1NJXA

Thymine-guanine mismatch at the polymerase active site
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njxA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njxA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njxA01
2PYLA 4BDYA 4Z0UA 3NH2A 4B9VA 4YMMA 4CCHA 4R8UA 3F73A 2W42A 3Q8RB 4PWDA 4UQGA 2YNHA 1KTQA 5JUMA 3T5JA 3HK2A 4PGQA 3ZCMA 2PFNA 4OPJA 3ZDCA 4ID1A 4E7IA 3VQ6A 1KCFA 4FS2A 1ZBUA 2MUTB 1CXQA 5CR0A 1RBRA 2BKEA 5DBAA 3JPOA 1ZETA 3MGHA 4R65A 2QXFA 3ISNC 1XHZA 4NYNA 2QKBA 4DQSA 1IO2A 4O0JA 5DB6A 5CYMA 1MSWD 4OGCA 4OLBA 1N48A 3PV8A 2B6AA 1CXUA 2V4RA 2IC3A 4ED2A 1KFTA 2FLNA 3OYIA 4DG1A 8ICBA 4R5PA 1RT7A 4N47A 1TAQA 5DBBA 5J2FA 4NLNA 3NF7A 3C2KA 4F2SA 2KZZA 4J9MA 4O3PA 2R7YA 3K5MA 4I2IA 4DSJA 4MFCA 4PUOA 1YVUA 2Z1HA 1W0HA 4CF9A 2HNDA 4Q43A 3IM1A 3AUOA 2VWKA 3KJVA 3PW2A 4IR9A 3PNCA 1LV5A 2ATLA 4F5OA 3AO4A 1ZBLA 3SNNA 1EX4A 2G8HA 5HRRA 9ICTA 3OYBA 4TQRA 1S1UA 1SL0A 3V6DA 2NRVA 4I2DA 5D4BA 3QEWA 1N6QA 1JIHA 2ZJAA 4CFCA 4R63A 1TFRA 2R8GA 4B9MA 4M2YA 4EZ6A 4F93B 2MAXA 5KFUA 3V7KA 2NRTA 4BDZA 3RMDA 5KT5A 1I3AA 5I42A 3DLKA 2XRIA 5D49A 4DL5A 3SPZA 4GC7A 4J9LA 4NLZA 2DPJA 3HX0A 4BDPA 1HUOA 4NLKA 5BOMA 2P51A 4LSLA 3NBPA 5KT3A 2ATQA 1DTTA 5HP1A 3LWLA 2XCAA 3RR8A 2HHWA 4CHPA 5L9XA 3JPPA 3OJUA 2FPMA 3QEBZ 3Q8KA 2RPIA 2BCVA 3MEGA 1XSNA 5KFBA 1RTJA 3TAPA 3KLHA 1WSIA 5KG1A 4ELVA 1N5YA 1HQEA 5EWFA 3GV7B 2V9WA 4YG2A 2AJQA 4I2BA 1C0UA 3G6YA 1WSJA 1D9FA 2IHNA 4M47A 2G8FA 4KKOA 2RDIA 3CFRA 4I2JA 3D0PA 1LWFA 2C2EA 2BPGA 3GV8B 2R8HA 3WNGA 4I9QA 4YCXA 1VSFA 2A1JA 1XSPA 4CHNA 4RW9A 4HCBA 4KO0A 8ICRA 4RW4A 1IKVA 1H38A 4KN4A 3IRXA 5J2QA 2JGUA 1ZQBA 4XUSA 5J2JA 3EWAA 1SV5A 4FJHA 3TFRA 4CHQA 4ELTA 5CY4A 4W5NA 1KLNA 3RJGA 3MXIA 4MF8A 1L3SA 3MGIA 1TL3A 9ICIA 3JPNA 3NGZA 1ZJNA 2ISOA 3U3GA 2Q0ZX 4KITB 2G8VA 3JPSA 2BCQA 3PY8A 3ISBA 4GMJB 4W5RA 1REVA 5IINA 1JL1A 1Z25A 3NTUA 7ICGA 4E7HA 4QZEA 3OS0A 4GXJA 4RQ3A 2F96A 4KHUA 1Z3EB 3EPGA 5BOLA 1KVCA 3VQ5A 4YQWA 3ALYA 1WSGA 9ICKA 9ICSA 2Z1GA 1B22A 4M3UA 1L3UA 2DFFA 4GXKA 1RILA 1JLCA 4E7JA 1BGXT 4DSEA 3BDPA 4DTUA 1S9GA 4CE9A 1ZQLA 3JYTA 3JSMA 3CM6A 3IS9A 4KLOA 1COOA 5SZTA 5CJ7A 2OPRA 4GLXA 3VA3A 4FK0A 2ZJ8A 9ICLA 3G6XA 4DF8A 1C1BA 4EP4A 4ED1A 3TR8A 5J0UA 5FROA 2NRWA 1ZQWA 9ICHA 2IBKA 4YVZA 1C1AA 4BWJA 4O3QA 4K4GA 3RR7A 1VSEA 4RNMA 1S0VA 3DOKA 3L8BA 3LK9A 1HQUA 2RF2A 4RW7A 1TKXA 1BI4B 4FLZA 4E89A 3P83D 4Y1DA 5J2CA 4DF4A 2YHAA 8ICUA 3ZSOA 4E0DA 4DL3A 4DOBA 1BPYA 1HUZA 5KGWA 1JL2A 3T1AA 4I2CA 8ICFA 2ASLA 4CFAA 3ZT2A 5HHHA 2A1JB 8ICTA 3AVMA 4CEEA 1QE1A 1NJWA 1A5WA 3O3HA 4DL4A 2HHVA 4CHYA 2LYHA 5KG2A 5C42A 4CJEA 2B21A 3ZT3A 2KW4A 3O3GA 3RJHA 4AHUA 4K8ZA 1T05A 2QKKA 4Z4CA 2KZ3A 4KLHA 4CJKA 1C6VA 1XHXA 1CUKA 3LP0A 5C5JA 3AO3A 4IRKA 3MEDA 2BGWA 5KFRA 4J9OA 1YTUA 4YR3A 2BPCA 1S0NA 4QWBA 4K8XA 3OYLA 3O3FA 3OYGA 5J2MA 3HP9A 3HO1A 1C7YA 1KVAA 4ZTJA 3ISDA 5KRSA 1ZQHA 5EU7A 4OKJA 4I7FA 3AU6A 5C25A 2OPSA 2DY4A 4JUZA 4CEBA 4CESA 3V6HA 7ICFA 4H8KA 2B5JA 2DFHA 8ICLA 4E19A 4CIFA 2P5OA 1NK4A 4E7KA 5KT6A 3MXMA 4RT2A 4M9NA 3SUOA 2D0CA 2UVRA 1RTDA 3K5OA 3AO5A 1S9FA 4DFPA 1DTQA 3B0XA 5L1IA 4OGEA 3KLEA 3HWTA 4PHEA 3CG7A 1KVBA 1MQ3A 1V9PA 4FM1A 2IS3A 1NOMA 2Q3SA 3Q8QB 1TVAA 4CJPA 3M9MB 3PW5A 3TARA 1HPZA 3O4NA 1KSPA 1D8LA 3OYFA 2D0AA 4M3ZA 3BQTA 4RQ6A 1KFDA 1GOAA 4J2AA 4Z4GA 3OYHA 8ICZA 1A5XA 5KG7A 3VQBA 4CERA 4FLYA 1J9AA 1S9EA 3TQ1A 2G8UA 4YD2A 7ICHA 2ASJA 5HNKA 3RB4A 1L3TA 5SWMA 3PVXA 3KLFA 4EEYA 3CFOA 3QIPA 9ICGA 4N76A 5CHGA 4M3YA 2W9CA 2YKMA 3B0YA 4QZBA 4J9KA 1WSHA 1NOZA 4O0IA 7ICIA 5KFKA 3RMAA 4CJTA 1QSLA 1PZNA 4RU9A 2ZUBA 4AHTA 4ECSA 1JN3A 2PFPA 1RTIA 3PX4A 4DLGA 3RH6A 3G10A 4RNNA 4NCGA 1NK8A 5HROA 4IQUA 4RQ2A 5KG0A 4BWMA 4F4KA 4RQ8A 1BISA 4Z4HA 3QEIA 2R8IA 4F4ZA 2FLPA 7ICJA 3C1YA 3DLGA 3PX6A 3RJJA 1RYSA 1X9MA 4M3TA 3PMNA 9ICXA 4CEDA 3MECA 5J0XA 5J2BA 2I9GA 2H5XA 1U48A 3SQ0A 4UBCA 3KKSA 4FW1A 4FXDA 7ICKA 2ZQBA 4ID5A 1HNIA 1U47A 4DU3A 4RUAA 5F9LA 1BPZA 3D45A 4YXJA 1ZQQA 4DSFA 3SQ4A 3NF6A 4FJKA 1DOQA 3AA2A 2VWJA 3ZDEA 2XO7A 1BIZA 2HMIA 4DFKA 4CJSA 5DGBA 4EBDA 1U49A 1ZQXA 7ICSA 3RJIA 1ZQNA 3CQ8A 5DBCA 3RTVA 1QQCA 3RMBA 1JLBA 5KG5A 4AH9A 4F5PA 3S9HA 3M9OB 7ICNA 2PZSA 3GIMA 5CZ1A 1S5JA 2R8JA 5J29A 4ECRA 3V9UA 2JEIA 1XU4A 1HJRA 4ZTFA 3ZSVA 4DTXA 3AU2A 1QSSA 4CF2A 5KG3A 4XQ8A 1WLJA 1ZQRA 4IRDA 3DM2A 3HJFA 1JMSA 5KFNA 2BCRA 4UB1A 3UQ2A 5DKWA 1JX4A 3ZD9A 4DOAA 4Z6DA 4F5QA 1QS4A 4BE0A 3T5LA 3NGIA 4ECTA 4P4OA 2XCPA 3ZSWA 3VQEA 2GUIA 4O55A 7ICQA 1VSHA 1HJPA 4LVSA 2KTQA 4FCYA 4B08A 1BVSA 1S1XA 2FLLA 2UVWA 5JS2A 4BE1A 4J9PA 3EY1A 1QLNA 4NYFA 4RUCA 4PGYA 3TAFA 3OJSA 2UVVA 3KHHA 5J2EA 4KLEA 3I8DA 1JXLA 3ZSYA 3MDCA 3NHGA 4B9LA 2AQ4A 1T7PA 4DU1A 4NCAA 1Y97A 4R64A 4PHAA 4ED6A 5KTQA 1NKBA 4HUGA 3V6KA 4GW6A 3TWHA 4KMUA 5KFSA 2O4IA 2HHXA 4KI6A 4YNQA 4JK1A 4ECZA 1WAJA 1KEJA 3HVRA 1NOYA 4G1QA 2D0BA 4F2RA 8ICVA 1K1QA 4KLJA 4DU4A 2HHQA 3DLBA 1JLGA 2DFEA 5IIIA 4NLGA 1CZ9A 3PMLA 4F4WA 1ZQZA 3RAQA 3K4GA 5KFTA 5DB9A 2ASDA 3KHGA 4BXOB 3P5JA 4KLSA 3SUQA 2V4QA 3C2LA 2VA3A 3GILA 5DQGA 4I27A 4UAWA 1TL1A 3N4MB 2HB5A 2E6MA 4HTUA 4QOZB 5CA7A 4RNOA 1CLQA 4L8RB 3KK1A 5KGXA 3C6UA 3VN5A 5HMMA 4BGDA 3V6JA 7ICUA 3PR4A 4J9RA 1Q8IA 2G8IA 2HNZA 4W5TA 1JXBA 4DQIA 1X2IA 3E2EA 3DRRA 4CIGA 5EWGA 7ICVA 4RQ5A 3GV5B 4M9GA 3TAGA 4CJFA 3BJYA 2GBZA 1ZQTA 1ZQUA 4CGIA 1SKWA 3GQCA 4F50A 3SUPA 4BE2A 1Y88A 3OYKA 1FXXA 3G6VA 3A2FA 2Y1JA 3DYAA 5IIOA 3C94A 1HYZA 4HVJA 4FO6A 2XGPA 4J2EA 5IIKA 4IFVA 4ZHRA 4YMOA 2XY5A 3L3VA 3HSTB 3NF8A 5KFJA 3QEVA 5J0QA 4QZHA 5CWRA 2A1SA 3PO4A 3DOLA 3RB0A 4O44A 4Z4IA 2ISPA 4QZGA 4UB3A 3SCXA 4IKFA 3FYHA 1W9HA 4N56A 1ZJMA 3F9KA 2VG6A 1EKEA 3ZSRA 5FRNA 4M9JA 3AVNA 2DFLA 4M6WA 1ZBHA 2JEJA 1VK0A 4PHDA 4RT3A 2ZE2A 3PX0A 4Z6CA 4B3OA 4Q45A 1BCMA 1UWBA 3AA4A 2FPLA 2OZMA 5KG4A 1RT4A 5J0OA 2C28A 1J5OA 5K14A 1U45A 4PH5A 4DQRA 1SL1A 1D5AA 3LALA 1RDDA 3VQCA 5KFDA 3N97B 1D9DA 5KFZA 2AGOA 1VSDA 4TURA 9ICEA 1ZQYA 4B9UA 4HUFA 1T8EA 4QW9A 3OHBA 9ICOA 3JPQA 3UQ0A 8ICXA 5D46A 3ZDDA 9ICUA 2FC0A 2OWOA 1BL3A 3VQ7A 4N5SA 3SJJA 4J9NA 1ZQIA 3AO2A 4JWMA 3K59A 3V9ZA 4AHRA 2I5JA 3V7LA 4CF0A 5F9NA 3OHAA 1TKDA 1HRHA 1XS9D 7ICTA 4OKKA 1NJYA 1RZTA 3C6TA 1J54A 3L2WA 1QHTA 4I9LA 4FLTA 1RDAA 5L1JA 2IHMA 1RCHA 1T03A 5DLGA 3LPTA 3DI6A 3HM9A 2FBTA 5CP2A 3VQ8A 4O3NA 2AQ0A 1MU2A 3V1RA 3M8PA 4FLVA 1X1PA 1ZQKA 1Z00B 3IG1A 3OYCA 3SQ1A 2E6LA 3MFHA 2ALZA 5HRSA 4FZYA 1TKTA 3O4QA 2FMSA 4CJ5A 1T3NA 4X5VA 3SZ2A 1VSMA 3LANA 4CGDA 2J6SA 1A77A 1XWLA 3PW7A 3OY9A 5DK5A 3MDAA 1O1WA 1GOCA 1S97A 4M9LA 2Z1JA 1BIUA 4RQ4A 4G3IA 4DTRA 3S3OA 4RZRA 4QWDA 4RPYA 1EXNA 1ZQEA 2W9MA 4CEZA 3K2PA 4LZGA 1ASUA 2X6NA 1VSIA 4C8NA 3KHLA 4Q8FA 4KLGA 3ASMA 3CFPA 3B6PA 3DMJA 3FFIA 3OGUA 3ITHA 3KD1E 1AROP 8ICGA 4KLFA 1S1VA 4I2FA 1SZPA 5DG8A 4IDKA 5J0YA 1BHLA 4DL6A 1B9FA 2R8KA 5KT4A 4KREA 3AA3A 3UXPA 4TUSA 3MR3A 3ULDA 4CJWA 3NAEA 2F8SA 4QCLA 1LAVA 5DB7A 3G0ZA 4PHPA 4KLUA 4FLXA 9ICMA 2NUBA 3QINA 4KPYA 4IQTA 3ZD8A 1J53A 2PYJA 3K57A 4O5BA 4QZDA 3I0RA 3LAMA 3L2UA 2YNFA 1BCOA 1ZQSA 5EOZA 4JV2A 2PXIA 4RQ0A 4CFBA 5J2HA 4CF1A 5HBMA 4KLTA 4F8RA 3RJEA 2EX3A 4M42A 4CEFA 3T3FA 1R0AA 3C21A 4BACA 4ED0A 4DQQA 4TQSA 2ZTDA 3RRHA 1NKEA 4CJ4A 3U3YA 5J0WA 1ZQMA 8ICAA 2OYQA 3Q8LA 4J2DA 3OVNA 8ICKA 8ICJA 4XA5A 1VSJA 3GDXA 3OYEA 2IA6A 5HHIA 1RYRA 4AHVA 3PR5B 3TAQA 3PW0A 1RXWA 3H40A 3KKRA 1TVRA 3SV4A 3HW8A 3RH5A 3QZ7A 3L2QA 2BHNA 2WTFA 2W8LA 7ICOA 4CFDA 2OZSA 2BPFA 4F3OA 4QZ9A 4ED3A 1TV6A 4P4MA 2OPPA 4NXZA 3QE9Y 4M3WA 3Q8MA 1GOBA 1ZBIA 1SL2A 4N41A 1U9LA 1JLFA 1S0MA 2OPQA 1IXRA 2IGIA 1S6QA 3L2RA 3M8SA 2PI5A 4I2HA 3GFKB 4ELUA 4KV8A 5KRTA 3RAXA 1C1CA 7ICRA 1WSFA 3VQAA 1ZQOA 1SUQA 3L3UA 1MC8A 2FBYA 5KFHA 4FW2A 4UBBA 4FJ5A 4DTMA 1S1WA 3SI6A 9ICQA 1ASWA 4M9HA 4CK3A 4LY7A 4FJNA 2VG5A 2Z1IA 4YFUA 3HVTA 9ICNA 3MBYA 1X9SA 5J2NA 4KHSA 3UPQA 3K75D 3LPUA 3SUNA 4O5CA 3NGDA 4KLQA 3QLHA 3NFAA 2XHBA 4YFKA 8ICEA 3KTQA 4GC6A 4QZFA 5CYQA 4NM2A 3RH4A 3AVBA 4QZAA 3KLGA 3H08A 4F3TA 3WNFA 3GIJA 4EP5A 3JPRA 4IRCA 1FKPA 2O4GA 2RDJA 3C5GA 4PA1A 1NK6A 2W9BB 4OVLA 5CB1A 1X9WA 2XY8A 3GIKA 2F8TA 2ZUCA 4CJQA 3OYMA 4ED7A 3MEEA 1K6YA 4QW8A 5FDLA 4PY5A 2C22A 4Z4FA 4K4IA 4DOCA 4FJXA 3PUFA 1RT2A 1TK8A 2ZTCA 4O3OA 2C2DA 1C0TA 4RPXA 2BQ3A 2X6SA 7ICLA 2BDPA 3CM5A 1XSLA 4KB1A 1Q9XA 4DSIA 4QZCA 5KFEA 4QWAA 4JS4A 5KFMA 4GXIA 2IOCA 2P5GA 8ICNA 4E7LA 3ZSQA 4O3RA 4F4XA 1RPLA 8ICCA 1LWEA 4KAZA 4JV0A 4ECWA 4M45A 5I3UA 1DGSA 4YR2A 1C0MA 4FK2A 5DG9A 1ITGA 3TAMA 1I39A 5J0RA 5DLFA 1IKWA 4O3SA 3ZT0A 2FBXA 3QNOA 1WCNA 3OSPA 2W9AA 4I28A 4CECA 2G8KA 4AHCA 4LD0A 1K1SA 8ICPA 3V9WA 1ZBFA 3Q8PB 1RNHA 3V1OA 2XC9A 4H4MA 4RW6A 1QSYA 4IQVA 2PY5A 2FMPA 3ETLA 5EWEA 3MFIA 4JLHA 5KI6A 1RBSA 3T19A 1S1TA 3QERA 4CGHA 4FLUA 4F5RA 4FJJA 3RJFA 2P6RA 4I2EA 1FKOA 4FVMA 3K5LA 2JZBB 7ICEA 4Q5VA 2PFQA 1IM4A 4E1NA 1TGOA 5T7BA 4B8AB 1F21A 2AGPA 5KFCA 1T4GA 4CJVA 4C8LA 4DSKA 5JS1A 3RRGA 5HMLA 3TAEA 2UVUA 5KFIA 5KT7A 2LSNA 4CGFA 3ISCA 5IIMA 4ECYA 3NCIA 1L3VA 4CEQA 2KFNA 2IAJA 4AILC 4C8OA 4B9TA 3NGYA 4CK2A 1UA0A 3HPGA 8ICMA 2JLEA 3AVHA 4DLEA 3S3MA 4KHWA 4FYDA 4MFAA 4TUPA 5KFQA 2ZD1A 4CHZA 1WN7A 1NK9A 9ICAA 3MABA 5DMRA 3KLIA 3BQ2A 2WOMA 5BPCA 5J2KA 2BGGA 2HHUA 1VRTA 5E41A 2VA2A 4KHYA 1RT1A 3AVGA 1BPEA 4OLAA 4LZDA 1U4BA 3AVKA 4FM0A 3V1QA 3UXOA 2HVIA 4JWNA 1CZBA 2W9CB 4Z6EA 2BR0A 1ZQCA 8ICYA 3OYJA 4J9SA 4PQUA 2BQUA 3AA5X 4FJIA 4DS4A 4FLWA 3C2MA 3KK3A 5KFGA 1SKRA 3HXMA 2IDOA 2BCUA 1EP4A 4MFFA 4Z6FA 4CF8A 3TI0A 9ICFA 3V9XA 4E3SA 2KZMA 4KTZA 4ECVA 3NF9A 3DRSA 1ZQFA 1NJXA 1EXQA 4FJ7A 4YR0A 4O5KA 3AVIA 4QWCA 4IFYA 2M9NA 4CJ3A 3T5HA 3KK2A 4PGXA 4DO9A 1NK0A 4ECUA 1WCLA 3AVCA 4DQPA 2VG7A 3RB6A 9ICBA 4H4OA 4EYHB 9ICPA 5TZVA 2ZUDA 2HW3A 4YXMA 4DTPA 3IHQB 1UT8A 2VANA 4FJGA 4MEXA 2YNIA 2FMQA 2P1JA 2QK9A 1IG9A 3P1GA 4DMNA 1XI1A 2FBVA 2RKIA 2JZBA 3GIIA 1S6PA 4OPKA 4HUEA 2F1IA 1ZQJA 5HP4A 4Z4EA 1Z26A 2AU0A 4DL7A 1YT3A 3ZT4A 3KHRA 3MR2A 1BPXA 5C24A 4CEAA 2X74A 4CGJA 3UIQA 2P6UA 3LZJA 3AVFA 4CJRA 3DLHA 1HMVA 2GWSA 1BPDA 3QESA 3PO5A 4M04A 4CK1A 3NH0A 1G15A 4E1MA 5J2GA 1KFSA 3AV9A 3VQ9A 2ETJA 2HNYA 3MR6A 4EZ9A 4UB5A 4FBTA 4EYIB 3OYNA 1UOCA 4QWEA 8ICHA 5DGAA 8ICWA 4CGGA 3I0SA 3FDSA 5J0TA 4NM1A 3QETA 3QEPA 3H8SA 3V7JA 4R66A 2NRZA 1NJZA 3LAKA 2JEGA 5HRPA 3QIOA 4W5QA 3SYZA 4RW8A 4Q44A 4IG0A 3WNHA 4R8UB 9ICWA 1ZQDA 2RN2A 4JS5A 4OJRA 1BI4A 4M3RA 3H7IA 5DQIA 1EETA 4I2AA 3WNEA 4P4PA 3MR5A 4XIUA 3AVLA 2BQRA 3L2VA 2ZJ5A 3EPIA 2HVHA 3DLRA 4DTSA 4FK4A 3QNNA 3SPYA 5D3GA 4ECQA 4UB2A 2DPIA 1JLAA 1BQNA 3LWMA 4DTOA 4UB4A 1A76A 2XY6A 4DTJA 4FZZA 1BPBA 3HP6A 5J0PA 4K4HA 3LP3A 2W9BA 9ICCA 4FJ8A 3OYAA 3HT3A 5DDYA 4I29A 7ICPA 3NDKA 1VRUA 1RTHA 5KFAA 4QZIA 3VQPA 1LWCA 2KFZA 2BE2A 4MQ3A 3KIOA 3LDSA 1JKHA 4LSNA 4ECXA 2E4LA 2ITGA 2ZTEA 4TUQA 4HCCA 3OYDA 4PPXA 3M8RA 4IBNA 1A5VA 1IKXA 4P2HA 3BQ0A 3RBEA 2G8WA 5DDMA 1TAUA 1B92A 4XRHA 9ICVA 1LAWA 8ICIA 5HRNA 3V72A 4DFJA 3QZ8A 4IQWA 4RPZA 2XY7A 1LW0A 3JPTA 4W5OA 4FM2A 4M3XA 2B4JA 4IG3A 2OA8A 3UXNA 1U04A 5KFPA 5IIJA 3LP2A 2F1HA 1XO1A 2P66A 4KLMA 1LW2A 4KHQA 8ICSA 4QZ8A 3BQ1A 4I2PA 2Y1IA 3ORYA 1IH7A 5L1KA 4UAYA 2GV9A 4DFMA 1NK7A 4MF2A 3M9NB 1BQMA 4KFBA 4C8MA 1WNSA 4M41A 4FS1A 4C8KA 1B43A 1QTMA 1ASVA 3K58A 3AO1A 1KLMA 2BCSA 4B9NA 5J1EA 1ZQAA 3K5NA 2WONA 3U6FA 3V4IA 4YP3A 1KDHA 9ICRA 3V81A 1MQ2A 3VQDA 3HYFA 3SQ2A 1RBVA 4J2BA 1N56A 4KTQA 4M0AA 3M8QA 4YD1A 2A1RA 4RG8A 4KHNA 1RBUA 3S3NA 2C2RA 4KTWA 4F92B 2KQ2A 3HL8A 4JV1A 3RJKA 8ICOA 1IKYA 4B9SA 3BGRA 4DWIA 3V9SA 2IMWP 3E01A 4TSXA 3RWUA 2YKNA 3RB3A 3NH1A 4HHTA 2I1QA 3HPHA 7ICMA 3KD5E 4NY8A 4MEYA 1S0OA 2HHTA 5KG6A 4ICLA 3VA0A 1ZQPA 4IR1A 5FRMA 4WE1A 3QEXA 2YV0X 1Z00A 4F91B 1ZYQA 3TANA 3ZDAA 3LP1A 4ED8A 2DTUA 3H4DA 2D5RA 5KFFA 3H4BA 5DG7A 3NE6A 1HNVA 1RDCA 2J6TA 1CEZA 2F1JA 4O9MA 3C23A 3THVA 4CIEA 4FJLA 4CHOA 4YMNA 4M6WB 1B9DA 4LH5A 1NKCA 1RT3A 1RXVA 3TABA 3AVAA 3SV3A 3IAYA 5L1LA 3B6OA 5KFOA 3PW4A 5DB8A 4B8CA 2J6UA 5J2PA 1TKZA 1RT5A 2BANA 4CJUA 3EYZA 4DSLA 1JXEA 5HLFA 3C5FA 3ZSZA 4J9QA 4FZXC 3H8JA 4F4YA 1S10A 4QAGA 1RT6A 1HYVA 3CYMA 3EW9A 4KLLA 5KFLA 1L5UA 4O4GA 4I2GA 1YTAA 1TV9A 3DLEA 3AVJA 1UT5A 2NRXA 4KN7A 3EZ5A 1D8YA 1KRPA 4KLDA 5IILA 1RBTA 2AGQA 4AHSA 1RDBA 4MFBA 3LDAA 4JRQA 3TFSA 1TK5A 5J0SA 4I2QA 1Q9YA 3OSNA 4Q0BA 4Q8EA 4LH4A 1JLQA 1WSEA 1LB2B 3ZT1A 3T5KA 2W8KA 3DRPA 2MUTA 5KFWA 2HHSA 5DQHA 1ZQVA 3VQ4A 4RQ7A 5J2DA 1UA1A 1HYSA 4F5NA 1DLOA 1TK0A 2FPKA 4KB0A 1WAFA 3ZDBA 4EBCA 5KFXA 5J2AA 4GVMA 3VQQA 2PI4A 1VSLA 4HYKA 4DEZA 1UAXA 3MAQA 3QEAZ 1VSKA 4Y1CA 1JLEA 4KRFA 4UAZA 2X78A 1XC9A 4NCBA 2JEFA 4RQ1A 3C1ZA 5CZ2A 1SKSA 4OKEA 3SI8A 5KT2A 5KFVA 4CEOA 4KI4A 3QO9A 4DL2A 2VA8A 3LZIA 3OS2A 3RMCA 3MXJA 4DTNA 4YN4A 4DS5A 3RBDA 1S76D 4EBEA 1ZQGA 1NK5A 4CJLA 3C95A 4ZH4A 3Q8SB 1FK9A 2EHGA 2PFOA 4BXOA 1S77D 4O5EA 4KLIA 5J2IA 3OS1A 8ICQA 3HPOA 3H8WA 4FJMA 2YNGA 4FBUA 2YHBA 2KN7A 4JRPA 3ZSXA 5KFYA 4FJ9A 9ICJA 2XGQA
chains in the Genus database with same CATH superfamily
2EI5A 4ID5B 2PYLA 3PG9A 4LVNP 1YK9A 3R5JB 3WK7A 4K42A 3NH2A 4B9VA 3P4UB 3ZC4A 2RRNA 2Z58B 1DTTB 1BOTO 2VQFK 2YNHA 4OHWA 3I56S 3LOUA 2OLWA 3DOMA 2DNMA 1R6YA 1KTQA 2F9TA 3HK2A 4K0KF 4OI6A 3AODA 1V6HA 4ZP9A 3VQ6A 4FS2A 1ZBUA 4B3MJ 1CJVB 1CXQA 5CR0A 3JPOA 2NSCA 5BREA 4R65A 2QXFA 4LC9B 3FZLA 1IKWB 3PHTA 4MJKA 1O08A 1TU0B 2QKBA 4GKKJ 3CJ4A 2HQIA 1U1QA 4CT8A 2B8PA 2IOFA 4Q2LA 1M5KC 4G1PA 4DR7J 3MUMP 4HHHA 4OGCA 5ALQA 3OR2A 1L8OA 5AK4A 2IC3A 3CD5A 1KFTA 2XS5A 1Y5NB 4R5PA 1RT7A 5J2FA 4I4BA 1X9XA 3W9JA 3EN9A 2I6WA 5DM7Q 4NXNF 3C2KA 1YJWN 3M1VA 3D2EB 1YTYA 1KQSM 2RHKA 4DCCA 1E6VA 1W0HA 4JI4F 2KYZA 1SB3C 1JLFB 3AUOA 4B3MF 5FDLB 3KJVA 1EB0A 4BRNA 2Q6CA 3PW2A 4IR9A 1LV5A 3CRXA 4WTOB 4F5OA 3AO4A 5HRRA 2R2RA 9ICTA 3ZETB 4TQRA 5F8HA 5F41A 4CBXA 1PAEX 1YRUA 4BR2A 2HSZA 4NZ6A 4DR5K 2NRVA 2ZXHA 3QEWA 3Q23A 3SEOA 1K9MT 4LF1A 4R63A 1TFRA 1X40A 2H3EB 4PYDA 2HPUA 4JI0J 2MAXA 3GJQB 1LWEB 3RMDA 5KT5A 5I42A 1IBMK 5D49A 3L7PA 2HRYA 1Q4RA 4KBOA 2K8BB 2GWKA 5FIIA 3HX0A 1QM9A 1RT6B 1HUOA 4NXMF 1WF0A 4NLKA 1WC6A 3ENWA 1NZBA 3KWGA 2RP5A 4ATNA 1H7WA 2VKQA 2HHWA 1MG7A 3CQXA 4OZ2A 3T1YJ 3QEBZ 1T6CA 3C7NA 3D2WA 4CM0A 2OSQA 1WG1A 1HIYA 5LL6Z 4MK7A 3QICA 4PXEA 2NV3A 2J7KA 4CD3A 3TWZA 2VPYB 4QZVB 1N33F 5AQXA 3DLLL 1URRA 1R31A 3R1LA 1C0UA 1NJIO 3IGNA 1D9FA 4M47A 4MH8A 1WHYA 3ATUA 1LWFA 2C2EA 5CABA 2V94A 4IOBA 4I9QA 3GV8B 2R8HA 2N82B 1IQZA 1XSPA 2NPIA 2Y9UA 4HCBA 4KO0A 4OHVA 8ICRA 4LF5F 3IRXA 1H72C 5J2QA 4XUSA 3P4IA 3EWAA 1SV5A 4FJHA 4RBVA 3D1QA 1VQ6S 1TKXB 4W5NA 1KLNA 4JK9A 3J81O 2B0GA 1HNWF 3AGKA 3MGIA 5GMKa 4Y34A 3CPWM 9ICIA 4DX6A 4K7QA 3G96A 3TUPA 2G0JA 1GLEG 3HLUA 2Q0ZX 4ZJLA 3GMGA 1M5HA 3ISBA 5IINA 1JL1A 1Z25A 1M0SA 1YLXA 3EVWA 1WUUA 3ZZOA 2A3VA 3FBCA 4DPYA 4RW9B 1FWPA 4YQWA 9ICKA 2KHOA 9ICSA 5L1MA 1N34K 1JLCA 2E8NA 1FE4A 2G4BA 3I55S 3BDPA 3KMSA 3MWTA 2K3IA 4DR6F 2UUBK 3THXB 4M5IA 4MK9A 1TL1B 1COOA 3I87A 3VV2B 5AQJA 2NLXA 1U1OA 3VA3A 1RWPB 5EDWA 9ICLA 3IBPA 3I6PA 3LP1B 4C0BA 5M2PA 4ED1A 3MGVA 3TX8A 4NB4A 1SV0A 1KC8T 1Z1VA 2YJFA 2IBKA 2A6MA 4GKJJ 3BGOP 4TY8B 1VSEA 4A8EA 2QSWA 3AQPA 3VHQA 3L8BA 1HQUA 5A8KA 3MMVA 2LEAA 3NWGA 4FLZA 5CZXA 4ZLLA 4E89A 1RT2B 1XR5A 2YHAA 1SBRA 5C2CA 3NBPB 4KGVB 4DOBA 1UZDA 1BPYA 1HUZA 3BS9A 1X6JA 2GS8A 4I2CA 8ICFA 3CWJA 1EQYA 1BDGA 8ICTA 1KVKA 3GLJA 2E8AA 1QE1A 1NJWA 3MCPA 1K0VA 4DL4A 4ICAA 2AX1A 2KJWA 2I5HA 4KGZB 4RBUA 1X66A 1KR4A 4DR5F 2M8HA 3CNHA 3ONNA 5C42A 4CJEA 1NSAA 3RJHA 4CW7B 2POKA 4QYRA 1T05A 4RWTA 4ZPWR 2Z7JA 5EOYA 3AOBA 4CJKA 4GKJF 3BKTA 2BJ3A 4IRKA 2BGWA 1S1VB 5KFRA 4HAIA 4J9OA 2QFIA 1URNA 2CPFA 2BPCA 2QG9B 1YGYA 2IJRA 4QWBA 2WW4A 4KX3A 3OYLA 3HP9A 3HTVA 3BGRB 2F4VJ 4LF9K 4OKJA 3NNHA 4DX8H 2Z2LA 2CNOB 2M0GB 4CESA 4B3SF 4H8KA 1SH0A 1TL3B 3WDOA 5H1SQ 4E19A 3JXUA 2P5OA 1NK4A 4RT2A 3SUOA 2WAQD 1WEXA 2B9XA 2E5JA 4TY9A 1GQEA 3CCLS 1JROA 4WJBA 5FD1A 4OGEA 2IAJB 3M5RA 4IEIA 1OPZA 5AE1A 1RUSA 3OL7A 3B82A 4DV7J 2E1CA 2V2QA 5ALSA 3D54A 1TVAA 4I68A 3W9HA 5LMUK 4WFXA 1HPZA 2EAOA 3KG0A 1KSPA 1FCAA 3O4NA 2YH0A 2P9PA 4C23A 3OYHA 5ADZA 3R6LB 1MWYA 3VQBA 3QSIA 4JBCA 4XH4A 3O1LA 3TP2A 4AD6A 2ASJA 4B3SJ 1SJFA 1QHAA 5JMVA 3CNQP 1TFWA 5SWMA 5FLXU 3UMBA 2CYYA 1HKCA 2RQMA 4RQNA 4LUBA 2AT1B 4RBTA 3CFOA 4K4VA 3SXLA 1NOZA 4DR3K 4ZHRB 4QR1A 1HBUB 3FGVA 5T14A 4O0IA 1SCJB 2YXLA 3AEVA 7ICIA 2KKZA 3RMAA 2E1EA 1X4GA 4MAKA 4AHTA 4LF5K 3UVJA 2FLOA 2CGKA 3ZFVA 2PFPA 1RTIA 3W2WB 4Z37A 3PX4A 5D0RA 2KDOA 4CBWA 4IQUA 2VUGA 4F4KA 3VVTA 3ET6B 4FWRA 2HWHA 3DGVA 4JI7F 4OO1J 1LEOA 2XWXA 4K50A 1RYSA 2R7OA 3QAUA 1PC4A 4M3TA 3PMNA 3AB4B 5J0XA 5J2BA 2I9GA 4JI1K 4PWDB 3FC4A 5HMZA 4FW1A 3VEYA 2YPZA 2CZVC 5J8YC 2HBMA 2ZH8A 3QU5A 4OZ1A 3AAWB 2DRBA 4YXJA 1VQ8S 2P9KB 4DSFA 3SQ4A 1ZAWA 4O3MA 2AJ2A 3AA2A 1OMSA 4P71A 1DFDA 2DNYA 2XULA 3A3OB 4YDXA 3BKUA 2WB1F 4DFKA 1ZQXA 7ICSA 4ZVTB 2A2DA 1ZQNA 1MMNA 1IVZA 5AZJA 3FSIA 4YHHK 5DBCA 1ZC6A 1DK2A 3MURP 2CVIA 2O8BB 2FHOB 1K0TA 1NH7A 2YX4A 2G5IB 5LMNF 7ICNA 3O5TB 4CLTA 3EE9A 5CZ1A 2R8JA 3EXCX 3V9UA 2JEIA 1XU4A 4DTXA 2YKOA 4QJVA 1WLJA 1MROB 2WSFC 2FVCA 1I51B 4FP9A 3HVTB 3VTIA 1Y64A 3ENHA 2BCRA 4TKTA 4YB5A 4IZ9A 1HWIA 3UQ2A 1JX4A 5DZ6A 2V9KA 1L6NA 4USTA 4F0HA 2DHAA 3GIRA 3JB9k 3T5LA 4C48A 2LECA 4P4OA 3VQEA 1YJUA 4P75A 2OYYA 4ZVHA 2GUIA 3W66A 5AQPA 4WFAQ 2HBKA 4OX9K 1BG3A 4B08A 3SBTA 2KVSA 3QGHA 3U26A 4P2MA 3A0HU 2IVFB 2UVWA 4DG1B 3FLCO 2VHGA 3NS5A 3CJ9A 3NWRA 5JMNA 4OIXA 3T41A 4PGYA 3ID8A 2FQQB 3TAFA 1W7WA 3GZ7A 3NRZA 4MK8A 3I8DA 3OL6A 5CHIA 2V63A 1X7VA 4HHUA 3UWTA 2ZH2A 4B1VA 2EW9A 2XMMA 1U6BA 4Y0WA 2A1BA 1Y97A 5HJYA 2QARA 2AJ4A 1IIPA 4EELA 2WF5A 1T9YA 1NKBA 4C80A 1Z4OA 3OPXA 1SJ3P 4HUGA 5EX3A 3V6KA 4RWWA 3G8TA 3TWHA 5CAAA 2HHXA 3BS7A 5JRTA 4ECZA 3L09A 1WAJA 2AW0A 2G2ZA 1X4FA 4BR5A 3FGUA 4HR2A 3CD7A 3BEGB 3FK4A 1VQMN 1K1QA 4KLJA 3L95X 4DU4A 5IIIA 4NLGA 1RYUA 4P7TA 2QA4S 4NZ0A 3S6EA 2CGLA 4LR7A 1X3NA 2KO1A 3DNCA 3KHGA 1HNWK 3PFEA 4BXOB 1HJOA 3PKMA 3I28A 4KLSA 2V4QA 3GCXP 3AXMA 3GILA 5DQGA 4HT7A 4I27A 1H6KX 3N4MB 1PYTA 3IS9B 1N36J 4CZIA 3IO1A 2AA4A 3TR5A 2A6OA 1G1XA 2BJDA 3CXCR 4ILGB 4OPHA 3W1YC 3QO9B 3VN5A 3CJBA 4PZNA 1OY8A 3AY0A 4W5TA 4CZMA 2VL1A 4OI3A 4DPWA 2A3JA 1FEHA 4AXIA 2OSRA 1S22A 3RBXA 1ZZFA 4CF4A 1HUXA 7ICVA 4PG8A 4LF7K 2FGCA 3DLEB 1NH8A 2UUBF 2ZZNA 1NDPA 2JWKA 2D7SA 1ZQTA 1U0SA 5DETA 2Y3YA 2KHVA 4UAUA 1KC8O 1U2FA 2V51B 1X4EA 1G99A 3SUPA 2EZXA 1Y88A 2ESEA 4ZOSA 3G6VA 3A2FA 5IIOA 3HI0A 4HVJA 4FO6A 2XGPA 4J2EA 5IIKA 2P9SA 4ZHRA 4YMOA 4LFBK 3T7ZA 4K0KJ 1N36F 3ENOA 2E8PA 3AXKA 5CWRA 2QW9A 3C65A 3DOLA 4G1QB 4O44A 4Z4IA 3TSQA 2DHXA 2ISPA 4BX9C 3UDEA 1W9HA 3TX0A 4HLBA 1ZJMA 2GEMA 3ZSRA 3GR0A 4KY3A 1N63A 2KG1A 2DD8S 3MMJA 4PHDA 3D6TB 5DJBA 2F77X 1Z4UA 2ZJQQ 3F41A 3E9PA 4DUZK 2KFYA 3IBFB 3R2DJ 4JB8B 3K9KA 1EZZB 2NZCA 1VRUB 5KG4A 5D78A 3VQTA 2PAVA 1PVQA 2KXNB 1FKAF 1DTQB 1I1GA 5K14A 4OJ6A 1TE2A 3MPVA 4DZDA 4OPAA 3I4HX 3RU0A 2YQ0A 3G71N 1D9DA 1IWGA 2FGOA 4TURA 3PSIA 9ICEA 1ICEB 4LFBJ 4HUFA 1T8EA 2YKNB 4QW9A 5C25B 4J9VA 3RGIA 3UQ0A 3MN6A 2OMOA 4I69A 1CC7A 4J7CA 1IJEB 4R25A 3AO2A 4RTFD 4WCEQ 3K59A 3V9ZA 3AD7C 2UYTA 4CF0A 5G0RB 5F9NA 1XMQF 3BS5B 2HMXA 3THYB 3K9JA 2BE2B 3UB5A 4ZN1A 2BVZA 2D41A 4RWXA 4B1YB 5L1JA 1T03A 2WONB 1DRZA 3RW7A 3CJ5A 4F7VA 4DR1K 4PKGA 3IBCB 3B8HA 4O3NA 5DDOC 2AQ0A 2E5LF 1MU2A 3V1RA 4C8YA 3FRZA 1R6VA 1VBZA 2QGFB 1X1PA 1N36K 2XLJA 3MFHA 5HRSA 1T03B 1TKTA 3O4QA 2FMSA 4U96A 2FJAB 4X5VA 4AL6A 2ZJRL 1A77A 1XWLA 3HHLC 3OXFA 4IFVB 3PSFA 2VC0A 2V52B 3OY9A 4J5OA 3TA1A 1O1WA 1AQ6A 5G0RA 1XMQJ 4RQ4A 2M5YA 1EXNA 1PYSB 2V34A 2KI2A 4C0ZA 1RACB 2HOFA 4AF1A 4LRAA 1FD8A 1YVFA 1J6ZA 2C2MB 1ASUA 4NZ7A 3KZBA 3VF4A 1F9EB 3KHLA 3EUB2 2VU5A 5D4NA 3OTOJ 5I3QA 3AH6A 4O8UA 4LF4J 1LKZA 2MB0B 1IN0A 4KLFA 1OY6A 1N2XA 3CCQS 2G0IA 5DG8A 4LREA 4Z7YA 1BHLA 4LSNB 1EWQA 1BWVA 4KREA 1HL6A 2NRHA 2FIUA 3UXPA 3AA3A 3MR3A 2Z4PA 3AOAA 1RKIA 3ULDA 4FNIA 3M30A 3NAEA 4HT5A 2F8SA 4QCLA 1HNVB 2CZ9A 1WG5A 3G0ZA 4OYMA 4OI2A 2Y0SD 5CD4H 2YX6A 2F76X 2NUBA 4KPYA 4IQTA 2E20A 4FSVA 3BO3A 4BS2A 4DU8A 4QZDA 5AFUH 1RHKB 2HVDA 4BC7A 2VYPA 2G06A 4ISFA 5HQMA 1FFGB 1ZOTA 3T69A 2IYIA 2MKCA 3CJQA 3OTQA 2GV1A 4UUXA 2BKOA 5HBMA 4LBPA 2DR9A 4CEFA 2FZCB 4J37A 3J7YI 5L8RC 1QQ6A 5DRKA 4DQQA 2A0FB 1NKEA 3CJ7A 2L41A 2H3GX 2OYQA 1VQ8N 4V19J 1XIQA 1LK5A 4OYXA 4TXSA 1H1VA 1DJ0A 2IA6A 5HHIA 5THWA 5I9EB 4NASA 2Y1LB 4M95A 5E3CA 3VF6A 3H40A 5HATA 3G71S 2K4EA 3JS6A 3HW8A 3VAHA 3M2RB 2OZSA 2BPFA 2MGZA 3WKAA 4F3OA 2HYIB 2ZBPA 1KP6A 1YJ7A 4AL5A 1TV6A 4P0PA 2VD3A 4YHHJ 2AYGA 4FF2A 5LXRA 3A8EA 1SB6A 3IDHA 3ITHB 2FTRA 1DQAA 1PJ5A 1S6QA 4H03B 3M8SA 3NRWA 4KV8A 4ELUA 5KRTA 1C1CA 2DNOA 1JXVA 2P35A 2FBYA 5GADU 4B17A 5AI9A 3ILIA 4OV1A 4DTMA 4EUVA 1G6BA 1HD0A 1YITS 3UKRA 3SI6A 3D0HE 3CTRA 1ASWA 3R5AA 1J27A 5L38A 5E2QA 4FJNA 3FEZA 4YFUA 1O5JA 5M1QA 9ICNA 3MBYA 4WU2A 1UFLA 1IKVB 1JLQB 2D3ZA 1VLYA 4KHSA 3JSYA 2XZWA 3FQKA 1V5VA 3UPQA 2PO4A 2GAGC 4IO8A 3LPUA 1UPMB 4QJFB 3IBWA 3EEQA 4KLQA 2YB4A 4WQ4C 1T3OA 3PKYA 2PFUA 2CDRB 2KVIA 8ICEA 1UVNA 4KKOB 4XEIA 1KOOA 3KTQA 1U2VA 4QZFA 5CYQA 4NM2A 3RH4A 4Z7CA 2HBLA 3KLGA 5J1NA 3GBTA 4F3TA 3JSRA 4EP5A 1FXLA 1NM2A 4PA1A 4LF5J 4FFDA 2XY8A 4KH6A 1VC0A 3VGVA 3H98A 1TUGB 3QFWA 1ZOLA 4HI1A 4QW8A 4A8SA 5FDLA 5KAFU 4MT1A 3KWIA 2QC3A 5HQLA 4LRFA 4ZLJA 4IJAA 1E6VB 4MIAA 4CJ7A 3UQSA 1XK8A 2AH5A 5IC6B 1BY9A 5FPNA 5A2QU 3CCSS 2HAFA 1U1PA 2KSOB 2APOA 3NVWA 3TEHB 4QZCA 4QWAA 2P5GA 3CCJS 2C2ZB 1K73T 4E7LA 3ULHA 3ZSQA 4PKDB 8ICCA 5B7WA 4GVBB 3FCWA 1C0MA 3AOCA 3TAMA 2GH1A 1N5TA 3A1YG 4NCGB 5J0RA 1IKWA 2FBXA 3QNOA 1HI0P 4LF4K 2ZE2B 3ZEUA 3A13A 4BHQA 4PXDA 4CECA 2V69A 4F3QA 3UM9A 1K1SA 2HFNA 1OWXA 3V9WA 5GAHP 2XC9A 4CZKA 4H4MA 1QSYA 4IQVA 2PY5A 1YG0A 2QXLA 5AXMA 5KI6A 2QB0A 1RBSA 1UETA 3CD6S 1U24A 2JOQA 3W5YA 1NGBA 2HK3A 2P6RA 2OFHX 3K5LA 2P6TA 2QB0B 4OZJA 5CCLA 4Q5VA 4BRCA 1WHWA 3Q8VA 1FVQA 3V81B 1F21A 5KFCA 1UEUA 1T4GA 4BRQA 1TV6B 2A42A 2GW8A 2VF3A 5KT7A 2VPWB 3G6ES 4GNIA 1N8RO 3RG6A 2QYGA 3GU0A 3AQFA 4DN9A 5JLFA 3NCIA 1BD6A 2NUHA 4CEQA 5LJVA 2QARB 4CK2A 1EKRA 6AT1B 3S3MA 5EVZA 2VBZA 2AXTU 1B99A 1CQMA 2ZJRQ 2BOAA 2ZD1A 4CHZA 1WN7A 2LXFA 2OH2A 4LR8A 5JXSA 1UVLA 1Z4NA 5TKYA 2BGGA 3H5UA 4FKXA 4FXWA 8AT1B 1ILYA 2AZ1A 4RKUC 2D74B 4KHYA 1RT1A 1H98A 2GZOA 2F4VF 4OLAA 2XM3A 3AQOA 2JZ5A 3ZZYA 1RTJB 5A6PA 3L4IA 2DR5A 3LGNA 2RILA 1YBTA 3VTHA 4UY8O 1TP7A 3ZZ0A 1VQMS 2HSTA 3TO8A 1KEKA 2GC8A 1FJGK 4UF4A 1HBOB 1N5VA 3TADC 5LMNJ 5J8YA 2N3LA 1HNZK 3KJFB 4Z6FA 4CF8A 4E3SA 5AI6A 1ZQFA 1NJXA 1EXQA 1CBKA 4FJ7A 1SC3B 1SKUB 3AVIA 3BYRA 4CJ3A 4KE5A 4DUZJ 5CYQB 4PGXA 2MQMA 4JNEA 3R6GB 4N8OA 1KQFB 4PHTX 2W25A 1VQ5N 1YZ6A 2QYCA 1EX8A 1N34J 5TZVA 1RP5A 5D3GB 1N6QB 5A76A 2FJDB 3J80O 3JQMA 2HRTA 2VANA 1VAZA 1FXDA 1NXIA 3CC4S 5DM7L 2YNIA 4JKFA 3CCVS 1APSA 3CCSN 2GUPA 1OUQA 1IR2A 3QFHA 2HNDB 4WF9L 1MA7A 5F3TA 3GIIA 2DGSA 2LDYA 4HUEA 4PYAA 2KJ8A 5HP4A 4KV8B 1RT3B 4Z4EA 2ILYA 2ZHBA 4DL7A 3NVYA 3QAEA 4BQLA 3MR2A 3E9LA 1KTVA 2PC6A 5E3PA 3ZX3A 3LZJA 1N33K 1HMVA 3PCOB 5F0WA 3QESA 1QAYA 3U1NA 4FPIA 3PO5A 4YOYA 4CK1A 3NH0A 1U09A 4KYZA 4ZVOB 4E1MA 1CSJA 4Y2JA 1KFSA 2OEMA 1FRHA 3V5RA 2KP7A 3CJAA 4DR6J 4K8RA 1UOCA 3GFZA 5ALKA 1PILA 3AD8C 2H5IB 4XPCA 4LRBA 4CGGA 4IO1A 4RQMA 3N7PD 1HNWJ 2RHSB 4OHXA 4WFBL 1FRLA 2MSTA 2QLXA 1GXLA 4H0OA 3T9ZA 4X4VA 2Q2RA 4JMUA 2UUCF 4K5RA 5C12A 2KG5A 3K2YA 3AHPA 3SYZA 4RW8A 4R8UB 9ICWA 2BM1A 3H7IA 1NDKA 1QQ7A 4QR2A 3M8QB 1ZM4A 3I56N 4P4PA 1CPZA 2B4OA 5B0FA 3RAMA 3WX4A 3L2VA 3OLAA 2MYFA 3EPIA 4I56A 3SPYA 5D3GA 2HOEA 3IXQA 1JLAA 2DPIA 1BQNA 4UB4A 1Z2ZA 3FKBA 1YAGA 4K4XA 1BPBA 1UEKA 2DYAA 2EXUA 3CQYA 4I6MB 3J7YU 3QSYB 1RQNA 2ZIVB 1FK9B 1XMBA 2ZM6F 5L46A 1CJUA 4CO0A 4FJ8A 3OYAA 1VRUA 4F25A 4FPRA 1RTHA 2OD6A 2OEHA 3B6BA 5G5HA 3ILJA 3VQPA 1LWCA 3E3XA 2O1PA 4MQ3A 4LSNA 2E4LA 5AKHA 3DFEA 1S6UA 2ZTEA 4WU3A 2JXJA 2P9UB 4HCCA 4PPXA 3GU3A 1IKXA 1A5VA 1DAXA 1NMDA 5DDMA 4XRHA 2RS2A 2HFVA 2F4FA 1LAWA 3V72A 4QBUA 3QZ8A 3FEXB 4X4TA 2HOQA 3OFFA 4Y2YA 1B0VA 3RBZA 3N6MA 2B4JA 3KG1A 4IG3A 5KFPA 1GMWA 3BR8A 2FJVA 2LA4A 1WI8A 1Q81O 4H5RA 2KJVA 1WEYA 2Y1IA 4I6WA 3MK6A 5J2QB 2F9WA 4GIBA 3B78A 1GH8A 1NZ8A 4CZCA 3OBYA 3NRBA 1VI7A 1J5EJ 3WUHA 4URGA 3FSYA 2DRDA 1ASVA 3D3CJ 4IH6A 1JNZB 3CHWA 3I5CA 3HBTA 3P31A 1ZQAA 5HQ8A 5IQQA 4CGZA 1YKWA 3K5NA 2O8EB 2H4YB 2WONA 9ICRA 3V81A 1GO3F 3VF0B 3QGPA 2BJ1A 3HYFA 3SQ2A 1RBVA 1KHVA 4FE3A 4RG8A 2BDUA 4ZITA 2JGAA 2W2MP 2C2RA 3SAFA 1A0PA 4OX7A 2JH3A 5AK3A 3U4LA 3RJKA 8ICOA 4HEA9 2E9ZA 2IMWP 4Y65A 3H0RB 5HBMB 2QN6B 3F5TA 2YKNA 2XZTB 4UW9A 3NH1A 2ACYA 5AM4A 1HNXF 2I1QA 4HHTA 4YOUA 3KD5E 3GE9A 4DL0C 4NL9A 2E5LJ 1ZQPA 3TAMB 2XYPB 2R2SA 4MHVA 4F91B 4HWIA 1Q7LB 3TTDA 3LP1A 1FO4A 2V8DA 4TNOA 2D5RA 5AM5A 1ZD2P 5DG7A 2W54A 1HNVA 3DJCA 4OJOA 1VFJA 2GIFA 3IAM9 2P9NA 2F1JA 4O9MA 4DR7F 3EDQB 4PL7A 1V5IB 1B9DA 3UDLA 1E3MA 1Z05A 5DDRC 2DQNB 3QT6A 1YJVA 2PN6A 5F2RA 3IAYA 2NZTA 2G2OA 3J81j 1V9OA 1VQNS 1TKZA 2XYHB 4CLUA 4CJUA 4X4PA 4EAHD 4OL8A 3BN7A 2YH1A 1FEZA 4RLEA 4F4YA 2AV5A 1FRIA 2F1FA 4M94A 3N7SC 4JI4J 1S10A 3LGHA 4L73A 3VCDA 3CYMA 5K8OA 4OFZA 3B9JA 2E9TA 3FBBA 2YMLA 4I2GA 1WSRA 1YTAA 1TV9A 5LMUJ 3DLEA 1UT5A 2NRXA 1FRKA 2LKZA 2XS7A 2MA1A 2K8CB 1SQKA 4KLDA 3HHNB 2HZAA 1RHJB 2JLGA 4MFBA 3LDAA 2XMVA 4DPUA 4D3GA 2ZBCA 3TNVA 4DV0K 1URJA 1CJKB 3NMUA 3K0SA 3JSBA 1JLQA 2EAPA 2FZGB 5ETKA 3ZT1A 2WMMA 1N61A 5KFWA 2GTDA 1VQ4N 1RAJA 1V4SA 1ZA1B 1ZQVA 2V2ZA 4PABA 5AZJB 4LRDA 1UA1A 1OY9A 2GVDA 2PE8A 3ICLA 1AFJA 1TK0A 2B7CB 1K5OA 5EGYA 3LA0A 1S59A 1EP4B 2G13A 3MM8A 3ZDBA 4OHYA 4KRWA 5I4MA 5BRFA 5FPMA 2VKRA 5CRXA 4NLVA 2D3O1 3DDIA 4M7YA 1SV4A 1S49A 2P9KA 1Y11A 2A41A 1IJFB 2UUTA 3L4PA 3RUBL 3MAQA 3QWUA 4KRFA 4JI6K 4ZVPB 2YNIB 1I94F 1WKLA 3NLCA 4IFEA 4JI3K 4NCBA 2LA6A 4CZJA 3GONA 2LU2A 4E8UA 4CTAA 1Y9OA 4OKEA 3W0LA 3SI8A 4BJQA 4EX6A 3SR6A 2DR6A 3GYNA 3SLCA 2PT0A 3AJDA 4DMZA 3H59A 4WTYA 4HVZA 2VA8A 1YXQA 3RMCA 2AX0A 3MXJA 3UN3A 1ZQGA 3W2WA 5MLCV 3C95A 3S41A 2ZIVA 1FK9A 1TYQB 1UQVA 1V85A 4KLIA 3OS1A 2VJ5A 1QVFM 1MN7A 4P7VA 5JVGQ 1QQNA 4CRXA 2YHBA 5AT1B 2HAIA 3HHDA 1PSDA 2CA9A 3H0MB 3AQEA 2R2TA 3WC0A 3THWB 4JI8F 2IM3A 2OANA 1GEHA 2XS2A 1GFWB 3H2LA 4L3KA 4PZOA 4R8UA 1TTHB 3QPIA 3OTOF 4UQGA 1O03A 2DH9A 4ES1A 2FDNA 1SJ4P 4CIOA 3T5JA 5JVHQ 4PGQA 2DKOB 2EC0A 4OPJA 2OKQA 4QS8A 1C0FA 1KCFA 3M30B 4DHYA 4DX7A 1RBRA 2GJ2A 2Y8YA 1ZETA 1FXRA 1F5SA 3OV7A 3WXKA 1COKA 1UJ5A 2QL7B 4KH1B 1YUWA 3JTPA 3QT7A 4OQJA 4LF9F 4YOEA 2IMOA 1VQLS 2H48B 5DB6A 1NMNA 3FM9A 3UCGA 1YF5L 2WZ1A 3NP5A 1JJ2M 1FTCA 1AW0A 4MKYA 3PV8A 2L5YA 2KVQE 3BR9A 4JI8J 4UZCA 1HIWA 2FLNA 2W7PA 4N47A 5DBBA 4US8A 4PUOB 2X3GA 2HVZA 3NF7A 4F2SA 2GJFA 3G4SN 3QBXA 3IM8A 4J9MA 4O3PA 1FD2A 2LYAA 3BDEA 2NCKL 4AQYF 4PUOA 3MM8B 4JV5F 2KT5A 1YVUA 3TYTA 4CF9A 3W3SA 3FBFA 2HNDA 3IM1A 4NRUA 2A18A 4M5KA 1XMOF 2WHOA 4B02A 4A46A 1ZBLA 3E1YA 1HD1A 3IDWA 2MGZB 2ZC4A 1SL0A 1T0TV 3V6DA 3HILA 2Q3PA 7FD1A 4K41A 4I2DA 2NYHA 1N6QA 2ES6A 1JIHA 1NGAA 5KL8B 4JKGA 4V19S 2OIHA 2Z8QA 4EZ6A 2I1RA 4F93B 4C9DA 3EVOA 2ZJPQ 5KFUA 3V7KA 4BDZA 1JCGA 1QY7A 1XNQK 5GVQA 4CLYA 2B8QA 3SPZA 3C8YA 3BZKA 2DPJA 2ZWOA 1RTIB 2E5HA 3SFGA 4BDPA 4LJMA 3NBPA 5KT3A 4CP5A 4LFBF 5AR0A 4GO7X 3CC4N 3JPPA 3OJUA 3D1OA 1B0XA 3Q8KA 2RPIA 1PVRA 2A1AA 2XQCA 1RTJA 3TAPA 3KLHA 4H54A 2E1YA 3MN9A 4NA2A 2U1AA 2FJWA 5KG1A 1DLOB 1N5YA 4BRMA 2H3ZA 4F3MA 2IRUA 5E33A 3GV7B 2JSXA 1B7FA 1AFIA 3THXA 3WIVA 1CJUB 1WSJA 2D0OA 3MWBA 2QWMA 2G8FA 4KKOA 2OI2A 2B9EA 2OELA 5JLHA 2VQEK 3ED5A 1JLCB 1WF1A 2BUNA 4PG7A 3EE8A 4YCXA 1VSFA 2A1JA 1CQNA 2MZRA 5IV3A 2ADCA 4USJC 2KYXA 3W8PA 5HL7Q 5CXTA 4RW9A 1IKVA 4C3LA 4DV6J 2HHHJ 4KB7A 2EQYA 2JFDA 4ZPAA 4K43A 3C46A 2GAHC 2O8BA 5GINA 4CHQA 1HKBA 4ELTA 1SIZA 4HKQA 3CDUA 2NYIA 5M1PA 3MXIA 2FZKB 1L3SA 3QT5A 1TL3A 3Q8UA 3H3OB 3JPNA 2KKVA 2YWHA 4KITB 2G8VA 3JPSA 2BCQA 4YEAA 3PY8A 3VAGA 4GMJB 4QIGA 2VFUA 3NTUA 7ICGA 5F8IA 3OS0A 2R7TA 4GXJA 4RQ3A 3OTEA 3OQ2A 3FZKA 1RT5B 1MWZA 4JKDA 5AQKA 3RW6A 4X4NA 1R0CB 3VMFB 1L3UA 2DFFA 2JC1A 3JYTB 4QS7A 2QB1A 2R18A 1S3XA 1T6DA 4DSEA 4DTUA 3Q22A 4ED4A 2AMCB 3JYTA 5F8MA 5AQFA 3NY0A 3CM6A 3IS9A 4BC3A 4GLXA 4FK0A 2ZJ8A 2HQDA 3CW2C 2KMDA 3THYA 4WFBQ 3TR8A 4EWTA 2YHYA 2NRWA 3T79A 2CFXA 3BS5A 2IJNA 4YVZA 2BACA 4XAKA 3RR7A 3A0BU 3ZTSA 1S0VA 2IA0A 5AQIA 4RW7A 4I7FB 4OJ3A 4M8LA 8ICUA 2Z2MA 2HVEA 2DGZA 4DL3A 2QIFA 2XEXA 1NEEA 3HZ6A 1Q18A 2ZITA 4LFCF 1GX6A 2A1JB 2QLTA 4NMLA 1VQKS 4ZA1A 1F9HA 2QV6A 1A5WA 3MCMA 4QYZK 2A40A 5ALNA 2J76E 2FHJA 2CPDA 1KAZA 1FW6A 4RL1A 5KG2A 2EFPA 2P9CA 3ZT3A 1GMWD 1YVNA 3MHYA 5BJRA 4Z4CA 1GXUA 3HOSA 4I6MA 1M1KT 3VAIA 5ALVA 1XHXA 1CUKA 1YJNN 5C5JA 2M88A 3CF5L 2W03A 1Q82T 1RG6A 3QIDA 1S0NA 2BZ2A 1HWUA 4M7XA 4K8XA 3O3FA 3WC2A 3OYGA 3ISZA 3D0GE 3VGMA 4ZTJA 3RVCA 5KRSA 5EU7A 4I7FA 3QUBA 2F3NA 2UU9K 2W6LA 5I3PA 2I5JB 4RW8B 4KQZA 5T41A 2DFHA 1HKGA 4GY2B 2QMWA 3L9ZA 4CIFA 1QUPA 3EKSA 3NL0A 2IC3B 5KT6A 2G09A 3MXMA 2DGUA 2KHQA 2RU3A 2UVRA 3UKUA 1UVJA 2F40A 3OTCA 2LP4A 1EQ0A 4JD2B 4DFPA 2CH6A 3IWNC 5L1IA 3HWTA 4X4OA 1WACA 1VQ7S 2SXLA 1QTNB 1KVBA 1MQ3A 4KPCA 2BW7A 1NOMA 1BWFO 2KIVA 2KXHA 2CWXA 1JKHB 3M9MB 3PW5A 2ZNYA 2ZGZA 2FXUA 1RJJA 4OJGA 5FP0A 3OYFA 2D0AA 4M3ZA 4RQ6A 3P49B 1OO0B 3SFUA 2PMZC 3GJSB 2X1GA 2LYVA 4URQU 1EAYC 3TQ1A 2YNHB 7ICHA 1ECWA 4ALZA 1L3TA 1Z2LA 3CO9A 4M1KA 4HL9A 3R97A 3QIPA 9ICGA 5CHGA 4M3YA 4YUDA 2NO4A 3B0YA 4CBUA 2F2AB 3ZI4A 1V3RA 1NCLA 4QIFA 1VLBA 4FXVA 4K2JA 2XHWA 1PZNA 4WKYA 6FD1A 4ECSA 3LVVA 4K4UA 2ILZA 4NCGA 4EU0A 3D2SA 1NK8A 4H0PA 4RQ2A 5KG0A 3GSIA 2W04A 3MPYA 5BR8J 2CZ4A 2FLPA 1WKJA 3C1YA 3DLGA 4OZLA 2MMYA 4CYUA 3D68A 2RNEA 1X9MA 2HNYB 1Z19A 2DNLA 2DGTA 9ATCB 2E5SA 3OL8A 3PLAA 4NLYA 3MOZA 3TZWA 3THPA 1M1KO 2B4UA 1U48A 3LO3A 2V2VA 1H2TZ 1UP1A 3H7HB 2NPFA 1BHNA 4O44B 5BYQA 4BROA 1U6ZA 2GGPB 1HNIA 3KDOA 2CJXB 5F0UA 2Y9TA 4DU3A 1EKSA 1BPZA 2ATCB 2LBOA 2MKSA 4FWQA 3KJQB 2OEKA 5DGBA 1U49A 2R7XA 2IVYA 1KQQA 1RT7B 2HBJA 5FPEA 4RW6B 1QQCA 2Q97A 2L9DA 2ZFHA 3BBFA 3TADA 5BR8F 2UXBK 4UOHA 3TVYA 5CYJA 1B64A 5KG5A 4AH9A 4KO0B 2ZM6J 2AJFE 2GMLA 2XLKA 3QBWA 1JRPA 3M9OB 2PZSA 2RLTA 5AKLA 2VBWA 2OFGX 1QZ5A 2RMLA 5J29A 2B6GA 3RJMB 4ZTFA 5LJ5Y 1ZQRA 1CJVA 4C1NI 2MZTA 2KD1A 4UB1A 4DOAA 4BE0A 3KUGA 1OW5A 2RB7A 3MUTP 4ECTA 2ROPA 5A2QY 3ZSWA 4O55A 4KT0C 7ICQA 1NGCA 5B0CA 2FC8A 3WK8A 2CG4A 2EKYA 3R3LA 5JS2A 5LMUF 4BE1A 4J9PA 4H4MB 4WPAA 3BY5A 5BRDA 1QQ5A 4RUCA 1P1LA 2CADA 1Y3JA 7FDRA 2OTLN 2ZH6A 3O08A 2UVVA 1TMJA 2MQ8A 2E1AA 4KLEA 5KOXA 3M8ZA 1SC6A 2GIQA 3ZSYA 4TU7A 2UUCK 4DR2K 2ROGA 1P8ZA 4NCAA 5K14B 2V7YA 3NNCA 1R7IA 2GLEA 1U26A 4O23A 3WHIA 4ER8A 4ED6A 3CMQA 2XMTA 1JWWA 4ICLB 3CCUS 1YIJN 4GW6A 3O1WA 4IEEA 3TTFA 4FWKA 3ENBA 1OIAA 2CQPA 5ETOA 3N7RC 2CH5A 1DURA 2ZWPA 1GK8A 4X66J 3DOLB 4G1QA 2D0BA 4BLGA 4F2RA 2DIUA 8ATCB 2XHCA 3OTBA 2V8VA 1T94A 5M1NA 1FKOB 2I6XA 5CHCB 4F4WA 4HDGA 2UXCF 4LF6K 5CE3A 3M1VB 4BG8A 3RAQA 5DB9A 2DNPA 2QX0A 1TYQA 4WK3A 4Y28C 1NGDA 3HFZB 2V7ZA 4UAWA 4PG6A 3AY9A 1TL1A 2HB5A 2E6MA 3CJ8A 2ZD1B 1CLFA 1CLQA 3C2PA 1WDDA 3HKWA 1MROA 3CP8A 3CJ3A 7ICUA 3LDQA 3PR4A 1GLAG 5DS7A 3JAMY 1JXBA 1IBKK 2AHOB 1X2IA 3E2EA 4CIGA 2FJEB 3PJWA 2DNRA 3UW1A 4AUKA 3VAFA 4ES3A 4NLWA 1EO1A 1VCTA 4CJFA 2OUGA 1U1NA 3BJYA 2G07A 1BA1A 2ZH4A 2Z2YB 3MX2A 2DNQA 3UKRB 4ZVUB 4CGIA 4PRFA 2AWZA 4ZCMA 1RWMB 4Y2MA 4BE2A 1C1CB 3UNYA 4JI5F 3C94A 1XQSC 2JHDA 1HYZA 3N79A 4YDUA 4IFVA 2XY5A 2GMHA 4N8NA 2QFJA 3HSTB 3NF8A 3QNMA 5KFJA 5J0QA 4JYAK 2B51A 3RB0A 3H1VX 4DU7A 4IKFA 3UD4P 2GWJA 4DPOA 5FRNA 3AVNA 3O80A 1ZBHA 4UASA 1MU2B 3MR7A 4RT3A 2ZE2A 3ZEUB 4ILMA 1XQIA 1BCMA 3MCNA 4OX9F 2AP6A 1HARA 1H0HB 3IC1A 2AYBA 5J0OA 1K9MO 2O66A 4G9BA 5JU5A 1J5OA 4DUTA 3KOAA 4RR5A 2YX1A 4Z2XA 4HH1A 4EEKA 1RA6A 1FJ7A 4DUYK 1JMTA 1D5AA 3LALA 3ID6A 2CPRA 5FPDA 2E1ZA 2AGOA 1VSDA 3LW5C 2QMXA 1HNZJ 4B9UA 4YOTA 9ICOA 2R3VA 1G7CB 8ICXA 9ICUA 3F9MA 2OWOA 1FJGJ 4N5SA 4JI7J 2YWFA 3I8BA 3QJPA 1TKZB 4HDHA 4JWMA 4BRGA 3NCQA 2PMZF 1IKXB 3T1HJ 2J9CA 1NGFA 7ICTA 4MKVA 1NJYA 4ANEA 5AQSA 2N7CA 3L2WA 1FO1A 1R89A 1QHTA 4ILJA 1ZH5A 2IHMA 1RCHA 4ZVSB 3KG4A 4YY3J 2P9PB 1F5BA 3VQ8A 1NGIA 3IA0A 3WK6A 5ETMA 2PMHA 3N5FA 4FLVA 3KDNA 1ZQKA 3VOVA 3SQ1A 4FYVB 2E6LA 3DN9A 3WXIA 2ZH3A 1BQNB 4PQAA 2D1KA 4FDFA 2W4DA 2XBPA 3ZNUA 3TQEA 1V4TA 2J6SA 1YJWS 4KJIA 2P9SB 3B4DA 4ZN3A 3SCJE 1GOCA 3QU2A 1S97A 4M9LA 2D3DA 1S6PB 3G87A 3BZCA 4X62K 4DTRA 2V8GA 1HWLA 2W9MA 2E5IA 3EZUA 4LZGA 1NHKL 4QR0A 4QIEA 4X4RA 3A3PB 3KD3A 4KLGA 1S6QB 1RXOB 3OFGA 3B6PA 3FFIA 3CC2N 1OYDA 3ITHA 1JALA 1ZXIA 1S1VA 4DR3F 4DV3K 5EN1A 3WKEA 3E0FA 3EJMA 3KHYA 5J0YA 5KT4A 2LCWA 3M2RA 1UW4A 4CJWA 1J2VA 5GADI 5IT9Y 4U9RA 1LAVA 3PYDA 5C42B 1FDDA 4QU7A 4PHPA 4X64J 4KLUA 3N4PA 4JK8A 5KNIA 1WB9A 3AM9A 1SV0C 4FLXA 5GIOA 5T7LB 5GAHI 4FF1A 2PYJA 2H3QA 4BC5A 4O5BA 1R8AA 3N0VA 2JH7A 3SEIA 1ZQSA 1VLOA 4C0OC 5EOZA 2DGOA 2KICA 4JV2A 2PXIA 4UB6U 3DMJB 3HSJA 1YDLA 4KLTA 1O13A 2JR5A 3OUYA 2EX3A 4FYXB 5KPRA 3L6QA 1KNZA 5C15A 1IKYB 1HQUB 3C21A 2KLAA 2ZUGA 4ED0A 4TQSA 1NGJA 3RRHA 4QS9A 2UUAJ 3CE8A 2GHWA 2W4CA 3HDSA 1VRQC 3OVNA 2GFFA 3EMTA 3PEHA 3O5BA 3AMZA 3HKZF 5HMXA 4XA5A 1VSJA 2MZSA 3G6EN 4AHVA 3R9PA 3PR5B 2AKWB 1KL9A 4CH0S 1RTHB 2CG8A 1NHVA 3CT9A 1VISA 4I6AA 4G6VB 3P45B 1TUUA 2O8CA 3H2VE 3CJCA 1HPZB 3QZ7A 4B6JA 2BHNA 4NWBA 5LSOA 2QSFA 2CQHA 3A0IX 2CNNB 4CFDA 1NSQA 1S48A 3ZETA 2O6KA 1HBOA 2A2CA 2CPXA 5EXWA 5EE9A 4JN4A 4M3WA 4KHRA 1ZBIA 1BQMB 2KB2A 1JLFA 5HANA 4CH7A 4OJPA 1S0MA 4WFNQ 1IXRA 2GNKA 1ZBSA 4I6YA 2IGIA 4CLKA 4PJ0U 1RK8A 2VWBA 2PI5A 4I2HA 3R1XA 4BG9A 2WC9A 1S1TB 3LP2B 1S12A 5JTIA 3GJRB 2HCFA 1LVHA 3DC2A 5KFHA 2RE2A 4Y2IA 2DNGA 9ICQA 3W3DA 1SZ2A 4M9HA 4CK3A 2MJUA 4LY7A 1SV5B 4DKWA 1NRKA 3HVTA 1WWHA 1G4CA 2VBXA 2ZHAA 1N5SA 5J2NA 1OH8A 3K75D 5GAGP 3KYLA 3M1FA 3V2UC 3D0IE 4ZPVR 3PIPL 2QA2A 2VBYA 3I96A 2CQDA 2AP1A 2XHBA 1L7MA 3V6DB 1RQLA 4GFJA 4PWWA 3UNGC 3SD7A 3VGKA 1C0UB 2H3FA 2B43A 3AVBA 2CJAA 1HA1A 3H08A 3GIJA 2BJ7A 2KOBA 1NK6A 3JXOA 5CB1A 1P90A 3CD0A 3W9IA 4CJQA 1RGVA 3U9DA 3KOOA 1QE1B 3CDBA 1DZ5A 1R8HA 2DXEA 4JKEA 3CJ2A 2HZVA 2C22A 3C7NB 1R0BG 1IV8A 4FJXA 1LK7A 1RT2A 3KNGA 4CF5A 2XNQA 2RRBA 1X5PA 2M3DA 4RPXA 2Y9HA 1Y0HA 2X6SA 7ICLA 1C2PA 2JNJA 1X5OA 5H1SV 5A0YA 4JS4A 2D3OR 3C29A 4GXIA 2IOCA 4IQXA 8ICNA 1J2MA 3CJ1A 1LWEA 1KKHA 2DL0A 4ECWA 1ZRMA 5ALTA 1YHQS 1JB0C 3DWLA 4FK2A 3S8SA 2UP1A 1BUXA 3QNWB 3ZT0A 1DHMA 2KSOA 4I28A 2XNRA 4FWSA 3HM8A 4LD0A 2WB1C 4Y00A 4YORA 5GAHU 2DEJA 1ZBFA 1RNHA 3V1OA 3H5XA 3WX8A 2PBDA 3I76A 3THWA 2FMPA 4K2XA 3ETLA 2EPIA 4JLHA 2BTFA 3LH2S 5ALUA 1XNSA 3KUHA 4CGHA 4FLUA 4H5NA 1QUVA 3D2EA 1RT1B 1UMJA 4I2EA 5D77A 3OD2A 5F8NA 3TA0A 1RBOB 2EFGA 1RCXB 2K7JA 1IM4A 1RAFB 3KLGB 3ZXWA 5A6WA 2RQ5A 3CVKA 5JS1A 3RRGA 3TAEA 2EFQA 3SMPA 1WELA 2K8AA 2UVUA 1U2VB 3GR1A 3TUJC 3ZZUA 4KR0B 3PRBA 4WBFA 5IIMA 2V67A 2OD4A 2IAJA 4C8OA 3Q86A 1AT1B 2DVIA 2KJ9A 1FI4A 2JLEA 1MA9B 3GTYX 2GA7A 3D66A 4FYDA 4MFAA 2A19A 1HX1A 1BC6A 4TUPA 5DMRA 3KLIA 2CQ4A 3LGMA 1MDUB 5J2KA 2BRKA 2JRZA 3OVSA 3U02A 2VZ9A 4B3TF 2KV2A 1VRTA 5E41A 5M2UA 2QWLA 2VA2A 2FHKA 4ANDA 1GLDG 5ALLA 4OJHA 1VIXA 3O8WA 1VQ4S 4LZDA 2C2KB 3NVZA 1U4BA 2D6FC 5LOQA 4FM0A 3UXOA 1P9YA 2A6AA 4JWNA 2W9CB 2BR0A 3BGLA 3AA5X 3IUCA 4DR1F 2CPEA 1GLCG 4LF6F 4DS4A 2C3PA 4M5HA 2KRBA 3R2CJ 3HHEA 1SKRA 3HXMA 1IBMF 2IDOA 3SCKE 1S9EB 2ZBQA 3TI0A 1CJKA 1RLCL 2DNHA 5D0HA 3V9XA 3NF9A 1T05B 1YBAA 4ZJQA 4RCHA 4YR0A 2VICA 4YOXA 1LNQA 1FDAA 3KK2A 4MFBB 3QMQA 3BH6B 4ECUA 2HG4A 3ET6A 1M5OC 4GVBA 3CULA 1QDUB 2HQCA 1NJIT 4DR4F 1VMBA 9ICBA 1FX2A 2ZBRA 4ZIVA 1M5SA 4QPTA 4JKHA 1U2CA 9ICPA 4NXMK 1FFUA 1OQ6A 1SQFA 4XH1A 3VEWA 3D7EO 2E2NA 2HW3A 1NDCA 1UT8A 4FJGA 5LMNK 4DPXA 1RTDB 2JMGA 2FMQA 1ZZNA 2O5DA 3CCVN 3VEOA 5ALGA 4DMNA 4RJVA 5C2DA 2FHJD 4W90B 2F1IA 2MY8A 5AQMA 5AZIB 4K0KK 4JAXA 4U8YA 2MKIA 3VAKA 2LMIA 3ZT4A 3NS1A 4ANCA 2X74A 5GAEP 3CDAA 4BQZA 3GCWP 4C4TA 1JJ4A 3NUQA 1WOPA 1XO0A 4M04A 5ETQA 4H5TA 4ZVRB 5BPNA 4CVNE 3VQ9A 4IC9A 3TSUA 3UDVA 2Z2ZA 4FBTA 4EYIB 2OP5A 2E3TA 4JI1F 8ICHA 4UQTA 1UPPA 5DGAA 1GLJO 8ICWA 5IM0B 3I31A 4RUBA 2E1FA 3I0SA 1QZ6A 5J0TA 3M6XA 2YCHA 1NMEB 4NPOA 3FZBA 4O4GB 2VKZG 2R7RA 3ETOA 4MTPA 3FBEA 2C3OA 2QWRA 1RWOB 2MJNA 1IBLF 3QIOA 4FYYB 4TYBA 3LPYA 3PIOQ 3U8XA 4Q44A 4MYUA 1C0TB 4IG0A 4A8WA 2MTLA 4WP3A 3NMAA 3IP4B 1X4HA 2DY9A 4JS5A 4KH0B 1U8SA 3CCRS 1EETA 4I2AA 1WC1A 2DGQA 4L3QA 2NRRA 1V38A 4XIUA 3AVLA 2BQRA 3DXKB 2HVHA 3CMAN 4UARA 3QNNA 4E2FB 1DBDA 1S5LU 4WKRA 4UB2A 3MPUB 4WWSA 4ZLNA 2XY6A 1AUDA 4OYBA 3JTNA 4FZZA 3KZXA 1UCNA 2P9LB 5GAEU 4MYTA 2XMUA 2FVPA 5HVHA 2DEIA 5DDYA 2RD5C 4ITSA 4BRIA 2DNKA 2K7KA 1YBUA 1TL7A 2W7OA 4QZIA 1QCKA 1PAUB 2CQBA 2WW8A 3ZX2A 2KFZA 2BE2A 4EI2A 2W3RA 3TSPA 3BSAA 1HR0K 1JNRB 2YWGA 4ZPBA 4F02A 3D6FB 3E8OA 2IDEA 3EICA 3M8RA 3BP8A 2G8WA 1TAUA 1FFWB 1P1TA 3UVJB 2BOPA 2RRAA 2DF4B 1PVPA 2VQFF 1AZSB 4BBYA 2ZWHA 5MAOA 4DFJA 4NV0A 4Y2VA 3OT9A 4RPZA 2XY7A 1QQMA 3JPTA 4M3XA 2K4PA 3VGLA 3C14A 2B3TB 4KAIA 4NLBA 3LL3A 1NO8A 4L74A 1RLDA 4PKIA 2ZUAA 4KLMA 4KHQA 8ICSA 3D5MA 2P9UA 3BQ1A 1L3KA 1IH7A 2AEFA 5AQLA 2W2QP 2MDAA 1K8KA 4A61A 3QRQA 3R8YA 4C11A 2GV9A 2LQ8A 4C8MA 3EO3A 3G2XA 5HSPA 1IG6A 4S0MA 1QTMA 3JS9A 4NA1A 3AO1A 1SC4B 1UW9A 1X0PA 3VQSA 2FY8A 3WQUA 3ENAA 4I2QB 2E8OA 4ZPDA 3TZYA 2P5VA 4M5NA 5K4LA 2BM0A 3T1YF 1MQ2A 3VQDA 2RT3A 6FDRA 5ALFA 3M8QA 4I2PB 2Q0RA 1HHTP 3M7VA 3S3NA 2IVOA 5AI5A 2OCEA 2RVJA 2CN1A 4RPFA 3TPQA 3TU5A 4JV1A 1BMQB 5HR6A 4PKHA 1R0AB 4NYOA 5F0XA 3BGRA 1R43A 3OR2B 3V9SA 4OYPA 2ZF5O 4TSXA 3W60A 4DUYJ 3HPHA 3M7DA 4NXNJ 4MEYA 3A12A 1TKTB 2JLFA 2HHTA 3QU7A 5KG6A 2UV8G 3MM7B 4WE1A 1XNQF 2YV0X 5F8JA 1RE1B 4IWVA 5KFFA 2VGMA 3O2IA 3TTCA 3NE6A 3PYGA 4YOVA 2J6TA 1PIEA 2OEJA 1HR0J 2VFRA 3Q2TC 3C23A 4NLRA 4YMNA 4WIIA 2YHXA 1NKCA 2YKPA 1RT3A 4P72A 3TABA 3LQVA 2BUPA 2KL8A 4DV4F 5L1LA 4US9A 1VBYA 4B8CA 3CMEN 2HI0A 5J2PA 5AE2A 2BANA 5ALJA 5IT0A 5J1PA 2EFOA 5KL1B 1Q79A 4FVCA 3W2VA 5HLFA 4BVPA 3C5FA 5A8KB 4DR3J 4YOWA 5G5GA 1RT6A 5CEHA 2GIRA 2OO4A 2ACMA 2GVZB 1FTRA 5C2GA 3T9NA 2H4WB 4IQMA 1E4GT 3HOTA 2MZJA 1UCVA 1IBKJ 1YJRA 2NUUG 3JTOA 4B3SK 1Q8BA 4U7UD 3EZ5A 1D8YA 2DHGA 1KRPA 4L72B 4QIWC 5IILA 1U0HA 3QLHB 4JRQA 1WD6A 3IRUA 1IR0A 1PC5A 5J0SA 3BBBA 4AM6A 1N5XA 5CZVA 3SBGA 5ETVA 1WSEA 3GG0A 2W8KA 1I6JA 1F0MA 2HHSA 3DGPA 5DQHA 4DV7K 3WK9A 3E51A 3M8YA 3O4WA 4F5NA 4Y6IA 3VALA 4MLEA 4KB0A 4FO0A 4DR4K 2CPJA 1WF2A 1VSLA 1N32J 4DEZA 4C0HA 2Q4TA 1UAXA 3QEAZ 1NGGA 1VSKA 5AQRA 3CCJN 2IVPA 2X78A 3VEXA 1XC9A 2OHDA 2W24A 2J9DE 5BRHA 3C1ZA 4FF4A 2CVEA 3DU5A 3F0NA 2UUCJ 2WOMB 1SKSA 2DB1A 3J8AA 2LI6A 3M05A 1Q3VA 2R7VA 2OMLA 5KFVA 4CEOA 2YWEA 3FQLA 3QO9A 3GFHA 4NI2B 4DL2A 3UI3A 3LZIA 4C2MA 3ZX0A 4K4YA 1RHMB 4NXMJ 4YN4A 1F60B 1NHUA 4DS5A 4EBEA 1LFPA 4BC9A 2RJZA 1LOUA 3Q8SB 2EHGA 2CQIA 2PFOA 4BXOA 1S77D 4O5EA 5J2IA 5EE1A 3SQIA 3PEJA 4JRPA 3MM5B 4H0TB 4FJ9A 2B21A 2F8EX 4MMOA 4BDYA 3VPZA 4YMMA 3EWGA 1X8DA 2ZOGA 3F73A 2CXEA 3Q8RB 4U67L 4PWDA 1FERA 1X5TA 2YPYA 1IG8A 2VFTA 5JUMA 1D3WA 4Y2PA 3ZCMA 1FA0A 2ZH1A 2PFNA 4C7YA 2A10A 2JL9A 2DR7A 3NS7B 3QUCA 2CPZA 3M2UA 3OTDA 1XN9A 5I42B 1NSKL 2MUTB 3LDNA 2C1EB 4GVEA 2QA1A 2YQ3A 1FWKA 5DBAA 4QNLA 3MGHA 2UXBJ 4MLHA 2QEXN 1RWWB 4DQSA 3CMES 2NLWA 1FDBA 1CS4B 2VG5B 3SQGA 1H73A 1HBUA 1N48A 4NA3A 2B6AA 4HACB 2MXYA 4ED2A 2RU9A 2DH7A 3OYIA 4DG1A 1TAQA 1ATRA 2MQNA 4YDUC 2HK2A 2HMIB 2FHMA 2KZZA 2IDLA 3DLJA 3BH7B 1JK9B 4MFCA 2CRLA 1N32K 2J9DA 1N34F 1MMDA 4J91A 4Q43A 2VWKA 5HOOA 2ATLA 4BGBA 4CZFA 5IT9O 3SNNA 1EX4A 2G8HA 1T3QA 1S1UA 1U2RA 4JP8A 4A8XA 2JWNA 4Q0BB 2ZJAA 1WJ9A 4CFCA 4A8KA 2F7TA 2HF4A 1NB2A 2UXDF 4B9MA 3WK4A 4X4QA 3M6ZA 2DHHA 1VJWA 3DXMA 4O4RA 5AJ3F 1DKGD 1I3AA 3QU4A 3A8JA 3DLKA 2XRIA 1NLVA 4GC7A 2ZIWA 2WB4A 2W43A 4NLZA 4EHUA 5BN8A 4PAAA 3U9ZA 1YIJS 4U7UK 2DUYA 3DOMB 2KRRA 5BOMA 1PO6A 2P51A 5F8LA 4H0XB 3PFOA 3VC8A 2ATQA 1DTTA 3LWLA 5AXLA 2XCAA 2WUSA 4NWIA 2FPMA 1JLEB 3D6JA 1Z6RA 3I9V9 2GCFA 2J7WA 3VAMA 3MEGA 2OTJS 4X64K 2GX8A 2WAQC 4DV4K 1CI4A 4XO0A 3ZZTA 2EZZA 1NB7A 4P0PB 2OXOA 4C3KA 4PL8A 3BYPA 2O8FA 3HVAA 1VQ7N 3GYXB 3SAGA 2E1PA 2G1DA 2V9WA 1DGKN 2AJQA 2W3SA 4DV3J 4I2BA 1W2IA 3G6YA 4V19X 4ILLA 3OA9A 2RDIA 3CFRA 4I2JA 2Q79A 2K1RA 2U2FA 2GOLA 3QUTA 3SK3A 2BPGA 3WNGA 3QYYA 2CDQA 1ZAVA 4AT1B 1FJGF 1WG8A 5C7PA 3EE3A 4CHNA 1GMVA 2L9NA 4HTLA 3QX7A 1H38A 4KN4A 3HFVA 3N01A 2UU9J 2JGUA 1ZQBA 5J2JA 2K06A 4LR9A 4DV5F 4FPAA 1QVFR 3WKBA 2XTJP 3MEKA 4NXNK 2MRLA 1F2GA 3DU6A 4CF3A 2KEYA 3NGZA 1ZJNA 2W4PA 4W5RA 4Y2XA 1REVA 2HFZA 2EZYA 5AI8A 1U02A 1VDHA 4Y2KA 4KHUA 4TLRA 3ALYA 3QRPA 1WSGA 4M5GA 1B22A 4M3UA 4X2BA 1HBMA 4A8FA 1RAEB 1BGXT 2XZDB 3LTOA 1KLMB 3HX9A 4DR7K 1W7AA 1S9GA 4CE9A 2J8SA 3D4JA 5EY4A 4KLOA 3CCES 1RB0A 3IR7B 4GRSA 3IFEA 5D0GA 4DF8A 2MEWA 1SI9A 1T95A 1NNLA 1KD1O 5J0UA 1JJHA 4MO5A 3CJRA 5KOWA 3HSDA 9ICHA 2PD1A 1MWQA 4TN2A 2PEHA 2C3YA 4K4GA 2I7PA 1M6YA 4YB6A 1L7PA 5CA5A 1RFQA 2VJ4A 2E66A 3DOKA 3LK9A 2RF2A 1TKXA 4WYWA 1BI4B 3IFRA 3SMSA 3P83D 2VIHA 4OJLA 1PK1A 4NLTA 3ILLA 3IRXB