1MN8A

Structure of moloney murine leukaemia virus matrix protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
QTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structure of Moloney murine leukaemia virus matrix protein and its relationship to other retroviral matrix proteins.
pubmed doi rcsb
source organism Moloney murine leukemia virus
molecule tags Viral protein
molecule keywords Core protein p15
total genus 32
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.180 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Gamma-retroviral matrix domain 1mn8A00
1UHUA 1MN8A
chains in the Genus database with same CATH superfamily
5D49A 2DPJA 3VCBA 4RUCA 1ZQUA 5ALNA 2JR5A 2W8LA 1Z1VA 5J2DA 3UXNA 2W9AA 2HHWA 2ZUCA 4ECVA 1PVRA 3TKAA 5DBAA 4F5PA 3G6VA 4F5QA 7ICPA 7ICJA 9ICKA 3UQ2A 1T3NA 4DL5A 4YR0A 2KVSA 5IINA 4PGXA 2XI9A 2FI1A 3UM9A 3NGDA 1IIPA 5J29A 1ZQZA 2E3TA 4LZDA 2IBKA 2PFOA 3SV4A 1UA0A 2NO4A 1T94A 4KLMA 1FFUA 9ICLA 3T5LA 1ZQAA 2D3DA 4DOBA 2F2AB 3PO4A 3K1ZA 5KL8B 4MF2A 5J2GA 3OSPA 5H2FU 5L1KA 8ICLA 1SKWA 2WF6A 4O3OA 2EZYA 3B0XA 4M04A 1S77D 1BGXT 3BJYA 4LJXA 3I76A 5J0SA 2MA1A 1ZYQA 3SI8A 5ALSA 2FPLA 3PR4A 3WKAA 3E58A 2JZBB 4EX7A 2R8IA 1JI7A 9ICXA 3Q8SB 5J0UA 2I1QA 5AI0A 1VLBA 4RQNA 4RZRA 3H40A 2PI5A 3KHGA 2BCQA 1IV8A 4DEZA 4KLOA 2B21A 4R66A 4DQQA 4CDGA 2FMPA 1UHUA 1ZXIA 2ZTEA 1PK1B 2ASJA 4OJ6A 5CWRA 2GO7A 4DS5A 3HKZC 2BDPA 3RJIA 9ICRA 1Z00B 2JV3A 2LYAA 5ALKA 5AKHA 3C29A 3C23A 3H4DA 4EEKA 3C2LA 2P6RA 1FEZA 3KBBA 3WKBA 5KFJA 4I2HA 3GIKA 5J0PA 5ALTA 3GIJA 2WB1C 5TISU 3SMVA 2YMMA 3F2CA 2LYHA 3PW0A 4XQ8A 3KFUF 2ODGA 1IG6A 5KFIA 5CEHA 1XU4A 2K4EA 1KL9A 1ZQ1C 5KFGA 3RF9A 3T5JA 4NWIA 3IM1A 4K4HA 4HAIA 1Q8KA 8ICMA 3GZFA 4KLJA 3QUQA 5GTIU 5HMLA 2ZJ8A 4RQ5A 2Q0ZX 3V7LA 2KJ8A 1L3UA 3JPOA 5AK3A 5KFKA 1ZQXA 4K4GA 5KT2A 3EPIA 5J2AA 2FLLA 2YMPA 1IM4A 3EW9A 3MBYA 2BCSA 1COOA 4NLCA 1ZD3A 4ECTA 7ICHA 5EWFA 5CHGA 2BQUA 3RB3A 4CF5A 5J0OA 5DDYA 4BGDA 5J2JA 5KFTA 4KX5A 8ICAA 4UARA 4M6WB 3UXPA 2UVRA 3PV8A 3HILA 4DFJA 1AQ6A 1LV5A 1S0OA 1XSLA 5DKWA 3MGVA 2A3VA 4JV0A 1NZPA 2EDUA 2A1AA 1TVAA 1HUZA 3GIMA 5KFEA 3QUCA 1ZQSA 2NO5A 1LKYB 4UB4A 3E2EA 4GLXA 4I2AA 3WKEA 1ZQTA 3D6JA 2LPEA 3HW8A 4RQ8A 4O5EA 2PFNA 4X5VA 1SL0A 4B9NA 4DFPA 1S5LU 2N1RA 1ZQYA 2NV3A 3RFAA 4I2IA 2W7OA 1RG6A 4MHVA 5K4LA 2W04A 1ZD5A 3K4GA 5KNIA 4O3PA 4ELUA 3L4PA 3C21A 4QWBA 5ALFA 1KEJA 3WK4A 4B9LA 2BR0A 1UCVA 2BPCA 3QU5A 3BQ0A 2WF8A 3WKDA 3RJHA 1X66A 1MA7A 4FZLA 2RLTA 5AIAA 4F5RA 2K8AA 2E8MA 3T79A 1O03A 3V6JA 3LVWA 1MC8A 4KLQA 4J9KA 4DL7A 2HVHA 2KKVA 2D6FC 4GC7A 3OGUA 5DQIA 2W55A 2AGQA 1EXNA 4DLEA 1KKXA 2ALZA 2KIWA 3AM9A 4MFAA 3M1YA 5CR0A 3D2NA 1SL1A 5ALXA 1B0XA 1JXLA 1V38A 3CRXA 3BQ1A 3IRUA 2W3RA 2ZUDA 4QWAA 3PMLA 2UVVA 8ICYA 5DB8A 4CRXA 1QQ7A 3NVVA 4R65A 1JUDA 4C8MA 4QZHA 1UPHA 2R8HA 2F1IA 5EWGA 5IIJA 4YN4A 5D4BA 3OHBA 2EAMA 1D8BA 1Z1BA 4I28A 4QJFB 4RQMA 4DSEA 1ZQLA 2LMRA 4QNLA 3PW4A 2XICA 5J0XA 5KFZA 3PR5B 4FO6A 1WWUA 4TURA 3V7KA 3MC1A 1KLNA 2G5HB 3GIIA 5DG8A 2Y9TA 2JRZA 7ICIA 2B6GA 4M2YA 1D8YA 2EANA 5KG4A 2F3NA 5AHXA 1ED1A 1L7OA 1XNSA 2WFAA 2XVTA 3FC4A 4UAWA 5KFSA 3D2QA 5AKLA 1NK8A 2FLPA 3IV6A 3KKAA 5KFXA 2HBMA 2JGAA 3MR5A 2DKZA 1KW4A 2KP7A 1COKA 2YX8A 2E8PA 2XGQA 4WJ3B 2G06A 5ALHA 4GXJA 1TAUA 3RRGA 2AXTU 2D8CA 2ES6A 8ICQA 3PW5A 3PNCA 1OW5A 5AK4A 3ORYA 3TFSA 1SL2A 5IIKA 4GIBA 1MQ3A 2AJQA 2M0NA 4Y2UA 2E8OA 3ONNA 2KSOB 3LDAA 3M6KA 4FS2A 3PW2A 5ALIA 1DXSA 1YZ7A 3QZ7A 4F4KA 1RPLA 2KD1A 1QSLA 3AQEA 2O6KA 4PJ0U 2HBLA 2HHQA 5AM2A 4A8EA 1XWLA 3MR3A 2ZIUA 5AM0A 8ICPA 7ICOA 5AM1A 2GH1A 3RBDA 4QZEA 5F9NA 2Y1IA 2H3IA 3I28A 5KFOA 3JPRA 1F0MA 5AI6A 4C4TA 8ICOA 3KKAC 3B9JA 3RBEA 4DS4A 2EAOA 1Y88A 3MGIA 1VJ5A 1ECWA 4FZNA 2FLNA 4DSIA 5JU5A 2JMGA 1PK3A 4RT3A 4KITB 4IR1A 4B6JA 3A0HU 4DCCA 1J97A 5KAIU 4NXZA 2Y9UA 4YD1A 4Q8EA 3BS5B 4ED2A 4Y2JA 4BXOB 3NVWA 4I2FA 3T3FA 1L3VA 7ICLA 1V97A 5L1JA 4PHPA 3OJUA 3N28A 2K4PA 3C1YA 5J2EA 1ZQMA 4F93B 1N56A 3LYSA 5KFQA 2OH2A 4C8LA 1MN8A 4NLBA 2DKXA 3M9MB 2HSZA 2ZIVB 4QWDA 2PFPA 3MGHA 4JV1A 4PZOA 1HUOA 4XUSA 4MFFA 5KAFU 4GFJA 5ALZA 2ZG6A 1NJXA 5DBBA 4P0QB 4ELVA 5KG5A 4GC6A 1X42A 5J0YA 5DG7A 3LWMA 4BJQA 4F4ZA 1KFSA 1TV9A 4IRCA 4I29A 1QQ5A 2EQYA 5ALRA 4ECXA 3ZD8A 2HBKA 2FDRA 2I5HA 2V4QA 3GDXA 4BX9C 2DUYA 3T5KA 2UVUA 5L1MA 3H4BA 1O08A 4IL6U 5CA7A 3F2DA 9ICUA 7ICGA 4NL9C 3KZXA 1V85A 2DFLA 3AEVA 1NK5A 5DBCA 2NRVA 1ZQWA 4IR9A 3EPGA 4F50A 2BHNA 3PO5A 4RNMA 3JPPA 5HHIA 3TANA 4QZBA 3Q8MA 2ISOA 4JMUA 2JEFA 5J2CA 3PSPA 1UT8A 4ECUA 4IC9A 4ECQA 2J6SA 2H3VA 4Y2PA 3GV8B 3AU2A 1NJZA 7ICUA 4DSKA 1X9XA 2HI0A 2ZUBA 5J2KA 1X9SA 1SIJA 1RXVA 2OCEA 2BKEA 3V7JA 1X2IA 4Q45A 2WHEA 1BPEA 1WWVA 9ICPA 4IRKA 2H3QA 3SENA 3THVA 4RU9A 5AKEA 2V4RA 3MDAA 1VDVA 3PW7A 5J0TA 1WYGA 4RQ7A 1CI4A 2OXOA 4F5OA 5DGAA 2HDOA 2XIDA 3SD7A 2GOLA 2KZMA 4YXMA 4JK1A 3RTVA 4ELTA 3ZD9A 4K4IA 7ICVA 5KT5A 4KLSA 8ICXA 4YR2A 3BS7A 2AGOA 8ICEA 2HBJA 4TQRA 4B9UA 4UB2A 4GXIA 4AYBF 2HCFA 2F1JA 4DLGA 1KBUA 3DDHA 1FO4A 4RNOA 2W9BA 2QB1A 3NUQA 3WK8A 1MSWD 3ZDEA 1XS9D 1J2NA 4DSLA 4QZFA 3ISCA 4J9RA 2G0AA 3LVVA 4QZDA 1SGGA 1B22A 2ESEA 3RB6A 5ALLA 1T7PA 4C8OA 1ZQIA 4YR3A 1NJWA 4BXOA 1A0PA 4M47A 2HHSA 8ICVA 8ICSA 9ICEA 2K60A 3N7PD 2VJ5A 1KRPA 2ZIVA 4U7CA 2IA6A 4DSJA 5KFVA 3H0RB 3IHQB 5TZVA 2HHXA 4OJ5A 2IMWP 4JWMA 3RRHA 3H8JA 1ZD2P 3UXOA 5IIMA 3TACB 3KD3A 2ZTCA 2B0CA 3U26A 2BQ3A 1NK4A 5J2FA 1DGJA 4TQSA 3BDPA 1NZBA 5E79U 4DL4A 2ATLA 1N62A 3HX0A 5KT4A 1QH9A 2FPMA 1S0VA 5DQGA 2ZIXA 1KDHA 2W9MA 3SV3A 2P66A 4DO9A 2BZFA 2G5IB 2W7PA 1J2MA 4KTQA 4EYIB 4EYHB 1UA1A 1ZQPA 3F5AA 1SV0C 4J9NA 1ZQFA 4MFCA 1S76D 2ZJAA 1TE2A 2W11A 4QIWC 3ED5A 4J03A 1L5UA 5EOZA 4C8KA 4I2EA 1UQVA 3Q8PB 4RPYA 4IQTA 3MR6A 3GU3A 3QU7A 4PHAA 7ICNA 5AKGA 4MF8A 1RZTA 1NJYA 4CF4A 4YMOA 9ICOA 2XO7A 1P7DA 4RNNA 3RH4A 5IIOA 5KTQA 2UVWA 2VA2A 2FE9A 4I2BA 5JTIA 4IQUA 3KHLA 3Q8LA 4QZCA 9ICWA 4RQ1A 5ALGA 2ASLA 3FYHA 1T8EA 1SXEA 5J8YA 3KHRA 2QB0A 1URJA 1X40A 1BNOA 1NNLA 3ETRA 3UPQA 4P0PA 5JRTA 2WF5A 1Z00A 4UB5A 1QCKA 2QKQA 3C28A 4QW9A 3TQ1A 2F8LA 2W9CB 1K1SA 1KFTA 1S0NA 3UMGA 3M9OB 4PGYA 2R8JA 1PUZA 1NK6A 3H0LB 4R63A 3SAHA 3MDCA 2KFNA 3N4MB 5L1IA 3G6YA 1WCNA 3QYPA 9ICMA 2CRXA 4PPXA 4PL1A 2HW3A 4UASA 4Y2YA 4DL3A 1ZQGA 4UATA 4O0IA 4DQPA 3SAFA 3IN5A 1ZQJA 2XCPA 3BS5A 3RR8A 1BPDA 2A19A 5AK5A 2IHNA 4UAZA 1V9PA 2JXJA 3FM9A 4J9SA 5EE1A 2ZXIA 4DQIA 5HR6A 2K89A 3FDSA 2PXIA 4M9JA 1BPXA 5F3XB 9ICHA 4RUAA 2C2EA 1KN5A 5IILA 4KLEA 4R8UB 3OSNA 1FFVA 5DB6A 3ICXA 4Y2TA 5AM5A 4UAVA 3OPXA 2Z7JA 3QU4A 5KFNA 2DWQA 4KLDA 5DLFA 4FZMA 1CEZA 4DFMA 1D9FA 2QARB 4EBDA 2MU2A 4OCZA 4PL2A 1DK3A 3HT3A 5AKJA 5HMMA 4RT2A 2NRTA 3MR2A 5L1LA 2AGPA 5L9XA 1ZJNA 2C22A 5G5HA 4CE6A 4TUQA 5ALEA 1DOQA 9ICGA 2KSOA 4G3IA 5ALQA 4NY8A 4YMNA 2LBOA 1LB2B 2KHVA 3DV9A 2HHUA 2AQ4A 3RJKA 2HVIA 5ALUA 4C8NA 4HYKA 5HHHA 2XCAA 4Y2QA 5ALWA 1XSPA 4FE3A 1RXWA 2GWSA 1LKYA 2LI6A 4B9SA 4ZOHC 1N5XA 2HHTA 4C4RA 1S10A 7ICKA 4F4YA 2KHQA 4RQ3A 2FMQA 1K5OA 4BWJA 2XY6A 4J9QA 4UB1A 4IS7A 5DLGA 1U4BA 3QUBA 4M9NA 3WK7A 4J9MA 4O9MA 1UT5A 4PHDA 1ZQQA 4ED6A 1F5SA 4Z6CA 3C5GA 3JPTA 3D2SA 4J9OA 2EH9A 2W54A 3QEBZ 2LM1A 2F44A 8ICTA 4BWMA 3K75D 8ICKA 1X9WA 5BPCA 2RRDA 5C5JA 1C7YA 1U49A 5T14A 8ICCA 2ZJ5A 1PVPA 4O3SA 4Z6FA 2YB1A 2KFZA 3QNMA 1OUQA 4FFDA 5AKIA 2KG5A 2E1EA 3QZ8A 1TKDA 3CYMA 5CB1A 2F8KA 3UMCA 2BDUA 1RYUA 5JUMA 5DGBA 5ALVA 1NOMA 1B43A 9ICVA 3UQ0A 3PZPA 1QTMA 3QEAZ 5EE0A 4AYBC 3ZDCA 2Y0SF 3L3FX 1X9MA 4M9LA 5AI9A 3O0FA 1LVHA 4BDPA 2YMLA 3JPNA 4ED7A 3G6XA 4I2CA 5KL1B 4OJLA 4YFKA 2JHDA 2WAQF 2J6UA 3N7RC 1XO1A 4Z6DA 1U47A 7ICEA 3RAXA 2YMQA 4UAYA 1X6IA 2WB1F 4YVZA 2MAXA 3TFRA 5J2BA 5AK6A 2KZ3A 3E0FA 1NKCA 3QE9Y 1H38A 1BNPA 4ECSA 2EZXA 3OJSA 5J2IA 4TUSA 1WUDA 4ED0A 5KFBA 4UW9A 2QB0B 1Z19A 5KG0A 2WF7A 1NK7A 1HJPA 3BZKA 1PK1A 2KMDA 2R18A 2YN4A 2G09A 2J6TA 2VIXA 2KKPA 1A76A 4DOAA 4NV0A 2BCRA 4IQVA 4PZNA 4RQ2A 3H8WA 1ZQCA 3KZIU 2C2RA 3CP8A 1Q3VA 1A6SA 2P6UA 5DB9A 3SQIA 3ZDAA 2ZIXB 3NVZA 4PGQA 4O5KA 3EUB2 2W43A 4OD0A 4I2JA 5KFHA 4DQSA 3ISDA 2KEYA 1SZHA 3EWAA 4Y2XA 2QARA 3WKCA 3PMNA 5FP0A 7ICRA 4DFDA 3HPOA 4O5CA 4NM2A 3RH6A 4O3QA 4ECRA 5ALDA 3C2MA 2M9NA 3ALRA 4EELA 2WAQC 2K8CB 2ASDA 1N61A 1SWWA 4QWEA 8ICHA 8ICIA 4O3NA 5HP4A 1BPYA 4KLUA 1ZQOA 2ISPA 4EZ6A 1NK9A 1Z3EB 2Y0SC 1L7MA 2V9WA 3CW2C 4YP3A 4QIWF 4JWNA 1K1QA 3ETLA 3AL0B 4US9A 2YQEA 1XO0A 3IG5A 4P4OA 3JPSA 3TADA 2DBYA 1WG8A 3EZ5A 1BPBA 5IIIA 2W9BB 2K4IA 3KHHA 4NLZA 4FBUA 2R8GA 4LZGA 3SAGA 4Q44A 2EZZA 9ICBA 2NRWA 4C4SA 2P35A 2KV2A 4KLHA 3GV5B 4US8A 4C7YA 1ZJMA 4QW8A 1TFRA 2EAPA 4UBBA 4E0DA 7ICFA 3J81j 5BOLA 3RH5A 3H8MA 3ZDDA 4RPXA 5B5EU 4QZGA 2JEJA 2KIVA 4O3MA 4F71A 1ZQDA 1SXDA 2PFQA 4F3OA 3AQFA 3BZCA 4KN4A 4CNQA 4P2HA 4RQ0A 1JN3A 1N5WA 2MUTB 2ZIWA 1RDFA 1ZQHA 4C80A 1QSYA 1ZETA 3F2BA 2RHFA 4DSFA 4YG2A 8ICGA 3SR6A 1ZRMA 2GLEA 3H0MB 4R8UA 3KOOA 1L7PA 1NI3A 4MEXA 1RM6C 2I6XA 4ED8A 3PX4A 1PVQA 5KT6A 4M0AA 1D9DA 3WK5A 2L5YA 2KVCA 3HJEA 1L8OA 2XGPA 3HWTA 2KN7A 4DF8A 7ICQA 2KNJA 1SKSA 3ZI4A 3Q8KA 3RAQA 2JEIA 5DDMA 4NJ8A 9ICTA 2H3FA 5AIBA 1ZQBA 3TI0A 9ICAA 1AROP 1S0MA 4EZ9A 4DL6A 2LYBA 5KG1A 2XY7A 4NLNA 2KK0A 1JROA 4OO1J 1S9FA 7ICMA 3AUOA 5KFDA 4Q43A 2R8KA 3BQ7A 2DL0A 2KJ5A 2KOBA 4QZ9A 1L6NA 1L7NA 1SZPA 1Z4OA 3IG8A 3Q8RB 3C1ZA 1RYRA 2F77X 1JXEA 4F8RA 3HRDD 3V6HA 3SEIA 2KICA 1CUKA 1RYSA 1HEKA 3V72A 1Q46A 5KFLA 1XSNA 4YXJA 4G9BA 3M7DA 1ZQKA 4PH5A 4I2GA 1T3QA 3B0YA 4KLTA 4P4PA 3T5HA 2IOHA 4UAUA 4ACOA 1CRXA 5KG6A 2BPFA 3EYZA 5AKXA 3JPQA 4QZIA 4BUGA 5G5GA 5ALPA 2E8NA 5CP2A 4M9HA 2H5XA 1OXJA 5AI8A 4F2RA 3OTQA 2YY6A 1HIWA 2G07A 3WK9A 3AMZA 5KFCA 3QX7A 3OHAA 2K4HA 2KJ9A 1KSPA 1DRGA 4RQ6A 4YD2A 3PVXA 1DGSA 5CJ7A 3NTUA 5AKKA 4CGZA 5AI4A 4P4MA 8ICWA 4KLGA 2AQ0A 3N97B 1NK0A 2OWOA 3C5FA 1A77A 3M8SA 2JH7A 2WF9A 2OEHA 4UB3A 2NRZA 9ICNA 5HR7A 3CNHA 2C28A 5KFPA 5J0RA 2OHFA 3FAHA 1N60A 4RQ4A 3RJFA 3H7IA 3RJGA 2BQRA 2ZIUB 4JB3A 1L3TA 2XY5A 2BCUA 3M9NB 4F4WA 3PX0A 4B9TA 3PSIA 1L3SA 4NLKA 5EE9A 1RQLA 3A0BU 2RDJA 2W9CA 4B9VA 4DWIA 1S8OA 4DF4A 1JMSA 4UB6U 3AN1A 1U45A 2I9GA 1ZOLA 3RB0A 3GILA 1N63A 1BPZA 1T4GA 2NRXA 4JUZA 3F53A 1JX4A 2IOFK 3MFIA 7ICTA 9ICSA 3BQTA 4GXKA 4KX3A 4UQGA 1L8LA 3KTQA 4QZ8A 4RPZA 4I27A 3TADC 4XRHA 1IXRA 4YCXA 1M6YA 5KFUA 3QU2A 1SV4A 3RJJA 5CRXA 5DG9A 3NRWA 4ECYA 4ED3A 3UMBA 5EWEA 4CCHA 4QZAA 3AU6A 4P0QA 5GTHU 2AHOB 4U6PA 2NYVA 1TK5A 2KZZA 1B4FA 5C0YA 1C20A 1ZQVA 4EBCA 3LK9A 2JH1A 1PZNA 3GV7B 4OJOA 2YB4A 1F44A 2RQ5A 4KMUA 1TAMA 4NLGA 2BGWA 4Z6EA 5KFRA 2PI4A 4J9LA 4Q8FA 3GFKB 4M6WA 3I1YA 3H8SA 2A1JA 4KMOB 2OM6A 3PSFA 2K8BB 5KFWA 3TARA 1X6JA 8ICZA 2VKQA 4EENA 1SKRA 1ZQRA 7ICSA 2CXYA 3M6ZA 1KQQA 4O3RA 1XC9A 4XA5A 2OYYA 4YQWA 2CN1A 2MRLA 3LWLA 3IP4B 3PX6A 8ICNA 3IDWA 2FPKA 4ECWA 5DB7A 5AM4A 5DQHA 1JRPA 1FIQA 2VA3A 2VANA 2KE7A 3WU2U 4F2SA 4Y2RA 1SB3C 4F5NA 2XC9A 2BPGA 3QU9A 1N2XA 4LVSA 2F76X 2RDIA 2IHMA 4ED1A 3RJEA 1U9LA 3K1RB 5KFAA 5D46A 2LHTA 4YMMA 5KFMA 2MUTA 3C2KA 2HOIA 4AP9A 2C2DA 2KTQA 9ICIA 2QLTA 3L5KA 5AI5A 1QQ6A 1TK0A 2F1HA 2FJ6A 1YZ6A 1U48A 4DL2A 4R64A 4P0PB 3SZ2A 3NS1A 3MABA 2PKEA 2PMZC 3S6JA 5KG3A 3HKZF 4UBCA 4KN7A 1D8LA 1ZQEA 4ECZA 3NRZA 2HHVA 3N7SC 8ICBA 4DFKA 9ICFA 2BCVA 1QSSA 4EX6A 1SWVA 4Y2VA 4J9PA 1S97A 1TAQA 3TAQA 3VC8A 4KLIA 1YT3A 3ZDBA 5AKYA 1TK8A 2RP5A 2ZXHA 4F72A 2DQNB 4C0ZA 5KT7A 4QWCA 9ICQA 3QUTA 5KG2A 4OJPA 3QXGA 2LM4A 1QLNA 1ZQNA 1JALA 3PY8A 3NASA 2HOFA 2W03A 1BVSA 5KG7A 2JZBA 8ICUA 1Q3UA 3MFHA 3ISBA 2YTUA 4IRDA 1ZRNA 5J2HA 4CF3A 2PMZF 2HMXA 1N48A 4M9GA 8ICFA 4F4XA 1MQ2A 4KLFA 2VJ4A 1JIHA 2E1FA 2DGZA 5AICA 3WK6A 2A1JB 1DK2A 3V6KA 4F92B 5J0QA 1ZD4A 4ZH4A 2FMSA 2E5SA 4NL9A 2ZTDA 9ICJA 2VA8A 2G08A 3DEEA 1KTQA 1NKBA 4NM1A 2CPRA 5F9LA 5ALOA 4C7ZA 2W3SA 3RB4A 3Q8QB 2H3ZA 2IOFA 3NVYA 2Y1JA 4FS1A 2JEGA 1NKEA 3SYZA 2HOQA 4UB8U 5EE3A 3R9KA 3GQCA 4TUPA 1SV0A 4ICAA 5J0WA 3RR7A 5J8YC 5A0LA 5KT3A 4EEYA 5HNKA 2AH5A 1RQNA 1KFDA 5KFYA 5ALJA 5KFFA 5ALMA 5BOMA 4PHEA 1GO3F 4JV2A 1WCLA 4FBTA 4IQWA 2Q4TA 4Y2SA 4KLLA 9ICCA 2DF4B 4I2DA 2W8KA 2AU0A 5AKZA 4DQRA 4F91B 2ZIWB 5AM3A 3BQ2A 2LKYA 5ALYA 5B66U 2WTFA 1Z4NA 3HP6A 8ICJA 3PSTA 2MSNA 3F5EA 4EBEA 3TAPA 8ICRA 3M8RA 4MEYA 2DPIA 4USAA 4DOCA 4B9MA
chains in the Genus database with same CATH topology
1UHUA 1MN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHU A;  1MN8 A; 
#chains in the Genus database with same CATH topology
 5D49 A;  2DPJ A;  3VCB A;  4RUC A;  1ZQU A;  5ALN A;  2JR5 A;  2W8L A;  1Z1V A;  5J2D A;  3UXN A;  2W9A A;  2HHW A;  2ZUC A;  4ECV A;  1PVR A;  3TKA A;  5DBA A;  4F5P A;  3G6V A;  4F5Q A;  7ICP A;  7ICJ A;  9ICK A;  3UQ2 A;  1T3N A;  4DL5 A;  4YR0 A;  2KVS A;  5IIN A;  4PGX A;  2XI9 A;  2FI1 A;  3UM9 A;  3NGD A;  1IIP A;  5J29 A;  1ZQZ A;  2E3T A;  4LZD A;  2IBK A;  2PFO A;  3SV4 A;  1UA0 A;  2NO4 A;  1T94 A;  4KLM A;  1FFU A;  9ICL A;  3T5L A;  1ZQA A;  2D3D A;  4DOB A;  2F2A B;  3PO4 A;  3K1Z A;  5KL8 B;  4MF2 A;  5J2G A;  3OSP A;  5H2F U;  5L1K A;  8ICL A;  1SKW A;  2WF6 A;  4O3O A;  2EZY A;  3B0X A;  4M04 A;  1S77 D;  1BGX T;  3BJY A;  4LJX A;  3I76 A;  5J0S A;  2MA1 A;  1ZYQ A;  3SI8 A;  5ALS A;  2FPL A;  3PR4 A;  3WKA A;  3E58 A;  2JZB B;  4EX7 A;  2R8I A;  1JI7 A;  9ICX A;  3Q8S B;  5J0U A;  2I1Q A;  5AI0 A;  1VLB A;  4RQN A;  4RZR A;  3H40 A;  2PI5 A;  3KHG A;  2BCQ A;  1IV8 A;  4DEZ A;  4KLO A;  2B21 A;  4R66 A;  4DQQ A;  4CDG A;  2FMP A;  1UHU A;  1ZXI A;  2ZTE A;  1PK1 B;  2ASJ A;  4OJ6 A;  5CWR A;  2GO7 A;  4DS5 A;  3HKZ C;  2BDP A;  3RJI A;  9ICR A;  1Z00 B;  2JV3 A;  2LYA A;  5ALK A;  5AKH A;  3C29 A;  3C23 A;  3H4D A;  4EEK A;  3C2L A;  2P6R A;  1FEZ A;  3KBB A;  3WKB A;  5KFJ A;  4I2H A;  3GIK A;  5J0P A;  5ALT A;  3GIJ A;  2WB1 C;  5TIS U;  3SMV A;  2YMM A;  3F2C A;  2LYH A;  3PW0 A;  4XQ8 A;  3KFU F;  2ODG A;  1IG6 A;  5KFI A;  5CEH A;  1XU4 A;  2K4E A;  1KL9 A;  1ZQ1 C;  5KFG A;  3RF9 A;  3T5J A;  4NWI A;  3IM1 A;  4K4H A;  4HAI A;  1Q8K A;  8ICM A;  3GZF A;  4KLJ A;  3QUQ A;  5GTI U;  5HML A;  2ZJ8 A;  4RQ5 A;  2Q0Z X;  3V7L A;  2KJ8 A;  1L3U A;  3JPO A;  5AK3 A;  5KFK A;  1ZQX A;  4K4G A;  5KT2 A;  3EPI A;  5J2A A;  2FLL A;  2YMP A;  1IM4 A;  3EW9 A;  3MBY A;  2BCS A;  1COO A;  4NLC A;  1ZD3 A;  4ECT A;  7ICH A;  5EWF A;  5CHG A;  2BQU A;  3RB3 A;  4CF5 A;  5J0O A;  5DDY A;  4BGD A;  5J2J A;  5KFT A;  4KX5 A;  8ICA A;  4UAR A;  4M6W B;  3UXP A;  2UVR A;  3PV8 A;  3HIL A;  4DFJ A;  1AQ6 A;  1LV5 A;  1S0O A;  1XSL A;  5DKW A;  3MGV A;  2A3V A;  4JV0 A;  1NZP A;  2EDU A;  2A1A A;  1TVA A;  1HUZ A;  3GIM A;  5KFE A;  3QUC A;  1ZQS A;  2NO5 A;  1LKY B;  4UB4 A;  3E2E A;  4GLX A;  4I2A A;  3WKE A;  1ZQT A;  3D6J A;  2LPE A;  3HW8 A;  4RQ8 A;  4O5E A;  2PFN A;  4X5V A;  1SL0 A;  4B9N A;  4DFP A;  1S5L U;  2N1R A;  1ZQY A;  2NV3 A;  3RFA A;  4I2I A;  2W7O A;  1RG6 A;  4MHV A;  5K4L A;  2W04 A;  1ZD5 A;  3K4G A;  5KNI A;  4O3P A;  4ELU A;  3L4P A;  3C21 A;  4QWB A;  5ALF A;  1KEJ A;  3WK4 A;  4B9L A;  2BR0 A;  1UCV A;  2BPC A;  3QU5 A;  3BQ0 A;  2WF8 A;  3WKD A;  3RJH A;  1X66 A;  1MA7 A;  4FZL A;  2RLT A;  5AIA A;  4F5R A;  2K8A A;  2E8M A;  3T79 A;  1O03 A;  3V6J A;  3LVW A;  1MC8 A;  4KLQ A;  4J9K A;  4DL7 A;  2HVH A;  2KKV A;  2D6F C;  4GC7 A;  3OGU A;  5DQI A;  2W55 A;  2AGQ A;  1EXN A;  4DLE A;  1KKX A;  2ALZ A;  2KIW A;  3AM9 A;  4MFA A;  3M1Y A;  5CR0 A;  3D2N A;  1SL1 A;  5ALX A;  1B0X A;  1JXL A;  1V38 A;  3CRX A;  3BQ1 A;  3IRU A;  2W3R A;  2ZUD A;  4QWA A;  3PML A;  2UVV A;  8ICY A;  5DB8 A;  4CRX A;  1QQ7 A;  3NVV A;  4R65 A;  1JUD A;  4C8M A;  4QZH A;  1UPH A;  2R8H A;  2F1I A;  5EWG A;  5IIJ A;  4YN4 A;  5D4B A;  3OHB A;  2EAM A;  1D8B A;  1Z1B A;  4I28 A;  4QJF B;  4RQM A;  4DSE A;  1ZQL A;  2LMR A;  4QNL A;  3PW4 A;  2XIC A;  5J0X A;  5KFZ A;  3PR5 B;  4FO6 A;  1WWU A;  4TUR A;  3V7K A;  3MC1 A;  1KLN A;  2G5H B;  3GII A;  5DG8 A;  2Y9T A;  2JRZ A;  7ICI A;  2B6G A;  4M2Y A;  1D8Y A;  2EAN A;  5KG4 A;  2F3N A;  5AHX A;  1ED1 A;  1L7O A;  1XNS A;  2WFA A;  2XVT A;  3FC4 A;  4UAW A;  5KFS A;  3D2Q A;  5AKL A;  1NK8 A;  2FLP A;  3IV6 A;  3KKA A;  5KFX A;  2HBM A;  2JGA A;  3MR5 A;  2DKZ A;  1KW4 A;  2KP7 A;  1COK A;  2YX8 A;  2E8P A;  2XGQ A;  4WJ3 B;  2G06 A;  5ALH A;  4GXJ A;  1TAU A;  3RRG A;  2AXT U;  2D8C A;  2ES6 A;  8ICQ A;  3PW5 A;  3PNC A;  1OW5 A;  5AK4 A;  3ORY A;  3TFS A;  1SL2 A;  5IIK A;  4GIB A;  1MQ3 A;  2AJQ A;  2M0N A;  4Y2U A;  2E8O A;  3ONN A;  2KSO B;  3LDA A;  3M6K A;  4FS2 A;  3PW2 A;  5ALI A;  1DXS A;  1YZ7 A;  3QZ7 A;  4F4K A;  1RPL A;  2KD1 A;  1QSL A;  3AQE A;  2O6K A;  4PJ0 U;  2HBL A;  2HHQ A;  5AM2 A;  4A8E A;  1XWL A;  3MR3 A;  2ZIU A;  5AM0 A;  8ICP A;  7ICO A;  5AM1 A;  2GH1 A;  3RBD A;  4QZE A;  5F9N A;  2Y1I A;  2H3I A;  3I28 A;  5KFO A;  3JPR A;  1F0M A;  5AI6 A;  4C4T A;  8ICO A;  3KKA C;  3B9J A;  3RBE A;  4DS4 A;  2EAO A;  1Y88 A;  3MGI A;  1VJ5 A;  1ECW A;  4FZN A;  2FLN A;  4DSI A;  5JU5 A;  2JMG A;  1PK3 A;  4RT3 A;  4KIT B;  4IR1 A;  4B6J A;  3A0H U;  4DCC A;  1J97 A;  5KAI U;  4NXZ A;  2Y9U A;  4YD1 A;  4Q8E A;  3BS5 B;  4ED2 A;  4Y2J A;  4BXO B;  3NVW A;  4I2F A;  3T3F A;  1L3V A;  7ICL A;  1V97 A;  5L1J A;  4PHP A;  3OJU A;  3N28 A;  2K4P A;  3C1Y A;  5J2E A;  1ZQM A;  4F93 B;  1N56 A;  3LYS A;  5KFQ A;  2OH2 A;  4C8L A;  1MN8 A;  4NLB A;  2DKX A;  3M9M B;  2HSZ A;  2ZIV B;  4QWD A;  2PFP A;  3MGH A;  4JV1 A;  4PZO A;  1HUO A;  4XUS A;  4MFF A;  5KAF U;  4GFJ A;  5ALZ A;  2ZG6 A;  1NJX A;  5DBB A;  4P0Q B;  4ELV A;  5KG5 A;  4GC6 A;  1X42 A;  5J0Y A;  5DG7 A;  3LWM A;  4BJQ A;  4F4Z A;  1KFS A;  1TV9 A;  4IRC A;  4I29 A;  1QQ5 A;  2EQY A;  5ALR A;  4ECX A;  3ZD8 A;  2HBK A;  2FDR A;  2I5H A;  2V4Q A;  3GDX A;  4BX9 C;  2DUY A;  3T5K A;  2UVU A;  5L1M A;  3H4B A;  1O08 A;  4IL6 U;  5CA7 A;  3F2D A;  9ICU A;  7ICG A;  4NL9 C;  3KZX A;  1V85 A;  2DFL A;  3AEV A;  1NK5 A;  5DBC A;  2NRV A;  1ZQW A;  4IR9 A;  3EPG A;  4F50 A;  2BHN A;  3PO5 A;  4RNM A;  3JPP A;  5HHI A;  3TAN A;  4QZB A;  3Q8M A;  2ISO A;  4JMU A;  2JEF A;  5J2C A;  3PSP A;  1UT8 A;  4ECU A;  4IC9 A;  4ECQ A;  2J6S A;  2H3V A;  4Y2P A;  3GV8 B;  3AU2 A;  1NJZ A;  7ICU A;  4DSK A;  1X9X A;  2HI0 A;  2ZUB A;  5J2K A;  1X9S A;  1SIJ A;  1RXV A;  2OCE A;  2BKE A;  3V7J A;  1X2I A;  4Q45 A;  2WHE A;  1BPE A;  1WWV A;  9ICP A;  4IRK A;  2H3Q A;  3SEN A;  3THV A;  4RU9 A;  5AKE A;  2V4R A;  3MDA A;  1VDV A;  3PW7 A;  5J0T A;  1WYG A;  4RQ7 A;  1CI4 A;  2OXO A;  4F5O A;  5DGA A;  2HDO A;  2XID A;  3SD7 A;  2GOL A;  2KZM A;  4YXM A;  4JK1 A;  3RTV A;  4ELT A;  3ZD9 A;  4K4I A;  7ICV A;  5KT5 A;  4KLS A;  8ICX A;  4YR2 A;  3BS7 A;  2AGO A;  8ICE A;  2HBJ A;  4TQR A;  4B9U A;  4UB2 A;  4GXI A;  4AYB F;  2HCF A;  2F1J A;  4DLG A;  1KBU A;  3DDH A;  1FO4 A;  4RNO A;  2W9B A;  2QB1 A;  3NUQ A;  3WK8 A;  1MSW D;  3ZDE A;  1XS9 D;  1J2N A;  4DSL A;  4QZF A;  3ISC A;  4J9R A;  2G0A A;  3LVV A;  4QZD A;  1SGG A;  1B22 A;  2ESE A;  3RB6 A;  5ALL A;  1T7P A;  4C8O A;  1ZQI A;  4YR3 A;  1NJW A;  4BXO A;  1A0P A;  4M47 A;  2HHS A;  8ICV A;  8ICS A;  9ICE A;  2K60 A;  3N7P D;  2VJ5 A;  1KRP A;  2ZIV A;  4U7C A;  2IA6 A;  4DSJ A;  5KFV A;  3H0R B;  3IHQ B;  5TZV A;  2HHX A;  4OJ5 A;  2IMW P;  4JWM A;  3RRH A;  3H8J A;  1ZD2 P;  3UXO A;  5IIM A;  3TAC B;  3KD3 A;  2ZTC A;  2B0C A;  3U26 A;  2BQ3 A;  1NK4 A;  5J2F A;  1DGJ A;  4TQS A;  3BDP A;  1NZB A;  5E79 U;  4DL4 A;  2ATL A;  1N62 A;  3HX0 A;  5KT4 A;  1QH9 A;  2FPM A;  1S0V A;  5DQG A;  2ZIX A;  1KDH A;  2W9M A;  3SV3 A;  2P66 A;  4DO9 A;  2BZF A;  2G5I B;  2W7P A;  1J2M A;  4KTQ A;  4EYI B;  4EYH B;  1UA1 A;  1ZQP A;  3F5A A;  1SV0 C;  4J9N A;  1ZQF A;  4MFC A;  1S76 D;  2ZJA A;  1TE2 A;  2W11 A;  4QIW C;  3ED5 A;  4J03 A;  1L5U A;  5EOZ A;  4C8K A;  4I2E A;  1UQV A;  3Q8P B;  4RPY A;  4IQT A;  3MR6 A;  3GU3 A;  3QU7 A;  4PHA A;  7ICN A;  5AKG A;  4MF8 A;  1RZT A;  1NJY A;  4CF4 A;  4YMO A;  9ICO A;  2XO7 A;  1P7D A;  4RNN A;  3RH4 A;  5IIO A;  5KTQ A;  2UVW A;  2VA2 A;  2FE9 A;  4I2B A;  5JTI A;  4IQU A;  3KHL A;  3Q8L A;  4QZC A;  9ICW A;  4RQ1 A;  5ALG A;  2ASL A;  3FYH A;  1T8E A;  1SXE A;  5J8Y A;  3KHR A;  2QB0 A;  1URJ A;  1X40 A;  1BNO A;  1NNL A;  3ETR A;  3UPQ A;  4P0P A;  5JRT A;  2WF5 A;  1Z00 A;  4UB5 A;  1QCK A;  2QKQ A;  3C28 A;  4QW9 A;  3TQ1 A;  2F8L A;  2W9C B;  1K1S A;  1KFT A;  1S0N A;  3UMG A;  3M9O B;  4PGY A;  2R8J A;  1PUZ A;  1NK6 A;  3H0L B;  4R63 A;  3SAH A;  3MDC A;  2KFN A;  3N4M B;  5L1I A;  3G6Y A;  1WCN A;  3QYP A;  9ICM A;  2CRX A;  4PPX A;  4PL1 A;  2HW3 A;  4UAS A;  4Y2Y A;  4DL3 A;  1ZQG A;  4UAT A;  4O0I A;  4DQP A;  3SAF A;  3IN5 A;  1ZQJ A;  2XCP A;  3BS5 A;  3RR8 A;  1BPD A;  2A19 A;  5AK5 A;  2IHN A;  4UAZ A;  1V9P A;  2JXJ A;  3FM9 A;  4J9S A;  5EE1 A;  2ZXI A;  4DQI A;  5HR6 A;  2K89 A;  3FDS A;  2PXI A;  4M9J A;  1BPX A;  5F3X B;  9ICH A;  4RUA A;  2C2E A;  1KN5 A;  5IIL A;  4KLE A;  4R8U B;  3OSN A;  1FFV A;  5DB6 A;  3ICX A;  4Y2T A;  5AM5 A;  4UAV A;  3OPX A;  2Z7J A;  3QU4 A;  5KFN A;  2DWQ A;  4KLD A;  5DLF A;  4FZM A;  1CEZ A;  4DFM A;  1D9F A;  2QAR B;  4EBD A;  2MU2 A;  4OCZ A;  4PL2 A;  1DK3 A;  3HT3 A;  5AKJ A;  5HMM A;  4RT2 A;  2NRT A;  3MR2 A;  5L1L A;  2AGP A;  5L9X A;  1ZJN A;  2C22 A;  5G5H A;  4CE6 A;  4TUQ A;  5ALE A;  1DOQ A;  9ICG A;  2KSO A;  4G3I A;  5ALQ A;  4NY8 A;  4YMN A;  2LBO A;  1LB2 B;  2KHV A;  3DV9 A;  2HHU A;  2AQ4 A;  3RJK A;  2HVI A;  5ALU A;  4C8N A;  4HYK A;  5HHH A;  2XCA A;  4Y2Q A;  5ALW A;  1XSP A;  4FE3 A;  1RXW A;  2GWS A;  1LKY A;  2LI6 A;  4B9S A;  4ZOH C;  1N5X A;  2HHT A;  4C4R A;  1S10 A;  7ICK A;  4F4Y A;  2KHQ A;  4RQ3 A;  2FMQ A;  1K5O A;  4BWJ A;  2XY6 A;  4J9Q A;  4UB1 A;  4IS7 A;  5DLG A;  1U4B A;  3QUB A;  4M9N A;  3WK7 A;  4J9M A;  4O9M A;  1UT5 A;  4PHD A;  1ZQQ A;  4ED6 A;  1F5S A;  4Z6C A;  3C5G A;  3JPT A;  3D2S A;  4J9O A;  2EH9 A;  2W54 A;  3QEB Z;  2LM1 A;  2F44 A;  8ICT A;  4BWM A;  3K75 D;  8ICK A;  1X9W A;  5BPC A;  2RRD A;  5C5J A;  1C7Y A;  1U49 A;  5T14 A;  8ICC A;  2ZJ5 A;  1PVP A;  4O3S A;  4Z6F A;  2YB1 A;  2KFZ A;  3QNM A;  1OUQ A;  4FFD A;  5AKI A;  2KG5 A;  2E1E A;  3QZ8 A;  1TKD A;  3CYM A;  5CB1 A;  2F8K A;  3UMC A;  2BDU A;  1RYU A;  5JUM A;  5DGB A;  5ALV A;  1NOM A;  1B43 A;  9ICV A;  3UQ0 A;  3PZP A;  1QTM A;  3QEA Z;  5EE0 A;  4AYB C;  3ZDC A;  2Y0S F;  3L3F X;  1X9M A;  4M9L A;  5AI9 A;  3O0F A;  1LVH A;  4BDP A;  2YML A;  3JPN A;  4ED7 A;  3G6X A;  4I2C A;  5KL1 B;  4OJL A;  4YFK A;  2JHD A;  2WAQ F;  2J6U A;  3N7R C;  1XO1 A;  4Z6D A;  1U47 A;  7ICE A;  3RAX A;  2YMQ A;  4UAY A;  1X6I A;  2WB1 F;  4YVZ A;  2MAX A;  3TFR A;  5J2B A;  5AK6 A;  2KZ3 A;  3E0F A;  1NKC A;  3QE9 Y;  1H38 A;  1BNP A;  4ECS A;  2EZX A;  3OJS A;  5J2I A;  4TUS A;  1WUD A;  4ED0 A;  5KFB A;  4UW9 A;  2QB0 B;  1Z19 A;  5KG0 A;  2WF7 A;  1NK7 A;  1HJP A;  3BZK A;  1PK1 A;  2KMD A;  2R18 A;  2YN4 A;  2G09 A;  2J6T A;  2VIX A;  2KKP A;  1A76 A;  4DOA A;  4NV0 A;  2BCR A;  4IQV A;  4PZN A;  4RQ2 A;  3H8W A;  1ZQC A;  3KZI U;  2C2R A;  3CP8 A;  1Q3V A;  1A6S A;  2P6U A;  5DB9 A;  3SQI A;  3ZDA A;  2ZIX B;  3NVZ A;  4PGQ A;  4O5K A;  3EUB 2;  2W43 A;  4OD0 A;  4I2J A;  5KFH A;  4DQS A;  3ISD A;  2KEY A;  1SZH A;  3EWA A;  4Y2X A;  2QAR A;  3WKC A;  3PMN A;  5FP0 A;  7ICR A;  4DFD A;  3HPO A;  4O5C A;  4NM2 A;  3RH6 A;  4O3Q A;  4ECR A;  5ALD A;  3C2M A;  2M9N A;  3ALR A;  4EEL A;  2WAQ C;  2K8C B;  2ASD A;  1N61 A;  1SWW A;  4QWE A;  8ICH A;  8ICI A;  4O3N A;  5HP4 A;  1BPY A;  4KLU A;  1ZQO A;  2ISP A;  4EZ6 A;  1NK9 A;  1Z3E B;  2Y0S C;  1L7M A;  2V9W A;  3CW2 C;  4YP3 A;  4QIW F;  4JWN A;  1K1Q A;  3ETL A;  3AL0 B;  4US9 A;  2YQE A;  1XO0 A;  3IG5 A;  4P4O A;  3JPS A;  3TAD A;  2DBY A;  1WG8 A;  3EZ5 A;  1BPB A;  5III A;  2W9B B;  2K4I A;  3KHH A;  4NLZ A;  4FBU A;  2R8G A;  4LZG A;  3SAG A;  4Q44 A;  2EZZ A;  9ICB A;  2NRW A;  4C4S A;  2P35 A;  2KV2 A;  4KLH A;  3GV5 B;  4US8 A;  4C7Y A;  1ZJM A;  4QW8 A;  1TFR A;  2EAP A;  4UBB A;  4E0D A;  7ICF A;  3J81 j;  5BOL A;  3RH5 A;  3H8M A;  3ZDD A;  4RPX A;  5B5E U;  4QZG A;  2JEJ A;  2KIV A;  4O3M A;  4F71 A;  1ZQD A;  1SXD A;  2PFQ A;  4F3O A;  3AQF A;  3BZC A;  4KN4 A;  4CNQ A;  4P2H A;  4RQ0 A;  1JN3 A;  1N5W A;  2MUT B;  2ZIW A;  1RDF A;  1ZQH A;  4C80 A;  1QSY A;  1ZET A;  3F2B A;  2RHF A;  4DSF A;  4YG2 A;  8ICG A;  3SR6 A;  1ZRM A;  2GLE A;  3H0M B;  4R8U A;  3KOO A;  1L7P A;  1NI3 A;  4MEX A;  1RM6 C;  2I6X A;  4ED8 A;  3PX4 A;  1PVQ A;  5KT6 A;  4M0A A;  1D9D A;  3WK5 A;  2L5Y A;  2KVC A;  3HJE A;  1L8O A;  2XGP A;  3HWT A;  2KN7 A;  4DF8 A;  7ICQ A;  2KNJ A;  1SKS A;  3ZI4 A;  3Q8K A;  3RAQ A;  2JEI A;  5DDM A;  4NJ8 A;  9ICT A;  2H3F A;  5AIB A;  1ZQB A;  3TI0 A;  9ICA A;  1ARO P;  1S0M A;  4EZ9 A;  4DL6 A;  2LYB A;  5KG1 A;  2XY7 A;  4NLN A;  2KK0 A;  1JRO A;  4OO1 J;  1S9F A;  7ICM A;  3AUO A;  5KFD A;  4Q43 A;  2R8K A;  3BQ7 A;  2DL0 A;  2KJ5 A;  2KOB A;  4QZ9 A;  1L6N A;  1L7N A;  1SZP A;  1Z4O A;  3IG8 A;  3Q8R B;  3C1Z A;  1RYR A;  2F77 X;  1JXE A;  4F8R A;  3HRD D;  3V6H A;  3SEI A;  2KIC A;  1CUK A;  1RYS A;  1HEK A;  3V72 A;  1Q46 A;  5KFL A;  1XSN A;  4YXJ A;  4G9B A;  3M7D A;  1ZQK A;  4PH5 A;  4I2G A;  1T3Q A;  3B0Y A;  4KLT A;  4P4P A;  3T5H A;  2IOH A;  4UAU A;  4ACO A;  1CRX A;  5KG6 A;  2BPF A;  3EYZ A;  5AKX A;  3JPQ A;  4QZI A;  4BUG A;  5G5G A;  5ALP A;  2E8N A;  5CP2 A;  4M9H A;  2H5X A;  1OXJ A;  5AI8 A;  4F2R A;  3OTQ A;  2YY6 A;  1HIW A;  2G07 A;  3WK9 A;  3AMZ A;  5KFC A;  3QX7 A;  3OHA A;  2K4H A;  2KJ9 A;  1KSP A;  1DRG A;  4RQ6 A;  4YD2 A;  3PVX A;  1DGS A;  5CJ7 A;  3NTU A;  5AKK A;  4CGZ A;  5AI4 A;  4P4M A;  8ICW A;  4KLG A;  2AQ0 A;  3N97 B;  1NK0 A;  2OWO A;  3C5F A;  1A77 A;  3M8S A;  2JH7 A;  2WF9 A;  2OEH A;  4UB3 A;  2NRZ A;  9ICN A;  5HR7 A;  3CNH A;  2C28 A;  5KFP A;  5J0R A;  2OHF A;  3FAH A;  1N60 A;  4RQ4 A;  3RJF A;  3H7I A;  3RJG A;  2BQR A;  2ZIU B;  4JB3 A;  1L3T A;  2XY5 A;  2BCU A;  3M9N B;  4F4W A;  3PX0 A;  4B9T A;  3PSI A;  1L3S A;  4NLK A;  5EE9 A;  1RQL A;  3A0B U;  2RDJ A;  2W9C A;  4B9V A;  4DWI A;  1S8O A;  4DF4 A;  1JMS A;  4UB6 U;  3AN1 A;  1U45 A;  2I9G A;  1ZOL A;  3RB0 A;  3GIL A;  1N63 A;  1BPZ A;  1T4G A;  2NRX A;  4JUZ A;  3F53 A;  1JX4 A;  2IOF K;  3MFI A;  7ICT A;  9ICS A;  3BQT A;  4GXK A;  4KX3 A;  4UQG A;  1L8L A;  3KTQ A;  4QZ8 A;  4RPZ A;  4I27 A;  3TAD C;  4XRH A;  1IXR A;  4YCX A;  1M6Y A;  5KFU A;  3QU2 A;  1SV4 A;  3RJJ A;  5CRX A;  5DG9 A;  3NRW A;  4ECY A;  4ED3 A;  3UMB A;  5EWE A;  4CCH A;  4QZA A;  3AU6 A;  4P0Q A;  5GTH U;  2AHO B;  4U6P A;  2NYV A;  1TK5 A;  2KZZ A;  1B4F A;  5C0Y A;  1C20 A;  1ZQV A;  4EBC A;  3LK9 A;  2JH1 A;  1PZN A;  3GV7 B;  4OJO A;  2YB4 A;  1F44 A;  2RQ5 A;  4KMU A;  1TAM A;  4NLG A;  2BGW A;  4Z6E A;  5KFR A;  2PI4 A;  4J9L A;  4Q8F A;  3GFK B;  4M6W A;  3I1Y A;  3H8S A;  2A1J A;  4KMO B;  2OM6 A;  3PSF A;  2K8B B;  5KFW A;  3TAR A;  1X6J A;  8ICZ A;  2VKQ A;  4EEN A;  1SKR A;  1ZQR A;  7ICS A;  2CXY A;  3M6Z A;  1KQQ A;  4O3R A;  1XC9 A;  4XA5 A;  2OYY A;  4YQW A;  2CN1 A;  2MRL A;  3LWL A;  3IP4 B;  3PX6 A;  8ICN A;  3IDW A;  2FPK A;  4ECW A;  5DB7 A;  5AM4 A;  5DQH A;  1JRP A;  1FIQ A;  2VA3 A;  2VAN A;  2KE7 A;  3WU2 U;  4F2S A;  4Y2R A;  1SB3 C;  4F5N A;  2XC9 A;  2BPG A;  3QU9 A;  1N2X A;  4LVS A;  2F76 X;  2RDI A;  2IHM A;  4ED1 A;  3RJE A;  1U9L A;  3K1R B;  5KFA A;  5D46 A;  2LHT A;  4YMM A;  5KFM A;  2MUT A;  3C2K A;  2HOI A;  4AP9 A;  2C2D A;  2KTQ A;  9ICI A;  2QLT A;  3L5K A;  5AI5 A;  1QQ6 A;  1TK0 A;  2F1H A;  2FJ6 A;  1YZ6 A;  1U48 A;  4DL2 A;  4R64 A;  4P0P B;  3SZ2 A;  3NS1 A;  3MAB A;  2PKE A;  2PMZ C;  3S6J A;  5KG3 A;  3HKZ F;  4UBC A;  4KN7 A;  1D8L A;  1ZQE A;  4ECZ A;  3NRZ A;  2HHV A;  3N7S C;  8ICB A;  4DFK A;  9ICF A;  2BCV A;  1QSS A;  4EX6 A;  1SWV A;  4Y2V A;  4J9P A;  1S97 A;  1TAQ A;  3TAQ A;  3VC8 A;  4KLI A;  1YT3 A;  3ZDB A;  5AKY A;  1TK8 A;  2RP5 A;  2ZXH A;  4F72 A;  2DQN B;  4C0Z A;  5KT7 A;  4QWC A;  9ICQ A;  3QUT A;  5KG2 A;  4OJP A;  3QXG A;  2LM4 A;  1QLN A;  1ZQN A;  1JAL A;  3PY8 A;  3NAS A;  2HOF A;  2W03 A;  1BVS A;  5KG7 A;  2JZB A;  8ICU A;  1Q3U A;  3MFH A;  3ISB A;  2YTU A;  4IRD A;  1ZRN A;  5J2H A;  4CF3 A;  2PMZ F;  2HMX A;  1N48 A;  4M9G A;  8ICF A;  4F4X A;  1MQ2 A;  4KLF A;  2VJ4 A;  1JIH A;  2E1F A;  2DGZ A;  5AIC A;  3WK6 A;  2A1J B;  1DK2 A;  3V6K A;  4F92 B;  5J0Q A;  1ZD4 A;  4ZH4 A;  2FMS A;  2E5S A;  4NL9 A;  2ZTD A;  9ICJ A;  2VA8 A;  2G08 A;  3DEE A;  1KTQ A;  1NKB A;  4NM1 A;  2CPR A;  5F9L A;  5ALO A;  4C7Z A;  2W3S A;  3RB4 A;  3Q8Q B;  2H3Z A;  2IOF A;  3NVY A;  2Y1J A;  4FS1 A;  2JEG A;  1NKE A;  3SYZ A;  2HOQ A;  4UB8 U;  5EE3 A;  3R9K A;  3GQC A;  4TUP A;  1SV0 A;  4ICA A;  5J0W A;  3RR7 A;  5J8Y C;  5A0L A;  5KT3 A;  4EEY A;  5HNK A;  2AH5 A;  1RQN A;  1KFD A;  5KFY A;  5ALJ A;  5KFF A;  5ALM A;  5BOM A;  4PHE A;  1GO3 F;  4JV2 A;  1WCL A;  4FBT A;  4IQW A;  2Q4T A;  4Y2S A;  4KLL A;  9ICC A;  2DF4 B;  4I2D A;  2W8K A;  2AU0 A;  5AKZ A;  4DQR A;  4F91 B;  2ZIW B;  5AM3 A;  3BQ2 A;  2LKY A;  5ALY A;  5B66 U;  2WTF A;  1Z4N A;  3HP6 A;  8ICJ A;  3PST A;  2MSN A;  3F5E A;  4EBE A;  3TAP A;  8ICR A;  3M8R A;  4MEY A;  2DPI A;  4USA A;  4DOC A;  4B9M A; 
#chains in the Genus database with same CATH homology
 1UHU A;  1MN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...