4JMUA

Crystal structure of hiv matrix residues 1-111 in complex with inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Gag-Pol polyprotein
publication title Enantiomeric Atropisomers Inhibit HCV Polymerase and/or HIV Matrix: Characterizing Hindered Bond Rotations and Target Selectivity.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
total genus 41
structure length 105
sequence length 105
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4jmuA00
2K4HA 1HIWA 2JMGA 2LYBA 4ICAA 2H3IA 2H3VA 2LYAA 2K4IA 1ED1A 2H3ZA 1TAMA 2NV3A 2N1RA 4JMUA 1ECWA 2GOLA 4IC9A 1HEKA 1L6NA 2H3QA 1UPHA 2K4EA 1A6SA 2HMXA 2H3FA
chains in the Genus database with same CATH superfamily
3G6YA 4J9QA 1X66A 2I5HA 4XQ8A 4C7ZA 3MFHA 5AM2A 1IIPA 5KFSA 1LKYB 1TAQA 1SXEA 2BPCA 4ECUA 5EE1A 4I2BA 4DQPA 2XO7A 1PVPA 2WFAA 4CRXA 2HVHA 2BCUA 2JZBB 3PSTA 3M9NB 4YD1A 1C20A 2PKEA 3KHGA 1SKRA 5KFFA 2W03A 2VIXA 2WAQC 3H7IA 5F9NA 5L1JA 3MC1A 5AKXA 2DKXA 1BPXA 8ICSA 2W9CB 5KT2A 3AU2A 4UARA 2Y0SC 9ICRA 2NRVA 1ZQQA 3N7RC 1ZD2P 3UXOA 3IHQB 2MU2A 3MGIA 3WK7A 5CB1A 8ICLA 5KFVA 5KFEA 4RPXA 3UXPA 1N5XA 3PZPA 5J0PA 2DQNB 5DLGA 1BGXT 1OUQA 2DGZA 3DEEA 2PXIA 1ZOLA 1ZQGA 1S77D 5L1KA 4AYBC 4DWIA 5AKLA 2K89A 2KHVA 4F4ZA 1DK2A 2I1QA 3EW9A 5AM4A 7ICUA 2XI9A 5KG0A 3QUCA 4FS2A 3I28A 3GIJA 5ALDA 1KKXA 5KTQA 5G5HA 2ZXIA 4GC6A 3SENA 3Q8RB 2HVIA 3PX0A 1XWLA 4O5CA 1S97A 2KJ5A 4M0AA 1Z1VA 2PI5A 3RH6A 5IIMA 3RJKA 3SI8A 7ICFA 4R63A 2K8AA 1CUKA 2XCAA 2BDUA 1Z4OA 5IIIA 1UA0A 4FE3A 1U47A 1B22A 2HI0A 4FZMA 3RJJA 2R8KA 3SAFA 3UXNA 4M47A 3T5KA 1ZQLA 2ISPA 3IRUA 4FO6A 5AKIA 1BPZA 2R8HA 3KHHA 3WK9A 4F5RA 1K1SA 2FI1A 2D8CA 3GFKB 2UVUA 1B0XA 4UAUA 4IS7A 3QU9A 1Z3EB 2W9MA 9ICOA 1B4FA 2OWOA 5HHIA 3QNMA 4M6WB 2HBJA 5ALXA 5J2JA 5KAIU 4CF4A 4JWMA 4BWMA 2ZIWB 3JPQA 2XY5A 4KLUA 5AM3A 1ZQBA 1WCNA 2AGOA 4P0QA 2W9BB 1ZQFA 5ALSA 1DK3A 4CGZA 2FMPA 4B9VA 1QQ7A 2WF7A 3ORYA 2DPIA 3PW7A 4M9HA 2HBMA 4B9TA 1Q3UA 2ZXHA 3H4BA 1AQ6A 4RQNA 1QCKA 3QEAZ 1QLNA 5KFMA 3I76A 3UQ0A 3SYZA 2GOLA 4BXOA 1IM4A 1JMSA 2F3NA 4O3SA 2OM6A 2A3VA 1JN3A 1FO4A 1S8OA 2KVSA 7ICQA 4Z6CA 1SB3C 7ICTA 4DQRA 4OJ6A 1SGGA 3RF9A 2F8KA 3L3FX 4Y2UA 1RPLA 2ASDA 3RB4A 4QWAA 5L9XA 2QB1A 2HW3A 1XSLA 2D6FC 3B0YA 3G6VA 4KLHA 9ICAA 5KT5A 2KD1A 2DFLA 2YB1A 3QU7A 5HMMA 2Y9UA 1KTQA 5KG2A 4GLXA 1TKDA 3ONNA 4K4GA 3KFUF 1WG8A 4GC7A 2AU0A 1NI3A 2WF6A 5KFOA 3V7JA 5AK6A 3RRHA 5HNKA 3BQTA 2FPKA 2Q4TA 2F76X 4ED2A 4O5EA 2C2EA 2HOFA 4Z6DA 1XO1A 1S9FA 2NO4A 2AGPA 2JMGA 3RB0A 4LVSA 4ED6A 3H0MB 1ZQ1C 2VA8A 1QSYA 1PK3A 2CPRA 3OSPA 2NV3A 1O08A 1VDVA 4RQMA 3TANA 4DFPA 5ALUA 4F4XA 4HAIA 2BDPA 3BJYA 3BZCA 4DLEA 8ICPA 4PHEA 4DSIA 2XCPA 4UB5A 2MA1A 3NRZA 1ZETA 1Z1BA 5EE3A 2OH2A 4QZEA 3K75D 3C2LA 2W11A 3LWLA 3UM9A 4KLQA 1S0NA 4EELA 4LZGA 4QZAA 3ZDAA 4J9MA 3CP8A 4YD2A 1MA7A 2KFNA 2WTFA 3JPPA 2FE9A 4DFDA 1S0OA 3GIIA 5KG4A 5EE9A 2GO7A 4NLNA 2XY7A 4F93B 5KG3A 2AGQA 1L3SA 3HRDD 4O9MA 3CYMA 4NJ8A 5AKKA 3L5KA 4OJOA 3AQFA 2V4QA 2HHUA 2KVCA 4UB6U 3RJIA 5J0YA 3V7LA 5J2BA 2LYBA 2WF9A 1L5UA 5JTIA 1TK8A 2ASLA 4TURA 4BWJA 3TACB 5DDMA 3OJSA 4RPZA 1VLBA 4BX9C 2B6GA 4PGXA 4F92B 5ALFA 3ISCA 2K60A 2AXTU 3K1ZA 2ZIUA 2MSNA 2WF5A 5IINA 1DOQA 3CRXA 3UQ2A 1ZQTA 2R8GA 3UPQA 1WYGA 4EYHB 4C4SA 4JV0A 2EZZA 3HX0A 2W3SA 1NJYA 1CI4A 1TK0A 5J2IA 1ZQKA 3T5LA 1UHUA 1D9FA 3GDXA 1TAMA 4QNLA 2XGPA 5ALTA 4UAWA 4I29A 5ALRA 5IIOA 4CF3A 5D46A 3K4GA 2JEGA 4I2IA 2HHXA 4A8EA 3K1RB 2XGQA 1ZQEA 3B0XA 1ZQWA 3F2BA 2LYAA 2MUTA 3KKAA 1UT5A 1L8LA 3IN5A 4PGYA 3R9KA 2QB0B 4I27A 4KN7A 5ALPA 4CE6A 1BPYA 4IC9A 4Q43A 5ALIA 1QQ6A 2HBLA 4DSKA 5KFHA 1YT3A 4I2GA 3CW2C 4TUQA 2YMPA 2YMMA 7ICGA 1ZQRA 3RJGA 4QIWF 4QZFA 5HMLA 2EZYA 4PL2A 5KFUA 2HDOA 9ICBA 4ECZA 1K5OA 1A77A 4LZDA 1KL9A 1NJZA 1A6SA 2HMXA 4DO9A 4I28A 1Z19A 3TKAA 5KFRA 2J6TA 3RRGA 5KFLA 4O3RA 1Q3VA 4YP3A 4M9NA 3M6ZA 5L1LA 1ZD5A 4JUZA 1U49A 1VJ5A 2QLTA 2KICA 4NLKA 3M6KA 5ALNA 3WK4A 4MFCA 4EBCA 1N56A 5KFAA 5DB8A 3PMNA 4B9LA 4UAVA 1UA1A 8ICZA 1COOA 2LI6A 3U26A 3A0BU 2H3ZA 4MFAA 1HUZA 1RXWA 4J9LA 4MFFA 1NJXA 4R65A 9ICMA 2KHQA 4YMMA 4QJFB 1CRXA 1RG6A 1ZRNA 2NYVA 3FM9A 3VC8A 3MGHA 4K4HA 3F5AA 7ICSA 3UMGA 3C23A 2W55A 1KFTA 4QZ9A 4YXMA 3E58A 2VJ4A 2G06A 3L4PA 2XY6A 1L3VA 2R18A 5KFCA 4DF8A 5AKZA 1S76D 2A1JA 3PSPA 2ZJ8A 2BPGA 5J2EA 2K4HA 3AU6A 4PPXA 2RP5A 2J6SA 5ALQA 5KT3A 3V6KA 4QZDA 4O3NA 5J2FA 4OJLA 5J8YC 4RQ5A 4OJPA 1RXVA 5IIKA 1KFDA 4XA5A 2KP7A 5DLFA 1X9SA 5AIBA 4C0ZA 1Z00B 2E1EA 2KMDA 2PI4A 2PFPA 2G07A 5KFDA 1MN8A 8ICVA 2LMRA 2KOBA 4R8UB 3NVWA 5KG7A 1J2NA 2KSOA 5J0SA 3AQEA 5B5EU 5CA7A 2ZTEA 3THVA 5KFPA 5AK5A 1SWVA 3AUOA 2VJ5A 4FS1A 1PK1A 5F9LA 3AMZA 2BCQA 1N63A 3WKAA 4KLSA 1BNOA 2VA3A 5AI6A 2Y9TA 1NKBA 1SXDA 3QU2A 2ZIXA 2C22A 2G08A 4DFKA 3SEIA 2HHWA 1WUDA 5AICA 2KK0A 2BKEA 3ZD9A 4DL6A 2F44A 4Z6FA 5ALZA 2CRXA 1T94A 1J2MA 1ED1A 4IRCA 4I2FA 3HJEA 4ECWA 3IDWA 2E3TA 2NRXA 2ES6A 4R66A 2A1AA 1FFVA 3MR3A 2LKYA 1Y88A 3PO4A 3KHRA 2ZIVA 3MDCA 4BJQA 4M04A 4RPYA 1EXNA 2P6UA 4ZH4A 3MDAA 4RU9A 4F4KA 1K1QA 1KW4A 2F8LA 3PW2A 4IR9A 1X2IA 4DCCA 4DL4A 1AROP 4QZIA 2EAOA 3EZ5A 1FIQA 4O0IA 4PHPA 2BPFA 2A19A 1KEJA 1ZQCA 3RH5A 1MQ2A 1NK7A 2IOFK 3M8SA 1F0MA 2Y1JA 2WAQF 1ZQDA 4Q8FA 2FLPA 3PR4A 2HOQA 5C5JA 4B9UA 9ICWA 2EDUA 3QYPA 4DSLA 1L7OA 4F5NA 5AKEA 4MEXA 1S0MA 8ICJA 2NRWA 4Y2TA 4ED7A 1QSSA 3H0LB 4ED8A 4F71A 5KNIA 4KMUA 5AM1A 4DEZA 1X42A 3V6HA 1SZHA 2JR5A 2G0AA 5C0YA 5TISU 2DL0A 1N2XA 3NVYA 2JH1A 4I2EA 4J9KA 3HW8A 3IG5A 8ICRA 5J0OA 2VANA 3ZI4A 4UBBA 5J0UA 3LDAA 2ZTDA 2Q0ZX 4F50A 3ETLA 3MFIA 3KBBA 4RT3A 1SWWA 4F2SA 3WK6A 3B9JA 3M1YA 4YMNA 1A0PA 2PFQA 5J0XA 5D49A 3ETRA 5KFWA 4J9RA 3N7SC 4EEYA 3I1YA 2VKQA 4Y2RA 1NZBA 4DOAA 4KX5A 5DGBA 5AI0A 9ICKA 2MAXA 2HSZA 2BQRA 1HIWA 3AM9A 1D8BA 2HHTA 3RBDA 2DBYA 4NV0A 1O03A 4US9A 9ICTA 2W8KA 8ICAA 1U45A 2FLNA 1ZQOA 5KG5A 4RUCA 5EOZA 4DQQA 4LJXA 4DSFA 2W8LA 2CXYA 3O0FA 3RR7A 3A0HU 3ZDCA 4OCZA 9ICLA 4F4WA 2F1IA 3D6JA 2L5YA 1C7YA 2FLLA 2IMWP 9ICGA 1RYRA 4E0DA 2WB1F 1TAUA 1L3UA 4R64A 2EANA 4RZRA 1XC9A 5DBBA 7ICLA 2ZUDA 4ECQA 3AEVA 1X40A 2F77X 3QU5A 1QTMA 3RJEA 4B9MA 4P0QB 5DBCA 5EE0A 4DS4A 2BCRA 2G5HB 4NLBA 3KZIU 5DQGA 3PW4A 2RLTA 5J2DA 5H2FU 3FC4A 2V9WA 4NM1A 2N1RA 2PMZF 2PFNA 3FYHA 4BDPA 4ZOHC 2E8OA 3T3FA 2KZZA 4M9LA 7ICJA 8ICCA 4EEKA 3E0FA 4NLGA 1MQ3A 2XICA 4BXOB 1ZD3A 1PVQA 2QKQA 4DOBA 4Y2PA 1WWUA 4QZ8A 1XU4A 3RAXA 2CN1A 4QWBA 5HR7A 3TADC 2JGAA 3DV9A 3ICXA 4NLCA 3MR2A 3JPNA 2OHFA 4KITB 4RUAA 3KTQA 4ECRA 1D8LA 7ICPA 5J2GA 5KFNA 1A76A 4IR1A 4YVZA 4C8LA 1X9WA 1ZQZA 5CP2A 5ALGA 4KLDA 4C8OA 3AL0B 5ALEA 1RZTA 8ICNA 3RJHA 4I2AA 5FP0A 4KLEA 3Q8KA 1F5SA 2AQ0A 3NUQA 5DGAA 4F4YA 3N28A 1N61A 4CDGA 4PL1A 4B9SA 4DL3A 4RQ2A 3OSNA 3QEBZ 3LVWA 4DLGA 2C2DA 1JXLA 9ICFA 5KFTA 1ZQHA 4YR2A 3H8MA 4EENA 3VCBA 2ZJ5A 5IILA 3HKZC 2C28A 1L8OA 7ICNA 2WF8A 2P66A 1TFRA 2W54A 2YMQA 1Q46A 1SV0C 3QUTA 3ZDBA 2H3IA 4F72A 4QIWC 4NY8A 2E8PA 5AK3A 3D2SA 4YN4A 7ICHA 1XSPA 1ZQAA 1UPHA 5ALHA 3BDPA 3NTUA 1IV8A 3Q8LA 4CCHA 5KT4A 1PZNA 1RM6C 4KLMA 5DQHA 3KZXA 3M9OB 3BQ1A 7ICRA 3EPGA 1YZ7A 5CEHA 9ICJA 3H8WA 5KL1B 3Q8SB 4HYKA 5AHXA 3RAQA 2H5XA 3GIMA 2I6XA 4KLLA 3BS5A 2W7PA 3WK8A 4MF8A 3SMVA 1JALA 2JEIA 4EZ6A 3TAPA 5EWGA 3RB3A 2GLEA 5J2CA 4DQSA 4P0PA 1TVAA 3JPOA 3MABA 5HP4A 1L3TA 2BGWA 3V6JA 2IOFA 2QARA 3M8RA 5J2KA 2NRTA 1RDFA 3C2KA 3JPTA 2W9AA 2F1HA 3FDSA 1IG6A 2ZIUB 4Y2YA 5J0TA 5J2HA 4ECYA 3QX7A 1BPEA 2YMLA 2AHOB 1JUDA 5DDYA 1T4GA 3QU4A 1Q8KA 3FAHA 2XIDA 1S5LU 8ICUA 5DG8A 1D9DA 3NS1A 1KBUA 4KLJA 1HUOA 5L1MA 4Y2QA 1LB2B 3PSFA 4GXIA 1SKWA 2IHNA 8ICBA 2E1FA 5KFBA 4IQTA 2LM1A 4O3QA 4NLZA 2V4RA 1PVRA 8ICQA 5JRTA 4I2CA 2MUTB 4M2YA 3H4DA 3SAHA 1LKYA 3F53A 4FBTA 7ICEA 4QWCA 4PHAA 1JX4A 4EZ9A 4GFJA 4DQIA 2AJQA 3GQCA 4J03A 2W7OA 2KIVA 3V7KA 5KG6A 1ZJMA 5DKWA 1HJPA 1KQQA 3BQ0A 1NK0A 4KLTA 4YQWA 3WU2U 3RJFA 4IL6U 3RR8A 1SV0A 1RQLA 3S6JA 2E8NA 5T14A 3RTVA 1T8EA 3QXGA 2BQUA 1ZQJA 3PVXA 2HCFA 3PR5B 2ZUBA 2BR0A 2YQEA 1U4BA 2OXOA 1IXRA 8ICGA 3LYSA 2RHFA 4QW8A 4KN4A 2W9CA 3HPOA 3SR6A 4F5PA 3TFSA 4KX3A 4UATA 3GV7B 4C7YA 9ICQA 2ALZA 7ICOA 5AI8A 3SV3A 2KIWA 3T79A 3H8JA 4UB2A 2KV2A 4DL5A 3LWMA 8ICWA 4UB1A 4U6PA 4DSEA 1XO0A 3RB6A 5J0WA 4IQUA 1GO3F 3PMLA 1XS9D 2DUYA 2IA6A 3OPXA 5B66U 2AQ4A 5CR0A 5KFJA 4QWDA 4B6JA 2ASJA 3BQ2A 1ZQNA 2DF4B 3RH4A 4Q44A 4RQ8A 4GXJA 1SL0A 4DOCA 4ELVA 5AKJA 4F3OA 1ZRMA 5ALVA 1MSWD 9ICPA 3KD3A 2JEFA 2KFZA 3C1ZA 1ECWA 1NJWA 1FFUA 4O3MA 2H3QA 3IM1A 3Q8MA 4RNNA 2A1JB 2IHMA 4ELTA 1TV9A 4JWNA 4UB4A 4ECXA 4QZCA 1DXSA 4ED3A 4U7CA 5KFXA 3PY8A 4Y2VA 3SAGA 4Q8EA 1SZPA 1OW5A 3EYZA 4EYIB 4Y2SA 5KFIA 3MR5A 3HILA 4PJ0U 5AKYA 4EX6A 4DS5A 4C4RA 3SZ2A 5KT7A 4F5OA 2XVTA 2JEJA 2LM4A 2DKZA 3OTQA 4M6WA 4KTQA 3SV4A 3WKEA 2ZIWA 2UVVA 4KLOA 3HP6A 1LV5A 1KFSA 2KN7A 2H3VA 1JIHA 2KSOB 2W9BA 2ZUCA 1NK6A 2HBKA 5F3XB 1URJA 5KFZA 2YX8A 4IQVA 3EPIA 3JPSA 3ZD8A 1NK8A 4JV1A 3KOOA 4KLFA 1T3NA 1PK1B 2Y0SF 4CNQA 2H3FA 3V72A 3QZ7A 1KLNA 1SL1A 5TZVA 5KFKA 2J6UA 4MEYA 5J8YA 1H38A 4M9GA 2ZIXB 2EAMA 1JXEA 1WWVA 5AI5A 4C8NA 2W3RA 1XSNA 1KSPA 1QQ5A 3M7DA 1UCVA 4UW9A 1ZQIA 4YFKA 3OJUA 3PSIA 5ALMA 3Q8QB 1QSLA 1B43A 3F5EA 4AYBF 3GIKA 4EX7A 4DL7A 2KJ8A 2KZ3A 4C8KA 2M0NA 3T5HA 2KTQA 4EBDA 3GV8B 1MC8A 4UB8U 5GTHU 4NXZA 2HHVA 2ZIVB 1NK4A 3MR6A 4KLGA 3H8SA 1FEZA 5AM5A 3WKCA 3HT3A 8ICYA 4JV2A 3PX4A 3BQ7A 4JB3A 4YR0A 1S0VA 2NO5A 2R8IA 2YB4A 4EBEA 4O3PA 2O6KA 5DG7A 4UASA 3IG8A 4GXKA 2FMSA 1TE2A 4UB3A 4GIBA 1ZQMA 1YZ6A 3ZDDA 1KRPA 2WB1C 3TAQA 3WK5A 3C21A 4RNOA 4J9PA 2PFOA 3MBYA 1BPDA 9ICCA 5JUMA 1L6NA 5JU5A 4YCXA 1SKSA 2BQ3A 2K4PA 2R8JA 3C28A 2KKPA 2KEYA 1NKCA 3WKDA 3OGUA 4DF4A 1BVSA 2E8MA 4OJ5A 4M9JA 5CJ7A 2UVRA 4ECSA 4YXJA 2PMZC 5AKHA 4JMUA 3PNCA 2KG5A 3MGVA 5CRXA 4J9OA 4XUSA 2YTUA 4F2RA 5DG9A 2FPLA 1ZQSA 5BPCA 2ATLA 5EWEA 4BGDA 4Z6EA 3TI0A 1T7PA 5AI9A 3OHBA 2IOHA 2KNJA 3ED5A 4RQ3A 4F5QA 3PW0A 4Q45A 1DRGA 1BPBA 4DFJA 4OO1J 1CEZA 5ALKA 4UAZA 1ZQVA 1T3QA 1PUZA 2JHDA 2YY6A 1L7NA 2LPEA 9ICNA 4K4IA 4RQ1A 2W04A 4UAYA 1ZQYA 1KDHA 4PHDA 4IRDA 4XRHA 4KLIA 4P4MA 4BUGA 3C2MA 3N97B 3GU3A 2K8BB 2Y1IA 2B0CA 5KG1A 2HHQA 1V97A 8ICHA 5ALYA 3EUB2 5IIJA 3KKAC 1SL2A 1DGSA 4F91B 7ICIA 3WKBA 4NL9C 4QZHA 1WCLA 1F44A 2RQ5A 4RQ7A 5KFYA 4F8RA 2B21A 3SD7A 9ICHA 3NASA 4FZLA 3TARA 4FZNA 4J9SA 5L1IA 1RQNA 3D2QA 3T5JA 1OXJA 9ICIA 3JPRA 1L7MA 2FDRA 4FBUA 3C5GA 1V9PA 4C8MA 2OYYA 4ACOA 1ZQUA 2GH1A 1NZPA 3G6XA 7ICVA 3J81j 2DWQA 3SQIA 4P2HA 5DQIA 4CF5A 1N5WA 1QH9A 3N4MB 3F2CA 2LBOA 4I2HA 2K4IA 4YMOA 2NRZA 3H0RB 4I2JA 8ICEA 3N7PD 2ZJAA 4YR3A 2VA2A 1N62A 5BOLA 4ECTA 5ALLA 3RFAA 4RT2A 3BZKA 1S10A 2P35A 2RRDA 4KMOB 2QB0A 4ICAA 5ALWA 2Z7JA 5ALJA 9ICSA 5DB6A 5AM0A 1LVHA 2C2RA 4AP9A 4C80A 3PW5A 5K4LA 2ZTCA 3DDHA 3NVZA 3OHAA 3UMBA 2LHTA 2BZFA 3M9MB 3ISDA 9ICEA 3GILA 3C5FA 3CNHA 5BOMA 1X6IA 4ED1A 4P4OA 3LK9A 3ISBA 2P6RA 4FFDA 1NNLA 4IRKA 2OEHA 4G3IA 1UQVA 3IV6A 4TQSA 2EAPA 3BS7A 2EZXA 1L7PA 3PO5A 5DB7A 5KFGA 4NWIA 1X9XA 4O5KA 3UMCA 5HHHA 2EQYA 5KL8B 2ISOA 5J29A 4RQ0A 2E5SA 2AH5A 2FPMA 2LYHA 2KKVA 2HOIA 2JXJA 3RBEA 3Q8PB 3KHLA 2ODGA 2EH9A 5GTIU 3TFRA 1BNPA 1HEKA 3NVVA 3ZDEA 4ELUA 4C4TA 1J97A 1NKEA 9ICVA 4G9BA 3C1YA 3D2NA 4NL9A 5CWRA 5E79U 5EWFA 1RYSA 2F2AB 3EWAA 3HWTA 1NK5A 1KN5A 3HKZF 5A0LA 4I2DA 1NK9A 5DB9A 4OD0A 3TADA 1V38A 4Y2XA 4TUSA 4PH5A 5KT6A 1ZJNA 9ICUA 8ICMA 1NOMA 4YG2A 4UBCA 3IP4B 4IQWA 1ZYQA 5AKGA 5ALOA 1Z4NA 1M6YA 2W43A 1JI7A 1X9MA 5AI4A 4TQRA 3F2DA 2JV3A 1U48A 2F1JA 1V85A 8ICKA 1TK5A 1JRPA 9ICXA 3QZ8A 7ICMA 4X5VA 3GZFA 1SIJA 7ICKA 1ZD4A 2WHEA 2G5IB 1COKA 3PV8A 1RYUA 5KAFU 2K4EA 3BS5B 5J2AA 1Z00A 4Y2JA 3H40A 3QUBA 2YN4A 1UT8A 3QE9Y 1ZXIA 4ED0A 2JRZA 5HR6A 2KJ9A 8ICXA 2ESEA 4P0PB 2K8CB 1N60A 3AN1A 4R8UA 2BCVA 4DFMA 3E2EA 2FMQA 2JZBA 4US8A 2D3DA 2HHSA 4TUPA 5G5GA 2MRLA 2I9GA 2KE7A 5AK4A 2QARB 1ZQPA 3ALRA 2BCSA 2GWSA 1N48A 4QZGA 2XC9A 3TQ1A 5J0QA 2M9NA 3NGDA 1P7DA 2FJ6A 1ZQXA 5KFQA 4O3OA 4JK1A 2KZMA 3QUQA 4DL2A 4QW9A 8ICIA 3NRWA 4USAA 4NM2A 5D4BA 4QWEA 1U9LA 5AIAA 4QZBA 4P4PA 8ICFA 1JROA 2BHNA 4ECVA 1D8YA 2ZG6A 4PZOA 4DSJA 1SV4A 4B9NA 2G09A 4RQ6A 4UQGA 1DGJA 1X6JA 3PX6A 2DPJA 2UVWA 2RDJA 4RQ4A 2RDIA 8ICTA 5CHGA 2IBKA 2JH7A 4MF2A 3C29A 4PGQA 3GV5B 3LVVA 1XNSA 4J9NA 4MHVA 4RNMA 4WJ3B 5J0RA 5DBAA 2OCEA 4PZNA 8ICOA
chains in the Genus database with same CATH topology
2HBLA 2K4HA 2KJ8A 2M0NA 3E0FA 3CP8A 2A3VA 4GFJA 1MA7A 3KZXA 1A0PA 1YT3A 2K8AA 2W04A 2XICA 2RP5A 2W7OA 1PVQA 3GZFA 1IIPA 2F8LA 2ZIVB 5KL1B 2BDUA 3N7SC 4BUGA 2VKQA 2CN1A 4FE3A 3GU3A 4OJ6A 4QIWF 3RF9A 1NZBA 5HR7A 2K8BB 2JGAA 3ICXA 4U7CA 3L3FX 4NLCA 4KX5A 4OJLA 2G5IB 4FZMA 4OJPA 3SAGA 2W7PA 4PL2A 3CYMA 1PVPA 4NWIA 3SAFA 5T14A 4OJOA 3AQFA 2D6FC 2KVCA 2K4EA 3SMVA 4CRXA 1A6SA 2KD1A 2YB1A 2HMXA 2YB4A 1HIWA 1F44A 1Z19A 2LYBA 3PSTA 5KL8B 1D8BA 3IG8A 3AL0B 4P0PA 1Q3VA 2OXOA 2E5SA 4C0ZA 3ONNA 3KFUF 3LYSA 4NV0A 3M6ZA 2W03A 2VIXA 2RHFA 2WAQC 2WAQF 4BX9C 5HR6A 2KKVA 2WB1C 2HOIA 2KJ9A 4FZLA 3NUQA 2HOQA 4FZNA 2K8CB 4P0PB 2Q4TA 2E1EA 2F76X 3K1ZA 4KX3A 2G07A 2ZIUA 2XVTA 3D2QA 2HOFA 2KICA 3M6KA 1HEKA 2MRLA 4CDGA 1L6NA 3CRXA 2Y0SC 4PL1A 2KOBA 3ALRA 2OYYA 2KIWA 2ZIUB 3N7RC 4ACOA 3T79A 3O0FA 3C28A 2GH1A 2KKPA 3AQEA 2JMGA 2KEYA 2KV2A 3LVWA 2ZIWA 3SQIA 3PZPA 4U6PA 2HBJA 3H0LB 4OJ5A 1P7DA 2DQNB 2H3VA 3D2NA 1OUQA 3H0MB 1ZQ1C 3F2CA 2DGZA 2LBOA 2K4IA 1XO0A 2CPRA 2VJ5A 2H3ZA 2HBKA 2WB1F 1TAMA 1GO3F 1URJA 2NV3A 2XIDA 2PMZC 2YX8A 2ZIWB 3DEEA 3H0RB 1SZHA 4QNLA 3N7PD 4JMUA 1KBUA 3MGVA 3VCBA 5CRXA 2G0AA 3NRWA 2F2AB 4AYBC 3PSFA 5C0YA 3OPXA 4P0QA 2ZIXA 2K89A 2KHVA 2KHQA 3HKZF 3HKZC 4QJFB 5A0LA 4CGZA 3RFAA 2Y0SF 2F77X 2ZG6A 2G08A 1CRXA 3SAHA 2JH1A 2H3FA 1WUDA 2DF4B 2XI9A 2E1FA 2G09A 3VC8A 2RRDA 3F5AA 4A8EA 4P0QB 2HBMA 2ZIXB 4KMOB 2KNJA 4ICAA 3IG5A 2Z7JA 2H3IA 2MA1A 1Q3UA 2G5HB 4NLBA 3F2BA 2LYAA 1DRGA 3IP4B 2VJ4A 2G06A 1Z1BA 4OO1J 4QIWC 2JH7A 1T94A 2ZXHA 1ED1A 2ZXIA 2CRXA 3IN5A 2OH2A 3M7DA 3D2SA 2N1RA 2PMZF 3C29A 3PSIA 3LVVA 1PVRA 2R18A 1XNSA 1ECWA 2JHDA 4O3MA 2GOLA 4IC9A 4WJ3B 3F5EA 4AYBF 2LKYA 3PSPA 2H3QA 3F2DA 1UPHA 2KJ5A 2LHTA 2OM6A 2ZIVA 3F53A 4BJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4H A;  1HIW A;  2JMG A;  2LYB A;  4ICA A;  2H3I A;  2H3V A;  2LYA A;  2K4I A;  1ED1 A;  2H3Z A;  1TAM A;  2NV3 A;  2N1R A;  4JMU A;  1ECW A;  2GOL A;  4IC9 A;  1HEK A;  1L6N A;  2H3Q A;  1UPH A;  2K4E A;  1A6S A;  2HMX A;  2H3F A; 
#chains in the Genus database with same CATH topology
 3G6Y A;  4J9Q A;  1X66 A;  2I5H A;  4XQ8 A;  4C7Z A;  3MFH A;  5AM2 A;  1IIP A;  5KFS A;  1LKY B;  1TAQ A;  1SXE A;  2BPC A;  4ECU A;  5EE1 A;  4I2B A;  4DQP A;  2XO7 A;  1PVP A;  2WFA A;  4CRX A;  2HVH A;  2BCU A;  2JZB B;  3PST A;  3M9N B;  4YD1 A;  1C20 A;  2PKE A;  3KHG A;  1SKR A;  5KFF A;  2W03 A;  2VIX A;  2WAQ C;  3H7I A;  5F9N A;  5L1J A;  3MC1 A;  5AKX A;  2DKX A;  1BPX A;  8ICS A;  2W9C B;  5KT2 A;  3AU2 A;  4UAR A;  2Y0S C;  9ICR A;  2NRV A;  1ZQQ A;  3N7R C;  1ZD2 P;  3UXO A;  3IHQ B;  2MU2 A;  3MGI A;  3WK7 A;  5CB1 A;  8ICL A;  5KFV A;  5KFE A;  4RPX A;  3UXP A;  1N5X A;  3PZP A;  5J0P A;  2DQN B;  5DLG A;  1BGX T;  1OUQ A;  2DGZ A;  3DEE A;  2PXI A;  1ZOL A;  1ZQG A;  1S77 D;  5L1K A;  4AYB C;  4DWI A;  5AKL A;  2K89 A;  2KHV A;  4F4Z A;  1DK2 A;  2I1Q A;  3EW9 A;  5AM4 A;  7ICU A;  2XI9 A;  5KG0 A;  3QUC A;  4FS2 A;  3I28 A;  3GIJ A;  5ALD A;  1KKX A;  5KTQ A;  5G5H A;  2ZXI A;  4GC6 A;  3SEN A;  3Q8R B;  2HVI A;  3PX0 A;  1XWL A;  4O5C A;  1S97 A;  2KJ5 A;  4M0A A;  1Z1V A;  2PI5 A;  3RH6 A;  5IIM A;  3RJK A;  3SI8 A;  7ICF A;  4R63 A;  2K8A A;  1CUK A;  2XCA A;  2BDU A;  1Z4O A;  5III A;  1UA0 A;  4FE3 A;  1U47 A;  1B22 A;  2HI0 A;  4FZM A;  3RJJ A;  2R8K A;  3SAF A;  3UXN A;  4M47 A;  3T5K A;  1ZQL A;  2ISP A;  3IRU A;  4FO6 A;  5AKI A;  1BPZ A;  2R8H A;  3KHH A;  3WK9 A;  4F5R A;  1K1S A;  2FI1 A;  2D8C A;  3GFK B;  2UVU A;  1B0X A;  4UAU A;  4IS7 A;  3QU9 A;  1Z3E B;  2W9M A;  9ICO A;  1B4F A;  2OWO A;  5HHI A;  3QNM A;  4M6W B;  2HBJ A;  5ALX A;  5J2J A;  5KAI U;  4CF4 A;  4JWM A;  4BWM A;  2ZIW B;  3JPQ A;  2XY5 A;  4KLU A;  5AM3 A;  1ZQB A;  1WCN A;  2AGO A;  4P0Q A;  2W9B B;  1ZQF A;  5ALS A;  1DK3 A;  4CGZ A;  2FMP A;  4B9V A;  1QQ7 A;  2WF7 A;  3ORY A;  2DPI A;  3PW7 A;  4M9H A;  2HBM A;  4B9T A;  1Q3U A;  2ZXH A;  3H4B A;  1AQ6 A;  4RQN A;  1QCK A;  3QEA Z;  1QLN A;  5KFM A;  3I76 A;  3UQ0 A;  3SYZ A;  2GOL A;  4BXO A;  1IM4 A;  1JMS A;  2F3N A;  4O3S A;  2OM6 A;  2A3V A;  1JN3 A;  1FO4 A;  1S8O A;  2KVS A;  7ICQ A;  4Z6C A;  1SB3 C;  7ICT A;  4DQR A;  4OJ6 A;  1SGG A;  3RF9 A;  2F8K A;  3L3F X;  4Y2U A;  1RPL A;  2ASD A;  3RB4 A;  4QWA A;  5L9X A;  2QB1 A;  2HW3 A;  1XSL A;  2D6F C;  3B0Y A;  3G6V A;  4KLH A;  9ICA A;  5KT5 A;  2KD1 A;  2DFL A;  2YB1 A;  3QU7 A;  5HMM A;  2Y9U A;  1KTQ A;  5KG2 A;  4GLX A;  1TKD A;  3ONN A;  4K4G A;  3KFU F;  1WG8 A;  4GC7 A;  2AU0 A;  1NI3 A;  2WF6 A;  5KFO A;  3V7J A;  5AK6 A;  3RRH A;  5HNK A;  3BQT A;  2FPK A;  2Q4T A;  2F76 X;  4ED2 A;  4O5E A;  2C2E A;  2HOF A;  4Z6D A;  1XO1 A;  1S9F A;  2NO4 A;  2AGP A;  2JMG A;  3RB0 A;  4LVS A;  4ED6 A;  3H0M B;  1ZQ1 C;  2VA8 A;  1QSY A;  1PK3 A;  2CPR A;  3OSP A;  2NV3 A;  1O08 A;  1VDV A;  4RQM A;  3TAN A;  4DFP A;  5ALU A;  4F4X A;  4HAI A;  2BDP A;  3BJY A;  3BZC A;  4DLE A;  8ICP A;  4PHE A;  4DSI A;  2XCP A;  4UB5 A;  2MA1 A;  3NRZ A;  1ZET A;  1Z1B A;  5EE3 A;  2OH2 A;  4QZE A;  3K75 D;  3C2L A;  2W11 A;  3LWL A;  3UM9 A;  4KLQ A;  1S0N A;  4EEL A;  4LZG A;  4QZA A;  3ZDA A;  4J9M A;  3CP8 A;  4YD2 A;  1MA7 A;  2KFN A;  2WTF A;  3JPP A;  2FE9 A;  4DFD A;  1S0O A;  3GII A;  5KG4 A;  5EE9 A;  2GO7 A;  4NLN A;  2XY7 A;  4F93 B;  5KG3 A;  2AGQ A;  1L3S A;  3HRD D;  4O9M A;  3CYM A;  4NJ8 A;  5AKK A;  3L5K A;  4OJO A;  3AQF A;  2V4Q A;  2HHU A;  2KVC A;  4UB6 U;  3RJI A;  5J0Y A;  3V7L A;  5J2B A;  2LYB A;  2WF9 A;  1L5U A;  5JTI A;  1TK8 A;  2ASL A;  4TUR A;  4BWJ A;  3TAC B;  5DDM A;  3OJS A;  4RPZ A;  1VLB A;  4BX9 C;  2B6G A;  4PGX A;  4F92 B;  5ALF A;  3ISC A;  2K60 A;  2AXT U;  3K1Z A;  2ZIU A;  2MSN A;  2WF5 A;  5IIN A;  1DOQ A;  3CRX A;  3UQ2 A;  1ZQT A;  2R8G A;  3UPQ A;  1WYG A;  4EYH B;  4C4S A;  4JV0 A;  2EZZ A;  3HX0 A;  2W3S A;  1NJY A;  1CI4 A;  1TK0 A;  5J2I A;  1ZQK A;  3T5L A;  1UHU A;  1D9F A;  3GDX A;  1TAM A;  4QNL A;  2XGP A;  5ALT A;  4UAW A;  4I29 A;  5ALR A;  5IIO A;  4CF3 A;  5D46 A;  3K4G A;  2JEG A;  4I2I A;  2HHX A;  4A8E A;  3K1R B;  2XGQ A;  1ZQE A;  3B0X A;  1ZQW A;  3F2B A;  2LYA A;  2MUT A;  3KKA A;  1UT5 A;  1L8L A;  3IN5 A;  4PGY A;  3R9K A;  2QB0 B;  4I27 A;  4KN7 A;  5ALP A;  4CE6 A;  1BPY A;  4IC9 A;  4Q43 A;  5ALI A;  1QQ6 A;  2HBL A;  4DSK A;  5KFH A;  1YT3 A;  4I2G A;  3CW2 C;  4TUQ A;  2YMP A;  2YMM A;  7ICG A;  1ZQR A;  3RJG A;  4QIW F;  4QZF A;  5HML A;  2EZY A;  4PL2 A;  5KFU A;  2HDO A;  9ICB A;  4ECZ A;  1K5O A;  1A77 A;  4LZD A;  1KL9 A;  1NJZ A;  1A6S A;  2HMX A;  4DO9 A;  4I28 A;  1Z19 A;  3TKA A;  5KFR A;  2J6T A;  3RRG A;  5KFL A;  4O3R A;  1Q3V A;  4YP3 A;  4M9N A;  3M6Z A;  5L1L A;  1ZD5 A;  4JUZ A;  1U49 A;  1VJ5 A;  2QLT A;  2KIC A;  4NLK A;  3M6K A;  5ALN A;  3WK4 A;  4MFC A;  4EBC A;  1N56 A;  5KFA A;  5DB8 A;  3PMN A;  4B9L A;  4UAV A;  1UA1 A;  8ICZ A;  1COO A;  2LI6 A;  3U26 A;  3A0B U;  2H3Z A;  4MFA A;  1HUZ A;  1RXW A;  4J9L A;  4MFF A;  1NJX A;  4R65 A;  9ICM A;  2KHQ A;  4YMM A;  4QJF B;  1CRX A;  1RG6 A;  1ZRN A;  2NYV A;  3FM9 A;  3VC8 A;  3MGH A;  4K4H A;  3F5A A;  7ICS A;  3UMG A;  3C23 A;  2W55 A;  1KFT A;  4QZ9 A;  4YXM A;  3E58 A;  2VJ4 A;  2G06 A;  3L4P A;  2XY6 A;  1L3V A;  2R18 A;  5KFC A;  4DF8 A;  5AKZ A;  1S76 D;  2A1J A;  3PSP A;  2ZJ8 A;  2BPG A;  5J2E A;  2K4H A;  3AU6 A;  4PPX A;  2RP5 A;  2J6S A;  5ALQ A;  5KT3 A;  3V6K A;  4QZD A;  4O3N A;  5J2F A;  4OJL A;  5J8Y C;  4RQ5 A;  4OJP A;  1RXV A;  5IIK A;  1KFD A;  4XA5 A;  2KP7 A;  5DLF A;  1X9S A;  5AIB A;  4C0Z A;  1Z00 B;  2E1E A;  2KMD A;  2PI4 A;  2PFP A;  2G07 A;  5KFD A;  1MN8 A;  8ICV A;  2LMR A;  2KOB A;  4R8U B;  3NVW A;  5KG7 A;  1J2N A;  2KSO A;  5J0S A;  3AQE A;  5B5E U;  5CA7 A;  2ZTE A;  3THV A;  5KFP A;  5AK5 A;  1SWV A;  3AUO A;  2VJ5 A;  4FS1 A;  1PK1 A;  5F9L A;  3AMZ A;  2BCQ A;  1N63 A;  3WKA A;  4KLS A;  1BNO A;  2VA3 A;  5AI6 A;  2Y9T A;  1NKB A;  1SXD A;  3QU2 A;  2ZIX A;  2C22 A;  2G08 A;  4DFK A;  3SEI A;  2HHW A;  1WUD A;  5AIC A;  2KK0 A;  2BKE A;  3ZD9 A;  4DL6 A;  2F44 A;  4Z6F A;  5ALZ A;  2CRX A;  1T94 A;  1J2M A;  1ED1 A;  4IRC A;  4I2F A;  3HJE A;  4ECW A;  3IDW A;  2E3T A;  2NRX A;  2ES6 A;  4R66 A;  2A1A A;  1FFV A;  3MR3 A;  2LKY A;  1Y88 A;  3PO4 A;  3KHR A;  2ZIV A;  3MDC A;  4BJQ A;  4M04 A;  4RPY A;  1EXN A;  2P6U A;  4ZH4 A;  3MDA A;  4RU9 A;  4F4K A;  1K1Q A;  1KW4 A;  2F8L A;  3PW2 A;  4IR9 A;  1X2I A;  4DCC A;  4DL4 A;  1ARO P;  4QZI A;  2EAO A;  3EZ5 A;  1FIQ A;  4O0I A;  4PHP A;  2BPF A;  2A19 A;  1KEJ A;  1ZQC A;  3RH5 A;  1MQ2 A;  1NK7 A;  2IOF K;  3M8S A;  1F0M A;  2Y1J A;  2WAQ F;  1ZQD A;  4Q8F A;  2FLP A;  3PR4 A;  2HOQ A;  5C5J A;  4B9U A;  9ICW A;  2EDU A;  3QYP A;  4DSL A;  1L7O A;  4F5N A;  5AKE A;  4MEX A;  1S0M A;  8ICJ A;  2NRW A;  4Y2T A;  4ED7 A;  1QSS A;  3H0L B;  4ED8 A;  4F71 A;  5KNI A;  4KMU A;  5AM1 A;  4DEZ A;  1X42 A;  3V6H A;  1SZH A;  2JR5 A;  2G0A A;  5C0Y A;  5TIS U;  2DL0 A;  1N2X A;  3NVY A;  2JH1 A;  4I2E A;  4J9K A;  3HW8 A;  3IG5 A;  8ICR A;  5J0O A;  2VAN A;  3ZI4 A;  4UBB A;  5J0U A;  3LDA A;  2ZTD A;  2Q0Z X;  4F50 A;  3ETL A;  3MFI A;  3KBB A;  4RT3 A;  1SWW A;  4F2S A;  3WK6 A;  3B9J A;  3M1Y A;  4YMN A;  1A0P A;  2PFQ A;  5J0X A;  5D49 A;  3ETR A;  5KFW A;  4J9R A;  3N7S C;  4EEY A;  3I1Y A;  2VKQ A;  4Y2R A;  1NZB A;  4DOA A;  4KX5 A;  5DGB A;  5AI0 A;  9ICK A;  2MAX A;  2HSZ A;  2BQR A;  1HIW A;  3AM9 A;  1D8B A;  2HHT A;  3RBD A;  2DBY A;  4NV0 A;  1O03 A;  4US9 A;  9ICT A;  2W8K A;  8ICA A;  1U45 A;  2FLN A;  1ZQO A;  5KG5 A;  4RUC A;  5EOZ A;  4DQQ A;  4LJX A;  4DSF A;  2W8L A;  2CXY A;  3O0F A;  3RR7 A;  3A0H U;  3ZDC A;  4OCZ A;  9ICL A;  4F4W A;  2F1I A;  3D6J A;  2L5Y A;  1C7Y A;  2FLL A;  2IMW P;  9ICG A;  1RYR A;  4E0D A;  2WB1 F;  1TAU A;  1L3U A;  4R64 A;  2EAN A;  4RZR A;  1XC9 A;  5DBB A;  7ICL A;  2ZUD A;  4ECQ A;  3AEV A;  1X40 A;  2F77 X;  3QU5 A;  1QTM A;  3RJE A;  4B9M A;  4P0Q B;  5DBC A;  5EE0 A;  4DS4 A;  2BCR A;  2G5H B;  4NLB A;  3KZI U;  5DQG A;  3PW4 A;  2RLT A;  5J2D A;  5H2F U;  3FC4 A;  2V9W A;  4NM1 A;  2N1R A;  2PMZ F;  2PFN A;  3FYH A;  4BDP A;  4ZOH C;  2E8O A;  3T3F A;  2KZZ A;  4M9L A;  7ICJ A;  8ICC A;  4EEK A;  3E0F A;  4NLG A;  1MQ3 A;  2XIC A;  4BXO B;  1ZD3 A;  1PVQ A;  2QKQ A;  4DOB A;  4Y2P A;  1WWU A;  4QZ8 A;  1XU4 A;  3RAX A;  2CN1 A;  4QWB A;  5HR7 A;  3TAD C;  2JGA A;  3DV9 A;  3ICX A;  4NLC A;  3MR2 A;  3JPN A;  2OHF A;  4KIT B;  4RUA A;  3KTQ A;  4ECR A;  1D8L A;  7ICP A;  5J2G A;  5KFN A;  1A76 A;  4IR1 A;  4YVZ A;  4C8L A;  1X9W A;  1ZQZ A;  5CP2 A;  5ALG A;  4KLD A;  4C8O A;  3AL0 B;  5ALE A;  1RZT A;  8ICN A;  3RJH A;  4I2A A;  5FP0 A;  4KLE A;  3Q8K A;  1F5S A;  2AQ0 A;  3NUQ A;  5DGA A;  4F4Y A;  3N28 A;  1N61 A;  4CDG A;  4PL1 A;  4B9S A;  4DL3 A;  4RQ2 A;  3OSN A;  3QEB Z;  3LVW A;  4DLG A;  2C2D A;  1JXL A;  9ICF A;  5KFT A;  1ZQH A;  4YR2 A;  3H8M A;  4EEN A;  3VCB A;  2ZJ5 A;  5IIL A;  3HKZ C;  2C28 A;  1L8O A;  7ICN A;  2WF8 A;  2P66 A;  1TFR A;  2W54 A;  2YMQ A;  1Q46 A;  1SV0 C;  3QUT A;  3ZDB A;  2H3I A;  4F72 A;  4QIW C;  4NY8 A;  2E8P A;  5AK3 A;  3D2S A;  4YN4 A;  7ICH A;  1XSP A;  1ZQA A;  1UPH A;  5ALH A;  3BDP A;  3NTU A;  1IV8 A;  3Q8L A;  4CCH A;  5KT4 A;  1PZN A;  1RM6 C;  4KLM A;  5DQH A;  3KZX A;  3M9O B;  3BQ1 A;  7ICR A;  3EPG A;  1YZ7 A;  5CEH A;  9ICJ A;  3H8W A;  5KL1 B;  3Q8S B;  4HYK A;  5AHX A;  3RAQ A;  2H5X A;  3GIM A;  2I6X A;  4KLL A;  3BS5 A;  2W7P A;  3WK8 A;  4MF8 A;  3SMV A;  1JAL A;  2JEI A;  4EZ6 A;  3TAP A;  5EWG A;  3RB3 A;  2GLE A;  5J2C A;  4DQS A;  4P0P A;  1TVA A;  3JPO A;  3MAB A;  5HP4 A;  1L3T A;  2BGW A;  3V6J A;  2IOF A;  2QAR A;  3M8R A;  5J2K A;  2NRT A;  1RDF A;  3C2K A;  3JPT A;  2W9A A;  2F1H A;  3FDS A;  1IG6 A;  2ZIU B;  4Y2Y A;  5J0T A;  5J2H A;  4ECY A;  3QX7 A;  1BPE A;  2YML A;  2AHO B;  1JUD A;  5DDY A;  1T4G A;  3QU4 A;  1Q8K A;  3FAH A;  2XID A;  1S5L U;  8ICU A;  5DG8 A;  1D9D A;  3NS1 A;  1KBU A;  4KLJ A;  1HUO A;  5L1M A;  4Y2Q A;  1LB2 B;  3PSF A;  4GXI A;  1SKW A;  2IHN A;  8ICB A;  2E1F A;  5KFB A;  4IQT A;  2LM1 A;  4O3Q A;  4NLZ A;  2V4R A;  1PVR A;  8ICQ A;  5JRT A;  4I2C A;  2MUT B;  4M2Y A;  3H4D A;  3SAH A;  1LKY A;  3F53 A;  4FBT A;  7ICE A;  4QWC A;  4PHA A;  1JX4 A;  4EZ9 A;  4GFJ A;  4DQI A;  2AJQ A;  3GQC A;  4J03 A;  2W7O A;  2KIV A;  3V7K A;  5KG6 A;  1ZJM A;  5DKW A;  1HJP A;  1KQQ A;  3BQ0 A;  1NK0 A;  4KLT A;  4YQW A;  3WU2 U;  3RJF A;  4IL6 U;  3RR8 A;  1SV0 A;  1RQL A;  3S6J A;  2E8N A;  5T14 A;  3RTV A;  1T8E A;  3QXG A;  2BQU A;  1ZQJ A;  3PVX A;  2HCF A;  3PR5 B;  2ZUB A;  2BR0 A;  2YQE A;  1U4B A;  2OXO A;  1IXR A;  8ICG A;  3LYS A;  2RHF A;  4QW8 A;  4KN4 A;  2W9C A;  3HPO A;  3SR6 A;  4F5P A;  3TFS A;  4KX3 A;  4UAT A;  3GV7 B;  4C7Y A;  9ICQ A;  2ALZ A;  7ICO A;  5AI8 A;  3SV3 A;  2KIW A;  3T79 A;  3H8J A;  4UB2 A;  2KV2 A;  4DL5 A;  3LWM A;  8ICW A;  4UB1 A;  4U6P A;  4DSE A;  1XO0 A;  3RB6 A;  5J0W A;  4IQU A;  1GO3 F;  3PML A;  1XS9 D;  2DUY A;  2IA6 A;  3OPX A;  5B66 U;  2AQ4 A;  5CR0 A;  5KFJ A;  4QWD A;  4B6J A;  2ASJ A;  3BQ2 A;  1ZQN A;  2DF4 B;  3RH4 A;  4Q44 A;  4RQ8 A;  4GXJ A;  1SL0 A;  4DOC A;  4ELV A;  5AKJ A;  4F3O A;  1ZRM A;  5ALV A;  1MSW D;  9ICP A;  3KD3 A;  2JEF A;  2KFZ A;  3C1Z A;  1ECW A;  1NJW A;  1FFU A;  4O3M A;  2H3Q A;  3IM1 A;  3Q8M A;  4RNN A;  2A1J B;  2IHM A;  4ELT A;  1TV9 A;  4JWN A;  4UB4 A;  4ECX A;  4QZC A;  1DXS A;  4ED3 A;  4U7C A;  5KFX A;  3PY8 A;  4Y2V A;  3SAG A;  4Q8E A;  1SZP A;  1OW5 A;  3EYZ A;  4EYI B;  4Y2S A;  5KFI A;  3MR5 A;  3HIL A;  4PJ0 U;  5AKY A;  4EX6 A;  4DS5 A;  4C4R A;  3SZ2 A;  5KT7 A;  4F5O A;  2XVT A;  2JEJ A;  2LM4 A;  2DKZ A;  3OTQ A;  4M6W A;  4KTQ A;  3SV4 A;  3WKE A;  2ZIW A;  2UVV A;  4KLO A;  3HP6 A;  1LV5 A;  1KFS A;  2KN7 A;  2H3V A;  1JIH A;  2KSO B;  2W9B A;  2ZUC A;  1NK6 A;  2HBK A;  5F3X B;  1URJ A;  5KFZ A;  2YX8 A;  4IQV A;  3EPI A;  3JPS A;  3ZD8 A;  1NK8 A;  4JV1 A;  3KOO A;  4KLF A;  1T3N A;  1PK1 B;  2Y0S F;  4CNQ A;  2H3F A;  3V72 A;  3QZ7 A;  1KLN A;  1SL1 A;  5TZV A;  5KFK A;  2J6U A;  4MEY A;  5J8Y A;  1H38 A;  4M9G A;  2ZIX B;  2EAM A;  1JXE A;  1WWV A;  5AI5 A;  4C8N A;  2W3R A;  1XSN A;  1KSP A;  1QQ5 A;  3M7D A;  1UCV A;  4UW9 A;  1ZQI A;  4YFK A;  3OJU A;  3PSI A;  5ALM A;  3Q8Q B;  1QSL A;  1B43 A;  3F5E A;  4AYB F;  3GIK A;  4EX7 A;  4DL7 A;  2KJ8 A;  2KZ3 A;  4C8K A;  2M0N A;  3T5H A;  2KTQ A;  4EBD A;  3GV8 B;  1MC8 A;  4UB8 U;  5GTH U;  4NXZ A;  2HHV A;  2ZIV B;  1NK4 A;  3MR6 A;  4KLG A;  3H8S A;  1FEZ A;  5AM5 A;  3WKC A;  3HT3 A;  8ICY A;  4JV2 A;  3PX4 A;  3BQ7 A;  4JB3 A;  4YR0 A;  1S0V A;  2NO5 A;  2R8I A;  2YB4 A;  4EBE A;  4O3P A;  2O6K A;  5DG7 A;  4UAS A;  3IG8 A;  4GXK A;  2FMS A;  1TE2 A;  4UB3 A;  4GIB A;  1ZQM A;  1YZ6 A;  3ZDD A;  1KRP A;  2WB1 C;  3TAQ A;  3WK5 A;  3C21 A;  4RNO A;  4J9P A;  2PFO A;  3MBY A;  1BPD A;  9ICC A;  5JUM A;  1L6N A;  5JU5 A;  4YCX A;  1SKS A;  2BQ3 A;  2K4P A;  2R8J A;  3C28 A;  2KKP A;  2KEY A;  1NKC A;  3WKD A;  3OGU A;  4DF4 A;  1BVS A;  2E8M A;  4OJ5 A;  4M9J A;  5CJ7 A;  2UVR A;  4ECS A;  4YXJ A;  2PMZ C;  5AKH A;  4JMU A;  3PNC A;  2KG5 A;  3MGV A;  5CRX A;  4J9O A;  4XUS A;  2YTU A;  4F2R A;  5DG9 A;  2FPL A;  1ZQS A;  5BPC A;  2ATL A;  5EWE A;  4BGD A;  4Z6E A;  3TI0 A;  1T7P A;  5AI9 A;  3OHB A;  2IOH A;  2KNJ A;  3ED5 A;  4RQ3 A;  4F5Q A;  3PW0 A;  4Q45 A;  1DRG A;  1BPB A;  4DFJ A;  4OO1 J;  1CEZ A;  5ALK A;  4UAZ A;  1ZQV A;  1T3Q A;  1PUZ A;  2JHD A;  2YY6 A;  1L7N A;  2LPE A;  9ICN A;  4K4I A;  4RQ1 A;  2W04 A;  4UAY A;  1ZQY A;  1KDH A;  4PHD A;  4IRD A;  4XRH A;  4KLI A;  4P4M A;  4BUG A;  3C2M A;  3N97 B;  3GU3 A;  2K8B B;  2Y1I A;  2B0C A;  5KG1 A;  2HHQ A;  1V97 A;  8ICH A;  5ALY A;  3EUB 2;  5IIJ A;  3KKA C;  1SL2 A;  1DGS A;  4F91 B;  7ICI A;  3WKB A;  4NL9 C;  4QZH A;  1WCL A;  1F44 A;  2RQ5 A;  4RQ7 A;  5KFY A;  4F8R A;  2B21 A;  3SD7 A;  9ICH A;  3NAS A;  4FZL A;  3TAR A;  4FZN A;  4J9S A;  5L1I A;  1RQN A;  3D2Q A;  3T5J A;  1OXJ A;  9ICI A;  3JPR A;  1L7M A;  2FDR A;  4FBU A;  3C5G A;  1V9P A;  4C8M A;  2OYY A;  4ACO A;  1ZQU A;  2GH1 A;  1NZP A;  3G6X A;  7ICV A;  3J81 j;  2DWQ A;  3SQI A;  4P2H A;  5DQI A;  4CF5 A;  1N5W A;  1QH9 A;  3N4M B;  3F2C A;  2LBO A;  4I2H A;  2K4I A;  4YMO A;  2NRZ A;  3H0R B;  4I2J A;  8ICE A;  3N7P D;  2ZJA A;  4YR3 A;  2VA2 A;  1N62 A;  5BOL A;  4ECT A;  5ALL A;  3RFA A;  4RT2 A;  3BZK A;  1S10 A;  2P35 A;  2RRD A;  4KMO B;  2QB0 A;  4ICA A;  5ALW A;  2Z7J A;  5ALJ A;  9ICS A;  5DB6 A;  5AM0 A;  1LVH A;  2C2R A;  4AP9 A;  4C80 A;  3PW5 A;  5K4L A;  2ZTC A;  3DDH A;  3NVZ A;  3OHA A;  3UMB A;  2LHT A;  2BZF A;  3M9M B;  3ISD A;  9ICE A;  3GIL A;  3C5F A;  3CNH A;  5BOM A;  1X6I A;  4ED1 A;  4P4O A;  3LK9 A;  3ISB A;  2P6R A;  4FFD A;  1NNL A;  4IRK A;  2OEH A;  4G3I A;  1UQV A;  3IV6 A;  4TQS A;  2EAP A;  3BS7 A;  2EZX A;  1L7P A;  3PO5 A;  5DB7 A;  5KFG A;  4NWI A;  1X9X A;  4O5K A;  3UMC A;  5HHH A;  2EQY A;  5KL8 B;  2ISO A;  5J29 A;  4RQ0 A;  2E5S A;  2AH5 A;  2FPM A;  2LYH A;  2KKV A;  2HOI A;  2JXJ A;  3RBE A;  3Q8P B;  3KHL A;  2ODG A;  2EH9 A;  5GTI U;  3TFR A;  1BNP A;  1HEK A;  3NVV A;  3ZDE A;  4ELU A;  4C4T A;  1J97 A;  1NKE A;  9ICV A;  4G9B A;  3C1Y A;  3D2N A;  4NL9 A;  5CWR A;  5E79 U;  5EWF A;  1RYS A;  2F2A B;  3EWA A;  3HWT A;  1NK5 A;  1KN5 A;  3HKZ F;  5A0L A;  4I2D A;  1NK9 A;  5DB9 A;  4OD0 A;  3TAD A;  1V38 A;  4Y2X A;  4TUS A;  4PH5 A;  5KT6 A;  1ZJN A;  9ICU A;  8ICM A;  1NOM A;  4YG2 A;  4UBC A;  3IP4 B;  4IQW A;  1ZYQ A;  5AKG A;  5ALO A;  1Z4N A;  1M6Y A;  2W43 A;  1JI7 A;  1X9M A;  5AI4 A;  4TQR A;  3F2D A;  2JV3 A;  1U48 A;  2F1J A;  1V85 A;  8ICK A;  1TK5 A;  1JRP A;  9ICX A;  3QZ8 A;  7ICM A;  4X5V A;  3GZF A;  1SIJ A;  7ICK A;  1ZD4 A;  2WHE A;  2G5I B;  1COK A;  3PV8 A;  1RYU A;  5KAF U;  2K4E A;  3BS5 B;  5J2A A;  1Z00 A;  4Y2J A;  3H40 A;  3QUB A;  2YN4 A;  1UT8 A;  3QE9 Y;  1ZXI A;  4ED0 A;  2JRZ A;  5HR6 A;  2KJ9 A;  8ICX A;  2ESE A;  4P0P B;  2K8C B;  1N60 A;  3AN1 A;  4R8U A;  2BCV A;  4DFM A;  3E2E A;  2FMQ A;  2JZB A;  4US8 A;  2D3D A;  2HHS A;  4TUP A;  5G5G A;  2MRL A;  2I9G A;  2KE7 A;  5AK4 A;  2QAR B;  1ZQP A;  3ALR A;  2BCS A;  2GWS A;  1N48 A;  4QZG A;  2XC9 A;  3TQ1 A;  5J0Q A;  2M9N A;  3NGD A;  1P7D A;  2FJ6 A;  1ZQX A;  5KFQ A;  4O3O A;  4JK1 A;  2KZM A;  3QUQ A;  4DL2 A;  4QW9 A;  8ICI A;  3NRW A;  4USA A;  4NM2 A;  5D4B A;  4QWE A;  1U9L A;  5AIA A;  4QZB A;  4P4P A;  8ICF A;  1JRO A;  2BHN A;  4ECV A;  1D8Y A;  2ZG6 A;  4PZO A;  4DSJ A;  1SV4 A;  4B9N A;  2G09 A;  4RQ6 A;  4UQG A;  1DGJ A;  1X6J A;  3PX6 A;  2DPJ A;  2UVW A;  2RDJ A;  4RQ4 A;  2RDI A;  8ICT A;  5CHG A;  2IBK A;  2JH7 A;  4MF2 A;  3C29 A;  4PGQ A;  3GV5 B;  3LVV A;  1XNS A;  4J9N A;  4MHV A;  4RNM A;  4WJ3 B;  5J0R A;  5DBA A;  2OCE A;  4PZN A;  8ICO A; 
#chains in the Genus database with same CATH homology
 2HBL A;  2K4H A;  2KJ8 A;  2M0N A;  3E0F A;  3CP8 A;  2A3V A;  4GFJ A;  1MA7 A;  3KZX A;  1A0P A;  1YT3 A;  2K8A A;  2W04 A;  2XIC A;  2RP5 A;  2W7O A;  1PVQ A;  3GZF A;  1IIP A;  2F8L A;  2ZIV B;  5KL1 B;  2BDU A;  3N7S C;  4BUG A;  2VKQ A;  2CN1 A;  4FE3 A;  3GU3 A;  4OJ6 A;  4QIW F;  3RF9 A;  1NZB A;  5HR7 A;  2K8B B;  2JGA A;  3ICX A;  4U7C A;  3L3F X;  4NLC A;  4KX5 A;  4OJL A;  2G5I B;  4FZM A;  4OJP A;  3SAG A;  2W7P A;  4PL2 A;  3CYM A;  1PVP A;  4NWI A;  3SAF A;  5T14 A;  4OJO A;  3AQF A;  2D6F C;  2KVC A;  2K4E A;  3SMV A;  4CRX A;  1A6S A;  2KD1 A;  2YB1 A;  2HMX A;  2YB4 A;  1HIW A;  1F44 A;  1Z19 A;  2LYB A;  3PST A;  5KL8 B;  1D8B A;  3IG8 A;  3AL0 B;  4P0P A;  1Q3V A;  2OXO A;  2E5S A;  4C0Z A;  3ONN A;  3KFU F;  3LYS A;  4NV0 A;  3M6Z A;  2W03 A;  2VIX A;  2RHF A;  2WAQ C;  2WAQ F;  4BX9 C;  5HR6 A;  2KKV A;  2WB1 C;  2HOI A;  2KJ9 A;  4FZL A;  3NUQ A;  2HOQ A;  4FZN A;  2K8C B;  4P0P B;  2Q4T A;  2E1E A;  2F76 X;  3K1Z A;  4KX3 A;  2G07 A;  2ZIU A;  2XVT A;  3D2Q A;  2HOF A;  2KIC A;  3M6K A;  1HEK A;  2MRL A;  4CDG A;  1L6N A;  3CRX A;  2Y0S C;  4PL1 A;  2KOB A;  3ALR A;  2OYY A;  2KIW A;  2ZIU B;  3N7R C;  4ACO A;  3T79 A;  3O0F A;  3C28 A;  2GH1 A;  2KKP A;  3AQE A;  2JMG A;  2KEY A;  2KV2 A;  3LVW A;  2ZIW A;  3SQI A;  3PZP A;  4U6P A;  2HBJ A;  3H0L B;  4OJ5 A;  1P7D A;  2DQN B;  2H3V A;  3D2N A;  1OUQ A;  3H0M B;  1ZQ1 C;  3F2C A;  2DGZ A;  2LBO A;  2K4I A;  1XO0 A;  2CPR A;  2VJ5 A;  2H3Z A;  2HBK A;  2WB1 F;  1TAM A;  1GO3 F;  1URJ A;  2NV3 A;  2XID A;  2PMZ C;  2YX8 A;  2ZIW B;  3DEE A;  3H0R B;  1SZH A;  4QNL A;  3N7P D;  4JMU A;  1KBU A;  3MGV A;  3VCB A;  5CRX A;  2G0A A;  3NRW A;  2F2A B;  4AYB C;  3PSF A;  5C0Y A;  3OPX A;  4P0Q A;  2ZIX A;  2K89 A;  2KHV A;  2KHQ A;  3HKZ F;  3HKZ C;  4QJF B;  5A0L A;  4CGZ A;  3RFA A;  2Y0S F;  2F77 X;  2ZG6 A;  2G08 A;  1CRX A;  3SAH A;  2JH1 A;  2H3F A;  1WUD A;  2DF4 B;  2XI9 A;  2E1F A;  2G09 A;  3VC8 A;  2RRD A;  3F5A A;  4A8E A;  4P0Q B;  2HBM A;  2ZIX B;  4KMO B;  2KNJ A;  4ICA A;  3IG5 A;  2Z7J A;  2H3I A;  2MA1 A;  1Q3U A;  2G5H B;  4NLB A;  3F2B A;  2LYA A;  1DRG A;  3IP4 B;  2VJ4 A;  2G06 A;  1Z1B A;  4OO1 J;  4QIW C;  2JH7 A;  1T94 A;  2ZXH A;  1ED1 A;  2ZXI A;  2CRX A;  3IN5 A;  2OH2 A;  3M7D A;  3D2S A;  2N1R A;  2PMZ F;  3C29 A;  3PSI A;  3LVV A;  1PVR A;  2R18 A;  1XNS A;  1ECW A;  2JHD A;  4O3M A;  2GOL A;  4IC9 A;  4WJ3 B;  3F5E A;  4AYB F;  2LKY A;  3PSP A;  2H3Q A;  3F2D A;  1UPH A;  2KJ5 A;  2LHT A;  2OM6 A;  2ZIV A;  3F53 A;  4BJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...