4JMUA

Crystal structure of hiv matrix residues 1-111 in complex with inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Enantiomeric Atropisomers Inhibit HCV Polymerase and/or HIV Matrix: Characterizing Hindered Bond Rotations and Target Selectivity.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 105
sequence length 105
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4jmuA00
4IC9A 4ICAA 1A6SA 2LYAA 2K4EA 2H3IA 1ECWA 1ED1A 2GOLA 1TAMA 1UPHA 2JMGA 1HIWA 4JMUA 2LYBA 2K4HA 2HMXA 2H3FA 2K4IA 2H3QA 1L6NA 1HEKA 2N1RA 2NV3A 2H3VA 2H3ZA
chains in the Genus database with same CATH superfamily
1V97A 3LWMA 4KLTA 4P4PA 3V7JA 3SQIA 4Z6FA 4ELUA 4XQ8A 1LVHA 4Q45A 2RQ5A 4MEYA 3KD3A 1S10A 2KHVA 3OSPA 7ICSA 3KBBA 2HHSA 4KMUA 1Z1BA 3IHQB 2R8IA 2ZUDA 3T5JA 4CCHA 4BGDA 1F5SA 9ICIA 4J9RA 1ZQLA 3NASA 4R8UB 4C8MA 4P0QB 3U26A 4ED6A 3CNHA 2XIDA 9ICUA 1ZQTA 1JRPA 1RPLA 8ICXA 1V85A 2DQNB 1ZQMA 4DFMA 4DSKA 2Y1JA 1C20A 3UXNA 5KT3A 5G5HA 1ZQDA 3AU6A 2YB1A 4KLEA 2FE9A 3LVWA 1TV9A 2ZTCA 1ZD5A 3BZKA 4HYKA 5KG4A 2I6XA 2W8LA 4GXJA 1XO1A 5JU5A 3K1ZA 4F5QA 1PVRA 4Y2QA 3KZXA 1NK8A 4QWCA 3ZI4A 2JV3A 1ZQOA 3QX7A 2MA1A 4EX7A 5DKWA 3HP6A 1UHUA 2H3VA 5AI9A 5AKZA 3LYSA 4KLHA 1U4BA 4DSLA 3GZFA 1S0OA 3GDXA 1QSSA 2XI9A 3MFHA 4Q43A 4UAYA 8ICAA 4DLEA 5J2BA 4UQGA 3IG5A 3O0FA 5DG7A 4DL5A 1ZQZA 1SZHA 3HX0A 3V7LA 4NL9A 1OW5A 1JROA 2A1JB 3WKCA 4UB5A 1S9FA 1XC9A 2ESEA 3TFRA 3OTQA 2J6UA 3ED5A 1KRPA 5EE0A 2HHQA 3N4MB 4O3SA 2H5XA 4UASA 3NTUA 2WTFA 2IHMA 7ICIA 1L6NA 5KFPA 2HHXA 2ALZA 1DGJA 1N2XA 2LM1A 1TVAA 4KLOA 1DOQA 4C7ZA 1WCNA 2NO5A 4YG2A 4CGZA 2XICA 5KG3A 3I76A 4NWIA 4MF2A 4ACOA 2KP7A 3HW8A 4MFFA 4J9KA 2KZZA 4IQVA 1KEJA 1NZPA 5EWEA 3OGUA 3ISDA 9ICAA 5CHGA 2VJ4A 1A0PA 2FMPA 2E1EA 4F92B 1A6SA 4QZCA 1YT3A 4DFPA 1ZQJA 2HOFA 5KFJA 3C1ZA 2VA3A 4M9NA 2ZIVB 3SI8A 3RRGA 3FM9A 3BDPA 4DOBA 2W55A 2KE7A 2UVVA 5AI8A 4QNLA 4E0DA 1NOMA 2I1QA 5KFNA 4DEZA 3L3FX 2H3ZA 5D46A 3RR8A 4EELA 5KFEA 1KFTA 2YTUA 5DGAA 3DEEA 3SV3A 2GO7A 1HIWA 2Q0ZX 3KHHA 4F2RA 3ZDDA 5J2GA 1B0XA 4M9HA 2JHDA 5AICA 2PFPA 4ED8A 4OJLA 5HR7A 3QEAZ 2E3TA 2W7PA 3TARA 3KZIU 4ELTA 4YMOA 1X6JA 1QH9A 1GO3F 3AU2A 5KNIA 2FLLA 2G08A 1U47A 2PI4A 4MFCA 2ZIWB 4KLJA 3GIJA 3V6KA 2O6KA 3SAHA 2RHFA 2UVRA 1KN5A 1NJZA 7ICQA 4RPXA 2EQYA 3PZPA 2ZJAA 1X9MA 3N7RC 3ZD8A 3PW7A 4MFAA 2K4PA 4IRDA 1ZD3A 3MDAA 4KN4A 5AI4A 1ZQYA 1NKCA 5AM0A 4PGYA 3WK6A 5FP0A 3KHLA 1J2NA 3MDCA 2BQUA 4JWMA 2FPLA 4DOAA 4YR2A 2PMZC 1ZQIA 4I2FA 1K1QA 4RQ0A 4ED2A 2ZJ8A 4ECXA 1N61A 3ETRA 1SZPA 1IG6A 2A3VA 2HDOA 5J0TA 4RQ5A 3CYMA 3NS1A 1JXLA 5AKXA 4J03A 2ZXIA 3FYHA 3BZCA 3MGVA 4MHVA 2W9CB 3GQCA 2WF8A 3NRWA 1N48A 4DL2A 3RH6A 4FS1A 3T5KA 2J6SA 8ICGA 2CXYA 3NVVA 4FFDA 7ICNA 1Z00B 4O3NA 2WAQC 3ZDEA 4F91B 3ETLA 4KLUA 4C4RA 4DQIA 4P4OA 5IILA 3GIMA 5KFWA 4CE6A 5AM3A 7ICVA 8ICPA 2LYHA 3M8RA 4C8OA 2JEJA 4NM2A 3WK7A 3EPIA 4F93B 3RRHA 2EH9A 2AGQA 4KLFA 1V38A 1SL0A 3KTQA 4KLIA 8ICHA 8ICWA 2BPFA 4F5PA 4O5EA 2AJQA 2HBLA 4YMNA 4IRKA 1JALA 3RFAA 2HBMA 8ICKA 3H4BA 1KBUA 3HJEA 2WB1F 5DGBA 1T3NA 4C80A 5D4BA 2KZMA 3PX6A 5CP2A 3KHGA 4NLGA 4OD0A 3HILA 3F53A 2A19A 1WYGA 1FFVA 5JUMA 1UQVA 4RQ4A 3Q8MA 1JUDA 4M6WB 2KICA 3SMVA 2RP5A 3M1YA 4B9TA 2AH5A 2K60A 2QKQA 3ORYA 1KFSA 1Q3VA 3NRZA 4EX6A 4DQQA 1A76A 5B66U 5DB6A 1K5OA 3G6YA 4QZFA 3K4GA 9ICMA 3C2LA 1S5LU 4P0PA 5ALFA 1SGGA 1B22A 1ZJNA 3N28A 4QZHA 4OJ5A 2V9WA 2R8JA 3JPOA 9ICEA 5KFLA 3UQ2A 1ZRNA 4DCCA 1N5XA 2AGOA 5CB1A 3GILA 1COOA 4BXOB 4F3OA 4OJ6A 1Z19A 4Q8FA 3H8WA 2E8PA 1JXEA 4ECSA 2VJ5A 2LI6A 3RJIA 1A77A 1C7YA 2B21A 2JEFA 2LYAA 3M8SA 4IR1A 1YZ6A 1SV0C 2W9MA 2ATLA 1X42A 2J6TA 5ALKA 4LJXA 1ZETA 3WU2U 2A1AA 2BPGA 5L1IA 3E58A 3S6JA 1X9WA 1MQ3A 2E5SA 2MU2A 5KG5A 1TK5A 4YP3A 5AK5A 4UBBA 1CI4A 5KG7A 4YR3A 5AKEA 1ED1A 3N7PD 4RQ8A 4DL3A 5AKLA 3V6JA 1Z4OA 1D8LA 4AP9A 2V4RA 3EW9A 4K4HA 2HW3A 1SL1A 4BJQA 5J0UA 4MEXA 2LKYA 5ALJA 2P6RA 5EWGA 2W9BB 5KFCA 5IIKA 3DDHA 1TAQA 1BPEA 5IIMA 2PFOA 1PK3A 3RB4A 3Q8LA 5KG0A 1KQQA 5J0RA 3RF9A 5AK4A 2DWQA 4ECRA 4FE3A 4B9VA 8ICYA 1F0MA 3C1YA 2QARB 5F9NA 2H3FA 2C2RA 2FI1A 4F4KA 4JB3A 4KN7A 5J0PA 3GV7B 1LB2B 3K1RB 2BCSA 2PMZF 3RJHA 3HT3A 2D8CA 4G9BA 4EENA 3M6ZA 2LHTA 9ICXA 4GC6A 5AK6A 1D8BA 2XY7A 4DFDA 5KFSA 1JMSA 2CRXA 4YXMA 2HMXA 4USAA 3C29A 2RRDA 3HRDD 1X6IA 5DBCA 3V72A 2MUTA 5AKJA 5ALMA 3RBDA 4Y2RA 1ZOLA 1PVQA 1ZQWA 5KFHA 3PSFA 2ZIXB 4FBTA 4JMUA 4I2IA 3OHAA 2NO4A 4B9SA 5K4LA 2F1JA 3UXOA 4M2YA 1Z1VA 5E79U 7ICKA 8ICVA 1ZQRA 1JIHA 4B9LA 5J0OA 4I2GA 4KLLA 2C2DA 3QU7A 5KG2A 3G6VA 1VLBA 2DPJA 5J29A 1ZQGA 3B0YA 2H3QA 5HMLA 5CR0A 4PJ0U 5HR6A 2ODGA 3F5AA 2HBJA 3JPTA 2BQ3A 2F3NA 2W11A 5KFVA 3PW0A 7ICPA 5J8YC 9ICKA 1WCLA 1L3VA 1SXEA 5KFMA 3PMNA 1S77D 3Q8QB 2W3SA 4ECYA 2IA6A 3WK8A 2QB0A 2DPIA 3KOOA 3RH4A 2ASJA 4F5OA 2ZG6A 1B43A 2Y0SF 1QLNA 4EBEA 7ICGA 4DSJA 3QUCA 2G5IB 2XGQA 3M9NB 5F9LA 3RJGA 3ZDCA 3PW5A 2W7OA 2W54A 4PL1A 5DB9A 3M7DA 1FIQA 3RAQA 2PFQA 3MGIA 2IOFA 1ZQXA 3SAGA 3ZD9A 2JZBB 3AEVA 2BZFA 5ALLA 5KG1A 1X9SA 2KSOB 2NRXA 2KJ9A 1L5UA 4Y2SA 2JH7A 3OJSA 2EZXA 3H0RB 1DGSA 7ICFA 1OUQA 1B4FA 2VKQA 1NKEA 1HUOA 5KL1B 3SYZA 1TKDA 2WF6A 2PKEA 1ZYQA 4RPYA 2HVIA 2OXOA 3H8SA 2DFLA 4Y2JA 1NK0A 2KIVA 3KFUF 4YQWA 1KTQA 4PL2A 1IIPA 1NJXA 3BJYA 2KNJA 4Y2PA 4CNQA 2IOHA 3L5KA 2KZ3A 3HKZC 4YD1A 4I2CA 3BQ7A 4G3IA 1KKXA 4O3PA 5L1LA 4FBUA 8ICZA 2Q4TA 4I2AA 2P35A 3PR4A 7ICMA 4RQ1A 9ICOA 5ALZA 3QYPA 5CA7A 8ICOA 4O3MA 1TK8A 4R65A 5EE9A 4C8KA 4B9MA 1ZQQA 2F76X 1TK0A 7ICJA 3OSNA 4J9QA 1RXVA 4RUAA 5AM1A 1OXJA 2HOIA 2HSZA 2XGPA 1TAMA 5BOMA 4U6PA 2AQ4A 3ZDBA 2IMWP 5AI6A 2R18A 4DWIA 1SKWA 2W43A 3BS7A 5DQHA 1AQ6A 3K75D 1N5WA 4OJOA 2PI5A 5HP4A 4RQ3A 4RQ7A 2YMMA 4TQSA 2JXJA 2ZTEA 3WK4A 3RJEA 4J9SA 4M04A 5CWRA 5KFKA 3IRUA 4RZRA 4EBCA 1HJPA 2AGPA 1FFUA 3M9OB 4DOCA 3AUOA 2D3DA 1RQLA 4NV0A 3H4DA 4I2HA 2GLEA 4EZ6A 4XRHA 4XUSA 1JI7A 4B6JA 3CW2C 2ES6A 1XS9D 1ZQUA 1SWWA 1FO4A 1COKA 3QU4A 3TAQA 1SV0A 4ECQA 2MSNA 3DV9A 1UA1A 4IRCA 2OCEA 5IIOA 1UT8A 2KFZA 4RQNA 5KT4A 4NY8A 4WJ3B 3Q8KA 4UATA 1S0VA 2EAPA 5CRXA 3TADC 4UB2A 9ICGA 4RQ2A 3IM1A 4CF3A 2V4QA 4F50A 4GLXA 3HPOA 2CPRA 1ZQPA 1HEKA 3AQEA 4B9NA 4QW9A 1U49A 2ZIUA 2KJ5A 4PZNA 4F72A 4OJPA 1VDVA 3C21A 3QE9Y 4JV2A 1QQ6A 4Y2XA 1UCVA 3QEBZ 4Q8EA 4GXKA 2K89A 4O0IA 1NKBA 3WK5A 1QQ5A 5ALQA 5J2IA 3UMCA 2Z7JA 1KL9A 4KLMA 2NRVA 7ICEA 4J9MA 1S8OA 7ICLA 2WFAA 3GU3A 2YMQA 4PZOA 2BQRA 2F8LA 5KFAA 4UW9A 1ZQHA 2C2EA 3NVYA 4I27A 4NJ8A 3D2QA 1T7PA 2FLPA 1L7PA 3WKAA 2E8MA 3C2MA 2FMQA 2XCAA 2HHVA 2HHWA 4BWJA 3OPXA 2KVSA 4GC7A 4F5NA 8ICCA 4C4SA 5KTQA 2B6GA 1BPXA 4O3QA 1RG6A 4ED7A 4AYBC 4F4XA 3MBYA 1NJWA 4TURA 5KAIU 3OJUA 1N62A 3PMLA 3MR3A 3PW2A 2FLNA 1WWUA 3N7SC 3V6HA 1X2IA 3A0BU 2LYBA 4UAZA 1L8LA 1SL2A 4IS7A 3BQ1A 3PW4A 1O08A 3KKAC 1FEZA 3IV6A 7ICRA 1ZRMA 2DKZA 1S76D 2BCVA 2HVHA 3PX0A 5DQIA 5KG6A 4UBCA 4J9PA 3NUQA 4I2BA 5CEHA 3AL0B 2NRZA 4C8NA 1VJ5A 2KKVA 2KK0A 5ALUA 4P4MA 5ALDA 5DB8A 3H40A 4RNOA 2R8HA 1PUZA 1TE2A 2XO7A 3T3FA 1PK1B 8ICMA 8ICTA 4Z6EA 2AU0A 1U48A 3RB3A 3IG8A 2KG5A 1PVPA 3SAFA 1ZXIA 5J8YA 1NK5A 1PZNA 3MR5A 2HHUA 2KD1A 2FPMA 2G06A 3TKAA 2WF5A 1Y88A 1X66A 5J2HA 1CRXA 4ECTA 3AN1A 4ED0A 1WG8A 1ZQ1C 4LZGA 5GTIU 3Q8PB 5J2CA 4C7YA 3H0MB 4QZ9A 4DQRA 5J2JA 4DQPA 5AKKA 4F2SA 4I2EA 9ICPA 5TISU 3RH5A 4RUCA 2DF4B 5DG8A 3QZ8A 1V9PA 4YCXA 4QZAA 2YN4A 4CF5A 2BDPA 4DS4A 9ICVA 2W04A 5EWFA 2XY5A 2OYYA 4DFJA 4I29A 1UT5A 1SB3C 4KLQA 3C2KA 1MC8A 4KX5A 3GIKA 2IBKA 2VANA 3A0HU 2RDJA 4J9NA 2UVWA 8ICIA 3N97B 4UAVA 8ICJA 3UQ0A 3SENA 5ALSA 3WKEA 4ED1A 5HHHA 2XCPA 1N56A 1L3TA 3ISCA 9ICTA 1ZD2P 5KFOA 2I5HA 4ELVA 2OWOA 2BHNA 2GWSA 1U45A 5AIBA 1S0MA 3SV4A 2EZZA 5AI5A 1ZQSA 1ZQAA 3SR6A 1ZQFA 4MF8A 1SV4A 1ZD4A 3QUTA 1RXWA 4BX9C 4YD2A 7ICOA 3F2CA 1Z4NA 1LKYB 5KFUA 1QCKA 3GV8B 5J0YA 2OM6A 4O9MA 2W3RA 3BQTA 4F71A 4P0PB 1L8OA 1U9LA 2H3IA 4JUZA 2HCFA 2K8AA 3MFIA 4RNNA 1RM6C 2D6FC 9ICRA 2WF7A 2QB1A 1S97A 3H0LB 2F1IA 4GFJA 3PX4A 2QLTA 2RLTA 5ALWA 2KOBA 4I2JA 4QZGA 4PPXA 2B0CA 4BWMA 9ICCA 3TI0A 4EEKA 3RBEA 3F2BA 3BS5B 1NK7A 5J2DA 3WK9A 2KIWA 5JRTA 2MRLA 1NJYA 4R8UA 4P0QA 1ZQCA 1CUKA 2N1RA 1P7DA 2NV3A 1URJA 2P66A 3VCBA 4UB1A 2WAQF 5EE3A 4B9UA 4ECZA 1DK3A 2KHQA 4PHEA 1XU4A 1DK2A 3RB0A 1EXNA 4RQMA 2HHTA 4C4TA 2YY6A 3MABA 3QU9A 3BQ2A 3I28A 1NK6A 2R8KA 5KFQA 5ALOA 2IHNA 4J9OA 4NM1A 4K4GA 3F2DA 2E8OA 4Q44A 5DBAA 3GIIA 4TQRA 4BDPA 2CN1A 2YMLA 3C5GA 5J0QA 1T3QA 2KSOA 4RQ6A 3C28A 3PVXA 1BPYA 2BDUA 4M9JA 3PO4A 5GTHU 5DQGA 3B0XA 4C0ZA 3E0FA 2A1JA 3RR7A 4YXJA 4QIWC 8ICQA 3TADA 2YX8A 5BPCA 4QWBA 1XSLA 3AMZA 3H8MA 1ZQEA 1T8EA 2ZTDA 3THVA 1M6YA 4DF8A 4BUGA 3EPGA 2ZJ5A 2ZXHA 1KFDA 2VIXA 4X5VA 1Q8KA 4RT3A 1JX4A 3ZDAA 3TFSA 2XC9A 3NGDA 1BPZA 3JPNA 2M0NA 3WKDA 3QZ7A 2MUTB 1D9DA 1L7NA 3RB6A 3PSPA 3EYZA 3PSTA 5HHIA 4US8A 4EZ9A 4PHPA 4IQUA 3QXGA 3PO5A 1QSYA 2K4EA 1BNPA 4Z6DA 9ICBA 2BCRA 2JMGA 9ICFA 4Y2UA 2VA8A 3T79A 1N60A 2ZIVA 1XSNA 1IM4A 1WUDA 3UM9A 1NI3A 1XNSA 3RTVA 9ICNA 3E2EA 5KFFA 3QU2A 5AKGA 1UPHA 5ALTA 3FC4A 3QNMA 3D2NA 2FJ6A 2OEHA 4ED3A 2VA2A 2F44A 3R9KA 1T4GA 3WKBA 5JTIA 7ICTA 4PHDA 1N63A 3KKAA 2JR5A 4TUSA 2JGAA 2WB1C 3ICXA 4NLCA 4NXZA 2OHFA 2C28A 3UXPA 4UARA 2F2AB 1NNLA 2K4HA 4KTQA 4XA5A 2IOFK 5AM5A 4EEYA 2ISPA 2ASDA 2ZIWA 2QB0B 3GFKB 1H38A 5BOLA 3H8JA 2M9NA 4KLDA 2PFNA 8ICEA 2G5HB 5ALPA 1ZQBA 3JPQA 4F4WA 1KLNA 1F44A 4US9A 4DL4A 3KHRA 5AKYA 4TUQA 1KSPA 5CJ7A 1IXRA 2LMRA 2BCQA 4ZOHC 5HNKA 1S0NA 9ICQA 4UB4A 5KFYA 2GH1A 4ZH4A 5AM4A 5IIIA 4IC9A 4KX3A 4YMMA 4DL7A 5KFGA 3TAPA 5ALVA 2G0AA 3PY8A 5H2FU 3FDSA 4DS5A 5KFDA 1CEZA 4M9LA 1KDHA 4Z6CA 3IDWA 1Q3UA 1ZQVA 5J0WA 2XVTA 4QJFB 4DSEA 3T5LA 2W9CA 2PXIA 3EWAA 2ISOA 4R63A 4KMOB 3UPQA 4LVSA 3MC1A 3RJJA 3V7KA 4UAUA 2RDIA 5EOZA 4DLGA 2NRTA 1Z00A 4PGXA 2KJ8A 5IIJA 5KFXA 5A0LA 1TAUA 4F5RA 4QWAA 5J2FA 2JH1A 4P2HA 4NLZA 4FZLA 4EYHB 1ZQNA 5DDYA 4ICAA 2W03A 4UB8U 2L5YA 1ZQKA 2W8KA 2E8NA 3ALRA 4QZ8A 4JK1A 4UB6U 3IN5A 1SKRA 1DXSA 4CRXA 1MQ2A 1NK9A 4UB3A 2DKXA 4DL6A 2LPEA 5ALYA 4QZIA 4M0AA 9ICWA 4QZBA 8ICBA 2G09A 1MSWD 5ALEA 4JWNA 3MR2A 2I9GA 4PH5A 5J2EA 1UA0A 2BKEA 4YFKA 5ALXA 5DDMA 4QIWF 3I1YA 4KITB 2KN7A 5AKHA 4J9LA 3HWTA 1WWVA 2MAXA 2KV2A 2BPCA 4LZDA 8ICLA 4M6WA 4F8RA 5G5GA 3JPRA 2WHEA 1PK1A 1NK4A 2NRWA 3D2SA 5L1KA 2BCUA 3CP8A 3LDAA 4PGQA 4F4YA 2GOLA 3TACB 2F77X 8ICUA 4FS2A 5D49A 2EDUA 8ICNA 5J2AA 4OCZA 4FZMA 9ICHA 2UVUA 2K8CB 5ALGA 1MA7A 5AIAA 3JPPA 3IP4B 2LBOA 1J2MA 2AQ0A 4RT2A 5DB7A 2F8KA 3NVZA 1X40A 2EZYA 1TFRA 3PNCA 3T5HA 1K1SA 2EANA 1IV8A 2E1FA 4Y2VA 4NLBA 4BXOA 5AK3A 5L1JA 1XO0A 2DUYA 4NL9C 8ICFA 1MN8A 3RAXA 5B5EU 4K4IA 1RZTA 5KFTA 3TANA 1DRGA 1BPBA 5EE1A 2JEIA 4JV0A 5ALNA 4DFKA 4PHAA 1KW4A 5KT7A 3HKZF 1SIJA 5KT5A 2ZIUB 3ISBA 3Q8SB 1RYRA 4U7CA 1J97A 4R66A 3QU5A 3MGHA 4DF4A 1NZBA 2KEYA 2EAOA 2Y9TA 3J81j 4ECVA 4YVZA 4O3RA 4QWEA 3FAHA 1Q46A 5T14A 4ECUA 4I28A 3ONNA 4M47A 9ICSA 1LKYA 4YN4A 7ICHA 2Y0SC 2W9BA 5L9XA 1AROP 2WF9A 1HUZA 4HAIA 5ALHA 3QUQA 2C22A 1BNOA 1L7OA 4O5CA 4O3OA 4OO1J 2Y1IA 2W9AA 2K4IA 1D8YA 3CRXA 7ICUA 2Y9UA 4IQWA 2QARA 4DO9A 9ICLA 2ZUBA 4R64A 1YZ7A 2G07A 5AM2A 4C8LA 1QSLA 4QZDA 3LVVA 4I2DA 4KLGA 1LV5A 5KFBA 1RDFA 3B9JA 1BPDA 3F5EA 4CF4A 1QQ7A 1XWLA 4A8EA 3BS5A 2DL0A 3TQ1A 4GIBA 2YQEA 3C23A 3AM9A 2F1HA 1JN3A 1O03A 1X9XA 3Q8RB 5HMMA 2LM4A 8ICRA 3RJFA 5J0SA 1SXDA 5KT6A 3SEIA 4Y2TA 5KFIA 2BGWA 3PV8A 1L3UA 4FZNA 3G6XA 5ALIA 3EZ5A 2ASLA 2XY6A 5L1MA 4F4ZA 2ZIXA 4DQSA 2KMDA 2NYVA 2EAMA 4EBDA 1BVSA 4NLNA 3M6KA 2DBYA 3EUB2 2OH2A 3UMBA 5DLFA 2JRZA 2KVCA 1RYSA 4IQTA 2AHOB 9ICJA 2HBKA 1ECWA 2DGZA 3UMGA 3VC8A 5DBBA 4ECWA 2FPKA 3C5FA 3BQ0A 4IL6U 3MR6A 3L4PA 4NLKA 5DLGA 4YR0A 3SD7A 2BR0A 1L7MA 2P6UA 1BGXT 4UAWA 4KLSA 3AQFA 2JEGA 3GV5B 5J0XA 2KTQA 1XSPA 5AHXA 5C5JA 3SZ2A 3QUBA 4DSFA 5C0YA 2YB4A 5KAFU 5ALRA 1Z3EB 2YMPA 5KL8B 4DSIA 1SKSA 1QTMA 5J2KA 3D6JA 2K8BB 3PSIA 2KFNA 5KT2A 1ZJMA 1D9FA 4QW8A 1T94A 3LK9A 3PR5B 5KFZA 4FO6A 5KFRA 5F3XB 4AYBF 3H7IA 4RU9A 1L3SA 4QZEA 3LWLA 4M9GA 8ICSA 4QWDA 5AI0A 2ZUCA 2FMSA 3OHBA 2JZBA 2KKPA 1RYUA 1RQNA 5IINA 4IR9A 2AXTU 5AKIA 5TZVA 3RJKA 3M9MB 4EYIB 3NVWA 4RNMA 2HI0A 4CDGA 4TUPA 2R8GA 4RPZA 3JPSA 4GXIA 2FDRA 4Y2YA 2HOQA 5DG9A 4JV1A 1SWVA 4O5KA
chains in the Genus database with same CATH topology
2F8LA 1GO3F 1F44A 3SAGA 3H0MB 2LYAA 1PVQA 2HBKA 1ECWA 2DGZA 2G08A 2KEYA 1NZBA 3PSFA 3VC8A 3F2BA 3SQIA 4QIWF 2ZIXB 3D2QA 2KJ9A 4JMUA 2ZIWB 2M0NA 2JH7A 2KIWA 5T14A 3H0RB 3SAHA 2MRLA 3OPXA 2DF4B 2RHFA 2KHVA 1OUQA 4P0QA 2KV2A 2HBLA 2VKQA 1L6NA 3PZPA 4NV0A 2GH1A 3N7RC 3RFAA 2N1RA 1P7DA 2HBMA 2W04A 2E5SA 3ONNA 5KL1B 2NV3A 2OYYA 4AYBC 3PSPA 1Z1BA 3PSTA 1KBUA 2WB1F 1URJA 3D2SA 4IC9A 3VCBA 2OXOA 2Y0SC 4KX3A 2WAQF 2K4EA 3N7SC 3CP8A 3KFUF 4KX5A 1ED1A 2GOLA 2JMGA 2F77X 3AQFA 3N7PD 2KHQA 2XICA 4PL2A 1IIPA 4CGZA 2LYBA 4P0QB 2KNJA 2G0AA 3F53A 4OO1J 3T79A 2K4IA 2H3QA 4NWIA 3CRXA 4FZMA 2XIDA 2ZIVA 4ACOA 3HKZC 4BJQA 2KICA 1Q3UA 3SMVA 1WUDA 2RP5A 2LKYA 2XVTA 2DQNB 2K8CB 4QJFB 2G07A 2YB4A 5C0YA 5HR6A 2PMZC 2HBJA 3F5AA 4KMOB 1XNSA 1Q3VA 1MA7A 3LVVA 5KL8B 2VJ4A 1A0PA 3IP4B 2E1EA 3NUQA 3F2DA 2LBOA 1A6SA 4WJ3B 3AL0B 2Q4TA 2K8BB 1YT3A 1UPHA 2YB1A 3PSIA 3RF9A 2CN1A 3F5EA 2A3VA 2KKVA 2HOFA 5CRXA 4P0PA 3LVWA 4FE3A 3D2NA 3CYMA 2ZIVB 4A8EA 4O3MA 3C28A 2KJ8A 2BDUA 2H3FA 2E1FA 2ZXIA 5A0LA 1T94A 3MGVA 4BX9C 2CPRA 3K1ZA 4NLBA 3NRWA 4OJ5A 3KZXA 1PVRA 3F2CA 2F76X 4QNLA 1HEKA 2JH1A 1XO0A 2PMZF 4AYBF 2MA1A 2OM6A 2JGAA 3AQEA 4FZLA 3M6ZA 2H3VA 3L3FX 2H3ZA 2ZG6A 2WB1C 2KOBA 2ZIUA 2LHTA 2Y0SF 3ICXA 4NLCA 3IG8A 2KJ5A 4ICAA 4OJPA 2W03A 1PVPA 2HOIA 4P0PB 2WAQC 2H3IA 3SAFA 1D8BA 3ALRA 3LYSA 1DRGA 1TAMA 2K8AA 2ZXHA 4C0ZA 3DEEA 4FZNA 3GZFA 1HIWA 2G5IB 3E0FA 2F2AB 4U6PA 2KKPA 2KD1A 4QIWC 2G06A 2K4HA 2XI9A 3IN5A 2CRXA 2HMXA 2JHDA 2K89A 3C29A 4CRXA 2D6FC 2R18A 2ZIXA 2RRDA 2YX8A 2ZIWA 2W7OA 4OJLA 5HR7A 4OJ6A 3HKZF 3IG5A 1Z19A 4PL1A 2Z7JA 4OJOA 3H0LB 3M7DA 2W7PA 4CDGA 1CRXA 3O0FA 2ZIUB 3M6KA 4GFJA 2G5HB 2VJ5A 2OH2A 4BUGA 3GU3A 2HOQA 1ZQ1C 2G09A 4U7CA 1SZHA 2VIXA 2KVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IC9 A;  4ICA A;  1A6S A;  2LYA A;  2K4E A;  2H3I A;  1ECW A;  1ED1 A;  2GOL A;  1TAM A;  1UPH A;  2JMG A;  1HIW A;  4JMU A;  2LYB A;  2K4H A;  2HMX A;  2H3F A;  2K4I A;  2H3Q A;  1L6N A;  1HEK A;  2N1R A;  2NV3 A;  2H3V A;  2H3Z A; 
#chains in the Genus database with same CATH topology
 1V97 A;  3LWM A;  4KLT A;  4P4P A;  3V7J A;  3SQI A;  4Z6F A;  4ELU A;  4XQ8 A;  1LVH A;  4Q45 A;  2RQ5 A;  4MEY A;  3KD3 A;  1S10 A;  2KHV A;  3OSP A;  7ICS A;  3KBB A;  2HHS A;  4KMU A;  1Z1B A;  3IHQ B;  2R8I A;  2ZUD A;  3T5J A;  4CCH A;  4BGD A;  1F5S A;  9ICI A;  4J9R A;  1ZQL A;  3NAS A;  4R8U B;  4C8M A;  4P0Q B;  3U26 A;  4ED6 A;  3CNH A;  2XID A;  9ICU A;  1ZQT A;  1JRP A;  1RPL A;  8ICX A;  1V85 A;  2DQN B;  1ZQM A;  4DFM A;  4DSK A;  2Y1J A;  1C20 A;  3UXN A;  5KT3 A;  5G5H A;  1ZQD A;  3AU6 A;  2YB1 A;  4KLE A;  2FE9 A;  3LVW A;  1TV9 A;  2ZTC A;  1ZD5 A;  3BZK A;  4HYK A;  5KG4 A;  2I6X A;  2W8L A;  4GXJ A;  1XO1 A;  5JU5 A;  3K1Z A;  4F5Q A;  1PVR A;  4Y2Q A;  3KZX A;  1NK8 A;  4QWC A;  3ZI4 A;  2JV3 A;  1ZQO A;  3QX7 A;  2MA1 A;  4EX7 A;  5DKW A;  3HP6 A;  1UHU A;  2H3V A;  5AI9 A;  5AKZ A;  3LYS A;  4KLH A;  1U4B A;  4DSL A;  3GZF A;  1S0O A;  3GDX A;  1QSS A;  2XI9 A;  3MFH A;  4Q43 A;  4UAY A;  8ICA A;  4DLE A;  5J2B A;  4UQG A;  3IG5 A;  3O0F A;  5DG7 A;  4DL5 A;  1ZQZ A;  1SZH A;  3HX0 A;  3V7L A;  4NL9 A;  1OW5 A;  1JRO A;  2A1J B;  3WKC A;  4UB5 A;  1S9F A;  1XC9 A;  2ESE A;  3TFR A;  3OTQ A;  2J6U A;  3ED5 A;  1KRP A;  5EE0 A;  2HHQ A;  3N4M B;  4O3S A;  2H5X A;  4UAS A;  3NTU A;  2WTF A;  2IHM A;  7ICI A;  1L6N A;  5KFP A;  2HHX A;  2ALZ A;  1DGJ A;  1N2X A;  2LM1 A;  1TVA A;  4KLO A;  1DOQ A;  4C7Z A;  1WCN A;  2NO5 A;  4YG2 A;  4CGZ A;  2XIC A;  5KG3 A;  3I76 A;  4NWI A;  4MF2 A;  4ACO A;  2KP7 A;  3HW8 A;  4MFF A;  4J9K A;  2KZZ A;  4IQV A;  1KEJ A;  1NZP A;  5EWE A;  3OGU A;  3ISD A;  9ICA A;  5CHG A;  2VJ4 A;  1A0P A;  2FMP A;  2E1E A;  4F92 B;  1A6S A;  4QZC A;  1YT3 A;  4DFP A;  1ZQJ A;  2HOF A;  5KFJ A;  3C1Z A;  2VA3 A;  4M9N A;  2ZIV B;  3SI8 A;  3RRG A;  3FM9 A;  3BDP A;  4DOB A;  2W55 A;  2KE7 A;  2UVV A;  5AI8 A;  4QNL A;  4E0D A;  1NOM A;  2I1Q A;  5KFN A;  4DEZ A;  3L3F X;  2H3Z A;  5D46 A;  3RR8 A;  4EEL A;  5KFE A;  1KFT A;  2YTU A;  5DGA A;  3DEE A;  3SV3 A;  2GO7 A;  1HIW A;  2Q0Z X;  3KHH A;  4F2R A;  3ZDD A;  5J2G A;  1B0X A;  4M9H A;  2JHD A;  5AIC A;  2PFP A;  4ED8 A;  4OJL A;  5HR7 A;  3QEA Z;  2E3T A;  2W7P A;  3TAR A;  3KZI U;  4ELT A;  4YMO A;  1X6J A;  1QH9 A;  1GO3 F;  3AU2 A;  5KNI A;  2FLL A;  2G08 A;  1U47 A;  2PI4 A;  4MFC A;  2ZIW B;  4KLJ A;  3GIJ A;  3V6K A;  2O6K A;  3SAH A;  2RHF A;  2UVR A;  1KN5 A;  1NJZ A;  7ICQ A;  4RPX A;  2EQY A;  3PZP A;  2ZJA A;  1X9M A;  3N7R C;  3ZD8 A;  3PW7 A;  4MFA A;  2K4P A;  4IRD A;  1ZD3 A;  3MDA A;  4KN4 A;  5AI4 A;  1ZQY A;  1NKC A;  5AM0 A;  4PGY A;  3WK6 A;  5FP0 A;  3KHL A;  1J2N A;  3MDC A;  2BQU A;  4JWM A;  2FPL A;  4DOA A;  4YR2 A;  2PMZ C;  1ZQI A;  4I2F A;  1K1Q A;  4RQ0 A;  4ED2 A;  2ZJ8 A;  4ECX A;  1N61 A;  3ETR A;  1SZP A;  1IG6 A;  2A3V A;  2HDO A;  5J0T A;  4RQ5 A;  3CYM A;  3NS1 A;  1JXL A;  5AKX A;  4J03 A;  2ZXI A;  3FYH A;  3BZC A;  3MGV A;  4MHV A;  2W9C B;  3GQC A;  2WF8 A;  3NRW A;  1N48 A;  4DL2 A;  3RH6 A;  4FS1 A;  3T5K A;  2J6S A;  8ICG A;  2CXY A;  3NVV A;  4FFD A;  7ICN A;  1Z00 B;  4O3N A;  2WAQ C;  3ZDE A;  4F91 B;  3ETL A;  4KLU A;  4C4R A;  4DQI A;  4P4O A;  5IIL A;  3GIM A;  5KFW A;  4CE6 A;  5AM3 A;  7ICV A;  8ICP A;  2LYH A;  3M8R A;  4C8O A;  2JEJ A;  4NM2 A;  3WK7 A;  3EPI A;  4F93 B;  3RRH A;  2EH9 A;  2AGQ A;  4KLF A;  1V38 A;  1SL0 A;  3KTQ A;  4KLI A;  8ICH A;  8ICW A;  2BPF A;  4F5P A;  4O5E A;  2AJQ A;  2HBL A;  4YMN A;  4IRK A;  1JAL A;  3RFA A;  2HBM A;  8ICK A;  3H4B A;  1KBU A;  3HJE A;  2WB1 F;  5DGB A;  1T3N A;  4C80 A;  5D4B A;  2KZM A;  3PX6 A;  5CP2 A;  3KHG A;  4NLG A;  4OD0 A;  3HIL A;  3F53 A;  2A19 A;  1WYG A;  1FFV A;  5JUM A;  1UQV A;  4RQ4 A;  3Q8M A;  1JUD A;  4M6W B;  2KIC A;  3SMV A;  2RP5 A;  3M1Y A;  4B9T A;  2AH5 A;  2K60 A;  2QKQ A;  3ORY A;  1KFS A;  1Q3V A;  3NRZ A;  4EX6 A;  4DQQ A;  1A76 A;  5B66 U;  5DB6 A;  1K5O A;  3G6Y A;  4QZF A;  3K4G A;  9ICM A;  3C2L A;  1S5L U;  4P0P A;  5ALF A;  1SGG A;  1B22 A;  1ZJN A;  3N28 A;  4QZH A;  4OJ5 A;  2V9W A;  2R8J A;  3JPO A;  9ICE A;  5KFL A;  3UQ2 A;  1ZRN A;  4DCC A;  1N5X A;  2AGO A;  5CB1 A;  3GIL A;  1COO A;  4BXO B;  4F3O A;  4OJ6 A;  1Z19 A;  4Q8F A;  3H8W A;  2E8P A;  1JXE A;  4ECS A;  2VJ5 A;  2LI6 A;  3RJI A;  1A77 A;  1C7Y A;  2B21 A;  2JEF A;  2LYA A;  3M8S A;  4IR1 A;  1YZ6 A;  1SV0 C;  2W9M A;  2ATL A;  1X42 A;  2J6T A;  5ALK A;  4LJX A;  1ZET A;  3WU2 U;  2A1A A;  2BPG A;  5L1I A;  3E58 A;  3S6J A;  1X9W A;  1MQ3 A;  2E5S A;  2MU2 A;  5KG5 A;  1TK5 A;  4YP3 A;  5AK5 A;  4UBB A;  1CI4 A;  5KG7 A;  4YR3 A;  5AKE A;  1ED1 A;  3N7P D;  4RQ8 A;  4DL3 A;  5AKL A;  3V6J A;  1Z4O A;  1D8L A;  4AP9 A;  2V4R A;  3EW9 A;  4K4H A;  2HW3 A;  1SL1 A;  4BJQ A;  5J0U A;  4MEX A;  2LKY A;  5ALJ A;  2P6R A;  5EWG A;  2W9B B;  5KFC A;  5IIK A;  3DDH A;  1TAQ A;  1BPE A;  5IIM A;  2PFO A;  1PK3 A;  3RB4 A;  3Q8L A;  5KG0 A;  1KQQ A;  5J0R A;  3RF9 A;  5AK4 A;  2DWQ A;  4ECR A;  4FE3 A;  4B9V A;  8ICY A;  1F0M A;  3C1Y A;  2QAR B;  5F9N A;  2H3F A;  2C2R A;  2FI1 A;  4F4K A;  4JB3 A;  4KN7 A;  5J0P A;  3GV7 B;  1LB2 B;  3K1R B;  2BCS A;  2PMZ F;  3RJH A;  3HT3 A;  2D8C A;  4G9B A;  4EEN A;  3M6Z A;  2LHT A;  9ICX A;  4GC6 A;  5AK6 A;  1D8B A;  2XY7 A;  4DFD A;  5KFS A;  1JMS A;  2CRX A;  4YXM A;  2HMX A;  4USA A;  3C29 A;  2RRD A;  3HRD D;  1X6I A;  5DBC A;  3V72 A;  2MUT A;  5AKJ A;  5ALM A;  3RBD A;  4Y2R A;  1ZOL A;  1PVQ A;  1ZQW A;  5KFH A;  3PSF A;  2ZIX B;  4FBT A;  4JMU A;  4I2I A;  3OHA A;  2NO4 A;  4B9S A;  5K4L A;  2F1J A;  3UXO A;  4M2Y A;  1Z1V A;  5E79 U;  7ICK A;  8ICV A;  1ZQR A;  1JIH A;  4B9L A;  5J0O A;  4I2G A;  4KLL A;  2C2D A;  3QU7 A;  5KG2 A;  3G6V A;  1VLB A;  2DPJ A;  5J29 A;  1ZQG A;  3B0Y A;  2H3Q A;  5HML A;  5CR0 A;  4PJ0 U;  5HR6 A;  2ODG A;  3F5A A;  2HBJ A;  3JPT A;  2BQ3 A;  2F3N A;  2W11 A;  5KFV A;  3PW0 A;  7ICP A;  5J8Y C;  9ICK A;  1WCL A;  1L3V A;  1SXE A;  5KFM A;  3PMN A;  1S77 D;  3Q8Q B;  2W3S A;  4ECY A;  2IA6 A;  3WK8 A;  2QB0 A;  2DPI A;  3KOO A;  3RH4 A;  2ASJ A;  4F5O A;  2ZG6 A;  1B43 A;  2Y0S F;  1QLN A;  4EBE A;  7ICG A;  4DSJ A;  3QUC A;  2G5I B;  2XGQ A;  3M9N B;  5F9L A;  3RJG A;  3ZDC A;  3PW5 A;  2W7O A;  2W54 A;  4PL1 A;  5DB9 A;  3M7D A;  1FIQ A;  3RAQ A;  2PFQ A;  3MGI A;  2IOF A;  1ZQX A;  3SAG A;  3ZD9 A;  2JZB B;  3AEV A;  2BZF A;  5ALL A;  5KG1 A;  1X9S A;  2KSO B;  2NRX A;  2KJ9 A;  1L5U A;  4Y2S A;  2JH7 A;  3OJS A;  2EZX A;  3H0R B;  1DGS A;  7ICF A;  1OUQ A;  1B4F A;  2VKQ A;  1NKE A;  1HUO A;  5KL1 B;  3SYZ A;  1TKD A;  2WF6 A;  2PKE A;  1ZYQ A;  4RPY A;  2HVI A;  2OXO A;  3H8S A;  2DFL A;  4Y2J A;  1NK0 A;  2KIV A;  3KFU F;  4YQW A;  1KTQ A;  4PL2 A;  1IIP A;  1NJX A;  3BJY A;  2KNJ A;  4Y2P A;  4CNQ A;  2IOH A;  3L5K A;  2KZ3 A;  3HKZ C;  4YD1 A;  4I2C A;  3BQ7 A;  4G3I A;  1KKX A;  4O3P A;  5L1L A;  4FBU A;  8ICZ A;  2Q4T A;  4I2A A;  2P35 A;  3PR4 A;  7ICM A;  4RQ1 A;  9ICO A;  5ALZ A;  3QYP A;  5CA7 A;  8ICO A;  4O3M A;  1TK8 A;  4R65 A;  5EE9 A;  4C8K A;  4B9M A;  1ZQQ A;  2F76 X;  1TK0 A;  7ICJ A;  3OSN A;  4J9Q A;  1RXV A;  4RUA A;  5AM1 A;  1OXJ A;  2HOI A;  2HSZ A;  2XGP A;  1TAM A;  5BOM A;  4U6P A;  2AQ4 A;  3ZDB A;  2IMW P;  5AI6 A;  2R18 A;  4DWI A;  1SKW A;  2W43 A;  3BS7 A;  5DQH A;  1AQ6 A;  3K75 D;  1N5W A;  4OJO A;  2PI5 A;  5HP4 A;  4RQ3 A;  4RQ7 A;  2YMM A;  4TQS A;  2JXJ A;  2ZTE A;  3WK4 A;  3RJE A;  4J9S A;  4M04 A;  5CWR A;  5KFK A;  3IRU A;  4RZR A;  4EBC A;  1HJP A;  2AGP A;  1FFU A;  3M9O B;  4DOC A;  3AUO A;  2D3D A;  1RQL A;  4NV0 A;  3H4D A;  4I2H A;  2GLE A;  4EZ6 A;  4XRH A;  4XUS A;  1JI7 A;  4B6J A;  3CW2 C;  2ES6 A;  1XS9 D;  1ZQU A;  1SWW A;  1FO4 A;  1COK A;  3QU4 A;  3TAQ A;  1SV0 A;  4ECQ A;  2MSN A;  3DV9 A;  1UA1 A;  4IRC A;  2OCE A;  5IIO A;  1UT8 A;  2KFZ A;  4RQN A;  5KT4 A;  4NY8 A;  4WJ3 B;  3Q8K A;  4UAT A;  1S0V A;  2EAP A;  5CRX A;  3TAD C;  4UB2 A;  9ICG A;  4RQ2 A;  3IM1 A;  4CF3 A;  2V4Q A;  4F50 A;  4GLX A;  3HPO A;  2CPR A;  1ZQP A;  1HEK A;  3AQE A;  4B9N A;  4QW9 A;  1U49 A;  2ZIU A;  2KJ5 A;  4PZN A;  4F72 A;  4OJP A;  1VDV A;  3C21 A;  3QE9 Y;  4JV2 A;  1QQ6 A;  4Y2X A;  1UCV A;  3QEB Z;  4Q8E A;  4GXK A;  2K89 A;  4O0I A;  1NKB A;  3WK5 A;  1QQ5 A;  5ALQ A;  5J2I A;  3UMC A;  2Z7J A;  1KL9 A;  4KLM A;  2NRV A;  7ICE A;  4J9M A;  1S8O A;  7ICL A;  2WFA A;  3GU3 A;  2YMQ A;  4PZO A;  2BQR A;  2F8L A;  5KFA A;  4UW9 A;  1ZQH A;  2C2E A;  3NVY A;  4I27 A;  4NJ8 A;  3D2Q A;  1T7P A;  2FLP A;  1L7P A;  3WKA A;  2E8M A;  3C2M A;  2FMQ A;  2XCA A;  2HHV A;  2HHW A;  4BWJ A;  3OPX A;  2KVS A;  4GC7 A;  4F5N A;  8ICC A;  4C4S A;  5KTQ A;  2B6G A;  1BPX A;  4O3Q A;  1RG6 A;  4ED7 A;  4AYB C;  4F4X A;  3MBY A;  1NJW A;  4TUR A;  5KAI U;  3OJU A;  1N62 A;  3PML A;  3MR3 A;  3PW2 A;  2FLN A;  1WWU A;  3N7S C;  3V6H A;  1X2I A;  3A0B U;  2LYB A;  4UAZ A;  1L8L A;  1SL2 A;  4IS7 A;  3BQ1 A;  3PW4 A;  1O08 A;  3KKA C;  1FEZ A;  3IV6 A;  7ICR A;  1ZRM A;  2DKZ A;  1S76 D;  2BCV A;  2HVH A;  3PX0 A;  5DQI A;  5KG6 A;  4UBC A;  4J9P A;  3NUQ A;  4I2B A;  5CEH A;  3AL0 B;  2NRZ A;  4C8N A;  1VJ5 A;  2KKV A;  2KK0 A;  5ALU A;  4P4M A;  5ALD A;  5DB8 A;  3H40 A;  4RNO A;  2R8H A;  1PUZ A;  1TE2 A;  2XO7 A;  3T3F A;  1PK1 B;  8ICM A;  8ICT A;  4Z6E A;  2AU0 A;  1U48 A;  3RB3 A;  3IG8 A;  2KG5 A;  1PVP A;  3SAF A;  1ZXI A;  5J8Y A;  1NK5 A;  1PZN A;  3MR5 A;  2HHU A;  2KD1 A;  2FPM A;  2G06 A;  3TKA A;  2WF5 A;  1Y88 A;  1X66 A;  5J2H A;  1CRX A;  4ECT A;  3AN1 A;  4ED0 A;  1WG8 A;  1ZQ1 C;  4LZG A;  5GTI U;  3Q8P B;  5J2C A;  4C7Y A;  3H0M B;  4QZ9 A;  4DQR A;  5J2J A;  4DQP A;  5AKK A;  4F2S A;  4I2E A;  9ICP A;  5TIS U;  3RH5 A;  4RUC A;  2DF4 B;  5DG8 A;  3QZ8 A;  1V9P A;  4YCX A;  4QZA A;  2YN4 A;  4CF5 A;  2BDP A;  4DS4 A;  9ICV A;  2W04 A;  5EWF A;  2XY5 A;  2OYY A;  4DFJ A;  4I29 A;  1UT5 A;  1SB3 C;  4KLQ A;  3C2K A;  1MC8 A;  4KX5 A;  3GIK A;  2IBK A;  2VAN A;  3A0H U;  2RDJ A;  4J9N A;  2UVW A;  8ICI A;  3N97 B;  4UAV A;  8ICJ A;  3UQ0 A;  3SEN A;  5ALS A;  3WKE A;  4ED1 A;  5HHH A;  2XCP A;  1N56 A;  1L3T A;  3ISC A;  9ICT A;  1ZD2 P;  5KFO A;  2I5H A;  4ELV A;  2OWO A;  2BHN A;  2GWS A;  1U45 A;  5AIB A;  1S0M A;  3SV4 A;  2EZZ A;  5AI5 A;  1ZQS A;  1ZQA A;  3SR6 A;  1ZQF A;  4MF8 A;  1SV4 A;  1ZD4 A;  3QUT A;  1RXW A;  4BX9 C;  4YD2 A;  7ICO A;  3F2C A;  1Z4N A;  1LKY B;  5KFU A;  1QCK A;  3GV8 B;  5J0Y A;  2OM6 A;  4O9M A;  2W3R A;  3BQT A;  4F71 A;  4P0P B;  1L8O A;  1U9L A;  2H3I A;  4JUZ A;  2HCF A;  2K8A A;  3MFI A;  4RNN A;  1RM6 C;  2D6F C;  9ICR A;  2WF7 A;  2QB1 A;  1S97 A;  3H0L B;  2F1I A;  4GFJ A;  3PX4 A;  2QLT A;  2RLT A;  5ALW A;  2KOB A;  4I2J A;  4QZG A;  4PPX A;  2B0C A;  4BWM A;  9ICC A;  3TI0 A;  4EEK A;  3RBE A;  3F2B A;  3BS5 B;  1NK7 A;  5J2D A;  3WK9 A;  2KIW A;  5JRT A;  2MRL A;  1NJY A;  4R8U A;  4P0Q A;  1ZQC A;  1CUK A;  2N1R A;  1P7D A;  2NV3 A;  1URJ A;  2P66 A;  3VCB A;  4UB1 A;  2WAQ F;  5EE3 A;  4B9U A;  4ECZ A;  1DK3 A;  2KHQ A;  4PHE A;  1XU4 A;  1DK2 A;  3RB0 A;  1EXN A;  4RQM A;  2HHT A;  4C4T A;  2YY6 A;  3MAB A;  3QU9 A;  3BQ2 A;  3I28 A;  1NK6 A;  2R8K A;  5KFQ A;  5ALO A;  2IHN A;  4J9O A;  4NM1 A;  4K4G A;  3F2D A;  2E8O A;  4Q44 A;  5DBA A;  3GII A;  4TQR A;  4BDP A;  2CN1 A;  2YML A;  3C5G A;  5J0Q A;  1T3Q A;  2KSO A;  4RQ6 A;  3C28 A;  3PVX A;  1BPY A;  2BDU A;  4M9J A;  3PO4 A;  5GTH U;  5DQG A;  3B0X A;  4C0Z A;  3E0F A;  2A1J A;  3RR7 A;  4YXJ A;  4QIW C;  8ICQ A;  3TAD A;  2YX8 A;  5BPC A;  4QWB A;  1XSL A;  3AMZ A;  3H8M A;  1ZQE A;  1T8E A;  2ZTD A;  3THV A;  1M6Y A;  4DF8 A;  4BUG A;  3EPG A;  2ZJ5 A;  2ZXH A;  1KFD A;  2VIX A;  4X5V A;  1Q8K A;  4RT3 A;  1JX4 A;  3ZDA A;  3TFS A;  2XC9 A;  3NGD A;  1BPZ A;  3JPN A;  2M0N A;  3WKD A;  3QZ7 A;  2MUT B;  1D9D A;  1L7N A;  3RB6 A;  3PSP A;  3EYZ A;  3PST A;  5HHI A;  4US8 A;  4EZ9 A;  4PHP A;  4IQU A;  3QXG A;  3PO5 A;  1QSY A;  2K4E A;  1BNP A;  4Z6D A;  9ICB A;  2BCR A;  2JMG A;  9ICF A;  4Y2U A;  2VA8 A;  3T79 A;  1N60 A;  2ZIV A;  1XSN A;  1IM4 A;  1WUD A;  3UM9 A;  1NI3 A;  1XNS A;  3RTV A;  9ICN A;  3E2E A;  5KFF A;  3QU2 A;  5AKG A;  1UPH A;  5ALT A;  3FC4 A;  3QNM A;  3D2N A;  2FJ6 A;  2OEH A;  4ED3 A;  2VA2 A;  2F44 A;  3R9K A;  1T4G A;  3WKB A;  5JTI A;  7ICT A;  4PHD A;  1N63 A;  3KKA A;  2JR5 A;  4TUS A;  2JGA A;  2WB1 C;  3ICX A;  4NLC A;  4NXZ A;  2OHF A;  2C28 A;  3UXP A;  4UAR A;  2F2A B;  1NNL A;  2K4H A;  4KTQ A;  4XA5 A;  2IOF K;  5AM5 A;  4EEY A;  2ISP A;  2ASD A;  2ZIW A;  2QB0 B;  3GFK B;  1H38 A;  5BOL A;  3H8J A;  2M9N A;  4KLD A;  2PFN A;  8ICE A;  2G5H B;  5ALP A;  1ZQB A;  3JPQ A;  4F4W A;  1KLN A;  1F44 A;  4US9 A;  4DL4 A;  3KHR A;  5AKY A;  4TUQ A;  1KSP A;  5CJ7 A;  1IXR A;  2LMR A;  2BCQ A;  4ZOH C;  5HNK A;  1S0N A;  9ICQ A;  4UB4 A;  5KFY A;  2GH1 A;  4ZH4 A;  5AM4 A;  5III A;  4IC9 A;  4KX3 A;  4YMM A;  4DL7 A;  5KFG A;  3TAP A;  5ALV A;  2G0A A;  3PY8 A;  5H2F U;  3FDS A;  4DS5 A;  5KFD A;  1CEZ A;  4M9L A;  1KDH A;  4Z6C A;  3IDW A;  1Q3U A;  1ZQV A;  5J0W A;  2XVT A;  4QJF B;  4DSE A;  3T5L A;  2W9C A;  2PXI A;  3EWA A;  2ISO A;  4R63 A;  4KMO B;  3UPQ A;  4LVS A;  3MC1 A;  3RJJ A;  3V7K A;  4UAU A;  2RDI A;  5EOZ A;  4DLG A;  2NRT A;  1Z00 A;  4PGX A;  2KJ8 A;  5IIJ A;  5KFX A;  5A0L A;  1TAU A;  4F5R A;  4QWA A;  5J2F A;  2JH1 A;  4P2H A;  4NLZ A;  4FZL A;  4EYH B;  1ZQN A;  5DDY A;  4ICA A;  2W03 A;  4UB8 U;  2L5Y A;  1ZQK A;  2W8K A;  2E8N A;  3ALR A;  4QZ8 A;  4JK1 A;  4UB6 U;  3IN5 A;  1SKR A;  1DXS A;  4CRX A;  1MQ2 A;  1NK9 A;  4UB3 A;  2DKX A;  4DL6 A;  2LPE A;  5ALY A;  4QZI A;  4M0A A;  9ICW A;  4QZB A;  8ICB A;  2G09 A;  1MSW D;  5ALE A;  4JWN A;  3MR2 A;  2I9G A;  4PH5 A;  5J2E A;  1UA0 A;  2BKE A;  4YFK A;  5ALX A;  5DDM A;  4QIW F;  3I1Y A;  4KIT B;  2KN7 A;  5AKH A;  4J9L A;  3HWT A;  1WWV A;  2MAX A;  2KV2 A;  2BPC A;  4LZD A;  8ICL A;  4M6W A;  4F8R A;  5G5G A;  3JPR A;  2WHE A;  1PK1 A;  1NK4 A;  2NRW A;  3D2S A;  5L1K A;  2BCU A;  3CP8 A;  3LDA A;  4PGQ A;  4F4Y A;  2GOL A;  3TAC B;  2F77 X;  8ICU A;  4FS2 A;  5D49 A;  2EDU A;  8ICN A;  5J2A A;  4OCZ A;  4FZM A;  9ICH A;  2UVU A;  2K8C B;  5ALG A;  1MA7 A;  5AIA A;  3JPP A;  3IP4 B;  2LBO A;  1J2M A;  2AQ0 A;  4RT2 A;  5DB7 A;  2F8K A;  3NVZ A;  1X40 A;  2EZY A;  1TFR A;  3PNC A;  3T5H A;  1K1S A;  2EAN A;  1IV8 A;  2E1F A;  4Y2V A;  4NLB A;  4BXO A;  5AK3 A;  5L1J A;  1XO0 A;  2DUY A;  4NL9 C;  8ICF A;  1MN8 A;  3RAX A;  5B5E U;  4K4I A;  1RZT A;  5KFT A;  3TAN A;  1DRG A;  1BPB A;  5EE1 A;  2JEI A;  4JV0 A;  5ALN A;  4DFK A;  4PHA A;  1KW4 A;  5KT7 A;  3HKZ F;  1SIJ A;  5KT5 A;  2ZIU B;  3ISB A;  3Q8S B;  1RYR A;  4U7C A;  1J97 A;  4R66 A;  3QU5 A;  3MGH A;  4DF4 A;  1NZB A;  2KEY A;  2EAO A;  2Y9T A;  3J81 j;  4ECV A;  4YVZ A;  4O3R A;  4QWE A;  3FAH A;  1Q46 A;  5T14 A;  4ECU A;  4I28 A;  3ONN A;  4M47 A;  9ICS A;  1LKY A;  4YN4 A;  7ICH A;  2Y0S C;  2W9B A;  5L9X A;  1ARO P;  2WF9 A;  1HUZ A;  4HAI A;  5ALH A;  3QUQ A;  2C22 A;  1BNO A;  1L7O A;  4O5C A;  4O3O A;  4OO1 J;  2Y1I A;  2W9A A;  2K4I A;  1D8Y A;  3CRX A;  7ICU A;  2Y9U A;  4IQW A;  2QAR A;  4DO9 A;  9ICL A;  2ZUB A;  4R64 A;  1YZ7 A;  2G07 A;  5AM2 A;  4C8L A;  1QSL A;  4QZD A;  3LVV A;  4I2D A;  4KLG A;  1LV5 A;  5KFB A;  1RDF A;  3B9J A;  1BPD A;  3F5E A;  4CF4 A;  1QQ7 A;  1XWL A;  4A8E A;  3BS5 A;  2DL0 A;  3TQ1 A;  4GIB A;  2YQE A;  3C23 A;  3AM9 A;  2F1H A;  1JN3 A;  1O03 A;  1X9X A;  3Q8R B;  5HMM A;  2LM4 A;  8ICR A;  3RJF A;  5J0S A;  1SXD A;  5KT6 A;  3SEI A;  4Y2T A;  5KFI A;  2BGW A;  3PV8 A;  1L3U A;  4FZN A;  3G6X A;  5ALI A;  3EZ5 A;  2ASL A;  2XY6 A;  5L1M A;  4F4Z A;  2ZIX A;  4DQS A;  2KMD A;  2NYV A;  2EAM A;  4EBD A;  1BVS A;  4NLN A;  3M6K A;  2DBY A;  3EUB 2;  2OH2 A;  3UMB A;  5DLF A;  2JRZ A;  2KVC A;  1RYS A;  4IQT A;  2AHO B;  9ICJ A;  2HBK A;  1ECW A;  2DGZ A;  3UMG A;  3VC8 A;  5DBB A;  4ECW A;  2FPK A;  3C5F A;  3BQ0 A;  4IL6 U;  3MR6 A;  3L4P A;  4NLK A;  5DLG A;  4YR0 A;  3SD7 A;  2BR0 A;  1L7M A;  2P6U A;  1BGX T;  4UAW A;  4KLS A;  3AQF A;  2JEG A;  3GV5 B;  5J0X A;  2KTQ A;  1XSP A;  5AHX A;  5C5J A;  3SZ2 A;  3QUB A;  4DSF A;  5C0Y A;  2YB4 A;  5KAF U;  5ALR A;  1Z3E B;  2YMP A;  5KL8 B;  4DSI A;  1SKS A;  1QTM A;  5J2K A;  3D6J A;  2K8B B;  3PSI A;  2KFN A;  5KT2 A;  1ZJM A;  1D9F A;  4QW8 A;  1T94 A;  3LK9 A;  3PR5 B;  5KFZ A;  4FO6 A;  5KFR A;  5F3X B;  4AYB F;  3H7I A;  4RU9 A;  1L3S A;  4QZE A;  3LWL A;  4M9G A;  8ICS A;  4QWD A;  5AI0 A;  2ZUC A;  2FMS A;  3OHB A;  2JZB A;  2KKP A;  1RYU A;  1RQN A;  5IIN A;  4IR9 A;  2AXT U;  5AKI A;  5TZV A;  3RJK A;  3M9M B;  4EYI B;  3NVW A;  4RNM A;  2HI0 A;  4CDG A;  4TUP A;  2R8G A;  4RPZ A;  3JPS A;  4GXI A;  2FDR A;  4Y2Y A;  2HOQ A;  5DG9 A;  4JV1 A;  1SWV A;  4O5K A; 
#chains in the Genus database with same CATH homology
 2F8L A;  1GO3 F;  1F44 A;  3SAG A;  3H0M B;  2LYA A;  1PVQ A;  2HBK A;  1ECW A;  2DGZ A;  2G08 A;  2KEY A;  1NZB A;  3PSF A;  3VC8 A;  3F2B A;  3SQI A;  4QIW F;  2ZIX B;  3D2Q A;  2KJ9 A;  4JMU A;  2ZIW B;  2M0N A;  2JH7 A;  2KIW A;  5T14 A;  3H0R B;  3SAH A;  2MRL A;  3OPX A;  2DF4 B;  2RHF A;  2KHV A;  1OUQ A;  4P0Q A;  2KV2 A;  2HBL A;  2VKQ A;  1L6N A;  3PZP A;  4NV0 A;  2GH1 A;  3N7R C;  3RFA A;  2N1R A;  1P7D A;  2HBM A;  2W04 A;  2E5S A;  3ONN A;  5KL1 B;  2NV3 A;  2OYY A;  4AYB C;  3PSP A;  1Z1B A;  3PST A;  1KBU A;  2WB1 F;  1URJ A;  3D2S A;  4IC9 A;  3VCB A;  2OXO A;  2Y0S C;  4KX3 A;  2WAQ F;  2K4E A;  3N7S C;  3CP8 A;  3KFU F;  4KX5 A;  1ED1 A;  2GOL A;  2JMG A;  2F77 X;  3AQF A;  3N7P D;  2KHQ A;  2XIC A;  4PL2 A;  1IIP A;  4CGZ A;  2LYB A;  4P0Q B;  2KNJ A;  2G0A A;  3F53 A;  4OO1 J;  3T79 A;  2K4I A;  2H3Q A;  4NWI A;  3CRX A;  4FZM A;  2XID A;  2ZIV A;  4ACO A;  3HKZ C;  4BJQ A;  2KIC A;  1Q3U A;  3SMV A;  1WUD A;  2RP5 A;  2LKY A;  2XVT A;  2DQN B;  2K8C B;  4QJF B;  2G07 A;  2YB4 A;  5C0Y A;  5HR6 A;  2PMZ C;  2HBJ A;  3F5A A;  4KMO B;  1XNS A;  1Q3V A;  1MA7 A;  3LVV A;  5KL8 B;  2VJ4 A;  1A0P A;  3IP4 B;  2E1E A;  3NUQ A;  3F2D A;  2LBO A;  1A6S A;  4WJ3 B;  3AL0 B;  2Q4T A;  2K8B B;  1YT3 A;  1UPH A;  2YB1 A;  3PSI A;  3RF9 A;  2CN1 A;  3F5E A;  2A3V A;  2KKV A;  2HOF A;  5CRX A;  4P0P A;  3LVW A;  4FE3 A;  3D2N A;  3CYM A;  2ZIV B;  4A8E A;  4O3M A;  3C28 A;  2KJ8 A;  2BDU A;  2H3F A;  2E1F A;  2ZXI A;  5A0L A;  1T94 A;  3MGV A;  4BX9 C;  2CPR A;  3K1Z A;  4NLB A;  3NRW A;  4OJ5 A;  3KZX A;  1PVR A;  3F2C A;  2F76 X;  4QNL A;  1HEK A;  2JH1 A;  1XO0 A;  2PMZ F;  4AYB F;  2MA1 A;  2OM6 A;  2JGA A;  3AQE A;  4FZL A;  3M6Z A;  2H3V A;  3L3F X;  2H3Z A;  2ZG6 A;  2WB1 C;  2KOB A;  2ZIU A;  2LHT A;  2Y0S F;  3ICX A;  4NLC A;  3IG8 A;  2KJ5 A;  4ICA A;  4OJP A;  2W03 A;  1PVP A;  2HOI A;  4P0P B;  2WAQ C;  2H3I A;  3SAF A;  1D8B A;  3ALR A;  3LYS A;  1DRG A;  1TAM A;  2K8A A;  2ZXH A;  4C0Z A;  3DEE A;  4FZN A;  3GZF A;  1HIW A;  2G5I B;  3E0F A;  2F2A B;  4U6P A;  2KKP A;  2KD1 A;  4QIW C;  2G06 A;  2K4H A;  2XI9 A;  3IN5 A;  2CRX A;  2HMX A;  2JHD A;  2K89 A;  3C29 A;  4CRX A;  2D6F C;  2R18 A;  2ZIX A;  2RRD A;  2YX8 A;  2ZIW A;  2W7O A;  4OJL A;  5HR7 A;  4OJ6 A;  3HKZ F;  3IG5 A;  1Z19 A;  4PL1 A;  2Z7J A;  4OJO A;  3H0L B;  3M7D A;  2W7P A;  4CDG A;  1CRX A;  3O0F A;  2ZIU B;  3M6K A;  4GFJ A;  2G5H B;  2VJ5 A;  2OH2 A;  4BUG A;  3GU3 A;  2HOQ A;  1ZQ1 C;  2G09 A;  4U7C A;  1SZH A;  2VIX A;  2KVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...