4EELA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound citrate and sodium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
229
structure length
229
Chain Sequence
DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-phosphoglucomutase-related protein
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
source organism Deinococcus radiodurans
total genus 81
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eelA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eelA01
2FPSA 4C4TA 1RMTA 3N28A 5AKZA 2RAVA 5AW8A 3WGVA 2QLTA 4UATA 4C4RA 3ZUPA 1U02A 1LTQA 1Z5GA 3N07A 3QLEA 4KX5A 2VKQA 3U7FB 3NANA 2JAOA 4CE6A 2RBKA 1O08A 3KC2A 5A3QA 4DWOA 2G09A 3QX7A 5ALOA 2FPXA 5ALJA 2ZBDA 4EX7A 4MWOA 3AR8A 4QJBA 1QH9A 1WR8A 2P11A 2B1RA 2YY6A 3WK9A 2IOFK 4L6AA 1QQ5A 1NRWA 3L8EA 3B9RA 2HDOA 2C9MA 3R4CA 4B6JA 3MPOA 5AM2A 3DAOA 1Q92A 3L0BA 1RPZA 3L5KA 4Y2UA 2YMMA 5ALNA 2I34A 1RQNA 3OCZA 3U7EB 2JAUA 3MN1A 3DDHA 1L8LA 1ZD4A 3OCXA 5AI9A 1RKQA 1YV9A 1Z4MA 5AW0A 4UAVA 3R9KA 1Z5UA 2FPRA 3F9RA 3P96A 4HGQA 5AVVA 1VFPA 1ZD2P 5AKLA 3EF1A 5AK6A 3L8GA 5ALZA 2C8KA 4Y2XA 2G80A 4HGPA 3ZW7A 2OYCA 3FM9A 2C4NA 5AI6A 4HAIA 2OBBA 3HYCA 4Y2TA 4XOUA 4Y2RA 4BKMA 2JARA 5ALPA 3OCWA 4L6CA 4UAUA 4NWIA 5AK5A 5ALYA 4Y2JA 2Q5EA 3AR3A 2WF8A 4XPZA 1WVIA 5AKIA 3UMGA 1RLOA 4KYTA 1ZOLA 2YMPA 3KOOA 2PQ0A 2R8EA 4EENA 2ZG6A 5IT4A 2IA5A 4GIBA 5AM3A 5AVRA 2NO4A 2Q4TA 3AR5A 2FUCA 3WKCA 4OD0A 2ODAA 3NAMA 3QUQA 5AVTA 4YIKA 1JUDA 4RESA 5JJBA 3DV9A 3PGLA 5AICA 2I7DA 1IWOA 5AKEA 2YJ4A 3B8EA 3EF0A 3OPXA 2WM8A 4BX2A 3S6JA 5AIBA 5AKGA 3ESRA 1ZJJA 4HGOA 5ALVA 3PDWA 3QGMA 4Y2SA 3AR4A 3I6BA 5ALRA 3SKXA 5AKXA 1TJ4A 4CF3A 2B1QA 1NNLA 3QYPA 1YNSA 5AVXA 3IJ5A 1XPJA 4BX3A 3KBBA 1TE2A 2YBDA 3WK5A 2B30A 3SLRA 5AM1A 2AH5A 2HCFA 2ZBGA 1Q91A 5AKKA 5AVSA 5AK4A 3AR9A 4UMFA 3SF0A 2HX1A 4Y2VA 2HF7A 3QNMA 5ALKA 1L7MA 4HGNA 2ZBEA 3ZVMA 4YCMA 3WKDA 3EWIA 5AESA 1SWVA 4BEWA 1Z4LA 2B0CA 3ONNA 2YMQA 3U7GA 3AR7A 3E81A 1ZRNA 3L8FA 4UMVA 2BDUA 4PNHA 3N1UA 2G0AA 2HF2A 4DCCA 4Y3UA 1NF2A 2MU1A 5AK3A 1CR6A 1T9ZA 2FUEA 1U2TA 2ZOSA 4L57A 3N5KA 2B8JA 4OHFA 3NIWA 3SMVA 5IT0A 4YH1A 1L7OA 3QU9A 1RRCA 1ZRMA 4G9BA 1PW5A 3NALA 5IS2A 1S2OA 5A3SA 2OM6A 1EK2A 1N8NA 2GMWA 4OFZA 3ZX4A 4UU1A 2GFHA 2O9JA 1VJRA 4DW8A 4EX6A 5AVQA 2AMYA 5ALTA 3UM9A 4E88A 5AW6A 2YJ6A 3R09A 2O2XA 2X4DA 1J8DA 2DQSA 5AW2A 3NRJA 1SU4A 4UMDA 2FI1A 3PGVA 4AP9A 2G06A 1L7PA 2CFTA 2GHQA 3RF6A 4IFTA 1F5SA 2WF6A 4OCZA 1TJ3A 3WGUA 4BEVA 1FEZA 3B9BA 5E0OA 1VJ5A 1RKUA 3BWVA 3CZ4A 1ZD3A 4UW9A 1YJ5A 3GYGA 3M1YA 3OCVA 2JGAA 5AKHA 4UM5A 2C8LA 3ZWDA 5AHXA 3ED5A 4UASA 1KYTA 2WFAA 3L1UA 4IG4A 1CQZA 1Z4PX 3L1VA 2W11A 5AI8A 1Y8AA 3A1DA 4ZEXA 5AW1A 3E58A 5AM0A 3U7HB 5AM4A 4UMEA 1SWWA 4I9GA 3WK4A 2YJ5A 3L0YA 5T41A 1EK1A 5AIAA 3U19A 1ZD5A 3WKBA 1QQ6A 3ZTYA 1QQ7A 2WF7A 4KX3A 1ZS9A 4O8CA 5ALXA 3W5BA 1K1EA 3AR6A 4MUMA 2G1AA 1Z4OA 5AVUA 2B82A 3J7TA 2PR7A 4RETA 1RQLA 2BDEA 3IB6A 2WF5A 2WHEA 3U26A 3BA6A 2I54A 3EPRA 3A3YA 5AW5A 5A3RA 2W4MA 3MMZA 2D2VA 3MC1A 3I1YA 3OCYA 2FEAA 5AW4A 2PKEA 3FGOA 2P27A 2ZBFA 3QU2A 3FPSA 4AS3A 3W5DA 2HOQA 3ESQA 3N8GA 4F72A 4HGRA 2P9JA 1RLTA 2CN1A 1O03A 4H1WA 5AVZA 1RMQA 2EAUA 3K1ZA 1TA0A 2WF9A 5AKJA 2C88A 3NUQA 3L0CA 3OCUA 1AQ6A 4C4SA 3QXGA 3W5AA 3WK7A 5AI0A 4YIHA 4GXTA 3ZVLA 4ZEVA 1S8OA 5ALUA 3FZQA 1T5SA 2R8ZA 4FE3A 3TLMA 4YCLA 2B8EA 4XE5A 2RARA 1MH9A 3M9LA 3WK8A 1LVHA 1L8OA 3KD3A 1WPGA 2IOFA 2HI0A 3ZI4A 3E8MA 3L8HA 4NABA 2GO7A 4CNQA 2R8YA 4AS2A 2P69A 1YMQA 2BY4A 4UU0A 3WKAA 4BYGA 5FP0A 2I55A 3ET5A 4NV0A 5AI4A 3AR2A 1X42A 1RMYA 2MSNA 2HO4A 2RB5A 2OA0A 3ZU6A 2YN4A 3HLTA 1T5TA 5AW9A 2G07A 2EARA 3UMCA 3ET4A 4I9FA 3WK6A 1XP5A 2EATA 5AW7A 1YDFA 4BNDB 3QU4A 4BNDA 1RDFA 1L7NA 1Z4JA 3FPBA 3ZTWA 2R8XA 4Y2QA 3W5CA 2CFRA 3DNPA 3QUTA 4J03A 4NAVA 4KNWA 1WZCA 5ALMA 3SKYA 4Y2PA 3A1CA 3RFUA 5AKYA 5ALLA 4EELA 3D6JA 5ALFA 1RC8A 5AM5A 4BBJA 1RLMA 5AW3A 2NYVA 5ALHA 4JB3A 2YFYA 3ZWKA 4NFLA 1J97A 1YS9A 1XVIA 2HEGA 3A1EA 4KNVA 3IRUA 4CF5A 3KDPA 5AI5A 4J2TA 2G08A 2FPWA 5AVWA 2I33A 4UM7A 3I76A 3SD7A 2QYHA 2JAWA 3E84A 2IOHA 1TJ5A 1QYIA 3WKEA 2NO5A 1U2SA 1RKVA 2I6XA 1Z4QA 4CF4A 2AGVA 3FVVA 1U7OA 4YCNA 3OTQA 3QUCA 4FFDA 3KZXA 4XQ0A 3SHQA 4EZEA 3L7YA 2FDRA 2YJ3A 2IYEA 4JDPA 4F71A 1Z4KA 1N9KA 2Q4RA 4Y2YA 4HYTA 2AUTA 3VAYA 2HHLA 4FYPA 1U7PA 5AVYA 5ALIA 5ALWA 3QU7A 5ALDA 2HSZA 2YMLA 5ALGA 4G63A 2FPUA 4ZEWA 3CNHA 3QU5A 1Z4IA 3ZX5A 4BX0A 4KN8A 3UMBA 4YGYA 4DFDA 1L6RA 3NASA 1Z4NA 4EEKA 5ALQA 3QUBA 2W43A 5ALSA 2CFSA 2ZXEA 5ALEA 3U13A 3ZVNA 3PCTA 4QQFA 2GHTA 1Z88A 3I28A 4UARA 2MU2A
chains in the Genus database with same CATH superfamily
1Z5VA 2WTFA 1ZU5A 1AB5A 3K8YA 4KHZA 2YR0A 4BV3A 1WG8A 1XEXB 1E66A 3KWLA 2VCHA 1Y48E 3LDUA 2G1PA 4YYZA 2XA2A 3BRSA 2QU8A 4UTVA 2EC5A 2X2EA 4DMRA 2DQZA 1C29B 2PMDA 1N2BA 4LHSA 5CJJA 2FGKA 5C31A 3L9WA 2B6HA 3TTTA 4AYTA 1BDHA 1QOQB 1RCFA 2V1XA 1PR6A 2W6QA 2YJZA 2B8TA 4KXQA 4K9RA 2C4TA 4EF4A 4G36A 3TZCA 1EK6A 1QFZA 4BVHA 2IZ6A 1W87A 1ADYA 2H2DA 5COBA 4F7WA 2ZR9A 3OAAD 5AI9A 1JDPA 1JT9A 2QB0B 4LJSA 4UAVA 3PXAA 5LLDA 2EBHX 4FM9A 2AK2A 4YMLA 1UP7A 4JFAA 3P9SA 4ZODA 5ANRB 3GFPA 2Y0EA 4XSGA 4J3FA 1JBKA 1RXSA 4JLJA 3NJ8A 3T35A 2NOAA 2RHDA 4INZA 3SQIA 4MV0A 3H9CA 1FLAA 1OVMA 2PX6A 1CQPA 3MZ0A 1C7ZA 8ICHA 3V1NA 3IP1A 5KFWA 3GDFA 4ZT3A 3GEPA 2M6LA 5EWJB 2X9LA 2ZRIA 3AI2A 2YUIA 4QZEA 1ZD9A 2G5CA 2VDVE 1UPCA 4AG5A 3WJ7A 5E9QA 2O50A 3HCWA 4I08A 5CH3A 3QLUA 3OHMA 3WNVA 1RP1A 3I3SR 1SQ6A 3CWCA 3LDGA 5BSKA 4RFSB 3IT1A 4L7QA 4D9GA 2H5LA 1T0IA 4G1VA 2Q6KA 4UXIA 2QRQA 2MR5A 4XR9A 3IJEB 4W63A 4O6VA 2AEMA 2NTJA 2OMKA 4G5GA 3B13B 4JMLA 2KK0A 3MCAA 4CF7A 2QT0A 4RIGA 4HLUC 1RYMA 2VK1A 3FDJA 2YVKA 4M8LA 1Z82A 4H0NA 3WLMA 3LE8A 1NDUA 4KQEA 2Z7JA 1ESMA 1OTYA 1A8SA 2OZPA 3N0WA 2JEGA 1I3CA 3IVAA 5U4XA 2IE8A 1Q7RA 1H1TA 3NUZA 3SZMA 1DBQA 1M8KA 3UOAB 3MRVA 4UNQA 4CV0A 4AY6A 4MW7A 1IHXA 4ZOLB 5LA6F 3Q2KA 3OIFA 2EDUA 4XWTA 4ZEXA 2W22A 3C3DA 4OQ4A 1ONOA 4RJIA 1W85B 3GARA 2JGDB 2OV6A 3CWZA 2OAQ1 5ALXA 4DCTA 1O97D 2VCEA 3M70A 1Z22A 1KVTA 1NY5A 3NHSA 1EE9A 3RSHA 5I5EA 2UVVA 3TMKA 1BZYA 3HWSA 1VL0A 3Q0IA 3WRXC 1YFKA 3WOVA 1Z13A 4G9EA 3H0EA 2YIVX 3HNPA 3K8ZA 4A6XA 2K87A 1AXGA 2Q62A 4M36A 3EMDA 1J9GA 5EHGA 2WZBA 5HX7A 4X64B 5CP8A 1W25A 2ERXA 3BRWD 7ICRA 1ZM9A 3MOGA 5D1NA 3NHZA 4AS2A 3FTFA 4AIRA 2BY4A 3GX1A 5DBBA 1SCBA 2FW7A 9ICSA 3PGKA 1GJRA 2ZXIA 4BJQA 3TLAA 3USCS 4JVOA 2W54A 4Q9NA 1FSFA 4OJYA 4NJEB 3UA3A 1UMCB 5CDTA 3BYZA 5E1MA 2BISA 1KWKA 3D4LA 4Q6WA 1YVUA 3JVEA 5K45A 4B9TA 2IC5A 2QMUA 3HO6A 5DHAA 2H1FA 4JQCA 2ODGA 1SB3C 4G6ZA 1FJHA 2QGNA 3BH6A 4LNUA 2IX3A 4REQA 2QSZA 2ZETA 2DFDA 1X2EA 5EZYB 5KG4A 2RRDA 2UZ1A 5A1JA 2GM4A 3N86A 5K0CA 2VJ5A 1D9ZA 2P2NA 1VG8A 5J23A 1V7QA 4MI1A 5KWEA 3G2MA 4G8DA 4Q3EA 1K7CA 3GJ0A 4J29A 4X6LA 2GH1A 4LZOA 9LDBA 4KYUA 1SXDA 4DSJA 3REQB 3D7NA 1VYTA 1G8PA 2W6IA 1SL0A 1ZQFA 2ZUTA 2OC9A 2H57A 3RS9A 2C5HA 3B2QA 8ICKA 3RF7A 3MHTA 4PBRA 4AECA 1YUMA 2B1RA 2BJHA 5K8TA 2VZLA 4UHFA 1QG0A 4B6JA 5KNBA 2FSPA 1M34B 3KEFA 1E0DA 5D6NA 1JEYB 1Z7BA 1XD2B 4BFUA 1JW9B 1VGRA 3O47A 4XLLA 3DAFA 2JIZA 1GQ2A 4PXYA 4X71A 4PAWA 4B84A 1J9EA 2YWCA 1Q0UA 4X8HA 1GZDA 3F8SA 1JQEA 3LNCA 1RLUA 3FH0A 4TKUA 3JPYA 2ZPAA 2Z1NA 3IAEA 1USUA 1X9GA 4QATA 5MGNA 3AR5A 1UAAA 1T0UA 3KZOA 1C0PA 3C5CA 1G9SA 3QXHA 3C98A 5K8JB 2CLDX 5TPZA 2DP4E 4RH0A 1R0CA 1QDLB 4RPLA 1KORA 4R54A 2E4ZA 3HCBA 4RAOA 2GR9A 4YASA 3FFTA 5LQSA 1Y37A 2QJOA 1DQYA 2BWJA 3SE0A 3KNZA 1TA9A 2ZTDA 2WSIA 5DW3A 2GFIA 2PVPA 5AHKA 1PFQA 3LLCA 3AUOA 2K7FA 1EBUA 3HYNA 4GDFA 1UDXA 5L3ZA 2W8BB 3HM9A 1XRNA 2DJIA 4FXPA 2A5FA 1NVWQ 4V0OA 1J1IA 2PANA 2BDPA 3JR3A 4G0QA 4QJ3A 3ESXA 1V9PA 3E2MA 3QI2A 2C0PA 5HF9A 1P77A 5EWMA 1WTAA 5AW2A 4IIXA 1DGQA 4EFLA 1KLNA 2J09A 3TNYA 1MU0A 4XIGS 3USZA 1MQ8B 4IFTA 3I2HA 3IQDB 4F3RA 5B57C 5LQNA 3CINA 3GFTA 2OXIA 2ECKA 5EZ5A 4DRXB 4CQMB 2QS9A 3PR5B 1WW3A 4GPAA 2GRAA 4X7PA 3WKBA 5MDHA 4W5HA 4CMKA 3GD5A 1UXKA 3GWZA 5AQEA 3ZEIA 1JQJC 3IUBA 4CVNA 1B73A 4URZR 3PWTA 4NS4A 1E6EA 3ENNA 1ADBA 1MG5A 3BA6A 1XWIA 3DF9A 5FUMA 3I2GA 3ZIUA 3IN5A 2OP1A 3AHJA 3THVA 3L4BC 1KI2A 4PPYA 1X74A 3A27A 1LQ2A 1DTWA 2CNOA 4OMCA 2QTFA 2QPAA 4HUJA 3KSBC 4AWXA 4LDRA 3K94A 1K3UB 1WB5A 1ZI6A 1GN8A 2A8YA 2DFVA 3EIFA 1BFDA 4XJXA 3R5TA 4RLHA 1SD5A 4E6EA 1RHRA 4QD3A 3GROA 1AURA 4JWNA 3L4EA 3KKOA 4IWYA 1HDYA 1JAZA 4Y2QA 4ROTA 1T3HA 1E7SA 2UYHA 2WUGA 4QBIA 2IKSA 5DBGA 3PJDA 4YAKA 4Z7JA 3FKSD 3DONA 3FUTA 1M73E 2HB6A 2YVLA 2QP3A 4FOOA 2EG5A 4KXUA 4R6WA 3SBOA 1VHQA 4IG9A 1XN4A 1U7OA 4F5QA 3UMMA 2GWRA 4FCVA 1Z1BA 3P52A 2Y76A 1P9RA 1ZM2A 1KFTA 3T1QA 2KI5A 5DSTA 1JMSA 2NAPA 1HNWB 1XPUA 1BWRA 2O59A 4DFDA 3V1MA 5C3MA 3CW2C 2BPFA 2BEWA 1Y1LA 1BHJA 1XTZA 3ZY6A 4ENUA 3LH5A 1BXGB 2XW6A 1FLNA 1FOEB 2FPXA 2MU2A 2J9ZB 2WWGA 3M1AA 1HIWA 2JCYA 4O4JF 2JFOA 4H1VA 2VSYA 2QD5A 3OQNA 2AZ4A 5JAQA 1U9CA 2IK8A 1IVYA 4QDJA 4NS1A 4GBMA 2WB2A 1YS4A 3T3FA 2ZJZA 2GWHA 3INYA 2ZIGA 3WK9A 4W6ZA 1WNTA 5JXJA 7ICOA 4ZIRB 5DI3A 3EA4A 1QUFA 5CNIA 3CYFA 1RQNA 1M67A 2PL9A 4UBJA 2XICA 3HL4A 5C46F 4ZALA 2AW5A 2ZUEA 1JJVA 2P2YA 4BBZA 2BTQB 4FHZA 4BKRA 1TVKB 1NMZA 4C3VA 4EI8A 4LF8B 5IBCA 1PV4A 4S0ZA 3U7JA 1PSWA 5IDQA 2P3QA 2YB1A 3F6BX 3MJTA 4FN4A 1G7CA 1L3IA 2ZE6A 2QN7A 4EENA 1VLMA 1IBKB 4R4JA 3A6JA 4GZLA 2ZFUA 4DG9A 4EF5A 1EVLA 3BZKA 2ZAYA 3BICA 1EA5A 3M5WA 1IXRA 5IABA 5J0OA 5CT9A 3DBLB 1Q6YA 4TKVA 1D2NA 1C3XA 3C1ZA 3U1TA 2A0KA 5I7RA 2H85A 2H08A 5GOZA 4EA8A 3SSMA 3RANA 4Z0HO 3TOXA 1GPUA 2F3SA 3GEEA 3B0XA 2NNLD 3T5CA 4OQNA 4G0VA 2J9RA 3O8OB 2F9MA 4BMDA 1S6YA 5SZIA 1MR3F 2IHYA 3JYLA 2ZI4A 1XD8A 2HMVA 3EIWA 3R5HA 3RASA 1SG6A 3QFSA 4ELUA 3PYMA 1CUFA 1UK8A 2K6GA 3A9SA 1JWLA 3TW6A 4AJ2A 5A4IS 1V6SA 4UAWA 3EZGA 1YGYA 4I1YA 5F2NA 1VB5A 5LXTA 3AVXA 2Q49A 3K9LA 3ZJYA 4ATNA 3CH5A 4ZRNA 3ZNNA 3BRCA 3L1IA 1SU4A 4IOJA 1J2YA 2HJSA 3GRYA 4W6QA 1D6NA 4NXZA 1HWYA 5KJFA 4UC0A 5JS8A 2E4XA 1C50A 5ABPA 2NO6A 3SJBA 3OC6A 3PA6A 5F52A 4UM5A 1YRAA 4GNKA 3AFIA 4LSZA 2VUUA 1KGSA 4G4SP 4CZ2A 4P1ZA 4HQKA 3PNYA 3F97A 3PNOA 1M1YE 2HO5A 1W46A 3CR7A 2R85A 4C7OB 3DZKA 3T5GA 4B46A 6GPBA 1IEVA 3M6WA 4N8DA 1FMJA 4Y2GA 3RE1A 2ZI6A 4BWYA 5HF6A 4DSZA 5JPDA 3WGJA 4XVUA 3QUAA 4B1FA 1AS2A 1UKCA 1MJGA 3WGHA 3BRQA 1NK4A 1RW4A 1LA2A 2O48X 3DDWA 3SDZA 3TMAA 2X9QA 1C4KA 5EJMA 3ISTA 4NL9A 2WMDA 5DBCA 4H18A 5ESRA 3DT6A 4EPXA 1SEPA 4CWAA 2L5YA 2JFBA 2AKEA 3IESA 3INGA 1GXSA 5D2CA 1P8AA 4BTEA 4IJQA 1QG4A 1PFUA 3B5JA 4P5EA 1W1UA 5HRCA 4NM2A 4M1TA 1G8SA 4WKCA 4UTNA 1M3SA 2OECA 4PHDA 4Q6BA 1GGJA 1GFIA 4E5MA 1PR1A 2CFRA 1RM4A 3ZBTA 1MJFA 3D8BA 3HMQA 4TN1A 3C6QA 2CKDA 1CPYA 3QKTA 2QK4A 4NAHA 4MK4A 2HHSA 3R6GA 2YINC 3VOBA 5BSGA 1A4XA 2HEGA 4F85A 5EJEA 4KAJA 3RADC 2GBPA 1JROA 4QUHA 1HYHA 4L9RA 3VM6A 3H9JA 3QMMA 1V4VA 4QBFA 5KHOC 4Q8FA 4Z9FA 4FFDA 3SR3A 4IDGA 4PGHA 4FTWA 4F8JA 5IK2D 5JY6A 2A9FA 1Z4IA 2QHXA 1NJ8A 3RR2A 4GM4A 3UCXA 2V0CA 2H0QA 3LQ4A 3QG1A 3Q8SB 3PHHA 1Y4AE 3C3MA 2QRHA 2MSLA 2WAXA 2E37A 2JFPA 1A50B 2LD4A 2SKDA 1AZLA 1OI7A 3MGVA 4ECUA 5HF5A 3S2SA 4F5DA 3SIRA 1MQ3A 3ZCXA 2J3EA 1ODIA 3DMTA 3AR8A 1XMXA 5K3CA 3ZNOA 3QHAA 2R8IA 3IMGA 1CQWA 4JWTA 4QULA 5A7HA 4X0EA 2PLNA 2C96A 2JIRA 3KL4A 3WFZA 4MLZA 3LDHA 1L8LA 3IIEA 4EYOA 3RFVA 1YFZA 1NYRA 1ODKA 2W2QA 4TQUS 2OFPA 2HC9A 3P96A 2IHNA 4Q1VA 4BAUA 1U0NA 4LJ7A 5AQ1A 1OILA 1F48A 1JMYA 3HJHA 4GT1A 2WDZA 2J3MA 5TQJA 2FP4A 4TYNA 2VJDA 3AR3A 1GDHA 2R44A 5T4FA 4A1OA 1L1FA 3CA8A 1RLOA 4IDOA 3T7DA 4UBNA 3VO8A 2C7VA 4RIIA 1BNPA 1G21A 1QLJA 5BN4A 3M8KA 2BLNA 3AC0A 5ITWA 1XZNA 1ZR2A 2YJ4A 2HLNA 2XCAA 2JJMA 3A11A 1QX3A 4I55B 4JYBA 2Y4OA 1L5SA 3EAQA 4OL0A 5IVDA 3LPLA 5CFLA 1EFPB 3CZ9A 4RABA 3UG6A 3G8BA 4ARAA 5AK4A 1A4IA 3UT0A 2PD6A 2HJVA 1MENA 3L7CA 2AQ8A 3JATA 6REQB 2QBYB 1LPOA 4BPRA 4DJFC 1VCMA 4CKCA 4KGDA 3RARA 7ICJA 4QBGB 3RU9A 3WDLA 1TYAE 1FYDA 3U4HA 2CHUA 2X0NA 4WKGA 2B8JA 4MWTA 3UUEA 2KSOA 2O3QA 3RT7A 5LFAA 1VJRA 2ZIXA 2A4MA 2EGGA 3UK2A 2GJKA 1VL5A 8ICYA 1H6AA 3DOHA 1J8MF 1V1RA 3V1YA 3EPKA 3JPTA 1AQJA 2Y1KA 1L7PA 1J07A 1LK7A 3ZR4B 2F76X 4DL4A 4Z0NA 3WX0A 1PR5A 4US1R 1JAHA 1QHHB 4GHWA 2DY0A 1IMJA 1CQZA 1W47A 4H3VA 1EAMA 4BU1A 1F44A 5G0UA 2ZCJA 3REFA 1PP4A 5D8DA 1IY1A 1RWWA 3W4JA 3PKZA 4DCGA 3LCVB 2VF7A 5BOSA 3R40A 1UOQA 4X91A 4C8KA 3DB1A 4N6NA 3HILA 4KMRA 4EGJA 2XVZA 1D5WA 3IL2A 1JHPA 3HXTA 2P9JA 1XV5A 1LPBB 2ZRJA 3BQ9A 2I9KA 4C0LA 3W2TA 1TZCA 8ICRA 3BWYA 2RHWA 1JDBB 4J0JA 2YVAA 2HA7A 3VU9B 4O3OA 4MJ3A 4L3WA 3PKIA 3UMSA 3TSWA 4JOCA 5BW6B 2BW0A 2GEFA 4IF4A 5KYUA 5IDXA 4OUDA 2B9EA 2YWBA 3H97A 1AZWA 3W34A 2A0UA 2YXLA 1T2UA 3SGLA 2EGHA 3DWGA 5TMPA 4MR9A 1ZQ1A 3LV8A 2HMYB 1QNFA 2HGZA 3KUKA 4AN0A 1ZGGA 8GPBA 4TLMB 4LJ5A 4X54A 1PZNA 3LOUA 4OMDA 3L4PA 4AULA 3EXG2 3ZXSA 2MWMA 3A1WA 3H7AA 2RQ5A 5HBGA 4LV8B 1GZVA 4NCNA 1TF7A 1W4LA 3ICEA 3QHPA 3VR4A 4FR0A 4TLDA 5M04A 2QM3A 5G3YA 3BK7A 2QX4A 1M10A 4ZQFA 2N3ZA 1SGWA 2W93A 4G24A 2FR8A 2PT5A 2P2CA 1E5LA 2XLBA 2D5AA 1CERA 4RQ2A 3RS3A 3BCRA 4HLDA 1AKVA 1JXOA 5KVVA 3O8DA 1FDSA 5EEGA 1N60A 2AV6A 4LX8A 1JSCA 2JKVA 1RXEA 2O3UA 3WG9A 1K6EA 3T94A 4M9RA 1UJMA 1GCOA 2VJYA 5KFJA 3LYHA 3NV7A 1C0KA 1IZZA 1I3LA 1DK2A 5F7JA 3R7LA 3V7YA 4AJ9A 4BMOB 5BO5A 1C30A 4UB8U 2ZAOA 1BPZA 2PV0A 3SX2A 3ZW8A 1XN1A 3TADA 1ISRA 1GPAA 4JT9A 2G9UA 3DMHA 3NI2A 4BWMA 2ZWAA 2JFFA 4LHZA 5H4GA 2GSDA 2YY7A 3AF1A 3D6UA 3BXEA 4I50F 1SOAA 1OROA 3UMGA 3COVA 3RYTC 3AF3A 4B6QA 1WUYA 4GIBA 4UBMA 3HZRA 2X2FA 2OFFA 2XX3A 1DC6A 2DR0A 3WLJA 3CZMA 1N48A 1W73A 2NQ2C 3ZK9A 2HZ7A 1YZ3A 3INRA 1JE1A 5FA5A 1ND6A 1TCAA 2VP6A 3FBGA 1E7YA 1UPUA 1V6CA 2J59A 4EEZA 4W8OA 1PK9A 2GN0A 4EB6B 2MYNA 2B30A 4DEZA 1TKAA 1IEQA 3EAGA 1DOHA 1KJIA 1COWA 4TTRA 3SBDA 4DPMA 2HY7A 4FJ2A 3BF7A 2OB2A 4LXQA 5K0LA 2ZDHA 2EZYA 1NF8A 2P2ZA 1Z16A 1RWNA 2V03A 1RS0A 4B6PA 1NFFA 4WCVA 1L7OA 4KBFA 3ZJTA 1H9BA 2PSSA 3HDJA 3JD1A 4COOA 3EZ7A 1UXOA 1PSDA 4DW8A 4GOOD 1GYPA 1GQQA 1QIMA 3F46A 3RG2A 5K6TA 3P26A 4O2BA 2WD7B 3W9BA 4F91B 5JATA 1MIOA 2JLSA 2PTHA 1GT91 2BCJQ 4F3YA 4EGFA 3OM1A 3LPMA 1K1QA 1NAHA 2IV7A 4AY3A 2JGAA 4K03A 5IANA 4XX1A 3QOWA 3A9TA 4IX9A 4MEBA 1Z26A 5KQMA 5IIMA 5AM4A 4RZRA 3VKFA 4KIJA 4CDMA 1KO5A 4AG6A 4LXHA 3QYFA 2IQ5A 8ICVA 5BV7A 3HXPA 5IKEA 3FF4A 4DHWA 1JVBA 1Z0IA 4MO2A 4EY3A 4I2EA 1QFMA 1O54A 2O6LA 4Q1EA 3OM0A 4R01A 2AHRA 4FN5A 4G56A 3DZIA 5IHXA 5T6BA 1OX4B 4YBRA 2HOQA 1AZTA 2HHJA 1XU9A 1KOLA 4R83A 2O2EA 3RK1A 1UFVA 4BNNA 4G0PA 4YIHA 1ZUNA 5JMWA 3EW9A 4MUKA 4PIMA 3OVMA 5M5BA 4GKBA 4M9SA 2RIPA 4Q3AA 5KX5F 3BD8A 1X1EA 2NU7B 3QELA 3E5HA 2WJIA 1DIAA 5LQUA 2PS0A 3PGMA 4RELA 1MN6A 3D0RA 1PYDA 4RFLA 4TTSA 3P2KA 3AERB 2OAEA 3HVIA 2ASVA 3V4SA 1ESCA 3TXXA 1T3SA 4OV6B 1P91A 5GJVC 3VYVA 1PK8A 2HM7A 3FSRA 3MFIA 2JEJA 2XCQA 3AO0B 3Q8PB 3GJ4A 1EVIA 3U3XA 1ODTC 3VC2A 2OCKA 4R7TA 3B5IA 1DB3A 5HKBA 3UKDA 1GO2A 1KU6A 3NYRA 3ZD6A 4GBED 3Q6NA 3PSHA 5T57A 5IC4A 2C99A 3GUYA 1Q7TA 1WB9A 1V41E 4LBWA 4LDNA 4BRZA 2AB0A 1X9IA 2ZYIA 1T9GS 5PGMA 4E5SA 3BJZA 3LCUA 2FSUA 5F4ZA 1E3LA 2PA3A 2Q50A 3L02A 3ZDFA 2X14A 4GSYA 1BCSA 3WLEA 3AEQA 3AM3A 3GUHA 3GPIA 3OPQA 3LUAA 4LVCA 2BFNA 1XZPA 5DQGA 3NHLA 4UQLA 3DTTA 4L0QA 2WM9B 1CB7A 3M6AA 3H83A 3E5RA 2FEWB 3M4ZA 4R9RA 1F14A 2X5XA 4RJLA 3BMCA 1Y9AA 1AMOA 2YWDA 3I9OA 1L2TA 4QOGA 2ZJ1A 4WZBB 2BKVA 5KOHA 4KK4A 1GU1A 3WLLA 2E6KA 1NDQA 2N75A 2FRXA 4Z4CA 4QZHA 2QRPA 2FLWA 3PXXA 3CJTA 3KSRA 3P9IA 1Z5NA 2GN1A 5F12A 4F84A 5AICA 2Q6VA 3QE0A 1EWYA 4N82A 4L27A 2BRUA 4ISCA 3X1XA 4P3YA 4YRSA 1KDPA 3FTPA 3QI7A 1KS9A 4OBXA 3AV3A 1PT9A 3WGTA 1AXRA 4MKXA 1O0CA 1MJ5A 2V6GA 3A2LA 3C5HA 2J07A 3R3ZA 4G01B 2NO1A 2CLSA 1SKAA 1CT9A 3TGPA 1X0XA 1U3CA 4TZKA 3AL0C 4A2WA 1Z00A 5FKJA 3H0LB 4EWLA 3N5KA 3THWA 3MILA 2G9VA 2VBIA 4G9BA 3HU5A 3V80A 5C1PA 4JU9A 3HDTA 2JZOA 2O9JA 2BEKA 1HTWA 3W5VA 4D9BA 3RVDA 4GF5A 4CTOA 3K9HA 2JPDA 1JR4A 3OP4A 4XRRA 2E1FA 1NTOA 1K89A 3GD7A 1WXQA 4M0PA 1V0JA 5IARA 3EUFA 5LCXA 3WGKA 5IHPA 2YBEA 4CCYB 4BMSA 1H2EA 2CNBA 4DG5A 2OQIA 2DY1A 3BA1A 1PL7A 1KL9A 9LDTA 4C8OA 4IGEA 1JN0A 3JQGA 4BE4A 1U0FA 2IHJA 4GH5A 1UH5A 4YX9A 2FZGA 4N3AA 4DCJA 5D6OA 5FIUA 3NTOA 3CEMA 2PYZA 1S2GA 5JQWA 3TDMA 1QNLA 1ZWLA 1GYRA 1OHHA 1WB6A 2EW2A 4AJPA 1AN0A 1K92A 4M9ZA 1BWPA 1N0IA 5A3RA 4OIFA 3EIHA 4N0EA 2FGJA 2HSJA 2A78A 2FCAA 3M0EA 2BZ0A 4X1YA 1G5HA 4P08A 1RPJA 4LVOA 2JHAA 3OJUA 4X20A 3NUQA 1D2AA 5HCIA 3WMWA 2O52A 4WHMA 2XNDD 4JJ6A 1N5XA 4RK5A 3A1SA 3SHOA 3SYTA 4RJ2A 4H08A 1N5LA 1GTSA 4CFSA 3H9QA 3R0ZA 3VI4B 2QNRA 2QD3A 1PK1A 3IC5A 1A88A 5IT9A 2HQOA 3OM8A 3ETJA 3FA2A 2NZ8A 1RDFA 5GVRA 3HT3A 4W8HA 2ONZA 4I2VA 1ZU4A 4JEIA 1KRWA 4K9NA 1HMPA 4DQQA 2QXTA 2C2RA 3DAYA 1OLSB 4UEQA 1SV0C 4IFEA 2D0DA 4DN6A 2R62A 3TM4A 1X6IA 1G3UA 5H68A 3S70A 1OBVA 5J0XA 5HQ3B 1Y5IA 1OBCA 4MW1A 5IMBA 2VP0A 2PO7A 3F9IA 1U7PA 8OHMA 5FNVA 3AY6A 4MVJA 3LQRA 3D2SA 2Q5CA 3ZJVA 1IZ8A 3CYMA 2HJRA 4PAGA 5EESA 4HYEA 4C8NA 2HHVA 3ZDZB 1IZYA 4EECA 4UTRA 4DLAA 4P7GA 3EF3A 4HVLA 3PA8A 1M1YA 5IT5A 3RDPA 1NN1A 1W2WB 2YY6A 1DQRA 4UHEA 1SKRA 3QW2A 1OFGA 4HNHA 3GGCA 1T4MA 1EUZA 4XW2A 2QRNA 2A4KA 3M6XA 1DBRA 3K05A 1X7ZB 5C8YA 1G20E 3CN9A 3RVOA 4N5DA 3DJFA 3IB3A 1UFQA 5I7UA 1RRPA 2VP2A 4M99A 2JFQA 1XVVA 5CT5A 5FOXA 4TRNA 3IVCA 2PAFA 5IJWA 1NBHA 3WIBA 2C3OA 3D3EA 3PQ5A 4YUVA 1ZXLA 5F73A 1NWHA 1VQ1A 3MRXA 5E6RA 1HLDA 5IF3A 1MT0A 1VE9A 1L5ZA 4Y1RA 1NG9A 1VHWA 5DEIA 3GI1A 5LZ9A 3I6ZA 2KFZA 3W2EA 1UFOA 4O4HB 2FUCA 1X7XB 2NMVA 3LPAA 2FEOA 2LCIA 3RRBA 4TQSA 2KHZA 1SFRA 2ZBRA 5EAIA 2I62A 1Z18A 1TM3E 4XZ3A 1Q1AA 3ENKA 2OYRA 2IEZA 3VR6D 3GIMA 2BGGA 1JTEA 2X8AA 2I8CA 2EQ5A 2ZSAA 3KAJA 2W83A 3ZVMA 5C2JB 1BMFD 2IYWA 4RGBA 1KGDA 4YJ3B 3DBRA 4YVZA 3OIWA 2QG9A 2EFEB 3QNWA 2YCLA 2XBLA 2CBGA 4WLEA 4FYMA 2G0AA 3JU3A 4OHCA 3OPMA 4L8GA 4ZREA 2YIDA 1ZQSA 1XDUA 1ISGA 3RAPR 3QF4A 2GI4A 5JHHB 3T3MB 2IEYA 3CE9A 4N0PA 1A27A 1TF2A 3GGJA 3VNUA 4FW8A 1V39A 4JJAA 1P17A 4F5RA 2AU0A 1BAPA 4E88A 2XTJA 2MINA 2SBTA 3DE7X 5BR8B 3RR7A 1SVOA 3EQ7A 2VUSA 4ECYA 3MINA 3ZH9B 2W2OA 1I6MA 4WNAB 1UMKA 5K2OA 1F2VA 2V7EA 1HKUA 2QAGB 4E3WA 2BKAA 4O4IA 2VDOB 1V3VA 3ZV7A 2DAPA 1V8PA 4W1QA 3TVYA 1B26A 4X5VA 4J0CA 1BH2A 3AG6A 5EWGA 1TTPB 2PMFA 4CRXA 1WMSA 3HACA 1QG2A 5C51B 2RP5A 2WAMA 2XPCA 1W5TA 2KLHA 2R9VA 4BX9A 2WHEA 1IG3A 4K4GA 1N9GB 2V8OA 2FWBA 5CLLA 1ZYQA 2FEAA 1D4FA 3G8YA 1R64A 3CO0S 4K87A 1QIGA 3TIIA 2VHWA 3LC1O 2XF8A 3EVEA 5B7PA 1AROP 1O03A 4UDYX 3AY3A 1B43A 221PA 3O8LA 1U3VA 1MOQA 4CCSA 3C3BA 3NWJA 1YVPA 1CZHA 2A9KA 1A1SA 3I5MA 3BMOB 4MPJA 3F90A 4MQEB 1H23A 2AQIA 3C15C 5K4GA 1PHRA 3U4QA 4EB8A 2AC7A 1IM5A 4ER6A 2MSNA 5A4DA 5LN1A 1TK3A 5KFMA 4CJXA 2HMXA 4H4EA 5T8KC 2E4YA 2QM7A 4FBTA 1B16A 4NZMA 4MVJI 3JQPA 4G5QA 1JIIA 4PC6A 4IAOA 5AM5A 1Y1SA 3TQQA 3RBVA 3W2IA 3ISBA 1PQYA 3TZBA 4YREA 1GY8A 3K73O 3V8BA 3ER9A 3N05A 3SEAA 2DUMA 1BE8A 4WGGA 5MFPA 1DCTA 3JVIA 4UCFA 3OSUA 5JZBA 4XDZA 2H3EA 1SUIA 3FG9A 4YGYA 5DPMA 3WYAA 1JIQA 4ARSA 5DHUA 3H2BA 3ZTTA 4GRIA 1PVDA 1KY5A 3HABA 1XT6A 3L0ZA 3I01M 4ZVNA 3EY9A 2GD1O 4JT2A 4GPEA 1KDZA 1YSCA 4Y98A 3F5FA 2C8VA 2CCKA 2H1OA 2I3DA 1TZBA 3I9V1 4KWEA 3GJ3A 4GP6A 1WMBA 3RF9A 1BYUA 3NH9A 3W3AA 3TSOA 4XWYA 2EJTA 3KL2A 2YOGA 4QO8A 1ULBA 3GVHA 1YRQA 4RVNA 3PPXA 1KEEA 3F2IA 9ICVA 5CBPA 2ASLA 1Z08A 1UT5A 1EFRD 4WJLA 3M4YA 1N1DA 1KFKB 4RAQA 4Q3BA 2P3OA 5KG1A 3KHGA 3A36A 2FFHA 2BC9A 3GNSA 1I33A 1II9A 4RPJA 1RJWA 3AKCA 1R6AA 1IJBA 1AU9A 1TT5B 1OWOA 2C83A 1X1SA 3ZCSA 4DR4B 5IXYA 3S2YA 2BM1A 3MIIA 5KMGB 3KOYA 4WESB 4EHLA 3OEHD 5H9VA 4ZO4A 3AY0A 3GOHA 1S3SA 2R4TA 4HF7A 4UVEA 4J0KA 5BSVA 4R84A 4P0PA 4D96A 3RTGA 4WOKA 2P78A 1YAJA 2YXNA 1U7XA 3QFCA 5ALVA 1IZ9A 2ZJ7A 1ZCFA 3OZGA 1ZVKA 5T14A 3R6DA 1JYSA 1QFXA 4U2FA 4EEXA 1PUXA 5IFLA 4XUGB 1E5DA 3NW9A 4KE7A 4MW5A 2OGTA 4R9VA 1DELA 3TQCA 5TQ0A 1VLQA 5BOMA 4P4NA 3WQRA 3PHGA 1M1NB 5KFIA 4HGYA 1R00A 1NQ5A 1ZM7A 2RCYA 1WDWB 3EOBI 3HGQA 1WWKA 3PZRA 3M81A 5D3ZA 3IQXA 3HU2A 1O4WA 3DTVB 5GIOE 3H5WA 4C6RA 4P6VF 4EITA 1FFUA 2NPIA 1BVHA 1DV1A 3GDWA 3PNLA 4B9SA 1CNMA 3LUJA 3AHCA 3ZWQA 3MW8A 2CJFA 3ZCQA 2W6NA 3RRNA 1MJNA 4IIJF 2XNCA 2AFHE 1M8PA 1J33A 5HJ2A 5CXUA 1SC6A 2PXCA 4TOIA 1KYQA 2PKQP 4UASA 2EKLA 2VAPA 2YXEA 5IBQA 1XMJA 3IHWA 2JGEA 4BECA 1WQ1R 2GF2A 5TR9A 1ZQJA 2GJ9A 5CA0A 2WZCA 3KAQA 3TXAA 1VKOA 3ESCA 3H11A 4JJKA 1KH3A 4O8CA 1NFQA 1B6GA 4ENRA 2FG7C 1YXMA 4BWVA 3UQ0A 3E9EA 4M9QA 2LIVA 4QAQA 1LNZA 2RGGA 4MUNA 4XIYA 3MC1A 3I5YA 4JKOA 4MRPA 4DR3B 3VPDA 2OQVA 1UBJS 5JD3A 4AS3A 1EAYA 3K31A 3IPRA 5HZGA 5IUKC 3AFOA 5CCDA 1Z7EA 1EXDA 3EG9B 3F7NA 1ARZA 4ZOLF 3E9CA 2EP7A 2WU3A 3NDIA 3OI7A 2QW0X 3KUDA 3A58B 1NMSA 4A91A 10MHA 4COKA 5FP0A 1T3LA 1AO0A 3MBKA 4R1TA 3L41A 3ZE8A 2Z57A 4TQAA 2GS9A 2Q0XA 4LY3A 3T5AA 1AKMA 4LYHA 2EX4A 1MBZA 3OX2A 1MQAA 4V0KA 2J6IA 1SBNE 4KNWA 4QUDA 1A4UA 3EODA 1ACMA 1ZD1A 1N5OX 2IUFA 3BS5A 1CJSA 4EKIA 5KG0A 3EWSA 3EB9A 2A5LA 1CEEA 3DEHA 5ERYA 4ES6A 4KIFA 4PCAA 2JS7A 5TDHA 1FDVA 4HC4A 3FPEA 1X7WB 1MOZA 3ZHBA 2AJQA 2H2WA 2C92A 1T8WA 2VG8A 3IERA 3VAYA 3BGIA 3VPSA 2ZI3A 4EFNA 3S2IA 2CJWB 5C4IA 2IEAA 4EHJA 3AU2A 3P45A 4NLNA 2B36A 3HPOA 3EOZA 2LCFA 2XC9A 2JH1A 4OHZA 1R4AA 1XMVA 1EK5A 3L2OB 3ND7A 3UNXA 2QR2A 2GBIA 4L9SA 4LJ6A 3C5FA 1E2JA 5KT6A 3RFAA 3OZIA 3T3IA 3MGCA 1E9RA 1XL0A 2A9JA 3PV8A 3C2LA 1HO3A 3T79A 3EBLA 4G9GA 2CJPA 3PFGA 1NQUA 3HR8A 4QZ8A 5EZYF 3T52A 1NJYA 3FZYA 4PN3A 1FE8A 3PJGA 1G7SA 1YA8A 2E21A 5P8WA 1UWVA 1ZY2A 3NEYA 3ZJ4A 2PFGA 2DQ4A 3PX4A 1NBME 5HM6A 4B74A 1JDZA 3H1AA 4EW6A 1P1FA 4KQ6A 4J0FA 2RG7A 4TL8A 3ZDXB 1P18A 2P62A 1XIVA 1UHUA 2Z98A 2ZT7A 1ZC3A 4P82A 1E2GA 4M89A 4EABA 3REGA 2VZ0A 2ZAGA 3N7TA 2HJWA 5I9IA 5GV7A 3S29A 1JE0A 3C0KA 2FVXA 4DE5A 3KKPA 1DE0A 4J6EA 3O7MA 4F4DA 3A7DA 2H3ZA 1NAIA 1EFHA 4D5EA 4CTJA 1K5GA 1ABEA 3WA7A 1EVJA 2E4VA 3HKCA 3LLUA 1H8ED 3NC0C 3PDWA 4YD2A 1TUGA 3VV2A 5GMOA 1X2IA 4CF3A 3BJIC 4R1MA 2PLAA 1BQ3A 3IAHA 4OJKA 3K70B 2W6MA 2OILA 4OMUA 1ULZA 1OB2A 4I3HA 2F8TA 1NBWB 4AZWA 1MH1A 2W70A 4PNHA 3HFSA 2EFCB 3D1LA 1TDJA 1A96A 1DC5A 2PEYA 3LTEA 3OTHA 2RGNA 1MVNA 4YCCA 1NNEA 3WV5A 4HDRB 1YZFA 2R751 2HIGA 1NJGA 4D0RA 2QQEA 4NZPA 3KT8A 3U49A 2GM5A 4ZCSA 1NOKA 4Q7QA 2O2ZA 4HMOA 4FZLA 1WP4A 2R00A 1Z0FA 2OCBA 3AVPA 3R5JA 2CLIB 3R2JA 3GRCA 4TMZA 4ZCMA 5A7GA 1LSJA 3L1UA 2D3DA 4LA4A 1DXQA 1LTHR 1QFYA 2W8ZA 1QGUB 2OVBA 3OEEA 4Z4FA 1IBCA 1N7JA 1B3BA 3LPDA 2WF7A 4EFKA 1KAEA 1M7BA 4D97A 4GS5A 4Z1MA 4DJEC 3LP8A 1BN7A 4DC1A 1OI2A 3Q9LA 4Q93A 1XZMA 1O96B 4AO6A 2JATA 1FP7A 4P54A 1YDHA 1A97A 2FPMA 4MV8A 5TS2A 1Q46A 2DCMA 2O20A 4NE2A 3VA7A 1KSHA 4I1IA 2HW3A 4DLTA 1YB7A 1JSLA 2ATXA 2PKYX 4C01A 4OHKA 3BQTA 1QP4A 3M9LA 3KD3A 3E8MA 4RGVA 2BCEA 3B6KA 4QPDA 4CNQA 1G1AA 4Q7KA 1XNSA 3AB8A 1P5HA 1QTIA 3UJBA 5KL8B 1NM5A 4C0JA 3L0DA 2OZLB 3KEGA 2UUOA 1AV7A 4EB0A 4AQ7A 3NRBA 3M4XA 4OBEA 2AW3A 2W6OA 1HG1A 2FEMA 2PSHA 2Y93A 3U7IA 4XRGA 3UMJA 1FRFS 1DLIA 1E2LA 3FIJA 4A0RA 2PMBA 3I23A 3SBEA 2C61A 2A1TR 1J0DA 2IYVA 5BMVB 1W0CA 4H7EA 9ICGA 5FOWA 4GFDA 1RXYA 4NARA 4TPKA 4G0OA 1H3EA 4FJ1A 4UTPA 2CXRA 4CM4B 4UAGA 5L40A 2XDAA 4HEJA 3SM9A 2REOA 3E7PA 1ECLA 3BH7A 2AVDA 3FVVA 4YCNA 1MZPA 4JWKA 1GU7A 3TLKA 2NV0A 2XVYA 2BIFA 2G63A 4TM8A 2A1UA 5IAEA 2FPUA 1Z3EB 4E5YA 3W8RA 3RTEA 1SOUA 1OWLA 4P4MA 2OO5A 2WG0A 2ZR8A 4E4YA 2PN1A 1F20A 3SU8A 2XAAA 3K4PA 4HX2A 4RZ2A 5LQKA 3WFJA 1HE4A 2COUA 2FOLA 2G6BA 1FS4A 5B5EU 4LXUA 5DFAA 1T6ZA 3OX1A 5FH9A 2VKQA 1DJLA 4JR1A 3TAQA 3X43A 3BCSA 3CS3A 1NBAA 1KDRA 3T34A 2PUEA 5IAJA 3JQ8A 1RWQA 4CMCA 3T99A 4OHWA 2RHGB 3DF7A 3IPAA 2NX2A 1NBMD 4MFAA 4HTAA 2BTOA 3C5GA 4TMWA 1DNPA 4M47A 3C5EA 4X1OA 4BGEA 1ZD4A 2PH7A 5KSYA 1TU4A 2IZ1A 3A10A 2VQDA 4PSAA 4WK4B 3G2PA 4W1SA 1HLPA 1KK2A 3UW1A 3FM9A 1QTRA 4XX0B 3T3GA 3F3YA 4WXMA 2WBLC 4L0CA 5EN4A 4II2A 3HRKA 2FOXA 4XCXA 4ELTA 1XTRA 1SA0B 3FSJX 4PU0A 1XTPA 1G8AA 1RJFA 4GMGA 4RH3A 1KC1A 2QUZA 2ENWA 1GFZA 1IWOA 4ZHQB 5K0EA 3IHLA 3CQ9A 1K68A 3O8BA 5EINA 3OAAA 1L8XA 3UJDA 4LQLA 3EBPA 1K5DA 3AHGA 2Y68A 2NRZA 4UMFA 5KNDH 2FKNA 1UMBB 5L1MA 2DH5A 1SHUX 2BFWA 3H8SA 2PH1A 4JUZA 3GRPA 4YUYA 4QW8A 4RE6A 1H22A 1VJ0A 3MUOA 1F9AA 3P2JA 4M1QA 2GD6A 3K9FC 3RBDA 4QTZA 5PNTA 4KSCA 2ZOSA 2X3UA 3ZH2A 1M5RA 4D8TA 1NVMB 3AF0A 2FPGA 5C9ZA 3AQIA 4DXAA 3GY0A 3OQIB 2H92A 2HT6A 1ZQMA 3I12A 4YTEA 1LF0A 2RLTA 5G1OA 4F12A 4P34A 4PSCA 2IIBA 4ZMRA 5J0UA 2AC4A 2QN1A 3RF6A 2GF0A 4NYMR 1M7GA 4EUEA 2C57A 1OFVA 5FV7A 4RQ4A 3UHAA 1ZGHA 1UPXA 4QZIA 3LT4A 1WZ2A 3UHFA 1SCNE 2E3TA 5ES3A 4C43A 2Q29A 1UKYA 2FSVC 1SWWA 2Z30A 1LC3A 4KAAA 2NZUG 4XTRA 5KFFA 2PHZA 5KHLB 1BEEA 2XCSB 1G20A 3QVOA 2R8KA 3TD2A 2VSQA 4QDXA 2O6HA 4B17A 1ZH4A 3Q3HA 2LIPA 4KR3A 2DM6A 1TNDA 1HR0B 4Q8EA 2FRDC 4PXSA 1AY0A 4TYYA 2D1RA 1RBQA 5F7ZA 4P4SA 1QU3A 2VPTA 3DBOB 4XJTA 4YT2A 3QTLA 3V97A 4PZEA 4E4TA 2JGKA 1U90A 1JALA 4YCLA 5TJHA 3TLMA 3UXYA 3OEHA 1XAGA 3OIGA 3EFBA 5J2CA 1COOA 4NXNB 1T43A 2R5WA 4UU0A 5HR6A 2JIOA 4DSAA 1GT6A 5U4QA 5REQB 3HCCA 2UZ4A 4LZDA 3VTFA 3HI6A 3L4SO 2EFGA 1MZVA 1DFIA 1YIDA 3NBMA 3SKVA 1EWQA 3EVFA 1B15A 3SI8A 1NATA 4HOYA 4KP7A 2R6JA 3LS2A 3KOWA 4JBIA 1KO1A 3OE1A 1HORA 4UB3A 2C03A 1OZHA 4FB5A 4NOLA 1Y63A 1E62A 4HKTA 3CBGA 3VVLA 2VPYA 3BRWA 2A30A 2WT9A 3LGSA 3VCBA 2DPMA 1YMVA 1FK8A 3D8RA 1PLJA 1GSHA 4RKYA 1P1JA 1E2UA 4M49A 3DOIA 1UP6A 2D4AA 3DLTA 2NP6A 1PEYA 2W98A 1MVOA 2H16A 2JVKA 1PN3A 3TNDA 2G1JA 2I2FA 4AWAA 4ENSA 2Q8PA 4UNPA 4FOLA 4U39A 3T5DA 1P2VA 4O25A 3HM2A 4YJ2B 2F2AB 1JFRA 3PUVA 3ZV6A 9ICTA 1NR7A 3UQ2A 1ZNZA 1ISPA 2DXIA 2OORC 4BO5A 1DP4A 1NYLA 1P6QA 4NDZA 1SXGA 2IVZA 2CNNA 1HNZB 3LWBA 2A19A 3TRHA 1NI4A 5CD9A 2IEGA 4ISBA 4QGHA 2VHZA 4ZQEA 5K0FA 1JDJA 1VXRA 3A8TA 1QV9A 3K16A 1E60A 3RUAA 3V42A 3PO4A 5JUWA 1WCYA 3GOQA 2AI3A 2C3MA 3ZY2A 3CH6A 4MTCA 5IH7A 4URWR 4YV0A 1HY3A 5DM70 4IL6U 3IKTA 1BPBA 4L28A 4S12A 2ERYA 4R5MA 1K8QA 2O8CB 1LV5A 1ZVVA 1E2BA 5J9FA 1O5OA 2BHSA 1A77A 2NYUA 4CM8A 3LBFA 1GWNA 1MFZA 3F6CA 3HP7A 3ETGA 1W8IA 1LI4A 1P0FA 2ZSKA 4NK5A 5CT4A 2CXQA 1SBIA 3MSXA 4KXVA 2RBGA 1H4SA 1P0IA 1GKIA 1V25A 3WXBA 2H9YA 4EKEA 4JOSA 1PWZA 5EEHA 1ZSVA 4JODA 4DNFA 3D4OA 3KBBA 4IHKA 3GF4A 1WX1A 3CUKA 3X1MA 1FDUA 5IJXA 2JAXA 3QNMA 4YK7A 5LZ5A 5J3JA 1OLUA 2XUPA 3DZBA 4YR9A 2WU1A 1U8CB 5CTAA 3BBLA 3VXKA 3WYBA 1JB1A 1Y6GA 3VJRA 1FX0B 4HDCA 3F4KA 2YOHA 3ZHCA 1N78A 3ZGVA 2DB3A 3G17A 3PSTA 4DQUA 2ZIUB 2JCVA 4ZAXA 3OQ1A 2N1BA 4PQFA 1T3NA 3BWCA 2GPWA 5E2AA 4KKXB 1RLJA 5LWHA 1XNGA 2QP4A 5M2QA 1WMDA 3EGXA 1XTVA 1RI3A 3O38A 2XCOA 2JH7A 1LK5A 2XQKA 4IH4A 5E6UB 2YYAA 1VJ5A 3TQTA 2OFWA 4ZP1A 3ASUA 3FUUA 1I6WA 4ADSG 4XEHA 1YR6A 4HLUA 1Q7GA 5FPQA 2LI6A 1G8FA 2XWJI 3A1NA 1SB9A 5DGAA 2BFAA 2BF4A 4H6XA 2H8GA 2NUPA 1QMGA 1TC2A 4M1ZA 1LDNA 5B7NA 3F3SA 1GAEO 2GNPA 3OZ7A 3Q88A 4CG1A 4LZPA 4NBLA 3PQCA 1TEVA 2VP9A 1CDEA 5JFGA 1WU8A 3IA2A 1YQQA 1U7UA 2IDJA 2HUPA 3PJRA 1N56A 4RQUA 3D3WA 3FC4A 3WK7A 5EHQA 3UWSA 1R2QA 4HYQA 4JC5A 1H2BA 1FUIA 2V6JA 1FC0A 5LKRA 4L3VA 1T91A 3AM5A 2VJBA 3VC3A 2EH9A 3WRXA 1U63A 2OHJA 4OYRA 2FN8A 4WFQA 1E6LA 3B36A 5BN5B 1V43A 8ADHA 4AKIA 1TAQA 1H8EA 1AHPA 3JVDA 4AP6A 4D80A 2K4PA 5DH9A 4PZUA 5JO0A 3Q9UA 3ZOKA 3TD6A 3E7DA 4PYIA 4HR7A 4E7PA 3FCYA 4YWHA 1M2WA 2QPTA 3NC1C 2VYVD 3FMFA 3TZLA 4BFTA 2O8BA 1YCDA 1TMYA 4OSPA 1KQQA 1FFGA 3M5CA 4JLBA 2J8ZA 3PQ2A 3OT5A 1INLA 4JB8A 4LTMA 4OSOA 3ZGZA 1A5TA 4DOMA 5IRCD 3WNBA 1JG7A 4C7KA 4W5JA 3HKEA 2I2BA 2AFHA 3CG4A 3ZXYA 4KIUA 5GM1A 4QNNA 3FKSA 2X7HA 5AW8A 2C9DA 1RACA 5L3QA 3EEBA 2QTNA 1KZHA 1DX9A 1BEUB 4IYRA 1FL9A 1O08A 2OV2A 4YMVA 3HJGA 5EGNA 4Z6DA 3KJIA 5JROA 4I4IA 5EKSA 4ZCQA 1N8SA 2FFJA 2HL6A 2BH9A 2JFWA 4BLSA 4FUTA 3FOCA 1AV6A 4N18A 2YZMA 3AI1A 2IMWP 3RUFA 5IUNC 3K30A 3OUTA 1WMEA 3N0TA 2PUTA 2VOEA 4L5CA 1F2UB 3BGSA 1XFDA 4B7ZA 3EVAA 2J9FA 4ALNA 3WB0A 1I2MA 1QSSA 4B34A 2V3WA 2QRUA 2QAJA 2XD9A 4YNBA 4OP1A 1ZL0A 4G1MB 2QUHA 2WWXA 2WM3A 4CT0A 2V6IA 5TRTA 3OEWA 4GC6A 3ITNA 3DDNA 2GQ0A 4CW7A 4E46A 1JL3A 1IQPA 2BL4A 1FVHA 4U5XA 2BZGA 1TJPB 5LWQA 3RVKA 2Q27A 1JP7A 3AILA 3I4FA 1U8XX 2IUYA 4LZJA 1N3IA 5E3IA 4NZZA 4QPJC 4RL6A 4ECSA 9ICMA 3W8FA 4OQMA 1CE8B 4PGQA 4HX9A 3KPWA 2ETXA 2P3SA 4F2SA 1K6XA 1Z12A 5KVQA 4K4HA 3B1YA 4RU9A 2BHTA 4F06A 1EEXB 2ZJOA 2FHPA 3T5LA 4RA6A 4V0RA 2VAWA 2ZS7A 4MUXA 3CKLA 1I13A 1GPJA 1WP9A 4GC5A 3PV0A 3VC1A 5A03A 4BTLA 5JXWA 2HV9A 1DKNA 5KAPA 4DV6B 3T7CA 3RYFA 4R1OA 5LVAA 1FFSA 2QVXX 1LW7A 2AOVA 3I6IA 3AG5A 5B53A 1SXHA 5F35A 2GHQA 3VPFA 1S5PA 4Z4GA 1FSPA 1GUZA 2OWEA 2WMOB 5FWXB 3NRZA 1H94A 5D3KA 2B4TO 5AOVA 2C5BA 1EEHA 1VE3A 3GDGA 1YDGA 5J2GA 3CXUA 3MWJA 3ABZA 2ISPA 5C81A 2C98A 1X39A 4U4AA 4JK3A 1NBMA 5I9BA 3OF2A 4GKJB 3F6YA 4DGQA 4D3ZA 1Q50A 1G60A 1R8YA 3PP8A 3BFXA 4Z6FA 1E7QA 4MIOA 1PJSA 4J76A 2BGLA 1T2AA 1EFTA 1AQ6A 4DARA 3E0FA 4R8LA 3BFJA 2REBA 3DPSA 4BFLA 3LWLA 1W29A 4NXMB 1ZHHA 3M9XA 4FFSA 2ZJBA 3AVVA 2IW3A 3EFEA 4RD0A 1NXVA 1GKLA 3KQTA 2HRZA 4QVKA 2JCGA 5K9ZA 2UVPB 4M2YA 1T9BA 3L4BA 2P6RA 1VZ2A 3H87A 2UUAB 1WDMA 3DVLA 1DRWA 4FYWA 3LYUA 2ZLBA 4IHJB 1OB5A 2YIJA 3SN6A 1N6LA 4MGHA 3ZZMA 5EWLA 4DLRA 1UINA 4DFMA 4OM7A 2G08A 3C74A 4PFKA 2ZI7A 1L8QA 2Y67A 2WUFA 3H2JA 2RGRA 2O0HA 3U81A 4KQWA 1V9SA 4R8VA 4UPEA 3OTOB 3AEYA 4ZAFA 1BA2A 3HJCA 2R8PA 2BFMA 4S3MA 1XXHB 5I7AA 2IY7A 4EVSA 3ZYZA 1VLJA 3KVRA 1RQ7A 4K3VA 3WLQA 4DLNA 4P0TA 4NY1A 4GYKA 4XYEA 4Y0NA 4A82A 4O8ZA 4LOKA 4RWEA 3LXMA 2HDHA 4DWJA 1XUOA 5KYWA 3PVSA 2RCNA 1AK2A 2JD1A 4UZSA 1EP9A 4CMJA 1QOZA 3CW2A 1KK3A 2OXOA 2EX0A 4BHTA 2XT9A 4HEHA 3P0IA 5IK2A 3RH5A 4BJ1A 4G23A 1UC9A 1U9LA 4TXJA 3RQIA 1IU9A 2C3YA 3KQUA 4O3MA 1RABA 5TISU 2ZCUA 4UM9B 3SJUA 2MSKA 1JAIA 2PFPA 3UZUA 4Y1EA 1VIMA 3T3DA 1BVRA 4Z6CA 3WMRA 5LL6P 4ZVKA 1HM5A 2PI5A 4QM7A 5DBFA 1SCAA 4N0QA 5C8XA 2NU6A 5TQVA 3OLYA 4A8TA 2ZE5A 4M0DA 2ZJ4A 5FR2A 4MQFA 1N5DA 2GKSA 4GRDA 4YIKA 2HYIC 2QWXA 2ZI5A 3RLFA 3OESA 2GAJA 2ANBA 1OXBB 3DLAA 4JGGA 5JCJD 4XQEA 4NEQA 4UBKA 4AT1A 3KWMA 2B1QA 2DWCA 4P3NA 1BS2A 1CK4A 1P4SA 3HKBA 4J4BA 5I9SA 5ICGA 2HGSA 2YQ5A 2QTBA 2GN6A 2Q07A 2QYTA 2QJRA 3K1AB 3WI7A 4QEKA 3GEGA 2AMVA 1Q1ZA 1CF4A 1TAGA 2C2WA 1HFJA 3IIKA 2WTXA 2VDUE 1ZFNA 5J0SA 1ZIXA 4AJOA 5LYJA 3GDOA 2IYOA 4ZANA 1RRCA 1OPXA 3S27A 1IHPA 3IMEA 1YR9A 4KIGA 4NLKA 1VMEA 2GMWA 3SDSA 3HY6A 4CQJA 1PZMA 3GLIE 1SCJA 4YRGA 3E9MA 4RZXA 1GA6A 4JV2A 1P1KA 2G8LA 2KW5A 4AJ4A 3ZYCA 2IBTA 4UUNA 1L5HB 3CV3A 3MIZA 3GCDA 1X1AA 1U04A 3MPUA 1BJRE 4BKUA 1TA4A 3PEYA 2F9LA 3AU6A 3B9BA 1PBNA 1YIAA 5A06A 1XWFA 3CY6A 4FGSA 4TLLB 5IVIA 4HN4B 3GFRA 3H4BA 4KLUA 1N63A 5LQDA 2OENG 2VQEB 3AM9A 1XO1A 1T24A 4K8RB 2WIJA 3CTPA 1M54A 4IRKA 5IIOA 2QUAA 4UJ3A 4FSDA 2J7KA 3ADCA 3QWAA 2PUJA 1Z6AA 2RAUA 2IEBA 3U1VA 3FFBA 2VEDA 3F8WA 1FU4A 1DFHA 2X8JB 1DAPA 5T4BA 4X7RA 3S1AA 2GA8A 2BP7B 4RD1A 3P5SA 3RS2A 1UFKA 2INGX 2V59A 2OUKA 4XB2A 3JD0A 3KVOA 1D0SA 4OMFG 1TXGA 1V48A 2ARKA 1L5LA 4PHPA 5IEJA 3QX3A 4DR7B 1KMMA 1XJ0A 3LKVA 4JXZA 4EHNA 4FWBA 5JAPA 3SZUA 1N3LA 2FJ6A 4PG4A 5E4FA 3CFYA 1W4ZA 3ZNQA 3PMLA 4DEYA 5K01A 3TJMA 4KZKA 3SKYA 3A0RB 3AUKA 3FCSB 2Q1WA 3TTVA 2EFDB 1ZUIA 4K05A 4W5TA 3JAMA 5LJIA 1KTVA 1NZFA 2AOUA 3K1TA 2XUKA 3TRJA 3VDQA 3T9AA 3TFRA 4XYMA 1D7AA 3ND6A 1N3YA 1SXPA 1IQ0A 4R1LA 2FZEA 3PEFA 3Q1LA 4AUEA 3LKDA 3OTQA 1JNYA 3BAFA 3QENA 1KPIA 4LMAA 2XITA 2O7RA 4H7DA 1KZGB 5KTYA 3ORRA 1E3IA 3A3KA 2QN9A 3WIDA 3LVRE 4KYVA 4DNQA 2VYCA 4BO7A 4YRPA 2YQEA 1NP3A 2QY9A 3SFVA 4GZ6A 3GP8A 2CF5A 3L7KA 4JSYA 1OIXA 1XZEA 1RMTA 3LECA 1MABA 2CSXA 5IIKA 2EJVA 5KFGA 2B1GA 3IDQA 2EQAA 1GILA 4RIFA 2X13A 5MF6A 1U2GC 3OOSA 2Z3WA 3CUYA 2BHRA 1ZZEA 3FCUB 2ZYRA 4YFYA 4CKWB 3EEFA 3DV0B 3RJMA 3HB0A 2FN3A 2I6GA 5I9MA 1BHSA 2VF5X 3B1JA 2SCUA 4B8YA 4A8EA 1JA9A 6CHYA 4V0LA 2B99A 3SC6A 2ALJA 2VPXA 3JWGA 2HSEA 5CG2A 1URPA 4C4YA 3OT1A 4HVTA 3DO6A 3RS5A 3CRVA 4JVLA 3C87A 3EEOA 1QP7A 4NOJA 1ZN8A 2XR1A 2GXAA 1J2MA 4XQGA 3QMVA 1ZXIA 2FOIA 2VHXA 1ZAYA 2H7CA 1CJUC 4A3SA 4WGFA 3NMUF 3EZ6A 2X9NA 1EWTA 4US8A 2PAAA 3N8KA 4GI3A 4NOKA 2BHLA 4EG6A 3T6KA 5KC8A 2C9YA 1MGPA 2NSHA 2FZ5A 2W9CB 4MEAA 2EX1A 4HFJA 1VE5A 2H07A 2WD9A 4AZVA 8ICBA 3NEAA 3PRJA 4L74A 3ZWNA 1P9OA 3EIQA 2RK6A 1ACLA 4W4TA 3U4DA 3O6VA 2D2IA 2HCBA 4KPGA 5ILGA 5HKLA 1AG9A 4I6JA 3RYIA 1S10A 2FSHA 2FWPA 3KVVA 2M6RA 2WUDA 3MM4A 3D6VA 1QVRA 3G79A 2NLOA 2H2GA 1NXSA 4L5AA 1ONPA 3I32A 2OORA 4A15A 1DWUA 5B64A 3Q8LA 5HW0A 1SAYA 4KPEC 1DAEA 1K6IA 3DOOA 4YG2A 3RTAA 5K99A 1C1XA 3O9MA 3VYSB 1NNUA 2O8EB 1TKDA 2WFMA 1PR9A 1CJKC 1MAUA 1QQBA 3Q4GA 3MTAA 3LY5A 3R7SA 1KA9H 4WN3A 1S7CA 4YYEA 4DA0A 3O8CA 1E9DA 1N2CE 1SCUB 3WWEA 3VHRA 1J8YF 3MT0A 4TRJA 3V2UA 1VL6A 4IM7A 3NHMA 1NKBA 7ICEA 1ZIDA 1DBVO 2ORYA 4ZD6A 2J0UB 3QPWA 4B4UA 5ED4A 3DB2A 3DTYA 1I4OA 3HV0A 4HDSA 2ZBPA 5CK5A 2OEPA 1MKYA 2IZ7A 3FIUA 1NVBA 2EZTA 1PZXA 1ECGA 3IBGA 3LGXA 4D0LB 2H48A 3Q2OA 1Q57A 4QXMA 4EO9A 1TKBA 4LZAA 3HLTA 3KR1A 2EARA 2WG2A 3WK6A 4BVGA 4DV7B 1EUCA 4X45A 2UUPA 3ZY3A 2P79A 4YPVA 1A2OA 1PJRA 3BEDA 3HXMA 2PFOA 4KRFA 3I9JA 4MAFA 4XM2A 2KBEA 4QASA 3U44B 3V72A 1N32B 5KFEA 9ICNA 1QZXA 1G1MA 5JASA 4ZOCA 3D2CA 3L7AA 1AUQA 4QOJA 5KFZA 1DT5A 2ORED 3AP1A 2AYXA 5LZ2A 4GWLA 1J8FA 3HK2A 1H3FA 1RPLA 5KG7A 3Q3EA 1PNOA 1PQ4A 1Q11A 1X13A 2X4IA 4DOBA 2YMLA 2GT1A 4P4LA 2WKSA 2FNAA 4IDHA 5H83A 4W9NC 1KJJA 2XXBA 1E3WA 1C7IA 3KDAA 4KODA 4I8XA 1TQ2A 2CL6X 4I2CA 2QLNA 5ESWA 4AMYA 5CEFA 3T5KA 3LCCA 2XMSA 3TRDA 5ILQA 2FPIB 3BSWA 1B0ZA 1SELA 4CE6A 1GA4A 3IUSA 2OLEA 3MLEA 4KUEA 3VZRA 3AUJB 2HXSA 3VNSA 2HNBA 1N62A 3U1BA 2G77B 3R3JA 1DGJA 4MIKA 3QV1A 2QEQA 5C5JA 3BWXA 4LCBA 2DHRA 2WFLA 2IHTA 2OCGA 4BZQA 5FA6A 1DZIA 3H3FA 1OBFO 1YS7A 3IULA 4K40A 2HJHA 1I7QB 2CVFA 3PXUA 4DL6A 4ZO9A 3GH3A 1CIPA 5H16A 3R9XA 2PJDA 2KBFA 5HUHA 1Z7WA 3HCOA 4UBBA 3N76A 4F96A 1KBQA 5JMPA 1N5IA 3Q3IA 4ED9A 1ZBQA 2M2IA 4P8RA 4Y9DA 1JWAB 3WP1B 1LRJA 3CRMA 3TZ6A 4P4UA 3SX4A 5I6DA 1CY4A 3F5MA 1VCHA 4PRKA 3LXRA 1CQIA 3O2NA 5JS7A 1XQ9A 3FCXA 1KI6B 1RTTA 3IJ5A 3I34X 3C1YA 3E0QA 1AF7A 2GERA 4G0UA 1D4OA 4FX5A 5D49A 3ICCA 1JQ5A 1FDOA 4HNRA 5CVEA 4WAUA 4FWTA 1ABBA 3KYIB 4WVFA 4CQNA 3BWDD 3A31A 5JWRA 1H2ZA 3IMKA 1S1MA 4QUBA 1JVNA 3SNKA 4HLNA 2CV2A 3N75A 1WABA 4X95A 3KQKA 4KLDA 5EJAA 2E7ZA 3B52X 4UOEA 1V7PC 4HP8A 2KHQA 4E14A 4HUTA 4Q4LA 5F1PA 3AUAA 2YYYA 4GI1A 4ZCLA 4DCNA 1EG2A 3QBJA 2I7XA 3AXSA 3ZX4A 1NPDA 1JRPA 2ZS8A 2YTUA 1BMTA 1A7UA 2NVWA 4R2MA 3WLKX 4Z0TA 2CXOA 1IUOA 2CEKA 4TVBA 2ODWA 4DR5B 2KLBA 3R5FA 2BI7A 1KSPA 3A14A 3D1VA 1DX4A 3A1DA 3EVNA 5DB9A 1WHSA 1A9RA 4LSWA 2FH5B 4RLSA 2G25A 4UVGA 1CJCA 1XZAA 3EJWA 3CSUA 4ALJA 5DN9A 5ICSA 2B4KA 5CM8B 1EX1A 3M1LA 1CZKA 4HWTA 4RPKA 3I8OA 3OTIA 5FWYA 1C3OA 3IB6A 1F38A 3TKYA 2XKBA 5DG8A 3OBBA 4KYIB 4FFNA 3ZHUA 3OQOA 1D0IA 5JR3A 2QV7A 1J00A 2IXAA 3LFUA 2WJHA 3GEDA 4KLJA 1Z7GA 4PNEA 1X40A 2JC3A 2F8KA 1R0WA 3B53X 4X1IB 1VBFA 3V33A 5BPCA 1EUDA 4RTQA 1LVHA 5H1YA 1JFFB 2VH2A 5CR9A 1YZHA 1QJCA 3DXZA 4Q1BA 1S89A 4AP5A 1HG0A 3FOZA 2CZGA 1SOVA 2P4UA 2MJLA 5EMLA 4N0MA 2CNDA 3VI3B 3STHA 5KFQA 5FF9A 3DG9A 3X1JA 4HDMA 3MJDA 1O57A 5EE3A 4MWZA 1P72A 3HO8A 4TSFD 3RVQA 2ETVA 2ZQZA 4MRMB 2WA1A 3WS7A 3O4GA 4EHIA 1BEZA 1A7JA 4F7DA 4KMUA 4KLZA 4MR8A 4B7CA 1FFEA 3PUIA 2XNDA 4CKEB 3E84A 3IAAA 1Q1BA 2IA6A 2VA8A 3G5TA 5LZ8A 4OQEA 3SHQA 1LK0A 3EGIA 4F5ZA 2Q1TA 1JXEA 3GJXC 4ZV7A 4HGZA 3R1IA 4M0KA 4KACA 5EMJA 1WUIS 5L4LA 3QRWA 3MELA 4NEGA 2JBHA 3P5BA 4ZCPA 2Q28A 1X7DA 1LJUA 5JMOA 1LBQA 5JAHA 4P5PA 1E18A 2NTYC 2QLTA 1I9GA 3SIXA 4PG8A 3PZBA 3KYDB 4Q9HA 3TAPA 1JHRA 3FTNA 3KM0A 4Q3DA 3ITEA 2ZJFA 4A92A 5TE9A 3TR5A 2XADA 3NBZC 3RI3A 1A9QA 4ZZ0A 3M3HA 2H4WA 2HPVA 4BUGA 1QGYA 3AYXB 4BMVA 3ZXIA 4MF8A 3LT1A 1E4VA 3KKMA 5BW8A 3ORFA 3UWOA 2YFQA 5G1PA 5TGZA 3UUFA 3NOQA 4I2HA 4AN4A 4AXBA 4F4XA 3VPHA 1I4LD 3SAJA 2MTBA 1IBRA 2PUAA 2ZWOA 1JILA 2LUOA 4D3XA 2IVFA 5B6IA 4XSVA 2AG5A 4QFBA 3NWEA 3CNEA 2KOBA 2OBBA 3AZOA 2OEHA 1ID1A 2JLXA 3GH1A 5AHWA 5ILOA 3Q41A 4Z7QB 4R68A 1QH1B 5JTUA 1BJKA 2IA5A 3W04A 3VPCA 5LBIA 4FHEA 2J30A 1K2WA 2JLCA 1WXFA 2HAEA 4JP5A 3PNBA 1GPMA 2NSJA 4FFVA 5J2UB 2WM8A 2W6JD 3WGQA 1X3LA 4X62B 5JFOA 2FF5A 4G25A 2I5HA 2C2DA 1N6NA 2WTAA 3LK7A 1S3FA 4QGFA 3NP7A 2FWAA 3VR2D 4G1BA 2DBYA 3OZCA 2WPNA 4YQYA 2Y1IA 1L4KA 1VRWA 5KT4A 1L3TA 3L8FA 2MSEB 3L4JA 4JZYA 2C82A 4ED6A 2YHUA 2QIOA 3CLTC 2BM9A 4J0HA 3CUVA 4H2DA 1U99A 4TV9B 4GZ5A 3FJ1A 2Q21A 1W9MA 3V55A 7REQB 1Q16A 2V7BA 3HCPA 3FCAA 5BMOA 2P4EA 1VBMA 2B25A 5CHEA 4MROA 2CLKB 2YJ6A 4N01A 1GGKA 3SSOA 1M0TA 1Y89A 3VR6A 3PLRA 4U7CA 4GEGA 1UADA 4J0IA 1HDEA 3V3TA 4G1FA 1YCHA 2OLJA 2YZGA 2H18A 3VNBA 5IW8A 3LI2A 1SUWA 1BMFA 5IILA 1WXEA 4R8RA 1KE1A 1UBFA 9ICJA 2ZSDA 3F4LA 2VT3A 2QUIA 4BLUA 3E22B 2V7XA 1EDOA 4ID3A 2PGOA 4HBGA 1PKEA 2BFCB 3IE2A 2W8LA 4IS7A 3CN7A 5IU6A 3E03A 2FG6C 1RYHA 4J1TC 3ZQUA 3CRRA 4IRCA 2I4LA 4QM6A 2H4XA 4BCDA 4P92A 2ZE8A 2VDQB 2XB8A 3KG2A 4O5AA 4KLMA 3H4TA 1G63A 1YR7A 3K2EA 2OXEA 5TEWA 5J4YA 5D5HA 1UC5B 4GXJA 3ZG6A 3LM8A 5FBHA 4ECRA 4GR5A 1PFKA 1XFAA 1G38A 1M2VA 2XGGA 1YMQA 4KPUA 2RHRA 3HA3A 5FI3A 2WUVA 2O2HA 4ALKA 1JT2A 3EFOA 1G8KA 5BPFA 2J31A 1BVYF 1LJ8A 5BY2A 1EP2B 1M33A 4E0BA 4CM6A 3RK4A 4OA5A 3IALA 1E32A 4PLHA 1KFEB 3QA3E 5CK4A 3I05A 2FHSA 1TLFA 2GNOA 1P62B 1YZGA 2QT9A 4C0KA 5A4JA 5T3UA 4BO0A 2PR2A 2N9UA 1J21A 1Z8NA 1ZKMA 2AZDA 4TXHA 3LBAA 2J67A 5J4KA 3SAGA 4KREA 2FUG1 1P0MA 3GLIA 3JPPA 2GB4A 1AS3A 3E7XA 4TT3D 4IKEA 4ARBA 1C9KA 4ZMBA 3MR3A 2BM0A 2G40A 3HL0A 1F1BA 1SV0A 5HTKA 2NRXA 1SUBA 1Y98A 1S8NA 2OBXA 1CEQA 1PT8A 3SC2B 3RJTA 2G9NA 2UVRA 1VSTA 2PUVA 1XHEA 4MDEA 1II8B 4H7PA 4KVAA 3A06A 3LF2A 1NVAA 1R3UA 1E7RA 5K0BA 4ZARA 1J90A 4X97A 1VHDA 1ZRHA 3HH8A 4ZA2A 4RMJA 3VPBA 3ML1A 3HFRA 1YR1A 1KYXA 4DIDA 3ZV3A 2X1VA 3UB2A 5ALOA 1Y6ZA 4QZ9A 3L3BA 4JITA 3AY7A 5BUQA 3GUVA 3HB4X 4QJBA 3DEYX 5GGXA 4KPFC 4PAQA 3B6ZA 1LKZA 3TUIC 5GM2A 3ZIAD 5B2FA 3JASB 4ZJPA 3OX4A 1E7WA 3INTA 3ABOB 3ORSA 1MEJA 4KUGA 1NX9A 4RO0A 4RHYA 3UWPA 3T3EA 1E1CB 4JZKA 3D43A 3ZGLA 1N2JA 4NMLA 4IR1A 5KTKA 1I3NA 5KCMA 2X5NA 4QUJA 3GLFB 4MYTA 2GGSA 4FR2A 3MQ2A 1X7YA 3DBHB 5H80A 2R25B 1ZINA 1DIOB 1CI4A 4ZQHA 2NZWA 4JJEA 1EFRA 4X60A 1T5HX 2Q7XA 5AIBA 1QVZA 4GOXA 1KVSA 1PRYA 4ENQA 3ADDA 3SXJA 4L6IA 1G5RA 4IVNA 3QYPA 1UA1A 3FSGD 2HZBA 4I9NA 2Z6VA 1OFUA 4W9MC 2IS1A 3TAUA 2B6NA 3ZU3A 4CMHA 2CD7A 1XD9A 3CLTD 4CCWA 2JRLA 1WCNA 2Y1JA 4OXQA 3PCXA 2B5WA 3NEPX 1E63A 5MN4A 2PU7A 1L4FA 3NS7A 3IP8A 1V1MA 1DIRA 2Q5LA 4QZAA 4IR9A 5DCYA 4N5NA 1L5KA 2UYCA 4ZHQF 4NBSA 4PIVA 4F56A 1WTCA 2H1WA 4TV8B 3RC3A 1NULA 3SBXA 4GPZA 5EIOA 3DXYA 5CPBA 4RCZA 2FI1A 3KLPX 1KO4A 2OHHA 2VTEA 2HA5A 2Y99A 3OH8A 4BEVA 4FYJA 4TTJA 4D26A 4CG2A 4HB4A 3I45A 1NW3A 3BS7A 2HSDA 3EZFA 3UXEA 3O4RA 2ODTX 2W9BA 3MWGA 1GVNB 4JBGA 4OAPA 3H16A 3O2JA 4GLJA 4KVFA 1C41A 3VDRA 5F9FA 1PGNA 4DF4A 4QZFA 4L15A 3WRYC 1MW9X 1PT5A 2VH5R 1P7PA 1RWVA 2O2JA 2XI4A 1CWUA 2PPVA 3UPQA 3FGOA 5EKDA 2DUYA 4JP1A 4ZRDA 1U6IA 1L7AA 3QVJA 3SAFA 5H4HA 4HX5A 3RB8A 1M2NA 1CQJA 2DFPA 5HDQA 2ZRGA 1D8YA 3H4IA 3OM9A 5F7XA 1WCIB 1I6LA 4U02A 5I01A 1NPTO 3CTMA 3V7LA 3U3KA 1Q20A 2SNIE 2K89A 2QAGC 2RI1A 2OA0A 4I9FA 1T8UA 3F1LA 3F6RA 3MWEA 3FUXA 3OKFA 2NU9A 4ITRC 1UQRA 3C6MA 1P60A 4Z7OB 4NBKA 3AYZB 1QS0B 2XOXA 4OB6A 1US8A 1Z34A 1IPHA 2ADFA 1YQDA 2IUEA 1FYVA 1FFDA 3OJOA 1ZW1A 3V7NA 5IAKA 2FK7A 4DQRA 2GBLC 4PHGA 4R0VA 4UM7A 4CXMA 5L3RA 1KAOA 2LBOA 3ZZTA 4J9OA 1EXWA 5K3OA 5T8KA 5SV2A 3FWKA 2ONCA 3ZLTA 3WNZA 5FOUA 3AIMA 3N97B 5IBPA 1M6VA 4C2TA 2A9OA 4DV4B 1S5LU 1J2JA 1Y42X 4NULA 1DPGA 3BPSA 2LYBA 3UMBA 4YHBA 2VIIA 4MGIR 2DOKA 5IZCC 2Z5GA 3KXLA 4BBPA 2XRYA 4NR0A 2JEZA 1XO0A 3C85A 1QKKA 4GZ3A 3GFFA 1PJLA 2BGKA 2YV3A 4NQZA 3RUHA 5IJAA 2P9EA 2CL7X 5LBTA 1GARA 4BVLA 2DFLA 1Q3TA 4PZLA 1N2CA 4MVCA 1C9JA 4F97A 9MHTA 2X1LA 2NTEA 4XDGA 4BVAA 2HRBA 1TUIA 3DWIA 3MWDB 5A3JA 2ID9A 1EJ0A 2IYAA 4LXGA 2Q5JA 1BOOA 4OIMA 1PGJA 4RV4A 4XM0A 2AXEA 3OZBA 5F7OA 1QBKC 2ZRFA 3PW4A 1V3UA 4I55F 4KE8A 4KLFA 2KEYA 3SHVA 3HKDB 4FMCB 3BS4A 1H2XA 3SVLA 2DETA 4D4JA 4REMA 1R3DA 2W2LD 4YJ2F 3G5UA 3Q1KA 4GWGA 5FORA 3SEFA 2HFKA 5ENVA 3QVTA 2EIXA 4Q21A 2VJOA 3A2KA 3JPOA 1SO8A 1JU4A 4JLPA 4KLNA 1ND5A 5B3KA 4LY9A 1AKRA 1GTG1 2VHQA 3GZNA 2AUMA 5AKGA 1V3TA 3QXXA 2C9ZA 2PGJA 3HSSA 5FT9A 2CE2X 1E89A 4DA8A 1E5XA 4HAWA 4D4KA 4KLCA 4JLNA 5HFJA 4IV5A 3H04A 1NBEA 1XSLA 1P4GA 4I2GA 4HQ0A 2VDMB 4HNAB 1D2RA 1DEXA 4DQSA 4GLOA 2H2FA 2H4HA 1LKYA 4I50A 4OQZA 3TOSA 4DC0A 1GZ7A 3PITA 3DWFA 2NTVA 4Y3UA 1NF2A 4G8JA 2MU1A 2X8BA 4MUIA 5JBQA 1QWOA 3SNHA 1FQWA 5LOVB 3U2QA 1GN9A 5DNUA 2P75A 1G8MA 2ZEJA 2XBUA 3V1KA 1KS2A 3A4LA 1G291 1FXWA 1SH7A 4QNMA 3NM5A 4EMTA 4HRXA 2G0TA 4YO7A 4LG1A 5U9CA 4C6TA 1X77A 3EXEA 2BKEA 4URUR 1ZI9A 1IV8A 3PX7A 4D43A 2NYRA 3BDIA 2PGLA 2VQSA 2ZAIA 3IE1A 2WFAA 1WL8A 4I3FA 1DQZA 2HBYA 5FX2A 1NNI1 3W9SA 3HZHA 4C4XA 4RACA 3KWJA 1CKEA 4L95C 4ZCTA 2RBEA 1JLHA 4ER0A 2KX7A 3IAS6 2FPPB 1RVV1 3DEIA 5B7QA 4DSFA 3BGVA 3H8VA 1RLTA 3I01A 5BT8A 3R4VA 3H17A 2HPAA 4FMDB 3EYZA 4K3UA 1NR5A 4QWAA 3KHUA 2R6CA 2HIAA 4EATA 1TM2A 3GBPA 3WL4A 4KQXA 3C3EA 4XGIA 3E5NA 3M7IA 3GPLA 3QXSA 3GLKA 3V6MA 1SL1A 4DDKA 2ZXHA 5FOVA 1BCRB 2AGPA 4KHPB 1X1CA 5E6SB 3RSZA 2DHEA 1AIPA 1V3QE 2PWBA 4ZOHC 3IHQB 3VR2A 2V4UA 4EELA 4XDHA 3NUGA 3KSAC 2WAAA 2VXCA 3FDIA 4TLAA 1KVQA 4CU5A 1M66A 2FP3A 4MA4A 3MR2A 4DSUA 4MS4A 4C06A 4NIMA 5KX5A 1TFUA 4ZT4A 1GNQA 3IO3A 1YKGA 1Q0ZA 4YJHA 5EIFA 2GZSA 1GNTA 5ALDA 1UDBA 2VI5A 1CR4A 1EBFA 1MORA 2NV6A 3QX8A 3QUBA 1N0VC 2R8GA 3GLVA 5ALEA 2EAOA 4R1NA 2E0IA