1X6JA

Crystal structure of ygfy from escherichia coli
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
88
structure length
88
Chain Sequence
MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGKPADAELEMMVRLIQTRNRERGPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ygfY
publication title Crystal structure of the YgfY from Escherichia coli, a protein that may be involved in transcriptional regulation
pubmed doi rcsb
source organism Escherichia coli
total genus 37
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 1x6jA00
1X6IA 2LM4A 1X6JA 1PUZA 2JR5A
chains in the Genus database with same CATH superfamily
4RPYA 4EX7A 4J9PA 1LVHA 4O0IA 1PVQA 1S77D 1N2XA 1T94A 1OXJA 4O3NA 4NLKA 4YMMA 1ZQ1C 2V4QA 1KFSA 3HJEA 5AKHA 1RQLA 5KG5A 1B0XA 3WK4A 1Q8KA 3M9OB 3C2LA 3C21A 3FC4A 3H8SA 5J0QA 3HKZF 3IP4B 4ECYA 5KFTA 4FZMA 1U4BA 3GU3A 1KTQA 1B43A 1ZQZA 1SKWA 3IG5A 4OJ6A 3RJFA 2C28A 2HBLA 3UXNA 2F1IA 5CWRA 5L1JA 3RJHA 1NK8A 2UVWA 4KLFA 1F5SA 1SV0A 3V72A 4I2GA 3CNHA 3V7LA 1X66A 4GLXA 2ATLA 8ICZA 4PL1A 3WK6A 5J0WA 1MC8A 2KOBA 4YR3A 3KZXA 4ECRA 2YY6A 4YN4A 1X2IA 1Z4NA 3RF9A 2IA6A 2G06A 1XSNA 4KX5A 3TADC 1JXEA 4BX9C 1A6SA 4ECVA 8ICNA 1T4GA 3SMVA 3MGIA 4EBCA 3KTQA 2NRVA 3IN5A 2XI9A 5D4BA 3D2QA 2ESEA 4B9TA 4KLOA 5DBAA 4YD1A 3T5LA 2IHNA 2CN1A 3AQFA 4QNLA 4JWNA 4Z6FA 2PFNA 2DPJA 3UQ0A 3PZPA 1MQ3A 4O3QA 1NNLA 4EEYA 1TE2A 2YMPA 1PK3A 3BQ2A 2RDJA 2EDUA 5J0SA 2ZJ8A 4R65A 2AXTU 1V97A 5L9XA 2FLNA 4E0DA 2MUTB 3PX6A 3SV4A 7ICEA 4DQSA 2XO7A 4R63A 2JEFA 5HMMA 2K89A 2E3TA 4NWIA 5AM1A 2KSOB 1CI4A 2I9GA 1PUZA 4DS5A 4PHDA 5L1LA 2BPFA 3RJKA 4EBDA 4CF4A 5J0RA 4DCCA 9ICJA 8ICTA 2W8LA 2KKVA 1RYSA 5K4LA 4LJXA 4ICAA 4GC7A 2KZZA 3SAFA 3UMCA 1QQ6A 5C0YA 3C5FA 2E1FA 3EPGA 2Y9UA 5BOMA 2O6KA 2HCFA 4KLGA 1S0OA 4DFJA 1IV8A 4NLBA 4BJQA 4BGDA 3TARA 4C80A 1TK8A 2DL0A 2G07A 5KAIU 3H4DA 2ZIUB 3IDWA 2KIVA 4J9RA 3PX4A 5AM5A 2DF4B 4FO6A 3UPQA 1QCKA 2ZIWB 2QB1A 5KG4A 1JIHA 4IS7A 2MSNA 2GOLA 1ZQHA 5AK5A 3RH5A 1N63A 2R18A 2MUTA 5KFPA 1MSWD 2IHMA 3T5KA 4G9BA 5DB9A 3KHGA 2NRXA 2KSOA 3BZKA 3N7RC 2W55A 3PW0A 2KNJA 4UB3A 4ED0A 1T3QA 3L5KA 5J2GA 3NS1A 4IRDA 2B6GA 4KLLA 3UM9A 3BQ1A 1L8OA 3GIMA 2I5HA 3N97B 2VJ5A 4IC9A 2K60A 4CCHA 1ZQWA 4QWBA 3WKEA 8ICFA 2FLPA 2GH1A 5DKWA 1L3VA 4PPXA 3DDHA 4P4OA 3M1YA 3JPQA 4NV0A 1JRPA 1SV0C 2ZIUA 4DOCA 4RPXA 5KT7A 3LK9A 4DSLA 4QZIA 2F3NA 1Q46A 4RUCA 2P6UA 8ICAA 1WUDA 2M0NA 5ALPA 2ZIWA 3PO5A 4MFAA 2D3DA 1N56A 5ALUA 4I2CA 3KZIU 1J2MA 5KT6A 3ISCA 1O08A 3QUTA 2KN7A 3JPTA 1X6JA 3PMLA 5HMLA 3HRDD 1QTMA 1DK2A 5IIJA 3OTQA 3ETRA 2JMGA 3EYZA 1X9XA 1OUQA 2FI1A 1L8LA 1Y88A 1D8BA 2BCQA 4XQ8A 4P4MA 1RDFA 3QUBA 4I2JA 1AQ6A 1BPBA 8ICKA 1KFTA 9ICKA 4HAIA 4U7CA 2KZMA 3I1YA 3QEBZ 4KN4A 2ZUCA 5DBBA 5L1KA 2EZYA 3SAHA 1BGXT 1SXDA 3H0LB 3QNMA 1JXLA 2YB1A 2KHQA 3V6KA 1BPXA 3SYZA 3UXPA 3FAHA 3WK7A 3C23A 9ICXA 4Y2XA 2PFQA 3KHRA 3QU2A 4RQ4A 4YR0A 1SWVA 1L7MA 5J2BA 2A3VA 1MN8A 3F53A 1T3NA 3NVVA 2ISOA 2Y9TA 2H3QA 1TFRA 4OO1J 3BJYA 1DK3A 4I2BA 2KVSA 2OH2A 1M6YA 4GFJA 4ED3A 4C4RA 1JI7A 4QWDA 4NL9A 2AJQA 1IXRA 5AKEA 3M9MB 4K4GA 4ECSA 2J6UA 4ED7A 9ICOA 3H4BA 5ALHA 3AU6A 2VA3A 4F8RA 2LM4A 4LZDA 3ONNA 4KLUA 2OCEA 4KLDA 8ICRA 3AU2A 1ZD2P 3L4PA 2ASJA 2BZFA 5ALFA 4I27A 1WWUA 1ZD3A 4PJ0U 5KL1B 2KTQA 4DQIA 2QB0A 4O3PA 2ZIVB 4F4YA 4ECWA 2D6FC 1RG6A 3T5HA 5HHIA 4UBCA 3RRGA 1L7NA 4DQRA 1KW4A 2G08A 2F2AB 3RH6A 4USAA 4I2DA 4ZH4A 1ZJMA 3GDXA 1RQNA 4YR2A 3PMNA 2K4HA 1D9FA 4UB1A 1L3TA 1K1SA 5ALJA 1T7PA 1T8EA 3KHHA 3RFAA 1BNOA 2C2EA 2FMSA 4UQGA 1KN5A 1X42A 2LHTA 4YMNA 5GTIU 9ICHA 3RB0A 5AI8A 1VDVA 3G6XA 5ALYA 4DLEA 9ICWA 8ICXA 2FJ6A 3QU5A 1NJYA 4BWJA 2G5IB 3C5GA 3C2KA 9ICEA 2HHSA 3RRHA 4RT3A 2WHEA 4F5PA 3ZDBA 5J0UA 4TQSA 2ZTCA 5AI0A 4Z6EA 4EYIB 2H3IA 2EQYA 3PW2A 1U49A 1S97A 2GWSA 2NRWA 2HOFA 4FZNA 3Q8QB 2WB1C 4UB4A 2EH9A 4RNNA 2BPCA 1FEZA 2WF5A 2LPEA 5KNIA 5J2IA 2AGPA 4DSKA 1S0VA 2OEHA 8ICSA 1CRXA 3KFUF 3WKAA 4MFCA 3K4GA 4QZEA 9ICSA 3QZ7A 5HNKA 1N5WA 2JGAA 3M7DA 4Q45A 3RH4A 1ZOLA 5KG1A 3SEIA 3GIJA 1CUKA 4I2AA 4QWCA 3GILA 2N1RA 8ICGA 4M04A 3GV5B 2KP7A 3GV7B 2UVVA 1D8LA 3ED5A 4OD0A 2HHTA 1RYRA 4M9GA 1KLNA 2ZIXB 5KFXA 2XY6A 2HOQA 1X9WA 4TUSA 4IR1A 3BQTA 4RQMA 2OHFA 2K4EA 3RJJA 3PR4A 3PX0A 4ED6A 2QLTA 4R64A 4FS2A 2YMQA 3NASA 4XRHA 2FMPA 2G09A 3C1ZA 2E8NA 4U6PA 4Y2RA 2KHVA 4GIBA 3L3FX 1N60A 4IRCA 1BNPA 4J9SA 4UATA 4F4ZA 3QX7A 2W9BB 1A77A 5AM0A 3MABA 4R66A 3QZ8A 3V7KA 1COKA 2EZXA 2W9MA 2I6XA 3SI8A 4Y2UA 9ICAA 3MBYA 1K1QA 7ICGA 4Y2QA 5ALGA 4B9MA 3THVA 2H5XA 2L5YA 3MR2A 5HR6A 4UB6U 4QW9A 5F9NA 5IIKA 2ZIXA 4UAYA 1F0MA 3TANA 1Q3VA 2BCRA 4O3OA 5JTIA 5KFCA 5J29A 1SKRA 1XSPA 4J9MA 4ELUA 2IOFK 4JV0A 4DFDA 1L7OA 3MR3A 3H8JA 4J9KA 1SGGA 2HOIA 1XC9A 2DGZA 5DQHA 4O5CA 3B0YA 3BZCA 5D46A 2W03A 3UMBA 3GIKA 4F4WA 8ICEA 2W9BA 4KMUA 4DSJA 5J0XA 1SB3C 5DGBA 1L3SA 3SQIA 2CXYA 3IRUA 5CP2A 3FDSA 7ICJA 4FZLA 9ICBA 2HMXA 2KEYA 4DL7A 3SR6A 2HBMA 1GO3F 1N62A 2ASLA 4KLSA 4Y2PA 4P0QB 4MFFA 7ICQA 3Q8MA 4O5EA 5AK4A 3PW5A 1X6IA 3C28A 2PKEA 7ICRA 4ECZA 1K5OA 1JN3A 3G6YA 1ZQIA 5ALEA 3Q8RB 8ICJA 5AICA 4RU9A 4RNMA 4RT2A 3HP6A 2LBOA 1BPYA 2ISPA 5AKJA 2JH1A 5DDYA 4DOBA 5DB7A 4DQQA 1JROA 2J6SA 3ZD8A 5KFQA 4CGZA 5J0OA 4QZDA 2AQ0A 2OXOA 3LWMA 4RQ5A 5KG2A 5D49A 3CRXA 4C7YA 3BS7A 4Q8EA 2KIWA 7ICUA 8ICBA 3JPSA 5TISU 2DFLA 9ICPA 5AKIA 4F3OA 9ICFA 1Z4OA 3ICXA 4DFPA 3VCBA 3PSIA 4IQVA 1L6NA 1NKEA 4M6WA 4DQPA 3DEEA 1QSSA 4EZ9A 4UAUA 2WB1F 1PZNA 2HW3A 1ZQVA 5J2CA 4P0QA 4DL2A 3TAPA 5J2FA 1KL9A 1BVSA 2K4IA 4FFDA 1S9FA 3PO4A 3RJIA 4C8OA 3PSTA 3BDPA 2F8LA 4CF3A 1RZTA 5ALDA 1NK4A 3AUOA 1NKBA 9ICGA 1ZJNA 1ZQXA 2HSZA 1SXEA 4UBBA 2XICA 1XSLA 5CJ7A 1V85A 1XWLA 2XC9A 3KD3A 3SZ2A 5J8YA 1ZQYA 9ICTA 9ICCA 4CE6A 5AHXA 3N4MB 3QXGA 4UB5A 7ICNA 5DQIA 9ICLA 4JWMA 4Q43A 2XIDA 3AL0B 3VC8A 5B5EU 1NJZA 4CRXA 4QZGA 4ECQA 2W54A 5EE3A 4C0ZA 5AI4A 3F2BA 5KFNA 2KJ5A 1Z3EB 7ICOA 1PVPA 3RBEA 1MA7A 3A0HU 1KDHA 1S0MA 1Z1VA 2XGPA 5DLFA 3PW7A 4XUSA 4MEXA 2FMQA 4F5NA 2UVUA 2ASDA 5EWGA 3IG8A 4NLCA 1VJ5A 4F93B 1WCLA 3R9KA 5ALQA 4Q44A 3TFSA 4RQ6A 3V6JA 2LYBA 1UHUA 4P4PA 1RYUA 4RZRA 1KKXA 2VA2A 1HEKA 5JU5A 5J0TA 2BKEA 3NVWA 1XS9D 4NLZA 2NO4A 4F5QA 2LYHA 2V9WA 2MA1A 5AM2A 2FE9A 5AKGA 4IR9A 9ICQA 5KFEA 1NZBA 1IIPA 2PFPA 1D9DA 3D2NA 4ZOHC 4O9MA 2DBYA 4KLJA 8ICIA 3GV8B 1NK5A 4RNOA 2CPRA 2F1JA 2ZXHA 5ALOA 5CA7A 1KEJA 3DV9A 3EWAA 2VANA 2W7OA 5DLGA 5KL8B 2W9AA 1X40A 1A0PA 2BQUA 5ALVA 4M9LA 3ISBA 1LV5A 4DL6A 1WWVA 4F4XA 1DGSA 2JRZA 5JRTA 2K4PA 2A1AA 2LI6A 1FFUA 5GTHU 2DKXA 2H3FA 4TURA 1RPLA 5J2KA 4PGQA 5KFKA 4Y2SA 3RTVA 2C2DA 3K1RB 2XVTA 2QB0B 2KMDA 4M47A 2P35A 4GXKA 5KT2A 2XCPA 4UW9A 3AEVA 5AM3A 5L1IA 1BPDA 4PL2A 4F71A 2HVHA 2AQ4A 2NV3A 3OGUA 2GLEA 1URJA 5DG8A 3SAGA 1ZQGA 2QARA 1KQQA 2OWOA 2P66A 5IIMA 2KE7A 3KBBA 4RQ7A 1B22A 3BQ7A 4BDPA 5H2FU 3PY8A 1QH9A 2BCSA 3OHBA 3NVZA 2ZJ5A 4EYHB 3LYSA 2H3ZA 5AKKA 1ZQDA 3M8SA 5DDMA 8ICPA 3UXOA 2GO7A 4C8MA 4YVZA 3HKZC 3M9NB 3LDAA 2V4RA 1SWWA 2DPIA 3G6VA 5KFJA 4A8EA 4RQ8A 3AQEA 4NY8A 1UA0A 2C22A 7ICVA 2KJ9A 4DSIA 5ALTA 2HBKA 2XY7A 5KFAA 3ETLA 1PK1B 5EE1A 4UARA 5IIIA 5J8YC 2WF7A 5IIOA 2YQEA 2LM1A 1PVRA 2JH7A 4R8UB 2R8HA 4F92B 2B0CA 2JEIA 5KFZA 3RB6A 4US9A 4GXIA 4DSEA 3FM9A 2HHUA 2Z7JA 1EXNA 5AI6A 1S76D 4IL6U 4OJ5A 3OHAA 1D8YA 2IBKA 1U9LA 3PW4A 4ELVA 1ZQLA 3M6ZA 3TQ1A 2NYVA 2IMWP 3TACB 4I2HA 4C4TA 5CR0A 4EENA 4UB2A 3KKAA 3K1ZA 4ECXA 1N61A 1ZRMA 1BPZA 1KFDA 5DB6A 8ICLA 4YMOA 5J2EA 2LMRA 4JMUA 2OM6A 8ICHA 5KFOA 5BPCA 5DQGA 2ZTEA 2BQRA 3LVWA 3QUCA 4OJLA 4LZGA 4TQRA 1NOMA 5AKLA 5DBCA 2DQNB 4P0PB 1PK1A 2FLLA 5KFDA 1TK5A 2WF8A 2G5HB 4UASA 3TADA 2AGOA 4R8UA 1ED1A 5DGAA 5KG6A 5J2JA 2KFZA 2JR5A 1ZQKA 4RQ2A 2WAQC 4J9LA 1TV9A 4QWEA 4F2SA 1DOQA 1WG8A 3MC1A 4Y2VA 5CRXA 3IV6A 2PI5A 1KRPA 3ZD9A 4BUGA 5IINA 2AGQA 8ICUA 2K8BB 5ALMA 4FBUA 5B66U 5JUMA 4QIWC 3RB3A 4QZAA 5ALXA 1QSYA 3JPOA 1L3UA 1ZQSA 7ICFA 2P6RA 4F4KA 2ES6A 2Q0ZX 1SZPA 3SENA 4B6JA 3F5EA 4OJOA 3H0RB 2FPLA 3RBDA 2WFAA 4P0PA 3C29A 2A1JA 4RPZA 3H7IA 3B0XA 4YD2A 5A0LA 3Q8SB 2W9CB 4EELA 4I2IA 2DKZA 1ZQPA 4KTQA 2MAXA 5J2DA 2PMZC 4LVSA 2PXIA 4C8KA 2FPKA 3PNCA 9ICRA 5KG7A 1RXWA 1ECWA 2Q4TA 2ALZA 9ICNA 2B21A 3ALRA 3MFIA 1ZQOA 5KAFU 1QQ7A 1ZQEA 4NL9C 3H40A 2BHNA 3V7JA 5J0YA 4C8NA 1JUDA 4IQWA 4PGXA 2YX8A 3NTUA 3O0FA 2W8KA 3ZDAA 1BPEA 5ALNA 2E8OA 4IRKA 3B9JA 5ALKA 4B9UA 4F2RA 3QU9A 1YZ6A 1Z00B 4EX6A 1V38A 2H3VA 3WK5A 1U45A 2XCAA 4KITB 2EAMA 4HYKA 2W9CA 5ALLA 2BGWA 2R8IA 4DL5A 1QLNA 5ALWA 3HW8A 4DL3A 2HHXA 3QUQA 4NM2A 2KFNA 3H0MB 3PSFA 1ZD4A 2W3SA 3TFRA 4B9LA 4EEKA 5AIAA 4O3RA 2VJ4A 8ICVA 1QSLA 8ICOA 4GC6A 1ZQRA 5BOLA 5AK6A 4FE3A 3WU2U 3ORYA 1KSPA 1F44A 3EZ5A 4F72A 3NUQA 3MGVA 3KKAC 1ZXIA 4QZFA 4M6WB 8ICWA 4GXJA 1XO0A 7ICHA 4ED8A 2HHQA 3AM9A 2Y0SC 2LYAA 3D6JA 1Z00A 5G5HA 4QJFB 4NLNA 2YB4A 3QU4A 3OPXA 3MR5A 2G0AA 3C2MA 5KG0A 7ICKA 3N28A 5KT3A 2ZG6A 4C8LA 3PR5B 3TAQA 1ZQAA 4UAWA 3H8WA 1J97A 5C5JA 5AK3A 1P7DA 4JV1A 7ICTA 2RP5A 5EE9A 2A19A 2JZBB 1ZQJA 4PZNA 1S8OA 3GIIA 1C7YA 2C2RA 3RAXA 1SL2A 5KFLA 3WK9A 1NZPA 2E8MA 2F77X 3Q8PB 1N48A 2LKYA 2EANA 1Z1BA 3HWTA 1C20A 5DB8A 4YXMA 2ZXIA 2ZTDA 4DS4A 5KFRA 1O03A 2ZUBA 4C7ZA 5FP0A 5HP4A 3RAQA 5KFVA 1XU4A 3QYPA 1KBUA 4ELTA 2E1EA 4RQNA 4KLTA 1TK0A 1H38A 2Y1IA 2ODGA 1Z19A 1XNSA 2CRXA 2JEJA 1ZD5A 4BXOB 5CEHA 4P2HA 1CEZA 2WAQF 2BQ3A 3IM1A 3GFKB 4MEYA 4DOAA 1FO4A 4KLHA 4RUAA 2MU2A 2YMMA 2E8PA 5KFGA 4I2FA 2BCUA 4ED1A 4DEZA 3I76A 5F3XB 3SD7A 2XGQA 5KFWA 4CF5A 3H8MA 3TKAA 4PZOA 4QIWF 1ZETA 8ICMA 2JZBA 2FPMA 3ZDCA 2W04A 3HILA 4ED2A 2JEGA 1HJPA 3LWLA 3ZDEA 1ZQTA 5ALSA 1HIWA 1UA1A 2RLTA 2VIXA 3RJEA 7ICPA 2R8JA 4F5RA 3LVVA 2D8CA 4Y2TA 3U26A 5KFBA 2NRTA 2RRDA 5KFYA 2JXJA 2ZJAA 5KT5A 4TUQA 4JK1A 2HI0A 3PSPA 4OJPA 4DSFA 3AN1A 2VKQA 4QZCA 1WCNA 3UMGA 2WTFA 4BXOA 1TAMA 3EW9A 1SV4A 4YP3A 3MDCA 4AP9A 4ECTA 3ISDA 2UVRA 2PMZF 3QU7A 8ICCA 3UQ2A 2EAPA 2OYYA 4XA5A 3JPRA 1SKSA 4WJ3B 5EWFA 4AYBC 3EUB2 5G5GA 3JPPA 8ICQA 3OSNA 4EZ6A 3PVXA 9ICIA 3WKDA 4PH5A 2ZUDA 5IILA 4DFMA 1SZHA 3RR8A 1NKCA 1UT8A 1ZRNA 5HHHA 4M2YA 3D2SA 4F91B 3HT3A 2I1QA 1NK0A 3HX0A 4DWIA 4I29A 4DF8A 3M6KA 2R8GA 3NVYA 2XY5A 4PHPA 5AI9A 4X5VA 2KKPA 4ECUA 1OW5A 4YQWA 3F2CA 1S10A 2QARB 3SV3A 9ICVA 4EBEA 2BDPA 2K8CB 4RQ0A 1NK9A 4TUPA 3F2DA 3CP8A 3ZDDA 1UT5A 1X9MA 2WF6A 5F9LA 1COOA 4JB3A 1V9PA 2JV3A 2R8KA 4QZBA 1NJWA 4KLMA 1UPHA 2RQ5A 3V6HA 1QQ5A 1SL1A 1ZQNA 1DRGA 2KV2A 3Q8LA 3MDAA 1FFVA 3N7PD 4DO9A 4KX3A 4F5OA 3FYHA 1NI3A 2Y0SF 5KFSA 5TZVA 2Y1JA 2JHDA 2BDUA 4RQ3A 2E5SA 3T79A 4BWMA 2HVIA 2KK0A 5CB1A 3GZFA 3NRZA 1X9SA 4M9JA 1U47A 4KLIA 1DGJA 2F76X 4J03A 2YMLA 1JX4A 5ALIA 1LKYB 2KJ8A 2KZ3A 4MF2A 2F44A 3Q8KA 1A76A 4I2EA 5KFHA 4DFKA 4M9NA 2AHOB 4PGYA 5KFFA 1MQ2A 3PV8A 4QW8A 4JUZA 2KG5A 4KLEA 5KG3A 1NK7A 1TAUA 1VLBA 3BS5B 3T3FA 5ALZA 4DLGA 2BPGA 3RR7A 9ICMA 4B9VA 4O5KA 2MRLA 4J9QA 3OJSA 4M9HA 4F50A 1HUOA 3A0BU 1J2NA 4UB8U 4KN7A 3M8RA 4JV2A 9ICUA 2PFOA 4C4SA 1JALA 3T5JA 1ZQUA 4Q8FA 4J9NA 3N7SC 5L1MA 3QE9Y 1SL0A 1Q3UA 4DL4A 3OJUA 3WKCA 4NJ8A 4Z6DA 4UAVA 4QZ9A 5AI5A 2IOHA 1FIQA 4YCXA 1LKYA 5T14A 4UAZA 1YZ7A 2QKQA 2DUYA 1S5LU 3NGDA 4FBTA 2YTUA 3TI0A 2HDOA 1L7PA 4PHAA 1LB2B 4MHVA 3RB4A 4O3SA 1UCVA 5AKZA 2F8KA 3BS5A 4O3MA 3JPNA 3NRWA 5KFIA 3I28A 1SIJA 4DF4A 3C1YA 2BR0A 2WF9A 2FDRA 5AM4A 2W7PA 3E2EA 2DWQA 2AH5A 2W3RA 1ZQCA 4YG2A 5DG7A 3J81j 5EE0A 2IOFA 3BQ0A 2A1JB 2KICA 1B4FA 1L5UA 5KFUA 3ZI4A 4IQTA 7ICMA 4YXJA 4FS1A 1N5XA 7ICIA 4QWAA 3WK8A 1ZQMA 5HR7A 2J6TA 4AYBF 1ZYQA 1NK6A 3IHQB 1AROP 4ACOA 3KOOA 3S6JA 4CNQA 2ZIVA 1U48A 1NJXA 3MFHA 1IG6A 1S0NA 1ZQBA 4I28A 2AU0A 4QZHA 1WYGA 4NLGA 3OSPA 4K4HA 4B9NA 4KMOB 3F5AA 3HPOA 4G3IA 5KTQA 2HHVA 2EZZA 4YFKA 4OCZA 3KHLA 4M0AA 2PI4A 4B9SA 5ALRA 4MF8A 1ZQFA 2KVCA 5CHGA 1RXVA 3E58A 4US8A 2RDIA 3K75D 4K4IA 2RHFA 3MR6A 1UQVA 1XO1A 1TKDA 2EAOA 5DG9A 3QEAZ 3RJGA 2NRZA 1YT3A 3CW2C 4Y2JA 4QZ8A 1TAQA 5J0PA 2BCVA 8ICYA 3EPIA 1DXSA 3AMZA 4CDGA 4IQUA 4NXZA 5J2HA 3E0FA 5EOZA 4Y2YA 1HUZA 1JMSA 1IM4A 3CYMA 5KT4A 7ICSA 4NM1A 1RM6C 2KD1A 5AKYA 3GQCA 2K8AA 5AIBA 2HHWA 5E79U 2W43A 4PHEA 2VA8A 5AKXA 4RQ1A 2F1HA 2M9NA 1TVAA 7ICLA 4KLQA 2NO5A 3MGHA 1ZQQA 2YN4A 5KFMA 4Z6CA 2W11A 4J9OA 5EWEA 3WKBA 5J2AA 2HBJA
chains in the Genus database with same CATH topology
1X6IA 2LM4A 1X6JA 1PUZA 2JR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6I A;  2LM4 A;  1X6J A;  1PUZ A;  2JR5 A; 
#chains in the Genus database with same CATH topology
 4RPY A;  4EX7 A;  4J9P A;  1LVH A;  4O0I A;  1PVQ A;  1S77 D;  1N2X A;  1T94 A;  1OXJ A;  4O3N A;  4NLK A;  4YMM A;  1ZQ1 C;  2V4Q A;  1KFS A;  3HJE A;  5AKH A;  1RQL A;  5KG5 A;  1B0X A;  3WK4 A;  1Q8K A;  3M9O B;  3C2L A;  3C21 A;  3FC4 A;  3H8S A;  5J0Q A;  3HKZ F;  3IP4 B;  4ECY A;  5KFT A;  4FZM A;  1U4B A;  3GU3 A;  1KTQ A;  1B43 A;  1ZQZ A;  1SKW A;  3IG5 A;  4OJ6 A;  3RJF A;  2C28 A;  2HBL A;  3UXN A;  2F1I A;  5CWR A;  5L1J A;  3RJH A;  1NK8 A;  2UVW A;  4KLF A;  1F5S A;  1SV0 A;  3V72 A;  4I2G A;  3CNH A;  3V7L A;  1X66 A;  4GLX A;  2ATL A;  8ICZ A;  4PL1 A;  3WK6 A;  5J0W A;  1MC8 A;  2KOB A;  4YR3 A;  3KZX A;  4ECR A;  2YY6 A;  4YN4 A;  1X2I A;  1Z4N A;  3RF9 A;  2IA6 A;  2G06 A;  1XSN A;  4KX5 A;  3TAD C;  1JXE A;  4BX9 C;  1A6S A;  4ECV A;  8ICN A;  1T4G A;  3SMV A;  3MGI A;  4EBC A;  3KTQ A;  2NRV A;  3IN5 A;  2XI9 A;  5D4B A;  3D2Q A;  2ESE A;  4B9T A;  4KLO A;  5DBA A;  4YD1 A;  3T5L A;  2IHN A;  2CN1 A;  3AQF A;  4QNL A;  4JWN A;  4Z6F A;  2PFN A;  2DPJ A;  3UQ0 A;  3PZP A;  1MQ3 A;  4O3Q A;  1NNL A;  4EEY A;  1TE2 A;  2YMP A;  1PK3 A;  3BQ2 A;  2RDJ A;  2EDU A;  5J0S A;  2ZJ8 A;  4R65 A;  2AXT U;  1V97 A;  5L9X A;  2FLN A;  4E0D A;  2MUT B;  3PX6 A;  3SV4 A;  7ICE A;  4DQS A;  2XO7 A;  4R63 A;  2JEF A;  5HMM A;  2K89 A;  2E3T A;  4NWI A;  5AM1 A;  2KSO B;  1CI4 A;  2I9G A;  1PUZ A;  4DS5 A;  4PHD A;  5L1L A;  2BPF A;  3RJK A;  4EBD A;  4CF4 A;  5J0R A;  4DCC A;  9ICJ A;  8ICT A;  2W8L A;  2KKV A;  1RYS A;  5K4L A;  4LJX A;  4ICA A;  4GC7 A;  2KZZ A;  3SAF A;  3UMC A;  1QQ6 A;  5C0Y A;  3C5F A;  2E1F A;  3EPG A;  2Y9U A;  5BOM A;  2O6K A;  2HCF A;  4KLG A;  1S0O A;  4DFJ A;  1IV8 A;  4NLB A;  4BJQ A;  4BGD A;  3TAR A;  4C80 A;  1TK8 A;  2DL0 A;  2G07 A;  5KAI U;  3H4D A;  2ZIU B;  3IDW A;  2KIV A;  4J9R A;  3PX4 A;  5AM5 A;  2DF4 B;  4FO6 A;  3UPQ A;  1QCK A;  2ZIW B;  2QB1 A;  5KG4 A;  1JIH A;  4IS7 A;  2MSN A;  2GOL A;  1ZQH A;  5AK5 A;  3RH5 A;  1N63 A;  2R18 A;  2MUT A;  5KFP A;  1MSW D;  2IHM A;  3T5K A;  4G9B A;  5DB9 A;  3KHG A;  2NRX A;  2KSO A;  3BZK A;  3N7R C;  2W55 A;  3PW0 A;  2KNJ A;  4UB3 A;  4ED0 A;  1T3Q A;  3L5K A;  5J2G A;  3NS1 A;  4IRD A;  2B6G A;  4KLL A;  3UM9 A;  3BQ1 A;  1L8O A;  3GIM A;  2I5H A;  3N97 B;  2VJ5 A;  4IC9 A;  2K60 A;  4CCH A;  1ZQW A;  4QWB A;  3WKE A;  8ICF A;  2FLP A;  2GH1 A;  5DKW A;  1L3V A;  4PPX A;  3DDH A;  4P4O A;  3M1Y A;  3JPQ A;  4NV0 A;  1JRP A;  1SV0 C;  2ZIU A;  4DOC A;  4RPX A;  5KT7 A;  3LK9 A;  4DSL A;  4QZI A;  2F3N A;  1Q46 A;  4RUC A;  2P6U A;  8ICA A;  1WUD A;  2M0N A;  5ALP A;  2ZIW A;  3PO5 A;  4MFA A;  2D3D A;  1N56 A;  5ALU A;  4I2C A;  3KZI U;  1J2M A;  5KT6 A;  3ISC A;  1O08 A;  3QUT A;  2KN7 A;  3JPT A;  1X6J A;  3PML A;  5HML A;  3HRD D;  1QTM A;  1DK2 A;  5IIJ A;  3OTQ A;  3ETR A;  2JMG A;  3EYZ A;  1X9X A;  1OUQ A;  2FI1 A;  1L8L A;  1Y88 A;  1D8B A;  2BCQ A;  4XQ8 A;  4P4M A;  1RDF A;  3QUB A;  4I2J A;  1AQ6 A;  1BPB A;  8ICK A;  1KFT A;  9ICK A;  4HAI A;  4U7C A;  2KZM A;  3I1Y A;  3QEB Z;  4KN4 A;  2ZUC A;  5DBB A;  5L1K A;  2EZY A;  3SAH A;  1BGX T;  1SXD A;  3H0L B;  3QNM A;  1JXL A;  2YB1 A;  2KHQ A;  3V6K A;  1BPX A;  3SYZ A;  3UXP A;  3FAH A;  3WK7 A;  3C23 A;  9ICX A;  4Y2X A;  2PFQ A;  3KHR A;  3QU2 A;  4RQ4 A;  4YR0 A;  1SWV A;  1L7M A;  5J2B A;  2A3V A;  1MN8 A;  3F53 A;  1T3N A;  3NVV A;  2ISO A;  2Y9T A;  2H3Q A;  1TFR A;  4OO1 J;  3BJY A;  1DK3 A;  4I2B A;  2KVS A;  2OH2 A;  1M6Y A;  4GFJ A;  4ED3 A;  4C4R A;  1JI7 A;  4QWD A;  4NL9 A;  2AJQ A;  1IXR A;  5AKE A;  3M9M B;  4K4G A;  4ECS A;  2J6U A;  4ED7 A;  9ICO A;  3H4B A;  5ALH A;  3AU6 A;  2VA3 A;  4F8R A;  2LM4 A;  4LZD A;  3ONN A;  4KLU A;  2OCE A;  4KLD A;  8ICR A;  3AU2 A;  1ZD2 P;  3L4P A;  2ASJ A;  2BZF A;  5ALF A;  4I27 A;  1WWU A;  1ZD3 A;  4PJ0 U;  5KL1 B;  2KTQ A;  4DQI A;  2QB0 A;  4O3P A;  2ZIV B;  4F4Y A;  4ECW A;  2D6F C;  1RG6 A;  3T5H A;  5HHI A;  4UBC A;  3RRG A;  1L7N A;  4DQR A;  1KW4 A;  2G08 A;  2F2A B;  3RH6 A;  4USA A;  4I2D A;  4ZH4 A;  1ZJM A;  3GDX A;  1RQN A;  4YR2 A;  3PMN A;  2K4H A;  1D9F A;  4UB1 A;  1L3T A;  1K1S A;  5ALJ A;  1T7P A;  1T8E A;  3KHH A;  3RFA A;  1BNO A;  2C2E A;  2FMS A;  4UQG A;  1KN5 A;  1X42 A;  2LHT A;  4YMN A;  5GTI U;  9ICH A;  3RB0 A;  5AI8 A;  1VDV A;  3G6X A;  5ALY A;  4DLE A;  9ICW A;  8ICX A;  2FJ6 A;  3QU5 A;  1NJY A;  4BWJ A;  2G5I B;  3C5G A;  3C2K A;  9ICE A;  2HHS A;  3RRH A;  4RT3 A;  2WHE A;  4F5P A;  3ZDB A;  5J0U A;  4TQS A;  2ZTC A;  5AI0 A;  4Z6E A;  4EYI B;  2H3I A;  2EQY A;  3PW2 A;  1U49 A;  1S97 A;  2GWS A;  2NRW A;  2HOF A;  4FZN A;  3Q8Q B;  2WB1 C;  4UB4 A;  2EH9 A;  4RNN A;  2BPC A;  1FEZ A;  2WF5 A;  2LPE A;  5KNI A;  5J2I A;  2AGP A;  4DSK A;  1S0V A;  2OEH A;  8ICS A;  1CRX A;  3KFU F;  3WKA A;  4MFC A;  3K4G A;  4QZE A;  9ICS A;  3QZ7 A;  5HNK A;  1N5W A;  2JGA A;  3M7D A;  4Q45 A;  3RH4 A;  1ZOL A;  5KG1 A;  3SEI A;  3GIJ A;  1CUK A;  4I2A A;  4QWC A;  3GIL A;  2N1R A;  8ICG A;  4M04 A;  3GV5 B;  2KP7 A;  3GV7 B;  2UVV A;  1D8L A;  3ED5 A;  4OD0 A;  2HHT A;  1RYR A;  4M9G A;  1KLN A;  2ZIX B;  5KFX A;  2XY6 A;  2HOQ A;  1X9W A;  4TUS A;  4IR1 A;  3BQT A;  4RQM A;  2OHF A;  2K4E A;  3RJJ A;  3PR4 A;  3PX0 A;  4ED6 A;  2QLT A;  4R64 A;  4FS2 A;  2YMQ A;  3NAS A;  4XRH A;  2FMP A;  2G09 A;  3C1Z A;  2E8N A;  4U6P A;  4Y2R A;  2KHV A;  4GIB A;  3L3F X;  1N60 A;  4IRC A;  1BNP A;  4J9S A;  4UAT A;  4F4Z A;  3QX7 A;  2W9B B;  1A77 A;  5AM0 A;  3MAB A;  4R66 A;  3QZ8 A;  3V7K A;  1COK A;  2EZX A;  2W9M A;  2I6X A;  3SI8 A;  4Y2U A;  9ICA A;  3MBY A;  1K1Q A;  7ICG A;  4Y2Q A;  5ALG A;  4B9M A;  3THV A;  2H5X A;  2L5Y A;  3MR2 A;  5HR6 A;  4UB6 U;  4QW9 A;  5F9N A;  5IIK A;  2ZIX A;  4UAY A;  1F0M A;  3TAN A;  1Q3V A;  2BCR A;  4O3O A;  5JTI A;  5KFC A;  5J29 A;  1SKR A;  1XSP A;  4J9M A;  4ELU A;  2IOF K;  4JV0 A;  4DFD A;  1L7O A;  3MR3 A;  3H8J A;  4J9K A;  1SGG A;  2HOI A;  1XC9 A;  2DGZ A;  5DQH A;  4O5C A;  3B0Y A;  3BZC A;  5D46 A;  2W03 A;  3UMB A;  3GIK A;  4F4W A;  8ICE A;  2W9B A;  4KMU A;  4DSJ A;  5J0X A;  1SB3 C;  5DGB A;  1L3S A;  3SQI A;  2CXY A;  3IRU A;  5CP2 A;  3FDS A;  7ICJ A;  4FZL A;  9ICB A;  2HMX A;  2KEY A;  4DL7 A;  3SR6 A;  2HBM A;  1GO3 F;  1N62 A;  2ASL A;  4KLS A;  4Y2P A;  4P0Q B;  4MFF A;  7ICQ A;  3Q8M A;  4O5E A;  5AK4 A;  3PW5 A;  1X6I A;  3C28 A;  2PKE A;  7ICR A;  4ECZ A;  1K5O A;  1JN3 A;  3G6Y A;  1ZQI A;  5ALE A;  3Q8R B;  8ICJ A;  5AIC A;  4RU9 A;  4RNM A;  4RT2 A;  3HP6 A;  2LBO A;  1BPY A;  2ISP A;  5AKJ A;  2JH1 A;  5DDY A;  4DOB A;  5DB7 A;  4DQQ A;  1JRO A;  2J6S A;  3ZD8 A;  5KFQ A;  4CGZ A;  5J0O A;  4QZD A;  2AQ0 A;  2OXO A;  3LWM A;  4RQ5 A;  5KG2 A;  5D49 A;  3CRX A;  4C7Y A;  3BS7 A;  4Q8E A;  2KIW A;  7ICU A;  8ICB A;  3JPS A;  5TIS U;  2DFL A;  9ICP A;  5AKI A;  4F3O A;  9ICF A;  1Z4O A;  3ICX A;  4DFP A;  3VCB A;  3PSI A;  4IQV A;  1L6N A;  1NKE A;  4M6W A;  4DQP A;  3DEE A;  1QSS A;  4EZ9 A;  4UAU A;  2WB1 F;  1PZN A;  2HW3 A;  1ZQV A;  5J2C A;  4P0Q A;  4DL2 A;  3TAP A;  5J2F A;  1KL9 A;  1BVS A;  2K4I A;  4FFD A;  1S9F A;  3PO4 A;  3RJI A;  4C8O A;  3PST A;  3BDP A;  2F8L A;  4CF3 A;  1RZT A;  5ALD A;  1NK4 A;  3AUO A;  1NKB A;  9ICG A;  1ZJN A;  1ZQX A;  2HSZ A;  1SXE A;  4UBB A;  2XIC A;  1XSL A;  5CJ7 A;  1V85 A;  1XWL A;  2XC9 A;  3KD3 A;  3SZ2 A;  5J8Y A;  1ZQY A;  9ICT A;  9ICC A;  4CE6 A;  5AHX A;  3N4M B;  3QXG A;  4UB5 A;  7ICN A;  5DQI A;  9ICL A;  4JWM A;  4Q43 A;  2XID A;  3AL0 B;  3VC8 A;  5B5E U;  1NJZ A;  4CRX A;  4QZG A;  4ECQ A;  2W54 A;  5EE3 A;  4C0Z A;  5AI4 A;  3F2B A;  5KFN A;  2KJ5 A;  1Z3E B;  7ICO A;  1PVP A;  3RBE A;  1MA7 A;  3A0H U;  1KDH A;  1S0M A;  1Z1V A;  2XGP A;  5DLF A;  3PW7 A;  4XUS A;  4MEX A;  2FMQ A;  4F5N A;  2UVU A;  2ASD A;  5EWG A;  3IG8 A;  4NLC A;  1VJ5 A;  4F93 B;  1WCL A;  3R9K A;  5ALQ A;  4Q44 A;  3TFS A;  4RQ6 A;  3V6J A;  2LYB A;  1UHU A;  4P4P A;  1RYU A;  4RZR A;  1KKX A;  2VA2 A;  1HEK A;  5JU5 A;  5J0T A;  2BKE A;  3NVW A;  1XS9 D;  4NLZ A;  2NO4 A;  4F5Q A;  2LYH A;  2V9W A;  2MA1 A;  5AM2 A;  2FE9 A;  5AKG A;  4IR9 A;  9ICQ A;  5KFE A;  1NZB A;  1IIP A;  2PFP A;  1D9D A;  3D2N A;  4ZOH C;  4O9M A;  2DBY A;  4KLJ A;  8ICI A;  3GV8 B;  1NK5 A;  4RNO A;  2CPR A;  2F1J A;  2ZXH A;  5ALO A;  5CA7 A;  1KEJ A;  3DV9 A;  3EWA A;  2VAN A;  2W7O A;  5DLG A;  5KL8 B;  2W9A A;  1X40 A;  1A0P A;  2BQU A;  5ALV A;  4M9L A;  3ISB A;  1LV5 A;  4DL6 A;  1WWV A;  4F4X A;  1DGS A;  2JRZ A;  5JRT A;  2K4P A;  2A1A A;  2LI6 A;  1FFU A;  5GTH U;  2DKX A;  2H3F A;  4TUR A;  1RPL A;  5J2K A;  4PGQ A;  5KFK A;  4Y2S A;  3RTV A;  2C2D A;  3K1R B;  2XVT A;  2QB0 B;  2KMD A;  4M47 A;  2P35 A;  4GXK A;  5KT2 A;  2XCP A;  4UW9 A;  3AEV A;  5AM3 A;  5L1I A;  1BPD A;  4PL2 A;  4F71 A;  2HVH A;  2AQ4 A;  2NV3 A;  3OGU A;  2GLE A;  1URJ A;  5DG8 A;  3SAG A;  1ZQG A;  2QAR A;  1KQQ A;  2OWO A;  2P66 A;  5IIM A;  2KE7 A;  3KBB A;  4RQ7 A;  1B22 A;  3BQ7 A;  4BDP A;  5H2F U;  3PY8 A;  1QH9 A;  2BCS A;  3OHB A;  3NVZ A;  2ZJ5 A;  4EYH B;  3LYS A;  2H3Z A;  5AKK A;  1ZQD A;  3M8S A;  5DDM A;  8ICP A;  3UXO A;  2GO7 A;  4C8M A;  4YVZ A;  3HKZ C;  3M9N B;  3LDA A;  2V4R A;  1SWW A;  2DPI A;  3G6V A;  5KFJ A;  4A8E A;  4RQ8 A;  3AQE A;  4NY8 A;  1UA0 A;  2C22 A;  7ICV A;  2KJ9 A;  4DSI A;  5ALT A;  2HBK A;  2XY7 A;  5KFA A;  3ETL A;  1PK1 B;  5EE1 A;  4UAR A;  5III A;  5J8Y C;  2WF7 A;  5IIO A;  2YQE A;  2LM1 A;  1PVR A;  2JH7 A;  4R8U B;  2R8H A;  4F92 B;  2B0C A;  2JEI A;  5KFZ A;  3RB6 A;  4US9 A;  4GXI A;  4DSE A;  3FM9 A;  2HHU A;  2Z7J A;  1EXN A;  5AI6 A;  1S76 D;  4IL6 U;  4OJ5 A;  3OHA A;  1D8Y A;  2IBK A;  1U9L A;  3PW4 A;  4ELV A;  1ZQL A;  3M6Z A;  3TQ1 A;  2NYV A;  2IMW P;  3TAC B;  4I2H A;  4C4T A;  5CR0 A;  4EEN A;  4UB2 A;  3KKA A;  3K1Z A;  4ECX A;  1N61 A;  1ZRM A;  1BPZ A;  1KFD A;  5DB6 A;  8ICL A;  4YMO A;  5J2E A;  2LMR A;  4JMU A;  2OM6 A;  8ICH A;  5KFO A;  5BPC A;  5DQG A;  2ZTE A;  2BQR A;  3LVW A;  3QUC A;  4OJL A;  4LZG A;  4TQR A;  1NOM A;  5AKL A;  5DBC A;  2DQN B;  4P0P B;  1PK1 A;  2FLL A;  5KFD A;  1TK5 A;  2WF8 A;  2G5H B;  4UAS A;  3TAD A;  2AGO A;  4R8U A;  1ED1 A;  5DGA A;  5KG6 A;  5J2J A;  2KFZ A;  2JR5 A;  1ZQK A;  4RQ2 A;  2WAQ C;  4J9L A;  1TV9 A;  4QWE A;  4F2S A;  1DOQ A;  1WG8 A;  3MC1 A;  4Y2V A;  5CRX A;  3IV6 A;  2PI5 A;  1KRP A;  3ZD9 A;  4BUG A;  5IIN A;  2AGQ A;  8ICU A;  2K8B B;  5ALM A;  4FBU A;  5B66 U;  5JUM A;  4QIW C;  3RB3 A;  4QZA A;  5ALX A;  1QSY A;  3JPO A;  1L3U A;  1ZQS A;  7ICF A;  2P6R A;  4F4K A;  2ES6 A;  2Q0Z X;  1SZP A;  3SEN A;  4B6J A;  3F5E A;  4OJO A;  3H0R B;  2FPL A;  3RBD A;  2WFA A;  4P0P A;  3C29 A;  2A1J A;  4RPZ A;  3H7I A;  3B0X A;  4YD2 A;  5A0L A;  3Q8S B;  2W9C B;  4EEL A;  4I2I A;  2DKZ A;  1ZQP A;  4KTQ A;  2MAX A;  5J2D A;  2PMZ C;  4LVS A;  2PXI A;  4C8K A;  2FPK A;  3PNC A;  9ICR A;  5KG7 A;  1RXW A;  1ECW A;  2Q4T A;  2ALZ A;  9ICN A;  2B21 A;  3ALR A;  3MFI A;  1ZQO A;  5KAF U;  1QQ7 A;  1ZQE A;  4NL9 C;  3H40 A;  2BHN A;  3V7J A;  5J0Y A;  4C8N A;  1JUD A;  4IQW A;  4PGX A;  2YX8 A;  3NTU A;  3O0F A;  2W8K A;  3ZDA A;  1BPE A;  5ALN A;  2E8O A;  4IRK A;  3B9J A;  5ALK A;  4B9U A;  4F2R A;  3QU9 A;  1YZ6 A;  1Z00 B;  4EX6 A;  1V38 A;  2H3V A;  3WK5 A;  1U45 A;  2XCA A;  4KIT B;  2EAM A;  4HYK A;  2W9C A;  5ALL A;  2BGW A;  2R8I A;  4DL5 A;  1QLN A;  5ALW A;  3HW8 A;  4DL3 A;  2HHX A;  3QUQ A;  4NM2 A;  2KFN A;  3H0M B;  3PSF A;  1ZD4 A;  2W3S A;  3TFR A;  4B9L A;  4EEK A;  5AIA A;  4O3R A;  2VJ4 A;  8ICV A;  1QSL A;  8ICO A;  4GC6 A;  1ZQR A;  5BOL A;  5AK6 A;  4FE3 A;  3WU2 U;  3ORY A;  1KSP A;  1F44 A;  3EZ5 A;  4F72 A;  3NUQ A;  3MGV A;  3KKA C;  1ZXI A;  4QZF A;  4M6W B;  8ICW A;  4GXJ A;  1XO0 A;  7ICH A;  4ED8 A;  2HHQ A;  3AM9 A;  2Y0S C;  2LYA A;  3D6J A;  1Z00 A;  5G5H A;  4QJF B;  4NLN A;  2YB4 A;  3QU4 A;  3OPX A;  3MR5 A;  2G0A A;  3C2M A;  5KG0 A;  7ICK A;  3N28 A;  5KT3 A;  2ZG6 A;  4C8L A;  3PR5 B;  3TAQ A;  1ZQA A;  4UAW A;  3H8W A;  1J97 A;  5C5J A;  5AK3 A;  1P7D A;  4JV1 A;  7ICT A;  2RP5 A;  5EE9 A;  2A19 A;  2JZB B;  1ZQJ A;  4PZN A;  1S8O A;  3GII A;  1C7Y A;  2C2R A;  3RAX A;  1SL2 A;  5KFL A;  3WK9 A;  1NZP A;  2E8M A;  2F77 X;  3Q8P B;  1N48 A;  2LKY A;  2EAN A;  1Z1B A;  3HWT A;  1C20 A;  5DB8 A;  4YXM A;  2ZXI A;  2ZTD A;  4DS4 A;  5KFR A;  1O03 A;  2ZUB A;  4C7Z A;  5FP0 A;  5HP4 A;  3RAQ A;  5KFV A;  1XU4 A;  3QYP A;  1KBU A;  4ELT A;  2E1E A;  4RQN A;  4KLT A;  1TK0 A;  1H38 A;  2Y1I A;  2ODG A;  1Z19 A;  1XNS A;  2CRX A;  2JEJ A;  1ZD5 A;  4BXO B;  5CEH A;  4P2H A;  1CEZ A;  2WAQ F;  2BQ3 A;  3IM1 A;  3GFK B;  4MEY A;  4DOA A;  1FO4 A;  4KLH A;  4RUA A;  2MU2 A;  2YMM A;  2E8P A;  5KFG A;  4I2F A;  2BCU A;  4ED1 A;  4DEZ A;  3I76 A;  5F3X B;  3SD7 A;  2XGQ A;  5KFW A;  4CF5 A;  3H8M A;  3TKA A;  4PZO A;  4QIW F;  1ZET A;  8ICM A;  2JZB A;  2FPM A;  3ZDC A;  2W04 A;  3HIL A;  4ED2 A;  2JEG A;  1HJP A;  3LWL A;  3ZDE A;  1ZQT A;  5ALS A;  1HIW A;  1UA1 A;  2RLT A;  2VIX A;  3RJE A;  7ICP A;  2R8J A;  4F5R A;  3LVV A;  2D8C A;  4Y2T A;  3U26 A;  5KFB A;  2NRT A;  2RRD A;  5KFY A;  2JXJ A;  2ZJA A;  5KT5 A;  4TUQ A;  4JK1 A;  2HI0 A;  3PSP A;  4OJP A;  4DSF A;  3AN1 A;  2VKQ A;  4QZC A;  1WCN A;  3UMG A;  2WTF A;  4BXO A;  1TAM A;  3EW9 A;  1SV4 A;  4YP3 A;  3MDC A;  4AP9 A;  4ECT A;  3ISD A;  2UVR A;  2PMZ F;  3QU7 A;  8ICC A;  3UQ2 A;  2EAP A;  2OYY A;  4XA5 A;  3JPR A;  1SKS A;  4WJ3 B;  5EWF A;  4AYB C;  3EUB 2;  5G5G A;  3JPP A;  8ICQ A;  3OSN A;  4EZ6 A;  3PVX A;  9ICI A;  3WKD A;  4PH5 A;  2ZUD A;  5IIL A;  4DFM A;  1SZH A;  3RR8 A;  1NKC A;  1UT8 A;  1ZRN A;  5HHH A;  4M2Y A;  3D2S A;  4F91 B;  3HT3 A;  2I1Q A;  1NK0 A;  3HX0 A;  4DWI A;  4I29 A;  4DF8 A;  3M6K A;  2R8G A;  3NVY A;  2XY5 A;  4PHP A;  5AI9 A;  4X5V A;  2KKP A;  4ECU A;  1OW5 A;  4YQW A;  3F2C A;  1S10 A;  2QAR B;  3SV3 A;  9ICV A;  4EBE A;  2BDP A;  2K8C B;  4RQ0 A;  1NK9 A;  4TUP A;  3F2D A;  3CP8 A;  3ZDD A;  1UT5 A;  1X9M A;  2WF6 A;  5F9L A;  1COO A;  4JB3 A;  1V9P A;  2JV3 A;  2R8K A;  4QZB A;  1NJW A;  4KLM A;  1UPH A;  2RQ5 A;  3V6H A;  1QQ5 A;  1SL1 A;  1ZQN A;  1DRG A;  2KV2 A;  3Q8L A;  3MDA A;  1FFV A;  3N7P D;  4DO9 A;  4KX3 A;  4F5O A;  3FYH A;  1NI3 A;  2Y0S F;  5KFS A;  5TZV A;  2Y1J A;  2JHD A;  2BDU A;  4RQ3 A;  2E5S A;  3T79 A;  4BWM A;  2HVI A;  2KK0 A;  5CB1 A;  3GZF A;  3NRZ A;  1X9S A;  4M9J A;  1U47 A;  4KLI A;  1DGJ A;  2F76 X;  4J03 A;  2YML A;  1JX4 A;  5ALI A;  1LKY B;  2KJ8 A;  2KZ3 A;  4MF2 A;  2F44 A;  3Q8K A;  1A76 A;  4I2E A;  5KFH A;  4DFK A;  4M9N A;  2AHO B;  4PGY A;  5KFF A;  1MQ2 A;  3PV8 A;  4QW8 A;  4JUZ A;  2KG5 A;  4KLE A;  5KG3 A;  1NK7 A;  1TAU A;  1VLB A;  3BS5 B;  3T3F A;  5ALZ A;  4DLG A;  2BPG A;  3RR7 A;  9ICM A;  4B9V A;  4O5K A;  2MRL A;  4J9Q A;  3OJS A;  4M9H A;  4F50 A;  1HUO A;  3A0B U;  1J2N A;  4UB8 U;  4KN7 A;  3M8R A;  4JV2 A;  9ICU A;  2PFO A;  4C4S A;  1JAL A;  3T5J A;  1ZQU A;  4Q8F A;  4J9N A;  3N7S C;  5L1M A;  3QE9 Y;  1SL0 A;  1Q3U A;  4DL4 A;  3OJU A;  3WKC A;  4NJ8 A;  4Z6D A;  4UAV A;  4QZ9 A;  5AI5 A;  2IOH A;  1FIQ A;  4YCX A;  1LKY A;  5T14 A;  4UAZ A;  1YZ7 A;  2QKQ A;  2DUY A;  1S5L U;  3NGD A;  4FBT A;  2YTU A;  3TI0 A;  2HDO A;  1L7P A;  4PHA A;  1LB2 B;  4MHV A;  3RB4 A;  4O3S A;  1UCV A;  5AKZ A;  2F8K A;  3BS5 A;  4O3M A;  3JPN A;  3NRW A;  5KFI A;  3I28 A;  1SIJ A;  4DF4 A;  3C1Y A;  2BR0 A;  2WF9 A;  2FDR A;  5AM4 A;  2W7P A;  3E2E A;  2DWQ A;  2AH5 A;  2W3R A;  1ZQC A;  4YG2 A;  5DG7 A;  3J81 j;  5EE0 A;  2IOF A;  3BQ0 A;  2A1J B;  2KIC A;  1B4F A;  1L5U A;  5KFU A;  3ZI4 A;  4IQT A;  7ICM A;  4YXJ A;  4FS1 A;  1N5X A;  7ICI A;  4QWA A;  3WK8 A;  1ZQM A;  5HR7 A;  2J6T A;  4AYB F;  1ZYQ A;  1NK6 A;  3IHQ B;  1ARO P;  4ACO A;  3KOO A;  3S6J A;  4CNQ A;  2ZIV A;  1U48 A;  1NJX A;  3MFH A;  1IG6 A;  1S0N A;  1ZQB A;  4I28 A;  2AU0 A;  4QZH A;  1WYG A;  4NLG A;  3OSP A;  4K4H A;  4B9N A;  4KMO B;  3F5A A;  3HPO A;  4G3I A;  5KTQ A;  2HHV A;  2EZZ A;  4YFK A;  4OCZ A;  3KHL A;  4M0A A;  2PI4 A;  4B9S A;  5ALR A;  4MF8 A;  1ZQF A;  2KVC A;  5CHG A;  1RXV A;  3E58 A;  4US8 A;  2RDI A;  3K75 D;  4K4I A;  2RHF A;  3MR6 A;  1UQV A;  1XO1 A;  1TKD A;  2EAO A;  5DG9 A;  3QEA Z;  3RJG A;  2NRZ A;  1YT3 A;  3CW2 C;  4Y2J A;  4QZ8 A;  1TAQ A;  5J0P A;  2BCV A;  8ICY A;  3EPI A;  1DXS A;  3AMZ A;  4CDG A;  4IQU A;  4NXZ A;  5J2H A;  3E0F A;  5EOZ A;  4Y2Y A;  1HUZ A;  1JMS A;  1IM4 A;  3CYM A;  5KT4 A;  7ICS A;  4NM1 A;  1RM6 C;  2KD1 A;  5AKY A;  3GQC A;  2K8A A;  5AIB A;  2HHW A;  5E79 U;  2W43 A;  4PHE A;  2VA8 A;  5AKX A;  4RQ1 A;  2F1H A;  2M9N A;  1TVA A;  7ICL A;  4KLQ A;  2NO5 A;  3MGH A;  1ZQQ A;  2YN4 A;  5KFM A;  4Z6C A;  2W11 A;  4J9O A;  5EWE A;  3WKB A;  5J2A A;  2HBJ A; 
#chains in the Genus database with same CATH homology
 1X6I A;  2LM4 A;  1X6J A;  1PUZ A;  2JR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...