2DQNB

Structure of trna-dependent amidotransferase gatcab complexed with asn
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
405
structure length
405
Chain Sequence
b'FETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
molecule tags Ligase
source organism Staphylococcus aureus
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
total genus 115
structure length 405
sequence length 405
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2dqnB02
2G5IB 3H0RB 3IP4B 2F2AB 2DQNB 2DF4B 2G5HB 4WJ3B 3AL0B 3KFUF 3H0LB 1ZQ1C 2D6FC 3H0MB
chains in the Genus database with same CATH superfamily
2K4PA 1Z3EB 4KX3A 1S10A 5CP2A 5DGBA 4DSLA 4Y2XA 3QU2A 3ZD8A 4RUCA 4TUPA 2OXOA 2ISOA 5AM5A 1SGGA 1ZQLA 1ZQJA 3SV3A 3NS1A 2C22A 1JMSA 3EZ5A 2G0AA 5DBCA 2KKPA 3AL0B 3MGVA 4PPXA 1Q3UA 1ZQNA 4QWEA 3RJGA 3LVWA 5KG7A 1UCVA 2FMSA 1VJ5A 3PZPA 5ALJA 4KLOA 4YVZA 4ECQA 4DOCA 4OJLA 3RAXA 3H8JA 1ZQVA 1SV4A 7ICPA 4DSJA 4M9NA 5KFDA 5J0OA 1QQ7A 1PK1A 4NLNA 4O5CA 2Y0SF 3H7IA 2E5SA 7ICFA 3E58A 2LMRA 9ICEA 4DOBA 4C80A 3T5HA 2ZUDA 4ECTA 2IHNA 3SAHA 4QIWF 1T4GA 3PY8A 3ISBA 3PW4A 5HNKA 4RNNA 4EYHB 2CPRA 2LHTA 5BPCA 3FYHA 4EZ9A 2K89A 1BNPA 2W3RA 2F1JA 3UMBA 1ZQFA 1IM4A 1IG6A 4UB3A 3DV9A 4ECRA 3SI8A 4EX7A 4I2GA 1N60A 2KN7A 3WK8A 2G07A 3EWAA 2ZJAA 4MFAA 8ICSA 8ICLA 2UVWA 4O3PA 1TK0A 1UT5A 2FLLA 4JV0A 4RPXA 5ALLA 2AXTU 1L3UA 4GFJA 1O08A 3GFKB 2F77X 3H0RB 3ZI4A 4UATA 3C1YA 1NI3A 4B9UA 2QARA 3AEVA 3H0MB 4QZIA 4Y2PA 1PK3A 5KT4A 1ZQIA 1RPLA 3OHBA 1SKWA 4YMNA 2HHXA 4F5QA 4IQTA 4Y2UA 3EPGA 4AYBF 4FS1A 4ED8A 2JZBB 1JIHA 4ED6A 1ZJMA 1KLNA 1KW4A 3B0YA 4Z6DA 5TISU 1WWVA 5TZVA 1X9MA 4XA5A 2UVRA 4DF4A 2OWOA 1TV9A 2JEGA 5EWFA 9ICAA 3GIJA 5KFQA 2E1FA 5KFAA 1OUQA 5HR7A 1BNOA 3RH6A 1U47A 4GC7A 1URJA 4ELVA 9ICXA 4DFKA 2P35A 5KG1A 4RQ7A 2BQUA 1ZQMA 4EYIB 9ICGA 1F5SA 2ZIUB 3GQCA 4BXOB 2PFNA 2V4RA 2Q0ZX 3TAQA 2KJ5A 5J0PA 5DG9A 4Y2VA 2WFAA 3OPXA 2FPKA 4PZNA 1NKCA 4R63A 2ES6A 4I2EA 2HBMA 4M6WA 3RR8A 2EQYA 1MA7A 4F72A 2P66A 3HP6A 4Y2TA 3PSTA 1CRXA 2AJQA 3KKAA 1Z1BA 2JEJA 5CJ7A 2HBKA 4U7CA 5AK3A 7ICJA 3N7PD 2IBKA 1IIPA 2IOHA 2LBOA 2YMPA 3GV7B 4FBTA 3OSPA 2LM1A 3BZKA 2IMWP 1HIWA 2F2AB 4ED2A 3JPQA 5ALWA 3C29A 1SL1A 8ICQA 4YQWA 4ED3A 2W9BA 4USAA 5CEHA 4QWCA 4IQVA 4KLGA 4J9KA 1N2XA 5J2DA 4RQ0A 3PR4A 1KFDA 4DCCA 5J2EA 1KRPA 1P7DA 1TAQA 4R8UB 4C4TA 3WKDA 4GXJA 3BDPA 1L3SA 8ICUA 1V97A 4C8LA 1Q8KA 4JV1A 2I1QA 1ED1A 4QZCA 3G6VA 4I2FA 3QEBZ 3G6XA 4EENA 3F53A 4KLQA 3T5LA 5F9LA 5J0RA 1XC9A 1S76D 2OYYA 4F5PA 3OHAA 5DQHA 1ZD4A 1RXWA 2LYHA 4NLKA 2QLTA 4GIBA 3MR5A 3AUOA 9ICFA 2BDPA 4P2HA 2LM4A 2HOIA 1MSWD 1EXNA 1TAMA 3KZXA 5J2BA 5KG6A 3QNMA 4ECVA 1ZD5A 4Y2QA 3LYSA 5AKEA 2R8HA 2RLTA 2Y9TA 3QUBA 2NO5A 5EOZA 4R64A 4P0PA 4RQ2A 3KTQA 2K60A 4Q8FA 5AM1A 3MFIA 3RJFA 3GV5B 4Q8EA 5KFUA 1N5XA 2A19A 1HUOA 3MC1A 3WK6A 3BQ1A 4YR3A 2PFQA 4UB4A 3HJEA 3I76A 2W04A 4RNMA 3F5EA 4NL9C 1L3VA 2F44A 2HDOA 4BDPA 2BZFA 1S97A 4QZ8A 9ICPA 1ZQQA 1X42A 3UXNA 5DB9A 5J0WA 4O3MA 4I29A 4PGYA 3N28A 3MDCA 1AQ6A 1O03A 2FI1A 2Q4TA 4PGXA 3AU6A 5KT2A 4XRHA 2DL0A 3PSIA 2E1EA 1A0PA 3M9MB 2PMZF 4DSEA 3QUTA 4F2SA 2H3ZA 3WK5A 1L5UA 2JHDA 3RBDA 1B0XA 4B9SA 2FPMA 2WF7A 1DOQA 1QQ5A 4IRKA 1MN8A 1KQQA 1ZQKA 8ICOA 3TQ1A 2PI4A 4RQNA 4YR2A 2EDUA 3V6JA 1TK5A 2BDUA 4PJ0U 5D49A 2IOFK 5AK6A 5KL8B 3Q8RB 4KLLA 4RU9A 4CF3A 3PO4A 1NJXA 2ZIXB 5IIKA 3UM9A 4KLSA 3R9KA 7ICEA 8ICTA 3U26A 5AI5A 1Z4OA 1TVAA 4F4ZA 2W11A 4JK1A 5J0YA 2UVVA 4B9TA 3KHRA 5J2KA 2W9AA 4RQ5A 4IQWA 3E2EA 3AN1A 3FC4A 1BPBA 2BQ3A 2VA8A 1YT3A 5ALPA 2NRWA 1FFVA 3IN5A 4RQ3A 2PFOA 3H8SA 2W9CB 4CDGA 1TKDA 4KLJA 2DF4B 1TAUA 4IR1A 8ICYA 2M0NA 1D8BA 1ZQOA 5AKKA 3B9JA 4KTQA 3QU9A 2B21A 2W8LA 4QZHA 5AM3A 4XUSA 1VLBA 4IL6U 1D8YA 2KZMA 8ICKA 1A77A 3QZ8A 1RDFA 4ELTA 3WU2U 3NVWA 2ZTCA 4YP3A 3SAGA 2W03A 4NLCA 3NRWA 2CN1A 4EBCA 3EUB2 5EE3A 1DK3A 5CB1A 3RB0A 3KHGA 3J81j 5KFNA 3HILA 5DBAA 2QB0B 4UBCA 2PI5A 3QZ7A 1WYGA 5EWGA 3TACB 5ALFA 5KAFU 4EX6A 4F4KA 4QW9A 3M9NB 4YXJA 4NXZA 2D8CA 4UW9A 1JUDA 5EE9A 4F4WA 2KICA 3MR2A 3ZDBA 5G5GA 3O0FA 5GTHU 3D2QA 1PK1B 4KX5A 1B22A 4DO9A 1U9LA 3Q8MA 1X40A 3TADC 5IIIA 4PHAA 5AI9A 1JROA 5DB6A 1KFSA 1MQ3A 8ICZA 2BPFA 3MR3A 2DWQA 5E79U 2A1JB 2DKXA 1DK2A 3HX0A 4R8UA 5HMMA 4RQMA 3THVA 5KAIU 2ZIXA 2KVCA 2PXIA 1RQNA 3NUQA 8ICXA 2AGOA 1JXEA 2A1JA 1QH9A 2DPJA 2JEIA 3ZDCA 2H3QA 3ETLA 2XY6A 4NLGA 5KFBA 3HPOA 9ICMA 2W54A 3JPSA 3RJHA 7ICLA 5ALDA 3SR6A 5AM0A 5J2IA 1V85A 3PSPA 4EBDA 2GOLA 5IILA 5KFCA 5J8YA 2XY5A 1KFTA 3UMCA 1UA1A 5FP0A 3LWMA 3RJKA 4HYKA 5EE0A 4J9QA 3C2MA 2RHFA 3MBYA 1NK8A 1RYRA 3HW8A 4QNLA 5KT6A 4BX9C 5KT5A 2A3VA 3QEAZ 3GU3A 2W55A 3QUCA 4OD0A 7ICSA 1NK0A 4O9MA 2QB0A 4NJ8A 4O3SA 2F3NA 2YQEA 5JU5A 2KNJA 1RQLA 1BPXA 5KT3A 5CRXA 1JN3A 3BQ7A 5T14A 4TUSA 4A8EA 9ICHA 2EZYA 9ICSA 3SEIA 4UQGA 3PV8A 4FZMA 5K4LA 3JPPA 8ICWA 8ICBA 4PZOA 4UB5A 2FLNA 4YCXA 4UB2A 3UQ2A 1JX4A 4R65A 1WCNA 2Y1JA 2OCEA 4P4OA 3TAPA 1ZQRA 2YN4A 1DXSA 5HHHA 4UB8U 3H8MA 1B43A 4CCHA 4YMMA 3M1YA 5ALXA 3PMNA 4YMOA 5AKIA 4GXKA 2LKYA 3MABA 2CXYA 1SL2A 2AGQA 5AKZA 1OW5A 4B9LA 5F3XB 2VJ5A 5ALSA 8ICCA 2F1IA 4BGDA 2FJ6A 3PW0A 5AKXA 5AI0A 2R8KA 1XSPA 3PW7A 4R66A 2ASDA 3ONNA 3GIMA 2OH2A 1J97A 3V72A 1SB3C 3T5JA 1SZHA 2OHFA 2W3SA 2V9WA 4NWIA 4E0DA 2YMMA 1XU4A 5KFFA 5CR0A 4CNQA 4K4IA 2AQ4A 2QKQA 5J0UA 3GV8B 1XSNA 3OSNA 3GZFA 4FS2A 1N5WA 4EEKA 1PVPA 4F91B 4ECYA 1L7MA 1K1SA 5KL1B 1XWLA 4KITB 4I2CA 2NV3A 3BS7A 5KFHA 4EEYA 5KFEA 3BQTA 4F93B 2GO7A 2XO7A 1F44A 2DPIA 3KD3A 3CNHA 2KVSA 2ZTDA 3MDAA 9ICNA 3BQ0A 5IIMA 1LKYA 1T8EA 4C4SA 3L4PA 1ZQAA 3IG8A 8ICPA 8ICEA 2ATLA 4QZAA 4DL4A 2ZTEA 4PL1A 3UQ0A 1Z00A 1ZJNA 4DEZA 4FFDA 4J03A 5ALVA 4DLGA 4F4YA 3A0BU 4ZH4A 2ZIWB 4Z6EA 2XCAA 1RM6C 2DBYA 2KEYA 3WK7A 5AIBA 4ED7A 5L1MA 4DQIA 1WG8A 4LVSA 2RP5A 1ZQUA 4LZDA 5KFKA 4ZOHC 5L1LA 1J2NA 4RQ1A 4KLMA 2AH5A 2E8NA 4I2IA 1ZQSA 3G6YA 4DFMA 3SAFA 4RNOA 4BXOA 4MFFA 4F5OA 2ISPA 2F8KA 2Z7JA 5AI4A 2W7PA 4QZGA 3CYMA 2MUTB 1NK9A 3H4BA 5AKJA 2JH7A 1YZ7A 4FZNA 1NK4A 2KOBA 1BPZA 5KG2A 3V6KA 2KIVA 1N62A 1UHUA 3RB3A 5AKYA 2QARB 1ZYQA 3JPOA 2WF5A 3WK4A 5DB8A 1BPDA 4DQPA 4KMOB 1K1QA 3CRXA 1SWVA 1A6SA 2BPGA 2CRXA 2RQ5A 4B9MA 4YG2A 2L5YA 4DF8A 3A0HU 4CF4A 3OTQA 4KLHA 1D9FA 2EAMA 3C21A 3NTUA 3VC8A 4OJPA 3ZDAA 4B9NA 9ICCA 1QQ6A 4AYBC 4JUZA 5ALKA 2HCFA 5AM4A 5HP4A 5ALIA 2R8IA 4DLEA 4C7YA 4ECZA 2AHOB 4CE6A 4YR0A 3KOOA 5JUMA 8ICFA 4PHDA 1CI4A 2YB1A 4ELUA 2Y0SC 2EAOA 2J6UA 4C8NA 2KV2A 2PKEA 2ZUBA 1SXEA 2KP7A 4FE3A 2LI6A 1L8OA 3M6KA 3PX4A 5L1KA 1JI7A 1T7PA 3V7KA 3PW5A 4MF2A 3TADA 2KK0A 1HJPA 4DQRA 3BJYA 1Q3VA 2BQRA 2HBLA 1OXJA 3RTVA 4UARA 3RF9A 4DWIA 2HBJA 4KLEA 4M04A 3WKAA 5DDMA 3RBEA 5DG8A 9ICJA 3MFHA 4Y2SA 5DB7A 3D6JA 3UXOA 2J6TA 3M6ZA 5AI6A 5AM2A 1PUZA 1Y88A 4KLIA 2GLEA 4JMUA 2JMGA 3RH4A 2YY6A 5HR6A 5DGAA 4NL9A 3H40A 1BPYA 5EE1A 3GILA 4YN4A 1V38A 4BUGA 4O5EA 2LYAA 2BPCA 3K1RB 5IIJA 1T3QA 1X66A 3HWTA 5J2FA 4KLFA 1A76A 4G9BA 5L1IA 4RUAA 1RG6A 5L9XA 4UAWA 5CHGA 5JTIA 3AU2A 4M47A 3LVVA 3NRZA 5KFLA 4RPZA 4KLDA 5KFZA 3SQIA 5KFOA 2PFPA 4CGZA 4IQUA 1NNLA 1PZNA 3TKAA 3RJEA 2YB4A 4O0IA 3TFSA 4P4MA 3VCBA 3SMVA 4J9MA 3KBBA 7ICGA 3Q8PB 4PGQA 4JWMA 1L3TA 9ICTA 2WB1C 3OJUA 5C5JA 2P6RA 2KZ3A 2XC9A 5DG7A 4B9VA 4RT2A 4J9NA 4MEYA 4RQ4A 3RJIA 3QE9Y 3AM9A 3C5GA 3L5KA 3M7DA 2NYVA 4ECXA 3EYZA 3AQEA 2MAXA 3ETRA 4OJ6A 2IA6A 2DQNB 1WWUA 2FE9A 2HSZA 4M9JA 9ICUA 2ZIVB 3N97B 3ZDEA 5J2GA 3SZ2A 3PX0A 4C8OA 3CW2C 4EELA 3M8RA 3Q8LA 4ACOA 1DGJA 3IM1A 2C2RA 4ED0A 3ORYA 2XI9A 5B5EU 2DFLA 4RT3A 2C28A 2I6XA 4P0PB 2ZXHA 3ISCA 2XCPA 2XGPA 3QU4A 3FM9A 4GXIA 4QZ9A 2WF6A 3F2CA 1LB2B 5IIOA 1N63A 4MHVA 1UA0A 2QB1A 7ICHA 1WUDA 4UASA 3KKAC 4YD1A 5KTQA 5J8YC 2JV3A 1RZTA 1KBUA 1V9PA 3ZDDA 3E0FA 4Q43A 3PW2A 1ECWA 1XO1A 4QJFB 4M9LA 1JALA 1S5LU 5BOMA 4KLTA 1S0OA 1U48A 5F9NA 2LYBA 2R8JA 7ICIA 1BPEA 1ZQ1C 3C23A 3QU7A 2ZJ5A 2EH9A 4QIWC 3AMZA 2WAQC 5KFVA 1Z00B 3IDWA 2YMQA 1LKYB 4FBUA 2H3FA 2W7OA 5ALTA 5KG0A 5ALRA 1SIJA 2ASLA 5ALNA 3UPQA 8ICAA 1NZPA 1T94A 3SENA 2HW3A 2B0CA 8ICVA 1NKEA 2KZZA 4JWNA 2WTFA 5KFWA 2AU0A 2DKZA 3H8WA 1Z19A 4DS5A 7ICVA 2KFZA 2MU2A 4I2HA 5KFXA 4J9OA 2HHVA 1X9WA 4F5NA 5GTIU 1FFUA 2YX8A 2FPLA 2ALZA 4GLXA 5KNIA 1NK6A 3T5KA 4AP9A 5KFMA 2KJ9A 5EWEA 3WKCA 3T79A 2F76X 1U49A 1NZBA 2HOQA 1S9FA 2H3VA 1ZQGA 1ZQDA 2G09A 2KIWA 4UB6U 1SZPA 1B4FA 4CRXA 2K4EA 1GO3F 4I27A 4DQSA 2KG5A 4O3QA 5DQGA 2I9GA 4TQSA 1XS9D 4M9GA 1IXRA 5J2HA 2MUTA 4F3OA 5AK4A 2IHMA 4F2RA 2B6GA 3GIKA 2VIXA 4EBEA 4NLZA 4ECWA 3EPIA 2EZZA 3F2BA 1L7PA 5DKWA 2N1RA 3HT3A 2W9CA 2BKEA 1JXLA 4DSFA 2E3TA 3BS5B 4TURA 1SWWA 2BR0A 4WJ3B 3RAQA 4YD2A 1NKBA 5ALEA 4RZRA 3D2NA 1BVSA 1QCKA 1WCLA 3ISDA 2NRZA 9ICQA 1RYSA 3V7LA 1SXDA 2F1HA 4P0QB 4DL6A 5KFRA 8ICNA 2K4IA 9ICIA 2BCQA 2K4HA 3H0LB 3JPRA 1IV8A 1LVHA 2RDJA 4DL2A 4J9SA 3B0XA 4QZBA 4DL5A 1ZETA 2E8MA 3PR5B 1QSSA 1PVRA 3C28A 1X6JA 1NJZA 2BCSA 3RR7A 3H4DA 3RFAA 2DUYA 2VA3A 3ICXA 1NK5A 7ICRA 4O3NA 3LWLA 5J2AA 3FAHA 5KFJA 2XGQA 8ICRA 2C2EA 2C2DA 3M8SA 5L1JA 2LPEA 5BOLA 2ZXIA 4OO1J 1Z4NA 7ICUA 3C2KA 5AI8A 9ICKA 4NV0A 2WB1F 2V4QA 5KG4A 3SV4A 4JV2A 3PNCA 2G5IB 4MFCA 2OM6A 2HOFA 4X5VA 4YXMA 2FMQA 1SV0C 3ED5A 3WK9A 1KN5A 1L8LA 4DS4A 4F50A 2AGPA 2HHUA 4LJXA 4Q45A 2MSNA 3D2SA 3IP4B 3V6HA 2AQ0A 4P0QA 5ALYA 1C7YA 1FO4A 1F0MA 9ICBA 1KTQA 2Y1IA 4M2YA 3WKBA 2H3IA 4J9PA 5ALMA 4RQ6A 1ZOLA 2R18A 4UAUA 4KMUA 1DRGA 4FZLA 4UAYA 3S6JA 4IC9A 2IOFA 5J0SA 5AK5A 1PVQA 1X6IA 4EZ6A 2KHQA 9ICLA 5ALHA 5ALZA 2KTQA 4QWDA 3T3FA 3NGDA 9ICVA 5CA7A 2H5XA 4DSKA 1NJWA 4QZEA 4BJQA 5DLGA 5C0YA 5AHXA 2JEFA 3IG5A 3KZIU 4I2DA 1KSPA 1JRPA 1SKRA 2KJ8A 3Q8QB 5AKHA 9ICWA 1QTMA 7ICNA 3RRHA 3QXGA 1X2IA 1LV5A 4RQ8A 2BCVA 2HI0A 5DBBA 5J0QA 1RXVA 2MA1A 1X9SA 5H2FU 1NJYA 3N7RC 2ZJ8A 2W9MA 9ICRA 2G5HB 4MF8A 5IINA 5KFTA 2PMZC 7ICQA 4K4GA 3EW9A 5AIAA 4PHEA 4RPYA 3PMLA 4US8A 4KN7A 1ZD3A 3MR6A 4IS7A 4XQ8A 2RRDA 1CUKA 2GWSA 4B6JA 3V7JA 2ZUCA 2NRTA 1ZQYA 3OJSA 2R8GA 4ECUA 5ALQA 1T3NA 1ZQWA 4PL2A 1COOA 2UVUA 3I28A 2OEHA 4I28A 1HEKA 4U6PA 4NM2A 2HHSA 4O3RA 5J2CA 1K5OA 2K8AA 3RRGA 5KFPA 4I2JA 4M6WB 4O3OA 3KHLA 3TANA 4DFJA 7ICOA 4Y2RA 1ZQEA 1XO0A 4TUQA 2HHQA 2KKVA 5J29A 3IRUA 1L6NA 4QWAA 4QZDA 4QW8A 1COKA 4JB3A 1RYUA 1S0VA 2D6FC 1TE2A 1YZ6A 2K8BB 1DGSA 3M9OB 1ZQTA 2W9BB 2BGWA 2A1AA 1S0NA 4I2BA 3LDAA 1C20A 4C4RA 3SD7A 5KFSA 3KFUF 3JPTA 3HRDD 2HVHA 4G3IA 3WKEA 3RH5A 8ICIA 1MC8A 2VANA 2GH1A 5DDYA 5D46A 1XSLA 8ICJA 2EANA 1UPHA 4ICAA 4I2AA 2NRVA 3OGUA 4F5RA 4IRCA 4PH5A 1KEJA 3Q8SB 5AKGA 3QYPA 4TQRA 2KHVA 4BWMA 4IRDA 4ECSA 3PSFA 1UT8A 3N4MB 2E8PA 4FO6A 4K4HA 3NASA 4DOAA 5ALGA 2HHWA 2BHNA 5J0TA 2VA2A 4DQQA 4O5KA 2YTUA 1ZQCA 7ICTA 3DDHA 3PO5A 3N7SC 2RDIA 8ICMA 5D4BA 2EAPA 4F4XA 2KMDA 3JPNA 2G06A 3BS5A 2KD1A 2JXJA 3RJJA 1CEZA 1SL0A 3SYZA 1Q46A 2HMXA 4DL7A 3TARA 3AQFA 2JZBA 2Y9UA 5DLFA 2BCRA 4F92B 1S0MA 4ED1A 4DSIA 4HAIA 5JRTA 2FDRA 4Z6CA 4YFKA 4CF5A 4KN4A 3I1YA 5KFIA 4M0AA 1ZQZA 2I5HA 2K8CB 5HMLA 2HVIA 1NOMA 3QUQA 3RB6A 3HKZC 1D8LA 3F2DA 3MGIA 5KG3A 3NVVA 4C7ZA 2O6KA 4C8KA 2DGZA 2J6SA 4QZFA 3MGHA 4NY8A 2WAQF 1TK8A 5HHIA 4C8MA 1S8OA 4UAVA 4J9RA 2NRXA 1J2MA 1L7OA 2KE7A 4US9A 3IV6A 4F71A 1H38A 2VJ4A 5B66U 5J0XA 3CP8A 2EZXA 1ZRNA 1BGXT 2VKQA 1N61A 1X9XA 2ZG6A 4J9LA 2HHTA 3C5FA 2FLPA 1QSLA 1FEZA 3PVXA 5CWRA 2JGAA 3BQ2A 1ZQHA 2D3DA 2XY7A 4OJ5A 1M6YA 7ICMA 4PHPA 3HKZF 3F5AA 3PX6A 5J2JA 2FMPA 3GDXA 3DEEA 1L7NA 2KSOA 4BWJA 2M9NA 3NVZA 3K75D 3RB4A 1KDHA 1U45A 1ZXIA 2E8OA 4QWBA 3BZCA 1AROP 3KHHA 5G5HA 3L3FX 4UAZA 2XICA 3C1ZA 2ZIUA 4DFDA 8ICGA 3UMGA 3FDSA 1QSYA 1D9DA 1ZD2P 1SV0A 4IR9A 1KL9A 2NO4A 3ZD9A 2W43A 3QU5A 7ICKA 3K1ZA 4UB1A 4GC6A 2F8LA 3Q8KA 5KG5A 1Z1VA 8ICHA 2KSOB 1TFRA 3ALRA 2XVTA 3K4GA 2WHEA 1U4BA 2ESEA 2BCUA 1ZQBA 5KFGA 2G08A 1VDVA 4NLBA 5AICA 1N56A 3QX7A 4Y2YA 1ZQPA 2P6UA 2JR5A 4NM1A 1NK7A 2W8KA 4DFPA 1XNSA 2JH1A 9ICOA 4LZGA 5KT7A 5KFYA 4C0ZA 4KLUA 2ZIVA 2MRLA 4OJOA 2YMLA 4Q44A 5ALUA 1SKSA 2ODGA 2ASJA 4Y2JA 3TFRA 2JRZA 1ZRMA 4DL3A 5AKLA 4MEXA 1QLNA 4OCZA 3IHQB 3NVYA 3GIIA 2WF8A 1FIQA 4UBBA 1MQ2A 5A0LA 3LK9A 3C2LA 5DQIA 1ZQXA 1N48A 2WF9A 1UQVA 3TI0A 4Z6FA 1KKXA 1HUZA 3UXPA 2KFNA 4M9HA 2ZIWA 2XIDA 5ALOA 4P4PA 4F8RA 1S77D
chains in the Genus database with same CATH topology
5T14A 3L3FX 4A8EA 3SQIA 3D2NA 1Z1BA 3N7SC 2HBKA 4KX3A 4PL2A 4QIWC 4U7CA 3IG8A 4GFJA 2WAQC 2XICA 4CGZA 3N7PD 1IIPA 4FZMA 2ZIUA 2LBOA 3D2SA 3H0RB 2F77X 3IP4B 4P0QA 1HEKA 2H3FA 2W7OA 2OXOA 2YB4A 2G06A 2YB1A 4PL1A 2KD1A 2Y0SC 4U6PA 4P0QB 3VCBA 1HIWA 2KICA 3H0MB 2K4IA 2F2AB 3SMVA 2KV2A 2K8AA 2W04A 2H3IA 2HMXA 2K4HA 3F5EA 3H0LB 3O0FA 2G0AA 3C29A 3D2QA 4KX5A 4FE3A 3AQFA 1YT3A 2KKPA 2WB1C 2R18A 3M6KA 3K1ZA 2ZIWB 3IN5A 1DRGA 3AL0B 2F8LA 4FZLA 1T94A 3MGVA 2KEYA 4CDGA 1Q3UA 2LKYA 4IC9A 4O3MA 2DF4B 3ALRA 2XVTA 2RP5A 1Q3VA 1XO0A 1PVQA 1P7DA 3LVWA 2HBLA 2KKVA 4AYBF 1PVRA 2KHQA 2M0NA 2K8CB 3RF9A 3PZPA 1Z19A 3C28A 1L6NA 2VJ5A 2HBJA 1D8BA 2Q4TA 2G08A 2ZIXA 3M7DA 2KVCA 3HKZC 4NLBA 4OJLA 3AQEA 3F2DA 3NUQA 1ED1A 4BJQA 2YX8A 2D6FC 3SAFA 2K8BB 4OJ6A 3RFAA 5C0YA 3PSIA 2DQNB 2E1EA 1A0PA 2DGZA 2PMZF 2H3QA 2Z7JA 2W7PA 2ZIVB 2WAQF 3CYMA 3ICXA 2E1FA 2H3ZA 3IG5A 1OUQA 5HR7A 2KJ9A 2JH7A 3T79A 4ACOA 2JHDA 3M6ZA 3KFUF 3ONNA 1XNSA 3PSPA 4FZNA 2F76X 2Y0SF 1NZBA 2OH2A 4JMUA 2KJ8A 2E5SA 2GOLA 1SZHA 1URJA 2HOQA 2JH1A 2JMGA 2KOBA 2XI9A 3F53A 5HR6A 2H3VA 4NWIA 4P0PB 2G09A 2KIWA 2VJ4A 2ZXHA 2OYYA 3CP8A 4C0ZA 3SAHA 4QIWF 4BUGA 2ZIVA 2VKQA 2MRLA 4OJOA 2ZG6A 4CRXA 2ZXIA 2K4EA 1GO3F 4OO1J 2GH1A 2RHFA 3SAGA 3GZFA 2LYAA 3F2CA 2CPRA 2LHTA 2MA1A 2W03A 2ZIUB 1UPHA 4ICAA 1PVPA 2BDUA 2K89A 2JGAA 4QNLA 1WUDA 4BX9C 4NLCA 3N7RC 2A3VA 2HOIA 3NRWA 2CN1A 2G5HB 5KL1B 1TAMA 3KZXA 2KJ5A 4KMOB 4NV0A 3CRXA 2NV3A 3GU3A 4OJ5A 1A6SA 5KL8B 3OPXA 2PMZC 2CRXA 2VIXA 2KHVA 2WB1F 3LYSA 3HKZF 3F5AA 3PSFA 5A0LA 1KBUA 2G07A 2G5IB 3DEEA 3E0FA 2ZIXB 1F44A 2KNJA 2OM6A 2HOFA 1ECWA 3F2BA 4QJFB 2RRDA 2HBMA 2N1RA 1MA7A 3VC8A 4P0PA 3LVVA 4OJPA 3PSTA 2ZIWA 2LYBA 2XIDA 1CRXA 4AYBC 5CRXA 4WJ3B 1ZQ1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G5I B;  3H0R B;  3IP4 B;  2F2A B;  2DQN B;  2DF4 B;  2G5H B;  4WJ3 B;  3AL0 B;  3KFU F;  3H0L B;  1ZQ1 C;  2D6F C;  3H0M B; 
#chains in the Genus database with same CATH topology
 2K4P A;  1Z3E B;  4KX3 A;  1S10 A;  5CP2 A;  5DGB A;  4DSL A;  4Y2X A;  3QU2 A;  3ZD8 A;  4RUC A;  4TUP A;  2OXO A;  2ISO A;  5AM5 A;  1SGG A;  1ZQL A;  1ZQJ A;  3SV3 A;  3NS1 A;  2C22 A;  1JMS A;  3EZ5 A;  2G0A A;  5DBC A;  2KKP A;  3AL0 B;  3MGV A;  4PPX A;  1Q3U A;  1ZQN A;  4QWE A;  3RJG A;  3LVW A;  5KG7 A;  1UCV A;  2FMS A;  1VJ5 A;  3PZP A;  5ALJ A;  4KLO A;  4YVZ A;  4ECQ A;  4DOC A;  4OJL A;  3RAX A;  3H8J A;  1ZQV A;  1SV4 A;  7ICP A;  4DSJ A;  4M9N A;  5KFD A;  5J0O A;  1QQ7 A;  1PK1 A;  4NLN A;  4O5C A;  2Y0S F;  3H7I A;  2E5S A;  7ICF A;  3E58 A;  2LMR A;  9ICE A;  4DOB A;  4C80 A;  3T5H A;  2ZUD A;  4ECT A;  2IHN A;  3SAH A;  4QIW F;  1T4G A;  3PY8 A;  3ISB A;  3PW4 A;  5HNK A;  4RNN A;  4EYH B;  2CPR A;  2LHT A;  5BPC A;  3FYH A;  4EZ9 A;  2K89 A;  1BNP A;  2W3R A;  2F1J A;  3UMB A;  1ZQF A;  1IM4 A;  1IG6 A;  4UB3 A;  3DV9 A;  4ECR A;  3SI8 A;  4EX7 A;  4I2G A;  1N60 A;  2KN7 A;  3WK8 A;  2G07 A;  3EWA A;  2ZJA A;  4MFA A;  8ICS A;  8ICL A;  2UVW A;  4O3P A;  1TK0 A;  1UT5 A;  2FLL A;  4JV0 A;  4RPX A;  5ALL A;  2AXT U;  1L3U A;  4GFJ A;  1O08 A;  3GFK B;  2F77 X;  3H0R B;  3ZI4 A;  4UAT A;  3C1Y A;  1NI3 A;  4B9U A;  2QAR A;  3AEV A;  3H0M B;  4QZI A;  4Y2P A;  1PK3 A;  5KT4 A;  1ZQI A;  1RPL A;  3OHB A;  1SKW A;  4YMN A;  2HHX A;  4F5Q A;  4IQT A;  4Y2U A;  3EPG A;  4AYB F;  4FS1 A;  4ED8 A;  2JZB B;  1JIH A;  4ED6 A;  1ZJM A;  1KLN A;  1KW4 A;  3B0Y A;  4Z6D A;  5TIS U;  1WWV A;  5TZV A;  1X9M A;  4XA5 A;  2UVR A;  4DF4 A;  2OWO A;  1TV9 A;  2JEG A;  5EWF A;  9ICA A;  3GIJ A;  5KFQ A;  2E1F A;  5KFA A;  1OUQ A;  5HR7 A;  1BNO A;  3RH6 A;  1U47 A;  4GC7 A;  1URJ A;  4ELV A;  9ICX A;  4DFK A;  2P35 A;  5KG1 A;  4RQ7 A;  2BQU A;  1ZQM A;  4EYI B;  9ICG A;  1F5S A;  2ZIU B;  3GQC A;  4BXO B;  2PFN A;  2V4R A;  2Q0Z X;  3TAQ A;  2KJ5 A;  5J0P A;  5DG9 A;  4Y2V A;  2WFA A;  3OPX A;  2FPK A;  4PZN A;  1NKC A;  4R63 A;  2ES6 A;  4I2E A;  2HBM A;  4M6W A;  3RR8 A;  2EQY A;  1MA7 A;  4F72 A;  2P66 A;  3HP6 A;  4Y2T A;  3PST A;  1CRX A;  2AJQ A;  3KKA A;  1Z1B A;  2JEJ A;  5CJ7 A;  2HBK A;  4U7C A;  5AK3 A;  7ICJ A;  3N7P D;  2IBK A;  1IIP A;  2IOH A;  2LBO A;  2YMP A;  3GV7 B;  4FBT A;  3OSP A;  2LM1 A;  3BZK A;  2IMW P;  1HIW A;  2F2A B;  4ED2 A;  3JPQ A;  5ALW A;  3C29 A;  1SL1 A;  8ICQ A;  4YQW A;  4ED3 A;  2W9B A;  4USA A;  5CEH A;  4QWC A;  4IQV A;  4KLG A;  4J9K A;  1N2X A;  5J2D A;  4RQ0 A;  3PR4 A;  1KFD A;  4DCC A;  5J2E A;  1KRP A;  1P7D A;  1TAQ A;  4R8U B;  4C4T A;  3WKD A;  4GXJ A;  3BDP A;  1L3S A;  8ICU A;  1V97 A;  4C8L A;  1Q8K A;  4JV1 A;  2I1Q A;  1ED1 A;  4QZC A;  3G6V A;  4I2F A;  3QEB Z;  3G6X A;  4EEN A;  3F53 A;  4KLQ A;  3T5L A;  5F9L A;  5J0R A;  1XC9 A;  1S76 D;  2OYY A;  4F5P A;  3OHA A;  5DQH A;  1ZD4 A;  1RXW A;  2LYH A;  4NLK A;  2QLT A;  4GIB A;  3MR5 A;  3AUO A;  9ICF A;  2BDP A;  4P2H A;  2LM4 A;  2HOI A;  1MSW D;  1EXN A;  1TAM A;  3KZX A;  5J2B A;  5KG6 A;  3QNM A;  4ECV A;  1ZD5 A;  4Y2Q A;  3LYS A;  5AKE A;  2R8H A;  2RLT A;  2Y9T A;  3QUB A;  2NO5 A;  5EOZ A;  4R64 A;  4P0P A;  4RQ2 A;  3KTQ A;  2K60 A;  4Q8F A;  5AM1 A;  3MFI A;  3RJF A;  3GV5 B;  4Q8E A;  5KFU A;  1N5X A;  2A19 A;  1HUO A;  3MC1 A;  3WK6 A;  3BQ1 A;  4YR3 A;  2PFQ A;  4UB4 A;  3HJE A;  3I76 A;  2W04 A;  4RNM A;  3F5E A;  4NL9 C;  1L3V A;  2F44 A;  2HDO A;  4BDP A;  2BZF A;  1S97 A;  4QZ8 A;  9ICP A;  1ZQQ A;  1X42 A;  3UXN A;  5DB9 A;  5J0W A;  4O3M A;  4I29 A;  4PGY A;  3N28 A;  3MDC A;  1AQ6 A;  1O03 A;  2FI1 A;  2Q4T A;  4PGX A;  3AU6 A;  5KT2 A;  4XRH A;  2DL0 A;  3PSI A;  2E1E A;  1A0P A;  3M9M B;  2PMZ F;  4DSE A;  3QUT A;  4F2S A;  2H3Z A;  3WK5 A;  1L5U A;  2JHD A;  3RBD A;  1B0X A;  4B9S A;  2FPM A;  2WF7 A;  1DOQ A;  1QQ5 A;  4IRK A;  1MN8 A;  1KQQ A;  1ZQK A;  8ICO A;  3TQ1 A;  2PI4 A;  4RQN A;  4YR2 A;  2EDU A;  3V6J A;  1TK5 A;  2BDU A;  4PJ0 U;  5D49 A;  2IOF K;  5AK6 A;  5KL8 B;  3Q8R B;  4KLL A;  4RU9 A;  4CF3 A;  3PO4 A;  1NJX A;  2ZIX B;  5IIK A;  3UM9 A;  4KLS A;  3R9K A;  7ICE A;  8ICT A;  3U26 A;  5AI5 A;  1Z4O A;  1TVA A;  4F4Z A;  2W11 A;  4JK1 A;  5J0Y A;  2UVV A;  4B9T A;  3KHR A;  5J2K A;  2W9A A;  4RQ5 A;  4IQW A;  3E2E A;  3AN1 A;  3FC4 A;  1BPB A;  2BQ3 A;  2VA8 A;  1YT3 A;  5ALP A;  2NRW A;  1FFV A;  3IN5 A;  4RQ3 A;  2PFO A;  3H8S A;  2W9C B;  4CDG A;  1TKD A;  4KLJ A;  2DF4 B;  1TAU A;  4IR1 A;  8ICY A;  2M0N A;  1D8B A;  1ZQO A;  5AKK A;  3B9J A;  4KTQ A;  3QU9 A;  2B21 A;  2W8L A;  4QZH A;  5AM3 A;  4XUS A;  1VLB A;  4IL6 U;  1D8Y A;  2KZM A;  8ICK A;  1A77 A;  3QZ8 A;  1RDF A;  4ELT A;  3WU2 U;  3NVW A;  2ZTC A;  4YP3 A;  3SAG A;  2W03 A;  4NLC A;  3NRW A;  2CN1 A;  4EBC A;  3EUB 2;  5EE3 A;  1DK3 A;  5CB1 A;  3RB0 A;  3KHG A;  3J81 j;  5KFN A;  3HIL A;  5DBA A;  2QB0 B;  4UBC A;  2PI5 A;  3QZ7 A;  1WYG A;  5EWG A;  3TAC B;  5ALF A;  5KAF U;  4EX6 A;  4F4K A;  4QW9 A;  3M9N B;  4YXJ A;  4NXZ A;  2D8C A;  4UW9 A;  1JUD A;  5EE9 A;  4F4W A;  2KIC A;  3MR2 A;  3ZDB A;  5G5G A;  3O0F A;  5GTH U;  3D2Q A;  1PK1 B;  4KX5 A;  1B22 A;  4DO9 A;  1U9L A;  3Q8M A;  1X40 A;  3TAD C;  5III A;  4PHA A;  5AI9 A;  1JRO A;  5DB6 A;  1KFS A;  1MQ3 A;  8ICZ A;  2BPF A;  3MR3 A;  2DWQ A;  5E79 U;  2A1J B;  2DKX A;  1DK2 A;  3HX0 A;  4R8U A;  5HMM A;  4RQM A;  3THV A;  5KAI U;  2ZIX A;  2KVC A;  2PXI A;  1RQN A;  3NUQ A;  8ICX A;  2AGO A;  1JXE A;  2A1J A;  1QH9 A;  2DPJ A;  2JEI A;  3ZDC A;  2H3Q A;  3ETL A;  2XY6 A;  4NLG A;  5KFB A;  3HPO A;  9ICM A;  2W54 A;  3JPS A;  3RJH A;  7ICL A;  5ALD A;  3SR6 A;  5AM0 A;  5J2I A;  1V85 A;  3PSP A;  4EBD A;  2GOL A;  5IIL A;  5KFC A;  5J8Y A;  2XY5 A;  1KFT A;  3UMC A;  1UA1 A;  5FP0 A;  3LWM A;  3RJK A;  4HYK A;  5EE0 A;  4J9Q A;  3C2M A;  2RHF A;  3MBY A;  1NK8 A;  1RYR A;  3HW8 A;  4QNL A;  5KT6 A;  4BX9 C;  5KT5 A;  2A3V A;  3QEA Z;  3GU3 A;  2W55 A;  3QUC A;  4OD0 A;  7ICS A;  1NK0 A;  4O9M A;  2QB0 A;  4NJ8 A;  4O3S A;  2F3N A;  2YQE A;  5JU5 A;  2KNJ A;  1RQL A;  1BPX A;  5KT3 A;  5CRX A;  1JN3 A;  3BQ7 A;  5T14 A;  4TUS A;  4A8E A;  9ICH A;  2EZY A;  9ICS A;  3SEI A;  4UQG A;  3PV8 A;  4FZM A;  5K4L A;  3JPP A;  8ICW A;  8ICB A;  4PZO A;  4UB5 A;  2FLN A;  4YCX A;  4UB2 A;  3UQ2 A;  1JX4 A;  4R65 A;  1WCN A;  2Y1J A;  2OCE A;  4P4O A;  3TAP A;  1ZQR A;  2YN4 A;  1DXS A;  5HHH A;  4UB8 U;  3H8M A;  1B43 A;  4CCH A;  4YMM A;  3M1Y A;  5ALX A;  3PMN A;  4YMO A;  5AKI A;  4GXK A;  2LKY A;  3MAB A;  2CXY A;  1SL2 A;  2AGQ A;  5AKZ A;  1OW5 A;  4B9L A;  5F3X B;  2VJ5 A;  5ALS A;  8ICC A;  2F1I A;  4BGD A;  2FJ6 A;  3PW0 A;  5AKX A;  5AI0 A;  2R8K A;  1XSP A;  3PW7 A;  4R66 A;  2ASD A;  3ONN A;  3GIM A;  2OH2 A;  1J97 A;  3V72 A;  1SB3 C;  3T5J A;  1SZH A;  2OHF A;  2W3S A;  2V9W A;  4NWI A;  4E0D A;  2YMM A;  1XU4 A;  5KFF A;  5CR0 A;  4CNQ A;  4K4I A;  2AQ4 A;  2QKQ A;  5J0U A;  3GV8 B;  1XSN A;  3OSN A;  3GZF A;  4FS2 A;  1N5W A;  4EEK A;  1PVP A;  4F91 B;  4ECY A;  1L7M A;  1K1S A;  5KL1 B;  1XWL A;  4KIT B;  4I2C A;  2NV3 A;  3BS7 A;  5KFH A;  4EEY A;  5KFE A;  3BQT A;  4F93 B;  2GO7 A;  2XO7 A;  1F44 A;  2DPI A;  3KD3 A;  3CNH A;  2KVS A;  2ZTD A;  3MDA A;  9ICN A;  3BQ0 A;  5IIM A;  1LKY A;  1T8E A;  4C4S A;  3L4P A;  1ZQA A;  3IG8 A;  8ICP A;  8ICE A;  2ATL A;  4QZA A;  4DL4 A;  2ZTE A;  4PL1 A;  3UQ0 A;  1Z00 A;  1ZJN A;  4DEZ A;  4FFD A;  4J03 A;  5ALV A;  4DLG A;  4F4Y A;  3A0B U;  4ZH4 A;  2ZIW B;  4Z6E A;  2XCA A;  1RM6 C;  2DBY A;  2KEY A;  3WK7 A;  5AIB A;  4ED7 A;  5L1M A;  4DQI A;  1WG8 A;  4LVS A;  2RP5 A;  1ZQU A;  4LZD A;  5KFK A;  4ZOH C;  5L1L A;  1J2N A;  4RQ1 A;  4KLM A;  2AH5 A;  2E8N A;  4I2I A;  1ZQS A;  3G6Y A;  4DFM A;  3SAF A;  4RNO A;  4BXO A;  4MFF A;  4F5O A;  2ISP A;  2F8K A;  2Z7J A;  5AI4 A;  2W7P A;  4QZG A;  3CYM A;  2MUT B;  1NK9 A;  3H4B A;  5AKJ A;  2JH7 A;  1YZ7 A;  4FZN A;  1NK4 A;  2KOB A;  1BPZ A;  5KG2 A;  3V6K A;  2KIV A;  1N62 A;  1UHU A;  3RB3 A;  5AKY A;  2QAR B;  1ZYQ A;  3JPO A;  2WF5 A;  3WK4 A;  5DB8 A;  1BPD A;  4DQP A;  4KMO B;  1K1Q A;  3CRX A;  1SWV A;  1A6S A;  2BPG A;  2CRX A;  2RQ5 A;  4B9M A;  4YG2 A;  2L5Y A;  4DF8 A;  3A0H U;  4CF4 A;  3OTQ A;  4KLH A;  1D9F A;  2EAM A;  3C21 A;  3NTU A;  3VC8 A;  4OJP A;  3ZDA A;  4B9N A;  9ICC A;  1QQ6 A;  4AYB C;  4JUZ A;  5ALK A;  2HCF A;  5AM4 A;  5HP4 A;  5ALI A;  2R8I A;  4DLE A;  4C7Y A;  4ECZ A;  2AHO B;  4CE6 A;  4YR0 A;  3KOO A;  5JUM A;  8ICF A;  4PHD A;  1CI4 A;  2YB1 A;  4ELU A;  2Y0S C;  2EAO A;  2J6U A;  4C8N A;  2KV2 A;  2PKE A;  2ZUB A;  1SXE A;  2KP7 A;  4FE3 A;  2LI6 A;  1L8O A;  3M6K A;  3PX4 A;  5L1K A;  1JI7 A;  1T7P A;  3V7K A;  3PW5 A;  4MF2 A;  3TAD A;  2KK0 A;  1HJP A;  4DQR A;  3BJY A;  1Q3V A;  2BQR A;  2HBL A;  1OXJ A;  3RTV A;  4UAR A;  3RF9 A;  4DWI A;  2HBJ A;  4KLE A;  4M04 A;  3WKA A;  5DDM A;  3RBE A;  5DG8 A;  9ICJ A;  3MFH A;  4Y2S A;  5DB7 A;  3D6J A;  3UXO A;  2J6T A;  3M6Z A;  5AI6 A;  5AM2 A;  1PUZ A;  1Y88 A;  4KLI A;  2GLE A;  4JMU A;  2JMG A;  3RH4 A;  2YY6 A;  5HR6 A;  5DGA A;  4NL9 A;  3H40 A;  1BPY A;  5EE1 A;  3GIL A;  4YN4 A;  1V38 A;  4BUG A;  4O5E A;  2LYA A;  2BPC A;  3K1R B;  5IIJ A;  1T3Q A;  1X66 A;  3HWT A;  5J2F A;  4KLF A;  1A76 A;  4G9B A;  5L1I A;  4RUA A;  1RG6 A;  5L9X A;  4UAW A;  5CHG A;  5JTI A;  3AU2 A;  4M47 A;  3LVV A;  3NRZ A;  5KFL A;  4RPZ A;  4KLD A;  5KFZ A;  3SQI A;  5KFO A;  2PFP A;  4CGZ A;  4IQU A;  1NNL A;  1PZN A;  3TKA A;  3RJE A;  2YB4 A;  4O0I A;  3TFS A;  4P4M A;  3VCB A;  3SMV A;  4J9M A;  3KBB A;  7ICG A;  3Q8P B;  4PGQ A;  4JWM A;  1L3T A;  9ICT A;  2WB1 C;  3OJU A;  5C5J A;  2P6R A;  2KZ3 A;  2XC9 A;  5DG7 A;  4B9V A;  4RT2 A;  4J9N A;  4MEY A;  4RQ4 A;  3RJI A;  3QE9 Y;  3AM9 A;  3C5G A;  3L5K A;  3M7D A;  2NYV A;  4ECX A;  3EYZ A;  3AQE A;  2MAX A;  3ETR A;  4OJ6 A;  2IA6 A;  2DQN B;  1WWU A;  2FE9 A;  2HSZ A;  4M9J A;  9ICU A;  2ZIV B;  3N97 B;  3ZDE A;  5J2G A;  3SZ2 A;  3PX0 A;  4C8O A;  3CW2 C;  4EEL A;  3M8R A;  3Q8L A;  4ACO A;  1DGJ A;  3IM1 A;  2C2R A;  4ED0 A;  3ORY A;  2XI9 A;  5B5E U;  2DFL A;  4RT3 A;  2C28 A;  2I6X A;  4P0P B;  2ZXH A;  3ISC A;  2XCP A;  2XGP A;  3QU4 A;  3FM9 A;  4GXI A;  4QZ9 A;  2WF6 A;  3F2C A;  1LB2 B;  5IIO A;  1N63 A;  4MHV A;  1UA0 A;  2QB1 A;  7ICH A;  1WUD A;  4UAS A;  3KKA C;  4YD1 A;  5KTQ A;  5J8Y C;  2JV3 A;  1RZT A;  1KBU A;  1V9P A;  3ZDD A;  3E0F A;  4Q43 A;  3PW2 A;  1ECW A;  1XO1 A;  4QJF B;  4M9L A;  1JAL A;  1S5L U;  5BOM A;  4KLT A;  1S0O A;  1U48 A;  5F9N A;  2LYB A;  2R8J A;  7ICI A;  1BPE A;  1ZQ1 C;  3C23 A;  3QU7 A;  2ZJ5 A;  2EH9 A;  4QIW C;  3AMZ A;  2WAQ C;  5KFV A;  1Z00 B;  3IDW A;  2YMQ A;  1LKY B;  4FBU A;  2H3F A;  2W7O A;  5ALT A;  5KG0 A;  5ALR A;  1SIJ A;  2ASL A;  5ALN A;  3UPQ A;  8ICA A;  1NZP A;  1T94 A;  3SEN A;  2HW3 A;  2B0C A;  8ICV A;  1NKE A;  2KZZ A;  4JWN A;  2WTF A;  5KFW A;  2AU0 A;  2DKZ A;  3H8W A;  1Z19 A;  4DS5 A;  7ICV A;  2KFZ A;  2MU2 A;  4I2H A;  5KFX A;  4J9O A;  2HHV A;  1X9W A;  4F5N A;  5GTI U;  1FFU A;  2YX8 A;  2FPL A;  2ALZ A;  4GLX A;  5KNI A;  1NK6 A;  3T5K A;  4AP9 A;  5KFM A;  2KJ9 A;  5EWE A;  3WKC A;  3T79 A;  2F76 X;  1U49 A;  1NZB A;  2HOQ A;  1S9F A;  2H3V A;  1ZQG A;  1ZQD A;  2G09 A;  2KIW A;  4UB6 U;  1SZP A;  1B4F A;  4CRX A;  2K4E A;  1GO3 F;  4I27 A;  4DQS A;  2KG5 A;  4O3Q A;  5DQG A;  2I9G A;  4TQS A;  1XS9 D;  4M9G A;  1IXR A;  5J2H A;  2MUT A;  4F3O A;  5AK4 A;  2IHM A;  4F2R A;  2B6G A;  3GIK A;  2VIX A;  4EBE A;  4NLZ A;  4ECW A;  3EPI A;  2EZZ A;  3F2B A;  1L7P A;  5DKW A;  2N1R A;  3HT3 A;  2W9C A;  2BKE A;  1JXL A;  4DSF A;  2E3T A;  3BS5 B;  4TUR A;  1SWW A;  2BR0 A;  4WJ3 B;  3RAQ A;  4YD2 A;  1NKB A;  5ALE A;  4RZR A;  3D2N A;  1BVS A;  1QCK A;  1WCL A;  3ISD A;  2NRZ A;  9ICQ A;  1RYS A;  3V7L A;  1SXD A;  2F1H A;  4P0Q B;  4DL6 A;  5KFR A;  8ICN A;  2K4I A;  9ICI A;  2BCQ A;  2K4H A;  3H0L B;  3JPR A;  1IV8 A;  1LVH A;  2RDJ A;  4DL2 A;  4J9S A;  3B0X A;  4QZB A;  4DL5 A;  1ZET A;  2E8M A;  3PR5 B;  1QSS A;  1PVR A;  3C28 A;  1X6J A;  1NJZ A;  2BCS A;  3RR7 A;  3H4D A;  3RFA A;  2DUY A;  2VA3 A;  3ICX A;  1NK5 A;  7ICR A;  4O3N A;  3LWL A;  5J2A A;  3FAH A;  5KFJ A;  2XGQ A;  8ICR A;  2C2E A;  2C2D A;  3M8S A;  5L1J A;  2LPE A;  5BOL A;  2ZXI A;  4OO1 J;  1Z4N A;  7ICU A;  3C2K A;  5AI8 A;  9ICK A;  4NV0 A;  2WB1 F;  2V4Q A;  5KG4 A;  3SV4 A;  4JV2 A;  3PNC A;  2G5I B;  4MFC A;  2OM6 A;  2HOF A;  4X5V A;  4YXM A;  2FMQ A;  1SV0 C;  3ED5 A;  3WK9 A;  1KN5 A;  1L8L A;  4DS4 A;  4F50 A;  2AGP A;  2HHU A;  4LJX A;  4Q45 A;  2MSN A;  3D2S A;  3IP4 B;  3V6H A;  2AQ0 A;  4P0Q A;  5ALY A;  1C7Y A;  1FO4 A;  1F0M A;  9ICB A;  1KTQ A;  2Y1I A;  4M2Y A;  3WKB A;  2H3I A;  4J9P A;  5ALM A;  4RQ6 A;  1ZOL A;  2R18 A;  4UAU A;  4KMU A;  1DRG A;  4FZL A;  4UAY A;  3S6J A;  4IC9 A;  2IOF A;  5J0S A;  5AK5 A;  1PVQ A;  1X6I A;  4EZ6 A;  2KHQ A;  9ICL A;  5ALH A;  5ALZ A;  2KTQ A;  4QWD A;  3T3F A;  3NGD A;  9ICV A;  5CA7 A;  2H5X A;  4DSK A;  1NJW A;  4QZE A;  4BJQ A;  5DLG A;  5C0Y A;  5AHX A;  2JEF A;  3IG5 A;  3KZI U;  4I2D A;  1KSP A;  1JRP A;  1SKR A;  2KJ8 A;  3Q8Q B;  5AKH A;  9ICW A;  1QTM A;  7ICN A;  3RRH A;  3QXG A;  1X2I A;  1LV5 A;  4RQ8 A;  2BCV A;  2HI0 A;  5DBB A;  5J0Q A;  1RXV A;  2MA1 A;  1X9S A;  5H2F U;  1NJY A;  3N7R C;  2ZJ8 A;  2W9M A;  9ICR A;  2G5H B;  4MF8 A;  5IIN A;  5KFT A;  2PMZ C;  7ICQ A;  4K4G A;  3EW9 A;  5AIA A;  4PHE A;  4RPY A;  3PML A;  4US8 A;  4KN7 A;  1ZD3 A;  3MR6 A;  4IS7 A;  4XQ8 A;  2RRD A;  1CUK A;  2GWS A;  4B6J A;  3V7J A;  2ZUC A;  2NRT A;  1ZQY A;  3OJS A;  2R8G A;  4ECU A;  5ALQ A;  1T3N A;  1ZQW A;  4PL2 A;  1COO A;  2UVU A;  3I28 A;  2OEH A;  4I28 A;  1HEK A;  4U6P A;  4NM2 A;  2HHS A;  4O3R A;  5J2C A;  1K5O A;  2K8A A;  3RRG A;  5KFP A;  4I2J A;  4M6W B;  4O3O A;  3KHL A;  3TAN A;  4DFJ A;  7ICO A;  4Y2R A;  1ZQE A;  1XO0 A;  4TUQ A;  2HHQ A;  2KKV A;  5J29 A;  3IRU A;  1L6N A;  4QWA A;  4QZD A;  4QW8 A;  1COK A;  4JB3 A;  1RYU A;  1S0V A;  2D6F C;  1TE2 A;  1YZ6 A;  2K8B B;  1DGS A;  3M9O B;  1ZQT A;  2W9B B;  2BGW A;  2A1A A;  1S0N A;  4I2B A;  3LDA A;  1C20 A;  4C4R A;  3SD7 A;  5KFS A;  3KFU F;  3JPT A;  3HRD D;  2HVH A;  4G3I A;  3WKE A;  3RH5 A;  8ICI A;  1MC8 A;  2VAN A;  2GH1 A;  5DDY A;  5D46 A;  1XSL A;  8ICJ A;  2EAN A;  1UPH A;  4ICA A;  4I2A A;  2NRV A;  3OGU A;  4F5R A;  4IRC A;  4PH5 A;  1KEJ A;  3Q8S B;  5AKG A;  3QYP A;  4TQR A;  2KHV A;  4BWM A;  4IRD A;  4ECS A;  3PSF A;  1UT8 A;  3N4M B;  2E8P A;  4FO6 A;  4K4H A;  3NAS A;  4DOA A;  5ALG A;  2HHW A;  2BHN A;  5J0T A;  2VA2 A;  4DQQ A;  4O5K A;  2YTU A;  1ZQC A;  7ICT A;  3DDH A;  3PO5 A;  3N7S C;  2RDI A;  8ICM A;  5D4B A;  2EAP A;  4F4X A;  2KMD A;  3JPN A;  2G06 A;  3BS5 A;  2KD1 A;  2JXJ A;  3RJJ A;  1CEZ A;  1SL0 A;  3SYZ A;  1Q46 A;  2HMX A;  4DL7 A;  3TAR A;  3AQF A;  2JZB A;  2Y9U A;  5DLF A;  2BCR A;  4F92 B;  1S0M A;  4ED1 A;  4DSI A;  4HAI A;  5JRT A;  2FDR A;  4Z6C A;  4YFK A;  4CF5 A;  4KN4 A;  3I1Y A;  5KFI A;  4M0A A;  1ZQZ A;  2I5H A;  2K8C B;  5HML A;  2HVI A;  1NOM A;  3QUQ A;  3RB6 A;  3HKZ C;  1D8L A;  3F2D A;  3MGI A;  5KG3 A;  3NVV A;  4C7Z A;  2O6K A;  4C8K A;  2DGZ A;  2J6S A;  4QZF A;  3MGH A;  4NY8 A;  2WAQ F;  1TK8 A;  5HHI A;  4C8M A;  1S8O A;  4UAV A;  4J9R A;  2NRX A;  1J2M A;  1L7O A;  2KE7 A;  4US9 A;  3IV6 A;  4F71 A;  1H38 A;  2VJ4 A;  5B66 U;  5J0X A;  3CP8 A;  2EZX A;  1ZRN A;  1BGX T;  2VKQ A;  1N61 A;  1X9X A;  2ZG6 A;  4J9L A;  2HHT A;  3C5F A;  2FLP A;  1QSL A;  1FEZ A;  3PVX A;  5CWR A;  2JGA A;  3BQ2 A;  1ZQH A;  2D3D A;  2XY7 A;  4OJ5 A;  1M6Y A;  7ICM A;  4PHP A;  3HKZ F;  3F5A A;  3PX6 A;  5J2J A;  2FMP A;  3GDX A;  3DEE A;  1L7N A;  2KSO A;  4BWJ A;  2M9N A;  3NVZ A;  3K75 D;  3RB4 A;  1KDH A;  1U45 A;  1ZXI A;  2E8O A;  4QWB A;  3BZC A;  1ARO P;  3KHH A;  5G5H A;  3L3F X;  4UAZ A;  2XIC A;  3C1Z A;  2ZIU A;  4DFD A;  8ICG A;  3UMG A;  3FDS A;  1QSY A;  1D9D A;  1ZD2 P;  1SV0 A;  4IR9 A;  1KL9 A;  2NO4 A;  3ZD9 A;  2W43 A;  3QU5 A;  7ICK A;  3K1Z A;  4UB1 A;  4GC6 A;  2F8L A;  3Q8K A;  5KG5 A;  1Z1V A;  8ICH A;  2KSO B;  1TFR A;  3ALR A;  2XVT A;  3K4G A;  2WHE A;  1U4B A;  2ESE A;  2BCU A;  1ZQB A;  5KFG A;  2G08 A;  1VDV A;  4NLB A;  5AIC A;  1N56 A;  3QX7 A;  4Y2Y A;  1ZQP A;  2P6U A;  2JR5 A;  4NM1 A;  1NK7 A;  2W8K A;  4DFP A;  1XNS A;  2JH1 A;  9ICO A;  4LZG A;  5KT7 A;  5KFY A;  4C0Z A;  4KLU A;  2ZIV A;  2MRL A;  4OJO A;  2YML A;  4Q44 A;  5ALU A;  1SKS A;  2ODG A;  2ASJ A;  4Y2J A;  3TFR A;  2JRZ A;  1ZRM A;  4DL3 A;  5AKL A;  4MEX A;  1QLN A;  4OCZ A;  3IHQ B;  3NVY A;  3GII A;  2WF8 A;  1FIQ A;  4UBB A;  1MQ2 A;  5A0L A;  3LK9 A;  3C2L A;  5DQI A;  1ZQX A;  1N48 A;  2WF9 A;  1UQV A;  3TI0 A;  4Z6F A;  1KKX A;  1HUZ A;  3UXP A;  2KFN A;  4M9H A;  2ZIW A;  2XID A;  5ALO A;  4P4P A;  4F8R A;  1S77 D; 
#chains in the Genus database with same CATH homology
 5T14 A;  3L3F X;  4A8E A;  3SQI A;  3D2N A;  1Z1B A;  3N7S C;  2HBK A;  4KX3 A;  4PL2 A;  4QIW C;  4U7C A;  3IG8 A;  4GFJ A;  2WAQ C;  2XIC A;  4CGZ A;  3N7P D;  1IIP A;  4FZM A;  2ZIU A;  2LBO A;  3D2S A;  3H0R B;  2F77 X;  3IP4 B;  4P0Q A;  1HEK A;  2H3F A;  2W7O A;  2OXO A;  2YB4 A;  2G06 A;  2YB1 A;  4PL1 A;  2KD1 A;  2Y0S C;  4U6P A;  4P0Q B;  3VCB A;  1HIW A;  2KIC A;  3H0M B;  2K4I A;  2F2A B;  3SMV A;  2KV2 A;  2K8A A;  2W04 A;  2H3I A;  2HMX A;  2K4H A;  3F5E A;  3H0L B;  3O0F A;  2G0A A;  3C29 A;  3D2Q A;  4KX5 A;  4FE3 A;  3AQF A;  1YT3 A;  2KKP A;  2WB1 C;  2R18 A;  3M6K A;  3K1Z A;  2ZIW B;  3IN5 A;  1DRG A;  3AL0 B;  2F8L A;  4FZL A;  1T94 A;  3MGV A;  2KEY A;  4CDG A;  1Q3U A;  2LKY A;  4IC9 A;  4O3M A;  2DF4 B;  3ALR A;  2XVT A;  2RP5 A;  1Q3V A;  1XO0 A;  1PVQ A;  1P7D A;  3LVW A;  2HBL A;  2KKV A;  4AYB F;  1PVR A;  2KHQ A;  2M0N A;  2K8C B;  3RF9 A;  3PZP A;  1Z19 A;  3C28 A;  1L6N A;  2VJ5 A;  2HBJ A;  1D8B A;  2Q4T A;  2G08 A;  2ZIX A;  3M7D A;  2KVC A;  3HKZ C;  4NLB A;  4OJL A;  3AQE A;  3F2D A;  3NUQ A;  1ED1 A;  4BJQ A;  2YX8 A;  2D6F C;  3SAF A;  2K8B B;  4OJ6 A;  3RFA A;  5C0Y A;  3PSI A;  2DQN B;  2E1E A;  1A0P A;  2DGZ A;  2PMZ F;  2H3Q A;  2Z7J A;  2W7P A;  2ZIV B;  2WAQ F;  3CYM A;  3ICX A;  2E1F A;  2H3Z A;  3IG5 A;  1OUQ A;  5HR7 A;  2KJ9 A;  2JH7 A;  3T79 A;  4ACO A;  2JHD A;  3M6Z A;  3KFU F;  3ONN A;  1XNS A;  3PSP A;  4FZN A;  2F76 X;  2Y0S F;  1NZB A;  2OH2 A;  4JMU A;  2KJ8 A;  2E5S A;  2GOL A;  1SZH A;  1URJ A;  2HOQ A;  2JH1 A;  2JMG A;  2KOB A;  2XI9 A;  3F53 A;  5HR6 A;  2H3V A;  4NWI A;  4P0P B;  2G09 A;  2KIW A;  2VJ4 A;  2ZXH A;  2OYY A;  3CP8 A;  4C0Z A;  3SAH A;  4QIW F;  4BUG A;  2ZIV A;  2VKQ A;  2MRL A;  4OJO A;  2ZG6 A;  4CRX A;  2ZXI A;  2K4E A;  1GO3 F;  4OO1 J;  2GH1 A;  2RHF A;  3SAG A;  3GZF A;  2LYA A;  3F2C A;  2CPR A;  2LHT A;  2MA1 A;  2W03 A;  2ZIU B;  1UPH A;  4ICA A;  1PVP A;  2BDU A;  2K89 A;  2JGA A;  4QNL A;  1WUD A;  4BX9 C;  4NLC A;  3N7R C;  2A3V A;  2HOI A;  3NRW A;  2CN1 A;  2G5H B;  5KL1 B;  1TAM A;  3KZX A;  2KJ5 A;  4KMO B;  4NV0 A;  3CRX A;  2NV3 A;  3GU3 A;  4OJ5 A;  1A6S A;  5KL8 B;  3OPX A;  2PMZ C;  2CRX A;  2VIX A;  2KHV A;  2WB1 F;  3LYS A;  3HKZ F;  3F5A A;  3PSF A;  5A0L A;  1KBU A;  2G07 A;  2G5I B;  3DEE A;  3E0F A;  2ZIX B;  1F44 A;  2KNJ A;  2OM6 A;  2HOF A;  1ECW A;  3F2B A;  4QJF B;  2RRD A;  2HBM A;  2N1R A;  1MA7 A;  3VC8 A;  4P0P A;  3LVV A;  4OJP A;  3PST A;  2ZIW A;  2LYB A;  2XID A;  1CRX A;  4AYB C;  5CRX A;  4WJ3 B;  1ZQ1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...