1NJXA

Thymine-guanine mismatch at the polymerase active site
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njxA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njxA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njxA01
4W5RA 4NLZA 1BGXT 4QWCA 4E89A 3AVMA 3RTVA 3CG7A 5CP2A 4YCXA 5KG6A 1KRPA 5FDLA 3MGIA 1NOYA 1S0NA 2P66A 4FJHA 4ZH4A 4MF8A 2XGPA 2A1JA 4KLUA 1EETA 1BL3A 4M47A 3WNFA 3O3FA 3U6FA 2O4GA 5DG9A 4DSJA 5J2CA 3GFKB 5J2QA 4JV2A 4ED3A 4DMNA 3SV4A 4ECQA 3U3GA 5KFSA 4QZHA 3M9OB 1RBVA 1RTJA 3QLHA 4I29A 3NGZA 2IC3A 4TUQA 2F1IA 1NOZA 3B6PA 3LALA 2G8IA 3H40A 2P5OA 3Q8MA 1UWBA 3DLKA 4DQPA 4CJQA 2I9GA 2OA8A 3N4MB 4G3IA 4FCYA 3S3OA 3KK1A 3VQQA 3HX0A 4CEAA 2KQ2A 1ZQAA 1Z00B 5D46A 3NGYA 4DTXA 3RH6A 2HNYA 3IRXA 2A1RA 3LP2A 3TAMA 2GWSA 1FKPA 2IHNA 4GC7A 4DLGA 3RJJA 1X9MA 8ICNA 4M0AA 2YV0X 4J9LA 2P51A 4QAGA 1XS9D 2QKKA 5D49A 3OYJA 7ICHA 4FJIA 3NF8A 4JRQA 3DI6A 4ZTFA 5KG4A 4YR3A 4XRHA 1RBRA 4NY8A 5HMMA 2E6MA 3V6DA 1IKYA 3QIOA 4KO0A 1EXNA 7ICLA 2V4QA 4FM2A 4PWDA 4DSFA 4MEXA 2FLLA 1XSPA 2B5JA 3IG1A 4CGGA 3QERA 1FKOA 4YR0A 4O4GA 3GV7B 4KHUA 5KFZA 4RQ2A 4I2EA 1LW2A 4CGHA 3T5LA 1VSEA 1MC8A 4KHQA 3EYZA 2GUIA 1RPLA 3PX6A 3HPGA 2FMQA 1C1AA 3TI0A 4HUFA 1JXLA 4IQTA 2XRIA 4C8MA 1YTAA 1HNIA 4J2DA 3OYIA 2X6SA 1UT5A 4NLNA 1HYSA 3MEEA 1N48A 4F3OA 1RXWA 2JEJA 3GIKA 2ISPA 9ICCA 2G8KA 1T3NA 2W8LA 3V9SA 3LAMA 1TL3A 2DTUA 9ICNA 1WSHA 1WSGA 4E7HA 2IGIA 3QIPA 4QOZB 3L2UA 2BR0A 3ZSXA 5KG2A 1KCFA 3VQ8A 3KLFA 3MXJA 4ELTA 1BPBA 1RT4A 1RBTA 8ICOA 4M3TA 4LSNA 1TK0A 3M8PA 3CM5A 4PGYA 2ALZA 1U45A 4EBCA 4JWNA 3QNOA 5J2DA 2HHWA 3CYMA 4LZDA 3HPOA 1U4BA 5CZ1A 2FLNA 2D0CA 9ICJA 4YD2A 3C21A 1IM4A 4UAWA 2I5JA 1RYRA 3RBEA 4DQIA 3C94A 3K5OA 4N47A 1S6PA 4I2CA 4KLIA 2X74A 4FO6A 3MFIA 3AO5A 1GOAA 1BPYA 4ECWA 3PMNA 1S97A 1JLQA 2AQ0A 1ZBUA 4M3WA 4UB5A 2VANA 2WOMA 4CIEA 4NYNA 1LAWA 5KFOA 3MEGA 2D5RA 4DU1A 4E19A 2R7YA 1L3SA 4O9MA 4DTRA 4KLTA 3JPOA 4CHQA 1B92A 5DQGA 4DSIA 3Q8SB 3KD5E 4DL6A 1ZQPA 5J0OA 4B8AB 5DLFA 1J54A 1Y88A 5KT2A 5HRPA 2BQ3A 1C6VA 2BGWA 4J2BA 4F4ZA 3GQCA 2FBYA 3OYLA 5HMLA 3NDKA 4UB4A 2PYLA 4JLHA 1SUQA 1RDCA 7ICSA 4K4GA 3KJVA 4BDYA 1JN3A 5J2HA 4E1MA 4J9RA 4CFAA 1J53A 5HNKA 3SZ2A 1SKSA 1GOCA 1ZQQA 2VWJA 2W9BB 7ICNA 3GIIA 2W8KA 4F5RA 1J9AA 4IBNA 5FRMA 5KRSA 3OHBA 4CERA 2D0AA 2JEGA 7ICPA 2ATQA 4DOAA 1QSSA 1RNHA 4DTMA 3N97B 4NCBA 4KMUA 2Q0ZX 2F1JA 2F8TA 3AUOA 4O3NA 4CJVA 1QLNA 7ICKA 2A1JB 3S9HA 4M6WA 2UVWA 3H8WA 1X1PA 1DLOA 4NM1A 1Z25A 4TUSA 3G0ZA 5KFJA 1TVRA 1WNSA 1BHLA 1YTUA 3RH4A 3D0PA 4F5QA 2PY5A 3ZDCA 2PYJA 4CK2A 4XA5A 4M2YA 3PW4A 1S1VA 3O4NA 4YN4A 5KFBA 3MAQA 2JEIA 4DS5A 1ZJMA 1RDAA 5J29A 4F5NA 4P4OA 4FJ7A 4NLKA 1S9FA 2HHVA 3RJKA 4M45A 5KG1A 3PW7A 1GOBA 4F4XA 4EYIB 2DFHA 3QO9A 5EWEA 4O3RA 3KK2A 1Q9XA 3PUFA 4I2PA 5EU7A 1ZQHA 4UAZA 4ECTA 4KLFA 3KLHA 4EZ9A 5J0QA 3K5LA 4ED6A 1Z00A 4OLBA 1JL2A 4H4MA 4IFVA 2E4LA 1ZQMA 3JPSA 2HHTA 3PO4A 3DOLA 3QE9Y 5KFYA 1BPDA 3VQ4A 4MFFA 4IQVA 1NK4A 3CQ8A 4H4OA 1SL1A 4DTPA 4CEQA 8ICEA 3HJFA 5DKWA 3TFSA 4KTZA 1VSMA 4MFCA 1HMVA 1TKZA 1B43A 3AU6A 2AU0A 3JPRA 4CF9A 4RW9A 4RQ5A 1L3VA 3QEXA 4E1NA 4FJ8A 1NK8A 5KFLA 1ASUA 2MAXA 5T7BA 4B9NA 3LPUA 1O1WA 2RF2A 5KT3A 5KFFA 5DK5A 5L1KA 4DF8A 4RU9A 3M8QA 5C25A 4UQGA 7ICVA 1T05A 8ICKA 2E6LA 1EX4A 3IAYA 4PPXA 1KTQA 8ICUA 2KW4A 1A77A 3TAQA 4IFYA 3H8JA 4F93B 1XU4A 2XY8A 4YQWA 3O3GA 4M9HA 3HPHA 3OYFA 5KFMA 1TKDA 2LYHA 4DFJA 3HVTA 1HJRA 4HYKA 1A5XA 1B9FA 2PXIA 1EKEA 2RDIA 3LANA 3AVAA 4JWMA 1T7PA 4Z6DA 2BPGA 3C23A 4ELVA 4Z6CA 4RW8A 3K5MA 3OYGA 5HP1A 1BI4B 4B9UA 3TQ1A 4DLEA 4P4PA 4R66A 1C0UA 4CJTA 3Q8LA 3KKSA 2ZJ5A 3OYBA 4N76A 2IDOA 3TAGA 2VG7A 3L2WA 2HB5A 5CY4A 3CFRA 4CF2A 4N41A 2MUTB 8ICBA 1WLJA 1S10A 2Y1IA 3HW8A 2C28A 1NK5A 1G15A 1SL0A 3OYEA 3NH1A 4NM2A 1ZBHA 2BANA 4ECZA 4Q45A 1U49A 1TGOA 3RBDA 5KGXA 5HBMA 4UB2A 4MFAA 3L2VA 1SKWA 4AILC 2XY5A 4DOBA 5C42A 5L1JA 4F50A 4QZCA 1X2IA 2J6UA 3OVNA 3JYTA 1BISA 3DRSA 2FBVA 2QKBA 4CCHA 4KLQA 4E0DA 2BDPA 4I9LA 4IRCA 4B9MA 2OPSA 3ZSZA 4RT2A 3BQ2A 4DOCA 3AVFA 2BCUA 2VA8A 1VSHA 1Q8IA 2C2RA 3OS2A 1WCNA 1XI1A 2NRXA 4PA1A 1JL1A 5J2IA 3PW5A 3RJHA 1HUZA 5HRSA 4OLAA 3AO4A 2R8HA 1ZQNA 4F2RA 3GDXA 3SQ0A 4M3ZA 4HVJA 1D9DA 1A5VA 3B0XA 5IIOA 4M6WB 4P2HA 5CZ2A 2ASDA 4KHNA 3NGIA 3MR3A 4I28A 5IINA 2W42A 4DQRA 4LY7A 2G8FA 1CXQA 1TKTA 3SYZA 1N6QA 4Q43A 3B0YA 4I2AA 4EBEA 3MXMA 4M41A 3LDAA 9ICSA 3SUQA 3QEAZ 1ZQTA 3JPPA 3SUPA 1VSIA 1H38A 3ALYA 1RYSA 4CJKA 1CXUA 2ISOA 4RQ1A 3PX4A 5KFEA 3ORYA 4DFPA 4DL3A 3PV8A 4RPXA 2OZSA 1VSFA 4FLUA 3DOKA 4KLLA 1ZBLA 3H4DA 2V9WA 4DL5A 1Z3EB 4OPJA 4ECSA 1RZTA 4QZFA 1AROP 3M9NB 4DL7A 3VA0A 1JXEA 1NKCA 4B9SA 4CEZA 1Q9YA 8ICLA 3MEDA 4KKOA 2YKNA 4CECA 5DG8A 4IKFA 3ISCA 4Q0BA 1LWFA 4X5VA 5J0WA 4O55A 3H7IA 2AQ4A 4DQSA 3RWUA 2PFQA 4BDPA 2DPJA 1HYVA 3C2KA 2HVIA 7ICEA 2X6NA 3EW9A 5KFUA 3T5JA 3T19A 9ICLA 7ICMA 2AGPA 5C24A 1BPXA 2BQRA 1C1BA 2NUBA 2XY7A 1XWLA 3WNGA 1NJWA 4KTQA 4KREA 4CFBA 4E7KA 3HWTA 2BCSA 3OSNA 3LWLA 9ICIA 4EYHB 1WSIA 3LPTA 4DS4A 1S1XA 3SQ1A 5L9XA 4NLGA 3OYDA 4CJLA 4FLYA 3MDCA 4LH5A 3H8SA 1C7YA 2ZTDA 5F9LA 4RQ8A 4KFBA 4CJUA 2HHUA 1XO1A 3IHQB 3V9UA 1BVSA 4BDZA 4KB0A 5J0TA 3OSPA 4ID1A 3MXIA 5DLGA 4CEEA 3RH5A 3RR8A 1BQNA 3MR6A 1NKEA 3RJIA 4KLHA 1L3UA 3KHGA 3KLIA 2YNFA 4DO9A 5KFKA 1TVAA 3KHRA 3KHHA 2VG5A 4J9OA 3LP3A 4CF8A 3JPQA 1NJZA 4ELUA 4E3SA 3QESA 4F4KA 1U04A 2IBKA 2RKIA 3PY8A 4LH4A 2UVUA 3NFAA 4BXOB 4BWJA 2H5XA 3LAKA 5KFTA 3TAPA 1RT6A 4O5BA 5KRTA 5DG7A 2KZ3A 4B8CA 2XY6A 1S0MA 5SWMA 3KK3A 2Z1GA 4FLXA 3Q8KA 3BGRA 1L5UA 4PHPA 2EX3A 4DTJA 4IRKA 3AVIA 3L3VA 3RAXA 3AA4A 2FBTA 3UXPA 4HTUA 3THVA 2VA3A 4I2GA 3S3NA 1UT8A 2C2DA 3AVLA 2W9CA 3IM1A 3RJEA 4WE1A 4EEYA 2HHXA 1YVUA 4F92B 1ZQRA 3SQ2A 1ZQSA 4KRFA 3OGUA 4M9GA 1EXQA 4BGDA 1BI4A 2RPIA 4NCAA 3AO1A 7ICQA 5CYMA 1DOQA 1KLMA 2IMWP 4R65A 4KLDA 2DFLA 3K4GA 4N56A 4UBBA 3V1QA 1S0VA 4RQ4A 3SQ4A 4FJLA 4OKJA 1NKBA 4FM1A 4AHSA 1RCHA 4F2SA 4K4IA 4LSLA 2MUTA 5BOMA 1HJPA 3C1ZA 1TKXA 1N56A 1BQMA 3DLHA 1Y97A 1A76A 4YXJA 4ECXA 1B9DA 3B6OA 4O5KA 3DLGA 3HP6A 4BE1A 1KFTA 1SKRA 1LV5A 2DFEA 4I27A 4I2HA 4CIFA 2PZSA 4UAYA 1JKHA 3D45A 3U3YA 1WSJA 5KT4A 4QZIA 1U47A 3T3FA 3MDAA 3CM6A 4OKEA 3K5NA 3OS1A 3QEVA 1D8YA 3ZSWA 3TFRA 5J2MA 3VQDA 1UAXA 9ICVA 3JSMA 3G6VA 4KI6A 4RQ0A 3RAQA 4Q8EA 3F9KA 4RPYA 1S9GA 4EP4A 2OPQA 4PHDA 3RJFA 1TK8A 1KLNA 3E01A 1KVAA 5J0SA 3ZCMA 4L8RB 1VRUA 9ICBA 4R8UA 3EY1A 3BQTA 5IIIA 1S0OA 5DQIA 5DB9A 3C95A 1CLQA 4DFMA 2F8SA 4RW7A 4ED1A 5KG7A 5BPCA 4HUEA 3G6YA 4KI4A 4Z6EA 5KFGA 5KFNA 1LWEA 2XCPA 1QQCA 1WSEA 4HCCA 4OVLA 2QXFA 5DDMA 3PO5A 3ZSRA 4YG2A 3PW2A 4RW6A 4DEZA 5HROA 3V4IA 2ASJA 3V9WA 2FPMA 4FK0A 4KV8A 3OY9A 3IS9A 4Z0UA 4ED2A 4DSLA 5J2NA 9ICGA 3RB0A 2ATLA 4XIUA 2O4IA 3T1AA 3OYKA 3MGHA 4N5SA 4JV1A 2HVHA 2IA6A 3V6KA 1HPZA 3MR2A 4OKKA 2M9NA 3NGDA 2R8KA 8ICFA 3O3HA 2XHBA 5IILA 4J9KA 4DQQA 4PQUA 3AVJA 2JZBB 4JS5A 1VSKA 3C2MA 4DTUA 1JIHA 5DBAA 3EWAA 3C2LA 4CESA 1W9HA 2AJQA 4JUZA 1IH7A 1BIZA 5CB1A 3UIQA 1ZQXA 4QWEA 4F91B 4Q8FA 3V1RA 1TV6A 2BGGA 1K1SA 3V7KA 2DY4A 5HRNA 2UVRA 1ZETA 3VQ6A 4ZTJA 4FK2A 2G8UA 4IQWA 3NTUA 2F96A 3QNNA 1UA0A 2BHNA 3OYCA 5J2PA 1XSNA 3L2QA 2DFFA 2XCAA 1SL2A 4BACA 3A2FA 4I2JA 2FMSA 1BCMA 3VQ7A 4BE2A 3QETA 5KFQA 2P1JA 4J9MA 1RT3A 2NRWA 1Z26A 3P5JA 4CJ4A 4LVSA 4PHAA 3HVRA 4YD1A 4KLOA 5DB7A 5J0YA 3GILA 4KLMA 4CGIA 4TURA 3VA3A 3ULDA 2HNZA 4KHWA 5SZTA 4O3QA 4KTWA 3ISDA 3HM9A 1W0HA 1C1CA 2HW3A 1TAUA 3SUNA 1ZQYA 2JLEA 2ZJ8A 1QSYA 3DM2A 1N5YA 4BXOA 3RR7A 2YNIA 3AVGA 4Z4HA 5HHIA 8ICWA 1PZNA 1ZQUA 2ZUBA 2VWKA 2HHSA 1RILA 2PFNA 1XHXA 3BQ1A 4YXMA 3DLRA 1ZYQA 3LP0A 3RB4A 3PVXA 3NF7A 1S6QA 3V9XA 4YVZA 2DPIA 3KIOA 4QW8A 1BIUA 1NK6A 3ZDAA 1IO2A 4CHOA 3EPGA 1ASVA 2W9CB 4KAZA 4FZZA 4YMMA 5KFIA 4IG3A 4KHYA 2FMPA 4TUPA 3DRPA 1F21A 3UQ0A 1IKXA 4ED7A 4C8KA 4Z6FA 3AA5X 2BCVA 3NCIA 3LDSA 5BOLA 1ZQLA 4CJRA 2XC9A 9ICAA 3UQ2A 4FJXA 4JV0A 4I2QA 2G8WA 3G10A 4FJ9A 4FJJA 3SPYA 1KVBA 2VA2A 1VSLA 4J9NA 5IIKA 5FRNA 3KLGA 4UB1A 8ICPA 4FJMA 3MECA 4J9SA 1C0TA 4AHVA 5KFAA 5EOZA 5DMRA 3OYMA 5KFWA 2OPPA 5I3UA 3GIMA 1CEZA 8ICRA 4I2IA 5EWFA 4CJPA 2BKEA 3SI6A 5K14A 3PR5B 5KFHA 3OYAA 3UPQA 1TAQA 2B21A 8ICMA 2Z1IA 4M42A 3MFHA 2WONA 8ICSA 3QEBZ 2VG6A 4FBUA 4O3PA 3TABA 1VSDA 9ICOA 4C8LA 3JPTA 1ZQOA 5CJ7A 1XSLA 3ZSVA 2EHGA 4DL4A 3DMJA 3CFPA 5KFVA 4E7LA 2G8HA 2J6TA 4W5QA 4NXZA 3AA3A 1LAVA 3ZSYA 1D8LA 3KHLA 5FROA 5I42A 4GLXA 4KB1A 4IR1A 4ID5A 4QWAA 2XGQA 3RB6A 3VQCA 4R8UB 4H8KA 3ZDEA 4IRDA 3Q8RB 1SV5A 3ZT3A 4PGQA 3NHGA 4Y1DA 4PGXA 4C8NA 3K2PA 3OHAA 3C5GA 2Z1JA 3Q8PB 3V9ZA 4B9TA 5KG3A 3HL8A 4M3XA 1HYZA 1MSWD 4FZXC 3PNCA 5D4BA 5KG5A 5F9NA 5L1LA 4TSXA 4B3OA 2IS3A 3NAEA 2I1QA 3NE6A 5J2KA 4DWIA 1SZPA 5JUMA 1IKWA 4ECYA 4CHPA 5J2BA 4CJFA 2QK9A 4PY5A 4RUAA 9ICEA 4FM0A 1ASWA 4B9LA 1ZQVA 3LK9A 1BCOA 3RRHA 4FK4A 3TAFA 9ICMA 1KFSA 3O4QA 5KFDA 5L1IA 1ZQGA 3RMCA 4AHRA 3C1YA 3QEWA 1U48A 4B08A 2HMIA 2ZTCA 4R5PA 4OJRA 4CEFA 3OYNA 1HRHA 4O3SA 3BDPA 4XQ8A 4FXDA 4F3TA 3C6UA 4DG1A 1WCLA 2JZBA 4KITB 7ICIA 3K59A 1CZBA 4RNMA 3HYFA 4M3RA 5KFRA 4RT3A 3M8RA 3C5FA 3ZSOA 3WNEA 1NK0A 4CHZA 2YNHA 2YNGA 7ICGA 1RT5A 3PR4A 3ISBA 3JPNA 5DB6A 1RTDA 4KN7A 4CEOA 1KEJA 1KFDA 1JLAA 3V6JA 1YT3A 3ZSQA 1NK7A 1X9SA 4IDKA 1QHTA 1ZQWA 1RDBA 4O44A 1XHZA 1RTHA 3G6XA 1C0MA 4O3OA 1DTTA 1KVCA 4FW1A 3VQPA 5KFXA 1JX4A 4CEDA 4FJ5A 8ICAA 2BCQA 4CEBA 4F5PA 4DFKA 1JLFA 1NJYA 4Z4CA 2KTQA 2KZMA 5CA7A 1I3AA 3LWMA 4YMOA 4QWDA 3H08A 4FLWA 2BQUA 1HNVA 4W5NA 4HUGA 3V7LA 1S76D 3ITHA 5JS2A 2HHQA 3EZ5A 4CHYA 1TFRA 1TV9A 2FC0A 1S1TA 4CF1A 3KKRA 3BQ0A 4CGFA 5KT7A 3AO3A 3M8SA 4CF0A 1D9FA 4BWMA 9ICQA 3AVKA 2B6AA 2KFZA 3QEPA 2BCRA 5J2GA 4FJGA 4Z4EA 8ICJA 3V7JA 2FPKA 3ZT1A 4IG0A 3VQAA 3ASMA 3LP1A 4K8ZA 1QS4A 3HXMA 1S77D 4QCLA 5DBBA 4CE9A 3ZT0A 5HP4A 8ICYA 4CIGA 1RDDA 4KN4A 3ISNC 2Q3SA 4KPYA 4AHUA 1VRTA 1S9EA 3AV9A 4IR9A 2ZJAA 5J2EA 2ZQBA 4GXKA 4EP5A 1LB2B 4LD0A 4AH9A 5J2JA 1RXVA 4DU3A 8ICGA 4PH5A 2NRTA 1UOCA 2A1SA 4Q5VA 4GXIA 2X78A 1ZQBA 3MR5A 3QZ8A 4M9NA 4DL2A 5HRRA 4KLSA 4FYDA 3NF6A 2BPFA 3Q8QB 7ICTA 1IG9A 9ICRA 2ASLA 1ZQEA 2KN7A 1S5JA 1QSLA 2NRZA 1NOMA 7ICOA 3RMAA 9ICPA 5KI6A 4M3YA 2OYQA 5J0PA 4W5OA 4KLEA 4RZRA 1ITGA 1RT7A 4MQ3A 3L2RA 4DSKA 2ZE2A 1UA1A 1NJXA 4YR2A 3KLEA 3TAEA 5JS1A 4KLJA 4I9QA 3NF9A 5IIMA 1S1WA 1IKVA 5DGBA 2JGUA 1ZQIA 4W5TA 4AHCA 2W9MA 2R8GA 4RQ7A 3H4BA 5J0RA 4Z4FA 4CGDA 2J6SA 4QWBA 4P4MA 4XUSA 3GV8B 4DU4A 3FDSA 5KG0A 1TK5A 1RT1A 3CFOA 4F5OA 8ICIA 1B22A 3P83D 4TQSA 4KHSA 4B9VA 3RRGA 5DDYA 3SV3A 2UVVA 3GV5B 4ECUA 1ZQZA 2B4JA 3HO1A 4OPKA 1MQ3A 1WAJA 5CHGA 3ZDBA 3VQ5A 3KD1E 4Z4GA 1EP4A 4YP3A 5KT6A 4J9PA 1JLBA 4OGCA 4QZEA 4CJSA 3UXOA 1KDHA 4F4WA 4FW2A 4Z4IA 8ICVA 2P6RA 4YMNA 4QW9A 4JK1A 2BPCA 5DB8A 4KLGA 4QZBA 1V9PA 4RNOA 4FS2A 1DTQA 4ICLA 2R8JA 2Z1HA 4GW6A 5HLFA 4FLTA 5KFPA 4E7JA 3ZT2A 1X9WA 1TL1A 4RG8A 4CHNA 2RDJA 2ITGA 3NH0A 1CUKA 1LWCA 3AA2A 3MABA 1JLEA 2ZTEA 1ZQCA 4MEYA 3M9MB 3DLEA 4MF2A 1COOA 5DGAA 1A5WA 2XO7A 7ICUA 1WSFA 1BPZA 3SNNA 2PFPA 5IIJA 4PUOA 1VK0A 1NK9A 1XC9A 4CFCA 4M9LA 9ICXA 4F4YA 4J9QA 5E41A 5TZVA 4J2AA 4FS1A 3HT3A 4MFBA 1J5OA 1LW0A 4F8RA 4JRPA 1KSPA 1HUOA 1ZQFA 3S3MA 5CYQA 3DLBA 3VQEA 4CK3A 4FZYA 8ICXA 3OYHA 2LSNA 3DYAA 1T4GA 3MBYA 4TQRA 4K8XA 8ICTA 2ZUDA 4DF4A 1MQ2A 3RMBA 3K75D 4K4HA 2PI5A 3QEIA 3WNHA 3RJGA 4CFDA 4HHTA 1REVA 4CK1A 4C8OA 3LZJA 2RN2A 4O5CA 3TWHA 4RQ6A 3GIJA 4E7IA 1JXBA 4RW4A 7ICJA 4GVMA 3P1GA 1K6YA 2IAJA 3ZD9A 2HNDA 3SPZA 3RB3A 5J1EA 8ICZA 1S1UA 4I2FA 2C22A 5J2FA 1ZJNA 1CZ9A 1BPEA 4Q44A 4DTOA 3V81A 2FBXA 4FLVA 4FLZA 1VSJA 4RPZA 5KGWA 5DQHA 5CWRA 3AVNA 2IOCA 7ICFA 3ETLA 4NYFA 3OJSA 2GBZA 4M9JA 3L3UA 4ED8A 4O0IA 7ICRA 1QTMA 1FXXA 3C6TA 5D3GA 1RTIA 5KT5A 4PHEA 1T8EA 3I0SA 2YHAA 3UXNA 1HQUA 2FPLA 2G8VA 2OPRA 4YFKA 3V1OA 3SCXA 3AU2A 4I2BA 3RMDA 4GC6A 3OS0A 4ED0A 2V4RA 5DBCA 5KTQA 2OZMA 3SJJA 4RUCA 8ICCA 2ETJA 3V6HA 4GMJB 2AGQA 2ZUCA 5KFCA 9ICFA 3VQ9A 4CGJA 4UB3A 3FFIA 4I7FA 5EWGA 9ICHA 9ICUA 4BE0A 3BJYA 4DSEA 5CR0A 4AHTA 4QZ8A 4OGEA 2NRVA 3ZD8A 4HCBA 3V72A 4JS4A 1DGSA 4G1QA 5HHHA 3HK2A 8ICHA 4ECRA 2GV9A 3PW0A 2PI4A 3KTQA 3SI8A 2OWOA 1QE1A 3TANA 4I2DA 3EPIA 3AVBA 3PX0A 4CJ3A 4O0JA 9ICKA 3ZT4A 1RBUA 3HP9A 1ZQDA 3QZ7A 4CJWA 2P6UA 3QINA 1IXRA 8ICQA 3VN5A 3F73A 1FK9A 4M3UA 4FJKA 5J0XA 2ZD1A 1JLGA 3OJUA 2WTFA 4GXJA 3VQBA 4RQ3A 3K57A 2R8IA 1JMSA 9ICTA 4NCGA 3ZDDA 1RT2A 9ICWA 3NH2A 4O5EA 1ZBFA 3AO2A 2P5GA 3TR8A 5C5JA 1ZQKA 4M04A 4QZGA 4FJNA 4UBCA 1HQEA 3SUOA 3I8DA 4FVMA 4QZ9A 3T5HA 3TARA 4Y1CA 3FYHA 1WN7A 4IQUA 1L3TA 4FBTA 2F1HA 4ECVA 4LZGA 3AVHA 2W9AA 3PMLA 2IHMA 2C2EA 3AVCA 4J2EA 3T5KA 4CJ5A 2FLPA 1ZQJA 1JLCA 4YNQA 2KZZA 3LZIA 1K1QA 4R64A 2PFOA 3DRRA 3NBPA 1MU2A 4DTSA 2JEFA 4EBDA 3L8BA 4QZAA 4ZHRA 1U9LA 3I0RA 4YFUA 2AGOA 1I39A 1R0AA 2BE2A 4R63A 2YKMA 4DTNA 5J2AA 2D0BA 1ZBIA 4QZDA 3E2EA 1RBSA 4CJEA 2KFNA 1D5AA 1WAFA 3HSTB 4EZ6A 2YHBA 4RNNA 2Y1JA 1T03A 3K58A 2W9BA 5J0UA
chains in the Genus database with same CATH superfamily
1R6YA 5C15A 1URJA 3IC1A 2B8PA 4QWCA 2FHOB 4FL9A 5LMUJ 4AFFA 5DM6Q 3AVMA 3RTVA 4BQLA 5A76A 1U1QA 2A10A 2WVDA 4CLKA 2HVZA 3MGIA 1B0VA 5JVGL 5AZIA 2ZHBA 3DLEB 4CNQA 2EFQA 2ZBPA 4MF8A 4OI3A 2P6TA 4JKDA 1EETA 3WNFA 3O3FA 3Q2TC 1MDUB 4BR2A 2O8FA 4CH1A 1H0HB 1RU1A 4GNIA 4MFBB 4CF5A 3SV4A 4WCEL 1LKZA 4DR6J 5CYQB 3NGZA 4DU8A 3ZETA 5GAEP 4Y34A 2F5GA 2VJUA 3DYAB 3HHDA 3HJEA 3Q8MA 1UWBA 3E51A 3QNMA 4OYAA 1RAAB 3H5SA 3IBFB 1F0XA 5IT4A 3S3OA 5A8KB 4USMA 3FCVA 1TTHB 4CEAA 5D46A 1VHFA 2F9DA 2YKPA 5BPMA 3DOLB 2LA4A 2OYYA 2Z30B 1DY3A 4C97A 3MMAA 1UKUA 3GG0A 2HNDB 2UU9F 4CM0A 2MYFA 4M0AA 1HKGA 1XS9D 2ZVSA 2BH1A 1KQSM 5D49A 1IJEB 3OYJA 4PWUA 3RSEB 2AWZA 2HQFA 3SK3A 3QRQA 1LEOA 3DI6A 3TX0A 5K4LA 4ZP7A 4IQXA 4IC9A 4XRHA 1KAZA 3MUTP 1L8OA 1DGJA 7ICLA 3ILOA 3KDNA 4FM2A 3MWBA 4DR4K 4RWWA 4PWDA 4H0OA 1BA1A 4KHPJ 4MK7A 2RHKA 4MEXA 2GX9A 1B99A 2E5IA 2XNRA 3IG1A 4TU7A 2BKPA 1FKOA 2HSTA 3SLCA 5BR8J 3THXB 3A8EA 2EKYA 3WUHA 5F0XA 4NLDA 3PX6A 2FMQA 1JALA 2EEYA 1C1AA 4HUFA 1IN0A 1ZM4A 1X5SA 4J2DA 3L7UA 2KM8C 1KOOA 3MEEA 4ZLNA 1N48A 1MN7A 4GKKJ 5H9EJ 4MIAA 2W8LA 3A3OB 3W8GA 2L3MA 2A3ZA 2PEBA 3F56A 1TL3A 2IIRA 1MMDA 2D7SA 1YBTA 4RPFA 2VZ9A 3QIPA 4M63A 4BR7A 1KCFA 3VR1A 1HI1A 5L1MA 1KXPA 2C3YA 2XI3A 2JHDA 4X4PA 2HHHF 3DGVA 3MXJA 4BC9A 2COLA 2BJ8A 2OM6A 3RFAA 4OHWA 3IMXA 3UD4P 1U1OA 1NBEB 1VQ9S 3CM5A 4PGYA 2ALZA 1U45A 1VI7A 3QNOA 1NPKA 3CYMA 1FK9B 4B3RK 2CQHA 1M6YA 2FLNA 2BKNA 1C0UB 2D0CA 2EZYA 3EVOA 4KH1B 2HWIA 1RYRA 1LXNA 2D8CA 2A40A 3RBEA 4LRBA 4DQIA 5AQMA 3K5OA 4I2CA 2X74A 5EVZA 3MFIA 3HKWA 3AO5A 1ROFA 1GOAA 4DV4J 1S4FA 1HQEB 4JK8A 3DAWA 2BV3A 4ECWA 1RJJA 4OV1A 1S97A 5LMUF 3EUB2 4WQ4C 4M3WA 5IM0A 5T7LB 2KM8B 1WC4A 4JD2A 4HVZA 4USJC 1PYTA 3FUYA 3MEGA 1ESVA 1T9VA 2RT3A 4E19A 3DRYA 3BREA 3OFFA 4DTRA 3FBFA 4KLTA 2G1HA 2A2CA 3JPOA 4Y2AA 2FXUA 4NLSA 5BN9A 4OJOA 1F5BA 4I69A 3G6EN 3KD5E 5CH7B 1ZQPA 3DDNA 1CJUA 4NRUA 2DIUA 4B8AB 3HSJA 1U09A 5KT2A 3MMBB 3I0RB 4DR6F 4G65A 1C0GA 5H1SV 3C29A 1RAIB 1VRQC 1WORA 2FBYA 1U6BA 6FD1A 1RADB 3OYLA 3NDKA 4NO7A 4JLHA 3UVJB 1P9QC 1NJIO 4BDYA 1S6OA 3VOVA 5J2HA 1PJ7A 1EKSA 3E0FA 1HBUB 1SIWB 4J9RA 3R7BB 1APSA 4BGAA 1SKSA 2QMXA 1B7YB 2W8KA 5AKGA 4ZJQA 3ELHA 1VQYA 3D2FB 2JEGA 4DOAA 2OXOA 4CH0S 5FDLB 3C19A 3J7AN 2F8TA 3AUOA 1JK9B 1RCOB 1SCJB 2Y1LB 4PL2A 3ENAA 3F9MA 2Z8QA 3H8WA 2KVIA 1TVRA 4BRDA 4C3KA 3VAHA 1WNSA 2KB2A 1WACA 4LF8K 3O1BA 1R6VA 3TZWA 4CK2A 2MEWA 5K8MA 2LEBA 3W5ZA 4KHPF 2JEIA 4DS5A 3MEDB 2L48A 4OI1A 5J29A 2W3RA 1RXOB 3JTOA 1S5LU 4FJ7A 2DNLA 4NLKA 4QYZK 3HBTA 4Q0BB 3HSCA 1S9FA 5BR8F 3V4MA 4UAUA 2HHVA 2C3UA 3CDBA 3CC2S 2H51B 3CVKA 4M45A 2HNYB 5KG1A 3HZGA 3MF5A 2MB0B 1XNQK 1UVKA 1GOBA 4F4XA 3L4BC 1RKIA 2KT5A 4EYIB 1YITS 3QO9A 3WK4A 4KE5A 3H2UB 4RTFD 5FPDA 1FKPB 4DX5A 4KLFA 4UAZA 2YBVA 3MPYA 4EZ9A 1GEHA 3K5LA 4MDAA 1Z00A 4H4MA 4GKKF 4IFVA 1ZQMA 1T3VA 3PO4A 2FVCA 1GK8A 5IQQA 2Q79A 4PG8A 2FHMA 4MFFA 3T9NA 3TUPA 4IQVA 4RUHA 1DHMA 3NLCA 1SL1A 5CXTA 4V19S 4CEQA 2LVWA 1IKYB 4KTZA 4MFCA 1HMVA 2CKWA 3TNVA 1BQNB 3AU6A 1FTCA 3S6EA 4ZOSA 3JPRA 3GU3A 3GU0A 2W2OP 4RQ5A 4DR1J 1T9TA 1L3VA 3FC4A 3QEXA 4E1NA 2WVFA 3WQUA 1S6UA 3NVKA 2ZIUB 1BWVA 3HFVA 5HI7A 3K89A 3LPUA 2XZTB 2K4PA 2YX1A 2RF2A 4DV5F 1WUAA 4DV4F 3GJRB 3BSNA 2CQ2A 4J91A 3CIPA 4CLSA 5C25A 2E1EA 2AKWB 2YPZA 3DLLQ 1EX4A 3IDHA 3MAHA 5EGYA 1WWHA 2Y0SC 3M4XA 2CJXB 3O3GA 4M9HA 1P8ZA 3HPHA 1RT4B 5KFMA 4FSVA 2LYHA 2AZ3A 1HJRA 4HYKA 3H1VX 3EX7B 1B9FA 2X3GA 3GYGA 2FJEB 3PRDA 2V68A 4OHZA 1UWAA 3CJKA 3CJ0A 2FJBB 4WFXA 2UXBJ 4FN5A 4PL7A 1QCKA 3MAAA 1UVLA 3G71N 3ILIA 3ULEB 4B9UA 2KJWA 5LY3A 3O0FA 2ZJ5A 1L7NA 1Q18A 2ZZMA 4N76A 1HL6A 2VG7A 5CY4A 3CFRA 1N2XA 2K7KA 4CLPA 4N41A 4RWTA 2MUTB 4DPXA 1CJTA 3ETOA 1YJNN 1G7CB 2GHPA 4V1Ak 2BANA 4Q45A 4LFCJ 1RHQB 3EGVA 3U02A 1E3MA 5KGXA 3A13A 3GLJA 2QFJA 4AILC 4NLXA 5C42A 2HCFA 1NDCA 3THPA 3VGMA 3N0VA 4KLQA 2ZIWA 4E0DA 3MEKA 4B9MA 2MGZA 4NLUA 2HBJA 1TUGB 4R0EA 1DXSA 1N34K 1FO4A 1R0BG 3OPXA 1QM9A 2GUPA 3S6JA 1J5EJ 4I6MA 3TVKA 3F2KA 1QHAA 3R9PA 3OS2A 3CNHA 1XI1A 4PA1A 2GVDA 3E01B 5ETLA 5J2IA 3BF1A 1YVNA 2P9CA 1HUZA 1Q79A 3KJQB 2K2PA 3HKZD 4QIGA 1PC5A 2GW8A 4OLAA 1K47A 2JJ4D 2R8HA 1M5KC 1U1PA 1HW8A 3UDLA 3L6QA 1P1TA 1XR7A 3CGIA 4NRTA 3NGIA 5IINA 3SAHA 5AJ3K 3CF5L 2KV2A 4ER8A 3TA0A 1BO5O 1CXQA 3CXCM 4EBEA 2HVDA 2ADCA 2FC9A 3OUYB 3MXMA 1M5SA 4M41A 3SUQA 1ZQTA 1Q1KA 1NM1A 2B51A 1H38A 4QBUA 1ZAWA 5AM0A 1T02A 3BSCA 1L7PA 1S1VB 3M6GA 1IG8A 2V52B 4DCCA 4U9RA 1KW4A 4DR1F 1VSFA 5BRHA 2ZZNA 1ZBLA 3KZXA 1Q4RA 2CA9A 4ECSA 2A0FB 4OPJA 2HDOA 3E9OA 2LLZA 3ID8A 2HOIA 1X66A 4AUKA 4BC2A 4KKOA 4FOIA 3H20A 2QLBB 4JI1K 2DRBA 5LJWA 2VPWB 1OH8A 3OLBA 1O03A 2DPJA 2D41A 3D7EO 4AYBD 5AK4A 2EG1A 3TX8A 4NV0A 1D4XA 2CQBA 2BCSA 1FVSA 9ICIA 5DM6L 3MMVA 1U25A 4EYHB 1WSIA 1U1RA 1Y10A 4NLGA 4WYBA 3OYDA 4MN4C 1PAUB 3FRYA 4LH5A 5AQNA 4LREA 4EHUA 3NY0A 3T1YJ 4JI4J 1S3XA 1G4CA 5EE1A 3MXIA 3H2VE 3HHLC 2UXBF 1SAZA 2IRUA 4FKXA 3RAMA 2R7XA 1F0MA 2YB4A 1L3UA 2YNFA 4TLQA 3MWTA 3UE5A 4JV5J 4CF8A 4HDGA 1CJKA 4XH4A 3JPQA 3WK7A 1L8LA 2RKIA 2EFVA 2V67A 5ALPA 3NMRA 2ZH7A 1RWVB 2F8LA 4BXOB 2QSWA 1QTNB 3H6EA 3LAKA 5AQWA 2GJIA 3UN5A 5KFTA 4O5BA 5KRTA 4LFCF 5DG7A 2G4BA 2XY6A 3HVTB 3KK3A 2A3VA 2Z1GA 3D2NA 3Q8KA 1HARA 4YOXA 3CCJN 2KH9A 4RR5A 5B66U 4IRKA 1CULA 3AVIA 3KJNB 4M5MA 2OD4A 4YDUA 4A8KA 4C6AA 2OEJA 3GE1A 2GH1A 2XULA 4AM6A 1BWFO 3DXMA 3HHLB 4HTUA 3ZLJA 2QWOA 2H1YA 2W9CA 5AQHA 1PBAA 4PYDA 1J5EF 4EEYA 1UTAA 2HHXA 5J8YA 3EZOA 1YVUA 1FFGB 4F92B 1ZQRA 3CCRN 3IO1A 1HHSA 2FPHX 4UOGA 1Q46A 3WBZA 1VQ6S 1SZ2A 2R7QA 3H5UA 2CZ9A 4B3MK 1DOQA 3D6TB 2NR0A 3PRVA 1TYQB 4N56A 4HKQA 2OPPB 2IVYA 3NVYA 1NKBA 4CLLA 2GIQA 4FM1A 1B4FA 2KIVA 5AKJA 2R4FA 4F2SA 4K4IA 2MLXA 1XNRK 1O0PA 3RU0A 3QMLA 3PEJA 1HNXK 5BOMA 1VQ4N 5L46A 3OW2R 2IYIA 4DR7J 1KQGB 2YY3A 1TKXA 1N56A 4A8QA 1BQMA 2UXCK 3VZHA 1B9DA 3B6OA 2F7TA 3IR5B 3CD6N 2OPSB 3BH7B 2UUTA 1X60A 3WK8A 3O6QA 2I1RA 1Z2ZA 3U26A 2E8PA 4A4JA 2YI1A 1XMOJ 1OPIA 2DGWA 2DFEA 3VF4A 1XEZA 1JKHA 4LF7K 4K4WA 1YTYA 3U3YA 1U47A 5A2QO 1KN6A 3MDAA 3QEVA 4GIBA 1OO0B 3TFRA 3DHXA 4K41A 1HHQA 3QWUA 5A6PA 3G6VA 3GZ7A 4Q8EA 2GAGC 2NNWA 1R43A 1WG1A 1P7DA 2JX2A 5J0SA 3ZTPA 2W1BA 3EY1A 1HI0P 2QEXS 5DQIA 1YF5L 4IZ9A 4IO8A 2NO5A 5GMDA 4KHRA 1N6QB 3CDUA 2R2SA 1NLVA 3G4SS 5CZVA 5M2RA 5D0HA 2C3MA 2XCPA 3U1NA 3QRRA 2X7IA 3T1YF 4JI4F 4DUZJ 5A8RA 2UUAJ 3F5TA 5GINA 3PM9A 1JJHA 3PW2A 2ZH1A 2LDYA 3DOKB 4DEZA 3QDKA 3QUQA 3R6LB 3IS9A 4H4KA 3ZTOA 2HGNA 2BBEA 2UV8G 3Q7BA 3HSZA 5C2CA 2X1FA 3R2CJ 2YKNB 4JV5F 4ED5A 3MGHA 4HHJA 4WBFA 4ISEA 2EWSA 2HVHA 1LWFB 1E6YA 3ZZOA 2R8KA 4CQ1A 4PQUA 4DQQA 2HS3A 5D0RA 5GAHU 2E1YA 3SBGA 3K7RA 3C2MA 1WC1A 1NGAA 5DBAA 2VC0A 3J7ZO 3M1VB 2PFDA 5DDPC 3MPDA 5CB1A 3UIQA 3ZZPA 3CCES 3K17A 4OJLA 4ZVSB 1EWRA 5IZHA 4ZTJA 4FK2A 4QIFA 2G8UA 4IQWA 3VGSA 3I28A 3QXGA 3OYCA 3CJ1A 3J81j 2DFFA 4JKHA 4LSZB 3A2FA 1JLFB 1D1UA 2FMSA 2OANA 3CETA 5GADP 3IRWP 3QETA 2DHAA 2G06A 1OJ4A 3OVAA 3FE1A 4C7ZA 2FZGB 4LVSA 2IOHA 1YKWA 4H0TB 4KH4A 2V2VA 3H90A 4TU9A 2E9RX 4WKYA 1WKLA 1AZSB 4HACA 1C4CA 3PLAA 2BVZA 5C2DA 3NRWA 4P2SA 3MMCA 4LF9J 2W7PA 4MLHA 3ULDA 1DK2A 1VLBA 2O66A 3MX2A 4FWLA 2MHNA 4O3QA 3MPVA 3HM9A 1Y11A 1RYUA 1K73O 4HEA9 3UR3C 5AM5A 4PL8A 1FDBA 3FCWA 2KJVA 1WEYA 4H5WA 2KVCA 1ZQUA 2VWKA 2JLFA 4DR7F 1OMSA 1S48A 3EEQA 1SWWA 3C14A 3TUIC 3QGGA 2P9EA 3G96A 3OV7A 1RILA 2AXTU 4L74A 2PFNA 3THTA 4WYWA 1MN8A 1AB8A 5EUHA 3R7SB 1IBMJ 3TTFA 1N8RO 3DLRA 1NDPA 3PVXA 3NF7A 4JI7K 3V9XA 4QW8A 4KAZA 3CWJA 4AQYK 4YMMA 2QG9B 3IG8A 2LA6A 2H5EA 4IG3A 4KHYA 3WKAA 3TOQA 4I6YA 4Y2CA 3CCVN 4NI2A 4X62K 1S4EA 4Z6FA 4AXIA 2BCVA 4BC7A 3LDSA 2HLUA 4H0PA 4JKEA 3W3DA 2W4DA 3M5RA 4LFAK 4I2QA 5HMXA 2DHXA 4FJJA 4TY9A 4K59A 2VA2A 1JJ2M 2EZXA 4BQZA 1GTHA 3DDHA 4OJGA 4UB1A 8ICPA 4FJMA 3MECA 1C0TA 1ZD3A 3L4PA 2JXJA 1UETA 3IRUA 1VDHA 3OYMA 3C2PA 3QBXA 5I3UA 3M05A 4JI8J 1CEZA 3L7PA 2BDUA 2UXDK 4ZLPA 3DLLL 5K14A 2YQ0A 4TY8B 4DUZF 2UUAF 4DCHA 3H8YA 4EFHA 2RS2A 4XH5A 4K4VA 5GAEU 1TAQA 2XLIA 4M42A 1ZXOA 2OCEA 3MFHA 2ITMA 4UF4A 5FP0A 2VG6A 3JPTA 2VGMA 5CJ7A 3RF9A 1RT1B 1U0HA 4WZMA 3DMJA 2WUSA 5KFVA 4E7LA 1RBLA 3JSMB 4Y3CA 5K9FA 2Q66A 1UFKA 3ZSYA 4B6JA 3KHLA 2X1GA 2OPQB 2E5SA 5ALZA 1N61A 3ATUA 4UUWA 2KSOA 4CZEA 1NCLA 3ZDEA 4M5JA 4IRDA 3N79A 4K0KK 3RGIA 4C8NA 3D28A 4PZVA 3OHAA 3WX8A 4LF2A 1DTQB 1LWEB 5IV3A 3ICXA 1X4BA 2KKZA 5HLFB 2VOPA 3CCUS 2KRBA 5HROB 1HBNB 1Z4NA 4UZCA 2G2ZA 2CPZA 4FZXC 3CJRA 5KG5A 3CRXA 5F9NA 5L1LA 4B3OA 2QSFA 2IS3A 3FZ2A 3KFUF 1NZBA 2Z2ZA 5LJ3Y 3NE6A 3D6MB 3UKUB 1Q86O 1FD8A 1SZPA 4NXMJ 4KY3A 1R8AA 4ECYA 1NHKL 1QVFM 3F5EA 2XMAA 2HQIA 4PPZA 3POTA 3DOMA 4PY5A 9ICEA 1X3MA 2EVZA 1F5AA 3CE8A 3CNQP 1ZQVA 2FJAB 1X8DA 3G82B 1KFSA 3ZYYX 1UCNA 3I55S 2JOQA 3RMCA 5L1IA 3C6HA 3EMTA 1EZZB 3DXKB 4NXNJ 2HMIA 4AM7A 4YDXA 2B8QA 4CEFA 4O3SA 4FXDA 4DG1A 2JZBA 2ZGZA 2OEKA 7ICIA 3FVYA 3HHEA 4M3RA 1XR6A 5C2GA 2AEJA 4X4QA 4RT3A 5AK5A 5G0RB 3WK5A 2ZIXA 2YNGA 4WFZA 1VJ5A 4DN9A 3ISBA 1IBMF 4ILMA 4KN7A 4X84A 3NWGA 3GTYX 4A8XA 2UUBK 2CVIA 3ZSQA 1UJ5A 1QHTA 3CC4S 2DGTA 3FCHA 4JI5K 4TVAB 3VAJA 3BO3A 1WSRA 2W24A 4FW1A 1RT3B 1JX4A 5J1EB 4FJ5A 5AKHA 4YDDB 1DFDA 5KPZA 4GY2B 1LNQA 3V81B 1NJYA 2CH6A 2DBBA 5CA7A 1I3AA 3BBCA 4BG8A 4WFBQ 3HSDA 1HNVA 3PHEA 1K44A 3CI5A 2ZJQQ 1S76D 4JKFA 3W3SA 4DHVA 2H54B 2P2CB 3H7HB 1TFRA 1S1TA 4ZKAA 4PXDA 3N7PD 4K8RA 4CGFA 1KR4A 2EPIA 1HQUB 3PKMA 2DY1A 3GDQA 3AO3A 3M8SA 2F76X 4JI8F 3JS6A 5HMYA 1H2UX 4OV6A 2B6AA 4G1IA 2KFZA 5J2GA 4Z4EA 5AHXA 2V6AA 1EJ7L 2ZHAA 5G5GA 3CHWA 2SXLA 2MSTA 1WOOA 1GNKA 4K8ZA 4CI6A 3LVVA 1ZD2P 5DBBA 4CE9A 1W7AA 1MWKA 8ICYA 1Z1BA 4IH7A 8RUCA 2GIRA 3MM5B 3C8YA 3HRGA 4KPYA 3AXKA 1VRTA 4IR9A 5L39A 2ZJAA 2APOA 3OL8A 2GX8A 3EJMA 4AH9A 5HN0A 1WC0A 4M5DB 4OHVA 4XO0A 3CW2C 3VTIA 2DH9A 2MKKA 4BGBA 2A1SA 4Q7AA 4XEIA 2X78A 5EDWA 1ZQBA 1SV0A 1EARA 1UHUA 2VBWA 4CZLA 2A19A 2ZD1B 3WC0A 4Y2YA 1M1GA 1IG9A 2ASLA 1HEKA 2W03A 1UL3A 2B56A 4JI0K 3A1YG 4F04B 2NRZA 9ICPA 2OTLN 5M1QA 3S7RA 1BXNA 2KVQE 3O9SA 1U1NA 1ITGA 4IL6U 2W11A 4DSKA 2QYCA 4FYWB 2ZC4A 3FSIA 2Y9TA 4LBIA 1E6VA 4IQMA 3WHIA 3KLEA 5JS1A 4KLJA 4NLWA 4F0KA 3OXLA 1E4FT 3Q8VA 3GWCA 1R0CB 1S7HA 4NXMF 3W8PA 1A7GE 5B09A 5F8IA 3KWGA 4C0HA 4A8EA 2IM2A 3H4BA 5J0RA 2V9KA 4CGDA 3BV8A 4FWOA 4P4MA 1UAWA 2DL0A 3JSBA 3WZ0A 4OJ6A 5I42B 4X66J 8ICIA 1UEUA 2I7PA 4HAIA 4B9VA 3MCSA 2PDAA 3SV3A 2UVVA 2BX6A 4NXNF 4ECUA 5E0OA 3I9ZA 2LQ9A 1R0AB 4OPKA 2BE2B 4QJVA 3IA0A 4Y2VA 2K7JA 4Z4GA 5KT6A 1JLBA 2RQCA 2E2NA 4KGXB 4FW2A 4DB3A 1AQ6A 3W1YC 1HIWA 5ALVA 1ZZFA 4JK1A 4X4UA 4EK2A 5DB8A 4KLGA 1COKA 3A0IX 4K2JA 2Y0SD 4FPIA 3VAFA 1IKWB 1X5TA 1OY6A 4RG8A 2RDJA 3AFGA 3QRPA 1D09B 2CQCA 1ZA2B 3MABA 1JLEA 3QNWB 2ZTEA 3TVZA 3AA2A 4M7XA 3SMVA 2GVZA 2V7YA 3LYSA 3M9MB 4US8A 4U7UK 1F1BB 1COOA 1A5WA 2XO7A 4JYAJ 2WAQC 4PUOA 1ZTTA 2CXEA 3M2UA 2ABYA 4CFCA 9ICXA 2FDRA 2ZKTA 5MLCV 5HATA 3CMAN 4J9QA 5TZVA 2ALYB 1XUPO 4J2AA 3C6UB 1GLJO 3ENQA 4NJ8A 3MPWA 4F8RA 1D8BA 4UY85 4AT1B 4PEOA 1KSPA 3BP8A 2IJNA 3QJJA 4YOTA 1FJ7A 6FDRA 4H5VA 1ZQFA 4BCAA 1B4SA 1RTDB 1DEJA 2NPFA 2LSNA 2G07A 3OYHA 1VR6A 1KBUA 4TQRA 2Z56B 3LP2B 4A5BA 4X2BA 2ZUDA 2CG4A 4DF4A 2ZNYA 3TRGA 2NQPA 3UDVA 4K4HA 3AD8C 3QEIA 2V2ZA 4HHTA 1SXDA 4C8OA 3L09A 3LZJA 2RN2A 5ALRA 4NA1A 3TWHA 2NS1B 3PCOB 4GVLA 1JXBA 4RW4A 1AYEA 3OR2A 5M1FA 4DUYJ 1K6YA 2IAJA 5FLXU 3SPZA 3SQIA 1VQPS 3RB3A 3WK9A 1ACMB 2C22A 2WVBA 1ZJNA 2PBDA 4BRGA 2H4WB 3V6DB 4Y00A 4Q44A 4DTOA 4JK7A 4DX8H 5U47A 5DQHA 5CWRA 5TISU 2M4MA 1ZQ1C 2R2TA 1K9MT 4E1JA 2VQFK 5AFUH 2C3PA 2LI6A 1NNDA 3A5NC 1DQ8A 3KKFA 4DR2F 4DI6A 2MZ1A 3B6BA 5ADXA 1QTMA 4RX6A 5D3GA 2V51B 4PHEA 4CO5A 2HZVA 2P9NB 2VB6A 1KN5A 2HRUA 4OI6A 3SR6A 4CT8A 3UKRA 5DBCA 2HGMA 4QU7A 4WQ5C 3OHRA 8ICCA 2BJ3A 3NVMA 4NMXA 3IP4B 1RSCA 4BY9C 3MCNA 3FFIA 3AD9C 1H2VZ 2Q97A 5EWGA 3PZPA 3MCOA 3BJYA 2UZAA 4F4AA 4X66F 4HHUA 4L73A 4OGEA 4DCPB 2NRVA 2A6AA 3AGKA 5BPNA 4BC5A 5D0GA 3ZD8A 3A8KA 2LEAA 5EOYA 4YHHK 3DXBA 1OQ3A 5HHHA 2CQ0A 2H3IA 1H6KX 3BZCA 3WK6A 2PI4A 2FY8A 3KTQA 1YJWS 1UQVA 1QE1A 2R7UA 4I2DA 2JGAA 1NSPA 4NL9C 3EXYA 3HP9A 4DV2J 3HRDD 3QZ7A 1IXRA 5ALEA 4PZNA 3A3NB 3HILA 3VN5A 4DHYA 3DCAA 4M3UA 4FJKA 4GKJJ 3KNAA 3UM9A 1YIJN 1RHJB 2QXLA 1HHTP 4NZ7A 3J7A1 3ZDDA 3AO2A 2XBPA 4ZP8A 4IO9Q 1HR0J 5ALXA 1JQGA 4LVOP 5B7WA 4DZ6A 5H1SQ 2KXNB 3MD3A 3EKUA 3A3PB 3GR0A 3IXQA 4DV0J 5CQGA 1TFYA 2C2OB 2QN6B 3D1HA 4ZVQB 1WN7A 4QPTA 4F0HA 4FBTA 2LECA 2GAHC 1VQNN 3ZX2A 4NL5A 2F1HA 1YXQA 2KEYA 2W9AA 4OYXA 3HHLD 2YCHA 2C2EA 4JYAF 4LF5K 4J2EA 3ET6B 3G2XA 4FF1A 4OYMA 3D0HE 5G4DA 2FLPA 1ZQJA 1V5IB 2F65A 1IM6A 2RQMA 3DRRA 1VBKA 2JEFA 5AM4A 2JH7A 3AN1A 4QZAA 1U9LA 1QUPA 1PK1A 1I39A 4B9QA 1YI2N 2O8EB 3EVMA 2A6MA 1B0PA 4BC4A 2ZOGA 1LXJA 4KPCA 3KDOA 1QVGM 2D0BA 1ZBIA 1VMBA 1RAEB 4B3TK 3E2EA 1N32J 2MRLA 4MKAA 1X42A 3CCQS 3HSTB 3PACA 1AUDA 3RRKA 5L9NA 2QGFB 3IUCA 4RNNA 1QAYA 1KQKA 3K5PA 4FXWA 2Q1LA 4OO1J 1BD6A 1TL1B 3HKZF 4RBUA 4ZVFA 3D7SB 2NXNA 2LYVA 3CG7A 1TP7A 1KWMA 3JTNA 5CP2A 4DUYF 3PXGa 1KRPA 3IP0A 2D3DA 2P66A 3H0MB 2V5HG 4ZH4A 2XGPA 2GV1A 3M2VB 2V4JA 4HHHA 5DG9A 3FZLA 4DSJA 4QYRA 5J2QA 2P9IA 1J5OB 1XERA 5AK6A 4DMNA 3IWLA 4ECQA 1M1HA 4PG4A 3U3GA 5A8WB 3M9OB 3TA1A 2QMWA 2HFUA 3UD3P 2GO8A 2E20A 1RTJA 1SH2A 1SJQA 4JI2J 3QLHA 1Y3JA 4DV3J 5GIPA 2E2QA 2G8IA 3H40A 2N3LA 4F72A 2CNNB 4OI2A 1Q0NA 2ILZA 2P5OA 2E1CA 2OP5A 5B0BA 4CJQA 2R2UA 4ZVUB 3UMGA 3SQGB 3HX0A 3NGYA 1ZQAA 3THWB 4DTXA 3RH6A 1REVB 3IRXA 2FF6A 3MM8B 2VFUA 3ADAC 3M8WA 2A1RA 2EC2A 1HNWJ 1SBRA 1ZM3A 1YZ7A 2VC1A 2ZIVA 5C10A 3TAMA 5BJRA 1KNZA 5M1NA 2Z2LA 3N7SC 2KVSA 3RJJA 2A5XA 3U9DA 4ZJLA 1VBYA 4AYBF 3IWXA 8ICNA 5IT0A 5AXNA 2YV0X 4J9LA 2UV8A 3GFYA 2P51A 2O8BA 1U8WA 4LFBK 1JROA 1TKZB 4P71A 5FIIA 2DD8S 2J7UA 1SJ4P 7ICHA 3BH6B 1MWZA 4HH1A 2YX8A 1QZ6A 4NY8A 1NG9A 5HMMA 3UNYA 3DGPB 1N5WA 4DV2F 2NPIA 1N54B 2ZG6A 3B78A 4GKJF 2FLLA 4X64K 2B5JA 4JAXA 1NUEA 2BOPA 4CGGA 2CGLA 3FZBA 5AQYA 3GV7B 5IT9O 5KFZA 1RGVA 3QSIA 3TJ9A 4I2EA 4DPWA 1FEEA 1LW2A 3O9TA 3T5LA 5FJ4A 5TKWA 4KHQA 3HPGA 1IBKJ 1M0SA 1WI8A 2EZZA 4IS7A 3TI0A 4A2AA 1JXLA 2IRYA 1GLDG 3ZTSA 3OYIA 1FNXH 2X6SA 4DV0F 4NLNA 4WJBA 2GLEA 2G08A 4F3OA 2JEJA 2W04A 9ICCA 1AFJA 1I1GA 1N63A 2L9DA 2E44A 3BS5B 3MD1A 2QB0B 3G25A 1BUXA 1HLUA 2VOOA 3HSGA 1WSHA 1TZ0A 1Q5VA 2IGIA 1IIPA 4OYOA 3ZSXA 2WW8A 2IPOB 1HX1A 4ZITA 4FOEA 3GJTB 8ICOA 4M3TA 1TR0A 2E7VA 2RDDA 4E98A 4A57A 1JXVA 4ZIVA 4EBCA 4WFBL 5J2DA 1U4BA 2ZJQL 4Q2LA 2AX0A 5CRXA 4BRLA 3C21A 2I5JA 4ILJA 4NCGB 1N32F 1RT2B 4F02A 3MM6A 4KH0B 1S6PA 4KLIA 1HIYA 1WKJA 2UU9K 4MO4A 3W9IA 3SSSA 1OSCA 5E79U 1ZBUA 2K60A 4CYUB 3W2VA 4C8YA 2C2NA 5DM7Q 3AAWB 1X9XA 4CIEA 2FGCA 4DU1A 4PHTX 1L3SA 4O9MA 5B8HA 2V8HA 5AICA 2PA8D 3MTJA 4RBVA 4NB4A 4CHQA 1XJWB 1JLCB 2D69A 5DQGA 2XS5A 3Q8SB 4DL6A 3NBPB 4M5IA 3CCWA 4EU0A 2D3ZA 1SH3A 2ACMA 2CPFA 5DLFA 3G9CA 3QYYA 2MZQA 1SQEA 2BQ3A 5DZ7A 1RK8A 3HT0A 4GRSA 5D8HB 3VVTA 3NNAA 1OH7A 1FFWB 4J2BA 2IVMA 5DZ6A 4CP5A 5C7PA 2CQDA 2G9OA 4DV3F 2YKMB 2PYLA 1V3SA 1KQSR 1SUQA 4K4GA 2J0WA 3KJVA 1ZS6A 2DUYA 2CH5A 4E1MA 4CO2A 2WF6A 2P9PA 3OVSA 1F2GA 1K5OA 3I76A 4A8SA 3SZ2A 1GOCA 2ASPA 2W9BB 7ICNA 4XPEA 1X6IA 5FRMA 5KRSA 3OHBA 1HNWF 2W54A 1C20A 5B0AA 3C6AA 2J76E 1EB0A 4NCBA 4KMUA 1YHQN 2Q0ZX 3UCZP 1ELOA 2Q2RA 4AE5A 3VEZA 2F1JA 3BPSP 4USTA 4CJVA 1QLNA 1RWOB 1EETB 2VWBA 1BQXA 4F3QA 1ATNA 2O8FB 3O4WA 5AK3A 4WU2A 2Q4TA 4BX9C 2KIWA 3RH4A 1YTUA 2VUGA 3D0PA 4F5QA 2HAIA 2DR7A 2VJ5A 5KFBA 3ZETB 2NUHA 5IS2A 1DK3A 5GTIU 3TZYA 5ALMA 1UWBB 1RWKB 2O67A 2D9PA 2RU3A 2QWNA 4W90B 5LMUK 3RJMB 1PGZA 3PW7A 1IBKF 1UPMB 1N4LA 2DT9A 3N9UC 3NUQA 3AA9A 2PC6A 5C24B 4P10A 3PUFA 4I2PA 3IG5A 3MMAB 2CZ4A 2QJ3A 4JB8B 4ECTA 3O9QA 3CCTA 5J0QA 1JL2A 4OJHA 3TSQA 2BXJA 1KQFB 3DOLA 2KHOA 2IDLA 1MA9B 1UEKA 4M63C 2DNOA 3H98A 2DNGA 3VQ4A 3WXLA 1CI4A 3G6ES 3N7RC 4DR6K 1NK4A 3DI6B 2LMIA 4H4OA 1QAIA 5DETA 4DTPA 3NG8A 3CUNA 8ICEA 3HJFA 4LR7A 5DKWA 1VSMA 2XVTA 4DV7J 2XZDB 2FY1A 3RSEA 2AU0A 3TO8A 4PWDB 4HTLA 4NLRA 4RU2A 2DHHA 2QO3A 3BGOP 1IV8A 3BZKA 1M90T 2YTCA 4OX8A 4RNHA 2D0PA 2MAXA 5DRKA 3E9PA 2JSXA 3TYTA 1YSJA 2QWMA 4C48A 2WK4A 5AE3A 3H0PA 2Y8WA 2YWFA 3L3FX 4DF8A 1T9UA 3M8QA 3MEEB 4Z2XA 2LU1A 3QGIA 2HG4A 1QAJA 2E6LA 4TKTA 3IAYA 3EGNA 3AA8A 1TL3B 8ICUA 2CAJA 2KW4A 2RJZA 1YJVA 3QIPB 3AL0B 4CLFA 4F93B 4FNIA 4DUTA 3OYFA 1HI8A 4B02A 4KHPK 1UFLA 2RDIA 4OPHA 1NXIA 2CNKB 1MWQA 2VJ4A 4Z6DA 4Y2RA 3C23A 1GMWD 4ZN1A 2B9WA 2QB1A 4Z6CA 4RW8A 8ATCB 3K5MA 1GO3F 3I5CA 2CGKA 1UMJA 1TL5A 1ZOTA 1C0UA 3Q8LA 1NI3A 1N5TA 3OYBA 4GKKK 1NGFA 5H9EK 3F41A 2WZ1A 4J37A 2CJYB 5IM0B 2P8IA 2IMOA 1JCGA 3QPIA 3TACB 3C7NA 3SAGA 2Y1IA 3HW8A 2C28A 1NK5A 2RS8A 3D0GE 1H74A 1SL0A 2FVSA 2RILA 5LMNJ 3MEGB 4CZMA 1J2VA 3RYLA 1ZBHA 1U49A 3TA2A 3H25A 3VESA 5T7LA 1X6JA 5HBMA 4UB2A 1CJUB 4QS8A 5BREA 4DOBA 3AQFA 4QZCA 2VASA 1BISA 3DRSA 2CJAA 4XK8C 1EQMA 4I9LA 1U2RA 4ICAA 1LCUA 4WTOB 3BQ2A 3QJLA 4DOCA 1FE4A 3J7YP 2BCUA 2KL8A 4HL9A 2PGCA 3WQPA 4DV4K 3D2EA 4ZP9A 4EGLA 5HL7L 3C65A 4LF8J 2C2RA 3EO3A 5B5EU 2I7NA 3G8TA 3UVJA 4GV6A 1JL1A 3HHNB 3PW5A 2NO4A 3RJHA 1WD6A 3SCKE 2Q0UA 4C80A 1FWPA 1Y5IB 2JH3A 1CBKA 2LBOA 3SQ0A 2W41A 4M3ZA 4WIIA 3R1XA 1V5VA 5DO2A 2CN1A 5CZ2A 4KHNA 4IO9L 4MK8A 1Q16B 2HQDA 4OHYA 2W42A 5CR4A 1TVRB 1TKTA 2LXIA 2E5GA 1TL7A 3ENBA 3SYZA 1KAXA 2VCPA 5F3XB 3JPPA 4Y0FA 3ONQA 1VSIA 4CJKA 1FW6A 1X4EA 1F5SA 3ORYA 4DFPA 3CMQA 3PV8A 3T69A 4A8WA 2WFBA 1LFWA 4KLLA 1E4GT 3I32A 3H4DA 3NWRA 1Z3EB 2Q6CA 3G71S 1RZTA 1N60A 1HPZB 2WVCA 3OFGA 1JXEA 1NKCA 2JL9A 3MEDA 2RB7A 4JKCA 2DIVA 3QO9B 2P9KA 5DG8A 4IKFA 3ISCA 2DHSA 5HQ8A 4FFDA 4Y2UA 4Q0BA 2I6XA 4MYUA 4HWIA 4X5VA 2HIQA 1DBDA 3BUZB 2AQ4A 2W3SA 3ONNA 4H4MB 4IFVB 5ITHA 1YJNS 3EW9A 3L95X 5A2QU 1DKGD 2M3DA 1IR1A 1XK8A 1BPXA 1OYDA 2QA4N 4CO4A 2HBZB 2XY7A 4B17A 3GJSB 4UOFA 5F8MA 4KREA 3HWTA 5JLHA 3OSNA 2RHSB 1XMBA 4NLYA 4NPOA 2QM1A 1S8OA 5DJBA 5BYSA 1S1XA 1HMVB 5L9XA 4CJLA 4FLYA 1LOTB 1A0PA 3MDCA 3H8SA 2WBRA 3R5AA 3Q23A 4BDZA 2DY9A 3OSPA 5FLXY 5DLGA 2MQNA 3RH5A 1BQNA 1RUSA 1M5OC 2B0CA 2CPDA 3C3LA 1NKEA 4FZMA 3KLIA 2NYHA 5EE9A 1FJCA 2RF2B 2VG5A 4EIAA 1NJZA 4H03B 3QESA 2ZIUA 1ZM9A 3PY8A 5C25B 1T94A 2YMPA 3PSTA 5K8NA 4C1NK 3NFAA 3N28A 1UCVA 2M0GB 2K1RB 4BWJA 1KS2A 3ZZTA 4PL1A 1R8BA 5LMNF 1VK8A 2DB1A 4CZHA 4DPTA 3TAPA 2E2PA 3MDFA 3NCRA 5AQVA 1OY8A 5ETRA 4J90A 5FPEA 1UP1A 1S0MA 2GJ2A 2HOEA 3WIUA 2LM1A 5ETOA 2PAVA 4DR1K 1S6QB 1YDLA 3OQ2A 3BGRA 2E8MA 4OZ2A 3P4IA 2EX3A 3D54A 4DTJA 4KBIA 1RDUA 3R3LA 3O5BA 3RAXA 2G0CA 3CJKB 2FBTA 3AA4A 2V8PA 3KKAC 3UXPA 4NMLA 4FYXB 1X7VA 3C15A 4USWA 3THVA 3MAAB 4I2GA 4QNLA 3S3NA 1UT8A 2WAQD 3CXCR 3OTQA 4UT4A 3IM1A 3RJEA 4LF8F 4Z37A 1U2CA 3CJCA 4YOEA 3SQ2A 3A5OC 3LA0A 2J0SD 1EXQA 2VG7B 1WF2A 1JJCB 2IJRA 5AQJA 1CRXA 3IM9A 7ICQA 3PHTA 1KLMA 3KLGB 4QR1A 1N34J 2IMWP 4JEPA 3CC2N 4QS7A 1CJTB 4UBBA 5CAAA 5HJXA 1YITN 2XMWA 4JP8A 2DEJA 2BANB 4CO3A 5GVQA 2ZH6A 4AHSA 3R2DJ 1VAZA 5B0CA 2MUTA 1B7FA 4KGZB 3EVWA 3TADC 1WHVA 3I82A 4IO1A 3A0BU 5C42B 1VISA 2ZGYA 2BJEA 2WONB 1O6XA 3D1QA 2UXBK 1YVFA 2ZIWB 3DLGA 2MGZB 1PIEA 1KFTA 1SKRA 1QQOA 2HBMA 4RJVA 2KG0A 4C11B 2HMXA 4I6MB 1A0OB 3D45A 5KT4A 4QZIA 1VQLN 2JFDA 4YOUA 3CM6A 3OS1A 2GVDB 1D8YA 4ANEA 4Y2KA 4C3LA 4UATA 4OYWA 1FX4A 1OWXA 1KDNA 4M1KA 1OKJA 2K89A 1JJ4A 4LFCK 3F9KA 4TNOA 1S9GA 3RJFA 2P9UA 1KHVA 1Y4ZB 1KLNA 2HF3A 3E01A 4L8RB 2F4FA 2PEHA 1A9NB 3LO3A 3C95A 1W97L 4FWMA 3CJ5A 2F8SA 1T9WA 3AARA 4RW7A 3CCJS 4OLOA 1WOSA 4HUEA 4KI4A 2VHGA 2G0AA 4B3SJ 5KFNA 1QQCA 5DM7L 4ZVOB 4HCCA 2Z2MA 2KXFA 2DXDA 3PO5A 1S12A 1J5EK 5I9EB 4RW6A 3VQTA 2Y0SF 3M6ZA 4F7VA 4ZDNA 4OX7A 1Q8BA 3MN7A 4FK0A 1QQ7A 2J0XA 2O8DA 4Y2MA 4YB1P 5KL1B 4KKOB 3AJ1A 3T1AA 3EL2A 4I6WA 2AJ2A 4CDIA 1CG2A 4EO8A 4N5SA 3IFEA 3SSQA 2WCXA 2Q0RA 3FSXA 2BW2A 1WBDA 3E3XA 2M9NA 3NGDA 2DO0A 5IOLA 3E58A 2DKXA 1JNZB 4XAKA 4B1ZA 4A46A 2AZ1A 3GSDA 4NLVA 4BR5A 1VSKA 1YBAA 4DTUA 1CLFA 1PVRA 2J7KA 3QBWA 3C2LA 3FSYA 3R1LA 2A3JA 3BGLA 1VQ4S 2E5HA 1YJ9N 4QWEA 3LF0A 1U2FA 4ZA1A 4CBUA 4Y28C 3CD6S 2CDRB 3U7JA 4EUVA 4IH5A 3VETA 3NTUA 1RHMB 2HS4A 2FSKA 2M0NA 5IC4B 2F96A 3QNNA 1ZPVA 3ENOA 3L9ZA 5J2PA 2XCAA 3KUEA 1SL2A 4BACA 2RUSA 5J8YC 1BCMA 2BJ1A 3DRXA 2DR5A 3A4TA 3VQ7A 2DGVA 1ZOLA 5E33A 2P1JA 4J9MA 2NRWA 5M1OA 5B0DA 4CLTA 5M1PA 3QUBA 4U96A 1N34F 4CVNE 1NGJA 2W2QP 3VA3A 3KWMA 1X3NA 1GQEA 2HNZA 2L5YA 1GAOA 3F2BA 2F40A 4TXSA 1C1CA 2WHOA 1J6ZA 1TAUA 3SUNA 2JLEA 2YWEA 1QSYA 2FSJA 5C12A 3DM2A 4BXOA 4IG0B 3T1YK 3AVGA 4JI4K 2OHDA 5HHIA 4P2FA 3KK3B 1PZNA 2ZUBA 3ENVA 2ASYA 4B3MJ 4URQU 2HHSA 3F0NA 3M1FA 1CULB 2ROEA 1XHXA 1WKKA 4K4TA 2D6FC 3HD1A 4P0PB 3ZZ0A 1VQOS 5AJ3F 3DXMB 3OTOJ 4YVZA 1YRXA 1K8KA 3KIOA 1S9EB 5EX0A 4JV5K 1IO2A 4WK1A 2W9CB 3CCZA 2CUYA 3EDQB 2HOQA 3D67A 5GAHP 2QL9B 3KUGA 1GMVA 2FMPA 4X4NA 1F21A 2FYXA 1RQNA 2XTJP 3AA5X 3AY0A 4MIBA 1R89A 3NCIA 5BOLA 4CJRA 2VKQA 1PCAA 4EI2A 4US9A 2R9LA 2G8WA 2GMJA 3P49B 1R7IA 4U8VA 1KVBA 5FPMA 4LF7J 1VSLA 4MHVA 3O9RA 2MLZA 5FRNA 3FGVA 1N62A 2EAOA 4J9SA 4AHVA 2ZEJA 2OPPA 1TKXB 1BQMB 3GIMA 2RMLA 1AXQA 3SI6A 3PR5B 2QE5A 4B3SF 5KFHA 2VPZB 3K9KA 2EK6A 1IKVB 4M5NA 3OYAA 3DDIA 1L3KA 2BRKA 1N5VA 5ALTA 1DZ5A 2JVRA 3UPQA 2Z1IA 2VYPA 4LBPA 1PKUA 3I4HX 2HURA 4OHXA 4O3PA 4BROA 1JKHB 4CIOA 2FI1A 2H5JB 2WB1C 1XSLA 1H98A 3TPQA 3GL1A 1RWNB 3T7ZA 4DL4A 3CFPA 4BHQA 4EMDA 1WOQA 1RWWB 5HR7A 5CD4H 1VC5A 1NGEA 3FC9A 1Q82O 1LAVA 2PIIA 4FO0A 1D8LA 5FROA 2ZVIA 2VJVA 2HHHJ 2R7SA 4GLXA 2RAQA 3N4PA 4KB1A 3NGSA 4QWAA 2XGQA 3RB6A 1D0EA 1VDVA 4DXLA 3ZZYA 1FDAA 4ZPAA 2AJFE 2FHKA 4RQNA 2YXLA 4WP9A 2FJVA 2DNHA 4YOYA 1SV5A 1R59O 3M8ZA 3ZT3A 2JC1A 3KYLA 1OSDA 2KHDA 2LXUA 5D4LA 2ZJRQ 1GXUA 1FFUA 2MQ8A 1FNOA 3N6LA 3Q8PB 1KC8T 2CZVC 2F9TA 5A8RB 1XMOK 4MYTA 2E5LJ 2JWKA 4B9TA 3K2YA 1HYZA 3I5BA 4FWKA 1HQ2A 1VLOA 5F8HA 1LWCB 3IS9B 4TSXA 1GLLO 2I1QA 3FFKB 1CQMA 5JUMA 3CCVS 3K8VA 3VAMA 2MSNA 2HLTA 2Q31A 2W40A 4CJFA 2ATCB 2QK9A 3TP2A 4FM0A 1E6YB 4BRKA 2AW0A 1BCOA 3GE9A 3TAFA 4PQUB 9ICMA 3R5DA 4KR0B 2JDJA 3O4QA 5KFDA 1ZQGA 2VDHA 2XSJB 5CCMA 2O3DA 4NLQA 3C1YA 3MMJA 3QEWA 4URSA 1YAGA 3AOAA 3NRBA 3SAFA 1O51A 4ZVHA 4OJRA 4DR3J 3BDPA 4L76A 1WCLA 4DUZK 4KITB 2UUAK 1FXDA 5BN8A 1CZBA 3HYFA 4B3MF 4ZPTR 5KFRA 2B43A 4FXVA 2QX0A 3C5FA 3GONA 1B0XA 3ZSOA 5HVGA 4CHZA 2YNHA 1RT5A 2CJBA 1VQMN 3J7AP 3PR4A 1JJ2R 5DB6A 3I8BA 2LQ8A 1KEJA 3WKEA 1XNRF 2GS8A 3OTOF 2B0GA 3V6JA 2EXUA 3I5AA 1WC5A 3CQYA 1ZQWA 4O44A 1WI6A 1RTHA 4MKBA 3AMZA 1DTTA 2QWQA 1KVCA 2UUCJ 1S1UB 3FZMA 4DFKA 1EIYB 3L0QA 3LW5C 1JLFA 4CNZA 1F6TA 4M94A 2EBEA 4ILLA 2WSFC 3IAS9 3EM1A 3LWMA 4YMOA 1FTRA 1FEZA 3H08A 1VC6A 4NASA 4USVA 3AHPA 4JKGA 2BQUA 2NSBA 5ETSA 4W5NA 4AQYJ 3AT1B 4LF7F 1V9OA 3GCXP 3ITHA 1QD1A 3Q7CA 3EZ5A 3W2WA 3TEGA 3C6TB 2ZKUA 4MH8A 4HLBA 1RTIB 3R5CA 2H3QA 3C14B 1D9FA 1RKJA 4BWMA 4LFAJ 9ICQA 2A1AA 4Y6IA 8ICJA 2FPKA 2MQMA 4RWXA 5GAGI 4WIQA 4DX7A 1T9XA 3VQAA 2ZBQA 2FLOA 1FJGJ 1DRGA 4YUDA 3ZT0A 4OMFG 5HP4A 2FF3B 4HTIA 3HLUA 2OUGA 4IG3B 2XYPB 3M32B 2EK1A 3QFHA 1KAYA 1RDDA 3HVWA 2QW9A 3VMFB 4NI2B 4CD1A 3WXIA 4KN4A 4DV6J 3ISNC 1ZPWX 2CQ3A 3AV9A 1NMDA 2V8GA 2ZDPA 2MZTA 4LF9K 2ZQBA 2EFPA 4GXKA 3BR9A 1LB2B 4I2QB 2ZWOA 3CO9A 5AXMA 3LDQA 1RXVA 4DJBA 3M6XA 8ICGA 3H5XA 2AYGA 1UOCA 3MDQA 2RVJA 4GXIA 1RG6A 1R31A 4C1NI 3MR5A 3QZ8A 4CTAB 3R9KA 2MQQA 1C0TB 3VEVA 5CHIA 4DL2A 1QVFR 3D2SA 2LHTA 4FYDA 1NEEA 3NF6A 2OKQA 1MNEA 5CZXA 4ES3A 2BPFA 2E9ZA 3Q8QB 5I3UB 5GAEI 1ZQEA 1S5JA 1IBMK 1QSLA 1NOMA 4U8YA 3RMAA 5K14B 2IDEA 3Q89A 9RUBA 2OYQA 5J0PA 1R8CA 4KLEA 4RZRA 5BPLA 2E5LF 3MWPA 3M6WA 4ZCIA 2ZE2A 4DV5J 3QIDA 4I56A 1CS4B 1HLWA 5AKEA 4YR2A 2Y1RI 5CABA 2M70A 5E2QA 2VG6B 2BM0A 4TY8A 5IIMA 5DGBA 3KBBA 1WNEA 2O5DA 3IKMA 4B1VA 2FC8A 1ZQIA 4AHCA 4USIA 2W9MA 1SC6A 2JRSA 1H72C 4OFZA 4Z4FA 4QWBA 3GV8B 1F3FA 4MKYA 1P27B 1UVNA 2B4VA 5KG0A 1RT1A 1RTZA 2EANA 3MGJA 2PMZC 1Z6RA 4ZOHC 2QWLA 4TQSA 2KSOB 3RRGA 4PG6A 4ZHRB 5DDYA 1OYEA 1XMQJ 4B1UB 3GV5B 2AD9A 2IOFK 4JI8K 2B4JA 4DR3F 2JHEA 2KD1A 2CWXA 4ZVTB 3QT5A 1BU6O 2BM1A 3VQ5A 3GIRA 1EP4A 4YP3A 1GX6A 2YHWA 4QZEA 1KKXA 4CJSA 3UXOA 1KDHA 2V94A 2K4EA 5HVHA 1UPPA 2P6RA 5FPNA 2EH9A 5D15A 4V19X 3ALRA 3UMCA 1DTQA 3QYPA 4Z7CA 4ICLA 3VCDA 4B3OB 3ZTQA 4KSEB 1N36J 3LM9A 5HLFA 1QQMA 1X4DA 4FLTA 1OXJA 3HOSA 1PILA 1AA1B 1Q7YT 2UUCF 1UPHA 1V4SA 2P6SA 3DOMB 3NH0A 2VF3A 5E3PA 4F3MA 4WK3A 3UKUA 2RRBA 3MN5A 4MEYA 4JI7F 4L75A 4MF2A 1SVDA 1F44A 5K8PA 7ICUA 4W98A 1BPZA 4AQYF 2RSQA 5IIJA 1IWAA 2W6KA 2DNKA 2HMIB 2BJDA 2LPEA 4F4YA 4DG1B 4CLUA 5RUBA 1LW0A 2M5YA 2UP1A 3DXKA 5F1XA 2OTLS 4PCQA 1FRLA 3DLKB 4LFAF 3CP8A 3FEXB 3S3MA 2ZIXB 2Y0BB 2YNGB 5DDOC 1WDDA 5C2FA 4FZYA 4NXMK 5A2QY 1T4GA 4K8XA 1X4HA 2DR6A 1VQ7S 4FP9A 3W9JA 1FJGF 5G0RA 5HO4A 3RMBA 4IJNA 3Q24A 2HYIB 4CK1A 1V3ZA 3T1HJ 5BR9A 4DV6F 2KOBA 1FA0A 4OLPA 3BSAA 2QLWA 3BDEA 4Q2MA 4ERDA 4N8OA 3ZD9A 4NXNK 4HT5A 5J1EA 4URGA 5J2FA 4W92B 3BYRA 3O80A 1SV0C 1CZ9A 1BPEA 4Y2XA 4CO0A 2BA9A 3V81A 4FLVA 2D3UA 1VSJA 5AQTA 1NZAA 3AVNA 1GMWA 2KMDA 2IOCA 2I6WA 2KK0A 1VYAA 4G9BA 4ED8A 2B6AB 3NVZA 3G8QA 3PIOQ 2CYYA 3SD7A 2DRAA 4U67Q 1T8EA 4XDDA 1N33J 3UXNA 1HQUA 2G1DA 3O1LA 2OPRA 4YFKA 2PD1A 2R7WA 4DQ8A 3SCXA 3J7YU 4K5RA 4I2BA 3RMDA 3OS0A 2V4RA 5KTQA 3VGKA 4WF9Q 3V6HA 4BRMA 4GMJB 1RDWX 1IVZA 3VQ9A 3PYEA 4DOZA 1VRTB 3LGMA 1U24A 9ICHA 3VEWA 1W2BR 2OGUA 4BE0A 3H46O 2U2FA 5CR0A 2CPIA 4I64A 4FPAA 2VU5A 2DEIA 4H0YB 2KKPA 4HCBA 4KT0C 3V72A 1RWPB 4CRJA 1XMQF 4JS4A 4G1QA 2XNQA 2Q1NA 3CMAS 2PT0A 1OW5A 1TELA 2IM3A 3R97A 1Z2LA 4M5DA 5LSOA 3SI8A 1M5PC 2OWOA 2XSFA 3WC2A 2H3ZA 4CJ3A 4O0JA 3ZT4A 4P73A 2XEXA 3AM9A 3WX4A 2ASOA 2C2KB 3H45C 3K1ZA 3NP5A 5J0XA 1CC7A 2ZD1A 1JLGA 3OJUA 3VQBA 1E6VB 1GLCG 1IBCB 1NO8A 2EI5A 9ICTA 4DCJB 4ENOA 4IOAQ 3KLEB 2QMUB 3LPEA 2HF4A 9ICWA 3I31A 1FT8A 3NH2A 4O5EA 1N36F 2P5GA 3DFEA 4FWQA 3HI9A 3VGVA 5KAKA 4AP9A 2K4IA 1G99A 2WOMB 3F2DA 1JUDA 1LK5A 3ZEUA 3J81O 1RAOA 3VF2A 3I8DA 5IT9U 1DJ0A 2FHJA 3TARA 4Y1CA 2IVNA 1ZBTA 1IV0A 3AVHA 4RQMA 1D9AA 3AVCA 3O2IA 4K4UA 4CJ5A 1NHUA 4A47A 2E7WA 4YNQA 1LVHA 1V4TA 1K1QA 2HQGA 2PFOA 1X0PA 3T6JA 1IUJA 3NOGA 3NXZA 1JLBB 2DWQA 4YFUA 2D1KA 4JNEA 2J5AA 2V8VA 2FB0A 5F3TA 1R0AA 1B0TA 2BE2A 4A8MP 2CPHA 4L3QA 4ZMMA 3O1WA 5EX3A 4R63A 2CQ4A 2YTUA 1KVIA 2YQEA 1BHNA 2NXCA 3MUMP 5J2AA 3HD2A 3B4MA 1RBSA 2V63A 4LRFA 2AP6A 3U4LA 5HMWA 1VLYA 2V8DA 2ZOFA 3T1HF 4X66K 3QB0A 2ZUAA 4NLZA 1BGXT 4CZCA 5F41A 4E89A 2K3IA 1NAQA 2GVZB 4WKRA 3PG9A 1UZDA 3TW0A 3SFGA 4K5SA 1J2NA 2DTJA 5KAFU 2A1JA 2AF6A 4PUOB 1BL3A 3M2UB 2O4GA 1OUQA 3GFKB 4FPBA 5ALUA 1NBWA 3OD2A 5KFSA 2AYMA 1QQ6A 4O23A 3R5BA 3NS7B 3UI3A 2IC3A 3R5GA 1YIJS 3AAPA 3B6PA 1N33F 1VQKS 3GYNA 1A6SA 5ADZA 1OH5A 1IQTA 2F8HA 4DQPA 2I9GA 3KK2B 2OA8A 3N4MB 4G3IA 2LXFA 3WKCA 3KLHB 3KK1A 2A41A 4K50A 4FWNA 2XYGB 3BO2A 3VQQA 1RLCL 5IWAJ 2KQ2A 2W7OA 2ZJRL 2YHYA 5BRDA 2ZJPQ 2NZ4A 3LP2A 1IR0A 3UCGA 3WEEA 3OR2B 4EWTA 4GC7A 4DLGA 4Y2TA 4HTJA 4JYAK 1X9MA 2EAMA 1FXLA 4FVCA 3QFWA 3GFHA 4QAGA 2KI2A 2QKKA 3L4QA 4OD0A 2DH7A 4H5TA 5F8GA 3ICLA 2YKOA 3NF8A 4JRQA 4ZTFA 5EE0A 4YR3A 2DGUA 4MKVA 3V6DA 1FE0A 3BEGB 2E6MA 3QIOA 4KO0A 5LL6d 2V4QA 2J9DE 3QUTA 1C0FA 4CO1A 3T9ZA 2AP1A 3KZBA 3C0BA 5J1NA 1RWUA 1S59A 1XSPA 1WG4A 1MW7A 2DH8A 5EE3A 3QERA 4YR0A 4O4GA 1MWMA 2G0JA 3SENA 4CGHA 2ZOMA 1VSEA 4N77A 2GUIA 3CD0A 4QR2A 1RPLA 3D2WA 3EZWA 4ZK7M 2P9NA 4DUYK 3HZEA 3GFZA 4C8ZA 2XRIA 3FFIB 3H0RB 1HNIA 3P6YC 2GMHA 4BR0A 4OQJA 3MCMA 4R0JA 1HYSA 3MUVP 3H42A 4OJPA 5AR0A 2MMYA 1RXWA 2ISPA 4PKDB 2MZJA 4UOCA 2VFSA 1QVGR 4K25A 1T3NA 2G8KA 3LAMA 3BPDA 4WFAQ 9ICNA 2MPUA 1WSGA 2W25A 2V2KA 2MJUA 1W7WA 2R2RA 4QOZB 3L2UA 1NM2A 2BR0A 2JWNA 5KG2A 3VQ8A 3KLFA 1KBRA 5KPRA 2RE1A 4LSNA 1TK0A 3D3CJ 3M8PA 3S1TA 5HP1B 1BE4A 5ALJA 4JWNA 2QLTA 4LZDA 4X4VA 4QQBA 3BSOA 2WRMA 4CH7A 9ICJA 2KJ9A 1IM4A 2WAQF 4UAWA 1N0UA 4FPRA 2G2YA 2EG2A 4FO6A 3ZZUA 5LSLA 1RAGB 1D8ZA 4OYBA 5AXKA 2BKOA 1BPYA 5EY4A 3PMNA 3L4IA 3CDAA 1JLQA 2AQ0A 2EFGA 2R7TA 3M6UA 4MTPA 4UB5A 4WQ5A 3CC7N 3DC2A 3LDNA 2R7YA 3JYTB 4WXWA 4BVPA