1NJXA

Thymine-guanine mismatch at the polymerase active site
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njxA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njxA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njxA01
1K1SA 4EBCA 5DDYA 1TKDA 1SKRA 4LSLA 3TR8A 3TAFA 3OS0A 3VQBA 1QTMA 4AH9A 4FLXA 4CFDA 4W5TA 3C5FA 1FXXA 3HPGA 4DOCA 3PW2A 2OPPA 3QINA 2RKIA 1RNHA 5C42A 4B9SA 4FZZA 4N5SA 3QO9A 4HHTA 1QSSA 3S9HA 3VA3A 5J2BA 4AHTA 4Z4HA 4K4IA 8ICNA 3H8WA 3GFKB 4KLMA 3AO3A 7ICRA 3C6UA 3G10A 3OJUA 4DL3A 1JMSA 2AGPA 2FLNA 3LP2A 4RW4A 4UBBA 1LWFA 3SI6A 4M3XA 4KAZA 4KV8A 4FCYA 3ISDA 2DTUA 1Y88A 4CCHA 5KFFA 4FW2A 4NCAA 1F21A 4F93B 5KG2A 2HHXA 9ICHA 4CGHA 1VRUA 9ICCA 3V6JA 2RDIA 3KKSA 3GIIA 9ICAA 1KFTA 4BDZA 3FFIA 5J0YA 1WSHA 2G8VA 4QZIA 2XCPA 1HMVA 4YG2A 1IO2A 5KRTA 1S6QA 3ZDDA 3OHAA 3L2VA 3CG7A 4CJVA 1HYZA 5HHIA 4RQ0A 4H8KA 3RAQA 3QETA 1JN3A 3RTVA 4KLOA 5KTQA 3EWAA 1Z25A 5J0OA 4FJMA 2PFOA 4FM0A 5IIKA 4ID1A 3RR8A 4C8KA 4FK4A 2OPRA 8ICUA 3Q8RB 3MR3A 2XY8A 4UQGA 3RB6A 1BI4B 5J2HA 2A1SA 2XY5A 2F1HA 1KSPA 3B0XA 1TK8A 1ZQMA 2ATLA 1LV5A 1ZJNA 3PV8A 4IR9A 5BOMA 7ICGA 1L5UA 4YMNA 5F9LA 5KFMA 5J2JA 4UB3A 5EWGA 3HX0A 1ZQJA 4EP4A 5J2MA 2JEFA 3VQ6A 2WONA 4AHRA 4CGDA 4IR1A 1T05A 5IILA 3SUPA 3MBYA 4I2CA 5C25A 3RWUA 4J9LA 3RJIA 3RB4A 2Y1JA 3KLEA 1NK8A 2FMQA 1T3NA 1VRTA 3VQEA 8ICMA 2ZJAA 3O4NA 1KLNA 3GIJA 1RT1A 4KHSA 1YT3A 1SL1A 1C7YA 4CJLA 3C1ZA 4FS2A 4KLEA 4QZDA 2IA6A 1QHTA 2YHBA 5DBBA 1Q9YA 3M8SA 4OKKA 4QZEA 2R8GA 3KLHA 1S1UA 1QSLA 3G0ZA 3PX0A 5HRPA 3MXMA 1IM4A 4QOZB 4QW8A 3AO2A 5FRMA 3CFRA 1S1TA 4ZTFA 1TAQA 1ZQNA 1RDCA 4E1NA 8ICIA 1XO1A 4FJ8A 5KFSA 1S0MA 4ED0A 1SV5A 1ZBFA 2W42A 3AVBA 9ICPA 4JK1A 4DTXA 2QK9A 4CF0A 3ZSOA 4F4YA 1U04A 5EWFA 3I0SA 1HRHA 5KFHA 4CEZA 1CZ9A 8ICYA 1KLMA 5DG9A 4GW6A 4E1MA 1ZQDA 3RJFA 1CZBA 5CB1A 4MEXA 1VK0A 2PFNA 3UXNA 2I1QA 3HT3A 2I9GA 2FBXA 1RTDA 4DFJA 1WNSA 4C8MA 5KG4A 8ICSA 3GV8B 1S9EA 3HO1A 5KFGA 3HXMA 3KD1E 3HSTB 3I0RA 4ELTA 4YD1A 2ASDA 2AQ4A 2O4IA 2V4RA 1WAFA 4OGCA 1VSJA 3DI6A 3QESA 3AU6A 3HP6A 4CJRA 2C28A 2HVIA 4DSIA 1N48A 3PX6A 4PHDA 3HW8A 1NKCA 3VQ9A 4DTPA 4Z6EA 4CERA 3K2PA 1ZQVA 5KFRA 4DSEA 4P4PA 1NOZA 3LK9A 4RQ6A 3QIOA 2XGPA 1RCHA 2PYJA 5IIMA 3IS9A 4YVZA 4TUPA 3C23A 2KN7A 3SQ0A 4YMOA 4I27A 3ZCMA 2F8TA 2AGOA 1K6YA 1C1BA 3DLGA 1RBTA 3PUFA 5DB7A 4GLXA 3CQ8A 1EP4A 4EYHB 4MF2A 1WSEA 2IS3A 4M9HA 3DLKA 3V72A 2BE2A 3UXPA 4EP5A 4QZGA 4CJPA 4RQ3A 2YNGA 4OPKA 1S97A 4CJEA 1Q9XA 1SKSA 5IIJA 4DMNA 4Z4GA 3CFOA 4UAWA 3KLIA 3HM9A 5F9NA 2WTFA 3AUOA 3BDPA 3WNHA 5DLGA 3V1RA 4OKJA 5CP2A 4RU9A 1KEJA 3N97B 1ZQOA 3L3VA 4F92B 1JL2A 5KFCA 1VSMA 3D0PA 4DLGA 2FC0A 4KB1A 4R8UB 2YNIA 1UA1A 4BWMA 4M0AA 4PGXA 2PFQA 3AO5A 4F4WA 3C5GA 1S76D 4KHNA 1VSFA 2HHUA 4QZ9A 3MEEA 3MGHA 3IM1A 4RNMA 3F9KA 4FYDA 2ISOA 4FJIA 2YHAA 7ICEA 5CWRA 2W9BB 8ICXA 5DBCA 1MQ3A 1ZQBA 4I2QA 3V6DA 1JKHA 2VWKA 2OYQA 3PMNA 4YP3A 2E4LA 3UXOA 4DQSA 2C2DA 5IIIA 1NK7A 3NTUA 3ZT1A 3KHRA 4N47A 4Z0UA 3VQDA 4IRCA 4ZTJA 5L1IA 2A1JA 1RBRA 3LDSA 2G8FA 3V1QA 5J2DA 1D8YA 4RQ2A 8ICCA 5KFUA 1QS4A 3EY1A 1JLQA 1WN7A 2BGGA 3SYZA 1BPEA 3OGUA 3OYAA 2DFLA 1Z00B 3PW0A 4CHYA 1HJPA 5J0WA 4FLWA 8ICGA 4PHEA 3GV7B 9ICRA 3HVTA 4CIGA 4IRKA 3HPOA 4Q44A 5DDMA 4YMMA 2YKMA 4KI4A 4BXOB 1N5YA 5J29A 3TFSA 4J2BA 3NH1A 4ECYA 4J9SA 4O5KA 4FM1A 5HRNA 3OY9A 4CHOA 5J0PA 3T5HA 3DYAA 2P66A 1NJXA 1QLNA 4KHWA 1RTIA 3HL8A 4XIUA 5KFNA 7ICSA 3FDSA 4ELVA 3RAXA 1ZQZA 1JLAA 1WAJA 4B9VA 4KLFA 8ICQA 2R8IA 4KMUA 5KI6A 2HNDA 4NM1A 3KK2A 3PW5A 1ZQHA 3EZ5A 3GIMA 2ASLA 2HHVA 4E0DA 4XRHA 4P4OA 3KIOA 2KQ2A 4O0IA 4FJNA 5HHHA 9ICXA 7ICPA 1KVAA 1RT5A 3OVNA 2HMIA 3C2MA 4J2DA 4HVJA 4M3WA 2XGQA 1VSHA 3PR4A 1HUOA 2HNZA 3ZSXA 1KDHA 2E6MA 2EX3A 3FYHA 2ZUBA 4KHQA 3Q8PB 3TAQA 1RXWA 4DOAA 3Q8LA 3C95A 1A77A 3DM2A 2R8KA 4M42A 2ZUCA 3T5LA 3DOLA 3OYJA 4DS5A 4O3RA 1RT3A 4CFAA 4M3ZA 2BHNA 3DMJA 3RRHA 4RUAA 3IAYA 4CECA 4PY5A 1BCMA 2XO7A 3O3HA 4DTSA 2JZBA 3JSMA 4O3OA 4KLIA 3Q8SB 1N56A 3NAEA 1TVRA 3C2LA 4JV1A 4BACA 1XC9A 4CGJA 1TKXA 3MDAA 1U4BA 1KVCA 3LP1A 1FK9A 4W5OA 1REVA 3B6PA 4G3IA 1LW0A 5CYQA 1RDAA 3TANA 2W8LA 5IIOA 3LAKA 5KFIA 7ICQA 4CJ4A 4ECSA 4TUSA 4NYNA 4I2BA 5KFYA 1RT7A 5I42A 1N6QA 3BQ0A 4MFFA 4PHAA 3AA3A 2YNFA 4BGDA 5DQIA 3V4IA 1RILA 5HP4A 3SNNA 1ZQSA 3QE9Y 1RT2A 9ICUA 1RDBA 4FZXC 4CIEA 4ECUA 2LSNA 2GV9A 1U9LA 4MFBA 4GXJA 5K14A 3QEXA 2IDOA 4Z6DA 5KFBA 4DFMA 4PWDA 2ZE2A 2IAJA 3BQ1A 3CM5A 5KG7A 2QKBA 3AA2A 5KG3A 3RJJA 2FMSA 3H4BA 4RW9A 1XSPA 3MFHA 5DKWA 3ZDEA 3LDAA 1RBVA 3KJVA 3RH6A 3M9NB 2G8HA 3O4QA 1YTAA 3SJJA 4GXIA 3C21A 1NK5A 2PI4A 2BGWA 1CEZA 2FLLA 1IKWA 4IKFA 3UQ2A 4ECXA 2D0CA 3OYLA 4DEZA 7ICJA 5KGWA 4KREA 4B9LA 3ORYA 4CGGA 1DTTA 1U49A 4EBEA 1D9FA 4B9MA 1JLGA 4CF2A 1I3AA 9ICTA 4KKOA 2PXIA 1L3VA 4KI6A 5SZTA 3ISBA 1KFSA 3NBPA 3OYBA 4I9QA 5IINA 5E41A 2ZTEA 4LH5A 1BIUA 4RPZA 4GC7A 3NF7A 3HVRA 3E01A 2Y1IA 2Z1HA 4ED1A 4UB5A 2R8JA 2LYHA 3OYKA 4DU3A 1KVBA 1X9SA 1H38A 3B0YA 3ZSQA 2G8UA 1BQNA 1J5OA 4O0JA 3T19A 3O3GA 3JPPA 4CK1A 4I2GA 5KFZA 4CJWA 1X2IA 3TABA 4FS1A 5KFQA 9ICMA 5J0RA 3QEIA 5HBMA 3VQCA 3MXJA 5D46A 4FJGA 1RXVA 4O5EA 4O3QA 4UB2A 4ECQA 4ECVA 5BPCA 3V7JA 3VQPA 3S3MA 1TKZA 3M8RA 3QEPA 3AVLA 1ZQKA 4EEYA 5DQHA 4B9TA 1S0VA 1S1WA 4F3OA 1KRPA 2YNHA 2J6SA 3SV3A 2NRWA 4QWBA 4R5PA 3OYIA 1RT6A 3TFRA 4DTMA 4DL7A 2ZQBA 4JV2A 3M8QA 1TV9A 4M04A 5J0TA 5L1KA 3SCXA 2DPJA 3MEDA 3M9OB 3TWHA 2BQ3A 4IBNA 3ZT4A 2AJQA 1B43A 2R8HA 5KT4A 2DPIA 4NY8A 2VA8A 4KLHA 4N56A 5TZVA 3TQ1A 4N41A 2MUTB 4DF4A 3VQ8A 1JIHA 4IQUA 4IQTA 7ICHA 1S1VA 4GMJB 9ICKA 5KGXA 1NK0A 1AROP 3K5OA 3L2UA 3CM6A 2W9CA 5KG1A 2ITGA 3H08A 4O5CA 5DK5A 2Z1GA 2VG6A 4DL5A 3OYFA 3C2KA 5KFWA 1KFDA 8ICFA 1ZBLA 1JL1A 1XSNA 1WLJA 3AVMA 3K59A 4I29A 3LANA 1JLEA 1HNIA 4DTJA 1WSIA 4RT3A 1C0UA 3VA0A 4KFBA 7ICLA 3H7IA 4CF9A 4QZAA 4RPYA 5CZ1A 4CEBA 2OPSA 1IG9A 4RUCA 3T5KA 8ICEA 1T4GA 1VSDA 1RTHA 2XHBA 1CXUA 5I3UA 2Q0ZX 4C8OA 4JLHA 3MR2A 3ZDBA 4QWCA 4IG0A 4RW7A 4DLEA 5KT7A 1VSIA 3P1GA 2A1JB 2Z1IA 1ZQFA 4FJ7A 3QZ7A 1VSKA 1L3SA 4KLQA 2GBZA 5KG0A 5D4BA 2P51A 4KTZA 2XC9A 3JPTA 1HYSA 1LWEA 4BDPA 3H8JA 4HUEA 3GQCA 3UQ0A 4J9QA 3O3FA 4E7JA 4L8RB 1NJWA 1U48A 3NH2A 4Q43A 3AVHA 1WSFA 4HTUA 3S3OA 4H4MA 4E89A 5KFTA 3KHGA 4CHZA 4FLTA 4ZH4A 2PI5A 4NLGA 3AVIA 1BI4A 1ZBIA 9ICBA 3T3FA 4YQWA 2E6LA 4KRFA 4RW8A 3Q8MA 3OYDA 5J2QA 4KO0A 3LWLA 3LZJA 4AHSA 2C2RA 4CK3A 4KPYA 4JWNA 3I8DA 2ZJ5A 1BIZA 7ICVA 3NCIA 8ICKA 4J9RA 1SL2A 4KN7A 3MAQA 4CEFA 3ZSYA 4GVMA 4AHVA 4FLYA 3AO4A 1NOMA 3H40A 1TK5A 5L1JA 3RJEA 5J0SA 3KTQA 1WSJA 5CYMA 1ZQRA 1ZQIA 4KHUA 4F4ZA 2PFPA 4CF8A 5KT3A 1C0MA 4ICLA 1EETA 1C6VA 4KITB 2X78A 4LSNA 3OYEA 4DSFA 4DQQA 3SUOA 2FMPA 3KHHA 2BANA 4DSKA 3RBEA 1GOBA 3OJSA 3AVKA 3NF8A 3V9SA 4ED2A 1BL3A 3CYMA 5HMLA 4Q5VA 1KTQA 4F5RA 1ZETA 4J9KA 3G6YA 1TKTA 4DTRA 1XSLA 3BQ2A 3RBDA 2RF2A 4DU4A 4YXJA 1LW2A 4DL6A 4DU1A 2P6UA 1TK0A 4CIFA 3NGDA 1EX4A 4CHQA 1GOAA 5DBAA 3MR6A 4IRDA 3HPHA 4J9OA 4OVLA 4X5VA 3PO5A 2IC3A 2PY5A 1B9FA 4CJUA 4FJXA 4I9LA 4Q8FA 3QNOA 3V9XA 3RJHA 1SZPA 2JZBB 1A5XA 2I5JA 1RBUA 1B22A 4O5BA 1BISA 4IDKA 4RW6A 4I7FA 3KLGA 3HYFA 1IH7A 4M47A 1RYSA 2HNYA 4FK2A 4E19A 3OS2A 1IKXA 3KK3A 3TAPA 3LPTA 4JS5A 9ICWA 3IHQB 3ZSRA 9ICSA 3U6FA 4TUQA 3AVCA 4ED3A 1DTQA 4KN4A 4RQ7A 1PZNA 4HYKA 1BPXA 4J2EA 3U3YA 2RN2A 3NDKA 3LAMA 2JEGA 3PX4A 5KG5A 4KLUA 3RMDA 4TURA 9ICNA 3VQQA 4QCLA 1VSEA 4M45A 4F50A 3NE6A 4Z4IA 2BCVA 4CEEA 4W5RA 2BR0A 2UVRA 7ICIA 1KCFA 1ZBUA 2KZMA 3OSPA 3RJKA 1U47A 3ZDCA 8ICHA 3TI0A 5KG6A 3P83D 4IFVA 1ASVA 5HLFA 4Y1CA 5HP1A 3V9ZA 4M6WB 2DY4A 2X6SA 5D3GA 2HVHA 2QXFA 4UAYA 3HWTA 3KLFA 1U45A 5KT6A 4DWIA 5DQGA 2HW3A 4OGEA 1ZJMA 4EBDA 3V7KA 1NJZA 8ICBA 1S6PA 3H4DA 5EWEA 1B9DA 3NGYA 4FLUA 5HNKA 1I39A 4ED7A 2HHQA 4DO9A 5DB9A 4CFCA 4E7IA 3L8BA 3RB3A 2IBKA 5HROA 3QEAZ 4O3NA 4CE9A 1NKBA 4J2AA 3ZDAA 1ZQPA 4QWAA 1YVUA 3MABA 2W9BA 5EOZA 4KLTA 5J2EA 2F8SA 2ZTDA 9ICQA 1HUZA 4F5OA 4F4KA 4AHCA 1DOQA 1D8LA 3QERA 3MEGA 1COOA 4F5NA 7ICMA 4KB0A 2VA2A 2BKEA 1Z3EB 3ISCA 2XCAA 2P6RA 4NLNA 1TFRA 5DLFA 2RDJA 4YR2A 4O9MA 3A2FA 4DG1A 3D45A 3MDCA 4CFBA 3TAGA 1S5JA 3MFIA 1CXQA 2BPGA 4ECTA 3AV9A 9ICLA 1A5WA 4DFKA 3G6XA 5J0XA 2D0BA 3M9MB 4FM2A 1XWLA 3RMAA 8ICWA 3V7LA 3KHLA 4DSJA 4J9PA 4CJKA 2RPIA 1FKPA 2P5OA 1S10A 2FPMA 2VANA 1RTJA 1XHZA 3L2WA 5KFDA 4C8NA 5J2PA 7ICOA 4KTQA 4YCXA 9ICOA 4RZRA 3N4MB 4G1QA 2XRIA 4MF8A 4DF8A 1IKYA 1BPDA 5HRSA 4FO6A 3LALA 3E2EA 4FW1A 5J2IA 4RT2A 4P2HA 7ICUA 1T8EA 3JPRA 3VQ4A 1D9DA 4RQ4A 4YXMA 3PMLA 3WNEA 4QZHA 1BCOA 1ZQUA 3ASMA 3MGIA 2J6UA 4F2RA 2W9CB 5DGAA 3V81A 3MECA 4O3SA 8ICTA 3NGIA 4M2YA 1L3TA 2JLEA 4F4XA 2ISPA 1CLQA 4OKEA 4CHPA 1S0NA 4I2FA 2F1IA 1S1XA 4BE2A 2HHSA 2A1RA 4I2AA 3BGRA 4CHNA 3AVAA 3ZT3A 1SKWA 4EYIB 3T1AA 1QQCA 1J53A 1BPZA 2KZZA 4BDYA 4NM2A 3SQ4A 3K4GA 2GUIA 5KFOA 7ICKA 4QZCA 1RDDA 3JPSA 3OYMA 2DFEA 4CK2A 4TQRA 1X9MA 4YFUA 1JLCA 4E7LA 3DRSA 1J9AA 4KLSA 5T7BA 2OWOA 3L2RA 4UAZA 4NLKA 3LP0A 1V9PA 4KLLA 4KLJA 1TV6A 4CJ3A 2VG5A 2ATQA 3RJGA 2B5JA 4JWMA 2BDPA 3CFPA 2ZD1A 4RG8A 9ICVA 2JEIA 4FJLA 4DL4A 3ZT0A 3Q8KA 1TL1A 5J1EA 3SI8A 9ICEA 4J9MA 2BPCA 3RMBA 4M9JA 3K57A 1BHLA 5J2NA 4RNOA 3DOKA 5C24A 2FPLA 4FJJA 1RPLA 4EZ9A 2FBVA 5DB8A 3QIPA 4KTWA 3V6HA 2D5RA 1YTUA 4DOBA 4DTUA 2X74A 4BE1A 2IMWP 3KD5E 3PY8A 5DGBA 1VSLA 4PGYA 2AQ0A 4YN4A 4Y1DA 4F3TA 1UA0A 1DGSA 2DFFA 4LZDA 3IRXA 2P1JA 1C0TA 3JYTA 4QW9A 4OPJA 4QZFA 4E3SA 4B9UA 9ICIA 1JX4A 4TSXA 4F5QA 1UT5A 3SQ2A 2PYLA 3LWMA 2BCSA 3AVGA 4RPXA 3BQTA 5KFLA 4PQUA 3HK2A 4XQ8A 1Z26A 1TVAA 2B6AA 1TL3A 1A76A 1MC8A 3EW9A 1TAUA 3RR7A 3VN5A 4OLAA 1JXBA 3OSNA 4NCBA 2R7YA 3PO4A 4IFYA 1XU4A 3ULDA 4JS4A 3RRGA 2VWJA 3ZT2A 2W8KA 2BQUA 1RYRA 3SV4A 1HJRA 3QEBZ 4N76A 2ALZA 4DQIA 1G15A 1S77D 3K5MA 4DTNA 3ZSZA 5DB6A 5JUMA 5J2GA 5FROA 1UT8A 5KRSA 1ZQQA 3DLEA 4KLDA 1NKEA 4CGFA 3ZD8A 4CGIA 2JGUA 1GOCA 2G8IA 4BE0A 4LVSA 1ZQCA 2KW4A 2FLPA 2C22A 5HMMA 1C1AA 2DFHA 3WNGA 4DFPA 3OYGA 4DQRA 5JS1A 1HQEA 1T03A 4FJ5A 2F1JA 3H8SA 1XHXA 1UOCA 4K8ZA 8ICOA 5C5JA 1Y97A 4Z4EA 3DRRA 4CJQA 4Z6CA 3V6KA 5J2AA 4R66A 3V1OA 3DLBA 4PPXA 3K75D 4Z4FA 4HCCA 5KT2A 1BVSA 3NHGA 2VG7A 4IG3A 2XY7A 3ISNC 5CHGA 1J54A 5BOLA 4IQWA 4M9NA 1ASWA 5J0QA 3K5LA 4DS4A 3U3GA 3QEWA 3MXIA 3PR5B 4Q45A 8ICVA 4M3YA 1JXEA 4CEQA 1D5AA 3B6OA 8ICAA 1UAXA 3C94A 5DG8A 3G6VA 8ICPA 5EU7A 3AVFA 1QSYA 1RT4A 4PUOA 9ICGA 4ECRA 3LP3A 4QAGA 3WNFA 1EXQA 2BCRA 1ZQXA 4NXZA 4NLZA 2BCQA 4ID5A 4AILC 3QNNA 4XA5A 5CA7A 5J2KA 1NOYA 4JUZA 2QKKA 2WOMA 3SQ1A 3K5NA 3NFAA 2W9MA 3SZ2A 3L2QA 2D0AA 3LPUA 4I2DA 1ZQGA 4M41A 4RNNA 4UB1A 2JEJA 4F5PA 3T5JA 2W9AA 4M3UA 4LH4A 1W0HA 8ICRA 4M3TA 3GV5B 4F2SA 4Q8EA 4YR0A 1LB2B 9ICFA 3ALYA 3UIQA 4AHUA 1ZBHA 1TGOA 2MAXA 4QZBA 2FPKA 4QWDA 2B4JA 2IOCA 2ASJA 2GWSA 4W5NA 2MUTA 5J0UA 4ED8A 2M9NA 1SL0A 3EPIA 4KHYA 4PH5A 4PHPA 1DLOA 2ZUDA 1WSGA 1L3UA 4FVMA 1W9HA 4I28A 4JRPA 3F73A 4KLGA 5KFVA 5J2FA 5CR0A 3L3UA 4K8XA 4Q0BA 4JV0A 5KFAA 3S3NA 3HP9A 1ZQEA 4I2PA 8ICZA 3HJFA 1X9WA 4M9GA 3AU2A 2NUBA 1IXRA 2IHNA 2HB5A 3RH5A 4FLZA 4CJFA 3RH4A 3SUQA 1XS9D 1HQUA 1QE1A 1BPBA 3GDXA 3BJYA 4CF1A 4B3OA 1MU2A 7ICNA 2HHTA 2NRVA 3RMCA 2NRXA 3DLRA 4O4GA 4DL2A 3C1YA 1ASUA 4FZYA 4MFAA 4R64A 3OS1A 7ICFA 2B21A 4Z4CA 1JXLA 2G8WA 5KFXA 2VA3A 2Z1JA 5FDLA 9ICJA 1ZQTA 3ITHA 5KFKA 3IG1A 4ZHRA 1EXNA 1ZQAA 2FBTA 4MQ3A 4UBCA 4YR3A 2O4GA 4F91B 3DRPA 5DMRA 3TARA 5DG7A 4W5QA 4GXKA 1T7PA 2KZ3A 1IKVA 4ECWA 4FK0A 1MQ2A 4LZGA 3PW4A 4QZ8A 2KFZA 1MSWD 2YV0X 2BQRA 1NK9A 4MFCA 3OYCA 4RQ8A 5D49A 2KTQA 4FJ9A 3THVA 4HUGA 2V4QA 1FKOA 4WE1A 3DLHA 2OA8A 3Q8QB 4FBUA 4I2IA 1K1QA 3SPZA 3SUNA 4DQPA 4FJKA 4J9NA 3V9WA 2HHWA 1BGXT 4EZ6A 4IQVA 4B9NA 1X1PA 1HPZA 4YNQA 2OPQA 5L9XA 1C1CA 4DSLA 1ITGA 4FLVA 1ZYQA 4PGQA 3NH0A 4CESA 3QZ8A 1NK6A 8ICJA 4I2JA 1ZQYA 7ICTA 1LWCA 1S9GA 4DTOA 3OYNA 5CZ2A 4CEDA 2F96A 2PZSA 4R8UA 3GILA 3C6TA 4YD2A 4CJSA 2ZJ8A 5FRNA 4JRQA 1BPYA 3OYHA 1S0OA 8ICLA 3MR5A 3JPQA 4LY7A 1NK4A 5CY4A 3JPOA 1EKEA 3M8PA 1LAWA 2OZSA 1WCLA 2AGQA 1WCNA 3AO1A 1LAVA 4K4HA 4M3RA 2H5XA 5L1LA 3V9UA 2XY6A 2UVWA 3AVNA 4PA1A 3TAMA 4E7KA 4RQ1A 4OJRA 4K4GA 4HUFA 2BCUA 3ZSWA 2IHMA 3LZIA 2OZMA 4I2EA 3VQ5A 3ZSVA 3EPGA 4ELUA 1RBSA 1Q8IA 3KKRA 4B08A 2YKNA 1R0AA 1ZQWA 1A5VA 4P4MA 5J2CA 3NF6A 1HNVA 4RQ5A 1O1WA 2UVUA 4BWJA 1Z00A 4FXDA 5KFEA 4I2HA 1SUQA 4CJTA 1XI1A 4O44A 4BXOA 4B8AB 4OLBA 4HCBA 2X6NA 4O55A 3JPNA 4E7HA 4XUSA 3GIKA 2V9WA 2BPFA 4Z6FA 1ZQLA 4CJ5A 3NGZA 3KK1A 3PNCA 4NYFA 4ED6A 4YFKA 3PW7A 5CJ7A 2NRTA 1S9FA 4FBTA 2FBYA 3K58A 1B92A 3QLHA 5SWMA 4B8CA 4F8RA 2ETJA 4CEAA 5KFJA 5KFPA 4M9LA 2P5GA 5KT5A 3OHBA 1JLFA 2Q3SA 3ZD9A 4UB4A 4LD0A 2AU0A 4FJHA 4R65A 3QEVA 3SPYA 1UWBA 1CUKA 4QWEA 1BQMA 1JLBA 2C2EA 2NRZA 3AA4A 3AA5X 2UVVA 3ETLA 3EYZA 2KFNA 4O3PA 4R63A 2J6TA 1NJYA 3RB0A 4MEYA 2IGIA 3AVJA 5HRRA 4ECZA 4CEOA 5JS2A 3PVXA 3TAEA 1HYVA 4GC6A 4TQSA 3P5JA 2ZTCA 2EHGA 2G8KA 1RZTA 4M6WA 3UPQA 4H4OA 4NCGA 3NF9A 3VQAA 4C8LA 3VQ7A
chains in the Genus database with same CATH superfamily
1K1SA 3AN1A 4CI6A 1IBLK 5DDYA 1SKRA 1SZHA 4GKKK 4LF6F 2C2KB 2UXDF 2O8CA 3RZAA 3OHRA 1BY9A 3AQOA 1QTMA 2QL5B 4AH9A 4CFDA 4W5TA 4FLXA 3C5FA 1B7FA 2DH8A 1YF5L 2OPPA 2ZOGA 3R1HA 3OT9A 1IR1A 4DR7K 4I6YA 3U1LA 1H2TZ 4OLPA 4HHTA 2ZJQL 4ACOA 2A40A 5L46A 3VA3A 1TUVA 5ALJA 4Z4HA 1X40A 1B64A 1YJ9S 3GFKB 1BLUA 4L73A 3MOZA 1LWFA 5GAGU 3BH7B 4KV8A 4FCYA 2LM4A 3ISDA 1CJVB 4BRGA 4NCAA 1VQYA 4AQYJ 4BRPA 4F93B 5KG2A 4KX5A 4CGHA 1EIYB 9ICCA 2UZAA 3KKSA 3UCUP 5J0YA 1NU4A 2J9DE 4BREA 4QZIA 1HMVA 3I87A 2RUSA 4JN4A 5DRKA 3JAMU 2MHNA 5AM0A 3RAQA 4UT4A 3QETA 1Q7LB 5KTQA 4MIBA 4WFYA 3EWAA 1G6BA 2XO6A 4WKRA 3QRPA 3PHEA 4ID1A 3RR8A 4OHZA 3U1MA 2XY8A 3CC4S 4UQGA 1X4CA 4BC2A 2WOMB 1IV0A 4CYUB 4LF4F 3QNWB 2A2CA 3FSIA 1ZOTA 4DV1K 2F8LA 3D0GE 3VF2A 2D3O1 4UAUA 3HVWA 3R9LA 1J5EJ 4IR9A 1HW8A 2H3ZA 3CXCR 7ICGA 5F0UA 3TKAA 4MK9A 2DNPA 4YMNA 2VFUA 5J2JA 3HZEA 3SDEA 4DV4K 5EWGA 1ZQJA 4EP4A 5J2MA 4DR1F 2E5JA 3ADAC 3QBWA 3AD9C 2MLYA 1TFWA 3M7DA 3GZFA 4J9LA 2UXBJ 1M5SA 4OZJA 1NK8A 2HI0A 2KRBA 2FJXA 5EDWA 1UFKA 5CYMB 5KPTA 1Y3KA 3F2CA 2NZCA 3R97A 3BO3A 1RT1A 2KI2A 1Z1BA 1DLOB 3MCOA 1WUDA 4CBWA 4WU2A 3TA2A 3DFEA 2ZITA 4BGBA 3A8EA 3GCWP 4QZEA 4D3GA 1RKIA 4NL9A 2R8GA 3KLHA 1SH0A 4JP8A 1QSLA 3G0ZA 3PX0A 5HRPA 1VLYA 3HHLD 3SQGB 3KZIU 2UUCJ 8ICIA 1FTRA 2GVZA 3AVBA 2KVSA 1HIYA 4JK1A 4LVOP 4DTXA 2CN1A 2PGCA 1HQUB 4F4YA 1U04A 3I0SA 1HRHA 1JNRB 1Q7YO 4C3KA 4CEZA 1RDRA 2GGPB 1CZ9A 2KP7A 1ZM4A 4NLBA 4O4GB 5E7OB 4GW6A 1M1KT 1ZQDA 3P5TL 1M5KC 4NLOA 5AQVA 5K5MA 1RWUA 1VK0A 1RTDA 2I9GA 4P7VA 4C8MA 4FSVA 5ETPA 4RNFA 5CABA 4IDHA 2ZC3A 1IKXB 4OMFG 3HO1A 3HXMA 2YI1A 2ZBRA 3LH2S 1YBAA 3I0RA 5AQIA 3AB4B 1SB3C 2AQ4A 2V4RA 1WAFA 5HR6A 1S49A 4M5MA 1CJTA 5GTIU 3HP6A 2M8HA 3ALRA 2I9SA 4Z6EA 4DTPA 3NVWA 3P45B 3W2VB 1IBKJ 3CQXA 1ZQVA 3LK9A 4AYBF 2XGPA 1RCHA 5AI4A 3KJFB 2FLOA 3OVAA 2XYGB 4UAVA 4ZS6A 5FLXO 4F4AA 3KUHA 4NXNF 5E26A 1MNEA 1B0TA 4WCEQ 3SQ0A 1R59O 4DR6K 5AI0A 3DLGA 3OTOK 3THXA 4RJVA 1IWGA 1RADB 2YWEA 1WSEA 3D6MB 4M9HA 2BE2A 3UXPA 4EP5A 4QZGA 4CJPA 1FNOA 1YUWA 2RRNA 4WWSA 4IFVB 2YPYA 2QWQA 3CFOA 2CQ3A 3KLIA 1IBMJ 1ZM3A 2A2DA 2IDEA 3E58A 1CPZA 5EUHA 4RU9A 1S6OA 3NGRA 3ET6B 3L3VA 2EEYA 1MN9A 3SBTA 4DLGA 2UXDK 5AQZA 4KGKA 1UA1A 4M0AA 2HF3A 1A0PA 1XNSA 4GVBB 4DPYA 2HS4A 4DR3J 3D2EB 1S76D 3MGHA 1JB0C 3IM1A 2AEFA 3D4JA 3IDWA 2VPYB 4Y65A 1OKJA 3M8PB 3CJ5A 5CWRA 4M5DA 1VJQA 4K5SA 2QIFA 1DFDA 4MIAA 1X31C 4DV7J 1SS6A 3W60A 4LBPA 4IQMA 1UTAA 3CJ4A 3V6DA 1JKHA 1FDNA 5ALXA 2C2ZB 5M1FA 3SK3A 4AYBD 4YOYA 3PMNA 2E4LA 4BR0A 4DQSA 4B3TK 3DLLL 3NTUA 2MKJA 4I64A 2F7VA 3ZT1A 1KVKA 4DR2F 4RWTA 5MLCQ 3BSOA 3VQDA 2FC9A 3TP2A 2A1JA 4NLRA 5J2DA 1D8YA 4RQ2A 5JMVA 3HDSA 3SJHA 4PXEA 4NLQA 4YB6A 3OYAA 2QI2A 4IWVA 4C9DA 5J0WA 4FLWA 4EX6A 8ICGA 5C7PA 3EDQB 3GV7B 1HNXF 2V6AA 3HCXA 1Y64A 4IRKA 3L4QA 4FPAA 3VERA 3TFSA 2WK4A 4J2BA 5AK4A 4XAKA 3M2VA 3QQCD 5T7LA 3KK1B 3FC9A 4YDDB 3DXBA 4LFCK 3MN6A 1LVHA 3NUQA 3AXKA 3NCPA 4C3LA 2YWKA 2GWKA 1F44A 1QLNA 1CJUA 2HFOA 1RTIA 1R7IA 3HL8A 3RAXA 4QNLA 2IBOA 1NBWA 3T1HK 1RCOB 3DKDA 5KI6A 3WC2A 2LYAA 2HNDA 3HSJA 1UWBB 1QVFM 3KK2A 1CSJA 2HFSA 2P9PA 3D2WA 3EZ5A 1RWVB 2ASLA 3X3UA 3MM9B 2R7VA 3AD8C 4K25A 4O8UA 5HHHA 3PNIA 4MDAA 3U1NA 4QR2A 4RL1A 2HMIA 4DPUA 1QQMA 4J2DA 4NLUA 2V7YA 2WSFC 4JI0J 2EAMA 4M5KA 3JS9A 4YB1P 3AGKA 4WF9L 4ILRA 2LLZA 2B4OA 3FYHA 2ZUBA 4LQ9A 4NJ8A 2BBEA 4KHQA 2GJ2A 4DOAA 1FJGJ 3HT0A 1AW0A 4NV0A 3LTOA 4H5RA 1GLAG 2LXFA 1RKJA 1RT3A 4CFAA 3R5GA 1WOOA 2BHNA 1GMUA 5IXUA 3D2SA 4RUAA 1PK1B 2J0SD 4CECA 4MLHA 4RX6A 1EO1A 3HHLA 3NOGA 5BREA 2MKYA 3PJWA 3VEXA 3CCSN 1VS3A 3BSNA 1X5PA 4O3OA 2H9ZA 2BMBA 5M1OA 3FGUA 4DPXA 3C6UB 1JJCB 1XC9A 1HNZJ 4CGJA 2RDDA 1N5VA 2DWQA 2OFGX 2ZIWA 4BRQA 1REVA 4W5OA 5D0EA 5CQGA 5IWAK 1NJIO 5FLXY 9RUBA 5CYQA 1VRUB 1S3XA 2YH0A 2UUTA 2IJFA 3DOKB 5IIOA 3BGOP 1F9FA 4YY3J 2D3OR 3QIPB 2E8MA 4RWWA 1WD6A 4MKVA 3UR3C 1S6QB 2CQ0A 4TUSA 2CNOB 4WFNQ 5KFYA 1W2IA 4B6JA 1LQ9A 2OLWA 1OMSA 3GFYA 3SQOP 3V4IA 3UO0A 3Q0AA 3FEZA 3QE9Y 1RT2A 4NXNK 1FX4A 2N4DA 2OYYA 4FL9A 2LQ9A 2MMYA 1IBCB 4MFBA 5K14A 2DGSA 1UMJA 2L48A 2P9GA 1J2NA 1ZH5A 2ZE2A 4PQUB 3POTB 2O8DA 2B6AB 3BQ1A 2BW2A 3RJJA 2UUAJ 2FMSA 3R2CJ 2K1RB 2PC6A 3ZDEA 2WONB 3HI0A 1RBVA 3KJVA 2NSCA 5AZJB 2IA0A 1T05B 2G8HA 2B4UA 2PFUA 3QRRA 3FSXA 3KLEB 4GXIA 3RSEB 1CEZA 1IKWA 4NZ6A 4ECXA 4H0YB 5AQTA 3OYLA 4DEZA 1IUJA 1Y5IB 4KREA 1ESVA 3J81U 1XQSC 1DTTA 2NREA 4KMOB 1U49A 3T41A 4EBEA 2LA4A 1JLGA 1S1UB 1N8RT 2W41A 3OFGA 3R6GB 1L3VA 2X1AA 2ASOA 3TEGA 1KFSA 2ROEA 4FVUA 1OH5A 1QUPA 3T69A 5IINA 4I1TA 2ZH9A 4EWTA 5D0HA 2L3MA 5I9EB 4NI2B 3ZI4A 4RPZA 5GMEA 4DV0F 3E01A 2Y1IA 5J1PA 2Y9TA 2E7VA 4ED1A 4UB5A 4LQ3A 1F5BA 2LEBA 2CJQA 2CDRB 3OYKA 1APSA 4DR2K 3B0YA 2EI5A 3IWLA 2NXJA 3FBEA 3PXGa 3VZIA 1QH9A 5HO4A 1NHKL 3JPPA 4KE5A 4M5GA 3SMPA 1FWLA 3TABA 5J0RA 3GE1A 3DXKA 3QEIA 1ZTWA 1HNXK 4FJGA 1FCAA 2HOFA 4EEKA 5A6PA 1JCGA 2WFBA 2EZYA 3ID8A 3V7JA 5C2GA 3S3MA 1F5CA 1TKZA 3QEPA 4K4SA 2GO9A 5DQHA 3PFOA 3FCHA 4ZVPB 3W64A 2ZH6A 5DM6L 2J6SA 3TUPA 3IBPA 2NRWA 4R5PA 2HLTA 3B6BA 2XI3A 5B0CA 5ETMA 3IP4B 4DTMA 3SR6A 3W9IA 1X60A 3L0QA 1M1HA 1PYTA 2XTJP 4CNYA 5IC4B 4CQ1A 2DPJA 1EQ0A 2RE2A 2RQ4A 1K9MT 4IBNA 3ZT4A 2AJQA 5KT4A 2VA8A 4KLHA 1VQ8S 3DLKB 3EDRB 7FD1A 2YNGB 2QA1A 4OX9J 3MDFA 4GMJB 3SAFA 3L2UA 2W9CA 3SSRA 1Q82T 2GIFA 2CZ4A 4Y2UA 4DL5A 2UXCK 1KFDA 2X1FA 3AVMA 1KVIA 4ZDNA 5BYSA 1S5ZA 3K7RA 4LFBK 4C7ZA 1HNIA 1K0VA 1GX6A 4DTJA 2LKZA 4RUBA 3CDEA 2Z8QA 2BEFA 1S6UA 3TACB 4FXWA 5KOWA 1P8GA 2KOBA 4ZLNA 4JI7F 4CF9A 2R2SA 3WXLA 2J9DA 2XB2D 1D09B 5GAHI 3P5BP 3VAGA 3N4QA 4B3OB 1X4FA 4KH5A 2OPSA 1XC3A 1IG9A 3PIPQ 1JK9B 2ZUAA 3LDPA 4I2QB 1VHFA 1YK9A 1UVIA 1T4GA 3UWTA 2FD2A 3I55N 1VSDA 2XMMA 2H3GX 1L3KA 2N4CA 2PE8A 3DJCA 1RWKB 2P9NB 8AT1B 3E9LA 5H1SV 3THYA 5KT7A 3Q23A 2W7OA 5ALMA 3IC1A 2Z1IA 1ZQFA 1VSKA 1U6ZA 4KLQA 3L7PA 4ATNA 4ZN1A 3SFGA 1QVFR 2RNEA 1IKVB 4KTZA 4QIVA 2F1FA 3BN7A 5DDOC 3KG0A 3QMLA 4JHDB 3GQCA 3UQ0A 4RUHA 3O3FA 2GQ2A 4E7JA 2KLAA 5AQLA 4U67L 2QA4N 3GTYX 4Q43A 2V68A 5LL6Z 1PJ5A 1YRUA 4HTUA 2ZM6J 4E89A 3KHGA 4NASA 1QAYA 1P8ZA 3W2WB 4FLTA 2VKRA 3EE8A 2BUNA 1ZBIA 3T3FA 4CYUA 3DYAB 4RW8A 3UNGC 3Q8MA 4WQ5C 5J2QA 4LJMA 3LWLA 3D3CJ 4B1YB 3QGPA 4KPYA 4LF5F 1HKAA 2KK0A 1NEEA 4ZVQB 2M0NA 4F04B 1U1QA 1TE2A 4J9RA 2R4FA 1SL2A 2LEAA 4QJVA 3I76A 1RHUB 3ZSYA 4CEFA 4A59A 4WQ4C 4EFHA 3GIRA 3FCWA 3JTOA 5EX0A 4H0VB 3FRYA 2ZIUB 3AGRA 3TZWA 2QWOA 2VBXA 5IV4A 1LWCB 1N32J 5CYMA 3H25A 3PYFA 4NZ0A 4F4ZA 2PFPA 5KT3A 1FNXH 4ICLA 1C6VA 4NXMJ 5LMNJ 5A0LA 1GLDG 2JJ4D 3SUOA 2WF9A 3G8QA 2GFFA 1GOBA 1Q8BA 1WC1A 4MDBA 1Z1VA 4JI6K 5EXWA 4ED2A 1BL3A 4XH4A 1AYEA 1XSLA 3RBDA 3PSFA 4O23A 3EN9A 4YXJA 3A8YA 4V19S 4DU1A 2P6UA 1RWNB 3CDBA 4CIFA 3QU9A 3OR1B 4JI8F 2DKXA 3MR6A 3HPHA 4K2JA 2ZGZA 4J9OA 5IT9U 2YMLA 2H65B 4WFAL 2PY5A 5THWA 1B9FA 2E2OA 4Q8FA 4LFAF 3V9XA 2RRDA 2YKNB 4PXBA 3RJHA 1SZPA 5HJYA 2GGPA 4PEOA 3QT6A 3BO2A 4Y2TA 4GV6A 1RYSA 1W7WA 2HNYA 4CP5A 3MMCB 2HQGA 2BKPA 1IKXA 3K9JA 3KK3A 2LPEA 3TAPA 3MM8B 3BEGB 4OYAA 1CULB 5D4NA 3IHQB 2VPXB 1EKRA 3HLUA 1ZZFA 1RB0A 1M5VC 5G5GA 4K8RA 2F77X 4ED3A 1DTQA 3P4UB 5CCMA 2PEHA 1BPXA 2XSJA 3TTFA 4YB7A 3U3YA 3WXJA 4K4UA 2DB1A 1Y11A 2CAJA 3LAMA 1YWXA 4QIFA 4O5FA 4JI5F 1N6QB 4ZVSB 4KLUA 3TA1A 2MKCA 1T94A 3QUCA 3VQQA 2J76E 2DIUA 3CJSA 4QCLA 3TSPA 3CD6S 5H9EK 2BCVA 2AYEA 4IH6A 2ZZMA 5HJXA 4CEEA 4W5RA 2RHQB 3HM8A 2BR0A 4USIA 5E3RA 2PMZF 3O1BA 2ASMA 1Q3UA 5HSPA 2QB1A 1RU1A 4IFVA 4JI1F 3P83D 4B9QA 4K4TA 2RP5A 1KTVA 2NNWA 3V9ZA 2DY4A 3QU7A 3QMQA 3EKUA 4X66J 3HWTA 3N5FA 4CVNE 3DRYA 2HW3A 3HULA 5A6WA 1ZJMA 4A8QA 4U95A 3GDQA 2MRLA 3EGNA 3NKYA 3DN9A 5FIIA 4GVBA 1B4FA 4FLUA 1HD1A 5DB9A 4FF2A 1SJRA 2RKIB 4Y2IA 3VAFA 5LJVA 4E7IA 2IBKA 2W2QP 5C42B 4JK8A 4CE9A 3QU4A 3UPFA 1YVUA 1SBRA 3UDEA 4HWIA 2OJ3A 1TAMA 5AM4A 4IXCA 5J2EA 2F8SA 2GIRA 1J2VA 3R3TA 3NP5A 3EMTA 6FD1A 4KB0A 2VA2A 1UCVA 1Z3EB 1Z4NA 2K3KA 5DLFA 4OV1A 1M5OC 1XO0A 2P5VA 3D1OA 2LFVA 1J2MA 2K4HA 1N33F 2CXEA 2F4VJ 3TUIC 3D45A 2YB4A 4ZPTR 3B9JA 2PMZD 5HBMB 2HKEA 2GVDA 4Y3CA 1U2RA 2HHHJ 1RZMA 3D0HE 4BRNA 9ICLA 5KAFU 1A5WA 4FWRA 3MN9A 5M1QA 3CCVN 3K1RB 2KN4A 2D0BA 1VIXA 2CQ2A 4FP9A 1S1WB 8ICWA 1RP5A 5AKEA 3KHLA 2DT9A 2EZXA 2D9PA 2RPIA 3LUYA 1SVDA 3MUMP 4FZLA 3BGFA 2RHKA 3ZZYA 2Q3PA 2VJVA 1VQLS 3GSIA 4ZMMA 4ZITA 3L2WA 4LF5K 3M8QB 4KTQA 2DHXA 4GRSA 2B0CA 4RZRA 2ZZNA 2MKIA 2KDOA 2NO4A 1BPDA 2FQQB 3LALA 4JKFA 3IN5A 5CYJA 2F5GA 2RU9A 3N28A 4OYBA 5DDRC 4IOXA 2P9SB 7ICUA 1OPZA 2FZKB 1T8EA 5A76A 2KXFA 2VFTA 2UV8G 4Y34A 4RQ4A 5CR4A 1S1VB 1BCOA 1IVZA 1YTYA 3MXHP 4F2RA 3V81A 1QQOA 2MA1A 5B08A 4GKKJ 4OKEA 1S12A 5AE2A 2VQEK 2F1IA 1S1XA 3TJAA 2HHSA 3O0FA 4I2AA 2A1RA 1Q18A 4KPCA 3QFPA 3P6YC 2V8DA 4EYIB 3V2UC 2GMHA 3T1AA 1WC5A 2KHDA 2KZZA 4V19J 3SQ4A 5LSRA 3K4GA 1JLEB 2GUIA 1V6HA 2K8CB 2KIVA 1VK3A 1PK1A 1DEJA 3WXIA 3OYMA 4TNOA 2G0CA 2O66A 4CNQA 1J9AA 1VDHA 1E4FT 3FAHA 1UZDA 3NVKA 4IO8A 2ILZA 3CUNA 2OWOA 3L2RA 4NLKA 2NXNA 2A1AA 4NOHA 4EENA 4EI2A 1OY6A 4A5AA 3RJGA 2EAOA 3IBCB 4A47A 4YORA 1RTHB 4B1ZA 2JEIA 2YWWA 2DQNB 3D54A 4JI3J 1RWXB 1RQLA 9ICEA 4IG0B 3VTIA 3THWA 1M1KO 4WCEL 4X4RA 2A1BA 1NSAA 4U7CA 3DOKA 1VC5A 2FPLA 2BA9A 1T3OA 4EZ9A 4JI4J 2E1MC 2N3OA 3DI6B 5DB8A 3QIPA 2AYGA 2D5RA 1YTUA 4DOBA 2VFSA 2X74A 2IMWP 4Q2MA 3A3OB 1LWEB 3OV7A 1VSLA 2LQ5A 2RJZA 4C2MA 3MMBA 4YN4A 2R7OA 1XMOF 4JI5K 5AKIA 3NNHA 3TADA 4OJ6A 2RHSB 3CCQS 3G6EN 4LZDA 1OYDA 5DETA 4XH5A 2MU2A 1RA7A 4QW9A 1Y0HA 1VQ4N 4QZFA 1YZ6A 1YBTA 4KO0B 4E3SA 2JZ5A 4KIAA 4F5QA 1TR0A 3LWMA 2E88A 4Y2JA 3AVGA 4JMUA 4PQUA 5K8OA 5AK3A 2B6AA 2PIIA 1WI8A 1DZ5A 1MC8A 3EW9A 4OZ2A 3VN5A 4OLAA 2W3RA 1GLEG 1JXBA 3CC2S 1J97A 3BV8A 2MY7A 1FNMA 4IFYA 4TVAB 3ULDA 5AZJA 4JS4A 2VWJA 4L3KA 2V63A 2WB1C 1F0XA 1RYRA 2W6KA 2DXEA 3BSAA 3CCUN 4DQIA 1G15A 1YGYA 3AOBA 4YB5A 4GIBA 3NNAA 1S77D 4JI2F 4GFJA 5FROA 1EETB 3L3CA 1UT8A 5KRSA 1CBKA 2JGUA 3PEJA 1GOCA 1P7DA 2BANB 3N0VA 2JH3A 3KWGA 4LF8F 3CCRN 2C22A 5HMMA 1C1AA 2DFHA 5IM0B 3OYGA 3WZ0A 2XLJA 3TQEA 5AJ3K 4FJ5A 1XHXA 3D5MA 8ICOA 4ZCLA 3TZYA 3DRRA 3CMAN 3B4MA 4Z6CA 4WIQA 4GKJF 1J6ZA 4R66A 4PPXA 3K75D 1R8HA 3H0PA 5KT2A 3TZXA 2FPHX 3NLCA 3S01A 3ISNC 1KAYA 4PKHA 1J54A 1ASWA 1NSQA 1R3NA 3ULEA 1CC7A 2B4VA 4OZ0A 4H0PA 4Q45A 2MLXA 1JXEA 1N33K 1KEKA 1R27B 4CEQA 1KAZA 2LQJA 1N52B 1QSYA 2E1FA 4MYUA 2BCRA 1GLBG 3CDAA 3DAWA 5K20B 3IG8A 2QB0A 4Y28C 5CA7A 3THPA 2QKKA 1PYSB 5LMUK 1IJEB 1Q8KA 1X3MA 4LR8A 1FRKA 1L7NA 3N6NA 4DUZJ 4M41A 2H5EA 2XMKA 4OO1J 4DR4F 2JEJA 3T5JA 3RBZA 4GO5X 3WK4A 3NS6A 1U26A 3D2NA 3N01A 4C97A 5JICA 4ZPVR 1P27B 4DOZA 3F2BA 2IVOA 1YITN 1XMQF 1WNEA 3SD7A 1RBAA 2KJWA 1LB2B 9ICFA 5IFMA 4ZOSA 4Y2XA 4QZBA 4QWDA 2B4JA 2GWSA 5J0UA 2M9NA 2J0XA 4BRCA 4FPRA 2PEBA 3AH6A 2HNZB 5L38A 1ZAVA 3JXOA 5A2QU 2DCLA 2E5LJ 1V97A 3RBXA 4X4TA 4LF6J 3UKRB 4M9GA 4BRIA 2DGOA 2OCEA 3HOTA 5HI7A 3DMJB 2A3ZA 5HROB 2JGAA 3U02A 4PWWA 2G13A 3AXMA 1HNWF 4BC7A 1BPBA 3EXYA 3BJYA 4B3OA 3RMCA 1MA7A 3EEQA 3DLRA 3J81O 1Q16B 1R8PA 4DUYF 2A19A 4WFZA 2HQDA 3GFZA 2G8WA 3PRBA 1NNEA 2P9NA 5KFKA 3IG1A 4ZHRA 1IQTA 4MQ3A 4UBCA 4YR3A 4F9OA 2O4GA 4OZNA 1R6YA 3T9ZA 3AQEA 1LK5A 5DG7A 2V9KA 4P0PB 1NH8A 1VHIA 3MCMA 1IKVA 3ILOA 4ZVRB 3BR8A 2FHJA 1SJ3P 2K8BB 1MQ2A 4LZGA 1X8DA 5AK5A 3OPXA 2YH1A 1JQGA 3CCWA 2KFZA 1RT7B 3TW0A 3K8VA 4FE3A 2PFDA 4ES1A 1XMOK 4LJXA 3NVMA 2FF6A 3FZMA 2DXDA 2IM3A 5AQNA 3HMJG 1M5HA 3E1YA 4FJ9A 2AXTU 4LF4J 2V4QA 2CA9A 4WE1A 3W63A 3Q8QB 3D6FB 4I2IA 3PM9A 3HKWA 2RRBA 1NMDA 4J9NA 1RAHB 3V9WA 4LSZB 2OI2A 5K8NA 2DISA 4DR1J 1ZA2B 4UOGA 4DSLA 1S99A 3ICXA 1ITGA 4FF4A 2ZIUA 2AJ0A 4Y2PA 3HF5A 1ZQYA 7ICTA 1LWCA 1S9GA 2F65A 4ZVFA 1WC4A 2W03A 3IR6B 1SH2A 2F96A 2VDIA 3BGUA 1SV0C 2W7AA 4UB8U 4F36A 3VGVA 3GILA 3CMEN 4YD2A 4CJSA 1KC8T 4YHHK 2O8FB 4Z7YA 3PIOQ 4DPWA 2VOOA 1ATNA 3K9KA 3MR5A 3FM9A 2CKWA 3JPOA 1EKEA 2ZG6A 1KOHA 1ZOLA 1HPMA 1WUAA 3AO1A 3H5SA 2UUCF 3D7SB 4M3RA 3GL1A 4WK3A 3AVNA 2NCKL 3ENQA 4K4GA 3OR1A 2OEJA 2OTLS 2BJ9A 4CWBA 3N6MA 1N8RO 2OZMA 3DGPB 1JLCB 2KT2A 1LOUA 4M5LA 4DPTA 1VYAA 4ELUA 4GKJK 1VHXA 3KKRA 3MHYA 2HDOA 4PL2A 1TL7A 2YKNA 4B08A 2FTRA 2LM1A 4PL7A 1ZQWA 5FP0A 2ZGYA 1FDDA 3CVKA 1BQXA 1HNVA 1TV6B 2VG5B 3KMSA 4KC5A 4MH8A 3BP8A 4FXDA 3FBBA 3C14B 4I2HA 6AT1B 3JTNA 1OVYA 2ZD1B 3MM8A 4NLVA 4A46A 1JCEA 3KK7A 3R6MA 3QGHA 2D3DA 2XNQA 2X6NA 3WK6A 2C3UA 2RQMA 1E6YB 4E7HA 4XUSA 4JKEA 3RVCA 1L8LA 2CPDA 2YQEA 3PNCA 5L1MA 1F2HA 1A0OB 2NRTA 2FBYA 1NXIA 3NOCA 3J81j 1X5TA 1IBKF 2KT5A 3EVMA 2YQ3A 5B5EU 4PPDA 4V19X 2ETJA 1V4TA 4XTTA 4M9LA 1RT6B 3H45C 4ISFA 2WMMA 5GAGI 2DIVA 4FWKA 2QEXN 5ALGA 4JD2A 1CUKA 2D74B 4X2BA 1NLKL 2LDYA 1JLBA 4FNIA 3AA4A 2QLFB 3EYZA 4PRFA 2KFNA 4OI0A 2NS1B 3M6WA 4ERDA 3T9NA 3RB0A 2V94A 2YBVA 2HCFA 2JC0A 5JS2A 3TAEA 4DL0C 1X4HA 1HYVA 4GC6A 3P5JA 2ZTCA 2XWXA 4K42A 1BA1A 2M4MA 3UPQA 1K9MO 1ZM9A 2G08A 2JH1A 1U1MA 1RYUA 3I4PA 2Q1NA 3O9SA 3GJRB 3QWPA 4BY9C 4EBCA 2DR5A 4C0ZA 3M2RA 3J81Y 1N5QA 2A0FB 3CIMA 3PIPL 3OS0A 3VQBA 1S22A 2OEKA 2GCFA 4DOCA 1Q82O 1YLXA 1CQNA 4B3SF 2GA7A 3QINA 3H0MB 2RKIA 2EQYA 3I9V9 3FZLA 5C42A 3CPWM 4FZZA 1FRJA 3AD7C 4EHTA 1V4SA 3S9HA 3OLBA 5JU5A 3OL6A 4K7QA 2FSNA 3HHDA 3C3LA 4B1WB 1HQEB 3AMZA 4DV7F 3AO3A 7ICRA 4LF1A 1FD8A 5AQYA 1VAZA 4J8FA 3G10A 2KG5A 2VJ4A 1HFEL 4MYTA 5HN0A 2FLNA 1GNKA 2VL1A 2EDUA 3GONA 2F8MA 3GWCA 3D7EO 2DNRA 1WF2A 2RRAA 4XDCA 3D6HB 4AQYK 2VG7B 1B0VA 3V6JA 2MQMA 2RDIA 3C6AA 1TUUA 3FFIA 1KXPA 2YJEA 4MJKA 1WSHA 2E5HA 5B09A 4CE6A 5AFUH 3QUQA 4LR9A 4CLPA 5KRTA 3KD3A 4LF7J 3L2VA 1HYZA 5HHIA 3GSDA 3UN3A 2CPXA 1JN3A 5HQLA 1HKCA 2GMLA 4FM0A 4ID5B 4I6WA 4H4MB 2V8HA 3MR3A 1VBKA 3ENBA 1MW7A 2CXYA 1U1KA 2XY5A 2A1SA 3CF5Q 4ZP8A 2IM2A 3BZQA 1ZQMA 4A62A 2ATLA 1ZJNA 1H1VA 1U02A 3ZTOA 1J5EK 2R7XA 3ZZOA 2IVMA 3R7BB 3C7NB 2MDAA 3MPWA 1GEHA 1GFWB 3SUPA 1X7VA 2HQIA 4QOTA 1LKYB 2FMQA 2UXBK 2ASPA 1T3NA 2P9SA 3I4HX 4AUKA 2P9UA 3CO0P 2B7CB 1KLNA 4KHSA 2IHR1 1SH3A 2K4EA 1YT3A 2XMTA 3NVYA 2J0QD 3NASA 2J8AA 3M5RA 3AOAA 1S72N 2RB7A 2YHBA 1Q9YA 4IC9A 1VGYA 1RAEB 1NGAA 4OKKA 2ZDPA 4BC9A 4I2PB 2ZKUA 2OM6A 1OH8A 4I4BA 4ZTFA 1RDCA 1BO5O 1VJWA 3D3BJ 3QNMA 2UUCK 4FJ8A 3PKYA 1S0MA 4ED0A 2YPZA 4L72B 3MN7A 4PKGA 2HBMA 3R7NB 1SWWA 3HI9A 2IC3B 3ZSOA 5B0FA 5EWFA 1B99A 2DEJA 1MU2B 2ATCB 2I5JB 4RW6B 5F8MA 1BA0A 2XBPA 1BG3A 1FTCA 1GXLA 3EUNA 4WXWA 1JUDA 3AY9A 5KFGA 1AA1B 1TTHB 2DO0A 3RW6A 2Y0SC 4WIIA 1SC1B 3ITHB 2NSBA 4ELTA 4YD1A 1RFQA 3RW7A 2ASDA 2DXFA 4BVOA 2V5HG 2Q1LA 5J8YC 2DGQA 3UVJB 2OH2A 3DI6A 4KGVB 1WBBA 2C28A 2P9IA 1N48A 4PHDA 2DJWA 2E5IA 3KXDA 4CERA 5KFRA 2F8HA 1JRPA 2HSEB 2PMWA 1IBKK 5ADXH 2FJAB 1AQ6A 3QIOA 4NPOA 3E0FA 4C6AA 1FEEA 3KG1A 2PYJA 1DK3A 2KN7A 4YMOA 4I27A 4DN9A 2MTLA 2HGNA 2AT1B 2KRRA 5HK4A 1K6YA 2AP6A 2GUPA 1QQ6A 1C1BA 3PUFA 4CZKA 2M0GB 2ZNZA 4GLXA 1A6SA 1D3WA 1OS5A 4DXLA 2IS3A 1Q9XA 4CJEA 3UM9A 1SKSA 2UUAF 2E5SA 3I28A 5IIJA 4OX8A 5GAHU 3MM7B 5ALUA 4IJNA 2OPQB 2R7QA 3HM9A 1IBMK 4TYBA 3AUOA 3WNHA 4OKJA 3GU3A 2RD5C 5BRHA 1FEZA 2WVCA 1U1OA 1KEJA 4UW2A 4ZIVA 4F92B 2VONA 2W4CA 4CT9A 1U0HB 2FC0A 4OX6A 1VQKN 3PFEA 4IH7A 2YNIA 2ZH8A 1S6PB 3H8MA 1VQ7N 5F1XA 2WB4A 2PFQA 4LREA 1ZRMA 1SAZA 2YKPA 5ETNA 3ZLJA 4DR3K 5IZHA 1VSFA 2I6XA 3MEEA 3QWUA 2W04A 4RNMA 3F9KA 1NZ8A 4BG8A 5HMWA 4IS7A 4DV2J 1U1NA 7ICEA 2YXLA 2AD9A 3L4PA 3CWJA 3G8TA 1CS4A 4DV7K 4DU8A 4PABA 2BJ7A 2P2CB 3BSCA 2OYQA 1UVJA 2MZ1A 4DV0J 3VEZA 4YP3A 1UJ5A 1NK7A 3KHRA 4N47A 2LDIA 3C2PA 4ZTJA 5L1IA 2XYHB 1F9EB 1RBRA 3PSIA 3V1QA 4MLEA 4HACB 3S6EA 5KFUA 3EY1A 3GR1A 3MAAB 3TEHB 4ZJOA 2YKOA 3SYZA 1G3OA 4PHTX 3C29A 3PW0A 4CHYA 3AAPA 1SUQB 1N5XA 3HVTA 2YKMA 4Q44A 2NUHA 1YJNN 4EMDA 1HA1A 3WQPA 4ECYA 2P6TA 5AQOA 2W7PA 3CERA 4O5KA 5ALZA 1C0GA 2BRLA 4N7TA 3DOMB 1VFJA 5HRNA 3THTA 3N4PA 1SXDA 2HFVA 1WG4A 7ICSA 3AEVA 1WAJA 5ETKA 4KLFA 8ICQA 1C0FA 3A5OC 2AZ3A 3G71N 1AZSB 4KB7A 1BQMB 5H9EJ 1VDVA 2HHVA 1ZD2P 4E0DA 1RAAB 1V3RA 4FJNA 1Z4OA 1FXDA 2QGFB 9ICXA 3D66A 1KVAA 3TR5A 4GV9A 2VZ9A 3NWRA 3I55S 4OX9F 4M3WA 3M6KA 1VSHA 3PR4A 2N7CA 2HNZA 1U09A 4JKDA 3ZSXA 4JI0K 4H4OB 4NCGB 2V51B 1VQ5N 3H0LB 1SXLA 4RTFD 2EX3A 5LXRA 3UKRA 3K0SA 3Q8LA 4NLYA 3C95A 1A77A 3BGRB 4M42A 3W66A 2ZUCA 2L5YA 2V2ZA 1FJGK 3DOLA 2KM8C 3OYJA 2OPPB 3DMJA 4WZMA 1WF0A 4UARA 1R43A 3RRHA 3L7OA 4LBHA 4X65F 2RVJA 4JI7J 3ULHA 2XO7A 2QA4S 1URRA 2YY3A 2VQFF 3ICLA 2JZBA 3JSMA 1N56A 1NGEA 1TMJA 2W2PP 2BRKA 3SENA 1U4BA 1HNZK 1KVCA 1LWFB 4KV8B 3A8IA 3KKAC 5ALDA 2KJ9A 3WIVA 2G09A 4NMXA 4IOCQ 3R9PA 3TANA 2XMVA 1PUZA 4P0PA 1FRMA 4DMZA 4NA3A 2FXUA 2KO1A 3T6JA 3VESA 4XPCA 2EFVA 2VJUA 2M2BA 4NYNA 1RWOB 4EU0A 3MC1A 1UETA 1RT7A 2PKEA 4K43A 1CI4A 3BM7A 2RT3A 4BGDA 5DQIA 1HBNA 5KPRA 3O9RA 2XI9A 2HSZA 1V5VA 2M52A 3CCLS 4FZXC 1VQMN 4CO5A 4U7UK 2QX0A 3NS1A 2GO8A 5CD4A 4Z6DA 5KFBA 3FZBA 5JRTA 1SB6A 2X1GA 3OBWA 2FYXA 4W4MA 3UN2A 5AXKA 3SDEB 3M1FA 5J2MB 3V5RA 1XSPA 2UUAK 4HT5A 4QIEA 3MFHA 5BYQA 2WFAA 3RH6A 4LRAA 2WB1F 3QUBA 5T41A 2BOPA 2E20A 3G87A 2PI4A 2OKQA 1X5OA 3FSYA 1RT1B 2EFGA 5HL7Q 2OEMA 2O8FA 2XMJA 3UE2A 1S57A 4B9LA 4BRLA 3ORYA 1GK8A 2F44A 2GNKA 3O1LA 1YJWS 2DF4B 4CF2A 4QIWC 4LRBA 1XERA 3WKAA 5CHIA 4KHPF 3OYBA 3F5AA 4OZ3A 1R89A 1U8WA 3DHWC 5B8HA 1PVQA 1BIUA 4JI8J 1T95A 3HVRA 1OQ6A 1XJWB 2Z1HA 4G1IA 5ETOA 2HRUA 1UJ6A 4LFAJ 2FJVA 2GZOA 3I0SB 4DU3A 1KVBA 1BQNA 4DI6A 1H2VZ 1B7YB 1ZZNA 3SCIE 3N7RC 4U9RA 4CK1A 1FRXA 1VJ5A 4CLYA 4CJWA 1NH7A 1W97L 4NLPA 5KFQA 2PN6A 3M1YA 3TWZA 4A2BA 1Q46A 3WBZA 5D46A 1RXVA 1KOOA 2WRMA 4MT1A 4PUOB 1MA9B 3IBFB 4EHUA 5JTIA 2FHOB 3FGVA 1SJFA 2YCHA 4PAAA 4OCZA 3A4TA 4RWXA 1ZQKA 5K4LA 4EEYA 2WB1D 4K4VA 4CLTA 3QIDA 2R18A 1CJTB 4IO9Q 5BR9A 1HR0F 1O8BA 1LXNA 1RT6A 3TFRA 1SIWB 1VQ6N 2X7IA 4C8ZA 1Z6RA 1TV9A 3CDWA 4FKXA 2C3PA 5L1KA 3FZHA 3DLGB 5ETLA 5AM5A 3THXB 4F0HA 3TVKA 3QSIA 2DPIA 3GMGA 1R6VA 1KP6A 5AQGA 3WQUA 2BE2B 1BU6O 4MHVA 4N41A 3VQ8A 1DAXA 2KB2A 3NS7B 4IQUA 4ZP9A 1UW9A 2DNHA 4USHA 4JI1J 7ICHA 2V4JA 4OX9K 3KLIB 4X66F 5KG1A 2ITGA 4F3MA 2DPNA 3LPYA 1BOTO 4A48A 4Y0FA 3ISND 2KMDA 2RLTA 1Q3VA 4O5CA 2JFDA 5DK5A 2VG6A 1SWVA 2DK2A 3CNQP 4CO3A 1ZBLA 3AQFA 4F71A 2FSKA 2KHQA 5KNIA 1ED1A 2H3FA 5F0WA 3K59A 5KAKA 3MWTA 4DDFA 1YAGA 1YIJN 3OL7A 2FVPA 2DRAA 5B0BA 2FDRA 3A3NB 1X9JA 3F41A 1C0UA 3FQKA 5EE1A 2WUSA 3H7IA 2R2UA 3CCVS 3ZTQA 4RPYA 1OPIA 3IO1A 1QE1B 2AX0A 4RR5A 3MD3A 4CEBA 2IIRA 3EJMA 3QBCA 5BXIA 1FFSB 3V6DB 8ICEA 2GX9A 1WTFA 2Q0ZX 4C8OA 4CGZA 3HD1A 4JLHA 3ZDBA 4Q7AA 1GTHA 3M6GA 2OHDA 2A1JB 3QZ7A 1NGHA 4QBUA 4TKTA 4JKBA 2YY6A 3AJ1A 2F4VF 2LP4A 2IVFB 2XC9A 1WEZA 4L3QA 4OL8A 2Z30B 4C4WA 2HHHF 3QAUA 2V7ZA 3OW2R 3M2VB 2Y8YA 1HUXA 3F9MA 3AVHA 2X1BA 1WSFA 3S3OA 4H4MA 5KFTA 4ZH4A 2ZM6K 4NLGA 2ZUGA 2IOHA 2GQCA 4YQWA 4KRFA 3JQJA 5AQKA 1CJUB 4X4UA 4BHQA 1FWPA 2DY9A 4AHSA 1NB2A 2ZHBA 1IXKA 3ZZUA 4M5JA 1BD6A 4QU6A 1RISA 2ZJ5A 2L9DA 4U7BA 3PIOL 2ABYA 3C7NA 2HNDB 4KN7A 3KK2B 2KHCA 2QC3A 4ILMA 4CM2A 2HG4A 5KL8B 5C2DA 3FZ2A 4A61A 1LKYA 3KTQA 3D67A 1WSJA 3TUZC 1ZQRA 5LT5A 1N32K 2HMIB 3BS7A 5AXNA 1HWLA 2ZWOA 3D9BA 3LF0A 4ER8A 4LSNA 4NXMK 3O5BA 3UR0A 3OYEA 2BACA 5LMNK 3ENHA 4E2FB 3RBEA 4CO1A 4M7YA 3M2UB 4Q5VA 1B0PA 1KTQA 4F5RA 3CXCM 4J9KA 2A6OA 3G6YA 1KC8O 4DTRA 1I94J 3BQ2A 2RF2A 4AXIA 3IR7B 1VC0A 2H54B 1LFWA 1DQAA 1RT3B 3TX8A 1TK0A 3CIZA 3OVSA 4CHQA 1UVLA 5DBAA 4IRDA 1MWYA 1A6LA 1WC3A 1SC6A 2VIHA 1NG9A 3PO5A 2IC3A 2Y1LB 4I9LA 3G6ES 1NDLA 2I5JA 2LEPA 1RBUA 1B22A 4RW6A 3HYFA 1F3FA 2R9LA 1OYEA 2QA4G 1VQ4S 1GAOA 3OS2A 1AFIA 1T9XA 2JMGA 1D9AA 4NLSA 1REVB 1F6TA 2FJEB 2HS3A 5GVQA 4I69A 3SMZA 3SCJE 2FSJA 1F60B 9ICSA 1M5PC 3OVBA 2BJ1A 4CNZA 4DX5A 4CM0A 1YJ9N 4R25A 1XEZA 3CCUS 3QLHB 4CZJA 2RN2A 3OXFA 2BKNA 2G5HB 2JRSA 4CH1A 4ENOA 5A8WA 2E8NA 1XMOJ 3OUYA 4WFBL 4Y00A 2UU9J 2UUBF 3V4IB 4TURA 4P2FA 1NGCA 9ICNA 3NGSA 1OH7A 2DNQA 1S59A 2KVIA 3CCRS 1SZ2A 3MK6A 2HOQA 2ROPA 2E8OA 4F50A 2YQ0A 5K14B 3ONQA 1T11A 4F72A 3IMXA 2ZE2B 2K7JA 1KHVA 2O8DB 2IYGA 4IOAQ 5KG6A 1OY8A 3MM7A 1WOSA 5IC6B 1BE4A 1GQEA 3CMAS 2RQ5A 3CPEA 3WXMB 2CRXA 3NGTA 5D3GA 2HVHA 4C3MA 2AZ1A 4X66K 4GMKA 4DWIA 3HSCA 1IKWB 3TADC 1U0HA 2EWHA 4LSLB 4JI2J 5EVZA 1RAJA 2OTJN 2D0PA 1S6PA 1TYQA 5EWEA 1OO0B 2VC0A 1OIAA 1WDTA 3DWLA 2J9EA 2N1RA 2RILA 3L8BA 4EX7A 4O3NA 4LF8J 3ZDAA 1ZQPA 2IVNA 1JLGB 3C6HA 2HS0A 2MZJA 4P2MA 2XS7A 1AT1B 2LYBA 2HLUA 2AP1A 4C4RA 4TXSA 2WBNA 1OXJA 4KLTA 1VMBA 4AL7A 1RE1B 3A3PB 3WDOA 3EX7B 2XSFA 3ZC4A 4C8YA 4ETZA 1D8LA 3MEGA 3VCDA 1COOA 4F5NA 7ICMA 3TU5A 5E33A 2HYIB 2Z2MA 1CVJA 1TELA 2HBKA 4FXVA 3U9DA 4K4ZA 2WAQC 1IN0A 1JJ4A 4RO0A 3KZXA 3WT0A 2HMXA 1U2VB 1ZS6A 3WX8A 1X66A 1YITS 3MAAA 1NPRA 3A2FA 2F3JA 2FB0A 3CF5L 3JS6A 2VUGA 4DG1A 2Z2ZA 4YDXA 2F4VK 3DXKB 2VGMA 4CFBA 2N82B 2JFKA 4R79A 3TAGA 1S5JA 1HBMA 3MFIA 1HKGA 2HHHK 5C15A 3FZFA 2ASYA 1BUPA 5BN9A 3G6XA 3EM1A 1Y5LB 3JB9k 1TKZB 1T9VA 1HWIA 1FRLA 3I5BA 3CC7N 2LQ8A 4ISEA 2OPRB 3RMAA 2HFZA 3BY5A 3F5EA 2YQ1A 3V7LA 1S4EA 1F9HA 4XPEA 4CJKA 4J9PA 4KGXB 4CRXA 1FKPA 1S10A 4R5PB 3AM9A 1GLLO 3NG8A 2VANA 4DUZF 1RTJA 1PGZA 1KONA 2CNNB 4DR4J 4JAXA 5KFDA 3S8SA 4C48A 1SV4A 7ICOA 3DXMA 3MR7A 1UEVA 4OIXA 3SLCA 1XR7A 2NXCA 5AI5A 2DGWA 2PFFB 3N4MB 4G1QA 2F63A 2XRIA 4MMOA 2KM8B 1XMQJ 2PAVA 1WWHA 4FO6A 5C25B 5F8LA 3NL0A 2GEMA 1UEUA 2BJ8A 4GVEA 4L76A 4L3NA 4P2HA 5B0EA 1CJKA 3VGTA 1D9DA 3PMLA 1L8OA 2XVTA 4XH1A 3MGIA 2OANA 2W9CB 1NSPA 2A6AA 2E2NA 3H6EA 1QVGM 3VEYA 2NLWA 3H5XA 8ICTA 2E5LF 1L3TA 3QFUA 2JLEA 2ISPA 1CLQA 3GG0A 2CWXA 4K4XA 2VFRA 4ZKAA 2KKVA 1T3QA 3BGRA 3AVAA 3J7Z5 3SEIA 3DDIA 3UW1A 3WKDA 3L09A 5K8MA 5TKWA 1KVJA 1BPZA 4BDYA 1HNIB 2Y9UA 7ICKA 1SV5B 4QZCA 5BN8A 2HZVA 1U6BA 3JPSA 5B66U 4TQRA 4YFUA 1SQFA 1QAIA 4JKGB 1UPMB 3I9ZA 1HNWJ 4PWUA 3QT8A 2MZRA 1RHMB 2MQNA 1H7WA 5AR0A 2OPSB 3LP0A 1V9PA 4KLLA 5LSOA 2RMLA 3I33A 3MGVA 4DUYJ 2DH7A 2QLXA 1JWWA 2B5JA 1IR0A 3CFPA 4RG8A 4NLCA 4W90B 3ZT0A 2Y0SF 4KSEB 1BWVA 2HOEA 1RCXB 2VODA 4JI3K 3THYB 2LU1A 2QWNA 3VAIA 4A8EA 2WBRA 3K57A 3MMVA 2B7BB 4H54A 4CZMA 1X4DA 2HWTA 1W25A 2C3OA 4JI4K 3RU0A 5HMYA 4DUTA 2NXEA 4DTUA 3KD5E 1PILA 1EJ7L 5H1SQ 5DGBA 2R2RA 1VLOA 3UDVA 4Y1DA 1VK8A 4TU7A 3SSQA 3UI3A 2QO3A 2OMLA 2B0GA 3IS9B 1ROFA 1SV0A 3KNGA 3ENOA 1ZBTA 3IRXA 2P1JA 1L7MA 3CD7A 1CQMA 2P6SA 4RW8B 4OPJA 3JQMA 2GO7A 4TLQA 5J2QB 3FR0A 4IL6U 4B9UA 5CA5A 5JLFA 2PYLA 2BCSA 3CRXA 1Z26A 1A76A 4DX6A 3OD2A 4OX7A 1FKAF 3PO4A 1FO4A 1D8ZA 3G86A 1CZAN 3OTQA 1DRGA 3RRGA 4YS2A 3L9ZA 1PC5A 2W8KA 4ZJLA 3G82B 1U1LA 5AZIB 5F8NA 1HJRA 3QEBZ 2DNOA 3DU6A 5AM3A 3F2DA 4ZA1A 4F67A 2Y1RI 3PRVA 4KHRA 3K5MA 3PKMA 4DTNA 5DB6A 4ICLB 5JUMA 5J2GA 1NNLA 4DV3F 3BF3A 3DLEA 4KLDA 1KAXA 2G0JA 2W4DA 2Y0SD 3DLJA 1T9YA 2DGVA 2FGOA 1H0HB 4YOTA 4P0QA 2OFHX 1F1BB 4LVSA 4WYWA 1ZQCA 2KW4A 2KKZA 3WNGA 4DFPA 8RUCA 3PYEA 5KQDA 2OO4A 2F1JA 1Q81T 3H8SA 2VH7A 4C1NK 4K8ZA 1Y97A 3IAS9 4CJQA 2PT0A 3V6KA 4CD1A 5J2AA 4ALZA 4OYIA 4Z4FA 1BVSA 3HD2A 4HHHA 4IG3A 4FWMA 3ZNJ1 4C7QA 4ANDA 3EWGA 3SBGA 3HHKA 4C0OC 2HNYB 3KUEA 3ZX2A 3TSUA 1R8BA 5AI9A 4ILLA 4CZIA 4NYOA 1WSVA 4IOBA 3KK3B 1D5AA 3B6OA 8ICAA 5IOLA 4RBUA 4EO8A 1ITPA 4DCJB 5DG8A 2DITA 3WX4A 3AVFA 4PUOA 2DNYA 4ECRA 3WNFA 1EXQA 1ZQXA 4NXZA 4ISGA 2BJEA 2B51A 4AILC 3D68A 1DTQB 1OY9A 3UNYA 4JUZA 1H98A 2JNJA 2XSJB 3K5NA 4ZPWR 3UMGA 3SZ2A 2A42A 3L2QA 3LPUA 3ZTRA 5GIOA 4U8YA 4RNNA 4UB1A 1U8SA 3B54A 3Q2TC 4DUZK 3BBBA 4F5PA 5AQWA 1UW4A 2H4WB 4ZVEA 2AYMA 4F25A 3SSSA 1RACB 8ICRA 5M2PA 3GV5B 4QJFB 4QIGA 2DTJA 2V2VA 4DFDA 1OWXA 2CGJA 3ALYA 1RGIA 3FKBA 4AHUA 1ZBHA 4GV3A 1RSCA 1MMNA 3OL8A 1RT5B 2VPZB 4W5NA 2DCUB 4BX9C 1O03A 4PH5A 4PHPA 2ZUDA 2IY5B 4FZNA 1WOPA 4ZLLA 4I28A 1VIOA 4AL6A 4JRPA 3F73A 5KFVA 5J2FA 9ATCB 2CQIA 3J7ZT 1R0BG 2B8QA 2E5LK 4JV0A 5KFAA 3S3NA 4Y2CA 2E1EA 5D0GA 1FEHA 4ZOHC 1ZQEA 4LF6K 3DM2B 1Y10A 3VGSA 3D6JA 1KWMA 2P9KB 1HLWA 2NUBA 3ZXWA 4B3SJ 4FOIA 3RH5A 1S7IA 5AT1B 1OW5A 4CJFA 1MG7A 1XS9D 4IOCL 1QE1A 3QGGA 2JOQA 3ZZZA 2ZH2A 1Y9OA 4QPXA 5F0XA 4DL2A 1ASUA 5DJBA 4R64A 4HH1A 3NRZA 3EGZA 3OS1A 7ICFA 2XZTB 3FBFA 2FVRA 5CZXA 4FDFA 3CJ2A 4OJ1A 1NDKA 2KG1A 4C98A 2RAQA 1UWAA 2K3IA 3H7HB 4Q2LA 5GMKa 1WWVA 1FERA 4W5QA 3A1YG 2B8PA 3DC2A 4NEZA 3CD0A 4H4KC 4WYBA 2IVYA 4ECWA 5G0RA 3TSQA 3ETRA 2DR8A 2GVDB 1MN7A 4LF7F 4QZ8A 2VASA 2MQQA 3K17A 1MSWD 2YV0X 4XK8C 3VGLA 3VVUA 2ACMA 3GYNA 2ZNYA 2VIXA 1S72S 1YG0A 4RQ8A 1KQGB 3CE8A 5D49A 2AKWB 3I1YA 4PL1A 3T79A 1QVGR 3EE9A 4HUGA 2P35A 1NUEA 3QAEA 4LF4K 4WP3A 3LDQA 3HILA 4DQPA 5K9FA 2ACYA 5HL7L 1Q95G 2IAJB 4U96A 4IQVA 4B9NA 3AT1B 4OHWA 3TO8A 4KBIA 1JROA 4OYOA 4YNQA 3CJTA 2IOFA 1C1CA 1Z2LA 4KH1B 4DR1K 4FLVA 4MN4C 3CEDA 4CESA 3QZ8A 1NK6A 1WG1A 5BPMA 3OYNA 5CZ2A 3MX2A 4R8UA 5ELZA 2X3GA 3CCTA 4BR7A 1Q53A 1JJ2M 5LJ3Y 4UB6U 3NXZA 2BM0A 3G2XA 1NGIA 1BPYA 2HURA 4WPAA 1U6FA 3A8JA 3V81B 1NGDA 3CW2C 2HAIA 1BDGA 2VWBA 4D3HA 2ZIVB 4LY7A 1DGJA 1SGGA 3M2UA 1S1XB 4TY9A 3CJ0A 4KKOB 1QAXA 2OZSA 2AGQA 3H1QA 3M1VA 3V9UA 5J8YA 2XY6A 3BQ7A 2KD1A 3VQTA 5E84A 4RQ1A 4OJRA 1U25A 2BCUA 4LBIA 2WHEA 3VQ5A 3HSZA 1Q8IA 3OQ2A 4FPBA 3K5PA 4P52A 4AD6A 4P4MA 2XI2A 3NF6A 2FZGB 1O1WA 4BWJA 2CPIA 1Z00A 3BDEA 3EKSA 3W5ZA 1OJ4A 3AQPA 1XI1A 2KICA 4LRCA 4O44A 2ADBA 5E3AA 2I0XA 3GYXB 4BXOA 3THWB 4CLWA 4HCBA 5E3QA 4MK7A 3LM9A 2V9WA 2BPFA 2IDLA 3W5XA 4ED6A 4KH4A 5AQMA 4RLEA 2FJWA 2APOA 2WVFA 3QLHA 5SWMA 5HVFA 1EAYC 2GV1A 1VQKS 5KFJA 1UKUA 2PSZA 2O3DA 5KFPA 3MMBB 1NGGA 2P5GA 4NYZA 2ZH4A 2OMOA 1ZQ1C 2BJ3A 2JDJA 3WK7A 4UB4A 4LD0A 4R65A 3CI5A 2EKYA 1HX1A 1NM1A 3W8PA 4QIWD 4QWEA 3ZZTA 2C2EA 2NRZA 3MPVA 1F0MA 3LQVA 3T7ZA 2Y8WA 1HBUA 1T0TV 1ZM2A 4R63A 2J6TA 4WP8A 2IGIA 3MZIA 4DJBA 4ECZA 1QJHA 3QX7A 3TPQA 4TQSA 2F9WA 4PXCA 4IFYB 4USKA 5KL1B 1O6XA 1HWKA 3WUHA 4LF9F 3NF9A 4EUVA 2HK3A 1BWFO 4NLTA 4LSLA 3TR8A 3BKTA 3TAFA 1FXXA 3PW2A 1BXNA 3LDLA 4CDGA 4CJ7A 3WEEB 2I2YA 3WKEA 1DKGD 1YJNS 4N5SA 3O9TA 4H5TA 1AB8A 1FHTA 4KFBB 2F76X 5ALFA 4DV2F 3GJTB 4F26A 4AHTA 4K4IA 2OP5A 2AW0A 3K1ZA 3H8WA 5BYRA 2MSSA 3OJUA 4ILGB 3F53A 4DL3A 2ZOMA 1JMSA 5JJBA 2OD4A 1HBOA 2XNRA 4DX7A 4UBBA 5MAOA 3Q89A 3AFGA 3DRRB 1QAJA 3IP0A 4JV5F 3HZ6A 1YJUA 5I3UB 4R0EA 1F21A 2HHXA 3NY0A 1ACMB 4BQLA 3G71S 2UUWA 1U2VA 3GIIA 9ICAA 3KBBA 4YOEA 4BDZA 2DEIA 1MMDA 3ULEB 2G8VA 2XCPA 2I8EA 2Y9HA 5JVGQ 3L95X 5ALPA 3IMQJ 3ZDDA 1TP7A 2QW9A 4LF7K 3BUZB 1LWXA 2ZVSA 3NS5A 3AJ2A 4ZLPA 4FJMA 2PFOA 2NV3A 4X64F 5IIKA 1VQ5S 5ETRA 3CJCA 2QB0B 4FK4A 2AX1A 8ICUA 2LKYA 3Q8RB 1BUXA 2OPRA 2DVIA 5M2RA 3RB6A 5J2HA 3CCEN 4WJ3B 1KSPA 2QTWA 1LV5A 4CO0A 1DURA 3P31A 1U1PA 2PMHA 1RDWX 4ZVUB 3H98A 1L5UA 2DKOB 3W3SA 5F9LA 3R3LA 4DZDA 3HX0A 2JEFA 2Q36A 2YMMA 1ZPWX 4AHRA 3MCSA 1X6IA 3ZO7A 4IR1A 2ZWHA 4IKAA 2O8EB 5IILA 2W6LA 3MBYA 2XULA 5C25A 3RJIA 2D1CA 4Y0WA 2XS5A 2MEWA 1YVFA 1VRTA 2A3JA 3VQEA 4HAIA 5DZ6A 3TA0A 8ICMA 2ZJAA 4LT6A 3O4NA 3GIJA 1LK7A 1Q86O 3KDNA 1SL1A 1N34J 3C1ZA 4KLEA 1NO8A 1K47A 5L8RC 1MMLA 2IA6A 1QHTA 1Q0NA 4I68A 1NAQA 4PKIA 1NHVA 4P74A 3TTDA 2DGZA 2E8PA 1K73T 4QOZB 4QW8A 3KKAA 3AO2A 3CFRA 1TAQA 2MKKA 3I56N 4E1NA 2ZH7A 3MAHA 1WI6A 1XO1A 4AF1A 1PK3A 1ZBFA 1X4BA 1SV5A 5LJWA 3J80U 3NGKA 1FJEB 1WC0A 3QFWA 2RU3A 4JKGA 3D6TB 4X65J 2AMCB 1KQKA 3LA0A 4WZQA 2VQFJ 1NNDA 2D8CA 2KT3A 8ICYA 4IDKB 5DG9A 3GFHA 4I6MA 3HVAA 4E1MA 3CSKA 1VQMS 4H5VA 4US9A 2BJDA 1CZBA 2J0WA 5CB1A 3K0JA 4J9UE 2PFNA 2W11A 2I1QA 3UXNA 1EX8A 2FBXA 4DFJA 2NUUG 4HDHA 5BR8F 3J7YP 3PSPA 4A8XA 5KG4A 8ICSA 1JI7A 1N0VC 5DDPC 5A0YB 3KD1E 1H73A 2M88A 2XEXA 3O2IA 1DARA 3IG1B 4ZHRB 1YI2N 2XG8A 4Y2SA 5DM7L 1ZAWA 2Q6CA 3O80A 3EGVA 4OGCA 3QESA 3AU6A 2V34A 4CJRA 3NVZA 2MSNA 3PX6A 3HW8A 1NKCA 4B3RF 3RG6A 3RFAA 4ZPCA 1FJ7A 3ONNA 2MY8A 4OJ5A 4CF4A 2FGCA 4P4PA 1NOZA 4IOAL 2WW4A 2L41A 3UQSA 4UF4A 3KHYA 2HHPA 2LBOA 5IIMA 2JXJA 3IS9A 4TUPA 1ZD3A 1JJ2R 2R7UA 3ZCMA 1URNA 2EK1A 2F8TA 2L9WA 4RQMA 3QICA 3KNAA 2IM0A 3LDOA 5M1NA 4JKCA 5DB7A 4FPIA 3CQ8A 4WE1B 1EP4A 4EYHB 4MF2A 4C7YA 4X62F 4L6V3 5ALRA 1IV8A 2QFIA 4TU8A 2G0AA 4EELA 4TY8A 4RQ3A 4UZBA 2LYVA 1FFUA 4UAWA 2HWIA 2UP1A 1QUVA 1IG8A 3BDPA 1Q8LA 5DLGA 5F8HA 5CP2A 2QZ8A 1IBLF 3KLFB 3N97B 3G82A 5AZIA 3FK4A