1X6JA

Crystal structure of ygfy from escherichia coli
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
88
structure length
88
Chain Sequence
MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGKPADAELEMMVRLIQTRNRERGPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ygfY
publication title Crystal structure of the YgfY from Escherichia coli, a protein that may be involved in transcriptional regulation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 37
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 1x6jA00
2LM4A 2JR5A 1PUZA 1X6IA 1X6JA
chains in the Genus database with same CATH superfamily
1V97A 1ZD3A 4YMOA 4QWCA 3LWLA 1SV4A 1TAUA 3KHRA 3KHGA 4X5VA 2AGQA 4NXZA 3GU3A 2EZZA 1H38A 4KLHA 3KOOA 2LHTA 3O0FA 2EAPA 1L7NA 3SZ2A 2BCVA 2G08A 4PHDA 3LWMA 1NKBA 2CPRA 2MSNA 4KLOA 3PSIA 2KVCA 2HW3A 3SAFA 2F3NA 5DB6A 3GV7B 1ZQTA 2E5SA 2K8AA 4RQ4A 4RNOA 4I2DA 2ZJ8A 4P0PB 3PV8A 3V7JA 4C4TA 5J0WA 4DL3A 4XQ8A 3C2KA 4NL9A 3T5JA 1XC9A 7ICMA 2HHWA 2ZIVB 3RTVA 3FDSA 4DQPA 2AJQA 1Z00B 3KHHA 1ZQPA 4Z6DA 3OGUA 5ALFA 4ZOHC 4F4YA 4NL9C 4F4XA 1XSPA 3T3FA 4DQIA 4P0QB 4NLBA 1KFDA 4IC9A 4QZCA 1NNLA 2RP5A 2WF7A 4FZNA 1DRGA 1Z4NA 3MGHA 4AYBF 2W8LA 9ICLA 4RQNA 2UVVA 1U45A 5JTIA 2BPFA 3JPNA 1QSSA 2WF5A 1D9DA 3IP4B 4B9NA 4O3NA 5DQIA 2E3TA 2KD1A 1FFUA 1IXRA 5ALUA 5AKIA 1WYGA 1RQLA 2JEIA 3BJYA 3UXNA 2E8NA 3G6YA 2QARA 2BHNA 1ZQSA 2K60A 3AQFA 4UAWA 4UB8U 2C2EA 4ED2A 3H8JA 3AQEA 4R8UA 4YG2A 2GWSA 2I9GA 5KG5A 1L7PA 4ED0A 1N61A 2DUYA 9ICMA 5KT5A 3AL0B 9ICSA 3PMLA 1MQ3A 2GOLA 9ICIA 4Q8FA 4MF2A 1RG6A 2KIWA 1F0MA 1PK1A 3RJKA 5A0LA 5BPCA 3GILA 2EAMA 1TKDA 1ZQGA 2J6SA 5EE9A 1V85A 9ICPA 4CRXA 5CWRA 3T5LA 3H4BA 1SWVA 5L1KA 5C0YA 3BS7A 3C23A 4DSIA 4JUZA 1J97A 4HYKA 1WUDA 2DKZA 4YD2A 1S0VA 3DEEA 4F2RA 1ED1A 4DCCA 2F1HA 4G9BA 4KLMA 4BX9C 4TURA 3PSPA 1QSLA 9ICKA 5AI5A 2AU0A 2W9CB 4ECZA 5L9XA 1DK2A 4ED8A 4O3MA 3SV4A 5HR7A 3IDWA 5KNIA 3M8RA 1RXWA 4JB3A 4DLEA 2HHQA 5KFSA 3OTQA 2F1JA 2HOQA 3ZI4A 3RF9A 4EZ6A 4B6JA 4Q43A 3FM9A 2FMSA 1AQ6A 5ALNA 3BZCA 4C8NA 2BCQA 1JALA 2ATLA 1GO3F 4PGXA 2WHEA 1A0PA 3ED5A 5DGAA 2BQUA 1FFVA 2RRDA 2E1EA 1SL0A 1B22A 3AMZA 3NVZA 2LBOA 2KKPA 4MHVA 5HMMA 4UAVA 1SXDA 2KHQA 4YCXA 5J0RA 5J2GA 3M9MB 4IQUA 2ISOA 2MUTB 1KL9A 3NVWA 3MDAA 4UAYA 4I2BA 2FE9A 4EX6A 4ELVA 5DQHA 2P66A 4K4GA 4QIWF 2AQ0A 3EW9A 4DL7A 4RQ6A 3ORYA 1CRXA 5KT6A 4M9HA 1HIWA 2ZXHA 4DEZA 4NJ8A 1ZQBA 2KICA 4FZMA 1JRPA 1NJYA 1NOMA 1URJA 2AQ4A 5ALJA 4Y2VA 4DSKA 3SENA 2O6KA 1O03A 3N7SC 4NLGA 9ICCA 1B0XA 1XSNA 3PX0A 4DOCA 2FJ6A 1QQ7A 4RU9A 2K8BB 3N97B 2HDOA 4BUGA 5AKZA 1Q3VA 4RQMA 3F5AA 2OHFA 8ICRA 2YMLA 5KT2A 8ICTA 2KEYA 2JZBB 3R9KA 2HVHA 4C80A 5AM5A 5KFEA 5HP4A 3M7DA 4KMOB 1J2NA 2HMXA 8ICPA 4DF4A 2R8JA 3RB3A 2YY6A 2BQRA 5JRTA 4YMNA 5KFKA 4I2FA 4M47A 5KFNA 1KSPA 4CF4A 8ICUA 1ZQ1C 1Y88A 1X9SA 5KFUA 3LDAA 3UM9A 2ZIWA 4J9RA 4BWMA 2F2AB 4RPXA 4R63A 4OJ6A 1X9WA 2RLTA 1M6YA 4Y2RA 3ZDCA 2W3RA 3GIJA 4PH5A 4MFAA 4QZGA 2BCRA 5J0PA 4EX7A 1TK0A 5CB1A 3HWTA 1C20A 3EUB2 1NI3A 4NLZA 2WFAA 1RZTA 4I2JA 3MABA 1SL2A 5J0XA 1FIQA 3ETRA 3NASA 2KV2A 3OSPA 3QUTA 3SAHA 1ZXIA 2HBLA 2AGOA 2ASLA 1SKSA 4KLQA 3EYZA 1KLNA 2G06A 3TFSA 1QQ5A 3RJJA 5KG2A 4C0ZA 5KFCA 2Y9UA 1T8EA 4KLIA 4KX5A 5KAIU 5AK3A 3PX6A 2RQ5A 4O3QA 1LV5A 3GV8B 2MA1A 3PW5A 2W11A 5KT7A 2HOFA 4ECYA 3Q8PB 3BS5A 3EPIA 2VJ4A 2JR5A 1B4FA 4B9MA 2K89A 4YXMA 1S5LU 2Z7JA 2P6RA 5ALQA 4F50A 2OH2A 3H0MB 3OHAA 5BOMA 5B66U 3MR5A 1KEJA 4QZ8A 4R64A 1O08A 4Y2PA 1BNPA 2NRWA 2WF6A 1SV0A 4HAIA 2C28A 2VA3A 3HKZC 2ZUDA 3RR7A 1T3QA 5ALIA 5HNKA 1UT8A 3JPRA 2W04A 1S77D 3QUBA 5J29A 3KZIU 5J2BA 4ZH4A 5KFBA 7ICKA 1SV0C 3TFRA 3WU2U 3V72A 5DB7A 2YX8A 2G09A 1JUDA 1NK7A 4ECTA 4M0AA 3IHQB 1BNOA 4Y2QA 5KT3A 1ZJNA 1NZBA 3KHLA 2FLPA 1RYRA 2IBKA 3UXPA 3F5EA 1JXEA 4YD1A 4CNQA 4FE3A 4DWIA 2M0NA 4RZRA 3JPOA 4GC6A 1FEZA 1LB2B 4DL5A 1NJZA 4F5RA 2XICA 1N5XA 2UVRA 3RFAA 4I2CA 4ECXA 5KFAA 4QJFB 5DG7A 3CW2C 3EWAA 4BJQA 2WAQC 3H8MA 5G5GA 1RYSA 2UVUA 4XUSA 1QSYA 4R66A 5J2CA 3M6KA 2C22A 1X40A 4UB4A 4TUSA 3QU4A 3CP8A 3ZDAA 1N60A 4DOBA 4IRKA 5KL8B 5ALWA 4UB1A 4DL4A 3A0BU 3PZPA 5KG1A 2F1IA 4F72A 5F9NA 3Q8MA 1PVRA 3RB6A 3M1YA 4QZHA 4RNNA 5ALXA 2ZG6A 4JV1A 9ICEA 4OJOA 1ZETA 4QW8A 2PMZC 2NRTA 4YR0A 8ICQA 2KVSA 2CN1A 4PHEA 5DBBA 4ED6A 2BDPA 4Q44A 2HHTA 4RNMA 1ZQEA 3SV3A 3BDPA 1ZQLA 3LYSA 2I1QA 3L3FX 1Z3EB 3CYMA 1KTQA 1PZNA 1JROA 4QIWC 4YP3A 1A76A 2ZJ5A 1SB3C 3HJEA 3PR5B 5ALEA 1TAMA 2C2DA 4DLGA 4ECWA 1P7DA 1TAQA 4TQRA 2K4EA 3Q8QB 1RDFA 4EZ9A 3MGIA 4RPZA 2P6UA 1BPEA 1PK1B 2BGWA 8ICBA 4KLTA 5J2AA 4RQ0A 1NK6A 1RYUA 3ZD9A 2A1JB 4I2EA 4TUQA 3NS1A 4YQWA 3D2QA 2FMQA 3LVWA 4DFKA 2BDUA 2K4PA 1T7PA 3TI0A 4B9TA 5IIKA 1VLBA 3ALRA 2KHVA 4Q8EA 4JWMA 1SIJA 3KKAA 1ZJMA 4Z6FA 2DBYA 1T94A 2ES6A 2XIDA 4IQVA 1ZQDA 4PL1A 2H3FA 2F77X 3MR6A 1DXSA 3KKAC 1BPZA 8ICGA 5G5HA 1UCVA 2YQEA 4ED3A 3SAGA 9ICRA 5DQGA 2PI5A 1IM4A 1X2IA 3E0FA 3H8SA 5DBCA 5ALRA 9ICHA 3C2LA 1FO4A 4F5NA 4G3IA 3B9JA 2XO7A 3D2NA 7ICNA 3RRGA 4KMUA 1YZ6A 2KFZA 1ZQNA 5E79U 4F93B 2XI9A 3F2DA 3KFUF 1KDHA 2W55A 1A6SA 3QEBZ 3AEVA 4UBBA 5KG0A 2NV3A 8ICLA 2PI4A 1C7YA 3MBYA 2BCUA 4CCHA 5EE0A 1ZD2P 2FLNA 3NVVA 1VDVA 4DSJA 1L3UA 1LVHA 3OPXA 7ICJA 3BQ7A 4RQ3A 2H5XA 5KFLA 2HBJA 8ICEA 2W9BA 2PFPA 8ICWA 4B9LA 5L1IA 4M6WA 5KFPA 4Q45A 5DG8A 5DGBA 2QB0A 5AHXA 1TFRA 2KE7A 4YR2A 4M9NA 4J9MA 5J0OA 1SXEA 2ZIXA 4IQWA 4JWNA 3F53A 3OHBA 5H2FU 4DF8A 2B0CA 5ALOA 1Z1BA 3QZ7A 2NYVA 3G6XA 1ZQXA 2MAXA 2JGAA 2Y1IA 1CI4A 4DQQA 4F71A 5DB9A 2PKEA 4BWJA 5HHIA 3HT3A 1F5SA 1NK0A 3NVYA 1Q8KA 4J9KA 2W8KA 2JEGA 2NRZA 1COOA 3N4MB 7ICFA 3H8WA 1KFSA 1PVQA 3GV5B 2VJ5A 3GIKA 2WB1C 3ISDA 2J6TA 2HSZA 3QUCA 3OSNA 4KX3A 2G5HB 3TARA 3HP6A 3RBEA 2ZIWB 4O3PA 1HEKA 3M8SA 7ICVA 3PMNA 4F8RA 3KZXA 4YN4A 4KLFA 1ZQKA 1CEZA 3TANA 2DQNB 1JI7A 3RJHA 1YZ7A 2W54A 4BGDA 8ICZA 1ZQWA 3V7LA 2D3DA 2P35A 1VJ5A 4KITB 5AM4A 1ZQUA 5AI9A 3B0XA 5KFDA 2NO5A 3RR8A 3C1ZA 2IOFA 2W9MA 4JMUA 5KFOA 3RJIA 1K1SA 5KG3A 2NRXA 3Q8RB 2V9WA 2ZIVA 4KLDA 1T3NA 3QE9Y 1BPDA 2PFQA 3N28A 3THVA 1QLNA 4LJXA 2LYHA 3IG8A 2Y0SF 3UXOA 5L1LA 4KLLA 1N2XA 3Q8KA 3IRUA 3BS5B 2I5HA 3K1ZA 1U4BA 1NK9A 4F4KA 3MFIA 1ZQCA 2LYBA 3GIMA 4OD0A 1L8OA 1OXJA 3B0YA 2IMWP 4DFPA 5IIMA 3QU2A 5KFYA 3MFHA 4IR9A 5KFRA 3HW8A 3N7RC 1XNSA 4QWBA 1BPBA 5AK6A 2LKYA 4CE6A 2XY7A 2ASDA 2PFOA 3PSFA 3GDXA 5KFJA 1QH9A 1UHUA 3RJGA 4GLXA 4MEXA 7ICEA 3ZD8A 2W7OA 1T4GA 5IIIA 4EEYA 5GTIU 1KQQA 4Z6CA 4F4ZA 2XCAA 7ICQA 3SEIA 5DLFA 3NTUA 2UVWA 7ICPA 1NJWA 1ZQOA 4I29A 7ICTA 5AICA 3HX0A 4GXIA 1TVAA 2JHDA 2DPIA 4F2SA 1IG6A 4UB2A 4DQSA 4J9SA 2XVTA 2YTUA 3TACB 4GFJA 5KT4A 2V4QA 2M9NA 4RQ1A 3EZ5A 3NRWA 1HUZA 2Q0ZX 3ICXA 2B21A 2I6XA 2YB4A 5K4LA 3ZDDA 1XO1A 2JXJA 4PGQA 2E1FA 4QW9A 8ICJA 3V6JA 3AUOA 4WJ3B 1PUZA 5J2FA 4M9GA 1NKCA 4O0IA 3LVVA 4YVZA 1Z1VA 1COKA 4AYBC 4F4WA 1L3TA 2YMPA 4RPYA 1NKEA 5CR0A 1OUQA 1S0NA 3WKAA 4C8OA 3WKBA 4JK1A 4B9UA 3LK9A 3RJFA 4C8MA 1WCNA 4UARA 2OYYA 3RH6A 3CNHA 4NLCA 2LMRA 2GH1A 5F9LA 5DBAA 5AI0A 4IR1A 4XRHA 2F8LA 2CXYA 3PW4A 2DFLA 2OM6A 4FZLA 1JXLA 8ICSA 5KTQA 2KKVA 3C29A 4J9OA 3ISBA 4CGZA 2K8CB 5CHGA 1KN5A 4C4RA 2LM1A 1S97A 4B9SA 8ICIA 4DFJA 4AP9A 1SZPA 4LVSA 1BPYA 5D4BA 2A1AA 3MR3A 3PW0A 2JRZA 2XCPA 3BZKA 3AN1A 1S0MA 2GO7A 4IL6U 1WG8A 1RQNA 3V6HA 3CRXA 1UA0A 3PW2A 2MUTA 2G0AA 4Y2UA 4GIBA 5EWEA 2Y9TA 4J9PA 2KJ8A 2C2RA 1HUOA 4GXKA 5KFXA 2ZTDA 3MC1A 4NM2A 5L1MA 2VA8A 4FBTA 3UQ2A 4KLEA 2XGQA 1D9FA 5HHHA 1BVSA 3UMBA 3DV9A 4TUPA 2HHSA 1Q46A 5AIAA 2HHVA 1K5OA 1SL1A 5ALSA 2GLEA 1XO0A 5CJ7A 3H7IA 1ZQRA 2L5YA 4UAZA 5KL1B 5AK4A 5KFIA 3H40A 4PHPA 2R18A 3TAPA 2BR0A 4Y2YA 5J2KA 2ZIUA 4PPXA 5AM3A 4I2IA 2QLTA 3WKDA 3NRZA 2FDRA 2EQYA 3RAQA 5EWGA 5AK5A 2FI1A 1S10A 2IHMA 5KFHA 5BOLA 5AI4A 2AH5A 5AKEA 4ECSA 2WTFA 4Y2SA 4K4HA 1ZQVA 3QU9A 9ICWA 2E8OA 3QNMA 4ED1A 3GFKB 1CUKA 2BZFA 2NRVA 3RB0A 3L4PA 4C8LA 3SYZA 3Q8SB 5KFTA 2PXIA 1X9XA 3KTQA 5KFVA 3UMCA 2ESEA 1WWVA 2RHFA 1IV8A 4O3OA 2IOHA 2KZZA 2QARB 3HRDD 3C5GA 2AHOB 4YFKA 3BQ0A 5J0YA 3D2SA 1WCLA 3PVXA 2H3QA 4R8UB 5D49A 2CRXA 1JIHA 4Y2TA 4JV0A 9ICGA 2W9BB 2BQ3A 5IILA 1S8OA 1MC8A 2MRLA 5JUMA 4OCZA 8ICYA 4J03A 2QB0B 3FYHA 4PZNA 2IHNA 1XS9D 5DB8A 5J2HA 4Z6EA 4OJ5A 3PO4A 4RQ2A 3MGVA 7ICRA 1AROP 4OJLA 3VC8A 3BQTA 4O5CA 2ZIXB 3NUQA 5ALMA 3H4DA 2AXTU 4C4SA 2D8CA 1ECWA 4US8A 3F2BA 3U26A 2WF8A 2IOFK 3RB4A 2FPMA 2DKXA 2JH1A 5EOZA 3TADA 5KFZA 5KAFU 4EYHB 3SR6A 2OCEA 4A8EA 1NJXA 2JV3A 1DOQA 2BPCA 4QZFA 4YXJA 2B6GA 2YMQA 1UPHA 9ICQA 3TADC 3N7PD 2N1RA 1QCKA 5KG6A 2ZTCA 4QWAA 3V7KA 1L3SA 5DG9A 1SZHA 4I27A 5J0TA 9ICOA 2ZJAA 2W7PA 3QU5A 4B9VA 5TISU 1L7MA 4RUCA 3H0LB 3K4GA 4C7ZA 3J81j 5KFWA 2ZXIA 3IG5A 5AKXA 3E2EA 4ICAA 1SGGA 5AKJA 1PK3A 2ALZA 4KN4A 4Y2XA 5DDMA 5JU5A 3WK8A 3I76A 4Y2JA 4FS2A 3L5KA 2R8HA 4DFDA 4YMMA 5HMLA 2YMMA 4USAA 4PL2A 4US9A 5J2EA 4U6PA 1MSWD 4J9QA 1V9PA 4TQSA 1ZQZA 3WKEA 5DKWA 3C28A 3C5FA 8ICOA 4FBUA 8ICCA 1DK3A 1MN8A 2KJ5A 1U47A 1NK5A 2OEHA 2XC9A 1U9LA 4QZBA 3PW7A 5IIOA 8ICVA 2LYAA 5AKYA 4OO1J 1L8LA 3GIIA 3MDCA 1U48A 3QYPA 8ICMA 4CF3A 1Z19A 5AIBA 4BXOA 4F91B 2RDIA 2HBKA 4ECUA 1ZQIA 1S9FA 1EXNA 9ICAA 3C1YA 5ALTA 4GC7A 4EENA 1XWLA 2KSOA 4P4MA 8ICAA 3QUQA 1RM6C 2H3VA 3M9NB 4KTQA 3JPPA 3TKAA 2KIVA 1N5WA 1X66A 4RQ5A 1D8LA 4NY8A 3QXGA 5J2DA 5TZVA 3PR4A 5ALLA 2VIXA 2YN4A 2E8MA 2YB1A 1QTMA 1N56A 2HCFA 1LKYA 2NO4A 2W9AA 2FPLA 1X9MA 2DL0A 5ALVA 4DO9A 1K1QA 3QU7A 2H3ZA 3HKZF 4C8KA 2DPJA 1UT5A 4BDPA 1SWWA 1ZQAA 4UB6U 4FFDA 2KZMA 3V6KA 2ZUCA 5ALKA 2EZYA 4ELTA 4O5KA 2KK0A 4FS1A 2HVIA 5KFMA 4E0DA 3RRHA 5AKKA 5CA7A 3WK4A 3WK7A 3OJUA 4O9MA 4KLUA 2KTQA 2A1JA 3SD7A 3QX7A 4MF8A 8ICXA 1OW5A 2V4RA 4EEKA 3KD3A 1L3VA 3RJEA 1X6IA 1D8BA 3GQCA 4KN7A 9ICNA 1NK8A 4P0PA 1N63A 3NGDA 2KFNA 2WAQF 2J6UA 4KLJA 4MFFA 4DS5A 3PX4A 2DGZA 2XGPA 3JPQA 4P2HA 2EZXA 4DFMA 3G6VA 5KFGA 1Z00A 7ICGA 3BQ1A 4MFCA 4I2HA 1KFTA 3IV6A 2F76X 4F92B 4GXJA 4P0QA 3E58A 1PVPA 4PHAA 1D8YA 2Y1JA 3HPOA 2A19A 1SKWA 2W43A 4P4OA 5IIJA 4CDGA 4QWEA 1QQ6A 1YT3A 4DSEA 3WK5A 1NZPA 1KRPA 2KOBA 4EYIB 3UPQA 2R8KA 4MEYA 2ODGA 5J0UA 2PMZF 3JPSA 3I1YA 5KFFA 4QZDA 2VA2A 5DLGA 3Q8LA 2H3IA 5B5EU 1NK4A 2W3SA 2EAOA 3C21A 8ICNA 3FAHA 1JMSA 4I28A 3M9OB 3FC4A 2G5IB 1XU4A 2R8GA 4DL2A 3S6JA 5GTHU 3TQ1A 3RBDA 4UAUA 4JV2A 4UB5A 2XY5A 4IS7A 1V38A 4ECRA 3T5KA 7ICHA 4UATA 4ED7A 3AU2A 1DGJA 5ALYA 1BPXA 1L6NA 5J0QA 2F44A 5IINA 1TE2A 5AKHA 2ZIUB 2AGPA 3SQIA 1BGXT 4ECQA 4M2YA 3WK6A 4DSFA 3ZDBA 2HI0A 2KN7A 3EPGA 1RXVA 3PY8A 2FPKA 5HR6A 4ECVA 5J2JA 2QB1A 2K4HA 4NWIA 1ZRMA 3DDHA 4U7CA 3TAQA 1J2MA 1L7OA 2K4IA 3SMVA 4IRDA 8ICKA 4ACOA 5AI8A 5DDYA 4EELA 3JPTA 1TK5A 4UQGA 3QZ8A 3M6ZA 1N48A 2R8IA 3PSTA 2LM4A 5D46A 3ETLA 2DWQA 4RT3A 4KLGA 1TK8A 3IN5A 3ZDEA 3IM1A 2G07A 3VCBA 4PGYA 3ONNA 1F44A 3WKCA 4DQRA 4DL6A 1TV9A 9ICTA 2KNJA 5CEHA 2W9CA 3C2MA 4ELUA 2XY6A 3RH5A 2JMGA 4RUAA 1A77A 3RH4A 9ICXA 3A0HU 4RQ7A 5AKGA 4M9LA 1ZYQA 2MU2A 5AM2A 4NV0A 3RAXA 1S0OA 5CRXA 4DOAA 1MA7A 1ZQMA 4OJPA 3PO5A 2OWOA 4RT2A 4UBCA 7ICLA 2HHXA 2E8PA 5L1JA 3K75D 2D6FC 4QWDA 1ZOLA 4QZIA 2F8KA 4RQ8A 4EBCA 9ICVA 2KMDA 1ZD4A 2BCSA 8ICHA 4M04A 4QZAA 4C7YA 2LI6A 3HILA 1ZD5A 4LZGA 3UQ0A 2KJ9A 5J2IA 2BKEA 3QEAZ 2PFNA 4QZ9A 2KP7A 3F2CA 5KG7A 5J8YA 4DSLA 3K1RB 5AKLA 2EANA 2HOIA 9ICUA 3BQ2A 4NLKA 4XA5A 7ICOA 1ZQHA 3MR2A 3ISCA 7ICSA 5AM0A 5J8YC 4IRCA 4O5EA 4IQTA 1UQVA 4UASA 7ICIA 2KG5A 4CF5A 2JEFA 5KG4A 4F3OA 3WK9A 1U49A 5ALPA 5EE1A 2EH9A 2WB1F 3PNCA 2HHUA 1S76D 3OJSA 1DGSA 1N62A 2FLLA 2OXOA 3AU6A 3KBBA 2JZBA 2QKQA 1JX4A 4K4IA 4P4PA 1MQ2A 5CP2A 2FMPA 5ALHA 1UA1A 1B43A 1Z4OA 4EBDA 5F3XB 2VANA 9ICJA 4M9JA 1JN3A 1KKXA 2KZ3A 9ICFA 1X6JA 9ICBA 1X42A 2ZTEA 4DS4A 4PZOA 4EBEA 5ALZA 4UW9A 2VKQA 5T14A 2ZUBA 3AM9A 2BPGA 2ISPA 7ICUA 1IIPA 4LZDA 1ZRNA 4KLSA 2W03A 1ZQYA 1L5UA 2IA6A 3H0RB 4BXOB 3SI8A 1ZQFA 1ZQJA 4J9LA 4F5QA 5ALDA 5EWFA 1XSLA 1ZQQA 2Y0SC 4YR3A 2A3VA 4I2GA 2EDUA 3I28A 2JEJA 4NLNA 4PJ0U 2KSOB 4O3SA 3T5HA 5EE3A 2JH7A 4M6WB 2LPEA 2DF4B 4F5OA 5AI6A 5J0SA 1KBUA 5ALGA 1KW4A 1HJPA 2HBMA 1RPLA 4R65A 1WWUA 4F5PA 4FO6A 5AM1A 4O3RA 3UMGA 2RDJA 2Q4TA 3GZFA 5FP0A 4UB3A 3D6JA 4J9NA 2WF9A 8ICFA 1SKRA 1Q3UA 1LKYB 2ASJA 4I2AA 4NM1A 5KFQA 4QNLA 5C5JA 4QZEA 3T79A
chains in the Genus database with same CATH topology
2LM4A 2JR5A 1PUZA 1X6IA 1X6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LM4 A;  2JR5 A;  1PUZ A;  1X6I A;  1X6J A; 
#chains in the Genus database with same CATH topology
 1V97 A;  1ZD3 A;  4YMO A;  4QWC A;  3LWL A;  1SV4 A;  1TAU A;  3KHR A;  3KHG A;  4X5V A;  2AGQ A;  4NXZ A;  3GU3 A;  2EZZ A;  1H38 A;  4KLH A;  3KOO A;  2LHT A;  3O0F A;  2EAP A;  1L7N A;  3SZ2 A;  2BCV A;  2G08 A;  4PHD A;  3LWM A;  1NKB A;  2CPR A;  2MSN A;  4KLO A;  3PSI A;  2KVC A;  2HW3 A;  3SAF A;  2F3N A;  5DB6 A;  3GV7 B;  1ZQT A;  2E5S A;  2K8A A;  4RQ4 A;  4RNO A;  4I2D A;  2ZJ8 A;  4P0P B;  3PV8 A;  3V7J A;  4C4T A;  5J0W A;  4DL3 A;  4XQ8 A;  3C2K A;  4NL9 A;  3T5J A;  1XC9 A;  7ICM A;  2HHW A;  2ZIV B;  3RTV A;  3FDS A;  4DQP A;  2AJQ A;  1Z00 B;  3KHH A;  1ZQP A;  4Z6D A;  3OGU A;  5ALF A;  4ZOH C;  4F4Y A;  4NL9 C;  4F4X A;  1XSP A;  3T3F A;  4DQI A;  4P0Q B;  4NLB A;  1KFD A;  4IC9 A;  4QZC A;  1NNL A;  2RP5 A;  2WF7 A;  4FZN A;  1DRG A;  1Z4N A;  3MGH A;  4AYB F;  2W8L A;  9ICL A;  4RQN A;  2UVV A;  1U45 A;  5JTI A;  2BPF A;  3JPN A;  1QSS A;  2WF5 A;  1D9D A;  3IP4 B;  4B9N A;  4O3N A;  5DQI A;  2E3T A;  2KD1 A;  1FFU A;  1IXR A;  5ALU A;  5AKI A;  1WYG A;  1RQL A;  2JEI A;  3BJY A;  3UXN A;  2E8N A;  3G6Y A;  2QAR A;  2BHN A;  1ZQS A;  2K60 A;  3AQF A;  4UAW A;  4UB8 U;  2C2E A;  4ED2 A;  3H8J A;  3AQE A;  4R8U A;  4YG2 A;  2GWS A;  2I9G A;  5KG5 A;  1L7P A;  4ED0 A;  1N61 A;  2DUY A;  9ICM A;  5KT5 A;  3AL0 B;  9ICS A;  3PML A;  1MQ3 A;  2GOL A;  9ICI A;  4Q8F A;  4MF2 A;  1RG6 A;  2KIW A;  1F0M A;  1PK1 A;  3RJK A;  5A0L A;  5BPC A;  3GIL A;  2EAM A;  1TKD A;  1ZQG A;  2J6S A;  5EE9 A;  1V85 A;  9ICP A;  4CRX A;  5CWR A;  3T5L A;  3H4B A;  1SWV A;  5L1K A;  5C0Y A;  3BS7 A;  3C23 A;  4DSI A;  4JUZ A;  1J97 A;  4HYK A;  1WUD A;  2DKZ A;  4YD2 A;  1S0V A;  3DEE A;  4F2R A;  1ED1 A;  4DCC A;  2F1H A;  4G9B A;  4KLM A;  4BX9 C;  4TUR A;  3PSP A;  1QSL A;  9ICK A;  5AI5 A;  2AU0 A;  2W9C B;  4ECZ A;  5L9X A;  1DK2 A;  4ED8 A;  4O3M A;  3SV4 A;  5HR7 A;  3IDW A;  5KNI A;  3M8R A;  1RXW A;  4JB3 A;  4DLE A;  2HHQ A;  5KFS A;  3OTQ A;  2F1J A;  2HOQ A;  3ZI4 A;  3RF9 A;  4EZ6 A;  4B6J A;  4Q43 A;  3FM9 A;  2FMS A;  1AQ6 A;  5ALN A;  3BZC A;  4C8N A;  2BCQ A;  1JAL A;  2ATL A;  1GO3 F;  4PGX A;  2WHE A;  1A0P A;  3ED5 A;  5DGA A;  2BQU A;  1FFV A;  2RRD A;  2E1E A;  1SL0 A;  1B22 A;  3AMZ A;  3NVZ A;  2LBO A;  2KKP A;  4MHV A;  5HMM A;  4UAV A;  1SXD A;  2KHQ A;  4YCX A;  5J0R A;  5J2G A;  3M9M B;  4IQU A;  2ISO A;  2MUT B;  1KL9 A;  3NVW A;  3MDA A;  4UAY A;  4I2B A;  2FE9 A;  4EX6 A;  4ELV A;  5DQH A;  2P66 A;  4K4G A;  4QIW F;  2AQ0 A;  3EW9 A;  4DL7 A;  4RQ6 A;  3ORY A;  1CRX A;  5KT6 A;  4M9H A;  1HIW A;  2ZXH A;  4DEZ A;  4NJ8 A;  1ZQB A;  2KIC A;  4FZM A;  1JRP A;  1NJY A;  1NOM A;  1URJ A;  2AQ4 A;  5ALJ A;  4Y2V A;  4DSK A;  3SEN A;  2O6K A;  1O03 A;  3N7S C;  4NLG A;  9ICC A;  1B0X A;  1XSN A;  3PX0 A;  4DOC A;  2FJ6 A;  1QQ7 A;  4RU9 A;  2K8B B;  3N97 B;  2HDO A;  4BUG A;  5AKZ A;  1Q3V A;  4RQM A;  3F5A A;  2OHF A;  8ICR A;  2YML A;  5KT2 A;  8ICT A;  2KEY A;  2JZB B;  3R9K A;  2HVH A;  4C80 A;  5AM5 A;  5KFE A;  5HP4 A;  3M7D A;  4KMO B;  1J2N A;  2HMX A;  8ICP A;  4DF4 A;  2R8J A;  3RB3 A;  2YY6 A;  2BQR A;  5JRT A;  4YMN A;  5KFK A;  4I2F A;  4M47 A;  5KFN A;  1KSP A;  4CF4 A;  8ICU A;  1ZQ1 C;  1Y88 A;  1X9S A;  5KFU A;  3LDA A;  3UM9 A;  2ZIW A;  4J9R A;  4BWM A;  2F2A B;  4RPX A;  4R63 A;  4OJ6 A;  1X9W A;  2RLT A;  1M6Y A;  4Y2R A;  3ZDC A;  2W3R A;  3GIJ A;  4PH5 A;  4MFA A;  4QZG A;  2BCR A;  5J0P A;  4EX7 A;  1TK0 A;  5CB1 A;  3HWT A;  1C20 A;  3EUB 2;  1NI3 A;  4NLZ A;  2WFA A;  1RZT A;  4I2J A;  3MAB A;  1SL2 A;  5J0X A;  1FIQ A;  3ETR A;  3NAS A;  2KV2 A;  3OSP A;  3QUT A;  3SAH A;  1ZXI A;  2HBL A;  2AGO A;  2ASL A;  1SKS A;  4KLQ A;  3EYZ A;  1KLN A;  2G06 A;  3TFS A;  1QQ5 A;  3RJJ A;  5KG2 A;  4C0Z A;  5KFC A;  2Y9U A;  1T8E A;  4KLI A;  4KX5 A;  5KAI U;  5AK3 A;  3PX6 A;  2RQ5 A;  4O3Q A;  1LV5 A;  3GV8 B;  2MA1 A;  3PW5 A;  2W11 A;  5KT7 A;  2HOF A;  4ECY A;  3Q8P B;  3BS5 A;  3EPI A;  2VJ4 A;  2JR5 A;  1B4F A;  4B9M A;  2K89 A;  4YXM A;  1S5L U;  2Z7J A;  2P6R A;  5ALQ A;  4F50 A;  2OH2 A;  3H0M B;  3OHA A;  5BOM A;  5B66 U;  3MR5 A;  1KEJ A;  4QZ8 A;  4R64 A;  1O08 A;  4Y2P A;  1BNP A;  2NRW A;  2WF6 A;  1SV0 A;  4HAI A;  2C28 A;  2VA3 A;  3HKZ C;  2ZUD A;  3RR7 A;  1T3Q A;  5ALI A;  5HNK A;  1UT8 A;  3JPR A;  2W04 A;  1S77 D;  3QUB A;  5J29 A;  3KZI U;  5J2B A;  4ZH4 A;  5KFB A;  7ICK A;  1SV0 C;  3TFR A;  3WU2 U;  3V72 A;  5DB7 A;  2YX8 A;  2G09 A;  1JUD A;  1NK7 A;  4ECT A;  4M0A A;  3IHQ B;  1BNO A;  4Y2Q A;  5KT3 A;  1ZJN A;  1NZB A;  3KHL A;  2FLP A;  1RYR A;  2IBK A;  3UXP A;  3F5E A;  1JXE A;  4YD1 A;  4CNQ A;  4FE3 A;  4DWI A;  2M0N A;  4RZR A;  3JPO A;  4GC6 A;  1FEZ A;  1LB2 B;  4DL5 A;  1NJZ A;  4F5R A;  2XIC A;  1N5X A;  2UVR A;  3RFA A;  4I2C A;  4ECX A;  5KFA A;  4QJF B;  5DG7 A;  3CW2 C;  3EWA A;  4BJQ A;  2WAQ C;  3H8M A;  5G5G A;  1RYS A;  2UVU A;  4XUS A;  1QSY A;  4R66 A;  5J2C A;  3M6K A;  2C22 A;  1X40 A;  4UB4 A;  4TUS A;  3QU4 A;  3CP8 A;  3ZDA A;  1N60 A;  4DOB A;  4IRK A;  5KL8 B;  5ALW A;  4UB1 A;  4DL4 A;  3A0B U;  3PZP A;  5KG1 A;  2F1I A;  4F72 A;  5F9N A;  3Q8M A;  1PVR A;  3RB6 A;  3M1Y A;  4QZH A;  4RNN A;  5ALX A;  2ZG6 A;  4JV1 A;  9ICE A;  4OJO A;  1ZET A;  4QW8 A;  2PMZ C;  2NRT A;  4YR0 A;  8ICQ A;  2KVS A;  2CN1 A;  4PHE A;  5DBB A;  4ED6 A;  2BDP A;  4Q44 A;  2HHT A;  4RNM A;  1ZQE A;  3SV3 A;  3BDP A;  1ZQL A;  3LYS A;  2I1Q A;  3L3F X;  1Z3E B;  3CYM A;  1KTQ A;  1PZN A;  1JRO A;  4QIW C;  4YP3 A;  1A76 A;  2ZJ5 A;  1SB3 C;  3HJE A;  3PR5 B;  5ALE A;  1TAM A;  2C2D A;  4DLG A;  4ECW A;  1P7D A;  1TAQ A;  4TQR A;  2K4E A;  3Q8Q B;  1RDF A;  4EZ9 A;  3MGI A;  4RPZ A;  2P6U A;  1BPE A;  1PK1 B;  2BGW A;  8ICB A;  4KLT A;  5J2A A;  4RQ0 A;  1NK6 A;  1RYU A;  3ZD9 A;  2A1J B;  4I2E A;  4TUQ A;  3NS1 A;  4YQW A;  3D2Q A;  2FMQ A;  3LVW A;  4DFK A;  2BDU A;  2K4P A;  1T7P A;  3TI0 A;  4B9T A;  5IIK A;  1VLB A;  3ALR A;  2KHV A;  4Q8E A;  4JWM A;  1SIJ A;  3KKA A;  1ZJM A;  4Z6F A;  2DBY A;  1T94 A;  2ES6 A;  2XID A;  4IQV A;  1ZQD A;  4PL1 A;  2H3F A;  2F77 X;  3MR6 A;  1DXS A;  3KKA C;  1BPZ A;  8ICG A;  5G5H A;  1UCV A;  2YQE A;  4ED3 A;  3SAG A;  9ICR A;  5DQG A;  2PI5 A;  1IM4 A;  1X2I A;  3E0F A;  3H8S A;  5DBC A;  5ALR A;  9ICH A;  3C2L A;  1FO4 A;  4F5N A;  4G3I A;  3B9J A;  2XO7 A;  3D2N A;  7ICN A;  3RRG A;  4KMU A;  1YZ6 A;  2KFZ A;  1ZQN A;  5E79 U;  4F93 B;  2XI9 A;  3F2D A;  3KFU F;  1KDH A;  2W55 A;  1A6S A;  3QEB Z;  3AEV A;  4UBB A;  5KG0 A;  2NV3 A;  8ICL A;  2PI4 A;  1C7Y A;  3MBY A;  2BCU A;  4CCH A;  5EE0 A;  1ZD2 P;  2FLN A;  3NVV A;  1VDV A;  4DSJ A;  1L3U A;  1LVH A;  3OPX A;  7ICJ A;  3BQ7 A;  4RQ3 A;  2H5X A;  5KFL A;  2HBJ A;  8ICE A;  2W9B A;  2PFP A;  8ICW A;  4B9L A;  5L1I A;  4M6W A;  5KFP A;  4Q45 A;  5DG8 A;  5DGB A;  2QB0 A;  5AHX A;  1TFR A;  2KE7 A;  4YR2 A;  4M9N A;  4J9M A;  5J0O A;  1SXE A;  2ZIX A;  4IQW A;  4JWN A;  3F53 A;  3OHB A;  5H2F U;  4DF8 A;  2B0C A;  5ALO A;  1Z1B A;  3QZ7 A;  2NYV A;  3G6X A;  1ZQX A;  2MAX A;  2JGA A;  2Y1I A;  1CI4 A;  4DQQ A;  4F71 A;  5DB9 A;  2PKE A;  4BWJ A;  5HHI A;  3HT3 A;  1F5S A;  1NK0 A;  3NVY A;  1Q8K A;  4J9K A;  2W8K A;  2JEG A;  2NRZ A;  1COO A;  3N4M B;  7ICF A;  3H8W A;  1KFS A;  1PVQ A;  3GV5 B;  2VJ5 A;  3GIK A;  2WB1 C;  3ISD A;  2J6T A;  2HSZ A;  3QUC A;  3OSN A;  4KX3 A;  2G5H B;  3TAR A;  3HP6 A;  3RBE A;  2ZIW B;  4O3P A;  1HEK A;  3M8S A;  7ICV A;  3PMN A;  4F8R A;  3KZX A;  4YN4 A;  4KLF A;  1ZQK A;  1CEZ A;  3TAN A;  2DQN B;  1JI7 A;  3RJH A;  1YZ7 A;  2W54 A;  4BGD A;  8ICZ A;  1ZQW A;  3V7L A;  2D3D A;  2P35 A;  1VJ5 A;  4KIT B;  5AM4 A;  1ZQU A;  5AI9 A;  3B0X A;  5KFD A;  2NO5 A;  3RR8 A;  3C1Z A;  2IOF A;  2W9M A;  4JMU A;  5KFO A;  3RJI A;  1K1S A;  5KG3 A;  2NRX A;  3Q8R B;  2V9W A;  2ZIV A;  4KLD A;  1T3N A;  3QE9 Y;  1BPD A;  2PFQ A;  3N28 A;  3THV A;  1QLN A;  4LJX A;  2LYH A;  3IG8 A;  2Y0S F;  3UXO A;  5L1L A;  4KLL A;  1N2X A;  3Q8K A;  3IRU A;  3BS5 B;  2I5H A;  3K1Z A;  1U4B A;  1NK9 A;  4F4K A;  3MFI A;  1ZQC A;  2LYB A;  3GIM A;  4OD0 A;  1L8O A;  1OXJ A;  3B0Y A;  2IMW P;  4DFP A;  5IIM A;  3QU2 A;  5KFY A;  3MFH A;  4IR9 A;  5KFR A;  3HW8 A;  3N7R C;  1XNS A;  4QWB A;  1BPB A;  5AK6 A;  2LKY A;  4CE6 A;  2XY7 A;  2ASD A;  2PFO A;  3PSF A;  3GDX A;  5KFJ A;  1QH9 A;  1UHU A;  3RJG A;  4GLX A;  4MEX A;  7ICE A;  3ZD8 A;  2W7O A;  1T4G A;  5III A;  4EEY A;  5GTI U;  1KQQ A;  4Z6C A;  4F4Z A;  2XCA A;  7ICQ A;  3SEI A;  5DLF A;  3NTU A;  2UVW A;  7ICP A;  1NJW A;  1ZQO A;  4I29 A;  7ICT A;  5AIC A;  3HX0 A;  4GXI A;  1TVA A;  2JHD A;  2DPI A;  4F2S A;  1IG6 A;  4UB2 A;  4DQS A;  4J9S A;  2XVT A;  2YTU A;  3TAC B;  4GFJ A;  5KT4 A;  2V4Q A;  2M9N A;  4RQ1 A;  3EZ5 A;  3NRW A;  1HUZ A;  2Q0Z X;  3ICX A;  2B21 A;  2I6X A;  2YB4 A;  5K4L A;  3ZDD A;  1XO1 A;  2JXJ A;  4PGQ A;  2E1F A;  4QW9 A;  8ICJ A;  3V6J A;  3AUO A;  4WJ3 B;  1PUZ A;  5J2F A;  4M9G A;  1NKC A;  4O0I A;  3LVV A;  4YVZ A;  1Z1V A;  1COK A;  4AYB C;  4F4W A;  1L3T A;  2YMP A;  4RPY A;  1NKE A;  5CR0 A;  1OUQ A;  1S0N A;  3WKA A;  4C8O A;  3WKB A;  4JK1 A;  4B9U A;  3LK9 A;  3RJF A;  4C8M A;  1WCN A;  4UAR A;  2OYY A;  3RH6 A;  3CNH A;  4NLC A;  2LMR A;  2GH1 A;  5F9L A;  5DBA A;  5AI0 A;  4IR1 A;  4XRH A;  2F8L A;  2CXY A;  3PW4 A;  2DFL A;  2OM6 A;  4FZL A;  1JXL A;  8ICS A;  5KTQ A;  2KKV A;  3C29 A;  4J9O A;  3ISB A;  4CGZ A;  2K8C B;  5CHG A;  1KN5 A;  4C4R A;  2LM1 A;  1S97 A;  4B9S A;  8ICI A;  4DFJ A;  4AP9 A;  1SZP A;  4LVS A;  1BPY A;  5D4B A;  2A1A A;  3MR3 A;  3PW0 A;  2JRZ A;  2XCP A;  3BZK A;  3AN1 A;  1S0M A;  2GO7 A;  4IL6 U;  1WG8 A;  1RQN A;  3V6H A;  3CRX A;  1UA0 A;  3PW2 A;  2MUT A;  2G0A A;  4Y2U A;  4GIB A;  5EWE A;  2Y9T A;  4J9P A;  2KJ8 A;  2C2R A;  1HUO A;  4GXK A;  5KFX A;  2ZTD A;  3MC1 A;  4NM2 A;  5L1M A;  2VA8 A;  4FBT A;  3UQ2 A;  4KLE A;  2XGQ A;  1D9F A;  5HHH A;  1BVS A;  3UMB A;  3DV9 A;  4TUP A;  2HHS A;  1Q46 A;  5AIA A;  2HHV A;  1K5O A;  1SL1 A;  5ALS A;  2GLE A;  1XO0 A;  5CJ7 A;  3H7I A;  1ZQR A;  2L5Y A;  4UAZ A;  5KL1 B;  5AK4 A;  5KFI A;  3H40 A;  4PHP A;  2R18 A;  3TAP A;  2BR0 A;  4Y2Y A;  5J2K A;  2ZIU A;  4PPX A;  5AM3 A;  4I2I A;  2QLT A;  3WKD A;  3NRZ A;  2FDR A;  2EQY A;  3RAQ A;  5EWG A;  5AK5 A;  2FI1 A;  1S10 A;  2IHM A;  5KFH A;  5BOL A;  5AI4 A;  2AH5 A;  5AKE A;  4ECS A;  2WTF A;  4Y2S A;  4K4H A;  1ZQV A;  3QU9 A;  9ICW A;  2E8O A;  3QNM A;  4ED1 A;  3GFK B;  1CUK A;  2BZF A;  2NRV A;  3RB0 A;  3L4P A;  4C8L A;  3SYZ A;  3Q8S B;  5KFT A;  2PXI A;  1X9X A;  3KTQ A;  5KFV A;  3UMC A;  2ESE A;  1WWV A;  2RHF A;  1IV8 A;  4O3O A;  2IOH A;  2KZZ A;  2QAR B;  3HRD D;  3C5G A;  2AHO B;  4YFK A;  3BQ0 A;  5J0Y A;  3D2S A;  1WCL A;  3PVX A;  2H3Q A;  4R8U B;  5D49 A;  2CRX A;  1JIH A;  4Y2T A;  4JV0 A;  9ICG A;  2W9B B;  2BQ3 A;  5IIL A;  1S8O A;  1MC8 A;  2MRL A;  5JUM A;  4OCZ A;  8ICY A;  4J03 A;  2QB0 B;  3FYH A;  4PZN A;  2IHN A;  1XS9 D;  5DB8 A;  5J2H A;  4Z6E A;  4OJ5 A;  3PO4 A;  4RQ2 A;  3MGV A;  7ICR A;  1ARO P;  4OJL A;  3VC8 A;  3BQT A;  4O5C A;  2ZIX B;  3NUQ A;  5ALM A;  3H4D A;  2AXT U;  4C4S A;  2D8C A;  1ECW A;  4US8 A;  3F2B A;  3U26 A;  2WF8 A;  2IOF K;  3RB4 A;  2FPM A;  2DKX A;  2JH1 A;  5EOZ A;  3TAD A;  5KFZ A;  5KAF U;  4EYH B;  3SR6 A;  2OCE A;  4A8E A;  1NJX A;  2JV3 A;  1DOQ A;  2BPC A;  4QZF A;  4YXJ A;  2B6G A;  2YMQ A;  1UPH A;  9ICQ A;  3TAD C;  3N7P D;  2N1R A;  1QCK A;  5KG6 A;  2ZTC A;  4QWA A;  3V7K A;  1L3S A;  5DG9 A;  1SZH A;  4I27 A;  5J0T A;  9ICO A;  2ZJA A;  2W7P A;  3QU5 A;  4B9V A;  5TIS U;  1L7M A;  4RUC A;  3H0L B;  3K4G A;  4C7Z A;  3J81 j;  5KFW A;  2ZXI A;  3IG5 A;  5AKX A;  3E2E A;  4ICA A;  1SGG A;  5AKJ A;  1PK3 A;  2ALZ A;  4KN4 A;  4Y2X A;  5DDM A;  5JU5 A;  3WK8 A;  3I76 A;  4Y2J A;  4FS2 A;  3L5K A;  2R8H A;  4DFD A;  4YMM A;  5HML A;  2YMM A;  4USA A;  4PL2 A;  4US9 A;  5J2E A;  4U6P A;  1MSW D;  4J9Q A;  1V9P A;  4TQS A;  1ZQZ A;  3WKE A;  5DKW A;  3C28 A;  3C5F A;  8ICO A;  4FBU A;  8ICC A;  1DK3 A;  1MN8 A;  2KJ5 A;  1U47 A;  1NK5 A;  2OEH A;  2XC9 A;  1U9L A;  4QZB A;  3PW7 A;  5IIO A;  8ICV A;  2LYA A;  5AKY A;  4OO1 J;  1L8L A;  3GII A;  3MDC A;  1U48 A;  3QYP A;  8ICM A;  4CF3 A;  1Z19 A;  5AIB A;  4BXO A;  4F91 B;  2RDI A;  2HBK A;  4ECU A;  1ZQI A;  1S9F A;  1EXN A;  9ICA A;  3C1Y A;  5ALT A;  4GC7 A;  4EEN A;  1XWL A;  2KSO A;  4P4M A;  8ICA A;  3QUQ A;  1RM6 C;  2H3V A;  3M9N B;  4KTQ A;  3JPP A;  3TKA A;  2KIV A;  1N5W A;  1X66 A;  4RQ5 A;  1D8L A;  4NY8 A;  3QXG A;  5J2D A;  5TZV A;  3PR4 A;  5ALL A;  2VIX A;  2YN4 A;  2E8M A;  2YB1 A;  1QTM A;  1N56 A;  2HCF A;  1LKY A;  2NO4 A;  2W9A A;  2FPL A;  1X9M A;  2DL0 A;  5ALV A;  4DO9 A;  1K1Q A;  3QU7 A;  2H3Z A;  3HKZ F;  4C8K A;  2DPJ A;  1UT5 A;  4BDP A;  1SWW A;  1ZQA A;  4UB6 U;  4FFD A;  2KZM A;  3V6K A;  2ZUC A;  5ALK A;  2EZY A;  4ELT A;  4O5K A;  2KK0 A;  4FS1 A;  2HVI A;  5KFM A;  4E0D A;  3RRH A;  5AKK A;  5CA7 A;  3WK4 A;  3WK7 A;  3OJU A;  4O9M A;  4KLU A;  2KTQ A;  2A1J A;  3SD7 A;  3QX7 A;  4MF8 A;  8ICX A;  1OW5 A;  2V4R A;  4EEK A;  3KD3 A;  1L3V A;  3RJE A;  1X6I A;  1D8B A;  3GQC A;  4KN7 A;  9ICN A;  1NK8 A;  4P0P A;  1N63 A;  3NGD A;  2KFN A;  2WAQ F;  2J6U A;  4KLJ A;  4MFF A;  4DS5 A;  3PX4 A;  2DGZ A;  2XGP A;  3JPQ A;  4P2H A;  2EZX A;  4DFM A;  3G6V A;  5KFG A;  1Z00 A;  7ICG A;  3BQ1 A;  4MFC A;  4I2H A;  1KFT A;  3IV6 A;  2F76 X;  4F92 B;  4GXJ A;  4P0Q A;  3E58 A;  1PVP A;  4PHA A;  1D8Y A;  2Y1J A;  3HPO A;  2A19 A;  1SKW A;  2W43 A;  4P4O A;  5IIJ A;  4CDG A;  4QWE A;  1QQ6 A;  1YT3 A;  4DSE A;  3WK5 A;  1NZP A;  1KRP A;  2KOB A;  4EYI B;  3UPQ A;  2R8K A;  4MEY A;  2ODG A;  5J0U A;  2PMZ F;  3JPS A;  3I1Y A;  5KFF A;  4QZD A;  2VA2 A;  5DLG A;  3Q8L A;  2H3I A;  5B5E U;  1NK4 A;  2W3S A;  2EAO A;  3C21 A;  8ICN A;  3FAH A;  1JMS A;  4I28 A;  3M9O B;  3FC4 A;  2G5I B;  1XU4 A;  2R8G A;  4DL2 A;  3S6J A;  5GTH U;  3TQ1 A;  3RBD A;  4UAU A;  4JV2 A;  4UB5 A;  2XY5 A;  4IS7 A;  1V38 A;  4ECR A;  3T5K A;  7ICH A;  4UAT A;  4ED7 A;  3AU2 A;  1DGJ A;  5ALY A;  1BPX A;  1L6N A;  5J0Q A;  2F44 A;  5IIN A;  1TE2 A;  5AKH A;  2ZIU B;  2AGP A;  3SQI A;  1BGX T;  4ECQ A;  4M2Y A;  3WK6 A;  4DSF A;  3ZDB A;  2HI0 A;  2KN7 A;  3EPG A;  1RXV A;  3PY8 A;  2FPK A;  5HR6 A;  4ECV A;  5J2J A;  2QB1 A;  2K4H A;  4NWI A;  1ZRM A;  3DDH A;  4U7C A;  3TAQ A;  1J2M A;  1L7O A;  2K4I A;  3SMV A;  4IRD A;  8ICK A;  4ACO A;  5AI8 A;  5DDY A;  4EEL A;  3JPT A;  1TK5 A;  4UQG A;  3QZ8 A;  3M6Z A;  1N48 A;  2R8I A;  3PST A;  2LM4 A;  5D46 A;  3ETL A;  2DWQ A;  4RT3 A;  4KLG A;  1TK8 A;  3IN5 A;  3ZDE A;  3IM1 A;  2G07 A;  3VCB A;  4PGY A;  3ONN A;  1F44 A;  3WKC A;  4DQR A;  4DL6 A;  1TV9 A;  9ICT A;  2KNJ A;  5CEH A;  2W9C A;  3C2M A;  4ELU A;  2XY6 A;  3RH5 A;  2JMG A;  4RUA A;  1A77 A;  3RH4 A;  9ICX A;  3A0H U;  4RQ7 A;  5AKG A;  4M9L A;  1ZYQ A;  2MU2 A;  5AM2 A;  4NV0 A;  3RAX A;  1S0O A;  5CRX A;  4DOA A;  1MA7 A;  1ZQM A;  4OJP A;  3PO5 A;  2OWO A;  4RT2 A;  4UBC A;  7ICL A;  2HHX A;  2E8P A;  5L1J A;  3K75 D;  2D6F C;  4QWD A;  1ZOL A;  4QZI A;  2F8K A;  4RQ8 A;  4EBC A;  9ICV A;  2KMD A;  1ZD4 A;  2BCS A;  8ICH A;  4M04 A;  4QZA A;  4C7Y A;  2LI6 A;  3HIL A;  1ZD5 A;  4LZG A;  3UQ0 A;  2KJ9 A;  5J2I A;  2BKE A;  3QEA Z;  2PFN A;  4QZ9 A;  2KP7 A;  3F2C A;  5KG7 A;  5J8Y A;  4DSL A;  3K1R B;  5AKL A;  2EAN A;  2HOI A;  9ICU A;  3BQ2 A;  4NLK A;  4XA5 A;  7ICO A;  1ZQH A;  3MR2 A;  3ISC A;  7ICS A;  5AM0 A;  5J8Y C;  4IRC A;  4O5E A;  4IQT A;  1UQV A;  4UAS A;  7ICI A;  2KG5 A;  4CF5 A;  2JEF A;  5KG4 A;  4F3O A;  3WK9 A;  1U49 A;  5ALP A;  5EE1 A;  2EH9 A;  2WB1 F;  3PNC A;  2HHU A;  1S76 D;  3OJS A;  1DGS A;  1N62 A;  2FLL A;  2OXO A;  3AU6 A;  3KBB A;  2JZB A;  2QKQ A;  1JX4 A;  4K4I A;  4P4P A;  1MQ2 A;  5CP2 A;  2FMP A;  5ALH A;  1UA1 A;  1B43 A;  1Z4O A;  4EBD A;  5F3X B;  2VAN A;  9ICJ A;  4M9J A;  1JN3 A;  1KKX A;  2KZ3 A;  9ICF A;  1X6J A;  9ICB A;  1X42 A;  2ZTE A;  4DS4 A;  4PZO A;  4EBE A;  5ALZ A;  4UW9 A;  2VKQ A;  5T14 A;  2ZUB A;  3AM9 A;  2BPG A;  2ISP A;  7ICU A;  1IIP A;  4LZD A;  1ZRN A;  4KLS A;  2W03 A;  1ZQY A;  1L5U A;  2IA6 A;  3H0R B;  4BXO B;  3SI8 A;  1ZQF A;  1ZQJ A;  4J9L A;  4F5Q A;  5ALD A;  5EWF A;  1XSL A;  1ZQQ A;  2Y0S C;  4YR3 A;  2A3V A;  4I2G A;  2EDU A;  3I28 A;  2JEJ A;  4NLN A;  4PJ0 U;  2KSO B;  4O3S A;  3T5H A;  5EE3 A;  2JH7 A;  4M6W B;  2LPE A;  2DF4 B;  4F5O A;  5AI6 A;  5J0S A;  1KBU A;  5ALG A;  1KW4 A;  1HJP A;  2HBM A;  1RPL A;  4R65 A;  1WWU A;  4F5P A;  4FO6 A;  5AM1 A;  4O3R A;  3UMG A;  2RDJ A;  2Q4T A;  3GZF A;  5FP0 A;  4UB3 A;  3D6J A;  4J9N A;  2WF9 A;  8ICF A;  1SKR A;  1Q3U A;  1LKY B;  2ASJ A;  4I2A A;  4NM1 A;  5KFQ A;  4QNL A;  5C5J A;  4QZE A;  3T79 A; 
#chains in the Genus database with same CATH homology
 2LM4 A;  2JR5 A;  1PUZ A;  1X6I A;  1X6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...