1MN8A

Structure of moloney murine leukaemia virus matrix protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
QTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Core protein p15
publication title Atomic resolution structure of Moloney murine leukaemia virus matrix protein and its relationship to other retroviral matrix proteins.
pubmed doi rcsb
source organism Moloney murine leukemia virus
molecule tags Viral protein
total genus 32
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.180 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Gamma-retroviral matrix domain 1mn8A00
1UHUA 1MN8A
chains in the Genus database with same CATH superfamily
5AKLA 5ALMA 4WJ3B 4YMOA 4K4IA 2ZJAA 1RM6C 1DXSA 1RQLA 8ICTA 3QU5A 1UT8A 2IBKA 2H3VA 9ICVA 2MRLA 1MSWD 4NY8A 1FIQA 3MABA 2H5XA 4O0IA 3MDCA 2E5SA 1CRXA 3RJEA 4EZ9A 2HVIA 3OJSA 3MR3A 4KITB 3B9JA 4Y2RA 4I2HA 4QWDA 4KLEA 5DB7A 5AKEA 2QARA 4TUPA 2BQRA 3GQCA 2ZTDA 4YN4A 4PGXA 4QWAA 3OSNA 4PJ0U 3KOOA 1JI7A 2XY7A 5AI5A 2BR0A 5ALSA 2KFZA 2FMQA 1L3UA 2G08A 1WWUA 2A1JB 1KFDA 1ZQAA 5AK5A 3HKZF 1ZD5A 5ALIA 5F3XB 1N5XA 5KFKA 4LVSA 2UVUA 3PW5A 9ICCA 5AKKA 2Y0SC 4AYBC 4FS2A 2RDIA 3C1ZA 1B0XA 2F3NA 3H8JA 3IG5A 2JV3A 2C2RA 4ECRA 3V7KA 3IRUA 3ORYA 1FFUA 3HRDD 2KJ8A 4DL4A 1NI3A 4B9NA 4Y2TA 3L3FX 4KLQA 1V85A 4IQTA 3PMNA 2YMLA 3HILA 2AH5A 1Z3EB 4MEXA 2F8LA 1SL1A 5ALYA 2AGOA 3UMBA 4RQ3A 1N48A 4F50A 5J2IA 2PMZC 5HHIA 5J0RA 3C2KA 1S97A 2YY6A 2KKPA 5AKYA 1IIPA 3NS1A 4M9GA 2HHTA 2F44A 4BXOA 5F9NA 2AXTU 4RPYA 3OGUA 5KFHA 2IOFA 3RB3A 9ICNA 4PGQA 4DFDA 4QZAA 1Z19A 2HSZA 2UVRA 7ICVA 4ED3A 5AIBA 1N63A 4B6JA 3C1YA 4NM1A 3BZKA 3ETLA 5KFXA 3ISDA 8ICGA 4TURA 1AQ6A 7ICFA 1ZD3A 4QIWC 1F5SA 2IHNA 3G6XA 2KHQA 2I5HA 5EE3A 2F8KA 1L3SA 4IR1A 2B0CA 1LB2B 3SYZA 1ECWA 2KZMA 1BPEA 4NLCA 3EWAA 3TQ1A 3PX4A 4O3SA 1U47A 1J2MA 3BS5B 1SL0A 1TKDA 5H2FU 3EPGA 2KD1A 4TUSA 3RR8A 4EENA 3HX0A 8ICPA 4OD0A 3DDHA 3FC4A 4EZ6A 3CYMA 1BPYA 3ZDCA 8ICFA 3M6ZA 4DL7A 2EZXA 1N5WA 4F8RA 7ICOA 3RJGA 4BUGA 4QZ8A 4KLFA 1IG6A 1X2IA 1ZQWA 4YXMA 5CEHA 3OHBA 2C28A 5DBAA 4AP9A 1NJZA 2I1QA 4EBEA 2A19A 5DBBA 1ZQEA 1WCLA 4UB8U 5L1JA 5KT4A 1MN8A 5KFGA 3RJJA 4NWIA 1ZQFA 5C0YA 3IV6A 4YMNA 4Q45A 1IV8A 8ICNA 2E8MA 5KT2A 1TE2A 2EZZA 2W9CA 2Y1IA 4JV2A 4I2AA 1ZQSA 4K4GA 4C4TA 1QQ5A 5J8YC 2RP5A 1ZQZA 5EWEA 2XCAA 3MFIA 2HI0A 4YMMA 1N62A 3RBEA 2KMDA 2K4IA 5ALJA 4O3OA 1ZQLA 1ZQGA 2NRXA 3KZIU 2WAQF 8ICQA 2QARB 4P4OA 3LWMA 3SV3A 4BJQA 1SV0A 2LBOA 1Z1BA 4F71A 1T8EA 2ZXHA 5EE1A 2KNJA 1KSPA 4O3PA 3T79A 1SZPA 9ICXA 5CB1A 2ZTEA 2JEFA 4DS4A 2HHSA 4IRCA 2Y9TA 1IXRA 4ECSA 2E1FA 3NUQA 4OCZA 2BCSA 2D6FC 5AKZA 4Q44A 3AU2A 3OPXA 1X6IA 3MR2A 4RQ1A 4R64A 2JRZA 2EH9A 3UPQA 1DRGA 2QB0A 3FM9A 2HHXA 3UM9A 3I28A 1TFRA 4CDGA 3LK9A 3EPIA 4J9PA 4XRHA 4KLUA 2KTQA 4YD2A 1NZBA 5KFAA 3B0XA 3VCBA 1BPZA 3H0MB 4KLIA 1ZRMA 1OXJA 1A77A 1ZQ1C 2WB1C 5J2GA 2DWQA 1TK0A 8ICCA 3TADA 5CJ7A 5ALGA 2CN1A 2MU2A 3WKBA 1JX4A 2E3TA 2KV2A 3ZD9A 4RQ7A 2FJ6A 3N7RC 4EYIB 7ICUA 1K1SA 3I1YA 5ALZA 4NLGA 3QYPA 4TQRA 3B0YA 4BXOB 2P6UA 4XA5A 2KG5A 3RB6A 7ICPA 2ZJ8A 2QB1A 2ISOA 4KMOB 2CXYA 4NLZA 2XICA 1SWWA 3C5FA 2ASJA 4LZDA 5ALRA 7ICNA 3V7LA 2KIWA 4XQ8A 1UPHA 4B9VA 4FBUA 4J9OA 1KBUA 4QZIA 3PO4A 3M1YA 3MGVA 3HT3A 5DGAA 1LKYA 3KKAC 2F77X 4JWNA 1O08A 4F4KA 5EWGA 4UAZA 1XO0A 5CWRA 4M2YA 4U6PA 1ZQDA 2EANA 2YMQA 3QU4A 4JV0A 9ICUA 2ZIVA 5KG1A 7ICGA 1N60A 2KJ9A 3QEAZ 3H4DA 1L7PA 2YB4A 2HOQA 1L5UA 2OWOA 2K4HA 3WKAA 2LM1A 3RJHA 2ESEA 1ZQPA 3WK9A 4Y2QA 4QWCA 8ICJA 3ED5A 5J2KA 2PI4A 3RJKA 3WKDA 4GC7A 1V9PA 4KTQA 2VKQA 3H4BA 4B9UA 9ICKA 2WAQC 9ICPA 3UMGA 4Y2UA 2ZIUA 4PZNA 2K4EA 3FYHA 5KT3A 1NK8A 1KKXA 3U26A 1NKCA 2PFQA 4UB1A 4P0PA 2BQUA 7ICEA 3KD3A 5IIOA 4DLGA 4UAWA 4RQ5A 2NO4A 4XUSA 4ED2A 9ICRA 2W9CB 1ZQKA 2KK0A 3PW7A 2NYVA 2EAPA 1ZQBA 5J2FA 4UBBA 2BDUA 2DL0A 4DFPA 1KFSA 2H3QA 2EDUA 4F3OA 1JXLA 5J0WA 5IINA 1Y88A 5J0YA 3NTUA 3SEIA 1WYGA 3RBDA 2Y0SF 4Z6EA 4QZDA 2GLEA 5AICA 5KFFA 3RR7A 3T5LA 5ALPA 4RQ4A 4F5RA 1SWVA 3KZXA 1RDFA 5IIMA 5J8YA 7ICJA 3RRHA 5KAFU 2KEYA 2FPLA 1RXVA 4PHAA 5L9XA 4IQWA 5DLGA 8ICEA 3H8SA 1MQ3A 4DL3A 5KFMA 5KG7A 5EE0A 1X9SA 2HOIA 2MAXA 3NGDA 1X42A 4O3QA 2GO7A 7ICTA 4F4YA 4DQQA 2O6KA 2DUYA 1PVRA 3GIKA 4I2CA 2PMZF 3ALRA 2AGQA 5KFEA 1RYSA 2K60A 4CRXA 5DDMA 2B6GA 4KLHA 4QWBA 2QB0B 2ASLA 4EX7A 2R8GA 2KVSA 3IN5A 1HUZA 4DFMA 2LPEA 3AQEA 1RQNA 2HBKA 5AKGA 4FFDA 5KG3A 4U7CA 1L8OA 2XY6A 5KFUA 3PZPA 2WF5A 4I27A 4RQNA 1C7YA 5TISU 5L1IA 4KLDA 4QIWF 4YFKA 2NRWA 2W04A 4DSJA 2HHWA 8ICUA 3SAGA 3MR5A 1N56A 3SI8A 3C2MA 4RUCA 1V38A 2L5YA 3FDSA 2F1JA 2KP7A 4Y2PA 1LV5A 1ZQJA 3K1RB 2W3SA 5D46A 4O9MA 4QZBA 5DB9A 3C23A 4YR2A 5AKHA 1PK3A 4KLJA 2R8IA 1XSNA 1VLBA 4UQGA 3SENA 4ECVA 4X5VA 1D8LA 3IP4B 3PX0A 1RZTA 3V7JA 4UBCA 1LKYB 5AM0A 1TK8A 2AGPA 3MGIA 1JRPA 2W11A 2W3RA 3TACB 2M0NA 4OJ6A 4TUQA 2W43A 1NK9A 5DB8A 3JPRA 2FMPA 4ELTA 2ZIVB 3KHLA 3JPNA 2A1AA 4F4XA 4C4RA 4UB3A 1ZD4A 3QUQA 3DEEA 7ICKA 2FPKA 3BZCA 2MA1A 2IA6A 1KFTA 2ZUDA 2W55A 5IIIA 1QLNA 3CW2C 2W54A 4QW8A 2I6XA 4CF3A 3F5AA 3C29A 1NKEA 5AM2A 1S77D 5B5EU 4LZGA 2ASDA 2ZIUB 4G3IA 7ICRA 4KMUA 1UA0A 1YT3A 5CRXA 3JPOA 1U48A 2HHUA 4ELUA 2H3ZA 4F5OA 4P0PB 4DQIA 2LKYA 4DFJA 4M9JA 3HJEA 3Q8MA 5KT6A 2NRTA 2XI9A 4QZCA 5DG9A 4PZOA 5BPCA 4C8NA 1TV9A 4Q8FA 2K8BB 2G0AA 1PVQA 5AK4A 3SD7A 4DSFA 2HBJA 5ALOA 5KFRA 2GWSA 4UW9A 2JEJA 4OJLA 1NK4A 2LYBA 2OHFA 1X9XA 4ED8A 2OYYA 2F1IA 2KFNA 3LVWA 1NJYA 2A3VA 2Q4TA 3S6JA 4CF4A 2E8PA 1ZJNA 2VIXA 2AU0A 3ZI4A 5D49A 2XC9A 1HUOA 3N7SC 2QLTA 3WU2U 1J2NA 1DGJA 4K4HA 2WB1F 4I2IA 1QSYA 1KRPA 1QQ6A 3ZDAA 4C8LA 4RZRA 1B4FA 5KFTA 4RQ2A 2F76X 2ZUCA 4QNLA 7ICHA 5J2DA 3PSTA 4MFFA 1ZQOA 2NRZA 2PFOA 1IM4A 1SV4A 2BKEA 2YX8A 1OUQA 2VA2A 3K1ZA 2JR5A 4OJPA 3QU7A 2D8CA 9ICLA 4CNQA 4M9HA 4KLTA 1BPBA 4F93B 2G09A 4O3RA 2DQNB 3RFAA 2C2EA 1TAMA 3OJUA 2RDJA 2BPFA 4RPZA 4QZEA 1S0VA 2W03A 5DG8A 2W9MA 1HJPA 1F44A 2J6TA 4NL9C 7ICLA 1PUZA 4IL6U 4YQWA 4DOAA 3ONNA 3RH5A 4B9LA 2GOLA 1TAUA 3JPSA 3LYSA 1ZQRA 5J2JA 1ZQIA 3NVVA 3BQ7A 2AHOB 4FZMA 4IS7A 1LVHA 8ICKA 1Z00A 1RYUA 2B21A 5ALTA 1S9FA 3EZ5A 1JROA 3QEBZ 3PR5B 3K4GA 1TVAA 2NRVA 4O3MA 1S10A 1URJA 3TI0A 4C4SA 1NK6A 2BQ3A 5ALXA 2XCPA 3IG8A 3M8SA 2ISPA 3KHGA 2Q0ZX 2WF7A 3ETRA 4P0QA 4YG2A 4C8OA 2E8NA 5JUMA 2AQ4A 3A0BU 5GTIU 4DWIA 4EELA 1DK2A 1JALA 1FEZA 3EW9A 4EEKA 1H38A 3NRZA 4UARA 2LM4A 2ZUBA 1X9MA 4Q43A 1DK3A 4B9TA 4KX5A 1SIJA 5ALLA 2XO7A 4M9LA 2JXJA 4M0AA 2OEHA 5KFZA 4JWMA 3AL0B 3BS7A 4PL1A 7ICSA 2OM6A 5J0XA 3PW2A 3K75D 2C22A 4MFAA 1T3NA 4I2EA 4CF5A 3E2EA 8ICVA 3TKAA 3Q8LA 3V72A 4PL2A 3GIMA 2DF4B 1HEKA 2WF8A 4US8A 9ICEA 3AUOA 5AI8A 2LHTA 2ZIXA 5ALFA 1UA1A 3MBYA 2XVTA 1X9WA 4PH5A 5HMLA 2KZZA 2HVHA 4Y2YA 1N61A 5J0PA 5DB6A 3MR6A 4DSIA 3GIJA 3BQTA 4R8UA 4NM2A 4JUZA 4BWJA 3IDWA 4MF8A 9ICSA 4F92B 3PR4A 2FI1A 3RF9A 3PV8A 1ZQQA 1ZETA 3MDAA 2P66A 3PVXA 1J97A 5HP4A 4ELVA 5J0TA 3QU2A 4GLXA 1UCVA 3AEVA 1FO4A 3D2NA 5AM4A 2KSOA 5EE9A 4PHEA 1KQQA 2YTUA 2LMRA 1PK1A 3UMCA 4ECTA 4J9QA 3SMVA 1S8OA 3M8RA 3T5JA 2OCEA 1GO3F 2FLNA 1ZQHA 3LWLA 1L7NA 3H0LB 3QZ7A 1SKSA 4F5NA 3NVZA 1SGGA 3H8WA 5DQIA 4DS5A 1A76A 3H8MA 3JPPA 3RH6A 5KFQA 4QW9A 3AQFA 4DFKA 2HHVA 1SKRA 4DLEA 4IRKA 5DG7A 5IIJA 4I2FA 1PZNA 4DO9A 2VA8A 2H3FA 4DSEA 5KT5A 3SR6A 4NLKA 2LYAA 2YN4A 3AM9A 3IM1A 2R8JA 1AROP 4ECWA 1MA7A 3HW8A 3N4MB 3BQ0A 4DQPA 4UB6U 5KFWA 2W9BA 2HCFA 2KHVA 3ISCA 5L1KA 2KKVA 4ED0A 8ICWA 3E58A 4RU9A 1T4GA 5AKXA 2BDPA 1A6SA 4LJXA 1JXEA 1KEJA 3BDPA 3RB4A 2G07A 3TARA 2K8AA 4YP3A 1SZHA 3NRWA 2KIVA 4ECYA 4DF4A 1QQ7A 1U4BA 1RXWA 2Y9UA 2P6RA 1S76D 3ZDEA 1L7MA 5AM5A 4FS1A 3UXNA 3JPTA 2W8KA 1Z00B 3QZ8A 2ZJ5A 1YZ6A 4NL9A 4F2SA 3NASA 1WCNA 5B66U 5AK3A 2BHNA 2EAMA 2PFPA 2JZBA 3SZ2A 3QUCA 1X6JA 8ICLA 4F2RA 1NJXA 2G5IB 4FO6A 4B9MA 4NLBA 2DFLA 3AMZA 5AI4A 4P0QB 4EX6A 3RAXA 5AKJA 3HPOA 3ZDDA 5GTHU 4IQVA 4Z6FA 4M6WA 2G5HB 1ZXIA 3AN1A 1UT5A 1P7DA 8ICXA 4O3NA 3RH4A 1U45A 2DKXA 5T14A 5KT7A 4E0DA 3KBBA 3M9MB 3RJFA 3WK5A 4RNOA 4M47A 4C80A 2WF9A 4J9SA 1HIWA 5AM1A 8ICHA 5KL8B 2EZYA 4HYKA 9ICQA 4BDPA 2RLTA 4DF8A 4J03A 5ALVA 3WK4A 2XY5A 2KOBA 1S0MA 1L3TA 3ZD8A 4ECQA 1B43A 1Q8KA 5J0QA 1C20A 3NVYA 4C8KA 5ALWA 3RAQA 5EWFA 2ZIXB 3BJYA 4ECZA 4KLMA 1KTQA 1D8YA 2W7OA 1F0MA 2JH1A 4GFJA 5AI0A 2MUTA 4DSLA 2DGZA 1MQ2A 1Z4NA 4R8UB 5KFNA 2ZXIA 3HWTA 1XU4A 3WK8A 1QSSA 5J0OA 4I2BA 3C28A 3PY8A 5KL1B 3GZFA 2XGPA 3RRGA 9ICBA 4RQMA 4YD1A 2FDRA 4UB5A 2H3IA 2PI5A 1SXDA 1WWVA 2RQ5A 1M6YA 3Q8SB 1L6NA 4ZH4A 3LVVA 2JEIA 2JMGA 1SXEA 1S5LU 1ZQYA 3GU3A 3C5GA 1XS9D 1PK1B 2DBYA 1RYRA 2WFAA 4F72A 2HMXA 3RB0A 5C5JA 3WKEA 2BCUA 4GIBA 1ED1A 2JEGA 5J0SA 2E8OA 5IILA 1RG6A 1SL2A 4P2HA 4OO1J 4YXJA 4CGZA 3SAFA 3Q8PB 1D9FA 1ZQVA 1K5OA 8ICIA 1KN5A 1SV0C 1T94A 5ALQA 5CA7A 8ICYA 2PKEA 4RPXA 3MFHA 3I76A 1WG8A 3LDAA 8ICSA 4QZHA 3M9NB 1XSPA 3M9OB 2AJQA 1X40A 8ICMA 2LYHA 2ZIWA 2IMWP 2KE7A 4Y2SA 2JGAA 3KKAA 3UQ2A 2YB1A 5CR0A 5TZVA 1VJ5A 4MEYA 4RQ8A 2W9BB 4EBCA 4BX9C 5D4BA 4PPXA 3PO5A 5L1LA 5HHHA 1ZQNA 3DV9A 3V6HA 3MC1A 5BOMA 1KL9A 3O0FA 5J2AA 2CRXA 1PVPA 1CEZA 5ALUA 2KN7A 9ICGA 3RJIA 5JU5A 1XSLA 9ICJA 2WHEA 1QCKA 2YQEA 2Y1JA 2R8KA 2IOHA 3TADC 3MGHA 1XWLA 5J29A 5E79U 4JK1A 2FMSA 1NZPA 5AI6A 9ICMA 3GDXA 1DGSA 2MSNA 3F5EA 2HBMA 3QU9A 4UATA 5DBCA 2F2AB 3ISBA 2JZBB 3THVA 3GIIA 4BWMA 2JHDA 3CNHA 2DPJA 5KFSA 4FZLA 3GILA 5KTQA 2PFNA 2VA3A 5KG0A 2K4PA 5KG2A 2ES6A 4RNNA 4J9NA 4I2GA 4CE6A 2HHQA 2IOFK 5ALDA 4DCCA 1ZRNA 4EBDA 1ZJMA 2XIDA 1UQVA 3CRXA 1OW5A 4M6WB 1DOQA 2N1RA 4RNMA 1BGXT 3D6JA 1L7OA 3N97B 3RTVA 1N2XA 3QXGA 3C21A 4I2DA 3PSIA 1TAQA 1NOMA 4ICAA 1ZYQA 3J81j 1U9LA 5J2BA 4BGDA 3D2QA 5DKWA 4KLLA 5KFPA 4DSKA 3GV7B 2VANA 1S0OA 1ZOLA 4EEYA 1V97A 3C2LA 4UAUA 4ECXA 1BPDA 4R66A 4RT2A 5ALHA 5J0UA 4C8MA 4IRDA 4M9NA 5J2CA 5ALNA 5KFYA 4Z6CA 4QZGA 4O5CA 3OHAA 2DKZA 2FE9A 2V4QA 2MUTB 1WUDA 2RRDA 4FZNA 3M7DA 1NK7A 3BQ2A 1NK0A 3Q8QB 2NV3A 3T5KA 4FE3A 3Q8KA 3Q8RB 5DDYA 3PW4A 2VJ5A 4F5QA 8ICZA 4ED7A 5AK6A 2VJ4A 2CPRA 5G5GA 8ICBA 1ZQCA 2HW3A 2M9NA 1SB3C 1VDVA 5KFDA 7ICIA 4UB2A 2BZFA 3H0RB 5DGBA 1Q3UA 4F4WA 3A0HU 1UHUA 2HDOA 4NXZA 2I9GA 2WTFA 3HKZC 1KLNA 2ZTCA 1QH9A 2YMMA 1XNSA 2DPIA 4I28A 4OJOA 1JN3A 5HR7A 3PW0A 3V6KA 4USAA 1L8LA 4DOCA 5DLFA 2Z7JA 2FLPA 4R63A 3M6KA 1D8BA 4JB3A 7ICMA 4RQ0A 4PHPA 1QTMA 5KFJA 1BVSA 5F9LA 2ZIWB 3TFSA 2BCVA 1Q46A 3F2DA 3OSPA 2HOFA 2V9WA 4MFCA 3PNCA 5HNKA 3GV5B 4F5PA 2AQ0A 3VC8A 2J6SA 3R9KA 7ICQA 1NNLA 5AIAA 3G6YA 9ICFA 4QJFB 3EUB2 2JH7A 2EAOA 3L4PA 2ALZA 2K8CB 4OJ5A 2IHMA 1COOA 1K1QA 4DL5A 5J2EA 4PHDA 3G6VA 4M04A 4RT3A 2RHFA 4ACOA 5AI9A 4JMUA 4JV1A 4KX3A 2HBLA 4RQ6A 4R65A 3T3FA 3JPQA 5KFBA 9ICIA 2XGQA 5FP0A 4DQSA 4YVZA 5EOZA 1O03A 1NKBA 4F4ZA 4YCXA 5DQGA 5G5HA 2BGWA 2GH1A 4QZFA 3QX7A 9ICOA 4UASA 1Q3VA 3H40A 4UAYA 3ICXA 5KFOA 4DL2A 3TAQA 3F2CA 4NJ8A 1A0PA 4I2JA 5KNIA 5ALEA 3KFUF 4NLNA 3BQ1A 2V4RA 9ICWA 2LI6A 2OXOA 3SV4A 9ICTA 4J9KA 1L3VA 1TK5A 5KAIU 1ZQUA 1S0NA 4G9BA 1B22A 4C0ZA 4ZOHC 8ICRA 1T3QA 4MHVA 4KN7A 3N28A 3UXOA 5JRTA 2YMPA 5KG4A 4UB4A 1BNPA 1CUKA 4O5EA 4GXKA 4NV0A 3F53A 5KFLA 2OH2A 3N7PD 2W9AA 1QSLA 1EXNA 4DL6A 5KFIA 4DEZA 3WK6A 2P35A 2G06A 3HP6A 2W7PA 4A8EA 2A1JA 2R18A 4FBTA 3TFRA 8ICOA 4J9LA 2ATLA 3H7IA 2KVCA 3PSPA 4DOBA 5ALKA 4Z6DA 3TANA 1ZQTA 4B9SA 1KW4A 1RPLA 4IQUA 4TQSA 4CCHA 5IIKA 2E1EA 1JIHA 1ZQMA 1YZ7A 2WF6A 2UVVA 5L1MA 3V6JA 4O5KA 4Q8EA 2FLLA 4KN4A 4KLOA 5KG6A 3PX6A 5CHGA 4YR3A 4UAVA 2KZ3A 5CP2A 3UQ0A 5AHXA 3IHQB 5KFVA 4EYHB 4GC6A 1Z4OA 9ICAA 4J9RA 3QNMA 4ECUA 2ZG6A 3WK7A 4C7ZA 4IC9A 2BCRA 3CP8A 2BCQA 3NVWA 4Y2JA 3F2BA 4J9MA 1NJWA 5K4LA 4KLGA 4F91B 1T7PA 1ZD2P 1BNOA 4AYBF 3PSFA 4YR0A 3GFKB 9ICHA 5KG5A 4IR9A 5A0LA 5J2HA 1NK5A 1KDHA 2D3DA 3WKCA 1MC8A 4QZ9A 2ODGA 3KHHA 4HAIA 3GV8B 2W8LA 4GXJA 3T5HA 2EQYA 4US9A 2J6UA 2BPCA 3D2SA 1U49A 3PMLA 1XC9A 3TAPA 5KFCA 3BS5A 4MF2A 1XO1A 2NO5A 4C7YA 3OTQA 8ICAA 1SKWA 5HR6A 4DQRA 2FPMA 1JUDA 3UXPA 5BOLA 5HMMA 4P4MA 3KHRA 3SAHA 4QWEA 3SQIA 4P4PA 2KJ5A 1JMSA 1CI4A 1BPXA 4Y2VA 4RUAA 4ED1A 3QUTA 5JTIA 3ZDBA 2K89A 2C2DA 3QE9Y 2KICA 3E0FA 1COKA 4PGYA 2R8HA 5AM3A 1ZQXA 2F1HA 3FAHA 2QKQA 4GXIA 1X66A 3QUBA 3KTQA 2KSOB 1Z1VA 1FFVA 5AKIA 4ED6A 5DQHA 2BPGA 2UVWA 3EYZA 4KLSA 3AU6A 1D9DA 4I29A 2PXIA 3L5KA 4Y2XA
chains in the Genus database with same CATH topology
1UHUA 1MN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHU A;  1MN8 A; 
#chains in the Genus database with same CATH topology
 5AKL A;  5ALM A;  4WJ3 B;  4YMO A;  4K4I A;  2ZJA A;  1RM6 C;  1DXS A;  1RQL A;  8ICT A;  3QU5 A;  1UT8 A;  2IBK A;  2H3V A;  9ICV A;  2MRL A;  1MSW D;  4NY8 A;  1FIQ A;  3MAB A;  2H5X A;  4O0I A;  3MDC A;  2E5S A;  1CRX A;  3RJE A;  4EZ9 A;  2HVI A;  3OJS A;  3MR3 A;  4KIT B;  3B9J A;  4Y2R A;  4I2H A;  4QWD A;  4KLE A;  5DB7 A;  5AKE A;  2QAR A;  4TUP A;  2BQR A;  3GQC A;  2ZTD A;  4YN4 A;  4PGX A;  4QWA A;  3OSN A;  4PJ0 U;  3KOO A;  1JI7 A;  2XY7 A;  5AI5 A;  2BR0 A;  5ALS A;  2KFZ A;  2FMQ A;  1L3U A;  2G08 A;  1WWU A;  2A1J B;  1KFD A;  1ZQA A;  5AK5 A;  3HKZ F;  1ZD5 A;  5ALI A;  5F3X B;  1N5X A;  5KFK A;  4LVS A;  2UVU A;  3PW5 A;  9ICC A;  5AKK A;  2Y0S C;  4AYB C;  4FS2 A;  2RDI A;  3C1Z A;  1B0X A;  2F3N A;  3H8J A;  3IG5 A;  2JV3 A;  2C2R A;  4ECR A;  3V7K A;  3IRU A;  3ORY A;  1FFU A;  3HRD D;  2KJ8 A;  4DL4 A;  1NI3 A;  4B9N A;  4Y2T A;  3L3F X;  4KLQ A;  1V85 A;  4IQT A;  3PMN A;  2YML A;  3HIL A;  2AH5 A;  1Z3E B;  4MEX A;  2F8L A;  1SL1 A;  5ALY A;  2AGO A;  3UMB A;  4RQ3 A;  1N48 A;  4F50 A;  5J2I A;  2PMZ C;  5HHI A;  5J0R A;  3C2K A;  1S97 A;  2YY6 A;  2KKP A;  5AKY A;  1IIP A;  3NS1 A;  4M9G A;  2HHT A;  2F44 A;  4BXO A;  5F9N A;  2AXT U;  4RPY A;  3OGU A;  5KFH A;  2IOF A;  3RB3 A;  9ICN A;  4PGQ A;  4DFD A;  4QZA A;  1Z19 A;  2HSZ A;  2UVR A;  7ICV A;  4ED3 A;  5AIB A;  1N63 A;  4B6J A;  3C1Y A;  4NM1 A;  3BZK A;  3ETL A;  5KFX A;  3ISD A;  8ICG A;  4TUR A;  1AQ6 A;  7ICF A;  1ZD3 A;  4QIW C;  1F5S A;  2IHN A;  3G6X A;  2KHQ A;  2I5H A;  5EE3 A;  2F8K A;  1L3S A;  4IR1 A;  2B0C A;  1LB2 B;  3SYZ A;  1ECW A;  2KZM A;  1BPE A;  4NLC A;  3EWA A;  3TQ1 A;  3PX4 A;  4O3S A;  1U47 A;  1J2M A;  3BS5 B;  1SL0 A;  1TKD A;  5H2F U;  3EPG A;  2KD1 A;  4TUS A;  3RR8 A;  4EEN A;  3HX0 A;  8ICP A;  4OD0 A;  3DDH A;  3FC4 A;  4EZ6 A;  3CYM A;  1BPY A;  3ZDC A;  8ICF A;  3M6Z A;  4DL7 A;  2EZX A;  1N5W A;  4F8R A;  7ICO A;  3RJG A;  4BUG A;  4QZ8 A;  4KLF A;  1IG6 A;  1X2I A;  1ZQW A;  4YXM A;  5CEH A;  3OHB A;  2C28 A;  5DBA A;  4AP9 A;  1NJZ A;  2I1Q A;  4EBE A;  2A19 A;  5DBB A;  1ZQE A;  1WCL A;  4UB8 U;  5L1J A;  5KT4 A;  1MN8 A;  5KFG A;  3RJJ A;  4NWI A;  1ZQF A;  5C0Y A;  3IV6 A;  4YMN A;  4Q45 A;  1IV8 A;  8ICN A;  2E8M A;  5KT2 A;  1TE2 A;  2EZZ A;  2W9C A;  2Y1I A;  4JV2 A;  4I2A A;  1ZQS A;  4K4G A;  4C4T A;  1QQ5 A;  5J8Y C;  2RP5 A;  1ZQZ A;  5EWE A;  2XCA A;  3MFI A;  2HI0 A;  4YMM A;  1N62 A;  3RBE A;  2KMD A;  2K4I A;  5ALJ A;  4O3O A;  1ZQL A;  1ZQG A;  2NRX A;  3KZI U;  2WAQ F;  8ICQ A;  2QAR B;  4P4O A;  3LWM A;  3SV3 A;  4BJQ A;  1SV0 A;  2LBO A;  1Z1B A;  4F71 A;  1T8E A;  2ZXH A;  5EE1 A;  2KNJ A;  1KSP A;  4O3P A;  3T79 A;  1SZP A;  9ICX A;  5CB1 A;  2ZTE A;  2JEF A;  4DS4 A;  2HHS A;  4IRC A;  2Y9T A;  1IXR A;  4ECS A;  2E1F A;  3NUQ A;  4OCZ A;  2BCS A;  2D6F C;  5AKZ A;  4Q44 A;  3AU2 A;  3OPX A;  1X6I A;  3MR2 A;  4RQ1 A;  4R64 A;  2JRZ A;  2EH9 A;  3UPQ A;  1DRG A;  2QB0 A;  3FM9 A;  2HHX A;  3UM9 A;  3I28 A;  1TFR A;  4CDG A;  3LK9 A;  3EPI A;  4J9P A;  4XRH A;  4KLU A;  2KTQ A;  4YD2 A;  1NZB A;  5KFA A;  3B0X A;  3VCB A;  1BPZ A;  3H0M B;  4KLI A;  1ZRM A;  1OXJ A;  1A77 A;  1ZQ1 C;  2WB1 C;  5J2G A;  2DWQ A;  1TK0 A;  8ICC A;  3TAD A;  5CJ7 A;  5ALG A;  2CN1 A;  2MU2 A;  3WKB A;  1JX4 A;  2E3T A;  2KV2 A;  3ZD9 A;  4RQ7 A;  2FJ6 A;  3N7R C;  4EYI B;  7ICU A;  1K1S A;  3I1Y A;  5ALZ A;  4NLG A;  3QYP A;  4TQR A;  3B0Y A;  4BXO B;  2P6U A;  4XA5 A;  2KG5 A;  3RB6 A;  7ICP A;  2ZJ8 A;  2QB1 A;  2ISO A;  4KMO B;  2CXY A;  4NLZ A;  2XIC A;  1SWW A;  3C5F A;  2ASJ A;  4LZD A;  5ALR A;  7ICN A;  3V7L A;  2KIW A;  4XQ8 A;  1UPH A;  4B9V A;  4FBU A;  4J9O A;  1KBU A;  4QZI A;  3PO4 A;  3M1Y A;  3MGV A;  3HT3 A;  5DGA A;  1LKY A;  3KKA C;  2F77 X;  4JWN A;  1O08 A;  4F4K A;  5EWG A;  4UAZ A;  1XO0 A;  5CWR A;  4M2Y A;  4U6P A;  1ZQD A;  2EAN A;  2YMQ A;  3QU4 A;  4JV0 A;  9ICU A;  2ZIV A;  5KG1 A;  7ICG A;  1N60 A;  2KJ9 A;  3QEA Z;  3H4D A;  1L7P A;  2YB4 A;  2HOQ A;  1L5U A;  2OWO A;  2K4H A;  3WKA A;  2LM1 A;  3RJH A;  2ESE A;  1ZQP A;  3WK9 A;  4Y2Q A;  4QWC A;  8ICJ A;  3ED5 A;  5J2K A;  2PI4 A;  3RJK A;  3WKD A;  4GC7 A;  1V9P A;  4KTQ A;  2VKQ A;  3H4B A;  4B9U A;  9ICK A;  2WAQ C;  9ICP A;  3UMG A;  4Y2U A;  2ZIU A;  4PZN A;  2K4E A;  3FYH A;  5KT3 A;  1NK8 A;  1KKX A;  3U26 A;  1NKC A;  2PFQ A;  4UB1 A;  4P0P A;  2BQU A;  7ICE A;  3KD3 A;  5IIO A;  4DLG A;  4UAW A;  4RQ5 A;  2NO4 A;  4XUS A;  4ED2 A;  9ICR A;  2W9C B;  1ZQK A;  2KK0 A;  3PW7 A;  2NYV A;  2EAP A;  1ZQB A;  5J2F A;  4UBB A;  2BDU A;  2DL0 A;  4DFP A;  1KFS A;  2H3Q A;  2EDU A;  4F3O A;  1JXL A;  5J0W A;  5IIN A;  1Y88 A;  5J0Y A;  3NTU A;  3SEI A;  1WYG A;  3RBD A;  2Y0S F;  4Z6E A;  4QZD A;  2GLE A;  5AIC A;  5KFF A;  3RR7 A;  3T5L A;  5ALP A;  4RQ4 A;  4F5R A;  1SWV A;  3KZX A;  1RDF A;  5IIM A;  5J8Y A;  7ICJ A;  3RRH A;  5KAF U;  2KEY A;  2FPL A;  1RXV A;  4PHA A;  5L9X A;  4IQW A;  5DLG A;  8ICE A;  3H8S A;  1MQ3 A;  4DL3 A;  5KFM A;  5KG7 A;  5EE0 A;  1X9S A;  2HOI A;  2MAX A;  3NGD A;  1X42 A;  4O3Q A;  2GO7 A;  7ICT A;  4F4Y A;  4DQQ A;  2O6K A;  2DUY A;  1PVR A;  3GIK A;  4I2C A;  2PMZ F;  3ALR A;  2AGQ A;  5KFE A;  1RYS A;  2K60 A;  4CRX A;  5DDM A;  2B6G A;  4KLH A;  4QWB A;  2QB0 B;  2ASL A;  4EX7 A;  2R8G A;  2KVS A;  3IN5 A;  1HUZ A;  4DFM A;  2LPE A;  3AQE A;  1RQN A;  2HBK A;  5AKG A;  4FFD A;  5KG3 A;  4U7C A;  1L8O A;  2XY6 A;  5KFU A;  3PZP A;  2WF5 A;  4I27 A;  4RQN A;  1C7Y A;  5TIS U;  5L1I A;  4KLD A;  4QIW F;  4YFK A;  2NRW A;  2W04 A;  4DSJ A;  2HHW A;  8ICU A;  3SAG A;  3MR5 A;  1N56 A;  3SI8 A;  3C2M A;  4RUC A;  1V38 A;  2L5Y A;  3FDS A;  2F1J A;  2KP7 A;  4Y2P A;  1LV5 A;  1ZQJ A;  3K1R B;  2W3S A;  5D46 A;  4O9M A;  4QZB A;  5DB9 A;  3C23 A;  4YR2 A;  5AKH A;  1PK3 A;  4KLJ A;  2R8I A;  1XSN A;  1VLB A;  4UQG A;  3SEN A;  4ECV A;  4X5V A;  1D8L A;  3IP4 B;  3PX0 A;  1RZT A;  3V7J A;  4UBC A;  1LKY B;  5AM0 A;  1TK8 A;  2AGP A;  3MGI A;  1JRP A;  2W11 A;  2W3R A;  3TAC B;  2M0N A;  4OJ6 A;  4TUQ A;  2W43 A;  1NK9 A;  5DB8 A;  3JPR A;  2FMP A;  4ELT A;  2ZIV B;  3KHL A;  3JPN A;  2A1A A;  4F4X A;  4C4R A;  4UB3 A;  1ZD4 A;  3QUQ A;  3DEE A;  7ICK A;  2FPK A;  3BZC A;  2MA1 A;  2IA6 A;  1KFT A;  2ZUD A;  2W55 A;  5III A;  1QLN A;  3CW2 C;  2W54 A;  4QW8 A;  2I6X A;  4CF3 A;  3F5A A;  3C29 A;  1NKE A;  5AM2 A;  1S77 D;  5B5E U;  4LZG A;  2ASD A;  2ZIU B;  4G3I A;  7ICR A;  4KMU A;  1UA0 A;  1YT3 A;  5CRX A;  3JPO A;  1U48 A;  2HHU A;  4ELU A;  2H3Z A;  4F5O A;  4P0P B;  4DQI A;  2LKY A;  4DFJ A;  4M9J A;  3HJE A;  3Q8M A;  5KT6 A;  2NRT A;  2XI9 A;  4QZC A;  5DG9 A;  4PZO A;  5BPC A;  4C8N A;  1TV9 A;  4Q8F A;  2K8B B;  2G0A A;  1PVQ A;  5AK4 A;  3SD7 A;  4DSF A;  2HBJ A;  5ALO A;  5KFR A;  2GWS A;  4UW9 A;  2JEJ A;  4OJL A;  1NK4 A;  2LYB A;  2OHF A;  1X9X A;  4ED8 A;  2OYY A;  2F1I A;  2KFN A;  3LVW A;  1NJY A;  2A3V A;  2Q4T A;  3S6J A;  4CF4 A;  2E8P A;  1ZJN A;  2VIX A;  2AU0 A;  3ZI4 A;  5D49 A;  2XC9 A;  1HUO A;  3N7S C;  2QLT A;  3WU2 U;  1J2N A;  1DGJ A;  4K4H A;  2WB1 F;  4I2I A;  1QSY A;  1KRP A;  1QQ6 A;  3ZDA A;  4C8L A;  4RZR A;  1B4F A;  5KFT A;  4RQ2 A;  2F76 X;  2ZUC A;  4QNL A;  7ICH A;  5J2D A;  3PST A;  4MFF A;  1ZQO A;  2NRZ A;  2PFO A;  1IM4 A;  1SV4 A;  2BKE A;  2YX8 A;  1OUQ A;  2VA2 A;  3K1Z A;  2JR5 A;  4OJP A;  3QU7 A;  2D8C A;  9ICL A;  4CNQ A;  4M9H A;  4KLT A;  1BPB A;  4F93 B;  2G09 A;  4O3R A;  2DQN B;  3RFA A;  2C2E A;  1TAM A;  3OJU A;  2RDJ A;  2BPF A;  4RPZ A;  4QZE A;  1S0V A;  2W03 A;  5DG8 A;  2W9M A;  1HJP A;  1F44 A;  2J6T A;  4NL9 C;  7ICL A;  1PUZ A;  4IL6 U;  4YQW A;  4DOA A;  3ONN A;  3RH5 A;  4B9L A;  2GOL A;  1TAU A;  3JPS A;  3LYS A;  1ZQR A;  5J2J A;  1ZQI A;  3NVV A;  3BQ7 A;  2AHO B;  4FZM A;  4IS7 A;  1LVH A;  8ICK A;  1Z00 A;  1RYU A;  2B21 A;  5ALT A;  1S9F A;  3EZ5 A;  1JRO A;  3QEB Z;  3PR5 B;  3K4G A;  1TVA A;  2NRV A;  4O3M A;  1S10 A;  1URJ A;  3TI0 A;  4C4S A;  1NK6 A;  2BQ3 A;  5ALX A;  2XCP A;  3IG8 A;  3M8S A;  2ISP A;  3KHG A;  2Q0Z X;  2WF7 A;  3ETR A;  4P0Q A;  4YG2 A;  4C8O A;  2E8N A;  5JUM A;  2AQ4 A;  3A0B U;  5GTI U;  4DWI A;  4EEL A;  1DK2 A;  1JAL A;  1FEZ A;  3EW9 A;  4EEK A;  1H38 A;  3NRZ A;  4UAR A;  2LM4 A;  2ZUB A;  1X9M A;  4Q43 A;  1DK3 A;  4B9T A;  4KX5 A;  1SIJ A;  5ALL A;  2XO7 A;  4M9L A;  2JXJ A;  4M0A A;  2OEH A;  5KFZ A;  4JWM A;  3AL0 B;  3BS7 A;  4PL1 A;  7ICS A;  2OM6 A;  5J0X A;  3PW2 A;  3K75 D;  2C22 A;  4MFA A;  1T3N A;  4I2E A;  4CF5 A;  3E2E A;  8ICV A;  3TKA A;  3Q8L A;  3V72 A;  4PL2 A;  3GIM A;  2DF4 B;  1HEK A;  2WF8 A;  4US8 A;  9ICE A;  3AUO A;  5AI8 A;  2LHT A;  2ZIX A;  5ALF A;  1UA1 A;  3MBY A;  2XVT A;  1X9W A;  4PH5 A;  5HML A;  2KZZ A;  2HVH A;  4Y2Y A;  1N61 A;  5J0P A;  5DB6 A;  3MR6 A;  4DSI A;  3GIJ A;  3BQT A;  4R8U A;  4NM2 A;  4JUZ A;  4BWJ A;  3IDW A;  4MF8 A;  9ICS A;  4F92 B;  3PR4 A;  2FI1 A;  3RF9 A;  3PV8 A;  1ZQQ A;  1ZET A;  3MDA A;  2P66 A;  3PVX A;  1J97 A;  5HP4 A;  4ELV A;  5J0T A;  3QU2 A;  4GLX A;  1UCV A;  3AEV A;  1FO4 A;  3D2N A;  5AM4 A;  2KSO A;  5EE9 A;  4PHE A;  1KQQ A;  2YTU A;  2LMR A;  1PK1 A;  3UMC A;  4ECT A;  4J9Q A;  3SMV A;  1S8O A;  3M8R A;  3T5J A;  2OCE A;  1GO3 F;  2FLN A;  1ZQH A;  3LWL A;  1L7N A;  3H0L B;  3QZ7 A;  1SKS A;  4F5N A;  3NVZ A;  1SGG A;  3H8W A;  5DQI A;  4DS5 A;  1A76 A;  3H8M A;  3JPP A;  3RH6 A;  5KFQ A;  4QW9 A;  3AQF A;  4DFK A;  2HHV A;  1SKR A;  4DLE A;  4IRK A;  5DG7 A;  5IIJ A;  4I2F A;  1PZN A;  4DO9 A;  2VA8 A;  2H3F A;  4DSE A;  5KT5 A;  3SR6 A;  4NLK A;  2LYA A;  2YN4 A;  3AM9 A;  3IM1 A;  2R8J A;  1ARO P;  4ECW A;  1MA7 A;  3HW8 A;  3N4M B;  3BQ0 A;  4DQP A;  4UB6 U;  5KFW A;  2W9B A;  2HCF A;  2KHV A;  3ISC A;  5L1K A;  2KKV A;  4ED0 A;  8ICW A;  3E58 A;  4RU9 A;  1T4G A;  5AKX A;  2BDP A;  1A6S A;  4LJX A;  1JXE A;  1KEJ A;  3BDP A;  3RB4 A;  2G07 A;  3TAR A;  2K8A A;  4YP3 A;  1SZH A;  3NRW A;  2KIV A;  4ECY A;  4DF4 A;  1QQ7 A;  1U4B A;  1RXW A;  2Y9U A;  2P6R A;  1S76 D;  3ZDE A;  1L7M A;  5AM5 A;  4FS1 A;  3UXN A;  3JPT A;  2W8K A;  1Z00 B;  3QZ8 A;  2ZJ5 A;  1YZ6 A;  4NL9 A;  4F2S A;  3NAS A;  1WCN A;  5B66 U;  5AK3 A;  2BHN A;  2EAM A;  2PFP A;  2JZB A;  3SZ2 A;  3QUC A;  1X6J A;  8ICL A;  4F2R A;  1NJX A;  2G5I B;  4FO6 A;  4B9M A;  4NLB A;  2DFL A;  3AMZ A;  5AI4 A;  4P0Q B;  4EX6 A;  3RAX A;  5AKJ A;  3HPO A;  3ZDD A;  5GTH U;  4IQV A;  4Z6F A;  4M6W A;  2G5H B;  1ZXI A;  3AN1 A;  1UT5 A;  1P7D A;  8ICX A;  4O3N A;  3RH4 A;  1U45 A;  2DKX A;  5T14 A;  5KT7 A;  4E0D A;  3KBB A;  3M9M B;  3RJF A;  3WK5 A;  4RNO A;  4M47 A;  4C80 A;  2WF9 A;  4J9S A;  1HIW A;  5AM1 A;  8ICH A;  5KL8 B;  2EZY A;  4HYK A;  9ICQ A;  4BDP A;  2RLT A;  4DF8 A;  4J03 A;  5ALV A;  3WK4 A;  2XY5 A;  2KOB A;  1S0M A;  1L3T A;  3ZD8 A;  4ECQ A;  1B43 A;  1Q8K A;  5J0Q A;  1C20 A;  3NVY A;  4C8K A;  5ALW A;  3RAQ A;  5EWF A;  2ZIX B;  3BJY A;  4ECZ A;  4KLM A;  1KTQ A;  1D8Y A;  2W7O A;  1F0M A;  2JH1 A;  4GFJ A;  5AI0 A;  2MUT A;  4DSL A;  2DGZ A;  1MQ2 A;  1Z4N A;  4R8U B;  5KFN A;  2ZXI A;  3HWT A;  1XU4 A;  3WK8 A;  1QSS A;  5J0O A;  4I2B A;  3C28 A;  3PY8 A;  5KL1 B;  3GZF A;  2XGP A;  3RRG A;  9ICB A;  4RQM A;  4YD1 A;  2FDR A;  4UB5 A;  2H3I A;  2PI5 A;  1SXD A;  1WWV A;  2RQ5 A;  1M6Y A;  3Q8S B;  1L6N A;  4ZH4 A;  3LVV A;  2JEI A;  2JMG A;  1SXE A;  1S5L U;  1ZQY A;  3GU3 A;  3C5G A;  1XS9 D;  1PK1 B;  2DBY A;  1RYR A;  2WFA A;  4F72 A;  2HMX A;  3RB0 A;  5C5J A;  3WKE A;  2BCU A;  4GIB A;  1ED1 A;  2JEG A;  5J0S A;  2E8O A;  5IIL A;  1RG6 A;  1SL2 A;  4P2H A;  4OO1 J;  4YXJ A;  4CGZ A;  3SAF A;  3Q8P B;  1D9F A;  1ZQV A;  1K5O A;  8ICI A;  1KN5 A;  1SV0 C;  1T94 A;  5ALQ A;  5CA7 A;  8ICY A;  2PKE A;  4RPX A;  3MFH A;  3I76 A;  1WG8 A;  3LDA A;  8ICS A;  4QZH A;  3M9N B;  1XSP A;  3M9O B;  2AJQ A;  1X40 A;  8ICM A;  2LYH A;  2ZIW A;  2IMW P;  2KE7 A;  4Y2S A;  2JGA A;  3KKA A;  3UQ2 A;  2YB1 A;  5CR0 A;  5TZV A;  1VJ5 A;  4MEY A;  4RQ8 A;  2W9B B;  4EBC A;  4BX9 C;  5D4B A;  4PPX A;  3PO5 A;  5L1L A;  5HHH A;  1ZQN A;  3DV9 A;  3V6H A;  3MC1 A;  5BOM A;  1KL9 A;  3O0F A;  5J2A A;  2CRX A;  1PVP A;  1CEZ A;  5ALU A;  2KN7 A;  9ICG A;  3RJI A;  5JU5 A;  1XSL A;  9ICJ A;  2WHE A;  1QCK A;  2YQE A;  2Y1J A;  2R8K A;  2IOH A;  3TAD C;  3MGH A;  1XWL A;  5J29 A;  5E79 U;  4JK1 A;  2FMS A;  1NZP A;  5AI6 A;  9ICM A;  3GDX A;  1DGS A;  2MSN A;  3F5E A;  2HBM A;  3QU9 A;  4UAT A;  5DBC A;  2F2A B;  3ISB A;  2JZB B;  3THV A;  3GII A;  4BWM A;  2JHD A;  3CNH A;  2DPJ A;  5KFS A;  4FZL A;  3GIL A;  5KTQ A;  2PFN A;  2VA3 A;  5KG0 A;  2K4P A;  5KG2 A;  2ES6 A;  4RNN A;  4J9N A;  4I2G A;  4CE6 A;  2HHQ A;  2IOF K;  5ALD A;  4DCC A;  1ZRN A;  4EBD A;  1ZJM A;  2XID A;  1UQV A;  3CRX A;  1OW5 A;  4M6W B;  1DOQ A;  2N1R A;  4RNM A;  1BGX T;  3D6J A;  1L7O A;  3N97 B;  3RTV A;  1N2X A;  3QXG A;  3C21 A;  4I2D A;  3PSI A;  1TAQ A;  1NOM A;  4ICA A;  1ZYQ A;  3J81 j;  1U9L A;  5J2B A;  4BGD A;  3D2Q A;  5DKW A;  4KLL A;  5KFP A;  4DSK A;  3GV7 B;  2VAN A;  1S0O A;  1ZOL A;  4EEY A;  1V97 A;  3C2L A;  4UAU A;  4ECX A;  1BPD A;  4R66 A;  4RT2 A;  5ALH A;  5J0U A;  4C8M A;  4IRD A;  4M9N A;  5J2C A;  5ALN A;  5KFY A;  4Z6C A;  4QZG A;  4O5C A;  3OHA A;  2DKZ A;  2FE9 A;  2V4Q A;  2MUT B;  1WUD A;  2RRD A;  4FZN A;  3M7D A;  1NK7 A;  3BQ2 A;  1NK0 A;  3Q8Q B;  2NV3 A;  3T5K A;  4FE3 A;  3Q8K A;  3Q8R B;  5DDY A;  3PW4 A;  2VJ5 A;  4F5Q A;  8ICZ A;  4ED7 A;  5AK6 A;  2VJ4 A;  2CPR A;  5G5G A;  8ICB A;  1ZQC A;  2HW3 A;  2M9N A;  1SB3 C;  1VDV A;  5KFD A;  7ICI A;  4UB2 A;  2BZF A;  3H0R B;  5DGB A;  1Q3U A;  4F4W A;  3A0H U;  1UHU A;  2HDO A;  4NXZ A;  2I9G A;  2WTF A;  3HKZ C;  1KLN A;  2ZTC A;  1QH9 A;  2YMM A;  1XNS A;  2DPI A;  4I28 A;  4OJO A;  1JN3 A;  5HR7 A;  3PW0 A;  3V6K A;  4USA A;  1L8L A;  4DOC A;  5DLF A;  2Z7J A;  2FLP A;  4R63 A;  3M6K A;  1D8B A;  4JB3 A;  7ICM A;  4RQ0 A;  4PHP A;  1QTM A;  5KFJ A;  1BVS A;  5F9L A;  2ZIW B;  3TFS A;  2BCV A;  1Q46 A;  3F2D A;  3OSP A;  2HOF A;  2V9W A;  4MFC A;  3PNC A;  5HNK A;  3GV5 B;  4F5P A;  2AQ0 A;  3VC8 A;  2J6S A;  3R9K A;  7ICQ A;  1NNL A;  5AIA A;  3G6Y A;  9ICF A;  4QJF B;  3EUB 2;  2JH7 A;  2EAO A;  3L4P A;  2ALZ A;  2K8C B;  4OJ5 A;  2IHM A;  1COO A;  1K1Q A;  4DL5 A;  5J2E A;  4PHD A;  3G6V A;  4M04 A;  4RT3 A;  2RHF A;  4ACO A;  5AI9 A;  4JMU A;  4JV1 A;  4KX3 A;  2HBL A;  4RQ6 A;  4R65 A;  3T3F A;  3JPQ A;  5KFB A;  9ICI A;  2XGQ A;  5FP0 A;  4DQS A;  4YVZ A;  5EOZ A;  1O03 A;  1NKB A;  4F4Z A;  4YCX A;  5DQG A;  5G5H A;  2BGW A;  2GH1 A;  4QZF A;  3QX7 A;  9ICO A;  4UAS A;  1Q3V A;  3H40 A;  4UAY A;  3ICX A;  5KFO A;  4DL2 A;  3TAQ A;  3F2C A;  4NJ8 A;  1A0P A;  4I2J A;  5KNI A;  5ALE A;  3KFU F;  4NLN A;  3BQ1 A;  2V4R A;  9ICW A;  2LI6 A;  2OXO A;  3SV4 A;  9ICT A;  4J9K A;  1L3V A;  1TK5 A;  5KAI U;  1ZQU A;  1S0N A;  4G9B A;  1B22 A;  4C0Z A;  4ZOH C;  8ICR A;  1T3Q A;  4MHV A;  4KN7 A;  3N28 A;  3UXO A;  5JRT A;  2YMP A;  5KG4 A;  4UB4 A;  1BNP A;  1CUK A;  4O5E A;  4GXK A;  4NV0 A;  3F53 A;  5KFL A;  2OH2 A;  3N7P D;  2W9A A;  1QSL A;  1EXN A;  4DL6 A;  5KFI A;  4DEZ A;  3WK6 A;  2P35 A;  2G06 A;  3HP6 A;  2W7P A;  4A8E A;  2A1J A;  2R18 A;  4FBT A;  3TFR A;  8ICO A;  4J9L A;  2ATL A;  3H7I A;  2KVC A;  3PSP A;  4DOB A;  5ALK A;  4Z6D A;  3TAN A;  1ZQT A;  4B9S A;  1KW4 A;  1RPL A;  4IQU A;  4TQS A;  4CCH A;  5IIK A;  2E1E A;  1JIH A;  1ZQM A;  1YZ7 A;  2WF6 A;  2UVV A;  5L1M A;  3V6J A;  4O5K A;  4Q8E A;  2FLL A;  4KN4 A;  4KLO A;  5KG6 A;  3PX6 A;  5CHG A;  4YR3 A;  4UAV A;  2KZ3 A;  5CP2 A;  3UQ0 A;  5AHX A;  3IHQ B;  5KFV A;  4EYH B;  4GC6 A;  1Z4O A;  9ICA A;  4J9R A;  3QNM A;  4ECU A;  2ZG6 A;  3WK7 A;  4C7Z A;  4IC9 A;  2BCR A;  3CP8 A;  2BCQ A;  3NVW A;  4Y2J A;  3F2B A;  4J9M A;  1NJW A;  5K4L A;  4KLG A;  4F91 B;  1T7P A;  1ZD2 P;  1BNO A;  4AYB F;  3PSF A;  4YR0 A;  3GFK B;  9ICH A;  5KG5 A;  4IR9 A;  5A0L A;  5J2H A;  1NK5 A;  1KDH A;  2D3D A;  3WKC A;  1MC8 A;  4QZ9 A;  2ODG A;  3KHH A;  4HAI A;  3GV8 B;  2W8L A;  4GXJ A;  3T5H A;  2EQY A;  4US9 A;  2J6U A;  2BPC A;  3D2S A;  1U49 A;  3PML A;  1XC9 A;  3TAP A;  5KFC A;  3BS5 A;  4MF2 A;  1XO1 A;  2NO5 A;  4C7Y A;  3OTQ A;  8ICA A;  1SKW A;  5HR6 A;  4DQR A;  2FPM A;  1JUD A;  3UXP A;  5BOL A;  5HMM A;  4P4M A;  3KHR A;  3SAH A;  4QWE A;  3SQI A;  4P4P A;  2KJ5 A;  1JMS A;  1CI4 A;  1BPX A;  4Y2V A;  4RUA A;  4ED1 A;  3QUT A;  5JTI A;  3ZDB A;  2K89 A;  2C2D A;  3QE9 Y;  2KIC A;  3E0F A;  1COK A;  4PGY A;  2R8H A;  5AM3 A;  1ZQX A;  2F1H A;  3FAH A;  2QKQ A;  4GXI A;  1X66 A;  3QUB A;  3KTQ A;  2KSO B;  1Z1V A;  1FFV A;  5AKI A;  4ED6 A;  5DQH A;  2BPG A;  2UVW A;  3EYZ A;  4KLS A;  3AU6 A;  1D9D A;  4I29 A;  2PXI A;  3L5K A;  4Y2X A; 
#chains in the Genus database with same CATH homology
 1UHU A;  1MN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...