1X6JA

Crystal structure of ygfy from escherichia coli
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
88
structure length
88
Chain Sequence
MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGKPADAELEMMVRLIQTRNRERGPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YgfY from Escherichia coli, a protein that may be involved in transcriptional regulation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ygfY
total genus 37
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 1x6jA00
1PUZA 1X6JA 2LM4A 1X6IA 2JR5A
chains in the Genus database with same CATH superfamily
2KSOA 2NRZA 5ALDA 3EPIA 2R8IA 5DG7A 1CI4A 5KG2A 2XY5A 1S5LU 4F2RA 5DDYA 5BOLA 8ICEA 4Z6FA 1SB3C 3QUQA 5AM0A 2DPJA 5ALHA 1NZBA 5CA7A 3PSFA 2G5IB 1DGSA 1RXWA 2VA2A 1ZETA 2HBLA 3FM9A 4PPXA 3BQ1A 2WF8A 4ECRA 4O5KA 4RQ1A 4I2DA 1OW5A 5EOZA 1ZQCA 2HHUA 3H4DA 1NK4A 2PFNA 3F2DA 3KHRA 4R63A 1XO0A 9ICGA 3UMBA 4ED8A 4ED2A 1ZQJA 4J9LA 4YVZA 3HKZC 2UVVA 1KKXA 4O3NA 2JRZA 5AKGA 2MRLA 1NK5A 4KITB 3SAFA 3RAQA 8ICZA 4PHEA 3TADC 1ZQIA 4LVSA 5C5JA 3ICXA 3HP6A 8ICYA 4GC6A 3T5LA 2DKZA 1BPDA 1XS9D 1S76D 3FAHA 3D2NA 3TKAA 3RJHA 1WYGA 1SL1A 4DFJA 3Q8KA 1BPBA 4Y2XA 1N5WA 1ZQQA 1MN8A 2DUYA 2C2EA 4R8UA 4DO9A 2F1HA 1WWVA 5L1IA 4PL1A 3GILA 5DG8A 4U7CA 3SYZA 3UQ2A 2A19A 8ICXA 4DSJA 4Z6DA 1VLBA 3SV3A 3PO5A 1JIHA 1T3NA 4C8LA 2BQUA 1U48A 2A1JA 3V7JA 3HILA 1L7PA 4RQ5A 1ZQHA 4E0DA 3L3FX 2B6GA 3PZPA 1NK6A 3IRUA 1HIWA 3GV7B 3PW2A 5AI4A 2QLTA 2GH1A 2AU0A 5CRXA 2HVIA 4ELVA 4DS4A 2WF5A 1WG8A 1ZQGA 1NKBA 3V7LA 2XGQA 4ECYA 4ECSA 5DLGA 3PR5B 5G5GA 2GLEA 4FFDA 3THVA 3MGVA 1JX4A 2IA6A 4Y2TA 4Q8EA 2W54A 3H40A 1WWUA 2NRXA 3JPOA 1S9FA 2W43A 2NYVA 4NL9A 3Q8PB 3TAPA 2OHFA 3M6ZA 7ICOA 5B5EU 2E3TA 2YX8A 1TE2A 4DL2A 4DQRA 3EZ5A 2FI1A 4PL2A 1PK1B 1COOA 2W55A 4G9BA 5GTHU 2PI5A 4ZOHC 3PR4A 4PH5A 1H38A 3E58A 4DQPA 1ZD4A 5F9NA 1Z4OA 4ED0A 2ZIUB 5KFBA 1WCLA 4F5NA 7ICNA 2WFAA 2ZUDA 1N56A 3HKZF 3SR6A 2XI9A 1TAMA 9ICFA 4OD0A 4RPZA 3ORYA 5KT3A 3I76A 1ZQFA 3QU9A 5KT2A 3G6XA 4IL6U 3MR5A 3QUTA 4ACOA 4ECUA 8ICQA 5L1KA 1TK8A 2KD1A 1ZQLA 5AKLA 2KOBA 1L7NA 3CP8A 4KLUA 1ZQXA 5KFEA 3KZIU 1CEZA 1S8OA 4ELTA 2PKEA 2QB0B 1T4GA 2V4RA 2K89A 2W9CA 3GQCA 3V6HA 4C8NA 3DDHA 3TANA 2XO7A 5ALXA 3ED5A 4FE3A 3N4MB 4IC9A 3UMGA 5EE9A 1NJZA 3D2SA 2HHXA 3PSPA 2W3RA 4I28A 4YR2A 5AHXA 3WKAA 1X9SA 3RH6A 4IRDA 4O3PA 2KIVA 1V97A 2Y9TA 4AP9A 4F5OA 1ZQMA 2Q4TA 4RQNA 3KKAA 5EE0A 4F50A 1SKSA 5DKWA 9ICMA 4MF2A 4YN4A 2Y0SF 1KFDA 3KBBA 2K4HA 1S77D 1B0XA 4BUGA 4IR9A 4JWMA 5DQGA 4F4ZA 2KK0A 3SENA 2F8KA 4IQVA 2R8HA 2KN7A 4UW9A 1U9LA 2EQYA 1TK0A 4DLEA 2ASJA 3OSNA 5AICA 4QZEA 4OJ6A 3KKAC 3PO4A 3C5GA 4O3SA 1LKYB 1N63A 1ZQBA 4P0PB 2WF9A 1F44A 2ISPA 4DEZA 1ZQZA 1Z1BA 2KSOB 4NLBA 4NLNA 2F3NA 5DBCA 3T79A 1FIQA 3RBEA 1U49A 1BPZA 5KG5A 1NI3A 5KG6A 1UCVA 1X2IA 2FLPA 3ZDBA 3BZCA 5DGBA 5ALLA 1SZPA 4I2GA 1ZJNA 3UM9A 3ALRA 3T5KA 1JMSA 3D6JA 2F44A 5KFQA 1SIJA 1N48A 1U47A 4F5QA 1JUDA 5AKZA 5J0WA 4FZMA 1UT5A 3B9JA 5AIAA 5AI9A 4J9OA 4KX3A 2AH5A 2H3QA 2AGPA 3G6VA 3MFHA 1ZYQA 5AM4A 2D6FC 4XA5A 5HP4A 1X9MA 5AK6A 5AKYA 5DGAA 1MQ3A 5AKKA 1PVRA 2GO7A 4BGDA 4M9LA 1L6NA 5DB6A 4F4KA 2Y0SC 3HWTA 2R8KA 5DLFA 2VANA 8ICLA 1N60A 2LYAA 2RHFA 4QZCA 4ELUA 3M9MB 1ZQRA 3MR3A 2PI4A 3TADA 4ICAA 5IIKA 1ECWA 5KL8B 3RFAA 3KOOA 3V6KA 3Q8QB 5KFYA 4B9VA 4TUPA 5J0TA 4R8UB 1AROP 1BVSA 2IOFK 5ALIA 1Y88A 4J9QA 4FO6A 1SV4A 2VKQA 3WKBA 3JPNA 4F2SA 4UB4A 3LDAA 3ETRA 8ICVA 2ESEA 7ICUA 2F8LA 4YD2A 9ICIA 4Z6EA 4YP3A 3PX4A 4Q8FA 3Q8RB 3K4GA 3RB0A 3ETLA 3LVVA 3IG5A 3PX6A 4C8KA 4F4WA 4EBCA 1DK2A 3H8MA 2AJQA 1N62A 1PVQA 4USAA 3AQFA 1A77A 1T94A 1NKEA 1ZRMA 4I27A 3EW9A 5J0UA 2AQ0A 3RJKA 4QZBA 2YTUA 3WKDA 3C1ZA 5KT4A 4EENA 4UAUA 5J2HA 3RJFA 4U6PA 2AXTU 3MABA 4C80A 8ICMA 3SD7A 1JALA 3N97B 2HOIA 2CN1A 2Z7JA 2YB4A 5KFDA 2BCSA 2P6RA 3C1YA 4NL9C 5AI8A 4FBTA 3QXGA 4IQUA 4RPYA 3TFSA 2EAMA 3AQEA 3UXNA 2GOLA 3M1YA 2HSZA 5KAIU 2ZIUA 2J6TA 3QUCA 5CWRA 3BS7A 4BWMA 4KLDA 2WTFA 5HHHA 4ECTA 4DF4A 2YMPA 4UAYA 4IQTA 2W9MA 7ICJA 1B4FA 3N7PD 3T5HA 2Y1JA 5CEHA 3NUQA 2FPKA 1QH9A 3JPRA 1X66A 3CW2C 4YR3A 4FS1A 1U4BA 1HEKA 4QZFA 2CXYA 4AYBC 2G06A 4DFPA 2W7PA 3PVXA 2I5HA 1SKRA 1MC8A 3AM9A 4C7YA 7ICHA 8ICFA 1AQ6A 4DWIA 1QQ6A 2G5HB 2F77X 2FE9A 2B0CA 5DQHA 2BHNA 2I1QA 2N1RA 3GIMA 3TFRA 1TK5A 1L3VA 1KSPA 1JRPA 3EUB2 8ICUA 4KLHA 1L8OA 2NRTA 3RTVA 4QIWF 3MDAA 5AM1A 2KNJA 2YMLA 9ICEA 5ALUA 4PGYA 1ZQTA 5AKIA 3TI0A 2KMDA 3NRZA 2FMSA 3ZD9A 1LV5A 5J2GA 2ASLA 1VJ5A 4ED1A 2K8AA 2WAQC 1UA1A 3PW0A 4YMOA 8ICHA 4QWCA 4Y2PA 1QSYA 5AI0A 3F2CA 5D46A 1NJYA 1ZXIA 3MDCA 4RQ3A 1SWVA 4KLMA 3HPOA 1RYSA 4MFAA 4DSIA 1KFTA 1KN5A 4PGQA 1XO1A 4CF3A 2F2AB 2LI6A 2EDUA 5C0YA 7ICPA 3LYSA 5ALJA 2HDOA 4DF8A 4KLTA 1BGXT 1SV0A 2BCQA 4OO1J 5ALQA 2KKVA 1MSWD 1S0VA 1TAQA 2DL0A 4DSKA 4P0PA 4HAIA 4OJPA 9ICNA 1QLNA 1A0PA 5DG9A 2UVUA 1BNOA 2KV2A 1KQQA 4UB3A 5DBBA 3UXOA 3H8SA 3BZKA 5J2JA 4ZH4A 3L4PA 4C8OA 2JZBB 1NJXA 9ICPA 3CNHA 2PMZF 4GXIA 3KTQA 1JXLA 4Q43A 2AQ4A 2JMGA 1IM4A 3RF9A 3WK6A 4C4SA 4DCCA 4DL4A 2NV3A 4JK1A 3EPGA 1KEJA 2XC9A 4OJOA 1Z4NA 8ICKA 4KTQA 3UQ0A 4Y2UA 3GU3A 4F93B 1L3TA 3BQ7A 3MGHA 9ICLA 5F3XB 4O3QA 2H3IA 4PGXA 5ALKA 1X6IA 5KFMA 2KICA 1ZQPA 4EYIB 8ICIA 1Z1VA 4UB5A 5AKEA 5ALSA 4P2HA 3N28A 2EANA 4F71A 2HVHA 2HHWA 1X9XA 2FJ6A 5AKXA 2KZ3A 4RNNA 3V7KA 4YFKA 4QWEA 4CE6A 5HR6A 4P0QA 4UARA 1C7YA 2BDPA 1ZQDA 1UA0A 5JU5A 9ICCA 3OPXA 2D8CA 3M9NB 4Q45A 1RXVA 1S0MA 3S6JA 2HHQA 4BJQA 1MA7A 4F3OA 4UAVA 1RM6C 5KFTA 2KHQA 5L1MA 4GC7A 3MR6A 2K60A 4KLJA 1Z19A 3TARA 5EE3A 3F2BA 1U45A 5JTIA 2H3ZA 1NZPA 3ZDEA 5J8YC 3SAHA 1VDVA 2PMZC 4EEKA 5J2EA 2OYYA 2KP7A 1Z00B 1S97A 5J0QA 4YXJA 2C2RA 2EZXA 3RB6A 9ICUA 2ZUCA 3UXPA 3KFUF 2ZG6A 1EXNA 1OUQA 5KAFU 4O5CA 2E8MA 3RAXA 3NTUA 4QJFB 3WU2U 1T8EA 1D9FA 5J8YA 3RB4A 3GV8B 1RG6A 4CRXA 4DL7A 3WK8A 3HT3A 2EAOA 1BPEA 1KL9A 4DOAA 4NLZA 2MA1A 3PV8A 4I29A 5AKHA 3C5FA 2ZXIA 4TURA 3ZI4A 3RRHA 3NVZA 3QU5A 5ALRA 4NWIA 5KG7A 4NJ8A 4NLCA 2JH1A 5J29A 1KTQA 3L5KA 2R8GA 4QWBA 2G09A 2E8NA 4M0AA 1DK3A 2CRXA 4EZ6A 4GLXA 1O08A 2ZTDA 2UVRA 1A76A 2JH7A 3QX7A 2MU2A 2W11A 2QB1A 3FC4A 3A0BU 1T3QA 2HMXA 3F53A 1XSNA 2BZFA 1IG6A 3KHHA 2KZMA 3RB3A 3AEVA 2W03A 2HOQA 1L7MA 4B9SA 7ICMA 2ZXHA 2KG5A 5KFGA 1D8BA 3KHGA 9ICBA 3WK5A 2XY7A 4JUZA 1QCKA 5ALFA 4KX5A 1ZQSA 2HBMA 5DBAA 3IM1A 1ZQUA 4IQWA 4JV2A 2FPLA 5J2DA 3D2QA 1COKA 2W04A 5ALNA 3IG8A 3U26A 4US8A 3NGDA 5ALTA 3IDWA 3NS1A 4KLLA 5KFJA 3AMZA 5HMMA 5J2KA 1JN3A 4YMMA 2ZUBA 4LZDA 4YG2A 1KRPA 4UB6U 2BGWA 2IOHA 1NKCA 2IHNA 4M6WA 2WF6A 2PXIA 3A0HU 4EZ9A 3VC8A 3SAGA 4ED7A 2J6UA 5AI5A 3AN1A 3RBDA 4MEXA 2LMRA 3OJUA 3OGUA 5IIJA 4J03A 1NK0A 2QARB 4B6JA 2VJ5A 3BQ0A 8ICAA 9ICXA 3Q8MA 1Q8KA 5KFLA 3OTQA 4QZ8A 2KEYA 1T7PA 5KFNA 4RT3A 4YQWA 3QEAZ 1XSLA 2LYBA 2K8CB 2DGZA 1FO4A 4DQSA 4RQ4A 5A0LA 2RDIA 2RLTA 2YB1A 3R9KA 4J9PA 1C20A 4Y2SA 2QKQA 2ES6A 2HCFA 4PHAA 4GIBA 2WB1F 3JPPA 1O03A 3N7SC 1ZQ1C 3PX0A 5G5HA 5H2FU 1KW4A 4PZOA 2P35A 3QZ7A 4CGZA 3WK9A 2LPEA 4FZLA 4US9A 3JPTA 4J9MA 1Q3UA 1IIPA 1NK8A 3RH4A 4B9NA 2JZBA 3LK9A 2F1IA 4QZGA 1KBUA 2XVTA 4YXMA 1SV0C 2V9WA 4YCXA 3ISBA 3PNCA 2ZJ8A 3WK4A 2HHTA 4RU9A 7ICEA 4RQ8A 2ZTEA 3QU7A 4DSEA 4Y2RA 3GIKA 4QW9A 3HX0A 5EWEA 3C29A 2W8LA 4M9GA 4GXJA 4DSFA 5EWFA 2DPIA 3G6YA 2Y9UA 4XRHA 5KG0A 4M04A 3FYHA 3BQ2A 3ZDAA 3AL0B 2AGQA 3MFIA 2ASDA 1ZQOA 2ZJ5A 4RQ7A 4I2CA 4B9MA 3PY8A 3C2KA 2VA8A 2FLNA 1BNPA 1TKDA 4ECWA 4I2JA 1S0NA 2OM6A 2B21A 3SQIA 2K8BB 5J0PA 4IR1A 5J0XA 4KLIA 2HOFA 3NASA 3MR2A 2BDUA 2MAXA 2EAPA 5ALPA 2KHVA 8ICPA 2G0AA 4P0QB 1ZQWA 1OXJA 4TUSA 3PSIA 4ECZA 7ICQA 3NVYA 2OXOA 1K1QA 1UPHA 9ICWA 3M9OB 4EYHB 1RQLA 4JB3A 1KLNA 2BKEA 2OCEA 5DB9A 2FDRA 3V72A 3BS5A 4K4IA 5J0RA 2H3VA 8ICRA 4RUCA 2DFLA 4P4MA 2W9AA 3Q8LA 1HUZA 9ICVA 3I1YA 7ICIA 4K4HA 8ICOA 1PVPA 4A8EA 1P7DA 2MSNA 4F4YA 2L5YA 5KFVA 3H4BA 1K1SA 5KFXA 4IS7A 3NVVA 1N61A 1SWWA 5GTIU 1Z00A 1SL0A 3H0LB 3SMVA 3LVWA 5BPCA 2PFOA 2LKYA 2KKPA 2ZIXA 2WHEA 4RQ6A 3PSTA 5L1LA 3OSPA 4QW8A 2BQRA 2IOFA 5JRTA 4B9TA 3EYZA 2BCUA 4FBUA 2C22A 4YD1A 2HW3A 2M0NA 1TFRA 4R66A 2JEJA 5ALEA 2D3DA 3QZ8A 4DOCA 2W3SA 3BDPA 1TVAA 3OHBA 5J0SA 8ICCA 4JWNA 3RRGA 2R18A 5L9XA 2FMPA 1L8LA 2BPCA 4UAZA 1N2XA 3C2MA 4RNOA 4I2EA 4DOBA 2A3VA 2YQEA 2I9GA 4R65A 4P4OA 2E8PA 4O3RA 4EEYA 2KVSA 1L5UA 4EELA 4RUAA 3FDSA 4EX7A 4DFDA 5EWGA 2P6UA 1S0OA 2ZIWB 5J2CA 4DL5A 4Z6CA 2E1FA 2W8KA 7ICFA 4G3IA 5HNKA 2ZIVB 1RYUA 4UQGA 2KJ5A 4BXOB 3I28A 3RJGA 2H5XA 2NO5A 5CR0A 3GZFA 4ED3A 5KFIA 1RYRA 3AU6A 4CNQA 2RQ5A 5EE1A 4PHPA 5KFZA 5KG1A 5HR7A 4HYKA 1UT8A 1WCNA 2LBOA 2BCVA 5FP0A 1GO3F 4IRKA 1QQ7A 3E0FA 2H3FA 3EWAA 3J81j 1XSPA 2EH9A 1ZQAA 4M9HA 1V85A 5KTQA 1DRGA 2P66A 4JV1A 5AIBA 4IRCA 5ALVA 4C7ZA 3V6JA 4XQ8A 2KFNA 1SGGA 4BX9C 1YZ6A 3RJIA 3SI8A 4X5VA 1B22A 1X42A 1B43A 5KFSA 4F5RA 2A1AA 5HHIA 4UBBA 2LM4A 1DXSA 3TACB 4TUQA 4UB2A 3ZDCA 3HJEA 4PHDA 4KMUA 5BOMA 3PMNA 1NK7A 2FPMA 2YY6A 3WK7A 1V9PA 4M6WB 3MGIA 2JR5A 4DS5A 1F0MA 2YMQA 1A6SA 3SV4A 4RPXA 5F9LA 2YN4A 5TZVA 8ICTA 4F8RA 1Z3EB 2ISOA 2G07A 5ALZA 5KFOA 4QZDA 1X6JA 2QARA 3F5EA 5KFFA 9ICKA 2HBKA 2VA3A 3WKEA 5AM5A 1ZQVA 5KG4A 3HRDD 2K4IA 3NRWA 2BCRA 2XICA 7ICLA 4KLEA 4NV0A 2AGOA 2XIDA 2XGPA 1Q3VA 4UAWA 5KT6A 4NM1A 4KN4A 2KZZA 4I2FA 4KLSA 5JUMA 2G08A 2JGAA 3DEEA 4Y2QA 2CPRA 2DF4B 4C8MA 3B0XA 4ED6A 1UQVA 4ECVA 2E8OA 2Y1IA 2C2DA 5ALWA 5E79U 3KZXA 2EZYA 3SEIA 4C4RA 1RPLA 1N5XA 1ZJMA 4M2YA 2RDJA 3DV9A 4KLQA 1LB2B 1SL2A 2KE7A 2XCAA 1L3SA 4KLGA 1M6YA 8ICBA 4GFJA 5IIMA 3N7RC 5ALYA 3IP4B 2E5SA 4WJ3B 1ZQKA 1FEZA 4YR0A 2E1EA 4K4GA 3UPQA 4NM2A 4O3OA 3ZD8A 2IBKA 3QU2A 2F1JA 4DL6A 3Q8SB 2MUTB 7ICKA 9ICSA 1BPXA 3VCBA 2JEIA 2NRWA 5ALOA 4RZRA 5IILA 2W9BB 2KTQA 1J97A 3C23A 4QWAA 4DQIA 5DB7A 2RP5A 3QUBA 7ICSA 4FZNA 8ICSA 3MBYA 4I2AA 8ICNA 3LWLA 4I2BA 3BQTA 5KFRA 1FFUA 1ZQEA 5J2AA 2KFZA 3IN5A 4J9KA 4ECQA 4TQSA 2Q0ZX 2BR0A 1QSLA 5KG3A 1NJWA 4AYBF 1SKWA 4P4PA 3H7IA 5KFUA 2NRVA 3SZ2A 5ALMA 3RJJA 2PFPA 9ICOA 1RQNA 5KFAA 3T3FA 1FFVA 1YZ7A 5IIIA 3C21A 3ISCA 2V4QA 4J9NA 9ICRA 4LJXA 5J0YA 5J2FA 3BS5B 2HBJA 4DFKA 1IXRA 4BDPA 3IV6A 1S10A 8ICJA 2BPGA 2FLLA 4UBCA 1ZD2P 5HMLA 5AK3A 4F72A 5AM3A 3RR7A 2O6KA 9ICQA 4O0IA 1JROA 9ICHA 5IINA 3F5AA 1ZRNA 1ZOLA 5D4BA 4KLOA 1LVHA 5CB1A 7ICVA 4DL3A 2JXJA 2ZIXB 1NK9A 3H0RB 4Y2YA 2R8JA 3TQ1A 9ICAA 1YT3A 9ICJA 1RDFA 5KFKA 1QTMA 5KFWA 5AI6A 8ICGA 2C28A 5AKJA 1CRXA 3ISDA 2OWOA 1XC9A 1QQ5A 1TV9A 3GIJA 4B9LA 4XUSA 2KIWA 4OCZA 5AK4A 1D8YA 2OEHA 1XWLA 3QEBZ 5DB8A 4M9JA 2HI0A 4NXZA 4BWJA 2J6SA 2WF7A 3OJSA 3T5JA 5J2BA 4JMUA 2I6XA 5J0OA 3H0MB 1UHUA 1CUKA 4ECXA 4LZGA 2DBYA 4MF8A 4YMNA 3ZDDA 2LYHA 4QZIA 3QYPA 3HW8A 3QU4A 4F92B 2ODGA 2KJ8A 5KT5A 1ZQNA 9ICTA 4UB8U 3GV5B 5J2IA 3IHQB 3M6KA 2ZIWA 5D49A 1SZHA 1L3UA 3MC1A 1DOQA 5K4LA 5AM2A 4GXKA 1L7OA 2IMWP 4RQ2A 2ATLA 2RRDA 3PW7A 1SXEA 2ZIVA 4Y2VA 2A1JB 4BXOA 4RQ0A 4QZHA 2JEGA 4EBDA 4RQMA 5DQIA 1PK3A 2F76X 2K4EA 4FS2A 2XCPA 4MFFA 4MEYA 4CDGA 4R64A 2NO4A 5L1JA 2JV3A 1JI7A 8ICWA 4DSLA 1KFSA 4C0ZA 1NOMA 2FMQA 3NVWA 2BPFA 4RNMA 5CJ7A 2DWQA 4DFMA 4TQRA 2IHMA 4O5EA 5AK5A 4DQQA 3PW4A 5KFPA 2KJ9A 4QNLA 5B66U 1ZD5A 5IIOA 3M7DA 4Q44A 3BJYA 1MQ2A 2YMMA 4I2HA 1XU4A 4CF5A 2WAQF 4QWDA 4I2IA 3K75D 1PZNA 7ICGA 3TAQA 5KNIA 1PK1A 4F5PA 2HHVA 4PJ0U 3UMCA 3GFKB 3C2LA 3OHAA 4O9MA 4CCHA 5KFHA 3KD3A 3PW5A 4OJ5A 4CF4A 5ALGA 4B9UA 1ZQYA 2PFQA 1HUOA 1SXDA 2AHOB 3GIIA 3GDXA 4C4TA 2GWSA 3M8RA 2KVCA 2HHSA 1RZTA 5DDMA 3QNMA 3CRXA 4M47A 2BQ3A 1ED1A 4EX6A 2JHDA 4M9NA 1Q46A 1V38A 1DGJA 4Y2JA 5KT7A 1ZD3A 2ALZA 4KLFA 1J2MA 3K1RB 4MHVA 5T14A 2VJ4A 1WUDA 2OH2A 2QB0A 2W9CB 3AUOA 3E2EA 1TAUA 4PZNA 5CP2A 1XNSA 3K1ZA 2M9NA 4JV0A 2ZTCA 3RJEA 4MFCA 4KMOB 4QZAA 1HJPA 3M8SA 4DLGA 5TISU 2JEFA 4NY8A 4O3MA 3H8JA 5KL1B 3RH5A 2ZJAA 2XY6A 1D8LA 1X9WA 1J2NA 7ICTA 3KHLA 1X40A 2DQNB 2K4PA 4NLKA 4KN7A 3AU2A 4UATA 5KFCA 3JPSA 3LWMA 3WKCA 1K5OA 4RT2A 3JPQA 3PMLA 4QIWC 2LM1A 1NNLA 1F5SA 2EZZA 2MUTA 2VIXA 3C28A 3O0FA 5CHGA 4UASA 4OJLA 2W9BA 4J9RA 3H8WA 1PUZA 4NLGA 4F91B 1KDHA 1D9DA 3ONNA 4UB1A 1BPYA 7ICRA 2W7OA 2WB1C 4EBEA 1IV8A 4F4XA 3RR8A 3B0YA 1JXEA 4J9SA 3QE9Y 3CYMA 2DKXA 2UVWA 1URJA 2LHTA 1QSSA 1LKYA 4QZ9A
chains in the Genus database with same CATH topology
1PUZA 1X6JA 2LM4A 1X6IA 2JR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUZ A;  1X6J A;  2LM4 A;  1X6I A;  2JR5 A; 
#chains in the Genus database with same CATH topology
 2KSO A;  2NRZ A;  5ALD A;  3EPI A;  2R8I A;  5DG7 A;  1CI4 A;  5KG2 A;  2XY5 A;  1S5L U;  4F2R A;  5DDY A;  5BOL A;  8ICE A;  4Z6F A;  1SB3 C;  3QUQ A;  5AM0 A;  2DPJ A;  5ALH A;  1NZB A;  5CA7 A;  3PSF A;  2G5I B;  1DGS A;  1RXW A;  2VA2 A;  1ZET A;  2HBL A;  3FM9 A;  4PPX A;  3BQ1 A;  2WF8 A;  4ECR A;  4O5K A;  4RQ1 A;  4I2D A;  1OW5 A;  5EOZ A;  1ZQC A;  2HHU A;  3H4D A;  1NK4 A;  2PFN A;  3F2D A;  3KHR A;  4R63 A;  1XO0 A;  9ICG A;  3UMB A;  4ED8 A;  4ED2 A;  1ZQJ A;  4J9L A;  4YVZ A;  3HKZ C;  2UVV A;  1KKX A;  4O3N A;  2JRZ A;  5AKG A;  2MRL A;  1NK5 A;  4KIT B;  3SAF A;  3RAQ A;  8ICZ A;  4PHE A;  3TAD C;  1ZQI A;  4LVS A;  5C5J A;  3ICX A;  3HP6 A;  8ICY A;  4GC6 A;  3T5L A;  2DKZ A;  1BPD A;  1XS9 D;  1S76 D;  3FAH A;  3D2N A;  3TKA A;  3RJH A;  1WYG A;  1SL1 A;  4DFJ A;  3Q8K A;  1BPB A;  4Y2X A;  1N5W A;  1ZQQ A;  1MN8 A;  2DUY A;  2C2E A;  4R8U A;  4DO9 A;  2F1H A;  1WWV A;  5L1I A;  4PL1 A;  3GIL A;  5DG8 A;  4U7C A;  3SYZ A;  3UQ2 A;  2A19 A;  8ICX A;  4DSJ A;  4Z6D A;  1VLB A;  3SV3 A;  3PO5 A;  1JIH A;  1T3N A;  4C8L A;  2BQU A;  1U48 A;  2A1J A;  3V7J A;  3HIL A;  1L7P A;  4RQ5 A;  1ZQH A;  4E0D A;  3L3F X;  2B6G A;  3PZP A;  1NK6 A;  3IRU A;  1HIW A;  3GV7 B;  3PW2 A;  5AI4 A;  2QLT A;  2GH1 A;  2AU0 A;  5CRX A;  2HVI A;  4ELV A;  4DS4 A;  2WF5 A;  1WG8 A;  1ZQG A;  1NKB A;  3V7L A;  2XGQ A;  4ECY A;  4ECS A;  5DLG A;  3PR5 B;  5G5G A;  2GLE A;  4FFD A;  3THV A;  3MGV A;  1JX4 A;  2IA6 A;  4Y2T A;  4Q8E A;  2W54 A;  3H40 A;  1WWU A;  2NRX A;  3JPO A;  1S9F A;  2W43 A;  2NYV A;  4NL9 A;  3Q8P B;  3TAP A;  2OHF A;  3M6Z A;  7ICO A;  5B5E U;  2E3T A;  2YX8 A;  1TE2 A;  4DL2 A;  4DQR A;  3EZ5 A;  2FI1 A;  4PL2 A;  1PK1 B;  1COO A;  2W55 A;  4G9B A;  5GTH U;  2PI5 A;  4ZOH C;  3PR4 A;  4PH5 A;  1H38 A;  3E58 A;  4DQP A;  1ZD4 A;  5F9N A;  1Z4O A;  4ED0 A;  2ZIU B;  5KFB A;  1WCL A;  4F5N A;  7ICN A;  2WFA A;  2ZUD A;  1N56 A;  3HKZ F;  3SR6 A;  2XI9 A;  1TAM A;  9ICF A;  4OD0 A;  4RPZ A;  3ORY A;  5KT3 A;  3I76 A;  1ZQF A;  3QU9 A;  5KT2 A;  3G6X A;  4IL6 U;  3MR5 A;  3QUT A;  4ACO A;  4ECU A;  8ICQ A;  5L1K A;  1TK8 A;  2KD1 A;  1ZQL A;  5AKL A;  2KOB A;  1L7N A;  3CP8 A;  4KLU A;  1ZQX A;  5KFE A;  3KZI U;  1CEZ A;  1S8O A;  4ELT A;  2PKE A;  2QB0 B;  1T4G A;  2V4R A;  2K89 A;  2W9C A;  3GQC A;  3V6H A;  4C8N A;  3DDH A;  3TAN A;  2XO7 A;  5ALX A;  3ED5 A;  4FE3 A;  3N4M B;  4IC9 A;  3UMG A;  5EE9 A;  1NJZ A;  3D2S A;  2HHX A;  3PSP A;  2W3R A;  4I28 A;  4YR2 A;  5AHX A;  3WKA A;  1X9S A;  3RH6 A;  4IRD A;  4O3P A;  2KIV A;  1V97 A;  2Y9T A;  4AP9 A;  4F5O A;  1ZQM A;  2Q4T A;  4RQN A;  3KKA A;  5EE0 A;  4F50 A;  1SKS A;  5DKW A;  9ICM A;  4MF2 A;  4YN4 A;  2Y0S F;  1KFD A;  3KBB A;  2K4H A;  1S77 D;  1B0X A;  4BUG A;  4IR9 A;  4JWM A;  5DQG A;  4F4Z A;  2KK0 A;  3SEN A;  2F8K A;  4IQV A;  2R8H A;  2KN7 A;  4UW9 A;  1U9L A;  2EQY A;  1TK0 A;  4DLE A;  2ASJ A;  3OSN A;  5AIC A;  4QZE A;  4OJ6 A;  3KKA C;  3PO4 A;  3C5G A;  4O3S A;  1LKY B;  1N63 A;  1ZQB A;  4P0P B;  2WF9 A;  1F44 A;  2ISP A;  4DEZ A;  1ZQZ A;  1Z1B A;  2KSO B;  4NLB A;  4NLN A;  2F3N A;  5DBC A;  3T79 A;  1FIQ A;  3RBE A;  1U49 A;  1BPZ A;  5KG5 A;  1NI3 A;  5KG6 A;  1UCV A;  1X2I A;  2FLP A;  3ZDB A;  3BZC A;  5DGB A;  5ALL A;  1SZP A;  4I2G A;  1ZJN A;  3UM9 A;  3ALR A;  3T5K A;  1JMS A;  3D6J A;  2F44 A;  5KFQ A;  1SIJ A;  1N48 A;  1U47 A;  4F5Q A;  1JUD A;  5AKZ A;  5J0W A;  4FZM A;  1UT5 A;  3B9J A;  5AIA A;  5AI9 A;  4J9O A;  4KX3 A;  2AH5 A;  2H3Q A;  2AGP A;  3G6V A;  3MFH A;  1ZYQ A;  5AM4 A;  2D6F C;  4XA5 A;  5HP4 A;  1X9M A;  5AK6 A;  5AKY A;  5DGA A;  1MQ3 A;  5AKK A;  1PVR A;  2GO7 A;  4BGD A;  4M9L A;  1L6N A;  5DB6 A;  4F4K A;  2Y0S C;  3HWT A;  2R8K A;  5DLF A;  2VAN A;  8ICL A;  1N60 A;  2LYA A;  2RHF A;  4QZC A;  4ELU A;  3M9M B;  1ZQR A;  3MR3 A;  2PI4 A;  3TAD A;  4ICA A;  5IIK A;  1ECW A;  5KL8 B;  3RFA A;  3KOO A;  3V6K A;  3Q8Q B;  5KFY A;  4B9V A;  4TUP A;  5J0T A;  4R8U B;  1ARO P;  1BVS A;  2IOF K;  5ALI A;  1Y88 A;  4J9Q A;  4FO6 A;  1SV4 A;  2VKQ A;  3WKB A;  3JPN A;  4F2S A;  4UB4 A;  3LDA A;  3ETR A;  8ICV A;  2ESE A;  7ICU A;  2F8L A;  4YD2 A;  9ICI A;  4Z6E A;  4YP3 A;  3PX4 A;  4Q8F A;  3Q8R B;  3K4G A;  3RB0 A;  3ETL A;  3LVV A;  3IG5 A;  3PX6 A;  4C8K A;  4F4W A;  4EBC A;  1DK2 A;  3H8M A;  2AJQ A;  1N62 A;  1PVQ A;  4USA A;  3AQF A;  1A77 A;  1T94 A;  1NKE A;  1ZRM A;  4I27 A;  3EW9 A;  5J0U A;  2AQ0 A;  3RJK A;  4QZB A;  2YTU A;  3WKD A;  3C1Z A;  5KT4 A;  4EEN A;  4UAU A;  5J2H A;  3RJF A;  4U6P A;  2AXT U;  3MAB A;  4C80 A;  8ICM A;  3SD7 A;  1JAL A;  3N97 B;  2HOI A;  2CN1 A;  2Z7J A;  2YB4 A;  5KFD A;  2BCS A;  2P6R A;  3C1Y A;  4NL9 C;  5AI8 A;  4FBT A;  3QXG A;  4IQU A;  4RPY A;  3TFS A;  2EAM A;  3AQE A;  3UXN A;  2GOL A;  3M1Y A;  2HSZ A;  5KAI U;  2ZIU A;  2J6T A;  3QUC A;  5CWR A;  3BS7 A;  4BWM A;  4KLD A;  2WTF A;  5HHH A;  4ECT A;  4DF4 A;  2YMP A;  4UAY A;  4IQT A;  2W9M A;  7ICJ A;  1B4F A;  3N7P D;  3T5H A;  2Y1J A;  5CEH A;  3NUQ A;  2FPK A;  1QH9 A;  3JPR A;  1X66 A;  3CW2 C;  4YR3 A;  4FS1 A;  1U4B A;  1HEK A;  4QZF A;  2CXY A;  4AYB C;  2G06 A;  4DFP A;  2W7P A;  3PVX A;  2I5H A;  1SKR A;  1MC8 A;  3AM9 A;  4C7Y A;  7ICH A;  8ICF A;  1AQ6 A;  4DWI A;  1QQ6 A;  2G5H B;  2F77 X;  2FE9 A;  2B0C A;  5DQH A;  2BHN A;  2I1Q A;  2N1R A;  3GIM A;  3TFR A;  1TK5 A;  1L3V A;  1KSP A;  1JRP A;  3EUB 2;  8ICU A;  4KLH A;  1L8O A;  2NRT A;  3RTV A;  4QIW F;  3MDA A;  5AM1 A;  2KNJ A;  2YML A;  9ICE A;  5ALU A;  4PGY A;  1ZQT A;  5AKI A;  3TI0 A;  2KMD A;  3NRZ A;  2FMS A;  3ZD9 A;  1LV5 A;  5J2G A;  2ASL A;  1VJ5 A;  4ED1 A;  2K8A A;  2WAQ C;  1UA1 A;  3PW0 A;  4YMO A;  8ICH A;  4QWC A;  4Y2P A;  1QSY A;  5AI0 A;  3F2C A;  5D46 A;  1NJY A;  1ZXI A;  3MDC A;  4RQ3 A;  1SWV A;  4KLM A;  3HPO A;  1RYS A;  4MFA A;  4DSI A;  1KFT A;  1KN5 A;  4PGQ A;  1XO1 A;  4CF3 A;  2F2A B;  2LI6 A;  2EDU A;  5C0Y A;  7ICP A;  3LYS A;  5ALJ A;  2HDO A;  4DF8 A;  4KLT A;  1BGX T;  1SV0 A;  2BCQ A;  4OO1 J;  5ALQ A;  2KKV A;  1MSW D;  1S0V A;  1TAQ A;  2DL0 A;  4DSK A;  4P0P A;  4HAI A;  4OJP A;  9ICN A;  1QLN A;  1A0P A;  5DG9 A;  2UVU A;  1BNO A;  2KV2 A;  1KQQ A;  4UB3 A;  5DBB A;  3UXO A;  3H8S A;  3BZK A;  5J2J A;  4ZH4 A;  3L4P A;  4C8O A;  2JZB B;  1NJX A;  9ICP A;  3CNH A;  2PMZ F;  4GXI A;  3KTQ A;  1JXL A;  4Q43 A;  2AQ4 A;  2JMG A;  1IM4 A;  3RF9 A;  3WK6 A;  4C4S A;  4DCC A;  4DL4 A;  2NV3 A;  4JK1 A;  3EPG A;  1KEJ A;  2XC9 A;  4OJO A;  1Z4N A;  8ICK A;  4KTQ A;  3UQ0 A;  4Y2U A;  3GU3 A;  4F93 B;  1L3T A;  3BQ7 A;  3MGH A;  9ICL A;  5F3X B;  4O3Q A;  2H3I A;  4PGX A;  5ALK A;  1X6I A;  5KFM A;  2KIC A;  1ZQP A;  4EYI B;  8ICI A;  1Z1V A;  4UB5 A;  5AKE A;  5ALS A;  4P2H A;  3N28 A;  2EAN A;  4F71 A;  2HVH A;  2HHW A;  1X9X A;  2FJ6 A;  5AKX A;  2KZ3 A;  4RNN A;  3V7K A;  4YFK A;  4QWE A;  4CE6 A;  5HR6 A;  4P0Q A;  4UAR A;  1C7Y A;  2BDP A;  1ZQD A;  1UA0 A;  5JU5 A;  9ICC A;  3OPX A;  2D8C A;  3M9N B;  4Q45 A;  1RXV A;  1S0M A;  3S6J A;  2HHQ A;  4BJQ A;  1MA7 A;  4F3O A;  4UAV A;  1RM6 C;  5KFT A;  2KHQ A;  5L1M A;  4GC7 A;  3MR6 A;  2K60 A;  4KLJ A;  1Z19 A;  3TAR A;  5EE3 A;  3F2B A;  1U45 A;  5JTI A;  2H3Z A;  1NZP A;  3ZDE A;  5J8Y C;  3SAH A;  1VDV A;  2PMZ C;  4EEK A;  5J2E A;  2OYY A;  2KP7 A;  1Z00 B;  1S97 A;  5J0Q A;  4YXJ A;  2C2R A;  2EZX A;  3RB6 A;  9ICU A;  2ZUC A;  3UXP A;  3KFU F;  2ZG6 A;  1EXN A;  1OUQ A;  5KAF U;  4O5C A;  2E8M A;  3RAX A;  3NTU A;  4QJF B;  3WU2 U;  1T8E A;  1D9F A;  5J8Y A;  3RB4 A;  3GV8 B;  1RG6 A;  4CRX A;  4DL7 A;  3WK8 A;  3HT3 A;  2EAO A;  1BPE A;  1KL9 A;  4DOA A;  4NLZ A;  2MA1 A;  3PV8 A;  4I29 A;  5AKH A;  3C5F A;  2ZXI A;  4TUR A;  3ZI4 A;  3RRH A;  3NVZ A;  3QU5 A;  5ALR A;  4NWI A;  5KG7 A;  4NJ8 A;  4NLC A;  2JH1 A;  5J29 A;  1KTQ A;  3L5K A;  2R8G A;  4QWB A;  2G09 A;  2E8N A;  4M0A A;  1DK3 A;  2CRX A;  4EZ6 A;  4GLX A;  1O08 A;  2ZTD A;  2UVR A;  1A76 A;  2JH7 A;  3QX7 A;  2MU2 A;  2W11 A;  2QB1 A;  3FC4 A;  3A0B U;  1T3Q A;  2HMX A;  3F53 A;  1XSN A;  2BZF A;  1IG6 A;  3KHH A;  2KZM A;  3RB3 A;  3AEV A;  2W03 A;  2HOQ A;  1L7M A;  4B9S A;  7ICM A;  2ZXH A;  2KG5 A;  5KFG A;  1D8B A;  3KHG A;  9ICB A;  3WK5 A;  2XY7 A;  4JUZ A;  1QCK A;  5ALF A;  4KX5 A;  1ZQS A;  2HBM A;  5DBA A;  3IM1 A;  1ZQU A;  4IQW A;  4JV2 A;  2FPL A;  5J2D A;  3D2Q A;  1COK A;  2W04 A;  5ALN A;  3IG8 A;  3U26 A;  4US8 A;  3NGD A;  5ALT A;  3IDW A;  3NS1 A;  4KLL A;  5KFJ A;  3AMZ A;  5HMM A;  5J2K A;  1JN3 A;  4YMM A;  2ZUB A;  4LZD A;  4YG2 A;  1KRP A;  4UB6 U;  2BGW A;  2IOH A;  1NKC A;  2IHN A;  4M6W A;  2WF6 A;  2PXI A;  3A0H U;  4EZ9 A;  3VC8 A;  3SAG A;  4ED7 A;  2J6U A;  5AI5 A;  3AN1 A;  3RBD A;  4MEX A;  2LMR A;  3OJU A;  3OGU A;  5IIJ A;  4J03 A;  1NK0 A;  2QAR B;  4B6J A;  2VJ5 A;  3BQ0 A;  8ICA A;  9ICX A;  3Q8M A;  1Q8K A;  5KFL A;  3OTQ A;  4QZ8 A;  2KEY A;  1T7P A;  5KFN A;  4RT3 A;  4YQW A;  3QEA Z;  1XSL A;  2LYB A;  2K8C B;  2DGZ A;  1FO4 A;  4DQS A;  4RQ4 A;  5A0L A;  2RDI A;  2RLT A;  2YB1 A;  3R9K A;  4J9P A;  1C20 A;  4Y2S A;  2QKQ A;  2ES6 A;  2HCF A;  4PHA A;  4GIB A;  2WB1 F;  3JPP A;  1O03 A;  3N7S C;  1ZQ1 C;  3PX0 A;  5G5H A;  5H2F U;  1KW4 A;  4PZO A;  2P35 A;  3QZ7 A;  4CGZ A;  3WK9 A;  2LPE A;  4FZL A;  4US9 A;  3JPT A;  4J9M A;  1Q3U A;  1IIP A;  1NK8 A;  3RH4 A;  4B9N A;  2JZB A;  3LK9 A;  2F1I A;  4QZG A;  1KBU A;  2XVT A;  4YXM A;  1SV0 C;  2V9W A;  4YCX A;  3ISB A;  3PNC A;  2ZJ8 A;  3WK4 A;  2HHT A;  4RU9 A;  7ICE A;  4RQ8 A;  2ZTE A;  3QU7 A;  4DSE A;  4Y2R A;  3GIK A;  4QW9 A;  3HX0 A;  5EWE A;  3C29 A;  2W8L A;  4M9G A;  4GXJ A;  4DSF A;  5EWF A;  2DPI A;  3G6Y A;  2Y9U A;  4XRH A;  5KG0 A;  4M04 A;  3FYH A;  3BQ2 A;  3ZDA A;  3AL0 B;  2AGQ A;  3MFI A;  2ASD A;  1ZQO A;  2ZJ5 A;  4RQ7 A;  4I2C A;  4B9M A;  3PY8 A;  3C2K A;  2VA8 A;  2FLN A;  1BNP A;  1TKD A;  4ECW A;  4I2J A;  1S0N A;  2OM6 A;  2B21 A;  3SQI A;  2K8B B;  5J0P A;  4IR1 A;  5J0X A;  4KLI A;  2HOF A;  3NAS A;  3MR2 A;  2BDU A;  2MAX A;  2EAP A;  5ALP A;  2KHV A;  8ICP A;  2G0A A;  4P0Q B;  1ZQW A;  1OXJ A;  4TUS A;  3PSI A;  4ECZ A;  7ICQ A;  3NVY A;  2OXO A;  1K1Q A;  1UPH A;  9ICW A;  3M9O B;  4EYH B;  1RQL A;  4JB3 A;  1KLN A;  2BKE A;  2OCE A;  5DB9 A;  2FDR A;  3V72 A;  3BS5 A;  4K4I A;  5J0R A;  2H3V A;  8ICR A;  4RUC A;  2DFL A;  4P4M A;  2W9A A;  3Q8L A;  1HUZ A;  9ICV A;  3I1Y A;  7ICI A;  4K4H A;  8ICO A;  1PVP A;  4A8E A;  1P7D A;  2MSN A;  4F4Y A;  2L5Y A;  5KFV A;  3H4B A;  1K1S A;  5KFX A;  4IS7 A;  3NVV A;  1N61 A;  1SWW A;  5GTI U;  1Z00 A;  1SL0 A;  3H0L B;  3SMV A;  3LVW A;  5BPC A;  2PFO A;  2LKY A;  2KKP A;  2ZIX A;  2WHE A;  4RQ6 A;  3PST A;  5L1L A;  3OSP A;  4QW8 A;  2BQR A;  2IOF A;  5JRT A;  4B9T A;  3EYZ A;  2BCU A;  4FBU A;  2C22 A;  4YD1 A;  2HW3 A;  2M0N A;  1TFR A;  4R66 A;  2JEJ A;  5ALE A;  2D3D A;  3QZ8 A;  4DOC A;  2W3S A;  3BDP A;  1TVA A;  3OHB A;  5J0S A;  8ICC A;  4JWN A;  3RRG A;  2R18 A;  5L9X A;  2FMP A;  1L8L A;  2BPC A;  4UAZ A;  1N2X A;  3C2M A;  4RNO A;  4I2E A;  4DOB A;  2A3V A;  2YQE A;  2I9G A;  4R65 A;  4P4O A;  2E8P A;  4O3R A;  4EEY A;  2KVS A;  1L5U A;  4EEL A;  4RUA A;  3FDS A;  4EX7 A;  4DFD A;  5EWG A;  2P6U A;  1S0O A;  2ZIW B;  5J2C A;  4DL5 A;  4Z6C A;  2E1F A;  2W8K A;  7ICF A;  4G3I A;  5HNK A;  2ZIV B;  1RYU A;  4UQG A;  2KJ5 A;  4BXO B;  3I28 A;  3RJG A;  2H5X A;  2NO5 A;  5CR0 A;  3GZF A;  4ED3 A;  5KFI A;  1RYR A;  3AU6 A;  4CNQ A;  2RQ5 A;  5EE1 A;  4PHP A;  5KFZ A;  5KG1 A;  5HR7 A;  4HYK A;  1UT8 A;  1WCN A;  2LBO A;  2BCV A;  5FP0 A;  1GO3 F;  4IRK A;  1QQ7 A;  3E0F A;  2H3F A;  3EWA A;  3J81 j;  1XSP A;  2EH9 A;  1ZQA A;  4M9H A;  1V85 A;  5KTQ A;  1DRG A;  2P66 A;  4JV1 A;  5AIB A;  4IRC A;  5ALV A;  4C7Z A;  3V6J A;  4XQ8 A;  2KFN A;  1SGG A;  4BX9 C;  1YZ6 A;  3RJI A;  3SI8 A;  4X5V A;  1B22 A;  1X42 A;  1B43 A;  5KFS A;  4F5R A;  2A1A A;  5HHI A;  4UBB A;  2LM4 A;  1DXS A;  3TAC B;  4TUQ A;  4UB2 A;  3ZDC A;  3HJE A;  4PHD A;  4KMU A;  5BOM A;  3PMN A;  1NK7 A;  2FPM A;  2YY6 A;  3WK7 A;  1V9P A;  4M6W B;  3MGI A;  2JR5 A;  4DS5 A;  1F0M A;  2YMQ A;  1A6S A;  3SV4 A;  4RPX A;  5F9L A;  2YN4 A;  5TZV A;  8ICT A;  4F8R A;  1Z3E B;  2ISO A;  2G07 A;  5ALZ A;  5KFO A;  4QZD A;  1X6J A;  2QAR A;  3F5E A;  5KFF A;  9ICK A;  2HBK A;  2VA3 A;  3WKE A;  5AM5 A;  1ZQV A;  5KG4 A;  3HRD D;  2K4I A;  3NRW A;  2BCR A;  2XIC A;  7ICL A;  4KLE A;  4NV0 A;  2AGO A;  2XID A;  2XGP A;  1Q3V A;  4UAW A;  5KT6 A;  4NM1 A;  4KN4 A;  2KZZ A;  4I2F A;  4KLS A;  5JUM A;  2G08 A;  2JGA A;  3DEE A;  4Y2Q A;  2CPR A;  2DF4 B;  4C8M A;  3B0X A;  4ED6 A;  1UQV A;  4ECV A;  2E8O A;  2Y1I A;  2C2D A;  5ALW A;  5E79 U;  3KZX A;  2EZY A;  3SEI A;  4C4R A;  1RPL A;  1N5X A;  1ZJM A;  4M2Y A;  2RDJ A;  3DV9 A;  4KLQ A;  1LB2 B;  1SL2 A;  2KE7 A;  2XCA A;  1L3S A;  4KLG A;  1M6Y A;  8ICB A;  4GFJ A;  5IIM A;  3N7R C;  5ALY A;  3IP4 B;  2E5S A;  4WJ3 B;  1ZQK A;  1FEZ A;  4YR0 A;  2E1E A;  4K4G A;  3UPQ A;  4NM2 A;  4O3O A;  3ZD8 A;  2IBK A;  3QU2 A;  2F1J A;  4DL6 A;  3Q8S B;  2MUT B;  7ICK A;  9ICS A;  1BPX A;  3VCB A;  2JEI A;  2NRW A;  5ALO A;  4RZR A;  5IIL A;  2W9B B;  2KTQ A;  1J97 A;  3C23 A;  4QWA A;  4DQI A;  5DB7 A;  2RP5 A;  3QUB A;  7ICS A;  4FZN A;  8ICS A;  3MBY A;  4I2A A;  8ICN A;  3LWL A;  4I2B A;  3BQT A;  5KFR A;  1FFU A;  1ZQE A;  5J2A A;  2KFZ A;  3IN5 A;  4J9K A;  4ECQ A;  4TQS A;  2Q0Z X;  2BR0 A;  1QSL A;  5KG3 A;  1NJW A;  4AYB F;  1SKW A;  4P4P A;  3H7I A;  5KFU A;  2NRV A;  3SZ2 A;  5ALM A;  3RJJ A;  2PFP A;  9ICO A;  1RQN A;  5KFA A;  3T3F A;  1FFV A;  1YZ7 A;  5III A;  3C21 A;  3ISC A;  2V4Q A;  4J9N A;  9ICR A;  4LJX A;  5J0Y A;  5J2F A;  3BS5 B;  2HBJ A;  4DFK A;  1IXR A;  4BDP A;  3IV6 A;  1S10 A;  8ICJ A;  2BPG A;  2FLL A;  4UBC A;  1ZD2 P;  5HML A;  5AK3 A;  4F72 A;  5AM3 A;  3RR7 A;  2O6K A;  9ICQ A;  4O0I A;  1JRO A;  9ICH A;  5IIN A;  3F5A A;  1ZRN A;  1ZOL A;  5D4B A;  4KLO A;  1LVH A;  5CB1 A;  7ICV A;  4DL3 A;  2JXJ A;  2ZIX B;  1NK9 A;  3H0R B;  4Y2Y A;  2R8J A;  3TQ1 A;  9ICA A;  1YT3 A;  9ICJ A;  1RDF A;  5KFK A;  1QTM A;  5KFW A;  5AI6 A;  8ICG A;  2C28 A;  5AKJ A;  1CRX A;  3ISD A;  2OWO A;  1XC9 A;  1QQ5 A;  1TV9 A;  3GIJ A;  4B9L A;  4XUS A;  2KIW A;  4OCZ A;  5AK4 A;  1D8Y A;  2OEH A;  1XWL A;  3QEB Z;  5DB8 A;  4M9J A;  2HI0 A;  4NXZ A;  4BWJ A;  2J6S A;  2WF7 A;  3OJS A;  3T5J A;  5J2B A;  4JMU A;  2I6X A;  5J0O A;  3H0M B;  1UHU A;  1CUK A;  4ECX A;  4LZG A;  2DBY A;  4MF8 A;  4YMN A;  3ZDD A;  2LYH A;  4QZI A;  3QYP A;  3HW8 A;  3QU4 A;  4F92 B;  2ODG A;  2KJ8 A;  5KT5 A;  1ZQN A;  9ICT A;  4UB8 U;  3GV5 B;  5J2I A;  3IHQ B;  3M6K A;  2ZIW A;  5D49 A;  1SZH A;  1L3U A;  3MC1 A;  1DOQ A;  5K4L A;  5AM2 A;  4GXK A;  1L7O A;  2IMW P;  4RQ2 A;  2ATL A;  2RRD A;  3PW7 A;  1SXE A;  2ZIV A;  4Y2V A;  2A1J B;  4BXO A;  4RQ0 A;  4QZH A;  2JEG A;  4EBD A;  4RQM A;  5DQI A;  1PK3 A;  2F76 X;  2K4E A;  4FS2 A;  2XCP A;  4MFF A;  4MEY A;  4CDG A;  4R64 A;  2NO4 A;  5L1J A;  2JV3 A;  1JI7 A;  8ICW A;  4DSL A;  1KFS A;  4C0Z A;  1NOM A;  2FMQ A;  3NVW A;  2BPF A;  4RNM A;  5CJ7 A;  2DWQ A;  4DFM A;  4TQR A;  2IHM A;  4O5E A;  5AK5 A;  4DQQ A;  3PW4 A;  5KFP A;  2KJ9 A;  4QNL A;  5B66 U;  1ZD5 A;  5IIO A;  3M7D A;  4Q44 A;  3BJY A;  1MQ2 A;  2YMM A;  4I2H A;  1XU4 A;  4CF5 A;  2WAQ F;  4QWD A;  4I2I A;  3K75 D;  1PZN A;  7ICG A;  3TAQ A;  5KNI A;  1PK1 A;  4F5P A;  2HHV A;  4PJ0 U;  3UMC A;  3GFK B;  3C2L A;  3OHA A;  4O9M A;  4CCH A;  5KFH A;  3KD3 A;  3PW5 A;  4OJ5 A;  4CF4 A;  5ALG A;  4B9U A;  1ZQY A;  2PFQ A;  1HUO A;  1SXD A;  2AHO B;  3GII A;  3GDX A;  4C4T A;  2GWS A;  3M8R A;  2KVC A;  2HHS A;  1RZT A;  5DDM A;  3QNM A;  3CRX A;  4M47 A;  2BQ3 A;  1ED1 A;  4EX6 A;  2JHD A;  4M9N A;  1Q46 A;  1V38 A;  1DGJ A;  4Y2J A;  5KT7 A;  1ZD3 A;  2ALZ A;  4KLF A;  1J2M A;  3K1R B;  4MHV A;  5T14 A;  2VJ4 A;  1WUD A;  2OH2 A;  2QB0 A;  2W9C B;  3AUO A;  3E2E A;  1TAU A;  4PZN A;  5CP2 A;  1XNS A;  3K1Z A;  2M9N A;  4JV0 A;  2ZTC A;  3RJE A;  4MFC A;  4KMO B;  4QZA A;  1HJP A;  3M8S A;  4DLG A;  5TIS U;  2JEF A;  4NY8 A;  4O3M A;  3H8J A;  5KL1 B;  3RH5 A;  2ZJA A;  2XY6 A;  1D8L A;  1X9W A;  1J2N A;  7ICT A;  3KHL A;  1X40 A;  2DQN B;  2K4P A;  4NLK A;  4KN7 A;  3AU2 A;  4UAT A;  5KFC A;  3JPS A;  3LWM A;  3WKC A;  1K5O A;  4RT2 A;  3JPQ A;  3PML A;  4QIW C;  2LM1 A;  1NNL A;  1F5S A;  2EZZ A;  2MUT A;  2VIX A;  3C28 A;  3O0F A;  5CHG A;  4UAS A;  4OJL A;  2W9B A;  4J9R A;  3H8W A;  1PUZ A;  4NLG A;  4F91 B;  1KDH A;  1D9D A;  3ONN A;  4UB1 A;  1BPY A;  7ICR A;  2W7O A;  2WB1 C;  4EBE A;  1IV8 A;  4F4X A;  3RR8 A;  3B0Y A;  1JXE A;  4J9S A;  3QE9 Y;  3CYM A;  2DKX A;  2UVW A;  1URJ A;  2LHT A;  1QSS A;  1LKY A;  4QZ9 A; 
#chains in the Genus database with same CATH homology
 1PUZ A;  1X6J A;  2LM4 A;  1X6I A;  2JR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...