1MN8A

Structure of moloney murine leukaemia virus matrix protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
QTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Core protein p15
publication title Atomic resolution structure of Moloney murine leukaemia virus matrix protein and its relationship to other retroviral matrix proteins.
pubmed doi rcsb
source organism Moloney murine leukemia virus
total genus 32
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.180 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Gamma-retroviral matrix domain 1mn8A00
1UHUA 1MN8A
chains in the Genus database with same CATH superfamily
1MC8A 1XSNA 4OJPA 2KE7A 2BCVA 4I2BA 5CEHA 4NM1A 1Z4NA 5KFJA 1J2NA 5AKYA 2BZFA 3C21A 1Z1VA 3M8RA 4DLEA 3V7LA 1ZQIA 2RLTA 3E2EA 5KG3A 5IINA 4B9NA 3E0FA 3RJIA 1ZQBA 2I5HA 5ALGA 4EZ6A 4I2AA 5C5JA 3KHLA 1UT8A 2DPJA 1HJPA 2KJ8A 1S76D 3PNCA 3AU6A 4F8RA 1OUQA 1JROA 5J2CA 4CGZA 4DEZA 4DF4A 2ISPA 3M8SA 8ICNA 2DF4B 3F5EA 5CP2A 2ZTEA 1TK8A 4KLSA 9ICCA 5B66U 5E79U 1XO0A 5DLGA 3UXNA 3C2KA 3RRHA 4KLTA 5J0OA 4R63A 3GZFA 1ZQYA 1D9FA 1KFTA 2BKEA 5HHIA 3JPSA 3GV5B 1XWLA 4YP3A 3PMNA 5TISU 3UMCA 2WB1C 1PVPA 1WG8A 1MSWD 4KLUA 2JRZA 3TACB 1ZRNA 3FM9A 4DSEA 2FPMA 3TAPA 1CI4A 4NL9C 2KTQA 3TI0A 2E8NA 5AM4A 4PGYA 5KFVA 1D8BA 5KFOA 3ZI4A 1V38A 3BQTA 3VC8A 2QB0B 4GIBA 3SMVA 1XC9A 3RJGA 5KFXA 5AK5A 3KKAA 7ICOA 1D8YA 1CUKA 3RR7A 2F1JA 8ICWA 2EQYA 1JALA 1YZ7A 1SL0A 3C2LA 5KFDA 4YN4A 2HBLA 1SKSA 5CB1A 4RT2A 4K4GA 5J0RA 5AIAA 2IOFA 1IM4A 4Y2RA 2W9CB 2EZZA 1K1SA 1NK6A 4DQSA 2ES6A 4DSKA 4QZ8A 2W9BB 1WCNA 1NK5A 2K4IA 1T7PA 3KOOA 8ICBA 4EBEA 3GQCA 3ORYA 2W8LA 1NK4A 4QWEA 1L3VA 9ICNA 3I76A 1L7MA 3ZDBA 4B6JA 1ZYQA 2HBJA 1ZQGA 9ICMA 1ZJMA 4ECQA 3IRUA 1HUOA 7ICSA 5L1LA 4O3PA 5DQIA 3OSNA 5KFIA 4ECWA 2WF7A 2C2RA 2LHTA 2YN4A 1JMSA 4Y2XA 4RQ0A 1TVAA 4DQIA 7ICNA 4NLGA 1ZQNA 1U9LA 1ZQOA 5KFMA 2W7OA 1X9WA 4ED6A 4ELVA 4X5VA 3CRXA 4USAA 3N7PD 5HR7A 4J9OA 1PVQA 4US8A 2EDUA 2JXJA 3WKBA 2PI5A 3JPNA 2LM1A 4UB2A 1ZQMA 2KHQA 1MQ2A 5DG8A 3RB4A 2F1HA 5J2EA 5KT5A 8ICZA 4RNMA 2B6GA 1D9DA 5KFKA 4KLHA 2LBOA 2YTUA 2ODGA 1NJWA 3OJSA 5HHHA 2XY6A 3TADA 4QZEA 2CRXA 3WKDA 4RU9A 4P0PB 4C4SA 3GIIA 3CP8A 1S5LU 5J0SA 1ZQJA 5KFTA 1KTQA 9ICOA 1UA0A 5IIJA 2EAPA 1TKDA 3HILA 8ICXA 2KKPA 1JXLA 2V4RA 2W54A 4M47A 2H3QA 2A3VA 3T5JA 2JZBA 3SD7A 3OHBA 1NK8A 8ICLA 2UVWA 8ICUA 3QX7A 1Z3EB 3LVVA 4R8UB 2G08A 4O9MA 4O3SA 1S0OA 1U48A 2NRZA 2FPKA 4GXIA 4KN7A 3GU3A 4ED1A 1F0MA 4ECSA 4JWMA 4KLIA 4QIWC 1SXDA 8ICFA 2J6TA 4YXMA 5J2AA 4DSFA 2DGZA 3QXGA 4LZGA 3EPGA 3DEEA 2O6KA 1SGGA 1BPBA 2ZUDA 2W9CA 9ICGA 1NOMA 3H4DA 3N4MB 5ALIA 3QE9Y 4MFAA 2ZIXB 2EH9A 4F50A 3RJJA 5KFLA 4ECRA 4QZ9A 4AP9A 1J2MA 5ALPA 1D8LA 4DL6A 2ZTDA 4NY8A 2GOLA 2MUTA 9ICJA 5J0PA 3NRWA 1FO4A 1S97A 4B9VA 4NLZA 2ZG6A 3SZ2A 2KHVA 3DV9A 3O0FA 1ZQAA 2OCEA 1PVRA 4P4MA 4DFPA 2P66A 4UB1A 3ZDEA 5J0TA 3G6XA 1WWUA 2FPLA 5HNKA 1F44A 1OW5A 4CDGA 4DL2A 1ZQSA 2EANA 3K1ZA 4G3IA 3WKEA 3NTUA 1B4FA 4U7CA 3QUQA 4UAZA 5ALHA 4QJFB 5ALMA 4NLBA 3MGIA 3LVWA 4QWAA 1QLNA 3KHGA 9ICEA 5ALVA 2MRLA 3OTQA 4C8MA 3IV6A 1T3NA 1V85A 2YMLA 3J81j 2FDRA 1T94A 4F92B 4XQ8A 3Q8PB 3LWMA 3V7KA 3NVWA 4WJ3B 4DFDA 2Y1JA 2KEYA 2F8KA 3MR5A 3QYPA 4ECZA 4Y2UA 4O5CA 4Q45A 4F3OA 2R8JA 2OWOA 2YB1A 2LPEA 5KAFU 2KOBA 3RB0A 5KTQA 3RR8A 3UMGA 5J2JA 4ECXA 1ZQQA 7ICVA 4RQMA 4RQ1A 1IIPA 4Z6EA 4EX7A 3C2MA 1M6YA 4KLGA 3N7SC 1KDHA 1CEZA 2DUYA 4B9MA 2MAXA 2LM4A 2VJ5A 1P7DA 1BNOA 4PGQA 3T79A 2W55A 5KFUA 5IILA 4UB8U 1V9PA 1UQVA 3QEAZ 4BX9C 4LVSA 2WAQF 3JPRA 3THVA 2ASJA 5ALKA 4O0IA 5KFAA 1HIWA 3MDCA 2YMMA 4RQ2A 2KG5A 3NVYA 1DOQA 3BQ2A 3SAFA 2XI9A 4MF8A 1S0NA 1JIHA 2LMRA 3HKZC 2WHEA 1DRGA 2BHNA 3BQ1A 5DB7A 2FMPA 3SENA 2A1AA 3LWLA 1RXVA 4Q43A 3WK8A 7ICFA 2AHOB 2MSNA 3WK7A 3OSPA 9ICAA 1SKRA 4O5EA 4RPXA 4KLEA 1COKA 1S0MA 4C8NA 1N61A 1KEJA 5J0XA 3EYZA 1X40A 3PW5A 2EZYA 3M9NB 1BGXT 4FS1A 2JEJA 4F5RA 1L8OA 4CF3A 4PHPA 4Y2YA 4YR2A 2LYAA 9ICKA 2D6FC 3F2CA 5J2HA 4KITB 2PFOA 1O08A 4QZCA 5CA7A 3LDAA 3LK9A 2G5HB 2KNJA 3N7RC 1N56A 5KT7A 4C0ZA 2W04A 1ZQXA 3RB6A 2BPFA 4G9BA 4DOCA 4FBUA 3T5KA 2WF6A 3RF9A 1NJZA 2I9GA 1L7PA 2QB1A 1NKBA 2XGQA 4NJ8A 4QWDA 4Q8EA 2F1IA 4HAIA 3M9OB 5AICA 5DG9A 2GLEA 7ICTA 5AM0A 4PHAA 3RAQA 2YMPA 3KZIU 4DL5A 4O3MA 2I1QA 1SB3C 5KG6A 1ZD3A 1NK9A 3K1RB 4EEYA 4UBCA 4C8LA 3KBBA 2AH5A 3PX4A 5DG7A 4FE3A 4KMOB 3AN1A 2DBYA 2HDOA 3V72A 3ICXA 4IR9A 4KTQA 2ZXIA 4UBBA 5L1IA 4F2SA 1Y88A 3GILA 3D6JA 1Z00A 4DL4A 4IQUA 4OJ5A 1KQQA 4JV0A 2BCUA 1VJ5A 2ZJ8A 2RQ5A 3N97B 2AU0A 8ICEA 4DOAA 2NRVA 2V9WA 3KD3A 4KLOA 5DGAA 1S9FA 2G5IB 4K4HA 4ED8A 2Q0ZX 2YX8A 2G0AA 2W03A 3MC1A 4UB3A 7ICPA 5J0UA 3PSIA 8ICTA 2JGAA 4UW9A 3DDHA 2IOFK 2ASLA 4MEYA 5AHXA 4FFDA 1BPXA 5CJ7A 1KFSA 4PGXA 1Q46A 2HSZA 2ZJAA 3VCBA 3NRZA 2D8CA 2H5XA 1B0XA 3AMZA 8ICHA 4KX5A 5KL8B 3ETLA 4US9A 5JU5A 3K75D 5KG1A 3HP6A 2HHUA 5J8YA 1S10A 4CRXA 2MU2A 3MABA 2KK0A 2WTFA 2LYHA 1RZTA 1NKCA 1KW4A 3KHRA 4R65A 4MF2A 3RBDA 5AM5A 1NNLA 1QQ5A 2JZBB 4J9KA 2YQEA 3SV3A 3U26A 2KJ5A 1QQ7A 1QH9A 2ZIVA 2H3FA 4Z6CA 1H38A 2DKZA 1ZQDA 5ALTA 4YMOA 4IRKA 5J2IA 2AQ4A 5JTIA 3GIJA 9ICPA 4QWBA 2HHVA 4NLCA 1UT5A 4AYBF 3RAXA 5HMMA 2J6SA 5AK4A 4A8EA 2GWSA 1ZQCA 2P6UA 4YCXA 4Z6FA 5BOLA 4F4WA 1DK2A 3BS5A 3H8SA 4F91B 3ZDCA 1WYGA 5J29A 2VJ4A 3M1YA 2GO7A 1Q3UA 2BQ3A 2OXOA 2VIXA 4Q44A 4Y2SA 5ALXA 1SKWA 2K4PA 3PMLA 4NXZA 4J9RA 4UATA 4Y2TA 3PY8A 1KBUA 2YY6A 5EOZA 3JPTA 2MUTB 1BVSA 2BCRA 5D49A 4DSIA 2FLPA 4UAYA 2R8KA 3EZ5A 8ICKA 1X2IA 3QEBZ 2KJ9A 2C28A 4M6WA 2B0CA 4YVZA 5ALUA 5AKKA 1ECWA 8ICCA 4I2FA 3PO4A 3F53A 4DQQA 1A0PA 2W8KA 2ZXHA 3G6YA 2VKQA 4I2IA 2KV2A 4PPXA 3C1ZA 4U6PA 4EYIB 3ZDAA 5J0QA 5J2BA 3QZ7A 2V4QA 1EXNA 2HOIA 4UAUA 5AIBA 1SXEA 1SL2A 5CR0A 2JEGA 5EE0A 2IHMA 4M04A 5AK3A 1JN3A 4QW9A 2DKXA 1BPEA 3C5GA 3UMBA 4OJ6A 3PVXA 5DQGA 4ED3A 2AQ0A 4JV2A 2BQRA 1SZPA 3G6VA 3WK5A 3ZD9A 4Y2PA 4CNQA 1ZJNA 2HI0A 3V6HA 2WF8A 3AU2A 2HHQA 5KG0A 4RQNA 4ELTA 4JUZA 9ICLA 5KFBA 3M6ZA 2JEIA 4ICAA 1HUZA 2ZIWA 1AQ6A 1NZBA 3BS7A 5A0LA 5DBBA 2HVIA 4F5NA 4F5OA 4F72A 3AEVA 4ECVA 1ZQZA 1X9MA 5KT6A 4KN4A 2JEFA 1WUDA 1FFVA 1PZNA 5D4BA 5L1MA 2NRTA 3UM9A 1C20A 2OYYA 3IP4B 2H3ZA 2KVCA 3TARA 1SV0A 2XCAA 2K8BB 3IG8A 4GC7A 1IG6A 3AQFA 1XU4A 4YFKA 4RPYA 4QZIA 2FJ6A 4MEXA 4QZFA 2XVTA 2C2EA 2Z7JA 3ISDA 3RB3A 2FMSA 1F5SA 4QZDA 1N48A 1CRXA 4C7YA 1MN8A 3ISBA 2PMZF 1ZXIA 2BPGA 3OPXA 3OHAA 2HBKA 3NASA 4TQRA 2UVUA 3KKAC 1FIQA 8ICOA 4RQ7A 4RPZA 2W7PA 2KZ3A 9ICUA 1XSLA 2F44A 3OGUA 2ASDA 4BDPA 3RH4A 1DGSA 3N28A 8ICMA 3RBEA 5DLFA 3F5AA 4OO1J 4CF4A 2E8PA 2IHNA 2BDPA 4M9LA 2W9AA 2K8CB 2CXYA 3B0YA 5ALRA 3UQ2A 1ZD5A 5KFGA 3QU7A 3A0BU 2D3DA 1AROP 3FYHA 3H7IA 4FS2A 5KFHA 2BGWA 4JK1A 1RQNA 2K4HA 4F5QA 2HVHA 5AKIA 1U45A 4J9QA 5K4LA 1TK0A 1GO3F 5AI5A 5DB8A 2ATLA 2G07A 3QU2A 1IXRA 1KKXA 2B21A 1Q8KA 5DDYA 4P4OA 1X6JA 3UQ0A 3NGDA 3TKAA 2UVVA 4FZMA 4UAWA 1TAQA 1YZ6A 4F93B 1SWWA 3A0HU 7ICRA 3AM9A 4PL2A 3JPPA 4IRDA 2F2AB 2F8LA 4B9TA 2E8OA 3OJUA 3SAHA 5AKLA 3ONNA 3HX0A 2W11A 2JH7A 3S6JA 3PV8A 4TURA 5J0YA 3HW8A 4DF8A 2WF9A 5DDMA 2DFLA 3HPOA 1L3UA 5J0WA 1Z00B 2MA1A 5KFSA 7ICKA 1DK3A 5AKXA 1RYSA 5IIIA 2E1EA 3RH5A 1ZQFA 1PUZA 4Y2VA 2PFPA 2EZXA 1V97A 5KFZA 2R8IA 5AI0A 3MBYA 3TADC 1WCLA 4EBCA 4E0DA 7ICIA 2NYVA 2OEHA 3ZD8A 4EZ9A 3ISCA 4NL9A 1ZRMA 3D2NA 5HP4A 2RHFA 8ICPA 1LB2B 1S8OA 5DB6A 3MR3A 5F3XB 1DXSA 2A1JA 1JI7A 2WAQC 3TFRA 4YR3A 3QUTA 1ZETA 4KLQA 4JWNA 1LV5A 2M9NA 3GIMA 3C23A 2ZIUA 2VANA 4I2GA 3IDWA 4MFCA 2EAMA 4GFJA 5AI4A 3MGHA 1UCVA 4IQWA 2HOQA 3PO5A 3QUCA 4RNOA 1TAMA 2RDJA 1T8EA 3F2BA 4DLGA 1Z4OA 2PXIA 1Z19A 2G06A 3GV8B 5KFQA 3H4BA 2Y0SF 5KFCA 3SR6A 3EUB2 9ICHA 2KP7A 2QLTA 4I2DA 2R8GA 2ZIVB 4ED2A 7ICMA 4O3NA 3C28A 1U47A 2P35A 5ALDA 4C4RA 4ED0A 3R9KA 2XY7A 5DBAA 1C7YA 4QW8A 3Q8QB 1NZPA 4DFMA 1YT3A 2IBKA 4YMNA 8ICYA 1QSSA 1XO1A 1NK7A 2Y9UA 4Y2JA 1KFDA 1PK3A 4UB6U 2W9MA 8ICIA 4I2HA 3PR4A 4RQ6A 7ICJA 3V6JA 3D2SA 2RRDA 4QZGA 2QARA 7ICGA 5H2FU 3BS5B 5L1JA 2KFNA 5ALLA 5HR6A 4NLNA 4ACOA 5ALZA 3H0LB 2OHFA 2LYBA 3B9JA 4O3OA 4PHEA 2E5SA 1ZD2P 4PHDA 2Q4TA 1ZQLA 3NVZA 4DQRA 3UPQA 1ZQ1C 4R66A 5L9XA 4DFKA 2R18A 4LZDA 1X42A 5KFPA 2KZZA 2K4EA 5J2KA 4YD2A 4PL1A 4XA5A 4XRHA 4BXOB 1HEKA 1JUDA 8ICQA 4KLJA 4O5KA 1U49A 1L6NA 4M6WB 3Q8RB 4KLLA 2ZJ5A 4ECUA 3RJKA 4C8KA 1A6SA 3NVVA 3GDXA 4DSLA 3PSPA 3FAHA 2AGOA 2XCPA 3L3FX 7ICEA 1XS9D 1ZQRA 2KKVA 5KFFA 2C22A 4Z6DA 5B5EU 5EWFA 1LVHA 2IA6A 3QU5A 4JMUA 4FO6A 4EX6A 3H8WA 5ALQA 4FZNA 2YMQA 1N60A 5TZVA 2H3VA 2VA2A 5AK6A 4GLXA 1RM6C 3IN5A 5IIMA 3RFAA 4C7ZA 3M7DA 3PW4A 3SV4A 1RYUA 4YMMA 5T14A 1UHUA 5AKGA 2WB1F 5KFRA 4LJXA 5ALSA 8ICVA 3E58A 3KZXA 5ALJA 4J9SA 1JX4A 3PR5B 3H0RB 3ETRA 5J2FA 1ZQKA 2XC9A 2JH1A 4BWJA 2KZMA 3Q8KA 3HT3A 1S77D 2FLNA 2HHWA 1NK0A 1X6IA 1ZQPA 4B9UA 5ALYA 1U4BA 5KNIA 5FP0A 2W43A 2Y1IA 7ICLA 3FDSA 3M6KA 3MR2A 2ZIWB 1XNSA 2I6XA 4KX3A 3IM1A 1MA7A 4P2HA 3BQ0A 4P0QA 4OJLA 3IG5A 2AJQA 3Q8LA 2K60A 2WF5A 1PK1A 5GTIU 4B9LA 4RNNA 4HYKA 1KL9A 4IC9A 5ALFA 3BQ7A 3K4GA 4PH5A 3GV7B 2IOHA 4RQ8A 5CRXA 5KL1B 2FMQA 2EAOA 2M0NA 4DCCA 5G5GA 4FZLA 7ICUA 1ZQVA 2PFQA 4F2RA 1TK5A 1BPDA 4BUGA 1QSYA 1ZD4A 1K5OA 2UVRA 2DL0A 2BQUA 5AM1A 8ICSA 4EYHB 3H40A 1TFRA 3C29A 2NV3A 2IMWP 4O3QA 2KSOA 4NM2A 3PZPA 2DQNB 3WKCA 1MQ3A 4RUAA 1JRPA 1RPLA 4KMUA 4PZOA 2ZTCA 4J9PA 3BDPA 1N2XA 2KIVA 5AM3A 4TUSA 4AYBC 5IIKA 1NJXA 4CE6A 4M2YA 1NKEA 4IQVA 3EPIA 5CWRA 2HCFA 3PSFA 3F2DA 3TQ1A 1WWVA 2DPIA 4BXOA 4TQSA 4NV0A 5DGBA 4QNLA 4JV1A 4ED7A 1N63A 5ALEA 3JPQA 8ICRA 4NLKA 4M9NA 3PX0A 4EENA 3AL0B 2K89A 3C1YA 3MDAA 4I2JA 4XUSA 3GFKB 4DOBA 3SYZA 1L3TA 1FFUA 4OJOA 2HHTA 9ICTA 3QNMA 1LKYB 1B43A 5J2DA 2VA3A 9ICSA 1DGJA 4OCZA 5D46A 5AKZA 4YXJA 3NUQA 1RQLA 4TUPA 5G5HA 2HMXA 2L5YA 2YB4A 4GC6A 9ICFA 3UXOA 4I2CA 1TAUA 5IIOA 1UPHA 2KICA 4RZRA 2JHDA 4YR0A 4RQ4A 3T5LA 9ICQA 2FI1A 3NS1A 3AUOA 5EWGA 1BPYA 4PZNA 3PSTA 5DQHA 2BR0A 4B9SA 2J6UA 2XY5A 3MGVA 2E3TA 5AI8A 1ZQTA 5GTHU 2KVSA 4M9GA 3D2QA 5AKJA 2BPCA 3CYMA 4QZAA 1ZQWA 7ICQA 1X9SA 4PJ0U 3Q8SB 1VLBA 1A76A 1S0VA 1NJYA 1VDVA 5EWEA 1Q3VA 4TUQA 4QIWF 4BWMA 3IHQB 1L5UA 3V6KA 4ZH4A 2BDUA 4DO9A 1L8LA 1L7OA 4FBTA 4BGDA 5KFEA 3KTQA 1N5WA 3WK4A 1SWVA 1ZQHA 4J9MA 9ICRA 3BZKA 4I29A 2QB0A 4CF5A 4IL6U 4UARA 2AXTU 1QTMA 4J03A 4KLDA 3HWTA 3WU2U 4DS4A 4F4YA 5JRTA 2XGPA 3SAGA 2G09A 5DBCA 5J8YC 2A1JB 4DL7A 3SEIA 2NRXA 3PW7A 2W3RA 2FLLA 1SL1A 3TFSA 3PW2A 3RTVA 2ZIUB 2ZUBA 3CW2C 3ALRA 2PI4A 1RXWA 4I2EA 2HOFA 9ICXA 2C2DA 3RJHA 5KAIU 3RJFA 5AI6A 4F5PA 4YQWA 2HBMA 3QU4A 3EWAA 4YG2A 2GH1A 2W9BA 5KT4A 3PX6A 4K4IA 5ALNA 3KFUF 2FE9A 3B0XA 5EE9A 4M9JA 5C0YA 2PFNA 4KLMA 3MFIA 2HHXA 5KFWA 2KD1A 4KLFA 4IR1A 1UA1A 3L4PA 4GXJA 3EW9A 4P4PA 4RT3A 3H8MA 1FEZA 1LKYA 4R64A 2AGPA 1RYRA 1COOA 4CCHA 1ZQUA 5KG2A 4I27A 4O3RA 3BZCA 4ECTA 3MFHA 5KG7A 1TE2A 2PMZC 4DQPA 1JXEA 5J2GA 4RQ5A 5AKEA 3GIKA 3T5HA 2QARB 4MFFA 4J9NA 5KFNA 5KG4A 1A77A 2QKQA 1N5XA 1KSPA 3WK6A 2LI6A 4BJQA 3TANA 2JMGA 5DB9A 3JPOA 2P6RA 4QWCA 3Q8MA 5ALWA 2VA8A 2N1RA 2HW3A 3TAQA 3H8JA 4JB3A 1T4GA 2ISOA 3ZDDA 3I28A 5KT2A 4UB4A 4QZBA 1SIJA 1IV8A 1QQ6A 9ICWA 5KT3A 3SQIA 1TV9A 4UASA 4P0PA 4IQTA 4Y2QA 5AKHA 2RP5A 1URJA 3HJEA 4F4XA 5KFYA 3BJYA 4DL3A 4F4ZA 1Z1BA 2E1FA 1J97A 3RRGA 5ALOA 4C80A 1BPZA 4EELA 2CN1A 2PKEA 2AGQA 3ED5A 7ICHA 5BPCA 5AM2A 1ZQEA 5CHGA 4YD1A 4M0AA 3CNHA 5JUMA 3LYSA 4IRCA 1ZOLA 3QUBA 2JV3A 1NI3A 3HKZF 4R8UA 4QZHA 2KMDA 5F9NA 5EE3A 2OM6A 2XIDA 2ESEA 2Y9TA 2ALZA 4UQGA 1SZHA 1RG6A 4ZOHC 2DWQA 2R8HA 3T3FA 1OXJA 3C5FA 1KN5A 2XO7A 3RJEA 4RQ3A 1N62A 2A19A 3WKAA 5HMLA 2XICA 4UAVA 5AI9A 3FC4A 2BCSA 3AQEA 4IS7A 3SI8A 2ZIXA 1ED1A 1KLNA 2JR5A 4Q8FA 4F4KA 3QU9A 1XSPA 4GXKA 3UXPA 5L1KA 1X66A 5F9LA 2NRWA 3L5KA 2F76X 2WFAA 2ZUCA 1L7NA 5EE1A 4EEKA 4DS5A 4ELUA 4ECYA 8ICGA 2K8AA 2KFZA 4P0QB 5KG5A 1X9XA 8ICAA 5DKWA 4NWIA 1L3SA 1QSLA 1SV4A 4DWIA 1PK1B 1SV0C 2F3NA 2NO4A 2W3SA 4EBDA 4DFJA 4F71A 2LKYA 1QCKA 2NO5A 2BCQA 9ICVA 3WK9A 1BNPA 4UB5A 1O03A 4OD0A 2OH2A 2CPRA 2Y0SC 2HHSA 2H3IA 2F77X 1B22A 3RH6A 9ICIA 4M9HA 8ICJA 1T3QA 2KSOB 4MHVA 3M9MB 2KN7A 2KIWA 2RDIA 4C4TA 3QZ8A 3KHHA 4I28A 4DSJA 4RUCA 1K1QA 5BOMA 1RDFA 3V7JA 4C8OA 3HRDD 3H0MB 2E8MA 3MR6A 3I1YA 3PW0A 1KRPA 4J9LA 9ICBA
chains in the Genus database with same CATH topology
1UHUA 1MN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHU A;  1MN8 A; 
#chains in the Genus database with same CATH topology
 1MC8 A;  1XSN A;  4OJP A;  2KE7 A;  2BCV A;  4I2B A;  5CEH A;  4NM1 A;  1Z4N A;  5KFJ A;  1J2N A;  5AKY A;  2BZF A;  3C21 A;  1Z1V A;  3M8R A;  4DLE A;  3V7L A;  1ZQI A;  2RLT A;  3E2E A;  5KG3 A;  5IIN A;  4B9N A;  3E0F A;  3RJI A;  1ZQB A;  2I5H A;  5ALG A;  4EZ6 A;  4I2A A;  5C5J A;  3KHL A;  1UT8 A;  2DPJ A;  1HJP A;  2KJ8 A;  1S76 D;  3PNC A;  3AU6 A;  4F8R A;  1OUQ A;  1JRO A;  5J2C A;  4CGZ A;  4DEZ A;  4DF4 A;  2ISP A;  3M8S A;  8ICN A;  2DF4 B;  3F5E A;  5CP2 A;  2ZTE A;  1TK8 A;  4KLS A;  9ICC A;  5B66 U;  5E79 U;  1XO0 A;  5DLG A;  3UXN A;  3C2K A;  3RRH A;  4KLT A;  5J0O A;  4R63 A;  3GZF A;  1ZQY A;  1D9F A;  1KFT A;  2BKE A;  5HHI A;  3JPS A;  3GV5 B;  1XWL A;  4YP3 A;  3PMN A;  5TIS U;  3UMC A;  2WB1 C;  1PVP A;  1WG8 A;  1MSW D;  4KLU A;  2JRZ A;  3TAC B;  1ZRN A;  3FM9 A;  4DSE A;  2FPM A;  3TAP A;  1CI4 A;  4NL9 C;  2KTQ A;  3TI0 A;  2E8N A;  5AM4 A;  4PGY A;  5KFV A;  1D8B A;  5KFO A;  3ZI4 A;  1V38 A;  3BQT A;  3VC8 A;  2QB0 B;  4GIB A;  3SMV A;  1XC9 A;  3RJG A;  5KFX A;  5AK5 A;  3KKA A;  7ICO A;  1D8Y A;  1CUK A;  3RR7 A;  2F1J A;  8ICW A;  2EQY A;  1JAL A;  1YZ7 A;  1SL0 A;  3C2L A;  5KFD A;  4YN4 A;  2HBL A;  1SKS A;  5CB1 A;  4RT2 A;  4K4G A;  5J0R A;  5AIA A;  2IOF A;  1IM4 A;  4Y2R A;  2W9C B;  2EZZ A;  1K1S A;  1NK6 A;  4DQS A;  2ES6 A;  4DSK A;  4QZ8 A;  2W9B B;  1WCN A;  1NK5 A;  2K4I A;  1T7P A;  3KOO A;  8ICB A;  4EBE A;  3GQC A;  3ORY A;  2W8L A;  1NK4 A;  4QWE A;  1L3V A;  9ICN A;  3I76 A;  1L7M A;  3ZDB A;  4B6J A;  1ZYQ A;  2HBJ A;  1ZQG A;  9ICM A;  1ZJM A;  4ECQ A;  3IRU A;  1HUO A;  7ICS A;  5L1L A;  4O3P A;  5DQI A;  3OSN A;  5KFI A;  4ECW A;  2WF7 A;  2C2R A;  2LHT A;  2YN4 A;  1JMS A;  4Y2X A;  4RQ0 A;  1TVA A;  4DQI A;  7ICN A;  4NLG A;  1ZQN A;  1U9L A;  1ZQO A;  5KFM A;  2W7O A;  1X9W A;  4ED6 A;  4ELV A;  4X5V A;  3CRX A;  4USA A;  3N7P D;  5HR7 A;  4J9O A;  1PVQ A;  4US8 A;  2EDU A;  2JXJ A;  3WKB A;  2PI5 A;  3JPN A;  2LM1 A;  4UB2 A;  1ZQM A;  2KHQ A;  1MQ2 A;  5DG8 A;  3RB4 A;  2F1H A;  5J2E A;  5KT5 A;  8ICZ A;  4RNM A;  2B6G A;  1D9D A;  5KFK A;  4KLH A;  2LBO A;  2YTU A;  2ODG A;  1NJW A;  3OJS A;  5HHH A;  2XY6 A;  3TAD A;  4QZE A;  2CRX A;  3WKD A;  4RU9 A;  4P0P B;  4C4S A;  3GII A;  3CP8 A;  1S5L U;  5J0S A;  1ZQJ A;  5KFT A;  1KTQ A;  9ICO A;  1UA0 A;  5IIJ A;  2EAP A;  1TKD A;  3HIL A;  8ICX A;  2KKP A;  1JXL A;  2V4R A;  2W54 A;  4M47 A;  2H3Q A;  2A3V A;  3T5J A;  2JZB A;  3SD7 A;  3OHB A;  1NK8 A;  8ICL A;  2UVW A;  8ICU A;  3QX7 A;  1Z3E B;  3LVV A;  4R8U B;  2G08 A;  4O9M A;  4O3S A;  1S0O A;  1U48 A;  2NRZ A;  2FPK A;  4GXI A;  4KN7 A;  3GU3 A;  4ED1 A;  1F0M A;  4ECS A;  4JWM A;  4KLI A;  4QIW C;  1SXD A;  8ICF A;  2J6T A;  4YXM A;  5J2A A;  4DSF A;  2DGZ A;  3QXG A;  4LZG A;  3EPG A;  3DEE A;  2O6K A;  1SGG A;  1BPB A;  2ZUD A;  2W9C A;  9ICG A;  1NOM A;  3H4D A;  3N4M B;  5ALI A;  3QE9 Y;  4MFA A;  2ZIX B;  2EH9 A;  4F50 A;  3RJJ A;  5KFL A;  4ECR A;  4QZ9 A;  4AP9 A;  1J2M A;  5ALP A;  1D8L A;  4DL6 A;  2ZTD A;  4NY8 A;  2GOL A;  2MUT A;  9ICJ A;  5J0P A;  3NRW A;  1FO4 A;  1S97 A;  4B9V A;  4NLZ A;  2ZG6 A;  3SZ2 A;  2KHV A;  3DV9 A;  3O0F A;  1ZQA A;  2OCE A;  1PVR A;  4P4M A;  4DFP A;  2P66 A;  4UB1 A;  3ZDE A;  5J0T A;  3G6X A;  1WWU A;  2FPL A;  5HNK A;  1F44 A;  1OW5 A;  4CDG A;  4DL2 A;  1ZQS A;  2EAN A;  3K1Z A;  4G3I A;  3WKE A;  3NTU A;  1B4F A;  4U7C A;  3QUQ A;  4UAZ A;  5ALH A;  4QJF B;  5ALM A;  4NLB A;  3MGI A;  3LVW A;  4QWA A;  1QLN A;  3KHG A;  9ICE A;  5ALV A;  2MRL A;  3OTQ A;  4C8M A;  3IV6 A;  1T3N A;  1V85 A;  2YML A;  3J81 j;  2FDR A;  1T94 A;  4F92 B;  4XQ8 A;  3Q8P B;  3LWM A;  3V7K A;  3NVW A;  4WJ3 B;  4DFD A;  2Y1J A;  2KEY A;  2F8K A;  3MR5 A;  3QYP A;  4ECZ A;  4Y2U A;  4O5C A;  4Q45 A;  4F3O A;  2R8J A;  2OWO A;  2YB1 A;  2LPE A;  5KAF U;  2KOB A;  3RB0 A;  5KTQ A;  3RR8 A;  3UMG A;  5J2J A;  4ECX A;  1ZQQ A;  7ICV A;  4RQM A;  4RQ1 A;  1IIP A;  4Z6E A;  4EX7 A;  3C2M A;  1M6Y A;  4KLG A;  3N7S C;  1KDH A;  1CEZ A;  2DUY A;  4B9M A;  2MAX A;  2LM4 A;  2VJ5 A;  1P7D A;  1BNO A;  4PGQ A;  3T79 A;  2W55 A;  5KFU A;  5IIL A;  4UB8 U;  1V9P A;  1UQV A;  3QEA Z;  4BX9 C;  4LVS A;  2WAQ F;  3JPR A;  3THV A;  2ASJ A;  5ALK A;  4O0I A;  5KFA A;  1HIW A;  3MDC A;  2YMM A;  4RQ2 A;  2KG5 A;  3NVY A;  1DOQ A;  3BQ2 A;  3SAF A;  2XI9 A;  4MF8 A;  1S0N A;  1JIH A;  2LMR A;  3HKZ C;  2WHE A;  1DRG A;  2BHN A;  3BQ1 A;  5DB7 A;  2FMP A;  3SEN A;  2A1A A;  3LWL A;  1RXV A;  4Q43 A;  3WK8 A;  7ICF A;  2AHO B;  2MSN A;  3WK7 A;  3OSP A;  9ICA A;  1SKR A;  4O5E A;  4RPX A;  4KLE A;  1COK A;  1S0M A;  4C8N A;  1N61 A;  1KEJ A;  5J0X A;  3EYZ A;  1X40 A;  3PW5 A;  2EZY A;  3M9N B;  1BGX T;  4FS1 A;  2JEJ A;  4F5R A;  1L8O A;  4CF3 A;  4PHP A;  4Y2Y A;  4YR2 A;  2LYA A;  9ICK A;  2D6F C;  3F2C A;  5J2H A;  4KIT B;  2PFO A;  1O08 A;  4QZC A;  5CA7 A;  3LDA A;  3LK9 A;  2G5H B;  2KNJ A;  3N7R C;  1N56 A;  5KT7 A;  4C0Z A;  2W04 A;  1ZQX A;  3RB6 A;  2BPF A;  4G9B A;  4DOC A;  4FBU A;  3T5K A;  2WF6 A;  3RF9 A;  1NJZ A;  2I9G A;  1L7P A;  2QB1 A;  1NKB A;  2XGQ A;  4NJ8 A;  4QWD A;  4Q8E A;  2F1I A;  4HAI A;  3M9O B;  5AIC A;  5DG9 A;  2GLE A;  7ICT A;  5AM0 A;  4PHA A;  3RAQ A;  2YMP A;  3KZI U;  4DL5 A;  4O3M A;  2I1Q A;  1SB3 C;  5KG6 A;  1ZD3 A;  1NK9 A;  3K1R B;  4EEY A;  4UBC A;  4C8L A;  3KBB A;  2AH5 A;  3PX4 A;  5DG7 A;  4FE3 A;  4KMO B;  3AN1 A;  2DBY A;  2HDO A;  3V72 A;  3ICX A;  4IR9 A;  4KTQ A;  2ZXI A;  4UBB A;  5L1I A;  4F2S A;  1Y88 A;  3GIL A;  3D6J A;  1Z00 A;  4DL4 A;  4IQU A;  4OJ5 A;  1KQQ A;  4JV0 A;  2BCU A;  1VJ5 A;  2ZJ8 A;  2RQ5 A;  3N97 B;  2AU0 A;  8ICE A;  4DOA A;  2NRV A;  2V9W A;  3KD3 A;  4KLO A;  5DGA A;  1S9F A;  2G5I B;  4K4H A;  4ED8 A;  2Q0Z X;  2YX8 A;  2G0A A;  2W03 A;  3MC1 A;  4UB3 A;  7ICP A;  5J0U A;  3PSI A;  8ICT A;  2JGA A;  4UW9 A;  3DDH A;  2IOF K;  2ASL A;  4MEY A;  5AHX A;  4FFD A;  1BPX A;  5CJ7 A;  1KFS A;  4PGX A;  1Q46 A;  2HSZ A;  2ZJA A;  3VCB A;  3NRZ A;  2D8C A;  2H5X A;  1B0X A;  3AMZ A;  8ICH A;  4KX5 A;  5KL8 B;  3ETL A;  4US9 A;  5JU5 A;  3K75 D;  5KG1 A;  3HP6 A;  2HHU A;  5J8Y A;  1S10 A;  4CRX A;  2MU2 A;  3MAB A;  2KK0 A;  2WTF A;  2LYH A;  1RZT A;  1NKC A;  1KW4 A;  3KHR A;  4R65 A;  4MF2 A;  3RBD A;  5AM5 A;  1NNL A;  1QQ5 A;  2JZB B;  4J9K A;  2YQE A;  3SV3 A;  3U26 A;  2KJ5 A;  1QQ7 A;  1QH9 A;  2ZIV A;  2H3F A;  4Z6C A;  1H38 A;  2DKZ A;  1ZQD A;  5ALT A;  4YMO A;  4IRK A;  5J2I A;  2AQ4 A;  5JTI A;  3GIJ A;  9ICP A;  4QWB A;  2HHV A;  4NLC A;  1UT5 A;  4AYB F;  3RAX A;  5HMM A;  2J6S A;  5AK4 A;  4A8E A;  2GWS A;  1ZQC A;  2P6U A;  4YCX A;  4Z6F A;  5BOL A;  4F4W A;  1DK2 A;  3BS5 A;  3H8S A;  4F91 B;  3ZDC A;  1WYG A;  5J29 A;  2VJ4 A;  3M1Y A;  2GO7 A;  1Q3U A;  2BQ3 A;  2OXO A;  2VIX A;  4Q44 A;  4Y2S A;  5ALX A;  1SKW A;  2K4P A;  3PML A;  4NXZ A;  4J9R A;  4UAT A;  4Y2T A;  3PY8 A;  1KBU A;  2YY6 A;  5EOZ A;  3JPT A;  2MUT B;  1BVS A;  2BCR A;  5D49 A;  4DSI A;  2FLP A;  4UAY A;  2R8K A;  3EZ5 A;  8ICK A;  1X2I A;  3QEB Z;  2KJ9 A;  2C28 A;  4M6W A;  2B0C A;  4YVZ A;  5ALU A;  5AKK A;  1ECW A;  8ICC A;  4I2F A;  3PO4 A;  3F53 A;  4DQQ A;  1A0P A;  2W8K A;  2ZXH A;  3G6Y A;  2VKQ A;  4I2I A;  2KV2 A;  4PPX A;  3C1Z A;  4U6P A;  4EYI B;  3ZDA A;  5J0Q A;  5J2B A;  3QZ7 A;  2V4Q A;  1EXN A;  2HOI A;  4UAU A;  5AIB A;  1SXE A;  1SL2 A;  5CR0 A;  2JEG A;  5EE0 A;  2IHM A;  4M04 A;  5AK3 A;  1JN3 A;  4QW9 A;  2DKX A;  1BPE A;  3C5G A;  3UMB A;  4OJ6 A;  3PVX A;  5DQG A;  4ED3 A;  2AQ0 A;  4JV2 A;  2BQR A;  1SZP A;  3G6V A;  3WK5 A;  3ZD9 A;  4Y2P A;  4CNQ A;  1ZJN A;  2HI0 A;  3V6H A;  2WF8 A;  3AU2 A;  2HHQ A;  5KG0 A;  4RQN A;  4ELT A;  4JUZ A;  9ICL A;  5KFB A;  3M6Z A;  2JEI A;  4ICA A;  1HUZ A;  2ZIW A;  1AQ6 A;  1NZB A;  3BS7 A;  5A0L A;  5DBB A;  2HVI A;  4F5N A;  4F5O A;  4F72 A;  3AEV A;  4ECV A;  1ZQZ A;  1X9M A;  5KT6 A;  4KN4 A;  2JEF A;  1WUD A;  1FFV A;  1PZN A;  5D4B A;  5L1M A;  2NRT A;  3UM9 A;  1C20 A;  2OYY A;  3IP4 B;  2H3Z A;  2KVC A;  3TAR A;  1SV0 A;  2XCA A;  2K8B B;  3IG8 A;  4GC7 A;  1IG6 A;  3AQF A;  1XU4 A;  4YFK A;  4RPY A;  4QZI A;  2FJ6 A;  4MEX A;  4QZF A;  2XVT A;  2C2E A;  2Z7J A;  3ISD A;  3RB3 A;  2FMS A;  1F5S A;  4QZD A;  1N48 A;  1CRX A;  4C7Y A;  1MN8 A;  3ISB A;  2PMZ F;  1ZXI A;  2BPG A;  3OPX A;  3OHA A;  2HBK A;  3NAS A;  4TQR A;  2UVU A;  3KKA C;  1FIQ A;  8ICO A;  4RQ7 A;  4RPZ A;  2W7P A;  2KZ3 A;  9ICU A;  1XSL A;  2F44 A;  3OGU A;  2ASD A;  4BDP A;  3RH4 A;  1DGS A;  3N28 A;  8ICM A;  3RBE A;  5DLF A;  3F5A A;  4OO1 J;  4CF4 A;  2E8P A;  2IHN A;  2BDP A;  4M9L A;  2W9A A;  2K8C B;  2CXY A;  3B0Y A;  5ALR A;  3UQ2 A;  1ZD5 A;  5KFG A;  3QU7 A;  3A0B U;  2D3D A;  1ARO P;  3FYH A;  3H7I A;  4FS2 A;  5KFH A;  2BGW A;  4JK1 A;  1RQN A;  2K4H A;  4F5Q A;  2HVH A;  5AKI A;  1U45 A;  4J9Q A;  5K4L A;  1TK0 A;  1GO3 F;  5AI5 A;  5DB8 A;  2ATL A;  2G07 A;  3QU2 A;  1IXR A;  1KKX A;  2B21 A;  1Q8K A;  5DDY A;  4P4O A;  1X6J A;  3UQ0 A;  3NGD A;  3TKA A;  2UVV A;  4FZM A;  4UAW A;  1TAQ A;  1YZ6 A;  4F93 B;  1SWW A;  3A0H U;  7ICR A;  3AM9 A;  4PL2 A;  3JPP A;  4IRD A;  2F2A B;  2F8L A;  4B9T A;  2E8O A;  3OJU A;  3SAH A;  5AKL A;  3ONN A;  3HX0 A;  2W11 A;  2JH7 A;  3S6J A;  3PV8 A;  4TUR A;  5J0Y A;  3HW8 A;  4DF8 A;  2WF9 A;  5DDM A;  2DFL A;  3HPO A;  1L3U A;  5J0W A;  1Z00 B;  2MA1 A;  5KFS A;  7ICK A;  1DK3 A;  5AKX A;  1RYS A;  5III A;  2E1E A;  3RH5 A;  1ZQF A;  1PUZ A;  4Y2V A;  2PFP A;  2EZX A;  1V97 A;  5KFZ A;  2R8I A;  5AI0 A;  3MBY A;  3TAD C;  1WCL A;  4EBC A;  4E0D A;  7ICI A;  2NYV A;  2OEH A;  3ZD8 A;  4EZ9 A;  3ISC A;  4NL9 A;  1ZRM A;  3D2N A;  5HP4 A;  2RHF A;  8ICP A;  1LB2 B;  1S8O A;  5DB6 A;  3MR3 A;  5F3X B;  1DXS A;  2A1J A;  1JI7 A;  2WAQ C;  3TFR A;  4YR3 A;  3QUT A;  1ZET A;  4KLQ A;  4JWN A;  1LV5 A;  2M9N A;  3GIM A;  3C23 A;  2ZIU A;  2VAN A;  4I2G A;  3IDW A;  4MFC A;  2EAM A;  4GFJ A;  5AI4 A;  3MGH A;  1UCV A;  4IQW A;  2HOQ A;  3PO5 A;  3QUC A;  4RNO A;  1TAM A;  2RDJ A;  1T8E A;  3F2B A;  4DLG A;  1Z4O A;  2PXI A;  1Z19 A;  2G06 A;  3GV8 B;  5KFQ A;  3H4B A;  2Y0S F;  5KFC A;  3SR6 A;  3EUB 2;  9ICH A;  2KP7 A;  2QLT A;  4I2D A;  2R8G A;  2ZIV B;  4ED2 A;  7ICM A;  4O3N A;  3C28 A;  1U47 A;  2P35 A;  5ALD A;  4C4R A;  4ED0 A;  3R9K A;  2XY7 A;  5DBA A;  1C7Y A;  4QW8 A;  3Q8Q B;  1NZP A;  4DFM A;  1YT3 A;  2IBK A;  4YMN A;  8ICY A;  1QSS A;  1XO1 A;  1NK7 A;  2Y9U A;  4Y2J A;  1KFD A;  1PK3 A;  4UB6 U;  2W9M A;  8ICI A;  4I2H A;  3PR4 A;  4RQ6 A;  7ICJ A;  3V6J A;  3D2S A;  2RRD A;  4QZG A;  2QAR A;  7ICG A;  5H2F U;  3BS5 B;  5L1J A;  2KFN A;  5ALL A;  5HR6 A;  4NLN A;  4ACO A;  5ALZ A;  3H0L B;  2OHF A;  2LYB A;  3B9J A;  4O3O A;  4PHE A;  2E5S A;  1ZD2 P;  4PHD A;  2Q4T A;  1ZQL A;  3NVZ A;  4DQR A;  3UPQ A;  1ZQ1 C;  4R66 A;  5L9X A;  4DFK A;  2R18 A;  4LZD A;  1X42 A;  5KFP A;  2KZZ A;  2K4E A;  5J2K A;  4YD2 A;  4PL1 A;  4XA5 A;  4XRH A;  4BXO B;  1HEK A;  1JUD A;  8ICQ A;  4KLJ A;  4O5K A;  1U49 A;  1L6N A;  4M6W B;  3Q8R B;  4KLL A;  2ZJ5 A;  4ECU A;  3RJK A;  4C8K A;  1A6S A;  3NVV A;  3GDX A;  4DSL A;  3PSP A;  3FAH A;  2AGO A;  2XCP A;  3L3F X;  7ICE A;  1XS9 D;  1ZQR A;  2KKV A;  5KFF A;  2C22 A;  4Z6D A;  5B5E U;  5EWF A;  1LVH A;  2IA6 A;  3QU5 A;  4JMU A;  4FO6 A;  4EX6 A;  3H8W A;  5ALQ A;  4FZN A;  2YMQ A;  1N60 A;  5TZV A;  2H3V A;  2VA2 A;  5AK6 A;  4GLX A;  1RM6 C;  3IN5 A;  5IIM A;  3RFA A;  4C7Z A;  3M7D A;  3PW4 A;  3SV4 A;  1RYU A;  4YMM A;  5T14 A;  1UHU A;  5AKG A;  2WB1 F;  5KFR A;  4LJX A;  5ALS A;  8ICV A;  3E58 A;  3KZX A;  5ALJ A;  4J9S A;  1JX4 A;  3PR5 B;  3H0R B;  3ETR A;  5J2F A;  1ZQK A;  2XC9 A;  2JH1 A;  4BWJ A;  2KZM A;  3Q8K A;  3HT3 A;  1S77 D;  2FLN A;  2HHW A;  1NK0 A;  1X6I A;  1ZQP A;  4B9U A;  5ALY A;  1U4B A;  5KNI A;  5FP0 A;  2W43 A;  2Y1I A;  7ICL A;  3FDS A;  3M6K A;  3MR2 A;  2ZIW B;  1XNS A;  2I6X A;  4KX3 A;  3IM1 A;  1MA7 A;  4P2H A;  3BQ0 A;  4P0Q A;  4OJL A;  3IG5 A;  2AJQ A;  3Q8L A;  2K60 A;  2WF5 A;  1PK1 A;  5GTI U;  4B9L A;  4RNN A;  4HYK A;  1KL9 A;  4IC9 A;  5ALF A;  3BQ7 A;  3K4G A;  4PH5 A;  3GV7 B;  2IOH A;  4RQ8 A;  5CRX A;  5KL1 B;  2FMQ A;  2EAO A;  2M0N A;  4DCC A;  5G5G A;  4FZL A;  7ICU A;  1ZQV A;  2PFQ A;  4F2R A;  1TK5 A;  1BPD A;  4BUG A;  1QSY A;  1ZD4 A;  1K5O A;  2UVR A;  2DL0 A;  2BQU A;  5AM1 A;  8ICS A;  4EYH B;  3H40 A;  1TFR A;  3C29 A;  2NV3 A;  2IMW P;  4O3Q A;  2KSO A;  4NM2 A;  3PZP A;  2DQN B;  3WKC A;  1MQ3 A;  4RUA A;  1JRP A;  1RPL A;  4KMU A;  4PZO A;  2ZTC A;  4J9P A;  3BDP A;  1N2X A;  2KIV A;  5AM3 A;  4TUS A;  4AYB C;  5IIK A;  1NJX A;  4CE6 A;  4M2Y A;  1NKE A;  4IQV A;  3EPI A;  5CWR A;  2HCF A;  3PSF A;  3F2D A;  3TQ1 A;  1WWV A;  2DPI A;  4BXO A;  4TQS A;  4NV0 A;  5DGB A;  4QNL A;  4JV1 A;  4ED7 A;  1N63 A;  5ALE A;  3JPQ A;  8ICR A;  4NLK A;  4M9N A;  3PX0 A;  4EEN A;  3AL0 B;  2K89 A;  3C1Y A;  3MDA A;  4I2J A;  4XUS A;  3GFK B;  4DOB A;  3SYZ A;  1L3T A;  1FFU A;  4OJO A;  2HHT A;  9ICT A;  3QNM A;  1LKY B;  1B43 A;  5J2D A;  2VA3 A;  9ICS A;  1DGJ A;  4OCZ A;  5D46 A;  5AKZ A;  4YXJ A;  3NUQ A;  1RQL A;  4TUP A;  5G5H A;  2HMX A;  2L5Y A;  2YB4 A;  4GC6 A;  9ICF A;  3UXO A;  4I2C A;  1TAU A;  5IIO A;  1UPH A;  2KIC A;  4RZR A;  2JHD A;  4YR0 A;  4RQ4 A;  3T5L A;  9ICQ A;  2FI1 A;  3NS1 A;  3AUO A;  5EWG A;  1BPY A;  4PZN A;  3PST A;  5DQH A;  2BR0 A;  4B9S A;  2J6U A;  2XY5 A;  3MGV A;  2E3T A;  5AI8 A;  1ZQT A;  5GTH U;  2KVS A;  4M9G A;  3D2Q A;  5AKJ A;  2BPC A;  3CYM A;  4QZA A;  1ZQW A;  7ICQ A;  1X9S A;  4PJ0 U;  3Q8S B;  1VLB A;  1A76 A;  1S0V A;  1NJY A;  1VDV A;  5EWE A;  1Q3V A;  4TUQ A;  4QIW F;  4BWM A;  3IHQ B;  1L5U A;  3V6K A;  4ZH4 A;  2BDU A;  4DO9 A;  1L8L A;  1L7O A;  4FBT A;  4BGD A;  5KFE A;  3KTQ A;  1N5W A;  3WK4 A;  1SWV A;  1ZQH A;  4J9M A;  9ICR A;  3BZK A;  4I29 A;  2QB0 A;  4CF5 A;  4IL6 U;  4UAR A;  2AXT U;  1QTM A;  4J03 A;  4KLD A;  3HWT A;  3WU2 U;  4DS4 A;  4F4Y A;  5JRT A;  2XGP A;  3SAG A;  2G09 A;  5DBC A;  5J8Y C;  2A1J B;  4DL7 A;  3SEI A;  2NRX A;  3PW7 A;  2W3R A;  2FLL A;  1SL1 A;  3TFS A;  3PW2 A;  3RTV A;  2ZIU B;  2ZUB A;  3CW2 C;  3ALR A;  2PI4 A;  1RXW A;  4I2E A;  2HOF A;  9ICX A;  2C2D A;  3RJH A;  5KAI U;  3RJF A;  5AI6 A;  4F5P A;  4YQW A;  2HBM A;  3QU4 A;  3EWA A;  4YG2 A;  2GH1 A;  2W9B A;  5KT4 A;  3PX6 A;  4K4I A;  5ALN A;  3KFU F;  2FE9 A;  3B0X A;  5EE9 A;  4M9J A;  5C0Y A;  2PFN A;  4KLM A;  3MFI A;  2HHX A;  5KFW A;  2KD1 A;  4KLF A;  4IR1 A;  1UA1 A;  3L4P A;  4GXJ A;  3EW9 A;  4P4P A;  4RT3 A;  3H8M A;  1FEZ A;  1LKY A;  4R64 A;  2AGP A;  1RYR A;  1COO A;  4CCH A;  1ZQU A;  5KG2 A;  4I27 A;  4O3R A;  3BZC A;  4ECT A;  3MFH A;  5KG7 A;  1TE2 A;  2PMZ C;  4DQP A;  1JXE A;  5J2G A;  4RQ5 A;  5AKE A;  3GIK A;  3T5H A;  2QAR B;  4MFF A;  4J9N A;  5KFN A;  5KG4 A;  1A77 A;  2QKQ A;  1N5X A;  1KSP A;  3WK6 A;  2LI6 A;  4BJQ A;  3TAN A;  2JMG A;  5DB9 A;  3JPO A;  2P6R A;  4QWC A;  3Q8M A;  5ALW A;  2VA8 A;  2N1R A;  2HW3 A;  3TAQ A;  3H8J A;  4JB3 A;  1T4G A;  2ISO A;  3ZDD A;  3I28 A;  5KT2 A;  4UB4 A;  4QZB A;  1SIJ A;  1IV8 A;  1QQ6 A;  9ICW A;  5KT3 A;  3SQI A;  1TV9 A;  4UAS A;  4P0P A;  4IQT A;  4Y2Q A;  5AKH A;  2RP5 A;  1URJ A;  3HJE A;  4F4X A;  5KFY A;  3BJY A;  4DL3 A;  4F4Z A;  1Z1B A;  2E1F A;  1J97 A;  3RRG A;  5ALO A;  4C80 A;  1BPZ A;  4EEL A;  2CN1 A;  2PKE A;  2AGQ A;  3ED5 A;  7ICH A;  5BPC A;  5AM2 A;  1ZQE A;  5CHG A;  4YD1 A;  4M0A A;  3CNH A;  5JUM A;  3LYS A;  4IRC A;  1ZOL A;  3QUB A;  2JV3 A;  1NI3 A;  3HKZ F;  4R8U A;  4QZH A;  2KMD A;  5F9N A;  5EE3 A;  2OM6 A;  2XID A;  2ESE A;  2Y9T A;  2ALZ A;  4UQG A;  1SZH A;  1RG6 A;  4ZOH C;  2DWQ A;  2R8H A;  3T3F A;  1OXJ A;  3C5F A;  1KN5 A;  2XO7 A;  3RJE A;  4RQ3 A;  1N62 A;  2A19 A;  3WKA A;  5HML A;  2XIC A;  4UAV A;  5AI9 A;  3FC4 A;  2BCS A;  3AQE A;  4IS7 A;  3SI8 A;  2ZIX A;  1ED1 A;  1KLN A;  2JR5 A;  4Q8F A;  4F4K A;  3QU9 A;  1XSP A;  4GXK A;  3UXP A;  5L1K A;  1X66 A;  5F9L A;  2NRW A;  3L5K A;  2F76 X;  2WFA A;  2ZUC A;  1L7N A;  5EE1 A;  4EEK A;  4DS5 A;  4ELU A;  4ECY A;  8ICG A;  2K8A A;  2KFZ A;  4P0Q B;  5KG5 A;  1X9X A;  8ICA A;  5DKW A;  4NWI A;  1L3S A;  1QSL A;  1SV4 A;  4DWI A;  1PK1 B;  1SV0 C;  2F3N A;  2NO4 A;  2W3S A;  4EBD A;  4DFJ A;  4F71 A;  2LKY A;  1QCK A;  2NO5 A;  2BCQ A;  9ICV A;  3WK9 A;  1BNP A;  4UB5 A;  1O03 A;  4OD0 A;  2OH2 A;  2CPR A;  2Y0S C;  2HHS A;  2H3I A;  2F77 X;  1B22 A;  3RH6 A;  9ICI A;  4M9H A;  8ICJ A;  1T3Q A;  2KSO B;  4MHV A;  3M9M B;  2KN7 A;  2KIW A;  2RDI A;  4C4T A;  3QZ8 A;  3KHH A;  4I28 A;  4DSJ A;  4RUC A;  1K1Q A;  5BOM A;  1RDF A;  3V7J A;  4C8O A;  3HRD D;  3H0M B;  2E8M A;  3MR6 A;  3I1Y A;  3PW0 A;  1KRP A;  4J9L A;  9ICB A; 
#chains in the Genus database with same CATH homology
 1UHU A;  1MN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...