1NJXA

Thymine-guanine mismatch at the polymerase active site
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njxA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njxA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njxA01
4BE1A 1W9HA 4MEYA 3IM1A 1S0VA 4KLMA 4OLBA 3T5HA 2ZJ5A 3U6FA 4FVMA 1C1BA 2G8UA 1TFRA 1ZQUA 5KFTA 1S1WA 4HCCA 1Y88A 4YCXA 3O4QA 5FRNA 3AU2A 1ZQVA 2BQ3A 3KD1E 4PPXA 2BQUA 2OPQA 3NH0A 4Z0UA 4KLLA 5KFOA 4J9SA 1HYZA 2XCPA 2PZSA 3V9SA 4YMMA 2PFNA 2ASJA 1S10A 4CEAA 3THVA 4W5NA 1JL2A 2IBKA 2DY4A 1SUQA 1IM4A 4QZ9A 3KLFA 1ZQEA 4E19A 4FBTA 4O3PA 3PX6A 1QLNA 4YG2A 3WNGA 5HRSA 4AHTA 2WTFA 4JWNA 4QZGA 1K1QA 1ZQWA 5L1KA 2P1JA 4R65A 2P51A 2IS3A 4NLZA 2RKIA 4IKFA 3BDPA 5TZVA 1TKZA 3K2PA 5KTQA 1RDBA 3ZT1A 1WSJA 4ED2A 1ZQQA 3RWUA 2KZMA 4QZBA 8ICRA 1NJWA 4J9RA 1ZQGA 1JX4A 1VSFA 4JLHA 3C21A 3LWMA 2PI5A 4IQWA 3M9OB 1RT6A 4RW4A 3OYNA 2EX3A 1MQ2A 5KFHA 4FK0A 5HROA 2YNGA 4KN7A 3FDSA 3S9HA 4FJNA 1T4GA 4IR1A 5J2HA 4B9MA 3E2EA 2BE2A 4F4ZA 2HHQA 1ZQZA 4I2HA 4KLJA 1N5YA 1ZYQA 9ICAA 3C2KA 3HW8A 3BQTA 5CWRA 2DPJA 2G8WA 5CJ7A 5KFYA 4RNMA 4N41A 3HT3A 3K75D 4WE1A 4O0JA 3ZSYA 2PI4A 3RB6A 3SQ4A 2ATQA 4F5OA 1KRPA 4Q8FA 4FLTA 3PV8A 5DBCA 2P5GA 5HMLA 4F2RA 1HQEA 4DMNA 4LZGA 5DQHA 1MQ3A 2R8KA 4M0AA 4DL4A 1ZQJA 4KMUA 3ZDAA 4CJLA 1TKTA 2VWJA 4EYHB 1L5UA 1TL1A 2DFHA 4E7KA 2I5JA 4MFFA 4DFJA 4DSJA 5CYQA 8ICZA 1KLMA 1S9EA 4C8OA 5CA7A 7ICQA 4I2PA 5DGBA 2HHXA 3TWHA 2BPCA 4F50A 3EZ5A 2VA8A 2PYLA 1FK9A 1X9SA 1WSGA 3SI6A 1QS4A 3I0RA 3T5LA 3RB0A 1NK0A 3V7LA 5IIJA 5KFMA 4HYKA 4IDKA 4NXZA 4YR2A 3DYAA 4FJJA 3ASMA 3MXMA 4KPYA 1ZQKA 4DSEA 3OHAA 2JEJA 5SZTA 7ICTA 3OY9A 5J0RA 2C28A 3UQ2A 3ZSRA 1NK4A 4O55A 1XO1A 2OZMA 5EWEA 1Z25A 4F2SA 5EOZA 3QO9A 3MABA 4JK1A 3PY8A 2ISOA 5KG0A 4M45A 2Y1IA 2VANA 5CR0A 5KT7A 1L3VA 1IXRA 5C5JA 2E6LA 4M9NA 1C1AA 3L3VA 1IG9A 1VSIA 2MUTA 4M2YA 3RMDA 1HPZA 1U9LA 4RPYA 2YKMA 4Z6EA 4M3XA 1Z26A 2FMPA 2DFEA 5DQGA 5HNKA 1TK0A 3GDXA 1U4BA 1KFSA 3OYHA 3TAFA 4HCBA 8ICUA 1GOAA 1TKXA 5KT3A 4RQ5A 9ICNA 5CHGA 1ZQNA 5D3GA 4O3NA 2IMWP 3V6KA 4YD1A 8ICTA 4IR9A 2BKEA 4ZH4A 2G8HA 4JRPA 1BHLA 4NYNA 3MBYA 4PHEA 1LW0A 4RW9A 2XCAA 4YXJA 3C1ZA 4ED6A 4CEZA 1NKEA 4FK4A 3DLGA 2O4IA 4UAWA 2FLNA 3AVFA 5DBAA 3AO3A 5J0QA 5I42A 2FLPA 1W0HA 1ZBIA 4TUSA 3MEGA 4FZZA 4RW8A 4UAYA 1JLFA 4AHCA 1A5WA 3NGYA 3EWAA 3C95A 8ICNA 4IFVA 2FPLA 9ICJA 4DU1A 3GILA 1S9FA 4PA1A 2HMIA 2ASLA 4B08A 4TUPA 4UB5A 1RZTA 2IA6A 3C6UA 1BPYA 2BHNA 5HRRA 5JS2A 4ICLA 4ED3A 4YNQA 1KFDA 1RT1A 5J2BA 1D8LA 4KTQA 1SV5A 2D0CA 1VSJA 3RMCA 4P4OA 1JN3A 3QINA 5I3UA 3H7IA 1NKBA 4CJKA 3AA4A 4FJLA 5DDMA 4QWDA 1MSWD 1CEZA 4I2AA 3JPPA 8ICHA 4LSLA 4QZDA 4R66A 4I9QA 4KREA 3A2FA 3V1OA 5IIIA 3VA3A 3Q8RB 4JS5A 8ICWA 4RUAA 1ZQHA 4BWMA 4KLOA 3GV7B 1BPBA 7ICNA 2B4JA 2M9NA 2IDOA 1XSPA 3H40A 4J9LA 2ETJA 3TAQA 2DTUA 4RNOA 1BVSA 3SV4A 4DU3A 5DBBA 3V9WA 5KRSA 4CJQA 1X9WA 9ICGA 3QEXA 3HVRA 4E0DA 4J9NA 3SYZA 4F5RA 4XIUA 2HVIA 3DRSA 4B9TA 4O5CA 3SNNA 3SUPA 1BPDA 4B9UA 4DTOA 1RDCA 8ICCA 1HNVA 4O5EA 4F8RA 3IRXA 4QZIA 3DOKA 3ZT2A 3RJKA 4FM1A 4J2BA 4QW9A 3RRGA 2KW4A 3OS2A 1YT3A 3MR6A 2J6TA 4RW7A 1NOZA 5J0TA 3SQ0A 2NRZA 5KFKA 2XC9A 4UB4A 3V9XA 1RXWA 1ASUA 3RBEA 4J2EA 4QWAA 4DF4A 2OZSA 3TFRA 3MEDA 3GIKA 4AILC 3LPUA 4RPZA 3MR5A 1RTHA 4H4MA 4O5BA 1C1CA 3L2RA 4M42A 1D9FA 1ZQAA 3K57A 3ZDEA 4I27A 3RJHA 7ICPA 9ICEA 3DLKA 3M8RA 4H8KA 2I9GA 3V7KA 1JLBA 3MDCA 4B8AB 4DL6A 4I9LA 2NRTA 4CGHA 4L8RB 1Z00B 2A1RA 2KQ2A 2YV0X 3ISBA 3DOLA 4KLTA 4OGEA 1RYSA 3QERA 4H4OA 1YTAA 2BPFA 1BQMA 2R8JA 5D4BA 3FFIA 2W9BB 5KG2A 4BDYA 2NRXA 4F4WA 5KFVA 3SCXA 4NYFA 4NCGA 4CEDA 4J9QA 4CJ5A 1IKYA 4DS4A 4YD2A 5J0PA 5J0XA 4HUFA 4RUCA 4M3TA 3S3OA 3V1QA 4KB0A 4UB3A 3OJSA 4RT2A 2NUBA 1ZQSA 5CYMA 4CF9A 1IH7A 1BI4B 4ECTA 2RN2A 3V81A 2ZUDA 3ZD8A 3AV9A 4FW1A 1QSLA 4KLUA 2IHNA 1BQNA 5DGAA 5KFRA 4KHSA 1U04A 4QZEA 1ASWA 2G8FA 4DL2A 2WONA 4J2DA 4DQPA 4FM2A 3MGIA 1HMVA 5CP2A 1VRTA 3PNCA 5KT5A 4NCBA 9ICRA 1JIHA 1CXUA 2FMQA 3AVAA 5J2EA 4DOBA 9ICVA 3TR8A 2X6SA 1CZ9A 4C8LA 3NTUA 2P6RA 3SQ2A 4FZYA 1TV6A 4N56A 2DFLA 1LWEA 5L1LA 3AUOA 4MFAA 1BI4A 4J2AA 3ZSVA 1ZQBA 4B9VA 3HM9A 1QSYA 4ED1A 2FBTA 1DLOA 1TKDA 3EW9A 4CCHA 3V6DA 2KFNA 3WNHA 4CJEA 4CJVA 3KJVA 4BACA 1RTJA 2OPSA 4CFDA 1ZQXA 2FBYA 4DOAA 3WNFA 1NKCA 1NK6A 4GXKA 2AGOA 1NJYA 1ASVA 4ECQA 1D9DA 4LH4A 1TAQA 3LDAA 4UBBA 1QE1A 1S0NA 4FLWA 1JLEA 5J0OA 4CGDA 5D46A 1ITGA 3ULDA 1VSEA 5J1EA 3BQ1A 2OPPA 5DMRA 3EYZA 1Z00A 3V6HA 4M9LA 1ZBFA 1Y97A 2QXFA 2W8LA 4FJHA 5J0SA 5J0UA 5L1JA 2V4RA 5KGWA 5EU7A 4EBEA 4PUOA 1S5JA 3ALYA 1EP4A 2MUTB 8ICQA 4O3RA 2KZZA 3OHBA 1B9FA 4NLNA 4HUGA 3RAQA 2P5OA 2OYQA 1ZQMA 3RMAA 4LZDA 4QWBA 1JLCA 3AA5X 2G8KA 1JLGA 3AVBA 2Q0ZX 3HVTA 2VA2A 4OVLA 4KN4A 2YNHA 4ELTA 4MEXA 1NK7A 1UAXA 1CUKA 3H4DA 4OGCA 1NJXA 1V9PA 1H38A 7ICIA 3QIPA 4Z4HA 5IIOA 2AQ4A 3V72A 3HPHA 4OKJA 1O1WA 3GIMA 5J2NA 4J9PA 3OJUA 4E3SA 4DF8A 3GIJA 5HMMA 1XSNA 1D5AA 2RF2A 3TFSA 2JEGA 4E89A 5KFGA 3LP1A 2JZBB 3OS0A 1SL1A 4YXMA 3RJEA 3MECA 4FLZA 4CFBA 4CK1A 2LSNA 4RQ6A 2C2EA 1T05A 1BPEA 1L3UA 3ZDCA 3OYJA 2VA3A 4IRKA 3KD5E 1TVAA 4FJ8A 3D0PA 5FRMA 4R8UB 3G6XA 4F4XA 7ICRA 1U49A 1JXEA 5DDYA 5CZ2A 1WNSA 1XI1A 2DPIA 2YNIA 1S97A 3P83D 5J2CA 4NLGA 4QCLA 1EETA 4CHZA 1N56A 3OYCA 5KFDA 1XC9A 3OYFA 4RQ7A 8ICPA 3T19A 3PO4A 1RBRA 4AHRA 4FS2A 5KG5A 4F5QA 4KO0A 3SV3A 3E01A 3OYIA 4DTJA 4K8ZA 1GOBA 3RJFA 3TAGA 3OS1A 9ICFA 3LAMA 1J53A 4M3RA 5BOMA 3KK3A 8ICBA 7ICHA 1WSFA 4J9MA 1JMSA 3VQEA 2XY6A 1KVAA 1DTTA 9ICPA 5KFUA 1ZQOA 4O0IA 1LW2A 4CJPA 4E7IA 4FK2A 3SZ2A 1JL1A 1WSEA 4AHVA 3K59A 4KLEA 3AA3A 1JXBA 4EBDA 4JWMA 3OYKA 3GFKB 3IG1A 4ECYA 2NRVA 2A1JA 4LSNA 4IQVA 3PW2A 4F5PA 3RTVA 2HHTA 2Z1GA 2A1JB 4MF8A 2ATLA 2EHGA 3VQ6A 4ECZA 1XHZA 4ZHRA 2NRWA 3FYHA 2MAXA 1UA1A 4NY8A 5K14A 2BGWA 1RT5A 2ZUCA 4CESA 3HL8A 8ICFA 3TAEA 4XA5A 1QSSA 3AO2A 5DK5A 4G1QA 4CJRA 1ZQFA 3KHRA 5KFXA 1HUOA 1RT2A 4PHDA 4EYIB 4DTRA 3U3GA 3MGHA 1SL2A 3OGUA 2F1HA 7ICLA 5J2JA 4M41A 3O3HA 2F8SA 9ICOA 5C42A 1TVRA 5J2IA 4DO9A 5FROA 5FDLA 2C2RA 1HRHA 3L2WA 4CFCA 4DTUA 3PR4A 4B9SA 1RNHA 3Q8PB 4KAZA 4FZXC 1C0TA 4IG3A 3G6YA 1RDDA 4W5OA 4OKKA 4JRQA 4KLFA 1BIUA 2W9BA 1TAUA 1EXQA 3QNNA 1S1TA 3LP2A 5DLGA 4FLYA 2H5XA 1FXXA 3ISDA 4DOCA 3K5OA 3TAPA 4AH9A 4C8MA 3PUFA 4JS4A 2ZJAA 4N5SA 3KLEA 5J2FA 3ZT3A 2R8GA 4I29A 1B9DA 1YVUA 1XHXA 3QE9Y 5EWFA 2YHAA 4Z6DA 4DQRA 1LWCA 4F91B 1BL3A 5DG7A 3MFIA 3AVLA 1RBTA 3K58A 3AVGA 4CHYA 3K5NA 1B22A 4O4GA 4X5VA 3K5LA 3VN5A 4FCYA 3H08A 4Q45A 3KHLA 4MFBA 2W9MA 3V1RA 8ICXA 3QNOA 3HYFA 3T5KA 2D0BA 1SKWA 3OYGA 3OYLA 2R7YA 4DTSA 1BPXA 4CGFA 4OPKA 3ZCMA 3OVNA 9ICLA 1A77A 4QWEA 1HQUA 2Y1JA 3O4NA 3HP9A 1B92A 7ICOA 3RJGA 2B6AA 3UPQA 4Y1CA 3SPYA 2KTQA 3TQ1A 4F92B 1HUZA 3TAMA 3VQDA 2JGUA 3ZT4A 4F5NA 1C7YA 8ICGA 1JKHA 2PFQA 4DWIA 2BDPA 4FLVA 5DG8A 3VQ9A 2Z1IA 3PW0A 2BANA 3HPGA 3VQCA 5DLFA 4HUEA 2ALZA 1TGOA 1DOQA 3HO1A 5IIMA 9ICCA 1KTQA 3O3FA 3KLHA 1LAWA 3WNEA 2O4GA 2ISPA 4PGXA 3K4GA 5KFQA 2Z1HA 4LH5A 4KI4A 2VG6A 4M9JA 4TURA 2HHUA 4M3YA 4LVSA 4KHWA 1RT3A 2AU0A 2JEFA 4DSIA 4I2FA 4MQ3A 4ELVA 4R64A 2OWOA 1VSMA 4RT3A 4PGQA 3IS9A 3B0YA 3M9NB 1QQCA 2BGGA 1ZETA 2IHMA 1J5OA 5HP1A 3ZSOA 1C0MA 2VWKA 1X1PA 1RBSA 3AO1A 2KZ3A 2X78A 2QKBA 3V7JA 3G6VA 3DI6A 3LDSA 1IKWA 2UVVA 4QZAA 3KHHA 2ZE2A 4EP5A 4DTPA 1ZJNA 4Y1DA 2PXIA 2W42A 4DTNA 3H4BA 7ICSA 8ICOA 3RR7A 3HXMA 3ZD9A 4QZ8A 3RB3A 4CF2A 7ICJA 3SUNA 5F9NA 4TSXA 4ECUA 1BCOA 3OYDA 4PQUA 5KT2A 1XU4A 4PHAA 2HHVA 3JPTA 5T7BA 1KEJA 1VRUA 1SKRA 1Z3EB 2G8IA 2HB5A 5C25A 4Q5VA 3HX0A 3AU6A 2VG5A 3LP0A 1G15A 3SUOA 1TK8A 4FM0A 2R8IA 4FO6A 5KG1A 2F8TA 5HHIA 3ORYA 1FKPA 1VSKA 5KFCA 4CIGA 2AQ0A 1A5XA 1ZQYA 5KFZA 4M9HA 3RH5A 3K5MA 4YMOA 1T7PA 1BCMA 1I3AA 2B5JA 4ED7A 3MDAA 4N47A 2I1QA 3PW7A 1EKEA 8ICIA 4F93B 4LD0A 2JEIA 3ISNC 3JPQA 2HW3A 4DLEA 4KFBA 7ICFA 3RB4A 5HLFA 4Z4IA 1BGXT 3LP3A 4ED0A 4KKOA 3DLBA 4HTUA 1ZQRA 5J0YA 3ZDDA 3AVNA 4IG0A 1I39A 4DG1A 3AVJA 5KG4A 2G8VA 4KLSA 3NGZA 2BCSA 4DS5A 2BCUA 4CJSA 5J0WA 3C1YA 1N48A 2HNDA 2QKKA 1KVCA 4CEFA 3ZSZA 1WCNA 4QAGA 1K6YA 4M6WB 5KFPA 1L3TA 4OLAA 4JV2A 5BOLA 4MF2A 2AGQA 4FJMA 3PW4A 1XWLA 1S1XA 1B43A 3AO5A 4FJXA 4KV8A 4KLGA 3V6JA 4IQTA 1NOYA 4CFAA 1S1VA 3PX4A 2JLEA 3C23A 1S0OA 1K1SA 4ECRA 3IAYA 4PGYA 2XGPA 4R5PA 1RTIA 1WAJA 4HHTA 3RBDA 5KFJA 4Z4GA 2AGPA 4Z4FA 3NAEA 3MFHA 4KTWA 3I8DA 3GV5B 3F9KA 1RPLA 4B3OA 1RCHA 3NF9A 1JLAA 2V4QA 4ECWA 3AVCA 2F1JA 1HJRA 3EPIA 4QW8A 4GVMA 4QZCA 1LAVA 2JZBA 4ECVA 4KTZA 4RQ2A 4EBCA 2YKNA 1S0MA 4G3IA 3DRPA 3PW5A 1T03A 2W9CA 1SL0A 4ECSA 4ID1A 1REVA 4CE9A 1ZQPA 8ICLA 3MR2A 3PX0A 3Q8SB 3V9UA 2FLLA 2FPKA 3G0ZA 4FXDA 3OYMA 4XRHA 4DFKA 4AHUA 2R8HA 3NFAA 4GMJB 1ZBHA 1L3SA 3JPRA 4FW2A 3NGDA 5DB9A 1LV5A 4RQ4A 1WLJA 4CIEA 9ICIA 5EWGA 4NLKA 1T3NA 3MR3A 1LWFA 4YMNA 3DMJA 4KHNA 2ITGA 3H8JA 1J54A 4RQ0A 1YTUA 5JS1A 3LAKA 3KLGA 2IAJA 3UIQA 4FJIA 5KGXA 1U47A 3QEPA 3AVKA 3BQ2A 4DFPA 1XS9D 4CGGA 4ID5A 4DLGA 1ZQLA 2KFZA 3VQAA 3UXPA 3ZSXA 4M3ZA 4RQ1A 3QZ8A 2Q3SA 2YHBA 2UVRA 4GLXA 1MC8A 5L9XA 4FJ7A 4Q43A 4RZRA 3CQ8A 4KI6A 3VQ7A 4EZ6A 1IO2A 5J2AA 4UBCA 3S3NA 9ICMA 4RG8A 4UQGA 2PFPA 2XO7A 3UXOA 2RDJA 1RBUA 3L8BA 4TQSA 4KHUA 4PH5A 8ICKA 7ICMA 1ZBLA 2XY7A 4PHPA 3JPNA 4M47A 1U45A 4W5TA 4CF0A 1A5VA 2XY8A 3C2LA 1RYRA 4P4MA 3KIOA 4JV0A 2IOCA 4NCAA 3RH6A 3NCIA 4B8CA 3UXNA 2FMSA 4TUQA 1JLQA 3H8WA 3C94A 3GV8B 7ICUA 9ICQA 2QK9A 4K4IA 3HJFA 1S6PA 2BCRA 3NGIA 1KLNA 4KHYA 3LZJA 4I7FA 9ICHA 4Z4EA 4KITB 4K4HA 3GQCA 5HBMA 8ICMA 4DL3A 5BPCA 1S9GA 1RXVA 1LB2B 2HHSA 4E1MA 3NF7A 2J6SA 3TABA 1TK5A 5KFNA 4R63A 4Q44A 4O9MA 3M8PA 4AHSA 3UQ0A 2VG7A 4DEZA 4ELUA 2YNFA 4I2DA 3AVHA 4YQWA 2V9WA 8ICSA 5J2MA 1N6QA 4LY7A 1F21A 3HWTA 1KCFA 3CG7A 4FLUA 4PY5A 3RMBA 4N76A 3PO5A 4E7JA 4GC7A 5IINA 4O44A 3MXJA 3B0XA 8ICYA 3ZT0A 4I28A 4FJGA 3AVIA 7ICEA 3HK2A 4BXOA 3AO4A 3PR5B 4DL5A 4OJRA 4DSFA 1ZQCA 4P2HA 1NJZA 4DL7A 4F4YA 3S3MA 3RAXA 3OSPA 1D8YA 1MU2A 2FBXA 4IRCA 5KG3A 4I2GA 4ED8A 4BE2A 2ZTDA 3P5JA 4IQUA 3V4IA 4B9NA 4CEOA 4YN4A 5KFBA 4YR0A 4QWCA 4M3UA 4GC6A 1RBVA 8ICVA 5J2DA 3B6PA 1J9AA 3M9MB 3Q8LA 3RJIA 4DFMA 4KB1A 3T5JA 3IHQB 3L2QA 4KLDA 2ZD1A 4F3OA 3GIIA 3QIOA 1ZQIA 1KFTA 1IKXA 4DQSA 3Q8QB 3I0SA 4CK3A 2ZQBA 4E7LA 4RPXA 3CM5A 5KFSA 3L2UA 3T3FA 2PFOA 3DM2A 4UAZA 3TI0A 4RW6A 3N4MB 4BWJA 1SZPA 3HPOA 2HVHA 4QZHA 1TL3A 1C6VA 3C5FA 1WN7A 3OSNA 1ZBUA 3NBPA 4FS1A 1WSIA 3EPGA 2HNYA 1UA0A 9ICXA 1HYVA 4CGIA 2Z1JA 4Q8EA 4CECA 4KLHA 1SKSA 3KLIA 3QEIA 5DB7A 3Q8KA 4CEEA 4YFUA 5KT4A 4EEYA 1QHTA 4KLQA 4M3WA 2A1SA 1DTQA 4KRFA 1RILA 4DTXA 4P4PA 4K8XA 4O5KA 2W9CB 4DSKA 2GV9A 3CFPA 1EXNA 1HJPA 9ICWA 3C6TA 3OYBA 8ICJA 1IKVA 1WSHA 2RPIA 3O3GA 3VQBA 3KKRA 5KG7A 5E41A 4I2JA 4QOZB 1KSPA 4FBUA 4KLIA 3RJJA 5KG6A 3L2VA 2AJQA 1XSLA 5SWMA 4DQIA 3LALA 1Q9YA 2B21A 5KFEA 2OA8A 4PWDA 4NM2A 3LZIA 3H8SA 3SPZA 3TANA 1RT7A 3CYMA 4CEQA 4BXOB 1CLQA 4I2BA 1TV9A 1ZQTA 4CK2A 4J9KA 2PY5A 5KFIA 3NE6A 2LYHA 1U48A 5KT6A 2XGQA 3NF8A 3DLRA 1NOMA 2ZTCA 2BCQA 3VQ5A 4I2EA 4CJWA 1X2IA 2F1IA 4YFKA 1UWBA 3L3UA 3PMNA 1Q8IA 5J2KA 3PVXA 3JPSA 4F3TA 2ZJ8A 5KRTA 5HRNA 1T8EA 2D0AA 4CHPA 3VA0A 1CXQA 3ITHA 4RNNA 3QEAZ 5L1IA 3QETA 4CF1A 8ICEA 4YVZA 3VQ8A 2W9AA 1COOA 4QZFA 1KVBA 4CJ3A 1NK9A 3G10A 4XQ8A 4CJUA 3SJJA 4FJ5A 5D49A 1FKOA 4FJ9A 9ICKA 4HVJA 1Q9XA 2UVUA 1NK8A 8ICAA 3NDKA 4RU9A 4BGDA 2GBZA 1ZQDA 2ZTEA 3AVMA 2KN7A 4FLXA 3CM6A 4CJFA 4I2QA 2FBVA 4DQQA 1S76D 4C8KA 3QESA 2D5RA 5HRPA 3CFRA 4I2IA 4IFYA 5J29A 3RH4A 3QEVA 5HP4A 3VQQA 4DU4A 3TARA 3KK1A 2BCVA 4DSLA 5CZ1A 4JV1A 4E1NA 3U3YA 2J6UA 1AROP 5DB8A 3DLHA 5CY4A 4E7HA 2WOMA 3KKSA 2BR0A 3NH1A 1EX4A 4UB2A 3SUQA 2HNZA 1UT8A 3VQ4A 3JPOA 5KI6A 1NK5A 5KFLA 4NM1A 2FPMA 3LPTA 3DLEA 4M04A 4ZTFA 3RRHA 3DRRA 3B6OA 1QTMA 9ICUA 2IC3A 2C2DA 3D45A 3MEEA 4XUSA 4W5RA 3SI8A 3BGRA 2DFFA 2UVWA 1DGSA 4F4KA 5DKWA 3JSMA 3RR8A 1KDHA 4CHOA 4GXJA 4UB1A 4R8UA 5J2QA 5DG9A 4BE0A 4GW6A 3NH2A 3HSTB 1C0UA 2RDIA 7ICVA 1HYSA 3LK9A 9ICTA 4KHQA 3JYTA 1VSLA 5KFAA 1WAFA 4EZ9A 3ZDBA 2PYJA 4BDZA 4OKEA 2FC0A 1X9MA 4OPJA 3T1AA 4CHQA 4YP3A 3SQ1A 2P66A 2E6MA 5CB1A 3PMLA 2X6NA 4J9OA 2IGIA 3F73A 3OYEA 3NF6A 3QEWA 2ZUBA 1RDAA 2OPRA 3Q8MA 3KTQA 4O3OA 1JXLA 5DB6A 3BQ0A 3ZSQA 5HHHA 7ICGA 2XRIA 1UT5A 3ISCA 4W5QA 1UOCA 1BISA 1RT4A 5KFWA 4CJTA 2GUIA 4CERA 3VQPA 2ASDA 4CEBA 3N97B 4CHNA 9ICBA 5JUMA 5J2PA 4FJKA 4ECXA 4CF8A 4K4GA 2W8KA 1ZJMA 3M8SA 2P6UA 3LANA 3HP6A 4EP4A 4IBNA 1S1UA 3P1GA 1S77D 5C24A 4JUZA 3QEBZ 9ICSA 5IIKA 3M8QA 2F96A 7ICKA 3CFOA 2X74A 3QLHA 3ZSWA 1A76A 1PZNA 4BDPA 1VSDA 2BQRA 4B9LA 3OYAA 4I2CA 4ZTJA 4M6WA 4C8NA 3C5GA 2XHBA 4FYDA 4Z6CA 1HNIA 3V9ZA 4O3SA 3KHGA 3MAQA 1WCLA 2BPGA 5IILA 4CIFA 1RTDA 2GWSA 5KFFA 4CJ4A 3BJYA 5F9LA 4TQRA 2C22A 4MFCA 4CGJA 1BPZA 3ETLA 3QZ7A 1BIZA 4RQ8A 2XY5A 4IRDA 4Z6FA 1GOCA 3EY1A 3LWLA 4RQ3A 4M9GA 3AA2A 2E4LA 3C2MA 3MXIA 4O3QA 3KK2A 4Z4CA 4GXIA 4Q0BA 1VSHA 1VK0A 5J2GA 1S6QA 2HHWA 1CZBA 3NHGA 1R0AA 4YR3A 4DTMA 5DQIA
chains in the Genus database with same CATH superfamily
2AXTU 2NYIA 1PC4A 3L09A 2K1RB 4NL5A 2ZJ5A 1HJOA 4Y65A 4L74A 3N79A 4X66F 4O0NA 1S1WA 4HCCA 4DFDA 3OLAA 1Y88A 1BQMB 1WUDA 2EK1A 1ZQVA 1N5VA 2BQUA 4DKWA 1DAXA 3D0IE 4KLLA 5KFOA 4J9SA 2PZSA 5F8LA 3V9SA 2PFNA 1SC3B 1JL2A 2IBKA 3AOCA 2DY4A 1IM4A 4QZ9A 3CVKA 3BO2A 1YTYA 1J5EK 3A3PB 1CJUB 3TSQA 3PX6A 1F5SA 4YG2A 1PJ5A 4MKBA 4CO5A 2VIXA 4AHTA 2FHJA 2WTFA 4JWNA 5IWAF 2R7SA 1SQEA 5L1KA 3M1YA 2VKRA 2P1JA 4R65A 2XI3A 1N32J 4F04B 2GMHA 2RAQA 1H7XA 1E4GT 5ALZA 3BDPA 4H0YB 4H5NA 4QQBA 1M5PC 4M5LA 4K4YA 3CJTA 1GMWD 1F1BB 2BKNA 2W4CA 1MWKA 3ETOA 3EXCX 1NJWA 4DBQA 3D6MB 3C21A 3UVJB 4UOGA 4BQLA 2V8HA 2DNNA 5KAFU 4FK0A 3KZXA 3FDSA 2FQQB 1CG2A 2QMXA 2QW9A 1NGEA 3VAJA 1TE2A 2CNNB 4B3TK 1HNXF 2H3FA 2BE2A 4F4ZA 1M1GA 5HP1B 1ZQZA 3BV8A 3J7AN 5A8RA 3MAAB 1J27A 1RAFB 2VC0A 4ATNA 5EVZA 1X9XA 2Q79A 5ADXA 3ZEUA 3C2KA 4RUHA 2L9NA 3WK5A 3PFEA 4LF2A 4RNMA 4N41A 2ZH4A 3E01B 3RB6A 1KRPA 4Q8FA 4FLTA 2V4JA 1QAIA 2OEJA 2P5GA 2O8BB 3VQSA 3CJ3A 2Z2YB 1OH5A 1NDKA 4DR1K 1ZQJA 5D4NA 4KMUA 2BEFA 2VWJA 3ALRA 1HKBA 2MLXA 1ATRA 2DFHA 4E7KA 2MGZA 1F9HA 3LL3A 4B3RF 4DSJA 2P8IA 8ICZA 3CUNA 4C8OA 2HBQB 1BUPA 4DV7J 3TUZC 2V34A 1KNZA 1IBMF 3EZ5A 5FP0A 2Z30B 2HBZB 2G2YA 4LSLB 1QS4A 2ZH6A 4F26A 1RXOB 1Q5YA 5GIOA 4CLTA 5KFMA 5THWA 4IDKA 4NXZA 4F36A 3ISND 2KHQA 3MXMA 4KPYA 1ZQKA 3HSDA 4OZ3A 1V85A 4PZOA 3OHAA 5SZTA 1HEKA 1PVRA 3I1YA 4USKA 1JJ2R 1BLUA 1XO1A 2NO4A 3A0IX 1NJIT 2WCXA 2WVDA 5M2RA 2MKKA 4NXNF 4NLYA 2EDUA 3NEKA 4LF5F 1AUDA 2E44A 4JK1A 3CCVS 4W92B 2YMQA 2HOFA 3M1VA 3D2FA 4M45A 2Z4PA 4AL5A 2R7XA 2FGCA 1N36F 1COKA 5C5JA 4PG7A 4I64A 1IG9A 2MSTA 2MUTA 4QPTA 1HPZA 1U9LA 2YKMA 4RW8B 2DFEA 2F7VA 4C80A 2LMRA 4WFNQ 3GDXA 5GAGP 1RHUB 5J8YC 2RQ5A 2CJAA 1ZC6A 1MG7A 1FKPB 2HQGA 2VPZB 5KT3A 1M5SA 4IH6A 2X1GA 1UMJA 1HL6A 2AEFA 3NL0A 2IMWP 3V6KA 8RUCA 4C4TA 3CJ8A 4IR9A 2QV6A 1FKOB 2G8HA 4LR9A 1JRPA 4JRPA 1P9QC 1BHLA 1C4AA 3CJRA 1C20A 3TUPA 4RW9A 4DCHA 4ED6A 4CEZA 1NKEA 3M2VA 1P9YA 3FZLA 2O4IA 4I56A 4BC7A 2RE2A 4TUSA 4XAKA 2NQPA 2G9OA 2W25A 3BS9A 4RW8A 4UAYA 1VQ9N 1RDWX 1S79A 1A5WA 3NGYA 2CUYA 3OFGA 3CIZA 2VJUA 9ICJA 2IDLA 1Z05A 4C3LA 1S9FA 1IJJA 5CHIA 4Y28C 2DHAA 1SKUB 4B08A 3FZ2A 2Z57B 1PC5A 4LFCF 5JS2A 4A4JA 5F0XA 4ED3A 1YHQN 1ZTWA 1KFDA 1RT1A 3GZ7A 5J2BA 2EFGA 2HCFA 2J0WA 5L8RC 3LDLA 1TL1B 1PSDA 1SV5A 2VGMA 2E1YA 3RMCA 3DLJA 5ALRA 1Z6RA 4U8VA 3IS9B 2RSQA 3HHKA 2OMLA 3DXSX 3H7IA 2DO0A 3R9LA 4JI3J 4AQYK 2DTJA 2RHSB 2HVZA 4FJLA 5EX5A 3IAM9 1WOOA 2GX9A 8ICHA 4LSLA 4AL7A 4FSVA 2P9GA 2D41A 3H45C 2UXDK 4UF4A 3CJSA 3VA3A 5CA5A 2J76E 5F8NA 4LT6A 1BPBA 3W66A 4I68A 2M9NA 5LMUF 3H40A 3VF6A 1NI3A 3J7AP 3TAQA 1YXQA 2I5HA 3W63A 3PYFA 3BGLA 3F5AA 4DPWA 2B6AB 2ZKUA 2MQ8A 2HVIA 3DRSA 3S6EA 1YRXA 4YOUA 3J7ZO 4DV3K 2HFVA 1X0PA 3NNHA 1N32K 4DTOA 5IV3A 2O8BA 1HNVA 4F8RA 4TYBA 4QZIA 1BY9A 1SI9A 4JAXA 3FE1A 4JI5F 3RRGA 1YT3A 4CZIA 1LFPA 2CPDA 2DGOA 4IG0B 4BC9A 3BF4A 2QA2A 3SQ0A 2NRZA 3H8YA 3MR7A 2MZQA 4X4SA 1IUJA 2ZF5O 1RXWA 1ASUA 1OH7A 5ALVA 5HVFA 4QWAA 2E1EA 3TFRA 5LSLA 3GIKA 3A1YG 3MR5A 2AHOB 4AYBF 3M1FA 4O5BA 1C1CA 1F5AA 4CH7A 2WUSA 3K57A 3EVWA 3UFCX 4V1Ak 7ICPA 3RJHA 3FKBA 1UW9A 4H8KA 5AKYA 1JLBA 2J0QD 1IQZA 2XMVA 4B8AB 3VGTA 3WX8A 1S57A 1R3NA 1L6NA 2NRTA 3NS5A 1Z00B 2A1RA 1N0UA 2KQ2A 3ISBA 2YV0X 4KLTA 4OGEA 1RYSA 3KLVA 1YTAA 2R8JA 5AKHA 4NOHA 4V19S 1X7VA 2L9DA 4QS7A 3FFIA 3R27A 4P0PB 3TEGA 1NMDA 4CEDA 4CDIA 2Q31A 3NRBA 3ZZUA 3VAHA 1HBMA 1XNQK 4RUCA 4M3TA 1MA7A 2QLWA 4UB3A 4TY8A 4PPDA 1IH7A 3TA0A 1VS3A 1BI4B 1KKXA 5AK3A 2JFDA 2J7UA 4HVZA 2RN2A 2D3O1 3BEGB 3ZD8A 3MPYA 2BV3A 3FNNA 2D0PA 3AV9A 5FPNA 4U67L 4KLUA 2O8CB 1Y3JA 1Z19A 3UDCA 3UB5A 3UM9A 5KFRA 1FNXH 4LFBJ 1U04A 4KH5A 2JRZA 2WONA 4GMKA 2XS7A 4J2DA 3C6HA 3L7PA 4FM2A 1QQMA 3N0VA 4LC9B 1VRTA 4MAKA 5F3TA 2J7WA 4NCBA 2RUGA 4DR6J 1JIHA 1CXUA 5DDPC 2DNZA 3KYLA 9ICVA 4JKGB 1OYEA 4WZMA 2LKYA 4C0ZA 4Q0BB 2APOA 1TV6A 4N56A 2LM4A 1ZZFA 3E51A 3LH2S 5L1LA 4I4BA 4DV3J 3ZSVA 2MJNA 3C46A 2FBTA 1DLOA 2AA4A 3I6PA 1W7AA 2CQPA 2KP7A 2K4EA 5BYRA 3MD1A 4CCHA 3V6DA 1X3MA 2KFNA 2O8DA 1H72C 3GJRB 2BUPA 4DOAA 1NJIO 1NKCA 2BA9A 4LH4A 2ZH3A 1PBAA 4TY9A 1NU0A 2LP4A 1SXEA 2DNLA 5J0OA 5GVQA 2GX8A 3QGGA 1ITGA 3ULDA 5J1EA 2EAOA 1ZAWA 2YNIB 5DDQC 4M9LA 3MM8A 3KFUF 2QXFA 2V8GA 3DOMA 5J0UA 2V4RA 5KGWA 1RM6C 2YKMB 3ALYA 2JV3A 4GRSA 3NVKA 2WMMA 3KWMA 1U2FA 4HUGA 5CAAA 4OJ6A 3RAQA 2OYQA 2QLBB 4LZDA 4B02A 4WU3A 5ETOA 2W4PA 1H2TZ 4Y2RA 2CQ0A 5IWAJ 2YWWA 4MEXA 4QIVA 4KR0B 4DV4F 1XO0A 3PSPA 1V9PA 2E66A 4FYWB 7ICIA 3MX2A 5IIOA 2AQ4A 1AT1B 1F0XA 4KJIA 5C2CA 5EE9A 3ZO7A 4OKJA 4DHVA 4C23A 4J9PA 4EK2A 2CXYA 1OSCA 2K3KA 4DF8A 4A8OA 2WAQD 2RF2A 1E6YB 4USTA 3KMSA 4CBUA 4NLRA 3LP1A 1FEHA 2FJAB 2IM1A 4ID5B 2QWRA 3OS0A 3CCZA 1SL1A 5AM5A 3MECA 1VQLN 5AXMA 1S4FA 3IMQJ 2QMWA 2WF7A 1DZ5A 2UXCJ 2E3TA 1L3UA 3OBIA 5M1FA 3ZDCA 3OYJA 4CZLA 2VA3A 3A3NB 2RS8A 1NH7A 5FRMA 2I5JB 3PIOQ 5MLCV 2IOHA 7ICRA 1JXEA 5DDYA 4BBYA 3HSGA 2OFHX 2OMOA 1WNSA 3P83D 5J2CA 4NLGA 5LL6d 4J91A 3MI7X 4S0MA 4L73A 4K2XA 1RBRA 4TNOA 1X5PA 5DS7A 5ALDA 2DUYA 4F5QA 2K06A 3E01A 2XMUA 2LEPA 3CD5A 4ZJOA 1OVYA 2WSFC 3N9UC 4FWKA 3DLLQ 2O8DB 3TAGA 1FWPA 3OS1A 2K4IA 9ICFA 2O3DA 1AXQA 3VEXA 4HDHA 7ICHA 2HGMA 1WSFA 4ZLJA 2QRRA 1Q7YT 4ILRA 3QRPA 3ET6A 5ALOA 1ZQOA 2XMKA 1XUPO 3IBPA 3MAAA 4FK2A 2B9XA 4ZN3A 4P9SA 1JL1A 3CETA 3IC1A 1R0BG 2VBYA 4MKYA 4EBDA 2KSOB 3OYKA 2DVIA 4CIOA 1U6ZA 3TW0A 2FJVA 3ZX0A 3X3UA 4HHJA 4F5PA 1Z1ZA 2A1JB 1Q95G 2L5YA 3G8QA 3VQ6A 1G4CA 4NYOA 3NASA 4ZHRA 5HN0A 3JXUA 5AIAA 4Y2XA 1TU0B 1YVNA 4NEYA 4NY8A 2IRUA 5K14A 4GVLA 2BGWA 1RT5A 4EHUA 2DKXA 3H1VX 1HNWF 3HL8A 2WAQC 3O9QA 3CCEN 3LVVA 1YSJA 5KFXA 2V8DA 3R3LA 2LFVA 1VLOA 3THYA 3O3HA 2F8SA 1Q86T 2IPOB 1KAZA 3L3FX 3M6KA 5C42A 1YZ7A 3HTVA 2IJRA 3EEQA 4NA3A 5FROA 1HRHA 2ASMA 5EDWA 4B9SA 4GV9A 1HBNA 3M2RA 4BGAA 1KOOA 3HRGA 5AQZA 4FZXC 1XIQA 1KTVA 4W5OA 4OKKA 3BM7A 3PIOL 4J7CA 2G4BA 3M6VA 3Q8YA 2H5XA 3K5OA 4AH9A 3PUFA 4L3QA 5EGYA 5FD1A 3WEEA 4QYRA 1N5QA 3ZT3A 2R8GA 2CXEA 2QL5B 2GAGC 1SJ1A 1OMSA 4AM6A 4DQRA 4DR1F 3K8WA 4OPHA 5KAIU 2QA1A 4O4RA 1K8AT 4ZLPA 4M5MA 3X1LB 5BPLA 3K58A 1TUYA 4JNEA 3UNGC 1ZRNA 4CHYA 2UUWA 3K5NA 3FMWA 4O4GA 4X5VA 4NJ8A 4J90A 2KV2A 1H0HB 3VPZA 4JI8J 1IV8A 2X1BA 8ICXA 2W4DA 3VV2B 1U8SA 5KL8B 3U26A 1SKWA 2YNHB 4DV5J 4ZPTR 4Y2QA 3HHLB 4LUBA 1WTBA 4B9QA 3MN9A 3ZCMA 2A3JA 3KLHB 4RCHA 1A77A 3VCBA 1HQUA 5A0YB 2EBGA 2AJ0A 4DZDA 3DRSB 3HP9A 7ICOA 2V8PA 3RJGA 2B6AA 3UPQA 3OTOF 3T6BA 3LPEA 4FYVB 2DR8A 3SPYA 4YY3J 4IO1A 2LDIA 2ZXIA 1HUZA 2QYCA 4DUTA 1Q7LB 1SS6A 1C7YA 1JKHA 2OCEA 3M8QB 4DWIA 4FLVA 2BANA 1BA0A 4JYAJ 2COLA 3A0BU 1SQKA 3OTCA 1U25A 2IDEA 2MRLA 1FNOA 4NXMK 3D2EB 4O8UA 2ZIUB 2DNMA 2CQ2A 1W2IA 2VG6A 4M9JA 4TURA 2HHUA 4M3YA 1RG6A 2DQNB 1RT3A 2AU0A 3QJLA 1QVGM 3WIUA 4I2FA 4DV1K 4ELVA 1KQSM 4YDDB 3M9NB 4JI0F 3LTOA 1ZETA 4N8OA 3ZC4A 5H9FJ 4QIGA 3BSCA 1KOHA 5AKZA 4FPBA 5GAHP 1C0MA 5F2RA 1UVIA 4NX9A 2G06A 2VZ9A 2YNGB 2A5XA 2WF9A 4FL9A 1IR0A 2Z8QA 3JS6A 3TZXA 1KHWA 3KHHA 4DX7A 3KZBA 2WTUA 4EP5A 4DTPA 2CJKA 4CE6A 3EICA 4QZ8A 2YJFA 1LKYB 1PIEA 3FBFA 3OTQA 5B0BA 3OYDA 3TJ8A 3O2IA 3QBWA 4JMUA 2HHVA 3R7NB 2PMHA 3IDWA 1P7DA 3O3LA 1WHVA 4ZCIA 3AU6A 3LP0A 1WC6A 2CPRA 1TVRB 4CI6A 1FXDA 1IKYB 4FO6A 5G5GA 3F2KA 3VF2A 2BW7A 4KSEB 3K2YA 3CJ0A 5AE3A 2CVIA 1TKXB 3WIVA 1R89A 1IN0A 1VSKA 1SUQB 1URJA 4P10A 3AJ1A 2GOLA 2AQ0A 1A5XA 1W2BM 4JI1J 1ZQYA 1T9XA 1FRIA 1YG0A 2H3VA 1NSQA 4EFAC 1URNA 1I3AA 2B5JA 4ED7A 3MDAA 3I4HX 1Q1KA 3TR5A 3OBYA 3GPAA 3D6HB 1OUQA 2SXLA 5AM0A 2KI2A 4ER8A 3FZMA 8ICIA 3TRGA 4BRHA 2WW4A 4JEPA 4RNHA 1ZAXA 3ISNC 3JPQA 3QO9B 3OT9A 4QR2A 3QU2A 4HACA 2W6KA 3FZFA 3KWGA 3KK2B 4K41A 4KKOA 2D3ZA 1N60A 1G1XA 5AM3A 1GK8A 3R97A 3ZTPA 1B0TA 4P7TA 1TUWA 3JQKA 1VGYA 3CCLN 4ZP7A 2OHFA 4OFZA 6FDRA 4CJSA 1N48A 4IOAL 3HI9A 3OTDA 4A62A 3J80Y 3UCUP 5J1PA 2YKQA 4KH6A 4NB4A 5D77A 3AJDA 5BR8F 1L3TA 4MF2A 2G1DA 3PW4A 1XWLA 3CJ9A 1B43A 3CD0A 1Q0NA 4FJXA 2D0OA 2ES6A 3QLHB 2Q66A 4CFAA 1S1VA 3ET6B 2KXHA 3LUYA 3IAYA 2XGPA 3J80U 2HLUA 4JI0J 4DDFA 2F7TA 1KBUA 3NAEA 4BREA 3PXGa 3GV5B 1RPLA 5J2PB 4CQ1A 4JP8A 2FXUA 4M7XA 1JLAA 3FEYB 1YI2N 1N36J 3CSKA 3EPIA 4QW8A 1UTAA 5GAEU 2JZBA 1JCEA 3D3BJ 4NL9A 4G3IA 3DRPA 1X5TA 5HMYA 1T03A 4WJBA 4ID1A 8ICLA 2FLLA 1FDDA 2FPKA 4FXDA 3UD3P 4XRHA 4GMJB 4LJMA 4FW2A 3NGDA 5DB9A 1LV5A 1D4XA 4RQ4A 4NMLA 3HULA 4ZVPB 3VESA 2V9KA 1M1HA 1FW6A 3TX8A 1KD1T 1N61A 3QU5A 1T3NA 2QA4N 2WAQF 1LWFA 3DMJA 4KHNA 1S5LU 4EEKA 3OFEA 3CGIA 1J54A 4RQ0A 1YTUA 5JS1A 4BVPA 4A8XA 5HROB 3MGVA 4K4ZA 5EY4A 4DFPA 3LP1B 1ZQLA 3VQAA 4Y2MA 3CIPA 1CJKB 4KX3A 1Q82O 3ID8A 1L7PA 3GG0A 2ZWOA 3I33A 1FRKA 5L9XA 4FJ7A 1KN6A 5JU5A 3MEEB 1XMOK 3QB0A 2FZGB 1ZM3A 2XB2D 4XPEA 5F0WA 5J2AA 2CIMA 3W5XA 3L7UA 3GU0A 3GFZA 1QH9A 1RGIA 2PFPA 2XO7A 4FPIA 2RHQB 2P9PB 2M4MA 2RUSA 1Q78A 2YTUA 1NZBA 2I8EA 4OV1A 3UDVA 3GE9A 2XY7A 3GG1A 4YB7A 4LRFA 3AOAA 4M47A 1U45A 1SAZA 2XY8A 2Q43A 1EP4B 2KO1A 4DR7F 1KD1O 4WFYA 4OI6A 1RYRA 2VUGA 1IBKF 4KMOB 2H48B 2IOCA 4LFBF 2RILA 3RGIA 1V4SA 1ZD3A 1NWKA 3VAMA 5K8NA 4B8CA 1IBMK 3UXNA 1JLQA 3H8WA 1WEZA 3KOOA 2ZNYA 3GV8B 7ICUA 1HMVB 3QU7A 3HJFA 3UD4P 4OHYA 2PFDA 1F3FA 3LP0B 2R7TA 2BABA 2CQBA 4KITB 5EE3A 1N6QB 3EZWA 3IA0A 5HBMA 4DL3A 1S9GA 2RE1A 4MKAA 1LB2B 4E1MA 1TK5A 4R63A 2MTLA 4Q44A 5DO2A 3R1XA 3ZTSA 1HQ2A 3OTBA 1UHUA 1RHKB 1X4GA 3EGVA 2DIUA 2VG6B 3I0RB 3PEJA 1TMJA 2V9WA 2BJDA 5AQOA 4X4PA 3CCWA 1E3MA 1FHTA 5D0RA 4FLUA 3RMBA 3PO5A 4GC7A 5IINA 3DXMA 4O44A 2AWZA 1XR6A 1GNKA 1N5TA 4YHHJ 2R42A 1TUGB 2LXIA 4OJGA 1SBRA 3AVIA 3CCRN 3VGUA 1I1GA 3QFUA 4BXOA 3W2WB 3I55N 4OJRA 2O8CA 1MN7A 4PL8A 4DL7A 2WF5A 3O80A 1D8YA 3C15B 3DWLA 1V4TA 3IAS9 1K8AO 2JRSA 2PBDA 4ED8A 4BE2A 3ENVA 3JQJA 4JI3F 4CEOA 5KFBA 2KKHA 2EWHA 5JVGL 1HQEB 3QYYA 3M4XA 4USMA 3R2CJ 5ADZA 3NRZA 4NLUA 3Q8LA 1HBMB 1G2EA 1ZBSA 3TTFA 4KB1A 1FVSA 4BC4A 3T5JA 4HL9A 5ALJA 2ZJQQ 3JAMY 2B9YA 3HZGA 1JJ4A 4YB5A 4KLDA 1Z4UA 1JKHB 1BD6A 3GIIA 1H1VA 4GIBA 3WQUA 2GZOA 3K5PA 3BS7A 3BSAA 4E7LA 3CM5A 1CJVB 5KFSA 4P71A 3BKFA 1IBLF 2HRTA 3DOKB 3T3FA 3R5BA 4WP8A 3DM2A 1GLAG 3TI0A 4RW6A 3HD1A 1XMBA 4BWJA 4GVBA 1TL3A 1WSIA 3MTKA 2HNYA 5CD4A 4EENA 2WBRA 5AQIA 1KBRA 2M5YA 2G5HB 3KLIA 4QIEA 4IOBA 4H5VA 3I9V9 4GKJF 3DNCA 1QHTA 2A1SA 1FKAF 4KRFA 4NLWA 2MSNA 1RILA 3MURP 4X64J 4DSKA 4UASA 3GFXA 3CFPA 3BN7A 4A57A 3NCPA 1AFIA 5BPNA 3C6TA 2WVCA 5IS2A 3CD7A 3MM9B 2KM8C 4NMXA 4IJAA 3OYBA 2RQMA 9ATCB 1HNVB 2G2OA 3VQBA 3KKRA 3THYB 3O08A 1G99A 4I2JA 4KGMA 3HSJA 4QPXA 1VDVA 3L2VA 1WKKA 1XSLA 4EO8A 2C2MB 5IQQA 3LALA 2B8PA 3VMFB 5KFEA 1YKWA 4OLPA 3VC8A 2LYAA 3MTJA 4RUBA 1TUVA 4QOTA 5D78A 3UD5A 4RO0A 3H8SA 5LJWA 3CYMA 2E29A 1AYEA 2UUBK 4CLSA 1CLQA 4ZHRB 2P9LA 1OXJA 1VC5A 3C6UB 3NE6A 2UXBK 3LGNA 2X1FA 4YHHK 5B5EU 3LM2A 1U48A 1QQ5A 2XGQA 2ZBCA 3QAEA 3GYNA 2KFYA 1Q5VA 3DLRA 2A1AA 2F1IA 4WF9L 2RVJA 5G4DA 1SJQA 1F0MA 1DXSA 1ZZNA 4RR5A 4Y2YA 3SBTA 2QWMA 4LFAJ 3J7ZT 3ULEA 1UKUA 4US9A 3UKUA 3DKDA 3FQKA 4NI2A 3MAHA 4CJ3A 2CGKA 3EZOA 2UUAF 2AW0A 4LF4K 4TLRA 1VQMN 1V3SA 1KDNA 4FYYB 4NWBA 1DK2A 1WACA 4CO2A 8ICAA 3NDKA 1LNQA 1T0TV 3IP0A 4BGDA 2GBZA 2ZTEA 1EKSA 4MJKA 2D5RA 2KSOA 2GV1A 1B0PA 3TEHB 4OZLA 1JLFB 2ZH2A 4PXCA 3IM8A 3VEYA 4IH7A 4CYUB 5LOQA 5C24B 1YITS 1U8WA 4P0QB 1R6YA 3R7SB 3AXMA 4KH0B 3DLHA 1BOTO 3N6MA 4IC9A 1RDRA 3KKSA 2EI5A 3AOBA 2HHHF 3QBXA 4OHWA 1UT8A 3W62A 5RUBA 3TVYA 4H0XB 2E5LK 2BE9B 2WBNA 3D67A 3PACA 2Q6CA 4AQYJ 2OANA 3RRHA 3DRRA 3B6OA 9ICUA 3UR3C 4ZLNA 2C2DA 4XUSA 3SI8A 1BHNA 3CDBA 4DB3A 1DGSA 1U6FA 1M0SA 5E3RA 4DJBA 2A40A 4Q2LA 1X60A 4CHOA 5IM0B 4UB1A 4MLEA 5J2QA 3TZZA 4OX9F 5LMUJ 1GLBG 3NH2A 5KPTA 2EPIA 4OZJA 3J81Y 3HSTB 4RQMA 2LVWA 1C0UA 1IKWB 2E8OA 4BHQA 5ETRA 2DR6A 5KFAA 1FERA 4FYXB 2VJVA 3M6XA 4FXVA 4OYAA 4RWXA 3A8KA 2WSEC 3OTOK 5EUHA 1E6YA 4IWVA 2FDNA 1DFDA 4CLYA 2V7YA 3SBGA 2NV3A 2R7UA 3BKUA 3SQIA 2OPPB 1QDUB 2YHYA 2UXBJ 4TYAA 1JXLA 5DB6A 3KUHA 4ETXA 2G2ZA 3ISCA 1JLEB 3GCXP 4FF2A 1UOCA 3E66A 4CZFA 3AXKA 4CJTA 2K4HA 1REGX 4CERA 2EG2A 3N97B 1OW5A 4BR7A 3N5FA 2M52A 4RBUA 5JUMA 4NRTA 5EX3A 2V8VA 1YJNN 4GKKK 5KOXA 4MK7A 4C11B 1ZJMA 3HP6A 3TACB 2BANB 1NEEA 1S1UA 3P1GA 4IEEA 4TXSA 3EM1A 9ICSA 1NLVA 3M8QA 3OD2A 3UMCA 1R0CB 4A5AA 1N0VC 4DN9A 5AQYA 3GFHA 1PZNA 5M1PA 3BZQA 2BQRA 2I38A 2KKVA 4I2CA 1JI7A 2N4CA 1XBWA 4ZTJA 2A3ZA 1H3DA 4M6WA 3CERA 4DV0K 1ZM2A 1ZOLA 3C5GA 4LF7J 1YRUA 5B0EA 4O3SA 3H2LA 2PA8D 2Y0SD 2BPGA 3RW6A 4DPTA 4OJLA 2CA9A 2WRMA 1RTDA 2GWSA 3WC0A 1RBLA 4AM7A 2BDUA 4DHYA 3BJYA 4TQRA 4C0BA 3EVOA 1B4FA 4FXWA 3G87A 5F8JA 4PXDA 1BPZA 2ZEJA 3ETLA 3H46O 3PYGA 3AT1B 2XY5A 3HKZD 3QRRA 1GOCA 2KHCA 3EY1A 2NYHA 1M5VC 5AQWA 3AA2A 2B4PA 1KKHA 1WBBA 1TP7A 5D0HA 3EUB2 1VAZA 2F63A 2LDYA 1UVKA 3FUYA 5ETVA 4Q0BA 4Z4CA 4MIBA 1S6QA 2YQ0A 2BE2B 1PBUA 1L7MA 3UO0A 3R1HA 3IM1A 1VRTB 1S0VA 4KLMA 4OLBA 1AW0A 2DH7A 4OJPA 3NVZA 2G8UA 1ZQUA 2BTFA 2WSCC 5FRNA 1KW4A 4GKJJ 3KD1E 2OPQA 1N34F 1R59O 1E6VA 1EQ0A 4YMMA 1S10A 5GAGI 4C1NI 1S1TB 3L9ZA 2DEJA 3VAGA 4B17A 1ZA1B 2UV8G 4CRJA 5A8WA 4E19A 3IN5A 2YXLA 4KHPJ 5AZJB 3WNGA 5HRSA 2O5DA 4QZGA 4WQ5C 3A13A 5HL7L 1L8LA 2KKPA 4XK8C 2EC2A 4IKFA 4BC2A 2DR5A 1CJUA 3K9KA 1RDBA 1K44A 1WUAA 1YAGA 1QZ6A 3ZT1A 3R5GA 2DHXA 2KOBA 2UUCF 2QTWA 3ED5A 3RWUA 5B7WA 4GVEA 4K8RA 8ICRA 2RJZA 2E2NA 1ZQGA 1F60B 1JX4A 3CJKA 2RD5C 4ZP6A 2PI5A 5AJ3K 2HVEA 4JI6K 1RT6A 4RW4A 3T6JA 1MQ2A 1MN9A 1S1WB 2MMYA 2BH1A 3KZIU 3KLGB 2O6KA 3S9HA 2QN6B 1T4GA 4USIA 4IR1A 3W60A 4JI2J 2GHVC 2JGAA 5J2HA 3E2EA 4M94A 2HHQA 3H5UA 3J7YU 2C1EB 2MQPA 1J5OB 2OTLS 4Z7CA 4A47A 2DYAA 2M8HA 3QWUA 1BG3A 1NUEA 3F5EA 3FC4A 4NYZA 2RRDA 2R7VA 4K0KF 3WKAA 4YOVA 2DPJA 2G8WA 4RJVA 1U1PA 5CJ7A 5KFYA 4WBFA 5HK4A 4JBCA 4OYBA 3GOIA 3ZSYA 3SQ4A 4F5OA 4OZ0A 4CZGA 2BKOA 2OXOA 4J5OA 3PV8A 5DBCA 5ETQA 3W9IA 2FY1A 5GADP 1YHQS 3H3NO 4DMNA 4LZGA 1BQXA 3MPVA 3GG4A 1Q16B 5JLFA 2NZ4A 4AYBD 3QT7A 3QNMA 3WKCA 4M0AA 4MT1A 3UNYA 2U1AA 1V38A 1Q8BA 3CXCR 3A5NC 3QAUA 3KKAA 1L5UA 3HSCA 5ALNA 2I5JA 4NLCA 2H3ZA 2CQIA 3RRKA 2IOFK 1SQFA 1YJTA 2E5LJ 5CA7A 4CP5A 3KJNB 1YK9A 5GAHU 3PJXA 2PEBA 2ZKTA 1FO4A 2I0XA 2BPCA 3CDEA 3MMBA 3AD7C 5F41A 3NGKA 2KT2A 2CQ4A 4MN4C 5DZ7A 4HYKA 2P9EA 1J2VA 1Z1VA 3CCQN 1PILA 4IQMA 2FVRA 3L0QA 2MU2A 4I6AA 5D4OA 4DSEA 2UUTA 2JEJA 4RW9B 1FRXA 3K0JA 3OY9A 5J0RA 1NB2A 3UQ2A 2FYXA 3ENAA 4O55A 2NR0A 4KHPF 2GWKA 2HLTA 3PFOA 1JLQB 1RA7A 5FPDA 1C0UB 1W26A 4I0WA 2E6LA 1ZTTA 1C1AA 3L3VA 1VLBA 3P49B 5AM4A 5HMWA 3L4IA 4XO0A 4OHZA 4RPYA 4FPRA 3I56S 1VQSA 1DRZA 4CYUA 5DQGA 5HNKA 1TK0A 1WC0A 2JL9A 3P96A 2ZVSA 1U4BA 1KFSA 3OBWA 3TAFA 1RFQA 2IVNA 8ICUA 3U02A 3D2FB 3GJQB 3KWIA 2B8QA 4DV1F 2N1RA 1VI7A 3B4DA 3S1TA 1D8BA 8ICTA 2V2KA 1ZBTA 1NNLA 4ZH4A 1FIQA 1PYOB 5LY3A 1MNEA 4PHEA 1MDUB 1TTHB 2HNZB 5JJBA 4UOHA 3C1ZA 2QLXA 2BJ1A 3HILA 4UAWA 1OQ6A 3VQTA 5DBAA 1ZM4A 3R9KA 4QYZJ 3BEXA 3AO3A 1Q81T 1NXIA 1T9UA 1W0HA 1GX6A 3KK1B 3S6JA 3MEGA 4CLFA 1VK3A 3KG0A 3VEOA 1JLFA 1P8GA 1B7YB 4AHCA 3EWAA 2IM2A 5IT9U 3CC7N 4DU1A 3GILA 4PA1A 3DXBA 1NSPA 2DGQA 2HZCA 2J8AA 2HMIA 4I2QB 5BREA 2IA6A 3C6UA 5IZHA 1K0VA 2GIQA 3CULA 2ZIVA 2DWQA 2DRBA 4UY8T 3H7HB 1D8LA 2GC8A 3I4PA 2E7WA 1VSJA 3BGUA 4P4OA 4JKHA 2H3IA 5HANA 3PJWA 4U67Q 4TU9A 1NKBA 3CJ1A 3NAIA 1IBCB 2W2MP 3SMSA 3R5JB 1CEZA 5F8MA 4I2AA 3JPPA 4DPUA 1FK9B 3VEZA 4QZDA 1UW4A 1VYAA 1YJNS 2G0CA 3N4QA 2UXDJ 4KH4A 3SFGA 3Q89A 1EAYC 1VLYA 4CNYA 2DF4B 1SXLA 5AKLA 3QPIA 4GFJA 3QGPA 2EZYA 4BWMA 4PEOA 4KLOA 4GKJK 3KUGA 2CYYA 2GLEA 3GV7B 3ILLA 7ICNA 3ZZOA 3L7OA 4P0PA 4MYUA 2B4JA 2YJEA 5K9FA 3R3TA 3D2SA 4I6YA 2OEMA 2BBEA 4RNOA 3MF5A 4DU3A 2JDJA 5DBBA 4U7UD 2CDRB 1X9WA 1I3OB 2ZIXA 1VIXA 1NSAA 3QX7A 4E0DA 2BZFA 3WK9A 2HFSA 3POTA 3QT6A 5B0FA 2PC6A 3Q22A 1Q8KA 3AQPA 2YHXA 4B9TA 2PT0A 2ZIWB 4WYLA 1RDCA 1NGDA 4A2BA 4O5EA 4QJVA 3DOKA 5HO4A 3R5DA 3C6TB 3RJKA 4IH5A 3UVJA 1C1CB 5F0UA 3MR6A 4RBTA 2UXBF 4WK3A 2J6TA 1OH8A 2DH9A 3OLBA 4U6PA 5AQLA 1T44A 2HIYA 5KFKA 2E5HA 1DK3A 3GMGA 5KNIA 3V5RA 2F8MA 4EU0A 3RBEA 3SMZA 3H20A 2OZSA 2E9TA 1RAIB 4HACB 3LPUA 5A8RB 4RPZA 5HAOA 2Z56B 1QD1A 5AKXA 4H0PA 4D3GA 2XMWA 1SH2A 1D9FA 2YX1A 1ZQAA 1FD8A 4LVOP 4GVBB 3NGTA 4DR3F 5AZJA 1DRGA 1IM6A 4X65J 2HVDA 1XNRF 3M8RA 2I6XA 5D15A 3QRQA 4BR2A 4H0OA 2OGUA 2UU9J 3BREA 3MDCA 3W2VB 3GWCA 4K0KJ 2JOQA 1UEVA 3W2WA 3I28A 2H3QA 1HD0A 1SH0A 4H4OA 3MX5A 4B1VA 2Z2ZA 1BQMA 3VGMA 1V9OA 3WU2U 5EHHA 4BDYA 2BMBA 5A2QO 2F8KA 4F4WA 3SCXA 3OVBA 1C0TB 2JMGA 4L75A 4WFZA 3CJ4A 4ZVFA 2Y0BB 4CJ5A 1B0XA 4YD2A 1CVJA 4HUFA 2OPSB 2A2DA 3S3OA 1U1NA 3OJSA 4RT2A 4FN5A 4OMFG 3CNQP 1UFWA 5AQSA 4CF9A 3M8PB 3D2QA 2EXUA 2HBRB 4U8YA 2OKQA 5KL1B 3DHWC 1ATSA 4CM0A 2NXNA 4KGXB 1QSLA 4ZCMA 1YX2A 1NH8A 2YX4A 3PKMA 1YJWN 4QZEA 4Y2CA 1Y9OA 4LF1A 3IG8A 3VCDA 1HMVA 2DNQA 5E7OB 2KVQE 3I8BA 2W1BA 4PKGA 3KOAA 1HKGA 3HKZF 5CP2A 2E2OA 2VQFJ 1OYDA 5KT5A 4V19X 3H1QA 4O23A 2VIHA 1VBYA 4DR6K 4HI2A 3D1QA 3KJQB 2LEAA 5ALQA 2A6AA 3F44A 3NTUA 2P6RA 2QWOA 3SQ2A 4BY9C 1H2VZ 5L46A 2VFTA 8AT1B 3H8MA 1KWMA 1LWEA 3AUOA 4ZDNA 1PO6A 4B9VA 3HM9A 1QSYA 4K5SA 5DZ6A 5T7LB 3DLGB 3U7JA 2F9WA 1TKDA 4DR2F 2MYFA 3QGHA 3EW9A 3KJVA 4CJVA 1RTJA 1KC8T 2W7AA 1WOPA 2FBYA 3J81U 4FWMA 2JC0A 1V6HA 4IFEA 4JB8B 2NRRA 4UBBA 1YZ6A 3IFRA 2YX8A 1JLEA 4U9RA 5D46A 3HVAA 2OJ3A 2LQJA 1VSEA 4X4RA 4ZITA 1MWQA 1NO8A 2OPPA 3KNGA 5DMRA 3MM7B 3H2UB 3M05A 1X4EA 3ZXWA 1Y97A 1ZBFA 1YUWA 4OX7A 3KKAC 3BBFA 4MMOA 4MYTA 4EBEA 4OLOA 4PUOA 5DM6L 1EP4A 2MUTB 4R79A 3O4WA 3OHBA 3TZYA 1K8KB 1ZXIA 2R2RA 2DXFA 3RMAA 2CPXA 5AJ3F 4OI1A 1S7HA 3HCXA 2G8KA 2H5JB 2F4FA 2AYEA 2Q0ZX 4IO8A 5H9EJ 2VA2A 3T9ZA 5ALWA 4ELTA 1ZOTA 2QA4S 5I4MA 2DBBA 4ES2A 3H5XA 1CUKA 4CRXA 2JC1A 2W04A 1RWNB 1O1WA 3GIMA 2HOEA 3OJUA 4E3SA 4PKDB 4M5GA 4I69A 3GIJA 1XSNA 1D5AA 4XPCA 2JEGA 1WOSA 4AXJA 3GB0A 2KIWA 4EX7A 3MXHP 4FZLA 1RAAB 4YXMA 1O03A 2IOFA 1CC8A 4FWRA 1S9EB 2ILYA 3POTB 2MZ1A 2JH7A 4IRKA 3DMJB 1TVAA 3D0PA 2Q1NA 4UQTA 2H65B 3MM6A 2GJFA 3BDEA 4JKAA 1Y4ZB 2Y9UA 3LQVA 1XI1A 1S97A 2F4VF 4B3SK 3OYCA 4I6MA 4LF8J 2E5SA 5LJ3Y 4NL9C 2CPIA 1HKCA 4LR8A 4QNLA 1JUDA 3RJFA 1YBAA 4ZCKA 2IYGA 2ZXHA 3D7EO 3MWTA 3LAMA 1AFJA 2EFNA 3NVVA 4OV6A 1RT2B 3JTOA 5AK5A 2XY6A 1KVAA 2M8DB 3CPWR 9ICPA 3W3SA 2ZJPL 5KFUA 4JYAF 3IBWA 7FDRA 4MTPA 4E7IA 1RT5B 2YBVA 3OL8A 4KV8B 2GO7A 4KLEA 3AA3A 1N32F 4R0JA 2UUCK 4ECYA 2A1JA 3P39A 4DR4K 2CZ4A 2NXCA 4IQVA 3E9OA 5I3QA 2E88A 1BWVA 1RDUA 1ELOA 3CCUN 2M3DA 4YOYA 1BXNA 3V4MA 2GQ2A 2MAXA 2GWJA 2ZUCA 1BQNB 3M6UA 8ICFA 3FR0A 2W2QP 4CLZA 4XA5A 3AO2A 1X4HA 1ZQ1C 1ZQFA 1RT2A 4PHDA 3WXJA 2E8PA 2FF6A 3MGHA 5HQMA 9ICOA 4NXMF 5GTIU 1LOUA 3M6WA 4DO9A 2C2RA 3L2WA 4CFCA 4JOUA 3BP8A 1U1LA 2UU9K 4JI4J 4JN4A 1KONA 3MN5A 3G4SN 1RDDA 1UZHA 4JRQA 1UETA 2W9BA 1TAUA 1WF0A 2WBMA 4OJHA 2XYGB 4TKTA 1EXQA 2B5JB 5TISU 3OW2M 1ICEB 4FLYA 1V97A 3TAPA 1X5SA 4C8MA 4DXLA 2IVOA 4NLDA 2X3DA 2RU9A 1KQFB 4N5SA 3KLEA 1A9NB 2L48A 5J2FA 2GO9A 2QLTA 2ZHOA 1JJCB 4I29A 1B9DA 5MAOA 2DRAA 3CJCA 3TADA 2P9NA 1U7LA 2JLGA 2HHHJ 3PRVA 1IKVB 3MFIA 3AVLA 2E20A 2D74B 1RBTA 1NGIA 2ZBIA 7FD1A 2LQ8A 1YBTA 5ELZA 1B22A 5L39A 2V2ZA 3K5LA 3VN5A 4FCYA 2PA3A 3H08A 2JWKA 1EZZB 3J7Z5 3DFEA 4Q45A 3DGVA 1IQTA 4ISEA 4MFBA 2W9MA 5I3PA 3SEOA 5JXSA 1RWVB 2MY7A 3J81O 2Q1LA 3T5KA 2D0BA 4HR2A 2ZIUA 1BPXA 2VPWB 5C12A 3OVNA 4UW2A 3FCHA 3CXCM 5F3XB 3ETRA 3V2UC 1HNIB 1U1RA 3M30B 4WKRA 1S12A 2G08A 3C15A 2ASOA 4Y1CA 3NXZA 8ATCB 4ZP8A 4F92B 1FFUA 2OI2A 3C66A 3WC2A 2LHTA 4ANCA 2JGUA 5LJ5Y 3JSYA 1HWUA 2PFQA 2RH3A 3FCVA 2BDPA 5DG8A 3B4MA 1F5BA 4W98A 4UB8U 2E7VA 4MHVA 1J5EJ 1TGOA 1DOQA 1RLDA 9ICCA 3OPXA 4A2AA 3FJ2A 2PKEA 1ZS6A 4MO5A 1N33K 4EMDA 1VC0A 2HS3A 3I5BA 1DGJA 4F67A 1N34J 2WVFA 3D2EA 3CRXA 4PGXA 3K4GA 2Z1HA 2I2YA 4KHWA 4ES1A 2JEFA 4DSIA 2J9DA 4K4WA 4MQ3A 4DV1J 1R31A 4PGQA 1KS2A 4O4GB 2AJ2A 1FWKA 1LOTB 1VK8A 2EKYA 5JVHQ 5H9EK 4UUWA 2VWKA 4DX5A 5E3PA 2VV5A 3CQYA 2DCLA 4CH0S 3G6VA 3LDSA 3R2DJ 4QZAA 2NYVA 3KLEB 4A8WA 2N7CA 1ZJNA 2E1FA 3K1ZA 2W42A 4A59A 3H4BA 3P4UB 3HXMA 4CF2A 2JVOA 3SUNA 3HKWA 4IUFA 4PQUA 2R2TA 2W2NP 2DPNA 1KEJA 3EGWB 3SQGA 5HQ8A 3FVYA 2NSBA 1VRUA 1SKRA 1Z3EB 2G8IA 3LYSA 4FM0A 4KHMA 3JTNA 3H98A 5C42B 1X9JA 4O5FA 2F8TA 1QVFR 2B9EA 2XS5A 5GAEP 3H59A 4ZPVR 4EUVA 5A8WB 4LF4J 1MMNA 5KFCA 4CIGA 4J9VA 4XDDA 3SSSA 2GGPB 2NZTA 1E6VB 1TL7A 3CCES 5BRFA 1U2RA 2IVPA 3SQOP 4OX9J 2F2AB 4YMOA 3GYXB 1T7PA 2ZNZA 4N47A 3I96A 1NZPA 3E3XA 1GLDG 3EX7B 2JEIA 1Y00A 4JKEA 4DLEA 4A8EA 2CWKA 1LVHA 3G86A 1DEJA 3RB4A 2MKCA 2XM3A 1BGXT 3LP3A 4ED0A 1A6SA 1RJJA 2JFKA 1VHXA 5E2QA 4HTUA 4OHXA 4K25A 3I55S 3ZZZA 3DYAB 1Y10A 5JVHL 2UUCJ 1I39A 3AVJA 4DR4J 3TUJC 1RYUA 3NGZA 2BCSA 3VR1A 4HWIA 1RA6A 5CYJA 4K4SA 3ZZYA 1KVCA 2IVMA 4ISFA 2RQCA 5GAHI 1NSKL 3DDIA 2A42A 4QAGA 4YUDA 2XULA 3ZZ0A 1NPKA 5BRHA 1U0SA 5CYQB 5LMUK 1O08A 4HEA9 2ZIXB 2C2OB 4OI2A 4C7QA 3AO5A 4KGKA 3V6JA 4IQTA 1NOYA 4RTFD 4NZ0A 4FZVA 3US5A 4X4NA 5AQVA 4PZNA 1RU1A 2O8FA 4R5PA 1WAJA 1NDPA 5KFJA 4KTWA 4BLGA 3IDHA 1NGFA 4DV3F 3VOVA 4B3OA 2M9KA 3ENHA 2V4QA 3QDKA 4JI4K 5L1MA 4AF1A 3G25A 2LKZA 1I51B 1OPIA 5D4LA 4NA2A 4A61A 2HF4A 4ECVA 1XMQF 1G7CB 4C8YA 3PW5A 3W9HA 3AD9C 2XZTB 4CE9A 1GLCG 1ZQPA 3MR2A 2BYCA 3D54A 2MLZA 3M6GA 1RADB 3TKAA 4ZPDA 2OO4A 3NFAA 3JPRA 2D9OA 5AQHA 3H42A 4CIEA 3TVZA 4NLKA 3MR3A 3UWTA 4YMNA 3TYTA 2ITGA 3H8JA 3CDAA 2HGLA 5F8GA 1HNXJ 1Z2ZA 2L9WA 3LAKA 4FJIA 3AVKA 4DOZA 4DV7F 3BQ2A 1XS9D 4KB7A 4CGGA 3CDWA 4WKYA 1L3KA 4ID5A 4NLTA 2KFZA 3ZSXA 4M3ZA 4RQ1A 4DV0J 4JI8F 2YHBA 2UVRA 3CCUS 1MC8A 4KRWA 1NB7A 4LF7K 2KT5A 4Q43A 4RZRA 4F0HA 3QT8A 2EC0A 2Y8WA 2IIRA 3ZFVA 2DO4A 2WVBA 3S7RA 2K60A 1TKZB 4ZJQA 9ICMA 4UQGA 1RGVA 2YI1A 2Z0GA 4G1IA 3UXOA 2QIFA 1BO5O 2RDJA 2KHDA 2B7CB 1HX1A 2RT3A 3LDQA 3L8BA 4BRDA 2XBPA 3NS1A 1WTFA 1H74A 4H54A 1LXJA 1OY9A 3V4IB 1RB0A 4W5TA 4CF0A 1EQMA 2M88A 3N7PD 2Y9TA 2YX7A 2E7XA 2AYMA 3A8IA 4JV0A 3H5YA 1U02A 3RH6A 2ZE2B 1Y64A 5FLXY 5EN1A 4UOCA 2FMSA 2EZZA 1IBMJ 2F4VJ 3OXGA 1ESVA 4IEIA 1QAYA 1T02A 4ITSA 1F6TA 1PVPA 1NPPA 1R43A 1S6PA 1N63A 2RRAA 5M1OA 3NGIA 1KLNA 1NGGA 3LZJA 1JMTA 2JWLA 1XMQK 2V68A 2VG5B 5C25B 1S99A 4K4HA 8ICMA 4BG8A 1U24A 2ZOFA 1Q82T 3NF7A 2J6SA 3M7VA 5CR4A 3C29A 3NKYA 4DN0A 2PEHA 1RQ0A 4BX9C 4O9MA 3MD3A 4E1JA 3M8PA 4F4AA 2JHDA 3I5AA 4ELUA 4LF5K 3AVHA 3NVYA 8ICSA 2HBYB 2FJDB 2ZH8A 1WC1A 4DV4K 2ZZMA 4KBOA 1KHVA 1WKLA 3DI6B 4YN3B 3FAHA 1OJ4A 1T6CA 3MXJA 3F2BA 2P9LB 2CFXA 7ICEA 3HK2A 3PR5B 3M8YA 1N88A 4P6QA 1GXTA 1ZXOA 1ZQCA 2A3VA 3HDSA 3QNWB 3OSPA 1I94F 1IWAA 4I2GA 4Y0FA 3RVCA 3P5JA 1K47A 4B9NA 2B9WA 1CS4B 4A8FA 4QIWC 3ZETA 4M3UA 2ZJPQ 3HHLA 1RBVA 2KNJA 4DR5K 5J2DA 1Y5LB 3DRXA 3W0LA 3RJIA 4DFMA 2C2NA 1RT4B 1GQEA 4F0MA 5B0CA 4FPAA 3IHQB 2G0JA 3L95X 3ONQA 1Q7YO 3MPUB 4BRGA 1UCNA 3G6EN 4QZVB 4RPFA 4K2JA 4F3OA 2PFUA 3PRDA 1ZQIA 1JK9B 3LM9A 1HNZJ 1ZAVA 2FIUA 4CK3A 2ZQBA 4LFCJ 2KG1A 5GADU 5CE3A 2J9CA 1KQSR 4YOXA 5K8PA 1JLBB 3FEZA 1MWZA 4G9ZA 2LQBA 3L2UA 2QJ3A 2L08A 4Y00A 1PKUA 3N4MB 3KJFB 3DM2B 3HPOA 4V19J 4QZHA 1C6VA 3OSNA 4C97A 2OHDA 1M90T 1CJVA 2JH1A 3CJKB 2HBLA 1HYVA 1VDHA 2Z1JA 4IDHA 4FWLA 1R8PA 1WG4A 1C0FA 4UY8O 5DB7A 1WG5A 5KT4A 4KLQA 1EKRA 4UZCA 1Q4RA 1U1QA 3VZIA 1DTQA 4FWOA 1RAHB 1VQOS 4YS2A 5AQQA 4DV2K 3GLJA 2W9CB 3M2RB 4X64K 1HBNB 2AJ1A 2GV9A 1UAWA 4DUZK 2RDDA 3F0NA 1HJPA 2GMLA 3AGKA 3O3GA 4RQNA 1KAXA 5E41A 3RBXA 4QOZB 1KSPA 1SIWB 1WUUA 2GNKA 1Y11A 3QIDA 1M5OC 1X4CA 1HWJA 5KG6A 2FZCB 4BCAA 3OL9A 4XEIA 3THTA 2HAIA 5AK4A 4DQIA 4LF5J 1Q9YA 2KVCA 2OA8A 1GXUA 4PWDA 2O8EB 4DV4J 1RT1B 3S01A 2VPXB 4OI3A 1PK3A 4J9KA 4LR7A 1HWLA 5B8HA 1JROA 5DM6Q 3VAFA 2LYHA 3KG1A 1RACB 2QL7B 2CPZA 3NF8A 1NOMA 2BCQA 1T95A 3TTCA 3VQ5A 1DT9A 4CJWA 3QUBA 5FDLB 1O0PA 3L3UA 2C3YA 3PMNA 3U9DA 1YDLA 1Q8IA 2EFVA 4F3TA 1RLCL 3CMES 2M7SA 3G8TA 3MEGB 2D0AA 3ITHA 2VFSA 1Q79A 3QEAZ 3LOUA 4NLOA 4BRPA 5L1IA 5AI8A 3QETA 4CF1A 2FI1A 1ZD5A 3QSIA 3VQ8A 2YMMA 3P45B 4XH1A 1KVBA 1NK9A 4F25A 3G10A 4XQ8A 4CJUA 1NGAA 5IC6B 1WBDA 2AZ1A 9ICKA 2DY9A 4HVJA 1Q9XA 5TKYA 4U7BA 4HH0A 3UR0A 4RU9A 4UW9A 3QYPA 1S6PB 2V50A 1T94A 3EE3A 2KN7A 3CM6A 2NUHA 5ALGA 2FBVA 4DQQA 4C8KA 3CFRA 1VJWA 4CJ7A 2IVYA 3RBZA 3QMQA 1J2MA 5AFUA 1LW2B 3TARA 1S1UB 1FRLA 3SD7A 4DU8A 4E7HA 3W65A 4AUKA 2DGWA 3BSOA 5CXTA 2WOMA 2WFBA 1X4FA 1FE0A 5KAKA 2KJ9A 2N7YA 1ULRA 3VQ4A 3JPOA 2CADA 1WSVA 4CNZA 5KFLA 2DHGA 4NM1A 5D3GB 2ZG6A 2FY8A 3DLEA 4M04A 1HKAA 1N33F 3ATVA 1N52B 4A8SA 2M2BA 3TOQA 3MEEA 4F4KA 5DKWA 2A0FB 1WB9A 1SWWA 3JSMA 2P9KB 2AX0A 2PMWA 2M70A 4BE0A 3CW2C 3UQSA 4BRIA 7ICVA 2ZJRL 2CVEA 4YB1P 1XNSA 1VJQA 4YOWA 2K89A 4ZVUB 3IR5B 1HYSA 1JLCB 1WAFA 3ZDBA 4WWSA 1GX5A 5BXIA 2Q36A 2UP1A 4ZN1A 4OQJA 1X9MA 2JJ4D 4CHQA 4OPJA 2VASA 3FBCA 4YP3A 1BWEA 3LGMA 5AQNA 4EAHD 3MM5B 1RTZA 5CB1A 2X6NA 4YOTA 5LMNK 2IGIA 3KFWX 4BRCA 5LXYA 3AODA 3JQMA 3GDQA 1MMDA 3PYEA 3ZTRA 3NS7B 3Q8MA 3KTQA 3ZSQA 7ICGA 1PG5B 4PZVA 1UT5A 5AZIB 3BZCA 4BUGA 4ILHA 5M2PA 1BISA 3DRPB 1RT4A 3OL7A 4OI4A 4IOCL 5IWAK 4OX8A 2H51B 2V4JB 3VQPA 4KPCA 3OVSA 3AL0B 9RUBA 1UP1A 1RE1B 2CDQA 1XEZA 1CS4A 2G09A 2OD6A 5J2PA 4GY2B 4C9DA 4FJKA 4ECXA 4DUYF 4OJOA 4R5PB 2FPHX 2N3LA 4K4UA 4NWIA 4CO3A 4IBNA 1U1OA 5C24A 1VQ6S 4UOFA 3M2UA 2KK0A 5IIKA 3NG8A 1SV4A 2OFGX 7ICKA 1A76A 3KDOA 1DJ0A 1S8OA 2GHWA 3VERA 2HPUA 1RWWB 2NPFA 3THWA 1HR0F 1N8RT 3MAQA 2BJ9A 3ZI4A 1KEKA 5IILA 2HZAA 1L8OA 3FFKB 5ALIA 3C3LA 4PKIA 3Q8VA 5GMDA 2NLWA 4JD2B 4CGJA 1NHKL 1BIZA 4RQ8A 2FJ6A 2R9LA 4IRDA 3GYGA 2CAJA 4M9GA 1VBZA 2QX0A 4KGVB 1N5YB 2OLWA 2DGUA 5BR9A 1VK0A 5AI0A 3GL1A 2HHWA 1CZBA 1R0AA 2MXYA 3N01A 2K4PA 2RU3A 1O6XA 4Y2JA 4OZNA 1W9HA 4MEYA 3HFVA 4QS8A 1H7WA 4DV6F 4WTYA 5GAEI 3RYLA 1LWCB 2QMUB 1C1BA 1TFRA 5KFTA 2QARA 3IRWP 4CDGA 2OP5A 3AU2A 3LW5C 4F71A 5B09A 4PPXA 4NRUA 3NH0A 1CPZA 4YDXA 1GFWB 5M1NA 2OPQB 2VQFF 2DXDA 1HYZA 2XCPA 1IG6A 2DR7A 4W5NA 2MZSA 1DGKN 4DUZJ 2ZH1A 4URGA 3QFHA 1FXRA 1ZQEA 4FBTA 4O3PA 1FESA 4IG3B 4ERDA 1QLNA 4UTGA 3TSPA 2WZ1A 4CZHA 3WKBA 1HBUB 1RHMB 3A8JA 1ZQWA 2DISA 3FSIA 3TJ9A 1KQQA 3L5KA 4N8NA 2C3OA 4PG6A 2H54B 3H0PA 1VRUB 2BXJA 1QQOA 4NLZA 2F9JA 4OJ3A 4NZ7A 1TKZA 1SPBP 1S59A 3WXKA 2QYGA 3G9CA 1WYGA 3GR1A 5E79U 4ED2A 1IVZA 1ZQQA 2B6GA 3VZHA 2KZMA 3CIMA 2BM1A 3CJAA 3NY0A 4J9RA 2LYBA 4QIWF 2AMCB 3LWMA 1IIPA 3AARA 3OYNA 2VDIA 2EX3A 1N54B 2LI6A 3NLCA 1S22A 1JCFA 2XMTA 2A6MA 1VQKN 4FJNA 3PSIA 2HWTA 3JAMU 3Q86A 1WORA 4K7QA 4KLJA 5DJBA 1QAJA 1JCGA 4B1ZA 1CQNA 3UMBA 9ICAA 3HW8A 1VOMA 3BQTA 4F3MA 4LF8F 3ILJA 1DURA 3NMUA 5SUHA 4WE1A 1DBDA 2ATQA 2X7IA 3OFFA 5AE1A 4LF7F 4QIFA 5HMLA 1HQEA 5DQHA 3I5CA 3IFEA 1MQ3A 2R8KA 3EE8A 1YJ9S 1DY3A 3J81j 2ROPA 2O8FB 4WZQA 2JZ5A 2KB2A 4CJLA 5B0AA 3ENQA 4B1UB 1TL1A 4PG5A 4KX5A 3LDPA 1JNZB 2XYHB 1GMUA 3AAQA 3C14A 2B0CA 1WI8A 2B56A 4DFJA 3DDHA 2WB1C 1KLMA 4FF3A 2FJWA 1P27B 4OYOA 2H5IB 2HHXA 3JSRA 3TWHA 2YVSA 1R8HA 4K5RA 1RWOB 3IXQA 3NAHA 3JXOA 4URSA 2I6WA 3KK7A 2F40A 2QGFB 1SJ3P 2W2PP 1EWQA 1WSGA 5IM0A 3SI6A 3I0RA 3RZAA 4PL7A 3T5LA 3RB0A 1NK0A 3V7LA 5IIJA 1JB0C 3FSXA 4DG1B 1GLJO 3JB9k 2VQEF 4YR2A 3DYAA 4FJJA 1X31C 3VENA 3ASMA 3G82B 3S8SA 1WWHA 2FTRA 1WDDA 5FLXO 7ICTA 2VFVA 3QWPA 5C7PA 1NK4A 3THXA 2C3UA 1AB8A 1Z25A 3A5LC 4GV6A 5EOZA 1RK8A 4JHDA 2J4RA 4B3MJ 3MABA 2V52B 4CZJA 2ISOA 2CRXA 2Y1IA 2DH8A 2VL1A 5CR0A 2BKPA 1L3VA 4P0QA 3B82A 4FDFA 4M9NA 4USJC 3RMDA 1Y0HA 3K8VA 4DR3K 2W2OP 3PG9A 2VGNA 2KXNB 1Z26A 2FMPA 2DK2A 4WIQA 1HPZB 4OYWA 5EE0A 4IO9Q 4Q7AA 1NGBA 3OYHA 4LRCA 1TUUA 4WQ4A 2E1PA 2XSFA 2EEYA 2E8MA 4EX6A 2IC3B 2ZWPA 1DKGD 1ZQNA 4Z2XA 2E5IA 3MCNA 3CF5Q 3G2XA 4YD1A 1ECWA 1U0HA 5AQTA 1ATNA 2A2CA 1RWMB 4WQ5A 1O5JA 3WK7A 1LW0A 4HKQA 4GO5X 4WPAA 1TFWA 3KMQA 4NI2B 3B8HA 3R9PA 2GAHC 3MCMA 2VJ4A 4LVNP 5I42A 2FLPA 2WB1F 1ZBIA 4X4TA 4LFAK 4FZZA 3ZTOA 2XMMA 3C95A 4IFVA 5FJ4A 1U6BA 2CNOB 1HPMA 1SZHA 1RZTA 2LXFA 2BHNA 5HRRA 3CI5A 2F3JA 2CNLB 2QEXN 1NAQA 5CHCB 3CC7S 2HF3A 1RKJA 4CGZA 2XZWA 3BZKA 3QBCA 5HQLA 2MKSA 1JN3A 3QINA 3G82A 4MKVA 3G4SS 1IG8A 3OUYA 3HVWA 4ED5A 2MHEA 2H1YA 1QM9A 4CJKA 3I9ZA 4C0OC 5L9NA 5DDMA 1MSWD 2HSZA 2AT1B 3CT9A 4R66A 2ZOGA 3WXMB