4EELA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound citrate and sodium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
229
structure length
229
Chain Sequence
DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords Beta-phosphoglucomutase-related protein
total genus 81
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eelA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eelA01
2OA0A 1RMYA 4KNVA 1N8NA 1Q91A 1Z4OA 1YNSA 3ET5A 4F72A 3DDHA 3L8HA 2YMQA 5AKXA 3PCTA 3SKXA 2JARA 4O8CA 3ZTWA 5IT0A 3QNMA 1VJ5A 3ESQA 1WPGA 3WK7A 3WKCA 2G07A 1S2OA 2HDOA 5AM5A 3PGLA 2NO5A 2D2VA 1U02A 2RARA 3NUQA 3NAMA 4XE5A 5AW7A 5ALRA 5AVRA 4CF3A 3N5KA 2YJ5A 3ESRA 2FPUA 4HGRA 3QU9A 4Y2PA 2BDUA 2WF8A 5AI9A 1IWOA 5T41A 3KZXA 2IOFA 2FPRA 4BEWA 5AHXA 3E58A 3AR3A 3S6JA 3FZQA 1X42A 1ZJJA 1J8DA 3U7HB 2JAUA 3SF0A 5ALKA 1Q92A 5AK3A 5ALMA 4QJBA 3ET4A 5AVYA 3VAYA 5ALUA 3MPOA 1XPJA 4I9FA 2I55A 2MU1A 2YN4A 4EX7A 1ZD2P 3QUBA 4E88A 2HF7A 3L0CA 3D6JA 2W43A 5AM1A 4EELA 2HF2A 5AK5A 3ED5A 2QLTA 2B1QA 4GIBA 5AIAA 3A1EA 1QQ5A 4BBJA 5AI0A 1RQLA 1TJ4A 3HLTA 3ZUPA 2YMLA 4DCCA 2HOQA 2VKQA 5AKLA 1YDFA 4AP9A 4G9BA 4Y2TA 1NF2A 1ZRMA 4KX3A 3W5BA 5AKKA 4AS2A 4DW8A 1PW5A 3L1UA 1K1EA 1S8OA 2ZBDA 3N1UA 5AKJA 3NIWA 4XPZA 1QQ7A 3UMCA 2OM6A 3K1ZA 2YMMA 1XVIA 1T5SA 1L7NA 4UASA 4CE6A 5AM0A 1VFPA 3A1DA 4Y2XA 3EWIA 5ALSA 3B9BA 2PQ0A 5AVUA 2CFRA 1RLTA 4UARA 3KDPA 1TJ5A 3DAOA 4HYTA 3NANA 1ZD4A 2I7DA 3WKEA 2FUEA 3A3YA 1LVHA 4Y2JA 4DFDA 2B82A 4NV0A 1TJ3A 3L0BA 5AW2A 3WK6A 3J7TA 3TLMA 2NYVA 3HYCA 2HI0A 2IOFK 5AK4A 4UAVA 1CR6A 2G06A 2FDRA 2HEGA 3RF6A 5A3RA 2RAVA 4CF5A 2C8LA 4KX5A 4BX2A 2FUCA 2G0AA 3WKAA 3N8GA 2GMWA 5AVTA 5AW9A 3N07A 5AESA 3QU4A 4CF4A 1YV9A 4UW9A 3OCYA 3ZX4A 2Q5EA 4QQFA 2OYCA 3NRJA 3OCZA 3ZU6A 1U7PA 4ZEXA 2EAUA 2B8JA 2YJ6A 1L8OA 1U2SA 1U7OA 4Y2QA 3UMBA 2PR7A 2I34A 4UATA 5AW8A 2MSNA 1L8LA 2C4NA 2YFYA 3OPXA 5ALGA 1WR8A 5ALHA 2IOHA 4HGOA 1QYIA 5AIBA 2RB5A 1ZD5A 2R8ZA 4KYTA 4RESA 3SD7A 1Z4LA 2B0CA 5ALWA 5AKEA 5AI5A 3PDWA 2CFSA 1EK1A 2AH5A 3W5CA 2BDEA 2AUTA 3QU7A 5A3QA 2FPSA 1NRWA 1RQNA 1Z4IA 5AK6A 3ZVNA 4C4SA 3U19A 3E84A 4IFTA 3GYGA 3OCVA 3WK9A 3ZVLA 3ZX5A 1RKUA 1Z4PX 3IRUA 2GHQA 1RC8A 5AI6A 2GO7A 1L6RA 3AR6A 3M1YA 2ZG6A 4Y2SA 2P27A 3ZWKA 4BKMA 3F9RA 5IT4A 4EENA 4XQ0A 1ZRNA 2R8YA 3R4CA 3AR8A 2B8EA 3L7YA 2R8EA 3NALA 5ALOA 3U7EB 2FI1A 3M9LA 5ALIA 2FPXA 4C4TA 4FFDA 2P11A 4BX3A 5AM4A 1YMQA 3ZTYA 5ALQA 2O2XA 3I28A 5AVXA 2RBKA 4FYPA 4DWOA 4ZEVA 2G09A 3QUCA 1U2TA 1QH9A 2C8KA 3QU5A 4UU0A 3EPRA 1N9KA 2WF9A 5ALZA 2YBDA 5AKZA 3KD3A 4YCLA 1Z88A 1RKQA 1Z4JA 2EATA 3I6BA 4G63A 4UM5A 4YIKA 2IA5A 4BEVA 3AR9A 4Y2YA 3MN1A 3AR5A 4HAIA 1Z5UA 3IJ5A 4NAVA 4Y2RA 5AW3A 3BWVA 2G1AA 4NABA 1TA0A 1Z4QA 4XOUA 4YCNA 3QUTA 1T9ZA 2EARA 3WKBA 3AR2A 5A3SA 2HCFA 4BYGA 3DNPA 1RKVA 1RLOA 1WZCA 2HO4A 3R9KA 2QYHA 5AKIA 2WM8A 4NFLA 4JDPA 3OTQA 5ALVA 3UM9A 3OCUA 4UM7A 3WK8A 5ALNA 5ALLA 2CFTA 5ALDA 3KOOA 2O9JA 3MMZA 2AMYA 2I54A 3ZI4A 1RMTA 4J03A 3PGVA 3WGUA 4UMVA 4OFZA 2HHLA 3EF0A 3L0YA 2WHEA 4OHFA 3QU2A 1L7PA 2G08A 4YH1A 1CQZA 2JAOA 2G80A 1RMQA 4UAUA 4GXTA 3P96A 4EZEA 3L8FA 5AVSA 3ONNA 2GHTA 2Q4RA 3QGMA 2I33A 3I76A 2ZOSA 1SU4A 1WVIA 2BY4A 4C4RA 3ZVMA 3AR7A 2MU2A 4FE3A 1XP5A 5AW4A 2HX1A 1T5TA 3ZW7A 3KC2A 1FEZA 2YMPA 5ALFA 2ZBEA 3QYPA 4YGYA 3FPSA 3NASA 2OBBA 3R09A 4YIHA 2B1RA 3MC1A 1J97A 2YY6A 1NNLA 4MWOA 4BX0A 1F5SA 1YS9A 2GFHA 3B9RA 4J2TA 2P9JA 1RPZA 1O03A 1Z4NA 3FVVA 3W5AA 2WF5A 1YJ5A 5ALTA 3SHQA 4OCZA 4EX6A 1Y8AA 1TE2A 5AVVA 2FEAA 5AKGA 3BA6A 5JJBA 3DV9A 2CN1A 2R8XA 3QLEA 4UU1A 4RETA 2NO4A 1ZD3A 5AI8A 4HGNA 2FPWA 4EEKA 5AW0A 3QX7A 4Y2VA 5E0OA 2AGVA 4L6CA 2WF6A 5AKHA 5AW5A 2ODAA 5ALPA 3WK5A 2X4DA 2WFAA 5AM3A 3U7GA 2JAWA 3SMVA 2JGAA 3EF1A 4MUMA 1QQ6A 2YJ3A 3RFUA 4OD0A 3L8EA 1AQ6A 2C9MA 5AVWA 5ALEA 3B8EA 4F71A 3U13A 4JB3A 4AS3A 3ZWDA 1Z5GA 3KBBA 4UMFA 1JUDA 2PKEA 5AICA 1O08A 3I1YA 2WF7A 2DQSA 1ZS9A 4NWIA 4KNWA 1Z4MA 5AM2A 2B30A 4BNDB 3FM9A 4CNQA 5AW6A 3WK4A 3L5KA 3A1CA 4IG4A 4ZEWA 4I9GA 2IYEA 5FP0A 5AI4A 4UMEA 3L8GA 1LTQA 3L1VA 3E81A 1RRCA 5ALXA 3AR4A 4B6JA 5ALYA 4L6AA 3OCXA 1L7MA 1ZOLA 3CZ4A 4YCMA 2I6XA 4UMDA 3U26A 1RLMA 3WKDA 1RDFA 5AW1A 1KYTA 3U7FB 4Y2UA 2ZBGA 1EK2A 2W11A 5AVQA 3QUQA 3W5DA 3QXGA 4KN8A 3SKYA 1MH9A 2ZBFA 4PNHA 1SWVA 3CNHA 4L57A 2C88A 4BNDA 4HGQA 3UMGA 1Z4KA 3N28A 5AVZA 5IS2A 3FGOA 4HGPA 3IB6A 5AKYA 3E8MA 1L7OA 1SWWA 3FPBA 2Q4TA 1VJRA 2YJ4A 5ALJA 3SLRA 3OCWA 3WGVA 2ZXEA 4H1WA 2HSZA 2P69A 4Y3UA 2W4MA
chains in the Genus database with same CATH superfamily
1LF0A 4A0QA 4TLLB 2WB2A 1ZETA 4RFVA 1NVKA 2LCIA 4TWZA 5BYAA 4B3SB 4H7DA 4MW9A 4KKVA 1IMJA 2GESA 4RT2A 1N9ZA 2ASLA 1ULZA 4MVXA 2XCOA 1E1DA 1W4ZA 2D5AA 2RJNA 2ZQYA 4RA9A 1EUYA 1U0NA 2NTYC 2VC2B 3C5HA 4FEYA 4DVGA 1UJ6A 1Z0FA 4WZBB 4D3YA 5GJCA 4DQXA 3LBYA 5J2EA 3DHEA 1EBUA 3VX4A 5FPSA 2B6GA 3IVGA 3LOPA 1WVGA 4QC2A 5EZSA 6Q21A 1UKCA 3S8EA 4IQFA 3V00A 1W1UA 2H3IA 1VI2A 2EDAA 3PGLA 4IDPA 2AYXA 1Z33A 3O0DA 3V9AA 5JNLA 3NORA 4PGFA 3TUJC 4ARZA 1UXIA 5HJ2A 3EPKA 1F2DA 4DR2B 1BWPA 2XI4A 1YHZA 3MRSA 2WJ4A 4E3WA 4S1TA 2YIMA 4HNAB 3KP1A 4LYEA 2PG3A 3CQ9A 1ENOA 2IH2A 2ZRCA 1Q5PA 3GDGA 1SXJC 9ICOA 3AUAA 3M6VA 3P27A 4MHSA 4YFYA 4BNKA 4BVFA 3VOBA 3SYNA 4H7IA 4MW6A 1L0BA 5DPMA 1F1BA 1PD0A 1TCUA 2DUWA 2YVQA 4D9JA 4D4MA 1A95A 1GPAA 2R4QA 1OXJA 1DC5A 2VT6A 3HGTA 5EWFA 2WM3A 4IPTA 1T9GS 4UBJA 2LHTA 1C3JA 4L5CA 4CCAA 1Q92A 3HB7A 1S9HA 3EVTA 4U0JA 3SXUB 3OLQA 1DTWB 1HT0A 2DWOA 1JFFB 1JG1A 1XCLA 3STWA 4ECXA 5ALUA 3VAYA 3DAGA 4F3RA 1CHDA 3TSWA 3R9WA 3E27A 1SA0A 3SJZA 4D26A 4MQ6A 1JW9B 3ZWAA 4A27A 1E3JA 1PJCA 3M6ZA 4HHEA 1DWUA 4HQ6A 4UMVA 3V8EA 4YVZA 2QZSA 3ED5A 2H17A 4WWHA 3ADOA 4ID9A 1DB3A 4NCXA 4TXLA 3E9YA 2Y1EA 5AIAA 1TQHA 3CINA 1HWYA 1QE0A 4I50F 4NYMQ 5AI0A 2PL3A 1E99A 2GN0A 1N0VC 1TJ4A 4Q7EA 3CKMA 1JXEA 2YMLA 1GA4A 2OO7A 3P2KA 4K86A 4NNPA 1A7UA 1U8EA 2IYYA 2VF5X 4UB6U 2XGOA 3DLCA 3RUPA 2R44A 3SM9A 5K5EA 3WGYA 3CF2A 2JBHA 3MBIA 3OZEA 2OYRA 1AXRA 1VCIA 4DMUB 4B45A 2XDWA 1USGA 3GJQA 4FS3A 3PJFA 1UPXA 1E6LA 5JARA 5IIJA 1CT9A 4EPWA 1AK9A 4US8A 5KQLA 3NBUA 2V58A 1PVRA 4J9VA 5IN4A 3GJTA 3NRWA 2CC2A 9ICFA 1RWOA 2VAVA 5EIXA 4LA4A 2BZ1A 4X24A 3R0QA 5ECWA 3K1ZA 2NZ2A 4BVLA 3RJGA 3AM3A 4QDOA 2CJWB 3H1TA 3V8PA 3RAXA 2GF9A 5I4KA 2YDXA 4PZZA 4ZRMA 4AY3A 6ADHA 4C8KA 5A6SB 3UV7A 2C5FA 3GLGB 4KQKA 4EKEA 1H0HA 1USIA 3U9SA 4RHUA 5CB4A 3I37X 2PQ0A 4BB6A 3N7RC 1B76A 3RWOA 4F4YA 3V4PB 1NQWA 4NKRA 3CKKA 1ZD4A 2EIHA 5AFSA 5FBRB 1C7YA 2DUYA 4ZOLB 5J2FA 1QYWA 1Y8ZA 4KQ1A 2C8JA 3C7KA 3CLVA 5EJ4A 3DMGA 4LY0A 2K4HA 4WADA 1NOKA 4PQYA 1PJAA 5FWAA 4FS1A 1HDZA 4OLBA 3MWYW 2O4UX 1QRSA 1OH6A 1OKKA 2OR3A 3S8MA 3FAHA 1DMSA 5EE1A 4QZHA 4LHXA 4XZ3A 5BQOA 2QUIA 4BFUA 4D3FA 3U31A 1VMAA 2GBIA 2RQ5A 1ULHA 3MTDA 3G9XA 2WMNB 3IOYA 4J0QA 5I9SA 4QATA 3RF6A 5J5CA 4YMHA 1PYOA 2H1HA 1VA4A 2A88A 4Q8EA 4QX6A 1ZYUA 2QZ9A 3W9UA 4KX5A 3ZTTA 3K1RB 5B2ZA 1PFYA 4KTVE 2OFXA 4LE0A 3MHTA 1JHOA 2IYPA 5FEUA 1P9LA 3ZY2A 1BW9A 1Q0UA 1W25A 1N92A 1YV9A 1ZN2A 2P9FA 2ZZKA 2C0QA 1P61B 2RKBA 3NW9A 3SF8B 3BWDD 2QG9A 2P2SA 3AHGA 4YRTA 1OILA 5FNVA 1BRTA 2WG1A 8ICUA 3EA4A 1RG6A 4RLQA 2B2CA 3JPNA 1HUZA 2X15A 3O8OB 2KVCA 1Q3HA 3N0WA 1GKLA 2LIVA 3B7GA 3NC1C 2CXQA 5HMLA 4YMOA 1WW2A 5JNUA 1WEKA 3O4RA 3L7BA 5KFRA 2GCOB 3PJDA 4R01A 3TVYA 5HE8A 2YJ6A 3L49A 4F1JA 2MSLA 4NXNB 1CB7A 4O0IA 1XP8A 1XMXA 4EYIB 2DQNB 4FD2A 1CNMA 521PA 4F45A 2OZEA 4KV7A 3SCZA 4DS3A 1GY8A 3DTVD 3NRZA 3KHLA 5KFIA 4QZGA 4HBZA 1X3SA 8AT1A 1WYGA 5AIBA 1E7QA 3ZDCA 2BM8A 2X14A 1ISRA 3O8CA 1LWNA 4YRBA 4M54A 2GBGA 2IW1A 2NO7A 4WBXC 5ULLA 5ADUS 3UJNA 1DZIA 4ITRC 3VRHA 2CFSA 3GCZA 3JPOA 1IM8A 4O6VA 3N2IA 3SFTA 1ADFA 1DRVA 4JH0A 5EZYF 4LDNA 4BPBA 4IKEA 2YZGA 3G1UA 1QP0A 5M34A 3TL6A 2XQJA 2OMKA 1D2HA 5BPCA 3D6AA 3R7WA 4AZ0B 5G3ZA 4QTTB 3RS9A 4ZVKA 1PL7A 2GD1O 1K0UA 1U94A 3R44A 4N3BA 2I0FA 1G59A 3H86A 3ZGYA 1DBWA 2FFHA 3EFBA 3K9BA 4N6OA 4DSTA 2JLRA 4MV6A 4ZAZA 3GIIA 5DI9A 2JCYA 1PLLA 3NATA 4FOOA 2GCNA 4M49A 1WEHA 3MR6A 3AR6A 1K6IA 3FYCA 2QBYB 3AUXA 5FBZA 4F3YA 1KZ9A 4HWPA 3OCCA 2PUVA 2Y0SF 2QUAA 3T52A 4YMTA 4YJHA 4W7HA 3TI9A 3THRA 3VTAA 3ROXA 1N5LA 2JH7A 5BN3A 3AR8A 2HBJA 5A6VA 1QIEA 4L7VA 2WHQA 2O8BA 4ZH4A 2OUKA 2SKDA 8ICRA 1QGYA 4O5AA 5CD9A 1STOA 4A1FA 5GTIU 4KFUA 4LOJA 2Z0MA 4DZRA 1UFQA 4UZEA 5B1SA 3SYRA 3CSSA 3SAGA 3HL4A 3GEPA 4P6VF 4WLFA 4A0HA 4UBOA 4ZIRB 4DSKA 3AEKA 2O2XA 3AEVA 4WKOA 3O3OB 1PGJA 2VQFB 4RGQA 4KQGA 2G09A 3DQQA 1JMSA 1N62A 1KK1A 1V1JA 2J6BA 2ZKIA 3ETGA 3D43A 3FN4A 3BWCA 3QHPA 1P6XA 1U3DA 2C8KA 2IUYA 3QU5A 2OD7A 3EPRA 2CYAA 2QMEA 2ZYWX 4IDAA 5TMPA 1N5WA 3HEMA 1JB1A 5JT1A 4ZKEA 2ECFA 1DKMA 5CHEA 3WSVA 5LOVB 1FXWA 1YKSA 4ZVMA 4BX9A 2CNWD 1PSWA 2QARB 1S3IA 5K6RA 6ABPA 1JWLA 3ZW9A 1TI7A 1YK0A 2O8DA 1ZNZA 1V11A 2ZT5A 4G63A 2I2WA 4TXJA 2XOXA 3R7BA 2V9WA 3F7OA 4ZVVA 2POCA 2Y68A 2BFFB 1XRJA 1L7XA 1QQTA 1KDYA 1DI0A 1O87A 5C18A 2OCEA 1ZH0A 4RZ2A 1AE1A 1KS9A 1OWPA 3IJ5A 3KG2A 2DQKA 3DLTA 1S2DA 1F6DA 4DCPA 1U9ZA 3EDRA 1ES9A 2AFIE 4QFDA 4ZTZB 2VHCA 1GILA 1GSHA 4JX8A 4MB2A 4X1IA 1GYRA 3OC0A 4KLOA 4O29A 4YRNA 5J4YA 5DGCA 1GO3F 2FJPA 4J7CA 3T94A 4WXHA 1TJPB 4UXIA 3DDWA 3ESYA 3WIUA 3R9KA 2JFHA 4G24A 3PGMA 1L1QA 2H5IA 2WM8A 5L7WA 3QMWA 1Y9JA 2BV3A 4IW3B 1HT2E 3DEJA 2ZB3A 4UM7A 5ANRB 4FX2A 1TK3A 1WB9A 2BFDA 2PX8A 4BZZA 4ZZ0A 3C6QA 3CYMA 3FHOA 4I19A 4F8EA 4ARZB 3HA5A 1NN5A 2FZLA 3BGIA 3NP9A 1NOMA 1M1ZA 4W1PA 3SYTA 1TTTA 3GCXA 3LNCA 4FFWA 4FJ2A 4K9SA 3I9KA 2AJDA 2OZVA 2MUTB 4C6TA 3KSAC 3CUYA 2ZFUA 3IJEB 2ZWIA 3AILA 1WB6A 3C45A 3LP6A 4TV8B 1G3QA 5C31A 3ISBA 3IHWA 3NOVA 4QEDA 3M8SA 4TGLA 1G41A 3KHGA 2AC7A 4YPFA 1M66A 4HATA 5KNIA 1I4DD 4QTUB 3K30A 3QQPA 4XWTA 4R7GA 5EQTA 4DJEC 4EZEA 6GPBA 4CW7A 1SXJB 2JFQA 2YRFA 2HA6A 2R47A 3I6ZA 3TQHA 4QOEA 1AD2A 4Y0VA 4F5QA 3FGNA 2I33A 3TLEA 1GGJA 1Y5IA 3GGPA 3T34A 1EDBA 1F6WA 2CJXA 2ZOSA 4V02A 4EHFA 2JI6A 2XE4A 5TS2A 2JIQA 2O20A 3M89A 5A4JA 3GO4A 4EZ9A 2AXQA 3F6YA 4O2BF 4C4RA 2R1TA 4AG3A 1D09A 4Q19A 2ERXA 4QRDA 5J2UF 2PX0A 4ZHSA 2BONA 1SZHA 4HNVA 3GMSA 1MQSA 3I4LA 3K6RA 3D6HA 2BM0A 2V4ZA 3DMDA 1WO8A 2K4IA 2BKLA 4TLDA 3DFZA 3GD5A 1MFPA 2VIIA 4J0DA 1XT6A 3QYPA 3FPSA 3H04A 1Z6ZA 3EZ2A 2LKCA 2UVDA 3HGQA 3HP1A 2XB2A 4RV9A 5JUWA 2FN8A 2LKDA 3X44A 9ICIA 1E1CB 1KYQA 3H2ZA 5K7SA 5EIAA 3RT9A 4C0ZA 4LHSA 4YCXA 2OEPA 2RHHA 1Y80A 1EG2A 3B9RA 3PRJA 2QM8A 4BNWA 5KPDA 3AZPA 1PG0A 4KU4A 1U0LA 1M6WA 4CMKA 1QM5A 1LBEA 4HLNA 2XEDA 3DT6A 3F6BX 1J22A 1LI4A 2C4KA 3EVZA 1DO2A 1GNRA 2VATA 2FLPA 1NF8A 2EX0A 3EVBA 1I4TD 1EEHA 2NYRA 1D2MA 1XDUA 2ZSJA 3OJLA 4LYJA 2B69A 2EOAA 5ERXA 3BZBA 1PS9A 2BEWA 2EZTA 2VTKA 1PQUA 4HZGA 5JJKA 1FE8A 2FTKE 4V0KA 1S2MA 4K88A 2D5LA 2LD4A 2WLTA 8ICVA 4KLZA 4OQ4A 2ZSFA 2EGUA 1C7EA 5E79U 1GZDA 2O5VA 2XNHA 4J0GA 4TXNA 4UU1A 1PBNA 1AZSC 1N2BA 2AN3A 4FGZA 1YGYA 2NO4A 1OI3A 4HGNA 1XN4A 3D59A 2BFPA 4D80A 1E4EA 4OXKA 1R0ZA 5LA6A 3GFVA 4B46A 3C3EA 2NSYA 4UOEA 2ZULA 3T4XA 4JR1A 2VTDA 4AJPA 5E6SB 3EZ6A 1EFKA 1XO0A 5EHIA 3EF1A 5AJVB 5KYWB 3PK0A 3PNKA 4BLSA 1FNCA 1PN3A 2IHBA 1CY8A 3IMFA 3QWFA 1GYPA 4KL8S 5IIIA 1NBIA 4R1UA 4U3JB 4XJTA 5SZHB 2UUBB 4DF3A 1Y88A 1Q6YA 1UL1X 3KJNA 3GA0A 3MUEA 2BKVA 3L05A 3LC2O 5D00A 1OAKA 4IOKA 5KG4A 4F12A 5JFTA 2UZ1A 1ODKA 1RYHA 2BHLA 4YMIA 1ILWA 5LP6F 1H3NA 1O95D 3FCYA 4HPXB 4DV5B 3IO3A 5FQNA 1CJCA 3VR4D 2JBAA 4OLJA 1ZCBA 3JWEA 3L8MA 5G41A 3ZWPA 4PIPA 4X6LA 5J0SA 4BFWA 3RASA 5AM2A 2ZYDA 2ORED 2RGEA 4XWOA 4HTFA 3UMYA 4LF4B 3WK4A 2XNKA 4PZ9A 1DK3A 4QBFA 5K3FA 1HT1E 2AR0A 1S8NA 3RRBA 4US1R 4JUZA 1U3UA 2JJ1D 3F6PA 2NP6A 2WT4A 2XOKD 1AS2A 3ETEA 7ICQA 1J00A 5CA0B 1NIJA 1LTQA 4W5RA 1GM5A 3E81A 4RVNA 4WGFA 5AMXA 2PZMA 3CR8A 2VXOA 2FEOA 3WHPA 4ZV4A 3HLKA 1YTUA 5DZSA 3G6WA 1NLZA 1KMIY 1MIHA 4CG0A 1N0UA 1ZHOA 2VJMA 4BKQA 3S2FA 1ZOLA 2X41A 1N34B 1ZQDA 4XDHA 2XUAA 3E22B 2H9AA 3PV8A 2H6EA 4M4SA 2QKYA 4MTLA 4UDOA 1G8YA 3HU2A 4HX5A 1AK1A 3B3QA 4N5HX 2WUDA 4WW0A 1SR8A 4X97A 3RYTC 4CM1A 3AY3A 2W9MA 4M6WB 2ALJA 4OX9B 5AJYA 4GP6A 1FFXA 5EJ2A 1N6PA 4XFKA 3NHBA 1CZKA 2R87A 3L06A 5D3ZA 4DY4A 1D1QA 1NX9A 1Y1QA 3EPGA 2J30A 5CA0A 2YNMC 4C0SA 1W30A 2NLOA 1KL9A 2QMZA 1VKZA 4C01A 4GVXA 1OCEA 4MKZA 1Z5PA 2R1UA 3LMKA 2QZ4A 3MGBA 4O2LA 5BWMA 1EFUA 4X1KB 1YBMA 1CVIA 1OB2A 821PA 1IQRA 4IWXA 2FN9A 4YAKA 5FLEX 2ID4A 5B30A 2W2MA 3NR2A 4UTZA 5CLFA 5IG2A 1UHUA 1NP6A 3Q0IA 5BUZA 2NU8A 5A71A 5EWLA 3G17A 2NVUA 4LDJA 9ICTA 3D6VA 2K89A 2IXBA 3F5SA 3IOCA 2CDCA 4KO3S 3RV4A 1JR3E 5EKUA 1FP6A 1E4OA 1G7RA 3CSUA 3SI7A 5KFHA 3H2SA 3VBEA 4UEKA 1JALA 3OCJA 3QE2A 1LB2B 4EJFA 1L7OA 5HJ5A 2DPIA 3HNPA 2Q4TA 4GHWA 1ORTA 3GEGA 4X6XA 4D3ZA 1A9XB 3C1TA 2WU3A 2UVRA 4NMMA 3AEUA 4N0DA 2WBLC 3QLTA 2Y0SC 1NDHA 1QB8A 3GARA 3N2KB 3D1VA 4YRFA 3AVTA 2E21A 3O2SB 3JQFC 4FFNA 4IFBA 3TLCA 2H2FA 1N9GB 1FQWA 3COSA 3FCEA 3NOXA 4EEYA 5AH0A 1Q12A 2X0FA 5F9NA 3NVWA 3PX4A 1EHIA 3R7NA 3RU3A 1HLDA 4MVJH 4C78A 2O7NA 4R9SA 2FSGA 3M6LA 4WNCA 4ED8A 1KJJA 2ZCUA 4WOJA 1ISIA 1G3IA 3LQ4A 3QZUA 1FMJA 3ORQA 4FFLA 5E38A 2RH4A 3E2PA 1H1LA 2ASEA 1FOEB 5IAJA 4M1MA 5KL1B 3WK7A 1VHDA 1Y4UA 2OGWA 4DMGA 5A2QA 3HE3A 1HYQA 3EVGA 4JCCA 4FS8A 4I4TA 1EQUA 4EVRA 5DXJA 3I01M 3S1AA 2AG0A 1SBNE 3BDVA 2GXQA 5CX4A 1JEQA 2H06A 4CWAA 4YAGA 5B12A 1DXSA 1MUUA 3KUUA 1Z07A 4U39A 4ARIA 2HPVA 1IQUA 1LZKA 1RADA 4MUBA 1M72A 3GLTA 4TM8A 3U6BA 4KH0A 4QG7A 3RUEA 1KH3A 5GTDA 2BDUA 5DP1A 1R5NA 2Z6VA 4JJFA 4CEIA 1YS2X 2BFBB 1V5FA 2Y1DA 1QHYA 1S0OA 3C5WP 3BBPA 3JV7A 1C8LA 3KJXA 3PKIA 5AHXA 4OAQA 2P0EA 4RSMA 3SR0A 2PL5A 3GVPA 2NMVA 3W2HA 3FWNA 3HDVA 3AO0B 3R3SA 4EQ6A 4P7GA 4XSVA 4BB5A 3IDWA 3TKYA 4EECA 1JT9A 2BCJQ 3REQA 4ED6A 2NW6A 2Y1FA 5FFMA 5DCYA 2DC1A 2M32A 5DVZA 4TURA 1UBRS 1YQWA 4ZQBA 3TJZA 4OLAA 4QVKA 1VHJA 1XUOA 3LDUA 4ZJYA 2PU7A 4ADSG 1TXGA 2A5FA 4DL3A 4XQ8A 1ZJWA 1OH5A 1WZEA 4XM0A 2HF2A 3DKPA 3DFKA 2XQGA 1KBOA 1BE6A 3FYUA 4ZGGA 1KEWA 1QP4A 1RHQA 2JFNA 4OTZA 1EZZA 4RSRA 3R7SA 2G8LA 3B82A 2IIPA 4WDQA 5LZ4A 3EDMA 1C0KA 3NC0C 5BPFA 1DBPA 1PNVA 2C54A 2WU8A 4YJGA 4RUCA 1C4KA 1RYEA 2BHTA 3L4SO 3QV1A 4LNHA 1B3RA 2W2LA 4NL4H 4MLCA 2KZZA 3BSFA 4P4SA 4RKFA 1D03A 3I34X 3X3HA 4B79A 5FPHA 4JWKA 1VIYA 4AZ0A 1QTMA 1XL0A 5ICGA 1LGYA 1ZRMA 2IYUA 4TXHA 2F2TA 3KTAA 5E3IA 5COAA 2VI5A 3OECA 1M2GA 1ZX1A 3RYCB 4X84A 2CXPA 3AV0B 1Q8KA 2HRRA 4D6XA 4D8TA 2ISPA 1R0CA 1V8DA 3O82A 2JANA 2JDID 5K6AA 2NIPA 2DKNA 2PKXA 3OPYA 1Z2AA 1PL8A 3RS8A 4A03A 1JDUA 3O8DA 2Q5QA 2X5KO 4J4HA 4R65A 2D3WA 3NB0A 1K7XB 2ECKA 1U28A 3B6IA 2FWPA 1MVNA 3CRVA 1RJ9B 2I3GA 2R751 3BOSA 4K3VA 4ZO4A 1RCUA 4C7OA 4Q4JA 3HXOA 3OFSA 4NARA 3L4JA 4ND6A 4HYEA 4KPUB 3WLKX 1CVLA 4R2IA 5CFLA 5KOHA 1EP3B 1V71A 4CCSA 4CLHA 1FDSA 5F9FA 2QRVA 1KORA 3FCUB 3S99A 1IB0A 1YDEA 3O26A 3QKSA 4QPDA 4R1MA 3ROTA 1C3OB 1BDIA 4KAAA 2XBMA 1KI7A 1PQYA 1QONA 1S01A 3EN0A 3PLNA 4AAYA 4DXHA 5JAMA 1PR2A 4WJLA 3GI1A 3A6ZA 3LYLA 5AHRA 4IHJF 3S7ZA 2R6JA 3F5QA 4K6CA 4DCUA 2AXEA 1YAJA 1ZR2A 2D1TA 4PRKA 3LBIA 4EABA 4GX1A 3M9NB 2H3FA 3A2KA 2WAXA 3HB9A 4F84A 4GDFA 3MK31 4GYWA 1DRWA 2W8LA 2H3EA 5DNWA 4ARUA 4CV2A 1JLHA 1CJTC 4UVEA 3S5UA 2NOAA 4FR0A 3LE8A 2Z2KA 4ERXA 2VHJA 4IDGA 1WXWA 1I32A 2OB2A 2C2HA 2ZLBA 2WSBA 2RAVA 4MAFA 1NHGA 1X86B 4OGWA 4ZOCA 5C81A 4XB6B 5LMUB 2QTHA 5FWXB 3LHIA 2JVKA 3WKAA 3GLHE 1S6YA 3LA6A 1VP3A 3CWZA 4ZQCB 5AVTA 4RTJA 4BN4A 1VCMA 3TUZC 1H6DA 1XZCA 2IHNA 3N7PD 4JMPA 3WHLA 1G21A 1G1AA 4CMAA 3PR3A 5KNDH 4YWJA 2HA5A 1KR2A 4EZ6A 1J0XO 3K16A 4FUQA 1G60A 1P0QA 1YZ3A 2KLBA 2QT9A 2RHOA 2XTMA 3HY6A 3OOYA 4N18A 4PBTA 2ZS7A 4B40A 2BF7A 2IX3A 5EXSA 4TMKA 4DFPA 1MKYA 3MAGA 2FETA 2G04A 2VQ3A 1GTZA 3JWJA 3WO1A 2H5LA 3V7KA 3BTUA 3O9ZA 3I9OA 1GCOA 3KELA 3EGIA 3AHCA 4LBWA 3PUKA 4Z6FA 1ZNXA 1ZU5A 3RVQA 1H9AA 2V8BA 3IRVA 4G5RA 4RX1A 5JS7A 3MWDB 3RQIA 2F1RA 1J8YF 3NHRA 1MRZA 3IAM6 2QMUA 4F9EA 2ZIGA 1LU9A 3FMGA 2IOHA 4IIJF 3PPYA 4UE3S 4LRYA 4EL5A 3SSNA 4J8PA 1ZN7A 1CFZA 1LVUA 2GETA 3EGXA 4D82A 2EHJA 5I7SA 2MYPA 5E4FA 1A8IA 3KZMA 1P4AA 3PUIA 2XRYA 4GOJA 5EERA 3RIYA 1CE8B 5U9CA 4RL6A 3LWZA 1AV7A 3ZWNA 3SE0A 2MSEB 3R8FA 4M1OA 3JASA 2L2QA 1MTOA 2JCVA 4UCQA 2V1UA 2BSQA 3B1JA 5EXTA 2XF2A 3EA0A 1ACLA 3EXFA 3QX8A 4S1OA 4FZ3A 4ZQGA 1E7RA 2YKGA 2A7QA 3A8TA 4PZYA 2GOLA 1AKRA 4XGNA 5CRXA 2FFRA 4JITA 1WZUA 4JLNA 4WVLA 2PX6A 3ZVNA 1SUBA 4MWZA 1ZUWA 1E3EA 1MHPA 1QR6A 2WT9A 8ADHA 3WLPA 5L4LA 2PKQP 3CRQA 5IVKA 4DXAA 1OU0A 1KFEB 4L5YA 4HDOB 3R41A 2J5XA 2NT4A 4OJNA 5J0QA 1Y3AA 4G5SA 3FPJA 1S10A 1F4LA 1JKXA 3BXZA 2Q3BA 4JFAA 4RTRA 1FMLA 1SIUA 2HXGA 4FWIB 5JTIA 1TCBA 3ONWA 3N53A 2ZIWA 4EKNB 2FLVA 5HTOA 2AOTB 1E5LA 2XCSB 3NYIA 5TXGA 2IZZA 3DMRA 4F9TA 2HJVA 1PBTA 5IT4A 4C5BA 3O8NA 4Q02A 1ZA2A 3K9NA 3ZE8A 3MGIA 1NVGA 2JGDA 3FVRA 4G09A 4RUAA 2O3SA 1G8SA 3NBFA 4LYYA 2FI1A 1YJCA 1UIMA 2H59A 3I04A 4F4KA 3M0EA 2MJLA 1L3SA 1ZQGA 4OXQA 4YXWA 2Y1JA 3PJGA 5ALIA 3T9CA 4LXYA 1J49A 2NADA 4I29A 3P2IA 2X42A 1VLVA 2JB9A 2P11A 4OI1A 2FUG6 2ET6A 3AY6A 3SGLA 4E5SA 3BFXA 2V4MA 3I28A 1NYTA 3O2JA 3R7LA 2BPFA 1E6WA 3JVDA 4NZOA 3PGKA 2GEJA 4MIKA 2JA2A 4Z0PA 1BD3A 1AKNA 5IYZF 1L5LA 5KQPA 3TIIA 1JR6A 5EPOA 4DN6A 2H07A 3JWPA 5A0LA 2AJTA 2J08A 3IP9A 4IVNA 3SP1A 1PR9A 2CUKA 5AJWA 4FNMA 4NYIQ 5ALZA 3T5LA 4JUCA 5DO9A 4EA8A 3IOBA 1PKEA 3HU5A 3MG9A 1P18A 5IDYA 3SQLA 4CIXA 4DT1B 4MAMA 4N12A 5EZYA 1ZICA 2JFWA 1AMOA 2AC4A 4Y1RA 1ZG3A 1XU4A 1C1HA 4UE2A 3RG2A 3MGCA 2ZJ0A 2R6HA 5BPHA 1VJCA 1WXQA 2IC5A 3ZXSA 1G55A 4V1CI 4QL3A 5J2CA 2AX3A 3SWWA 4RD4A 3JQ7B 2HT6A 3WC4A 3HZHA 2JJ1A 3IBFA 2G76A 1X9HA 3LPAA 4B85A 5DSTA 4QYTA 4MIYA 1SXJE 2CLKB 2QRLA 3WKBA 1NRJB 1V5EA 3E2MA 3JQRA 3BQ1A 3CX7A 1L5HB 5K2MA 3LH5A 1HE5A 3ZBUA 4J1QA 5EINA 1Y5RA 1A9TA 4MUHA 1I01A 1TVCA 2CMGA 1KFCB 1G64A 2AVNA 3HVIA 3RTCA 1IM4A 3G9ZA 1MCZA 3ZJYA 1JG7A 3JZDA 3E6AA 1F0KA 3A6JA 4OPMA 4BQEA 2QGNA 3OZ7A 3LTNC 2BMWA 2EV9A 4AZSA 3OLCX 2ZUCA 1E1NA 1IEWA 4FOTA 2I2DA 4M8SA 3QF4B 2J9RA 2FY8A 2Q5FA 4IJ5A 5KNLA 1SCKA 3INTA 1UDXA 1UXJA 1WV0A 2YV1A 3L8DA 2HHSA 5F12A 3UENA 4D46A 2O0LA 3B1WA 2X23A 1Q3KA 3N76A 2I54A 5HFNA 1Z2NX 2EQ5A 2O3TA 1RMTA 1GJRA 2VQDA 4MR9B 2JXJA 4ZRNA 5CWRA 3V3KA 3DEKA 5J2KA 1SIJA 2XCPA 1O6GA 2FLWA 2WKRA 4KDRA 3ECAA 4AX8A 1N32B 2C96A 2QSJA 2PVSA 3DBVO 3NI2A 3Q2IA 1GPUA 2H2DA 4PHCA 4C8MA 3DEIA 3A3NA 3PSAA 4BLTA 2HMSA 3CM0A 3MS4A 3RROA 3K75D 1S77D 1TMGE 2B8TA 3CUSA 3QKRA 1ZQSA 4KJZA 1JRPA 4P3YA 5DM1A 5TEVA 3RU2A 4M46A 3ICEA 3L8FA 4XGKA 1BAPA 2YW2A 4Z6KA 1IONA 1RPLA 8ICKA 1EVQA 1FLAA 2PS1A 3AYZB 3FJOA 3IAM1 4V39A 3T1YB 4G9GA 4WXPA 5H83A 1SL2A 4O9MA 5U4XA 5JZSA 4DSFA 3H1AA 4XARA 5FR1A 4RD1A 2FH5B 2W9BA 1LJ8A 4WLEA 1MNQA 4XGQA 1ODLA 1ZJZA 2JR5A 3VHRA 5EE0A 3RB6A 3COWA 5JATA 1I7PA 4PZPA 5ENZA 2IUUA 4ARAA 5JSZB 3ZVMA 1I5OA 2XB6A 3CX6A 3IP5A 4YRKA 1PQPA 3F3KA 1EXWA 2BM1A 2H4YA 3TPFA 1E2IA 4JQOA 3S2ZA 4CG1A 1WCLA 4P3NA 1H8HD 1VJ1A 4RE6A 4D97A 3PXEA 4RZQA 2FMQA 3VPCA 1FFVA 3M4NA 2WUFA 2JFYA 3RS0A 1ULUA 2OFFA 2YXEA 1Y98A 2QY6A 2EX4A 2Z04A 2EJCA 2YY6A 4LV5B 1ESNA 1THZA 2I9GA 3ZBQA 3FYUB 3UMRA 3K70B 9ICCA 5DCLA 4NZPA 1U65A 1IV8A 2B35A 3BCRA 3MFYA 5JCOA 2AC2A 2BI4A 5JNTA 4RZSA 5GONB 4NFSA 3NTQA 4C6HA 3AJ9A 2ZT8A 2Q3EA 3DBHB 4RACA 4XVQA 5TSDA 4B4KA 4EPYA 2K8BB 4CTOA 1KTIA 1RRPA 4QPZA 1U11A 1B74A 4CMHA 5IAGA 4RY9A 2M6RA 1KY3A 2J3QA 4Q4AB 1YQEA 3O03A 2PCJA 2PZ8A 1GXSB 3J81j 3G2HA 4WIAA 4A2PA 3SZ3A 4KQXA 4JNCA 4L4XA 4D43A 2ONCA 2WQ7A 1KLNA 1HE4A 3OM1A 4GOKA 4WESA 4WA8A 5KDOA 3KTOA 3T12A 1FQKA 3BEOA 4JD5A 4AYXA 4EJ2A 2O2IA 2PA0A 4J1SA 1FUEA 3E18A 4P4PA 1OC2A 4PCLA 4Q4DA 3VISA 5AM3A 2SCUA 5CAEB 4EW2A 4BAUA 1DG9A 1LTHR 4JN6B 2JGAA 5IM4A 1W4AA 2WKSA 3ZBTA 2ZSEA 3G7UA 1DIOB 1K75A 5JH7F 2CF6A 3LY8A 5I7FA 3RS2A 1U3VA 2YHIA 4AYBC 3V3TA 3DCJA 1U0BB 1MABB 1WD5A 3IUSA 2VEDA 4E5MA 2DETA 3TN7A 2YQEA 3Q7QA 3TW8A 4YLGA 1C4OA 1WAMA 2KEYA 1NZBA 3UAYA 1BH2A 4RVFA 4UVDA 5JD3A 4DSLA 2HF9A 3AU8A 3VAAA 5LKAA 3PVZA 2M9NA 4DLEA 1DV2A 2BFFA 4B17A 2VLBA 4AN0A 3CVYA 5EOZA 3FOWA 3BIFA 1ESEA 2FUNB 3WI7A 4MR7A 2I3DA 4PZDA 3J80A 1QKJA 1Z63A 1ZMXA 1K3TA 1KZGB 1M0WA 2W5UA 3X2SA 2F3SA 4S12A 4DL4A 4WN3A 4DC9A 6PFKA 4LHEA 4S3MA 5CB4F 2P40A 4I4IA 5A4MS 5H7XA 3DOJA 3RC2A 2NUAA 2VDUE 5A04A 1H1TA 5JROA 3PXXA 5J2AA 1FFSA 2NPFA 1ESCA 1T9KA 3ZCRA 4XRHA 3Q6MA 4D0SA 2AZXA 4DZTA 3TF5A 3D54D 3UTDA 4BU1A 2AQHA 2VDNB 1E6KA 1T1EA 3KQPA 2QV0A 5J2UB 2JFBA 1X80B 2V74B 3GLVA 2AHRA 4LDPA 1ZQXA 4GX2A 4ABYA 1JXLA 3IURA 3MLAA 3MXTA 1UK6A 5JI3E 2IBTA 1AA6A 2CZCA 8ICBA 1KO1A 3LLUA 3LX8A 5EFOA 5M29A 3R9XB 3WR5A 3O9VA 2ZYAA 3MM4A 1A6SA 1VSUA 3HVRA 3V6HA 4KQFA 1B0XA 1LKYA 2F17A 3OZIA 5H16A 2QRQA 2C0CA 4EB6B 3GFKB 1O4VA 1R0SA 2CNOA 2FPOA 4UHBA 4BCBA 2IEIA 2WJYA 1EAYA 1KZYC 4GT1A 4AJJA 4U00A 4E6PA 3QUQA 4DOAA 2A9PA 4K0RA 5BR8B 2FRXA 2CNWA 1ECWA 2JLYA 3A36A 1CUKA 5J2DA 1L4BA 4W1SA 2FWMX 2KJQA 1JA0A 4IIFA 4YYZA 2PSJA 1IHYA 3FW1A 1PVDA 2NZVG 4TT8A 3WIVA 4GEGA 3TTXA 1EM6A 2QR5A 4PPYA 3MR5A 3WL5A 2PZFA 3W34A 2DPXA 3E22A 4QT0A 1A5AB 5JO0A 2FMPA 1JAYA 2ZDGA 3K9QO 3DDZX 3TLGA 4F04A 3B13B 4NK5A 4RS4A 1SQ5A 1RPJA 1IVNA 1M9NA 1ZUNB 4HY3A 1EJ2A 5L1KA 2OAEA 2VPPA 3O8QB 3SAHA 3DC2A 5JJLA 4Q4HA 3SNHA 3ZHVA 1VJRA 5DHUA 5L3QA 4FDAA 4KI0A 3SOPA 3CZ9A 1UT5A 3ZCUA 1AGYA 1NMZA 3VO1A 5A5FA 2AX4A 3GBSA 4H7FA 3VR5H 2AN5A 3TB4A 3GUYA 3A1WA 2I1QA 2ACKA 3CBQA 3IA7A 1GUDA 3RFXA 4Q66C 1QFSA 3D5TA 4LQCA 3HLYA 1L2TA 1DBVO 1FJXA 2VBGA 1SBTA 1NW3A 4DJDC 5F23A 2HQ1A 2HHVA 1EIWA 1UKZA 1GCAA 2K4MA 1Y6ZA 2NSJA 3ZZMA 3R4VA 1IYZA 4O8CA 1HJPA 1ZQBA 4BKOA 4YMLA 4LN1A 4G07A 1W87A 1KQ3A 2W9BB 3S2IA 4JJIA 5CDFE 3F6CA 1X77A 2SHKA 1UFVA 2ZBVA 1U2GC 1I2AA 3PF8A 4D4IA 5IZCC 1KOJA 2FQQA 2YV5A 2DBRA 1XZGA 2DLNA 2I99A 4DCOA 4TVBA 4F91B 2O07A 4FHCA 4KLIA 5KFCA 1H5QA 5I47A 4CEHB 5C4IA 4QWWA 3OESA 4X71A 2FPIA 3DF9A 1W581 5B6PA 1RLUA 1U6KA 3ORSA 5ALRA 4RFLA 1R50A 3V32A 5HKKD 2ATEA 2ZI3A 4O63O 2FG6C 2NQTA 3ESRA 4UEWA 4F5WA 4ZGWA 1DV1A 2Q1SA 4IR1A 3C8ZA 2ZSAA 4MEJA 2AZ4A 4U8HA 3QFSA 4W8HA 3TKLA 3T5PA 2WYIA 2Q8PA 2EGGA 2KZMA 2HWYA 2ZAGA 3TH5A 3BQ2A 4X20A 1I7QB 4COOA 2DHDA 2F3NA 2UVWA 1XSNA 1UBLS 3RDPA 3LDGA 5E9JA 4E1BA 3GFQA 1J8DA 3GRPA 4L95C 1YB6A 5AUQA 2GEDA 3U9LA 3G82C 3L6DA 2HRQA 3PC3A 4OP3A 2NN3C 1XRLA 1C0IA 4FZMA 2CCGA 5T64A 3W2FA 4F5NA 1TJNA 4YRJA 1TT5A 3WWEA 4KP7A 4FYJA 1LSOA 5FA6A 4E88A 3KJFA 1ZW6A 4IGEA 5C8YB 3FTFA 3GCGA 1BQEA 3LXUX 2AE1A 4WAUA 3V6MA 3EPHA 4IDCA 1X94A 1L5HA 3HCAA 2XVMA 4LS3A 4M0EA 1TPZA 4HYKA 1NC1A 3IAS1 3EUWA 1XF9A 4KN5A 3ZGZA 4JGGA 4XIIA 2HDHA 3Q1KA 4IQ0A 4JIGA 3WSWA 2JA1A 4EG8A 2OYSA 1OREA 3MJHA 4QWMA 1V7CA 1WDMA 2HMAA 1IHOA 2R6ZA 3DNFA 3FUTA 2VA2A 1O94C 3A4IA 2WHYA 3KPYA 2XB9A 3QIVA 5K3AA 3UW1A 3PC6A 4L0DA 4DCJA 4C2TA 1QFZA 2OVFA 3CPEA 1ZJYA 3AMVA 3M6KA 2QRZA 4J7AA 3V1LA 2XSZA 3NLLA 4JR2A 1CZHA 1LKZA 2VPQA 4BDSA 3C7CB 5K8LA 1NUTA 2A94A 4CTJA 4H27A 3T15A 1KZ6A 2OG2A 5CBPA 1K1EA 4QQRA 2CL5A 4BDTA 5KAFU 4GXKA 1RNLA 3H4MA 3H5IA 4G67A 4H7EA 1OZHA 1R4ZA 4N7MA 4QBIA 1P4RA 5JBQA 3FGPA 1FQJA 1G8PA 4O3FA 4URYR 5FOSA 4NONA 3F90A 3Q3VA 4MKIA 1Y1LA 4HWSA 3KUXA 1G0OA 3N2GB 5BSEA 2E3JA 1EBBA 4CE6A 3QI2A 4Z9XA 4ALJA 5K9ZA 2IT1A 4BAZA 5L6LB 4HWGA 1NXQA 5LXTA 5HDBB 4R1LA 4C6TB 5B64A 3RTAA 3K8OE 1SBIA 3ETLA 2PFGA 1P9NA 2Y2UA 4OLHA 3QBJA 5AT1A 5DIZA 5SYMA 3WA6A 4LXQA 2HA4A 1VPLA 2LPMA 1XZMA 3S44A 4RNCA 1RFLA 3UG6A 4B6PA 4C08A 4KLHA 4EI8A 2L69A 3COPA 3E2IA 4K05A 4Y2JA 1FPMA 3BMXA 3K70D 3EVAA 3ZU4A 2LIPA 4HB4A 4XWGA 1CRQA 3PKZA 2BC9A 4OKNA 2FW9A 2JFFA 5E9WA 3NWPA 1I10A 3AQEA 1F0NA 4P32A 2OXIA 2D4HA 1PT5A 2H8GA 4N1AA 5G0UA 3ELBA 5K3BA 3C24A 3GY0A 3KTAB 2NQ8A 3KUKA 5EP4A 1D2GA 2LDBA 3EFHA 1XU9A 3ZXUB 1T29A 4YP1A 4QREA 3CP8A 3JARA 3NDBB 2BSXA 4EJ6A 4EYQA 1RXVA 4EI7A 1C7QA 2JJMA 4LV6A 3OHSX 5DX0A 3ASUA 4PGQA 1Z35A 4K03A 4DNFA 3Q10A 2HU5A 3KO8A 1ZXLA 1NKBA 3EXFB 2E5SA 4MI3A 4TLAA 1QU2A 2H4XA 1E7MA 1P7ZA 2C4WA 3NVMB 2P79A 4N8SA 2HYIC 4D9FA 2G0NA 3FPAA 1RM6C 2PKRA 2ZB7A 5BN4A 1V1MA 2PE5A 1XZ8A 2ZE7A 1H4SA 2IEZA 2QPOA 4KLUA 4Q7MB 1M7HA 1C0PA 2GRJA 2PRIA 3ONDA 1YZGA 3WGZA 2Z6AA 2OHFA 3DLPX 5LR6A 4KI7A 4QQNA 1P5RA 3K6KA 2B8JA 2JVIA 2Y99A 1HTWA 1NN3A 3L8YA 4G0WA 5KFTA 3ME5A 4K6OA 1U7OA 4G1CA 4OA8A 5G0SA 3R7AA 1DQYA 5E3HA 2EW8A 721PA 1LFAA 1VE5A 2YWFA 3KQMA 4MV3A 5A05A 4PLCA 4BQOA 1QJCA 5EZ6B 1Z2EA 3V4VB 3VR1A 3K31A 4TKUA 5ALHA 3A7EA 4LMBA 1W46A 3VZPA 1L8QA 4DVJA 1YRHA 1MIOA 4NFYA 2JLXA 3HBAA 4ZYXA 3WSTA 1KAGA 3EHDA 5CDSA 5EEGA 2CLEB 5FAXA 4EPTA 1LLUA 1V2GA 4EPVA 1XQXA 2ONZA 4ERNA 2Y9MB 1T1RA 2VZLA 5LYJB 5M7EA 4RCZA 5KT3A 1KJIA 1Q7BA 1YQDA 3L8ZA 1G6OA 1XTQA 4PG5A 2F2AB 3JQBC 4PLFA 4F4CA 2P4SA 3RBAA 1PTKA 1RZUA 4EB3A 2CLDX 4A23A 1THTA 2I9PA 3GFSA 3Q5EA 5HIJA 3E82A 1EFRD 4NBTA 4UQLA 1NSYA 4A8PA 1IY0A 1J0DA 2GJSA 5EYPB 3WLMA 4B34A 2CLFB 2H4ZA 4B4UA 4LF9B 1OA0A 2JD0A 4B3DA 4N5LA 1H2RS 3KKPA 2PMWB 5KYXB 1DQNA 3EOBI 4KSYA 5KYTA 1OT3A 1DBIA 3C41J 1JYFA 3W5IA 4IFIA 3OHPA 3DD1A 1G2QA 2E6UX 3SIRA 3OEHA 3CZRA 3F9RA 2ECPA 5JD5A 2GYVA 4NK4A 5KFBA 2HDWA 2IDMA 4J9MA 3M2TA 3R4CA 4BEBA 1AKVA 3DGFC 3L7YA 4DLPA 1V5GA 3QOYA 2XZDA 4YCJA 1VE9A 4Z6DA 2DYKA 1YH3A 4YUVA 2VPIA 3WGJA 1AJEA 4CMCA 2XQKA 2QRVB 2X8BA 2J59A 2Q5IA 3Q8WA 1CF2O 3KSMA 3RTGA 9ICVA 4WINA 5JSKA 4BX3A 4BHTA 3UK1A 3BXXA 1RJFA 4L8YA 5EJ7A 1G20E 4X7PA 3DKVA 1Y8RB 5ALQA 1SHJA 2B4TO 3L2OB 1JEEA 3AL0C 2RBKA 3H2JA 3RK0A 1QHXA 3QUCA 1T6NA 3CLRC 4YCCA 4KMOA 3ZXXA 2ZUBA 4NJ8A 1IXRC 2QRNA 4DV1B 2EL7A 1X6JA 1XTZA 2K87A 2ZVJA 3FB4A 3OT5A 4YAFA 5BVHA 4B9TA 1EHCA 1IXKA 4MS1B 3AOEA 2RK6A 9ICSA 5CCXA 2IYFA 1AN9A 2YZ7A 4MW2A 4OU5A 2IL1A 3EZYA 3QMMA 1TFRA 1WRBA 5DXAA 4EATA 3MT8A 2DX7A 1RKQA 1ESZA 2XO7A 1XMJA 2FZWA 4MR8B 4N03A 5ARDA 2GVDC 3VPFA 3ISVA 1TCAA 3EJWA 2CYCA 3MGKA 4YJFA 2OQIA 3U3RA 1ODFA 2QN3A 2J6TA 1Q17A 1LDGA 1HYHA 2BRUA 2G70A 2LPEA 4BGDA 1Z7EA 1T0HB 1CUUA 1QV9A 2R00C 2UVPA 2Z1MA 3SIWA 5KTOA 1M7BA 4TUYA 3VPHA 4ER5A 5KTKA 5GIPE 1DT3A 4KXYA 2X0KA 1W7AA 1GG5A 1TA0A 1XDWA 1N1MA 4FKZA 2BGNA 3CPHA 3VZRA 5DBOA 3WLOA 1E89A 4F4DA 5JY6A 2C3UA 4QIHA 2OPHA 1SXHA 5F9MA 4DAOA 1C30B 1YDHA 2FPPA 4GP9A 4W5NA 5D01A 3MLBA 4BQNA 5LYJF 2BFBA 1ZOSA 2BOVA 4FDLA 5BYBA 2Y1XA 2X9QA 2WAAA 2X9LA 3OCUA 3LGXA 2VP3A 3I32A 3T3GA 3W4KA 4DMHA 3Q8PB 4J76A 3RARA 1JTEA 4RJ2A 1N6OA 3E23A 3M49A 4HNTA 4CLOB 1E8NA 3E9DA 3B5EA 4FJ0A 3VZQA 4LRTB 3QPUA 2IX9A 1R0WA 2ECQA 2BGRA 2FHSA 1MAVA 2LI6A 3PGVA 1LPSA 2I6QA 1HIWA 5CJ7A 4FEGA 3B48A 3H1BA 2GSDA 2JIDA 1VHQA 4LYDA 4YJ3F 1NBAA 5IM4F 4J9NA 3FWKA 2D1RA 1CTQA 3HY4A 3JQ9C 1AHHA 1Z6PA 4G5XA 4OOEA 5AJZA 3J7AC 1ZMOA 4ZCLA 1NJYA 2GLTA 2HU7A 2J0QA 4I55A 4UAUA 3GF4A 4EYOA 4YBRA 3K0SA 2D8MA 5FL7D 3B3GA 3P96A 5BQPA 3L6EA 4WJKB 5I48A 4OHVA 3AQFA 3ONNA 1ZNQO 1RKXA 4Q45A 3MSCA 5F51A 2F76X 1WABA 2X2EA 1RXEA 2C77A 2C57A 2CD7A 2JRLA 1T13A 4NP6A 1T9AA 4CIVA 3GBVA 3UQYS 1IK4A 2NX2A 5TF0A 3ZGVA 3CNEA 4LDRA 2AZDA 5EWMA 4OQLA 4DLTA 4ES6A 5AJXA 2WB1F 3SS7X 3MHPA 3GRZA 2Q62A 3RUFA 2OP1A 1ETUA 2CRXA 3BF7A 2AGQA 3EIXA 1MC5A 4L0MA 2SBTA 3GYBA 1TKBA 1FU8A 3FXAA 4GL4A 8ICOA 4ZVLA 1DX4A 2F8LA 3ETDA 3U3DA 3H1GA 5BVGA 5MDHA 3U4AA 1MGOA 3EDOA 1N2SA 1AXEA 1IHPA 3G85A 3KAJA 5BSHA 2UXCB 2JEOA 4P80A 3MQ2A 2Q1TA 4PO9A 5KB3A 2CY0A 1NVFA 4ESEA 1QV6A 1KP2A 2R8BA 2YFKA 1RPTA 1N60A 1QDLB 3FAZA 4HMOA 5CGQB 1I4LD 3LWBA 3FVVA 3IBSA 2WF5A 5KDDA 3EG9A 4IUBS 3LKDA 4H08A 2UXDB 4LTMA 1M34E 4US0R 2B2NA 2GVNA 3ZOKA 1XPRA 4GO1A 1GNQA 4FZLA 3A05A 1OVMA 3E7PA 4O3MA 3LA8A 3FBTA 1PJ4A 2W22A 2WPDA 4KQWA 3PEWA 2WWYA 5J8YA 1M8JA 3AHJA 2DR3A 4RNNA 3JZFA 4CLDA 1KYIA 2PLWA 4QDXA 2Z5VA 3IJRA 1ISJA 3O4IA 4PONA 4XX1A 1SBCA 3KPUA 3R76A 2PBFA 3N2LA 2CF5A 1JJ7A 5E4YA 2C9OA 3QPVA 5E0OA 2H2GA 1RHUA 3M5DA 4IMRA 1H69A 3CS3A 5I9IA 1QH1A 4OKSA 4ZMSA 2IE0A 4LRWA 3U17A 4W1RA 1ECFA 3F5DA 3OKFA 5KYXA 3SVLA 4GKAA 3B9JA 2CJWA 3TR5A 5IPFA 2Y66A 3RRZA 2QN9A 4MW5A 5IIKA 2B37A 3DMPA 3MCUA 3VGJA 4EG6A 5T3UA 3AFOA 3L8EA 2FMSA 4FYVA 2MOKA 2BI8A 3D0KA 3IFSA 4R64A 4H77A 4HNSA 3HBMA 4M53A 5ALEA 3B8EA 1U0JA 2LBOA 4NJEA 4JB3A 3GBPA 1U7DA 3SHTA 1Z5GA 2WHPB 4LMAA 2I9KA 1WTAA 1JUDA 2RHBA 1ZQQA 4MP8A 4OYLA 1RQPA 3C3CA 5EQDA 1N2GA 1XO1A 1BFKA 4AWXA 1NK5A 2ZTHA 2FOXA 4GRIA 4FT2A 3UK2A 1DKLA 2KBEA 4KJXA 4R16A 1WMEA 2J4DA 4FR5A 1SNYA 2RGGA 4U2GA 4Z1OA 3FDXA 2O0KA 5DNDA 7ICTA 1T5OA 1ZK0A 2J3DA 3QVXA 4HDRB 2VPXA 1O97D 1ZQ1A 3NBYC 3OC6A 4WACA 5K8IA 2C97A 3F6EX 4QA9A 3GRRA 3T3OA 1U63A 3DULA 2LYHA 2CJYA 1DC6A 3GW8A 3D3EA 4O3QA 1D6SA 1I3NA 4ZI7A 4P8RA 1H1DA 3ONEA 1U4BA 3C3PA 1VI6A 4E30A 1NBEA 5T8KC 2I62A 3GHYA 3GUCA 2ODTX 4EO4A 3ABOB 4A7PA 1QLJA 1B8VA 4MR8A 5GWXA 5HQTA 2WKQA 1MOZA 3EMKA 4K6FA 2R66A 5A3JA 5CK5A 1Y3HA 3AF0A 1ZGZA 1GGEA 3EDQA 3IEXA 1YONA 2LCFA 5ARBA 2P90A 1Q16A 2BTOA 4GZ5A 4DLAA 1JEDA 1WMAA 2GO1A 4E08A 1JILA 3WLIA 1C1XA 1OXXK 2Z3VA 1G2IA 1WETA 5DQGA 5J3JA 4G26A 5LBUA 3C6ZA 3I64A 1KFJB 1EK2A 4FDTA 4NBNA 3VMMA 1TRKA 4UDYX 2DERA 2OAQ1 4A36A 3NONA 1B42A 4YP9A 5EQJB 3A6KA 4KQ6A 4O3OA 2IOYA 2ZBQA 3FPKA 4C2AA 4CU2A 4OAPA 4IHAA 1I3KA 2H16A 1AROP 4JBLA 4QYIA 5J4LA 3FYHA 4P0QA 1U2GA 2ZE5A 5EIEA 3KLPX 4YG2A 1E2GA 2DFDA 9ICEA 1F2UA 1UJBA 2GPJA 3MOIA 4ZCMA 2R5WA 4WFJA 1XS9D 1EUZA 1GRQA 3DKRA 3E5NA 4FHGA 4K9LA 4NJMB 2WC1A 4Q9DA 4JI5B 3RUDA 5HCUA 4AJ2A 3AKDA 5DKWA 3JZAA 2CVOA 4KLAA 2OXTA 4KAXA 1SVIA 3FPBA 4LJ9A 3RRXA 4DYVA 1SCNE 2WJAA 3BMOA 4TPKA 1JG4A 3EHEA 3K8QA 4M1KA 4X8OA 5E9AA 3WQBA 2HIGA 1Z6TA 2G9RA 2NSDA 3Q7SA 5JHGB 2DB3A 3BICA 4N4AA 1CUGA 2CLCX 4M9GA 1XJ0A 4IKOA 4MW1A 3T3IA 3VR0A 1KSJA 1RI1A 3BL8A 1NT4A 1YB7A 4IXWA 5DWVA 2Y92A 2ORYA 2P7HA 2OA0A 4DSNA 1LPNA 2XTZA 4IIJA 1U8TA 1XZHA 1E2QA 4KAFA 2QU7A 2A1TR 4OY3A 2OCDA 4HJXA 4OKIA 3ZWVA 1P1FA 1U5BB 2W6JD 3KSZO 2J6SA 3A2LA 5T6MA 3SU8A 1PK3A 5JRJA 2P75A 3D3NA 4R7ZA 5DOZA 3SX2A 4Z4FA 1B00A 2PMZF 2N1RA 1HDGO 4LVCA 3WLTA 2DUMA 1NY5A 3F96A 3HXMA 3HYLA 2CXXA 3P9CA 3PD0A 4JL8A 5A7GA 2AN9A 4AZ3A 3A0UA 4ND5A 1EAMA 2A30A 1V38A 2N0SA 3B1ZA 4PFJA 3AG6A 2JGNA 3OBIA 1T26A 1XG5A 1J2NA 3ZIDA 1NJ5A 2NO5A 1VIMA 5FI0B 2HZBA 3SAJA 5I9TA 5ITWA 4ESVA 4EO9A 5MF6A 3DBOB 2JKZA 1Q7CA 2NZWA 4JLAA 4CKWA 2PIAA 2B5VA 2PXXA 1JHAA 5NLLA 4P22A 2CT8A 3IEKA 3NVVA 1U0SY 2QNIA 3A6DA 3FPFA 1UZLA 1X40A 1YZHA 3UHOA 3VPXA 3QU9A 3AI1A 4PG7A 4DMFA 5AI9A 4RH0A 1KEVA 3A1NA 2AG5A 1AUQA 5FOTA 5KAMA 1K92A 4LWQA 3K2IA 1FXUA 3T7EA 1I2BA 1RBMA 2CE7A 16PKA 3A10A 5AK0A 4CT4B 8OHMA 1P5HA 2O8FB 4I4TB 1ZL0A 1KVTA 2K2WA 4FGJA 1W88B 2B6HA 3D6FA 4KUGA 1CUIA 3H42B 3ET4A 1O54A 3NVAA 4PZUA 5F9HA 1L3CA 1KKUA 1LNSA 1N63A 1DAGA 1Z2CA 2GZAA 1CJBA 3K3PA 4HAXA 4GP7A 2MDTA 4QG3A 4ISCA 4ZXFA 1KSGA 3P2JA 4EVIA 4ECZA 3T5HA 1E1RA 4DS4A 4IRKA 1HV8A 3K0EA 1NMYA 3OLWA 4D6PA 9MHTA 4BVHA 1K9SA 1GLVA 2GOYA 2WJPA 3MTQA 4UNNA 2VAWA 2B1QA 3C5GA 1WDKA 1YDGA 5B5EU 2JCXA 2RHCA 4B6OA 1SKAA 2XJ4A 4JKYA 4IDOA 5KTPA 2QX4A 1PR6A 3U39A 3HI6A 1YXMA 1CYDA 2YWXA 2OSVA 4P38A 3HLTA 3P4XA 4PSDA 4QXOA 4HDMB 1AGXA 1OX5A 4H1UA 3GAZA 2PRYA 5AKLA 1VBKA 2ZIZA 8ICTA 4MEBA 5H3HA 3ISCA 4UUNA 5I7AA 4TT3D 4F85A 1Q22A 3SVTA 1QZUA 2GARA 1PW5A 3NHJA 5EIFA 2XMRA 4W5QA 1WF6A 2D5IA 3A4NA 2EP8A 3BB4A 3BZKA 5HHTA 1B93A 2AI2A 1NZDA 1JG3A 1LH0A 3GPLA 1JVSA 2GAIA 3ILHA 1UMBA 2P9EA 3OOEA 1SPBS 3TQCA 5D5HA 1N2XA 3GC6A 1K5PA 4R8RA 1ID8A 2IZ1A 3TDNA 2YMMA 1C4WA 2EHDA 1JQEA 1TIBA 3BE6A 3PRYA 3OQIA 2F9FA 4OBBA 2W9CB 1UZMA 4EY6A 4ENSA 4AKHA 5LOVF 1KO7A 1LPPA 5CNMA 4E15A 4CJXA 4RVOA 4Q43A 5C8YA 5AVUA 3QLUA 5ESDA 5DTMA 4UARA 4C0WA 4K5QA 5KCZA 5KAIU 1TJ5A 1XQ1A 1MX5A 3GJZA 3RB0A 1E2LA 2FFQA 5EUCA 4OMFG 1QYRA 1V9CA 5J1SB 5AVOA 2BAGA 2C84A 1K8ZB 1OX6A 4GZLA 3Q0TA 4RDCA 1EFVA 5IULC 2EFJA 2E1PA 4MW7A 1PT7A 4KWHA 1BFDA 1DKNA 2R8HA 5KYVA 5D5PA 4QTXA 4HDKB 1AUVA 5LQJA 3PI7A 2E89A 2J1LA 2F90A 2QX6A 3C48A 5HYVA 4GQBA 4TUSA 5DBHX 4YPOA 5DCWA 3MGVA 2DF8A 3K0AB 4KE9A 3VNQA 5IT9A 2C2ZA 3OX1A 1XXHE 3LX5A 2G9QA 2A5DA 2Q0QA 4PTZA 4OQFA 2RAFA 4JELA 3IVRA 4P33A 3MTIA 2DF4B 4WXRA 2PFQA 5JC8A 5TLSA 3WA7A 1SBQA 2PLAA 3HHPA 1QOQB 4UBIA 2F3PA 2HLHA 3UV6A 3ASVA 3L7IA 1FL9A 1OXTA 3ZHSA 1HDIA 4BVBA 2FSHA 1V8ZA 3BJEA 4B0PA 3MUFA 3BZWA 1GZSA 2ETXA 1EM8B 3DCYA 1TZ2A 3OTGA 4FGSA 1ZA1A 3HQ4O 4JNKA 4TQAA 4B48A 3RANA 3OIWA 2BH2A 1ULAA 3BRWA 2Z2JA 4C3OB 3IL2A 2PJUA 3C8HA 3WAKA 3D0RA 3LCUA 1Y3DE 4DOCA 1AM4D 3PI6A 1BNCA 2G9NA 1QU3A 3HDJA 3QKIA 1Y82A 3MJCA 2FP3A 3WLEA 4R84A 1CQPA 1EFCA 3WO0A 1N6KA 4G5YA 2IQIA 2RGYA 1TUBA 1POWA 2ZBPA 2CXHA 1U2QA 2JAXA 2ERYA 1AXGA 2OCGA 3AFGA 4R5MA 5DBBA 1BEEA 1W0CA 2ZP1A 2EYUA 3UW3A 4M1WA 3TG8A 3VXKA 1X9GA 2YUTA 1M2FA 4HGOA 4EUSA 1QOZA 3UHPA 3FPCA 2R8ZA 4Z4EA 2WOJA 3D8BA 4RXMA 3A1SA 1L4HA 3KTDA 2IZ7A 3WICA 5FPYA 1XLTC 3PUJA 4G0OA 4TTAA 5T57A 5BYKA 3PIDA 4K46A 2YNMD 5TPZD 1NVVQ 2NGRA 2WAQF 1P5ZB 4I55B 2GZDA 4DUGD 5DBAA 1S4MA 1W0JA 1T5HX 2QQ5A 1LY1A 4G5GA 3SM3A 4D9HA 3EUB2 3ORHA 3ZK7A 3N75A 4DG5A 3U19A 1IU9A 4MRPA 1NVAA 2O3QA 1BPDA 2ZVDA 4GBED 4F4IA 2MYTA 1J1UA 1ZQMA 3GGCA 2XLCA 4LX0A 4IIXA 4RV4A 4HLUC 1UFOA 2WFZA 4KTQA 4RA9B 3S2EA 1H0SA 3LQRA 2A0WA 1UKVY 1YJBA 1AGNA 1HG0A 2H0QA 2LE0A 4DR5B 3GLRA 3HJNA 2PAFA 3Q8MA 3RVBA 1TW3A 1X8LA 3AFMA 1VMEA 3M1YA 5JCPA 3RH5A 1BPBA 4FFRA 3QBTA 3ZCPA 3HMKA 3OQ6A 5C5IA 1Q1BA 2J6IA 2AFIB 5LDHA 4OI4A 4Z3KA 4KLCA 1V43A 1RTTA 3D2SA 1Y8CA 3ACBA 4MYDA 5REQB 2JATA 4HDAA 4F4WA 3H1FA 5IT5A 1PNTA 3DO8A 1CCWA 3OA0A 5TR9A 3CIFA 3CU5A 9ICNA 3MB8A 3R3YA 1P3Y1 2ZITA 4NU6A 5KYKA 4MFCA 3CRXA 3KEOA 4FDUA 3W2EA 4RIFA 3KQKA 1NBMA 1FFWA 4P2HA 3FR8A 1O6BA 3B6JA 4GXJA 2HVHA 1Q95A 3MYYA 4DDKA 2UZ3A 1P9OA 3PU6A 2HWXA 1HI9A 4DCNA 4URHA 2WYHA 3BIXA 3MNFA 3KV3O 2GLEA 3N7AA 2GK3A 1W44A 1CYEA 1JDVA 3NBXX 3GLFB 2ISQA 2AK3A 3A06A 4OL9A 4UHCA 1GUBA 2ODGA 4NL9A 3K4GA 3UGKA 3NXSA 1R6DA 2G0TA 3BCUA 5FFFA 2IKSA 2MWMA 4BO4A 5L3SA 5IVHA 2FEMA 1H3EA 1I30A 1FTNA 1Z4JA 4EUEA 2QMYA 1SIOA 1JNYA 1YRQA 3DE0X 3W05A 2AA3A 1OYWA 3WB1A 4BEVA 4ENPA 2A9QA 4RNDB 2R7NA 4XCVA 2NRWA 4EHNA 2R86A 3AR5A 1XZFA 4HDMA 5TPZA 1JH9A 2EFHB 2W00A 3H6GA 4WOPA 4PLVA 1TFUA 4RHEA 3UNXA 2ATVA 2WVHA 3GRUA 2PMZC 1R15A 2WU4A 3MMPA 3R2JA 4BRUA 2ZIVB 3E8XA 4MW4A 5C0YA 1ODIA 1XSPA 4KLJA 3G5TA 2FN7A 5BO5A 4AJNA 2GZHA 3NNDA 2DQ4A 4LRSB 5HGJA 1C7RA 1K68A 2YYYA 1LDYA 5TVGA 2FNAA 2FOLA 1XQ9A 3F98A 5JSUA 2E1EA 3BCHA 3EG5A 2GF0A 4MV9A 4MVYA 2FSPA 3VI4B 4HSEA 4AJEA 3LX6A 1QHSA 2QROA 5YASA 2QWXA 4GKBA 4IZIA 5ALDA 3G0OA 2QUZA 2VJAA 1OLSB 1R4NA 4MVJE 4GOXA 1O0CA 2QVGA 5C80A 1XJWA 3F5FA 4ZALA 4UVHA 5JFOA 4PLGA 3WISA 2SKCA 5C7IO 5B4UA 3HCFA 3TI0A 1GZVA 2PMEA 1H2FA 1PYGA 2TMDA 4FE7A 2PZLA 3QRWA 1CB0A 1FSZA 1LLCA 3G89A 2WHEA 3RRGA 4P0PB 3QU2A 1AUOA 3IR6A 3CT4A 3Q98A 2W98A 1CQZA 4JXKA 5HUQA 4N3NA 4R98A 2CZQA 3DDCA 3BS7A 5J2TA 3OFKA 5DNEA 3AERB 3ZE9A 1F60A 1Q7TA 3AMZA 1J8VA 1JA1A 1WQ3A 4EAQA 3KKMA 5AVSA 1X70A 4GZ3A 1XELA 2A86A 2W8BA 4IOMA 5HKLA 2ID9A 4WNIA 3ZDEA 3VKHA 1E1KA 6YASA 1DX9A 2PVPA 3WJ1A 2DG2A 1G21B 4JASB 3I76A 1YVEI 1SU4A 2V6IA 3ANYB 4M88A 3G1WA 1CEQA 1FVOA 1KP9A 3C5EA 1B1CA 1XHFA 2QE7A 1EX1A 2YJGA 3BMCA 1H4TA 2F64A 2C31A 2M6KA 5IJ9B 3MWEA 1XP5A 4OYRA 2X0NA 4P0PA 1QWOA 3AXSA 3W5VA 3OEWA 2HHTA 4XYBA 1CUFA 1T5TA 2V7WA 4QNNA 1NYRA 1HSOA 1KQPA 1QIIA 1U0TA 2B98A 2N9UA 4S35A 1EDDA 5LFAA 3L7NA 1WLYA 3MTBA 1A7KA 3HVUA 4PZ0A 4AIRA 1L6NA 2C3PA 1CU1A 2R84A 2ZGVA 4KDCA 3NASA 1LJUA 5EMKA 5G53C 4CMIA 5KPJA 1SU7A 2BGIA 2BMEA 2PUFA 3NV7A 4IHKA 4PQGA 2LXNA 3F8TA 3ROZA 4G1EB 4BE9A 4Z54A 1PTJA 4D9NA 3JYLA 3I8XA 4PIMA 5CU7A 4E33A 7YASA 1ED1A 1U99A 3HYTA 1D9XA 4MRAA 4O4IB 1L4EA 4N9WA 2OXOA 3GA5A 3FHTA 1MRNA 2LKYA 4PHAA 1GPH1 1YJ5A 1ZXIA 4QPJC 4D4LA 4ARCA 1L5FA 3PD1A 4O2BA 2Y4NA 3H40A 1XVTA 2QIPA 1ZM7A 2X0JA 5JAQA 2RIPA 3IXQA 4JUIA 3QJYA 1V6CA 2I6SA 2XRMA 2P68A 3RM3A 3BB1A 1RC1A 3NNSA 3DV9A 2YHIB 5JJBA 2ZAYA 3VO8A 4L9AA 1WZNA 4YECA 4DLRA 3FSGD 3M1LA 4N7RA 3UJCA 1X1AA 4S1VA 2IITA 2X5NA 1TO1E 3P0EA 4BZWA 4OJLA 2OCIA 3HNRA 4M86A 4XIFA 3TTYA 4DB2A 1NK6A 4HLCA 4IBOA 5MGNA 2WG2A 3W8EA 3OIVA 3KJQA 2ZYGA 4F4JA 3L3FX 4KN7A 3HJGA 2CVFA 3N87A 3ESZA 4BV2A 3RRMA 3IT3A 2IE8A 3M5CA 5TNXA 3IULA 3VPGA 4E14A 1RD4A 3VHXA 3ZE2B 3DDNA 1L4MA 3GRFA 4JQCA 5CNIA 4AU1A 4D41A 1J6UA 4XD7A 3VZDA 1CJVC 4HFNA 3ZJ5A 4C5AA 5C7YA 3ZDBA 1CEYA 3TTUA 3GFTA 2XNJA 1U7ZA 3MQ4A 4K9DA 1FMTA 5A7HA 3U13A 4ECVA 3HSSA 1CQXA 1QNFA 1XNJA 4BNZA 1CUDA 1W0KA 2AZTA 5FB3A 1GIAA 4QRHA 3VR4H 5A62A 1PI3A 5IF3A 1RU3A 4GSYA 5EP2A 2HRDA 1UEXC 3HR4A 3M6XA 1F0MA 3Q15C 4C03A 1VOTA 3ZGOA 4AMVA 4J7UA 1XTUA 4Z7QB 3FWYA 1NAHA 1XTKA 4BNDB 2E3TA 1EP1B 4CUKA 1VYVA 1A9PA 2W6ZA 1FFXB 3LW8A 3B12A 3WV4A 4YR9A 1X38A 3HXKA 3P9ZA 2NRTA 2Q8QA 1G4HA 3R1IA 4L4ZA 2PZAA 2AU0A 1ZVJA 3G2LA 8ICYA 1LV8A 2O7QA 4TS9A 4XFDA 1UM8A 4BWVA 2NSHA 1ZIYA 3RHFA 5CG1A 2C7QA 1VKNA 1XPUA 5DKFA 3WLFA 4BDPA 1VHLA 4YEDA 2UYHA 4JJ6A 3K9WA 4F4ZA 2OXFA 1ZQJA 1Z34A 2JCSA 4UQPA 1ZEMA 1G20B 1SCDA 3CNNA 3F73A 3CPSA 4MGHA 2EKDA 3NHKA 3PF9A 1FY2A 2IEBA 3NZEA 4E46A 3UTCA 2IHZA 3X1MA 4OA5A 2OCLA 1E18A 1M6EX 3U26A 1NM5C 1NMSA 3BQ9A 4W7SA 1YVUA 1WNFA 4QXMA 1OYOA 3KZIU 1MC4A 3MA0A 3V9PA 4MYUA 4BQRA 4XD7D 4ID3A 3ZJTA 2C58A 2IXFA 1ZQAA 1ECPA 1XYYA 5HNKA 2HLPA 3KPVA 2WP8J 5I8ZA 4JBNA 3SJ7A 4BU0A 2ZJ4A 1UBUS 3RF9A 3ZCSA 1U6JA 5EJGA 1FLVA 2CLHB 3KKAA 1E5QA 2HNBA 1Y8QA 3A6LA 4LRXA 1XMOB 2I76A 1EFDN 3JASB 2H1LA 4LAFA 4E2WA 4F8YA 5IDVA 1XROA 3B20A 4HGPA 4DTIA 4XWWA 1QK5A 3F78A 4CR6A 3JD2A 4CQJA 1F4PA 4GOOD 4JROA 2Z5FA 3OJSA 4LC9A 4TMYA 2PGJA 4PGHA 4CR8A 2ACVA 3GN1A 2YJ4A 3O1HB 4RDXA 3WGQA 1SELA 1O96B 2INGX 3W2GA 2P2LA 4M38A 2C2BA 3AUKA 3H4TA 2LM1A 4HGZA 1I6KA 3STYA 2QW1A 2A1UA 5ICFA 2CV0A 1N7IA 1WE2A 4BNTA 2HDNB 4OV6B 3VR3A 2VP2A 3T8YA 3II6X 1TM5E 4YJDA 4ETWA 3GT4A 4INPA 1TCCA 3CG4A 4D81A 2UU9B 4LHWA 3HA7A 2YZ2A 3G13A 4GVLA 3OQNA 1S3SA 1OJ7A 1J99A 1SGWA 5FTNA 4MEAA 5DOVA 4ARSA 3SKXA 1NI3A 1FYVA 1COWD 2JARA 4YDHB 3UUWA 4MTCA 1V3VA 1MNAA 4PL2A 4QYMA 5BQ3A 3KKNA 2V7BA 2HK7A 3AIKA 1B22A 3BFPA 2RP5A 1YQUA 3USES 2PWZA 2HDOA 5E4TA 2NYAA 3SEAA 1JHUA 1L4UA 5B58T 3VYRB 1KBZA 7ICRA 3PITA 4YT5A 1EHYA 3HPOA 3NUQA 1IIBA 2XXBA 3HCEA 4NMLA 5TARA 5AVRA 1TAHA 1NBWB 1FYWA 1MRSA 3HKDB 2ZBUA 4P3KA 4IXDA 5CJPA 5KTMA 2XUHA 2B4AA 4Y18A 3VDXA 1SKQA 4J0HA 1N4AA 5A6SA 3I73A 1IAVA 3NPAA 3M4XA 3B51X 3ZH2A 3ZQUA 3ZCQA 4ZCRA 2YY5A 9ICKA 5J2IA 2HRCA 5JC1A 4Y9SA 1A4RA 1X14A 2I78A 2PSHA 1Q74A 2GT1A 2OGSA 4GM0A 3OHMA 4QJIA 3CKLA 1N3IA 1NXWA 1IE3A 1UMBB 3MOSA 4RLHA 5H4GA 2PTGA 5KYGA 1BQ3A 4P08A 4TUYF 4FMCB 3DKKA 5TISU 2VJYA 2X3YA 1A2QA 2KMLA 5L3ZA 2I55A 4FZJA 4I6JA 2WUEA 4P93A 5KTTA 1KGSA 4N65A 1CSEE 1ZOOA 2P3QA 1RWKA 3IT1A 1UDWA 4A8JA 5I7HA 3JQBA 3QKWA 3DAPA 4YS6A 2VT7A 1R2QA 4LOIA 3TQIA 3W7BA 4CM9A 2MYUA 1MOQA 1R37A 4DXDA 3VTKA 5LMCA 3S8YA 4Q48A 2JZCA 3KB6A 4NPAA 4JEHA 2QLTA 1SHLA 1Z6AA 2CBXA 2H1SA 3OU2A 4NDNE 2F4NA 2CVQA 5I9LA 2BGGA 4N3GA 1KPGA 3DL7A 4R5HA 5KFUA 1MQ3A 1E5DA 3DW1X 4ND2A 5J59A 4ER0A 2CXSA 1HNWB 5JCOC 1N6NA 4FI3F 1HXHA 2QJFA 2P2YA 1ZPDA 4M76B 4RMIA 5JXGA 1ZXBA 3UZUA 2OHJA 4CQLA 1WHTA 1ZK3A 2E4YA 4KX3A 3VDQA 4AULA 2XWSA 2A59A 4B44A 1A3CA 2XZLA 3OJOA 4NEHB 2PM8A 3NBQA 3L1UA 1Z5WA 4O4IA 1EVJA 1U48A 3GVHA 3TTSA 3UB3A 5L7TA 4AC9A 1LDMA 2IUFA 2JI9A 3GGDA 1XXHB 2C2DA 2OXRA 2C4UA 3TX6A 5C1IA 2DH5A 2YFQA 3LLMA 1C9MA 3IAAA 3DXYA 3UKDA 4AN1A 3DAYA 1M0EA 1R6BX 1RZ3A 4B5LA 1ZH2A 2LBPA 2Q4BA 3RC3A 5GOZA 3THVA 5G0WA 1F48A 2AD1A 4WY2A 2J0UB 4QLBA 1US8A 1X7WB 2O4CA 4Q9HA 1XVIA 3V55A 3D7NA 5HJ7A 3BDPA 3H0RB 1F8GA 5J23A 4KZKA 2GM3A 1BCSB 4QOJA 5KT7A 2PUDA 3AXTA 5LSAA 4U7CA 1N7JA 1P4JA 1U80A 3EWIA 1UJMA 3JPWA 3AYXB 3D7LA 3LKBA 4X44A 1EGHA 3S29A 1A2KC 1PJ2A 1DADA 2ZSBA 4X1YB 1RLTA 1X0VA 5F7JA 1DMRA 4R1OA 2IS4A 4IKPA 1ZW1A 2IXAA 3A9UA 3C29A 3PNLA 4DLBA 2PV7A 5MFZA 3OU7A 5EJIA 3TLXA 4CEJA 3FF4A 4UBNA 5I8WA 4I2GA 4NH4A 4USAA 1WSWA 5A4IS 5I4BA 5IRCD 2FW1A 1JU4A 4U0KA 2JZBB 1ZZGA 1YRLA 2R7LA 3I1FA 4ITVA 5IARA 2R8IA 2HT1A 2Z9BA 4G23A 2W6MA 3PFFA 4Q5IA 4A8TA 1Y5NA 4UAVA 2PRKA 4P1ZA 4WFIA 4DIUA 3ANTA 3M7DA 3C8UA 2E4XA 4UJ3A 4AJ9A 5FUWA 2V3VA 2CEAA 2O6KA 1TVMA 3DPIA 3DAHA 1EZ4A 1PHPA 2G8NA 3USZA 1E9RA 5C37A 4TROA 4L5AA 2P4QA 4JK1A 4DGQA 4DZZA 4F93B 1R5JA 2GFIA 2VHYA 4PYMA 4XA5A 4X45A 1WPQA 3UC9A 1UZAA 2VH1A 1T2DA 2PH3A 2WYOA 3Q2KA 4R3UC 2FR1A 2FKNA 3FRJA 3EC7A 3WBKA 2WZCA 4BV9A 2V7PA 2XYRA 1JSCA 2WD8A 4HWKA 2M6LA 4BMPB 2BFNA 2H1IA 2IXEA 2QI9F 3GFRA 5LB2A 1BN7A 2Q5EA 4ZQHA 4CPDA 3MRXA 4XIJA 4KWCA 2AK2A 3L1JA 1Q3UA 5CLHA 3F1KA 1Z74A 4NRDA 5LQUA 4JI7B 2XDYA 2O2DA 2GK7A 3I9V6 3DF7A 4YMWA 4CQNA 1IZ9A 1UP6A 2VNIA 2XVZA 3HYSA 1NNSA 3HM2A 1YJXA 1D0VA 1D1PA 1BCSA 2WJJA 1VJ0A 4DHEA 2YWJA 3G2IA 3A70A 1KPIA 3T9EA 1L5MA 2XNDA 4FCTA 4M83A 1DCTA 1U2DA 1TTPB 3V4OA 2HY7A 4FCWA 4DB4A 2BQ3A 5HIKA 4Y8VA 1M75A 3A1UA 3I58A 4YCAA 1MO3A 3O8RA 2N46A 4KAJA 3A04A 1T94A 1RWQA 2EW1A 2ZJ3A 3QKUA 2CXOA 1Q1QA 4DL5A 4WKCA 3EA5A 2MIIA 2DPMA 2QTLA 3O31A 2PKCA 3QPBA 4GM1A 1D1SA 1VSQA 3C4VA 1FTYA 3VVCA 3ZD6A 3DHNA 4MUNA 1TUIA 3M6MD 3U44A 2TMKA 3ISDA 4JVSB 4KR3A 2WTBA 2P3LA 3OMXA 1ZCJA 4AXBA 1ULBA 1RXIA 2Z95A 4PV7A 2B3DA 3EMDA 3OZUA 1VJGA 5H5JA 2OBYA 3B6KA 4R0NA 4BP1A 4YMMA 1F9EA 2WWXA 4GLFA 1IMOA 3LDAA 1OFUA 5DX1A 2ILVA 1NW7A 3G5UA 4CV1A 4TYNA 3FNEA 1DNPA 4BIMA 4Z4IA 3KOYA 3U7QB 1KXZA 2Z1NA 1BPYA 3CCCA 3IP6A 3RYHA 1JLLB 3EUAA 1MU0A 4MCIA 4F2HA 5DQHA 4G56A 1AQNA 2ASVA 4IH9A 3IIJA 2IU3A 3H1PA 2I4MA 1E8MA 4Z2YA 3GG9A 1GAXA 1E0DA 3PVSA 1OFUX 1H05A