1IG6A

Human mrf-2 domain, nmr, 11 structures
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
RADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPIKPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODULATOR RECOGNITION FACTOR 2
publication title HUMAN MRF-2 DOMAIN, NMR, 11 STRUCTURES
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 33
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1ig6A00
2JRZA 2EQYA 2KK0A 2EH9A 1KQQA 1IG6A 2RQ5A 5CEHA 1KN5A 2OEHA 2LI6A 4LJXA 1RYUA 5K4LA 2JXJA 2YQEA 1C20A 1KKXA 2LM1A 2CXYA
chains in the Genus database with same CATH superfamily
5DQGA 4CGZA 3ZDBA 9ICQA 1QLNA 1ZQHA 3I76A 5J2AA 5ALNA 3SV3A 2NRXA 4O5KA 3PSTA 1U45A 4J03A 2IHMA 4RQ6A 5AI9A 1K1SA 2ES6A 2LBOA 1Z1VA 4NLCA 4UAWA 2E1FA 3S6JA 9ICMA 1SB3C 3N7SC 1WWVA 4AP9A 7ICIA 1ZQQA 2H3QA 2FMQA 2AQ0A 1RYRA 1KEJA 3QUBA 7ICHA 2W3RA 3V7KA 5L1JA 1S97A 4RQMA 3ZD8A 5DQHA 4GC7A 2HI0A 3THVA 4O3PA 8ICOA 5HR6A 4F4KA 8ICAA 3PY8A 4C8NA 2JXJA 1UHUA 4AYBF 1TAUA 3RJEA 2Y9TA 3C1ZA 4J9MA 4CNQA 5ALEA 4YP3A 2C22A 4DL3A 4RUAA 2LKYA 4I2EA 2Y9UA 5DBCA 1HIWA 4QZAA 2ZIXB 2LMRA 3H8JA 2KZMA 3G6VA 2O6KA 3KHRA 2R8HA 2DL0A 2KKVA 1KW4A 4C8KA 4B6JA 4F71A 3GU3A 4C80A 2ZJAA 3O0FA 1XNSA 1V97A 4P0QB 1TAQA 2K4IA 3JPPA 3RTVA 1RYUA 1MN8A 3KHLA 5AM4A 4BX9C 5KAFU 5A0LA 5KFYA 4GC6A 1S76D 5TISU 4Q43A 3FC4A 5IIKA 9ICFA 3QU9A 4GFJA 2OWOA 5ALPA 3RJFA 4J9PA 5KT6A 4Z6DA 4OJPA 2OHFA 3PVXA 4YMOA 5B66U 4RQNA 4KLQA 3RB6A 4LJXA 4YMMA 2MUTA 1A77A 5BOLA 4M9LA 9ICWA 2W55A 4YG2A 3T5JA 3PW5A 5AKIA 3AEVA 4F5QA 4K4HA 1JN3A 4YD1A 4KLMA 4I29A 3TAPA 2FPLA 4NJ8A 2AGOA 1ZQAA 2WF6A 3BQ2A 3LVVA 5KFRA 4Z6FA 5IIOA 1BPXA 9ICSA 2FJ6A 4YR2A 3H4DA 2WAQF 4NLKA 3QU4A 3PW7A 3N7PD 1Q8KA 2FE9A 2I6XA 7ICTA 1TK8A 1ZRMA 4BGDA 1BNPA 1UQVA 3SQIA 1HEKA 2JH1A 2EAOA 2HVIA 4RPZA 1U9LA 2XY7A 5EE1A 5HNKA 1ZQKA 4DSLA 1Z3EB 2HMXA 5J0OA 3BDPA 1XC9A 3Q8LA 1X66A 4DL5A 2OXOA 1D8YA 3N28A 4NL9C 2BQUA 1ZQVA 4JWMA 4DOBA 4UARA 4ECSA 3QUCA 3PMNA 1L3TA 5T14A 1A0PA 2YTUA 2W7PA 8ICHA 2XIDA 4PGXA 3V6HA 3PR5B 3RH5A 4DSFA 1JXLA 8ICJA 1OXJA 1ZQNA 4US8A 5J0SA 4MF8A 2W9CB 2D6FC 4ZOHC 2UVRA 4Q44A 3PX6A 1ZQOA 3UXOA 2HOFA 2GOLA 2KSOB 4OD0A 2C2RA 4FBUA 3T79A 3CRXA 2WF9A 3F53A 3H8MA 2K89A 4RUCA 1NJWA 1KL9A 1CUKA 2HW3A 5J2GA 2ALZA 1RQLA 1MC8A 3HPOA 4O9MA 4PPXA 3C2KA 3IRUA 4J9OA 4RU9A 4HAIA 1FEZA 1ZQ1C 4PL2A 3PX0A 3H7IA 2RDJA 3M8SA 2KMDA 2Z7JA 3ETLA 4B9TA 4O3OA 2RRDA 1X9MA 4DSEA 3M6KA 2ZXHA 1RXVA 5F9LA 1A76A 1ZD5A 5AKKA 5KG5A 3SENA 4PHDA 2DPIA 4NM2A 2EQYA 4CF4A 2GH1A 2QB0A 4EX7A 4K4GA 2NRWA 1SGGA 3AQEA 2L5YA 4C8MA 3IN5A 2YN4A 1TE2A 5ALVA 2PI5A 5F3XB 3KKAC 2IBKA 5KFAA 3NRZA 2BDUA 1UA1A 3KHHA 3TADC 1QTMA 1XSLA 1TV9A 5C5JA 4RNMA 5J2CA 4Y2SA 4KMOB 4J9QA 4GIBA 4PGYA 4F5OA 4B9LA 2NO4A 2JH7A 3RB0A 1T3QA 2RLTA 4C4RA 3NVYA 3HRDD 4LZGA 3PV8A 5L1MA 3QU7A 1S0VA 2P35A 5KAIU 4KMUA 1O08A 1KFTA 1NKEA 1SV4A 4JUZA 2K4EA 3EZ5A 4EBDA 2KK0A 4EZ9A 8ICGA 2ZUBA 4Y2UA 3F5EA 5KT7A 5KFIA 4F72A 2EZYA 2YMMA 2KE7A 2HDOA 1ECWA 1ZQDA 1N5XA 5JTIA 1Z00A 1U49A 2W03A 2XGQA 1L3SA 3NVVA 1F44A 7ICRA 4FZMA 3B9JA 4DLEA 9ICAA 3RJJA 9ICBA 5EE3A 1RYSA 4C4SA 4I2GA 2DKZA 1KRPA 3BQ1A 1QQ5A 5J0QA 4DQRA 5AICA 1NNLA 1HJPA 3M9OB 1J2MA 4ICAA 1D8BA 4IQWA 2K4PA 4I2CA 2BCVA 5CP2A 5KG1A 3ZI4A 2ZIUA 1B22A 2KKPA 9ICJA 1HUZA 2ZUDA 1WUDA 3Q8QB 1RDFA 2B21A 5DG8A 4DL7A 1RPLA 1VDVA 2VKQA 5AM1A 3OSPA 2WFAA 1IM4A 2LYAA 2E1EA 4ZH4A 3GV8B 3PW2A 4Y2TA 1FIQA 5AI5A 1T94A 2VJ5A 2KIWA 4OO1J 5IIIA 3F5AA 8ICWA 5AKHA 2G08A 1NK6A 2MUTB 4R66A 5ALMA 3QU5A 4ECXA 1F5SA 2CRXA 3ONNA 4KTQA 5AK6A 3LWMA 3PNCA 3RB4A 4DF8A 4DLGA 2KVSA 1D9DA 4KLHA 4NL9A 3QX7A 3QZ8A 2N1RA 3GIJA 4F50A 5CWRA 2DUYA 3RJGA 4RQ3A 3ETRA 3TKAA 4RZRA 2MRLA 3HT3A 1A6SA 2ZUCA 3NVWA 5AM2A 1PK1A 1COKA 2A1JB 3BQ7A 1Z4OA 5KFXA 4FS2A 3TARA 4UB8U 1WYGA 2CPRA 3MC1A 8ICZA 2KN7A 1SL1A 1SZPA 4C8LA 1J97A 1C20A 1BPEA 3WKCA 4QWEA 4Y2JA 4K4IA 2XCAA 5L9XA 4JV1A 1O03A 3V72A 1ZQJA 1KFSA 3IHQB 5JUMA 4RQ0A 3PR4A 2BCUA 3H0LB 4B9UA 4EZ6A 4UAVA 2EANA 2LI6A 4DQPA 4DL2A 2ZTCA 5KFPA 3ISDA 5HHIA 3QYPA 3OHAA 3Q8MA 4DFPA 1LV5A 4ED8A 2R8IA 4KN4A 4J9SA 2DWQA 1ZQFA 3SMVA 2V4RA 2E8OA 1QH9A 4P0PA 1BVSA 3MGIA 4M47A 3F2CA 2DKXA 5HMLA 3T5LA 5KT2A 2DFLA 3VCBA 3QE9Y 1EXNA 1WCNA 3KD3A 1HUOA 1XO0A 1VLBA 1BPYA 1KBUA 9ICKA 3PO5A 1SV0C 4ED2A 3FAHA 1KSPA 3E2EA 3QU2A 2OH2A 2WF5A 4UBBA 2AHOB 4PL1A 3FYHA 4Q8EA 3KKAA 4OCZA 5J0XA 3WKEA 4YFKA 3TADA 1N5WA 4C7ZA 1DGJA 5ALIA 5FP0A 4MF2A 2F77X 1OUQA 2W8KA 4O0IA 3ICXA 3LWLA 3HX0A 2PFPA 4P2HA 2Q4TA 1ZQBA 3IP4B 4EENA 3MR6A 3D6JA 5ALYA 5D4BA 1LB2B 4M9JA 4C8OA 3V6JA 3PO4A 1KFDA 3EUB2 3MDCA 3C2LA 4IRCA 2F2AB 4MHVA 4IQVA 1X9XA 4PGQA 4ECTA 4DFMA 2J6SA 2K8AA 3RR7A 4KLOA 2BKEA 1PVRA 3TAQA 4Y2VA 1SXEA 4XQ8A 4F4YA 2F44A 4IR9A 2A1AA 3PZPA 4IRKA 4F5RA 8ICLA 3UMCA 2W43A 2I1QA 4TURA 5L1LA 5DGAA 4FBTA 1D9FA 2C28A 5TZVA 3RJIA 1V9PA 5AI0A 4NY8A 3IV6A 3TFRA 8ICFA 4DF4A 1K1QA 7ICFA 3NASA 3UXNA 1XWLA 4RQ4A 2FLPA 3KZIU 8ICCA 2D3DA 3RAXA 3RJHA 4F92B 2W8LA 2J6TA 8ICNA 1NZPA 5J0UA 4TUPA 3MBYA 4X5VA 2M9NA 5DLFA 4EYIB 4BXOA 4JV2A 2E8NA 1L3VA 1COOA 1RM6C 5ALLA 5KFHA 3ZDEA 3C23A 4Z6EA 3Q8KA 4I2AA 3IG8A 3KHGA 2BDPA 1ZQLA 2Y0SC 4ECRA 2Y1JA 4M6WB 4IQTA 3C5FA 5AKLA 3V7LA 5AM5A 9ICOA 1ZQPA 7ICNA 2KNJA 2NYVA 3BQTA 1N56A 3C28A 2E5SA 4DOCA 1SKRA 5AKZA 2KVCA 3QEBZ 4QZGA 2HBMA 3NS1A 2ZIUB 1SL2A 5J0PA 3UM9A 1DXSA 3QEAZ 5AI4A 5AHXA 2H5XA 2DF4B 2XC9A 1ZJMA 2FLNA 3M9NB 5G5GA 2WTFA 3PMLA 5AKEA 8ICSA 3SAFA 3M6ZA 1RXWA 2A19A 3Q8SB 1C7YA 1Z4NA 1ZD2P 2ZIWB 1UCVA 2E8MA 4M0AA 4F3OA 5EE0A 7ICVA 5IINA 2PFQA 4USAA 3LK9A 2IOHA 2JR5A 5JRTA 5KFGA 4LVSA 2PXIA 3HKZC 8ICRA 3PX4A 5KFNA 2A3VA 4CF3A 1ZQGA 3RH6A 4KLGA 5KT4A 1FFUA 3SV4A 3F2BA 1TFRA 1ZQCA 1BPZA 3AM9A 4DL4A 1SV0A 1DRGA 1S9FA 4DEZA 1H38A 4M2YA 4JB3A 2NRVA 3SYZA 7ICEA 2RDIA 4Y2QA 4O5CA 1TVAA 1IV8A 2ZIVB 4P4OA 7ICJA 5HP4A 3GV5B 1NI3A 4I28A 2MA1A 4R8UA 2B6GA 1LKYB 5KTQA 3K75D 1NK4A 3GQCA 4KLJA 2JEGA 3SAGA 3UMGA 2LM4A 5ALXA 3RF9A 3TACB 4QJFB 2LPEA 1ZYQA 4O3MA 3NRWA 3WK6A 4PJ0U 5F9NA 2QARA 2JRZA 3BS5A 2K4HA 1MQ2A 2GLEA 2BPCA 1L8OA 4J9NA 3IDWA 8ICXA 5KFZA 2BQRA 2ASLA 2KZZA 3SZ2A 3PW4A 3UMBA 3OJSA 4PHPA 5KFCA 1U4BA 2FPKA 1ZRNA 2Y1IA 4QNLA 2AQ4A 2I9GA 1S77D 5AKYA 3UQ0A 4DQIA 2HHXA 4RQ8A 2NV3A 2P6UA 4EX6A 5KFLA 4UAYA 3H8WA 2XY6A 7ICKA 2GWSA 9ICIA 4EYHB 5J29A 2IHNA 1S0OA 1NZBA 3TQ1A 3RH4A 4QW9A 3EWAA 4KX3A 4MFCA 4RNOA 2WB1C 2RP5A 4G9BA 4NXZA 2OM6A 3K1RB 2BCRA 3KTQA 4NM1A 1U48A 5J2BA 4KLTA 4DSIA 2BPFA 3AU2A 2IOFK 1ZQWA 1JIHA 4IR1A 3PSPA 1NOMA 4MEYA 2LYHA 2VA3A 1NJXA 4UBCA 2YMLA 1N63A 1QQ6A 3ISBA 2YX8A 4RT3A 3B0YA 4IRDA 5J2FA 3MR2A 1Q3UA 4UB2A 4KLDA 2AXTU 5ALRA 5EE9A 1NK8A 3RRHA 4QWAA 4CRXA 1L5UA 2ATLA 3A0BU 4BWJA 5AKGA 4YQWA 3LDAA 3RAQA 4QW8A 5B5EU 1JX4A 1P7DA 3M8RA 2UVVA 4YMNA 3WK7A 1ED1A 2WF8A 4JV0A 1SKSA 3TFSA 4F4WA 2ASJA 1ZQTA 1TK5A 5IIMA 5J8YA 3EPGA 3QXGA 4P4MA 1IIPA 1TKDA 3GIMA 1PVQA 4EBCA 4O3SA 8ICPA 3SEIA 4NLBA 4ECQA 1WWUA 3CW2C 2AGPA 3C29A 2LM1A 3HKZF 3EPIA 3RR8A 2ZIXA 3NVZA 5AK3A 2AU0A 1XSPA 4I2BA 2P6RA 4NLNA 5C0YA 5KFTA 3AL0B 1SWVA 1NKCA 3J81j 3WKDA 3D2SA 9ICUA 4XUSA 4M9NA 2QB1A 3H0MB 5D49A 3KFUF 4FE3A 2QKQA 2YB4A 4Q8FA 2I5HA 4AYBC 3OTQA 9ICXA 4GXIA 2FLLA 4PH5A 4BDPA 3GV7B 1AQ6A 5CA7A 1GO3F 1MSWD 3LVWA 4DSJA 4F5PA 2YMPA 1XO1A 2JZBA 2ODGA 2F8KA 2F1JA 1DOQA 4B9VA 3BJYA 1ZQUA 4DO9A 4CE6A 2G5HB 4C4TA 1N2XA 5AKJA 5CHGA 2PKEA 5KFDA 2M0NA 1MQ3A 2HBJA 4ACOA 1NJYA 4UAZA 1Y88A 1L7NA 1SKWA 3RRGA 4Y2YA 1X9WA 4ELTA 3AMZA 3KOOA 3RJKA 7ICQA 4M9GA 5DDMA 3E0FA 3CNHA 5AIAA 3ED5A 3R9KA 4M04A 9ICEA 5ALJA 2OEHA 2VANA 4F2SA 2F3NA 1FFVA 1NK0A 2JEIA 2BCSA 5AIBA 2JHDA 2UVUA 5J2IA 4KN7A 4O3RA 4UAUA 4Q45A 4YXMA 2KD1A 3ORYA 5HR7A 5AK4A 5JU5A 4B9SA 4CCHA 2KZ3A 3N97B 2UVWA 5KFOA 2G06A 1L6NA 5DG7A 2HHSA 2QARB 2K8BB 5J0TA 2WF7A 2WAQC 5KFFA 2XY5A 3PW0A 1SWWA 1ZD4A 2WB1F 4QZHA 2E3TA 4KLUA 5DGBA 4PZNA 4UB3A 4RPYA 2KIVA 1YZ6A 5DBAA 2W9CA 4DFDA 9ICLA 5G5HA 2FMSA 8ICYA 4DCCA 2KSOA 2KJ5A 2VA2A 5L1IA 1B43A 4TUSA 4QZFA 2W9AA 4ELUA 1L7PA 2YMQA 2W04A 4F5NA 3NTUA 2HOIA 3ZDDA 1BNOA 3HWTA 1QSYA 1ZJNA 2Q0ZX 4U7CA 2FMPA 3GILA 2XI9A 4ECYA 2AGQA 2G09A 4YVZA 2QB0B 2W9BA 1J2NA 2FI1A 1QQ7A 2KFZA 4QZEA 4QWBA 2BR0A 5KL8B 5KFBA 2EZZA 4NV0A 1RZTA 4P4PA 2RQ5A 2KP7A 3HJEA 4KITB 5DB7A 2E8PA 2IOFA 2XVTA 3MGVA 1JALA 2J6UA 4XRHA 3GIKA 5CRXA 4I2FA 5IILA 2KOBA 3KBBA 5GTIU 2MAXA 2HHVA 3DDHA 4UB4A 1CEZA 2VIXA 3QZ7A 4MEXA 4GXJA 2HHUA 2HBKA 5KFEA 2G5IB 4LZDA 1L7OA 2C2DA 1DK2A 4UATA 1ZQIA 3RB3A 1L8LA 4Y2RA 4DS4A 5KFMA 2LYBA 7ICOA 2BHNA 4YR0A 4ED0A 3Q8PB 4PHAA 1SL0A 3AU6A 2GO7A 4TUQA 4I2JA 1Z00B 1PK3A 4O5EA 2W11A 2D8CA 1ZQXA 1T7PA 1X2IA 2F8LA 3IG5A 2G07A 8ICUA 2H3ZA 1UA0A 4YR3A 1ZETA 2WHEA 1M6YA 2YB1A 4GLXA 5KFKA 1NK5A 4WJ3B 5AI6A 4I2DA 3CYMA 2KJ8A 3NGDA 4DQSA 2ZJ5A 3H40A 2KG5A 1S0MA 5DLGA 4RPXA 2HCFA 4RQ2A 3SD7A 5ALWA 4BWMA 2DGZA 4G3IA 3V6KA 3HILA 3BS7A 4OJ6A 5AK5A 3ZDAA 4QZ8A 3QNMA 5J2JA 4YXJA 5KFWA 4OJ5A 4KLEA 3RBDA 1N61A 1UPHA 9ICVA 3OJUA 2V9WA 1UT8A 8ICEA 4F93B 5J8YC 1JXEA 2EZXA 1UT5A 3N4MB 2DBYA 2HOQA 3I1YA 3M9MB 4ELVA 4EBEA 4OJLA 5HMMA 5KFUA 4IL6U 2PFOA 1QCKA 2KHVA 4UQGA 1S5LU 2W54A 2ZTDA 2YY6A 2XCPA 2ISPA 2BCQA 3IM1A 5ALZA 3T5HA 7ICUA 3L3FX 1U47A 4DSKA 1PZNA 2JZBB 4QZDA 5KNIA 1SIJA 2R8KA 9ICGA 1Z19A 3GZFA 3L4PA 5ALDA 4EEYA 3WK8A 3EYZA 3GDXA 2KTQA 2EDUA 3BZKA 1PK1B 1V38A 4A8EA 1JROA 1DK3A 5KFQA 5K4LA 3TI0A 1YZ7A 4ED1A 1T8EA 2HSZA 3MABA 4F2RA 5KG7A 2A1JA 3VC8A 3JPRA 2CXYA 2C2EA 2QLTA 4TQSA 2VJ4A 2NO5A 5EWFA 4PHEA 4Y2XA 2V4QA 3EW9A 3WK5A 1TAMA 3G6XA 9ICRA 3F2DA 2PMZC 5ALHA 3SI8A 2BGWA 1N60A 4DOAA 1JI7A 2ZJ8A 2H3FA 5KL1B 4P0PB 3FDSA 3D2QA 1V85A 2KV2A 5CR0A 2F1HA 1FO4A 2W3SA 3WK4A 5DB9A 2P66A 1B0XA 3C1YA 1NK9A 2HBLA 2B0CA 4F91B 5KFJA 4UASA 4O3NA 2EAPA 2W7OA 4M9HA 4CF5A 1ZQMA 9ICCA 2AH5A 4FS1A 3V7JA 2BQ3A 1ZOLA 1B4FA 3JPOA 2EH9A 2MU2A 5ALQA 3RFAA 8ICTA 3FM9A 2XO7A 8ICKA 4DFJA 3RBEA 1KDHA 4KX5A 1ZQRA 2HHWA 1ZQSA 2HVHA 5CJ7A 3AUOA 4MFFA 4RT2A 1VJ5A 2OCEA 5J2DA 4ED6A 3JPSA 2NRZA 2W9BB 4R65A 5IIJA 1AROP 9ICNA 4ECZA 4I2HA 2ZG6A 3HP6A 4BUGA 2JGAA 1CI4A 2KEYA 3H0RB 1ZQZA 3HW8A 4FFDA 3WU2U 2AJQA 3WK9A 5EWGA 1WCLA 2HHTA 4RQ7A 3C5GA 2ZXIA 1BPDA 5H2FU 4J9LA 2F76X 1IG6A 2JMGA 4UB6U 1PVPA 2Y0SF 1L7MA 1TK0A 4TQRA 2KHQA 3N7RC 4YN4A 2H3VA 2R18A 4FO6A 1S0NA 3OGUA 3K1ZA 2ZTEA 4NLZA 8ICIA 5BOMA 1N48A 7ICPA 1RG6A 4FZNA 4IS7A 5KG2A 1OW5A 3ZD9A 5AKXA 1SXDA 1PUZA 4ED7A 1Q46A 1D8LA 8ICVA 4JK1A 1ZQYA 1X42A 4DWIA 4Y2PA 3WKBA 5DDYA 1NK7A 4BXOB 4Z6CA 1KTQA 3M1YA 4QWDA 1JUDA 4IC9A 3L5KA 5KT3A 1X6IA 3K4GA 3WKAA 4MFAA 4QIWC 5J2HA 1X9SA 4I2IA 3MFIA 4QZ9A 5ALFA 1DGSA 7ICGA 4IQUA 4B9NA 3OPXA 2XICA 4UB1A 4KLLA 2PFNA 2JV3A 2YQEA 3M7DA 2ISOA 3B0XA 4M6WA 3ISCA 8ICQA 4F4ZA 2R8GA 2ESEA 3QUQA 5CB1A 1KN5A 3KZXA 1YT3A 3UQ2A 2CN1A 4ECWA 3JPQA 1BPBA 3AN1A 5DQIA 4F8RA 5DG9A 4NWIA 1Q3VA 2VA8A 3GFKB 4P0QA 7ICMA 5E79U 2G0AA 2FPMA 1K5OA 5KT5A 4YD2A 5KG4A 3ZDCA 2PI4A 5L1KA 5ALKA 1ZD3A 4FZLA 2NRTA 4DS5A 5KG6A 4JMUA 2JEFA 2K60A 3H8SA 4CDGA 1CRXA 3DV9A 9ICTA 2JEJA 4UB5A 4EELA 3C2MA 2F1IA 5EOZA 1L3UA 4J9KA 4EEKA 3G6YA 4US9A 3E58A 4XA5A 3MR5A 3TANA 1JMSA 2ZIWA 4BJQA 3JPTA 3D2NA 1KQQA 4DL6A 4ECUA 2PMZF 4QZBA 1SZHA 3I28A 1T3NA 1S8OA 3MDAA 1NKBA 1XU4A 4RQ1A 3CP8A 4J9RA 2DPJA 4R63A 7ICSA 3PSIA 2RHFA 1MA7A 4QZCA 1KLNA 1T4GA 2IA6A 4DQQA 1NJZA 5ALTA 1LVHA 5DBBA 5EWEA 3Q8RB 1JRPA 3OHBA 5DB8A 3U26A 5AI8A 5KFSA 1QSSA 3JPNA 5CEHA 2ASDA 5ALOA 5GTHU 4KLFA 5J2EA 5KG0A 4DFKA 4R8UB 1WG8A 4QWCA 2HHQA 4C7YA 1URJA 2KICA 1S10A 4UW9A 1X6JA 3MFHA 1ZXIA 2EAMA 4F4XA 2ZIVA 2OYYA 4GXKA 3A0HU 4PZOA 4I27A 3ALRA 5AM3A 3SAHA 1LKYA 3T5KA 5ALSA 3DEEA 4KLSA 1RQNA 5J2KA 4YCXA 4C0ZA 1N62A 4O3QA 4RNNA 3BS5B 2BPGA 3GIIA 2H3IA 2R8JA 4B9MA 1Z1BA 7ICLA 1IXRA 4R64A 2FDRA 4NLGA 2MSNA 3T3FA 4E0DA 4QZIA 3UXPA 2K8CB 2BZFA 3MGHA 3NUQA 5KFVA 3SR6A 1KKXA 1BGXT 5J0YA 5KG3A 2IMWP 5DB6A 2W9MA 2LHTA 1XS9D 4OJOA 4RQ5A 5ALUA 4ECVA 5ALGA 9ICHA 3BZCA 1ZQEA 5DKWA 1QSLA 3UPQA 1X40A 4KLIA 5D46A 4HYKA 5HHHA 8ICMA 3QUTA 3PSFA 3H4BA 3AQFA 5J0WA 4U6PA 1XSNA 3C21A 2DQNB 5BPCA 3LYSA 5J0RA 1F0MA 5AM0A 3MR3A 4QIWF 2XGPA 3OSNA 4JWNA 4ED3A 2KJ9A 3BQ0A 9ICPA 2KFNA 8ICBA
chains in the Genus database with same CATH topology
2JRZA 2EQYA 2KK0A 2EH9A 1KQQA 1IG6A 2RQ5A 5CEHA 1KN5A 2OEHA 2LI6A 4LJXA 1RYUA 5K4LA 2JXJA 2YQEA 1C20A 1KKXA 2LM1A 2CXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRZ A;  2EQY A;  2KK0 A;  2EH9 A;  1KQQ A;  1IG6 A;  2RQ5 A;  5CEH A;  1KN5 A;  2OEH A;  2LI6 A;  4LJX A;  1RYU A;  5K4L A;  2JXJ A;  2YQE A;  1C20 A;  1KKX A;  2LM1 A;  2CXY A; 
#chains in the Genus database with same CATH topology
 5DQG A;  4CGZ A;  3ZDB A;  9ICQ A;  1QLN A;  1ZQH A;  3I76 A;  5J2A A;  5ALN A;  3SV3 A;  2NRX A;  4O5K A;  3PST A;  1U45 A;  4J03 A;  2IHM A;  4RQ6 A;  5AI9 A;  1K1S A;  2ES6 A;  2LBO A;  1Z1V A;  4NLC A;  4UAW A;  2E1F A;  3S6J A;  9ICM A;  1SB3 C;  3N7S C;  1WWV A;  4AP9 A;  7ICI A;  1ZQQ A;  2H3Q A;  2FMQ A;  2AQ0 A;  1RYR A;  1KEJ A;  3QUB A;  7ICH A;  2W3R A;  3V7K A;  5L1J A;  1S97 A;  4RQM A;  3ZD8 A;  5DQH A;  4GC7 A;  2HI0 A;  3THV A;  4O3P A;  8ICO A;  5HR6 A;  4F4K A;  8ICA A;  3PY8 A;  4C8N A;  2JXJ A;  1UHU A;  4AYB F;  1TAU A;  3RJE A;  2Y9T A;  3C1Z A;  4J9M A;  4CNQ A;  5ALE A;  4YP3 A;  2C22 A;  4DL3 A;  4RUA A;  2LKY A;  4I2E A;  2Y9U A;  5DBC A;  1HIW A;  4QZA A;  2ZIX B;  2LMR A;  3H8J A;  2KZM A;  3G6V A;  2O6K A;  3KHR A;  2R8H A;  2DL0 A;  2KKV A;  1KW4 A;  4C8K A;  4B6J A;  4F71 A;  3GU3 A;  4C80 A;  2ZJA A;  3O0F A;  1XNS A;  1V97 A;  4P0Q B;  1TAQ A;  2K4I A;  3JPP A;  3RTV A;  1RYU A;  1MN8 A;  3KHL A;  5AM4 A;  4BX9 C;  5KAF U;  5A0L A;  5KFY A;  4GC6 A;  1S76 D;  5TIS U;  4Q43 A;  3FC4 A;  5IIK A;  9ICF A;  3QU9 A;  4GFJ A;  2OWO A;  5ALP A;  3RJF A;  4J9P A;  5KT6 A;  4Z6D A;  4OJP A;  2OHF A;  3PVX A;  4YMO A;  5B66 U;  4RQN A;  4KLQ A;  3RB6 A;  4LJX A;  4YMM A;  2MUT A;  1A77 A;  5BOL A;  4M9L A;  9ICW A;  2W55 A;  4YG2 A;  3T5J A;  3PW5 A;  5AKI A;  3AEV A;  4F5Q A;  4K4H A;  1JN3 A;  4YD1 A;  4KLM A;  4I29 A;  3TAP A;  2FPL A;  4NJ8 A;  2AGO A;  1ZQA A;  2WF6 A;  3BQ2 A;  3LVV A;  5KFR A;  4Z6F A;  5IIO A;  1BPX A;  9ICS A;  2FJ6 A;  4YR2 A;  3H4D A;  2WAQ F;  4NLK A;  3QU4 A;  3PW7 A;  3N7P D;  1Q8K A;  2FE9 A;  2I6X A;  7ICT A;  1TK8 A;  1ZRM A;  4BGD A;  1BNP A;  1UQV A;  3SQI A;  1HEK A;  2JH1 A;  2EAO A;  2HVI A;  4RPZ A;  1U9L A;  2XY7 A;  5EE1 A;  5HNK A;  1ZQK A;  4DSL A;  1Z3E B;  2HMX A;  5J0O A;  3BDP A;  1XC9 A;  3Q8L A;  1X66 A;  4DL5 A;  2OXO A;  1D8Y A;  3N28 A;  4NL9 C;  2BQU A;  1ZQV A;  4JWM A;  4DOB A;  4UAR A;  4ECS A;  3QUC A;  3PMN A;  1L3T A;  5T14 A;  1A0P A;  2YTU A;  2W7P A;  8ICH A;  2XID A;  4PGX A;  3V6H A;  3PR5 B;  3RH5 A;  4DSF A;  1JXL A;  8ICJ A;  1OXJ A;  1ZQN A;  4US8 A;  5J0S A;  4MF8 A;  2W9C B;  2D6F C;  4ZOH C;  2UVR A;  4Q44 A;  3PX6 A;  1ZQO A;  3UXO A;  2HOF A;  2GOL A;  2KSO B;  4OD0 A;  2C2R A;  4FBU A;  3T79 A;  3CRX A;  2WF9 A;  3F53 A;  3H8M A;  2K89 A;  4RUC A;  1NJW A;  1KL9 A;  1CUK A;  2HW3 A;  5J2G A;  2ALZ A;  1RQL A;  1MC8 A;  3HPO A;  4O9M A;  4PPX A;  3C2K A;  3IRU A;  4J9O A;  4RU9 A;  4HAI A;  1FEZ A;  1ZQ1 C;  4PL2 A;  3PX0 A;  3H7I A;  2RDJ A;  3M8S A;  2KMD A;  2Z7J A;  3ETL A;  4B9T A;  4O3O A;  2RRD A;  1X9M A;  4DSE A;  3M6K A;  2ZXH A;  1RXV A;  5F9L A;  1A76 A;  1ZD5 A;  5AKK A;  5KG5 A;  3SEN A;  4PHD A;  2DPI A;  4NM2 A;  2EQY A;  4CF4 A;  2GH1 A;  2QB0 A;  4EX7 A;  4K4G A;  2NRW A;  1SGG A;  3AQE A;  2L5Y A;  4C8M A;  3IN5 A;  2YN4 A;  1TE2 A;  5ALV A;  2PI5 A;  5F3X B;  3KKA C;  2IBK A;  5KFA A;  3NRZ A;  2BDU A;  1UA1 A;  3KHH A;  3TAD C;  1QTM A;  1XSL A;  1TV9 A;  5C5J A;  4RNM A;  5J2C A;  4Y2S A;  4KMO B;  4J9Q A;  4GIB A;  4PGY A;  4F5O A;  4B9L A;  2NO4 A;  2JH7 A;  3RB0 A;  1T3Q A;  2RLT A;  4C4R A;  3NVY A;  3HRD D;  4LZG A;  3PV8 A;  5L1M A;  3QU7 A;  1S0V A;  2P35 A;  5KAI U;  4KMU A;  1O08 A;  1KFT A;  1NKE A;  1SV4 A;  4JUZ A;  2K4E A;  3EZ5 A;  4EBD A;  2KK0 A;  4EZ9 A;  8ICG A;  2ZUB A;  4Y2U A;  3F5E A;  5KT7 A;  5KFI A;  4F72 A;  2EZY A;  2YMM A;  2KE7 A;  2HDO A;  1ECW A;  1ZQD A;  1N5X A;  5JTI A;  1Z00 A;  1U49 A;  2W03 A;  2XGQ A;  1L3S A;  3NVV A;  1F44 A;  7ICR A;  4FZM A;  3B9J A;  4DLE A;  9ICA A;  3RJJ A;  9ICB A;  5EE3 A;  1RYS A;  4C4S A;  4I2G A;  2DKZ A;  1KRP A;  3BQ1 A;  1QQ5 A;  5J0Q A;  4DQR A;  5AIC A;  1NNL A;  1HJP A;  3M9O B;  1J2M A;  4ICA A;  1D8B A;  4IQW A;  2K4P A;  4I2C A;  2BCV A;  5CP2 A;  5KG1 A;  3ZI4 A;  2ZIU A;  1B22 A;  2KKP A;  9ICJ A;  1HUZ A;  2ZUD A;  1WUD A;  3Q8Q B;  1RDF A;  2B21 A;  5DG8 A;  4DL7 A;  1RPL A;  1VDV A;  2VKQ A;  5AM1 A;  3OSP A;  2WFA A;  1IM4 A;  2LYA A;  2E1E A;  4ZH4 A;  3GV8 B;  3PW2 A;  4Y2T A;  1FIQ A;  5AI5 A;  1T94 A;  2VJ5 A;  2KIW A;  4OO1 J;  5III A;  3F5A A;  8ICW A;  5AKH A;  2G08 A;  1NK6 A;  2MUT B;  4R66 A;  5ALM A;  3QU5 A;  4ECX A;  1F5S A;  2CRX A;  3ONN A;  4KTQ A;  5AK6 A;  3LWM A;  3PNC A;  3RB4 A;  4DF8 A;  4DLG A;  2KVS A;  1D9D A;  4KLH A;  4NL9 A;  3QX7 A;  3QZ8 A;  2N1R A;  3GIJ A;  4F50 A;  5CWR A;  2DUY A;  3RJG A;  4RQ3 A;  3ETR A;  3TKA A;  4RZR A;  2MRL A;  3HT3 A;  1A6S A;  2ZUC A;  3NVW A;  5AM2 A;  1PK1 A;  1COK A;  2A1J B;  3BQ7 A;  1Z4O A;  5KFX A;  4FS2 A;  3TAR A;  4UB8 U;  1WYG A;  2CPR A;  3MC1 A;  8ICZ A;  2KN7 A;  1SL1 A;  1SZP A;  4C8L A;  1J97 A;  1C20 A;  1BPE A;  3WKC A;  4QWE A;  4Y2J A;  4K4I A;  2XCA A;  5L9X A;  4JV1 A;  1O03 A;  3V72 A;  1ZQJ A;  1KFS A;  3IHQ B;  5JUM A;  4RQ0 A;  3PR4 A;  2BCU A;  3H0L B;  4B9U A;  4EZ6 A;  4UAV A;  2EAN A;  2LI6 A;  4DQP A;  4DL2 A;  2ZTC A;  5KFP A;  3ISD A;  5HHI A;  3QYP A;  3OHA A;  3Q8M A;  4DFP A;  1LV5 A;  4ED8 A;  2R8I A;  4KN4 A;  4J9S A;  2DWQ A;  1ZQF A;  3SMV A;  2V4R A;  2E8O A;  1QH9 A;  4P0P A;  1BVS A;  3MGI A;  4M47 A;  3F2C A;  2DKX A;  5HML A;  3T5L A;  5KT2 A;  2DFL A;  3VCB A;  3QE9 Y;  1EXN A;  1WCN A;  3KD3 A;  1HUO A;  1XO0 A;  1VLB A;  1BPY A;  1KBU A;  9ICK A;  3PO5 A;  1SV0 C;  4ED2 A;  3FAH A;  1KSP A;  3E2E A;  3QU2 A;  2OH2 A;  2WF5 A;  4UBB A;  2AHO B;  4PL1 A;  3FYH A;  4Q8E A;  3KKA A;  4OCZ A;  5J0X A;  3WKE A;  4YFK A;  3TAD A;  1N5W A;  4C7Z A;  1DGJ A;  5ALI A;  5FP0 A;  4MF2 A;  2F77 X;  1OUQ A;  2W8K A;  4O0I A;  3ICX A;  3LWL A;  3HX0 A;  2PFP A;  4P2H A;  2Q4T A;  1ZQB A;  3IP4 B;  4EEN A;  3MR6 A;  3D6J A;  5ALY A;  5D4B A;  1LB2 B;  4M9J A;  4C8O A;  3V6J A;  3PO4 A;  1KFD A;  3EUB 2;  3MDC A;  3C2L A;  4IRC A;  2F2A B;  4MHV A;  4IQV A;  1X9X A;  4PGQ A;  4ECT A;  4DFM A;  2J6S A;  2K8A A;  3RR7 A;  4KLO A;  2BKE A;  1PVR A;  3TAQ A;  4Y2V A;  1SXE A;  4XQ8 A;  4F4Y A;  2F44 A;  4IR9 A;  2A1A A;  3PZP A;  4IRK A;  4F5R A;  8ICL A;  3UMC A;  2W43 A;  2I1Q A;  4TUR A;  5L1L A;  5DGA A;  4FBT A;  1D9F A;  2C28 A;  5TZV A;  3RJI A;  1V9P A;  5AI0 A;  4NY8 A;  3IV6 A;  3TFR A;  8ICF A;  4DF4 A;  1K1Q A;  7ICF A;  3NAS A;  3UXN A;  1XWL A;  4RQ4 A;  2FLP A;  3KZI U;  8ICC A;  2D3D A;  3RAX A;  3RJH A;  4F92 B;  2W8L A;  2J6T A;  8ICN A;  1NZP A;  5J0U A;  4TUP A;  3MBY A;  4X5V A;  2M9N A;  5DLF A;  4EYI B;  4BXO A;  4JV2 A;  2E8N A;  1L3V A;  1COO A;  1RM6 C;  5ALL A;  5KFH A;  3ZDE A;  3C23 A;  4Z6E A;  3Q8K A;  4I2A A;  3IG8 A;  3KHG A;  2BDP A;  1ZQL A;  2Y0S C;  4ECR A;  2Y1J A;  4M6W B;  4IQT A;  3C5F A;  5AKL A;  3V7L A;  5AM5 A;  9ICO A;  1ZQP A;  7ICN A;  2KNJ A;  2NYV A;  3BQT A;  1N56 A;  3C28 A;  2E5S A;  4DOC A;  1SKR A;  5AKZ A;  2KVC A;  3QEB Z;  4QZG A;  2HBM A;  3NS1 A;  2ZIU B;  1SL2 A;  5J0P A;  3UM9 A;  1DXS A;  3QEA Z;  5AI4 A;  5AHX A;  2H5X A;  2DF4 B;  2XC9 A;  1ZJM A;  2FLN A;  3M9N B;  5G5G A;  2WTF A;  3PML A;  5AKE A;  8ICS A;  3SAF A;  3M6Z A;  1RXW A;  2A19 A;  3Q8S B;  1C7Y A;  1Z4N A;  1ZD2 P;  2ZIW B;  1UCV A;  2E8M A;  4M0A A;  4F3O A;  5EE0 A;  7ICV A;  5IIN A;  2PFQ A;  4USA A;  3LK9 A;  2IOH A;  2JR5 A;  5JRT A;  5KFG A;  4LVS A;  2PXI A;  3HKZ C;  8ICR A;  3PX4 A;  5KFN A;  2A3V A;  4CF3 A;  1ZQG A;  3RH6 A;  4KLG A;  5KT4 A;  1FFU A;  3SV4 A;  3F2B A;  1TFR A;  1ZQC A;  1BPZ A;  3AM9 A;  4DL4 A;  1SV0 A;  1DRG A;  1S9F A;  4DEZ A;  1H38 A;  4M2Y A;  4JB3 A;  2NRV A;  3SYZ A;  7ICE A;  2RDI A;  4Y2Q A;  4O5C A;  1TVA A;  1IV8 A;  2ZIV B;  4P4O A;  7ICJ A;  5HP4 A;  3GV5 B;  1NI3 A;  4I28 A;  2MA1 A;  4R8U A;  2B6G A;  1LKY B;  5KTQ A;  3K75 D;  1NK4 A;  3GQC A;  4KLJ A;  2JEG A;  3SAG A;  3UMG A;  2LM4 A;  5ALX A;  3RF9 A;  3TAC B;  4QJF B;  2LPE A;  1ZYQ A;  4O3M A;  3NRW A;  3WK6 A;  4PJ0 U;  5F9N A;  2QAR A;  2JRZ A;  3BS5 A;  2K4H A;  1MQ2 A;  2GLE A;  2BPC A;  1L8O A;  4J9N A;  3IDW A;  8ICX A;  5KFZ A;  2BQR A;  2ASL A;  2KZZ A;  3SZ2 A;  3PW4 A;  3UMB A;  3OJS A;  4PHP A;  5KFC A;  1U4B A;  2FPK A;  1ZRN A;  2Y1I A;  4QNL A;  2AQ4 A;  2I9G A;  1S77 D;  5AKY A;  3UQ0 A;  4DQI A;  2HHX A;  4RQ8 A;  2NV3 A;  2P6U A;  4EX6 A;  5KFL A;  4UAY A;  3H8W A;  2XY6 A;  7ICK A;  2GWS A;  9ICI A;  4EYH B;  5J29 A;  2IHN A;  1S0O A;  1NZB A;  3TQ1 A;  3RH4 A;  4QW9 A;  3EWA A;  4KX3 A;  4MFC A;  4RNO A;  2WB1 C;  2RP5 A;  4G9B A;  4NXZ A;  2OM6 A;  3K1R B;  2BCR A;  3KTQ A;  4NM1 A;  1U48 A;  5J2B A;  4KLT A;  4DSI A;  2BPF A;  3AU2 A;  2IOF K;  1ZQW A;  1JIH A;  4IR1 A;  3PSP A;  1NOM A;  4MEY A;  2LYH A;  2VA3 A;  1NJX A;  4UBC A;  2YML A;  1N63 A;  1QQ6 A;  3ISB A;  2YX8 A;  4RT3 A;  3B0Y A;  4IRD A;  5J2F A;  3MR2 A;  1Q3U A;  4UB2 A;  4KLD A;  2AXT U;  5ALR A;  5EE9 A;  1NK8 A;  3RRH A;  4QWA A;  4CRX A;  1L5U A;  2ATL A;  3A0B U;  4BWJ A;  5AKG A;  4YQW A;  3LDA A;  3RAQ A;  4QW8 A;  5B5E U;  1JX4 A;  1P7D A;  3M8R A;  2UVV A;  4YMN A;  3WK7 A;  1ED1 A;  2WF8 A;  4JV0 A;  1SKS A;  3TFS A;  4F4W A;  2ASJ A;  1ZQT A;  1TK5 A;  5IIM A;  5J8Y A;  3EPG A;  3QXG A;  4P4M A;  1IIP A;  1TKD A;  3GIM A;  1PVQ A;  4EBC A;  4O3S A;  8ICP A;  3SEI A;  4NLB A;  4ECQ A;  1WWU A;  3CW2 C;  2AGP A;  3C29 A;  2LM1 A;  3HKZ F;  3EPI A;  3RR8 A;  2ZIX A;  3NVZ A;  5AK3 A;  2AU0 A;  1XSP A;  4I2B A;  2P6R A;  4NLN A;  5C0Y A;  5KFT A;  3AL0 B;  1SWV A;  1NKC A;  3J81 j;  3WKD A;  3D2S A;  9ICU A;  4XUS A;  4M9N A;  2QB1 A;  3H0M B;  5D49 A;  3KFU F;  4FE3 A;  2QKQ A;  2YB4 A;  4Q8F A;  2I5H A;  4AYB C;  3OTQ A;  9ICX A;  4GXI A;  2FLL A;  4PH5 A;  4BDP A;  3GV7 B;  1AQ6 A;  5CA7 A;  1GO3 F;  1MSW D;  3LVW A;  4DSJ A;  4F5P A;  2YMP A;  1XO1 A;  2JZB A;  2ODG A;  2F8K A;  2F1J A;  1DOQ A;  4B9V A;  3BJY A;  1ZQU A;  4DO9 A;  4CE6 A;  2G5H B;  4C4T A;  1N2X A;  5AKJ A;  5CHG A;  2PKE A;  5KFD A;  2M0N A;  1MQ3 A;  2HBJ A;  4ACO A;  1NJY A;  4UAZ A;  1Y88 A;  1L7N A;  1SKW A;  3RRG A;  4Y2Y A;  1X9W A;  4ELT A;  3AMZ A;  3KOO A;  3RJK A;  7ICQ A;  4M9G A;  5DDM A;  3E0F A;  3CNH A;  5AIA A;  3ED5 A;  3R9K A;  4M04 A;  9ICE A;  5ALJ A;  2OEH A;  2VAN A;  4F2S A;  2F3N A;  1FFV A;  1NK0 A;  2JEI A;  2BCS A;  5AIB A;  2JHD A;  2UVU A;  5J2I A;  4KN7 A;  4O3R A;  4UAU A;  4Q45 A;  4YXM A;  2KD1 A;  3ORY A;  5HR7 A;  5AK4 A;  5JU5 A;  4B9S A;  4CCH A;  2KZ3 A;  3N97 B;  2UVW A;  5KFO A;  2G06 A;  1L6N A;  5DG7 A;  2HHS A;  2QAR B;  2K8B B;  5J0T A;  2WF7 A;  2WAQ C;  5KFF A;  2XY5 A;  3PW0 A;  1SWW A;  1ZD4 A;  2WB1 F;  4QZH A;  2E3T A;  4KLU A;  5DGB A;  4PZN A;  4UB3 A;  4RPY A;  2KIV A;  1YZ6 A;  5DBA A;  2W9C A;  4DFD A;  9ICL A;  5G5H A;  2FMS A;  8ICY A;  4DCC A;  2KSO A;  2KJ5 A;  2VA2 A;  5L1I A;  1B43 A;  4TUS A;  4QZF A;  2W9A A;  4ELU A;  1L7P A;  2YMQ A;  2W04 A;  4F5N A;  3NTU A;  2HOI A;  3ZDD A;  1BNO A;  3HWT A;  1QSY A;  1ZJN A;  2Q0Z X;  4U7C A;  2FMP A;  3GIL A;  2XI9 A;  4ECY A;  2AGQ A;  2G09 A;  4YVZ A;  2QB0 B;  2W9B A;  1J2N A;  2FI1 A;  1QQ7 A;  2KFZ A;  4QZE A;  4QWB A;  2BR0 A;  5KL8 B;  5KFB A;  2EZZ A;  4NV0 A;  1RZT A;  4P4P A;  2RQ5 A;  2KP7 A;  3HJE A;  4KIT B;  5DB7 A;  2E8P A;  2IOF A;  2XVT A;  3MGV A;  1JAL A;  2J6U A;  4XRH A;  3GIK A;  5CRX A;  4I2F A;  5IIL A;  2KOB A;  3KBB A;  5GTI U;  2MAX A;  2HHV A;  3DDH A;  4UB4 A;  1CEZ A;  2VIX A;  3QZ7 A;  4MEX A;  4GXJ A;  2HHU A;  2HBK A;  5KFE A;  2G5I B;  4LZD A;  1L7O A;  2C2D A;  1DK2 A;  4UAT A;  1ZQI A;  3RB3 A;  1L8L A;  4Y2R A;  4DS4 A;  5KFM A;  2LYB A;  7ICO A;  2BHN A;  4YR0 A;  4ED0 A;  3Q8P B;  4PHA A;  1SL0 A;  3AU6 A;  2GO7 A;  4TUQ A;  4I2J A;  1Z00 B;  1PK3 A;  4O5E A;  2W11 A;  2D8C A;  1ZQX A;  1T7P A;  1X2I A;  2F8L A;  3IG5 A;  2G07 A;  8ICU A;  2H3Z A;  1UA0 A;  4YR3 A;  1ZET A;  2WHE A;  1M6Y A;  2YB1 A;  4GLX A;  5KFK A;  1NK5 A;  4WJ3 B;  5AI6 A;  4I2D A;  3CYM A;  2KJ8 A;  3NGD A;  4DQS A;  2ZJ5 A;  3H40 A;  2KG5 A;  1S0M A;  5DLG A;  4RPX A;  2HCF A;  4RQ2 A;  3SD7 A;  5ALW A;  4BWM A;  2DGZ A;  4G3I A;  3V6K A;  3HIL A;  3BS7 A;  4OJ6 A;  5AK5 A;  3ZDA A;  4QZ8 A;  3QNM A;  5J2J A;  4YXJ A;  5KFW A;  4OJ5 A;  4KLE A;  3RBD A;  1N61 A;  1UPH A;  9ICV A;  3OJU A;  2V9W A;  1UT8 A;  8ICE A;  4F93 B;  5J8Y C;  1JXE A;  2EZX A;  1UT5 A;  3N4M B;  2DBY A;  2HOQ A;  3I1Y A;  3M9M B;  4ELV A;  4EBE A;  4OJL A;  5HMM A;  5KFU A;  4IL6 U;  2PFO A;  1QCK A;  2KHV A;  4UQG A;  1S5L U;  2W54 A;  2ZTD A;  2YY6 A;  2XCP A;  2ISP A;  2BCQ A;  3IM1 A;  5ALZ A;  3T5H A;  7ICU A;  3L3F X;  1U47 A;  4DSK A;  1PZN A;  2JZB B;  4QZD A;  5KNI A;  1SIJ A;  2R8K A;  9ICG A;  1Z19 A;  3GZF A;  3L4P A;  5ALD A;  4EEY A;  3WK8 A;  3EYZ A;  3GDX A;  2KTQ A;  2EDU A;  3BZK A;  1PK1 B;  1V38 A;  4A8E A;  1JRO A;  1DK3 A;  5KFQ A;  5K4L A;  3TI0 A;  1YZ7 A;  4ED1 A;  1T8E A;  2HSZ A;  3MAB A;  4F2R A;  5KG7 A;  2A1J A;  3VC8 A;  3JPR A;  2CXY A;  2C2E A;  2QLT A;  4TQS A;  2VJ4 A;  2NO5 A;  5EWF A;  4PHE A;  4Y2X A;  2V4Q A;  3EW9 A;  3WK5 A;  1TAM A;  3G6X A;  9ICR A;  3F2D A;  2PMZ C;  5ALH A;  3SI8 A;  2BGW A;  1N60 A;  4DOA A;  1JI7 A;  2ZJ8 A;  2H3F A;  5KL1 B;  4P0P B;  3FDS A;  3D2Q A;  1V85 A;  2KV2 A;  5CR0 A;  2F1H A;  1FO4 A;  2W3S A;  3WK4 A;  5DB9 A;  2P66 A;  1B0X A;  3C1Y A;  1NK9 A;  2HBL A;  2B0C A;  4F91 B;  5KFJ A;  4UAS A;  4O3N A;  2EAP A;  2W7O A;  4M9H A;  4CF5 A;  1ZQM A;  9ICC A;  2AH5 A;  4FS1 A;  3V7J A;  2BQ3 A;  1ZOL A;  1B4F A;  3JPO A;  2EH9 A;  2MU2 A;  5ALQ A;  3RFA A;  8ICT A;  3FM9 A;  2XO7 A;  8ICK A;  4DFJ A;  3RBE A;  1KDH A;  4KX5 A;  1ZQR A;  2HHW A;  1ZQS A;  2HVH A;  5CJ7 A;  3AUO A;  4MFF A;  4RT2 A;  1VJ5 A;  2OCE A;  5J2D A;  4ED6 A;  3JPS A;  2NRZ A;  2W9B B;  4R65 A;  5IIJ A;  1ARO P;  9ICN A;  4ECZ A;  4I2H A;  2ZG6 A;  3HP6 A;  4BUG A;  2JGA A;  1CI4 A;  2KEY A;  3H0R B;  1ZQZ A;  3HW8 A;  4FFD A;  3WU2 U;  2AJQ A;  3WK9 A;  5EWG A;  1WCL A;  2HHT A;  4RQ7 A;  3C5G A;  2ZXI A;  1BPD A;  5H2F U;  4J9L A;  2F76 X;  1IG6 A;  2JMG A;  4UB6 U;  1PVP A;  2Y0S F;  1L7M A;  1TK0 A;  4TQR A;  2KHQ A;  3N7R C;  4YN4 A;  2H3V A;  2R18 A;  4FO6 A;  1S0N A;  3OGU A;  3K1Z A;  2ZTE A;  4NLZ A;  8ICI A;  5BOM A;  1N48 A;  7ICP A;  1RG6 A;  4FZN A;  4IS7 A;  5KG2 A;  1OW5 A;  3ZD9 A;  5AKX A;  1SXD A;  1PUZ A;  4ED7 A;  1Q46 A;  1D8L A;  8ICV A;  4JK1 A;  1ZQY A;  1X42 A;  4DWI A;  4Y2P A;  3WKB A;  5DDY A;  1NK7 A;  4BXO B;  4Z6C A;  1KTQ A;  3M1Y A;  4QWD A;  1JUD A;  4IC9 A;  3L5K A;  5KT3 A;  1X6I A;  3K4G A;  3WKA A;  4MFA A;  4QIW C;  5J2H A;  1X9S A;  4I2I A;  3MFI A;  4QZ9 A;  5ALF A;  1DGS A;  7ICG A;  4IQU A;  4B9N A;  3OPX A;  2XIC A;  4UB1 A;  4KLL A;  2PFN A;  2JV3 A;  2YQE A;  3M7D A;  2ISO A;  3B0X A;  4M6W A;  3ISC A;  8ICQ A;  4F4Z A;  2R8G A;  2ESE A;  3QUQ A;  5CB1 A;  1KN5 A;  3KZX A;  1YT3 A;  3UQ2 A;  2CN1 A;  4ECW A;  3JPQ A;  1BPB A;  3AN1 A;  5DQI A;  4F8R A;  5DG9 A;  4NWI A;  1Q3V A;  2VA8 A;  3GFK B;  4P0Q A;  7ICM A;  5E79 U;  2G0A A;  2FPM A;  1K5O A;  5KT5 A;  4YD2 A;  5KG4 A;  3ZDC A;  2PI4 A;  5L1K A;  5ALK A;  1ZD3 A;  4FZL A;  2NRT A;  4DS5 A;  5KG6 A;  4JMU A;  2JEF A;  2K60 A;  3H8S A;  4CDG A;  1CRX A;  3DV9 A;  9ICT A;  2JEJ A;  4UB5 A;  4EEL A;  3C2M A;  2F1I A;  5EOZ A;  1L3U A;  4J9K A;  4EEK A;  3G6Y A;  4US9 A;  3E58 A;  4XA5 A;  3MR5 A;  3TAN A;  1JMS A;  2ZIW A;  4BJQ A;  3JPT A;  3D2N A;  1KQQ A;  4DL6 A;  4ECU A;  2PMZ F;  4QZB A;  1SZH A;  3I28 A;  1T3N A;  1S8O A;  3MDA A;  1NKB A;  1XU4 A;  4RQ1 A;  3CP8 A;  4J9R A;  2DPJ A;  4R63 A;  7ICS A;  3PSI A;  2RHF A;  1MA7 A;  4QZC A;  1KLN A;  1T4G A;  2IA6 A;  4DQQ A;  1NJZ A;  5ALT A;  1LVH A;  5DBB A;  5EWE A;  3Q8R B;  1JRP A;  3OHB A;  5DB8 A;  3U26 A;  5AI8 A;  5KFS A;  1QSS A;  3JPN A;  5CEH A;  2ASD A;  5ALO A;  5GTH U;  4KLF A;  5J2E A;  5KG0 A;  4DFK A;  4R8U B;  1WG8 A;  4QWC A;  2HHQ A;  4C7Y A;  1URJ A;  2KIC A;  1S10 A;  4UW9 A;  1X6J A;  3MFH A;  1ZXI A;  2EAM A;  4F4X A;  2ZIV A;  2OYY A;  4GXK A;  3A0H U;  4PZO A;  4I27 A;  3ALR A;  5AM3 A;  3SAH A;  1LKY A;  3T5K A;  5ALS A;  3DEE A;  4KLS A;  1RQN A;  5J2K A;  4YCX A;  4C0Z A;  1N62 A;  4O3Q A;  4RNN A;  3BS5 B;  2BPG A;  3GII A;  2H3I A;  2R8J A;  4B9M A;  1Z1B A;  7ICL A;  1IXR A;  4R64 A;  2FDR A;  4NLG A;  2MSN A;  3T3F A;  4E0D A;  4QZI A;  3UXP A;  2K8C B;  2BZF A;  3MGH A;  3NUQ A;  5KFV A;  3SR6 A;  1KKX A;  1BGX T;  5J0Y A;  5KG3 A;  2IMW P;  5DB6 A;  2W9M A;  2LHT A;  1XS9 D;  4OJO A;  4RQ5 A;  5ALU A;  4ECV A;  5ALG A;  9ICH A;  3BZC A;  1ZQE A;  5DKW A;  1QSL A;  3UPQ A;  1X40 A;  4KLI A;  5D46 A;  4HYK A;  5HHH A;  8ICM A;  3QUT A;  3PSF A;  3H4B A;  3AQF A;  5J0W A;  4U6P A;  1XSN A;  3C21 A;  2DQN B;  5BPC A;  3LYS A;  5J0R A;  1F0M A;  5AM0 A;  3MR3 A;  4QIW F;  2XGP A;  3OSN A;  4JWN A;  4ED3 A;  2KJ9 A;  3BQ0 A;  9ICP A;  2KFN A;  8ICB A; 
#chains in the Genus database with same CATH homology
 2JRZ A;  2EQY A;  2KK0 A;  2EH9 A;  1KQQ A;  1IG6 A;  2RQ5 A;  5CEH A;  1KN5 A;  2OEH A;  2LI6 A;  4LJX A;  1RYU A;  5K4L A;  2JXJ A;  2YQE A;  1C20 A;  1KKX A;  2LM1 A;  2CXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...