2A19A

Pkr kinase domain- eif2alpha- amp-pnp complex.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
165
Chain Sequence
SSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
total genus 46
structure length 165
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a19A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a19A01
2WAQG 4JI5L 1PYSB 1PA6A 3TS0A 3H3VI 1IZ6A 2MFIA 3A74A 3AYHB 3T1HL 1Y1VH 3CCLA 3CPWA 1D8LA 3CPFA 4RMFA 3I56A 1TWAH 4LF9Q 2UUCQ 4DV2Q 1Q82C 3PSIA 4LF7L 1DGSA 1EOVA 1VQ6A 4AH6A 5M5WH 1EQRA 3HOZG 3GTQH 3J80c 2QEXA 4X66L 3ULPA 4OX9Q 2VS1A 4YCVA 1PHJA 2UUBL 2E8GA 2YYZA 5C4XH 2A1AA 5H1SE 4A3JH 4UP8A 4YWLA 1AE2A 3AQQA 2HT1A 3PF4A 3HOWG 1YJNA 1L1OB 5FLXc 1QVFA 4IPHA 3M4PA 4A75A 4A3EH 4JYAL 3S1QH 3S24A 1X56A 3D0FA 1VQDA 1EUJA 2JQOA 1SE8A 3BZCA 5DLQE 3T1YQ 1D7QA 3M85A 3OYYA 3PF5A 2EXDA 3NBHB 4XTCS 4DR5Q 5IYCH 2PI2A 3SGIA 4WJ4A 4AYBG 3M3YH 3CC7A 2UXCL 1XPUA 2JE6I 4DR1L 3EIVA 2GN5A 2NVYH 4O2DA 1J6QA 4NXML 3I55A 1HNXQ 2R7ZH 5IYBG 3PIPA 3S1RH 3M7NA 4DR4L 2NN6I 4L5QA 2CKZB 4BBRG 2RHSB 4MNOA 3S15H 4A3BG 3GTJH 1HNZL 1N33L 2ZJQA 3K81C 4GKKL 4IFDI 4MTNA 3GTKH 4JI2L 1KXLA 1GD7A 1C9OA 1K8GA 3S1NH 2I5LX 1X3EA 2R92G 4YHHL 4LF4L 3K7AH 3I2ZA 2Y0SE 4B3SQ 2YV5A 4LFBQ 4DR2Q 2YTVA 3PUXA 1E1TA 1VQJA 2ZJRA 1VQPA 5ELOA 3MEFA 1CUKA 4JI3Q 2K5NA 4YY3Q 2RF4A 5C44G 3CMEA 3PUVA 4LF5L 2ASBA 1LM0A 4IOCA 1BKBA 1NTGA 1G291 5IYBH 5ELNA 5C3EG 1IBLQ 3TS2A 1Z47A 1LUZA 1CKNB 2MO1A 4GLAC 3UE1A 1K8AC 1QUQB 2HIXA 4QQBX 1FJGL 3CQZH 4PZ8A 5J3BA 3UDFA 3A5UA 2NVXH 4A3LG 1Q7YC 4GN5A 3KDFA 1XMOL 1JJCB 3W5OA 1HNWL 4NPSA 1K73C 1IBKL 4A3CH 4UP9A 1TWGH 1GVPA 1XNRQ 5C0XJ 1S3OA 4GOPA 5IP9G 2K5VA 3RNUA 4DR7Q 1G51A 4LF8Q 5IP7G 3HKZG 4PG3A 2VQEQ 2QA4A 1IL2A 4YWMA 1CKOA 3BJUA 1S40A 3B6YA 4P74A 4JI0L 3CMAA 3K7UC 2B3GA 5JEAG 1HZBA 3F8TA 4IPCA 3E9HA 1ASZA 4DUZQ 4JI8Q 1OXUA 3HOVH 3W1GA 2F4VQ 3NENA 1I50H 1SLJA 1PH8A 4DV7L 5LMUQ 3S2HH 4OONA 2QGQA 3AFQA 4YWKA 2VQFQ 2VNUD 1K83H 4GOPC 5GQOA 5JJLA 1WFQA 5BR8Q 4B3RL 2ES2A 2PQAB 1KAWA 5IYDG 1N34Q 4DR6L 3CCSA 4NB3A 1WCMG 2K5HA 5LMNQ 1QVGA 3A5ZB 4R4IA 2HHHQ 2OQKA 3E9IA 1K9MC 4DV0L 3HKSA 3KF6B 4A3KG 1XNQQ 1PH4A 2YTXA 4DAYB 2MNAA 3RZOH 1X55A 2KHIA 1B7YB 4X6AH 4DV1Q 4LF6Q 3JC66 1KC8C 4KHZA 1I94Q 1WJJA 2E2JH 4X65Q 2LXKA 3HOXH 4DV4Q 2ZJPA 1OXXK 1VQKA 3RN2A 5IWAQ 4DUYQ 3TEHB 1NMGA 3OTOQ 4A3IH 4GN3B 3J81i 3CAMA 3AFPA 1VQIA 4KHPQ 1WCMH 1BBUA 3WWVA 1VQ7A 3M4OH 3L7ZC 1HR0W 2K50A 4NXNL 3F2BA 4B3TL 1CSQA 2ALYB 3ULLA 3PUZA 4A3KH 2Y0SG 2VUMG 1ASYA 4UPAA 2UU9L 1N32L 1Y1WG 3S16H 4B3ML 1N36Q 1IBML 2Q2TA 2BA0A 3H0GG 4PZ7A 4A76A 4BA1I 4C3HH 2ATWA 3CCMA 1E7ZA 1E24A 2NZOA 5IY0A 2VW9A 4BY7G 1Q81C 2I0QA 2JA7G 1KQSA 4JI1L 4JI6Q 1I5FA 3HFZB 2IT1A 3PIOA 1VQCA 3RR5A 4POFA 1PH1A 3KOJA 4LUZA 1JE5A 1BBWA 2MQHA 4DR3Q 4LF9L 1VQ5A 2UUCL 4DV2L 2JA8G 3FP9A 4R4QA 4JBMA 1VQMA 2OCEA 2CQOA 1OXTA 3CF5A 4L5RC 4OWWB 1J5EQ 2AWOA 4J15A 3U50C 3M4QA 1HZAA 4L5SA 3HOZH 1L1OA 4OX9L 2UXCQ 1SROA 1LYLA 3F2DA 5FJ8G 3J81j 2IHEA 4DR1Q 4JI7L 3I4OA 1W3SA 4HJ8A 1SMXA 5M5XH 1C0AA 2H5XA 4R4TA 1GM5A 2JA7H 4DR4Q 4PZ6A 2VZAA 3HOWH 3RLOA 3T1YL 1GO3E 3CCVA 1HNZQ 4X62Q 1RIPA 1HZ9A 2E2HH 1VQLA 1HJPA 3STBD 3KJOA 4GNXA 3KF8B 4JI4L 2GVBA 1L1OC 2AWNA 4JG2A 5M3MG 2V1CC 2YU9H 2LSSA 2Q2UA 2PNHA 3U4ZA 2BH2A 1UE5A 1HNXL 1JJGA 4XIGS 1XJVA 4BBSG 2ID0A 1YZ7A 1FL0A 2WAQE 2NZHA 1QZHA 1OXVA 1HR0L 4A3MG 4LF5Q 4TVAB 2N49A 1V1QA 1O7IA 4BBRH 4A3BH 1X6OA 3FKIG 3J81c 1YJ9A 1HZCA 2UXBQ 5LMNW 4A4IA 1YBYA 2ZM6Q 4AQYL 1CSPA 2I5HA 2DGYA 3L0OA 3Q8DA 1KL9A 3GTMH 3F1ZA 3MXNB 1LTLA 2R92H 4GNXC 4P73A 4IO9A 4DR2L 1XMOQ 3KFUA 2UXDQ 1EIFA 1JJ2A 1OTCA 1HNWQ 1YI2A 1XMQQ 2GVAA 2E5LL 1B70B 1A62A 1CKNA 1PYBA 4JI3L 5M3MH 2IX0A 4KI0A 5GROA 1QUQA 4YY3L 1IBKQ 4AIMA 3S17H 3I4NG 4IOAA 3F2CA 4QGUA 4WJ3M 2VY3A 4A3DG 1EQQA 1YJWA 5C44H 4BBSH 5C0XG 3M9BA 1KRSA 5C3EH 2N8NA 2YTYA 5GAHC 3ICEA 1YITA 3ULJA 5AJ3Q 2K75A 3HOYG 5FLMG 3U58A 3JAMi 3FKIH 4JBJA 1E22A 3PO2G 4DPGA 1U0LA 1YZ6A 1MIUA 2CWPA 2NVTH 4JV5Q 1B8AA 1XPRA 1YHBA 1YHQA 2JEBI 5M3FG 3AEVA 2DUDA 4FDBA 2ZTCA 3PGZA 2JA5G 1XNRL 2A8VA 2WB1E 3G48A 1MJEA 4LF8L 5IT9c 2VQEL 1PH3A 3S1MH 1Q1EA 4MZ9A 3RLFA 4K0KQ 5GAGC 1H95A 5IP9H 5IP7H 2F3IA 5EAYA 3K0XA 4GKJQ 4A3DH 1TXYA 2OTLA 1IYJB 3I7FA 3PUWA 4QJFA 4LFAQ 4LW1A 4JI8L 3K80C 2K4KA 2F4VL 5FLMH 1EYGA 1AH9A 2CFMA 4QL5A 2UUAQ 1KRTA 3GDEA 3GTLH 2R93G 1CKMA 2AHOB 3GTPH 5LMUL 1QVCA 4DV5L 3BZKA 4BY1G 2PQAA 1A63A 3PO2H 4HIKA 1VQEA 2KENA 4HJ5A 3I4MG 1UE1A 1PVOA 1JMCA 2JA5H 1N9WA 5BR8L 2FXQA 1Z9FA 1WI5A 4DV6L 4EX5A 3RZDH 3DM3A 4POGA 5HY6A 3H3VH 2A19A 5LMNL 4JI5Q 1VQNA 4LFCL 1SRUA 5IYDH 4P75A 3L2PA 1N8RC 5C0XI 4IJHA 4KLKA 1X3FA 3T1HQ 1EFWA 1YHAA 2EQSA 1UEBA 2RCNA 3GO5A 4L5TA 3W1BA 3OW2A 1NY4A 3DLLA 4IPDA 1S72A 2B29A 4DV1L 1NBWA 1UE6A 2R6GA 4B3TQ 4LF6L 1I94L 4LF7Q 2PMZE 2KCMA 4X64L 1PFSA 2R93H 4HJAA 4A93G 1HH2P 3STBC 1NMFA 4DV4L 4BY1H 4X66Q 1FGUA 2UU9Q 1G6PA 5C4XG 2D62A 4DV3L 1SFOH 4A3JG 5IWAL 3H15A 1L2FA 5IE8A 1PH5A 1U5KA 2B63G 2NN6G 4IFDJ 1FVIA 1X3GA 3CCEA 4HIDA 4HJ9A 2UUBQ 2WFWA 3HKZE 4JBWA 1VQ4A 1YNXA 1MKHA 2IX1A 2Q2HA 2WP8J 4A3EG 1K3RA 4PMWA 4JI1Q 1YEZA 5M5YH 4IFDG 3UDXA 4KHPL 2ZTEA 4EQ5A 4HIMA 4GN4B 1E3PA 4JYAQ 4Y52H 3KYHC 3CCUA 1VQ8A 4OWTB 4Y7NH 1MJCA 1V43A 3E0EA 5IYCG 3HOUG 3PO3G 3UE0A 4DNIA 1GKHA 3JAMc 1UE7A 4O0AA 2E2IH 3PCOB 2EIFA 1V9PA 2VUMH 1N36L 4BXXG 4IPGA 4UP7A 3CP0A 4GLVB 1Y1WH 1PH2A 1Q8KA 4A93H 1VQOA 2R7ZG 1KD1C 1SN8A 3KJPA 3H0GH 1RL2A 4JI7Q 4JI6L 1YVCA 2HIVA 2Z6KA 2B63H 2JEAI 4NXMQ 4BY7H 3G4SA 2I5MX 2AMCB 4GS3A 3TREA 4TQUS 2R7DA 2PI2E 4DR3L 4LNQA 3IRBA 1N33Q 4C2MH 4GKKQ 1PH6A 2K14A 3FHWA 4LWCA 2LXJA 2JA9A 3BU2A 4JI2Q 4C3IH 2D0PA 4C3JH 1VQAA 4DR5L 1J5EL 2JA8H 1XTDA 2ZTDA 4R4CA 1WOCA 4YHHQ 2N78A 4LF4Q 3HOUH 3PO3H 4BA2I 4OO1G 1BVSA 4QIWE 1A8VA 2L15A 3UDIA 2MO0A 4JI4Q 4LUVA 4BXXH 2WB1G 2CCZA 5FJ8H 1VQFA 1PV4A 5GAEC 1Q46A 2Z6KC 3CC2A 3CD6A 4GNXB 1AE3A 4P72A 3S14H 3NELA 5K36G 4R1JA 4H02A 1HR0Q 4X62L 1VQBA 2XTIA 2BH8A 3UDGA 4HJ7A 1VCIA 4A3FG 1FJGQ 4B3SL 3KLWA 2VL6A 4AQYQ 4LFBL 1KHIA 4A3CG 1NE3A 1P8LA 1W2BA 2NVQH 3RN5A 2Q2IA 4IJLA 2OTJA 3CW2C 4HIOA 5JJIA 1M90C 2CWAA 3NEMA 2E5LQ 3LGJA 3KDFB 3J7A5 4A3GG 3K8AA 4JCVE 3ERSX 1IBLL 4JBKA 3ER0A 3PUYA 5GADC 2JA6G 3ZJYC 2RHQB 2UXBL 5C4JH 3CCQA 4GLXA 1X65A 2ZM6L 4OWXB 4A3MH 1QZGA 2D0OA 2KBNA 4GOPB 3HOVG 2KHJA 4JC0A 4JI0Q 2F52A 1E1OA 4YCWA 2Z0SA 3D31A 3EN2A 4RG1A 1L0WA 3J80i 2AKWB 4A3FH 2UXDL 2IY5B 1K0RA 4AYBE 1XMQL 1P16A 1X9NA 4DV7Q 4OO1I 1X54A 4DR7L 1I3QH 3GD7A 3EBEA 3CXCA 1UWVA 4P71A 4A3LH 3PV0A 1TWHH 1VQHA 4ME3A 4DK6C 1TWFH 1Q86C 1VS0A 3I4NH 5JEAJ 1Q1BA 3TRZA 4A3GH 4B3RQ 1OXSC 3A0JA 3GTGH 2JA6H 4JOIA 5AJ3L 4DR6Q 3J7ZC 4R4OA 1WYDA 4YCUA 1PH7A 4DUZL 1C7YA 5HGQA 3HOYH 2HQLA 2KCTA 2N3SA 3G71A 4DV0Q 3TQYA 2IHFA 1IXRA 4JV5L 2C35B 1KIXA 3HOXG 1A0IA 2VQFL 4DV5Q 4DK3C 4QY7A 2R7FA 1T9HA 4OXPA 1I6HH 5M3FH 2OWOA 1EWIA 1NJIC 3KF6A 2K52A 1YIJA 4K0KL 4A3IG 1VQGA 5JJKA 1N34L 1SR3A 1JT8A 4GKJL 4DV6Q 1XPOA 3RLNA 1Y1VG 4JOIC 2HHHL 1PH9A 1Q12A 4LFAL 4LFCQ 5E7NA 1EIYB 1XNQL 4ALPA 1TWCH 3VDYA 3GTOH 2XGTA 2UUAL 4APVA 3CCRA 2JJQA 1JB7A 2BA1A 2JK8A 4NXNQ 2OQ0A 3S2DH 1VQ9A 3CCJA 1M1KC 4DAMA 4X65L 1Y14B 4X64Q 4LUOA 1R9TH 3U4VA 3G6EA 1N32Q 4DKAC 3I4MH 4B3MQ 4DUYL 1IBMQ 4DV3Q 3OTOL 4UY8C 3CC4A
chains in the Genus database with same CATH superfamily
1LTBD 2HUGA 2WAQG 4P2CB 3M8SA 2V4DA 2HI0A 1KDCA 7ICEA 2MFIA 3T1HL 1NR4A 2JV3A 5KYLA 3N7SC 1Y1VH 2AQ2B 3CCLA 3GTPB 1NK4A 3PO2B 4B6JA 4ZUJA 4RPXA 4RMFA 3I56A 4DN4M 3OIPA 4LF9Q 2UUCQ 4EZ9A 4DAVA 3IM1A 4LF7L 4PZOA 1DGSA 4HAIA 5A35A 5M5WH 2HOFA 9ICIA 2AU0A 1ZQTA 3K5LA 3ULPA 2KKPA 4X66L 2QEXA 2QARB 3K58A 3RZDB 1QCKA 4HCSA 4OX9Q 4YCVA 2ENBA 1ILPA 1PHJA 4UAZA 5ALMA 3NTUA 4PQXA 7ICSA 3SVMA 3Q22A 4YWLA 3MWYW 2F0VA 5AIBA 3HOWG 4CGZA 3SI8A 1L1OB 4FS1A 1U48A 3D6WA 4B9MA 3S24A 1QTMA 1DK2A 1EUJA 1BPEA 1SE8A 2DUYA 4BY1B 3OYYA 3PF5A 1JORA 4QZ9A 1SFOB 4J9KA 1DZ1A 2KCCA 4DR5Q 1W6JA 4NWIA 3PNCA 4DOAA 7ICMA 1ZETA 3JPSA 1PVPA 2W3RA 5JVH3 4B9TA 3WKBA 4NXML 1Z3EB 8ICQA 4X3SA 4M1UB 2P5ZX 4QZFA 2R61A 1HQRD 3M7NA 2NN6I 4DR4L 4PH5A 5JAVA 2CKZB 4PPXA 5ALVA 1MGSA 1D8BA 4O0IA 2ZIWB 2V4RA 4MNOA 3S15H 1HNZL 1N33L 1NNLA 2H3ZA 1T8EA 5ALEA 2VB3X 3NTKA 3M9OB 4JI2L 1C9OA 3V7LA 1LVHA 2G5HB 4DF8A 1Y1WB 4A93B 3WU2U 2W9BB 5KFHA 5CMDA 4RWSC 2W3SA 4MEXA 3MXUA 4LFBQ 2HBKA 3PUXA 3H40A 1VQPA 4UW9A 5ELOA 3MR2A 4JI3Q 3KBGA 4Y2XA 2RKSA 4F4YA 2RF4A 5C44G 1URJA 3A8IE 2PW5A 3DEEA 2ASBA 1D1IA 3A0BU 4IOCA 1G291 4C3IB 1PK1A 3TS2A 4OJLA 4C3JB 4F5NA 2JA8B 2MO1A 3UE1A 3HOUB 5EE3A 4PNYA 3SMVA 2WAQC 5J3BA 3UDFA 5JPMC 2KJXA 2KJ8A 4N9PA 1EWHA 3T16A 5CJ7A 2MP1A 4RQ5A 4HYKA 3AB9A 4NPSA 2HHSA 2G9DA 1JALA 3BDCA 3EPIA 1ZQHA 3BVMA 4AP9A 1U4BA 1RF2D 1YT3A 3QYPA 3VYSA 4XQ8A 4EEKA 4GOPA 5IP9G 2K5VA 3Q8PB 3RNUA 1L7OA 4EELA 4LF8Q 2RRDA 2E8MA 2VQEQ 3PVXA 4RQ2A 3ZDCA 3QJYA 8ICLA 5HMMA 3IG5A 3BJUA 3CRLC 1RDPD 3ZDAA 1B3QA 2D2CC 4IPCA 5G5HA 3SEBA 1TY0A 4DUZQ 8ICWA 3OWEB 2F4VQ 4KJNA 1IM4A 2LYHA 1L3UA 4NJ8A 5AKKA 3D2SA 1SLJA 1PH8A 1EQVA 3TKAA 4XUSA 2L5TA 4K5WA 5DLGA 3S2HH 2QGQA 3AFQA 4M8AA 4KLUA 1ZEQX 3D6JA 4GOPC 5JJLA 4DL5A 2K33A 1D6EC 1X42A 4A3MB 1KDBA 3RMHA 1AQ6A 1A77A 4ZH4A 2F76X 4DR6L 3GV3A 3C46A 3JPOA 5DB7A 4NB3A 2Z9HA 1KQQA 5ALGA 2K5HA 2HHHQ 7ICKA 4PGXA 2VB2X 2KZ3A 4ECTA 5ALJA 1K9MC 3HKSA 4CJ2C 4K4HA 4DAYB 2MNAA 2K60A 2NRTA 2EANA 1D1KA 4KD3A 1GOZA 3U9SA 3OWFA 2PCFB 3RJFA 1KEJA 1BPDA 1WJJA 3HOXH 4DV4Q 5IGBA 5I2XA 3GTGB 1Y69U 1FFVA 3OSNA 1NMGA 3W2DA 2OM6A 4C56C 2KA7A 8ICVA 1RM6C 4C8LA 3FPUB 1HRJA 1VMPA 4JMUA 4O3OA 3CAMA 4Z6FA 3N97B 2GLEA 3HRDD 3M7DA 4USAA 3W3AA 3L7ZC 1HR0W 5AKLA 3PQIA 2YY6A 4JV0A 3ULLA 2BE5D 5A0LA 3GILA 4R8IA 1Y1WG 2PZUA 1XC9A 4HR7B 3PW2A 3RAXA 2NYZD 2ATWA 2R8GA 4LZDA 3D2QA 2NZOA 1FNWA 1TKDA 1QNUA 3J81E 5AK6A 4RNOA 4B9NA 3NUCA 1TWCB 5KFBA 2EYFA 4KKUA 3GTOB 2IT1A 1IG6A 2Y9TA 1T4GA 7ICLA 1VQCA 2QARA 3KOJA 3S2DB 3KUPA 1BBWA 2MQHA 4C3IG 2XO7A 1DOLA 2JA8G 4PJ0U 1VQMA 5J2EA 1OXTA 1TK8A 4L5RC 3C5GA 4DNRB 5AKEA 4G7ZC 1L1OA 1E2ZA 1I4PA 4A3IB 2KICA 2M9NA 3RH5A 4YR2A 3J81j 2X69A 1QH9A 4JI7L 4ED0A 3A8KE 2BGWA 4K6LA 4KLHA 2BPFA 4YR3A 4F50A 3MDAA 5J0SA 1SMXA 1ENCA 2H5XA 4DR4Q 1CA5A 5DBCA 4F91B 4PZ6A 5K5PA 1RXVA 1ZYQA 3BZDB 3T1YL 4QWBA 3ZDDA 1GO3E 2KV2A 4OO1J 4X62Q 3CHBD 1HNZQ 4MTKA 3K59A 4Q8FA 3R2TA 4PMBA 5CWRA 3JPRA 1NOMA 3QU5A 1F2MA 3SEIA 3STBD 4YMMA 1CHQD 4GNXA 4JI4L 3KHRA 1L1OC 2AWNA 3AU7A 2IOFA 2ZIWA 2ZJ5A 3GIIA 2LSSA 2YU9H 3ND8A 1PFMA 1MQ3A 1UE5A 5CORA 1HNXL 1JJGA 2YB1A 4I29A 1SXEA 1GHJA 4RNMA 1FL0A 5CEHA 2FINB 1AW7A 1ML0D 4A3MG 1WG8A 4FZMA 2E8OA 2VIXA 3M3YB 3J81c 3FKIG 4WJ3B 1QSYA 1HZCA 2JR5A 3ISCA 1NAPA 3I28A 2DGYA 1AEXA 4GNXC 3M7GA 3PSFA 4FP5D 3OTQA 1EIFA 2R7ZB 4IR1A 3S1RB 1YI2A 3ZDBA 1BDOA 2GVAA 3KBBA 1XMQQ 1L3VA 3MGHA 5GROA 2HHUA 5IIIA 3T51B 5CC4A 3G6VA 1QG7A 4FXKC 1ZQIA 3F2CA 4FZLA 1RG6A 2NRXA 1ZQPA 1UUPA 3NUQA 1EQQA 2IHNA 1RTOA 2ZUCA 1M6YA 2QDBA 2WB1F 3K7AB 2QDLA 3FMCA 5CV8A 4ZQ3A 3N6RA 3EZ5A 4UAVA 1G6ZA 4L8JA 2P6UA 2F4IA 3JAMi 3FKIH 4IUNA 3MFGA 1NK7A 2JH1A 4XT3B 2CQAA 4JBJA 4DPGA 1U0LA 1YZ6A 2NVTH 2GWSA 1EOTA 4CF5A 2ASDA 2F0TA 5J2GA 3AEVA 2HSZA 1XNRL 3PGZA 2LY7A 4ID6A 3ZI4A 1XSLA 2B39A 3G48A 3MTSA 1ZQUA 1PH3A 1ZQLA 4FE3A 1FIQA 5KFGA 2XY6A 1KAAA 3VR6A 3CQZB 4K0KQ 2TMPA 4TKOB 4HN7A 3QE9Y 1ZQAA 3NHHA 1ZQMA 4CKBA 3GTMB 2B0CA 4K4IA 3DM1A 3GQCA 2HOIA 1IYJB 8ICFA 4DK1A 1DRGA 2LMRA 4K4GA 3KOOA 2PI5A 3UXNA 3LWUA 2F1HA 2K4KA 4HSPA 1JX4A 3SK8A 2FI1A 2F0SA 1TWGB 2CFMA 4QL5A 1KRTA 4RUAA 5KT5A 1CKMA 5ALIA 2WTFA 2HDMA 5J0XA 4HIKA 4HJ5A 2ZIXA 2H4OA 5COYA 1QE6A 3G7LA 3ETRA 1GJXA 2WF9A 3D6CA 1N9WA 2IPKD 2FXQA 5C4ZA 3GV8B 9ICSA 1MBYA 2FMSA 3G6JB 2A6ED 4DAYA 5DM63 4DV6L 2W8KA 4XXEA 4POGA 2A19A 5LMNL 3VR3A 4JI5Q 4I2CA 1JC7A 5IYDH 4ME5A 5IOCA 3SD7A 5FP0A 3MFYA 1ZQOA 5KGUA 5AM3A 1PLFA 1X3PA 2G5DA 4L5TA 5KFFA 1PMRA 3OW2A 2M00A 1LV5A 1ZOLA 5B66U 2AGPA 1K83B 1TR5A 2B29A 1ZYRD 3Q0AA 4DV1L 2PMZE 3DV9A 3X3MA 5CV6A 4ED1A 4IN3A 3WK6A 3DMUA 3SAHA 4DSEA 1TV9A 2IMWP 2F0PA 4DV3L 3JPTA 5IE8A 1U5KA 5CHGA 3PX4A 4HIDA 2JXJA 3FEWX 3HKZE 2EQYA 2BCUA 4DF4A 4EZ6A 2FE9A 1EY0A 1K3RA 2EAMA 4Z6EA 4YR0A 1YEZA 3E6ZX 5M5YH 4IFDG 4KHPL 2HQEA 3RZOB 3F2UA 1VQ8A 1EY4A 5C3XA 2NRVA 3E0FA 1MJCA 2G07A 2DGZA 3PO3G 3QEAZ 1UQVA 4DNIA 1BPBA 8ICJA 3EA6A 3H09A 5AI0A 3NQTA 2E2IH 3J7AV 1V9PA 3FYHA 5J0WA 9ICRA 3Q24A 2EJMA 2XCPA 2ZXRA 2FMPA 1PH2A 2JZBB 1IHZA 1VQOA 1TU2B 2R7ZG 3HILA 4ZOHC 5GTIU 1COKA 5L1JA 4JI7Q 3HT3A 1ESRA 1K8OA 4UB8U 5KFZA 3RJKA 5J0TA 2F0OA 2O4XA 3M4OB 4KTQA 2F1IA 2JHDA 2XGQA 4C8OA 3DXJC 4GS3A 2MAXA 1DCZA 2PI2E 4DR3L 3N28A 4NLGA 3ZD9A 3I91A 3IRBA 3IRUA 3Q8QB 3WKCA 2MHVA 5ALKA 2K14A 2K8CB 2LXJA 4XA5A 4RAUC 1EIHA 5J1ZA 4LF4Q 5DQHA 3NVWA 4UB4A 3MGVA 2N78A 3PO3H 4OO1G 2XWJB 1BVSA 3QNMA 1J2MA 1Y88A 1A8VA 4QIWE 2ESEA 1X40A 4JI4Q 2RP5A 4WJWA 4EQPA 1VQFA 9ICQA 1PV4A 5ELCA 1NNXA 1Q46A 2EJGC 4DL7A 3CC2A 3C2PA 1V85A 2GA4B 2EZYA 3EYZA 3LVVA 5K36G 4NXZA 3UQ2A 4PL1A 2XTIA 4JV2A 1NKCA 4ED2A 1TS4A 4KY5A 1FJGQ 4J9LA 4FS2A 3WKDA 1EQTA 3DHQA 5L1IA 2K7VA 4A3CG 4HSVA 1FFUA 1W2BA 4QZEA 3RAQA 4OO1H 4IJLA 3CW2C 4DS4A 2EY6A 2CWAA 2Q4TA 1ZQDA 3KDFB 7ICJA 4JV1A 2JA6G 3PUYA 3GTMH 2EYHA 5AI5A 1FD7D 2ES6A 1B9MA 3BYTB 2HCIA 2P6RA 3BJYA 1SMYC 1FEZA 4DEZA 1WD0A 5K36H 5AKHA 2D0OA 2KBNA 3NWSA 4XDXA 2KHJA 1QILA 1ENFA 4YCWA 2Z0SA 1NK0A 1KLNA 2FJ2A 3EN2A 1L0WA 2AKWB 1Y8OB 3I1YA 1K0RA 4KX5A 4DQSA 1X9NA 3PMNA 4JVZA 5EGTA 1ZQRA 2CN1A 1Y8PB 3CXCA 2OEHA 4A3LH 1B53A 5JVG3 1TWHH 1TWFH 2AUJD 2RQXA 5T1IA 1NI3A 4PGYA 5JTIA 1JWSD 2BCQA 1Q1BA 1SE2A 3CU7A 3I4NH 3NWTA 2JA6H 3TDQA 4I7AA 3J7ZC 4IRCA 2E8PA 4NLBA 3MR6A 3BDLA 4R4OA 2R92B 3J80E 1WWVA 5KFAA 3ITPA 2XSCA 1OUQA 5DB9A 4DL2A 3C5FA 2KIVA 3K1ZA 7ICIA 3M6ZA 2M0NA 4EX7A 2C35B 1Z6HA 4OXPA 4ECRA 4M9HA 3TFSA 1I6HH 2E5SA 1A0PA 1NJIC 2K52A 5C3EB 3AU2A 4FBUA 3IKJA 1VQGA 1PZNA 1EYAA 3WOFA 3PSPA 4N8X1 4F5RA 1N34L 4DV6Q 5CBAE 1XPOA 2ZUBA 1RODA 1W6KA 2QLTA 3N7PD 1Q3UA 1EIYB 4ALPA 4ZUIA 3MDCA 2DY7A 2UUAL 4APVA 1XYIA 2BDNA 3PX0A 4J9SA 4F5OA 1L0YB 1VQ9A 5ALXA 3T3FA 5A2QL 3NRZA 1B4FA 5KFJA 1NJZA 4I28A 4L6TB 4RHRA 2PNRC 9ICTA 1R9TH 4LUOA 2WF7A 3U4VA 5CB1A 8ICAA 2Q8RE 4B3MQ 2K4PA 2F03A 4DV3Q 3H8WA 5K4LA 2BR0A 4Y2VA 7ICPA 3TS0A 4KK7A 4F4WA 1IZ6A 4MFCA 2ZXOA 5DBAA 4DQIA 4F72A 2G5IB 5A2QE 4PGQA 1D8LA 3CPFA 5J8YA 4G7OC 1TWAH 1VF5C 3VC8A 3CRKC 1EOVA 4YVZA 5KFUA 1NZBA 3C28A 2HVHA 1MD2D 3J80c 1PTOB 3R3OA 1X9XA 2LPEA 7ICRA 5CV4A 4NP5A 3NASA 2A1AA 4KLTA 4A3JH 2BDUA 3PW0A 4UP8A 7ICOA 5F9LA 2NN6H 4X5VA 3C2KA 3HZXA 1YJNA 3NVYA 4A3EH 1K28A 4O3SA 1EEID 1X56A 4J9MA 2R93B 5C5JA 3BZCA 1J2NA 5J8YC 1U49A 1VQDA 5DLQE 1D7QA 3B0XA 3M85A 2H3VA 3TZUA 3NBHB 2E8NA 2UVRA 5IYCH 3VYRA 5KFQA 4MFAA 2PFNA 2IBKA 2NRWA 5BN5A 2LYBA 2J6SA 1HFNA 2GN5A 1XSPA 2NVYH 5J2JA 1H9RA 2YMLA 4MF2A 5IYBG 1OO9B 3NPPA 3SK6A 1B44D 2C2EA 1BO0A 2RHSB 5M5WB 4QWEA 2HCCA 4IFDI 1JR0D 1ZXTA 2VUMB 1TE2A 1CK1A 2JGAA 1GD7A 1K8GA 1KXLA 2R92G 4UASA 3K75D 1SNMA 2RA4A 4C8NA 5KFSA 2PFPA 1LKYB 2Y0SE 3KLRA 5AI6A 4QUFA 4HAEA 2EDUA 3Q8SB 2B63B 2EY2A 1JOQA 2PZTA 4RGOS 2OYYA 2ZJRA 1X3QA 5AM0A 2K5NA 4YY3Q 2W9CB 2J6TA 2VA3A 5IIJA 4LF5L 1BKBA 5EOZA 1NTGA 2ATLA 1H9KA 5IYBH 5C3EG 1NK8A 2BCOA 1XSNA 2FHTA 3TARA 5DAUA 3V6JA 1K8AC 1HPCA 5AI4A 1QUQB 4QQBX 4PZ8A 3HWTA 4J9PA 2KE7A 2HOQA 1Q7YC 3KDFA 1STAA 5DG8A 4KMUA 1RXWA 2MGSA 4OIJA 4G9BA 2NRZA 5L1MA 1K73C 2VJ4A 4DFPA 3RH4A 2EY1A 3WOEA 1F9PA 2DPJA 1GVPA 5KG6A 2WV6D 1NKEA 1G51A 4EGVA 4GXKA 4PG3A 1ONLA 2J4XA 4CRXA 3C1FA 4DGZA 2NO5A 4M6WB 2F0GA 4DO9A 4DXFA 1CKOA 1NK6A 3B6YA 4P74A 4CDEC 3CMAA 4TUSA 1KFSA 1PZID 1X32A 1HZBA 2B3GA 4HMIA 3L3FX 3E9HA 1ASZA 5HHHA 1S10A 9ICOA 4CJ1B 3JAML 4K8JA 1T94A 3P75A 1EWCA 4KMUC 4OELB 1SJED 5KYIA 4DV7L 4NV0A 1G91A 5LMUQ 1X6JA 1L3SA 1FGBD 4OONA 2HHVA 1U9RA 1SSOA 4J9OA 2BDOA 3OW7A 4H44C 5C4JB 4ECXA 4B3RL 3H91A 1AZPA 1F77A 1IL8A 2KNJA 1N34Q 1WCMG 2L0CA 1UA1A 9ICLA 2KQ3A 1QVGA 3B0YA 1K5OA 2OQKA 1Z4NA 1TVAA 2QKIC 4DV0L 4FZNA 2R3ZA 3DEPA 5FO7B 5D65A 4A3KG 2YTXA 1PH4A 3K57A 1X55A 3GIMA 4M9LA 1I3QB 4UB5A 3LWEA 3MGIA 3H4BA 4F87A 4DSLA 3GV5B 1ET6A 4LF6Q 1KC8C 2KN7A 2LYAA 4QWDA 3IN5A 1H9JA 5KT2A 2A6HD 2Z4IA 1N2XA 9ICUA 2SNMA 4UAUA 5HNKA 2ZJPA 1DOKA 4XYOA 5IWAQ 2DL0A 5J2BA 3HOYB 1SMYD 3MEHA 5I4DA 5DDYA 4GN3B 4J9QA 3AFPA 4JW0A 4UBCA 4ZAIA 5G5GA 1WCMH 4P4OA 3WWVA 1ECWA 4C1NK 5KFDA 2K50A 2L12A 2LFNA 4RH6A 4NXNL 3F2BA 4UARA 2K5WA 4A3KH 2VUMG 2L5YA 4TUQA 4ELVA 4IQUA 2RSNA 4CF4A 2UU9L 1N32L 1CRXA 1K1QA 1BCPB 1F2ZA 2BA0A 4BA1I 2F8KA 1CQVA 2E1EA 5ALRA 1E7ZA 4C7ZA 5F2DA 2I0QA 3WK5A 1KQSA 4IQWA 4O3MA 4JI1L 2XGPA 1GUWA 1WCLA 3TACB 3RRHA 4C8KA 4NW2A 4POFA 1PH1A 1EXNA 2H3IA 3KBXA 1JXEA 3NVVA 1VQ5A 4DV2L 3RB6A 2JH7A 2BCRA 3I4MB 3CF5A 2CQOA 4Z9CB 1VMCA 4OWWB 2KUMA 1GUGA 1SJHD 1J5EQ 1NJWA 4J15A 3M4QA 3BS1A 5KG3A 4DNTB 3HOZH 1Z1VA 3F2DA 1LYLA 4ICAA 3H94A 4PZNA 1V97A 3DUZA 1U4PA 2MUYA 1XWLA 1W3SA 1NZPA 1L8OA 3NBHA 4R4TA 1J9OA 2NV3A 3HOWH 1QLNA 3MZ5A 4QB4A 3RLOA 4TRDA 2ZIUB 3GTQB 3TAPA 2ASLA 2E75C 4QZ8A 1HZ9A 4C80A 4ECSA 5C4XB 4DF7A 4FFDA 4BUGA 2HHQA 4JG2A 5M3MG 5EE9A 2V1CC 1B0XA 2RDIA 2PNHA 2BCSA 4C4TA 5IIOA 1UCVA 4FF1A 2O5JC 4Y2PA 2D8CA 2W9AA 1EYCA 5D14A 8ICTA 3S1QB 5EKIA 4BBSG 2OH2A 1YZ7A 2WAQE 1QZHA 4LF5Q 1OXVA 1HR0L 1V38A 3BDPA 2N49A 3L3OC 4O42A 3ERQA 2XN9C 5KFMA 2KSOB 3RR8A 1YJ9A 2ZM6Q 1B3AA 2W9CA 3TMEA 3F1ZA 1QSLA 4M47A 5FO8B 5KG5A 4DR2L 4M9JA 4IO9A 1KN5A 1ZQSA 4I2EA 4DSKA 3HP3A 4GFJA 2E5LL 2WINB 2OXOA 5M3MH 4KI0A 1QUQA 4AIMA 1EU3A 2QKQA 3U26A 1BPZA 1NCVA 3GTKB 1JE4A 2VY3A 5DNFA 3WKEA 2G9HD 4A3DG 3S1NB 5JUMA 3DWQA 5C44H 1YJWA 1SL2A 4BBSH 5JU5A 1STHA 4F7XA 2E74C 3HOYG 3ULJA 2K75A 2SEBD 4F93B 2RDJA 4A3FG 5KL8B 5JRTA 4UAYA 3PO2G 3OHBA 1WTRA 3H0MB 1Z7TA 1MIUA 4M6WA 2B6GA 2BQRA 2PFOA 3OPXA 2UVVA 1LTSD 1YHBA 2JEBI 2KIWA 2DUDA 4FDBA 2JA5G 2A8VA 5F3XB 3IAYA 1XO0A 4Q45A 4Q43A 8ICYA 3S1MH 1N63A 1Q1EA 3VR2A 5KFYA 3GU3A 3L4PA 5GAGC 5IP9H 5KNCA 2NVXB 1H95A 4OJ5A 5TISU 5FLXL 4KLEA 3NQIA 3TN2A 4A3DH 1IV8A 4GKJQ 5HP4A 3QZ7A 3PO5A 3LWMA 3H8MA 4DQPA 2K1BA 3PUWA 2BCVA 3NP8A 4JK1A 4QJFA 2FPKA 4LW1A 4JI8L 2JMGA 4TUPA 1KFDA 3T5HA 3GTPH 4CKEA 1QVCA 4BY1G 1K1SA 3PO2H 2BOSA 4PHPA 1STEA 1V8QA 3I4MG 2EE1A 2F0WA 2B2VA 2CHBD 1JMCA 2PXIA 3JPQA 5BR8L 2JA5H 4X3UA 3CRXA 3QR8A 5GTHU 2CW0C 3WKAA 2HHTA 2K5QA 4EX5A 5IGGA 3RZDH 5HY6A 1ZD2P 3MC0B 3HOVB 1XX8A 3TQ1A 1F44A 4RT3A 1SRUA 4LFCL 3L2PA 1WTVA 2AGQA 1I50B 5C0XI 4KLKA 4JK1C 3T1HQ 2HVIA 3KLSA 3CYMA 2EQSA 2PMZB 1SZPA 1NY4A 4J03A 3DLLA 4DOBA 1X9MA 4IPDA 2HHXA 2XRQD 1D9FA 2R6GA 4B9XA 1I94L 4O1NA 4LF7Q 1KKXA 4X64L 2FLPA 4DA2A 2OEOA 5T1GA 5L1KA 3RJEA 1NMFA 4BY1H 4X66Q 2UU9Q 3FDSA 2B2VC 1GUSA 3HKZB 5C4XG 1SFOH 1G6PA 3A7LA 1O7LA 3H15A 1L2FA 4IFDJ 1FVIA 3SAFA 2NYVA 4F4KA 1S4ZA 2WFWA 4JBWA 4GIBA 4KY7A 1CI3M 1SL1A 5D3DA 4J8QA 3M4YA 4JI1Q 3QX7A 3SXHA 2QEJC 2ZTEA 4HIMA 4NY8A 4GN4B 4LJZC 4MHVA 3KYHC 3CCUA 4C3JG 2E2JB 2DF4B 1BNPA 3HOUG 3UE0A 2KEDA 5J2IA 5J2HA 1JWUD 1UE7A 5TZVA 3PCOB 1BF4A 1BNOA 1N36L 1ZQCA 4GC7A 4X3KA 3IP4B 2YN4A 1TT2A 4GLVB 1Y1WH 4A93H 1Q8KA 1SN8A 4LMQD 1SDFA 2K01A 4WRDA 1MI2A 1Y8NB 1U9LA 2WF5A 3JPNA 1YVCA 4JI6L 2OT2A 5AFWA 4NXMQ 4QMGA 3PMFA 3HEJA 3G4SA 2EAPA 3FM9A 4PL2A 4S3SA 4F71A 2PFQA 2B2UA 2XIDA 1N33Q 4KJOA 3S16B 4LWCA 1T3QA 3WK4A 4JI2Q 4C3IH 2YTUA 2EH9A 4QIWB 2HBMA 3G6XA 4C3JH 4C3HB 2DY8A 2KHVA 2JA8H 3HOUH 3SK5A 4FVMA 5IODA 4CGYB 1B9NA 3T5LA 4NM1A 2K6AA 3TI0A 2ZIUA 1PRTB 2TSSA 2CCZA 1P7DA 3V96A 5GAEC 4F8RA 2RBMA 8ICCA 4NLCA 2RLTA 3R9KA 1KRPA 4JWMA 1FO4A 1AN8A 4OEMB 2WF8A 4QZHA 2W9BA 9ICHA 1AE3A 4P72A 2KFNA 9ICGA 1O78A 1TQOA 4YMNA 2B2UC 4R9WA 4IRKA 2DNEA 1HR0Q 2E2IB 2B2WA 8ICUA 4EBEA 2BH8A 2XNAC 4M04A 1VCIA 2D3DA 7ICTA 1A6XA 1EEFD 2IX3A 2BZFA 1S5BD 2LI6A 1ZD5A 4RQMA 5AM5A 1TAMA 1KHIA 1P8LA 5AICA 2EY5A 4PMCA 4DFKA 2NVQH 2OTJA 5M5XB 2JA7B 5JJIA 4H13C 1M90C 2KSOA 1MQ2A 3NEMA 2E5LQ 3HG9A 1N48A 1ZQFA 2QCPX 2QW7A 3K8AA 4L63B 1IIPA 3ALRA 1F2LA 1L7MA 4KX3A 2XCAA 2NZ1D 3ER0A 5GADC 4ACOA 1IBLL 4JBKA 3SR6A 3T13A 2E2HB 1Q3VA 3ZJYC 2RHQB 5DB8A 2UXBL 3CCQA 4GLXA 1X65A 2B2WC 2ZT9C 4OWXB 4A3MH 1QZGA 1H38A 3HOVG 4JC0A 2F52A 1EY8A 4IC9A 1HQMC 4RG1A 3OHXC 3K4GA 5HURA 2UXDL 2IY5B 1LB2B 2NTSA 4AYBE 1ZD3A 3PZPA 3RR7A 3OPOA 4V0BA 4J9NA 2F0QA 4N8FA 3B9JA 3BQ7A 4UQGA 3C2MA 4DQQA 2Z6BA 3HS0C 3Q6SA 4CDCC 1X66A 4Q44A 4PHEA 4G3IA 2O6KA 1E0BA 1F9RA 4YQWA 1X2IA 1HA5A 1D5XC 3EBEA 1VQHA 4HMJA 2MRLA 5EWEA 4BBRB 4DK6C 1WWUA 4A3BB 3H8SA 4Z6DA 4I2HA 8ICNA 5JEAJ 4O3NA 4MN3A 1KNAA 1OXSC 1KDHA 1D5ZC 3X3NA 3GTGH 2M2LA 4RU9A 5AJ3L 4DR6Q 4BS9A 4C7YA 3GIJA 3AQFA 1KLGD 4QZBA 2N3SA 2N55A 4CDGA 4LZGA 1O80A 1D2BA 3LDAA 3AM9A 1L7NA 4I2JA 2A69C 4JV5L 1QNKA 5FO9B 2HHWA 3S17B 4K2KA 1PZJD 1KIXA 4BWJA 1A0IA 1K8MA 2VQFL 4UB3A 4O3PA 3G6YA 2R7FA 1ZQEA 1EWIA 3RTVA 1PDQA 5E3FA 2VKQA 4N9TA 1L6NA 3NTHA 4A3IG 2KMDA 1SR3A 4KLDA 1KNEA 3E58A 3RRGA 1Q12A 4LFAL 2YB4A 1S5ED 2JSOA 3RJIA 3WDNA 4LFCQ 5E7NA 1XNQL 5ALDA 1QSSA 1TWCH 3D4RA 3GTOH 2EXZA 3KK7A 4F3OA 5BOLA 3CCRA 2D5DA 3TP6A 2BA1A 2YX8A 2OQ0A 3S2DH 4OHJA 1HTPA 2PW7A 3FC4A 5ISRA 5JPNC 1M1KC 1UPHA 2WF6A 4X65L 1S5CD 5AM1A 4ECUA 5ALOA 1RYSA 1Y14B 4X64Q 3G6EA 4DKAC 5L37A 1JCKB 3KHLA 3OTOL 3T4AC 4XYQA 1ZRNA 2F0NA 1PA6A 4IQZA 3M6KA 1PYSB 1F9SA 2OF1A 3I76A 3GTLB 3UMBA 2XRSD 1LTTD 1PTOF 2BHNA 3C23A 2AQ1B 4K5XA 3PSIA 2XICA 1VQ6A 4AH6A 2KHSA 1EQRA 3GZFA 2ICEC 3T53B 1MC8A 2DJGC 1BBXC 4FO2A 1C4QA 5C4HA 1VDVA 2UUBL 4FF4A 2IOHA 2E8GA 5H1SE 2IHMA 4IRDA 1EY7A 2K04A 3QUTA 8ICGA 3PF4A 5KT3A 3V6KA 3MC1A 1UAPA 5IGEA 1QVFA 4A75A 4JYAL 1SXDA 3T5JA 4IFDH 1K0SA 2OHFA 3T1YQ 3F5EA 2W03A 4IZ8A 1EY6A 3MHBA 4GC6A 5KAIU 2L55A 1RDFA 4XTCS 2F2AB 2PI2A 3SGIA 3M3YH 2UXCL 1MN8A 1XU4A 1Z19A 2JE6I 5KFNA 3KZXA 2YMMA 4DR1L 3MAQA 3RJJA 5IT9L 2CW0D 2JYOA 3UXOA 5KT7A 2Y1JA 4RNNA 8ICBA 2XC9A 3RH6A 3I55A 1HNXQ 2R7ZH 3S1RH 4B9WA 2B8FA 4L5QA 5G3LF 4Y7NB 4XQQA 3IV6A 4FBTA 2HBJA 1DM0B 4BBRG 4A3BG 3GTJH 1X9SA 1L0XB 4C4SA 4GKKL 2MA1A 5CGKA 2Y0SB 3H4DA 4DU9A 1X3EA 4Q5VA 5IIKA 3SV3A 4YHHL 2W7PA 1STBA 4F92B 3I2ZA 3K7AH 4ILWA 5CV5A 1WTWA 5J2CA 2IWHA 5CYUA 3H0GB 4IUUA 2YTVA 3I70A 4M9NA 5BPCA 1E1TA 4BY7B 2B2YA 1CUKA 1UEAB 4Y2RA 2NUCA 3AU6A 3I90A 4QIWC 3E0JA 9ICJA 1EYDA 1ICFB 3PUVA 4C2MB 5I9OA 2I9GA 1HUMA 1JIHA 5EJWA 5ELNA 1IBLQ 4IR9A 3UM9A 4I2AA 1Z47A 1LUZA 2K03A 5EWGA 3QEBZ 4GLAC 1IYVA 4I2DA 2HIXA 4NMZA 1PRTC 3CQZH 3A5UA 4HTHA 1GUTA 3MA2B 1ZRMA 4GN5A 5KG2A 1XMOL 2RDGA 1ILQA 1HNWL 2GOLA 3RB0A 1WTOA 4YG2A 2KCNA 4A3CH 2RQ5A 2W04A 2B8GA 1TWGH 1PVQA 3H0LB 3ORYA 2B2YC 4UP9A 2LHTA 3SHLA 1XNRQ 3S14B 1Z00B 4NLNA 5LL6S 1A15A 5C0XJ 4ZKBB 5IP7G 2ICIA 2MUTB 1IL2A 5IGFA 1JOKA 5ALNA 4YWMA 1M4VA 3BG3A 2K8AA 5DQIA 1CM9A 5DM73 1S5LU 3SQIA 4A8EA 4JI0L 5J2DA 4DSIA 4KLIA 4J1MA 5JEAG 2AQ4A 3FRPB 3F8TA 1EIGA 1COOA 4OJOA 1S9FA 2KVCA 5KG4A 4KLSA 2H1EA 2LMCB 3I4LA 3OMGA 3IG8A 3R8BA 1DOMA 1TIID 1DXMA 2M9VA 3QG1A 2VQFQ 1N5WA 1ZQXA 1K83H 4U673 9ICEA 1B43A 3WK9A 2PQAB 1KAWA 4BWGB 4KMOB 4A3FB 2NBFA 5LMNQ 4OL7A 5AK5A 1R4PB 3A5ZB 3E9IA 1TS3A 1WTPA 5KT4A 9ICXA 1QJOA 3KF6B 3K0YA 1XNQQ 5KFIA 1HEKA 5JEAH 3RZOH 3PR4A 2KHIA 4UHVA 2DQNB 4P4PA 2PYKA 3V72A 4DV1Q 2WKCA 5C0YA 1HIWA 3MXPA 3ISBA 3A55A 4X65Q 4DWIA 2LXKA 3BVGA 4A3GB 8ICEA 1OXXK 3ONNA 1VQKA 4DSJA 1A76A 5KFLA 3TEHB 4Y2TA 1TAQA 2VANA 1I4GA 3KTQA 3A54A 2SNSA 1LLRD 2EYOA 1OW5A 2IW3A 3OTOQ 4Z6CA 2F44A 2R18A 1G2SA 3J81i 2YMQA 1VQIA 2FMMA 4KHPQ 1BBUA 3CNHA 1SNDA 1VQ7A 3M4OH 3J7YW 3UPQA 1MHWC 3NRWA 1DYQA 1U4MA 3P7JA 3PSTA 2KVMA 3QIAA 5M3FB 5ALHA 2Y0SG 2IOFK 1J8IA 1A3VA 1ASYA 4UPAA 5CV7A 4F4XA 2FPLA 1IBML 3KD3A 3H0GG 2WFAA 1PFNA 3Q8MA 3PY8A 3CCMA 8ICIA 1SAPA 3RB4A 4R66A 2F0KA 1E24A 4BY7G 2VW9A 4IUQA 1KLUD 1Q81C 4ZK9B 1KBUA 3O13A 4F88A 4M0AA 4P0PB 4XQJA 1F0MA 9ICKA 5ALWA 2KTQA 1LT5D 3TP5A 1T7PA 1NK9A 5ELDA 2NTTA 3BS5B 5I6YA 2JZBA 1JOOA 3N4MB 3HGBA 4DR3Q 2UUCL 4LF9L 1EL0A 4BWMA 3QUCA 1A2UA 4JBMA 3DWPA 2KK0A 1CQFA 2A1JB 5KG0A 2AWOA 3U50C 1GO3F 4EQOA 1FNUA 2VA2A 4OX9L 1S0OA 4UAWA 5BOMA 1SROA 4I27A 1SYBA 5FJ8G 2UXCQ 2XIWA 4EENA 4DR1Q 2GO7A 1Y1VB 3I4OA 4CHTB 5EQ0A 7ICVA 1DK3A 1SNCA 3NTIA 4HJ8A 2K89A 4US8A 3KHGA 1C0AA 4B9SA 5AM2A 4TURA 1F2YA 2VZAA 4P4MA 4O9MA 4NM2A 4P2HA 1NUCA 1SKWA 1SYEA 2Y1IA 3KLSX 3E5SA 5KFPA 3FDTA 1VQLA 3TADA 4U6PA 1HJPA 3E2EA 5ALQA 1LT6D 4WORA 3KHHA 3KF8B 1S77D 4YIJA 5IGDA 3FAHA 2Q2UA 3U4ZA 3ONAB 2J0TD 1LABA 2WAQB 4F2SA 1UT5A 4RA8A 1JRPA 4Q0FA 1PK3A 2D9UA 1XJVA 2W7OA 4TVAB 1V1QA 2RHFA 1O7IA 1GXDC 3GP7A 2FFKB 1X6OA 1GUOA 3BS7A 4A4IA 4DOCA 3HOZB 4QWCA 5EE0A 3TADC 5J2KA 2R92H 3E3XA 1TK0A 4DLEA 3KFUA 1XMOQ 4RQ1A 1OTCA 1HNWQ 4ELUA 1A62A 1B70B 4JI3L 1I6VC 4EVOA 2IX0A 5CRXA 2Y0SC 3S15B 3IDWA 2VXWA 5FK9C 1SEBD 5AM4A 3OMCA 4IOAA 4JWNA 2KG5A 4WJ3M 3R2IA 5I9PA 1XXGA 2F0UA 3SYZA 3AUOA 2LKVA 4ED8A 2AXTU 5C0XG 3M9BA 3PMLA 1GUNA 1EU4A 2N8NA 5C3EH 1YITA 4JB3A 2BQ3A 2ALZA 1ENAA 1Z00A 4ED7A 2F0LA 4CE6A 2NO4A 2ZJAA 4K14A 3UI2A 2MUTA 4RQ6A 4B9VA 1IW7C 1XPRA 2KFZA 3SDZA 2VJ5A 5M3FG 4RQ0A 5IILA 2ZTCA 5KFVA 2YMPA 3QU9A 2WB1E 4LF8L 2C9OA 4KY6A 2VQEL 1HUZA 3GQBA 3RLFA 4K8IA 4RFBA 4HEDA 3K0XA 1HUNA 3JAME 2KZZA 1I4XA 2OTLA 5C0XH 1DONA 1RKNA 2F4VL 5AI9A 5ALZA 4IUPA 1EYGA 1AH9A 2UUAQ 2L1BA 1O08A 3RJGA 2RSOA 2AHOB 3GDEA 2R93G 4DV5L 2H3QA 3BZKA 2PQAA 2KENA 4RGMA 1ZQKA 1PVOA 3SAGA 5KFOA 4DXGA 2XVTA 4KTAA 1S8OA 1ZQZA 5DQGA 3H0RB 1WI5A 2PMZF 5CV9A 4RQNA 2W8LA 2ZG6A 1PTOH 2ZJ8A 3DM3A 1E2VA 3H3VH 4O5KA 3QUBA 4UDUC 4ECQA 4P75A 4V190 5KIXA 4IJHA 1EFWA 3HOZG 3O0FA 3HKZF 2AGOA 8ICKA 1YHAA 1UEBA 3S2HB 1X9WA 3W1BA 1H9SB 1O7YA 1QCBD 1NBWA 1UE6A 3H6MA 2L9HA 2K28A 2R93H 2KCMA 4UBBA 4HJAA 1HH2P 3STBC 4DV4L 4CKCA 3DEOA 3N52A 3NE5B 2D62A 4X3TA 4QWAA 3EWAA 2NWGA 1PH5A 2B63G 2E76C 1SKSA 2EAOA 4KITB 1VF7A 2KJ5A 1X3GA 2PO4A 3CCEA 1VQ4A 3P20A 1YNXA 2KP7A 3LYSA 4I2GA 2Q2HA 4KV6A 3ICXA 1C20A 3MVVA 3NXWA 4M9GA 3I73A 3UDXA 4EQ5A 1Z1BA 1E3PA 5J0PA 8ICPA 2A3VA 4OWTB 1J97A 5J22A 2B21A 4RCNA 3HOXB 1SL0A 3DWAA 3JAMc 1GKHA 4IL6U 4YCXA 4DLGA 2EIFA 2VUMH 2H3FA 3RB3A 1PVRA 4P0PA 1PXUA 1SNOA 2DNCA 1L7PA 2DKXA 4IPGA 4UP7A 3CP0A 5C5LA 3U9OA 2F77X 4KLMA 3HJEA 2KOBA 1BR9A 3BS5A 4UB6U 1LV9A 4KLOA 2P66A 1RL2A 2RDFA 4K2LA 3Q23A 2Z6KA 2B63H 4QIWF 4F4ZA 2G06A 2JEAI 1I4RA 4JUZA 5ELFA 3BVZA 4RT2A 2A1JA 3KKAA 1IKLA 1K3BC 3TREA 4TQUS 4Y2QA 1PTOC 3D8GA 3H3VC 2VA8A 5L1LA 1U45A 3LVWA 4YP3A 1PRTF 5F9NA 2JA9A 3BU2A 4K6DA 2Q8IB 2D0PA 1HA6A 4EBDA 5AKIA 1ZKOA 4QUCA 2LM1A 4QZAA 3RBEA 5IIMA 3UDIA 4CF3A 4ED3A 4I2FA 4OIKA 3ZDEA 5KFCA 3VYTA 2FPMA 2Z6KC 2KEYA 1HTLD 4RQ3A 2YQEA 2X6LA 3CD6A 1LKYA 4GNXB 4CBVA 3KKAC 5HR6A 3NELA 4R1JA 4QNLA 3SV4A 3KF8A 4H02A 1YNJC 4X62L 4RGTA 2R8HA 1VQBA 5DLFA 1S97A 2FLNA 4I2IA 4B9LA 4XQNA 4DSFA 1U4RA 2C2RA 2RVLA 4HJ7A 4DCCA 3FVQA 4O3QA 4B3SL 4I2BA 2DFLA 3IHQB 5AHXA 4OJPA 1NE3A 5DG7A 1STGA 4M2YA 5HGTA 3RN5A 4DFDA 3QU7A 1PFBA 1DGJA 5EWFA 4JCVE 3EUB2 1DD2A 1CI4A 5KNDA 2A6EC 1UNSA 3SE0A 1AZQA 5C4JH 1CZGA 4C4RA 1VDZA 5D4BA 2QB1A 2YU9B 4AYBB 4ECYA 3LK9A 2W9MA 4R65A 3D31A 3J80i 4QZGA 2UVWA 3OSPA 1ZJMA 3LNNA 4NLKA 1XMQL 8ICSA 1ZYRC 3RBDA 1N61A 1EZ8A 4ECVA 1JN3A 1X54A 4DV7Q 4DR7L 2ISOA 4YD2A 1I3QH 2F8LA 5B5EU 7ICGA 1UWVA 1XO1A 3PV0A 3TZDA 4ZYSA 3F53A 2LS01 1LTRD 5T14A 3TRZA 4B3RQ 4O5EA 4KLLA 2EYJA 1STNA 3T79A 3A8JE 1WYDA 2NVQB 1WUDA 2K4EA 1C7YA 1KW4A 5HGQA 3HOYH 3G71A 2FMCA 2MJ8A 4DV0Q 2W54A 5CP2A 7ICHA 2V4QA 2EDGA 1N60A 3AQEA 4MIUA 2ODGA 2E3TA 5AI8A 4RKLA 2QB0B 1CZWA 3HOXG 1FYCA 5KFEA 4DK3C 4DV5Q 4NDXA 4FF2A 4QY7A 1T9HA 1YNNC 5FLXE 1JQYD 4B9UA 4K0KL 3M8RA 1STYA 5CBEE 1BOSA 5JJKA 1RHPA 1JT8A 3RFAA 3FKIB 2ZIXB 1PH9A 4CJ0B 5IGCA 4H7BA 3D2NA 2EYMA 4CDFC 2NVTB 3OGUA 3EPGA 2MPMA 1EZ6A 2AUKA 1B4OA 2JJQA 3RF9A 4DFMA 1BXTA 5AIAA 2JK8A 3EQLC 4NXNQ 5AKXA 8ICRA 2OXPA 3ETLA 4KN4A 4G7HC 4DAMA 4RQ4A 2EZXA 2R8JA 1BUVT 2KJ9A 5EPLA 1N32Q 1IYUA 2F0IA 3I4MH 4MHEA 4DUYL 1S0NA 4J6HA 4UY8C 3BQ1A 1H9SA 4O5CA 7ICNA 1F5SA 5HHIA 4JI5L 3T56B 3S6JA 4O3RA 2EZZA 2ISPA 3H3VI 3I8ZA 4KD4A 3A74A 3GDXA 2QF7A 3AYHB 1X6IA 3J81L 2ZIVB 3OJUA 3BQTA 1ZQNA 4G4KA 3CPWA 1SV4A 1UT8A 1ZXIA 5ELEA 2IJ0A 4DV2Q 3H7IA 5DKWA 2I6XA 1IW7D 5TSSA 4FO6A 1O03A 4KN4C 5ALSA 4GZYC 1HHVA 2F3VA 2HCFA 3GTQH 3DDHA 2NB0A 2JEJA 1JI7A 5AKZA 5DGAA 1SYDA 2VS1A 3KZIU 2EYPA 2YYZA 3MFIA 2A68C 5C4XH 4UB2A 1TVXA 1AE2A 3AQQA 3MBYA 4ABNA 3ZYYX 2XY5A 2HT1A 1I4QA 1U47A 5FLXc 4IPHA 1NJXA 2BQUA 3M4PA 1D8YA 3M1YA 2Z7JA 1BCPC 3S1QH 2RDHA 3D0FA 1RYUA 1ZQBA 2JQOA 3MR5A 2G08A 2V9WA 2I07B 1HCZA 2EXDA 2W11A 4ZLTF 1AP0A 3V2TA 1TAUA 5J39A 4WJ4A 4AYBG 1SE4A 3CC7A 1XPUA 4BX9C 1RZTA 1RCVD 3EW9A 5CR0A 3BQ0A 3I72A 3EIVA 1BGXT 5M5YB 1ET9A 4O2DA 3L9AX 5BN4A 2Y0SF 1J6QA 4HCEA 1NKBA 1I4HA 2DPIA 3PIPA 4YXMA 1N56A 4KLJA 4KLGA 3LX0A 3V7KA 4FNFA 2BPCA 8ICOA 5C5MA 2EPBA 1ZQ1C 4BJQA 3K81C 1LO5D 4RZRA 4MTNA 2ZJQA 3GTKH 1CHPD 3MXGA 3S1NH 2I5LX 1KDAA 2W43A 2BDPA 4LF4L 4RPZA 3C1YA 3QXGA 4B3SQ 3KFUF 2YV5A 2WACA 4DR2Q 5FOBB 1JROA 1A3TA 3TSSA 5EBCA 1S76D 5KNIA 1VQJA 2FJ6A 4PHAA 5KL1B 4IURA 4LVSA 3MEFA 4UATA 3L5KA 3R93A 3SR1A 3C2LA 4KN7A 3UQ0A 4PHDA 3CMEA 1LM0A 2DWQA 3VR5A 4FXGC 1EY5A 4JPBW 1CKNB 2KZMA 1SV0A 4DL3A 3PO3B 1ZJNA 9ICMA 3TP7A 2NVXH 1FJGL 5KFXA 1O7ZA 3A0HU 4E0DA 4EX6A 2PZWA 3C3LA 2MU2A 1JJCB 3W5OA 2ZXHA 1SKRA 2F3WA 4U68A 5C3WA 4FF3A 1IBKL 2UVUA 4KLFA 4NL9A 7ICUA 4XT1B 4Y2YA 1S3OA 3GTJB 3V6HA 4DR7Q 4P0QB 1EFID 4KN7C 1KFTA 2K5DA 3HKZG 3QWNA 1NK5A 4DL4A 2G0AA 4F8MA 4DK0A 4GXIA 1JB3A 2Y9UA 1PTOD 2QA4A 5KRUA 4LAAA 2C2DA 1S40A 3VCBA 1SV0C 2JP1A 3HW8A 1V1OA 1BPYA 1WTHA 3K7UC 3ND9A 3GIKA 1OXJA 2C28A 1ZQGA 7ICFA 9ICWA 1OXUA 4JI8Q 3W1GA 3NENA 5C6AA 4F5QA 3TBIB 3HOVH 1I50H 4IQVA 1TKWB 3PX6A 1HUOA 3UMCA 1D9DA 4YWKA 4NL9C 3PR5B 3HP6A 3RUZA 3K5MA 2VNUD 5GQOA 2KVSA 2PI4A 1WFQA 4AYBC 2AQ0A 3OSOA 3I3CA 4ZRZA 5BR8Q 1CEZA 4RHSA 4CDDC 2ES2A 2F0DA 4MEYA 2A73B 1YNJD 1ZQQA 5IYDG 2JA5B 3CCSA 2K4IA 3HPOA 2QB0A 3V7JA 1ESFA 4R4IA 1B50A 4KLQA 2DBYA 5NUCA 3J7AF 2KEEA 2Z1CA 5ALFA 4BXOB 1B7YB 1A3UA 4X6AH 1TWHB 3JC66 1RYRA 1TWFB 2X6GA 4KHZA 1I94Q 4C3HG 5ALYA 5E4XA 2E2JH 3I4NB 2Q0ZX 2C5CA 1B22A 2JA6B 5G3LD 4IS7A 3QZ8A 2FLLA 2BKEA 2D6FC 1TY2A 4DUYQ 3RN2A 1GHKA 5ELBA 8ICZA 1SXTA 1A6SA 4A3IH 2DN8A 4RGNA 1L3TA 2A74C 3OHAA 1ZQWA 4G57A 3S9WA 4FXDA 3AL0B 3C21A 2EJFC 4ED6A 2KHQA 4CNQA 4WFN3 2JEIA 4NLZA 1CSQA 2ALYB 4B3TL 1AROP 3PUZA 1I6HB 5DDMA 3OOCA 3C29A 1N5XA 2N88A 2P35A 4PV1C 2HBLA 2XI9A 3AN1A 2LM4A 3S16H 2BPGA 1CFMA 2PKEA 4UAIA 2C22A 1N36Q 2Q2TA 2ZIVA 4PZ7A 4A76A 2JEFA 4C3HH 1HXYD 2PMZC 1QWYA 2O2LD 5IY0A 3N7RC 2K05A 5M9OA 2JA7G 4R8UB 1KTKA 4JI6Q 1I5FA 3HFZB 1ICWA 3D4WA 2MSNA 2FMQA 3PIOA 3RR5A 2SOBA 3TAQA 4LUZA 1ZQVA 2HMXA 3HKZC 1JMSA 2FDRA 2R8IA 1JE5A 4YXJA 1RJTA 1WVLA 3PO4A 1QQ7A 4K5VA 2XY7A 1R9TB 2I46A 3F5AA 3FP9A 1MSWD 3PW7A 4R4QA 1CA6A 2OCEA 5DEHA 1CT1D 4ODGA 4KKTA 3CKIB 1JXLA 1BQQT 1HZAA 3PIP3 4L5SA 1YNND 1V1PB 9ICVA 4QZIA 5ALPA 1KABA 2IHEA 3M9NB 2J6UA 1D5MC 2O5IC 1LACA 1Q3LA 3C1ZA 1II3A 1WCNA 9ICPA 5M5XH 1Q90A 1TWAB 1GM5A 2JA7H 3RD4A 4ECZA 2QILA 3A7AB 3D3RA 1JUDA 1WYGA 3CCVA 4RKBA 3VA5A 4DFAA 5LHY1 2WAQF 1RIPA 2E2HH 1UHUA 5KG7A 2SDFA 5IT9E 7ICQA 3KJOA 5J2FA 4QZCA 3THVA 4A3JB 3IFTA 2GVBA 4NKLA 3MFHA 2F1MA 2DKZA 4BDPA 2BH2A 5D46A 4E6IA 4A3EB 1NR2A 3NSWA 2K32A 2Z8LA 4XIGS 3VA7A 1SIJA 2ZXPA 2ID0A 3BYYB 2KECA 3PW5A 5AK4A 9ICCA 3WK8A 2NZHA 1QB5D 2JEGA 1PZKD 2HDLA 2LKYA 4DFJA 5E1FA 4ZCKA 3K6OA 5AK3A 4BBRH 4ECWA 4A3BH 2UXBQ 1SNQA 2CPRA 4EYHB 5LMNW 2F1JA 5ALTA 1YBYA 5LL6X 4AQYL 3HRZC 2I5HA 1CSPA 1TK5A 3L0OA 3Q8DA 1SWWA 1KL9A 4KKSA 8ICMA 3Q8RB 2NVYB 1LTLA 3MXNB 4UB1A 4OGQC 3NBIA 2ASJA 4P73A 4Y2UA 1MA7A 1BNZA 2UXDQ 1JJ2A 1B1ZA 4KHVA 1CKNA 1PYBA 2A68D 3URYA 4LJXA 4YY3L 2WIIB 1IBKQ 2A6HC 4A3LG 4FYDA 1JWMD 1DJRD 3S17H 3CP8A 3I4NG 4IQTA 4QGUA 2KKVA 1LT4D 3PV8A 3EJIA 3QOLA 5BN3A 5KFTA 1BCPD 2AJQA 1N62A 3ICEA 1KRSA 2KOLA 2YTYA 5GAHC 2CH4A 2L11A 3TP8A 5AJ3Q 5H2FU 5FLMG 2ZUDA 1RTNA 3U58A 1XS9D 5HR7A 1SE3A 4P0QA 3QB3A 5KG1A 1E22A 1L8LA 4Y2JA 3RJHA 4YD1A 3J80L 1MSGA 2CWPA 2WB1B 1T3NA 4JV5Q 4DL6A 1B8AA 1NSNS 1VLBA 1YHQA 3GFKB 3H8JA 5DGBA 5JJZA 2XWBB 1MJEA 3K5NA 5IT9c 5AKJA 1QQ6A 1SZHA 1RD9D 4MZ9A 9ICNA 1S5DD 5IP7H 2F3IA 5EAYA 4OCZA 1C8CA 5I2YA 5KTQA 1TXYA 3SENA 4MFFA 3I7FA 4LFAQ 1SYGA 2EZVA 3K80C 5FLMH 3QUQA 1S0VA 3GTLH 8ICXA 2JXMB 9ICFA 2AQ3B 5LMUL 1A63A 5KT6A 1VQEA 2AH5A 1UE1A 5IIFA 5EKLA 4ZKCB 3OIQA 1FNVA 3ZD8A 4QW8A 4TQSA 9ICBA 1Z9FA 2IA6A 4YMOA 5DB6A 3EVQA 1QOHA 1ED1A 3GV6A 4I7ZC 4U7CA 1DOQA 4BXOA 4F5PA 2Z4HA 1ZD4A 4QZDA 4GXJA 4OJ6A 5CA7A 1VQNA 2CVRA 1A2TA 3BDOA 5CR3A 5DG9A 3VR4A 1N8RC 1X3FA 1BCPF 3GV7B 1VJ5A 5KFRA 5J0RA 4Q8EA 2RCNA 3GO5A 4DS5A 1FR3A 4I65A 1S72A 2G09A 4B3TQ 4LF6L 2R8KA 2WHEA 4RQ7A 1BPXA 1MSHA 1PFSA 2XVSA 2L4NA 1QQ5A 1FGUA 3JPPA 3QU2A 1B2TA 3PIO3 4A3JG 5IWAL 3ISDA 5JOBA 3NK9A 2NN6G 2K8BB 4CCHA 4HJ9A 3SZ2A 2UUBQ 4Y2SA 1MKHA 2IX1A 2WP8J 4A3EG 4PMWA 4B08A 1TS2A 2ZXIA 4RPYA 1SWVA 1WTXA 2JN4A 4MF8A 4JYAQ 4Y52H 1KTQA 1PUZA 1Q8IA 2A69D 4Y7NH 3SK4A 2PPBC 1ZQJA 1V43A 3E0EA 2CH4W 5IYCG 4RQ8A 1L5UA 5I6WA 4O0AA 4R8UA 4QCLA 2HDOA 4EBCA 8ICHA 4BXXG 4TQRA 1JICA 3AMUA 1T5XD 2J7ZA 2PQEA 1KD1C 3KJPA 3H0GH 1WCMB 2HIVA 4LK1C 5HMLA 3UXPA 4BY7H 2I5MX 2AMCB 1SYFA 2F0FA 1EY9A 4A3KB 1SBBB 4B3ML 1V1PA 4YFKA 1U4LA 2R7DA 4LNQA 5E79U 4C1NI 4C2MH 3K1RB 4DAPA 2KD1A 1PH6A 4GKKQ 3FHWA 4H0LC 4DR5L 1WD1A 5AKYA 1TS5A 1VQAA 1J5EL 4A93G 1XTDA 2ZTDA 4R4CA 1WOCA 4QW9A 4YHHQ 4BA2I 1S5FD 3EROA 2L15A 2MO0A 2I1QA 4LUVA 4C0ZA 4BXXH 3ED5A 3NVZA 5KAFU 2WB1G 5FJ8H 3QU4A 2F0HA 5EPJA 4RUCA 4F2RA 2F3NA 3S14H 5EKKA 3V05A 1UA0A 3OJSA 4BGDA 2CRXA 4ELTA 5L9XA 1R4QB 1XNSA 1RPLA 1S0MA 3EFXD 3VYUA 1XWEA 3UDGA 2W55A 1CTMA 4EQNA 3D4DA 1Z4OA 1HFGA 3KLWA 2VL6A 4AQYQ 4LFBL 4J9RA 3TANA 1LTGD 1PK1B 1G2TA 3AMZA 2F0JA 2Q2IA 1LTID 2DJFC 2A5HA 4HIOA 1G8ZD 3HOWB 3IFDA 3LGJA 1F9QA 3J7A5 4AYBF 5IINA 4OD0A 4A3GG 3ERSX 4EEYA 5ALUA 2HW3A 3MXNA 3C1EA 1Q82C 5KNBA 1XTCD 5E4WC 4IUVA 3LWLA 2ZM6L 1RQNA 3WK7A 4GOPB 4JI0Q 1E1OA 1NJYA 2RCFA 5EBDA 3P1HA 9ICAA 4A3FH 3NGDA 2F0EA 2EYLA 4IUTA 1T5EA 2BE5C 1P16A 4OO1I 3UMGA 5EPKA 2WKDA 1SNPA 3GD7A 5DBBA 2F0MA 4P71A 5J0OA 3TFRA 4ME3A 4XRHA 1Q86C 3MR3A 3A56A 1VS0A 4A3GH 2CXYA 5KFKA 3A0JA 4R64A 2IL8A 4ULLA 3Q8KA 4JOIA 2EOTA 2GH1A 1C48A 4YCUA 1PH7A 4US9A 3QOJA 4DUZL 3IL8A 5J0YA 2E1FA 3BQ2A 2HQLA 5ALLA 2KCTA 4IALA 5KEEA 3TQYA 1SB3C 2HD3A 5AKGA 1IXRA 2IHFA 1TFRA 5M3MB 1RQLA 2K4HA 5J0UA 3PW4A 3Q8LA 1LTAD 2B2TA 1KSPA 4EYIB 4QJFB 5C44B 4BBSB 1SYCA 5EE1A 5M3FH 2OWOA 3KF6A 1YIJA 1SGGA 3MABA 4DQRA 2N1RA 5D3IB 1ZQYA 4GKJL 1DXSA 5D49A 3RLNA 2WB1C 1Y1VG 4JOIC 5KFWA 1H9MA 1LT3D 2HHHL 5J2AA 1PRTD 3HX0A 4R63A 4QF4A 4R8NA 1M8AA 4TSSA 3NS1A 3VDYA 2XGTA 5J29A 3QO2A 1AFPA 4RCOA 1WTQA 3FPPA 1JB7A 3M9MB 2Q8TA 2B2TC 4C8MA 3S1MB 5FKAC 3CCJA 5J0QA 3T5KA 4YN4A 1IKMA 2JRZA 2E2DC 2EVBA 3K5OA 1E2WA 4A3DB 1IBMQ 1PYWD 2LBOA 3CC4A
chains in the Genus database with same CATH topology
2WAQG 4JI5L 1PYSB 1PA6A 3TS0A 3H3VI 1IZ6A 2MFIA 3A74A 3AYHB 3T1HL 1Y1VH 3CCLA 3CPWA 1D8LA 3CPFA 4RMFA 3I56A 1TWAH 4LF9Q 2UUCQ 4DV2Q 1Q82C 3PSIA 4LF7L 1DGSA 1EOVA 1VQ6A 4AH6A 5M5WH 1EQRA 3HOZG 3GTQH 3J80c 2QEXA 4X66L 3ULPA 4OX9Q 2VS1A 4YCVA 1PHJA 2UUBL 2E8GA 2YYZA 5C4XH 2A1AA 5H1SE 4A3JH 4UP8A 4YWLA 1AE2A 3AQQA 2HT1A 3PF4A 3HOWG 1YJNA 1L1OB 5FLXc 1QVFA 4IPHA 3M4PA 4A75A 4A3EH 4JYAL 3S1QH 3S24A 1X56A 3D0FA 1VQDA 1EUJA 2JQOA 1SE8A 3BZCA 5DLQE 3T1YQ 1D7QA 3M85A 3OYYA 3PF5A 2EXDA 3NBHB 4XTCS 4DR5Q 5IYCH 2PI2A 3SGIA 4WJ4A 4AYBG 3M3YH 3CC7A 2UXCL 1XPUA 2JE6I 4DR1L 3EIVA 2GN5A 2NVYH 4O2DA 1J6QA 4NXML 3I55A 1HNXQ 2R7ZH 5IYBG 3PIPA 3S1RH 3M7NA 4DR4L 2NN6I 4L5QA 2CKZB 4BBRG 2RHSB 4MNOA 3S15H 4A3BG 3GTJH 1HNZL 1N33L 2ZJQA 3K81C 4GKKL 4IFDI 4MTNA 3GTKH 4JI2L 1KXLA 1GD7A 1C9OA 1K8GA 3S1NH 2I5LX 1X3EA 2R92G 4YHHL 4LF4L 3K7AH 3I2ZA 2Y0SE 4B3SQ 2YV5A 4LFBQ 4DR2Q 2YTVA 3PUXA 1E1TA 1VQJA 2ZJRA 1VQPA 5ELOA 3MEFA 1CUKA 4JI3Q 2K5NA 4YY3Q 2RF4A 5C44G 3CMEA 3PUVA 4LF5L 2ASBA 1LM0A 4IOCA 1BKBA 1NTGA 1G291 5IYBH 5ELNA 5C3EG 1IBLQ 3TS2A 1Z47A 1LUZA 1CKNB 2MO1A 4GLAC 3UE1A 1K8AC 1QUQB 2HIXA 4QQBX 1FJGL 3CQZH 4PZ8A 5J3BA 3UDFA 3A5UA 2NVXH 4A3LG 1Q7YC 4GN5A 3KDFA 1XMOL 1JJCB 3W5OA 1HNWL 4NPSA 1K73C 1IBKL 4A3CH 4UP9A 1TWGH 1GVPA 1XNRQ 5C0XJ 1S3OA 4GOPA 5IP9G 2K5VA 3RNUA 4DR7Q 1G51A 4LF8Q 5IP7G 3HKZG 4PG3A 2VQEQ 2QA4A 1IL2A 4YWMA 1CKOA 3BJUA 1S40A 3B6YA 4P74A 4JI0L 3CMAA 3K7UC 2B3GA 5JEAG 1HZBA 3F8TA 4IPCA 3E9HA 1ASZA 4DUZQ 4JI8Q 1OXUA 3HOVH 3W1GA 2F4VQ 3NENA 1I50H 1SLJA 1PH8A 4DV7L 5LMUQ 3S2HH 4OONA 2QGQA 3AFQA 4YWKA 2VQFQ 2VNUD 1K83H 4GOPC 5GQOA 5JJLA 1WFQA 5BR8Q 4B3RL 2ES2A 2PQAB 1KAWA 5IYDG 1N34Q 4DR6L 3CCSA 4NB3A 1WCMG 2K5HA 5LMNQ 1QVGA 3A5ZB 4R4IA 2HHHQ 2OQKA 3E9IA 1K9MC 4DV0L 3HKSA 3KF6B 4A3KG 1XNQQ 1PH4A 2YTXA 4DAYB 2MNAA 3RZOH 1X55A 2KHIA 1B7YB 4X6AH 4DV1Q 4LF6Q 3JC66 1KC8C 4KHZA 1I94Q 1WJJA 2E2JH 4X65Q 2LXKA 3HOXH 4DV4Q 2ZJPA 1OXXK 1VQKA 3RN2A 5IWAQ 4DUYQ 3TEHB 1NMGA 3OTOQ 4A3IH 4GN3B 3J81i 3CAMA 3AFPA 1VQIA 4KHPQ 1WCMH 1BBUA 3WWVA 1VQ7A 3M4OH 3L7ZC 1HR0W 2K50A 4NXNL 3F2BA 4B3TL 1CSQA 2ALYB 3ULLA 3PUZA 4A3KH 2Y0SG 2VUMG 1ASYA 4UPAA 2UU9L 1N32L 1Y1WG 3S16H 4B3ML 1N36Q 1IBML 2Q2TA 2BA0A 3H0GG 4PZ7A 4A76A 4BA1I 4C3HH 2ATWA 3CCMA 1E7ZA 1E24A 2NZOA 5IY0A 2VW9A 4BY7G 1Q81C 2I0QA 2JA7G 1KQSA 4JI1L 4JI6Q 1I5FA 3HFZB 2IT1A 3PIOA 1VQCA 3RR5A 4POFA 1PH1A 3KOJA 4LUZA 1JE5A 1BBWA 2MQHA 4DR3Q 4LF9L 1VQ5A 2UUCL 4DV2L 2JA8G 3FP9A 4R4QA 4JBMA 1VQMA 2OCEA 2CQOA 1OXTA 3CF5A 4L5RC 4OWWB 1J5EQ 2AWOA 4J15A 3U50C 3M4QA 1HZAA 4L5SA 3HOZH 1L1OA 4OX9L 2UXCQ 1SROA 1LYLA 3F2DA 5FJ8G 3J81j 2IHEA 4DR1Q 4JI7L 3I4OA 1W3SA 4HJ8A 1SMXA 5M5XH 1C0AA 2H5XA 4R4TA 1GM5A 2JA7H 4DR4Q 4PZ6A 2VZAA 3HOWH 3RLOA 3T1YL 1GO3E 3CCVA 1HNZQ 4X62Q 1RIPA 1HZ9A 2E2HH 1VQLA 1HJPA 3STBD 3KJOA 4GNXA 3KF8B 4JI4L 2GVBA 1L1OC 2AWNA 4JG2A 5M3MG 2V1CC 2YU9H 2LSSA 2Q2UA 2PNHA 3U4ZA 2BH2A 1UE5A 1HNXL 1JJGA 4XIGS 1XJVA 4BBSG 2ID0A 1YZ7A 1FL0A 2WAQE 2NZHA 1QZHA 1OXVA 1HR0L 4A3MG 4LF5Q 4TVAB 2N49A 1V1QA 1O7IA 4BBRH 4A3BH 1X6OA 3FKIG 3J81c 1YJ9A 1HZCA 2UXBQ 5LMNW 4A4IA 1YBYA 2ZM6Q 4AQYL 1CSPA 2I5HA 2DGYA 3L0OA 3Q8DA 1KL9A 3GTMH 3F1ZA 3MXNB 1LTLA 2R92H 4GNXC 4P73A 4IO9A 4DR2L 1XMOQ 3KFUA 2UXDQ 1EIFA 1JJ2A 1OTCA 1HNWQ 1YI2A 1XMQQ 2GVAA 2E5LL 1B70B 1A62A 1CKNA 1PYBA 4JI3L 5M3MH 2IX0A 4KI0A 5GROA 1QUQA 4YY3L 1IBKQ 4AIMA 3S17H 3I4NG 4IOAA 3F2CA 4QGUA 4WJ3M 2VY3A 4A3DG 1EQQA 1YJWA 5C44H 4BBSH 5C0XG 3M9BA 1KRSA 5C3EH 2N8NA 2YTYA 5GAHC 3ICEA 1YITA 3ULJA 5AJ3Q 2K75A 3HOYG 5FLMG 3U58A 3JAMi 3FKIH 4JBJA 1E22A 3PO2G 4DPGA 1U0LA 1YZ6A 1MIUA 2CWPA 2NVTH 4JV5Q 1B8AA 1XPRA 1YHBA 1YHQA 2JEBI 5M3FG 3AEVA 2DUDA 4FDBA 2ZTCA 3PGZA 2JA5G 1XNRL 2A8VA 2WB1E 3G48A 1MJEA 4LF8L 5IT9c 2VQEL 1PH3A 3S1MH 1Q1EA 4MZ9A 3RLFA 4K0KQ 5GAGC 1H95A 5IP9H 5IP7H 2F3IA 5EAYA 3K0XA 4GKJQ 4A3DH 1TXYA 2OTLA 1IYJB 3I7FA 3PUWA 4QJFA 4LFAQ 4LW1A 4JI8L 3K80C 2K4KA 2F4VL 5FLMH 1EYGA 1AH9A 2CFMA 4QL5A 2UUAQ 1KRTA 3GDEA 3GTLH 2R93G 1CKMA 2AHOB 3GTPH 5LMUL 1QVCA 4DV5L 3BZKA 4BY1G 2PQAA 1A63A 3PO2H 4HIKA 1VQEA 2KENA 4HJ5A 3I4MG 1UE1A 1PVOA 1JMCA 2JA5H 1N9WA 5BR8L 2FXQA 1Z9FA 1WI5A 4DV6L 4EX5A 3RZDH 3DM3A 4POGA 5HY6A 3H3VH 2A19A 5LMNL 4JI5Q 1VQNA 4LFCL 1SRUA 5IYDH 4P75A 3L2PA 1N8RC 5C0XI 4IJHA 4KLKA 1X3FA 3T1HQ 1EFWA 1YHAA 2EQSA 1UEBA 2RCNA 3GO5A 4L5TA 3W1BA 3OW2A 1NY4A 3DLLA 4IPDA 1S72A 2B29A 4DV1L 1NBWA 1UE6A 2R6GA 4B3TQ 4LF6L 1I94L 4LF7Q 2PMZE 2KCMA 4X64L 1PFSA 2R93H 4HJAA 4A93G 1HH2P 3STBC 1NMFA 4DV4L 4BY1H 4X66Q 1FGUA 2UU9Q 1G6PA 5C4XG 2D62A 4DV3L 1SFOH 4A3JG 5IWAL 3H15A 1L2FA 5IE8A 1PH5A 1U5KA 2B63G 2NN6G 4IFDJ 1FVIA 1X3GA 3CCEA 4HIDA 4HJ9A 2UUBQ 2WFWA 3HKZE 4JBWA 1VQ4A 1YNXA 1MKHA 2IX1A 2Q2HA 2WP8J 4A3EG 1K3RA 4PMWA 4JI1Q 1YEZA 5M5YH 4IFDG 3UDXA 4KHPL 2ZTEA 4EQ5A 4HIMA 4GN4B 1E3PA 4JYAQ 4Y52H 3KYHC 3CCUA 1VQ8A 4OWTB 4Y7NH 1MJCA 1V43A 3E0EA 5IYCG 3HOUG 3PO3G 3UE0A 4DNIA 1GKHA 3JAMc 1UE7A 4O0AA 2E2IH 3PCOB 2EIFA 1V9PA 2VUMH 1N36L 4BXXG 4IPGA 4UP7A 3CP0A 4GLVB 1Y1WH 1PH2A 1Q8KA 4A93H 1VQOA 2R7ZG 1KD1C 1SN8A 3KJPA 3H0GH 1RL2A 4JI7Q 4JI6L 1YVCA 2HIVA 2Z6KA 2B63H 2JEAI 4NXMQ 4BY7H 3G4SA 2I5MX 2AMCB 4GS3A 3TREA 4TQUS 2R7DA 2PI2E 4DR3L 4LNQA 3IRBA 1N33Q 4C2MH 4GKKQ 1PH6A 2K14A 3FHWA 4LWCA 2LXJA 2JA9A 3BU2A 4JI2Q 4C3IH 2D0PA 4C3JH 1VQAA 4DR5L 1J5EL 2JA8H 1XTDA 2ZTDA 4R4CA 1WOCA 4YHHQ 2N78A 4LF4Q 3HOUH 3PO3H 4BA2I 4OO1G 1BVSA 4QIWE 1A8VA 2L15A 3UDIA 2MO0A 4JI4Q 4LUVA 4BXXH 2WB1G 2CCZA 5FJ8H 1VQFA 1PV4A 5GAEC 1Q46A 2Z6KC 3CC2A 3CD6A 4GNXB 1AE3A 4P72A 3S14H 3NELA 5K36G 4R1JA 4H02A 1HR0Q 4X62L 1VQBA 2XTIA 2BH8A 3UDGA 4HJ7A 1VCIA 4A3FG 1FJGQ 4B3SL 3KLWA 2VL6A 4AQYQ 4LFBL 1KHIA 4A3CG 1NE3A 1P8LA 1W2BA 2NVQH 3RN5A 2Q2IA 4IJLA 2OTJA 3CW2C 4HIOA 5JJIA 1M90C 2CWAA 3NEMA 2E5LQ 3LGJA 3KDFB 3J7A5 4A3GG 3K8AA 4JCVE 3ERSX 1IBLL 4JBKA 3ER0A 3PUYA 5GADC 2JA6G 3ZJYC 2RHQB 2UXBL 5C4JH 3CCQA 4GLXA 1X65A 2ZM6L 4OWXB 4A3MH 1QZGA 2D0OA 2KBNA 4GOPB 3HOVG 2KHJA 4JC0A 4JI0Q 2F52A 1E1OA 4YCWA 2Z0SA 3D31A 3EN2A 4RG1A 1L0WA 3J80i 2AKWB 4A3FH 2UXDL 2IY5B 1K0RA 4AYBE 1XMQL 1P16A 1X9NA 4DV7Q 4OO1I 1X54A 4DR7L 1I3QH 3GD7A 3EBEA 3CXCA 1UWVA 4P71A 4A3LH 3PV0A 1TWHH 1VQHA 4ME3A 4DK6C 1TWFH 1Q86C 1VS0A 3I4NH 5JEAJ 1Q1BA 3TRZA 4A3GH 4B3RQ 1OXSC