4EELA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound citrate and sodium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
229
structure length
229
Chain Sequence
b'DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase-related protein
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 81
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eelA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eelA01
3FVVA 4UATA 3WKAA 4MUMA 5AESA 1L8OA 3ET5A 3U26A 4XPZA 5AVYA 3DAOA 2WF6A 3IJ5A 4OFZA 4EX7A 4JB3A 2I33A 4UASA 2Q4TA 5ALLA 3NUQA 3U7FB 5AK3A 3E84A 4EEKA 3KD3A 3PCTA 4RETA 5ALEA 5A3SA 1ZRNA 5ALMA 4Y2YA 3U7HB 2WHEA 3I1YA 2WFAA 2QLTA 1F5SA 3FPSA 5AKIA 3L8EA 1LVHA 2MU2A 4HAIA 3QUQA 3ZX4A 1L7MA 1RMQA 3WKEA 3ZX5A 2JAUA 3KZXA 2W4MA 2FDRA 2B8EA 4Y2TA 4Y2SA 1FEZA 4H1WA 5AIAA 2YJ4A 3CZ4A 2YMQA 1U2TA 3W5DA 3HLTA 2HSZA 4FE3A 4ZEWA 3ESRA 3AR5A 1NF2A 4AS3A 1RPZA 5ALKA 3L8HA 4L6AA 1J97A 4OHFA 5A3RA 4Y2UA 4NABA 3MC1A 3N8GA 2EAUA 4HGQA 4UM7A 2RARA 3WKCA 3SD7A 3L8GA 5AKJA 1ZS9A 1L8LA 1ZJJA 4UAVA 2FPSA 4F72A 3WK4A 4HGNA 5AKYA 2HEGA 4OCZA 4HGOA 5IS2A 3ZW7A 1Z4JA 3R9KA 2ZBEA 2I6XA 2R8YA 5JJBA 5ALPA 2ZBGA 1PW5A 2WF9A 2DQSA 1VJRA 2R8XA 1WPGA 4UU0A 2G1AA 3WKDA 3FZQA 3ZU6A 5AVSA 3M9LA 1Z4IA 1Z4NA 2R8ZA 5AM3A 2C88A 2Q5EA 4BNDB 3OPXA 4L57A 1RMTA 3L0CA 1Z4PX 4ZEXA 2IOFK 2ZOSA 4GXTA 2WF5A 4UARA 2OBBA 3KC2A 3AR6A 4OD0A 3KBBA 3E58A 2NO5A 1ZRMA 3S6JA 4IFTA 1N9KA 3TLMA 2O2XA 4YIKA 4HYTA 5AI5A 1AQ6A 3HYCA 4RESA 2FPXA 2B82A 4UMVA 3I76A 3A1DA 1U7OA 5ALDA 3ZTYA 4AP9A 5AKEA 3A3YA 2HO4A 1TJ4A 4CF5A 2FI1A 5ALGA 4YH1A 3ED5A 3FM9A 4ZEVA 5AW8A 4Y2XA 4EELA 3VAYA 3ZVMA 1YV9A 2PQ0A 3UMBA 4UM5A 4BBJA 2HHLA 3D6JA 4I9GA 4DW8A 5AHXA 2G80A 2CFSA 2RAVA 4UAUA 3N1UA 3R4CA 2C9MA 2GFHA 4QQFA 3QXGA 3N28A 3L8FA 4XOUA 5ALRA 3QUTA 2I55A 4C4RA 2YJ3A 2EATA 3EF1A 2AMYA 1ZOLA 2BDUA 2YBDA 1RLOA 2G0AA 3QNMA 5AK4A 5AI0A 5AKXA 3M1YA 5AIBA 2AGVA 1Z88A 4B6JA 5ALXA 5ALWA 2JGAA 5ALNA 1YS9A 2JAWA 2GO7A 3ZTWA 1QH9A 4O8CA 5AI9A 3U7GA 1Q92A 5A3QA 2PR7A 3OCUA 5AKHA 4EX6A 1L7PA 4BKMA 1VFPA 2CFTA 5AW3A 1YNSA 4J03A 3QU7A 5AICA 3ZUPA 1Q91A 4YIHA 1Z5GA 3R09A 2B1RA 3E8MA 2RBKA 4HGRA 5T41A 1JUDA 4FFDA 5AW1A 4UW9A 4Y2RA 1RKVA 1K1EA 3AR9A 2VKQA 5AVZA 3QX7A 4AS2A 4E88A 4DWOA 3IB6A 4CE6A 2QYHA 2WM8A 2HX1A 2FPRA 1VJ5A 3PGVA 2W43A 4BEVA 1SWWA 1T5SA 4JDPA 1RLMA 2HDOA 2YJ6A 1L7OA 2HCFA 3A1CA 2FEAA 3UMGA 2GHQA 2W11A 3NANA 2P27A 2HOQA 3N07A 3NIWA 4F71A 1TE2A 3OTQA 2P69A 4NV0A 3U13A 2JAOA 4UMEA 3NRJA 3U19A 4UMFA 2GHTA 3SKXA 1RKQA 1N8NA 1J8DA 2RB5A 5AVRA 3I28A 3WK7A 3WGUA 3OCVA 1S8OA 1YJ5A 3IRUA 1RDFA 3L1UA 3W5BA 5IT4A 1KYTA 5AW6A 2WF7A 3AR2A 3MMZA 3P96A 3NALA 1ZD2P 2ODAA 2B0CA 3ET4A 2YMMA 1EK2A 3I6BA 3EF0A 1Z4MA 3QGMA 1RQNA 3K1ZA 4I9FA 2Q4RA 2ZG6A 3U7EB 2R8EA 3QU5A 1RC8A 3WK8A 4YCNA 1L7NA 4EZEA 5AKLA 2G07A 3L7YA 4DCCA 3PDWA 1IWOA 3OCWA 3AR4A 2B8JA 3DV9A 2D2VA 4FYPA 3WGVA 4L6CA 2I54A 3WKBA 1Z4KA 2ZBDA 3AR7A 2P11A 5AI8A 3SF0A 5ALHA 4CF4A 5FP0A 3B8EA 1MH9A 2YMLA 3UMCA 3WK5A 4PNHA 2G08A 4BX2A 4XE5A 3CNHA 3QU9A 5ALJA 3B9BA 1T5TA 5ALZA 4J2TA 3RF6A 5AM0A 5AM5A 5ALUA 3E81A 1Z4OA 4G63A 2IYEA 2CFRA 3KOOA 2HF7A 1O03A 5AVTA 4CNQA 2EARA 2FPUA 1SU4A 3EWIA 3MPOA 2FUEA 2G09A 2OM6A 5AM1A 1WR8A 1YDFA 2BDEA 5AW9A 1Y8AA 4YCMA 1ZD4A 3F9RA 5ALVA 2C8KA 4DFDA 2C4NA 5AKGA 3DNPA 4KNVA 1X42A 1TA0A 3BA6A 4XQ0A 1O08A 3OCYA 5AVQA 2OA0A 2JARA 3ZI4A 2CN1A 2GMWA 3KDPA 1QQ6A 5ALOA 1NRWA 3BWVA 4KNWA 5AK5A 4BX0A 1EK1A 2FPWA 2WF8A 3PGLA 5AI4A 2YN4A 3B9RA 4KX3A 3RFUA 4KX5A 1T9ZA 1U02A 3MN1A 2B1QA 3QU2A 5AW0A 4BX3A 5ALFA 2BY4A 5AI6A 1RLTA 3ZWKA 4CF3A 4GIBA 4Y2QA 3UM9A 3QLEA 5AW7A 2ZBFA 5ALIA 4YCLA 1TJ3A 4BNDA 2AH5A 4BYGA 5E0OA 2I34A 5ALSA 1WVIA 3ZWDA 5AW4A 5IT0A 3AR3A 3W5CA 1S2OA 2B30A 1RKUA 1YMQA 3SLRA 1NNLA 1SWVA 3ZVNA 1XVIA 3QUBA 3SKYA 4G9BA 2IOFA 5ALYA 2G06A 5AVXA 2YY6A 2FUCA 4UU1A 1WZCA 4KYTA 3L0YA 3OCXA 4KN8A 3WK9A 1U7PA 1TJ5A 4Y2PA 5AKKA 4NWIA 2ZXEA 2YJ5A 4C4SA 3L5KA 1Z5UA 3QYPA 2NO4A 1Z4QA 3QUCA 3AR8A 2NYVA 4NAVA 3GYGA 3OCZA 4HGPA 1QQ5A 5AVVA 3NAMA 2OYCA 4BEWA 2YFYA 5AW5A 5ALTA 1QYIA 1QQ7A 1XP5A 1CQZA 1Z4LA 1RRCA 4IG4A 5AKZA 2IOHA 1RMYA 5AVUA 3N5KA 2IA5A 2MU1A 2P9JA 2O9JA 3SHQA 4Y2JA 3FPBA 2YMPA 1ZD3A 5AVWA 2HI0A 3A1EA 2X4DA 1XPJA 2AUTA 4UMDA 3QU4A 4MWOA 5ALQA 4NFLA 3FGOA 5AM4A 2I7DA 3W5AA 1CR6A 5AW2A 1U2SA 3WK6A 1RQLA 2PKEA 3DDHA 1L6RA 3ONNA 3L1VA 4C4TA 3ZVLA 3SMVA 3EPRA 3L0BA 2MSNA 2HF2A 4Y3UA 4QJBA 3J7TA 3ESQA 5AM2A 5AK6A 2C8LA 4EENA 3NASA 1ZD5A 4Y2VA 1LTQA 4YGYA
chains in the Genus database with same CATH superfamily
3KX2A 3MGBA 2BL4A 1Q7TA 1GDDA 1HDOA 2QD1A 4PFQA 3CISA 4ZRDA 4Y2HA 5EEGA 4MQMA 2GEFA 2CE2X 4HYKA 3H13A 5HWSA 4EATA 5CA0F 4W63A 2W9MA 5ILGA 4LISA 1OU4A 4N48A 2IYFA 4EJMA 3T34A 2VJCA 4HXFB 1ZNYA 5HK8A 3CP8A 4IQTA 5JY1A 1AKTA 5GWXA 3TDKA 1S02A 2C5LA 1W0KD 2OZKA 2K4EA 1DCKA 4NLLA 3GBPA 3SMQA 3H9QA 2OVBA 4G5QA 3H4BA 1IV8A 5A3RA 4OGGA 3HCNA 4HGQA 2DPLA 2XE4A 4H59A 2PXXA 3RAEC 1ZGZA 4KN5A 1IAVA 5IS2A 3KS9A 4MAFA 3IAEA 2K8CB 3CRRA 1I3OA 1EVYA 2FEOA 5J47A 4DSZA 2Y77A 4RZRA 1HYHA 1I7DA 1WW3A 2I6GA 4YCSA 5CAEB 4ZYWA 1W88A 1JV2B 3G02A 3TVTA 3FDSA 2GTHA 5DISB 3WWYA 3ZTYA 3W4KA 2BM0A 3ETGA 2DU8A 1FNMA 1RIFA 2YUTA 1F2VA 3F71A 1NYTA 4V0SA 3Q8XB 4NL9A 1N5LA 3VU9A 4B6OA 2FN7A 2ET6A 3S40A 1U80A 4MQFA 4E5MA 4MX8A 1H5NA 2XMZA 1V6CA 1W36C 3D5EA 3DUWA 3Q8KA 4PEVA 1DARA 5K0CA 3T38A 4YMHA 2QRVA 1G8MA 2DWOA 5C1DA 4R4JA 4AMVA 1GPAA 2A0WA 3NOOA 5GIOE 4PXYA 2JI7A 1U47A 1UBUS 5D85A 1U1CA 3E70C 2W2KB 2AMJA 2XCOA 5B6IA 3HH8A 3VNVA 3FJYA 1O2DA 4FFBA 4LK2A 2LMRA 3U4QB 3S7TA 2B37A 5JSZB 2WAQF 2Q9AA 2R7MA 5DGCA 4RKYA 2P69A 3LUHA 2E8OA 3H4TA 4BAUA 3IAXA 1AQUA 1UXHA 2VAPA 3DLIA 3GDWA 4RZIA 4K9RA 1U65A 3NALA 4UFNA 3TR6A 3M70A 2ZTLA 6Q21A 2JRCA 1Z5VA 2QM0A 3PL5A 4YJHB 1GDTA 3VMMA 4A0QA 4AUMA 3ENZA 1TGVA 4HDCA 4NV1A 2X4IA 5C52B 3UPUA 4Z6DA 4IDEA 2PKXA 3WK5A 4MGHA 3MQ4A 2Q4EA 3VZPA 5LM3A 2FE1A 2IZOA 4J2TA 3IIEA 2Q3JA 1KHHA 1QGUB 2SKDA 1VSTA 4J1NA 3VU0A 2O2YA 4R9SA 2FPUA 4RK4A 1TCVA 4OJKA 4CKYA 1NLYA 3AKYA 4DFPA 1MB4A 3T9BA 4UBKA 5ALVA 3BXFA 3DOFA 3QKSB 5JJ5A 4HEA6 2WJWA 4YAFA 5CA0A 5C3MA 2FPGB 3KEOA 4ZREA 4YHHB 2Q3MA 4B7XA 4EYOA 1P45A 4BX3A 4LVSA 2VK2A 3OZVA 2BUCA 5DYGA 4YCLA 1OW3B 2GZMA 4O4LF 4IXMA 2OHVA 4NBTA 1XZJA 4Q39A 1NU6A 3ZXYA 1EBBA 2FN3A 1OI4A 3K7EA 1L4BA 2NO1A 3ENWA 3ISTA 4L8WB 2ST1A 2X1MA 2PUAA 2VWQA 2CBXA 4CRWB 3HSSA 5ALTA 4R8LA 1XP5A 3R2JA 2ZU0C 1O95A 1Q46A 2AHRA 2V7EA 3CUTA 3O8OB 3U7IA 2ISSD 4BZWA 5HKLA 3HJAA 1KO4A 1QYXA 2IDJA 2DPYA 4ZT3A 1XTJA 3K72B 3FGOA 1A2KC 1XZ8A 2C03A 4N3NA 2FQQA 4LI0A 4OJQA 2IIBA 1UBJS 1GZ5A 2A5LA 2G3YA 3BS4A 3STHA 3R0VA 2ZR7A 5B3AA 4B87A 2GOLA 1AC5A 3QELA 4EG4A 3LKBA 2ASDA 1CZUA 2WYWA 1DXYA 3BWBA 4YRSA 3HJBA 1E3SA 1R6DA 2NQ8A 4X8LA 4DV2B 3N39C 1Z2OX 3I5XA 5KYUB 2RKBA 4D3ZA 4LV5B 4Z7OB 3IDFA 3FFXA 3RAJA 4F5EA 3CR7A 4Z9BA 5JBIA 4ZDJA 4JYAB 5KG0A 2PAAA 2WWFA 2Y6VA 4N12A 2RARA 3OPNA 1V41E 1VDMA 3GB9A 4LZNA 4IQUA 2C78A 4JI3B 1MOSA 3U3MA 1LRKA 1QJ4A 5FLXA 2K60A 2F76X 1ODIA 1GYQA 2X5NA 1QONA 2AXTU 3HADA 1PL7A 1JEOA 2D62A 1ZD1A 5D84A 3M4YA 4US1R 4V2IA 4CV2A 3RBAA 2GNAA 1QYCA 3Q9LA 1NMYA 2GA8A 2X2OA 1HLPA 4N01A 2OZEA 3SX4A 5FDFA 1XX6A 5E6RB 1V26A 2SICE 5FL7A 4M9GA 3UW3A 3WLIA 3EGEA 1M74A 5KX5B 4G85A 1PK1A 1G6KA 1C81A 4DCVA 4YGXB 1YS2X 4RY2A 4OAPA 2BJHA 5HILA 3W78A 4M1ZA 3KUDA 2D0DA 2CFCA 4L4RA 3G9ZA 5AKHA 5K20A 2WSSD 5AW3A 3IA7A 4PAWA 2RK6A 3V7UA 4LY3A 5JHHB 1DTSA 4S0XA 5LZ4A 1U9IA 1XSNA 2AOTB 3AC0A 3GEEA 4YUVA 4BEVA 1QQBA 2XWJI 2HDOA 3PVSA 1X1EA 4GOKA 4ASUD 3GIKA 2Q3BA 5JS2A 4L51A 4RNNA 1PG0A 3ZIAA 1JR2A 2K87A 3L8ZA 4NL9C 4TUYF 3QI7A 1KDTA 4FS3A 4CTOA 2L19A 4I81A 4PVDA 3FPFA 3EXIA 4QL3A 4ED6A 1K5PA 3LLSA 1BJTA 4OQQA 5TY0A 4P4LA 1T43A 1SZPA 4MPJA 4ZHSA 5B6JA 1K7XB 3LWZA 2X1HA 4PSCA 8ICYA 4NV3A 2X58A 5ALZA 5J9FA 3ES9A 4BP1A 1UCVA 2ATVA 3UAWA 4JIGA 2IWHA 1BDBA 1JB9A 1JX6A 3ZDXB 1XG5A 1XHEA 5LKRA 3CSSA 1Y8AA 2PI5A 1G3MA 3J80A 2KVCA 1FDVA 2OYSA 3ZWMA 4DCPA 2PGNA 3BA6A 4DBVO 4JBHA 3O47A 1XJQA 1KSGA 1CQWA 5ALOA 2IUTA 1OW5A 4UE2A 4ADSG 2AZXA 2CLOB 4LY0A 3DFMA 4WA7A 1EGVB 1BMDA 3H8WA 1Q17A 1T1RA 2PYZA 2G5PA 1SK8A 1P1HA 1W19A 2FW9A 4PHDA 1IHUA 4OA5A 2IELA 1K9SA 5J0PA 1NVUQ 5EUMA 4HB0A 3GNLA 2ZB7A 3C1YA 1XIVA 4F1KA 4DEYA 1GFSA 4XCQA 1JI0A 1FS4A 4MLZA 2MSEB 2OH2A 3SI7A 1FNDA 2J0VA 3ZHRA 4H7HA 4B6QA 4W7HA 1CQZA 4FMCF 2F3PA 4NTZA 3SLKA 2PQ2A 5FTWA 2YWEA 3GFBA 4JP5A 2REQB 1VE6A 4FDVA 2BCQA 2BDTA 3N59A 1EVQA 2QL5A 2XCUA 1L7DA 1JAIA 2QA5A 4F4KA 5C2JB 1KGSA 3SQNA 2O8VA 3PS9A 4NAHA 5I9NA 3TRFA 1P60A 2A9PA 1R9JA 3UH0A 1M0WA 4R1OA 5GONB 2BR5A 3TQ1A 2Q1YA 3ENKA 1G9SA 4LMRA 1H22A 1BVSA 2BI4A 2XMSA 3PQCA 5KFHA 4UUAA 3DWGA 1SCBA 1LW7A 4HLCA 1E2DA 4BCBA 1B8NA 1Z6AA 4II3A 3EFOB 3A3OA 1V3TA 2PEYA 2FX3A 3PC2A 1Z16A 2XTAA 4DLSA 2IUYA 4DDUA 4EHJA 1KOJA 1O95C 4RS3A 2YVQA 1FXSA 3LU1A 1LLFA 2JLQA 2OCKA 2C7RA 3PW2A 5KNBH 4GPIB 4UB5A 1PLJA 2TSYB 3ZCUA 3A6ZA 4ZO8A 3N70A 4P4TA 5FPTA 1YFJA 1ZGBA 1SEPA 5JO0A 3A3NA 2FP3A 2NP7A 4B34A 5E8RA 5FOUA 3OQPA 3TINA 3K2QA 4F2WA 2CLCX 5DBGA 4PNEA 4JXKA 1LI7A 1ZQ9A 3TKYA 4MKXA 5IVKA 4P83A 3WO0A 2JJ1D 4RM3A 4EO9A 3QBEA 2HDWA 1PT8A 3UGQA 5ALGA 4CU5A 3U37A 2JL1A 3JPTA 3KOZA 3AEKB 4E4TA 2R65A 3CE9A 4X1IA 4WN9A 3NIDB 1MA0A 4FILA 3KAQA 2REOA 4NE9A 2P9BA 1X1CA 5DN6D 1W0CA 1A71A 2FZGA 2QVLA 4KR2A 3FC4A 1H6BA 2WFMA 3T9EA 2WD7B 3ONWA 2J6HA 1I9CA 4P4NA 2M32A 3EPKA 4Z8YA 5ALWA 1OBCA 4YAKA 3EIQA 4AL4A 4O3QA 4JY7A 4F06A 3DWEX 3SICE 2XOKD 4R8UB 4QC2A 1K68A 1Q91A 2FRXA 3LG2A 1W5BA 5EVCA 4C6TB 1XRQA 5DSTA 5KFNA 4CMGA 4A0HA 1I2ZA 4R8SA 4WLNA 2XXAA 2AN1A 3HDVA 4C01A 1J0XO 1TEXA 4QYWA 2P27A 1Q1BA 2E4ZA 2MSWA 2II6A 4D3XA 1DXHA 3PWTA 4K46A 2FLNA 1CS4C 1VI6A 3IDAA 2QMQA 4GR4A 3DOIA 4E2ZA 1RT9A 3AVOA 3GX1A 4REQB 3ND5A 4RNCA 4L50A 1IZ8A 1N5KA 3MFQA 1I4OA 2GLXA 2VRCD 3HEBA 3HN2A 5KPJA 8AT1A 4DANA 7ICGA 3DV9A 4BE7B 2X1VA 3NB0A 5LMUB 4CMEA 4G67A 4J76A 4WBXC 1Z75A 4Z9AA 2LDXA 4ED3A 1CY6A 2H4ZA 4W9NA 2QN3A 3PPXA 3RAFC 5TE9A 3GG9A 2W03A 5AM5A 1FUYB 5D49A 3RVBA 2YWCA 3KSDO 4R5MA 3I62A 1U9IC 4I50F 2F17A 1TMGE 3PR3A 3EARA 2VHVA 1Z00B 2JVJA 3M4JA 1RZRD 3OHPA 5DI9A 3NM5A 1I9GA 1FSZA 1QRRA 1NXXA 3IVMA 3TB6A 1YZ3A 3DFFA 3VQTA 1FUEA 3Q12A 4TV9A 4RY9A 1CY8A 1JR3A 4KZKA 3DZBA 2XODA 1KIFA 4MZDA 5FPPA 4RX1A 4KTQA 5DI3B 1WTCA 5IC6A 3U39A 4UDYX 1U63A 3EA4A 4FFLA 2PJUA 1IZ0A 1WNFA 1GPYA 3KQTA 4FBUA 3F97A 2GCOB 5I7RA 1RPAA 1RC0A 3VDNB 4LC9A 3S8YA 2OWOA 3AERA 4NYIR 3AJ8A 4PSAA 3DZJA 2GK3A 4F92B 1NVXQ 3ND9A 2O9JA 3GJ7A 5JBQA 1S2GA 2JXJA 5KS2A 3O75A 4R51A 1GG9A 1QB8A 3KCQA 4G4GA 1YZKA 1NPTO 2Z6AA 1Q77A 1P5JA 3CHYA 2UXBB 1RJ9A 3B1KA 3MAJA 4JP3A 3WDSA 1Z3EB 2CHFA 4NFYA 2ZBQA 2BZ0A 4W6ZA 4PFKA 1V16A 4L74A 3PITA 1ZVMA 1JBEA 1EK6A 5CH8A 3IVCA 2IXDA 3IKVA 2ZDGA 1BS9A 1VKZA 2H5EA 2PZLA 3THRA 3EUB2 2GBIA 1P19A 2ZJ6A 3EBLA 2I67A 3EHDA 1O0BA 3PIIA 1D1QA 3PNYA 3BFVA 1HZJA 2ZP1A 1AHHA 4QGSA 3L0OA 1NMZA 1VKNA 3P9CA 4ECYA 1PEAA 2PX3A 4FN4A 1JN0A 4MULA 2Z8XA 2HQOA 3PTLA 4MAAA 1Q20A 3NYIA 2RAPA 4GMGA 4KRGA 5CA7A 2E5FA 3HO6A 3UK6A 3WNVA 1H8HD 1ENZA 3EXFB 1EFAA 1OSNA 2NNLD 3V1MA 2XUGA 1LLCA 3C3DA 4C43A 2CUTA 2IHVA 2GK7A 2WW8A 3U4HA 2YWBA 2N42A 1F2TB 2OD2A 3DTTA 5JTUA 4H3KB 1EJ0A 2CNKA 2Z2XA 1QFMA 1NQWA 3HYCA 2QXTA 3VISA 1E7SA 4DN6A 1XVAA 1NXOA 1AKNA 3A2LA 1NLFA 3QFFA 4GD3Q 1LRJA 4NZOA 3VKWA 4L95C 1GGHA 3OD1A 3ZTTA 1A4UA 1XKQA 2CF6A 5AJXA 1X40A 2JIPA 2Z9CA 4ERNA 2KKVA 2D8AA 4YP5A 3QUTA 4KUEA 2TRSB 3R5TA 5KQLA 3DM9B 1KR5A 2DY0A 1LSSA 2KE7A 4OQPA 5FUYA 3QSGA 3O0TA 1G7SA 2K89A 2GBGA 2HW8A 3FFWA 1DQNA 2HJSA 1DKLA 1X3SA 5C8DA 3VR3D 3GH1A 4PG5A 2JVIA 3EZGA 3IVRA 2Y8EA 4P84A 1Y42X 2C2HA 3QLVA 1KJZA 1D8LA 4M98A 5IILA 1SBQA 3FOFC 2JKYA 4Q19A 5C4MA 3W2FA 4GLJA 1P6QA 3M7IA 3WAKA 3JD1A 5FOSA 1XCLA 3WWCA 1Z6TA 2IBSA 4EMUA 1NT2A 3MD9A 1R5NA 4U39A 3H8VA 5JE8A 3I2JA 1TPYA 4NECA 2ZTVA 2FSVA 3QA3E 3DC2A 3N2YA 3L6CA 4C7BA 1QX3A 2H0AA 4F8YA 4GI3A 4MP8A 2BPFA 2R2GA 4ER6A 3T52A 2C9YA 3EPJA 3HDTA 9ICPA 3VM6A 3WB9A 1DAFA 3W2TA 5G4KB 1Y0BA 2LE0A 4PR0A 2QUAA 1C3EA 1I51A 4QZGA 3Q7PA 3P2EA 4INJA 3EXEB 3FPHA 2CLSA 2R6GA 1G21A 4KQKA 2LIPA 3LCUA 2WG1A 4KO8A 3NBXX 3UTCA 5G2OA 2R6CA 3P94A 1VSVA 3P0RA 1Z6GA 3QSYA 2PQMA 4JGBA 1W2WB 5DIFA 3RJJA 1YMVA 1ODSA 5ESWA 3BMXA 4D8TA 3EDQA 4D57A 1TPZA 4GQIA 4JC5A 3O2JA 2ZJ0A 2B1QA 4NCJA 3FNQA 1SD1A 4OO1J 3DE3X 2FPKA 2DERA 4QG7A 5E0OA 4DSOA 4MTLA 1BPYA 3EDOA 2YXNA 3ZW8A 4RABA 3M83A 3TYXA 3LYUA 1Z1BA 4K8OA 4J1QA 4CMEC 1RAEA 4GC7A 3VOSA 5FCDA 5CD9A 4NEGA 4W9NC 3IKLA 2PXAA 4NY1A 2QTCA 1CS0A 4JEUA 2Y2UA 1I24A 5D3MA 3OE4A 4TS4A 2W6PA 1PKEA 1GYPA 1PGQA 1N5IA 2J45A 1N33B 3MGKA 3K0CA 1GL9B 2CLFB 1VLHA 4GI5A 3BC1A 3QKRB 3QTLA 4O4IF 1NPYA 2X23A 4LJ6A 3N8HA 4TROA 8ICXA 4LMAA 4EK9A 1UDRA 1M7BA 4DLTA 5AVYA 3I2KA 1KI1A 4F04A 2NU6B 4N7MA 2F8TA 3F6CA 4BNWA 4RETA 1BDJA 2KX7A 2JDID 3RBVA 3VYWA 3UWKA 2Y99A 4ARZB 4MQLA 3TIFA 4X41A 5E7JA 1ZQXA 4X1OA 2ZAOA 4CKWA 3A14A 2IV3A 3SC3A 3LF2A 4YUYA 1L8QA 4FC7A 1DZ3A 1S3SA 4HPJB 2NRXA 4GGOA 6CHYA 3A4TA 4R7ZA 4PN7A 3H1FA 2XF2A 3BMOA 3DE4X 4GLFA 1CKEA 2ZCUA 2O2DA 1T6YA 4UARA 4AYXA 1W48A 4XYGA 1EBUA 5E7QA 5JUMA 1T2AA 4U7WA 1P0IA 1XSLA 4P08A 1D7OA 3VH2A 5L45A 2Q5QA 5D4BA 1QSYA 1SVNA 2QARB 5BY2A 4GWLA 3VAYA 3PUVA 2VLBA 2WIDA 4RQ0A 3DMNA 4DLUA 5HOQA 4FKZA 2XB6A 4PSUA 5IZCA 3RC3A 1E2QA 1Z28A 3N1UA 5DOZA 1K08A 4CKCA 3MINA 3HSYA 1VYHA 1WOYA 1U3TA 4DRXA 3GP3A 2W22A 1GPNA 3D6HA 4DQSA 4OHWA 8ICBA 3ZTWA 2PX8A 1QH9A 1U8CB 2MUTA 4F6RA 4MWCA 4JVOA 1MB3A 1L5QA 4BKMA 2ZITA 3UA4A 1DQRA 1Z9BA 1G5HA 1R5OA 2JCBA 2CL7X 3JPOA 3DE2X 4IPTA 1BOFA 5IKXA 1UP6A 4OHPA 2V7QA 2IH2A 2E37A 4ZT6A 3AZOA 3D2QA 2IK8A 2PN1A 3IILA 5CFLA 1U0RA 4GEKA 1GZSA 1E9RA 4UMEA 1VKOA 2NRTA 1TQ6A 4I6EA 4KLLA 3ZDEA 4DLNA 1IHOA 4J9QA 3R7BA 3KYCB 5GV7A 5DYIA 1QS0A 4PZPA 4MKIA 4IG9A 3M1AA 3UXMA 4WNAB 1LI5A 5I7FA 5I7VA 1ZSVA 4UPEA 1PS8A 3GDOA 4OG2A 1WS6A 3I4FA 3HJGA 3PRYA 3U4DA 1U49A 3ER8A 1D4FA 3RS9A 3SIRA 2XTMA 3AM9A 4I1YA 1WQ3A 2MSKA 2XC9A 2AF3C 4JLDA 1M6VB 4C08A 3MGCA 4IHKA 3R7WB 1OZHA 2NM0A 3W6ZA 4DLRA 3QLVC 3NS1A 3EZYA 3SEQA 2BMWA 2QV0A 4LJAA 3FNBA 4J2HA 2NV2B 4UBBA 1CQPA 3VKUA 4LS3A 1Q84A 2RHLA 3KIPA 1XYVA 5FWXB 1CCWA 4XEHA 1JIHA 3A1WA 2RCYA 3OZ7A 2IIPA 5J5AA 1GTRA 1R3UA 1AHPA 4BMCA 2WF8A 2I4NA 2G7ZA 1TA9A 1T8TA 2BY4A 2FSVC 2AUMA 3WLHA 2A5DA 3PD1A 1R00A 3ZGVA 1SO8A 5L1LA 5BSRA 3VC3A 5ALSA 3MWEB 1JU3A 1FTQA 3QA9A 5TLSA 5I9MA 1PGJA 3WIUA 3QHAA 3QBDA 4EOGA 8ABPA 4P8RA 2HGZA 2PWAA 1E6KA 5DX0A 2R0QC 1QYIA 2ZBUA 2GN8A 1V7ZA 1SIUA 3UJDA 4TUPA 1LJ8A 1R4NB 4YMSA 3NUZA 4E1BA 1U7HA 3TUJC 1QRTA 3JZIA 1FJ2A 4EFMA 1K9VF 3WDMA 1N9GA 1T4CB 1VRWA 5A9SA 4RS4A 1XXHE 1NJFA 3B3GA 4Q7KA 2RGGA 1GSHA 3R9XB 2DFPA 2IEDA 3W77A 2Z56A 4E03A 1UT6A 2XNHA 1E9BA 5EP3A 1M0SA 4OFZA 2RHFA 3SVLA 2VP4A 5K45A 3C15C 4MFFA 1BWPA 3TGWA 3GJ5A 3BKWA 4WERA 1ZRNA 5LMCA 3BZCA 2OBLA 3L8EA 2A9JA 4G0PA 3FG9A 1RMQA 2KP7A 4X24A 3SNHA 1ODLA 1SCUB 1XRMA 2MJLA 1D8YA 3C8DA 4P2GA 5EQTA 3ZC3A 1FDIA 4XH9B 3FFAA 3QEAZ 1KTIA 1LFDB 3JVDA 2K4HA 2ZWPA 1AA6A 1M7HA 2OBFA 4N0DA 4MVJP 1X0VA 3WK4A 3NGMA 5AKYA 4DUYB 1XF1A 3JZAA 2H2IA 3F4BA 2HBYA 3FSRA 4JHLA 3K0CC 1WPGA 1E6CA 1Y9EA 5J0RA 4X1KA 3HBJA 4FNOA 1K6EA 5JTTA 5TV2A 1QGZA 1TIBA 2A1TR 4RPKA 1ABFA 3WYEA 2C2DA 2GZ1A 1WMBA 3W9YA 1XTIA 1XL0A 3BH6A 5E3JA 4MVJH 3B2NA 4M9LA 1S1CA 1GLGA 1XZAA 3VVMA 1W7AA 4YH1A 4QATA 3HRKA 1U8XX 1AUQA 3K1AB 4V0OA 1GUZA 3PDUA 4C1NA 3IH5A 3SAHA 1PUIA 2QS9A 1DO2A 1P4HA 2P0AA 3EY9A 2MYUA 3ZK9A 2XT9A 3Q1KA 1LBEA 4QDXA 1IXYA 1EDDA 1R1DA 3OMLA 2W8BA 2XCQA 4MDHA 2O5VA 3ESBA 3EZ6A 4R1TA 3N3AC 2YV1A 3WNBA 2BFBA 2RI0A 1QV6A 1Z8NA 4I8DA 1NY5A 3V5NA 1QAOA 3WGNA 2O0JA 4IJMA 1MCZA 3MT9A 2OFOA 4I2HA 2CVQA 3QW2A 3MWGA 3I72A 1XTRA 5CRXA 3BCHA 3LOQA 2PZMA 4QRIA 4BLRA 1H2YA 4N5MA 3MCVA 2FXIA 1AS0A 1QUFA 5DVZA 4PLTA 2R6AA 4PZDA 4LZLA 5IZCC 2BBWA 1A96A 3I83A 4C0XA 4V38A 3A28A 3AEQA 3GEMA 3T4UA 3L18A 4C8OA 2IHTA 4R9NA 1RQNA 4JWMA 4P33A 4E6PA 1Z63A 3EYWA 1M1XB 5K6RA 4L3OA 3FH0A 2O8NA 4OMUA 5FTNA 1QUEA 4YT8A 2GN4A 2JLSA 1XEXB 4KH0A 3KNZA 4K9NA 2DHRA 1ZQEA 4E4YA 4QTUB 2JEZA 2KICA 3HHPA 4TSKA 1GILA 4KWIA 3LP8A 1TVMA 3O3OB 5B3KA 3QNUA 5B5SA 1HNWB 5H59A 4Y9SA 1TYBE 4X7BA 5KJ1A 3LBAA 2CJFA 5B1HA 1W25A 3F78A 3DDUA 1ISHA 2HBMA 1KJYA 3IDSA 3ABRB 1TAQA 4XUCA 2UZ1A 4LVOA 4HAWA 3O0FA 5F7JA 3GARA 1KEPA 1WXIA 4UAGA 3SYZA 3NNDA 5AWFC 1HF3A 3GRUA 1G0NA 1IFXA 2V4ZA 1REQB 1S2DA 3LRTA 1DK3A 3OCXA 2XUQA 3T61A 3TQRA 4C3OB 4UZFA 1LDGA 1KYYA 4WFQA 3W3AD 3BXZA 1RWMA 3K8YA 1Z5OA 1ZLYA 4NZNA 3VU3A 1FP1D 5ICGA 5AM4A 4AX8A 3AX6A 2V0GA 4CL2A 3T7SA 4U6SA 2QUKA 5ECDA 3DKKA 2OY0A 5FNVB 4RF2A 5KL8B 1G5RA 4BO1A 2H00A 3BEOA 2J6CA 2NVWA 5TDHA 3OZGA 1Y3DE 4WXEA 4G5YA 5C1OA 1F14A 2LWIA 5AK0A 1CR1A 1JJ7A 5DK6A 1UPXA 4ZTUB 4KXQA 3EBPA 2H9IA 5BSEA 3CLTD 1YJQA 3PKZA 1FOEB 1FQKA 3DBVO 4ZQHA 4XFDA 1NVWQ 3GOQA 5JQGB 1VCMA 5KFWA 2B7LA 3ZH9B 3ZQUA 4L08A 4DL9A 1E2GA 1VFNA 5LP6A 4F50A 3H2IA 3AQFA 3SEIA 4JI7B 3R9KA 1UJ4A 2X6TA 2PT7A 1S3IA 1BJRE 2HHUA 3HKDB 5EFOA 2WQ6A 3M9LA 1C2TA 4UTRA 5H2FU 2VR1A 5I3ZA 3AP2A 4JXXA 3KT6A 4URUR 4X92A 3LUBA 3I09A 2FMKA 2UYHA 2Z5GA 5A4KA 2X9VA 4AF6A 2LYBA 4Y7DA 5C1IA 4JI0B 4NYJR 3RRZA 4EW2A 1A9ZA 1YV9A 1KRPA 3SEFA 2BMDA 5CVJA 2NVUB 4QLBA 3EIHA 3PSFA 2ZRDA 1RS0A 1DPFA 1IOWA 2GHRA 4DWVA 3JASA 1MFPA 2HBZA 4Z3KA 4COOA 3WR5A 3WGGA 4MUKA 4OP3A 3CRXA 4B6JA 5K1ZA 4HYYA 2YW9A 1RXVA 4WZAB 3PSPA 2JJ8A 3TUZC 2E4YA 2G82A 1WEKA 2GD0A 5I8PA 2PYIA 1ZIPA 4DR2B 2FUG6 5HX7A 3VR2A 4JD5A 2AWNA 5KJCA 4HGZA 4AZ3B 1N25A 4A5SA 1KJ9A 3ND7A 3NJRA 4D9GA 2H2GA 1VL2A 3RJFA 4PJ0U 4Z0HO 2WHRA 4ZJUA 3PT5A 2QUIA 3QFCA 4N1AA 4D4MA 1LS6A 2VUSA 4O4HA 2VSNA 4TMTA 5EWMA 3X2FA 1U3GA 3T5JA 2IEIA 2VTVA 3UMFA 3X44A 5E2BA 1L3SA 2DJIA 3MLAA 3ISBA 4V2UA 1KZYC 4RUAA 1ESCA 1Q2XA 2BONA 1KPGA 5KQGA 4D8VA 1UOQA 4EFLA 1I1NA 2FJ6A 1QF7A 3BULA 4HJRA 2ZSAA 1ZCAA 3NBFA 5A3VA 1SXPA 1RU3A 4OXYA 2NSDA 2BI7A 5FFFA 4GKJB 1YZVA 1C7FA 3IPRA 5JD3A 4AJNA 1D1PA 1ZQLA 2H48A 5EMHA 1YI1A 2VQDA 4DFDA 4A0RA 5FTMA 3DBHB 4M88A 2JARA 4P3YA 1OI2A 2BI8A 3FB1A 2FPWA 1JU9A 3IHLA 1G20A 3V6HA 1L7QA 4MEBA 1G8PA 1UJ2A 4KE8A 3X1JA 1JQBA 1HNZB 2PHZA 3CN7A 4QQ8A 5FI5A 5ALIA 3L7CA 2QL7A 3N9IA 1TKAA 4Q3KA 3HU2A 1K1SA 3DVAB 4QXMA 3JWJA 4K26A 1VA4A 5EKTA 1F9EA 4DC9A 3RV3A 2WILA 1ABBA 3ICOA 4CKBB 1NKVA 1N5DA 4D56A 4JQCA 1SUWA 3MS2A 2YC4C 2VWPA 4RTSA 1YGPA 4MS3A 2Y9MB 4GPEA 2J85A 1E79A 2KI5A 2RHRA 2YHBA 4F4CA 1DWOA 5BWLA 5J59A 1WHTA 1OUQA 4DLVA 4GR5A 1G5PA 4RQ4A 2PKEA 3T99A 2ZIUB 3GRAA 5JS7A 5GAJA 2G9RA 2WTMA 5C81A 3SEAA 1DHTA 2BFDB 4ZEXA 1MQ8B 1F06A 3DAHA 4MYDA 3KUKA 2W6JD 4AJEA 2WF6A 1E0SA 3A37A 2ZJBA 4UD2A 4LXIA 3MJRA 4YUWA 1XA0A 1HX7A 2C9OA 1IWPB 2WFAA 4CG1A 1G7TA 4KR6A 4KQFA 5L3QA 2G6BA 4YK7A 3BQTA 5F1KA 4MLCA 1QGDA 4QD3A 1XO0A 1VL0A 3ETNA 2FZCA 3KXDA 1GN8A 4CCAA 2OSVA 1EVZA 3GGSA 1UZMA 1GZHB 5F2NA 5E4FA 1OAKA 4Q1BA 4PY2A 2R8YA 1NY6A 3RVNA 1XMVA 4AYTA 2V8OA 4FCWA 2GAFA 1OXTA 1A8UA 2WWVD 1DBWA 5F5NA 3CWZA 1Q12A 3C7KA 1TK9A 2OBBA 4I2DA 1Z15A 2GYVA 4GC9A 3TCKA 3G5AA 1ZKDA 2QX8A 1QANA 3T3MB 3GLVA 4A0SA 3GMIA 1YUMA 2WUVA 2JGIA 3VHXA 2NN3C 3B51X 3RJZA 1BMQA 3U6BA 4NHEA 2D00A 2DCMA 2JASA 4MJLA 2OC4A 2COKA 4MRMB 1B3RA 1ENYA 4DKXA 1KMQA 5FX2A 3V1UA 4C03A 4JVNA 1GPLA 1P1BA 3GW8A 3TZEA 1SA0B 1SY7A 3Q2IA 4MQEA 2EZ9A 3K0AB 3LLVA 4C2BA 3THXB 4IILA 2DECA 5LP6C 4U2CA 4K9OA 2XKJE 1LV5A 4Q4AB 4AKEA 2X14A 5KFMA 4TXHA 3K9WA 3HX0A 4UHEA 2J5KA 1W52X 1UA1A 1UKZA 4B47A 3VPCA 1AD2A 1DRGA 1SZCA 4E08A 3U3JA 3CEPB 1O4WA 3AQEA 4YWJA 4KR9A 1H23A 1V95A 1JMVA 1RLMA 3BX1A 3DE0X 4C89A 1LPOA 2H16A 2QBYA 1RWXA 4BMZA 2PS1A 4KO3S 3TVYA 4DFMA 4LRSB 3KEGA 5EIAA 2A35A 1VJDA 3BMQA 7ICVA 5DB6A 3EMVA 5JROA 1EDOA 4RY8A 5J4VA 1ZQAA 4YLYA 4HN4B 3BIJA 1MC5A 4QJ5A 2YMMA 2CHGA 2B7CA 3RG2A 4KODA 3NDBB 2DF4B 4HYEA 3GRYA 5LR6A 3LX5A 3SBOA 3H19A 4HH4A 4IOMA 4BNFA 1T5BA 4E0BA 3PT9A 2IUSA 5MF6A 4MLPA 1WDMA 5LCXA 1T5TA 5AM0A 1G2QA 3DTVA 4QTYA 7ADHA 2QW8A 1OBVA 1JR6A 2EEPA 1IM8A 3A11A 3D4OA 4OHRA 1IXKA 2IZZA 2QUHA 5IVDA 3M33A 2HU2A 5KYYB 3OX3A 4GUDA 3MBOA 1KI8A 5KNDA 2RIPA 4MYHA 1BJKA 2HHVA 4ZU6X 2PX4A 2R4UA 1F0PA 1E9EA 5A71A 4Y0AA 1FS5A 4FGKA 4G01B 1X19A 2WSBA 3MB8A 5EMMA 5BOVA 3IQIX 2ZTDA 3BK2A 5DEIA 5DNVA 3WTBA 4BTLA 3MQ2A 3C39A 3M9OB 3PXDA 4ZYUA 3K8OE 3GFSA 1XZFA 2RFLA 3HN7A 1JHYA 3DE7X 1QR2A 1TU0A 4QULA 4EY6A 2ZRAA 3L04A 1JHMA 1PUJA 1TVKB 4UTZA 2Q99A 3KQSA 3PUYA 4OHVA 4RTPA 2GTIA 4RE5A 4FJ1A 2FX5A 4W9MC 1Q19A 4EUEA 4U0JA 2UYOA 2P6MA 4YMMA 4HAXA 3FBWA 1UKBA 2EHJA 2IEGA 3UKDA 1DKOA 5IIJA 4DE5A 4GC6A 1OR8A 3R24A 2CDBA 1VLMA 1OE0A 3HS3A 2PSEA 5IKEA 1VB3A 2GILA 1H2FA 2B1JA 4ABTA 3LKZA 4DA0A 4KH1A 3SAGA 2A86A 4G56A 1X77A 4WSOA 4LJYA 2LTAA 2DLCX 5CB8A 3T5LA 4DG9A 3U7HB 3NHJA 1B1CA 3TGLA 2VIIA 1TEVA 4C3VA 2VHTA 1O77A 4HLUA 3KG2A 2IA6A 2IXAA 1IVSA 4QDZA 5HTOA 4CHGA 1J9ZA 4KE6A 3RS4A 2Z04A 3LAWA 3D3QA 2H51A 4KSYA 4RL4A 1DGQA 3R8XA 3J81k 1PUZA 1JLRA 3ICVA 2DHQA 3QWAA 5BQOA 3V8MA 3G2HA 1FNSA 4NE2A 2FQYA 1CQJB 2PKRA 3O8BA 4PLFA 2XI4A 1T0UA 2SKCA 4M1TA 2V5VA 5EIBD 1CJKC 3ZBUA 3AJAA 5DRYA 1V85A 3QYFA 2FFJA 4WY5A 1ZC4A 4P3PA 4Q8EA 3O84A 4O4LA 3H3FA 4ZYTA 5E3HA 1V7PC 2DETA 1AS2A 2DR3A 5KCZA 1XALA 3RK4A 4U7JA 3ZWBA 2QSJA 3GLIA 3Q8LA 3BWDD 2VG8A 2VKTA 4IZHA 3RRNA 4I1OA 2Q7XA 3LQFA 4ED8A 4EB3A 1QVRA 3I3OA 5J2HA 4IF4A 4CDNA 1M54A 4GSYA 3PGJA 1ZQZA 3UMSA 2C2KA 2DKOA 1LC0A 1C20A 2LZ0A 4MCHA 4HH1A 4HRVA 1BS2A 1UAAA 1G5TA 1VLVA 2QX4A 4PO1A 2CUNA 4TS9A 4HK4A 3WWDA 3T15A 4CL0A 3O5AA 3T35A 1YAHA 1J2EA 4IIVA 5B58T 4DPKA 1EJ2A 3U7RA 1Z47A 3ILXA 5AW1A 2DTDA 4BQIA 2EYQA 5GADl 2ARKA 5DLEA 5FL3A 3F46A 5J2DA 1JMYA 3T8YA 3COYA 1L4LA 3EZ2A 4MUGA 4FYKA 3ROTA 3DZ8A 4W8OA 3BGWA 2FMUA 3W5SA 3H2GA 5K3FB 2WYVA 2YWJA 4EZBA 4WRRA 1RP1A 4QFMA 1NWCA 1UQVA 5EYPB 2HBRA 1PSWA 1KK1A 2JA1A 3M82A 2ZS9A 2ES6A 4DLZA 2EERA 1KMHA 3JZDA 1HT3A 5FUWA 1Z22A 2PIDA 1E1CA 5FAKA 1IWOA 3W4IA 2XDAA 2HBLA 2D2VA 2V4QA 3JARA 1USGA 5J29A 2C5SA 2AQIA 1NP3A 5JATA 2B21A 2WZDA 4P3KA 3ETEA 3CRMA 1G38A 4E12A 4EBCA 5ECWA 2GRJA 5HHIA 3RFFA 5BORA 3COVA 3JQAA 1FRVA 1M1YA 3FIUA 3AETA 2O8CA 4IGIA 2CHQA 1O03A 2O2IA 3WISA 1RXUA 2DPHA 4NMLA 3UATA 4W5OA 1EPUA 1XR3A 3MBIA 3H0RB 1MABA 1Z7BA 1QKIA 3MOGA 3EIUA 2IX3A 3HNPA 1FFYA 4YREA 5I7OA 1RPTA 3T06B 2ZJ8A 1FFWA 3GGDA 3TSZA 5E1OA 2V7GA 3ITEA 2GMWA 3K9FC 1GCIA 2YDXA 2XE6A 4YO8A 7MDHA 1Y6ZA 4FXOA 4KX3A 5IDWA 2JH3A 5KO2A 1C7ZA 2OBMA 4TZKA 4YRGA 3O8RA 4DVGA 2KBEA 3IT1A 5LB4A 5BVHA 2YOGA 3ZZTA 1NFFA 2IXEA 4JT8A 3ZQKA 4QPPA 4YRAA 3UIEA 4PQRA 2XAAA 5FI0B 4WBNF 5K3SA 3SFTA 3HJRA 1XVTA 2JHFA 3WK9A 5HKKD 2YJ5A 5CT9A 4BMSA 3QEBZ 4JVSB 1NGSA 1UL1X 5CT6A 5EKDA 3HG7A 1DRJA 1JI3A 4DQXA 1J5PA 4O2LA 2XCIA 3FF4A 3MTDA 2IF0A 2ZGVA 2O7QA 4DCMA 3WGIA 4X5VA 1IEXA 4N3AA 3E9MA 1BA2A 5HM6A 3A4VA 3NJ4A 3FCXA 1SU6A 4TUYA 2NU8A 4I8XA 2QD3A 3HXOA 4GP9A 1NSTA 2YOFA 5JUWA 3ESQA 5AK6A 3ZDBA 3X1MA 1NNI1 3KR9A 2NO0A 3MDAA 2E55A 5LXTB 1YDGA 4F3CA 3BJYA 3IJ5A 1W5EA 1I94B 1GGJA 3VCBA 3A2MA 3CZRA 1GFZA 3KD3A 3N53A 1THTA 4OUDA 1G98A 3EF3A 3DV0A 1QRDA 1DOAA 3SCZA 2YY7A 2H3EA 2DQ4A 4RDIA 2OP0A 2OK7A 4OP1A 1C30A 2LCFA 2J6SA 5CVCA 2WAQC 3C0KA 1S1MA 2P4EA 4P58A 3QWHA 1M10A 4CM6A 4IIFA 3BAZA 1UOOA 2C7QA 3PFHA 1H2RS 2AN3A 1JECA 4HEA1 3LXUX 3V8BA 4RUCA 1LKZA 1E3LA 2CFOA 4Y6GB 3LZ6A 3ZNNA 4W5NA 2WV7A 2WJ3A 5E9WA 3ZY4A 5ITWA 4F46A 2H8KA 3PRHA 2ZUDA 4KP7A 2XMCA 4AUEA 2BHSA 5LQAA 4Q7EA 5GTDA 3TTUA 3GPCA 1QNLA 2BGUA 2H5XA 4NP6A 3EVFA 2MCFA 4A5OA 1JVBA 3HMKA 3T3IA 4MB2A 5DO9A 3RRXA 2A1UB 5HOEA 2WU0A 2A1JB 2AC4A 3CUSA 4MSUA 4F38A 4J7CA 4HLUC 4MEAA 3AKZA 4ZAWA 5GJWC 4RD1A 2C77A 1M7GA 4WLOA 4I4LA 2GPSA 5TVKA 2DPJA 2ZB3A 2XV1A 1E2UA 1NJSA 3A4LA 4C2AA 1ICIA 3LPCA 3MLEA 3AUUA 1Q1AA 3KSMA 4NU0A 2FSHA 1DLJA 2OCDA 4DF8A 4MINA 4IVQA 3TZLA 3CUYA 1QHNA 1J0EA 1RKVA 2FAXA 2AFIA 3IUNA 4GXJA 4PSKA 1H2EA 4ZI7F 4NZMA 1PV1A 4MPRA 2XB9A 2APJA 4XFJA 4YRQA 1CRWG 4IDAA 3BGDA 4DLBA 3U19A 4FEYA 1PL8A 3RKRA 4YWHA 4HXEB 2E0IA 4MHOA 3G8CA 4JR0A 4BO7A 4H0FA 7REQA 1DO8A 2J6BA 3BWEA 2GH1A 3KTAA 2YXPX 5EN4A 4PZAA 5JFGA 1AK1A 4YI3A 3A04A 3CKLA 1YZLA 1V96A 1C9JA 2QMZA 1Z4KA 2ECQA 3QVGA 3S8MA 4BCDA 1ONSA 2VJYA 2CZGA 3PVCA 4PX5A 3LVVA 3FTEA 4BGDA 2R47A 1R8XA 4ZTBA 1KY5A 2FPPA 2KE5A 1PJLA 2CJPA 2QGZA 2E49A 2DHCA 3R8FA 3O1HB 3H4VA 4EKYA 3CLSC 3F8WA 4JL5A 1X8XA 1U0SY 4GRAA 5CP2A 5EWLA 5F1OA 4RSRA 3DVLA 5H5JA 5SY4A 3SF8B 4WDQA 4RK6A 4FKBA 1G8YA 2QW1A 4CPDA 1CXZA 3I45A 4HZIA 2V6IA 5DLFA 3DHWC 2HF8A 1C3LA 3LTNC 3EIXA 4OU4A 1MU0A 4C7MA 1QSLA 2J87A 1AS3A 1KPHA 4D02A 1PVPA 2AEMA 1ZAKA 4NYIQ 3K5WA 4LNHA 1D1TA 8ADHA 3QYPA 1CRZA 3IQXA 2YZ2A 3FFBA 4RTMA 3VYTB 3CLRD 4CTNA 4PYNA 1SIOA 3UHOA 1JR3E 3SAJA 5DP1A 2RHJA 3Q7EA 4F4ZA 1GZ7A 4NLGA 1Y9DA 2I91A 2BH9A 4RHCA 7ICLA 4RQ7A 3AEZA 4E13A 2Y1DA 2A0XA 1OBFO 5BXYA 3DDHA 1BOOA 1YNOA 5G1NA 3ZE1B 3EPRA 4Q3LA 3WYCA 1COKA 4HC4A 4TLLB 5DDIP 1UBGA 4I9NA 1C1DA 3BXGA 2QN8A 4QUAA 5C8XA 5SYNA 5D01A 3WO1A 4K6KA 3SZMA 2BQ3A 2QTBA 1HFKA 3K1TA 4KIFA 1EFTA 2EKPA 2XITA 3WLTA 1Q0SA 4M7RA 3V32A 2ZUEA 2AQKA 3M0EA 3QZ8A 3ICPA 3AINA 1XQWA 2ADFA 4I50A 5TRTA 1YRLA 1YDHA 3GIWA 2OKGA 1P2VA 4XB2A 2IDKA 3JTMA 1KFJB 3W8DA 3R3JA 4TL9A 3UNXA 4IIEA 3FVRA 2PGIA 2WTEA 3ZDCA 3JQFA 3SD7A 4K6CA 2QU8A 2BZ1A 4FK8A 4EHNA 4UAVA 1NW4A 2OXIA 4AJ1A 3D2CA 1BPDA 4KQIA 2IIQA 2C3OA 5EQFA 4LOIA 3CUUA 2EF1A 4FS8A 4URZR 4ZI7A 3GF4A 2ZSEA 3NGLA 2QR2A 5B1IA 5JDIA 1JT2A 2SNIE 3S1AB 4L0MA 2ZRMA 1T2EA 3R6LA 5EPEA 3GQCA 2GPTA 4M6WB 1ISRA 2J3KA 2XJ4A 4ZI2A 2HPHA 1V9SA 5BR4A 1WWUA 3DKIA 1BHSA 1GRRA 4GT1A 2PQ0A 4P82A 5J4HA 3QIAA 4O2BB 1NATA 1BCSA 2Q4DA 4F2SA 4DMHA 2PDAA 2QP9X 5GOZA 3QXGA 4CIVA 4PONA 1IRIA 2X0EA 4N47A 3ZHQA 3K0FA 3TQCA 4O2AF 4BLVA 4FSHA 2UUCB 3M6KA 1HUZA 4ETNA 3GY0A 4KR7A 3WGLA 4BDPA 4MA0A 1F51E 3L40A 2P6PA 1EFCA 1O87A 1YNSA 4DHEA 4WCDA 4FZ5A 2B34A 3UK2A 4CMJA 1JG1A 2Q1XA 3IS3A 1WA5A 3GN2A 4UUMA 1NZBA 4KPFC 3C1ZA 5J2TB 1ZM9A 1IPEA 1NASA 1A04A 4PWZA 2NZYA 3KAPA 3OP4A 4NENA 3QM1A 2WHQA 4FZMA 4DNPA 2JBWA 3TIXB 4QZBA 2JAOA 1CEEA 1MO2A 2JAPA 3HY4A 1SMKA 1PK7A 2A3VA 1LXCA 4PAGA 1P3JA 4X62B 3KFVA 2W9XA 2Q4RA 3KJHA 2HZ7A 1LKYB 3UMYA 9MHTA 3L4PA 1ANKA 1QHEA 4M87A 4TYWA 2X7JA 3HM9A 1KE2A 4OYRA 5DTEA 4GMDA 1LQ2A 1TM2A 2F8LA 5E38A 4K6FA 4KLTA 3A36A 3LWLA 1JHPA 1XZBA 4OOEA 2VFAA 4EG1A 3DZDA 1NU8A 2NQ2C 3AUAA 1DC8A 3RBZA 4WXPA 4F5DA 2IY7A 1DTEA 3RHTA 1P1IA 3RUCA 1QORA 4RXMA 1VHLA 4YCMA 4EHIA 1EU1A 2ZVQX 1SUEA 2FTKE 4A91A 2KHVA 2F9LA 3VNRA 4P54A 1I0LA 1O1YA 4DZTA 4KNWA 1FFXA 3EK2A 4YALA 5TJ9A 1YK0A 5BMOA 1OH7A 4IIDA 4O3RA 3SXUA 4GFJA 1Q74A 2ZZKA 4PX2A 5FBQB 1QOZA 2D5AA 1QOQB 4ZP1A 1DC3A 3O4HA 1EVJA 1QZZA 3N7TA 1ZEJA 3L01A 1S01A 3CVXA 1ZR4A 1P9OA 3GWZA 1ZWLA 4FGLA 3BWXA 3OESA 1XV5A 4CV3A 2Q3LA 1EQAA 5T3YA 1DFGA 4M60A 4CFYA 3AB7A 2OGTA 3KL4A 4YCXA 2OYCA 1OLSA 5L9XA 3SXJA 1J70A 3BHMA 5KNIA 1FP4A 3GLSA 1IJFA 4Q4JA 4C5AA 4X84A 2HDNB 3K09A 4DIDA 3W7VA 2Q9BA 2A3NA 4Q9IA 1DE0A 3U48A 1WO8A 1F7UA 1YQTA 2QTFA 4GAEA 1F6BA 4LHEA 3GMSA 5HQ3A 1Z82A 4IFBA 2LW7A 2JGMA 2ZJFA 4ZICA 1SBTA 1VE7A 5EERA 5I5EA 1TCCA 4YAOA 5DWDA 3TW8B 3L7JA 2GEBA 3EUEA 1W4ZA 3QPCA 4KKVA 4B2YA 1RYSA 1M5RA 1BD4A 4IKEA 5C5CA 3TG2A 5CR9A 2XGPA 2UXDB 1USIA 2A6PA 2ZBVA 2PT6A 3F49S 4OOFA 2Q62A 5DBAA 2DWUA 3F6SA 3ZI7A 2VHZA 4PIVA 2VJDA 1TKDA 2REBA 4KMOB 2B6NA 3NTQA 5LYYA 2YZ7A 1CWUA 4BWJA 1W96A 1XD2A 3PX3A 2HWKA 4JB2A 2AJLI 2H08A 4UVEA 1QZXA 4QWBA 4ND7A 3D7KA 5IBCA 4RU1A 2J3HA 2Q4BA 2ZIZA 1GL6A 4Q1VA 1CUGA 1ORDA 3UWMA 3KHHA 4IJQA 4NCNA 4RK0A 5IYZB 5FBRB 2QSZA 4GX5A 1GAWA 4M2LA 4UREA 2WU1A 1F3OA 1T2NA 1CUXA 3FN4A 1JE0A 4UCXA 4WXMA 3F2DA 3BRQA 5G5GA 1CERA 4C7ZA 1YJ8A 1GA1A 1PD0A 3ESYA 3QVXA 2YRXA 5DDMA 3H4IA 2D1TA 3LK9A 2ASEA 2O8EB 3CB4A 3JQFC 2E7ZA 2HHTA 4O4IA 3VYRB 3H2BA 3FMPB 3M6AA 4LYJA 1LBQA 3F5MA 5A2QA 1QSSA 3NMUF 1V9CA 4FMBB 4NRDA 2C4KA 1Y1QA 1O6BA 2YJZA 5TNXA 3KQMA 4KGXA 4USAA 2RHDA 2WM8A 5JDIC 1HT1E 2ZIXA 5GVRA 4S2EA 1FZTA 5GV8A 4JDPA 4RA9B 2CGEA 3GA5A 2JZBA 2WWHA 1QHGA 4GM1A 3Q9SA 3S5UA 2CK3D 2Q21A 4QZFA 3B7GA 3EQZA 2O8DA 5ICSA 1PRYA 4R7TA 3D7NA 4P2HA 3PEUA 1P61B 2PL9A 5IT4A 3MTAA 2GOYA 4LF5B 2QMYA 4ZOBA 1P7PA 5A0FA 2IYWA 3JQ6A 2C2MA 3OZRA 3WMRA 3K1ZA 5K6AC 3S55A 3H6HA 4B45A 2AZ4A 3AHDA 1F5NA 4PZZA 1FDRA 4PYMA 2R6JA 4I2GA 1WU7A 4L6CA 3ECSA 1JLMA 3IP3A 3RH0A 3OQHA 1TW2A 3EEYA 4PYQA 4QO8A 3B9BA 1LVUA 3H11A 1NXPA 2LI6A 5JLJA 4BRUA 4ED9A 1YOVA 1UPFA 2FUEA 1V37A 4MIOA 3DDSA 3SKVA 4C80A 4GGMX 5DV9A 4WECA 3IAM6 2PVSA 2HPAA 1IC6A 4RVHA 3IBCA 3GJ3A 3UC5A 4NI5A 2AKEA 4DEVA 2V97A 5B2FA 4V03A 4M1SA 3REFA 2FW0A 2BSAA 3I4LA 2XZDA 1TLFA 4O8ZA 3KZNA 2D5IA 4C30A 4M4SA 5FTJA 2R8HA 3DL2A 4ENWA 1KDPA 1CX9B 1I4LD 1J06A 1U0FA 2EG5A 2I1VB 2C42A 4CQNA 2CB9A 3RUAA 1I6KA 4MS4A 2JZNA 1GUFA 4OB8A 1LTHR 2ZIGA 3HDYA 1KE1A 4Q6BA 3G89A 4CYMA 4FI3F 1YC5A 1U99A 1WUJS 1OX4B 3CUEF 3NVZA 2L82A 3A1EA 2CXQA 4DREA 5D00A 2HLPA 2C1EA 2NLOA 2HHAA 1I4TD 2AF4C 3C3BA 1EZZA 1BXKA 3SP1A 2GHIA 2WUEA 4X45A 2O8BB 1DDGA 4MWEA 1LJUA 1JXQA 3ZBPA 1DJLA 4AJPA 4D0SA 2Q7OE 5FF9A 3GCGA 3OQIA 4DEXA 1F17A 3SLGA 4U6NA 1N57A 4IDCA 1F20A 5KINB 3V8PA 4GPBA 2I33A 3PCTA 1W87A 3PF8A 2WHEA 3RS0A 4RQ8A 2WM9B 4CKXA 1KZ1A 1K8XB 4C6HA 4XTCS 3RT1A 2EHDA 2BSXA 1PX0A 3FYUB 1TUBB 2BPCA 1XZQA 4LJ8A 2RJOA 5AD1A 4HWOA 1X7WB 2FG6C 1X74A 1DEXA 3Q7QA 3LT2A 2DULA 4ENUA 3QOXA 4WJ3B 3GJYA 3NV7A 4I4TB 4E94A 3BSYA 1U2QA 1ST3A 2P68A 3H9UA 3K09C 1Z4PX 1DJMA 4M1KA 1P2DA 4F1WA 3TOSA 3C5VA 1GKLA 3CUKA 4YIKA 2JEJA 1RYYA 2OXEA 4ZCTA 1DQPA 2VDUE 4C9BA 1BX1A 2VPTA 2ZSIA 3ED5A 3OFKA 3LVRE 3O8QA 1J0CA 5BPFA 1L5SA 1BAPA 3MW8A 1EDEA 3LCMA 5DX1A 1KZ9A 3OX4A 4YJFA 1EHCA 5BUQA 4PIPA 3G82C 4Y67A 3FTPA 3OX1A 5BP7A 5AKXA 1L5NA 4DF4A 3WJAA 4MB6A 4IUDS 1E32A 5L7WA 1CTQA 1E58A 4GMKA 4R54A 3GELA 1DWPA 2MSDB 1IG3A 2ZRNA 4TSFD 2FSIA 2P5YA 3I01A 3DEIA 1R5BA 3QY9A 4Q24A 5TR9A 3GRCA 3EODA 4C2TA 1T36A 1CYDA 1N3IA 2EOAA 2QYTA 3WV5A 4B7ZA 3NNSA 4YC7A 2AU0A 1MX1A 1RLIA 2OORA 2W11A 2AW5A 3PQ2A 3V6LA 1KXJA 2WWWA 3GGCA 3QVMA 2HAEA 3IAFA 4Y9RA 1N5JA 4DWIA 4JIMA 4L8LA 5J8YC 1LK7A 3ONFA 3SAFA 5CBPB 1NVDA 1PJ3A 2J31A 1QH1A 1YC2A 1PQUA 2O14A 4MYRA 3D6AA 1L7NA 4HNSA 2HLDA 2ZWIA 1VLLA 2P2LA 5BSUA 1B6GA 2WVJA 8ICHA 5BSKA 5I7EA 5J2KA 3RROA 2BBOA 1T8PA 1KU0A 1A5TA 3IVAA 5ALJA 4YRPA 4EPXA 5JAHA 3GAAA 2ZKLA 1SB9A 1MFZA 2IC5A 2PZJA 3IMCA 1Y3HA 1N5WA 3VR1A 3SEZA 3JQGB 2GAJA 3NKVA 3W8FA 4TQRA 3UYLA 3TCXB 1FW6A 2NSLA 2EZTA 3DXXA 1SVLA 3NOVA 4B5KA 1GRVA 3SXPA 4HS4A 3KUUA 4XQ0A 4LPSA 5CDYA 4HMOA 4DMFA 2VH1A 1S10A 3TOVA 1DAHA 1SOVA 1O5IA 1UC8A 3H2JA 1VCIA 1MTZA 3KKKA 3KSAC 1OZFA 3BREA 5AI6A 1SFRA 4HH0A 3WDLA 2G5TA 5KSOA 4NMHA 3FJ1A 4Q7JB 3WLLA 2ID8A 5H82A 4KZPA 1V8OA 4JJFA 1Z7GA 4OREX 4QOSA 2IOQA 4JP1A 1QQ5A 3LX8A 5KFKA 2K2QB 4ZDWA 1MJ5A 2BMJA 3L4BA 1ZBDA 1NBMA 2IS1A 3LX6A 2KB0A 1GXSB 1VYUA 1VL5A 3QU4A 2DPXA 4BO8A 4J16C 1UJMA 4R5HA 1KZ7B 3UFXA 5G0WA 2V96A 2C0PA 1M2JA 2GXQA 5CM8B 1GEEA 4DQLA 1XNHA 5B53A 3HO1A 4F85A 3Q10A 1ZFNA 2H3IA 2B78A 1BNPA 3Q7RA 3FNHA 3KHLA 4Q3OA 3SZOA 1D9ZA 1QPGA 2JIBA 1DB3A 1XFDA 1C1XB 5AKIA 2BEWB 1FBTA 4S1WA 4CLOA 1TZCA 3Q3GE 1VHWA 2HXGA 2KSOB 1UQTA 1PEYA 3WYDA 4IRXA 1VBKA 3UHFA 2AR7A 4M0DA 3O4GA 3UXHA 2BEVA 5CTAA 2BTEA 5JASA 2IUUA 1ORVA 1ZS9A 5KQPA 4B6FA 1ZW1A 3T95A 2CVZA 2BJVA 2FV8A 1V2GA 3WKDA 3FZQA 3CYFA 2HZBA 7ICIA 1JZSA 3UHPA 2DSNA 1K66A 3PX7A 3OT1A 5AYVA 1NLUA 1E8MA 4ICAA 4LJXA 3I6YA 3UPQA 1Q0ZA 1JI7A 1FFSA 4NYJQ 1RQXA 4MGEA 1GAQA 2C00A 1U2ZA 3G88A 3IEUA 4ENQA 2O0MA 3OOSA 2JIQA 1JL3A 3ZVMA 3NBZC 4XQGA 4DJTA 3E27A 3R75A 2ILVA 3PI6A 4W1PA 3VBEA 2CFSA 2GCEA 1NUAA 3OSUA 5J5CA 1YGYA 3NVKI 2QOEA 2N1MA 1PQ4A 9ICOA 2PR2A 3L8FA 4C4PA 2G67A 2J3JA 5BOSB 4D46A 4BNVA 1J2NA 1ZOLA 2H3HA 4YAGA 3N7SC 1Z88A 4Z4FA 4JYZA 3DLBA 2I1QA 2DKFA 4WBSA 2A9RA 3IBTA 3ROEA 5BN4B 3A25A 3VO9A 5HQJA 4B85A 1Y6RA 2ZEJA 2EJBA 2JFHA 2XZOA 5FPKA 4PCVA 5FBKA 1MPXA 2P6UA 2ZK7A 5HHHA 3SHTA 4OBEA 2GARA 4YASA 4Z4EA 2HRCA 4F5OA 2AE1A 4B44A 1QU2A 1JFVA 1OYYA 1CUVA 3U9SA 2VHYA 3W3AH 2DR0A 1IVNA 3FR8A 3FZNA 3WGUA 4QLAA 5TGDA 1KJJA 1QIIA 3M8KA 2CSXA 4O3PA 2ZM6B 4F2GA 4GUAA 2FPOA 3ZE6A 4MCAA 5JADA 2A88A 1NTOA 1Z4MA 3MYYA 3VSBA 2R8EA 4TQ9A 5A4FS 2Z8YA 1SKSA 4XFKA 1NW6A 4R41A 1JTVA 4HLDA 1E5LA 3GJ0A 4YR0A 1ZCZA 3MS7A 1HMYA 1CDDA 2Q3DA 1E3MA 1P7CA 3OO0A 2Y1EA 2ZE8A 3QXXA 5CT4A 4FJ0A 2SKEA 3EGXA 3DR5A 4KLJA 1T3TA 3RF6A 3GEGA 3HA3A 4TZ6A 2NAFA 1U2PA 3UWSA 3MFIA 4BCCA 1MR3F 2P5TB 3AM4A 3EWIA 4KXNA 1GZVA 4ZQBA 5C34B 4MB0A 1EX1A 3GLGA 5FV7A 3OLVA 2OORC 3NDRA 1MVNA 5A9RA 3UUGA 1XSEA 5K99A 3O4VA 4BNMA 4D97A 2BKAA 3RB6A 1YR6A 5J0XA 1BSVA 2QLBA 1HQYE 4XB1A 2R1VA 4TRMA 3DKPA 2G40A 3V9PA 2TS1A 2M2IA 2JAHA 1WHSB 4K9SA 3VTFA 1IIPA 2NUTB 3SK0A 3AP1A 4EFDA 3WL4A 3T3EA 3VSAA 2Z9BA 1T6XA 5C5JA 1ZC3A 5K0FA 5DT2A 2BHRA 2EZ4A 4GSKA 4TLCA 5DKWA 3FYCA 4IHJB 2IX9A 4KDRA 3EPLA 1P3DA 3IPAA 3VPFA 1RXIA 3LQRA 2K6GA 5BR1A 4NOKA 3O74A 4XIIA 3B36A 3QFHA 5G0VA 3N7UA 3M89A 3WX0A 4YR9A 3KZCA 3DO6A 2ODPA 1PR2A 2UDPA 2J0EA 2ZUVA 4LF9B 4Z8XA 1U8UA 1KL7A 2FEWB 3LUFA 3HSKA 1GZ6A 5DHQA 1O57A 3PUJA 3W5VA 4UQGA 3GNSA 1CUCA 1Y1SA 4JLKA 4P34A 1Q1NA 4HMQA 3WWOA 3MJVA 5TQ2A 4L5CA 4QIHA 2YZMA 3LP5A 5K6TA 3VJKA 3EXHB 4PWYA 2Q4TA 3EX7C 5HF6A 4FUQA 1UK7A 2HF9A 1C0KA 1HI9A 1N1DA 4AP6A 1HXHA 3PNCA 3N2LA 1LDYA 2JFZA 3Q41A 4R83A 2HU8A 1QTNA 2VRBA 1UIRA 4ZN6A 4IH1A 1U1FA 3K53A 8ICIA 5HIIA 4BVFA 3L4BC 1VC2A 1NUTA 4BZPA 4QICA 3AL0C 3IMFA 2CLDX 3QFTA 5ESRA 3TBFA 1JQEA 3CLVA 4DV1B 5JWOA 4HDRB 1HQKA 5GGYA 2WJVA 2WF9A 3M4XA 2C58A 4OHKA 5JAQA 4I55B 2PL5A 1N56A 3W8EA 1MT3A 3QRWA 4MVJI 1QC5A 4WLFA 3WMWA 1TFUA 1JEQB 1PW7A 1DIAA 4H3HB 2P2GA 3E4DA 5KWEA 3DDNA 1SN7A 1M2WA 3RSGA 4DGQA 1Z29A 2VYNA 2GJKA 2PEZA 3G2OA 4HDSA 1KYZA 5EEHA 2R1TA 3IUPA 3BXEA 4QYTA 3PGA1 1W59A 4DTCA 3N28A 4ZH4A 3T7DA 2ZJZA 3UBMA 3ILVA 4PR3A 3I8XA 1VMEA 4LOJA 1KKMA 3PDCA 4HL6A 2ID4A 5A5GA 4U9IS 1GL7A 2OKCA 1KIAA 1SVWA 3P9NA 2K2WA 1M1ZA 3G0GA 3CUVA 5H02A 2GA9A 1IHXA 1Z0KA 3BQNB 4TVSA 3AF1A 3N8IA 5F7XA 2NZJA 3H7AA 4WVFA 1R74A 9GPBA 2PRYA 3OUUA 1NJ8A 2F1JA 4ECVA 5CX1A 4JL6A 4Y2RA 4EGJA 1N6OA 3HA5A 3TRKA 2F62A 3RB8A 3IIKA 1VHJA 5J2AA 3INTA 4OLJA 2QLNA 3GFVA 5ELXA 5EXEA 4I1VA 3RUEA 4X93A 3PHLA 4M8KA 3AVTA 5JVDF 5EZQA 2KZZA 2FMFA 3LECA 5HBRA 4FMDF 3CR3C 4BO9A 1TTQB 1ZSNA 3EEBA 2CNNA 1JQJC 3JQDA 4Y1EA 4HSGA 1P72A 1TJPB 4XWKA 4P5EA 1W47A 2VNSA 2WR8A 1H2ZA 2EFGA 4G41A 3BGSA 3RUDA 4S1NA 5H9VA 1J2UA 2V9ZA 5L7YA 2PFSA 4IXWA 1HEIA 3E3MA 4AM8A 3WLNA 5ENZA 5A06A 1SOMA 3C87A 4LRUA 3GEHA 5E6UB 4MKHA 4EF5A 2FW7A 4M8SA 3NVDA 3FBGA 3TFWA 1UAGA 5AVTA 1P81A 2A19A 2ROQA 4B9LA 3CVJA 4NICA 2XWSA 1JKJB 2HSGA 2JAQA 4R2WA 4TRRA 1X0XA 1ZQFA 1D04A 1MH1A 2P2DA 4UU8A 5CFOA 5HQTA 1ISIA 2JH9A 4R3NA 1X7XB 2OA0A 3MCTA 4TTTS 1NRWA 1MHTA 5A5EA 4LHWA 4DAOA 1CR2A 4BFYA 1JQ5A 4PGMA 4Q16A 2FK8A 5IVIA 5C7IO 1CY7A 1H94A 2HXSA 1D5WA 3A9SA 3HMQA 2H52A 2O1SA 3OZDA 3EGDB 3HVHA 2FVXA 4IICA 1OLUB 1G9XA 4LY6A 3D2NA 1NNLA 5F9NA 1V8DA 4X64B 1VP3A 3QI2A 4DYVA 1FRFS 3SS8A 1BW9A 1XTBA 3LDAA 4PLYA 3N86A 2FUG1 1UMBB 1IMJA 2ZYVX 1OI7A 1JBKA 3A1FA 4QELA 1KAGA 4JLVA 3IKTA 3PPWA 2R86A 7ICRA 1JA0A 3LWMA 2ETXA 4EGQA 3RWBA 2ZIWA 5JZMA 4QRHA 4L9AA 4CT0A 3I52A 2LCIA 2A5GA 4RA6A 1V8ZA 4FONA 2W2XA 4L76A 1MV5A 3OWXA 3IPYA 3SBDA 3HB9A 1S8NA 5T4EA 4MUMA 2UYCA 1UMKA 3PVZA 3QUSA 3E7FA 1O54A 3QF4A 4LDJA 5F7OA 3EQ9A 1TL7C 3CRVA 1EHYA 3PEYA 1ZY2A 3QKIA 2WFLA 3FHTA 1PJAA 5FBHA 4PX9A 1SQSA 4C8MA 5J2FA 1X7YA 4BWVA 2JLVA 4J0FA 5DGTA 5ITVA 3P5SA 5EINA 5TQ0B 2XY6A 1J1IA 4EY3A 2LR0A 1V0JA 5IJXA 3NATA 4OQEA 2HWWA 4FINA 2HEGA 4D4KA 4C0LA 3I58A 3R23A 3OWOA 4MR9A 5TVGA 3S8EA 4YMIA 3O1IC 3WBJA 3DCYA 3DHVA 1TYEB 4U7DA 1XRLA 4Q93A 2IGBA 3KVYA 4JGIA 4YAJA 1TFRA 2XAUA 4D43A 3CNNA 4CCSA 1QIMA 3H65A 2Y1KA 1NG9A 4QASA 5TQJA 1AGNA 4WKNA 3HE3A 3FSJX 2NACA 2WVAA 1ECGA 3NIBA 2AN5A 2N1RA 2QL9A 3IO3A 4QGHA 3PNLA 4G07A 1P2BA 3D6JA 1V1MA 5CA1F 3O21A 1DG1G 3TQTA 1D5CA 1IIRA 4UTOA 1ZEMA 4ROTA 2JZOA 5LU8A 1VL1A 4FCCA 5J5VA 2CYBA 4WOJA 2REXB 1C7QA 1YVDA 2MR5A 1IUKA 2BR3A 5EIOA 3B1FA 2BKEA 2I71A 1N2ZA 2BHTA 3KT0A 1Z26A 4Z4HA 1A1VA 1UEIA 2Z4SA 2Z5FA 3RFAA 3SQMA 3DW3X 2QJOA 2H4XA 3URKA 1GA4A 2O52A 1KOLA 4DZZA 4X00A 2OFWA 4HXYA 1V4NA 2ACVA 3EVBA 4PZEA 1Y3BE 4Q7MB 3NBMA 3Q3VA 2B4YA 3T12A 4J8PA 4MOWA 1Z3IX 4JJ8A 2I7VA 3EH1A 1A7JA 2AFRA 1IN7A 3MELA 3C5WP 2GHTA 1DRUA 4PZOA 4OXXA 4NESA 4KKXB 4BV9A 2ZBPA 3DOEA 4WPGA 2VT2A 3GGGA 2FKNA 2ZAIA 4I9FA 5FOVA 1NRJB 2ZG6A 2FCAA 3QU5A 2OCGA 4D9FA 1YACA 2FWPA 4LTDA 3DB1A 3CVVA 4MQ4A 1P4GA 5DM70 3LCRA 4NCKA 4RFSA 3VR6A 3KD2A 1X13A 5E6SB 4YJGA 3HUFA 2FU5C 1JLSA 1E18A 1V3UA 4ZT5A 1WMSA 3R7LA 4X1YA 1HDRA 1A98A 4Z4QA 4II2A 1E6LA 1RI5A 1U2EA 2QZ4A 4XYLA 5EHZA 1MNAA 1UBMS 1QO0D 3SV3A 4ZOCA 1NQVA 4WZBB 3G0BA 1OAAA 3ZJTA 4O3FA 1CJTC 4QJFB 2HCJB 1DVRA 2XUZA 4B46A 2QVXX 2P3LA 1W46A 3BVPA 2BV3A 4MEJA 4GXQA 3UHJA 5AW7A 4F9GA 2X13A 3BHJA 1GVNB 3IOYA 2H5LA 3IUJA 5IXJA 1MX9A 3B6ZA 1MA3A 3C8ZA 1Y1TA 1A2OA 5HIJA 2JBAA 2X4LA 4EMTA 3ABSB 4RQ3A 4KQJA 4F7WA 3MIZA 1OHHD 4PLPA 4YP9A 2LD4A 1VI2A 3TQHA 4D6XA 3KV3O 4F97A 1OA1A 3MBYA 4AG3A 4C3UA 3PYXA 3OJSA 1MZPA 1B0UA 3ZXSA 4ZYZA 3SSMA 4UJ3A 2AR0A 4ZC1A 1AKMA 4KVAA 3I0NA 1E2HA 3L1VA 4EAAA 1HNXB 5DT9A 1W4BA 3C7TA 1PJSA 5DXJA 4E09A 2I9GA 3W8NA 1JXEA 3GFRA 2EZUA 2BGKA 1M67A 5L3RA 4EPRA 2YFQA 4ARUA 1NN3A 4DO9A 2J41A 4ZGBA 3DEJA 1NC1A 3GFOA 1CUFA 4TWRA 1TUIA 4DDVA 4WESB 5KNLA 1MEJA 4OFWA 2VBIA 3R5SA 5T3UA 1JJBA 3ZIUA 2G83A 3MT0A 3O1LA 1OLXB 2BF4A 5HUQA 3N6RA 1LX7A 2I1LA 3Q4GA 3FJOA 3VDXA 1DQZA 1KQOA 4AK9A 3FB4A 4CM4B 3KVNA 1SXJA 5EGNA 3HKCB 3A70A 3D6TB 2IQ5A 1P5RA 1PW5A 5A2GA 2FZLA 3KTOA 1QGED 2HBKA 1TQDA 1CUEA 3G1UA 4XGNA 1AKUA 2J0UA 1FFHA 2W6IA 4R69A 2NVOA 4WBNA 3RK0A 1IZ9A 2JANA 2ZR0A 4UMVA 3ZEIA 2BPGA 3DE1X 1YZFA 4F9EA 4FGZA 1AKWA 4O1IA 4RGYA 2WKSA 3U3KA 4F84A 2NXWA 2OAEA 1CJBA 5U4XA 5DTQA 3DONA 3R0JA 1JHRA 3KV1A 2FWMX 1PX2A 1I2CA 1E2BA 4UAUA 3HZZA 1P80A 4KWEA 4LZGA 4CZ2A 5K0JA 5AVOA 1I2MA 3P27A 5IDVA 1I6MA 4FGWA 1IQ0A 5ES4B 1FTGA 1XTTA 1X7ZB 5AI0A 3PVXA 3V33A 3M5WA 3OF2A 4M0LA 3PUZA 4HNAA 4HS9A 3QENA 1O97D 3LTEA 1PAUA 3MJDA 4NPCA 4ZCRA 3R09A 4Y98A 5T41A 4A8EA 4EG8A 1SG6A 3A3PA 5IEBA 4DSLA 2UZIR 3OM9A 4EUFA 4G1FA 4ZMRA 5BW6B 1NONA 1TGYA 3FGZA 2PX5A 4G0WA 3QG1A 3FUVA 1QCDA 1QE3A 1BPZA 3NIWA 3FYDA 3PICA 2BUBA 1KDVA 1YH3A 3DHEA 2ESRA 3P9KA 1TVAA 3KHTA 3DBIA 2FWIA 1U2RA 4X8HA 2KG5A 5AW6A 2JLBA 3LT1A 3C8HA 2GZ3A 3QQPA 2GKOA 5IVHA 2ASLA 5KUTA 1QF6A 2P40A 2VP3A 3F2BA 3VR5D 1H4SA 1ZIDA 2YOHA 2WZBA 5SICE 2NPFA 2J48A 3G9TA 2GUGA 3SQIA 2ZCVA 1DG3A 2FZ4A 4KIJA 1BQ4A 4ZYXA 1D4ZA 3BQ7A 4YYEA 5C4GB 2OM2A 4GPAA 5CJ2A 2WA1A 4KQWA 4CLRA 3GYBA 4PG4A 2WPDD 4XASA 1Y8QB 1R18A 4M49A 1TV9A 4RPXA 4U2FA 1YHYA 3RF9A 1ML4A 1MW8X 1UANA 1RCFA 3NH9A 4KPGA 3IP4B 3IYLW 1E3WB 4GXKA 3KB1A 3TKLA 4GIBA 4MVJM 1W0JA 1CRLA 2BFCA 3JATB 1DRKA 3A8TA 5JS6A 1YMQA 1J2MA 1LWNA 3EW7A 3R6WA 2BWJA 4PYRA 1GU1A 1QV7A 2KSQA 4WINA 4BV8A 3MRTA 3PXCX 1XXHB 3JD2A 1AMUA 3IQWA 1RXCA 2WLSA 3WB2A 5BN3B 4Z9YA 1MQ3A 2VNKA 1NJ6A 1WYGA 1U48A 1F4VA 4MWOA 3TLBA 3O2SB 1IQRA 4G0VA 1WF3A 4B2PA 9ICSA 5TARA 3AUFA 3JQ7A 4RIFA 4IY1A 5CB4B 5J40A 2D7CA 3QEKA 4OIFA 1JSLA 1TYDE 2GPYA 2H06A 4JQYA 5CP8A 4J0GA 3VR4D 2V59A 5IAGA 1KS2A 4BFTA 3W8RA 2PUVA 3BBLA 2FMPA 5K6AA 4U7CA 4PGYA 1T9CA 5DBOA 5EPOA 2NU7A 3GROA 1SKBA 5EESA 2JA2A 1SU7A 1F0KA 3CW8X 4NULA 1ZQKA 4LHVA 1R27A 2YQEA 1DG9A 1LBIA 5KTYA 3QV2A 2XY7A 1I7QB 3GGPA 4LYGA 3K8QA 2YHIA 3SDSA 8ICGA 2P9TA 3K2IA 4HTFA 3TIIA 2DFLA 5DM60 4ILEA 3ZZ1A 9ICTA 1WUHS 1XDGA 4JLOA 1CJUC 4F6LA 4EYIB 5AM3A 4KLQA 2ZIVA 4JBGA 4PQEA 2XNKA 2FP4B 3EMDA 1KRXA 3QX3A 1YIAA 1A8QA 1TMOA 3GIMA 1TJ4A 4CF5A 2HREA 2PKWA 4G3IA 5HXAA 2CVHA 5EC8A 3C6KA 3AQIA 9ICUA 3C1TA 4BJHB 1TIKA 4FYJA 3X1DA 2PGDA 2MIIA 5JCJD 4AKIA 5D86A 1N6NA 2AS0A 3AUXA 4HWTA 2O3UA 2JLRA 4FLEA 3EIOA 1JLHA 6YASA 4XLZA 1SXJC 3RBEA 4R3WA 3TD9A 5EMLA 3H18A 1EFPA 2WT8A 4YAIA 1A7AA 1VFPA 3MDCA 1Q0HA 2TYSB 4YBRA 3A9VA 4Y6RA 3PMNA 4RIIA 5CYPA 3AR9A 4RANA 2ZJ4A 4E88A 4IIHA 5CU7A 2ZT8A 5CDSA 2PT5A 3W9UA 2W8LA 1ZOIA 5JNRA 2YN0A 3ZHCA 4DMUB 4BXOB 4YACA 1G5IA 1G21E 3WIEA 3BS5A 1TE2A 3F0TA 3D3NA 1WXQA 2CJYA 5CGQB 3DMPA 5CFQA 3D7RA 3DJFA 2JD1A 4MIKA 2OO3A 3CY6A 2W4QA 3ZWAA 3JX9A 5IHPA 2JEGA 5ADHA 5KCMA 5ED0A 4IZ6A 2WE7A 5CLGA 1NAIA 4EZEA 1M2VA 3CZCA 2R8JA 1WXGA 1RWOA 3JQCA 1F8GA 5FLEX 4PTZA 4BEBA 1JMKC 4CDMA 3N74A 2OVFA 3CLUC 2XY4A 3F2IA 4WY8A 1I3NA 2HJVA 1FQJA 1BPBA 2NYAA 8ICMA 2YRWA 4G63A 3LOUA 1Q0LA 2C2OA 2IDMA 4QQKA 3OE1A 3OKPA 3W5IA 4P35A 2PS0A 2BDEA 1RXYA 2V4MA 3PJGA 5CG1A 1Y6GA 3HWWA 1XZMA 4NVRA 2GWSA 1DAGA 4UB8U 4KQMA 1P7WA 1RBZA 4O2AA 3NAGA 1Z36A 2CCKA 1ZGAA 4ZIRA 2M1XA 1XJCA 5BPHA 3RAQA 2JAXA 2EKDA 5DN9A 3G6KA 1BE1A 1JZTA 5TJHA 2A5FA 2F3UA 3AESB 4N5NA 2Y67A 4LCEA 2VSYA 2Y05A 2W6OA 1XA3A 3IP7A 4ZHQF 3OPVA 4HBGA 3GJZA 1V3VA 1R8QA 3RO7A 3M6UA 4H6PA 2VJBA 3AJEA 2A94A 3E1SA 3NHPA 5KSPA 2QPOA 3K15A 1TJNA 4ND4A 3ZKWA 1KEEB 4ECEA 1PT6A 4LA4A 3LUKA 4UBLA 4V0KA 2JHCA 1P0CA 1QMPA 4MV9A 5J8YA 3ELDA 2XCAA 3NHAA 4PQGA 3U26A 2C5FA 2J3IA 1YIDA 4U3JA 2PX6A 3E9EA 4OJLA 2XSZA 5IP5A 1NM5A 3I8OA 1GPMA 3U7FB 2OV4A 2H29A 3SBXA 4C0QC 4MCJA 1YA8A 3HCOA 4BZZA 1LVHA 4DV0B 1XZGA <