2ES6A

Structure of the sam domain of vts1p
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
MPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vts1p
publication title Shape-specific recognition in the structure of the Vts1p SAM domain with RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 28
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2es6A00
3IDWA 2E8OA 2YTUA 5L1MA 2EAMA 3BS5B 1RG6A 1V38A 1JI7A 2QB1A 1OW5A 3KKAC 2KIVA 3KKAA 1OXJA 2LMRA 1PK1B 1Z1VA 4IS7A 2Y9UA 1SXDA 2QB0A 2KSOA 1PK3A 2F44A 2DKXA 2K4PA 2Y9TA 1DXSA 2JV3A 1F0MA 4NL9C 4NL9A 1WWUA 1SV4A 5JU5A 2D8CA 3SEIA 3H8MA 5F3XB 1V85A 3BS7A 1SGGA 2K60A 5J8YC 1SXEA 2D3DA 2GLEA 2QARB 1UCVA 1X66A 4MHVA 2FE9A 4PZNA 1LKYA 3TADC 2E8NA 3TACB 3TADA 2KE7A 1X9XA 2ES6A 1WWVA 4NJ8A 2F8KA 2E8PA 2EANA 2QB0B 2KSOB 3BS5A 1UQVA 4RQNA 3SENA 1B0XA 2EAOA 2LPEA 5J8YA 5JTIA 2DKZA 2EAPA 1PK1A 1SV0C 1SV0A 1X40A 2ESEA 1COKA 2E8MA 2QKQA 2QARA 4PZOA 1KW4A 3BQ7A 2L5YA 3HILA 2DL0A 5KNIA 2B6GA 1LKYB 1B4FA 5JRTA 2F3NA 3K1RB 2KMDA 4RQMA 2KG5A
chains in the Genus database with same CATH superfamily
5ALGA 3HT3A 3IDWA 2P66A 2EAMA 3QEBZ 2R8HA 3OSNA 1ZQTA 4JB3A 3H0RB 3NVVA 4QZ9A 1OXJA 4M6WA 2CN1A 1CEZA 3V7JA 1JALA 2QB0A 4NY8A 4RNMA 1L6NA 4KMUA 8ICIA 1QQ7A 4J9KA 2BPCA 4BX9C 4J9RA 1TK8A 1NK4A 3CNHA 5AHXA 2K8AA 2XCPA 1DXSA 4NL9A 2G08A 1DGJA 3I76A 4YG2A 2HMXA 1L3UA 3M9MB 4MFCA 2MUTB 4J03A 3KOOA 1NK9A 2YMLA 4B6JA 1Z00A 3N28A 3UQ2A 9ICSA 4G9BA 2FDRA 2F1HA 1UCVA 5KFNA 2KNJA 4I2IA 4DS4A 3T5HA 4IRDA 2CPRA 2WF8A 5KFTA 1PVQA 3C2LA 8ICCA 2JEIA 2F1IA 2OXOA 5DQGA 3LWMA 2A1AA 1T94A 2MRLA 4F93B 2HHUA 3RR8A 1KN5A 5CRXA 5JTIA 4Y2XA 1HJPA 2Y1IA 1BVSA 1S0OA 7ICQA 2NO5A 4O3RA 1HEKA 3HPOA 2AGQA 2J6UA 8ICRA 3QUTA 2XGQA 7ICHA 1PZNA 2ZXIA 2MSNA 2LBOA 3PX0A 3VCBA 5KFRA 1T7PA 1Q3VA 4PPXA 2OEHA 9ICQA 3THVA 2HHQA 4EYHB 2J6SA 2JXJA 4UB5A 9ICKA 4NV0A 5F9LA 1QH9A 3C1YA 2HVIA 4QZHA 1Z00B 5B5EU 2FLPA 1RQLA 4AYBF 3ETLA 2HW3A 2HDOA 1B43A 3E0FA 8ICLA 1Z4NA 5ALDA 2ZJ5A 2LYHA 1SWWA 1ZJMA 1U48A 3NVZA 5BOLA 1ZD4A 4UQGA 9ICIA 3I28A 4DQPA 4TQRA 1D8YA 4FZLA 5IIJA 4O5CA 5J8YC 5KG3A 2OYYA 1SL0A 3M9OB 9ICBA 9ICXA 3V7LA 4PZNA 5EE3A 1BNOA 1WYGA 3GU3A 4F71A 4RT3A 3QXGA 1V97A 1KLNA 3Q8RB 4FS2A 1RXVA 4PL2A 4YR2A 2LHTA 4P4OA 3RJKA 5AI5A 2DPIA 1B0XA 3PSTA 2KICA 5AKXA 2EH9A 1N56A 3MFHA 4O0IA 5J0YA 3C2KA 1TFRA 2WF5A 5ALRA 3ICXA 1VDVA 1UT5A 5KFYA 2W3RA 5KG7A 3ONNA 3ISBA 4QZAA 3SAFA 4KLLA 4PHPA 4XRHA 4ECUA 4AYBC 4RUCA 3RH5A 3L4PA 3SV3A 2EQYA 2KMDA 4DO9A 3IRUA 9ICLA 4RNOA 3Q8LA 3ORYA 3Q8SB 4CCHA 2UVRA 1A76A 1TK0A 1OUQA 2R18A 4KN7A 2GWSA 4EELA 1XSLA 4EEKA 4ED8A 1FFVA 3F2BA 5KFGA 3NGDA 1NK0A 1X2IA 3FDSA 3M9NB 4MF2A 3H4DA 4YMMA 4DL4A 1Z19A 2W7OA 3PVXA 1J2MA 1Z3EB 2NO4A 2HOFA 3BS7A 5DLGA 3ED5A 5AM3A 3OHBA 4JV1A 3RRHA 7ICFA 3MC1A 2A3VA 5KG5A 4PHEA 2GLEA 2PMZF 3SYZA 5AKJA 1NKEA 3TACB 4I2CA 2A1JB 4F91B 4LZDA 2KJ8A 1ZQHA 8ICQA 2D6FC 5KFEA 3GIIA 2F8KA 5AI0A 1ZXIA 4CDGA 1RZTA 1J97A 9ICAA 8ICNA 4RQ2A 3J81j 5KT2A 3T5KA 3KD3A 3WKCA 3BS5A 3HX0A 2WF7A 4YXJA 2DKZA 5BOMA 8ICZA 1SV0C 2ZIUB 1ECWA 3OJUA 4Q45A 2ZTEA 4ECZA 5AM0A 3H7IA 1HUOA 4BWJA 3WK6A 1XU4A 2FI1A 2GOLA 4EBDA 1B22A 4FFDA 5C5JA 1D9FA 2KTQA 5KTQA 3K75D 1YZ7A 3F2DA 2ZIVB 4MFAA 4GFJA 4O3OA 4OCZA 3QEAZ 9ICWA 5AKEA 1IXRA 1ZQRA 5AM5A 4BXOB 3QX7A 5ALTA 3KKAA 4CF3A 1NZPA 3HW8A 1U4BA 4IS7A 4F8RA 4KLGA 3RFAA 3ZD8A 3WK9A 3UXOA 4MEXA 1U45A 1KSPA 3WK7A 3NS1A 2PMZC 5ALHA 2K8CB 4OJ5A 3ZD9A 2Y0SF 2KVCA 4OD0A 4CE6A 3MABA 2JH7A 4UAVA 3F2CA 4KLOA 3KZXA 2K60A 4YR0A 1TVAA 4C8OA 5J2HA 3H0LB 2KHQA 5KFFA 1X66A 4DLGA 1L7NA 4RT2A 1S0MA 1SKSA 1YZ6A 8ICUA 5DDYA 5L1LA 2ES6A 4PGXA 9ICOA 3NVWA 3PW4A 2YQEA 1JX4A 4DL2A 4I2HA 4DSIA 4ED3A 3IM1A 3UM9A 3UQ0A 3TAQA 3V6JA 5DGAA 4LVSA 1IM4A 1JXLA 4I27A 3GILA 8ICEA 4PZOA 1RYRA 3N7RC 3JPTA 3MGVA 3BQ7A 5KFPA 2EZYA 5DQHA 1RQNA 3SV4A 1L3TA 4DQQA 4DOBA 4NLCA 7ICJA 4Y2JA 1LB2B 4O9MA 4YR3A 4DF8A 1KQQA 3CRXA 3NTUA 3M8SA 3G6YA 3K1RB 5ALOA 5KG2A 3D2NA 3CYMA 4F5RA 4EZ6A 1WG8A 3IP4B 3JPQA 4QWCA 1NK6A 3KHRA 1QSYA 2W3SA 1AROP 3AL0B 5KT5A 4B9MA 2M9NA 2JEJA 4F92B 3V6HA 1RYUA 4F4WA 1V38A 2QB1A 4JV2A 2Y0SC 1XNSA 4YD2A 2PFOA 5KFQA 2BZFA 5AK6A 4EBCA 3BQTA 3EPIA 3C29A 3V7KA 1DRGA 1S0VA 2BR0A 3H8WA 1XO0A 2K4PA 3GV8B 4PL1A 4RQ6A 1WWUA 3B0XA 3I1YA 5DKWA 1A0PA 1SZHA 1ZQCA 2ASJA 5L1IA 1QQ5A 1QLNA 2HHVA 8ICWA 3FYHA 3QUQA 4KLMA 2NRTA 2ZJAA 2G5IB 2C28A 1RPLA 2I9GA 4F4XA 9ICVA 2ZTCA 3BQ2A 1XWLA 5J0SA 5KG6A 8ICHA 5KFSA 4Y2PA 3NUQA 2XO7A 4R65A 4RQNA 4PHDA 4YN4A 5ALQA 1NOMA 4IR9A 3TKAA 3HWTA 4X5VA 3MR2A 1ZQZA 5TZVA 2QKQA 2JMGA 1ZQSA 2XY6A 5CJ7A 2BCRA 1M6YA 5EE0A 1KL9A 4ECSA 2EZZA 1SKWA 3F53A 3PSFA 4ELVA 1RXWA 3ZDDA 4M47A 4YMOA 4XA5A 4BUGA 4HAIA 4RNNA 3SR6A 2I6XA 3F5AA 4DEZA 3SAHA 4O5EA 7ICEA 2GO7A 2OWOA 4JWNA 4DL7A 1SZPA 5KFUA 1ZQDA 2LI6A 3M8RA 9ICNA 2PKEA 2DGZA 4J9SA 1SXDA 4DFKA 3DV9A 2KJ9A 5KFJA 4IQTA 2DFLA 3RR7A 3FC4A 4P4PA 4IRCA 3G6VA 1KTQA 2VIXA 4UBCA 4NM2A 3OHAA 3SEIA 5EWEA 3NRZA 5F3XB 1X9MA 1CRXA 4NM1A 3PNCA 1ZQNA 4B9LA 1SXEA 1S5LU 3N97B 2HOIA 2ATLA 2D3DA 2RRDA 4RPXA 3RAXA 4MHVA 4MF8A 1ZQ1C 3TADC 3PW2A 2E8NA 2O6KA 3EW9A 5AI4A 4RQ8A 5DB9A 4DOAA 1A6SA 2DBYA 2AQ0A 1NJZA 5DG8A 5D4BA 1T3QA 2ZUDA 5L1KA 4P0QA 4EYIB 4C7YA 3ZDCA 1S0NA 2G06A 2C2DA 4DSJA 3SMVA 2HBJA 1ZQMA 5GTIU 3GIMA 1IIPA 2K89A 1S8OA 1NI3A 4Y2YA 4RQ3A 2AH5A 1QTMA 2BCSA 4CNQA 2VANA 1TV9A 4NWIA 3LVVA 2YY6A 4KLTA 3IG5A 1BPXA 2AJQA 4C8LA 2R8KA 5ALZA 2WHEA 1L7OA 1ZQFA 2OH2A 2ZUCA 3R9KA 4QZFA 3B9JA 3FM9A 4GC6A 4CGZA 2G09A 3UXPA 3M6ZA 2NRWA 1JROA 3UMBA 1GO3F 1PK3A 2H3QA 2JEGA 4F5PA 5K4LA 8ICFA 2HHTA 1N2XA 2RP5A 4DFJA 3KHLA 1H38A 4MFFA 4JUZA 4ED0A 5AM2A 1L5UA 4C4RA 4P0QB 3PR4A 4Z6EA 3E58A 4CF5A 3BQ0A 1NKBA 4OJPA 5EOZA 3UMCA 5J2JA 4USAA 1QSLA 3NASA 4YMNA 5AICA 2KJ5A 4IC9A 5KT4A 4KLHA 2KSOB 1ZRMA 3DEEA 3SENA 4IQUA 4BWMA 2BQ3A 4CRXA 1IG6A 4BJQA 2EAPA 4UB1A 1S76D 4TQSA 1X40A 3KZIU 5HP4A 2DQNB 4DSFA 1Q8KA 8ICYA 2RDIA 5CB1A 3AMZA 4KLSA 2W9MA 5AKHA 4GIBA 2YN4A 5KNIA 5ALXA 4KLQA 2B6GA 5AKGA 3RJGA 3T5JA 3UXNA 5J0XA 3BZKA 2BPFA 4B9VA 4I2GA 1N5XA 3MFIA 2A1JA 4QJFB 2KN7A 3PY8A 4DSLA 1P7DA 3TAPA 3RAQA 2LM1A 1JUDA 4KTQA 1BGXT 7ICNA 2F44A 1UT8A 1NKCA 2ZIWA 3LDAA 2KFNA 1BPZA 2XIDA 2K8BB 2F1JA 4RUAA 1SV4A 2ZIUA 2D8CA 1DK2A 4Y2SA 4EZ9A 2KVSA 2G5HB 7ICTA 3BZCA 4O3PA 2ASLA 2LKYA 3RJIA 5EE1A 5AKIA 3H40A 4C4TA 5B66U 5J0WA 1U9LA 4DWIA 1XC9A 4C8NA 4RQ4A 2FLNA 3MR6A 4DFDA 4F2SA 4IQWA 5J0RA 2ZIVA 4PH5A 4DLEA 4IR1A 5J0QA 4UB3A 2I5HA 3RJEA 1ZQWA 1ZQJA 2IHMA 1XSNA 3UPQA 2E1FA 4BXOA 1S77D 1WCLA 5J2AA 1SV0A 2EZXA 3SZ2A 4ZH4A 3T79A 1UA1A 2QARA 3EUB2 1PVPA 3A0BU 3RB6A 1KW4A 2ZXHA 5J2FA 2AHOB 2K4EA 1KFTA 3RRGA 1BPBA 5AIAA 3U26A 1NZBA 2ZIWB 5J2IA 3C1ZA 4KLFA 1RM6C 2FPLA 3WK5A 3WKAA 2JEFA 2KG5A 4J9LA 3QU2A 5KFMA 5KAIU 5KFKA 1SIJA 4K4GA 3HRDD 2V4QA 1QSSA 4NLGA 3EZ5A 1QCKA 9ICEA 4R66A 3SQIA 2PI4A 2W8LA 1FFUA 3MR3A 1EXNA 3ISDA 2IBKA 5J2BA 4ED7A 2ALZA 1X9SA 4F50A 2DKXA 1KKXA 1CI4A 2W43A 5J0PA 2W11A 5ALNA 4B9SA 5E79U 5KT3A 5H2FU 4Y2RA 3H0MB 2PFNA 1ZQAA 4FZMA 3RBDA 3TI0A 3EYZA 3NRWA 5KL1B 4US8A 1AQ6A 2QARB 3RTVA 4O3QA 2HHWA 5A0LA 3KFUF 4Q8EA 2W03A 4PHAA 4UAYA 1BPYA 5KFZA 9ICMA 4FO6A 3D2SA 2NYVA 3RJHA 4RPYA 4QZEA 2ISOA 1L3VA 7ICPA 4GLXA 4Z6FA 5J2GA 4ECQA 1T3NA 2PFQA 2RHFA 5HHIA 4M2YA 4Y2QA 5HR6A 2R8IA 1D8BA 5AK5A 1ZD5A 1SWVA 1SL2A 2HBLA 2EDUA 3C28A 4QZGA 2OHFA 2IA6A 1WCNA 2OCEA 2FPKA 2DL0A 5DGBA 4KX3A 3RF9A 4I2JA 4J9PA 2N1RA 2LYAA 2KIWA 1COOA 2W9BB 5IIMA 8ICBA 3IHQB 5CR0A 4R63A 1Y88A 1SL1A 4RQMA 4YD1A 9ICFA 4UW9A 1ZQBA 8ICPA 4U7CA 3OPXA 2JR5A 3QUBA 4JWMA 1F5SA 4F2RA 4KITB 2KFZA 2PXIA 1RG6A 2R8GA 1OW5A 2FLLA 2FJ6A 3JPSA 3V72A 1T8EA 2Y9UA 5J0UA 1NK7A 4K4IA 2R8JA 5DQIA 1NJXA 4ELUA 2LM4A 2IOHA 9ICHA 4U6PA 1S10A 1MA7A 1ZQPA 3WKBA 1F0MA 1NNLA 2JZBB 4M9JA 5L1JA 3PW7A 2HHSA 1DK3A 1LVHA 4R8UB 3JPOA 4JV0A 3PX6A 3H8MA 4NLNA 3QU4A 1Q46A 4CF4A 5DLFA 3T5LA 4RPZA 2QLTA 7ICIA 1MN8A 4P4MA 8ICTA 3QU9A 2KE7A 3RJJA 5AI9A 1JMSA 3L5KA 1C7YA 3SAGA 3JPPA 2E8PA 1NJWA 2BDUA 5CHGA 2AGOA 3PO4A 4TURA 4XQ8A 4RZRA 2W04A 5GTHU 1KFSA 2ISPA 1XS9D 4G3IA 2LPEA 4FS1A 2E3TA 2FMSA 1XSPA 2AQ4A 3VC8A 4KN4A 2VA2A 1PVRA 2MA1A 3RB0A 2YB1A 2CRXA 4QIWF 2W9AA 5DBAA 3TFRA 5CP2A 5DBBA 4MEYA 2VJ5A 4ECVA 2WFAA 4TUSA 4OO1J 1N62A 4M9GA 4C80A 4UAZA 4PJ0U 2W54A 2NRVA 4FBUA 5J2KA 2F3NA 2KZMA 1KBUA 2B0CA 1ZQIA 4RQ7A 5J0OA 2HVHA 3S6JA 7ICVA 2KEYA 2OM6A 2BQRA 3AEVA 3IN5A 5EWGA 2BDPA 3MGHA 1JI7A 2FMQA 1X6IA 2VJ4A 3WKDA 3AU6A 1RYSA 1DGSA 3PR5B 1N61A 2W55A 7ICUA 4RQ5A 4DQSA 3HKZF 5KFOA 1U47A 2DUYA 4TUQA 2BCQA 5BPCA 3KHHA 1UHUA 3AQFA 5DB7A 1ZOLA 4UATA 2KKVA 3SD7A 1D8LA 2H3VA 4EX7A 4ECRA 2DWQA 4B9NA 1V85A 2JHDA 5AK3A 2HCFA 1FEZA 3LK9A 3Q8PB 4ED1A 3N7PD 5G5GA 4OJ6A 1ZQVA 4GXJA 5KFVA 3TADA 2YMMA 3BQ1A 4YCXA 2M0NA 5AM1A 3JPRA 1ZD2P 4YQWA 2KP7A 1HUZA 1S97A 2JH1A 4QIWC 9ICPA 2HOQA 2ODGA 2HSZA 7ICGA 2KD1A 3IG8A 1BNPA 5KFHA 4I29A 2YMQA 4F4KA 2KZZA 1T4GA 2IOFK 3GV7B 3RH4A 4I2FA 4Z6DA 2BQUA 4NLKA 3B0YA 3QNMA 3NVYA 3PMNA 5KG1A 3CP8A 3JPNA 2G0AA 4UASA 1NJYA 2XC9A 5KT7A 1O08A 4QW9A 2H5XA 1ZQEA 1LKYB 4P0PA 4DSKA 4DF4A 2XY7A 2XGPA 3HKZC 2IMWP 4EEYA 2HI0A 2E8OA 1K5OA 2XICA 4LJXA 5AM4A 3D2QA 5CWRA 5DB8A 1TAUA 2HBMA 2KV2A 3H8JA 4EX6A 5ALJA 1CUKA 1PK1B 9ICTA 4DL6A 3MBYA 2A19A 2KSOA 1WUDA 3PSPA 3H4BA 4KX5A 4M9NA 1ZETA 2ZG6A 4YVZA 2ZIXA 4NL9C 1MC8A 4IL6U 4I2BA 5AIBA 3PW5A 3LYSA 4F4ZA 1ZQYA 3TARA 4B9TA 2YB4A 3CW2C 2NRXA 4UB6U 3F5EA 2DF4B 5J2DA 2VKQA 4I2EA 5CA7A 3EWAA 2FE9A 2F77X 4ZOHC 4C4SA 5DB6A 3QE9Y 1N60A 1FO4A 4NJ8A 4M6WB 3FAHA 1SKRA 4K4HA 4KLJA 4QNLA 4P0PB 2QB0B 2VA3A 3AU2A 3PX4A 4YP3A 5J8YA 2DPJA 1JXEA 8ICAA 2YX8A 2F76X 4DOCA 5ALKA 1ZYQA 4BDPA 2ZUBA 4JK1A 3KTQA 3AM9A 3OTQA 1ZQOA 4UAWA 1JIHA 4P2HA 4J9NA 5IINA 1B4FA 2WTFA 4UARA 2ZIXB 3OJSA 8ICVA 2GH1A 2K4IA 3C5GA 3M7DA 5KT6A 5EE9A 3PMLA 5HMMA 4LZGA 2WF9A 4F5OA 2NRZA 2Q0ZX 4DQRA 2F2AB 3AQEA 1L7MA 4ECYA 2F8LA 3TQ1A 4F4YA 5AI8A 2H3ZA 4C0ZA 5EWFA 1UPHA 2Y9TA 4NLZA 2V4RA 3GFKB 2IHNA 4KLIA 5ALFA 4KMOB 2ZTDA 2RLTA 8ICXA 4QWAA 3GDXA 4C8MA 5D46A 1VJ5A 4ECXA 2BHNA 3KHGA 2K4HA 4EENA 3M6KA 1ZJNA 4UB2A 4DFPA 1ZQGA 1TE2A 4F5QA 3OGUA 2JGAA 7ICKA 1WWVA 2E1EA 1O03A 4I28A 4NXZA 3GIKA 3SI8A 2W8KA 2UVVA 2W9CA 3LVWA 4GXKA 5TISU 4XUSA 2Z7JA 2BGWA 3OSPA 2WAQF 4PGQA 1BPDA 5ALIA 2C22A 3H8SA 4I2AA 3Q8QB 4FE3A 5ALPA 3ALRA 3HILA 4O3MA 2C2RA 4O5KA 4QWEA 1VLBA 2BKEA 5CEHA 5KFIA 2FPMA 4UB4A 1QQ6A 4FZNA 2WF6A 5JUMA 3ZDAA 1ZQXA 3C5FA 5AKKA 2AXTU 1A77A 3WKEA 5L1MA 4DS5A 3QU5A 5KFWA 3RB3A 1TK5A 7ICRA 2PFPA 9ICUA 2WB1F 2LMRA 4KLDA 4M9LA 4DL3A 1N5WA 1TAQA 1IV8A 1URJA 2UVWA 5KFXA 3G6XA 1ZRNA 3ZDEA 1DOQA 4QW8A 4DFMA 4O3NA 4ECTA 2H3IA 2JV3A 2XY5A 5KG0A 2W9CB 1JN3A 2Q4TA 2XI9A 5ALEA 4QWDA 1KDHA 4ED6A 3IV6A 4DL5A 3HP6A 9ICRA 7ICMA 4F5NA 3ZI4A 1L8OA 1ZQKA 2W9BA 4C8KA 2XCAA 3QYPA 4KLUA 3L3FX 3T3FA 4FBTA 4J9OA 2P6RA 1MQ2A 5KFLA 2RQ5A 2WAQC 2G07A 1HIWA 3M1YA 3AN1A 3HJEA 3GV5B 2C2EA 1UQVA 4Q8FA 2EAOA 2MU2A 1MQ3A 5AKYA 2KKPA 5AKZA 2ESEA 2XVTA 2E8MA 4ICAA 4UAUA 5KFAA 1J2NA 4B9UA 3UMGA 1MSWD 2L5YA 1K1SA 4RQ1A 3Q8MA 4EBEA 5IIIA 4IRKA 4Q44A 3MR5A 3MDCA 2JZBA 5IILA 3PZPA 2CXYA 2H3FA 4M0AA 3C2MA 4R8UA 5T14A 4HYKA 5D49A 5HHHA 2VA8A 5JRTA 2HBKA 3C23A 2YMPA 2WB1C 5AI6A 1ZD3A 1V9PA 1KFDA 5L9XA 4UB8U 3BS5B 4ED2A 2MAXA 2PI5A 9ICGA 2I1QA 2HHXA 3ETRA 3KKAC 2KIVA 1Z4OA 3TFSA 4QZCA 1K1QA 1SB3C 2FMPA 1S9FA 4O3SA 3RJFA 3ISCA 5ALLA 3WU2U 5J2CA 3ZDBA 8ICGA 1UA0A 5ALSA 4QZIA 3QZ7A 1BPEA 1X9WA 5C0YA 3QU7A 2Y1JA 3WK8A 5DBCA 4Q43A 2ASDA 3MGIA 3LWLA 3KBBA 5DDMA 3QUCA 5IIOA 5AKLA 4Y2UA 4RQ0A 5HMLA 2LYBA 4JMUA 3PV8A 1N48A 4DQIA 1TKDA 3WK4A 4QZBA 5KFBA 2AU0A 3K4GA 4TUPA 2P6UA 2EANA 1TAMA 3O0FA 1RDFA 3AUOA 4J9QA 3RBEA 4GXIA 5ALUA 4ECWA 1L3SA 4DSEA 1LV5A 3C21A 4Y2VA 4F72A 5FP0A 2KOBA 3PO5A 4C7ZA 4GC7A 1NK8A 9ICJA 1C20A 1COKA 4QZ8A 3V6KA 1Z1BA 1PUZA 1ZQUA 5DG9A 3N7SC 4OJLA 2J6TA 8ICJA 3A0HU 5J0TA 4R64A 4WJ3B 4YFKA 2BPGA 1X42A 4E0DA 3N4MB 3RH6A 5KFCA 4QZDA 1KEJA 1D9DA 1NK5A 2E5SA 5ALWA 3DDHA 1XO1A 1ZQLA 2YTUA 4PGYA 8ICMA 1FIQA 3K1ZA 3BJYA 2B21A 7ICSA 4Y2TA 4I2DA 7ICOA 8ICOA 1Z1VA 2V9WA 2KZ3A 1Q3UA 3GQCA 3RB4A 1YT3A 4Z6CA 3Q8KA 2W7PA 1JRPA 2BCUA 4M9HA 5G5HA 2P35A 4IQVA 5J29A 5JU5A 1KRPA 1L8LA 3QZ8A 4KLEA 5KG4A 5DG7A 4AP9A 1ED1A 1SGGA 3PSIA 5ALYA 1X6JA 5HNKA 1LKYA 4UBBA 1ZQQA 9ICCA 5HR7A 7ICLA 3MDAA 3BDPA 1X9XA 2BCVA 2NV3A 3PW0A 4M04A 4YXMA 4F3OA 2MUTA 1L7PA 5KAFU 4DCCA 2AGPA 4NLBA 5F9NA 1PK1A 2KK0A 3EPGA 5ALVA 3E2EA 4RU9A 2JRZA 4ELTA 3GIJA 2IOFA 8ICSA 5IIKA 1U49A 4BGDA 3D6JA 4J9MA 8ICKA 4OJOA 4ACOA 5ALMA 4A8EA 2KHVA 2ZJ8A 5J2EA 5AK4A 2RDJA 3GZFA 4QWBA 2UVUA 1F44A 3TANA 5KL8B 4US9A 1N63A 5KFDA
chains in the Genus database with same CATH topology
3IDWA 2E8OA 2YTUA 5L1MA 2EAMA 3BS5B 1RG6A 1V38A 1JI7A 2QB1A 1OW5A 3KKAC 2KIVA 3KKAA 1OXJA 2LMRA 1PK1B 1Z1VA 4IS7A 2Y9UA 1SXDA 2QB0A 2KSOA 1PK3A 2F44A 2DKXA 2K4PA 2Y9TA 1DXSA 2JV3A 1F0MA 4NL9C 4NL9A 1WWUA 1SV4A 5JU5A 2D8CA 3SEIA 3H8MA 5F3XB 1V85A 3BS7A 1SGGA 2K60A 5J8YC 1SXEA 2D3DA 2GLEA 2QARB 1UCVA 1X66A 4MHVA 2FE9A 4PZNA 1LKYA 3TADC 2E8NA 3TACB 3TADA 2KE7A 1X9XA 2ES6A 1WWVA 4NJ8A 2F8KA 2E8PA 2EANA 2QB0B 2KSOB 3BS5A 1UQVA 4RQNA 3SENA 1B0XA 2EAOA 2LPEA 5J8YA 5JTIA 2DKZA 2EAPA 1PK1A 1SV0C 1SV0A 1X40A 2ESEA 1COKA 2E8MA 2QKQA 2QARA 4PZOA 1KW4A 3BQ7A 2L5YA 3HILA 2DL0A 5KNIA 2B6GA 1LKYB 1B4FA 5JRTA 2F3NA 3K1RB 2KMDA 4RQMA 2KG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IDW A;  2E8O A;  2YTU A;  5L1M A;  2EAM A;  3BS5 B;  1RG6 A;  1V38 A;  1JI7 A;  2QB1 A;  1OW5 A;  3KKA C;  2KIV A;  3KKA A;  1OXJ A;  2LMR A;  1PK1 B;  1Z1V A;  4IS7 A;  2Y9U A;  1SXD A;  2QB0 A;  2KSO A;  1PK3 A;  2F44 A;  2DKX A;  2K4P A;  2Y9T A;  1DXS A;  2JV3 A;  1F0M A;  4NL9 C;  4NL9 A;  1WWU A;  1SV4 A;  5JU5 A;  2D8C A;  3SEI A;  3H8M A;  5F3X B;  1V85 A;  3BS7 A;  1SGG A;  2K60 A;  5J8Y C;  1SXE A;  2D3D A;  2GLE A;  2QAR B;  1UCV A;  1X66 A;  4MHV A;  2FE9 A;  4PZN A;  1LKY A;  3TAD C;  2E8N A;  3TAC B;  3TAD A;  2KE7 A;  1X9X A;  2ES6 A;  1WWV A;  4NJ8 A;  2F8K A;  2E8P A;  2EAN A;  2QB0 B;  2KSO B;  3BS5 A;  1UQV A;  4RQN A;  3SEN A;  1B0X A;  2EAO A;  2LPE A;  5J8Y A;  5JTI A;  2DKZ A;  2EAP A;  1PK1 A;  1SV0 C;  1SV0 A;  1X40 A;  2ESE A;  1COK A;  2E8M A;  2QKQ A;  2QAR A;  4PZO A;  1KW4 A;  3BQ7 A;  2L5Y A;  3HIL A;  2DL0 A;  5KNI A;  2B6G A;  1LKY B;  1B4F A;  5JRT A;  2F3N A;  3K1R B;  2KMD A;  4RQM A;  2KG5 A; 
#chains in the Genus database with same CATH topology
 5ALG A;  3HT3 A;  3IDW A;  2P66 A;  2EAM A;  3QEB Z;  2R8H A;  3OSN A;  1ZQT A;  4JB3 A;  3H0R B;  3NVV A;  4QZ9 A;  1OXJ A;  4M6W A;  2CN1 A;  1CEZ A;  3V7J A;  1JAL A;  2QB0 A;  4NY8 A;  4RNM A;  1L6N A;  4KMU A;  8ICI A;  1QQ7 A;  4J9K A;  2BPC A;  4BX9 C;  4J9R A;  1TK8 A;  1NK4 A;  3CNH A;  5AHX A;  2K8A A;  2XCP A;  1DXS A;  4NL9 A;  2G08 A;  1DGJ A;  3I76 A;  4YG2 A;  2HMX A;  1L3U A;  3M9M B;  4MFC A;  2MUT B;  4J03 A;  3KOO A;  1NK9 A;  2YML A;  4B6J A;  1Z00 A;  3N28 A;  3UQ2 A;  9ICS A;  4G9B A;  2FDR A;  2F1H A;  1UCV A;  5KFN A;  2KNJ A;  4I2I A;  4DS4 A;  3T5H A;  4IRD A;  2CPR A;  2WF8 A;  5KFT A;  1PVQ A;  3C2L A;  8ICC A;  2JEI A;  2F1I A;  2OXO A;  5DQG A;  3LWM A;  2A1A A;  1T94 A;  2MRL A;  4F93 B;  2HHU A;  3RR8 A;  1KN5 A;  5CRX A;  5JTI A;  4Y2X A;  1HJP A;  2Y1I A;  1BVS A;  1S0O A;  7ICQ A;  2NO5 A;  4O3R A;  1HEK A;  3HPO A;  2AGQ A;  2J6U A;  8ICR A;  3QUT A;  2XGQ A;  7ICH A;  1PZN A;  2ZXI A;  2MSN A;  2LBO A;  3PX0 A;  3VCB A;  5KFR A;  1T7P A;  1Q3V A;  4PPX A;  2OEH A;  9ICQ A;  3THV A;  2HHQ A;  4EYH B;  2J6S A;  2JXJ A;  4UB5 A;  9ICK A;  4NV0 A;  5F9L A;  1QH9 A;  3C1Y A;  2HVI A;  4QZH A;  1Z00 B;  5B5E U;  2FLP A;  1RQL A;  4AYB F;  3ETL A;  2HW3 A;  2HDO A;  1B43 A;  3E0F A;  8ICL A;  1Z4N A;  5ALD A;  2ZJ5 A;  2LYH A;  1SWW A;  1ZJM A;  1U48 A;  3NVZ A;  5BOL A;  1ZD4 A;  4UQG A;  9ICI A;  3I28 A;  4DQP A;  4TQR A;  1D8Y A;  4FZL A;  5IIJ A;  4O5C A;  5J8Y C;  5KG3 A;  2OYY A;  1SL0 A;  3M9O B;  9ICB A;  9ICX A;  3V7L A;  4PZN A;  5EE3 A;  1BNO A;  1WYG A;  3GU3 A;  4F71 A;  4RT3 A;  3QXG A;  1V97 A;  1KLN A;  3Q8R B;  4FS2 A;  1RXV A;  4PL2 A;  4YR2 A;  2LHT A;  4P4O A;  3RJK A;  5AI5 A;  2DPI A;  1B0X A;  3PST A;  2KIC A;  5AKX A;  2EH9 A;  1N56 A;  3MFH A;  4O0I A;  5J0Y A;  3C2K A;  1TFR A;  2WF5 A;  5ALR A;  3ICX A;  1VDV A;  1UT5 A;  5KFY A;  2W3R A;  5KG7 A;  3ONN A;  3ISB A;  4QZA A;  3SAF A;  4KLL A;  4PHP A;  4XRH A;  4ECU A;  4AYB C;  4RUC A;  3RH5 A;  3L4P A;  3SV3 A;  2EQY A;  2KMD A;  4DO9 A;  3IRU A;  9ICL A;  4RNO A;  3Q8L A;  3ORY A;  3Q8S B;  4CCH A;  2UVR A;  1A76 A;  1TK0 A;  1OUQ A;  2R18 A;  4KN7 A;  2GWS A;  4EEL A;  1XSL A;  4EEK A;  4ED8 A;  1FFV A;  3F2B A;  5KFG A;  3NGD A;  1NK0 A;  1X2I A;  3FDS A;  3M9N B;  4MF2 A;  3H4D A;  4YMM A;  4DL4 A;  1Z19 A;  2W7O A;  3PVX A;  1J2M A;  1Z3E B;  2NO4 A;  2HOF A;  3BS7 A;  5DLG A;  3ED5 A;  5AM3 A;  3OHB A;  4JV1 A;  3RRH A;  7ICF A;  3MC1 A;  2A3V A;  5KG5 A;  4PHE A;  2GLE A;  2PMZ F;  3SYZ A;  5AKJ A;  1NKE A;  3TAC B;  4I2C A;  2A1J B;  4F91 B;  4LZD A;  2KJ8 A;  1ZQH A;  8ICQ A;  2D6F C;  5KFE A;  3GII A;  2F8K A;  5AI0 A;  1ZXI A;  4CDG A;  1RZT A;  1J97 A;  9ICA A;  8ICN A;  4RQ2 A;  3J81 j;  5KT2 A;  3T5K A;  3KD3 A;  3WKC A;  3BS5 A;  3HX0 A;  2WF7 A;  4YXJ A;  2DKZ A;  5BOM A;  8ICZ A;  1SV0 C;  2ZIU B;  1ECW A;  3OJU A;  4Q45 A;  2ZTE A;  4ECZ A;  5AM0 A;  3H7I A;  1HUO A;  4BWJ A;  3WK6 A;  1XU4 A;  2FI1 A;  2GOL A;  4EBD A;  1B22 A;  4FFD A;  5C5J A;  1D9F A;  2KTQ A;  5KTQ A;  3K75 D;  1YZ7 A;  3F2D A;  2ZIV B;  4MFA A;  4GFJ A;  4O3O A;  4OCZ A;  3QEA Z;  9ICW A;  5AKE A;  1IXR A;  1ZQR A;  5AM5 A;  4BXO B;  3QX7 A;  5ALT A;  3KKA A;  4CF3 A;  1NZP A;  3HW8 A;  1U4B A;  4IS7 A;  4F8R A;  4KLG A;  3RFA A;  3ZD8 A;  3WK9 A;  3UXO A;  4MEX A;  1U45 A;  1KSP A;  3WK7 A;  3NS1 A;  2PMZ C;  5ALH A;  2K8C B;  4OJ5 A;  3ZD9 A;  2Y0S F;  2KVC A;  4OD0 A;  4CE6 A;  3MAB A;  2JH7 A;  4UAV A;  3F2C A;  4KLO A;  3KZX A;  2K60 A;  4YR0 A;  1TVA A;  4C8O A;  5J2H A;  3H0L B;  2KHQ A;  5KFF A;  1X66 A;  4DLG A;  1L7N A;  4RT2 A;  1S0M A;  1SKS A;  1YZ6 A;  8ICU A;  5DDY A;  5L1L A;  2ES6 A;  4PGX A;  9ICO A;  3NVW A;  3PW4 A;  2YQE A;  1JX4 A;  4DL2 A;  4I2H A;  4DSI A;  4ED3 A;  3IM1 A;  3UM9 A;  3UQ0 A;  3TAQ A;  3V6J A;  5DGA A;  4LVS A;  1IM4 A;  1JXL A;  4I27 A;  3GIL A;  8ICE A;  4PZO A;  1RYR A;  3N7R C;  3JPT A;  3MGV A;  3BQ7 A;  5KFP A;  2EZY A;  5DQH A;  1RQN A;  3SV4 A;  1L3T A;  4DQQ A;  4DOB A;  4NLC A;  7ICJ A;  4Y2J A;  1LB2 B;  4O9M A;  4YR3 A;  4DF8 A;  1KQQ A;  3CRX A;  3NTU A;  3M8S A;  3G6Y A;  3K1R B;  5ALO A;  5KG2 A;  3D2N A;  3CYM A;  4F5R A;  4EZ6 A;  1WG8 A;  3IP4 B;  3JPQ A;  4QWC A;  1NK6 A;  3KHR A;  1QSY A;  2W3S A;  1ARO P;  3AL0 B;  5KT5 A;  4B9M A;  2M9N A;  2JEJ A;  4F92 B;  3V6H A;  1RYU A;  4F4W A;  1V38 A;  2QB1 A;  4JV2 A;  2Y0S C;  1XNS A;  4YD2 A;  2PFO A;  5KFQ A;  2BZF A;  5AK6 A;  4EBC A;  3BQT A;  3EPI A;  3C29 A;  3V7K A;  1DRG A;  1S0V A;  2BR0 A;  3H8W A;  1XO0 A;  2K4P A;  3GV8 B;  4PL1 A;  4RQ6 A;  1WWU A;  3B0X A;  3I1Y A;  5DKW A;  1A0P A;  1SZH A;  1ZQC A;  2ASJ A;  5L1I A;  1QQ5 A;  1QLN A;  2HHV A;  8ICW A;  3FYH A;  3QUQ A;  4KLM A;  2NRT A;  2ZJA A;  2G5I B;  2C28 A;  1RPL A;  2I9G A;  4F4X A;  9ICV A;  2ZTC A;  3BQ2 A;  1XWL A;  5J0S A;  5KG6 A;  8ICH A;  5KFS A;  4Y2P A;  3NUQ A;  2XO7 A;  4R65 A;  4RQN A;  4PHD A;  4YN4 A;  5ALQ A;  1NOM A;  4IR9 A;  3TKA A;  3HWT A;  4X5V A;  3MR2 A;  1ZQZ A;  5TZV A;  2QKQ A;  2JMG A;  1ZQS A;  2XY6 A;  5CJ7 A;  2BCR A;  1M6Y A;  5EE0 A;  1KL9 A;  4ECS A;  2EZZ A;  1SKW A;  3F53 A;  3PSF A;  4ELV A;  1RXW A;  3ZDD A;  4M47 A;  4YMO A;  4XA5 A;  4BUG A;  4HAI A;  4RNN A;  3SR6 A;  2I6X A;  3F5A A;  4DEZ A;  3SAH A;  4O5E A;  7ICE A;  2GO7 A;  2OWO A;  4JWN A;  4DL7 A;  1SZP A;  5KFU A;  1ZQD A;  2LI6 A;  3M8R A;  9ICN A;  2PKE A;  2DGZ A;  4J9S A;  1SXD A;  4DFK A;  3DV9 A;  2KJ9 A;  5KFJ A;  4IQT A;  2DFL A;  3RR7 A;  3FC4 A;  4P4P A;  4IRC A;  3G6V A;  1KTQ A;  2VIX A;  4UBC A;  4NM2 A;  3OHA A;  3SEI A;  5EWE A;  3NRZ A;  5F3X B;  1X9M A;  1CRX A;  4NM1 A;  3PNC A;  1ZQN A;  4B9L A;  1SXE A;  1S5L U;  3N97 B;  2HOI A;  2ATL A;  2D3D A;  2RRD A;  4RPX A;  3RAX A;  4MHV A;  4MF8 A;  1ZQ1 C;  3TAD C;  3PW2 A;  2E8N A;  2O6K A;  3EW9 A;  5AI4 A;  4RQ8 A;  5DB9 A;  4DOA A;  1A6S A;  2DBY A;  2AQ0 A;  1NJZ A;  5DG8 A;  5D4B A;  1T3Q A;  2ZUD A;  5L1K A;  4P0Q A;  4EYI B;  4C7Y A;  3ZDC A;  1S0N A;  2G06 A;  2C2D A;  4DSJ A;  3SMV A;  2HBJ A;  1ZQM A;  5GTI U;  3GIM A;  1IIP A;  2K89 A;  1S8O A;  1NI3 A;  4Y2Y A;  4RQ3 A;  2AH5 A;  1QTM A;  2BCS A;  4CNQ A;  2VAN A;  1TV9 A;  4NWI A;  3LVV A;  2YY6 A;  4KLT A;  3IG5 A;  1BPX A;  2AJQ A;  4C8L A;  2R8K A;  5ALZ A;  2WHE A;  1L7O A;  1ZQF A;  2OH2 A;  2ZUC A;  3R9K A;  4QZF A;  3B9J A;  3FM9 A;  4GC6 A;  4CGZ A;  2G09 A;  3UXP A;  3M6Z A;  2NRW A;  1JRO A;  3UMB A;  1GO3 F;  1PK3 A;  2H3Q A;  2JEG A;  4F5P A;  5K4L A;  8ICF A;  2HHT A;  1N2X A;  2RP5 A;  4DFJ A;  3KHL A;  1H38 A;  4MFF A;  4JUZ A;  4ED0 A;  5AM2 A;  1L5U A;  4C4R A;  4P0Q B;  3PR4 A;  4Z6E A;  3E58 A;  4CF5 A;  3BQ0 A;  1NKB A;  4OJP A;  5EOZ A;  3UMC A;  5J2J A;  4USA A;  1QSL A;  3NAS A;  4YMN A;  5AIC A;  2KJ5 A;  4IC9 A;  5KT4 A;  4KLH A;  2KSO B;  1ZRM A;  3DEE A;  3SEN A;  4IQU A;  4BWM A;  2BQ3 A;  4CRX A;  1IG6 A;  4BJQ A;  2EAP A;  4UB1 A;  1S76 D;  4TQS A;  1X40 A;  3KZI U;  5HP4 A;  2DQN B;  4DSF A;  1Q8K A;  8ICY A;  2RDI A;  5CB1 A;  3AMZ A;  4KLS A;  2W9M A;  5AKH A;  4GIB A;  2YN4 A;  5KNI A;  5ALX A;  4KLQ A;  2B6G A;  5AKG A;  3RJG A;  3T5J A;  3UXN A;  5J0X A;  3BZK A;  2BPF A;  4B9V A;  4I2G A;  1N5X A;  3MFI A;  2A1J A;  4QJF B;  2KN7 A;  3PY8 A;  4DSL A;  1P7D A;  3TAP A;  3RAQ A;  2LM1 A;  1JUD A;  4KTQ A;  1BGX T;  7ICN A;  2F44 A;  1UT8 A;  1NKC A;  2ZIW A;  3LDA A;  2KFN A;  1BPZ A;  2XID A;  2K8B B;  2F1J A;  4RUA A;  1SV4 A;  2ZIU A;  2D8C A;  1DK2 A;  4Y2S A;  4EZ9 A;  2KVS A;  2G5H B;  7ICT A;  3BZC A;  4O3P A;  2ASL A;  2LKY A;  3RJI A;  5EE1 A;  5AKI A;  3H40 A;  4C4T A;  5B66 U;  5J0W A;  1U9L A;  4DWI A;  1XC9 A;  4C8N A;  4RQ4 A;  2FLN A;  3MR6 A;  4DFD A;  4F2S A;  4IQW A;  5J0R A;  2ZIV A;  4PH5 A;  4DLE A;  4IR1 A;  5J0Q A;  4UB3 A;  2I5H A;  3RJE A;  1ZQW A;  1ZQJ A;  2IHM A;  1XSN A;  3UPQ A;  2E1F A;  4BXO A;  1S77 D;  1WCL A;  5J2A A;  1SV0 A;  2EZX A;  3SZ2 A;  4ZH4 A;  3T79 A;  1UA1 A;  2QAR A;  3EUB 2;  1PVP A;  3A0B U;  3RB6 A;  1KW4 A;  2ZXH A;  5J2F A;  2AHO B;  2K4E A;  1KFT A;  3RRG A;  1BPB A;  5AIA A;  3U26 A;  1NZB A;  2ZIW B;  5J2I A;  3C1Z A;  4KLF A;  1RM6 C;  2FPL A;  3WK5 A;  3WKA A;  2JEF A;  2KG5 A;  4J9L A;  3QU2 A;  5KFM A;  5KAI U;  5KFK A;  1SIJ A;  4K4G A;  3HRD D;  2V4Q A;  1QSS A;  4NLG A;  3EZ5 A;  1QCK A;  9ICE A;  4R66 A;  3SQI A;  2PI4 A;  2W8L A;  1FFU A;  3MR3 A;  1EXN A;  3ISD A;  2IBK A;  5J2B A;  4ED7 A;  2ALZ A;  1X9S A;  4F50 A;  2DKX A;  1KKX A;  1CI4 A;  2W43 A;  5J0P A;  2W11 A;  5ALN A;  4B9S A;  5E79 U;  5KT3 A;  5H2F U;  4Y2R A;  3H0M B;  2PFN A;  1ZQA A;  4FZM A;  3RBD A;  3TI0 A;  3EYZ A;  3NRW A;  5KL1 B;  4US8 A;  1AQ6 A;  2QAR B;  3RTV A;  4O3Q A;  2HHW A;  5A0L A;  3KFU F;  4Q8E A;  2W03 A;  4PHA A;  4UAY A;  1BPY A;  5KFZ A;  9ICM A;  4FO6 A;  3D2S A;  2NYV A;  3RJH A;  4RPY A;  4QZE A;  2ISO A;  1L3V A;  7ICP A;  4GLX A;  4Z6F A;  5J2G A;  4ECQ A;  1T3N A;  2PFQ A;  2RHF A;  5HHI A;  4M2Y A;  4Y2Q A;  5HR6 A;  2R8I A;  1D8B A;  5AK5 A;  1ZD5 A;  1SWV A;  1SL2 A;  2HBL A;  2EDU A;  3C28 A;  4QZG A;  2OHF A;  2IA6 A;  1WCN A;  2OCE A;  2FPK A;  2DL0 A;  5DGB A;  4KX3 A;  3RF9 A;  4I2J A;  4J9P A;  2N1R A;  2LYA A;  2KIW A;  1COO A;  2W9B B;  5IIM A;  8ICB A;  3IHQ B;  5CR0 A;  4R63 A;  1Y88 A;  1SL1 A;  4RQM A;  4YD1 A;  9ICF A;  4UW9 A;  1ZQB A;  8ICP A;  4U7C A;  3OPX A;  2JR5 A;  3QUB A;  4JWM A;  1F5S A;  4F2R A;  4KIT B;  2KFZ A;  2PXI A;  1RG6 A;  2R8G A;  1OW5 A;  2FLL A;  2FJ6 A;  3JPS A;  3V72 A;  1T8E A;  2Y9U A;  5J0U A;  1NK7 A;  4K4I A;  2R8J A;  5DQI A;  1NJX A;  4ELU A;  2LM4 A;  2IOH A;  9ICH A;  4U6P A;  1S10 A;  1MA7 A;  1ZQP A;  3WKB A;  1F0M A;  1NNL A;  2JZB B;  4M9J A;  5L1J A;  3PW7 A;  2HHS A;  1DK3 A;  1LVH A;  4R8U B;  3JPO A;  4JV0 A;  3PX6 A;  3H8M A;  4NLN A;  3QU4 A;  1Q46 A;  4CF4 A;  5DLF A;  3T5L A;  4RPZ A;  2QLT A;  7ICI A;  1MN8 A;  4P4M A;  8ICT A;  3QU9 A;  2KE7 A;  3RJJ A;  5AI9 A;  1JMS A;  3L5K A;  1C7Y A;  3SAG A;  3JPP A;  2E8P A;  1NJW A;  2BDU A;  5CHG A;  2AGO A;  3PO4 A;  4TUR A;  4XQ8 A;  4RZR A;  2W04 A;  5GTH U;  1KFS A;  2ISP A;  1XS9 D;  4G3I A;  2LPE A;  4FS1 A;  2E3T A;  2FMS A;  1XSP A;  2AQ4 A;  3VC8 A;  4KN4 A;  2VA2 A;  1PVR A;  2MA1 A;  3RB0 A;  2YB1 A;  2CRX A;  4QIW F;  2W9A A;  5DBA A;  3TFR A;  5CP2 A;  5DBB A;  4MEY A;  2VJ5 A;  4ECV A;  2WFA A;  4TUS A;  4OO1 J;  1N62 A;  4M9G A;  4C80 A;  4UAZ A;  4PJ0 U;  2W54 A;  2NRV A;  4FBU A;  5J2K A;  2F3N A;  2KZM A;  1KBU A;  2B0C A;  1ZQI A;  4RQ7 A;  5J0O A;  2HVH A;  3S6J A;  7ICV A;  2KEY A;  2OM6 A;  2BQR A;  3AEV A;  3IN5 A;  5EWG A;  2BDP A;  3MGH A;  1JI7 A;  2FMQ A;  1X6I A;  2VJ4 A;  3WKD A;  3AU6 A;  1RYS A;  1DGS A;  3PR5 B;  1N61 A;  2W55 A;  7ICU A;  4RQ5 A;  4DQS A;  3HKZ F;  5KFO A;  1U47 A;  2DUY A;  4TUQ A;  2BCQ A;  5BPC A;  3KHH A;  1UHU A;  3AQF A;  5DB7 A;  1ZOL A;  4UAT A;  2KKV A;  3SD7 A;  1D8L A;  2H3V A;  4EX7 A;  4ECR A;  2DWQ A;  4B9N A;  1V85 A;  2JHD A;  5AK3 A;  2HCF A;  1FEZ A;  3LK9 A;  3Q8P B;  4ED1 A;  3N7P D;  5G5G A;  4OJ6 A;  1ZQV A;  4GXJ A;  5KFV A;  3TAD A;  2YMM A;  3BQ1 A;  4YCX A;  2M0N A;  5AM1 A;  3JPR A;  1ZD2 P;  4YQW A;  2KP7 A;  1HUZ A;  1S97 A;  2JH1 A;  4QIW C;  9ICP A;  2HOQ A;  2ODG A;  2HSZ A;  7ICG A;  2KD1 A;  3IG8 A;  1BNP A;  5KFH A;  4I29 A;  2YMQ A;  4F4K A;  2KZZ A;  1T4G A;  2IOF K;  3GV7 B;  3RH4 A;  4I2F A;  4Z6D A;  2BQU A;  4NLK A;  3B0Y A;  3QNM A;  3NVY A;  3PMN A;  5KG1 A;  3CP8 A;  3JPN A;  2G0A A;  4UAS A;  1NJY A;  2XC9 A;  5KT7 A;  1O08 A;  4QW9 A;  2H5X A;  1ZQE A;  1LKY B;  4P0P A;  4DSK A;  4DF4 A;  2XY7 A;  2XGP A;  3HKZ C;  2IMW P;  4EEY A;  2HI0 A;  2E8O A;  1K5O A;  2XIC A;  4LJX A;  5AM4 A;  3D2Q A;  5CWR A;  5DB8 A;  1TAU A;  2HBM A;  2KV2 A;  3H8J A;  4EX6 A;  5ALJ A;  1CUK A;  1PK1 B;  9ICT A;  4DL6 A;  3MBY A;  2A19 A;  2KSO A;  1WUD A;  3PSP A;  3H4B A;  4KX5 A;  4M9N A;  1ZET A;  2ZG6 A;  4YVZ A;  2ZIX A;  4NL9 C;  1MC8 A;  4IL6 U;  4I2B A;  5AIB A;  3PW5 A;  3LYS A;  4F4Z A;  1ZQY A;  3TAR A;  4B9T A;  2YB4 A;  3CW2 C;  2NRX A;  4UB6 U;  3F5E A;  2DF4 B;  5J2D A;  2VKQ A;  4I2E A;  5CA7 A;  3EWA A;  2FE9 A;  2F77 X;  4ZOH C;  4C4S A;  5DB6 A;  3QE9 Y;  1N60 A;  1FO4 A;  4NJ8 A;  4M6W B;  3FAH A;  1SKR A;  4K4H A;  4KLJ A;  4QNL A;  4P0P B;  2QB0 B;  2VA3 A;  3AU2 A;  3PX4 A;  4YP3 A;  5J8Y A;  2DPJ A;  1JXE A;  8ICA A;  2YX8 A;  2F76 X;  4DOC A;  5ALK A;  1ZYQ A;  4BDP A;  2ZUB A;  4JK1 A;  3KTQ A;  3AM9 A;  3OTQ A;  1ZQO A;  4UAW A;  1JIH A;  4P2H A;  4J9N A;  5IIN A;  1B4F A;  2WTF A;  4UAR A;  2ZIX B;  3OJS A;  8ICV A;  2GH1 A;  2K4I A;  3C5G A;  3M7D A;  5KT6 A;  5EE9 A;  3PML A;  5HMM A;  4LZG A;  2WF9 A;  4F5O A;  2NRZ A;  2Q0Z X;  4DQR A;  2F2A B;  3AQE A;  1L7M A;  4ECY A;  2F8L A;  3TQ1 A;  4F4Y A;  5AI8 A;  2H3Z A;  4C0Z A;  5EWF A;  1UPH A;  2Y9T A;  4NLZ A;  2V4R A;  3GFK B;  2IHN A;  4KLI A;  5ALF A;  4KMO B;  2ZTD A;  2RLT A;  8ICX A;  4QWA A;  3GDX A;  4C8M A;  5D46 A;  1VJ5 A;  4ECX A;  2BHN A;  3KHG A;  2K4H A;  4EEN A;  3M6K A;  1ZJN A;  4UB2 A;  4DFP A;  1ZQG A;  1TE2 A;  4F5Q A;  3OGU A;  2JGA A;  7ICK A;  1WWV A;  2E1E A;  1O03 A;  4I28 A;  4NXZ A;  3GIK A;  3SI8 A;  2W8K A;  2UVV A;  2W9C A;  3LVW A;  4GXK A;  5TIS U;  4XUS A;  2Z7J A;  2BGW A;  3OSP A;  2WAQ F;  4PGQ A;  1BPD A;  5ALI A;  2C22 A;  3H8S A;  4I2A A;  3Q8Q B;  4FE3 A;  5ALP A;  3ALR A;  3HIL A;  4O3M A;  2C2R A;  4O5K A;  4QWE A;  1VLB A;  2BKE A;  5CEH A;  5KFI A;  2FPM A;  4UB4 A;  1QQ6 A;  4FZN A;  2WF6 A;  5JUM A;  3ZDA A;  1ZQX A;  3C5F A;  5AKK A;  2AXT U;  1A77 A;  3WKE A;  5L1M A;  4DS5 A;  3QU5 A;  5KFW A;  3RB3 A;  1TK5 A;  7ICR A;  2PFP A;  9ICU A;  2WB1 F;  2LMR A;  4KLD A;  4M9L A;  4DL3 A;  1N5W A;  1TAQ A;  1IV8 A;  1URJ A;  2UVW A;  5KFX A;  3G6X A;  1ZRN A;  3ZDE A;  1DOQ A;  4QW8 A;  4DFM A;  4O3N A;  4ECT A;  2H3I A;  2JV3 A;  2XY5 A;  5KG0 A;  2W9C B;  1JN3 A;  2Q4T A;  2XI9 A;  5ALE A;  4QWD A;  1KDH A;  4ED6 A;  3IV6 A;  4DL5 A;  3HP6 A;  9ICR A;  7ICM A;  4F5N A;  3ZI4 A;  1L8O A;  1ZQK A;  2W9B A;  4C8K A;  2XCA A;  3QYP A;  4KLU A;  3L3F X;  3T3F A;  4FBT A;  4J9O A;  2P6R A;  1MQ2 A;  5KFL A;  2RQ5 A;  2WAQ C;  2G07 A;  1HIW A;  3M1Y A;  3AN1 A;  3HJE A;  3GV5 B;  2C2E A;  1UQV A;  4Q8F A;  2EAO A;  2MU2 A;  1MQ3 A;  5AKY A;  2KKP A;  5AKZ A;  2ESE A;  2XVT A;  2E8M A;  4ICA A;  4UAU A;  5KFA A;  1J2N A;  4B9U A;  3UMG A;  1MSW D;  2L5Y A;  1K1S A;  4RQ1 A;  3Q8M A;  4EBE A;  5III A;  4IRK A;  4Q44 A;  3MR5 A;  3MDC A;  2JZB A;  5IIL A;  3PZP A;  2CXY A;  2H3F A;  4M0A A;  3C2M A;  4R8U A;  5T14 A;  4HYK A;  5D49 A;  5HHH A;  2VA8 A;  5JRT A;  2HBK A;  3C23 A;  2YMP A;  2WB1 C;  5AI6 A;  1ZD3 A;  1V9P A;  1KFD A;  5L9X A;  4UB8 U;  3BS5 B;  4ED2 A;  2MAX A;  2PI5 A;  9ICG A;  2I1Q A;  2HHX A;  3ETR A;  3KKA C;  2KIV A;  1Z4O A;  3TFS A;  4QZC A;  1K1Q A;  1SB3 C;  2FMP A;  1S9F A;  4O3S A;  3RJF A;  3ISC A;  5ALL A;  3WU2 U;  5J2C A;  3ZDB A;  8ICG A;  1UA0 A;  5ALS A;  4QZI A;  3QZ7 A;  1BPE A;  1X9W A;  5C0Y A;  3QU7 A;  2Y1J A;  3WK8 A;  5DBC A;  4Q43 A;  2ASD A;  3MGI A;  3LWL A;  3KBB A;  5DDM A;  3QUC A;  5IIO A;  5AKL A;  4Y2U A;  4RQ0 A;  5HML A;  2LYB A;  4JMU A;  3PV8 A;  1N48 A;  4DQI A;  1TKD A;  3WK4 A;  4QZB A;  5KFB A;  2AU0 A;  3K4G A;  4TUP A;  2P6U A;  2EAN A;  1TAM A;  3O0F A;  1RDF A;  3AUO A;  4J9Q A;  3RBE A;  4GXI A;  5ALU A;  4ECW A;  1L3S A;  4DSE A;  1LV5 A;  3C21 A;  4Y2V A;  4F72 A;  5FP0 A;  2KOB A;  3PO5 A;  4C7Z A;  4GC7 A;  1NK8 A;  9ICJ A;  1C20 A;  1COK A;  4QZ8 A;  3V6K A;  1Z1B A;  1PUZ A;  1ZQU A;  5DG9 A;  3N7S C;  4OJL A;  2J6T A;  8ICJ A;  3A0H U;  5J0T A;  4R64 A;  4WJ3 B;  4YFK A;  2BPG A;  1X42 A;  4E0D A;  3N4M B;  3RH6 A;  5KFC A;  4QZD A;  1KEJ A;  1D9D A;  1NK5 A;  2E5S A;  5ALW A;  3DDH A;  1XO1 A;  1ZQL A;  2YTU A;  4PGY A;  8ICM A;  1FIQ A;  3K1Z A;  3BJY A;  2B21 A;  7ICS A;  4Y2T A;  4I2D A;  7ICO A;  8ICO A;  1Z1V A;  2V9W A;  2KZ3 A;  1Q3U A;  3GQC A;  3RB4 A;  1YT3 A;  4Z6C A;  3Q8K A;  2W7P A;  1JRP A;  2BCU A;  4M9H A;  5G5H A;  2P35 A;  4IQV A;  5J29 A;  5JU5 A;  1KRP A;  1L8L A;  3QZ8 A;  4KLE A;  5KG4 A;  5DG7 A;  4AP9 A;  1ED1 A;  1SGG A;  3PSI A;  5ALY A;  1X6J A;  5HNK A;  1LKY A;  4UBB A;  1ZQQ A;  9ICC A;  5HR7 A;  7ICL A;  3MDA A;  3BDP A;  1X9X A;  2BCV A;  2NV3 A;  3PW0 A;  4M04 A;  4YXM A;  4F3O A;  2MUT A;  1L7P A;  5KAF U;  4DCC A;  2AGP A;  4NLB A;  5F9N A;  1PK1 A;  2KK0 A;  3EPG A;  5ALV A;  3E2E A;  4RU9 A;  2JRZ A;  4ELT A;  3GIJ A;  2IOF A;  8ICS A;  5IIK A;  1U49 A;  4BGD A;  3D6J A;  4J9M A;  8ICK A;  4OJO A;  4ACO A;  5ALM A;  4A8E A;  2KHV A;  2ZJ8 A;  5J2E A;  5AK4 A;  2RDJ A;  3GZF A;  4QWB A;  2UVU A;  1F44 A;  3TAN A;  5KL8 B;  4US9 A;  1N63 A;  5KFD A; 
#chains in the Genus database with same CATH homology
 3IDW A;  2E8O A;  2YTU A;  5L1M A;  2EAM A;  3BS5 B;  1RG6 A;  1V38 A;  1JI7 A;  2QB1 A;  1OW5 A;  3KKA C;  2KIV A;  3KKA A;  1OXJ A;  2LMR A;  1PK1 B;  1Z1V A;  4IS7 A;  2Y9U A;  1SXD A;  2QB0 A;  2KSO A;  1PK3 A;  2F44 A;  2DKX A;  2K4P A;  2Y9T A;  1DXS A;  2JV3 A;  1F0M A;  4NL9 C;  4NL9 A;  1WWU A;  1SV4 A;  5JU5 A;  2D8C A;  3SEI A;  3H8M A;  5F3X B;  1V85 A;  3BS7 A;  1SGG A;  2K60 A;  5J8Y C;  1SXE A;  2D3D A;  2GLE A;  2QAR B;  1UCV A;  1X66 A;  4MHV A;  2FE9 A;  4PZN A;  1LKY A;  3TAD C;  2E8N A;  3TAC B;  3TAD A;  2KE7 A;  1X9X A;  2ES6 A;  1WWV A;  4NJ8 A;  2F8K A;  2E8P A;  2EAN A;  2QB0 B;  2KSO B;  3BS5 A;  1UQV A;  4RQN A;  3SEN A;  1B0X A;  2EAO A;  2LPE A;  5J8Y A;  5JTI A;  2DKZ A;  2EAP A;  1PK1 A;  1SV0 C;  1SV0 A;  1X40 A;  2ESE A;  1COK A;  2E8M A;  2QKQ A;  2QAR A;  4PZO A;  1KW4 A;  3BQ7 A;  2L5Y A;  3HIL A;  2DL0 A;  5KNI A;  2B6G A;  1LKY B;  1B4F A;  5JRT A;  2F3N A;  3K1R B;  2KMD A;  4RQM A;  2KG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...