4EELA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound citrate and sodium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
229
structure length
229
Chain Sequence
DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase-related protein
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 81
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eelA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eelA01
4E88A 4AP9A 3IRUA 4OFZA 2WF7A 2G06A 3N1UA 5ALVA 3U7GA 5ALOA 4KNWA 2GFHA 4B6JA 3EPRA 3L8FA 5AKXA 3ZUPA 4RESA 3FZQA 5AHXA 4DFDA 4EZEA 4Y3UA 4HGNA 5ALJA 3ONNA 2IOHA 4C4RA 3L0YA 2P9JA 5AKEA 5AW8A 2HCFA 2D2VA 3DDHA 3QXGA 1Z4QA 1SWVA 3W5CA 5A3SA 3WKDA 4NABA 5ALZA 5AI6A 2B1RA 1ZD4A 4UM5A 5AM2A 1QH9A 2G09A 3BWVA 3ZI4A 2G1AA 4I9FA 3ZWDA 5AVXA 4DW8A 2WHEA 5AW0A 1N8NA 5AVWA 3WK9A 3QU9A 4O8CA 5FP0A 4JDPA 4UMEA 5AVRA 4QQFA 2IOFA 2Q5EA 3QUQA 2RBKA 2O9JA 1U02A 4UM7A 4UMFA 2P69A 3ZVLA 1ZS9A 3P96A 3L8EA 1ZOLA 1FEZA 2ZXEA 3ZU6A 3EWIA 1VJ5A 2OM6A 1L7NA 2HX1A 1YMQA 3S6JA 4CE6A 4HGRA 5IS2A 5ALIA 1L7MA 1RPZA 5AKYA 1F5SA 4JB3A 3EF0A 3UMBA 5AI9A 2RAVA 2W4MA 3PCTA 1ZJJA 3PGLA 1T5TA 3FM9A 3W5DA 3BA6A 4J03A 5AKHA 1L7PA 1NF2A 3WKEA 5AVQA 3WK6A 3L1VA 5AK6A 5ALLA 1U7OA 4YIKA 3A1CA 1VJRA 4HYTA 3N5KA 5AW2A 3I76A 3E81A 5AICA 2ZG6A 2C88A 4Y2UA 5AW7A 4EX6A 3IJ5A 2BDUA 2FEAA 3NAMA 2ZBDA 3MPOA 2PQ0A 2I6XA 2AH5A 5AM5A 3R9KA 3L5KA 1YDFA 4QJBA 5AI0A 3N8GA 1ZRNA 3ET4A 4YIHA 5ALDA 5AKZA 3I1YA 3A3YA 5AI4A 4NFLA 3SMVA 2FPUA 4C4SA 1Z5UA 4DWOA 3OCUA 3QX7A 5AKIA 4KN8A 4CF5A 2HI0A 3RF6A 4HGPA 1RKUA 5AVSA 3FPSA 2JARA 4KX5A 5AM0A 1U7PA 3K1ZA 2I54A 5A3RA 5AW4A 4FYPA 3NALA 1N9KA 3F9RA 1QQ7A 4HGOA 1Z4KA 3AR6A 1RQNA 3U7EB 2I7DA 1RLOA 4IFTA 1U2SA 4FFDA 5AM4A 3ZVMA 4FE3A 3QU5A 4NWIA 3OCVA 3QGMA 1L8OA 4UMDA 3TLMA 1SU4A 3WKAA 3WGUA 1Z4IA 2FI1A 3PDWA 1XP5A 1Z4NA 2NO5A 1PW5A 1Z4PX 4MWOA 3L0BA 5AKLA 3OTQA 2YBDA 1NNLA 4YH1A 2YN4A 5ALNA 2FPWA 3ESRA 3QUTA 4UARA 3MN1A 1O08A 4UAVA 4GXTA 2B82A 2QYHA 3U19A 1RDFA 1WZCA 2EARA 3ZW7A 2G80A 5AK5A 1ZD3A 2IYEA 3WGVA 2YMLA 4Y2PA 5AKGA 1SWWA 4CNQA 4XOUA 2I33A 3U13A 4AS3A 2MU1A 5AIBA 1J97A 3ZTWA 1WPGA 3SKXA 3UMGA 5AIAA 4EENA 1KYTA 2R8XA 2P27A 2WF8A 1CQZA 1ZD2P 5ALUA 4IG4A 3OCXA 2W43A 3A1DA 1O03A 5IT0A 4L6CA 1X42A 3L7YA 3UMCA 3KC2A 2GHQA 2MU2A 2HEGA 2GMWA 2EATA 2FPRA 2W11A 1TJ4A 2ZOSA 3NRJA 4EEKA 3UM9A 3QU4A 4Y2TA 3KD3A 4HAIA 2C8KA 3B8EA 1RC8A 3ET5A 4YCNA 3QUCA 4EX7A 3B9BA 2WF5A 2G08A 3NANA 5ALGA 4I9GA 4ZEVA 4C4TA 2FUCA 1QQ5A 3NIWA 5AVUA 4UASA 3WK5A 2FPXA 4BX0A 4BEWA 3W5BA 2YMMA 4XE5A 1S2OA 3L1UA 3SD7A 3ZX4A 4KX3A 1QQ6A 3U7HB 1EK2A 3WKBA 3I6BA 5T41A 2Q4RA 4Y2XA 3AR3A 2HOQA 5ALXA 4BEVA 4G9BA 2OYCA 5A3QA 3AR5A 4F71A 4CF3A 1S8OA 1RMQA 2YJ6A 5ALQA 3NASA 3PGVA 2C4NA 3WK7A 3AR7A 2IA5A 4J2TA 1TJ5A 1WR8A 1Z4OA 3ZWKA 5AKKA 2C9MA 5AW3A 5ALFA 2HDOA 4Y2SA 4UW9A 1VFPA 3AR4A 3R4CA 5AVVA 2WF6A 4L57A 4BX2A 2YY6A 3E58A 4UMVA 4OD0A 4ZEWA 5AI8A 2YMQA 2YFYA 4DCCA 2YJ5A 4XPZA 1JUDA 3QU7A 3WK8A 2AMYA 4YCMA 2WF9A 3OCYA 3A1EA 2VKQA 1Q92A 5IT4A 3FPBA 4F72A 2ODAA 3AR2A 3WKCA 2RARA 1Z4JA 3VAYA 1EK1A 1RMTA 3FVVA 4RETA 1L7OA 2FDRA 2JAOA 2Q4TA 4OHFA 3E84A 2YJ3A 3M9LA 1WVIA 1RRCA 3M1YA 2WFAA 3SF0A 1YS9A 5JJBA 1L8LA 4KNVA 3RFUA 2WM8A 3N28A 5ALMA 1J8DA 1L6RA 1QYIA 5AM1A 1TJ3A 2BY4A 3QNMA 1Q91A 4UU0A 2R8ZA 1YV9A 2HSZA 4UAUA 5AI5A 4Y2JA 3WK4A 4YCLA 3CZ4A 4HGQA 2CN1A 3L0CA 5E0OA 2AGVA 3ZX5A 5ALTA 2OA0A 5ALHA 4BYGA 2B8JA 5ALEA 3B9RA 4XQ0A 3L8GA 3KBBA 3L8HA 1Z88A 3AR8A 5ALSA 5AK4A 2PR7A 4KYTA 3HYCA 3AR9A 5AKJA 1RLMA 4Y2YA 2B30A 5AM3A 2CFTA 2HO4A 3DV9A 2FPSA 2C8LA 3ESQA 2B0CA 1TA0A 3CNHA 1RMYA 5AVTA 2CFRA 2RB5A 3E8MA 3R09A 5AW9A 2B8EA 1YNSA 4NV0A 3OPXA 4UATA 4BKMA 3KZXA 3SHQA 1Z5GA 1AQ6A 5AW5A 1YJ5A 5ALRA 2IOFK 3U26A 1XVIA 2P11A 5AW1A 2YMPA 2I34A 1IWOA 1MH9A 5AW6A 2JGAA 3ED5A 5AVZA 3KOOA 4AS2A 1CR6A 1LVHA 2B1QA 2R8YA 2PKEA 4YGYA 2MSNA 3MMZA 2HHLA 1Z4LA 2GO7A 5ALKA 3D6JA 2G0AA 2JAUA 4GIBA 2ZBGA 3HLTA 4H1WA 2ZBFA 5ALYA 1LTQA 3NUQA 2DQSA 4NAVA 4G63A 3QYPA 1T9ZA 2HF7A 1K1EA 2HF2A 3MC1A 3KDPA 4BBJA 3QLEA 2NO4A 4MUMA 4OCZA 3ZVNA 2CFSA 4Y2RA 1RLTA 2O2XA 3ZTYA 3I28A 5ALPA 4CF4A 2FUEA 3GYGA 1T5SA 3SLRA 2I55A 2JAWA 3J7TA 4Y2VA 3N07A 3SKYA 4L6AA 4Y2QA 2AUTA 3OCZA 2QLTA 3W5AA 1TE2A 2ZBEA 2R8EA 2G07A 3QU2A 3DNPA 3EF1A 5ALWA 4EELA 3IB6A 4PNHA 2NYVA 1Y8AA 4BNDB 4BNDA 2YJ4A 2GHTA 1ZD5A 1RQLA 1RKQA 1RKVA 1U2TA 2EAUA 3OCWA 4UU1A 3DAOA 1XPJA 1Z4MA 4ZEXA 1NRWA 5AK3A 2OBBA 1ZRMA 3U7FB 5AESA 5AVYA 2BDEA 3QUBA 2X4DA 3FGOA 4BX3A
chains in the Genus database with same CATH superfamily
4QU9A 1ZIYA 3GARA 3JD1A 1KTVA 1MAWA 3ADDA 2VNKA 2Y8EA 2XCIA 3QKUA 3BKXA 4G0MA 3SHVA 1XVUA 1RVDA 1BJTA 1ONNA 1M0EA 3BXXA 4JT8A 1V39A 3L0YA 1MLDA 1Q2UA 1EM6A 2X4GA 3BWEA 3VKFA 4EJ0A 1PGQA 4R7GA 4RY2A 3OLCX 3CUSA 3NTRA 5JRDS 4TZKA 2HLDA 2IIBA 1OAAA 1QRSA 4YP3A 3RPEA 3U5TA 4MKIA 1B22A 1NQVA 5BSEA 2DC1A 1VJ5A 3R3WA 5IVPA 5HF8A 4QZ8A 2AG6A 1H2XA 5IJZA 3O3OB 2ISQA 3KQSA 1H0HA 5FT9A 2HGSA 1QIEA 3COJA 1OIWA 4ENRA 4YCAA 5ALLA 5HFJA 1U5AA 5JCXA 5KQMA 4MDFA 3E6AA 4NEHB 2Q6LA 1J49A 2OSBA 2JI4A 5C4GB 2DE0X 4LOLA 3LH5A 1M74A 1S89A 2EIXA 1MA7A 1PQPA 2IE0A 4JODA 1SUAA 4HEQA 1VL8A 2VDNB 3BXGA 4AECA 3CT4A 1RBMA 5E4TA 1OFUX 4RNOA 4F1WA 3CVVA 2KVCA 2Z08A 3O9ZA 5JY6A 5FNVA 4OI1A 3ND6A 3E0FA 3LY9A 1XMVA 5C0OE 1U2SA 1FMCA 2R5NA 3P2OA 1MP0A 2V6GA 4K3VA 1KL9A 4TQ9A 4UNIA 4A16A 4KV9A 4HLQB 1I5OA 1EX1A 3IP5A 2VJYA 4PL1A 3GEEA 3ZDCA 2ECFA 5AK5A 1ZD3A 1GFWA 2H5EA 1E6LA 2W00A 1Z28A 3PKJA 3HWTA 4NMMA 3BZWA 1O3YA 3AESB 4IHJB 4MHTA 1SXEA 3H2JA 2AC7A 3FB4A 3LY5A 2QB0B 4GQIA 5DNWA 1PRYA 4LTMA 4B4DA 2CXTA 3EVBA 1KO1A 1CY8A 3I32A 4RD3A 5EE9A 3OMWA 4G4SO 2YMMA 1GTG1 3QKSB 4UEJA 3VJLA 2IOQA 4EKDA 4K2HA 4AQ7A 1FPQA 3GP8A 4K88A 4B3FX 8ATCA 4HDRA 4QWMA 2AKYA 3OTIA 3IOEA 4GKAA 4B75A 5LSAA 2YV4A 2RJOA 2BEKA 1KMNA 5E6UB 1S9FA 3BREA 1RPLA 2INGX 4UFNA 3JV7A 3MLAA 3BQ1A 4YN4A 4U7WA 1DO2A 1QLWA 2HHHB 3VR6D 1T8EA 4L8LA 4IYJA 1KS9A 3A2MA 4Q45A 2EERA 4KFUA 1UK9A 1DIOB 2WYWA 2O2GA 3TMYA 1RQGA 1VMKA 2ASVA 2NQ8A 5IT4A 4XQ9A 4HDSA 4F8JA 3B9PA 3JQFA 3HSYA 4IILA 1Q1BA 2B4KA 2WJIA 4CEIA 4AROA 1Y9ZA 5FHQA 5KUTA 5JADA 2FVXA 5FOSA 1CUZA 4EZIA 2KZZA 3RG8A 5G0TA 3HRHA 5DI3A 1XEWY 5K8IA 4RTPA 3QV1A 1N0UA 4B87A 4AIRA 5KFMA 5FL7A 2KSOA 4N82A 2QRNA 4AU1A 5J58A 4O3NA 3G2NA 2JLVA 3WFZA 1BDIA 3TPCA 4JT9A 3SK0A 5KNDH 3U9LA 1SBTA 4H6WA 4KXMA 3L93A 1DDGA 3G0HA 1KFKB 4WJLA 4JI4B 5I9SA 2FRXA 3MGAA 3QEOA 4K9OA 5B4TA 1JNYA 2CHEA 1YRHA 2PXAA 1ZISA 1JH8A 2ZTEA 2OYRA 3RYCA 4M36A 4TWBA 2JJ2A 4HVAA 2HF2A 1IXRA 4JI2B 5K09A 2Q21A 3QPVA 1T1RA 4L9AA 4D9KA 4F11A 4U9HS 2IY7A 2BMEA 4RXMA 3BCRA 1OH5A 1DAMA 1ST2A 5GZ3A 1DMRA 2XW6A 3SZLA 2RD2A 2CHGA 4CKEB 2Q0XA 4E1VA 1U9YA 4JAVC 4JLAA 4D0RA 5GGYA 4ESHA 5FQNA 4MQUA 3P71T 4UQPA 2JK1A 2JKVA 5C46F 1YDMA 4KK4A 2IS4A 1MR3F 3TI7A 5IDQA 4HBZA 2HY7A 5HKLA 2JRZA 5SZJA 2XAAA 4PWZA 4DR2B 1RTTA 2I62A 3R9XA 2OHGA 1BQ4A 1PT6A 4UM9B 2FR8C 3RROA 1XWFA 5HCNA 4FKBA 3ZI4A 3N0TA 3TPZA 3ZE2B 3I8XA 1CRXA 1MGPA 4FIDA 1ANKA 2A58A 3V7NA 3AUUA 4DQVA 3EVEA 1L4GA 4OAQA 1DRKA 4CV1A 1IIBA 1T3SA 2YKGA 3HJNA 2OB2A 1P2FA 1TI7A 3IXMA 2JLWA 3PGLA 4OGLA 1EIZA 3TTXA 4WOJA 3L3FX 3E7DA 4D5GA 1K3TA 1KY4A 1UC5B 4JZKA 1FJXA 4MUIA 3OC6A 1U8CB 1SFRA 4MVJA 4PHFA 4BKRA 4LVUA 4PONA 4QBIA 4IQ4A 5JQGB 2VTKA 5IU6A 4RCVA 2I5HA 1BMFA 4JK1A 3AF5A 1Z6ZA 3R40A 1WXFA 4WMLA 2GWSA 1U1GA 2QVGA 2QTNA 2OE2A 4RTMA 5D3MA 5D5HA 2C82A 3H3JA 3UCFA 3ITDA 1SBYA 3JALA 1NYRA 4ZAZA 1F8YA 3AIMA 3ZE6A 2FE9A 4OHXA 4J0IA 1D4OA 1ZOOA 1UMBB 1OI7A 4AMVA 5FWNA 3VH4A 5HKKD 5A9RA 2OY0A 2XUHA 3PUHA 6LDHA 2CF5A 2DPJA 3GV7B 2HKIA 3A36A 4YP1A 3ZDRA 3ZHCA 3OSZA 3OX4A 5KJ6A 5ESDA 3G23A 1GUFA 4MS4B 3ZCTA 3CX3A 5TMBA 4ISCA 4JP2A 1Q0SA 5K3CA 1OZAA 2KVSA 2K4MA 3R3XA 2HHAA 4GFDA 5HSGA 2GDJA 1M2NA 2PD3A 2Y1EA 5THXA 4WKOA 1AMUA 2H18A 1CJTC 3OM9A 1T5BA 3UK1A 2UXCB 1YIDA 1EEXB 1SC1A 3BS5A 2QTHA 5BT8A 1JGTA 4QGGA 3OF2A 1SCJA 4YXWD 1N5OX 2CRXA 3KLOA 4DR1B 4OHVA 2VDLB 1ZQYA 2PZAA 3JZMA 4OL9A 4C05A 2ZRQA 1E96A 4GBED 2VP0A 3B48A 2YX8A 1G5RA 3AF6A 1Z26A 1UXHA 2OAP1 1P8AA 3ROEA 5HBRA 1SV4A 3L4SO 2A1AA 1ZQQA 2C92A 5G0UA 2A33A 1Z73A 4KE9A 4IEEA 4A0QA 2EZXA 2CXRA 2CNKA 1A5BB 1DV2A 3LT2A 3PTZA 5C80A 4DZRA 1C7JA 1Y7HA 1NR1A 1FP4A 4IY1A 5JPCA 1GDDA 4GXRA 4RDIA 1UPFA 2WFAA 3ROMA 5BV8A 1VLMA 3CRQA 3NBAA 5CXSA 2W6PA 2PT7A 2PLWA 4CI9A 3SDSA 4M22A 2RKBA 1V9SA 4DBVO 1SUDA 3V5NA 4F2RA 3SHWA 2M1XA 4FC7A 1UT5A 1TM7E 2C28A 2FMFA 5JLJA 5C5JA 3RRXA 4UOEA 3JPOA 4BUGA 1VYVA 3V4PB 2O2YA 3ILYA 4E30A 3D5QA 2NX2A 1OAKA 4M98A 1EVEA 1HZZA 2FPLA 4BMYA 2GH1A 3KQTA 4KN4A 1YZUA 3FGPA 3GLSA 4GS5A 1NXPA 3ZY6A 2DCMA 1NULA 4XIJA 4F4JA 5BOSB 4M9JA 1R10A 2P3SA 1QFZA 1J39A 3CMMA 4F4YA 4H18A 5D4BA 2XGOA 3A2KA 1S3SA 5E1OA 3DAPA 2FN4A 1KSJA 2XE8A 2HM7A 1ZONA 4AZ3A 2CVPA 3NTVA 1XJCA 3GQBA 3G13A 1P45A 2H1RA 3ABSB 5F35A 3BFKA 2JZOA 4QZAA 1E20A 1B93A 5DH9A 4R1MA 2XYGA 5TPWB 3H97A 4IOMA 1QFMA 4CR8A 1OCEA 7ABPA 2PLNA 2D7DA 4LE1A 2XCTB 2IA6A 4Y3UA 2O0MA 2VSXA 1GSAA 2Y77A 3RS2A 3HBNA 1EFKA 2JLBA 2QI9C 3ANSA 3DL2A 4TS1A 2G09A 3BL5A 1KDOA 3LS2A 4MRPA 5LBUA 2E85A 4CW7A 4NC9A 4KRYA 1E99A 2BR5A 3EGIA 1V37A 2W93A 4LQDA 3PEWA 4ECQA 4JLUA 3AP3A 1EI9A 4RHUA 4FBLA 3D2QA 1GUZA 4Q18A 1GA1A 3DGEC 4RJKA 3JQFC 4DDHA 4RF2A 3WADA 2AK2A 1KZGB 2HQRA 3OM0A 3IR6A 1T5TA 4U7DA 4MHVA 4YEDA 4RPCA 3Q6IA 3LYAA 2Y4NA 2D74A 3A1TA 4C0WA 3M5CA 4ZC1A 4LJ5A 2AR0A 4MV3A 1UIRA 2GS9A 3CF6R 2ZWOA 2V1XA 1ZO8A 3FGNA 3N0XA 1JHAA 3CZRA 1RNLA 4C7ZA 1RZTA 5JASA 4CT5A 2EWVA 2A57A 5NULA 1HDOA 1GR1A 4XRHA 2IJGX 3JQEA 3V34A 3WLAA 3JWPA 4GKKB 4LXXA 4ZI3A 1KI8A 2AFIB 5H5JA 4LRUA 2W4IA 3LCCA 3GP5A 1QHEA 3KPVA 3DLIA 1IJBA 4MV7A 5KHLB 3UOGA 2OP1A 3W5VA 1GDTA 3RFCA 4Q4LA 1D6NA 4KW7A 2R4UA 5HE8A 1DC3A 8ADHA 3SQWA 1J2UA 2G36A 2YWEA 2RGAA 4LV5B 4LRTB 1MX1A 4F9EA 2WV7A 2J31A 3VPCA 4MI9A 1EDEA 1NBAA 2GPWA 3MRVA 5JCPA 3TQHA 3B5IA 3RWBA 2XXAA 3E9RA 2ZKIA 4GPD1 4DHWA 1GT6A 3IGFA 1V1JA 3C3MA 1KDVA 5CFPA 5HKBA 1I5RA 3OU2A 4JENA 5J4KA 3ZCPA 2A9KA 1W25A 2OVBA 5LYJA 4YG2A 2PX5A 4LHYA 1CG6A 4M1EA 1N2JA 1UDXA 3A8TA 3JWEA 1UWLA 2DECA 4UHCA 2JI9A 3GGCA 1HV8A 2C7BA 1HNWB 2RGRA 1X8JA 4BNXA 3GNTA 3KL4A 4U7HA 3KSZO 2HU2A 3HA3A 4X94A 2W3RA 1ADBA 2ONJA 1V16B 3WRVA 1T2AA 1N75A 1KZYC 1VFPA 2ZSUA 3C14C 1NL3A 5CYOA 3AEUB 3OQBA 2XMBA 2N9UA 4C08A 4GE3A 4YQYA 5BYJA 4NBSA 3A6DA 1VHLA 4EQ6A 3IKJA 1BOFA 2F3RA 4XJTA 3J7AC 2Q4TA 3LBIA 4F5QA 3S1AA 3A4IA 2WZQA 1N34B 4R9UC 2ONKA 3NWJA 1UM8A 4R63A 3PTLA 3ZHQA 3RAFC 2NZJA 1LSSA 3VBCA 4BO0A 2PCLA 1G18A 1MO2A 5CLLA 1VGVA 2ZYTX 3D0RA 4QRIA 5EWMB 5IMBA 5E0OA 5ALTA 3P9SA 2V3CC 3CEHA 2FDXA 5EVCA 3HXQA 2BFEB 3S7ZA 1CX9B 1UM9B 2Z2KA 5DYIA 3H5NA 4OUDB 2PIDA 4B4KA 5A9SA 1ISHA 5KBYA 1SRQA 1XNQB 5A1TA 4I1UA 1VCOA 2AIRA 1DARA 1XK6A 5AW1A 1O97C 1GPWB 3CGWA 2JH1A 1RWKA 3MNFA 5C7LO 4LMAA 1WJGA 4LHEA 2COEA 1T3ZA 3A4LA 4BJQA 3C8DA 1XCJA 3VAZA 1EDZA 4Q3OA 3JQ7B 5KPDA 2CFSA 3PCRB 1JRPA 1RLTA 4TQGA 3AYZB 1FNBA 3GYGA 3R1IA 2I55A 4DB2A 4DEZA 3F6PA 2AOTA 1NYQA 3ISBA 1SIUA 1NKCA 2EU8A 1SXHA 3AHCA 5KB3A 1E69A 4U00A 3PITA 2EW1A 1Z4MA 3KQWA 1P2DA 4WACA 4BATA 4JUAA 4P4PA 1QHHA 2XZPA 1OLXA 3H99A 1E1LA 1FFEA 1NLUA 4FOSA 3T4XA 3HCBA 1G5QA 2MOKA 4ZZ2A 5C3UA 1ELOA 4PSKA 3SF8A 3QLVA 3JQRA 1XRSB 2P41A 4RPHA 1NXSA 4KL8S 1Y4DE 3ACBA 4RJIA 4QQFA 2ORVA 1F8FA 2N46A 3L0ZA 2WAQF 4A5SA 1L3VA 4EB8A 1IBMB 1LKYA 4C3UA 3LLSA 3SZRA 1KFSA 3D4BA 2XB2A 1BN7A 2WLSA 2RAVA 3RT7A 4S1TA 3BILA 3ZD6A 4E5PA 2X1MA 3KFXA 2Y1LA 1OOEA 3UPQA 2OO5C 2P0EA 3KQLA 3NGLA 4NQZA 1C9YA 1N56A 3KKPA 4B31A 1G6HA 2XGSA 1XCLA 3HFGA 1IQ0A 3U3MA 1QZTA 2C2DA 1LQ2A 4DPLA 2CMFA 3NLLA 1EFTA 2IXAA 3FPSA 4ZI5A 1G21B 4F1KA 3BFXA 4GMDA 1V9LA 3QFHA 3JQ8A 1HZZC 4HN2A 4CTMA 4K0KB 4RK1A 5EKTA 2O7SA 3WR5A 1PKXA 1XTSA 4E31A 1E0AA 2VQ6A 4XLZA 3CUKA 4MEXA 2PWYA 3BE8A 4F6RA 4E5NA 3B8HA 2LPEA 1WS6A 1DAFA 3F0TA 2ZTCA 3KHHA 4NE7A 1IY0A 1G4AE 1H2FA 2C4MA 2KFZA 1E3LA 2FLNA 3C87A 1OIXA 1REQB 3OHAA 4YT8A 3RC3A 3AUOA 3C8HA 4KE8A 3BE5A 1U0JA 4K1LA 1DCMA 4BBAA 3OQHA 1E9AA 3KYDA 5T3YA 1VP9A 3PI7A 5AXBA 1IHXA 1WUDA 4FT4A 3MTGA 4J7AA 4G1MB 4I50B 4EL0A 4MUBA 4RQ0A 4MPTA 1SUWA 1IATA 4KQCA 1Q21A 1TZBA 3SD7A 5LL6P 3O4FA 4KIJA 3TSOA 4RCYA 2G28A 2J7PD 3OD1A 4PNZA 2QXTA 3UCXA 1Z25A 2BP7A 4D9FA 3BZUA 5T3UA 3DO6A 1FYXA 3M3HA 1JHDA 8ICJA 4RHCA 1S76D 2IYFA 4IV5A 4OI2A 4GM4A 3TLGA 1TT5B 2BOVA 1F0MA 3KWMA 4GP7A 4F5NA 2KE5A 4G85A 4TS9A 1NUUA 3OM8A 3DOEA 3MELA 2VSQA 4QHSA 5A06A 5CUQA 1QHFA 5DQHA 2OHXA 2QX9A 2R18A 4M4SA 3F46A 4JIGA 4CM4A 2DMRA 3GRZA 2ZIVA 3RIEA 4CM5A 3UAVA 1L7QA 1E2DA 4L4RA 4F45A 2PRYA 1B73A 5FLYA 4J07A 1ZL0A 4DL2A 2NUPA 3LBAA 1ICIA 3WB2A 5KTOA 5C5CA 1N32B 2ZTMA 4M1SA 3NEPX 2X13A 3BZKA 5TQ0A 3Q0TA 4S2UA 1A27A 2GN0A 2QT1A 3EOZA 1ZVMA 2ZBFA 4RNCA 2IYZA 4YYEA 2IYVA 3ZH9B 1D8YA 3R7SA 3I8OA 4ZT3A 2GZHA 2JXJA 2PS1A 3CYMA 3DF9A 4RL6A 4X1KB 3TLXA 2BE9A 2J30A 3ETDA 4AUNA 1SQFA 1SA0A 2HXSA 3EMKA 5CIYA 3FGOA 2CYBA 3HYLA 1XRNA 4EITA 3QZUA 5DG8A 1UBGA 4W6QA 4KMOA 2ATCA 3HCDA 5AKXA 3F1KA 4J0JA 3PJFA 3UAGA 4M1OA 2EL9A 5IDXA 1U28A 5DK6A 1Z6GA 3CLSD 4DZTA 1RAEA 2C97A 2KQUA 4TX1A 4IV0A 4X24A 3ZDAA 1KO7A 4CFSA 3SIRA 4KAJA 2QS9A 2IBMA 1TTHA 3I9V1 1PJRA 4M9QA 4PHAA 2HADA 1WKCA 4H16A 2R2GA 1HDRA 3FUWA 3LOQA 1DBRA 5B7NA 1NUAA 4YO7A 1ZKMA 2XZTA 3MT8A 1YZQA 3OGUA 1Y33E 2OXOA 2AXEA 3LUFA 5BSUA 5EHXA 4YQZA 1FMJA 2JIMA 4B3XA 3RIHA 3M82A 2REXB 4F8EA 4GPIB 5A04A 2YZGA 3QP9A 2Z5GA 5LMZA 5D85A 3SZMA 4CVNA 3A1VA 1G8PA 3H1TA 4BLWA 5F76A 2DSTA 4QO8A 3ZYCA 4Q3KA 1QQ7A 1DTEA 2AFHB 3MTAA 1XROA 5IJAA 3EGXB 4N0MA 4Y2HA 1X1DA 1JMKC 1A96A 4JI8B 4KXUA 3RKRA 3K0HA 1NNLA 3MR5A 1PV2A 1VGRA 4RH0A 5CRXA 2P90A 4CM3A 4ALJA 2ZRPA 3R7DA 3PC6A 4FCCA 3MWDA 4K4HA 3DKKA 2O2IA 3UMRA 5K8VA 1SVWA 4RTNA 2RP5A 2HNAA 3F3SA 3OECA 5IDVA 3AB8A 3MAJA 4ER6A 2C7QA 5AOVA 1H1LA 4F3CA 3E82A 2JI8A 7ICTA 2F2AB 2NZUG 1Y80A 1ZCZA 3QWAA 4Y2TA 4X1YB 4GHWA 1PX2A 1JMVA 4IVRA 3HKCA 2NNWB 2R00C 2DR2A 1DO8A 2BEVB 2G08A 5JYBA 3B1ZA 4PXAA 1KQ3A 1JI3A 1Z5NA 4RW0A 3SXUA 4N0PA 1SL1A 1VKZA 4XIGS 4HNTA 3HDGA 5KIAA 1ZWKA 4I9NA 4WX2B 1A8PA 3HXOA 2HJVA 3U62A 3NM6B 3VTAA 4PGGA 1J9EA 1UEXC 3C5CA 4KLHA 2JZBA 1KDYA 2VANA 3RF7A 4HWKA 4YAUA 4OLAA 1GQQA 1T35A 2D8MA 3DCYA 4C6TA 2QKYA 3HABA 2FZVA 3CHYA 3WQSB 3LVWA 5CFZA 1EDBA 4DFJA 4V2IA 1KY3A 4L0DA 1EX7A 4DRYA 3SSAA 3CWQA 1CLEA 4XPZA 3WQBA 3GP3A 3WU2U 1J5PA 5FFMA 1KFBB 3LTEA 3DV0A 3TBKA 5L4SA 1ZCJA 4I2JA 1IG0A 1SELA 3NDRA 2ZAGA 3CX4A 3QVMA 1VKRA 3THWA 4EUNA 3N2NA 5BYAA 2C5EA 1ZVVA 3T5AA 3L7OA 1L1RA 1WCV1 1Z7EA 3CM0A 4O8ZA 1SVIA 5LXTB 1ZGAA 4A2QA 2Q3FA 4C7MA 2HIAA 1R0BA 2J3KA 4K2AA 1RJDA 1SC6A 4BOYA 4XQ0A 1CQXA 5AJUA 2ORIA 1N0HA 1D0VA 1UP4A 2OGUA 3ST7A 3V8BA 1RPJA 4KUHA 1PT9A 1GY8A 4QGFA 2X0EA 2ZVJA 1ODLA 3JYPA 2KPOA 1KZ6A 1AA6A 2P9YA 1J2NA 3GBSA 1B76A 4S04A 1CNFA 1GARA 1DKRA 5LVAA 2WTFA 4D9IA 1VG1A 1I0IA 3S8EA 3WQRA 1UJCA 2HFKA 1QC5A 5F4ZA 4QWWA 2G25A 3OIVA 3BIFA 4JASB 1L9KA 1VRCA 4RSGA 4YREA 5JCJD 4BFTA 1WKVA 1YGPA 4BMOB 4YQFA 4AJKA 1LXCA 1ZRMA 1ILEA 4LGYA 3R5JA 3QUAA 4ZRNA 1VJ1A 2FZ5A 2WJPA 4KP7A 4DARA 4JYCA 4BTLA 1Z37A 3KYIB 5CR0A 3W5IA 2J3MA 2W22A 1U3GA 3MLBA 2C2RA 1KSFX 2K60A 2WJAA 4O33A 3OJWA 2W98A 1WEHA 2GYWA 4UBJA 2ORWA 3T3HA 3NVKI 2O4CA 1VE6A 1N8NA 4MS1B 3LRPA 4IDAA 5BUSA 5KKCA 3NKLA 4WVFA 1J2JA 3AJAA 2UV8A 1JEQA 1DK2A 5CP2A 2XBUA 3K9GA 1GUAA 1FEZA 1W4LA 2OM6A 3IAXA 3X1WA 1XBTA 1JLMA 5K8TA 3M8KA 1EUDB 5KJ1A 4TXLA 2LIPA 2BF7A 2H54A 3D3EA 4P4TA 5BPFA 4EI8A 3E81A 1HFJA 5E0KB 2XKBA 4JU9A 2AN5A 2YJZA 5BUZA 1E0KA 4M87A 3OOHA 3ASZA 5JBIA 3PR2B 3U7QA 4AN4A 3TVTA 2Y0SC 2RK3A 4PG5A 1LEHA 3OCUA 2RKOA 5CPFA 2JA1A 3CW2C 3RF6A 1Q3VA 1DXYA 4ZZ3A 1TJNA 3GPBA 1RWXA 1CE8A 2Y0BA 4F9FA 1IN1A 3EZXA 2ZJYA 1YB7A 3OLZA 3RJFA 5HJ2A 3T5JA 3NHLA 2J5QA 2WPNA 4QFDA 4C7XA 2QRQA 5EWGA 4AVYA 1JR3E 1N4DA 2PUAA 1COOA 1SUCA 3OEED 3M9XA 5EUCA 2WBLC 1IG6A 4N76A 1Z2AA 4A6PA 2BFMA 3IT0A 4IJUA 3TKAA 4ZYZA 5JSZA 1A8HA 4D2IA 1CDZA 1EVIA 1LFDB 2NPIA 2Z2ZA 5JW6A 4GR4A 4L6CA 1W87A 3BSSA 3F53A 1U5BA 3GBVA 2FPGB 4V0NA 3S2YA 3U7IA 1RP1A 1QVZA 2C31A 1TJ4A 2KJ8A 4JI1B 3LWZA 5ILGA 5D5QA 2DGZA 3F67A 1DAKA 3AHIA 3QLJA 1QGUB 2LKDA 1QP8A 3IDSA 3LUBA 5I01A 2WYVA 1XMJA 3QQPA 2IXFA 5CVEA 3TAPA 2QY9A 2OYCA 4N5MA 4DRZA 3L1JA 5JZMA 2ZJOA 2ID7A 2VYCA 4UW9A 4PYMA 2ORYA 3VKUA 3A04A 1XMSA 4NYMR 3KFUF 5TE9A 1NF8A 3GIKA 3PXXA 5IKPA 1WX1A 1X70A 2YY6A 3RRGA 1XN1A 3MMNA 4I1RA 2BFPA 3DEYX 3FTNA 1YL5A 4IGFA 1DRJA 4DCCA 3PQCA 4XR9A 5KOIA 4DCNA 1UFVA 3EF3A 3OZDA 3NV7A 3OZAA 1WDWB 4E46A 1KU6A 4DSEA 1MABB 1S8FA 4UU0A 1BVHA 1V5IA 1U3FA 4K8RB 1VA4A 1XMXA 3MS7A 4TKVA 4MI1A 3DVRX 4YVFA 3HNOA 3KJGA 4HAXA 3B13B 4DR3B 2B8JA 4FDAA 3RTBA 2JIPA 1HA3A 2XVTA 4E3ZA 2EF0A 1FFXA 4MWGA 3ZHZA 4DUZB 2VP2A 1WO8A 1DJMA 1F9AA 3LX4A 4BDSA 1U8XX 3VR4H 3E5MA 4MW6A 4EG0A 1SOVA 1XO0A 1SGWA 2I34A 5AW6A 2ZSIA 2B1QA 1U0FA 4HGYA 5F9HA 4YR7A 3O47A 3FYCA 4PG4A 3BERA 1VFNA 1SBIA 3IELA 2IHBA 4D8VA 3CTPA 2RGXA 1OLUA 3WJ2A 1E9DA 2CLMB 4RA6A 1U2ZA 3C6YA 2FV8A 4BVKA 1WMBA 3G8CA 1IZ8A 5G3YA 1YCGA 4JHLA 2Z98A 1P61B 1KAHA 2HPZA 3PFHA 3RWOA 3A4TA 2O8BA 4E5VA 1XTVA 4UU7A 2H08A 4R01A 2AHOB 4QNRA 2H51A 3HILA 3PRJA 4EA6A 3L8FA 7ICVA 2PKXA 4RYDA 3D3NA 2GF0A 3SNKA 4QKQA 2LE0A 4WLNA 2A1TS 3V7JA 1GGNA 3PIDA 1N33B 1N4AA 2M32A 5KCZA 3A3OA 1PFGA 1USVA 3QVGA 1V1MB 2YWGA 5DQGA 4EMUA 2WAAA 5B55A 2DTEA 1IFXA 4C3OB 3IB3A 3RUDA 2ZWAA 1ODKA 4BVJA 2HYDA 3IQGX 4KQHA 2BSXA 1SUBA 3FPEA 2FLLA 4II7A 1WQ3A 4DQ0A 5CK5A 3JQQA 1Y98A 1JHZA 2X0NA 1SULA 2C7VA 1JIXA 1X9XA 1G63A 4KLAA 1JR4A 1FSFA 4QPZA 2NU6B 2D8AA 3KALA 2IFTA 3G82C 5H80A 3CYFA 5C1PA 2HW3A 1DQPA 3N7SC 4QOIA 3HI6A 3LAWA 1ZNZA 4LF4B 1ZUIA 2BMDA 4O1HA 1EXWA 1NQAO 2JARA 4RZUA 1JLLB 2KEYA 1O2DA 4M1YA 1XR3A 3GRVA 3C1TA 3R0QA 4ARAA 2OESA 2AI1A 3DOHA 3I01M 5FBLB 4D8YA 5B1YA 2DWCA 3GGSA 5F78A 5ED0A 3V4FA 1HKUA 3L0IB 3CVUA 4NQRA 1F3LA 1ACJA 2B98A 2FRVA 2GM9A 2QX6A 3GFSA 3K2IA 3UICA 1M2KA 1SL2A 3SMQA 4LWZA 2O07A 5CX4A 4AZTA 5BQFA 4IDEA 4ON9A 3E05A 4MUFA 5CLIA 2B7LA 1VXRA 4TTTS 8ICQA 4IG4A 4RQ3A 1AGXA 5CLQA 2FUNB 2Z6AA 1Z8NA 3Q7RA 2PBRA 3WLIA 3DONA 1I3CA 4UU8A 3FDXA 1CULC 4AP6A 4O4LA 4JBIA 1EFPA 1Z1VA 3FDIA 5DNEA 1KYVA 3QKRB 5KQLA 1D6MA 4BX0A 4HYQA 5KYGA 3Q8QB 1C9DB 3W8DA 4ASUD 3PPIA 4NXNB 4E5SA 4EZBA 4WY2A 4F71A 4TLDA 4MV0A 4A8PA 4I5FA 3BC1A 3C5FA 2O3JA 1TL7C 1O4VA 5G4KB 2EQAA 3GVHA 4E21A 3WICA 2HRQA 1S01A 5CXXA 3AFHA 5DP1A 5EZ5A 1KI2A 2QV7A 5DFAA 1NQXA 3OCYA 4F2HA 3V1MA 5KDDA 3EEQA 2ZJ3A 1QLHA 3DTTA 5LU9A 8ICYA 4X85A 3MTEA 4MFFA 5AM1A 1BE0A 3QNMA 2V4MA 3IBTA 3OKAA 1KR5A 2DX7A 2VVTA 3ZHXA 1EJBA 4PRKA 2FEPA 1MIOA 5FHRA 3U9SA 2PJRA 1N60A 1G20E 4IDNA 5F1OA 3H0LB 3LBFA 4II2A 3WL4A 3O8OB 5JSUA 2AOXA 3D31A 3D8SA 3K96A 3SHQA 2NU8A 1EQ2A 4J43A 2J41A 3HV0A 3AVYA 2YIVX 3C7AA 4EA9A 2PGNA 3I39X 3TZKA 4LGVA 4XGRA 3GDGA 3WQQA 4LXUA 3BUSA 3NUQA 1XKQA 2I9GA 4P22A 1IY1A 2ZRFA 5BMVA 3T1TA 3DW3X 1DQSA 4BO6A 1PUIA 5CRIA 4QPCA 4QIWF 3VMMA 1EVJA 3O1JC 3D8NA 2R8EA 1X1AA 5IF3A 4E2YA 4L15A 3NHSA 4HNUA 4XXHA 4KR3A 4EF4A 3ZH2A 3R20A 5AFSA 1GTJ1 2H1LA 4LF7B 1V0JA 1CRZA 1P0PA 4ECRA 2HRZA 1OU0A 5EP1A 1KFCB 3ITNA 2GZAA 4PYNA 1Y42X 3ESYA 5FA6A 5EJEA 1XT6A 2D1SA 3DBLB 2LIVA 4LVOA 3L04A 2B7CA 3WGKA 5F1YA 3AGQA 3HBAA 3THOA 4G2NA 2AGOA 1HX7A 4YAIA 3T3NA 2PUGA 2CK3A 1W59A 4OB8A 3GRUA 3WMGA 3SOZA 5DF1A 4DG5A 3IUBA 4U7TB 1PT5A 2QYOA 2B2CA 4FP9A 3HKZF 2BL4A 5AVJA 2CGEA 1I6LA 4J4TA 2X9NA 1EU1A 1DELA 2XE7A 1MAHA 1CZLA 4DA8A 4J03A 2XGMA 2WG0A 4DQDA 1RI5A 1KBQA 2OZVA 3PW7A 1SKWA 4MGIR 1B6GA 1ZG3A 3V4RA 4G1VA 2XTNA 2EX1A 1PBTA 3MPOA 4XWWA 2QPTA 4B9EA 4OHWA 4HEA1 4XIFA 4F4CA 1G5FA 4IH4A 5KFKA 1S0NA 1CP2A 3HU1A 2W9AA 1HLFA 4WZ6A 5ADVA 3LF1A 4ER0A 4HZIA 1EJ2A 2AVNA 3L1HA 5DBCA 3TR0A 2WJHA 3AVOA 1A4RA 5CITA 3SEIA 3VYTB 4MLCA 4LW8A 5LQAA 5BSKA 1T94A 4FE3A 1P2UA 2JJ1D 2IHKA 2ZTLA 3ND7A 4DC0A 2QN7A 3AF4A 2P77A 1N6IA 2B0JA 1AK9A 2HWYA 4XJXA 3A06A 5KG1A 1EZZA 3O73A 2XXBA 2JH9A 2HA0A 5DXAA 2F3NA 2W2TA 1G9SA 1K06A 4N6GA 2IHVA 2I6QA 1UINA 3DPSA 4KGXA 5FI1B 1I2CA 4G0ZA 1OXXK 3HL4A 1C1XB 4N7BA 5BWNA 1VJ0A 1FYWA 1CERA 1QHIA 4J91A 2K8AA 1KZHA 5KFCA 2YOHA 1UUFA 3SVTA 4BEWA 3EDMA 3F78A 1R3DA 2TYSB 1KJJA 2OCXA 4JC8A 1OA0A 4OK6A 4D5EA 4HX5A 3BS7A 1K8XB 3B2NA 9ICWA 2GD6A 1JXLA 3TZCA 2NIPA 2G9NA 3HACA 2Q6VA 1MA3A 1IUPA 1TYDE 4PY2A 1KK3A 4M1QA 5DU2A 2B99A 4FD2A 4HQNA 1N1GA 3RWMB 1P7DA 1XQ9A 3TLZA 1H1DA 4P0PB 1KPIA 1PHRA 3RNLA 1RMTA 1P6UA 4GC9A 4H1HA 3F3MA 5KFPA 4I6EA 4XB6B 4QGSA 4WADA 3VDQA 4IHAA 2UVQA 3GYBA 3DLPX 1PT8A 1KP3A 5DCYA 1VI2A 1LV7A 4ALIA 2F17A 1C29B 4HWPA 2EANA 5LP6C 4DQQA 1SL0A 3K0FA 1O94A 5L1JA 4TTVA 5COQA 4TVBA 3N2KA 1JFFA 1TK0A 2GHIA 4YUWA 2H3HA 3EHEA 4DQSA 3E7WA 5KYWB 3CF0A 1NW7A 5KJEA 4L08A 4IIYA 4BJ3A 1M8GA 5KQRA 4Y18A 3WA6A 5FO0A 5A7HA 1DAGA 5B2FA 3UK6A 3RI3A 4MJ7A 2V6IA 3GFQA 3I0ZA 2F8SA 1ZQNA 3BT7A 1YMUA 1TKAA 1L7RA 3H8WA 3OURA 2BM8A 5SICE 3PWZA 1OBOA 4DWJA 1FC0A 1YQTA 5ICCA 3PX4A 4PZDA 4XLLA 4BMSA 2F1KA 4S1NA 1YR1A 2QLLA 3GUVA 3IG8A 5CX1B 3MJEA 3U4AA 3I3OA 1ID1A 1L3IA 4HMOA 1R64A 4TLAA 4ED6A 2PMEA 2RGBA 1NP6A 4M7PA 1WMDA 3GDHA 2PSDA 4QXRA 2FG6C 3L18A 1AXEA 4DMHA 3BAFA 1CB0A 4GLXA 3ZQ6A 2O14A 2WWGA 5DYGA 3ZUPA 2FWNA 2OD7A 4H15A 4LC1A 1GWNA 2JVIA 1T8PA 3NVAA 1ARZA 4JP8A 4G2TA 2VQFB 4C89A 4BE7B 3HADA 1NVMB 5MDHA 1GU7A 1GPAA 2JFPA 2X0JA 7MHTA 2IYSA 1N7GA 4DEXA 5B2EA 3VH2A 2B78A 1JAYA 2GCPA 3X1DA 3PUKA 3C5WP 5DGIA 3M6XA 1VHWA 4E6EA 3A6FA 5ICEA 1T5LA 4B3IA 4FBUA 3GJSA 2PGIA 2OCPA 1BPDA 2R87A 4FT2A 4E2WA 1XVLA 4BVLA 4NCHA 2BDUA 3NAMA 4EUHA 4Y6PA 1LPBB 4RGBA 3CZQA 1RPTA 4LXTA 1D9FA 2GFQA 2PKCA 7ICOA 2OK7A 4PHPA 2IP2A 1HI9A 1XVAA 1BXRB 1TUIA 3V7FA 5KT2A 1EGHA 3F3YA 2A9QA 3DTVB 3ZU4A 4FCVA 4J9VA 4R4JA 3MHPA 2H4JA 1BS2A 4R71A 4FFBA 2CE7A 1IN4A 4Q7LA 1TMOA 1LD3A 1LBHA 1MVLA 1Y6ZA 3L43A 3H2ZA 1KH2A 2KN7A 1U0NA 2VP9A 2OO5A 3UTDA 2WSSA 3WGVA 1M1XB 2OWEA 4Q7MB 1TB4A 2X14A 2WP8J 2JFQA 3N75A 1N6KA 4YX9A 4PZ9A 4H27A 1A1SA 2NSHA 4I8XA 2AMVA 4L7QA 2QTFA 4YC7A 1JEOA 3DZKA 3ZV7A 1T1SA 5BV7A 2FSGA 2FPPB 4OHKA 1S96A 3W2EA 4NAHA 1F2UA 3W1EA 4COKA 2HCJB 1QZXA 1O96A 3YASA 4E5DA 4XE5A 1Q7CA 3FLBA 1KJ8A 4PE5B 4AG6A 5G02A 5AVOA 2ZRKA 3F6YA 2BHSA 3MTJA 5HZMA 3BD9A 3GT0A 1P7YA 3W4JA 3SGLA 3WK7A 1ETUA 1ZNXA 3DE5X 2A1UB 4PIMA 1P91A 1G6KA 1DQZA 3RVDA 4AJ1A 3A25A 1AHIA 5MN6A 1OY1A 3N53A 2BM1A 4YNBA 1LK7A 4YMHA 1W85A 3MRXA 2OZKA 4JVMA 4Q4JB 3GLUA 1RRGA 3EPGA 1JIJA 2PYZA 3FHTA 3X1XA 1T1IA 4NNOA 8ICAA 3T38A 2A59A 1C2YA 4WE3A 1O6GA 4FS8A 2ECQA 2ZFUA 2VP6A 2VRBA 1N5XA 1GGJA 1L6RA 2C07A 1YK0A 3F8SA 4AF8A 1PQ4A 3R7LA 3INNA 1XD8A 5IBRA 5HF5A 2DJIA 4D45A 4D6PA 3ZX5A 2YIMA 3GGGA 4BYGA 3H83A 1NKVA 1JU9A 5JNVA 5KFNA 3GLHA 3I9KA 2X8AA 2VFAA 5CA1B 4JUFA 1KXZA 3WLSA 3IPLA 4XCQA 1N9GA 4OJ6A 1M7GA 1N3LA 5C1IA 3MLEA 4YR0A 1MMFB 4ZQEA 3UT5B 3MMZA 4JWKA 2PL1A 2MHCA 3M0EA 2YDXA 1LQUA 5E9QA 1QTQA 1APBA 1NJ8A 1DADA 3ZDDA 1ZQXA 2GCNA 2DR3A 4GM0A 2B2NA 4L4YA 4O3PA 4JEUA 4B6EA 5KAIU 1RRMA 1GAEO 3GRRA 4HLCA 2HDWA 4BP9A 1EGQA 5IZCA 1SD1A 2FN7A 2CXSA 1X19A 3T7RA 1T3LA 2WVJA 1LZLA 4LY3A 5L53A 4NXZA 4O4HA 4COOA 4RGQA 2EJTA 4V0KA 1NVBA 1T43A 2IE8A 2O7RA 1CR0A 1TYEB 4PN7A 2H92A 4Y1EA 4YRRA 2BFBA 3VGJA 1PBNA 3O92A 1NVFA 5E4JA 3JD4A 4J2HA 2BBOA 1UQUA 4R3NA 1UBJS 2X4LA 1RFLA 5F2NA 1YZFA 1UBMS 1JQBA 2JKYA 4WXYB 2IEDA 4Z6EA 1QE0A 1BKDR 1J1UA 3LC1O 4EHKA 1XRQA 4TRJA 3KPJA 2XMQA 2GXUA 1KEZA 4XPIA 4URUR 3DPUA 1YS2X 4Z9BA 2HJGA 4UMFA 3LFUA 4WXHA 5I4CA 2XJ9A 3R5XA 2B20A 2WIBA 1ZNWA 5HDQA 5AKYA 2I1VB 3PUIA 1JQKA 4WK4B 3UQYS 1XCOA 3UB3A 1KQPA 4MB2A 4RNNA 4F2DA 2EFHB 3OT1A 1DT3A 5CLJA 1H0KA 2B36A 2LWIA 1JAZA 4X45A 5A6SB 2QMUA 1JEAA 1TEXA 4C7JA 2AQ4A 3ES9A 1GPUA 1Z5UA 1O94C 2W8BB 2AD1A 2ZXFA 1KRHA 4AJLA 1GU0A 2X9VA 4EGJA 3QA9A 1N9KA 2AXQA 1I0LA 4RFSB 4Q6BA 2VPYA 1ZU5A 4CEJA 4QUEA 3OOYA 1TQDA 3BJZA 4EY4A 4ZO7A 3DBHA 3OJEA 2I4LA 4X92A 1XNGA 4QFCA 4ZIRB 1WTCA 2OYSA 3H18A 4UVDA 1TM1E 1E66A 1AB5A 3OKCA 2EX4A 1ZH8A 3MT7A 5ELLA 4DNQA 3DTVD 1AM4D 1JAXA 1TKBA 1DKUA 4MCAA 5DULA 1WL8A 3BA1A 3C41J 1R8SA 2CCKA 4DCJA 2O2CA 3KC2A 2R7LA 3KQQA 4QRHA 9LDTA 4O5AA 3UHJA 1OC2A 1YBFA 4PFQA 1BDMA 5KFZA 4MEAA 4FKMA 5GMOA 4ZV9A 4IRKA 2FFBA 1L5LA 4NESA 3WHPA 2GJ9A 2BBSA 3KPWA 5CYFA 3KSBC 1JKJA 5DHUA 4IIBA 2FZWA 3RLFA 2IA5A 4O5EA 4P84A 2VQDA 1K8QA 4I46A 3M34A 3LNCA 1U31A 5DDMA 5AJHA 1T7PA 3P9IA 2JCVA 3L8ZA 4Q1VA 3H2HA 3TB6A 1XDSA 5FBVB 1LU9A 1KDZA 2Q45A 1ZD8A 5F5XA 4R66A 2HV9A 2KD1A 2Q6TA 2R00A 4IP0A 1JPNA 2D2IA 3E70C 5CM9C 1YS9A 4RORA 3UC5A 4Y9RA 4JDUA 1TEZA 1C4OA 2RHWA 4GDMA 4URWR 3SAGA 3CU5A 5J1SB 1P1HA 4QWBA 4JMLA 3OY7A 5FBWB 1NXVA 3EEOA 3NP7A 3WTBA 4INPA 2ZIWA 1E4OA 4B9NA 4RUCA 5ALSA 4DEVA 3Q8PB 1G7CA 2NO1A 3HKEA 5JE8A 1E4VA 4ND8A 3VJRA 3WGLA 3R09A 4X7MA 1W36B 1XVIA 2I66A 1V8DA 4BZPA 3KOOA 4J9UE 1B0ZA 3F97A 1N25A 1QUEA 5EI5A 3SXPA 2MJLA 3RBAA 1X66A 1CF4A 3L6CA 3R6GA 1XLVA 1U2GC 5L3SB 3D7SA 1T9ZA 5IVKA 6PFKA 5JDIC 1UA1A 2Q0ZX 3HH8A 3M9MB 1L7EA 5TPZA 2QAGB 3DQPA 1SEVA 1W5BA 4R1TA 2XYPA 4D4MA 3J7TA 4ADSG 2WJ3A 9ICXA 5DDIP 4IR9A 1NXOA 4EELA 3MWEA 5JU6A 3OTWA 2QY6A 2FXVA 3HA7A 3A9WA 4QRDA 3O3CA 2X0FA 4E6PA 5F3WB 3NYQA 1I3OA 4G0WA 3FFXA 4BX3A 3AEVA 4PO1A 5D87A 2Q7XA 2WP0A 1W6RA 1UOOA 5DSZA 5DNVA 2F9LA 5JV5A 3V8NA 3BZBA 3DTYA 1XNHA 2ECPA 1MV5A 2UVPB 5HRUA 1OT3A 4DV7B 4DFDA 4GQAA 5A9TA 2H07A 2OFWA 4FINA 3GGPA 3MR6A 3FVTA 4L0MA 4TV8F 3ZHRA 5FPKA 3SXJA 3U4QB 1ZHHA 2E37A 2ZRDA 5JDCC 4N0DA 5DGBA 5JS6A 4X20A 1X6JA 1G2QA 4OU4A 1AD2A 5T14A 3FY4A 4Z6KA 4B6QA 4BHTA 5SYAA 4TTSA 2NRWA 2XYRA 3UANA 4YV0A 3UPDA 4PXYA 4NEQA 5AICA 3DCIA 3LNTA 5TSDA 1GQYA 4L5AA 1LPPA 3UAYA 1Y82A 5JVDF 3QYJA 3CBGA 1ZRNA 2CLDX 5AKZA 4M2LA 1QVWA 3SZOA 3I9V6 5KU7A 1LV8A 4MVCA 4DWOA 4ZOBA 2OP0A 3MCTA 4KYUA 2PZFA 4EJSA 1P0CA 4R1LA 3TQFA 2XT6A 4WXPA 3G89A 4ZRDA 4MWSA 4Q3BA 8ABPA 1EP1B 4G1FA 2E1EA 2BUAA 4K8OA 3CQ9A 1H2BA 3JRNA 3B52X 1KZ1A 1YT3A 1Z8HA 4ZVLA 3EAGA 5BR7A 2BKLA 4RXUA 1SXPA 4KR2A 4X3CA 1PV1A 2RK6A 3EY9A 1XDDA 1MAVA 3AQIA 2JEIA 4O4IF 2W42A 2R6GA 1X80A 1T4MA 5IZCC 2LYBA 2C57A 4KBFA 2W11A 5B64A 3CW2A 2UUOA 4G0NA 1VKNA 3SC2A 3FB1A 4IJ5A 4KLDA 4R2JA 3FSEA 4OOFA 4KITB 4PHGA 1MVOA 1PJCA 3F5EA 2PYDA 1BMDA 5C8YF 2PUBA 3E23A 3V32A 1JWBB 4UBLA 4CF3A 1QH8B 5K3BA 4PO8A 2WMDA 3B38A 3PHBE 4A10A 3BVPA 4G0VA 2MIIA 3Q4GA 1N78A 3LK6A 1WUYA 1OW3B 1BHSA 4GI7A 3TXAA 2CMGA 5A5DA 2FUKA 4TVSA 5KVAA 4NDNE 4UMVA 3S0JA 5ITWA 2JFVA 2WD7A 3E7XA 5CK4A 4MYHA 3DXXA 2OPHA 3VPSA 4LXGA 3C6MA 1TMKA 4ZAXA 1NY5A 5JJBA 4MKHA 2YZNA 3JQGB 1Q0QA 4WEOA 4I5DA 3WSWA 1Y1QA 1RVV1 3GIJA 5TZVA 2I9PA 3PS9A 1Q7GA 3IUJA 4IIVA 1MQ2A 3DKPA 4B3DA 3V9AA 1A0PA 2WB4A 4AURA 5KFDA 1W34A 1PG2A 1THZA 1YI1A 2E6KA 3NTUA 4LFAB 4PBTA 4Q15A 5BWOA 3QE3A 3ESQA 4ECAA 3A0RB 3W3AH 3N70A 3BL6A 2J6HA 1ZIDA 5ESXA 1NZBA 5CT4A 2GKSA 5FUMA 2DERA 1K8ZB 3RFFA 3AL3A 2DUMA 1Z00B 3ZV4A 3ZQ4A 2IOFK 4IMIB 4UTRA 3PXGA 5DP2A 3ZK9A 4CBVA 3WP1B 4I8IA 1CEZA 2PKEA 1GSHA 3WBKA 1QR6A 4FZ3A 3SYZA 1T8UA 2Q46A 1MRZA 4XASA 3AI3A 1M66A 3ROXA 2IV3A 2O05A 3TNFA 3HW8A 2KKPA 1W36D 1TA9A 5CMLA 1WUHS 2JAWA 3N39C 5ITZA 1S10A 1M72A 1H8ED 1G8JA 3L7BA 2XUKA 2PQMA 4FYHA 2QSZA 1JHXA 4MLPA 3RFVA 1QM5A 2VSFA 1QRDA 1CUUA 2WTXA 5BRJA 3WHKA 2V5AA 1P3DA 5JMOA 2C99A 2NO0A 2FW8A 4E2FA 3ZWWA 3Q3VA 1ZQPA 5LN1A 4LZOA 2A5YB 3H9CA 2HHJA 3H5WA 2IP4A 3ZD8A 2JGLA 4ZK6A 4HP8A 4FMDB 3PQEA 1KVTA 5CWRA 2A84A 2K87A 3ZGZA 1GL9B 1LRLA 3NDBB 2D2VA 3O4HA 2XV1A 4H3HB 4Z6CA 1VL2A 4MQ5A 3EVAA 4UM5A 3Q98A 2X8BA 5ICSA 2A0XA 1XPRA 1U4NA 2WC1A 4PC7A 1U6IA 4ZOLB 3SQDA 3G6VA 3G6KA 2F44A 1A4UA 2E3TA 1WSAA 4DSJA 1K9SA 3I5YA 1KJZA 5HR5A 2EDAA 3BCHA 1M2HA 1E77A 2PGJA 1KRXA 1KA9H 2JATA 4P38A 4NG5A 5BV1A 4EDHA 4P36A 1HETA 4U6NA 5CA0B 4EVRA 2OV3A 1YZNA 1NZDA 2V3VA 3UWDA 1S2MA 1N3IA 4LJXA 1VIMA 1ESMA 1BXGB 1NW4A 1PFYA 4YVZA 1AXGA 2GEJA 4RD6A 4J75A 1JFSA 1HF3A 4KIGA 4FWIB 2WTNA 5I7VA 3OHSX 2DPGA 4IH9A 3N5CA 1CHNA 3I2IA 3WGYA 1IRXA 2UZAA 5FPQA 4INOA 3HR4A 3ACCA 1LTKA 2QMYA 3T9FA 3LUKA 2A5LA 3R7FA 4RAOA 2WB1C 3ROFA 4F86A 3C8ZA 3ORRA 2P30A 4DSOA 1A5SB 1SBZA 3FWNA 1IOLA 4LNUA 3OF5A 5K4GA 4MQ6A 2ZWPA 1BXZA 5C8XA 2HB6A 3WE7A 1XA0A 2PSHA 5DM2A 2CXPA 3LY7A 4TT3D 5LP1A 1L7VC 4U7GA 4YHHB 3IMGA 4HFRA 5KYNA 2Y1JA 1QS0B 1Q57A 3RSGA 3BXFA 2ZCUA 3B8EA 4BAUA 2KHVA 2DH6A 4XGIA 3LT4A 1FE8A 2QR2A 4DF3A 2PI4A 4LBZA 1YR3A 1PWXA 1LI4A 3F5QA 4WY5A 5JAPA 4LA4A 3UK7A 3D5EA 1XA3A 3ICCA 4YJ3B 3H5LA 2UZ0A 1PCXA 2BJWA 3AR7A 4Y7CA 8ICHA 1XVVA 2C9YA 3JQDA 5D3KA 2VUTA 4QXPA 3I9JA 2LMRA 1DBSA 2IW1A 3QKIA 2UXBB 4AX4A 5AH0A 3UAZA 3Q5DA 1DFGA 2DHRA 3IAEA 4QFMA 3L7JA 4RA9B 3P26A 5DXFA 1DGJA 2RH5A 5A05A 2V58A 4O4JF 4TXHA 1NVXQ 1NPYA 4TXNA 3T99A 5IM4F 1Y5LA 5A02A 1D4AA 3CURA 1X7XB 1IJFA 2P2CA 5F2OA 3NWPA 4YASA 1XHLA 4G24A 3STTA 3NJ4A 3HC7A 4WZBB 3SHFA 1PSDA 3A1FA 2JGMA 3IO3A 1R6XA 3KTAA 3HP7A 4M9RA 1C1HA 3B0YA 3RU2A 1R0SA 3WZMA 2BQ3A 2Q3EA 1TGVA 4EJSC 4EFLA 4XUGB 1XXHA 4BLUA 4KCGA 4OLHA 1X7YB 2J5BA 1EXNA 2OHJA 2PCJA 3DDCA 2HHCA 4RLFA 3VOTA 4EFKA 3ZE8A 3EXFA 1TCVA 3AVQA 1SIJA 4WESB 2CCGA 1VJGA 4G5RA 3LT0A 4MJLA 2IY8A 4J16C 3QOYA 1ZWLA 3Q9SA 1FX0B 1LJUA 4N3NA 4EEXA 1DSSG 2F7SA 3RYFB 5KL1B 2XCUA 2QRVB 2V7UA 4DJAA 3NM5A 2BCRA 3GVPA 5JFOA 3S2SA 1XU9A 5J9FA 2XCOA 4LAFA 4Z8YA 3ZZMA 4P3XA 1G41A 4U6PA 5J2AA 1P1CA 5HMMA 3CCFA 3KAJA 3R5KA 2OL4A 3F6BX 1CJVC 4TWRA 4R9RA 4NL9C 4UHDA 3IUYA 3WYNA 1G59A 1BNPA 3PRYA 4DNPA 1ZOSA 2ZE6A 1GCIA 3JAKB 1OUMA 3ZBUA 2WB2A 1NQOA 5FF9A 3ORYA 3JXEA 3B1VA 2Q5JA 1P31A 1FFCA 2J9GA 5EXXA 4ZAWA 2P7HA 2IUTA 1QTMA 5HHTA 2Y68A 5T6MA 3SVZA 4OJKA 4DL6A 4CUJA 2LCQA 1XSLA 1P4JA 2FWRA 4YB8A 2VA8A 3V7KA 3HUDA 4XWKA 4F92B 1II8B 3G1TA 1M1YB 9ICPA 2X77A 2F3UA 5CG2A 1LW7A 4F2WA 1KRPA 1L7PA 1S0VA 1LJLA 2WAXA 4PEVA 3A26A 4RPIA 1Y1RA 1OFHA 2NTNA 2JGIA 4YRPA 1C3JA 4H7FA 4KFTA 2R8JA 1X7WB 4M04A 2IUSA 5K0CA 4QZGA 5CM8B 1N62A 1DK3A 2REBA 4OQQA 4AUMA 3NG1A 4RVOA 5CNKA 4Z54A 1CRWG 2UZ1A 3ET4A 4BVGA 1E64A 4TL9A 2WKPA 1XG5A 2Z1DA 1G5PA 2XYVA 3DT8A 3RAEC 4JLSA 1L3SA 4ZDJA 4FHDA 5KWVA 1U7PA 2I4NA 1U0SY 3OOJA 3OX1A 4NJEA 5JJKA 3HLKA 2QM0A 4F50A 3ETNA 4M3NA 3BQNB 2ZUUA 1YFJA 4TUQA 1G0NA 4IIUA 2OEHA 1GO3F 3AEQA 2J5KA 4GPEA 4D57A 3OQJA 2VHCA 4Q05A 1M9NA 3IMKA 1OZGA 4QVGA 2KZMA 3VO8A 2C03A 2RGCA 3B36A 4MVJH 2RJ3A 4MWEA 4NONA 5LQDA 4GXKA 3C3KA 5AKGA 1MTOA 5DISB 2EGHA 4W1PA 2JNWA 3KYCA 1ESNA 4K7JA 4ENUA 4BRWA 3OZUA 2QX4A 3L0SA 1HEIA 1Y1LA 2E89A 4GMGA 2GEFA 3LXXA 4L50A 4MZXA 3MFHA 3FKSA 1RRFA 1Z0IA 2QJOA 4BDTA 3ZD9A 3DC7A 3QUCA 4OHYA 1W88A 2BEUA 9ICAA 2QZ9A 1G9TA 2FFHA 3NHMA 1MEOA 4I55B 4KSYA 1UH5A 4HWOA 3N0RA 1LDNA 1KBUA 3C24A 1W4CA 3OE7D 4GYKA 1JHPA 1NLFA 5ICFA 4ECSA 4FX5A 4WFIA 1L5MA 4PTYA 3IE2A 1XTUA 2ZRJA 4BLSA 1X15A 2QM8A 4EKIA 2ZCJA 4M6WB 2ZRNA 3HXLA 1CJMA 4DNXA 5CB8A 3NBZC 1EHIA 1LLQA 3I6ZA 4HPXB 4MFCA 3GIDA 3S27A 3PC3A 3R0XA 3QXCA 3G59A 1H23A 4M54A 1DXOA 3CPEA 1DBVO 4MW1A 2BY4A 2WHRA 2R8ZA 4ZYYA 3LPAA 3R74A 2E21A 1KHHA 1FIQA 2XMRA 1TUBA 3H1GA 2ZANA 4YS6A 3LDGA 5B5EU 4RPKA 2REOA 3KKKA 4ZMBA 3U9TA 1C3OA 4UFOA 2GYYA 1KAMA 1YBHA 1ZQUA 5H7XA 5EY5B 3G6XA 1UDCA 3W5HA 1UDRA 1JN0A 1FSPA 4QEDA 4NV0A 4G23A 1F51E 5K3AA 4C8LA 2ZIFA 3RFXA 3SJ7A 5A6VA 5JH7F 2WYHA 1BE8A 3RGGA 3ENZA 2JAUA 2VZ9A 3JTMA 5ALYA 4M9LA 3CGGA 1GV0A 1Y8RB 2JIOA 4FR2A 4DS3A 2Q0HA 2QJTA 4TT8A 1EFRD 3EIOA 1B0UA 4ZI2A 5KNLA 3GLQA 5IULC 4D26A 3ELWA 1DUIA 4DOAA 3QHAA 4W8OA 5LP6A 2Q1YA 2AQ0A 3CT6A 3QOXA 3ZPXA 2PZEA 1IHYA 3M4YA 1SCUB 2EAUA 2V1UA 2C2KA 2WD8A 2D3DA 1IRIA 4KO1S 2BUCA 2ZRGA 3TJZA 3RVMA 3FWHA 4LTDA 3OTOB 3RJZA 4HNHA 3U7GA 3E1GA 1AMNA 3JASA 1BDJA 3RKSA 2Q4OA 2ID4A 3BS4A 1VBKA 3WBBA 2ICAA 2IZZA 2IU0A 3RASA 5F52A 1V3VA 4NFHA 3OJSA 2OLEA 3PW4A 3ETJA 3DDHA 3GGOA 3PJGA 1AUXA 3KB6A 1D4ZA 3BORA 1MQ3A 3SQMA 4LOHA 4JU8A 2W2VA 3G9UA 2BCVA 3IKMB 1KN5A 2ASLA 1WHTB 1V9PA 7ICPA 3FMFA 4OA5A 2OCBA 5KSZA 3D02A 2CWDA 1SB8A 3FNQA 3KHSA 3I61A 3PD7A 5CBPA 1E9FA 1R2QA 5FLKA 3FPAA 1O9GA 1KEKA 1BG6A 1PS0A 3RUIA 1EXMA 1WULS 2OKCA 4HMPA 3UEOA 4OXYA 1F7UA 4JQCA 1TGYA 1A9RA 2JG3A 3VC8A 5KT7A 2P9GA 3KU1A 3PX6A 3FZEA 1GILA 1Z9BA 1UANA 3RUAA 4UTZA 1FSZA 2I4TA 3D6UA 1T4GA 8ICTA 4I3FA 1XTTA 1AKMA 1OKKA 2VUUA 3OZ7A 2COUA 3AFGA 4Q4HA 2W71A 4G1BA 3BGWA 2SHKA 3HEMA 5LQNA 4BGDA 4KACA 3NALA 3DG9A 5L1MA 4ZZ1A 4URYR 3AMZA 2YVUA 1J06A 3LWLA 1PNOA 2TMDA 2O8CA 2IYXA 2JLRA 3FMOB 1C7QA 1B0PA 3H19A 1EXDA 2QW8A 3DC2A 4HEA6 3ETLA 4XEHA 4E1AA 4DO9A 4BB0A 1F17A 2VEDA 3VPXA 4A0GA 3BRWA 3PKIA 2BZ0A 5NLLA 5EXEA 5A1JA 5EMJA 4WNCA 5LZ2A 4TV9B 2NAPA 4WRRA 1UPCA 2D13A 5I7WA 1HDXA 3QU4A 3B1JA 1T2NA 2FZKA 3WYAA 2A86A 2J9FA 1MC5A 5L3ZA 4PGHA 1NIPA 4ISBA 3RO7A 4MB6A 4MB0A 3IDFA 1ZAKA 5K3SA 4MTLA 1P3Y1 2B3TA 2NTYC 3WB0A 5ALQA 4GC7A 3NASA 4JQZA 1VYUA 4RT2A 5J2TB 4W5WA 4PSCA 2BDTA 4OHOA 2V8BA 2NQTA 2ATLA 3R2JA 4D42A 4ITUA 4O5KA 2RBEA 4TYNA 4NULA 3ER9A 3O7WA 2IH2A 3TIXB 2O2EA 4LHWA 4L9SA 1OXTA 1QKIA 4ERNA 3QVUA 1P9LA 4YRQA 2H4YA 4H08A 1ULBA 3I72A 5J2FA 4CLHA 1LLFA 4HATA 3KT8A 4HBGA 2H7YA 3VNUA 1U3WA 4UEKA 1GFIA 1KOLA 3SS9X 1HFKA 3S55A 2IV7A 5DWDA 2J3HA 2J08A 4C4XA 4BGVA 3PSAA 3H5RA 1RXEA 2Z4RA 4KXNA 4WZAE 2C2OA 3CWCA 2QL9A 1NX9A 1CKEA 4KBGA 3PLAE 2NUAA 4JGBA 1Y34E 4NARA 1E2FA 1JU4A 4IIEA 5DB6A 4GQBA 5BN4B 4V38A 2FW1A 1X7ZA 5K3EA 2AOUA 2GNOA 2VKTA 3TNLA 2NTEA 1RWNA 4G0PA 2JMGA 1KVUA 2GBPA 4UC0A 3COSA 3QG1A 3FW1A 3OZVA 3OIWA 3IOBA 1H2EA 3QKWA 4B3RB 2DPHA 2QR3A 3M70A 1XP8A 2YOGA 4ZYWA 3ZTTA 3M9NB 2GXAA 1GADO 4OB6A 2O2HA 4EL5A 3UOWA 2J0UB 1G55A 4B9UA 2R68A 2G07A 3DNPA 3PNLA 3W2HA 4S35A 4DZZA 1QSLA 4BP8A 1I32A 4Z1MA 1OX4A 4BKQA 2ODWA 5HJ7A 3UAXA 5I8PA 4GOLD 1NYTA 3WSTA 1N2IA 3EW9A 1A76A 4D1YA 3DUFA 3FYUB 2OBMA 5T67A 1IAQA 4BTVA 4I1OA 4EZ9A 4C9BA 2ZE7A 2BEWA 2IGTA 4LE0A 4KMMA 3S1LA 4HNSA 1QGED 1HUZA 1AUQA 2CD7A 2AJCA 3U6BA 5I4IA 4MR9A 3L4PA 1JEJA 1TIKA 1LC3A 2ZYAA 1W96A 3PBKA 3AN1A 4BWYA 4BQPA 4IFIA 1R15A 1B23P 4O9MA 3NOVA 3GLIE 4GG1A 4B4VA 2O0LA 4L8VA 1YB6A 1JI0A 2ZITA 3WRXC 4JEIA 4Q4AB 4H0CA 4O0LA 4TS3A 4BVHA 3TZ6A 2FHSA 2IX3A 4EKGA 4RIHA 4P3KA 3K1AA 2X42A 1JX4A 1XAJA 1PZXA 3GZNB 5IUKC 2HI0A 5B2ZA 1A8UA 1A5AB 1QNLA 4QODA 1MRSA 4OJYA 2AJLI 1KKLA 1ZSNA 3Q0IA 5ES4B 1JIIA 2P0YA 2WIFA 1ZXIA 3FHCB 1GL7A 4DLRA 3U7EB 4C0BA 1OW5A 5B7PA 4N0EA 3VU0A 1RLUA 4FHEA 1XMOB 2I2CA 1SU7A 3LPNA 2QTZA 3HSKA 3B1WA 5H02A 2HU8A 5KJFA 1WSBA 4CMHA 3W6ZA 4F4IA 1WUIS 4IXWA 2O8FB 5KVSA 3FNEA 1VDVA 1C0KA 8ICWA 2WMNB 1A7UA 4OXKA 4IJKA 3JPNA 2OHHA 4N6OA 4L78A 1BAPA 4ILKA 1TQ8A 2GZMA 2PZKA 5I9IA 2C61A 4YD2A 4CM8B 1EG7A 4UQOA 1MAAA 2B4RO 3HKBA 4CQMA 3HY4A 1W6UA 3BD6A 1IPFA 2VAWA 5H9VA 4WD3A 1N0IA 1DOZA 3HVJA 1RBYA 1WMFA 1BPEA 2BH2A 1D0SA 2JC3A 3G2PA 2OXCA 9ICCA 5LQMA 1EP3B 2XR1A 1NNEA 3ABQB 3JQ6A 1F5NA 3GPDG 3MWFA 2HZ7A 1RP7A 5ALFA 2W6QA 2HMUA 1JPJA 3CONA 3IOYA 2C04A 2VYNA 3TINA 4II3A 1WB9A 3GFPA 3VNAA 4O2AB 3OZGA 1KI9A 4BASA 1NKBA 1SV0C 1H2AS 2OOKA 2NQ2C 2JGKA 1YZLA 3Q88A 1RXYA 5J2KA 5I9TA 3QRWA 3FVVA 2HCTA 2QXUA 1PU2A 1V3TA 2VHVA 3OVMA 3SBXA 4EM6A 1T6BY 3C5HA 3THXB 1MHTA 3MZ0A 1DOQA 1EGMB 3PLRA 4UAGA 1QU2A 2H0RA 2PZ8A 4U9UA 4PLZA 2R60A 3OZTA 4GLBA 2ZM5A 1REQA 1YQ9A 3BCUA 3TNDA 5HX7A 2MYNA 4ZO4A 4KYTA 3KZOA 2VA9A 4OPMA 4YRFA 3H9UA 2YZ2A 3EA5A 3IE1A 1P7CA 4PZLA 1YA4A 3CNNA 4JA0A 1Z22A 4KLUA 4UQGA 1CQJB 1D2HA 4X54A 4E70A 5TV2A 3NMUF 1ORTA 3A6HA 1EDOA 2WA1A 5BRAA 1WUKS 3IDWA 2HHLA 1T0BA 3AL2A 4JJ4A 3P19A 2V0GA 4HH3C 4UBMA 2WWTA 5CBKA 1DXSA 4JFAA 3FG9A 4QD3A 4MXDA 4ZJUA 3NIGB 5FR1A 5ALPA 4XA8A 4D99A 4KLFA 1KFDA 1GCOA 3JARA 2IDKA 3D2SA 3QX8A 3PJEA 3PSPA 3NATA 1WP4A 7ICKA 4YV2A 2ZAYA 1VMAA 2QUBA 2IZ7A 1YVDA 4BFWA 1ZMBA 3PC7A 2K4EA 3EVDA 3IEIA 4HUQB 2DQYA 3C98A 4C6RA 3WO0A 1C50A 1EFCA 3D64A 2XTJA 1YI8A 5EKXA 4K9MA 2QX8A 4ACOA 3KJEA 1R27A 3CVXA 1U2GA 1QO0A 1M2FA 1TTPB 5JDIA 2J48A 3NVVA 1JG1A 1JDTA 4ARIA 2XICA 1RRPA 3FPHA 2PMBA 4XDGA 1VJCA 3T52A 1W0KA 4K9QA 3JY6A 1QYCA 1P2SA 2PKRA 4Q9HA 1TK8A 2QLBA 1YOVB 2VBGA 4D0LB 4C8OA 1XCGB 4J9QA 3CV3A 5BV0A 4JB3A 2QVLA 1L5QA 1E4EB 2P75A 5IVDA 5KFYA 5EKDA 2B4AA 5JPIA 1UODA 3W8EA 1WQ4A 3D6NB 1NI4A 3AVVA 3PEFA 2PNJA 4Z7JA 1SIWA 3PNOA 5JD4A 3UJNA 4ACAA 4Y2UA 1Z7BA 1IXSB 2UVVA 1RTKA 3GLFE 4F56A 3OZEA 4KVGA 4RD4A 2NVBA 3SHOA 2ID9A 3Q40A 3OZWA 2J09A 3D3WB 3GRFA 2YWCA 3KJNA 1YCHA 1RWOA 3E18A 5JDCA 4JQSA 4X63A 3LWDA 2F43A 5DEOA 3ANNA 1EP2B 3A0BU 2G9ZA 4CMBA 5EG5A 1SB3C 2IEYA 4MPJA 5EWJA 1Z2CA 3WGNA 2B69A 3CIOA 3SEZA 2QVBA 3ON5A 2AMJA 2WSMA 1I13A 2OZEA 3PDWA 1ZJNA 2FFQA 3DGFC 5KHAA 3ESRA 1MEEA 1ODJA 4F5YA 3ZGXA 2ZI6A 1T8YA 3NPMA 4YRGA 4M8NE 5JQWA 1M33A 2O8EB 1FP2A 1LKZA 3R6WA 1WRBA 5KDOA 3DMHA 5B58C 4J7XA 4QULA 2W43A 3O7MA 2RIPA 2RHFA 5CHGA 4X66B 2Z1MA 5EXTA 4UCWA 3GX1A 1Q7EA 1CR2A 2YY7A 4CKYA 5CCDA 2DL0A 1YDEA 2PX8A 3SV4A 1RADA 4P93A 4NENB 3ICWA 4EYIB 3IIMA 1FL9A 4KX3A 1Z2PX 3E03A 1IHOA 3MBOA 2HW8A 3WGGA 3DAFA 3ZV3A 5J2GA 1S8OA 3W6PA 4US8A 4BNUA 2B5OA 3F8TA 2PO7A 3CZ5A 3RHTA 2ISSD 4Y2SA 4XAQA 4D79A 2DPIA 4FEYA 2PG3A 4M9XA 1W48A 3BJMA 1V2GA 3V7WA 5BY2A 1DDIA 2VJLA 3BMQB 4ES6A 2Q2QA 1OXBB 4S2EA 3AIIA 1RW4A 2Q99A 2M9MA 4L02A 2GBLC 2HO5A 1KY5A 2P35A 3K9CA 3AETB 4F72A 3C1OA 1Z4JA 4ODIA 3N76A 3COZA 4L72A 2XY6A 1MB0A 3RFUA 4PCLA 1TJ3A 3RDPA 3VZSA 5LQKA 1JL3A 4D82A 1PK7A 3L6BA 2XE4A 4W5NA 1YU6A 3PVXA 1UWVA 3G68A 2L2QA 4P53A 1L2TA 3ZOKA 3INYA 4MKZA 2XF8A 1ADYA 2VK8A 1QG2A 4R0MA 2QRJA 3MINA 1GZ5A 3DR3A 3KCNA 3L6UA 2BJHA 5AW9A 3TE6A 4A1FA 4W5RA 3LJKA 1Q6YA 1BA3A 1K88A 4F5RA 4FD3A 3VR5D 4B34A 5DGAA 1IZ0A 4LCJA 3JWHA 1PNVA 5BPHA 1D5WA 3AVPA 4RS4A 3LK9A 1T9HA 1J8MF 2XVMA 4M60A 4PG6A 2NYRA 3A1UA 4G5YA 1NP3A 2J4DA 4H7EA 1ISSA 2QP4A 4JOCA 2VDRB 4KODA 3B70A 2WWHA 3W5AA 2R47A 2N47A 5BR4A 1AURA 3SJUA 2GHTA 1R5JA 3A4YA 2Q5HA 1GTL1 1H6BA 4KZPA 1NJFA 2I2DA 3A9SA 5FPYA 3INGA 5I8ZA 3PX0A 2WG2A 2VRWA 3K75D 4MIKA 4N18A 1P0FA 5ERGB 3K9BA 4IQGA 4I9UA 2XZOA 4HNAA 1L5KA 3QLUC 4F4XA 3WMFA 3ZIAA 4MLZA 2HSGA 3G88A 4J1QA 1HY3A 3QXGA 1LWNA 1O0SA 4G1CA 2RHGB 1G2OA 5E79U 1P9NA 2B1RA 4HYYA 4Z0TA 5TARA 1GD1O 4I4TF 4ZVOA 5AW0A 2WABA 4JUIA 3TXYA 4K6HA 2ZAMA 4D92A 4QG3A 1WZEA 3R3UA 4ECEA 5DGDA 5K0EA 1I6KA 1L7NA 1TAMA 5FJIA 3FM9A 2BGWA 1ONBA 3SZGA 5IKOA 3NHFA 3UAOA 1O5OA 4X93A 4F6LA 3AY3A 3ZHVA 2L82A 3EIHA 1S5LU 2ZBDA 3WGJA 2P68A 5L4NA 4HDKB 2QUZA 1AKRA 3EVFA 3M4JA 1Q0ZA 3NB0A 1E6MA 4BCBA 1L8QA 3UUWA 3VSBA 4EF6A 1LI7A 2PMZC 3LQFA 5F73A 1OSNA 3TAQA 1Z74A 4BJHB 4ER3A 3NVWA 3GFRA 2XOXA 3VU3A 1L1QA 1NQTA 4GZMA 2HHVA 3WI7A 5CAEB 4BWGA 3OE1A 5IUJC 2I6SA 4Y6RA 5A5GA 2FPWA 3JZAA 2YXPX 4RSMA 1C1DB 1G64A 3IP4B 1NU6A 1W0JA 2C5FA 1C8VB 2G67A 2OMKA 4J3JA 1GR0A 2C3YA 1MDFA 4IBOA 4NH0A 1YIAA 2NXEA 2OCLA 4PSVA 4FFSA 4GWGA 4J90A 1WDMA 5TNXA 1VLZA 1MKYA 3V7YA 5CFMA 4DFKA 4LPSA 2CXQA 3DEHA 4ZQIA 1AC5A 3WY9A 4ED2A 2DXIA 3L40A 5T8KC 5KYTA 1AKTA 3F9CA 2NN3C 1TAUA 1L5RA 4WBXC 4D4IA 5EXPA 1CFZA 3U40A 4BNZA 1MC8A 4NX2A 4E3WA 4EFMA 1V8FA 4R05A 4WBNB 1TU0A 4OOEA 3ROKA 1WU7A 4JXXA 3HDTA 2D4AA 3G0DA 2IEAA 4JT2A 8ICOA 1H85A 2JJMA 3P2IA 1BW9A 1QIDA 2XB9A 4XB2A 1OROA 5FOTA 4F3KA 1TLTA 4M0PA 4YCMA 1V41E 4O2BA 4L4SA 521PA 2FU5C 4CU2A 4Q00A 2V0CA 1POXA 1UF9A 4QUBA 1A97A 2QE7A 2QKQA 1U99A 2ISCA 5KVCA 4GOJA 4D25A 2FJ6A 5JS1A 3LCMA 4V3BA 4FB5A 2QAJA 3I73A 1Q0HA 1AGYA 3BMOA 1O7JA 5KNIA 1E3JA 1R1DA 3RSZA 9ICTA 2RB5A 3FXAA 1P1RA 1XZFA 3KXIA 3QSGA 1U9CA 3WLKX 3BMCB 1GKUB 1YNOA 5HIIA 4Z4QA 4F93B 4UUPA 1WOMA 1NSTA 4QZ9A 3MMPA 1V71A 5KVQA 3JU3A 4CMIA 1Z82A 2W2KA 3LUHA 5ECDA 3FWKA 1M34A 2CVOA 4V0SA 1SKSA 2PUTA 1JQ5A 4O08A 3V7LA 1WDKA 5HPYB 3MBKA 1SCKA 2AX4A 3UA3A 1L6IA 4YMGA 3TRDA 3BIJA 4FFOA 2HHQA 2OV6A 3EZYA 2XB4A 3G2JA 3QPDA 3GO4A 4ZGBA 2H3FA 4YUYA 1BRTA 4PNHA 2HTEA 1JG2A 3DZBA 2E6UX 1QOQB 3H5AA 4PW0A 3AEYA 3UNXA 5JYEA 1C3VA 4DR4B 2H4WA 3W9YA 4TL7A 2PDAA 1M75A 4X3PA 3MR2A 2CJWA 3GRYA 4QZCA 4NZ9A 2J5XA 3UJ7A 3VGPA 3HUFA 4RHYA 5EZYA 3JSXA 4NYMQ 3MWYW 2AZDA 3WDKA 4TQAA 5FTWA 4BGUA 3JW8A 5TEWA 2W9XA 4BV9A 1K89A 1ORHA 4J16A 1X87A 5CT5A 3GT7A 4UZSA 3QU9A 3B6MA 1W8DA 1GVNB 1A5ZA 5D7BA 4CT0A 4IW3B 3JAWA 4BP3A 4AZSA 4NNJA 3O6VA 1GNLA 3T54A 3H05A 4A8HA 2EKDA 3LQKA 2X5KO 1BS1A 5FYDA 4KNYA 1L4HA 2G77B 5CB4A 2PFSA 3GA5A 5BT9A 3JQAB 2PRZA 4P82A 1U7OA 1M2OB 5IJ9A 3K6SB 4KPYA 4NL9A 1X0VA 4QAJA 1RJ9B 2YXBA 2P3OA 4MDEA 4REMA 1EGAA 4GO1A 5AI4A 2FPUA 2NU9B 1WSDA 1N2CB 2Q3DA 1IM2A 3TIGA 1ND6A 4P4SB 3WS7A 5EUMA 5LA6F 5FUVA 2XA2A 5LCXA 1TPZA 1QQBA 1CUGA 4KI0A 1U2RA 3TEJA 3R5FA 4MQFA 3SR4A 1I2ZA 1CYEA 5LLTA 2NO5A 3MB5A 4YJ2B 2KK0A 3EGEA 1I36A 2YYSA 4FMCF 3W2TA 3BCSA 4UAVA 4RU9A 2BI8A 4DDKA 3IULA 1R6TA 2E55A 3PEYA 3HEBA 4LMPA 1F0YA 4R5HA 4DF8A 1EUYA 4OV6B 1XEWX 4B3HA 4W9NC 3PDIB 3OJOA 2XD4A 1ZQKA 2G9RA 4GPAA 3QA3E 1ZQVA 3G7SA 2QUHA 2NUBA 4FOTA 2IEGA 1O0BA 2YWJA 3BZCA 2VJKA 3NANA 1GSOA 3DO8A 8ICLA 1ZN7A 3RJIA 1RM5A 4HZUB 5TF0A 4RMJA 5E9JA 3HB0A 1Q16A 3LP6A 5G1OA 5E6RB 2ILVA 2AXPA 2LI6A 2ZIXB 2WUFA 3JD2A 2BR4A 3B7WA 3VR6A 2L42A 1GVHA 1PK8A 2QVZX 3HGQA 5CJPA 5LFAA 4XVHA 1E2GA 3OIGA 1ATZA 2DLDA 2DULA 3FMVA 3R8FA 3VZDA 4NJ8A 3EGVA 1AK2A 2XOKD 3QPBA 2JD0A 3H16A 3T5PA 4NBRA 2J3QA 3PGKA 1NRXA 2A0KA 2REQA 2YV1A 4Q82A 4EI9A 2AI3A 4V0MA 2BHNA 4RABA 3SS7X 3NUZA 1CQWA 5C51B 2CV2A 2Z8ZA 4QPDA 3JSAA 1UPAA 1KE1A 1IZ7A 3VAYA 3DYBA 4BFSA 5G0VA 3M1YA 1PV4A 3SF0A 4GZ6A 2QP3A 4DSLA 3BF8