4JMUA

Crystal structure of hiv matrix residues 1-111 in complex with inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Enantiomeric Atropisomers Inhibit HCV Polymerase and/or HIV Matrix: Characterizing Hindered Bond Rotations and Target Selectivity.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 105
sequence length 105
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4jmuA00
2H3VA 4JMUA 1L6NA 1A6SA 2K4EA 2H3QA 2K4HA 2LYBA 1UPHA 2N1RA 4IC9A 2H3IA 2JMGA 2GOLA 2HMXA 2H3ZA 1HIWA 2H3FA 1ED1A 2NV3A 1ECWA 1HEKA 2K4IA 2LYAA 1TAMA 4ICAA
chains in the Genus database with same CATH superfamily
5KFHA 2WAQC 3N7SC 4FO6A 2WHEA 4YMMA 3FAHA 2IA6A 2KVSA 4DQSA 3SD7A 3WK4A 2GH1A 4RU9A 4O0IA 5CEHA 1L3UA 3E0FA 1NOMA 5ALWA 4F8RA 3UPQA 3LWLA 2AH5A 3B0XA 2PMZC 2ASJA 4FZNA 1MQ3A 4UAWA 4C80A 4QZIA 4UAYA 2PI5A 3AU2A 4R66A 3PR4A 4JV1A 2FLLA 2G5IB 3JPOA 4UB1A 1SWVA 4UB2A 7ICQA 2ZIVB 1K1SA 4I2AA 4UB3A 5AM4A 1ZQUA 1OXJA 2V4QA 3KHGA 2LYBA 5KAFU 5AIBA 4KLMA 1COKA 3NUQA 2D3DA 4NM1A 5DBCA 2OWOA 2D6FC 4ECZA 4KLUA 4DF4A 2HCFA 2ZIVA 2MAXA 1PVQA 1TK8A 3F2BA 3EW9A 3QZ8A 2LHTA 4I27A 2KSOB 3TFRA 4KLFA 5ALYA 1ZQQA 2W3SA 5A0LA 2FMPA 1SL0A 4KLLA 1N62A 3N7RC 1D9FA 3HPOA 4ECTA 2WF8A 1VLBA 2FE9A 8ICAA 4RNNA 5JTIA 1BPDA 1KSPA 3KKAC 1JXEA 4YMNA 4B9TA 3S6JA 4F71A 3RAQA 1PUZA 1Z19A 2KSOA 4ELVA 2M9NA 3BQ2A 4B9SA 1KFDA 2KICA 3NVZA 4ECWA 2GO7A 5KFMA 1RQLA 2A1JB 3ONNA 4I2GA 2W7OA 2XCPA 3PX6A 4J03A 4XA5A 1RQNA 1ZQCA 2KFNA 3LVVA 2K8CB 1Q3VA 5DB6A 5KFZA 3TAPA 4J9PA 1S9FA 3QU9A 1ZQLA 4F4WA 2A1JA 2CN1A 4RUAA 4X5VA 3AL0B 7ICVA 3WK5A 2G08A 2WF6A 2VANA 2UVVA 4RQ6A 1SXDA 1J2NA 2KKPA 2KIWA 3IHQB 2Y9TA 2V9WA 4CDGA 2W03A 3GV8B 2AJQA 2P35A 3BS5B 4KMUA 4GFJA 1RG6A 1S8OA 2ZUCA 4QZAA 4RQ8A 4DLGA 4YQWA 2HBLA 1JX4A 3DDHA 5KG0A 2DKXA 4OJLA 3EPGA 3Q8MA 3AQFA 1QCKA 2PI4A 1TVAA 1RXVA 4QWAA 4RQ5A 1UT5A 3NRWA 3LVWA 5ALDA 3I28A 3KKAA 4RQ1A 4M9GA 1COOA 4NL9C 4K4HA 4CGZA 3H0RB 1T3QA 8ICUA 4QNLA 5CA7A 4MEXA 3QU4A 1KN5A 4TUSA 2LKYA 4QWEA 2W3RA 2KN7A 2DPJA 1SB3C 2YTUA 3UQ0A 2KZZA 2NO4A 2HHUA 7ICPA 2JGAA 5ALIA 1ZQRA 1BNOA 3GDXA 1ZQZA 5L1JA 5L1MA 1X9SA 9ICJA 1ZQXA 3MFHA 2W9BB 4B9UA 5G5GA 3JPTA 3ZD8A 3V6JA 2JEIA 4KX5A 4QIWF 4CE6A 4YCXA 9ICQA 1FEZA 1Z4OA 1L3VA 2I9GA 7ICHA 5J0OA 1K1QA 2AGQA 5DB9A 4NLCA 4US8A 4QW9A 3E2EA 4QZCA 2RQ5A 4EZ9A 2W9BA 5KT5A 2ASDA 4DEZA 4MHVA 4F4ZA 2ZUDA 2Y0SC 1YT3A 3TI0A 3H0LB 1U47A 3QU5A 3V72A 4YXMA 4Y2UA 1V38A 1ZJMA 2HVHA 1O03A 8ICOA 5CJ7A 5AKGA 4RQ7A 3C1YA 3NS1A 2YMPA 5AI5A 1ZETA 2W9MA 2H3QA 1TFRA 3MDCA 3WKCA 1RYRA 3Q8SB 4A8EA 8ICPA 1SZPA 5AM5A 2KHVA 3A0BU 3TQ1A 3PW7A 2FDRA 3GV7B 4YMOA 4DQQA 3LDAA 4B6JA 3RH6A 2QKQA 3HJEA 2JR5A 4IC9A 1ZRMA 2DF4B 2CPRA 2H3ZA 1BPEA 1L7NA 4I2EA 3ZDAA 4RQNA 1U48A 3N28A 1XO0A 3Q8QB 4DS5A 4QWDA 1WWUA 3M9OB 5KG7A 2C2EA 5AKLA 2KJ8A 3MGHA 1L8LA 1LV5A 1UHUA 3O0FA 3PO4A 2HBJA 3Q8LA 8ICWA 1OUQA 9ICUA 3PO5A 3MR5A 2DFLA 5J0SA 9ICEA 4BUGA 2HDOA 4YG2A 1A77A 1IG6A 4EZ6A 5L1IA 5ALJA 4KLIA 1ZQEA 1D8YA 4UAZA 4Y2RA 5CWRA 3ED5A 2J6TA 7ICMA 3WK6A 1L8OA 3RF9A 3UMGA 1KLNA 2HHVA 4QZEA 2NRWA 1TK5A 2F1IA 3K4GA 1SV4A 1T94A 2W04A 1N5XA 3AM9A 3ZDDA 1SV0C 2Y9UA 1A76A 1ECWA 4UATA 5IILA 1DXSA 3UMBA 3RB6A 3H8WA 5DG8A 4QZFA 2H3VA 4EBEA 8ICHA 1ZYQA 3JPNA 1ZD2P 2LYHA 2AQ0A 2VJ5A 4UW9A 4MFFA 1X9MA 1BPYA 5KT3A 4BXOB 4C4RA 5GTIU 2KJ9A 3FM9A 5DDYA 2F2AB 2KOBA 2NV3A 2PFQA 5KFAA 4M9NA 4GC7A 4MF2A 2KZ3A 3H4BA 1NK7A 3MDAA 4O3QA 4DL2A 3RRGA 3OHAA 2XGQA 4ED1A 4P0PA 4BXOA 1ZQ1C 3SR6A 1TAUA 3KOOA 1FO4A 4QZHA 1ZQYA 2ZJ8A 5IIOA 1MSWD 4GXKA 3E58A 2LI6A 2KKVA 3RH5A 3PW2A 4O3MA 4F4KA 3QXGA 1X66A 2HHTA 3SZ2A 3QEBZ 9ICXA 4XRHA 1DK2A 3QUQA 3EYZA 2JHDA 5J2JA 1Z3EB 2GWSA 4OJPA 3RJGA 2NRZA 5EE1A 2HHSA 2W7PA 5L9XA 4NWIA 5ALMA 1SV0A 2KFZA 3RR7A 5KNIA 5DKWA 4M6WB 1C20A 3QUCA 2OM6A 1N61A 9ICOA 4GLXA 4C8KA 4QIWC 4F5QA 5KFWA 1U49A 3IDWA 3NVYA 1XS9D 2IBKA 2C22A 2QB0A 1ZD4A 4M6WA 2OYYA 1TAMA 1IXRA 4F3OA 2BQUA 4QJFB 2BKEA 1ZQDA 4YXJA 1F0MA 4DFMA 2KMDA 2Y1JA 2HI0A 2KE7A 1QSSA 1NZBA 3NASA 4BJQA 5DG7A 2YN4A 4YN4A 3SAFA 1K5OA 3PV8A 2BPGA 4F92B 4J9LA 4RQ4A 5AKIA 3PW0A 4I2CA 5F3XB 2ZG6A 1D8LA 3M1YA 3IRUA 3AUOA 2FMSA 5DQGA 4UB8U 3C1ZA 5KFTA 3H40A 4DSIA 2G0AA 1WUDA 5J2AA 1NK9A 1X40A 4I2JA 5DG9A 4UASA 4PZOA 1U4BA 7ICLA 5ALSA 3GILA 4DCCA 3C21A 5CHGA 2R8JA 3UXPA 1L3SA 3WKEA 1PK3A 2FMQA 3M7DA 3PSFA 4PHAA 3C23A 1BPZA 4RQ3A 3HKZC 8ICLA 2PXIA 1SIJA 5J2CA 3PW4A 3IM1A 3KZIU 4DFKA 5JU5A 1N2XA 1ZQOA 3ORYA 4FFDA 5DGAA 1UPHA 1ZXIA 2N1RA 1ZQKA 1S0MA 4DQPA 4GC6A 5IIJA 4F5OA 8ICBA 4GXIA 4DFJA 2BQRA 4R63A 4Z6DA 3V6HA 3HILA 1L7MA 2ZIXB 3SI8A 4RNOA 1F44A 3MC1A 2XCAA 4KLDA 3QEAZ 2M0NA 5AKHA 3HP6A 4PJ0U 4K4GA 4ED8A 2BZFA 2JRZA 3RJIA 4B9VA 3SQIA 1IIPA 2GOLA 4NJ8A 5EWEA 4ECVA 3L4PA 2XI9A 1OW5A 2D8CA 1JALA 2ZIXA 3OSNA 2ZJ5A 1XSNA 1WWVA 2OH2A 5KFQA 3ZDBA 3BQ0A 1SKRA 2W11A 3J81j 4B9MA 4O3PA 5AKYA 1Q8KA 2K4PA 4OCZA 3F2CA 1O08A 1X9XA 5ALLA 1LB2B 4YD2A 3PZPA 1T8EA 3OSPA 1PVRA 3ZI4A 3I76A 4CF5A 5HP4A 4KLQA 4CF3A 1KW4A 1CUKA 4F93B 2YB1A 9ICBA 2ESEA 2RLTA 4DFDA 3IG5A 4DS4A 1KDHA 2PFNA 4GXJA 1NJXA 3T3FA 2BPFA 2O6KA 2WB1F 4EX6A 3N7PD 1S5LU 5KT6A 4KLEA 5BOMA 3ZD9A 4UB5A 4DOBA 1S77D 4AYBC 1SKSA 2PKEA 2E8OA 2V4RA 4MEYA 4PGYA 5B5EU 1SGGA 1ZQBA 4ZH4A 3QU7A 1URJA 1FIQA 4MF8A 5C0YA 3SEIA 2XIDA 4Y2VA 1TAQA 2LBOA 3TANA 4US9A 2UVRA 4QZDA 3SMVA 3K1RB 3UXOA 3TKAA 4RNMA 4J9KA 1N63A 8ICSA 4OJOA 4EYIB 4PL2A 5HMLA 4DSEA 2BDUA 3RJJA 3OHBA 2HHWA 1WCLA 2VJ4A 3QYPA 2R8IA 3KD3A 4IRKA 4NLKA 2XY6A 4QWBA 7ICFA 3C5FA 2KV2A 3M6ZA 1Z00B 4PGXA 8ICIA 3H8SA 1N48A 4CRXA 5ALQA 1RM6C 3RJHA 2L5YA 1ZOLA 3T5HA 2C28A 8ICYA 2ALZA 1JROA 2WFAA 1SXEA 4ECXA 1PVPA 3D2NA 2XICA 1QSYA 5AK6A 3PSTA 4Q44A 5BOLA 4J9SA 2VA8A 1Z00A 1NK5A 4QZBA 5DDMA 2NRTA 4DOAA 2EZXA 3JPSA 2BCSA 5BPCA 3C29A 1ED1A 3M9MB 1NKEA 4DFPA 4O5EA 3KBBA 3H0MB 4JV2A 1HJPA 2ASLA 1DRGA 4JUZA 1H38A 3M8RA 1RZTA 1NK8A 1ZJNA 4P4MA 2EH9A 1ZQVA 1JI7A 4EELA 7ICTA 2W9AA 5KFJA 5D4BA 1MN8A 1Z4NA 1BNPA 5DB7A 5TISU 4RPYA 4DF8A 3NTUA 3BQ1A 5ALHA 3VCBA 2KNJA 3ZDEA 2K60A 5KFKA 4P4OA 4ZOHC 4F91B 2RDJA 4UARA 1TE2A 9ICVA 5KFEA 3OJUA 1TK0A 1ZD5A 2W8KA 3T5KA 4IL6U 3MBYA 3F5AA 3AU6A 9ICMA 3KHRA 2B6GA 3ISDA 9ICRA 3QE9Y 1BGXT 1DGSA 2G06A 4Y2QA 4KLJA 3ETLA 5KFPA 3R9KA 1LVHA 4R64A 2J6UA 2YMLA 7ICEA 5KAIU 4KTQA 3AQEA 5EE0A 1FFUA 5J2KA 4TURA 2DUYA 3PX0A 5KFBA 5E79U 5J2EA 4IS7A 1AROP 2MRLA 1KKXA 2AGPA 5KFYA 2GLEA 3G6VA 1C7YA 2DGZA 1S76D 4OO1J 2H3FA 2RP5A 5AI6A 3T5JA 2P6RA 2JH7A 5FP0A 2B21A 5J2GA 5J0RA 2DWQA 2IOFK 4YR0A 3WKAA 7ICGA 2XC9A 7ICJA 3RB4A 3B9JA 2EDUA 1A6SA 3ETRA 5DBBA 4DL5A 4KLGA 4FZLA 2WB1C 3T5LA 5JRTA 1Z1BA 2XGPA 2ATLA 2FLPA 1IM4A 3WK9A 1HUZA 3C2KA 3V6KA 4R65A 2KIVA 4J9NA 4KX3A 5J0YA 4LZDA 3CP8A 3F5EA 5CRXA 4NLNA 1HEKA 5KFDA 3PW5A 4YFKA 5AM1A 4O5KA 2JH1A 1LKYB 2G09A 2KJ5A 4C4SA 5CR0A 5D49A 3V7JA 2YX8A 1L5UA 5T14A 3UQ2A 4KN4A 1TV9A 2WAQF 1MQ2A 1SWWA 3QUTA 3TACB 4NLBA 4RQ0A 2Z7JA 5K4LA 1LKYA 1QTMA 2P6UA 1S10A 3LK9A 5J0PA 1TKDA 2VKQA 3ALRA 5HHIA 4EBDA 1ZQSA 1V9PA 2ZTDA 2PMZF 4P0PB 1SZHA 4Z6FA 2NRVA 3HX0A 7ICKA 2A19A 4J9RA 1UCVA 5J0TA 4EEKA 1NJZA 4XQ8A 4RQMA 2KVCA 2KD1A 4LJXA 2FPLA 1KFTA 2G07A 2FLNA 7ICOA 4DL6A 2XY7A 5KFLA 2WF7A 1KL9A 3B0YA 1KRPA 8ICFA 4DO9A 4M9LA 3GIMA 5DQHA 1S0NA 2K4HA 2BCQA 5KFVA 3KFUF 8ICRA 4DQRA 4O3RA 4RT3A 3PY8A 2F1JA 2A1AA 4C0ZA 3PX4A 4O9MA 3BDPA 2EZYA 4LVSA 5J0UA 3IG8A 2E8PA 4I2IA 2ODGA 3PSPA 3SV3A 3KHLA 4O3SA 3BZKA 4PZNA 4FBUA 2R8KA 2EAMA 3ISCA 1RYUA 1J2MA 5KFFA 1L3TA 1RDFA 4EENA 3K1ZA 4ACOA 3TARA 1ZQFA 4P2HA 9ICHA 3HWTA 2QB0B 2LM1A 4Y2PA 4QW8A 4CF4A 2ISOA 2BGWA 3ZDCA 4RPXA 3NRZA 1ZQMA 4B9NA 4C7YA 4I29A 5HR6A 2WF9A 4DSLA 9ICLA 1NKCA 4O3OA 3C5GA 8ICCA 5KFNA 4UB4A 8ICKA 2YB4A 3N4MB 2K4EA 4EYHB 1ZQJA 2MA1A 5AM2A 1UT8A 1KBUA 1ZQGA 4EX7A 5KG5A 4PHDA 4AP9A 5DQIA 9ICKA 4J9QA 2HW3A 4BGDA 2BR0A 8ICQA 4PL1A 3SAHA 1XU4A 1BVSA 5AKEA 2ZXHA 3MGVA 2VIXA 8ICJA 2HOQA 2FJ6A 2KEYA 3GIKA 4UB6U 1B22A 1GO3F 3RB3A 2R8GA 5TZVA 4M2YA 5G5HA 2W8LA 3N97B 3C28A 2KTQA 5AK4A 4F5NA 2OHFA 8ICVA 2Y1IA 2ZTCA 2BDPA 1JRPA 1NNLA 4YR3A 2E8NA 2YY6A 4JB3A 3LYSA 3G6XA 1XSPA 3PVXA 3D2SA 2F8KA 4RUCA 4QZGA 4ELTA 3THVA 4BWMA 2F1HA 2XO7A 3CNHA 5AIAA 4B9LA 1NI3A 5CP2A 1SL2A 5J0WA 4DQIA 5ALZA 1B4FA 2HSZA 4C4TA 2VA2A 1X6IA 3VC8A 4KMOB 5KTQA 5IINA 3MR2A 1B43A 2FPMA 2DL0A 3ISBA 4U6PA 5ALXA 1SL1A 1N5WA 3EPIA 2BCRA 4JWMA 1PZNA 3BZCA 1ZQNA 4NLZA 1HUOA 4Y2JA 4KLTA 1UA1A 2HHXA 4ICAA 4OJ5A 2NO5A 4FBTA 4J9MA 5KFCA 4I2FA 1Q46A 4DSKA 1XNSA 1PK1B 9ICIA 1WYGA 2C2RA 5KG2A 2JMGA 5AKJA 2E1FA 3CRXA 2B0CA 3GV5B 4ED0A 3F2DA 7ICNA 4NXZA 2F44A 3PMLA 2J6SA 8ICNA 2C2DA 3SYZA 2EZZA 4J9OA 2Y0SF 2BHNA 1J97A 1UA0A 4M9HA 3NVWA 1NJWA 3RFAA 1PK1A 5AKZA 1Y88A 2OCEA 1KQQA 4C8MA 3OJSA 4E0DA 1WCNA 1CEZA 4ED3A 4O3NA 2BPCA 3EZ5A 1ZQWA 2BQ3A 4Y2TA 7ICSA 3L3FX 5J0QA 3TAQA 3AEVA 3OTQA 2MUTB 4DL4A 3Q8PB 3OPXA 3GFKB 3F53A 4UAUA 1U9LA 3M6KA 4MFAA 5CB1A 2K8AA 4F5PA 1A0PA 1XC9A 3HW8A 2ZJAA 8ICGA 2H5XA 2EAPA 1RXWA 2F8LA 2MUTA 5ALEA 1F5SA 1QQ6A 1CI4A 4ED2A 4C8NA 4JMUA 2E5SA 5ALPA 4P4PA 5IIIA 2I1QA 3RJEA 3H8JA 5ALFA 3MGIA 5J2DA 5DB8A 3V7KA 2K4IA 4C8OA 4OJ6A 2LM4A 1T3NA 2A3VA 2HOIA 4NLGA 3U26A 1P7DA 4RPZA 5J29A 5AI0A 2F76X 3MABA 5B66U 2NYVA 4F2RA 3QUBA 5JUMA 3K75D 5KT7A 1B0XA 4C8LA 8ICXA 2NRXA 1L7PA 4EEYA 4F72A 2W43A 3I1YA 8ICMA 5DLGA 9ICGA 1WG8A 9ICCA 1NJYA 2FI1A 5C5JA 4TUQA 3PR5B 3TFSA 3QNMA 4Q45A 5AI9A 1QSLA 2P66A 4EBCA 3ICXA 4FE3A 4PPXA 3RRHA 2HOFA 2HVIA 4I2DA 4I2HA 1SKWA 2KK0A 2KHQA 3RR8A 5HMMA 4ED7A 3WKBA 3GU3A 4R8UB 4DWIA 2YMQA 5KL1B 5J8YC 5DBAA 3IV6A 2HBKA 5ALUA 1L6NA 1QLNA 4M04A 9ICWA 5J2IA 1YZ6A 4Q43A 3EUB2 1HIWA 1X9WA 5D46A 3OGUA 4R8UA 2QB1A 5AM0A 2MU2A 4JV0A 4F2SA 1N56A 5J2FA 2W54A 9ICSA 5ALOA 3BS7A 2OXOA 3CYMA 1XWLA 3JPRA 4M47A 3BS5A 3MFIA 4Y2SA 2I6XA 4F5RA 1JUDA 3HRDD 1IV8A 2ZXIA 3MR6A 3JPPA 4PHEA 3RBDA 4KN7A 4QWCA 3SAGA 2JEJA 4PHPA 3BQTA 3GIJA 4Q8FA 1RPLA 3NGDA 2JEGA 1QH9A 3WK7A 2CRXA 5GTHU 2AQ4A 5AM3A 4I28A 1NKBA 2R18A 2W55A 5KT4A 5KFGA 5AKKA 3C2LA 5KG1A 2WTFA 5HR7A 1ZQPA 4USAA 1Q3UA 5EOZA 4YP3A 2ISPA 9ICNA 3BQ7A 5KG3A 1QQ7A 5ALVA 5J8YA 1MC8A 1ZQIA 4G3IA 3FDSA 2EAOA 3C2MA 1X6JA 3T79A 4FS2A 4RQ2A 3RJKA 5EWGA 2ZIUB 2EANA 2JV3A 1NK0A 5IIKA 3H8MA 4JK1A 3MR3A 4IR9A 1S97A 3PMNA 4KITB 5J2HA 2LYAA 4ECQA 1ZQTA 1VDVA 2E1EA 3RAXA 3FYHA 1N60A 4NL9A 4JWNA 2QLTA 1MA7A 2ZIUA 4F4XA 2PFPA 3BJYA 1X42A 2CXYA 1JN3A 2IHNA 1DK3A 1UQVA 4ED6A 5ALTA 2F3NA 2PFOA 5AHXA 4BDPA 3UXNA 5KT2A 2XVTA 4KLOA 1QQ5A 4HYKA 4TUPA 4DOCA 1V85A 2IHMA 1S0VA 3WU2U 4QZ8A 1ZD3A 3D6JA 1ZQHA 4ECSA 3FC4A 2HHQA 5F9NA 2JEFA 3H7IA 2BCUA 2IOFA 4XUSA 5AK3A 1M6YA 3LWMA 3HKZF 7ICUA 5AKXA 3RB0A 4MFCA 2ES6A 5AI4A 2BCVA 1VJ5A 2HMXA 4NV0A 1D9DA 5AICA 2RDIA 2EQYA 4ECUA 5HHHA 4KLHA 4IQUA 5H2FU 2E8MA 4Z6EA 4F4YA 3IN5A 3Q8KA 9ICTA 5KG6A 8ICZA 2ZUBA 4HAIA 3SV4A 4O5CA 3Q8RB 2FPKA 4PGQA 4C7ZA 5HNKA 1D8BA 9ICPA 1ZQAA 3GQCA 4U7CA 1L7OA 3SENA 1BPBA 4UAVA 2YQEA 4M9JA 2WF5A 3GZFA 3RTVA 2OEHA 2DBYA 4IQWA 1JMSA 2LMRA 2KG5A 2Q4TA 2I5HA 4RZRA 1X2IA 5EWFA 2K89A 4CCHA 1Z1VA 2MSNA 4ELUA 5L1KA 2F77X 5KG4A 5AI8A 5KFIA 2G5HB 5KFUA 4F50A 2XY5A 1DGJA 2UVWA 5J0XA 2RHFA 1T7PA 1XO1A 2Q0ZX 3QU2A 5ALKA 4DLEA 3IP4B 5KFXA 2VA3A 2HBMA 5KFOA 4CNQA 3JPQA 4OD0A 1NZPA 3AMZA 3G6YA 5IIMA 1FFVA 5ALGA 1KTQA 4BWJA 3WK8A 2AHOB 3KZXA 1BPXA 2JXJA 2K8BB 5KL8B 1CRXA 3TADC 4GIBA 4P0QB 2H3IA 5L1LA 3WKDA 3M8SA 5DGBA 3V7LA 4Y2YA 2DKZA 4IQVA 1RYSA 4ECRA 1NK4A 4AYBF 5KFSA 4ECYA 1KFSA 4DSJA 1EXNA 4Z6CA 3NVVA 4IRCA 3RJFA 3QX7A 4P0QA 4UBBA 4IQTA 4UBCA 1S0OA 1V97A 3GIIA 3KTQA 2IMWP 4WJ3B 4M0AA 4UQGA 2ZIWB 3RH4A 3PSIA 3H4DA 4DL3A 3A0HU 2AGOA 2W9CB 1XSLA 3UMCA 4NM2A 2E3TA 4PH5A 4QZ9A 2JZBB 3PNCA 4LZGA 4I2BA 3AN1A 5ALNA 7ICRA 4BX9C 2ZIWA 2RRDA 3L5KA 4KLSA 4TQSA 4YVZA 5F9LA 2W9CA 3QZ7A 1T4GA 3D2QA 5AK5A 2KZMA 8ICEA 3DV9A 1YZ7A 2JZBA 4K4IA 3M9NB 9ICAA 3TADA 4YD1A 4RT2A 2LPEA 8ICTA 2QARB 1ZRNA 1DOQA 5KFRA 4TQRA 3RBEA 3KHHA 5ALRA 2YMMA 2KP7A 2DPIA 2AU0A 4Y2XA 4Q8EA 4G9BA 5EE9A 4FZMA 3UM9A 5EE3A 4DSFA 2ZTEA 2AXTU 1JIHA 5J2BA 4IRDA 3HT3A 1KEJA 3CW2C 2QARA 4NY8A 9ICFA 1AQ6A 4YR2A 2IOHA 2DQNB 4DL7A 2R8HA 1NK6A 4IR1A 3EWAA 4FS1A 1U45A 2UVUA 7ICIA 5DLFA 3DEEA 1JXLA
chains in the Genus database with same CATH topology
2KEYA 3D2NA 3ICXA 2XICA 4O3MA 3RFAA 2WAQC 4FE3A 3N7SC 3IN5A 1GO3F 3O0FA 1Z19A 4P0QA 2K4HA 2HBJA 2JHDA 2MRLA 3T79A 3PSTA 1OUQA 2YB1A 2HOFA 3KFUF 2ZIUB 3C28A 4OJPA 1D8BA 2DGZA 2KICA 3IG5A 2GH1A 4WJ3B 4OO1J 4C0ZA 2H3FA 2ZIWB 2RP5A 1ED1A 3M7DA 2KHQA 3PSIA 4BUGA 3PSFA 4U7CA 2W7PA 3E0FA 3ONNA 4NWIA 2WB1F 3GU3A 4KX5A 4QIWF 3L3FX 2W7OA 2JH7A 3H0MB 3HKZC 3IG8A 2LYAA 3N7PD 3PSPA 2PMZC 5KL1B 4FZNA 2HBKA 2E1EA 3OPXA 1DRGA 2OM6A 3LYSA 4NLCA 3F53A 1A6SA 1L6NA 3GZFA 3LVVA 4FZLA 3M6KA 2WB1C 4AYBC 1Z1BA 2ZIUA 4QIWC 1MA7A 1UPHA 2K8CB 2N1RA 1Q3VA 3RF9A 4BX9C 2Y0SC 3D2SA 1YT3A 2K8AA 1HIWA 2ZIWA 2RRDA 3H0LB 4KX3A 2Q4TA 1A0PA 2CN1A 3K1ZA 4ACOA 1T94A 2W04A 2G5IB 2K89A 3CP8A 3F5EA 3AL0B 1URJA 5C0YA 2G08A 2F77X 5CRXA 1ECWA 1HEKA 2XIDA 2ZIXB 1F44A 2OYYA 2F8LA 1TAMA 3D2QA 2LBOA 2ZIVB 3VC8A 4KMOB 2JH1A 2G5HB 2M0NA 2H3VA 4QJFB 2G09A 2KJ5A 4JMUA 3VCBA 2KKPA 2KNJA 2E5SA 2OXOA 3CYMA 2RHFA 3SMVA 2KIWA 2H3QA 2XVTA 4U6PA 2LYBA 2VJ5A 2YX8A 2W03A 4CDGA 5T14A 3SQIA 4GFJA 3IP4B 1IIPA 2GOLA 5HR6A 4A8EA 2KJ9A 3NUQA 2HBMA 4OJOA 2WAQF 2ZXIA 2XI9A 1NZBA 2HBLA 4PL2A 2F2AB 2KOBA 2NV3A 2ZIXA 4NLBA 4BJQA 2BDUA 4OJLA 2D6FC 2Z7JA 2KHVA 2K4IA 3SAFA 3AQFA 2ZIVA 3F5AA 3SAGA 4FZMA 4ICAA 4OJ6A 4OJ5A 2OH2A 3KZXA 2VJ4A 1PVQA 2K8BB 3F2BA 2A3VA 3NRWA 2HOIA 3LVWA 2YB4A 5KL8B 1P7DA 2K4EA 1XNSA 2VKQA 2ZG6A 1CRXA 3ALRA 2MA1A 2CRXA 1KBUA 4CGZA 4P0PA 2F76X 3HKZF 2LHTA 4IC9A 3H0RB 2H3IA 4P0QB 4QNLA 1ZQ1C 2DF4B 2CPRA 2JMGA 2PMZF 4P0PB 2G06A 1SZHA 2E1FA 2R18A 3F2CA 2HMXA 3CRXA 4NV0A 2H3ZA 2KV2A 5A0LA 3M6ZA 2DQNB 2LKYA 4PL1A 3SAHA 5HR7A 3F2DA 3N7RC 3PZPA 1Q3UA 4CRXA 2ZXHA 4AYBF 2G0AA 1PVRA 3MGVA 2VIXA 3AQEA 2KVCA 2KD1A 3DEEA 1XO0A 1WUDA 2G07A 2HOQA 2JGAA 3C29A 2Y0SF 2KKVA 2KJ8A 1PVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3V A;  4JMU A;  1L6N A;  1A6S A;  2K4E A;  2H3Q A;  2K4H A;  2LYB A;  1UPH A;  2N1R A;  4IC9 A;  2H3I A;  2JMG A;  2GOL A;  2HMX A;  2H3Z A;  1HIW A;  2H3F A;  1ED1 A;  2NV3 A;  1ECW A;  1HEK A;  2K4I A;  2LYA A;  1TAM A;  4ICA A; 
#chains in the Genus database with same CATH topology
 5KFH A;  2WAQ C;  3N7S C;  4FO6 A;  2WHE A;  4YMM A;  3FAH A;  2IA6 A;  2KVS A;  4DQS A;  3SD7 A;  3WK4 A;  2GH1 A;  4RU9 A;  4O0I A;  5CEH A;  1L3U A;  3E0F A;  1NOM A;  5ALW A;  4F8R A;  3UPQ A;  3LWL A;  2AH5 A;  3B0X A;  2PMZ C;  2ASJ A;  4FZN A;  1MQ3 A;  4UAW A;  4C80 A;  4QZI A;  4UAY A;  2PI5 A;  3AU2 A;  4R66 A;  3PR4 A;  4JV1 A;  2FLL A;  2G5I B;  3JPO A;  4UB1 A;  1SWV A;  4UB2 A;  7ICQ A;  2ZIV B;  1K1S A;  4I2A A;  4UB3 A;  5AM4 A;  1ZQU A;  1OXJ A;  2V4Q A;  3KHG A;  2LYB A;  5KAF U;  5AIB A;  4KLM A;  1COK A;  3NUQ A;  2D3D A;  4NM1 A;  5DBC A;  2OWO A;  2D6F C;  4ECZ A;  4KLU A;  4DF4 A;  2HCF A;  2ZIV A;  2MAX A;  1PVQ A;  1TK8 A;  3F2B A;  3EW9 A;  3QZ8 A;  2LHT A;  4I27 A;  2KSO B;  3TFR A;  4KLF A;  5ALY A;  1ZQQ A;  2W3S A;  5A0L A;  2FMP A;  1SL0 A;  4KLL A;  1N62 A;  3N7R C;  1D9F A;  3HPO A;  4ECT A;  2WF8 A;  1VLB A;  2FE9 A;  8ICA A;  4RNN A;  5JTI A;  1BPD A;  1KSP A;  3KKA C;  1JXE A;  4YMN A;  4B9T A;  3S6J A;  4F71 A;  3RAQ A;  1PUZ A;  1Z19 A;  2KSO A;  4ELV A;  2M9N A;  3BQ2 A;  4B9S A;  1KFD A;  2KIC A;  3NVZ A;  4ECW A;  2GO7 A;  5KFM A;  1RQL A;  2A1J B;  3ONN A;  4I2G A;  2W7O A;  2XCP A;  3PX6 A;  4J03 A;  4XA5 A;  1RQN A;  1ZQC A;  2KFN A;  3LVV A;  2K8C B;  1Q3V A;  5DB6 A;  5KFZ A;  3TAP A;  4J9P A;  1S9F A;  3QU9 A;  1ZQL A;  4F4W A;  2A1J A;  2CN1 A;  4RUA A;  4X5V A;  3AL0 B;  7ICV A;  3WK5 A;  2G08 A;  2WF6 A;  2VAN A;  2UVV A;  4RQ6 A;  1SXD A;  1J2N A;  2KKP A;  2KIW A;  3IHQ B;  2Y9T A;  2V9W A;  4CDG A;  2W03 A;  3GV8 B;  2AJQ A;  2P35 A;  3BS5 B;  4KMU A;  4GFJ A;  1RG6 A;  1S8O A;  2ZUC A;  4QZA A;  4RQ8 A;  4DLG A;  4YQW A;  2HBL A;  1JX4 A;  3DDH A;  5KG0 A;  2DKX A;  4OJL A;  3EPG A;  3Q8M A;  3AQF A;  1QCK A;  2PI4 A;  1TVA A;  1RXV A;  4QWA A;  4RQ5 A;  1UT5 A;  3NRW A;  3LVW A;  5ALD A;  3I28 A;  3KKA A;  4RQ1 A;  4M9G A;  1COO A;  4NL9 C;  4K4H A;  4CGZ A;  3H0R B;  1T3Q A;  8ICU A;  4QNL A;  5CA7 A;  4MEX A;  3QU4 A;  1KN5 A;  4TUS A;  2LKY A;  4QWE A;  2W3R A;  2KN7 A;  2DPJ A;  1SB3 C;  2YTU A;  3UQ0 A;  2KZZ A;  2NO4 A;  2HHU A;  7ICP A;  2JGA A;  5ALI A;  1ZQR A;  1BNO A;  3GDX A;  1ZQZ A;  5L1J A;  5L1M A;  1X9S A;  9ICJ A;  1ZQX A;  3MFH A;  2W9B B;  4B9U A;  5G5G A;  3JPT A;  3ZD8 A;  3V6J A;  2JEI A;  4KX5 A;  4QIW F;  4CE6 A;  4YCX A;  9ICQ A;  1FEZ A;  1Z4O A;  1L3V A;  2I9G A;  7ICH A;  5J0O A;  1K1Q A;  2AGQ A;  5DB9 A;  4NLC A;  4US8 A;  4QW9 A;  3E2E A;  4QZC A;  2RQ5 A;  4EZ9 A;  2W9B A;  5KT5 A;  2ASD A;  4DEZ A;  4MHV A;  4F4Z A;  2ZUD A;  2Y0S C;  1YT3 A;  3TI0 A;  3H0L B;  1U47 A;  3QU5 A;  3V72 A;  4YXM A;  4Y2U A;  1V38 A;  1ZJM A;  2HVH A;  1O03 A;  8ICO A;  5CJ7 A;  5AKG A;  4RQ7 A;  3C1Y A;  3NS1 A;  2YMP A;  5AI5 A;  1ZET A;  2W9M A;  2H3Q A;  1TFR A;  3MDC A;  3WKC A;  1RYR A;  3Q8S B;  4A8E A;  8ICP A;  1SZP A;  5AM5 A;  2KHV A;  3A0B U;  3TQ1 A;  3PW7 A;  2FDR A;  3GV7 B;  4YMO A;  4DQQ A;  3LDA A;  4B6J A;  3RH6 A;  2QKQ A;  3HJE A;  2JR5 A;  4IC9 A;  1ZRM A;  2DF4 B;  2CPR A;  2H3Z A;  1BPE A;  1L7N A;  4I2E A;  3ZDA A;  4RQN A;  1U48 A;  3N28 A;  1XO0 A;  3Q8Q B;  4DS5 A;  4QWD A;  1WWU A;  3M9O B;  5KG7 A;  2C2E A;  5AKL A;  2KJ8 A;  3MGH A;  1L8L A;  1LV5 A;  1UHU A;  3O0F A;  3PO4 A;  2HBJ A;  3Q8L A;  8ICW A;  1OUQ A;  9ICU A;  3PO5 A;  3MR5 A;  2DFL A;  5J0S A;  9ICE A;  4BUG A;  2HDO A;  4YG2 A;  1A77 A;  1IG6 A;  4EZ6 A;  5L1I A;  5ALJ A;  4KLI A;  1ZQE A;  1D8Y A;  4UAZ A;  4Y2R A;  5CWR A;  3ED5 A;  2J6T A;  7ICM A;  3WK6 A;  1L8O A;  3RF9 A;  3UMG A;  1KLN A;  2HHV A;  4QZE A;  2NRW A;  1TK5 A;  2F1I A;  3K4G A;  1SV4 A;  1T94 A;  2W04 A;  1N5X A;  3AM9 A;  3ZDD A;  1SV0 C;  2Y9U A;  1A76 A;  1ECW A;  4UAT A;  5IIL A;  1DXS A;  3UMB A;  3RB6 A;  3H8W A;  5DG8 A;  4QZF A;  2H3V A;  4EBE A;  8ICH A;  1ZYQ A;  3JPN A;  1ZD2 P;  2LYH A;  2AQ0 A;  2VJ5 A;  4UW9 A;  4MFF A;  1X9M A;  1BPY A;  5KT3 A;  4BXO B;  4C4R A;  5GTI U;  2KJ9 A;  3FM9 A;  5DDY A;  2F2A B;  2KOB A;  2NV3 A;  2PFQ A;  5KFA A;  4M9N A;  4GC7 A;  4MF2 A;  2KZ3 A;  3H4B A;  1NK7 A;  3MDA A;  4O3Q A;  4DL2 A;  3RRG A;  3OHA A;  2XGQ A;  4ED1 A;  4P0P A;  4BXO A;  1ZQ1 C;  3SR6 A;  1TAU A;  3KOO A;  1FO4 A;  4QZH A;  1ZQY A;  2ZJ8 A;  5IIO A;  1MSW D;  4GXK A;  3E58 A;  2LI6 A;  2KKV A;  3RH5 A;  3PW2 A;  4O3M A;  4F4K A;  3QXG A;  1X66 A;  2HHT A;  3SZ2 A;  3QEB Z;  9ICX A;  4XRH A;  1DK2 A;  3QUQ A;  3EYZ A;  2JHD A;  5J2J A;  1Z3E B;  2GWS A;  4OJP A;  3RJG A;  2NRZ A;  5EE1 A;  2HHS A;  2W7P A;  5L9X A;  4NWI A;  5ALM A;  1SV0 A;  2KFZ A;  3RR7 A;  5KNI A;  5DKW A;  4M6W B;  1C20 A;  3QUC A;  2OM6 A;  1N61 A;  9ICO A;  4GLX A;  4C8K A;  4QIW C;  4F5Q A;  5KFW A;  1U49 A;  3IDW A;  3NVY A;  1XS9 D;  2IBK A;  2C22 A;  2QB0 A;  1ZD4 A;  4M6W A;  2OYY A;  1TAM A;  1IXR A;  4F3O A;  2BQU A;  4QJF B;  2BKE A;  1ZQD A;  4YXJ A;  1F0M A;  4DFM A;  2KMD A;  2Y1J A;  2HI0 A;  2KE7 A;  1QSS A;  1NZB A;  3NAS A;  4BJQ A;  5DG7 A;  2YN4 A;  4YN4 A;  3SAF A;  1K5O A;  3PV8 A;  2BPG A;  4F92 B;  4J9L A;  4RQ4 A;  5AKI A;  3PW0 A;  4I2C A;  5F3X B;  2ZG6 A;  1D8L A;  3M1Y A;  3IRU A;  3AUO A;  2FMS A;  5DQG A;  4UB8 U;  3C1Z A;  5KFT A;  3H40 A;  4DSI A;  2G0A A;  1WUD A;  5J2A A;  1NK9 A;  1X40 A;  4I2J A;  5DG9 A;  4UAS A;  4PZO A;  1U4B A;  7ICL A;  5ALS A;  3GIL A;  4DCC A;  3C21 A;  5CHG A;  2R8J A;  3UXP A;  1L3S A;  3WKE A;  1PK3 A;  2FMQ A;  3M7D A;  3PSF A;  4PHA A;  3C23 A;  1BPZ A;  4RQ3 A;  3HKZ C;  8ICL A;  2PXI A;  1SIJ A;  5J2C A;  3PW4 A;  3IM1 A;  3KZI U;  4DFK A;  5JU5 A;  1N2X A;  1ZQO A;  3ORY A;  4FFD A;  5DGA A;  1UPH A;  1ZXI A;  2N1R A;  1ZQK A;  1S0M A;  4DQP A;  4GC6 A;  5IIJ A;  4F5O A;  8ICB A;  4GXI A;  4DFJ A;  2BQR A;  4R63 A;  4Z6D A;  3V6H A;  3HIL A;  1L7M A;  2ZIX B;  3SI8 A;  4RNO A;  1F44 A;  3MC1 A;  2XCA A;  4KLD A;  3QEA Z;  2M0N A;  5AKH A;  3HP6 A;  4PJ0 U;  4K4G A;  4ED8 A;  2BZF A;  2JRZ A;  3RJI A;  4B9V A;  3SQI A;  1IIP A;  2GOL A;  4NJ8 A;  5EWE A;  4ECV A;  3L4P A;  2XI9 A;  1OW5 A;  2D8C A;  1JAL A;  2ZIX A;  3OSN A;  2ZJ5 A;  1XSN A;  1WWV A;  2OH2 A;  5KFQ A;  3ZDB A;  3BQ0 A;  1SKR A;  2W11 A;  3J81 j;  4B9M A;  4O3P A;  5AKY A;  1Q8K A;  2K4P A;  4OCZ A;  3F2C A;  1O08 A;  1X9X A;  5ALL A;  1LB2 B;  4YD2 A;  3PZP A;  1T8E A;  3OSP A;  1PVR A;  3ZI4 A;  3I76 A;  4CF5 A;  5HP4 A;  4KLQ A;  4CF3 A;  1KW4 A;  1CUK A;  4F93 B;  2YB1 A;  9ICB A;  2ESE A;  2RLT A;  4DFD A;  3IG5 A;  4DS4 A;  1KDH A;  2PFN A;  4GXJ A;  1NJX A;  3T3F A;  2BPF A;  2O6K A;  2WB1 F;  4EX6 A;  3N7P D;  1S5L U;  5KT6 A;  4KLE A;  5BOM A;  3ZD9 A;  4UB5 A;  4DOB A;  1S77 D;  4AYB C;  1SKS A;  2PKE A;  2E8O A;  2V4R A;  4MEY A;  4PGY A;  5B5E U;  1SGG A;  1ZQB A;  4ZH4 A;  3QU7 A;  1URJ A;  1FIQ A;  4MF8 A;  5C0Y A;  3SEI A;  2XID A;  4Y2V A;  1TAQ A;  2LBO A;  3TAN A;  4US9 A;  2UVR A;  4QZD A;  3SMV A;  3K1R B;  3UXO A;  3TKA A;  4RNM A;  4J9K A;  1N63 A;  8ICS A;  4OJO A;  4EYI B;  4PL2 A;  5HML A;  4DSE A;  2BDU A;  3RJJ A;  3OHB A;  2HHW A;  1WCL A;  2VJ4 A;  3QYP A;  2R8I A;  3KD3 A;  4IRK A;  4NLK A;  2XY6 A;  4QWB A;  7ICF A;  3C5F A;  2KV2 A;  3M6Z A;  1Z00 B;  4PGX A;  8ICI A;  3H8S A;  1N48 A;  4CRX A;  5ALQ A;  1RM6 C;  3RJH A;  2L5Y A;  1ZOL A;  3T5H A;  2C28 A;  8ICY A;  2ALZ A;  1JRO A;  2WFA A;  1SXE A;  4ECX A;  1PVP A;  3D2N A;  2XIC A;  1QSY A;  5AK6 A;  3PST A;  4Q44 A;  5BOL A;  4J9S A;  2VA8 A;  1Z00 A;  1NK5 A;  4QZB A;  5DDM A;  2NRT A;  4DOA A;  2EZX A;  3JPS A;  2BCS A;  5BPC A;  3C29 A;  1ED1 A;  3M9M B;  1NKE A;  4DFP A;  4O5E A;  3KBB A;  3H0M B;  4JV2 A;  1HJP A;  2ASL A;  1DRG A;  4JUZ A;  1H38 A;  3M8R A;  1RZT A;  1NK8 A;  1ZJN A;  4P4M A;  2EH9 A;  1ZQV A;  1JI7 A;  4EEL A;  7ICT A;  2W9A A;  5KFJ A;  5D4B A;  1MN8 A;  1Z4N A;  1BNP A;  5DB7 A;  5TIS U;  4RPY A;  4DF8 A;  3NTU A;  3BQ1 A;  5ALH A;  3VCB A;  2KNJ A;  3ZDE A;  2K60 A;  5KFK A;  4P4O A;  4ZOH C;  4F91 B;  2RDJ A;  4UAR A;  1TE2 A;  9ICV A;  5KFE A;  3OJU A;  1TK0 A;  1ZD5 A;  2W8K A;  3T5K A;  4IL6 U;  3MBY A;  3F5A A;  3AU6 A;  9ICM A;  3KHR A;  2B6G A;  3ISD A;  9ICR A;  3QE9 Y;  1BGX T;  1DGS A;  2G06 A;  4Y2Q A;  4KLJ A;  3ETL A;  5KFP A;  3R9K A;  1LVH A;  4R64 A;  2J6U A;  2YML A;  7ICE A;  5KAI U;  4KTQ A;  3AQE A;  5EE0 A;  1FFU A;  5J2K A;  4TUR A;  2DUY A;  3PX0 A;  5KFB A;  5E79 U;  5J2E A;  4IS7 A;  1ARO P;  2MRL A;  1KKX A;  2AGP A;  5KFY A;  2GLE A;  3G6V A;  1C7Y A;  2DGZ A;  1S76 D;  4OO1 J;  2H3F A;  2RP5 A;  5AI6 A;  3T5J A;  2P6R A;  2JH7 A;  5FP0 A;  2B21 A;  5J2G A;  5J0R A;  2DWQ A;  2IOF K;  4YR0 A;  3WKA A;  7ICG A;  2XC9 A;  7ICJ A;  3RB4 A;  3B9J A;  2EDU A;  1A6S A;  3ETR A;  5DBB A;  4DL5 A;  4KLG A;  4FZL A;  2WB1 C;  3T5L A;  5JRT A;  1Z1B A;  2XGP A;  2ATL A;  2FLP A;  1IM4 A;  3WK9 A;  1HUZ A;  3C2K A;  3V6K A;  4R65 A;  2KIV A;  4J9N A;  4KX3 A;  5J0Y A;  4LZD A;  3CP8 A;  3F5E A;  5CRX A;  4NLN A;  1HEK A;  5KFD A;  3PW5 A;  4YFK A;  5AM1 A;  4O5K A;  2JH1 A;  1LKY B;  2G09 A;  2KJ5 A;  4C4S A;  5CR0 A;  5D49 A;  3V7J A;  2YX8 A;  1L5U A;  5T14 A;  3UQ2 A;  4KN4 A;  1TV9 A;  2WAQ F;  1MQ2 A;  1SWW A;  3QUT A;  3TAC B;  4NLB A;  4RQ0 A;  2Z7J A;  5K4L A;  1LKY A;  1QTM A;  2P6U A;  1S10 A;  3LK9 A;  5J0P A;  1TKD A;  2VKQ A;  3ALR A;  5HHI A;  4EBD A;  1ZQS A;  1V9P A;  2ZTD A;  2PMZ F;  4P0P B;  1SZH A;  4Z6F A;  2NRV A;  3HX0 A;  7ICK A;  2A19 A;  4J9R A;  1UCV A;  5J0T A;  4EEK A;  1NJZ A;  4XQ8 A;  4RQM A;  2KVC A;  2KD1 A;  4LJX A;  2FPL A;  1KFT A;  2G07 A;  2FLN A;  7ICO A;  4DL6 A;  2XY7 A;  5KFL A;  2WF7 A;  1KL9 A;  3B0Y A;  1KRP A;  8ICF A;  4DO9 A;  4M9L A;  3GIM A;  5DQH A;  1S0N A;  2K4H A;  2BCQ A;  5KFV A;  3KFU F;  8ICR A;  4DQR A;  4O3R A;  4RT3 A;  3PY8 A;  2F1J A;  2A1A A;  4C0Z A;  3PX4 A;  4O9M A;  3BDP A;  2EZY A;  4LVS A;  5J0U A;  3IG8 A;  2E8P A;  4I2I A;  2ODG A;  3PSP A;  3SV3 A;  3KHL A;  4O3S A;  3BZK A;  4PZN A;  4FBU A;  2R8K A;  2EAM A;  3ISC A;  1RYU A;  1J2M A;  5KFF A;  1L3T A;  1RDF A;  4EEN A;  3K1Z A;  4ACO A;  3TAR A;  1ZQF A;  4P2H A;  9ICH A;  3HWT A;  2QB0 B;  2LM1 A;  4Y2P A;  4QW8 A;  4CF4 A;  2ISO A;  2BGW A;  3ZDC A;  4RPX A;  3NRZ A;  1ZQM A;  4B9N A;  4C7Y A;  4I29 A;  5HR6 A;  2WF9 A;  4DSL A;  9ICL A;  1NKC A;  4O3O A;  3C5G A;  8ICC A;  5KFN A;  4UB4 A;  8ICK A;  2YB4 A;  3N4M B;  2K4E A;  4EYH B;  1ZQJ A;  2MA1 A;  5AM2 A;  1UT8 A;  1KBU A;  1ZQG A;  4EX7 A;  5KG5 A;  4PHD A;  4AP9 A;  5DQI A;  9ICK A;  4J9Q A;  2HW3 A;  4BGD A;  2BR0 A;  8ICQ A;  4PL1 A;  3SAH A;  1XU4 A;  1BVS A;  5AKE A;  2ZXH A;  3MGV A;  2VIX A;  8ICJ A;  2HOQ A;  2FJ6 A;  2KEY A;  3GIK A;  4UB6 U;  1B22 A;  1GO3 F;  3RB3 A;  2R8G A;  5TZV A;  4M2Y A;  5G5H A;  2W8L A;  3N97 B;  3C28 A;  2KTQ A;  5AK4 A;  4F5N A;  2OHF A;  8ICV A;  2Y1I A;  2ZTC A;  2BDP A;  1JRP A;  1NNL A;  4YR3 A;  2E8N A;  2YY6 A;  4JB3 A;  3LYS A;  3G6X A;  1XSP A;  3PVX A;  3D2S A;  2F8K A;  4RUC A;  4QZG A;  4ELT A;  3THV A;  4BWM A;  2F1H A;  2XO7 A;  3CNH A;  5AIA A;  4B9L A;  1NI3 A;  5CP2 A;  1SL2 A;  5J0W A;  4DQI A;  5ALZ A;  1B4F A;  2HSZ A;  4C4T A;  2VA2 A;  1X6I A;  3VC8 A;  4KMO B;  5KTQ A;  5IIN A;  3MR2 A;  1B43 A;  2FPM A;  2DL0 A;  3ISB A;  4U6P A;  5ALX A;  1SL1 A;  1N5W A;  3EPI A;  2BCR A;  4JWM A;  1PZN A;  3BZC A;  1ZQN A;  4NLZ A;  1HUO A;  4Y2J A;  4KLT A;  1UA1 A;  2HHX A;  4ICA A;  4OJ5 A;  2NO5 A;  4FBT A;  4J9M A;  5KFC A;  4I2F A;  1Q46 A;  4DSK A;  1XNS A;  1PK1 B;  9ICI A;  1WYG A;  2C2R A;  5KG2 A;  2JMG A;  5AKJ A;  2E1F A;  3CRX A;  2B0C A;  3GV5 B;  4ED0 A;  3F2D A;  7ICN A;  4NXZ A;  2F44 A;  3PML A;  2J6S A;  8ICN A;  2C2D A;  3SYZ A;  2EZZ A;  4J9O A;  2Y0S F;  2BHN A;  1J97 A;  1UA0 A;  4M9H A;  3NVW A;  1NJW A;  3RFA A;  1PK1 A;  5AKZ A;  1Y88 A;  2OCE A;  1KQQ A;  4C8M A;  3OJS A;  4E0D A;  1WCN A;  1CEZ A;  4ED3 A;  4O3N A;  2BPC A;  3EZ5 A;  1ZQW A;  2BQ3 A;  4Y2T A;  7ICS A;  3L3F X;  5J0Q A;  3TAQ A;  3AEV A;  3OTQ A;  2MUT B;  4DL4 A;  3Q8P B;  3OPX A;  3GFK B;  3F53 A;  4UAU A;  1U9L A;  3M6K A;  4MFA A;  5CB1 A;  2K8A A;  4F5P A;  1A0P A;  1XC9 A;  3HW8 A;  2ZJA A;  8ICG A;  2H5X A;  2EAP A;  1RXW A;  2F8L A;  2MUT A;  5ALE A;  1F5S A;  1QQ6 A;  1CI4 A;  4ED2 A;  4C8N A;  4JMU A;  2E5S A;  5ALP A;  4P4P A;  5III A;  2I1Q A;  3RJE A;  3H8J A;  5ALF A;  3MGI A;  5J2D A;  5DB8 A;  3V7K A;  2K4I A;  4C8O A;  4OJ6 A;  2LM4 A;  1T3N A;  2A3V A;  2HOI A;  4NLG A;  3U26 A;  1P7D A;  4RPZ A;  5J29 A;  5AI0 A;  2F76 X;  3MAB A;  5B66 U;  2NYV A;  4F2R A;  3QUB A;  5JUM A;  3K75 D;  5KT7 A;  1B0X A;  4C8L A;  8ICX A;  2NRX A;  1L7P A;  4EEY A;  4F72 A;  2W43 A;  3I1Y A;  8ICM A;  5DLG A;  9ICG A;  1WG8 A;  9ICC A;  1NJY A;  2FI1 A;  5C5J A;  4TUQ A;  3PR5 B;  3TFS A;  3QNM A;  4Q45 A;  5AI9 A;  1QSL A;  2P66 A;  4EBC A;  3ICX A;  4FE3 A;  4PPX A;  3RRH A;  2HOF A;  2HVI A;  4I2D A;  4I2H A;  1SKW A;  2KK0 A;  2KHQ A;  3RR8 A;  5HMM A;  4ED7 A;  3WKB A;  3GU3 A;  4R8U B;  4DWI A;  2YMQ A;  5KL1 B;  5J8Y C;  5DBA A;  3IV6 A;  2HBK A;  5ALU A;  1L6N A;  1QLN A;  4M04 A;  9ICW A;  5J2I A;  1YZ6 A;  4Q43 A;  3EUB 2;  1HIW A;  1X9W A;  5D46 A;  3OGU A;  4R8U A;  2QB1 A;  5AM0 A;  2MU2 A;  4JV0 A;  4F2S A;  1N56 A;  5J2F A;  2W54 A;  9ICS A;  5ALO A;  3BS7 A;  2OXO A;  3CYM A;  1XWL A;  3JPR A;  4M47 A;  3BS5 A;  3MFI A;  4Y2S A;  2I6X A;  4F5R A;  1JUD A;  3HRD D;  1IV8 A;  2ZXI A;  3MR6 A;  3JPP A;  4PHE A;  3RBD A;  4KN7 A;  4QWC A;  3SAG A;  2JEJ A;  4PHP A;  3BQT A;  3GIJ A;  4Q8F A;  1RPL A;  3NGD A;  2JEG A;  1QH9 A;  3WK7 A;  2CRX A;  5GTH U;  2AQ4 A;  5AM3 A;  4I28 A;  1NKB A;  2R18 A;  2W55 A;  5KT4 A;  5KFG A;  5AKK A;  3C2L A;  5KG1 A;  2WTF A;  5HR7 A;  1ZQP A;  4USA A;  1Q3U A;  5EOZ A;  4YP3 A;  2ISP A;  9ICN A;  3BQ7 A;  5KG3 A;  1QQ7 A;  5ALV A;  5J8Y A;  1MC8 A;  1ZQI A;  4G3I A;  3FDS A;  2EAO A;  3C2M A;  1X6J A;  3T79 A;  4FS2 A;  4RQ2 A;  3RJK A;  5EWG A;  2ZIU B;  2EAN A;  2JV3 A;  1NK0 A;  5IIK A;  3H8M A;  4JK1 A;  3MR3 A;  4IR9 A;  1S97 A;  3PMN A;  4KIT B;  5J2H A;  2LYA A;  4ECQ A;  1ZQT A;  1VDV A;  2E1E A;  3RAX A;  3FYH A;  1N60 A;  4NL9 A;  4JWN A;  2QLT A;  1MA7 A;  2ZIU A;  4F4X A;  2PFP A;  3BJY A;  1X42 A;  2CXY A;  1JN3 A;  2IHN A;  1DK3 A;  1UQV A;  4ED6 A;  5ALT A;  2F3N A;  2PFO A;  5AHX A;  4BDP A;  3UXN A;  5KT2 A;  2XVT A;  4KLO A;  1QQ5 A;  4HYK A;  4TUP A;  4DOC A;  1V85 A;  2IHM A;  1S0V A;  3WU2 U;  4QZ8 A;  1ZD3 A;  3D6J A;  1ZQH A;  4ECS A;  3FC4 A;  2HHQ A;  5F9N A;  2JEF A;  3H7I A;  2BCU A;  2IOF A;  4XUS A;  5AK3 A;  1M6Y A;  3LWM A;  3HKZ F;  7ICU A;  5AKX A;  3RB0 A;  4MFC A;  2ES6 A;  5AI4 A;  2BCV A;  1VJ5 A;  2HMX A;  4NV0 A;  1D9D A;  5AIC A;  2RDI A;  2EQY A;  4ECU A;  5HHH A;  4KLH A;  4IQU A;  5H2F U;  2E8M A;  4Z6E A;  4F4Y A;  3IN5 A;  3Q8K A;  9ICT A;  5KG6 A;  8ICZ A;  2ZUB A;  4HAI A;  3SV4 A;  4O5C A;  3Q8R B;  2FPK A;  4PGQ A;  4C7Z A;  5HNK A;  1D8B A;  9ICP A;  1ZQA A;  3GQC A;  4U7C A;  1L7O A;  3SEN A;  1BPB A;  4UAV A;  2YQE A;  4M9J A;  2WF5 A;  3GZF A;  3RTV A;  2OEH A;  2DBY A;  4IQW A;  1JMS A;  2LMR A;  2KG5 A;  2Q4T A;  2I5H A;  4RZR A;  1X2I A;  5EWF A;  2K89 A;  4CCH A;  1Z1V A;  2MSN A;  4ELU A;  5L1K A;  2F77 X;  5KG4 A;  5AI8 A;  5KFI A;  2G5H B;  5KFU A;  4F50 A;  2XY5 A;  1DGJ A;  2UVW A;  5J0X A;  2RHF A;  1T7P A;  1XO1 A;  2Q0Z X;  3QU2 A;  5ALK A;  4DLE A;  3IP4 B;  5KFX A;  2VA3 A;  2HBM A;  5KFO A;  4CNQ A;  3JPQ A;  4OD0 A;  1NZP A;  3AMZ A;  3G6Y A;  5IIM A;  1FFV A;  5ALG A;  1KTQ A;  4BWJ A;  3WK8 A;  2AHO B;  3KZX A;  1BPX A;  2JXJ A;  2K8B B;  5KL8 B;  1CRX A;  3TAD C;  4GIB A;  4P0Q B;  2H3I A;  5L1L A;  3WKD A;  3M8S A;  5DGB A;  3V7L A;  4Y2Y A;  2DKZ A;  4IQV A;  1RYS A;  4ECR A;  1NK4 A;  4AYB F;  5KFS A;  4ECY A;  1KFS A;  4DSJ A;  1EXN A;  4Z6C A;  3NVV A;  4IRC A;  3RJF A;  3QX7 A;  4P0Q A;  4UBB A;  4IQT A;  4UBC A;  1S0O A;  1V97 A;  3GII A;  3KTQ A;  2IMW P;  4WJ3 B;  4M0A A;  4UQG A;  2ZIW B;  3RH4 A;  3PSI A;  3H4D A;  4DL3 A;  3A0H U;  2AGO A;  2W9C B;  1XSL A;  3UMC A;  4NM2 A;  2E3T A;  4PH5 A;  4QZ9 A;  2JZB B;  3PNC A;  4LZG A;  4I2B A;  3AN1 A;  5ALN A;  7ICR A;  4BX9 C;  2ZIW A;  2RRD A;  3L5K A;  4KLS A;  4TQS A;  4YVZ A;  5F9L A;  2W9C A;  3QZ7 A;  1T4G A;  3D2Q A;  5AK5 A;  2KZM A;  8ICE A;  3DV9 A;  1YZ7 A;  2JZB A;  4K4I A;  3M9N B;  9ICA A;  3TAD A;  4YD1 A;  4RT2 A;  2LPE A;  8ICT A;  2QAR B;  1ZRN A;  1DOQ A;  5KFR A;  4TQR A;  3RBE A;  3KHH A;  5ALR A;  2YMM A;  2KP7 A;  2DPI A;  2AU0 A;  4Y2X A;  4Q8E A;  4G9B A;  5EE9 A;  4FZM A;  3UM9 A;  5EE3 A;  4DSF A;  2ZTE A;  2AXT U;  1JIH A;  5J2B A;  4IRD A;  3HT3 A;  1KEJ A;  3CW2 C;  2QAR A;  4NY8 A;  9ICF A;  1AQ6 A;  4YR2 A;  2IOH A;  2DQN B;  4DL7 A;  2R8H A;  1NK6 A;  4IR1 A;  3EWA A;  4FS1 A;  1U45 A;  2UVU A;  7ICI A;  5DLF A;  3DEE A;  1JXL A; 
#chains in the Genus database with same CATH homology
 2KEY A;  3D2N A;  3ICX A;  2XIC A;  4O3M A;  3RFA A;  2WAQ C;  4FE3 A;  3N7S C;  3IN5 A;  1GO3 F;  3O0F A;  1Z19 A;  4P0Q A;  2K4H A;  2HBJ A;  2JHD A;  2MRL A;  3T79 A;  3PST A;  1OUQ A;  2YB1 A;  2HOF A;  3KFU F;  2ZIU B;  3C28 A;  4OJP A;  1D8B A;  2DGZ A;  2KIC A;  3IG5 A;  2GH1 A;  4WJ3 B;  4OO1 J;  4C0Z A;  2H3F A;  2ZIW B;  2RP5 A;  1ED1 A;  3M7D A;  2KHQ A;  3PSI A;  4BUG A;  3PSF A;  4U7C A;  2W7P A;  3E0F A;  3ONN A;  4NWI A;  2WB1 F;  3GU3 A;  4KX5 A;  4QIW F;  3L3F X;  2W7O A;  2JH7 A;  3H0M B;  3HKZ C;  3IG8 A;  2LYA A;  3N7P D;  3PSP A;  2PMZ C;  5KL1 B;  4FZN A;  2HBK A;  2E1E A;  3OPX A;  1DRG A;  2OM6 A;  3LYS A;  4NLC A;  3F53 A;  1A6S A;  1L6N A;  3GZF A;  3LVV A;  4FZL A;  3M6K A;  2WB1 C;  4AYB C;  1Z1B A;  2ZIU A;  4QIW C;  1MA7 A;  1UPH A;  2K8C B;  2N1R A;  1Q3V A;  3RF9 A;  4BX9 C;  2Y0S C;  3D2S A;  1YT3 A;  2K8A A;  1HIW A;  2ZIW A;  2RRD A;  3H0L B;  4KX3 A;  2Q4T A;  1A0P A;  2CN1 A;  3K1Z A;  4ACO A;  1T94 A;  2W04 A;  2G5I B;  2K89 A;  3CP8 A;  3F5E A;  3AL0 B;  1URJ A;  5C0Y A;  2G08 A;  2F77 X;  5CRX A;  1ECW A;  1HEK A;  2XID A;  2ZIX B;  1F44 A;  2OYY A;  2F8L A;  1TAM A;  3D2Q A;  2LBO A;  2ZIV B;  3VC8 A;  4KMO B;  2JH1 A;  2G5H B;  2M0N A;  2H3V A;  4QJF B;  2G09 A;  2KJ5 A;  4JMU A;  3VCB A;  2KKP A;  2KNJ A;  2E5S A;  2OXO A;  3CYM A;  2RHF A;  3SMV A;  2KIW A;  2H3Q A;  2XVT A;  4U6P A;  2LYB A;  2VJ5 A;  2YX8 A;  2W03 A;  4CDG A;  5T14 A;  3SQI A;  4GFJ A;  3IP4 B;  1IIP A;  2GOL A;  5HR6 A;  4A8E A;  2KJ9 A;  3NUQ A;  2HBM A;  4OJO A;  2WAQ F;  2ZXI A;  2XI9 A;  1NZB A;  2HBL A;  4PL2 A;  2F2A B;  2KOB A;  2NV3 A;  2ZIX A;  4NLB A;  4BJQ A;  2BDU A;  4OJL A;  2D6F C;  2Z7J A;  2KHV A;  2K4I A;  3SAF A;  3AQF A;  2ZIV A;  3F5A A;  3SAG A;  4FZM A;  4ICA A;  4OJ6 A;  4OJ5 A;  2OH2 A;  3KZX A;  2VJ4 A;  1PVQ A;  2K8B B;  3F2B A;  2A3V A;  3NRW A;  2HOI A;  3LVW A;  2YB4 A;  5KL8 B;  1P7D A;  2K4E A;  1XNS A;  2VKQ A;  2ZG6 A;  1CRX A;  3ALR A;  2MA1 A;  2CRX A;  1KBU A;  4CGZ A;  4P0P A;  2F76 X;  3HKZ F;  2LHT A;  4IC9 A;  3H0R B;  2H3I A;  4P0Q B;  4QNL A;  1ZQ1 C;  2DF4 B;  2CPR A;  2JMG A;  2PMZ F;  4P0P B;  2G06 A;  1SZH A;  2E1F A;  2R18 A;  3F2C A;  2HMX A;  3CRX A;  4NV0 A;  2H3Z A;  2KV2 A;  5A0L A;  3M6Z A;  2DQN B;  2LKY A;  4PL1 A;  3SAH A;  5HR7 A;  3F2D A;  3N7R C;  3PZP A;  1Q3U A;  4CRX A;  2ZXH A;  4AYB F;  2G0A A;  1PVR A;  3MGV A;  2VIX A;  3AQE A;  2KVC A;  2KD1 A;  3DEE A;  1XO0 A;  1WUD A;  2G07 A;  2HOQ A;  2JGA A;  3C29 A;  2Y0S F;  2KKV A;  2KJ8 A;  1PVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...