4UB6U

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 30
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 4ub6U01
3A0HU 5B5EU 3WU2U 4UB8U 3KZIU 3A0BU 5TISU 5B66U 5KAIU 4UB6U 1S5LU 5GTIU 2DUYA 5H2FU 5E79U 5KAFU 4IL6U 4PJ0U 2AXTU 5GTHU
chains in the Genus database with same CATH superfamily
7ICRA 4DOAA 1NK7A 3C2LA 4B9MA 3EWAA 2BZFA 3BQ1A 2F3NA 2HBMA 2DBYA 4KLFA 1DK3A 4RUCA 4GLXA 2YTUA 1N5WA 4CNQA 1TVAA 2Y9UA 3H0MB 2NO5A 4KMOB 3V6HA 3ISCA 3GIMA 1ZQEA 2LM1A 1DGJA 4YG2A 4KX3A 4B9LA 4NY8A 2WTFA 4O9MA 3PVXA 3O0FA 2RRDA 4BXOA 3D2QA 2QB0A 3B9JA 1KLNA 1WCNA 1KBUA 4C7YA 3SEIA 5ALJA 1D8BA 4FS1A 3RRHA 3SAGA 3H8SA 1UHUA 2ZIWA 3HILA 5EOZA 1U9LA 1KW4A 3B0YA 4DL3A 4F4WA 1TAUA 3Q8KA 2OEHA 5KT7A 1T8EA 4J9SA 3F2BA 4CF3A 5B66U 4X5VA 1N61A 1VDVA 3OTQA 4F91B 5DQIA 4RPZA 2A19A 5AKXA 1QQ7A 2E5SA 5AHXA 3MGIA 4QWBA 3NUQA 4DWIA 4DL2A 5EWFA 2K4PA 5KFLA 3H8MA 4AYBC 4C8LA 2KN7A 3V72A 1SV4A 4NV0A 4GXJA 1NKBA 2KZZA 5BPCA 2YMLA 5KG6A 1NZPA 2XCPA 2IHNA 1MA7A 2ZUDA 4C4SA 5KT6A 2R8IA 3JPQA 1QCKA 2W9BA 2OWOA 2ZJAA 1X42A 1HEKA 3RB0A 3AUOA 3QX7A 4RQ5A 3HP6A 4I2FA 2XVTA 3PZPA 4J03A 3TAPA 1NK8A 1IXRA 4DO9A 3PW5A 1L7NA 1BGXT 3H0LB 2R8HA 1Q3VA 2LBOA 1H38A 1O08A 3CNHA 2W9CA 2MUTB 2P6UA 3ETRA 5ALLA 3H40A 1QQ6A 2CRXA 1L3VA 1TK0A 2ZJ8A 5J2IA 4ED2A 3AL0B 1NJZA 3N7PD 2DGZA 3RFAA 1RQLA 2LI6A 3M6ZA 3RAXA 3V6KA 1Z1VA 4CF4A 1ZQJA 4R64A 1L7PA 2HHUA 2JHDA 1ZQSA 2HBLA 2J6SA 3I28A 2AQ0A 4IC9A 4RQNA 3SV3A 9ICAA 9ICIA 2RQ5A 4CDGA 4M6WB 4IQVA 7ICLA 2D3DA 4KLEA 5DBBA 3Q8MA 3RH6A 9ICNA 4NLKA 2ZTDA 3K75D 2KSOB 3L4PA 1BPXA 3BZKA 5AK6A 2CPRA 2NV3A 3ALRA 4UQGA 2ESEA 3AEVA 5AKIA 9ICBA 4UB5A 5J0WA 3E0FA 4EELA 4C8NA 2JEFA 4U6PA 2QKQA 3AN1A 2KICA 4CE6A 4IR9A 2EZYA 2KV2A 5AKKA 3C2MA 3Q8LA 4PGQA 1B0XA 3ZDEA 5J2JA 2AGOA 2VA8A 1N2XA 4DQSA 1PVQA 3AU2A 2PMZF 1QTMA 4F5OA 2B0CA 3HKZF 2NRTA 3QUBA 2C28A 5DBAA 1ZETA 4XA5A 1NKEA 4ELTA 4ECSA 4KTQA 3PV8A 2J6TA 1Y88A 2BR0A 1NI3A 3PR5B 1HUOA 7ICVA 9ICVA 4ED7A 5IIKA 4KLQA 3K4GA 1SXDA 1JI7A 2MU2A 3SV4A 3J81j 2W9CB 4CRXA 4DS4A 2JMGA 4P2HA 4M9NA 2KJ8A 4M9HA 1KFDA 3Q8SB 3IN5A 5KFZA 3H0RB 4M9GA 3KHGA 2DPIA 3PX6A 2HW3A 7ICPA 2H3QA 1WCLA 4E0DA 5AI4A 1ZQZA 3PW4A 2N1RA 1ZQTA 3QYPA 3LVWA 1DGSA 1TAQA 2F2AB 3C21A 4MFFA 4YR3A 3G6VA 2K8BB 4LVSA 1RYSA 3OJUA 1HJPA 4Z6CA 5IILA 8ICLA 2K60A 2XO7A 5KG1A 2JZBB 2KE7A 4ZH4A 3IP4B 2FDRA 4QZAA 5J0UA 2BDPA 1ZQWA 4BXOB 2FLLA 2LYAA 4O0IA 4MFAA 4RQ0A 3T3FA 4YMOA 2DKZA 4QZ8A 5ALWA 3V7LA 4IS7A 1XO1A 8ICZA 3C1ZA 4B9SA 3RH5A 1T3QA 3GDXA 2BCVA 2ZIVB 3SR6A 4BWMA 5H2FU 2UVVA 4O5CA 2A3VA 4EENA 2W04A 2MSNA 5KT3A 2HHTA 1ZJMA 2JEIA 8ICPA 4PHAA 5AM4A 2WB1C 4YD1A 3JPOA 2JGAA 4RQ8A 2K8CB 5J8YC 2ZIXA 4DFDA 4GXKA 2YQEA 1ZQAA 1BNOA 4YMMA 5J0SA 5AM3A 2HHVA 2DL0A 1L8LA 2ATLA 1ZQQA 5A0LA 3ZDDA 2P6RA 2E8MA 1UT8A 5C5JA 1JMSA 4NLGA 4ED3A 2NRWA 3HRDD 7ICQA 2DQNB 5ALRA 4QIWC 3Q8RB 4TUQA 1BPDA 1QH9A 1KRPA 5KFJA 4DQIA 1DK2A 2G07A 9ICSA 2LHTA 3CP8A 4M0AA 3TFSA 2ZXIA 4YN4A 4F93B 2Q4TA 1J2MA 3PO4A 5C0YA 3H8JA 4UW9A 3QEBZ 5KFHA 4UASA 4UAWA 4R63A 4U7CA 5IIIA 4A8EA 1T94A 5KT5A 2HOIA 4FFDA 4USAA 2P35A 2FMPA 3NS1A 5J8YA 3HX0A 2HCFA 1WG8A 1N5XA 2IOFA 2BDUA 2LMRA 4US8A 1S77D 4EEYA 3TANA 1SV0C 5KFUA 1B22A 2KZ3A 4KLOA 1COKA 4BUGA 1N62A 1A77A 1KFSA 2V4RA 4GIBA 4PZOA 2KKPA 1EXNA 4NLCA 2PFNA 2ZIUA 5J2BA 3OGUA 4EBCA 1Z3EB 4MF2A 2DUYA 5J2FA 5L1JA 4KLIA 1IG6A 1L6NA 1L7MA 3QZ7A 5J0XA 3SZ2A 3KKAA 1COOA 4DFPA 1ZQOA 1DOQA 3V7JA 3JPRA 1AROP 2HOQA 2E1FA 4M9LA 4JWMA 5L1MA 1WYGA 2KNJA 5T14A 4DQQA 1ZQXA 4ECYA 2JV3A 3F5AA 2WAQC 4ED1A 4F92B 1T4GA 4I2AA 2FPLA 3QE9Y 5AKJA 8ICXA 2I9GA 2BPCA 4OCZA 5J0YA 8ICHA 2FPMA 4ICAA 3TQ1A 8ICRA 1F0MA 5ALPA 2JEGA 5KFRA 4OJ5A 3BS7A 4DFKA 1QSSA 3UM9A 4ECRA 1OW5A 2AJQA 4J9QA 1Z19A 5EE9A 5F3XB 1MN8A 2KVSA 1O03A 5J0RA 4Z6FA 4R8UB 3NVWA 3IM1A 4YMNA 4EBEA 1A76A 9ICWA 3GIIA 4LZDA 3D6JA 2QARB 2ZTEA 5EWEA 2HHQA 4LJXA 5DDYA 4Y2UA 2AHOB 2VIXA 1KSPA 8ICTA 2CXYA 2JXJA 2ASDA 2C2RA 3RTVA 4UAVA 4JUZA 2KJ9A 1IIPA 1WWUA 2KIVA 4OJLA 2M0NA 5KFFA 8ICBA 1K1QA 5DLGA 4PPXA 1SKRA 1BPBA 5ALGA 1A0PA 1V97A 4PH5A 3PW2A 2RP5A 2JRZA 2HVHA 4QW8A 1BPZA 3N7SC 4GXIA 2GO7A 2UVRA 7ICKA 5AI9A 5DG7A 3IDWA 2Y9TA 5KFWA 4M04A 4C8OA 3BDPA 5CJ7A 5L9XA 2FPKA 3ZI4A 9ICEA 2AH5A 4EEKA 4DLEA 1ZD4A 3LYSA 2ISOA 2EQYA 4QZFA 2DF4B 4HYKA 2HHXA 4EZ9A 2W7OA 2KSOA 3C1YA 2W54A 1RDFA 5L1LA 9ICQA 1U4BA 4B9TA 4J9PA 1X66A 3QUTA 4OJPA 3K1RB 3GIKA 4K4HA 2K4HA 3C5GA 5KT4A 1B43A 4OO1J 3Q8PB 2HOFA 3WKAA 3SENA 3UQ2A 4BX9C 2EAMA 1DXSA 3FC4A 2WB1F 4P0PA 2I1QA 3SI8A 3LWMA 4IRKA 5KFOA 5HP4A 3ICXA 4M2YA 4IQWA 2HBKA 2JEJA 4BDPA 4ELVA 2YB1A 3PR4A 3PSPA 1QQ5A 3GV8B 8ICFA 1RYUA 4NXZA 8ICKA 4Y2XA 1D9FA 2BCRA 4UAZA 3NVZA 3TADC 1TFRA 1X9WA 1XNSA 2G5HB 1BPYA 2UVUA 2AXTU 4RQ7A 3AMZA 2RDIA 1NJWA 2PI5A 4Z6DA 2ASJA 3WK9A 4Y2QA 3MDCA 2NO4A 3G6XA 7ICJA 5JU5A 4P4OA 5ALKA 8ICMA 2W55A 1UCVA 8ICGA 4Q8EA 1ZQVA 2A1JA 4Q43A 3H7IA 3V6JA 5J0OA 3PMLA 1PK3A 3WU2U 3A0BU 1ZQMA 3JPTA 4DFJA 9ICHA 5AM1A 5D4BA 1L3UA 4IQUA 1S97A 2XY5A 4EBDA 1JROA 5AK4A 3LVVA 4J9OA 1SZHA 3RJKA 3R9KA 1BNPA 3TAQA 5G5GA 2K4EA 3OSNA 4OD0A 5F9LA 3ED5A 5ALIA 5AM5A 3RB6A 4RQ1A 1CRXA 3PNCA 4DOCA 2W9MA 4RU9A 5JRTA 2V4QA 4FBUA 4P4MA 2EANA 5EE3A 2VJ4A 4GC6A 5ALFA 4ECVA 4I2IA 5AI5A 5AIBA 4KLDA 1X6JA 2BQRA 4JWNA 4EX6A 5KAFU 3RR8A 7ICHA 4UBBA 2QB0B 4NJ8A 1S5LU 1XO0A 4M47A 2F44A 4QWEA 1BVSA 3N28A 2ZTCA 1N60A 3NVYA 3T5KA 3VC8A 4KN4A 1KEJA 1SIJA 7ICSA 5KFVA 4C7ZA 2WHEA 3KD3A 1KQQA 1SWWA 1SKSA 3SMVA 5KFQA 3GIJA 4FO6A 5IINA 3RAQA 1F44A 3WK8A 5DBCA 5AKHA 2DFLA 1KTQA 3PW7A 4RPYA 9ICTA 1B4FA 3IHQB 5E79U 4Y2JA 2IA6A 1L3TA 4US9A 2YB4A 9ICJA 4I29A 1LB2B 3QU4A 3ZD8A 2ZUCA 5CHGA 1PVPA 1KFTA 1JXEA 1RXWA 4Q44A 3TACB 1YZ7A 2H3ZA 1S0OA 1P7DA 2PFQA 4QZ9A 5J0PA 5KFYA 1TK5A 1JRPA 2EDUA 5ALMA 4RZRA 1ZOLA 4J9KA 3PSIA 3WKDA 2Y0SF 4P0PB 2UVWA 3D2SA 3NRWA 1X9SA 2JH1A 4F4KA 5KFBA 5L1KA 1S8OA 5AIAA 5D46A 1S76D 2LYBA 1XU4A 4GFJA 1D8YA 2H3FA 2KJ5A 5AK3A 5ALQA 4DL4A 1MC8A 3PSTA 4F4YA 1V85A 3F53A 1UPHA 3I1YA 5CWRA 4B9NA 3TI0A 5GTHU 2G5IB 5DB9A 1XSNA 5AI0A 1Z1BA 3UMCA 3NASA 2W3SA 3FYHA 1ZQCA 1KN5A 4DQPA 2ZIWB 5ALOA 3MR5A 1RXVA 5AI8A 3EZ5A 4FBTA 1XC9A 3KOOA 2QARA 4ECTA 4DS5A 5DDMA 3A0HU 4F5RA 2KKVA 3BS5A 3QXGA 4O3QA 4JB3A 9ICKA 2W8KA 1NJYA 3RR7A 3PSFA 2LM4A 8ICAA 3RRGA 4UAYA 5BOMA 2XICA 5KFAA 4P4PA 1N56A 1T3NA 3FDSA 3T5HA 5KG7A 4UARA 2AQ4A 2W9BB 3MBYA 3GZFA 5EWGA 4RNNA 2FI1A 1TKDA 5KFDA 5ALHA 2WF6A 2OXOA 4DSLA 2H3IA 2MRLA 2OCEA 2LPEA 5KG2A 1J2NA 4RQ3A 4IRCA 1FO4A 5J2EA 1C20A 5AM2A 4KLSA 5AKGA 1CI4A 3FAHA 4C8KA 4PL1A 5BOLA 1GO3F 2C2DA 3IG5A 4O3SA 4O5EA 2F8KA 3KFUF 2HHWA 4UB6U 4O3NA 1IM4A 5JTIA 2BCQA 1K1SA 3PX0A 3NGDA 2HDOA 1ZYQA 3N7RC 3H4BA 2BQ3A 3DV9A 4UBCA 5KG5A 2KMDA 1S0MA 2WF7A 7ICEA 3MR6A 1CEZA 8ICQA 2NRZA 2OHFA 5J0QA 1PVRA 4RT3A 1TV9A 3M9OB 4ECQA 4UB4A 2F1JA 2G0AA 8ICSA 3ZDAA 3ISBA 2LYHA 4AP9A 2ZIVA 4ED0A 2JR5A 4O3RA 4TUPA 3EW9A 2BKEA 2GWSA 2FMQA 3M1YA 3ISDA 3E58A 1U45A 1ZQGA 3K1ZA 2PFPA 3G6YA 4UB3A 1D9DA 3MGHA 2AU0A 4B9UA 4DF8A 4YXMA 2F76X 1RZTA 4DL5A 5ALSA 7ICMA 3NRZA 3M9MB 4CGZA 4DFMA 4JMUA 1ZQIA 1ZD5A 4TQSA 3RH4A 1OUQA 2KHVA 1ZRMA 3QU2A 4XRHA 3KZXA 5J0TA 4AYBF 2MA1A 4RQMA 3PMNA 2ZUBA 2VJ5A 1OXJA 1L7OA 5IIOA 2DKXA 3SAFA 3KHLA 4MFCA 1RM6C 4UATA 4Z6EA 2FE9A 3MFHA 2I6XA 3B0XA 3C2KA 4EZ6A 3RJIA 3IV6A 3AQFA 1MQ3A 2KTQA 9ICPA 7ICFA 1LV5A 5CRXA 2HSZA 1QLNA 2KP7A 4I2EA 4I27A 3RF9A 2ZG6A 4RQ4A 4TQRA 1S9FA 2KK0A 3GILA 3OSPA 4YD2A 3RB4A 5KFPA 4FZLA 5ALYA 2AGQA 4KLJA 4TURA 2QB1A 5CB1A 2O6KA 3WK6A 3LK9A 3ETLA 3LDAA 1SZPA 4I2DA 4KLTA 1N63A 2B21A 5DLFA 1SV0A 3PY8A 8ICWA 5L1IA 9ICRA 2WF8A 1PUZA 4F5QA 4BJQA 5KG3A 2VA2A 2OYYA 5KFMA 4ELUA 1T7PA 2YMPA 3NTUA 2KFZA 4ACOA 5CEHA 5AM0A 5AKYA 5DKWA 2A1AA 2L5YA 1L3SA 1WUDA 1UA1A 3SAHA 8ICNA 5HHIA 8ICUA 4NLNA 3L5KA 2WF5A 4QZIA 1N48A 5J29A 2KEYA 2R8KA 4KLMA 5ALDA 5DB8A 1ZD3A 1Z00B 5DB7A 2MAXA 4P0QB 3BQTA 3QU9A 4YQWA 4G3IA 1ZQUA 3M6KA 3QU7A 1ZQHA 1CUKA 1S0VA 4M6WA 1JN3A 3EYZA 4I2GA 3BQ7A 1DRGA 2DPJA 4ED8A 4ED6A 3CYMA 5ALXA 5AICA 3I76A 3MABA 2W7PA 4QIWF 2F1IA 4F71A 5GTIU 1AQ6A 4QW9A 2W8LA 2QLTA 1ED1A 4MEXA 1ZQPA 3EUB2 3AU6A 1JALA 1NK9A 2E8OA 4R65A 3OJSA 4G9BA 2FJ6A 3THVA 1VJ5A 3ORYA 3HJEA 4FZMA 2R18A 7ICTA 1J97A 4NL9A 2I5HA 5DQGA 1VLBA 1XSPA 4NM2A 1S10A 1NK4A 3QU5A 3OPXA 4NWIA 4PJ0U 4YVZA 1UA0A 2Q0ZX 4PZNA 2WF9A 2XY7A 2IHMA 2GLEA 4CF5A 2F1HA 8ICEA 3Q8QB 5AKEA 5HHHA 4GC7A 5CR0A 3UMBA 2HBJA 3BJYA 3T5JA 3HW8A 3CRXA 5KL1B 5DGBA 5AKLA 3DDHA 2NYVA 2G06A 4MHVA 4I2BA 3RJHA 2GH1A 4UB8U 3M9NB 2IBKA 3FM9A 4KN7A 4QWAA 8ICCA 2Y0SC 3BS5B 3GQCA 3F5EA 9ICGA 5KNIA 8ICYA 4P0QA 1MSWD 4YFKA 4ECUA 1TAMA 3UXPA 4DCCA 4OJOA 3WKCA 1NZBA 4F2SA 3N4MB 2PI4A 3EPIA 1M6YA 4DLGA 3AM9A 4FE3A 2W9AA 2BGWA 4DSJA 7ICGA 2W3RA 3WKBA 1NK5A 3ZDBA 3H8WA 1ZQBA 4R66A 3C29A 5TISU 4I2CA 2ES6A 3C28A 2OH2A 5KG0A 4F5PA 1A6SA 3GV7B 5KFNA 5KFSA 1Z4NA 2PXIA 3WK7A 5ALNA 2NRXA 2KD1A 4XQ8A 5HR7A 3ZD9A 3UXNA 9ICLA 2MUTA 3C23A 3M8SA 3UQ0A 3TKAA 4ECZA 5J2AA 5J2CA 2YMMA 4B9VA 2OM6A 1ZXIA 3NVVA 3PO5A 9ICMA 4UB1A 2W11A 2JH7A 4DL6A 3SD7A 3ONNA 3PW0A 2BPGA 3RBEA 3QEAZ 4ECXA 2FLNA 1X40A 1ZQ1C 4RNMA 2XY6A 4KX5A 1RQNA 2A1JB 5J2KA 4BWJA 9ICOA 2ZJ5A 5G5HA 4DSFA 4HAIA 1S0NA 1ZQFA 5ALEA 3MC1A 8ICJA 4JV2A 4CCHA 4KLLA 2E1EA 1IV8A 3TARA 4NLZA 1NK0A 4IRDA 5EE1A 3IG8A 3N97B 2ZIXB 9ICCA 3T79A 5KAIU 2Z7JA 3WK5A 3TFRA 1X6IA 3MGVA 4YXJA 3T5LA 4LZGA 4NM1A 2F8LA 2J6UA 5F9NA 2KIWA 1MQ2A 4PL2A 1LVHA 2W03A 3GV5B 2H5XA 5KFGA 1JX4A 4F2RA 3KTQA 2M9NA 1Q46A 3MFIA 4YCXA 1ZQDA 4FZNA 5JUMA 2KHQA 3BZCA 2VANA 2BCSA 4NL9C 3OHBA 4TUSA 1SL1A 1NK6A 4O5KA 7ICIA 2R8JA 4J9LA 5D49A 1BPEA 2C22A 4C4RA 1TK8A 4YR2A 2ASLA 4Y2YA 1TE2A 2ZXHA 2HVIA 3L3FX 3RJEA 4RPXA 3M8RA 2E8NA 2G08A 2E3TA 2HHSA 2B6GA 5J2DA 1FFVA 2XI9A 2RLTA 4QNLA 5IIJA 1NNLA 2WFAA 2FLPA 4WJ3B 1U49A 2ALZA 4F4XA 1KDHA 5DB6A 2YMQA 2HMXA 2BHNA 4RT2A 3QUQA 1HIWA 4J9MA 4FS2A 4JV1A 9ICXA 2FMSA 5DQHA 1V9PA 5DG9A 2EH9A 2PFOA 8ICOA 3RJJA 1ZQNA 4F72A 5KL8B 2BPFA 1SKWA 2KVCA 4OJ6A 4KMUA 4Y2SA 4QJFB 2LKYA 2IMWP 2F77X 3HT3A 4QZBA 4PHDA 2XCAA 1SB3C 2XIDA 2WAQF 5ALUA 4RUAA 3MR3A 3GFKB 4JV0A 1X9MA 5K4LA 5KTQA 3JPNA 4RNOA 5IIMA 2D8CA 3F2DA 4PGYA 1L5UA 4O3MA 1QSLA 1Z00A 5AK5A 1F5SA 1XSLA 5KT2A 2V9WA 1KKXA 5B5EU 4KLUA 5HNKA 3JPPA 4DQRA 4JK1A 4I28A 3BQ2A 4F50A 1FFUA 1V38A 3RJFA 3S6JA 2ISPA 1FIQA 2W43A 4C8MA 2HI0A 2GOLA 1SL2A 7ICUA 3ZDCA 4XUSA 4I2HA 2EZZA 2PKEA 5KG4A 4MF8A 4DF4A 1UQVA 5AKZA 1XWLA 3MR2A 1RG6A 3RBDA 1JXLA 1YZ6A 2KFNA 4EYHB 1ZQYA 4DSKA 1Q8KA 4QZEA 3KKAC 1PK1B 2AGPA 5FP0A 5KFTA 4QWCA 1LKYB 5CP2A 4QZDA 4I2JA 2JZBA 3UXOA 2KOBA 2VKQA 1U48A 1QSYA 2K89A 3RJGA 3PX4A 2RDJA 4Y2PA 4F3OA 4J9RA 3U26A 8ICVA 4C4TA 4PHEA 3HWTA 4RQ2A 4DOBA 1RYRA 1C7YA 4IR1A 3QZ8A 4F8RA 5J2HA 2Y1IA 4O3PA 3D2NA 3CW2C 1JUDA 2D6FC 4R8UA 1NJXA 2R8GA 4MEYA 4Y2TA 4BGDA 3LWLA 4Q8FA 3OHAA 4F4ZA 9ICFA 4F5NA 3MDAA 4ECWA 2IOFK 1SL0A 5KFXA 1NKCA 3KBBA 4Y2RA 4QZCA 1XS9D 2H3VA 1JIHA 2YX8A 5KFEA 2CN1A 1KL9A 2XGQA 4KITB 4QZHA 4C0ZA 1PZNA 1ZRNA 2EZXA 3JPSA 1X2IA 2BCUA 4K4GA 3WKEA 2Y1JA 4O3OA 3WK4A 4NLBA 5CA7A 4QZGA 5HMMA 1FEZA 3M7DA 2IOHA 2KG5A 4Y2VA 2XC9A 4UB2A 1URJA 2EAOA 4UAUA 1YT3A 3KHHA 1SGGA 2G09A 7ICNA 2KZMA 4K4IA 3QNMA 3KHRA 2ZIUB 4RQ6A 4M9JA 5DG8A 3GU3A 4YR0A 1ZQRA 1SXEA 1X9XA 2YN4A 3SYZA 1ZD2P 5TZVA 5KFIA 1LKYA 5ALTA 3EPGA 4YP3A 2RHFA 1Q3UA 4ZOHC 4PHPA 3DEEA 1PK1A 2XGPA 5J2GA 2E8PA 4DEZA 5AI6A 1ZQLA 1SWVA 1K5OA 3V7KA 4DSEA 1RPLA 4B6JA 3F2CA 3VCBA 3SQIA 7ICOA 9ICUA 1ECWA 4C80A 1Z4OA 3HKZC 3AQEA 1U47A 3C5FA 5DGAA 4IQTA 3QUCA 8ICIA 2K8AA 1D8LA 4PGXA 3E2EA 1WWVA 3H4DA 2P66A 3IRUA 4QWDA 5HMLA 4IL6U 5ALZA 3UMGA 2PMZC 4J9NA 2YY6A 2DWQA 2C2EA 2NRVA 1ZQKA 1L8OA 5EE0A 5KFCA 4EX7A 1ZJNA 3TADA 1NOMA 2K4IA 5KFKA 2VA3A 4KLHA 4DL7A 3HPOA 2BQUA 3KZIU 4EYIB 5HR6A 3UPQA 2EAPA 1UT5A 5ALVA 4DSIA 1HUZA 3BQ0A 2ODGA 4KLGA 4Q45A 3RB3A
chains in the Genus database with same CATH topology
3A0HU 5B5EU 3WU2U 4UB8U 3KZIU 3A0BU 5TISU 5B66U 5KAIU 4UB6U 1S5LU 5GTIU 2DUYA 5H2FU 5E79U 5KAFU 4IL6U 4PJ0U 2AXTU 5GTHU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H U;  5B5E U;  3WU2 U;  4UB8 U;  3KZI U;  3A0B U;  5TIS U;  5B66 U;  5KAI U;  4UB6 U;  1S5L U;  5GTI U;  2DUY A;  5H2F U;  5E79 U;  5KAF U;  4IL6 U;  4PJ0 U;  2AXT U;  5GTH U; 
#chains in the Genus database with same CATH topology
 7ICR A;  4DOA A;  1NK7 A;  3C2L A;  4B9M A;  3EWA A;  2BZF A;  3BQ1 A;  2F3N A;  2HBM A;  2DBY A;  4KLF A;  1DK3 A;  4RUC A;  4GLX A;  2YTU A;  1N5W A;  4CNQ A;  1TVA A;  2Y9U A;  3H0M B;  2NO5 A;  4KMO B;  3V6H A;  3ISC A;  3GIM A;  1ZQE A;  2LM1 A;  1DGJ A;  4YG2 A;  4KX3 A;  4B9L A;  4NY8 A;  2WTF A;  4O9M A;  3PVX A;  3O0F A;  2RRD A;  4BXO A;  3D2Q A;  2QB0 A;  3B9J A;  1KLN A;  1WCN A;  1KBU A;  4C7Y A;  3SEI A;  5ALJ A;  1D8B A;  4FS1 A;  3RRH A;  3SAG A;  3H8S A;  1UHU A;  2ZIW A;  3HIL A;  5EOZ A;  1U9L A;  1KW4 A;  3B0Y A;  4DL3 A;  4F4W A;  1TAU A;  3Q8K A;  2OEH A;  5KT7 A;  1T8E A;  4J9S A;  3F2B A;  4CF3 A;  5B66 U;  4X5V A;  1N61 A;  1VDV A;  3OTQ A;  4F91 B;  5DQI A;  4RPZ A;  2A19 A;  5AKX A;  1QQ7 A;  2E5S A;  5AHX A;  3MGI A;  4QWB A;  3NUQ A;  4DWI A;  4DL2 A;  5EWF A;  2K4P A;  5KFL A;  3H8M A;  4AYB C;  4C8L A;  2KN7 A;  3V72 A;  1SV4 A;  4NV0 A;  4GXJ A;  1NKB A;  2KZZ A;  5BPC A;  2YML A;  5KG6 A;  1NZP A;  2XCP A;  2IHN A;  1MA7 A;  2ZUD A;  4C4S A;  5KT6 A;  2R8I A;  3JPQ A;  1QCK A;  2W9B A;  2OWO A;  2ZJA A;  1X42 A;  1HEK A;  3RB0 A;  3AUO A;  3QX7 A;  4RQ5 A;  3HP6 A;  4I2F A;  2XVT A;  3PZP A;  4J03 A;  3TAP A;  1NK8 A;  1IXR A;  4DO9 A;  3PW5 A;  1L7N A;  1BGX T;  3H0L B;  2R8H A;  1Q3V A;  2LBO A;  1H38 A;  1O08 A;  3CNH A;  2W9C A;  2MUT B;  2P6U A;  3ETR A;  5ALL A;  3H40 A;  1QQ6 A;  2CRX A;  1L3V A;  1TK0 A;  2ZJ8 A;  5J2I A;  4ED2 A;  3AL0 B;  1NJZ A;  3N7P D;  2DGZ A;  3RFA A;  1RQL A;  2LI6 A;  3M6Z A;  3RAX A;  3V6K A;  1Z1V A;  4CF4 A;  1ZQJ A;  4R64 A;  1L7P A;  2HHU A;  2JHD A;  1ZQS A;  2HBL A;  2J6S A;  3I28 A;  2AQ0 A;  4IC9 A;  4RQN A;  3SV3 A;  9ICA A;  9ICI A;  2RQ5 A;  4CDG A;  4M6W B;  4IQV A;  7ICL A;  2D3D A;  4KLE A;  5DBB A;  3Q8M A;  3RH6 A;  9ICN A;  4NLK A;  2ZTD A;  3K75 D;  2KSO B;  3L4P A;  1BPX A;  3BZK A;  5AK6 A;  2CPR A;  2NV3 A;  3ALR A;  4UQG A;  2ESE A;  3AEV A;  5AKI A;  9ICB A;  4UB5 A;  5J0W A;  3E0F A;  4EEL A;  4C8N A;  2JEF A;  4U6P A;  2QKQ A;  3AN1 A;  2KIC A;  4CE6 A;  4IR9 A;  2EZY A;  2KV2 A;  5AKK A;  3C2M A;  3Q8L A;  4PGQ A;  1B0X A;  3ZDE A;  5J2J A;  2AGO A;  2VA8 A;  1N2X A;  4DQS A;  1PVQ A;  3AU2 A;  2PMZ F;  1QTM A;  4F5O A;  2B0C A;  3HKZ F;  2NRT A;  3QUB A;  2C28 A;  5DBA A;  1ZET A;  4XA5 A;  1NKE A;  4ELT A;  4ECS A;  4KTQ A;  3PV8 A;  2J6T A;  1Y88 A;  2BR0 A;  1NI3 A;  3PR5 B;  1HUO A;  7ICV A;  9ICV A;  4ED7 A;  5IIK A;  4KLQ A;  3K4G A;  1SXD A;  1JI7 A;  2MU2 A;  3SV4 A;  3J81 j;  2W9C B;  4CRX A;  4DS4 A;  2JMG A;  4P2H A;  4M9N A;  2KJ8 A;  4M9H A;  1KFD A;  3Q8S B;  3IN5 A;  5KFZ A;  3H0R B;  4M9G A;  3KHG A;  2DPI A;  3PX6 A;  2HW3 A;  7ICP A;  2H3Q A;  1WCL A;  4E0D A;  5AI4 A;  1ZQZ A;  3PW4 A;  2N1R A;  1ZQT A;  3QYP A;  3LVW A;  1DGS A;  1TAQ A;  2F2A B;  3C21 A;  4MFF A;  4YR3 A;  3G6V A;  2K8B B;  4LVS A;  1RYS A;  3OJU A;  1HJP A;  4Z6C A;  5IIL A;  8ICL A;  2K60 A;  2XO7 A;  5KG1 A;  2JZB B;  2KE7 A;  4ZH4 A;  3IP4 B;  2FDR A;  4QZA A;  5J0U A;  2BDP A;  1ZQW A;  4BXO B;  2FLL A;  2LYA A;  4O0I A;  4MFA A;  4RQ0 A;  3T3F A;  4YMO A;  2DKZ A;  4QZ8 A;  5ALW A;  3V7L A;  4IS7 A;  1XO1 A;  8ICZ A;  3C1Z A;  4B9S A;  3RH5 A;  1T3Q A;  3GDX A;  2BCV A;  2ZIV B;  3SR6 A;  4BWM A;  5H2F U;  2UVV A;  4O5C A;  2A3V A;  4EEN A;  2W04 A;  2MSN A;  5KT3 A;  2HHT A;  1ZJM A;  2JEI A;  8ICP A;  4PHA A;  5AM4 A;  2WB1 C;  4YD1 A;  3JPO A;  2JGA A;  4RQ8 A;  2K8C B;  5J8Y C;  2ZIX A;  4DFD A;  4GXK A;  2YQE A;  1ZQA A;  1BNO A;  4YMM A;  5J0S A;  5AM3 A;  2HHV A;  2DL0 A;  1L8L A;  2ATL A;  1ZQQ A;  5A0L A;  3ZDD A;  2P6R A;  2E8M A;  1UT8 A;  5C5J A;  1JMS A;  4NLG A;  4ED3 A;  2NRW A;  3HRD D;  7ICQ A;  2DQN B;  5ALR A;  4QIW C;  3Q8R B;  4TUQ A;  1BPD A;  1QH9 A;  1KRP A;  5KFJ A;  4DQI A;  1DK2 A;  2G07 A;  9ICS A;  2LHT A;  3CP8 A;  4M0A A;  3TFS A;  2ZXI A;  4YN4 A;  4F93 B;  2Q4T A;  1J2M A;  3PO4 A;  5C0Y A;  3H8J A;  4UW9 A;  3QEB Z;  5KFH A;  4UAS A;  4UAW A;  4R63 A;  4U7C A;  5III A;  4A8E A;  1T94 A;  5KT5 A;  2HOI A;  4FFD A;  4USA A;  2P35 A;  2FMP A;  3NS1 A;  5J8Y A;  3HX0 A;  2HCF A;  1WG8 A;  1N5X A;  2IOF A;  2BDU A;  2LMR A;  4US8 A;  1S77 D;  4EEY A;  3TAN A;  1SV0 C;  5KFU A;  1B22 A;  2KZ3 A;  4KLO A;  1COK A;  4BUG A;  1N62 A;  1A77 A;  1KFS A;  2V4R A;  4GIB A;  4PZO A;  2KKP A;  1EXN A;  4NLC A;  2PFN A;  2ZIU A;  5J2B A;  3OGU A;  4EBC A;  1Z3E B;  4MF2 A;  2DUY A;  5J2F A;  5L1J A;  4KLI A;  1IG6 A;  1L6N A;  1L7M A;  3QZ7 A;  5J0X A;  3SZ2 A;  3KKA A;  1COO A;  4DFP A;  1ZQO A;  1DOQ A;  3V7J A;  3JPR A;  1ARO P;  2HOQ A;  2E1F A;  4M9L A;  4JWM A;  5L1M A;  1WYG A;  2KNJ A;  5T14 A;  4DQQ A;  1ZQX A;  4ECY A;  2JV3 A;  3F5A A;  2WAQ C;  4ED1 A;  4F92 B;  1T4G A;  4I2A A;  2FPL A;  3QE9 Y;  5AKJ A;  8ICX A;  2I9G A;  2BPC A;  4OCZ A;  5J0Y A;  8ICH A;  2FPM A;  4ICA A;  3TQ1 A;  8ICR A;  1F0M A;  5ALP A;  2JEG A;  5KFR A;  4OJ5 A;  3BS7 A;  4DFK A;  1QSS A;  3UM9 A;  4ECR A;  1OW5 A;  2AJQ A;  4J9Q A;  1Z19 A;  5EE9 A;  5F3X B;  1MN8 A;  2KVS A;  1O03 A;  5J0R A;  4Z6F A;  4R8U B;  3NVW A;  3IM1 A;  4YMN A;  4EBE A;  1A76 A;  9ICW A;  3GII A;  4LZD A;  3D6J A;  2QAR B;  2ZTE A;  5EWE A;  2HHQ A;  4LJX A;  5DDY A;  4Y2U A;  2AHO B;  2VIX A;  1KSP A;  8ICT A;  2CXY A;  2JXJ A;  2ASD A;  2C2R A;  3RTV A;  4UAV A;  4JUZ A;  2KJ9 A;  1IIP A;  1WWU A;  2KIV A;  4OJL A;  2M0N A;  5KFF A;  8ICB A;  1K1Q A;  5DLG A;  4PPX A;  1SKR A;  1BPB A;  5ALG A;  1A0P A;  1V97 A;  4PH5 A;  3PW2 A;  2RP5 A;  2JRZ A;  2HVH A;  4QW8 A;  1BPZ A;  3N7S C;  4GXI A;  2GO7 A;  2UVR A;  7ICK A;  5AI9 A;  5DG7 A;  3IDW A;  2Y9T A;  5KFW A;  4M04 A;  4C8O A;  3BDP A;  5CJ7 A;  5L9X A;  2FPK A;  3ZI4 A;  9ICE A;  2AH5 A;  4EEK A;  4DLE A;  1ZD4 A;  3LYS A;  2ISO A;  2EQY A;  4QZF A;  2DF4 B;  4HYK A;  2HHX A;  4EZ9 A;  2W7O A;  2KSO A;  3C1Y A;  2W54 A;  1RDF A;  5L1L A;  9ICQ A;  1U4B A;  4B9T A;  4J9P A;  1X66 A;  3QUT A;  4OJP A;  3K1R B;  3GIK A;  4K4H A;  2K4H A;  3C5G A;  5KT4 A;  1B43 A;  4OO1 J;  3Q8P B;  2HOF A;  3WKA A;  3SEN A;  3UQ2 A;  4BX9 C;  2EAM A;  1DXS A;  3FC4 A;  2WB1 F;  4P0P A;  2I1Q A;  3SI8 A;  3LWM A;  4IRK A;  5KFO A;  5HP4 A;  3ICX A;  4M2Y A;  4IQW A;  2HBK A;  2JEJ A;  4BDP A;  4ELV A;  2YB1 A;  3PR4 A;  3PSP A;  1QQ5 A;  3GV8 B;  8ICF A;  1RYU A;  4NXZ A;  8ICK A;  4Y2X A;  1D9F A;  2BCR A;  4UAZ A;  3NVZ A;  3TAD C;  1TFR A;  1X9W A;  1XNS A;  2G5H B;  1BPY A;  2UVU A;  2AXT U;  4RQ7 A;  3AMZ A;  2RDI A;  1NJW A;  2PI5 A;  4Z6D A;  2ASJ A;  3WK9 A;  4Y2Q A;  3MDC A;  2NO4 A;  3G6X A;  7ICJ A;  5JU5 A;  4P4O A;  5ALK A;  8ICM A;  2W55 A;  1UCV A;  8ICG A;  4Q8E A;  1ZQV A;  2A1J A;  4Q43 A;  3H7I A;  3V6J A;  5J0O A;  3PML A;  1PK3 A;  3WU2 U;  3A0B U;  1ZQM A;  3JPT A;  4DFJ A;  9ICH A;  5AM1 A;  5D4B A;  1L3U A;  4IQU A;  1S97 A;  2XY5 A;  4EBD A;  1JRO A;  5AK4 A;  3LVV A;  4J9O A;  1SZH A;  3RJK A;  3R9K A;  1BNP A;  3TAQ A;  5G5G A;  2K4E A;  3OSN A;  4OD0 A;  5F9L A;  3ED5 A;  5ALI A;  5AM5 A;  3RB6 A;  4RQ1 A;  1CRX A;  3PNC A;  4DOC A;  2W9M A;  4RU9 A;  5JRT A;  2V4Q A;  4FBU A;  4P4M A;  2EAN A;  5EE3 A;  2VJ4 A;  4GC6 A;  5ALF A;  4ECV A;  4I2I A;  5AI5 A;  5AIB A;  4KLD A;  1X6J A;  2BQR A;  4JWN A;  4EX6 A;  5KAF U;  3RR8 A;  7ICH A;  4UBB A;  2QB0 B;  4NJ8 A;  1S5L U;  1XO0 A;  4M47 A;  2F44 A;  4QWE A;  1BVS A;  3N28 A;  2ZTC A;  1N60 A;  3NVY A;  3T5K A;  3VC8 A;  4KN4 A;  1KEJ A;  1SIJ A;  7ICS A;  5KFV A;  4C7Z A;  2WHE A;  3KD3 A;  1KQQ A;  1SWW A;  1SKS A;  3SMV A;  5KFQ A;  3GIJ A;  4FO6 A;  5IIN A;  3RAQ A;  1F44 A;  3WK8 A;  5DBC A;  5AKH A;  2DFL A;  1KTQ A;  3PW7 A;  4RPY A;  9ICT A;  1B4F A;  3IHQ B;  5E79 U;  4Y2J A;  2IA6 A;  1L3T A;  4US9 A;  2YB4 A;  9ICJ A;  4I29 A;  1LB2 B;  3QU4 A;  3ZD8 A;  2ZUC A;  5CHG A;  1PVP A;  1KFT A;  1JXE A;  1RXW A;  4Q44 A;  3TAC B;  1YZ7 A;  2H3Z A;  1S0O A;  1P7D A;  2PFQ A;  4QZ9 A;  5J0P A;  5KFY A;  1TK5 A;  1JRP A;  2EDU A;  5ALM A;  4RZR A;  1ZOL A;  4J9K A;  3PSI A;  3WKD A;  2Y0S F;  4P0P B;  2UVW A;  3D2S A;  3NRW A;  1X9S A;  2JH1 A;  4F4K A;  5KFB A;  5L1K A;  1S8O A;  5AIA A;  5D46 A;  1S76 D;  2LYB A;  1XU4 A;  4GFJ A;  1D8Y A;  2H3F A;  2KJ5 A;  5AK3 A;  5ALQ A;  4DL4 A;  1MC8 A;  3PST A;  4F4Y A;  1V85 A;  3F53 A;  1UPH A;  3I1Y A;  5CWR A;  4B9N A;  3TI0 A;  5GTH U;  2G5I B;  5DB9 A;  1XSN A;  5AI0 A;  1Z1B A;  3UMC A;  3NAS A;  2W3S A;  3FYH A;  1ZQC A;  1KN5 A;  4DQP A;  2ZIW B;  5ALO A;  3MR5 A;  1RXV A;  5AI8 A;  3EZ5 A;  4FBT A;  1XC9 A;  3KOO A;  2QAR A;  4ECT A;  4DS5 A;  5DDM A;  3A0H U;  4F5R A;  2KKV A;  3BS5 A;  3QXG A;  4O3Q A;  4JB3 A;  9ICK A;  2W8K A;  1NJY A;  3RR7 A;  3PSF A;  2LM4 A;  8ICA A;  3RRG A;  4UAY A;  5BOM A;  2XIC A;  5KFA A;  4P4P A;  1N56 A;  1T3N A;  3FDS A;  3T5H A;  5KG7 A;  4UAR A;  2AQ4 A;  2W9B B;  3MBY A;  3GZF A;  5EWG A;  4RNN A;  2FI1 A;  1TKD A;  5KFD A;  5ALH A;  2WF6 A;  2OXO A;  4DSL A;  2H3I A;  2MRL A;  2OCE A;  2LPE A;  5KG2 A;  1J2N A;  4RQ3 A;  4IRC A;  1FO4 A;  5J2E A;  1C20 A;  5AM2 A;  4KLS A;  5AKG A;  1CI4 A;  3FAH A;  4C8K A;  4PL1 A;  5BOL A;  1GO3 F;  2C2D A;  3IG5 A;  4O3S A;  4O5E A;  2F8K A;  3KFU F;  2HHW A;  4UB6 U;  4O3N A;  1IM4 A;  5JTI A;  2BCQ A;  1K1S A;  3PX0 A;  3NGD A;  2HDO A;  1ZYQ A;  3N7R C;  3H4B A;  2BQ3 A;  3DV9 A;  4UBC A;  5KG5 A;  2KMD A;  1S0M A;  2WF7 A;  7ICE A;  3MR6 A;  1CEZ A;  8ICQ A;  2NRZ A;  2OHF A;  5J0Q A;  1PVR A;  4RT3 A;  1TV9 A;  3M9O B;  4ECQ A;  4UB4 A;  2F1J A;  2G0A A;  8ICS A;  3ZDA A;  3ISB A;  2LYH A;  4AP9 A;  2ZIV A;  4ED0 A;  2JR5 A;  4O3R A;  4TUP A;  3EW9 A;  2BKE A;  2GWS A;  2FMQ A;  3M1Y A;  3ISD A;  3E58 A;  1U45 A;  1ZQG A;  3K1Z A;  2PFP A;  3G6Y A;  4UB3 A;  1D9D A;  3MGH A;  2AU0 A;  4B9U A;  4DF8 A;  4YXM A;  2F76 X;  1RZT A;  4DL5 A;  5ALS A;  7ICM A;  3NRZ A;  3M9M B;  4CGZ A;  4DFM A;  4JMU A;  1ZQI A;  1ZD5 A;  4TQS A;  3RH4 A;  1OUQ A;  2KHV A;  1ZRM A;  3QU2 A;  4XRH A;  3KZX A;  5J0T A;  4AYB F;  2MA1 A;  4RQM A;  3PMN A;  2ZUB A;  2VJ5 A;  1OXJ A;  1L7O A;  5IIO A;  2DKX A;  3SAF A;  3KHL A;  4MFC A;  1RM6 C;  4UAT A;  4Z6E A;  2FE9 A;  3MFH A;  2I6X A;  3B0X A;  3C2K A;  4EZ6 A;  3RJI A;  3IV6 A;  3AQF A;  1MQ3 A;  2KTQ A;  9ICP A;  7ICF A;  1LV5 A;  5CRX A;  2HSZ A;  1QLN A;  2KP7 A;  4I2E A;  4I27 A;  3RF9 A;  2ZG6 A;  4RQ4 A;  4TQR A;  1S9F A;  2KK0 A;  3GIL A;  3OSP A;  4YD2 A;  3RB4 A;  5KFP A;  4FZL A;  5ALY A;  2AGQ A;  4KLJ A;  4TUR A;  2QB1 A;  5CB1 A;  2O6K A;  3WK6 A;  3LK9 A;  3ETL A;  3LDA A;  1SZP A;  4I2D A;  4KLT A;  1N63 A;  2B21 A;  5DLF A;  1SV0 A;  3PY8 A;  8ICW A;  5L1I A;  9ICR A;  2WF8 A;  1PUZ A;  4F5Q A;  4BJQ A;  5KG3 A;  2VA2 A;  2OYY A;  5KFM A;  4ELU A;  1T7P A;  2YMP A;  3NTU A;  2KFZ A;  4ACO A;  5CEH A;  5AM0 A;  5AKY A;  5DKW A;  2A1A A;  2L5Y A;  1L3S A;  1WUD A;  1UA1 A;  3SAH A;  8ICN A;  5HHI A;  8ICU A;  4NLN A;  3L5K A;  2WF5 A;  4QZI A;  1N48 A;  5J29 A;  2KEY A;  2R8K A;  4KLM A;  5ALD A;  5DB8 A;  1ZD3 A;  1Z00 B;  5DB7 A;  2MAX A;  4P0Q B;  3BQT A;  3QU9 A;  4YQW A;  4G3I A;  1ZQU A;  3M6K A;  3QU7 A;  1ZQH A;  1CUK A;  1S0V A;  4M6W A;  1JN3 A;  3EYZ A;  4I2G A;  3BQ7 A;  1DRG A;  2DPJ A;  4ED8 A;  4ED6 A;  3CYM A;  5ALX A;  5AIC A;  3I76 A;  3MAB A;  2W7P A;  4QIW F;  2F1I A;  4F71 A;  5GTI U;  1AQ6 A;  4QW9 A;  2W8L A;  2QLT A;  1ED1 A;  4MEX A;  1ZQP A;  3EUB 2;  3AU6 A;  1JAL A;  1NK9 A;  2E8O A;  4R65 A;  3OJS A;  4G9B A;  2FJ6 A;  3THV A;  1VJ5 A;  3ORY A;  3HJE A;  4FZM A;  2R18 A;  7ICT A;  1J97 A;  4NL9 A;  2I5H A;  5DQG A;  1VLB A;  1XSP A;  4NM2 A;  1S10 A;  1NK4 A;  3QU5 A;  3OPX A;  4NWI A;  4PJ0 U;  4YVZ A;  1UA0 A;  2Q0Z X;  4PZN A;  2WF9 A;  2XY7 A;  2IHM A;  2GLE A;  4CF5 A;  2F1H A;  8ICE A;  3Q8Q B;  5AKE A;  5HHH A;  4GC7 A;  5CR0 A;  3UMB A;  2HBJ A;  3BJY A;  3T5J A;  3HW8 A;  3CRX A;  5KL1 B;  5DGB A;  5AKL A;  3DDH A;  2NYV A;  2G06 A;  4MHV A;  4I2B A;  3RJH A;  2GH1 A;  4UB8 U;  3M9N B;  2IBK A;  3FM9 A;  4KN7 A;  4QWA A;  8ICC A;  2Y0S C;  3BS5 B;  3GQC A;  3F5E A;  9ICG A;  5KNI A;  8ICY A;  4P0Q A;  1MSW D;  4YFK A;  4ECU A;  1TAM A;  3UXP A;  4DCC A;  4OJO A;  3WKC A;  1NZB A;  4F2S A;  3N4M B;  2PI4 A;  3EPI A;  1M6Y A;  4DLG A;  3AM9 A;  4FE3 A;  2W9A A;  2BGW A;  4DSJ A;  7ICG A;  2W3R A;  3WKB A;  1NK5 A;  3ZDB A;  3H8W A;  1ZQB A;  4R66 A;  3C29 A;  5TIS U;  4I2C A;  2ES6 A;  3C28 A;  2OH2 A;  5KG0 A;  4F5P A;  1A6S A;  3GV7 B;  5KFN A;  5KFS A;  1Z4N A;  2PXI A;  3WK7 A;  5ALN A;  2NRX A;  2KD1 A;  4XQ8 A;  5HR7 A;  3ZD9 A;  3UXN A;  9ICL A;  2MUT A;  3C23 A;  3M8S A;  3UQ0 A;  3TKA A;  4ECZ A;  5J2A A;  5J2C A;  2YMM A;  4B9V A;  2OM6 A;  1ZXI A;  3NVV A;  3PO5 A;  9ICM A;  4UB1 A;  2W11 A;  2JH7 A;  4DL6 A;  3SD7 A;  3ONN A;  3PW0 A;  2BPG A;  3RBE A;  3QEA Z;  4ECX A;  2FLN A;  1X40 A;  1ZQ1 C;  4RNM A;  2XY6 A;  4KX5 A;  1RQN A;  2A1J B;  5J2K A;  4BWJ A;  9ICO A;  2ZJ5 A;  5G5H A;  4DSF A;  4HAI A;  1S0N A;  1ZQF A;  5ALE A;  3MC1 A;  8ICJ A;  4JV2 A;  4CCH A;  4KLL A;  2E1E A;  1IV8 A;  3TAR A;  4NLZ A;  1NK0 A;  4IRD A;  5EE1 A;  3IG8 A;  3N97 B;  2ZIX B;  9ICC A;  3T79 A;  5KAI U;  2Z7J A;  3WK5 A;  3TFR A;  1X6I A;  3MGV A;  4YXJ A;  3T5L A;  4LZG A;  4NM1 A;  2F8L A;  2J6U A;  5F9N A;  2KIW A;  1MQ2 A;  4PL2 A;  1LVH A;  2W03 A;  3GV5 B;  2H5X A;  5KFG A;  1JX4 A;  4F2R A;  3KTQ A;  2M9N A;  1Q46 A;  3MFI A;  4YCX A;  1ZQD A;  4FZN A;  5JUM A;  2KHQ A;  3BZC A;  2VAN A;  2BCS A;  4NL9 C;  3OHB A;  4TUS A;  1SL1 A;  1NK6 A;  4O5K A;  7ICI A;  2R8J A;  4J9L A;  5D49 A;  1BPE A;  2C22 A;  4C4R A;  1TK8 A;  4YR2 A;  2ASL A;  4Y2Y A;  1TE2 A;  2ZXH A;  2HVI A;  3L3F X;  3RJE A;  4RPX A;  3M8R A;  2E8N A;  2G08 A;  2E3T A;  2HHS A;  2B6G A;  5J2D A;  1FFV A;  2XI9 A;  2RLT A;  4QNL A;  5IIJ A;  1NNL A;  2WFA A;  2FLP A;  4WJ3 B;  1U49 A;  2ALZ A;  4F4X A;  1KDH A;  5DB6 A;  2YMQ A;  2HMX A;  2BHN A;  4RT2 A;  3QUQ A;  1HIW A;  4J9M A;  4FS2 A;  4JV1 A;  9ICX A;  2FMS A;  5DQH A;  1V9P A;  5DG9 A;  2EH9 A;  2PFO A;  8ICO A;  3RJJ A;  1ZQN A;  4F72 A;  5KL8 B;  2BPF A;  1SKW A;  2KVC A;  4OJ6 A;  4KMU A;  4Y2S A;  4QJF B;  2LKY A;  2IMW P;  2F77 X;  3HT3 A;  4QZB A;  4PHD A;  2XCA A;  1SB3 C;  2XID A;  2WAQ F;  5ALU A;  4RUA A;  3MR3 A;  3GFK B;  4JV0 A;  1X9M A;  5K4L A;  5KTQ A;  3JPN A;  4RNO A;  5IIM A;  2D8C A;  3F2D A;  4PGY A;  1L5U A;  4O3M A;  1QSL A;  1Z00 A;  5AK5 A;  1F5S A;  1XSL A;  5KT2 A;  2V9W A;  1KKX A;  5B5E U;  4KLU A;  5HNK A;  3JPP A;  4DQR A;  4JK1 A;  4I28 A;  3BQ2 A;  4F50 A;  1FFU A;  1V38 A;  3RJF A;  3S6J A;  2ISP A;  1FIQ A;  2W43 A;  4C8M A;  2HI0 A;  2GOL A;  1SL2 A;  7ICU A;  3ZDC A;  4XUS A;  4I2H A;  2EZZ A;  2PKE A;  5KG4 A;  4MF8 A;  4DF4 A;  1UQV A;  5AKZ A;  1XWL A;  3MR2 A;  1RG6 A;  3RBD A;  1JXL A;  1YZ6 A;  2KFN A;  4EYH B;  1ZQY A;  4DSK A;  1Q8K A;  4QZE A;  3KKA C;  1PK1 B;  2AGP A;  5FP0 A;  5KFT A;  4QWC A;  1LKY B;  5CP2 A;  4QZD A;  4I2J A;  2JZB A;  3UXO A;  2KOB A;  2VKQ A;  1U48 A;  1QSY A;  2K89 A;  3RJG A;  3PX4 A;  2RDJ A;  4Y2P A;  4F3O A;  4J9R A;  3U26 A;  8ICV A;  4C4T A;  4PHE A;  3HWT A;  4RQ2 A;  4DOB A;  1RYR A;  1C7Y A;  4IR1 A;  3QZ8 A;  4F8R A;  5J2H A;  2Y1I A;  4O3P A;  3D2N A;  3CW2 C;  1JUD A;  2D6F C;  4R8U A;  1NJX A;  2R8G A;  4MEY A;  4Y2T A;  4BGD A;  3LWL A;  4Q8F A;  3OHA A;  4F4Z A;  9ICF A;  4F5N A;  3MDA A;  4ECW A;  2IOF K;  1SL0 A;  5KFX A;  1NKC A;  3KBB A;  4Y2R A;  4QZC A;  1XS9 D;  2H3V A;  1JIH A;  2YX8 A;  5KFE A;  2CN1 A;  1KL9 A;  2XGQ A;  4KIT B;  4QZH A;  4C0Z A;  1PZN A;  1ZRN A;  2EZX A;  3JPS A;  1X2I A;  2BCU A;  4K4G A;  3WKE A;  2Y1J A;  4O3O A;  3WK4 A;  4NLB A;  5CA7 A;  4QZG A;  5HMM A;  1FEZ A;  3M7D A;  2IOH A;  2KG5 A;  4Y2V A;  2XC9 A;  4UB2 A;  1URJ A;  2EAO A;  4UAU A;  1YT3 A;  3KHH A;  1SGG A;  2G09 A;  7ICN A;  2KZM A;  4K4I A;  3QNM A;  3KHR A;  2ZIU B;  4RQ6 A;  4M9J A;  5DG8 A;  3GU3 A;  4YR0 A;  1ZQR A;  1SXE A;  1X9X A;  2YN4 A;  3SYZ A;  1ZD2 P;  5TZV A;  5KFI A;  1LKY A;  5ALT A;  3EPG A;  4YP3 A;  2RHF A;  1Q3U A;  4ZOH C;  4PHP A;  3DEE A;  1PK1 A;  2XGP A;  5J2G A;  2E8P A;  4DEZ A;  5AI6 A;  1ZQL A;  1SWV A;  1K5O A;  3V7K A;  4DSE A;  1RPL A;  4B6J A;  3F2C A;  3VCB A;  3SQI A;  7ICO A;  9ICU A;  1ECW A;  4C80 A;  1Z4O A;  3HKZ C;  3AQE A;  1U47 A;  3C5F A;  5DGA A;  4IQT A;  3QUC A;  8ICI A;  2K8A A;  1D8L A;  4PGX A;  3E2E A;  1WWV A;  3H4D A;  2P66 A;  3IRU A;  4QWD A;  5HML A;  4IL6 U;  5ALZ A;  3UMG A;  2PMZ C;  4J9N A;  2YY6 A;  2DWQ A;  2C2E A;  2NRV A;  1ZQK A;  1L8O A;  5EE0 A;  5KFC A;  4EX7 A;  1ZJN A;  3TAD A;  1NOM A;  2K4I A;  5KFK A;  2VA3 A;  4KLH A;  4DL7 A;  3HPO A;  2BQU A;  3KZI U;  4EYI B;  5HR6 A;  3UPQ A;  2EAP A;  1UT5 A;  5ALV A;  4DSI A;  1HUZ A;  3BQ0 A;  2ODG A;  4KLG A;  4Q45 A;  3RB3 A; 
#chains in the Genus database with same CATH homology
 3A0H U;  5B5E U;  3WU2 U;  4UB8 U;  3KZI U;  3A0B U;  5TIS U;  5B66 U;  5KAI U;  4UB6 U;  1S5L U;  5GTI U;  2DUY A;  5H2F U;  5E79 U;  5KAF U;  4IL6 U;  4PJ0 U;  2AXT U;  5GTH U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...