2LMRA

Solution structure of the first sam domain of odin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
MISGLRTLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the First Sam Domain of Odin and Binding Studies with the EphA2 Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ankyrin repeat and SAM domain-containing protein 1A
total genus 12
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2lmrA01
2QARA 1LKYA 2GLEA 1SGGA 2EAMA 5JTIA 4NL9A 1SV0A 2K60A 4PZNA 2DKXA 3H8MA 1Z1VA 2DL0A 1SV0C 5KNIA 3SENA 2ESEA 1OW5A 2DKZA 2Y9TA 2KSOA 1WWVA 1SXEA 2KE7A 1COKA 2D3DA 2JV3A 2F8KA 1B4FA 2ES6A 2QB1A 4IS7A 2YTUA 5JRTA 1DXSA 2F3NA 2EAPA 2D8CA 2E8MA 4PZOA 3SEIA 1OXJA 5JU5A 1LKYB 1PK1B 2KMDA 3KKAC 3TACB 2E8NA 1F0MA 2K4PA 1UQVA 2QB0B 1PK3A 2QKQA 3BS5B 1PK1A 1KW4A 3BS5A 2EANA 2LMRA 1UCVA 2KG5A 3TADC 5J8YA 2E8OA 2E8PA 2F44A 1SV4A 3K1RB 5L1MA 2FE9A 4RQNA 1V38A 2KSOB 1JI7A 4RQMA 4NJ8A 1X9XA 1B0XA 3HILA 3TADA 2QARB 5J8YC 3IDWA 2QB0A 2KIVA 3KKAA 3BQ7A 1V85A 5F3XB 1RG6A 4MHVA 3BS7A 2LPEA 1X66A 1WWUA 2Y9UA 2L5YA 2B6GA 2EAOA 4NL9C 1SXDA 1X40A
chains in the Genus database with same CATH superfamily
3MR3A 1ZQKA 1LKYA 1ZQLA 3GFKB 3JPQA 4O5CA 3EW9A 2B21A 2DQNB 4F4KA 5KFTA 4EBDA 5HR6A 8ICIA 3OPXA 3GV7B 2W11A 1B22A 2I1QA 1MA7A 1ZQQA 5ALDA 4M9HA 2DUYA 9ICVA 3RH6A 2D3DA 5DB8A 4KN4A 3AM9A 3RJEA 4ED8A 3KTQA 3ORYA 4UBBA 1BPZA 1NK4A 3BQ1A 3ZI4A 4RQ3A 2ZJAA 4FS2A 2AH5A 1L3UA 1D9FA 4O3RA 2PMZC 4YR2A 1SL0A 4MEXA 2FDRA 4USAA 1DGSA 2W9AA 2QB0B 1RYRA 2WFAA 3RRHA 3OSPA 3RR8A 2EANA 5EWEA 2I9GA 5J2JA 3ED5A 2F44A 1BPDA 1QTMA 4Y2PA 2J6SA 1S0MA 4EELA 5B5EU 2KSOB 4F71A 3JPSA 2NO4A 3T5KA 2FI1A 7ICMA 5ALYA 4DEZA 2QARB 8ICXA 4FFDA 1RYSA 9ICWA 2HOQA 5F9LA 4MFAA 5DLGA 3T3FA 5IINA 3D6JA 5KFXA 2HBMA 1Z1BA 2L5YA 2BQUA 2IMWP 4YXMA 2UVVA 3FYHA 2KV2A 5AI9A 5KFGA 5DB6A 1ZQPA 2WB1F 2YMMA 4F5RA 3SMVA 3AU6A 2XO7A 2DPIA 4QZFA 5KFOA 1SL1A 1PUZA 1ZD3A 2OEHA 5EWGA 3HWTA 5DQIA 7ICQA 3SENA 3RJJA 3O0FA 4PL2A 4UAYA 4C4RA 3UPQA 1LB2B 2W55A 5J2AA 3C23A 3SAFA 4Z6FA 4QZHA 2G5IB 4NLZA 9ICAA 3QZ8A 1V9PA 2HMXA 4EENA 2Z7JA 1DXSA 3QU5A 4CF4A 2YX8A 1UA0A 3OJSA 5AKLA 1PK1B 1K1SA 3M9MB 4MFFA 4DO9A 5AI0A 4EBEA 1L5UA 2AGOA 4I29A 2ZIWB 4OJOA 7ICEA 2NO5A 5EOZA 1KTQA 1RXVA 2XI9A 4QZEA 2K8CB 4YD1A 3KOOA 4IRKA 5KT7A 5DBAA 2BCQA 3PW2A 3PSPA 3QEAZ 1Q46A 3KFUF 2W9MA 5AM2A 4KLLA 4DCCA 2PFPA 1TE2A 4P0QA 2Q0ZX 4FZNA 2NRTA 3HJEA 2HCFA 2QB0A 2BHNA 4FS1A 2LKYA 3GQCA 4Y2QA 4AYBC 5AI4A 5KT3A 1Q8KA 5ALGA 1ZRNA 3AMZA 1NKCA 1NK6A 3V7KA 3BQ0A 2XY7A 2AHOB 3OJUA 5CJ7A 7ICKA 4DOAA 2J6UA 4QZGA 1BPEA 1J97A 3QUTA 1NK0A 2V4QA 4F2RA 2YY6A 3A0HU 1VJ5A 2AGPA 3H40A 2WHEA 2AXTU 8ICGA 5CWRA 4MF2A 3QE9Y 4PGYA 4KLOA 2OHFA 2PI5A 5ALSA 2EH9A 4CGZA 3T5HA 2VA3A 4OCZA 4O5EA 5J0QA 2DWQA 4BXOB 1S0OA 5AK5A 3SEIA 1OXJA 9ICGA 2Q4TA 1LKYB 4GFJA 4F2SA 1AQ6A 2HHXA 3QYPA 4DFKA 5L1KA 5H2FU 3WK7A 3PX4A 3ZDBA 1QQ5A 1ZQAA 2BQ3A 1X9WA 1NOMA 4IQWA 3EZ5A 3RJKA 3NTUA 5J2BA 2IA6A 4F91B 3RH4A 8ICEA 3MDAA 5KG0A 1RYUA 2RRDA 2ZTDA 2HW3A 9ICXA 3WU2U 1JXEA 4QJFB 5J29A 3HP6A 4QZDA 2ZIUA 4UB2A 2XIDA 4RQ4A 1D8BA 3F2CA 2A1JB 2FMSA 3GIIA 5CRXA 4KN7A 4DLEA 4J03A 4RQ0A 4ZOHC 4P0PA 3UMCA 4BJQA 1N56A 5BOMA 3T5JA 2MA1A 2KNJA 5AKKA 3EPIA 3LVVA 4KTQA 8ICJA 4M9JA 1ZQGA 4ECTA 5AM0A 8ICMA 1C7YA 1SV0C 4M9NA 4I2AA 2DKZA 8ICPA 2ZJ8A 3SAGA 4Q8EA 4YCXA 1BPBA 2HHUA 1U48A 2JEGA 1L8OA 4RQ7A 4DWIA 1KEJA 5JRTA 5DB7A 4DL4A 1XC9A 3PW4A 2W9CA 3VCBA 4IR1A 1D8YA 3H0RB 1QSYA 3D2SA 5J2DA 3WKCA 4YMMA 4IL6U 2BPGA 4UB8U 1TFRA 2RDJA 1WG8A 4ECWA 4ECUA 5DG7A 1IV8A 1UT8A 2O6KA 5KFDA 1UCVA 4RPXA 1T94A 2OWOA 2W43A 4KLTA 4J9SA 1QSLA 4ED0A 4XQ8A 8ICHA 4UAZA 7ICRA 3NGDA 4Y2JA 4Q44A 4F3OA 3QU7A 1NKEA 8ICRA 4Y2VA 5J2FA 4I2FA 4YMOA 1Z4OA 3N28A 1RG6A 1U49A 4M47A 5AKEA 4C0ZA 1T4GA 5ALQA 3BDPA 3PMLA 4YP3A 1JRPA 4F93B 2H3ZA 1QQ6A 3WKEA 3MFHA 5KFQA 4B9SA 5KG6A 3TAPA 5DLFA 1LVHA 4CE6A 2MUTB 3LWMA 1SV0A 5KAIU 4ED7A 4PZNA 3M7DA 2W3SA 4C80A 5CB1A 4QZAA 1ZJNA 3QXGA 5DBCA 1NJWA 3L4PA 4Y2SA 5K4LA 5ALPA 3UQ2A 1ZD5A 5DB9A 4YG2A 1WWVA 4EEYA 4OJ5A 2KJ8A 1Y88A 2EZZA 4RQ5A 4C4SA 4KITB 5KFHA 4UBCA 3NUQA 3UQ0A 4IQUA 3PO5A 5KFYA 4IRDA 5ALKA 3AL0B 1O08A 1U47A 3KHGA 4TURA 9ICTA 1XO0A 3E2EA 3RBEA 1RDFA 4F5NA 5ALNA 4JV0A 3MGHA 3F5EA 4QZ8A 5L1MA 3GIJA 1NJZA 2JHDA 3ZDAA 2BCSA 4TUPA 4DL6A 3E58A 3M9NB 2AGQA 2A1AA 4RNNA 1KDHA 4FBTA 2Y1JA 4M6WA 3PY8A 1X2IA 2XCPA 5L1JA 3PSFA 4KLUA 1Q3VA 1RZTA 1X9MA 5HMMA 3IG8A 2C2DA 1J2NA 2JZBA 1IIPA 1ZD4A 1TAQA 4DFDA 5EWFA 1Z19A 5JUMA 3S6JA 2ZG6A 4C7ZA 3RH5A 2G08A 3TARA 1CRXA 4DF8A 1IM4A 3B0YA 2PFNA 4F4WA 4Q45A 3LDAA 3Q8QB 2F2AB 4QW9A 3UXPA 2BDPA 1Z1VA 1SL2A 2BR0A 1PVPA 4IC9A 2BCRA 2F1IA 1COKA 2KE7A 2BKEA 3PX6A 2JV3A 3VC8A 4F72A 3UM9A 8ICZA 4IQVA 2GO7A 4NLBA 3RRGA 1WCNA 2WF8A 1ZQCA 2YB1A 2H3QA 2D8CA 1ZQXA 2E8MA 4YFKA 3IP4B 1TV9A 3PMNA 5JU5A 1L3TA 2K4IA 1KFTA 5ALXA 3AUOA 1TK8A 2WB1C 3WKDA 2K4HA 2DPJA 2E8NA 4DQIA 1ZQHA 3GDXA 8ICBA 5A0LA 1S97A 1V97A 4TUSA 4RQ6A 5J0OA 2ZIVB 3GIMA 3RFAA 4JV1A 1KQQA 2PXIA 1LV5A 3MGVA 1NK8A 4GC6A 5AK3A 4Y2UA 4FBUA 4RU9A 3PW5A 2ISOA 4R8UA 4PJ0U 1TKDA 3N97B 2BCVA 7ICPA 3RJFA 3RB4A 2G0AA 2F1HA 9ICHA 4J9NA 4JWMA 3ZDEA 4QZBA 3MGIA 4C8OA 2A3VA 4O9MA 5AI6A 5AM5A 3BS7A 4EYIB 1URJA 1DK3A 3AN1A 3DDHA 2AQ0A 5AK4A 4P0PB 3TANA 1QLNA 3TFSA 4KLJA 3ISBA 5JTIA 2WF5A 9ICUA 3KHHA 2ZXHA 2WF7A 3C28A 3RB3A 4JWNA 3QU4A 4PPXA 1OW5A 4CCHA 4ZH4A 3BQTA 2KSOA 2UVUA 1ZQRA 1A76A 2K4EA 3EYZA 1U45A 1L3SA 2ES6A 5C0YA 2KKPA 3SV4A 3WK5A 2LYHA 3UMBA 4GXKA 8ICCA 2C2RA 2CXYA 4O3PA 3SI8A 9ICRA 3GIKA 4ECVA 7ICJA 3RAXA 3WKBA 3OSNA 4NLNA 2YQEA 3NVYA 4OD0A 2ODGA 2OXOA 3BS5A 4Q43A 1N5WA 4Z6DA 4CF3A 2XGPA 1SZPA 2EQYA 2FPKA 5AHXA 2OCEA 3OTQA 3RBDA 4NM2A 9ICBA 9ICCA 2JR5A 5J0TA 2QLTA 2XY6A 5F9NA 3E0FA 4R65A 4AYBF 5HNKA 5ALMA 3H4BA 2BZFA 3I76A 3QUBA 4U6PA 3RB0A 4RQ2A 3C5FA 1NZBA 1JUDA 2KZ3A 3HILA 4DL7A 2V9WA 4CRXA 4R63A 2XY5A 2ASLA 4LZDA 8ICAA 1NK7A 4WJ3B 7ICIA 3RTVA 8ICWA 2HHSA 1IG6A 1X66A 2F1JA 2H3IA 3M6KA 3SYZA 5J2EA 5IIJA 3G6YA 3ZDDA 2QARA 5KFIA 4KX5A 3PR4A 1RPLA 4QW8A 1SIJA 3BJYA 3MC1A 4US8A 2Y0SF 1SWVA 3ALRA 5GTHU 1UA1A 5GTIU 2B0CA 3HW8A 1ZQFA 5KFSA 3V6JA 5KTQA 1HEKA 4C8LA 1QQ7A 1NNLA 3ISDA 3QEBZ 9ICKA 3H4DA 3PO4A 3SR6A 4PHDA 2G06A 3IV6A 1YT3A 4YR3A 2EZYA 4DL5A 8ICLA 5J0UA 4KLMA 5J2HA 2Y1IA 3TI0A 3WK9A 1M6YA 4K4HA 2NYVA 2R18A 3F5AA 4F5OA 8ICTA 3IRUA 4UATA 5EE3A 1A77A 1PK1A 3BZCA 3WKAA 4F4ZA 2KG5A 2P66A 2P6RA 4RUCA 4YQWA 3AU2A 4BGDA 9ICPA 4PGQA 4KLDA 2OH2A 9ICNA 5ALHA 1K1QA 3K1RB 3HRDD 7ICTA 3ONNA 1RM6C 3C2MA 4QIWF 1JROA 3JPNA 2JMGA 1KL9A 3A0BU 1D9DA 3C5GA 2KVSA 1X9XA 1B0XA 5AICA 3JPTA 2CN1A 4MF8A 4DOCA 3IDWA 3I28A 1RXWA 2BPCA 4GXJA 2WF9A 4M9LA 4BX9C 4TQRA 5ALRA 3BQ2A 4UAVA 2OM6A 7ICVA 1WWUA 2HI0A 5DG8A 2XCAA 4UB4A 3OGUA 5KT2A 2KICA 4DS5A 2DBYA 3CYMA 4ELTA 2EAMA 3H7IA 4DSJA 3TAQA 3N7SC 2DKXA 3H8MA 2VIXA 3V6HA 3PW0A 2HOIA 7ICFA 4BUGA 3UMGA 3LWLA 1BPXA 4LVSA 3GU3A 3Q8MA 2WAQF 4I2IA 3Q8RB 1X6IA 4NM1A 4QZIA 1ZQJA 5HMLA 3NVZA 4UQGA 1NK9A 1ECWA 1ZQYA 2V4RA 1T7PA 2ZUBA 3PSIA 4KMOB 2AJQA 4DFMA 1S0VA 1WUDA 4QZ9A 4XRHA 1J2MA 1F0MA 1S8OA 2A19A 4IR9A 5KFVA 2RDIA 5ALLA 2QKQA 5KFCA 9ICOA 2A1JA 3KHRA 1T3NA 1QH9A 4ECZA 2R8IA 2KZMA 1DK2A 2XICA 3RAQA 4G3IA 1ZJMA 3M8SA 1KLNA 3K1ZA 2PKEA 3M8RA 4C8NA 2F8LA 4QWAA 4RQNA 3WK8A 5CHGA 4OJLA 3FC4A 1ZQOA 2GWSA 2EDUA 4R8UB 4NV0A 4M0AA 4O3OA 3N7RC 4BDPA 2G5HB 3BQ7A 1TK5A 5KFMA 2HBJA 5J2KA 5KL8B 5G5HA 2MUTA 3EWAA 3HX0A 4R64A 2Y9UA 1FEZA 4DFJA 2EAOA 4NL9C 1SXDA 2HHWA 3CW2C 3PZPA 5DDYA 2HDOA 3WK6A 5KL1B 4TQSA 4I2CA 3QUQA 4UAUA 1TAUA 4ELUA 4MEYA 3C2LA 1NK5A 5ALUA 2ZIXB 5KNIA 5DBBA 1DOQA 3I1YA 2FPMA 3V72A 4BXOA 4XUSA 3CP8A 2HSZA 4Y2YA 3WK4A 5D4BA 4MFCA 2QB1A 3KZIU 4ECQA 3FAHA 2ZUCA 5HHHA 3RR7A 4O5KA 2EAPA 4PZOA 3M1YA 4YXJA 2XGQA 1BVSA 3DEEA 2XVTA 1VLBA 2NRVA 3ZD9A 2FJ6A 1SKRA 3D2QA 2E1EA 1UQVA 2ZIUB 9ICEA 5KFPA 1QCKA 3C21A 3UXNA 5J0SA 2PI4A 1D8LA 5J8YA 7ICHA 4GXIA 4X5VA 2E8PA 5KT5A 1ZETA 3ISCA 2VANA 2WAQC 4PL1A 8ICKA 2PFOA 4OJPA 1N63A 3ICXA 3UXOA 1ZQDA 1JI7A 2LYAA 5DG9A 3PNCA 2BQRA 2ZTCA 4DSEA 4CDGA 5KFNA 2YN4A 4QZCA 3NRWA 2PMZF 4R66A 3J81j 4J9LA 1GO3F 2KEYA 5AKGA 1SZHA 4EZ9A 1N2XA 5IIOA 2LPEA 4ED2A 5AIBA 1TVAA 4DSFA 4Z6EA 4DOBA 1K5OA 2LM1A 1H38A 5CP2A 1KBUA 2IHNA 4YVZA 5DGAA 1PVRA 1A0PA 4I27A 4UB6U 4F4YA 3F53A 1T3QA 1NZPA 5G5GA 2M0NA 1ZXIA 2HVIA 1JALA 2RQ5A 2K8AA 3RF9A 4DFPA 5ALZA 3T79A 1VDVA 4I2HA 2R8JA 5KFBA 2DL0A 4J9RA 5ALTA 2KJ9A 4K4IA 2GOLA 5KFAA 5L9XA 2AU0A 2KTQA 4F92B 1COOA 3PVXA 7ICGA 3MABA 1JXLA 3RJIA 5KG1A 5KG4A 1S77D 2NRXA 1CI4A 5AI5A 5EE9A 2JXJA 1MN8A 3QZ7A 3HT3A 2MSNA 4K4GA 1MSWD 4O0IA 1Z3EB 5DDMA 1L7MA 5J0XA 1UHUA 1NJYA 1FO4A 2W3RA 4Y2TA 5IIKA 4ED1A 4IQTA 3H0MB 4G9BA 1SB3C 2KIWA 5IILA 4FZMA 1N5XA 4JB3A 1WCLA 3NS1A 4TUQA 4C8MA 5KFKA 2W8KA 4P4MA 1RQNA 5J0WA 4QWDA 1L7OA 3AQFA 4RPYA 4RPZA 1F44A 4DF4A 1ED1A 2MAXA 3SV3A 3B0XA 5EE1A 3PV8A 4RQMA 1SKSA 1DRGA 1U4BA 1KRPA 3RJGA 2VJ4A 4KLIA 5AKYA 5J8YC 2ALZA 2H3VA 4B9TA 3JPRA 3G6XA 2M9NA 3K75D 3L5KA 2J6TA 2LM4A 4E0DA 4DL3A 5L1LA 4KLSA 4DQQA 2KK0A 2LI6A 3Q8KA 1F5SA 3Q8PB 1ZQZA 2DGZA 3F2DA 4UW9A 4DQRA 5KFLA 2CPRA 2UVWA 5KG3A 4NWIA 3LYSA 2JZBB 5AKHA 2R8GA 3MR2A 2W9CB 2KD1A 5BOLA 1YZ6A 4GIBA 2DFLA 2P35A 1N61A 5HP4A 3Q8LA 7ICNA 3NVVA 4Y2XA 2ZIWA 4B9LA 1XSLA 4I2GA 1YZ7A 5KFZA 4PHAA 1X9SA 2W9BA 5KT6A 3B9JA 5DGBA 3BS5B 4KX3A 3DV9A 2WTFA 1ZQBA 2IOFA 2KKVA 2FLNA 1ZQVA 5CR0A 1BGXT 1HJPA 4YN4A 1ZD2P 4I2BA 4PGXA 2E1FA 1O03A 3Q8SB 3G6VA 4M2YA 3K4GA 2KZZA 8ICSA 4KLFA 3KHLA 2I5HA 4B9MA 2W7PA 3H8JA 4Q8FA 3PSTA 4CNQA 5AKZA 1S0NA 1ZQ1C 1MQ3A 4B9UA 1B43A 1HUZA 1U9LA 2JRZA 4MHVA 2KHVA 1Z00B 2KN7A 1Z4NA 1QSSA 5T14A 4ED6A 3THVA 2VA8A 4P4OA 9ICFA 1XSPA 4PHEA 1PZNA 1SGGA 4XA5A 1FFVA 2MU2A 4NL9A 1HIWA 4ICAA 4YR0A 4F50A 4QIWC 1ZYQA 1AROP 2JH1A 4QNLA 5KG7A 3PX0A 1L8LA 1FFUA 1SXEA 4DSKA 2F8KA 4O3SA 1CEZA 8ICYA 5KG2A 1KFDA 3PR5B 4J9KA 3HPOA 2HBKA 3AEVA 3H0LB 5KFUA 4RZRA 7ICOA 1BPYA 1XO1A 4RT2A 4O3NA 4B9VA 2HVHA 4ACOA 2UVRA 2G07A 2KMDA 3KKAC 3SD7A 4RUAA 2JH7A 4Y2RA 2H3FA 4HYKA 2LHTA 2YMPA 5ALEA 5B66U 5AM1A 4QWBA 1BNPA 1L6NA 2F76X 1MQ2A 2G09A 1XWLA 1N60A 2ZTEA 4JK1A 3TADC 2HHTA 4F5PA 2E8OA 1BNOA 4GC7A 2BDUA 4LJXA 4DQSA 2PFQA 4FE3A 4EBCA 1XS9D 4FZLA 5AKIA 5AK6A 5L1IA 4RQ8A 4C4TA 4JV2A 4I2DA 4I2EA 2IBKA 4BWMA 1KFSA 2NRZA 2W7OA 1MC8A 4RNOA 4ECSA 3JPOA 2KFNA 3F2BA 4KLGA 9ICSA 2JEFA 8ICUA 1FIQA 1Q3UA 3T5LA 2MRLA 4RNMA 5J2IA 5J0PA 5ALOA 3R9KA 5J0RA 2WF6A 2JGAA 4CF5A 2XC9A 2JEJA 2ZXIA 5IIIA 1SKWA 3TFRA 5ALIA 3RB6A 2GLEA 3OHBA 3D2NA 2JEIA 1S5LU 4DS4A 4F8RA 3NVWA 2K60A 4NXZA 3QU2A 4UB3A 3FM9A 4C7YA 3V6KA 4B9NA 4NLKA 2LBOA 4DSLA 2ESEA 2W54A 5AI8A 2I6XA 2IOFK 2FLLA 5KFRA 2HHVA 3KBBA 3KD3A 5DQHA 5TZVA 8ICVA 9ICLA 3ZDCA 4J9PA 4GLXA 4BWJA 2FLPA 4QWEA 2GH1A 1HUOA 3GZFA 1TK0A 4O3QA 3EUB2 1EXNA 1X6JA 1KN5A 1L7NA 4J9QA 3M6ZA 2YMQA 4KLQA 4AP9A 4KLHA 4UASA 1PK3A 1ZOLA 2BCUA 2W8LA 4YD2A 2LMRA 2R8KA 3L3FX 4P2HA 3JPPA 4A8EA 4KMUA 4RT3A 3OHAA 3U26A 7ICUA 3LVWA 2KP7A 4YMNA 2CRXA 2Y0SC 2ZIVA 4HAIA 4NLCA 3IHQB 1XSNA 1UPHA 3V7LA 1N62A 4RQ1A 3TADA 2D6FC 1T8EA 3TKAA 1JX4A 2C28A 1IXRA 3QX7A 2DF4B 5C5JA 1XNSA 4PHPA 3ETLA 3CNHA 5KFJA 2B6GA 2IOHA 1L3VA 1ZQWA 2P6UA 5ALWA 3PW7A 2OYYA 2R8HA 3IN5A 4NY8A 3H8SA 2NV3A 3TQ1A 3ZD8A 3AQEA 2YMLA 5E79U 4ELVA 5D46A 4P0QB 4DLGA 4JMUA 2Y9TA 1N48A 5HR7A 1ZQSA 1XU4A 3V7JA 2KFZA 2ISPA 4DL2A 4C8KA 2ASJA 1TAMA 1C20A 1NI3A 2RHFA 2W03A 5KT4A 5TISU 3IM1A 2KJ5A 3C29A 5KFFA 3FDSA 4IRCA 1JIHA 3QUCA 4M04A 3SZ2A 3EPGA 2FPLA 4O3MA 1JMSA 2C22A 1ZQIA 1WYGA 4UAWA 1PVQA 2VA2A 4OJ6A 2ZJ5A 2F77X 1X42A 4QWCA 1ZQMA 4EZ6A 4UB5A 2HOFA 1UT5A 4EYHB 4P4PA 4Z6CA 4F4XA 1ZQEA 3LK9A 1A6SA 1V38A 3GV5B 3MFIA 4DQPA 5KAFU 4NJ8A 4EX6A 5CEHA 4ECYA 5AM4A 2VKQA 9ICJA 2KIVA 2HBLA 5KG5A 4B6JA 1V85A 5DKWA 5F3XB 5KFEA 2RLTA 5ALJA 4J9OA 1CUKA 2K89A 3C1ZA 2K8BB 4M9GA 7ICLA 4KLEA 3MR5A 1DGJA 5ALVA 4EX7A 5J0YA 9ICIA 2EZXA 4JUZA 5J2CA 4DSIA 5J2GA 1OUQA 2FMQA 2W9BB 4UB1A 3NASA 1ZQUA 4ECXA 2KOBA 3H8WA 2KHQA 5DQGA 2H5XA 8ICQA 1S76D 3NRZA 9ICMA 2AQ4A 2ZUDA 9ICQA 3SQIA 1B4FA 1KSPA 3HKZF 2YB4A 1JN3A 5HHIA 4IS7A 2YTUA 8ICFA 4LZGA 4J9MA 5AKJA 3QNMA 2F3NA 2BPFA 8ICOA 4ED3A 3GILA 2E5SA 2ATLA 5EE0A 3MBYA 1L7PA 2N1RA 2ASDA 2W04A 4U7CA 3HKZC 3TACB 1NJXA 2K4PA 3KZXA 3BZKA 3GV8B 2C2EA 4PH5A 1Z00A 3ETRA 1RQLA 1KW4A 4US9A 2BGWA 3MR6A 4I2JA 3CRXA 5AKXA 3N4MB 4ECRA 4OO1J 5FP0A 4EEKA 1ZQNA 5D49A 3SAHA 3M9OB 1S9FA 7ICSA 2HHQA 1KKXA 1SV4A 4FO6A 2KVCA 3IG5A 2FE9A 2VJ5A 1P7DA 3C2KA 5AM3A 2LYBA 5ALFA 3C1YA 4UARA 1NKBA 2RP5A 5CA7A 8ICNA 3MDCA 1ZRMA 2ZIXA 4NLGA 3KKAA 1ZQTA 2NRWA 2E3TA 1SWWA 4F5QA 5AIAA 3N7PD 2FMPA 1S10A 5KFWA 5BPCA 3RJHA 4I28A 3QU9A 5IIMA 1X40A 4M6WB 2IHMA
chains in the Genus database with same CATH topology
2QARA 1LKYA 2GLEA 1SGGA 2EAMA 5JTIA 4NL9A 1SV0A 2K60A 4PZNA 2DKXA 3H8MA 1Z1VA 2DL0A 1SV0C 5KNIA 3SENA 2ESEA 1OW5A 2DKZA 2Y9TA 2KSOA 1WWVA 1SXEA 2KE7A 1COKA 2D3DA 2JV3A 2F8KA 1B4FA 2ES6A 2QB1A 4IS7A 2YTUA 5JRTA 1DXSA 2F3NA 2EAPA 2D8CA 2E8MA 4PZOA 3SEIA 1OXJA 5JU5A 1LKYB 1PK1B 2KMDA 3KKAC 3TACB 2E8NA 1F0MA 2K4PA 1UQVA 2QB0B 1PK3A 2QKQA 3BS5B 1PK1A 1KW4A 3BS5A 2EANA 2LMRA 1UCVA 2KG5A 3TADC 5J8YA 2E8OA 2E8PA 2F44A 1SV4A 3K1RB 5L1MA 2FE9A 4RQNA 1V38A 2KSOB 1JI7A 4RQMA 4NJ8A 1X9XA 1B0XA 3HILA 3TADA 2QARB 5J8YC 3IDWA 2QB0A 2KIVA 3KKAA 3BQ7A 1V85A 5F3XB 1RG6A 4MHVA 3BS7A 2LPEA 1X66A 1WWUA 2Y9UA 2L5YA 2B6GA 2EAOA 4NL9C 1SXDA 1X40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAR A;  1LKY A;  2GLE A;  1SGG A;  2EAM A;  5JTI A;  4NL9 A;  1SV0 A;  2K60 A;  4PZN A;  2DKX A;  3H8M A;  1Z1V A;  2DL0 A;  1SV0 C;  5KNI A;  3SEN A;  2ESE A;  1OW5 A;  2DKZ A;  2Y9T A;  2KSO A;  1WWV A;  1SXE A;  2KE7 A;  1COK A;  2D3D A;  2JV3 A;  2F8K A;  1B4F A;  2ES6 A;  2QB1 A;  4IS7 A;  2YTU A;  5JRT A;  1DXS A;  2F3N A;  2EAP A;  2D8C A;  2E8M A;  4PZO A;  3SEI A;  1OXJ A;  5JU5 A;  1LKY B;  1PK1 B;  2KMD A;  3KKA C;  3TAC B;  2E8N A;  1F0M A;  2K4P A;  1UQV A;  2QB0 B;  1PK3 A;  2QKQ A;  3BS5 B;  1PK1 A;  1KW4 A;  3BS5 A;  2EAN A;  2LMR A;  1UCV A;  2KG5 A;  3TAD C;  5J8Y A;  2E8O A;  2E8P A;  2F44 A;  1SV4 A;  3K1R B;  5L1M A;  2FE9 A;  4RQN A;  1V38 A;  2KSO B;  1JI7 A;  4RQM A;  4NJ8 A;  1X9X A;  1B0X A;  3HIL A;  3TAD A;  2QAR B;  5J8Y C;  3IDW A;  2QB0 A;  2KIV A;  3KKA A;  3BQ7 A;  1V85 A;  5F3X B;  1RG6 A;  4MHV A;  3BS7 A;  2LPE A;  1X66 A;  1WWU A;  2Y9U A;  2L5Y A;  2B6G A;  2EAO A;  4NL9 C;  1SXD A;  1X40 A; 
#chains in the Genus database with same CATH topology
 3MR3 A;  1ZQK A;  1LKY A;  1ZQL A;  3GFK B;  3JPQ A;  4O5C A;  3EW9 A;  2B21 A;  2DQN B;  4F4K A;  5KFT A;  4EBD A;  5HR6 A;  8ICI A;  3OPX A;  3GV7 B;  2W11 A;  1B22 A;  2I1Q A;  1MA7 A;  1ZQQ A;  5ALD A;  4M9H A;  2DUY A;  9ICV A;  3RH6 A;  2D3D A;  5DB8 A;  4KN4 A;  3AM9 A;  3RJE A;  4ED8 A;  3KTQ A;  3ORY A;  4UBB A;  1BPZ A;  1NK4 A;  3BQ1 A;  3ZI4 A;  4RQ3 A;  2ZJA A;  4FS2 A;  2AH5 A;  1L3U A;  1D9F A;  4O3R A;  2PMZ C;  4YR2 A;  1SL0 A;  4MEX A;  2FDR A;  4USA A;  1DGS A;  2W9A A;  2QB0 B;  1RYR A;  2WFA A;  3RRH A;  3OSP A;  3RR8 A;  2EAN A;  5EWE A;  2I9G A;  5J2J A;  3ED5 A;  2F44 A;  1BPD A;  1QTM A;  4Y2P A;  2J6S A;  1S0M A;  4EEL A;  5B5E U;  2KSO B;  4F71 A;  3JPS A;  2NO4 A;  3T5K A;  2FI1 A;  7ICM A;  5ALY A;  4DEZ A;  2QAR B;  8ICX A;  4FFD A;  1RYS A;  9ICW A;  2HOQ A;  5F9L A;  4MFA A;  5DLG A;  3T3F A;  5IIN A;  3D6J A;  5KFX A;  2HBM A;  1Z1B A;  2L5Y A;  2BQU A;  2IMW P;  4YXM A;  2UVV A;  3FYH A;  2KV2 A;  5AI9 A;  5KFG A;  5DB6 A;  1ZQP A;  2WB1 F;  2YMM A;  4F5R A;  3SMV A;  3AU6 A;  2XO7 A;  2DPI A;  4QZF A;  5KFO A;  1SL1 A;  1PUZ A;  1ZD3 A;  2OEH A;  5EWG A;  3HWT A;  5DQI A;  7ICQ A;  3SEN A;  3RJJ A;  3O0F A;  4PL2 A;  4UAY A;  4C4R A;  3UPQ A;  1LB2 B;  2W55 A;  5J2A A;  3C23 A;  3SAF A;  4Z6F A;  4QZH A;  2G5I B;  4NLZ A;  9ICA A;  3QZ8 A;  1V9P A;  2HMX A;  4EEN A;  2Z7J A;  1DXS A;  3QU5 A;  4CF4 A;  2YX8 A;  1UA0 A;  3OJS A;  5AKL A;  1PK1 B;  1K1S A;  3M9M B;  4MFF A;  4DO9 A;  5AI0 A;  4EBE A;  1L5U A;  2AGO A;  4I29 A;  2ZIW B;  4OJO A;  7ICE A;  2NO5 A;  5EOZ A;  1KTQ A;  1RXV A;  2XI9 A;  4QZE A;  2K8C B;  4YD1 A;  3KOO A;  4IRK A;  5KT7 A;  5DBA A;  2BCQ A;  3PW2 A;  3PSP A;  3QEA Z;  1Q46 A;  3KFU F;  2W9M A;  5AM2 A;  4KLL A;  4DCC A;  2PFP A;  1TE2 A;  4P0Q A;  2Q0Z X;  4FZN A;  2NRT A;  3HJE A;  2HCF A;  2QB0 A;  2BHN A;  4FS1 A;  2LKY A;  3GQC A;  4Y2Q A;  4AYB C;  5AI4 A;  5KT3 A;  1Q8K A;  5ALG A;  1ZRN A;  3AMZ A;  1NKC A;  1NK6 A;  3V7K A;  3BQ0 A;  2XY7 A;  2AHO B;  3OJU A;  5CJ7 A;  7ICK A;  4DOA A;  2J6U A;  4QZG A;  1BPE A;  1J97 A;  3QUT A;  1NK0 A;  2V4Q A;  4F2R A;  2YY6 A;  3A0H U;  1VJ5 A;  2AGP A;  3H40 A;  2WHE A;  2AXT U;  8ICG A;  5CWR A;  4MF2 A;  3QE9 Y;  4PGY A;  4KLO A;  2OHF A;  2PI5 A;  5ALS A;  2EH9 A;  4CGZ A;  3T5H A;  2VA3 A;  4OCZ A;  4O5E A;  5J0Q A;  2DWQ A;  4BXO B;  1S0O A;  5AK5 A;  3SEI A;  1OXJ A;  9ICG A;  2Q4T A;  1LKY B;  4GFJ A;  4F2S A;  1AQ6 A;  2HHX A;  3QYP A;  4DFK A;  5L1K A;  5H2F U;  3WK7 A;  3PX4 A;  3ZDB A;  1QQ5 A;  1ZQA A;  2BQ3 A;  1X9W A;  1NOM A;  4IQW A;  3EZ5 A;  3RJK A;  3NTU A;  5J2B A;  2IA6 A;  4F91 B;  3RH4 A;  8ICE A;  3MDA A;  5KG0 A;  1RYU A;  2RRD A;  2ZTD A;  2HW3 A;  9ICX A;  3WU2 U;  1JXE A;  4QJF B;  5J29 A;  3HP6 A;  4QZD A;  2ZIU A;  4UB2 A;  2XID A;  4RQ4 A;  1D8B A;  3F2C A;  2A1J B;  2FMS A;  3GII A;  5CRX A;  4KN7 A;  4DLE A;  4J03 A;  4RQ0 A;  4ZOH C;  4P0P A;  3UMC A;  4BJQ A;  1N56 A;  5BOM A;  3T5J A;  2MA1 A;  2KNJ A;  5AKK A;  3EPI A;  3LVV A;  4KTQ A;  8ICJ A;  4M9J A;  1ZQG A;  4ECT A;  5AM0 A;  8ICM A;  1C7Y A;  1SV0 C;  4M9N A;  4I2A A;  2DKZ A;  8ICP A;  2ZJ8 A;  3SAG A;  4Q8E A;  4YCX A;  1BPB A;  2HHU A;  1U48 A;  2JEG A;  1L8O A;  4RQ7 A;  4DWI A;  1KEJ A;  5JRT A;  5DB7 A;  4DL4 A;  1XC9 A;  3PW4 A;  2W9C A;  3VCB A;  4IR1 A;  1D8Y A;  3H0R B;  1QSY A;  3D2S A;  5J2D A;  3WKC A;  4YMM A;  4IL6 U;  2BPG A;  4UB8 U;  1TFR A;  2RDJ A;  1WG8 A;  4ECW A;  4ECU A;  5DG7 A;  1IV8 A;  1UT8 A;  2O6K A;  5KFD A;  1UCV A;  4RPX A;  1T94 A;  2OWO A;  2W43 A;  4KLT A;  4J9S A;  1QSL A;  4ED0 A;  4XQ8 A;  8ICH A;  4UAZ A;  7ICR A;  3NGD A;  4Y2J A;  4Q44 A;  4F3O A;  3QU7 A;  1NKE A;  8ICR A;  4Y2V A;  5J2F A;  4I2F A;  4YMO A;  1Z4O A;  3N28 A;  1RG6 A;  1U49 A;  4M47 A;  5AKE A;  4C0Z A;  1T4G A;  5ALQ A;  3BDP A;  3PML A;  4YP3 A;  1JRP A;  4F93 B;  2H3Z A;  1QQ6 A;  3WKE A;  3MFH A;  5KFQ A;  4B9S A;  5KG6 A;  3TAP A;  5DLF A;  1LVH A;  4CE6 A;  2MUT B;  3LWM A;  1SV0 A;  5KAI U;  4ED7 A;  4PZN A;  3M7D A;  2W3S A;  4C80 A;  5CB1 A;  4QZA A;  1ZJN A;  3QXG A;  5DBC A;  1NJW A;  3L4P A;  4Y2S A;  5K4L A;  5ALP A;  3UQ2 A;  1ZD5 A;  5DB9 A;  4YG2 A;  1WWV A;  4EEY A;  4OJ5 A;  2KJ8 A;  1Y88 A;  2EZZ A;  4RQ5 A;  4C4S A;  4KIT B;  5KFH A;  4UBC A;  3NUQ A;  3UQ0 A;  4IQU A;  3PO5 A;  5KFY A;  4IRD A;  5ALK A;  3AL0 B;  1O08 A;  1U47 A;  3KHG A;  4TUR A;  9ICT A;  1XO0 A;  3E2E A;  3RBE A;  1RDF A;  4F5N A;  5ALN A;  4JV0 A;  3MGH A;  3F5E A;  4QZ8 A;  5L1M A;  3GIJ A;  1NJZ A;  2JHD A;  3ZDA A;  2BCS A;  4TUP A;  4DL6 A;  3E58 A;  3M9N B;  2AGQ A;  2A1A A;  4RNN A;  1KDH A;  4FBT A;  2Y1J A;  4M6W A;  3PY8 A;  1X2I A;  2XCP A;  5L1J A;  3PSF A;  4KLU A;  1Q3V A;  1RZT A;  1X9M A;  5HMM A;  3IG8 A;  2C2D A;  1J2N A;  2JZB A;  1IIP A;  1ZD4 A;  1TAQ A;  4DFD A;  5EWF A;  1Z19 A;  5JUM A;  3S6J A;  2ZG6 A;  4C7Z A;  3RH5 A;  2G08 A;  3TAR A;  1CRX A;  4DF8 A;  1IM4 A;  3B0Y A;  2PFN A;  4F4W A;  4Q45 A;  3LDA A;  3Q8Q B;  2F2A B;  4QW9 A;  3UXP A;  2BDP A;  1Z1V A;  1SL2 A;  2BR0 A;  1PVP A;  4IC9 A;  2BCR A;  2F1I A;  1COK A;  2KE7 A;  2BKE A;  3PX6 A;  2JV3 A;  3VC8 A;  4F72 A;  3UM9 A;  8ICZ A;  4IQV A;  2GO7 A;  4NLB A;  3RRG A;  1WCN A;  2WF8 A;  1ZQC A;  2YB1 A;  2H3Q A;  2D8C A;  1ZQX A;  2E8M A;  4YFK A;  3IP4 B;  1TV9 A;  3PMN A;  5JU5 A;  1L3T A;  2K4I A;  1KFT A;  5ALX A;  3AUO A;  1TK8 A;  2WB1 C;  3WKD A;  2K4H A;  2DPJ A;  2E8N A;  4DQI A;  1ZQH A;  3GDX A;  8ICB A;  5A0L A;  1S97 A;  1V97 A;  4TUS A;  4RQ6 A;  5J0O A;  2ZIV B;  3GIM A;  3RFA A;  4JV1 A;  1KQQ A;  2PXI A;  1LV5 A;  3MGV A;  1NK8 A;  4GC6 A;  5AK3 A;  4Y2U A;  4FBU A;  4RU9 A;  3PW5 A;  2ISO A;  4R8U A;  4PJ0 U;  1TKD A;  3N97 B;  2BCV A;  7ICP A;  3RJF A;  3RB4 A;  2G0A A;  2F1H A;  9ICH A;  4J9N A;  4JWM A;  3ZDE A;  4QZB A;  3MGI A;  4C8O A;  2A3V A;  4O9M A;  5AI6 A;  5AM5 A;  3BS7 A;  4EYI B;  1URJ A;  1DK3 A;  3AN1 A;  3DDH A;  2AQ0 A;  5AK4 A;  4P0P B;  3TAN A;  1QLN A;  3TFS A;  4KLJ A;  3ISB A;  5JTI A;  2WF5 A;  9ICU A;  3KHH A;  2ZXH A;  2WF7 A;  3C28 A;  3RB3 A;  4JWN A;  3QU4 A;  4PPX A;  1OW5 A;  4CCH A;  4ZH4 A;  3BQT A;  2KSO A;  2UVU A;  1ZQR A;  1A76 A;  2K4E A;  3EYZ A;  1U45 A;  1L3S A;  2ES6 A;  5C0Y A;  2KKP A;  3SV4 A;  3WK5 A;  2LYH A;  3UMB A;  4GXK A;  8ICC A;  2C2R A;  2CXY A;  4O3P A;  3SI8 A;  9ICR A;  3GIK A;  4ECV A;  7ICJ A;  3RAX A;  3WKB A;  3OSN A;  4NLN A;  2YQE A;  3NVY A;  4OD0 A;  2ODG A;  2OXO A;  3BS5 A;  4Q43 A;  1N5W A;  4Z6D A;  4CF3 A;  2XGP A;  1SZP A;  2EQY A;  2FPK A;  5AHX A;  2OCE A;  3OTQ A;  3RBD A;  4NM2 A;  9ICB A;  9ICC A;  2JR5 A;  5J0T A;  2QLT A;  2XY6 A;  5F9N A;  3E0F A;  4R65 A;  4AYB F;  5HNK A;  5ALM A;  3H4B A;  2BZF A;  3I76 A;  3QUB A;  4U6P A;  3RB0 A;  4RQ2 A;  3C5F A;  1NZB A;  1JUD A;  2KZ3 A;  3HIL A;  4DL7 A;  2V9W A;  4CRX A;  4R63 A;  2XY5 A;  2ASL A;  4LZD A;  8ICA A;  1NK7 A;  4WJ3 B;  7ICI A;  3RTV A;  8ICW A;  2HHS A;  1IG6 A;  1X66 A;  2F1J A;  2H3I A;  3M6K A;  3SYZ A;  5J2E A;  5IIJ A;  3G6Y A;  3ZDD A;  2QAR A;  5KFI A;  4KX5 A;  3PR4 A;  1RPL A;  4QW8 A;  1SIJ A;  3BJY A;  3MC1 A;  4US8 A;  2Y0S F;  1SWV A;  3ALR A;  5GTH U;  1UA1 A;  5GTI U;  2B0C A;  3HW8 A;  1ZQF A;  5KFS A;  3V6J A;  5KTQ A;  1HEK A;  4C8L A;  1QQ7 A;  1NNL A;  3ISD A;  3QEB Z;  9ICK A;  3H4D A;  3PO4 A;  3SR6 A;  4PHD A;  2G06 A;  3IV6 A;  1YT3 A;  4YR3 A;  2EZY A;  4DL5 A;  8ICL A;  5J0U A;  4KLM A;  5J2H A;  2Y1I A;  3TI0 A;  3WK9 A;  1M6Y A;  4K4H A;  2NYV A;  2R18 A;  3F5A A;  4F5O A;  8ICT A;  3IRU A;  4UAT A;  5EE3 A;  1A77 A;  1PK1 A;  3BZC A;  3WKA A;  4F4Z A;  2KG5 A;  2P66 A;  2P6R A;  4RUC A;  4YQW A;  3AU2 A;  4BGD A;  9ICP A;  4PGQ A;  4KLD A;  2OH2 A;  9ICN A;  5ALH A;  1K1Q A;  3K1R B;  3HRD D;  7ICT A;  3ONN A;  1RM6 C;  3C2M A;  4QIW F;  1JRO A;  3JPN A;  2JMG A;  1KL9 A;  3A0B U;  1D9D A;  3C5G A;  2KVS A;  1X9X A;  1B0X A;  5AIC A;  3JPT A;  2CN1 A;  4MF8 A;  4DOC A;  3IDW A;  3I28 A;  1RXW A;  2BPC A;  4GXJ A;  2WF9 A;  4M9L A;  4BX9 C;  4TQR A;  5ALR A;  3BQ2 A;  4UAV A;  2OM6 A;  7ICV A;  1WWU A;  2HI0 A;  5DG8 A;  2XCA A;  4UB4 A;  3OGU A;  5KT2 A;  2KIC A;  4DS5 A;  2DBY A;  3CYM A;  4ELT A;  2EAM A;  3H7I A;  4DSJ A;  3TAQ A;  3N7S C;  2DKX A;  3H8M A;  2VIX A;  3V6H A;  3PW0 A;  2HOI A;  7ICF A;  4BUG A;  3UMG A;  3LWL A;  1BPX A;  4LVS A;  3GU3 A;  3Q8M A;  2WAQ F;  4I2I A;  3Q8R B;  1X6I A;  4NM1 A;  4QZI A;  1ZQJ A;  5HML A;  3NVZ A;  4UQG A;  1NK9 A;  1ECW A;  1ZQY A;  2V4R A;  1T7P A;  2ZUB A;  3PSI A;  4KMO B;  2AJQ A;  4DFM A;  1S0V A;  1WUD A;  4QZ9 A;  4XRH A;  1J2M A;  1F0M A;  1S8O A;  2A19 A;  4IR9 A;  5KFV A;  2RDI A;  5ALL A;  2QKQ A;  5KFC A;  9ICO A;  2A1J A;  3KHR A;  1T3N A;  1QH9 A;  4ECZ A;  2R8I A;  2KZM A;  1DK2 A;  2XIC A;  3RAQ A;  4G3I A;  1ZJM A;  3M8S A;  1KLN A;  3K1Z A;  2PKE A;  3M8R A;  4C8N A;  2F8L A;  4QWA A;  4RQN A;  3WK8 A;  5CHG A;  4OJL A;  3FC4 A;  1ZQO A;  2GWS A;  2EDU A;  4R8U B;  4NV0 A;  4M0A A;  4O3O A;  3N7R C;  4BDP A;  2G5H B;  3BQ7 A;  1TK5 A;  5KFM A;  2HBJ A;  5J2K A;  5KL8 B;  5G5H A;  2MUT A;  3EWA A;  3HX0 A;  4R64 A;  2Y9U A;  1FEZ A;  4DFJ A;  2EAO A;  4NL9 C;  1SXD A;  2HHW A;  3CW2 C;  3PZP A;  5DDY A;  2HDO A;  3WK6 A;  5KL1 B;  4TQS A;  4I2C A;  3QUQ A;  4UAU A;  1TAU A;  4ELU A;  4MEY A;  3C2L A;  1NK5 A;  5ALU A;  2ZIX B;  5KNI A;  5DBB A;  1DOQ A;  3I1Y A;  2FPM A;  3V72 A;  4BXO A;  4XUS A;  3CP8 A;  2HSZ A;  4Y2Y A;  3WK4 A;  5D4B A;  4MFC A;  2QB1 A;  3KZI U;  4ECQ A;  3FAH A;  2ZUC A;  5HHH A;  3RR7 A;  4O5K A;  2EAP A;  4PZO A;  3M1Y A;  4YXJ A;  2XGQ A;  1BVS A;  3DEE A;  2XVT A;  1VLB A;  2NRV A;  3ZD9 A;  2FJ6 A;  1SKR A;  3D2Q A;  2E1E A;  1UQV A;  2ZIU B;  9ICE A;  5KFP A;  1QCK A;  3C21 A;  3UXN A;  5J0S A;  2PI4 A;  1D8L A;  5J8Y A;  7ICH A;  4GXI A;  4X5V A;  2E8P A;  5KT5 A;  1ZET A;  3ISC A;  2VAN A;  2WAQ C;  4PL1 A;  8ICK A;  2PFO A;  4OJP A;  1N63 A;  3ICX A;  3UXO A;  1ZQD A;  1JI7 A;  2LYA A;  5DG9 A;  3PNC A;  2BQR A;  2ZTC A;  4DSE A;  4CDG A;  5KFN A;  2YN4 A;  4QZC A;  3NRW A;  2PMZ F;  4R66 A;  3J81 j;  4J9L A;  1GO3 F;  2KEY A;  5AKG A;  1SZH A;  4EZ9 A;  1N2X A;  5IIO A;  2LPE A;  4ED2 A;  5AIB A;  1TVA A;  4DSF A;  4Z6E A;  4DOB A;  1K5O A;  2LM1 A;  1H38 A;  5CP2 A;  1KBU A;  2IHN A;  4YVZ A;  5DGA A;  1PVR A;  1A0P A;  4I27 A;  4UB6 U;  4F4Y A;  3F53 A;  1T3Q A;  1NZP A;  5G5G A;  2M0N A;  1ZXI A;  2HVI A;  1JAL A;  2RQ5 A;  2K8A A;  3RF9 A;  4DFP A;  5ALZ A;  3T79 A;  1VDV A;  4I2H A;  2R8J A;  5KFB A;  2DL0 A;  4J9R A;  5ALT A;  2KJ9 A;  4K4I A;  2GOL A;  5KFA A;  5L9X A;  2AU0 A;  2KTQ A;  4F92 B;  1COO A;  3PVX A;  7ICG A;  3MAB A;  1JXL A;  3RJI A;  5KG1 A;  5KG4 A;  1S77 D;  2NRX A;  1CI4 A;  5AI5 A;  5EE9 A;  2JXJ A;  1MN8 A;  3QZ7 A;  3HT3 A;  2MSN A;  4K4G A;  1MSW D;  4O0I A;  1Z3E B;  5DDM A;  1L7M A;  5J0X A;  1UHU A;  1NJY A;  1FO4 A;  2W3R A;  4Y2T A;  5IIK A;  4ED1 A;  4IQT A;  3H0M B;  4G9B A;  1SB3 C;  2KIW A;  5IIL A;  4FZM A;  1N5X A;  4JB3 A;  1WCL A;  3NS1 A;  4TUQ A;  4C8M A;  5KFK A;  2W8K A;  4P4M A;  1RQN A;  5J0W A;  4QWD A;  1L7O A;  3AQF A;  4RPY A;  4RPZ A;  1F44 A;  4DF4 A;  1ED1 A;  2MAX A;  3SV3 A;  3B0X A;  5EE1 A;  3PV8 A;  4RQM A;  1SKS A;  1DRG A;  1U4B A;  1KRP A;  3RJG A;  2VJ4 A;  4KLI A;  5AKY A;  5J8Y C;  2ALZ A;  2H3V A;  4B9T A;  3JPR A;  3G6X A;  2M9N A;  3K75 D;  3L5K A;  2J6T A;  2LM4 A;  4E0D A;  4DL3 A;  5L1L A;  4KLS A;  4DQQ A;  2KK0 A;  2LI6 A;  3Q8K A;  1F5S A;  3Q8P B;  1ZQZ A;  2DGZ A;  3F2D A;  4UW9 A;  4DQR A;  5KFL A;  2CPR A;  2UVW A;  5KG3 A;  4NWI A;  3LYS A;  2JZB B;  5AKH A;  2R8G A;  3MR2 A;  2W9C B;  2KD1 A;  5BOL A;  1YZ6 A;  4GIB A;  2DFL A;  2P35 A;  1N61 A;  5HP4 A;  3Q8L A;  7ICN A;  3NVV A;  4Y2X A;  2ZIW A;  4B9L A;  1XSL A;  4I2G A;  1YZ7 A;  5KFZ A;  4PHA A;  1X9S A;  2W9B A;  5KT6 A;  3B9J A;  5DGB A;  3BS5 B;  4KX3 A;  3DV9 A;  2WTF A;  1ZQB A;  2IOF A;  2KKV A;  2FLN A;  1ZQV A;  5CR0 A;  1BGX T;  1HJP A;  4YN4 A;  1ZD2 P;  4I2B A;  4PGX A;  2E1F A;  1O03 A;  3Q8S B;  3G6V A;  4M2Y A;  3K4G A;  2KZZ A;  8ICS A;  4KLF A;  3KHL A;  2I5H A;  4B9M A;  2W7P A;  3H8J A;  4Q8F A;  3PST A;  4CNQ A;  5AKZ A;  1S0N A;  1ZQ1 C;  1MQ3 A;  4B9U A;  1B43 A;  1HUZ A;  1U9L A;  2JRZ A;  4MHV A;  2KHV A;  1Z00 B;  2KN7 A;  1Z4N A;  1QSS A;  5T14 A;  4ED6 A;  3THV A;  2VA8 A;  4P4O A;  9ICF A;  1XSP A;  4PHE A;  1PZN A;  1SGG A;  4XA5 A;  1FFV A;  2MU2 A;  4NL9 A;  1HIW A;  4ICA A;  4YR0 A;  4F50 A;  4QIW C;  1ZYQ A;  1ARO P;  2JH1 A;  4QNL A;  5KG7 A;  3PX0 A;  1L8L A;  1FFU A;  1SXE A;  4DSK A;  2F8K A;  4O3S A;  1CEZ A;  8ICY A;  5KG2 A;  1KFD A;  3PR5 B;  4J9K A;  3HPO A;  2HBK A;  3AEV A;  3H0L B;  5KFU A;  4RZR A;  7ICO A;  1BPY A;  1XO1 A;  4RT2 A;  4O3N A;  4B9V A;  2HVH A;  4ACO A;  2UVR A;  2G07 A;  2KMD A;  3KKA C;  3SD7 A;  4RUA A;  2JH7 A;  4Y2R A;  2H3F A;  4HYK A;  2LHT A;  2YMP A;  5ALE A;  5B66 U;  5AM1 A;  4QWB A;  1BNP A;  1L6N A;  2F76 X;  1MQ2 A;  2G09 A;  1XWL A;  1N60 A;  2ZTE A;  4JK1 A;  3TAD C;  2HHT A;  4F5P A;  2E8O A;  1BNO A;  4GC7 A;  2BDU A;  4LJX A;  4DQS A;  2PFQ A;  4FE3 A;  4EBC A;  1XS9 D;  4FZL A;  5AKI A;  5AK6 A;  5L1I A;  4RQ8 A;  4C4T A;  4JV2 A;  4I2D A;  4I2E A;  2IBK A;  4BWM A;  1KFS A;  2NRZ A;  2W7O A;  1MC8 A;  4RNO A;  4ECS A;  3JPO A;  2KFN A;  3F2B A;  4KLG A;  9ICS A;  2JEF A;  8ICU A;  1FIQ A;  1Q3U A;  3T5L A;  2MRL A;  4RNM A;  5J2I A;  5J0P A;  5ALO A;  3R9K A;  5J0R A;  2WF6 A;  2JGA A;  4CF5 A;  2XC9 A;  2JEJ A;  2ZXI A;  5III A;  1SKW A;  3TFR A;  5ALI A;  3RB6 A;  2GLE A;  3OHB A;  3D2N A;  2JEI A;  1S5L U;  4DS4 A;  4F8R A;  3NVW A;  2K60 A;  4NXZ A;  3QU2 A;  4UB3 A;  3FM9 A;  4C7Y A;  3V6K A;  4B9N A;  4NLK A;  2LBO A;  4DSL A;  2ESE A;  2W54 A;  5AI8 A;  2I6X A;  2IOF K;  2FLL A;  5KFR A;  2HHV A;  3KBB A;  3KD3 A;  5DQH A;  5TZV A;  8ICV A;  9ICL A;  3ZDC A;  4J9P A;  4GLX A;  4BWJ A;  2FLP A;  4QWE A;  2GH1 A;  1HUO A;  3GZF A;  1TK0 A;  4O3Q A;  3EUB 2;  1EXN A;  1X6J A;  1KN5 A;  1L7N A;  4J9Q A;  3M6Z A;  2YMQ A;  4KLQ A;  4AP9 A;  4KLH A;  4UAS A;  1PK3 A;  1ZOL A;  2BCU A;  2W8L A;  4YD2 A;  2LMR A;  2R8K A;  3L3F X;  4P2H A;  3JPP A;  4A8E A;  4KMU A;  4RT3 A;  3OHA A;  3U26 A;  7ICU A;  3LVW A;  2KP7 A;  4YMN A;  2CRX A;  2Y0S C;  2ZIV A;  4HAI A;  4NLC A;  3IHQ B;  1XSN A;  1UPH A;  3V7L A;  1N62 A;  4RQ1 A;  3TAD A;  2D6F C;  1T8E A;  3TKA A;  1JX4 A;  2C28 A;  1IXR A;  3QX7 A;  2DF4 B;  5C5J A;  1XNS A;  4PHP A;  3ETL A;  3CNH A;  5KFJ A;  2B6G A;  2IOH A;  1L3V A;  1ZQW A;  2P6U A;  5ALW A;  3PW7 A;  2OYY A;  2R8H A;  3IN5 A;  4NY8 A;  3H8S A;  2NV3 A;  3TQ1 A;  3ZD8 A;  3AQE A;  2YML A;  5E79 U;  4ELV A;  5D46 A;  4P0Q B;  4DLG A;  4JMU A;  2Y9T A;  1N48 A;  5HR7 A;  1ZQS A;  1XU4 A;  3V7J A;  2KFZ A;  2ISP A;  4DL2 A;  4C8K A;  2ASJ A;  1TAM A;  1C20 A;  1NI3 A;  2RHF A;  2W03 A;  5KT4 A;  5TIS U;  3IM1 A;  2KJ5 A;  3C29 A;  5KFF A;  3FDS A;  4IRC A;  1JIH A;  3QUC A;  4M04 A;  3SZ2 A;  3EPG A;  2FPL A;  4O3M A;  1JMS A;  2C22 A;  1ZQI A;  1WYG A;  4UAW A;  1PVQ A;  2VA2 A;  4OJ6 A;  2ZJ5 A;  2F77 X;  1X42 A;  4QWC A;  1ZQM A;  4EZ6 A;  4UB5 A;  2HOF A;  1UT5 A;  4EYH B;  4P4P A;  4Z6C A;  4F4X A;  1ZQE A;  3LK9 A;  1A6S A;  1V38 A;  3GV5 B;  3MFI A;  4DQP A;  5KAF U;  4NJ8 A;  4EX6 A;  5CEH A;  4ECY A;  5AM4 A;  2VKQ A;  9ICJ A;  2KIV A;  2HBL A;  5KG5 A;  4B6J A;  1V85 A;  5DKW A;  5F3X B;  5KFE A;  2RLT A;  5ALJ A;  4J9O A;  1CUK A;  2K89 A;  3C1Z A;  2K8B B;  4M9G A;  7ICL A;  4KLE A;  3MR5 A;  1DGJ A;  5ALV A;  4EX7 A;  5J0Y A;  9ICI A;  2EZX A;  4JUZ A;  5J2C A;  4DSI A;  5J2G A;  1OUQ A;  2FMQ A;  2W9B B;  4UB1 A;  3NAS A;  1ZQU A;  4ECX A;  2KOB A;  3H8W A;  2KHQ A;  5DQG A;  2H5X A;  8ICQ A;  1S76 D;  3NRZ A;  9ICM A;  2AQ4 A;  2ZUD A;  9ICQ A;  3SQI A;  1B4F A;  1KSP A;  3HKZ F;  2YB4 A;  1JN3 A;  5HHI A;  4IS7 A;  2YTU A;  8ICF A;  4LZG A;  4J9M A;  5AKJ A;  3QNM A;  2F3N A;  2BPF A;  8ICO A;  4ED3 A;  3GIL A;  2E5S A;  2ATL A;  5EE0 A;  3MBY A;  1L7P A;  2N1R A;  2ASD A;  2W04 A;  4U7C A;  3HKZ C;  3TAC B;  1NJX A;  2K4P A;  3KZX A;  3BZK A;  3GV8 B;  2C2E A;  4PH5 A;  1Z00 A;  3ETR A;  1RQL A;  1KW4 A;  4US9 A;  2BGW A;  3MR6 A;  4I2J A;  3CRX A;  5AKX A;  3N4M B;  4ECR A;  4OO1 J;  5FP0 A;  4EEK A;  1ZQN A;  5D49 A;  3SAH A;  3M9O B;  1S9F A;  7ICS A;  2HHQ A;  1KKX A;  1SV4 A;  4FO6 A;  2KVC A;  3IG5 A;  2FE9 A;  2VJ5 A;  1P7D A;  3C2K A;  5AM3 A;  2LYB A;  5ALF A;  3C1Y A;  4UAR A;  1NKB A;  2RP5 A;  5CA7 A;  8ICN A;  3MDC A;  1ZRM A;  2ZIX A;  4NLG A;  3KKA A;  1ZQT A;  2NRW A;  2E3T A;  1SWW A;  4F5Q A;  5AIA A;  3N7P D;  2FMP A;  1S10 A;  5KFW A;  5BPC A;  3RJH A;  4I28 A;  3QU9 A;  5IIM A;  1X40 A;  4M6W B;  2IHM A; 
#chains in the Genus database with same CATH homology
 2QAR A;  1LKY A;  2GLE A;  1SGG A;  2EAM A;  5JTI A;  4NL9 A;  1SV0 A;  2K60 A;  4PZN A;  2DKX A;  3H8M A;  1Z1V A;  2DL0 A;  1SV0 C;  5KNI A;  3SEN A;  2ESE A;  1OW5 A;  2DKZ A;  2Y9T A;  2KSO A;  1WWV A;  1SXE A;  2KE7 A;  1COK A;  2D3D A;  2JV3 A;  2F8K A;  1B4F A;  2ES6 A;  2QB1 A;  4IS7 A;  2YTU A;  5JRT A;  1DXS A;  2F3N A;  2EAP A;  2D8C A;  2E8M A;  4PZO A;  3SEI A;  1OXJ A;  5JU5 A;  1LKY B;  1PK1 B;  2KMD A;  3KKA C;  3TAC B;  2E8N A;  1F0M A;  2K4P A;  1UQV A;  2QB0 B;  1PK3 A;  2QKQ A;  3BS5 B;  1PK1 A;  1KW4 A;  3BS5 A;  2EAN A;  2LMR A;  1UCV A;  2KG5 A;  3TAD C;  5J8Y A;  2E8O A;  2E8P A;  2F44 A;  1SV4 A;  3K1R B;  5L1M A;  2FE9 A;  4RQN A;  1V38 A;  2KSO B;  1JI7 A;  4RQM A;  4NJ8 A;  1X9X A;  1B0X A;  3HIL A;  3TAD A;  2QAR B;  5J8Y C;  3IDW A;  2QB0 A;  2KIV A;  3KKA A;  3BQ7 A;  1V85 A;  5F3X B;  1RG6 A;  4MHV A;  3BS7 A;  2LPE A;  1X66 A;  1WWU A;  2Y9U A;  2L5Y A;  2B6G A;  2EAO A;  4NL9 C;  1SXD A;  1X40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...