1NJXA

Thymine-guanine mismatch at the polymerase active site
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njxA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njxA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njxA01
4RQ8A 4DTJA 1ZQYA 5J2NA 2LYHA 1Q9YA 5DMRA 1RT3A 2IMWP 4M9GA 4O3PA 5J0YA 1VRUA 4J2BA 4IR1A 3VQ5A 3HL8A 3DLBA 1KFSA 4KLMA 1JKHA 4OGCA 4CF0A 9ICSA 3JPRA 4ECSA 1N6QA 4OLBA 4M9HA 1S0NA 1IKYA 3CYMA 5C42A 3T5JA 8ICFA 2KTQA 3H40A 3ZD9A 5HBMA 3HO1A 2ZQBA 1FK9A 4QZEA 2DPIA 1ZYQA 5KFAA 3SI8A 5DQGA 4IQWA 3RTVA 3SV4A 3KJVA 2QK9A 5DBBA 5KG4A 2F1HA 8ICQA 4J9MA 4FK2A 4LD0A 1BPZA 4NXZA 4FJMA 1BPBA 5IILA 4B9SA 4FJXA 4CJQA 4LZGA 4KHSA 1YTAA 2NRXA 2OA8A 2ZJ8A 2IOCA 4IFYA 1S6QA 3LP3A 4TUSA 4FCYA 1NJYA 4KITB 4ECUA 4UAYA 4RZRA 4RW4A 4FBUA 4EYHB 1ZQOA 4CGDA 3L2QA 1S97A 1BISA 3VQAA 1RTJA 3EWAA 4TSXA 4DG1A 3M9OB 3UXPA 2BHNA 4E7LA 1D9DA 3HM9A 4K8XA 9ICHA 5KG0A 2D0CA 3NGYA 3BJYA 2KFNA 3RB4A 5D49A 1EP4A 1RCHA 1TVRA 4H4MA 4MFFA 5J2BA 1S1VA 4NLKA 4GMJB 3N97B 3RJHA 1QTMA 3KLEA 4Z4GA 1Z00B 3AVGA 3LWMA 3ZD8A 5KFUA 2ZE2A 2VG5A 1T05A 1LWEA 4CEQA 3OYNA 4KB1A 1WSHA 1ZBHA 1X9SA 1NK6A 5HNKA 3LP2A 2Q3SA 2BGWA 5IIIA 3EYZA 5J1EA 2V9WA 2IBKA 3OYMA 4KB0A 3AO4A 4E3SA 3FDSA 4CJ5A 3RB0A 3RAXA 4M47A 4I2CA 8ICYA 3PMLA 2JGUA 4IKFA 1ZQUA 1J5OA 4HUEA 4DTRA 3V7JA 8ICJA 4ZTFA 4J9RA 4YR2A 4JV1A 2QKBA 2XCPA 3C2MA 3LZIA 5I42A 4R8UB 1JX4A 5CY4A 2HHTA 2FPLA 3BQTA 5J2AA 1C1BA 5KFBA 4K4IA 4RW8A 3SUNA 1BQMA 4BWMA 4ECRA 1RBSA 3C6TA 4QZCA 2ITGA 3GIMA 4DS4A 3L2RA 3RH6A 4Q5VA 1S76D 3TARA 1IG9A 2MUTA 2XY6A 1MQ3A 7ICNA 4KRFA 4KI4A 4TUQA 3L8BA 3VA0A 3ZDCA 3T3FA 2YNGA 3KKSA 4CHOA 4Z4EA 1REVA 4O44A 2YV0X 3V81A 1MSWD 2YNIA 4FJHA 7ICLA 3M9MB 2P51A 4CEFA 3VQ9A 3S3MA 2ATQA 1S77D 1CXUA 3D45A 9ICKA 3TAGA 2Z1GA 3L2UA 5F9LA 3PX4A 1SKWA 8ICWA 4FS2A 4PWDA 1ZQHA 4OLAA 3RBEA 1HNVA 2Q0ZX 2OPQA 3V6HA 1ZQCA 5KGXA 5KFIA 3DRRA 3C5FA 3SQ1A 1RBRA 3P83D 1ZQJA 7ICPA 1RYSA 9ICOA 4JV0A 2HNDA 2FMPA 1LAVA 3MABA 2ZJAA 7ICSA 2JEFA 1WN7A 3AA5X 4O9MA 4ED2A 3AA2A 3QESA 1GOCA 5HRPA 1KVBA 3GDXA 3PW2A 1R0AA 3NGZA 2BCVA 3SCXA 5BOMA 2J6UA 1Y88A 4KLSA 1QQCA 2JEJA 3RJKA 4LSNA 4CJLA 4FJ8A 1FXXA 4O55A 4DL5A 4CFDA 2BANA 3M8PA 3C1YA 2LSNA 3S9HA 1JXEA 5CP2A 2HHXA 4F2RA 5KFRA 4FLTA 4KN4A 2J6SA 2PI5A 4JV2A 4Z6EA 5KRTA 3WNHA 1V9PA 1UT5A 4Q8FA 3F9KA 3MEDA 3V4IA 3T19A 3V9XA 4FJNA 5KT7A 3DLGA 4OGEA 1GOBA 1TVAA 2PZSA 4J9QA 1NOYA 4ED1A 3GV8B 1QS4A 1ZQQA 2V4QA 3ISDA 1KEJA 3OYBA 1ITGA 5HP4A 1ZQWA 4NCBA 1NK9A 3CFRA 7ICOA 4RUCA 3RJJA 1RT4A 2DTUA 5KFNA 3ZSYA 1ZQMA 1XI1A 5KFLA 4F91B 8ICMA 4HCBA 4DF8A 3C2LA 2JZBB 4CHZA 2G8IA 2PYLA 5KG6A 3RR8A 4KFBA 3C5GA 2VA2A 3PW4A 4QZAA 2HVHA 2B5JA 3ZSOA 3KIOA 5KFXA 3CM5A 5C5JA 4I2EA 4RT2A 2P66A 2G8UA 1U4BA 4FK4A 1X9WA 5KG2A 2G8KA 2OWOA 3OYKA 3MXIA 4FBTA 4C8MA 4TURA 1KSPA 3IHQB 3AA4A 4HVJA 1CZBA 5KFHA 4DEZA 1B9FA 3KHLA 1RDBA 3ISCA 3NH0A 9ICAA 3HK2A 2AQ0A 2AGPA 4RW9A 4CEEA 5E41A 5J0OA 4DQPA 2NRVA 1VSJA 3NDKA 3MFHA 4NCGA 5DDMA 4CJPA 3KLFA 1NKBA 3MR2A 2ZTCA 9ICCA 3NGDA 4CFCA 4CK1A 3EZ5A 4NM2A 3QETA 4RQ0A 4GC6A 3TFSA 5CYQA 3C2KA 3CM6A 4BDPA 7ICVA 4GVMA 1HQUA 3P1GA 2IHMA 3S3OA 5DDYA 4NLGA 1LWFA 4BE1A 8ICHA 4YD1A 9ICQA 4ED7A 5FRNA 7ICUA 2B6AA 4KO0A 4KI6A 4M3UA 5DBCA 2HMIA 5KRSA 1EX4A 3VN5A 2FBTA 5F9NA 4KLTA 4Q44A 4YMOA 4IRCA 4DLGA 3QZ7A 1X2IA 1ZQAA 2A1JB 3H8WA 2Z1HA 5J2CA 1VSDA 7ICIA 2HVIA 4J9LA 4F4YA 1YVUA 1CLQA 4KMUA 3SUQA 3VA3A 2JEGA 4FW2A 4M04A 3JSMA 5CZ2A 2R8GA 4JK1A 1H38A 3ETLA 4CFAA 2UVRA 3NH2A 4O5BA 4XRHA 4F4ZA 1JMSA 3UQ2A 4GLXA 3NTUA 1NJWA 2PYJA 4LZDA 4IG0A 4EZ6A 3UPQA 3DLKA 3P5JA 4GC7A 4ECZA 1S0MA 4DLEA 4B3OA 1S0VA 9ICFA 3DM2A 3OSPA 1CXQA 3HYFA 3L2WA 2XY7A 5SZTA 3MR3A 4LH4A 4I2QA 3SZ2A 1WCLA 4F5NA 1TV6A 2MAXA 1VSHA 3ZDBA 2EHGA 1UT8A 3G6XA 4CIEA 3H8SA 1RT2A 3PNCA 3UQ0A 2PFOA 4DOCA 1BPDA 4E0DA 4EP5A 3K5NA 2BCSA 5J2JA 2V4RA 1D8YA 4W5OA 4WE1A 3JYTA 1N56A 4YVZA 4JLHA 1W0HA 2E6MA 1C6VA 2AJQA 3FFIA 3OYCA 4KTWA 4BE0A 1IXRA 1TKTA 4RQ1A 4ECTA 3VQ4A 5J0QA 2D5RA 3V7KA 4Z6DA 4DOBA 8ICCA 8ICVA 4O5CA 1L3UA 4PQUA 1KLMA 1VRTA 1WSJA 4MEYA 2B21A 9ICXA 5KFWA 4UBBA 3ZDDA 3RJEA 1K6YA 3QEXA 5IIOA 1ZBIA 3PO4A 4AHCA 5FRMA 5KG7A 3FYHA 1DGSA 4AILC 5HP1A 4ELVA 3HW8A 3V9SA 5L1IA 3S3NA 1KFTA 3GILA 4RPZA 1IKWA 4KTZA 5HRRA 5JS1A 4RNOA 3V1RA 1S1WA 3RJIA 1Z00A 1HJPA 3RBDA 1K1SA 1ZQFA 8ICLA 4O3SA 4JRPA 1I3AA 3U3YA 2KZZA 2KZMA 4ELUA 3OVNA 4Y1CA 1LB2B 3TANA 5KG3A 5DB9A 4KHNA 3LPTA 2IA6A 2GV9A 3OYHA 4FJ5A 1RBUA 4HTUA 3NGIA 3QNNA 4EP4A 4DFMA 2FBYA 3AVCA 4B8AB 1C1AA 4QOZB 3SNNA 3WNGA 5CA7A 2YKNA 5C24A 3SV3A 3ZT4A 4O0JA 4DTMA 4KLFA 3GV7B 4O5EA 5JS2A 9ICLA 1U04A 3QEIA 3VQEA 1JLQA 3GIKA 3OYFA 3HX0A 3TAPA 4ECWA 1ZBFA 1RTDA 3ISBA 4R8UA 1ZQGA 5L1LA 4M3YA 5HMLA 4DL4A 4OKEA 5D46A 4F5RA 4DU3A 4M45A 4NLZA 4M3RA 3PO5A 4KHYA 1QSLA 4PUOA 9ICVA 4ICLA 3LANA 4MQ3A 4F4WA 2X74A 4F4XA 1LW2A 4G3IA 4CJTA 4CJFA 4DL3A 4M42A 4KLIA 3LPUA 3HT3A 1XU4A 3MR6A 1BIUA 2GWSA 3T1AA 4CJWA 3ORYA 1S9GA 2C22A 3C6UA 1ZQSA 1XS9D 3BQ0A 1C7YA 4R66A 3AVKA 1IKVA 4O3RA 4RW6A 4PHEA 8ICZA 4QW8A 2EX3A 4XIUA 4F5QA 4PH5A 3H7IA 3OYEA 2B4JA 4EBDA 7ICTA 4J2EA 1QSSA 4RQ6A 3MECA 2YNFA 4NYFA 3K5MA 3I0RA 3DI6A 8ICIA 1XWLA 1U9LA 4R65A 1S1TA 5J0XA 5KT5A 1ZQXA 4XA5A 4JUZA 2R8JA 5J2EA 2HW3A 5KFYA 8ICUA 3PW0A 1BQNA 1BPYA 2I5JA 4CEOA 2G8WA 1JLAA 3QZ8A 4FK0A 2IHNA 4FM2A 3T5HA 3L3VA 1XC9A 2UVUA 3QEWA 4DSKA 4K8ZA 3LDSA 4PHPA 3ZSVA 3ZDAA 1WCNA 3OS0A 5DG8A 2BCUA 3HSTB 2BKEA 1UAXA 2R8KA 4KLHA 3TAEA 3ZSQA 1XSLA 3C23A 1ZQZA 3KHHA 1KCFA 3O3GA 4CEDA 3ULDA 2A1RA 3RR7A 2OZSA 3O3HA 4J9NA 4M6WA 3OYLA 3NF6A 4I9QA 4E7IA 4NYNA 4N41A 5DQIA 3SQ2A 1EETA 4ECXA 4F4KA 4EZ9A 2ZJ5A 4TQSA 3Q8SB 3UXNA 3RMDA 1ZQEA 4FLYA 3DRSA 3ZT2A 2OPPA 3ALYA 3AVLA 5J2HA 2YKMA 3KLGA 4FXDA 3BQ1A 1B92A 4RQ7A 4O5KA 4N5SA 3IRXA 4CHPA 8ICPA 5HRNA 2W9AA 1JLBA 4BWJA 3UIQA 2ASLA 3H8JA 5CZ1A 4CK3A 3HVRA 1ZQBA 3VQ7A 4RPYA 4CJEA 3KLHA 4HHTA 5I3UA 4DFPA 3KK1A 3TFRA 3F73A 4CIGA 4ZH4A 3NFAA 2IDOA 4HUGA 1U47A 3BDPA 5KT6A 2HHVA 4CGJA 2YNHA 5D4BA 1BHLA 5TZVA 3VQQA 4ED0A 3RJFA 2OZMA 2JZBA 2FMSA 9ICMA 7ICGA 3G6YA 1EXQA 3JPOA 1J53A 4QWBA 3VQDA 3LWLA 4PPXA 4CJ4A 3ITHA 4CECA 4RT3A 4AHRA 4NY8A 5IINA 4IG3A 4DSFA 1MU2A 3HVTA 3MGHA 1B22A 3V7LA 5J0PA 4RG8A 1WLJA 3KHGA 2F8TA 4IRKA 1HQEA 4B9UA 3MEGA 5KT3A 2P6UA 4PGYA 1KDHA 2DPJA 7ICKA 3TAMA 3OGUA 9ICBA 3VQ6A 3WNEA 5KG5A 4Z0UA 1CZ9A 1SUQA 4BACA 3M8QA 4I27A 5K14A 3TABA 3UXOA 1Q9XA 5KFEA 1L3SA 4QCLA 1SV5A 1XO1A 4I2FA 3T5KA 2HNZA 9ICJA 3PVXA 4CFBA 4P4OA 3O4QA 4ELTA 1HMVA 2IS3A 1NJZA 4W5RA 5KI6A 3MFIA 4IDKA 3MGIA 4BXOB 4CGFA 3M8RA 1RXVA 1CUKA 3CQ8A 3AVFA 4HUFA 3CFOA 3EY1A 2VANA 3PY8A 4CE9A 2AQ4A 3V6DA 1I39A 1C0TA 3HPOA 4W5NA 1HUOA 5IIJA 1O1WA 4LY7A 5J0SA 3SUOA 3AVIA 4YG2A 2ATLA 3NE6A 4FZXC 3Q8KA 5KT4A 3T5LA 1LW0A 1WAFA 2Y1IA 3V9WA 4PHAA 9ICTA 1IO2A 1S9EA 2W8KA 7ICJA 1IH7A 4CESA 2R8IA 1U49A 1J9AA 2MUTB 2ZUBA 3ZSRA 1N5YA 1LWCA 3DOKA 4UB1A 2FPKA 4ZHRA 4CJKA 1ZQKA 3KK2A 3IAYA 4FVMA 1D8LA 2GBZA 2ASDA 1HYSA 1EXNA 5JUMA 3RAQA 4I2IA 3N4MB 3AVNA 2ALZA 4ECVA 2X6NA 1JL2A 1J54A 1RDCA 1JXLA 2KZ3A 3KTQA 2Z1IA 4UAWA 1S1UA 2P5GA 4DTPA 5HROA 5DB6A 2FBXA 3BGRA 4I2JA 3TAQA 4CHYA 3PR4A 3GQCA 4XQ8A 4YXMA 2C2EA 3ISNC 5DLGA 3ZT1A 3DLRA 1G15A 2I1QA 3PMNA 5KGWA 1RZTA 4YMMA 1JLGA 2W9BB 5DLFA 4YFKA 4UB2A 2DFEA 1BPEA 1TKDA 4KKOA 3G0ZA 3DLEA 3Q8PB 4Q8EA 4FJJA 1MQ2A 4J2AA 1JLEA 4HYKA 1JIHA 2KW4A 5J2KA 4TUPA 3PW7A 3NF9A 7ICEA 1DOQA 2RKIA 4YCXA 2D0AA 3QIOA 3QEPA 7ICFA 2F8SA 3AVMA 4ED8A 5CWRA 5EWEA 4YN4A 4B9NA 5CHGA 4F5PA 3G6VA 4F93B 4C8OA 3RJGA 4DWIA 2P5OA 1RYRA 4CHQA 3CFPA 1KVCA 3GFKB 1ZJNA 5CR0A 4GXIA 2I9GA 5EOZA 1NOZA 4DL6A 3QO9A 1YTUA 5SWMA 3PX0A 5KFZA 1ZQVA 4FYDA 4P4MA 1AROP 4R64A 3Q8MA 4NCAA 1COOA 1NK0A 4FJGA 2BCQA 5J2PA 2RF2A 3PUFA 4PGQA 1BL3A 4XUSA 5D3GA 4RQ2A 3KD1E 7ICMA 3M9NB 1TK8A 2E4LA 3VQ8A 3K59A 5HHHA 4E7KA 5HMMA 2OPSA 2AU0A 1ZBLA 4M3ZA 1NK5A 1HNIA 2AGQA 1LV5A 3V6KA 1MC8A 3GV5B 2VA3A 1Z26A 3MAQA 3U6FA 3SI6A 4CGIA 3KLIA 4RW7A 2BPFA 2PFQA 4CF2A 2ZTEA 4GXKA 2RPIA 4CERA 4Z4IA 4CJUA 2PI4A 1Y97A 3AU2A 2C2RA 4DTOA 4RNNA 4KLDA 5KFFA 1A5WA 4B9VA 4O3NA 3OS2A 4CCHA 4IBNA 4Z6FA 1BIZA 4OVLA 5IIKA 3OJSA 3RRGA 9ICNA 2ETJA 2YHBA 4KREA 3ZT3A 4QWCA 9ICIA 1ASWA 3HWTA 2W42A 2W9CB 4F50A 2UVWA 4O3OA 1RT1A 3OHAA 4DSJA 4J9SA 1S9FA 3B0XA 3OYJA 4DO9A 3RMCA 4DFKA 3LK9A 1TKXA 4Q45A 7ICQA 3VQBA 8ICGA 1JLFA 1JXBA 1KFDA 4IR9A 1UWBA 1UOCA 4JWNA 4FJ7A 4M9NA 2BCRA 3NF7A 4DF4A 4JS5A 3WNFA 4CGGA 2BPCA 3L3UA 4DTUA 2F1JA 3MEEA 5J2QA 1FKOA 2FBVA 3JPNA 3AO1A 3Q8LA 4HCCA 2ASJA 1HUZA 4KLGA 1TAUA 4Y1DA 4M9JA 3AV9A 1RPLA 4IQUA 2ISOA 4F8RA 3QEBZ 4JS4A 4DTSA 2DFHA 3TQ1A 1RILA 5KFGA 2BPGA 1QLNA 4FLXA 3A2FA 4RU9A 5KT2A 3EW9A 3V9ZA 3V1QA 1SL1A 1TK0A 4NLNA 1KLNA 1QSYA 4QWDA 3G10A 2RDIA 2ISPA 2W8LA 4ZTJA 4M3TA 5EU7A 4DFJA 4RPXA 3MBYA 4DS5A 8ICRA 4AHSA 3MXMA 3SYZA 4B9MA 5IIMA 4DU1A 4DQIA 4KLEA 4I9LA 2D0BA 1SKSA 1PZNA 4FLWA 2F1IA 4F3TA 9ICWA 4QZ9A 1EKEA 4MF2A 5HHIA 4EBEA 4YMNA 5EWGA 4W5TA 1Z3EB 3C1ZA 3GIIA 3AUOA 1XSPA 4YD2A 4H4OA 3RMAA 3NHGA 1ZQRA 4LVSA 3K58A 3ASMA 1T03A 4C8KA 4FS1A 3OYDA 2ZTDA 4ED6A 1BI4B 2C28A 4YXJA 4ECYA 1TGOA 8ICKA 1BCOA 4KLLA 4DQQA 1S1XA 2HB5A 3OYAA 2Y1JA 2FLLA 3K75D 4R63A 3BQ2A 1U45A 4EYIB 1TFRA 1SL0A 2ZUDA 2XC9A 4M2YA 3LP1A 3QEVA 4UAZA 4J9KA 5KFQA 4BGDA 3DOLA 1ZQTA 3LAKA 4IFVA 4QZIA 3AVJA 1VSKA 4Q43A 2XCAA 2BQ3A 1L5UA 2XY8A 4PGXA 3LALA 3QNOA 3K5LA 2WTFA 4KPYA 4QZFA 3AO5A 1BGXT 4DL7A 4B08A 3HP9A 4DU4A 4PY5A 3JPSA 3QLHA 3HP6A 4DSIA 4YNQA 4UB5A 4YQWA 3DMJA 8ICNA 5KFPA 4QWEA 3PW5A 2VG6A 3DYAA 3L2VA 5CB1A 4N47A 3NAEA 3M8SA 3EPGA 2R8HA 1QHTA 4M0AA 2P1JA 1NK4A 4ID5A 4PA1A 4B8CA 2HHQA 2J6TA 4GW6A 1HRHA 3AO3A 1RTHA 2Z1JA 1ZBUA 5J2FA 5J0RA 2PXIA 3LAMA 5KFOA 3K57A 4DSEA 2G8VA 1ASVA 2PY5A 1YT3A 4K4HA 1T4GA 4KLJA 4QZBA 8ICEA 4KHUA 4RQ3A 1QE1A 1WSIA 4CF9A 2OYQA 4BXOA 4E1MA 3ZCMA 4IRDA 4DOAA 4CGHA 5EWFA 4C8LA 2HHSA 3RRHA 4CEAA 1ZQDA 4FJIA 4R5PA 4I28A 2G8HA 3KHRA 9ICUA 2YHAA 1X9MA 1HYZA 2XHBA 2XY5A 2RDJA 4F2SA 5KTQA 1L3VA 4CJVA 3RH4A 4OPJA 8ICSA 8ICTA 1ZQLA 4W5QA 2HHWA 1HJRA 4Z6CA 3OHBA 2HNYA 4RQ4A 2NUBA 3IM1A 3GIJA 2DY4A 2IGIA 5KFJA 5DB7A 4YP3A 1SZPA 1VSLA 2FLPA 1NKCA 1A5XA 9ICRA 5KFVA 3SQ0A 1ASUA 1RTIA 2KQ2A 4BDZA 4P2HA 4J9PA 4I2GA 4M41A 4QZGA 2XO7A 1IKXA 3NBPA 4E89A 3B6PA 4B9LA 1TKZA 4F3OA 1U48A 4RUAA 3HJFA 4FM1A 2NRWA 4FJ9A 1RNHA 4FLUA 3OSNA 2KN7A 4DL2A 2KFZA 4I7FA 8ICAA 3QERA 5J0WA 1SL2A 3QIPA 4MFBA 4CF8A 4DMNA 1RT6A 4FW1A 2FMQA 5CYMA 1XHZA 3B6OA 2IC3A 2XGQA 3OY9A 3K4GA 2W9BA 4DQRA 4EEYA 2BGGA 2DFLA 2A1SA 3THVA 4BE2A 5DBAA 3OJUA 3V1OA 1T7PA 3SPYA 4N76A 2ZUCA 2E6LA 4FM0A 4F92B 1XHXA 8ICXA 3PR5B 2RN2A 3JPTA 3ZDEA 3TI0A 2JEIA 3AO2A 8ICOA 3SJJA 3E2EA 1DTQA 4ECQA 4Z4HA 1NJXA 1Z25A 3HPHA 4M6WB 1WSEA 2F96A 9ICPA 1TL3A 3SPZA 4TQRA 1NOMA 4O3QA 4NM1A 1A76A 1WSFA 4J2DA 3AA3A 1VSMA 2DFFA 4YFUA 4CIFA 3H08A 3MXJA 4E7JA 4DQSA 2A1JA 4I2DA 2G8FA 1TK5A 3TWHA 4QAGA 1D5AA 2PFPA 4KAZA 3IS9A 2P6RA 9ICGA 2O4GA 2W9MA 2NRZA 3VQCA 2IAJA 3NCIA 4I2BA 4X5VA 5DQHA 2M9NA 1ZQPA 1B9DA 2VWKA 3AU6A 4CJRA 5KFKA 4AH9A 5J2IA 3TAFA 4OPKA 5J0UA 3SQ4A 5FROA 5J0TA 1A77A 1WAJA 4E19A 4AHUA 4CHNA 2H5XA 2X78A 1VSEA 1KRPA 7ICHA 1S5JA 3JPPA 1HPZA 4MF8A 1D9FA 3PV8A 2BR0A 3CG7A 5J2GA 5CJ7A 3O4NA 8ICBA 2HHUA 3OS1A 3ZT0A 1RT7A 4CK2A 1JL1A 4KHQA 4Q0BA 5KFCA 2VA8A 1BCMA 4CF1A 4LH5A 4OJRA 4FLZA 5L1KA 1X1PA 3MDCA 4K4GA 1S10A 5L1JA 4IQVA 1RT5A 5DGAA 3AVBA 5J2MA 1KTQA 4DTNA 4O4GA 1ZQIA 4UB4A 5HLFA 4OKKA 2W9CA 1ZQNA 4I2AA 1TL1A 1L3TA 4DSLA 4M9LA 3QINA 2BE2A 4GXJA 1NK7A 3MDAA 3KK3A 4J9OA 4JWMA 1B43A 7ICRA 4L8RB 1ZJMA 4JRQA 1F21A 2FC0A 3DLHA 4F5OA 4PHDA 3QEAZ 1IM4A 2QKKA 3K5OA 3I0SA 4FZYA 2O4IA 5KFMA 3HXMA 4KTQA 4YR3A 3C21A 3I8DA 1RXWA 4YR0A 4FO6A 4FLVA 2WONA 2GUIA 3MR5A 2XRIA 4DTXA 5DK5A 4KLUA 3C94A 1C0UA 3V72A 3EPIA 1NKEA 4RNMA 4I2PA 2X6SA 1WSGA 1VSIA 4MEXA 3NH1A 4I29A 2PFNA 3H4DA 4N56A 5L9XA 3NF8A 4CEZA 2OPRA 2VWJA 4KLOA 1HYVA 2C2DA 5FDLA 5C25A 5BOLA 4AHVA 4KLQA 1UA0A 1GOAA 1KVAA 4AHTA 1K1QA 1RBTA 4Z4CA 3QE9Y 4Z4FA 1RDDA 1CEZA 4IQTA 4BDYA 4KN7A 1DTTA 3B0YA 3OYIA 3D0PA 4H8KA 3DRPA 3JPQA 5DGBA 4E7HA 3LZJA 1TV9A 1T8EA 2BQUA 1BVSA 1C1CA 3RMBA 4CEBA 4LSLA 3HPGA 3OYGA 5J29A 4MFCA 3Q8QB 1FKPA 1LAWA 5DKWA 5DB8A 1S6PA 2R7YA 4O0IA 1NK8A 2QXFA 4QWAA 1BPXA 5KFSA 4P4PA 1DLOA 1VK0A 4UBCA 4FZZA 3K2PA 1Q8IA 3PX6A 1S0OA 2BQRA 1A5VA 3LP0A 1BI4A 4FJLA 5KG1A 5T7BA 1SKRA 3AVHA 3O3FA 2FPMA 3LDAA 1T3NA 1XSNA 4KV8A 3RB3A 4ID1A 4CJSA 1W9HA 9ICEA 3ZSXA 5HRSA 3VQPA 4QZHA 1UA1A 2FLNA 2VG7A 4M3WA 3SUPA 4OKJA 4E1NA 5DG7A 3AVAA 3C95A 2WOMA 4CJ3A 1N48A 3E01A 4M3XA 2BDPA 4QW9A 4C8NA 1WNSA 3RH5A 3TR8A 3V9UA 1JLCA 5DG9A 2AGOA 2NRTA 4QZ8A 4UQGA 4ED3A 1JN3A 5J2DA 1VSFA 4RQ5A 1C0MA 5KFTA 2XGPA 4MFAA 3KKRA 3RB6A 3ZSZA 3H4BA 1ZETA 5BPCA 4EBCA 4UB3A 1RBVA 3U3GA 3IG1A 4KHWA 2JLEA 4QZDA 2UVVA 5KFDA 1RDAA 4B9TA 4G1QA 3Q8RB 4FJKA 1TAQA 4I2HA 3ZSWA 3V6JA 3KD5E 2ZD1A 3RWUA
chains in the Genus database with same CATH superfamily
1X5SA 5A8KB 5J2NA 2PAVA 1RAEB 4X4SA 4NB4A 4M9GA 2Y0SF 2XYHB 4Y0WA 2MKKA 5KOXA 3DLBA 1UVLA 1X42A 1VQNN 2KMDA 2SXLA 5SUHA 2IYIA 4DX5A 1RACB 2UV8G 4M5NA 1FJ7A 3R5JB 3CJ7A 4ECSA 4BRPA 4OLBA 4CZMA 3DM2B 3CYMA 3I56S 2F44A 3DXBA 4K2JA 1KHWA 8ICFA 3Q7CA 1Q7YO 2CJAA 5GTHU 3LM2A 1I1GA 5KFAA 1TV6B 2Q0RA 1O6XA 3RTVA 3SV4A 4DZDA 5LSLA 2W1BA 4IUFA 5DBBA 4FSVA 2BABA 3RBXA 3HI0A 3DNCA 8ICQA 3X3UA 4DJBA 3QMLA 5F0WA 2ZZMA 4FJMA 3MN7A 4F36A 4HT7A 5DRKA 4FJXA 1RGVA 4IFYA 2IOCA 4TUSA 1NZ8A 4FCYA 1NJYA 2HBLA 1H6KX 1MNEA 2HHHK 1AT1B 5L39A 4GO5X 4BG8A 1ZQOA 3GR1A 2XI9A 3M9OB 4E7LA 3L4PA 2F8MA 1LOUA 2ZZTA 3WIUA 3HDSA 4PQUB 3GSIA 4P7TA 1VRTB 2XSFA 5KG0A 1RG6A 4U7UK 3NGYA 2R3VA 4ZVFA 3MXHP 3RB4A 3QGGA 5H9EK 1EP4A 1IWAA 2PFDA 1TVRA 1LQ9A 4ED4A 4GMJB 4Z4GA 2FJDB 3NOGA 1N54B 3WQTA 4WU2A 4I56A 2ZE2A 3OYNA 2DJWA 4EGLA 1ZBHA 1X9SA 3E66A 2FI1A 1ZM2A 2V9WA 1X4AA 2XMMA 1CI4A 2QC3A 2YKNB 5A8WB 4I2CA 1UVNA 3DDHA 4IKFA 2HOFA 4J9RA 4PL1A 3KDNA 2E8PA 6FD1A 5FIIA 4LVNP 3IAS9 4C8YA 1N34K 3B9JA 1YAGA 1JX4A 2G09A 3BQTA 1UTAA 1C1BA 5KFBA 2KRBA 4RW8A 3B4DA 3CD0A 1NNLA 1JALA 1WC3A 5ALZA 3TARA 4N7TA 3I31A 5JXSA 4DX8H 2XY6A 3MN5A 2EG2A 4HI2A 3KWGA 3T3FA 2DGQA 5ALUA 3G4SS 1NU4A 3DDIA 3HHLD 1REVA 2M7SA 4PKHA 4O8KA 3EZUA 7ICLA 4HACB 2AYBA 2ZIUB 2MRLA 3M9MB 1IKVB 2LYVA 4CEFA 4ZLLA 1KEKA 1FT8A 2ATQA 1S77D 1OSCA 3UI3A 1CXUA 2EWSA 2UU9J 3TAGA 2KVCA 3J7YI 2V8DA 1H0HB 4CNYA 2HGLA 5IWAJ 4ZLPA 1MW7A 3DI6B 2GJFA 4I6MA 5KGXA 1PJ6A 1N61A 2HZVA 7ICPA 2M9KA 1XN9A 3QLHB 4F4AA 9ICOA 3SSRA 4JV0A 1CJTB 2FMPA 3PHTA 3ULEA 5ITHA 3TYTA 1N33K 5E2QA 4OZLA 3MABA 3PRDA 2IPOB 4OL8A 5CZVA 4LFBF 1WN7A 4Y3CA 3MX2A 1YBTA 1S57A 1SQFA 3U7JA 2CZ4A 1N4LA 5HRPA 4ZVOB 2H3QA 3PIOQ 2BCVA 5BOMA 3CJ2A 3W7BA 4KLSA 2JEJA 4GV3A 4FJ8A 3NASA 3VF6A 4O55A 2BANA 1UCVA 2R7TA 3C1YA 2RAQA 1QQOA 4Y2PA 2LSNA 2NRHA 2DCLA 1KVKA 1HFEL 1QQ7A 5HJYA 4AE5A 3R6LB 3BF3A 3MM6A 3BYPA 4DZ6A 2HS3A 1UW4A 3J7YU 3DRSB 5C10A 2OPPB 1KAXA 3KLGB 4Q8FA 4CZLA 1W2BR 4K43A 1U1LA 3NVMA 1K73T 3V9XA 3FZFA 1YITS 1MN8A 2WHOA 2CDRB 2QKQA 4OGEA 3VENA 1RWVB 2FLOA 4MKAA 1N32K 4ED1A 5I3UB 5AM1A 2VZ9A 2V4QA 3ISDA 5TKYA 2OSRA 5LMNF 2W6LA 1RFQA 3F0NA 1NK9A 1R3NA 4G6VB 1NGEA 4RUCA 2D69A 3EXCX 3CJ8A 5KFNA 1ZQMA 2MJUA 1RAIB 2YNHB 1XI1A 2ZIVA 4JB8B 2O1PA 2XVTA 8ICMA 4MJKA 2PYLA 2HLUA 3TU5A 4ILLA 2HVHA 2B5JA 2BA9A 2K4HA 2K8BB 2R2RA 5KFXA 2BJ8A 3CM5A 2PC6A 2BDUA 2G8UA 4M5LA 4OJ1A 4IH6A 3P38A 3ZEUB 2G8KA 2OWOA 3OYKA 2AJ2A 3AA4A 3O9TA 3IHQB 4CE6A 4W4MA 2F8EX 3HSJA 3T9NA 4CIOA 1B9FA 5JLHA 1NDKA 1H73A 3QIPB 3IDHA 1RK8A 3DGPB 2QW9A 4ZVUB 9ICAA 2G5IB 5GADP 1SUQB 2AQ0A 4RW9A 2QM1A 1RDRA 3PKMA 3FM9A 1LNQA 4BGBA 3BPSP 3NDKA 3MFHA 4M63C 3M7VA 2J9DE 1SV5B 4GNIA 2BM1A 5DDMA 4CJPA 5E3PA 1NKBA 1OO0B 4KY3A 1WC0A 5ALXA 1HIYA 3HD2A 9ICCA 3NGDA 5ALVA 4TLRA 1IBMF 3PZPA 1ECWA 4PL8A 2M8HA 2QL7B 4RQ0A 3D7EO 3D2SA 3MMCB 2UUAK 4BR5A 2QA2A 1RQ0A 4LF8F 1V97A 1VIXA 5EHHA 4YUDA 1C0TB 1FDAA 3GFYA 8ICHA 4ZLJA 2R7VA 9ICQA 1TL3B 4ED7A 5FRNA 3TO8A 2JNJA 4UOGA 4KO0A 4M3UA 2FHOB 3VN5A 1OPIA 1ZRNA 4KLTA 2YQ1A 3Q8VA 2GGPA 5BN9A 3MCMA 3PSFA 4LR8A 1UVIA 1ZQAA 1S9EB 4MT1A 3I55N 3KBBA 5J2CA 2R2UA 1VSDA 1FXLA 1G3OA 4IOCL 3OR2A 4J9LA 3RGIA 5ADXH 4P10A 1RGIA 2E5HA 4X4QA 1HJOA 1LXNA 2QWRA 2UP1A 4P2XA 1PK1B 5DDPC 4JK1A 1WHYA 4P0QA 1HYSB 3GJQB 5K8MA 4Y2RA 4XRHA 5A8KA 8RUCA 3KZIU 4UTGA 3UCGA 2DKOB 2EVZA 3NTUA 4JMUA 1HNWJ 3D5MA 4J03A 2J8SA 3BGRB 2RDDA 1L7PA 2C1EB 3P5JA 2DKZA 1PC5A 1YXQA 3M6ZA 1S0MA 2KSOA 1WOQA 3QJLA 4B3OA 2K8CB 3DM2A 4L3QA 3WKDA 2Z2ZA 1WCLA 2NXUA 3DLLL 1TV6A 2EHGA 4OI4A 3G6XA 1IWGA 2WMMA 3UQ0A 1X3MA 2W4DA 2R9LA 3P45B 2HPUA 3ZYYX 5FLXY 2OELA 3NUQA 2CNOB 2UXBF 4MTPA 4B3TK 1GLFO 3TJ8A 2XLJA 3K5NA 4M5DB 1D8YA 1WEYA 4WE1A 1FW6A 2Y1LB 4Z37A 2E1FA 4YVZA 5HLFB 4P74A 3BYRA 2H5EA 4HEA9 3BQ7A 5HATA 2AJQA 2XIDA 2GCFA 2LI6A 2ESEA 2KP7A 4UF4A 4RQ1A 4ECTA 2PMHA 3CMEN 2D5RA 3V7KA 4H4KA 4BQLA 1HWIA 1B99A 4PQUA 1FJEB 1VRTA 1UZDA 9ICXA 2VBYA 1D9AA 1K6YA 1KKHA 1ZBIA 5FRMA 5IC4B 2F2AB 3HW8A 3UN2A 4MN4C 2RT3A 3HD1A 3GILA 3O8WA 1IKWA 4DR3F 3V1RA 2HWIA 4OYZA 5F2RA 2K8AA 3PEHA 4JKDA 3RBDA 2KICA 1RB0A 4LRFA 1ZQFA 2C2ZB 4NI2A 1HLWA 3AA8A 1G2EA 4JRPA 1R8HA 3LQVA 4KGVB 4JI1F 3U3YA 1HI1A 2KZMA 2P6SA 2EDUA 4KHNA 1UFKA 3OUYA 2IA6A 1HNIB 2GV9A 4FJ5A 2ZXHA 2P6TA 1AFIA 4HDHA 3GJTB 1RWKB 2CQ1A 4EP4A 3TADA 3AVCA 1XERA 3CCLS 2QSWA 3ILIA 2YKNA 5A8WA 4DR5K 3FQLA 4RW7B 2MB0B 3H0MB 3GV7B 5JS2A 2B9EA 5MAOA 2HQFA 1FX2A 5LL6Z 3TAPA 1P27B 1T95A 4GIBA 3UNGC 4OKEA 2PBDA 2XHWA 1DK3A 3Q24A 4NLZA 3PKYA 2OHFA 3DDNA 2ZM6F 3EUNA 1X5PA 4NLQA 3CIMA 4G3IA 2CGLA 4FOIA 5ALLA 2GW8A 3LF0A 8AT1B 4M42A 4PG5A 1QUPA 2OEKA 1UFLA 4CJWA 2DXEA 4NX9A 2WRMA 1FRLA 2ZUGA 2ZIUA 2WTUA 4ITSA 1IKVA 1UCNA 1X4HA 4PH5A 1WWHA 1NJIO 2E1MC 3GOIA 2E88A 3WK4A 3GMGA 1XR5A 1T6DA 4J2EA 2D6FC 3PRVA 2YWHA 3EGNA 3IAM9 3NS5A 4OYPA 4RQ6A 2ZC3A 1FE0A 3K5MA 1UWBB 2IM1A 3DI6A 1ATNA 2OMOA 2H3VA 1ZQXA 4RCHA 4J37A 1QVGM 5J2QB 1ZBSA 3PIOL 2ZH6A 1V5IB 4OV1A 1CJTA 2IHR1 3W66A 5A2QO 3ID8A 4E8UA 3JXUA 4FK0A 2WFBA 4AL6A 3K5PA 3FZ2A 1XC9A 2DNYA 2XWYA 4URQU 3ZDAA 1WCNA 4FYYB 3AD9C 2FJ6A 3FCHA 2LQ9A 4C23A 3CJ4A 4KLHA 2UUBK 3TAEA 3DEEA 4PWUA 3C23A 1KCFA 3AAQA 3LPEA 4ZA1A 2YCHA 1BOTO 1IBMJ 2XTJP 1I94K 3IR5B 3UM9A 1APSA 1PO6A 3SQ2A 1D3WA 4JNEA 3O6WA 1FEHA 2KVIA 4NL5A 2ZJ5A 1GK8A 3NVZA 4LF8J 4ES1A 3RMDA 2H1YA 3EEQA 1JMTA 3DRSA 2YJEA 2D9OA 1WI6A 2OPPA 4ZVEA 3ALYA 3KLGA 4IL6U 3VWSA 4BJQA 2YI1A 2Z58B 2W9AA 3UIQA 3BZCA 5C42B 1HIWA 2XYGB 3VQ7A 2LXIA 4JI6K 1O51A 2GO7A 4CGZA 4CJEA 4HHTA 1BWVA 5I3UA 3KK1A 1N36J 3BN4A 4HUGA 3C7NB 1WOOA 1SQEA 2LDIA 3MM9B 4USAA 5GAHI 1Z1VA 4HR2A 2YNHA 1FVQA 2FMSA 2IOFA 4UAUA 2EFNA 9ICMA 7ICGA 3G6YA 3CJTA 2JWLA 2CQIA 4QWBA 4WK3A 1BHNA 2VV5A 3ITHA 4UQTA 4RT3A 2PD1A 4GFJA 1MU2A 3ZZ0A 3ZEUA 3VPZA 2HBRB 4ILMA 3GG0A 4IOBA 4M8LA 2FVPA 3DMJB 3U27A 1WLJA 1KHVA 2FD2A 4Y2CA 3CCTA 2CJQA 3DGPA 5M1PA 1SJ3P 2CIMA 2H4WB 3WNEA 1KAZA 2RP5A 3J7AN 3DXMA 1SUQA 4BACA 2F65A 4I27A 2BE7D 4F3QA 1SB3C 3CC2S 3ATVA 4IO1A 2HMPA 5C2DA 1RA6A 3M1YA 1L3SA 3I5CA 2EKNA 4O0NA 4QIEA 1FFSB 1SV5A 1RTHB 3TRGA 2GAGC 3F5TA 3T5KA 3B78A 4CFBA 4X65F 2KM8B 2IS3A 3I8BA 1NJZA 2EK6A 5GAHU 3MWBA 3MMCA 2J5AA 2YWKA 4NOHA 3EZOA 2DNMA 4X4TA 4BRIA 4CE9A 4BC2A 2AQ4A 3ZC4A 1FRIA 1C0TA 2P35A 3FZMA 2RE1A 4LY7A 4PG7A 4CLKA 5K9FA 1ED1A 2ADCA 3ZETB 1YX2A 2FUG9 2C3YA 2BYCA 3NE6A 3Q8KA 1Q53A 4KAIA 3T5LA 1WAFA 2Y1IA 4FF1A 3GFZA 2MU2A 1IO2A 1FDBA 1RXOB 1S9EA 2ZKUA 4CESA 4YORA 3J81U 1J9AA 3CQYA 3C19A 5JVHL 4CZIA 1VK8A 1FTCA 1WEZA 2ZUBA 3M6GA 4DR3J 2O6KA 1M5SA 4F71A 5D6GA 2OYYA 3QMQA 4FWLA 1S79A 1RHUB 3IAYA 4EU0A 3GWCA 2ASDA 1HYSA 4JI1J 4MYTA 3N4MB 4FF3A 3AVNA 2ALZA 4RBVA 3A5OC 1RDCA 2Z1IA 3HHLC 4ZPAA 2ZC4A 4JK9A 1RWNB 3BGRA 4QIFA 1BLUA 3TAQA 4CHYA 1KQKA 4YXMA 1RT6B 4B1UB 5CYMB 2EPIA 4HHUA 4YMMA 2B4VA 5BJRA 1JROA 1X9JA 4IOXA 3I96A 4OD0A 2HOEA 5GAEP 3GPAA 3A0IX 5AQKA 2QEXS 3G0ZA 1MQ2A 2P9EA 2ZM6J 3I32A 1QAJA 3DXSX 4TUPA 3PW7A 3MDFA 1R0AB 4MLEA 5LXRA 7ICEA 3LTOA 1DOQA 1M90T 3PYEA 4YCXA 4LRDA 1IXKA 2UUWA 2D0AA 4I69A 3G71S 3C15B 2YVSA 3IP0A 2F8SA 4W98A 2D7SA 5AI5A 4ILGB 5EWEA 2P9UA 4B9NA 2H3IA 2DNGA 4NMLA 3UE2A 4P7VA 1N63A 2JZ5A 5L38A 2Z57B 5ALWA 1XNRK 4DOZA 4C8ZA 5BYRA 2M8DB 2AYMA 3QQCD 1XMOF 1RAJA 2BW7A 1KN5A 1AXQA 1HHQA 3GCXP 2A2DA 5DETA 4DUYF 4OHXA 1WUAA 2CG8A 4NXNK 5EVZA 3NCRA 1N2XA 3CCVS 3ET6B 3AQPA 4C98A 2V6AA 3IG8A 2F4VF 4R64A 2PIIA 2RMLA 5IC6B 3W65A 3W63A 5J2PA 2WVFA 4PGQA 4GKJF 4UY85 3KD1E 2E4LA 1OY9A 2XULA 1SJQA 4E7KA 4TY8B 1GNKA 1HNIA 2AGQA 7FD1A 3CD6N 4DKWA 1TUVA 4ZPWR 1L6NA 1QHAA 2VA3A 4HI1A 1Z26A 3SI6A 3C0BA 2KD1A 4RW7A 4U95A 3PTWA 2PFQA 1H1VA 2ZTEA 4GXKA 4CW7B 1QQNA 2Z8QA 4CJUA 2PI4A 4Z4IA 1Y97A 1S6UA 4LF7F 2VGNA 2NXCA 4KLDA 4N8NA 1A5WA 5K20B 1NMEB 3E1YA 4QU6A 3K1RB 1FVSA 1Y64A 5M1QA 5EX3A 4ZOHC 2CXEA 1X0PA 5AKHA 1N5QA 4IBNA 4RQMA 4Z6FA 5IIKA 2DGUA 1RT5B 3U1NA 3RRGA 4NWIA 2J7WA 1NGIA 9ICIA 2AX1A 3PCOB 1X5OA 1VQLN 2EBGA 2YMPA 1T9WA 3CD6S 1EKSA 4DCCA 2CG4A 3I6PA 2ZNZA 3RMCA 2O01C 3SFGA 5DM7Q 3HZGA 1FRXA 3PSPA 2GV1A 2GOLA 4MKVA 4JAXA 3TZZA 1SXDA 8ICGA 3FK4A 5FPNA 3N0VA 4AYBF 3I0SB 5DDQC 1JXBA 1M1KT 1LWFB 1UWBA 2YMQA 1K8AO 5IT9U 4ZKAA 4FJ7A 2E20A 2G5HB 2BOPA 4ILRA 5LT5A 4DTUA 5J2QA 3BP8A 2QMWA 3VAIA 5D0RA 4LFCK 2ASJA 4B3SK 3CPWM 3HJEA 4D3GA 1VQKS 4PABA 4Y1DA 3I5AA 4M9JA 4BS2A 5BPNA 4IQUA 1F0MA 3IO1A 1KXPA 1VMBA 1OYEA 4LSZB 3J7ZO 4XPCA 2DFHA 4C0BA 2KT5A 1S72N 5FDLB 5C25B 1QLNA 4XDCA 4Y2UA 4FLXA 4RU9A 3SSQA 2EAPA 4DV7F 3QGIA 4NZ6A 1CLFA 2MZ1A 3M7DA 3KYLA 4PZNA 4NLNA 1KLNA 3BBCA 4ZN1A 1V3ZA 2ISPA 4M3TA 3A0HU 4C80A 4BLGA 3SFUA 1YWXA 1C1CB 2K1RB 1YRTA 4DS5A 1HNZK 1L8LA 2K2PA 8ICRA 4DPTA 3SYZA 4LSLB 3RFAA 2EANA 4FPBA 1VQ4N 3V2UC 1NSQA 4DU1A 4DQIA 1WORA 1QZ6A 4CT8A 1EX8A 1Z19A 4YOEA 3CCJS 1Q5YA 4YMNA 2KT3A 1RBAA 3GIIA 4W5TA 5K4LA 4DUTA 3O9RA 4JV5F 2AEFA 4HTLA 1S72S 1S12A 1TGOA 2KKVA 4DPWA 2E9ZA 3C7NA 4KV8B 4OV6A 2OTLN 3MM9A 4CTAB 5GAGP 5AFUH 4JI2K 1KKXA 3K75D 3BQ2A 1Y5NB 4IJAA 2BRLA 1TFRA 1SL0A 1GMVA 2XC9A 4LBPA 4M2YA 3M2UB 1N5VA 3AHPA 4UAZA 4IO9Q 4CO1A 3FFIB 2RB7A 3AVJA 3ICLA 2HWHA 1B3TA 2W4CA 1AUSL 3QNOA 4KPYA 2QMXA 4DL7A 3SCIE 4YNQA 4UB5A 3DMJA 1Q7YT 3A5LC 1NBWA 4QWEA 3HSDA 5F0UA 4DR1F 5ALHA 2MZTA 3L2VA 2DXDA 2R8HA 3IG1B 1RWWB 2MZQA 5DM6Q 2HHQA 4GW6A 3CJ3A 3AO3A 1RTHA 3U8XA 5M1NA 4TKTA 5J0RA 2V5HG 3CIPA 2GO9A 3POTB 3J7A1 1B64A 5GMDA 1R8CA 2VJ5A 1B0XA 1YT3A 8ICEA 1EO1A 1PGZA 1WDDA 4N8OA 1W7WA 1X6IA 4RQ3A 1FCAA 1WSIA 1VRUB 3QAUA 3O9QA 1N60A 4DOAA 2HHSA 4NLVA 4WFNQ 3RRHA 3AY9A 1GLLO 1JKHB 3I9V9 1QZ5A 4I28A 3BZQA 3KHRA 9ICUA 3FBCA 1X9MA 1DHMA 3ZETA 2CZ9A 4L3NA 1KQSM 2RDJA 3M6WA 5KTQA 1FK9B 1T9TA 1L3VA 1KOOA 4CJVA 4B17A 3KG0A 1HHTP 2U1AA 8ICTA 3IRUA 2R7SA 2NO5A 3U9ZA 2NZ4A 3ZTPA 2HHWA 3AEVA 3IWLA 3P5BP 4RQ4A 1MN7A 3IM1A 3DRXA 2DNQA 2W2PP 5KFJA 4HTIA 2RU3A 2F4VJ 4A61A 3SQ0A 1YTYA 2JL9A 4A62A 4H5RA 4GKJJ 1WELA 4BDZA 3OFGA 4P2HA 5D4PA 5CEHA 3VGLA 4OYAA 2FJVA 4KX5A 4B9LA 4NLSA 5D0GA 1I5OB 4RUAA 1B4SA 3HJFA 4JOUA 3W64A 4U8VA 1ZA2B 2KN7A 4EELA 4DL2A 5CYJA 3QERA 2G2OA 4MKBA 2D0OA 4O3MA 2EQYA 2IBOA 3OQ2A 1RT6A 1OQ3A 1ZTTA 4FW1A 2JFKA 5CYMA 4H4MB 5CZXA 3HHDA 3PJ9A 2P9LB 3B6OA 1Q8LA 2XGQA 3H1VX 4IDHA 4EEYA 2BJ3A 2G06A 4BE2A 3DXKB 2CGKA 2I5JB 4ZPBA 3VTIA 3SBTA 1V6HA 2VG5B 1T05B 2QMUB 2ZUCA 4CF3A 2JEIA 3LP2B 8ICOA 1GAOA 2JC1A 1NH7A 5AQLA 4EFAC 4K25A 4K4WA 3OW2R 4JI3F 2R7RA 3I33A 3C15A 2IOFK 2FZKB 3GCWP 1VYAA 4Z4HA 1WG8A 2R7OA 4PXCA 4LF4K 2BJ7A 4K0KF 1J5OB 4M6WB 1WSEA 3F41A 1M1HA 1NOMA 1Y11A 2V4JB 4JI5F 2B43A 1DARA 3VEVA 1XJWB 1K0TA 2QTWA 4CIFA 3SR6A 2G2YA 3H0LB 4YY3J 2JMGA 1TK5A 3TWHA 4QAGA 1D5AA 2PFPA 2Q2RA 2P6RA 3P96A 3TSUA 4HT5A 3ZX2A 2BMBA 3K8WA 4K8RA 5M1OA 3NCIA 1SJ4P 2W54A 4CRXA 3BB5A 4KHPF 2M9NA 4CO4A 1WC6A 2YQEA 1NZAA 2P8IA 1WDTA 3V81B 1B9DA 4WFYA 5J0UA 5J0TA 5E3CA 1WAJA 4TY8A 2B6GA 4E19A 2P9PB 4R0JA 1IJJA 2XS5A 2YKQA 4AQYK 1IG8A 3MAAB 1GLEG 1JNRB 3HCXA 4DV7J 2X78A 8ATCB 1FFWB 1VSEA 4PWDB 7ICHA 3ENOA 1S5JA 1HNVB 2MQLA 4AD6A 2OPQB 1GEHA 3BO3A 3HBTA 1D9FA 3FSYA 2WF9A 3VGSA 2ZVIA 5J2GA 4H5NA 1VLOA 1U6ZA 1YRUA 2B0CA 1JL1A 4KHQA 5HK4A 1HKGA 4JKGB 2XQCA 3KZXA 4HVZA 4LH5A 4OJRA 3MDCA 1KQQA 5L1JA 1RT5A 3MMAB 3OT9A 5DM7L 3WZ0A 4UB4A 1RWPB 3KLVA 4JV5J 4LSNB 2F3JA 3QGPA 4M9LA 1Q86O 2B4OA 3MDAA 3VGVA 2FIUA 2VH7A 1VJ5A 4YB5A 4L8RB 2FDNA 4IDKB 4FDFA 2IM0A 1HX1A 3WQUA 3R3LA 1WJ9A 4OZ1A 4B1VA 1IM4A 4ZVSB 4F72A 3I0SA 5KFMA 4G9ZA 1HNXF 3HLUA 3KVGA 2QA4G 1M5HA 2KXFA 4DQ8A 4US9A 1M1GA 4LIRA 4CZKA 1TL5A 4NLWA 3V4IB 2ODGA 1NPPA 1W7AA 2K4EA 2FC8A 3FFKB 3EVMA 4B3RK 4USIA 4CLZA 5DK5A 5F1XA 1U2RA 2J7KA 2DRAA 3EPIA 4RNMA 2RQ4A 4DR7F 3NS7B 4I2PA 2X6SA 4X66K 1HD1A 1VSIA 2FPHX 4DR1J 4WJBA 3Q89A 4N56A 3NF8A 1FWPA 1RT4B 5FDLA 5BOLA 5C25A 1NWKA 4TU9A 3GL1A 1KVAA 3M1FA 5ALKA 1K1QA 2E1CA 3QE9Y 5GIPA 3K8VA 1RDDA 4IQTA 3VV2B 1U25A 4BDYA 4A8FA 3A5NC 3JB9k 5AXKA 2F5GA 4H8KA 1SAZA 1GX6A 1BVSA 1C1CA 1UJ5A 3RYLA 1BG3A 4CEBA 4NLBA 3IM9A 4LSLA 3HPGA 4GY2B 5BXIA 4ZP6A 1GXLA 1LFPA 3WC0A 1LAWA 2HRUA 1ZS6A 2GH1A 3W8PA 4UB8U 5KFSA 5GINA 3H45C 4WFAL 1DLOA 2CH6A 1RYUA 2GAHC 1HHSA 4OX9F 2ILYA 1N0UA 3B82A 1VK0A 1J2NA 5AKJA 4UBCA 3K2PA 5JRTA 3PX6A 2ZIWB 1S0OA 3PG9A 1O03A 3AB4B 1VS3A 3E9LA 4KH0B 3EL2A 4FWKA 1XQIA 4Y2IA 4NLYA 5T7BA 1SKRA 4DV1F 4JI7K 4KV8A 3RB3A 2VHGA 1Q5VA 4NXMJ 4CTAA 4LF9K 5HRSA 3AJDA 3QBXA 1UA1A 5CYQB 2FLNA 4KYZA 4BRGA 3QSYB 3VF2A 3J80U 2N7CA 3M2UA 3JSRA 1HQUB 4FYXB 1KL9A 1N48A 2LEAA 1WKLA 2IFXA 5TKWA 4JP8A 4YDDB 3L09A 4IJNA 4QW9A 3B8AX 5LL6d 4C8NA 2Q6BA 3JSYA 3QUCA 4TYBA 1WBBA 4WPAA 2NRTA 4DV4K 2HQGA 1RM6C 5J2DA 4FL9A 1Y3JA 4TU7A 3QT6A 4RQ5A 3CP8A 3W5ZA 3CW2C 3GU3A 4F0HA 1IR1A 1VLBA 1J27A 4CO0A 3ZSZA 1ZETA 4EBCA 1RBVA 3U3GA 1SC3B 3IG1A 5FP0A 4KHWA 4Y2AA 4U7CA 1HPMA 3EKUA 1VQ8S 3EWGA 3IWNC 4P2SA 3Q8RB 2KKHA 4X64F 2H4YB 4FJKA 1PCAA 3E9PA 1HR0K 1LKYB 2KKZA 3ZSWA 3KD5E 1FXRA 3LDOA 1R8AA 5H9FJ 1ZQYA 2LYHA 2UUCF 3NCPA 1Q9YA 5DMRA 3D6JA 5J0YA 1VRUA 2YY3A 3L4IA 1Y5IB 4IG0B 4XPEA 4IR1A 3VQ5A 3HL8A 1SIZA 3BBFA 5AQZA 1JKHA 3FGVA 4ZP8A 4K0KJ 4CF0A 1QAIA 9ICSA 2ZOMA 1S0NA 3H40A 3QJPA 3ZD9A 4JI5J 3HO1A 1FK9A 1ZYQA 4P9SA 1WUUA 1B0VA 2UXDF 3OBWA 3W2VB 3KFWX 3KMSA 1XMQK 3CPWR 3HZEA 1PYSB 2F1HA 3H0RB 2ZH4A 3IR6B 4J9MA 3D3BJ 4FK2A 1BPZA 2VONA 5FPDA 2E1PA 2QG9B 1R8PA 1BPBA 4BRMA 2HFZA 1VQ9S 5IILA 3O5TB 4B9SA 3JYTB 2X1FA 4KHPJ 1HBMB 4KHSA 3CSKA 3FRZA 4MHVA 1DQ9A 3KUGA 2CPEA 2G07A 4UAYA 4RZRA 2EZXA 4FBUA 4EYHB 1S97A 3DV9A 3VQAA 3CJQA 2BHNA 3RW6A 4JI8F 1D9DA 2HYIB 4NA3A 3D6TB 9ICHA 2AX0A 4H0YB 2D0CA 3CC7N 2E7WA 5AQIA 3CF5Q 1RCHA 2VPZB 4H4MA 1VBZA 3O2IA 1NHVA 2P9LA 3VVUA 2HK2A 3CJAA 5BR8F 5C2FA 4BREA 2NZCA 1Z00B 3DXKA 2CQ4A 3I4PA 3ZD8A 2E1AA 5KFUA 2VG5A 1T05A 4CEQA 1WF1A 1A0OB 2EFVA 2X51A 3NKYA 3WK7A 5HNKA 3LP2A 4NZ0A 2Q3SA 3KD3A 5D0EA 2L9DA 1TQLA 3N5BA 1NJIT 3GBTA 3RB0A 3TKAA 3OLAA 4DV0K 8ICYA 3PMLA 2GJ2A 1J5OA 4TU8A 2W41A 1JWWA 2YX8A 4JV1A 2VQEK 1JLQB 2V4JA 2KN4A 1SV0C 4MIAA 3D0HE 1XIQA 3C2MA 1RAAB 4CNZA 1ZM4A 4R8UB 3DGVA 3K17A 2HHTA 2GVDB 3GJSB 2VOPA 2DB1A 3VGKA 5H1SV 1XK8A 3QU7A 1S76D 1FNOA 2MUTA 1NDLA 4KRFA 3TZYA 3ZDCA 2E5SA 2IMOA 2WSCC 4CHOA 4Z4EA 1T03B 2P9IA 5D15A 1YJWS 4DR7J 2X1GA 1CVJA 2YV0X 3H20A 3V81A 2JH7A 3IC1A 5IT0A 4NLOA 4YHHF 2HRTA 5HI7A 2P51A 2P9PA 3ZTSA 1EKRA 3NGSA 2HF3A 3MAAA 3L2UA 3CXCM 1Q0NA 1SKWA 1NHKL 4QJFB 3MMJA 4PWDA 4OLAA 5I3PA 2WF7A 3RBEA 1HNVA 2EFQA 2YNFB 2OPQA 5LJ5Y 3V6HA 3T1HK 3SK3A 1ZQCA 1S1TB 2XI3A 3D2EB 3CO9A 3SQ1A 1XNQK 1ZQJA 4KX3A 1BUXA 3QFWA 1FO1A 2VDHA 4GKKK 1KQSR 4X4PA 1YJNS 2FHKA 1GH8A 3CGIA 1LAVA 2D3DA 2A40A 4JKGA 4EFHA 2E66A 4ED2A 3UPFA 3AA2A 3QESA 1GTEA 2JVRA 3GDXA 2IJNA 3AGKA 3SCXA 3H0PA 3RZAA 2J8AA 1VQSA 2QGFB 4LSNA 5CABA 4CJLA 1D8BA 2GMJA 1MWMA 1NB7A 1ESVA 1Y5LB 4DV1J 1JXEA 3UMGA 1ZD5A 2KYZA 2CJYB 3DU6A 1EETB 3WKEA 4DUZK 5AICA 1FIQA 4YDUC 4FLTA 4KN4A 1YKWA 4AL5A 3ONQA 2J6SA 2ZHBA 3BN7A 1NAQA 3D6FB 2JXJA 2LCWA 3ENWA 3WNHA 4EIAA 1V9PA 2EG1A 4R5PB 1YLXA 3F9KA 3O9SA 3FQKA 3V4IA 2HSZA 4OYBA 1JJCB 2GO8A 5KT7A 3AD7C 2PN6A 4HH0A 1H72C 2CNLB 2HBJA 4AYBD 1Q8KA 3THXB 4BHQA 2PZSA 2FQQB 5ETKA 2HF4A 3UCZP 5DZ7A 1N88A 3RJMB 2O3DA 1S99A 2PDAA 3VHQA 5HP4A 3LDNA 5E3RA 7ICOA 3HFKA 5HN0A 1RT4A 3ZSYA 2XO6A 2VYPA 2LQ5A 4F91B 4HCBA 2BJEA 2C2KB 4CHZA 4JYAK 3NNHA 3A3NB 4X64J 3H90A 3C5GA 3TP2A 3ZSOA 1ZD4A 2AXTU 3CCSN 1RAOA 4QNLA 5GMEA 4I2EA 1NZPA 2P66A 2M52A 1U4BA 4IG3B 4FK4A 3HVTB 1KWMA 1TKZB 2QZ8A 1X9WA 1FJGK 2F7VA 3MXIA 4FBTA 4WXWA 4IO8A 1CZBA 1VQ7N 2V68A 3R5AA 4C97A 4HKQA 1VHFA 4V19J 1RDBA 3E0FA 3ISCA 2AWZA 3UNYA 1VJQA 2DGOA 4CZEA 3VALA 2HS4A 4WQ5C 4J9UE 3C65A 3LO3A 3TJ9A 3M8QB 2AGPA 2JDJA 3QIDA 3CVKA 4CEEA 5E41A 5J0OA 2HHHF 2KEYA 2W3SA 4CZHA 3R6GB 4Q2MA 2UXDJ 5BREA 4WBFA 2HNZB 4DL0C 1ZH5A 4CFCA 4F02A 3MC1A 1SWWA 1SB6A 4A8WA 2H5IB 2KHDA 3ULHA 4NM2A 2O8FA 4GC6A 2A19A 3AOBA 5IQQA 5CYQA 2XS2A 4FN5A 3L3FX 4BDPA 3IP4B 3LGHA 7ICVA 2ABYA 4GVMA 1HQUA 3BPDA 1J5EK 2IHMA 1P7DA 4NLGA 4BE1A 4YD1A 1JCGA 1VQ7S 7ICUA 4ANCA 4JI8J 2FJEB 1SJFA 1EX4A 5KRSA 1ZTWA 5F9NA 4AXJA 2FBTA 4A59A 1G7CB 4Q44A 1HA1A 3QZ7A 4JKBA 2MKHA 2PMZD 1S48A 3H8WA 3DCAA 1HL6A 3N01A 3L4QA 5BR8J 4ETZA 2G9OA 4X62F 4K50A 2CQHA 4KMUA 2AEJA 4ZHRB 3SUQA 4UOHA 2JEGA 2CUYA 4FW2A 3VEYA 5JVGQ 2QB0B 4PJ0U 1CULB 1MMLA 2EAMA 5HMWA 2R8GA 3KK2B 1LKYA 2YHWA 5HOOA 3E58A 1W25A 2WF8A 2Q43A 2IDLA 3NH2A 2AKWB 2HVDA 4USMA 1ZZNA 1S1UB 4NLCA 4RUHA 4LZDA 4IG0A 2FVSA 3DLKA 1NGAA 3A8IA 1S0VA 4I68A 5LY3A 2MKYA 2P9KB 2LVWA 2JHEA 4S0MA 3HYFA 3MR3A 4LH4A 4I2QA 2N7YA 1VSHA 3W2VA 2DBYA 1UT8A 5MLCV 4MK9A 3PNCA 3CDAA 3FUYA 4DPUA 5AI8A 1PVPA 1BA0A 4LFBK 4E0DA 3N6LA 2F8HA 5J2JA 2V4RA 1FRHA 4MO5A 3JYTA 4FYVB 2JFDA 4LR7A 4JI0F 2AMCB 4IFEA 4WFBQ 1K5OA 4CP5A 3TVYA 4BE0A 4OPHA 3H5YA 3WBZA 3KK3B 1Q82O 3TNVA 3LM9A 1RJJA 4DOBA 8ICVA 3FCWA 1L3UA 5KFWA 3U26A 1WHVA 4BRFA 3ZDDA 3RJEA 2CRXA 1RCXB 5IIOA 4BRAA 4AHCA 1T94A 1WSVA 5KG7A 3FYHA 2WB4A 1PAUB 3QX7A 2EZYA 5T41A 3BV8A 4PG6A 2HAIA 1DURA 1ZPVA 2RILA 1Z00A 3TSQA 2AYEA 3NS1A 3S6JA 5ALDA 3C16B 1K1SA 8ICLA 2X3DA 4O3SA 2GWJA 2YWGA 3OXFA 2IRYA 2GHWA 2XLKA 2KZZA 4ELUA 4B6JA 3OVNA 3IWXA 4H0TB 5DB9A 4CBXA 4AP9A 3WUHA 2UUTA 2BBEA 3NS6A 3OYHA 2GTDA 1RBUA 2M5YA 1ULRA 5LMNK 3TX0A 4J9VA 3VESA 1SIWB 3MM7B 4B8AB 3SNNA 1GO3F 1DTTB 3KLIB 5CA7A 3KJFB 3DRPB 3SV3A 5D4LA 3LDPA 3O1BA 4DTMA 4O5EA 1NGBA 1U04A 4ZOSA 1K8AT 3VQEA 1JLQA 3GIKA 2J9EA 5ETVA 1ZBFA 1JUDA 1PYOB 1NLVA 2D3O1 4R8UA 5L1LA 2GVDA 5HMLA 3D54A 4DL4A 1BC6A 1B0TA 4MIBA 1L8OA 5D46A 4DU3A 3RAMA 4DU7A 2FVCA 3HX9A 3O1WA 3L0QA 1SH0A 1QSLA 3FZKA 1WUDA 1IUJA 3FEYB 1TUGB 1IBKK 3J7ZT 4QR2A 4CJTA 1Q78A 2DR7A 4H5WA 3OPKA 3S7RA 4DL3A 3VGTA 5EOYA 1BIUA 4LVOP 1NH8A 1ZQSA 1XS9D 1SGGA 4OX6A 3GE9A 3PXGa 3BEXA 3OD2A 8ICZA 4QW8A 3UD5A 2EX3A 5F8GA 4F5QA 3R1XA 1R6VA 2C3MA 2DL0A 4ISFA 2B4JA 7ICTA 2W6KA 1SCJB 3MCSA 2YNFA 4NYFA 1Y4ZB 1S1TA 5KT5A 3D2EA 3V5RA 4XA5A 4WTOB 4FF2A 4TY9A 5KFYA 8ICUA 2WSFC 3LVVA 3QGHA 2A6OA 4RNFA 2CRLA 1NNEA 3MF5A 2J0WA 2CQPA 2BVZA 2UUAF 3LUYA 3SQGB 4PHPA 5F8JA 3ZSVA 3OS0A 5DG8A 1XO0A 1GTHA 3R5CA 3HSTB 4C2MA 2R8KA 3L5KA 1X4BA 1Q3VA 2HHHJ 1PVRA 4KIAA 1VFJA 5AK6A 2DRDA 4B1XB 3RR7A 2DK2A 3O3HA 4J9NA 2IVYA 2DCUB 1N62A 4QIVA 3NF6A 4I9QA 5J2NB 1EETA 4ECXA 4R25A 4EZ9A 5H9EJ 2CZVC 4R0EA 5HVGA 1ZQEA 4MYUA 2G1DA 3ZT2A 4PKIA 2NXJA 1IR2A 5J2HA 4IH7A 1B92A 4N5SA 2F77X 8ICPA 4BWJA 2ASLA 5CZ1A 3SJHA 1PJ5A 5AKXA 4USVA 2OD4A 3THXA 2XMTA 3KLHA 2CQBA 4J5OA 1O0PA 1RAHB 2QTDA 3TFRA 5JLFA 3F73A 2GFFA 5C7PA 2P5VA 3NFAA 1U47A 1VQPN 1QAYA 3VEZA 1MWKA 5B0FA 1RAFB 2EBEA 1S4FA 1IV0A 3CCMN 2YMMA 4ED0A 2B56A 2HI0A 2UYTA 4WP8A 3LP1B 1EXQA 1H2UX 2UXBK 3DOLB 3BDEA 1ZOTA 1N34J 1T9UA 4CECA 1IM6A 1TP7A 3UDLA 4NY8A 3N5FA 4JB3A 4IG3A 4DSFA 3HVTA 4B3MK 2EKYA 3J81Y 1UEKA 2VC1A 4OO1J 3VAFA 2POKA 4ZN3A 1HQEA 4PXDA 2P6UA 3MK6A 4PGYA 4BROA 1W2BM 1Z4OA 2LXUA 1PK3A 3DYAB 2APOA 2LP4A 3MM8A 3G8SA 3W62A 3VQ6A 1T0TV 2GX9A 5KG5A 2CVIA 3ENBA 3M8QA 4OYWA 3UXOA 1LXJA 4DV2F 1Q9XA 3OVSA 5CXTA 1NSKL 1MMDA 2FF6A 2Q4TA 3ISZA 2OTJN 2OP5A 4IOAL 2V50A 2HNZA 4JI4K 5IT4A 1K9MO 3O4QA 4P0PB 1IBCB 1GXTA 2VQFF 3ZX3A 3MR7A 1RKJA 2MSNA 2GIQA 2DY1A 2VFTA 2F76X 4FXVA 3MGIA 4BXOB 2W7AA 1DQ8A 2HMXA 3AVFA 4HUFA 3CFOA 4NE9C 3WK6A 4H0PA 4W5NA 1KDNA 1NB2A 4DB3A 5J0SA 4C7YA 3SUOA 3AVIA 1N33J 5B0AA 2XI2A 1KVIA 1LW0A 1SS6A 1TFYA 3V9WA 1N0VC 1FD8A 5JVGL 5GAGI 1C1BB 5CD4A 2E7XA 4UW2A 2DNRA 2R8IA 2QWNA 2HNYB 4NLTA 4C3LA 3RSEA 3G8QA 1LWCA 3NNAA 4QR0A 4Y2JA 3DOKA 4UB1A 4ZHRA 2LXFA 2PA3A 1REVB 2QB0A 2JGAA 1CULA 1BA1A 2A18A 1WOPA 2RU9A 3KK2A 3AQEA 1RTIB 2EW9A 3M4XA 5AM3A 3JTOA 1V9OA 1YIJS 2LEBA 1IKXB 2X6NA 3GYXB 4WQ4C 1J54A 5ELZA 2KZ3A 3KTQA 1S1UA 2P5GA 2Y9TA 1FO4A 5CCLA 3FEZA 2L5YA 3GQCA 2AJ0A 2D0PA 5DLGA 3SQIA 3LA0A 3DLRA 1G15A 2PEBA 1N32J 2P9KA 3BSAA 2FGCA 5DLFA 3L6QA 4YFKA 3ULEB 5HVFA 4LQ3A 4UB2A 5GAGU 1BQXA 3VTHA 2CPXA 3VGUA 1QTNB 2CQ0A 4J2AA 1U6FA 4WFBL 3MHYA 4HYKA 1NGGA 2EZZA 1JIHA 2KW4A 2DRBA 1PUZA 1I6JA 3QIOA 3QEPA 3QU4A 4BR4A 1YJVA 4ZMMA 3AVMA 4PG8A 2KM8C 1UJ6A 4F5PA 2OHDA 4F93B 3RJGA 4DWIA 1RYRA 4CO3A 4CHQA 2F4FA 3CCQN 3AY0A 3IMQJ 5HR6A 2G0IA 2I9GA 3SAHA 2BOAA 4OX7A 3JTPA 5EOZA 4J90A 1NOZA 2G13A 4NV0A 2XNQA 4DL6A 3QO9A 3VR1A 2R7UA 3X1LB 3IS9B 3PX0A 3PYDA 5G5GA 4G1IA 3SENA 2IAJB 1DT9A 4RTFD 4P4MA 3R3TA 3Q8MA 4NCAA 1COOA 1NK0A 3N4PA 1I94F 4FJGA 1N5WA 3PUFA 4WIIA 1BL3A 4XUSA 4CF5A 2XWXA 4XAKA 2N4CA 3R6MA 4MDBA 2IVMA 2UUAJ 3VQ8A 1TK8A 1G4CA 1RHQB 4IS7A 2ZHOA 2AV5A 1NK5A 3V6KA 3GV5B 3SAGA 4CZCA 3MAQA 2OANA 3KLIA 4A8OA 2KB2A 1TAMA 2YHYA 1HARA 2B5JB 4ICAA 2E9RX 2W03A 4CERA 1U2CA 3CCQS 4J7CA 3R1HA 3C3LA 4RNNA 3JAMO 1VQON 3AN1A 5I4MA 1VQMN 3M30A 4O3NA 3AT1B 4Q0BB 4ZCLA 2XMAA 4RU2A 4XH1A 1SH3A 3N9UC 3OS2A 2WVCA 2E1RA 5BRDA 3C28A 1BIZA 5HQLA 4ZS6A 2K60A 2HBQB 3TEHB 1YJ9S 1M6YA 4RLEA 1SVDA 3TTCA 2ETJA 2IJRA 2YHBA 4KREA 4QWCA 1ASWA 2HLTA 1IJFB 1SPBP 1DXSA 2WVEA 3A13A 4X4OA 2W42A 2WZ1A 5AE2A 3NLCA 4RWXA 3OHAA 5D4NA 3S41A 2RHFA 5K8PA 1JXVA 1YF5L 4X65K 1BNOA 1OJ4A 2M88A 1F0XA 3ZXWA 2HGMA 1FXDA 2N82B 2GQCA 4IR9A 4QR1A 1UOCA 3CERA 5ALMA 4JWNA 3R5DA 2J0XA 1VQOS 2A3JA 2KU7A 1WC1A 2YKAA 3NF7A 3VCBA 4JS5A 3SBGA 1LK7A 3L3UA 3J7YP 4OZ2A 4BR0A 3G82B 3Q8LA 1BE4A 3I56N 3MGJA 4HCCA 1HUZA 3TZXA 3AV9A 4B3TJ 1RPLA 2ISOA 1FRKA 4JS4A 4DTSA 3SQGA 2ZWHA 3TQ1A 2E2QA 1YQHA 2MZJA 4JKFA 2QL9B 2CNKB 3OL7A 2PMZC 3IUCA 4GVBB 1ZAWA 3LGMA 1TK0A 1Y7PA 2QI2A 4QWDA 3G10A 2DR6A 2VFSA 2VQFJ 4LRBA 4IOCQ 3FVYA 2XZDB 4AHSA 5M1FA 5LMUK 1DJ0A 1S7HA 3D4JA 3JQKA 3Q8UA 2F1IA 2KSOB 3RG6A 4B3OB 3P4UB 3R9PA 4EBEA 1MDUB 2KV2A 5JJBA 3C1ZA 2CQDA 4H4OA 2IRUA 2RVJA 2D74B 4C48A 3F2DA 2XICA 1BU6O 3OYDA 1P8GA 1BI4B 1VRQC 4ECYA 2BZ2A 8ICKA 1BCOA 4KLLA 2EEYA 3BM7A 5AE3A 2Y1JA 1PC4A 2FLLA 1U45A 4DR5J 1KS2A 3DLLQ 2VG7B 4AXIA 2ZUDA 1ZXOA 3MWTA 4WE1B 4KQZA 2MHEA 2KXNB 1Y3KA 4K5SA 3LP1A 3QEVA 2AJ1A 2L9NA 1RWUA 3E01B 3DOLA 4L75A 4QZIA 3ZTOA 4AUKA 4IYQA 2KHQA 2KNJA 4FNIA 4PGXA 3LALA 3K5LA 2WTFA 5I9EB 4QZFA 4FZVA 1JQGA 1BGXT 4PY5A 2A1BA 4DSIA 2RRDA 4YQWA 1NNDA 2IM2A 4M63A 5CAAA 1OQ6A 4QIWD 4BVOA 3PW5A 3FKBA 1XMOK 3DYAA 1F9HA 4N47A 2YWFA 4DUYK 4FVCA 1IKWB 4RPFA 3D6RA 1JB0C 3BS9A 1HRHA 1NGHA 1UPMB 2E3TA 3M32B 3GU0A 3DN9A 4ILJA 1ZBUA 1VDHA 1XNRF 3EICA 3LAMA 5KFOA 4NI2B 5AXNA 4DSEA 3G4SN 1FFUA 3C14B 2G8VA 4P0PA 2Y9HA 2ZD1B 3GZ7A 4KLJA 1S6OA 1TUYA 3OUYB 3F5EA 3D66A 4NXNF 3GONA 2IYGA 4KHUA 2B3TB 2OYQA 2OEMA 1HNWF 2HBKA 4BXOA 5AIAA 4E1MA 3P5TL 3ZCMA 2DWQA 3CMAS 5EWFA 4C8LA 2NYHA 4E98A 4K4XA 1NHUA 4PPZA 3IBWA 1WKJA 3BEGB 4U7UD 4A5BA 2LMIA 4CBUA 2YHAA 3OTOK 2H54B 3CO0P 4LF6K 3JSBA 3R7SB 2XY5A 1K8KB 3AFGA 5HBMB 4F2SA 1EAYC 3UKRA 5A6PA 3RH4A 2ACMA 2V94A 4LF7K 1ZQLA 1VIOA 3KJVB 1Q4RA 1HJRA 4Y2KA 2LA4A 2UUBJ 3OHBA 2HNYA 4CI0B 2KJ8A 3KNAA 5AXLA 4ENOA 2IGIA 3PFEA 4BQZA 2D8CA 2F63A 1OS5A 3HHLB 1YHQN 2LQ8A 2FLPA 1NKCA 4RX6A 1A5XA 1I94J 3A4TA 3O4WA 1RTIA 2Y8YA 2BW2A 3ONNA 2YHXA 2KE7A 3F2BA 4RW4B 1IKXA 1JNZB 2ZGYA 1OXJA 1M5OC 4P73A 5E3QA 4Y0FA 3MGVA 4FM1A 2NRWA 4KHMA 3EUB2 3ILOA 2CYYA 4M5IA 4DMNA 2VF3A 3GP9A 3MURP 1XHZA 2QA4S 4PEOA 3QU5A 1S1VB 4JI6J 4C1NI 2VB6A 4H0XB 2IY5B 5EE3A 4OHWA 1HUXA 3DJCA 3HFVA 1RLCL 2DFLA 2IA0A 5AQQA 1KR4A 1T7PA 3W5YA 1D4XA 5AM5A 3KKFA 3NOCA 1YITN 1S22A 4N76A 2WSEC 3O1LA 1XHXA 8ICXA 4ID8A 1YHQS 4XEIA 3THYB 2KVQE 4FKXA 3UD4P 1PILA 4P71A 4ECQA 2HFVA 4PHTX 4PCQA 2E5LK 4C11B 4FWQA 3MI7X 2F96A 9ICPA 4LFCF 4B3SF 4LT6A 2XYPB 1TMMA 3BH6B 4UY8O 4ZP9A 4J2DA 1XR6A 3NVKA 1E3MA 2YX4A 1G6BA 4YFUA 2HK3A 3CJ5A 3MXJA 1N5TA 4DQSA 2A1JA 2KYXA 4I2DA 1Q8BA 1WHXA 2G8FA 3I28A 2NLWA 4KAZA 3IS9A 3VERA 9ICGA 3AAWB 1YK9A 2O4GA 4HAIA 2W9MA 2JJ4D 1EZZB 1HWKA 2IAJA 4DMZA 3G9CA 3QYYA 2DGZA 2CNNB 1ZQPA 1GLDG 4O44B 3KK1B 3VEWA 3AU6A 2ZXIA 5KFKA 1HNZF 4CJRA 2YNIB 3TAFA 5FROA 1E6YB 4U67L 1WKKA 1GMWD 4DU8A 4DCPB 1RADB 2H5XA 3OFHA 1U1KA 4E2FB 2CJKA 1RAGB 5AK4A 1XNSA 4ZVHA 3JPPA 2ZBCA 2KIWA 1HPZA 2DO4A 3D68A 5AKIA 4MF8A 3ITHB 4YN3B 3DRRB 3P6YC 3R5BA 1MWYA 1MU2B 4USUA 2BR0A 3MMVA 3CG7A 3H5UA 5CJ7A 1YZ7A 5E3AA 2HNDB 3OS1A 4CK2A 3DFEA 4Q0BA 4K42A 2M3DA 5HJXA 4CF1A 5T7LB 4K4GA 3UO0A 2YKPA 4IQVA 3DXMB 2ASMA 4UB6U 5DGAA 1U1PA 1Q16B 2EI5A 4DTNA 1VI7A 3T6BA 2DHAA 3FZBA 2F1FA 4PR6A 2YJFA 2EK1A 2HQIA 1L3TA 4DSLA 2MKCA 3O08A 1E6VB 4OHZA 3GDQA 5IT9O 2W2MP 4LBIA 4OYMA 2LQJA 2OXOA 4JWMA 5F8MA 2FC0A 2KO1A 3L3CA 2ZUAA 1NXIA 4ANEA 3VF4A 2MQPA 3QEAZ 2DNPA 2QKKA 3CNHA 4UW9A 4FZYA 1F3VA 3MPWA 3DWLA 1Q95G 1RXWA 4YR0A 4FLVA 1YI2S 3WXMB 2RUSA 1SZHA 2XRIA 3DLGB 4DTXA 1Q81O 2DUYA 1H98A 4KLUA 3C94A 3V72A 1HBUB 3G82A 1FKAF 4B9QA 2ZFHA 5KQ8A 2JOQA 1O13A 4JD2B 1N36F 1RTZA 3NL0A 4DX6A 4KGKA 3H4DA 2JLGA 3J80Y 4WXOA 3CTRA 4KLOA 3NGRA 2C2DA 4ZP7A 1UA0A 4JKEA 3H42A 3TW0A 3IBFB 1RBTA 2HOIA 3HZ6A 3GSDA 2YN4A 4J91A 2L41A 4WP3A 1Q3UA 1WWUA 4KN7A 1XNRJ 4GVBA 3B0YA 3OYIA 3D0PA 2B4UA 3ALRA 4I6YA 5JVHQ 1T8EA 3HVWA 1U24A 4OZ3A 2CPDA 3SXLA 4NXNJ 2O67A 4UUWA 3OYGA 5KPRA 1V4TA 5ETOA 3MN9A 4BRLA 5DB8A 1F3FA 1ELOA 1S6PA 4WF9L 2W2NP 1NK8A 2QXFA 3QNWB 5ALFA 5F3XB 4M5JA 4FZZA 1HWLA 4NYOA 1F1BB 2ZBIA 1A5VA 4EX7A 1BI4A 1X40A 3KLFB 2MKIA 1R7IA 2ZBPA 3O3FA 2GUPA 3LDAA 2JSXA 1T3NA 3TR5A 2QWPA 4ID1A 1W9HA 2QLXA 1ZC6A 4QZHA 3O44A 3UWTA 1E4GT 2VG7A 3M8WA 3SCJE 3KXDA 2HVEA 1DK2A 2MDAA 2L3MA 5CR4A 2V51B 3C95A 3E01A 5GAHP 2P9UB 2I6XA 4JI3K 2HFNA 3CB4A 2YB4A 2ZG6A 3CCLN 3ICXA 4UATA 3TR8A 4LF1A 2QARB 3HMJG 2V9KA 2HMIB 3A3PB 4PKGA 3UN3A 5RUBA 2AH5A 4CNQA 4DCJB 1FNMA 4A47A 3MPDA 5KFTA 3D1QA 3P49B 1WBDA 3CJ9A 2C2NA 3TTFA 5BPCA 3O5BA 2DXFA 1RISA 2YWWA 3HSZA 2JLEA 5L9NA 4LF4F 2ZF5O 2DGVA 3EN9A 2O8BB 2V7ZA 3G96A 3QRPA 9ATCB 3M32A 2D9PA 3S01A 5J2PB 3L4BC 2K3KA 3C8YA 4I2HA 4OJPA 2CPYA 3G2XA 3V6JA 3C14A 3QSIA 2ZD1A 1C4AA 4JHDB 2WVDA 3QJJA 1SI9A 1OVQA 2IMWP 2A0FB 1Z1BA 1Q82T 2CVEA 2BRKA 3WQPA 5ALJA 4J2BA 3KWMA 3R97A 2Y3YA 1VK3A 2YY6A 2YQ0A 2EFOA 2HFOA 2V63A 4KBOA 2AIRB 3M6VA 2XS7A 4LFCJ 4M9HA 4B3SJ 2XMWA 3GB0A 4EO6A 4K4VA 4DV6K 1K8KA 5HBMA 3QYPA 5ALTA 1KOHA 1Q1KA 3A8JA 1Z4NA 4OI6A 3SI8A 2FJAB 2KHVA 3KJVA 4V1Ak 4DR4K 2RH3A 5CCMA 5KG4A 5KAKA 1RT2B 1R89A 4AQYF 4LD0A 4NXZA 2A6AA 4F67A 4DR2K 1J2MA 4KHRA 3HHLA 4KSEB 5FJ4A 1NGDA 4PWWA 1NPKA 3KOAA 1HNZJ 2ZJ8A 3QFHA 3P4IA 3QXGA 3LDQA 4NL9A 4ECUA 1TKTB 4RW4A 1CPZA 1L3KA 2P9NB 2DIVA 1BISA 4TSXA 2ZJQL 3UXPA 1HEKA 4K8XA 3HJVA 4KPCA 2W01A 1YSJA 3Q23A 3R5GA 4JEPA 3TOQA 5D49A 1MA9B 3BSNA 3M1VB 5J2BA 1S1VA 3N97B 2OFGX 1QTMA 2XMVA 1HNXK 5IV4A 1HBNB 4ERDA 1URJA 2AA4A 3BO2A 4JI2J 6FDRA 3WDOA 4EK2A 3EMTA 2J7UA 4A8YA 5E5NA 2F40A 3H2LA 3THYA 1TELA 5ALQA 3AO4A 2KT2A 3PJWA 4CJ5A 1ZPWX 2UV8A 4C11A 2V69A 2VPWB 4M47A 2YTCA 4B3RF 3N6NA 1ZQUA 1ZD2P 3N7PD 3V7JA 4DTRA 2VC0A 8ICJA 3EE8A 4Y2YA 2QKBA 1NU0A 2XCPA 4X66F 5GVQA 1RTDB 1H2TZ 3LZIA 3OL6A 4DN9A 3MAHA 3CJBA 5CY4A 5AI4A 1GLCG 4A8KA 5J2AA 2FY1A 3SUNA 3CCRS 1GLAG 4JKAA 4BWMA 4ECRA 1WTBA 4QZCA 3BGLA 2FJWA 3AD8C 4DS4A 7FDRA 4Q5VA 3C66A 1TMJA 5AQRA 4ICLB 2E1EA 4X4NA 7ICNA 4KI4A 4TUQA 3L8BA 5AKEA 4NO7A 2ZH5A 4KGZB 1UFWA 2HGNA 1EB0A 3MPYA 3CC2N 4O44A 1W97L 4OX9K 4OQJA 1ZOLA 2YNIA 4FJHA 1E6YA 2DD8S 3VQ9A 3S3MA 3OW2M 4WU3A 3O6QA 4K2XA 3D45A 4DV1K 9ICKA 3K9JA 5F9LA 5M2UA 4FS2A 1T9YA 2K89A 1TYQB 4CD1A 4HL9A 3MECB 2Q0ZX 2CQ2A 3I0RB 2LEPA 4C0OC 3DRRA 4NEYA 3C5FA 1WNEA 1RBRA 3P83D 1T02A 2GJIA 1RCOB 2HZCA 1RYSA 2CFXA 2HNDA 2NR0A 3MZIA 1P1TA 2LM4A 3PHEA 1COKA 4Y65A 1U09A 1UVMA 3OBIA 2DHXA 2ZJAA 2MZSA 4LF9F 2JEFA 5BPMA 3TUPA 4NA2A 4ED5A 3AA5X 4O9MA 5GIOA 5T7LA 2DR5A 3FBEA 1SC4B 2B7CB 3NGZA 1F5AA 2PEHA 3BBBA 2VOOA 4YOXA 2J6UA 4JKCA 3EGVA 1Y88A 5AKKA 4RL1A 1RQNA 4QIWC 1P8ZA 1D0EA 4OI3A 4AL7A 4CFDA 1E6VA 3G86A 4DV4F 4I6WA 3S9HA 2M70A 3CEDA 2YPZA 5KPTA 3UDEA 4HHJA 1J6ZA 1T9VA 2UUCK 4Z6EA 1P9QC 5KRTA 3K0JA 2NPFA 2HS0A 2YKMB 1UT5A 3B8HA 3SCLE 3R1LA 3IRXB 2W40A 2B0GA 3T19A 5LXYA 3F53A 1IBLK 3IDWA 1RP5A 3DLGA 1XEZA 2OEJA 4FZLA 3WKAA 5BRFA 1HBUA 1BY9A 1TVAA 2CPFA 5CA5A 3CCZA 1S5LU 2N3OA 1UJ4A 3HKZC 2Q3PA 4JD2A 4CVNE 1KEJA 3OYBA