1NJXA

Thymine-guanine mismatch at the polymerase active site
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njxA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njxA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njxA01
5L1JA 3QEXA 2BCVA 1S1TA 3FDSA 2KZ3A 4I2DA 4EYIB 3SJJA 2G8FA 1TAUA 3G6YA 3RJFA 3C23A 3H8JA 4R63A 4R8UB 4XRHA 3F9KA 3VQ9A 1CXQA 3RAXA 2HVIA 3RR7A 3C1ZA 1KLMA 2A1SA 4EEYA 3KLHA 5D3GA 2XY7A 4RQ6A 4N47A 4FJ7A 4F8RA 1B43A 3E01A 4O3PA 4DSFA 4Q43A 2J6SA 1Z3EB 3VQDA 3T1AA 3RJEA 3TWHA 1TVRA 1JKHA 2XY8A 5HHHA 1TGOA 4ECVA 3V9WA 3QIOA 4FJKA 9ICGA 3KLFA 8ICZA 2VWJA 4BE2A 5KFYA 1ZBHA 3QESA 2G8IA 1JLQA 4CJRA 4OKKA 4Z4HA 4PPXA 3WNHA 2NRXA 4IQWA 4RQ8A 4F5NA 3V6HA 4CJLA 2HNDA 5KFGA 3AA3A 4N5SA 2RDIA 4JLHA 3U6FA 4O5CA 4UB4A 3OYFA 4UAZA 4KI6A 4FJNA 3IG1A 1Q9YA 4OLAA 4I2IA 2OZMA 3TANA 4RNOA 4CJEA 3C94A 3PW5A 4O0IA 4FJGA 3AVMA 4J2AA 2I5JA 4EP4A 4ED0A 3CFRA 3AVIA 4ID5A 4W5QA 4N56A 1KSPA 3V9UA 3LZJA 4CHZA 4Q5VA 4J9RA 2JZBB 4MFBA 3K4GA 3HPHA 4RW4A 5J0OA 3JYTA 1T3NA 4E7HA 4NLGA 3LK9A 1HYZA 1X9MA 3PY8A 4YQWA 4Z0UA 1UAXA 4PQUA 2BPFA 3UQ0A 1MQ2A 3NH2A 2AGQA 2VG5A 4KLIA 5DG7A 1KFTA 4DSKA 4OLBA 5KG5A 2AU0A 3QNNA 1NK8A 1KVBA 4CEOA 3OS1A 3V7JA 4BWJA 4ZTJA 3BQ0A 2W9AA 1IH7A 4JWNA 4EZ6A 4M3XA 4F91B 3SUOA 3NHGA 1C0UA 2FPLA 3RJJA 3C6TA 4ED1A 5D46A 1XS9D 4QW9A 1BL3A 3EPGA 3AV9A 1N56A 2O4GA 1TK5A 3HJFA 4CF9A 3WNFA 1NK7A 4DSJA 1D5AA 2YHAA 4DO9A 3O3FA 2BGWA 4QWAA 1NK9A 2HHUA 1JXEA 4KHYA 1QSYA 1CEZA 4O5BA 1ZQSA 1ITGA 4UAWA 4B9SA 4QZBA 3M8PA 4JS4A 1SZPA 4OKEA 2A1RA 4TURA 3NDKA 4RT3A 5IINA 4FLVA 2OPQA 1CZBA 4CESA 3LWMA 4EBDA 3P1GA 1ZQYA 4RUCA 1U49A 4F2RA 1RDCA 3CFOA 3OYLA 3BQTA 3P5JA 3H8WA 3AVLA 3LPUA 3MGIA 2PFQA 1IXRA 3QETA 5KGXA 4DTXA 2G8UA 3IRXA 4O3RA 4KLFA 3DMJA 2ZD1A 3TFSA 1TK0A 4J9SA 4I29A 4TUPA 3VN5A 4IQTA 1KVCA 1RCHA 1L3UA 4CERA 3EW9A 2DPIA 3Q8QB 3RMBA 1HJRA 1WSGA 3OVNA 4UBCA 2VANA 2P6UA 3PX0A 4H4OA 4FZZA 5BOLA 3HP6A 4M45A 5KFAA 3NAEA 1ZQTA 1WLJA 1DOQA 2FPKA 4EP5A 2PZSA 1RILA 1AROP 4F92B 4ECYA 5KGWA 2AGPA 3HK2A 4JRPA 4ELUA 2GWSA 2RDJA 1VSIA 3V6JA 4JUZA 4IFYA 2AQ0A 4B9MA 4CK2A 5F9NA 3DLRA 3NGZA 3ZDDA 1HYVA 9ICPA 5HMMA 5J0RA 1TK8A 4UB3A 4F5OA 4F2SA 4IG0A 2W42A 3V7LA 1CXUA 1ZQGA 3KKRA 1SKWA 3ULDA 4UQGA 4KPYA 4HUFA 2Q3SA 5TZVA 1N48A 4O55A 4J9LA 7ICLA 1HUOA 4CJTA 1B9FA 3NBPA 2X78A 8ICQA 1D9DA 1C1AA 3U3GA 3PW2A 1HYSA 3SQ0A 2C22A 4DQSA 1FXXA 5J2HA 1Y88A 2HMIA 2HHTA 5J29A 3ZDEA 2NRVA 1XU4A 1J5OA 4LY7A 4RW9A 4O0JA 4B9NA 3SZ2A 5CYMA 1L3TA 3I8DA 3LDAA 3DLGA 3MEGA 2HNZA 3RRGA 3HVTA 4TUQA 4ECUA 4CF8A 2UVWA 3Q8LA 4I2EA 3OS0A 2IC3A 3PR5B 2AQ4A 4FLTA 4LH5A 4RQ1A 1ZQUA 4KB1A 3KLGA 9ICWA 4DL2A 4M3UA 1UOCA 4HCBA 2ZE2A 5CJ7A 1JMSA 1RXWA 4M3YA 2BCRA 2MUTA 1G15A 3RWUA 4Y1DA 3SI8A 3TQ1A 2BCQA 4M2YA 4M3TA 2NRWA 3AVNA 3B0XA 2ATLA 1JXLA 3MDCA 3KHGA 4IFVA 2PI4A 4K4IA 1XSLA 4RPYA 4I9QA 3RH4A 3DLKA 3LP2A 2F1JA 3KLIA 2FMQA 1JXBA 2Z1IA 4RPZA 4O5EA 1RT4A 4CGDA 3NCIA 3KHLA 4CJWA 1ZQPA 1EP4A 4HCCA 3IHQB 4IQVA 2JEIA 2KW4A 2R8KA 5DB6A 4NYNA 3OYBA 5SZTA 2V4RA 2XHBA 3OY9A 2ZJ5A 5EWFA 4FYDA 3B6OA 4C8OA 4QCLA 5J2EA 7ICNA 1EKEA 4CHPA 3OHBA 4YNQA 1WCNA 4CJ5A 2RKIA 1T7PA 4FLXA 3ZT3A 9ICCA 1XC9A 1MU2A 4J9QA 9ICTA 1WSFA 4CCHA 1TV6A 1V9PA 4DF8A 2NRZA 2IBKA 3QINA 4CJKA 4NM1A 3PV8A 2P51A 2JEFA 3VQPA 4CHNA 5EU7A 4MFFA 2XC9A 4I2HA 4KLTA 8ICIA 3ZSOA 1C0MA 3DRSA 3LP3A 3AVBA 7ICVA 3VA3A 1TVAA 3NF6A 4KI4A 3KTQA 3PW0A 3TAFA 7ICJA 1S1VA 8ICRA 5DBAA 1S0MA 2Q0ZX 5KFVA 3CFPA 4Q45A 3TFRA 5EWEA 1B92A 1A76A 4CJVA 2W9BB 3FFIA 2IGIA 4FW2A 3MR2A 1RXVA 5DLFA 1UT8A 4R8UA 8ICHA 3OYMA 4CEAA 4GXKA 5C5JA 1NKCA 2NUBA 1QSLA 2ZUCA 3V72A 3RB0A 2XY6A 5KG1A 5J2JA 1HNVA 4FJ8A 1RT5A 5DQGA 3L2UA 2R8HA 3SI6A 4J9KA 4CEDA 1LW2A 2IMWP 4QAGA 3RBEA 3V6DA 3HPOA 1MSWD 2ZUBA 2VA8A 4DL6A 1CUKA 1PZNA 4PA1A 1U47A 4F3OA 1B9DA 4O9MA 4DL3A 4LZDA 4DF4A 4M3ZA 3MR3A 2HW3A 4DTNA 7ICRA 2BQRA 1ZBLA 4FBTA 4LD0A 4M9NA 5J2GA 1MQ3A 3AA2A 8ICWA 1XSPA 5J2FA 4IDKA 2GBZA 1JLCA 1T03A 4KLEA 4C8NA 4FVMA 3NGDA 1QLNA 8ICXA 4J9OA 2ZQBA 4KN4A 4KRFA 5J0XA 4MFAA 4KMUA 3JPPA 1DLOA 2RPIA 4FK0A 1GOAA 2ATQA 4DSEA 5DB9A 4K8ZA 3PO4A 3MXJA 2D5RA 5KFXA 3OYGA 1A5XA 1LW0A 3TR8A 5DK5A 5KFKA 3E2EA 9ICXA 1IKVA 4MF2A 1LV5A 4KAZA 4O4GA 3LAKA 3DM2A 1ZQVA 4DFJA 4Q44A 3NGYA 1JL1A 3RH5A 4W5NA 4ED8A 2GV9A 4CJ3A 1UA0A 4PHPA 4J9MA 1ZQRA 5FRMA 3AVJA 3Q8RB 4TQSA 5KT5A 5KG7A 3GQCA 3L2QA 3GFKB 3PNCA 4X5VA 2JZBA 4RUAA 4LZGA 1NK0A 3VQBA 3AA4A 3TAPA 3IS9A 1RBSA 1ZYQA 4F4YA 3KD1E 3GV5B 4QZCA 3RRHA 5KFSA 4KLJA 1BQNA 3TABA 2I1QA 1QE1A 1W9HA 5KFUA 2KTQA 4P2HA 3RMCA 4CIFA 4W5TA 2UVUA 4DL4A 1SL0A 1TV9A 3V6KA 4HHTA 2DTUA 2KFNA 1SV5A 4M04A 5J2NA 4E7KA 2C2DA 3SV4A 2OYQA 3ISCA 1LAVA 1HRHA 2W9CB 4HTUA 4ED2A 1NK5A 4KLOA 4DMNA 3MR6A 4QZGA 4ECTA 1YT3A 3QEPA 4IQUA 5HMLA 2BPGA 3KK2A 4CF2A 4AHTA 1UWBA 3RJHA 2O4IA 3KHHA 4FBUA 3N97B 7ICHA 3PX4A 4QWCA 4P4PA 2F8SA 5IIIA 1K1SA 3KD5E 3LP0A 4EBCA 4CHOA 4MFCA 4CHQA 3KHRA 4XQ8A 3T19A 2X74A 5CZ2A 1VSFA 1C1BA 5EWGA 2BHNA 3SCXA 2ZJ8A 4YVZA 3ORYA 5L9XA 2VA2A 3AVAA 4CGIA 4GC7A 4KHNA 2R7YA 8ICLA 1QTMA 1JN3A 5T7BA 5HRSA 1NK4A 4HUGA 2KN7A 9ICSA 4E19A 2D0BA 3HM9A 3HWTA 1HPZA 3K2PA 5EOZA 1T4GA 3L3VA 4KFBA 4J9NA 3QO9A 3RH6A 2BQUA 3C2KA 1COOA 5J2PA 3RJGA 4OJRA 4RNMA 3EZ5A 4B9VA 2FBVA 5CP2A 9ICHA 1ZBIA 4IRCA 3DI6A 2F1IA 4CFDA 3DOLA 4FZYA 1DTQA 3H7IA 5J2AA 4DL5A 5E41A 1YTUA 9ICAA 1J9AA 4QOZB 4YXMA 4DEZA 4PGXA 1U48A 2HHQA 2EX3A 1TAQA 4CECA 8ICSA 3SPZA 1BPEA 1I39A 4BE0A 5JS1A 1K1QA 8ICUA 5CWRA 3UXPA 4FLWA 1S10A 3ISNC 2DPJA 5DG9A 3F73A 3PX6A 4OPKA 9ICQA 4XIUA 5J2QA 4PHEA 4F4KA 2IDOA 1W0HA 3C5FA 4DU4A 3UXNA 4RW6A 3EYZA 4YG2A 1FK9A 2YHBA 2YNHA 2H5XA 5J2IA 3K75D 4P4MA 3UPQA 8ICPA 3THVA 4FW1A 4FO6A 4CEZA 3HXMA 1KFDA 2IHMA 4LSNA 4LSLA 2ITGA 2KZMA 4B08A 1NKBA 2F1HA 3AVGA 7ICQA 2UVVA 4F4WA 4FK4A 8ICCA 3V1RA 2JEJA 4IRDA 4J2DA 3Q8MA 4M9HA 5BPCA 1WCLA 4NLKA 4CEEA 3MFIA 1RT3A 5DDMA 2LYHA 3LPTA 5FRNA 3O4NA 7ICKA 4F50A 1S9GA 5DMRA 3VQ6A 4AHVA 3VQ4A 9ICRA 3ZD8A 4CGJA 7ICSA 4ECWA 4B9TA 2B21A 3AO2A 1S9EA 1Z25A 5CHGA 4G1QA 4KLQA 4Z6EA 4H4MA 4M3RA 1TKDA 4DQRA 4BXOB 5HROA 4QW8A 1S5JA 9ICKA 4R64A 1S1UA 3D0PA 4PHAA 9ICNA 3LP1A 1RT7A 5DQIA 4UB1A 7ICEA 5KFEA 3V81A 5CY4A 4KREA 1Z00B 4I2QA 1VSJA 3HW8A 3RMDA 5KFIA 4YMNA 4RT2A 1KLNA 5I42A 4YN4A 4DOCA 4IRKA 5DLGA 2ASLA 4DFMA 3LWLA 4DOBA 1RT2A 5J2MA 5DKWA 1NJWA 5CR0A 3OSPA 2WTFA 4KHUA 1VSMA 3NFAA 4RQ2A 4FS2A 5HLFA 3PMNA 4KLDA 4GXIA 2BCSA 4I27A 2IS3A 4NYFA 3C95A 3ZDBA 3G0ZA 1RYSA 3MBYA 1N5YA 3GIJA 4K4GA 3K5LA 1IKWA 1RPLA 4KB0A 1JX4A 3TARA 4CK3A 1U45A 3TAEA 3NTUA 4OKJA 1KRPA 1ZBUA 3BJYA 1RBRA 3HT3A 4JV2A 5IIJA 2YKNA 1RNHA 2D0AA 1HQUA 4I2BA 5DB7A 3QEIA 1TL1A 4W5RA 4C8KA 4FS1A 4E0DA 3GV7B 2HHWA 3VA0A 4I2CA 3MGHA 2RF2A 4MEXA 1ZQZA 3O3GA 1WAJA 3QNOA 2P66A 4DS5A 1BIUA 3S9HA 2ZTDA 3DRPA 4RZRA 3MFHA 4ECSA 8ICMA 2RN2A 3ZT4A 1ASVA 3BDPA 4KLMA 3PVXA 4ED6A 5HNKA 5KI6A 4ECXA 1BCMA 1HJPA 1VSHA 4C8LA 1S97A 4YR3A 1XO1A 3H40A 5J0SA 2OPPA 4I28A 1QSSA 4RW8A 4CJPA 2W8KA 1S1WA 3LANA 8ICGA 4CEFA 3DLHA 1ZJMA 1ZQBA 2ISPA 3QEBZ 3JPNA 4KTQA 1RDAA 2XRIA 4FJJA 1SL2A 2ZTCA 1IKYA 1A5VA 2YNIA 2KZZA 5C24A 3TAMA 1EETA 5C42A 3K5MA 3O4QA 4ICLA 1BGXT 4EYHB 4NLNA 4G3IA 1ZQHA 2PYJA 4HUEA 5KG0A 4UB2A 5KG6A 3HP9A 2R8IA 4DQPA 2W9BA 3NF9A 1BPZA 2P1JA 3KKSA 3TI0A 4KO0A 5HBMA 4CGFA 2PFOA 2FLNA 4BGDA 3PW7A 4RQ4A 2R8JA 1X9SA 3T3FA 5IIKA 4RPXA 3V9SA 4DSIA 4ECZA 8ICFA 3MDAA 4DTSA 2IHNA 3SUPA 2BGGA 4KN7A 3NH0A 8ICTA 1WAFA 4QZHA 4PGQA 1BPXA 3V4IA 5DQHA 2A1JB 3GIIA 3OJUA 1N6QA 3BQ1A 4Q0BA 5F9LA 1EX4A 1XHZA 4Q8FA 4F93B 3UQ2A 3GIKA 7ICFA 4CJFA 2B6AA 3ETLA 2FMSA 2VWKA 2DFHA 3K5NA 4RQ3A 2E6LA 1S1XA 1VK0A 4KTZA 4WE1A 4FZXC 2DFLA 4RQ7A 2XO7A 4EBEA 5IIOA 4J2EA 8ICAA 3AUOA 1XSNA 4FJIA 4KLHA 3IAYA 3ZDCA 2ETJA 4M42A 1IKXA 3C21A 4QWDA 4DTJA 7ICPA 4ELVA 1A5WA 2P6RA 3OYNA 4CIGA 2BQ3A 4CJSA 2ASJA 3LAMA 3L2WA 3M8RA 3ZDAA 3ALYA 5FDLA 2XCPA 1NOZA 3OJSA 3U3YA 1S6PA 2PYLA 5CA7A 4DTMA 4KHQA 4CF1A 2Z1HA 1VSKA 2PXIA 1VSEA 4GLXA 1DGSA 2ISOA 5JS2A 1EXNA 3AVFA 4KHSA 1WNSA 3MECA 3K5OA 4O44A 5KFRA 1ZQJA 1ZQIA 2MAXA 8ICBA 4YR0A 1YVUA 3SV3A 1SL1A 1BI4B 4FM0A 4QZIA 4IR9A 4YFUA 1VRTA 2W9MA 4YD2A 3AU2A 1DTTA 3OSNA 2W9CA 3D45A 4I2JA 3QIPA 1JLAA 4F4XA 1TKZA 4E7JA 2X6NA 4CFAA 3ZSVA 3C5GA 5KT2A 3BQ2A 9ICLA 3EY1A 2KQ2A 1A77A 3OYHA 4E3SA 2B5JA 5D49A 5KFQA 9ICOA 3HSTB 1Q8IA 4FK2A 1HNIA 3JPSA 3TAGA 2PFPA 2VG6A 4M47A 1J53A 4BDZA 3ZSXA 2F96A 5DDYA 2I9GA 5J0WA 4EZ9A 4PWDA 3OYAA 4Z6DA 3VQEA 3SQ1A 1ZETA 9ICBA 4M3WA 4PGYA 4KLUA 2EHGA 5KFTA 9ICJA 4M41A 2C2EA 1ZQXA 4CJ4A 4DTPA 2FBXA 2OWOA 2DY4A 2FBTA 3MXMA 4BWMA 1Q9XA 4Z6CA 3DOKA 3NE6A 4ZHRA 4CIEA 4CK1A 4O3SA 4J9PA 4QZEA 1NOYA 4Y1CA 2G8KA 1U4BA 4ELTA 4F3TA 9ICEA 1RYRA 4E89A 4OVLA 4MEYA 3M8SA 3QEWA 3VQCA 4K4HA 3RAQA 4R65A 3EWAA 4FM1A 1L3SA 3MAQA 3OYKA 3ZT0A 1TFRA 3T5KA 3MEEA 5KFJA 5J2DA 3OYDA 3C2LA 1S6QA 4YR2A 3M9MB 2AGOA 4ID1A 3S3MA 2W8LA 4QWBA 3QZ7A 4I2AA 4KV8A 3HO1A 4QWEA 2G8WA 4M6WB 4IG3A 4R66A 4IBNA 2F8TA 3L3UA 3MABA 4YFKA 3SYZA 2ASDA 1ZJNA 3ZSYA 4FLYA 2ZJAA 5J2KA 5SWMA 2G8HA 2QXFA 4GXJA 1WSHA 1NK6A 1SKSA 3S3NA 1ASUA 4TSXA 1ZQOA 1ZQAA 2YV0X 3SPYA 1NJZA 1S77D 4NCAA 1JLEA 1WSEA 3ZSZA 4PHDA 3VQ7A 3RB4A 4AHRA 4O5KA 3PR4A 3OGUA 4N76A 4E7IA 4PUOA 1C6VA 3UXOA 2E6MA 3H4DA 2YNFA 2QKBA 1JIHA 1UT5A 4LH4A 3ZSQA 4OGEA 4QZ8A 4CHYA 1BPDA 5IILA 3QZ8A 4N41A 4QZ9A 3I0SA 3WNGA 3MXIA 1TL3A 5HP4A 3C2MA 2HVHA 2J6TA 5KG3A 1X1PA 3OYJA 1XI1A 3V9XA 3O3HA 2V9WA 2ALZA 2V4QA 4NCGA 4DG1A 2OA8A 3RBDA 4FLZA 5DGBA 1LWCA 1VSLA 3H4BA 4BXOA 3KJVA 2IOCA 8ICYA 1RBTA 3PO5A 1KCFA 2FC0A 2P5OA 4J2BA 2J6UA 5KFCA 2BR0A 3GDXA 8ICJA 1MC8A 1ZBFA 4UBBA 4M0AA 4I9LA 2QKKA 4CJUA 1Z00A 1CLQA 1HMVA 5KT7A 3NH1A 1D9FA 1NJXA 4FJXA 3VQAA 8ICEA 4NY8A 1S0VA 3AVKA 3RB3A 3ITHA 1RBUA 5C25A 3AVHA 4KHWA 3RTVA 3LZIA 4Z4GA 5L1KA 3DRRA 1UA1A 3SQ2A 2P5GA 1K6YA 1REVA 1NJYA 3SUNA 1F21A 1JL2A 4KTWA 2XGPA 2DFEA 4CEQA 3AO5A 4QZDA 3PW4A 4YMOA 4YP3A 4O3OA 3KK3A 3BGRA 4KLLA 4HVJA 3LDSA 3C1YA 2M9NA 3G10A 4F4ZA 2Y1JA 4B8AB 2GUIA 5DG8A 2WOMA 3L2VA 2FLLA 1BCOA 4MQ3A 5DGAA 1L3VA 3C6UA 5DB8A 4AHCA 4DFPA 2D0CA 1EXQA 4NCBA 2JLEA 8ICVA 4GW6A 4OPJA 4RQ0A 4I2PA 4DTRA 1IM4A 4BE1A 2IA6A 4FJMA 5KFMA 4DQQA 4ZH4A 5J1EA 3HVRA 3AU6A 1Z26A 4JRQA 1VRUA 1WSJA 3CG7A 3H8SA 3JPTA 3HL8A 5CB1A 4C8MA 4NXZA 5HRPA 4CF0A 3JPRA 1SUQA 4DQIA 4DU1A 3OHAA 3KIOA 4TUSA 4FJ9A 2NRTA 3CM5A 5J2BA 1U9LA 2HNYA 4PY5A 3P83D 4TQRA 3AA5X 2KFZA 5HP1A 5CYQA 3K58A 1IG9A 4NM2A 3SNNA 1C7YA 1BHLA 3ASMA 3M9OB 2XCAA 3DYAA 1ZQDA 3AO4A 1B22A 4E1NA 5KFPA 5KFNA 2XGQA 4JK1A 1S0OA 5KFZA 1GOBA 4BDYA 2DFFA 3OYEA 4RU9A 3MR5A 1HQEA 4BDPA 4DS4A 4DLGA 3JSMA 2QK9A 3N4MB 1LAWA 3ISDA 5HRRA 3CQ8A 4W5OA 3T5JA 4RNNA 4FJLA 2B4JA 3HYFA 1RDDA 4ED3A 4E1MA 1BVSA 5HRNA 3Q8SB 2R8GA 5KFLA 3IM1A 2YNGA 4I2GA 4DFKA 2C28A 4M9LA 3G6XA 4OGCA 3ZT2A 5HHIA 4M9GA 4H8KA 5DBBA 5J0UA 3EPIA 3CM6A 4CGHA 3RJKA 4DOAA 3T5LA 7ICUA 4YMMA 1QS4A 2BPCA 1RT6A 3ZCMA 8ICKA 8ICNA 1BIZA 8ICOA 7ICIA 1LWEA 4FCYA 2A1JA 1WSIA 4XA5A 3DLBA 5I3UA 4IR1A 5D4BA 4KITB 4HYKA 2BANA 3PMLA 3DLEA 3S3OA 3OYCA 3Q8KA 2VG7A 2FLPA 2LSNA 3KK1A 3ISBA 4NLZA 1KDHA 4CFCA 1KEJA 2FPMA 3ZD9A 1KVAA 3SQ4A 1I3AA 4E7LA 3PUFA 3B0YA 3V1QA 5KFBA 7ICOA 4DU3A 4JS5A 3HX0A 4JV0A 4B3OA 5KRSA 3SUQA 9ICVA 4B8CA 1ZQWA 1D8YA 3GV8B 4F5QA 5KTQA 2JGUA 4RG8A 4CEBA 5KT4A 4Z4EA 3QLHA 5KFHA 4Z4IA 1XWLA 4RQ5A 3I0RA 4GVMA 1ZQFA 1S76D 3V7KA 5BOMA 9ICIA 2PFNA 3OS2A 1BPBA 2X6SA 3HPGA 3NF8A 1O1WA 1RTHA 4QZAA 4FJ5A 1RTIA 4L8RB 5J0YA 4IKFA 2XY5A 1FKOA 3H08A 4YXJA 4UB5A 2BCUA 1L5UA 2HHSA 3K57A 1JLFA 4I7FA 5DBCA 4KKOA 3UIQA 5KFDA 5L1LA 1H38A 4GMJB 3M8QA 2HHXA 3RR8A 2OZSA 3VQ8A 4GC6A 3V1OA 1J54A 1TKXA 4Q8EA 5KG2A 2BDPA 5KG4A 4FJHA 1T8EA 2BKEA 4CJQA 4B9UA 4P4OA 2OPSA 2FMPA 3FYHA 4ED7A 2OPRA 3QE9Y 2IAJA 1RTJA 2BE2A 1Y97A 1BI4A 1ZQLA 4DWIA 3JPOA 5JUMA 2ZUDA 1S9FA 1WN7A 3AO3A 2G8VA 7ICGA 1GOCA 4DTUA 3Q8PB 3NGIA 1R0AA 3CYMA 5L1IA 9ICUA 4XUSA 3B6PA 2ZTEA 4YD1A 3MEDA 9ICFA 4JV1A 4DSLA 2MUTB 1HUZA 2FBYA 5J0QA 3JPQA 1RT1A 4FLUA 5KFWA 3RJIA 3G6VA 4CGGA 4DLEA 3NF7A 3ZSRA 3ZT1A 4AILC 4PH5A 4ECRA 7ICMA 1SKRA 3A2FA 5K14A 5KRTA 3LALA 4R5PA 3GILA 4DTOA 4UAYA 7ICTA 1XHXA 1BISA 3AVCA 4F5PA 4FXDA 4O3QA 4F5RA 1T05A 3TAQA 4K8XA 3M9NB 1RTDA 4LVSA 4CE9A 3V9ZA 1CZ9A 3QERA 3L8BA 5J0TA 5CZ1A 2HHVA 5FROA 4Z4FA 1YTAA 3AO1A 2E4LA 2YKMA 4KLGA 1JLGA 1LWFA 2HB5A 4AH9A 5KFFA 4KLSA 1C0TA 1U04A 3RB6A 1ASWA 4Z6FA 1FKPA 1VSDA 1D8LA 4JWMA 3VQQA 3GIMA 2Y1IA 3QEAZ 4QZFA 2VA3A 4ZTFA 4AHUA 3OYIA 4I2FA 4RW7A 1RZTA 1LB2B 1ZQCA 3KLEA 4MF8A 4DL7A 2UVRA 2Z1JA 1NKEA 3K59A 2WONA 1ZQNA 1ZQEA 4YCXA 1ZQMA 1BQMA 1X2IA 3ZSWA 2Z1GA 5IIMA 4ECQA 3L2RA 5KT3A 5J2CA 1QQCA 1RDBA 4O3NA 4B9LA 4Z4CA 1ZQKA 4M9JA 2PY5A 5J0PA 1KTQA 3WNEA 1ZQQA 4M6WA 1QHTA 3QEVA 9ICMA 1C1CA 1JLBA 1NOMA 5KFOA 1TKTA 4AHSA 2AJQA 1X9WA 1KFSA 2C2RA 2PI5A 2JEGA 1IO2A 1RBVA 3RMAA 4FM2A 5KT6A 3T5HA 4CFBA 3VQ5A 1BPYA 1S0NA 4BACA
chains in the Genus database with same CATH superfamily
4MIBA 4GY2B 2CQ4A 3LA0A 1IJJA 4CE6A 3EXCX 1YRXA 2V50A 3SJJA 2XULA 2OAUA 1TAUA 2H54B 4OZ2A 3RJFA 4WFBL 2LM1A 3Q7BA 1S12A 2FF3B 3WQPA 4H0XB 5AICA 3F9KA 3MMBB 3VQ9A 3ZTPA 1U8WA 2JOQA 3F41A 5C2GA 2MGZA 4EEYA 1HNVB 5GIPA 4RQ6A 1WF2A 2D0OA 1L6NA 1KVIA 4F8RA 1B43A 4XPEA 2GC8A 5M2UA 3E8OA 4H4KA 3BEXA 3V6DB 3WKCA 4MLHA 4FE3A 5F41A 1T6DA 1JKHA 2NXCA 1NG9A 3QIOA 4FJKA 4CLZA 2VWJA 1GNKA 3MTJA 5KFYA 1V5IB 2MZQA 2MEWA 1JLCB 4NZ7A 3O1WA 3SFUA 4BG9A 3BGFA 2G9OA 2VPZB 4WFAQ 3V6HA 4FOEA 4JD2A 1HR0F 2DJWA 2DXEA 3AOBA 5KFGA 4RBUA 2JR5A 1DLOB 3OBIA 3WUHA 4NEYA 4C0ZA 3IMQJ 2RDIA 4MAKA 1W25A 5HMZA 5LY3A 1N33J 4O5CA 4UB4A 3OYFA 4K0KJ 4FJNA 3CC4S 3Q86A 1YLXA 1Q9YA 4HACA 1T94A 3O9QA 4G9ZA 3DM2B 1QUVA 2AXTU 4NI2B 3TANA 4CJEA 3F2CA 2XHWA 4BQLA 3AVMA 4U96A 5B08A 4J2AA 1GX6A 2CDRB 5CR4A 2ROEA 3W9JA 1NLKL 4EP4A 4ED0A 3AVIA 2ACMA 4W5QA 1RDWX 2DGSA 2W11A 1VQ8N 3GYGA 3WC2A 4Q5VA 3NG8A 2YBVA 1WG4A 1VQ6S 4MFBA 2YCHA 3K4GA 3HPHA 2GJFA 2I8EA 3ZZZA 4E7HA 4FNIA 1HYZA 1BQNB 1Y4ZB 1UPMB 3SLCA 2PT0A 2AEJA 2BPFA 2E29A 2VJ4A 1MQ2A 1RBOB 2AGQA 5DG7A 4ED4A 2FYXA 2P6SA 4YOTA 4YB6A 4OLBA 2AU0A 3QNNA 4X4VA 2HRUA 5M1OA 4BWJA 4LRDA 2HEKA 4ZTJA 3ONNA 1UCNA 2W9AA 2HBYB 1IH7A 1KQGB 3PIPQ 4XDDA 3ATUA 1SWVA 4WIIA 4YY3J 1UWBB 3C6TA 2MJUA 4ED1A 1XS9D 4WJ3B 1BL3A 1RBLA 3J7YI 2WB1F 1RQNA 3PIOL 1X8DA 3HSCA 1NK7A 3WNFA 2H3IA 2P9KB 2YHAA 3OR2A 3M32B 1NK9A 1YTYA 1JXEA 2KJ8A 1U24A 2JVOA 4KHYA 1QSYA 5KOXA 1ZQSA 3M8PA 2BACA 4OI6A 4JS4A 1SZPA 1NNDA 4QYZJ 1N36K 4OKEA 2FJEB 4TURA 4FLVA 2OPQA 1GFWB 2YX4A 1ZQYA 4OI4A 4RUCA 2G0AA 1U49A 4YORA 3IM9A 1HNZJ 3P5JA 1S49A 2FHJD 4TLRA 4Y2AA 2XS2A 2HWTA 4ZK7M 3W1YC 3MGIA 2PFQA 2Z7JA 3D2SA 3QO9B 4DTXA 3IRXA 3T6BA 2GEMA 4O3RA 2COLA 4BRQA 3DMJA 2ZD1A 2ZIXA 1TK0A 5FJ4A 2RT3A 3J7YP 1O0PA 5HR7A 3DI6B 2RJZA 3O5TB 1RCHA 2ZZMA 4RLEA 2DPIA 3P45B 3K17A 3Q8VA 4UBCA 2VANA 3ZC4A 5AKHA 3DLLL 2V2QA 1S3XA 3N79A 4FZZA 2AJ1A 5KFAA 2O3DA 1ZQTA 2HCFA 2PMZD 1AA1B 4ECYA 1NM2A 1WC1A 5KGWA 4WK3A 4JRPA 2GWSA 5HN0A 2ROPA 4KYZA 2FGOA 3V6JA 3SENA 3CCVS 4IFYA 2KI2A 2AQ0A 3FFKB 2CPEA 3W9IA 2ZJRQ 3NGZA 3TA1A 4U95A 3NNHA 1VLOA 4DR7K 3CJ7A 3R8EA 5J0RA 5EE9A 1X3MA 1VI7A 5A0YA 1CXUA 2ZGZA 3JSRA 4JI2K 3B82A 4HUFA 2B8PA 2YNHB 4OJOA 1W2IA 4J9LA 2UXBK 4AD6A 1VC6A 1U0SA 1YUWA 1VCTA 3D0HE 3CDWA 3U3GA 1YRTA 1JROA 5J8YA 1HW9A 3D3BJ 3TUIC 2YWEA 2D41A 1APSA 2EAPA 2HHTA 4A8SA 2UXCJ 5LJWA 1RWKB 3O9TA 3HHEA 5ETVA 2CJAA 4L6V3 3HX9A 4B9NA 5CYMA 4I68A 3KJQB 4A62A 2HNZA 2WB1C 4P7TA 5KOWA 3PSIA 4CF8A 2JRZA 3HRGA 4I2EA 2XVTA 1HKGA 1S9EB 1DGJA 4CH7A 4RQ1A 3LGMA 9ICWA 1UOCA 4ILJA 2ZE2A 5CJ7A 1JMSA 2V4JA 2XI9A 3BH6B 2JJ4D 4OJPA 1KQSM 3RWUA 4Y1DA 2WF8A 2VIXA 4M3TA 2ZBQA 4F04B 5ALZA 5EE0A 2BEFA 2K4IA 1X5OA 5I42B 5J1NA 1HI0P 5AKKA 4OJ5A 4K4IA 3VR1A 1VQSA 2HHHF 2WSEC 3RH4A 2E1ZA 1TYQB 2Q79A 5ETTA 3M6KA 2FMQA 2EQYA 2ALYB 1JXBA 2Z1IA 3O4WA 1G2EA 4CZJA 1N5YB 2HKEA 5FP0A 1D0EA 1G3OA 1OXJA 5ALRA 2E5JA 1U0HB 4CH0S 4FF4A 3EE3A 1F5SA 1MMLA 2NXEA 1YG0A 5HMYA 5DB6A 3GOIA 4ZJOA 4AL6A 2AKWB 1WSVA 5C2CA 2XHBA 1TL1B 2MLYA 2PMWA 1U2VA 3EVOA 2E5SA 3MM9B 5AZJB 5EWFA 4A48A 5H9FK 4C8OA 3O9UA 3MXHP 1YJUA 4QCLA 1FJGF 7ICNA 4K7QA 5T7LA 1N52B 3PJXA 1J2MA 4X62F 3UFCX 4CHPA 1KQSR 2J0SD 2HFVA 3MN5A 4FLXA 4LF8F 1XC9A 2MRLA 4H0PA 4CCHA 4AUKA 1SQKA 4K5RA 4UARA 1XNQJ 3NS5A 2PAVA 3NMUA 3OR1B 2JEFA 3VQPA 2E5LJ 2DHSA 5EU7A 3RF9A 4MFFA 1S1WB 2HS0A 2B0CA 3LOUA 1KD1T 4I2HA 2HSEB 3DXSX 4B3OB 4K43A 4KLTA 2CFXA 3IKMA 4TU7A 2R3VA 4LFCK 1JMTA 3LDQA 2RDDA 5KPTA 2YMQA 1RABB 3VA3A 3BN4A 4OJGA 3NF6A 4H0OA 2YNIB 2AIRB 5C24B 2RB7A 1EETB 2ZXIA 3PW0A 3D5MA 1OQ3A 3TAFA 2NV3A 2HURA 2UXDF 1T3QA 1S0MA 2Q0ZX 2A19A 1WEYA 4NLRA 3CFPA 2ZXHA 2Z2LA 2ASYA 4A2AA 5D78A 4DV7J 3N6LA 4R8UA 4JYAJ 1HD1A 3OXLA 2QL5B 4JI7F 1EARA 3CUNA 1VC5A 1FRKA 2H3VA 5KG1A 4NV0A 1LNQA 1X4EA 2W3RA 1ZOTA 3HOTA 4S0MA 3QU7A 3C8YA 2NXUA 3F9MA 3HPOA 2WVDA 3CP8A 3OFGA 2W03A 4PA1A 4CGZA 1B9DA 1M5VC 3D1HA 4DL3A 4DF4A 4M3ZA 4B6JA 1Q16B 3UDLA 2RUGA 5T41A 2HW3A 4DTNA 2BQRA 1N6QB 3AA2A 2W2QP 5J2FA 1T03A 2CQ3A 4KLEA 4NXMJ 2FJWA 1RZMA 3NGDA 8ICXA 4X66F 3AOAA 4KRFA 5RUBA 2P9LB 4YB5A 2FTRA 2F8HA 5ALMA 5A76A 4B1VA 1DQAA 5DB9A 5C0YA 2HLUA 1VQ4N 2MJNA 5HL7Q 1LW0A 1BLUA 1IKVA 1AUDA 3PRBA 4C7YA 4BR7A 1X31C 1K9MT 4MLEA 3QFUA 1X6JA 2JFKA 2NSCA 2NLXA 3TTDA 3IWNC 4PL1A 3PDNA 2R7XA 3MHYA 3KVGA 1N32F 2KVCA 4J9MA 1C0GA 5I3QA 3A5LC 4TQSA 5KT5A 4F72A 3ZZ0A 4ZPCA 3IAS9 1HNWF 3MF5A 2JZBA 3CD7A 4F4YA 1FD2A 5B5EU 4FSVA 3W2WA 1XMOK 3GR0A 3RRHA 2QZ8A 5C2DA 2D9PA 4KLJA 3M1FA 1OKJA 1H2UX 5BXIA 4O44B 2G13A 4Y65A 4DPOA 5HATA 3P3DA 4E1JA 3VAHA 2IJFA 3MMCA 4ER8A 4W5TA 1SL0A 2Z2ZA 3IP0A 2KFNA 1SV5A 4M04A 4AFFA 1Z2ZA 2EEYA 3FEZA 1ROFA 3T9NA 2C2DA 1DTTB 1IG6A 2OYQA 3ISCA 4ZLJA 1LAVA 4OJ1A 1Q53A 1WORA 4CBUA 3FZHA 1JLAB 1PYTA 3U7JA 5AKXA 1M5OC 5AKZA 5HMLA 1TKZB 2IIHA 2UU9K 3RJHA 3TSUA 1N5QA 3KHHA 1XN9A 5HVHA 1Q82T 5IOLA 3MMAA 5K20B 2F63A 2FJXA 1N4LA 1K1SA 1KBUA 4EFHA 2VG6B 4MFCA 4CTAB 4XQ8A 3T19A 3VGUA 3WKDA 5CZ2A 2GNKA 2J0XA 3IR6B 1T9VA 3NXZA 2M2BA 4NLUA 2ZJ8A 1LQ9A 4U67Q 3ORYA 1NZ8A 2HPUA 1HI8A 3AVAA 1EKRA 2NSBA 4BRAA 1I6JA 1EWQA 2VQEF 1NSPA 5HRSA 1NDKA 4HUGA 4WF9L 2KN7A 3FSIA 3N6MA 3ELHA 1Y5NB 1HPZA 2QLJB 4I64A 3GJRB 3FMBA 2FJBB 3SJHA 4AE5A 2XS7A 4P2XA 2ASPA 1COOA 4ZHRB 4WFXA 2F4VK 4OJRA 3EE8A 9ICHA 3A0HU 2F1IA 3DHXA 5CZVA 2L3MA 2C2OB 3DOMB 1MN7A 3A8YA 1XNSA 4BRGA 1DTQA 3WT0A 4I6MB 4DL5A 5E41A 3N01A 2LU2A 1YTUA 1R27B 3HVAA 2ZKUA 4PYDA 3HKZF 1NO8A 1HW8A 3ED5A 1XR6A 1YF5L 3VEVA 3D6HB 3RFAA 4AYBF 2OEJA 5GAGI 3HFKA 5JS1A 1K1QA 3LF0A 1YJWS 4M5MA 4CDGA 1AFJA 2GMHA 1N34K 2ZJPL 2DPJA 1Y3JA 3Q2SC 4C0OC 2YKPA 4PCQA 1JCFA 4XIUA 4F4KA 1HARA 3C5FA 4DU4A 4DFDA 2QWRA 4YS2A 3W7BA 3EYZA 4YG2A 2ERRA 4E2FB 2YHBA 1RB0A 1UFLA 1X3NA 5AQLA 4IOAL 3UPQA 3THVA 2OH2A 3TW0A 2DHHA 4FO6A 3TOQA 3D2WA 3DCAA 4JKCA 4H5WA 1NDCA 4LSNA 4PXCA 4UQTA 2KZMA 1NKBA 2B43A 5AQSA 4CT9A 1R31A 4F26A 4B3TJ 4FK4A 3V1RA 3VESA 4KE5A 1T9WA 1WCLA 4NLKA 1RT3A 3AD8C 3LPTA 7ICKA 4F50A 1FX2A 4PPDA 3EICA 3ZD8A 7ICSA 1BMQB 2HOFA 2CVEA 4B9TA 1YSJA 4FPIA 2ZUGA 1Z25A 2B8QA 5CHGA 4DG1B 4KLQA 2A5XA 1TKDA 1LWCB 1O8BA 2CGKA 3HSJA 2OANA 5HROA 3HTVA 9ICKA 3PZPA 1UTAA 4PHAA 2DEJA 9ICNA 2QEXS 1RT7A 5FPDA 3ISND 2P2CB 2DK2A 5CY4A 1CJTA 4KREA 2G1HA 5AE3A 1Z00B 1HMVB 1M1KO 1TELA 3RMDA 3W65A 4RT2A 2RHSB 2GTDA 1KLNA 4DOCA 4FXWA 2MXYA 1FRJA 3GSIA 3ITHB 2ASLA 3UDVA 3IXQA 2AHOB 4DOBA 1RT2A 5C25B 3NFAA 4FS2A 2LYBA 1T02A 2XYGB 4OJLA 2R2UA 2IS3A 5KAKA 5AQOA 2P35A 2RD5C 4OZ1A 5DDOC 3G0ZA 3GIJA 1UVLA 2DYAA 4RJVA 4KHPJ 4KB0A 3NCPA 1KKXA 1AUSL 3TAEA 3HKZC 1RHMB 4OKJA 3RVCA 1ZBUA 3KK3B 1GMVA 2QARA 1OO0B 5ADZA 4JV2A 4DV4J 3AFGA 2YKNA 1UVNA 3WEEB 1N33K 1JRPA 4C8KA 1KVJA 3M2RA 4P7VA 2EWHA 1GMWD 1NCLA 2VZ9A 3EE9A 4DS5A 1UP1A 3FZ2A 4I6WA 3MN7A 2ZTDA 4RZRA 3H3OB 3U1LA 4HL9A 5LXRA 3HFVA 1LFWA 5J1EB 1NPKA 1KAZA 3AQEA 1SJQA 3J80O 4DR3J 1BCMA 5ADXH 5C7PA 4DCPB 1WUAA 1S97A 2HRYA 4YR3A 1DURA 1SUQB 3NP5A 5AJ3F 3CEDA 5AQKA 2O8FA 1RU2A 2OEMA 4I28A 1QSSA 1OH7A 1H72C 3FBEA 2H4YB 1Q7YO 4Y2TA 3LANA 1CJKB 1ZJMA 5HSPA 2HNYB 4TY8A 2DGZA 1F5BA 4FWPA 3QEBZ 3JPNA 4ZLNA 5CYQB 4ZPAA 2HYIB 2OUGA 4UY8O 1X60A 3TAMA 4WFNL 3VAGA 4ICLA 4EYHB 4G3IA 1ACMB 1F0XA 4MDAA 3GSDA 2CPIA 4R25A 3CT9A 4GVLA 1ZXOA 4GVBA 1IBLF 3HP9A 1UWAA 2W9BA 3HLUA 5HMWA 3PKMA 2AT1B 5HBMA 2FLNA 4BX9C 1N5XA 2JWKA 3CJCA 3WQTA 4BC5A 1NGJA 4K5SA 3T3FA 5ETNA 4YY3K 4BHQA 4HTLA 1ZTTA 8ICFA 3MDAA 1RCOB 2MQNA 3GTYX 3OTCA 2J76E 1N8RO 1V9OA 1WWVA 1RT6B 4PG5A 1BPXA 1CS4B 1SS6A 2HFSA 2KNJA 4P6QA 3CMAN 3L6QA 2LEBA 2VKQA 3EZOA 4JI5F 5B66U 4QYZK 2BANB 2RIJA 1YX2A 2IVOA 2VG7B 5F9LA 2PA8D 3GJSB 1BWEA 4Q8FA 3A3NB 4XH1A 2EWSA 2E5IA 2VHGA 4KQZA 3G8TA 3K5NA 2AWZA 5ALKA 3A5NC 2Y9UA 3DJCA 1HNZK 3LTOA 3D2NA 5IIOA 4Y2KA 1TFYA 4Y0WA 5IT9U 3GYNA 2IJNA 1RGIA 3GE1A 2WFAA 4MKYA 4BR2A 3B9JA 2XZTB 3QLHB 2CIMA 2WVFA 3PFEA 2ETJA 2APOA 5K9FA 1ZZNA 1V38A 3W9HA 4XDCA 2QA4S 4YHHK 4DCJB 5IT9Y 4USMA 4KB7A 2ZIUA 2BMBA 1HR0J 2MZSA 4CIGA 2D74B 1K73T 2BQ3A 4P75A 1HNXF 1NGGA 3L2WA 4JI4J 1SC6A 1WUDA 4JEPA 4ZCKA 3K7RA 1WHYA 5B0GA 1NOZA 3ATVA 3OJSA 4ZLPA 2GO7A 3U3YA 2PYLA 3P31A 1E6VB 3MDQA 3H0MB 2WVBA 4KHQA 4KKOB 2IDEA 5AI5A 2PXIA 3M8QB 1TUWA 2GMJA 1QH9A 3FCWA 2QB1A 3TUPA 4USWA 2FHKA 2QFJA 1VC0A 1K0TA 1VQ9S 3D2FB 3I32A 3GCWP 4IWVA 4CZHA 3P6YC 2OPSB 5KFRA 4CD1A 1Q5YA 2MAXA 1CZAN 5G5GA 3HZ6A 2HBZB 4Q2LA 2BE2B 1BI4B 3EDRB 3SK3A 5L1MA 2MTLA 3UD5A 2CPHA 2W9MA 2LVWA 2G5HB 5HJYA 7FD1A 3PKYA 4CNZA 2YJEA 2JHDA 2FD2A 4OI2A 4E7JA 4OX7A 3C5GA 2AV5A 4NWIA 1DFDA 9ICLA 3EY1A 1A77A 2UXCK 1FTCA 1XR7A 4E3SA 3UMBA 5D49A 2N4DA 1V97A 4CM0A 1RBAA 9ICOA 1RT1B 1HNIA 1VAZA 3JPSA 2PFPA 4M47A 5C12A 3M2UA 4JHDB 4BDZA 2GX9A 1CRXA 4NL9A 1LWXA 2K1RA 5K14B 3BS5B 3MCPA 1VGYA 2A3VA 1JJ2M 2YI1A 4URGA 2WHEA 3OTOK 2GIFA 1U8SA 2LQBA 4MKAA 2C2EA 1ZQXA 2BYCA 3FC4A 1R3NA 5CQGA 1SC4B 4U8YA 1RTDB 3FRYA 4CF3A 3MXMA 1BOTO 1ZM9A 3O8WA 3DOKA 4DUYF 2WW8A 3NE6A 4J9PA 3HHLC 5L46A 3GONA 1NGCA 4BRIA 2RVJA 4ELTA 1SJ3P 5AKYA 4Y2SA 1SV0C 4NXNF 2RQCA 2KDOA 5BYQA 3VWSA 3MURP 3ZETA 5CAAA 3FGUA 1ZPVA 2GA7A 5GAGU 3VEWA 4MEYA 4RW7B 5LJ5Y 2OTJS 2HDOA 3GP9A 3MAQA 3PYGA 4P2FA 3R9KA 3A3PB 2IFXA 3MEEA 3ZZOA 4UUXA 3QT6A 1DQ9A 2FSNA 1XEZA 2UUWA 1TUYA 3SEIA 2HSTA 1SXEA 1N2XA 5AQZA 3I9ZA 4NLBA 3TP2A 1FRHA 3IM8A 1WACA 4KV8A 4QWEA 1JJ2R 1I5OB 5CHIA 2J8AA 3CB4A 1V3RA 3BGUA 3M2VB 2GIRA 1KXPA 1H7WA 5SWMA 2G8HA 1N0UA 2CG8A 3GDQA 1NK6A 3KMSA 4DR2F 4TSXA 4MKBA 2H3FA 1ZQAA 1XNQK 2YV0X 1U1KA 2MKYA 2DNZA 4O5KA 3PR4A 3CIZA 2E5LK 1TL7A 1C6VA 3VGMA 1F5CA 4H54A 2QKBA 2W7OA 2VBWA 3I5BA 2AJ0A 3G25A 1UVIA 3I0SA 3MXIA 3KJFB 2MGZB 1LXJA 1TL3A 3I9V9 4X65J 4DR5J 2KT3A 4LF9F 3A0BU 5F0UA 1NHVA 3TUZC 4A8KA 3SBGA 2KJ9A 1RHKB 1VS3A 4NCGA 4ZP6A 1ULRA 1JKHB 4FLZA 2GMLA 4DV7K 5KAFU 2NO4A 3G2XA 3PO5A 1KCFA 2MLZA 2FC0A 2P5OA 4JYAK 3CCJS 2BR0A 2GCFA 3AOCA 1SC3B 1Z19A 2CYYA 3G86A 4PKGA 2QKKA 4DI6A 1D9FA 3ENQA 3A4TA 4JD2B 3VQAA 4P10A 4ZP7A 3RB3A 2ZBRA 2A42A 3OUYA 3D9BA 3N7SC 2H1YA 2KXFA 3LZIA 2H3GX 4DCHA 2IVYA 1V3ZA 4Z4GA 3QRPA 1UA1A 2P5GA 2DGXA 4HACB 3VERA 3SUNA 4GFJA 4HLBA 4WFYA 4CEQA 2UUCJ 2C3PA 5EOYA 4NXMK 4YP3A 1W26A 2ZHOA 3GZ7A 4O3OA 2C2NA 4JAXA 5EN1A 1GX5A 3KWMA 1FESA 2HHHJ 4B8AB 1X40A 4ILMA 4IOCL 3SD7A 5DB8A 3M6ZA 4DFPA 5D0EA 2D0CA 5EX5A 4MFBB 5HI7A 4QBUA 3NGKA 4GW6A 4OPJA 4I2PA 1U6FA 2IA6A 3NCRA 2Z8QA 3M05A 3BBBA 2QLFB 3HVRA 1Z26A 4CNQA 4ZN3A 3H8SA 1SH2A 2HIQA 4IXCA 5HRPA 1WHVA 3CF5Q 4DQIA 3MI7X 4DU1A 3GPAA 3OLBA 1VQNS 1FJGJ 3CM5A 4X62J 2KFZA 1MG7A 4LF8J 5F1XA 1BHLA 3U4LA 3PXGa 1IXKA 2FQQB 3C6TB 3ASMA 3M9OB 4LBIA 1MMDA 2XCAA 3AO4A 1UKUA 3RW6A 5BR9A 4P74A 1OIAA 4E1NA 3H98A 5KFNA 2CXEA 3BZQA 5KFZA 3OR2B 5AK4A 5ALPA 3EXYA 1HQEA 2XLIA 4DS4A 2QK9A 3MUVP 3F5AA 3M8PB 5HRRA 4X64F 2IA0A 3UDCA 3DXKA 2OPQB 2YNGA 3M3ZA 5D0GA 2UXDJ 3VAFA 4UT4A 3H42A 1RFQA 1VJQA 1AXQA 1GLEG 1URNA 1WF0A 5DBBA 3GB0A 2DNNA 4CGHA 4BREA 3R7BB 3M8YA 3CDAA 4Q2MA 1QS4A 3KZBA 3ZCMA 4RNHA 1BIZA 3IRXB 2X3GA 3D28A 3MCNA 4JI7J 3BO4A 1FFWB 3DMJB 2EG1A 3L3FX 2CN1A 2ZD1B 2ZIXB 3UMGA 5D4BA 3UKUA 1IJEB 3PYDA 2AX0A 3KG1A 3OYCA 3Q8KA 3BP8A 4A46A 2ZH6A 3ISBA 1RQ0A 3H5XA 3RAMA 2JV3A 1KEJA 4WKRA 4CFCA 3SQ4A 1VJWA 4ETZA 3B0YA 3V1QA 4DU3A 4KH4A 3Q2TC 4GO5X 1FFUA 3HX0A 3SSRA 1ZQWA 3KJNB 4F5QA 2RS8A 1ZM2A 2CQ1A 1OYDA 2JGUA 2Z58B 5IWAF 4Z4EA 2CQCA 3W8GA 4IFYB 2HK3A 1XWLA 1WDDA 1ZQFA 3V7KA 5BOMA 2XMJA 4X66J 3HPGA 3NF8A 1GXTA 4ZP8A 4U7BA 4L8RB 5AQYA 5A0YB 3H08A 1FKOA 4UB5A 4KGXB 2BCUA 1L5UA 2ZH4A 3CMES 4TY9A 3LGHA 4M5KA 4RQNA 5DBCA 3WK8A 5KFDA 5L1LA 1H38A 2M0NA 2XMUA 4NLQA 3T69A 4JKDA 5LJVA 2XZDB 1J54A 1AFIA 4LF5K 3KOOA 3CIPA 4KJIA 4EO6A 1B99A 3I31A 1SQFA 2N7YA 1A9NB 2RU3A 5CYMB 2YMLA 2E8OA 2IAJA 4DR6J 1RTJA 2HNZB 5CH7B 1P8GA 1P27B 2ZUDA 7ICGA 1GOCA 4DTUA 9ICUA 2JLFA 4XUSA 2MLXA 6FD1A 3RZAA 3MUMP 4B3TK 1HQ2A 2ZE2B 3MEDA 2V4JB 4JV1A 5J0QA 5CZXA 1NI3A 4K4XA 3FBFA 3QATA 1U7LA 1RWMB 4KH5A 3ZSRA 4AILC 4PKIA 4OJ3A 3RGIA 2GHPA 1SKRA 4I67A 2WUSA 2IHR1 2ZC4A 5B0FA 1MNEA 2OSRA 5AHXA 1U26A 7ICTA 5AR0A 2ZWHA 4B02A 3AAWB 1BISA 1P9QC 1F0MA 2A0FB 3AVCA 4F5PA 2B6GA 4N8OA 4C0HA 1YI2N 3V9ZA 3MCAB 1S72N 4M5IA 4Z4FA 2PD1A 3AO1A 2XB2D 1EKSA 4KLGA 1JLGA 1LWFA 2HB5A 3J8AA 3J7ZO 4KLSA 1C0TA 3MAHA 1U04A 2IMOA 2VQEJ 2WZ1A 3KFUF 5AQJA 1HKCA 1K0VA 1VQPS 2DKZA 1VYAA 2F8KA 4AHUA 1U2VB 3OYIA 3CCQN 3RJMB 2JVRA 3DRYA 2UVRA 4PEOA 1NKEA 5E3PA 3K59A 5T7LB 1ZQNA 4OYZA 4PZNA 4NLTA 4ISFA 1ZQMA 3TA0A 2DGVA 3W64A 3CJBA 2YTUA 5ETLA 3L2RA 1IN0A 4KHPK 2DNHA 5J2CA 5E3AA 2G06A 2OP5A 4BC3A 2K8BB 4B9LA 3UWTA 2NPIA 4Z4CA 4DV4K 1ZQKA 3T41A 1KTQA 3WNEA 2FJ6A 1ZQQA 4HH0A 4M6WA 2CG4A 2LKYA 2ABYA 3CC7N 1YRUA 9ICMA 4Y2JA 1C1CA 1JLBA 1CI4A 2WF7A 2DNOA 2Q0UA 3QUTA 4CBWA 2Y0BB 3G8SA 2AJQA 1U02A 1KFSA 2IIRA 2JEGA 4ZVEA 3QUCA 2DCLA 4MO4A 3RMAA 4DL0C 5LMUF 3JXUA 2MKJA 3K9KA 1X4CA 1M5SA 1BPYA 2E7VA 3WXIA 3R6LB 1S0NA 4DR3K 1KOHA 3D68A 1F9EB 1F1BB 2XM3A 5L1JA 3AQPA 4JKHA 1U2RA 4I56A 1S8OA 4CLFA 3D7SB 2YHYA 4C0BA 3EKSA 3G6YA 4EMDA 3C23A 3PFOA 1HFEL 3OD2A 4R63A 4R8UB 2D69A 4HDHA 2KEYA 1SB6A 2VFSA 3C65A 4YOXA 2MSTA 1CXQA 3RAXA 2HVIA 3C19A 1KLMA 3SSSA 3NVKA 3KLHA 4TU9A 3WKEA 4FJ7A 1OH5A 4O3PA 4ZLLA 4OYOA 1Z3EB 2HQIA 3PRVA 3MCSA 2RQ4A 3VMFB 3TWHA 5EXWA 4ZVHA 5HHHA 2SXLA 3V9WA 1ZOLA 3VEXA 3U02A 1KQQA 3N6NA 3NVYA 2QMXA 3QYYA 1UJ4A 1WOSA 4USHA 1ZBHA 4IFEA 2G8IA 3NS7B 1JLQA 4Z4HA 4PPXA 3WNHA 4RQ8A 4F5NA 2ZBPA 2DPNA 2PGCA 5ALXA 3AA3A 4MK9A 1JK9B 2YX6A 3Q7CA 4JLHA 3U6FA 1NXIA 3WC0A 3CI5A 3KWGA 4KI6A 4DXLA 4ZVSB 4UZBA 4LR7A 1LW0B 5A8KA 3IG1A 1IKVB 3SAGA 2XLJA 3S6EA 1DK2A 4LF1A 4BRHA 2OZMA 4RNOA 2HZAA 2HGMA 3CERA 4O0IA 4LJXA 4K8RA 2I5JA 1UJ5A 3AH6A 2GH1A 1R0BG 3OLAA 2F9DA 4ID5A 4V1Ak 4N56A 5M1KA 1KSPA 3CCZA 2O8CA 2EK1A 4MIAA 2JZBB 1MWQA 4CZEA 4OX6A 2LMIA 3W2WB 4RW4A 5J0OA 1H3DA 3QFWA 3GCXP 3AAPA 2I7NA 1GAOA 1JXVA 2V8HA 4YQWA 5CYJA 1X4AA 1HI1A 2CPZA 1HR0K 5IFMA 5A8RA 3U9ZA 3NH2A 2PEBA 3MMCB 4P0QA 1HEKA 2R7TA 1Z1VA 1SV5B 2V94A 4WU3A 5A0LA 3CIMA 4W90B 3OS1A 3AJ1A 1PIEA 3I5CA 1BWVA 1Q3UA 1FJEB 3CJKA 2FPLA 4F3MA 1ZAWA 5D46A 3D2EA 3O9SA 3PRDA 3HJFA 3CC2S 1XK8A 2X7IA 3MMAB 2E5HA 1D5AA 2K4HA 1XJWB 4P52A 4NYPA 3EN9A 2BGWA 3ENVA 1E4GT 4Y2XA 2HHUA 4QYRA 3CD5A 1YJRA 2HHPA 1KR4A 1X42A 3TNVA 5F8HA 4ILGB 1HIYA 3N7RC 3UCZP 4ID8A 2HBKA 3CJ5A 2AYBA 5A2QU 1U1PA 2ZFHA 1NM1A 4XK8C 4C4SA 2Y8YA 1Y11A 4EBDA 3MPDA 2B7BB 1HUXA 1FXLA 4YN3B 3C16A 4JI1J 2H4WB 3H8WA 2MY8A 4RO0A 1HPZB 2DGUA 3D6MB 5A2QY 1VBYA 1IXRA 4WFAL 2KP7A 3QETA 5LSOA 2P9PA 2CZVC 3H2VE 3HULA 4I29A 1MMNA 1SGGA 2ZH5A 3VN5A 2GJ2A 5LOQA 3JAMU 3TKAA 1K8AT 1L3UA 3EW9A 4NJ8A 4O0NA 1HJRA 4DN9A 3GFHA 3OVNA 1DTQB 4NLOA 1MA7A 3OFEA 3FMWA 4H4OA 2DD8S 1UW4A 1X5PA 4DV5F 1WLJA 1BO5O 4GVEA 2AW0A 4NLCA 3JAMY 1HJOA 4QS8A 5BPLA 3CJTA 4GKJF 4ZOHC 4CK2A 2FHOB 5LM7E 3ZDDA 9ICPA 1WHWA 4NASA 4FWQA 5AQFA 3WX4A 1TK8A 4UB3A 4F5OA 2VFRA 4IG0A 4ZPTR 4KH1B 3BSAA 2W42A 1ZQGA 3KKRA 3R5AA 2G1DA 3NS1A 4HI1A 2WF5A 2Q3SA 3I1YA 4LF6F 2RRNA 2FI1A 1GK8A 5IQ6A 2EFOA 3NBPA 1B9FA 4UF4A 8ICQA 3SMSA 2CDQA 4LSNB 1RISA 2Q66A 2VB6A 5D15A 2ZUAA 5FIIA 4QZVB 4HEA9 3BO2A 3AGRA 1FXXA 1HNXJ 2HMIA 3PIPL 4OX8A 1MDUB 2NRVA 4BVOA 4U7UK 4O0JA 2L9DA 1RT3B 3SZ2A 3I82A 1NB7A 1YGYA 5AM5A 4FVUA 4ZVGA 2ZH8A 3RRGA 2DWQA 3OXFA 2F5GA 5BR8F 3HVTA 5AQXA 2UVWA 3ZTRA 2BVZA 5G0RA 4OZ5A 4JOUA 2G09A 4F7VA 2DR8A 2RHQB 3WIVA 4FLTA 3D54A 4JI3F 2HS3A 4MK7A 4KB1A 4Z2XA 3KLGA 1OSCA 4M3UA 4HCBA 3PEJA 4US9A 3ZZTA 5F0XA 4C11A 1N63A 1KP6A 2BCRA 5HROB 4LRBA 1NMNA 5HMXA 2BE7D 1G15A 3I8BA 1RT7B 3AHPA 2UP1A 2GQ2A 3N9UC 1CJTB 2A18A 2RE1A 3BGOP 5IT4A 4X65K 1NNLA 3CJ8A 4DR5K 1MN9A 2W7PA 2YKAA 2JGAA 3B0XA 5ALVA 3PYFA 2ATLA 4Y2PA 2PI4A 3D3CJ 1U1MA 4UY8T 2IJRA 1RT2B 2F76X 1VDHA 1K47A 3DLKA 3LP2A 3R5DA 2F1JA 4Z7YA 1J6ZA 2KKZA 4M5LA 5M1PA 3IGVA 2ZZTA 4O5EA 2E9TA 1FO1A 4J91A 2BOPA 4LR9A 4AQYF 2QARB 3IHQB 4IQVA 3ZO7A 2KW4A 2I38A 2YKNB 2R8KA 3D66A 3OYBA 5JJBA 4EELA 4PL8A 1Y00A 2V4RA 4LFAJ 3M2RB 1T11A 2ZJ5A 3B6OA 2ZJRL 5J2EA 3TEHB 1WCNA 3CJ1A 3KZIU 4CJ5A 2RKIA 4DUYJ 1YXQA 3NVZA 3DN9A 3R9LA 4LIRA 2UUCK 1L7MA 5GMEA 2IBKA 5IM0A 5ETOA 2V6AA 4TKTA 4NXNJ 1RADB 4EGLA 2HHHK 3WK9A 2BJ7A 5F0WA 2O8FB 4WCEQ 1QM9A 4CHNA 1REGX 4JKFA 1ZXIA 4TY8B 3ETOA 3ZSOA 3ULEA 3DRSA 1LKYA 3L95X 2VWBA 1TVAA 5KQ8A 1EQYA 4K4ZA 3NS6A 2GZOA 3KMQA 5BRHA 4NLWA 3TAMB 5CA5A 4ICLB 1X66A 8ICRA 5DBAA 2GO9A 2OTLN 4I6YA 4Q45A 3TFRA 3EEQA 3VEZA 1P9YA 4GVBB 1SVDA 1B92A 1WKKA 2W9BB 4DV2F 2K7JA 1RXVA 5DLFA 1UT8A 5HBMB 4GRSA 1FJGK 5C5JA 4X62K 2V7ZA 4ZVFA 2A3ZA 5FLXO 5BJRA 5L9NA 2NNWA 4LF8K 2ZIVA 3QU5A 4RWXA 3IBWA 4HHJA 1RT5A 3L2UA 5M1QA 3SI6A 4KBIA 4CEDA 4MN4C 4LBHA 4CH1A 1RA6A 3UNYA 4DR2J 2GJIA 2YHXA 2IMWP 2X1GA 2MQOA 4QAGA 1ATSA 2XZWA 2VA8A 3PJ9A 1PZNA 1VLYA 3CSKA 2P5VA 1U47A 2K2PA 1X4DA 4UUWA 2JC1A 3EO3A 3DXBA 2YVSA 4FBTA 1SJRA 8ICWA 3THPA 3TTFA 3ZTQA 4LF9J 4C8NA 1N36J 3O8MA 2UXDK 4J9OA 4KN4A 1T44A 5J0XA 4MFAA 3JPPA 4FK0A 1GOAA 5ALUA 1FRLA 1QJHA 2ZZNA 3C28A 3VF4A 5AIAA 4K8ZA 3MXJA 3D2QA 3B8HA 1NZBA 1KWMA 4JI7K 4FF2A 5ELZA 4JKGA 4ILRA 1LV5A 2ZJQQ 1K9MO 1D3WA 4PXDA 3R1XA 5D77A 1ZQVA 3IWXA 4DFJA 3ETRA 2OEHA 1XUPO 3CE8A 2ZIUB 1KL9A 4W5NA 2LEAA 2PMZF 1H98A 3FK4A 1JUDA 2WFBA 3AVJA 5D4NA 5KG7A 3GQCA 4X5VA 1UMJA 1NK0A 3CCSN 2H5EA 3IS9A 3AA4A 1ZYQA 3FC9A 5D8HB 4ZPDA 3VAIA 3U8XA 4LF4F 4LC9B 2YY3A 4FYVB 1PCAA 4CW7B 3L7PA 3TABA 2KVQE 2I1QA 1W9HA 4X66K 4WTOB 5KFUA 2POKA 4P2HA 4W4MA 4TNOA 4ALZA 3C29A 2B4VA 5J2NA 3ILLA 2LXFA 1HRHA 4JI2J 4HTUA 1WBBA 4ED2A 4OLOA 4ECTA 3QEPA 2CQBA 3QXGA 1J5EJ 4DQ8A 2UXBJ 1R8AA 3HM8A 3HDSA 1N32K 3KKAC 2P9IA 2Y3YA 4P4PA 2CKWA 5IIIA 1U1QA 2DIVA 3IDWA 1HNIB 2FSJA 3LP0A 1HNWK 1FNXH 2CJBA 4YDXA 3M2UB 3CNQP 3TZXA 1C1BA 2K1RB 4LFBF 2BHNA 2LHTA 4EEKA 1OS5A 1OW5A 4ANEA 1YWXA 3G71S 5E7OB 2VL1A 1FIQA 3S8SA 2ZH7A 1NK4A 4M5HA 4JKAA 4E19A 2D0BA 3HWTA 3T6JA 1BNPA 3L3VA 4LVNP 3A3OB 3OL7A 1YVFA 3RH6A 3DOKB 1VQ7S 5D4LA 1NGFA 5J2PA 1B0TA 2VUGA 4RNMA 3EZ5A 3CCES 4JI0F 5CP2A 5JLFA 4F67A 5HL7L 3ADAC 3ZETB 5ALEA 1T3OA 3H7IA 4X4QA 5EHHA 1Q81T 4L3KA 1BUPA 5CABA 2XEXA 2XYPB 3MEEB 1RU1A 4GMKA 2PMZC 2HHQA 5D4OA 2DO0A 3Q8UA 1H74A 1I39A 3UXPA 2F9JA 3AARA 2EFVA 2W2NP 4B9QA 1VQON 4WJBA 2VQEK 4OPKA 3A1YG 7FDRA 4KV8B 1AZSA 2FY8A 9ICQA 3D6FB 2DNQA 2VFTA 5J2QA 4PHEA 5IC4B 3GU3A 2IDOA 1OVYA 4YDUC 1VDVA 1NRKA 1FK9A 2H5XA 1DT9A 1HBUA 4C3MA 5IWAJ 3V4MA 4L76A 3O6WA 2BX6A 5HK4A 4PRFA 2GVZA 2W01A 4LSLA 2M5YA 5CD4H 2F1HA 3AVGA 7ICQA 4DX7A 2UVVA 3KG4A 4ES1A 2F8EX 4FKXA 1TL7B 4EUVA 1Y0HA 3Q8MA 4M9HA 2MSNA 2HQDA 2CVIA 5DDMA 2DIUA 5FRNA 1S9GA 4QOTA 5DMRA 3I0SB 4JK7A 4AHVA 3VQ4A 1TL3B 4H5TA 5FD1A 1ZD5A 4MJKA 2DGQA 5F8NA 2OHFA 1R89A 2QLWA 5BYRA 2B21A 3AO2A 2EBEA 2FC9A 4X4PA 1QAXA 4NCGB 4ZIVA 4H4MA 2J9DA 3FQLA 4U67L 4DQRA 3UO0A 3D6TB 1W2BR 2OD4A 2ZVIA 4K4UA 3LP1A 3GBTA 4UB1A 5AE2A 3WBZA 3HW8A 2Q97A 2J9EA 3LUYA 2EFQA 1YJ9N 1NZPA 5F3TA 1S4FA 3W0LA 4DFMA 3OUYB 5J2MA 3OSPA 2WTFA 4RQ2A 5HLFA 1GLCG 1IQZA 3P49B 3G87A 1WSRA 2QL9B 2V0NA 2HQCA 1H7XA 2VD3A 4H5RA 2MPUA 2UUBF 3MBYA 3VC8A 2W24A 3K5PA 3I55N 1IKWA 3OTEA 3PJWA 4ZVUB 4CK3A 4TYBA 1B4FA 3BJYA 3ENBA 2QYGA 1Z1BA 3J7A1 4KBOA 5IIJA 4USKA 1HQUA 1TL4A 4CBXA 5FPNA 1L8LA 4ZA1A 4BC7A 4W5RA 1XNRF 4E0DA 2LYAA 3G4SN 2CGJA 4H5NA 3MN9A 4MEXA 3M30A 4FVCA 3O3GA 1WAJA 4OX9F 1U6ZA 5JVGQ 3QNOA 2P66A 2ROGA 2I1RA 2VBXA 1BIUA 3S9HA 3DRPA 4I2PB 3FQKA 3MFHA 4ECSA 2F77X 2VONA 1JJ4A 1ASVA 3S7RA 3SMPA 3W5XA 3MK6A 1GTEA 2P8IA 4ZMMA 3I56N 3M6GA 1U25A 4ECXA 5EUHA 2KIVA 2YQ0A 1RAHB 2DGTA 3SQGA 1XO1A 3H40A 1RM6C 2ZH1A 5J0SA 2OPPA 3LW5C 1C4AA 3H6EA 2B56A 3TU5A 3KNGA 8ICGA 4CEFA 3DLHA 1LXNA 1ZQBA 1UEVA 3IFRA 2XRIA 2ZTCA 3NL0A 1A5VA 2UYTA 1NJIO 1K8KA 3O4QA 4NLNA 3I5AA 2PYJA 1E4FT 4B1UB 2DH7A 3CD6N 2XI3A 3QWUA 1FTRA 3KG0A 5KG0A 2XBPA 4HUEA 4UB2A 2WSCC 4WYWA 2HG4A 2R8IA 3CGIA 1HQEB 1IBCB 2P9GA 4CGFA 5HQMA 4XAKA 4RQ4A 3DXKB 2R8JA 2BE9B 3VF0B 3VENA 2JNJA 1CJVA 5IIKA 4EK2A 1VJ5A 5LMUJ 3QRRA 1JCEA 2YNGB 3D1QA 3CHWA 1EO1A 1RWUA 2LFVA 1X4GA 2M52A 2RAQA 5AM2A 2P9EA 4Y3CA 4DPWA 2W40A 3G6EN 1GLJO 2W04A 2IHNA 1RK8A 3W2VA 3S41A 5AJ3K 2RRAA 1V4TA 3KKAA 4KN7A 3NH0A 5ALIA 4MHVA 1WAFA 2A41A 1VQ8S 4PGQA 3V4IA 4CLKA 2X1BA 1WI6A 3JTNA 4CZFA 2OI2A 2RH3A 4RNFA 4KH0B 3UKUB 1BUXA 4BC9A 5BRDA 4EIAA 1RAFB 3GYXB 1XHZA 4F93B 3GIKA 7ICFA 3D0IE 2QRRA 4CJFA 3ETLA 1BG3A 2DFHA 4JI1K 4RQ3A 1S1XA 3CDUA 4FZXC 4RQ7A 4Y6IA 4TLQA 4ZPBA 8ICAA 4OI1A 1N5TA 4BBYA 3AUOA 2PBDA 1NHUA 1XSNA 4YOUA 4U9RA 1FXDA 3ZEUA 3RSEA 4MTPA 5GTIU 3OHRA 1IKXA 3BREA 4DTJA 2F4VJ 4NZ6A 4WYLA 4ELVA 5E3RA 2ILZA 2KFYA 2E8AA 4CJSA 2H9ZA 2ZH9A 5FDLA 1NDPA 1FKOB 4PZVA 5B0DA 4EO8A 1WOOA 1LFPA 3P39A 3R2DJ 3P5TL 4JI5K 3QQCD 4DTMA 1Q46A 2HFUA 3U26A 3BV8A 3WKBA 4PWUA 1DGSA 2HQFA 1GT8A 3IC1A 3BUZB 1JALA 3UR3C 3AVFA 4A8YA 1N34J 1VK3A 3J7ZT 2YWWA 1ZQJA 4QNLA 3F5EA 8ICBA 3GG0A 3ZZUA 2B4UA 4YR0A 2IAJB 1RTJB 2CPDA 3CULA 4YDUA 5A6PA 4YFUA 1FE0A 5ALTA 4N7TA 4ZP9A 5K8PA 2W9CA 4I2JA 4URSA 3THWA 3QIPA 3ZX0A 1VBKA 1NLVA 2HQ3A 2X6NA 4RL1A 3MGVA 5KT2A 4DU7A 1HNXK 2HGNA 4OV1A 3MEDB 3I6PA 5AQWA 2JFDA 3CJSA 3OYHA 1JI7A 3IFEA 4BR4A 2BKPA 3QB0A 3U1NA 1UVJA 1TU0B 1Q8IA 3K89A 2HBQB 5AK3A 4RQMA 3MPYA 4PXBA 1J53A 2IRXA 4A57A 2Q43A 3TTCA 3ZSXA 1XR5A 5DDYA 3BGLA 2XO6A 2B9YA 4PWDA 4Z6DA 4LT6A 3VQEA 9ICBA 2QA2A 2M9KA 3GJQB 1G99A 4RUBA 2F2AB 4UOFA 2EHGA 1OVQA 1SXLA 1S1VB 1SI9A 3H0RB 2OWOA 2VC0A 4NMLA 3DRXA 3A12A 4CK1A 3T1YF 1JLGB 5B09A 1LWFB 4LQ9A 1FRMA 1NOYA 1C0TB 1HBNA 4Y1CA 2G8KA 3DLJA 4LVOP 3IBPA 1RYRA 2MQPA 4OVLA 3M8SA 2N82B 3VQCA 4OV6A 4R65A 2VFVA 2J4RA 2D3UA 3EWAA 1L3SA 3M7DA 4USUA 3FVYA 3OFHA 3DDNA 2H3EB 2JLGA 4BC2A 3OVAA 2FE9A 4YR2A 3BPSP 2AJFE 3LYSA 4Y2YA 4ID1A 3S3MA 4LF7J 5E79U 4M5GA 2WW4A 3V5RA 4C80A 3QZ7A 5AI8A 4K4TA 8AT1B 4LFAK 4M6WB 3R97A 4IG3A 4R66A 4UW9A 1C1CB 3I33A 1JLBB 1J27A 3C66A 3WXKA 5IV3A 6AT1B 3M1YA 2X3DA 1N54B 4DUYK 2ZJAA 3ID6A 1IWAA 1Y5IB 2CPFA 5AKEA 4GKJJ 2VQFF 4IO9Q 1WSHA 3CXCM 2CXYA 3KUHA 4K41A 3K0JA 2NYVA 2BM1A 2AZ1A 4NXNK 1NJZA 3BYPA 4LQ3A 5AI4A 4FWMA 5AM0A 3RB4A 1Q8BA 2DEIA 3OGUA 2GQQA 3MN6A 3A5MC 4PUOA 4D3HA 3D1OA 3R7SB 4RU2A 1JIHA 1UT5A 4CZIA 4QZ8A 4HT5A 4CHYA 4LF6J 4N41A 1KLMB 4QZ9A 3AODA 2ES6A 1OUQA 1M1GA 1Y3KA 3KLHB 3C2MA 2MZTA 2J6TA 4M8LA 3SMZA 1X1PA 3V9XA 3O3HA 1TR0A 2V4QA 4ATNA 3BSOA 5G4DA 5DGBA 3FEYB 1VSLA 3H4BA 4BXOA 4FL9A 4CZGA 2Y9HA 3BYRA 8ICYA 1PYSB 1YJVA 1VRQC 4J2BA 1P1TA 2J6UA 1WC4A 1ZD3A 4CO3A 2J8SA 2KT5A 3NMAA 4B1WB 3C14A 3GMGA 5BR8J 3AXMA 4I9LA 3EUB2 3IGNA 1JLQB 3CCRN 1UCVA 3SQOP 4DV0F 3ILJA 4WZQA 4DR2K 2B9XA 3IG5A 3W61A 2E1AA 8ICEA 3CXCR 4PG7A 5C2FA 3QT5A 1RBUA 1V4SA 5EDWA 1XQSC 3GJTB 1FJ7A 1IBKF 1U2CA 2IBOA 5D6GA 5A8KB 3IG1B 4O23A 5L1KA 3F56A 1Q4RA 3DRRA 3SQ2A 1REVA 1VQMN 4MK8A 2M4MA 3CTRA 3NVVA 1Q95G 5ETPA 2O6KA 2XGPA 1ZA2B 2DFEA 4LF9K 4NPOA 4QZDA 3SBMA 4C23A 2KV2A 3BGRA 2I5JB 2DUYA 5GAHI 4KLLA 2DR9A 3D6RA 3C1YA 2KJWA 1XMQJ 1IBMF 4ID5B 3IBFB 4ZJLA 5DG8A 2WOMA 1WNEA 3L2VA 1Z2LA 1S79A 1TUUA 2FLLA 4MQ3A 1B0XA 2O8CB 4Q7AA 3OTQA 5AXNA 4NCBA 2JLEA 4RW4B 5A8WA 1FT8A 4K42A 4DTRA 3CVKA 1TE2A 4AQYJ 4H03B 1X5TA 2ZWOA 4BGAA 3E9LA 4JRQA 3HSGA 3JPTA 5A8RB 5F8JA 2YB4A 2W4PA 1UPPA 3KNAA 4P0QB 4YHHJ 4K0KF 2W41A 4CF0A 3ALRA 2ZVSA 3OHAA 2EFNA 2NZTA 3K1RB 2LDIA 1U9LA 1SJFA 3IRWP 3P83D 4IO8A 3VCBA 1Z1ZA 5HP1A 1NPRA 4JMUA 3K58A 1SAZA 3OL8A 1Q79A 1DGKN 3CJKB 4PL7A 2A1BA 5DRKA 3G8QA 3PHEA 3D2EB 3WK6A 3TVZA 1PGZA 1M90O 4KH6A 4X84A 1GOBA 2HGLA 4BDYA 4BLGA 3OYEA 4PL2A 1VQ4S 3ZTOA 4JN4A 2L9WA 3MR5A 2R7VA 3JSMA 4QIWD 3US5A 2V67A 1IIPA 4W5OA 3T5JA 2IVFB 2KG1A 2XMVA 2R8GA 4KSEB 3JQMA 5KFLA 3H90A 4LRAA 4V19J 1YK9A 1J5EK 3AT1B 3C16B 4CLLA 4M9LA 3G6XA 1PAUB 3EGVA 4OGCA 5BREA 1J2NA 4OHYA 3R6GB 3J7Z5 3NNCA 3CM6A 3K8VA 3T5LA 2BPCA 4DV2J 4BUGA 2MZ1A 3E9PA 8ICNA 2V8DA 4FCYA 8ICOA 4GV9A 1WSIA 5AXLA 2P9PB 2JRSA 3DLBA 4US8A 1CQNA 5I3UA 4YOYA 3KLVA 3DLEA 3NOCA 3GG4A 5BN9A 2LSNA 1KDHA 2DO4A 1L7PA 2H3ZA 4QR2A 1I3AA 3PUFA 2Z2MA 5KFBA 4H4OB 1DQ8A 3OTOJ 4B3OA 2HZVA 5E3CA 3O1BA 3SUQA 9ICVA 5BN8A 1FI4A 4K2JA 3GV8B 4AL5A 1UZHA 3P4UB 4CEBA 4X64K 1RG6A 2OYYA 5B8HA 3UN5A 2L48A 3KYLA 1FO4A 4RQ5A 1H1VA 3I0RA 1S76D 3FZKA 4C3LA 1DAXA 4IG0B 3F5TA 3W3DA 4QU6A 3NGTA 1NSAA 2WTUA 2MB0B 2O66A 2OM6A 1NGBA 2EAMA 1Q5VA 4I7FA 3CF5L 1VK8A 4WPAA 1YZ7A 4GMJB 1B0PA 4ZVTB 2HHXA 1XTZA 3NBPB 1ZD4A 2RLTA 4GC6A 2QTDA 1ZD2P 2XNRA 1GXUA 3TSQA 1QZ5A 1T8EA 2BKEA 2HMIB 4ZVQB 2LQ5A 2KHQA 3LL3A 2ZNZA 2FMPA 2BJ3A 3TVYA 3CQYA 3DV9A 2OPRA 3QE9Y 2EANA 5K5MA 4FO0A 1Y97A 1RWPB 1WG1A 3BN7A 4DWIA 4IH7A 3HVTB 5IWAK 3NMRA 1WN7A 3AO3A 4LF4J 3J81O 3Q8PB 1R0AA 1T0TV 5G0RB 5L1IA 3MOJB 1GQEA 4CNYA 4IYQA 3KLGB 3RW7A 3U27A 1P7DA 2HWIA 3EVWA 2XWYA 4C11B 4DSLA 2EC0A 2FBYA 5ETMA 2WVCA 5SUHA 1QAIA 4FLUA 3G6VA 1DEJA 3ZT1A 2OEKA 3SMVA 4KIAA 4EENA 3N5FA 3UD3P 1KAXA 3MX5A 4PH5A 1T9XA 4B3RF 5AQUA 3CCUN 1HWJA 3LALA 2XTJP 2CJXB 3ENAA 2BKOA 2WRMA 2KIWA 4UAYA 2G0CA 4XH4A 4CVNE 2J9DE 3QNWB 4PG4A 2E8MA 4RWWA 4QJVA 4FF1A 4O3QA 3DLKB 3MCOA 1UPHA 3LP2B 3TAQA 4K8XA 1IWGA 2ZH2A 4CE9A 3QERA 2HHVA 2E2QA 5FROA 4IO1A 1YTAA 2E4LA 4ZIWA 4TN2A 2NUUG 4AH9A 1ASWA 3R9PA 3I4PA 2AD9A 2GAGC 1D8LA 1RWVB 3VQQA 1PVPA 3GIMA 1A6LA 3VVTA 1RTZA 4M95A 3ZYYX 4QZFA 2VA3A 5H1SQ 1PUZA 4I2FA 2QWNA 2FXUA 3KLEA 4MF8A 4DL7A 2Z1JA 2WONA 4YDDB 1ZQEA 3BR9A 1BQMA 5AZIA 2RKIB 1L8OA 4NMXA 4ECQA 1JB0C 3AN1A 4AT1B 4JI0J 1QQCA 2Z30B 2CPYA 5AI0A 4O3NA 5IM0B 4F3QA 1K44A 3MWPA 2YPYA 3PACA 3RBXA 5H9EJ 3CO9A 2O8DA 4JI6F 3HJEA 1VQ5N 5J0PA 1BC6A 3VVUA 3QEVA 1YHQN 1KHWA 2JWLA 3VEOA 4ZVRB 3L0QA 3ULEB 3DRSB 3QJJA 1LKYB 2PI5A 2XI2A 1GMWA 3T5HA 3AY0A 3HOSA 2M7SA 1HWUA 4IQXA 2GELA 2BCVA 1S1TA 2B51A 2KZ3A 2KXHA 3KFWX 4I2DA 2G2YA 2XQCA 4XRHA 4CO0A 1ZC6A 2DB1A 1C4CA 3RR7A 3C1ZA 3SCKE 4HKQA 2A1SA 2DCUB 2ZIVB 2D7SA 2IM0A 4BG8A 4P72A 3FBBA 1RT5B 4LF2A 3O08A 4N47A 1VHXA 3L4PA 1GTHA 2Q0RA 3E01A 2PE8A 2IOHA 4Q43A 1MWYA 2B7CB 4EX6A 3T1AA 2NRHA 1TVRA 2XY8A 1TGOA 2W54A 3KLFA 8ICZA 5I3PA 4BE2A 3X1LB 3FZBA 1URJA 3HMJG 3QESA 3WXLA 5LMUK 3TZZA 1ZM3A 4CJRA 4OKKA 4B17A 4X4UA 4FZNA 4RPFA 2EKNA 5C10A 4N5SA 3B6BA 2MZJA 4JYAF 2D6FC 1ICEB 2ZOMA 2QFIA 2OCEA 2ADCA 4B1XB 2FJVA 5GAHU 2X51A 5ETQA 4JKGB 4IEIA 2J0WA 3KUGA 2N3OA 1SPBP 2YX8A 1R8PA 4I2IA 4PAAA 1L3KA 2CWKA 2FIUA 3PW5A 1RLCL 4FJGA 1DY3A 3ENOA 5F3XB 4A5BA 3BKFA 4DX8H 1RUSA 1IV0A 3LZJA 2WB4A 5CD4A 5JU5A 4J9RA 3JTOA 1NGEA 3IS9B 3LGNA 4YOWA 3JYTA 4NLGA 3R5BA 2E88A 3UKRA 1X9MA 4X4SA 2KH9A 5GADI 3WXMB 4J9VA 2M88A 2VG5A 3M6VA 3B8AX 4KLIA 2Y1RI 4DPYA 1KFTA 1XNRJ 2N1RA 4DSKA 5KG5A 2N3LA 2HMPA 2EDUA 4RCHA 3CMAS 1NK8A 5J2NB 4OX9J 3K9JA 4PHTX 1WC5A 3V7JA 1OQ6A 4RKUC 3O80A 4A47A 2P9CA 2ASOA 3BQ0A 2KD1A 1LVHA 4F91B 3MWTA 2QG9B 4D3GA 3OPKA 2J0QD 2CRXA 1CQMA 1N56A 3AV9A 1ECWA 2O4GA 3LH2S 1XERA 2P9IB 3M7VA 1GH8A 2E8NA 3P8BB 4LF5J 2ZOGA 2QE5A 4DO9A 3O3FA 4CZLA 3CCMN 1KDNA 1RXOB 3M8WA 3LP0B 2EZYA 4CLSA 2PFDA 1ITGA 4UAWA 4B9SA 1B3TA 1C1BB 5GADP 2A1RA 3NDKA 4RT3A 2CH5A 2QMWA 1JNRB 3C3LA 1CZBA 4CO5A 3J80U 3LWMA 3HSDA 4F2RA 1PJ6A 4NZ0A 3OYLA 3BQTA 2LPEA 2Y8WA 2IM2A 2AMCB 4C8YA 4KHMA 3GFZA 2W2OP 2A6MA 3UI3A 3NNAA 4OZNA 2CQGA 2D3O1 1F2HA 5KGXA 5GAGP 3J80Y 2WHOA 1RGVA 3POTA 5J2PB 2KVSA 5C15A 4OLPA 2EC2A 2KXNB 4IQTA 1NEEA 4CZKA 1K8AO 2ZC3A 4CERA 4HHHA 3Q8QB 3RMBA 1O13A 2P6UA 3WK5A 2MZRA 1SZ2A 1QUPA 2AYEA 3NAEA 3LVVA 2PZSA 4EP5A 1RILA 2U2FA 1AROP 2MYFA 4F92B 4CDIA 3HK2A 4ELUA 1DK3A 1VSIA 1DRZA 4H4KC 3M6UA 5F9NA 2PC6A 3N0VA 4BRCA 1AZSB 3QX7A 3PEHA 3A5OC 1WJ9A 5J2QB 2VBYA 3V7LA 5AQVA 1SKWA 3ULDA 4UQGA 2NYHA 1FK9B 1Y10A 5TZVA 1N48A 1HBUB 2EG2A 4O55A 4NRTA 3Q23A 7ICLA 4ZITA 4H0VB 1YBUA 4CJTA 2ZHBA 2F40A 2GVZB 3NAIA 1D9DA 4F0MA 1C1AA 1GLFO 4LF7K 3EJMA 4LSLB 2F7VA 3CO0P 4K59A 3PW2A 1HYSA 3SQ0A 2C22A 4DQSA 4P73A 3EKUA 5HR6A 1Y88A 2UV8A 5CEHA 5J29A 4FPRA 1XU4A 4Y2QA 4RW9A 1RWNB 4LY7A 4DV5K 4AYBC 1OY6A 1S9GB 3MEGA 5F2RA 2EAOA 4WXOA 3CCLN 2DH8A 4GKJK 4ECUA 3Q8LA 1NZAA 4NLVA 1B7YB 4XEIA 3PR5B 4PKDB 2AQ4A 3RU0A 1ZRNA 2FVCA 1YDLA 1RWOB 1ZQUA