1MN8A

Structure of moloney murine leukaemia virus matrix protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
QTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structure of Moloney murine leukaemia virus matrix protein and its relationship to other retroviral matrix proteins.
pubmed doi rcsb
source organism Moloney murine leukemia virus
molecule tags Viral protein
molecule keywords Core protein p15
total genus 32
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.180 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Gamma-retroviral matrix domain 1mn8A00
1UHUA 1MN8A
chains in the Genus database with same CATH superfamily
7ICIA 1KLNA 1SV0C 4IQUA 7ICQA 2QLTA 4YR3A 3F53A 5KFRA 1RM6C 3QU7A 2C2DA 4M0AA 5L1JA 4C7ZA 1T3NA 1TK0A 4DL3A 4P0QA 4UB1A 4F8RA 3TAQA 3GV5B 1Z3EB 5D4BA 1XSLA 1Z00B 1WCLA 2AH5A 4P0PA 2GO7A 2NRWA 3WU2U 2L5YA 1NOMA 5J2DA 2W03A 2E8NA 3M8RA 2XC9A 9ICCA 3NRWA 4KN4A 2Q4TA 4DQRA 4KLTA 3MC1A 4EELA 4QNLA 1NK5A 3QZ7A 2KVSA 5BPCA 2KICA 2A1JB 4EYHB 2KHVA 1N61A 1NJZA 4YD2A 4YR2A 5ALSA 1ZQRA 3MDCA 3LK9A 3KOOA 5DBAA 4IRDA 1L6NA 3E58A 1Q3UA 2R8HA 1OXJA 1NZPA 4Q44A 7ICHA 2KJ5A 5J8YA 1Z19A 1EXNA 4YR0A 5A0LA 2HHVA 4EZ6A 3H4BA 2PFQA 5JU5A 3UMCA 2OYYA 2F76X 3UXOA 3RJIA 8ICJA 2NV3A 4QWEA 1Q46A 3OHBA 4F5PA 5DGAA 1FIQA 3BQ7A 1RYSA 2KJ8A 4QW9A 3C2KA 4ECRA 9ICKA 2PXIA 2KG5A 2JEJA 1NKEA 4M04A 2PMZF 4RQMA 2IOHA 2BCSA 1ZQFA 5J8YC 3MR6A 5KNIA 4ECYA 3SAFA 2Y1JA 3H7IA 9ICJA 1A77A 2ISOA 2BKEA 3IRUA 1F44A 2KD1A 3WK8A 4ECTA 3BDPA 1SV0A 4RQ3A 1K5OA 5DKWA 1ZQHA 2I6XA 1PK1A 3OSNA 1ZQVA 3AU6A 5ALYA 1NK6A 5J0XA 5KFAA 2HHTA 5GTIU 2ASDA 1FFUA 3QE9Y 2JEGA 4QZCA 1X40A 1KDHA 5AKKA 1S5LU 3SEIA 5KFNA 1DGJA 1D8YA 3F5EA 2KK0A 2HHUA 5L1MA 4B9VA 5IIMA 2JZBB 5AKJA 2C28A 1IM4A 5DQIA 3AN1A 2EQYA 4OJ6A 3RH6A 5HHIA 4KLDA 1QCKA 3GIIA 2HOIA 2F8LA 8ICHA 3NUQA 4F4WA 1MQ3A 1NNLA 3MGIA 3Q8SB 3DEEA 3L3FX 1NK8A 2AQ4A 2UVWA 9ICBA 2F2AB 5TZVA 5DQHA 8ICUA 4JV1A 5ALWA 1UA0A 7ICTA 4LZGA 4J03A 5J2CA 4RNNA 4DL5A 3RJEA 2ZIWA 1UT5A 2JGAA 1BNOA 4BWMA 2XCPA 1C7YA 4DWIA 1ZQGA 2DGZA 3BS5B 4UBBA 3RJFA 2ASLA 4MHVA 5G5GA 3M9NB 2W9CA 2XCAA 2KVCA 2WF5A 3QUQA 5GTHU 3PMNA 3ZDBA 2IHMA 4F3OA 3G6VA 3M9OB 4RQNA 4TQSA 3SQIA 4F2SA 4O3MA 3PW0A 3EPIA 4P4PA 4C8MA 5C5JA 1N56A 2JXJA 2BQ3A 4ED1A 2F1HA 3CYMA 1ZD4A 2MAXA 4I29A 1NZBA 2D3DA 4DL4A 4Y2TA 2AU0A 3B0XA 8ICKA 1SZPA 4F71A 4UB8U 2G06A 2HHSA 1JMSA 8ICSA 7ICGA 7ICVA 2ZTDA 5IIIA 5KT7A 3QNMA 3PO4A 2XY7A 3BZCA 5ALNA 3RJKA 3WKEA 5FP0A 5J2FA 2G5IB 2WAQF 1D8BA 2BCVA 4UAWA 1T94A 4BXOA 4QWDA 3IP4B 5J0SA 4EX7A 1WCNA 1VDVA 2UVUA 4I2BA 3LYSA 3S6JA 5B5EU 2K4PA 4QZAA 1ZQJA 5AI5A 8ICYA 2WF8A 1PZNA 3AQFA 4QZ9A 2MSNA 4DEZA 4US9A 2EZZA 4Q45A 4ED8A 2H3FA 1ZQTA 5DBBA 2RHFA 5KFJA 8ICLA 1DGSA 2G0AA 2R8IA 1XC9A 4TURA 5AM0A 3QU9A 4P0QB 5ALMA 4R8UA 3SD7A 1SWVA 2ZTEA 1UPHA 1JX4A 1BPDA 5K4LA 3VCBA 3AU2A 1URJA 4J9LA 5DQGA 4Y2SA 2CN1A 5AKEA 7ICLA 5ALUA 2ISPA 1NK0A 5KG2A 1IG6A 3N7RC 2F77X 2YB4A 4NLCA 2E8PA 4KLIA 2PFNA 2ZIXB 1ZRNA 4K4GA 3AL0B 1NJYA 4J9RA 3L5KA 3KHHA 1LKYA 2AGOA 2ZXHA 2FPKA 5AHXA 5DG7A 2LI6A 3K4GA 3VC8A 4O5KA 3C28A 5EE9A 1U47A 2HOFA 3SZ2A 4CCHA 5CB1A 3K1RB 2VJ5A 3EZ5A 3SV4A 3RR7A 2B0CA 1RQNA 3AEVA 4J9OA 3HP6A 5J0TA 3PW4A 1TVAA 2ES6A 4YVZA 4RPXA 2BR0A 4DQPA 4EBDA 8ICRA 1SL2A 4F5NA 1Z1VA 1S9FA 2KFNA 1F5SA 4CF5A 4GIBA 1Q3VA 3TARA 2W9BA 4RPZA 2W9BB 4HAIA 3OHAA 5AI6A 2DUYA 1ZETA 4QZDA 3MBYA 1ZQBA 2HBKA 5JRTA 3SR6A 4BWJA 5EE0A 4AYBC 4XA5A 3NVWA 3HW8A 1T8EA 8ICZA 1TFRA 4ED2A 2JRZA 2ATLA 3AQEA 5J0UA 2XICA 1L7OA 1DOQA 2NRVA 2UVRA 8ICTA 3C23A 2YY6A 3E2EA 1U48A 4JV2A 4PZNA 9ICSA 2UVVA 2V4QA 1RG6A 2DKZA 2KZ3A 4QIWC 2JV3A 5ALIA 1NKCA 1ZQEA 5KFQA 4NM2A 1K1SA 2W54A 2ZIUA 1COOA 1YZ7A 4KTQA 3KHRA 4PH5A 3RJHA 2E1FA 4GXKA 1S76D 2LM1A 3RB0A 3Q8QB 4NLKA 4M2YA 9ICXA 1VLBA 2LBOA 2HHXA 4ECWA 7ICSA 3HILA 2BCUA 1O03A 4RQ8A 4J9MA 3V7KA 2H3VA 3THVA 4Y2PA 4KLOA 3NVYA 3WKBA 2OCEA 5AI9A 4KLMA 1B43A 3T79A 3PW2A 2VJ4A 9ICHA 5IIKA 4RQ7A 4RQ0A 4DOBA 1L8LA 4K4IA 3ETRA 2WB1C 5J2HA 1OW5A 3C1YA 1QTMA 4U7CA 1P7DA 5ALPA 1XU4A 2G09A 2R18A 2LYBA 4US8A 5D46A 1ZQIA 9ICMA 1S8OA 3OGUA 2MA1A 5J0PA 3C5FA 3C2LA 3T3FA 1JI7A 1MN8A 3FM9A 3UPQA 1TAMA 5KFFA 8ICGA 3EWAA 4R63A 1TE2A 2W9MA 4YMMA 2HBJA 4UAYA 3QUTA 2MUTA 4RPYA 4XQ8A 1NKBA 5ALJA 4UAVA 2XY6A 1NI3A 3H0MB 5CR0A 3UQ2A 3BS7A 4FBUA 2QKQA 1KKXA 4QWBA 1N2XA 3HRDD 4UARA 2ZIVB 4PL1A 3RRGA 5AI8A 1SGGA 3H0RB 4I2EA 1IXRA 5E79U 4MEYA 2HSZA 3QXGA 4HYKA 1XSPA 2NYVA 1AROP 4B9LA 4F4KA 2P6UA 5G5HA 2ZUCA 5DG9A 1YT3A 2Z7JA 1TK8A 4I2IA 1QQ5A 2A3VA 2KHQA 3PX4A 1F0MA 4Y2JA 5CA7A 2ESEA 4G3IA 3M1YA 1ZQDA 2I9GA 4DCCA 3PY8A 2BCQA 1KEJA 3DDHA 4NLGA 4C4TA 4QZIA 4RQ2A 4QWCA 4UW9A 3PR4A 3SENA 2KFZA 5HHHA 5KFLA 4M9NA 2CRXA 2H5XA 4DLGA 7ICMA 1J2MA 2ZUBA 4I2DA 3Q8LA 4F72A 1KFDA 5KFUA 8ICOA 2Y9TA 5ALFA 5AKHA 5F9LA 3G6XA 1CRXA 5HNKA 4X5VA 3TADC 2ZIVA 5AM1A 2PMZC 2A1AA 2W7PA 4DQIA 3RB3A 4UASA 2WB1F 2BPFA 4YCXA 2K60A 4EX6A 4CNQA 4M9JA 1TAQA 3MDAA 4C80A 1SL1A 1SKSA 3KKAC 3TKAA 5AK3A 2J6SA 4R8UB 2ASJA 2WAQC 3TACB 4MEXA 7ICFA 4YXJA 2IOFA 2H3ZA 4ECQA 1O08A 2G08A 4NV0A 4I2GA 5ALRA 4UQGA 3RBDA 1SB3C 2HVHA 4ZH4A 3MGHA 7ICNA 5D49A 2BGWA 4Y2UA 4IQVA 2FJ6A 1JIHA 1ZQNA 4XRHA 5AK5A 4RZRA 5DG8A 4I2CA 2PI4A 5ALEA 4RQ4A 2W8KA 3RB4A 2J6UA 5CEHA 4OCZA 3LVWA 4J9NA 1FEZA 2Y0SC 1BPEA 3F2CA 4QZEA 5HMMA 1JXLA 3C5GA 2I1QA 2JZBA 4Z6DA 3OSPA 2ZIXA 2DPIA 1DK3A 3TADA 1N63A 1NJWA 3KKAA 2K8CB 3CP8A 2RLTA 1SKWA 1VJ5A 4Y2YA 5AICA 2XY5A 3RB6A 2MUTB 1XS9D 3MR5A 4ED6A 3IG5A 4PGXA 3D2NA 3I28A 3WK7A 3V7LA 3RBEA 3IDWA 3IN5A 1WUDA 2DKXA 3RAQA 8ICPA 2CPRA 3QUBA 3MR3A 1IV8A 3GIKA 3FDSA 2GOLA 3ZI4A 4O3SA 4FE3A 1C20A 4DF4A 4MFFA 2D6FC 3GU3A 5AI4A 2B6GA 2JH1A 1ZQSA 4O9MA 3BS5A 3ETLA 4EEKA 3PW7A 4NLBA 4QZBA 3CRXA 1HEKA 2XI9A 4M6WB 4NLZA 2W11A 2EZXA 5ALZA 4F5RA 4O5EA 4ECUA 1LKYB 2JHDA 3C21A 5J2GA 3FYHA 3GV7B 1ZQ1C 4KLSA 4C4RA 8ICIA 5H2FU 5KG0A 5BOLA 3GILA 1LV5A 2OEHA 4LZDA 4TUPA 2W04A 1IIPA 4DSFA 2N1RA 8ICCA 3H8WA 4NY8A 4ED7A 2VIXA 1GO3F 2XIDA 2ZJ5A 4KLHA 4ELVA 4ECXA 2KP7A 4BGDA 3UM9A 9ICNA 2EDUA 5KFSA 1COKA 4YMOA 3UQ0A 4NL9A 2YMQA 5JTIA 4RUCA 5KFZA 9ICLA 3ALRA 2LKYA 1PK1B 3NTUA 1A0PA 9ICQA 2ZIWB 2DBYA 4DSJA 5KFMA 4M47A 1UHUA 1KL9A 1ZXIA 2KSOA 3G6YA 3GIJA 1RDFA 2W9CB 3HKZC 1ZD5A 4O3RA 3UMGA 1A76A 3JPNA 5F3XB 1L7MA 4KLJA 1SWWA 3N97B 4EZ9A 8ICNA 5DBCA 5ALTA 3BQ0A 3OJUA 4Z6EA 2E1EA 4G9BA 1NJXA 3PZPA 1UQVA 4CE6A 1UT8A 3M8SA 2AJQA 4NLNA 4CF3A 3EW9A 3ZDEA 1HUOA 2PKEA 4KLGA 5KG4A 4IRKA 1B4FA 2HDOA 3RJGA 5IILA 4KLLA 9ICUA 4MF2A 2FMPA 1L3UA 4B6JA 2LPEA 1U49A 4GXIA 4EBEA 4MF8A 5ALVA 1Z1BA 1BPBA 1PVPA 1ZJNA 5KT5A 4DL7A 5F9NA 3M9MB 3MGVA 1HIWA 9ICRA 4U6PA 5J29A 1D8LA 1BGXT 1S0VA 4O3QA 1ZD2P 3TFRA 2P66A 1X2IA 4FS2A 2M0NA 4Y2VA 4F5QA 5DGBA 5ALDA 1ZQMA 3QEAZ 2W3SA 3NASA 5KAIU 4NJ8A 4PPXA 1L3VA 2I5HA 2VA3A 1L7NA 2KIWA 9ICWA 3RH4A 3H0LB 4AYBF 2BZFA 4GC6A 4JUZA 3JPTA 1S0MA 4O3NA 1V38A 4C8OA 1XO1A 3F2DA 3AMZA 2C2RA 2F1IA 2FLPA 1NK7A 3V72A 4NM1A 4FO6A 4Q8FA 4DFMA 5J2JA 2AXTU 1B22A 2KZMA 1RPLA 2CXYA 5AK6A 3FAHA 3NVZA 4P2HA 9ICTA 2WTFA 1KN5A 5AM3A 4M9GA 8ICBA 1ZQZA 5CRXA 4Y2RA 4DSKA 4UB6U 2IBKA 1S10A 4C8LA 2DQNB 4A8EA 3PMLA 2ALZA 1Q8KA 1T3QA 2DWQA 2W8LA 3GQCA 3ED5A 1LVHA 3OTQA 5KFOA 3KD3A 1KTQA 2JMGA 2FMSA 4UB2A 4R66A 2AGPA 1KFSA 1A6SA 4CGZA 2P35A 5KT3A 2KV2A 4IC9A 3D2SA 3ZD9A 3WK4A 4F5OA 4ICAA 4TQRA 3GIMA 3PW5A 4YD1A 5KFGA 1PVQA 2O6KA 1KRPA 2KTQA 1V9PA 2W43A 3Q8PB 3HJEA 4B9SA 3O0FA 4DL2A 2FLLA 5KT4A 4I2FA 5EOZA 4O5CA 3A0HU 3RH5A 4TUSA 3WKDA 4RQ1A 3CNHA 4KMUA 4KLEA 2K4HA 2Y0SF 2YMPA 3LWLA 4DSEA 7ICRA 5KFVA 2R8KA 5DB6A 4I2HA 2QB1A 3T5JA 2E5SA 2JH7A 1KQQA 8ICQA 5KFKA 2IOFK 7ICJA 5J0RA 4RQ5A 1L3TA 3PSTA 2JEIA 1ZQOA 4QWAA 1JN3A 2YMLA 5KFEA 4DQSA 2KIVA 2IA6A 1S0NA 4GFJA 7ICUA 3UMBA 2ODGA 4DFDA 3Q8KA 1T4GA 3PSFA 2EANA 4QIWF 1ECWA 2WF9A 3N4MB 3RJJA 4KLFA 3HT3A 4RQ6A 3LVVA 2YX8A 9ICIA 2QB0B 4BUGA 1MC8A 3QU4A 5KG1A 4F91B 3H4DA 1WWUA 4IQWA 5KG6A 1QQ7A 1KSPA 4OJ5A 3MFIA 5AKGA 4ED0A 4E0DA 4C7YA 4M9HA 3SV3A 2EAOA 1ZQWA 3GDXA 1FFVA 2HHWA 4XUSA 3T5LA 2YN4A 5KFWA 5AKYA 4UB4A 1RQLA 4NXZA 1L8OA 2OWOA 4EYIB 5AKXA 2FI1A 3ISDA 5AK4A 4Y2QA 3I76A 3NGDA 2F44A 2AHOB 2HI0A 2KJ9A 2FMQA 3HPOA 4RT3A 1JRPA 3QU2A 3KZIU 4KN7A 1JALA 1JUDA 2K8AA 4DS5A 3OPXA 1JXEA 4J9QA 3HKZF 3GV8B 3ORYA 3IG8A 8ICWA 3NVVA 5KTQA 5IIOA 2PI5A 1S0OA 1X66A 2ZJAA 5ALOA 3K75D 4QZFA 4KITB 2FDRA 4FZLA 4KMOB 2BPGA 4PZOA 5ALHA 4RNOA 3UXPA 4EBCA 4QZHA 4NWIA 5DDYA 3SAHA 1L5UA 2YTUA 2BQRA 4Z6FA 3PSIA 4JWMA 2KZZA 4ELUA 1AQ6A 4OJPA 4YP3A 4LVSA 1RXWA 3TFSA 2NRXA 7ICEA 2XVTA 3WKCA 4OJLA 4P4MA 5DLGA 2C22A 3ONNA 3R9KA 3T5HA 1TK5A 5AKZA 1SKRA 5J0OA 2OH2A 3TQ1A 3V6JA 5EWEA 3MR2A 3OJSA 9ICOA 1WWVA 1QSYA 4TUQA 4RU9A 4F4YA 1CI4A 1CUKA 4NL9C 1X9SA 5HR6A 3NRZA 3DV9A 2E3TA 5HMLA 4IL6U 4R64A 8ICFA 3V6KA 4BDPA 3JPPA 1TV9A 4RUAA 1ZYQA 5AM4A 1M6YA 4P4OA 1L3SA 2BPCA 3C1ZA 3PX6A 4FS1A 1RXVA 4CRXA 4YN4A 4DSLA 1SIJA 3NS1A 3RTVA 1ZQKA 8ICXA 4Z6CA 1S97A 1HUZA 2Y1IA 3PR5B 5J0QA 3T5KA 5ALGA 4PHDA 2VA8A 1D9FA 1PUZA 2RDIA 5DB8A 2WHEA 2WF6A 1LB2B 1X9WA 1BPZA 3QX7A 2BDPA 3ICXA 2R8JA 1ZQUA 1ZQXA 3EYZA 1X9MA 1SXEA 2JEFA 2FE9A 5DLFA 1ZQLA 4DQQA 3M6ZA 2NRTA 2MRLA 5KFXA 2OM6A 4F92B 2K8BB 9ICPA 3UXNA 4JV0A 4GXJA 5KFIA 2HMXA 5AM5A 4RT2A 8ICAA 3FC4A 3SYZA 2LHTA 2NRZA 3AM9A 8ICEA 5B66U 4YMNA 2R8GA 3PO5A 3H8MA 4QZ8A 1J2NA 3Q8RB 3ZDDA 4C0ZA 2QARB 1H38A 2HBLA 2J6TA 2KSOB 2DFLA 1ZQYA 4DOAA 1Z00A 3K1ZA 1MQ2A 3LDAA 2MU2A 4PL2A 2YB1A 4MFCA 2HHQA 2KE7A 4UB5A 9ICAA 2LYAA 1X6JA 3RF9A 4YFKA 5HR7A 3L4PA 4OD0A 4GC7A 3ZDCA 2G5HB 2A1JA 4IQTA 5KG7A 4DFPA 1ED1A 5DDMA 2EZYA 3H8JA 5CJ7A 4B9UA 2HBMA 4KLQA 4Y2XA 5L1IA 1WG8A 5CWRA 1Z4NA 1N5XA 3V7JA 1L7PA 3KBBA 3KHGA 2XGPA 1XNSA 2EH9A 2RRDA 3GFKB 5AKIA 4DLEA 1J97A 3F5AA 4R65A 4ED3A 2IHNA 1Z4OA 4F2RA 3H8SA 2BDUA 3B0YA 3B9JA 2VANA 5L1LA 5J2EA 1BPXA 4JMUA 1CEZA 1Y88A 2DPJA 5EE1A 2K4IA 2M9NA 9ICFA 1X9XA 2E8OA 4ACOA 3TI0A 9ICGA 3H40A 8ICVA 4YG2A 4J9KA 2BQUA 1T7PA 4DF8A 4M6WA 7ICKA 4JWNA 4KLUA 1MA7A 1SZHA 2H3QA 4UBCA 1KW4A 5EWFA 4KX5A 4I27A 4DFKA 4DSIA 3N7SC 3MABA 4F50A 1X42A 1X6IA 3KZXA 4UAZA 3TANA 2F8KA 3QYPA 5C0YA 2ZG6A 1XO0A 1V85A 5ALQA 1ZQPA 1ZQAA 1ZD3A 1DRGA 3HX0A 3ISBA 4P0PB 4PHAA 3WK5A 2KKPA 4O3OA 4FZMA 5T14A 4ELTA 3QZ8A 3ZD8A 3JPSA 2ZTCA 4QZGA 1BVSA 4ECZA 1MSWD 1TKDA 4BXOB 9ICVA 2GLEA 1OUQA 4B9MA 1HJPA 2HW3A 4I28A 4EEYA 1DXSA 2HCFA 3Q8MA 1NK4A 2YQEA 4QW8A 2VKQA 2IMWP 4ECSA 3AUOA 4OJOA 4EENA 5ALKA 5KAFU 5KFHA 2ZJ8A 1JROA 1K1QA 3KFUF 2AQ0A 1ZRMA 2G07A 2KEYA 2A19A 5J2KA 2WF7A 5J0WA 3M6KA 3I1YA 3C29A 1ZQQA 2W7OA 3J81j 3V6HA 2BHNA 4B9TA 1D9DA 1BNPA 2KNJA 2LM4A 3RFAA 4LJXA 5KFCA 3CW2C 4DS4A 5KT6A 4BJQA 1QSLA 3BZKA 2DL0A 1QH9A 5EWGA 4IRCA 1ZQCA 5HP4A 2PFPA 4DO9A 4DL6A 4M9LA 2XO7A 5IINA 4FFDA 1YZ6A 2W55A 2DF4B 4C8KA 3BQTA 4PHEA 2LYHA 4PGYA 5J2BA 3ISCA 2WFAA 2KOBA 5J2AA 2FLNA 1U9LA 2ZUDA 3PNCA 4F4XA 1KBUA 3WK6A 1QSSA 1U45A 4UB3A 5DB7A 3SAGA 3A0BU 2EAPA 3PX0A 2FPLA 1ZJMA 3RAXA 2NO4A 5L9XA 1UA1A 3QU5A 2E8MA 3EPGA 4ECVA 3PVXA 2OXOA 3MFHA 2GWSA 3QEBZ 3E0FA 4UATA 2W9AA 9ICEA 1KFTA 4YXMA 4USAA 2FPMA 2Y9UA 1XWLA 5KFYA 3D6JA 4OO1J 3IM1A 1QLNA 4QJFB 5AIBA 2QARA 5ALLA 1TAUA 1PK3A 2EAMA 3PSPA 2PFOA 1SXDA 1RYUA 5DB9A 3BJYA 2Q0ZX 4F4ZA 2K4EA 4C8NA 5CHGA 5ALXA 2KMDA 1S77D 2H3IA 3TAPA 1RZTA 5KFDA 4Q43A 4JK1A 5KG3A 4GLXA 4B9NA 4CDGA 3SMVA 4I2JA 3SI8A 2W3RA 1N62A 2KKVA 2VA2A 5L1KA 7ICPA 3C2MA 4YQWA 2ZIUB 1V97A 3N7PD 4C4SA 2C2EA 7ICOA 1NK9A 5KL8B 3RRHA 1SV4A 5J0YA 1FO4A 1B0XA 5TISU 2V4RA 2BCRA 4UAUA 5AI0A 5KFTA 2F3NA 2YMMA 2P6RA 3JPQA 1N48A 4PGQA 3HWTA 1PVRA 4F93B 1SL0A 4CF4A 3KHLA 5AM2A 1BPYA 2V9WA 4IS7A 4FBTA 8ICMA 4RNMA 3WK9A 4O3PA 2AGQA 1UCVA 2K89A 4FZNA 3U26A 2RP5A 4ZOHC 5EE3A 3F2BA 1U4BA 3BQ2A 4I2AA 5KFPA 2OHFA 5AKLA 1N5WA 2QB0A 3WKAA 3EUB2 1ZOLA 3LWMA 3GZFA 4BX9C 2KN7A 4Q8EA 5CP2A 4K4HA 5KG5A 3RR8A 2RDJA 3IHQB 5J2IA 4DFJA 3PV8A 2HOQA 4AP9A 3BQ1A 4O0IA 5KL1B 2B21A 5JUMA 4DOCA 1QQ6A 4PJ0U 4J9PA 1WYGA 4J9SA 4MFAA 5KFBA 3N28A 1N60A 1DK2A 1RYRA 2F1JA 3IV6A 5AIAA 2XGQA 3KTQA 2LMRA 1XSNA 4JB3A 4KX3A 4PHPA 2HVIA 2JR5A 2GH1A 5IIJA 3M7DA 5KT2A 2NO5A 2ZXIA 5BOMA 3JPOA 4IR9A 3JPRA 4WJ3B 3QUCA 3ZDAA 2D8CA 4IR1A 3D2QA 2RQ5A
chains in the Genus database with same CATH topology
1UHUA 1MN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHU A;  1MN8 A; 
#chains in the Genus database with same CATH topology
 7ICI A;  1KLN A;  1SV0 C;  4IQU A;  7ICQ A;  2QLT A;  4YR3 A;  3F53 A;  5KFR A;  1RM6 C;  3QU7 A;  2C2D A;  4M0A A;  5L1J A;  4C7Z A;  1T3N A;  1TK0 A;  4DL3 A;  4P0Q A;  4UB1 A;  4F8R A;  3TAQ A;  3GV5 B;  1Z3E B;  5D4B A;  1XSL A;  1Z00 B;  1WCL A;  2AH5 A;  4P0P A;  2GO7 A;  2NRW A;  3WU2 U;  2L5Y A;  1NOM A;  5J2D A;  2W03 A;  2E8N A;  3M8R A;  2XC9 A;  9ICC A;  3NRW A;  4KN4 A;  2Q4T A;  4DQR A;  4KLT A;  3MC1 A;  4EEL A;  4QNL A;  1NK5 A;  3QZ7 A;  2KVS A;  5BPC A;  2KIC A;  2A1J B;  4EYH B;  2KHV A;  1N61 A;  1NJZ A;  4YD2 A;  4YR2 A;  5ALS A;  1ZQR A;  3MDC A;  3LK9 A;  3KOO A;  5DBA A;  4IRD A;  1L6N A;  3E58 A;  1Q3U A;  2R8H A;  1OXJ A;  1NZP A;  4Q44 A;  7ICH A;  2KJ5 A;  5J8Y A;  1Z19 A;  1EXN A;  4YR0 A;  5A0L A;  2HHV A;  4EZ6 A;  3H4B A;  2PFQ A;  5JU5 A;  3UMC A;  2OYY A;  2F76 X;  3UXO A;  3RJI A;  8ICJ A;  2NV3 A;  4QWE A;  1Q46 A;  3OHB A;  4F5P A;  5DGA A;  1FIQ A;  3BQ7 A;  1RYS A;  2KJ8 A;  4QW9 A;  3C2K A;  4ECR A;  9ICK A;  2PXI A;  2KG5 A;  2JEJ A;  1NKE A;  4M04 A;  2PMZ F;  4RQM A;  2IOH A;  2BCS A;  1ZQF A;  5J8Y C;  3MR6 A;  5KNI A;  4ECY A;  3SAF A;  2Y1J A;  3H7I A;  9ICJ A;  1A77 A;  2ISO A;  2BKE A;  3IRU A;  1F44 A;  2KD1 A;  3WK8 A;  4ECT A;  3BDP A;  1SV0 A;  4RQ3 A;  1K5O A;  5DKW A;  1ZQH A;  2I6X A;  1PK1 A;  3OSN A;  1ZQV A;  3AU6 A;  5ALY A;  1NK6 A;  5J0X A;  5KFA A;  2HHT A;  5GTI U;  2ASD A;  1FFU A;  3QE9 Y;  2JEG A;  4QZC A;  1X40 A;  1KDH A;  5AKK A;  1S5L U;  3SEI A;  5KFN A;  1DGJ A;  1D8Y A;  3F5E A;  2KK0 A;  2HHU A;  5L1M A;  4B9V A;  5IIM A;  2JZB B;  5AKJ A;  2C28 A;  1IM4 A;  5DQI A;  3AN1 A;  2EQY A;  4OJ6 A;  3RH6 A;  5HHI A;  4KLD A;  1QCK A;  3GII A;  2HOI A;  2F8L A;  8ICH A;  3NUQ A;  4F4W A;  1MQ3 A;  1NNL A;  3MGI A;  3Q8S B;  3DEE A;  3L3F X;  1NK8 A;  2AQ4 A;  2UVW A;  9ICB A;  2F2A B;  5TZV A;  5DQH A;  8ICU A;  4JV1 A;  5ALW A;  1UA0 A;  7ICT A;  4LZG A;  4J03 A;  5J2C A;  4RNN A;  4DL5 A;  3RJE A;  2ZIW A;  1UT5 A;  2JGA A;  1BNO A;  4BWM A;  2XCP A;  1C7Y A;  4DWI A;  1ZQG A;  2DGZ A;  3BS5 B;  4UBB A;  3RJF A;  2ASL A;  4MHV A;  5G5G A;  3M9N B;  2W9C A;  2XCA A;  2KVC A;  2WF5 A;  3QUQ A;  5GTH U;  3PMN A;  3ZDB A;  2IHM A;  4F3O A;  3G6V A;  3M9O B;  4RQN A;  4TQS A;  3SQI A;  4F2S A;  4O3M A;  3PW0 A;  3EPI A;  4P4P A;  4C8M A;  5C5J A;  1N56 A;  2JXJ A;  2BQ3 A;  4ED1 A;  2F1H A;  3CYM A;  1ZD4 A;  2MAX A;  4I29 A;  1NZB A;  2D3D A;  4DL4 A;  4Y2T A;  2AU0 A;  3B0X A;  8ICK A;  1SZP A;  4F71 A;  4UB8 U;  2G06 A;  2HHS A;  1JMS A;  8ICS A;  7ICG A;  7ICV A;  2ZTD A;  5III A;  5KT7 A;  3QNM A;  3PO4 A;  2XY7 A;  3BZC A;  5ALN A;  3RJK A;  3WKE A;  5FP0 A;  5J2F A;  2G5I B;  2WAQ F;  1D8B A;  2BCV A;  4UAW A;  1T94 A;  4BXO A;  4QWD A;  3IP4 B;  5J0S A;  4EX7 A;  1WCN A;  1VDV A;  2UVU A;  4I2B A;  3LYS A;  3S6J A;  5B5E U;  2K4P A;  4QZA A;  1ZQJ A;  5AI5 A;  8ICY A;  2WF8 A;  1PZN A;  3AQF A;  4QZ9 A;  2MSN A;  4DEZ A;  4US9 A;  2EZZ A;  4Q45 A;  4ED8 A;  2H3F A;  1ZQT A;  5DBB A;  2RHF A;  5KFJ A;  8ICL A;  1DGS A;  2G0A A;  2R8I A;  1XC9 A;  4TUR A;  5AM0 A;  3QU9 A;  4P0Q B;  5ALM A;  4R8U A;  3SD7 A;  1SWV A;  2ZTE A;  1UPH A;  1JX4 A;  1BPD A;  5K4L A;  3VCB A;  3AU2 A;  1URJ A;  4J9L A;  5DQG A;  4Y2S A;  2CN1 A;  5AKE A;  7ICL A;  5ALU A;  2ISP A;  1NK0 A;  5KG2 A;  1IG6 A;  3N7R C;  2F77 X;  2YB4 A;  4NLC A;  2E8P A;  4KLI A;  2PFN A;  2ZIX B;  1ZRN A;  4K4G A;  3AL0 B;  1NJY A;  4J9R A;  3L5K A;  3KHH A;  1LKY A;  2AGO A;  2ZXH A;  2FPK A;  5AHX A;  5DG7 A;  2LI6 A;  3K4G A;  3VC8 A;  4O5K A;  3C28 A;  5EE9 A;  1U47 A;  2HOF A;  3SZ2 A;  4CCH A;  5CB1 A;  3K1R B;  2VJ5 A;  3EZ5 A;  3SV4 A;  3RR7 A;  2B0C A;  1RQN A;  3AEV A;  4J9O A;  3HP6 A;  5J0T A;  3PW4 A;  1TVA A;  2ES6 A;  4YVZ A;  4RPX A;  2BR0 A;  4DQP A;  4EBD A;  8ICR A;  1SL2 A;  4F5N A;  1Z1V A;  1S9F A;  2KFN A;  1F5S A;  4CF5 A;  4GIB A;  1Q3V A;  3TAR A;  2W9B A;  4RPZ A;  2W9B B;  4HAI A;  3OHA A;  5AI6 A;  2DUY A;  1ZET A;  4QZD A;  3MBY A;  1ZQB A;  2HBK A;  5JRT A;  3SR6 A;  4BWJ A;  5EE0 A;  4AYB C;  4XA5 A;  3NVW A;  3HW8 A;  1T8E A;  8ICZ A;  1TFR A;  4ED2 A;  2JRZ A;  2ATL A;  3AQE A;  5J0U A;  2XIC A;  1L7O A;  1DOQ A;  2NRV A;  2UVR A;  8ICT A;  3C23 A;  2YY6 A;  3E2E A;  1U48 A;  4JV2 A;  4PZN A;  9ICS A;  2UVV A;  2V4Q A;  1RG6 A;  2DKZ A;  2KZ3 A;  4QIW C;  2JV3 A;  5ALI A;  1NKC A;  1ZQE A;  5KFQ A;  4NM2 A;  1K1S A;  2W54 A;  2ZIU A;  1COO A;  1YZ7 A;  4KTQ A;  3KHR A;  4PH5 A;  3RJH A;  2E1F A;  4GXK A;  1S76 D;  2LM1 A;  3RB0 A;  3Q8Q B;  4NLK A;  4M2Y A;  9ICX A;  1VLB A;  2LBO A;  2HHX A;  4ECW A;  7ICS A;  3HIL A;  2BCU A;  1O03 A;  4RQ8 A;  4J9M A;  3V7K A;  2H3V A;  3THV A;  4Y2P A;  4KLO A;  3NVY A;  3WKB A;  2OCE A;  5AI9 A;  4KLM A;  1B43 A;  3T79 A;  3PW2 A;  2VJ4 A;  9ICH A;  5IIK A;  4RQ7 A;  4RQ0 A;  4DOB A;  1L8L A;  4K4I A;  3ETR A;  2WB1 C;  5J2H A;  1OW5 A;  3C1Y A;  1QTM A;  4U7C A;  1P7D A;  5ALP A;  1XU4 A;  2G09 A;  2R18 A;  2LYB A;  4US8 A;  5D46 A;  1ZQI A;  9ICM A;  1S8O A;  3OGU A;  2MA1 A;  5J0P A;  3C5F A;  3C2L A;  3T3F A;  1JI7 A;  1MN8 A;  3FM9 A;  3UPQ A;  1TAM A;  5KFF A;  8ICG A;  3EWA A;  4R63 A;  1TE2 A;  2W9M A;  4YMM A;  2HBJ A;  4UAY A;  3QUT A;  2MUT A;  4RPY A;  4XQ8 A;  1NKB A;  5ALJ A;  4UAV A;  2XY6 A;  1NI3 A;  3H0M B;  5CR0 A;  3UQ2 A;  3BS7 A;  4FBU A;  2QKQ A;  1KKX A;  4QWB A;  1N2X A;  3HRD D;  4UAR A;  2ZIV B;  4PL1 A;  3RRG A;  5AI8 A;  1SGG A;  3H0R B;  4I2E A;  1IXR A;  5E79 U;  4MEY A;  2HSZ A;  3QXG A;  4HYK A;  1XSP A;  2NYV A;  1ARO P;  4B9L A;  4F4K A;  2P6U A;  5G5H A;  2ZUC A;  5DG9 A;  1YT3 A;  2Z7J A;  1TK8 A;  4I2I A;  1QQ5 A;  2A3V A;  2KHQ A;  3PX4 A;  1F0M A;  4Y2J A;  5CA7 A;  2ESE A;  4G3I A;  3M1Y A;  1ZQD A;  2I9G A;  4DCC A;  3PY8 A;  2BCQ A;  1KEJ A;  3DDH A;  4NLG A;  4C4T A;  4QZI A;  4RQ2 A;  4QWC A;  4UW9 A;  3PR4 A;  3SEN A;  2KFZ A;  5HHH A;  5KFL A;  4M9N A;  2CRX A;  2H5X A;  4DLG A;  7ICM A;  1J2M A;  2ZUB A;  4I2D A;  3Q8L A;  4F72 A;  1KFD A;  5KFU A;  8ICO A;  2Y9T A;  5ALF A;  5AKH A;  5F9L A;  3G6X A;  1CRX A;  5HNK A;  4X5V A;  3TAD C;  2ZIV A;  5AM1 A;  2PMZ C;  2A1A A;  2W7P A;  4DQI A;  3RB3 A;  4UAS A;  2WB1 F;  2BPF A;  4YCX A;  2K60 A;  4EX6 A;  4CNQ A;  4M9J A;  1TAQ A;  3MDA A;  4C80 A;  1SL1 A;  1SKS A;  3KKA C;  3TKA A;  5AK3 A;  2J6S A;  4R8U B;  2ASJ A;  2WAQ C;  3TAC B;  4MEX A;  7ICF A;  4YXJ A;  2IOF A;  2H3Z A;  4ECQ A;  1O08 A;  2G08 A;  4NV0 A;  4I2G A;  5ALR A;  4UQG A;  3RBD A;  1SB3 C;  2HVH A;  4ZH4 A;  3MGH A;  7ICN A;  5D49 A;  2BGW A;  4Y2U A;  4IQV A;  2FJ6 A;  1JIH A;  1ZQN A;  4XRH A;  5AK5 A;  4RZR A;  5DG8 A;  4I2C A;  2PI4 A;  5ALE A;  4RQ4 A;  2W8K A;  3RB4 A;  2J6U A;  5CEH A;  4OCZ A;  3LVW A;  4J9N A;  1FEZ A;  2Y0S C;  1BPE A;  3F2C A;  4QZE A;  5HMM A;  1JXL A;  3C5G A;  2I1Q A;  2JZB A;  4Z6D A;  3OSP A;  2ZIX A;  2DPI A;  1DK3 A;  3TAD A;  1N63 A;  1NJW A;  3KKA A;  2K8C B;  3CP8 A;  2RLT A;  1SKW A;  1VJ5 A;  4Y2Y A;  5AIC A;  2XY5 A;  3RB6 A;  2MUT B;  1XS9 D;  3MR5 A;  4ED6 A;  3IG5 A;  4PGX A;  3D2N A;  3I28 A;  3WK7 A;  3V7L A;  3RBE A;  3IDW A;  3IN5 A;  1WUD A;  2DKX A;  3RAQ A;  8ICP A;  2CPR A;  3QUB A;  3MR3 A;  1IV8 A;  3GIK A;  3FDS A;  2GOL A;  3ZI4 A;  4O3S A;  4FE3 A;  1C20 A;  4DF4 A;  4MFF A;  2D6F C;  3GU3 A;  5AI4 A;  2B6G A;  2JH1 A;  1ZQS A;  4O9M A;  3BS5 A;  3ETL A;  4EEK A;  3PW7 A;  4NLB A;  4QZB A;  3CRX A;  1HEK A;  2XI9 A;  4M6W B;  4NLZ A;  2W11 A;  2EZX A;  5ALZ A;  4F5R A;  4O5E A;  4ECU A;  1LKY B;  2JHD A;  3C21 A;  5J2G A;  3FYH A;  3GV7 B;  1ZQ1 C;  4KLS A;  4C4R A;  8ICI A;  5H2F U;  5KG0 A;  5BOL A;  3GIL A;  1LV5 A;  2OEH A;  4LZD A;  4TUP A;  2W04 A;  1IIP A;  4DSF A;  2N1R A;  8ICC A;  3H8W A;  4NY8 A;  4ED7 A;  2VIX A;  1GO3 F;  2XID A;  2ZJ5 A;  4KLH A;  4ELV A;  4ECX A;  2KP7 A;  4BGD A;  3UM9 A;  9ICN A;  2EDU A;  5KFS A;  1COK A;  4YMO A;  3UQ0 A;  4NL9 A;  2YMQ A;  5JTI A;  4RUC A;  5KFZ A;  9ICL A;  3ALR A;  2LKY A;  1PK1 B;  3NTU A;  1A0P A;  9ICQ A;  2ZIW B;  2DBY A;  4DSJ A;  5KFM A;  4M47 A;  1UHU A;  1KL9 A;  1ZXI A;  2KSO A;  3G6Y A;  3GIJ A;  1RDF A;  2W9C B;  3HKZ C;  1ZD5 A;  4O3R A;  3UMG A;  1A76 A;  3JPN A;  5F3X B;  1L7M A;  4KLJ A;  1SWW A;  3N97 B;  4EZ9 A;  8ICN A;  5DBC A;  5ALT A;  3BQ0 A;  3OJU A;  4Z6E A;  2E1E A;  4G9B A;  1NJX A;  3PZP A;  1UQV A;  4CE6 A;  1UT8 A;  3M8S A;  2AJQ A;  4NLN A;  4CF3 A;  3EW9 A;  3ZDE A;  1HUO A;  2PKE A;  4KLG A;  5KG4 A;  4IRK A;  1B4F A;  2HDO A;  3RJG A;  5IIL A;  4KLL A;  9ICU A;  4MF2 A;  2FMP A;  1L3U A;  4B6J A;  2LPE A;  1U49 A;  4GXI A;  4EBE A;  4MF8 A;  5ALV A;  1Z1B A;  1BPB A;  1PVP A;  1ZJN A;  5KT5 A;  4DL7 A;  5F9N A;  3M9M B;  3MGV A;  1HIW A;  9ICR A;  4U6P A;  5J29 A;  1D8L A;  1BGX T;  1S0V A;  4O3Q A;  1ZD2 P;  3TFR A;  2P66 A;  1X2I A;  4FS2 A;  2M0N A;  4Y2V A;  4F5Q A;  5DGB A;  5ALD A;  1ZQM A;  3QEA Z;  2W3S A;  3NAS A;  5KAI U;  4NJ8 A;  4PPX A;  1L3V A;  2I5H A;  2VA3 A;  1L7N A;  2KIW A;  9ICW A;  3RH4 A;  3H0L B;  4AYB F;  2BZF A;  4GC6 A;  4JUZ A;  3JPT A;  1S0M A;  4O3N A;  1V38 A;  4C8O A;  1XO1 A;  3F2D A;  3AMZ A;  2C2R A;  2F1I A;  2FLP A;  1NK7 A;  3V72 A;  4NM1 A;  4FO6 A;  4Q8F A;  4DFM A;  5J2J A;  2AXT U;  1B22 A;  2KZM A;  1RPL A;  2CXY A;  5AK6 A;  3FAH A;  3NVZ A;  4P2H A;  9ICT A;  2WTF A;  1KN5 A;  5AM3 A;  4M9G A;  8ICB A;  1ZQZ A;  5CRX A;  4Y2R A;  4DSK A;  4UB6 U;  2IBK A;  1S10 A;  4C8L A;  2DQN B;  4A8E A;  3PML A;  2ALZ A;  1Q8K A;  1T3Q A;  2DWQ A;  2W8L A;  3GQC A;  3ED5 A;  1LVH A;  3OTQ A;  5KFO A;  3KD3 A;  1KTQ A;  2JMG A;  2FMS A;  4UB2 A;  4R66 A;  2AGP A;  1KFS A;  1A6S A;  4CGZ A;  2P35 A;  5KT3 A;  2KV2 A;  4IC9 A;  3D2S A;  3ZD9 A;  3WK4 A;  4F5O A;  4ICA A;  4TQR A;  3GIM A;  3PW5 A;  4YD1 A;  5KFG A;  1PVQ A;  2O6K A;  1KRP A;  2KTQ A;  1V9P A;  2W43 A;  3Q8P B;  3HJE A;  4B9S A;  3O0F A;  4DL2 A;  2FLL A;  5KT4 A;  4I2F A;  5EOZ A;  4O5C A;  3A0H U;  3RH5 A;  4TUS A;  3WKD A;  4RQ1 A;  3CNH A;  4KMU A;  4KLE A;  2K4H A;  2Y0S F;  2YMP A;  3LWL A;  4DSE A;  7ICR A;  5KFV A;  2R8K A;  5DB6 A;  4I2H A;  2QB1 A;  3T5J A;  2E5S A;  2JH7 A;  1KQQ A;  8ICQ A;  5KFK A;  2IOF K;  7ICJ A;  5J0R A;  4RQ5 A;  1L3T A;  3PST A;  2JEI A;  1ZQO A;  4QWA A;  1JN3 A;  2YML A;  5KFE A;  4DQS A;  2KIV A;  2IA6 A;  1S0N A;  4GFJ A;  7ICU A;  3UMB A;  2ODG A;  4DFD A;  3Q8K A;  1T4G A;  3PSF A;  2EAN A;  4QIW F;  1ECW A;  2WF9 A;  3N4M B;  3RJJ A;  4KLF A;  3HT3 A;  4RQ6 A;  3LVV A;  2YX8 A;  9ICI A;  2QB0 B;  4BUG A;  1MC8 A;  3QU4 A;  5KG1 A;  4F91 B;  3H4D A;  1WWU A;  4IQW A;  5KG6 A;  1QQ7 A;  1KSP A;  4OJ5 A;  3MFI A;  5AKG A;  4ED0 A;  4E0D A;  4C7Y A;  4M9H A;  3SV3 A;  2EAO A;  1ZQW A;  3GDX A;  1FFV A;  2HHW A;  4XUS A;  3T5L A;  2YN4 A;  5KFW A;  5AKY A;  4UB4 A;  1RQL A;  4NXZ A;  1L8O A;  2OWO A;  4EYI B;  5AKX A;  2FI1 A;  3ISD A;  5AK4 A;  4Y2Q A;  3I76 A;  3NGD A;  2F44 A;  2AHO B;  2HI0 A;  2KJ9 A;  2FMQ A;  3HPO A;  4RT3 A;  1JRP A;  3QU2 A;  3KZI U;  4KN7 A;  1JAL A;  1JUD A;  2K8A A;  4DS5 A;  3OPX A;  1JXE A;  4J9Q A;  3HKZ F;  3GV8 B;  3ORY A;  3IG8 A;  8ICW A;  3NVV A;  5KTQ A;  5IIO A;  2PI5 A;  1S0O A;  1X66 A;  2ZJA A;  5ALO A;  3K75 D;  4QZF A;  4KIT B;  2FDR A;  4FZL A;  4KMO B;  2BPG A;  4PZO A;  5ALH A;  4RNO A;  3UXP A;  4EBC A;  4QZH A;  4NWI A;  5DDY A;  3SAH A;  1L5U A;  2YTU A;  2BQR A;  4Z6F A;  3PSI A;  4JWM A;  2KZZ A;  4ELU A;  1AQ6 A;  4OJP A;  4YP3 A;  4LVS A;  1RXW A;  3TFS A;  2NRX A;  7ICE A;  2XVT A;  3WKC A;  4OJL A;  4P4M A;  5DLG A;  2C22 A;  3ONN A;  3R9K A;  3T5H A;  1TK5 A;  5AKZ A;  1SKR A;  5J0O A;  2OH2 A;  3TQ1 A;  3V6J A;  5EWE A;  3MR2 A;  3OJS A;  9ICO A;  1WWV A;  1QSY A;  4TUQ A;  4RU9 A;  4F4Y A;  1CI4 A;  1CUK A;  4NL9 C;  1X9S A;  5HR6 A;  3NRZ A;  3DV9 A;  2E3T A;  5HML A;  4IL6 U;  4R64 A;  8ICF A;  3V6K A;  4BDP A;  3JPP A;  1TV9 A;  4RUA A;  1ZYQ A;  5AM4 A;  1M6Y A;  4P4O A;  1L3S A;  2BPC A;  3C1Z A;  3PX6 A;  4FS1 A;  1RXV A;  4CRX A;  4YN4 A;  4DSL A;  1SIJ A;  3NS1 A;  3RTV A;  1ZQK A;  8ICX A;  4Z6C A;  1S97 A;  1HUZ A;  2Y1I A;  3PR5 B;  5J0Q A;  3T5K A;  5ALG A;  4PHD A;  2VA8 A;  1D9F A;  1PUZ A;  2RDI A;  5DB8 A;  2WHE A;  2WF6 A;  1LB2 B;  1X9W A;  1BPZ A;  3QX7 A;  2BDP A;  3ICX A;  2R8J A;  1ZQU A;  1ZQX A;  3EYZ A;  1X9M A;  1SXE A;  2JEF A;  2FE9 A;  5DLF A;  1ZQL A;  4DQQ A;  3M6Z A;  2NRT A;  2MRL A;  5KFX A;  2OM6 A;  4F92 B;  2K8B B;  9ICP A;  3UXN A;  4JV0 A;  4GXJ A;  5KFI A;  2HMX A;  5AM5 A;  4RT2 A;  8ICA A;  3FC4 A;  3SYZ A;  2LHT A;  2NRZ A;  3AM9 A;  8ICE A;  5B66 U;  4YMN A;  2R8G A;  3PO5 A;  3H8M A;  4QZ8 A;  1J2N A;  3Q8R B;  3ZDD A;  4C0Z A;  2QAR B;  1H38 A;  2HBL A;  2J6T A;  2KSO B;  2DFL A;  1ZQY A;  4DOA A;  1Z00 A;  3K1Z A;  1MQ2 A;  3LDA A;  2MU2 A;  4PL2 A;  2YB1 A;  4MFC A;  2HHQ A;  2KE7 A;  4UB5 A;  9ICA A;  2LYA A;  1X6J A;  3RF9 A;  4YFK A;  5HR7 A;  3L4P A;  4OD0 A;  4GC7 A;  3ZDC A;  2G5H B;  2A1J A;  4IQT A;  5KG7 A;  4DFP A;  1ED1 A;  5DDM A;  2EZY A;  3H8J A;  5CJ7 A;  4B9U A;  2HBM A;  4KLQ A;  4Y2X A;  5L1I A;  1WG8 A;  5CWR A;  1Z4N A;  1N5X A;  3V7J A;  1L7P A;  3KBB A;  3KHG A;  2XGP A;  1XNS A;  2EH9 A;  2RRD A;  3GFK B;  5AKI A;  4DLE A;  1J97 A;  3F5A A;  4R65 A;  4ED3 A;  2IHN A;  1Z4O A;  4F2R A;  3H8S A;  2BDU A;  3B0Y A;  3B9J A;  2VAN A;  5L1L A;  5J2E A;  1BPX A;  4JMU A;  1CEZ A;  1Y88 A;  2DPJ A;  5EE1 A;  2K4I A;  2M9N A;  9ICF A;  1X9X A;  2E8O A;  4ACO A;  3TI0 A;  9ICG A;  3H40 A;  8ICV A;  4YG2 A;  4J9K A;  2BQU A;  1T7P A;  4DF8 A;  4M6W A;  7ICK A;  4JWN A;  4KLU A;  1MA7 A;  1SZH A;  2H3Q A;  4UBC A;  1KW4 A;  5EWF A;  4KX5 A;  4I27 A;  4DFK A;  4DSI A;  3N7S C;  3MAB A;  4F50 A;  1X42 A;  1X6I A;  3KZX A;  4UAZ A;  3TAN A;  2F8K A;  3QYP A;  5C0Y A;  2ZG6 A;  1XO0 A;  1V85 A;  5ALQ A;  1ZQP A;  1ZQA A;  1ZD3 A;  1DRG A;  3HX0 A;  3ISB A;  4P0P B;  4PHA A;  3WK5 A;  2KKP A;  4O3O A;  4FZM A;  5T14 A;  4ELT A;  3QZ8 A;  3ZD8 A;  3JPS A;  2ZTC A;  4QZG A;  1BVS A;  4ECZ A;  1MSW D;  1TKD A;  4BXO B;  9ICV A;  2GLE A;  1OUQ A;  4B9M A;  1HJP A;  2HW3 A;  4I28 A;  4EEY A;  1DXS A;  2HCF A;  3Q8M A;  1NK4 A;  2YQE A;  4QW8 A;  2VKQ A;  2IMW P;  4ECS A;  3AUO A;  4OJO A;  4EEN A;  5ALK A;  5KAF U;  5KFH A;  2ZJ8 A;  1JRO A;  1K1Q A;  3KFU F;  2AQ0 A;  1ZRM A;  2G07 A;  2KEY A;  2A19 A;  5J2K A;  2WF7 A;  5J0W A;  3M6K A;  3I1Y A;  3C29 A;  1ZQQ A;  2W7O A;  3J81 j;  3V6H A;  2BHN A;  4B9T A;  1D9D A;  1BNP A;  2KNJ A;  2LM4 A;  3RFA A;  4LJX A;  5KFC A;  3CW2 C;  4DS4 A;  5KT6 A;  4BJQ A;  1QSL A;  3BZK A;  2DL0 A;  1QH9 A;  5EWG A;  4IRC A;  1ZQC A;  5HP4 A;  2PFP A;  4DO9 A;  4DL6 A;  4M9L A;  2XO7 A;  5IIN A;  4FFD A;  1YZ6 A;  2W55 A;  2DF4 B;  4C8K A;  3BQT A;  4PHE A;  2LYH A;  4PGY A;  5J2B A;  3ISC A;  2WFA A;  2KOB A;  5J2A A;  2FLN A;  1U9L A;  2ZUD A;  3PNC A;  4F4X A;  1KBU A;  3WK6 A;  1QSS A;  1U45 A;  4UB3 A;  5DB7 A;  3SAG A;  3A0B U;  2EAP A;  3PX0 A;  2FPL A;  1ZJM A;  3RAX A;  2NO4 A;  5L9X A;  1UA1 A;  3QU5 A;  2E8M A;  3EPG A;  4ECV A;  3PVX A;  2OXO A;  3MFH A;  2GWS A;  3QEB Z;  3E0F A;  4UAT A;  2W9A A;  9ICE A;  1KFT A;  4YXM A;  4USA A;  2FPM A;  2Y9U A;  1XWL A;  5KFY A;  3D6J A;  4OO1 J;  3IM1 A;  1QLN A;  4QJF B;  5AIB A;  2QAR A;  5ALL A;  1TAU A;  1PK3 A;  2EAM A;  3PSP A;  2PFO A;  1SXD A;  1RYU A;  5DB9 A;  3BJY A;  2Q0Z X;  4F4Z A;  2K4E A;  4C8N A;  5CHG A;  5ALX A;  2KMD A;  1S77 D;  2H3I A;  3TAP A;  1RZT A;  5KFD A;  4Q43 A;  4JK1 A;  5KG3 A;  4GLX A;  4B9N A;  4CDG A;  3SMV A;  4I2J A;  3SI8 A;  2W3R A;  1N62 A;  2KKV A;  2VA2 A;  5L1K A;  7ICP A;  3C2M A;  4YQW A;  2ZIU B;  1V97 A;  3N7P D;  4C4S A;  2C2E A;  7ICO A;  1NK9 A;  5KL8 B;  3RRH A;  1SV4 A;  5J0Y A;  1FO4 A;  1B0X A;  5TIS U;  2V4R A;  2BCR A;  4UAU A;  5AI0 A;  5KFT A;  2F3N A;  2YMM A;  2P6R A;  3JPQ A;  1N48 A;  4PGQ A;  3HWT A;  1PVR A;  4F93 B;  1SL0 A;  4CF4 A;  3KHL A;  5AM2 A;  1BPY A;  2V9W A;  4IS7 A;  4FBT A;  8ICM A;  4RNM A;  3WK9 A;  4O3P A;  2AGQ A;  1UCV A;  2K89 A;  4FZN A;  3U26 A;  2RP5 A;  4ZOH C;  5EE3 A;  3F2B A;  1U4B A;  3BQ2 A;  4I2A A;  5KFP A;  2OHF A;  5AKL A;  1N5W A;  2QB0 A;  3WKA A;  3EUB 2;  1ZOL A;  3LWM A;  3GZF A;  4BX9 C;  2KN7 A;  4Q8E A;  5CP2 A;  4K4H A;  5KG5 A;  3RR8 A;  2RDJ A;  3IHQ B;  5J2I A;  4DFJ A;  3PV8 A;  2HOQ A;  4AP9 A;  3BQ1 A;  4O0I A;  5KL1 B;  2B21 A;  5JUM A;  4DOC A;  1QQ6 A;  4PJ0 U;  4J9P A;  1WYG A;  4J9S A;  4MFA A;  5KFB A;  3N28 A;  1N60 A;  1DK2 A;  1RYR A;  2F1J A;  3IV6 A;  5AIA A;  2XGQ A;  3KTQ A;  2LMR A;  1XSN A;  4JB3 A;  4KX3 A;  4PHP A;  2HVI A;  2JR5 A;  2GH1 A;  5IIJ A;  3M7D A;  5KT2 A;  2NO5 A;  2ZXI A;  5BOM A;  3JPO A;  4IR9 A;  3JPR A;  4WJ3 B;  3QUC A;  3ZDA A;  2D8C A;  4IR1 A;  3D2Q A;  2RQ5 A; 
#chains in the Genus database with same CATH homology
 1UHU A;  1MN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...