2ES6A

Structure of the sam domain of vts1p
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
MPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords Vts1p
publication title Shape-specific recognition in the structure of the Vts1p SAM domain with RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 28
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2es6A00
1B4FA 5J8YC 4NJ8A 1SXDA 1PK1A 1F0MA 1KW4A 2D3DA 3HILA 1B0XA 3H8MA 2D8CA 1WWUA 1PK1B 5L1MA 1JI7A 5F3XB 3BS5A 2Y9TA 1SGGA 2F3NA 3BS5B 1PK3A 2KSOA 2EAOA 1V85A 1OXJA 1X66A 2Y9UA 2E8OA 2E8NA 4PZNA 1Z1VA 2KIVA 3KKAA 2QKQA 2ES6A 2B6GA 4RQNA 2LPEA 2KSOB 3SEIA 2L5YA 1SV0A 2KE7A 4MHVA 3TADC 5JTIA 3IDWA 5J8YA 1COKA 4RQMA 2FE9A 3K1RB 1RG6A 2KG5A 1UQVA 3BQ7A 2E8PA 1SXEA 2F8KA 1X9XA 4NL9A 3SENA 1SV4A 2K60A 3KKAC 5JU5A 2DL0A 1SV0C 3TACB 2QARA 2DKZA 4IS7A 2EAPA 2KMDA 1WWVA 2QB0A 1LKYA 5KNIA 2QARB 1X40A 2QB1A 1UCVA 2QB0B 2LMRA 1LKYB 3TADA 2EANA 4NL9C 2F44A 1OW5A 5JRTA 2EAMA 2K4PA 2YTUA 1V38A 2GLEA 2DKXA 2ESEA 4PZOA 2E8MA 2JV3A 1DXSA 3BS7A
chains in the Genus database with same CATH superfamily
4JWNA 5AKXA 5J0XA 3L3FX 4KMOB 1NK9A 1Y88A 1L6NA 2D8CA 1WWUA 2VA3A 4P0QA 2OEHA 4ACOA 3S6JA 2FMQA 2BGWA 7ICEA 4F92B 5KFVA 4RQ7A 2HBKA 1X2IA 7ICIA 1KBUA 2VJ4A 1XSNA 4GFJA 5CEHA 2VANA 4DSIA 4DS5A 2F8LA 2HBMA 4C8NA 2QKQA 4YR3A 4QZCA 2YMQA 5BOLA 4C80A 4RZRA 4TQSA 3FYHA 3DV9A 4PPXA 2IOFK 5J2CA 1HUOA 4I2GA 3SYZA 3MC1A 2XC9A 2W8LA 4JV0A 5KFCA 3C2LA 4NM1A 4NLGA 1A77A 2FPLA 5AKHA 5ALSA 4AYBC 5DDMA 5KFEA 1NJZA 5B66U 2ZIUB 1S0MA 2QARA 3GFKB 5KT2A 5DBAA 4R63A 1C20A 4OJLA 8ICVA 5G5GA 4ECVA 3SV3A 4C4SA 3GIIA 2I6XA 3SAGA 3KHLA 1NKBA 1JROA 3TADA 4RUCA 4GXKA 4NLKA 1J97A 3QU7A 3Q8PB 2ZJAA 8ICRA 2W7PA 3SZ2A 1DGSA 5DKWA 1OW5A 2V4RA 1ZQOA 4KMUA 4UBBA 3RJEA 4LJXA 1ZQPA 4I2FA 4K4HA 4DSEA 3IM1A 1JX4A 2W11A 1F0MA 1NZPA 3H0MB 3D2NA 4UAUA 9ICBA 4QWBA 4GXJA 4GLXA 4PHPA 1ECWA 2JR5A 2BDUA 4RT2A 2G06A 1ED1A 3LWLA 3JPSA 2AGPA 1L7MA 4FZLA 3GV8B 2G07A 2I5HA 3KZXA 2W03A 2W3RA 9ICLA 2ES6A 1ZQRA 1U45A 3ALRA 5J0SA 4PHAA 3OJUA 2DWQA 4EX6A 3ISDA 4RQ8A 1DGJA 4OO1J 2W55A 1BVSA 2KVCA 1T4GA 3PW7A 3NUQA 2KN7A 1V97A 4YD2A 4F71A 4MFFA 3H0LB 3QU2A 3QNMA 5ALIA 4KLSA 1XO1A 4QWCA 3RH6A 4OJ5A 3ZDCA 4IS7A 2WF8A 3MDAA 2WB1F 4EBDA 3VC8A 4QW9A 2AH5A 5IIMA 5ALHA 2F2AB 1HJPA 4C0ZA 2AQ4A 4JMUA 5DB7A 3HW8A 2PFOA 4NL9C 5KL8B 5D4BA 3BQ0A 4NY8A 3PMNA 2C2DA 1N5WA 2BQRA 4F5PA 2E3TA 4XA5A 1LV5A 5EOZA 3RBDA 3RH5A 1Z4OA 1Z1BA 4IQTA 1SWWA 3QZ8A 1XNSA 2PFNA 3HILA 3PO4A 1ZQXA 1N61A 2XIDA 1ZQUA 3DEEA 2YB1A 4OCZA 4GXIA 4UB1A 1PK1B 3F5EA 1WCNA 4GC6A 3ISCA 2LM1A 2V4QA 3THVA 1SZHA 3BS5A 3JPTA 2MUTA 4US9A 4FFDA 4IQUA 3LWMA 7ICPA 5DQHA 1KKXA 2DPJA 3AUOA 5KG6A 1ZQZA 2G09A 1NOMA 4CF5A 5KFXA 1NK7A 4P0PA 4UB8U 4UQGA 1N2XA 1NKCA 3LK9A 5ALYA 2YMMA 9ICCA 3RJGA 9ICNA 5IILA 3TAPA 2HVIA 1XSLA 2NO5A 4HAIA 2JGAA 5KFLA 2XO7A 2BCVA 2KG5A 4Z6FA 4DL3A 1Q3VA 1RPLA 4KLTA 2FLNA 4P4OA 1T94A 1IV8A 4NL9A 2RDJA 2A1AA 9ICPA 4YFKA 3UM9A 2P6UA 3LVVA 1ZXIA 1ZQFA 3MGIA 1QH9A 2W9AA 4QZEA 4R64A 2XICA 2JH1A 2K4IA 4DLEA 1SKWA 4R65A 1Z19A 3QUQA 3T79A 3RJIA 2HHSA 1QQ5A 1X40A 5AM5A 2BCUA 1A76A 2FJ6A 4ECXA 1RXVA 3L5KA 4ECTA 3WK9A 2J6UA 4C7ZA 1X9WA 5ALUA 1S0VA 4DQSA 1NJYA 1ZQNA 4F2SA 4IRCA 2LHTA 2K4EA 2JV3A 3M9NB 4DQIA 3VCBA 5J8YC 3PW4A 2BR0A 1SL1A 3NVYA 4B9MA 3NGDA 1NZBA 1M6YA 4DSJA 3QXGA 1TK0A 2KV2A 1UPHA 7ICRA 2KFNA 3KBBA 4KLHA 5CWRA 1ZQIA 4Y2UA 1K1QA 3WK8A 4YN4A 2F3NA 5KFHA 3MR3A 1CEZA 4QNLA 2BCSA 5KFJA 1BNOA 2CN1A 1OXJA 1QQ7A 1Z1VA 4NLZA 2JMGA 2LPEA 2G5HB 3QU5A 1ZRNA 3KZIU 5AI9A 3OGUA 5KL1B 3RH4A 3JPQA 1XWLA 1SWVA 3QUTA 1YT3A 3PSPA 9ICHA 5EE9A 3F2DA 2KD1A 2NRTA 2E8PA 5AHXA 1TAMA 1O08A 4EZ9A 2CRXA 1X9XA 3SENA 5KFOA 1NNLA 5BPCA 1P7DA 4Y2VA 5DB8A 4YG2A 1QSSA 2XGPA 4TUPA 3H8JA 3PVXA 4ELUA 4J9RA 2MRLA 4AYBF 2W04A 4MFAA 5HMLA 4QIWC 2E5SA 4AP9A 2O6KA 3FM9A 1T8EA 2ZIWB 5ALJA 5IIIA 1ZETA 4F4KA 1B22A 1DK2A 2YTUA 4FE3A 1NJXA 4YD1A 1QLNA 3QU4A 4ED8A 2HHQA 8ICMA 4QZDA 1Z00B 2XI9A 2K8BB 4FZMA 4DFDA 8ICJA 1KW4A 5KG4A 9ICXA 9ICUA 1PVPA 3EPIA 4O3NA 2NYVA 2HMXA 5CR0A 5TISU 3QUCA 2PI4A 4EZ6A 2Y1IA 5HHIA 1CUKA 1QCKA 2OXOA 4B9VA 2KP7A 1L3UA 2H3VA 2K8CB 3I1YA 4Z6DA 1H38A 2EZYA 4F93B 2F1IA 1K5OA 4M9NA 2KSOB 4RNOA 2W7OA 5AICA 1QQ6A 3F2BA 5G5HA 4EX7A 5J0RA 2MSNA 2IOHA 1JXLA 5AM4A 1RDFA 5J2JA 1FFVA 5AM0A 3HWTA 9ICWA 8ICAA 4KLLA 1U49A 4PHEA 5F9LA 1DK3A 1ZQEA 2ASLA 4Q8FA 4KX3A 2ZIUA 3OJSA 5CRXA 4Y2XA 4F4ZA 5CA7A 3PV8A 7ICLA 4IRKA 3UMCA 3GILA 2C22A 1ZD4A 1ZQJA 5AI4A 2XY5A 5C5JA 2KMDA 4C8LA 4M9JA 3OHBA 1IIPA 3M8SA 4JK1A 4CRXA 2G0AA 3M9MB 3Q8LA 3IG5A 2G5IB 4RNNA 5KFDA 1TE2A 1F5SA 4USAA 4QWAA 4ECRA 1IG6A 4QJFB 5KFNA 4UAZA 4RQ0A 4I2JA 4NLBA 1DRGA 2FLPA 8ICHA 9ICQA 3H8SA 4Q43A 4EENA 5KAIU 5B5EU 4DOAA 1N62A 3F53A 1SXDA 2BDPA 1KL9A 5ALVA 1L8OA 3N28A 3H4BA 1BPEA 1D9FA 1U4BA 1COOA 3EZ5A 2H5XA 4BDPA 4DSKA 4TUSA 4UAYA 3V6KA 1D8YA 3JPRA 3V7KA 3HJEA 1FEZA 3GV7B 4O3MA 3GIKA 7ICSA 2OCEA 3M6ZA 4DSFA 1QSLA 1SKSA 1V85A 1X66A 5EE0A 5DGBA 2B6GA 1PZNA 1U48A 4IRDA 5HP4A 5J0YA 4DQRA 4MHVA 3TADC 3MR5A 5JTIA 5KFAA 1X9MA 5J0WA 2VIXA 3WKAA 1S77D 5ALEA 5L1LA 5KFMA 1BPBA 2FMSA 4RQ2A 2KVSA 2P35A 1RYSA 2KOBA 5DB6A 5EWEA 1SL0A 4B9SA 3T5LA 3WK5A 5KG2A 5DBCA 4B9UA 2R8IA 3ONNA 4DOCA 4EEYA 3NVWA 4J03A 2ZTEA 3EPGA 1K1SA 4CF4A 4NV0A 2LM4A 5J2GA 2YN4A 2HBLA 4ED6A 3HRDD 5H2FU 4YR2A 4F5QA 2ZXHA 5ALNA 3BJYA 3T5KA 8ICBA 4QZHA 4KLGA 4DCCA 4DOBA 5JRTA 1S76D 2GLEA 3H40A 2ESEA 5KFTA 4Q44A 1B4FA 4I28A 1SZPA 3C2KA 1PK1A 3OPXA 4O3PA 3HT3A 4JB3A 3IHQB 4Y2PA 4ZH4A 2HHTA 1TK8A 3ZDDA 1FFUA 3M8RA 3JPOA 1S8OA 2RDIA 3Q8MA 2ALZA 8ICFA 4BUGA 7ICQA 4P4PA 9ICFA 2KEYA 4QZAA 3OTQA 2DQNB 3TI0A 1PK3A 1Q3UA 4O5KA 5AKLA 4KLQA 2G08A 4RPZA 5FP0A 1NK8A 2L5YA 3AEVA 4I29A 3TAQA 3WK7A 3TFRA 4I2AA 2DPIA 4DL2A 7ICHA 5K4LA 4KLDA 5ALRA 4C4TA 5DQGA 3H4DA 3A0HU 5J2KA 4WJ3B 1NJWA 3ICXA 2N1RA 3WKCA 5IINA 1A6SA 2KZMA 2K89A 1JMSA 1SB3C 3SMVA 5J2HA 2AJQA 2MA1A 3QEBZ 2JZBB 4MEXA 4NM2A 4Q45A 4CNQA 3Q8KA 4M6WB 4DO9A 9ICRA 4EELA 2HHUA 3V6HA 4DF8A 1BNPA 3TKAA 2KK0A 3WKDA 2UVWA 5ALKA 4IQWA 2JEJA 2WFAA 3AN1A 5DB9A 3JPNA 1VJ5A 2YX8A 3N7PD 4QIWF 4ECWA 1Q8KA 5ALFA 4CF3A 1GO3F 4XRHA 1BPYA 2NRWA 4ICAA 2MAXA 8ICKA 4B9NA 5AM2A 2HOIA 1MA7A 1KTQA 5TZVA 8ICGA 3ORYA 1ZQAA 3SAHA 3Q8RB 2RP5A 5KFRA 4M9HA 1N5XA 4CE6A 2WHEA 4KLJA 3PSFA 4FS1A 3G6XA 2EQYA 4YXMA 1ZQYA 2DFLA 8ICYA 4O5EA 3QE9Y 2XVTA 9ICTA 7ICVA 2FPKA 3V7LA 2F1JA 2FLLA 4UAVA 1NK6A 3D2QA 3AMZA 3KTQA 4KTQA 1LVHA 2IOFA 5IIKA 4QZGA 2RHFA 4YVZA 4UASA 9ICKA 1S10A 5KT4A 1COKA 4C4RA 5DLGA 1BGXT 2H3IA 4IR9A 1PVQA 3B0YA 5DG8A 4BX9C 4PGXA 4RQ1A 2XCAA 5J2DA 3ETRA 1TAQA 4B9LA 2ASDA 4KLFA 5GTIU 5HHHA 3RB4A 1JRPA 5KTQA 5EE1A 4UARA 1LB2B 3AL0B 2DGZA 2ZG6A 2ZIWA 3M7DA 2ZTCA 2KZ3A 5GTHU 1LKYB 3TARA 4EYHB 3WK6A 3ZD9A 3FDSA 5KFSA 5J0TA 2H3QA 4R8UB 4I2DA 2C28A 5DDYA 5AKZA 1Z00A 2Q4TA 4RQ3A 1T3NA 3F2CA 9ICJA 2E8MA 2B0CA 4O3QA 3BS7A 1ZQWA 4DQQA 2Z7JA 4F5RA 1ZQDA 3ZI4A 4F4XA 7ICGA 5ALDA 7ICNA 5KT3A 7ICKA 4UB4A 5IIJA 8ICTA 4RPXA 2LYAA 4KLUA 1AROP 5DBBA 2C2EA 1ZJNA 2BPCA 1N56A 2ZJ5A 2YMLA 4YP3A 4F4YA 1X42A 1KRPA 2KSOA 2E8OA 3HKZC 5AIBA 3CNHA 5T14A 3C29A 2I9GA 4KLEA 2WF9A 3V72A 1KFTA 2VA2A 3IN5A 2IMWP 2AHOB 4FBUA 5KFQA 1RG6A 2AGOA 5J2AA 5L1JA 3CYMA 5EE3A 1ZRMA 3BZKA 2K4HA 4DFPA 3C2MA 2P66A 3C5FA 5JU5A 4I2BA 4BJQA 3GIJA 3PNCA 4TUQA 2BPFA 3RTVA 3AU6A 5DG9A 1EXNA 3PW0A 3KD3A 3UQ2A 2QB1A 2HDOA 3CRXA 9ICOA 2KJ9A 5CB1A 3EWAA 1RYRA 2ZUBA 5A0LA 9ICMA 9ICSA 4ED7A 2ATLA 3GU3A 2PXIA 1QSYA 4NLCA 1DXSA 4UAWA 2W9BB 4RQ6A 4MF8A 5KFPA 2IA6A 3NVVA 3MFHA 3NVZA 5AKGA 2BQ3A 1N48A 1HIWA 4KLIA 4Y2YA 5J2EA 1HUZA 4K4GA 3DDHA 2IBKA 3EYZA 4FBTA 3TFSA 1RM6C 4QWEA 2WF6A 4IQVA 1XU4A 4ECZA 3T5HA 2E1FA 2KHVA 1ZQHA 3QEAZ 1WG8A 1PVRA 7ICJA 5ALGA 3C28A 2NV3A 5KG3A 3KFUF 4O0IA 1JN3A 8ICOA 4M9GA 4DWIA 1L5UA 3ED5A 4NWIA 4YR0A 8ICPA 2FE9A 4MF2A 4RQ4A 2YQEA 3PSIA 1L7PA 2ZTDA 4LVSA 3QX7A 3RJKA 2F8KA 4Y2JA 5AI6A 2C2RA 2GO7A 2J6TA 5ALLA 1FIQA 3BDPA 3BZCA 1Q46A 5E79U 1SKRA 2ZIXB 4ECUA 4PL2A 2HBJA 2KTQA 2F76X 2NRZA 3FAHA 4F5OA 2ASJA 7ICMA 3ISBA 1JUDA 2HW3A 4DFJA 5HR6A 3PR5B 3WU2U 3HP6A 1UA1A 3UXPA 2R8KA 1WUDA 2ZUCA 2EZZA 4I2IA 4NJ8A 3NS1A 3M1YA 8ICSA 2E1EA 3WKBA 3QYPA 1ZQ1C 2YMPA 4F5NA 3SD7A 2HVHA 4EBEA 4C8MA 4UB6U 2VKQA 4PHDA 2HHXA 2LKYA 3IRUA 3E58A 1CI4A 5KFYA 3OSNA 3UMBA 4F72A 4JV2A 2F1HA 1ZQQA 3PX4A 3C1ZA 2UVRA 2W9CB 1L7OA 4BWMA 3RJHA 4IR1A 1UHUA 2KZZA 3MR2A 2UVVA 4U6PA 4QZBA 4O3SA 9ICEA 5AKJA 3QZ7A 3RB6A 4J9KA 4DL5A 4J9QA 2BHNA 4IL6U 2RQ5A 1JIHA 2KNJA 3C5GA 4G3IA 2Q0ZX 4PGYA 1Z3EB 2P6RA 4KLOA 4M0AA 4BGDA 3KHRA 4RQMA 3J81j 4F4WA 1UQVA 3MDCA 4RQ5A 2JZBA 4HYKA 2LI6A 2EDUA 2HOQA 2YY6A 1NK5A 2FMPA 3PY8A 3RF9A 3M6KA 4M6WA 2H3ZA 2IHMA 2QLTA 5ALOA 5CP2A 3RR8A 1X9SA 1SV0C 4M47A 2F77X 1TFRA 2JHDA 3QU9A 5KT7A 2PMZC 4KITB 4DLGA 8ICIA 5AKIA 2QB0B 4C8KA 2HSZA 5J0OA 5AM1A 3LYSA 5HMMA 2F44A 1NKEA 2ISOA 2XGQA 2BQUA 4F91B 5J2IA 2K8AA 3LVWA 4DSLA 3TQ1A 4M9LA 3MGVA 4DL6A 4MFCA 4DS4A 4F3OA 9ICAA 3G6VA 1HEKA 8ICEA 8ICLA 5ALZA 1MSWD 2HHVA 4RU9A 4GC7A 2Y0SF 1ZD5A 4YMMA 5L1MA 2XY7A 1JI7A 7ICUA 4X5VA 3CP8A 3L4PA 5KFBA 4F8RA 3NASA 2W43A 3HX0A 1KLNA 2A1JB 2W3SA 1KFDA 2ZIVB 5DGAA 4J9NA 1S0NA 1YZ7A 4JWMA 3N7RC 1U9LA 2HOFA 1NK0A 1SV0A 3HKZF 3JPPA 1CRXA 4EEKA 1N60A 3WK4A 2NRVA 4ECYA 1B43A 5KT5A 4ECQA 1X6IA 3T3FA 1ZQSA 3SR6A 4I27A 3BQ7A 3GDXA 3KKAC 2LYHA 4Y2SA 2KFZA 7ICTA 2BKEA 3ZDBA 2DL0A 8ICNA 2JXJA 4BXOB 4P2HA 4KLMA 1FO4A 4DF4A 1ZQKA 4GIBA 2GH1A 4XUSA 2EH9A 2PKEA 1LKYA 1ZQCA 1VDVA 5ALMA 2YB4A 4R8UA 5L9XA 1BPXA 1T7PA 3UMGA 3UXNA 1UCVA 4CCHA 5KG7A 2EANA 1ZQLA 1T3QA 2W9MA 1TVAA 1S5LU 5AI5A 2K4PA 2JEIA 7ICOA 3C23A 3BQTA 1S97A 4YQWA 4DL7A 3SI8A 3UPQA 4JV1A 1D9DA 1KSPA 4C8OA 4J9SA 1D8BA 2FI1A 2JEFA 3N7SC 4OJ6A 3RFAA 3TANA 7ICFA 3PX0A 3AQFA 9ICVA 2HI0A 2Y9TA 4P0QB 2OM6A 2B21A 4FS2A 5KFFA 9ICIA 2JRZA 4B6JA 5J2BA 5AKKA 5KFGA 5BOMA 5EWGA 2LBOA 3WKEA 1MC8A 2FDRA 1F44A 1KEJA 4TQRA 2WF5A 1L3SA 3RAXA 2KIVA 3KKAA 1ZQTA 2VJ5A 1O03A 4YXJA 5ALPA 1URJA 3NRWA 4ED3A 1UT5A 4O5CA 3PW5A 2AXTU 5KFUA 3C1YA 4OJOA 4A8EA 2IHNA 1IM4A 2JH7A 3K1RB 4UW9A 3K4GA 3N4MB 2D6FC 4QZFA 4QZIA 5KG5A 3MFIA 3RJFA 4UBCA 3PR4A 4EBCA 4C7YA 5AK5A 2DF4B 4ED1A 1AQ6A 4CDGA 3CW2C 5AM3A 4NXZA 1ZQVA 1BPDA 5ALXA 2EAPA 2WAQF 4YMOA 4NLNA 2QARB 4DFMA 3ETLA 3PMLA 3MGHA 2RLTA 1DOQA 4KN7A 3O0FA 5J2FA 5DLFA 2DBYA 4PH5A 1OUQA 2R18A 1MQ3A 3KHHA 4UB3A 5HR7A 5AK3A 3PZPA 3FC4A 4O3OA 2W9BA 2GWSA 4M2YA 2EAMA 5ALQA 3V6JA 1V38A 1IXRA 3GV5B 1SIJA 4Z6CA 1QTMA 4ECSA 2WTFA 3SAFA 2CPRA 2J6SA 1KN5A 1RQLA 4O9MA 4ELTA 1ZOLA 1KDHA 8ICQA 4PL1A 4PGQA 3ZDEA 2VA8A 4Y2QA 2A3VA 3H0RB 3B0XA 2PFPA 4G9BA 2V9WA 2Y0SC 4MEYA 4YMNA 2Y9UA 1XSPA 3G6YA 1JXEA 3BQ1A 2NRXA 2NO4A 3E0FA 3K1ZA 4I2EA 3IV6A 4YCXA 4F2RA 1A0PA 3GIMA 3C21A 1YZ6A 1UT8A 2WF7A 2A19A 5KFIA 4F50A 1L8LA 5CJ7A 9ICGA 4R66A 8ICUA 1PUZA 5J0QA 5F9NA 1BPZA 4U7CA 3HPOA 1C7YA 1ZQGA 2W54A 2K60A 1MQ2A 2FPMA 4QZ8A 2KJ8A 2ZIXA 1WYGA 2PI5A 2M9NA 4QWDA 1D8LA 2ISPA 4JUZA 1S0OA 3B9JA 3KHGA 8ICWA 2ODGA 1XC9A 2CXYA 5ALWA 4KN4A 4RT3A 2KIWA 4EYIB 3OHAA 2R8JA 2LMRA 2PMZF 1MN8A 1JALA 3RB3A 1UA0A 4PZOA 5AKEA 3EUB2 3RBEA 3PO5A 2ZXIA 2D3DA 4B9TA 4Y2RA 3H8MA 5AK6A 1S9FA 1U47A 4CGZA 4UB2A 5F3XB 1WCLA 2W9CA 4RUAA 1X6JA 2R8HA 4TURA 3PSTA 3BQ2A 2UVUA 8ICZA 5L1KA 3BS5B 4Q8EA 2LYBA 2OHFA 2MUTB 2EAOA 4PJ0U 3U26A 1J2MA 2E8NA 5KFKA 4KX5A 2AU0A 3OSPA 4RQNA 5IIOA 3SEIA 4LZGA 4ED0A 5KAFU 4FZNA 2KE7A 4P0PB 3I28A 5J0PA 4ED2A 3KOOA 3QUBA 5J8YA 5KT6A 1TK5A 2MU2A 2GOLA 4DQPA 1RXWA 5KFWA 3AM9A 1RZTA 5HNKA 1TV9A 5KFZA 5D46A 3EW9A 3NTUA 1ZD3A 3A0BU 2WB1C 2EZXA 3F5AA 1V9PA 5DQIA 3AQEA 5L1IA 2OH2A 2DKZA 5C0YA 1SL2A 2XY6A 1XO0A 1WWVA 3PX6A 2QB0A 5ALTA 5KNIA 4ZOHC 5AI0A 2KKPA 5D49A 3MBYA 4J9PA 4LZDA 4UB5A 2KICA 2KKVA 8ICCA 3Q8SB 2AGQA 4FO6A 2W8KA 2WAQC 1ZYQA 4M04A 4P4MA 2HHWA 1L7NA 3D6JA 5EWFA 2H3FA 3V7JA 1ZQMA 4DL4A 3MR6A 2AQ0A 2DKXA 4DFKA 3RRGA 2R8GA 4I2CA 3H8WA 2JEGA 4OJPA 3RRHA 4OD0A 5J29A 4QW8A 1B0XA 4XQ8A 2M0NA 5AK4A 4BWJA 2KHQA 4US8A 3MABA 3ZDAA 2A1JA 2ZIVA 4J9MA 4ELVA 3LDAA 3UQ0A 3UXOA 2BZFA 4I2HA 3RR7A 1SGGA 3H7IA 4QZ9A 4K4IA 4Z6EA 3GQCA 3AU2A 3I76A 5AIAA 2OWOA 5DG7A 1XS9D 1J2NA 1NI3A 4PZNA 2KJ5A 2RRDA 3IP4B 2BPGA 3R9KA 3ZD8A 1N63A 3IDWA 3K75D 3IG8A 3RAQA 3M9OB 1VLBA 1KFSA 2DUYA 5KG1A 3SV4A 4E0DA 3NRZA 1L3TA 1SXEA 1NK4A 3T5JA 2Y1JA 2I1QA 1SV4A 1TAUA 3E2EA 4BXOA 1ZD2P 4Y2TA 2ZJ8A 3RB0A 2XCPA 4IC9A 1Z4NA 3PW2A 3SQIA 3TACB 1TKDA 4RNMA 4J9LA 2OYYA 5KG0A 3GZFA 2BCQA 5J0UA 1RQNA 3RJJA 4UATA 5JUMA 1ZJMA 1ZQBA 4RPYA 5AKYA 8ICXA 2PFQA 5AI8A 4J9OA 2BCRA 2ZUDA 3Q8QB 4DEZA 3D2SA 1L3VA 2HCFA 3N97B 1RYUA 5CHGA 4O3RA 1KQQA
chains in the Genus database with same CATH topology
1B4FA 5J8YC 4NJ8A 1SXDA 1PK1A 1F0MA 1KW4A 2D3DA 3HILA 1B0XA 3H8MA 2D8CA 1WWUA 1PK1B 5L1MA 1JI7A 5F3XB 3BS5A 2Y9TA 1SGGA 2F3NA 3BS5B 1PK3A 2KSOA 2EAOA 1V85A 1OXJA 1X66A 2Y9UA 2E8OA 2E8NA 4PZNA 1Z1VA 2KIVA 3KKAA 2QKQA 2ES6A 2B6GA 4RQNA 2LPEA 2KSOB 3SEIA 2L5YA 1SV0A 2KE7A 4MHVA 3TADC 5JTIA 3IDWA 5J8YA 1COKA 4RQMA 2FE9A 3K1RB 1RG6A 2KG5A 1UQVA 3BQ7A 2E8PA 1SXEA 2F8KA 1X9XA 4NL9A 3SENA 1SV4A 2K60A 3KKAC 5JU5A 2DL0A 1SV0C 3TACB 2QARA 2DKZA 4IS7A 2EAPA 2KMDA 1WWVA 2QB0A 1LKYA 5KNIA 2QARB 1X40A 2QB1A 1UCVA 2QB0B 2LMRA 1LKYB 3TADA 2EANA 4NL9C 2F44A 1OW5A 5JRTA 2EAMA 2K4PA 2YTUA 1V38A 2GLEA 2DKXA 2ESEA 4PZOA 2E8MA 2JV3A 1DXSA 3BS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4F A;  5J8Y C;  4NJ8 A;  1SXD A;  1PK1 A;  1F0M A;  1KW4 A;  2D3D A;  3HIL A;  1B0X A;  3H8M A;  2D8C A;  1WWU A;  1PK1 B;  5L1M A;  1JI7 A;  5F3X B;  3BS5 A;  2Y9T A;  1SGG A;  2F3N A;  3BS5 B;  1PK3 A;  2KSO A;  2EAO A;  1V85 A;  1OXJ A;  1X66 A;  2Y9U A;  2E8O A;  2E8N A;  4PZN A;  1Z1V A;  2KIV A;  3KKA A;  2QKQ A;  2ES6 A;  2B6G A;  4RQN A;  2LPE A;  2KSO B;  3SEI A;  2L5Y A;  1SV0 A;  2KE7 A;  4MHV A;  3TAD C;  5JTI A;  3IDW A;  5J8Y A;  1COK A;  4RQM A;  2FE9 A;  3K1R B;  1RG6 A;  2KG5 A;  1UQV A;  3BQ7 A;  2E8P A;  1SXE A;  2F8K A;  1X9X A;  4NL9 A;  3SEN A;  1SV4 A;  2K60 A;  3KKA C;  5JU5 A;  2DL0 A;  1SV0 C;  3TAC B;  2QAR A;  2DKZ A;  4IS7 A;  2EAP A;  2KMD A;  1WWV A;  2QB0 A;  1LKY A;  5KNI A;  2QAR B;  1X40 A;  2QB1 A;  1UCV A;  2QB0 B;  2LMR A;  1LKY B;  3TAD A;  2EAN A;  4NL9 C;  2F44 A;  1OW5 A;  5JRT A;  2EAM A;  2K4P A;  2YTU A;  1V38 A;  2GLE A;  2DKX A;  2ESE A;  4PZO A;  2E8M A;  2JV3 A;  1DXS A;  3BS7 A; 
#chains in the Genus database with same CATH topology
 4JWN A;  5AKX A;  5J0X A;  3L3F X;  4KMO B;  1NK9 A;  1Y88 A;  1L6N A;  2D8C A;  1WWU A;  2VA3 A;  4P0Q A;  2OEH A;  4ACO A;  3S6J A;  2FMQ A;  2BGW A;  7ICE A;  4F92 B;  5KFV A;  4RQ7 A;  2HBK A;  1X2I A;  7ICI A;  1KBU A;  2VJ4 A;  1XSN A;  4GFJ A;  5CEH A;  2VAN A;  4DSI A;  4DS5 A;  2F8L A;  2HBM A;  4C8N A;  2QKQ A;  4YR3 A;  4QZC A;  2YMQ A;  5BOL A;  4C80 A;  4RZR A;  4TQS A;  3FYH A;  3DV9 A;  4PPX A;  2IOF K;  5J2C A;  1HUO A;  4I2G A;  3SYZ A;  3MC1 A;  2XC9 A;  2W8L A;  4JV0 A;  5KFC A;  3C2L A;  4NM1 A;  4NLG A;  1A77 A;  2FPL A;  5AKH A;  5ALS A;  4AYB C;  5DDM A;  5KFE A;  1NJZ A;  5B66 U;  2ZIU B;  1S0M A;  2QAR A;  3GFK B;  5KT2 A;  5DBA A;  4R63 A;  1C20 A;  4OJL A;  8ICV A;  5G5G A;  4ECV A;  3SV3 A;  4C4S A;  3GII A;  2I6X A;  3SAG A;  3KHL A;  1NKB A;  1JRO A;  3TAD A;  4RUC A;  4GXK A;  4NLK A;  1J97 A;  3QU7 A;  3Q8P B;  2ZJA A;  8ICR A;  2W7P A;  3SZ2 A;  1DGS A;  5DKW A;  1OW5 A;  2V4R A;  1ZQO A;  4KMU A;  4UBB A;  3RJE A;  4LJX A;  1ZQP A;  4I2F A;  4K4H A;  4DSE A;  3IM1 A;  1JX4 A;  2W11 A;  1F0M A;  1NZP A;  3H0M B;  3D2N A;  4UAU A;  9ICB A;  4QWB A;  4GXJ A;  4GLX A;  4PHP A;  1ECW A;  2JR5 A;  2BDU A;  4RT2 A;  2G06 A;  1ED1 A;  3LWL A;  3JPS A;  2AGP A;  1L7M A;  4FZL A;  3GV8 B;  2G07 A;  2I5H A;  3KZX A;  2W03 A;  2W3R A;  9ICL A;  2ES6 A;  1ZQR A;  1U45 A;  3ALR A;  5J0S A;  4PHA A;  3OJU A;  2DWQ A;  4EX6 A;  3ISD A;  4RQ8 A;  1DGJ A;  4OO1 J;  2W55 A;  1BVS A;  2KVC A;  1T4G A;  3PW7 A;  3NUQ A;  2KN7 A;  1V97 A;  4YD2 A;  4F71 A;  4MFF A;  3H0L B;  3QU2 A;  3QNM A;  5ALI A;  4KLS A;  1XO1 A;  4QWC A;  3RH6 A;  4OJ5 A;  3ZDC A;  4IS7 A;  2WF8 A;  3MDA A;  2WB1 F;  4EBD A;  3VC8 A;  4QW9 A;  2AH5 A;  5IIM A;  5ALH A;  2F2A B;  1HJP A;  4C0Z A;  2AQ4 A;  4JMU A;  5DB7 A;  3HW8 A;  2PFO A;  4NL9 C;  5KL8 B;  5D4B A;  3BQ0 A;  4NY8 A;  3PMN A;  2C2D A;  1N5W A;  2BQR A;  4F5P A;  2E3T A;  4XA5 A;  1LV5 A;  5EOZ A;  3RBD A;  3RH5 A;  1Z4O A;  1Z1B A;  4IQT A;  1SWW A;  3QZ8 A;  1XNS A;  2PFN A;  3HIL A;  3PO4 A;  1ZQX A;  1N61 A;  2XID A;  1ZQU A;  3DEE A;  2YB1 A;  4OCZ A;  4GXI A;  4UB1 A;  1PK1 B;  3F5E A;  1WCN A;  4GC6 A;  3ISC A;  2LM1 A;  2V4Q A;  3THV A;  1SZH A;  3BS5 A;  3JPT A;  2MUT A;  4US9 A;  4FFD A;  4IQU A;  3LWM A;  7ICP A;  5DQH A;  1KKX A;  2DPJ A;  3AUO A;  5KG6 A;  1ZQZ A;  2G09 A;  1NOM A;  4CF5 A;  5KFX A;  1NK7 A;  4P0P A;  4UB8 U;  4UQG A;  1N2X A;  1NKC A;  3LK9 A;  5ALY A;  2YMM A;  9ICC A;  3RJG A;  9ICN A;  5IIL A;  3TAP A;  2HVI A;  1XSL A;  2NO5 A;  4HAI A;  2JGA A;  5KFL A;  2XO7 A;  2BCV A;  2KG5 A;  4Z6F A;  4DL3 A;  1Q3V A;  1RPL A;  4KLT A;  2FLN A;  4P4O A;  1T94 A;  1IV8 A;  4NL9 A;  2RDJ A;  2A1A A;  9ICP A;  4YFK A;  3UM9 A;  2P6U A;  3LVV A;  1ZXI A;  1ZQF A;  3MGI A;  1QH9 A;  2W9A A;  4QZE A;  4R64 A;  2XIC A;  2JH1 A;  2K4I A;  4DLE A;  1SKW A;  4R65 A;  1Z19 A;  3QUQ A;  3T79 A;  3RJI A;  2HHS A;  1QQ5 A;  1X40 A;  5AM5 A;  2BCU A;  1A76 A;  2FJ6 A;  4ECX A;  1RXV A;  3L5K A;  4ECT A;  3WK9 A;  2J6U A;  4C7Z A;  1X9W A;  5ALU A;  1S0V A;  4DQS A;  1NJY A;  1ZQN A;  4F2S A;  4IRC A;  2LHT A;  2K4E A;  2JV3 A;  3M9N B;  4DQI A;  3VCB A;  5J8Y C;  3PW4 A;  2BR0 A;  1SL1 A;  3NVY A;  4B9M A;  3NGD A;  1NZB A;  1M6Y A;  4DSJ A;  3QXG A;  1TK0 A;  2KV2 A;  1UPH A;  7ICR A;  2KFN A;  3KBB A;  4KLH A;  5CWR A;  1ZQI A;  4Y2U A;  1K1Q A;  3WK8 A;  4YN4 A;  2F3N A;  5KFH A;  3MR3 A;  1CEZ A;  4QNL A;  2BCS A;  5KFJ A;  1BNO A;  2CN1 A;  1OXJ A;  1QQ7 A;  1Z1V A;  4NLZ A;  2JMG A;  2LPE A;  2G5H B;  3QU5 A;  1ZRN A;  3KZI U;  5AI9 A;  3OGU A;  5KL1 B;  3RH4 A;  3JPQ A;  1XWL A;  1SWV A;  3QUT A;  1YT3 A;  3PSP A;  9ICH A;  5EE9 A;  3F2D A;  2KD1 A;  2NRT A;  2E8P A;  5AHX A;  1TAM A;  1O08 A;  4EZ9 A;  2CRX A;  1X9X A;  3SEN A;  5KFO A;  1NNL A;  5BPC A;  1P7D A;  4Y2V A;  5DB8 A;  4YG2 A;  1QSS A;  2XGP A;  4TUP A;  3H8J A;  3PVX A;  4ELU A;  4J9R A;  2MRL A;  4AYB F;  2W04 A;  4MFA A;  5HML A;  4QIW C;  2E5S A;  4AP9 A;  2O6K A;  3FM9 A;  1T8E A;  2ZIW B;  5ALJ A;  5III A;  1ZET A;  4F4K A;  1B22 A;  1DK2 A;  2YTU A;  4FE3 A;  1NJX A;  4YD1 A;  1QLN A;  3QU4 A;  4ED8 A;  2HHQ A;  8ICM A;  4QZD A;  1Z00 B;  2XI9 A;  2K8B B;  4FZM A;  4DFD A;  8ICJ A;  1KW4 A;  5KG4 A;  9ICX A;  9ICU A;  1PVP A;  3EPI A;  4O3N A;  2NYV A;  2HMX A;  5CR0 A;  5TIS U;  3QUC A;  2PI4 A;  4EZ6 A;  2Y1I A;  5HHI A;  1CUK A;  1QCK A;  2OXO A;  4B9V A;  2KP7 A;  1L3U A;  2H3V A;  2K8C B;  3I1Y A;  4Z6D A;  1H38 A;  2EZY A;  4F93 B;  2F1I A;  1K5O A;  4M9N A;  2KSO B;  4RNO A;  2W7O A;  5AIC A;  1QQ6 A;  3F2B A;  5G5H A;  4EX7 A;  5J0R A;  2MSN A;  2IOH A;  1JXL A;  5AM4 A;  1RDF A;  5J2J A;  1FFV A;  5AM0 A;  3HWT A;  9ICW A;  8ICA A;  4KLL A;  1U49 A;  4PHE A;  5F9L A;  1DK3 A;  1ZQE A;  2ASL A;  4Q8F A;  4KX3 A;  2ZIU A;  3OJS A;  5CRX A;  4Y2X A;  4F4Z A;  5CA7 A;  3PV8 A;  7ICL A;  4IRK A;  3UMC A;  3GIL A;  2C22 A;  1ZD4 A;  1ZQJ A;  5AI4 A;  2XY5 A;  5C5J A;  2KMD A;  4C8L A;  4M9J A;  3OHB A;  1IIP A;  3M8S A;  4JK1 A;  4CRX A;  2G0A A;  3M9M B;  3Q8L A;  3IG5 A;  2G5I B;  4RNN A;  5KFD A;  1TE2 A;  1F5S A;  4USA A;  4QWA A;  4ECR A;  1IG6 A;  4QJF B;  5KFN A;  4UAZ A;  4RQ0 A;  4I2J A;  4NLB A;  1DRG A;  2FLP A;  8ICH A;  9ICQ A;  3H8S A;  4Q43 A;  4EEN A;  5KAI U;  5B5E U;  4DOA A;  1N62 A;  3F53 A;  1SXD A;  2BDP A;  1KL9 A;  5ALV A;  1L8O A;  3N28 A;  3H4B A;  1BPE A;  1D9F A;  1U4B A;  1COO A;  3EZ5 A;  2H5X A;  4BDP A;  4DSK A;  4TUS A;  4UAY A;  3V6K A;  1D8Y A;  3JPR A;  3V7K A;  3HJE A;  1FEZ A;  3GV7 B;  4O3M A;  3GIK A;  7ICS A;  2OCE A;  3M6Z A;  4DSF A;  1QSL A;  1SKS A;  1V85 A;  1X66 A;  5EE0 A;  5DGB A;  2B6G A;  1PZN A;  1U48 A;  4IRD A;  5HP4 A;  5J0Y A;  4DQR A;  4MHV A;  3TAD C;  3MR5 A;  5JTI A;  5KFA A;  1X9M A;  5J0W A;  2VIX A;  3WKA A;  1S77 D;  5ALE A;  5L1L A;  5KFM A;  1BPB A;  2FMS A;  4RQ2 A;  2KVS A;  2P35 A;  1RYS A;  2KOB A;  5DB6 A;  5EWE A;  1SL0 A;  4B9S A;  3T5L A;  3WK5 A;  5KG2 A;  5DBC A;  4B9U A;  2R8I A;  3ONN A;  4DOC A;  4EEY A;  3NVW A;  4J03 A;  2ZTE A;  3EPG A;  1K1S A;  4CF4 A;  4NV0 A;  2LM4 A;  5J2G A;  2YN4 A;  2HBL A;  4ED6 A;  3HRD D;  5H2F U;  4YR2 A;  4F5Q A;  2ZXH A;  5ALN A;  3BJY A;  3T5K A;  8ICB A;  4QZH A;  4KLG A;  4DCC A;  4DOB A;  5JRT A;  1S76 D;  2GLE A;  3H40 A;  2ESE A;  5KFT A;  4Q44 A;  1B4F A;  4I28 A;  1SZP A;  3C2K A;  1PK1 A;  3OPX A;  4O3P A;  3HT3 A;  4JB3 A;  3IHQ B;  4Y2P A;  4ZH4 A;  2HHT A;  1TK8 A;  3ZDD A;  1FFU A;  3M8R A;  3JPO A;  1S8O A;  2RDI A;  3Q8M A;  2ALZ A;  8ICF A;  4BUG A;  7ICQ A;  4P4P A;  9ICF A;  2KEY A;  4QZA A;  3OTQ A;  2DQN B;  3TI0 A;  1PK3 A;  1Q3U A;  4O5K A;  5AKL A;  4KLQ A;  2G08 A;  4RPZ A;  5FP0 A;  1NK8 A;  2L5Y A;  3AEV A;  4I29 A;  3TAQ A;  3WK7 A;  3TFR A;  4I2A A;  2DPI A;  4DL2 A;  7ICH A;  5K4L A;  4KLD A;  5ALR A;  4C4T A;  5DQG A;  3H4D A;  3A0H U;  5J2K A;  4WJ3 B;  1NJW A;  3ICX A;  2N1R A;  3WKC A;  5IIN A;  1A6S A;  2KZM A;  2K89 A;  1JMS A;  1SB3 C;  3SMV A;  5J2H A;  2AJQ A;  2MA1 A;  3QEB Z;  2JZB B;  4MEX A;  4NM2 A;  4Q45 A;  4CNQ A;  3Q8K A;  4M6W B;  4DO9 A;  9ICR A;  4EEL A;  2HHU A;  3V6H A;  4DF8 A;  1BNP A;  3TKA A;  2KK0 A;  3WKD A;  2UVW A;  5ALK A;  4IQW A;  2JEJ A;  2WFA A;  3AN1 A;  5DB9 A;  3JPN A;  1VJ5 A;  2YX8 A;  3N7P D;  4QIW F;  4ECW A;  1Q8K A;  5ALF A;  4CF3 A;  1GO3 F;  4XRH A;  1BPY A;  2NRW A;  4ICA A;  2MAX A;  8ICK A;  4B9N A;  5AM2 A;  2HOI A;  1MA7 A;  1KTQ A;  5TZV A;  8ICG A;  3ORY A;  1ZQA A;  3SAH A;  3Q8R B;  2RP5 A;  5KFR A;  4M9H A;  1N5X A;  4CE6 A;  2WHE A;  4KLJ A;  3PSF A;  4FS1 A;  3G6X A;  2EQY A;  4YXM A;  1ZQY A;  2DFL A;  8ICY A;  4O5E A;  3QE9 Y;  2XVT A;  9ICT A;  7ICV A;  2FPK A;  3V7L A;  2F1J A;  2FLL A;  4UAV A;  1NK6 A;  3D2Q A;  3AMZ A;  3KTQ A;  4KTQ A;  1LVH A;  2IOF A;  5IIK A;  4QZG A;  2RHF A;  4YVZ A;  4UAS A;  9ICK A;  1S10 A;  5KT4 A;  1COK A;  4C4R A;  5DLG A;  1BGX T;  2H3I A;  4IR9 A;  1PVQ A;  3B0Y A;  5DG8 A;  4BX9 C;  4PGX A;  4RQ1 A;  2XCA A;  5J2D A;  3ETR A;  1TAQ A;  4B9L A;  2ASD A;  4KLF A;  5GTI U;  5HHH A;  3RB4 A;  1JRP A;  5KTQ A;  5EE1 A;  4UAR A;  1LB2 B;  3AL0 B;  2DGZ A;  2ZG6 A;  2ZIW A;  3M7D A;  2ZTC A;  2KZ3 A;  5GTH U;  1LKY B;  3TAR A;  4EYH B;  3WK6 A;  3ZD9 A;  3FDS A;  5KFS A;  5J0T A;  2H3Q A;  4R8U B;  4I2D A;  2C28 A;  5DDY A;  5AKZ A;  1Z00 A;  2Q4T A;  4RQ3 A;  1T3N A;  3F2C A;  9ICJ A;  2E8M A;  2B0C A;  4O3Q A;  3BS7 A;  1ZQW A;  4DQQ A;  2Z7J A;  4F5R A;  1ZQD A;  3ZI4 A;  4F4X A;  7ICG A;  5ALD A;  7ICN A;  5KT3 A;  7ICK A;  4UB4 A;  5IIJ A;  8ICT A;  4RPX A;  2LYA A;  4KLU A;  1ARO P;  5DBB A;  2C2E A;  1ZJN A;  2BPC A;  1N56 A;  2ZJ5 A;  2YML A;  4YP3 A;  4F4Y A;  1X42 A;  1KRP A;  2KSO A;  2E8O A;  3HKZ C;  5AIB A;  3CNH A;  5T14 A;  3C29 A;  2I9G A;  4KLE A;  2WF9 A;  3V72 A;  1KFT A;  2VA2 A;  3IN5 A;  2IMW P;  2AHO B;  4FBU A;  5KFQ A;  1RG6 A;  2AGO A;  5J2A A;  5L1J A;  3CYM A;  5EE3 A;  1ZRM A;  3BZK A;  2K4H A;  4DFP A;  3C2M A;  2P66 A;  3C5F A;  5JU5 A;  4I2B A;  4BJQ A;  3GIJ A;  3PNC A;  4TUQ A;  2BPF A;  3RTV A;  3AU6 A;  5DG9 A;  1EXN A;  3PW0 A;  3KD3 A;  3UQ2 A;  2QB1 A;  2HDO A;  3CRX A;  9ICO A;  2KJ9 A;  5CB1 A;  3EWA A;  1RYR A;  2ZUB A;  5A0L A;  9ICM A;  9ICS A;  4ED7 A;  2ATL A;  3GU3 A;  2PXI A;  1QSY A;  4NLC A;  1DXS A;  4UAW A;  2W9B B;  4RQ6 A;  4MF8 A;  5KFP A;  2IA6 A;  3NVV A;  3MFH A;  3NVZ A;  5AKG A;  2BQ3 A;  1N48 A;  1HIW A;  4KLI A;  4Y2Y A;  5J2E A;  1HUZ A;  4K4G A;  3DDH A;  2IBK A;  3EYZ A;  4FBT A;  3TFS A;  1RM6 C;  4QWE A;  2WF6 A;  4IQV A;  1XU4 A;  4ECZ A;  3T5H A;  2E1F A;  2KHV A;  1ZQH A;  3QEA Z;  1WG8 A;  1PVR A;  7ICJ A;  5ALG A;  3C28 A;  2NV3 A;  5KG3 A;  3KFU F;  4O0I A;  1JN3 A;  8ICO A;  4M9G A;  4DWI A;  1L5U A;  3ED5 A;  4NWI A;  4YR0 A;  8ICP A;  2FE9 A;  4MF2 A;  4RQ4 A;  2YQE A;  3PSI A;  1L7P A;  2ZTD A;  4LVS A;  3QX7 A;  3RJK A;  2F8K A;  4Y2J A;  5AI6 A;  2C2R A;  2GO7 A;  2J6T A;  5ALL A;  1FIQ A;  3BDP A;  3BZC A;  1Q46 A;  5E79 U;  1SKR A;  2ZIX B;  4ECU A;  4PL2 A;  2HBJ A;  2KTQ A;  2F76 X;  2NRZ A;  3FAH A;  4F5O A;  2ASJ A;  7ICM A;  3ISB A;  1JUD A;  2HW3 A;  4DFJ A;  5HR6 A;  3PR5 B;  3WU2 U;  3HP6 A;  1UA1 A;  3UXP A;  2R8K A;  1WUD A;  2ZUC A;  2EZZ A;  4I2I A;  4NJ8 A;  3NS1 A;  3M1Y A;  8ICS A;  2E1E A;  3WKB A;  3QYP A;  1ZQ1 C;  2YMP A;  4F5N A;  3SD7 A;  2HVH A;  4EBE A;  4C8M A;  4UB6 U;  2VKQ A;  4PHD A;  2HHX A;  2LKY A;  3IRU A;  3E58 A;  1CI4 A;  5KFY A;  3OSN A;  3UMB A;  4F72 A;  4JV2 A;  2F1H A;  1ZQQ A;  3PX4 A;  3C1Z A;  2UVR A;  2W9C B;  1L7O A;  4BWM A;  3RJH A;  4IR1 A;  1UHU A;  2KZZ A;  3MR2 A;  2UVV A;  4U6P A;  4QZB A;  4O3S A;  9ICE A;  5AKJ A;  3QZ7 A;  3RB6 A;  4J9K A;  4DL5 A;  4J9Q A;  2BHN A;  4IL6 U;  2RQ5 A;  1JIH A;  2KNJ A;  3C5G A;  4G3I A;  2Q0Z X;  4PGY A;  1Z3E B;  2P6R A;  4KLO A;  4M0A A;  4BGD A;  3KHR A;  4RQM A;  3J81 j;  4F4W A;  1UQV A;  3MDC A;  4RQ5 A;  2JZB A;  4HYK A;  2LI6 A;  2EDU A;  2HOQ A;  2YY6 A;  1NK5 A;  2FMP A;  3PY8 A;  3RF9 A;  3M6K A;  4M6W A;  2H3Z A;  2IHM A;  2QLT A;  5ALO A;  5CP2 A;  3RR8 A;  1X9S A;  1SV0 C;  4M47 A;  2F77 X;  1TFR A;  2JHD A;  3QU9 A;  5KT7 A;  2PMZ C;  4KIT B;  4DLG A;  8ICI A;  5AKI A;  2QB0 B;  4C8K A;  2HSZ A;  5J0O A;  5AM1 A;  3LYS A;  5HMM A;  2F44 A;  1NKE A;  2ISO A;  2XGQ A;  2BQU A;  4F91 B;  5J2I A;  2K8A A;  3LVW A;  4DSL A;  3TQ1 A;  4M9L A;  3MGV A;  4DL6 A;  4MFC A;  4DS4 A;  4F3O A;  9ICA A;  3G6V A;  1HEK A;  8ICE A;  8ICL A;  5ALZ A;  1MSW D;  2HHV A;  4RU9 A;  4GC7 A;  2Y0S F;  1ZD5 A;  4YMM A;  5L1M A;  2XY7 A;  1JI7 A;  7ICU A;  4X5V A;  3CP8 A;  3L4P A;  5KFB A;  4F8R A;  3NAS A;  2W43 A;  3HX0 A;  1KLN A;  2A1J B;  2W3S A;  1KFD A;  2ZIV B;  5DGA A;  4J9N A;  1S0N A;  1YZ7 A;  4JWM A;  3N7R C;  1U9L A;  2HOF A;  1NK0 A;  1SV0 A;  3HKZ F;  3JPP A;  1CRX A;  4EEK A;  1N60 A;  3WK4 A;  2NRV A;  4ECY A;  1B43 A;  5KT5 A;  4ECQ A;  1X6I A;  3T3F A;  1ZQS A;  3SR6 A;  4I27 A;  3BQ7 A;  3GDX A;  3KKA C;  2LYH A;  4Y2S A;  2KFZ A;  7ICT A;  2BKE A;  3ZDB A;  2DL0 A;  8ICN A;  2JXJ A;  4BXO B;  4P2H A;  4KLM A;  1FO4 A;  4DF4 A;  1ZQK A;  4GIB A;  2GH1 A;  4XUS A;  2EH9 A;  2PKE A;  1LKY A;  1ZQC A;  1VDV A;  5ALM A;  2YB4 A;  4R8U A;  5L9X A;  1BPX A;  1T7P A;  3UMG A;  3UXN A;  1UCV A;  4CCH A;  5KG7 A;  2EAN A;  1ZQL A;  1T3Q A;  2W9M A;  1TVA A;  1S5L U;  5AI5 A;  2K4P A;  2JEI A;  7ICO A;  3C23 A;  3BQT A;  1S97 A;  4YQW A;  4DL7 A;  3SI8 A;  3UPQ A;  4JV1 A;  1D9D A;  1KSP A;  4C8O A;  4J9S A;  1D8B A;  2FI1 A;  2JEF A;  3N7S C;  4OJ6 A;  3RFA A;  3TAN A;  7ICF A;  3PX0 A;  3AQF A;  9ICV A;  2HI0 A;  2Y9T A;  4P0Q B;  2OM6 A;  2B21 A;  4FS2 A;  5KFF A;  9ICI A;  2JRZ A;  4B6J A;  5J2B A;  5AKK A;  5KFG A;  5BOM A;  5EWG A;  2LBO A;  3WKE A;  1MC8 A;  2FDR A;  1F44 A;  1KEJ A;  4TQR A;  2WF5 A;  1L3S A;  3RAX A;  2KIV A;  3KKA A;  1ZQT A;  2VJ5 A;  1O03 A;  4YXJ A;  5ALP A;  1URJ A;  3NRW A;  4ED3 A;  1UT5 A;  4O5C A;  3PW5 A;  2AXT U;  5KFU A;  3C1Y A;  4OJO A;  4A8E A;  2IHN A;  1IM4 A;  2JH7 A;  3K1R B;  4UW9 A;  3K4G A;  3N4M B;  2D6F C;  4QZF A;  4QZI A;  5KG5 A;  3MFI A;  3RJF A;  4UBC A;  3PR4 A;  4EBC A;  4C7Y A;  5AK5 A;  2DF4 B;  4ED1 A;  1AQ6 A;  4CDG A;  3CW2 C;  5AM3 A;  4NXZ A;  1ZQV A;  1BPD A;  5ALX A;  2EAP A;  2WAQ F;  4YMO A;  4NLN A;  2QAR B;  4DFM A;  3ETL A;  3PML A;  3MGH A;  2RLT A;  1DOQ A;  4KN7 A;  3O0F A;  5J2F A;  5DLF A;  2DBY A;  4PH5 A;  1OUQ A;  2R18 A;  1MQ3 A;  3KHH A;  4UB3 A;  5HR7 A;  5AK3 A;  3PZP A;  3FC4 A;  4O3O A;  2W9B A;  2GWS A;  4M2Y A;  2EAM A;  5ALQ A;  3V6J A;  1V38 A;  1IXR A;  3GV5 B;  1SIJ A;  4Z6C A;  1QTM A;  4ECS A;  2WTF A;  3SAF A;  2CPR A;  2J6S A;  1KN5 A;  1RQL A;  4O9M A;  4ELT A;  1ZOL A;  1KDH A;  8ICQ A;  4PL1 A;  4PGQ A;  3ZDE A;  2VA8 A;  4Y2Q A;  2A3V A;  3H0R B;  3B0X A;  2PFP A;  4G9B A;  2V9W A;  2Y0S C;  4MEY A;  4YMN A;  2Y9U A;  1XSP A;  3G6Y A;  1JXE A;  3BQ1 A;  2NRX A;  2NO4 A;  3E0F A;  3K1Z A;  4I2E A;  3IV6 A;  4YCX A;  4F2R A;  1A0P A;  3GIM A;  3C21 A;  1YZ6 A;  1UT8 A;  2WF7 A;  2A19 A;  5KFI A;  4F50 A;  1L8L A;  5CJ7 A;  9ICG A;  4R66 A;  8ICU A;  1PUZ A;  5J0Q A;  5F9N A;  1BPZ A;  4U7C A;  3HPO A;  1C7Y A;  1ZQG A;  2W54 A;  2K60 A;  1MQ2 A;  2FPM A;  4QZ8 A;  2KJ8 A;  2ZIX A;  1WYG A;  2PI5 A;  2M9N A;  4QWD A;  1D8L A;  2ISP A;  4JUZ A;  1S0O A;  3B9J A;  3KHG A;  8ICW A;  2ODG A;  1XC9 A;  2CXY A;  5ALW A;  4KN4 A;  4RT3 A;  2KIW A;  4EYI B;  3OHA A;  2R8J A;  2LMR A;  2PMZ F;  1MN8 A;  1JAL A;  3RB3 A;  1UA0 A;  4PZO A;  5AKE A;  3EUB 2;  3RBE A;  3PO5 A;  2ZXI A;  2D3D A;  4B9T A;  4Y2R A;  3H8M A;  5AK6 A;  1S9F A;  1U47 A;  4CGZ A;  4UB2 A;  5F3X B;  1WCL A;  2W9C A;  4RUA A;  1X6J A;  2R8H A;  4TUR A;  3PST A;  3BQ2 A;  2UVU A;  8ICZ A;  5L1K A;  3BS5 B;  4Q8E A;  2LYB A;  2OHF A;  2MUT B;  2EAO A;  4PJ0 U;  3U26 A;  1J2M A;  2E8N A;  5KFK A;  4KX5 A;  2AU0 A;  3OSP A;  4RQN A;  5IIO A;  3SEI A;  4LZG A;  4ED0 A;  5KAF U;  4FZN A;  2KE7 A;  4P0P B;  3I28 A;  5J0P A;  4ED2 A;  3KOO A;  3QUB A;  5J8Y A;  5KT6 A;  1TK5 A;  2MU2 A;  2GOL A;  4DQP A;  1RXW A;  5KFW A;  3AM9 A;  1RZT A;  5HNK A;  1TV9 A;  5KFZ A;  5D46 A;  3EW9 A;  3NTU A;  1ZD3 A;  3A0B U;  2WB1 C;  2EZX A;  3F5A A;  1V9P A;  5DQI A;  3AQE A;  5L1I A;  2OH2 A;  2DKZ A;  5C0Y A;  1SL2 A;  2XY6 A;  1XO0 A;  1WWV A;  3PX6 A;  2QB0 A;  5ALT A;  5KNI A;  4ZOH C;  5AI0 A;  2KKP A;  5D49 A;  3MBY A;  4J9P A;  4LZD A;  4UB5 A;  2KIC A;  2KKV A;  8ICC A;  3Q8S B;  2AGQ A;  4FO6 A;  2W8K A;  2WAQ C;  1ZYQ A;  4M04 A;  4P4M A;  2HHW A;  1L7N A;  3D6J A;  5EWF A;  2H3F A;  3V7J A;  1ZQM A;  4DL4 A;  3MR6 A;  2AQ0 A;  2DKX A;  4DFK A;  3RRG A;  2R8G A;  4I2C A;  3H8W A;  2JEG A;  4OJP A;  3RRH A;  4OD0 A;  5J29 A;  4QW8 A;  1B0X A;  4XQ8 A;  2M0N A;  5AK4 A;  4BWJ A;  2KHQ A;  4US8 A;  3MAB A;  3ZDA A;  2A1J A;  2ZIV A;  4J9M A;  4ELV A;  3LDA A;  3UQ0 A;  3UXO A;  2BZF A;  4I2H A;  3RR7 A;  1SGG A;  3H7I A;  4QZ9 A;  4K4I A;  4Z6E A;  3GQC A;  3AU2 A;  3I76 A;  5AIA A;  2OWO A;  5DG7 A;  1XS9 D;  1J2N A;  1NI3 A;  4PZN A;  2KJ5 A;  2RRD A;  3IP4 B;  2BPG A;  3R9K A;  3ZD8 A;  1N63 A;  3IDW A;  3K75 D;  3IG8 A;  3RAQ A;  3M9O B;  1VLB A;  1KFS A;  2DUY A;  5KG1 A;  3SV4 A;  4E0D A;  3NRZ A;  1L3T A;  1SXE A;  1NK4 A;  3T5J A;  2Y1J A;  2I1Q A;  1SV4 A;  1TAU A;  3E2E A;  4BXO A;  1ZD2 P;  4Y2T A;  2ZJ8 A;  3RB0 A;  2XCP A;  4IC9 A;  1Z4N A;  3PW2 A;  3SQI A;  3TAC B;  1TKD A;  4RNM A;  4J9L A;  2OYY A;  5KG0 A;  3GZF A;  2BCQ A;  5J0U A;  1RQN A;  3RJJ A;  4UAT A;  5JUM A;  1ZJM A;  1ZQB A;  4RPY A;  5AKY A;  8ICX A;  2PFQ A;  5AI8 A;  4J9O A;  2BCR A;  2ZUD A;  3Q8Q B;  4DEZ A;  3D2S A;  1L3V A;  2HCF A;  3N97 B;  1RYU A;  5CHG A;  4O3R A;  1KQQ A; 
#chains in the Genus database with same CATH homology
 1B4F A;  5J8Y C;  4NJ8 A;  1SXD A;  1PK1 A;  1F0M A;  1KW4 A;  2D3D A;  3HIL A;  1B0X A;  3H8M A;  2D8C A;  1WWU A;  1PK1 B;  5L1M A;  1JI7 A;  5F3X B;  3BS5 A;  2Y9T A;  1SGG A;  2F3N A;  3BS5 B;  1PK3 A;  2KSO A;  2EAO A;  1V85 A;  1OXJ A;  1X66 A;  2Y9U A;  2E8O A;  2E8N A;  4PZN A;  1Z1V A;  2KIV A;  3KKA A;  2QKQ A;  2ES6 A;  2B6G A;  4RQN A;  2LPE A;  2KSO B;  3SEI A;  2L5Y A;  1SV0 A;  2KE7 A;  4MHV A;  3TAD C;  5JTI A;  3IDW A;  5J8Y A;  1COK A;  4RQM A;  2FE9 A;  3K1R B;  1RG6 A;  2KG5 A;  1UQV A;  3BQ7 A;  2E8P A;  1SXE A;  2F8K A;  1X9X A;  4NL9 A;  3SEN A;  1SV4 A;  2K60 A;  3KKA C;  5JU5 A;  2DL0 A;  1SV0 C;  3TAC B;  2QAR A;  2DKZ A;  4IS7 A;  2EAP A;  2KMD A;  1WWV A;  2QB0 A;  1LKY A;  5KNI A;  2QAR B;  1X40 A;  2QB1 A;  1UCV A;  2QB0 B;  2LMR A;  1LKY B;  3TAD A;  2EAN A;  4NL9 C;  2F44 A;  1OW5 A;  5JRT A;  2EAM A;  2K4P A;  2YTU A;  1V38 A;  2GLE A;  2DKX A;  2ESE A;  4PZO A;  2E8M A;  2JV3 A;  1DXS A;  3BS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...