1IG6A

Human mrf-2 domain, nmr, 11 structures
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
b'RADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPIKPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODULATOR RECOGNITION FACTOR 2
publication title HUMAN MRF-2 DOMAIN, NMR, 11 STRUCTURES
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 33
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1ig6A00
1KN5A 2EH9A 2JRZA 2OEHA 2YQEA 2JXJA 2CXYA 4LJXA 2LM1A 5CEHA 1KKXA 2EQYA 2KK0A 1KQQA 1IG6A 1C20A 2RQ5A 1RYUA 5K4LA 2LI6A
chains in the Genus database with same CATH superfamily
4DL3A 1KBUA 4Z6CA 2HHQA 3G6YA 2BDPA 3RBDA 2P6RA 2NRXA 5E79U 3DDHA 8ICGA 2K89A 3FAHA 3QU5A 3HRDD 5ALVA 4LZGA 1F5SA 3PR4A 4PL2A 2Z7JA 2HHSA 5HNKA 2F8KA 4DFDA 1ZQAA 5AI0A 2KZZA 8ICWA 1B43A 7ICJA 5KFIA 4ZH4A 1TVAA 5DBCA 3SAGA 4UAUA 3MGHA 1PVQA 3KBBA 5ALDA 4Y2YA 1X42A 1Z4OA 5EE1A 5DBBA 3KHHA 3EPGA 4I2AA 1ZQ1C 5KG4A 4M9NA 4EENA 3LYSA 4GLXA 5ALUA 1ZQNA 2KFZA 5KL8B 2DFLA 5L9XA 1ZQTA 3BQ0A 2F76X 3TFRA 5DBAA 4ECZA 8ICHA 2E8OA 4IQUA 1JIHA 5KFNA 2FMQA 1D8YA 3KHGA 3GFKB 4B6JA 4UBBA 1ED1A 3WKEA 5ALMA 2XICA 3KD3A 4F72A 2YMLA 2EAOA 4AYBC 2W9CA 1QH9A 1BPYA 2ZXHA 4DSKA 4J9RA 4RQ7A 1T4GA 5CHGA 2GOLA 4OD0A 5KG5A 4KLIA 9ICUA 4F4ZA 1SKWA 4GFJA 3GU3A 2Y9UA 1QLNA 2XVTA 1SIJA 3PR5B 4MF8A 4YMMA 4Y2SA 2C2RA 1SV0C 5DLFA 3GQCA 9ICBA 5DB7A 4F50A 2EANA 1DXSA 1SWVA 3AQEA 4PZNA 5IIMA 4ELTA 5HMLA 3Q8SB 4I2FA 4ECSA 1V97A 3HJEA 1ZETA 4RT3A 3RR7A 4A8EA 4QWBA 3M9NB 2XGPA 2JH1A 2R8IA 4C80A 7ICQA 1SB3C 2KK0A 2WF5A 4KLFA 1NJWA 5KFEA 1S8OA 8ICAA 2P66A 2DKXA 2W3SA 1URJA 3K1ZA 3HP6A 1KDHA 4M9LA 3BQ2A 2WAQF 1ZD5A 4DOBA 1ZQCA 4UB2A 1HIWA 4GXIA 4O3QA 3UMCA 3IG8A 2G07A 1RDFA 2E5SA 3PX4A 4P2HA 3RH6A 5KFUA 4ECTA 3ALRA 2P35A 7ICHA 3WKAA 2AU0A 3C1ZA 1A6SA 7ICTA 3J81j 4DWIA 3SD7A 1LV5A 2ISPA 4QZFA 1JRPA 2V9WA 5AKYA 4US8A 5HHHA 3F2BA 1X2IA 4PGQA 2R8HA 4OJLA 4I2EA 4OCZA 1CRXA 3QUTA 2K4HA 1L3UA 1U48A 5G5GA 2KOBA 2QKQA 1J2MA 3WKDA 1RPLA 1NK0A 3L5KA 4ECRA 5AK3A 5CR0A 2EZZA 4Z6DA 1QTMA 1N2XA 2XCPA 2O6KA 4F4WA 4YD1A 4DEZA 2MU2A 1QQ5A 4UATA 1ZQEA 3AL0B 4XQ8A 1ZRNA 1ZD3A 2G5IB 1MQ2A 4NLZA 1ZQZA 1KRPA 3SV3A 3TARA 2F44A 4F5RA 2C2DA 1TE2A 3D2SA 1ZYQA 5J0PA 3C2LA 4JV2A 4IR1A 3MFIA 3C1YA 2WF9A 4J03A 3ETRA 4HYKA 5HR6A 5KT3A 4YCXA 5KFHA 2BR0A 4F8RA 9ICIA 1LB2B 1SL2A 3K75D 3JPOA 2UVRA 1S97A 1XC9A 1SGGA 2C2EA 1B22A 1N62A 1OXJA 1PK3A 3LK9A 5J2IA 4ECXA 1Q8KA 2KP7A 3M6KA 1L6NA 5KFRA 5J2KA 8ICVA 1T7PA 5FP0A 4PHDA 1L5UA 4CNQA 9ICWA 2D3DA 5IILA 1Q46A 4F2RA 5ALWA 3JPTA 2KD1A 1ZQXA 5J2CA 2RQ5A 1RYUA 4QZEA 1TAUA 1T3QA 1XSLA 4QZ9A 4F2SA 2PXIA 1GO3F 2HOFA 5KFSA 4I2GA 4DLEA 1BPBA 2FDRA 1PVRA 1WUDA 4IQTA 3S6JA 2ESEA 4F4KA 5L1JA 1NOMA 1AROP 1IV8A 4FE3A 5J2AA 2BKEA 2HHVA 2L5YA 3TADC 1BVSA 1NK4A 3H4BA 4YG2A 4MFFA 2E1EA 2PI5A 9ICAA 1S10A 3RAQA 3T3FA 1KEJA 3V7LA 4J9SA 1L7OA 4R66A 3ISCA 4Y2QA 8ICUA 4J9OA 5GTHU 4Q43A 3F2CA 1IM4A 5EWFA 2DGZA 1UA1A 2I5HA 4EBCA 3C5FA 2CRXA 5KT7A 2HI0A 2RHFA 3EPIA 2FPLA 4IRKA 5J0QA 1LVHA 1ZRMA 2EDUA 2ZJ5A 4KMUA 4Q8EA 4R8UA 4JWNA 3NVYA 5KG6A 3HT3A 5BOLA 4F5QA 3Q8KA 4RQ3A 1X9WA 5JUMA 4CF3A 2NRWA 5DB8A 9ICTA 2NV3A 1FFUA 7ICIA 3V6KA 1WG8A 4DL7A 2DPIA 2K4EA 1X6IA 4CDGA 5AKGA 4R64A 5DB9A 5ALKA 2MRLA 5KFLA 4Y2RA 4Y2UA 3QNMA 1Q3VA 1WCLA 1NK6A 4UB6U 1KFTA 4RPYA 4KMOB 4MEXA 1YZ6A 4C7ZA 5AM3A 4O3SA 5AI5A 4EBEA 1XO0A 9ICKA 4OJOA 2XGQA 5KFAA 1QCKA 4DSEA 1QSSA 3UQ2A 2V4RA 5TISU 5DDYA 3WKBA 5H2FU 4TURA 3ZDBA 5AM1A 2W7OA 4TUQA 2LI6A 1N60A 2W43A 3VCBA 5CWRA 5ALGA 4C4RA 3CRXA 4UB8U 5ALRA 2VJ5A 4F4YA 1NI3A 3LVVA 4KX3A 4B9NA 3OPXA 4NWIA 2A1JB 3Q8PB 4K4GA 4P0QA 5KG3A 7ICGA 5KFWA 4P0PB 3OHBA 1JXLA 2HOQA 1ZQKA 4J9QA 2BCUA 2ES6A 3GDXA 3GV5B 4CCHA 8ICRA 4JMUA 7ICKA 4F91B 3KZIU 1ZQJA 4EX7A 1NZBA 1ZQDA 3PSIA 1TAQA 4QZIA 3IM1A 2QARB 4BDPA 3NRZA 1KTQA 4KLJA 2AQ0A 1ZXIA 4GC6A 2OWOA 1A0PA 2R8JA 1NJYA 1MA7A 2HW3A 2MSNA 4Y2JA 2EAPA 2JEGA 3FDSA 3Q8LA 4OJ6A 3AU2A 4KLTA 4Q8FA 3M8RA 4RU9A 3WK6A 1ZQVA 4HAIA 3FC4A 8ICSA 3RJIA 2GH1A 5ALQA 1ZQRA 7ICOA 2ODGA 2KVCA 4F5OA 4QZGA 5ALHA 1RYRA 2VIXA 4PHAA 1UQVA 3LDAA 1L3VA 4DO9A 1JMSA 2HCFA 1T8EA 4C4TA 3UXPA 3PW5A 4UAYA 2KSOA 1S5LU 4ED6A 4ECWA 4RPXA 4M9JA 4KLLA 1FFVA 2QLTA 4M9GA 1S0OA 5AKEA 5ALFA 3SAHA 4Y2XA 3ZDEA 4NXZA 7ICMA 3NVVA 2JV3A 1UHUA 2ZIXB 3B0YA 3PV8A 4B9UA 1JX4A 3A0HU 4RQ6A 5CJ7A 2AGOA 3RB3A 4UASA 8ICJA 4E0DA 5F9LA 1KFDA 5T14A 4J9MA 3K1RB 2AGPA 2GLEA 3CYMA 5DQIA 3B0XA 2OYYA 1PZNA 2QB0B 1NJZA 4PZOA 4QIWF 1D9DA 3EW9A 3RB6A 3PO5A 3OHAA 5AKZA 2BCQA 5CRXA 1Z00B 9ICOA 4QW9A 1DOQA 3V6HA 5KAFU 4F4XA 3UQ0A 4DQSA 2WF7A 2JGAA 4DSFA 1U9LA 3SAFA 4R65A 1SXDA 4FZNA 4UARA 2HHWA 3QEBZ 2LKYA 3MR5A 1JXEA 2Q4TA 3M9OB 1IXRA 4GC7A 3PW4A 4DQRA 4Z6FA 5AKXA 4F92B 5L1KA 2WHEA 5G5HA 1L8LA 1U49A 3GILA 4DQQA 2ZIWB 2BQRA 4O5CA 1RXWA 3ETLA 2KSOB 1JN3A 1XU4A 1H38A 1ZD2P 5ALYA 3JPSA 2PMZF 2VA3A 2DL0A 1ZQIA 4Q44A 4KLDA 4IR9A 4UAVA 2KHVA 2YMPA 3ZDCA 3QZ7A 2LYAA 5J29A 1VDVA 3RJKA 1DK3A 2F1HA 5AICA 1PK1B 1QSLA 5ALZA 4J9PA 3AM9A 4C4SA 2HHUA 4DSLA 9ICQA 3RH4A 8ICIA 1AQ6A 3QU2A 3T5KA 3NASA 3C23A 3PSPA 5JU5A 5KG7A 2M0NA 5AK6A 1BPZA 2IOHA 2OM6A 3RJJA 4BUGA 5EE9A 2W8LA 4CF4A 2R18A 4ECQA 3BQTA 1N61A 1OW5A 4RQ8A 4ED2A 1HJPA 2G09A 2Y1IA 1TK8A 4I2DA 3AN1A 4QZAA 3OJSA 4M0AA 3E2EA 2YB4A 1CEZA 4QZDA 4DF4A 5AKKA 3G6VA 2KIWA 3MGIA 1ZQOA 3H0LB 2BPGA 1UA0A 1SWWA 5CEHA 3RH5A 2MUTB 3UM9A 8ICOA 2ZXIA 2KJ5A 2DQNB 4KLHA 3MGVA 2KV2A 4M6WB 1L3SA 2E8MA 3PW2A 1L3TA 4UB4A 5KFZA 4FBUA 5KFPA 2MA1A 1FO4A 1IIPA 8ICTA 1J2NA 2WTFA 2W11A 1SXEA 2NO5A 5KNIA 1NZPA 4O5EA 5KL1B 1ZQBA 4DQPA 1B4FA 1X66A 3BS5B 2ASLA 1RXVA 4NM1A 4RNNA 2ATLA 2IMWP 3ZI4A 3JPNA 1MQ3A 5J2DA 2EH9A 3GIJA 4YXMA 3PX0A 2VKQA 2F77X 5KFGA 3AU6A 4DFMA 3ED5A 5KFXA 2IA6A 3T5HA 2ZJ8A 5BOMA 2W9BA 3M9MB 3T79A 1CI4A 1SKRA 4JK1A 3ZDAA 2Y0SF 4YXJA 5J0UA 5AIAA 2PFNA 3BQ7A 1TK0A 3AEVA 5IINA 2CPRA 5KT6A 4ZOHC 2YB1A 5AI6A 4USAA 3KKAA 1ZD4A 2JZBB 4RUAA 9ICSA 1BGXT 3LWLA 3ZDDA 3IHQB 1HUZA 1BPDA 5L1MA 1UT5A 9ICXA 2NRZA 5J0RA 5AM5A 2HOIA 3F2DA 3KHLA 2W3RA 4QIWC 5JTIA 2KICA 4YFKA 3E0FA 3UPQA 1NKCA 5KFVA 2YQEA 2F8LA 5KTQA 3KZXA 2YN4A 4QW8A 2ASJA 8ICEA 4QZHA 4JWMA 4JB3A 2RDJA 5DB6A 2ZIUB 4KX5A 2XY6A 3KTQA 5DG7A 3C2KA 2RP5A 3MR6A 2WFAA 2XY7A 1ZQLA 4JV1A 3B9JA 3SV4A 5KFQA 4DF8A 5J0WA 4EELA 4F3OA 4QWAA 5AM2A 1YT3A 3TAQA 4O3PA 3BZKA 2ALZA 3ICXA 4O0IA 3BJYA 3GZFA 4C0ZA 4O3OA 5KFMA 4EZ6A 3WK8A 4NLGA 2GWSA 4MHVA 3DEEA 2N1RA 4QZCA 1V9PA 3QZ8A 3H8JA 2UVWA 2JEJA 4BXOB 9ICNA 2XY5A 2LMRA 3N7PD 1LKYB 9ICCA 1ZOLA 2LYBA 2VANA 1U45A 1Z1BA 4I28A 3OGUA 2ZTEA 3D2QA 4O9MA 2KKVA 5IIJA 2A3VA 2A1JA 2W9BB 4ED7A 4NY8A 4P0PA 9ICJA 2YTUA 3GIKA 2V4QA 3UXNA 3KFUF 3PSTA 2W8KA 2BCVA 4CRXA 1UCVA 4KLEA 5KFJA 1B0XA 3NTUA 1ZQUA 2KKPA 3OJUA 4NLCA 8ICLA 2K4PA 4NL9A 2D8CA 3C21A 2VA2A 2ZIVB 2QARA 1ZQQA 2ISOA 2HBKA 1TK5A 2EAMA 4DL2A 4C8KA 2ZG6A 1K1SA 1NNLA 5J8YA 2BPFA 1ZQWA 1IG6A 2PI4A 1XO1A 4P4PA 1JALA 2WAQC 2FMSA 3F5EA 5HR7A 4IRDA 2BDUA 4PPXA 1X9MA 3OSNA 2ZUBA 2K8BB 5DDMA 3V6JA 3QE9Y 3WU2U 2B6GA 5AK4A 2H3ZA 3HKZF 5J2JA 2OH2A 2UVVA 2DUYA 5J2HA 3T5LA 2DWQA 2H3QA 5J0YA 3EZ5A 3V7JA 1WCNA 3BDPA 3F53A 4RQNA 4FS1A 5J2BA 2AXTU 9ICRA 2H3IA 2WF6A 3N4MB 1L8OA 1RYSA 1P7DA 2RRDA 4IRCA 2CN1A 4M2YA 2CXYA 4RUCA 4I27A 9ICVA 1RZTA 2LPEA 4YMOA 5KFTA 2PKEA 2BCSA 3QUQA 4US9A 2ZIXA 4XRHA 4NLBA 2B0CA 1KL9A 4YVZA 4ELUA 2JR5A 1NKEA 1DRGA 3TQ1A 4DS4A 1XWLA 1ZQMA 4KLMA 1COKA 8ICFA 4M9HA 4G3IA 5DGAA 4ED8A 2F1IA 4P4OA 5ALNA 4LJXA 3IN5A 5EE3A 2G5HB 3WK7A 4I2IA 5A0LA 3UMGA 4IQVA 4OJPA 8ICXA 4XA5A 2QB0A 4CGZA 4MEYA 2LM4A 4F5NA 2NO4A 3RRGA 3MR3A 3U26A 2K8CB 3QUBA 1BNPA 1ZQYA 1NKBA 2FMPA 3WK5A 5ALOA 1S0MA 1Z00A 1XS9D 2KFNA 9ICMA 4GXJA 1BNOA 1Z19A 1JI7A 3M6ZA 3RF9A 4O3NA 1F44A 2XI9A 4EEKA 4DL6A 5IIOA 4U7CA 3H8WA 1MSWD 1RQLA 3SZ2A 3NVZA 5C5JA 5KG2A 5ALIA 5D49A 4OO1J 1Y88A 1O08A 2HMXA 4C8NA 3RJHA 4RZRA 2WB1F 7ICRA 3Q8QB 2ZIWA 3L4PA 4LZDA 4ED3A 4DOAA 4DSIA 1JUDA 4PH5A 4YMNA 3JPQA 2HBLA 1D8BA 5J0XA 4NJ8A 4F93B 5DGBA 1QSYA 5DQHA 7ICLA 4RQ0A 4UQGA 5L1LA 5AM4A 4NLKA 7ICEA 2G0AA 1PK1A 4C8LA 4I2JA 4ICAA 3IG5A 4KN4A 3N97B 1DGSA 3MFHA 3TKAA 3H8MA 5IIIA 4RQ5A 2ZTCA 4YR3A 2FE9A 5D4BA 1S76D 1SL0A 1RQNA 4EX6A 3H40A 3EYZA 2AGQA 3HW8A 2BZFA 4PHPA 2XIDA 5HHIA 3D2NA 1KKXA 4PHEA 4DL4A 2KG5A 3MDAA 5IIKA 4QWDA 2FI1A 5KFCA 2ZTDA 3RFAA 3V7KA 2KN7A 2UVUA 3TANA 3N7RC 3FM9A 2IHNA 3MDCA 4IQWA 3AUOA 4RQ2A 7ICNA 5F9NA 1T3NA 2J6SA 2HBJA 4QZBA 5ALLA 5J0OA 5J0TA 2HHXA 2MUTA 2OEHA 3F5AA 4BWJA 4QJFB 4NM2A 1ZQSA 3I28A 1QQ6A 4M6WA 9ICHA 4YD2A 4RNOA 5KFYA 2J6UA 2YMQA 3TFSA 3QEAZ 1RM6C 3QU9A 3KOOA 3HKZC 3UXOA 1O03A 3BS5A 1XSPA 3NVWA 1QQ7A 2ZJAA 1NK7A 5AHXA 3EWAA 4UB3A 3ONNA 4FZLA 3CNHA 8ICBA 4FO6A 3G6XA 1N48A 4BWMA 2A19A 5AK5A 2AHOB 3E58A 5TZVA 2DKZA 1V38A 3LWMA 2XO7A 5KFOA 2Y1JA 2AH5A 5EWEA 1CUKA 4Y2PA 4UAZA 2W04A 2HSZA 3SMVA 4RT2A 2IOFA 4DSJA 4K4HA 1N5WA 1SKSA 4ELVA 4C8OA 2JZBA 2LBOA 1Z1VA 2M9NA 5EE0A 2JRZA 5KG0A 3PNCA 4FFDA 2OXOA 3MR2A 1NK5A 3THVA 9ICGA 2EQYA 7ICVA 1RG6A 2BGWA 1C20A 3SYZA 3WK4A 2G06A 4I2HA 3SEIA 3GV7B 4EYIB 4IS7A 4QNLA 3N7SC 4PJ0U 3NRWA 3AQFA 2ZIUA 3RB4A 1WWVA 3IRUA 2H3FA 2Y9TA 1N63A 1PUZA 2YMMA 1S0NA 8ICNA 4RQ4A 4ED1A 2FPKA 5AIBA 4UBCA 1L7NA 3M8SA 1ZQGA 5DG9A 5JRTA 5CB1A 5DQGA 4RPZA 3KKAC 3PX6A 2E1FA 5ALTA 2W9MA 4UB5A 1A76A 5ALXA 4DL5A 1X9SA 3RRHA 3FYHA 2WB1C 4FS2A 4I29A 4PGXA 1SV0A 2H3VA 5BPCA 4EBDA 2FLLA 2IHMA 1SV4A 2RLTA 4TQSA 5KFKA 4BXOA 3V72A 2J6TA 2W03A 3HPOA 1S9FA 1LKYA 3SENA 4KLGA 1ZJNA 2ZUCA 2FLNA 8ICMA 1SZHA 4KITB 1BPEA 1A77A 5J2GA 1TV9A 2BQUA 3LVWA 4J9NA 2W9CB 1Q3UA 5AI8A 2PFQA 5DKWA 3QYPA 2Q0ZX 3PY8A 2PFPA 2KNJA 2W7PA 1X9XA 7ICFA 1ZQPA 2H5XA 3RJGA 4CF5A 2KIVA 2KJ8A 2BHNA 1XNSA 3RB0A 1S77D 3CW2C 1N5XA 2ZIVA 4MFCA 1UPHA 3GV8B 2WF8A 8ICYA 4Z6EA 2W9AA 4X5VA 2EZXA 2K60A 1YZ7A 1K5OA 1KSPA 5ALJA 3PSFA 3Q8MA 5ALSA 3IDWA 2LYHA 1Z4NA 3R9KA 3QU4A 4PL1A 3KHRA 4BX9C 3QU7A 4IL6U 1KQQA 5L1IA 4J9LA 2DBYA 3PVXA 3WK9A 8ICZA 5D46A 1FEZA 5AI9A 7ICPA 4O3MA 5KT4A 3HX0A 3K4GA 4Y2TA 4M04A 4UAWA 2BPCA 4DS5A 1L7PA 1J97A 3BS7A 2I1QA 4B9VA 2D6FC 5CA7A 4YR2A 4Y2VA 1ZQHA 4IC9A 2LHTA 2GO7A 1SL1A 2I9GA 3NS1A 4C8MA 1V85A 3SI8A 3I1YA 3I76A 2FPMA 4NL9C 1TAMA 3H4DA 4NV0A 4TUSA 5KFDA 1KW4A 3TI0A 2ASDA 5J0SA 1K1QA 1VLBA 1VJ5A 4F5PA 5GTIU 5J8YC 5B5EU 2F2AB 1DK2A 2K8AA 2PMZC 9ICEA 4JUZA 1C7YA 2EZYA 3RAXA 5AKJA 3H0RB 1NK9A 3H0MB 4GIBA 2AQ4A 2P6UA 1NK8A 4RNMA 1Z3EB 4C7YA 2KEYA 3MABA 4B9LA 4ACOA 2ZUDA 3SR6A 3L3FX 3TAPA 4EZ9A 2JXJA 4DOCA 4KLOA 5CP2A 2HVHA 4FZMA 3RTVA 3OTQA 5F3XB 4WJ3B 2R8KA 3GIIA 2I6XA 1ECWA 1EXNA 1PVPA 5AM0A 1X6JA 1T94A 5EWGA 1L7MA 4K4IA 3QXGA 5ALPA 3UMBA 5KT5A 2KE7A 3RBEA 3HWTA 3IV6A 4F71A 2YX8A 3ZD9A 5ALEA 3CP8A 1N56A 4MF2A 3EUB2 3C2MA 3TACB 3NGDA 4TUPA 1U47A 3C29A 2BCRA 1BPXA 2JH7A 3D6JA 3H7IA 4GXKA 4QZ8A 3PMLA 9ICLA 2R8GA 2AJQA 1KN5A 1F0MA 2DPJA 4DFKA 2KJ9A 2HVIA 2YY6A 3DV9A 4NLNA 2KTQA 4B9SA 1WWUA 2HDOA 3MC1A 5DG8A 4ED0A 8ICCA 3MBYA 1KFSA 3ISDA 5HP4A 4QWCA 3JPRA 4KN7A 4FBTA 3C5GA 3RJFA 2MAXA 2W54A 3TADA 2VJ4A 2A1AA 3M1YA 1HUOA 3SQIA 2BQ3A 4Q45A 2KHQA 1OUQA 4B9MA 4YN4A 3VC8A 3C28A 2DF4B 4J9KA 4MFAA 4YQWA 4BJQA 2IBKA 4B9TA 1M6YA 9ICFA 5K4LA 3PMNA 4KLUA 2K4IA 2JMGA 2E8NA 1TKDA 4AYBF 2KZMA 5AKLA 1WYGA 3NUQA 1DGJA 3PW0A 1S0VA 4R63A 2Y0SC 8ICKA 4U6PA 3PZPA 2XCAA 2E8PA 4KLQA 5DLGA 4UW9A 2HBMA 4DQIA 4O5KA 1XSNA 4EYHB 3H8SA 2KMDA 4YP3A 3HILA 4P4MA 5KFFA 2NRTA 2OHFA 3QX7A 1NJXA 2NRVA 2HHTA 1D9FA 5AI4A 4ECUA 3OSPA 2B21A 3ISBA 1MN8A 4RQ1A 4DCCA 3GIMA 4ECVA 5B66U 1D8LA 1HEKA 3RJEA 1ZJMA 2W55A 8ICQA 2KZ3A 1U4BA 4O3RA 3ZD8A 2VA8A 3M7DA 3WKCA 3QUCA 5HMMA 4YR0A 4R8UB 2NYVA 5J2EA 4M47A 5AKHA 2C22A 2XC9A 1ZQFA 5KG1A 5AKIA 4I2BA 7ICUA 4RQMA 4CE6A 2IOFK 1SZPA 2C28A 3A0BU 4PGYA 5KT2A 2RDIA 4TQRA 3RR8A 3N28A 2JHDA 3AMZA 1JROA 4DFPA 3O0FA 3PO4A 4ECYA 5KFBA 4G9BA 5J2FA 4BGDA 1X40A 4KLSA 3JPPA 4XUSA 4I2CA 2OCEA 4AP9A 4OJ5A 1UT8A 4KTQA 8ICPA 4DLGA 4UB1A 3ORYA 2QB1A 4DFJA 7ICSA 2JEIA 2G08A 3BZCA 5KAIU 2FLPA 2PFOA 9ICPA 2KVSA 1TFRA 4EEYA 4JV0A 2F1JA 1FIQA 4QWEA 4LVSA 2LM1A 2E3TA 3BQ1A 3PW7A 3Q8RB 2F3NA 3IP4B 4P0QB 5EOZA 5C0YA 3T5JA 1MC8A 2JEFA 2FJ6A 1KLNA 1COOA
chains in the Genus database with same CATH topology
1KN5A 2EH9A 2JRZA 2OEHA 2YQEA 2JXJA 2CXYA 4LJXA 2LM1A 5CEHA 1KKXA 2EQYA 2KK0A 1KQQA 1IG6A 1C20A 2RQ5A 1RYUA 5K4LA 2LI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KN5 A;  2EH9 A;  2JRZ A;  2OEH A;  2YQE A;  2JXJ A;  2CXY A;  4LJX A;  2LM1 A;  5CEH A;  1KKX A;  2EQY A;  2KK0 A;  1KQQ A;  1IG6 A;  1C20 A;  2RQ5 A;  1RYU A;  5K4L A;  2LI6 A; 
#chains in the Genus database with same CATH topology
 4DL3 A;  1KBU A;  4Z6C A;  2HHQ A;  3G6Y A;  2BDP A;  3RBD A;  2P6R A;  2NRX A;  5E79 U;  3DDH A;  8ICG A;  2K89 A;  3FAH A;  3QU5 A;  3HRD D;  5ALV A;  4LZG A;  1F5S A;  3PR4 A;  4PL2 A;  2Z7J A;  2HHS A;  5HNK A;  2F8K A;  4DFD A;  1ZQA A;  5AI0 A;  2KZZ A;  8ICW A;  1B43 A;  7ICJ A;  5KFI A;  4ZH4 A;  1TVA A;  5DBC A;  3SAG A;  4UAU A;  3MGH A;  1PVQ A;  3KBB A;  5ALD A;  4Y2Y A;  1X42 A;  1Z4O A;  5EE1 A;  5DBB A;  3KHH A;  3EPG A;  4I2A A;  1ZQ1 C;  5KG4 A;  4M9N A;  4EEN A;  3LYS A;  4GLX A;  5ALU A;  1ZQN A;  2KFZ A;  5KL8 B;  2DFL A;  5L9X A;  1ZQT A;  3BQ0 A;  2F76 X;  3TFR A;  5DBA A;  4ECZ A;  8ICH A;  2E8O A;  4IQU A;  1JIH A;  5KFN A;  2FMQ A;  1D8Y A;  3KHG A;  3GFK B;  4B6J A;  4UBB A;  1ED1 A;  3WKE A;  5ALM A;  2XIC A;  3KD3 A;  4F72 A;  2YML A;  2EAO A;  4AYB C;  2W9C A;  1QH9 A;  1BPY A;  2ZXH A;  4DSK A;  4J9R A;  4RQ7 A;  1T4G A;  5CHG A;  2GOL A;  4OD0 A;  5KG5 A;  4KLI A;  9ICU A;  4F4Z A;  1SKW A;  4GFJ A;  3GU3 A;  2Y9U A;  1QLN A;  2XVT A;  1SIJ A;  3PR5 B;  4MF8 A;  4YMM A;  4Y2S A;  2C2R A;  1SV0 C;  5DLF A;  3GQC A;  9ICB A;  5DB7 A;  4F50 A;  2EAN A;  1DXS A;  1SWV A;  3AQE A;  4PZN A;  5IIM A;  4ELT A;  5HML A;  3Q8S B;  4I2F A;  4ECS A;  1V97 A;  3HJE A;  1ZET A;  4RT3 A;  3RR7 A;  4A8E A;  4QWB A;  3M9N B;  2XGP A;  2JH1 A;  2R8I A;  4C80 A;  7ICQ A;  1SB3 C;  2KK0 A;  2WF5 A;  4KLF A;  1NJW A;  5KFE A;  1S8O A;  8ICA A;  2P66 A;  2DKX A;  2W3S A;  1URJ A;  3K1Z A;  3HP6 A;  1KDH A;  4M9L A;  3BQ2 A;  2WAQ F;  1ZD5 A;  4DOB A;  1ZQC A;  4UB2 A;  1HIW A;  4GXI A;  4O3Q A;  3UMC A;  3IG8 A;  2G07 A;  1RDF A;  2E5S A;  3PX4 A;  4P2H A;  3RH6 A;  5KFU A;  4ECT A;  3ALR A;  2P35 A;  7ICH A;  3WKA A;  2AU0 A;  3C1Z A;  1A6S A;  7ICT A;  3J81 j;  4DWI A;  3SD7 A;  1LV5 A;  2ISP A;  4QZF A;  1JRP A;  2V9W A;  5AKY A;  4US8 A;  5HHH A;  3F2B A;  1X2I A;  4PGQ A;  2R8H A;  4OJL A;  4I2E A;  4OCZ A;  1CRX A;  3QUT A;  2K4H A;  1L3U A;  1U48 A;  5G5G A;  2KOB A;  2QKQ A;  1J2M A;  3WKD A;  1RPL A;  1NK0 A;  3L5K A;  4ECR A;  5AK3 A;  5CR0 A;  2EZZ A;  4Z6D A;  1QTM A;  1N2X A;  2XCP A;  2O6K A;  4F4W A;  4YD1 A;  4DEZ A;  2MU2 A;  1QQ5 A;  4UAT A;  1ZQE A;  3AL0 B;  4XQ8 A;  1ZRN A;  1ZD3 A;  2G5I B;  1MQ2 A;  4NLZ A;  1ZQZ A;  1KRP A;  3SV3 A;  3TAR A;  2F44 A;  4F5R A;  2C2D A;  1TE2 A;  3D2S A;  1ZYQ A;  5J0P A;  3C2L A;  4JV2 A;  4IR1 A;  3MFI A;  3C1Y A;  2WF9 A;  4J03 A;  3ETR A;  4HYK A;  5HR6 A;  5KT3 A;  4YCX A;  5KFH A;  2BR0 A;  4F8R A;  9ICI A;  1LB2 B;  1SL2 A;  3K75 D;  3JPO A;  2UVR A;  1S97 A;  1XC9 A;  1SGG A;  2C2E A;  1B22 A;  1N62 A;  1OXJ A;  1PK3 A;  3LK9 A;  5J2I A;  4ECX A;  1Q8K A;  2KP7 A;  3M6K A;  1L6N A;  5KFR A;  5J2K A;  8ICV A;  1T7P A;  5FP0 A;  4PHD A;  1L5U A;  4CNQ A;  9ICW A;  2D3D A;  5IIL A;  1Q46 A;  4F2R A;  5ALW A;  3JPT A;  2KD1 A;  1ZQX A;  5J2C A;  2RQ5 A;  1RYU A;  4QZE A;  1TAU A;  1T3Q A;  1XSL A;  4QZ9 A;  4F2S A;  2PXI A;  1GO3 F;  2HOF A;  5KFS A;  4I2G A;  4DLE A;  1BPB A;  2FDR A;  1PVR A;  1WUD A;  4IQT A;  3S6J A;  2ESE A;  4F4K A;  5L1J A;  1NOM A;  1ARO P;  1IV8 A;  4FE3 A;  5J2A A;  2BKE A;  2HHV A;  2L5Y A;  3TAD C;  1BVS A;  1NK4 A;  3H4B A;  4YG2 A;  4MFF A;  2E1E A;  2PI5 A;  9ICA A;  1S10 A;  3RAQ A;  3T3F A;  1KEJ A;  3V7L A;  4J9S A;  1L7O A;  4R66 A;  3ISC A;  4Y2Q A;  8ICU A;  4J9O A;  5GTH U;  4Q43 A;  3F2C A;  1IM4 A;  5EWF A;  2DGZ A;  1UA1 A;  2I5H A;  4EBC A;  3C5F A;  2CRX A;  5KT7 A;  2HI0 A;  2RHF A;  3EPI A;  2FPL A;  4IRK A;  5J0Q A;  1LVH A;  1ZRM A;  2EDU A;  2ZJ5 A;  4KMU A;  4Q8E A;  4R8U A;  4JWN A;  3NVY A;  5KG6 A;  3HT3 A;  5BOL A;  4F5Q A;  3Q8K A;  4RQ3 A;  1X9W A;  5JUM A;  4CF3 A;  2NRW A;  5DB8 A;  9ICT A;  2NV3 A;  1FFU A;  7ICI A;  3V6K A;  1WG8 A;  4DL7 A;  2DPI A;  2K4E A;  1X6I A;  4CDG A;  5AKG A;  4R64 A;  5DB9 A;  5ALK A;  2MRL A;  5KFL A;  4Y2R A;  4Y2U A;  3QNM A;  1Q3V A;  1WCL A;  1NK6 A;  4UB6 U;  1KFT A;  4RPY A;  4KMO B;  4MEX A;  1YZ6 A;  4C7Z A;  5AM3 A;  4O3S A;  5AI5 A;  4EBE A;  1XO0 A;  9ICK A;  4OJO A;  2XGQ A;  5KFA A;  1QCK A;  4DSE A;  1QSS A;  3UQ2 A;  2V4R A;  5TIS U;  5DDY A;  3WKB A;  5H2F U;  4TUR A;  3ZDB A;  5AM1 A;  2W7O A;  4TUQ A;  2LI6 A;  1N60 A;  2W43 A;  3VCB A;  5CWR A;  5ALG A;  4C4R A;  3CRX A;  4UB8 U;  5ALR A;  2VJ5 A;  4F4Y A;  1NI3 A;  3LVV A;  4KX3 A;  4B9N A;  3OPX A;  4NWI A;  2A1J B;  3Q8P B;  4K4G A;  4P0Q A;  5KG3 A;  7ICG A;  5KFW A;  4P0P B;  3OHB A;  1JXL A;  2HOQ A;  1ZQK A;  4J9Q A;  2BCU A;  2ES6 A;  3GDX A;  3GV5 B;  4CCH A;  8ICR A;  4JMU A;  7ICK A;  4F91 B;  3KZI U;  1ZQJ A;  4EX7 A;  1NZB A;  1ZQD A;  3PSI A;  1TAQ A;  4QZI A;  3IM1 A;  2QAR B;  4BDP A;  3NRZ A;  1KTQ A;  4KLJ A;  2AQ0 A;  1ZXI A;  4GC6 A;  2OWO A;  1A0P A;  2R8J A;  1NJY A;  1MA7 A;  2HW3 A;  2MSN A;  4Y2J A;  2EAP A;  2JEG A;  3FDS A;  3Q8L A;  4OJ6 A;  3AU2 A;  4KLT A;  4Q8F A;  3M8R A;  4RU9 A;  3WK6 A;  1ZQV A;  4HAI A;  3FC4 A;  8ICS A;  3RJI A;  2GH1 A;  5ALQ A;  1ZQR A;  7ICO A;  2ODG A;  2KVC A;  4F5O A;  4QZG A;  5ALH A;  1RYR A;  2VIX A;  4PHA A;  1UQV A;  3LDA A;  1L3V A;  4DO9 A;  1JMS A;  2HCF A;  1T8E A;  4C4T A;  3UXP A;  3PW5 A;  4UAY A;  2KSO A;  1S5L U;  4ED6 A;  4ECW A;  4RPX A;  4M9J A;  4KLL A;  1FFV A;  2QLT A;  4M9G A;  1S0O A;  5AKE A;  5ALF A;  3SAH A;  4Y2X A;  3ZDE A;  4NXZ A;  7ICM A;  3NVV A;  2JV3 A;  1UHU A;  2ZIX B;  3B0Y A;  3PV8 A;  4B9U A;  1JX4 A;  3A0H U;  4RQ6 A;  5CJ7 A;  2AGO A;  3RB3 A;  4UAS A;  8ICJ A;  4E0D A;  5F9L A;  1KFD A;  5T14 A;  4J9M A;  3K1R B;  2AGP A;  2GLE A;  3CYM A;  5DQI A;  3B0X A;  2OYY A;  1PZN A;  2QB0 B;  1NJZ A;  4PZO A;  4QIW F;  1D9D A;  3EW9 A;  3RB6 A;  3PO5 A;  3OHA A;  5AKZ A;  2BCQ A;  5CRX A;  1Z00 B;  9ICO A;  4QW9 A;  1DOQ A;  3V6H A;  5KAF U;  4F4X A;  3UQ0 A;  4DQS A;  2WF7 A;  2JGA A;  4DSF A;  1U9L A;  3SAF A;  4R65 A;  1SXD A;  4FZN A;  4UAR A;  2HHW A;  3QEB Z;  2LKY A;  3MR5 A;  1JXE A;  2Q4T A;  3M9O B;  1IXR A;  4GC7 A;  3PW4 A;  4DQR A;  4Z6F A;  5AKX A;  4F92 B;  5L1K A;  2WHE A;  5G5H A;  1L8L A;  1U49 A;  3GIL A;  4DQQ A;  2ZIW B;  2BQR A;  4O5C A;  1RXW A;  3ETL A;  2KSO B;  1JN3 A;  1XU4 A;  1H38 A;  1ZD2 P;  5ALY A;  3JPS A;  2PMZ F;  2VA3 A;  2DL0 A;  1ZQI A;  4Q44 A;  4KLD A;  4IR9 A;  4UAV A;  2KHV A;  2YMP A;  3ZDC A;  3QZ7 A;  2LYA A;  5J29 A;  1VDV A;  3RJK A;  1DK3 A;  2F1H A;  5AIC A;  1PK1 B;  1QSL A;  5ALZ A;  4J9P A;  3AM9 A;  4C4S A;  2HHU A;  4DSL A;  9ICQ A;  3RH4 A;  8ICI A;  1AQ6 A;  3QU2 A;  3T5K A;  3NAS A;  3C23 A;  3PSP A;  5JU5 A;  5KG7 A;  2M0N A;  5AK6 A;  1BPZ A;  2IOH A;  2OM6 A;  3RJJ A;  4BUG A;  5EE9 A;  2W8L A;  4CF4 A;  2R18 A;  4ECQ A;  3BQT A;  1N61 A;  1OW5 A;  4RQ8 A;  4ED2 A;  1HJP A;  2G09 A;  2Y1I A;  1TK8 A;  4I2D A;  3AN1 A;  4QZA A;  3OJS A;  4M0A A;  3E2E A;  2YB4 A;  1CEZ A;  4QZD A;  4DF4 A;  5AKK A;  3G6V A;  2KIW A;  3MGI A;  1ZQO A;  3H0L B;  2BPG A;  1UA0 A;  1SWW A;  5CEH A;  3RH5 A;  2MUT B;  3UM9 A;  8ICO A;  2ZXI A;  2KJ5 A;  2DQN B;  4KLH A;  3MGV A;  2KV2 A;  4M6W B;  1L3S A;  2E8M A;  3PW2 A;  1L3T A;  4UB4 A;  5KFZ A;  4FBU A;  5KFP A;  2MA1 A;  1FO4 A;  1IIP A;  8ICT A;  1J2N A;  2WTF A;  2W11 A;  1SXE A;  2NO5 A;  5KNI A;  1NZP A;  4O5E A;  5KL1 B;  1ZQB A;  4DQP A;  1B4F A;  1X66 A;  3BS5 B;  2ASL A;  1RXV A;  4NM1 A;  4RNN A;  2ATL A;  2IMW P;  3ZI4 A;  3JPN A;  1MQ3 A;  5J2D A;  2EH9 A;  3GIJ A;  4YXM A;  3PX0 A;  2VKQ A;  2F77 X;  5KFG A;  3AU6 A;  4DFM A;  3ED5 A;  5KFX A;  2IA6 A;  3T5H A;  2ZJ8 A;  5BOM A;  2W9B A;  3M9M B;  3T79 A;  1CI4 A;  1SKR A;  4JK1 A;  3ZDA A;  2Y0S F;  4YXJ A;  5J0U A;  5AIA A;  2PFN A;  3BQ7 A;  1TK0 A;  3AEV A;  5IIN A;  2CPR A;  5KT6 A;  4ZOH C;  2YB1 A;  5AI6 A;  4USA A;  3KKA A;  1ZD4 A;  2JZB B;  4RUA A;  9ICS A;  1BGX T;  3LWL A;  3ZDD A;  3IHQ B;  1HUZ A;  1BPD A;  5L1M A;  1UT5 A;  9ICX A;  2NRZ A;  5J0R A;  5AM5 A;  2HOI A;  3F2D A;  3KHL A;  2W3R A;  4QIW C;  5JTI A;  2KIC A;  4YFK A;  3E0F A;  3UPQ A;  1NKC A;  5KFV A;  2YQE A;  2F8L A;  5KTQ A;  3KZX A;  2YN4 A;  4QW8 A;  2ASJ A;  8ICE A;  4QZH A;  4JWM A;  4JB3 A;  2RDJ A;  5DB6 A;  2ZIU B;  4KX5 A;  2XY6 A;  3KTQ A;  5DG7 A;  3C2K A;  2RP5 A;  3MR6 A;  2WFA A;  2XY7 A;  1ZQL A;  4JV1 A;  3B9J A;  3SV4 A;  5KFQ A;  4DF8 A;  5J0W A;  4EEL A;  4F3O A;  4QWA A;  5AM2 A;  1YT3 A;  3TAQ A;  4O3P A;  3BZK A;  2ALZ A;  3ICX A;  4O0I A;  3BJY A;  3GZF A;  4C0Z A;  4O3O A;  5KFM A;  4EZ6 A;  3WK8 A;  4NLG A;  2GWS A;  4MHV A;  3DEE A;  2N1R A;  4QZC A;  1V9P A;  3QZ8 A;  3H8J A;  2UVW A;  2JEJ A;  4BXO B;  9ICN A;  2XY5 A;  2LMR A;  3N7P D;  1LKY B;  9ICC A;  1ZOL A;  2LYB A;  2VAN A;  1U45 A;  1Z1B A;  4I28 A;  3OGU A;  2ZTE A;  3D2Q A;  4O9M A;  2KKV A;  5IIJ A;  2A3V A;  2A1J A;  2W9B B;  4ED7 A;  4NY8 A;  4P0P A;  9ICJ A;  2YTU A;  3GIK A;  2V4Q A;  3UXN A;  3KFU F;  3PST A;  2W8K A;  2BCV A;  4CRX A;  1UCV A;  4KLE A;  5KFJ A;  1B0X A;  3NTU A;  1ZQU A;  2KKP A;  3OJU A;  4NLC A;  8ICL A;  2K4P A;  4NL9 A;  2D8C A;  3C21 A;  2VA2 A;  2ZIV B;  2QAR A;  1ZQQ A;  2ISO A;  2HBK A;  1TK5 A;  2EAM A;  4DL2 A;  4C8K A;  2ZG6 A;  1K1S A;  1NNL A;  5J8Y A;  2BPF A;  1ZQW A;  1IG6 A;  2PI4 A;  1XO1 A;  4P4P A;  1JAL A;  2WAQ C;  2FMS A;  3F5E A;  5HR7 A;  4IRD A;  2BDU A;  4PPX A;  1X9M A;  3OSN A;  2ZUB A;  2K8B B;  5DDM A;  3V6J A;  3QE9 Y;  3WU2 U;  2B6G A;  5AK4 A;  2H3Z A;  3HKZ F;  5J2J A;  2OH2 A;  2UVV A;  2DUY A;  5J2H A;  3T5L A;  2DWQ A;  2H3Q A;  5J0Y A;  3EZ5 A;  3V7J A;  1WCN A;  3BDP A;  3F53 A;  4RQN A;  4FS1 A;  5J2B A;  2AXT U;  9ICR A;  2H3I A;  2WF6 A;  3N4M B;  1L8O A;  1RYS A;  1P7D A;  2RRD A;  4IRC A;  2CN1 A;  4M2Y A;  2CXY A;  4RUC A;  4I27 A;  9ICV A;  1RZT A;  2LPE A;  4YMO A;  5KFT A;  2PKE A;  2BCS A;  3QUQ A;  4US9 A;  2ZIX A;  4XRH A;  4NLB A;  2B0C A;  1KL9 A;  4YVZ A;  4ELU A;  2JR5 A;  1NKE A;  1DRG A;  3TQ1 A;  4DS4 A;  1XWL A;  1ZQM A;  4KLM A;  1COK A;  8ICF A;  4M9H A;  4G3I A;  5DGA A;  4ED8 A;  2F1I A;  4P4O A;  5ALN A;  4LJX A;  3IN5 A;  5EE3 A;  2G5H B;  3WK7 A;  4I2I A;  5A0L A;  3UMG A;  4IQV A;  4OJP A;  8ICX A;  4XA5 A;  2QB0 A;  4CGZ A;  4MEY A;  2LM4 A;  4F5N A;  2NO4 A;  3RRG A;  3MR3 A;  3U26 A;  2K8C B;  3QUB A;  1BNP A;  1ZQY A;  1NKB A;  2FMP A;  3WK5 A;  5ALO A;  1S0M A;  1Z00 A;  1XS9 D;  2KFN A;  9ICM A;  4GXJ A;  1BNO A;  1Z19 A;  1JI7 A;  3M6Z A;  3RF9 A;  4O3N A;  1F44 A;  2XI9 A;  4EEK A;  4DL6 A;  5IIO A;  4U7C A;  3H8W A;  1MSW D;  1RQL A;  3SZ2 A;  3NVZ A;  5C5J A;  5KG2 A;  5ALI A;  5D49 A;  4OO1 J;  1Y88 A;  1O08 A;  2HMX A;  4C8N A;  3RJH A;  4RZR A;  2WB1 F;  7ICR A;  3Q8Q B;  2ZIW A;  3L4P A;  4LZD A;  4ED3 A;  4DOA A;  4DSI A;  1JUD A;  4PH5 A;  4YMN A;  3JPQ A;  2HBL A;  1D8B A;  5J0X A;  4NJ8 A;  4F93 B;  5DGB A;  1QSY A;  5DQH A;  7ICL A;  4RQ0 A;  4UQG A;  5L1L A;  5AM4 A;  4NLK A;  7ICE A;  2G0A A;  1PK1 A;  4C8L A;  4I2J A;  4ICA A;  3IG5 A;  4KN4 A;  3N97 B;  1DGS A;  3MFH A;  3TKA A;  3H8M A;  5III A;  4RQ5 A;  2ZTC A;  4YR3 A;  2FE9 A;  5D4B A;  1S76 D;  1SL0 A;  1RQN A;  4EX6 A;  3H40 A;  3EYZ A;  2AGQ A;  3HW8 A;  2BZF A;  4PHP A;  2XID A;  5HHI A;  3D2N A;  1KKX A;  4PHE A;  4DL4 A;  2KG5 A;  3MDA A;  5IIK A;  4QWD A;  2FI1 A;  5KFC A;  2ZTD A;  3RFA A;  3V7K A;  2KN7 A;  2UVU A;  3TAN A;  3N7R C;  3FM9 A;  2IHN A;  3MDC A;  4IQW A;  3AUO A;  4RQ2 A;  7ICN A;  5F9N A;  1T3N A;  2J6S A;  2HBJ A;  4QZB A;  5ALL A;  5J0O A;  5J0T A;  2HHX A;  2MUT A;  2OEH A;  3F5A A;  4BWJ A;  4QJF B;  4NM2 A;  1ZQS A;  3I28 A;  1QQ6 A;  4M6W A;  9ICH A;  4YD2 A;  4RNO A;  5KFY A;  2J6U A;  2YMQ A;  3TFS A;  3QEA Z;  1RM6 C;  3QU9 A;  3KOO A;  3HKZ C;  3UXO A;  1O03 A;  3BS5 A;  1XSP A;  3NVW A;  1QQ7 A;  2ZJA A;  1NK7 A;  5AHX A;  3EWA A;  4UB3 A;  3ONN A;  4FZL A;  3CNH A;  8ICB A;  4FO6 A;  3G6X A;  1N48 A;  4BWM A;  2A19 A;  5AK5 A;  2AHO B;  3E58 A;  5TZV A;  2DKZ A;  1V38 A;  3LWM A;  2XO7 A;  5KFO A;  2Y1J A;  2AH5 A;  5EWE A;  1CUK A;  4Y2P A;  4UAZ A;  2W04 A;  2HSZ A;  3SMV A;  4RT2 A;  2IOF A;  4DSJ A;  4K4H A;  1N5W A;  1SKS A;  4ELV A;  4C8O A;  2JZB A;  2LBO A;  1Z1V A;  2M9N A;  5EE0 A;  2JRZ A;  5KG0 A;  3PNC A;  4FFD A;  2OXO A;  3MR2 A;  1NK5 A;  3THV A;  9ICG A;  2EQY A;  7ICV A;  1RG6 A;  2BGW A;  1C20 A;  3SYZ A;  3WK4 A;  2G06 A;  4I2H A;  3SEI A;  3GV7 B;  4EYI B;  4IS7 A;  4QNL A;  3N7S C;  4PJ0 U;  3NRW A;  3AQF A;  2ZIU A;  3RB4 A;  1WWV A;  3IRU A;  2H3F A;  2Y9T A;  1N63 A;  1PUZ A;  2YMM A;  1S0N A;  8ICN A;  4RQ4 A;  4ED1 A;  2FPK A;  5AIB A;  4UBC A;  1L7N A;  3M8S A;  1ZQG A;  5DG9 A;  5JRT A;  5CB1 A;  5DQG A;  4RPZ A;  3KKA C;  3PX6 A;  2E1F A;  5ALT A;  2W9M A;  4UB5 A;  1A76 A;  5ALX A;  4DL5 A;  1X9S A;  3RRH A;  3FYH A;  2WB1 C;  4FS2 A;  4I29 A;  4PGX A;  1SV0 A;  2H3V A;  5BPC A;  4EBD A;  2FLL A;  2IHM A;  1SV4 A;  2RLT A;  4TQS A;  5KFK A;  4BXO A;  3V72 A;  2J6T A;  2W03 A;  3HPO A;  1S9F A;  1LKY A;  3SEN A;  4KLG A;  1ZJN A;  2ZUC A;  2FLN A;  8ICM A;  1SZH A;  4KIT B;  1BPE A;  1A77 A;  5J2G A;  1TV9 A;  2BQU A;  3LVW A;  4J9N A;  2W9C B;  1Q3U A;  5AI8 A;  2PFQ A;  5DKW A;  3QYP A;  2Q0Z X;  3PY8 A;  2PFP A;  2KNJ A;  2W7P A;  1X9X A;  7ICF A;  1ZQP A;  2H5X A;  3RJG A;  4CF5 A;  2KIV A;  2KJ8 A;  2BHN A;  1XNS A;  3RB0 A;  1S77 D;  3CW2 C;  1N5X A;  2ZIV A;  4MFC A;  1UPH A;  3GV8 B;  2WF8 A;  8ICY A;  4Z6E A;  2W9A A;  4X5V A;  2EZX A;  2K60 A;  1YZ7 A;  1K5O A;  1KSP A;  5ALJ A;  3PSF A;  3Q8M A;  5ALS A;  3IDW A;  2LYH A;  1Z4N A;  3R9K A;  3QU4 A;  4PL1 A;  3KHR A;  4BX9 C;  3QU7 A;  4IL6 U;  1KQQ A;  5L1I A;  4J9L A;  2DBY A;  3PVX A;  3WK9 A;  8ICZ A;  5D46 A;  1FEZ A;  5AI9 A;  7ICP A;  4O3M A;  5KT4 A;  3HX0 A;  3K4G A;  4Y2T A;  4M04 A;  4UAW A;  2BPC A;  4DS5 A;  1L7P A;  1J97 A;  3BS7 A;  2I1Q A;  4B9V A;  2D6F C;  5CA7 A;  4YR2 A;  4Y2V A;  1ZQH A;  4IC9 A;  2LHT A;  2GO7 A;  1SL1 A;  2I9G A;  3NS1 A;  4C8M A;  1V85 A;  3SI8 A;  3I1Y A;  3I76 A;  2FPM A;  4NL9 C;  1TAM A;  3H4D A;  4NV0 A;  4TUS A;  5KFD A;  1KW4 A;  3TI0 A;  2ASD A;  5J0S A;  1K1Q A;  1VLB A;  1VJ5 A;  4F5P A;  5GTI U;  5J8Y C;  5B5E U;  2F2A B;  1DK2 A;  2K8A A;  2PMZ C;  9ICE A;  4JUZ A;  1C7Y A;  2EZY A;  3RAX A;  5AKJ A;  3H0R B;  1NK9 A;  3H0M B;  4GIB A;  2AQ4 A;  2P6U A;  1NK8 A;  4RNM A;  1Z3E B;  4C7Y A;  2KEY A;  3MAB A;  4B9L A;  4ACO A;  2ZUD A;  3SR6 A;  3L3F X;  3TAP A;  4EZ9 A;  2JXJ A;  4DOC A;  4KLO A;  5CP2 A;  2HVH A;  4FZM A;  3RTV A;  3OTQ A;  5F3X B;  4WJ3 B;  2R8K A;  3GII A;  2I6X A;  1ECW A;  1EXN A;  1PVP A;  5AM0 A;  1X6J A;  1T94 A;  5EWG A;  1L7M A;  4K4I A;  3QXG A;  5ALP A;  3UMB A;  5KT5 A;  2KE7 A;  3RBE A;  3HWT A;  3IV6 A;  4F71 A;  2YX8 A;  3ZD9 A;  5ALE A;  3CP8 A;  1N56 A;  4MF2 A;  3EUB 2;  3C2M A;  3TAC B;  3NGD A;  4TUP A;  1U47 A;  3C29 A;  2BCR A;  1BPX A;  2JH7 A;  3D6J A;  3H7I A;  4GXK A;  4QZ8 A;  3PML A;  9ICL A;  2R8G A;  2AJQ A;  1KN5 A;  1F0M A;  2DPJ A;  4DFK A;  2KJ9 A;  2HVI A;  2YY6 A;  3DV9 A;  4NLN A;  2KTQ A;  4B9S A;  1WWU A;  2HDO A;  3MC1 A;  5DG8 A;  4ED0 A;  8ICC A;  3MBY A;  1KFS A;  3ISD A;  5HP4 A;  4QWC A;  3JPR A;  4KN7 A;  4FBT A;  3C5G A;  3RJF A;  2MAX A;  2W54 A;  3TAD A;  2VJ4 A;  2A1A A;  3M1Y A;  1HUO A;  3SQI A;  2BQ3 A;  4Q45 A;  2KHQ A;  1OUQ A;  4B9M A;  4YN4 A;  3VC8 A;  3C28 A;  2DF4 B;  4J9K A;  4MFA A;  4YQW A;  4BJQ A;  2IBK A;  4B9T A;  1M6Y A;  9ICF A;  5K4L A;  3PMN A;  4KLU A;  2K4I A;  2JMG A;  2E8N A;  1TKD A;  4AYB F;  2KZM A;  5AKL A;  1WYG A;  3NUQ A;  1DGJ A;  3PW0 A;  1S0V A;  4R63 A;  2Y0S C;  8ICK A;  4U6P A;  3PZP A;  2XCA A;  2E8P A;  4KLQ A;  5DLG A;  4UW9 A;  2HBM A;  4DQI A;  4O5K A;  1XSN A;  4EYH B;  3H8S A;  2KMD A;  4YP3 A;  3HIL A;  4P4M A;  5KFF A;  2NRT A;  2OHF A;  3QX7 A;  1NJX A;  2NRV A;  2HHT A;  1D9F A;  5AI4 A;  4ECU A;  3OSP A;  2B21 A;  3ISB A;  1MN8 A;  4RQ1 A;  4DCC A;  3GIM A;  4ECV A;  5B66 U;  1D8L A;  1HEK A;  3RJE A;  1ZJM A;  2W55 A;  8ICQ A;  2KZ3 A;  1U4B A;  4O3R A;  3ZD8 A;  2VA8 A;  3M7D A;  3WKC A;  3QUC A;  5HMM A;  4YR0 A;  4R8U B;  2NYV A;  5J2E A;  4M47 A;  5AKH A;  2C22 A;  2XC9 A;  1ZQF A;  5KG1 A;  5AKI A;  4I2B A;  7ICU A;  4RQM A;  4CE6 A;  2IOF K;  1SZP A;  2C28 A;  3A0B U;  4PGY A;  5KT2 A;  2RDI A;  4TQR A;  3RR8 A;  3N28 A;  2JHD A;  3AMZ A;  1JRO A;  4DFP A;  3O0F A;  3PO4 A;  4ECY A;  5KFB A;  4G9B A;  5J2F A;  4BGD A;  1X40 A;  4KLS A;  3JPP A;  4XUS A;  4I2C A;  2OCE A;  4AP9 A;  4OJ5 A;  1UT8 A;  4KTQ A;  8ICP A;  4DLG A;  4UB1 A;  3ORY A;  2QB1 A;  4DFJ A;  7ICS A;  2JEI A;  2G08 A;  3BZC A;  5KAI U;  2FLP A;  2PFO A;  9ICP A;  2KVS A;  1TFR A;  4EEY A;  4JV0 A;  2F1J A;  1FIQ A;  4QWE A;  4LVS A;  2LM1 A;  2E3T A;  3BQ1 A;  3PW7 A;  3Q8R B;  2F3N A;  3IP4 B;  4P0Q B;  5EOZ A;  5C0Y A;  3T5J A;  1MC8 A;  2JEF A;  2FJ6 A;  1KLN A;  1COO A; 
#chains in the Genus database with same CATH homology
 1KN5 A;  2EH9 A;  2JRZ A;  2OEH A;  2YQE A;  2JXJ A;  2CXY A;  4LJX A;  2LM1 A;  5CEH A;  1KKX A;  2EQY A;  2KK0 A;  1KQQ A;  1IG6 A;  1C20 A;  2RQ5 A;  1RYU A;  5K4L A;  2LI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...