2DQNB

Structure of trna-dependent amidotransferase gatcab complexed with asn
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
405
structure length
405
Chain Sequence
FETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 115
structure length 405
sequence length 405
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2dqnB02
2F2AB 1ZQ1C 2DQNB 2G5HB 2G5IB 2D6FC 4WJ3B 3IP4B 2DF4B 3H0RB 3H0MB 3H0LB 3KFUF 3AL0B
chains in the Genus database with same CATH superfamily
2XVTA 2KMDA 3K75D 5CB1A 1NKCA 4TUQA 2DUYA 4Y2JA 5FP0A 2QARB 2Q0ZX 8ICRA 1D8BA 4QZAA 4DS4A 1YT3A 4F2RA 1TE2A 5KFVA 2KKVA 3C2LA 2L5YA 3GIJA 2LHTA 4QW8A 3Q8SB 2J6UA 5KFOA 3M9NB 1D9DA 2A1JB 2ISPA 2LYBA 3WK9A 4GC6A 1JI7A 4UW9A 3GIMA 2AJQA 2ASDA 2ALZA 2AQ4A 1TK5A 2ZIUB 1KN5A 1ZQFA 2G0AA 2JZBB 2PMZC 4YR2A 3HX0A 3JPSA 1ZQLA 2B6GA 2HHSA 1Q3UA 2KN7A 2VA3A 3AQFA 2HHUA 4QJFB 2E1EA 1SXDA 4EYHB 2KZMA 2D8CA 2JEIA 2UVWA 3TANA 9ICCA 1LVHA 9ICAA 3WU2U 4IQVA 4KLHA 4YVZA 4KX5A 3GU3A 5B5EU 5KFIA 1S5LU 4MEXA 1N61A 2M0NA 3GQCA 1EXNA 3B0XA 2KVSA 1LKYB 4M6WB 4DOCA 2NO5A 4ECXA 2JEJA 1N60A 3TADA 1QH9A 4YXMA 4O3NA 5EE1A 4EX6A 2OCEA 1TAUA 2ZJ5A 1L3SA 2AHOB 3I76A 4PHAA 1Z4NA 4CDGA 2FPKA 1RXWA 1XS9D 2OYYA 4YR3A 1D8YA 5F9NA 2AQ0A 4QZHA 3PNCA 3ISCA 1T3NA 2DKXA 1X9XA 4MFCA 3HRDD 1F44A 2W3RA 2BKEA 3HW8A 2DPIA 2EAOA 2WF5A 2LMRA 1KFTA 4Y2RA 1JROA 2EQYA 1XWLA 3ISDA 4PGQA 9ICWA 1KEJA 4RUAA 1H38A 1RYRA 2IMWP 2IOFK 2W11A 2BCUA 4KLQA 4EEKA 2K89A 2UVVA 2MUTA 4J9PA 4J9NA 5ALYA 3HKZC 3OGUA 4M0AA 7ICNA 3CP8A 3LYSA 1UPHA 4C4TA 4NL9C 5AIAA 1ZQHA 2F76X 1NK6A 2RDJA 2HBJA 3HP6A 4KMUA 2PFNA 3H4DA 4G9BA 3QEAZ 3BQ2A 3C5FA 4UB4A 4EEYA 4F72A 4OO1J 1XO1A 2C2DA 2ISOA 4NLGA 3M9MB 4RPXA 4DSIA 4J9OA 5AKKA 2PI4A 3EUB2 3PY8A 1KFSA 1QCKA 4ECUA 1NZBA 4ICAA 4NV0A 2FLPA 4EX7A 2B0CA 4BXOA 2XY7A 2A3VA 5AK4A 2VA2A 3PX6A 2ZG6A 3EZ5A 1NK5A 2DFLA 5HHIA 1ZQVA 2P6UA 5ALEA 2RHFA 3K1RB 1ZRMA 2KNJA 1U49A 2YB4A 5C0YA 4RQ1A 2GOLA 4R66A 3WKCA 3QZ8A 2K4PA 1ZD5A 4WJ3B 3G6YA 4DS5A 1KBUA 4PL1A 2W43A 4I2AA 4C7ZA 3BS5A 4BGDA 2R18A 4F4XA 4O3MA 4Y2TA 2Y1IA 5D46A 1WCNA 3IDWA 3SYZA 9ICBA 7ICKA 5BOMA 1BPXA 3H40A 5CEHA 4UBCA 4LJXA 4I2BA 4NM2A 1K1SA 5DG9A 5DLFA 4DL5A 4ELTA 2YN4A 2VIXA 3QZ7A 4Y2YA 5KNIA 1ZOLA 5KFYA 4PZNA 4I2GA 5KFMA 3I1YA 1FO4A 2KD1A 2XC9A 1ZXIA 1ZJNA 5DB7A 2MUTB 5J0QA 5AKGA 2F2AB 1CUKA 2ASLA 1ZD3A 2YMPA 2AU0A 3HWTA 2C22A 4PGXA 2EZZA 3C5GA 4DCCA 1N5WA 4DQIA 8ICCA 4OJ6A 3RBEA 4BDPA 1KFDA 3ZDBA 3LDAA 4BWJA 3C1YA 1SKRA 3M6ZA 4NL9A 2FMSA 5KFGA 1MN8A 2OEHA 1ZD4A 3AQEA 4ECVA 2KZ3A 4MEYA 2F3NA 7ICGA 1NOMA 4C4SA 3NUQA 1PK1B 1QQ5A 2NRVA 3E0FA 1X9WA 1B0XA 1BPBA 4B9LA 1S0OA 1MQ3A 4BXOB 4YN4A 2ZUBA 3PSIA 2BQUA 1UA0A 9ICTA 4U7CA 2R8HA 2B21A 4DL7A 4M9LA 4UBBA 2DGZA 4EZ6A 5AKZA 1HEKA 1TVAA 1ZQAA 2HHVA 2FJ6A 3WKEA 5KFTA 2JEFA 3R9KA 4BJQA 5KAFU 1NK0A 4TUSA 4FBTA 3ISBA 1TAMA 1CI4A 5DBAA 8ICWA 4P0PA 4O5EA 4KITB 4FZNA 3J81j 4QZFA 1BPYA 3QU4A 1QLNA 4DQPA 3BZKA 2I9GA 2CN1A 4M9HA 5J2DA 1SWWA 2K60A 2LM1A 3SEIA 1BPEA 2N1RA 5CR0A 4KLLA 4O3OA 4Y2UA 3AU6A 4CF5A 4ELUA 2IHNA 2EZXA 1FFVA 1BNOA 4ECTA 8ICQA 8ICYA 1WYGA 3B0YA 4DL3A 1N63A 5KFSA 8ICBA 1RXVA 4YMOA 3OHAA 4QWDA 3RRHA 4EBCA 5KT5A 2W9MA 3T79A 2R8IA 4Y2PA 1UCVA 4DSFA 1UHUA 1DOQA 3PX4A 5DDYA 5HNKA 3MR2A 3SD7A 4YD1A 4RQ6A 2KG5A 4KLIA 3RAQA 1A0PA 5KG1A 3GV8B 2BPFA 1RQNA 5HMLA 4I2IA 3BQ0A 1IV8A 4DEZA 3RB0A 2OM6A 5KG0A 2UVRA 4UB6U 1OXJA 4CNQA 4TURA 4KLMA 8ICKA 1NK4A 1QSYA 1V97A 1K5OA 3JPNA 4MHVA 1ZQCA 2KFNA 9ICEA 1RYUA 3PW5A 4ECQA 9ICGA 2D3DA 1IXRA 2IBKA 4ECSA 1XC9A 2W9BB 1S9FA 1BPZA 3V7JA 4A8EA 3BQ1A 2Y0SF 3H8WA 4PHEA 5AM1A 3GV7B 4RT2A 1KDHA 3QX7A 1A77A 1LB2B 3HT3A 2HW3A 2FPLA 1BPDA 4QZGA 4CRXA 1C7YA 4CCHA 3ONNA 5DLGA 4ELVA 1WG8A 1ZQUA 4DO9A 2W7OA 5KFNA 5JUMA 5K4LA 2OWOA 4IQWA 3TI0A 3S6JA 4IRKA 3WK4A 3PW0A 4DFKA 2QB0A 4YP3A 2JGAA 3CYMA 5AI8A 3UXNA 4QWEA 1KQQA 4F4KA 3KHHA 3IG8A 1TFRA 4NLKA 1LV5A 3MDAA 4P4PA 3TQ1A 4QZCA 2KV2A 2ZIVA 4C4RA 3QU7A 2KP7A 4AP9A 3E2EA 3WKAA 1A6SA 5DGBA 7ICOA 4QWCA 9ICRA 5J0WA 4IR1A 5AI6A 3MFHA 5ALHA 4DLEA 4HAIA 5EWEA 3EWAA 4KTQA 9ICHA 2F1IA 3NGDA 3ORYA 3KZXA 2I1QA 1NK8A 1SXEA 3WK6A 5KT3A 3PMLA 3HJEA 8ICHA 1L6NA 8ICUA 5D4BA 5KTQA 4I2EA 2PFQA 4K4IA 2HBLA 4LVSA 9ICQA 1ZQJA 3H8JA 2Y1JA 1A76A 1ZQRA 1SKWA 2KHVA 1BGXT 1O08A 3F2BA 3OJUA 1SL1A 1HIWA 9ICLA 1WUDA 5KG6A 2DPJA 5KFWA 4JV0A 4QIWF 1N5XA 4I2JA 9ICNA 2HHXA 7ICFA 3N7SC 1PUZA 1MC8A 5KT4A 5KFDA 2FLLA 5KFFA 5KG4A 3MR5A 4P4MA 4EELA 5KFQA 1Q46A 5AKIA 1RPLA 1WWVA 4RQ7A 3V6JA 1N2XA 4HYKA 5AI4A 5DBBA 4PL2A 2DWQA 3FAHA 3I28A 2QB0B 4I29A 4ED3A 1S0MA 3QU2A 4OJOA 1JRPA 1VLBA 1NJZA 8ICLA 3N7RC 2JRZA 3MR6A 3CRXA 3KKAC 2ZIVB 2XI9A 3T5LA 5AK5A 8ICTA 3JPTA 4O3QA 3PX0A 3SR6A 3AEVA 1RZTA 1PVQA 2Y9TA 5CP2A 3JPRA 4O5KA 4I2HA 2AXTU 4M04A 2FMPA 4USAA 5J0TA 1L3UA 2BPGA 5F3XB 4O9MA 3RJJA 3QNMA 1ED1A 1X6JA 3FDSA 4IS7A 3Q8LA 3PZPA 1ZQIA 1KW4A 2XGPA 4RZRA 3TFSA 3C29A 5HP4A 9ICFA 3Q8RB 5L1IA 5KT6A 4C0ZA 3G6VA 3M6KA 3D6JA 1DGJA 1NKEA 5ALRA 2QB1A 2BDPA 2GH1A 2R8JA 2KSOA 1X66A 4IR9A 4AYBF 1ZQPA 1XSNA 5GTIU 1HUZA 1UT8A 5CRXA 4DSLA 3RB4A 2GLEA 2ZIXA 4OJPA 3KD3A 1MA7A 4I2CA 4DOBA 1JALA 1RYSA 2ZXIA 2ZJ8A 4JK1A 3UMCA 2KTQA 4KLJA 5AM5A 1F5SA 2FI1A 4X5VA 3NRZA 2CRXA 2HDOA 4F5NA 4EBEA 3PW2A 4R65A 3MBYA 1UA1A 3Q8MA 4O3SA 1RQLA 7ICUA 4BWMA 3TAPA 2H3FA 3MDCA 4J9MA 1Z4OA 7ICRA 3RB3A 1SV0C 4MF2A 1KSPA 4I2DA 1ZRNA 4KLSA 2E5SA 3LK9A 3PV8A 3EW9A 1X9SA 5AKLA 4KLEA 3N97B 3C1ZA 5KG7A 3KKAA 2HI0A 3T5KA 4IC9A 5ALFA 4C8KA 4F5OA 3KTQA 3M1YA 2BCSA 2ZUDA 1HJPA 3RRGA 2XO7A 4GC7A 3MC1A 5KT7A 5CHGA 9ICSA 3OSNA 1XU4A 3BQTA 3PW4A 4DWIA 3LWLA 1JXEA 1TAQA 3DEEA 3H8SA 4TQSA 1ZD2P 5IIKA 2NO4A 3NS1A 3MGVA 1COKA 4ECRA 2QLTA 2OH2A 3QU9A 3QXGA 5A0LA 5AM0A 3GILA 5G5GA 2NRZA 2XCAA 5CA7A 3ZI4A 4RQ2A 1L8LA 4RPZA 5EE0A 5BPCA 4UB8U 3BS7A 2HHWA 2I6XA 3NVWA 2W9AA 3H0MB 2BPCA 2H3QA 2YY6A 7ICIA 2LPEA 3H8MA 1ZQQA 2KSOB 4J9QA 2WAQF 3BQ7A 2MRLA 5EE9A 3Q8QB 5KFJA 2AGQA 5J0RA 4Q45A 4UB2A 1V9PA 3C21A 4Z6FA 1ZQZA 1B43A 1JXLA 4Y2QA 1PVRA 3ZDAA 3UQ0A 4B9MA 7ICTA 1NJWA 2CPRA 4F91B 2YB1A 4FS2A 9ICOA 4EENA 4NXZA 2RRDA 2HSZA 3SENA 4M9NA 2MU2A 1DRGA 4JV1A 1NK7A 2O6KA 3AU2A 5JU5A 5HHHA 3IHQB 5J2CA 1TKDA 5D49A 1YZ7A 2YMLA 1U45A 2EZYA 3L5KA 4I27A 2WB1F 4JB3A 2KK0A 2G06A 3H7IA 3KHRA 3RH5A 1SV0A 5JRTA 1YZ6A 2W9CA 2P6RA 3RF9A 5KG5A 4QWAA 5ALOA 3V6KA 1KTQA 5ALQA 1DXSA 5KFKA 3QUQA 4EZ9A 5IIOA 4UB1A 4J9RA 4F2SA 2KHQA 1D9FA 2KIWA 2Y9UA 1NZPA 4J03A 2KJ9A 5L9XA 3OSPA 3N7PD 1VJ5A 3GIKA 1X40A 3LWMA 5DKWA 5EWFA 5DQHA 1UT5A 3RFAA 2YQEA 2ATLA 2W8KA 1IG6A 4FO6A 4DF8A 8ICMA 3RJFA 3BS5B 1ZQNA 3PO5A 4ED0A 4C8NA 1NJYA 3MABA 1J97A 2LBOA 4K4GA 3UMGA 1FEZA 4P2HA 1WWUA 1NKBA 1QSSA 4E0DA 5ALWA 8ICJA 4JWNA 3IM1A 2ASJA 4M9JA 3IG5A 5EE3A 4UB3A 2MSNA 4PZOA 4EBDA 4P0QA 5C5JA 2ZJAA 2LYAA 4YCXA 5J2BA 4ZH4A 4DF4A 4UB5A 1L3TA 4Z6EA 4Q8EA 2XY6A 7ICJA 1ZQXA 4B9SA 2BCRA 5KAIU 3KHGA 1SB3C 1KLNA 4DSKA 5ALDA 1RG6A 5L1JA 1DK2A 4C8OA 4XUSA 4PPXA 7ICMA 2RLTA 1F0MA 4UASA 2F8LA 4RNNA 3SV4A 3RR7A 3RJHA 1T4GA 4Z6DA 2RDIA 4JV2A 2WFAA 1ZETA 4Z6CA 3T5HA 4DFMA 5JTIA 5ALSA 5F9LA 2WHEA 3D2SA 1XSLA 1SV4A 2XY5A 2XICA 3QYPA 2W9CB 3UM9A 4ED8A 4ZOHC 5KFEA 2E8NA 2V4QA 5KFAA 3IV6A 2E8OA 2AH5A 5AKHA 2BQRA 2JH7A 3AUOA 4IRCA 2HVIA 3KZIU 2AGPA 3NVVA 8ICNA 4GIBA 2HHQA 2NRTA 3BJYA 4FS1A 1J2MA 1ZQMA 3JPOA 4Q43A 4Q44A 3NVZA 2XGQA 3RJEA 3TARA 1S97A 5AK6A 2WAQC 2QARA 4NM1A 5AI0A 2JV3A 4P0PB 4R63A 3WK5A 2PI5A 2C2EA 3Q8PB 5J0YA 2E8PA 1T94A 1ZQKA 1VDVA 5KFHA 4QZIA 5IIJA 1ECWA 1ZQTA 1T7PA 3WK7A 2HOIA 4PJ0U 5J8YC 4NLCA 1MSWD 1HUOA 8ICZA 4NLNA 3PSTA 3UQ2A 2D6FC 2KJ8A 4DFJA 2VJ4A 5KFCA 2F8KA 1SZPA 4QW9A 4M2YA 3F2CA 1OUQA 3JPQA 2ZIUA 1ZQWA 3MGIA 4DSEA 1PZNA 3FYHA 2EANA 3RBDA 4P0QB 4DFDA 1S76D 3VCBA 4Y2SA 4ECWA 4QNLA 2JR5A 4R8UA 1J2NA 5KFRA 3SAGA 2YX8A 4KMOB 2WB1C 4QZ9A 3O0FA 4IL6U 2ZUCA 2DKZA 3EYZA 5J2EA 2BR0A 3SQIA 2XIDA 4IQUA 1GO3F 2BZFA 5J2HA 4KLFA 8ICIA 5ALPA 2UVUA 4MFFA 3C2KA 3HKZF 5L1LA 4IQTA 5ALXA 3TKAA 2F1HA 3OHBA 4F4WA 3BDPA 3M8SA 2MA1A 4RQ5A 4C7YA 3KOOA 1QQ6A 4FZLA 3C23A 5ALTA 8ICAA 3ETLA 4J9SA 3V6HA 3UXPA 1NJXA 4F4ZA 2BCQA 5ALGA 4YMMA 2WTFA 2Z7JA 4IRDA 1LKYA 3N4MB 5AM3A 3C2MA 1S0VA 3M9OB 3TACB 1N48A 2ZIWA 5AI9A 1T8EA 4GFJA 4TQRA 3AM9A 5ALUA 2ZTCA 1SKSA 1NNLA 4Y2VA 4RQNA 2NYVA 3U26A 3RJKA 5HR7A 3A0HU 1Z00A 4YR0A 2VA8A 3T3FA 4FFDA 1B22A 4XA5A 4U6PA 5J0PA 2KIVA 1OW5A 3CNHA 4NWIA 4ED6A 1JIHA 5J2FA 1X2IA 5ALJA 3HPOA 2I5HA 4ECZA 1QQ7A 1V85A 4ED7A 4GXKA 3LVWA 2EAPA 4F8RA 1L3VA 1CEZA 1KRPA 4UAVA 2G5IB 4OD0A 2HOQA 1ZQYA 1XSPA 5J8YA 3PSPA 1L5UA 1U9LA 4NLZA 4CF4A 2JEGA 4ED1A 2KFZA 2AGOA 1BVSA 3RJIA 5KG2A 2JH1A 3C28A 4QWBA 2P35A 4R8UB 3OJSA 4JWMA 1SL0A 4RQ0A 2ODGA 2W55A 2DQNB 2HHTA 2GO7A 4PGYA 4RPYA 5DG8A 2R8GA 2YMQA 2P66A 5J2AA 5AKYA 5G5HA 1SZHA 1URJA 4QZBA 5DBCA 2OHFA 4UAUA 3A0BU 3PVXA 2HOFA 2YMMA 3D2NA 3LVVA 1ZQEA 2Y0SC 3RB6A 1AROP 2G09A 3FC4A 3UXOA 4PHDA 1X9MA 4FE3A 2VJ5A 3HILA 1Z1VA 1FIQA 2PFPA 4R64A 5DG7A 1IIPA 2J6SA 4GXJA 4F71A 4YXJA 2DL0A 2LM4A 4M9GA 2ZIWB 1COOA 2FPMA 3GIIA 5ALVA 5DQGA 2KICA 3PR5B 2K4HA 4DFPA 1Z00B 1PK3A 4RT3A 3VC8A 1RDFA 2JHDA 1ZJMA 4XRHA 2ESEA 1L7NA 5J2IA 3Q8KA 4YFKA 3WKBA 5IIIA 1L7MA 1L8OA 9ICMA 3V7LA 2FE9A 4YQWA 2QKQA 4O0IA 4F5RA 9ICXA 5AICA 3ICXA 4KN7A 3UPQA 1K1QA 5AIBA 3G6XA 8ICXA 3SAHA 2V4RA 3IN5A 1ZQBA 1P7DA 2XCPA 2NV3A 2R8KA 4RQ8A 3MFIA 2H5XA 2ZTDA 4ACOA 2ZXHA 4NJ8A 2YTUA 3NVYA 4F4YA 2PFOA 4KLUA 7ICPA 2KKPA 3GFKB 4LZGA 1PVPA 2W04A 4KLTA 1Z3EB 3THVA 1ZQSA 2G5HB 1U47A 2ZTEA 2J6TA 1L7OA 3QU5A 5J2JA 1QTMA 3MR3A 2IOHA 3NTUA 3ZDCA 5J0SA 1Y88A 3AMZA 5AM4A 4DL2A 4O5CA 1L7PA 1BNPA 4DL6A 3SAFA 4KX3A 4GXIA 4UAWA 1PK1A 2KEYA 3GV5B 1DK3A 4PHPA 9ICJA 2PKEA 3QEBZ 3L4PA 3CW2C 2LKYA 5IILA 4QIWC 4TUPA 4UATA 5IINA 5HR6A 4RNMA 3F5AA 2KJ5A 5EWGA 1NK9A 1X6IA 2K8CB 2HVHA 2WF7A 2NRXA 2VANA 3QE9Y 9ICUA 2F77X 5HMMA 3F2DA 2F1JA 5DB8A 3ZDDA 3N28A 4I2FA 1Q8KA 1TK8A 5AM2A 8ICSA 3B9JA 4Q8FA 4DQRA 4F93B 2RQ5A 2ZIXB 3ZD8A 5J0UA 3TAQA 2W3SA 4BUGA 2C28A 5KFUA 4LZDA 1M6YA 2OXOA 1JX4A 5ALKA 2GWSA 3NRWA 4M47A 5L1KA 2VKQA 5J2KA 3GZFA 2IA6A 2E8MA 3RH4A 7ICSA 3EPIA 3M8RA 3EPGA 1X42A 3BZCA 1SWVA 8ICOA 4US8A 4RQMA 4F92B 5DQIA 2H3IA 4NY8A 3ETRA 4CE6A 3IP4B 2HBMA 2BCVA 5J29A 2H3VA 5EOZA 2W7PA 3H0RB 5KFLA 4MF8A 5ALZA 2WF8A 4JMUA 3V7KA 1Q3VA 2BDUA 3PSFA 5BOLA 1N62A 3PMNA 1ZQGA 2A19A 4J9LA 4XQ8A 8ICGA 3DV9A 1ZQ1C 5TISU 4ED2A 1S77D 1ZQDA 4AYBC 5H2FU 5AHXA 5AKEA 4UARA 5KL1B 2EH9A 4KLDA 2HMXA 3GDXA 2NRWA 1S8OA 4DSJA 2K8AA 2W9BA 1C20A 2G07A 4NLBA 5KG3A 4UQGA 2CXYA 3IRUA 3ALRA 3H0LB 3FM9A 2HCFA 5AKXA 3F5EA 1JMSA 1SL2A 4DL4A 4I28A 1KL9A 4O3RA 3NASA 4DQQA 3V72A 2RP5A 4CF3A 4CGZA 7ICEA 2K4EA 2IHMA 3KHLA 1AQ6A 8ICFA 4GLXA 2W54A 7ICVA 5DB9A 3K4GA 5J2GA 4FBUA 5B66U 3RH6A 2FMQA 2H3ZA 2K4IA 4YMNA 4EYIB 1S10A 5J0XA 1QSLA 5AI5A 4F3OA 4UAYA 3OTQA 3D2QA 2WF6A 5DGAA 2ES6A 2E3TA 1U4BA 1CRXA 4F50A 4B9NA 3UMBA 4QZ8A 4J9KA 2BGWA 3JPPA 3ZD9A 4DOAA 1S0NA 8ICPA 5ALNA 2PMZF 2C2RA 5CWRA 4QZEA 1Z19A 3ZDEA 2K8BB 4Y2XA 1O03A 1B4FA 4P4OA 4MFAA 3DDHA 4RU9A 2MAXA 9ICVA 1SGGA 2IOFA 1KKXA 5DDMA 1XO0A 4YG2A 3RR8A 1JN3A 4RNOA 1JUDA 2KVCA 3ED5A 4C80A 1WCLA 2DF4B 3PW7A 3PO4A 4OCZA 4KLOA 8ICEA 2JXJA 2LI6A 4YD2A 4KN4A 7ICLA 1RM6C 2WF9A 4RUCA 4BX9C 3SMVA 1Z1BA 2KE7A 1FFUA 3QUCA 2E1FA 2DBYA 4B9TA 2G08A 5CJ7A 4B6JA 2KZZA 5IIMA 3QUTA 3SI8A 4PH5A 4C8MA 3WK8A 3TFRA 5ALIA 5L1MA 4O3PA 1D8LA 2PXIA 3K1ZA 2LYHA 3M7DA 5AKJA 3AL0B 4F5QA 2KOBA 2W03A 2JMGA 5KL8B 4C8LA 3RAXA 4QZDA 3H4BA 1XNSA 5J0OA 2W8LA 1ZYQA 9ICPA 4DQSA 1N56A 1TK0A 2A1JA 4DLGA 4JUZA 4UAZA 7ICHA 5T14A 1V38A 3RTVA 4OJLA 5KT2A 5AK3A 5E79U 1MQ2A 5KFBA 1IM4A 3F53A 5GTHU 2BQ3A 5KFZA 4RQ3A 2JZBA 4K4HA 4F5PA 4ECYA 1U48A 8ICVA 3T5JA 4OJ5A 3AN1A 1TV9A 3RJGA 1UQVA 2FLNA 3QUBA 4FZMA 2EDUA 5ALMA 1ZQOA 3KBBA 3OPXA 7ICQA 4RQ4A 2A1AA 2Q4TA 2V9WA 1NI3A 3MGHA 5ALLA 4KLGA 4B9VA 2HBKA 4US9A 3SZ2A 1SIJA 3SV3A 9ICKA 3E58A 5TZVA 3WKDA 3TADC 3L3FX 3KFUF 3PR4A 2EAMA 2F44A 2M9NA 5KFPA 9ICIA 4B9UA 2FDRA 5KFXA 4M6WA 1T3QA 4G3IA 1DGSA 2BHNA 5DB6A
chains in the Genus database with same CATH topology
1A0PA 2K4HA 2G07A 3PSTA 2ZIVB 4NLBA 1NZBA 2XVTA 4ICAA 4NV0A 2D6FC 2XI9A 3AQEA 2CPRA 2KJ8A 3ALRA 2H3FA 3H0LB 4P0QA 2JHDA 2LYAA 3VC8A 2YB1A 2VJ4A 3LVWA 3K1ZA 2A3VA 3NUQA 3M7DA 2RRDA 2ZIXB 3KZXA 3E0FA 3AL0B 3F2CA 2KOBA 3F5EA 1OUQA 2OM6A 2ZIUA 2W03A 2JMGA 2G5IB 4BUGA 2E5SA 2HOQA 2ZG6A 5KL8B 1PVQA 4P0QB 1XNSA 1DRGA 1D8BA 3VCBA 1L6NA 3PSIA 1YT3A 3PSPA 4CDGA 3ICXA 4QNLA 4U7CA 2OXOA 2OYYA 3NRWA 2RP5A 3SAGA 2RHFA 2DGZA 4CGZA 2KKVA 2YX8A 4KMOB 2WB1C 4IC9A 2KNJA 2K4EA 2VKQA 2YB4A 5T14A 2HBLA 5C0YA 2LHTA 3O0FA 2GOLA 2WB1F 1HEKA 3GZFA 3SAHA 4OJLA 1ED1A 3IN5A 1P7DA 2G06A 4WJ3B 2NV3A 2F8LA 2JH1A 4BJQA 3F53A 3C28A 1KBUA 1F44A 4PL1A 3SQIA 2H3ZA 2K4IA 2XIDA 2LYBA 3RF9A 1GO3F 1TAMA 4ACOA 4A8EA 3PZPA 2R18A 2Y0SF 2ZXHA 4O3MA 4P0PA 3HKZF 3D2QA 3DEEA 2KKPA 3D2SA 2KHVA 2DQNB 4FZNA 3C29A 3MGVA 1CRXA 1PVPA 2W04A 2XICA 3F2BA 4OJ5A 2OH2A 2CN1A 1HIWA 2H3IA 2G5HB 1WUDA 2ZIUB 5A0LA 3IP4B 2G0AA 2HBMA 2MA1A 2PMZC 4FZLA 4CRXA 4FZMA 4C0ZA 2H3VA 2JH7A 1SZHA 1URJA 2KHQA 2N1RA 3ONNA 3M6KA 2VIXA 2PMZF 4QIWF 2KIWA 2W7PA 3H0RB 1Z19A 3OPXA 2K8BB 2HOFA 2GH1A 3D2NA 3LVVA 2Q4TA 2Z7JA 2W7OA 2K89A 3N7SC 2KJ9A 2Y0SC 1Q3UA 4AYBF 4JMUA 1Q3VA 3H0MB 3N7PD 3HKZC 2BDUA 2H3QA 3AQFA 3SAFA 4KX3A 5CRXA 3PSFA 2KD1A 2G09A 4QJFB 2E1EA 3CP8A 2HBKA 2ZIXA 3LYSA 1UPHA 2KEYA 2ZIWA 4OJPA 1XO0A 4FE3A 2VJ5A 3RFAA 2F76X 2WAQC 4GFJA 1MA7A 1ZQ1C 2KVCA 2HBJA 2DF4B 2JGAA 2WAQF 3CYMA 2ZXIA 1IIPA 2LKYA 4PL2A 4P0PB 4QIWC 2MRLA 2F2AB 3IG8A 3T79A 5HR6A 1T94A 2ZIWB 3L3FX 3KFUF 5HR7A 3F5AA 2LBOA 2KJ5A 4BX9C 1ECWA 2KV2A 2ZIVA 3SMVA 4AYBC 1Z1BA 4KX5A 4OO1J 4OJ6A 3GU3A 5KL1B 2K8CB 2CRXA 1PVRA 4U6PA 4OJOA 2HOIA 1A6SA 2E1FA 4NLCA 2HMXA 2KICA 2F77X 3N7RC 2G08A 3M6ZA 4NWIA 3IG5A 3F2DA 2M0NA 2K8AA 3CRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2A B;  1ZQ1 C;  2DQN B;  2G5H B;  2G5I B;  2D6F C;  4WJ3 B;  3IP4 B;  2DF4 B;  3H0R B;  3H0M B;  3H0L B;  3KFU F;  3AL0 B; 
#chains in the Genus database with same CATH topology
 2XVT A;  2KMD A;  3K75 D;  5CB1 A;  1NKC A;  4TUQ A;  2DUY A;  4Y2J A;  5FP0 A;  2QAR B;  2Q0Z X;  8ICR A;  1D8B A;  4QZA A;  4DS4 A;  1YT3 A;  4F2R A;  1TE2 A;  5KFV A;  2KKV A;  3C2L A;  2L5Y A;  3GIJ A;  2LHT A;  4QW8 A;  3Q8S B;  2J6U A;  5KFO A;  3M9N B;  1D9D A;  2A1J B;  2ISP A;  2LYB A;  3WK9 A;  4GC6 A;  1JI7 A;  4UW9 A;  3GIM A;  2AJQ A;  2ASD A;  2ALZ A;  2AQ4 A;  1TK5 A;  2ZIU B;  1KN5 A;  1ZQF A;  2G0A A;  2JZB B;  2PMZ C;  4YR2 A;  3HX0 A;  3JPS A;  1ZQL A;  2B6G A;  2HHS A;  1Q3U A;  2KN7 A;  2VA3 A;  3AQF A;  2HHU A;  4QJF B;  2E1E A;  1SXD A;  4EYH B;  2KZM A;  2D8C A;  2JEI A;  2UVW A;  3TAN A;  9ICC A;  1LVH A;  9ICA A;  3WU2 U;  4IQV A;  4KLH A;  4YVZ A;  4KX5 A;  3GU3 A;  5B5E U;  5KFI A;  1S5L U;  4MEX A;  1N61 A;  2M0N A;  3GQC A;  1EXN A;  3B0X A;  2KVS A;  1LKY B;  4M6W B;  4DOC A;  2NO5 A;  4ECX A;  2JEJ A;  1N60 A;  3TAD A;  1QH9 A;  4YXM A;  4O3N A;  5EE1 A;  4EX6 A;  2OCE A;  1TAU A;  2ZJ5 A;  1L3S A;  2AHO B;  3I76 A;  4PHA A;  1Z4N A;  4CDG A;  2FPK A;  1RXW A;  1XS9 D;  2OYY A;  4YR3 A;  1D8Y A;  5F9N A;  2AQ0 A;  4QZH A;  3PNC A;  3ISC A;  1T3N A;  2DKX A;  1X9X A;  4MFC A;  3HRD D;  1F44 A;  2W3R A;  2BKE A;  3HW8 A;  2DPI A;  2EAO A;  2WF5 A;  2LMR A;  1KFT A;  4Y2R A;  1JRO A;  2EQY A;  1XWL A;  3ISD A;  4PGQ A;  9ICW A;  1KEJ A;  4RUA A;  1H38 A;  1RYR A;  2IMW P;  2IOF K;  2W11 A;  2BCU A;  4KLQ A;  4EEK A;  2K89 A;  2UVV A;  2MUT A;  4J9P A;  4J9N A;  5ALY A;  3HKZ C;  3OGU A;  4M0A A;  7ICN A;  3CP8 A;  3LYS A;  1UPH A;  4C4T A;  4NL9 C;  5AIA A;  1ZQH A;  2F76 X;  1NK6 A;  2RDJ A;  2HBJ A;  3HP6 A;  4KMU A;  2PFN A;  3H4D A;  4G9B A;  3QEA Z;  3BQ2 A;  3C5F A;  4UB4 A;  4EEY A;  4F72 A;  4OO1 J;  1XO1 A;  2C2D A;  2ISO A;  4NLG A;  3M9M B;  4RPX A;  4DSI A;  4J9O A;  5AKK A;  2PI4 A;  3EUB 2;  3PY8 A;  1KFS A;  1QCK A;  4ECU A;  1NZB A;  4ICA A;  4NV0 A;  2FLP A;  4EX7 A;  2B0C A;  4BXO A;  2XY7 A;  2A3V A;  5AK4 A;  2VA2 A;  3PX6 A;  2ZG6 A;  3EZ5 A;  1NK5 A;  2DFL A;  5HHI A;  1ZQV A;  2P6U A;  5ALE A;  2RHF A;  3K1R B;  1ZRM A;  2KNJ A;  1U49 A;  2YB4 A;  5C0Y A;  4RQ1 A;  2GOL A;  4R66 A;  3WKC A;  3QZ8 A;  2K4P A;  1ZD5 A;  4WJ3 B;  3G6Y A;  4DS5 A;  1KBU A;  4PL1 A;  2W43 A;  4I2A A;  4C7Z A;  3BS5 A;  4BGD A;  2R18 A;  4F4X A;  4O3M A;  4Y2T A;  2Y1I A;  5D46 A;  1WCN A;  3IDW A;  3SYZ A;  9ICB A;  7ICK A;  5BOM A;  1BPX A;  3H40 A;  5CEH A;  4UBC A;  4LJX A;  4I2B A;  4NM2 A;  1K1S A;  5DG9 A;  5DLF A;  4DL5 A;  4ELT A;  2YN4 A;  2VIX A;  3QZ7 A;  4Y2Y A;  5KNI A;  1ZOL A;  5KFY A;  4PZN A;  4I2G A;  5KFM A;  3I1Y A;  1FO4 A;  2KD1 A;  2XC9 A;  1ZXI A;  1ZJN A;  5DB7 A;  2MUT B;  5J0Q A;  5AKG A;  2F2A B;  1CUK A;  2ASL A;  1ZD3 A;  2YMP A;  2AU0 A;  3HWT A;  2C22 A;  4PGX A;  2EZZ A;  3C5G A;  4DCC A;  1N5W A;  4DQI A;  8ICC A;  4OJ6 A;  3RBE A;  4BDP A;  1KFD A;  3ZDB A;  3LDA A;  4BWJ A;  3C1Y A;  1SKR A;  3M6Z A;  4NL9 A;  2FMS A;  5KFG A;  1MN8 A;  2OEH A;  1ZD4 A;  3AQE A;  4ECV A;  2KZ3 A;  4MEY A;  2F3N A;  7ICG A;  1NOM A;  4C4S A;  3NUQ A;  1PK1 B;  1QQ5 A;  2NRV A;  3E0F A;  1X9W A;  1B0X A;  1BPB A;  4B9L A;  1S0O A;  1MQ3 A;  4BXO B;  4YN4 A;  2ZUB A;  3PSI A;  2BQU A;  1UA0 A;  9ICT A;  4U7C A;  2R8H A;  2B21 A;  4DL7 A;  4M9L A;  4UBB A;  2DGZ A;  4EZ6 A;  5AKZ A;  1HEK A;  1TVA A;  1ZQA A;  2HHV A;  2FJ6 A;  3WKE A;  5KFT A;  2JEF A;  3R9K A;  4BJQ A;  5KAF U;  1NK0 A;  4TUS A;  4FBT A;  3ISB A;  1TAM A;  1CI4 A;  5DBA A;  8ICW A;  4P0P A;  4O5E A;  4KIT B;  4FZN A;  3J81 j;  4QZF A;  1BPY A;  3QU4 A;  1QLN A;  4DQP A;  3BZK A;  2I9G A;  2CN1 A;  4M9H A;  5J2D A;  1SWW A;  2K60 A;  2LM1 A;  3SEI A;  1BPE A;  2N1R A;  5CR0 A;  4KLL A;  4O3O A;  4Y2U A;  3AU6 A;  4CF5 A;  4ELU A;  2IHN A;  2EZX A;  1FFV A;  1BNO A;  4ECT A;  8ICQ A;  8ICY A;  1WYG A;  3B0Y A;  4DL3 A;  1N63 A;  5KFS A;  8ICB A;  1RXV A;  4YMO A;  3OHA A;  4QWD A;  3RRH A;  4EBC A;  5KT5 A;  2W9M A;  3T79 A;  2R8I A;  4Y2P A;  1UCV A;  4DSF A;  1UHU A;  1DOQ A;  3PX4 A;  5DDY A;  5HNK A;  3MR2 A;  3SD7 A;  4YD1 A;  4RQ6 A;  2KG5 A;  4KLI A;  3RAQ A;  1A0P A;  5KG1 A;  3GV8 B;  2BPF A;  1RQN A;  5HML A;  4I2I A;  3BQ0 A;  1IV8 A;  4DEZ A;  3RB0 A;  2OM6 A;  5KG0 A;  2UVR A;  4UB6 U;  1OXJ A;  4CNQ A;  4TUR A;  4KLM A;  8ICK A;  1NK4 A;  1QSY A;  1V97 A;  1K5O A;  3JPN A;  4MHV A;  1ZQC A;  2KFN A;  9ICE A;  1RYU A;  3PW5 A;  4ECQ A;  9ICG A;  2D3D A;  1IXR A;  2IBK A;  4ECS A;  1XC9 A;  2W9B B;  1S9F A;  1BPZ A;  3V7J A;  4A8E A;  3BQ1 A;  2Y0S F;  3H8W A;  4PHE A;  5AM1 A;  3GV7 B;  4RT2 A;  1KDH A;  3QX7 A;  1A77 A;  1LB2 B;  3HT3 A;  2HW3 A;  2FPL A;  1BPD A;  4QZG A;  4CRX A;  1C7Y A;  4CCH A;  3ONN A;  5DLG A;  4ELV A;  1WG8 A;  1ZQU A;  4DO9 A;  2W7O A;  5KFN A;  5JUM A;  5K4L A;  2OWO A;  4IQW A;  3TI0 A;  3S6J A;  4IRK A;  3WK4 A;  3PW0 A;  4DFK A;  2QB0 A;  4YP3 A;  2JGA A;  3CYM A;  5AI8 A;  3UXN A;  4QWE A;  1KQQ A;  4F4K A;  3KHH A;  3IG8 A;  1TFR A;  4NLK A;  1LV5 A;  3MDA A;  4P4P A;  3TQ1 A;  4QZC A;  2KV2 A;  2ZIV A;  4C4R A;  3QU7 A;  2KP7 A;  4AP9 A;  3E2E A;  3WKA A;  1A6S A;  5DGB A;  7ICO A;  4QWC A;  9ICR A;  5J0W A;  4IR1 A;  5AI6 A;  3MFH A;  5ALH A;  4DLE A;  4HAI A;  5EWE A;  3EWA A;  4KTQ A;  9ICH A;  2F1I A;  3NGD A;  3ORY A;  3KZX A;  2I1Q A;  1NK8 A;  1SXE A;  3WK6 A;  5KT3 A;  3PML A;  3HJE A;  8ICH A;  1L6N A;  8ICU A;  5D4B A;  5KTQ A;  4I2E A;  2PFQ A;  4K4I A;  2HBL A;  4LVS A;  9ICQ A;  1ZQJ A;  3H8J A;  2Y1J A;  1A76 A;  1ZQR A;  1SKW A;  2KHV A;  1BGX T;  1O08 A;  3F2B A;  3OJU A;  1SL1 A;  1HIW A;  9ICL A;  1WUD A;  5KG6 A;  2DPJ A;  5KFW A;  4JV0 A;  4QIW F;  1N5X A;  4I2J A;  9ICN A;  2HHX A;  7ICF A;  3N7S C;  1PUZ A;  1MC8 A;  5KT4 A;  5KFD A;  2FLL A;  5KFF A;  5KG4 A;  3MR5 A;  4P4M A;  4EEL A;  5KFQ A;  1Q46 A;  5AKI A;  1RPL A;  1WWV A;  4RQ7 A;  3V6J A;  1N2X A;  4HYK A;  5AI4 A;  5DBB A;  4PL2 A;  2DWQ A;  3FAH A;  3I28 A;  2QB0 B;  4I29 A;  4ED3 A;  1S0M A;  3QU2 A;  4OJO A;  1JRP A;  1VLB A;  1NJZ A;  8ICL A;  3N7R C;  2JRZ A;  3MR6 A;  3CRX A;  3KKA C;  2ZIV B;  2XI9 A;  3T5L A;  5AK5 A;  8ICT A;  3JPT A;  4O3Q A;  3PX0 A;  3SR6 A;  3AEV A;  1RZT A;  1PVQ A;  2Y9T A;  5CP2 A;  3JPR A;  4O5K A;  4I2H A;  2AXT U;  4M04 A;  2FMP A;  4USA A;  5J0T A;  1L3U A;  2BPG A;  5F3X B;  4O9M A;  3RJJ A;  3QNM A;  1ED1 A;  1X6J A;  3FDS A;  4IS7 A;  3Q8L A;  3PZP A;  1ZQI A;  1KW4 A;  2XGP A;  4RZR A;  3TFS A;  3C29 A;  5HP4 A;  9ICF A;  3Q8R B;  5L1I A;  5KT6 A;  4C0Z A;  3G6V A;  3M6K A;  3D6J A;  1DGJ A;  1NKE A;  5ALR A;  2QB1 A;  2BDP A;  2GH1 A;  2R8J A;  2KSO A;  1X66 A;  4IR9 A;  4AYB F;  1ZQP A;  1XSN A;  5GTI U;  1HUZ A;  1UT8 A;  5CRX A;  4DSL A;  3RB4 A;  2GLE A;  2ZIX A;  4OJP A;  3KD3 A;  1MA7 A;  4I2C A;  4DOB A;  1JAL A;  1RYS A;  2ZXI A;  2ZJ8 A;  4JK1 A;  3UMC A;  2KTQ A;  4KLJ A;  5AM5 A;  1F5S A;  2FI1 A;  4X5V A;  3NRZ A;  2CRX A;  2HDO A;  4F5N A;  4EBE A;  3PW2 A;  4R65 A;  3MBY A;  1UA1 A;  3Q8M A;  4O3S A;  1RQL A;  7ICU A;  4BWM A;  3TAP A;  2H3F A;  3MDC A;  4J9M A;  1Z4O A;  7ICR A;  3RB3 A;  1SV0 C;  4MF2 A;  1KSP A;  4I2D A;  1ZRN A;  4KLS A;  2E5S A;  3LK9 A;  3PV8 A;  3EW9 A;  1X9S A;  5AKL A;  4KLE A;  3N97 B;  3C1Z A;  5KG7 A;  3KKA A;  2HI0 A;  3T5K A;  4IC9 A;  5ALF A;  4C8K A;  4F5O A;  3KTQ A;  3M1Y A;  2BCS A;  2ZUD A;  1HJP A;  3RRG A;  2XO7 A;  4GC7 A;  3MC1 A;  5KT7 A;  5CHG A;  9ICS A;  3OSN A;  1XU4 A;  3BQT A;  3PW4 A;  4DWI A;  3LWL A;  1JXE A;  1TAQ A;  3DEE A;  3H8S A;  4TQS A;  1ZD2 P;  5IIK A;  2NO4 A;  3NS1 A;  3MGV A;  1COK A;  4ECR A;  2QLT A;  2OH2 A;  3QU9 A;  3QXG A;  5A0L A;  5AM0 A;  3GIL A;  5G5G A;  2NRZ A;  2XCA A;  5CA7 A;  3ZI4 A;  4RQ2 A;  1L8L A;  4RPZ A;  5EE0 A;  5BPC A;  4UB8 U;  3BS7 A;  2HHW A;  2I6X A;  3NVW A;  2W9A A;  3H0M B;  2BPC A;  2H3Q A;  2YY6 A;  7ICI A;  2LPE A;  3H8M A;  1ZQQ A;  2KSO B;  4J9Q A;  2WAQ F;  3BQ7 A;  2MRL A;  5EE9 A;  3Q8Q B;  5KFJ A;  2AGQ A;  5J0R A;  4Q45 A;  4UB2 A;  1V9P A;  3C21 A;  4Z6F A;  1ZQZ A;  1B43 A;  1JXL A;  4Y2Q A;  1PVR A;  3ZDA A;  3UQ0 A;  4B9M A;  7ICT A;  1NJW A;  2CPR A;  4F91 B;  2YB1 A;  4FS2 A;  9ICO A;  4EEN A;  4NXZ A;  2RRD A;  2HSZ A;  3SEN A;  4M9N A;  2MU2 A;  1DRG A;  4JV1 A;  1NK7 A;  2O6K A;  3AU2 A;  5JU5 A;  5HHH A;  3IHQ B;  5J2C A;  1TKD A;  5D49 A;  1YZ7 A;  2YML A;  1U45 A;  2EZY A;  3L5K A;  4I27 A;  2WB1 F;  4JB3 A;  2KK0 A;  2G06 A;  3H7I A;  3KHR A;  3RH5 A;  1SV0 A;  5JRT A;  1YZ6 A;  2W9C A;  2P6R A;  3RF9 A;  5KG5 A;  4QWA A;  5ALO A;  3V6K A;  1KTQ A;  5ALQ A;  1DXS A;  5KFK A;  3QUQ A;  4EZ9 A;  5IIO A;  4UB1 A;  4J9R A;  4F2S A;  2KHQ A;  1D9F A;  2KIW A;  2Y9U A;  1NZP A;  4J03 A;  2KJ9 A;  5L9X A;  3OSP A;  3N7P D;  1VJ5 A;  3GIK A;  1X40 A;  3LWM A;  5DKW A;  5EWF A;  5DQH A;  1UT5 A;  3RFA A;  2YQE A;  2ATL A;  2W8K A;  1IG6 A;  4FO6 A;  4DF8 A;  8ICM A;  3RJF A;  3BS5 B;  1ZQN A;  3PO5 A;  4ED0 A;  4C8N A;  1NJY A;  3MAB A;  1J97 A;  2LBO A;  4K4G A;  3UMG A;  1FEZ A;  4P2H A;  1WWU A;  1NKB A;  1QSS A;  4E0D A;  5ALW A;  8ICJ A;  4JWN A;  3IM1 A;  2ASJ A;  4M9J A;  3IG5 A;  5EE3 A;  4UB3 A;  2MSN A;  4PZO A;  4EBD A;  4P0Q A;  5C5J A;  2ZJA A;  2LYA A;  4YCX A;  5J2B A;  4ZH4 A;  4DF4 A;  4UB5 A;  1L3T A;  4Z6E A;  4Q8E A;  2XY6 A;  7ICJ A;  1ZQX A;  4B9S A;  2BCR A;  5KAI U;  3KHG A;  1SB3 C;  1KLN A;  4DSK A;  5ALD A;  1RG6 A;  5L1J A;  1DK2 A;  4C8O A;  4XUS A;  4PPX A;  7ICM A;  2RLT A;  1F0M A;  4UAS A;  2F8L A;  4RNN A;  3SV4 A;  3RR7 A;  3RJH A;  1T4G A;  4Z6D A;  2RDI A;  4JV2 A;  2WFA A;  1ZET A;  4Z6C A;  3T5H A;  4DFM A;  5JTI A;  5ALS A;  5F9L A;  2WHE A;  3D2S A;  1XSL A;  1SV4 A;  2XY5 A;  2XIC A;  3QYP A;  2W9C B;  3UM9 A;  4ED8 A;  4ZOH C;  5KFE A;  2E8N A;  2V4Q A;  5KFA A;  3IV6 A;  2E8O A;  2AH5 A;  5AKH A;  2BQR A;  2JH7 A;  3AUO A;  4IRC A;  2HVI A;  3KZI U;  2AGP A;  3NVV A;  8ICN A;  4GIB A;  2HHQ A;  2NRT A;  3BJY A;  4FS1 A;  1J2M A;  1ZQM A;  3JPO A;  4Q43 A;  4Q44 A;  3NVZ A;  2XGQ A;  3RJE A;  3TAR A;  1S97 A;  5AK6 A;  2WAQ C;  2QAR A;  4NM1 A;  5AI0 A;  2JV3 A;  4P0P B;  4R63 A;  3WK5 A;  2PI5 A;  2C2E A;  3Q8P B;  5J0Y A;  2E8P A;  1T94 A;  1ZQK A;  1VDV A;  5KFH A;  4QZI A;  5IIJ A;  1ECW A;  1ZQT A;  1T7P A;  3WK7 A;  2HOI A;  4PJ0 U;  5J8Y C;  4NLC A;  1MSW D;  1HUO A;  8ICZ A;  4NLN A;  3PST A;  3UQ2 A;  2D6F C;  2KJ8 A;  4DFJ A;  2VJ4 A;  5KFC A;  2F8K A;  1SZP A;  4QW9 A;  4M2Y A;  3F2C A;  1OUQ A;  3JPQ A;  2ZIU A;  1ZQW A;  3MGI A;  4DSE A;  1PZN A;  3FYH A;  2EAN A;  3RBD A;  4P0Q B;  4DFD A;  1S76 D;  3VCB A;  4Y2S A;  4ECW A;  4QNL A;  2JR5 A;  4R8U A;  1J2N A;  5KFR A;  3SAG A;  2YX8 A;  4KMO B;  2WB1 C;  4QZ9 A;  3O0F A;  4IL6 U;  2ZUC A;  2DKZ A;  3EYZ A;  5J2E A;  2BR0 A;  3SQI A;  2XID A;  4IQU A;  1GO3 F;  2BZF A;  5J2H A;  4KLF A;  8ICI A;  5ALP A;  2UVU A;  4MFF A;  3C2K A;  3HKZ F;  5L1L A;  4IQT A;  5ALX A;  3TKA A;  2F1H A;  3OHB A;  4F4W A;  3BDP A;  3M8S A;  2MA1 A;  4RQ5 A;  4C7Y A;  3KOO A;  1QQ6 A;  4FZL A;  3C23 A;  5ALT A;  8ICA A;  3ETL A;  4J9S A;  3V6H A;  3UXP A;  1NJX A;  4F4Z A;  2BCQ A;  5ALG A;  4YMM A;  2WTF A;  2Z7J A;  4IRD A;  1LKY A;  3N4M B;  5AM3 A;  3C2M A;  1S0V A;  3M9O B;  3TAC B;  1N48 A;  2ZIW A;  5AI9 A;  1T8E A;  4GFJ A;  4TQR A;  3AM9 A;  5ALU A;  2ZTC A;  1SKS A;  1NNL A;  4Y2V A;  4RQN A;  2NYV A;  3U26 A;  3RJK A;  5HR7 A;  3A0H U;  1Z00 A;  4YR0 A;  2VA8 A;  3T3F A;  4FFD A;  1B22 A;  4XA5 A;  4U6P A;  5J0P A;  2KIV A;  1OW5 A;  3CNH A;  4NWI A;  4ED6 A;  1JIH A;  5J2F A;  1X2I A;  5ALJ A;  3HPO A;  2I5H A;  4ECZ A;  1QQ7 A;  1V85 A;  4ED7 A;  4GXK A;  3LVW A;  2EAP A;  4F8R A;  1L3V A;  1CEZ A;  1KRP A;  4UAV A;  2G5I B;  4OD0 A;  2HOQ A;  1ZQY A;  1XSP A;  5J8Y A;  3PSP A;  1L5U A;  1U9L A;  4NLZ A;  4CF4 A;  2JEG A;  4ED1 A;  2KFZ A;  2AGO A;  1BVS A;  3RJI A;  5KG2 A;  2JH1 A;  3C28 A;  4QWB A;  2P35 A;  4R8U B;  3OJS A;  4JWM A;  1SL0 A;  4RQ0 A;  2ODG A;  2W55 A;  2DQN B;  2HHT A;  2GO7 A;  4PGY A;  4RPY A;  5DG8 A;  2R8G A;  2YMQ A;  2P66 A;  5J2A A;  5AKY A;  5G5H A;  1SZH A;  1URJ A;  4QZB A;  5DBC A;  2OHF A;  4UAU A;  3A0B U;  3PVX A;  2HOF A;  2YMM A;  3D2N A;  3LVV A;  1ZQE A;  2Y0S C;  3RB6 A;  1ARO P;  2G09 A;  3FC4 A;  3UXO A;  4PHD A;  1X9M A;  4FE3 A;  2VJ5 A;  3HIL A;  1Z1V A;  1FIQ A;  2PFP A;  4R64 A;  5DG7 A;  1IIP A;  2J6S A;  4GXJ A;  4F71 A;  4YXJ A;  2DL0 A;  2LM4 A;  4M9G A;  2ZIW B;  1COO A;  2FPM A;  3GII A;  5ALV A;  5DQG A;  2KIC A;  3PR5 B;  2K4H A;  4DFP A;  1Z00 B;  1PK3 A;  4RT3 A;  3VC8 A;  1RDF A;  2JHD A;  1ZJM A;  4XRH A;  2ESE A;  1L7N A;  5J2I A;  3Q8K A;  4YFK A;  3WKB A;  5III A;  1L7M A;  1L8O A;  9ICM A;  3V7L A;  2FE9 A;  4YQW A;  2QKQ A;  4O0I A;  4F5R A;  9ICX A;  5AIC A;  3ICX A;  4KN7 A;  3UPQ A;  1K1Q A;  5AIB A;  3G6X A;  8ICX A;  3SAH A;  2V4R A;  3IN5 A;  1ZQB A;  1P7D A;  2XCP A;  2NV3 A;  2R8K A;  4RQ8 A;  3MFI A;  2H5X A;  2ZTD A;  4ACO A;  2ZXH A;  4NJ8 A;  2YTU A;  3NVY A;  4F4Y A;  2PFO A;  4KLU A;  7ICP A;  2KKP A;  3GFK B;  4LZG A;  1PVP A;  2W04 A;  4KLT A;  1Z3E B;  3THV A;  1ZQS A;  2G5H B;  1U47 A;  2ZTE A;  2J6T A;  1L7O A;  3QU5 A;  5J2J A;  1QTM A;  3MR3 A;  2IOH A;  3NTU A;  3ZDC A;  5J0S A;  1Y88 A;  3AMZ A;  5AM4 A;  4DL2 A;  4O5C A;  1L7P A;  1BNP A;  4DL6 A;  3SAF A;  4KX3 A;  4GXI A;  4UAW A;  1PK1 A;  2KEY A;  3GV5 B;  1DK3 A;  4PHP A;  9ICJ A;  2PKE A;  3QEB Z;  3L4P A;  3CW2 C;  2LKY A;  5IIL A;  4QIW C;  4TUP A;  4UAT A;  5IIN A;  5HR6 A;  4RNM A;  3F5A A;  2KJ5 A;  5EWG A;  1NK9 A;  1X6I A;  2K8C B;  2HVH A;  2WF7 A;  2NRX A;  2VAN A;  3QE9 Y;  9ICU A;  2F77 X;  5HMM A;  3F2D A;  2F1J A;  5DB8 A;  3ZDD A;  3N28 A;  4I2F A;  1Q8K A;  1TK8 A;  5AM2 A;  8ICS A;  3B9J A;  4Q8F A;  4DQR A;  4F93 B;  2RQ5 A;  2ZIX B;  3ZD8 A;  5J0U A;  3TAQ A;  2W3S A;  4BUG A;  2C28 A;  5KFU A;  4LZD A;  1M6Y A;  2OXO A;  1JX4 A;  5ALK A;  2GWS A;  3NRW A;  4M47 A;  5L1K A;  2VKQ A;  5J2K A;  3GZF A;  2IA6 A;  2E8M A;  3RH4 A;  7ICS A;  3EPI A;  3M8R A;  3EPG A;  1X42 A;  3BZC A;  1SWV A;  8ICO A;  4US8 A;  4RQM A;  4F92 B;  5DQI A;  2H3I A;  4NY8 A;  3ETR A;  4CE6 A;  3IP4 B;  2HBM A;  2BCV A;  5J29 A;  2H3V A;  5EOZ A;  2W7P A;  3H0R B;  5KFL A;  4MF8 A;  5ALZ A;  2WF8 A;  4JMU A;  3V7K A;  1Q3V A;  2BDU A;  3PSF A;  5BOL A;  1N62 A;  3PMN A;  1ZQG A;  2A19 A;  4J9L A;  4XQ8 A;  8ICG A;  3DV9 A;  1ZQ1 C;  5TIS U;  4ED2 A;  1S77 D;  1ZQD A;  4AYB C;  5H2F U;  5AHX A;  5AKE A;  4UAR A;  5KL1 B;  2EH9 A;  4KLD A;  2HMX A;  3GDX A;  2NRW A;  1S8O A;  4DSJ A;  2K8A A;  2W9B A;  1C20 A;  2G07 A;  4NLB A;  5KG3 A;  4UQG A;  2CXY A;  3IRU A;  3ALR A;  3H0L B;  3FM9 A;  2HCF A;  5AKX A;  3F5E A;  1JMS A;  1SL2 A;  4DL4 A;  4I28 A;  1KL9 A;  4O3R A;  3NAS A;  4DQQ A;  3V72 A;  2RP5 A;  4CF3 A;  4CGZ A;  7ICE A;  2K4E A;  2IHM A;  3KHL A;  1AQ6 A;  8ICF A;  4GLX A;  2W54 A;  7ICV A;  5DB9 A;  3K4G A;  5J2G A;  4FBU A;  5B66 U;  3RH6 A;  2FMQ A;  2H3Z A;  2K4I A;  4YMN A;  4EYI B;  1S10 A;  5J0X A;  1QSL A;  5AI5 A;  4F3O A;  4UAY A;  3OTQ A;  3D2Q A;  2WF6 A;  5DGA A;  2ES6 A;  2E3T A;  1U4B A;  1CRX A;  4F50 A;  4B9N A;  3UMB A;  4QZ8 A;  4J9K A;  2BGW A;  3JPP A;  3ZD9 A;  4DOA A;  1S0N A;  8ICP A;  5ALN A;  2PMZ F;  2C2R A;  5CWR A;  4QZE A;  1Z19 A;  3ZDE A;  2K8B B;  4Y2X A;  1O03 A;  1B4F A;  4P4O A;  4MFA A;  3DDH A;  4RU9 A;  2MAX A;  9ICV A;  1SGG A;  2IOF A;  1KKX A;  5DDM A;  1XO0 A;  4YG2 A;  3RR8 A;  1JN3 A;  4RNO A;  1JUD A;  2KVC A;  3ED5 A;  4C80 A;  1WCL A;  2DF4 B;  3PW7 A;  3PO4 A;  4OCZ A;  4KLO A;  8ICE A;  2JXJ A;  2LI6 A;  4YD2 A;  4KN4 A;  7ICL A;  1RM6 C;  2WF9 A;  4RUC A;  4BX9 C;  3SMV A;  1Z1B A;  2KE7 A;  1FFU A;  3QUC A;  2E1F A;  2DBY A;  4B9T A;  2G08 A;  5CJ7 A;  4B6J A;  2KZZ A;  5IIM A;  3QUT A;  3SI8 A;  4PH5 A;  4C8M A;  3WK8 A;  3TFR A;  5ALI A;  5L1M A;  4O3P A;  1D8L A;  2PXI A;  3K1Z A;  2LYH A;  3M7D A;  5AKJ A;  3AL0 B;  4F5Q A;  2KOB A;  2W03 A;  2JMG A;  5KL8 B;  4C8L A;  3RAX A;  4QZD A;  3H4B A;  1XNS A;  5J0O A;  2W8L A;  1ZYQ A;  9ICP A;  4DQS A;  1N56 A;  1TK0 A;  2A1J A;  4DLG A;  4JUZ A;  4UAZ A;  7ICH A;  5T14 A;  1V38 A;  3RTV A;  4OJL A;  5KT2 A;  5AK3 A;  5E79 U;  1MQ2 A;  5KFB A;  1IM4 A;  3F53 A;  5GTH U;  2BQ3 A;  5KFZ A;  4RQ3 A;  2JZB A;  4K4H A;  4F5P A;  4ECY A;  1U48 A;  8ICV A;  3T5J A;  4OJ5 A;  3AN1 A;  1TV9 A;  3RJG A;  1UQV A;  2FLN A;  3QUB A;  4FZM A;  2EDU A;  5ALM A;  1ZQO A;  3KBB A;  3OPX A;  7ICQ A;  4RQ4 A;  2A1A A;  2Q4T A;  2V9W A;  1NI3 A;  3MGH A;  5ALL A;  4KLG A;  4B9V A;  2HBK A;  4US9 A;  3SZ2 A;  1SIJ A;  3SV3 A;  9ICK A;  3E58 A;  5TZV A;  3WKD A;  3TAD C;  3L3F X;  3KFU F;  3PR4 A;  2EAM A;  2F44 A;  2M9N A;  5KFP A;  9ICI A;  4B9U A;  2FDR A;  5KFX A;  4M6W A;  1T3Q A;  4G3I A;  1DGS A;  2BHN A;  5DB6 A; 
#chains in the Genus database with same CATH homology
 1A0P A;  2K4H A;  2G07 A;  3PST A;  2ZIV B;  4NLB A;  1NZB A;  2XVT A;  4ICA A;  4NV0 A;  2D6F C;  2XI9 A;  3AQE A;  2CPR A;  2KJ8 A;  3ALR A;  2H3F A;  3H0L B;  4P0Q A;  2JHD A;  2LYA A;  3VC8 A;  2YB1 A;  2VJ4 A;  3LVW A;  3K1Z A;  2A3V A;  3NUQ A;  3M7D A;  2RRD A;  2ZIX B;  3KZX A;  3E0F A;  3AL0 B;  3F2C A;  2KOB A;  3F5E A;  1OUQ A;  2OM6 A;  2ZIU A;  2W03 A;  2JMG A;  2G5I B;  4BUG A;  2E5S A;  2HOQ A;  2ZG6 A;  5KL8 B;  1PVQ A;  4P0Q B;  1XNS A;  1DRG A;  1D8B A;  3VCB A;  1L6N A;  3PSI A;  1YT3 A;  3PSP A;  4CDG A;  3ICX A;  4QNL A;  4U7C A;  2OXO A;  2OYY A;  3NRW A;  2RP5 A;  3SAG A;  2RHF A;  2DGZ A;  4CGZ A;  2KKV A;  2YX8 A;  4KMO B;  2WB1 C;  4IC9 A;  2KNJ A;  2K4E A;  2VKQ A;  2YB4 A;  5T14 A;  2HBL A;  5C0Y A;  2LHT A;  3O0F A;  2GOL A;  2WB1 F;  1HEK A;  3GZF A;  3SAH A;  4OJL A;  1ED1 A;  3IN5 A;  1P7D A;  2G06 A;  4WJ3 B;  2NV3 A;  2F8L A;  2JH1 A;  4BJQ A;  3F53 A;  3C28 A;  1KBU A;  1F44 A;  4PL1 A;  3SQI A;  2H3Z A;  2K4I A;  2XID A;  2LYB A;  3RF9 A;  1GO3 F;  1TAM A;  4ACO A;  4A8E A;  3PZP A;  2R18 A;  2Y0S F;  2ZXH A;  4O3M A;  4P0P A;  3HKZ F;  3D2Q A;  3DEE A;  2KKP A;  3D2S A;  2KHV A;  2DQN B;  4FZN A;  3C29 A;  3MGV A;  1CRX A;  1PVP A;  2W04 A;  2XIC A;  3F2B A;  4OJ5 A;  2OH2 A;  2CN1 A;  1HIW A;  2H3I A;  2G5H B;  1WUD A;  2ZIU B;  5A0L A;  3IP4 B;  2G0A A;  2HBM A;  2MA1 A;  2PMZ C;  4FZL A;  4CRX A;  4FZM A;  4C0Z A;  2H3V A;  2JH7 A;  1SZH A;  1URJ A;  2KHQ A;  2N1R A;  3ONN A;  3M6K A;  2VIX A;  2PMZ F;  4QIW F;  2KIW A;  2W7P A;  3H0R B;  1Z19 A;  3OPX A;  2K8B B;  2HOF A;  2GH1 A;  3D2N A;  3LVV A;  2Q4T A;  2Z7J A;  2W7O A;  2K89 A;  3N7S C;  2KJ9 A;  2Y0S C;  1Q3U A;  4AYB F;  4JMU A;  1Q3V A;  3H0M B;  3N7P D;  3HKZ C;  2BDU A;  2H3Q A;  3AQF A;  3SAF A;  4KX3 A;  5CRX A;  3PSF A;  2KD1 A;  2G09 A;  4QJF B;  2E1E A;  3CP8 A;  2HBK A;  2ZIX A;  3LYS A;  1UPH A;  2KEY A;  2ZIW A;  4OJP A;  1XO0 A;  4FE3 A;  2VJ5 A;  3RFA A;  2F76 X;  2WAQ C;  4GFJ A;  1MA7 A;  1ZQ1 C;  2KVC A;  2HBJ A;  2DF4 B;  2JGA A;  2WAQ F;  3CYM A;  2ZXI A;  1IIP A;  2LKY A;  4PL2 A;  4P0P B;  4QIW C;  2MRL A;  2F2A B;  3IG8 A;  3T79 A;  5HR6 A;  1T94 A;  2ZIW B;  3L3F X;  3KFU F;  5HR7 A;  3F5A A;  2LBO A;  2KJ5 A;  4BX9 C;  1ECW A;  2KV2 A;  2ZIV A;  3SMV A;  4AYB C;  1Z1B A;  4KX5 A;  4OO1 J;  4OJ6 A;  3GU3 A;  5KL1 B;  2K8C B;  2CRX A;  1PVR A;  4U6P A;  4OJO A;  2HOI A;  1A6S A;  2E1F A;  4NLC A;  2HMX A;  2KIC A;  2F77 X;  3N7R C;  2G08 A;  3M6Z A;  4NWI A;  3IG5 A;  3F2D A;  2M0N A;  2K8A A;  3CRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...