1IG6A

Human mrf-2 domain, nmr, 11 structures
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
RADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPIKPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords MODULATOR RECOGNITION FACTOR 2
publication title HUMAN MRF-2 DOMAIN, NMR, 11 STRUCTURES
rcsb
source organism Homo sapiens
total genus 33
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1ig6A00
2YQEA 2EQYA 2KK0A 1KQQA 1RYUA 4LJXA 2OEHA 1IG6A 2CXYA 2JXJA 5CEHA 5K4LA 2LI6A 1C20A 2JRZA 2LM1A 2RQ5A 1KKXA 2EH9A 1KN5A
chains in the Genus database with same CATH superfamily
2RP5A 1BPEA 4NWIA 2NRWA 2PFPA 1ZRNA 1KRPA 2DF4B 5D4BA 1X9XA 2K4IA 2IMWP 2RRDA 4C8LA 3LWMA 3JPSA 3OHBA 4R63A 4DLEA 2W43A 4XA5A 1K1SA 2XI9A 1IXRA 1N62A 1URJA 2OHFA 2PKEA 1N61A 3MFHA 8ICQA 7ICVA 5L1KA 5AI8A 2AHOB 2H5XA 2G09A 2GH1A 4KMOB 5KFWA 4R8UA 5KG6A 3TARA 2XCPA 2KFNA 2ISPA 2CN1A 3UPQA 3QU4A 3RJHA 1C7YA 1NZBA 2XY6A 4CCHA 3BDPA 2LYAA 3EWAA 3D2QA 2JV3A 4O3QA 1PUZA 4K4IA 2DBYA 2J6SA 4J03A 2MA1A 3SV4A 1BPDA 2W03A 4EYHB 2KKPA 4BDPA 3GZFA 4PPXA 1X42A 1FFVA 2KOBA 2KZMA 4PHAA 8ICGA 4KLDA 4FO6A 4P0PB 3UXPA 8ICSA 1ZQDA 3TADC 2OH2A 4Q8EA 4UAYA 5F3XB 2Q4TA 4QZGA 5TZVA 1NKEA 3QZ8A 3SYZA 1NK5A 3J81j 1TK0A 2RLTA 3H0LB 5BOLA 1SL2A 5L1JA 3M9MB 1ZQVA 8ICMA 3QU2A 2FI1A 4KLOA 3RB4A 4YXMA 1ZQHA 3MGIA 5AKGA 2ZIWB 4RPZA 2ISOA 2XIDA 4DL3A 4B9UA 2MRLA 5KFIA 5DBAA 1XS9D 2UVRA 5ALSA 4RUCA 2D8CA 3C29A 4J9NA 4PL1A 3WK4A 4Y2SA 3RBEA 1LKYA 3T5KA 4C4TA 4RQ6A 1L8OA 1ZQYA 1KN5A 2WHEA 3K4GA 4Q45A 2KP7A 3C2LA 9ICUA 4IL6U 4B9VA 2CXYA 2DGZA 2EZYA 1ZQKA 2ESEA 1WWVA 1ZQIA 8ICTA 4AYBF 4Y2VA 5J2GA 4QZ8A 3AEVA 2JRZA 2KNJA 4QZIA 4JV2A 5J2DA 7ICHA 3TANA 4ED0A 2C22A 1RDFA 4J9RA 4CNQA 5CR0A 4MFFA 2KTQA 2AQ4A 1SKRA 1FFUA 4ECVA 4ED2A 9ICNA 2VKQA 1KSPA 4QNLA 4YR3A 1BPYA 3KHRA 4IC9A 2UVWA 3OSPA 2FPLA 5KFPA 4QZDA 3HJEA 4PJ0U 5KFQA 1NJYA 3PW7A 1KFSA 1MN8A 2QARA 4FS2A 2KD1A 2ZTDA 3TFSA 4P0QB 2GOLA 9ICGA 1KQQA 3IHQB 4QWEA 5DB6A 3L3FX 5D46A 8ICCA 1Z19A 1IG6A 1RG6A 2IHNA 3KOOA 3EPIA 5KG4A 4C80A 4O0IA 4DQSA 1NKCA 4IQUA 1RQLA 3NRZA 3HKZC 4QZHA 2HDOA 5EE3A 5A0LA 2OCEA 1QQ7A 5AIBA 2AGPA 4QJFB 8ICXA 3QU7A 3BS5A 4DS5A 4IS7A 4TURA 2E1FA 3TACB 5D49A 7ICEA 3LWLA 4CE6A 4RQ2A 5J0TA 5KL1B 4Z6EA 2HHXA 4M9LA 1LV5A 4M9HA 1Z4OA 3RJJA 1QLNA 3GV8B 4DFMA 1NK4A 1V9PA 1T3NA 1SXEA 4NLCA 2YY6A 1SWVA 2ZIUB 2XO7A 4I2FA 5L9XA 2D6FC 1N60A 3UM9A 2HVIA 4ECUA 3HILA 1NK0A 2JZBA 1TV9A 8ICJA 2F8LA 2HSZA 8ICIA 4I2CA 9ICFA 1XSNA 2FLNA 3T3FA 5KT4A 3JPNA 5J8YA 3KHGA 2RHFA 4RQ0A 3EYZA 5J0YA 2ZUDA 3WK7A 2JXJA 2K8AA 3PX4A 3KD3A 3PY8A 3NRWA 3PMNA 3C1YA 2F76X 2P6RA 2C2RA 5F9NA 5ALMA 3GV7B 2ASJA 1QTMA 2K4HA 4J9QA 9ICBA 1CI4A 3M8SA 3MDCA 1NKBA 2KZZA 3HPOA 2E8NA 1TAMA 4JWMA 2EQYA 5J2FA 3OHAA 5CJ7A 1XSPA 5AI9A 3Q8MA 4P4MA 2HBMA 4EZ9A 1IM4A 5AKEA 3BQ0A 4NM1A 2LM4A 2J6UA 5DKWA 2KE7A 3ZI4A 3AQFA 3N97B 5ALHA 3SZ2A 3OSNA 4YXJA 8ICVA 4RQ3A 1SV4A 1S9FA 1Q3VA 3I1YA 1L7MA 2HBLA 3PZPA 2R8GA 4YCXA 2AXTU 4Y2XA 5CA7A 1F44A 2FDRA 4XUSA 2HOIA 5AIAA 4DOAA 4B9LA 2I9GA 3BQ7A 2AH5A 3QXGA 2JEGA 4DQPA 3OPXA 2KK0A 3T5LA 4CF4A 2IA6A 4ECYA 9ICIA 2R8HA 4WJ3B 3K75D 2BCRA 3H0RB 1LB2B 2QKQA 4I2DA 2PFQA 2AGQA 3M9OB 1OW5A 4EBDA 2PXIA 2EDUA 3O0FA 3NVYA 9ICJA 1F0MA 3F5AA 2JMGA 1NNLA 1RYRA 3HWTA 4B9SA 3QUTA 4Q8FA 4QW9A 3QU9A 1SV0A 4EENA 3PVXA 2B21A 3PO5A 1WG8A 1ZD2P 3WKCA 1ZQZA 2C28A 2P35A 5C5JA 5ALGA 4KLGA 1JI7A 1UT8A 1COKA 1Z1BA 4F5OA 1H38A 5AK6A 2FMSA 1AROP 2NRZA 3IM1A 4BGDA 4C0ZA 5EE0A 1ZQEA 8ICUA 7ICRA 1YZ7A 1LVHA 5KFJA 2E3TA 2LMRA 4TUSA 4O5KA 3LVVA 3NVVA 4F50A 2Y1JA 1UT5A 4C7ZA 3RR7A 2XGPA 4ECSA 3KKAC 2NRXA 2HW3A 1NOMA 1PVQA 2HHVA 3FM9A 7ICJA 5ALKA 2W9BB 1QSLA 4C4SA 4DSLA 4QWCA 3UQ0A 3GILA 4MFAA 3PO4A 5AI0A 4Z6FA 1TK8A 3TADA 3MR3A 1MQ3A 4IRCA 2R18A 4LJXA 2KZ3A 1JRPA 4JUZA 4XRHA 4DF8A 4IR9A 1NJZA 1L5UA 5KT7A 2LI6A 3RH5A 1V38A 2LKYA 4KLHA 1A6SA 1C20A 4OJPA 3AM9A 1BGXT 5J29A 5J0RA 2V4RA 3TQ1A 1YT3A 7ICPA 3RFAA 3KHLA 3HT3A 1BNOA 4M9NA 4ZH4A 3PW4A 5DB7A 5KT6A 3D6JA 2EZXA 5ALDA 2BPCA 3V7KA 4Q44A 4RUAA 4DSFA 3PMLA 2EANA 5DLFA 4ECQA 1RXVA 2K89A 2RQ5A 2BKEA 1KFDA 3NUQA 4YG2A 2OWOA 4TUPA 3B9JA 2W8KA 4RQNA 4P0QA 4YR0A 2BDPA 2KKVA 2H3FA 5IIKA 2MUTB 3AU2A 4IR1A 3PSPA 5KT5A 3FC4A 4DSJA 4OJLA 5DG8A 1S8OA 4EBEA 3JPPA 2VA2A 4ED7A 2B6GA 3EUB2 2AJQA 3JPTA 1P7DA 4C8MA 2XICA 3A0BU 4RQ7A 4DSIA 3IG5A 4FZNA 3PR4A 4DLGA 2ZIXB 2PFNA 4EX7A 2BQUA 2A1JB 1M6YA 4ED3A 1F5SA 2W11A 3WKAA 2F44A 4ED1A 3WK5A 2ZIUA 4YR2A 1ZD3A 4PH5A 3NS1A 4NY8A 3GIJA 3WK6A 4U6PA 1U9LA 1TVAA 5DLGA 1J2NA 2LYHA 2H3IA 4IQWA 4FE3A 4M6WB 3H8MA 3C21A 4U7CA 1L3TA 2BCVA 1TE2A 1X6JA 3L4PA 5AKJA 5ALEA 1D9FA 3RRHA 1ZJNA 4KITB 4YD1A 5KFCA 2W9CB 1BPXA 5CB1A 4F91B 1J97A 5L1LA 3C2MA 2HHTA 3NTUA 3MFIA 4KLQA 5KT2A 4RNOA 2I1QA 4UARA 4ECRA 2XY5A 5AK5A 8ICBA 4DL2A 5DG9A 2HOFA 4KLTA 5J0UA 2M9NA 1JMSA 4FZLA 1Q8KA 3G6VA 2KSOB 3PW5A 2HCFA 3CP8A 3JPRA 4RQ1A 3S6JA 3R9KA 3JPOA 1XO0A 2KVCA 5J2HA 2ASDA 4PGQA 5KFYA 1KW4A 2YMMA 4DFJA 4PHEA 1T8EA 2HBJA 4PZOA 2ZXHA 5J2CA 4PGXA 3NGDA 2DUYA 2WAQC 4I2GA 3EW9A 3M6KA 1DXSA 3N7PD 9ICPA 4MEYA 4TQRA 2HVHA 5CEHA 3QYPA 1CRXA 5GTIU 3SAGA 4DQQA 2HHQA 3ALRA 3IV6A 2WTFA 2XVTA 5DQIA 2G07A 2BPFA 2FPKA 2ZIVB 4YMNA 1T3QA 4M9GA 5DBCA 2BR0A 1WUDA 2XGQA 1KL9A 1Z4NA 3TKAA 3IN5A 9ICSA 5KFSA 1X9SA 1RQNA 1JALA 4QZCA 5H2FU 1VJ5A 5AKKA 2LPEA 3U26A 3C1ZA 5DQHA 4MF8A 2K4PA 4B9TA 1XSLA 4DFKA 4KTQA 2HMXA 4I2JA 4QZ9A 2E5SA 4CF3A 1N5XA 4F92B 1ZQPA 2OM6A 5C0YA 4YVZA 3QZ7A 4I27A 1B4FA 4JK1A 3GQCA 2RDJA 3V72A 3TFRA 4Y2JA 3ETRA 2BCUA 2ATLA 1XNSA 2QB0B 5J0SA 2GO7A 2ALZA 1D9DA 2JEIA 3QUCA 5KFAA 4MEXA 1U4BA 5B66U 1V97A 4KN4A 4ED6A 1L7NA 1SL0A 1NZPA 3E0FA 4F4YA 2R8JA 5KG5A 1HIWA 2F1HA 3HKZF 3SV3A 4QZBA 4DEZA 3D2NA 2DQNB 3AMZA 1HUOA 3ZDBA 2W9BA 1O08A 3NASA 3C2KA 2R8KA 8ICOA 4K4GA 1U49A 1WYGA 3H4DA 5AKHA 3V7JA 3T79A 9ICRA 3PW0A 2KIWA 5ALNA 1IV8A 3QNMA 2YB4A 4UATA 1T94A 3ORYA 1UA1A 3RJEA 4QW8A 1RYSA 2DKXA 2JEFA 1X40A 4UAVA 5HR6A 5J2KA 5K4LA 3DV9A 2FMPA 1L3UA 4C8KA 3UMBA 4C8NA 5J0QA 3MC1A 2EAMA 3D2SA 4BXOB 5CP2A 1XC9A 3N7RC 2XC9A 7ICLA 4Q43A 5TISU 1PK1B 4KLLA 3FDSA 1A76A 4OCZA 4PHPA 2MUTA 4P2HA 3H8WA 2ZTCA 2HHSA 1NJXA 4HAIA 1BVSA 3AU6A 3F2DA 3ZD8A 1KKXA 3K1ZA 5J2JA 4EBCA 3H7IA 3OGUA 2YX8A 3RJKA 3UQ2A 1YZ6A 1B0XA 4EEKA 1ZQSA 5BOMA 1PK3A 2P6UA 4MHVA 5AM1A 3WK9A 3TI0A 2ZIXA 5AKZA 2A1JA 4LVSA 2BQ3A 1SKSA 2DKZA 5KG7A 4F4XA 2ZUCA 4NLNA 1XO1A 1QQ6A 5G5GA 4QZAA 1UQVA 2HI0A 4JV1A 1Z3EB 2EH9A 5T14A 9ICXA 3SAFA 2ODGA 2AU0A 4I28A 1DOQA 1Z00B 4M6WA 2KJ9A 4KLEA 8ICNA 1ZYQA 1MQ2A 5F9LA 1L7PA 2D3DA 4Z6CA 3K1RB 3T5HA 3A0HU 2YN4A 3UXNA 2W9CA 4I2EA 1UHUA 3M8RA 3QEBZ 2G5IB 2F1IA 1S5LU 2IOFK 2BPGA 3RTVA 3RH6A 5KT3A 5HMMA 2W7PA 4YD2A 2JGAA 1JIHA 3V6HA 4OJ6A 1D8YA 5ALFA 2KG5A 3JPQA 3N7SC 4KLIA 2KSOA 3RBDA 1S0VA 1N5WA 4J9MA 2VJ4A 3GV5B 4A8EA 1NK7A 4F5RA 3PX0A 1JROA 3WU2U 3C5FA 4M04A 2W55A 5ALIA 1ZETA 1L6NA 2YMLA 2YMPA 5KFZA 4KLMA 1A77A 4ZOHC 4UASA 4NL9C 4ECZA 5HMLA 2Y9TA 2WF5A 4BWJA 4IQTA 4F2RA 3KTQA 4P4PA 4ICAA 4P0PA 5ALZA 3GFKB 2ZIVA 1Y88A 2B0CA 3Q8SB 4DO9A 1X66A 3V7LA 1S77D 4ECXA 1QQ5A 1NK9A 3KFUF 3C28A 1QCKA 4J9PA 3VC8A 1JN3A 2A1AA 2BHNA 1AQ6A 2VANA 3HW8A 3SMVA 4EZ6A 3GDXA 4NM2A 2W3RA 4E0DA 1S0NA 2ZIWA 1BPBA 3RF9A 4UB1A 1ZQJA 1LKYB 1QH9A 4BJQA 2LYBA 3MR2A 2W9AA 2LBOA 2HHWA 7ICUA 2Y0SC 9ICVA 4ELVA 1PVPA 1RZTA 8ICHA 5L1IA 2QB0A 2HOQA 5IILA 4UBBA 4FBTA 3MR6A 3MBYA 4RPXA 3DDHA 2N1RA 2C2EA 2WFAA 3SEIA 3SQIA 3OTQA 5AKXA 1JUDA 2VJ5A 3PX6A 1PVRA 7ICKA 5KFFA 1WCLA 2W04A 3OJUA 4RPYA 7ICGA 1RXWA 1VDVA 1ZQCA 3BS7A 4DQRA 5IINA 4I2BA 4M0AA 1OXJA 1SZPA 4O3OA 2QARB 4PGYA 5CRXA 2VIXA 3MGHA 8ICEA 2V9WA 1EXNA 4QWDA 5ALJA 4JV0A 5EE9A 1ZQUA 3AN1A 4NLKA 3DEEA 2ES6A 3BZCA 3AL0B 2ZTEA 7ICTA 5J0PA 3H4BA 2W3SA 3VCBA 3GU3A 2DWQA 9ICWA 5BPCA 4F5PA 3C5GA 4CGZA 2W7OA 4ECWA 3BZKA 2KV2A 4I2IA 1N63A 7ICIA 9ICQA 5KFTA 3Q8QB 2ZG6A 1K1QA 1SWWA 5J8YC 2ZXIA 5KL8B 1TK5A 4YQWA 3BS5B 1DGSA 4UB6U 1S0OA 4BXOA 2EAPA 2H3QA 1SB3C 3NVWA 1RPLA 4M9JA 3IRUA 2GWSA 4NLGA 3SI8A 5GTHU 5HHIA 1PK1A 3RRGA 2BQRA 4F4ZA 1ECWA 2ZUBA 3IDWA 2G5HB 2IBKA 2KFZA 3ISBA 3BQTA 4F2SA 3ZD9A 2F8KA 1D8LA 1RYUA 2JEJA 3MDAA 2MU2A 5KFHA 1ZQTA 5ALXA 4O3NA 4I2AA 4G9BA 4CRXA 5KFNA 2G0AA 4GLXA 1TAUA 5ALYA 1T4GA 1B22A 4KLFA 5DB8A 2GLEA 2WAQF 4NLZA 3AUOA 2Z7JA 2JH7A 4OJ5A 4DL6A 5ALTA 1U47A 4DQIA 2JHDA 4UB4A 2CRXA 1GO3F 2E8PA 1L8LA 5KFRA 4UB8U 4R64A 4C8OA 1MC8A 3RB3A 2H3VA 4RQ8A 1S10A 4F71A 1KDHA 2FE9A 2PMZC 4UAWA 3PNCA 2FLLA 3B0XA 3KZXA 3RAQA 1Z00A 3BQ2A 4EYIB 2EAOA 1O03A 1S97A 2DPIA 5KFLA 2I6XA 4NJ8A 1ZQQA 4IRDA 9ICOA 5KTQA 5HR7A 3I76A 4O3MA 2NRVA 9ICCA 4CDGA 3SD7A 1ZQLA 1JXEA 1SV0C 4F8RA 2W8LA 4DCCA 1D8BA 4BWMA 5DQGA 3GIMA 5FP0A 4ELUA 4B9MA 3Q8LA 5KFBA 4QIWF 3IP4B 1FIQA 1BPZA 4MFCA 3TAPA 3SR6A 2JR5A 4UQGA 2ZJ8A 3ETLA 3NVZA 8ICPA 1X9WA 1N2XA 5KFVA 9ICEA 2KIVA 5EWFA 3PR5B 4JMUA 2PI4A 2G08A 4F4WA 3AQEA 2ZJ5A 2P66A 3M1YA 3HRDD 1ZQRA 3ZDAA 3E58A 2VA3A 1KBUA 5J0XA 7ICQA 1K5OA 1ZOLA 4OD0A 5IIIA 3SAHA 4C4RA 1QSYA 4BUGA 4B9NA 2I5HA 4GC7A 1BNPA 4QIWC 1SKWA 4NV0A 4TQSA 1ZJMA 3KZIU 4DL5A 2H3ZA 2YTUA 2MSNA 3WKEA 4KX3A 3CRXA 4QZEA 3WK8A 3PSTA 3F2BA 2OYYA 3HX0A 3T5JA 4DSEA 2NO4A 4TUQA 4DSKA 3RJGA 5KNIA 3IG8A 4KLJA 4YFKA 3ZDCA 5EOZA 4UW9A 2Y9UA 1TFRA 1X6IA 2KHVA 4R65A 2YB1A 3RH4A 4J9KA 1HUZA 5KG2A 3ED5A 5J2IA 2KJ8A 4NL9A 4PHDA 1MSWD 5KFUA 3QE9Y 1UA0A 2YQEA 3MGVA 4DOBA 4P4OA 3I28A 3LYSA 3F53A 2PFOA 8ICWA 4DS4A 1ZQNA 1S0MA 4RU9A 1SXDA 4RZRA 4DL7A 1V85A 5JUMA 2E1EA 1NK6A 3THVA 5J2AA 8ICFA 1S76D 4DWIA 4US9A 3H8JA 1Z1VA 4M47A 3L5KA 4F5QA 2WF6A 4Y2TA 5KFEA 3GIKA 3M9NB 4XQ8A 5G5HA 2DL0A 2W9MA 4I29A 3OJSA 3G6XA 5JRTA 2LM1A 5AI6A 2XCAA 5AHXA 1UCVA 3KKAA 3LVWA 3FYHA 3EZ5A 1XWLA 3LDAA 9ICKA 2A3VA 2QB1A 4DOCA 4MF2A 3V6KA 3ONNA 1J2MA 4AYBC 4EX6A 3SENA 4DL4A 5ALOA 3CYMA 4G3IA 4YMOA 1N48A 3WKBA 4EELA 1ZQ1C 4LZDA 2NO5A 4ECTA 5DDMA 5ALUA 2MAXA 3MABA 2BZFA 2ZJAA 4F4KA 1ZQGA 2Y1IA 4JB3A 4QWAA 1SGGA 4KLUA 1OUQA 1FO4A 1QSSA 3N28A 4KX5A 2E8MA 2UVUA 3BQ1A 4GFJA 4DF4A 4UAZA 4Y2QA 4M2YA 1ZQXA 5J2EA 4YMMA 2FPMA 2K8CB 4IRKA 4QWBA 2KN7A 3QU5A 1T7PA 1WCNA 2L5YA 5KG3A 5DGAA 2C2DA 1SIJA 2IHMA 1JXLA 3UMGA 5ALLA 4O5EA 3PSFA 5IIJA 3M6ZA 5AM3A 2WF8A 5J2BA 3RB6A 4O9MA 2RDIA 5KG1A 5AM5A 4GXIA 2OEHA 4DFPA 5ALWA 4O3RA 4HYKA 1DGJA 5CWRA 5KG0A 1Q3UA 4RNMA 1PZNA 3V6JA 4I2HA 4Y2RA 1L3SA 4RQMA 9ICHA 4BX9C 2V4QA 7ICNA 2KICA 3Q8RB 2E8OA 4Z6DA 1ZD4A 1ZQWA 2YMQA 3ISDA 1NK8A 1TKDA 3PSIA 3KHHA 4PZNA 5J0WA 2OXOA 4R8UB 5AM0A 2WB1F 4AP9A 1KTQA 5AKIA 2XY7A 2UVVA 1VLBA 2KHQA 5KFDA 2Q0ZX 3QX7A 2CPRA 1RM6C 1L7OA 4OO1J 4EEYA 2K60A 3TAQA 4UB3A 2DPJA 4Y2YA 1DK3A 4KLSA 5IIOA 8ICAA 9ICTA 2BDUA 5DB9A 3QUQA 1NJWA 8ICKA 4ACOA 4GXJA 3Q8PB 1ZD5A 2NV3A 2KVSA 9ICMA 2Y0SF 4YP3A 3H8SA 2LHTA 3ZDEA 4RQ5A 3F2CA 1ZQBA 5AM4A 4US8A 4RT2A 4DFDA 1X2IA 3HP6A 3N4MB 2M0NA 7ICMA 4O3SA 4RNNA 4PL2A 4UAUA 4J9LA 1WWUA 3RAXA 4JWNA 2IOHA 2BCQA 5DDYA 2PI5A 1N56A 2FJ6A 4IQVA 5L1MA 4LZGA 2WB1C 5KFGA 5KFMA 4ED8A 2J6TA 1U45A 1ZQFA 3G6YA 5AI4A 3WKDA 1L3VA 4F5NA 3EPGA 2KMDA 1ZQOA 4YN4A 5AK4A 2A19A 2K8BB 3QUBA 5AM2A 7ICOA 1DRGA 8ICZA 3CW2C 3PW2A 4X5VA 1SL1A 4FBUA 4NXZA 8ICYA 4UB2A 2BGWA 3M7DA 5ALVA 2NYVA 1ZQMA 5EWEA 1B43A 4FS1A 2ASLA 5KAIU 2FLPA 4GC6A 4F93B 2EZZA 5ALRA 4CF5A 4GXKA 4K4HA 1HEKA 5KFXA 2F3NA 2HHUA 5KAFU 1SZHA 9ICAA 1KFTA 4J9OA 2O6KA 1KEJA 5KFOA 2F1JA 1A0PA 5B5EU 5AK3A 2F77X 4KN7A 2KJ5A 5DBBA 4KMUA 3ICXA 1U48A 3UMCA 2W54A 5DG7A 3RJIA 1ZQAA 4C7YA 2G06A 5HHHA 3B0YA 5ALQA 4O3PA 7ICFA 5ALPA 3RB0A 1XU4A 3F5EA 4FZMA 9ICLA 4O5CA 2R8IA 5HNKA 3RJFA 5AICA 5AI5A 1DK2A 2F2AB 3RR8A 8ICRA 1HJPA 2QLTA 3ISCA 2K4EA 3CNHA 4QZFA 1COOA 1MA7A 2VA8A 1NI3A 2WF9A 2IOFA 5CHGA 5DGBA 4NLBA 3MR5A 1CEZA 4RT3A 5AKLA 4FFDA 3GIIA 5EWGA 4GIBA 2JH1A 5JTIA 1IIPA 2PMZF 1KLNA 1TAQA 5IIMA 5JU5A 4UBCA 3LK9A 1CUKA 2BCSA 3C23A 5E79U 3H40A 8ICLA 4F72A 2JZBB 4OJOA 4Y2UA 3ZDDA 5HP4A 1ZXIA 3BJYA 4J9SA 3UXOA 3E2EA 4ELTA 1UPHA 3FAHA 2AQ0A 1JX4A 2DFLA 3KBBA 3Q8KA 2WF7A 4R66A 5J0OA 4UB5A 2KEYA 2NRTA 1X9MA 2FMQA 2HBKA 4B6JA 3PV8A 3QEAZ 5KFKA 3H0MB 7ICSA 5AKYA 4USAA 1Q46A 5EE1A 1FEZA 4F3OA 4RQ4A 1ED1A 1ZRMA 2AGOA 4Y2PA
chains in the Genus database with same CATH topology
2YQEA 2EQYA 2KK0A 1KQQA 1RYUA 4LJXA 2OEHA 1IG6A 2CXYA 2JXJA 5CEHA 5K4LA 2LI6A 1C20A 2JRZA 2LM1A 2RQ5A 1KKXA 2EH9A 1KN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQE A;  2EQY A;  2KK0 A;  1KQQ A;  1RYU A;  4LJX A;  2OEH A;  1IG6 A;  2CXY A;  2JXJ A;  5CEH A;  5K4L A;  2LI6 A;  1C20 A;  2JRZ A;  2LM1 A;  2RQ5 A;  1KKX A;  2EH9 A;  1KN5 A; 
#chains in the Genus database with same CATH topology
 2RP5 A;  1BPE A;  4NWI A;  2NRW A;  2PFP A;  1ZRN A;  1KRP A;  2DF4 B;  5D4B A;  1X9X A;  2K4I A;  2IMW P;  2RRD A;  4C8L A;  3LWM A;  3JPS A;  3OHB A;  4R63 A;  4DLE A;  2W43 A;  4XA5 A;  1K1S A;  2XI9 A;  1IXR A;  1N62 A;  1URJ A;  2OHF A;  2PKE A;  1N61 A;  3MFH A;  8ICQ A;  7ICV A;  5L1K A;  5AI8 A;  2AHO B;  2H5X A;  2G09 A;  2GH1 A;  4KMO B;  5KFW A;  4R8U A;  5KG6 A;  3TAR A;  2XCP A;  2KFN A;  2ISP A;  2CN1 A;  3UPQ A;  3QU4 A;  3RJH A;  1C7Y A;  1NZB A;  2XY6 A;  4CCH A;  3BDP A;  2LYA A;  3EWA A;  3D2Q A;  2JV3 A;  4O3Q A;  1PUZ A;  4K4I A;  2DBY A;  2J6S A;  4J03 A;  2MA1 A;  3SV4 A;  1BPD A;  2W03 A;  4EYH B;  2KKP A;  4BDP A;  3GZF A;  4PPX A;  1X42 A;  1FFV A;  2KOB A;  2KZM A;  4PHA A;  8ICG A;  4KLD A;  4FO6 A;  4P0P B;  3UXP A;  8ICS A;  1ZQD A;  3TAD C;  2OH2 A;  4Q8E A;  4UAY A;  5F3X B;  2Q4T A;  4QZG A;  5TZV A;  1NKE A;  3QZ8 A;  3SYZ A;  1NK5 A;  3J81 j;  1TK0 A;  2RLT A;  3H0L B;  5BOL A;  1SL2 A;  5L1J A;  3M9M B;  1ZQV A;  8ICM A;  3QU2 A;  2FI1 A;  4KLO A;  3RB4 A;  4YXM A;  1ZQH A;  3MGI A;  5AKG A;  2ZIW B;  4RPZ A;  2ISO A;  2XID A;  4DL3 A;  4B9U A;  2MRL A;  5KFI A;  5DBA A;  1XS9 D;  2UVR A;  5ALS A;  4RUC A;  2D8C A;  3C29 A;  4J9N A;  4PL1 A;  3WK4 A;  4Y2S A;  3RBE A;  1LKY A;  3T5K A;  4C4T A;  4RQ6 A;  1L8O A;  1ZQY A;  1KN5 A;  2WHE A;  3K4G A;  4Q45 A;  2KP7 A;  3C2L A;  9ICU A;  4IL6 U;  4B9V A;  2CXY A;  2DGZ A;  2EZY A;  1ZQK A;  2ESE A;  1WWV A;  1ZQI A;  8ICT A;  4AYB F;  4Y2V A;  5J2G A;  4QZ8 A;  3AEV A;  2JRZ A;  2KNJ A;  4QZI A;  4JV2 A;  5J2D A;  7ICH A;  3TAN A;  4ED0 A;  2C22 A;  1RDF A;  4J9R A;  4CNQ A;  5CR0 A;  4MFF A;  2KTQ A;  2AQ4 A;  1SKR A;  1FFU A;  4ECV A;  4ED2 A;  9ICN A;  2VKQ A;  1KSP A;  4QNL A;  4YR3 A;  1BPY A;  3KHR A;  4IC9 A;  2UVW A;  3OSP A;  2FPL A;  5KFP A;  4QZD A;  3HJE A;  4PJ0 U;  5KFQ A;  1NJY A;  3PW7 A;  1KFS A;  1MN8 A;  2QAR A;  4FS2 A;  2KD1 A;  2ZTD A;  3TFS A;  4P0Q B;  2GOL A;  9ICG A;  1KQQ A;  3IHQ B;  4QWE A;  5DB6 A;  3L3F X;  5D46 A;  8ICC A;  1Z19 A;  1IG6 A;  1RG6 A;  2IHN A;  3KOO A;  3EPI A;  5KG4 A;  4C80 A;  4O0I A;  4DQS A;  1NKC A;  4IQU A;  1RQL A;  3NRZ A;  3HKZ C;  4QZH A;  2HDO A;  5EE3 A;  5A0L A;  2OCE A;  1QQ7 A;  5AIB A;  2AGP A;  4QJF B;  8ICX A;  3QU7 A;  3BS5 A;  4DS5 A;  4IS7 A;  4TUR A;  2E1F A;  3TAC B;  5D49 A;  7ICE A;  3LWL A;  4CE6 A;  4RQ2 A;  5J0T A;  5KL1 B;  4Z6E A;  2HHX A;  4M9L A;  1LV5 A;  4M9H A;  1Z4O A;  3RJJ A;  1QLN A;  3GV8 B;  4DFM A;  1NK4 A;  1V9P A;  1T3N A;  1SXE A;  4NLC A;  2YY6 A;  1SWV A;  2ZIU B;  2XO7 A;  4I2F A;  5L9X A;  2D6F C;  1N60 A;  3UM9 A;  2HVI A;  4ECU A;  3HIL A;  1NK0 A;  2JZB A;  1TV9 A;  8ICJ A;  2F8L A;  2HSZ A;  8ICI A;  4I2C A;  9ICF A;  1XSN A;  2FLN A;  3T3F A;  5KT4 A;  3JPN A;  5J8Y A;  3KHG A;  2RHF A;  4RQ0 A;  3EYZ A;  5J0Y A;  2ZUD A;  3WK7 A;  2JXJ A;  2K8A A;  3PX4 A;  3KD3 A;  3PY8 A;  3NRW A;  3PMN A;  3C1Y A;  2F76 X;  2P6R A;  2C2R A;  5F9N A;  5ALM A;  3GV7 B;  2ASJ A;  1QTM A;  2K4H A;  4J9Q A;  9ICB A;  1CI4 A;  3M8S A;  3MDC A;  1NKB A;  2KZZ A;  3HPO A;  2E8N A;  1TAM A;  4JWM A;  2EQY A;  5J2F A;  3OHA A;  5CJ7 A;  1XSP A;  5AI9 A;  3Q8M A;  4P4M A;  2HBM A;  4EZ9 A;  1IM4 A;  5AKE A;  3BQ0 A;  4NM1 A;  2LM4 A;  2J6U A;  5DKW A;  2KE7 A;  3ZI4 A;  3AQF A;  3N97 B;  5ALH A;  3SZ2 A;  3OSN A;  4YXJ A;  8ICV A;  4RQ3 A;  1SV4 A;  1S9F A;  1Q3V A;  3I1Y A;  1L7M A;  2HBL A;  3PZP A;  2R8G A;  4YCX A;  2AXT U;  4Y2X A;  5CA7 A;  1F44 A;  2FDR A;  4XUS A;  2HOI A;  5AIA A;  4DOA A;  4B9L A;  2I9G A;  3BQ7 A;  2AH5 A;  3QXG A;  2JEG A;  4DQP A;  3OPX A;  2KK0 A;  3T5L A;  4CF4 A;  2IA6 A;  4ECY A;  9ICI A;  2R8H A;  4WJ3 B;  3K75 D;  2BCR A;  3H0R B;  1LB2 B;  2QKQ A;  4I2D A;  2PFQ A;  2AGQ A;  3M9O B;  1OW5 A;  4EBD A;  2PXI A;  2EDU A;  3O0F A;  3NVY A;  9ICJ A;  1F0M A;  3F5A A;  2JMG A;  1NNL A;  1RYR A;  3HWT A;  4B9S A;  3QUT A;  4Q8F A;  4QW9 A;  3QU9 A;  1SV0 A;  4EEN A;  3PVX A;  2B21 A;  3PO5 A;  1WG8 A;  1ZD2 P;  3WKC A;  1ZQZ A;  2C28 A;  2P35 A;  5C5J A;  5ALG A;  4KLG A;  1JI7 A;  1UT8 A;  1COK A;  1Z1B A;  4F5O A;  1H38 A;  5AK6 A;  2FMS A;  1ARO P;  2NRZ A;  3IM1 A;  4BGD A;  4C0Z A;  5EE0 A;  1ZQE A;  8ICU A;  7ICR A;  1YZ7 A;  1LVH A;  5KFJ A;  2E3T A;  2LMR A;  4TUS A;  4O5K A;  3LVV A;  3NVV A;  4F50 A;  2Y1J A;  1UT5 A;  4C7Z A;  3RR7 A;  2XGP A;  4ECS A;  3KKA C;  2NRX A;  2HW3 A;  1NOM A;  1PVQ A;  2HHV A;  3FM9 A;  7ICJ A;  5ALK A;  2W9B B;  1QSL A;  4C4S A;  4DSL A;  4QWC A;  3UQ0 A;  3GIL A;  4MFA A;  3PO4 A;  5AI0 A;  4Z6F A;  1TK8 A;  3TAD A;  3MR3 A;  1MQ3 A;  4IRC A;  2R18 A;  4LJX A;  2KZ3 A;  1JRP A;  4JUZ A;  4XRH A;  4DF8 A;  4IR9 A;  1NJZ A;  1L5U A;  5KT7 A;  2LI6 A;  3RH5 A;  1V38 A;  2LKY A;  4KLH A;  1A6S A;  1C20 A;  4OJP A;  3AM9 A;  1BGX T;  5J29 A;  5J0R A;  2V4R A;  3TQ1 A;  1YT3 A;  7ICP A;  3RFA A;  3KHL A;  3HT3 A;  1BNO A;  4M9N A;  4ZH4 A;  3PW4 A;  5DB7 A;  5KT6 A;  3D6J A;  2EZX A;  5ALD A;  2BPC A;  3V7K A;  4Q44 A;  4RUA A;  4DSF A;  3PML A;  2EAN A;  5DLF A;  4ECQ A;  1RXV A;  2K89 A;  2RQ5 A;  2BKE A;  1KFD A;  3NUQ A;  4YG2 A;  2OWO A;  4TUP A;  3B9J A;  2W8K A;  4RQN A;  4P0Q A;  4YR0 A;  2BDP A;  2KKV A;  2H3F A;  5IIK A;  2MUT B;  3AU2 A;  4IR1 A;  3PSP A;  5KT5 A;  3FC4 A;  4DSJ A;  4OJL A;  5DG8 A;  1S8O A;  4EBE A;  3JPP A;  2VA2 A;  4ED7 A;  2B6G A;  3EUB 2;  2AJQ A;  3JPT A;  1P7D A;  4C8M A;  2XIC A;  3A0B U;  4RQ7 A;  4DSI A;  3IG5 A;  4FZN A;  3PR4 A;  4DLG A;  2ZIX B;  2PFN A;  4EX7 A;  2BQU A;  2A1J B;  1M6Y A;  4ED3 A;  1F5S A;  2W11 A;  3WKA A;  2F44 A;  4ED1 A;  3WK5 A;  2ZIU A;  4YR2 A;  1ZD3 A;  4PH5 A;  3NS1 A;  4NY8 A;  3GIJ A;  3WK6 A;  4U6P A;  1U9L A;  1TVA A;  5DLG A;  1J2N A;  2LYH A;  2H3I A;  4IQW A;  4FE3 A;  4M6W B;  3H8M A;  3C21 A;  4U7C A;  1L3T A;  2BCV A;  1TE2 A;  1X6J A;  3L4P A;  5AKJ A;  5ALE A;  1D9F A;  3RRH A;  1ZJN A;  4KIT B;  4YD1 A;  5KFC A;  2W9C B;  1BPX A;  5CB1 A;  4F91 B;  1J97 A;  5L1L A;  3C2M A;  2HHT A;  3NTU A;  3MFI A;  4KLQ A;  5KT2 A;  4RNO A;  2I1Q A;  4UAR A;  4ECR A;  2XY5 A;  5AK5 A;  8ICB A;  4DL2 A;  5DG9 A;  2HOF A;  4KLT A;  5J0U A;  2M9N A;  1JMS A;  4FZL A;  1Q8K A;  3G6V A;  2KSO B;  3PW5 A;  2HCF A;  3CP8 A;  3JPR A;  4RQ1 A;  3S6J A;  3R9K A;  3JPO A;  1XO0 A;  2KVC A;  5J2H A;  2ASD A;  4PGQ A;  5KFY A;  1KW4 A;  2YMM A;  4DFJ A;  4PHE A;  1T8E A;  2HBJ A;  4PZO A;  2ZXH A;  5J2C A;  4PGX A;  3NGD A;  2DUY A;  2WAQ C;  4I2G A;  3EW9 A;  3M6K A;  1DXS A;  3N7P D;  9ICP A;  4MEY A;  4TQR A;  2HVH A;  5CEH A;  3QYP A;  1CRX A;  5GTI U;  3SAG A;  4DQQ A;  2HHQ A;  3ALR A;  3IV6 A;  2WTF A;  2XVT A;  5DQI A;  2G07 A;  2BPF A;  2FPK A;  2ZIV B;  4YMN A;  1T3Q A;  4M9G A;  5DBC A;  2BR0 A;  1WUD A;  2XGQ A;  1KL9 A;  1Z4N A;  3TKA A;  3IN5 A;  9ICS A;  5KFS A;  1X9S A;  1RQN A;  1JAL A;  4QZC A;  5H2F U;  1VJ5 A;  5AKK A;  2LPE A;  3U26 A;  3C1Z A;  5DQH A;  4MF8 A;  2K4P A;  4B9T A;  1XSL A;  4DFK A;  4KTQ A;  2HMX A;  4I2J A;  4QZ9 A;  2E5S A;  4CF3 A;  1N5X A;  4F92 B;  1ZQP A;  2OM6 A;  5C0Y A;  4YVZ A;  3QZ7 A;  4I27 A;  1B4F A;  4JK1 A;  3GQC A;  2RDJ A;  3V72 A;  3TFR A;  4Y2J A;  3ETR A;  2BCU A;  2ATL A;  1XNS A;  2QB0 B;  5J0S A;  2GO7 A;  2ALZ A;  1D9D A;  2JEI A;  3QUC A;  5KFA A;  4MEX A;  1U4B A;  5B66 U;  1V97 A;  4KN4 A;  4ED6 A;  1L7N A;  1SL0 A;  1NZP A;  3E0F A;  4F4Y A;  2R8J A;  5KG5 A;  1HIW A;  2F1H A;  3HKZ F;  3SV3 A;  4QZB A;  4DEZ A;  3D2N A;  2DQN B;  3AMZ A;  1HUO A;  3ZDB A;  2W9B A;  1O08 A;  3NAS A;  3C2K A;  2R8K A;  8ICO A;  4K4G A;  1U49 A;  1WYG A;  3H4D A;  5AKH A;  3V7J A;  3T79 A;  9ICR A;  3PW0 A;  2KIW A;  5ALN A;  1IV8 A;  3QNM A;  2YB4 A;  4UAT A;  1T94 A;  3ORY A;  1UA1 A;  3RJE A;  4QW8 A;  1RYS A;  2DKX A;  2JEF A;  1X40 A;  4UAV A;  5HR6 A;  5J2K A;  5K4L A;  3DV9 A;  2FMP A;  1L3U A;  4C8K A;  3UMB A;  4C8N A;  5J0Q A;  3MC1 A;  2EAM A;  3D2S A;  4BXO B;  5CP2 A;  1XC9 A;  3N7R C;  2XC9 A;  7ICL A;  4Q43 A;  5TIS U;  1PK1 B;  4KLL A;  3FDS A;  1A76 A;  4OCZ A;  4PHP A;  2MUT A;  4P2H A;  3H8W A;  2ZTC A;  2HHS A;  1NJX A;  4HAI A;  1BVS A;  3AU6 A;  3F2D A;  3ZD8 A;  1KKX A;  3K1Z A;  5J2J A;  4EBC A;  3H7I A;  3OGU A;  2YX8 A;  3RJK A;  3UQ2 A;  1YZ6 A;  1B0X A;  4EEK A;  1ZQS A;  5BOM A;  1PK3 A;  2P6U A;  4MHV A;  5AM1 A;  3WK9 A;  3TI0 A;  2ZIX A;  5AKZ A;  2A1J A;  4LVS A;  2BQ3 A;  1SKS A;  2DKZ A;  5KG7 A;  4F4X A;  2ZUC A;  4NLN A;  1XO1 A;  1QQ6 A;  5G5G A;  4QZA A;  1UQV A;  2HI0 A;  4JV1 A;  1Z3E B;  2EH9 A;  5T14 A;  9ICX A;  3SAF A;  2ODG A;  2AU0 A;  4I28 A;  1DOQ A;  1Z00 B;  4M6W A;  2KJ9 A;  4KLE A;  8ICN A;  1ZYQ A;  1MQ2 A;  5F9L A;  1L7P A;  2D3D A;  4Z6C A;  3K1R B;  3T5H A;  3A0H U;  2YN4 A;  3UXN A;  2W9C A;  4I2E A;  1UHU A;  3M8R A;  3QEB Z;  2G5I B;  2F1I A;  1S5L U;  2IOF K;  2BPG A;  3RTV A;  3RH6 A;  5KT3 A;  5HMM A;  2W7P A;  4YD2 A;  2JGA A;  1JIH A;  3V6H A;  4OJ6 A;  1D8Y A;  5ALF A;  2KG5 A;  3JPQ A;  3N7S C;  4KLI A;  2KSO A;  3RBD A;  1S0V A;  1N5W A;  4J9M A;  2VJ4 A;  3GV5 B;  4A8E A;  1NK7 A;  4F5R A;  3PX0 A;  1JRO A;  3WU2 U;  3C5F A;  4M04 A;  2W55 A;  5ALI A;  1ZET A;  1L6N A;  2YML A;  2YMP A;  5KFZ A;  4KLM A;  1A77 A;  4ZOH C;  4UAS A;  4NL9 C;  4ECZ A;  5HML A;  2Y9T A;  2WF5 A;  4BWJ A;  4IQT A;  4F2R A;  3KTQ A;  4P4P A;  4ICA A;  4P0P A;  5ALZ A;  3GFK B;  2ZIV A;  1Y88 A;  2B0C A;  3Q8S B;  4DO9 A;  1X66 A;  3V7L A;  1S77 D;  4ECX A;  1QQ5 A;  1NK9 A;  3KFU F;  3C28 A;  1QCK A;  4J9P A;  3VC8 A;  1JN3 A;  2A1A A;  2BHN A;  1AQ6 A;  2VAN A;  3HW8 A;  3SMV A;  4EZ6 A;  3GDX A;  4NM2 A;  2W3R A;  4E0D A;  1S0N A;  2ZIW A;  1BPB A;  3RF9 A;  4UB1 A;  1ZQJ A;  1LKY B;  1QH9 A;  4BJQ A;  2LYB A;  3MR2 A;  2W9A A;  2LBO A;  2HHW A;  7ICU A;  2Y0S C;  9ICV A;  4ELV A;  1PVP A;  1RZT A;  8ICH A;  5L1I A;  2QB0 A;  2HOQ A;  5IIL A;  4UBB A;  4FBT A;  3MR6 A;  3MBY A;  4RPX A;  3DDH A;  2N1R A;  2C2E A;  2WFA A;  3SEI A;  3SQI A;  3OTQ A;  5AKX A;  1JUD A;  2VJ5 A;  3PX6 A;  1PVR A;  7ICK A;  5KFF A;  1WCL A;  2W04 A;  3OJU A;  4RPY A;  7ICG A;  1RXW A;  1VDV A;  1ZQC A;  3BS7 A;  4DQR A;  5IIN A;  4I2B A;  4M0A A;  1OXJ A;  1SZP A;  4O3O A;  2QAR B;  4PGY A;  5CRX A;  2VIX A;  3MGH A;  8ICE A;  2V9W A;  1EXN A;  4QWD A;  5ALJ A;  4JV0 A;  5EE9 A;  1ZQU A;  3AN1 A;  4NLK A;  3DEE A;  2ES6 A;  3BZC A;  3AL0 B;  2ZTE A;  7ICT A;  5J0P A;  3H4B A;  2W3S A;  3VCB A;  3GU3 A;  2DWQ A;  9ICW A;  5BPC A;  4F5P A;  3C5G A;  4CGZ A;  2W7O A;  4ECW A;  3BZK A;  2KV2 A;  4I2I A;  1N63 A;  7ICI A;  9ICQ A;  5KFT A;  3Q8Q B;  2ZG6 A;  1K1Q A;  1SWW A;  5J8Y C;  2ZXI A;  5KL8 B;  1TK5 A;  4YQW A;  3BS5 B;  1DGS A;  4UB6 U;  1S0O A;  4BXO A;  2EAP A;  2H3Q A;  1SB3 C;  3NVW A;  1RPL A;  4M9J A;  3IRU A;  2GWS A;  4NLG A;  3SI8 A;  5GTH U;  5HHI A;  1PK1 A;  3RRG A;  2BQR A;  4F4Z A;  1ECW A;  2ZUB A;  3IDW A;  2G5H B;  2IBK A;  2KFZ A;  3ISB A;  3BQT A;  4F2S A;  3ZD9 A;  2F8K A;  1D8L A;  1RYU A;  2JEJ A;  3MDA A;  2MU2 A;  5KFH A;  1ZQT A;  5ALX A;  4O3N A;  4I2A A;  4G9B A;  4CRX A;  5KFN A;  2G0A A;  4GLX A;  1TAU A;  5ALY A;  1T4G A;  1B22 A;  4KLF A;  5DB8 A;  2GLE A;  2WAQ F;  4NLZ A;  3AUO A;  2Z7J A;  2JH7 A;  4OJ5 A;  4DL6 A;  5ALT A;  1U47 A;  4DQI A;  2JHD A;  4UB4 A;  2CRX A;  1GO3 F;  2E8P A;  1L8L A;  5KFR A;  4UB8 U;  4R64 A;  4C8O A;  1MC8 A;  3RB3 A;  2H3V A;  4RQ8 A;  1S10 A;  4F71 A;  1KDH A;  2FE9 A;  2PMZ C;  4UAW A;  3PNC A;  2FLL A;  3B0X A;  3KZX A;  3RAQ A;  1Z00 A;  3BQ2 A;  4EYI B;  2EAO A;  1O03 A;  1S97 A;  2DPI A;  5KFL A;  2I6X A;  4NJ8 A;  1ZQQ A;  4IRD A;  9ICO A;  5KTQ A;  5HR7 A;  3I76 A;  4O3M A;  2NRV A;  9ICC A;  4CDG A;  3SD7 A;  1ZQL A;  1JXE A;  1SV0 C;  4F8R A;  2W8L A;  4DCC A;  1D8B A;  4BWM A;  5DQG A;  3GIM A;  5FP0 A;  4ELU A;  4B9M A;  3Q8L A;  5KFB A;  4QIW F;  3IP4 B;  1FIQ A;  1BPZ A;  4MFC A;  3TAP A;  3SR6 A;  2JR5 A;  4UQG A;  2ZJ8 A;  3ETL A;  3NVZ A;  8ICP A;  1X9W A;  1N2X A;  5KFV A;  9ICE A;  2KIV A;  5EWF A;  3PR5 B;  4JMU A;  2PI4 A;  2G08 A;  4F4W A;  3AQE A;  2ZJ5 A;  2P66 A;  3M1Y A;  3HRD D;  1ZQR A;  3ZDA A;  3E58 A;  2VA3 A;  1KBU A;  5J0X A;  7ICQ A;  1K5O A;  1ZOL A;  4OD0 A;  5III A;  3SAH A;  4C4R A;  1QSY A;  4BUG A;  4B9N A;  2I5H A;  4GC7 A;  1BNP A;  4QIW C;  1SKW A;  4NV0 A;  4TQS A;  1ZJM A;  3KZI U;  4DL5 A;  2H3Z A;  2YTU A;  2MSN A;  3WKE A;  4KX3 A;  3CRX A;  4QZE A;  3WK8 A;  3PST A;  3F2B A;  2OYY A;  3HX0 A;  3T5J A;  4DSE A;  2NO4 A;  4TUQ A;  4DSK A;  3RJG A;  5KNI A;  3IG8 A;  4KLJ A;  4YFK A;  3ZDC A;  5EOZ A;  4UW9 A;  2Y9U A;  1TFR A;  1X6I A;  2KHV A;  4R65 A;  2YB1 A;  3RH4 A;  4J9K A;  1HUZ A;  5KG2 A;  3ED5 A;  5J2I A;  2KJ8 A;  4NL9 A;  4PHD A;  1MSW D;  5KFU A;  3QE9 Y;  1UA0 A;  2YQE A;  3MGV A;  4DOB A;  4P4O A;  3I28 A;  3LYS A;  3F53 A;  2PFO A;  8ICW A;  4DS4 A;  1ZQN A;  1S0M A;  4RU9 A;  1SXD A;  4RZR A;  4DL7 A;  1V85 A;  5JUM A;  2E1E A;  1NK6 A;  3THV A;  5J2A A;  8ICF A;  1S76 D;  4DWI A;  4US9 A;  3H8J A;  1Z1V A;  4M47 A;  3L5K A;  4F5Q A;  2WF6 A;  4Y2T A;  5KFE A;  3GIK A;  3M9N B;  4XQ8 A;  5G5H A;  2DL0 A;  2W9M A;  4I29 A;  3OJS A;  3G6X A;  5JRT A;  2LM1 A;  5AI6 A;  2XCA A;  5AHX A;  1UCV A;  3KKA A;  3LVW A;  3FYH A;  3EZ5 A;  1XWL A;  3LDA A;  9ICK A;  2A3V A;  2QB1 A;  4DOC A;  4MF2 A;  3V6K A;  3ONN A;  1J2M A;  4AYB C;  4EX6 A;  3SEN A;  4DL4 A;  5ALO A;  3CYM A;  4G3I A;  4YMO A;  1N48 A;  3WKB A;  4EEL A;  1ZQ1 C;  4LZD A;  2NO5 A;  4ECT A;  5DDM A;  5ALU A;  2MAX A;  3MAB A;  2BZF A;  2ZJA A;  4F4K A;  1ZQG A;  2Y1I A;  4JB3 A;  4QWA A;  1SGG A;  4KLU A;  1OUQ A;  1FO4 A;  1QSS A;  3N28 A;  4KX5 A;  2E8M A;  2UVU A;  3BQ1 A;  4GFJ A;  4DF4 A;  4UAZ A;  4Y2Q A;  4M2Y A;  1ZQX A;  5J2E A;  4YMM A;  2FPM A;  2K8C B;  4IRK A;  4QWB A;  2KN7 A;  3QU5 A;  1T7P A;  1WCN A;  2L5Y A;  5KG3 A;  5DGA A;  2C2D A;  1SIJ A;  2IHM A;  1JXL A;  3UMG A;  5ALL A;  4O5E A;  3PSF A;  5IIJ A;  3M6Z A;  5AM3 A;  2WF8 A;  5J2B A;  3RB6 A;  4O9M A;  2RDI A;  5KG1 A;  5AM5 A;  4GXI A;  2OEH A;  4DFP A;  5ALW A;  4O3R A;  4HYK A;  1DGJ A;  5CWR A;  5KG0 A;  1Q3U A;  4RNM A;  1PZN A;  3V6J A;  4I2H A;  4Y2R A;  1L3S A;  4RQM A;  9ICH A;  4BX9 C;  2V4Q A;  7ICN A;  2KIC A;  3Q8R B;  2E8O A;  4Z6D A;  1ZD4 A;  1ZQW A;  2YMQ A;  3ISD A;  1NK8 A;  1TKD A;  3PSI A;  3KHH A;  4PZN A;  5J0W A;  2OXO A;  4R8U B;  5AM0 A;  2WB1 F;  4AP9 A;  1KTQ A;  5AKI A;  2XY7 A;  2UVV A;  1VLB A;  2KHQ A;  5KFD A;  2Q0Z X;  3QX7 A;  2CPR A;  1RM6 C;  1L7O A;  4OO1 J;  4EEY A;  2K60 A;  3TAQ A;  4UB3 A;  2DPJ A;  4Y2Y A;  1DK3 A;  4KLS A;  5IIO A;  8ICA A;  9ICT A;  2BDU A;  5DB9 A;  3QUQ A;  1NJW A;  8ICK A;  4ACO A;  4GXJ A;  3Q8P B;  1ZD5 A;  2NV3 A;  2KVS A;  9ICM A;  2Y0S F;  4YP3 A;  3H8S A;  2LHT A;  3ZDE A;  4RQ5 A;  3F2C A;  1ZQB A;  5AM4 A;  4US8 A;  4RT2 A;  4DFD A;  1X2I A;  3HP6 A;  3N4M B;  2M0N A;  7ICM A;  4O3S A;  4RNN A;  4PL2 A;  4UAU A;  4J9L A;  1WWU A;  3RAX A;  4JWN A;  2IOH A;  2BCQ A;  5DDY A;  2PI5 A;  1N56 A;  2FJ6 A;  4IQV A;  5L1M A;  4LZG A;  2WB1 C;  5KFG A;  5KFM A;  4ED8 A;  2J6T A;  1U45 A;  1ZQF A;  3G6Y A;  5AI4 A;  3WKD A;  1L3V A;  4F5N A;  3EPG A;  2KMD A;  1ZQO A;  4YN4 A;  5AK4 A;  2A19 A;  2K8B B;  3QUB A;  5AM2 A;  7ICO A;  1DRG A;  8ICZ A;  3CW2 C;  3PW2 A;  4X5V A;  1SL1 A;  4FBU A;  4NXZ A;  8ICY A;  4UB2 A;  2BGW A;  3M7D A;  5ALV A;  2NYV A;  1ZQM A;  5EWE A;  1B43 A;  4FS1 A;  2ASL A;  5KAI U;  2FLP A;  4GC6 A;  4F93 B;  2EZZ A;  5ALR A;  4CF5 A;  4GXK A;  4K4H A;  1HEK A;  5KFX A;  2F3N A;  2HHU A;  5KAF U;  1SZH A;  9ICA A;  1KFT A;  4J9O A;  2O6K A;  1KEJ A;  5KFO A;  2F1J A;  1A0P A;  5B5E U;  5AK3 A;  2F77 X;  4KN7 A;  2KJ5 A;  5DBB A;  4KMU A;  3ICX A;  1U48 A;  3UMC A;  2W54 A;  5DG7 A;  3RJI A;  1ZQA A;  4C7Y A;  2G06 A;  5HHH A;  3B0Y A;  5ALQ A;  4O3P A;  7ICF A;  5ALP A;  3RB0 A;  1XU4 A;  3F5E A;  4FZM A;  9ICL A;  4O5C A;  2R8I A;  5HNK A;  3RJF A;  5AIC A;  5AI5 A;  1DK2 A;  2F2A B;  3RR8 A;  8ICR A;  1HJP A;  2QLT A;  3ISC A;  2K4E A;  3CNH A;  4QZF A;  1COO A;  1MA7 A;  2VA8 A;  1NI3 A;  2WF9 A;  2IOF A;  5CHG A;  5DGB A;  4NLB A;  3MR5 A;  1CEZ A;  4RT3 A;  5AKL A;  4FFD A;  3GII A;  5EWG A;  4GIB A;  2JH1 A;  5JTI A;  1IIP A;  2PMZ F;  1KLN A;  1TAQ A;  5IIM A;  5JU5 A;  4UBC A;  3LK9 A;  1CUK A;  2BCS A;  3C23 A;  5E79 U;  3H40 A;  8ICL A;  4F72 A;  2JZB B;  4OJO A;  4Y2U A;  3ZDD A;  5HP4 A;  1ZXI A;  3BJY A;  4J9S A;  3UXO A;  3E2E A;  4ELT A;  1UPH A;  3FAH A;  2AQ0 A;  1JX4 A;  2DFL A;  3KBB A;  3Q8K A;  2WF7 A;  4R66 A;  5J0O A;  4UB5 A;  2KEY A;  2NRT A;  1X9M A;  2FMQ A;  2HBK A;  4B6J A;  3PV8 A;  3QEA Z;  5KFK A;  3H0M B;  7ICS A;  5AKY A;  4USA A;  1Q46 A;  5EE1 A;  1FEZ A;  4F3O A;  4RQ4 A;  1ED1 A;  1ZRM A;  2AGO A;  4Y2P A; 
#chains in the Genus database with same CATH homology
 2YQE A;  2EQY A;  2KK0 A;  1KQQ A;  1RYU A;  4LJX A;  2OEH A;  1IG6 A;  2CXY A;  2JXJ A;  5CEH A;  5K4L A;  2LI6 A;  1C20 A;  2JRZ A;  2LM1 A;  2RQ5 A;  1KKX A;  2EH9 A;  1KN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...