4UB6U

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
b'ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport, photosynthesis
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
total genus 30
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 4ub6U01
1S5LU 4IL6U 5B66U 3WU2U 5KAFU 4UB6U 5B5EU 5KAIU 4PJ0U 5GTHU 2AXTU 5GTIU 4UB8U 3A0BU 3KZIU 5H2FU 5TISU 5E79U 3A0HU 2DUYA
chains in the Genus database with same CATH superfamily
2E8NA 1Q46A 8ICXA 2OYYA 5EOZA 3RAXA 1PZNA 3MDCA 4MFCA 3HP6A 5AM4A 4PHEA 4B9NA 4QZHA 3MR2A 2W9AA 1Q3VA 1L3UA 3PNCA 4UATA 3IG8A 9ICGA 2K8BB 3T3FA 2FMSA 4K4GA 3RR7A 4I2FA 4B9UA 9ICAA 4GXKA 2ALZA 4Q8EA 4QZFA 5AI0A 1VLBA 4KLMA 3DV9A 3PY8A 3VC8A 5FP0A 4NXZA 5AM5A 3OHBA 4J9RA 1XSPA 4EZ9A 3PMNA 2JEFA 4USAA 2DKZA 4Q44A 3KHGA 1Q3UA 4Y2XA 3Q8KA 1WWUA 3WK6A 3ALRA 4J03A 4EENA 2CPRA 4MFFA 1Z00A 2KJ5A 3LWLA 4I2HA 4Y2UA 1JN3A 2IOFA 2XIDA 1CRXA 5F9LA 4RQ0A 2KFNA 7ICNA 2ISPA 4YMNA 1NK5A 2G09A 2AQ0A 5IINA 3KHRA 2Y1JA 2G5HB 2IHMA 3A0BU 3EW9A 4I2CA 1ZQQA 2LYHA 1SV0C 2YB1A 8ICZA 4JUZA 4DLEA 3KFUF 2RDIA 3IG5A 2JZBA 4O3PA 9ICRA 3D2NA 3MGVA 4ECTA 4ED3A 4Z6EA 1J2MA 4CE6A 1N62A 3UQ0A 2HSZA 4Y2JA 2H3IA 3ZD8A 4F4YA 1BPXA 1SWVA 4DSJA 2RDJA 1BNPA 3JPSA 2MUTB 3WKBA 1JXLA 4JV0A 4I29A 4MEXA 3QX7A 5ALPA 4U7CA 3EPGA 2B21A 3PSTA 3V72A 1SKSA 4OCZA 1ZQXA 3HKZF 4ECVA 3U26A 4CRXA 1NK7A 2CN1A 4TURA 4IQUA 2YY6A 2FPKA 5KFSA 5KG7A 3UQ2A 3M1YA 1ZQYA 4EELA 5AM2A 4HYKA 3QEAZ 2UVVA 3UM9A 5AI8A 4J9NA 4F5OA 4F72A 1SL1A 7ICJA 3A0HU 5CEHA 1TVAA 3JPQA 4YVZA 1NI3A 3QE9Y 4OJLA 4TUQA 4R8UB 3L3FX 1TAQA 3HKZC 5KFUA 5KFKA 3M8SA 5AIAA 5DGAA 4OJ6A 2KIVA 4CNQA 3IM1A 4BGDA 2Z7JA 4DSFA 4R63A 3NASA 1X9MA 3AEVA 7ICLA 2ZTEA 4DS4A 1D8YA 3TACB 1L3SA 4YP3A 3C23A 3QXGA 4BXOA 1LVHA 3D2QA 1WUDA 4UARA 3HRDD 2BCUA 3ZD9A 4I2JA 1KTQA 5J0QA 2KE7A 1TK8A 1F44A 4ECSA 7ICQA 1NK9A 4OD0A 1NOMA 1B43A 3TADC 3PV8A 3QU4A 1D8LA 7ICVA 5KFWA 2WTFA 3L5KA 7ICSA 2LI6A 2LKYA 3QU5A 1V97A 2LYBA 4EYIB 9ICVA 1SB3C 4B6JA 1NJWA 3RTVA 1IG6A 2FLNA 4ED7A 4M04A 1Z4OA 4UW9A 3GZFA 4YR2A 3OSNA 5KL1B 4ELVA 1ZQKA 2DBYA 3GDXA 4TUPA 2FPMA 1DRGA 2NRZA 2KZZA 2ESEA 3I28A 5J0TA 4YD2A 4C4RA 1QSYA 2I1QA 5EWGA 1K1SA 5A0LA 4R65A 3ONNA 4F93B 3JPPA 5CRXA 4KN4A 1UCVA 2PFNA 4ACOA 3BS5B 2ZUCA 2Y0SC 3H8JA 1D9FA 1BNOA 2HBJA 9ICEA 2K89A 1B22A 1X9SA 1NJXA 3ETRA 2OH2A 4QW9A 4YMOA 3UMGA 8ICBA 3ETLA 5KT2A 2DL0A 2F1IA 2ZJ5A 5TISU 2L5YA 1BPEA 4DOAA 3TARA 1HJPA 4DEZA 1S0NA 1CI4A 1SGGA 1T7PA 1J97A 5GTHU 3NVZA 3K75D 9ICQA 5KG6A 4RQ1A 4RQ5A 4MF8A 2BKEA 3C2KA 3RF9A 1WCLA 1U9LA 5AKZA 1ZQBA 3ZDEA 2DPIA 5IIMA 3RJKA 2CRXA 3M7DA 1RG6A 3RRHA 3H8SA 3BS7A 4KTQA 5D49A 2PFOA 3LK9A 3SEIA 3SAFA 5ALLA 5DBBA 1ZQFA 3HW8A 8ICGA 2KD1A 4F4ZA 3AQFA 2WF7A 4QWEA 1COKA 2ZXHA 5AK3A 2B6GA 5F3XB 2K4EA 3TAPA 5AKIA 4KLFA 2JEGA 1FFUA 4UAVA 5JRTA 2ZIUA 2F76X 4FZNA 2B0CA 4FE3A 3CW2C 2V4RA 5KFCA 5ALUA 4DFDA 4DQRA 4DQPA 3HWTA 4EEYA 4P0QB 1S8OA 2W7OA 4JWMA 3J81j 2BPCA 3WKAA 3N28A 5ALQA 3LWMA 4M9LA 7ICUA 5AKYA 3OPXA 1IIPA 1O08A 4KN7A 4C8KA 5IIIA 4NLGA 4JB3A 2QKQA 1L7PA 1KFDA 3PW7A 5DQHA 9ICLA 1S97A 1ZQRA 4I2EA 1SV0A 4RPYA 2G06A 1J2NA 4QZ8A 2P6RA 3TFRA 1N5WA 1C7YA 1BPZA 4ZOHC 1S9FA 4M6WA 5IIKA 1TFRA 5HMLA 1KDHA 3JPRA 4EX6A 5KFJA 2V4QA 1KQQA 2W9MA 3PO4A 2MRLA 5DQIA 4RNNA 2VIXA 5KFIA 1BPBA 2XO7A 4IQWA 4KMOB 3CRXA 2HOQA 1V85A 3THVA 3V7KA 5L1JA 3PX4A 4YXMA 4NL9A 8ICHA 5AK5A 2BHNA 5IIOA 4RQ6A 3AQEA 4F50A 5L9XA 1H38A 3Q8PB 1L7OA 1ED1A 4I2DA 4C80A 4IR9A 4WJ3B 1N48A 1P7DA 5KFDA 5CP2A 4BUGA 1KLNA 4I2BA 4M2YA 2F44A 2XY7A 1URJA 3EPIA 4LVSA 2JH7A 4QZ9A 2GH1A 4DL4A 5L1KA 2LHTA 4ED1A 4ED2A 1KEJA 7ICIA 4B9SA 3F2BA 1ZQPA 2F3NA 4UAUA 4C7ZA 5IILA 3PZPA 1SIJA 2RQ5A 1Z1BA 1ZQJA 1QH9A 3V7JA 2VJ4A 4BXOB 3PX6A 3QUBA 1U48A 2RLTA 5HMMA 5G5HA 2JXJA 4RU9A 2JH1A 2JEIA 3QYPA 4UB2A 5J2JA 4RQ7A 3HILA 2R8KA 4P4PA 4ELUA 4IRDA 5TZVA 5KFQA 4KLEA 3RAQA 1IXRA 3OSPA 3GU3A 3PSPA 4DL3A 4DQQA 1UA1A 5ALVA 4EBCA 9ICHA 4GLXA 8ICKA 2NRVA 1K1QA 3EWAA 2NO4A 3TQ1A 4IL6U 4J9QA 2WF6A 2D6FC 4M0AA 2KN7A 2KG5A 2GO7A 2HBLA 3WKDA 2OM6A 3TADA 4PGXA 3UMBA 2JRZA 3V6JA 2W3RA 8ICVA 3LVWA 3AN1A 2PXIA 5EE9A 2HHVA 4FBUA 3DEEA 3C1YA 2PMZF 4C4SA 4RQ4A 2BDPA 1KKXA 3GIKA 1U45A 4YD1A 1SV4A 2FLPA 8ICUA 1DK2A 7ICOA 5KFVA 5DDMA 4KLIA 3H40A 2XCPA 3L4PA 3AUOA 1NK4A 2LM1A 1A0PA 3B9JA 3F5EA 1PVRA 3OJUA 8ICJA 5AIBA 2QARB 1SZPA 2NO5A 4DL5A 1C20A 2HHWA 3M8RA 1KL9A 8ICYA 4NY8A 4C8NA 4RNMA 2NRWA 5J0XA 1L6NA 3RR8A 4ECXA 2KVCA 4B9VA 2V9WA 8ICAA 2KZMA 4UASA 2F8LA 3GV8B 8ICMA 5ALEA 2PI4A 4M9GA 8ICWA 2R8IA 1NK8A 1QSLA 4MEYA 4DF8A 3EYZA 4PPXA 1S0OA 2H3ZA 3WKEA 2DQNB 2F1HA 3PVXA 5HHHA 5ALHA 9ICIA 1ECWA 1ZQEA 3HX0A 4DQIA 3D2SA 5J2IA 4R64A 2FLLA 2W55A 1U4BA 1D8BA 4XA5A 5DB6A 4YCXA 2UVUA 2E3TA 2BZFA 3ICXA 4RZRA 3H4DA 7ICEA 5J29A 4YR3A 2ZIWA 1ZD2P 1JI7A 4UQGA 3H0LB 2EZYA 3K1ZA 3CYMA 1T94A 2W7PA 5HHIA 2IMWP 3IDWA 1S0MA 4Q43A 4O3SA 4K4HA 3NUQA 2BGWA 7ICTA 2I6XA 3BQTA 3T5KA 1SL0A 2E1FA 5KT4A 9ICXA 2DFLA 1CUKA 2JMGA 4MFAA 9ICBA 5GTIU 4QZIA 5K4LA 4EBEA 2HHXA 1ZQZA 2W03A 5J8YC 2HDOA 1Z19A 2C28A 2KSOA 2IOHA 3RJJA 2ZIVA 2DWQA 4KLTA 3ZDDA 1NZBA 5ALNA 4G3IA 3RB0A 3FDSA 3NRWA 3MFHA 4ED0A 4UB4A 2KOBA 2ZUBA 5AKXA 3OHAA 3ZDCA 3KTQA 5D4BA 2AGQA 3Q8SB 1KBUA 3FAHA 1ZJMA 4NWIA 3KKAC 5H2FU 3RH4A 4YN4A 8ICSA 1PK1B 4EYHB 4R8UA 5KT6A 2XVTA 5J0YA 4RQ3A 4QZCA 2XI9A 5AI6A 4CF5A 5KFOA 5AI4A 5KL8B 4IS7A 5KFMA 4O3RA 2MAXA 5AM3A 9ICUA 2ODGA 2XCAA 2FDRA 2YX8A 4UB5A 4CCHA 2AHOB 2WB1F 1HIWA 2NYVA 5EE0A 5ALGA 9ICFA 4U6PA 3QU2A 4DSEA 1TK5A 4NLCA 5DG8A 4PGYA 2Y9UA 1U47A 1O03A 2A1JA 3T5HA 1VDVA 3K4GA 4CGZA 1NJZA 2FE9A 2DF4B 4IRKA 4B9MA 3PSIA 2HBMA 3ISBA 2D3DA 1Y88A 1X40A 5J2CA 3KD3A 2DUYA 2I9GA 3RH5A 3PMLA 1MN8A 2KHQA 3E0FA 4RNOA 5JU5A 2JEJA 3M6KA 2PMZC 4NLZA 3UXNA 2LM4A 4RPXA 4F5QA 4YG2A 2EQYA 3SYZA 3RRGA 3GV7B 1RXVA 1ZXIA 5DBCA 1FO4A 1KFSA 8ICTA 3SD7A 2BR0A 4YXJA 3NGDA 1NK6A 1N61A 5ALKA 1KFTA 3LYSA 3WK9A 3N7PD 4G9BA 2YMMA 3C5GA 3N97B 5KFTA 2OXOA 5ALSA 5ALXA 1IV8A 1PVPA 5CWRA 4PL2A 4GC7A 2ASDA 4PL1A 4DOBA 4QZBA 2KVSA 4PGQA 5J2GA 3LVVA 4KLDA 3BQ1A 5ALIA 4O9MA 3TANA 4QWAA 4F8RA 5KFRA 4DF4A 2AGPA 3O0FA 3AM9A 5HP4A 3H7IA 3MGHA 3RJHA 4RQMA 4DSIA 5ALRA 3NTUA 3SV3A 3UXOA 9ICPA 3WK7A 1SXDA 3JPNA 1LKYB 1L7MA 1ZQMA 1JIHA 4O3QA 3NVWA 5AICA 2NV3A 1TAUA 2F77X 2FMQA 2KHVA 3KKAA 1A77A 4O3NA 4QWBA 4FZMA 3ZI4A 2RHFA 4QZGA 1YZ6A 2AXTU 4GIBA 4QJFB 4NLKA 5HR6A 4UBCA 5DQGA 3OJSA 4NM1A 4KLHA 3MDAA 2NRTA 1F0MA 2W43A 4DL2A 1ZQUA 3PW0A 5J0RA 3MC1A 3AMZA 5EE3A 5KFGA 2W8LA 1BVSA 2BQRA 4CF4A 4I28A 2G08A 1FEZA 2WF9A 1SZHA 2DKXA 1Z4NA 4RT2A 4ECUA 2F2AB 5J2EA 4FS2A 3E58A 5KG0A 5J0SA 1B0XA 2BCQA 1XSLA 4O5KA 2HVHA 2WF5A 2KJ9A 2YMQA 1EXNA 2ZG6A 2JGAA 2Y9TA 3TFSA 2IA6A 8ICPA 1L3VA 5C0YA 3QUQA 4C0ZA 2HHQA 1ZQWA 3NRZA 5ALDA 3I1YA 4QNLA 2DPJA 1XC9A 2OHFA 2XICA 3MBYA 4RPZA 2KKVA 5JUMA 1ZOLA 7ICRA 4GC6A 2MUTA 3RB3A 1LKYA 3KOOA 4F4XA 3KHLA 1IM4A 4TQSA 3SZ2A 8ICNA 2UVRA 3MFIA 3RJEA 5ALOA 2YQEA 1ZQ1C 4DLGA 3BQ0A 4YMMA 5KFYA 2RP5A 3GFKB 3GV5B 3PW5A 1TK0A 2W9CA 1S0VA 4OJOA 2BDUA 1ZQOA 5ALZA 5B66U 3MR5A 5EWFA 3BJYA 1NKCA 1WYGA 3ISCA 3SR6A 2ZJAA 1DK3A 1ZRNA 4DOCA 1NKBA 3HJEA 2XY5A 5DB9A 1ZQCA 3SAHA 4F4WA 2A3VA 4KLJA 1F5SA 2KFZA 4YR0A 3C1ZA 2J6UA 2FI1A 2I5HA 2IBKA 4QIWC 3DDHA 1MQ2A 5KT3A 4JV1A 4I27A 5B5EU 4NL9C 2AQ4A 2J6SA 3WKCA 4DS5A 1A76A 1SL2A 4RT3A 2BPFA 4JMUA 2WHEA 2W9CB 1BPYA 3N4MB 2EAOA 2ZIWB 2IOFK 3SI8A 5J8YA 4BDPA 1GO3F 5KFLA 2A1JB 2E8OA 1KW4A 3CNHA 1A6SA 2VA2A 4M6WB 3KZXA 1S5LU 4F5NA 1T4GA 4Y2TA 1XO1A 2K60A 2XC9A 4F3OA 5KFBA 2LYAA 2ISOA 4K4IA 1ZQTA 2K4HA 1OXJA 4PJ0U 1PK3A 4UAWA 1HEKA 1QCKA 1T8EA 2QB1A 5AKGA 4LZDA 1ZQNA 4UB8U 5HNKA 5BOMA 3KHHA 2YMPA 3RBDA 7ICHA 2W11A 3BZKA 1FIQA 1NJYA 3BQ2A 2K4IA 2F1JA 3PW4A 1N56A 2KICA 2LMRA 4KMUA 1Z3EB 9ICSA 3RJIA 5DB8A 3IP4B 4ZH4A 4F71A 4QZAA 4J9LA 2RRDA 3Q8LA 5AKLA 2R8HA 2W9BA 3NVYA 1N5XA 3RH6A 8ICRA 4P0QA 3MR6A 2Q4TA 3QUCA 2KP7A 3V6HA 4X5VA 3B0XA 4IR1A 4AYBF 1ZD4A 2C22A 4DWIA 4O5EA 4FFDA 2ASLA 2F8KA 4BJQA 3C5FA 3N7SC 2G0AA 1SKRA 3RJFA 5KNIA 3SV4A 1ZQLA 1K5OA 1LV5A 7ICFA 2KNJA 1KRPA 4JV2A 1X2IA 5J0WA 1M6YA 3GIMA 2CXYA 3AL0B 3QNMA 4KX3A 2A1AA 1ZRMA 3F2CA 2K4PA 5KFEA 2PKEA 2ZTCA 3T79A 4ELTA 1HUZA 1NKEA 4HAIA 3WK4A 2BCSA 5L1IA 1MA7A 4EX7A 5AKEA 4GFJA 2HW3A 1HUOA 3H0MB 1COOA 4JWNA 4Q45A 2GLEA 2VJ5A 5DBAA 4PHPA 4F2RA 3G6YA 3V7LA 2ZUDA 2HI0A 5DLGA 2KMDA 2E8MA 4CDGA 3PO5A 2P66A 3SAGA 5JTIA 3HT3A 4TQRA 1CEZA 2EH9A 2ASJA 1MC8A 2R18A 4J9KA 3FM9A 2M9NA 3SENA 3GIJA 2A19A 4C7YA 3MR3A 8ICLA 3B0YA 1WG8A 4IRCA 3H8WA 4NLNA 1L8LA 5KAFU 1MSWD 4EBDA 2HCFA 3M9OB 4Y2YA 4ECZA 5DG9A 1S10A 1RM6C 3SMVA 1JMSA 1XSNA 3AU2A 4DSLA 5J2HA 4EEKA 2ZTDA 3ZDAA 3EZ5A 5KAIU 5L1MA 4UB3A 5DLFA 1ZETA 2P35A 1SKWA 4NLBA 2W8KA 2O6KA 1NZPA 8ICCA 3VCBA 1NK0A 3Q8MA 4QW8A 1DGSA 4C4TA 5AK6A 4O3MA 5J2AA 4DCCA 4TUSA 8ICQA 2W54A 4GXIA 1QQ5A 4NM2A 2KSOB 1DXSA 4DQSA 5KFXA 4US9A 2ZIUB 4M9HA 2E1EA 9ICJA 9ICKA 2KKPA 3V6KA 4LZGA 4DFKA 3ZDBA 2H3QA 3BS5A 3C21A 5AI5A 5KT7A 4AYBC 3WK8A 5EWEA 4ED8A 3WU2U 4DL6A 8ICIA 3M9NB 2PFQA 4GXJA 4UAYA 1B4FA 3OGUA 2M0NA 3ISDA 4ECQA 2HMXA 5KG3A 1JROA 1ZD3A 5KFPA 5AI9A 3R9KA 4JK1A 1UT5A 3G6VA 4BX9C 4ED6A 1JXEA 3M6ZA 4FBTA 2QLTA 2NRXA 3BDPA 2XY6A 5KFHA 1RXWA 3IN5A 2N1RA 2DGZA 5EE1A 1ZQVA 5J2KA 1DGJA 3ED5A 5KG5A 1X9XA 2JR5A 2KK0A 4KITB 1N60A 4OJ5A 1X6IA 2HBKA 2PI5A 2K8CB 5KFAA 5KT5A 2BQ3A 5J0OA 2J6TA 3JPOA 1PUZA 3BQ7A 2H3VA 2OEHA 4C8OA 5J2BA 2JZBB 3GIIA 4UAZA 4IQTA 4O0IA 1JRPA 4QWDA 1TE2A 2EANA 2VANA 3S6JA 2FJ6A 9ICNA 5E79U 3C29A 3C2MA 5KFFA 4UB6U 4DO9A 5J0PA 3FC4A 1SWWA 4ECRA 4QZEA 2EZZA 3RBEA 1JUDA 1ZJNA 4F2SA 2C2EA 9ICCA 4Z6CA 3NVVA 3QZ7A 2AU0A 3D6JA 1UPHA 1AQ6A 2W04A 3NS1A 1SXEA 9ICTA 4P2HA 4C8MA 1DOQA 3H8MA 3RB4A 2Y0SF 3K1RB 3G6XA 1X9WA 3QEBZ 3PSFA 5DKWA 3T5LA 5BOLA 2VA3A 2BQUA 2WAQF 5DGBA 4OO1J 3GILA 2MSNA 2HHUA 4KLOA 4B9TA 2C2DA 4KX5A 2QB0A 2JV3A 2OWOA 2KTQA 2EDUA 4P4MA 5C5JA 5J2DA 5DB7A 3ORYA 3IV6A 1KSPA 4Y2QA 7ICKA 1ZQIA 2KZ3A 4I2AA 2EZXA 1PVQA 2YN4A 5AK4A 1FFVA 4I2IA 2AJQA 5DG7A 3MGIA 2BCVA 2WFAA 2HHTA 2E8PA 4XUSA 2W3SA 3FYHA 1N2XA 8ICFA 4O5CA 2LPEA 2YTUA 1OW5A 4DFPA 2UVWA 1UT8A 4QIWF 5AHXA 1RDFA 3H4BA 2YMLA 2JHDA 1T3NA 2D8CA 4PZNA 1RYUA 1L8OA 1ZQGA 3N7RC 3SQIA 2BCRA 1BPDA 1X66A 1XWLA 1QQ7A 2K8AA 3RB6A 4F5RA 1JX4A 2FMPA 1WCNA 4QZDA 1NNLA 3F53A 5L1LA 3H0RB 4P0PA 1RQNA 3TKAA 2OCEA 1D9DA 2KJ8A 1U49A 2W9BB 5KTQA 2QARA 1V9PA 4KLLA 2KV2A 5CR0A 1JALA 2ZIXA 4NJ8A 2EAMA 5AKJA 4O3OA 3UMCA 3LDAA 4YQWA 4KLSA 4J9OA 5AM1A 1QQ6A 1YZ7A 3GQCA 4B9LA 4RQNA 4PH5A 2HVIA 4F91B 1T3QA 1XU4A 4PHAA 8ICOA 4Y2PA 3F2DA 3HPOA 4M9JA 2AH5A 3KBBA 2ATLA 2EAPA 1XNSA 2PFPA 3PW2A 4QWCA 4AP9A 2HHSA 3T5JA 2ZXIA 2HOIA 4FO6A 4J9PA 1QTMA 5ALWA 5ALJA 3IRUA 1QSSA 1WWVA 5KG1A 4DL7A 2H3FA 9ICWA 4PZOA 5CJ7A 3EUB2 4EZ6A 3Q8RB 2Y1IA 1L7NA 3PX0A 3E2EA 2G07A 4F5PA 2Q0ZX 5AM0A 3RJGA 3QU9A 1ZQAA 1UA0A 4P4OA 4BWMA 5KFZA 4XRHA 4PHDA 2ZIVB 2VA8A 1QLNA 1Z00B 5CA7A 1ZD5A 1ZYQA 5T14A 2R8GA 1S77D 9ICOA 1X6JA 2R8JA 2AGOA 2FPLA 3UPQA 1L5UA 5AKKA 1ZQHA 4OJPA 5AKHA 4ECWA 1OUQA 3F5AA 4A8EA 5IIJA 4Z6DA 3CP8A 2GWSA 4DFJA 1KN5A 3TAQA 1RQLA 5F9NA 4Y2VA 4CF3A 5BPCA 1MQ3A 4M47A 7ICPA 2ZIXB 1L3TA 4FS1A 5KFNA 2BPGA 5CB1A 2ZJ8A 8ICEA 4RQ8A 2E5SA 3QUTA 3IHQB 9ICMA 4IC9A 4Y2RA 4DSKA 4RQ2A 1Q8KA 1XO0A 1RYRA 1PK1A 1S76D 4P0PB 3QU7A 1X42A 4Z6FA 2HOFA 2WF8A 1TKDA 1N63A 2KIWA 1Z1VA 3M9MB 2WAQC 4E0DA 1XS9D 3Q8QB 2LBOA 3UXPA 4BWJA 2XGPA 1LB2B 3PR5B 3TI0A 4LJXA 2P6UA 3MABA 4F4KA 7ICGA 5ALFA 4I2GA 1TAMA 2H5XA 4RUCA 2YB4A 4M9NA 5KG2A 5D46A 2C2RA 1BGXT 3KZIU 4YFKA 3C2LA 4ICAA 4US8A 4J9SA 1V38A 3WK5A 3I76A 4MF2A 2WB1C 5J2FA 4J9MA 1VJ5A 5G5GA 1ZQSA 2G5IB 4RUAA 5ALYA 4Q8FA 4NV0A 4F92B 2IHNA 3PR4A 3OTQA 2GOLA 4MHVA 1TV9A 4KLGA 2MA1A 4DFMA 1RZTA 1YT3A 1ZQDA 4XQ8A 1UQVA 7ICMA 4IQVA 2XGQA 3JPTA 2KEYA 4UBBA 1RYSA 3C28A 5J0UA 5ALTA 5CHGA 1RPLA 2QB0B 5HR7A 2MU2A 1AROP 2ES6A 4Y2SA 3BZCA 4KLQA 4FZLA 3RFAA 4UB1A 1UHUA 2VKQA 4C8LA 3QZ8A 4ECYA 4R66A 5ALMA 3AU6A 5DDYA 4KLUA 5KG4A
chains in the Genus database with same CATH topology
1S5LU 4IL6U 5B66U 3WU2U 5KAFU 4UB6U 5B5EU 5KAIU 4PJ0U 5GTHU 2AXTU 5GTIU 4UB8U 3A0BU 3KZIU 5H2FU 5TISU 5E79U 3A0HU 2DUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L U;  4IL6 U;  5B66 U;  3WU2 U;  5KAF U;  4UB6 U;  5B5E U;  5KAI U;  4PJ0 U;  5GTH U;  2AXT U;  5GTI U;  4UB8 U;  3A0B U;  3KZI U;  5H2F U;  5TIS U;  5E79 U;  3A0H U;  2DUY A; 
#chains in the Genus database with same CATH topology
 2E8N A;  1Q46 A;  8ICX A;  2OYY A;  5EOZ A;  3RAX A;  1PZN A;  3MDC A;  4MFC A;  3HP6 A;  5AM4 A;  4PHE A;  4B9N A;  4QZH A;  3MR2 A;  2W9A A;  1Q3V A;  1L3U A;  3PNC A;  4UAT A;  3IG8 A;  9ICG A;  2K8B B;  3T3F A;  2FMS A;  4K4G A;  3RR7 A;  4I2F A;  4B9U A;  9ICA A;  4GXK A;  2ALZ A;  4Q8E A;  4QZF A;  5AI0 A;  1VLB A;  4KLM A;  3DV9 A;  3PY8 A;  3VC8 A;  5FP0 A;  4NXZ A;  5AM5 A;  3OHB A;  4J9R A;  1XSP A;  4EZ9 A;  3PMN A;  2JEF A;  4USA A;  2DKZ A;  4Q44 A;  3KHG A;  1Q3U A;  4Y2X A;  3Q8K A;  1WWU A;  3WK6 A;  3ALR A;  4J03 A;  4EEN A;  2CPR A;  4MFF A;  1Z00 A;  2KJ5 A;  3LWL A;  4I2H A;  4Y2U A;  1JN3 A;  2IOF A;  2XID A;  1CRX A;  5F9L A;  4RQ0 A;  2KFN A;  7ICN A;  2ISP A;  4YMN A;  1NK5 A;  2G09 A;  2AQ0 A;  5IIN A;  3KHR A;  2Y1J A;  2G5H B;  2IHM A;  3A0B U;  3EW9 A;  4I2C A;  1ZQQ A;  2LYH A;  1SV0 C;  2YB1 A;  8ICZ A;  4JUZ A;  4DLE A;  3KFU F;  2RDI A;  3IG5 A;  2JZB A;  4O3P A;  9ICR A;  3D2N A;  3MGV A;  4ECT A;  4ED3 A;  4Z6E A;  1J2M A;  4CE6 A;  1N62 A;  3UQ0 A;  2HSZ A;  4Y2J A;  2H3I A;  3ZD8 A;  4F4Y A;  1BPX A;  1SWV A;  4DSJ A;  2RDJ A;  1BNP A;  3JPS A;  2MUT B;  3WKB A;  1JXL A;  4JV0 A;  4I29 A;  4MEX A;  3QX7 A;  5ALP A;  4U7C A;  3EPG A;  2B21 A;  3PST A;  3V72 A;  1SKS A;  4OCZ A;  1ZQX A;  3HKZ F;  4ECV A;  3U26 A;  4CRX A;  1NK7 A;  2CN1 A;  4TUR A;  4IQU A;  2YY6 A;  2FPK A;  5KFS A;  5KG7 A;  3UQ2 A;  3M1Y A;  1ZQY A;  4EEL A;  5AM2 A;  4HYK A;  3QEA Z;  2UVV A;  3UM9 A;  5AI8 A;  4J9N A;  4F5O A;  4F72 A;  1SL1 A;  7ICJ A;  3A0H U;  5CEH A;  1TVA A;  3JPQ A;  4YVZ A;  1NI3 A;  3QE9 Y;  4OJL A;  4TUQ A;  4R8U B;  3L3F X;  1TAQ A;  3HKZ C;  5KFU A;  5KFK A;  3M8S A;  5AIA A;  5DGA A;  4OJ6 A;  2KIV A;  4CNQ A;  3IM1 A;  4BGD A;  2Z7J A;  4DSF A;  4R63 A;  3NAS A;  1X9M A;  3AEV A;  7ICL A;  2ZTE A;  4DS4 A;  1D8Y A;  3TAC B;  1L3S A;  4YP3 A;  3C23 A;  3QXG A;  4BXO A;  1LVH A;  3D2Q A;  1WUD A;  4UAR A;  3HRD D;  2BCU A;  3ZD9 A;  4I2J A;  1KTQ A;  5J0Q A;  2KE7 A;  1TK8 A;  1F44 A;  4ECS A;  7ICQ A;  1NK9 A;  4OD0 A;  1NOM A;  1B43 A;  3TAD C;  3PV8 A;  3QU4 A;  1D8L A;  7ICV A;  5KFW A;  2WTF A;  3L5K A;  7ICS A;  2LI6 A;  2LKY A;  3QU5 A;  1V97 A;  2LYB A;  4EYI B;  9ICV A;  1SB3 C;  4B6J A;  1NJW A;  3RTV A;  1IG6 A;  2FLN A;  4ED7 A;  4M04 A;  1Z4O A;  4UW9 A;  3GZF A;  4YR2 A;  3OSN A;  5KL1 B;  4ELV A;  1ZQK A;  2DBY A;  3GDX A;  4TUP A;  2FPM A;  1DRG A;  2NRZ A;  2KZZ A;  2ESE A;  3I28 A;  5J0T A;  4YD2 A;  4C4R A;  1QSY A;  2I1Q A;  5EWG A;  1K1S A;  5A0L A;  4R65 A;  3ONN A;  4F93 B;  3JPP A;  5CRX A;  4KN4 A;  1UCV A;  2PFN A;  4ACO A;  3BS5 B;  2ZUC A;  2Y0S C;  3H8J A;  1D9F A;  1BNO A;  2HBJ A;  9ICE A;  2K89 A;  1B22 A;  1X9S A;  1NJX A;  3ETR A;  2OH2 A;  4QW9 A;  4YMO A;  3UMG A;  8ICB A;  3ETL A;  5KT2 A;  2DL0 A;  2F1I A;  2ZJ5 A;  5TIS U;  2L5Y A;  1BPE A;  4DOA A;  3TAR A;  1HJP A;  4DEZ A;  1S0N A;  1CI4 A;  1SGG A;  1T7P A;  1J97 A;  5GTH U;  3NVZ A;  3K75 D;  9ICQ A;  5KG6 A;  4RQ1 A;  4RQ5 A;  4MF8 A;  2BKE A;  3C2K A;  3RF9 A;  1WCL A;  1U9L A;  5AKZ A;  1ZQB A;  3ZDE A;  2DPI A;  5IIM A;  3RJK A;  2CRX A;  3M7D A;  1RG6 A;  3RRH A;  3H8S A;  3BS7 A;  4KTQ A;  5D49 A;  2PFO A;  3LK9 A;  3SEI A;  3SAF A;  5ALL A;  5DBB A;  1ZQF A;  3HW8 A;  8ICG A;  2KD1 A;  4F4Z A;  3AQF A;  2WF7 A;  4QWE A;  1COK A;  2ZXH A;  5AK3 A;  2B6G A;  5F3X B;  2K4E A;  3TAP A;  5AKI A;  4KLF A;  2JEG A;  1FFU A;  4UAV A;  5JRT A;  2ZIU A;  2F76 X;  4FZN A;  2B0C A;  4FE3 A;  3CW2 C;  2V4R A;  5KFC A;  5ALU A;  4DFD A;  4DQR A;  4DQP A;  3HWT A;  4EEY A;  4P0Q B;  1S8O A;  2W7O A;  4JWM A;  3J81 j;  2BPC A;  3WKA A;  3N28 A;  5ALQ A;  3LWM A;  4M9L A;  7ICU A;  5AKY A;  3OPX A;  1IIP A;  1O08 A;  4KN7 A;  4C8K A;  5III A;  4NLG A;  4JB3 A;  2QKQ A;  1L7P A;  1KFD A;  3PW7 A;  5DQH A;  9ICL A;  1S97 A;  1ZQR A;  4I2E A;  1SV0 A;  4RPY A;  2G06 A;  1J2N A;  4QZ8 A;  2P6R A;  3TFR A;  1N5W A;  1C7Y A;  1BPZ A;  4ZOH C;  1S9F A;  4M6W A;  5IIK A;  1TFR A;  5HML A;  1KDH A;  3JPR A;  4EX6 A;  5KFJ A;  2V4Q A;  1KQQ A;  2W9M A;  3PO4 A;  2MRL A;  5DQI A;  4RNN A;  2VIX A;  5KFI A;  1BPB A;  2XO7 A;  4IQW A;  4KMO B;  3CRX A;  2HOQ A;  1V85 A;  3THV A;  3V7K A;  5L1J A;  3PX4 A;  4YXM A;  4NL9 A;  8ICH A;  5AK5 A;  2BHN A;  5IIO A;  4RQ6 A;  3AQE A;  4F50 A;  5L9X A;  1H38 A;  3Q8P B;  1L7O A;  1ED1 A;  4I2D A;  4C80 A;  4IR9 A;  4WJ3 B;  1N48 A;  1P7D A;  5KFD A;  5CP2 A;  4BUG A;  1KLN A;  4I2B A;  4M2Y A;  2F44 A;  2XY7 A;  1URJ A;  3EPI A;  4LVS A;  2JH7 A;  4QZ9 A;  2GH1 A;  4DL4 A;  5L1K A;  2LHT A;  4ED1 A;  4ED2 A;  1KEJ A;  7ICI A;  4B9S A;  3F2B A;  1ZQP A;  2F3N A;  4UAU A;  4C7Z A;  5IIL A;  3PZP A;  1SIJ A;  2RQ5 A;  1Z1B A;  1ZQJ A;  1QH9 A;  3V7J A;  2VJ4 A;  4BXO B;  3PX6 A;  3QUB A;  1U48 A;  2RLT A;  5HMM A;  5G5H A;  2JXJ A;  4RU9 A;  2JH1 A;  2JEI A;  3QYP A;  4UB2 A;  5J2J A;  4RQ7 A;  3HIL A;  2R8K A;  4P4P A;  4ELU A;  4IRD A;  5TZV A;  5KFQ A;  4KLE A;  3RAQ A;  1IXR A;  3OSP A;  3GU3 A;  3PSP A;  4DL3 A;  4DQQ A;  1UA1 A;  5ALV A;  4EBC A;  9ICH A;  4GLX A;  8ICK A;  2NRV A;  1K1Q A;  3EWA A;  2NO4 A;  3TQ1 A;  4IL6 U;  4J9Q A;  2WF6 A;  2D6F C;  4M0A A;  2KN7 A;  2KG5 A;  2GO7 A;  2HBL A;  3WKD A;  2OM6 A;  3TAD A;  4PGX A;  3UMB A;  2JRZ A;  3V6J A;  2W3R A;  8ICV A;  3LVW A;  3AN1 A;  2PXI A;  5EE9 A;  2HHV A;  4FBU A;  3DEE A;  3C1Y A;  2PMZ F;  4C4S A;  4RQ4 A;  2BDP A;  1KKX A;  3GIK A;  1U45 A;  4YD1 A;  1SV4 A;  2FLP A;  8ICU A;  1DK2 A;  7ICO A;  5KFV A;  5DDM A;  4KLI A;  3H40 A;  2XCP A;  3L4P A;  3AUO A;  1NK4 A;  2LM1 A;  1A0P A;  3B9J A;  3F5E A;  1PVR A;  3OJU A;  8ICJ A;  5AIB A;  2QAR B;  1SZP A;  2NO5 A;  4DL5 A;  1C20 A;  2HHW A;  3M8R A;  1KL9 A;  8ICY A;  4NY8 A;  4C8N A;  4RNM A;  2NRW A;  5J0X A;  1L6N A;  3RR8 A;  4ECX A;  2KVC A;  4B9V A;  2V9W A;  8ICA A;  2KZM A;  4UAS A;  2F8L A;  3GV8 B;  8ICM A;  5ALE A;  2PI4 A;  4M9G A;  8ICW A;  2R8I A;  1NK8 A;  1QSL A;  4MEY A;  4DF8 A;  3EYZ A;  4PPX A;  1S0O A;  2H3Z A;  3WKE A;  2DQN B;  2F1H A;  3PVX A;  5HHH A;  5ALH A;  9ICI A;  1ECW A;  1ZQE A;  3HX0 A;  4DQI A;  3D2S A;  5J2I A;  4R64 A;  2FLL A;  2W55 A;  1U4B A;  1D8B A;  4XA5 A;  5DB6 A;  4YCX A;  2UVU A;  2E3T A;  2BZF A;  3ICX A;  4RZR A;  3H4D A;  7ICE A;  5J29 A;  4YR3 A;  2ZIW A;  1ZD2 P;  1JI7 A;  4UQG A;  3H0L B;  2EZY A;  3K1Z A;  3CYM A;  1T94 A;  2W7P A;  5HHI A;  2IMW P;  3IDW A;  1S0M A;  4Q43 A;  4O3S A;  4K4H A;  3NUQ A;  2BGW A;  7ICT A;  2I6X A;  3BQT A;  3T5K A;  1SL0 A;  2E1F A;  5KT4 A;  9ICX A;  2DFL A;  1CUK A;  2JMG A;  4MFA A;  9ICB A;  5GTI U;  4QZI A;  5K4L A;  4EBE A;  2HHX A;  1ZQZ A;  2W03 A;  5J8Y C;  2HDO A;  1Z19 A;  2C28 A;  2KSO A;  2IOH A;  3RJJ A;  2ZIV A;  2DWQ A;  4KLT A;  3ZDD A;  1NZB A;  5ALN A;  4G3I A;  3RB0 A;  3FDS A;  3NRW A;  3MFH A;  4ED0 A;  4UB4 A;  2KOB A;  2ZUB A;  5AKX A;  3OHA A;  3ZDC A;  3KTQ A;  5D4B A;  2AGQ A;  3Q8S B;  1KBU A;  3FAH A;  1ZJM A;  4NWI A;  3KKA C;  5H2F U;  3RH4 A;  4YN4 A;  8ICS A;  1PK1 B;  4EYH B;  4R8U A;  5KT6 A;  2XVT A;  5J0Y A;  4RQ3 A;  4QZC A;  2XI9 A;  5AI6 A;  4CF5 A;  5KFO A;  5AI4 A;  5KL8 B;  4IS7 A;  5KFM A;  4O3R A;  2MAX A;  5AM3 A;  9ICU A;  2ODG A;  2XCA A;  2FDR A;  2YX8 A;  4UB5 A;  4CCH A;  2AHO B;  2WB1 F;  1HIW A;  2NYV A;  5EE0 A;  5ALG A;  9ICF A;  4U6P A;  3QU2 A;  4DSE A;  1TK5 A;  4NLC A;  5DG8 A;  4PGY A;  2Y9U A;  1U47 A;  1O03 A;  2A1J A;  3T5H A;  1VDV A;  3K4G A;  4CGZ A;  1NJZ A;  2FE9 A;  2DF4 B;  4IRK A;  4B9M A;  3PSI A;  2HBM A;  3ISB A;  2D3D A;  1Y88 A;  1X40 A;  5J2C A;  3KD3 A;  2DUY A;  2I9G A;  3RH5 A;  3PML A;  1MN8 A;  2KHQ A;  3E0F A;  4RNO A;  5JU5 A;  2JEJ A;  3M6K A;  2PMZ C;  4NLZ A;  3UXN A;  2LM4 A;  4RPX A;  4F5Q A;  4YG2 A;  2EQY A;  3SYZ A;  3RRG A;  3GV7 B;  1RXV A;  1ZXI A;  5DBC A;  1FO4 A;  1KFS A;  8ICT A;  3SD7 A;  2BR0 A;  4YXJ A;  3NGD A;  1NK6 A;  1N61 A;  5ALK A;  1KFT A;  3LYS A;  3WK9 A;  3N7P D;  4G9B A;  2YMM A;  3C5G A;  3N97 B;  5KFT A;  2OXO A;  5ALS A;  5ALX A;  1IV8 A;  1PVP A;  5CWR A;  4PL2 A;  4GC7 A;  2ASD A;  4PL1 A;  4DOB A;  4QZB A;  2KVS A;  4PGQ A;  5J2G A;  3LVV A;  4KLD A;  3BQ1 A;  5ALI A;  4O9M A;  3TAN A;  4QWA A;  4F8R A;  5KFR A;  4DF4 A;  2AGP A;  3O0F A;  3AM9 A;  5HP4 A;  3H7I A;  3MGH A;  3RJH A;  4RQM A;  4DSI A;  5ALR A;  3NTU A;  3SV3 A;  3UXO A;  9ICP A;  3WK7 A;  1SXD A;  3JPN A;  1LKY B;  1L7M A;  1ZQM A;  1JIH A;  4O3Q A;  3NVW A;  5AIC A;  2NV3 A;  1TAU A;  2F77 X;  2FMQ A;  2KHV A;  3KKA A;  1A77 A;  4O3N A;  4QWB A;  4FZM A;  3ZI4 A;  2RHF A;  4QZG A;  1YZ6 A;  2AXT U;  4GIB A;  4QJF B;  4NLK A;  5HR6 A;  4UBC A;  5DQG A;  3OJS A;  4NM1 A;  4KLH A;  3MDA A;  2NRT A;  1F0M A;  2W43 A;  4DL2 A;  1ZQU A;  3PW0 A;  5J0R A;  3MC1 A;  3AMZ A;  5EE3 A;  5KFG A;  2W8L A;  1BVS A;  2BQR A;  4CF4 A;  4I28 A;  2G08 A;  1FEZ A;  2WF9 A;  1SZH A;  2DKX A;  1Z4N A;  4RT2 A;  4ECU A;  2F2A B;  5J2E A;  4FS2 A;  3E58 A;  5KG0 A;  5J0S A;  1B0X A;  2BCQ A;  1XSL A;  4O5K A;  2HVH A;  2WF5 A;  2KJ9 A;  2YMQ A;  1EXN A;  2ZG6 A;  2JGA A;  2Y9T A;  3TFS A;  2IA6 A;  8ICP A;  1L3V A;  5C0Y A;  3QUQ A;  4C0Z A;  2HHQ A;  1ZQW A;  3NRZ A;  5ALD A;  3I1Y A;  4QNL A;  2DPJ A;  1XC9 A;  2OHF A;  2XIC A;  3MBY A;  4RPZ A;  2KKV A;  5JUM A;  1ZOL A;  7ICR A;  4GC6 A;  2MUT A;  3RB3 A;  1LKY A;  3KOO A;  4F4X A;  3KHL A;  1IM4 A;  4TQS A;  3SZ2 A;  8ICN A;  2UVR A;  3MFI A;  3RJE A;  5ALO A;  2YQE A;  1ZQ1 C;  4DLG A;  3BQ0 A;  4YMM A;  5KFY A;  2RP5 A;  3GFK B;  3GV5 B;  3PW5 A;  1TK0 A;  2W9C A;  1S0V A;  4OJO A;  2BDU A;  1ZQO A;  5ALZ A;  5B66 U;  3MR5 A;  5EWF A;  3BJY A;  1NKC A;  1WYG A;  3ISC A;  3SR6 A;  2ZJA A;  1DK3 A;  1ZRN A;  4DOC A;  1NKB A;  3HJE A;  2XY5 A;  5DB9 A;  1ZQC A;  3SAH A;  4F4W A;  2A3V A;  4KLJ A;  1F5S A;  2KFZ A;  4YR0 A;  3C1Z A;  2J6U A;  2FI1 A;  2I5H A;  2IBK A;  4QIW C;  3DDH A;  1MQ2 A;  5KT3 A;  4JV1 A;  4I27 A;  5B5E U;  4NL9 C;  2AQ4 A;  2J6S A;  3WKC A;  4DS5 A;  1A76 A;  1SL2 A;  4RT3 A;  2BPF A;  4JMU A;  2WHE A;  2W9C B;  1BPY A;  3N4M B;  2EAO A;  2ZIW B;  2IOF K;  3SI8 A;  5J8Y A;  4BDP A;  1GO3 F;  5KFL A;  2A1J B;  2E8O A;  1KW4 A;  3CNH A;  1A6S A;  2VA2 A;  4M6W B;  3KZX A;  1S5L U;  4F5N A;  1T4G A;  4Y2T A;  1XO1 A;  2K60 A;  2XC9 A;  4F3O A;  5KFB A;  2LYA A;  2ISO A;  4K4I A;  1ZQT A;  2K4H A;  1OXJ A;  4PJ0 U;  1PK3 A;  4UAW A;  1HEK A;  1QCK A;  1T8E A;  2QB1 A;  5AKG A;  4LZD A;  1ZQN A;  4UB8 U;  5HNK A;  5BOM A;  3KHH A;  2YMP A;  3RBD A;  7ICH A;  2W11 A;  3BZK A;  1FIQ A;  1NJY A;  3BQ2 A;  2K4I A;  2F1J A;  3PW4 A;  1N56 A;  2KIC A;  2LMR A;  4KMU A;  1Z3E B;  9ICS A;  3RJI A;  5DB8 A;  3IP4 B;  4ZH4 A;  4F71 A;  4QZA A;  4J9L A;  2RRD A;  3Q8L A;  5AKL A;  2R8H A;  2W9B A;  3NVY A;  1N5X A;  3RH6 A;  8ICR A;  4P0Q A;  3MR6 A;  2Q4T A;  3QUC A;  2KP7 A;  3V6H A;  4X5V A;  3B0X A;  4IR1 A;  4AYB F;  1ZD4 A;  2C22 A;  4DWI A;  4O5E A;  4FFD A;  2ASL A;  2F8K A;  4BJQ A;  3C5F A;  3N7S C;  2G0A A;  1SKR A;  3RJF A;  5KNI A;  3SV4 A;  1ZQL A;  1K5O A;  1LV5 A;  7ICF A;  2KNJ A;  1KRP A;  4JV2 A;  1X2I A;  5J0W A;  1M6Y A;  3GIM A;  2CXY A;  3AL0 B;  3QNM A;  4KX3 A;  2A1A A;  1ZRM A;  3F2C A;  2K4P A;  5KFE A;  2PKE A;  2ZTC A;  3T79 A;  4ELT A;  1HUZ A;  1NKE A;  4HAI A;  3WK4 A;  2BCS A;  5L1I A;  1MA7 A;  4EX7 A;  5AKE A;  4GFJ A;  2HW3 A;  1HUO A;  3H0M B;  1COO A;  4JWN A;  4Q45 A;  2GLE A;  2VJ5 A;  5DBA A;  4PHP A;  4F2R A;  3G6Y A;  3V7L A;  2ZUD A;  2HI0 A;  5DLG A;  2KMD A;  2E8M A;  4CDG A;  3PO5 A;  2P66 A;  3SAG A;  5JTI A;  3HT3 A;  4TQR A;  1CEZ A;  2EH9 A;  2ASJ A;  1MC8 A;  2R18 A;  4J9K A;  3FM9 A;  2M9N A;  3SEN A;  3GIJ A;  2A19 A;  4C7Y A;  3MR3 A;  8ICL A;  3B0Y A;  1WG8 A;  4IRC A;  3H8W A;  4NLN A;  1L8L A;  5KAF U;  1MSW D;  4EBD A;  2HCF A;  3M9O B;  4Y2Y A;  4ECZ A;  5DG9 A;  1S10 A;  1RM6 C;  3SMV A;  1JMS A;  1XSN A;  3AU2 A;  4DSL A;  5J2H A;  4EEK A;  2ZTD A;  3ZDA A;  3EZ5 A;  5KAI U;  5L1M A;  4UB3 A;  5DLF A;  1ZET A;  2P35 A;  1SKW A;  4NLB A;  2W8K A;  2O6K A;  1NZP A;  8ICC A;  3VCB A;  1NK0 A;  3Q8M A;  4QW8 A;  1DGS A;  4C4T A;  5AK6 A;  4O3M A;  5J2A A;  4DCC A;  4TUS A;  8ICQ A;  2W54 A;  4GXI A;  1QQ5 A;  4NM2 A;  2KSO B;  1DXS A;  4DQS A;  5KFX A;  4US9 A;  2ZIU B;  4M9H A;  2E1E A;  9ICJ A;  9ICK A;  2KKP A;  3V6K A;  4LZG A;  4DFK A;  3ZDB A;  2H3Q A;  3BS5 A;  3C21 A;  5AI5 A;  5KT7 A;  4AYB C;  3WK8 A;  5EWE A;  4ED8 A;  3WU2 U;  4DL6 A;  8ICI A;  3M9N B;  2PFQ A;  4GXJ A;  4UAY A;  1B4F A;  3OGU A;  2M0N A;  3ISD A;  4ECQ A;  2HMX A;  5KG3 A;  1JRO A;  1ZD3 A;  5KFP A;  5AI9 A;  3R9K A;  4JK1 A;  1UT5 A;  3G6V A;  4BX9 C;  4ED6 A;  1JXE A;  3M6Z A;  4FBT A;  2QLT A;  2NRX A;  3BDP A;  2XY6 A;  5KFH A;  1RXW A;  3IN5 A;  2N1R A;  2DGZ A;  5EE1 A;  1ZQV A;  5J2K A;  1DGJ A;  3ED5 A;  5KG5 A;  1X9X A;  2JR5 A;  2KK0 A;  4KIT B;  1N60 A;  4OJ5 A;  1X6I A;  2HBK A;  2PI5 A;  2K8C B;  5KFA A;  5KT5 A;  2BQ3 A;  5J0O A;  2J6T A;  3JPO A;  1PUZ A;  3BQ7 A;  2H3V A;  2OEH A;  4C8O A;  5J2B A;  2JZB B;  3GII A;  4UAZ A;  4IQT A;  4O0I A;  1JRP A;  4QWD A;  1TE2 A;  2EAN A;  2VAN A;  3S6J A;  2FJ6 A;  9ICN A;  5E79 U;  3C29 A;  3C2M A;  5KFF A;  4UB6 U;  4DO9 A;  5J0P A;  3FC4 A;  1SWW A;  4ECR A;  4QZE A;  2EZZ A;  3RBE A;  1JUD A;  1ZJN A;  4F2S A;  2C2E A;  9ICC A;  4Z6C A;  3NVV A;  3QZ7 A;  2AU0 A;  3D6J A;  1UPH A;  1AQ6 A;  2W04 A;  3NS1 A;  1SXE A;  9ICT A;  4P2H A;  4C8M A;  1DOQ A;  3H8M A;  3RB4 A;  2Y0S F;  3K1R B;  3G6X A;  1X9W A;  3QEB Z;  3PSF A;  5DKW A;  3T5L A;  5BOL A;  2VA3 A;  2BQU A;  2WAQ F;  5DGB A;  4OO1 J;  3GIL A;  2MSN A;  2HHU A;  4KLO A;  4B9T A;  2C2D A;  4KX5 A;  2QB0 A;  2JV3 A;  2OWO A;  2KTQ A;  2EDU A;  4P4M A;  5C5J A;  5J2D A;  5DB7 A;  3ORY A;  3IV6 A;  1KSP A;  4Y2Q A;  7ICK A;  1ZQI A;  2KZ3 A;  4I2A A;  2EZX A;  1PVQ A;  2YN4 A;  5AK4 A;  1FFV A;  4I2I A;  2AJQ A;  5DG7 A;  3MGI A;  2BCV A;  2WFA A;  2HHT A;  2E8P A;  4XUS A;  2W3S A;  3FYH A;  1N2X A;  8ICF A;  4O5C A;  2LPE A;  2YTU A;  1OW5 A;  4DFP A;  2UVW A;  1UT8 A;  4QIW F;  5AHX A;  1RDF A;  3H4B A;  2YML A;  2JHD A;  1T3N A;  2D8C A;  4PZN A;  1RYU A;  1L8O A;  1ZQG A;  3N7R C;  3SQI A;  2BCR A;  1BPD A;  1X66 A;  1XWL A;  1QQ7 A;  2K8A A;  3RB6 A;  4F5R A;  1JX4 A;  2FMP A;  1WCN A;  4QZD A;  1NNL A;  3F53 A;  5L1L A;  3H0R B;  4P0P A;  1RQN A;  3TKA A;  2OCE A;  1D9D A;  2KJ8 A;  1U49 A;  2W9B B;  5KTQ A;  2QAR A;  1V9P A;  4KLL A;  2KV2 A;  5CR0 A;  1JAL A;  2ZIX A;  4NJ8 A;  2EAM A;  5AKJ A;  4O3O A;  3UMC A;  3LDA A;  4YQW A;  4KLS A;  4J9O A;  5AM1 A;  1QQ6 A;  1YZ7 A;  3GQC A;  4B9L A;  4RQN A;  4PH5 A;  2HVI A;  4F91 B;  1T3Q A;  1XU4 A;  4PHA A;  8ICO A;  4Y2P A;  3F2D A;  3HPO A;  4M9J A;  2AH5 A;  3KBB A;  2ATL A;  2EAP A;  1XNS A;  2PFP A;  3PW2 A;  4QWC A;  4AP9 A;  2HHS A;  3T5J A;  2ZXI A;  2HOI A;  4FO6 A;  4J9P A;  1QTM A;  5ALW A;  5ALJ A;  3IRU A;  1QSS A;  1WWV A;  5KG1 A;  4DL7 A;  2H3F A;  9ICW A;  4PZO A;  5CJ7 A;  3EUB 2;  4EZ6 A;  3Q8R B;  2Y1I A;  1L7N A;  3PX0 A;  3E2E A;  2G07 A;  4F5P A;  2Q0Z X;  5AM0 A;  3RJG A;  3QU9 A;  1ZQA A;  1UA0 A;  4P4O A;  4BWM A;  5KFZ A;  4XRH A;  4PHD A;  2ZIV B;  2VA8 A;  1QLN A;  1Z00 B;  5CA7 A;  1ZD5 A;  1ZYQ A;  5T14 A;  2R8G A;  1S77 D;  9ICO A;  1X6J A;  2R8J A;  2AGO A;  2FPL A;  3UPQ A;  1L5U A;  5AKK A;  1ZQH A;  4OJP A;  5AKH A;  4ECW A;  1OUQ A;  3F5A A;  4A8E A;  5IIJ A;  4Z6D A;  3CP8 A;  2GWS A;  4DFJ A;  1KN5 A;  3TAQ A;  1RQL A;  5F9N A;  4Y2V A;  4CF3 A;  5BPC A;  1MQ3 A;  4M47 A;  7ICP A;  2ZIX B;  1L3T A;  4FS1 A;  5KFN A;  2BPG A;  5CB1 A;  2ZJ8 A;  8ICE A;  4RQ8 A;  2E5S A;  3QUT A;  3IHQ B;  9ICM A;  4IC9 A;  4Y2R A;  4DSK A;  4RQ2 A;  1Q8K A;  1XO0 A;  1RYR A;  1PK1 A;  1S76 D;  4P0P B;  3QU7 A;  1X42 A;  4Z6F A;  2HOF A;  2WF8 A;  1TKD A;  1N63 A;  2KIW A;  1Z1V A;  3M9M B;  2WAQ C;  4E0D A;  1XS9 D;  3Q8Q B;  2LBO A;  3UXP A;  4BWJ A;  2XGP A;  1LB2 B;  3PR5 B;  3TI0 A;  4LJX A;  2P6U A;  3MAB A;  4F4K A;  7ICG A;  5ALF A;  4I2G A;  1TAM A;  2H5X A;  4RUC A;  2YB4 A;  4M9N A;  5KG2 A;  5D46 A;  2C2R A;  1BGX T;  3KZI U;  4YFK A;  3C2L A;  4ICA A;  4US8 A;  4J9S A;  1V38 A;  3WK5 A;  3I76 A;  4MF2 A;  2WB1 C;  5J2F A;  4J9M A;  1VJ5 A;  5G5G A;  1ZQS A;  2G5I B;  4RUA A;  5ALY A;  4Q8F A;  4NV0 A;  4F92 B;  2IHN A;  3PR4 A;  3OTQ A;  2GOL A;  4MHV A;  1TV9 A;  4KLG A;  2MA1 A;  4DFM A;  1RZT A;  1YT3 A;  1ZQD A;  4XQ8 A;  1UQV A;  7ICM A;  4IQV A;  2XGQ A;  3JPT A;  2KEY A;  4UBB A;  1RYS A;  3C28 A;  5J0U A;  5ALT A;  5CHG A;  1RPL A;  2QB0 B;  5HR7 A;  2MU2 A;  1ARO P;  2ES6 A;  4Y2S A;  3BZC A;  4KLQ A;  4FZL A;  3RFA A;  4UB1 A;  1UHU A;  2VKQ A;  4C8L A;  3QZ8 A;  4ECY A;  4R66 A;  5ALM A;  3AU6 A;  5DDY A;  4KLU A;  5KG4 A; 
#chains in the Genus database with same CATH homology
 1S5L U;  4IL6 U;  5B66 U;  3WU2 U;  5KAF U;  4UB6 U;  5B5E U;  5KAI U;  4PJ0 U;  5GTH U;  2AXT U;  5GTI U;  4UB8 U;  3A0B U;  3KZI U;  5H2F U;  5TIS U;  5E79 U;  3A0H U;  2DUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...