4JMUA

Crystal structure of hiv matrix residues 1-111 in complex with inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enantiomeric Atropisomers Inhibit HCV Polymerase and/or HIV Matrix: Characterizing Hindered Bond Rotations and Target Selectivity.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Gag-Pol polyprotein
total genus 41
structure length 105
sequence length 105
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4jmuA00
1TAMA 2K4IA 2LYBA 2H3IA 2NV3A 2GOLA 2K4EA 2K4HA 4ICAA 1HEKA 2LYAA 2H3FA 2H3ZA 2JMGA 1ED1A 2N1RA 1HIWA 1UPHA 2H3VA 1ECWA 1A6SA 1L6NA 2HMXA 2H3QA 4JMUA 4IC9A
chains in the Genus database with same CATH superfamily
3M9NB 4EBCA 2HW3A 4Y2TA 2KVSA 4RQ0A 3QU9A 1PVPA 5KFWA 3K1RB 4ICAA 4NY8A 1NK5A 7ICEA 3H40A 9ICPA 4HYKA 1XSLA 3KTQA 1XO0A 8ICJA 3PSIA 1KQQA 2ZTEA 1Z1BA 1B4FA 2BZFA 3V72A 2KFNA 2AGOA 4FZLA 3ONNA 2HHUA 1TVAA 5HR7A 2QLTA 4M9GA 5ALGA 4XRHA 2NYVA 4YR3A 3RTVA 5D4BA 2HHXA 2G09A 3O0FA 3RB6A 2IBKA 3CNHA 3U26A 1GO3F 2VA3A 2WB1F 2BHNA 1LKYB 3OTQA 2GWSA 1X2IA 4Z6FA 3CYMA 4NLBA 3V7LA 2VA2A 2MU2A 4CCHA 3WK7A 3D6JA 4O3QA 2CRXA 4U7CA 3C2LA 3H4BA 2WAQC 4OD0A 5AKZA 2PI5A 3KZXA 3G6XA 1BPDA 4FE3A 8ICBA 4QZGA 1A0PA 1ZYQA 3SV4A 4IQWA 3ISCA 2PFQA 1WWUA 3MC1A 4NLCA 2PMZC 5KG3A 5ALUA 4KLSA 1UA0A 2AJQA 3GV8B 2EANA 1MQ2A 1WCNA 1KKXA 4GXJA 4F92B 3RR8A 2QB0A 4CF3A 2E8PA 3IM1A 2EZYA 1Q46A 4FS1A 1NZPA 3OSNA 2XY6A 1UHUA 3GIIA 3R9KA 1JALA 1K5OA 2F76X 8ICEA 5KFPA 1QQ6A 2J6TA 5KFVA 4ECQA 2LYAA 1SKWA 2A1AA 5C5JA 4Y2RA 4C8KA 9ICHA 2HBMA 3EW9A 2BCQA 4B9TA 3PSFA 3C2KA 4CF5A 4DQQA 1VDVA 5KL1B 2ESEA 5J0OA 1U9LA 1WCLA 4KLEA 4YXMA 2E1FA 3NVZA 4PHEA 8ICZA 4KTQA 5HR6A 2YB4A 3Q8KA 1TE2A 1ZJMA 2IOFK 3JPTA 2HOIA 1FEZA 4IRDA 4JWMA 2AHOB 1KFSA 2KTQA 2YMMA 4TUQA 3UMBA 4QWEA 2R8GA 8ICCA 3C2MA 2HMXA 1ZQOA 4QZHA 3KHLA 2KHVA 4NM1A 4FBTA 1KN5A 4I29A 3PY8A 1URJA 3M8RA 2BCVA 5T14A 5DGAA 1UA1A 3TFRA 5KNIA 2KN7A 5L1IA 4O3SA 2B0CA 2F3NA 4FZMA 3L4PA 4UB6U 4QZIA 2HDOA 5JU5A 5DG9A 5J2HA 4C8NA 1T94A 4Q43A 4F50A 3ISDA 4QNLA 2KSOB 2WAQF 4ED3A 3CRXA 8ICFA 3SR6A 3WKAA 5AM4A 1P7DA 4DFPA 4P0PA 3H0MB 5KFZA 2W43A 1S0OA 4HAIA 5KFQA 3WU2U 3OHBA 3MDCA 3KOOA 4JV0A 4C4SA 2I6XA 4C4TA 3LYSA 1M6YA 1ZQWA 3N7SC 3MR6A 1DGSA 3I1YA 2KICA 2W3RA 4BGDA 2ZJAA 4A8EA 2E5SA 5J8YA 4RUCA 2WF9A 2WFAA 5HMMA 8ICIA 1PK1B 2MA1A 1JRPA 3KFUF 3F5EA 9ICMA 5IIOA 1ZQKA 2FPMA 2WF8A 9ICWA 1S5LU 5CB1A 1ZQZA 2JH7A 8ICNA 3OGUA 3KKAC 1ZQAA 3EYZA 4RPYA 2QKQA 1N63A 1X9WA 3N7PD 2BR0A 3RBEA 5AM2A 5ALQA 5HHHA 2L5YA 3PSTA 3BQ2A 3PW4A 4B9SA 4BXOA 4O9MA 3PR4A 3RJHA 4AP9A 1N60A 1TAQA 2FDRA 5F9NA 2VIXA 5L9XA 1Z00B 3KKAA 3JPRA 4KLFA 4R8UB 3TFSA 2XC9A 2ZIXA 5ALOA 2AU0A 4PZOA 2V4QA 3RH5A 4RQ2A 3QXGA 2HVIA 2KZZA 4EEKA 2F8LA 1L3VA 1SL1A 4KLDA 3EPIA 3UQ2A 1NK7A 4B9NA 1A76A 1XSNA 3EZ5A 4YD1A 3T79A 5EWEA 3PX4A 4DS4A 3BQ1A 2KJ8A 1JXEA 2DKZA 2W9CA 2JXJA 1NJZA 3RB0A 1Q3VA 1NKEA 4Y2UA 5JTIA 4Y2YA 2DL0A 3UPQA 1RXWA 4K4GA 1Z4OA 5DG7A 2ZJ5A 4F3OA 3H7IA 2HHVA 2F2AB 5KT6A 1DK3A 1A6SA 2KK0A 2KEYA 9ICKA 4NL9A 4PHDA 1A77A 4KLJA 2NV3A 5IINA 9ICAA 3SI8A 1ZQRA 2ZXIA 1BPBA 3C23A 1U48A 4FFDA 2FLNA 5AI9A 3RRHA 2AGQA 2IOHA 5H2FU 2FLLA 2CPRA 3IP4B 4XA5A 1NK8A 1RDFA 1ZQJA 4ED8A 5ALDA 1NK0A 4M9LA 2KJ5A 5B66U 4ED1A 1BNOA 7ICKA 4PGYA 1Q8KA 5ALHA 2K4HA 5ALNA 5KFIA 4PJ0U 2OHFA 5TISU 2ZIWB 4EX6A 2PFOA 4I2BA 2RHFA 4GXIA 3MR5A 2VANA 1QQ7A 3LDAA 4EZ6A 1B22A 1ZQXA 4KITB 5AKXA 4GXKA 2PFPA 3PW5A 3AN1A 3RFAA 3AM9A 4JUZA 5AI6A 1AROP 1RYUA 2AH5A 3THVA 4RNMA 5DG8A 3HKZF 4DOAA 2OWOA 5ALXA 3PW2A 2J6SA 2ASDA 4F4KA 3T5KA 5BPCA 4LZGA 5DDMA 1S97A 5KG5A 1DXSA 1NK9A 4NLGA 2HHQA 3F2BA 1U4BA 4QZ9A 5A0LA 1RXVA 3PO5A 8ICHA 4UB3A 3ETRA 2XVTA 4Z6CA 3M1YA 2Q4TA 3KBBA 3M8SA 1OUQA 2YTUA 5J0PA 5K4LA 3C21A 4J9PA 5J2AA 2W9MA 4CF4A 3HRDD 1TAMA 4KN7A 2H3IA 1D9DA 2IOFA 3AU2A 2P66A 4J9OA 5J2EA 4RQMA 4ZOHC 4EENA 4QW9A 8ICKA 3TADC 3QU5A 1PK1A 1DOQA 2JMGA 1SXEA 7ICUA 4B6JA 2JR5A 1MA7A 4P4PA 4KN4A 1TV9A 3RH6A 2BCUA 2E3TA 3C5FA 1YZ6A 3HX0A 4K4IA 2LBOA 3Q8LA 1ZQVA 5J29A 4KLGA 4RT3A 2RLTA 2XY5A 8ICMA 1ZQCA 4C0ZA 3WKEA 4F93B 2XGQA 1IXRA 5EE1A 1J2MA 3QU2A 5DB6A 1ZD3A 2R8KA 3Q8MA 5KFRA 3AMZA 8ICAA 2MUTB 3I28A 1L8OA 5CHGA 1O03A 4IRKA 5KFMA 1S8OA 4M47A 4KLTA 4ECXA 4DCCA 3HW8A 1KW4A 3SAFA 2NRZA 3IDWA 4M6WB 2P6RA 2ASLA 2EZZA 3WKDA 5CA7A 9ICXA 4C7ZA 5EWFA 4F2RA 8ICQA 2IA6A 2ZIUA 4I2FA 4RT2A 4UARA 8ICTA 2R8IA 3ORYA 2BDPA 5IIMA 5KAIU 1S9FA 5AKLA 2IHMA 3Q8RB 1COKA 3BS5B 4IQUA 5KFAA 5J0QA 3MFIA 2DWQA 1NJWA 5GTIU 2EDUA 4DS5A 7ICSA 1BPZA 4RZRA 2W11A 1IV8A 2NO5A 3MR3A 2E1EA 5KFYA 5DBAA 5J2FA 1T7PA 4I2HA 4E0DA 5HMLA 4O5CA 4QZ8A 1JIHA 4O0IA 4NJ8A 5DB9A 2HSZA 1XNSA 4RU9A 2F8KA 4ECRA 4MFFA 3BZCA 4BDPA 3LVWA 3N7RC 4BXOB 5ALZA 2XIDA 2E8MA 2KP7A 4UBCA 3ZI4A 7ICTA 2G5IB 1SKSA 1S0NA 2G06A 4ECTA 4UATA 1KLNA 1S0MA 2KIWA 3RF9A 4DL2A 2JEFA 2LMRA 3M7DA 3NVWA 2DQNB 4QIWC 1UPHA 4KX3A 5AKIA 3T3FA 2DPJA 3WK5A 4F4XA 1ZQHA 3JPQA 2ZTCA 7ICJA 7ICRA 4R66A 4MFAA 5KFNA 4Y2PA 4DF8A 3RRGA 1KFDA 1ZRMA 2BPGA 1PK3A 4NWIA 1SV4A 1ZQ1C 3WK4A 3OSPA 2GH1A 2JZBB 4RPZA 5HNKA 4KMOB 3VCBA 2KVCA 2A3VA 4J9QA 4RUAA 1ECWA 1D9FA 2DKXA 5CRXA 1COOA 1Z1VA 4F4ZA 3AEVA 1VJ5A 2F44A 4DFDA 3LK9A 3E2EA 3QNMA 1WWVA 2C2DA 4DSLA 3ZD9A 2OM6A 1F5SA 5KFXA 3UM9A 4JV1A 2I1QA 3WKBA 2HVHA 5B5EU 4DO9A 5AM3A 4ECUA 2P6UA 4US8A 9ICOA 3ZDCA 4LZDA 3GZFA 1CI4A 1XO1A 1NK4A 4GC6A 3NUQA 1JI7A 3GQCA 5AK5A 4ZH4A 4KLMA 1LKYA 8ICGA 1WG8A 1ED1A 1NNLA 1F0MA 2BGWA 4DL4A 4BWJA 4G9BA 3JPSA 3WK8A 5AKGA 5KAFU 2ZIWA 3BQ0A 5IIKA 9ICNA 5EE0A 1NJXA 5J0YA 2LM4A 3QUCA 5ALRA 4J9MA 4DSJA 2HHSA 1J97A 4GIBA 4KLOA 5ALPA 4I2CA 3AU6A 4BJQA 3RJJA 3RJFA 3MGVA 1T3NA 2BKEA 4X5VA 3QEBZ 5EWGA 5DQHA 1ZETA 2A1JA 4Q8EA 8ICYA 3SYZA 1JMSA 3Q8SB 5KTQA 1K1SA 5AKEA 2ES6A 3WKCA 3MR2A 1D8YA 4F2SA 3N97B 3SENA 1ZQGA 5E79U 1K1QA 3HILA 2MUTA 3PSPA 4RQ6A 4MFCA 1MSWD 2G07A 1NOMA 3KHGA 3FM9A 4KLQA 1YZ7A 2RDIA 4M6WA 5DGBA 2BCRA 3GV5B 1ZQTA 2JHDA 2ZG6A 4F4WA 3L3FX 2ZIUB 4YMNA 2B21A 1U49A 1X6JA 1N48A 3TADA 9ICIA 4KMUA 4KLHA 1UQVA 4R63A 5ALMA 5HHIA 2NO4A 3S6JA 2FE9A 4EYIB 1ZQQA 3PW7A 5AK3A 4DSEA 2FMQA 2I9GA 3NVYA 5KT5A 2K8BB 4DEZA 3NGDA 5IILA 4MF2A 4F8RA 4UB5A 3ZDDA 4UAUA 2W03A 5EE3A 1ZXIA 1RYSA 1B0XA 5AIAA 2HI0A 1TKDA 3FYHA 5TZVA 1YT3A 1LB2B 4C8OA 1HIWA 4I2JA 1KEJA 2AQ4A 3C29A 4EZ9A 1X9MA 3TACB 5KFLA 4CDGA 4M9JA 2MRLA 5AI8A 2DF4B 3H8JA 5J2DA 3UXPA 4DLEA 1L3TA 1X66A 2FI1A 1X9XA 4C4RA 4ELUA 3ALRA 2IMWP 5KFDA 2MAXA 4DSKA 5IIJA 3T5LA 5AIBA 3C1ZA 5EE9A 2V4RA 2GOLA 7ICFA 5J2GA 1TAUA 2JGAA 1SL2A 2XI9A 4RQ1A 1Z4NA 4UAVA 3EUB2 4QZBA 4B9UA 1F44A 1FFUA 2H3FA 4QZEA 4DOCA 3DV9A 5AKYA 2XY7A 1N5XA 4ED7A 3T5HA 4BUGA 4FS2A 3RAQA 1Y88A 2KHQA 3Q8PB 3B0YA 3GILA 3TARA 1Z19A 2OEHA 2K4IA 3M9OB 5KFCA 4R65A 3PNCA 2W9BB 1QSLA 4ED0A 1RPLA 4O3RA 4OJLA 5DBCA 2QARB 2KE7A 3I76A 2N1RA 5FP0A 3K75D 3F2DA 4QJFB 3D2QA 1V85A 3G6YA 4DF4A 4XUSA 1KDHA 3AQEA 3EWAA 5AK4A 5KFTA 4ED6A 3RR7A 4C8MA 3N4MB 3T5JA 7ICHA 2ZUBA 4Q44A 3PZPA 9ICSA 1N62A 3IG5A 4PL1A 2DFLA 2VKQA 4UAZA 5KT2A 3SD7A 1SXDA 2OH2A 2W04A 1V97A 1ZQBA 1X6IA 4QZAA 5ALSA 3MGIA 4DWIA 2FMSA 4J9KA 3CP8A 5D46A 2C28A 4ECWA 2EQYA 4TUPA 2Z7JA 4DL6A 3IV6A 5AHXA 3HP6A 2YMPA 2H3VA 2XO7A 1DGJA 1PVQA 4I27A 3QU7A 1T3QA 4R64A 3V7KA 1QSSA 4P0QB 4CRXA 4RQ7A 5L1KA 4NXZA 3D2SA 9ICFA 3AUOA 3N28A 3BQ7A 4ACOA 4IL6U 1U47A 2MSNA 4AYBF 2BPCA 3WK9A 1ZQEA 3RJKA 4DFKA 2KMDA 2RP5A 1V38A 8ICRA 4US9A 2XICA 2ZUDA 2UVRA 2CN1A 3BJYA 5G5GA 1PZNA 2Y0SC 1BPXA 3KD3A 4O3PA 1Z3EB 4Q8FA 2W54A 1NZBA 1H38A 1UT8A 5KFSA 1ZD5A 4M9NA 2FPLA 2DGZA 4DL5A 1L3SA 4EX7A 3RAXA 1SWVA 2G0AA 1L7NA 8ICWA 9ICQA 5J2IA 5ALJA 2FJ6A 3PX6A 9ICVA 5AM5A 5ALFA 3K1ZA 3SAHA 5KFOA 5J0WA 5DLGA 5DQGA 2EAMA 2C2RA 2GO7A 2VJ4A 2R8HA 1T8EA 3V6JA 1OW5A 2Y9UA 5KFFA 1KBUA 3ZD8A 2K8CB 1L3UA 3FC4A 2F1HA 1HUOA 3PO4A 1HJPA 5C0YA 2AXTU 1KSPA 4RQ5A 1ZD2P 2C2EA 5KG6A 4QWAA 2W9AA 2UVVA 2WB1C 2Y9TA 3RJEA 4MEXA 8ICUA 5HP4A 3OHAA 4LJXA 2WF5A 9ICCA 2G08A 2YMLA 4RNNA 1SV0A 3E0FA 3G6VA 4MEYA 5KT7A 2YX8A 3TI0A 2K60A 2YMQA 3H8SA 7ICVA 5EOZA 2LKYA 4NLKA 3OJSA 2ZIVB 3PR5B 5ALLA 4FZNA 4Y2QA 4B9LA 4NV0A 2EAPA 3M6ZA 2ISPA 2F1JA 5AI0A 2BDUA 3MGHA 2IHNA 2KKPA 2W9BA 1RQLA 4YMMA 4DLGA 3MDAA 4YP3A 2BQUA 4O3NA 5DQIA 2M9NA 2KFZA 4UASA 3UMCA 3GIJA 9ICTA 3IHQB 1JXLA 5J0RA 1BPEA 3CW2C 3JPNA 2RQ5A 1CEZA 2HBJA 2H5XA 2PFNA 3NVVA 3NRWA 4PHAA 3NRZA 4YMOA 4CNQA 4RQNA 3MFHA 4DSFA 3K4GA 4CE6A 3TANA 2FLPA 1NJYA 4QW8A 4I2IA 5KG7A 4UBBA 4F4YA 2H3ZA 3VC8A 2FMPA 5AI4A 4M9HA 4U6PA 4K4HA 1L7MA 3JPPA 4F71A 2LM1A 5AKJA 2I5HA 7ICGA 2KNJA 9ICRA 3M6KA 4OJ6A 3BDPA 2ZTDA 5J0TA 4ECSA 5KFHA 9ICUA 2D3DA 3LVVA 2JZBA 2E8NA 2PXIA 1BVSA 5L1MA 2ZXHA 2K89A 1SZPA 2Y1IA 1D8BA 4BX9C 2V9WA 2OXOA 1CUKA 3AQFA 7ICOA 4GFJA 2W55A 4O3OA 4YFKA 2J6UA 2PI4A 1SKRA 1EXNA 8ICLA 4RPXA 4DL7A 4YXJA 2WF7A 3H0RB 1N2XA 5KL8B 3TKAA 2JEJA 1NI3A 4PZNA 2KV2A 2UVUA 5KT4A 4KLUA 2HOFA 4CGZA 2W8KA 2R18A 4QZDA 4Q45A 1JN3A 7ICPA 1XU4A 4I2EA 4DQPA 4Z6EA 2H3QA 3QZ7A 1X9SA 3B0XA 2ISOA 1RZTA 5L1LA 1XSPA 1SB3C 3PV8A 7ICQA 2PKEA 4NLZA 7ICMA 4MHVA 4EBDA 5J2BA 4F72A 3LWLA 4UB1A 3DEEA 1RM6C 4JWNA 3E58A 5ALYA 4C80A 2JH1A 2D6FC 1RG6A 3SQIA 3QZ8A 2QB0B 4YQWA 1ZQUA 2EH9A 5IIIA 1L7PA 4DFMA 1OXJA 4OJPA 3BS7A 4YR2A 5ALWA 2Q0ZX 2ZUCA 4P0QA 7ICIA 4FBUA 4OCZA 3PMLA 1MN8A 4XQ8A 4UAWA 1HUZA 2DPIA 4O3MA 2AQ0A 1SL0A 1N61A 4LVSA 5KG1A 3BZKA 3BQTA 8ICSA 4QWBA 1JROA 1QCKA 5KT3A 4EYHB 3TAQA 5J8YC 4IC9A 3SAGA 2OCEA 1ZJNA 4F5NA 5J2JA 1BPYA 3ICXA 1V9PA 1ZQPA 3NS1A 2W3SA 1S77D 2UVWA 4USAA 3SZ2A 2KKVA 2WHEA 3UQ0A 5DB8A 5CEHA 2KZ3A 9ICJA 1LV5A 3QUTA 2EZXA 1BNPA 2BQ3A 3ZDEA 1ZQSA 2ZIVA 4IR1A 2W7OA 4F5QA 2LYHA 4YR0A 1WUDA 3C1YA 4QZCA 1QTMA 1KRPA 1QH9A 1B43A 1FFVA 3HKZC 1VLBA 5J0SA 5F9LA 1ZRNA 4Y2SA 4IQVA 2LI6A 3RJIA 4TUSA 2VA8A 1XS9D 2EAOA 4GC7A 2G5HB 3V6HA 1S10A 1T4GA 4JV2A 3J81j 1PUZA 2W8LA 1KL9A 4YG2A 2A1JB 3GV7B 3UXNA 5ALVA 2O6KA 5BOMA 4J03A 2BCSA 4B9VA 4YCXA 1X40A 4RNOA 4JMUA 3Q8QB 1ZQNA 2YY6A 3GFKB 5AM1A 2B6GA 1NK6A 2KJ9A 3RBDA 2HCFA 1FO4A 4UAYA 1SV0C 2JRZA 4I2DA 3WK6A 3HT3A 4R8UA 2P35A 3C28A 4TURA 1SIJA 3H0LB 3JPOA 5ALKA 1L8LA 1WYGA 4PGXA 4UB8U 5KFBA 4NLNA 3MABA 2LPEA 3V6KA 5DDYA 2HBKA 4PPXA 3ZDBA 4EBEA 1QLNA 3GU3A 5AI5A 1JUDA 1RQNA 2XCPA 2KG5A 1DK2A 4DQRA 1FIQA 1MQ3A 2W9CB 4GLXA 4UB2A 5KFEA 1LVHA 1IM4A 5J0UA 3UMGA 3QUBA 3QUQA 2NRWA 4UB4A 1CRXA 4I28A 1ZQIA 3QX7A 2DUYA 2HBLA 4DQSA 4IQTA 8ICPA 2E8OA 1ZOLA 5DB7A 1ZD4A 1TFRA 4DSIA 3V7JA 4EELA 2VJ5A 4J9RA 3NTUA 7ICNA 4KX5A 2HHTA 1O08A 1SZHA 2LYBA 3SV3A 2NRXA 1RYRA 4PL2A 1L5UA 3GIMA 3GIKA 4B9MA 4FO6A 2NRTA 3HJEA 4OO1J 5CJ7A 3C5GA 2CXYA 4DQIA 4J9NA 1C20A 2WTFA 1ZQYA 4P4MA 1TK8A 3DDHA 2QB1A 2F77X 5KG2A 3ZDAA 4IRCA 4F5RA 5AM0A 2ASJA 1QQ5A 2ALZA 2RDJA 1BGXT 3QU4A 1AQ6A 5KFGA 3HWTA 3MBYA 5AKKA 2KOBA 5ALIA 3H4DA 5KFJA 4MF8A 2FPKA 1TK0A 1NKCA 2JV3A 3PMNA 3L5KA 2ODGA 4DFJA 4OJOA 1TK5A 4ECZA 1Q3UA 4WJ3B 2JEIA 5KG4A 4P4OA 2KZMA 1XWLA 3F53A 3QEAZ 3ISBA 4J9LA 2K4EA 3PX0A 4TQRA 8ICOA 2PMZF 3SMVA 1ZQMA 3IRUA 4O5EA 4PH5A 4F5OA 5CWRA 2YQEA 5AK6A 3SEIA 2K8AA 1D8LA 2HHWA 5F3XB 2GLEA 2KD1A 5GTHU 2A19A 2QARA 4YN4A 4Y2JA 4O5KA 1ZQFA 3PW0A 3OJUA 4NM2A 4OJ5A 3A0HU 2BQRA 1N5WA 1UT5A 2XGPA 4G3IA 3RB3A 5J2CA 2D8CA 3RB4A 3IN5A 9ICLA 5ALEA 5J2KA 4I2AA 9ICGA 1ZQDA 5KG0A 1S0VA 4RQ4A 1HEKA 3QYPA 5CP2A 4ECYA 3TAPA 3ED5A 2NRVA 3PVXA 2WF6A 1IIPA 2HOQA 9ICBA 5JRTA 4P2HA 4C7YA 3B9JA 4QIWF 3RJGA 5KFKA 5BOLA 1U45A 4KLIA 1PVRA 4DOBA 4UW9A 2F1IA 3IG8A 4ELVA 1S76D 1JX4A 3NASA 1XC9A 2YN4A 4ED2A 4ELTA 3D2NA 1DRGA 4Z6DA 2JEGA 3TQ1A 3AL0B 4ECVA 1J2NA 3OPXA 4DL3A 4M04A 4JB3A 5JUMA 2Y0SF 4AYBC 2YB1A 4BWMA 1L7OA 3QE9Y 2R8JA 4IS7A 4P0PB 4QWDA 4Y2XA 2ATLA 1QSYA 5DBBA 5DKWA 7ICLA 3H8MA 3GDXA 1IG6A 3KZIU 4YVZA 4M2YA 4F91B 4RQ8A 4JK1A 5DLFA 3A0BU 1ZQLA 5AKHA 4YD2A 4M0AA 3RH4A 2KIVA 3EPGA 5D49A 1UCVA 5KFUA 5J0XA 5L1JA 2BPFA 1MC8A 2DBYA 1X42A 3LWMA 2XCAA 8ICVA 4NL9C 4Y2VA 3F5AA 1SWWA 4UQGA 4J9SA 2M0NA 5AICA 2W7PA 4PGQA 2ZJ8A 4QWCA 3FDSA 3UXOA 4EEYA 2AGPA 1C7YA 1KTQA 2Y1JA 4PHPA 3KHRA 4TQSA 2OYYA 5ALTA 5CR0A 2K4PA 4IR9A 4RQ3A 3HPOA 3M9MB 1KFTA 3KHHA 4F5PA 9ICEA 1NKBA 3ETLA 1N56A 2KSOA 3H8WA 1SGGA 2C22A 4QZFA 5G5HA 2RRDA 4C8LA 3BS5A 1Z00A 3FAHA 4I2GA 8ICXA 4KLLA 2LHTA 2ZIXB 1L6NA 3F2CA
chains in the Genus database with same CATH topology
4OJ6A 3SAGA 1Q3UA 4WJ3B 5CRXA 1F44A 2WB1C 4P0QB 4CRXA 2F76X 3F2BA 3ICXA 2KJ8A 5A0LA 3F53A 3D2SA 2HBKA 3OPXA 2K4EA 3LVVA 3LYSA 1PVPA 2XVTA 3GU3A 4ICAA 2G08A 2Y0SF 2LYAA 2H3FA 3N7SC 2ZXHA 2YB1A 4AYBC 2K89A 2KKVA 2PMZF 3SMVA 1D8BA 1Q3VA 2Q4TA 3E0FA 4ACOA 4BX9C 4BUGA 2KICA 2OXOA 2YX8A 2HBMA 4AYBF 2OM6A 4P0PB 1XO0A 3AQFA 1OUQA 4GFJA 2LKYA 3PSIA 3PSFA 2K8BB 2E5SA 2KHQA 2ZIVB 4A8EA 1Z1BA 2F2AB 5KL1B 1A6SA 2E1EA 1Z19A 2K8AA 2RP5A 2KEYA 4FZNA 1TAMA 4NV0A 3M6KA 1CRXA 2K4IA 2KD1A 2E1FA 2H3IA 2ZIVA 2HBLA 3GZFA 3H0RB 3M6ZA 2NV3A 5KL8B 4FZLA 3ONNA 2MA1A 2BDUA 2XICA 5HR7A 2W7OA 2CN1A 2ZXIA 5HR6A 2YB4A 3NUQA 3KFUF 2KKPA 2KV2A 2W03A 3F5EA 2Y0SC 4OJLA 2HOIA 4OJ5A 2G09A 2JMGA 1WUDA 3O0FA 1XNSA 2HOFA 4CGZA 1ED1A 2VJ5A 2CPRA 2N1RA 1MA7A 3IP4B 2R18A 3HKZC 1GO3F 1NZBA 3F2DA 4QJFB 1YT3A 2WB1F 3D2QA 2JH7A 2ZIWA 3LVWA 3N7RC 2DGZA 4KX5A 2HMXA 1HIWA 2H3QA 2XIDA 3IN5A 3CYMA 1SZHA 2G0AA 2KHVA 4NLBA 2KJ5A 3C29A 2LYBA 3AQEA 2LBOA 2CRXA 2G5IB 3F5AA 4U7CA 2G06A 2M0NA 4CDGA 2G5HB 2W7PA 4PL2A 1URJA 2WAQC 2K4HA 2MRLA 2KIWA 3N7PD 3KZXA 1HEKA 2DF4B 4BJQA 3PZPA 4C0ZA 3DEEA 3RF9A 4FE3A 5T14A 3MGVA 4OO1J 2ZIWB 2RHFA 3PSTA 1A0PA 3M7DA 2HBJA 2OYYA 3IG5A 4PL1A 2DQNB 2VKQA 3NRWA 1UPHA 2JH1A 4FZMA 4KX3A 1IIPA 4QIWC 3K1ZA 2VIXA 2D6FC 2OH2A 2HOQA 2W04A 3SQIA 3SAHA 3ALRA 4JMUA 2F77X 4NLCA 2KJ9A 2PMZC 4QIWF 3RFAA 2ZIXA 2VJ4A 3CP8A 4OJPA 2GOLA 3PSPA 1PVRA 3SAFA 4P0QA 1T94A 4NWIA 4QNLA 3HKZF 1ZQ1C 2H3ZA 2G07A 3C28A 2RRDA 1KBUA 3IG8A 2K8CB 2WAQF 3VC8A 4O3MA 2Z7JA 3CRXA 2JGAA 2F8LA 2GH1A 2KOBA 3H0LB 2ZIUA 1L6NA 4U6PA 5C0YA 2LHTA 4KMOB 3VCBA 2KVCA 1P7DA 2A3VA 2XI9A 2H3VA 3D2NA 1DRGA 2ZIXB 1PVQA 1ECWA 3T79A 2JHDA 2KNJA 4OJOA 3AL0B 2ZG6A 4P0PA 3H0MB 3L3FX 2ZIUB 3F2CA 4IC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAM A;  2K4I A;  2LYB A;  2H3I A;  2NV3 A;  2GOL A;  2K4E A;  2K4H A;  4ICA A;  1HEK A;  2LYA A;  2H3F A;  2H3Z A;  2JMG A;  1ED1 A;  2N1R A;  1HIW A;  1UPH A;  2H3V A;  1ECW A;  1A6S A;  1L6N A;  2HMX A;  2H3Q A;  4JMU A;  4IC9 A; 
#chains in the Genus database with same CATH topology
 3M9N B;  4EBC A;  2HW3 A;  4Y2T A;  2KVS A;  4RQ0 A;  3QU9 A;  1PVP A;  5KFW A;  3K1R B;  4ICA A;  4NY8 A;  1NK5 A;  7ICE A;  3H40 A;  9ICP A;  4HYK A;  1XSL A;  3KTQ A;  1XO0 A;  8ICJ A;  3PSI A;  1KQQ A;  2ZTE A;  1Z1B A;  1B4F A;  2BZF A;  3V72 A;  2KFN A;  2AGO A;  4FZL A;  3ONN A;  2HHU A;  1TVA A;  5HR7 A;  2QLT A;  4M9G A;  5ALG A;  4XRH A;  2NYV A;  4YR3 A;  3RTV A;  5D4B A;  2HHX A;  2G09 A;  3O0F A;  3RB6 A;  2IBK A;  3CNH A;  3U26 A;  1GO3 F;  2VA3 A;  2WB1 F;  2BHN A;  1LKY B;  3OTQ A;  2GWS A;  1X2I A;  4Z6F A;  3CYM A;  4NLB A;  3V7L A;  2VA2 A;  2MU2 A;  4CCH A;  3WK7 A;  3D6J A;  4O3Q A;  2CRX A;  4U7C A;  3C2L A;  3H4B A;  2WAQ C;  4OD0 A;  5AKZ A;  2PI5 A;  3KZX A;  3G6X A;  1BPD A;  4FE3 A;  8ICB A;  4QZG A;  1A0P A;  1ZYQ A;  3SV4 A;  4IQW A;  3ISC A;  2PFQ A;  1WWU A;  3MC1 A;  4NLC A;  2PMZ C;  5KG3 A;  5ALU A;  4KLS A;  1UA0 A;  2AJQ A;  3GV8 B;  2EAN A;  1MQ2 A;  1WCN A;  1KKX A;  4GXJ A;  4F92 B;  3RR8 A;  2QB0 A;  4CF3 A;  2E8P A;  3IM1 A;  2EZY A;  1Q46 A;  4FS1 A;  1NZP A;  3OSN A;  2XY6 A;  1UHU A;  3GII A;  3R9K A;  1JAL A;  1K5O A;  2F76 X;  8ICE A;  5KFP A;  1QQ6 A;  2J6T A;  5KFV A;  4ECQ A;  2LYA A;  1SKW A;  2A1A A;  5C5J A;  4Y2R A;  4C8K A;  9ICH A;  2HBM A;  3EW9 A;  2BCQ A;  4B9T A;  3PSF A;  3C2K A;  4CF5 A;  4DQQ A;  1VDV A;  5KL1 B;  2ESE A;  5J0O A;  1U9L A;  1WCL A;  4KLE A;  4YXM A;  2E1F A;  3NVZ A;  4PHE A;  8ICZ A;  4KTQ A;  5HR6 A;  2YB4 A;  3Q8K A;  1TE2 A;  1ZJM A;  2IOF K;  3JPT A;  2HOI A;  1FEZ A;  4IRD A;  4JWM A;  2AHO B;  1KFS A;  2KTQ A;  2YMM A;  4TUQ A;  3UMB A;  4QWE A;  2R8G A;  8ICC A;  3C2M A;  2HMX A;  1ZQO A;  4QZH A;  3KHL A;  2KHV A;  4NM1 A;  4FBT A;  1KN5 A;  4I29 A;  3PY8 A;  1URJ A;  3M8R A;  2BCV A;  5T14 A;  5DGA A;  1UA1 A;  3TFR A;  5KNI A;  2KN7 A;  5L1I A;  4O3S A;  2B0C A;  2F3N A;  4FZM A;  3L4P A;  4UB6 U;  4QZI A;  2HDO A;  5JU5 A;  5DG9 A;  5J2H A;  4C8N A;  1T94 A;  4Q43 A;  4F50 A;  3ISD A;  4QNL A;  2KSO B;  2WAQ F;  4ED3 A;  3CRX A;  8ICF A;  3SR6 A;  3WKA A;  5AM4 A;  1P7D A;  4DFP A;  4P0P A;  3H0M B;  5KFZ A;  2W43 A;  1S0O A;  4HAI A;  5KFQ A;  3WU2 U;  3OHB A;  3MDC A;  3KOO A;  4JV0 A;  4C4S A;  2I6X A;  4C4T A;  3LYS A;  1M6Y A;  1ZQW A;  3N7S C;  3MR6 A;  1DGS A;  3I1Y A;  2KIC A;  2W3R A;  4BGD A;  2ZJA A;  4A8E A;  2E5S A;  5J8Y A;  4RUC A;  2WF9 A;  2WFA A;  5HMM A;  8ICI A;  1PK1 B;  2MA1 A;  1JRP A;  3KFU F;  3F5E A;  9ICM A;  5IIO A;  1ZQK A;  2FPM A;  2WF8 A;  9ICW A;  1S5L U;  5CB1 A;  1ZQZ A;  2JH7 A;  8ICN A;  3OGU A;  3KKA C;  1ZQA A;  3EYZ A;  4RPY A;  2QKQ A;  1N63 A;  1X9W A;  3N7P D;  2BR0 A;  3RBE A;  5AM2 A;  5ALQ A;  5HHH A;  2L5Y A;  3PST A;  3BQ2 A;  3PW4 A;  4B9S A;  4BXO A;  4O9M A;  3PR4 A;  3RJH A;  4AP9 A;  1N60 A;  1TAQ A;  2FDR A;  5F9N A;  2VIX A;  5L9X A;  1Z00 B;  3KKA A;  3JPR A;  4KLF A;  4R8U B;  3TFS A;  2XC9 A;  2ZIX A;  5ALO A;  2AU0 A;  4PZO A;  2V4Q A;  3RH5 A;  4RQ2 A;  3QXG A;  2HVI A;  2KZZ A;  4EEK A;  2F8L A;  1L3V A;  1SL1 A;  4KLD A;  3EPI A;  3UQ2 A;  1NK7 A;  4B9N A;  1A76 A;  1XSN A;  3EZ5 A;  4YD1 A;  3T79 A;  5EWE A;  3PX4 A;  4DS4 A;  3BQ1 A;  2KJ8 A;  1JXE A;  2DKZ A;  2W9C A;  2JXJ A;  1NJZ A;  3RB0 A;  1Q3V A;  1NKE A;  4Y2U A;  5JTI A;  4Y2Y A;  2DL0 A;  3UPQ A;  1RXW A;  4K4G A;  1Z4O A;  5DG7 A;  2ZJ5 A;  4F3O A;  3H7I A;  2HHV A;  2F2A B;  5KT6 A;  1DK3 A;  1A6S A;  2KK0 A;  2KEY A;  9ICK A;  4NL9 A;  4PHD A;  1A77 A;  4KLJ A;  2NV3 A;  5IIN A;  9ICA A;  3SI8 A;  1ZQR A;  2ZXI A;  1BPB A;  3C23 A;  1U48 A;  4FFD A;  2FLN A;  5AI9 A;  3RRH A;  2AGQ A;  2IOH A;  5H2F U;  2FLL A;  2CPR A;  3IP4 B;  4XA5 A;  1NK8 A;  1RDF A;  1ZQJ A;  4ED8 A;  5ALD A;  1NK0 A;  4M9L A;  2KJ5 A;  5B66 U;  4ED1 A;  1BNO A;  7ICK A;  4PGY A;  1Q8K A;  5ALH A;  2K4H A;  5ALN A;  5KFI A;  4PJ0 U;  2OHF A;  5TIS U;  2ZIW B;  4EX6 A;  2PFO A;  4I2B A;  2RHF A;  4GXI A;  3MR5 A;  2VAN A;  1QQ7 A;  3LDA A;  4EZ6 A;  1B22 A;  1ZQX A;  4KIT B;  5AKX A;  4GXK A;  2PFP A;  3PW5 A;  3AN1 A;  3RFA A;  3AM9 A;  4JUZ A;  5AI6 A;  1ARO P;  1RYU A;  2AH5 A;  3THV A;  4RNM A;  5DG8 A;  3HKZ F;  4DOA A;  2OWO A;  5ALX A;  3PW2 A;  2J6S A;  2ASD A;  4F4K A;  3T5K A;  5BPC A;  4LZG A;  5DDM A;  1S97 A;  5KG5 A;  1DXS A;  1NK9 A;  4NLG A;  2HHQ A;  3F2B A;  1U4B A;  4QZ9 A;  5A0L A;  1RXV A;  3PO5 A;  8ICH A;  4UB3 A;  3ETR A;  2XVT A;  4Z6C A;  3M1Y A;  2Q4T A;  3KBB A;  3M8S A;  1OUQ A;  2YTU A;  5J0P A;  5K4L A;  3C21 A;  4J9P A;  5J2A A;  2W9M A;  4CF4 A;  3HRD D;  1TAM A;  4KN7 A;  2H3I A;  1D9D A;  2IOF A;  3AU2 A;  2P66 A;  4J9O A;  5J2E A;  4RQM A;  4ZOH C;  4EEN A;  4QW9 A;  8ICK A;  3TAD C;  3QU5 A;  1PK1 A;  1DOQ A;  2JMG A;  1SXE A;  7ICU A;  4B6J A;  2JR5 A;  1MA7 A;  4P4P A;  4KN4 A;  1TV9 A;  3RH6 A;  2BCU A;  2E3T A;  3C5F A;  1YZ6 A;  3HX0 A;  4K4I A;  2LBO A;  3Q8L A;  1ZQV A;  5J29 A;  4KLG A;  4RT3 A;  2RLT A;  2XY5 A;  8ICM A;  1ZQC A;  4C0Z A;  3WKE A;  4F93 B;  2XGQ A;  1IXR A;  5EE1 A;  1J2M A;  3QU2 A;  5DB6 A;  1ZD3 A;  2R8K A;  3Q8M A;  5KFR A;  3AMZ A;  8ICA A;  2MUT B;  3I28 A;  1L8O A;  5CHG A;  1O03 A;  4IRK A;  5KFM A;  1S8O A;  4M47 A;  4KLT A;  4ECX A;  4DCC A;  3HW8 A;  1KW4 A;  3SAF A;  2NRZ A;  3IDW A;  4M6W B;  2P6R A;  2ASL A;  2EZZ A;  3WKD A;  5CA7 A;  9ICX A;  4C7Z A;  5EWF A;  4F2R A;  8ICQ A;  2IA6 A;  2ZIU A;  4I2F A;  4RT2 A;  4UAR A;  8ICT A;  2R8I A;  3ORY A;  2BDP A;  5IIM A;  5KAI U;  1S9F A;  5AKL A;  2IHM A;  3Q8R B;  1COK A;  3BS5 B;  4IQU A;  5KFA A;  5J0Q A;  3MFI A;  2DWQ A;  1NJW A;  5GTI U;  2EDU A;  4DS5 A;  7ICS A;  1BPZ A;  4RZR A;  2W11 A;  1IV8 A;  2NO5 A;  3MR3 A;  2E1E A;  5KFY A;  5DBA A;  5J2F A;  1T7P A;  4I2H A;  4E0D A;  5HML A;  4O5C A;  4QZ8 A;  1JIH A;  4O0I A;  4NJ8 A;  5DB9 A;  2HSZ A;  1XNS A;  4RU9 A;  2F8K A;  4ECR A;  4MFF A;  3BZC A;  4BDP A;  3LVW A;  3N7R C;  4BXO B;  5ALZ A;  2XID A;  2E8M A;  2KP7 A;  4UBC A;  3ZI4 A;  7ICT A;  2G5I B;  1SKS A;  1S0N A;  2G06 A;  4ECT A;  4UAT A;  1KLN A;  1S0M A;  2KIW A;  3RF9 A;  4DL2 A;  2JEF A;  2LMR A;  3M7D A;  3NVW A;  2DQN B;  4QIW C;  1UPH A;  4KX3 A;  5AKI A;  3T3F A;  2DPJ A;  3WK5 A;  4F4X A;  1ZQH A;  3JPQ A;  2ZTC A;  7ICJ A;  7ICR A;  4R66 A;  4MFA A;  5KFN A;  4Y2P A;  4DF8 A;  3RRG A;  1KFD A;  1ZRM A;  2BPG A;  1PK3 A;  4NWI A;  1SV4 A;  1ZQ1 C;  3WK4 A;  3OSP A;  2GH1 A;  2JZB B;  4RPZ A;  5HNK A;  4KMO B;  3VCB A;  2KVC A;  2A3V A;  4J9Q A;  4RUA A;  1ECW A;  1D9F A;  2DKX A;  5CRX A;  1COO A;  1Z1V A;  4F4Z A;  3AEV A;  1VJ5 A;  2F44 A;  4DFD A;  3LK9 A;  3E2E A;  3QNM A;  1WWV A;  2C2D A;  4DSL A;  3ZD9 A;  2OM6 A;  1F5S A;  5KFX A;  3UM9 A;  4JV1 A;  2I1Q A;  3WKB A;  2HVH A;  5B5E U;  4DO9 A;  5AM3 A;  4ECU A;  2P6U A;  4US8 A;  9ICO A;  3ZDC A;  4LZD A;  3GZF A;  1CI4 A;  1XO1 A;  1NK4 A;  4GC6 A;  3NUQ A;  1JI7 A;  3GQC A;  5AK5 A;  4ZH4 A;  4KLM A;  1LKY A;  8ICG A;  1WG8 A;  1ED1 A;  1NNL A;  1F0M A;  2BGW A;  4DL4 A;  4BWJ A;  4G9B A;  3JPS A;  3WK8 A;  5AKG A;  5KAF U;  2ZIW A;  3BQ0 A;  5IIK A;  9ICN A;  5EE0 A;  1NJX A;  5J0Y A;  2LM4 A;  3QUC A;  5ALR A;  4J9M A;  4DSJ A;  2HHS A;  1J97 A;  4GIB A;  4KLO A;  5ALP A;  4I2C A;  3AU6 A;  4BJQ A;  3RJJ A;  3RJF A;  3MGV A;  1T3N A;  2BKE A;  4X5V A;  3QEB Z;  5EWG A;  5DQH A;  1ZET A;  2A1J A;  4Q8E A;  8ICY A;  3SYZ A;  1JMS A;  3Q8S B;  5KTQ A;  1K1S A;  5AKE A;  2ES6 A;  3WKC A;  3MR2 A;  1D8Y A;  4F2S A;  3N97 B;  3SEN A;  1ZQG A;  5E79 U;  1K1Q A;  3HIL A;  2MUT A;  3PSP A;  4RQ6 A;  4MFC A;  1MSW D;  2G07 A;  1NOM A;  3KHG A;  3FM9 A;  4KLQ A;  1YZ7 A;  2RDI A;  4M6W A;  5DGB A;  2BCR A;  3GV5 B;  1ZQT A;  2JHD A;  2ZG6 A;  4F4W A;  3L3F X;  2ZIU B;  4YMN A;  2B21 A;  1U49 A;  1X6J A;  1N48 A;  3TAD A;  9ICI A;  4KMU A;  4KLH A;  1UQV A;  4R63 A;  5ALM A;  5HHI A;  2NO4 A;  3S6J A;  2FE9 A;  4EYI B;  1ZQQ A;  3PW7 A;  5AK3 A;  4DSE A;  2FMQ A;  2I9G A;  3NVY A;  5KT5 A;  2K8B B;  4DEZ A;  3NGD A;  5IIL A;  4MF2 A;  4F8R A;  4UB5 A;  3ZDD A;  4UAU A;  2W03 A;  5EE3 A;  1ZXI A;  1RYS A;  1B0X A;  5AIA A;  2HI0 A;  1TKD A;  3FYH A;  5TZV A;  1YT3 A;  1LB2 B;  4C8O A;  1HIW A;  4I2J A;  1KEJ A;  2AQ4 A;  3C29 A;  4EZ9 A;  1X9M A;  3TAC B;  5KFL A;  4CDG A;  4M9J A;  2MRL A;  5AI8 A;  2DF4 B;  3H8J A;  5J2D A;  3UXP A;  4DLE A;  1L3T A;  1X66 A;  2FI1 A;  1X9X A;  4C4R A;  4ELU A;  3ALR A;  2IMW P;  5KFD A;  2MAX A;  4DSK A;  5IIJ A;  3T5L A;  5AIB A;  3C1Z A;  5EE9 A;  2V4R A;  2GOL A;  7ICF A;  5J2G A;  1TAU A;  2JGA A;  1SL2 A;  2XI9 A;  4RQ1 A;  1Z4N A;  4UAV A;  3EUB 2;  4QZB A;  4B9U A;  1F44 A;  1FFU A;  2H3F A;  4QZE A;  4DOC A;  3DV9 A;  5AKY A;  2XY7 A;  1N5X A;  4ED7 A;  3T5H A;  4BUG A;  4FS2 A;  3RAQ A;  1Y88 A;  2KHQ A;  3Q8P B;  3B0Y A;  3GIL A;  3TAR A;  1Z19 A;  2OEH A;  2K4I A;  3M9O B;  5KFC A;  4R65 A;  3PNC A;  2W9B B;  1QSL A;  4ED0 A;  1RPL A;  4O3R A;  4OJL A;  5DBC A;  2QAR B;  2KE7 A;  3I76 A;  2N1R A;  5FP0 A;  3K75 D;  3F2D A;  4QJF B;  3D2Q A;  1V85 A;  3G6Y A;  4DF4 A;  4XUS A;  1KDH A;  3AQE A;  3EWA A;  5AK4 A;  5KFT A;  4ED6 A;  3RR7 A;  4C8M A;  3N4M B;  3T5J A;  7ICH A;  2ZUB A;  4Q44 A;  3PZP A;  9ICS A;  1N62 A;  3IG5 A;  4PL1 A;  2DFL A;  2VKQ A;  4UAZ A;  5KT2 A;  3SD7 A;  1SXD A;  2OH2 A;  2W04 A;  1V97 A;  1ZQB A;  1X6I A;  4QZA A;  5ALS A;  3MGI A;  4DWI A;  2FMS A;  4J9K A;  3CP8 A;  5D46 A;  2C28 A;  4ECW A;  2EQY A;  4TUP A;  2Z7J A;  4DL6 A;  3IV6 A;  5AHX A;  3HP6 A;  2YMP A;  2H3V A;  2XO7 A;  1DGJ A;  1PVQ A;  4I27 A;  3QU7 A;  1T3Q A;  4R64 A;  3V7K A;  1QSS A;  4P0Q B;  4CRX A;  4RQ7 A;  5L1K A;  4NXZ A;  3D2S A;  9ICF A;  3AUO A;  3N28 A;  3BQ7 A;  4ACO A;  4IL6 U;  1U47 A;  2MSN A;  4AYB F;  2BPC A;  3WK9 A;  1ZQE A;  3RJK A;  4DFK A;  2KMD A;  2RP5 A;  1V38 A;  8ICR A;  4US9 A;  2XIC A;  2ZUD A;  2UVR A;  2CN1 A;  3BJY A;  5G5G A;  1PZN A;  2Y0S C;  1BPX A;  3KD3 A;  4O3P A;  1Z3E B;  4Q8F A;  2W54 A;  1NZB A;  1H38 A;  1UT8 A;  5KFS A;  1ZD5 A;  4M9N A;  2FPL A;  2DGZ A;  4DL5 A;  1L3S A;  4EX7 A;  3RAX A;  1SWV A;  2G0A A;  1L7N A;  8ICW A;  9ICQ A;  5J2I A;  5ALJ A;  2FJ6 A;  3PX6 A;  9ICV A;  5AM5 A;  5ALF A;  3K1Z A;  3SAH A;  5KFO A;  5J0W A;  5DLG A;  5DQG A;  2EAM A;  2C2R A;  2GO7 A;  2VJ4 A;  2R8H A;  1T8E A;  3V6J A;  1OW5 A;  2Y9U A;  5KFF A;  1KBU A;  3ZD8 A;  2K8C B;  1L3U A;  3FC4 A;  2F1H A;  1HUO A;  3PO4 A;  1HJP A;  5C0Y A;  2AXT U;  1KSP A;  4RQ5 A;  1ZD2 P;  2C2E A;  5KG6 A;  4QWA A;  2W9A A;  2UVV A;  2WB1 C;  2Y9T A;  3RJE A;  4MEX A;  8ICU A;  5HP4 A;  3OHA A;  4LJX A;  2WF5 A;  9ICC A;  2G08 A;  2YML A;  4RNN A;  1SV0 A;  3E0F A;  3G6V A;  4MEY A;  5KT7 A;  2YX8 A;  3TI0 A;  2K60 A;  2YMQ A;  3H8S A;  7ICV A;  5EOZ A;  2LKY A;  4NLK A;  3OJS A;  2ZIV B;  3PR5 B;  5ALL A;  4FZN A;  4Y2Q A;  4B9L A;  4NV0 A;  2EAP A;  3M6Z A;  2ISP A;  2F1J A;  5AI0 A;  2BDU A;  3MGH A;  2IHN A;  2KKP A;  2W9B A;  1RQL A;  4YMM A;  4DLG A;  3MDA A;  4YP3 A;  2BQU A;  4O3N A;  5DQI A;  2M9N A;  2KFZ A;  4UAS A;  3UMC A;  3GIJ A;  9ICT A;  3IHQ B;  1JXL A;  5J0R A;  1BPE A;  3CW2 C;  3JPN A;  2RQ5 A;  1CEZ A;  2HBJ A;  2H5X A;  2PFN A;  3NVV A;  3NRW A;  4PHA A;  3NRZ A;  4YMO A;  4CNQ A;  4RQN A;  3MFH A;  4DSF A;  3K4G A;  4CE6 A;  3TAN A;  2FLP A;  1NJY A;  4QW8 A;  4I2I A;  5KG7 A;  4UBB A;  4F4Y A;  2H3Z A;  3VC8 A;  2FMP A;  5AI4 A;  4M9H A;  4U6P A;  4K4H A;  1L7M A;  3JPP A;  4F71 A;  2LM1 A;  5AKJ A;  2I5H A;  7ICG A;  2KNJ A;  9ICR A;  3M6K A;  4OJ6 A;  3BDP A;  2ZTD A;  5J0T A;  4ECS A;  5KFH A;  9ICU A;  2D3D A;  3LVV A;  2JZB A;  2E8N A;  2PXI A;  1BVS A;  5L1M A;  2ZXH A;  2K89 A;  1SZP A;  2Y1I A;  1D8B A;  4BX9 C;  2V9W A;  2OXO A;  1CUK A;  3AQF A;  7ICO A;  4GFJ A;  2W55 A;  4O3O A;  4YFK A;  2J6U A;  2PI4 A;  1SKR A;  1EXN A;  8ICL A;  4RPX A;  4DL7 A;  4YXJ A;  2WF7 A;  3H0R B;  1N2X A;  5KL8 B;  3TKA A;  2JEJ A;  1NI3 A;  4PZN A;  2KV2 A;  2UVU A;  5KT4 A;  4KLU A;  2HOF A;  4CGZ A;  2W8K A;  2R18 A;  4QZD A;  4Q45 A;  1JN3 A;  7ICP A;  1XU4 A;  4I2E A;  4DQP A;  4Z6E A;  2H3Q A;  3QZ7 A;  1X9S A;  3B0X A;  2ISO A;  1RZT A;  5L1L A;  1XSP A;  1SB3 C;  3PV8 A;  7ICQ A;  2PKE A;  4NLZ A;  7ICM A;  4MHV A;  4EBD A;  5J2B A;  4F72 A;  3LWL A;  4UB1 A;  3DEE A;  1RM6 C;  4JWN A;  3E58 A;  5ALY A;  4C80 A;  2JH1 A;  2D6F C;  1RG6 A;  3SQI A;  3QZ8 A;  2QB0 B;  4YQW A;  1ZQU A;  2EH9 A;  5III A;  1L7P A;  4DFM A;  1OXJ A;  4OJP A;  3BS7 A;  4YR2 A;  5ALW A;  2Q0Z X;  2ZUC A;  4P0Q A;  7ICI A;  4FBU A;  4OCZ A;  3PML A;  1MN8 A;  4XQ8 A;  4UAW A;  1HUZ A;  2DPI A;  4O3M A;  2AQ0 A;  1SL0 A;  1N61 A;  4LVS A;  5KG1 A;  3BZK A;  3BQT A;  8ICS A;  4QWB A;  1JRO A;  1QCK A;  5KT3 A;  4EYH B;  3TAQ A;  5J8Y C;  4IC9 A;  3SAG A;  2OCE A;  1ZJN A;  4F5N A;  5J2J A;  1BPY A;  3ICX A;  1V9P A;  1ZQP A;  3NS1 A;  2W3S A;  1S77 D;  2UVW A;  4USA A;  3SZ2 A;  2KKV A;  2WHE A;  3UQ0 A;  5DB8 A;  5CEH A;  2KZ3 A;  9ICJ A;  1LV5 A;  3QUT A;  2EZX A;  1BNP A;  2BQ3 A;  3ZDE A;  1ZQS A;  2ZIV A;  4IR1 A;  2W7O A;  4F5Q A;  2LYH A;  4YR0 A;  1WUD A;  3C1Y A;  4QZC A;  1QTM A;  1KRP A;  1QH9 A;  1B43 A;  1FFV A;  3HKZ C;  1VLB A;  5J0S A;  5F9L A;  1ZRN A;  4Y2S A;  4IQV A;  2LI6 A;  3RJI A;  4TUS A;  2VA8 A;  1XS9 D;  2EAO A;  4GC7 A;  2G5H B;  3V6H A;  1S10 A;  1T4G A;  4JV2 A;  3J81 j;  1PUZ A;  2W8L A;  1KL9 A;  4YG2 A;  2A1J B;  3GV7 B;  3UXN A;  5ALV A;  2O6K A;  5BOM A;  4J03 A;  2BCS A;  4B9V A;  4YCX A;  1X40 A;  4RNO A;  4JMU A;  3Q8Q B;  1ZQN A;  2YY6 A;  3GFK B;  5AM1 A;  2B6G A;  1NK6 A;  2KJ9 A;  3RBD A;  2HCF A;  1FO4 A;  4UAY A;  1SV0 C;  2JRZ A;  4I2D A;  3WK6 A;  3HT3 A;  4R8U A;  2P35 A;  3C28 A;  4TUR A;  1SIJ A;  3H0L B;  3JPO A;  5ALK A;  1L8L A;  1WYG A;  4PGX A;  4UB8 U;  5KFB A;  4NLN A;  3MAB A;  2LPE A;  3V6K A;  5DDY A;  2HBK A;  4PPX A;  3ZDB A;  4EBE A;  1QLN A;  3GU3 A;  5AI5 A;  1JUD A;  1RQN A;  2XCP A;  2KG5 A;  1DK2 A;  4DQR A;  1FIQ A;  1MQ3 A;  2W9C B;  4GLX A;  4UB2 A;  5KFE A;  1LVH A;  1IM4 A;  5J0U A;  3UMG A;  3QUB A;  3QUQ A;  2NRW A;  4UB4 A;  1CRX A;  4I28 A;  1ZQI A;  3QX7 A;  2DUY A;  2HBL A;  4DQS A;  4IQT A;  8ICP A;  2E8O A;  1ZOL A;  5DB7 A;  1ZD4 A;  1TFR A;  4DSI A;  3V7J A;  4EEL A;  2VJ5 A;  4J9R A;  3NTU A;  7ICN A;  4KX5 A;  2HHT A;  1O08 A;  1SZH A;  2LYB A;  3SV3 A;  2NRX A;  1RYR A;  4PL2 A;  1L5U A;  3GIM A;  3GIK A;  4B9M A;  4FO6 A;  2NRT A;  3HJE A;  4OO1 J;  5CJ7 A;  3C5G A;  2CXY A;  4DQI A;  4J9N A;  1C20 A;  2WTF A;  1ZQY A;  4P4M A;  1TK8 A;  3DDH A;  2QB1 A;  2F77 X;  5KG2 A;  3ZDA A;  4IRC A;  4F5R A;  5AM0 A;  2ASJ A;  1QQ5 A;  2ALZ A;  2RDJ A;  1BGX T;  3QU4 A;  1AQ6 A;  5KFG A;  3HWT A;  3MBY A;  5AKK A;  2KOB A;  5ALI A;  3H4D A;  5KFJ A;  4MF8 A;  2FPK A;  1TK0 A;  1NKC A;  2JV3 A;  3PMN A;  3L5K A;  2ODG A;  4DFJ A;  4OJO A;  1TK5 A;  4ECZ A;  1Q3U A;  4WJ3 B;  2JEI A;  5KG4 A;  4P4O A;  2KZM A;  1XWL A;  3F53 A;  3QEA Z;  3ISB A;  4J9L A;  2K4E A;  3PX0 A;  4TQR A;  8ICO A;  2PMZ F;  3SMV A;  1ZQM A;  3IRU A;  4O5E A;  4PH5 A;  4F5O A;  5CWR A;  2YQE A;  5AK6 A;  3SEI A;  2K8A A;  1D8L A;  2HHW A;  5F3X B;  2GLE A;  2KD1 A;  5GTH U;  2A19 A;  2QAR A;  4YN4 A;  4Y2J A;  4O5K A;  1ZQF A;  3PW0 A;  3OJU A;  4NM2 A;  4OJ5 A;  3A0H U;  2BQR A;  1N5W A;  1UT5 A;  2XGP A;  4G3I A;  3RB3 A;  5J2C A;  2D8C A;  3RB4 A;  3IN5 A;  9ICL A;  5ALE A;  5J2K A;  4I2A A;  9ICG A;  1ZQD A;  5KG0 A;  1S0V A;  4RQ4 A;  1HEK A;  3QYP A;  5CP2 A;  4ECY A;  3TAP A;  3ED5 A;  2NRV A;  3PVX A;  2WF6 A;  1IIP A;  2HOQ A;  9ICB A;  5JRT A;  4P2H A;  4C7Y A;  3B9J A;  4QIW F;  3RJG A;  5KFK A;  5BOL A;  1U45 A;  4KLI A;  1PVR A;  4DOB A;  4UW9 A;  2F1I A;  3IG8 A;  4ELV A;  1S76 D;  1JX4 A;  3NAS A;  1XC9 A;  2YN4 A;  4ED2 A;  4ELT A;  3D2N A;  1DRG A;  4Z6D A;  2JEG A;  3TQ1 A;  3AL0 B;  4ECV A;  1J2N A;  3OPX A;  4DL3 A;  4M04 A;  4JB3 A;  5JUM A;  2Y0S F;  4AYB C;  2YB1 A;  4BWM A;  1L7O A;  3QE9 Y;  2R8J A;  4IS7 A;  4P0P B;  4QWD A;  4Y2X A;  2ATL A;  1QSY A;  5DBB A;  5DKW A;  7ICL A;  3H8M A;  3GDX A;  1IG6 A;  3KZI U;  4YVZ A;  4M2Y A;  4F91 B;  4RQ8 A;  4JK1 A;  5DLF A;  3A0B U;  1ZQL A;  5AKH A;  4YD2 A;  4M0A A;  3RH4 A;  2KIV A;  3EPG A;  5D49 A;  1UCV A;  5KFU A;  5J0X A;  5L1J A;  2BPF A;  1MC8 A;  2DBY A;  1X42 A;  3LWM A;  2XCA A;  8ICV A;  4NL9 C;  4Y2V A;  3F5A A;  1SWW A;  4UQG A;  4J9S A;  2M0N A;  5AIC A;  2W7P A;  4PGQ A;  2ZJ8 A;  4QWC A;  3FDS A;  3UXO A;  4EEY A;  2AGP A;  1C7Y A;  1KTQ A;  2Y1J A;  4PHP A;  3KHR A;  4TQS A;  2OYY A;  5ALT A;  5CR0 A;  2K4P A;  4IR9 A;  4RQ3 A;  3HPO A;  3M9M B;  1KFT A;  3KHH A;  4F5P A;  9ICE A;  1NKB A;  3ETL A;  1N56 A;  2KSO A;  3H8W A;  1SGG A;  2C22 A;  4QZF A;  5G5H A;  2RRD A;  4C8L A;  3BS5 A;  1Z00 A;  3FAH A;  4I2G A;  8ICX A;  4KLL A;  2LHT A;  2ZIX B;  1L6N A;  3F2C A; 
#chains in the Genus database with same CATH homology
 4OJ6 A;  3SAG A;  1Q3U A;  4WJ3 B;  5CRX A;  1F44 A;  2WB1 C;  4P0Q B;  4CRX A;  2F76 X;  3F2B A;  3ICX A;  2KJ8 A;  5A0L A;  3F53 A;  3D2S A;  2HBK A;  3OPX A;  2K4E A;  3LVV A;  3LYS A;  1PVP A;  2XVT A;  3GU3 A;  4ICA A;  2G08 A;  2Y0S F;  2LYA A;  2H3F A;  3N7S C;  2ZXH A;  2YB1 A;  4AYB C;  2K89 A;  2KKV A;  2PMZ F;  3SMV A;  1D8B A;  1Q3V A;  2Q4T A;  3E0F A;  4ACO A;  4BX9 C;  4BUG A;  2KIC A;  2OXO A;  2YX8 A;  2HBM A;  4AYB F;  2OM6 A;  4P0P B;  1XO0 A;  3AQF A;  1OUQ A;  4GFJ A;  2LKY A;  3PSI A;  3PSF A;  2K8B B;  2E5S A;  2KHQ A;  2ZIV B;  4A8E A;  1Z1B A;  2F2A B;  5KL1 B;  1A6S A;  2E1E A;  1Z19 A;  2K8A A;  2RP5 A;  2KEY A;  4FZN A;  1TAM A;  4NV0 A;  3M6K A;  1CRX A;  2K4I A;  2KD1 A;  2E1F A;  2H3I A;  2ZIV A;  2HBL A;  3GZF A;  3H0R B;  3M6Z A;  2NV3 A;  5KL8 B;  4FZL A;  3ONN A;  2MA1 A;  2BDU A;  2XIC A;  5HR7 A;  2W7O A;  2CN1 A;  2ZXI A;  5HR6 A;  2YB4 A;  3NUQ A;  3KFU F;  2KKP A;  2KV2 A;  2W03 A;  3F5E A;  2Y0S C;  4OJL A;  2HOI A;  4OJ5 A;  2G09 A;  2JMG A;  1WUD A;  3O0F A;  1XNS A;  2HOF A;  4CGZ A;  1ED1 A;  2VJ5 A;  2CPR A;  2N1R A;  1MA7 A;  3IP4 B;  2R18 A;  3HKZ C;  1GO3 F;  1NZB A;  3F2D A;  4QJF B;  1YT3 A;  2WB1 F;  3D2Q A;  2JH7 A;  2ZIW A;  3LVW A;  3N7R C;  2DGZ A;  4KX5 A;  2HMX A;  1HIW A;  2H3Q A;  2XID A;  3IN5 A;  3CYM A;  1SZH A;  2G0A A;  2KHV A;  4NLB A;  2KJ5 A;  3C29 A;  2LYB A;  3AQE A;  2LBO A;  2CRX A;  2G5I B;  3F5A A;  4U7C A;  2G06 A;  2M0N A;  4CDG A;  2G5H B;  2W7P A;  4PL2 A;  1URJ A;  2WAQ C;  2K4H A;  2MRL A;  2KIW A;  3N7P D;  3KZX A;  1HEK A;  2DF4 B;  4BJQ A;  3PZP A;  4C0Z A;  3DEE A;  3RF9 A;  4FE3 A;  5T14 A;  3MGV A;  4OO1 J;  2ZIW B;  2RHF A;  3PST A;  1A0P A;  3M7D A;  2HBJ A;  2OYY A;  3IG5 A;  4PL1 A;  2DQN B;  2VKQ A;  3NRW A;  1UPH A;  2JH1 A;  4FZM A;  4KX3 A;  1IIP A;  4QIW C;  3K1Z A;  2VIX A;  2D6F C;  2OH2 A;  2HOQ A;  2W04 A;  3SQI A;  3SAH A;  3ALR A;  4JMU A;  2F77 X;  4NLC A;  2KJ9 A;  2PMZ C;  4QIW F;  3RFA A;  2ZIX A;  2VJ4 A;  3CP8 A;  4OJP A;  2GOL A;  3PSP A;  1PVR A;  3SAF A;  4P0Q A;  1T94 A;  4NWI A;  4QNL A;  3HKZ F;  1ZQ1 C;  2H3Z A;  2G07 A;  3C28 A;  2RRD A;  1KBU A;  3IG8 A;  2K8C B;  2WAQ F;  3VC8 A;  4O3M A;  2Z7J A;  3CRX A;  2JGA A;  2F8L A;  2GH1 A;  2KOB A;  3H0L B;  2ZIU A;  1L6N A;  4U6P A;  5C0Y A;  2LHT A;  4KMO B;  3VCB A;  2KVC A;  1P7D A;  2A3V A;  2XI9 A;  2H3V A;  3D2N A;  1DRG A;  2ZIX B;  1PVQ A;  1ECW A;  3T79 A;  2JHD A;  2KNJ A;  4OJO A;  3AL0 B;  2ZG6 A;  4P0P A;  3H0M B;  3L3F X;  2ZIU B;  3F2C A;  4IC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...