4EELA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound citrate and sodium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
229
structure length
229
Chain Sequence
DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords Beta-phosphoglucomutase-related protein
total genus 81
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eelA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eelA01
3BA6A 2GHTA 3U7HB 1RLTA 3PCTA 5AW5A 3MMZA 3ESQA 4YGYA 4DWOA 5AVZA 3N07A 3ZWDA 5ALVA 3PGLA 3I76A 2ODAA 2Q5EA 3FZQA 1U7PA 4Y2UA 4KNWA 3ZVMA 3QU5A 4Y2SA 2WF8A 3NRJA 1ZD2P 2W11A 3ZU6A 3U7EB 1NRWA 3RF6A 4KNVA 4DW8A 2YJ6A 5AW3A 1ZS9A 1TJ5A 1TA0A 4JB3A 4NV0A 3QLEA 2WF9A 3ZX4A 1SWVA 5ALPA 4AS2A 5ALLA 2P27A 4QJBA 4UW9A 2FUCA 4BX3A 1Q92A 2IA5A 5ALEA 3U7GA 3ZUPA 4UU1A 1NNLA 4ZEWA 1VFPA 2B0CA 5ALOA 2CFSA 2O2XA 1QYIA 5A3RA 2HDOA 3A3YA 5AKGA 2YFYA 4O8CA 2OM6A 1U2TA 2B82A 3L1VA 5ALHA 2G0AA 3QGMA 5AVXA 4KN8A 1WPGA 5ALRA 3WGVA 2DQSA 3E8MA 3N5KA 3WKAA 4HYTA 1YS9A 1ZJJA 4UM5A 3L0BA 5AI6A 1Q91A 1PW5A 4BX0A 3ZTWA 5AKLA 5E0OA 1RMYA 1XVIA 3M1YA 4G63A 4I9GA 5AI8A 5IT0A 3L8GA 2G80A 1RRCA 2X4DA 4RETA 2I7DA 4HGRA 3QUQA 3L8FA 4UMDA 3WK4A 2BDEA 4J03A 5AVYA 3ZVNA 4KX3A 2CFRA 4C4RA 2JARA 4HGNA 5AIAA 4G9BA 1WVIA 5AESA 1VJ5A 3OTQA 4DFDA 2P9JA 4BNDA 2Q4RA 2OA0A 3QNMA 5ALMA 5ALNA 2YJ5A 1AQ6A 5IS2A 5AW0A 5ALFA 5AKIA 1L7MA 2YMPA 5AKYA 2P69A 1T5TA 2CN1A 2FDRA 3FPBA 3KD3A 5ALQA 1F5SA 4EELA 3E84A 3ZTYA 2ZXEA 4MWOA 2WF6A 3NUQA 2HF7A 3AR7A 3U13A 3ZVLA 3R09A 1U7OA 4CF4A 3L8EA 1LVHA 2EARA 1N9KA 2OBBA 2R8EA 4FFDA 2YY6A 1RMTA 5AW1A 3S6JA 1RKVA 3ONNA 3A1EA 4FE3A 2JGAA 1N8NA 5AW6A 3EPRA 1ZRNA 3UM9A 1Z4MA 3SLRA 3U26A 1L7PA 1L6RA 4EZEA 3TLMA 2HHLA 4BBJA 2PR7A 2JAWA 4UMFA 3ET4A 5AKHA 3WGUA 3N28A 3AR6A 5AM1A 2AUTA 1RKUA 5AM5A 5A3SA 3SF0A 5AVRA 1Z4OA 2WFAA 3OCXA 4CF3A 4OD0A 1S2OA 4C4SA 4Y2RA 1U2SA 3L7YA 4YIKA 3OPXA 1RLOA 4UASA 2I55A 5AKEA 2RARA 2HX1A 3J7TA 2B1QA 2HF2A 2WF7A 4IFTA 4NFLA 4KX5A 1SWWA 3MPOA 4YH1A 3FGOA 3DDHA 3B9BA 1YMQA 5AM3A 1YJ5A 4XE5A 3U7FB 4KYTA 2HCFA 1ZD4A 3OCVA 2ZBGA 3QUTA 3E81A 3SHQA 2QLTA 1RQLA 4CF5A 5ALGA 3KC2A 2MSNA 2I33A 3SKYA 4E88A 3M9LA 2MU2A 3OCUA 1ZD5A 1TJ3A 5AKJA 2I54A 5AHXA 2HO4A 2AGVA 5AW8A 3L0CA 4HAIA 4L6CA 5ALDA 3AR5A 2RB5A 2ZBEA 1ZRMA 5AKZA 2ZOSA 5AK5A 1O03A 2IOFK 4XQ0A 3R9KA 3OCYA 2FUEA 4H1WA 5T41A 2C8LA 5AW7A 3WK5A 5FP0A 1IWOA 1L8LA 2MU1A 2VKQA 1L7OA 5AI5A 3MN1A 3FPSA 4BEWA 1Z5UA 5ALIA 1VJRA 2WF5A 2G09A 4JDPA 2ZBFA 4OCZA 3KDPA 3B9RA 2ZG6A 1CQZA 5ALZA 2W43A 4EX6A 3QYPA 2YMLA 5AVTA 2YJ3A 3AR2A 3UMCA 4DCCA 3NALA 4ZEXA 5ALWA 4NABA 4L57A 5ALKA 4MUMA 3U19A 2PKEA 4GIBA 2O9JA 2D2VA 4EENA 2NYVA 2C88A 3R4CA 3KZXA 2FPSA 2HI0A 3AR3A 3FM9A 2P11A 2GO7A 2IOHA 4CNQA 1T5SA 2AH5A 2G08A 3WK6A 5ALJA 4UARA 3IB6A 2NO4A 2G06A 2WM8A 1EK2A 3QU7A 2FI1A 3MC1A 3WK8A 5AW4A 1RKQA 3I28A 2QYHA 1Z88A 4OHFA 2FEAA 2G1AA 4ZEVA 3WKDA 3SMVA 4UAUA 2B8JA 2RAVA 2Q4TA 3QU2A 2C9MA 5AW2A 4CE6A 3NASA 1YNSA 4RESA 2BY4A 4EX7A 2GFHA 5AVUA 3PGVA 4Y2PA 3F9RA 3SKXA 2I34A 3FVVA 4F72A 1S8OA 3HLTA 3QUBA 5ALSA 4C4TA 2C4NA 1RC8A 1QQ6A 4Y2TA 4J2TA 1Z4QA 1YDFA 2IOFA 3AR9A 1QH9A 2YMQA 1Y8AA 4OFZA 2OYCA 3GYGA 4BNDB 5ALTA 3WKEA 4Y2VA 1JUDA 3QX7A 3BWVA 1SU4A 3N1UA 3IJ5A 3DAOA 5IT4A 2YBDA 5AIBA 2C8KA 2B1RA 2GHQA 3NANA 4YIHA 3WK7A 4GXTA 3UMGA 4F71A 2HEGA 4HGOA 1RLMA 3PDWA 3W5BA 1J8DA 1Z4KA 1RQNA 1QQ7A 4UMVA 3VAYA 1T9ZA 5AVWA 5ALXA 2B8EA 1O08A 3UMBA 3NIWA 5AI9A 1L7NA 2EAUA 3D6JA 4NAVA 2IYEA 1LTQA 3ZWKA 4BEVA 3I6BA 2AMYA 2GMWA 2R8YA 1TJ4A 1RMQA 1Z4LA 5AVSA 2ZBDA 3L8HA 3ZW7A 3L5KA 3QU9A 2HSZA 1Z4IA 1TE2A 2RBKA 2W4MA 3A1CA 4BYGA 3A1DA 3W5AA 1ZD3A 3I1YA 3AR8A 2FPRA 4Y2JA 5ALYA 3ZI4A 3HYCA 3N8GA 3DNPA 4UM7A 5JJBA 1KYTA 5AW9A 1ZOLA 3RFUA 5AI4A 2R8XA 2HOQA 1XP5A 2JAUA 4B6JA 5AICA 3DV9A 5AKKA 3QUCA 5AK3A 3SD7A 2PQ0A 3OCWA 1XPJA 1Z4PX 3EF1A 1X42A 4UAVA 2JAOA 3P96A 1K1EA 2B30A 5A3QA 4EEKA 1RDFA 3B8EA 4L6AA 2FPUA 1L8OA 2EATA 5ALUA 2BDUA 2G07A 1Z5GA 3L0YA 4BX2A 4HGQA 1Z4NA 2I6XA 3WKBA 5AKXA 3ZX5A 4AP9A 2NO5A 1NF2A 5AK6A 3EF0A 3L1UA 3KBBA 3W5DA 3NAMA 5AI0A 1CR6A 3WK9A 4I9FA 1MH9A 4XPZA 4YCNA 3QU4A 4YCLA 1RPZA 2YN4A 4Y2XA 3AR4A 1J97A 4Y2QA 2YJ4A 3CZ4A 3K1ZA 2R8ZA 4UATA 5AM0A 5AM4A 2FPXA 3W5CA 1WR8A 3ED5A 4UU0A 4Y2YA 4FYPA 1Z4JA 4UMEA 2FPWA 3ET5A 3WKCA 3CNHA 1U02A 4AS3A 2YMMA 5AVVA 4PNHA 4HGPA 3IRUA 3E58A 1WZCA 3OCZA 5AK4A 4BKMA 4QQFA 3ESRA 5AM2A 3QXGA 3KOOA 4NWIA 4YCMA 3EWIA 4IG4A 1EK1A 5AVQA 1FEZA 4XOUA 4Y3UA 2WHEA 1YV9A 2CFTA 1QQ5A
chains in the Genus database with same CATH superfamily
3ZJ5A 4IDEA 3H83A 4FUTA 3HM2A 4RK4A 2G4LA 1MZPA 1N6RA 4RPJA 4N5DA 4LYDA 3AHFA 4KE8A 5DO9A 4DF4A 4EO7A 3RUDA 1OD6A 2EQYA 3PQEA 2QD3A 1RC1A 5ELLA 2FQYA 4RF5A 3WGJA 4GX5A 1S2IA 1Y9AA 3ZWDA 2R18A 4C6RA 1N1GA 1MRNA 5IKPA 2QSZA 2RI6A 1QR2A 4ZO6A 5CDGA 2R8JA 2YQEA 1QVAA 1V26A 1V45E 3H5TA 5FWXB 1AROP 5AJYA 3QU5A 4ZRNA 4IBOA 5EQTA 1BDMA 2A92A 4CBVA 4EKIA 4HVCA 3WWCA 1ZD2P 3M4NA 4YAKA 3K72B 4LQDA 1NRWA 4J2HA 4WNCA 3QVOA 5AT1A 2BAGA 3E0XA 4NMLA 2IY9A 3N74A 1PYOA 1VJ1A 3BXEA 3FG9A 1SAYA 4Q1VA 4OKNA 1GUZA 4QBFA 3WXMA 2VVTA 2OYSA 4PHFA 4EQ6B 3TZCA 3LUBA 4HQKA 2REOA 2ZUWA 1OH8A 4MYCA 1PT7A 1W4RA 3HP7A 3HYNA 3BIFA 3CXUA 4O4JF 4P4SA 4U2DA 4NY8A 1B4DA 4FM9A 4K1XA 2PRZA 4LYFA 1OYWA 5EJ6A 1K8RA 1RTKA 3EMBA 1Z73A 5JYCA 4PZEA 5DLYA 1ZJ6A 1KH2A 4NXMB 3FI9A 4YN4A 1QGYA 3N0VA 3TI7A 1Y6RA 4KKVA 1ZMXA 4WLEA 4FWTA 1DMRA 2REXB 4OP3A 5E6UB 4B3GA 1X7WA 2UVUA 2CE2X 4Z0PA 1E2UA 1Z8DA 1GQSA 3EUEA 3U48A 3G2PA 4AP5A 1BXKA 2Z2XA 1GR0A 1N4DA 2I62A 3OZRA 5KJEA 4L7VA 3M6UA 1TPZA 2ONCA 4ZIRB 3CUWA 4DA6A 3KSZO 1ODKA 5IXSA 1NW7A 1WPGA 2H3FA 4KR0A 1LJUA 3E1GA 1Z5OA 1D07A 3A2NA 1XAJA 1YS9A 1N8SA 3AJRA 3CWZA 3T1TA 2EQAA 2GCOB 3U44A 4Q02A 1FFUA 3W5VA 1DOQA 3U56A 2GH1A 1C7IA 2O8BA 2AU0A 2XCOA 1L4MA 3JQEA 3SQMA 1NUAA 3LRXA 2VPYA 1E1YA 1ZYQA 1V0JA 1XVIA 4ZU1X 5JO9A 4CL0A 2WFLB 1YZHA 3DA8A 2F1IA 3R2JA 4LE0A 2FETA 1TK3A 4PR3A 5J5CA 3L8GA 3Q6MA 3WHPA 5FTJA 1A6SA 4QYIA 5DG8A 1G5FA 4OJYA 4P7KA 1FMLA 3WU2U 1C9YA 3W8NA 2ES6A 1ATZA 2JA1A 3C6XA 5GVSA 5HOQA 2BGGA 2XYVA 3EQ6A 1QHGA 4EARA 2ACEA 3ELBA 3IQGX 2A1JA 4BQIA 2D1YA 1K8ZB 1M1YB 2PX0A 4O02B 3U3RA 4WBNF 2VT2A 4LFBB 1K88A 2OBNA 3WMGA 3Q8LA 1L7DA 5AD1A 1LPMA 1KFBB 4UC0A 4UNPA 1VJ5A 4YI5A 2BZ0A 4PPYA 4UM8B 4NZNA 1AS2A 3TO5A 2WKRA 3TQTA 1FNSA 2OGUA 1LDMA 6Q21A 1I7NA 1NI5A 1JBKA 1ML3A 3JWHA 1I5EA 4QUDA 5C8VA 5HE8A 5T8KC 3HKZF 3UT5A 3HKZC 4FVTA 1JFFB 4NLLA 3ZGOA 5JSHA 2WKPA 4LUCA 3UG6A 2FF5A 2QJRA 4PAQA 1T5TA 3I04M 9ICWA 4BO9A 4HXYA 4HKTA 4GOOD 1L5GB 1DE0A 5EIFA 1TRHA 3WFIA 4TUYF 3ZYZA 4MQLA 4RW0A 1BIFA 3FGNA 4RV5A 5DM2A 5JXWA 1TVEA 3JVUA 1L1FA 3N2GA 1X13A 2WF6A 3TECE 3AF3A 5F23A 4GOXA 1U9LA 2HPHA 3AR7A 4MV7A 3O4IA 1J24A 3BWEA 3IVMA 1L7RA 2VK2A 1Y7PA 3IMFA 4FXPA 3ZD6A 2YASA 2EP8A 2P5SA 3EVNA 3H3XA 3FMPB 4MS1B 5DCWA 1IZ0A 5EPUA 1L3TA 4JITA 1PTJC 3IKLA 4ZANA 5C80A 1ONSA 1RQXA 1VA4A 2HA4A 4F4HA 4O4HF 5KNBH 1J0BA 1TTTA 3MDAA 1L5HB 4EKDA 3KSBC 2E1EA 2XQJA 4WFIA 1XU4A 2OBXA 1MG0A 1W96A 2J3LA 3NNSA 4R3WA 4UCWA 3GV7B 1BCSA 1CR1A 2WYOA 3UGQA 4D9FA 4K3VA 2NN3C 3SR6A 2IZ6A 1ZGHA 1BPBA 1FNMA 2DPXA 2ZTUA 4L4ZA 1C7YA 4PXSA 3GOHA 3QEJA 3BAFA 2W2PA 3C24A 5BV0A 4RU1A 1KRXA 2AOTB 5AKHA 3WGUA 4YD2A 3GLHA 1Z8HA 4YAGA 5KTSA 1WU8A 2HVIA 1VIMA 1PDVA 2IHJA 3GL9A 1UOPA 2LNDA 1NUPA 1SGWA 4WZZA 4CN8A 4WY2A 4E3WA 3R74A 1HYGA 2QPOA 1I2DA 1QGUA 1QH1B 3LLUA 3A2MA 1FTNA 1GNSA 1T5LA 1ZRHA 3MWKA 2H1LA 2NUAB 3WP1B 4I2FA 1HSOA 2QD2A 7GPBA 1NX9A 2Y0DA 2MSDB 4HG2A 1U2SA 2WYUA 2J7PA 5A03A 1JMYA 3T1YB 1MEOA 3K3PA 1BEZA 2INGX 1ODCA 1SUSA 5BUSA 5EHNA 2PZKA 2O3TA 3K53A 7ICQA 2HBQA 3I9KA 4JL8A 1E32A 4MYHA 5A71A 3UJDA 3ZKWB 5AFSA 2A4KA 5C32A 3S8MA 2HF2A 4F3TA 4X3CA 3AU9A 2BKEA 4EB6A 5A04A 3SJBA 4FHEA 1VMIA 3R9IA 5L3VA 1FTSA 2G1JA 1N3LA 4JP3A 2X2FA 1HE3A 3SIXA 3C3WA 1V16B 1F0PA 5D49A 2D2FA 5REQB 2MSWA 2VHYA 1BH2A 4IGFA 1YJ5A 2H92A 3PR2B 3NUGA 1R5BA 1G2QA 2J6UA 1C8VB 1YH3A 4PZPA 4EITA 1Z7EA 1RQLA 5BWOA 1Z47A 2VIIA 2KHQA 5EJ8A 1Q12A 2MSNA 3OIYA 1EVIA 3OZVA 3C8HA 5DK4A 4CCYA 5EHZA 4PG7A 1PX2A 2JHFA 3ES9A 4F8JA 4DR1B 4N6GA 1G3RA 4RD2A 4EECA 4RKEA 3E3OA 2RSLA 3RJMA 5E4TA 4M76B 2FW6A 3GLQA 3T5AA 1N60A 3OC6A 1CRLA 3FNHA 3HKBB 4FB4A 5BN5A 1VE3A 3V2IA 4NESA 1C14A 3X1WA 3KB1A 3BMQA 1QRDA 2WFMA 1CE8B 3C0KA 2H59A 2V7QD 2HREA 3A0BU 2XLCA 1JHVA 3GPCA 1P7CA 3LFUA 3WL5A 4NK4A 4TS3A 1M10A 5FWDA 3L4KA 1MD9A 1KETA 4RIEA 3C3CA 4ZAXA 2XA9A 3UQ2A 3LPCA 3TIIA 3ZCPA 5CDUA 1XTBA 2XGQA 4QTTB 3CLRC 1FK8A 1ZXBA 3GPDG 1PL7A 5AW7A 1W0JA 2K4HA 2L19A 2MR5A 3ZS8A 4FHDA 5FP0A 1SOVA 1XMVA 2VANA 4Q3AA 5LZ5A 4OQDA 2JJQA 1ZQGA 3P19A 2AGQA 5I4BA 3I0NA 1OZHA 3FPSA 3AHCA 5EJFA 3U4AA 5ERYA 5KZMB 1JKMA 4QL3A 3I6MA 4HRAA 1MN8A 2R8IA 4FCCA 1E6WA 1NW5A 3HCOA 3RK1A 4CG3A 5JZMA 4GX2A 5BXQC 1XMOB 1XHFA 3K4GA 2FCAA 2KYRA 3ECAA 3GWGA 4LOHA 1O0BA 1CQZA 1SCIA 1TIBA 4GHWA 4MR9B 3AF6A 1IEQA 1DGSA 3A9TA 3S81A 1CB7A 1EDEA 2EBUA 2AC2A 2WBLC 5IJ0B 5LP1A 1QKIA 4XW2A 4EYQA 5CDYA 3MWFA 1ZD8A 1LEHA 4JJ7A 4TZ0A 4RNOA 2BGIA 2ZYTX 3OZSA 2RDMA 3HUTA 5L7TA 4DCTA 2YCBA 3H5WA 4BMCA 2B94A 4B7AA 2QL5A 1GRRA 3L8MA 1I10A 2GEVA 1OUQA 1EFDN 2BHSA 3LCJA 5I7HA 1SXJD 4TT3D 3LVQE 1FMTA 4IINA 4WKBA 1YRWA 2ZXIA 2Z56A 1OA0A 5J0PA 8ICPA 1N6NA 5HZGA 1NA5A 4BN5A 2DC1A 3BRWA 1NU8A 1QLHA 4KMMA 3RV3A 3EIEA 4YR3A 2GO7A 3LUHA 2XCSB 2IIQA 2LYHA 1X1RA 3O4FA 4FN4A 4R84A 4ZICA 4CDNA 4ESVA 1LDBA 4G67A 4ZU3A 2IQIA 1ZIYA 3AIKA 1NKEA 2GKGA 4RCYA 5TGDA 1L4FA 1CNFA 1QVZA 1TC1A 1TU4A 2POQX 3EB9A 4UQPA 1EEHA 2DTEA 3RABA 2FG5A 4O3QA 3AUOA 3EZ6A 4NE7A 3IB6A 4TLAA 1D1TA 2XITA 2ORIA 3EUAA 3RH4A 1ATIA 4FK8A 5KG1A 4WZBA 5JNWA 2O14A 2JEGA 1CUGA 5KYGA 2ABWA 2JFNA 4V2IA 1E5VA 1EUDA 3HPRA 4Q9HA 4DJDC 1A2BA 1BMDA 3RC7A 2J5BA 4P5DA 1WXHA 3IR6A 5MDHA 3B3FA 3LDUA 4O0MA 5KQRA 4GXKA 2X0NA 4KXUA 5B5EU 1U3FA 4FQ8A 3TOSA 2HCJB 3HADA 4M89A 4O4JB 3GWZA 1R50A 2VTBB 3RS4A 2HW3A 2C82A 1NVWQ 3JYLA 4LMBA 4Y6OA 3AIIA 4YRSA 3OZWA 5SY6A 4JFRA 3S8EA 2Z98A 3BM5A 1SV0C 1UXJA 3PBKA 1FDOA 4N82A 3AY3A 4M22A 4QIWF 3UJPA 2POCA 3EXHC 4R1NA 5KT7A 4AZ3B 4YCAA 4ZDJA 5FBVB 2CNOA 2PGXA 4MYSA 2IPMA 2ID7A 3Q88A 2PEZA 3NIFB 4JVMA 2ZR7A 2NO9A 2IPXA 4ERXA 1NJ2A 3OQJA 1N78A 3STHA 1I4LD 2QRQA 1VFNA 3BXZA 4NP6A 1NUQA 4WD3A 4QU5A 3QUBA 3IG8A 1RZVA 2HA3A 3ZQKA 4ENTA 1JFTA 4Y2TA 2DFTA 4Z2YA 4TL7A 2IHTA 1RCUA 4N0QA 1E4OA 1SKMA 1PR9A 2BH2A 3AILA 1WCLA 3QFHA 4MGHA 2A0XA 2H8KA 3AR9A 1KDYA 3RPEA 4F11A 4UCXA 2R84A 2B37A 3V1MA 1R27A 2DYKA 2VI5A 4OSEA 3IODA 4CWAA 2OXTA 3K0FB 3A26A 4YK7A 3FHLA 2ZSIA 1LPNA 5EINA 1XPOA 2BCQA 3PEEA 2BJHA 4RTKA 1I1QB 1SQSA 1O94D 1BXRA 1RKBA 3CRNA 2BUAA 3ORFA 4E5DA 4QZAA 1USUA 2H52A 1PFYA 2CHGA 3Q0EA 4C7ZA 3UV6A 1KI2A 1PGOA 3PQCA 4JI5B 4JI8B 4MFCA 5F3WB 5J0UA 1ZQIA 3EYWA 3MCZA 4HQFA 5EERA 1KMCA 8LDHA 4I5GA 1JXAA 1KJQA 2G9RA 2B34A 3UXPA 2PO5A 4UMVA 1KMNA 4D9NA 3NETA 3QKSB 4FW9A 1PR2A 4WKGA 1YJXA 2PUJA 5LA6A 1PUXA 1Z25A 5J2JA 3AEVA 2DLNA 2VDUE 1JEYB 1OXUA 3NC1C 3SQWA 2B8WA 4L0QA 2IWRA 1ENOA 1Z6QA 1Z0DA 2HJVA 2O7RA 2YRXA 1E66A 3IP1A 4I1UA 4MRMB 2QARB 4BEVA 4BAUA 2UXCB 2YHAA 4AWBA 1RT9A 1NC3A 1N7IA 5CDSA 3L79A 5AVSA 5FWNA 2JLWA 1W1WA 4D99A 4W1PA 1TOAA 1J39A 3CUVA 2A9FA 4HWGA 4UBIA 4JUFA 2OC4A 3QPAA 2XUPA 2EKQA 2QVZX 3EXG2 4J0KA 4RENA 5DNVA 4BBPA 3UCEA 2NTVA 4G26A 2Z58A 4WXYB 3M4YA 3AR8A 4I4NA 3WZ2A 3LGAA 1YO6A 3FTFA 1NDHA 2P9TA 3TAXA 3JQBA 4MRRA 2UUOA 4R2WA 2J59A 2R8XA 3TW8B 1SB8A 1ZKMA 2CJPA 2ZRDA 3FNRA 4LI3X 4FEYA 4JJ8A 4RF3A 1Q7TA 1PJ3A 3G23A 3OM8A 2VPWA 4JGBA 3WO1A 3LWNA 2FFQA 5EXSA 5LIRA 5EHXA 4DJAA 3MD9A 1V9CA 3NV7A 2AC4A 1OBCA 2ZUVA 2ZQ5A 1Y8RB 3A9WA 3IUPA 4QBHA 4G1UC 2QGZA 4K6HA 4TLLB 1RDFA 4HAUA 1N7JA 5MN5A 5DG9A 2H9IA 3K71B 3E3AA 1Q3HA 1L5KA 3W3AD 3EISA 4L4RA 2F1HA 1HEYA 2GM5A 1DINA 4W9MC 4WDRA 1IY9A 5LQKA 3MAJA 4YAOA 2GVZC 1YT5A 3TI9A 3T4XA 1TA9A 2GLUA 1GNRA 5H70A 3W0LB 3KVRA 5AOVA 1K27A 3ZJTA 4BJQA 3EQZA 4MQBA 1PEAA 3WK9A 2WY2D 4DLTA 2YRFA 1CXZA 5CDHA 4YCNA 1AS3A 1I6KA 1LBEA 2H17A 4PS0A 4B43A 4X1YB 1JE0A 4JEIA 4ED0A 1JSRA 4X97A 2G9NA 3CINA 4KLEA 4BE7B 1YZ7A 3QEAZ 1DP4A 1QPGA 1U3VA 2J3QA 3ML1A 4MQMA 2DFKB 4JR0A 3KWMA 3IOBA 4H4EA 1BKYA 2C59A 3T79A 3S8YA 5U9CA 1DJLA 4UU0A 1K5OA 1HEUA 1SEVA 4B35A 4KVAA 3GP3A 4UCQA 3KSMA 4KIUA 3A10A 4YRCA 4A26A 3O3CA 1MQ3A 3CZQA 1HL3A 3NM4A 2OZLA 4W63A 4PFQA 2O8DB 4FC7A 4BLPA 1OGJA 2W8LA 4BFYA 2WWWA 4H6VA 4QASA 2O3QA 1WW3A 3G6WA 3N75A 3NIGB 1YDGA 4O2BB 5FBWB 5JY6A 3NTXA 3EBOA 4YJHA 1VMAA 4Y9UA 5JBNA 5AK4A 5FTNA 3H4BA 4ZT7A 5AM2A 1I7PA 2AEEA 2ZB7A 4ED6A 3FTNA 2FV8A 4JBNA 4JR2A 2NXEA 1JDVA 4N1AA 3RS0A 3WQQA 2B6NA 4XJVA 1UDAA 1XG5A 4DTCA 1T5OA 4AK9A 1A9TA 4IG4A 4C0BA 4EOGA 3TN7A 3QK7A 5HJ2A 1DAMA 3WRXC 4F45A 4ZAVA 4RV9A 4E5PA 3C8MA 5L1MA 1YT3A 4IJ6A 4DZTA 5EIOA 3TOCA 1H1TA 5KG2A 1OGYA 2V0CA 1JEEA 1SQ6A 3B5IA 3PD0A 4L4SA 2VHZA 3WHIA 2W9AA 2R5WA 4C07A 1YNOA 5A4IS 1NXOA 4Q18A 3OKPA 4P3XA 4TWZA 3NS7A 4X00A 3F4LA 1SL2A 4J16A 3RH0A 2JIRA 1X9MA 2ZK7A 4JJ4A 5J4VA 4KLQA 1T4MA 2O5CA 8ICWA 4BB5A 2QN8A 2VTVA 3COYA 4Z0NA 2BVNA 1XA4A 3IMGA 5JC1A 1P18A 2ZJZA 4DYVA 1GG2A 5F21A 4I08A 2Y77A 2I1VB 1UBNA 2X19A 1OFTA 4XYEA 5I7AA 3RNLA 2ZM5A 1JHRA 1E8DA 5LMNB 1N6LA 2HLDA 2KQUA 2YY7A 4WASA 3OESA 4BNUA 1PE0A 2K8AA 4PYOA 4GI2A 2OO5A 3VHXA 2XF2A 1ONOA 2E55A 3NHSA 4FXOA 4BV9A 4RADA 4JCOA 4TKUB 2OMEA 3GROA 1XTSA 1HX7A 2RHDA 4P35A 1QIKA 1UK7A 5CX1A 5IDVA 3VTZA 5EJ5A 3C2KA 1J7JA 1HPLA 2M9NA 4JLJA 4KAXA 4D98A 3T1HB 3D3WA 5G4KB 3ZCSA 3WNCA 3ZUPA 4IOKA 3B1XA 2QGNA 3NS1A 2QX4A 2PD3A 4L4YA 1U04A 1VFPA 4MVWA 1QF7A 3E7PA 4UPVA 1H6DA 3C23A 1C7RA 5TQ0B 1Z07A 2XR1A 3DF7A 3AEXA 4M38A 2EFJA 5C8YB 2DB3A 3OZBA 4AJ9A 3K1RB 2ZIVA 2CFCA 3RU9A 1YGPA 3WOVA 2JASA 2OGZA 3DJYA 1ZJWA 4ER0A 3GRFA 1RYEA 2VDRB 4E12A 5H0IA 2G0AA 2X23A 4F5YA 1PFVA 2O4CA 2LHTA 2ZVJA 1FTYA 2AFRA 2HL6A 2JA2A 4KN8A 5CH8A 4A5SA 1UPBA 3WGVA 3OU7A 5IUKC 2Z4SA 5FFFA 3CRZA 3D1LA 3L7DA 3SFTA 3HM9A 4O8ZA 3RJHA 2PLNA 3ZWWA 1ID1A 4WCFC 1QZ3A 2JFVA 3R5XA 1G4HA 4KQFA 4P8RA 4P0QB 3QMVA 2AFIB 4DS4A 2ECFA 4G5YA 4R41A 1NVVQ 1YR1A 4MWZA 2PUHA 4OOFA 3C6KA 1U9CA 4LS3A 3TLBA 5F98A 2Y6VA 2VHEA 3OJEA 3X1DA 3ORHA 3JQ9C 4E4RA 1ND6A 1XZNA 3KKKA 1IIPA 1UHUA 2W9CB 2EW8A 3HCAA 4R1LA 4EJSB 2C7RA 2P9QA 4RETA 2OH2A 2QR3A 3L6CA 3MT9A 5DXFA 1O9GA 2I3ZA 3Q0TA 4LVNA 2QUBA 4UMDA 3STTA 3ZV5A 1XTRA 4PGXA 3BD6A 3KUUA 4B3BA 4M0MA 5JH7F 1T26A 3ZVNA 2XRFA 1KJWA 4GKVA 4X61A 3PXXA 1QLWA 2FLKA 4C7VA 4HNTA 1I2ZA 4DABA 3D02A 5KFPA 1YULA 5KFSA 2QRVB 2FX3A 3RJKA 2YY5A 4K1LA 1CEZA 3C2MA 1MIHA 3MJTA 3K6JA 4YBRA 2Y9TA 2I66A 5DN9A 3S1SA 3V6JA 1OXVA 2QD1A 2R7AA 2VP9A 4JP8A 5T6MA 3RWOA 1UR5A 3QYFA 1KTVA 1B8NA 3IL2A 3G82C 2P9YA 3JARA 4YJ2B 1FSZA 2BPCA 4DMCA 5J2TB 1C1XA 2EKDA 4DM7A 3HPOA 2HLPA 3BKXA 1YI8A 2QZPA 2IFTA 5BORA 2ZETA 3NTRA 2P8SA 3ZV4A 1H94A 2ENWA 2VQFB 1XB2A 3OTOB 4WJKB 4J4HA 4JLVA 4NFHA 4F6CA 2ZZNA 4KPGA 1YQGA 3VR6H 1G2PA 3I9V6 2DWCA 1SXIA 2H0RA 2LKYA 4DXAA 5T3UA 2KZZA 1UC8A 2X6TA 1AO3A 1WO8A 4NU0A 5BW6B 2PH3A 3BGWA 1M2VA 3R09A 1VYVA 2Y1IA 1NKVA 4CL2A 1G64A 4L8VA 1M1YE 4Q3NA 3FBTA 2JHCA 3OEYA 1YQWA 5A6VA 3L7BA 3NBFA 4B9TA 4B6OA 4FFDA 1A04A 2D1SA 1YL5A 2C9DA 3MR2A 1E3WA 3FFAA 4P7FA 3CQ9A 4UVIA 3CUKA 1H0SA 1JLSA 1VKHA 1EJ6A 4DA0A 1PK1A 2JGAA 1KIMA 1MAHA 3IP5A 3ZZ1A 4E5KA 5BVHA 3IP4B 3TG8A 2DKFA 3ZPXA 3UPTA 4RDXA 1QWSA 2WVJA 1QB7A 1VGQA 2A1UB 4ID9A 2FG6C 4QUBA 3VDNB 1H3FA 1XI2A 4W5TA 3WRYC 3GFGA 1MX5A 4QODA 2J32A 2HBMA 2VRWA 2L82A 4X5OA 1IEVA 2B98A 3PP8A 2DUUA 2C4MA 4N48A 5IAAA 3DLBA 7ICOA 2I1WA 3GXOA 4RVDA 5DNAA 4HJXA 4C1NA 5HQ3A 3JQPA 2KV2A 3HX0A 2GLTA 4GQAA 1A4RA 1AXEA 1FRQA 2C7QA 3E15A 1OXJA 4R31A 1TUIA 2AUTA 1O96B 1QGOA 2QLMA 4GNKA 1JP7A 1P5HA 2R66A 2X2EA 4R69A 1H22A 2ID8A 4B3TB 1D2HA 1WSBA 1NJZA 4OHBA 2A0WA 4FSXA 3HABA 2BGKA 1CG6A 4ARUA 2HLNA 4EG7A 1P29A 4YIKA 4JYPA 5JRZA 5K8IA 4HDRA 3DZFA 3TTTA 2VQ3A 3Q3IA 1EE9A 2I55A 1F2UB 5TGZA 3K8QA 1QP4A 5G53C 4JLSA 1RJEA 2KEYA 2PT7A 2M6SA 3W90A 4PGMA 2ICAA 5TT1A 3FMIA 1X19A 5C4MA 2W55A 3RUCA 4XWTA 3WL3A 5E7JA 1EWQA 1UPFA 4IDDA 1MB3A 4WBNA 4DT1A 1NF3A 1PS8A 3S40A 3C48A 3DMGA 3HYSA 3LAWA 8ICEA 1XXHE 4W7IA 2VRCA 4EBEA 3B9BA 5JUWA 2K5UA 3WDMA 3NYWA 5KAMA 3BJMA 4XM0A 3CB2A 3P9KA 4YRTA 2EHJA 4FEAA 4L07A 4RPLA 2V98A 4BKRA 1T1RA 3NHKA 3PC3A 1V1MA 1U90A 4MA4A 1HSZA 1Q1BA 1H66A 1RQPA 1ZN9A 4FP9A 4JC5A 2J30A 3A0HU 3SGLA 5HHIA 1N2JA 2GLEA 3RRHA 1G16A 3COSA 3LIIA 2B2NA 3RJIA 3H0LB 1RRKA 3G1UA 4OMCA 3LT4A 3D2QA 4KO4S 5K8UA 3JQ8B 5FL3A 3DE4X 4YN3A 5AW8A 5FAXA 4DLSA 1VXRA 5J23A 4B9NA 2IELA 4LRQA 5JSUA 3H8JA 5DQIA 3G85A 5DBHX 2I4MA 4IMIB 1OI2A 2QENA 2MSKA 4L6CA 5KG6A 3PSAA 5HIKA 4LF4B 2N42A 2FRDC 4GLBA 4ARAA 4R0MA 4DA9A 3TTYA 1WV1A 3WWOA 3G9TA 4JLAA 4RY2A 3CUSA 4ZAZA 4ALJA 5SY9A 1GG5A 1Y33E 5COAA 2Q2NA 4TV9B 3VC7A 3SQXA 3UMRA 1NNUA 2H2DA 4RQMA 3LDGA 4C43A 3ORQA 3IT3A 1UPCA 3Q9SA 3DEIA 1PJSA 2MU1A 2VXBA 5H16A 2W98A 3JRWA 2HHQA 3OJSA 2JLSA 4LX0A 1U28A 3MTDA 4MFFA 1UBCA 2QD5A 4EPTA 1LKZA 5CK4A 5IH7A 1EDZA 4UDOA 2PRIA 1VJRA 1V7ZA 3WO0A 4O2BF 4PCVA 1Z13A 4OCZA 1R6XA 1ZWKA 1T9AA 4LHSA 2C94A 4NU5A 2G1UA 2W54A 5DMXA 3VPCA 2AF4C 4NL9A 3D1VA 4HDMA 5T4HA 3TNFA 4HH0A 1VMDA 3NXSA 3WRVA 3L1JA 3W5IA 1X7DA 2BP7A 2RH8A 2G9ZA 1W4CA 2HHUA 5FNVA 5BMOA 4G0PA 2XEDA 3OY2A 1T4CB 5T3YA 5KFVA 5J0TA 1D0IA 3BF7A 4DRZA 2O2ZA 3MS4A 3OVMA 1Z35A 1I6MA 5D3KA 5IVIA 4KGDA 4YR0A 3HY4A 5GMOA 3KPWA 3C3MA 5HJEA 3HGMA 2V4RA 5J63A 3O03A 2PX8A 3F6BX 2PBLA 2X6QA 3T7SA 1KBUA 3MJCA 3NJ4A 3BSFA 2EH9A 1T2CA 3DOCA 4DSKA 4KTVE 4M8KA 3WTCA 3ZWMA 3DCJA 5EVJA 3CT4A 3KZXA 1MGOA 1MGPA 2ZE5A 2FRDA 2CLFB 1ZQJA 3OT4A 4LWZA 4R9NA 2XKBA 1KEEA 4QZFA 1V5FA 5E9JA 2F1JA 1C0EA 5D46A 3D7MA 3LPDA 5CHEA 1Q44A 1W9MA 1ZGJA 1QX3A 2PSFA 2QSJA 3MT7A 1ZZGA 4KIWA 3CLRD 4I46A 1Z3EB 3RVBA 3ETLA 5GZ1A 5TMDA 4H4CA 5ALJA 2R8KA 1OZAA 2ENUA 2XYHA 4GQBA 1H2FA 4KQHA 4M1ZA 1R1DA 2AUNA 5ETJA 5HK9A 1YCGA 1BVSA 1A9SA 1XROA 2BGWA 8ICVA 3QU7A 1EK2A 1U8TA 5HP4A 1ZLXA 5DX8A 1HUOA 5CB0A 4FYJA 3AU8A 4MLDA 4X7RA 2OD7A 4D79A 2W4QA 4OKIA 1KJZA 3EZGA 3AFHA 3G8DA 2RGUA 4FD2A 4WPGA 2VJ5A 4JK1A 4O3OA 4BVEA 4YCSA 2JEZA 2EZXA 4B3DA 4OH7A 2BSXA 3N70A 4KTTE 3B78A 4KVZA 1XJWA 4G84A 3WQBA 4DV0B 1KMQA 2B8TA 4NHEA 1YVUA 5IWAB 1ORHA 3Q85A 3UT0A 2B6HA 2QRMA 3CLSC 4QZIA 2VA2A 1I32A 2GAOA 2EYQA 2IUUA 1W76A 5GTHU 5KG7A 1CFJA 3FDIA 3T7JA 3FKJA 1L4EA 5CVCA 5SZIA 2AFIE 3SBDA 1C3LA 1HMPA 2WP8J 1Z0FA 4ZJYA 5DYIA 4EVRA 2QTNA 4RHCA 4RK6A 3D1JA 2V74B 3AJ9A 4P0TA 3VDQA 2G8LA 2R48A 1GAXA 2IXTA 3P2KA 1AQIA 2DF4B 3R41A 2WE7A 1EEXB 3GJ8A 5L9XA 4FE4A 1JLLB 5KUTA 4J2TA 4RVHA 3V8MA 1K5GA 3UHPA 1S97A 2RDIA 4RZIA 3BTSA 1IFXA 1IBSA 3RT1A 5ITZB 2GNOA 4MVXA 4ZRMA 1E1QD 3IS3A 1O3YA 1FA9A 1U2EA 1U3UA 2J9YB 3Q9NA 5J4KA 3UVEA 4IJWA 4HRXA 4ECZA 1KI6A 1OFIA 3F47A 4LI0A 1C9EA 1XAIA 1RI4A 2Q0QA 3BFVA 4NC9A 1N2CB 3I5UA 3BFPA 3L0IB 3MMPA 1GTRA 4KPYA 5L3SB 2QLNA 1GL3A 2GBPA 4Y1GA 4DMRA 3PA8A 3S2FA 4BHTA 1WQ4A 4AAYA 3HDYA 1KQFA 5GONA 4R1SA 3FMVA 1GPKA 2CLEB 4CM9A 2FSGA 1KS9A 3GLRA 3WRYA 1BTOA 4Q3BA 2HMYB 1NOIA 4Q19A 3CG0A 4ASUA 1S8NA 4OX9Y 1D8TA 3HZZA 4ZT3A 2W7PA 1GTZA 3CRMA 2FKNA 1ZXIA 4U5QA 1KFCB 4KDRA 2A57A 2LYBA 1VHQA 2NPIA 2QVCA 3PUYA 5LUAA 4BUZA 2PLRA 2B8EA 3L6BA 1JKFA 3SXUB 3KALA 1PSWA 5AI9A 3VO2A 2JC3A 1Z5PA 1NQ5A 5IM4A 1PYGA 5DGBA 3GEBA 1N6OA 5C1IA 2YHIA 3E4DA 5HQTA 4BNYA 1P31A 3I6BA 3CNBA 3TLYA 4QFCA 5MHTA 3T3HA 4GS5A 3PZPA 2I3AA 2W6ID 1DMSA 2ONKA 4XDYA 4JZYA 3SMQA 1VZ3A 3OT5A 4C7OB 1TAGA 4YALA 1SG9A 4DUZB 2HSZA 1USIA 5KYUB 5K3SA 1NZDA 1PJRA 3NT5A 1KYQA 4IH9A 4Y6SA 4ZJPA 3A1DA 3T12A 1EUQA 3PC2A 1P60A 4FIDA 2FPRA 3N8GA 4RCZA 1GDHA 4FYVA 2ZAMA 3EARA 3TLEA 4QZVA 3EN0A 2DKOA 1AT1A 2JBAA 4IJUA 4KAJA 4WKPA 1IRIA 5CHYA 4UB4A 5F77A 2BTQB 4N40A 4QICA 3KXLA 5CM8B 4IIXA 4FX2A 1RHMA 4MR8A 4G3XA 2C7GA 2AYYA 5C81A 5AK3A 1IXYA 2IXDA 4IHJA 1GZ7A 3T3MB 1ZVMA 3GIMA 4JWKA 4QPNA 1QR6A 4MITA 3VR3D 1WD7A 2LI6A 1I4DD 2BI4A 3IV7A 1H4QA 4MVJI 1S5LU 4IOMA 4B17A 3UMSA 4XIYA 3CJQA 1D4AA 1Q0PA 5BWBA 3G2NA 3U7JA 2QW0X 1ZAYA 1YAHA 2QA5A 3T3DA 3OFND 4QDXA 3RG2A 4A6DA 2GPAA 2AR7A 1IXZA 3TTWA 4O4IA 2BSAA 4HAWA 1UAAA 5EMNA 2JF0A 3L1UA 3OH8A 4JDUA 4FR2A 1G3QA 1RS0A 3AP3A 3C2LA 2EX0A 2ZLBA 2FPLA 5JZSA 4DOCA 4BCDA 1JDTA 4EHJA 2C9CA 4LMPA 3BQ1A 1T3SA 3I58A 3KD2A 1N5LA 4BNWA 2CF6A 4Y2QA 2JIBA 2Q07A 3Q8MA 3DAGA 5KFBA 3FE2A 1JU3A 4J7AA 5FWYA 1I01A 1QC5B 2Q6IA 4CMIA 4NVRA 5C8DA 2CDRA 2PFKA 3ZY4A 2ACVA 2PZMA 4EPRA 5F7XA 2IGTA 3LLSA 3GQCA 3TUZC 3PHLA 4IY1A 4Y2YA 3CF4A 5JJKA 5BMVB 2O2GA 4GF5A 1D8AA 1V35A 5G1PA 5H82A 4NHOA 4Z6KA 1ZISA 3ND9A 4B3SB 4CF7A 3EGDA 2YMMA 4IJKA 1UOEA 3ZDBA 1HDZA 1Y5MA 3CR3C 3KNZA 3NH9A 1IQUA 2AG6A 3GC6A 5BV8A 1EHYA 1Z0ZA 3HJCA 4PLHA 2F3UA 3NR2A 4OYRA 1Q0UA 2O5RA 2PR2A 3E0FA 1JHDA 3MUOA 4ND4A 1RKXA 3GAAA 3O83A 4DAOA 4MARA 2YC4C 5D6NA 4I2BA 1GCOA 3MUFA 3ORRA 5T4FA 2WG1A 3FKSD 3DOUA 3OZAA 3W6NA 3QXGA 1G1AA 2GEJA 3HXTA 2VNKA 1NW8A 2HJHA 3IP8A 4PTYA 5BOSA 3K6SB 2CHEA 4EL0A 2FNAA 1DAIA 2X1VA 3B6KA 2Q6KA 4V3BA 5KWIA 4UBJA 3G5AA 2FE1A 1TNDA 1STOA 3BZWA 3N2NA 4OUDB 1NJ5A 2BPFA 1A8PA 2QTHA 3AJ8A 2C7PA 4IGEA 3RG8A 4ED2A 5ABPA 1AMOA 1A1SA 1RLTA 2GZMA 2CK3D 1J9ZA 2R6ZA 2V6IA 4QZHA 1II8B 2P7IA 4U7PB 3UWDA 1OJ7A 3GPIA 1X1CA 3RTAA 2PGLA 4MOWA 3TZHA 4TSRA 1V8ZA 2HLDD 2ZSFA 4NS1A 3ZCXA 3GLGA 4CUZA 3LO5A 4F4DA 1ZU4A 2A5DA 3KR0A 3Q9LA 3DLAA 3SIWA 1SY7A 2BD0A 2J3MA 3CRRA 4LXUA 4J16C 4MLPA 5KJCA 2OXCA 3AVVA 1C3OB 1JFLA 1WUKS 5CRIA 2KOBA 5JEDA 4LE1A 3LI2A 4F5DA 2BI8A 2IHZA 4Z6DA 3FWZA 4TTVA 5DHAA 5E2AA 2XVYA 5JYBA 4DR2B 1XKXA 3L7LA 4KL8S 2QSYA 3TF5A 2Z5FA 4TTRA 1AZTA 1KI4A 4RPYA 4MCHA 3WRXA 2QLBA 1L3CA 1IIRA 1WXFA 1DBQA 4NV0A 1H38A 5JJCA 5M04A 4QZGA 1FDRA 2ZBVA 4BPRA 3FTQA 4CYMA 3BZUA 3JAWB 1XLTC 3DKKA 2FSSA 3WP0A 1V43A 4MI1A 4MVJM 4DFMA 1K6XA 1V3QE 1YQQA 4HQ0A 3CYMA 1KKLA 2HRBA 2OFOA 3VNBA 4HDMB 4IIJB 4G4SO 1POXA 2PRSA 1S96A 3A9CA 3LM8A 4C01A 2ID4A 4XCQA 1ZITA 3KRTA 3OAAD 5FTMA 2F8SA 1B23P 4RDHA 4NLCA 2YFYA 3THWA 3UMFA 4AG5A 2ZIXA 2CYCA 1GU7A 1JSLA 3E70C 3RS7A 3LKDA 5ALHA 1BWQA 3T5KA 5DBGA 1LX6A 2FLNA 2A30A 3BB3A 4J0IA 5BW8A 1EVYA 3B12A 1O1YA 1TCAA 4D02A 2JEIA 2WWIA 3A4NA 2G4CA 2B9VA 1ZM4A 1DWOA 1SUEA 1XKLA 4HFMA 4IDQA 3ZGXA 1P77A 5KFUA 2BMFA 4BO5A 3PC8A 4ZI7A 1WU7A 1UJNA 1A72A 1I4TD 1Z38A 1EJBA 1ES9A 4TUQA 1U81A 4GC9A 1W85B 4MS3B 1B0PA 4LZLA 4OLHA 5U4QA 3VU9B 2PH1A 1NULA 4B4UA 2PT5A 2WOJA 4DYHA 3KLOA 4EB3A 1AMNA 1RMYA 1W5SA 2PA3A 4GZ6A 5HZKA 3CN7A 4HDCA 5GM2A 1ZNQO 1I1OA 5FHRA 1N2OA 1FFVA 3VQTA 3WIEA 4UEJA 1G63A 4QT4A 3TZ6A 4HLUA 4FJ0A 1CUKA 1ZMBA 5CVVA 5IHXA 4ODIA 4HXEB 2IYOA 3QENA 3WLRA 2RGCA 2CWDA 4XOIA 4TGLA 4EY5A 5KJFA 1XTQA 3BUSA 4NJ8A 4HR7A 4W5HA 1LKYB 1RP7A 1YASA 2X2PA 4RHTA 4CQMB 1W2HA 1SKWA 2ZB4A 3IKVA 1BVHA 4JGGA 1MBZA 1EDBA 7ICFA 1WUTA 1WVIA 1WTCA 1G4UR 3UAZA 4XRHA 4QDJA 1GKLA 1PR4A 2VHJA 2AEFA 3GW8A 3VNSA 1WMFA 1X7HA 2G40A 4E2FA 2GAIA 3WL7A 1K1SA 1JKJB 4V0SA 4GQIA 4BB0A 1RRVA 5AW0A 2DJ5A 2IDMA 4ENVA 5CXQA 2ZT5A 1FFDA 1EXDA 1AOXA 3CIFA 4KFTA 2O7VA 4ZOHC 2PGAA 4EFDA 5EMKA 5KT4A 1FBNA 1Z7GA 1Z83A 2WD8A 1KSHA 5EHQA 3EDCA 5EA2A 2Y4OA 2OGSA 3S5JA 1QO0A 3QTBA 3BMXA 4NM2A 3KD3A 2XEXA 2QP9X 3BWXA 3FPBA 1WZNA 1JGTA 2KB0A 3JYQA 5HBRA 2K7FA 2Y1CA 3WB9A 3BCSA 4YQYA 3W5HA 3K4PA 4MWOA 3AIMA 2PLAA 1Z33A 2R6AA 3E7XA 3MMNA 2B1IA 3SJCA 3EPJA 3I01M 4JLBA 4KQGA 1SMKA 1X87A 2AW5A 4AT1A 1YKGA 2FEKA 4BV8A 2OBBA 2WRZA 1HTWA 5IDXA 1U6KA 5EJIA 4PG4A 2RP5A 4CEHB 3FPCA 4DLPA 5JFOA 1N75A 5BSRA 3ZWBA 5KSWB 4LVSA 2JEJA 1CIVA 4GKKB 1UC5B 4TMZA 4CU2A 1GNTA 5CDFE 1Y1RA 3CPSA 3R5SA 4B8WA 2BEJA 2A9OA 2OM2A 4WV3A 4UTZA 1SVSA 2B3DA 3PYXA 3EPRA 3T3GA 4I14A 3F8TA 1ZRNA 1SL0A 3RBVA 1JG2A 1JWBB 2A78A 1J2MA 1GQYA 5LDGA 4L22A 4Z3KA 1L7PA 2ERCA 3PNPA 3TTXA 2XWBF 1ZQNA 5BQ5A 5F52A 3HVJA 2FJ6A 5TQVA 2F8KA 4C3ZA 3QV1A 4V2UA 5B30A 2JK1A 1B0AA 1L0BA 3DYBA 4OJLA 4KITB 1DVRA 2CL6X 3T0GA 4QWCA 3PUHA 4UMFA 1LUAA 4A3SA 4C05A 5KFIA 4YASA 4BWJA 3OHAA 2I3GA 1C30A 3F8WA 1D7OA 3FLAA 4IDOA 3OBBA 8ADHA 4EMUA 4DL7A 3UAGA 3OE7D 3D5TA 4KDEA 4O3PA 1JHPA 1TD9A 1NBIA 3CSUA 4POAA 2QUJA 3AHHA 2BC9A 1GOTA 1M2VB 2H1CA 1H4TA 5JUMA 3GEHA 4NU6A 5EEHA 5IJ9A 3IPRA 4LSWA 1JAHA 2XIQA 2JGFA 1D1SA 4Z4FA 4KMOB 1EPUA 4OTZA 2Y9MB 1X74A 2QRKA 4K7JA 4U7GA 5CT6A 3HJEA 1E2GA 2PWAA 1Z3CA 3N2LA 4XA5A 4MX8A 5AKEA 5L51A 1LNZA 1CB0A 4LNHA 1BJRE 1UFRA 2YFKA 1GGNA 3EXHA 1ZMRA 3VKFA 2E6UX 3L7AA 4JUDX 1SV0A 4OK5A 1GZVA 5J2TA 5J0QA 1EK0A 5JCPA 3HCPA 4O5EA 2J4FA 4Q93A 3S2YA 4XE5A 3AT1A 3ND6A 1V4VA 4PR0A 4QNRA 4MWTA 3RIYA 2DRIA 1Z34A 2OG1A 4US0R 3VNUA 5L53A 2FN7A 1IN5A 2BN4A 2R1ZA 2XB9A 3RAPR 4Z51A 4IEFB 1DG9A 4K2HA 4FR5A 1FMFA 3KYDA 5DKFA 3CX8A 5HE9A 8OHMA 1ID8A 3R8FA 2CD7A 2ZI9A 1SH7A 3OBIA 5CB4A 1XE3A 4ZK6A 4M9LA 4O3FA 1WZUA 4B81A 1N3YA 4EWLA 3K05A 4H3HB 1PNQA 3MYRA 4LX8A 4NECA 1UK9A 4XSVA 4YUAA 2Y1FA 1NAIA 4GYKA 4JJZA 2HHTA 1PP4A 1ND5A 2SKEA 4Q6BA 5P21A 2XVXA 2OG2A 1FP4B 1CIPA 1TM4E 1I5RA 1TYAE 3M4ZA 3PEVA 3H2YA 4W5RA 2BM1A 5FR2A 1WHSB 4QBKA 5DXAA 1RQ7A 5LZ2A 4MQFA 4X6YA 1QTMA 4UBNA 1WZ2A 4UU7A 2A6PA 5E7IA 3DEAA 1P9OA 3DEHA 1U7WA 3IDAA 4HMOA 1NWCA 2VCHA 4LRSB 2OK7A 3HWTA 3ENNA 1CI4A 4I8DA 3DDZX 1NW6A 4CNBA 2D13A 3NQ41 4C3UA 4H1WA 2Z9DA 2ESEA 3T54A 4PZOA 1GZ4A 2ZBRA 3Q0IA 1IWOA 2AT1A 2OL4A 4CKCB 1WULS 5AXAA 5EXXA 4Z7JA 1HQYE 2XCRB 1M74A 1ZA2A 3U0VA 4D97A 4E1BA 4O5KA 3WLPA 1UPXA 1NUSA 4K0RA 3N2EA 3NHAA 4Q24A 2GETA 3RJ9A 3C7DB 5U4XA 1P8AA 1H5QA 1LB2B 4OPMA 5B7QA 3K70B 4N49A 1YONA 4PY2A 4Q37A 1ZIXA 2R4TA 3V6HA 4KU4A 4Z4EA 5A0LA 2ZJ8A 2JFWA 3P8ZA 1ZH8A 1HO3A 1CEYA 2RJOA 4DDWA 3UHOA 3V33A 4KV9A 3MEQA 4YXWD 3VHXB 4GOND 3PHIA 4EY7A 4KV7A 2KIWA 3RSCA 3C16C 3EVZA 4YO8A 2EFDB 4MVJG 1VA5A 3PQDA 2C7BA 3DUFB 4DADA 1R15A 2JFZA 4ZN6A 2X14A 1J1ZA 4JUZA 2EZ9A 3INTA 3O5AA 3FM9A 1OV6A 1I0IA 2P9HA 3GA7A 4XB2A 3UYKA 4KB5A 2FKAA 3WICA 1DTSA 1DO8A 3MG9A 5L4NA 1UINA 4MRVA 4NENA 4BGVA 2WWYA 2G9UA 3ZLUA 4M9JA 5EQJB 1ORIA 1BO6A 2X8JA 1JEQB 1UCFA 2ZRJA 3LRTA 5KTKA 1KKXA 1OPRA 1H2XA 1KJ9A 3DOEA 4X66B 3LC1O 2QT1A 1OWPA 1HYQA 3GOQA 5HF6A 3PUVA 1B8OA 5GZ3A 5F5NA 4GVLA 1S1CA 2OP1A 4FDAA 2I29A 5KWVA 2DU8A 3I4LA 3NAZA 4D46A 2FEAA 2NV3A 1YRBA 5TS3A 1DOZA 4X20A 1IB0A 3CZ9A 3GILA 3SYTA 2AHOB 4G56A 1ISFA 1DXQA 1DCKA 3IJEB 1ITZA 5CVUA 3G0GA 1UBUS 1FPMA 1SEPA 1U2ZA 3ST7A 3D8UA 2CVOA 3P4UA 4TYMA 5L6LB 3QHQA 1KFKB 1IIBA 4G1CA 4CU5A 5B36A 1VLZA 5J2IA 2ATEA 4ED3A 4PF1A 3U62A 3UJ6A 2XADA 2HUPA 3KR1A 3M2PA 3O1HB 1UDBA 2IF0A 3KCNA 1KK1A 3LHDA 1RWPA 4P3OA 1XYYA 5L3QB 3HB0A 2CLKB 1V47A 3FUTA 5KG3A 4XX0B 1A2KC 4NLKA 1GZ5A 4F92B 5GZ6A 4WBXC 3K0EA 1HDXA 4QPZA 4D8WA 2BMEA 2WTMA 3IQZA 1M83A 1GGMA 3D3QA 5CBPB 4OREX 1KYZA 1SC9A 1Y1PA 2M1XA 2DFNA 4PRYA 4UEOA 4UVHA 4WNAB 1B6GA 4Y1RB 3JYNA 3EASA 5DYGA 5EXEA 3W8EA 3H1GA 3HR7A 2PJDA 1Y4ZA 4FS8A 4O59O 1F4PA 1T8PA 1KZHA 3B9JA 5JZVA 3HBLA 5EZ6B 3CEHA 2WYVA 3JY6A 1W0JD 2ZIUB 4M3NA 1KAGA 4L76A 10MHA 3WKEA 1ZUIA 4GDFA 1BQ3A 4E94A 4R0VA 1Y7IA 2VP5A 2X7HA 4EGAA 1E61A 2VK4A 3VH2A 4XB1A 1P0MA 3TRFA 1FL9A 1K6JA 1EYZA 2P78A 4KLHA 5TQ2A 4R2KA 1EH5A 2I5PO 2MYUA 3O95A 4UFOA 2TYSB 1SN7A 3PDWA 1GRQA 3DLTA 4L0DA 5AUOB 2FEXA 2CDNA 3K2IA 5HS6A 5HFJA 4EFLA 3AG5A 1PT6A 2N46A 3F49S 1OVMA 1D2RA 5AXCA 5ALXA 1JR4A 1DHRA 2OBLA 4OEHA 3VJRA 1D6MA 1Y8RA 1PEDA 3WYEA 1Y3IA 4OGFA 4OQQA 2AXQA 4RK0A 1RQ2A 4I8IA 1H2HA 1Z6ZA 1XD2B 1PTJA 3L7NA 1R0YA 2IYEA 2P65A 1ZQVA 1A0PA 2JGRA 1NVXQ 2BFFA 2GWRA 2BDTA 2BFPA 3ETDA 3IP6A 3MW8A 5E7MA 4AECA 2EP7A 2XGGA 4IXNA 2TMYA 4BQSA 4BP8A 2DUNA 4AUEA 2R8YA 3O73A 4MAMA 1N4AA 2OMKA 1SC4A 1O8BA 1P5RA 2Q29A 3O8QB 2FUNB 2N1MA 4RPZA 1KDZA 3ZHZA 2VUHB 2CLLB 4TVOA 1CZKA 1OXBB 1WMEA 3WOHA 1EDOA 3NBAA 3FTPA 1G9TA 4BE4A 2Q3CA 4FDVA 2NNWB 4HGYA 4HI0E 4J0EA 4WXRA 5I9IA 1GRVA 3KOMA 3A1VA 1HOXA 3EDYA 5CLLA 5LMCA 5YASA 1OTHA 1YZFA 3QX8A 5IMSA 3UAOA 1SVIA 4MW1A 3VUFA 1IQ0A 3OU6A 3MTGA 3BSYA 4OHPA 2ZWOA 2C3MA 2G88A 4J7UA 2HOQA 4HDSB 2VUUA 4FQ7A 1TB4A 1K8QA 1E9FA 1PZFA 1I51A 2PWYA 1T3QA 1RAHA 3HJTA 3QUCA 1A9PA 1OQAA 4WKCA 4IRDA 1JIJA 2X13A 2QB0A 1JR3A 1JS1X 2XE7A 3U6BA 3TVTA 3HJUA 2R1TB 1J0EA 1CJKC 2B30A 1TU0A 4ZI7F 5DLPA 2R8OA 3KJQA 3V8RA 1IBLB 1AD2A 4AKTA 2QM0A 2YVUA 3I2FA 2ZUBA 2Q1UA 4N5LA 4AZ0A 1JQJC 3RAFC 1B42A 4Q9JA 3L49A 5LZ7A 5CP2A 1NONA 4DV2B 4L4UA 4CFSA 1Q21A 5DLGA 1Z5GA 3ISTA 2G5HB 2FQXA 3S27A 4HFNA 3IEIA 5BURA 1JROA 5KTOA 4B3RB 4RXTA 2NZUG 5KG0A 4L02A 3SKVA 5K0SA 3S44A 5KFNA 1U8UA 3G6VA 3FZNA 1T3HA 2OHXA 3AJAA 1RWQA 3W3AA 4FIZA 4MPTA 1ORDA 4ND8A 1JQBA 3B7GA 1Q16A 4FX5A 2WG2A 3RFTA 4ZJZA 1SCDA 3R3SA 4Q21A 3TQOA 3ZCVA 2QY6A 2OO3A 4O63O 2QAGB 5GAJA 1JWAB 3W5JA 5EOVA 5JOQA 5AM4A 3B2QA 2MYPA 3GT0A 3LCUA 2RHBA 2V7GA 3DD5A 4C22A 1WR8A 4DKXA 5H7XA 4Q3DA 3GT3A 4RY0A 4J0CA 4BAZA 4C1BA 2VZEA 4J1NA 3VFDA 1IUNA 4UMEA 1U48A 1C7ZA 3U4GA 1NVEA 5AUQA 4IG9A 4X94A 2P75A 1PQ4A 2QUAA 5AVVA 1M1NA 2OE2A 4B2IA 4DL3A 1PBTA 3A25A 4E07A 3M1LA 2JI7A 4IVNA 4ZREA 1RFLA 2WQ7A 1RXVA 3GV0A 2K8CB 1XVAA 3OO0A 2JH3A 4C7BA 2QQEA 1QCYA 1XDGA 4RMNA 4XFDA 4YXFA 4D0RA 1GP2A 1NLZA 4E70A 9ICFA 2FFRA 4P58A 4NWIA 4O4JA 3RC2A 3PEYA 4KXQA 4OJPA 1ZMOA 4PRLA 3V97A 4YCMA 3VDMA 2J8ZA 4XJTA 2E4WA 5LCXA 5TARA 4EHFA 2A4MA 3BDPA 1M6HA 2KSQA 2QTWB 1FPQA 2JFBA 5BSEA 3AFMA 3PX3A 1Y5LA 5EPOA 1XN1A 4Z6CA 3TOVA 3OP4A 2GSDA 4MUKA 3O7MA 9GPBA 1XYGA 4PLPA 1KAOA 4MKIA 3WRWA 4P7BA 4UPDA 2O19A 2Q46A 3R0IA 3CUTA 1DFIA 2JNWA 4IVQA 5A0VA 4EKEA 4QFMA 4TLCA 1H3EA 5CJ2A 5LN1A 1FUEA 3V00A 4PZCA 1E69A 4UNIA 3QEOA 4FFMA 2IC5A 3F74A 4KNWA 3EG9B 1YQEA 4EUHA 3IERA 2PGJA 2XOKA 2JHPA 2YHUA 3C7AA 3ZXIA 1ZBDA 3O4RA 1CYEA 1X6JA 3E61A 4LXQA 1RZ3A 4PN3A 1K7EB 3U0BA 4AZ0B 1OYOA 3JQ6A 2PTHA 3C74A 2K4EA 4CDRA 1FFAA 4OJTA 4D56A 3ZX4A 2A8YA 3DZJA 3TXXA 2A9QA 2FK8A 2VO1A 4N7JA 2KSOB 1PFWA 2QB0B 3DMRA 4RO0A 5FHQA 1GL6A 4RVOA 4C6SA 1HQDA 4A0GA 3OFVA 1PK9A 1XELA 2O7NA 2VFAA 1GFZA 2CPRA 3KKPA 4GM4A 3F7MA 4B33A 5FUMA 1Q0HA 1FZTA 4MR9A 1V25A 2XXBA 4Z1MD 4M8IA 1COZA 1IPHA 2GYVA 1GPAA 2FMKA 1RSZA 1BOFA 2F3QA 1PR1A 9ICHA 2FLWA 2WJ4A 2B0CA 5ALOA 4ZEWA 2R86A 5KOYA 4HLDA 4PXYA 3S28A 1FFYA 5J0YA 1IM2A 1E9BA 4RVFA 2HDOA 1Q95A 3UB4A 5BSGA 3AETA 1EK6A 3WGQA 1U2TA 2AG5A 2D0IA 3C8ZA 4KRYA 1YS4A 2XNDA 1JPNA 1CZOA 1SVUA 3V1NA 3IIEA 3ELYA 4G8DA 2KZ3A 3A6LA 1DKLA 1NNEA 2OECA 1GDTA 5J58A 1CERA 5ALRA 1GFIA 4PZYA 1HT3A 3NVDA 4FMBB 4WCDA 4EA7A 2OORC 4ZYLA 1KL7A 4PH5A 4B3XA 3VVCA 2H3QA 1SKAA 4KFUA 4PGHA 5FUQA 1USVA 1WM1A 2BFFB 2KD1A 3HKEB 2XO7A 2NLOA 1ZQMA 1XCGB 1W0KD 3FA2A 5KG4A 2JFFA 1N61A 1WMDA 2QYOA 2WTEA 4TTTS 4O9MA 2XWQA 3IBCA 2WM2A 4G86A 4D8VA 5DJ5A 2IHUA 1T9BA 1MT3A 1QCCA 2IEAA 3AVQA 2WZQA 2IXEA 1P2UA 4ER5A 3AI7A 5CRXA 4URXR 5HRUA 5CA1F 4DPKA 1KEKA 1NJXA 4C6TB 1V96A 4CODB 5GM1A 2WMNB 2ZYGA 4MO9A 4J7CA 4Y0VA 5BRNA 2C29D 1PNOA 3WK4A 1XOIA 1ZSVA 1ULHA 2ZPUA 3EQ2A 3T41A 2WV7A 3QIAA 5TDHA 5J4LA 3KXPA 4I50B 3NHYA 1EWYA 2XVZA 1KZ7B 2HTEA 2RK3A 4QPCA 4XQ0A 3RODA 2E18A 1L3IA 3FMFA 5AIAA 4YMTA 5AESA 4K6FA 3RVKA 4DV7B 2VOJA 2V7BA 5K01A 3VC8A 1SCQA 4IMPA 4QTZA 4DWWA 9ICBA 2XMDA 1CQJB 2HZBA 1ZUD1 2J85A 4NZYA 4EGCB 5AUPB 4PLWA 4QDKA 2RDJA 5JARA 3M33A 2ERXA 3ZY2A 2V4QA 1B6TA 1BZYA 1KYXA 4Y1RA 4C04A 4NMMA 4EG3A 1P80A 1CUJA 4YR2A 2QM8A 4FB5A 4C3OB 2PKQO 1TKBA 1B8UA 3QVVA 3QVJA 3J81j 2MAXA 3M0EA 5FNZA 1KRWA 1XCBA 1NMSA 3S2ZA 3CO0S 2BCJQ 4CXMA 3H40A 2HV9A 1I9GA 5K6AA 4Q4AB 1PV1A 4YMNA 2HIGA 3WGZA 4CI0B 1E5TA 1T24A 4BZZA 2Q7OE 4XFKA 2P6OA 3UHFA 5HS4A 4P7GA 4C5CA 2UYCA 4MW9A 4RQBA 4F7WA 3AINA 1TQ6A 3H9UA 4HADA 1A7UA 3VNAA 1DIAA 1QGUB 2W6ZA 4MW6A 4PLFA 3LQ1A 1Y8CA 2O2DA 2UYYA 3G0CA 3A3KA 3ESDA 1H2EA 4IFEA 3TIGA 1PV4A 2KJQA 3S6JA 3H6GA 5I9BA 1SUWA 1ZXXA 3QE2A 2AOTA 1D7AA 3BWYA 4R01A 3SDZA 4FE3A 5TEWA 4IX1A 3D4OA 3TMAA 4OXXA 3V7JA 3HMQA 5F76A 1KEUA 1OH6A 3GB9A 3QOXA 2C04A 3E1SA 2ORED 1CS0B 3S4YA 3ULKA 1S89A 1WKBA 4KRGA 4YR9A 2WKSA 3TLMA 3OE7A 1DX4A 3M8SA 3IJPA 4OHWA 2CLSA 1JEQA 4Q9IA 3VBEA 5I7EA 3GPBA 1HFEL 2ODBA 1T10A 4YJ3A 1CS4C 4LZNA 4ZMBA 1M2OA 1K5DA 4CR7A 5BR8B 4C06A 2QS9A 1RHUA 2A2ZA 4ARZB 4KLTA 1QUEA 3CLTD 3Q15C 5EWMB 1BPDA 3PJFA 2B1GA 1X2IA 4TMTA 5G40A 5I47A 1NRJB 1PVDA 3A9RA 3V6MA 4JBGA 4L28A 1PO7A 4X8HA 4BMZA 2FZKA 2F7SA 2JFGA 2VDWB 5HSGA 3E2PA 1VOTA 1XLUA 4BVKA 1IUKA 2YNMC 3C4QA 3DTTA 4MUBA 1KRHA 3R77A 1Y4DE 3MTIA 3EPLA 4F86A 2XAAA 1MA0A 4O4LA 4YG2A 5GOZA 2WWVD 5CT8A 2WIGA 1NDUA 2IPOA 2JAHA 4PGQA 4U7TB 5FFNA 3W2TA 3VNVA 1ZXLA 4HNAA 1UPHA 1JFFA 2OCKA 2WA1A 3U7RA 4INAA 3T4EA 2GERA 2ZUTA 2ZUCA 1RYSA 3Q5DA 4C0JA 1G6Q1 5D1HA 3F53A 1RYHA 2VJMB 2I71A 3GUCA 1UZUA 1C1DB 3Q5GA 2M2IA 1MU0A 1J2JA 3AHIA 3GFTA 4IEIA 4AO6A 4HUJA 1M34B 3AQIA 1TUBB 5TY0A 4CUKA 1R3DA 5CVTA 1UM9B 3NAGA 3CEJA 2NVUB 4HZUB 1RVDA 3C3YA 3C14C 2IJGX 3KC2A 3O47A 4FHCA 2H5XA 5EWJA 5CA0B 4IXMA 1I7SB 3CLSD 1XHLA 2ZCUA 2FR1A 3GRYA 1IXSB 3P94A 2I2AA 3BH0A 1QZXA 1FMCA 1IUPA 1BHJA 1J42A 5SYAA 1T0BA 4P83A 2R9VA 4IFIA 5EWGA 5AKJA 1N2SA 5ESWA 4X7MA 4E30A 4YT4A 2VG8A 5EEGA 1QMPA 2C5AA 2HSDA 5I4CA 1Q0LA 2OVBA 5JZOA 4RQ6A 3RIEA 5F1OA 1S0VA 3EFEA 4EJ2A 1MG5A 3T1OA 2REQA 5ALDA 4ZPXA 3RI3A 4D6PA 3B0YA 5AKZA 5DN6D 5HMMA 2JJ2D 2ZM6B 3Q3CA 4BQNA 2ZWMA 1YQTA 2GCOA 4MROA 4DC9A 5LM3A 5F3XB 1B6SA 2PUEA 1XP8A 3T5GA 1O95C 1MV8A 3WQSB 1FSPA 3ANLA 4PC7A 2HRRA 4UBOA 3FZGA 4HUQA 3LP6A 5FI1B 5C7LO 2B92A 3EPIA 3BCHA 3GUHA 1F9AA 3WK5A 1TMYA 2QQ5A 3H1BA 2KG5A 4GUDA 3TNDA 2OPBA 1DRVA 4FWBA 4CMAA 3LYUA 1W0CA 2VF2A 1JRLA 3LUGA 3SBEA 3KYDB 4U2KA 4UUPA 5EI5A 3QJ5A 3KVVA 2G28A 1DWQA 5ESRA 2AVNA 5THKA 4RFSB 5MFZA 1F12A 3L8ZA 1SUCA 4FR0A 1Y80A 4DQIA 1UIRA 1IOLA 2F17A 2JGJA 5KFJA 1NMYA 2C2DA 1G5TA 2HBLA 1DAKA 2BF4A 3C3PA 4YXWA 3QP9A 4UOQA 1GPDG 3HO6A 3RVDA 4EPXA 5C8YA 3IDWA 4TURA 1EWKA 2W8KA 1U8YA 2A7XA 5D3QA 1LI4A 1MJFA 1OUMA 5B4TA 4G85A 4KP7A 4YRFA 3BTUA 5JNTA 1X7ZB 1TZCA 2QTRA 3BS7A 2L42A 4XSHA 3SEZA 1J7KA 2XGPA 3LCCA 2XCAA 5G3YA 3U9LA 4C4YA 4EQ6A 1XZKA 5L3RA 5D4BA 1OMOA 3SJZA 3THSA 5JCXA 1CUAA 1SHZA 1X1BA 2AXTU 1IXRC 2J6IA 3GNLA 1Q6YA 3WIOA 1DEKA 3R0VA 2HI0A 1GGVA 3SG0A 1EXMA 4YRQA 5JH7A 2W8ZA 5TLSA 1ZFNA 3KWLA 1P2DA 5EMHA 5F1PA 2CLCX 4U5XA 1I1HA 1XWIA 4Z9XA 4JROA 3RSGA 2HC9A 4M86A 4HAVA 5ECGC 3EF3A 5LOVB 3IH5A 3LK9A 3UPDA 1JKXA 4F97A 4H7DA 5BN3B 2O8CA 2ZXHA 1W75A 3GRCA 4IDAA 2VRCD 2X9VA 4ROTA 3D64A 3VSCA 2WWHA 3DZBA 4D3XA 4DVGA 2J5XA 3WKDA 2P0AA 3Q8XB 4XRRA 5CTJA 5M3BA 3ZGYA 4AN0A 5JAMA 1QRUA 1NVBA 3FIUA 3QU2A 4JKYA 3FF4A 5GJVC 1C0LA 3ZWVA 5H3LA 2ZUEA 4MUYA 4KBYA 2NO6A 4IKOA 4MRNA 3ADBA 3DONA 3TW4A 1J21A 1MKYA 2HJRA 3DBRB 5IKOA 1MLDA 5KC9A 1KVSA 1R8YA 1FLDA 2F55A 1UT5A 1DX9A 3ABIA 2J45A 3HR4A 3WZLA 2R8PA 4PLCA 5CB4F 3AEUB 4GC5A 1XSEA 3ADOA 1LPOA 2NW6A 2VF5X 3LWMA 1GPJA 2E4UA 3AEQB 5D86A 3ZWQA 4CM8A 4QECA 1WL8A 3B6ZA 4K9MA 3CMMA 1THGA 4LCJA 4QO8A 1T5IA 1V5EA 3D2SA 1ISRA 4G1FA 2HDWA 2O1XA 5F5XA 4F72A 1U3TA 3CKLA 3MXTA 4X41A 1ZIDA 5GV8A 3DTYA 1B3RA 1E2DA 3S29A 2W00A 4P93A 4CIWA 3OLZA 2HBKA 1ABFA 3DH0A 1YHYA 2O0MA 4GXNA 2RC5A 3ZXSA 5TMEA 2PUCA 3KJEA 2KJ8A 1Y34E 4REMA 4LC1A 3O9MA 5DBCA 2OYCA 3VA7A 5HUQA 3U61B 2DL0A 3ZCUA 4JT8A 1OHHD 2FUG1 3E22B 1H23A 5JCOA 3SF8A 3TBHA 2RAUA 1HDYA 3FDJA 1H9AA 2P5TB 1P1CA 3CM0A 4OHZA 5E1OA 2X40A 3R9XA 2DQNB 3HNPA 4ROSA 1V7CA 2Z4RA 1LKYA 2IX9A 5EZ5A 3W9UA 4BZPA 2GI4A 1E0DA 1YIOA 4UE3S 3ZW8A 4JWTA 1K6EA 4J1TC 2R11A 1KDVA 5MN4A 3HP6A 2ZUSA 1CQIA 1QVVA 4QD3A 1TD1A 4GVPA 4RM3A 5DNYB 4JXXA 3GRRA 3AYXB 4IQ8A 2HA6A 5TS2A 4BZQA 2WAAA 3QFCA 4NEQA 8ICFA 1BN7A 1B26A 1XD9A 4I50F 5CNIA 2YYAA 4GYJA 5JLAA 5K3DA 5JASA 5DW3A 3AKZA 2ECPA 3VDRA 3AEUA 3PX6A 1IG6A 4OB6A 4P08A 1T8TA 3PVXA 2ESRA 3UC5A 4F7DA 1W85A 3VU9A 4UNNA 2HBJA 2H07A 2UXDB 4FPXA 4P5EA 4EPYA 4NOLA 2LM1A 5J2FA 1EUZA 2HCRA 4OXIA 3H16A 3ZDYB 5IWCA 1Z4LA 1CJTC 2EBWA 2QRGA 1ISHA 4MQEA 3F8SA 3LS2A 7ICSA 3S70A 2IEGA 1OLUB 5CA7A 3F9CA 2AMJA 3HVIA 4K6KA 3W06A 1E99A 5JVDF 1NT2A 3BL6A 4IKEA 4WH0A 3MRXA 4M0FA 4QJIA 3VPGA 4GPZA 3OIGA 1ZD3A 4OQXA 2EANA 3K15A 3EXIB 4YPFA 3RANA 3EW7A 5FPKA 4E5MA 5JQGF 1HT0A 2PSJA 1TYCA 4OXKA 4ZTBA 3OKAA 5AI4A 1N2ZA 3SC6A 3UUEA 1N2BA 3OSPA 2M6RA 2WA2A 3PXCX 5LOVA 1N2GA 1O89A 3K09A 3KYJB 4BMDA 1R18A 1VYUA 3I8XA 4KTQA 3RYHB 4ZK2A 5FAKA 1GUBA 3CUEF 4TWBA 2G83A 4BEBA 4JSRA 5J3JA 3DR3A 3Q7TA 4OHUA 3EF1A 1CZLA 1OROA 1WCIB 3DE7X 1CDDA 3HB5X 1E2NA 4XEHA 1DADA 1WF6A 3AFOA 3B8EA 1GG8A 2W5UA 2VH5R 2HKIA 1CRQA 4KEAA 4O1MA 2BCVA 2GHIA 2EVWX 2EATA 3BS5A 2XB6A 3JQ7A 2D5IA 1UH5A 5ALUA 2Z4TA 1MIOB 3IEXA 1I4EB 1J2EA 4MW4A 4DLXA 2WSBA 3OTHA 4OJMX 4MMXB 1NBEA 2IW3A 3BJYA 2KJ5A 1NSFA 3H9QA 1CJMA 4PO3X 1V8BA 3N3BC 4UE2A 1YFKA 3KZKA 1NV9A 3T3NA 1MUUA 4F2SA 3JQFC 3TR5A 3ISCA 1E58A 4MUAA 1RZTA 1GGKA 1K9SA 1P1KA 2WSIA 3ESBA 3ESXA 3EZYA 4YAFA 4UFPA 3GLGB 3FFTA 1NHWA 2ZCVA 3EK2A 3KZ1E 4EW3A 1NBOA 3K1ZA 3L82B 3LLCA 1VMKA 1NLFA 4N0MA 3H17A 3TPFA 4PC2A 4WCVA 1IN8A 2QMZA 1QHFA 3WMRA 1FQKA 2EAMA 1DEAA 3DUWA 3MJSA 2PSEA 5AH0A 2O2IA 4TUYA 4C78A 5CITA 1QTRA 3CNHA 2WJJA 1J56A 1ODTC 4HUQB 4RSMA 3K6SA 3NVWA 3B70A 1A8UA 1CUZA 3V32A 4CM9D 3D6VA 3MMSA 5IIIA 1TM1E 4AU1A 5ARBA 3S7ZA 3HQ4O 3TJMA 1TO2E 4LF6B 2BHTA 2NUTB 3FYDA 4OLBA 2REQB 3HJFA 3KTAA 1NAHA 3W5SA 5CFOA 3SFZA 3I12A 1PJAA 4IILA 2G25A 5HPYB 2ZTDA 4H1TA 2CJYA 4P3NA 3JZFA 4F3RA 3T3IA 1QG0A 4EBFA 5KNDA 3OIWA 4YMWA 4LY6A 2W8BB 2ATLA 4A0RA 2LKCA 4Y3UA 2PMZC 5JO0A 1WX1A 3AW8A 3GGDA 4OJOA 5CA0A 4B3JA 3UMMA 5WRFA 2NVUA 2GHTA 4LGCA 5CW1A 5JNLA 4EYIB 4MVJF 4KPFC 2Z2ZA 2OB2A 4GG1A 4AMGA 1IM8A 1RQGA 2J5RA 3LBAA 2G6BA 2VBIA 1CNEA 3DEFA 1U7DA 3HLKA 2GK3A 1CRWG 1W49A 2HU2A 2Y1LA 3CLHA 3PGLA 4M98A 8ICLA 4BJ3A 3PNLA 1F6DA 1P4HA 2QORA 4PSVA 1XQ1A 4ND6A 1B43A 1GTVA 4FDMA 4ZTZB 4NICA 2IZZA 4KJXA 1BVYF 4IJVA 1R0XA 3EUB2 3TKLA 5KDLA 5KX5F 4FW8A 4V0KA 3NBXX 3ZU6A 2A5JA 2PD6A 5B1SA 4EYGA 1CNMA 5A7FA 2Z8YA 1RFGE 3E8SA 3IAM1 3RVRA 4B0OA 4BRWA 4Q4LA 4JMLA 4REQA 1NYQA 3HMKA 4MXDA 3OQPA 2OUKA 2P30A 3FWYA 4MJ7A 3VPAA 5CBKA 4OX9B 4DFPA 1QZUA 3ETRA 2JKZA 5K2MA 2PGIA 2RHJA 2SKDA 1UOQA 1SIWA 3DAFA 4MV4A 4P4LA 4IXWA 1RPAA 4JVOA 3QLVA 5JCJA 4EKGA 1QP7A 2J0VA 5KG5A 1RJDA 2Z1DA 1KOFA 4UW9A 1T8EA 2IKSA 3NCTA 1DIGA 4K5QA 2YN2A 4G4IA 4PC3A 3RRNA 1WP9A 1YDEA 3G0IA 3ZIAD 5G02A 5DM60 1HR0B 4HRVA 3K75D 4LNUB 1GYQA 1D8YA 2BTQA 3QVMA 4M37A 4R7GA 5GQSA 4US2R 3D7RA 4FD3A 1NIPA 2YXEA 4MEYA 2CDCA 3DE5X 1SC3A 2OOKA 2YJGA 1AM4D 2Q9AA 3EIFA 3IJRA 2FZEA 3OFNA 4K0KB 3OQOA 4IHQA 4URUR 3QITA 5CYFA 1ED1A 4WXHA 1UZLA 4E2XA 2OM6A 4D9HA 2FE9A 3ILVA 3BILA 4GPBA 2IV7A 3U16A 1KPIA 2W93A 4ZO4A 4ZVQA 4UVDA 3SHWA 3R6GA 4CM1A 2XCPA 1LBIA 2DQYA 1RYYA 2FP3A 4Q7EA 1LLFA 1OWNA 3SHVA 1UBGA 3U3OA 3N7AA 5BY2A 5AVXA 4W4TA 2P8JA 1IDOA 4LOAA 2EIXA 5DNDA 5G5HA 1TI7A 1YB7A 2XMPA 2ZBPA 4LYEA 5DZSA 3R75A 4A10A 3CX6A 4RVSA 1YBHA 3PQ2A 4R1PA 2GTPA 3R3VA 4Q9LA 3T0IA 4X1KA 1EVQA 1UM8A 3IXMA 1C4XA 1CCWA 4G01B 4C08A 5DQGA 2WT9A 1PK3A 3TIXB 1F3LA 4A6EA 4ENUA 1MJNA 2AQIA 1JQDA 1YC5A 3DQZA 3HKDA 4OYYA 1GTG1 3TH5A 3RHFA 8ICZA 3EVEA 3JQCA 3SXUA 3H5RA 2C2MA 1CHNA 3HGQA 1FRZA 1N33B 1Y6JA 3HA2A 5U1PA 2CSXA 1CEEA 3WB1A 1LS1A 2K8BB 1LF0A 1I2MA 1ZUHA 2ATIA 3H1EA 3PRKE 4I7EA 4LGVA 5DSXA 4B7ZA 2PBRA 1ZQQA 4D9GA 3K0HA 4KX3A 1YR6A 3BZBA 1M7HA 1D2MA 1SULA 1N8TA 1GLNA 4ZQGA 4TROA 1ZOIA 2IYRA 4WLOA 2YX1A 1MQSA 4QOFA 4PV7A 1JHUA 3T9AA 3E2IA 4DFDA 5TC4A 3LC7O 1JDBC 3GCZA 3KE8A 3MCVA 4N12A 3AZPA 4M9RA 4B44A 3ZZMA 1AQ6A 4B6SA 3SZ2A 2J7KA 2BCUA 4Q4JB 5E1DA 3PX2A 1I3LA 4AYTA 3W8RA 2H4WA 2FW7A 1W6UA 1NUUA 3P9QA 5JDIC 4H6XA 4I50A 1SUIA 3FPJA 4C0AC 2FPGB 3DBOB 4GPD1 3NATA 1J4AA 1D2EA 4PAGA 2E1FA 1G0NA 2O0JA 4LECA 4DNOA 2GA9A 1G9XA 5A7HA 8ICRA 3QVGA 4UM9B 5K45A 5HTOA 3EGEA 3RTEA 3ZVLA 4LJAA 2EDAA 1L5YA 1S02A 2FDXA 2ADOA 4TXJA 1BD4A 3WGMA 4D74A 4EI2A 3KHKA 2FR0A 3PD1A 2IV2X 4LYYA 3VZSA 3HVUA 4KSBA 3G59A 4ECVA 2H65A 1H0KA 2I6TA 2ZRBA 5KFTA 3DDWA 3UWKA 2IYUA 5JSFA 1UMBB 5DT2A 3VZBA 1XA0A 2GEUA 2PGOA 4EZIA 1RC0A 1RIFA 4CKBA 2AL7A 3BK7A 2RGBA 3A9SA 2FOIA 4KNYA 4KLGA 2Q0ZX 3ILSA 3VTFA 5AW6A 1YL7A 3EXEA 3QELB 4PSKA 1TYBE 1PJCA 3SOZA 3ZD7A 1VDZA 5J2DA 5DLEA 4BASA 1U5BA 5L8VA 3AERA 4EYEA 2OFXA 2CEKA 2C2KA 6AT1A 2V9PA 2VUTA 2Y0CA 4I2HA 4U7JA 2EG9A 3IMKA 4ZZ1A 2VDJA 1KE2A 5JMOA 1UWLA 1N7GA 4R2MA 3HEBA 1MJ5A 4I4TB 3DHYA 1EZ1A 4M9UA 3QY9A 3X1MA 1KQ3A 2XX3A 4XIJA 1ZNYA 4F0JA 1EP1B 2J0UB 1IPEA 3BCRA 4J3JA 4C3VA 4CLRA 2UUAB 4C8KA 3CW2C 4OO1J 1RKUA 2D2IA 3E82A 4KQ6A 1ISPA 2DE0X 4HFJA 3GGSA 5AVRA 2AD1A 3LUFA 1NC1A 4IJQA 1YB4A 1Q0RA 4OB8A 1ZOPA 2Y71A 4CLHA 1ZL2A 4I19A 1AF7A 1LWOA 1NQWA 1T5HX 2EL9A 2FZWA 2NOAA 2RGEA 3BREA 3RH6A 1M66A 3P4YA 4OBXA 4X92A 3QHAA 4R1MA 2FX2A 1UIMA 2H2HA 2HMSA 3E9MA 2ILVA 5DHRA 5A6SA 5JVDB 4J9LA 1QUFA 2E5SA 4XAQA 1PJ2A 3E2MA 4H4DA 5AK0A 1JI7A 2J3KA 3G2MA 2GJKA 3WIUA 1BX0A 1UKBA 4DN6A 2PX5A 3CS3A 1ZQKA 1GKKA 1VLHA 2J6SA 5ADVA 1IAVA 1GQRA 1JXOA 3FC4A 1QJCA 5JQGB 3ODGA 3GBSA 1QQBA 1XLVA 1Y5IA 2ZT6A 1TF7A 2F9LA 3CVVA 1CF9A 2G5IB 3Q8RB 1L7QA 1B73A 1YMQA 1LJ8A 4GP9A 3R0ZA 2BFMA 4RE5A 3NC0C 7YASA 1MO6A 4LV6A 1K4YA 3DM5A 5CDTA 4LEIA 1ISMA 4PFKA 3VM6A 2XECA 3QUTA 1K6IA 1NFQA 1NBMA 1T0PA 2FPIB 2QZ9A 2VJ4A 1ZM7A 2WU0A 5FYQA 3RSZA 2A58A 2VSQA 3Q12A 5B2FA 5ALGA 2XQIA 2RGRA 2EFCB 1VBKA 3ISBA 4C2BA 1PFKA 5DHPA 3CZAA 2JEOA 3LY5A 1Z2OX 4AMBA 4W8HA 2EEZA 2CVHA 4ZEOA 3UMJA 1HT2E 3SSMA 1XRQA 4E88A 3P9CA 1DARA 1V95A 3NH6A 4TL9A 3RS5A