1MN8A

Structure of moloney murine leukaemia virus matrix protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
QTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Core protein p15
publication title Atomic resolution structure of Moloney murine leukaemia virus matrix protein and its relationship to other retroviral matrix proteins.
pubmed doi rcsb
source organism Moloney murine leukemia virus
molecule tags Viral protein
total genus 32
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.180 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Gamma-retroviral matrix domain 1mn8A00
1MN8A 1UHUA
chains in the Genus database with same CATH superfamily
1X9WA 1ZOLA 1RPLA 5EE1A 4ED8A 1SZHA 3EYZA 7ICPA 2ZIUA 1RG6A 5F9NA 1ZQ1C 3NVWA 1NK0A 1PK1A 1WCNA 2KEYA 1KBUA 3I76A 4LJXA 2BCSA 2LKYA 2FPLA 4BDPA 5AKHA 3KZIU 1X42A 2KVSA 2K60A 1KTQA 4UBCA 2AHOB 3J81j 3MGVA 5J2DA 1XNSA 5KG0A 3T5KA 2YTUA 3RB3A 2WTFA 4X5VA 3WKBA 4UAZA 5ALLA 3RJEA 3RR7A 2BZFA 1A77A 2JRZA 3M6KA 5KT4A 3Q8MA 3K4GA 3D2NA 4O5EA 4F4YA 4Z6FA 3KHRA 3TAPA 8ICKA 4KX5A 5ALPA 3M7DA 4YD1A 4FZNA 2IOFK 2DBYA 3BQ2A 2G0AA 4O3MA 2P35A 2AQ4A 4FBUA 7ICHA 1S10A 2EANA 4DL4A 1WYGA 2Y0SC 1TAQA 3PR4A 5ALUA 2K8AA 4NWIA 5DG8A 3QNMA 2XVTA 3UQ0A 3RAQA 3E58A 1XS9D 3IN5A 4ECRA 1CEZA 1XO0A 3RB4A 2KJ5A 3M6ZA 2J6UA 4ED1A 3FC4A 3BQ0A 3MR5A 2KHVA 3HX0A 1BNOA 3RH5A 5KNIA 2ES6A 2AGQA 1X40A 3KD3A 5KFUA 5ALMA 2W9BB 4DS4A 3LWMA 2KK0A 3H4BA 4I2IA 4BXOB 1PVQA 4NLNA 1ZQEA 2AQ0A 3LYSA 2Y0SF 3SI8A 4YR3A 4F50A 4EZ9A 4XUSA 1HIWA 3N7SC 4CF3A 2NO4A 1HEKA 4JUZA 3AMZA 3RH4A 4DF4A 5ALSA 2Q4TA 3RF9A 2W03A 5L1KA 2ZG6A 3D6JA 2FLNA 4ECYA 2NRTA 4BUGA 2DKZA 3O0FA 3TFSA 3MR3A 2KIWA 2FLPA 1L7PA 5KFPA 2XGQA 1Z3EB 2ESEA 1J2MA 4PGYA 3NUQA 4Y2XA 2F1JA 1V9PA 3AN1A 4QZ9A 1JUDA 5AK6A 2LBOA 3BDPA 1B43A 3PSFA 3F2BA 5J0XA 5J2CA 5J0OA 4IR9A 4HYKA 7ICJA 3RAXA 1XU4A 2E1FA 4RPXA 1JMSA 2MRLA 2NO5A 3FAHA 3UMBA 1DOQA 5J2KA 2KV2A 3ZD9A 4DFMA 9ICXA 4QWDA 3SAGA 2W9BA 2PFQA 2WFAA 4BXOA 2EAMA 9ICCA 3JPOA 2R8HA 2FMQA 4NXZA 2IMWP 2N1RA 4J03A 4RQ5A 3ISCA 1AQ6A 3SV3A 3RB0A 3KFUF 4DSIA 2ALZA 1RM6C 1RXVA 3HRDD 4Z6CA 4MFFA 4KLIA 2KD1A 5KG7A 3PW7A 4O3SA 1K1QA 4ED0A 3F5AA 5EWEA 5DGBA 2BPCA 5AKJA 4I2CA 4PHDA 3PW5A 3NRWA 2H3VA 1TAUA 3GDXA 1ZRNA 3HILA 3DEEA 5AM3A 3BQ1A 4NM2A 4DWIA 8ICBA 2RRDA 3D2SA 5ALIA 1QTMA 2KZMA 5AI4A 1ZQGA 2R8IA 4F5RA 2FJ6A 2ZXHA 5DG7A 4F5QA 2CPRA 5AM1A 4LVSA 2ZJAA 3RB6A 7ICSA 3G6YA 2BDPA 2W3SA 4C0ZA 3EPGA 4P2HA 3WK8A 4IR1A 3SQIA 5ALVA 2QARB 3GILA 4FBTA 3C5FA 1U48A 4IRKA 7ICFA 2C2RA 4QW8A 2W8KA 5L1LA 4O5KA 5AIAA 5ALTA 4DF8A 8ICLA 2E5SA 3LDAA 2JV3A 4F2RA 2F3NA 2E8MA 1RQNA 1M6YA 3D2QA 4J9LA 4IRDA 5KT5A 5KT2A 4I2GA 4O3PA 2KIVA 1UT8A 3AQFA 1DXSA 4ECWA 9ICSA 2F76X 1Q3VA 1SXEA 3SMVA 2A1JB 3PO4A 2W54A 3QZ7A 2HBJA 1MQ2A 1N63A 3V6KA 2ZTCA 3QEBZ 3MBYA 5K4LA 1O03A 3U26A 2B0CA 3T5HA 4C8LA 3QZ8A 2OM6A 4KX3A 4Y2YA 3RFAA 1A76A 1X9MA 4YCXA 4MEXA 1K1SA 1NK9A 9ICTA 5J0YA 8ICMA 3ETLA 5J0UA 2EAPA 3PX0A 4I29A 4MFCA 5B5EU 1S0MA 5KFVA 2QARA 4U7CA 4NLBA 4P0PB 1ZQYA 4CCHA 5AK4A 3EWAA 1FIQA 2WF5A 2ISOA 2JZBB 5HHIA 5J0RA 1MQ3A 3GV8B 4BJQA 3F2DA 4YP3A 3KHGA 3QU9A 1WUDA 2BCRA 5AKIA 4AYBC 2JEIA 9ICAA 2B6GA 4B9VA 3EZ5A 1RYSA 2C2DA 4EBEA 1B22A 4FS2A 1BPXA 2A1JA 4QWAA 1RYRA 2VKQA 5KFQA 3PX4A 5KFSA 1JROA 2JXJA 1SV0C 4BGDA 4B9TA 4YXMA 4ED2A 2WB1C 1T3QA 4F8RA 1IG6A 4GXKA 1WWVA 4IQWA 3MFIA 3FDSA 2G5HB 4AYBF 2NYVA 4US8A 9ICUA 4IS7A 3TAQA 1KFDA 5AI8A 2R8KA 2DUYA 4QJFB 3RBEA 5DB8A 3M8RA 5D49A 3WKCA 4RNNA 1C7YA 2GWSA 4R65A 4P4MA 8ICVA 4ZOHC 2AJQA 2R8JA 2WF6A 3OPXA 4P0PA 3LK9A 3K1RB 3WK6A 4O3NA 3UQ2A 4O3QA 4ICAA 2JZBA 4C80A 4UAVA 5ALFA 3MR6A 4Y2JA 4J9QA 4KITB 7ICIA 4J9NA 4F71A 3C29A 8ICUA 4ECZA 9ICBA 1ZQNA 5J2AA 3MGHA 2H3FA 2EZXA 3QUTA 1U4BA 4KLEA 2XGPA 2I9GA 2IA6A 3H7IA 5GTIU 3K75D 4O9MA 9ICFA 1NKBA 3QE9Y 2D6FC 3N7RC 4RU9A 4UBBA 2LMRA 3MABA 1HUOA 2RDJA 2F2AB 3THVA 2R8GA 4K4GA 5JUMA 4QZEA 5KG5A 1ZQCA 2LHTA 4GXJA 2A3VA 1BGXT 2F1HA 4RNOA 5ALYA 4B9UA 2NRWA 2UVWA 1S77D 5ALNA 2JR5A 4RQ2A 3PW4A 1S8OA 2OYYA 4PZNA 1NK4A 2QB0B 4DEZA 2WF7A 2HOFA 1U47A 2JHDA 1XO1A 5E79U 3TARA 5J2EA 5KG3A 3SENA 1U45A 4YD2A 5HR7A 5DQIA 4OJ5A 2BHNA 5KFMA 4QNLA 4Y2TA 4KMUA 1ZQBA 5AKEA 1Q8KA 4DOAA 1N61A 5KFAA 5CHGA 2FI1A 4MEYA 1BPZA 1SIJA 5ALJA 3KKAA 4NL9A 2Y1IA 2K4PA 3PZPA 2QLTA 4JMUA 4J9KA 4CF4A 4JK1A 4KLSA 4PHPA 1JRPA 1YT3A 4XRHA 3B0YA 4DO9A 2H3ZA 1X66A 2AGPA 3OSPA 4RUAA 4I2EA 1Z19A 1ZQOA 2DGZA 5TISU 1KFSA 3H4DA 4UB3A 9ICWA 2F8LA 5DLFA 4OD0A 5IIMA 4Y2PA 8ICXA 1N5WA 3PO5A 1P7DA 3V7JA 2JEJA 3WK9A 2QB0A 1L3VA 3F5EA 5AKXA 1NKCA 3KHHA 2LM1A 1T4GA 8ICIA 4C7ZA 1DRGA 3TADA 4DL7A 2XCAA 1RZTA 2WHEA 4UB5A 1ZJNA 1NJXA 3KHLA 2PMZC 1UCVA 4DSJA 1PK3A 4QWBA 3SAHA 4MF8A 3SV4A 1SGGA 5CR0A 1OUQA 1F44A 5D46A 1XSPA 9ICVA 2G06A 1T94A 2I1QA 1RDFA 1Y88A 1SV4A 2W55A 3E2EA 5HHHA 5J2JA 4QZGA 2W11A 3ZDBA 8ICZA 4JV0A 4JV2A 1NZBA 2PI5A 3QUCA 4PHAA 5J29A 3NVVA 1X9SA 1WG8A 2PMZF 1WCLA 1SL2A 4B6JA 3TI0A 3VCBA 1H38A 4OJPA 5AKGA 2KJ9A 2E8OA 1JN3A 2MAXA 1L7NA 2ZJ5A 5KAFU 3OJUA 1Q3UA 2EAOA 4RUCA 2J6SA 1ZQXA 4IQTA 3KZXA 1Z4OA 2EZZA 2H5XA 3C2LA 1S0VA 3H8MA 2KKPA 3PSPA 4KLMA 4R64A 3PY8A 1Z1BA 5IIJA 2F1IA 4Z6EA 2HHTA 2KG5A 2VA2A 2KZ3A 3IG5A 4GC6A 4UQGA 1ZQTA 3S6JA 2BR0A 1BPEA 4DFJA 1ZQDA 3BS7A 5AK3A 4EENA 4XA5A 4KLFA 2MA1A 4NLKA 2ZUBA 3NGDA 4F92B 5AM5A 3ISBA 1KQQA 1QCKA 3H40A 2W9AA 9ICEA 7ICVA 2AXTU 1QH9A 3V72A 4US9A 1CUKA 4PL2A 3L3FX 2H3QA 4F72A 3H0RB 2KTQA 4R66A 4NY8A 1SL0A 2E3TA 2BCQA 1FFUA 4YFKA 4ED6A 1PZNA 4TUPA 2FMSA 2KOBA 2HBMA 2KNJA 1HUZA 2HOIA 4YN4A 2RQ5A 9ICLA 3OHBA 5J2BA 3WK5A 4RQ0A 2JMGA 3UXOA 3AUOA 4UB4A 2D3DA 3KTQA 2G07A 3UMCA 4UAYA 3WKDA 1IIPA 2XC9A 1C20A 2E8NA 2ODGA 4DS5A 5AI6A 2KVCA 3JPPA 2KFNA 4QZDA 3EUB2 4P4OA 4FZMA 1S0NA 4PGXA 4F5PA 4G3IA 2V4RA 5JTIA 2DL0A 3TFRA 4F4WA 5C5JA 2NRXA 1SB3C 3H8JA 5BOMA 4O5CA 1KKXA 3PW0A 5DDYA 1EXNA 4ELTA 2ATLA 1N5XA 1SL1A 8ICSA 2FMPA 1XC9A 2MUTB 2Q0ZX 2NRZA 1KDHA 1JALA 5ALQA 1V85A 4OO1J 5IILA 3Q8KA 4C8KA 1LV5A 1KL9A 4RQ6A 2WAQC 9ICHA 5IINA 4DSKA 5AI9A 5KFDA 2HOQA 2KE7A 3GV5B 3OGUA 2K89A 1NKEA 3Q8SB 9ICJA 2C22A 4RPZA 3RTVA 3IRUA 4BWJA 1JXEA 5BPCA 5KL1B 1KSPA 2RLTA 3SD7A 5AM0A 5BOLA 2M0NA 1PVRA 5J0SA 2ZJ8A 5J2FA 8ICTA 7ICRA 2YMQA 3B9JA 2JH7A 1L7MA 2QB1A 1UA0A 5CB1A 5EE9A 2PFOA 4EBDA 2ZXIA 5HR6A 3HP6A 2V4QA 9ICGA 1T3NA 3LVWA 2JH1A 1L6NA 2P6UA 3QU4A 3QUBA 5ALHA 4ECQA 2P66A 2W9MA 1SKWA 3BS5B 2KZZA 5AHXA 4Y2RA 2MUTA 2CN1A 1UPHA 1RYUA 3TANA 5KT3A 5DQGA 5KFJA 7ICLA 4PHEA 4CGZA 9ICMA 1QQ5A 3PNCA 4F2SA 5CA7A 1ZD4A 2W7PA 3C1ZA 2K4HA 4QWEA 4DCCA 5B66U 2UVVA 5KFBA 2FLLA 2H3IA 3C2KA 2AU0A 1L3UA 3OTQA 8ICNA 7ICKA 3KOOA 4KLOA 3WK4A 1F5SA 3FYHA 4RT3A 4UW9A 4C4TA 3GU3A 5KFRA 1QSYA 1Z00B 4FE3A 5DLGA 2F44A 5KFHA 1U49A 3AL0B 1ZJMA 3SYZA 2KP7A 4P0QB 3PSTA 4J9PA 2F8KA 1KLNA 2OEHA 1DK2A 1K5OA 2HHSA 2GLEA 4ACOA 5TZVA 2DWQA 3Q8RB 4ECVA 2G08A 2BQUA 5FP0A 4YVZA 2FE9A 3MR2A 3UPQA 5ALXA 2XICA 5G5HA 8ICQA 8ICFA 8ICCA 7ICNA 1UHUA 2LPEA 4R63A 4EX6A 1X6IA 1ZQZA 1KFTA 5KL8B 2XY7A 4DFKA 4AP9A 2BPFA 3BS5A 3NS1A 3BZKA 2YY6A 3M9MB 4KTQA 1WWUA 4F3OA 8ICOA 4DL2A 1ZQJA 4F93B 4QW9A 4DFDA 7ICTA 5L1IA 3WKAA 2ZIVB 2HHQA 1KRPA 2XIDA 2DKXA 1QSSA 1HJPA 8ICEA 3T79A 1OW5A 4RQMA 5AKKA 5AKZA 4O3RA 2HHXA 1O08A 4JWNA 2Y9UA 4HAIA 3I1YA 2A1AA 2Z7JA 2E1EA 3TACB 3BZCA 1V97A 3QU5A 4DOCA 2CRXA 5KFKA 5KFEA 2XY6A 3QX7A 1Z00A 4LZDA 5EE3A 1L3TA 4KLLA 2HBKA 2ZTEA 4P0QA 4DSLA 4KLGA 8ICRA 4DQSA 1RXWA 2BQRA 1CRXA 1ZQIA 4KLDA 3LWLA 2XO7A 5D4BA 2WB1F 3PX6A 2OWOA 1U9LA 1BPBA 2C28A 3BQTA 1TK5A 3KKAC 5L9XA 4CE6A 5DGAA 4R8UB 8ICYA 4DFPA 1ZD2P 3HW8A 2KJ8A 8ICJA 2K4EA 2YX8A 4RQ4A 2OXOA 2EDUA 4QZFA 1JIHA 4RQNA 2CXYA 2FPKA 2F77X 2BCVA 4PJ0U 5J8YA 3RH6A 1VLBA 4M9GA 4YMNA 1NJYA 1NK5A 1PVPA 4DSFA 2D8CA 4F91B 4IQUA 2MU2A 2DFLA 3H8SA 3WKEA 3EPIA 4K4HA 1ZQLA 4Q8EA 8ICPA 1ZQFA 2LYHA 2LYAA 1JXLA 7ICUA 3H0MB 4EX7A 2VA8A 4NLZA 5EE0A 5KFIA 4DLGA 3TQ1A 3DV9A 2AH5A 1N62A 3NASA 3Q8PB 4KLTA 4KLUA 1F0MA 8ICHA 3GFKB 4ECXA 2PFNA 1BPDA 4TUQA 1TK0A 4I27A 1COOA 3G6VA 1N56A 3TADC 4M6WB 1TV9A 2JEGA 4YQWA 4IL6U 5KFWA 4BX9C 4Y2UA 1ZXIA 2EH9A 3GV7B 3HKZC 2VIXA 1N48A 1ZRMA 3G6XA 2L5YA 3C1YA 1ZQWA 3CP8A 4KLJA 2VA3A 4C8NA 4P4PA 4TUSA 3GIIA 2GO7A 2QKQA 9ICIA 3PW2A 1IV8A 4ECUA 5J0PA 3FM9A 5J0WA 1IXRA 4R8UA 2VANA 1NI3A 3JPNA 1YZ6A 1XWLA 3GQCA 3C23A 2JEFA 5AI5A 4F5NA 1TVAA 3QUQA 4UAUA 3MC1A 2K8CB 3QXGA 4FO6A 4YMMA 1XSNA 3ZDCA 1TAMA 3WK7A 3OSNA 4RZRA 4CRXA 4G9BA 2AGOA 3IHQB 1ZQKA 2ZIWB 2W7OA 2R18A 3M9OB 5AIBA 3NVZA 3PVXA 4UB1A 5J2HA 4BWMA 3M9NB 2LM4A 2WF9A 1UA1A 3SAFA 4MF2A 3PMLA 2RP5A 3H0LB 7ICQA 5CJ7A 4M6WA 5CWRA 2ASLA 4PH5A 5J0TA 3EW9A 5F3XB 5HMLA 4DSEA 1SWVA 4DLEA 2BKEA 3C21A 3F53A 4ED7A 2KSOB 2EQYA 5J2IA 1X2IA 1S9FA 2NRVA 2W9CB 3GIMA 5T14A 5ALZA 3AU6A 1BPYA 3RR8A 5ALRA 2MSNA 3Q8LA 4JWMA 4TQRA 5H2FU 1URJA 1GO3F 5F9LA 3CYMA 4YR2A 5KFXA 4RQ1A 5AKLA 3RBDA 2GH1A 9ICPA 3R9KA 4B9MA 5KFGA 3UM9A 4DQRA 1N2XA 2ASDA 2KICA 3NTUA 2GOLA 1ZQSA 1TE2A 3HPOA 1UQVA 2IOFA 3N28A 3I28A 4JV1A 4GFJA 4A8EA 3ZI4A 2ZIWA 3HJEA 5CEHA 2VJ5A 3BJYA 1D9DA 1ZQRA 8ICAA 2IBKA 4B9SA 4PL1A 4C4SA 2ZUCA 3E0FA 1L8LA 2RDIA 1MA7A 3ZD8A 3L4PA 4OJOA 4UATA 4LZGA 4MHVA 2YMPA 4FS1A 3RRGA 2NV3A 1ZD5A 1NJZA 4XQ8A 1A6SA 1DK3A 2J6TA 5L1JA 2YN4A 4KLQA 1SKSA 3NVYA 2PI4A 2KSOA 1T8EA 2RHFA 4OJLA 5DB7A 4YMOA 4EYHB 2W9CA 5KFLA 4F4ZA 2HVHA 1JI7A 5DQHA 4K4IA 5ALGA 1NZPA 2UVRA 4ELVA 4M47A 2O6KA 3QEAZ 4E0DA 2C2EA 5KG1A 1L7OA 1J97A 1D8BA 3V7KA 3GZFA 3OJSA 3PV8A 3GIJA 5ALEA 2HSZA 5ALWA 4M9JA 1NK7A 5KT7A 4QZIA 3K1ZA 1X6JA 2IHMA 5A0LA 4MFAA 3RJIA 4YG2A 1DGSA 5GTHU 2EZYA 1ED1A 1AROP 2K4IA 4UAWA 4F4KA 4I2HA 4QWCA 2W04A 4NJ8A 1MSWD 8ICGA 4RQ8A 1SXDA 3TKAA 1B4FA 1BNPA 4EZ6A 5ALDA 4TURA 4C8MA 4RNMA 4EEKA 1NJWA 4IQVA 2XY5A 5KG4A 1D9FA 4GC7A 5L1MA 4OCZA 5G5GA 1VDVA 1FEZA 1NOMA 2HHWA 4PZOA 3ED5A 4M9LA 2ZTDA 4UARA 2BCUA 2VJ4A 3AM9A 4EELA 4EBCA 8ICWA 4B9LA 4NV0A 5DBCA 2ISPA 5DG9A 4Y2SA 3PR5B 2YB4A 1OXJA 2PFPA 2DPJA 4C8OA 3MFHA 4KN7A 3C28A 7ICOA 1RQLA 3AEVA 3QYPA 9ICQA 2JGAA 3SEIA 5J0QA 1COKA 2Y9TA 5EWFA 1YZ7A 3GIKA 4PGQA 3PMNA 3T3FA 2PKEA 3MDCA 3F2CA 1S76D 2HHUA 4U6PA 1UT5A 1ZQAA 3ALRA 2I6XA 2WAQF 1TKDA 5J2GA 2IOHA 2ZIXB 1NK6A 9ICRA 5DKWA 7ICEA 1ZETA 4Q45A 1LKYB 5HNKA 1MC8A 2G5IB 4Y2VA 1D8LA 5HMMA 1IM4A 3ZDAA 1SZPA 2M9NA 3RJFA 5DB6A 4I2JA 4DL5A 1ZQQA 3N4MB 3CW2C 3RJHA 2HW3A 4I2DA 2W8LA 4O0IA 4M0AA 7ICMA 1J2NA 3V6HA 2DPIA 5KFCA 3L5KA 2ZUDA 2YMMA 4KMOB 3RJKA 2YQEA 5DDMA 3M1YA 1L3SA 1L8OA 1ECWA 3Q8QB 4UB2A 4CDGA 3KBBA 3HT3A 2KMDA 5KG6A 4PPXA 4FFDA 5IIIA 1TK8A 2UVUA 2HBLA 4QZCA 4O3OA 5JRTA 2ASJA 3SZ2A 2Y1JA 4WJ3B 3CNHA 4DQPA 5KFFA 4CNQA 2XCPA 4USAA 3ORYA 3V6JA 2BQ3A 4Y2QA 2K8BB 5KFTA 3ONNA 9ICKA 3JPRA 3C2MA 2KN7A 3MDAA 3IP4B 4YR0A 2ZIXA 2WF8A 5AK5A 3CRXA 5EOZA 2A19A 2KFZA 4M04A 3IM1A 1ZQVA 5J8YC 1VJ5A 1LKYA 3IV6A 5CP2A 3T5JA 4NM1A 4C4RA 5CRXA 3ZDDA 2HI0A 4QZ8A 4QZAA 3IG8A 3PSIA 4KN4A 3VC8A 3N97B 1NK8A 3UXPA 1N60A 1XSLA 3B0XA 1QLNA 1S97A 5DBBA 4ELUA 3T5LA 4JB3A 1L5UA 2BPGA 2YMLA 4DL3A 4RT2A 1BVSA 2HMXA 4CF5A 4M9HA 5AKYA 2OHFA 2BGWA 1ZQMA 5AICA 3DDHA 5IIOA 4ZH4A 4RPYA 2FDRA 1B0XA 5EWGA 3AU2A 1PUZA 3NRZA 4NLCA 4IRCA 4Q43A 4RQ7A 4DOBA 4B9NA 5DBAA 2HHVA 2I5HA 5IIKA 1LVHA 4TQSA 3QU7A 1X9XA 5KFYA 5JU5A 5AI0A 1SWWA 2P6RA 3OHAA 2HCFA 7ICGA 1A0PA 4YXJA 3JPQA 2DF4B 4NL9C 3UMGA 3JPSA 2FPMA 3BQ7A 4OJ6A 5KFOA 1ZD3A 1ZYQA 1QQ6A 4F4XA 9ICOA 1Q46A 4I28A 1S0OA 4EYIB 1ZQHA 1CI4A 4UB8U 4M9NA 4IC9A 2YB1A 5AM2A 4GLXA 2PXIA 3ETRA 3ISDA 1FFVA 5HP4A 3H8WA 1KN5A 4F5OA 4DL6A 4Q44A 1D8YA 2KKVA 2ZIVA 5C0YA 2OCEA 4QZBA 3SR6A 4I2BA 4QIWC 4KLHA 1MN8A 1KW4A 4DQIA 4FZLA 5KFZA 5KG2A 1KEJA 3IDWA 4I2AA 1FO4A 3RJGA 2BDUA 3A0HU 2OH2A 4C7YA 2ZIUB 4NLGA 5KAIU 2XI9A 1LB2B 2W3RA 1S5LU 1PK1B 1T7PA 2KHQA 3ICXA 4Z6DA 4GXIA 1SV0A 3AQEA 9ICNA 2HDOA 2HVIA 5DB9A 1ZQPA 1DGJA 4QIWF 4I2FA 2W43A 4J9MA 5KFNA 5ALOA 4Q8FA 4J9SA 1QQ7A 5KTQA 3RRHA 3LVVA 4J9RA 4ECTA 4UASA 4GIBA 3A0BU 5AM4A 3C5GA 1ZQUA 3JPTA 1QSLA 1V38A 3HKZF 4ED3A 4J9OA 1Z1VA 4DQQA 1SKRA 3ZDEA 3MGIA 2LYBA 3QU2A 4RQ3A 1TFRA 2LI6A 5ALKA 3N7PD 2B21A 3V7LA 4ECSA 4UB6U 4QZHA 3HWTA 3WU2U 2IHNA 3UXNA 2E8PA 1JX4A 3M8SA 2DQNB 2V9WA 4M2YA 1NNLA 4EEYA 3RJJA 5KT6A 1Z4NA 2G09A
chains in the Genus database with same CATH topology
1MN8A 1UHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MN8 A;  1UHU A; 
#chains in the Genus database with same CATH topology
 1X9W A;  1ZOL A;  1RPL A;  5EE1 A;  4ED8 A;  1SZH A;  3EYZ A;  7ICP A;  2ZIU A;  1RG6 A;  5F9N A;  1ZQ1 C;  3NVW A;  1NK0 A;  1PK1 A;  1WCN A;  2KEY A;  1KBU A;  3I76 A;  4LJX A;  2BCS A;  2LKY A;  2FPL A;  4BDP A;  5AKH A;  3KZI U;  1X42 A;  2KVS A;  2K60 A;  1KTQ A;  4UBC A;  2AHO B;  3J81 j;  3MGV A;  5J2D A;  1XNS A;  5KG0 A;  3T5K A;  2YTU A;  3RB3 A;  2WTF A;  4X5V A;  3WKB A;  4UAZ A;  5ALL A;  3RJE A;  3RR7 A;  2BZF A;  1A77 A;  2JRZ A;  3M6K A;  5KT4 A;  3Q8M A;  3K4G A;  3D2N A;  4O5E A;  4F4Y A;  4Z6F A;  3KHR A;  3TAP A;  8ICK A;  4KX5 A;  5ALP A;  3M7D A;  4YD1 A;  4FZN A;  2IOF K;  2DBY A;  3BQ2 A;  2G0A A;  4O3M A;  2P35 A;  2AQ4 A;  4FBU A;  7ICH A;  1S10 A;  2EAN A;  4DL4 A;  1WYG A;  2Y0S C;  1TAQ A;  3PR4 A;  5ALU A;  2K8A A;  4NWI A;  5DG8 A;  3QNM A;  2XVT A;  3UQ0 A;  3RAQ A;  3E58 A;  1XS9 D;  3IN5 A;  4ECR A;  1CEZ A;  1XO0 A;  3RB4 A;  2KJ5 A;  3M6Z A;  2J6U A;  4ED1 A;  3FC4 A;  3BQ0 A;  3MR5 A;  2KHV A;  3HX0 A;  1BNO A;  3RH5 A;  5KNI A;  2ES6 A;  2AGQ A;  1X40 A;  3KD3 A;  5KFU A;  5ALM A;  2W9B B;  4DS4 A;  3LWM A;  2KK0 A;  3H4B A;  4I2I A;  4BXO B;  1PVQ A;  4NLN A;  1ZQE A;  2AQ0 A;  3LYS A;  2Y0S F;  3SI8 A;  4YR3 A;  4F50 A;  4EZ9 A;  4XUS A;  1HIW A;  3N7S C;  4CF3 A;  2NO4 A;  1HEK A;  4JUZ A;  3AMZ A;  3RH4 A;  4DF4 A;  5ALS A;  2Q4T A;  3RF9 A;  2W03 A;  5L1K A;  2ZG6 A;  3D6J A;  2FLN A;  4ECY A;  2NRT A;  4BUG A;  2DKZ A;  3O0F A;  3TFS A;  3MR3 A;  2KIW A;  2FLP A;  1L7P A;  5KFP A;  2XGQ A;  1Z3E B;  2ESE A;  1J2M A;  4PGY A;  3NUQ A;  4Y2X A;  2F1J A;  1V9P A;  3AN1 A;  4QZ9 A;  1JUD A;  5AK6 A;  2LBO A;  3BDP A;  1B43 A;  3PSF A;  3F2B A;  5J0X A;  5J2C A;  5J0O A;  4IR9 A;  4HYK A;  7ICJ A;  3RAX A;  1XU4 A;  2E1F A;  4RPX A;  1JMS A;  2MRL A;  2NO5 A;  3FAH A;  3UMB A;  1DOQ A;  5J2K A;  2KV2 A;  3ZD9 A;  4DFM A;  9ICX A;  4QWD A;  3SAG A;  2W9B A;  2PFQ A;  2WFA A;  4BXO A;  2EAM A;  9ICC A;  3JPO A;  2R8H A;  2FMQ A;  4NXZ A;  2IMW P;  2N1R A;  4J03 A;  4RQ5 A;  3ISC A;  1AQ6 A;  3SV3 A;  3RB0 A;  3KFU F;  4DSI A;  2ALZ A;  1RM6 C;  1RXV A;  3HRD D;  4Z6C A;  4MFF A;  4KLI A;  2KD1 A;  5KG7 A;  3PW7 A;  4O3S A;  1K1Q A;  4ED0 A;  3F5A A;  5EWE A;  5DGB A;  2BPC A;  5AKJ A;  4I2C A;  4PHD A;  3PW5 A;  3NRW A;  2H3V A;  1TAU A;  3GDX A;  1ZRN A;  3HIL A;  3DEE A;  5AM3 A;  3BQ1 A;  4NM2 A;  4DWI A;  8ICB A;  2RRD A;  3D2S A;  5ALI A;  1QTM A;  2KZM A;  5AI4 A;  1ZQG A;  2R8I A;  4F5R A;  2FJ6 A;  2ZXH A;  5DG7 A;  4F5Q A;  2CPR A;  5AM1 A;  4LVS A;  2ZJA A;  3RB6 A;  7ICS A;  3G6Y A;  2BDP A;  2W3S A;  4C0Z A;  3EPG A;  4P2H A;  3WK8 A;  4IR1 A;  3SQI A;  5ALV A;  2QAR B;  3GIL A;  4FBT A;  3C5F A;  1U48 A;  4IRK A;  7ICF A;  2C2R A;  4QW8 A;  2W8K A;  5L1L A;  4O5K A;  5AIA A;  5ALT A;  4DF8 A;  8ICL A;  2E5S A;  3LDA A;  2JV3 A;  4F2R A;  2F3N A;  2E8M A;  1RQN A;  1M6Y A;  3D2Q A;  4J9L A;  4IRD A;  5KT5 A;  5KT2 A;  4I2G A;  4O3P A;  2KIV A;  1UT8 A;  3AQF A;  1DXS A;  4ECW A;  9ICS A;  2F76 X;  1Q3V A;  1SXE A;  3SMV A;  2A1J B;  3PO4 A;  2W54 A;  3QZ7 A;  2HBJ A;  1MQ2 A;  1N63 A;  3V6K A;  2ZTC A;  3QEB Z;  3MBY A;  5K4L A;  1O03 A;  3U26 A;  2B0C A;  3T5H A;  4C8L A;  3QZ8 A;  2OM6 A;  4KX3 A;  4Y2Y A;  3RFA A;  1A76 A;  1X9M A;  4YCX A;  4MEX A;  1K1S A;  1NK9 A;  9ICT A;  5J0Y A;  8ICM A;  3ETL A;  5J0U A;  2EAP A;  3PX0 A;  4I29 A;  4MFC A;  5B5E U;  1S0M A;  5KFV A;  2QAR A;  4U7C A;  4NLB A;  4P0P B;  1ZQY A;  4CCH A;  5AK4 A;  3EWA A;  1FIQ A;  2WF5 A;  2ISO A;  2JZB B;  5HHI A;  5J0R A;  1MQ3 A;  3GV8 B;  4BJQ A;  3F2D A;  4YP3 A;  3KHG A;  3QU9 A;  1WUD A;  2BCR A;  5AKI A;  4AYB C;  2JEI A;  9ICA A;  2B6G A;  4B9V A;  3EZ5 A;  1RYS A;  2C2D A;  4EBE A;  1B22 A;  4FS2 A;  1BPX A;  2A1J A;  4QWA A;  1RYR A;  2VKQ A;  5KFQ A;  3PX4 A;  5KFS A;  1JRO A;  2JXJ A;  1SV0 C;  4BGD A;  4B9T A;  4YXM A;  4ED2 A;  2WB1 C;  1T3Q A;  4F8R A;  1IG6 A;  4GXK A;  1WWV A;  4IQW A;  3MFI A;  3FDS A;  2G5H B;  4AYB F;  2NYV A;  4US8 A;  9ICU A;  4IS7 A;  3TAQ A;  1KFD A;  5AI8 A;  2R8K A;  2DUY A;  4QJF B;  3RBE A;  5DB8 A;  3M8R A;  5D49 A;  3WKC A;  4RNN A;  1C7Y A;  2GWS A;  4R65 A;  4P4M A;  8ICV A;  4ZOH C;  2AJQ A;  2R8J A;  2WF6 A;  3OPX A;  4P0P A;  3LK9 A;  3K1R B;  3WK6 A;  4O3N A;  3UQ2 A;  4O3Q A;  4ICA A;  2JZB A;  4C80 A;  4UAV A;  5ALF A;  3MR6 A;  4Y2J A;  4J9Q A;  4KIT B;  7ICI A;  4J9N A;  4F71 A;  3C29 A;  8ICU A;  4ECZ A;  9ICB A;  1ZQN A;  5J2A A;  3MGH A;  2H3F A;  2EZX A;  3QUT A;  1U4B A;  4KLE A;  2XGP A;  2I9G A;  2IA6 A;  3H7I A;  5GTI U;  3K75 D;  4O9M A;  9ICF A;  1NKB A;  3QE9 Y;  2D6F C;  3N7R C;  4RU9 A;  4UBB A;  2LMR A;  3MAB A;  1HUO A;  2RDJ A;  2F2A B;  3THV A;  2R8G A;  4K4G A;  5JUM A;  4QZE A;  5KG5 A;  1ZQC A;  2LHT A;  4GXJ A;  2A3V A;  1BGX T;  2F1H A;  4RNO A;  5ALY A;  4B9U A;  2NRW A;  2UVW A;  1S77 D;  5ALN A;  2JR5 A;  4RQ2 A;  3PW4 A;  1S8O A;  2OYY A;  4PZN A;  1NK4 A;  2QB0 B;  4DEZ A;  2WF7 A;  2HOF A;  1U47 A;  2JHD A;  1XO1 A;  5E79 U;  3TAR A;  5J2E A;  5KG3 A;  3SEN A;  1U45 A;  4YD2 A;  5HR7 A;  5DQI A;  4OJ5 A;  2BHN A;  5KFM A;  4QNL A;  4Y2T A;  4KMU A;  1ZQB A;  5AKE A;  1Q8K A;  4DOA A;  1N61 A;  5KFA A;  5CHG A;  2FI1 A;  4MEY A;  1BPZ A;  1SIJ A;  5ALJ A;  3KKA A;  4NL9 A;  2Y1I A;  2K4P A;  3PZP A;  2QLT A;  4JMU A;  4J9K A;  4CF4 A;  4JK1 A;  4KLS A;  4PHP A;  1JRP A;  1YT3 A;  4XRH A;  3B0Y A;  4DO9 A;  2H3Z A;  1X66 A;  2AGP A;  3OSP A;  4RUA A;  4I2E A;  1Z19 A;  1ZQO A;  2DGZ A;  5TIS U;  1KFS A;  3H4D A;  4UB3 A;  9ICW A;  2F8L A;  5DLF A;  4OD0 A;  5IIM A;  4Y2P A;  8ICX A;  1N5W A;  3PO5 A;  1P7D A;  3V7J A;  2JEJ A;  3WK9 A;  2QB0 A;  1L3V A;  3F5E A;  5AKX A;  1NKC A;  3KHH A;  2LM1 A;  1T4G A;  8ICI A;  4C7Z A;  1DRG A;  3TAD A;  4DL7 A;  2XCA A;  1RZT A;  2WHE A;  4UB5 A;  1ZJN A;  1NJX A;  3KHL A;  2PMZ C;  1UCV A;  4DSJ A;  1PK3 A;  4QWB A;  3SAH A;  4MF8 A;  3SV4 A;  1SGG A;  5CR0 A;  1OUQ A;  1F44 A;  5D46 A;  1XSP A;  9ICV A;  2G06 A;  1T94 A;  2I1Q A;  1RDF A;  1Y88 A;  1SV4 A;  2W55 A;  3E2E A;  5HHH A;  5J2J A;  4QZG A;  2W11 A;  3ZDB A;  8ICZ A;  4JV0 A;  4JV2 A;  1NZB A;  2PI5 A;  3QUC A;  4PHA A;  5J29 A;  3NVV A;  1X9S A;  1WG8 A;  2PMZ F;  1WCL A;  1SL2 A;  4B6J A;  3TI0 A;  3VCB A;  1H38 A;  4OJP A;  5AKG A;  2KJ9 A;  2E8O A;  1JN3 A;  2MAX A;  1L7N A;  2ZJ5 A;  5KAF U;  3OJU A;  1Q3U A;  2EAO A;  4RUC A;  2J6S A;  1ZQX A;  4IQT A;  3KZX A;  1Z4O A;  2EZZ A;  2H5X A;  3C2L A;  1S0V A;  3H8M A;  2KKP A;  3PSP A;  4KLM A;  4R64 A;  3PY8 A;  1Z1B A;  5IIJ A;  2F1I A;  4Z6E A;  2HHT A;  2KG5 A;  2VA2 A;  2KZ3 A;  3IG5 A;  4GC6 A;  4UQG A;  1ZQT A;  3S6J A;  2BR0 A;  1BPE A;  4DFJ A;  1ZQD A;  3BS7 A;  5AK3 A;  4EEN A;  4XA5 A;  4KLF A;  2MA1 A;  4NLK A;  2ZUB A;  3NGD A;  4F92 B;  5AM5 A;  3ISB A;  1KQQ A;  1QCK A;  3H40 A;  2W9A A;  9ICE A;  7ICV A;  2AXT U;  1QH9 A;  3V72 A;  4US9 A;  1CUK A;  4PL2 A;  3L3F X;  2H3Q A;  4F72 A;  3H0R B;  2KTQ A;  4R66 A;  4NY8 A;  1SL0 A;  2E3T A;  2BCQ A;  1FFU A;  4YFK A;  4ED6 A;  1PZN A;  4TUP A;  2FMS A;  2KOB A;  2HBM A;  2KNJ A;  1HUZ A;  2HOI A;  4YN4 A;  2RQ5 A;  9ICL A;  3OHB A;  5J2B A;  3WK5 A;  4RQ0 A;  2JMG A;  3UXO A;  3AUO A;  4UB4 A;  2D3D A;  3KTQ A;  2G07 A;  3UMC A;  4UAY A;  3WKD A;  1IIP A;  2XC9 A;  1C20 A;  2E8N A;  2ODG A;  4DS5 A;  5AI6 A;  2KVC A;  3JPP A;  2KFN A;  4QZD A;  3EUB 2;  4P4O A;  4FZM A;  1S0N A;  4PGX A;  4F5P A;  4G3I A;  2V4R A;  5JTI A;  2DL0 A;  3TFR A;  4F4W A;  5C5J A;  2NRX A;  1SB3 C;  3H8J A;  5BOM A;  4O5C A;  1KKX A;  3PW0 A;  5DDY A;  1EXN A;  4ELT A;  2ATL A;  1N5X A;  1SL1 A;  8ICS A;  2FMP A;  1XC9 A;  2MUT B;  2Q0Z X;  2NRZ A;  1KDH A;  1JAL A;  5ALQ A;  1V85 A;  4OO1 J;  5IIL A;  3Q8K A;  4C8K A;  1LV5 A;  1KL9 A;  4RQ6 A;  2WAQ C;  9ICH A;  5IIN A;  4DSK A;  5AI9 A;  5KFD A;  2HOQ A;  2KE7 A;  3GV5 B;  3OGU A;  2K89 A;  1NKE A;  3Q8S B;  9ICJ A;  2C22 A;  4RPZ A;  3RTV A;  3IRU A;  4BWJ A;  1JXE A;  5BPC A;  5KL1 B;  1KSP A;  2RLT A;  3SD7 A;  5AM0 A;  5BOL A;  2M0N A;  1PVR A;  5J0S A;  2ZJ8 A;  5J2F A;  8ICT A;  7ICR A;  2YMQ A;  3B9J A;  2JH7 A;  1L7M A;  2QB1 A;  1UA0 A;  5CB1 A;  5EE9 A;  2PFO A;  4EBD A;  2ZXI A;  5HR6 A;  3HP6 A;  2V4Q A;  9ICG A;  1T3N A;  3LVW A;  2JH1 A;  1L6N A;  2P6U A;  3QU4 A;  3QUB A;  5ALH A;  4ECQ A;  2P66 A;  2W9M A;  1SKW A;  3BS5 B;  2KZZ A;  5AHX A;  4Y2R A;  2MUT A;  2CN1 A;  1UPH A;  1RYU A;  3TAN A;  5KT3 A;  5DQG A;  5KFJ A;  7ICL A;  4PHE A;  4CGZ A;  9ICM A;  1QQ5 A;  3PNC A;  4F2S A;  5CA7 A;  1ZD4 A;  2W7P A;  3C1Z A;  2K4H A;  4QWE A;  4DCC A;  5B66 U;  2UVV A;  5KFB A;  2FLL A;  2H3I A;  3C2K A;  2AU0 A;  1L3U A;  3OTQ A;  8ICN A;  7ICK A;  3KOO A;  4KLO A;  3WK4 A;  1F5S A;  3FYH A;  4RT3 A;  4UW9 A;  4C4T A;  3GU3 A;  5KFR A;  1QSY A;  1Z00 B;  4FE3 A;  5DLG A;  2F44 A;  5KFH A;  1U49 A;  3AL0 B;  1ZJM A;  3SYZ A;  2KP7 A;  4P0Q B;  3PST A;  4J9P A;  2F8K A;  1KLN A;  2OEH A;  1DK2 A;  1K5O A;  2HHS A;  2GLE A;  4ACO A;  5TZV A;  2DWQ A;  3Q8R B;  4ECV A;  2G08 A;  2BQU A;  5FP0 A;  4YVZ A;  2FE9 A;  3MR2 A;  3UPQ A;  5ALX A;  2XIC A;  5G5H A;  8ICQ A;  8ICF A;  8ICC A;  7ICN A;  1UHU A;  2LPE A;  4R63 A;  4EX6 A;  1X6I A;  1ZQZ A;  1KFT A;  5KL8 B;  2XY7 A;  4DFK A;  4AP9 A;  2BPF A;  3BS5 A;  3NS1 A;  3BZK A;  2YY6 A;  3M9M B;  4KTQ A;  1WWU A;  4F3O A;  8ICO A;  4DL2 A;  1ZQJ A;  4F93 B;  4QW9 A;  4DFD A;  7ICT A;  5L1I A;  3WKA A;  2ZIV B;  2HHQ A;  1KRP A;  2XID A;  2DKX A;  1QSS A;  1HJP A;  8ICE A;  3T79 A;  1OW5 A;  4RQM A;  5AKK A;  5AKZ A;  4O3R A;  2HHX A;  1O08 A;  4JWN A;  2Y9U A;  4HAI A;  3I1Y A;  2A1A A;  2Z7J A;  2E1E A;  3TAC B;  3BZC A;  1V97 A;  3QU5 A;  4DOC A;  2CRX A;  5KFK A;  5KFE A;  2XY6 A;  3QX7 A;  1Z00 A;  4LZD A;  5EE3 A;  1L3T A;  4KLL A;  2HBK A;  2ZTE A;  4P0Q A;  4DSL A;  4KLG A;  8ICR A;  4DQS A;  1RXW A;  2BQR A;  1CRX A;  1ZQI A;  4KLD A;  3LWL A;  2XO7 A;  5D4B A;  2WB1 F;  3PX6 A;  2OWO A;  1U9L A;  1BPB A;  2C28 A;  3BQT A;  1TK5 A;  3KKA C;  5L9X A;  4CE6 A;  5DGA A;  4R8U B;  8ICY A;  4DFP A;  1ZD2 P;  3HW8 A;  2KJ8 A;  8ICJ A;  2K4E A;  2YX8 A;  4RQ4 A;  2OXO A;  2EDU A;  4QZF A;  1JIH A;  4RQN A;  2CXY A;  2FPK A;  2F77 X;  2BCV A;  4PJ0 U;  5J8Y A;  3RH6 A;  1VLB A;  4M9G A;  4YMN A;  1NJY A;  1NK5 A;  1PVP A;  4DSF A;  2D8C A;  4F91 B;  4IQU A;  2MU2 A;  2DFL A;  3H8S A;  3WKE A;  3EPI A;  4K4H A;  1ZQL A;  4Q8E A;  8ICP A;  1ZQF A;  2LYH A;  2LYA A;  1JXL A;  7ICU A;  3H0M B;  4EX7 A;  2VA8 A;  4NLZ A;  5EE0 A;  5KFI A;  4DLG A;  3TQ1 A;  3DV9 A;  2AH5 A;  1N62 A;  3NAS A;  3Q8P B;  4KLT A;  4KLU A;  1F0M A;  8ICH A;  3GFK B;  4ECX A;  2PFN A;  1BPD A;  4TUQ A;  1TK0 A;  4I27 A;  1COO A;  3G6V A;  1N56 A;  3TAD C;  4M6W B;  1TV9 A;  2JEG A;  4YQW A;  4IL6 U;  5KFW A;  4BX9 C;  4Y2U A;  1ZXI A;  2EH9 A;  3GV7 B;  3HKZ C;  2VIX A;  1N48 A;  1ZRM A;  3G6X A;  2L5Y A;  3C1Y A;  1ZQW A;  3CP8 A;  4KLJ A;  2VA3 A;  4C8N A;  4P4P A;  4TUS A;  3GII A;  2GO7 A;  2QKQ A;  9ICI A;  3PW2 A;  1IV8 A;  4ECU A;  5J0P A;  3FM9 A;  5J0W A;  1IXR A;  4R8U A;  2VAN A;  1NI3 A;  3JPN A;  1YZ6 A;  1XWL A;  3GQC A;  3C23 A;  2JEF A;  5AI5 A;  4F5N A;  1TVA A;  3QUQ A;  4UAU A;  3MC1 A;  2K8C B;  3QXG A;  4FO6 A;  4YMM A;  1XSN A;  3ZDC A;  1TAM A;  3WK7 A;  3OSN A;  4RZR A;  4CRX A;  4G9B A;  2AGO A;  3IHQ B;  1ZQK A;  2ZIW B;  2W7O A;  2R18 A;  3M9O B;  5AIB A;  3NVZ A;  3PVX A;  4UB1 A;  5J2H A;  4BWM A;  3M9N B;  2LM4 A;  2WF9 A;  1UA1 A;  3SAF A;  4MF2 A;  3PML A;  2RP5 A;  3H0L B;  7ICQ A;  5CJ7 A;  4M6W A;  5CWR A;  2ASL A;  4PH5 A;  5J0T A;  3EW9 A;  5F3X B;  5HML A;  4DSE A;  1SWV A;  4DLE A;  2BKE A;  3C21 A;  3F53 A;  4ED7 A;  2KSO B;  2EQY A;  5J2I A;  1X2I A;  1S9F A;  2NRV A;  2W9C B;  3GIM A;  5T14 A;  5ALZ A;  3AU6 A;  1BPY A;  3RR8 A;  5ALR A;  2MSN A;  3Q8L A;  4JWM A;  4TQR A;  5H2F U;  1URJ A;  1GO3 F;  5F9L A;  3CYM A;  4YR2 A;  5KFX A;  4RQ1 A;  5AKL A;  3RBD A;  2GH1 A;  9ICP A;  3R9K A;  4B9M A;  5KFG A;  3UM9 A;  4DQR A;  1N2X A;  2ASD A;  2KIC A;  3NTU A;  2GOL A;  1ZQS A;  1TE2 A;  3HPO A;  1UQV A;  2IOF A;  3N28 A;  3I28 A;  4JV1 A;  4GFJ A;  4A8E A;  3ZI4 A;  2ZIW A;  3HJE A;  5CEH A;  2VJ5 A;  3BJY A;  1D9D A;  1ZQR A;  8ICA A;  2IBK A;  4B9S A;  4PL1 A;  4C4S A;  2ZUC A;  3E0F A;  1L8L A;  2RDI A;  1MA7 A;  3ZD8 A;  3L4P A;  4OJO A;  4UAT A;  4LZG A;  4MHV A;  2YMP A;  4FS1 A;  3RRG A;  2NV3 A;  1ZD5 A;  1NJZ A;  4XQ8 A;  1A6S A;  1DK3 A;  2J6T A;  5L1J A;  2YN4 A;  4KLQ A;  1SKS A;  3NVY A;  2PI4 A;  2KSO A;  1T8E A;  2RHF A;  4OJL A;  5DB7 A;  4YMO A;  4EYH B;  2W9C A;  5KFL A;  4F4Z A;  2HVH A;  1JI7 A;  5DQH A;  4K4I A;  5ALG A;  1NZP A;  2UVR A;  4ELV A;  4M47 A;  2O6K A;  3QEA Z;  4E0D A;  2C2E A;  5KG1 A;  1L7O A;  1J97 A;  1D8B A;  3V7K A;  3GZF A;  3OJS A;  3PV8 A;  3GIJ A;  5ALE A;  2HSZ A;  5ALW A;  4M9J A;  1NK7 A;  5KT7 A;  4QZI A;  3K1Z A;  1X6J A;  2IHM A;  5A0L A;  4MFA A;  3RJI A;  4YG2 A;  1DGS A;  5GTH U;  2EZY A;  1ED1 A;  1ARO P;  2K4I A;  4UAW A;  4F4K A;  4I2H A;  4QWC A;  2W04 A;  4NJ8 A;  1MSW D;  8ICG A;  4RQ8 A;  1SXD A;  3TKA A;  1B4F A;  1BNP A;  4EZ6 A;  5ALD A;  4TUR A;  4C8M A;  4RNM A;  4EEK A;  1NJW A;  4IQV A;  2XY5 A;  5KG4 A;  1D9F A;  4GC7 A;  5L1M A;  4OCZ A;  5G5G A;  1VDV A;  1FEZ A;  1NOM A;  2HHW A;  4PZO A;  3ED5 A;  4M9L A;  2ZTD A;  4UAR A;  2BCU A;  2VJ4 A;  3AM9 A;  4EEL A;  4EBC A;  8ICW A;  4B9L A;  4NV0 A;  5DBC A;  2ISP A;  5DG9 A;  4Y2S A;  3PR5 B;  2YB4 A;  1OXJ A;  2PFP A;  2DPJ A;  4C8O A;  3MFH A;  4KN7 A;  3C28 A;  7ICO A;  1RQL A;  3AEV A;  3QYP A;  9ICQ A;  2JGA A;  3SEI A;  5J0Q A;  1COK A;  2Y9T A;  5EWF A;  1YZ7 A;  3GIK A;  4PGQ A;  3PMN A;  3T3F A;  2PKE A;  3MDC A;  3F2C A;  1S76 D;  2HHU A;  4U6P A;  1UT5 A;  1ZQA A;  3ALR A;  2I6X A;  2WAQ F;  1TKD A;  5J2G A;  2IOH A;  2ZIX B;  1NK6 A;  9ICR A;  5DKW A;  7ICE A;  1ZET A;  4Q45 A;  1LKY B;  5HNK A;  1MC8 A;  2G5I B;  4Y2V A;  1D8L A;  5HMM A;  1IM4 A;  3ZDA A;  1SZP A;  2M9N A;  3RJF A;  5DB6 A;  4I2J A;  4DL5 A;  1ZQQ A;  3N4M B;  3CW2 C;  3RJH A;  2HW3 A;  4I2D A;  2W8L A;  4O0I A;  4M0A A;  7ICM A;  1J2N A;  3V6H A;  2DPI A;  5KFC A;  3L5K A;  2ZUD A;  2YMM A;  4KMO B;  3RJK A;  2YQE A;  5DDM A;  3M1Y A;  1L3S A;  1L8O A;  1ECW A;  3Q8Q B;  4UB2 A;  4CDG A;  3KBB A;  3HT3 A;  2KMD A;  5KG6 A;  4PPX A;  4FFD A;  5III A;  1TK8 A;  2UVU A;  2HBL A;  4QZC A;  4O3O A;  5JRT A;  2ASJ A;  3SZ2 A;  2Y1J A;  4WJ3 B;  3CNH A;  4DQP A;  5KFF A;  4CNQ A;  2XCP A;  4USA A;  3ORY A;  3V6J A;  2BQ3 A;  4Y2Q A;  2K8B B;  5KFT A;  3ONN A;  9ICK A;  3JPR A;  3C2M A;  2KN7 A;  3MDA A;  3IP4 B;  4YR0 A;  2ZIX A;  2WF8 A;  5AK5 A;  3CRX A;  5EOZ A;  2A19 A;  2KFZ A;  4M04 A;  3IM1 A;  1ZQV A;  5J8Y C;  1VJ5 A;  1LKY A;  3IV6 A;  5CP2 A;  3T5J A;  4NM1 A;  4C4R A;  5CRX A;  3ZDD A;  2HI0 A;  4QZ8 A;  4QZA A;  3IG8 A;  3PSI A;  4KN4 A;  3VC8 A;  3N97 B;  1NK8 A;  3UXP A;  1N60 A;  1XSL A;  3B0X A;  1QLN A;  1S97 A;  5DBB A;  4ELU A;  3T5L A;  4JB3 A;  1L5U A;  2BPG A;  2YML A;  4DL3 A;  4RT2 A;  1BVS A;  2HMX A;  4CF5 A;  4M9H A;  5AKY A;  2OHF A;  2BGW A;  1ZQM A;  5AIC A;  3DDH A;  5IIO A;  4ZH4 A;  4RPY A;  2FDR A;  1B0X A;  5EWG A;  3AU2 A;  1PUZ A;  3NRZ A;  4NLC A;  4IRC A;  4Q43 A;  4RQ7 A;  4DOB A;  4B9N A;  5DBA A;  2HHV A;  2I5H A;  5IIK A;  1LVH A;  4TQS A;  3QU7 A;  1X9X A;  5KFY A;  5JU5 A;  5AI0 A;  1SWW A;  2P6R A;  3OHA A;  2HCF A;  7ICG A;  1A0P A;  4YXJ A;  3JPQ A;  2DF4 B;  4NL9 C;  3UMG A;  3JPS A;  2FPM A;  3BQ7 A;  4OJ6 A;  5KFO A;  1ZD3 A;  1ZYQ A;  1QQ6 A;  4F4X A;  9ICO A;  1Q46 A;  4I28 A;  1S0O A;  4EYI B;  1ZQH A;  1CI4 A;  4UB8 U;  4M9N A;  4IC9 A;  2YB1 A;  5AM2 A;  4GLX A;  2PXI A;  3ETR A;  3ISD A;  1FFV A;  5HP4 A;  3H8W A;  1KN5 A;  4F5O A;  4DL6 A;  4Q44 A;  1D8Y A;  2KKV A;  2ZIV A;  5C0Y A;  2OCE A;  4QZB A;  3SR6 A;  4I2B A;  4QIW C;  4KLH A;  1MN8 A;  1KW4 A;  4DQI A;  4FZL A;  5KFZ A;  5KG2 A;  1KEJ A;  3IDW A;  4I2A A;  1FO4 A;  3RJG A;  2BDU A;  3A0H U;  2OH2 A;  4C7Y A;  2ZIU B;  4NLG A;  5KAI U;  2XI9 A;  1LB2 B;  2W3R A;  1S5L U;  1PK1 B;  1T7P A;  2KHQ A;  3ICX A;  4Z6D A;  4GXI A;  1SV0 A;  3AQE A;  9ICN A;  2HDO A;  2HVI A;  5DB9 A;  1ZQP A;  1DGJ A;  4QIW F;  4I2F A;  2W43 A;  4J9M A;  5KFN A;  5ALO A;  4Q8F A;  4J9S A;  1QQ7 A;  5KTQ A;  3RRH A;  3LVV A;  4J9R A;  4ECT A;  4UAS A;  4GIB A;  3A0B U;  5AM4 A;  3C5G A;  1ZQU A;  3JPT A;  1QSL A;  1V38 A;  3HKZ F;  4ED3 A;  4J9O A;  1Z1V A;  4DQQ A;  1SKR A;  3ZDE A;  3MGI A;  2LYB A;  3QU2 A;  4RQ3 A;  1TFR A;  2LI6 A;  5ALK A;  3N7P D;  2B21 A;  3V7L A;  4ECS A;  4UB6 U;  4QZH A;  3HWT A;  3WU2 U;  2IHN A;  3UXN A;  2E8P A;  1JX4 A;  3M8S A;  2DQN B;  2V9W A;  4M2Y A;  1NNL A;  4EEY A;  3RJJ A;  5KT6 A;  1Z4N A;  2G09 A; 
#chains in the Genus database with same CATH homology
 1MN8 A;  1UHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...