2DQNB

Structure of trna-dependent amidotransferase gatcab complexed with asn
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
405
structure length
405
Chain Sequence
FETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 115
structure length 405
sequence length 405
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2dqnB02
3KFUF 2F2AB 3AL0B 2G5IB 3H0MB 3H0RB 2D6FC 2DQNB 2DF4B 2G5HB 3IP4B 1ZQ1C 4WJ3B 3H0LB
chains in the Genus database with same CATH superfamily
1Z4OA 4DCCA 5AI8A 2I9GA 4YXMA 1D8BA 2MU2A 3EWAA 2W9BB 9ICBA 1WUDA 2LM1A 2RLTA 5KFKA 4NLBA 4J9MA 2K60A 1NZPA 3JPNA 4DEZA 4NY8A 5L9XA 4YR3A 9ICSA 4QIWC 2JEFA 5J2FA 7ICKA 5HMMA 1Q8KA 1XU4A 2F8LA 5ALIA 4K4HA 4DSEA 4YFKA 2ASDA 4ECWA 4Q45A 3WKAA 1X66A 5IIOA 1U47A 1Z4NA 3ORYA 2XI9A 2JEIA 2EAPA 3I28A 3ZD8A 5AI6A 4ELTA 2DKXA 1ZQMA 4EYHB 4ECRA 4HYKA 4M9JA 4RQ8A 4J9KA 2KG5A 4UB1A 4ECVA 8ICEA 3L4PA 4JUZA 3TKAA 4Z6CA 4K4IA 1ZQBA 4RNOA 2PXIA 2JMGA 4C7YA 1NI3A 1P7DA 1T3QA 2QARA 2LBOA 1SV4A 5CRXA 3C5GA 2FLLA 3M7DA 3FDSA 1U9LA 5KT4A 2KVSA 4RPZA 4TQSA 3RH6A 1KFTA 1IIPA 5E79U 4PZOA 1ZQOA 1VLBA 1WYGA 5KG1A 1T8EA 1ZRNA 4RU9A 5ALKA 3PO4A 3THVA 5KFFA 1RPLA 3TARA 3QU2A 5DB6A 3PR4A 1UQVA 3VC8A 4OJLA 4UQGA 8ICBA 2F3NA 2JZBA 1PUZA 5DLFA 4B9TA 1S77D 3H0LB 2KICA 2FDRA 3ISCA 1WG8A 2BCQA 3PNCA 3RJEA 5AK3A 3EW9A 2H3VA 1NK6A 2F8KA 4BUGA 4Y2YA 3SAGA 4NLNA 2KOBA 3SR6A 4LVSA 5AIBA 2FPKA 5T14A 4O9MA 2WF5A 3H4BA 5J0XA 4F92B 1QCKA 5DBBA 2EZZA 1X9SA 4J03A 4F71A 1S10A 4M9GA 2Y0SF 5KFNA 4RUAA 2JR5A 3RJGA 4DQIA 2KNJA 1HEKA 1U48A 1D8LA 5AKZA 4ECXA 2Y1JA 9ICOA 2KD1A 5KFYA 2Y1IA 4XUSA 1MSWD 4ECYA 1N2XA 3NVYA 3UMBA 4EBDA 2XY7A 2YMLA 2BCVA 5KG6A 4YVZA 1V97A 4UB2A 4YD2A 2ZIXB 2H3QA 5ALJA 4BGDA 2VA3A 2EDUA 2M9NA 3OSPA 2HBLA 5AKJA 9ICQA 2W55A 3N7PD 1NNLA 2P66A 8ICAA 2W8LA 3IM1A 4CF4A 5AK6A 4AYBF 4DS4A 9ICUA 4ECTA 1ZQLA 4DSJA 2XCAA 1QQ5A 2ZTDA 5FP0A 1TE2A 3KHHA 1BPDA 1IV8A 3M9MB 4RQMA 4KLTA 4R65A 2G09A 1B22A 2KKVA 3QUQA 4EBEA 2KSOB 3WK9A 4P4OA 4X5VA 3QZ8A 3IG8A 4US8A 4MF8A 3MGVA 2GWSA 4P4MA 3E58A 4BDPA 1MN8A 4ECSA 1SXEA 5KG5A 4BWMA 1RYSA 4DFJA 4NLCA 3Q8SB 2OEHA 1COOA 1MC8A 5DGBA 3RBDA 2FI1A 3ALRA 3UQ0A 4B9LA 3RF9A 2MAXA 2YB1A 2K4HA 5J0WA 4UAVA 2G0AA 2EZXA 8ICWA 2VA8A 3BQTA 1K1SA 1ZYQA 2DUYA 1ZQXA 2JH1A 1L6NA 5KFEA 3G6XA 1L7NA 4NV0A 1L8OA 5DGAA 3C2MA 1RXVA 5IINA 9ICCA 1F0MA 2FLNA 5L1LA 4CF3A 3Q8KA 5ALHA 3WK4A 3RB3A 4QW8A 3WKCA 8ICYA 4GFJA 4Y2UA 2VKQA 5EE0A 1KFSA 1KTQA 3KHGA 5ALGA 5ALNA 2H3ZA 1A0PA 1FFUA 5ALOA 3UXNA 4DL5A 2Q0ZX 2WAQF 1WWUA 1SWVA 4O5EA 4RQ2A 1C7YA 4DQRA 2ESEA 2OXOA 3MR2A 1JMSA 1ZXIA 5AI9A 1N48A 1ZRMA 5J0RA 3H40A 8ICOA 3BQ2A 4FZLA 2VJ5A 4Q44A 1ZQVA 3RB6A 1LKYB 4U7CA 4C4TA 5AM5A 3GIMA 3ZI4A 5KG3A 3OGUA 1QTMA 4DFKA 4M9LA 1KN5A 4IQWA 3UMCA 1TV9A 1ZQGA 3C28A 4KLDA 2E5SA 4QIWF 1QLNA 2M0NA 3C29A 5JUMA 4F5PA 3QUCA 3V7LA 1OXJA 3EPIA 5DB8A 4PZNA 1OW5A 2BPGA 3C23A 1QH9A 3A0HU 3EPGA 3V6HA 4J9LA 3SAFA 1BPBA 7ICOA 1NK9A 4J9OA 2N1RA 2R8KA 3ICXA 3HKZC 5KFMA 4B9VA 1ZQYA 1FIQA 1KQQA 4QNLA 3A0BU 2E1EA 1TAQA 3QXGA 2E8NA 5JTIA 4O3OA 4R8UA 2HHTA 3MGIA 2ZXHA 5DQHA 1V38A 4GXJA 3FC4A 4QJFB 1SKRA 4UAUA 2ZJ5A 4KITB 4QWDA 4M6WA 5EE1A 3FYHA 4FS1A 3PSFA 2WF7A 1M6YA 4UAWA 4PH5A 5KL1B 4CDGA 4DOAA 4I2EA 2NO4A 2KTQA 4EX7A 5ALRA 8ICHA 4F5RA 3K1RB 2ZJ8A 4O5KA 4CNQA 5G5GA 3SV3A 3AU6A 4B9UA 5J2BA 3G6YA 4QZIA 4KTQA 2K8AA 3H8JA 4CE6A 5F3XB 5D4BA 5TISU 2AJQA 4IC9A 2XCPA 1L3TA 4UAZA 1KW4A 4ICAA 2R8IA 3LYSA 1T7PA 4YR2A 4DL6A 4RUCA 3V6KA 2G07A 3M9OB 4KLSA 5KG7A 2XY6A 1X2IA 3NRWA 4DOCA 3KFUF 2B0CA 4QZEA 5J2KA 3J81j 3DV9A 2MRLA 2W54A 3IHQB 4OJ6A 3GFKB 1L7MA 4I2DA 4O3NA 1NK7A 1KRPA 4Y2JA 2HHXA 2C28A 1X6JA 2K4PA 4M0AA 4C7ZA 3PX4A 1L3SA 4NLZA 1ZQCA 4EBCA 4C8NA 2IMWP 3QU4A 2QB1A 3QUBA 2G06A 2XICA 4Z6FA 4KLQA 2WB1C 3WU2U 3KKAA 1N5XA 7ICPA 4C8MA 5J0UA 2R18A 4G3IA 4QZGA 4USAA 5AM4A 4IL6U 2F44A 2EH9A 2W03A 4P2HA 2FLPA 3D2QA 1TAUA 4KLJA 5EE9A 1NK5A 1S0OA 3RRGA 2LI6A 1SV0C 4MFAA 1K1QA 3GV8B 2WTFA 3BDPA 4J9PA 1X9MA 1TKDA 4PL1A 2YMQA 2K89A 5CEHA 3GV5B 2C2EA 5J2JA 2P6RA 5KFJA 1PVPA 4MEXA 3CRXA 2V4QA 1N61A 4GLXA 2BQUA 3C21A 9ICNA 4UB8U 2KZ3A 1Q3UA 5H2FU 2MUTA 9ICWA 1JROA 3MFIA 4Y2QA 2RQ5A 5L1KA 4TUQA 2PI5A 4RQ0A 4EENA 4EYIB 4TQRA 5AM2A 2NRZA 2HCFA 3MDAA 2ZXIA 4DQSA 3GZFA 8ICGA 2E8PA 2Y9UA 1TFRA 4UAYA 5J8YC 2DL0A 2OH2A 5AKEA 2GO7A 2BCRA 1KBUA 1PK1B 1LKYA 5DBCA 3Q8MA 4B9MA 3GIJA 2HMXA 1T3NA 3NGDA 2D6FC 4NL9A 1YZ7A 5AKLA 3M8RA 3T5HA 3PVXA 5KG4A 4RQ3A 5DG9A 3HT3A 2C2RA 4KLLA 7ICEA 1J2MA 4UASA 2YMMA 2UVRA 1BNPA 4M9HA 2J6TA 2NYVA 4QZHA 3KHRA 3AEVA 4JV1A 1S8OA 1ZOLA 5KFAA 9ICJA 3TADC 4ED8A 3F5AA 2HBKA 1HUOA 2J6UA 1UT5A 5HNKA 2NRWA 1Q46A 5AK4A 5J2CA 4KX5A 5ALQA 4B6JA 2W11A 3MR6A 5CA7A 1KEJA 4Y2RA 4JV2A 4O5CA 2AU0A 2E3TA 2KJ5A 3PW2A 2G08A 3OHBA 4ECZA 3KZXA 5KFUA 3DEEA 2HW3A 3Q8RB 5IIMA 1COKA 5ALTA 4DFMA 4GC6A 3TFRA 3NUQA 3HRDD 5AKKA 3IG5A 2I6XA 3ETRA 3MDCA 2AQ4A 5KG2A 5ALEA 5CJ7A 2JGAA 5KFTA 3I76A 4C0ZA 3QZ7A 4YMMA 1TK0A 3QNMA 2FMSA 3QU9A 4EEKA 1TVAA 1URJA 2BCUA 2KK0A 3C1ZA 5DG8A 2DGZA 2OWOA 5BOMA 3TAQA 3UQ2A 2WFAA 2G5IB 3UM9A 4C4RA 4ED1A 2CXYA 1SKSA 2BCSA 4C8LA 1QSLA 8ICTA 2W7OA 2F1IA 2K4IA 4M47A 1S5LU 7ICRA 2MSNA 2W3RA 3IP4B 3HW8A 1ZJNA 4Y2TA 8ICJA 3PW0A 4DFDA 5DLGA 9ICGA 5AICA 2KKPA 3PMNA 8ICVA 2DPIA 3CNHA 4C8OA 4DLEA 5DKWA 1KL9A 4F5NA 5J8YA 4A8EA 4R8UB 4UBBA 4DF8A 2UVUA 5GTIU 2ZG6A 3CW2C 1NKBA 1JN3A 3HKZF 1J97A 5CP2A 4QZ8A 3C2LA 4J9SA 3E2EA 2C22A 3GIIA 2A19A 5L1MA 1O03A 4M6WB 2NRTA 2WF8A 5ALPA 1ZQTA 5GTHU 2BQRA 4FBTA 8ICCA 4IQUA 3HJEA 2IOHA 3PX6A 1RXWA 4F91B 3BJYA 3PSPA 1IM4A 3L5KA 1BPZA 1ED1A 3RFAA 3N97B 1UCVA 1RYRA 2VA2A 5B66U 2XY5A 3F53A 5AI0A 5KT7A 3EZ5A 2ZIUA 5DDMA 1D9FA 9ICMA 1SL1A 2Y9TA 2XGPA 1NKEA 2IHMA 1CEZA 2HDOA 5L1IA 4YMOA 1NJYA 4KMUA 4EEYA 1TAMA 9ICLA 3TQ1A 9ICTA 1XWLA 3CP8A 4UB6U 3T79A 1O08A 3O0FA 4CCHA 5KFVA 5J2IA 4J9QA 3RB4A 2ASJA 2AHOB 9ICFA 1VDVA 4R63A 1UA1A 4UB5A 4OD0A 1L3VA 4IRCA 2BR0A 2BZFA 2HOQA 2Q4TA 4LJXA 2OCEA 2BKEA 3PSTA 4KX3A 2ZJAA 5J0OA 5KFRA 1ZQRA 3ZDEA 3V7KA 1X9XA 3KZIU 1D9DA 4OJOA 2GLEA 4KN4A 2AQ0A 2JEJA 2NO5A 2Z7JA 2HOIA 3QYPA 1PK1A 4F4ZA 5J2GA 4NWIA 1YZ6A 4RQ6A 4O3MA 4PGYA 3PX0A 3SZ2A 1C20A 4DL4A 4DWIA 1ZETA 1UA0A 1Y88A 2FMPA 1MQ3A 2HOFA 1A77A 4QWEA 2BPFA 2F1HA 5L1JA 2KZZA 1BVSA 2JRZA 3F2BA 2VJ4A 4QWAA 4M2YA 4GC7A 1L7OA 1NJZA 2WB1F 1BPEA 3BS5B 3H7IA 3ZDDA 4ELVA 3H0MB 2K4EA 2B21A 1S76D 4PHEA 5ALSA 1SL0A 3MC1A 1RM6C 5KFHA 3M1YA 1JXEA 3M6KA 4PJ0U 4C4SA 1SGGA 3M9NB 5KG0A 3OTQA 1SL2A 4RQ1A 4DF4A 4OJ5A 3PZPA 5DB7A 1KKXA 3H8MA 1UT8A 5KFIA 2P35A 2MUTB 4YCXA 2BPCA 2IOFA 4NLGA 2A1AA 3RJIA 5KFPA 3RAQA 4RQ7A 5DQIA 2BQ3A 1KFDA 4RPXA 1U45A 5KFGA 3OSNA 1T94A 5KFQA 4F93B 3AMZA 5J2EA 5ALWA 2XC9A 4DL7A 3PY8A 4CGZA 3LWLA 3V7JA 2WF9A 1JRPA 2ASLA 4HAIA 1B4FA 2HI0A 2W9AA 2LHTA 4F4XA 3QEAZ 1ZD5A 4F3OA 1RZTA 1KSPA 5ALMA 3V72A 5TZVA 5J2HA 4ED0A 4O3PA 5AM0A 3PR5B 1NK8A 1H38A 2LKYA 4ECQA 4DQQA 3ZDCA 3HP6A 4GXIA 4DOBA 2LPEA 1XSLA 2UVWA 2F76X 3H0RB 2D3DA 4ED7A 3T5LA 4E0DA 3RJKA 1U4BA 4XA5A 2JHDA 2E8MA 3ZDAA 3QUTA 2L5YA 7ICNA 4M9NA 7ICFA 3F2DA 3SYZA 3RAXA 2ES6A 5AKYA 3RJHA 1FEZA 5CWRA 3K75D 1WWVA 2FJ6A 4O3RA 5AKHA 2PI4A 5HHHA 1NK4A 5AK5A 4P4PA 1ZQEA 1QQ7A 1KLNA 2KVCA 2BDUA 2DKZA 4ED2A 4IRKA 1AQ6A 7ICMA 3PW4A 3FAHA 1HJPA 3NVVA 3NVWA 3Q8PB 1N56A 5ALVA 4I2GA 3FM9A 3JPRA 1S97A 3ISBA 4FE3A 2NRXA 5J2AA 2GOLA 3RTVA 3HX0A 4NM1A 1ZQWA 3C1YA 1HIWA 4P0QA 2H3IA 2LM4A 3L3FX 1BPYA 3ZD9A 2JEGA 4RT2A 3UXOA 5ALDA 4Y2XA 3LK9A 5ALZA 2CN1A 5D49A 2KE7A 4AYBC 4F50A 1S0MA 2DQNB 1MQ2A 4YR0A 3WK6A 2E1FA 8ICZA 5AIAA 3GIKA 4QW9A 1F44A 3Q8QB 4F2RA 4PGXA 1MA7A 2HHSA 1Z19A 2FE9A 2ODGA 4DSLA 3QE9Y 4F4KA 1CRXA 3RR7A 4GIBA 4Z6DA 2QB0B 2W04A 1X42A 9ICAA 1UHUA 3C5FA 2ISOA 9ICRA 4MFFA 2H3FA 5KFBA 4DO9A 2XO7A 8ICUA 2JV3A 3AUOA 5KFSA 4BJQA 2DPJA 3U26A 8ICNA 3D6JA 2DF4B 2FPMA 5AM1A 2ZUBA 4YN4A 4ACOA 2IA6A 2YQEA 4I2AA 1ECWA 2IHNA 4BWJA 2J6SA 2XGQA 1Z1BA 2F2AB 1ZQPA 3KTQA 2ZIUB 2K8BB 8ICRA 1RQNA 8ICSA 1N63A 2HHQA 3LVVA 3BS5A 8ICIA 3PW7A 1SKWA 1JI7A 4I28A 1S9FA 2IBKA 3SENA 4PHPA 3RBEA 5EOZA 3BQ1A 9ICVA 4I29A 4XRHA 9ICHA 4AP9A 3RH5A 2OHFA 1XSPA 5B5EU 4ED6A 2BGWA 1QQ6A 5EWEA 1OUQA 5HMLA 3M6ZA 5KFDA 1BPXA 3WKBA 4UW9A 4FS2A 2W7PA 2RRDA 5ALUA 2OM6A 2DBYA 1Z00B 1SIJA 3SEIA 5EWFA 1PVQA 5J0QA 2XVTA 4TUSA 1X6IA 5ALYA 3QU5A 3I1YA 3ED5A 1DGSA 1JALA 1S0VA 3JPTA 3JPOA 4OO1J 2YMPA 3LDAA 2ZUCA 4OCZA 4CF5A 3AQFA 3MABA 5G5HA 1ZD3A 3F5EA 5DDYA 4PPXA 4UBCA 4NM2A 4I27A 4O3QA 5KT5A 3HPOA 2YX8A 3IV6A 3GDXA 4F8RA 1LB2B 4RQ4A 3GQCA 2DFLA 5DQGA 2G5HB 4NLKA 3N4MB 1ZQJA 3NVZA 1FO4A 2F1JA 5DG7A 1B43A 1XC9A 2RP5A 4YXJA 3SI8A 3WKEA 2W8KA 1QSSA 5KTQA 4IRDA 1CUKA 3RRHA 2EAMA 2KJ8A 1PZNA 5AKIA 3WK7A 2W3SA 4RZRA 3AQEA 1QSYA 1A6SA 2EANA 4FFDA 7ICHA 9ICPA 1B0XA 2LYHA 3KBBA 2PMZC 1XNSA 2KEYA 3AU2A 2HHVA 4QZCA 1ZQNA 3MR3A 2O6KA 1DGJA 3T5KA 4C8KA 3N7RC 1SZHA 3N28A 2PKEA 2XIDA 4EZ6A 2AGOA 5C0YA 4FBUA 4YMNA 4JK1A 2KHVA 3BZCA 2FMQA 4JWMA 5KFCA 2RHFA 5AI5A 4I2CA 2LYAA 2QKQA 7ICJA 4UARA 2HBMA 4UB3A 1SV0A 2QLTA 1DRGA 2ZTEA 1RDFA 5J0TA 3H4DA 2EAOA 4O3SA 3LWMA 3PV8A 8ICQA 3EUB2 1NOMA 4F4YA 4I2BA 2ZIWA 2P6UA 3CYMA 1DK2A 4KLOA 5HHIA 2K8CB 1T4GA 4PHAA 4Y2SA 2BHNA 1ZD4A 3JPPA 3OJUA 3SAHA 2ZTCA 1S0NA 3H8SA 3G6VA 3AL0B 3K4GA 2KIWA 3PMLA 2QB0A 4BXOB 2DWQA 3KOOA 9ICKA 4DFPA 4Q8EA 4QWCA 1V85A 1SZPA 5ALXA 2ZUDA 2RDIA 4I2HA 2KP7A 3EYZA 4CRXA 4FO6A 5BOLA 2PFPA 1N60A 4KLHA 2ISPA 3UMGA 3AM9A 3QEBZ 4F2SA 1J2NA 3ZDBA 1BGXT 1AROP 3MFHA 5KFWA 3SQIA 9ICEA 1PK3A 1ZQZA 3DDHA 4R66A 4P0QB 5BPCA 2WF6A 3H8WA 3Q8LA 1UPHA 1F5SA 5CHGA 1JX4A 2HBJA 1A76A 1N5WA 5KAFU 3B9JA 3ONNA 4U6PA 5AKXA 1DK3A 1ZJMA 3TADA 4XQ8A 5J0YA 1ZQUA 2D8CA 1NZBA 4FZNA 3KHLA 4ECUA 7ICIA 4QZ9A 2R8GA 2EQYA 1L7PA 5J29A 1ZQSA 2YTUA 4KLUA 4RPYA 3PW5A 2KHQA 3TI0A 1D8YA 5AM3A 4P0PA 4RQNA 2V4RA 3OJSA 3QX7A 2ATLA 2HVIA 4JMUA 1DXSA 4QWBA 3MBYA 5AI4A 3RJJA 1Z00A 2EZYA 3SD7A 5IIJA 7ICLA 2KN7A 3D2SA 3C2KA 4IS7A 2YN4A 2C2DA 1NJXA 4DSIA 7ICSA 2VIXA 4DLGA 1ZQQA 3OPXA 1IXRA 1Z1VA 4FZMA 5AKGA 5J0SA 3BQ7A 1V9PA 2JH7A 5A0LA 2R8HA 3NASA 5HP4A 4EZ9A 3IRUA 3SV4A 3TANA 2W9BA 2I5HA 3NRZA 4DSFA 3R9KA 2UVVA 5KNIA 1FFVA 1TK8A 7ICGA 1XO1A 1NKCA 5KFZA 4LZDA 5KAIU 2JXJA 2E8OA 4Q43A 5IILA 2RDJA 1ZQHA 4IR1A 4C80A 3K1ZA 4PHDA 2HVHA 2CRXA 1RG6A 2WHEA 2ZIVB 1SB3C 2KFZA 2YY6A 4B9SA 5HR7A 3HILA 3BQ0A 5J2DA 4YG2A 3B0YA 3LVWA 4BX9C 2HHUA 2A1JB 2W9CB 4YP3A 2AH5A 5KT6A 3GILA 5JRTA 4KMOB 1L5UA 5ALLA 4QZDA 4I2JA 4ZOHC 1K5OA 1WCLA 5KFLA 3WKDA 4TURA 3JPSA 3SMVA 4RNNA 4KLFA 2VANA 5EE3A 4Q8FA 2MA1A 4ELUA 4KLIA 1PVRA 4Y2VA 4Z6EA 1L8LA 1X40A 3V6JA 3WK5A 4R64A 4YD1A 4MHVA 4F5OA 8ICPA 4F5QA 2PFNA 4JB3A 2I1QA 4DL3A 3RJFA 4LZGA 3RB0A 4F4WA 2GH1A 2KV2A 4KLEA 2H5XA 4DQPA 3HWTA 4GXKA 3BZKA 2OYYA 2KMDA 2IOFK 1LVHA 1YT3A 2W9MA 3F2CA 1EXNA 4OJPA 1L3UA 7ICTA 3KKAC 1SXDA 4J9NA 5DBAA 4ED3A 5K4LA 3GU3A 4BXOA 4IQTA 2NRVA 3D2NA 2Y0SC 3NTUA 5J0PA 4EX6A 3OHAA 2AGPA 4DS5A 3GV7B 1ZQDA 2R8JA 5KFOA 2A3VA 2KZMA 1JXLA 2PMZF 4J9RA 4YQWA 2HSZA 1DOQA 7ICUA 1WCNA 5DB9A 4QZFA 4I2IA 4M04A 1JIHA 1SWWA 2QARB 2AGQA 4EELA 3IDWA 3KD3A 1KDHA 1U49A 5KT3A 1RYUA 5JU5A 1XSNA 2FPLA 1GO3F 2PFQA 1ZQKA 3TACB 4I2FA 3RR8A 3UXPA 8ICLA 2LMRA 3T5JA 4JWNA 1TK5A 4ZH4A 1Q3VA 4WJ3B 4QZAA 1N62A 2ZIXA 3PSIA 3UPQA 1NJWA 2ZIWB 1NK0A 1ZD2P 2JZBB 4MF2A 2NV3A 4RNMA 5F9LA 4JV0A 1IG6A 4NL9C 5CR0A 5C5JA 9ICXA 3M8SA 1VJ5A 3IN5A 3B0XA 2F77X 2PFOA 5AHXA 3NS1A 1HUZA 3VCBA 2HHWA 4MFCA 1Z3EB 9ICIA 1ZQFA 4Y2PA 2KSOA 5IIIA 1ZQ1C 4MEYA 4UATA 4RQ5A 2KJ9A 1ZQAA 8ICKA 3T3FA 1ZQIA 4US9A 4QZBA 5KL8B 4UB4A 2CPRA 4G9BA 2KIVA 3BS7A 2KFNA 8ICXA 8ICMA 2BDPA 4DL2A 1XS9D 4K4GA 4KLGA 4IQVA 4KLMA 2YB4A 4RT3A 3E0FA 2W43A 3RH4A 8ICFA 4NXZA 3MGHA 5KT2A 2LYBA 4F72A 3TFSA 4NJ8A 2AXTU 5IIKA 1RQLA 2ALZA 3MR5A 5D46A 4DSKA 4O0IA 3TAPA 5EWGA 3PO5A 4TUPA 3AN1A 3ETLA 2B6GA 7ICVA 2ZIVA 1LV5A 1X9WA 7ICQA 5ALFA 2V9WA 4P0PB 1JUDA 1CI4A 3JPQA 5CB1A 1BNOA 1XO0A 4B9NA 3ISDA 2A1JA 4PGQA 4IR9A 2W9CA 4PL2A 2WAQC 3S6JA 4KN7A 5HR6A 5F9NA 3N7SC 5KFXA 3QU7A 3WK8A
chains in the Genus database with same CATH topology
2GH1A 2H3ZA 3PSFA 4AYBF 3AL0B 2KV2A 3H0MB 2K4EA 2JH7A 5A0LA 2DF4B 2KIWA 5KL1B 2WAQF 4CDGA 2RP5A 4ACOA 3IN5A 2F77X 1ECWA 1D8BA 2OXOA 2KVCA 3PSPA 1Z1BA 2KJ5A 1ED1A 2G08A 1WUDA 4OJLA 2F2AB 3M6KA 3RFAA 4PL1A 2BDUA 2OYYA 3VCBA 2K89A 2G09A 2KJ8A 4NLBA 3F53A 3KZXA 1YT3A 3VC8A 2KKVA 3F2CA 1PVPA 3CRXA 2ZIUA 3DEEA 2KICA 2ZIUB 3H0LB 2K8BB 4OJPA 4CRXA 4OJ5A 4FZLA 3AQEA 1A6SA 3PZPA 2VJ5A 1ZQ1C 2K8AA 3LVVA 4U7CA 1Q3UA 4QIWC 2KJ9A 3NUQA 2H3VA 3IG8A 4FE3A 5KL8B 2GOLA 4BUGA 3IG5A 2PMZC 1XNSA 3GU3A 4IC9A 3SQIA 3SAGA 3MGVA 2CPRA 2KEYA 1TAMA 2JGAA 2KOBA 3D2NA 2Y0SC 4ICAA 4C0ZA 1HIWA 2F8LA 3K1ZA 4P0QA 4P0QB 2H3IA 2CRXA 3LYSA 1URJA 3CP8A 5T14A 3C28A 3T79A 2E5SA 1UPHA 2YB4A 2ZIVB 2DGZA 2ZXIA 3GZFA 3L3FX 3O0FA 3E0FA 2HBJA 1T94A 2G07A 4QIWF 4NLCA 5HR7A 2G5IB 2A3VA 2XI9A 2M0NA 3N7RC 2LYBA 3C29A 2OH2A 2PMZF 3ONNA 4U6PA 1OUQA 1SZHA 3M6ZA 3NRWA 1KBUA 3KFUF 2XIDA 2Y0SF 1NZBA 4BX9C 2CN1A 2HOQA 2Q4TA 3ALRA 3LVWA 2W7OA 4CGZA 2W7PA 3RF9A 5C0YA 2RRDA 2YB1A 2K4HA 3PSTA 2HMXA 2MRLA 2OM6A 2K4IA 4FZNA 4AYBC 2G0AA 4OJ6A 2KHVA 2D6FC 2DQNB 4KX3A 1PVQA 2KNJA 3IP4B 2E1FA 1HEKA 2XVTA 2RHFA 1F44A 1GO3F 3SAFA 2LHTA 2LYAA 2KD1A 2HBMA 2JH1A 2ZIVA 4OJOA 1L6NA 1DRGA 1MA7A 2KHQA 4KMOB 2Z7JA 2KKPA 2N1RA 1Z19A 4P0PA 4P0PB 3ICXA 3HKZC 4NV0A 2HOIA 1CRXA 4QNLA 1XO0A 2JMGA 2G06A 2E1EA 2XICA 4OO1J 2LKYA 4JMUA 4NWIA 3SMVA 2WB1C 1P7DA 2W04A 1Q3VA 4WJ3B 4A8EA 4O3MA 4PL2A 3AQFA 2F76X 2ZG6A 2ZIXA 2ZIXB 2H3QA 2ZXHA 3F5EA 3H0RB 2LBOA 2R18A 2MA1A 3PSIA 2ZIWA 4QJFB 1PVRA 2WAQC 2ZIWB 2JHDA 2HBLA 3CYMA 4GFJA 2HOFA 5CRXA 3D2SA 3HKZF 2VKQA 2NV3A 5HR6A 3N7PD 2H3FA 2YX8A 3F5AA 2HBKA 3M7DA 3F2DA 2W03A 3N7SC 2K8CB 2VIXA 3OPXA 3F2BA 2VJ4A 1IIPA 3SAHA 2G5HB 2WB1F 3D2QA 4FZMA 1A0PA 4BJQA 4KX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFU F;  2F2A B;  3AL0 B;  2G5I B;  3H0M B;  3H0R B;  2D6F C;  2DQN B;  2DF4 B;  2G5H B;  3IP4 B;  1ZQ1 C;  4WJ3 B;  3H0L B; 
#chains in the Genus database with same CATH topology
 1Z4O A;  4DCC A;  5AI8 A;  2I9G A;  4YXM A;  1D8B A;  2MU2 A;  3EWA A;  2W9B B;  9ICB A;  1WUD A;  2LM1 A;  2RLT A;  5KFK A;  4NLB A;  4J9M A;  2K60 A;  1NZP A;  3JPN A;  4DEZ A;  4NY8 A;  5L9X A;  4YR3 A;  9ICS A;  4QIW C;  2JEF A;  5J2F A;  7ICK A;  5HMM A;  1Q8K A;  1XU4 A;  2F8L A;  5ALI A;  4K4H A;  4DSE A;  4YFK A;  2ASD A;  4ECW A;  4Q45 A;  3WKA A;  1X66 A;  5IIO A;  1U47 A;  1Z4N A;  3ORY A;  2XI9 A;  2JEI A;  2EAP A;  3I28 A;  3ZD8 A;  5AI6 A;  4ELT A;  2DKX A;  1ZQM A;  4EYH B;  4ECR A;  4HYK A;  4M9J A;  4RQ8 A;  4J9K A;  2KG5 A;  4UB1 A;  4ECV A;  8ICE A;  3L4P A;  4JUZ A;  3TKA A;  4Z6C A;  4K4I A;  1ZQB A;  4RNO A;  2PXI A;  2JMG A;  4C7Y A;  1NI3 A;  1P7D A;  1T3Q A;  2QAR A;  2LBO A;  1SV4 A;  5CRX A;  3C5G A;  2FLL A;  3M7D A;  3FDS A;  1U9L A;  5KT4 A;  2KVS A;  4RPZ A;  4TQS A;  3RH6 A;  1KFT A;  1IIP A;  5E79 U;  4PZO A;  1ZQO A;  1VLB A;  1WYG A;  5KG1 A;  1T8E A;  1ZRN A;  4RU9 A;  5ALK A;  3PO4 A;  3THV A;  5KFF A;  1RPL A;  3TAR A;  3QU2 A;  5DB6 A;  3PR4 A;  1UQV A;  3VC8 A;  4OJL A;  4UQG A;  8ICB A;  2F3N A;  2JZB A;  1PUZ A;  5DLF A;  4B9T A;  1S77 D;  3H0L B;  2KIC A;  2FDR A;  3ISC A;  1WG8 A;  2BCQ A;  3PNC A;  3RJE A;  5AK3 A;  3EW9 A;  2H3V A;  1NK6 A;  2F8K A;  4BUG A;  4Y2Y A;  3SAG A;  4NLN A;  2KOB A;  3SR6 A;  4LVS A;  5AIB A;  2FPK A;  5T14 A;  4O9M A;  2WF5 A;  3H4B A;  5J0X A;  4F92 B;  1QCK A;  5DBB A;  2EZZ A;  1X9S A;  4J03 A;  4F71 A;  1S10 A;  4M9G A;  2Y0S F;  5KFN A;  4RUA A;  2JR5 A;  3RJG A;  4DQI A;  2KNJ A;  1HEK A;  1U48 A;  1D8L A;  5AKZ A;  4ECX A;  2Y1J A;  9ICO A;  2KD1 A;  5KFY A;  2Y1I A;  4XUS A;  1MSW D;  4ECY A;  1N2X A;  3NVY A;  3UMB A;  4EBD A;  2XY7 A;  2YML A;  2BCV A;  5KG6 A;  4YVZ A;  1V97 A;  4UB2 A;  4YD2 A;  2ZIX B;  2H3Q A;  5ALJ A;  4BGD A;  2VA3 A;  2EDU A;  2M9N A;  3OSP A;  2HBL A;  5AKJ A;  9ICQ A;  2W55 A;  3N7P D;  1NNL A;  2P66 A;  8ICA A;  2W8L A;  3IM1 A;  4CF4 A;  5AK6 A;  4AYB F;  4DS4 A;  9ICU A;  4ECT A;  1ZQL A;  4DSJ A;  2XCA A;  1QQ5 A;  2ZTD A;  5FP0 A;  1TE2 A;  3KHH A;  1BPD A;  1IV8 A;  3M9M B;  4RQM A;  4KLT A;  4R65 A;  2G09 A;  1B22 A;  2KKV A;  3QUQ A;  4EBE A;  2KSO B;  3WK9 A;  4P4O A;  4X5V A;  3QZ8 A;  3IG8 A;  4US8 A;  4MF8 A;  3MGV A;  2GWS A;  4P4M A;  3E58 A;  4BDP A;  1MN8 A;  4ECS A;  1SXE A;  5KG5 A;  4BWM A;  1RYS A;  4DFJ A;  4NLC A;  3Q8S B;  2OEH A;  1COO A;  1MC8 A;  5DGB A;  3RBD A;  2FI1 A;  3ALR A;  3UQ0 A;  4B9L A;  3RF9 A;  2MAX A;  2YB1 A;  2K4H A;  5J0W A;  4UAV A;  2G0A A;  2EZX A;  8ICW A;  2VA8 A;  3BQT A;  1K1S A;  1ZYQ A;  2DUY A;  1ZQX A;  2JH1 A;  1L6N A;  5KFE A;  3G6X A;  1L7N A;  4NV0 A;  1L8O A;  5DGA A;  3C2M A;  1RXV A;  5IIN A;  9ICC A;  1F0M A;  2FLN A;  5L1L A;  4CF3 A;  3Q8K A;  5ALH A;  3WK4 A;  3RB3 A;  4QW8 A;  3WKC A;  8ICY A;  4GFJ A;  4Y2U A;  2VKQ A;  5EE0 A;  1KFS A;  1KTQ A;  3KHG A;  5ALG A;  5ALN A;  2H3Z A;  1A0P A;  1FFU A;  5ALO A;  3UXN A;  4DL5 A;  2Q0Z X;  2WAQ F;  1WWU A;  1SWV A;  4O5E A;  4RQ2 A;  1C7Y A;  4DQR A;  2ESE A;  2OXO A;  3MR2 A;  1JMS A;  1ZXI A;  5AI9 A;  1N48 A;  1ZRM A;  5J0R A;  3H40 A;  8ICO A;  3BQ2 A;  4FZL A;  2VJ5 A;  4Q44 A;  1ZQV A;  3RB6 A;  1LKY B;  4U7C A;  4C4T A;  5AM5 A;  3GIM A;  3ZI4 A;  5KG3 A;  3OGU A;  1QTM A;  4DFK A;  4M9L A;  1KN5 A;  4IQW A;  3UMC A;  1TV9 A;  1ZQG A;  3C28 A;  4KLD A;  2E5S A;  4QIW F;  1QLN A;  2M0N A;  3C29 A;  5JUM A;  4F5P A;  3QUC A;  3V7L A;  1OXJ A;  3EPI A;  5DB8 A;  4PZN A;  1OW5 A;  2BPG A;  3C23 A;  1QH9 A;  3A0H U;  3EPG A;  3V6H A;  4J9L A;  3SAF A;  1BPB A;  7ICO A;  1NK9 A;  4J9O A;  2N1R A;  2R8K A;  3ICX A;  3HKZ C;  5KFM A;  4B9V A;  1ZQY A;  1FIQ A;  1KQQ A;  4QNL A;  3A0B U;  2E1E A;  1TAQ A;  3QXG A;  2E8N A;  5JTI A;  4O3O A;  4R8U A;  2HHT A;  3MGI A;  2ZXH A;  5DQH A;  1V38 A;  4GXJ A;  3FC4 A;  4QJF B;  1SKR A;  4UAU A;  2ZJ5 A;  4KIT B;  4QWD A;  4M6W A;  5EE1 A;  3FYH A;  4FS1 A;  3PSF A;  2WF7 A;  1M6Y A;  4UAW A;  4PH5 A;  5KL1 B;  4CDG A;  4DOA A;  4I2E A;  2NO4 A;  2KTQ A;  4EX7 A;  5ALR A;  8ICH A;  4F5R A;  3K1R B;  2ZJ8 A;  4O5K A;  4CNQ A;  5G5G A;  3SV3 A;  3AU6 A;  4B9U A;  5J2B A;  3G6Y A;  4QZI A;  4KTQ A;  2K8A A;  3H8J A;  4CE6 A;  5F3X B;  5D4B A;  5TIS U;  2AJQ A;  4IC9 A;  2XCP A;  1L3T A;  4UAZ A;  1KW4 A;  4ICA A;  2R8I A;  3LYS A;  1T7P A;  4YR2 A;  4DL6 A;  4RUC A;  3V6K A;  2G07 A;  3M9O B;  4KLS A;  5KG7 A;  2XY6 A;  1X2I A;  3NRW A;  4DOC A;  3KFU F;  2B0C A;  4QZE A;  5J2K A;  3J81 j;  3DV9 A;  2MRL A;  2W54 A;  3IHQ B;  4OJ6 A;  3GFK B;  1L7M A;  4I2D A;  4O3N A;  1NK7 A;  1KRP A;  4Y2J A;  2HHX A;  2C28 A;  1X6J A;  2K4P A;  4M0A A;  4C7Z A;  3PX4 A;  1L3S A;  4NLZ A;  1ZQC A;  4EBC A;  4C8N A;  2IMW P;  3QU4 A;  2QB1 A;  3QUB A;  2G06 A;  2XIC A;  4Z6F A;  4KLQ A;  2WB1 C;  3WU2 U;  3KKA A;  1N5X A;  7ICP A;  4C8M A;  5J0U A;  2R18 A;  4G3I A;  4QZG A;  4USA A;  5AM4 A;  4IL6 U;  2F44 A;  2EH9 A;  2W03 A;  4P2H A;  2FLP A;  3D2Q A;  1TAU A;  4KLJ A;  5EE9 A;  1NK5 A;  1S0O A;  3RRG A;  2LI6 A;  1SV0 C;  4MFA A;  1K1Q A;  3GV8 B;  2WTF A;  3BDP A;  4J9P A;  1X9M A;  1TKD A;  4PL1 A;  2YMQ A;  2K89 A;  5CEH A;  3GV5 B;  2C2E A;  5J2J A;  2P6R A;  5KFJ A;  1PVP A;  4MEX A;  3CRX A;  2V4Q A;  1N61 A;  4GLX A;  2BQU A;  3C21 A;  9ICN A;  4UB8 U;  2KZ3 A;  1Q3U A;  5H2F U;  2MUT A;  9ICW A;  1JRO A;  3MFI A;  4Y2Q A;  2RQ5 A;  5L1K A;  4TUQ A;  2PI5 A;  4RQ0 A;  4EEN A;  4EYI B;  4TQR A;  5AM2 A;  2NRZ A;  2HCF A;  3MDA A;  2ZXI A;  4DQS A;  3GZF A;  8ICG A;  2E8P A;  2Y9U A;  1TFR A;  4UAY A;  5J8Y C;  2DL0 A;  2OH2 A;  5AKE A;  2GO7 A;  2BCR A;  1KBU A;  1PK1 B;  1LKY A;  5DBC A;  3Q8M A;  4B9M A;  3GIJ A;  2HMX A;  1T3N A;  3NGD A;  2D6F C;  4NL9 A;  1YZ7 A;  5AKL A;  3M8R A;  3T5H A;  3PVX A;  5KG4 A;  4RQ3 A;  5DG9 A;  3HT3 A;  2C2R A;  4KLL A;  7ICE A;  1J2M A;  4UAS A;  2YMM A;  2UVR A;  1BNP A;  4M9H A;  2J6T A;  2NYV A;  4QZH A;  3KHR A;  3AEV A;  4JV1 A;  1S8O A;  1ZOL A;  5KFA A;  9ICJ A;  3TAD C;  4ED8 A;  3F5A A;  2HBK A;  1HUO A;  2J6U A;  1UT5 A;  5HNK A;  2NRW A;  1Q46 A;  5AK4 A;  5J2C A;  4KX5 A;  5ALQ A;  4B6J A;  2W11 A;  3MR6 A;  5CA7 A;  1KEJ A;  4Y2R A;  4JV2 A;  4O5C A;  2AU0 A;  2E3T A;  2KJ5 A;  3PW2 A;  2G08 A;  3OHB A;  4ECZ A;  3KZX A;  5KFU A;  3DEE A;  2HW3 A;  3Q8R B;  5IIM A;  1COK A;  5ALT A;  4DFM A;  4GC6 A;  3TFR A;  3NUQ A;  3HRD D;  5AKK A;  3IG5 A;  2I6X A;  3ETR A;  3MDC A;  2AQ4 A;  5KG2 A;  5ALE A;  5CJ7 A;  2JGA A;  5KFT A;  3I76 A;  4C0Z A;  3QZ7 A;  4YMM A;  1TK0 A;  3QNM A;  2FMS A;  3QU9 A;  4EEK A;  1TVA A;  1URJ A;  2BCU A;  2KK0 A;  3C1Z A;  5DG8 A;  2DGZ A;  2OWO A;  5BOM A;  3TAQ A;  3UQ2 A;  2WFA A;  2G5I B;  3UM9 A;  4C4R A;  4ED1 A;  2CXY A;  1SKS A;  2BCS A;  4C8L A;  1QSL A;  8ICT A;  2W7O A;  2F1I A;  2K4I A;  4M47 A;  1S5L U;  7ICR A;  2MSN A;  2W3R A;  3IP4 B;  3HW8 A;  1ZJN A;  4Y2T A;  8ICJ A;  3PW0 A;  4DFD A;  5DLG A;  9ICG A;  5AIC A;  2KKP A;  3PMN A;  8ICV A;  2DPI A;  3CNH A;  4C8O A;  4DLE A;  5DKW A;  1KL9 A;  4F5N A;  5J8Y A;  4A8E A;  4R8U B;  4UBB A;  4DF8 A;  2UVU A;  5GTI U;  2ZG6 A;  3CW2 C;  1NKB A;  1JN3 A;  3HKZ F;  1J97 A;  5CP2 A;  4QZ8 A;  3C2L A;  4J9S A;  3E2E A;  2C22 A;  3GII A;  2A19 A;  5L1M A;  1O03 A;  4M6W B;  2NRT A;  2WF8 A;  5ALP A;  1ZQT A;  5GTH U;  2BQR A;  4FBT A;  8ICC A;  4IQU A;  3HJE A;  2IOH A;  3PX6 A;  1RXW A;  4F91 B;  3BJY A;  3PSP A;  1IM4 A;  3L5K A;  1BPZ A;  1ED1 A;  3RFA A;  3N97 B;  1UCV A;  1RYR A;  2VA2 A;  5B66 U;  2XY5 A;  3F53 A;  5AI0 A;  5KT7 A;  3EZ5 A;  2ZIU A;  5DDM A;  1D9F A;  9ICM A;  1SL1 A;  2Y9T A;  2XGP A;  1NKE A;  2IHM A;  1CEZ A;  2HDO A;  5L1I A;  4YMO A;  1NJY A;  4KMU A;  4EEY A;  1TAM A;  9ICL A;  3TQ1 A;  9ICT A;  1XWL A;  3CP8 A;  4UB6 U;  3T79 A;  1O08 A;  3O0F A;  4CCH A;  5KFV A;  5J2I A;  4J9Q A;  3RB4 A;  2ASJ A;  2AHO B;  9ICF A;  1VDV A;  4R63 A;  1UA1 A;  4UB5 A;  4OD0 A;  1L3V A;  4IRC A;  2BR0 A;  2BZF A;  2HOQ A;  2Q4T A;  4LJX A;  2OCE A;  2BKE A;  3PST A;  4KX3 A;  2ZJA A;  5J0O A;  5KFR A;  1ZQR A;  3ZDE A;  3V7K A;  1X9X A;  3KZI U;  1D9D A;  4OJO A;  2GLE A;  4KN4 A;  2AQ0 A;  2JEJ A;  2NO5 A;  2Z7J A;  2HOI A;  3QYP A;  1PK1 A;  4F4Z A;  5J2G A;  4NWI A;  1YZ6 A;  4RQ6 A;  4O3M A;  4PGY A;  3PX0 A;  3SZ2 A;  1C20 A;  4DL4 A;  4DWI A;  1ZET A;  1UA0 A;  1Y88 A;  2FMP A;  1MQ3 A;  2HOF A;  1A77 A;  4QWE A;  2BPF A;  2F1H A;  5L1J A;  2KZZ A;  1BVS A;  2JRZ A;  3F2B A;  2VJ4 A;  4QWA A;  4M2Y A;  4GC7 A;  1L7O A;  1NJZ A;  2WB1 F;  1BPE A;  3BS5 B;  3H7I A;  3ZDD A;  4ELV A;  3H0M B;  2K4E A;  2B21 A;  1S76 D;  4PHE A;  5ALS A;  1SL0 A;  3MC1 A;  1RM6 C;  5KFH A;  3M1Y A;  1JXE A;  3M6K A;  4PJ0 U;  4C4S A;  1SGG A;  3M9N B;  5KG0 A;  3OTQ A;  1SL2 A;  4RQ1 A;  4DF4 A;  4OJ5 A;  3PZP A;  5DB7 A;  1KKX A;  3H8M A;  1UT8 A;  5KFI A;  2P35 A;  2MUT B;  4YCX A;  2BPC A;  2IOF A;  4NLG A;  2A1A A;  3RJI A;  5KFP A;  3RAQ A;  4RQ7 A;  5DQI A;  2BQ3 A;  1KFD A;  4RPX A;  1U45 A;  5KFG A;  3OSN A;  1T94 A;  5KFQ A;  4F93 B;  3AMZ A;  5J2E A;  5ALW A;  2XC9 A;  4DL7 A;  3PY8 A;  4CGZ A;  3LWL A;  3V7J A;  2WF9 A;  1JRP A;  2ASL A;  4HAI A;  1B4F A;  2HI0 A;  2W9A A;  2LHT A;  4F4X A;  3QEA Z;  1ZD5 A;  4F3O A;  1RZT A;  1KSP A;  5ALM A;  3V72 A;  5TZV A;  5J2H A;  4ED0 A;  4O3P A;  5AM0 A;  3PR5 B;  1NK8 A;  1H38 A;  2LKY A;  4ECQ A;  4DQQ A;  3ZDC A;  3HP6 A;  4GXI A;  4DOB A;  2LPE A;  1XSL A;  2UVW A;  2F76 X;  3H0R B;  2D3D A;  4ED7 A;  3T5L A;  4E0D A;  3RJK A;  1U4B A;  4XA5 A;  2JHD A;  2E8M A;  3ZDA A;  3QUT A;  2L5Y A;  7ICN A;  4M9N A;  7ICF A;  3F2D A;  3SYZ A;  3RAX A;  2ES6 A;  5AKY A;  3RJH A;  1FEZ A;  5CWR A;  3K75 D;  1WWV A;  2FJ6 A;  4O3R A;  5AKH A;  2PI4 A;  5HHH A;  1NK4 A;  5AK5 A;  4P4P A;  1ZQE A;  1QQ7 A;  1KLN A;  2KVC A;  2BDU A;  2DKZ A;  4ED2 A;  4IRK A;  1AQ6 A;  7ICM A;  3PW4 A;  3FAH A;  1HJP A;  3NVV A;  3NVW A;  3Q8P B;  1N56 A;  5ALV A;  4I2G A;  3FM9 A;  3JPR A;  1S97 A;  3ISB A;  4FE3 A;  2NRX A;  5J2A A;  2GOL A;  3RTV A;  3HX0 A;  4NM1 A;  1ZQW A;  3C1Y A;  1HIW A;  4P0Q A;  2H3I A;  2LM4 A;  3L3F X;  1BPY A;  3ZD9 A;  2JEG A;  4RT2 A;  3UXO A;  5ALD A;  4Y2X A;  3LK9 A;  5ALZ A;  2CN1 A;  5D49 A;  2KE7 A;  4AYB C;  4F50 A;  1S0M A;  2DQN B;  1MQ2 A;  4YR0 A;  3WK6 A;  2E1F A;  8ICZ A;  5AIA A;  3GIK A;  4QW9 A;  1F44 A;  3Q8Q B;  4F2R A;  4PGX A;  1MA7 A;  2HHS A;  1Z19 A;  2FE9 A;  2ODG A;  4DSL A;  3QE9 Y;  4F4K A;  1CRX A;  3RR7 A;  4GIB A;  4Z6D A;  2QB0 B;  2W04 A;  1X42 A;  9ICA A;  1UHU A;  3C5F A;  2ISO A;  9ICR A;  4MFF A;  2H3F A;  5KFB A;  4DO9 A;  2XO7 A;  8ICU A;  2JV3 A;  3AUO A;  5KFS A;  4BJQ A;  2DPJ A;  3U26 A;  8ICN A;  3D6J A;  2DF4 B;  2FPM A;  5AM1 A;  2ZUB A;  4YN4 A;  4ACO A;  2IA6 A;  2YQE A;  4I2A A;  1ECW A;  2IHN A;  4BWJ A;  2J6S A;  2XGQ A;  1Z1B A;  2F2A B;  1ZQP A;  3KTQ A;  2ZIU B;  2K8B B;  8ICR A;  1RQN A;  8ICS A;  1N63 A;  2HHQ A;  3LVV A;  3BS5 A;  8ICI A;  3PW7 A;  1SKW A;  1JI7 A;  4I28 A;  1S9F A;  2IBK A;  3SEN A;  4PHP A;  3RBE A;  5EOZ A;  3BQ1 A;  9ICV A;  4I29 A;  4XRH A;  9ICH A;  4AP9 A;  3RH5 A;  2OHF A;  1XSP A;  5B5E U;  4ED6 A;  2BGW A;  1QQ6 A;  5EWE A;  1OUQ A;  5HML A;  3M6Z A;  5KFD A;  1BPX A;  3WKB A;  4UW9 A;  4FS2 A;  2W7P A;  2RRD A;  5ALU A;  2OM6 A;  2DBY A;  1Z00 B;  1SIJ A;  3SEI A;  5EWF A;  1PVQ A;  5J0Q A;  2XVT A;  4TUS A;  1X6I A;  5ALY A;  3QU5 A;  3I1Y A;  3ED5 A;  1DGS A;  1JAL A;  1S0V A;  3JPT A;  3JPO A;  4OO1 J;  2YMP A;  3LDA A;  2ZUC A;  4OCZ A;  4CF5 A;  3AQF A;  3MAB A;  5G5H A;  1ZD3 A;  3F5E A;  5DDY A;  4PPX A;  4UBC A;  4NM2 A;  4I27 A;  4O3Q A;  5KT5 A;  3HPO A;  2YX8 A;  3IV6 A;  3GDX A;  4F8R A;  1LB2 B;  4RQ4 A;  3GQC A;  2DFL A;  5DQG A;  2G5H B;  4NLK A;  3N4M B;  1ZQJ A;  3NVZ A;  1FO4 A;  2F1J A;  5DG7 A;  1B43 A;  1XC9 A;  2RP5 A;  4YXJ A;  3SI8 A;  3WKE A;  2W8K A;  1QSS A;  5KTQ A;  4IRD A;  1CUK A;  3RRH A;  2EAM A;  2KJ8 A;  1PZN A;  5AKI A;  3WK7 A;  2W3S A;  4RZR A;  3AQE A;  1QSY A;  1A6S A;  2EAN A;  4FFD A;  7ICH A;  9ICP A;  1B0X A;  2LYH A;  3KBB A;  2PMZ C;  1XNS A;  2KEY A;  3AU2 A;  2HHV A;  4QZC A;  1ZQN A;  3MR3 A;  2O6K A;  1DGJ A;  3T5K A;  4C8K A;  3N7R C;  1SZH A;  3N28 A;  2PKE A;  2XID A;  4EZ6 A;  2AGO A;  5C0Y A;  4FBU A;  4YMN A;  4JK1 A;  2KHV A;  3BZC A;  2FMQ A;  4JWM A;  5KFC A;  2RHF A;  5AI5 A;  4I2C A;  2LYA A;  2QKQ A;  7ICJ A;  4UAR A;  2HBM A;  4UB3 A;  1SV0 A;  2QLT A;  1DRG A;  2ZTE A;  1RDF A;  5J0T A;  3H4D A;  2EAO A;  4O3S A;  3LWM A;  3PV8 A;  8ICQ A;  3EUB 2;  1NOM A;  4F4Y A;  4I2B A;  2ZIW A;  2P6U A;  3CYM A;  1DK2 A;  4KLO A;  5HHI A;  2K8C B;  1T4G A;  4PHA A;  4Y2S A;  2BHN A;  1ZD4 A;  3JPP A;  3OJU A;  3SAH A;  2ZTC A;  1S0N A;  3H8S A;  3G6V A;  3AL0 B;  3K4G A;  2KIW A;  3PML A;  2QB0 A;  4BXO B;  2DWQ A;  3KOO A;  9ICK A;  4DFP A;  4Q8E A;  4QWC A;  1V85 A;  1SZP A;  5ALX A;  2ZUD A;  2RDI A;  4I2H A;  2KP7 A;  3EYZ A;  4CRX A;  4FO6 A;  5BOL A;  2PFP A;  1N60 A;  4KLH A;  2ISP A;  3UMG A;  3AM9 A;  3QEB Z;  4F2S A;  1J2N A;  3ZDB A;  1BGX T;  1ARO P;  3MFH A;  5KFW A;  3SQI A;  9ICE A;  1PK3 A;  1ZQZ A;  3DDH A;  4R66 A;  4P0Q B;  5BPC A;  2WF6 A;  3H8W A;  3Q8L A;  1UPH A;  1F5S A;  5CHG A;  1JX4 A;  2HBJ A;  1A76 A;  1N5W A;  5KAF U;  3B9J A;  3ONN A;  4U6P A;  5AKX A;  1DK3 A;  1ZJM A;  3TAD A;  4XQ8 A;  5J0Y A;  1ZQU A;  2D8C A;  1NZB A;  4FZN A;  3KHL A;  4ECU A;  7ICI A;  4QZ9 A;  2R8G A;  2EQY A;  1L7P A;  5J29 A;  1ZQS A;  2YTU A;  4KLU A;  4RPY A;  3PW5 A;  2KHQ A;  3TI0 A;  1D8Y A;  5AM3 A;  4P0P A;  4RQN A;  2V4R A;  3OJS A;  3QX7 A;  2ATL A;  2HVI A;  4JMU A;  1DXS A;  4QWB A;  3MBY A;  5AI4 A;  3RJJ A;  1Z00 A;  2EZY A;  3SD7 A;  5IIJ A;  7ICL A;  2KN7 A;  3D2S A;  3C2K A;  4IS7 A;  2YN4 A;  2C2D A;  1NJX A;  4DSI A;  7ICS A;  2VIX A;  4DLG A;  1ZQQ A;  3OPX A;  1IXR A;  1Z1V A;  4FZM A;  5AKG A;  5J0S A;  3BQ7 A;  1V9P A;  2JH7 A;  5A0L A;  2R8H A;  3NAS A;  5HP4 A;  4EZ9 A;  3IRU A;  3SV4 A;  3TAN A;  2W9B A;  2I5H A;  3NRZ A;  4DSF A;  3R9K A;  2UVV A;  5KNI A;  1FFV A;  1TK8 A;  7ICG A;  1XO1 A;  1NKC A;  5KFZ A;  4LZD A;  5KAI U;  2JXJ A;  2E8O A;  4Q43 A;  5IIL A;  2RDJ A;  1ZQH A;  4IR1 A;  4C80 A;  3K1Z A;  4PHD A;  2HVH A;  2CRX A;  1RG6 A;  2WHE A;  2ZIV B;  1SB3 C;  2KFZ A;  2YY6 A;  4B9S A;  5HR7 A;  3HIL A;  3BQ0 A;  5J2D A;  4YG2 A;  3B0Y A;  3LVW A;  4BX9 C;  2HHU A;  2A1J B;  2W9C B;  4YP3 A;  2AH5 A;  5KT6 A;  3GIL A;  5JRT A;  4KMO B;  1L5U A;  5ALL A;  4QZD A;  4I2J A;  4ZOH C;  1K5O A;  1WCL A;  5KFL A;  3WKD A;  4TUR A;  3JPS A;  3SMV A;  4RNN A;  4KLF A;  2VAN A;  5EE3 A;  4Q8F A;  2MA1 A;  4ELU A;  4KLI A;  1PVR A;  4Y2V A;  4Z6E A;  1L8L A;  1X40 A;  3V6J A;  3WK5 A;  4R64 A;  4YD1 A;  4MHV A;  4F5O A;  8ICP A;  4F5Q A;  2PFN A;  4JB3 A;  2I1Q A;  4DL3 A;  3RJF A;  4LZG A;  3RB0 A;  4F4W A;  2GH1 A;  2KV2 A;  4KLE A;  2H5X A;  4DQP A;  3HWT A;  4GXK A;  3BZK A;  2OYY A;  2KMD A;  2IOF K;  1LVH A;  1YT3 A;  2W9M A;  3F2C A;  1EXN A;  4OJP A;  1L3U A;  7ICT A;  3KKA C;  1SXD A;  4J9N A;  5DBA A;  4ED3 A;  5K4L A;  3GU3 A;  4BXO A;  4IQT A;  2NRV A;  3D2N A;  2Y0S C;  3NTU A;  5J0P A;  4EX6 A;  3OHA A;  2AGP A;  4DS5 A;  3GV7 B;  1ZQD A;  2R8J A;  5KFO A;  2A3V A;  2KZM A;  1JXL A;  2PMZ F;  4J9R A;  4YQW A;  2HSZ A;  1DOQ A;  7ICU A;  1WCN A;  5DB9 A;  4QZF A;  4I2I A;  4M04 A;  1JIH A;  1SWW A;  2QAR B;  2AGQ A;  4EEL A;  3IDW A;  3KD3 A;  1KDH A;  1U49 A;  5KT3 A;  1RYU A;  5JU5 A;  1XSN A;  2FPL A;  1GO3 F;  2PFQ A;  1ZQK A;  3TAC B;  4I2F A;  3RR8 A;  3UXP A;  8ICL A;  2LMR A;  3T5J A;  4JWN A;  1TK5 A;  4ZH4 A;  1Q3V A;  4WJ3 B;  4QZA A;  1N62 A;  2ZIX A;  3PSI A;  3UPQ A;  1NJW A;  2ZIW B;  1NK0 A;  1ZD2 P;  2JZB B;  4MF2 A;  2NV3 A;  4RNM A;  5F9L A;  4JV0 A;  1IG6 A;  4NL9 C;  5CR0 A;  5C5J A;  9ICX A;  3M8S A;  1VJ5 A;  3IN5 A;  3B0X A;  2F77 X;  2PFO A;  5AHX A;  3NS1 A;  1HUZ A;  3VCB A;  2HHW A;  4MFC A;  1Z3E B;  9ICI A;  1ZQF A;  4Y2P A;  2KSO A;  5III A;  1ZQ1 C;  4MEY A;  4UAT A;  4RQ5 A;  2KJ9 A;  1ZQA A;  8ICK A;  3T3F A;  1ZQI A;  4US9 A;  4QZB A;  5KL8 B;  4UB4 A;  2CPR A;  4G9B A;  2KIV A;  3BS7 A;  2KFN A;  8ICX A;  8ICM A;  2BDP A;  4DL2 A;  1XS9 D;  4K4G A;  4KLG A;  4IQV A;  4KLM A;  2YB4 A;  4RT3 A;  3E0F A;  2W43 A;  3RH4 A;  8ICF A;  4NXZ A;  3MGH A;  5KT2 A;  2LYB A;  4F72 A;  3TFS A;  4NJ8 A;  2AXT U;  5IIK A;  1RQL A;  2ALZ A;  3MR5 A;  5D46 A;  4DSK A;  4O0I A;  3TAP A;  5EWG A;  3PO5 A;  4TUP A;  3AN1 A;  3ETL A;  2B6G A;  7ICV A;  2ZIV A;  1LV5 A;  1X9W A;  7ICQ A;  5ALF A;  2V9W A;  4P0P B;  1JUD A;  1CI4 A;  3JPQ A;  5CB1 A;  1BNO A;  1XO0 A;  4B9N A;  3ISD A;  2A1J A;  4PGQ A;  4IR9 A;  2W9C A;  4PL2 A;  2WAQ C;  3S6J A;  4KN7 A;  5HR6 A;  5F9N A;  3N7S C;  5KFX A;  3QU7 A;  3WK8 A; 
#chains in the Genus database with same CATH homology
 2GH1 A;  2H3Z A;  3PSF A;  4AYB F;  3AL0 B;  2KV2 A;  3H0M B;  2K4E A;  2JH7 A;  5A0L A;  2DF4 B;  2KIW A;  5KL1 B;  2WAQ F;  4CDG A;  2RP5 A;  4ACO A;  3IN5 A;  2F77 X;  1ECW A;  1D8B A;  2OXO A;  2KVC A;  3PSP A;  1Z1B A;  2KJ5 A;  1ED1 A;  2G08 A;  1WUD A;  4OJL A;  2F2A B;  3M6K A;  3RFA A;  4PL1 A;  2BDU A;  2OYY A;  3VCB A;  2K89 A;  2G09 A;  2KJ8 A;  4NLB A;  3F53 A;  3KZX A;  1YT3 A;  3VC8 A;  2KKV A;  3F2C A;  1PVP A;  3CRX A;  2ZIU A;  3DEE A;  2KIC A;  2ZIU B;  3H0L B;  2K8B B;  4OJP A;  4CRX A;  4OJ5 A;  4FZL A;  3AQE A;  1A6S A;  3PZP A;  2VJ5 A;  1ZQ1 C;  2K8A A;  3LVV A;  4U7C A;  1Q3U A;  4QIW C;  2KJ9 A;  3NUQ A;  2H3V A;  3IG8 A;  4FE3 A;  5KL8 B;  2GOL A;  4BUG A;  3IG5 A;  2PMZ C;  1XNS A;  3GU3 A;  4IC9 A;  3SQI A;  3SAG A;  3MGV A;  2CPR A;  2KEY A;  1TAM A;  2JGA A;  2KOB A;  3D2N A;  2Y0S C;  4ICA A;  4C0Z A;  1HIW A;  2F8L A;  3K1Z A;  4P0Q A;  4P0Q B;  2H3I A;  2CRX A;  3LYS A;  1URJ A;  3CP8 A;  5T14 A;  3C28 A;  3T79 A;  2E5S A;  1UPH A;  2YB4 A;  2ZIV B;  2DGZ A;  2ZXI A;  3GZF A;  3L3F X;  3O0F A;  3E0F A;  2HBJ A;  1T94 A;  2G07 A;  4QIW F;  4NLC A;  5HR7 A;  2G5I B;  2A3V A;  2XI9 A;  2M0N A;  3N7R C;  2LYB A;  3C29 A;  2OH2 A;  2PMZ F;  3ONN A;  4U6P A;  1OUQ A;  1SZH A;  3M6Z A;  3NRW A;  1KBU A;  3KFU F;  2XID A;  2Y0S F;  1NZB A;  4BX9 C;  2CN1 A;  2HOQ A;  2Q4T A;  3ALR A;  3LVW A;  2W7O A;  4CGZ A;  2W7P A;  3RF9 A;  5C0Y A;  2RRD A;  2YB1 A;  2K4H A;  3PST A;  2HMX A;  2MRL A;  2OM6 A;  2K4I A;  4FZN A;  4AYB C;  2G0A A;  4OJ6 A;  2KHV A;  2D6F C;  2DQN B;  4KX3 A;  1PVQ A;  2KNJ A;  3IP4 B;  2E1F A;  1HEK A;  2XVT A;  2RHF A;  1F44 A;  1GO3 F;  3SAF A;  2LHT A;  2LYA A;  2KD1 A;  2HBM A;  2JH1 A;  2ZIV A;  4OJO A;  1L6N A;  1DRG A;  1MA7 A;  2KHQ A;  4KMO B;  2Z7J A;  2KKP A;  2N1R A;  1Z19 A;  4P0P A;  4P0P B;  3ICX A;  3HKZ C;  4NV0 A;  2HOI A;  1CRX A;  4QNL A;  1XO0 A;  2JMG A;  2G06 A;  2E1E A;  2XIC A;  4OO1 J;  2LKY A;  4JMU A;  4NWI A;  3SMV A;  2WB1 C;  1P7D A;  2W04 A;  1Q3V A;  4WJ3 B;  4A8E A;  4O3M A;  4PL2 A;  3AQF A;  2F76 X;  2ZG6 A;  2ZIX A;  2ZIX B;  2H3Q A;  2ZXH A;  3F5E A;  3H0R B;  2LBO A;  2R18 A;  2MA1 A;  3PSI A;  2ZIW A;  4QJF B;  1PVR A;  2WAQ C;  2ZIW B;  2JHD A;  2HBL A;  3CYM A;  4GFJ A;  2HOF A;  5CRX A;  3D2S A;  3HKZ F;  2VKQ A;  2NV3 A;  5HR6 A;  3N7P D;  2H3F A;  2YX8 A;  3F5A A;  2HBK A;  3M7D A;  3F2D A;  2W03 A;  3N7S C;  2K8C B;  2VIX A;  3OPX A;  3F2B A;  2VJ4 A;  1IIP A;  3SAH A;  2G5H B;  2WB1 F;  3D2Q A;  4FZM A;  1A0P A;  4BJQ A;  4KX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...