1X6JA

Crystal structure of ygfy from escherichia coli
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
88
structure length
88
Chain Sequence
b'MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGKPADAELEMMVRLIQTRNRERGPVAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ygfY
publication title Crystal structure of the YgfY from Escherichia coli, a protein that may be involved in transcriptional regulation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 37
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 1x6jA00
1PUZA 2LM4A 2JR5A 1X6JA 1X6IA
chains in the Genus database with same CATH superfamily
3GZFA 4ACOA 1WG8A 8ICTA 5ALWA 2OM6A 2NRWA 2FDRA 2KN7A 2KNJA 3KBBA 2QARB 5DLFA 2K4HA 2Y9TA 3H8WA 2JH7A 3M9NB 3C1ZA 4IQWA 3H0LB 5CB1A 2JEIA 4PGYA 1KTQA 1BPDA 4CRXA 8ICXA 2FE9A 5AKYA 1SV0C 2AJQA 3FC4A 4AYBC 2YY6A 4J03A 1DGSA 7ICPA 4I2IA 1HJPA 1XC9A 4DLGA 3T3FA 9ICNA 3HKZC 9ICUA 5AM0A 4ECQA 4PHEA 2GWSA 5AKZA 2VKQA 2P6UA 3AUOA 4ECYA 2DF4B 2MRLA 4DWIA 4YP3A 4F3OA 2ZUDA 5BPCA 3KKAC 3PR4A 3H7IA 3ALRA 4O3QA 3A0BU 5J2IA 5KT7A 4F2RA 5L1JA 4DCCA 3QUQA 1F44A 1NKEA 2E1FA 2B6GA 4OJPA 1H38A 3IP4B 2H3IA 5HHHA 9ICAA 5HR6A 1JROA 2V4RA 1YZ6A 3MGIA 4KLUA 5IIKA 5KG1A 3RTVA 4BXOB 5KAIU 3RH4A 1S0VA 4KLTA 5IIJA 2B0CA 3IN5A 5KAFU 4PPXA 5AI5A 4PL2A 5ALUA 5A0LA 1B0XA 4DO9A 2AXTU 7ICOA 1X6IA 3K4GA 5DG7A 2XY7A 4UAUA 2MUTB 3NVWA 7ICGA 2BCQA 2NRZA 1N62A 1NK7A 3PMLA 2LYAA 1ZD5A 1L5UA 2K4PA 3S6JA 3SI8A 4I2AA 9ICPA 1OW5A 1S76D 2YB4A 3G6VA 1ZOLA 1ZRNA 3FYHA 2K4IA 1UPHA 4OJLA 1NK4A 1X9XA 5KFRA 1IM4A 1T4GA 4R63A 1EXNA 2FPMA 3IG5A 9ICHA 2W7PA 1K1QA 5AKXA 2HSZA 3C5GA 4US8A 2M9NA 5ALEA 1UCVA 5EE0A 5DB8A 3RF9A 2K8AA 1L3SA 3U26A 5CHGA 4IR1A 1Z4OA 3PSIA 4LZDA 4Y2XA 1RQLA 3R9KA 4UB8U 5FP0A 2BCSA 4DQIA 3OHBA 2EZYA 4C7ZA 3WKAA 4JK1A 4JUZA 4RQ0A 3V7KA 5H2FU 2ISOA 1RZTA 4O3RA 4RUAA 3WK7A 3SZ2A 3NVVA 1SV4A 5EWEA 3H8JA 2XGQA 3M8SA 2YQEA 2FMPA 5F9NA 4UAWA 2FI1A 4KLGA 1U9LA 4DSJA 4Y2YA 1KW4A 2QB1A 4O3SA 4YD1A 9ICSA 3O0FA 1SL2A 2VA8A 2RHFA 3KTQA 3F2BA 2HHVA 1ZQZA 4JB3A 5AK3A 3C2LA 4DSEA 1M6YA 3MABA 5EWFA 4B9SA 2W7OA 1C20A 3AM9A 2FMSA 8ICVA 3MC1A 4TUPA 4DQSA 1RYSA 2BPCA 2F77X 3V6JA 2LYHA 2KFZA 2HHQA 4NLCA 4KN7A 1LB2B 1JIHA 1SXDA 1XU4A 1IV8A 3H4DA 2ASDA 8ICKA 3AU6A 4F8RA 5CEHA 5L1MA 2KP7A 2K60A 5E79U 5J0RA 2KKVA 4R8UB 4ECVA 4E0DA 2RLTA 2VA3A 3Q8KA 1PK3A 3KHRA 1JX4A 4GXJA 1O08A 4KTQA 1X40A 3RRHA 2W04A 2DQNB 3V7LA 2A3VA 2ZIVA 2GLEA 2K4EA 8ICNA 3QUBA 1PK1B 2FPKA 2K89A 7ICNA 2DL0A 1QTMA 2UVVA 3TAPA 2E8MA 1ZD3A 5KFEA 3TADC 1J2NA 2R8JA 4F5OA 1BGXT 3RJIA 5KFYA 2XGPA 4X5VA 4QZBA 5F9LA 4J9KA 4F5RA 2O6KA 1X42A 3E2EA 2EAMA 5AKGA 7ICFA 1XS9D 4FZMA 1XSNA 2M0NA 2XCPA 4NM2A 3ISBA 4QWAA 1HIWA 2JEGA 4DS5A 5KNIA 2W8LA 9ICKA 2MSNA 2JRZA 5EWGA 5DQIA 3SEIA 5C0YA 1U45A 4B9LA 4UBCA 4C8KA 2H3VA 2HCFA 4NL9A 4DFMA 4J9MA 4UAVA 2F2AB 4O3NA 4KMOB 1ZQBA 5HHIA 3KHHA 1ZQCA 3OSNA 2ZIXB 4F4WA 4ECUA 2KKPA 2A1JB 3TANA 3QNMA 5AIAA 3G6YA 3IHQB 1N48A 1RDFA 5IINA 1N61A 3UPQA 1ZQIA 5IIOA 2XO7A 3HILA 4O0IA 2WF5A 2W55A 4I2GA 4XQ8A 8ICHA 2BQUA 4ED0A 2HHXA 2KIVA 1V9PA 2HI0A 2XI9A 4M6WA 4OO1J 4I2DA 2FJ6A 2ZTDA 4ED3A 2UVUA 4O3OA 4YXMA 3MBYA 5KFBA 4MEXA 1MC8A 4I27A 4FBTA 3DV9A 2E5SA 2H3FA 4LZGA 1GO3F 5ALKA 2KTQA 3UQ2A 4DFKA 4Q44A 1RQNA 5AKEA 4FFDA 9ICRA 4DOCA 3JPTA 2EAPA 2EQYA 2J6UA 7ICUA 5AK6A 2Y1IA 4NLNA 1RYRA 3GFKB 4M9JA 4FE3A 5D4BA 3ZDEA 1QCKA 3V72A 4KLEA 4Z6FA 3EWAA 4ECXA 3B0YA 1FO4A 1SWWA 2YMQA 2C2DA 2BQ3A 4F50A 1L8OA 5DKWA 1T8EA 2AQ0A 5AHXA 3Q8RB 3NRZA 3J81j 3N7RC 3RFAA 1L7MA 3M6ZA 2G5HB 4AP9A 5KFGA 3C28A 7ICMA 2ZIWA 5TZVA 4US9A 5KFXA 4YMNA 3TACB 1JUDA 3GIKA 4KX5A 1S0OA 3AL0B 7ICRA 4KMUA 1KSPA 1SXEA 4C8LA 2NO4A 2D8CA 5KG0A 4GC7A 4TQSA 4B9VA 2YX8A 1KFTA 4QW9A 3K75D 4IQUA 4C4TA 1T3QA 5DQHA 1S5LU 3BQ7A 5KFPA 3EZ5A 2OCEA 4IC9A 4RPZA 3EW9A 4CE6A 4RNMA 3QE9Y 2BCRA 3WKEA 4K4GA 3IDWA 1NNLA 4C8NA 4UB1A 3GDXA 3QUCA 2L5YA 7ICJA 2PXIA 4FZNA 3NGDA 4PGQA 1L8LA 1Z00A 5DDYA 2JV3A 4UB3A 4P2HA 2KJ9A 3DDHA 1F5SA 5DBAA 4DOAA 4R64A 5AK5A 2WF9A 2LYBA 1A0PA 1ZXIA 2HVHA 3WKDA 5L1IA 8ICBA 4Y2TA 3TFSA 4UQGA 3CYMA 4RT3A 5ALYA 1CUKA 2HBKA 3IG8A 3JPNA 2PKEA 3GIMA 5KFCA 2BR0A 8ICEA 4ZOHC 2KFNA 7ICSA 4QWEA 3FDSA 2F76X 2DKZA 2H3ZA 4OCZA 2KV2A 2YTUA 4Z6CA 3PW5A 5KG5A 1ZQAA 3Q8PB 1CI4A 1ZQPA 2JEFA 1LV5A 2EZXA 3PZPA 4J9NA 5J2CA 3QU9A 4YFKA 5B66U 1NK9A 3ZDBA 2WF7A 5EE1A 4RQNA 2W9CA 1HUZA 3H0MB 2YMLA 3WU2U 3H0RB 3ICXA 2XCAA 2DBYA 4KLSA 1MSWD 1J97A 1XSLA 4K4HA 1HEKA 4Y2RA 3IV6A 5AKLA 2AGOA 3FAHA 5ALSA 4DOBA 3BZKA 3OTQA 1ZQOA 3RJEA 5ALOA 2I5HA 2DWQA 3UMCA 4ECZA 2C28A 4GXIA 2D3DA 2EH9A 3PV8A 2NRTA 2IHNA 3ZD9A 1RPLA 1TFRA 3WKBA 2KZZA 5J0UA 4QWBA 3RB6A 2DGZA 1V97A 3JPSA 4XRHA 3I76A 5D49A 3LWLA 5HMMA 2N1RA 4F91B 4RQ7A 1L6NA 3GV8B 4IRDA 1VDVA 3BS5A 3K1RB 2FMQA 1RXWA 3N7PD 4GLXA 3T5HA 1TK8A 3HW8A 4Y2PA 5DLGA 4OJOA 2VANA 1U47A 1T94A 2W11A 4NLZA 2CXYA 3PX0A 2BQRA 5J2BA 2IMWP 4I2JA 1TAMA 3WK6A 9ICQA 2ZIVB 2UVWA 8ICIA 4DFPA 3QZ8A 1WWUA 4KLMA 5J2DA 1URJA 3BS7A 1X9MA 3B9JA 1DK3A 2KMDA 3RH6A 2BPGA 4Y2SA 4DF4A 4BUGA 3QXGA 4ECRA 1L7OA 5AM4A 4DSLA 4QW8A 3T79A 4KLHA 3AU2A 2JHDA 2E8OA 4PGXA 3Q8QB 2G09A 1IXRA 1FFVA 3M9OB 1ZQKA 4C8MA 1TAUA 2JR5A 4DQRA 2JH1A 2KHQA 2VA2A 2C22A 1QSLA 1T3NA 1ZRMA 4O5KA 2JMGA 2WB1F 3PSFA 1N2XA 1XWLA 3D2SA 4U6PA 2YMPA 5KT5A 4KITB 2C2EA 2PMZF 1ZQSA 1ECWA 2GO7A 5KFKA 5ALMA 4ED2A 5J0PA 5DB6A 2F8KA 4B9TA 3IRUA 2ZXHA 4MFAA 3BQ0A 2WFAA 1NJWA 4YMMA 4QZAA 1NK0A 2GH1A 8ICCA 2EDUA 2BZFA 4EZ6A 1SKRA 1SKSA 1PVPA 3KHLA 3BJYA 1ZQUA 2ZJ8A 3MFHA 2Y1JA 3C5FA 2FLNA 1S0MA 9ICIA 7ICVA 2AHOB 4M6WB 4GC6A 1KQQA 1F0MA 2NRVA 2VJ5A 4CNQA 3NUQA 5G5GA 1S10A 1KFSA 2OHFA 5DG9A 1JXEA 2G0AA 2VIXA 1S97A 1WCNA 3QX7A 5GTHU 2KZMA 4U7CA 3TKAA 4M04A 2ZUCA 8ICMA 5AM2A 2OYYA 3GV5B 2OWOA 3RJFA 5ALXA 3ZD8A 3MR6A 7ICEA 1BPEA 1AROP 4CF3A 5ALGA 3HPOA 2D6FC 1IIPA 4QJFB 1SZPA 9ICGA 4KLIA 2JGAA 3LK9A 1LKYA 9ICTA 4PHDA 3H4BA 3RRGA 4YXJA 8ICUA 1YZ7A 2ZIUA 4F92B 5KFJA 5KT6A 3C2KA 9ICBA 5CRXA 4MEYA 1Z19A 3ZDCA 4ZH4A 4ECSA 2ZIWB 1SWVA 4ELTA 1ZQVA 9ICXA 2F1HA 9ICOA 1K1SA 5J2KA 5AKJA 1NKBA 3PO4A 3HX0A 4YQWA 3GIJA 2LM1A 4JV1A 2HHSA 1SB3C 3QU2A 1ZQWA 3UXOA 4RQ8A 2IBKA 1QH9A 1B4FA 2ODGA 5K4LA 4I2CA 4DL3A 2Q4TA 2KSOA 5J2AA 1Q8KA 1ZQJA 1ZJMA 1KLNA 3RR7A 2KE7A 5J0QA 5J29A 2B21A 4F93B 4O3MA 1SL1A 1KRPA 4BGDA 3JPRA 2ASLA 3HRDD 1AQ6A 1TVAA 1N5WA 1BVSA 3RBDA 4P0PA 1BNOA 1FEZA 2IOFK 3BDPA 4EZ9A 4BDPA 2LKYA 1ZQMA 8ICRA 2ESEA 3F2DA 2KK0A 1ZQRA 4F4ZA 2WF6A 1VJ5A 4KX3A 4UB6U 1JN3A 5KG4A 5J0YA 3BQTA 2OXOA 7ICKA 2ATLA 2MA1A 4RQMA 4RU9A 3UXNA 1Z4NA 1Z00B 3A0HU 3Q8SB 4DL6A 7ICLA 1Z1BA 4NLKA 4EX6A 1WCLA 4EX7A 1UA0A 1Z3EB 2E8NA 3N4MB 2XVTA 4EBCA 1BPXA 4F2SA 4QZ9A 3G6XA 1NI3A 2KZ3A 1PUZA 2R8IA 1WYGA 3UMGA 2PFQA 4HAIA 4UW9A 5KFAA 1Y88A 2WB1C 1L3TA 4RZRA 2PMZC 3PX6A 3WK4A 5DB9A 5DG8A 3SV3A 4NL9C 3SV4A 2ZUBA 3H40A 8ICFA 4MF8A 5D46A 2KIWA 5AI0A 5J8YA 2JEJA 5ALRA 4JWMA 2FLPA 4OJ5A 5J2FA 1ZETA 3SMVA 3KHGA 1S77D 1YT3A 4Y2JA 4C7YA 4M2YA 4RQ5A 1B43A 3M6KA 2W9CB 4J9OA 2YB1A 1COOA 8ICLA 3SENA 4IRKA 3KOOA 3MDAA 5KFQA 2MU2A 5ALQA 4QZ8A 1BPZA 2KHVA 1C7YA 1ZQGA 1RXVA 4EBEA 5KFNA 5KFVA 1V38A 4DL5A 1ZQEA 8ICQA 3MDCA 3NVYA 2XIDA 4A8EA 2HOFA 2HBMA 3I1YA 3L3FX 3SQIA 2I9GA 3TFRA 3LVWA 3JPQA 3RR8A 5AKKA 3D2QA 3TAQA 1NK6A 2NRXA 9ICFA 2RP5A 1NOMA 1UHUA 5KFFA 2BCUA 4PZOA 2R8HA 2BHNA 7ICTA 2KD1A 4RQ3A 4CCHA 5L9XA 4TUSA 3BQ1A 5HMLA 4ECWA 4EELA 4P0QA 2XY6A 1T7PA 4YR2A 4IRCA 3BS5B 2LM4A 2JZBA 9ICVA 1Q3VA 3CNHA 2A19A 4R65A 3GIIA 2F44A 1X2IA 2JXJA 2XICA 1ZQTA 1D8BA 5J2EA 4ED1A 4I2HA 3UXPA 3HP6A 4G9BA 4KN4A 3C29A 2EANA 5JU5A 1D9FA 3TARA 2I1QA 4Z6EA 4UBBA 4M9LA 5J0TA 9ICCA 3HWTA 1UT8A 1QSYA 1K5OA 1QQ5A 2W9BA 2KJ5A 1N60A 2BDPA 4F4XA 4FS2A 3KFUF 1A6SA 3SAGA 3NVZA 2IA6A 4IL6U 3I28A 4OD0A 1BNPA 1TK5A 3EYZA 8ICYA 3PW2A 2F8LA 1UT5A 4LJXA 3RB3A 4I28A 4C4SA 2AU0A 1RYUA 1NKCA 2HHUA 4EYIB 2NYVA 5KT3A 4UATA 1X9WA 5AI4A 5AM1A 3MFIA 4O9MA 4Q45A 5JTIA 1DGJA 4TUQA 2UVRA 2K8CB 9ICEA 1CRXA 3PX4A 1OXJA 2ES6A 4I29A 3BQ2A 1JRPA 4Y2QA 5AICA 4YD2A 4HYKA 1NZPA 4JMUA 3THVA 4DFDA 1NK8A 2BDUA 2LI6A 4YCXA 2FLLA 2QB0A 5DGBA 5KG6A 3LYSA 4GFJA 4JV0A 5F3XB 1SL0A 5HR7A 5L1LA 8ICSA 3PNCA 4Y2UA 4J9QA 3PVXA 5CJ7A 4EENA 2ZJAA 3Q8MA 8ICGA 4EBDA 1J2MA 5AM5A 2WAQF 5AKIA 2PFOA 4M9HA 1IG6A 2MAXA 5ALTA 4C0ZA 1SIJA 4O5CA 3QU4A 8ICWA 1DK2A 4QWCA 2Q0ZX 4DSFA 1SV0A 4B6JA 1S9FA 5CA7A 1MQ3A 4I2EA 4M9GA 4IQTA 4DSIA 2GOLA 4ELUA 4WJ3B 4YR3A 2LMRA 2Z7JA 2KOBA 2W3RA 3CW2C 2A1AA 4M9NA 1HUOA 4DL4A 4XA5A 5CWRA 5ALNA 3JPPA 3MR5A 2W9MA 2RQ5A 5DBCA 3KKAA 4CF4A 2HHTA 4J9SA 3N97B 2AGQA 3SAHA 5J0SA 1ZD2P 3C2MA 1LKYB 5AKHA 4B9NA 2NO5A 2KVCA 2ZIUB 1XO1A 3V6KA 5B5EU 4YMOA 4F5NA 4IS7A 3PW4A 4MF2A 4QWDA 2KJ8A 1ZJNA 3OJUA 2HVIA 3CP8A 5KFLA 3F5AA 4F4KA 5AIBA 1OUQA 3ONNA 2HDOA 2KSOB 2R8KA 4XUSA 3PMNA 2ASJA 2WF8A 3NTUA 1ZQNA 1Q46A 2RDJA 4MFCA 3LVVA 5ALHA 4DL2A 1TKDA 4M47A 3GQCA 1S8OA 3AMZA 1ZD4A 9ICMA 5DQGA 4P0PB 1N63A 2RRDA 1V85A 4BWMA 5ALIA 3EUB2 4F5QA 4BX9C 4CDGA 4RUCA 2Y9UA 1JXLA 2PI4A 4YR0A 2F3NA 5DDMA 2ISPA 4KLQA 3RB0A 4IR9A 4UB4A 4BWJA 4KLJA 1ZQXA 5KFMA 2DKXA 1MA7A 8ICJA 1LVHA 5BOLA 5JUMA 5ALPA 2HMXA 2FPLA 4GIBA 1D9DA 4QZFA 4KLLA 4EEKA 3GV7B 5J2GA 5AI8A 2KEYA 1NJZA 3FM9A 3AN1A 3EPIA 4DL7A 2YMMA 3RAQA 4KLDA 3QU5A 4TQRA 3RB4A 4O5EA 3V7JA 1QSSA 9ICJA 3KZXA 1N56A 2W54A 1KFDA 3KZIU 4NM1A 4ED6A 3ETRA 5KFIA 3NASA 4IQVA 5BOMA 5L1KA 4QZCA 3IM1A 3EPGA 3WK5A 1NJYA 4EYHB 4DSKA 5JRTA 3OGUA 3ORYA 5KFOA 2DUYA 3M1YA 4QIWF 1TAQA 2HOQA 1Q3UA 3C23A 2ZG6A 3GILA 1WWVA 4JV2A 2G07A 4B9MA 2LBOA 3D6JA 8ICAA 1RG6A 5J0XA 4PHPA 4PHAA 8ICZA 1L7PA 1SZHA 4GXKA 3N7SC 1JMSA 1QQ6A 2KVSA 3WK9A 4RNNA 1ZQQA 3PW7A 4NWIA 3PSPA 4DQQA 3MGHA 4I2FA 4MFFA 4KLFA 4G3IA 2QARA 3E58A 5CP2A 1WUDA 2WTFA 1UQVA 2DPIA 2WAQC 2DFLA 2IHMA 3MR2A 2W8KA 5DGAA 5KFWA 3M8RA 3TQ1A 3RH5A 3M7DA 2V4QA 1DOQA 3C1YA 4NY8A 2KICA 4C4RA 5ALJA 3HJEA 3AEVA 7ICIA 3CRXA 4ED7A 4P0QB 4CGZA 3SR6A 1Z1VA 2JZBB 1U48A 4Q43A 5AI9A 2V9WA 5GTIU 1L3UA 5J2HA 3HT3A 1FFUA 3PY8A 2R18A 2CPRA 4PJ0U 9ICWA 4P4OA 3TADA 2HOIA 1TE2A 4YN4A 2BKEA 3T5JA 1PVRA 1PVQA 1L3VA 1A77A 3NRWA 2CN1A 4C80A 2E1EA 2ZXIA 5KFUA 3RAXA 1TK0A 3BZCA 5AI6A 5KL8B 4MHVA 3RJHA 3SAFA 2ALZA 1SGGA 2P66A 3VC8A 2W9BB 3N28A 2P35A 4BXOA 1KL9A 4RQ6A 1NJXA 1KBUA 5KFZA 2XC9A 4RPXA 2IOHA 2EAOA 5KG2A 1XNSA 3PO5A 4LVSA 2ZTCA 1RM6C 2PI5A 4J9PA 3GU3A 2MUTA 2KG5A 5AM3A 3WKCA 1QQ7A 4I2BA 2E3TA 4J9RA 4B9UA 4RQ2A 4PZNA 4DFJA 1XO0A 2F1IA 1SKWA 3ETLA 4P4PA 5DB7A 1KEJA 3WK8A 3ED5A 8ICOA 4EEYA 2QLTA 4RPYA 4OJ6A 2H3QA 1X6JA 3Q8LA 4ECTA 1ZQHA 3K1ZA 5J2JA 1X66A 4UARA 2HW3A 2ZTEA 4DEZA 3OSPA 2OEHA 3B0XA 4O3PA 4ICAA 3TI0A 1BPYA 1B22A 2LHTA 2QB0B 4NJ8A 2Y0SF 2NV3A 1XSPA 3AQFA 4TURA 3KD3A 2RDIA 4Q8FA 1L7NA 1BPBA 3E0FA 7ICQA 1ZQ1C 5KFSA 1KKXA 3F2CA 3PW0A 3F53A 3VCBA 5KT2A 1ZQDA 1DRGA 5T14A 2HBLA 7ICHA 5IILA 2EZZA 5EE3A 1NZBA 5ALFA 5HNKA 3DEEA 5KFDA 4YVZA 3H8MA 3RJGA 5CR0A 3UMBA 2J6TA 1ZQYA 2BCVA 5ALVA 3UQ0A 2XY5A 2CRXA 1ZQFA 3PR5B 3D2NA 3OHAA 3QUTA 4NLBA 4F5PA 4QZEA 5KG3A 3V6HA 4AYBF 5J8YC 1NK5A 3JPOA 4QIWC 4FZLA 2W3SA 3HKZF 4J9LA 1D8YA 2OH2A 1ZQLA 1TV9A 4RQ4A 1DXSA 2BPFA 2AGPA 1N5XA 4QZDA 4DLEA 5KL1B 3QEBZ 4KLOA 2AH5A 3ISCA 1P7DA 5C5JA 1ED1A 4UAYA 2DPJA 4NLGA 4DQPA 2P6RA 3C21A 4Z6DA 5IIMA 4F4YA 3QYPA 4PL1A 2AQ4A 1UA1A 2VJ4A 3T5KA 1A76A 1KN5A 3ISDA 2G5IB 2HBJA 3SYZA 5HP4A 4BJQA 1FIQA 4QNLA 3QU7A 4FBUA 4R8UA 5KG7A 2E8PA 3RBEA 4M0AA 2R8GA 4RNOA 1U4BA 4UB2A 2W9AA 5EE9A 4FO6A 3F5EA 4RQ1A 1QLNA 1PK1A 1MQ2A 5G5HA 2H5XA 3PSTA 3LWMA 4ELVA 5EOZA 3AQEA 4UB5A 1MN8A 5KFHA 4K4IA 3H8SA 3OJSA 3QZ7A 4QZIA 4UAZA 3T5LA 1PZNA 2G08A 3LDAA 4USAA 1U49A 4Y2VA 2W43A 2PFNA 1KDHA 2W03A 8ICPA 3L5KA 5J0WA 4CF5A 4FS1A 3NS1A 1COKA 5ALZA 4F71A 3MGVA 4P4MA 2YN4A 4PH5A 3M9MB 1JI7A 3MR3A 3QEAZ 2BGWA 5ALDA 2ZJ5A 2G06A 4RT2A 2I6XA 1O03A 9ICLA 5J0OA 4F72A 4DF8A 1CEZA 2LPEA 4NV0A 1S0NA 4QZHA 3SD7A 2ZIXA 3UM9A 3OPXA 2A1JA 3L4PA 4DS4A 4Q8EA 5KFTA 4JWNA 2C2RA 1X9SA 2QKQA 2F1JA 1JALA 3RJKA 5IIIA 1ZYQA 4R66A 2J6SA 5AK4A 4QZGA 4C8OA 2IOFA 3ZDAA 2K8BB 5ALLA 3RJJA 3ZDDA 3ZI4A 4NXZA 2PFPA 5TISU 1D8LA 2Y0SC 5KTQA 5KT4A 1VLBA 4YG2A 4UASA 4ED8A 2WHEA 5DBBA 2HHWA
chains in the Genus database with same CATH topology
1PUZA 2LM4A 2JR5A 1X6JA 1X6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUZ A;  2LM4 A;  2JR5 A;  1X6J A;  1X6I A; 
#chains in the Genus database with same CATH topology
 3GZF A;  4ACO A;  1WG8 A;  8ICT A;  5ALW A;  2OM6 A;  2NRW A;  2FDR A;  2KN7 A;  2KNJ A;  3KBB A;  2QAR B;  5DLF A;  2K4H A;  2Y9T A;  3H8W A;  2JH7 A;  3M9N B;  3C1Z A;  4IQW A;  3H0L B;  5CB1 A;  2JEI A;  4PGY A;  1KTQ A;  1BPD A;  4CRX A;  8ICX A;  2FE9 A;  5AKY A;  1SV0 C;  2AJQ A;  3FC4 A;  4AYB C;  2YY6 A;  4J03 A;  1DGS A;  7ICP A;  4I2I A;  1HJP A;  1XC9 A;  4DLG A;  3T3F A;  9ICN A;  3HKZ C;  9ICU A;  5AM0 A;  4ECQ A;  4PHE A;  2GWS A;  5AKZ A;  2VKQ A;  2P6U A;  3AUO A;  4ECY A;  2DF4 B;  2MRL A;  4DWI A;  4YP3 A;  4F3O A;  2ZUD A;  5BPC A;  3KKA C;  3PR4 A;  3H7I A;  3ALR A;  4O3Q A;  3A0B U;  5J2I A;  5KT7 A;  4F2R A;  5L1J A;  4DCC A;  3QUQ A;  1F44 A;  1NKE A;  2E1F A;  2B6G A;  4OJP A;  1H38 A;  3IP4 B;  2H3I A;  5HHH A;  9ICA A;  5HR6 A;  1JRO A;  2V4R A;  1YZ6 A;  3MGI A;  4KLU A;  5IIK A;  5KG1 A;  3RTV A;  4BXO B;  5KAI U;  3RH4 A;  1S0V A;  4KLT A;  5IIJ A;  2B0C A;  3IN5 A;  5KAF U;  4PPX A;  5AI5 A;  4PL2 A;  5ALU A;  5A0L A;  1B0X A;  4DO9 A;  2AXT U;  7ICO A;  1X6I A;  3K4G A;  5DG7 A;  2XY7 A;  4UAU A;  2MUT B;  3NVW A;  7ICG A;  2BCQ A;  2NRZ A;  1N62 A;  1NK7 A;  3PML A;  2LYA A;  1ZD5 A;  1L5U A;  2K4P A;  3S6J A;  3SI8 A;  4I2A A;  9ICP A;  1OW5 A;  1S76 D;  2YB4 A;  3G6V A;  1ZOL A;  1ZRN A;  3FYH A;  2K4I A;  1UPH A;  4OJL A;  1NK4 A;  1X9X A;  5KFR A;  1IM4 A;  1T4G A;  4R63 A;  1EXN A;  2FPM A;  3IG5 A;  9ICH A;  2W7P A;  1K1Q A;  5AKX A;  2HSZ A;  3C5G A;  4US8 A;  2M9N A;  5ALE A;  1UCV A;  5EE0 A;  5DB8 A;  3RF9 A;  2K8A A;  1L3S A;  3U26 A;  5CHG A;  4IR1 A;  1Z4O A;  3PSI A;  4LZD A;  4Y2X A;  1RQL A;  3R9K A;  4UB8 U;  5FP0 A;  2BCS A;  4DQI A;  3OHB A;  2EZY A;  4C7Z A;  3WKA A;  4JK1 A;  4JUZ A;  4RQ0 A;  3V7K A;  5H2F U;  2ISO A;  1RZT A;  4O3R A;  4RUA A;  3WK7 A;  3SZ2 A;  3NVV A;  1SV4 A;  5EWE A;  3H8J A;  2XGQ A;  3M8S A;  2YQE A;  2FMP A;  5F9N A;  4UAW A;  2FI1 A;  4KLG A;  1U9L A;  4DSJ A;  4Y2Y A;  1KW4 A;  2QB1 A;  4O3S A;  4YD1 A;  9ICS A;  3O0F A;  1SL2 A;  2VA8 A;  2RHF A;  3KTQ A;  3F2B A;  2HHV A;  1ZQZ A;  4JB3 A;  5AK3 A;  3C2L A;  4DSE A;  1M6Y A;  3MAB A;  5EWF A;  4B9S A;  2W7O A;  1C20 A;  3AM9 A;  2FMS A;  8ICV A;  3MC1 A;  4TUP A;  4DQS A;  1RYS A;  2BPC A;  2F77 X;  3V6J A;  2LYH A;  2KFZ A;  2HHQ A;  4NLC A;  4KN7 A;  1LB2 B;  1JIH A;  1SXD A;  1XU4 A;  1IV8 A;  3H4D A;  2ASD A;  8ICK A;  3AU6 A;  4F8R A;  5CEH A;  5L1M A;  2KP7 A;  2K60 A;  5E79 U;  5J0R A;  2KKV A;  4R8U B;  4ECV A;  4E0D A;  2RLT A;  2VA3 A;  3Q8K A;  1PK3 A;  3KHR A;  1JX4 A;  4GXJ A;  1O08 A;  4KTQ A;  1X40 A;  3RRH A;  2W04 A;  2DQN B;  3V7L A;  2A3V A;  2ZIV A;  2GLE A;  2K4E A;  8ICN A;  3QUB A;  1PK1 B;  2FPK A;  2K89 A;  7ICN A;  2DL0 A;  1QTM A;  2UVV A;  3TAP A;  2E8M A;  1ZD3 A;  5KFE A;  3TAD C;  1J2N A;  2R8J A;  4F5O A;  1BGX T;  3RJI A;  5KFY A;  2XGP A;  4X5V A;  4QZB A;  5F9L A;  4J9K A;  4F5R A;  2O6K A;  1X42 A;  3E2E A;  2EAM A;  5AKG A;  7ICF A;  1XS9 D;  4FZM A;  1XSN A;  2M0N A;  2XCP A;  4NM2 A;  3ISB A;  4QWA A;  1HIW A;  2JEG A;  4DS5 A;  5KNI A;  2W8L A;  9ICK A;  2MSN A;  2JRZ A;  5EWG A;  5DQI A;  3SEI A;  5C0Y A;  1U45 A;  4B9L A;  4UBC A;  4C8K A;  2H3V A;  2HCF A;  4NL9 A;  4DFM A;  4J9M A;  4UAV A;  2F2A B;  4O3N A;  4KMO B;  1ZQB A;  5HHI A;  3KHH A;  1ZQC A;  3OSN A;  2ZIX B;  4F4W A;  4ECU A;  2KKP A;  2A1J B;  3TAN A;  3QNM A;  5AIA A;  3G6Y A;  3IHQ B;  1N48 A;  1RDF A;  5IIN A;  1N61 A;  3UPQ A;  1ZQI A;  5IIO A;  2XO7 A;  3HIL A;  4O0I A;  2WF5 A;  2W55 A;  4I2G A;  4XQ8 A;  8ICH A;  2BQU A;  4ED0 A;  2HHX A;  2KIV A;  1V9P A;  2HI0 A;  2XI9 A;  4M6W A;  4OO1 J;  4I2D A;  2FJ6 A;  2ZTD A;  4ED3 A;  2UVU A;  4O3O A;  4YXM A;  3MBY A;  5KFB A;  4MEX A;  1MC8 A;  4I27 A;  4FBT A;  3DV9 A;  2E5S A;  2H3F A;  4LZG A;  1GO3 F;  5ALK A;  2KTQ A;  3UQ2 A;  4DFK A;  4Q44 A;  1RQN A;  5AKE A;  4FFD A;  9ICR A;  4DOC A;  3JPT A;  2EAP A;  2EQY A;  2J6U A;  7ICU A;  5AK6 A;  2Y1I A;  4NLN A;  1RYR A;  3GFK B;  4M9J A;  4FE3 A;  5D4B A;  3ZDE A;  1QCK A;  3V72 A;  4KLE A;  4Z6F A;  3EWA A;  4ECX A;  3B0Y A;  1FO4 A;  1SWW A;  2YMQ A;  2C2D A;  2BQ3 A;  4F50 A;  1L8O A;  5DKW A;  1T8E A;  2AQ0 A;  5AHX A;  3Q8R B;  3NRZ A;  3J81 j;  3N7R C;  3RFA A;  1L7M A;  3M6Z A;  2G5H B;  4AP9 A;  5KFG A;  3C28 A;  7ICM A;  2ZIW A;  5TZV A;  4US9 A;  5KFX A;  4YMN A;  3TAC B;  1JUD A;  3GIK A;  4KX5 A;  1S0O A;  3AL0 B;  7ICR A;  4KMU A;  1KSP A;  1SXE A;  4C8L A;  2NO4 A;  2D8C A;  5KG0 A;  4GC7 A;  4TQS A;  4B9V A;  2YX8 A;  1KFT A;  4QW9 A;  3K75 D;  4IQU A;  4C4T A;  1T3Q A;  5DQH A;  1S5L U;  3BQ7 A;  5KFP A;  3EZ5 A;  2OCE A;  4IC9 A;  4RPZ A;  3EW9 A;  4CE6 A;  4RNM A;  3QE9 Y;  2BCR A;  3WKE A;  4K4G A;  3IDW A;  1NNL A;  4C8N A;  4UB1 A;  3GDX A;  3QUC A;  2L5Y A;  7ICJ A;  2PXI A;  4FZN A;  3NGD A;  4PGQ A;  1L8L A;  1Z00 A;  5DDY A;  2JV3 A;  4UB3 A;  4P2H A;  2KJ9 A;  3DDH A;  1F5S A;  5DBA A;  4DOA A;  4R64 A;  5AK5 A;  2WF9 A;  2LYB A;  1A0P A;  1ZXI A;  2HVH A;  3WKD A;  5L1I A;  8ICB A;  4Y2T A;  3TFS A;  4UQG A;  3CYM A;  4RT3 A;  5ALY A;  1CUK A;  2HBK A;  3IG8 A;  3JPN A;  2PKE A;  3GIM A;  5KFC A;  2BR0 A;  8ICE A;  4ZOH C;  2KFN A;  7ICS A;  4QWE A;  3FDS A;  2F76 X;  2DKZ A;  2H3Z A;  4OCZ A;  2KV2 A;  2YTU A;  4Z6C A;  3PW5 A;  5KG5 A;  1ZQA A;  3Q8P B;  1CI4 A;  1ZQP A;  2JEF A;  1LV5 A;  2EZX A;  3PZP A;  4J9N A;  5J2C A;  3QU9 A;  4YFK A;  5B66 U;  1NK9 A;  3ZDB A;  2WF7 A;  5EE1 A;  4RQN A;  2W9C A;  1HUZ A;  3H0M B;  2YML A;  3WU2 U;  3H0R B;  3ICX A;  2XCA A;  2DBY A;  4KLS A;  1MSW D;  1J97 A;  1XSL A;  4K4H A;  1HEK A;  4Y2R A;  3IV6 A;  5AKL A;  2AGO A;  3FAH A;  5ALS A;  4DOB A;  3BZK A;  3OTQ A;  1ZQO A;  3RJE A;  5ALO A;  2I5H A;  2DWQ A;  3UMC A;  4ECZ A;  2C28 A;  4GXI A;  2D3D A;  2EH9 A;  3PV8 A;  2NRT A;  2IHN A;  3ZD9 A;  1RPL A;  1TFR A;  3WKB A;  2KZZ A;  5J0U A;  4QWB A;  3RB6 A;  2DGZ A;  1V97 A;  3JPS A;  4XRH A;  3I76 A;  5D49 A;  3LWL A;  5HMM A;  2N1R A;  4F91 B;  4RQ7 A;  1L6N A;  3GV8 B;  4IRD A;  1VDV A;  3BS5 A;  3K1R B;  2FMQ A;  1RXW A;  3N7P D;  4GLX A;  3T5H A;  1TK8 A;  3HW8 A;  4Y2P A;  5DLG A;  4OJO A;  2VAN A;  1U47 A;  1T94 A;  2W11 A;  4NLZ A;  2CXY A;  3PX0 A;  2BQR A;  5J2B A;  2IMW P;  4I2J A;  1TAM A;  3WK6 A;  9ICQ A;  2ZIV B;  2UVW A;  8ICI A;  4DFP A;  3QZ8 A;  1WWU A;  4KLM A;  5J2D A;  1URJ A;  3BS7 A;  1X9M A;  3B9J A;  1DK3 A;  2KMD A;  3RH6 A;  2BPG A;  4Y2S A;  4DF4 A;  4BUG A;  3QXG A;  4ECR A;  1L7O A;  5AM4 A;  4DSL A;  4QW8 A;  3T79 A;  4KLH A;  3AU2 A;  2JHD A;  2E8O A;  4PGX A;  3Q8Q B;  2G09 A;  1IXR A;  1FFV A;  3M9O B;  1ZQK A;  4C8M A;  1TAU A;  2JR5 A;  4DQR A;  2JH1 A;  2KHQ A;  2VA2 A;  2C22 A;  1QSL A;  1T3N A;  1ZRM A;  4O5K A;  2JMG A;  2WB1 F;  3PSF A;  1N2X A;  1XWL A;  3D2S A;  4U6P A;  2YMP A;  5KT5 A;  4KIT B;  2C2E A;  2PMZ F;  1ZQS A;  1ECW A;  2GO7 A;  5KFK A;  5ALM A;  4ED2 A;  5J0P A;  5DB6 A;  2F8K A;  4B9T A;  3IRU A;  2ZXH A;  4MFA A;  3BQ0 A;  2WFA A;  1NJW A;  4YMM A;  4QZA A;  1NK0 A;  2GH1 A;  8ICC A;  2EDU A;  2BZF A;  4EZ6 A;  1SKR A;  1SKS A;  1PVP A;  3KHL A;  3BJY A;  1ZQU A;  2ZJ8 A;  3MFH A;  2Y1J A;  3C5F A;  2FLN A;  1S0M A;  9ICI A;  7ICV A;  2AHO B;  4M6W B;  4GC6 A;  1KQQ A;  1F0M A;  2NRV A;  2VJ5 A;  4CNQ A;  3NUQ A;  5G5G A;  1S10 A;  1KFS A;  2OHF A;  5DG9 A;  1JXE A;  2G0A A;  2VIX A;  1S97 A;  1WCN A;  3QX7 A;  5GTH U;  2KZM A;  4U7C A;  3TKA A;  4M04 A;  2ZUC A;  8ICM A;  5AM2 A;  2OYY A;  3GV5 B;  2OWO A;  3RJF A;  5ALX A;  3ZD8 A;  3MR6 A;  7ICE A;  1BPE A;  1ARO P;  4CF3 A;  5ALG A;  3HPO A;  2D6F C;  1IIP A;  4QJF B;  1SZP A;  9ICG A;  4KLI A;  2JGA A;  3LK9 A;  1LKY A;  9ICT A;  4PHD A;  3H4B A;  3RRG A;  4YXJ A;  8ICU A;  1YZ7 A;  2ZIU A;  4F92 B;  5KFJ A;  5KT6 A;  3C2K A;  9ICB A;  5CRX A;  4MEY A;  1Z19 A;  3ZDC A;  4ZH4 A;  4ECS A;  2ZIW B;  1SWV A;  4ELT A;  1ZQV A;  9ICX A;  2F1H A;  9ICO A;  1K1S A;  5J2K A;  5AKJ A;  1NKB A;  3PO4 A;  3HX0 A;  4YQW A;  3GIJ A;  2LM1 A;  4JV1 A;  2HHS A;  1SB3 C;  3QU2 A;  1ZQW A;  3UXO A;  4RQ8 A;  2IBK A;  1QH9 A;  1B4F A;  2ODG A;  5K4L A;  4I2C A;  4DL3 A;  2Q4T A;  2KSO A;  5J2A A;  1Q8K A;  1ZQJ A;  1ZJM A;  1KLN A;  3RR7 A;  2KE7 A;  5J0Q A;  5J29 A;  2B21 A;  4F93 B;  4O3M A;  1SL1 A;  1KRP A;  4BGD A;  3JPR A;  2ASL A;  3HRD D;  1AQ6 A;  1TVA A;  1N5W A;  1BVS A;  3RBD A;  4P0P A;  1BNO A;  1FEZ A;  2IOF K;  3BDP A;  4EZ9 A;  4BDP A;  2LKY A;  1ZQM A;  8ICR A;  2ESE A;  3F2D A;  2KK0 A;  1ZQR A;  4F4Z A;  2WF6 A;  1VJ5 A;  4KX3 A;  4UB6 U;  1JN3 A;  5KG4 A;  5J0Y A;  3BQT A;  2OXO A;  7ICK A;  2ATL A;  2MA1 A;  4RQM A;  4RU9 A;  3UXN A;  1Z4N A;  1Z00 B;  3A0H U;  3Q8S B;  4DL6 A;  7ICL A;  1Z1B A;  4NLK A;  4EX6 A;  1WCL A;  4EX7 A;  1UA0 A;  1Z3E B;  2E8N A;  3N4M B;  2XVT A;  4EBC A;  1BPX A;  4F2S A;  4QZ9 A;  3G6X A;  1NI3 A;  2KZ3 A;  1PUZ A;  2R8I A;  1WYG A;  3UMG A;  2PFQ A;  4HAI A;  4UW9 A;  5KFA A;  1Y88 A;  2WB1 C;  1L3T A;  4RZR A;  2PMZ C;  3PX6 A;  3WK4 A;  5DB9 A;  5DG8 A;  3SV3 A;  4NL9 C;  3SV4 A;  2ZUB A;  3H40 A;  8ICF A;  4MF8 A;  5D46 A;  2KIW A;  5AI0 A;  5J8Y A;  2JEJ A;  5ALR A;  4JWM A;  2FLP A;  4OJ5 A;  5J2F A;  1ZET A;  3SMV A;  3KHG A;  1S77 D;  1YT3 A;  4Y2J A;  4C7Y A;  4M2Y A;  4RQ5 A;  1B43 A;  3M6K A;  2W9C B;  4J9O A;  2YB1 A;  1COO A;  8ICL A;  3SEN A;  4IRK A;  3KOO A;  3MDA A;  5KFQ A;  2MU2 A;  5ALQ A;  4QZ8 A;  1BPZ A;  2KHV A;  1C7Y A;  1ZQG A;  1RXV A;  4EBE A;  5KFN A;  5KFV A;  1V38 A;  4DL5 A;  1ZQE A;  8ICQ A;  3MDC A;  3NVY A;  2XID A;  4A8E A;  2HOF A;  2HBM A;  3I1Y A;  3L3F X;  3SQI A;  2I9G A;  3TFR A;  3LVW A;  3JPQ A;  3RR8 A;  5AKK A;  3D2Q A;  3TAQ A;  1NK6 A;  2NRX A;  9ICF A;  2RP5 A;  1NOM A;  1UHU A;  5KFF A;  2BCU A;  4PZO A;  2R8H A;  2BHN A;  7ICT A;  2KD1 A;  4RQ3 A;  4CCH A;  5L9X A;  4TUS A;  3BQ1 A;  5HML A;  4ECW A;  4EEL A;  4P0Q A;  2XY6 A;  1T7P A;  4YR2 A;  4IRC A;  3BS5 B;  2LM4 A;  2JZB A;  9ICV A;  1Q3V A;  3CNH A;  2A19 A;  4R65 A;  3GII A;  2F44 A;  1X2I A;  2JXJ A;  2XIC A;  1ZQT A;  1D8B A;  5J2E A;  4ED1 A;  4I2H A;  3UXP A;  3HP6 A;  4G9B A;  4KN4 A;  3C29 A;  2EAN A;  5JU5 A;  1D9F A;  3TAR A;  2I1Q A;  4Z6E A;  4UBB A;  4M9L A;  5J0T A;  9ICC A;  3HWT A;  1UT8 A;  1QSY A;  1K5O A;  1QQ5 A;  2W9B A;  2KJ5 A;  1N60 A;  2BDP A;  4F4X A;  4FS2 A;  3KFU F;  1A6S A;  3SAG A;  3NVZ A;  2IA6 A;  4IL6 U;  3I28 A;  4OD0 A;  1BNP A;  1TK5 A;  3EYZ A;  8ICY A;  3PW2 A;  2F8L A;  1UT5 A;  4LJX A;  3RB3 A;  4I28 A;  4C4S A;  2AU0 A;  1RYU A;  1NKC A;  2HHU A;  4EYI B;  2NYV A;  5KT3 A;  4UAT A;  1X9W A;  5AI4 A;  5AM1 A;  3MFI A;  4O9M A;  4Q45 A;  5JTI A;  1DGJ A;  4TUQ A;  2UVR A;  2K8C B;  9ICE A;  1CRX A;  3PX4 A;  1OXJ A;  2ES6 A;  4I29 A;  3BQ2 A;  1JRP A;  4Y2Q A;  5AIC A;  4YD2 A;  4HYK A;  1NZP A;  4JMU A;  3THV A;  4DFD A;  1NK8 A;  2BDU A;  2LI6 A;  4YCX A;  2FLL A;  2QB0 A;  5DGB A;  5KG6 A;  3LYS A;  4GFJ A;  4JV0 A;  5F3X B;  1SL0 A;  5HR7 A;  5L1L A;  8ICS A;  3PNC A;  4Y2U A;  4J9Q A;  3PVX A;  5CJ7 A;  4EEN A;  2ZJA A;  3Q8M A;  8ICG A;  4EBD A;  1J2M A;  5AM5 A;  2WAQ F;  5AKI A;  2PFO A;  4M9H A;  1IG6 A;  2MAX A;  5ALT A;  4C0Z A;  1SIJ A;  4O5C A;  3QU4 A;  8ICW A;  1DK2 A;  4QWC A;  2Q0Z X;  4DSF A;  1SV0 A;  4B6J A;  1S9F A;  5CA7 A;  1MQ3 A;  4I2E A;  4M9G A;  4IQT A;  4DSI A;  2GOL A;  4ELU A;  4WJ3 B;  4YR3 A;  2LMR A;  2Z7J A;  2KOB A;  2W3R A;  3CW2 C;  2A1A A;  4M9N A;  1HUO A;  4DL4 A;  4XA5 A;  5CWR A;  5ALN A;  3JPP A;  3MR5 A;  2W9M A;  2RQ5 A;  5DBC A;  3KKA A;  4CF4 A;  2HHT A;  4J9S A;  3N97 B;  2AGQ A;  3SAH A;  5J0S A;  1ZD2 P;  3C2M A;  1LKY B;  5AKH A;  4B9N A;  2NO5 A;  2KVC A;  2ZIU B;  1XO1 A;  3V6K A;  5B5E U;  4YMO A;  4F5N A;  4IS7 A;  3PW4 A;  4MF2 A;  4QWD A;  2KJ8 A;  1ZJN A;  3OJU A;  2HVI A;  3CP8 A;  5KFL A;  3F5A A;  4F4K A;  5AIB A;  1OUQ A;  3ONN A;  2HDO A;  2KSO B;  2R8K A;  4XUS A;  3PMN A;  2ASJ A;  2WF8 A;  3NTU A;  1ZQN A;  1Q46 A;  2RDJ A;  4MFC A;  3LVV A;  5ALH A;  4DL2 A;  1TKD A;  4M47 A;  3GQC A;  1S8O A;  3AMZ A;  1ZD4 A;  9ICM A;  5DQG A;  4P0P B;  1N63 A;  2RRD A;  1V85 A;  4BWM A;  5ALI A;  3EUB 2;  4F5Q A;  4BX9 C;  4CDG A;  4RUC A;  2Y9U A;  1JXL A;  2PI4 A;  4YR0 A;  2F3N A;  5DDM A;  2ISP A;  4KLQ A;  3RB0 A;  4IR9 A;  4UB4 A;  4BWJ A;  4KLJ A;  1ZQX A;  5KFM A;  2DKX A;  1MA7 A;  8ICJ A;  1LVH A;  5BOL A;  5JUM A;  5ALP A;  2HMX A;  2FPL A;  4GIB A;  1D9D A;  4QZF A;  4KLL A;  4EEK A;  3GV7 B;  5J2G A;  5AI8 A;  2KEY A;  1NJZ A;  3FM9 A;  3AN1 A;  3EPI A;  4DL7 A;  2YMM A;  3RAQ A;  4KLD A;  3QU5 A;  4TQR A;  3RB4 A;  4O5E A;  3V7J A;  1QSS A;  9ICJ A;  3KZX A;  1N56 A;  2W54 A;  1KFD A;  3KZI U;  4NM1 A;  4ED6 A;  3ETR A;  5KFI A;  3NAS A;  4IQV A;  5BOM A;  5L1K A;  4QZC A;  3IM1 A;  3EPG A;  3WK5 A;  1NJY A;  4EYH B;  4DSK A;  5JRT A;  3OGU A;  3ORY A;  5KFO A;  2DUY A;  3M1Y A;  4QIW F;  1TAQ A;  2HOQ A;  1Q3U A;  3C23 A;  2ZG6 A;  3GIL A;  1WWV A;  4JV2 A;  2G07 A;  4B9M A;  2LBO A;  3D6J A;  8ICA A;  1RG6 A;  5J0X A;  4PHP A;  4PHA A;  8ICZ A;  1L7P A;  1SZH A;  4GXK A;  3N7S C;  1JMS A;  1QQ6 A;  2KVS A;  3WK9 A;  4RNN A;  1ZQQ A;  3PW7 A;  4NWI A;  3PSP A;  4DQQ A;  3MGH A;  4I2F A;  4MFF A;  4KLF A;  4G3I A;  2QAR A;  3E58 A;  5CP2 A;  1WUD A;  2WTF A;  1UQV A;  2DPI A;  2WAQ C;  2DFL A;  2IHM A;  3MR2 A;  2W8K A;  5DGA A;  5KFW A;  3M8R A;  3TQ1 A;  3RH5 A;  3M7D A;  2V4Q A;  1DOQ A;  3C1Y A;  4NY8 A;  2KIC A;  4C4R A;  5ALJ A;  3HJE A;  3AEV A;  7ICI A;  3CRX A;  4ED7 A;  4P0Q B;  4CGZ A;  3SR6 A;  1Z1V A;  2JZB B;  1U48 A;  4Q43 A;  5AI9 A;  2V9W A;  5GTI U;  1L3U A;  5J2H A;  3HT3 A;  1FFU A;  3PY8 A;  2R18 A;  2CPR A;  4PJ0 U;  9ICW A;  4P4O A;  3TAD A;  2HOI A;  1TE2 A;  4YN4 A;  2BKE A;  3T5J A;  1PVR A;  1PVQ A;  1L3V A;  1A77 A;  3NRW A;  2CN1 A;  4C80 A;  2E1E A;  2ZXI A;  5KFU A;  3RAX A;  1TK0 A;  3BZC A;  5AI6 A;  5KL8 B;  4MHV A;  3RJH A;  3SAF A;  2ALZ A;  1SGG A;  2P66 A;  3VC8 A;  2W9B B;  3N28 A;  2P35 A;  4BXO A;  1KL9 A;  4RQ6 A;  1NJX A;  1KBU A;  5KFZ A;  2XC9 A;  4RPX A;  2IOH A;  2EAO A;  5KG2 A;  1XNS A;  3PO5 A;  4LVS A;  2ZTC A;  1RM6 C;  2PI5 A;  4J9P A;  3GU3 A;  2MUT A;  2KG5 A;  5AM3 A;  3WKC A;  1QQ7 A;  4I2B A;  2E3T A;  4J9R A;  4B9U A;  4RQ2 A;  4PZN A;  4DFJ A;  1XO0 A;  2F1I A;  1SKW A;  3ETL A;  4P4P A;  5DB7 A;  1KEJ A;  3WK8 A;  3ED5 A;  8ICO A;  4EEY A;  2QLT A;  4RPY A;  4OJ6 A;  2H3Q A;  1X6J A;  3Q8L A;  4ECT A;  1ZQH A;  3K1Z A;  5J2J A;  1X66 A;  4UAR A;  2HW3 A;  2ZTE A;  4DEZ A;  3OSP A;  2OEH A;  3B0X A;  4O3P A;  4ICA A;  3TI0 A;  1BPY A;  1B22 A;  2LHT A;  2QB0 B;  4NJ8 A;  2Y0S F;  2NV3 A;  1XSP A;  3AQF A;  4TUR A;  3KD3 A;  2RDI A;  4Q8F A;  1L7N A;  1BPB A;  3E0F A;  7ICQ A;  1ZQ1 C;  5KFS A;  1KKX A;  3F2C A;  3PW0 A;  3F53 A;  3VCB A;  5KT2 A;  1ZQD A;  1DRG A;  5T14 A;  2HBL A;  7ICH A;  5IIL A;  2EZZ A;  5EE3 A;  1NZB A;  5ALF A;  5HNK A;  3DEE A;  5KFD A;  4YVZ A;  3H8M A;  3RJG A;  5CR0 A;  3UMB A;  2J6T A;  1ZQY A;  2BCV A;  5ALV A;  3UQ0 A;  2XY5 A;  2CRX A;  1ZQF A;  3PR5 B;  3D2N A;  3OHA A;  3QUT A;  4NLB A;  4F5P A;  4QZE A;  5KG3 A;  3V6H A;  4AYB F;  5J8Y C;  1NK5 A;  3JPO A;  4QIW C;  4FZL A;  2W3S A;  3HKZ F;  4J9L A;  1D8Y A;  2OH2 A;  1ZQL A;  1TV9 A;  4RQ4 A;  1DXS A;  2BPF A;  2AGP A;  1N5X A;  4QZD A;  4DLE A;  5KL1 B;  3QEB Z;  4KLO A;  2AH5 A;  3ISC A;  1P7D A;  5C5J A;  1ED1 A;  4UAY A;  2DPJ A;  4NLG A;  4DQP A;  2P6R A;  3C21 A;  4Z6D A;  5IIM A;  4F4Y A;  3QYP A;  4PL1 A;  2AQ4 A;  1UA1 A;  2VJ4 A;  3T5K A;  1A76 A;  1KN5 A;  3ISD A;  2G5I B;  2HBJ A;  3SYZ A;  5HP4 A;  4BJQ A;  1FIQ A;  4QNL A;  3QU7 A;  4FBU A;  4R8U A;  5KG7 A;  2E8P A;  3RBE A;  4M0A A;  2R8G A;  4RNO A;  1U4B A;  4UB2 A;  2W9A A;  5EE9 A;  4FO6 A;  3F5E A;  4RQ1 A;  1QLN A;  1PK1 A;  1MQ2 A;  5G5H A;  2H5X A;  3PST A;  3LWM A;  4ELV A;  5EOZ A;  3AQE A;  4UB5 A;  1MN8 A;  5KFH A;  4K4I A;  3H8S A;  3OJS A;  3QZ7 A;  4QZI A;  4UAZ A;  3T5L A;  1PZN A;  2G08 A;  3LDA A;  4USA A;  1U49 A;  4Y2V A;  2W43 A;  2PFN A;  1KDH A;  2W03 A;  8ICP A;  3L5K A;  5J0W A;  4CF5 A;  4FS1 A;  3NS1 A;  1COK A;  5ALZ A;  4F71 A;  3MGV A;  4P4M A;  2YN4 A;  4PH5 A;  3M9M B;  1JI7 A;  3MR3 A;  3QEA Z;  2BGW A;  5ALD A;  2ZJ5 A;  2G06 A;  4RT2 A;  2I6X A;  1O03 A;  9ICL A;  5J0O A;  4F72 A;  4DF8 A;  1CEZ A;  2LPE A;  4NV0 A;  1S0N A;  4QZH A;  3SD7 A;  2ZIX A;  3UM9 A;  3OPX A;  2A1J A;  3L4P A;  4DS4 A;  4Q8E A;  5KFT A;  4JWN A;  2C2R A;  1X9S A;  2QKQ A;  2F1J A;  1JAL A;  3RJK A;  5III A;  1ZYQ A;  4R66 A;  2J6S A;  5AK4 A;  4QZG A;  4C8O A;  2IOF A;  3ZDA A;  2K8B B;  5ALL A;  3RJJ A;  3ZDD A;  3ZI4 A;  4NXZ A;  2PFP A;  5TIS U;  1D8L A;  2Y0S C;  5KTQ A;  5KT4 A;  1VLB A;  4YG2 A;  4UAS A;  4ED8 A;  2WHE A;  5DBB A;  2HHW A; 
#chains in the Genus database with same CATH homology
 1PUZ A;  2LM4 A;  2JR5 A;  1X6J A;  1X6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...