4JMUA

Crystal structure of hiv matrix residues 1-111 in complex with inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enantiomeric Atropisomers Inhibit HCV Polymerase and/or HIV Matrix: Characterizing Hindered Bond Rotations and Target Selectivity.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Gag-Pol polyprotein
total genus 41
structure length 105
sequence length 105
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4jmuA00
1TAMA 2LYAA 2H3FA 2GOLA 4IC9A 2N1RA 2K4HA 1HEKA 2K4EA 1ECWA 1ED1A 2JMGA 2H3IA 2NV3A 1HIWA 1L6NA 2K4IA 2LYBA 2H3ZA 2H3VA 1UPHA 2H3QA 1A6SA 4ICAA 4JMUA 2HMXA
chains in the Genus database with same CATH superfamily
4PHDA 3QUTA 5J2GA 2LYAA 5KL8B 2KNJA 2ZIUA 2FMSA 2GWSA 4QZAA 4M9HA 4CF5A 5KG7A 1BNPA 3EPGA 2AHOB 2ZG6A 4F4WA 2KV2A 1ZXIA 4IL6U 1QQ7A 3RRGA 1CUKA 2G08A 1M6YA 4MFFA 5KNIA 9ICPA 2AGPA 2R8GA 3ALRA 2JEJA 1IG6A 3OTQA 4QIWF 2I9GA 4E0DA 3PW0A 3BZCA 4I2AA 2ASJA 1URJA 5EWEA 3RJHA 4DFJA 1X40A 7ICMA 2RHFA 2DWQA 3KHGA 5AI8A 2ASDA 1UQVA 1COKA 3SYZA 5KFJA 4FS1A 2OWOA 7ICLA 3D2SA 1T4GA 4PPXA 3TAQA 4F4ZA 1NKEA 2IHMA 3FYHA 2R8IA 1JX4A 3KHHA 1T3NA 9ICNA 2ZTCA 2LMRA 4F5RA 1NKBA 4J9QA 2KKPA 2W3SA 3RR7A 4EZ9A 2A1JA 2BCUA 1KL9A 4CF4A 3EWAA 4C4TA 4I2DA 2E5SA 1VJ5A 1SKSA 5AIAA 1JRPA 4QW9A 4DOCA 2BQ3A 2EZYA 1F44A 2LHTA 4M47A 1KW4A 3GU3A 3F5EA 2Q0ZX 1BPEA 3PSPA 1PVQA 5AM0A 2RQ5A 4UBBA 1ZQNA 1IM4A 3QU5A 3HKZF 1ZQLA 3V7LA 1P7DA 2XY6A 3HRDD 1V85A 3LK9A 3ICXA 4GIBA 1GO3F 2EH9A 3DDHA 1OUQA 4DF8A 5KFHA 4I2CA 5AKYA 4XUSA 4JV0A 4RQ1A 1SV4A 3AMZA 3D2NA 1TAMA 1NOMA 1RYSA 5L1JA 4B9TA 3T5LA 5GTHU 3GIJA 2MUTB 2PFPA 1SKWA 1D9DA 5KT7A 4GFJA 4BDPA 2HHWA 4NLZA 3F2BA 1WWVA 1ZQXA 4YD2A 4NL9C 3IG8A 5KFLA 9ICOA 4JK1A 1NZBA 3E0FA 1U4BA 4MF2A 5KG2A 5J2FA 3ZDDA 7ICTA 3NVZA 1QTMA 5KT2A 2YB1A 4P0PB 2ZIUB 2D3DA 2NRVA 1HIWA 3BQ0A 2G09A 1O03A 4QZBA 3RFAA 2LI6A 5EWFA 3WK5A 1LVHA 1ZQPA 1Z1BA 2ZTDA 3GIMA 4PJ0U 3G6XA 9ICHA 5T14A 1X6IA 3RH4A 4Y2UA 5EE0A 4F4KA 1S5LU 3RJEA 1VLBA 4ACOA 1Z19A 8ICGA 3MDAA 5J2IA 1BPYA 5KFRA 3G6YA 9ICEA 5DB8A 2EAMA 4BXOA 1SXDA 3EPIA 4BWMA 3GDXA 1DRGA 1UPHA 4IS7A 4C8OA 2F77X 3H0LB 3GIKA 1HEKA 4ECXA 1WWUA 5AK4A 3Q8PB 2ZJAA 1ZQHA 4KLLA 2W03A 5AK3A 2LPEA 4BX9C 4KMOB 4X5VA 3M9NB 5BOMA 3MGVA 1VDVA 1ZQQA 2ZJ8A 4EX7A 2H3QA 4YMOA 1S0MA 4B9LA 5KFCA 1KFSA 3JPSA 5D46A 2KVCA 5AKZA 5KAFU 2FJ6A 4IRCA 2YMQA 2J6UA 4F3OA 4KMUA 1SV0A 4ECRA 4F8RA 4DL4A 2W8KA 1S0OA 4AYBF 3UMGA 1ZQ1C 3PSIA 1H38A 4F5OA 3KOOA 5KFOA 3SV4A 4NLGA 5AM4A 5E79U 4JV1A 5ALVA 2QARB 5KFBA 2HOFA 5CJ7A 2F1IA 1NK8A 1ZQZA 1HJPA 5FP0A 1ZQKA 1NK4A 4DS5A 1UHUA 1X66A 2E3TA 4QZIA 3PW7A 4RPZA 4C80A 5J2AA 2JH7A 2XICA 2CRXA 5ALMA 5KFZA 4O3MA 7ICGA 4UAYA 3PVXA 4ELTA 2F1JA 5ALQA 2NYVA 5KFKA 3RB4A 1PVRA 5JU5A 5KT6A 2Y9TA 1X9XA 5DGBA 2LYBA 2H5XA 5AI5A 5KG6A 2BPFA 2BKEA 4YR0A 4G9BA 9ICJA 5ALNA 5DDYA 1ZQDA 4KLDA 3A0HU 5KG1A 3JPPA 4KTQA 1DOQA 4IC9A 2LYHA 4ECZA 3SAFA 2W3RA 3BQ2A 2JEFA 5J2HA 2AGQA 2DL0A 4GC7A 4NLBA 4OCZA 3PX4A 4CNQA 4C8MA 4M9GA 2KSOB 2NRWA 4UAWA 4FBTA 3O0FA 1RG6A 2KKVA 1TV9A 3Q8SB 3QNMA 8ICMA 1BGXT 4I29A 1S10A 3Q8MA 3RH6A 4LZDA 4QIWC 2K8AA 1MN8A 1S76D 4OJ6A 4AYBC 2YMPA 4BXOB 4PGXA 2W9BB 3N28A 3NRWA 5AK5A 1KRPA 4YG2A 4RQ2A 5KFIA 3QEBZ 2XY7A 2JV3A 3F2DA 2BZFA 3PW4A 5KFSA 3WKEA 4QJFB 4CF3A 5G5GA 2XY5A 1LB2B 3T3FA 2MUTA 3SI8A 3NRZA 1LV5A 5J0UA 4YXJA 1L7MA 4TUQA 3ISBA 2XGPA 5DQHA 5DB6A 3NTUA 3RJGA 3QYPA 4ELVA 4GXJA 3N7RC 4RQMA 4MEXA 8ICWA 2BR0A 2DBYA 1NZPA 2B0CA 2VA8A 4I2EA 3BS5A 1L3TA 1S9FA 3SR6A 3EYZA 1XO0A 1JXEA 2KHQA 2OXOA 4P4PA 3RR8A 4RT3A 5DBBA 2QKQA 4NV0A 4DQRA 1ZOLA 3RAQA 3THVA 1U49A 1SZPA 4KLGA 3UMCA 3B0YA 4MFAA 4I2GA 4UQGA 2HBKA 3M1YA 3M9MB 3CNHA 4PZOA 7ICVA 2K4PA 4LJXA 4YD1A 2J6SA 2PFQA 4Y2JA 4AP9A 5EE9A 3T5HA 3KHLA 3HP6A 2C2EA 2FE9A 1JN3A 1UT8A 5AICA 3UXPA 2D6FC 5EWGA 3M6ZA 2ZUCA 4NLKA 4F50A 1KN5A 1L8OA 3ISCA 1QSLA 4C8NA 3ED5A 3FDSA 3C2KA 2WAQF 4UB5A 4XRHA 1N63A 4B9UA 5C0YA 5DDMA 5DQIA 4QZFA 1X9WA 4QNLA 3OSNA 3SV3A 5IIKA 4KLJA 2P66A 4YFKA 4UB6U 1UT5A 3BQ7A 4DQQA 4QW8A 8ICKA 3HILA 1L7OA 4J9PA 2P6RA 2KP7A 3K1RB 1DGSA 3G6VA 3K75D 1SIJA 4QWCA 3LWMA 2DQNB 4DL6A 3H0MB 3GFKB 4BJQA 5DGAA 1HUZA 1C20A 4RQNA 2RRDA 4R8UA 4YXMA 5ALJA 3WKCA 2AQ0A 1T8EA 4ED3A 3KZXA 3AU6A 4U6PA 9ICXA 1ZQJA 4NL9A 4Z6DA 5J0YA 3KKAC 4ECTA 2UVVA 3WU2U 2AU0A 3TACB 3TI0A 3LVVA 2A3VA 3RJKA 2HHQA 1KBUA 3N7SC 4MFCA 3EW9A 2UVWA 4Q44A 2NRTA 3C5FA 3QUBA 3QX7A 5IIOA 3GV5B 1D9FA 2G06A 4DQSA 8ICEA 1BNOA 5KFWA 7ICEA 2KJ5A 8ICBA 9ICMA 4Y2RA 4DL7A 8ICZA 3ISDA 4WJ3B 1KTQA 5CEHA 2ZIVB 3M9OB 3UMBA 4B9VA 2H3FA 5ALDA 1F5SA 4PHPA 5KFGA 7ICUA 4UASA 4PHEA 4CCHA 4UB8U 3WK8A 3V6HA 4NY8A 1WYGA 3NVVA 1QCKA 5L1KA 1ZJNA 2EAOA 3NVWA 5AKJA 4B9MA 1KFDA 1S0VA 4F71A 3FM9A 4O3QA 1YT3A 1X9SA 2BCRA 2ZIXB 4JV2A 3QUCA 5J0PA 2IOFA 4XQ8A 3V6JA 5KFTA 2MA1A 4QZGA 1RQNA 2ISOA 2F2AB 1UA1A 1DK2A 3IDWA 2M0NA 3V6KA 4EBCA 4NM2A 4J9OA 3M8SA 5C5JA 4M9NA 2PI4A 3PV8A 3AM9A 5DQGA 2EZXA 2KHVA 3MGIA 3R9KA 5J0XA 2I1QA 5KFYA 2C22A 1BPBA 5IIMA 3PW2A 4TUSA 4O5KA 1MQ2A 3JPQA 1SL0A 3GIIA 2G07A 2K8CB 4IQVA 2LKYA 4LVSA 4O3PA 1COOA 1V97A 5ALRA 3MFHA 5KFEA 3WKDA 4O3OA 4BUGA 5KFQA 3PX6A 3AL0B 4ECUA 1U48A 4NLNA 2V9WA 4C0ZA 3Q8KA 7ICIA 1D8YA 1S0NA 4ZOHC 3QZ7A 2KD1A 1A77A 3MR3A 1NI3A 3KHRA 2JEIA 4GXKA 5KAIU 4DWIA 1OXJA 5L1MA 1FFUA 4PGYA 4F4XA 2HBMA 4O3RA 5AM3A 7ICNA 5ALTA 3NUQA 4ELUA 2KTQA 4J9NA 2ODGA 4B9SA 2HVIA 4QWAA 1QLNA 2WB1F 1QSYA 3GV8B 4YVZA 2MAXA 5IIJA 5KT4A 2HMXA 2BQRA 4UATA 8ICQA 5AI0A 4Z6CA 3LVWA 3RB6A 3QU2A 2VA2A 3GZFA 2C2RA 2OCEA 4NWIA 2Y0SC 2R8JA 4P2HA 4DFDA 5J0SA 4KN7A 9ICCA 2P6UA 2K4IA 1ZQWA 5KFMA 4ZH4A 2G5IB 5KT3A 2F1HA 4DO9A 3WK7A 4K4IA 1XNSA 3RJJA 5J2KA 2AJQA 1TK8A 1NK0A 1ZQEA 3QZ8A 3C28A 5G5HA 4EENA 5ALXA 1KFTA 4IRDA 2KK0A 5KFNA 4PHAA 4Y2VA 4F72A 3CRXA 4FS2A 3AQFA 2JRZA 4ED0A 3H8SA 1XWLA 9ICWA 2WB1C 5DG9A 2EAPA 4EEKA 8ICIA 3UM9A 4P0PA 2E8MA 5ALFA 4TQRA 3KZIU 2F76X 5HNKA 3GQCA 2JXJA 1SZHA 3SAHA 5KL1B 2RLTA 4UB2A 1Q3UA 3JPTA 2M9NA 2WF5A 5ALEA 2UVUA 5CB1A 2Y1IA 1JIHA 5J0QA 4HAIA 2FMQA 2ZXHA 4UBCA 3RBDA 1ZQGA 4C7ZA 1HUOA 2JR5A 2DPIA 4YQWA 3SZ2A 1RXWA 1RXVA 1DGJA 9ICRA 8ICSA 7ICPA 1TAQA 4YR2A 2VJ5A 3TQ1A 4M9JA 3MR6A 2W04A 3UXOA 2ZTEA 1NKCA 1X6JA 3M6KA 3PNCA 1TK0A 4M0AA 3CYMA 4GLXA 3PW5A 4ECWA 7ICFA 1ZRMA 4RQ4A 1N5XA 3CW2C 3PMLA 3IM1A 3QU4A 3RJIA 1PUZA 4M6WB 5KFVA 5HR6A 4RQ0A 1BPDA 1ZQAA 4C7YA 2ATLA 2HOQA 2FMPA 1LKYA 4UW9A 4KLTA 5DBCA 9ICKA 4F2RA 4KX5A 2I5HA 3IHQB 4ED1A 4CRXA 1S8OA 2PFOA 1MSWD 5KFPA 5AKXA 4XA5A 3BQ1A 4UARA 3QXGA 5AM2A 3C2LA 2BPCA 1ZQOA 4OJLA 2KVSA 4U7CA 3M7DA 2LBOA 3U26A 5BOLA 4M2YA 4NM1A 1RPLA 3JPOA 2OYYA 2W43A 4YCXA 4IR9A 2Y1JA 2KG5A 3OSPA 5F3XB 2WF8A 5KFXA 1B22A 2E8PA 1OW5A 5KTQA 4M6WA 1RYRA 2VIXA 1N61A 4DL5A 4O9MA 2FPKA 5L1IA 3QE9Y 4OJOA 3SEIA 4JUZA 7ICSA 4QWBA 2JZBB 2NRXA 2YMLA 5DB7A 1AROP 5J8YC 2VANA 3RB0A 1D8BA 2XVTA 2VA3A 1SKRA 4KLFA 1WG8A 1XC9A 3ZDBA 1FIQA 4RNNA 4I2IA 4RPYA 4FZLA 4PL2A 3DV9A 7ICRA 2KJ8A 4OD0A 1TK5A 1Z4NA 2IMWP 8ICCA 9ICVA 2BQUA 1B43A 4IQTA 4JWNA 2K4EA 7ICHA 1ZD5A 3KKAA 5CRXA 1BPXA 1DK3A 1O08A 4B9NA 8ICFA 1UCVA 4RNOA 1ZJMA 1FEZA 4I2FA 4DFKA 3TANA 2A19A 3PMNA 3DEEA 1KLNA 3N7PD 8ICJA 2R18A 3MABA 5JTIA 2DF4B 4NJ8A 4F93B 1ECWA 2A1JB 2XGQA 2ZUBA 1Z1VA 4ECSA 1Z4OA 4MHVA 4Q8EA 2IA6A 4PGQA 3KBBA 5J8YA 1PK1A 1C7YA 4DSKA 5J2DA 3TAPA 4F2SA 5ALKA 2ZIWB 4C4RA 3SMVA 3GILA 3TARA 3ZDEA 5KG3A 2OH2A 2HI0A 3S6JA 2KJ9A 3OPXA 3C1ZA 3F5AA 4RUCA 1S77D 4K4GA 1XS9D 1V38A 1JI7A 2VKQA 2WHEA 3N4MB 4A8EA 2BCSA 8ICOA 2JH1A 3RTVA 3BJYA 4YMNA 5H2FU 1ZD3A 2PI5A 1PK3A 5CP2A 4OO1J 1LKYB 4F91B 2ZIWA 4KX3A 3QEAZ 2AXTU 1ZRNA 3I28A 4Y2QA 4EX6A 5DLFA 1DXSA 2I6XA 3BS5B 1N56A 2CPRA 1WUDA 5CHGA 3C29A 2ASLA 4QZDA 3MR2A 3QU9A 1K5OA 2PFNA 3IRUA 3NGDA 1B4FA 3SENA 5DBAA 4EELA 1ZQYA 1RYUA 4MEYA 5ALPA 9ICUA 1JMSA 5AKGA 2C28A 3PR5B 5L1LA 4ED8A 3LDAA 1N62A 3NS1A 4J9KA 4QZ9A 3TKAA 2KIVA 3VCBA 3PY8A 3OHBA 4EBDA 2ALZA 2KICA 2W8LA 4BWJA 4US9A 2IOFK 4DOBA 3HKZC 3BQTA 3H4DA 2L5YA 5ALOA 2HBJA 2NRZA 4J9SA 4YR3A 4K4HA 3ZD8A 3B0XA 3I1YA 2XCAA 2QB0B 2KOBA 3J81j 3AEVA 3ONNA 5CR0A 4ECVA 1SL2A 4QWDA 4IQWA 2MU2A 7ICKA 5ALIA 1L3SA 2R8KA 5ALZA 1PVPA 3PSTA 4Z6EA 4PL1A 1SWWA 1Z3EB 2MRLA 4J9LA 1X42A 3V7KA 5AKHA 2LM4A 2YTUA 3SAGA 4C8LA 3I76A 2QB0A 5B5EU 1B0XA 3B9JA 4KLQA 2K60A 2OM6A 4O5EA 3PO4A 4R66A 3C5GA 2BGWA 2NV3A 2DKXA 5L9XA 4I2HA 1ZQBA 3N97B 3WK4A 5AM5A 5AKIA 2W9CB 4Y2SA 3PSFA 4ED7A 3ZI4A 3H40A 4J9RA 4FZMA 5GTIU 2HHSA 3MR5A 5ALLA 2WTFA 4M9LA 4UAVA 3OJSA 3ZDCA 2WFAA 2JZBA 2NO5A 4R64A 4DQPA 4Q45A 5KG4A 2ESEA 7ICOA 8ICUA 5EE3A 3Q8LA 3BDPA 2QB1A 4J03A 2KMDA 4CGZA 2BDUA 3H4BA 3K1ZA 2HHVA 4RQ8A 2GOLA 3K4GA 4Y2XA 2UVRA 2EZZA 4HYKA 1ED1A 2Z7JA 5AM1A 4DCCA 4Q43A 4FE3A 4GC6A 2FLLA 2E1EA 3WK6A 2Q4TA 1UA0A 2J6TA 3E2EA 3JPRA 2W9BA 1JROA 2W9CA 5AK6A 3MGHA 2BCQA 1U45A 4P0QB 3F2CA 2ZIVA 3NASA 3MFIA 3HJEA 2HCFA 3RJFA 2PMZC 4QWEA 3L5KA 4DEZA 2G5HB 3LYSA 4NLCA 8ICXA 2HBLA 2XI9A 2EANA 4DS4A 4RQ6A 1CEZA 1PK1B 4JMUA 1L8LA 2GH1A 4I2JA 3QU7A 4FZNA 9ICBA 2IOHA 4YN4A 1J97A 4P4OA 3TADC 5KFFA 4Y2PA 4F92B 1ZQMA 1Q3VA 2YQEA 1KQQA 4ECYA 3FAHA 1MA7A 1SV0C 1L6NA 1NK6A 9ICTA 2AH5A 1V9PA 1KDHA 4P0QA 2PKEA 2CXYA 4NXZA 1N5WA 3E58A 9ICSA 3A0BU 3KD3A 3RRHA 2OEHA 5IILA 2W54A 5DKWA 3HW8A 2W7OA 4CDGA 4KLIA 8ICAA 2V4RA 1KEJA 3ORYA 5HMLA 3ETRA 1JALA 1TVAA 2FLPA 3OJUA 1K1QA 4DFMA 4M04A 3TFSA 8ICRA 8ICPA 1RM6C 4KN4A 4QZHA 3Q8RB 3UPQA 2ISPA 5F9LA 4B6JA 1TE2A 2Y0SF 3V72A 4RUAA 3T5KA 3EUB2 3RF9A 4YMMA 1J2NA 3HPOA 8ICLA 3KTQA 1A76A 2BHNA 4IRKA 4FBUA 5DLGA 5ALUA 4PH5A 2JEGA 1EXNA 2GO7A 2XO7A 5ALYA 3LWLA 1YZ7A 1SWVA 1WCNA 3IP4B 1ZQIA 5ALSA 3IV6A 2K8BB 4DLEA 2DGZA 2R8HA 2RDIA 3HX0A 2E8NA 3KFUF 2DFLA 2IHNA 5AHXA 1A6SA 1SXEA 4O0IA 2DKZA 1L3UA 5IINA 4DFPA 4DLGA 4UAZA 5K4LA 8ICNA 1ZQSA 5KFUA 3VC8A 2JHDA 5HMMA 4UAUA 2H3IA 2HHXA 2P35A 2DUYA 2FI1A 4TURA 4DL2A 4R8UB 1ZD2P 5KFAA 2EQYA 2W9MA 2KSOA 3WKBA 9ICIA 2PMZF 2DPJA 2N1RA 4RQ3A 5AKEA 3AQEA 5J29A 5J2BA 2QARA 4UB4A 2E1FA 2KZMA 5EE1A 2ES6A 2XCPA 1TAUA 2HHTA 4GXIA 4C8KA 1U9LA 3PR4A 3ZD9A 5HP4A 5KG0A 3ETLA 3C1YA 3SD7A 2GLEA 2FDRA 1ZQTA 5J2EA 4EYIB 1CRXA 4KLHA 4DSLA 5KT5A 3IN5A 9ICLA 2HHUA 1IIPA 4IQUA 4US8A 4TUPA 4EEYA 1J2MA 1BVSA 3TFRA 1NJXA 5KFDA 1L7NA 5B66U 3C2MA 3MBYA 2HDOA 5AIBA 4MF8A 2XC9A 4QZ8A 2G0AA 3F53A 8ICYA 2E8OA 1TKDA 2FPLA 2JGAA 5J0WA 4DSIA 2ZIXA 1IV8A 2ZJ5A 4JB3A 1S97A 1K1SA 5JUMA 4KLSA 2KFZA 2C2DA 5J2JA 1JXLA 4IR1A 5A0LA 1RQLA 5BPCA 3GV7B 5DG8A 4TQSA 2V4QA 3C21A 5HR7A 1N60A 2WF6A 2WF9A 1NJWA 4R65A 3C23A 5IIIA 2ZUDA 4FO6A 2FPMA 1ZQUA 4RNMA 1YZ6A 7ICQA 1F0MA 4ECQA 1ZQFA 3H8WA 3D6JA 7ICJA 4F5QA 1SB3C 3WKAA 5ALWA 3M8RA 4OJPA 1ZQCA 1RDFA 4DSEA 2B6GA 3OGUA 5CA7A 1FFVA 2CN1A 1NJYA 1Q8KA 5HHIA 2YY6A 2HW3A 1IXRA 1QH9A 1XSNA 1PZNA 4Y2TA 3H8MA 4BGDA 1Z00B 1Q46A 1NK5A 2F8KA 1AQ6A 3SQIA 1NJZA 2W55A 1TFRA 3RH5A 5DB9A 3AUOA 3PX0A 2A1AA 4USAA 2BPGA 2H3VA 1WCLA 1SL1A 9ICQA 4ED6A 5D4BA 2FLNA 2AGOA 1XSPA 3H7IA 1NNLA 1N2XA 4R63A 1NK7A 2WAQC 4KLMA 2F44A 1Y88A 5AI9A 2YMMA 3FC4A 2K89A 2NO4A 3HWTA 3PZPA 5ALHA 2KEYA 1KKXA 4DSJA 4F4YA 5AKKA 2HSZA 2XIDA 9ICGA 2WF7A 8ICVA 2H3ZA 4RPXA 5TZVA 1N48A 3AU2A 3L3FX 4FFDA 4DOAA 2K4HA 1Z00A 2YX8A 5F9NA 4LZGA 1QQ5A 5CWRA 1KSPA 9ICAA 2KN7A 2BCVA 3IG5A 4UB1A 9ICFA 3UQ0A 1BPZA 4ED2A 2YB4A 4Y2YA 3T79A 2F8LA 3T5JA 2W9AA 1MQ3A 2QLTA 1QSSA 1D8LA 4CE6A 3BS7A 2B21A 4O5CA 3RAXA 2MSNA 2KIWA 2JMGA 3NVYA 4EBEA 1X2IA 2EDUA 4QZEA 1A0PA 2Y9UA 2W7PA 3MDCA 5HHHA 2KE7A 3QUQA 3PO5A 1U47A 4ICAA 5J0OA 1FO4A 4Q8FA 1T7PA 8ICTA 4KLEA 2D8CA 4J9MA 3V7JA 3Q8QB 5TISU 1X9MA 4I2BA 1L7PA 1CI4A 3RBEA 4O3SA 3WK9A 4C4SA 4F5NA 4RU9A 5J0TA 3TADA 2AQ4A 2RDJA 5D49A 4RZRA 2W11A 3HT3A 4I28A 4QZCA 4KITB 3CP8A 1ZD4A 4RQ5A 1NK9A 2OHFA 2HOIA 3AN1A 1XSLA 4O3NA 4I27A 3ZDAA 2KFNA 5AI6A 1JUDA 3D2QA 3RB3A 2HVHA 5ALGA 1L3VA 4KLOA 1RZTA 1MC8A 1T94A 1XO1A 4JWMA 2ZXIA 1ZQRA 4DL3A 5J0RA 1QQ6A 2VJ4A 3JPNA 3MC1A 4YP3A 1ZETA 1T3QA 4EYHB 1ZQVA 4UB3A 4F5PA 3UXNA 2IBKA 1L5UA 1SGGA 2PXIA 2BDPA 5JRTA 5AKLA 4DQIA 3EZ5A 2O6KA 4KLUA 2LM1A 5DG7A 2YN4A 4RQ7A 2KZZA 3L4PA 4Z6FA 5KG5A 3H0RB 1XU4A 3UQ2A 3OHAA 2KZ3A 2RP5A 4OJ5A 1ZYQA 8ICHA 4DSFA 2F3NA 4DF4A 3BZKA 4PZNA 5AI4A 5EOZA 4P4MA 3H8JA 4EZ6A 4G3IA 5J2CA 4RT2A
chains in the Genus database with same CATH topology
2CN1A 2F77X 2HOQA 2R18A 3H0LB 1XO0A 3K1ZA 2LYAA 5KL8B 4IC9A 2GOLA 2DF4B 2KHQA 2KHVA 2KNJA 2OXOA 2ZIUA 1HEKA 4KX5A 3HKZF 3HKZC 3C28A 1ECWA 1ED1A 4NV0A 2Z7JA 3KZXA 3SAFA 1P7DA 4CRXA 3SQIA 2W03A 2HBJA 4BX9C 2Y0SF 4FE3A 4U6PA 4KMOB 1CRXA 2E1EA 2ZG6A 4NLBA 2KV2A 2Q4TA 3RF9A 3ICXA 2HBKA 1GO3F 3MGVA 3CRXA 1OUQA 3IN5A 2H3VA 4OJLA 4P0QB 4U7CA 2H3QA 2G07A 3M7DA 3F2CA 2ZIVA 3AQFA 2LBOA 2KOBA 1IIPA 2K8CB 2LKYA 3D2NA 1TAMA 2G08A 2OYYA 2WB1C 3LVVA 3O0FA 2A3VA 3ONNA 1KBUA 2KKVA 2KVCA 2ZIWB 3N7SC 3SMVA 4P0PA 2F76X 3ALRA 3CP8A 2OH2A 2WAQC 2PMZC 3IP4B 4BUGA 2KJ9A 1SZHA 3AL0B 3SAHA 2G06A 2K8BB 2HOIA 2DGZA 2K89A 1PVPA 2G5HB 3LYSA 4QIWF 5KL1B 3PSTA 4QIWC 3PZPA 2K8AA 3OPXA 2KEYA 4NLCA 4PL1A 2KJ5A 2D6FC 4OJ6A 1Q3UA 2HBLA 2G0AA 3F53A 2XI9A 4GFJA 2MRLA 3M6ZA 3KFUF 3D2QA 3F5AA 4AYBC 4AYBF 4C0ZA 1ZQ1C 1URJA 2VIXA 3PSIA 3SAGA 2VKQA 2KD1A 3F2BA 2JGAA 4WJ3B 3NRWA 1A6SA 2XIDA 1T94A 2ZIXA 2ZXHA 4A8EA 4JMUA 4OJOA 3IG8A 2GH1A 2H3ZA 2ZIVB 2RHFA 2JH1A 1NZBA 4FZNA 2H3FA 3E0FA 3L3FX 2HBMA 2ZXIA 3F2DA 2K4HA 2WAQF 2YX8A 2HOFA 2OM6A 4OO1J 5A0LA 4QJFB 2ZIWA 2YB1A 4KX3A 4P0PB 2ZIUB 5C0YA 1Q3VA 3IG5A 3D2SA 3NUQA 2VJ4A 2JHDA 3VC8A 1D8BA 2H3IA 2XVTA 2NV3A 1MA7A 1HIWA 1L6NA 4QNLA 5HR7A 2G09A 4P0QA 2YB4A 3RFAA 2VJ5A 2CPRA 1WUDA 2JH7A 2XICA 3C29A 2CRXA 4FZLA 4PL2A 3T79A 2W04A 2WB1F 3PSFA 1Z1BA 4O3MA 2KJ8A 1YT3A 2HMXA 2F8LA 5T14A 2KKPA 3M6KA 2ZIXB 4FZMA 3CYMA 3LVWA 4ACOA 2PMZF 2N1RA 3AQEA 3N7RC 2W7OA 1Z19A 2K4EA 2BDUA 2E1FA 2KIWA 5CRXA 2JMGA 3GZFA 2DQNB 3H0RB 2E5SA 4NWIA 4CDGA 2Y0SC 2MA1A 3H0MB 1PVRA 4BJQA 2RP5A 1A0PA 2W7PA 4OJ5A 2K4IA 2F2AB 2LYBA 4OJPA 1F44A 2LHTA 1DRGA 2M0NA 3GU3A 3F5EA 2G5IB 2RRDA 1UPHA 5HR6A 4ICAA 3VCBA 3PSPA 1PVQA 3DEEA 1XNSA 3N7PD 4CGZA 2KICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAM A;  2LYA A;  2H3F A;  2GOL A;  4IC9 A;  2N1R A;  2K4H A;  1HEK A;  2K4E A;  1ECW A;  1ED1 A;  2JMG A;  2H3I A;  2NV3 A;  1HIW A;  1L6N A;  2K4I A;  2LYB A;  2H3Z A;  2H3V A;  1UPH A;  2H3Q A;  1A6S A;  4ICA A;  4JMU A;  2HMX A; 
#chains in the Genus database with same CATH topology
 4PHD A;  3QUT A;  5J2G A;  2LYA A;  5KL8 B;  2KNJ A;  2ZIU A;  2FMS A;  2GWS A;  4QZA A;  4M9H A;  4CF5 A;  5KG7 A;  1BNP A;  3EPG A;  2AHO B;  2ZG6 A;  4F4W A;  2KV2 A;  1ZXI A;  4IL6 U;  1QQ7 A;  3RRG A;  1CUK A;  2G08 A;  1M6Y A;  4MFF A;  5KNI A;  9ICP A;  2AGP A;  2R8G A;  3ALR A;  2JEJ A;  1IG6 A;  3OTQ A;  4QIW F;  2I9G A;  4E0D A;  3PW0 A;  3BZC A;  4I2A A;  2ASJ A;  1URJ A;  5EWE A;  3RJH A;  4DFJ A;  1X40 A;  7ICM A;  2RHF A;  2DWQ A;  3KHG A;  5AI8 A;  2ASD A;  1UQV A;  1COK A;  3SYZ A;  5KFJ A;  4FS1 A;  2OWO A;  7ICL A;  3D2S A;  1T4G A;  4PPX A;  3TAQ A;  4F4Z A;  1NKE A;  2IHM A;  3FYH A;  2R8I A;  1JX4 A;  3KHH A;  1T3N A;  9ICN A;  2ZTC A;  2LMR A;  4F5R A;  1NKB A;  4J9Q A;  2KKP A;  2W3S A;  3RR7 A;  4EZ9 A;  2A1J A;  2BCU A;  1KL9 A;  4CF4 A;  3EWA A;  4C4T A;  4I2D A;  2E5S A;  1VJ5 A;  1SKS A;  5AIA A;  1JRP A;  4QW9 A;  4DOC A;  2BQ3 A;  2EZY A;  1F44 A;  2LHT A;  4M47 A;  1KW4 A;  3GU3 A;  3F5E A;  2Q0Z X;  1BPE A;  3PSP A;  1PVQ A;  5AM0 A;  2RQ5 A;  4UBB A;  1ZQN A;  1IM4 A;  3QU5 A;  3HKZ F;  1ZQL A;  3V7L A;  1P7D A;  2XY6 A;  3HRD D;  1V85 A;  3LK9 A;  3ICX A;  4GIB A;  1GO3 F;  2EH9 A;  3DDH A;  1OUQ A;  4DF8 A;  5KFH A;  4I2C A;  5AKY A;  4XUS A;  4JV0 A;  4RQ1 A;  1SV4 A;  3AMZ A;  3D2N A;  1TAM A;  1NOM A;  1RYS A;  5L1J A;  4B9T A;  3T5L A;  5GTH U;  3GIJ A;  2MUT B;  2PFP A;  1SKW A;  1D9D A;  5KT7 A;  4GFJ A;  4BDP A;  2HHW A;  4NLZ A;  3F2B A;  1WWV A;  1ZQX A;  4YD2 A;  4NL9 C;  3IG8 A;  5KFL A;  9ICO A;  4JK1 A;  1NZB A;  3E0F A;  1U4B A;  4MF2 A;  5KG2 A;  5J2F A;  3ZDD A;  7ICT A;  3NVZ A;  1QTM A;  5KT2 A;  2YB1 A;  4P0P B;  2ZIU B;  2D3D A;  2NRV A;  1HIW A;  3BQ0 A;  2G09 A;  1O03 A;  4QZB A;  3RFA A;  2LI6 A;  5EWF A;  3WK5 A;  1LVH A;  1ZQP A;  1Z1B A;  2ZTD A;  3GIM A;  4PJ0 U;  3G6X A;  9ICH A;  5T14 A;  1X6I A;  3RH4 A;  4Y2U A;  5EE0 A;  4F4K A;  1S5L U;  3RJE A;  1VLB A;  4ACO A;  1Z19 A;  8ICG A;  3MDA A;  5J2I A;  1BPY A;  5KFR A;  3G6Y A;  9ICE A;  5DB8 A;  2EAM A;  4BXO A;  1SXD A;  3EPI A;  4BWM A;  3GDX A;  1DRG A;  1UPH A;  4IS7 A;  4C8O A;  2F77 X;  3H0L B;  3GIK A;  1HEK A;  4ECX A;  1WWU A;  5AK4 A;  3Q8P B;  2ZJA A;  1ZQH A;  4KLL A;  2W03 A;  5AK3 A;  2LPE A;  4BX9 C;  4KMO B;  4X5V A;  3M9N B;  5BOM A;  3MGV A;  1VDV A;  1ZQQ A;  2ZJ8 A;  4EX7 A;  2H3Q A;  4YMO A;  1S0M A;  4B9L A;  5KFC A;  1KFS A;  3JPS A;  5D46 A;  2KVC A;  5AKZ A;  5KAF U;  2FJ6 A;  4IRC A;  2YMQ A;  2J6U A;  4F3O A;  4KMU A;  1SV0 A;  4ECR A;  4F8R A;  4DL4 A;  2W8K A;  1S0O A;  4AYB F;  3UMG A;  1ZQ1 C;  3PSI A;  1H38 A;  4F5O A;  3KOO A;  5KFO A;  3SV4 A;  4NLG A;  5AM4 A;  5E79 U;  4JV1 A;  5ALV A;  2QAR B;  5KFB A;  2HOF A;  5CJ7 A;  2F1I A;  1NK8 A;  1ZQZ A;  1HJP A;  5FP0 A;  1ZQK A;  1NK4 A;  4DS5 A;  1UHU A;  1X66 A;  2E3T A;  4QZI A;  3PW7 A;  4RPZ A;  4C80 A;  5J2A A;  2JH7 A;  2XIC A;  2CRX A;  5ALM A;  5KFZ A;  4O3M A;  7ICG A;  4UAY A;  3PVX A;  4ELT A;  2F1J A;  5ALQ A;  2NYV A;  5KFK A;  3RB4 A;  1PVR A;  5JU5 A;  5KT6 A;  2Y9T A;  1X9X A;  5DGB A;  2LYB A;  2H5X A;  5AI5 A;  5KG6 A;  2BPF A;  2BKE A;  4YR0 A;  4G9B A;  9ICJ A;  5ALN A;  5DDY A;  1ZQD A;  4KLD A;  3A0H U;  5KG1 A;  3JPP A;  4KTQ A;  1DOQ A;  4IC9 A;  2LYH A;  4ECZ A;  3SAF A;  2W3R A;  3BQ2 A;  2JEF A;  5J2H A;  2AGQ A;  2DL0 A;  4GC7 A;  4NLB A;  4OCZ A;  3PX4 A;  4CNQ A;  4C8M A;  4M9G A;  2KSO B;  2NRW A;  4UAW A;  4FBT A;  3O0F A;  1RG6 A;  2KKV A;  1TV9 A;  3Q8S B;  3QNM A;  8ICM A;  1BGX T;  4I29 A;  1S10 A;  3Q8M A;  3RH6 A;  4LZD A;  4QIW C;  2K8A A;  1MN8 A;  1S76 D;  4OJ6 A;  4AYB C;  2YMP A;  4BXO B;  4PGX A;  2W9B B;  3N28 A;  3NRW A;  5AK5 A;  1KRP A;  4YG2 A;  4RQ2 A;  5KFI A;  3QEB Z;  2XY7 A;  2JV3 A;  3F2D A;  2BZF A;  3PW4 A;  5KFS A;  3WKE A;  4QJF B;  4CF3 A;  5G5G A;  2XY5 A;  1LB2 B;  3T3F A;  2MUT A;  3SI8 A;  3NRZ A;  1LV5 A;  5J0U A;  4YXJ A;  1L7M A;  4TUQ A;  3ISB A;  2XGP A;  5DQH A;  5DB6 A;  3NTU A;  3RJG A;  3QYP A;  4ELV A;  4GXJ A;  3N7R C;  4RQM A;  4MEX A;  8ICW A;  2BR0 A;  2DBY A;  1NZP A;  2B0C A;  2VA8 A;  4I2E A;  3BS5 A;  1L3T A;  1S9F A;  3SR6 A;  3EYZ A;  1XO0 A;  1JXE A;  2KHQ A;  2OXO A;  4P4P A;  3RR8 A;  4RT3 A;  5DBB A;  2QKQ A;  4NV0 A;  4DQR A;  1ZOL A;  3RAQ A;  3THV A;  1U49 A;  1SZP A;  4KLG A;  3UMC A;  3B0Y A;  4MFA A;  4I2G A;  4UQG A;  2HBK A;  3M1Y A;  3M9M B;  3CNH A;  4PZO A;  7ICV A;  2K4P A;  4LJX A;  4YD1 A;  2J6S A;  2PFQ A;  4Y2J A;  4AP9 A;  5EE9 A;  3T5H A;  3KHL A;  3HP6 A;  2C2E A;  2FE9 A;  1JN3 A;  1UT8 A;  5AIC A;  3UXP A;  2D6F C;  5EWG A;  3M6Z A;  2ZUC A;  4NLK A;  4F50 A;  1KN5 A;  1L8O A;  3ISC A;  1QSL A;  4C8N A;  3ED5 A;  3FDS A;  3C2K A;  2WAQ F;  4UB5 A;  4XRH A;  1N63 A;  4B9U A;  5C0Y A;  5DDM A;  5DQI A;  4QZF A;  1X9W A;  4QNL A;  3OSN A;  3SV3 A;  5IIK A;  4KLJ A;  2P66 A;  4YFK A;  4UB6 U;  1UT5 A;  3BQ7 A;  4DQQ A;  4QW8 A;  8ICK A;  3HIL A;  1L7O A;  4J9P A;  2P6R A;  2KP7 A;  3K1R B;  1DGS A;  3G6V A;  3K75 D;  1SIJ A;  4QWC A;  3LWM A;  2DQN B;  4DL6 A;  3H0M B;  3GFK B;  4BJQ A;  5DGA A;  1HUZ A;  1C20 A;  4RQN A;  2RRD A;  4R8U A;  4YXM A;  5ALJ A;  3WKC A;  2AQ0 A;  1T8E A;  4ED3 A;  3KZX A;  3AU6 A;  4U6P A;  9ICX A;  1ZQJ A;  4NL9 A;  4Z6D A;  5J0Y A;  3KKA C;  4ECT A;  2UVV A;  3WU2 U;  2AU0 A;  3TAC B;  3TI0 A;  3LVV A;  2A3V A;  3RJK A;  2HHQ A;  1KBU A;  3N7S C;  4MFC A;  3EW9 A;  2UVW A;  4Q44 A;  2NRT A;  3C5F A;  3QUB A;  3QX7 A;  5IIO A;  3GV5 B;  1D9F A;  2G06 A;  4DQS A;  8ICE A;  1BNO A;  5KFW A;  7ICE A;  2KJ5 A;  8ICB A;  9ICM A;  4Y2R A;  4DL7 A;  8ICZ A;  3ISD A;  4WJ3 B;  1KTQ A;  5CEH A;  2ZIV B;  3M9O B;  3UMB A;  4B9V A;  2H3F A;  5ALD A;  1F5S A;  4PHP A;  5KFG A;  7ICU A;  4UAS A;  4PHE A;  4CCH A;  4UB8 U;  3WK8 A;  3V6H A;  4NY8 A;  1WYG A;  3NVV A;  1QCK A;  5L1K A;  1ZJN A;  2EAO A;  3NVW A;  5AKJ A;  4B9M A;  1KFD A;  1S0V A;  4F71 A;  3FM9 A;  4O3Q A;  1YT3 A;  1X9S A;  2BCR A;  2ZIX B;  4JV2 A;  3QUC A;  5J0P A;  2IOF A;  4XQ8 A;  3V6J A;  5KFT A;  2MA1 A;  4QZG A;  1RQN A;  2ISO A;  2F2A B;  1UA1 A;  1DK2 A;  3IDW A;  2M0N A;  3V6K A;  4EBC A;  4NM2 A;  4J9O A;  3M8S A;  5C5J A;  4M9N A;  2PI4 A;  3PV8 A;  3AM9 A;  5DQG A;  2EZX A;  2KHV A;  3MGI A;  3R9K A;  5J0X A;  2I1Q A;  5KFY A;  2C22 A;  1BPB A;  5IIM A;  3PW2 A;  4TUS A;  4O5K A;  1MQ2 A;  3JPQ A;  1SL0 A;  3GII A;  2G07 A;  2K8C B;  4IQV A;  2LKY A;  4LVS A;  4O3P A;  1COO A;  1V97 A;  5ALR A;  3MFH A;  5KFE A;  3WKD A;  4O3O A;  4BUG A;  5KFQ A;  3PX6 A;  3AL0 B;  4ECU A;  1U48 A;  4NLN A;  2V9W A;  4C0Z A;  3Q8K A;  7ICI A;  1D8Y A;  1S0N A;  4ZOH C;  3QZ7 A;  2KD1 A;  1A77 A;  3MR3 A;  1NI3 A;  3KHR A;  2JEI A;  4GXK A;  5KAI U;  4DWI A;  1OXJ A;  5L1M A;  1FFU A;  4PGY A;  4F4X A;  2HBM A;  4O3R A;  5AM3 A;  7ICN A;  5ALT A;  3NUQ A;  4ELU A;  2KTQ A;  4J9N A;  2ODG A;  4B9S A;  2HVI A;  4QWA A;  1QLN A;  2WB1 F;  1QSY A;  3GV8 B;  4YVZ A;  2MAX A;  5IIJ A;  5KT4 A;  2HMX A;  2BQR A;  4UAT A;  8ICQ A;  5AI0 A;  4Z6C A;  3LVW A;  3RB6 A;  3QU2 A;  2VA2 A;  3GZF A;  2C2R A;  2OCE A;  4NWI A;  2Y0S C;  2R8J A;  4P2H A;  4DFD A;  5J0S A;  4KN7 A;  9ICC A;  2P6U A;  2K4I A;  1ZQW A;  5KFM A;  4ZH4 A;  2G5I B;  5KT3 A;  2F1H A;  4DO9 A;  3WK7 A;  4K4I A;  1XNS A;  3RJJ A;  5J2K A;  2AJQ A;  1TK8 A;  1NK0 A;  1ZQE A;  3QZ8 A;  3C28 A;  5G5H A;  4EEN A;  5ALX A;  1KFT A;  4IRD A;  2KK0 A;  5KFN A;  4PHA A;  4Y2V A;  4F72 A;  3CRX A;  4FS2 A;  3AQF A;  2JRZ A;  4ED0 A;  3H8S A;  1XWL A;  9ICW A;  2WB1 C;  5DG9 A;  2EAP A;  4EEK A;  8ICI A;  3UM9 A;  4P0P A;  2E8M A;  5ALF A;  4TQR A;  3KZI U;  2F76 X;  5HNK A;  3GQC A;  2JXJ A;  1SZH A;  3SAH A;  5KL1 B;  2RLT A;  4UB2 A;  1Q3U A;  3JPT A;  2M9N A;  2WF5 A;  5ALE A;  2UVU A;  5CB1 A;  2Y1I A;  1JIH A;  5J0Q A;  4HAI A;  2FMQ A;  2ZXH A;  4UBC A;  3RBD A;  1ZQG A;  4C7Z A;  1HUO A;  2JR5 A;  2DPI A;  4YQW A;  3SZ2 A;  1RXW A;  1RXV A;  1DGJ A;  9ICR A;  8ICS A;  7ICP A;  1TAQ A;  4YR2 A;  2VJ5 A;  3TQ1 A;  4M9J A;  3MR6 A;  2W04 A;  3UXO A;  2ZTE A;  1NKC A;  1X6J A;  3M6K A;  3PNC A;  1TK0 A;  4M0A A;  3CYM A;  4GLX A;  3PW5 A;  4ECW A;  7ICF A;  1ZRM A;  4RQ4 A;  1N5X A;  3CW2 C;  3PML A;  3IM1 A;  3QU4 A;  3RJI A;  1PUZ A;  4M6W B;  5KFV A;  5HR6 A;  4RQ0 A;  1BPD A;  1ZQA A;  4C7Y A;  2ATL A;  2HOQ A;  2FMP A;  1LKY A;  4UW9 A;  4KLT A;  5DBC A;  9ICK A;  4F2R A;  4KX5 A;  2I5H A;  3IHQ B;  4ED1 A;  4CRX A;  1S8O A;  2PFO A;  1MSW D;  5KFP A;  5AKX A;  4XA5 A;  3BQ1 A;  4UAR A;  3QXG A;  5AM2 A;  3C2L A;  2BPC A;  1ZQO A;  4OJL A;  2KVS A;  4U7C A;  3M7D A;  2LBO A;  3U26 A;  5BOL A;  4M2Y A;  4NM1 A;  1RPL A;  3JPO A;  2OYY A;  2W43 A;  4YCX A;  4IR9 A;  2Y1J A;  2KG5 A;  3OSP A;  5F3X B;  2WF8 A;  5KFX A;  1B22 A;  2E8P A;  1OW5 A;  5KTQ A;  4M6W A;  1RYR A;  2VIX A;  1N61 A;  4DL5 A;  4O9M A;  2FPK A;  5L1I A;  3QE9 Y;  4OJO A;  3SEI A;  4JUZ A;  7ICS A;  4QWB A;  2JZB B;  2NRX A;  2YML A;  5DB7 A;  1ARO P;  5J8Y C;  2VAN A;  3RB0 A;  1D8B A;  2XVT A;  2VA3 A;  1SKR A;  4KLF A;  1WG8 A;  1XC9 A;  3ZDB A;  1FIQ A;  4RNN A;  4I2I A;  4RPY A;  4FZL A;  4PL2 A;  3DV9 A;  7ICR A;  2KJ8 A;  4OD0 A;  1TK5 A;  1Z4N A;  2IMW P;  8ICC A;  9ICV A;  2BQU A;  1B43 A;  4IQT A;  4JWN A;  2K4E A;  7ICH A;  1ZD5 A;  3KKA A;  5CRX A;  1BPX A;  1DK3 A;  1O08 A;  4B9N A;  8ICF A;  1UCV A;  4RNO A;  1ZJM A;  1FEZ A;  4I2F A;  4DFK A;  3TAN A;  2A19 A;  3PMN A;  3DEE A;  1KLN A;  3N7P D;  8ICJ A;  2R18 A;  3MAB A;  5JTI A;  2DF4 B;  4NJ8 A;  4F93 B;  1ECW A;  2A1J B;  2XGQ A;  2ZUB A;  1Z1V A;  4ECS A;  1Z4O A;  4MHV A;  4Q8E A;  2IA6 A;  4PGQ A;  3KBB A;  5J8Y A;  1PK1 A;  1C7Y A;  4DSK A;  5J2D A;  3TAP A;  4F2S A;  5ALK A;  2ZIW B;  4C4R A;  3SMV A;  3GIL A;  3TAR A;  3ZDE A;  5KG3 A;  2OH2 A;  2HI0 A;  3S6J A;  2KJ9 A;  3OPX A;  3C1Z A;  3F5A A;  4RUC A;  1S77 D;  4K4G A;  1XS9 D;  1V38 A;  1JI7 A;  2VKQ A;  2WHE A;  3N4M B;  4A8E A;  2BCS A;  8ICO A;  2JH1 A;  3RTV A;  3BJY A;  4YMN A;  5H2F U;  1ZD3 A;  2PI5 A;  1PK3 A;  5CP2 A;  4OO1 J;  1LKY B;  4F91 B;  2ZIW A;  4KX3 A;  3QEA Z;  2AXT U;  1ZRN A;  3I28 A;  4Y2Q A;  4EX6 A;  5DLF A;  1DXS A;  2I6X A;  3BS5 B;  1N56 A;  2CPR A;  1WUD A;  5CHG A;  3C29 A;  2ASL A;  4QZD A;  3MR2 A;  3QU9 A;  1K5O A;  2PFN A;  3IRU A;  3NGD A;  1B4F A;  3SEN A;  5DBA A;  4EEL A;  1ZQY A;  1RYU A;  4MEY A;  5ALP A;  9ICU A;  1JMS A;  5AKG A;  2C28 A;  3PR5 B;  5L1L A;  4ED8 A;  3LDA A;  1N62 A;  3NS1 A;  4J9K A;  4QZ9 A;  3TKA A;  2KIV A;  3VCB A;  3PY8 A;  3OHB A;  4EBD A;  2ALZ A;  2KIC A;  2W8L A;  4BWJ A;  4US9 A;  2IOF K;  4DOB A;  3HKZ C;  3BQT A;  3H4D A;  2L5Y A;  5ALO A;  2HBJ A;  2NRZ A;  4J9S A;  4YR3 A;  4K4H A;  3ZD8 A;  3B0X A;  3I1Y A;  2XCA A;  2QB0 B;  2KOB A;  3J81 j;  3AEV A;  3ONN A;  5CR0 A;  4ECV A;  1SL2 A;  4QWD A;  4IQW A;  2MU2 A;  7ICK A;  5ALI A;  1L3S A;  2R8K A;  5ALZ A;  1PVP A;  3PST A;  4Z6E A;  4PL1 A;  1SWW A;  1Z3E B;  2MRL A;  4J9L A;  1X42 A;  3V7K A;  5AKH A;  2LM4 A;  2YTU A;  3SAG A;  4C8L A;  3I76 A;  2QB0 A;  5B5E U;  1B0X A;  3B9J A;  4KLQ A;  2K60 A;  2OM6 A;  4O5E A;  3PO4 A;  4R66 A;  3C5G A;  2BGW A;  2NV3 A;  2DKX A;  5L9X A;  4I2H A;  1ZQB A;  3N97 B;  3WK4 A;  5AM5 A;  5AKI A;  2W9C B;  4Y2S A;  3PSF A;  4ED7 A;  3ZI4 A;  3H40 A;  4J9R A;  4FZM A;  5GTI U;  2HHS A;  3MR5 A;  5ALL A;  2WTF A;  4M9L A;  4UAV A;  3OJS A;  3ZDC A;  2WFA A;  2JZB A;  2NO5 A;  4R64 A;  4DQP A;  4Q45 A;  5KG4 A;  2ESE A;  7ICO A;  8ICU A;  5EE3 A;  3Q8L A;  3BDP A;  2QB1 A;  4J03 A;  2KMD A;  4CGZ A;  2BDU A;  3H4B A;  3K1Z A;  2HHV A;  4RQ8 A;  2GOL A;  3K4G A;  4Y2X A;  2UVR A;  2EZZ A;  4HYK A;  1ED1 A;  2Z7J A;  5AM1 A;  4DCC A;  4Q43 A;  4FE3 A;  4GC6 A;  2FLL A;  2E1E A;  3WK6 A;  2Q4T A;  1UA0 A;  2J6T A;  3E2E A;  3JPR A;  2W9B A;  1JRO A;  2W9C A;  5AK6 A;  3MGH A;  2BCQ A;  1U45 A;  4P0Q B;  3F2C A;  2ZIV A;  3NAS A;  3MFI A;  3HJE A;  2HCF A;  3RJF A;  2PMZ C;  4QWE A;  3L5K A;  4DEZ A;  2G5H B;  3LYS A;  4NLC A;  8ICX A;  2HBL A;  2XI9 A;  2EAN A;  4DS4 A;  4RQ6 A;  1CEZ A;  1PK1 B;  4JMU A;  1L8L A;  2GH1 A;  4I2J A;  3QU7 A;  4FZN A;  9ICB A;  2IOH A;  4YN4 A;  1J97 A;  4P4O A;  3TAD C;  5KFF A;  4Y2P A;  4F92 B;  1ZQM A;  1Q3V A;  2YQE A;  1KQQ A;  4ECY A;  3FAH A;  1MA7 A;  1SV0 C;  1L6N A;  1NK6 A;  9ICT A;  2AH5 A;  1V9P A;  1KDH A;  4P0Q A;  2PKE A;  2CXY A;  4NXZ A;  1N5W A;  3E58 A;  9ICS A;  3A0B U;  3KD3 A;  3RRH A;  2OEH A;  5IIL A;  2W54 A;  5DKW A;  3HW8 A;  2W7O A;  4CDG A;  4KLI A;  8ICA A;  2V4R A;  1KEJ A;  3ORY A;  5HML A;  3ETR A;  1JAL A;  1TVA A;  2FLP A;  3OJU A;  1K1Q A;  4DFM A;  4M04 A;  3TFS A;  8ICR A;  8ICP A;  1RM6 C;  4KN4 A;  4QZH A;  3Q8R B;  3UPQ A;  2ISP A;  5F9L A;  4B6J A;  1TE2 A;  2Y0S F;  3V72 A;  4RUA A;  3T5K A;  3EUB 2;  3RF9 A;  4YMM A;  1J2N A;  3HPO A;  8ICL A;  3KTQ A;  1A76 A;  2BHN A;  4IRK A;  4FBU A;  5DLG A;  5ALU A;  4PH5 A;  2JEG A;  1EXN A;  2GO7 A;  2XO7 A;  5ALY A;  3LWL A;  1YZ7 A;  1SWV A;  1WCN A;  3IP4 B;  1ZQI A;  5ALS A;  3IV6 A;  2K8B B;  4DLE A;  2DGZ A;  2R8H A;  2RDI A;  3HX0 A;  2E8N A;  3KFU F;  2DFL A;  2IHN A;  5AHX A;  1A6S A;  1SXE A;  4O0I A;  2DKZ A;  1L3U A;  5IIN A;  4DFP A;  4DLG A;  4UAZ A;  5K4L A;  8ICN A;  1ZQS A;  5KFU A;  3VC8 A;  2JHD A;  5HMM A;  4UAU A;  2H3I A;  2HHX A;  2P35 A;  2DUY A;  2FI1 A;  4TUR A;  4DL2 A;  4R8U B;  1ZD2 P;  5KFA A;  2EQY A;  2W9M A;  2KSO A;  3WKB A;  9ICI A;  2PMZ F;  2DPJ A;  2N1R A;  4RQ3 A;  5AKE A;  3AQE A;  5J29 A;  5J2B A;  2QAR A;  4UB4 A;  2E1F A;  2KZM A;  5EE1 A;  2ES6 A;  2XCP A;  1TAU A;  2HHT A;  4GXI A;  4C8K A;  1U9L A;  3PR4 A;  3ZD9 A;  5HP4 A;  5KG0 A;  3ETL A;  3C1Y A;  3SD7 A;  2GLE A;  2FDR A;  1ZQT A;  5J2E A;  4EYI B;  1CRX A;  4KLH A;  4DSL A;  5KT5 A;  3IN5 A;  9ICL A;  2HHU A;  1IIP A;  4IQU A;  4US8 A;  4TUP A;  4EEY A;  1J2M A;  1BVS A;  3TFR A;  1NJX A;  5KFD A;  1L7N A;  5B66 U;  3C2M A;  3MBY A;  2HDO A;  5AIB A;  4MF8 A;  2XC9 A;  4QZ8 A;  2G0A A;  3F53 A;  8ICY A;  2E8O A;  1TKD A;  2FPL A;  2JGA A;  5J0W A;  4DSI A;  2ZIX A;  1IV8 A;  2ZJ5 A;  4JB3 A;  1S97 A;  1K1S A;  5JUM A;  4KLS A;  2KFZ A;  2C2D A;  5J2J A;  1JXL A;  4IR1 A;  5A0L A;  1RQL A;  5BPC A;  3GV7 B;  5DG8 A;  4TQS A;  2V4Q A;  3C21 A;  5HR7 A;  1N60 A;  2WF6 A;  2WF9 A;  1NJW A;  4R65 A;  3C23 A;  5III A;  2ZUD A;  4FO6 A;  2FPM A;  1ZQU A;  4RNM A;  1YZ6 A;  7ICQ A;  1F0M A;  4ECQ A;  1ZQF A;  3H8W A;  3D6J A;  7ICJ A;  4F5Q A;  1SB3 C;  3WKA A;  5ALW A;  3M8R A;  4OJP A;  1ZQC A;  1RDF A;  4DSE A;  2B6G A;  3OGU A;  5CA7 A;  1FFV A;  2CN1 A;  1NJY A;  1Q8K A;  5HHI A;  2YY6 A;  2HW3 A;  1IXR A;  1QH9 A;  1XSN A;  1PZN A;  4Y2T A;  3H8M A;  4BGD A;  1Z00 B;  1Q46 A;  1NK5 A;  2F8K A;  1AQ6 A;  3SQI A;  1NJZ A;  2W55 A;  1TFR A;  3RH5 A;  5DB9 A;  3AUO A;  3PX0 A;  2A1A A;  4USA A;  2BPG A;  2H3V A;  1WCL A;  1SL1 A;  9ICQ A;  4ED6 A;  5D4B A;  2FLN A;  2AGO A;  1XSP A;  3H7I A;  1NNL A;  1N2X A;  4R63 A;  1NK7 A;  2WAQ C;  4KLM A;  2F44 A;  1Y88 A;  5AI9 A;  2YMM A;  3FC4 A;  2K89 A;  2NO4 A;  3HWT A;  3PZP A;  5ALH A;  2KEY A;  1KKX A;  4DSJ A;  4F4Y A;  5AKK A;  2HSZ A;  2XID A;  9ICG A;  2WF7 A;  8ICV A;  2H3Z A;  4RPX A;  5TZV A;  1N48 A;  3AU2 A;  3L3F X;  4FFD A;  4DOA A;  2K4H A;  1Z00 A;  2YX8 A;  5F9N A;  4LZG A;  1QQ5 A;  5CWR A;  1KSP A;  9ICA A;  2KN7 A;  2BCV A;  3IG5 A;  4UB1 A;  9ICF A;  3UQ0 A;  1BPZ A;  4ED2 A;  2YB4 A;  4Y2Y A;  3T79 A;  2F8L A;  3T5J A;  2W9A A;  1MQ3 A;  2QLT A;  1QSS A;  1D8L A;  4CE6 A;  3BS7 A;  2B21 A;  4O5C A;  3RAX A;  2MSN A;  2KIW A;  2JMG A;  3NVY A;  4EBE A;  1X2I A;  2EDU A;  4QZE A;  1A0P A;  2Y9U A;  2W7P A;  3MDC A;  5HHH A;  2KE7 A;  3QUQ A;  3PO5 A;  1U47 A;  4ICA A;  5J0O A;  1FO4 A;  4Q8F A;  1T7P A;  8ICT A;  4KLE A;  2D8C A;  4J9M A;  3V7J A;  3Q8Q B;  5TIS U;  1X9M A;  4I2B A;  1L7P A;  1CI4 A;  3RBE A;  4O3S A;  3WK9 A;  4C4S A;  4F5N A;  4RU9 A;  5J0T A;  3TAD A;  2AQ4 A;  2RDJ A;  5D49 A;  4RZR A;  2W11 A;  3HT3 A;  4I28 A;  4QZC A;  4KIT B;  3CP8 A;  1ZD4 A;  4RQ5 A;  1NK9 A;  2OHF A;  2HOI A;  3AN1 A;  1XSL A;  4O3N A;  4I27 A;  3ZDA A;  2KFN A;  5AI6 A;  1JUD A;  3D2Q A;  3RB3 A;  2HVH A;  5ALG A;  1L3V A;  4KLO A;  1RZT A;  1MC8 A;  1T94 A;  1XO1 A;  4JWM A;  2ZXI A;  1ZQR A;  4DL3 A;  5J0R A;  1QQ6 A;  2VJ4 A;  3JPN A;  3MC1 A;  4YP3 A;  1ZET A;  1T3Q A;  4EYH B;  1ZQV A;  4UB3 A;  4F5P A;  3UXN A;  2IBK A;  1L5U A;  1SGG A;  2PXI A;  2BDP A;  5JRT A;  5AKL A;  4DQI A;  3EZ5 A;  2O6K A;  4KLU A;  2LM1 A;  5DG7 A;  2YN4 A;  4RQ7 A;  2KZZ A;  3L4P A;  4Z6F A;  5KG5 A;  3H0R B;  1XU4 A;  3UQ2 A;  3OHA A;  2KZ3 A;  2RP5 A;  4OJ5 A;  1ZYQ A;  8ICH A;  4DSF A;  2F3N A;  4DF4 A;  3BZK A;  4PZN A;  5AI4 A;  5EOZ A;  4P4M A;  3H8J A;  4EZ6 A;  4G3I A;  5J2C A;  4RT2 A; 
#chains in the Genus database with same CATH homology
 2CN1 A;  2F77 X;  2HOQ A;  2R18 A;  3H0L B;  1XO0 A;  3K1Z A;  2LYA A;  5KL8 B;  4IC9 A;  2GOL A;  2DF4 B;  2KHQ A;  2KHV A;  2KNJ A;  2OXO A;  2ZIU A;  1HEK A;  4KX5 A;  3HKZ F;  3HKZ C;  3C28 A;  1ECW A;  1ED1 A;  4NV0 A;  2Z7J A;  3KZX A;  3SAF A;  1P7D A;  4CRX A;  3SQI A;  2W03 A;  2HBJ A;  4BX9 C;  2Y0S F;  4FE3 A;  4U6P A;  4KMO B;  1CRX A;  2E1E A;  2ZG6 A;  4NLB A;  2KV2 A;  2Q4T A;  3RF9 A;  3ICX A;  2HBK A;  1GO3 F;  3MGV A;  3CRX A;  1OUQ A;  3IN5 A;  2H3V A;  4OJL A;  4P0Q B;  4U7C A;  2H3Q A;  2G07 A;  3M7D A;  3F2C A;  2ZIV A;  3AQF A;  2LBO A;  2KOB A;  1IIP A;  2K8C B;  2LKY A;  3D2N A;  1TAM A;  2G08 A;  2OYY A;  2WB1 C;  3LVV A;  3O0F A;  2A3V A;  3ONN A;  1KBU A;  2KKV A;  2KVC A;  2ZIW B;  3N7S C;  3SMV A;  4P0P A;  2F76 X;  3ALR A;  3CP8 A;  2OH2 A;  2WAQ C;  2PMZ C;  3IP4 B;  4BUG A;  2KJ9 A;  1SZH A;  3AL0 B;  3SAH A;  2G06 A;  2K8B B;  2HOI A;  2DGZ A;  2K89 A;  1PVP A;  2G5H B;  3LYS A;  4QIW F;  5KL1 B;  3PST A;  4QIW C;  3PZP A;  2K8A A;  3OPX A;  2KEY A;  4NLC A;  4PL1 A;  2KJ5 A;  2D6F C;  4OJ6 A;  1Q3U A;  2HBL A;  2G0A A;  3F53 A;  2XI9 A;  4GFJ A;  2MRL A;  3M6Z A;  3KFU F;  3D2Q A;  3F5A A;  4AYB C;  4AYB F;  4C0Z A;  1ZQ1 C;  1URJ A;  2VIX A;  3PSI A;  3SAG A;  2VKQ A;  2KD1 A;  3F2B A;  2JGA A;  4WJ3 B;  3NRW A;  1A6S A;  2XID A;  1T94 A;  2ZIX A;  2ZXH A;  4A8E A;  4JMU A;  4OJO A;  3IG8 A;  2GH1 A;  2H3Z A;  2ZIV B;  2RHF A;  2JH1 A;  1NZB A;  4FZN A;  2H3F A;  3E0F A;  3L3F X;  2HBM A;  2ZXI A;  3F2D A;  2K4H A;  2WAQ F;  2YX8 A;  2HOF A;  2OM6 A;  4OO1 J;  5A0L A;  4QJF B;  2ZIW A;  2YB1 A;  4KX3 A;  4P0P B;  2ZIU B;  5C0Y A;  1Q3V A;  3IG5 A;  3D2S A;  3NUQ A;  2VJ4 A;  2JHD A;  3VC8 A;  1D8B A;  2H3I A;  2XVT A;  2NV3 A;  1MA7 A;  1HIW A;  1L6N A;  4QNL A;  5HR7 A;  2G09 A;  4P0Q A;  2YB4 A;  3RFA A;  2VJ5 A;  2CPR A;  1WUD A;  2JH7 A;  2XIC A;  3C29 A;  2CRX A;  4FZL A;  4PL2 A;  3T79 A;  2W04 A;  2WB1 F;  3PSF A;  1Z1B A;  4O3M A;  2KJ8 A;  1YT3 A;  2HMX A;  2F8L A;  5T14 A;  2KKP A;  3M6K A;  2ZIX B;  4FZM A;  3CYM A;  3LVW A;  4ACO A;  2PMZ F;  2N1R A;  3AQE A;  3N7R C;  2W7O A;  1Z19 A;  2K4E A;  2BDU A;  2E1F A;  2KIW A;  5CRX A;  2JMG A;  3GZF A;  2DQN B;  3H0R B;  2E5S A;  4NWI A;  4CDG A;  2Y0S C;  2MA1 A;  3H0M B;  1PVR A;  4BJQ A;  2RP5 A;  1A0P A;  2W7P A;  4OJ5 A;  2K4I A;  2F2A B;  2LYB A;  4OJP A;  1F44 A;  2LHT A;  1DRG A;  2M0N A;  3GU3 A;  3F5E A;  2G5I B;  2RRD A;  1UPH A;  5HR6 A;  4ICA A;  3VCB A;  3PSP A;  1PVQ A;  3DEE A;  1XNS A;  3N7P D;  4CGZ A;  2KIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...