2A19A

Pkr kinase domain- eif2alpha- amp-pnp complex.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
165
Chain Sequence
SSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
total genus 46
structure length 165
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a19A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a19A01
1N34Q 1XMOQ 4AYBG 4J15A 2HHHL 3E9IA 2FXQA 1BBWA 1X3EA 2N49A 4DNIA 3CP0A 3G4SA 2JA6H 1X6OA 4DR3Q 3J7ZC 1YI2A 1HZ9A 4BBRH 5H1SE 2UXCQ 4IPCA 5GAEC 3I55A 4DV5Q 4JI3Q 5IYCH 4GS3A 1Y1WG 1HNWQ 3ICEA 3KF6A 1CSPA 2R7ZH 5C4XG 1K83H 1L1OC 1WCMG 3FHWA 3F1ZA 2I5LX 4LF9L 1UE7A 4O0AA 3UDXA 4JC0A 2JA7G 1AH9A 1YITA 5LMNQ 1I3QH 2Y0SG 2JEBI 1WOCA 3S24A 1JE5A 2UXDQ 1PH3A 3M85A 4HJ5A 4JI6Q 4MTNA 5C0XI 3DLLA 4KI0A 5IP7G 2NN6I 3CCQA 2H5XA 2YYZA 1IXRA 2JE6I 2K5NA 2PMZE 1YNXA 3PUVA 4HJ7A 1VQKA 1MJCA 1NBWA 4IPDA 3CC2A 3Q8DA 1UEBA 3SGIA 3OTOQ 3K0XA 2MNAA 2CFMA 4DV5L 4DR6Q 5IYDH 1HNWL 1RL2A 2CKZB 1X56A 3PO3H 2JA8H 3NBHB 1Q8KA 1SROA 3HKZG 4JBKA 1PH6A 3HOWH 4YWMA 2OTJA 1CUKA 4GKKQ 2UXBL 4KLKA 4ME3A 4DV4L 5JJLA 4GOPB 3STBD 1GM5A 2UXBQ 3GTMH 4IJLA 4JI6L 3MXNB 4DK3C 3K81C 4LFAQ 1IBML 1PH9A 4OX9Q 2K52A 3H3VI 2UXDL 3PV0A 4BY1G 5BR8Q 4AIMA 1I94Q 1XNQL 2E2JH 4HJ9A 4A93H 2CWAA 1XMQL 2ALYB 2K5VA 2XTIA 1TWCH 1NJIC 3HOUH 2HIVA 1HZBA 3GTOH 4A3IH 4A3EH 3A74A 1VQPA 2HQLA 5K36G 2RHSB 1LUZA 4GNXC 1VQ6A 1XPUA 3HOZH 4YHHL 2YTXA 4TQUS 3I7FA 3BU2A 5AJ3L 3F2BA 3AFQA 3OW2A 1VQNA 2ATWA 2MFIA 1HJPA 4A3LG 1B8AA 2VY3A 1FL0A 3EIVA 2Y0SE 1JT8A 5HGQA 4RG1A 1SMXA 4R4IA 1XPOA 4BXXH 4KHPQ 2ZTEA 4LFBQ 4B3RL 3PSIA 3I4MG 3RR5A 4LFBL 2BA0A 1YHBA 3PGZA 4BY7G 1K8AC 2WP8J 2CWPA 2V1CC 1YJNA 4IJHA 5C4JH 2UU9Q 4POGA 3KFUA 3S2DH 1FJGQ 2F4VL 2ZTCA 4IPGA 5FJ8G 4NXMQ 3A0JA 1KHIA 4A3CG 2CCZA 3F2CA 3J81c 3UE1A 4POFA 4FDBA 2AKWB 2R92H 3H3VH 3M4PA 3OTOL 3U58A 4OX9L 3HOWG 3GTLH 1VS0A 2BA1A 1X55A 3RZDH 2E2HH 5FLMG 4LF5L 4A3JH 4DV0L 2PI2A 3KJPA 2ZJQA 3M3YH 2R7FA 3TREA 3S1NH 5M3FH 4DR4Q 4DK6C 1A0IA 2Z0SA 4HJ8A 4A3BH 4MZ9A 2OQ0A 1QUQA 5FLXc 3CQZH 2RF4A 4X6AH 3PUYA 4IFDJ 4PZ6A 1EQRA 2IX1A 3S1MH 2IY5B 4B3TQ 4JI0L 4PZ7A 1N8RC 1EYGA 4DR1L 2E8GA 4OWXB 4NXNQ 1L1OA 2KCMA 1XTDA 4P75A 4OONA 4A76A 1IBLQ 4AYBE 4DV7Q 4A3FG 1S3OA 1KC8C 1VQHA 3GTQH 3HOUG 1C0AA 2B3GA 5IE8A 2LXKA 2L15A 4IPHA 3CCMA 4LUOA 4DR7L 5JJIA 4K0KQ 2CQOA 5JJKA 4DV0Q 4DR7Q 3CAMA 4DV2L 1RIPA 5AJ3Q 3GTPH 1E24A 1Q1EA 1SE8A 5JEAG 1YIJA 1P16A 2HHHQ 4IOAA 1D7QA 2OQKA 1N34L 2UUBL 2Q2IA 4WJ4A 3L2PA 4UP9A 1N32L 3CC7A 2VQEL 1A63A 5FLMH 2QGQA 1YHQA 1K73C 3GTJH 2I0QA 3J81j 3CCLA 1EWIA 3K7UC 1OXUA 1VQGA 2K4KA 4DV1Q 4OWWB 1L0WA 2BH8A 4MNOA 2MO0A 3S1RH 5JEAJ 4OXPA 3CD6A 4JI1L 3T1YQ 1I6HH 2XGTA 2JQOA 3PIOA 1Q86C 4LNQA 1QVCA 2IHFA 4TVAB 4DUZQ 4BA2I 1JJCB 1WJJA 4P72A 4EQ5A 2EQSA 2KHIA 1DGSA 3HOXH 3BZKA 4B3ML 4A3IG 3AEVA 2JA7H 1Q12A 5GAGC 1IYJB 2D62A 4JOIC 3FP9A 1XPRA 3HOYH 3CCVA 1I94L 5C44H 1XNQQ 3S14H 5LMUL 2N8NA 1QZGA 3G6EA 2UXCL 1S72A 2KENA 2NVTH 1LTLA 2YV5A 1BBUA 1E7ZA 2YU9H 1SLJA 4C3IH 1YVCA 2NVYH 4X62Q 3CXCA 3RZOH 1IZ6A 4AQYL 2AWOA 2UUAL 3TRZA 2KHJA 1YZ6A 4BBRG 4AQYQ 1Z47A 2UUAQ 4BBSH 1EIFA 1A8VA 3RNUA 4JBWA 1FVIA 3B6YA 4QY7A 1CKNA 3EBEA 5DLQE 3J80i 4BA1I 3W5OA 1X3FA 4JI8L 1QZHA 1M1KC 1WCMH 1R9TH 3TS2A 1HH2P 4YCUA 1VQFA 4A3MG 1J5EL 1VQBA 1CSQA 2HIXA 4A4IA 2JA5H 3GTGH 2A19A 4X64Q 2OTLA 1ASZA 3ULJA 2IT1A 1N36L 1HNXL 4IFDG 1IBKQ 1XMOL 4HJAA 4A3GG 1E3PA 5J3BA 3M4OH 4UPAA 4DUYQ 3F8TA 4LUVA 1VQ5A 2ZM6Q 2R93G 3CPWA 2K50A 2GVBA 1VQ4A 1PHJA 3WWVA 3L0OA 1FJGL 3T1HL 2VQFQ 4A3KH 2F4VQ 4DR2L 2JA8G 2UUCQ 4GKJQ 3CW2C 1KRTA 3M7NA 2WAQG 3HKSA 4DKAC 4JI2Q 4A3DG 2R6GA 5C4XH 3I4NH 4BBSG 2AWNA 5E7NA 4LFAL 3FKIH 1X65A 1FGUA 3S2HH 4JI8Q 2K14A 4Y52H 1KAWA 2IHEA 1HNZQ 3PF5A 2PI2E 4NPSA 4LF9Q 1OXTA 2Q2UA 1N33Q 4LFCL 1N33L 2Z6KC 5C3EG 1K9MC 5C44G 1VQDA 4X62L 2VW9A 4H02A 4A3KG 2BH2A 4LF7Q 4YCWA 4JBMA 2ID0A 2LSSA 4DR5L 2C35B 1T9HA 1A62A 4LUZA 1NY4A 1VQCA 4DPGA 1IL2A 4GLAC 1Z9FA 2B63H 3FKIG 1OXXK 1N9WA 1HZCA 4PZ8A 3E9HA 4HIDA 4NB3A 1D8LA 1VCIA 2D0PA 1G291 2Q2HA 5LMNL 4GKKL 1TWHH 3H0GG 4Y7NH 1C9OA 1GVPA 5ELNA 4IFDI 2NZOA 4LW1A 2E5LL 1QVFA 1X9NA 5IP9G 5IYBH 4YY3Q 1HR0L 1ASYA 2AMCB 3RLFA 5GAHC 2NZHA 2PNHA 4DV6Q 2IX0A 1MIUA 4GKJL 3KDFA 2F52A 4AH6A 1PA6A 2KBNA 1NTGA 4C3HH 5M3MG 2NVQH 2E2IH 3TS0A 2VL6A 4B3SQ 4LF4L 4A3DH 1EUJA 4GLXA 3A5UA 1YJ9A 4B3SL 4LF4Q 1MJEA 4IOCA 1V9PA 4LF8L 3PO2H 4DR6L 2RHQB 4BY7H 1UE6A 2GN5A 1NMFA 2F3IA 3ZJYC 4JV5Q 2LXJA 1XJVA 3KF8B 4HIOA 1Q81C 4APVA 1VQMA 4R4CA 4LF7L 3DM3A 3G48A 3HOVH 2VNUD 2VUMH 2EIFA 1J6QA 2JK8A 4GOPC 4P73A 1WFQA 2I5MX 4R4QA 1CKMA 5IY0A 1L2FA 1WYDA 4A3BG 3K80C 3GO5A 4HIMA 2WB1G 3CF5A 1K8GA 4JV5L 3H15A 4DUYL 3MEFA 2UU9L 4A3JG 3HOXG 3W1GA 3ULPA 2WAQE 4X65L 4YHHQ 3I4MH 1PH5A 3CMAA 1Y14B 4JI7Q 2R92G 1JB7A 5M5YH 1C7YA 4C2MH 4LF8Q 2ASBA 3I4OA 4A93G 1PV4A 3UDGA 2VUMG 3S1QH 4B3MQ 1B70B 1X3GA 4PG3A 2VQEQ 1NE3A 3CCUA 3JC66 3OYYA 2JA5G 3HOYG 4WJ3M 1GKHA 1LM0A 3CC4A 1N36Q 1HNXQ 1P8LA 4R4TA 2A1AA 5EAYA 1U5KA 3NENA 2AHOB 4PMWA 4DAMA 2ZJRA 4UP7A 4YWKA 1VQOA 2QA4A 4QQBX 2I5HA 4DV2Q 1K0RA 1OXVA 1KQSA 4L5SA 3J80c 1SN8A 1K3RA 4DR5Q 1E1OA 2ZTDA 5C0XJ 3HFZB 1G6PA 1SFOH 4DV6L 2OWOA 3PCOB 2HT1A 4B3TL 1W2BA 1EIYB 2Z6KA 1LYLA 3BJUA 3GDEA 4L5RC 4XTCS 3CPFA 4A3CH 4NXNL 4OO1I 3I2ZA 2YTYA 4JOIA 3M4QA 4A3FH 2VZAA 4GOPA 1PH1A 1BKBA 3HKZE 3AQQA 1TWAH 2MO1A 4UP8A 5IT9c 3W1BA 1EQQA 1UWVA 4K0KL 1J5EQ 1Q46A 1X54A 4L5TA 3KOJA 1KL9A 1IBKL 3NELA 4P71A 4JI4L 3CCRA 1VQLA 4RMFA 4X66Q 1L1OB 1HR0Q 1VQ8A 4GNXA 4X65Q 4R4OA 1IBMQ 3L7ZC 4A3LH 1PVOA 3D0FA 5GQOA 3KF6B 4DR1Q 3T1HQ 3HOVG 1B7YB 1TXYA 3CCSA 4A3EG 1YBYA 1TWGH 4JI3L 3UDFA 5GADC 1PYSB 4KHZA 4QJFA 4DV3L 4LWCA 3ERSX 1VQIA 1S40A 1MKHA 3T1YL 1KIXA 3NEMA 1Q7YC 3CCEA 1IBLL 3PO3G 4JI1Q 4P74A 4JBJA 4GN3B 4JG2A 1QVGA 5IYDG 1HNZL 3UE0A 2JEAI 4KHPL 3STBC 1KXLA 2QEXA 3BZCA 1XNRL 4L5QA 2DUDA 5ELOA 2WFWA 2GVAA 3CMEA 3KLWA 2K5HA 2ZM6L 5M3FG 2UUBQ 5BR8L 4YY3L 2NVXH 1SR3A 5M5XH 2ZJPA 1BVSA 3PO2G 3TEHB 2VS1A 4DR3L 3K7AH 4QIWE 4BXXG 2OCEA 2D0OA 2RCNA 3PUXA 3PF4A 3AYHB 1E22A 1H95A 2MQHA 3AFPA 2YTVA 4BY1H 1E1TA 2R93H 3GD7A 1SRUA 1Y1VH 4JI7L 5IP7H 1JJGA 3LGJA 1NMGA 4JI5L 5FJ8H 4IO9A 1Y1WH 1VQJA 1KRSA 3KYHC 5HY6A 2UUCL 4LFCQ 1YJWA 3HOZG 2DGYA 2E5LQ 4UY8C 1OXSC 5IP9H 5IYBG 2A8VA 1XNRQ 4YWLA 1YEZA 3JAMc 3PIPA 1M90C 1TWFH 2KCTA 3S16H 5GROA 3I56A 3E0EA 4QL5A 1Q1BA 4OWTB 1Q82C 3RN2A 3A5ZB 4YCVA 5M3MH 4OO1G 5C3EH 3H0GH 4B3RQ 4JCVE 1VQ7A 1PYBA 3IRBA 4DAYB 2K75A 1EFWA 1O7IA 1QUQB 5LMNW 4DV1L 4GNXB 1XMQQ 4QGUA 2VQFL 4A75A 2N78A 4ALPA 2N3SA 2Q2TA 1GD7A 3G71A 3F2DA 5C0XG 5IWAL 3JAMi 1HZAA 1UE1A 1HR0W 1WI5A 1OTCA 1KD1C 4JI2L 3K8AA 5IWAQ 1YZ7A 1PH2A 1EOVA 4GN5A 1I5FA 3CCJA 3PUZA 1VQEA 3UDIA 3TQYA 3U4VA 4C3JH 4DV4Q 4LF6Q 2B29A 2NN6G 3VDYA 3J7A5 4LF5Q 2PQAA 3KJOA 5IYCG 5M5WH 1I50H 4DR4L 4X64L 1CKNB 3M9BA 3U50C 4O2DA 4R1JA 3I4NG 3EN2A 3S17H 4JYAQ 1AE3A 1Y1VG 2PQAB 3ER0A 3RN5A 4GN4B 1PH7A 4DR2Q 2WB1E 3KDFB 4NXML 4JI0Q 1G51A 3J81i 4JI5Q 4A3MH 3RLNA 3S15H 1V43A 4HIKA 1N32Q 1UE5A 3ULLA 1PFSA 4DV3Q 1VQ9A 3RLOA 2R7ZG 4A3GH 1AE2A 1CKOA 4DV7L 3D31A 4GLVB 3PUWA 2JJQA 4XIGS 1YHAA 4LF6L 2B63G 1GO3E 2EXDA 4EX5A 1PH8A 2ES2A 2R7DA 5LMUQ 1W3SA 1JJ2A 2JA6G 1JMCA 1U0LA 4JYAL 2JA9A 4DUZL 4X66L 1V1QA 3U4ZA 1VQAA 1PH4A 3GTKH 4JI4Q
chains in the Genus database with same CATH superfamily
1N34Q 2B8GA 1M6YA 2RBMA 2EY2A 3E9IA 1C8CA 8ICPA 3PIP3 3LWUA 4O1NA 1SL1A 2WAQF 1BBWA 3VR2A 4F91B 9ICLA 4C0ZA 3G4SA 1X6OA 4XYQA 5G5GA 1YI2A 3PW2A 4BBRH 3S17B 3RH5A 2K1BA 3BVMA 3NUQA 4NXZA 1HNWQ 2ES6A 3IHQB 3FVQA 1ZQFA 5L9XA 2HHUA 5C4XG 5B5EU 3FHWA 1TR5A 1PVPA 1FNVA 4US9A 2BCOA 4M6WA 4O0AA 3UDXA 2OEOA 3QJYA 1DXSA 2Y0SG 2JA8B 9ICUA 1WOCA 1X3QA 5EKIA 3S24A 1TKWB 3MC0B 3ZI4A 4UAIA 3CCQA 2W03A 2KJ8A 5AKEA 1FYCA 1LABA 2IOFK 1IXRA 2F0UA 5KFYA 5KL1B 2JE6I 4XDXA 4U673 3TI0A 3DUZA 3OTOQ 3SGIA 3RJJA 4KLMA 5AKZA 2MNAA 4DV5L 1XNSA 4DR6Q 1SMYC 2CKZB 5AFWA 2WF9A 9ICJA 1NKCA 1S0OA 4XXEA 3BQ7A 3WDNA 4CJ2C 4YR2A 2NB0A 3RH4A 4GKKQ 2UXBL 4DV4L 5JJLA 5KIXA 1AW7A 4UAYA 1Q3UA 3DEPA 1LKYB 4JI6L 3NUCA 4DK3C 4FZMA 3K81C 4LFAQ 3D4DA 5ALXA 2K52A 1XYIA 3CRLC 3PV0A 4BY1G 5BR8Q 1B9NA 1A6XA 1SNMA 4HSPA 4UB6U 5ALIA 4A93H 3RB6A 1T3QA 3CRXA 1IW7D 2WKDA 3THVA 4HYKA 2R8KA 1K1QA 3T79A 3G7LA 4QQBX 5J2KA 2W3SA 4DSEA 1TWCH 2K5VA 3QXGA 2XTIA 1NJIC 3GTOH 4ZQ3A 4A3EH 3HOUH 5K36H 3GTLB 1COOA 3V6HA 4TQRA 4NLBA 3PV8A 2K32A 2A68D 3FEWX 3R2IA 2R92B 5IIIA 1DD2A 4YHHL 5LHY1 4LJZC 1S9FA 4KLDA 3BU2A 3P75A 4P0PA 3KBXA 4PHAA 2VY3A 4DFKA 1GO3F 3DV9A 1DYQA 4ELUA 1O03A 2OYYA 2JYOA 2WB1B 1SMXA 1LT5D 3H94A 4F8MA 5KFQA 3PSIA 4IR9A 5IT9E 5L1MA 4BY7G 1K8AC 3TFRA 4MF2A 1KLGD 3S2DH 4POGA 5FO9B 3QO2A 4B9TA 2NRWA 5ALSA 1TWCB 4AP9A 2K03A 5KAIU 4A3CG 2JN4A 2CCZA 5AI8A 5CP2A 1JXEA 8ICEA 1Y8NB 5I6YA 4RQ5A 3NBIA 3TP5A 1I50B 3H3VH 4DAPA 3U58A 3HOWG 2K28A 1VS0A 2CQAA 1ZQDA 1PK1B 2K7VA 3SI8A 3A7AB 2E2HH 2KG5A 1TWAB 4LF5L 2PI2A 2ZJQA 3AL0B 3TREA 3S1NH 1JX4A 4DR4Q 1A0IA 3C2LA 1UHUA 4DA2A 3CQZH 4X6AH 3N28A 5GTIU 5DG9A 3S1MH 3MGHA 2KCNA 1OW5A 1RXWA 4H44C 1TAQA 5KT7A 1ZQCA 4ED8A 1NNLA 3S6JA 1QG7A 1MA7A 1H9RA 4OWXB 3KLSA 4NXNQ 3GV7B 2HVHA 1XTDA 1LTSD 4OL7A 3TMEA 4C7YA 5J39A 4AYBE 4DV7Q 3IG5A 1N5XA 3QYPA 4BX9C 1PVRA 4KY7A 1U47A 1L5UA 2LXKA 4X3TA 2B2UC 2XY7A 4K0KQ 5JJKA 2EJMA 4DR7Q 3GTPH 5AKIA 4EBEA 3I73A 4I2BA 3EYZA 1L7PA 4Y2RA 3L2PA 1ZQBA 4UP9A 5J0UA 3CC7A 1EEFD 5JU5A 3N97B 5HP4A 3CCLA 1NJZA 2BPGA 2M9VA 4EENA 3MHBA 1L0WA 2A1JA 2F0NA 4TQSA 3HG9A 1PK3A 2MO0A 5COYA 2MGSA 1CEZA 4JI1L 5CRXA 1X3PA 1XO1A 1WD0A 2XGTA 2PMZF 2L11A 5KTQA 4DSFA 3PW7A 2Q8IB 3F5AA 2P5ZX 4EQ5A 2EQSA 4A3IG 2ZIXB 5KNDA 1X6JA 2HCIA 3C21A 4Y2PA 2RA4A 2LYAA 3Q23A 3QUQA 5C6AA 3HOYH 2WACA 3LVVA 4AYBF 5LMUL 1G2SA 2N8NA 1MGSA 1F2MA 1V1PB 4NLZA 1H9SA 2NVTH 1LTLA 2YV5A 4JV5Q 1JI7A 2BHNA 1SLJA 3ZD9A 2JH1A 1B22A 1YVCA 4FO6A 2XNAC 5LL6S 3RZOH 5C4HA 1K5OA 1U4RA 2AWOA 3TRZA 4KTQA 2R61A 4AQYQ 2UUAQ 4BBSH 1N60A 2N1RA 5KFZA 3PR4A 1O80A 3K5NA 3G6XA 4JBWA 4ECQA 4QY7A 4YFKA 1CKNA 2G9DA 1M1KC 3S15B 1H95A 1X3FA 4YXJA 1R9TH 1EWCA 4YCUA 2WAQB 4A3MG 1J5EL 3GV5B 4M04A 5L1LA 5ELCA 4A4IA 3H8JA 4RGMA 2KJ5A 4OELB 3ZYYX 2HUGA 3EFXD 1HNXL 2Z1CA 1XMOL 9ICEA 1K0SA 4Y2YA 4TUQA 1KLNA 4I2HA 1C4QA 1CA6A 4IFDH 4FP5D 5ALTA 2K50A 3HPOA 4LZGA 3VYTA 1FJGL 3MFIA 4CF4A 2F0GA 1VDVA 4GKJQ 3CW2C 2QILA 2HHSA 3C2PA 5DBCA 2R6GA 4BXOB 3IDWA 4ABNA 2EVBA 1QNUA 4EVOA 3Q24A 1LTAD 4JB3A 3J80E 4XA5A 4HSVA 3D4RA 4LFAL 2FPMA 2C22A 3B9JA 2PZTA 3DM1A 4Y52H 1KAWA 4M9JA 3CU7A 1HEKA 2B21A 2KHQA 3PF5A 4HCEA 1AQ6A 2PI2E 3K1ZA 1HFNA 4IQZA 2Q2UA 1N33Q 5EE3A 1ZQIA 3UQ2A 5ALWA 3Q8QB 1WWVA 2F0PA 5C4XB 3P1HA 1MQ3A 5AM2A 4X62L 4EGVA 4AYBB 3NS1A 1T8EA 2KMDA 2HHWA 1SAPA 8ICLA 1T9HA 4PZNA 4PMCA 1A62A 1FFVA 1L3VA 1VQCA 4XQQA 3SV4A 1X9WA 3NTUA 1T5EA 4QZFA 3RJIA 5M5XB 1EY7A 3PQIA 5ALDA 4YVZA 1RODA 4PZ8A 3E9HA 3QU5A 1CRXA 3Q8SB 1SXTA 1D8LA 2PFOA 4B6JA 4ECXA 4DFPA 8ICCA 1LT4D 3RH6A 2Z6BA 5DQHA 4DOCA 3OHAA 1CI4A 3GV8B 2NZOA 1SB3C 4DQPA 2QB0B 4RUAA 2ASJA 4JWNA 4IUPA 2W9MA 5IP9G 1X9NA 1QVFA 2CPRA 2F8KA 1WTPA 2CVRA 3RLFA 7ICTA 3QZ7A 3C29A 3NVZA 4DV6Q 2IX0A 4R64A 5M3FB 4F72A 1X66A 4F93B 2F52A 5CR3A 4AH6A 2KBNA 1F9QA 1IM4A 3V7LA 1JXLA 1UCVA 1NTGA 4C3HH 2L0CA 5EGTA 2NRTA 4NL9C 5D46A 3OHXC 4O3OA 2VL6A 4LF4L 2Q4TA 4QZBA 1YJ9A 2ZIXA 1RF2D 3O13A 4IOCA 2CW0C 2RHQB 5AICA 2GN5A 4NV0A 4C4TA 1NMFA 1ZJNA 2W7OA 4Y2XA 3KKAC 3PO4A 2AQ3B 3T56B 4K2LA 4UQGA 5KG6A 3DM3A 1QSLA 2J6SA 5JRTA 1VMPA 2JK8A 1NK8A 1RDPD 3OMCA 1U4LA 2FDRA 1WFQA 4FVMA 2WF8A 3IM1A 5C5JA 5IY0A 4F4XA 1L7NA 3ICXA 3GIKA 3GO5A 5FK9C 3QIAA 4F88A 4HIMA 2L4NA 2WB1G 3MWYW 4G4KA 3H15A 2F2AB 3UI2A 2B6GA 2QKQA 2Q8TA 2WAQE 2QF7A 4YHHQ 5ALGA 2YN4A 2R92G 4DLEA 3AB9A 4LF8Q 2KZZA 3AQEA 3UMCA 4WJWA 4EZ9A 5ALRA 3AU2A 2SEBD 2UVRA 2Y0SC 2ZIVA 5K4LA 3UDGA 4R8NA 2VUMG 4FYDA 1X2IA 3PX4A 8ICFA 1PFBA 4YIJA 2BPFA 1B70B 2OF1A 3S1QH 5JAVA 1ZQQA 2PFQA 3CCUA 3HOYG 4F87A 1K8MA 1Z4OA 1ZQLA 1GKHA 1HNXQ 1EZ6A 1CZGA 5EAYA 2ZIVB 3NENA 4PMWA 1LLRD 3AU6A 4DAMA 4J9NA 1VQOA 1HA6A 5C5LA 2QA4A 2I5HA 3W2DA 3J80c 5ALKA 2B2WC 1I4RA 4DR5Q 8ICIA 3HFZB 1G6PA 5KFSA 2E5SA 3K5MA 1EY5A 1K8OA 2JA6B 1XX8A 2NVXB 1LYLA 3I1YA 2MUYA 3BS1A 3I70A 4A3CH 4NXNL 2KN7A 2K4HA 4OO1I 2KIVA 3M4QA 3MVVA 4GOPA 1PH1A 1BKBA 3M3YB 3HKZE 3AQQA 5ELEA 1FO4A 4UP8A 5IT9c 7ICHA 3W1BA 3BDOA 4KLGA 2RP5A 4I2AA 5BOLA 1QLNA 4L5TA 5KFCA 3OJSA 3MFYA 3NELA 9ICKA 1SXEA 4JI4L 1ZQWA 1N2XA 1JROA 1BPZA 2D9UA 3VR6A 3LX0A 2YY6A 4MFAA 5KFKA 7ICUA 4X65Q 3KLSX 4FF3A 4Z6CA 2XVTA 3NASA 4R4OA 3SK4A 2EJGC 2IOHA 4K5WA 1DZ1A 4DR1Q 3OWEB 3CCSA 7ICFA 5ALLA 9ICHA 1GUOA 2BGWA 2G08A 2XGPA 1LTID 4Q43A 3QR8A 5ELDA 4KLUA 3NSWA 4QJFA 2FHTA 3OTQA 4ED0A 4LWCA 3T13A 4F3OA 1KIXA 2CH4W 2B2VC 3T53B 4KK7A 3PO3G 4DK0A 4JI1Q 5AM3A 1SWWA 5IYDG 1TQOA 3R93A 4EQOA 1EQVA 3EROA 1UT8A 3STBC 3BZCA 3C3LA 1SEBD 4L5QA 1DOKA 3JPSA 4F7XA 2WFWA 2PO4A 2B2UA 1SKRA 3URYA 5M3FG 2Z9HA 1HPCA 5BR8L 1PDQA 4G7OC 3Q6SA 2RDIA 2EYMA 4U68A 3K7AH 2OCEA 2DNEA 4K2KA 2A74C 5D49A 5KFPA 2MQHA 3JPTA 3I28A 2PQEA 2YTVA 1EL0A 1Y1VH 2XCAA 2VA2A 1HCZA 2LMRA 3IAYA 2HCFA 1COKA 4GXJA 3BZDB 3S1RB 1LB2B 5HY6A 2PMZB 4YD2A 2EOTA 3IRUA 1OXSC 1XNRQ 4R8UA 3I4LA 4J1MA 2Z4HA 2JXMB 3S2HB 4YWLA 4J9PA 4ZLTF 3RBEA 1TVAA 1WTWA 1M90C 5EE9A 4RQ8A 2RVLA 4LMQD 1EWHA 3S16H 2F4IA 5GROA 3W3AA 5KT4A 1Q1BA 3QE9Y 2EE1A 3A5ZB 1KABA 4YCVA 4DSIA 4C3HG 5I6WA 1D5ZC 5C3EH 3CKIB 4IURA 1VQ7A 4DAYB 1WTVA 4B3RQ 1LO5D 1EFWA 1DOLA 4BJQA 3QZ8A 2NO4A 3ITPA 4GNXB 2VQFL 1M8AA 4FF1A 4V190 3F2DA 1GD7A 4IALA 3JAMi 5AKXA 2ZIUA 4GXIA 3IN5A 1HZAA 2V4RA 3E5SA 3OIQA 3V2TA 3UXOA 5JPNC 1WTRA 1PH2A 3M8RA 4GN5A 4DFDA 4F2RA 4OIKA 1EIHA 3PUZA 1FIQA 4C3JH 4LF6Q 1PUZA 5ELBA 1RTNA 3HEJA 1SZHA 3C1FA 2NO5A 1XO0A 4Q8EA 5M5WH 1TK8A 5IYCG 3I72A 4EYHB 2BDPA 1EXNA 2V9WA 4DR4L 1CKNB 3SK8A 2EY6A 1EZ8A 1HTLD 5KFDA 1AE3A 2IHMA 5HMMA 4JBKA 1HQRD 1QNKA 2XN9C 4FXKC 4RHRA 4DQSA 2KECA 4YP3A 4HMIA 1G51A 2DKZA 4PL1A 3MFGA 2AQ1B 3S15H 4QZEA 1UE5A 1PFSA 5E79U 2W9AA 4K4HA 4BBSB 1VQ9A 3RLOA 1AE2A 4DV7L 2G09A 2C2RA 4NLGA 5ELFA 4PGQA 3D31A 3PUWA 2F0OA 3QEBZ 1MI2A 1GO3E 5BOMA 2J0TD 3H4DA 1SV4A 2L9HA 1UEAB 1LT3D 1JMCA 2JP1A 4DUZL 2RSNA 5AKHA 1VQAA 1PH4A 1B53A 5ALOA 1HRJA 2HHQA 4J15A 3GIJA 8ICSA 1CM9A 2HHHL 2G07A 4I2EA 4A3IB 2PCFB 4IS7A 2WFAA 5KFNA 2K04A 2JA6H 4TKOB 4YG2A 5H1SE 4QIWF 1S5DD 4IPCA 4IR1A 3RJGA 5IYCH 4GS3A 2V4DA 5KT2A 2XWBB 4QB4A 1CSPA 2R7ZH 1K83H 4J9QA 4NKLA 5I9OA 4EELA 1ZD5A 5A2QE 1UE7A 1N61A 1QH9A 1NK6A 1AH9A 1NJXA 9ICFA 1I3QH 2F1MA 4ELTA 2F3WA 3VR3A 2BDNA 4Q0FA 1T3NA 4QF4A 2WHEA 4FBTA 4M9LA 1SYBA 1JE5A 2ZUCA 7ICGA 3QUCA 5DLGA 5C0XI 1XXGA 1P7DA 1DRGA 2YYZA 4IRDA 4RZRA 2PMZE 1VQKA 1NBWA 3KHRA 4IPDA 1NCVA 2RDHA 3SD7A 1UEBA 1GXDC 2BE5D 1EEID 4M9HA 3ZDBA 2CFMA 3RF9A 5HURA 4KKUA 4RCNA 2ICEC 1HNWL 5IYDH 4UHVA 1X56A 2BDOA 3PO3H 4KLSA 2KFNA 1FGBD 2MUTB 1SROA 5ALMA 5E4WC 1D7QA 4P4MA 1EYCA 4J8QA 2R8GA 2NYZD 2DPJA 5KFHA 1CQVA 1GM5A 3GTMH 3NTHA 3Q8MA 4YR3A 2QDLA 2FI1A 1F9PA 1AN8A 1IBML 1QQ5A 1I94Q 4AIMA 1XNQL 1L7MA 2E2JH 3BQ1A 5J2FA 4HJ9A 5JOBA 1U48A 2CWAA 2HQEA 4P0QA 3I8ZA 3K6OA 5DM63 2NBFA 2ALYB 5K5PA 3V72A 2EPBA 4LK1C 4A3IH 2YMQA 1VQPA 2P6RA 3SZ2A 3T5KA 2W8KA 3TAQA 2CXYA 1LUZA 2B2TA 3FYHA 2YTXA 1LTTD 4TQUS 3AU7A 3MAQA 4GFJA 3H7IA 3JPOA 5AM4A 4US8A 4F5PA 1Q8IA 3R8BA 4BY1B 1MBYA 2MFIA 1OO9B 2RDGA 1B8AA 1Q90A 1FL0A 2Y0SE 4U6PA 3WK4A 5HGQA 1QILA 3S2DB 1RDFA 4JUZA 4YMOA 3WK8A 2F1JA 2E3TA 4DFMA 2KOLA 3I4MG 2HBLA 1D6EC 2A5HA 1CK1A 2BA0A 3PGZA 3M9MB 2MPMA 2ZXHA 2WP8J 4F4KA 1XWEA 2V1CC 4UAUA 1YJNA 2KVSA 1RKNA 1EY6A 4C1NI 2UU9Q 2F4VL 4I28A 2SOBA 2ZIWB 2WB1F 4V0BA 3RAQA 1IYVA 3CNHA 1BGXT 2A68C 2I46A 1J9OA 3JPQA 1N62A 1BNPA 2F0IA 3HZXA 4QZIA 5CV7A 2VKQA 4KITB 1N56A 5AM0A 1ZQSA 3UE1A 3LK9A 9ICIA 3SK6A 2W43A 2R92H 4PHDA 2NWGA 7ICMA 4DWIA 1O08A 3GTLH 4IUNA 4FS1A 1NUCA 5FLMG 3HOUB 2KD1A 4A3JH 4A8EA 2RQ5A 4DNTB 3FAHA 4DF7A 5DEHA 4MHVA 4P0QB 4C80A 4HJ8A 2OQ0A 2K89A 3RR8A 4A3BH 2JH7A 2A6EC 2RF4A 3I91A 1A3VA 3VYSA 2HMXA 2VANA 1EQRA 4B9VA 3OGUA 5DB9A 3WK9A 2HSZA 4DN4M 3T5HA 4DR1L 3PSFA 2HW3A 1DK2A 4RGOS 4FZLA 1PRTC 1M4VA 2K8BB 3N7RC 4OONA 2XY5A 4A3BB 1IBLQ 1ZQNA 1PYWD 3K5OA 8ICOA 4F5NA 1C0AA 5KNCA 3V6JA 8ICBA 5IE8A 3UXPA 4RUCA 4IPHA 3WK7A 4F5OA 4R8IA 3IV6A 4QZDA 2CQOA 4DV0Q 2K05A 3Q22A 3CAMA 3O0FA 5AJ3Q 4NY8A 4M2YA 4L8JA 1Q1EA 3GDXA 1P16A 2IL8A 4QZ9A 1BOSA 5ALFA 4WJ4A 5AI6A 2VB3X 4QUCA 4DL7A 5CYUA 2QGQA 2FJ6A 1K73C 2VXWA 3GTJH 3J81j 1EWIA 1VQGA 2AXTU 1V1OA 1UQVA 1TFRA 4BXOA 2X69A 5CMDA 4R8UB 5J8YC 4DQRA 1Z6HA 3FDSA 1GUGA 2EJFC 1STEA 4G7HC 1ZQMA 4OGQC 3IKJA 1D1KA 4RWSC 4B08A 2G06A 3MTSA 3PIOA 4CJ1B 3QEAZ 3KUPA 2ZUDA 1QB5D 2EYOA 5L1KA 1QVCA 2IHFA 3M4YA 4RHSA 5D65A 4DUZQ 4LNQA 3SQIA 4RNOA 1B0XA 2KOBA 2GO7A 4UAVA 5AKLA 1Z7TA 4CDDC 1LTGD 4OJOA 4N8FA 5AI0A 2EZYA 2EYHA 3BQ0A 1SYCA 3H0LB 1W6KA 2WF7A 1ZRMA 3EW9A 5J2JA 3RRGA 3DWQA 4JOIC 1VF5C 3CCVA 1WTQA 2ISOA 5C44H 3QUBA 1QZGA 3MXGA 2KIWA 1DM0B 4A3MB 3IFDA 2DY8A 3ERQA 4YR0A 1MD2D 2H3FA 1JRPA 4O5EA 1V85A 4Z6DA 5KFXA 1ED1A 1DCZA 2EYJA 4C3IH 3BDCA 2B2YC 3NWTA 1KDAA 4BBRG 2QEJC 1OUQA 1O78A 5DQGA 1A8VA 3M9OB 1RYSA 8ICGA 5DLQE 4BA1I 1ZQGA 4UATA 2K4EA 2W11A 1JN3A 1X9SA 1NNXA 2LI6A 3EBEA 5KFLA 4JI8L 3W5OA 2TMPA 1SE3A 2ISPA 1B9MA 1VQFA 2A6HC 5KFEA 4EEKA 2FMQA 2FINB 3ND8A 4RH6A 1V8QA 2JA5H 2QARB 5EWGA 1PLFA 2XIDA 4X64Q 2OTLA 3PO3B 5C0XH 3TQ1A 2BZFA 1ZQJA 2L1BA 4OD0A 1N36L 2XGQA 2W8LA 3KBGA 3TP8A 3M4OH 5J3BA 4A3GG 2HBJA 3F8TA 4KN7C 4KLOA 3CPWA 2GVBA 4F50A 1VQ4A 3WWVA 1PHJA 4OCZA 5T1IA 1UPHA 1Q3VA 2L5YA 1BQQT 2UUCQ 3KBBA 3TANA 3WKCA 4JK1A 2E2DC 1KRTA 3K5LA 2WAQG 4DKAC 3SMVA 4IC9A 4JI2Q 1TU2B 4DAVA 3LWMA 3ZDAA 1ZEQX 1KLUD 1ZETA 2B63B 3HT3A 1RZTA 7ICOA 2F0DA 4PNYA 5E7NA 4KN4A 1S10A 3S1QB 2BCRA 4HMJA 2IHEA 1HNZQ 1XWLA 1Y1WB 3BYTB 3I4NB 5J0SA 2Z6KC 4DAYA 2VW9A 2BH2A 3MA2B 2B2YA 1TS4A 2W9BA 3H4BA 2ID0A 8ICMA 5AK3A 2PFNA 5J2EA 1QCBD 1KTKA 3HP3A 2NRVA 1QTMA 3RJKA 2ESEA 2SDFA 4GLAC 2IX3A 5JEAH 4NLNA 3FKIG 4MEXA 5HR6A 1OXXK 1N9WA 4E6IA 2VJ4A 2D3DA 4HIDA 4X3SA 1VCIA 2L12A 4IUTA 2KKVA 4LJXA 5LL6X 4GKKL 2E8OA 3H0GG 4G57A 1C9OA 2HBKA 4RQ7A 2HDOA 2R8JA 5EPKA 1HR0L 1TY0A 5IYBH 1B4OA 2Z4IA 1QCKA 1KFDA 3EQLC 2NZHA 2PNHA 4IQTA 1TV9A 2E1EA 3BS5B 2LKVA 3KDFA 4GKJL 3SAFA 2EXZA 4UBBA 1PA6A 2CW0D 1TKDA 4NL9A 2AQ0A 4C3HB 1A3TA 1Z4NA 1X40A 1ZQYA 4JVZA 4XQNA 1ZD2P 3L3FX 2NN6H 2R3ZA 3S14B 4A3DH 5I2YA 4B3SL 1MJEA 1V9PA 8ICJA 3E3XA 3H0RB 1UE6A 4J9SA 2BQ3A 5J8YA 5I9PA 3ZJYC 1ZQHA 4GXKA 1XJVA 2R18A 1EFID 1PVQA 4OJ5A 5HMLA 1Q81C 4APVA 3TADC 1XTCD 4HR7B 3G48A 2VNUD 2W3RA 2EIFA 1UA1A 4OJPA 5FOBB 2FPLA 4OO1H 5J2GA 4FBUA 4DCCA 2JZBB 1CKMA 3QU7A 3K80C 1LT6D 1MQ2A 2NV3A 3J80L 4JV5L 3HOXB 1KDHA 3MEFA 3V6KA 4KJOA 5EBCA 3HILA 3ULPA 4CKBA 1A0PA 3T5LA 1FNWA 3CMAA 8ICHA 4ICAA 4JI7Q 1BXTA 3S16B 5ALNA 5KG1A 4G3IA 1JC7A 3I4OA 2J7ZA 4NJ8A 2PW5A 2XC9A 3ISBA 2BCSA 4IUUA 4PG3A 1UNSA 1ESRA 3TACB 2ZIWA 3HRDD 5J1ZA 3NPPA 1S8OA 1N36Q 2E2JB 2AQ4A 4UP7A 5DB6A 3GV3A 2MJ8A 2EYLA 4IUVA 1LTRD 3D4WA 4O5CA 4DXGA 4L5SA 2XVSA 5DNFA 1A76A 2ZTDA 4DL2A 3TP6A 2AGPA 2BQUA 3NGDA 1SFOH 2OWOA 4ELVA 1S5CD 4PL2A 1EIYB 1YNJD 1K3BC 2W7PA 3GV6A 1ILPA 4LVSA 4YMMA 2AQ2B 1JUDA 1JICA 5M9OA 1TS5A 3ZDEA 2ASDA 1JWMD 2F0LA 2MO1A 3MR6A 1F9RA 1CHQD 3C1EA 4KLJA 4K0KL 1UUPA 1Z19A 5CJ7A 2WKCA 3M4OB 4J6HA 1WTOA 3CCRA 1ZQUA 1N48A 8ICVA 1JWUD 1ZKOA 4RMFA 1X9MA 1WUDA 1D9FA 3FDTA 4J9MA 3HOVB 4A3LH 4ED1A 2E8MA 2M0NA 3L7ZC 1I3QB 1IBMQ 1PVOA 3D0FA 5GQOA 2NVTB 3T1HQ 1HHVA 3K1RB 4FS2A 2P66A 4KD4A 5HR7A 4M6WB 3B0YA 4JI3L 5GADC 3HOYB 2LYBA 4KHZA 2A69C 1NI3A 3ERSX 1VQIA 1BUVT 3PSPA 2KJ9A 4KLTA 1ENCA 1KBUA 5IINA 2ZIUB 1SSOA 4P74A 1IBLL 3WOFA 5KFFA 4JG2A 2JEAI 5AKKA 2E2IB 1R4QB 5D14A 4DGZA 1BF4A 2HOQA 2KSOA 9ICGA 4QJFB 4JV1A 3Q0AA 3CMEA 5F9LA 4DXFA 1ZOLA 1NK4A 2WF6A 9ICWA 1SR3A 3KLRA 3OSOA 2NVXH 3TEHB 5BN4A 2E74C 1D1IA 4QIWE 3K57A 3C1ZA 4F2SA 2D0OA 2RCNA 3PUXA 1DK3A 3DEEA 5FLXL 3AYHB 1XSLA 2ENBA 1B2TA 3AFPA 5IIFA 3GD7A 1XU4A 2Y9TA 2KZMA 4DFAA 1F9SA 3T5JA 2FPKA 1NMGA 4JI5L 2UUCL 4X5VA 1STYA 2F3VA 3A55A 2CH4A 3HOZG 2H3IA 5IP9H 2A8VA 1EQTA 3PX6A 3RFAA 3D2NA 1LVHA 3KZIU 3JAMc 1LACA 3I90A 5DG8A 3SDZA 3PIPA 1L0YB 1KTQA 2F1HA 2MUTA 4EQPA 3I56A 3KHHA 1I4QA 1XS9D 4QL5A 4RNMA 4OWTB 3C23A 5KYLA 3B0XA 4OO1G 1YNND 4H7BA 3IRBA 4XQ8A 1RTOA 2K75A 4RCOA 1BDOA 4F4ZA 5JVH3 1PRTF 4CE6A 4MTKA 1XMQQ 4A75A 2Q2TA 3G71A 2F0HA 2O2LD 1HR0W 1OTCA 1S97A 4JI2L 4PV1C 1EOVA 1V1PA 3CCJA 7ICQA 3GTGB 5AM1A 2KFZA 3VC8A 2QKIC 4C8NA 2AJQA 1VQEA 4O3PA 4QZHA 3TQYA 3U4VA 5AHXA 4DV4Q 3MBYA 8ICRA 2B29A 2E2HB 3J7A5 4TRDA 5KFGA 1STAA 2GA4B 2IJ0A 4DL5A 1RYRA 2N88A 4JW0A 3FPUB 7ICEA 1I50H 3BQTA 3EUB2 1R4PB 4X64L 5CBAE 4R1JA 5KNIA 4UARA 1F2LA 2NRZA 4JYAQ 3RN5A 1IL8A 4I2GA 3PR5B 4KY5A 4K5XA 4DR2Q 3KDFB 4NXML 4KN7A 3ONNA 3PVXA 1PFMA 1N32Q 3A7LA 4HIKA 4E0DA 3ULLA 2ZT9C 3LDAA 2DY7A 2R7ZG 2RDJA 2LMCB 1CKOA 1PZID 1PZKD 4FXGC 3NXWA 4GLVB 3H40A 2JJQA 4XIGS 5KGUA 5BN5A 2B63G 2O5IC 4YXMA 2LFNA 1Z1BA 5IGDA 3RJFA 2JA6G 1QQ7A 2JA9A 1L3UA 4HAIA 1JWSD 4L63B 3U4ZA 2JA5G 5J0WA 5IILA 1GUNA 3F53A 5ALUA 1SNDA 4I65A 4AYBG 4JI4Q 2A69D 4O0IA 3MDAA 5DGAA 5J2DA 1KDBA 5TISU 2JEJA 2K60A 2FXQA 4Y2JA 4IZ8A 1X3EA 3BDLA 5EBDA 3VYUA 4Y7NB 4N9PA 2YMMA 2D6FC 4DR3Q 4KX3A 3J7ZC 2V4QA 8ICZA 1VJ5A 5AIAA 2EDUA 9ICVA 1IYUA 1NK5A 5GAEC 2BDUA 1ET6A 3M9NB 1XC9A 1SJED 2ODGA 4J9KA 3ICEA 3MR5A 1NAPA 1F0MA 4K4IA 1WCMG 5JPMC 5DDMA 2I5LX 3PMLA 3BS5A 1Y8PB 4JC0A 4F71A 3EZ5A 2A6HD 2FLPA 1YITA 4QIWB 2JA7G 7ICPA 4CKEA 1NJYA 5DDYA 8ICXA 2UXDQ 1S0MA 2SNMA 2HOIA 4MTNA 3DLLA 1N63A 2NN6I 2AUJD 2Z8LA 2CRXA 4K4GA 2DJFC 3M6KA 4HJ7A 3PUVA 3CC2A 3MABA 2G0AA 3AN1A 2EDGA 1NK0A 3N52A 1D8YA 4KY6A 3GTQB 5DLFA 4J9RA 1RL2A 5B66U 1RQNA 3KHGA 4K6LA 1TK0A 3ZD8A 4EZ6A 5A35A 2JA8H 3NBHB 1Q8KA 4C1NK 4UB2A 3HKZG 2M2LA 4UASA 3SVMA 2NYVA 1O7YA 3P20A 5TSSA 1PH6A 4NW2A 2QB1A 4NM1A 3HOWH 4UB3A 4KLKA 4GOPB 5HHIA 2KP7A 4RPXA 1PXUA 3STBD 4C3IG 2UXBQ 4IJLA 4NLCA 5I2XA 5L1IA 5D4BA 1KKXA 3H3VI 3FPPA 2F03A 1O7ZA 2XWJB 4JMUA 1KRPA 3L9AX 1TT2A 2LKYA 3RRHA 1G8ZD 2K5QA 3QNMA 7ICJA 3F2UA 1XMQL 4O42A 1HZBA 5HHHA 5KFVA 2MHVA 4PGYA 1S0VA 2HQLA 5K36G 3A0HU 3SR6A 4KLEA 4DFJA 4C8MA 2J4XA 4GNXC 3HJEA 1RYUA 1SXDA 3AQFA 3F2BA 1A3UA 1BPYA 3AFQA 1L3SA 2FE9A 3D2QA 1MHWC 5FLXE 4Z6EA 5EKLA 4J9LA 2A73B 9ICCA 3EIVA 2DBYA 3QU4A 1L8OA 1ZXIA 4CGYB 1JT8A 4LFBQ 2K4IA 1WVLA 2ZTEA 4BXXH 4B3RL 3MFHA 5J0TA 1IKMA 7ICVA 5KFBA 2LPEA 3T4AC 1FEZA 4J9OA 2CWPA 2VB2X 5IGEA 4RPYA 4IJHA 5C4JH 3KFUA 5JVG3 9ICQA 3NVWA 5FO8B 1T5XD 4IPGA 1BPBA 1RPLA 3DHQA 4NXMQ 3A0JA 1KHIA 4Q8FA 3WKAA 3GIMA 5CV6A 4DL4A 3QX7A 3C2MA 3L4PA 3F2CA 4ECTA 4MIUA 4POFA 2AKWB 4J03A 2PI5A 3GTPB 3M4PA 4RGTA 1A2UA 4M8AA 5AIBA 4Q5VA 2EZZA 3BVZA 5M3FH 3VCBA 2WF5A 2Z0SA 3RMHA 1H9KA 3BQ2A 1QUQA 4MZ9A 5KFRA 1BPDA 9ICBA 5FLXc 5C4ZA 4PZ6A 4IFDJ 4B3TQ 5DG7A 2WV6D 4B9MA 1URJA 3LWLA 2LYHA 3OOCA 4PZ7A 2E8GA 1N8RC 4OHJA 1VF7A 1ZYRD 4MFFA 3NTIA 2KCMA 3TDQA 3A8IE 5AKJA 5ALHA 2B2TC 1XSPA 3SAGA 2HDLA 3SEIA 5JUMA 5D3IB 2G5DA 3S1NB 1KC8C 4FXDA 5IGCA 2B3GA 2H4OA 4M1UB 2L15A 3VR4A 3RB0A 2YTUA 5D3DA 4RA8A 4DR7L 1DOMA 3H91A 5JJIA 1SDFA 3VA7A 4RPZA 4KLHA 3HX0A 1RIPA 2JEFA 2G9HD 2RQXA 3TZUA 4DV2L 5F9NA 2B39A 4Q45A 1SE8A 2FMCA 1LV5A 4UDUC 9ICPA 5JEAG 5C3EB 1YIJA 2HHHQ 4IOAA 2OQKA 4EBCA 2Q2IA 1N32L 2ZXIA 1A63A 1YHQA 1ZQ1C 5AI9A 2RCFA 4BWMA 3ZDCA 2QB0A 2F0VA 4QZ8A 4OWWB 3FM9A 4JWMA 7ICIA 4HEDA 4MNOA 3NRZA 4QIWC 3QWNA 3S1RH 5JEAJ 4C8LA 4OXPA 1HUNA 2ICIA 1YNJC 4MN3A 3HP6A 2K8AA 1SMYD 3T1YQ 1I6HH 1PK1A 4I2CA 2JQOA 2ZUBA 4C4RA 3V05A 4TVAB 5KFJA 4K8JA 1X9XA 2EZVA 2JXJA 1JJCB 2F0TA 1G6ZA 2KHIA 3BZKA 2L55A 3AEVA 3L3OC 4WJ3B 2JA7H 2QLTA 5I4DA 2H3ZA 5EWEA 7ICLA 4KLLA 2D62A 2D5DA 3FP9A 1SJHD 2Z7JA 4A3DB 5KFWA 1I94L 1XNQQ 3S14H 3PW4A 1TWGB 3OW7A 4QZCA 3G6EA 3G6VA 4FF2A 2F44A 1D9DA 1QSYA 3A56A 8ICUA 4ODGA 3E0FA 2KENA 1S72A 1R9TB 1BBUA 2YU9H 4CDCC 1SNOA 4CDGA 4O3SA 3CXCA 4A93B 1IZ6A 4PMBA 4AQYL 2UUAL 2F0JA 3H8WA 3N7PD 3K0YA 1BPXA 2FLNA 2NRXA 3GQBA 3RNUA 2Y1JA 1FVIA 2O4XA 3RZOB 8ICTA 1HH2P 5J2IA 3D3RA 2XY6A 1VQBA 2ZJAA 2HHVA 2HIXA 2DPIA 3GTGH 3RJHA 4NLKA 1ASZA 3V7JA 1HTPA 3ULJA 5J22A 1IBKQ 4HJAA 2SNSA 5CA7A 4DQQA 4UPAA 4DUYQ 1VQ5A 2ZM6Q 2R93G 5KT6A 2KCCA 4DL6A 2KUMA 3L0OA 2HHTA 4RGNA 3T1HL 4A3KH 2F4VQ 4DR2L 2JA8G 2KKPA 5KFOA 1I4PA 3PNCA 1SNCA 2KEEA 4Y2TA 4LZDA 3HKSA 4C3JG 4ED3A 4ECZA 4ZUIA 1MSWD 5DBAA 1GUWA 3OWFA 5CGKA 3I4NH 2C2DA 3D8GA 1X65A 2W04A 4JI8Q 3KZXA 5E3FA 1D2BA 4Y2VA 2K14A 2RLTA 3GU3A 1LV9A 1PMRA 2KJXA 1RQLA 1OXTA 4NPSA 3QU2A 4RT2A 4RQ2A 1SL2A 5KT3A 1K9MC 5C3EG 1N33L 1B43A 5C44G 4BBRB 4LF7Q 4KX5A 1TS3A 1GJXA 3HS0C 4I27A 2LSSA 2IA6A 1JR0D 4I2IA 4ZH4A 3DEOA 4RQ0A 1PTOH 2I07B 4DPGA 1ZJMA 4DSKA 1D5XC 1IL2A 1Z9FA 5KFAA 5T14A 4DLGA 4P0PB 2XIWA 3GTKB 4I2DA 3N7SC 2DJGC 4X3UA 1WD1A 1G91A 2XRQD 5KG5A 1PRTB 2EYPA 2KV2A 4M9NA 3WOEA 4TUPA 1MSHA 3TARA 2Q2HA 5HNKA 3QB3A 1TWHH 4DSLA 4Y7NH 1GVPA 4UB5A 4O3RA 4G7ZC 4IFDI 4LW1A 2E5LL 1YT3A 1S5BD 2HDMA 3CQZB 4YY3Q 3PO2B 1ASYA 2M9NA 2YMLA 1Y88A 4DNRB 1MC8A 1SV0C 2PI4A 1WTHA 1MIUA 4MFCA 2KEDA 4C3IB 1Y8OB 3EJIA 2NVQB 2X6LA 1PZJD 1NZBA 1CZWA 2K33A 5M3MG 4C7ZA 3SYZA 5KG3A 5J2AA 2D8CA 1TIID 4FF4A 3KF8A 2W54A 1Z1VA 4GLXA 3A5UA 4LF4Q 4G9BA 3PZPA 2JEGA 3J7YW 4R65A 4LF8L 4OEMB 4H0LC 4WORA 4BY7H 3GP7A 3VYRA 1AP0A 5ALQA 2F0WA 3C1YA 4Z6FA 1I4XA 4XT3B 2YU9B 4RNNA 3KK7A 3EVQA 4R4CA 4K6DA 4LF7L 2KK0A 1KAAA 3ISDA 4GOPC 2DQNB 4P73A 2O5JC 2H1EA 1ENAA 2JMGA 2GLEA 2FMSA 2DL0A 4ZAIA 3TP7A 2F77X 4WFN3 5IIJA 4B9LA 1L2FA 4DS4A 1Q3LA 4EYIB 1WYDA 4A3BG 2JA7B 4OJLA 3Q8KA 5G5HA 3UXNA 1ZQKA 2K01A 2IW3A 2UU9L 4C8OA 2LHTA 2B2WA 2EYFA 1SYEA 3H0GB 3RD4A 4A3JG 2HCCA 3I4MH 1PH5A 1DOQA 4XRHA 4QWDA 1BO0A 1I6HB 4A93G 5M5YH 1C7YA 4C2MH 3MZ5A 2JHDA 1WCNA 1KFSA 1FNUA 1SNQA 2C9OA 4B3MQ 5CV4A 1JALA 5KG4A 1NE3A 5CWRA 3FKIB 3JC66 9ICAA 1FR3A 3CC4A 2F8LA 1U4PA 4R4TA 2A1AA 4RQ3A 4NMZA 2ZJRA 4P2CB 3KOOA 3NVYA 4YWKA 2R93B 5G3LF 2E8NA 3RJEA 3X3NA 4KMUC 4DV2Q 3GQCA 2JGAA 5J0OA 1PFNA 1SN8A 1K3RA 4B9XA 3UPQA 1E1OA 3C46A 3E6ZX 9ICRA 4YD1A 1E2VA 2WINB 5J0RA 3PY8A 2VIXA 9ICSA 3PCOB 1W2BA 4IRKA 4F92B 3H09A 3BJUA 7ICRA 2CHBD 4XTCS 2PNRC 2Q8RE 2VZAA 3I4MB 5J2CA 2KE7A 1S5ED 2KVCA 4F5QA 1UWVA 2HBMA 1Q46A 2KA7A 5J0XA 1IBKL 3C2KA 2XSCA 3TAPA 3ISCA 2XCPA 2F0EA 3VR5A 1ZQOA 5FKAC 5DB8A 5J2HA 1KW4A 4ED7A 4CKCA 5HGTA 4X66Q 2C28A 1ONLA 2ZJ5A 4PQXA 5IGBA 3MXUA 5CEHA 1KDCA 2ZXPA 1H9JA 1KQQA 3KF6B 1S77D 4XYOA 3D6JA 1Z3EB 1YBYA 3M8SA 4RQ1A 1L6NA 4ZKBB 3JAML 3OMGA 4FZNA 4BY7B 4DV3L 2DFLA 8ICQA 4BWGB 1MKHA 3T1YL 4TSSA 1X6IA 3TN2A 1TK5A 3CCEA 1HNZL 4GN3B 1YNNC 1QVGA 4KHPL 1SNPA 3NTKA 1TAUA 2QEXA 1XNRL 2ALZA 2E1FA 1AZPA 3Q8RB 2DUDA 2CN1A 5ELOA 3S9WA 4RQMA 5KG0A 4QWBA 1DXMA 4TURA 1BCPF 2K5HA 3KLWA 4CDEC 5C4JB 2ZM6L 1CA5A 4YY3L 1QQ6A 2F1IA 4PGXA 1EOTA 4GC7A 3WK5A 1BVSA 1RHPA 1HIWA 3PO2G 5KFTA 2JSOA 5T1GA 4BXXG 3WK6A 2KTQA 3IFTA 1GUSA 1EY9A 3PF4A 3IP4B 4OIJA 5EE1A 1E22A 3GFKB 3C5FA 3KFUF 8ICKA 4KV6A 4DL3A 3NWSA 4UB4A 1E1TA 3TFSA 1SRUA 3HWTA 5CBEE 5IP7H 1JJGA 5CB1A 4IO9A 4RT3A 1Y1WH 5F3XB 1RJTA 4TUSA 4LFCQ 2OXOA 2LM1A 3PSTA 1PTOB 4UY8C 5IYBG 2JEIA 3BG3A 3RB4A 4C8KA 1KNEA 1T4GA 2FMPA 1E2ZA 1RCVD 3UMGA 3AUOA 3SHLA 1L7OA 2KCTA 4JV2A 3H3VC 2RHFA 1SYFA 7ICKA 4ACOA 2W9BB 3MEHA 3T16A 3E2EA 1Q82C 4UAZA 4B9WA 5M3MH 4DOAA 4DO9A 3WKDA 2PFPA 1PYBA 1QUQB 5ISRA 2ZXOA 4DV1L 1CFMA 2IMWP 4ZK9B 4QGUA 2E76C 2N78A 2XI9A 4ALPA 3PIO3 3MR3A 2IWHA 5C0XG 5EQ0A 5IWAL 1UE1A 4HTHA 4ID6A 4DK1A 4I2FA 3SR1A 3K8AA 4H13C 2UVVA 4DQIA 2FLLA 2VUMB 2JA5B 2EH9A 2F76X 2OM6A 4MHEA 3TZDA 4YQWA 2EAMA 4R66A 4UB8U 2PQAA 3S1MB 2R7ZB 1SYDA 4NWIA 3K58A 3M9BA 3U50C 4O2DA 2PPBC 3EN2A 1TWFB 1NOMA 2PQAB 4GN4B 1PH7A 2C5CA 4JI0Q 3HKZB 1B1ZA 1BCPD 3TBIB 3J81i 4JI5Q 1C20A 4IUQA 3RLNA 4A3MH 2MRLA 4UBCA 3NRWA 2OEHA 3QOJA 2LBOA 1I4GA 2N55A 4ZYSA 1J97A 4CF5A 3WKBA 4ECVA 4B9SA 4A3GH 3U9SA 4UW9A 4LF6L 4ZKCB 2RRDA 2ZJ8A 2EXDA 3DDHA 2AU0A 4EX5A 2ES2A 2R7DA 4S3SA 1W3SA 5LMUQ 3HKZC 3HKZF 1CT1D 1JJ2A 1J2MA 3GTMB 1U0LA 4JYAL 4KKSA 2KICA 3RAXA 1V1QA 2KHSA 1JB3A 1XMOQ 4ZOHC 3IL8A 3SXHA 3CHBD 3EWAA 2N49A 1TY2A 4DNIA 3CP0A 1ZQRA 3GTJB 2EAOA 1HZ9A 2KHVA 3A0BU 3IG8A 5ALVA 1U4BA 5IT9L 2UXCQ 1ICFB 3I55A 3DWPA 3FMCA 4DV5Q 4JI3Q 1Y1WG 5BPCA 2IBKA 1U45A 3KF6A 1L1OC 1IW7C 3F1ZA 2QCPX 4LF9L 1NK7A 1JMSA 2LS01 3GTOB 5KEEA 4OJ6A 3PW5A 5LMNQ 5J2BA 3AM9A 1B4FA 5IIMA 3JAME 4IL6U 2AH5A 1HQMC 2JEBI 1STHA 3J7AF 1NJWA 1ZYQA 5GTHU 1PH3A 5ALYA 1FD7D 5KG2A 3V7KA 2UVWA 3M85A 4HJ5A 4JI6Q 4KI0A 5IP7G 4ZUJA 3OJUA 2H5XA 1S5LU 3CP8A 4CNQA 2DKXA 4IQVA 2K5NA 3ONAB 1YNXA 1L8LA 3SK5A 1AROP 1MJCA 2H3QA 3ETRA 1IG6A 1SE2A 1S4ZA 5AKYA 3OHBA 1SIJA 3Q8DA 3K0XA 3SE0A 4KMUA 5F2DA 1NZPA 2RDFA 4A3FB 3GIIA 4CBVA 1U9LA 3J7AV 4NDXA 1T94A 2BCUA 1AEXA 2DWQA 4M0AA 2VA3A 4A3JB 1SKSA 1ZQVA 1CUKA 4YWMA 2OTJA 4ME3A 2ATLA 4UAWA 5EPLA 3H0MB 2KZ3A 1JE4A 3MXNB 4K5VA 4PZOA 4QZAA 1PH9A 4OX9Q 2UXDL 2A3VA 4HN7A 3HW8A 1SGGA 1NKBA 2NVYB 1B50A 1TE2A 1NKEA 5NUCA 4RQ6A 4PHPA 1VDZA 4C56C 2HIVA 4ED2A 3K7AB 4R63A 3A74A 4CJ0B 2RHSB 1ZQPA 1WCLA 2XRSD 1Y69U 3BJYA 1VQ6A 1KEJA 5IIKA 2I6XA 3LWEA 1XPUA 3HOZH 1F2ZA 3I7FA 4KKTA 4BGDA 2WAQC 5AJ3L 5IIOA 1X42A 1F5SA 3OW2A 1BPEA 4PJ0U 8ICAA 3NQIA 1VQNA 4IQUA 4UB1A 9ICMA 2ATWA 1HJPA 4A3LG 2X6GA 3J81L 1Z00B 3OIPA 4QW8A 2Y9UA 4RG1A 2F0MA 4R4IA 1XPOA 4KHPQ 4O9MA 5AI5A 3K75D 3RR5A 5IGFA 4LFBL 3M7GA 3KTQA 1YHBA 3JPRA 3PMNA 3KHLA 4CRXA 4M9GA 4F4WA 3RTVA 1FJGQ 2FFKB 2EANA 2ZTCA 4EEYA 4QUFA 5FJ8G 3KD3A 2W9CA 2MSNA 5ALEA 2K8CB 4Z9CB 3J81c 3G6JB 4FDBA 3H8MA 3RUZA 3OTOL 4OX9L 2ZG6A 1IHZA 3H8SA 1LKYA 2GOLA 1X55A 2BA1A 2NZ1D 3RZDH 3NBHA 2NTTA 5CV5A 4ILWA 1JQYD 3RB3A 2BE5C 2AGOA 3LNNA 4CDFC 2F0SA 4KHVA 3KJPA 2R7FA 4DV0L 3M3YH 4KN4C 3ZDDA 1EY4A 4DK6C 3I76A 1XSNA 4CF3A 1JORA 9ICXA 3RR7A 2MU2A 3PUYA 2IY5B 2IX1A 5IGGA 3TADA 3R9KA 4RFBA 4JI0L 1EYGA 5EWFA 3HOWB 5CHGA 3V96A 1L1OA 2F3NA 4P75A 2L5TA 3G6YA 2P6UA 3PX0A 2E75C 5H2FU 4A76A 4A3FG 1N5WA 5ALZA 1S3OA 2BPCA 2RSOA 1VQHA 1PTOD 3GTQH 5C5MA 3HOUG 1CTMA 3CCMA 4FO2A 4LUOA 3MDCA 1NR2A 1A77A 3ALRA 1STBA 4F4YA 4QZGA 4Q44A 3EPGA 1K83B 4N8X1 1KN5A 4RU9A 1E24A 2K5WA 4PPXA 4I29A 5CC4A 2RKSA 3D2SA 1N34L 2UUBL 4KLFA 2VQEL 4GZYC 3N6RA 3LVWA 5FLMH 4RKBA 2VA8A 1F77A 1NSNS 2EAPA 2I0QA 3K7UC 1OXUA 2K4KA 4DV1Q 4EBDA 4IQWA 2R8IA 2BH8A 3NQTA 3L5KA 4QWEA 3CD6A 2EY5A 2UVUA 3BYYB 1PRTD 3U9OA 1Q86C 2A1JB 2PYKA 4PH5A 1ZXTA 5L37A 4OO1J 1J2NA 4BA2I 1WJJA 4HAEA 4P72A 1STGA 1DGSA 1PZNA 3HOXH 4B3ML 4QWAA 3PO5A 2YQEA 2GH1A 2J6TA 4DSJA 1Q12A 5GAGC 1IYJB 5A0LA 4FE3A 1XPRA 4ZCKA 1GHJA 5C0YA 1EU3A 4CCHA 4KTAA 2E8PA 5KG7A 2UXCL 1ZQZA 1ZQTA 1NR4A 4X3KA 3RBDA 3MXNA 8ICNA 3ORYA 5G3LD 4ZRZA 1F2YA 4RQ4A 1WCMB 1E7ZA 4ECWA 4KD3A 4X62Q 4ED6A 2NVYH 2IPKD 3ED5A 4BDPA 2LM4A 2KHJA 1VLBA 1Z00A 1YZ6A 1IIPA 1Z47A 1EY0A 2Y0SB 5DB7A 1EIFA 2QARA 2AGQA 7ICSA 1SWVA 5EKKA 5M5WB 4R9WA 4RAUC 2A6ED 3B6YA 3ND9A 2Y1IA 3J80i 1QZHA 3HGBA 3TSSA 3FRPB 3TS2A 3T3FA 1WCMH 3OPXA 1CQFA 4C3JB 2QDBA 1CSQA 3WU2U 2A19A 4PHEA 3UQ0A 2KSOB 2IT1A 5C3XA 4IFDG 2I9GA 3H6MA 1E3PA 1H9MA 4P2HA 1ICWA 4LUVA 4MF8A 2OH2A 2W55A 3M6ZA 1ILQA 4JPBW 3A8KE 2VQFQ 1BBXC 1C48A 1E0BA 4CHTB 5CORA 3UMBA 3K4GA 3M7NA 4Y2QA 2WB1C 1HUMA 4RKLA 1AZQA 4A3DG 3SENA 5C4XH 1F44A 1UT5A 3E0JA 4BBSG 2AWNA 1GOZA 1JIHA 3FKIH 2J6UA 1FFUA 1FGUA 2W9CB 1KNAA 1U9RA 3I3CA 3S2HH 3KKAA 1SKWA 3QOLA 4O3QA 4LF9Q 4USAA 3GZFA 5EJWA 4C2MB 4LFCL 3ETLA 1Y1VB 4KMOB 4DS5A 1W6JA 5E1FA 1WG8A 1VQDA 9ICNA 4H02A 4A3KG 4YCWA 4JV0A 2G5IB 3A8JE 5J0PA 4JBMA 3J81E 4DR5L 2C35B 1ENFA 2K6AA 1NY4A 4LUZA 4QMGA 1H38A 2ASLA 1BNZA 3E58A 2NUCA 1S5FD 4RQNA 2F0FA 1H9SB 5KNBA 2B63H 4KJNA 1HZCA 4Y2UA 3D6CA 2FJ2A 5J0QA 2LY7A 3JPPA 4NB3A 1QSSA 5EOZA 2D0PA 1G291 1JOOA 5LMNL 2DF4B 3M7DA 4FFDA 4F5RA 1HFGA 5ELNA 2IHNA 1ZD3A 1VMCA 4NP5A 4QCLA 3UM9A 1BCPC 1ZQXA 5KAFU 4ECYA 3DMUA 2K4PA 2AMCB 1X32A 2PXIA 5GAHC 4P4PA 3SAHA 1WYGA 5CV9A 1WTXA 2B8FA 2QW7A 1PTOC 3DWAA 3HRZC 1WWUA 5AI4A 4Y2SA 1SYGA 3X3MA 5E4XA 4NM2A 2NVQH 1B3AA 4I2JA 5BN3A 1ZQAA 2E2IH 1E2WA 5KFMA 3Q8PB 3TS0A 2YMPA 2EQYA 3N4MB 4B3SQ 1EUJA 2GWSA 2D2CC 2BKEA 4BS9A 2KEYA 1V38A 3PO2H 4DR6L 1PTOF 1SZPA 1CHPD 3MXPA 2F3IA 1LTBD 3U26A 2EZXA 4DOBA 2LXJA 2Q0ZX 1TWHB 3OSPA 3KF8B 2NTSA 4XT1B 3CYMA 3LYSA 4HIOA 1VQMA 1MN8A 3TKAA 4DU9A 3HOVH 1IKLA 2VUMH 1J6QA 4I7AA 4QWCA 2HOFA 2OT2A 3NE5B 1ESFA 1EYDA 2I5MX 2JR5A 1MSGA 2BOSA 3BVGA 4R4QA 5IODA 1OXJA 1JOKA 3D6WA 3CF5A 1K8GA 4L6TB 1JOQA 4DUYL 3HOXG 4ECSA 1TS2A 3W1GA 4O5KA 1G2TA 4X65L 1ECWA 2JZBA 3MC1A 3SEBA 1Y14B 5KRUA 4U7CA 5DKWA 1BNOA 3EPIA 5ALPA 1QOHA 1JB7A 3HOZB 2ASBA 4I7ZC 3QG1A 1DGJA 1K28A 1PV4A 2PZUA 1L3TA 1BR9A 4P4OA 1A6SA 1SFOB 3M1YA 1X3GA 2ZXRA 2F0KA 2VQEQ 1SE4A 4BWJA 3OYYA 4WJ3M 5JTIA 4GC6A 1LM0A 4XQJA 1J8IA 5EE0A 1P8LA 4B9UA 1GHKA 1SV0A 1U5KA 2AHOB 5AM5A 1ZRNA 1RG6A 5KFUA 1A15A 4HCSA 1D8BA 1K0RA 1OXVA 1KQSA 4EX7A 4JK1C 2BQRA 2FMMA 4A3KB 3AMUA 5KT5A 5C0XJ 1S0NA 8ICYA 4DV6L 2HT1A 1ZD4A 5JJZA 4B3TL 1GUTA 4DF4A 2Z6KA 1SBBB 3GDEA 5AK6A 2HVIA 4L5RC 3CPFA 2M00A 2YTYA 5AKGA 3I2ZA 2G5HB 4JOIA 4A3FH 4M47A 4ECUA 5KL8B 4YMNA 2TSSA 1TWAH 1EQQA 1TAMA 1UA0A 2OXPA 1J5EQ 1X54A 3KOJA 1KL9A 1AFPA 4P71A 5FO7B 2MP1A 3F5EA 1VQLA 4XUSA 4LAAA 3NVVA 2DGZA 3C28A 3R3OA 3NP8A 5DBBA 1L1OB 3PMFA 1HR0Q 1VQ8A 3PW0A 1T7PA 4GNXA 1DONA 1EYAA 4MEYA 3P7JA 2DUYA 2YB4A 5DGBA 1ET9A 2DNCA 3HOVG 1B7YB 1TXYA 2PKEA 4QNLA 4A3EG 1TWGH 2B2VA 5AK5A 3UDFA 1HXYD 1PYSB 1QJOA 1S40A 4ME5A 1IV8A 3NEMA 1Q7YC 2H3VA 4O3MA 1B44D 4JBJA 1KXLA 4FNFA 3UE0A 4AYBC 3MGIA 3SV3A 5FP0A 9ICTA 2P35A 2GVAA 4F8RA 2XO7A 1TVXA 1HUOA 2WIIB 2UUBQ 2MAXA 2VJ5A 2BCVA 2BCQA 3MGVA 5DAUA 3DXJC 2B0CA 2Y0SF 1EU4A 3NHHA 5M5XH 4YCXA 2I1QA 1EY8A 2PMZC 2ZJPA 5ALJA 2VS1A 4DR3L 4C4SA 3EA6A 4A3EB 3Q8LA 3BS7A 1II3A 1RD9D 2HD3A 5KYIA 2F0QA 3R2TA 2O6KA 2KQ3A 4BY1H 4DEZA 2R93H 5J0YA 5CR0A 1BCPB 3NK9A 4A3GB 5EPJA 1RXVA 4JI7L 1U4MA 3LGJA 5FJ8H 3QUTA 1KRSA 1VQJA 3KYHC 1JCKB 2PW7A 2HHXA 1YJWA 2DGYA 2E5LQ 5C3WA 5TZVA 7ICNA 1YEZA 1HA5A 1TWFH 1SL0A 1NK9A 5M5YB 1A2TA 3E0EA 1I4HA 4KLIA 1EIGA 3RN2A 1KFTA 3H0GH 5A2QL 4JCVE 1V97A 1O7IA 2DN8A 4ULLA 5LMNW 5AK4A 4CGZA 2AUKA 4KLQA 1B3QA 3AMZA 4BUGA 2N3SA 3MR2A 1ZYRC 4WRDA 3C5GA 1WI5A 1KD1C 5IWAQ 1KSPA 3VA5A 1YZ7A 1DJRD 2XICA 5J29A 4EQNA 1I5FA 2YB1A 1QE6A 3OSNA 3UDIA 4IRCA 1D5MC 1ML0D 3GILA 5L1JA 2NN6G 3VDYA 4O3NA 4LF5Q 2JRZA 2BR0A 2OHFA 3JPNA 3KJOA 1QWYA 5IOCA 5M3MB 2K5DA 3FC4A 1ZQEA 3A54A 3QU9A 3I4NG 3S17H 5KFIA 3WKEA 1O7LA 1UAPA 1Y1VG 2JV3A 2KNJA 4EX6A 2WTFA 5CV8A 3ER0A 4IN3A 2WB1E 4GIBA 3OPOA 2R8HA 3RZDB 4YN4A 4QW9A 1V43A 1I6VC 1U49A 2MA1A 4K8IA 4DV3Q 2EY1A 4DF8A 3K59A 3BDPA 2IOFA 4N9TA 1YHAA 4B9NA 9ICOA 1S76D 8ICWA 5DM73 5DQIA 1L0XB 3CRKC 1RM6C 1HUZA 1PH8A 2C2EA 1STNA 4K14A 4ECRA 3T51B 2YX8A 1K1SA 1CI3M 2HI0A 4X66L 5C44B 2KVMA 3GTKH 2PZWA
chains in the Genus database with same CATH topology
1N34Q 1XMOQ 4AYBG 4J15A 2HHHL 3E9IA 2FXQA 1BBWA 1X3EA 2N49A 4DNIA 3CP0A 3G4SA 2JA6H 1X6OA 4DR3Q 3J7ZC 1YI2A 1HZ9A 4BBRH 5H1SE 2UXCQ 4IPCA 5GAEC 3I55A 4DV5Q 4JI3Q 5IYCH 4GS3A 1Y1WG 1HNWQ 3ICEA 3KF6A 1CSPA 2R7ZH 5C4XG 1K83H 1L1OC 1WCMG 3FHWA 3F1ZA 2I5LX 4LF9L 1UE7A 4O0AA 3UDXA 4JC0A 2JA7G 1AH9A 1YITA 5LMNQ 1I3QH 2Y0SG 2JEBI 1WOCA 3S24A 1JE5A 2UXDQ 1PH3A 3M85A 4HJ5A 4JI6Q 4MTNA 5C0XI 3DLLA 4KI0A 5IP7G 2NN6I 3CCQA 2H5XA 2YYZA 1IXRA 2JE6I 2K5NA 2PMZE 1YNXA 3PUVA 4HJ7A 1VQKA 1MJCA 1NBWA 4IPDA 3CC2A 3Q8DA 1UEBA 3SGIA 3OTOQ 3K0XA 2MNAA 2CFMA 4DV5L 4DR6Q 5IYDH 1HNWL 1RL2A 2CKZB 1X56A 3PO3H 2JA8H 3NBHB 1Q8KA 1SROA 3HKZG 4JBKA 1PH6A 3HOWH 4YWMA 2OTJA 1CUKA 4GKKQ 2UXBL 4KLKA 4ME3A 4DV4L 5JJLA 4GOPB 3STBD 1GM5A 2UXBQ 3GTMH 4IJLA 4JI6L 3MXNB 4DK3C 3K81C 4LFAQ 1IBML 1PH9A 4OX9Q 2K52A 3H3VI 2UXDL 3PV0A 4BY1G 5BR8Q 4AIMA 1I94Q 1XNQL 2E2JH 4HJ9A 4A93H 2CWAA 1XMQL 2ALYB 2K5VA 2XTIA 1TWCH 1NJIC 3HOUH 2HIVA 1HZBA 3GTOH 4A3IH 4A3EH 3A74A 1VQPA 2HQLA 5K36G 2RHSB 1LUZA 4GNXC 1VQ6A 1XPUA 3HOZH 4YHHL 2YTXA 4TQUS 3I7FA 3BU2A 5AJ3L 3F2BA 3AFQA 3OW2A 1VQNA 2ATWA 2MFIA 1HJPA 4A3LG 1B8AA 2VY3A 1FL0A 3EIVA 2Y0SE 1JT8A 5HGQA 4RG1A 1SMXA 4R4IA 1XPOA 4BXXH 4KHPQ 2ZTEA 4LFBQ 4B3RL 3PSIA 3I4MG 3RR5A 4LFBL 2BA0A 1YHBA 3PGZA 4BY7G 1K8AC 2WP8J 2CWPA 2V1CC 1YJNA 4IJHA 5C4JH 2UU9Q 4POGA 3KFUA 3S2DH 1FJGQ 2F4VL 2ZTCA 4IPGA 5FJ8G 4NXMQ 3A0JA 1KHIA 4A3CG 2CCZA 3F2CA 3J81c 3UE1A 4POFA 4FDBA 2AKWB 2R92H 3H3VH 3M4PA 3OTOL 3U58A 4OX9L 3HOWG 3GTLH 1VS0A 2BA1A 1X55A 3RZDH 2E2HH 5FLMG 4LF5L 4A3JH 4DV0L 2PI2A 3KJPA 2ZJQA 3M3YH 2R7FA 3TREA 3S1NH 5M3FH 4DR4Q 4DK6C 1A0IA 2Z0SA 4HJ8A 4A3BH 4MZ9A 2OQ0A 1QUQA 5FLXc 3CQZH 2RF4A 4X6AH 3PUYA 4IFDJ 4PZ6A 1EQRA 2IX1A 3S1MH 2IY5B 4B3TQ 4JI0L 4PZ7A 1N8RC 1EYGA 4DR1L 2E8GA 4OWXB 4NXNQ 1L1OA 2KCMA 1XTDA 4P75A 4OONA 4A76A 1IBLQ 4AYBE 4DV7Q 4A3FG 1S3OA 1KC8C 1VQHA 3GTQH 3HOUG 1C0AA 2B3GA 5IE8A 2LXKA 2L15A 4IPHA 3CCMA 4LUOA 4DR7L 5JJIA 4K0KQ 2CQOA 5JJKA 4DV0Q 4DR7Q 3CAMA 4DV2L 1RIPA 5AJ3Q 3GTPH 1E24A 1Q1EA 1SE8A 5JEAG 1YIJA 1P16A 2HHHQ 4IOAA 1D7QA 2OQKA 1N34L 2UUBL 2Q2IA 4WJ4A 3L2PA 4UP9A 1N32L 3CC7A 2VQEL 1A63A 5FLMH 2QGQA 1YHQA 1K73C 3GTJH 2I0QA 3J81j 3CCLA 1EWIA 3K7UC 1OXUA 1VQGA 2K4KA 4DV1Q 4OWWB 1L0WA 2BH8A 4MNOA 2MO0A 3S1RH 5JEAJ 4OXPA 3CD6A 4JI1L 3T1YQ 1I6HH 2XGTA 2JQOA 3PIOA 1Q86C 4LNQA 1QVCA 2IHFA 4TVAB 4DUZQ 4BA2I 1JJCB 1WJJA 4P72A 4EQ5A 2EQSA 2KHIA 1DGSA 3HOXH 3BZKA 4B3ML 4A3IG 3AEVA 2JA7H 1Q12A 5GAGC 1IYJB 2D62A 4JOIC 3FP9A 1XPRA 3HOYH 3CCVA 1I94L 5C44H 1XNQQ 3S14H 5LMUL 2N8NA 1QZGA 3G6EA 2UXCL 1S72A 2KENA 2NVTH 1LTLA 2YV5A 1BBUA 1E7ZA 2YU9H 1SLJA 4C3IH 1YVCA 2NVYH 4X62Q 3CXCA 3RZOH 1IZ6A 4AQYL 2AWOA 2UUAL 3TRZA 2KHJA 1YZ6A 4BBRG 4AQYQ 1Z47A 2UUAQ 4BBSH 1EIFA 1A8VA 3RNUA 4JBWA 1FVIA 3B6YA 4QY7A 1CKNA 3EBEA 5DLQE 3J80i 4BA1I 3W5OA 1X3FA 4JI8L 1QZHA 1M1KC 1WCMH 1R9TH 3TS2A 1HH2P 4YCUA 1VQFA 4A3MG 1J5EL 1VQBA 1CSQA 2HIXA 4A4IA 2JA5H 3GTGH 2A19A 4X64Q 2OTLA 1ASZA 3ULJA 2IT1A 1N36L 1HNXL 4IFDG 1IBKQ 1XMOL 4HJAA 4A3GG 1E3PA 5J3BA 3M4OH 4UPAA 4DUYQ 3F8TA 4LUVA 1VQ5A 2ZM6Q 2R93G 3CPWA 2K50A 2GVBA 1VQ4A 1PHJA 3WWVA 3L0OA 1FJGL 3T1HL 2VQFQ 4A3KH 2F4VQ 4DR2L 2JA8G 2UUCQ 4GKJQ 3CW2C 1KRTA 3M7NA 2WAQG 3HKSA 4DKAC 4JI2Q 4A3DG 2R6GA 5C4XH 3I4NH 4BBSG 2AWNA 5E7NA 4LFAL 3FKIH 1X65A 1FGUA 3S2HH 4JI8Q 2K14A 4Y52H 1KAWA 2IHEA 1HNZQ 3PF5A 2PI2E 4NPSA 4LF9Q 1OXTA 2Q2UA 1N33Q 4LFCL 1N33L 2Z6KC 5C3EG 1K9MC 5C44G 1VQDA 4X62L 2VW9A 4H02A 4A3KG 2BH2A 4LF7Q 4YCWA 4JBMA 2ID0A 2LSSA 4DR5L 2C35B 1T9HA 1A62A 4LUZA 1NY4A 1VQCA 4DPGA 1IL2A 4GLAC 1Z9FA 2B63H 3FKIG 1OXXK 1N9WA 1HZCA 4PZ8A 3E9HA 4HIDA 4NB3A 1D8LA 1VCIA 2D0PA 1G291 2Q2HA 5LMNL 4GKKL 1TWHH 3H0GG 4Y7NH 1C9OA 1GVPA 5ELNA 4IFDI 2NZOA 4LW1A 2E5LL 1QVFA 1X9NA 5IP9G 5IYBH 4YY3Q 1HR0L 1ASYA 2AMCB 3RLFA 5GAHC 2NZHA 2PNHA 4DV6Q 2IX0A 1MIUA 4GKJL 3KDFA 2F52A 4AH6A 1PA6A 2KBNA 1NTGA 4C3HH 5M3MG 2NVQH 2E2IH 3TS0A 2VL6A 4B3SQ 4LF4L 4A3DH 1EUJA 4GLXA 3A5UA 1YJ9A 4B3SL 4LF4Q 1MJEA 4IOCA 1V9PA 4LF8L 3PO2H 4DR6L 2RHQB 4BY7H 1UE6A 2GN5A 1NMFA 2F3IA 3ZJYC 4JV5Q 2LXJA 1XJVA 3KF8B 4HIOA 1Q81C 4APVA 1VQMA 4R4CA 4LF7L 3DM3A 3G48A 3HOVH 2VNUD 2VUMH 2EIFA 1J6QA 2JK8A 4GOPC 4P73A 1WFQA 2I5MX 4R4QA 1CKMA 5IY0A 1L2FA 1WYDA 4A3BG 3K80C 3GO5A 4HIMA 2WB1G 3CF5A 1K8GA 4JV5L 3H15A 4DUYL 3MEFA 2UU9L 4A3JG 3HOXG 3W1GA 3ULPA 2WAQE 4X65L 4YHHQ 3I4MH 1PH5A 3CMAA 1Y14B 4JI7Q 2R92G 1JB7A 5M5YH 1C7YA 4C2MH 4LF8Q 2ASBA 3I4OA 4A93G 1PV4A 3UDGA 2VUMG 3S1QH 4B3MQ 1B70B 1X3GA 4PG3A 2VQEQ 1NE3A 3CCUA 3JC66 3OYYA 2JA5G 3HOYG 4WJ3M 1GKHA 1LM0A 3CC4A 1N36Q 1HNXQ 1P8LA 4R4TA 2A1AA 5EAYA 1U5KA 3NENA 2AHOB 4PMWA 4DAMA 2ZJRA 4UP7A 4YWKA 1VQOA 2QA4A 4QQBX 2I5HA 4DV2Q 1K0RA 1OXVA 1KQSA 4L5SA 3J80c 1SN8A 1K3RA 4DR5Q 1E1OA 2ZTDA 5C0XJ 3HFZB 1G6PA 1SFOH 4DV6L 2OWOA 3PCOB 2HT1A 4B3TL 1W2BA 1EIYB 2Z6KA 1LYLA 3BJUA 3GDEA 4L5RC 4XTCS 3CPFA 4A3CH 4NXNL 4OO1I 3I2ZA 2YTYA 4JOIA 3M4QA 4A3FH 2VZAA 4GOPA 1PH1A 1BKBA 3HKZE 3AQQA 1TWAH 2MO1A 4UP8A 5IT9c 3W1BA 1EQQA 1UWVA 4K0KL 1J5EQ 1Q46A 1X54A 4L5TA 3KOJA 1KL9A 1IBKL 3NELA 4P71A 4JI4L 3CCRA 1VQLA 4RMFA 4X66Q 1L1OB 1HR0Q 1VQ8A 4GNXA 4X65Q 4R4OA 1IBMQ 3L7ZC 4A3LH 1PVOA 3D0FA 5GQOA 3KF6B 4DR1Q 3T1HQ 3HOVG 1B7YB 1TXYA 3CCSA 4A3EG 1YBYA 1TWGH 4JI3L 3UDFA 5GADC 1PYSB 4KHZA 4QJFA 4DV3L 4LWCA 3ERSX 1VQIA 1S40A 1MKHA 3T1YL 1KIXA 3NEMA 1Q7YC 3CCEA 1IBLL 3PO3G 4JI1Q 4P74A 4JBJA 4GN3B 4JG2A 1QVGA 5IYDG 1HNZL 3UE0A 2JEAI 4KHPL 3STBC 1KXLA 2QEXA 3BZCA 1XNRL 4L5QA 2DUDA 5ELOA 2WFWA 2GVAA 3CMEA 3KLWA 2K5HA 2ZM6L 5M3FG 2UUBQ 5BR8L 4YY3L 2NVXH 1SR3A 5M5XH 2ZJPA 1BVSA 3PO2G 3TEHB 2VS1A 4DR3L 3K7AH 4QIWE 4BXXG 2OCEA 2D0OA 2RCNA 3PUXA 3PF4A 3AYHB 1E22A 1H95A 2MQHA 3AFPA 2YTVA 4BY1H 1E1TA 2R93H 3GD7A 1SRUA 1Y1VH 4JI7L 5IP7H 1JJGA 3LGJA 1NMGA 4JI5L 5FJ8H 4IO9A 1Y1WH 1VQJA 1KRSA 3KYHC 5HY6A 2UUCL 4LFCQ 1YJWA 3HOZG 2DGYA 2E5LQ 4UY8C 1OXSC 5IP9H 5IYBG 2A8VA 1XNRQ 4YWLA 1YEZA 3JAMc 3PIPA 1M90C 1TWFH 2KCTA 3S16H 5GROA 3I56A 3E0EA 4QL5A 1Q1BA 4OWTB 1Q82C 3RN2A 3A5ZB 4YCVA 5M3MH 4OO1G 5C3EH 3H0GH 4B3RQ 4JCVE 1VQ7A 1PYBA 3IRBA 4DAYB 2K75A 1EFWA 1O7IA 1QUQB 5LMNW 4DV1L 4GNXB 1XMQQ 4QGUA 2VQFL 4A75A 2N78A 4ALPA 2N3SA 2Q2TA 1GD7A 3G71A 3F2DA 5C0XG 5IWAL 3JAMi 1HZAA 1UE1A 1HR0W 1WI5A 1OTCA 1KD1C