4UB6U

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 30
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 4ub6U01
2AXTU 3A0HU 1S5LU 5KAIU 5B5EU 3A0BU 2DUYA 4PJ0U 4UB8U 5H2FU 4IL6U 5GTIU 5GTHU 5TISU 3WU2U 5B66U 4UB6U 3KZIU 5E79U 5KAFU
chains in the Genus database with same CATH superfamily
2IBKA 2YB1A 1Z1VA 1CI4A 3LVWA 3C28A 4QZCA 2C2EA 1ZQ1C 3LWLA 3NVVA 1L3VA 4GXIA 1WYGA 4BXOA 5ALUA 2G0AA 3BS5B 3C23A 4C80A 3R9KA 1N5WA 3JPNA 4I2EA 2YX8A 1NJWA 4OJ6A 4NWIA 4B9LA 5ALGA 1NK0A 2ZTEA 4KLHA 3PSFA 5J8YA 4B9MA 1ZQHA 4UBCA 3PVXA 2P66A 3WK9A 1L7MA 1LVHA 3I76A 2G07A 5ALYA 5KFTA 4I28A 1PVPA 1ZOLA 2IHNA 1TVAA 4ECQA 4UB2A 3ALRA 1KRPA 2PI4A 5KAFU 1SV0A 3D2SA 2HBKA 1X9MA 1HJPA 2N1RA 1NNLA 1V85A 4UARA 2PMZF 3RB6A 3GIMA 1ZQKA 2K4EA 2KKPA 4UAUA 2KJ5A 5GTHU 4Y2RA 5C5JA 5ALKA 3BDPA 2K8AA 3H8SA 4EX7A 5KT4A 2DBYA 2K8BB 5KG3A 4YR3A 2OEHA 1N63A 3WK7A 5J0YA 2UVVA 1HUOA 1PVQA 3LWMA 5GTIU 4KN4A 1B43A 2A19A 4QWBA 4J9RA 7ICIA 2HHXA 3Q8PB 1ZQXA 1AQ6A 2IMWP 3RH6A 2KG5A 5AIAA 1X6JA 4MFAA 2YY6A 5AI9A 4KLSA 3RJEA 1CRXA 2W7PA 4P0PB 5DG9A 1D9FA 3F5EA 1SZHA 4NM2A 7ICLA 1QQ7A 1ZQJA 4TUQA 1ZRMA 3WK5A 4C7YA 8ICGA 2NRTA 1X6IA 5CA7A 3C2LA 3QZ8A 2YMLA 5KG5A 2EAOA 9ICVA 1PK1B 2KHQA 4UB5A 4KX5A 1KN5A 5L1IA 3RJGA 4QWAA 4F5NA 4CF3A 4LVSA 4F2RA 4R8UB 1NJXA 1NK8A 2BDPA 3TKAA 3OJUA 5ALRA 3PZPA 4CF4A 1ECWA 2Y1JA 4RPYA 4YD1A 3OSNA 1ZQDA 1Z00A 2KSOB 5CJ7A 2AXTU 3V6KA 3MR5A 5KFVA 2W8KA 2YB4A 1QSYA 4DQRA 3SAGA 9ICGA 4B9NA 4DOAA 2F3NA 5ALPA 4I27A 5ALNA 7ICPA 2KMDA 1L7NA 2PKEA 4E0DA 1NKCA 2IOHA 2LYBA 1L7OA 4Y2JA 4DSLA 1SL2A 2EZXA 3MGHA 2E5SA 2RHFA 2IHMA 1U47A 3NRZA 1S76D 5HR7A 3GILA 1ZQZA 1J2MA 8ICXA 3HX0A 2BHNA 1XS9D 4F71A 3PNCA 2JH1A 3ZDDA 4GLXA 4J03A 4C8LA 2KSOA 5AM3A 4LJXA 5DDMA 1QSSA 5L1JA 5KT6A 4B9SA 5KFUA 2F76X 5DGAA 5AICA 2DQNB 8ICTA 1A76A 1FFUA 1ZQUA 2QB0B 3AU2A 3H40A 1RYRA 2OM6A 5AKKA 2G08A 2E8PA 1GO3F 3M9NB 3UQ0A 4YQWA 3GV7B 1RQNA 2E3TA 4ED8A 5AHXA 2ZTCA 1U4BA 3T5JA 2HHQA 3MDAA 1T3NA 4FZLA 2AGOA 4UB3A 2KN7A 4PJ0U 5KFLA 4DLEA 1BVSA 5BOMA 4ELVA 1N62A 5J0SA 2HCFA 4KN7A 3KBBA 1NZBA 3Q8SB 3I1YA 4PL2A 2H3ZA 1BPBA 3QUBA 4KTQA 2Y1IA 1FFVA 9ICRA 4J9OA 3Q8LA 1L6NA 3HWTA 3SQIA 1SZPA 2YMQA 5KFGA 3H0MB 4Y2TA 1NKBA 4RU9A 4CE6A 1OUQA 4O0IA 4DFPA 3QU7A 4F50A 5EWEA 1L3UA 4ED2A 5J2EA 1L3SA 2K4PA 2E1EA 5A0LA 1XNSA 2G5IB 1L7PA 2FLNA 3H0RB 4NLKA 1QQ6A 2DF4B 1ED1A 2XY7A 4DF4A 4P0QB 2PFQA 1ZJNA 4XUSA 2K4IA 8ICMA 2HBJA 8ICRA 2WF5A 3ETLA 5IIKA 2M0NA 3BQ0A 1YT3A 1Z19A 1BPDA 3H8MA 3TADC 2XIDA 5KG4A 1TAMA 4FO6A 2DKZA 4RQ5A 2ESEA 2ZJAA 3AM9A 4MEYA 5TZVA 2KTQA 2R8GA 4C4SA 4ED6A 4YVZA 2BKEA 3I28A 4ED0A 3RFAA 1V97A 4I2HA 5ALTA 3H4DA 2FDRA 3ZDEA 4KX3A 3N4MB 3B9JA 3OSPA 4RQ1A 4DS5A 1N2XA 4Y2QA 1ZETA 3M8RA 4EBCA 4QZAA 4JWNA 1XO0A 3TARA 4GFJA 4IR1A 4OJOA 4DFJA 3PV8A 4ECTA 5IINA 4GIBA 2BPCA 2XCAA 3SI8A 4IQWA 4ECWA 3H8WA 1OXJA 1BGXT 3ZD9A 1NK7A 4I29A 1NI3A 3QU5A 4NM1A 1KKXA 3QZ7A 4M47A 4ELUA 2EAPA 3KOOA 3M9OB 2W03A 3KHRA 4FE3A 4KLIA 1ZQGA 3V72A 1X42A 4F5RA 1PZNA 4KLQA 1Z1BA 1TAQA 3TFRA 2AGPA 4M9HA 3RF9A 4CGZA 2KZ3A 3TAPA 1K5OA 2Y0SC 3Q8RB 2EDUA 2K8CB 2E8OA 1ZQYA 1TV9A 3UM9A 4QWDA 2UVRA 1RM6C 5AK4A 2A1JA 5G5HA 5DBBA 4Z6FA 1S77D 1ZJMA 2W9MA 2AHOB 3C29A 4RQ6A 5ALOA 1BPXA 1Q3UA 3TACB 3N7RC 4NL9C 4TUPA 4PPXA 5DKWA 3AUOA 5AM0A 5KL8B 3EUB2 5DLGA 2D8CA 4RUCA 5J8YC 2ATLA 4M6WA 1CUKA 4J9KA 3UXOA 3RB4A 2KP7A 3RAXA 3LDAA 3PR5B 4R63A 1ZXIA 4Z6EA 4O3MA 9ICQA 3MABA 4KLOA 3KKAC 3RAQA 1UT5A 2BDUA 4Q8FA 3HKZC 5AM5A 4JV2A 2XICA 4EZ6A 3M6KA 5ALQA 8ICBA 4DCCA 4UAVA 3PW2A 5J0UA 1S0VA 2RP5A 4M04A 7ICGA 3E0FA 4RNOA 2OXOA 5KFJA 4IC9A 8ICPA 1XSPA 1A77A 2KIWA 2MUTA 3PW4A 4ACOA 4IR9A 5AK3A 3HILA 2ZUCA 9ICEA 2FPMA 4F72A 3DDHA 1O03A 3WKAA 2IOFA 4I2IA 3QUCA 4TQSA 3TFSA 2HHUA 5EWGA 3G6YA 1XSNA 2I9GA 1Z4NA 4EEYA 4FS2A 1YZ7A 3L3FX 2Z7JA 3E2EA 5KFMA 4UB4A 2ZIWA 4GC6A 1RG6A 1RXVA 3F2CA 1WWUA 7ICRA 4ZOHC 1D9DA 1Y88A 8ICVA 4NV0A 1QTMA 4C0ZA 5JU5A 5EWFA 4M0AA 4LZDA 3QX7A 3RRHA 5E79U 1RPLA 2W55A 5L1MA 3NS1A 1ZQRA 2KE7A 2FLLA 3Q8QB 1KFSA 3A0HU 8ICFA 2WB1C 1HUZA 8ICEA 3QEBZ 3RR8A 9ICPA 5KFQA 4QNLA 1S0MA 5AI6A 5FP0A 5KFRA 5DGBA 2NV3A 2KKVA 1ZQSA 2KJ9A 1L5UA 5HR6A 2HW3A 4F91B 1C7YA 5AKGA 4UAZA 3EZ5A 5JTIA 5F9NA 3NGDA 4DLGA 5J2CA 3SD7A 4R66A 4Q43A 1U9LA 3T79A 1N56A 4KLDA 3KHLA 3MBYA 3TADA 4GXJA 2ZJ8A 2ZXHA 5IILA 9ICXA 1A0PA 1ZD2P 1EXNA 2F8KA 9ICSA 3N97B 2OYYA 5JUMA 4EYHB 4Y2PA 4RQ4A 2KOBA 1DOQA 2JRZA 8ICSA 4ECXA 5ALZA 3AL0B 1DGJA 8ICZA 4I2AA 1ZYQA 2CRXA 4KLLA 4M2YA 2R8KA 4P0PA 3PR4A 1T4GA 5KT3A 4M9GA 3GV8B 4Y2UA 5G5GA 4J9PA 2JEGA 5ALJA 4P4MA 1S0NA 4KLMA 1JXEA 5KFIA 5HHHA 8ICLA 4DO9A 7ICJA 9ICFA 5IIMA 5BOLA 2OH2A 2WF9A 2AGQA 1SKSA 3D2QA 5KFOA 4ED7A 4F4XA 2JMGA 3MR6A 2YTUA 3BQTA 4C8OA 1MC8A 5J0OA 3IRUA 4QW9A 1RZTA 2JV3A 3MFHA 1U45A 3RTVA 2WF8A 5DG8A 5ALHA 2KFZA 3CYMA 5J2GA 4M9JA 1HIWA 5J0TA 4DFDA 4R65A 3GFKB 3ISCA 1F0MA 5CHGA 2F2AB 1BPEA 3SEIA 4YCXA 4WJ3B 1ZD3A 4DWIA 4C4TA 3OTQA 5KFEA 2LI6A 3HT3A 4G3IA 5ALEA 1VDVA 2CXYA 1ZQPA 2W11A 2ZIXB 1TKDA 3B0YA 8ICYA 2DPIA 2ZJ5A 5AKEA 5KFYA 2FMPA 1QQ5A 1SXDA 3BQ1A 2B6GA 2JHDA 3BS5A 2NO4A 4XRHA 4RQMA 5DBAA 5J2DA 2DPJA 2JZBB 4DFKA 2NYVA 4MFFA 3BZCA 5KG7A 3KHHA 4DSKA 2W54A 1V9PA 2JZBA 3MGVA 4J9NA 5D4BA 5ALVA 2ZIVB 2G09A 1L8LA 5ALFA 2HBMA 2ZIXA 4F3OA 3QEAZ 4ELTA 1MQ3A 3IV6A 2LKYA 3GZFA 2M9NA 3WK6A 4YR2A 1MSWD 5AKXA 2I1QA 4R8UA 2ZG6A 4F4WA 5J0WA 3L4PA 1BPYA 5ALSA 2H3QA 5KT5A 4NXZA 9ICBA 4IRCA 1N48A 3WU2U 4GC7A 4AP9A 2VJ4A 2WFAA 4EENA 4QIWC 1OW5A 4IQTA 1L3TA 2FI1A 2DWQA 3PO5A 4K4GA 3HW8A 4O5EA 4DS4A 3PMNA 2MA1A 4KMOB 4U7CA 1RQLA 2HOIA 2J6TA 1S97A 7ICQA 1SKRA 3K1ZA 3IHQB 7ICFA 2HHWA 8ICIA 5JRTA 7ICSA 3UMCA 3EW9A 2GO7A 2PI5A 3UPQA 3PMLA 4TQRA 3TAQA 4RNNA 1X66A 5J2JA 3NVWA 1WCNA 4DSIA 4IQUA 3PSTA 4OJ5A 5AI8A 1M6YA 4ICAA 1S5LU 3CP8A 5AKJA 3RBEA 1L8OA 3EPGA 3T5HA 3V6JA 4BJQA 2JH7A 4RQ3A 2BCVA 2ZXIA 5CRXA 1UHUA 1UCVA 2J6UA 3JPQA 4A8EA 2A1JB 3QNMA 4JUZA 2BCRA 4F4KA 4PHAA 5IIOA 3F5AA 1JROA 1KW4A 4EEKA 2HSZA 2XGPA 1QCKA 5HNKA 3S6JA 1ZQQA 3E58A 2RRDA 4RPZA 2KHVA 2JEIA 5ALWA 3RH5A 3RJHA 1DK2A 3N28A 2KVSA 2BR0A 2OHFA 4DOBA 4Q44A 5KT7A 4F5OA 4JWMA 4US8A 2MAXA 2OCEA 5KFBA 1UA0A 5CB1A 4BXOB 3G6XA 2LM4A 3FC4A 1QSLA 2AJQA 1J97A 1SWVA 2E8MA 2QLTA 4BWMA 5AKHA 4BX9C 4K4IA 1JI7A 4KLUA 4DL7A 9ICLA 1FO4A 4JB3A 5HMMA 2ZUBA 1SWWA 2L5YA 2NO5A 1WWVA 2WTFA 5KFAA 2QB1A 3BZKA 4DL2A 2ISOA 5IIIA 3K75D 3IN5A 4QZ8A 3OHBA 2B21A 4PGYA 4UBBA 4MF8A 2W8LA 1PUZA 1XO1A 1K1QA 5KFPA 3C2KA 2EH9A 1Q8KA 4PGXA 2VA2A 2I5HA 2HMXA 5KNIA 4ECYA 1K1SA 1NK5A 9ICNA 3C1YA 5B66U 4MEXA 3RBDA 5KAIU 2MUTB 1SGGA 3KZIU 3MGIA 3SV4A 3WKBA 2F44A 5DQGA 5KFWA 3QU2A 5CP2A 1ZQMA 1P7DA 4DSFA 5AM2A 8ICKA 3SZ2A 2KICA 3QXGA 4O5KA 4OCZA 2QARB 1JN3A 2C28A 4NL9A 1NK6A 5T14A 1S0OA 5CWRA 2JEJA 4M6WB 3EPIA 3JPSA 4DL6A 2J6SA 2HI0A 4ECRA 1S9FA 3KD3A 1MA7A 4JV0A 3MR3A 1TK0A 5AKZA 2RQ5A 2E1FA 3RB3A 5F9LA 4UASA 4OJPA 3Q8MA 4I2CA 3OGUA 4UB1A 1JX4A 4I2BA 4NLCA 4KLEA 2K89A 2K4HA 5EE3A 3QU4A 1TK5A 2LHTA 2NRZA 3AQEA 2AU0A 3WKEA 8ICQA 2PFNA 4CDGA 5KFSA 2ZUDA 2A3VA 2BCSA 5EE1A 3J81j 4C8NA 2FMQA 4DQQA 4FZMA 7ICOA 4O3QA 1ZQCA 3MDCA 3N7SC 4DFMA 2IA6A 3AMZA 1ZD4A 2B0CA 3MFIA 2RDJA 3DV9A 3EYZA 4B9TA 2LPEA 3JPRA 1MN8A 1X9XA 4I2JA 1X40A 3KTQA 2ZIWB 4O9MA 3SYZA 2WHEA 4DQSA 2WAQC 1KFTA 1NKEA 1UA1A 1X2IA 2H3IA 1WG8A 1Q3VA 3UMGA 5KFZA 2LM1A 1N61A 4F92B 4RZRA 3LK9A 1ZQAA 1AROP 2ASDA 4CNQA 5D46A 1ZQNA 1JUDA 3K4GA 2HOFA 1XU4A 3BQ7A 3WK8A 3ZDBA 4XA5A 4LZGA 2JXJA 4NLNA 4EELA 4C8KA 3TANA 4I2FA 5J0RA 2DGZA 2R18A 4M9LA 3QE9Y 3F53A 4F5PA 4QZBA 4C4RA 2W04A 3D2NA 4O5CA 3T5KA 2W7OA 9ICOA 2NRXA 7ICMA 3RJFA 3V6HA 3UXNA 3U26A 3SAHA 4I2GA 2FPLA 3SR6A 1Q46A 4TURA 2F1HA 3VC8A 4QWEA 4AYBC 1KBUA 2W9BA 1F44A 9ICIA 2PFOA 2ALZA 4F4ZA 5ALXA 3ISDA 2GLEA 5L1LA 1QH9A 4BDPA 4QZHA 4M9NA 4RNMA 2QARA 1J2NA 4MF2A 1ZQTA 8ICUA 2ZTDA 2VJ5A 1H38A 2AQ4A 1ZQOA 5EE9A 5J29A 3MR2A 1SL1A 2HHTA 7ICUA 2W3RA 4MFCA 4CCHA 2JGAA 3GIKA 2FE9A 4IRDA 1YZ6A 4ED1A 3TI0A 1T3QA 5DB6A 4K4HA 4DEZA 4J9QA 2NRWA 1BPZA 5KTQA 4I2DA 3PSIA 4FBTA 1ZQFA 9ICAA 2Y0SF 3AEVA 2CPRA 2KD1A 1SV4A 3TQ1A 2HVHA 8ICJA 4P4OA 5DDYA 2RLTA 3K1RB 3Q8KA 3UQ2A 4NLGA 2EAMA 2P6RA 4YG2A 2KNJA 2MU2A 3IG5A 4PHDA 5EE0A 1SIJA 4QWCA 3NUQA 4KITB 3AU6A 5F3XB 2QB0A 4USAA 3M6ZA 1IG6A 1LKYA 4DL5A 2F8LA 3AN1A 4F2SA 4J9MA 2A1AA 2IOFK 5AI4A 2D6FC 4F5QA 1B22A 2E8NA 4FBUA 4OJLA 3IP4B 5KT2A 3B0XA 4DL3A 5H2FU 2R8JA 2LYAA 9ICKA 2GOLA 9ICMA 7ICVA 4PZOA 3DEEA 2V4RA 5J2IA 1ZQVA 2Q4TA 3WK4A 2KZZA 3RJJA 1Z3EB 2KFNA 1XSLA 2ZIVA 1QLNA 5B5EU 2XO7A 4UATA 2KVCA 4RQNA 2W3SA 4F4YA 4ED3A 3M1YA 2KIVA 2KZMA 3O0FA 1T8EA 2QKQA 2BQRA 3SV3A 1U49A 9ICHA 5KFNA 1KDHA 2WB1F 4RT2A 1O08A 3LVVA 3OJSA 4QZEA 3PW0A 3FAHA 4F93B 2RDIA 2YMPA 1UPHA 2LMRA 3UMBA 1SKWA 2F1IA 1URJA 5ALMA 4RT3A 3KZXA 1NK4A 2XVTA 2H5XA 4DL4A 3H7IA 2FLPA 3RRGA 3V7KA 2C2RA 3VCBA 1Z4OA 9ICJA 5IIJA 3C1ZA 3MC1A 3GV5B 3PX4A 4DSEA 1MQ2A 2DL0A 1X9SA 4PHPA 1NJYA 2BCUA 3ETRA 4ZH4A 2W9AA 2ES6A 4B9VA 3PO4A 2HVIA 4X5VA 7ICEA 3LYSA 5KFFA 4O3PA 3RB0A 3RJIA 8ICNA 5KFHA 4O3RA 1B0XA 2Y9TA 2C22A 7ICNA 3C21A 4UW9A 1RXWA 5ALDA 4EX6A 2YQEA 1T7PA 3HP6A 4QZ9A 4Y2SA 4Y2YA 1FIQA 4RQ2A 4PZNA 2XCPA 2KK0A 2XY5A 1VLBA 3BS7A 5K4LA 4IRKA 3EWAA 4UB8U 5HMLA 4GXKA 1F5SA 3AQFA 2ODGA 2KV2A 2BQ3A 2BCQA 3T3FA 1U48A 3JPTA 2BZFA 4QIWF 5J2AA 2EANA 2BGWA 3M7DA 3KKAA 3THVA 2CN1A 3PX6A 1ZQIA 3GIIA 2UVUA 3QU9A 1N60A 3ZD8A 3D6JA 4B9UA 2C2DA 3ICXA 4YN4A 3H8JA 1V38A 4P4PA 2BPFA 1TE2A 2Y9UA 2YN4A 4UQGA 4R64A 3M9MB 9ICUA 2P35A 3HPOA 3T5LA 4HYKA 3GQCA 4YR0A 3M8SA 1PK3A 4YP3A 3N7PD 5AKIA 4YMMA 1RYUA 1NJZA 1Z00B 4IL6U 4KLGA 4RQ7A 4EBDA 4C7ZA 2G5HB 2K60A 5KG2A 1JALA 4EYIB 2WF7A 4B6JA 5DBCA 1KTQA 9ICTA 4RQ0A 3KFUF 2LBOA 3CRXA 2I6XA 1ZQEA 1FEZA 4P2HA 4DQIA 4DF8A 1ZQLA 3PY8A 2YMMA 3ZI4A 5DQHA 3QUQA 5KFDA 2HHSA 2WAQF 4Z6CA 2FMSA 4KLFA 2VKQA 1VJ5A 5KFKA 3RR7A 1DK3A 2KJ8A 5BPCA 4CF5A 2DUYA 3C5FA 4ECVA 1B4FA 4MHVA 5HHIA 1S10A 8ICAA 4F8RA 3QYPA 4PL1A 3NASA 1LV5A 2VIXA 2UVWA 5J2BA 4U6PA 3H4BA 2FJ6A 5J0QA 5HP4A 2GWSA 3SMVA 4Y2VA 4RUAA 1PK1A 3NRWA 5KFXA 5ALIA 2BPGA 2R8IA 4RQ8A 5KG6A 3NVYA 2XGQA 5TISU 4UAYA 4PHEA 3HKZF 2PXIA 4XQ8A 4YXMA 4CRXA 3SENA 5AK6A 2XI9A 5DQIA 2HHVA 3IDWA 1PVRA 3BQ2A 4Y2XA 1BNOA 4QZDA 2Q0ZX 4YD2A 5KG1A 1D8YA 2G06A 4QZIA 2H3VA 7ICTA 7ICKA 5C0YA 1JMSA 2XY6A 5L1KA 4DOCA 2HOQA 4PH5A 3IM1A 2WF6A 3IG8A 4NJ8A 1TAUA 2W9BB 1NOMA 2VANA 5J2FA 2PMZC 3G6VA 7ICHA 2H3FA 3HJEA 2PFPA 3ED5A 4Q8EA 2XC9A 5AK5A 2GH1A 4IQVA 4YMNA 1D8LA 5CR0A 3WKDA 3ISBA 2MRLA 2W9CA 4NLBA 1CEZA 4QZGA 3PSPA 4PGQA 5KG0A 1IV8A 3CNHA 3GU3A 1ZQWA 2R8HA 1IXRA 1S8OA 5J2HA 3NTUA 3V7LA 2OWOA 4JK1A 3C5GA 3GIJA 2D3DA 4OD0A 5DB8A 3WKCA 2JR5A 3PW7A 3ONNA 5EOZA 4ECZA 3FDSA 3PX0A 4J9LA 2FPKA 1KQQA 1NK9A 4KMUA 4HAIA 4O3OA 4OO1J 1RDFA 5L9XA 2ZIUA 1SXEA 4RPXA 1T94A 1D8BA 2AH5A 1WUDA 5DB7A 3FM9A 4NLZA 1JXLA 4QJFB 2ASJA 5AKYA 1ZQBA 2ZIUB 1N5XA 4FFDA 1ZRNA 3H0LB 4O3NA 5AIBA 4J9SA 4TUSA 2F77X 1XWLA 1LKYB 4IS7A 1NZPA 3F2BA 1TK8A 4QW8A 8ICCA 3A0BU 2W9CB 5J0XA 1KFDA 3C2MA 2P6UA 2EZZA 5J0PA 1ZD5A 2EQYA 2KEYA 3ZDAA 9ICCA 5KFCA 3PW5A 4G9BA 3ZDCA 4JMUA 4BWJA 4KLTA 4Z6DA 5AI5A 4C8MA 4DSJA 1IM4A 5J2KA 3RH4A 4YXJA 1SV0C 4BGDA 5AI0A 2O6KA 5CEHA 4US9A 4NY8A 1JIHA 2AQ0A 8ICOA 8ICWA 2V9WA 4P0QA 2DKXA 1SL0A 1C20A 2MSNA 1RYSA 4BUGA 1COOA 3KHGA 2V4QA 5AM1A 1XC9A 4FS1A 4JV1A 2F1JA 2JEFA 4QZFA 4EBEA 3SAFA 3HRDD 9ICWA 3JPPA 2ISPA 3GDXA 5ALLA 2DFLA 5D49A 4O3SA 5DB9A 1UT8A 3V7JA 1DXSA 2BQUA 1COKA 4YFKA 1LB2B 4UB6U 3OHAA 4AYBF 2HDOA 1JRPA 2EZYA 3ORYA 4FZNA 3F2DA 4DQPA 1X9WA 1BNPA 2VA3A 4UAWA 1A6SA 5DLFA 8ICHA 2LYHA 1UQVA 2VA8A 3CW2C 4ECSA 4KLJA 3L5KA 1DRGA 1DGSA 5DG7A 3JPOA 1WCLA 4Q45A 2W43A 2HBLA 4EZ9A 1KSPA 1KL9A 5AKLA 3BJYA 4ECUA 2ASLA 1HEKA 3RJKA 3OPXA 3QUTA 5AM4A 3FYHA 1KLNA 4YMOA 1SB3C 1IIPA 1TFRA 1KEJA 3NVZA 2NRVA 5KL1B 3UXPA
chains in the Genus database with same CATH topology
2AXTU 3A0HU 1S5LU 5KAIU 5B5EU 3A0BU 2DUYA 4PJ0U 4UB8U 5H2FU 4IL6U 5GTIU 5GTHU 5TISU 3WU2U 5B66U 4UB6U 3KZIU 5E79U 5KAFU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXT U;  3A0H U;  1S5L U;  5KAI U;  5B5E U;  3A0B U;  2DUY A;  4PJ0 U;  4UB8 U;  5H2F U;  4IL6 U;  5GTI U;  5GTH U;  5TIS U;  3WU2 U;  5B66 U;  4UB6 U;  3KZI U;  5E79 U;  5KAF U; 
#chains in the Genus database with same CATH topology
 2IBK A;  2YB1 A;  1Z1V A;  1CI4 A;  3LVW A;  3C28 A;  4QZC A;  2C2E A;  1ZQ1 C;  3LWL A;  3NVV A;  1L3V A;  4GXI A;  1WYG A;  4BXO A;  5ALU A;  2G0A A;  3BS5 B;  3C23 A;  4C80 A;  3R9K A;  1N5W A;  3JPN A;  4I2E A;  2YX8 A;  1NJW A;  4OJ6 A;  4NWI A;  4B9L A;  5ALG A;  1NK0 A;  2ZTE A;  4KLH A;  3PSF A;  5J8Y A;  4B9M A;  1ZQH A;  4UBC A;  3PVX A;  2P66 A;  3WK9 A;  1L7M A;  1LVH A;  3I76 A;  2G07 A;  5ALY A;  5KFT A;  4I28 A;  1PVP A;  1ZOL A;  2IHN A;  1TVA A;  4ECQ A;  4UB2 A;  3ALR A;  1KRP A;  2PI4 A;  5KAF U;  1SV0 A;  3D2S A;  2HBK A;  1X9M A;  1HJP A;  2N1R A;  1NNL A;  1V85 A;  4UAR A;  2PMZ F;  3RB6 A;  3GIM A;  1ZQK A;  2K4E A;  2KKP A;  4UAU A;  2KJ5 A;  5GTH U;  4Y2R A;  5C5J A;  5ALK A;  3BDP A;  2K8A A;  3H8S A;  4EX7 A;  5KT4 A;  2DBY A;  2K8B B;  5KG3 A;  4YR3 A;  2OEH A;  1N63 A;  3WK7 A;  5J0Y A;  2UVV A;  1HUO A;  1PVQ A;  3LWM A;  5GTI U;  4KN4 A;  1B43 A;  2A19 A;  4QWB A;  4J9R A;  7ICI A;  2HHX A;  3Q8P B;  1ZQX A;  1AQ6 A;  2IMW P;  3RH6 A;  2KG5 A;  5AIA A;  1X6J A;  4MFA A;  2YY6 A;  5AI9 A;  4KLS A;  3RJE A;  1CRX A;  2W7P A;  4P0P B;  5DG9 A;  1D9F A;  3F5E A;  1SZH A;  4NM2 A;  7ICL A;  1QQ7 A;  1ZQJ A;  4TUQ A;  1ZRM A;  3WK5 A;  4C7Y A;  8ICG A;  2NRT A;  1X6I A;  5CA7 A;  3C2L A;  3QZ8 A;  2YML A;  5KG5 A;  2EAO A;  9ICV A;  1PK1 B;  2KHQ A;  4UB5 A;  4KX5 A;  1KN5 A;  5L1I A;  3RJG A;  4QWA A;  4F5N A;  4CF3 A;  4LVS A;  4F2R A;  4R8U B;  1NJX A;  1NK8 A;  2BDP A;  3TKA A;  3OJU A;  5ALR A;  3PZP A;  4CF4 A;  1ECW A;  2Y1J A;  4RPY A;  4YD1 A;  3OSN A;  1ZQD A;  1Z00 A;  2KSO B;  5CJ7 A;  2AXT U;  3V6K A;  3MR5 A;  5KFV A;  2W8K A;  2YB4 A;  1QSY A;  4DQR A;  3SAG A;  9ICG A;  4B9N A;  4DOA A;  2F3N A;  5ALP A;  4I27 A;  5ALN A;  7ICP A;  2KMD A;  1L7N A;  2PKE A;  4E0D A;  1NKC A;  2IOH A;  2LYB A;  1L7O A;  4Y2J A;  4DSL A;  1SL2 A;  2EZX A;  3MGH A;  2E5S A;  2RHF A;  2IHM A;  1U47 A;  3NRZ A;  1S76 D;  5HR7 A;  3GIL A;  1ZQZ A;  1J2M A;  8ICX A;  3HX0 A;  2BHN A;  1XS9 D;  4F71 A;  3PNC A;  2JH1 A;  3ZDD A;  4GLX A;  4J03 A;  4C8L A;  2KSO A;  5AM3 A;  4LJX A;  5DDM A;  1QSS A;  5L1J A;  5KT6 A;  4B9S A;  5KFU A;  2F76 X;  5DGA A;  5AIC A;  2DQN B;  8ICT A;  1A76 A;  1FFU A;  1ZQU A;  2QB0 B;  3AU2 A;  3H40 A;  1RYR A;  2OM6 A;  5AKK A;  2G08 A;  2E8P A;  1GO3 F;  3M9N B;  3UQ0 A;  4YQW A;  3GV7 B;  1RQN A;  2E3T A;  4ED8 A;  5AHX A;  2ZTC A;  1U4B A;  3T5J A;  2HHQ A;  3MDA A;  1T3N A;  4FZL A;  2AGO A;  4UB3 A;  2KN7 A;  4PJ0 U;  5KFL A;  4DLE A;  1BVS A;  5BOM A;  4ELV A;  1N62 A;  5J0S A;  2HCF A;  4KN7 A;  3KBB A;  1NZB A;  3Q8S B;  3I1Y A;  4PL2 A;  2H3Z A;  1BPB A;  3QUB A;  4KTQ A;  2Y1I A;  1FFV A;  9ICR A;  4J9O A;  3Q8L A;  1L6N A;  3HWT A;  3SQI A;  1SZP A;  2YMQ A;  5KFG A;  3H0M B;  4Y2T A;  1NKB A;  4RU9 A;  4CE6 A;  1OUQ A;  4O0I A;  4DFP A;  3QU7 A;  4F50 A;  5EWE A;  1L3U A;  4ED2 A;  5J2E A;  1L3S A;  2K4P A;  2E1E A;  5A0L A;  1XNS A;  2G5I B;  1L7P A;  2FLN A;  3H0R B;  4NLK A;  1QQ6 A;  2DF4 B;  1ED1 A;  2XY7 A;  4DF4 A;  4P0Q B;  2PFQ A;  1ZJN A;  4XUS A;  2K4I A;  8ICM A;  2HBJ A;  8ICR A;  2WF5 A;  3ETL A;  5IIK A;  2M0N A;  3BQ0 A;  1YT3 A;  1Z19 A;  1BPD A;  3H8M A;  3TAD C;  2XID A;  5KG4 A;  1TAM A;  4FO6 A;  2DKZ A;  4RQ5 A;  2ESE A;  2ZJA A;  3AM9 A;  4MEY A;  5TZV A;  2KTQ A;  2R8G A;  4C4S A;  4ED6 A;  4YVZ A;  2BKE A;  3I28 A;  4ED0 A;  3RFA A;  1V97 A;  4I2H A;  5ALT A;  3H4D A;  2FDR A;  3ZDE A;  4KX3 A;  3N4M B;  3B9J A;  3OSP A;  4RQ1 A;  4DS5 A;  1N2X A;  4Y2Q A;  1ZET A;  3M8R A;  4EBC A;  4QZA A;  4JWN A;  1XO0 A;  3TAR A;  4GFJ A;  4IR1 A;  4OJO A;  4DFJ A;  3PV8 A;  4ECT A;  5IIN A;  4GIB A;  2BPC A;  2XCA A;  3SI8 A;  4IQW A;  4ECW A;  3H8W A;  1OXJ A;  1BGX T;  3ZD9 A;  1NK7 A;  4I29 A;  1NI3 A;  3QU5 A;  4NM1 A;  1KKX A;  3QZ7 A;  4M47 A;  4ELU A;  2EAP A;  3KOO A;  3M9O B;  2W03 A;  3KHR A;  4FE3 A;  4KLI A;  1ZQG A;  3V72 A;  1X42 A;  4F5R A;  1PZN A;  4KLQ A;  1Z1B A;  1TAQ A;  3TFR A;  2AGP A;  4M9H A;  3RF9 A;  4CGZ A;  2KZ3 A;  3TAP A;  1K5O A;  2Y0S C;  3Q8R B;  2EDU A;  2K8C B;  2E8O A;  1ZQY A;  1TV9 A;  3UM9 A;  4QWD A;  2UVR A;  1RM6 C;  5AK4 A;  2A1J A;  5G5H A;  5DBB A;  4Z6F A;  1S77 D;  1ZJM A;  2W9M A;  2AHO B;  3C29 A;  4RQ6 A;  5ALO A;  1BPX A;  1Q3U A;  3TAC B;  3N7R C;  4NL9 C;  4TUP A;  4PPX A;  5DKW A;  3AUO A;  5AM0 A;  5KL8 B;  3EUB 2;  5DLG A;  2D8C A;  4RUC A;  5J8Y C;  2ATL A;  4M6W A;  1CUK A;  4J9K A;  3UXO A;  3RB4 A;  2KP7 A;  3RAX A;  3LDA A;  3PR5 B;  4R63 A;  1ZXI A;  4Z6E A;  4O3M A;  9ICQ A;  3MAB A;  4KLO A;  3KKA C;  3RAQ A;  1UT5 A;  2BDU A;  4Q8F A;  3HKZ C;  5AM5 A;  4JV2 A;  2XIC A;  4EZ6 A;  3M6K A;  5ALQ A;  8ICB A;  4DCC A;  4UAV A;  3PW2 A;  5J0U A;  1S0V A;  2RP5 A;  4M04 A;  7ICG A;  3E0F A;  4RNO A;  2OXO A;  5KFJ A;  4IC9 A;  8ICP A;  1XSP A;  1A77 A;  2KIW A;  2MUT A;  3PW4 A;  4ACO A;  4IR9 A;  5AK3 A;  3HIL A;  2ZUC A;  9ICE A;  2FPM A;  4F72 A;  3DDH A;  1O03 A;  3WKA A;  2IOF A;  4I2I A;  3QUC A;  4TQS A;  3TFS A;  2HHU A;  5EWG A;  3G6Y A;  1XSN A;  2I9G A;  1Z4N A;  4EEY A;  4FS2 A;  1YZ7 A;  3L3F X;  2Z7J A;  3E2E A;  5KFM A;  4UB4 A;  2ZIW A;  4GC6 A;  1RG6 A;  1RXV A;  3F2C A;  1WWU A;  7ICR A;  4ZOH C;  1D9D A;  1Y88 A;  8ICV A;  4NV0 A;  1QTM A;  4C0Z A;  5JU5 A;  5EWF A;  4M0A A;  4LZD A;  3QX7 A;  3RRH A;  5E79 U;  1RPL A;  2W55 A;  5L1M A;  3NS1 A;  1ZQR A;  2KE7 A;  2FLL A;  3Q8Q B;  1KFS A;  3A0H U;  8ICF A;  2WB1 C;  1HUZ A;  8ICE A;  3QEB Z;  3RR8 A;  9ICP A;  5KFQ A;  4QNL A;  1S0M A;  5AI6 A;  5FP0 A;  5KFR A;  5DGB A;  2NV3 A;  2KKV A;  1ZQS A;  2KJ9 A;  1L5U A;  5HR6 A;  2HW3 A;  4F91 B;  1C7Y A;  5AKG A;  4UAZ A;  3EZ5 A;  5JTI A;  5F9N A;  3NGD A;  4DLG A;  5J2C A;  3SD7 A;  4R66 A;  4Q43 A;  1U9L A;  3T79 A;  1N56 A;  4KLD A;  3KHL A;  3MBY A;  3TAD A;  4GXJ A;  2ZJ8 A;  2ZXH A;  5IIL A;  9ICX A;  1A0P A;  1ZD2 P;  1EXN A;  2F8K A;  9ICS A;  3N97 B;  2OYY A;  5JUM A;  4EYH B;  4Y2P A;  4RQ4 A;  2KOB A;  1DOQ A;  2JRZ A;  8ICS A;  4ECX A;  5ALZ A;  3AL0 B;  1DGJ A;  8ICZ A;  4I2A A;  1ZYQ A;  2CRX A;  4KLL A;  4M2Y A;  2R8K A;  4P0P A;  3PR4 A;  1T4G A;  5KT3 A;  4M9G A;  3GV8 B;  4Y2U A;  5G5G A;  4J9P A;  2JEG A;  5ALJ A;  4P4M A;  1S0N A;  4KLM A;  1JXE A;  5KFI A;  5HHH A;  8ICL A;  4DO9 A;  7ICJ A;  9ICF A;  5IIM A;  5BOL A;  2OH2 A;  2WF9 A;  2AGQ A;  1SKS A;  3D2Q A;  5KFO A;  4ED7 A;  4F4X A;  2JMG A;  3MR6 A;  2YTU A;  3BQT A;  4C8O A;  1MC8 A;  5J0O A;  3IRU A;  4QW9 A;  1RZT A;  2JV3 A;  3MFH A;  1U45 A;  3RTV A;  2WF8 A;  5DG8 A;  5ALH A;  2KFZ A;  3CYM A;  5J2G A;  4M9J A;  1HIW A;  5J0T A;  4DFD A;  4R65 A;  3GFK B;  3ISC A;  1F0M A;  5CHG A;  2F2A B;  1BPE A;  3SEI A;  4YCX A;  4WJ3 B;  1ZD3 A;  4DWI A;  4C4T A;  3OTQ A;  5KFE A;  2LI6 A;  3HT3 A;  4G3I A;  5ALE A;  1VDV A;  2CXY A;  1ZQP A;  2W11 A;  2ZIX B;  1TKD A;  3B0Y A;  8ICY A;  2DPI A;  2ZJ5 A;  5AKE A;  5KFY A;  2FMP A;  1QQ5 A;  1SXD A;  3BQ1 A;  2B6G A;  2JHD A;  3BS5 A;  2NO4 A;  4XRH A;  4RQM A;  5DBA A;  5J2D A;  2DPJ A;  2JZB B;  4DFK A;  2NYV A;  4MFF A;  3BZC A;  5KG7 A;  3KHH A;  4DSK A;  2W54 A;  1V9P A;  2JZB A;  3MGV A;  4J9N A;  5D4B A;  5ALV A;  2ZIV B;  2G09 A;  1L8L A;  5ALF A;  2HBM A;  2ZIX A;  4F3O A;  3QEA Z;  4ELT A;  1MQ3 A;  3IV6 A;  2LKY A;  3GZF A;  2M9N A;  3WK6 A;  4YR2 A;  1MSW D;  5AKX A;  2I1Q A;  4R8U A;  2ZG6 A;  4F4W A;  5J0W A;  3L4P A;  1BPY A;  5ALS A;  2H3Q A;  5KT5 A;  4NXZ A;  9ICB A;  4IRC A;  1N48 A;  3WU2 U;  4GC7 A;  4AP9 A;  2VJ4 A;  2WFA A;  4EEN A;  4QIW C;  1OW5 A;  4IQT A;  1L3T A;  2FI1 A;  2DWQ A;  3PO5 A;  4K4G A;  3HW8 A;  4O5E A;  4DS4 A;  3PMN A;  2MA1 A;  4KMO B;  4U7C A;  1RQL A;  2HOI A;  2J6T A;  1S97 A;  7ICQ A;  1SKR A;  3K1Z A;  3IHQ B;  7ICF A;  2HHW A;  8ICI A;  5JRT A;  7ICS A;  3UMC A;  3EW9 A;  2GO7 A;  2PI5 A;  3UPQ A;  3PML A;  4TQR A;  3TAQ A;  4RNN A;  1X66 A;  5J2J A;  3NVW A;  1WCN A;  4DSI A;  4IQU A;  3PST A;  4OJ5 A;  5AI8 A;  1M6Y A;  4ICA A;  1S5L U;  3CP8 A;  5AKJ A;  3RBE A;  1L8O A;  3EPG A;  3T5H A;  3V6J A;  4BJQ A;  2JH7 A;  4RQ3 A;  2BCV A;  2ZXI A;  5CRX A;  1UHU A;  1UCV A;  2J6U A;  3JPQ A;  4A8E A;  2A1J B;  3QNM A;  4JUZ A;  2BCR A;  4F4K A;  4PHA A;  5IIO A;  3F5A A;  1JRO A;  1KW4 A;  4EEK A;  2HSZ A;  2XGP A;  1QCK A;  5HNK A;  3S6J A;  1ZQQ A;  3E58 A;  2RRD A;  4RPZ A;  2KHV A;  2JEI A;  5ALW A;  3RH5 A;  3RJH A;  1DK2 A;  3N28 A;  2KVS A;  2BR0 A;  2OHF A;  4DOB A;  4Q44 A;  5KT7 A;  4F5O A;  4JWM A;  4US8 A;  2MAX A;  2OCE A;  5KFB A;  1UA0 A;  5CB1 A;  4BXO B;  3G6X A;  2LM4 A;  3FC4 A;  1QSL A;  2AJQ A;  1J97 A;  1SWV A;  2E8M A;  2QLT A;  4BWM A;  5AKH A;  4BX9 C;  4K4I A;  1JI7 A;  4KLU A;  4DL7 A;  9ICL A;  1FO4 A;  4JB3 A;  5HMM A;  2ZUB A;  1SWW A;  2L5Y A;  2NO5 A;  1WWV A;  2WTF A;  5KFA A;  2QB1 A;  3BZK A;  4DL2 A;  2ISO A;  5III A;  3K75 D;  3IN5 A;  4QZ8 A;  3OHB A;  2B21 A;  4PGY A;  4UBB A;  4MF8 A;  2W8L A;  1PUZ A;  1XO1 A;  1K1Q A;  5KFP A;  3C2K A;  2EH9 A;  1Q8K A;  4PGX A;  2VA2 A;  2I5H A;  2HMX A;  5KNI A;  4ECY A;  1K1S A;  1NK5 A;  9ICN A;  3C1Y A;  5B66 U;  4MEX A;  3RBD A;  5KAI U;  2MUT B;  1SGG A;  3KZI U;  3MGI A;  3SV4 A;  3WKB A;  2F44 A;  5DQG A;  5KFW A;  3QU2 A;  5CP2 A;  1ZQM A;  1P7D A;  4DSF A;  5AM2 A;  8ICK A;  3SZ2 A;  2KIC A;  3QXG A;  4O5K A;  4OCZ A;  2QAR B;  1JN3 A;  2C28 A;  4NL9 A;  1NK6 A;  5T14 A;  1S0O A;  5CWR A;  2JEJ A;  4M6W B;  3EPI A;  3JPS A;  4DL6 A;  2J6S A;  2HI0 A;  4ECR A;  1S9F A;  3KD3 A;  1MA7 A;  4JV0 A;  3MR3 A;  1TK0 A;  5AKZ A;  2RQ5 A;  2E1F A;  3RB3 A;  5F9L A;  4UAS A;  4OJP A;  3Q8M A;  4I2C A;  3OGU A;  4UB1 A;  1JX4 A;  4I2B A;  4NLC A;  4KLE A;  2K89 A;  2K4H A;  5EE3 A;  3QU4 A;  1TK5 A;  2LHT A;  2NRZ A;  3AQE A;  2AU0 A;  3WKE A;  8ICQ A;  2PFN A;  4CDG A;  5KFS A;  2ZUD A;  2A3V A;  2BCS A;  5EE1 A;  3J81 j;  4C8N A;  2FMQ A;  4DQQ A;  4FZM A;  7ICO A;  4O3Q A;  1ZQC A;  3MDC A;  3N7S C;  4DFM A;  2IA6 A;  3AMZ A;  1ZD4 A;  2B0C A;  3MFI A;  2RDJ A;  3DV9 A;  3EYZ A;  4B9T A;  2LPE A;  3JPR A;  1MN8 A;  1X9X A;  4I2J A;  1X40 A;  3KTQ A;  2ZIW B;  4O9M A;  3SYZ A;  2WHE A;  4DQS A;  2WAQ C;  1KFT A;  1NKE A;  1UA1 A;  1X2I A;  2H3I A;  1WG8 A;  1Q3V A;  3UMG A;  5KFZ A;  2LM1 A;  1N61 A;  4F92 B;  4RZR A;  3LK9 A;  1ZQA A;  1ARO P;  2ASD A;  4CNQ A;  5D46 A;  1ZQN A;  1JUD A;  3K4G A;  2HOF A;  1XU4 A;  3BQ7 A;  3WK8 A;  3ZDB A;  4XA5 A;  4LZG A;  2JXJ A;  4NLN A;  4EEL A;  4C8K A;  3TAN A;  4I2F A;  5J0R A;  2DGZ A;  2R18 A;  4M9L A;  3QE9 Y;  3F53 A;  4F5P A;  4QZB A;  4C4R A;  2W04 A;  3D2N A;  4O5C A;  3T5K A;  2W7O A;  9ICO A;  2NRX A;  7ICM A;  3RJF A;  3V6H A;  3UXN A;  3U26 A;  3SAH A;  4I2G A;  2FPL A;  3SR6 A;  1Q46 A;  4TUR A;  2F1H A;  3VC8 A;  4QWE A;  4AYB C;  1KBU A;  2W9B A;  1F44 A;  9ICI A;  2PFO A;  2ALZ A;  4F4Z A;  5ALX A;  3ISD A;  2GLE A;  5L1L A;  1QH9 A;  4BDP A;  4QZH A;  4M9N A;  4RNM A;  2QAR A;  1J2N A;  4MF2 A;  1ZQT A;  8ICU A;  2ZTD A;  2VJ5 A;  1H38 A;  2AQ4 A;  1ZQO A;  5EE9 A;  5J29 A;  3MR2 A;  1SL1 A;  2HHT A;  7ICU A;  2W3R A;  4MFC A;  4CCH A;  2JGA A;  3GIK A;  2FE9 A;  4IRD A;  1YZ6 A;  4ED1 A;  3TI0 A;  1T3Q A;  5DB6 A;  4K4H A;  4DEZ A;  4J9Q A;  2NRW A;  1BPZ A;  5KTQ A;  4I2D A;  3PSI A;  4FBT A;  1ZQF A;  9ICA A;  2Y0S F;  3AEV A;  2CPR A;  2KD1 A;  1SV4 A;  3TQ1 A;  2HVH A;  8ICJ A;  4P4O A;  5DDY A;  2RLT A;  3K1R B;  3Q8K A;  3UQ2 A;  4NLG A;  2EAM A;  2P6R A;  4YG2 A;  2KNJ A;  2MU2 A;  3IG5 A;  4PHD A;  5EE0 A;  1SIJ A;  4QWC A;  3NUQ A;  4KIT B;  3AU6 A;  5F3X B;  2QB0 A;  4USA A;  3M6Z A;  1IG6 A;  1LKY A;  4DL5 A;  2F8L A;  3AN1 A;  4F2S A;  4J9M A;  2A1A A;  2IOF K;  5AI4 A;  2D6F C;  4F5Q A;  1B22 A;  2E8N A;  4FBU A;  4OJL A;  3IP4 B;  5KT2 A;  3B0X A;  4DL3 A;  5H2F U;  2R8J A;  2LYA A;  9ICK A;  2GOL A;  9ICM A;  7ICV A;  4PZO A;  3DEE A;  2V4R A;  5J2I A;  1ZQV A;  2Q4T A;  3WK4 A;  2KZZ A;  3RJJ A;  1Z3E B;  2KFN A;  1XSL A;  2ZIV A;  1QLN A;  5B5E U;  2XO7 A;  4UAT A;  2KVC A;  4RQN A;  2W3S A;  4F4Y A;  4ED3 A;  3M1Y A;  2KIV A;  2KZM A;  3O0F A;  1T8E A;  2QKQ A;  2BQR A;  3SV3 A;  1U49 A;  9ICH A;  5KFN A;  1KDH A;  2WB1 F;  4RT2 A;  1O08 A;  3LVV A;  3OJS A;  4QZE A;  3PW0 A;  3FAH A;  4F93 B;  2RDI A;  2YMP A;  1UPH A;  2LMR A;  3UMB A;  1SKW A;  2F1I A;  1URJ A;  5ALM A;  4RT3 A;  3KZX A;  1NK4 A;  2XVT A;  2H5X A;  4DL4 A;  3H7I A;  2FLP A;  3RRG A;  3V7K A;  2C2R A;  3VCB A;  1Z4O A;  9ICJ A;  5IIJ A;  3C1Z A;  3MC1 A;  3GV5 B;  3PX4 A;  4DSE A;  1MQ2 A;  2DL0 A;  1X9S A;  4PHP A;  1NJY A;  2BCU A;  3ETR A;  4ZH4 A;  2W9A A;  2ES6 A;  4B9V A;  3PO4 A;  2HVI A;  4X5V A;  7ICE A;  3LYS A;  5KFF A;  4O3P A;  3RB0 A;  3RJI A;  8ICN A;  5KFH A;  4O3R A;  1B0X A;  2Y9T A;  2C22 A;  7ICN A;  3C21 A;  4UW9 A;  1RXW A;  5ALD A;  4EX6 A;  2YQE A;  1T7P A;  3HP6 A;  4QZ9 A;  4Y2S A;  4Y2Y A;  1FIQ A;  4RQ2 A;  4PZN A;  2XCP A;  2KK0 A;  2XY5 A;  1VLB A;  3BS7 A;  5K4L A;  4IRK A;  3EWA A;  4UB8 U;  5HML A;  4GXK A;  1F5S A;  3AQF A;  2ODG A;  2KV2 A;  2BQ3 A;  2BCQ A;  3T3F A;  1U48 A;  3JPT A;  2BZF A;  4QIW F;  5J2A A;  2EAN A;  2BGW A;  3M7D A;  3KKA A;  3THV A;  2CN1 A;  3PX6 A;  1ZQI A;  3GII A;  2UVU A;  3QU9 A;  1N60 A;  3ZD8 A;  3D6J A;  4B9U A;  2C2D A;  3ICX A;  4YN4 A;  3H8J A;  1V38 A;  4P4P A;  2BPF A;  1TE2 A;  2Y9U A;  2YN4 A;  4UQG A;  4R64 A;  3M9M B;  9ICU A;  2P35 A;  3HPO A;  3T5L A;  4HYK A;  3GQC A;  4YR0 A;  3M8S A;  1PK3 A;  4YP3 A;  3N7P D;  5AKI A;  4YMM A;  1RYU A;  1NJZ A;  1Z00 B;  4IL6 U;  4KLG A;  4RQ7 A;  4EBD A;  4C7Z A;  2G5H B;  2K60 A;  5KG2 A;  1JAL A;  4EYI B;  2WF7 A;  4B6J A;  5DBC A;  1KTQ A;  9ICT A;  4RQ0 A;  3KFU F;  2LBO A;  3CRX A;  2I6X A;  1ZQE A;  1FEZ A;  4P2H A;  4DQI A;  4DF8 A;  1ZQL A;  3PY8 A;  2YMM A;  3ZI4 A;  5DQH A;  3QUQ A;  5KFD A;  2HHS A;  2WAQ F;  4Z6C A;  2FMS A;  4KLF A;  2VKQ A;  1VJ5 A;  5KFK A;  3RR7 A;  1DK3 A;  2KJ8 A;  5BPC A;  4CF5 A;  2DUY A;  3C5F A;  4ECV A;  1B4F A;  4MHV A;  5HHI A;  1S10 A;  8ICA A;  4F8R A;  3QYP A;  4PL1 A;  3NAS A;  1LV5 A;  2VIX A;  2UVW A;  5J2B A;  4U6P A;  3H4B A;  2FJ6 A;  5J0Q A;  5HP4 A;  2GWS A;  3SMV A;  4Y2V A;  4RUA A;  1PK1 A;  3NRW A;  5KFX A;  5ALI A;  2BPG A;  2R8I A;  4RQ8 A;  5KG6 A;  3NVY A;  2XGQ A;  5TIS U;  4UAY A;  4PHE A;  3HKZ F;  2PXI A;  4XQ8 A;  4YXM A;  4CRX A;  3SEN A;  5AK6 A;  2XI9 A;  5DQI A;  2HHV A;  3IDW A;  1PVR A;  3BQ2 A;  4Y2X A;  1BNO A;  4QZD A;  2Q0Z X;  4YD2 A;  5KG1 A;  1D8Y A;  2G06 A;  4QZI A;  2H3V A;  7ICT A;  7ICK A;  5C0Y A;  1JMS A;  2XY6 A;  5L1K A;  4DOC A;  2HOQ A;  4PH5 A;  3IM1 A;  2WF6 A;  3IG8 A;  4NJ8 A;  1TAU A;  2W9B B;  1NOM A;  2VAN A;  5J2F A;  2PMZ C;  3G6V A;  7ICH A;  2H3F A;  3HJE A;  2PFP A;  3ED5 A;  4Q8E A;  2XC9 A;  5AK5 A;  2GH1 A;  4IQV A;  4YMN A;  1D8L A;  5CR0 A;  3WKD A;  3ISB A;  2MRL A;  2W9C A;  4NLB A;  1CEZ A;  4QZG A;  3PSP A;  4PGQ A;  5KG0 A;  1IV8 A;  3CNH A;  3GU3 A;  1ZQW A;  2R8H A;  1IXR A;  1S8O A;  5J2H A;  3NTU A;  3V7L A;  2OWO A;  4JK1 A;  3C5G A;  3GIJ A;  2D3D A;  4OD0 A;  5DB8 A;  3WKC A;  2JR5 A;  3PW7 A;  3ONN A;  5EOZ A;  4ECZ A;  3FDS A;  3PX0 A;  4J9L A;  2FPK A;  1KQQ A;  1NK9 A;  4KMU A;  4HAI A;  4O3O A;  4OO1 J;  1RDF A;  5L9X A;  2ZIU A;  1SXE A;  4RPX A;  1T94 A;  1D8B A;  2AH5 A;  1WUD A;  5DB7 A;  3FM9 A;  4NLZ A;  1JXL A;  4QJF B;  2ASJ A;  5AKY A;  1ZQB A;  2ZIU B;  1N5X A;  4FFD A;  1ZRN A;  3H0L B;  4O3N A;  5AIB A;  4J9S A;  4TUS A;  2F77 X;  1XWL A;  1LKY B;  4IS7 A;  1NZP A;  3F2B A;  1TK8 A;  4QW8 A;  8ICC A;  3A0B U;  2W9C B;  5J0X A;  1KFD A;  3C2M A;  2P6U A;  2EZZ A;  5J0P A;  1ZD5 A;  2EQY A;  2KEY A;  3ZDA A;  9ICC A;  5KFC A;  3PW5 A;  4G9B A;  3ZDC A;  4JMU A;  4BWJ A;  4KLT A;  4Z6D A;  5AI5 A;  4C8M A;  4DSJ A;  1IM4 A;  5J2K A;  3RH4 A;  4YXJ A;  1SV0 C;  4BGD A;  5AI0 A;  2O6K A;  5CEH A;  4US9 A;  4NY8 A;  1JIH A;  2AQ0 A;  8ICO A;  8ICW A;  2V9W A;  4P0Q A;  2DKX A;  1SL0 A;  1C20 A;  2MSN A;  1RYS A;  4BUG A;  1COO A;  3KHG A;  2V4Q A;  5AM1 A;  1XC9 A;  4FS1 A;  4JV1 A;  2F1J A;  2JEF A;  4QZF A;  4EBE A;  3SAF A;  3HRD D;  9ICW A;  3JPP A;  2ISP A;  3GDX A;  5ALL A;  2DFL A;  5D49 A;  4O3S A;  5DB9 A;  1UT8 A;  3V7J A;  1DXS A;  2BQU A;  1COK A;  4YFK A;  1LB2 B;  4UB6 U;  3OHA A;  4AYB F;  2HDO A;  1JRP A;  2EZY A;  3ORY A;  4FZN A;  3F2D A;  4DQP A;  1X9W A;  1BNP A;  2VA3 A;  4UAW A;  1A6S A;  5DLF A;  8ICH A;  2LYH A;  1UQV A;  2VA8 A;  3CW2 C;  4ECS A;  4KLJ A;  3L5K A;  1DRG A;  1DGS A;  5DG7 A;  3JPO A;  1WCL A;  4Q45 A;  2W43 A;  2HBL A;  4EZ9 A;  1KSP A;  1KL9 A;  5AKL A;  3BJY A;  4ECU A;  2ASL A;  1HEK A;  3RJK A;  3OPX A;  3QUT A;  5AM4 A;  3FYH A;  1KLN A;  4YMO A;  1SB3 C;  1IIP A;  1TFR A;  1KEJ A;  3NVZ A;  2NRV A;  5KL1 B;  3UXP A; 
#chains in the Genus database with same CATH homology
 2AXT U;  3A0H U;  1S5L U;  5KAI U;  5B5E U;  3A0B U;  2DUY A;  4PJ0 U;  4UB8 U;  5H2F U;  4IL6 U;  5GTI U;  5GTH U;  5TIS U;  3WU2 U;  5B66 U;  4UB6 U;  3KZI U;  5E79 U;  5KAF U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...