4UB6U

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
total genus 30
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 4ub6U01
4UB8U 3WU2U 3KZIU 5KAFU 5KAIU 3A0BU 4PJ0U 2DUYA 5TISU 5B66U 5GTIU 2AXTU 4UB6U 5B5EU 3A0HU 5H2FU 1S5LU 5E79U 5GTHU 4IL6U
chains in the Genus database with same CATH superfamily
4KLEA 1RPLA 1X9XA 4GIBA 1ED1A 4CF4A 4I2GA 3KZXA 4JV1A 4ED3A 5KFAA 5HMMA 4UATA 1BPDA 5IIJA 3I28A 3C5GA 4F4WA 5L1LA 4XRHA 1JXLA 3EPIA 3IV6A 1UA1A 4TUQA 3EPGA 1PZNA 4M47A 2LPEA 1DOQA 4J9PA 7ICRA 2KIVA 4C4SA 2JZBA 4QWEA 3PW5A 4GLXA 1NI3A 1X66A 1T3QA 2RQ5A 9ICKA 1S0VA 4KLUA 1UPHA 2IOFA 4ECUA 4F92B 5EE3A 3QU5A 1TKDA 1RG6A 2FPLA 3M8SA 3RJIA 4RUAA 1URJA 3SQIA 1UHUA 3THVA 4DQSA 2G08A 2VJ4A 4QZAA 1SL2A 4QZIA 4UAYA 1LB2B 4EBEA 1IXRA 4FZLA 5ALNA 4DFPA 5AKKA 1T8EA 3UXNA 4KLQA 1S76D 5EE1A 2NYVA 2KKVA 1RXVA 2WTFA 4ICAA 4NY8A 2HMXA 4ED2A 4GC7A 3QUCA 5DLGA 4HYKA 4JV0A 5DBAA 5J2DA 5J2HA 2NRTA 4QIWF 1X40A 3OTQA 2ZTEA 5KFHA 4ECQA 2CPRA 2A3VA 2LHTA 3RB0A 3F2BA 2YB1A 8ICAA 2G0AA 5ALFA 1C7YA 2LM4A 1NKBA 4RPXA 1QQ5A 4CF3A 5KFWA 4F5OA 4OCZA 3KOOA 4O0IA 4Y2SA 3H8SA 5KFLA 5AK6A 4KMOB 3FM9A 4KN4A 4DCCA 2KKPA 4JB3A 2W8KA 5EWGA 4F5RA 2PFQA 3KBBA 4US9A 4YXJA 3N28A 5F9LA 7ICVA 4TQRA 2V4QA 1QSSA 1RYSA 4IQVA 4EEKA 1L6NA 1NK8A 2AQ0A 3V7LA 2W8LA 3GDXA 9ICVA 3HILA 1T7PA 2H3IA 2F44A 1Q8KA 1NZBA 3BZCA 5KFVA 2RDIA 3TANA 4GXKA 2ODGA 9ICFA 7ICQA 9ICHA 2ASJA 5KFOA 5ALIA 1XS9D 2PXIA 2R18A 2W9AA 4NM1A 5J8YA 2YN4A 5J0WA 3Q8QB 3MDCA 4O3RA 3RTVA 1ZQTA 2GLEA 3RB3A 2CRXA 3KHLA 1PUZA 4NXZA 5KT3A 1ZQIA 2KOBA 3PSPA 4DL3A 1ZQZA 5AKHA 3WK4A 4RQ5A 1A77A 1F44A 2HHQA 1TFRA 2BDUA 9ICUA 9ICGA 3LDAA 3RH5A 2PFNA 5AM2A 2JRZA 1TK5A 4DQIA 2KHVA 4Y2JA 4FFDA 5KFYA 5J0XA 3ETRA 2JH7A 5KFKA 5AICA 4I27A 4DQQA 2ZTCA 4LJXA 3RAQA 4QZGA 3QEAZ 5KG2A 4KLHA 3HJEA 5AKJA 3UM9A 5B66U 1JXEA 1PVPA 1CUKA 5J29A 1ZQJA 2A1AA 5JRTA 5J2KA 2YMQA 2N1RA 3D2NA 5CB1A 4Y2XA 3CYMA 3HKZF 4A8EA 1SKWA 2KJ5A 3CW2C 1S97A 3M6KA 2XY5A 3ZDEA 2XICA 3QX7A 1KBUA 4YMMA 8ICLA 3SR6A 7ICOA 4RT2A 3FDSA 4BWJA 1S0OA 4DL7A 2FDRA 3MC1A 2KJ9A 1ZQLA 5F3XB 1N5XA 4IR1A 3WU2U 1A6SA 4I2CA 8ICMA 4OJPA 2ALZA 1WCNA 4CDGA 2MUTA 1JI7A 1JN3A 3Q8MA 1HJPA 4DOAA 4UAZA 3PW7A 1NK4A 4JWNA 2KZMA 5C5JA 3C2MA 1U49A 3WK5A 4RNMA 3C23A 5KG5A 9ICSA 2XI9A 3F5EA 3NVVA 3PX4A 4K4GA 3CRXA 2G07A 1ZQXA 1DK3A 4DWIA 4F8RA 7ICIA 2W03A 3M1YA 4LZGA 4BXOA 2OM6A 3T3FA 4M0AA 4CF5A 4MEXA 5J2FA 4R8UA 2C2EA 4DL4A 1L3UA 4UAUA 1QH9A 1DGJA 3VCBA 2WHEA 4Y2VA 5KAIU 5HR6A 2DPIA 3WK8A 3WK7A 1FFUA 1N63A 4ECVA 2BQUA 5AKLA 2BCRA 1MC8A 3DEEA 2HCFA 1MQ3A 3H4BA 1XC9A 4RPZA 4NJ8A 2YX8A 3RB6A 1ZQHA 7ICUA 3M8RA 3SMVA 4C0ZA 9ICPA 1KLNA 1ZQUA 1D8YA 5AK5A 4PL2A 1N62A 4YN4A 1TK0A 3SEIA 3DV9A 2ZXHA 1BVSA 4I2JA 3HW8A 3QXGA 5HHIA 2HHVA 7ICPA 5AKEA 4KLDA 3IM1A 1RQNA 5KG7A 5HNKA 4QWBA 1PVRA 2P6RA 2DF4B 1Z00A 4DSIA 3N7SC 2EZYA 4U6PA 2C2RA 2ZJAA 2QARB 1N60A 4ECXA 3G6YA 5AKXA 4KLMA 1L7PA 3I1YA 1BPXA 5KT4A 2JH1A 5KFXA 4IR9A 2WF9A 3FYHA 3MABA 4US8A 1DK2A 1ZQKA 3AL0B 3B0XA 3TKAA 4ECSA 4P0PB 3GQCA 2J6TA 7ICTA 3OSNA 1L3VA 4UAVA 5IIOA 2HOQA 1FO4A 1KEJA 4IRCA 2W9BB 5ALWA 4ECZA 1NK0A 3K4GA 4DL5A 1ZQDA 4NM2A 2QB0A 4QIWC 2Q4TA 4UB8U 4XUSA 3ZDAA 1SL0A 3PR5B 2UVUA 2AQ4A 1SKSA 3OSPA 5J0RA 3TADA 2G09A 3ZD8A 4BUGA 5BOMA 4PL1A 3PW0A 1ZXIA 3MR5A 1KFSA 3RF9A 3SAHA 2EAOA 4KN7A 4NWIA 3RRGA 5E79U 3H40A 2K60A 1TE2A 3D6JA 3EYZA 2ES6A 4P4OA 1D9FA 3PY8A 3BQTA 4EZ6A 2XCPA 3RFAA 2HBLA 1T4GA 3IG8A 4P2HA 2R8KA 4IS7A 4J9OA 4I2DA 5A0LA 5KG4A 1Z4OA 1L7NA 3TQ1A 4RQ4A 2FJ6A 5AKYA 5J0YA 4C8LA 2E8PA 4KX5A 1HIWA 1QTMA 1KQQA 5TZVA 4UB1A 2GWSA 1LV5A 2FI1A 1RQLA 2IHNA 2DKZA 2HW3A 8ICBA 2Y9UA 1ZETA 5G5HA 1DXSA 1A76A 3SYZA 3Q8RB 4J9LA 5B5EU 3QU9A 2B21A 3OHBA 1KFDA 2QARA 2UVRA 2K89A 1MN8A 2KTQA 1WWUA 2XC9A 3O0FA 4RQNA 3IN5A 1NOMA 4PHDA 4PHPA 4Q43A 2F3NA 1L3SA 4MF2A 1KKXA 3GFKB 1NJYA 5L1JA 2RLTA 3NGDA 1D8LA 3Q8PB 1X9WA 3NVZA 4M9NA 3NTUA 5D4BA 4JMUA 2DUYA 3GIMA 2G5IB 2WF7A 1KTQA 3SV4A 1PK1B 1BPZA 2QB1A 2EANA 3A0HU 2XO7A 3SAGA 4R63A 4YD2A 5KFUA 4QWCA 5HP4A 2BGWA 4XA5A 5J0OA 1WG8A 4ED7A 4RQMA 3HKZC 4QW8A 3BDPA 3RH4A 2I9GA 5KFIA 5J2EA 4PGXA 1B0XA 3E58A 8ICWA 5KFCA 3K1ZA 2MAXA 5KFSA 3EZ5A 3H7IA 1XNSA 4ELVA 8ICCA 1O03A 3WKCA 2WF6A 1NKEA 2Y0SF 1O08A 1ZRNA 3ONNA 2P66A 3JPSA 3EWAA 5ALQA 2PI5A 1AROP 1C20A 4P4MA 4JK1A 2P6UA 3D2QA 2F8KA 1ZQMA 2E1EA 3QU7A 8ICHA 1WYGA 4DLEA 3PW2A 1IM4A 2BCUA 5ALEA 8ICJA 4NLBA 5IIIA 1CEZA 3PSTA 4J9SA 5CJ7A 2IA6A 8ICYA 2H3QA 4O3PA 4F71A 2W9MA 9ICBA 1U48A 4F4ZA 2K8CB 3EW9A 4B9LA 3WKBA 5DG9A 3ED5A 4DO9A 5AIBA 2KSOB 2H5XA 5IIKA 4X5VA 1N5WA 3IDWA 1F5SA 1NK5A 3B0YA 2KNJA 2BCQA 3BS5B 3N4MB 5CWRA 1NKCA 3TADC 4RQ1A 4QJFB 3PO4A 3MFIA 5AI5A 1P7DA 3MFHA 3T5HA 2DGZA 1D9DA 1SXDA 3AUOA 1S0NA 5AI6A 1S5LU 5EE9A 2KVCA 4BGDA 2EQYA 3AMZA 4UB2A 2WB1F 7ICMA 7ICLA 3TAQA 2HVHA 2LM1A 5ALYA 3ZD9A 1ZOLA 4C8MA 5HR7A 5J0UA 5AI9A 3AU6A 1TAQA 1ZD5A 2W54A 4KLSA 3IHQB 4ECTA 4I29A 2AGQA 3LVVA 4DSEA 1Q46A 4R66A 1L8LA 4P4PA 2OCEA 3N97B 2EZZA 2HHSA 4B9NA 5DGBA 3ZDCA 5DDYA 3T5JA 2K4IA 4Y2PA 3UPQA 4DS5A 5KFGA 4KLGA 2ZUCA 8ICOA 4MFFA 1S9FA 4RUCA 5ALRA 3RH6A 3QZ7A 3ORYA 2FLPA 1HEKA 4IRDA 3GILA 4P0QB 3Q8KA 4KLLA 2ZTDA 1ZQ1C 7ICNA 1EXNA 3PMNA 3J81j 2W55A 3G6VA 3H4DA 4F2SA 4FZNA 4GC6A 1VJ5A 5KFFA 3RBDA 4B9UA 4IC9A 4ED1A 4DL6A 2K8AA 1KN5A 1IG6A 2DFLA 5CA7A 2JEJA 1LKYB 3MBYA 2KSOA 3I76A 1NJWA 3OJUA 4BDPA 5AK3A 5AM4A 2LKYA 4QZEA 4Y2TA 1RYRA 3QU2A 1WUDA 2Q0ZX 5F9NA 3ZI4A 4EYIB 1NJXA 4EBCA 4CE6A 3F2DA 3C1ZA 5J2GA 3RAXA 2Y1IA 5GTHU 1U45A 3ISDA 3BZKA 1TVAA 2AGOA 1X9MA 2IBKA 2UVVA 3AQFA 2OYYA 3C2KA 3ZDBA 1U47A 5AI8A 4RNNA 9ICAA 4UB4A 4G9BA 2YQEA 1K1SA 2PMZF 2BKEA 3MGIA 3RJEA 5FP0A 3LVWA 4QZFA 1HUZA 1ZQRA 1ZQSA 1ZD3A 2HHWA 3QUTA 4RQ8A 4F4XA 1OUQA 2NRWA 2WAQF 5EWEA 1SKRA 5EE0A 4CCHA 2KK0A 4Z6EA 5AI0A 3SZ2A 4I2BA 4GFJA 5KT6A 4AYBF 3U26A 5ALPA 1L3TA 2KFNA 1BGXT 1VLBA 4KITB 4M9HA 5CR0A 4NL9C 3PMLA 3UMGA 3HRDD 1ZQNA 2JV3A 5KL1B 1CI4A 4PGQA 4JV2A 1ZQOA 4RQ7A 9ICQA 3NS1A 3KFUF 1COOA 5KL8B 2KJ8A 2OHFA 7ICEA 5J0PA 4YR2A 1FIQA 5H2FU 1NK9A 1FEZA 1WCLA 2ZG6A 4OJ6A 1D8BA 4MFCA 3KD3A 3H8WA 5DLFA 2VA2A 8ICZA 5CEHA 4FS1A 1XO1A 1LKYA 2W7OA 2RP5A 1ZQWA 2BHNA 2BPCA 1SV0A 2OEHA 1IIPA 2IMWP 2MU2A 1Z4NA 3KKAC 2R8GA 2HI0A 4QZCA 5J0QA 4EX7A 1Z1BA 1SL1A 3WKAA 4C7YA 3AU2A 2E8NA 4ED8A 1VDVA 4RQ6A 9ICCA 2B6GA 4ZH4A 4QWDA 2HHTA 3FC4A 4JUZA 3LWMA 1QSYA 1XSLA 4M9GA 3QYPA 8ICNA 4TQSA 2P35A 4OJ5A 1ZD2P 1X6IA 4M6WB 4FS2A 4TUPA 4QZBA 1N2XA 4QW9A 4TUSA 1H38A 4I28A 5ALVA 5ALSA 4PPXA 1Y88A 4F5PA 1UT5A 2EAPA 5AM3A 4DF8A 4YMNA 3IG5A 4J9MA 2E3TA 2G06A 3QU4A 4ELTA 2YB4A 5L1IA 4M9LA 5ALGA 1SXEA 2W43A 2XCAA 3GZFA 5JU5A 2KN7A 5L1KA 2KZ3A 3MR2A 5KFZA 3L4PA 5CP2A 4BWMA 1OXJA 2A1JB 4E0DA 4EYHB 2KHQA 1QQ6A 3C29A 4DFJA 1B22A 1XO0A 3GV5B 4B6JA 1NJZA 1A0PA 2IHMA 3PX0A 4F93B 3JPQA 2QKQA 2ISPA 1UCVA 2EH9A 7ICJA 1BNOA 1YT3A 3RRHA 3CP8A 5ALLA 3CNHA 2HOIA 2BQ3A 2E8OA 3BQ0A 3A0BU 4J9KA 1X9SA 1RZTA 2DBYA 2AH5A 3M9NB 5ALDA 2MSNA 4WJ3B 8ICKA 2D8CA 4C8NA 4Y2RA 4MFAA 4O3NA 3MR6A 4UAWA 3PV8A 5DDMA 2AHOB 2JEGA 1JROA 4ED6A 4DFKA 4J9RA 1QSLA 1M6YA 2E8MA 4QZHA 3H0RB 4I2FA 5J2AA 3IP4B 4KMUA 2W9CB 4G3IA 4M6WA 4JWMA 4RQ3A 2E1FA 1J2NA 4KLIA 2KD1A 3NRWA 4YCXA 3GV7B 1S77D 4YP3A 4Q8EA 1V38A 2H3FA 2JGAA 1X6JA 2R8IA 3NVYA 4J03A 2D6FC 4MF8A 4CNQA 3TARA 3KZIU 1JX4A 3SENA 1NZPA 1NK7A 2WFAA 5KFRA 4XQ8A 1PK3A 5AM0A 3JPPA 4AP9A 2W04A 1B4FA 4MEYA 1TAUA 4I2IA 3UXPA 3UMCA 4NLZA 1KRPA 1U9LA 3AQEA 2K8BB 3C1YA 3PSFA 4J9NA 4UB3A 7ICFA 4O5EA 4F91B 3M9MB 4GXIA 2JZBB 5KFBA 5DQHA 2ZUDA 4CRXA 1JRPA 1NNLA 2MA1A 3KHRA 5KFJA 3UXOA 3LYSA 2I6XA 3C21A 3ISBA 1GO3F 4PHEA 4DEZA 1MSWD 1SV0C 2K4PA 3TI0A 4DFDA 5KFTA 2KVSA 1OW5A 5ALHA 5CHGA 5D46A 4P0PA 2BDPA 5G5GA 3QUQA 3WKDA 1KW4A 1S8OA 2YMPA 4YFKA 3C2LA 4HAIA 4IL6U 4YR0A 4KLOA 2W9BA 1XWLA 1V97A 2A19A 4FE3A 5AKIA 3DDHA 3NVWA 3KHGA 3RJHA 2HBMA 3C28A 5BPCA 5TISU 1X42A 4KLJA 4F5QA 4J9QA 4O3OA 1ZJMA 4O5KA 4F2RA 5J2CA 1SWVA 2JMGA 5EOZA 3RR8A 4QZDA 1ZQEA 1LVHA 3GV8B 2GOLA 1SZPA 2FLNA 4I2HA 4Z6CA 3VC8A 2RRDA 2OXOA 4K4HA 2VIXA 5ALJA 5J2BA 4DQRA 4FBUA 3GIJA 2GO7A 4PH5A 5KT7A 4Q44A 5HMLA 3PW4A 2C22A 1NK6A 2FLLA 3SAFA 2ZXIA 7ICSA 1MQ2A 5IILA 4AYBC 4Y2QA 5KFNA 4YG2A 1ZRMA 5DG8A 3QUBA 2LYAA 1K1QA 2IOFK 1KFTA 3GU3A 4KX3A 2HOFA 2OH2A 4QNLA 5GTIU 2HHUA 4O3MA 1Z19A 4BJQA 3EUB2 4RNOA 4NL9A 3LK9A 4I2EA 5J0SA 4M9JA 3HX0A 1B43A 2XY7A 1QLNA 2J6SA 1KSPA 1COKA 3FAHA 3ZDDA 2XY6A 4QZ8A 5EWFA 4IQTA 4DS4A 3TFSA 1ZQAA 4PGYA 2AJQA 8ICGA 8ICVA 3B9JA 3IRUA 9ICOA 1SGGA 1F0MA 1RM6C 3JPTA 4LVSA 2C28A 2K4EA 4EZ9A 3RB4A 3BS7A 2H3VA 5ALXA 3KKAA 3JPRA 5KG1A 2VA3A 2G5HB 1SWWA 4O9MA 5KFMA 3RJKA 4YMOA 1PK1A 4MHVA 1YZ7A 3LWLA 3M9OB 4O5CA 3L5KA 4U7CA 3PNCA 4DOBA 3BJYA 2ZIXB 2YMMA 3QNMA 2AGPA 3JPNA 4UQGA 2BPGA 2IOHA 2JEIA 1Q3VA 1ZQYA 1J97A 5DGAA 4YR3A 4UBBA 2DWQA 5JUMA 1ZQPA 5IINA 3KHHA 2ZIUB 2ZJ5A 4YXMA 2F1JA 5HHHA 2NRXA 2ISOA 2F76X 1IV8A 8ICFA 5AKGA 4KLTA 2LI6A 3NRZA 9ICNA 3GIIA 1JMSA 2R8HA 9ICTA 3V6JA 3M7DA 1UA0A 3GIKA 3TACB 2XIDA 4OO1J 4F50A 4EELA 1XSPA 3V72A 2F1IA 3K1RB 1YZ6A 2ASLA 8ICPA 4CGZA 9ICWA 1J2MA 1UT8A 5KT2A 1ZQVA 2PKEA 2LBOA 3NASA 2MUTB 5KAFU 3PR4A 3WK9A 2YY6A 5KFEA 2FE9A 4Y2YA 3RBEA 2V4RA 1JIHA 4ECWA 4IRKA 4RU9A 4KLFA 2Y1JA 1ZQGA 3N7PD 3BS5A 4PZOA 4K4IA 1UQVA 4FZMA 3M6ZA 1BPYA 4F3OA 4RZRA 1BNPA 1SZHA 4DF4A 4BXOB 4PZNA 2RDJA 4PJ0U 5AM5A 3G6XA 4ACOA 3RJGA 3D2SA 3V7JA 2F77X 2FMSA 4R8UB 2KE7A 5D49A 2B0CA 2KEYA 2ZIXA 1TAMA 2KFZA 3S6JA 2Y9TA 5KT5A 3MR3A 3MDAA 2HHXA 1U4BA 3HP6A 2JXJA 1JALA 4IQUA 9ICRA 1AQ6A 2V9WA 3QZ8A 2ASDA 2ZIUA 2ZIWB 2KG5A 1MA7A 2CXYA 4C8OA 2W3RA 2C2DA 4NV0A 3RJJA 2OWOA 1SIJA 5ALKA 1QCKA 2XGQA 3BQ2A 5T14A 2DPJA 1KDHA 4I2AA 4C7ZA 2E5SA 3PSIA 2VA8A 4OD0A 3F5AA 3Q8LA 4FBTA 4P0QA 3R9KA 3SV3A 4DOCA 4ED0A 2KICA 2PFOA 1SV4A 3L3FX 4NLKA 5DB6A 4C4RA 1RYUA 4DQPA 2XVTA 3HPOA 1JUDA 1BPEA 8ICXA 1Z00B 1Z1VA 2F1HA 4OJLA 3H8MA 5CRXA 4EEYA 2J6UA 3BQ7A 3UQ0A 2HBKA 3F53A 1RDFA 1ZQCA 4YVZA 2NO5A 4DSLA 5ALOA 3ISCA 2ESEA 1ZQQA 4DL2A 2F8LA 5DG7A 5J0TA 3MGVA 5AM1A 5KFQA 2W3SA 2ATLA 2M9NA 1FFVA 3T5LA 3NUQA 2FMPA 1XSNA 1L7OA 3QEBZ 2I5HA 2BCSA 2K4HA 2QB0B 3OPXA 3T79A 1X2IA 2DKXA 3OJSA 5ALZA 2O6KA 5ALMA 3JPOA 2ZUBA 4KTQA 9ICMA 5AHXA 1KL9A 2QLTA 2LYHA 2ZIVB 2XGPA 2UVWA 2I1QA 3UQ2A 3V6KA 3PO5A 4NLGA 5KG0A 4Q8FA 1S10A 2ZIWA 2WF5A 1L7MA 3ICXA 4QWAA 2EZXA 3QE9Y 5L1MA 1DRGA 4UW9A 2FPMA 2NRVA 1Q3UA 2Y0SC 4C8KA 4PHAA 4R65A 1PVQA 4F4YA 2CN1A 4BX9C 8ICSA 5JTIA 1CRXA 3ETLA 4O3QA 1RXWA 5DB8A 4RQ0A 4R64A 2NV3A 2VJ5A 4M04A 2JHDA 5ALTA 4YQWA 5K4LA 2BQRA 2RHFA 2NRZA 3K75D 3V7KA 2F2AB 3PX6A 3T5KA 4TURA 5DKWA 4EENA 4IQWA 8ICQA 1Z3EB 4ECRA 2L5YA 5DBCA 2FMQA 4NLNA 8ICRA 4B9SA 2KIWA 3AEVA 2DQNB 5J8YC 4Z6DA 3BQ1A 3E0FA 1V85A 3SI8A 1S0MA 9ICEA 2EAMA 1QQ7A 3SD7A 1ZQBA 4DFMA 4ELUA 2NO4A 1HUOA 9ICIA 9ICXA 1T3NA 4YD1A 2Z7JA 3H0LB 2M0NA 1T94A 3N7RC 1XU4A 3AM9A 1V9PA 4UB6U 2PI4A 3AN1A 2MRLA 3WK6A 2WB1C 2PFPA 4GXJA 2KMDA 2DL0A 2FPKA 4UASA 2BR0A 1WWVA 2YMLA 4F72A 1L8OA 1N56A 2LYBA 4Z6FA 4O3SA 2HVIA 3HT3A 4F5NA 3TAPA 5ALUA 2JR5A 2ZIVA 4EX6A 3RR7A 3TFRA 4B9MA 2VANA 2HDOA 4F4KA 1ZD4A 3F2CA 2KV2A 3C5FA 4Q45A 3OHAA 8ICUA 3PVXA 1ECWA 2LMRA 5J2IA 4RQ2A 2GH1A 2ZJ8A 4B9VA 5DB9A 4UARA 1TK8A 2W11A 3WKEA 2AU0A 1N48A 5C0YA 1ZJNA 4DSKA 4NLCA 1SB3C 3UMBA 2YTUA 5DBBA 1K5OA 4C4TA 2HBJA 1L5UA 4LZDA 3ALRA 3OGUA 2R8JA 2A1JA 2VKQA 5DB7A 4USAA 2BZFA 5KG3A 4FO6A 4DSJA 5KG6A 1BPBA 4RPYA 2EDUA 4RT3A 3Q8SB 5KNIA 1DGSA 2H3ZA 3E2EA 2HSZA 5J2JA 5DQIA 2KP7A 2D3DA 2WF8A 1ZQFA 7ICHA 2W7PA 4UB5A 8ICEA 2AXTU 3H8JA 5AK4A 5DQGA 3KTQA 5BOLA 1ZYQA 8ICIA 4QZ9A 3H0MB 5AI4A 5KFDA 3RJFA 4UBCA 2KZZA 3HWTA 7ICKA 4ECYA 2PMZC 4DSFA 3MGHA 4C80A 4M2YA 5L9XA 4DLGA 2BPFA 5IIMA 2W9CA 4OJOA 9ICJA 7ICGA 3V6HA 2WAQC 9ICLA 3PZPA 4Y2UA 2JEFA 5KTQA 1N61A 5KFPA 1TV9A 4B9TA 5AIAA 4EBDA 8ICTA 5AKZA 2BCVA 4ZOHC
chains in the Genus database with same CATH topology
4UB8U 3WU2U 3KZIU 5KAFU 5KAIU 3A0BU 4PJ0U 2DUYA 5TISU 5B66U 5GTIU 2AXTU 4UB6U 5B5EU 3A0HU 5H2FU 1S5LU 5E79U 5GTHU 4IL6U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 U;  3WU2 U;  3KZI U;  5KAF U;  5KAI U;  3A0B U;  4PJ0 U;  2DUY A;  5TIS U;  5B66 U;  5GTI U;  2AXT U;  4UB6 U;  5B5E U;  3A0H U;  5H2F U;  1S5L U;  5E79 U;  5GTH U;  4IL6 U; 
#chains in the Genus database with same CATH topology
 4KLE A;  1RPL A;  1X9X A;  4GIB A;  1ED1 A;  4CF4 A;  4I2G A;  3KZX A;  4JV1 A;  4ED3 A;  5KFA A;  5HMM A;  4UAT A;  1BPD A;  5IIJ A;  3I28 A;  3C5G A;  4F4W A;  5L1L A;  4XRH A;  1JXL A;  3EPI A;  3IV6 A;  1UA1 A;  4TUQ A;  3EPG A;  1PZN A;  4M47 A;  2LPE A;  1DOQ A;  4J9P A;  7ICR A;  2KIV A;  4C4S A;  2JZB A;  4QWE A;  3PW5 A;  4GLX A;  1NI3 A;  1X66 A;  1T3Q A;  2RQ5 A;  9ICK A;  1S0V A;  4KLU A;  1UPH A;  2IOF A;  4ECU A;  4F92 B;  5EE3 A;  3QU5 A;  1TKD A;  1RG6 A;  2FPL A;  3M8S A;  3RJI A;  4RUA A;  1URJ A;  3SQI A;  1UHU A;  3THV A;  4DQS A;  2G08 A;  2VJ4 A;  4QZA A;  1SL2 A;  4QZI A;  4UAY A;  1LB2 B;  4EBE A;  1IXR A;  4FZL A;  5ALN A;  4DFP A;  5AKK A;  1T8E A;  3UXN A;  4KLQ A;  1S76 D;  5EE1 A;  2NYV A;  2KKV A;  1RXV A;  2WTF A;  4ICA A;  4NY8 A;  2HMX A;  4ED2 A;  4GC7 A;  3QUC A;  5DLG A;  4HYK A;  4JV0 A;  5DBA A;  5J2D A;  5J2H A;  2NRT A;  4QIW F;  1X40 A;  3OTQ A;  2ZTE A;  5KFH A;  4ECQ A;  2CPR A;  2A3V A;  2LHT A;  3RB0 A;  3F2B A;  2YB1 A;  8ICA A;  2G0A A;  5ALF A;  1C7Y A;  2LM4 A;  1NKB A;  4RPX A;  1QQ5 A;  4CF3 A;  5KFW A;  4F5O A;  4OCZ A;  3KOO A;  4O0I A;  4Y2S A;  3H8S A;  5KFL A;  5AK6 A;  4KMO B;  3FM9 A;  4KN4 A;  4DCC A;  2KKP A;  4JB3 A;  2W8K A;  5EWG A;  4F5R A;  2PFQ A;  3KBB A;  4US9 A;  4YXJ A;  3N28 A;  5F9L A;  7ICV A;  4TQR A;  2V4Q A;  1QSS A;  1RYS A;  4IQV A;  4EEK A;  1L6N A;  1NK8 A;  2AQ0 A;  3V7L A;  2W8L A;  3GDX A;  9ICV A;  3HIL A;  1T7P A;  2H3I A;  2F44 A;  1Q8K A;  1NZB A;  3BZC A;  5KFV A;  2RDI A;  3TAN A;  4GXK A;  2ODG A;  9ICF A;  7ICQ A;  9ICH A;  2ASJ A;  5KFO A;  5ALI A;  1XS9 D;  2PXI A;  2R18 A;  2W9A A;  4NM1 A;  5J8Y A;  2YN4 A;  5J0W A;  3Q8Q B;  3MDC A;  4O3R A;  3RTV A;  1ZQT A;  2GLE A;  3RB3 A;  2CRX A;  3KHL A;  1PUZ A;  4NXZ A;  5KT3 A;  1ZQI A;  2KOB A;  3PSP A;  4DL3 A;  1ZQZ A;  5AKH A;  3WK4 A;  4RQ5 A;  1A77 A;  1F44 A;  2HHQ A;  1TFR A;  2BDU A;  9ICU A;  9ICG A;  3LDA A;  3RH5 A;  2PFN A;  5AM2 A;  2JRZ A;  1TK5 A;  4DQI A;  2KHV A;  4Y2J A;  4FFD A;  5KFY A;  5J0X A;  3ETR A;  2JH7 A;  5KFK A;  5AIC A;  4I27 A;  4DQQ A;  2ZTC A;  4LJX A;  3RAQ A;  4QZG A;  3QEA Z;  5KG2 A;  4KLH A;  3HJE A;  5AKJ A;  3UM9 A;  5B66 U;  1JXE A;  1PVP A;  1CUK A;  5J29 A;  1ZQJ A;  2A1A A;  5JRT A;  5J2K A;  2YMQ A;  2N1R A;  3D2N A;  5CB1 A;  4Y2X A;  3CYM A;  3HKZ F;  4A8E A;  1SKW A;  2KJ5 A;  3CW2 C;  1S97 A;  3M6K A;  2XY5 A;  3ZDE A;  2XIC A;  3QX7 A;  1KBU A;  4YMM A;  8ICL A;  3SR6 A;  7ICO A;  4RT2 A;  3FDS A;  4BWJ A;  1S0O A;  4DL7 A;  2FDR A;  3MC1 A;  2KJ9 A;  1ZQL A;  5F3X B;  1N5X A;  4IR1 A;  3WU2 U;  1A6S A;  4I2C A;  8ICM A;  4OJP A;  2ALZ A;  1WCN A;  4CDG A;  2MUT A;  1JI7 A;  1JN3 A;  3Q8M A;  1HJP A;  4DOA A;  4UAZ A;  3PW7 A;  1NK4 A;  4JWN A;  2KZM A;  5C5J A;  3C2M A;  1U49 A;  3WK5 A;  4RNM A;  3C23 A;  5KG5 A;  9ICS A;  2XI9 A;  3F5E A;  3NVV A;  3PX4 A;  4K4G A;  3CRX A;  2G07 A;  1ZQX A;  1DK3 A;  4DWI A;  4F8R A;  7ICI A;  2W03 A;  3M1Y A;  4LZG A;  4BXO A;  2OM6 A;  3T3F A;  4M0A A;  4CF5 A;  4MEX A;  5J2F A;  4R8U A;  2C2E A;  4DL4 A;  1L3U A;  4UAU A;  1QH9 A;  1DGJ A;  3VCB A;  2WHE A;  4Y2V A;  5KAI U;  5HR6 A;  2DPI A;  3WK8 A;  3WK7 A;  1FFU A;  1N63 A;  4ECV A;  2BQU A;  5AKL A;  2BCR A;  1MC8 A;  3DEE A;  2HCF A;  1MQ3 A;  3H4B A;  1XC9 A;  4RPZ A;  4NJ8 A;  2YX8 A;  3RB6 A;  1ZQH A;  7ICU A;  3M8R A;  3SMV A;  4C0Z A;  9ICP A;  1KLN A;  1ZQU A;  1D8Y A;  5AK5 A;  4PL2 A;  1N62 A;  4YN4 A;  1TK0 A;  3SEI A;  3DV9 A;  2ZXH A;  1BVS A;  4I2J A;  3HW8 A;  3QXG A;  5HHI A;  2HHV A;  7ICP A;  5AKE A;  4KLD A;  3IM1 A;  1RQN A;  5KG7 A;  5HNK A;  4QWB A;  1PVR A;  2P6R A;  2DF4 B;  1Z00 A;  4DSI A;  3N7S C;  2EZY A;  4U6P A;  2C2R A;  2ZJA A;  2QAR B;  1N60 A;  4ECX A;  3G6Y A;  5AKX A;  4KLM A;  1L7P A;  3I1Y A;  1BPX A;  5KT4 A;  2JH1 A;  5KFX A;  4IR9 A;  2WF9 A;  3FYH A;  3MAB A;  4US8 A;  1DK2 A;  1ZQK A;  3AL0 B;  3B0X A;  3TKA A;  4ECS A;  4P0P B;  3GQC A;  2J6T A;  7ICT A;  3OSN A;  1L3V A;  4UAV A;  5IIO A;  2HOQ A;  1FO4 A;  1KEJ A;  4IRC A;  2W9B B;  5ALW A;  4ECZ A;  1NK0 A;  3K4G A;  4DL5 A;  1ZQD A;  4NM2 A;  2QB0 A;  4QIW C;  2Q4T A;  4UB8 U;  4XUS A;  3ZDA A;  1SL0 A;  3PR5 B;  2UVU A;  2AQ4 A;  1SKS A;  3OSP A;  5J0R A;  3TAD A;  2G09 A;  3ZD8 A;  4BUG A;  5BOM A;  4PL1 A;  3PW0 A;  1ZXI A;  3MR5 A;  1KFS A;  3RF9 A;  3SAH A;  2EAO A;  4KN7 A;  4NWI A;  3RRG A;  5E79 U;  3H40 A;  2K60 A;  1TE2 A;  3D6J A;  3EYZ A;  2ES6 A;  4P4O A;  1D9F A;  3PY8 A;  3BQT A;  4EZ6 A;  2XCP A;  3RFA A;  2HBL A;  1T4G A;  3IG8 A;  4P2H A;  2R8K A;  4IS7 A;  4J9O A;  4I2D A;  5A0L A;  5KG4 A;  1Z4O A;  1L7N A;  3TQ1 A;  4RQ4 A;  2FJ6 A;  5AKY A;  5J0Y A;  4C8L A;  2E8P A;  4KX5 A;  1HIW A;  1QTM A;  1KQQ A;  5TZV A;  4UB1 A;  2GWS A;  1LV5 A;  2FI1 A;  1RQL A;  2IHN A;  2DKZ A;  2HW3 A;  8ICB A;  2Y9U A;  1ZET A;  5G5H A;  1DXS A;  1A76 A;  3SYZ A;  3Q8R B;  4J9L A;  5B5E U;  3QU9 A;  2B21 A;  3OHB A;  1KFD A;  2QAR A;  2UVR A;  2K89 A;  1MN8 A;  2KTQ A;  1WWU A;  2XC9 A;  3O0F A;  4RQN A;  3IN5 A;  1NOM A;  4PHD A;  4PHP A;  4Q43 A;  2F3N A;  1L3S A;  4MF2 A;  1KKX A;  3GFK B;  1NJY A;  5L1J A;  2RLT A;  3NGD A;  1D8L A;  3Q8P B;  1X9W A;  3NVZ A;  4M9N A;  3NTU A;  5D4B A;  4JMU A;  2DUY A;  3GIM A;  2G5I B;  2WF7 A;  1KTQ A;  3SV4 A;  1PK1 B;  1BPZ A;  2QB1 A;  2EAN A;  3A0H U;  2XO7 A;  3SAG A;  4R63 A;  4YD2 A;  5KFU A;  4QWC A;  5HP4 A;  2BGW A;  4XA5 A;  5J0O A;  1WG8 A;  4ED7 A;  4RQM A;  3HKZ C;  4QW8 A;  3BDP A;  3RH4 A;  2I9G A;  5KFI A;  5J2E A;  4PGX A;  1B0X A;  3E58 A;  8ICW A;  5KFC A;  3K1Z A;  2MAX A;  5KFS A;  3EZ5 A;  3H7I A;  1XNS A;  4ELV A;  8ICC A;  1O03 A;  3WKC A;  2WF6 A;  1NKE A;  2Y0S F;  1O08 A;  1ZRN A;  3ONN A;  2P66 A;  3JPS A;  3EWA A;  5ALQ A;  2PI5 A;  1ARO P;  1C20 A;  4P4M A;  4JK1 A;  2P6U A;  3D2Q A;  2F8K A;  1ZQM A;  2E1E A;  3QU7 A;  8ICH A;  1WYG A;  4DLE A;  3PW2 A;  1IM4 A;  2BCU A;  5ALE A;  8ICJ A;  4NLB A;  5III A;  1CEZ A;  3PST A;  4J9S A;  5CJ7 A;  2IA6 A;  8ICY A;  2H3Q A;  4O3P A;  4F71 A;  2W9M A;  9ICB A;  1U48 A;  4F4Z A;  2K8C B;  3EW9 A;  4B9L A;  3WKB A;  5DG9 A;  3ED5 A;  4DO9 A;  5AIB A;  2KSO B;  2H5X A;  5IIK A;  4X5V A;  1N5W A;  3IDW A;  1F5S A;  1NK5 A;  3B0Y A;  2KNJ A;  2BCQ A;  3BS5 B;  3N4M B;  5CWR A;  1NKC A;  3TAD C;  4RQ1 A;  4QJF B;  3PO4 A;  3MFI A;  5AI5 A;  1P7D A;  3MFH A;  3T5H A;  2DGZ A;  1D9D A;  1SXD A;  3AUO A;  1S0N A;  5AI6 A;  1S5L U;  5EE9 A;  2KVC A;  4BGD A;  2EQY A;  3AMZ A;  4UB2 A;  2WB1 F;  7ICM A;  7ICL A;  3TAQ A;  2HVH A;  2LM1 A;  5ALY A;  3ZD9 A;  1ZOL A;  4C8M A;  5HR7 A;  5J0U A;  5AI9 A;  3AU6 A;  1TAQ A;  1ZD5 A;  2W54 A;  4KLS A;  3IHQ B;  4ECT A;  4I29 A;  2AGQ A;  3LVV A;  4DSE A;  1Q46 A;  4R66 A;  1L8L A;  4P4P A;  2OCE A;  3N97 B;  2EZZ A;  2HHS A;  4B9N A;  5DGB A;  3ZDC A;  5DDY A;  3T5J A;  2K4I A;  4Y2P A;  3UPQ A;  4DS5 A;  5KFG A;  4KLG A;  2ZUC A;  8ICO A;  4MFF A;  1S9F A;  4RUC A;  5ALR A;  3RH6 A;  3QZ7 A;  3ORY A;  2FLP A;  1HEK A;  4IRD A;  3GIL A;  4P0Q B;  3Q8K A;  4KLL A;  2ZTD A;  1ZQ1 C;  7ICN A;  1EXN A;  3PMN A;  3J81 j;  2W55 A;  3G6V A;  3H4D A;  4F2S A;  4FZN A;  4GC6 A;  1VJ5 A;  5KFF A;  3RBD A;  4B9U A;  4IC9 A;  4ED1 A;  4DL6 A;  2K8A A;  1KN5 A;  1IG6 A;  2DFL A;  5CA7 A;  2JEJ A;  1LKY B;  3MBY A;  2KSO A;  3I76 A;  1NJW A;  3OJU A;  4BDP A;  5AK3 A;  5AM4 A;  2LKY A;  4QZE A;  4Y2T A;  1RYR A;  3QU2 A;  1WUD A;  2Q0Z X;  5F9N A;  3ZI4 A;  4EYI B;  1NJX A;  4EBC A;  4CE6 A;  3F2D A;  3C1Z A;  5J2G A;  3RAX A;  2Y1I A;  5GTH U;  1U45 A;  3ISD A;  3BZK A;  1TVA A;  2AGO A;  1X9M A;  2IBK A;  2UVV A;  3AQF A;  2OYY A;  3C2K A;  3ZDB A;  1U47 A;  5AI8 A;  4RNN A;  9ICA A;  4UB4 A;  4G9B A;  2YQE A;  1K1S A;  2PMZ F;  2BKE A;  3MGI A;  3RJE A;  5FP0 A;  3LVW A;  4QZF A;  1HUZ A;  1ZQR A;  1ZQS A;  1ZD3 A;  2HHW A;  3QUT A;  4RQ8 A;  4F4X A;  1OUQ A;  2NRW A;  2WAQ F;  5EWE A;  1SKR A;  5EE0 A;  4CCH A;  2KK0 A;  4Z6E A;  5AI0 A;  3SZ2 A;  4I2B A;  4GFJ A;  5KT6 A;  4AYB F;  3U26 A;  5ALP A;  1L3T A;  2KFN A;  1BGX T;  1VLB A;  4KIT B;  4M9H A;  5CR0 A;  4NL9 C;  3PML A;  3UMG A;  3HRD D;  1ZQN A;  2JV3 A;  5KL1 B;  1CI4 A;  4PGQ A;  4JV2 A;  1ZQO A;  4RQ7 A;  9ICQ A;  3NS1 A;  3KFU F;  1COO A;  5KL8 B;  2KJ8 A;  2OHF A;  7ICE A;  5J0P A;  4YR2 A;  1FIQ A;  5H2F U;  1NK9 A;  1FEZ A;  1WCL A;  2ZG6 A;  4OJ6 A;  1D8B A;  4MFC A;  3KD3 A;  3H8W A;  5DLF A;  2VA2 A;  8ICZ A;  5CEH A;  4FS1 A;  1XO1 A;  1LKY A;  2W7O A;  2RP5 A;  1ZQW A;  2BHN A;  2BPC A;  1SV0 A;  2OEH A;  1IIP A;  2IMW P;  2MU2 A;  1Z4N A;  3KKA C;  2R8G A;  2HI0 A;  4QZC A;  5J0Q A;  4EX7 A;  1Z1B A;  1SL1 A;  3WKA A;  4C7Y A;  3AU2 A;  2E8N A;  4ED8 A;  1VDV A;  4RQ6 A;  9ICC A;  2B6G A;  4ZH4 A;  4QWD A;  2HHT A;  3FC4 A;  4JUZ A;  3LWM A;  1QSY A;  1XSL A;  4M9G A;  3QYP A;  8ICN A;  4TQS A;  2P35 A;  4OJ5 A;  1ZD2 P;  1X6I A;  4M6W B;  4FS2 A;  4TUP A;  4QZB A;  1N2X A;  4QW9 A;  4TUS A;  1H38 A;  4I28 A;  5ALV A;  5ALS A;  4PPX A;  1Y88 A;  4F5P A;  1UT5 A;  2EAP A;  5AM3 A;  4DF8 A;  4YMN A;  3IG5 A;  4J9M A;  2E3T A;  2G06 A;  3QU4 A;  4ELT A;  2YB4 A;  5L1I A;  4M9L A;  5ALG A;  1SXE A;  2W43 A;  2XCA A;  3GZF A;  5JU5 A;  2KN7 A;  5L1K A;  2KZ3 A;  3MR2 A;  5KFZ A;  3L4P A;  5CP2 A;  4BWM A;  1OXJ A;  2A1J B;  4E0D A;  4EYH B;  2KHQ A;  1QQ6 A;  3C29 A;  4DFJ A;  1B22 A;  1XO0 A;  3GV5 B;  4B6J A;  1NJZ A;  1A0P A;  2IHM A;  3PX0 A;  4F93 B;  3JPQ A;  2QKQ A;  2ISP A;  1UCV A;  2EH9 A;  7ICJ A;  1BNO A;  1YT3 A;  3RRH A;  3CP8 A;  5ALL A;  3CNH A;  2HOI A;  2BQ3 A;  2E8O A;  3BQ0 A;  3A0B U;  4J9K A;  1X9S A;  1RZT A;  2DBY A;  2AH5 A;  3M9N B;  5ALD A;  2MSN A;  4WJ3 B;  8ICK A;  2D8C A;  4C8N A;  4Y2R A;  4MFA A;  4O3N A;  3MR6 A;  4UAW A;  3PV8 A;  5DDM A;  2AHO B;  2JEG A;  1JRO A;  4ED6 A;  4DFK A;  4J9R A;  1QSL A;  1M6Y A;  2E8M A;  4QZH A;  3H0R B;  4I2F A;  5J2A A;  3IP4 B;  4KMU A;  2W9C B;  4G3I A;  4M6W A;  4JWM A;  4RQ3 A;  2E1F A;  1J2N A;  4KLI A;  2KD1 A;  3NRW A;  4YCX A;  3GV7 B;  1S77 D;  4YP3 A;  4Q8E A;  1V38 A;  2H3F A;  2JGA A;  1X6J A;  2R8I A;  3NVY A;  4J03 A;  2D6F C;  4MF8 A;  4CNQ A;  3TAR A;  3KZI U;  1JX4 A;  3SEN A;  1NZP A;  1NK7 A;  2WFA A;  5KFR A;  4XQ8 A;  1PK3 A;  5AM0 A;  3JPP A;  4AP9 A;  2W04 A;  1B4F A;  4MEY A;  1TAU A;  4I2I A;  3UXP A;  3UMC A;  4NLZ A;  1KRP A;  1U9L A;  3AQE A;  2K8B B;  3C1Y A;  3PSF A;  4J9N A;  4UB3 A;  7ICF A;  4O5E A;  4F91 B;  3M9M B;  4GXI A;  2JZB B;  5KFB A;  5DQH A;  2ZUD A;  4CRX A;  1JRP A;  1NNL A;  2MA1 A;  3KHR A;  5KFJ A;  3UXO A;  3LYS A;  2I6X A;  3C21 A;  3ISB A;  1GO3 F;  4PHE A;  4DEZ A;  1MSW D;  1SV0 C;  2K4P A;  3TI0 A;  4DFD A;  5KFT A;  2KVS A;  1OW5 A;  5ALH A;  5CHG A;  5D46 A;  4P0P A;  2BDP A;  5G5G A;  3QUQ A;  3WKD A;  1KW4 A;  1S8O A;  2YMP A;  4YFK A;  3C2L A;  4HAI A;  4IL6 U;  4YR0 A;  4KLO A;  2W9B A;  1XWL A;  1V97 A;  2A19 A;  4FE3 A;  5AKI A;  3DDH A;  3NVW A;  3KHG A;  3RJH A;  2HBM A;  3C28 A;  5BPC A;  5TIS U;  1X42 A;  4KLJ A;  4F5Q A;  4J9Q A;  4O3O A;  1ZJM A;  4O5K A;  4F2R A;  5J2C A;  1SWV A;  2JMG A;  5EOZ A;  3RR8 A;  4QZD A;  1ZQE A;  1LVH A;  3GV8 B;  2GOL A;  1SZP A;  2FLN A;  4I2H A;  4Z6C A;  3VC8 A;  2RRD A;  2OXO A;  4K4H A;  2VIX A;  5ALJ A;  5J2B A;  4DQR A;  4FBU A;  3GIJ A;  2GO7 A;  4PH5 A;  5KT7 A;  4Q44 A;  5HML A;  3PW4 A;  2C22 A;  1NK6 A;  2FLL A;  3SAF A;  2ZXI A;  7ICS A;  1MQ2 A;  5IIL A;  4AYB C;  4Y2Q A;  5KFN A;  4YG2 A;  1ZRM A;  5DG8 A;  3QUB A;  2LYA A;  1K1Q A;  2IOF K;  1KFT A;  3GU3 A;  4KX3 A;  2HOF A;  2OH2 A;  4QNL A;  5GTI U;  2HHU A;  4O3M A;  1Z19 A;  4BJQ A;  3EUB 2;  4RNO A;  4NL9 A;  3LK9 A;  4I2E A;  5J0S A;  4M9J A;  3HX0 A;  1B43 A;  2XY7 A;  1QLN A;  2J6S A;  1KSP A;  1COK A;  3FAH A;  3ZDD A;  2XY6 A;  4QZ8 A;  5EWF A;  4IQT A;  4DS4 A;  3TFS A;  1ZQA A;  4PGY A;  2AJQ A;  8ICG A;  8ICV A;  3B9J A;  3IRU A;  9ICO A;  1SGG A;  1F0M A;  1RM6 C;  3JPT A;  4LVS A;  2C28 A;  2K4E A;  4EZ9 A;  3RB4 A;  3BS7 A;  2H3V A;  5ALX A;  3KKA A;  3JPR A;  5KG1 A;  2VA3 A;  2G5H B;  1SWW A;  4O9M A;  5KFM A;  3RJK A;  4YMO A;  1PK1 A;  4MHV A;  1YZ7 A;  3LWL A;  3M9O B;  4O5C A;  3L5K A;  4U7C A;  3PNC A;  4DOB A;  3BJY A;  2ZIX B;  2YMM A;  3QNM A;  2AGP A;  3JPN A;  4UQG A;  2BPG A;  2IOH A;  2JEI A;  1Q3V A;  1ZQY A;  1J97 A;  5DGA A;  4YR3 A;  4UBB A;  2DWQ A;  5JUM A;  1ZQP A;  5IIN A;  3KHH A;  2ZIU B;  2ZJ5 A;  4YXM A;  2F1J A;  5HHH A;  2NRX A;  2ISO A;  2F76 X;  1IV8 A;  8ICF A;  5AKG A;  4KLT A;  2LI6 A;  3NRZ A;  9ICN A;  3GII A;  1JMS A;  2R8H A;  9ICT A;  3V6J A;  3M7D A;  1UA0 A;  3GIK A;  3TAC B;  2XID A;  4OO1 J;  4F50 A;  4EEL A;  1XSP A;  3V72 A;  2F1I A;  3K1R B;  1YZ6 A;  2ASL A;  8ICP A;  4CGZ A;  9ICW A;  1J2M A;  1UT8 A;  5KT2 A;  1ZQV A;  2PKE A;  2LBO A;  3NAS A;  2MUT B;  5KAF U;  3PR4 A;  3WK9 A;  2YY6 A;  5KFE A;  2FE9 A;  4Y2Y A;  3RBE A;  2V4R A;  1JIH A;  4ECW A;  4IRK A;  4RU9 A;  4KLF A;  2Y1J A;  1ZQG A;  3N7P D;  3BS5 A;  4PZO A;  4K4I A;  1UQV A;  4FZM A;  3M6Z A;  1BPY A;  4F3O A;  4RZR A;  1BNP A;  1SZH A;  4DF4 A;  4BXO B;  4PZN A;  2RDJ A;  4PJ0 U;  5AM5 A;  3G6X A;  4ACO A;  3RJG A;  3D2S A;  3V7J A;  2F77 X;  2FMS A;  4R8U B;  2KE7 A;  5D49 A;  2B0C A;  2KEY A;  2ZIX A;  1TAM A;  2KFZ A;  3S6J A;  2Y9T A;  5KT5 A;  3MR3 A;  3MDA A;  2HHX A;  1U4B A;  3HP6 A;  2JXJ A;  1JAL A;  4IQU A;  9ICR A;  1AQ6 A;  2V9W A;  3QZ8 A;  2ASD A;  2ZIU A;  2ZIW B;  2KG5 A;  1MA7 A;  2CXY A;  4C8O A;  2W3R A;  2C2D A;  4NV0 A;  3RJJ A;  2OWO A;  1SIJ A;  5ALK A;  1QCK A;  2XGQ A;  3BQ2 A;  5T14 A;  2DPJ A;  1KDH A;  4I2A A;  4C7Z A;  2E5S A;  3PSI A;  2VA8 A;  4OD0 A;  3F5A A;  3Q8L A;  4FBT A;  4P0Q A;  3R9K A;  3SV3 A;  4DOC A;  4ED0 A;  2KIC A;  2PFO A;  1SV4 A;  3L3F X;  4NLK A;  5DB6 A;  4C4R A;  1RYU A;  4DQP A;  2XVT A;  3HPO A;  1JUD A;  1BPE A;  8ICX A;  1Z00 B;  1Z1V A;  2F1H A;  4OJL A;  3H8M A;  5CRX A;  4EEY A;  2J6U A;  3BQ7 A;  3UQ0 A;  2HBK A;  3F53 A;  1RDF A;  1ZQC A;  4YVZ A;  2NO5 A;  4DSL A;  5ALO A;  3ISC A;  2ESE A;  1ZQQ A;  4DL2 A;  2F8L A;  5DG7 A;  5J0T A;  3MGV A;  5AM1 A;  5KFQ A;  2W3S A;  2ATL A;  2M9N A;  1FFV A;  3T5L A;  3NUQ A;  2FMP A;  1XSN A;  1L7O A;  3QEB Z;  2I5H A;  2BCS A;  2K4H A;  2QB0 B;  3OPX A;  3T79 A;  1X2I A;  2DKX A;  3OJS A;  5ALZ A;  2O6K A;  5ALM A;  3JPO A;  2ZUB A;  4KTQ A;  9ICM A;  5AHX A;  1KL9 A;  2QLT A;  2LYH A;  2ZIV B;  2XGP A;  2UVW A;  2I1Q A;  3UQ2 A;  3V6K A;  3PO5 A;  4NLG A;  5KG0 A;  4Q8F A;  1S10 A;  2ZIW A;  2WF5 A;  1L7M A;  3ICX A;  4QWA A;  2EZX A;  3QE9 Y;  5L1M A;  1DRG A;  4UW9 A;  2FPM A;  2NRV A;  1Q3U A;  2Y0S C;  4C8K A;  4PHA A;  4R65 A;  1PVQ A;  4F4Y A;  2CN1 A;  4BX9 C;  8ICS A;  5JTI A;  1CRX A;  3ETL A;  4O3Q A;  1RXW A;  5DB8 A;  4RQ0 A;  4R64 A;  2NV3 A;  2VJ5 A;  4M04 A;  2JHD A;  5ALT A;  4YQW A;  5K4L A;  2BQR A;  2RHF A;  2NRZ A;  3K75 D;  3V7K A;  2F2A B;  3PX6 A;  3T5K A;  4TUR A;  5DKW A;  4EEN A;  4IQW A;  8ICQ A;  1Z3E B;  4ECR A;  2L5Y A;  5DBC A;  2FMQ A;  4NLN A;  8ICR A;  4B9S A;  2KIW A;  3AEV A;  2DQN B;  5J8Y C;  4Z6D A;  3BQ1 A;  3E0F A;  1V85 A;  3SI8 A;  1S0M A;  9ICE A;  2EAM A;  1QQ7 A;  3SD7 A;  1ZQB A;  4DFM A;  4ELU A;  2NO4 A;  1HUO A;  9ICI A;  9ICX A;  1T3N A;  4YD1 A;  2Z7J A;  3H0L B;  2M0N A;  1T94 A;  3N7R C;  1XU4 A;  3AM9 A;  1V9P A;  4UB6 U;  2PI4 A;  3AN1 A;  2MRL A;  3WK6 A;  2WB1 C;  2PFP A;  4GXJ A;  2KMD A;  2DL0 A;  2FPK A;  4UAS A;  2BR0 A;  1WWV A;  2YML A;  4F72 A;  1L8O A;  1N56 A;  2LYB A;  4Z6F A;  4O3S A;  2HVI A;  3HT3 A;  4F5N A;  3TAP A;  5ALU A;  2JR5 A;  2ZIV A;  4EX6 A;  3RR7 A;  3TFR A;  4B9M A;  2VAN A;  2HDO A;  4F4K A;  1ZD4 A;  3F2C A;  2KV2 A;  3C5F A;  4Q45 A;  3OHA A;  8ICU A;  3PVX A;  1ECW A;  2LMR A;  5J2I A;  4RQ2 A;  2GH1 A;  2ZJ8 A;  4B9V A;  5DB9 A;  4UAR A;  1TK8 A;  2W11 A;  3WKE A;  2AU0 A;  1N48 A;  5C0Y A;  1ZJN A;  4DSK A;  4NLC A;  1SB3 C;  3UMB A;  2YTU A;  5DBB A;  1K5O A;  4C4T A;  2HBJ A;  1L5U A;  4LZD A;  3ALR A;  3OGU A;  2R8J A;  2A1J A;  2VKQ A;  5DB7 A;  4USA A;  2BZF A;  5KG3 A;  4FO6 A;  4DSJ A;  5KG6 A;  1BPB A;  4RPY A;  2EDU A;  4RT3 A;  3Q8S B;  5KNI A;  1DGS A;  2H3Z A;  3E2E A;  2HSZ A;  5J2J A;  5DQI A;  2KP7 A;  2D3D A;  2WF8 A;  1ZQF A;  7ICH A;  2W7P A;  4UB5 A;  8ICE A;  2AXT U;  3H8J A;  5AK4 A;  5DQG A;  3KTQ A;  5BOL A;  1ZYQ A;  8ICI A;  4QZ9 A;  3H0M B;  5AI4 A;  5KFD A;  3RJF A;  4UBC A;  2KZZ A;  3HWT A;  7ICK A;  4ECY A;  2PMZ C;  4DSF A;  3MGH A;  4C80 A;  4M2Y A;  5L9X A;  4DLG A;  2BPF A;  5IIM A;  2W9C A;  4OJO A;  9ICJ A;  7ICG A;  3V6H A;  2WAQ C;  9ICL A;  3PZP A;  4Y2U A;  2JEF A;  5KTQ A;  1N61 A;  5KFP A;  1TV9 A;  4B9T A;  5AIA A;  4EBD A;  8ICT A;  5AKZ A;  2BCV A;  4ZOH C; 
#chains in the Genus database with same CATH homology
 4UB8 U;  3WU2 U;  3KZI U;  5KAF U;  5KAI U;  3A0B U;  4PJ0 U;  2DUY A;  5TIS U;  5B66 U;  5GTI U;  2AXT U;  4UB6 U;  5B5E U;  3A0H U;  5H2F U;  1S5L U;  5E79 U;  5GTH U;  4IL6 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...