2DQNB

Structure of trna-dependent amidotransferase gatcab complexed with asn
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
405
structure length
405
Chain Sequence
FETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 115
structure length 405
sequence length 405
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2dqnB02
2F2AB 2G5IB 2D6FC 3H0LB 2DQNB 2G5HB 3H0RB 3IP4B 3KFUF 3H0MB 2DF4B 1ZQ1C 3AL0B 4WJ3B
chains in the Genus database with same CATH superfamily
5HP4A 3E58A 4KLGA 5DBCA 5J0SA 1RYUA 1CI4A 2A1JB 2E1FA 3OSNA 4J9RA 1GO3F 5KFWA 1FIQA 2DGZA 4YMMA 4EENA 3IV6A 3WU2U 4AYBF 3PW2A 4ICAA 3NVVA 2B6GA 2NYVA 4UAYA 8ICRA 4C8NA 4ZH4A 3DDHA 1TKDA 3LDAA 4IC9A 4JK1A 5HNKA 2KNJA 2HHSA 1A6SA 7ICGA 4MFAA 1ZQSA 4Q8EA 1CRXA 8ICAA 2JRZA 7ICKA 3RJGA 4RQMA 8ICLA 4MFCA 2K8AA 2NV3A 4NLGA 4B9TA 5IIJA 4IRDA 4F4XA 4KLEA 1KFTA 2K4IA 1L7NA 1ZQDA 4F5PA 1N62A 2A1JA 2BQ3A 4YMOA 3F2BA 1N2XA 3JPTA 3QXGA 4QZ9A 4US9A 4FZLA 2W7OA 1QSYA 2HDOA 2KP7A 3H8WA 1ZQBA 3PX0A 2E8PA 2ZTEA 2PKEA 1TAMA 5AKIA 4F5NA 4Y2RA 4IR1A 4K4GA 1NK4A 4QZCA 4NWIA 4DCCA 5D49A 4LZDA 2LYAA 5B5EU 3L3FX 5ALEA 9ICAA 2FLNA 5ALXA 2H3QA 2FE9A 4IR9A 1BNOA 1C7YA 2JR5A 1WYGA 3SZ2A 4DFPA 5J2KA 4UQGA 9ICCA 5ALOA 1QQ5A 2Y9TA 3UQ2A 3GDXA 3C2MA 4ECRA 4KLUA 3WKBA 2HHWA 5ALKA 2NO5A 4UATA 3H0RB 2KZ3A 2EAMA 3T79A 5K4LA 4ECVA 3V7KA 3EPIA 4RPXA 3ALRA 4PL2A 4C8OA 1B0XA 4P0QB 4NL9C 4Z6CA 3Q8RB 1QSSA 2NRWA 5CJ7A 2QARB 3E2EA 3OSPA 3M9NB 1EXNA 4JV1A 3QUCA 5KFNA 3U26A 2PFNA 4YR2A 2OXOA 1ZQVA 4UAZA 5ALIA 3MGHA 5J2EA 3IN5A 1KFDA 1VDVA 2JXJA 3F53A 4UASA 3I28A 2EAOA 5G5GA 4F72A 2WAQF 2LKYA 2H5XA 3JPRA 2IHMA 4NV0A 1Q3VA 1S5LU 1S97A 3D2SA 3M8RA 1PVQA 3PMNA 1ZQFA 5DBBA 4XA5A 2W8LA 3WK4A 4JWMA 2KIVA 4QIWC 1JN3A 4F5OA 3AMZA 1L8LA 4P0QA 5ALDA 4B9MA 4Q43A 2BDPA 1P7DA 1C20A 2W55A 1NJWA 1X6JA 1ZQHA 4M47A 2QARA 2MA1A 3EYZA 2AXTU 4I2DA 2H3ZA 3AUOA 4DSEA 2KTQA 4CGZA 4QWCA 1UA0A 1KDHA 5TZVA 2BPCA 1CEZA 1UT5A 1ED1A 4IRKA 5AHXA 3V7LA 2QB0A 2LHTA 3TFSA 2E5SA 3ETLA 4KMUA 1XSNA 2FLLA 4DSLA 1O03A 5AKJA 4UBBA 1S0OA 3T5HA 3RJFA 4YVZA 4KLLA 2W9CB 2CN1A 2UVVA 4ED8A 3F5AA 1ECWA 1J2MA 4IQVA 2FPKA 1JIHA 2F8LA 3MDAA 2BQRA 4R8UB 4B6JA 2K89A 1CUKA 4DSKA 1PK1B 3RJEA 8ICXA 8ICPA 4TUPA 4KTQA 1ZXIA 3QUTA 1U4BA 5KFEA 3ZDBA 5KG4A 4Y2SA 3H7IA 4NM1A 4M6WB 3AL0B 2MUTB 1ZQRA 4QZ8A 3K4GA 1V9PA 2LI6A 3MGIA 2DL0A 2KK0A 9ICQA 9ICBA 1L8OA 3ZD9A 5L9XA 3MDCA 4F3OA 1K1SA 1COOA 3QEBZ 8ICZA 2YMPA 2VA8A 2NO4A 2OHFA 3M6ZA 5F3XB 2VA3A 5DB7A 1RM6C 1ZQEA 1IXRA 1SWWA 1BNPA 5AK4A 2P6UA 5DB9A 3SQIA 3PO5A 1ZD3A 4DOBA 5DDMA 3OTQA 4R8UA 3D2QA 1PK1A 3SAFA 4TQRA 2Q0ZX 5AM0A 4DQIA 9ICOA 5CEHA 1IIPA 1RYRA 2DKXA 2O6KA 8ICTA 1IM4A 4M6WA 2MUTA 3PW7A 3PX4A 1ZQAA 2F1HA 1JXLA 2LYHA 3ISDA 2LM4A 3NVZA 4F93B 3T3FA 3WK8A 2PI4A 2XY7A 1NK0A 1U9LA 3F2CA 7ICOA 2G5IB 3T5KA 5KFRA 2KHQA 1RDFA 4BGDA 4B9SA 7ICMA 3RJJA 4NL9A 2F44A 1IV8A 4JMUA 4EYHB 2YB4A 4NLBA 4C4RA 1ZQQA 5KG0A 4PL1A 2MRLA 3GILA 1SKRA 4DSIA 2ZIXB 4M9JA 3C5GA 5IILA 4P0PB 3G6XA 2W3RA 4DQPA 3ZDEA 3BS5B 2AHOB 2ZXIA 2EDUA 3WKAA 2D6FC 3SR6A 3ICXA 2LPEA 2XIDA 3TANA 4KLQA 4QZIA 3RBDA 3WKEA 4EZ6A 1H38A 4RQ2A 2DUYA 3L4PA 2BPFA 2PFPA 4DSFA 5AKYA 4LJXA 4QNLA 3THVA 3EZ5A 4R64A 2IOFA 3TACB 3RF9A 4K4IA 3NTUA 2ZIVB 1Z1VA 2XVTA 1Z4NA 4M04A 4P4PA 3JPPA 5CA7A 3LWMA 4KLJA 2ZIXA 3ORYA 8ICVA 5ALNA 2ASJA 2R8IA 4P0PA 3KOOA 5L1IA 4Y2XA 1U45A 4ECTA 2HHVA 4YD1A 4QZAA 2HSZA 3BS5A 2KEYA 3FDSA 1ZQIA 2AGQA 5KNIA 4X5VA 3D2NA 3OJUA 3J81j 4J9OA 4WJ3B 4KLHA 4B9NA 3N7PD 2C2EA 1OUQA 2BDUA 2ISOA 5DB6A 2ODGA 4XUSA 4J9SA 2W9AA 4QZFA 3VC8A 2PMZF 2EQYA 3QU5A 4GFJA 5EWFA 4QWDA 5KAIU 3RRHA 3OHBA 5IIMA 2ZG6A 5AKGA 4Z6FA 4FE3A 1KTQA 4Q44A 1XO1A 2ZIVA 5KFMA 1IG6A 4R65A 4Y2UA 2LBOA 4DQRA 2FPLA 3K1RB 5DB8A 2WB1F 4O0IA 3PMLA 2C28A 2BR0A 1NJZA 3AQEA 3G6YA 4UBCA 5J0RA 3UMCA 3TFRA 4FBUA 3I1YA 5H2FU 2RRDA 1SV0A 3ZI4A 3ETRA 1NK8A 4DL5A 5ALRA 3EPGA 2OH2A 3HP6A 1MQ3A 4EX6A 2Y0SF 2BCUA 3SENA 4YFKA 4ED7A 1XO0A 4C8MA 2YY6A 3IP4B 3SEIA 5J2DA 4DFMA 4JV2A 2DFLA 3CYMA 2YQEA 4EZ9A 4CE6A 1BVSA 1U48A 1N48A 2BCQA 4FO6A 8ICNA 3CNHA 1F44A 1X6IA 5J0OA 3Q8MA 2HBMA 4QIWF 3PSPA 4EBEA 1QCKA 4DLGA 9ICSA 2GO7A 4ECZA 7ICFA 1VLBA 8ICQA 5KFUA 4CCHA 3CRXA 1B43A 1SV4A 4OJ6A 3V6JA 1DOQA 4KITB 3MR2A 1ZQOA 4BWMA 8ICWA 2AU0A 2G07A 4RQ1A 4CF5A 2F2AB 3NRWA 3HX0A 2YX8A 4I2FA 4YR3A 3ZD8A 1MC8A 3M8SA 4E0DA 1D8YA 1HUZA 5J0WA 2GH1A 2WF5A 3KZXA 4DL3A 3QU4A 2AQ0A 4C80A 3NGDA 3HWTA 4PJ0U 1ZQPA 1T7PA 1J97A 4J03A 3RB0A 3RJHA 3H0MB 2AJQA 1D8LA 2I9GA 1QTMA 4QZBA 3A0HU 2HHUA 2KN7A 1T3NA 3TADC 4EBDA 4GXKA 4BXOB 1ZQGA 1XWLA 2QB1A 4YR0A 7ICEA 3FAHA 1Y88A 5AKEA 4IQUA 4RQ4A 4DFDA 2CRXA 3GU3A 3RR8A 4RUCA 4RZRA 1NK7A 4IRCA 4MF8A 4P4OA 4MEYA 4R66A 2ZUBA 1M6YA 3Q8KA 2E3TA 3GZFA 1NNLA 2W9MA 1X42A 3QX7A 5ALTA 3KHLA 2HOQA 2XI9A 3RRGA 4DSJA 4YXJA 1ZETA 3PY8A 4M9GA 3V6HA 5J0PA 4F8RA 2BCRA 3TAQA 2UVUA 3M9MB 2HHTA 1MSWD 4PZOA 5DLGA 2BPGA 3MBYA 1NKCA 4JV0A 7ICHA 2OCEA 3NRZA 3M7DA 1X66A 4BXOA 4QW9A 3IRUA 5CR0A 2RLTA 5DG8A 4KX3A 3GV8B 1L3SA 3ZDAA 3C23A 4IQWA 2JEIA 4EX7A 1SB3C 3OGUA 5EE9A 4NLNA 4RPZA 2R8JA 1JROA 5JUMA 1JXEA 1JMSA 5AM1A 3N7SC 5ALLA 3HW8A 4Y2JA 2LYBA 2OWOA 3PW5A 1YT3A 5AK3A 3RB3A 2F76X 2ZJ8A 4KLMA 2W54A 4MHVA 4GLXA 3QZ7A 5J0YA 5ALHA 3T5LA 3AU6A 4YD2A 3DEEA 5DGAA 4RNOA 3L5KA 5KFJA 4C7ZA 7ICUA 2WF7A 2ZJ5A 4YP3A 1KLNA 2K4PA 1PZNA 1TK5A 4DL6A 2RP5A 4F50A 4QWBA 3ED5A 9ICJA 3OPXA 4ED3A 1COKA 2KKPA 1ZD2P 1SL2A 3WK5A 2YMLA 4NLKA 2WF8A 4YG2A 8ICSA 2BCSA 2IMWP 4RQ5A 3WKCA 1XNSA 3N97B 4RQ6A 4Y2YA 2R8KA 1AQ6A 3SD7A 1X9WA 4M9LA 8ICMA 5CP2A 3QU2A 1ZJMA 7ICJA 3G6VA 4F91B 1T3QA 1UHUA 3GQCA 1Q3UA 4EEKA 3EWAA 4ELTA 3T5JA 3KTQA 4F92B 4PPXA 2QKQA 3TARA 5J2FA 3H8SA 4QWEA 2K4HA 4PZNA 3IHQB 5KT2A 4ECQA 4RU9A 8ICHA 3BQ1A 4PGYA 1SZPA 5DQHA 4CNQA 2G09A 5BPCA 4M9HA 2HBLA 9ICLA 3MR5A 1X9XA 3BJYA 2C2DA 3AM9A 2PI5A 1RXVA 5FP0A 2OM6A 4G3IA 4YMNA 3PNCA 1ZQTA 4I2JA 1QLNA 1XS9D 5ALFA 3RBEA 4HAIA 4PHPA 3QZ8A 4AYBC 4PHEA 8ICJA 1KKXA 3AQFA 2ISPA 5AM5A 3M9OB 4P4MA 3TKAA 2I1QA 5AKZA 5KFVA 4USAA 1RZTA 5J0QA 2BQUA 3UQ0A 5CB1A 2YTUA 1LV5A 2EZZA 4ACOA 4UAWA 3K75D 4RQ8A 3QUQA 1HEKA 4F5RA 1NI3A 1L7PA 9ICVA 4TUQA 5T14A 3NUQA 2BZFA 2J6SA 9ICGA 3TADA 1PVPA 1WWUA 9ICXA 1QQ6A 5HMLA 2FJ6A 1KL9A 2ZXHA 2M9NA 4UAVA 1SV0C 4UB8U 2PFOA 5J8YA 4MFFA 1ZD5A 3M1YA 1YZ6A 1N5XA 3FYHA 4DL7A 5ALVA 2YB1A 4ECUA 4RQ7A 2MU2A 2E1EA 5KL1B 1S0VA 9ICHA 2ZUDA 4TQSA 2R8HA 5EWEA 5ALUA 4DL4A 3ISBA 1V97A 2OYYA 4DF4A 4QWAA 2IHNA 2W9CA 2ZIWB 4EEYA 1J2NA 1BPZA 3PO4A 5AIAA 4QZEA 5KTQA 1QH9A 2ASDA 2JZBB 4ELVA 1XU4A 1L3UA 4C7YA 2ZIUB 1X9SA 2I6XA 3GIKA 2HMXA 4FBTA 1T4GA 4K4HA 4QW8A 4J9NA 1S8OA 3B0XA 4GXIA 1ZQWA 2JEFA 2JH7A 3BQ7A 4KX5A 4CDGA 5AI5A 1S0MA 4B9VA 5IIKA 1RPLA 2H3FA 5KFCA 1DGSA 4OJOA 5CWRA 9ICNA 3FC4A 2HVHA 5GTHU 1TFRA 1ZQNA 4YCXA 3B9JA 2KOBA 3C2LA 2W03A 3AEVA 5J29A 3C29A 4NM2A 2ZIWA 4PH5A 3I76A 4ED6A 1Z3EB 5J2JA 2DKZA 4C4SA 5KT7A 4J9MA 3V72A 1X9MA 4IS7A 4I2IA 3WK7A 2JZBA 7ICPA 5DDYA 2ZIUA 3RB4A 3E0FA 3GV5B 2FI1A 4OD0A 5J0XA 3RFAA 4DLEA 7ICIA 4YN4A 3RJKA 2KJ5A 3EUB2 2H3IA 5L1MA 2WAQC 4PGQA 4ECWA 3CW2C 2KSOB 4O3NA 1RYSA 1ZRMA 4KLIA 1BPXA 2HHQA 4FS1A 3PZPA 4ED0A 1NK6A 1Z19A 5KG2A 2Y1IA 5F9NA 1D9DA 4RQ0A 5IIIA 5KFBA 1ZQXA 5L1JA 5AKLA 2ALZA 1ZQYA 8ICGA 2E8OA 2I5HA 2JEJA 2BGWA 1ZQJA 2ZJAA 7ICLA 2KG5A 3H40A 5DGBA 2D3DA 3MR6A 5HR6A 5J2GA 5AI9A 3BQ0A 2KJ8A 5DG9A 5IIOA 3H8MA 4KN7A 4NXZA 3N4MB 2LM1A 2W8KA 5ALQA 3SV4A 4LZGA 3SAGA 3FM9A 3VCBA 1ZQZA 2NRTA 2KHVA 1RQLA 2Y9UA 4YQWA 4RQNA 1NJYA 2AQ4A 1TAQA 5J2CA 2NRZA 2K4EA 1Q8KA 2F3NA 5F9LA 3HKZC 4O5KA 4Y2VA 3LK9A 1L7OA 2HW3A 1HJPA 8ICOA 3H0LB 2G0AA 2HBKA 1A77A 5L1KA 2OEHA 8ICEA 5KFGA 3RAQA 2EH9A 1SZHA 2V9WA 3PR4A 4XRHA 4O5EA 1U47A 1WUDA 4OCZA 3RJIA 1UA1A 4FS2A 4UB4A 3JPQA 4I2HA 4ZOHC 5CRXA 3GIMA 5CHGA 4LVSA 3SMVA 4US8A 9ICRA 1QSLA 1XC9A 8ICUA 1L3TA 2B21A 4BX9C 2EAPA 2EZXA 3ONNA 2ATLA 1D8BA 5JU5A 5AICA 3PW0A 5J2HA 4ECXA 3WKDA 1JUDA 2WTFA 5J0UA 4F4WA 4BUGA 2VANA 1TVAA 2XICA 1FO4A 1O08A 2HCFA 3S6JA 4DEZA 3PW4A 3HJEA 2GWSA 3RAXA 5DQIA 4UB5A 3K1ZA 5L1LA 4OJLA 1S0NA 2KE7A 1Z00B 2NRVA 3UMBA 3IM1A 4J9PA 3SYZA 5KT5A 2DPJA 4GXJA 2JV3A 5HMMA 2Y1JA 3F5EA 3JPSA 5KFYA 4RT2A 2HOFA 1SL1A 5KFQA 1S76D 2ZTCA 2KIWA 5AKXA 5DG7A 3ZDCA 3UPQA 1UT8A 2PFQA 5ALPA 5AI6A 4I2GA 4KN4A 3D6JA 4GC6A 5KG7A 4O3MA 1N63A 3N7RC 3KD3A 4FFDA 4RUAA 7ICRA 5C5JA 3PR5B 2NRXA 2WF6A 3QU9A 4OO1J 1PK3A 4DWIA 1A76A 1OW5A 5AI0A 4YXMA 4KLFA 3KKAA 2J6TA 3RH5A 3CP8A 5KFLA 1N61A 1NKBA 3LYSA 1JALA 3C1ZA 3RR7A 1Z00A 4NY8A 1TAUA 3QUBA 3KHRA 5KFPA 5HHHA 1Q46A 9ICKA 2MAXA 4I2BA 3KHGA 3KBBA 4NJ8A 5AK6A 4MEXA 1V85A 1WWVA 2F77X 4OJ5A 3V7JA 5J8YC 4NLCA 5KFFA 4F2RA 1ZQUA 1ZQ1C 4CF4A 4DFKA 8ICCA 5KFAA 4EELA 4O3QA 3PX6A 3Q8SB 5TISU 3LWLA 3F2DA 2R18A 5EOZA 4J9QA 1S10A 2XGQA 2K8BB 1BPYA 2RHFA 5KFOA 1K5OA 4R63A 4I28A 2IOFK 1ZJNA 4UAUA 1ZOLA 4BJQA 5KAFU 4RNMA 1K1QA 3IG8A 2G06A 1WG8A 3AU2A 2H3VA 4Q45A 4CF3A 4RNNA 2GOLA 5ALSA 4I2CA 2KKVA 2A19A 2DWQA 2KVCA 3BZKA 1URJA 2RQ5A 5KT3A 4PGXA 4QZDA 3PSTA 1BPDA 2Z7JA 3SAHA 1DK3A 4DQSA 5ALGA 2XY5A 2JMGA 1RG6A 2G5HB 4F5QA 1ZYQA 4F4ZA 4O3OA 5AKHA 2BHNA 3RB6A 3GV7B 5KFHA 2XO7A 3RTVA 3Q8LA 5BOMA 5IINA 4C8KA 4AP9A 5JTIA 1PUZA 1QQ7A 3H4DA 1SXDA 1Z4OA 7ICSA 5E79U 2E8NA 2PMZC 5DBAA 2F8KA 2EANA 5JRTA 1ZQCA 2A1AA 3Q8QB 4KLOA 5A0LA 2HVIA 3HPOA 1KW4A 4C8LA 2BCVA 2W11A 3C28A 5AM2A 2WB1C 3NS1A 4O3PA 2IA6A 2G08A 4RQ3A 3UXNA 2W3SA 5AM3A 5KFTA 1L6NA 4U7CA 4RPYA 3UM9A 5D4BA 4I27A 2HBJA 1T94A 3M6KA 4KLDA 5KG5A 3EW9A 5AM4A 1JI7A 2ZUCA 7ICVA 4U6PA 2Y0SC 2FLPA 3MR3A 2XCPA 2D8CA 5DLFA 2M0NA 2QB0B 2ESEA 2YN4A 2YMMA 4XQ8A 1MN8A 2VKQA 5EE0A 3B0YA 5DKWA 2RDIA 9ICIA 1TV9A 3BDPA 5AK5A 2DQNB 3TAPA 4F4YA 1SL0A 2N1RA 1SXEA 2KICA 4OJPA 3C1YA 1XSLA 4EBCA 9ICPA 1WCNA 4ED2A 3A0BU 2C22A 2XC9A 3QNMA 1SWVA 3OJSA 5KG6A 1HUOA 1KBUA 3MGVA 1LKYB 8ICYA 2VIXA 1U49A 2VJ4A 2KZMA 1N60A 4Z6EA 2HI0A 2IBKA 4O3RA 1L5UA 1L3VA 1BPBA 5EE3A 1SGGA 3QEAZ 3QU7A 3WK9A 1DK2A 2XCAA 2HOIA 4J9KA 1BGXT 7ICNA 4HYKA 4F71A 1DXSA 3HKZF 1UCVA 5GTIU 5KFXA 3MFHA 5B66U 1FEZA 1LVHA 4PHAA 1ZQKA 2QLTA 1V38A 2ASLA 1HIWA 3BZCA 2WF9A 1S77D 1TE2A 1F0MA 2F1JA 2LMRA 1KN5A 1MA7A 4Z6DA 1NZPA 2KFNA 3N28A 2P66A 4JWNA 1XSPA 4NLZA 4RT3A 1LKYA 3TI0A 3RH6A 1X40A 1AROP 2F1IA 2DF4B 4CRXA 4DS5A 1JRPA 2KV2A 3OHAA 1NK9A 3R9KA 4KMOB 3TQ1A 4M2YA 2GLEA 1YZ7A 3UXOA 4FZNA 4UARA 4O5CA 2FDRA 3V6KA 2WFAA 4DF8A 5HR7A 3C2KA 1NJXA 3GFKB 2KMDA 4IQTA 1ZRNA 3BS7A 5G5HA 5J2BA 3KFUF 1RQNA 7ICTA 4I2AA 2C2RA 3NASA 3RH4A 3QYPA 3LVVA 5J2IA 4B9LA 5DQGA 1KQQA 2DBYA 4DQQA 5C0YA 3C21A 4GC7A 4BWJA 5KL8B 4A8EA 5ALMA 2KZZA 1DRGA 4QJFB 3NVYA 4F2SA 2W7PA 4JB3A 5ALYA 1RXWA 1N56A 3KKAC 4JUZA 1F5SA 2BKEA 9ICFA 2B0CA 2JH1A 1JX4A 1TK8A 3GIJA 2FMQA 8ICKA 4FZMA 4QZHA 9ICMA 4M9NA 2DPIA 8ICBA 3JPNA 2JGAA 3MC1A 2Q4TA 2FMSA 4O3SA 5AI8A 1KRPA 2IOHA 1SKSA 1D9FA 4P2HA 4UW9A 3MABA 1ZQLA 3H4BA 1UQVA 2PXIA 5KG1A 3DV9A 4Y2TA 1X2IA 1KEJA 3SI8A 2VJ5A 2RDJA 2K60A 4ELUA 2KD1A 1N5WA 4J9LA 2XY6A 1SKWA 3KHHA 4TURA 3QE9Y 3PSFA 4M0AA 5KT4A 2ES6A 4KLTA 1A0PA 1NKEA 1SIJA 4C4TA 4UB2A 1L7MA 3NVWA 1FFUA 5BOLA 1Z1BA 2W43A 3KZIU 5EWGA 3PVXA 5ALJA 4I29A 2E8MA 2R8GA 1VJ5A 9ICWA 1FFVA 1UPHA 3UMGA 4UB6U 1TK0A 3H8JA 4F4KA 1LB2B 2CXYA 3ZDDA 3AN1A 4B9UA 4DOCA 5D46A 2JEGA 8ICIA 4O9MA 3PV8A 4EYIB 4G9BA 2V4RA 4UB1A 4Y2QA 8ICFA 2HHXA 5J0TA 2UVWA 1DGJA 1NZBA 3ISCA 2W9BB 2VA2A 5AI4A 9ICUA 4PHDA 3UXPA 4TUSA 3SV3A 4GIBA 1NK5A 2KSOA 4QZGA 4ED1A 1ZQMA 3WK6A 5HHIA 2A3VA 5KFSA 1KSPA 3GIIA 2MSNA 9ICEA 1B4FA 2W04A 5KFZA 3Q8PB 5EE1A 4DO9A 3BQTA 3IG5A 7ICQA 2J6UA 4Q8FA 2FMPA 4DOAA 3HT3A 4DFJA 3C5FA 2UVRA 5KFDA 1MQ2A 4DS4A 5KFKA 2AGPA 2P35A 3HRDD 3MFIA 2YMQA 9ICTA 1ZD4A 2KFZA 1BPEA 5KG3A 2FPMA 2AGOA 2W9BA 3O0FA 4MF2A 2EZYA 4BDPA 3HILA 5ALZA 3JPOA 3BQ2A 2KJ9A 4DL2A 3PSIA 3IDWA 4UB3A 5AKKA 2P6RA 1S9FA 5AIBA 5ALWA 4ECSA 1KFSA 1OXJA 2XGPA 2L5YA 1PVRA 2V4QA 5J2AA 1NOMA 4Y2PA 4I2EA 1B22A 4C0ZA 1WCLA 3LVWA 4KLSA 2AH5A 2ZTDA 1T8EA 4IL6U 4ECYA 5KT6A 5KFIA 2KVSA 2K8CB 2CPRA 2WHEA 2JHDA
chains in the Genus database with same CATH topology
1XNSA 2MA1A 3CYMA 2KJ5A 2JGAA 3HKZF 3RF9A 2H3IA 5A0LA 2E1FA 3GZFA 3SQIA 2WAQC 2Q4TA 4BX9C 2F77X 1GO3F 2H3ZA 2YB1A 2ZIVB 3ONNA 2HOQA 2W04A 2XI9A 1HIWA 4OJ5A 4QNLA 4NLCA 1D8BA 3D2QA 2DGZA 2E1EA 2XVTA 5KL1B 3SAFA 1ZQ1C 3IG5A 3C28A 1F44A 4CGZA 2WB1C 3PZPA 1Q3UA 1MA7A 1ED1A 4AYBF 2ZIXA 3H0RB 4BUGA 4ICAA 2HBMA 2VJ5A 4QIWF 3PSPA 1Z19A 2OYYA 2LHTA 2XICA 2G08A 4P0PA 3F2DA 2R18A 1IIPA 2E5SA 3T79A 2K8BB 2KD1A 2ZIWB 1L6NA 4U7CA 2K4HA 2RHFA 3PSFA 2KEYA 2HBJA 3ALRA 1T94A 4IC9A 3CRXA 3M6KA 3K1ZA 4PL2A 2DF4B 2KNJA 4OJLA 3D2NA 1A6SA 3M7DA 4OJ6A 4WJ3B 4U6PA 2Y0SC 4P0QB 1A0PA 3N7PD 4CRXA 1OUQA 2BDUA 4KX5A 2G09A 4BJQA 4CDGA 2M0NA 2ZIUB 5HR6A 2HBLA 2KV2A 4KX3A 1CRXA 2KJ8A 3O0FA 3IG8A 2G06A 2CN1A 1Z1BA 2VKQA 2HMXA 4KMOB 2H3VA 2OM6A 2G07A 3F2CA 2F2AB 3NRWA 3F5AA 2G5IB 1ECWA 2KHQA 2YX8A 3F5EA 2DQNB 4FZNA 2HOFA 3N7SC 3VC8A 2F8LA 2PMZF 2GOLA 3SAGA 2KKVA 2JH7A 4GFJA 1UPHA 4JMUA 2KJ9A 2KIWA 2LYBA 2K8AA 2NV3A 2OXOA 2KHVA 2YB4A 2N1RA 2KICA 1YT3A 2K89A 2KVCA 2F76X 2ZG6A 4NLBA 4OJPA 5HR7A 3IN5A 4PL1A 2K4IA 2GH1A 4FE3A 1URJA 2H3FA 4AYBC 2MRLA 3KZXA 3PSTA 3F53A 4OJOA 2ZIXB 2Z7JA 3SAHA 3KFUF 3PSIA 3AQFA 2JMGA 4O3MA 2WAQF 3N7RC 1PVRA 2ZIVA 4P0PB 2LKYA 3F2BA 3DEEA 2G5HB 2K4EA 3H0MB 3LVVA 1KBUA 3MGVA 2LBOA 3AL0B 3HKZC 4FZLA 4NV0A 2W7OA 2KOBA 4ACOA 1Q3VA 2WB1F 4OO1J 2W03A 2VIXA 5C0YA 1HEKA 2VJ4A 2ZXIA 3D2SA 4C0ZA 3LVWA 3AQEA 3C29A 5KL8B 1PVQA 3H0LB 2RP5A 2D6FC 2G0AA 4A8EA 2HBKA 2ZIWA 1NZBA 5T14A 3ICXA 3NUQA 3OPXA 1SZHA 1TAMA 2RRDA 1DRGA 3CP8A 4QJFB 2XIDA 2W7PA 2KKPA 4QIWC 3VCBA 4NWIA 1PVPA 2OH2A 1WUDA 3LYSA 2CRXA 4P0QA 3GU3A 2LYAA 2PMZC 2Y0SF 2ZXHA 2JH1A 3M6ZA 2HOIA 1P7DA 3L3FX 2ZIUA 1XO0A 3E0FA 5CRXA 2H3QA 2K8CB 3SMVA 2CPRA 3IP4B 3RFAA 4FZMA 2A3VA 2JHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2A B;  2G5I B;  2D6F C;  3H0L B;  2DQN B;  2G5H B;  3H0R B;  3IP4 B;  3KFU F;  3H0M B;  2DF4 B;  1ZQ1 C;  3AL0 B;  4WJ3 B; 
#chains in the Genus database with same CATH topology
 5HP4 A;  3E58 A;  4KLG A;  5DBC A;  5J0S A;  1RYU A;  1CI4 A;  2A1J B;  2E1F A;  3OSN A;  4J9R A;  1GO3 F;  5KFW A;  1FIQ A;  2DGZ A;  4YMM A;  4EEN A;  3IV6 A;  3WU2 U;  4AYB F;  3PW2 A;  4ICA A;  3NVV A;  2B6G A;  2NYV A;  4UAY A;  8ICR A;  4C8N A;  4ZH4 A;  3DDH A;  1TKD A;  3LDA A;  4IC9 A;  4JK1 A;  5HNK A;  2KNJ A;  2HHS A;  1A6S A;  7ICG A;  4MFA A;  1ZQS A;  4Q8E A;  1CRX A;  8ICA A;  2JRZ A;  7ICK A;  3RJG A;  4RQM A;  8ICL A;  4MFC A;  2K8A A;  2NV3 A;  4NLG A;  4B9T A;  5IIJ A;  4IRD A;  4F4X A;  4KLE A;  1KFT A;  2K4I A;  1L7N A;  1ZQD A;  4F5P A;  1N62 A;  2A1J A;  2BQ3 A;  4YMO A;  3F2B A;  1N2X A;  3JPT A;  3QXG A;  4QZ9 A;  4US9 A;  4FZL A;  2W7O A;  1QSY A;  2HDO A;  2KP7 A;  3H8W A;  1ZQB A;  3PX0 A;  2E8P A;  2ZTE A;  2PKE A;  1TAM A;  5AKI A;  4F5N A;  4Y2R A;  4IR1 A;  4K4G A;  1NK4 A;  4QZC A;  4NWI A;  4DCC A;  5D49 A;  4LZD A;  2LYA A;  5B5E U;  3L3F X;  5ALE A;  9ICA A;  2FLN A;  5ALX A;  2H3Q A;  2FE9 A;  4IR9 A;  1BNO A;  1C7Y A;  2JR5 A;  1WYG A;  3SZ2 A;  4DFP A;  5J2K A;  4UQG A;  9ICC A;  5ALO A;  1QQ5 A;  2Y9T A;  3UQ2 A;  3GDX A;  3C2M A;  4ECR A;  4KLU A;  3WKB A;  2HHW A;  5ALK A;  2NO5 A;  4UAT A;  3H0R B;  2KZ3 A;  2EAM A;  3T79 A;  5K4L A;  4ECV A;  3V7K A;  3EPI A;  4RPX A;  3ALR A;  4PL2 A;  4C8O A;  1B0X A;  4P0Q B;  4NL9 C;  4Z6C A;  3Q8R B;  1QSS A;  2NRW A;  5CJ7 A;  2QAR B;  3E2E A;  3OSP A;  3M9N B;  1EXN A;  4JV1 A;  3QUC A;  5KFN A;  3U26 A;  2PFN A;  4YR2 A;  2OXO A;  1ZQV A;  4UAZ A;  5ALI A;  3MGH A;  5J2E A;  3IN5 A;  1KFD A;  1VDV A;  2JXJ A;  3F53 A;  4UAS A;  3I28 A;  2EAO A;  5G5G A;  4F72 A;  2WAQ F;  2LKY A;  2H5X A;  3JPR A;  2IHM A;  4NV0 A;  1Q3V A;  1S5L U;  1S97 A;  3D2S A;  3M8R A;  1PVQ A;  3PMN A;  1ZQF A;  5DBB A;  4XA5 A;  2W8L A;  3WK4 A;  4JWM A;  2KIV A;  4QIW C;  1JN3 A;  4F5O A;  3AMZ A;  1L8L A;  4P0Q A;  5ALD A;  4B9M A;  4Q43 A;  2BDP A;  1P7D A;  1C20 A;  2W55 A;  1NJW A;  1X6J A;  1ZQH A;  4M47 A;  2QAR A;  2MA1 A;  3EYZ A;  2AXT U;  4I2D A;  2H3Z A;  3AUO A;  4DSE A;  2KTQ A;  4CGZ A;  4QWC A;  1UA0 A;  1KDH A;  5TZV A;  2BPC A;  1CEZ A;  1UT5 A;  1ED1 A;  4IRK A;  5AHX A;  3V7L A;  2QB0 A;  2LHT A;  3TFS A;  2E5S A;  3ETL A;  4KMU A;  1XSN A;  2FLL A;  4DSL A;  1O03 A;  5AKJ A;  4UBB A;  1S0O A;  3T5H A;  3RJF A;  4YVZ A;  4KLL A;  2W9C B;  2CN1 A;  2UVV A;  4ED8 A;  3F5A A;  1ECW A;  1J2M A;  4IQV A;  2FPK A;  1JIH A;  2F8L A;  3MDA A;  2BQR A;  4R8U B;  4B6J A;  2K89 A;  1CUK A;  4DSK A;  1PK1 B;  3RJE A;  8ICX A;  8ICP A;  4TUP A;  4KTQ A;  1ZXI A;  3QUT A;  1U4B A;  5KFE A;  3ZDB A;  5KG4 A;  4Y2S A;  3H7I A;  4NM1 A;  4M6W B;  3AL0 B;  2MUT B;  1ZQR A;  4QZ8 A;  3K4G A;  1V9P A;  2LI6 A;  3MGI A;  2DL0 A;  2KK0 A;  9ICQ A;  9ICB A;  1L8O A;  3ZD9 A;  5L9X A;  3MDC A;  4F3O A;  1K1S A;  1COO A;  3QEB Z;  8ICZ A;  2YMP A;  2VA8 A;  2NO4 A;  2OHF A;  3M6Z A;  5F3X B;  2VA3 A;  5DB7 A;  1RM6 C;  1ZQE A;  1IXR A;  1SWW A;  1BNP A;  5AK4 A;  2P6U A;  5DB9 A;  3SQI A;  3PO5 A;  1ZD3 A;  4DOB A;  5DDM A;  3OTQ A;  4R8U A;  3D2Q A;  1PK1 A;  3SAF A;  4TQR A;  2Q0Z X;  5AM0 A;  4DQI A;  9ICO A;  5CEH A;  1IIP A;  1RYR A;  2DKX A;  2O6K A;  8ICT A;  1IM4 A;  4M6W A;  2MUT A;  3PW7 A;  3PX4 A;  1ZQA A;  2F1H A;  1JXL A;  2LYH A;  3ISD A;  2LM4 A;  3NVZ A;  4F93 B;  3T3F A;  3WK8 A;  2PI4 A;  2XY7 A;  1NK0 A;  1U9L A;  3F2C A;  7ICO A;  2G5I B;  3T5K A;  5KFR A;  2KHQ A;  1RDF A;  4BGD A;  4B9S A;  7ICM A;  3RJJ A;  4NL9 A;  2F44 A;  1IV8 A;  4JMU A;  4EYH B;  2YB4 A;  4NLB A;  4C4R A;  1ZQQ A;  5KG0 A;  4PL1 A;  2MRL A;  3GIL A;  1SKR A;  4DSI A;  2ZIX B;  4M9J A;  3C5G A;  5IIL A;  4P0P B;  3G6X A;  2W3R A;  4DQP A;  3ZDE A;  3BS5 B;  2AHO B;  2ZXI A;  2EDU A;  3WKA A;  2D6F C;  3SR6 A;  3ICX A;  2LPE A;  2XID A;  3TAN A;  4KLQ A;  4QZI A;  3RBD A;  3WKE A;  4EZ6 A;  1H38 A;  4RQ2 A;  2DUY A;  3L4P A;  2BPF A;  2PFP A;  4DSF A;  5AKY A;  4LJX A;  4QNL A;  3THV A;  3EZ5 A;  4R64 A;  2IOF A;  3TAC B;  3RF9 A;  4K4I A;  3NTU A;  2ZIV B;  1Z1V A;  2XVT A;  1Z4N A;  4M04 A;  4P4P A;  3JPP A;  5CA7 A;  3LWM A;  4KLJ A;  2ZIX A;  3ORY A;  8ICV A;  5ALN A;  2ASJ A;  2R8I A;  4P0P A;  3KOO A;  5L1I A;  4Y2X A;  1U45 A;  4ECT A;  2HHV A;  4YD1 A;  4QZA A;  2HSZ A;  3BS5 A;  2KEY A;  3FDS A;  1ZQI A;  2AGQ A;  5KNI A;  4X5V A;  3D2N A;  3OJU A;  3J81 j;  4J9O A;  4WJ3 B;  4KLH A;  4B9N A;  3N7P D;  2C2E A;  1OUQ A;  2BDU A;  2ISO A;  5DB6 A;  2ODG A;  4XUS A;  4J9S A;  2W9A A;  4QZF A;  3VC8 A;  2PMZ F;  2EQY A;  3QU5 A;  4GFJ A;  5EWF A;  4QWD A;  5KAI U;  3RRH A;  3OHB A;  5IIM A;  2ZG6 A;  5AKG A;  4Z6F A;  4FE3 A;  1KTQ A;  4Q44 A;  1XO1 A;  2ZIV A;  5KFM A;  1IG6 A;  4R65 A;  4Y2U A;  2LBO A;  4DQR A;  2FPL A;  3K1R B;  5DB8 A;  2WB1 F;  4O0I A;  3PML A;  2C28 A;  2BR0 A;  1NJZ A;  3AQE A;  3G6Y A;  4UBC A;  5J0R A;  3UMC A;  3TFR A;  4FBU A;  3I1Y A;  5H2F U;  2RRD A;  1SV0 A;  3ZI4 A;  3ETR A;  1NK8 A;  4DL5 A;  5ALR A;  3EPG A;  2OH2 A;  3HP6 A;  1MQ3 A;  4EX6 A;  2Y0S F;  2BCU A;  3SEN A;  4YFK A;  4ED7 A;  1XO0 A;  4C8M A;  2YY6 A;  3IP4 B;  3SEI A;  5J2D A;  4DFM A;  4JV2 A;  2DFL A;  3CYM A;  2YQE A;  4EZ9 A;  4CE6 A;  1BVS A;  1U48 A;  1N48 A;  2BCQ A;  4FO6 A;  8ICN A;  3CNH A;  1F44 A;  1X6I A;  5J0O A;  3Q8M A;  2HBM A;  4QIW F;  3PSP A;  4EBE A;  1QCK A;  4DLG A;  9ICS A;  2GO7 A;  4ECZ A;  7ICF A;  1VLB A;  8ICQ A;  5KFU A;  4CCH A;  3CRX A;  1B43 A;  1SV4 A;  4OJ6 A;  3V6J A;  1DOQ A;  4KIT B;  3MR2 A;  1ZQO A;  4BWM A;  8ICW A;  2AU0 A;  2G07 A;  4RQ1 A;  4CF5 A;  2F2A B;  3NRW A;  3HX0 A;  2YX8 A;  4I2F A;  4YR3 A;  3ZD8 A;  1MC8 A;  3M8S A;  4E0D A;  1D8Y A;  1HUZ A;  5J0W A;  2GH1 A;  2WF5 A;  3KZX A;  4DL3 A;  3QU4 A;  2AQ0 A;  4C80 A;  3NGD A;  3HWT A;  4PJ0 U;  1ZQP A;  1T7P A;  1J97 A;  4J03 A;  3RB0 A;  3RJH A;  3H0M B;  2AJQ A;  1D8L A;  2I9G A;  1QTM A;  4QZB A;  3A0H U;  2HHU A;  2KN7 A;  1T3N A;  3TAD C;  4EBD A;  4GXK A;  4BXO B;  1ZQG A;  1XWL A;  2QB1 A;  4YR0 A;  7ICE A;  3FAH A;  1Y88 A;  5AKE A;  4IQU A;  4RQ4 A;  4DFD A;  2CRX A;  3GU3 A;  3RR8 A;  4RUC A;  4RZR A;  1NK7 A;  4IRC A;  4MF8 A;  4P4O A;  4MEY A;  4R66 A;  2ZUB A;  1M6Y A;  3Q8K A;  2E3T A;  3GZF A;  1NNL A;  2W9M A;  1X42 A;  3QX7 A;  5ALT A;  3KHL A;  2HOQ A;  2XI9 A;  3RRG A;  4DSJ A;  4YXJ A;  1ZET A;  3PY8 A;  4M9G A;  3V6H A;  5J0P A;  4F8R A;  2BCR A;  3TAQ A;  2UVU A;  3M9M B;  2HHT A;  1MSW D;  4PZO A;  5DLG A;  2BPG A;  3MBY A;  1NKC A;  4JV0 A;  7ICH A;  2OCE A;  3NRZ A;  3M7D A;  1X66 A;  4BXO A;  4QW9 A;  3IRU A;  5CR0 A;  2RLT A;  5DG8 A;  4KX3 A;  3GV8 B;  1L3S A;  3ZDA A;  3C23 A;  4IQW A;  2JEI A;  4EX7 A;  1SB3 C;  3OGU A;  5EE9 A;  4NLN A;  4RPZ A;  2R8J A;  1JRO A;  5JUM A;  1JXE A;  1JMS A;  5AM1 A;  3N7S C;  5ALL A;  3HW8 A;  4Y2J A;  2LYB A;  2OWO A;  3PW5 A;  1YT3 A;  5AK3 A;  3RB3 A;  2F76 X;  2ZJ8 A;  4KLM A;  2W54 A;  4MHV A;  4GLX A;  3QZ7 A;  5J0Y A;  5ALH A;  3T5L A;  3AU6 A;  4YD2 A;  3DEE A;  5DGA A;  4RNO A;  3L5K A;  5KFJ A;  4C7Z A;  7ICU A;  2WF7 A;  2ZJ5 A;  4YP3 A;  1KLN A;  2K4P A;  1PZN A;  1TK5 A;  4DL6 A;  2RP5 A;  4F50 A;  4QWB A;  3ED5 A;  9ICJ A;  3OPX A;  4ED3 A;  1COK A;  2KKP A;  1ZD2 P;  1SL2 A;  3WK5 A;  2YML A;  4NLK A;  2WF8 A;  4YG2 A;  8ICS A;  2BCS A;  2IMW P;  4RQ5 A;  3WKC A;  1XNS A;  3N97 B;  4RQ6 A;  4Y2Y A;  2R8K A;  1AQ6 A;  3SD7 A;  1X9W A;  4M9L A;  8ICM A;  5CP2 A;  3QU2 A;  1ZJM A;  7ICJ A;  3G6V A;  4F91 B;  1T3Q A;  1UHU A;  3GQC A;  1Q3U A;  4EEK A;  3EWA A;  4ELT A;  3T5J A;  3KTQ A;  4F92 B;  4PPX A;  2QKQ A;  3TAR A;  5J2F A;  3H8S A;  4QWE A;  2K4H A;  4PZN A;  3IHQ B;  5KT2 A;  4ECQ A;  4RU9 A;  8ICH A;  3BQ1 A;  4PGY A;  1SZP A;  5DQH A;  4CNQ A;  2G09 A;  5BPC A;  4M9H A;  2HBL A;  9ICL A;  3MR5 A;  1X9X A;  3BJY A;  2C2D A;  3AM9 A;  2PI5 A;  1RXV A;  5FP0 A;  2OM6 A;  4G3I A;  4YMN A;  3PNC A;  1ZQT A;  4I2J A;  1QLN A;  1XS9 D;  5ALF A;  3RBE A;  4HAI A;  4PHP A;  3QZ8 A;  4AYB C;  4PHE A;  8ICJ A;  1KKX A;  3AQF A;  2ISP A;  5AM5 A;  3M9O B;  4P4M A;  3TKA A;  2I1Q A;  5AKZ A;  5KFV A;  4USA A;  1RZT A;  5J0Q A;  2BQU A;  3UQ0 A;  5CB1 A;  2YTU A;  1LV5 A;  2EZZ A;  4ACO A;  4UAW A;  3K75 D;  4RQ8 A;  3QUQ A;  1HEK A;  4F5R A;  1NI3 A;  1L7P A;  9ICV A;  4TUQ A;  5T14 A;  3NUQ A;  2BZF A;  2J6S A;  9ICG A;  3TAD A;  1PVP A;  1WWU A;  9ICX A;  1QQ6 A;  5HML A;  2FJ6 A;  1KL9 A;  2ZXH A;  2M9N A;  4UAV A;  1SV0 C;  4UB8 U;  2PFO A;  5J8Y A;  4MFF A;  1ZD5 A;  3M1Y A;  1YZ6 A;  1N5X A;  3FYH A;  4DL7 A;  5ALV A;  2YB1 A;  4ECU A;  4RQ7 A;  2MU2 A;  2E1E A;  5KL1 B;  1S0V A;  9ICH A;  2ZUD A;  4TQS A;  2R8H A;  5EWE A;  5ALU A;  4DL4 A;  3ISB A;  1V97 A;  2OYY A;  4DF4 A;  4QWA A;  2IHN A;  2W9C A;  2ZIW B;  4EEY A;  1J2N A;  1BPZ A;  3PO4 A;  5AIA A;  4QZE A;  5KTQ A;  1QH9 A;  2ASD A;  2JZB B;  4ELV A;  1XU4 A;  1L3U A;  4C7Y A;  2ZIU B;  1X9S A;  2I6X A;  3GIK A;  2HMX A;  4FBT A;  1T4G A;  4K4H A;  4QW8 A;  4J9N A;  1S8O A;  3B0X A;  4GXI A;  1ZQW A;  2JEF A;  2JH7 A;  3BQ7 A;  4KX5 A;  4CDG A;  5AI5 A;  1S0M A;  4B9V A;  5IIK A;  1RPL A;  2H3F A;  5KFC A;  1DGS A;  4OJO A;  5CWR A;  9ICN A;  3FC4 A;  2HVH A;  5GTH U;  1TFR A;  1ZQN A;  4YCX A;  3B9J A;  2KOB A;  3C2L A;  2W03 A;  3AEV A;  5J29 A;  3C29 A;  4NM2 A;  2ZIW A;  4PH5 A;  3I76 A;  4ED6 A;  1Z3E B;  5J2J A;  2DKZ A;  4C4S A;  5KT7 A;  4J9M A;  3V72 A;  1X9M A;  4IS7 A;  4I2I A;  3WK7 A;  2JZB A;  7ICP A;  5DDY A;  2ZIU A;  3RB4 A;  3E0F A;  3GV5 B;  2FI1 A;  4OD0 A;  5J0X A;  3RFA A;  4DLE A;  7ICI A;  4YN4 A;  3RJK A;  2KJ5 A;  3EUB 2;  2H3I A;  5L1M A;  2WAQ C;  4PGQ A;  4ECW A;  3CW2 C;  2KSO B;  4O3N A;  1RYS A;  1ZRM A;  4KLI A;  1BPX A;  2HHQ A;  4FS1 A;  3PZP A;  4ED0 A;  1NK6 A;  1Z19 A;  5KG2 A;  2Y1I A;  5F9N A;  1D9D A;  4RQ0 A;  5III A;  5KFB A;  1ZQX A;  5L1J A;  5AKL A;  2ALZ A;  1ZQY A;  8ICG A;  2E8O A;  2I5H A;  2JEJ A;  2BGW A;  1ZQJ A;  2ZJA A;  7ICL A;  2KG5 A;  3H40 A;  5DGB A;  2D3D A;  3MR6 A;  5HR6 A;  5J2G A;  5AI9 A;  3BQ0 A;  2KJ8 A;  5DG9 A;  5IIO A;  3H8M A;  4KN7 A;  4NXZ A;  3N4M B;  2LM1 A;  2W8K A;  5ALQ A;  3SV4 A;  4LZG A;  3SAG A;  3FM9 A;  3VCB A;  1ZQZ A;  2NRT A;  2KHV A;  1RQL A;  2Y9U A;  4YQW A;  4RQN A;  1NJY A;  2AQ4 A;  1TAQ A;  5J2C A;  2NRZ A;  2K4E A;  1Q8K A;  2F3N A;  5F9L A;  3HKZ C;  4O5K A;  4Y2V A;  3LK9 A;  1L7O A;  2HW3 A;  1HJP A;  8ICO A;  3H0L B;  2G0A A;  2HBK A;  1A77 A;  5L1K A;  2OEH A;  8ICE A;  5KFG A;  3RAQ A;  2EH9 A;  1SZH A;  2V9W A;  3PR4 A;  4XRH A;  4O5E A;  1U47 A;  1WUD A;  4OCZ A;  3RJI A;  1UA1 A;  4FS2 A;  4UB4 A;  3JPQ A;  4I2H A;  4ZOH C;  5CRX A;  3GIM A;  5CHG A;  4LVS A;  3SMV A;  4US8 A;  9ICR A;  1QSL A;  1XC9 A;  8ICU A;  1L3T A;  2B21 A;  4BX9 C;  2EAP A;  2EZX A;  3ONN A;  2ATL A;  1D8B A;  5JU5 A;  5AIC A;  3PW0 A;  5J2H A;  4ECX A;  3WKD A;  1JUD A;  2WTF A;  5J0U A;  4F4W A;  4BUG A;  2VAN A;  1TVA A;  2XIC A;  1FO4 A;  1O08 A;  2HCF A;  3S6J A;  4DEZ A;  3PW4 A;  3HJE A;  2GWS A;  3RAX A;  5DQI A;  4UB5 A;  3K1Z A;  5L1L A;  4OJL A;  1S0N A;  2KE7 A;  1Z00 B;  2NRV A;  3UMB A;  3IM1 A;  4J9P A;  3SYZ A;  5KT5 A;  2DPJ A;  4GXJ A;  2JV3 A;  5HMM A;  2Y1J A;  3F5E A;  3JPS A;  5KFY A;  4RT2 A;  2HOF A;  1SL1 A;  5KFQ A;  1S76 D;  2ZTC A;  2KIW A;  5AKX A;  5DG7 A;  3ZDC A;  3UPQ A;  1UT8 A;  2PFQ A;  5ALP A;  5AI6 A;  4I2G A;  4KN4 A;  3D6J A;  4GC6 A;  5KG7 A;  4O3M A;  1N63 A;  3N7R C;  3KD3 A;  4FFD A;  4RUA A;  7ICR A;  5C5J A;  3PR5 B;  2NRX A;  2WF6 A;  3QU9 A;  4OO1 J;  1PK3 A;  4DWI A;  1A76 A;  1OW5 A;  5AI0 A;  4YXM A;  4KLF A;  3KKA A;  2J6T A;  3RH5 A;  3CP8 A;  5KFL A;  1N61 A;  1NKB A;  3LYS A;  1JAL A;  3C1Z A;  3RR7 A;  1Z00 A;  4NY8 A;  1TAU A;  3QUB A;  3KHR A;  5KFP A;  5HHH A;  1Q46 A;  9ICK A;  2MAX A;  4I2B A;  3KHG A;  3KBB A;  4NJ8 A;  5AK6 A;  4MEX A;  1V85 A;  1WWV A;  2F77 X;  4OJ5 A;  3V7J A;  5J8Y C;  4NLC A;  5KFF A;  4F2R A;  1ZQU A;  1ZQ1 C;  4CF4 A;  4DFK A;  8ICC A;  5KFA A;  4EEL A;  4O3Q A;  3PX6 A;  3Q8S B;  5TIS U;  3LWL A;  3F2D A;  2R18 A;  5EOZ A;  4J9Q A;  1S10 A;  2XGQ A;  2K8B B;  1BPY A;  2RHF A;  5KFO A;  1K5O A;  4R63 A;  4I28 A;  2IOF K;  1ZJN A;  4UAU A;  1ZOL A;  4BJQ A;  5KAF U;  4RNM A;  1K1Q A;  3IG8 A;  2G06 A;  1WG8 A;  3AU2 A;  2H3V A;  4Q45 A;  4CF3 A;  4RNN A;  2GOL A;  5ALS A;  4I2C A;  2KKV A;  2A19 A;  2DWQ A;  2KVC A;  3BZK A;  1URJ A;  2RQ5 A;  5KT3 A;  4PGX A;  4QZD A;  3PST A;  1BPD A;  2Z7J A;  3SAH A;  1DK3 A;  4DQS A;  5ALG A;  2XY5 A;  2JMG A;  1RG6 A;  2G5H B;  4F5Q A;  1ZYQ A;  4F4Z A;  4O3O A;  5AKH A;  2BHN A;  3RB6 A;  3GV7 B;  5KFH A;  2XO7 A;  3RTV A;  3Q8L A;  5BOM A;  5IIN A;  4C8K A;  4AP9 A;  5JTI A;  1PUZ A;  1QQ7 A;  3H4D A;  1SXD A;  1Z4O A;  7ICS A;  5E79 U;  2E8N A;  2PMZ C;  5DBA A;  2F8K A;  2EAN A;  5JRT A;  1ZQC A;  2A1A A;  3Q8Q B;  4KLO A;  5A0L A;  2HVI A;  3HPO A;  1KW4 A;  4C8L A;  2BCV A;  2W11 A;  3C28 A;  5AM2 A;  2WB1 C;  3NS1 A;  4O3P A;  2IA6 A;  2G08 A;  4RQ3 A;  3UXN A;  2W3S A;  5AM3 A;  5KFT A;  1L6N A;  4U7C A;  4RPY A;  3UM9 A;  5D4B A;  4I27 A;  2HBJ A;  1T94 A;  3M6K A;  4KLD A;  5KG5 A;  3EW9 A;  5AM4 A;  1JI7 A;  2ZUC A;  7ICV A;  4U6P A;  2Y0S C;  2FLP A;  3MR3 A;  2XCP A;  2D8C A;  5DLF A;  2M0N A;  2QB0 B;  2ESE A;  2YN4 A;  2YMM A;  4XQ8 A;  1MN8 A;  2VKQ A;  5EE0 A;  3B0Y A;  5DKW A;  2RDI A;  9ICI A;  1TV9 A;  3BDP A;  5AK5 A;  2DQN B;  3TAP A;  4F4Y A;  1SL0 A;  2N1R A;  1SXE A;  2KIC A;  4OJP A;  3C1Y A;  1XSL A;  4EBC A;  9ICP A;  1WCN A;  4ED2 A;  3A0B U;  2C22 A;  2XC9 A;  3QNM A;  1SWV A;  3OJS A;  5KG6 A;  1HUO A;  1KBU A;  3MGV A;  1LKY B;  8ICY A;  2VIX A;  1U49 A;  2VJ4 A;  2KZM A;  1N60 A;  4Z6E A;  2HI0 A;  2IBK A;  4O3R A;  1L5U A;  1L3V A;  1BPB A;  5EE3 A;  1SGG A;  3QEA Z;  3QU7 A;  3WK9 A;  1DK2 A;  2XCA A;  2HOI A;  4J9K A;  1BGX T;  7ICN A;  4HYK A;  4F71 A;  1DXS A;  3HKZ F;  1UCV A;  5GTI U;  5KFX A;  3MFH A;  5B66 U;  1FEZ A;  1LVH A;  4PHA A;  1ZQK A;  2QLT A;  1V38 A;  2ASL A;  1HIW A;  3BZC A;  2WF9 A;  1S77 D;  1TE2 A;  1F0M A;  2F1J A;  2LMR A;  1KN5 A;  1MA7 A;  4Z6D A;  1NZP A;  2KFN A;  3N28 A;  2P66 A;  4JWN A;  1XSP A;  4NLZ A;  4RT3 A;  1LKY A;  3TI0 A;  3RH6 A;  1X40 A;  1ARO P;  2F1I A;  2DF4 B;  4CRX A;  4DS5 A;  1JRP A;  2KV2 A;  3OHA A;  1NK9 A;  3R9K A;  4KMO B;  3TQ1 A;  4M2Y A;  2GLE A;  1YZ7 A;  3UXO A;  4FZN A;  4UAR A;  4O5C A;  2FDR A;  3V6K A;  2WFA A;  4DF8 A;  5HR7 A;  3C2K A;  1NJX A;  3GFK B;  2KMD A;  4IQT A;  1ZRN A;  3BS7 A;  5G5H A;  5J2B A;  3KFU F;  1RQN A;  7ICT A;  4I2A A;  2C2R A;  3NAS A;  3RH4 A;  3QYP A;  3LVV A;  5J2I A;  4B9L A;  5DQG A;  1KQQ A;  2DBY A;  4DQQ A;  5C0Y A;  3C21 A;  4GC7 A;  4BWJ A;  5KL8 B;  4A8E A;  5ALM A;  2KZZ A;  1DRG A;  4QJF B;  3NVY A;  4F2S A;  2W7P A;  4JB3 A;  5ALY A;  1RXW A;  1N56 A;  3KKA C;  4JUZ A;  1F5S A;  2BKE A;  9ICF A;  2B0C A;  2JH1 A;  1JX4 A;  1TK8 A;  3GIJ A;  2FMQ A;  8ICK A;  4FZM A;  4QZH A;  9ICM A;  4M9N A;  2DPI A;  8ICB A;  3JPN A;  2JGA A;  3MC1 A;  2Q4T A;  2FMS A;  4O3S A;  5AI8 A;  1KRP A;  2IOH A;  1SKS A;  1D9F A;  4P2H A;  4UW9 A;  3MAB A;  1ZQL A;  3H4B A;  1UQV A;  2PXI A;  5KG1 A;  3DV9 A;  4Y2T A;  1X2I A;  1KEJ A;  3SI8 A;  2VJ5 A;  2RDJ A;  2K60 A;  4ELU A;  2KD1 A;  1N5W A;  4J9L A;  2XY6 A;  1SKW A;  3KHH A;  4TUR A;  3QE9 Y;  3PSF A;  4M0A A;  5KT4 A;  2ES6 A;  4KLT A;  1A0P A;  1NKE A;  1SIJ A;  4C4T A;  4UB2 A;  1L7M A;  3NVW A;  1FFU A;  5BOL A;  1Z1B A;  2W43 A;  3KZI U;  5EWG A;  3PVX A;  5ALJ A;  4I29 A;  2E8M A;  2R8G A;  1VJ5 A;  9ICW A;  1FFV A;  1UPH A;  3UMG A;  4UB6 U;  1TK0 A;  3H8J A;  4F4K A;  1LB2 B;  2CXY A;  3ZDD A;  3AN1 A;  4B9U A;  4DOC A;  5D46 A;  2JEG A;  8ICI A;  4O9M A;  3PV8 A;  4EYI B;  4G9B A;  2V4R A;  4UB1 A;  4Y2Q A;  8ICF A;  2HHX A;  5J0T A;  2UVW A;  1DGJ A;  1NZB A;  3ISC A;  2W9B B;  2VA2 A;  5AI4 A;  9ICU A;  4PHD A;  3UXP A;  4TUS A;  3SV3 A;  4GIB A;  1NK5 A;  2KSO A;  4QZG A;  4ED1 A;  1ZQM A;  3WK6 A;  5HHI A;  2A3V A;  5KFS A;  1KSP A;  3GII A;  2MSN A;  9ICE A;  1B4F A;  2W04 A;  5KFZ A;  3Q8P B;  5EE1 A;  4DO9 A;  3BQT A;  3IG5 A;  7ICQ A;  2J6U A;  4Q8F A;  2FMP A;  4DOA A;  3HT3 A;  4DFJ A;  3C5F A;  2UVR A;  5KFD A;  1MQ2 A;  4DS4 A;  5KFK A;  2AGP A;  2P35 A;  3HRD D;  3MFI A;  2YMQ A;  9ICT A;  1ZD4 A;  2KFZ A;  1BPE A;  5KG3 A;  2FPM A;  2AGO A;  2W9B A;  3O0F A;  4MF2 A;  2EZY A;  4BDP A;  3HIL A;  5ALZ A;  3JPO A;  3BQ2 A;  2KJ9 A;  4DL2 A;  3PSI A;  3IDW A;  4UB3 A;  5AKK A;  2P6R A;  1S9F A;  5AIB A;  5ALW A;  4ECS A;  1KFS A;  1OXJ A;  2XGP A;  2L5Y A;  1PVR A;  2V4Q A;  5J2A A;  1NOM A;  4Y2P A;  4I2E A;  1B22 A;  4C0Z A;  1WCL A;  3LVW A;  4KLS A;  2AH5 A;  2ZTD A;  1T8E A;  4IL6 U;  4ECY A;  5KT6 A;  5KFI A;  2KVS A;  2K8C B;  2CPR A;  2WHE A;  2JHD A; 
#chains in the Genus database with same CATH homology
 1XNS A;  2MA1 A;  3CYM A;  2KJ5 A;  2JGA A;  3HKZ F;  3RF9 A;  2H3I A;  5A0L A;  2E1F A;  3GZF A;  3SQI A;  2WAQ C;  2Q4T A;  4BX9 C;  2F77 X;  1GO3 F;  2H3Z A;  2YB1 A;  2ZIV B;  3ONN A;  2HOQ A;  2W04 A;  2XI9 A;  1HIW A;  4OJ5 A;  4QNL A;  4NLC A;  1D8B A;  3D2Q A;  2DGZ A;  2E1E A;  2XVT A;  5KL1 B;  3SAF A;  1ZQ1 C;  3IG5 A;  3C28 A;  1F44 A;  4CGZ A;  2WB1 C;  3PZP A;  1Q3U A;  1MA7 A;  1ED1 A;  4AYB F;  2ZIX A;  3H0R B;  4BUG A;  4ICA A;  2HBM A;  2VJ5 A;  4QIW F;  3PSP A;  1Z19 A;  2OYY A;  2LHT A;  2XIC A;  2G08 A;  4P0P A;  3F2D A;  2R18 A;  1IIP A;  2E5S A;  3T79 A;  2K8B B;  2KD1 A;  2ZIW B;  1L6N A;  4U7C A;  2K4H A;  2RHF A;  3PSF A;  2KEY A;  2HBJ A;  3ALR A;  1T94 A;  4IC9 A;  3CRX A;  3M6K A;  3K1Z A;  4PL2 A;  2DF4 B;  2KNJ A;  4OJL A;  3D2N A;  1A6S A;  3M7D A;  4OJ6 A;  4WJ3 B;  4U6P A;  2Y0S C;  4P0Q B;  1A0P A;  3N7P D;  4CRX A;  1OUQ A;  2BDU A;  4KX5 A;  2G09 A;  4BJQ A;  4CDG A;  2M0N A;  2ZIU B;  5HR6 A;  2HBL A;  2KV2 A;  4KX3 A;  1CRX A;  2KJ8 A;  3O0F A;  3IG8 A;  2G06 A;  2CN1 A;  1Z1B A;  2VKQ A;  2HMX A;  4KMO B;  2H3V A;  2OM6 A;  2G07 A;  3F2C A;  2F2A B;  3NRW A;  3F5A A;  2G5I B;  1ECW A;  2KHQ A;  2YX8 A;  3F5E A;  2DQN B;  4FZN A;  2HOF A;  3N7S C;  3VC8 A;  2F8L A;  2PMZ F;  2GOL A;  3SAG A;  2KKV A;  2JH7 A;  4GFJ A;  1UPH A;  4JMU A;  2KJ9 A;  2KIW A;  2LYB A;  2K8A A;  2NV3 A;  2OXO A;  2KHV A;  2YB4 A;  2N1R A;  2KIC A;  1YT3 A;  2K89 A;  2KVC A;  2F76 X;  2ZG6 A;  4NLB A;  4OJP A;  5HR7 A;  3IN5 A;  4PL1 A;  2K4I A;  2GH1 A;  4FE3 A;  1URJ A;  2H3F A;  4AYB C;  2MRL A;  3KZX A;  3PST A;  3F53 A;  4OJO A;  2ZIX B;  2Z7J A;  3SAH A;  3KFU F;  3PSI A;  3AQF A;  2JMG A;  4O3M A;  2WAQ F;  3N7R C;  1PVR A;  2ZIV A;  4P0P B;  2LKY A;  3F2B A;  3DEE A;  2G5H B;  2K4E A;  3H0M B;  3LVV A;  1KBU A;  3MGV A;  2LBO A;  3AL0 B;  3HKZ C;  4FZL A;  4NV0 A;  2W7O A;  2KOB A;  4ACO A;  1Q3V A;  2WB1 F;  4OO1 J;  2W03 A;  2VIX A;  5C0Y A;  1HEK A;  2VJ4 A;  2ZXI A;  3D2S A;  4C0Z A;  3LVW A;  3AQE A;  3C29 A;  5KL8 B;  1PVQ A;  3H0L B;  2RP5 A;  2D6F C;  2G0A A;  4A8E A;  2HBK A;  2ZIW A;  1NZB A;  5T14 A;  3ICX A;  3NUQ A;  3OPX A;  1SZH A;  1TAM A;  2RRD A;  1DRG A;  3CP8 A;  4QJF B;  2XID A;  2W7P A;  2KKP A;  4QIW C;  3VCB A;  4NWI A;  1PVP A;  2OH2 A;  1WUD A;  3LYS A;  2CRX A;  4P0Q A;  3GU3 A;  2LYA A;  2PMZ C;  2Y0S F;  2ZXH A;  2JH1 A;  3M6Z A;  2HOI A;  1P7D A;  3L3F X;  2ZIU A;  1XO0 A;  3E0F A;  5CRX A;  2H3Q A;  2K8C B;  3SMV A;  2CPR A;  3IP4 B;  3RFA A;  4FZM A;  2A3V A;  2JHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...