2LMRA

Solution structure of the first sam domain of odin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
MISGLRTLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ankyrin repeat and SAM domain-containing protein 1A
publication title Solution Structure of the First Sam Domain of Odin and Binding Studies with the EphA2 Receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2lmrA01
2E8OA 2YTUA 5JU5A 1X66A 1UCVA 2FE9A 2B6GA 2EANA 2E8MA 2EAMA 2KG5A 4MHVA 2KE7A 1PK1B 2QARA 1SXEA 3TADC 3KKAC 1LKYB 1UQVA 1B0XA 2LMRA 2KSOA 5JTIA 2QARB 3BS5A 2K4PA 1V85A 1SXDA 1V38A 2JV3A 3K1RB 5J8YA 2D8CA 1B4FA 3SENA 2DKXA 2D3DA 4NJ8A 1COKA 2E8PA 2EAOA 4NL9C 3HILA 3TACB 4PZNA 2Y9UA 3SEIA 2DKZA 1DXSA 2KIVA 1X9XA 5F3XB 3H8MA 2KSOB 5L1MA 3BS5B 5KNIA 2Y9TA 1RG6A 3BS7A 1SV0C 1SGGA 2QB0A 1SV4A 1X40A 4RQMA 2DL0A 2F3NA 1OXJA 3TADA 4NL9A 3KKAA 1F0MA 1OW5A 1PK3A 1PK1A 2QB0B 1Z1VA 2QKQA 1WWVA 2ESEA 2E8NA 5J8YC 4PZOA 2K60A 1LKYA 1KW4A 2F44A 5JRTA 3BQ7A 2ES6A 2LPEA 4IS7A 3IDWA 2EAPA 2L5YA 1SV0A 1WWUA 2QB1A 4RQNA 1JI7A 2GLEA 2KMDA 2F8KA
chains in the Genus database with same CATH superfamily
4RZRA 1U45A 2P35A 2IOFK 4QZDA 3OHAA 5KFFA 4ECXA 4MFCA 4PHAA 4YMMA 5A0LA 1UA1A 2KE7A 3V6JA 1RXWA 2QARA 4LVSA 4UB1A 3MGVA 4OCZA 2K4HA 2WF5A 4TUSA 4J9PA 4M9JA 3FM9A 1ZQBA 4BXOB 1NK5A 3BZKA 1Q46A 1CI4A 3K75D 2BDUA 3Q8RB 3T79A 2KIWA 3WK9A 5J8YA 1U47A 2EDUA 1N5XA 1ZQMA 2XY5A 2KFZA 1BPEA 1B4FA 4I2AA 1J97A 2G07A 1TK0A 3BQTA 2ASJA 3HILA 4C4RA 2ZJ5A 3G6XA 4JV1A 4DL4A 1PZNA 3CP8A 5DKWA 3H0LB 2UVRA 2HSZA 2WTFA 2KIVA 2CN1A 3QUCA 1C20A 9ICHA 2H3ZA 2ZJ8A 2KICA 3NGDA 3F5EA 3LWMA 1N48A 2ZIXA 2MUTB 2YB1A 3M9OB 2KKVA 1HUZA 9ICJA 3SAHA 1N61A 4RQ8A 1ZD4A 1PK3A 2BCVA 4B9SA 3C2MA 5ALKA 9ICEA 4C4TA 4FBTA 2ESEA 2B21A 5IINA 2BPGA 5D49A 3MFIA 3RAXA 1KW4A 2F44A 4YR2A 2ES6A 4PH5A 4RNOA 3IDWA 4ED6A 4Y2SA 1XU4A 5KG0A 1U4BA 1QH9A 5ALGA 1P7DA 5KAFU 3PW2A 1S97A 3C2LA 3HW8A 2JEGA 1T3QA 1S9FA 2W11A 1PUZA 1JRPA 1UCVA 2FE9A 3SAFA 2I9GA 1K1QA 8ICWA 3PVXA 4F4KA 2YY6A 4QZFA 1VJ5A 3KKAC 1LB2B 3RR8A 1Z3EB 3MDAA 4FZLA 3QZ7A 4Z6EA 2XVTA 4ECZA 3GFKB 2E3TA 3WKEA 3PW4A 3ALRA 3MR5A 2OYYA 4C8NA 4AYBC 2DQNB 5IIMA 5B66U 3PX0A 1UHUA 4YD1A 4R63A 3KD3A 2K8AA 2MAXA 1URJA 3TACB 4GXJA 3KHLA 3M7DA 1X9WA 2JXJA 3AL0B 3RAQA 5KG3A 4B9NA 3VCBA 3ZDAA 7ICQA 4EEKA 1WCNA 2I5HA 4DO9A 2BGWA 3BS5B 3F2CA 1ZQVA 3PMNA 3SD7A 2LHTA 3L3FX 1O08A 4F2SA 1ZQNA 5KFYA 3CYMA 2F1HA 1NNLA 2FPMA 3PX6A 2H3FA 9ICFA 5J0XA 4G3IA 1T8EA 2LYAA 1TAMA 4QWCA 1LKYA 4F5PA 3TAPA 3OHBA 3UQ0A 2OM6A 4C0ZA 4C7YA 3LDAA 4O3NA 2L5YA 5J2FA 1SV0A 4QZHA 1JI7A 2KMDA 1XS9D 3QUTA 4KLIA 2R8KA 1D9DA 4P4MA 5AM3A 2ALZA 2H3IA 4M04A 5HP4A 2E8MA 4FZMA 3ISCA 1CEZA 2C22A 1RXVA 5DLFA 4IR9A 4RU9A 5TISU 4DL3A 1NZBA 4ECUA 2G0AA 1ZQCA 1ZRMA 3E58A 3TADC 7ICJA 3M6ZA 3F2DA 3MGHA 1J2MA 2LM4A 4KLHA 3GV7B 2BCRA 2V9WA 4O3SA 3WK7A 5DG7A 1S0MA 3RJEA 4F5NA 2JV3A 4DFPA 3MR3A 2MRLA 5DB8A 1BVSA 4HAIA 5GTIU 4ECSA 2W7PA 2WFAA 4B9VA 5KFXA 1MN8A 2AU0A 4P0QB 5DQHA 4I2JA 1X6IA 3C5FA 4OJLA 4I2GA 5J0YA 5KFUA 4I2IA 5B5EU 4E0DA 2KOBA 2Y9TA 3ZD9A 2JGAA 2KP7A 1NJWA 1PVPA 7ICFA 2FI1A 1L8LA 2OCEA 1N56A 2VA2A 4K4IA 2BR0A 1KSPA 2EH9A 2DPIA 4KMOB 5AKKA 4Q45A 3UXPA 4LJXA 5CB1A 3SV3A 2E8NA 1Y88A 3QE9Y 2XY7A 2JHDA 2K89A 4UQGA 3M8SA 4YG2A 4O5KA 3CNHA 2RQ5A 2XC9A 4EBEA 2VJ4A 4DFMA 1JUDA 4MFAA 4ICAA 2AXTU 2EZXA 3WKDA 8ICMA 5CRXA 4GIBA 4Y2TA 2EZZA 2NRXA 2KG5A 4R66A 1KDHA 5L1KA 2LYBA 4DFDA 2G5IB 4F92B 8ICOA 1Z4OA 2ZTCA 4MEYA 3KOOA 4P0PB 7ICOA 4JB3A 2OWOA 3Q8KA 4ED2A 3RFAA 5DGBA 3MFHA 7ICGA 3BZCA 3DDHA 2ZXHA 2YX8A 2BCQA 5KL1B 4FS1A 1C7YA 3C1YA 2DKXA 3ISBA 3BQ0A 3H8SA 1NKBA 1YZ6A 4QZ8A 1ZQZA 1JN3A 8ICYA 4NLGA 3TFSA 3AQEA 3OPXA 2K8BB 4DF4A 5KFOA 3JPSA 1L7PA 3I1YA 1TFRA 2GH1A 3OSPA 3PR5B 5J29A 3MR2A 1TV9A 4NLCA 5AK6A 4J9RA 1QQ5A 2QKQA 5ALSA 4IQUA 3NUQA 3T5HA 3GV5B 3CRXA 1A77A 5ALTA 3BJYA 9ICWA 1ZD3A 3D2QA 2H3QA 9ICXA 4F3OA 3QXGA 1VDVA 3ISDA 4RQ0A 4Y2JA 1NK7A 3THVA 4FBUA 3RB6A 2DGZA 2KHQA 4QZIA 2KJ5A 2HDOA 2ZIXB 4F93B 4BWJA 2AGPA 1NZPA 1ED1A 5KFWA 1FEZA 4AYBF 4C4SA 3SYZA 1ZQHA 4RQ1A 3ZDEA 4YQWA 4ELUA 3N28A 2DPJA 2HMXA 4GC6A 1U48A 4UBCA 1SIJA 3L5KA 4KLDA 5ALNA 1ZQSA 4DOBA 2XCPA 3RR7A 8ICVA 4KN4A 3QUQA 5CJ7A 2NRZA 5AKHA 4P4OA 1KQQA 3M6KA 1CUKA 3NRWA 2E8PA 3O0FA 5KG2A 7ICEA 1FIQA 4KN7A 5KFMA 3Q8PB 5K4LA 1WYGA 5AI9A 3SEIA 4J9LA 2LYHA 3R9KA 3H8MA 2XY6A 3RJFA 2AJQA 3HJEA 5KNIA 3NRZA 1ZQJA 4NLKA 3TAQA 4UBBA 5KFNA 1MA7A 5ALDA 1X40A 2F1JA 8ICKA 3SI8A 1L7OA 4KLUA 4YR3A 2W8LA 1F0MA 4M9LA 4UB8U 2QB0B 2Y0SF 1Z1VA 5J0WA 2W9BA 5AKLA 2KNJA 1X6JA 5J0RA 3MABA 3N4MB 8ICNA 2W9AA 1X42A 5KFVA 4GLXA 2W3SA 3NTUA 3H40A 4US8A 1UT5A 4DQPA 2QLTA 4DCCA 2HHVA 4DL2A 1KKXA 4OJ6A 3F53A 4LZGA 5F9LA 2BQUA 2HBLA 1X66A 1ECWA 2ZIWA 3UMBA 4PJ0U 1FFVA 4IL6U 5AM1A 2RDIA 2XICA 4EELA 1J2NA 3JPNA 4IRKA 3TFRA 3MR6A 3PSPA 2R8IA 1UT8A 3GIMA 3BQ2A 1LKYB 8ICGA 9ICBA 1V97A 4DFJA 2JZBA 2EQYA 5DLGA 2F1IA 4EEYA 5EWGA 2ZTDA 2NO5A 1ZQLA 3HX0A 4O3OA 5DDMA 3SENA 2RP5A 3UXOA 3NVVA 1SKRA 9ICVA 4NM1A 1UPHA 4F5QA 7ICPA 1XNSA 2KHVA 4PL1A 4MEXA 1ZYQA 3HKZC 2PXIA 1RM6C 1NOMA 2FMSA 4OJPA 2A3VA 2A19A 1SL2A 4CNQA 3DEEA 1KFDA 3WKAA 1SL1A 1UA0A 2ISPA 1NI3A 1RDFA 2IOHA 4AP9A 4RQ2A 1HJPA 1L3UA 2JEJA 5AI8A 5AHXA 4PZOA 1SL0A 2KJ8A 1A76A 2M0NA 1N63A 8ICHA 4Y2RA 4EENA 3PSIA 2WF6A 1VLBA 2F8KA 1KL9A 1PVRA 3OJSA 2ZUDA 2LKYA 4QJFB 2BQRA 4RNNA 4QWEA 3H0MB 2C2DA 3RBDA 2W03A 2JMGA 5G5HA 1DGJA 4DFKA 2BDPA 1D9FA 3KZIU 5J0TA 4Y2UA 3IG5A 4J9SA 4TURA 5E79U 1EXNA 1QLNA 1IIPA 4IC9A 4O0IA 4JUZA 2UVWA 5CWRA 5HHHA 4USAA 3TQ1A 1KTQA 3C28A 2RDJA 4UB6U 4M0AA 9ICLA 3LVVA 3RJGA 3OGUA 2IOFA 1ZJMA 3EYZA 1MC8A 5HR6A 1MSWD 5KFSA 5KG1A 4F4ZA 4A8EA 3M9NB 3PW0A 5AM5A 3EW9A 2XGQA 3MC1A 4PGQA 3ZDCA 2BCSA 3JPRA 9ICGA 8ICFA 4US9A 4YR0A 3HP6A 8ICUA 3UM9A 3M1YA 4DSLA 2NRTA 2QB0A 1T94A 2C28A 4I29A 1D8LA 4ECVA 2DL0A 2F3NA 2CXYA 1N5WA 3GQCA 4DLEA 3QU7A 5ALUA 1F5SA 5D46A 1ZQWA 1WCLA 5J8YC 4DSFA 3Q8QB 4QZGA 7ICUA 2Y1IA 3HT3A 1L8OA 2FPKA 5KG4A 4KLJA 3QNMA 2NO4A 1KN5A 5TZVA 1SWVA 5HMLA 3SZ2A 3L4PA 5AK3A 4QZBA 1JXEA 4EZ9A 2PMZF 3OJUA 1RYRA 5AI6A 3E0FA 5AI5A 4HYKA 3LVWA 4EX6A 2VKQA 5L1IA 5DBBA 4M6WB 3I28A 4MHVA 3BDPA 3QEAZ 1B43A 4MFFA 5KTQA 2BKEA 2UVVA 2HBJA 3RJKA 1KBUA 1FO4A 8ICAA 2ZUBA 3FC4A 5ALLA 3B0YA 3LWLA 1S77D 1QCKA 2Y0SC 5DGAA 5AM2A 4F4XA 3QX7A 1PVQA 1YT3A 4PHDA 4RT2A 2R8JA 5DG9A 3KHRA 9ICMA 2HHQA 1SZPA 2KZZA 1WG8A 3B9JA 4F4YA 1KRPA 4PGXA 4ED3A 3FYHA 4F91B 2E1FA 4Z6FA 2Y9UA 9ICIA 1RQNA 1DXSA 5EE1A 1L7MA 2JR5A 2RHFA 5AKJA 4O3PA 5EWEA 1RZTA 1Z4NA 2AHOB 4Z6CA 2IHNA 3PR4A 3ZDBA 4ECYA 5JUMA 3KHGA 1S5LU 2RRDA 1XC9A 3NASA 2IA6A 3TKAA 4CDGA 4ED0A 2WAQF 3RB3A 5EE3A 4YCXA 4M9GA 4F50A 3RB4A 3HPOA 3AMZA 4C7ZA 2B0CA 3TARA 2YMLA 5KFIA 4YMNA 3D2NA 3SQIA 5KT3A 5KT5A 4NM2A 4RQNA 9ICOA 3CW2C 2D6FC 4YP3A 4EZ6A 5KFZA 1KFTA 4UB2A 5KFEA 4U6PA 4R65A 4WJ3B 4KLGA 3JPOA 4DWIA 2B6GA 4KLEA 2EANA 3TI0A 3RBEA 1X9MA 2WB1F 1DK2A 2MA1A 2HBKA 5ALZA 3KBBA 2W9MA 2ATLA 4BJQA 2M9NA 2W9BB 4P4PA 1FFUA 5CP2A 5KFRA 5F9NA 2LMRA 5AM4A 4J9KA 4O5EA 7ICRA 3B0XA 4O3RA 1V85A 7ICNA 4GC7A 1ZETA 4C8MA 4CF5A 1ZQIA 1WUDA 1X2IA 3ED5A 3PV8A 2AGOA 2DBYA 3HKZF 2HVHA 4TUPA 4YMOA 2KD1A 3A0HU 2ZIWB 5IIOA 4IQWA 5ALXA 4YN4A 1A0PA 5KG6A 3WKCA 5F3XB 3D2SA 5C5JA 3KZXA 4UB4A 4I2CA 4ZH4A 2G06A 3RH5A 2JZBB 4B6JA 8ICPA 5C0YA 8ICJA 1ZJNA 2RLTA 2PFPA 3IG8A 2FLLA 4UB5A 1OW5A 4QZ9A 3ICXA 2CRXA 1DK3A 4J9OA 2DUYA 4DL6A 2Q4TA 1V9PA 3V7KA 1BGXT 4RQ7A 3BQ7A 2HW3A 8ICEA 2EAPA 2AQ0A 3HRDD 4UAUA 4Q8EA 4ELTA 4UAVA 4M6WA 1ZQTA 3RJJA 4KLLA 3SV4A 2W9CA 4IRCA 4NY8A 1RQLA 8ICQA 2OEHA 5AKXA 4IR1A 3E2EA 2J6TA 4UAWA 4F72A 2NRVA 3BQ1A 1JMSA 4I2FA 5KG5A 4DQIA 2KSOA 5CR0A 2W8KA 2BQ3A 2K4PA 4C8KA 1Z00A 8ICRA 3RJIA 4DS4A 4DOAA 3QU5A 4RPXA 4Y2QA 5ALVA 5EE9A 7ICHA 3PY8A 1N60A 5AKZA 2GWSA 4UW9A 1MQ3A 4C8OA 4ZOHC 8ICTA 2BHNA 7ICIA 5D4BA 2KVCA 1DGSA 2PMZC 9ICKA 2EZYA 1L7NA 2ISOA 4XQ8A 2PFOA 5CEHA 3NS1A 5KL8B 3C5GA 4GXKA 2P6UA 3V72A 2Z7JA 3MDCA 2MSNA 1S10A 4QIWF 1SZHA 5CHGA 5HMMA 3ZI4A 2P6RA 1OUQA 2UVUA 4YXJA 4J9QA 1TK5A 2ZTEA 1PK1A 1ZQRA 4KITB 1NJYA 4DSIA 5IIIA 1ZQFA 3OSNA 3C21A 3C2KA 3GIIA 1MQ2A 2MU2A 1XSLA 5DDYA 3AUOA 1B22A 2HI0A 1JXLA 4J03A 1XO1A 1GO3F 3GIJA 1WWUA 5DQGA 3I76A 4DQSA 3RRGA 5BOLA 2BCUA 1ZRNA 5AKEA 3ZD8A 4O5CA 1L3TA 1QQ7A 1JX4A 3EZ5A 5J2CA 4CRXA 4RQ5A 1BNPA 3H7IA 4G9BA 5L1JA 1ZOLA 2WF9A 1B0XA 2W04A 1SKSA 2WAQC 3RH6A 4KLOA 2Y1JA 3PW7A 3PMLA 4C8LA 3LYSA 4OO1J 2YMPA 3NVZA 3WU2U 4RUCA 2FJ6A 3N7RC 4ED7A 5L9XA 4ECRA 1RPLA 3TANA 1ZQPA 1QSLA 4NL9C 4XRHA 4BX9C 2LM1A 1F44A 2K4EA 2WB1C 4YFKA 2IMWP 4I27A 4I2EA 1KLNA 1RG6A 3BS7A 9ICTA 5KT6A 3GILA 1SV4A 3SMVA 3PNCA 3N97B 4NXZA 4CGZA 4EYIB 5GTHU 1OXJA 4CF4A 4JWNA 3KKAA 4NLZA 4YVZA 3Q8MA 5AKIA 4OD0A 2W3RA 2XIDA 3MGIA 8ICLA 5KFKA 4ECTA 5ALHA 4B9MA 1XWLA 4I2HA 4FE3A 3HWTA 2ASLA 1ZQAA 4Q8FA 2GLEA 2OXOA 5ALPA 3EPGA 5ALJA 5AI4A 3SR6A 2J6UA 5KFGA 4PHEA 4UAYA 3ONNA 1ZXIA 3RB0A 3JPPA 3H4DA 3QU9A 2K8CB 4JWMA 4QWBA 3KFUF 2E5SA 3Q8LA 2VJ5A 5ALIA 1HUOA 2A1JA 4KLSA 3DV9A 5JTIA 2KZ3A 4ACOA 1T3NA 2HHTA 5IIJA 1SXDA 4JV0A 8ICIA 1BNOA 4FFDA 2KN7A 3EPIA 4U7CA 4KLMA 4RPYA 1S0OA 4Y2YA 2R8GA 3RF9A 3C23A 2G5HB 2V4RA 3UXNA 5DB7A 4R8UA 4KX5A 4XUSA 2W55A 1ZQQA 4NJ8A 3JPQA 1NJXA 3S6JA 2FMPA 1COKA 5ALMA 2ODGA 4DQQA 7ICMA 4B9LA 4JK1A 1Z19A 3RH4A 3V6KA 8ICBA 3G6VA 2K4IA 3AEVA 2JH7A 4MF2A 4M9HA 1LVHA 2FLNA 7ICTA 1COOA 1M6YA 3OTQA 3A0BU 5DG8A 5HR7A 5J2AA 4DSEA 2HHSA 9ICQA 2DF4B 1D8YA 3TADA 3PSFA 2AQ4A 1L6NA 5DB6A 2PI5A 5J2IA 4EBCA 1LV5A 1RYUA 5AIAA 1XSNA 5J2GA 4CE6A 3ETRA 4YXMA 4IRDA 2K60A 5J2EA 4QZCA 2XGPA 3QEBZ 3ETLA 1NJZA 5J0SA 4DF8A 1ZQYA 4UATA 1AROP 3T5KA 2NYVA 5J2DA 3WK4A 4O3QA 2G08A 1ZQGA 3VC8A 4PGYA 4M9NA 1AQ6A 3QU2A 3QYPA 2XCAA 1NK9A 3AU2A 5EE0A 4QNLA 3WKBA 4RUAA 4F71A 4GFJA 4DSKA 2Q0ZX 1BPXA 4BUGA 4JMUA 3UMCA 4QIWC 1ZQKA 5ALYA 1Q3VA 2ZUCA 5EOZA 5KFTA 1Z1BA 2J6SA 2ASDA 2XI9A 3PSTA 3IN5A 3GZFA 2D8CA 2W9CB 5J2KA 3IP4B 2D3DA 5KFQA 4FZNA 2W43A 2KEYA 4KX3A 3SAGA 1K5OA 4NV0A 4DL5A 5J0OA 5EWFA 4ECWA 9ICSA 1NKCA 2XO7A 4YD2A 3GIKA 2GO7A 1NK4A 2ZIVA 1QQ6A 4K4GA 1X9XA 3PX4A 4EX7A 2KSOB 1IG6A 3H8WA 2KKPA 2W54A 1Z00B 4MF8A 2OH2A 1ZQXA 1TAQA 2G09A 1L5UA 1D8BA 3U26A 2V4QA 2E1EA 1NK6A 4KLFA 4Z6DA 3M8RA 4K4HA 2ZIUB 4Q44A 2ZG6A 1XSPA 2WF7A 4CF3A 2JEIA 4BXOA 2W7OA 1L3SA 5KAIU 4RQ3A 1U49A 1NK0A 4TQSA 1DRGA 1ZQDA 1JROA 2E8OA 4KTQA 1N2XA 5H2FU 3WK5A 5KFHA 1ZQUA 4C80A 2A1AA 5CA7A 5ALOA 5J2HA 2F76X 5KFAA 4NLNA 2KFNA 1PK1B 2WHEA 3KTQA 4NWIA 3WK6A 4P2HA 5DBCA 1JIHA 4Y2PA 8ICZA 2HVIA 2F77X 1UQVA 4R64A 1S8OA 4Y2XA 4UASA 3NVWA 3AQFA 1V38A 2MUTA 2HOFA 3UMGA 3PO4A 1BPBA 2NV3A 5KT4A 1N62A 3UQ2A 4TQRA 2JEFA 3RRHA 8ICXA 1BPYA 4DQRA 2DKZA 2C2EA 2FMQA 2HOIA 2LBOA 4EBDA 3C1ZA 1SV0C 5L1LA 2N1RA 2YMQA 4DEZA 5KFJA 5AK4A 3IHQB 1SKWA 4X5VA 1XO0A 4RQ6A 3PZPA 1U9LA 3MBYA 1WWVA 3V6HA 4F5OA 4M47A 3ORYA 5IIKA 5ALRA 3UPQA 2C2RA 4IS7A 1IXRA 4DOCA 3T5JA 3FDSA 1S0VA 5KT2A 4GXIA 3J81j 3N7SC 4PL2A 2VIXA 1HEKA 3WK8A 4BDPA 2H3VA 7ICVA 2FLPA 4DSJA 2VA8A 5KG7A 2PFQA 2R18A 2I6XA 2AH5A 3V7JA 2I1QA 3QU4A 4IQVA 2HHXA 1ZQOA 4ECQA 3EWAA 1KEJA 1SXEA 3GU3A 2IHMA 2AGQA 2YQEA 2QARB 3BS5A 3M9MB 4XA5A 3K4GA 5J0QA 2NRWA 5J0UA 4TUQA 9ICUA 5AM0A 3NVYA 4I2BA 5KFLA 9ICNA 7ICSA 3K1RB 1DOQA 1ZQ1C 2PFNA 1A6SA 3G6YA 2H5XA 4UAZA 5ALQA 5IILA 1S0NA 1HIWA 1NK8A 2EAOA 2F8LA 2CPRA 3K1ZA 2ZJAA 2O6KA 5HNKA 2KV2A 1SWWA 5ALFA 4Q43A 2KVSA 4FO6A 2A1JB 4BGDA 1QTMA 4UB3A 2GOLA 3D6JA 2R8HA 2LI6A 1O03A 5L1MA 4CCHA 1TK8A 2KTQA 5DQIA 3GDXA 2PKEA 3H0RB 2HOQA 4DLGA 2DFLA 2ZIUA 4NL9A 1TAUA 4O9MA 2HCFA 1RYSA 4R8UB 2DWQA 2P66A 5DBAA 4RT3A 2BPFA 8ICCA 1ZQEA 4OJ5A 3F5AA 4QWAA 4LZDA 3IM1A 1KFSA 5JRTA 2VANA 2LPEA 5ALEA 5KFDA 2FPLA 5J2JA 5G5GA 2QB1A 2BPCA 1Q8KA 5KT7A 4JV2A 4QWDA 2YTUA 9ICCA 3C29A 5JU5A 1T7PA 1L3VA 4KLQA 2VA3A 2EAMA 4QW9A 2KZMA 2IBKA 4ED8A 2ZXIA 8ICSA 4P0QA 2JRZA 1SB3C 1YZ7A 4F4WA 4ED1A 4M2YA 9ICPA 4O3MA 5AKGA 3IV6A 3V7LA 3EUB2 4I2DA 4QZEA 4RQ4A 1QSYA 1ZD2P 2F2AB 4DS5A 1QSSA 1K1SA 4RNMA 1IV8A 7ICLA 3N7PD 5T14A 3LK9A 3ZDDA 4FS2A 5HHIA 1IM4A 5KFBA 4F8RA 5DB9A 2WF8A 4J9MA 3PW5A 1BPZA 4KLTA 3H4BA 2KK0A 2YMMA 4DL7A 5J2BA 3AM9A 3AU6A 2FDRA 5FP0A 3Q8SB 2HHWA 4PZNA 1TKDA 5KFCA 3AN1A 3RJHA 2JH1A 3F2BA 4EYHB 1T4GA 2OHFA 7ICKA 5BOMA 4OJOA 5KFPA 2YB4A 3PO5A 4QZAA 4F5RA 3T3FA 4KMUA 3KHHA 3QZ8A 3IRUA 1H38A 1Q3UA 2KJ9A 1TVAA 4PHPA 1SGGA 4IQTA 4B9TA 5AICA 4RQMA 1NKEA 4QW8A 2PI4A 1TE2A 4RPZA 1ZD5A 9ICAA 1X9SA 9ICRA 4J9NA 2HHUA 5ALWA 4B9UA 2YN4A 5AI0A 2HBMA 5BPCA 3RTVA 5J0PA 3T5LA 5AIBA 2BZFA 4PPXA 3H8JA 3GV8B 4Y2VA 1CRXA 4P0PA 1S76D 3FAHA 1JALA 4ELVA 4UARA 5AK5A 4BWMA 4I28A 2ZIVB 4NLBA 3QUBA 5AKYA 1BPDA 3JPTA 4F2RA
chains in the Genus database with same CATH topology
2E8OA 2YTUA 5JU5A 1X66A 1UCVA 2FE9A 2B6GA 2EANA 2E8MA 2EAMA 2KG5A 4MHVA 2KE7A 1PK1B 2QARA 1SXEA 3TADC 3KKAC 1LKYB 1UQVA 1B0XA 2LMRA 2KSOA 5JTIA 2QARB 3BS5A 2K4PA 1V85A 1SXDA 1V38A 2JV3A 3K1RB 5J8YA 2D8CA 1B4FA 3SENA 2DKXA 2D3DA 4NJ8A 1COKA 2E8PA 2EAOA 4NL9C 3HILA 3TACB 4PZNA 2Y9UA 3SEIA 2DKZA 1DXSA 2KIVA 1X9XA 5F3XB 3H8MA 2KSOB 5L1MA 3BS5B 5KNIA 2Y9TA 1RG6A 3BS7A 1SV0C 1SGGA 2QB0A 1SV4A 1X40A 4RQMA 2DL0A 2F3NA 1OXJA 3TADA 4NL9A 3KKAA 1F0MA 1OW5A 1PK3A 1PK1A 2QB0B 1Z1VA 2QKQA 1WWVA 2ESEA 2E8NA 5J8YC 4PZOA 2K60A 1LKYA 1KW4A 2F44A 5JRTA 3BQ7A 2ES6A 2LPEA 4IS7A 3IDWA 2EAPA 2L5YA 1SV0A 1WWUA 2QB1A 4RQNA 1JI7A 2GLEA 2KMDA 2F8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8O A;  2YTU A;  5JU5 A;  1X66 A;  1UCV A;  2FE9 A;  2B6G A;  2EAN A;  2E8M A;  2EAM A;  2KG5 A;  4MHV A;  2KE7 A;  1PK1 B;  2QAR A;  1SXE A;  3TAD C;  3KKA C;  1LKY B;  1UQV A;  1B0X A;  2LMR A;  2KSO A;  5JTI A;  2QAR B;  3BS5 A;  2K4P A;  1V85 A;  1SXD A;  1V38 A;  2JV3 A;  3K1R B;  5J8Y A;  2D8C A;  1B4F A;  3SEN A;  2DKX A;  2D3D A;  4NJ8 A;  1COK A;  2E8P A;  2EAO A;  4NL9 C;  3HIL A;  3TAC B;  4PZN A;  2Y9U A;  3SEI A;  2DKZ A;  1DXS A;  2KIV A;  1X9X A;  5F3X B;  3H8M A;  2KSO B;  5L1M A;  3BS5 B;  5KNI A;  2Y9T A;  1RG6 A;  3BS7 A;  1SV0 C;  1SGG A;  2QB0 A;  1SV4 A;  1X40 A;  4RQM A;  2DL0 A;  2F3N A;  1OXJ A;  3TAD A;  4NL9 A;  3KKA A;  1F0M A;  1OW5 A;  1PK3 A;  1PK1 A;  2QB0 B;  1Z1V A;  2QKQ A;  1WWV A;  2ESE A;  2E8N A;  5J8Y C;  4PZO A;  2K60 A;  1LKY A;  1KW4 A;  2F44 A;  5JRT A;  3BQ7 A;  2ES6 A;  2LPE A;  4IS7 A;  3IDW A;  2EAP A;  2L5Y A;  1SV0 A;  1WWU A;  2QB1 A;  4RQN A;  1JI7 A;  2GLE A;  2KMD A;  2F8K A; 
#chains in the Genus database with same CATH topology
 4RZR A;  1U45 A;  2P35 A;  2IOF K;  4QZD A;  3OHA A;  5KFF A;  4ECX A;  4MFC A;  4PHA A;  4YMM A;  5A0L A;  1UA1 A;  2KE7 A;  3V6J A;  1RXW A;  2QAR A;  4LVS A;  4UB1 A;  3MGV A;  4OCZ A;  2K4H A;  2WF5 A;  4TUS A;  4J9P A;  4M9J A;  3FM9 A;  1ZQB A;  4BXO B;  1NK5 A;  3BZK A;  1Q46 A;  1CI4 A;  3K75 D;  2BDU A;  3Q8R B;  3T79 A;  2KIW A;  3WK9 A;  5J8Y A;  1U47 A;  2EDU A;  1N5X A;  1ZQM A;  2XY5 A;  2KFZ A;  1BPE A;  1B4F A;  4I2A A;  1J97 A;  2G07 A;  1TK0 A;  3BQT A;  2ASJ A;  3HIL A;  4C4R A;  2ZJ5 A;  3G6X A;  4JV1 A;  4DL4 A;  1PZN A;  3CP8 A;  5DKW A;  3H0L B;  2UVR A;  2HSZ A;  2WTF A;  2KIV A;  2CN1 A;  3QUC A;  1C20 A;  9ICH A;  2H3Z A;  2ZJ8 A;  2KIC A;  3NGD A;  3F5E A;  3LWM A;  1N48 A;  2ZIX A;  2MUT B;  2YB1 A;  3M9O B;  2KKV A;  1HUZ A;  9ICJ A;  3SAH A;  1N61 A;  4RQ8 A;  1ZD4 A;  1PK3 A;  2BCV A;  4B9S A;  3C2M A;  5ALK A;  9ICE A;  4C4T A;  4FBT A;  2ESE A;  2B21 A;  5IIN A;  2BPG A;  5D49 A;  3MFI A;  3RAX A;  1KW4 A;  2F44 A;  4YR2 A;  2ES6 A;  4PH5 A;  4RNO A;  3IDW A;  4ED6 A;  4Y2S A;  1XU4 A;  5KG0 A;  1U4B A;  1QH9 A;  5ALG A;  1P7D A;  5KAF U;  3PW2 A;  1S97 A;  3C2L A;  3HW8 A;  2JEG A;  1T3Q A;  1S9F A;  2W11 A;  1PUZ A;  1JRP A;  1UCV A;  2FE9 A;  3SAF A;  2I9G A;  1K1Q A;  8ICW A;  3PVX A;  4F4K A;  2YY6 A;  4QZF A;  1VJ5 A;  3KKA C;  1LB2 B;  3RR8 A;  1Z3E B;  3MDA A;  4FZL A;  3QZ7 A;  4Z6E A;  2XVT A;  4ECZ A;  3GFK B;  2E3T A;  3WKE A;  3PW4 A;  3ALR A;  3MR5 A;  2OYY A;  4C8N A;  4AYB C;  2DQN B;  5IIM A;  5B66 U;  3PX0 A;  1UHU A;  4YD1 A;  4R63 A;  3KD3 A;  2K8A A;  2MAX A;  1URJ A;  3TAC B;  4GXJ A;  3KHL A;  3M7D A;  1X9W A;  2JXJ A;  3AL0 B;  3RAQ A;  5KG3 A;  4B9N A;  3VCB A;  3ZDA A;  7ICQ A;  4EEK A;  1WCN A;  2I5H A;  4DO9 A;  2BGW A;  3BS5 B;  3F2C A;  1ZQV A;  3PMN A;  3SD7 A;  2LHT A;  3L3F X;  1O08 A;  4F2S A;  1ZQN A;  5KFY A;  3CYM A;  2F1H A;  1NNL A;  2FPM A;  3PX6 A;  2H3F A;  9ICF A;  5J0X A;  4G3I A;  1T8E A;  2LYA A;  1TAM A;  4QWC A;  1LKY A;  4F5P A;  3TAP A;  3OHB A;  3UQ0 A;  2OM6 A;  4C0Z A;  4C7Y A;  3LDA A;  4O3N A;  2L5Y A;  5J2F A;  1SV0 A;  4QZH A;  1JI7 A;  2KMD A;  1XS9 D;  3QUT A;  4KLI A;  2R8K A;  1D9D A;  4P4M A;  5AM3 A;  2ALZ A;  2H3I A;  4M04 A;  5HP4 A;  2E8M A;  4FZM A;  3ISC A;  1CEZ A;  2C22 A;  1RXV A;  5DLF A;  4IR9 A;  4RU9 A;  5TIS U;  4DL3 A;  1NZB A;  4ECU A;  2G0A A;  1ZQC A;  1ZRM A;  3E58 A;  3TAD C;  7ICJ A;  3M6Z A;  3F2D A;  3MGH A;  1J2M A;  2LM4 A;  4KLH A;  3GV7 B;  2BCR A;  2V9W A;  4O3S A;  3WK7 A;  5DG7 A;  1S0M A;  3RJE A;  4F5N A;  2JV3 A;  4DFP A;  3MR3 A;  2MRL A;  5DB8 A;  1BVS A;  4HAI A;  5GTI U;  4ECS A;  2W7P A;  2WFA A;  4B9V A;  5KFX A;  1MN8 A;  2AU0 A;  4P0Q B;  5DQH A;  4I2J A;  1X6I A;  3C5F A;  4OJL A;  4I2G A;  5J0Y A;  5KFU A;  4I2I A;  5B5E U;  4E0D A;  2KOB A;  2Y9T A;  3ZD9 A;  2JGA A;  2KP7 A;  1NJW A;  1PVP A;  7ICF A;  2FI1 A;  1L8L A;  2OCE A;  1N56 A;  2VA2 A;  4K4I A;  2BR0 A;  1KSP A;  2EH9 A;  2DPI A;  4KMO B;  5AKK A;  4Q45 A;  3UXP A;  4LJX A;  5CB1 A;  3SV3 A;  2E8N A;  1Y88 A;  3QE9 Y;  2XY7 A;  2JHD A;  2K89 A;  4UQG A;  3M8S A;  4YG2 A;  4O5K A;  3CNH A;  2RQ5 A;  2XC9 A;  4EBE A;  2VJ4 A;  4DFM A;  1JUD A;  4MFA A;  4ICA A;  2AXT U;  2EZX A;  3WKD A;  8ICM A;  5CRX A;  4GIB A;  4Y2T A;  2EZZ A;  2NRX A;  2KG5 A;  4R66 A;  1KDH A;  5L1K A;  2LYB A;  4DFD A;  2G5I B;  4F92 B;  8ICO A;  1Z4O A;  2ZTC A;  4MEY A;  3KOO A;  4P0P B;  7ICO A;  4JB3 A;  2OWO A;  3Q8K A;  4ED2 A;  3RFA A;  5DGB A;  3MFH A;  7ICG A;  3BZC A;  3DDH A;  2ZXH A;  2YX8 A;  2BCQ A;  5KL1 B;  4FS1 A;  1C7Y A;  3C1Y A;  2DKX A;  3ISB A;  3BQ0 A;  3H8S A;  1NKB A;  1YZ6 A;  4QZ8 A;  1ZQZ A;  1JN3 A;  8ICY A;  4NLG A;  3TFS A;  3AQE A;  3OPX A;  2K8B B;  4DF4 A;  5KFO A;  3JPS A;  1L7P A;  3I1Y A;  1TFR A;  2GH1 A;  3OSP A;  3PR5 B;  5J29 A;  3MR2 A;  1TV9 A;  4NLC A;  5AK6 A;  4J9R A;  1QQ5 A;  2QKQ A;  5ALS A;  4IQU A;  3NUQ A;  3T5H A;  3GV5 B;  3CRX A;  1A77 A;  5ALT A;  3BJY A;  9ICW A;  1ZD3 A;  3D2Q A;  2H3Q A;  9ICX A;  4F3O A;  3QXG A;  1VDV A;  3ISD A;  4RQ0 A;  4Y2J A;  1NK7 A;  3THV A;  4FBU A;  3RB6 A;  2DGZ A;  2KHQ A;  4QZI A;  2KJ5 A;  2HDO A;  2ZIX B;  4F93 B;  4BWJ A;  2AGP A;  1NZP A;  1ED1 A;  5KFW A;  1FEZ A;  4AYB F;  4C4S A;  3SYZ A;  1ZQH A;  4RQ1 A;  3ZDE A;  4YQW A;  4ELU A;  3N28 A;  2DPJ A;  2HMX A;  4GC6 A;  1U48 A;  4UBC A;  1SIJ A;  3L5K A;  4KLD A;  5ALN A;  1ZQS A;  4DOB A;  2XCP A;  3RR7 A;  8ICV A;  4KN4 A;  3QUQ A;  5CJ7 A;  2NRZ A;  5AKH A;  4P4O A;  1KQQ A;  3M6K A;  1CUK A;  3NRW A;  2E8P A;  3O0F A;  5KG2 A;  7ICE A;  1FIQ A;  4KN7 A;  5KFM A;  3Q8P B;  5K4L A;  1WYG A;  5AI9 A;  3SEI A;  4J9L A;  2LYH A;  3R9K A;  3H8M A;  2XY6 A;  3RJF A;  2AJQ A;  3HJE A;  5KNI A;  3NRZ A;  1ZQJ A;  4NLK A;  3TAQ A;  4UBB A;  5KFN A;  1MA7 A;  5ALD A;  1X40 A;  2F1J A;  8ICK A;  3SI8 A;  1L7O A;  4KLU A;  4YR3 A;  2W8L A;  1F0M A;  4M9L A;  4UB8 U;  2QB0 B;  2Y0S F;  1Z1V A;  5J0W A;  2W9B A;  5AKL A;  2KNJ A;  1X6J A;  5J0R A;  3MAB A;  3N4M B;  8ICN A;  2W9A A;  1X42 A;  5KFV A;  4GLX A;  2W3S A;  3NTU A;  3H40 A;  4US8 A;  1UT5 A;  4DQP A;  2QLT A;  4DCC A;  2HHV A;  4DL2 A;  1KKX A;  4OJ6 A;  3F53 A;  4LZG A;  5F9L A;  2BQU A;  2HBL A;  1X66 A;  1ECW A;  2ZIW A;  3UMB A;  4PJ0 U;  1FFV A;  4IL6 U;  5AM1 A;  2RDI A;  2XIC A;  4EEL A;  1J2N A;  3JPN A;  4IRK A;  3TFR A;  3MR6 A;  3PSP A;  2R8I A;  1UT8 A;  3GIM A;  3BQ2 A;  1LKY B;  8ICG A;  9ICB A;  1V97 A;  4DFJ A;  2JZB A;  2EQY A;  5DLG A;  2F1I A;  4EEY A;  5EWG A;  2ZTD A;  2NO5 A;  1ZQL A;  3HX0 A;  4O3O A;  5DDM A;  3SEN A;  2RP5 A;  3UXO A;  3NVV A;  1SKR A;  9ICV A;  4NM1 A;  1UPH A;  4F5Q A;  7ICP A;  1XNS A;  2KHV A;  4PL1 A;  4MEX A;  1ZYQ A;  3HKZ C;  2PXI A;  1RM6 C;  1NOM A;  2FMS A;  4OJP A;  2A3V A;  2A19 A;  1SL2 A;  4CNQ A;  3DEE A;  1KFD A;  3WKA A;  1SL1 A;  1UA0 A;  2ISP A;  1NI3 A;  1RDF A;  2IOH A;  4AP9 A;  4RQ2 A;  1HJP A;  1L3U A;  2JEJ A;  5AI8 A;  5AHX A;  4PZO A;  1SL0 A;  2KJ8 A;  1A76 A;  2M0N A;  1N63 A;  8ICH A;  4Y2R A;  4EEN A;  3PSI A;  2WF6 A;  1VLB A;  2F8K A;  1KL9 A;  1PVR A;  3OJS A;  2ZUD A;  2LKY A;  4QJF B;  2BQR A;  4RNN A;  4QWE A;  3H0M B;  2C2D A;  3RBD A;  2W03 A;  2JMG A;  5G5H A;  1DGJ A;  4DFK A;  2BDP A;  1D9F A;  3KZI U;  5J0T A;  4Y2U A;  3IG5 A;  4J9S A;  4TUR A;  5E79 U;  1EXN A;  1QLN A;  1IIP A;  4IC9 A;  4O0I A;  4JUZ A;  2UVW A;  5CWR A;  5HHH A;  4USA A;  3TQ1 A;  1KTQ A;  3C28 A;  2RDJ A;  4UB6 U;  4M0A A;  9ICL A;  3LVV A;  3RJG A;  3OGU A;  2IOF A;  1ZJM A;  3EYZ A;  1MC8 A;  5HR6 A;  1MSW D;  5KFS A;  5KG1 A;  4F4Z A;  4A8E A;  3M9N B;  3PW0 A;  5AM5 A;  3EW9 A;  2XGQ A;  3MC1 A;  4PGQ A;  3ZDC A;  2BCS A;  3JPR A;  9ICG A;  8ICF A;  4US9 A;  4YR0 A;  3HP6 A;  8ICU A;  3UM9 A;  3M1Y A;  4DSL A;  2NRT A;  2QB0 A;  1T94 A;  2C28 A;  4I29 A;  1D8L A;  4ECV A;  2DL0 A;  2F3N A;  2CXY A;  1N5W A;  3GQC A;  4DLE A;  3QU7 A;  5ALU A;  1F5S A;  5D46 A;  1ZQW A;  1WCL A;  5J8Y C;  4DSF A;  3Q8Q B;  4QZG A;  7ICU A;  2Y1I A;  3HT3 A;  1L8O A;  2FPK A;  5KG4 A;  4KLJ A;  3QNM A;  2NO4 A;  1KN5 A;  5TZV A;  1SWV A;  5HML A;  3SZ2 A;  3L4P A;  5AK3 A;  4QZB A;  1JXE A;  4EZ9 A;  2PMZ F;  3OJU A;  1RYR A;  5AI6 A;  3E0F A;  5AI5 A;  4HYK A;  3LVW A;  4EX6 A;  2VKQ A;  5L1I A;  5DBB A;  4M6W B;  3I28 A;  4MHV A;  3BDP A;  3QEA Z;  1B43 A;  4MFF A;  5KTQ A;  2BKE A;  2UVV A;  2HBJ A;  3RJK A;  1KBU A;  1FO4 A;  8ICA A;  2ZUB A;  3FC4 A;  5ALL A;  3B0Y A;  3LWL A;  1S77 D;  1QCK A;  2Y0S C;  5DGA A;  5AM2 A;  4F4X A;  3QX7 A;  1PVQ A;  1YT3 A;  4PHD A;  4RT2 A;  2R8J A;  5DG9 A;  3KHR A;  9ICM A;  2HHQ A;  1SZP A;  2KZZ A;  1WG8 A;  3B9J A;  4F4Y A;  1KRP A;  4PGX A;  4ED3 A;  3FYH A;  4F91 B;  2E1F A;  4Z6F A;  2Y9U A;  9ICI A;  1RQN A;  1DXS A;  5EE1 A;  1L7M A;  2JR5 A;  2RHF A;  5AKJ A;  4O3P A;  5EWE A;  1RZT A;  1Z4N A;  2AHO B;  4Z6C A;  2IHN A;  3PR4 A;  3ZDB A;  4ECY A;  5JUM A;  3KHG A;  1S5L U;  2RRD A;  1XC9 A;  3NAS A;  2IA6 A;  3TKA A;  4CDG A;  4ED0 A;  2WAQ F;  3RB3 A;  5EE3 A;  4YCX A;  4M9G A;  4F50 A;  3RB4 A;  3HPO A;  3AMZ A;  4C7Z A;  2B0C A;  3TAR A;  2YML A;  5KFI A;  4YMN A;  3D2N A;  3SQI A;  5KT3 A;  5KT5 A;  4NM2 A;  4RQN A;  9ICO A;  3CW2 C;  2D6F C;  4YP3 A;  4EZ6 A;  5KFZ A;  1KFT A;  4UB2 A;  5KFE A;  4U6P A;  4R65 A;  4WJ3 B;  4KLG A;  3JPO A;  4DWI A;  2B6G A;  4KLE A;  2EAN A;  3TI0 A;  3RBE A;  1X9M A;  2WB1 F;  1DK2 A;  2MA1 A;  2HBK A;  5ALZ A;  3KBB A;  2W9M A;  2ATL A;  4BJQ A;  2M9N A;  2W9B B;  4P4P A;  1FFU A;  5CP2 A;  5KFR A;  5F9N A;  2LMR A;  5AM4 A;  4J9K A;  4O5E A;  7ICR A;  3B0X A;  4O3R A;  1V85 A;  7ICN A;  4GC7 A;  1ZET A;  4C8M A;  4CF5 A;  1ZQI A;  1WUD A;  1X2I A;  3ED5 A;  3PV8 A;  2AGO A;  2DBY A;  3HKZ F;  2HVH A;  4TUP A;  4YMO A;  2KD1 A;  3A0H U;  2ZIW B;  5IIO A;  4IQW A;  5ALX A;  4YN4 A;  1A0P A;  5KG6 A;  3WKC A;  5F3X B;  3D2S A;  5C5J A;  3KZX A;  4UB4 A;  4I2C A;  4ZH4 A;  2G06 A;  3RH5 A;  2JZB B;  4B6J A;  8ICP A;  5C0Y A;  8ICJ A;  1ZJN A;  2RLT A;  2PFP A;  3IG8 A;  2FLL A;  4UB5 A;  1OW5 A;  4QZ9 A;  3ICX A;  2CRX A;  1DK3 A;  4J9O A;  2DUY A;  4DL6 A;  2Q4T A;  1V9P A;  3V7K A;  1BGX T;  4RQ7 A;  3BQ7 A;  2HW3 A;  8ICE A;  2EAP A;  2AQ0 A;  3HRD D;  4UAU A;  4Q8E A;  4ELT A;  4UAV A;  4M6W A;  1ZQT A;  3RJJ A;  4KLL A;  3SV4 A;  2W9C A;  4IRC A;  4NY8 A;  1RQL A;  8ICQ A;  2OEH A;  5AKX A;  4IR1 A;  3E2E A;  2J6T A;  4UAW A;  4F72 A;  2NRV A;  3BQ1 A;  1JMS A;  4I2F A;  5KG5 A;  4DQI A;  2KSO A;  5CR0 A;  2W8K A;  2BQ3 A;  2K4P A;  4C8K A;  1Z00 A;  8ICR A;  3RJI A;  4DS4 A;  4DOA A;  3QU5 A;  4RPX A;  4Y2Q A;  5ALV A;  5EE9 A;  7ICH A;  3PY8 A;  1N60 A;  5AKZ A;  2GWS A;  4UW9 A;  1MQ3 A;  4C8O A;  4ZOH C;  8ICT A;  2BHN A;  7ICI A;  5D4B A;  2KVC A;  1DGS A;  2PMZ C;  9ICK A;  2EZY A;  1L7N A;  2ISO A;  4XQ8 A;  2PFO A;  5CEH A;  3NS1 A;  5KL8 B;  3C5G A;  4GXK A;  2P6U A;  3V72 A;  2Z7J A;  3MDC A;  2MSN A;  1S10 A;  4QIW F;  1SZH A;  5CHG A;  5HMM A;  3ZI4 A;  2P6R A;  1OUQ A;  2UVU A;  4YXJ A;  4J9Q A;  1TK5 A;  2ZTE A;  1PK1 A;  1ZQR A;  4KIT B;  1NJY A;  4DSI A;  5III A;  1ZQF A;  3OSN A;  3C21 A;  3C2K A;  3GII A;  1MQ2 A;  2MU2 A;  1XSL A;  5DDY A;  3AUO A;  1B22 A;  2HI0 A;  1JXL A;  4J03 A;  1XO1 A;  1GO3 F;  3GIJ A;  1WWU A;  5DQG A;  3I76 A;  4DQS A;  3RRG A;  5BOL A;  2BCU A;  1ZRN A;  5AKE A;  3ZD8 A;  4O5C A;  1L3T A;  1QQ7 A;  1JX4 A;  3EZ5 A;  5J2C A;  4CRX A;  4RQ5 A;  1BNP A;  3H7I A;  4G9B A;  5L1J A;  1ZOL A;  2WF9 A;  1B0X A;  2W04 A;  1SKS A;  2WAQ C;  3RH6 A;  4KLO A;  2Y1J A;  3PW7 A;  3PML A;  4C8L A;  3LYS A;  4OO1 J;  2YMP A;  3NVZ A;  3WU2 U;  4RUC A;  2FJ6 A;  3N7R C;  4ED7 A;  5L9X A;  4ECR A;  1RPL A;  3TAN A;  1ZQP A;  1QSL A;  4NL9 C;  4XRH A;  4BX9 C;  2LM1 A;  1F44 A;  2K4E A;  2WB1 C;  4YFK A;  2IMW P;  4I27 A;  4I2E A;  1KLN A;  1RG6 A;  3BS7 A;  9ICT A;  5KT6 A;  3GIL A;  1SV4 A;  3SMV A;  3PNC A;  3N97 B;  4NXZ A;  4CGZ A;  4EYI B;  5GTH U;  1OXJ A;  4CF4 A;  4JWN A;  3KKA A;  4NLZ A;  4YVZ A;  3Q8M A;  5AKI A;  4OD0 A;  2W3R A;  2XID A;  3MGI A;  8ICL A;  5KFK A;  4ECT A;  5ALH A;  4B9M A;  1XWL A;  4I2H A;  4FE3 A;  3HWT A;  2ASL A;  1ZQA A;  4Q8F A;  2GLE A;  2OXO A;  5ALP A;  3EPG A;  5ALJ A;  5AI4 A;  3SR6 A;  2J6U A;  5KFG A;  4PHE A;  4UAY A;  3ONN A;  1ZXI A;  3RB0 A;  3JPP A;  3H4D A;  3QU9 A;  2K8C B;  4JWM A;  4QWB A;  3KFU F;  2E5S A;  3Q8L A;  2VJ5 A;  5ALI A;  1HUO A;  2A1J A;  4KLS A;  3DV9 A;  5JTI A;  2KZ3 A;  4ACO A;  1T3N A;  2HHT A;  5IIJ A;  1SXD A;  4JV0 A;  8ICI A;  1BNO A;  4FFD A;  2KN7 A;  3EPI A;  4U7C A;  4KLM A;  4RPY A;  1S0O A;  4Y2Y A;  2R8G A;  3RF9 A;  3C23 A;  2G5H B;  2V4R A;  3UXN A;  5DB7 A;  4R8U A;  4KX5 A;  4XUS A;  2W55 A;  1ZQQ A;  4NJ8 A;  3JPQ A;  1NJX A;  3S6J A;  2FMP A;  1COK A;  5ALM A;  2ODG A;  4DQQ A;  7ICM A;  4B9L A;  4JK1 A;  1Z19 A;  3RH4 A;  3V6K A;  8ICB A;  3G6V A;  2K4I A;  3AEV A;  2JH7 A;  4MF2 A;  4M9H A;  1LVH A;  2FLN A;  7ICT A;  1COO A;  1M6Y A;  3OTQ A;  3A0B U;  5DG8 A;  5HR7 A;  5J2A A;  4DSE A;  2HHS A;  9ICQ A;  2DF4 B;  1D8Y A;  3TAD A;  3PSF A;  2AQ4 A;  1L6N A;  5DB6 A;  2PI5 A;  5J2I A;  4EBC A;  1LV5 A;  1RYU A;  5AIA A;  1XSN A;  5J2G A;  4CE6 A;  3ETR A;  4YXM A;  4IRD A;  2K60 A;  5J2E A;  4QZC A;  2XGP A;  3QEB Z;  3ETL A;  1NJZ A;  5J0S A;  4DF8 A;  1ZQY A;  4UAT A;  1ARO P;  3T5K A;  2NYV A;  5J2D A;  3WK4 A;  4O3Q A;  2G08 A;  1ZQG A;  3VC8 A;  4PGY A;  4M9N A;  1AQ6 A;  3QU2 A;  3QYP A;  2XCA A;  1NK9 A;  3AU2 A;  5EE0 A;  4QNL A;  3WKB A;  4RUA A;  4F71 A;  4GFJ A;  4DSK A;  2Q0Z X;  1BPX A;  4BUG A;  4JMU A;  3UMC A;  4QIW C;  1ZQK A;  5ALY A;  1Q3V A;  2ZUC A;  5EOZ A;  5KFT A;  1Z1B A;  2J6S A;  2ASD A;  2XI9 A;  3PST A;  3IN5 A;  3GZF A;  2D8C A;  2W9C B;  5J2K A;  3IP4 B;  2D3D A;  5KFQ A;  4FZN A;  2W43 A;  2KEY A;  4KX3 A;  3SAG A;  1K5O A;  4NV0 A;  4DL5 A;  5J0O A;  5EWF A;  4ECW A;  9ICS A;  1NKC A;  2XO7 A;  4YD2 A;  3GIK A;  2GO7 A;  1NK4 A;  2ZIV A;  1QQ6 A;  4K4G A;  1X9X A;  3PX4 A;  4EX7 A;  2KSO B;  1IG6 A;  3H8W A;  2KKP A;  2W54 A;  1Z00 B;  4MF8 A;  2OH2 A;  1ZQX A;  1TAQ A;  2G09 A;  1L5U A;  1D8B A;  3U26 A;  2V4Q A;  2E1E A;  1NK6 A;  4KLF A;  4Z6D A;  3M8R A;  4K4H A;  2ZIU B;  4Q44 A;  2ZG6 A;  1XSP A;  2WF7 A;  4CF3 A;  2JEI A;  4BXO A;  2W7O A;  1L3S A;  5KAI U;  4RQ3 A;  1U49 A;  1NK0 A;  4TQS A;  1DRG A;  1ZQD A;  1JRO A;  2E8O A;  4KTQ A;  1N2X A;  5H2F U;  3WK5 A;  5KFH A;  1ZQU A;  4C80 A;  2A1A A;  5CA7 A;  5ALO A;  5J2H A;  2F76 X;  5KFA A;  4NLN A;  2KFN A;  1PK1 B;  2WHE A;  3KTQ A;  4NWI A;  3WK6 A;  4P2H A;  5DBC A;  1JIH A;  4Y2P A;  8ICZ A;  2HVI A;  2F77 X;  1UQV A;  4R64 A;  1S8O A;  4Y2X A;  4UAS A;  3NVW A;  3AQF A;  1V38 A;  2MUT A;  2HOF A;  3UMG A;  3PO4 A;  1BPB A;  2NV3 A;  5KT4 A;  1N62 A;  3UQ2 A;  4TQR A;  2JEF A;  3RRH A;  8ICX A;  1BPY A;  4DQR A;  2DKZ A;  2C2E A;  2FMQ A;  2HOI A;  2LBO A;  4EBD A;  3C1Z A;  1SV0 C;  5L1L A;  2N1R A;  2YMQ A;  4DEZ A;  5KFJ A;  5AK4 A;  3IHQ B;  1SKW A;  4X5V A;  1XO0 A;  4RQ6 A;  3PZP A;  1U9L A;  3MBY A;  1WWV A;  3V6H A;  4F5O A;  4M47 A;  3ORY A;  5IIK A;  5ALR A;  3UPQ A;  2C2R A;  4IS7 A;  1IXR A;  4DOC A;  3T5J A;  3FDS A;  1S0V A;  5KT2 A;  4GXI A;  3J81 j;  3N7S C;  4PL2 A;  2VIX A;  1HEK A;  3WK8 A;  4BDP A;  2H3V A;  7ICV A;  2FLP A;  4DSJ A;  2VA8 A;  5KG7 A;  2PFQ A;  2R18 A;  2I6X A;  2AH5 A;  3V7J A;  2I1Q A;  3QU4 A;  4IQV A;  2HHX A;  1ZQO A;  4ECQ A;  3EWA A;  1KEJ A;  1SXE A;  3GU3 A;  2IHM A;  2AGQ A;  2YQE A;  2QAR B;  3BS5 A;  3M9M B;  4XA5 A;  3K4G A;  5J0Q A;  2NRW A;  5J0U A;  4TUQ A;  9ICU A;  5AM0 A;  3NVY A;  4I2B A;  5KFL A;  9ICN A;  7ICS A;  3K1R B;  1DOQ A;  1ZQ1 C;  2PFN A;  1A6S A;  3G6Y A;  2H5X A;  4UAZ A;  5ALQ A;  5IIL A;  1S0N A;  1HIW A;  1NK8 A;  2EAO A;  2F8L A;  2CPR A;  3K1Z A;  2ZJA A;  2O6K A;  5HNK A;  2KV2 A;  1SWW A;  5ALF A;  4Q43 A;  2KVS A;  4FO6 A;  2A1J B;  4BGD A;  1QTM A;  4UB3 A;  2GOL A;  3D6J A;  2R8H A;  2LI6 A;  1O03 A;  5L1M A;  4CCH A;  1TK8 A;  2KTQ A;  5DQI A;  3GDX A;  2PKE A;  3H0R B;  2HOQ A;  4DLG A;  2DFL A;  2ZIU A;  4NL9 A;  1TAU A;  4O9M A;  2HCF A;  1RYS A;  4R8U B;  2DWQ A;  2P66 A;  5DBA A;  4RT3 A;  2BPF A;  8ICC A;  1ZQE A;  4OJ5 A;  3F5A A;  4QWA A;  4LZD A;  3IM1 A;  1KFS A;  5JRT A;  2VAN A;  2LPE A;  5ALE A;  5KFD A;  2FPL A;  5J2J A;  5G5G A;  2QB1 A;  2BPC A;  1Q8K A;  5KT7 A;  4JV2 A;  4QWD A;  2YTU A;  9ICC A;  3C29 A;  5JU5 A;  1T7P A;  1L3V A;  4KLQ A;  2VA3 A;  2EAM A;  4QW9 A;  2KZM A;  2IBK A;  4ED8 A;  2ZXI A;  8ICS A;  4P0Q A;  2JRZ A;  1SB3 C;  1YZ7 A;  4F4W A;  4ED1 A;  4M2Y A;  9ICP A;  4O3M A;  5AKG A;  3IV6 A;  3V7L A;  3EUB 2;  4I2D A;  4QZE A;  4RQ4 A;  1QSY A;  1ZD2 P;  2F2A B;  4DS5 A;  1QSS A;  1K1S A;  4RNM A;  1IV8 A;  7ICL A;  3N7P D;  5T14 A;  3LK9 A;  3ZDD A;  4FS2 A;  5HHI A;  1IM4 A;  5KFB A;  4F8R A;  5DB9 A;  2WF8 A;  4J9M A;  3PW5 A;  1BPZ A;  4KLT A;  3H4B A;  2KK0 A;  2YMM A;  4DL7 A;  5J2B A;  3AM9 A;  3AU6 A;  2FDR A;  5FP0 A;  3Q8S B;  2HHW A;  4PZN A;  1TKD A;  5KFC A;  3AN1 A;  3RJH A;  2JH1 A;  3F2B A;  4EYH B;  1T4G A;  2OHF A;  7ICK A;  5BOM A;  4OJO A;  5KFP A;  2YB4 A;  3PO5 A;  4QZA A;  4F5R A;  3T3F A;  4KMU A;  3KHH A;  3QZ8 A;  3IRU A;  1H38 A;  1Q3U A;  2KJ9 A;  1TVA A;  4PHP A;  1SGG A;  4IQT A;  4B9T A;  5AIC A;  4RQM A;  1NKE A;  4QW8 A;  2PI4 A;  1TE2 A;  4RPZ A;  1ZD5 A;  9ICA A;  1X9S A;  9ICR A;  4J9N A;  2HHU A;  5ALW A;  4B9U A;  2YN4 A;  5AI0 A;  2HBM A;  5BPC A;  3RTV A;  5J0P A;  3T5L A;  5AIB A;  2BZF A;  4PPX A;  3H8J A;  3GV8 B;  4Y2V A;  1CRX A;  4P0P A;  1S76 D;  3FAH A;  1JAL A;  4ELV A;  4UAR A;  5AK5 A;  4BWM A;  4I28 A;  2ZIV B;  4NLB A;  3QUB A;  5AKY A;  1BPD A;  3JPT A;  4F2R A; 
#chains in the Genus database with same CATH homology
 2E8O A;  2YTU A;  5JU5 A;  1X66 A;  1UCV A;  2FE9 A;  2B6G A;  2EAN A;  2E8M A;  2EAM A;  2KG5 A;  4MHV A;  2KE7 A;  1PK1 B;  2QAR A;  1SXE A;  3TAD C;  3KKA C;  1LKY B;  1UQV A;  1B0X A;  2LMR A;  2KSO A;  5JTI A;  2QAR B;  3BS5 A;  2K4P A;  1V85 A;  1SXD A;  1V38 A;  2JV3 A;  3K1R B;  5J8Y A;  2D8C A;  1B4F A;  3SEN A;  2DKX A;  2D3D A;  4NJ8 A;  1COK A;  2E8P A;  2EAO A;  4NL9 C;  3HIL A;  3TAC B;  4PZN A;  2Y9U A;  3SEI A;  2DKZ A;  1DXS A;  2KIV A;  1X9X A;  5F3X B;  3H8M A;  2KSO B;  5L1M A;  3BS5 B;  5KNI A;  2Y9T A;  1RG6 A;  3BS7 A;  1SV0 C;  1SGG A;  2QB0 A;  1SV4 A;  1X40 A;  4RQM A;  2DL0 A;  2F3N A;  1OXJ A;  3TAD A;  4NL9 A;  3KKA A;  1F0M A;  1OW5 A;  1PK3 A;  1PK1 A;  2QB0 B;  1Z1V A;  2QKQ A;  1WWV A;  2ESE A;  2E8N A;  5J8Y C;  4PZO A;  2K60 A;  1LKY A;  1KW4 A;  2F44 A;  5JRT A;  3BQ7 A;  2ES6 A;  2LPE A;  4IS7 A;  3IDW A;  2EAP A;  2L5Y A;  1SV0 A;  1WWU A;  2QB1 A;  4RQN A;  1JI7 A;  2GLE A;  2KMD A;  2F8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...