2A19A

Pkr kinase domain- eif2alpha- amp-pnp complex.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
165
Chain Sequence
SSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
total genus 46
structure length 165
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a19A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a19A01
1N36L 1Q86C 1QVGA 4TQUS 1MJEA 3AQQA 5C0XI 1QVCA 2I5MX 3I56A 4JI3L 3PO3G 2MO0A 1IL2A 2IX1A 3M4QA 4JI8L 1K9MC 4IOAA 2MNAA 3RNUA 2CFMA 1IYJB 3DLLA 2QA4A 4LF8Q 2EQSA 1EFWA 3KF6B 5JJLA 4ME3A 4LF7L 4JI7L 1H95A 1N34L 2UXBQ 1FGUA 4Y52H 3UDXA 3A5UA 3KOJA 4DNIA 2UUAQ 4TVAB 3D31A 2VQEL 2NVTH 4LF9L 4A3IH 3PCOB 1WYDA 4DUZQ 4JI1Q 2WFWA 2ZTDA 1KAWA 1VQIA 2YU9H 2D62A 3S1QH 2Q2TA 2N49A 1K8GA 4LF4Q 4NXNL 4GOPB 2ALYB 4X64Q 2R7ZH 4UPAA 1XMOQ 3TS0A 4UY8C 1VQOA 1EIYB 4BY1G 2JA7G 1G291 4H02A 3CMEA 4IO9A 4DR1L 4IPGA 4AYBE 3K7UC 1A63A 2UUCL 3AFQA 2WP8J 3HOYH 4BBSG 2JA6H 1QUQB 4YHHQ 2RHSB 2NZOA 3G6EA 1K73C 1U0LA 3J81c 2R7ZG 4DV6Q 2JA8H 2F4VL 1N32L 2WAQE 1YEZA 2H5XA 2JJQA 1IBML 1HNXQ 1RIPA 1V9PA 2K52A 4DV1Q 1IBLQ 4BA1I 4GNXA 4R4CA 1CKOA 5C4XH 2ATWA 2UXDQ 2NN6I 1UE7A 4BBSH 3JAMi 5JEAG 4GS3A 3FKIG 2HIVA 3RN5A 2JEAI 3A0JA 1E1OA 1VQKA 1MIUA 4X62L 4POFA 2K5HA 2UXCL 1NTGA 3RLOA 2F52A 3KLWA 1X56A 1GVPA 3S1NH 1PYSB 4LFCL 3K81C 3OTOL 1YJNA 4B3TL 2N78A 4BXXG 3CD6A 3CCUA 1S40A 1J6QA 5GROA 1I94Q 3J80c 4DR3L 2IY5B 2A19A 1PH9A 4L5QA 1VQ6A 5IYCG 3KDFA 1X3FA 2GN5A 5LMNQ 4GKKQ 2KENA 4GOPA 1K0RA 4J15A 1EQRA 3U4VA 4L5RC 1JJ2A 5AJ3Q 3W5OA 1Q1BA 3CCLA 4A3LH 1VQGA 1XMQQ 2E5LQ 3AFPA 3EN2A 4DK3C 1VQ9A 5M3FH 5IYCH 1N33Q 1S72A 1HJPA 3JC66 4OXPA 3H3VI 4HIOA 1GKHA 4B3MQ 3L2PA 1JT8A 2BA0A 2EXDA 4YCWA 1Q1EA 1VQEA 2YTXA 3AYHB 4YHHL 4DV3Q 1WJJA 4JI0Q 4DV4L 4A3CG 2R7FA 3H0GG 3J81j 3HOUH 5IYBH 5IP9H 1YI2A 1IZ6A 1L1OC 4A3DH 2R93G 3ER0A 3RZOH 4DR2Q 1ASYA 4FDBA 5GQOA 4X64L 4JBJA 2ID0A 4A3KG 3I2ZA 4NXNQ 1QVFA 1VQ7A 4WJ4A 2VUMH 1CKNB 1EWIA 2QEXA 2OQ0A 4DR2L 2NVXH 2JA8G 1EIFA 4IPCA 3HOVG 4C3IH 1C0AA 3E9IA 3PIOA 4LF9Q 1WCMH 1KD1C 3G4SA 1SMXA 4JBKA 2CCZA 4A3GG 4C2MH 4DV4Q 3U4ZA 1PVOA 4JI2Q 3CQZH 2ZJQA 3A74A 5JJKA 4Y7NH 4LF7Q 3GTPH 3HOWG 2R6GA 2Z0SA 3K0XA 3KYHC 3EBEA 4BBRG 3G71A 4A3EH 2ES2A 4LF8L 1B7YB 1VQ4A 2I0QA 3HKZG 1X54A 2D0OA 2VY3A 2OQKA 5HY6A 1OTCA 2JA6G 5IYDG 4MZ9A 4A93G 3CCQA 2R7DA 3I7FA 3FKIH 2JK8A 5IWAQ 4C3HH 1IBLL 2I5LX 1CKMA 2E2HH 2K14A 3SGIA 1PFSA 1OXXK 4OWTB 4B3SL 4A3MG 5IT9c 3CP0A 1XNQL 2HIXA 2MQHA 5FJ8G 1V43A 1PH2A 5IYDH 4A93H 3GTLH 4LUOA 1B8AA 1HZAA 1SR3A 2HQLA 4QIWE 2XTIA 4DKAC 2VQFQ 4OO1G 3LGJA 3NELA 3M7NA 2LXKA 3OTOQ 4LF5Q 4B3TQ 4JG2A 2JA9A 4BBRH 3WWVA 4A3EG 1E7ZA 1VCIA 2ZTEA 3PGZA 5IP7G 2MO1A 3PF5A 4EX5A 1VQJA 4NXMQ 1JJGA 1E22A 1N8RC 4GN4B 1Q81C 3CMAA 3ULPA 1PH1A 1IBKL 4A3DG 2E2IH 5C3EG 3RR5A 4JOIC 4YCVA 4JBWA 1P16A 4OWWB 4GLVB 1YBYA 2UXDL 1WFQA 1E1TA 1Q12A 1L1OA 4DV1L 1SN8A 1T9HA 2DUDA 1PH7A 1HNXL 1CSPA 3F1ZA 1YNXA 1X3EA 5LMUQ 1VQHA 2GVBA 3MXNB 2AHOB 4JI4L 4K0KQ 5DLQE 4DV6L 1PH6A 3M4PA 1XPOA 1QZGA 1XNRQ 1K3RA 4R4QA 1OXTA 1VQ8A 4DV2Q 1VQ5A 1TWHH 4DV5L 4DR7Q 1SROA 4GN3B 4IFDJ 1LUZA 3CPFA 4A3LG 1OXSC 1VQAA 4C3JH 4AIMA 2B63G 2UUCQ 1HZCA 4IJLA 4HIKA 4DR1Q 3BU2A 5E7NA 1VS0A 3TRZA 5LMUL 1XMOL 2RF4A 1WOCA 2CWPA 3UDIA 4BXXH 1HZ9A 4YWKA 4YY3Q 2LXJA 1K8AC 4QJFA 1EYGA 3GDEA 1HNWQ 4A3BH 3K7AH 4BY7H 3F2CA 4DUYQ 4R4OA 3TEHB 1FJGL 1Z47A 5JEAJ 3PO2G 4MTNA 1N9WA 4NXML 4DAMA 5C44G 1Q8KA 3I4OA 1SFOH 3GD7A 4LF4L 4B3RL 4LF5L 4R1JA 2I5HA 1Q7YC 4KHPL 1YHAA 4A3FG 1B70B 1XPRA 1HH2P 4JI7Q 2UUBL 4IJHA 3I4NH 4HJ8A 4NPSA 3S14H 1NMFA 1U5KA 4RMFA 4HIDA 2LSSA 2CKZB 3K80C 5ELNA 1PA6A 1BBWA 2E8GA 4QL5A 4A3CH 1RL2A 3L0OA 3RLFA 5IWAL 1A0IA 2IHEA 4JC0A 1X3GA 3A5ZB 2Q2HA 2B3GA 2N3SA 2VS1A 3F8TA 4PZ6A 4DK6C 3H15A 4R4IA 1YITA 1JMCA 3ICEA 3I4MH 1KHIA 5BR8Q 1M90C 1PYBA 4JI5L 4JOIA 4IOCA 1NE3A 2EIFA 2KHJA 4AH6A 3HOXG 2Q2IA 1YJ9A 2UUBQ 3U58A 2VNUD 2PQAB 1P8LA 1JE5A 4XTCS 1K83H 5EAYA 3F2BA 1KXLA 4IPDA 4JI2L 4A4IA 1O7IA 4GLAC 5C4JH 4B3RQ 4KHPQ 3CC4A 1BBUA 3PUZA 3T1YQ 1QUQA 3G48A 4A3IG 4WJ3M 2PNHA 2VL6A 3HOYG 5HGQA 2PI2E 5M3MH 2Y0SE 3J80i 3PV0A 3CAMA 3J81i 5GAHC 3KJPA 2Y0SG 3KDFB 2JE6I 1HNZQ 4YY3L 1XPUA 3CW2C 1SE8A 4GKJL 2KBNA 4A3MH 1D8LA 2ZM6Q 4AQYQ 2HHHQ 1YHQA 3RN2A 2BH8A 1Y1VH 4PMWA 3NENA 2KCTA 4DR6Q 1FVIA 3STBC 1LTLA 3ULJA 3W1BA 3NEMA 1ASZA 3CCJA 1G51A 4YCUA 1PH3A 2HT1A 5FLMG 1PV4A 2UU9Q 3S17H 5IP7H 4X6AH 4DV5Q 3GTOH 2K5VA 1R9TH 4JBMA 5K36G 3B6YA 3IRBA 3ZJYC 1BKBA 1Q82C 4K0KL 4HJ9A 1KL9A 3T1HQ 4LF6L 3CXCA 4OO1I 3U50C 4LNQA 1VQCA 1PH5A 4X65L 1N33L 2VW9A 1J5EL 3W1GA 2AKWB 4KI0A 2GVAA 5M5YH 3OW2A 5GAGC 2R92G 1PH4A 1XMQL 3KJOA 4LUZA 2E5LL 3I4MG 5JJIA 3CCRA 2OCEA 1L1OB 1HR0W 2ASBA 3UE1A 1IBKQ 5IYBG 5H1SE 3HOZH 1WI5A 4KLKA 3UE0A 4JI6Q 2NN6G 3J7ZC 4IFDI 1YJWA 4O0AA 4DR3Q 3UDGA 1I94L 2RHQB 1LM0A 2IX0A 4DV0Q 4OWXB 4LFBQ 3GTQH 1TWFH 3HKSA 2WB1E 2DGYA 2JEBI 1GO3E 4LFCQ 2VQFL 3PO3H 4LW1A 4P72A 2IT1A 1JB7A 2JA5H 4YWLA 4X62Q 1KRTA 3RZDH 4JI6L 3OYYA 2NVYH 1I5FA 3PUWA 4B3SQ 1A62A 5IY0A 5C44H 1YIJA 2K50A 1EQQA 2OTLA 2MFIA 3UDFA 2E2JH 2OWOA 3PO2H 3S2DH 3RLNA 3S1RH 2AWNA 3CCEA 3H0GH 4X66L 1W3SA 3S15H 4DR5L 4OX9L 3PUXA 1YHBA 4A3BG 4BY7G 1VQPA 1IBMQ 3CPWA 2KHIA 2JA5G 4JCVE 2F4VQ 1N32Q 4L5SA 1CUKA 2BH2A 1IXRA 1Y1WH 4A3JH 5J3BA 2D0PA 2Z6KC 3PUVA 4DPGA 2UU9L 3HOUG 3CCVA 1W2BA 3M4OH 3CC2A 5M5WH 3M9BA 4HJAA 2YTVA 4L5TA 4QY7A 1KQSA 3TS2A 3BZKA 5ELOA 4AYBG 4A3JG 3PF4A 1OXVA 3ULLA 4YWMA 2PMZE 1NY4A 4AQYL 4UP7A 1HR0L 4GKJQ 2OTJA 1AE3A 3E9HA 1EUJA 4LWCA 1HZBA 1Y14B 2R92H 1E3PA 5LMNW 1HNZL 2NZHA 3KF8B 4MNOA 2K5NA 3D0FA 2XGTA 2B29A 3GO5A 2YTYA 4GN5A 1HR0Q 4LUVA 3GTGH 2B63H 1I6HH 5FJ8H 4GNXB 1XJVA 4QQBX 2WAQG 3E0EA 3K8AA 3GTMH 3KF6A 2VQEQ 3JAMc 1AE2A 1SRUA 1S3OA 1UE1A 2PQAA 4OONA 1L0WA 2A1AA 4GOPC 2UUAL 1PH8A 1QZHA 2CWAA 2YYZA 5IE8A 1X6OA 4JI0L 4POGA 4IFDG 1X9NA 4DV3L 1I3QH 3S1MH 2KCMA 1N34Q 2UXBL 1YZ7A 2YV5A 1OXUA 1TWGH 1PHJA 1Y1VG 1YVCA 4B3ML 2NVQH 4JI8Q 2L15A 4JI5Q 3GTKH 5BR8L 3L7ZC 5GAEC 1NMGA 1C7YA 4PZ7A 5FLMH 4DR5Q 4OX9Q 1UEBA 1X65A 3CCSA 2PI2A 4X66Q 3S24A 4A76A 4A3GH 3STBD 3PIPA 1N36Q 5AJ3L 4BY1H 2VZAA 3PSIA 3BJUA 5LMNL 1VQNA 4GKKL 4O2DA 1GD7A 2JA7H 1EOVA 3FP9A 1MKHA 2JQOA 2VUMG 1CSQA 1UE5A 4BA2I 1KIXA 2WB1G 4LFAQ 4P71A 4DV0L 3S16H 3KFUA 1A8VA 1NJIC 4JYAL 4LFBL 1JJCB 4DV7L 1VQLA 4DR4L 1LYLA 1Q46A 3HOZG 5C3EH 2UXCQ 1TWCH 5FLXc 1FJGQ 1UWVA 4DUYL 2CQOA 2Z6KA 4GLXA 4IPHA 3CCMA 1HNWL 1FL0A 4ALPA 1Z9FA 2V1CC 4HIMA 3M85A 4JV5L 4P74A 2A8VA 1VQBA 4NB3A 1VQMA 1J5EQ 3S2HH 4X65Q 2FXQA 3HOWH 3TQYA 1YZ6A 1KRSA 3MEFA 5C0XG 3T1HL 1GM5A 4LF6Q 4QGUA 5M3MG 4A75A 4XIGS 4HJ7A 2QGQA 3HKZE 3ERSX 1XTDA 2AWOA 4PZ8A 2Q2UA 3H3VH 4DR7L 4HJ5A 4DV2L 5IP9G 1NBWA 4PG3A 2ZTCA 1G6PA 5C0XJ 1XNRL 4DR6L 4JI4Q 3M3YH 2N8NA 5GADC 2AMCB 1AH9A 3Q8DA 4P75A 3HOXH 2ZM6L 2HHHL 2C35B 4A3KH 1C9OA 1Y1WG 1DGSA 1V1QA 3DM3A 3NBHB 4P73A 4UP8A 1SLJA 5M5XH 2ZJPA 2K4KA 3I4NG 4JV5Q 4R4TA 3EIVA 3I55A 2IHFA 2K75A 1VQDA 3AEVA 4JI1L 1VQFA 4DUZL 5M3FG 4UP9A 1M1KC 1WCMG 1CKNA 4DAYB 3HOVH 4DR4Q 4DV7Q 3T1YL 2BA1A 1I50H 1BVSA 4APVA 1KC8C 3J7A5 4RG1A 3GTJH 4JYAQ 4LFAL 3FHWA 5C4XG 1L2FA 1MJCA 1TWAH 3HFZB 4GNXC 1E24A 2F3IA 2RCNA 3BZCA 3PUYA 4A3FH 4KHZA 4EQ5A 1UE6A 3F2DA 1XNQQ 3CF5A 3TREA 3CC7A 4JI3Q 2R93H 1X55A 1D7QA 1TXYA 2ZJRA 3VDYA
chains in the Genus database with same CATH superfamily
3DUZA 5DLFA 5CEHA 4IR1A 3H0GB 9ICCA 4X5VA 1I3QB 4CHTB 1M4VA 4EQPA 3AQQA 3HG9A 5CV8A 4N9PA 2E1FA 3PO3G 3D4DA 3QUBA 3MVVA 1IL2A 2K1BA 5KT6A 3M4QA 5IIKA 3QU2A 2MNAA 2JRZA 1H38A 1RYUA 5E79U 4USAA 3KF6B 1EFWA 3H3VC 4JI7L 1H95A 5KFQA 4YN4A 2B2YC 2NTSA 5A0LA 1JE4A 2LY7A 1RCVD 1SJHD 2UXBQ 1MQ3A 1TK8A 1NKEA 5AIBA 2EY5A 2IL8A 5D14A 2UUAQ 4HEDA 2NVTH 5AM4A 2J6UA 3R8BA 4I2HA 3OIQA 2G0AA 8ICZA 3PCOB 1S5DD 4DF4A 4KMUA 1KAWA 5T14A 2YU9H 8ICYA 2D62A 2CXYA 2QW7A 5JUMA 1FNWA 2ALYB 4GOPB 1WTVA 1DONA 2VA3A 4UPAA 2JXJA 1PUZA 1XMOQ 3TS0A 2FMSA 3DEPA 1RODA 2E2IB 8ICKA 2ES6A 2QB0B 1UUPA 2M00A 4RWSC 4ZKBB 2QKIC 7ICQA 2F0PA 4YMMA 3DMUA 4IPGA 2UUCL 1A63A 2JYOA 4G4KA 1EOTA 4KLUA 2ASDA 2XRQD 2F0QA 5JVG3 4KKSA 1ZQYA 3FYHA 1Y88A 2NRWA 4Y7NB 4DV6Q 2JHDA 2F4VL 2ALZA 1OUQA 2WAQE 1L3SA 4GC6A 4A3JB 1IBML 4H13C 4RQ2A 1V9PA 4DA2A 2ZXHA 2K52A 4KN7C 4DV1Q 4CGZA 5C4XH 1CKOA 1G8ZD 3JAME 4GNXA 2ATWA 2NN6I 1UE7A 2MAXA 2MHVA 4B9MA 5KFTA 2C2EA 4IL6U 4K4IA 5DGAA 3V96A 3ONNA 2WAQF 2PMZC 1HA5A 2K5HA 3NTKA 1L7MA 3N7RC 1GHJA 1NTGA 3KLWA 1GVPA 1II3A 3OHXC 3S1NH 1PYSB 3FDTA 3K81C 2DPJA 4LFCL 3UXOA 5ALIA 1SL2A 4M9NA 3CD6A 4BXXG 1ZD3A 4DK0A 1JOOA 3PSFA 4RT3A 2R7ZB 5IYCG 8ICCA 3AQEA 4QWDA 1FJGQ 4GKKQ 4FS2A 4GOPA 4J15A 1EQRA 5BN4A 1BCPC 3IL8A 3NBHA 4L5RC 5KG2A 2O6KA 2DY8A 3N6RA 2ZIUB 1VQGA 1XMQQ 2E5LQ 2F76X 1B50A 2EANA 4F2SA 4RQ4A 5ALZA 4C4RA 1SEBD 1STYA 4Q5VA 5DB8A 2KFNA 1S72A 1ZQNA 4OXPA 3H3VI 1GKHA 2L5YA 3NXWA 4KV6A 4YQWA 4TQSA 2AQ2B 2N88A 1N33L 9ICMA 1SL1A 2KHQA 1HTPA 5FP0A 4ZAIA 5IYBH 3MGIA 4C3JG 4CF4A 1Z1BA 3I72A 4Z9CB 2LMRA 3BDPA 4A3DH 2BCSA 3ER0A 2R93G 1ZQFA 1WTHA 2IOFK 1SGGA 3B0XA 2HHUA 3CU7A 3KUPA 2JN4A 5I9PA 4DR2Q 4OJPA 3ZDDA 4KLMA 3A56A 2Y0SB 4KTQA 4JBJA 1B44D 3RZOB 4DQSA 2J4XA 2ESEA 4F3OA 2VUMH 1SZPA 4O3NA 2OQ0A 2DFLA 4DR2L 2NVXH 2JA8G 4DLEA 1DCZA 1IIPA 2NVYB 4UASA 5FOBB 4JBKA 4KMOB 3IN5A 4YP3A 3SAGA 3E3XA 3OSPA 1NK9A 2DJFC 3QOLA 1WWUA 1NK6A 3T79A 1SKRA 1ZQEA 4C1NK 4LF7Q 2R6GA 3GTPH 5TZVA 4DU9A 1N5XA 3JPOA 3MFIA 4DQRA 4ED3A 1VQ4A 4QUCA 2I0QA 3EUB2 3NWTA 2D0OA 2Y9UA 4A93G 2DF4B 2KCNA 3NP8A 3IRUA 4RGTA 1STAA 1CKMA 1UCVA 3J81L 4BY1B 5IGDA 3SGIA 1PFSA 3OOCA 2P6RA 3H0MB 1BDOA 1V43A 5J39A 2NVTB 4DKAC 1HZAA 2HQLA 5AM3A 4QIWE 3CQZB 3NELA 1KKXA 3KHGA 3GILA 5AM5A 2Z9HA 1E7ZA 1VCIA 2ZTEA 4DO9A 4O0IA 5HR6A 3PGZA 5C4HA 1VQJA 3V05A 3C2PA 7ICPA 3HS0C 1JJGA 3RTVA 1Q81C 3CMAA 4A3DG 3NQTA 1PH1A 2E2IH 2EDUA 1FO4A 4Q44A 3RR5A 5DKWA 2AGPA 1P16A 1SNPA 4GFJA 4GLVB 3R2TA 8ICNA 3PX0A 1E1TA 2A6HC 5AKHA 4DV1L 2XWBB 4C56C 3RB6A 5J22A 4DSEA 5LMUQ 1ZQIA 5KFDA 1VQHA 4FZMA 4P4PA 1DM0B 2NRZA 2W8KA 3QEBZ 3VR2A 4B9UA 1EIGA 1CT1D 4DV6L 1PH6A 8ICIA 2K8AA 5AK6A 5ALJA 4KLIA 1OXTA 1SXDA 1S0MA 5GTHU 1PFNA 4DR7Q 1TWHH 1SROA 4GN3B 3BS5B 2RVLA 4AIMA 3I4MB 2NYVA 2UUCQ 4YG2A 1ZQGA 1DOMA 1PRTD 2DY7A 2JA8B 4IALA 1VS0A 3TRZA 5IIOA 4GIBA 1DJRD 5LMUL 1XMOL 5KT3A 2E5LL 2ZUBA 3T13A 4FF1A 4BXXH 1HZ9A 3T5JA 3QG1A 1ONLA 3LX0A 2Z1CA 3X3NA 5KFRA 1HNWQ 2BQUA 1J8IA 4BY7H 3TP7A 1F2LA 2A6HD 4JV2A 1GUTA 1EU3A 3JPTA 2ZUDA 1SE2A 4Z6CA 4K2LA 4KMUC 3PO2G 4KLOA 4ED7A 4MTNA 4M6WA 4NXML 2BCQA 3FVQA 1Q8KA 2XVTA 1CRXA 2I5HA 1JORA 4DAPA 1YHAA 4KHVA 1JROA 7ICGA 1AROP 1V1PA 4JI7Q 3M9MB 2XN9C 3QWNA 1SKWA 2L9HA 4F92B 5ALNA 3UM9A 5AKIA 1NCVA 1SNCA 1U5KA 3Q6SA 3PSPA 5J1ZA 2CKZB 5J2JA 3H91A 2NTTA 1KAAA 3OJSA 4DAVA 1BBWA 3M7GA 1ZRMA 4UAYA 4JC0A 3MA2B 2FJ6A 4PZ6A 4P2HA 1U9RA 2NRTA 1TAMA 1YITA 4QWCA 5EWGA 4ELVA 2AGQA 1ZEQX 1M90C 4P0QB 8ICMA 2YMLA 3MC1A 4ECUA 4ELUA 2HQEA 4JOIA 5JPNC 1LT5D 1ZOLA 4RKBA 4KX3A 1F9PA 8ICEA 4XTCS 2KSOB 3F2BA 4ECQA 2WB1C 2W55A 4IPDA 2SDFA 1CM9A 5FLXE 4KHPQ 1N2XA 1KN5A 3B9JA 9ICWA 2XY7A 2A74C 2ZG6A 4F50A 1FNVA 5FO7B 5J2BA 3PW2A 2WHEA 3RJJA 1QUQA 1D2BA 1NUCA 1XYIA 2VKQA 4Y2SA 2F2AB 2W8LA 1TKDA 5IOCA 5DM63 3D2NA 3J81i 5ISRA 5JU5A 5GAHC 3KJPA 1VDZA 1DRGA 4DQIA 3KDFB 3LWEA 3LWUA 4A3KB 1HNZQ 5CV5A 1S76D 1SE8A 2WIIB 3KBGA 4DSFA 2HHHQ 2BH8A 4BWMA 3NE5B 3M7DA 3NENA 1STGA 1B1ZA 1XXGA 3STBC 2KZZA 1LT4D 4UDUC 5CV6A 3K59A 3M6KA 3CCJA 1ED1A 3DV9A 1EXNA 4BXOA 5FLMG 2UU9Q 1JN3A 5IP7H 3S17H 3S1RB 4BWJA 1Z3EB 2C9OA 3BS5A 3UQ2A 4NLKA 4ME5A 3SK8A 3T1HQ 2KKPA 3GIMA 3HOXB 3HKZB 4R8IA 1PH5A 4ODGA 1BBXC 2AKWB 1I4XA 1EWCA 2PXIA 2QCPX 5J0SA 1E0BA 1TWFB 1CI3M 3EPGA 1AQ6A 4I2CA 4PL1A 4LUZA 3IP4B 4C7YA 1SMYD 4J9SA 3TZDA 1XMQL 1ZQQA 3QR8A 1WYGA 4JW0A 3CCRA 1WCLA 1I4PA 3QU4A 4IR9A 5IYBG 5E3FA 5KIXA 1IBKQ 3MWYW 3UE0A 1ZQKA 1NZPA 2E8PA 2BCOA 2NN6G 1YJWA 3DWQA 1V38A 1PRTC 1LT6D 4PL2A 5JAVA 4DV0Q 5A2QE 3GDXA 1TWFH 3HKSA 4MHEA 1A15A 3GTQH 4LFBQ 5CR0A 4LFCQ 3H0LB 3SAHA 3PO4A 5ALLA 4HSPA 4LW1A 4P72A 1KSPA 3TN2A 1LTBD 1Z6HA 4B9NA 4CKBA 4YWLA 2J0TD 1KRTA 4X62Q 1C8CA 3Q8SB 2SNSA 4JI6L 2BE5D 4KLHA 3TACB 2RCFA 1V1PB 1SKSA 4B3SQ 2Y1IA 4PH5A 5IY0A 5C44H 5KFWA 2WTFA 2XIDA 1KABA 2MFIA 1G2SA 2E2JH 3S1RH 3E2EA 3OGUA 2EH9A 5EWFA 1DGJA 1U49A 1B9MA 2F0GA 4OEMB 1HCZA 3ERQA 1X32A 5J0UA 4HCEA 1XWLA 4KTAA 1IBMQ 4FO6A 2BGWA 2JA5G 4A93B 5J2KA 2F4VQ 1ESFA 4L5SA 1IXRA 1ZD2P 4BDPA 1X6IA 5FO9B 3UXNA 5C5JA 3WKBA 1QJOA 2F0FA 2JEIA 5KFFA 5AI6A 4DPGA 5BN3A 3HOUG 3CCVA 1W2BA 2L0CA 4F4KA 5D46A 1KLGD 1R9TB 4OHJA 5M5WH 1ZQWA 4O3QA 7ICVA 4CDEC 1EY5A 2K4IA 1KQSA 3TS2A 3QUCA 2UVUA 3F5AA 2E74C 8ICJA 1AE3A 4QW9A 3N28A 1K83B 2HMXA 1Q90A 4MNOA 1B4FA 1V97A 2F3NA 1DXMA 2K5NA 1BF4A 4GN5A 1GJXA 5KTQA 2EYPA 3S2HB 8ICHA 5M5WB 2K05A 4LUVA 2B63H 5AM1A 3N4MB 1A76A 2WAQG 3E0EA 3K8AA 3GTGB 2AGOA 3NUCA 3JAMc 1AP0A 2UUAL 1QNUA 1ZQOA 4C3JB 1OW5A 2L1BA 7ICEA 5IE8A 2UXBL 4DV3L 2BZFA 1VMCA 2KCMA 3S1MH 1IHZA 3GTPB 4Y2RA 5D4BA 1Y1VG 2A6ED 2ISOA 5KFZA 3H7IA 3OPOA 2NVQH 4KN4C 1NK8A 1Y1VB 1O80A 2L15A 1HA6A 4XRHA 4F5QA 4H44C 3ZDAA 1RD9D 4OX9Q 1S77D 2DNEA 1X40A 1STHA 3S24A 3K5NA 9ICPA 4A76A 5D65A 1O03A 3KZIU 3RJFA 5AJ3L 1JALA 2OYYA 4UHVA 1KQQA 1MBYA 5IT9L 2B2UC 4O2DA 3FP9A 2HDMA 1I4HA 2AUKA 2F0NA 3RJGA 2JQOA 3WOFA 3PIO3 2IOFA 1CSQA 1RJTA 1UE5A 5CHGA 4BA2I 2WB1G 4XYOA 1PVOA 5AK5A 3KFUA 1A8VA 5M5XB 1NJIC 3S16H 1X3QA 3K58A 4Y2PA 4DQPA 3Q8MA 5FK9C 3JPRA 1TWCH 5LL6S 4X66L 4PNYA 3VYRA 3SVMA 1CEZA 2F0TA 4IPHA 4DL4A 1I4RA 3H94A 2KHSA 5DEHA 3RH6A 1CA6A 1O7LA 4HIMA 4ECZA 4JV5L 5HGTA 1VQBA 3EYZA 4RT2A 4X65Q 4C8LA 2PZWA 5C0XG 2EZZA 2PFOA 4PQXA 3HOWB 1L7PA 1MGSA 1O7ZA 3V2TA 4C3HG 3MXUA 3KOOA 2PI4A 1VLBA 3ORYA 3HZXA 4DV2L 1U48A 4I2GA 1NBWA 5HMMA 2XGPA 1JICA 2HCFA 2B2WA 4FXGC 5T1IA 4ICAA 2HBLA 4LAAA 1GUOA 1TKWB 2EY6A 3RRHA 4I2EA 5J0TA 1V1QA 4UP8A 1HFNA 5M5XH 2L11A 3I55A 4K5VA 4IFDH 4B9WA 4RNNA 2EYLA 4HR7B 3AEVA 4JI1L 2DL0A 3J80L 3D6CA 5M3FG 4Q8EA 5ELBA 4DUZL 4FE3A 5AM2A 1M1KC 3C46A 3BQTA 4JK1A 1WCMG 4DAYB 2ZXRA 1COOA 5KAIU 2NUCA 4DR4Q 1L8LA 1EYAA 4UB4A 4OJ6A 4N8X1 2LS01 4RG1A 4JYAQ 4LFAL 1S8OA 3CNHA 1QQ7A 2GWSA 1H9KA 1L2FA 2E75C 5CC4A 1DZ1A 3S1QB 1E24A 3PUYA 5ELDA 2MRLA 1FNUA 4EQ5A 1UE6A 4ZYSA 1RYSA 2F0VA 3CC7A 1WD1A 4PGYA 1D7QA 5J2GA 2K01A 5CORA 2FPKA 1N63A 2E8MA 5CJ7A 1WTWA 1Q86C 1TY0A 2Z4IA 1S5FD 4NL9C 4NV0A 2KQ3A 2XIWA 1EY0A 5C0XI 2GOLA 1ZJMA 5EKLA 4JI3L 1K9MC 4IOAA 2QA4A 2IWHA 3TAQA 4LF8Q 4QIWC 4ME3A 4PHPA 1SYDA 5K5PA 4RKLA 3TP6A 2LBOA 1N34L 1A0PA 1K5OA 1QILA 3UDXA 3A5UA 4RQMA 3C28A 1BQQT 2CH4W 5F2DA 4PZOA 1O78A 1K0SA 1LTAD 4LF9L 2L12A 2OT2A 3GV8B 1HXYD 4ELTA 5KFJA 4IQUA 1GOZA 2WF8A 3P75A 3A0BU 3RB0A 1VQIA 3S1QH 4K4GA 3SV3A 1ZYRD 2Q2TA 3UMBA 5J2IA 1OXJA 3A8KE 2RSOA 4FXDA 4UATA 4CDCC 4NMZA 2WACA 1Y1WB 5F9LA 4XYQA 1HEKA 3SHLA 3CMEA 4DR1L 1TK0A 3P7JA 5KG1A 3AFQA 2R93B 5JTIA 4X3UA 3HOYH 2F44A 4US9A 4BBSG 1LLRD 1N5WA 1NK5A 1QB5D 2NZOA 1C20A 5C5MA 3G6EA 3MDAA 2WB1F 5EE0A 1RPLA 3AU6A 2R7ZG 1U45A 1FIQA 4MN3A 2B2TA 1XSNA 3V7KA 1YEZA 2H5XA 3E58A 5KG0A 2D2CC 2B2VA 1N56A 3SMVA 1RIPA 3E5SA 2ICEC 3P20A 5C4XB 3ZDEA 1UA1A 1IBLQ 4BA1I 4YR3A 2YMQA 4C80A 3H8SA 2UXDQ 1GUWA 3JAMi 4GS3A 3PO5A 1PZID 2DWQA 1SIJA 1NK4A 1BCPF 3FKIG 2NVXB 9ICOA 2HIVA 4ECSA 1N48A 3NVVA 3KBXA 5EJWA 2LM1A 5EKKA 5CBAE 4RQ1A 1VQKA 5E4XA 5KFVA 4C3IG 1UA0A 3RLOA 3MAQA 3BQ0A 3OTOL 3RJIA 2PW7A 4DOBA 3GTLB 3C5FA 5KFLA 1EY8A 2YX8A 4PMCA 2A1JA 3J80c 4A3MB 2A19A 4C8KA 1CHPD 4L5QA 2IY5B 4I29A 3KDFA 2RHFA 5B5EU 2ZXIA 4M9GA 1MSGA 1X3FA 5LMNQ 1NR2A 1D1IA 3MGVA 3U4VA 2B2YA 1YNJC 3CCLA 3Q24A 2R3ZA 2GO7A 2K5QA 3EN2A 4DK3C 3IFTA 5J0YA 4IUQA 3VR3A 5M3FH 4KN4A 3HOUB 1N33Q 1NAPA 4UB5A 2FI1A 5L1IA 3H09A 1LB2B 3ZDCA 4HIOA 3L2PA 4RUAA 4MTKA 1JT8A 5EPLA 2M0NA 3L3FX 5AKJA 1FGBD 2EXDA 4X3KA 1HTLD 1Q1EA 2YTXA 3BQ1A 3AYHB 5ELCA 2KZ3A 4M0AA 3U9OA 2TMPA 1AZPA 3K1RB 3RH4A 4KLQA 4QZBA 2G5HB 3HOUH 4A3IB 9ICHA 1IZ6A 5KFXA 2BOSA 2BDPA 2ZIXA 4IRDA 4DNRB 3RZOH 2KK0A 3J81E 1H9JA 4FDBA 4A3KG 2EJGC 2NRXA 3I2ZA 1XC9A 1QVFA 3PW5A 2OEHA 2W7PA 1VQ7A 1CKNB 1EWIA 2QEXA 9ICSA 1EIFA 3SAFA 4DL7A 1ICWA 3SEBA 1IYUA 5KYLA 4C3IH 3SR6A 3E9IA 3M9NB 2F1IA 1SWWA 3PIOA 4LF9Q 1RG6A 4DK1A 3Q8LA 2BCUA 3KK7A 5KFCA 2FPMA 2CQAA 4IQWA 3U4ZA 4C2MH 5ALXA 3CQZH 1Z19A 1ILPA 1HRJA 5IIFA 3HOWG 4KX5A 5DQHA 1SBBB 2WKDA 2Z0SA 4BBRG 4LF8L 5ALFA 4OL7A 3JPPA 5K36H 1LV9A 5ALDA 1X54A 3HKZG 2AQ4A 1AW7A 2VB2X 2MGSA 2B21A 1B53A 4B9XA 1OTCA 2JA6G 2R7DA 3BVGA 5ALPA 1YNND 1CA5A 1KNEA 3VR5A 1IBLL 5CA7A 2I6XA 2E2HH 5KFIA 2V9WA 1S10A 1WUDA 5TISU 1OXXK 1ET6A 4A3MG 2WF5A 1AFPA 1D8BA 2MQHA 3L9AX 3KKAC 5IYDH 1RM6C 4F5NA 3GTLH 1JRPA 3HRZC 3JPNA 3HP6A 3C2KA 2XTIA 2QDLA 2ZJ5A 2LYAA 3LGJA 3C1ZA 5J0RA 1HUMA 2OF1A 4YD2A 3MEHA 2KJ8A 4JG2A 4DAYA 4A3EG 4B3TQ 4LF4Q 5IP7G 3T5KA 1F9SA 5DBAA 3PF5A 4CKEA 1V85A 1WTQA 1GXDC 4K8JA 5IODA 4NLZA 3IDWA 1B4OA 3O13A 1UPHA 2FJ2A 4IC9A 2BCRA 1PTOD 1S5LU 4O5CA 4YCVA 3HT3A 1Q3VA 3BDCA 1SYFA 2VIXA 3OJUA 1M8AA 1ZQZA 4RPZA 5IILA 4IUTA 2I46A 1SN8A 1T9HA 2DUDA 3E6ZX 4QJFB 1HNXL 4EEKA 2HOFA 2KA7A 2DNCA 3AMUA 4K6DA 2XY5A 2CVRA 2KVMA 3PO2B 5ALVA 2EVBA 1K3RA 5KFYA 4ECWA 4AYBC 3DHQA 4R4QA 4DN4M 4DV2Q 4IFDJ 4KY5A 2BCVA 3HKZF 1A3VA 4NLBA 4RPXA 4CDFC 4F93B 1HZCA 4HIKA 5EWEA 2K5DA 5KFPA 1CTMA 2F0JA 5E7NA 2M9VA 5KT5A 2MJ8A 9ICJA 4KLTA 2VANA 1GUSA 2RF4A 1WOCA 3WKEA 5KNIA 3TADC 4LK1C 1JWSD 3LNNA 3ICXA 2LXJA 4ZQ3A 3OWFA 1AEXA 1EYGA 1EQTA 1X9WA 4LZGA 2RDHA 4E0DA 3F2CA 2C2DA 4MF2A 1LTID 1PFMA 3AU7A 5NUCA 3WK8A 1I4QA 4FFDA 5KFNA 1MSWD 4RQ5A 4BGDA 1RYRA 3TMEA 4F8RA 5I2XA 1WVLA 2ZUCA 5C44G 3NK9A 3I4OA 1Q7YC 3BQ7A 4A3FG 7ICIA 1B70B 2HD3A 2V4DA 2XCAA 1HH2P 5EOZA 1CFMA 3D8GA 4UP7A 5C6AA 4NPSA 2NBFA 3S14H 4PGQA 1NMFA 3CRKC 4ZH4A 5AKYA 4TQRA 2K5WA 4J9LA 2AQ1B 3K6OA 3K80C 3VYTA 1K8OA 1WG8A 1RHPA 2E8GA 2WV6D 4QL5A 1RQNA 2EE1A 4A3CH 4Z6EA 4DK6C 3ICEA 5ALKA 4X62L 4DS5A 4MF8A 4HMIA 2G5DA 1PYBA 2KJXA 2DKXA 5AKEA 5EE3A 3T5HA 2KHJA 3VA7A 1ZQ1C 1AZQA 4G57A 2I9GA 3PW4A 1PK1A 1NJZA 5C5LA 3PMNA 2OM6A 5EAYA 2MU2A 3MXNA 5J0OA 1W6KA 4KLEA 2ZIWB 5KG3A 3CC4A 1BNOA 2PFPA 3T5LA 2FLPA 5DB6A 3G48A 5CWRA 3QU9A 2J7ZA 3L5KA 4ZKCB 3SZ2A 2KIWA 2HVHA 2PI2E 3EQLC 2Y0SE 4TKOB 8ICXA 3PV0A 4ID6A 8ICPA 1UT8A 2Y0SG 1L8OA 4EX6A 1B2TA 2RKSA 4NXZA 1XPUA 2HBKA 1BOSA 1YNJD 3QU5A 3X3MA 4A3MH 4CE6A 9ICEA 2VXWA 4DL3A 4PMWA 5A2QL 3RBDA 5C3EB 2ATLA 3ULJA 3K0YA 3T51B 1C4QA 3WK5A 2M2LA 2B8GA 1G51A 8ICUA 1SYCA 5C4ZA 4G7ZC 1PH3A 4L6TB 1PV4A 4FYDA 4X6AH 5DB7A 2PYKA 3ISDA 3RAQA 3GTOH 1R9TH 4UQGA 4P4MA 5K36G 1TWAB 2YMPA 1BKBA 2D8CA 3UMGA 5F3XB 4HN7A 1KL9A 4HJ9A 3EW9A 3C2LA 4JPBW 4UAWA 1DYQA 2G07A 4YCXA 4IRCA 3U50C 2BQRA 5KEEA 1J5EL 5DG7A 4KI0A 4GXIA 3OW2A 2VUMB 3IG5A 4FXKC 5GAGC 2BR0A 4IUUA 1U4PA 1PH4A 2ISPA 3K5MA 4Q0FA 4X3TA 2N1RA 1D9DA 1HR0W 4Z6FA 1ZYRC 2Q8RE 3HP3A 3UE1A 3OSOA 5H1SE 1WI5A 4JI6Q 3J7ZC 1ET9A 1L7OA 7ICNA 2F0MA 1D5MC 2IX0A 1EQVA 5AFWA 4UB3A 4UB2A 3S1MB 2WB1E 2DGYA 4R63A 1GO3E 3Q8RB 1CZGA 5AKZA 3PO3H 9ICUA 2IT1A 1JB7A 3UMCA 3RZDH 1RDFA 7ICMA 3GV3A 3OYYA 2NVYH 4O3OA 1I5FA 3EZ5A 4C3IB 1ZQMA 1I6HB 1L0YB 1A62A 3NVZA 1VF5C 1YIJA 3IKJA 3I73A 3PO2H 5HP4A 2YB4A 9ICNA 3KBBA 3S2DH 3RLNA 2MSNA 2AWNA 1SV0C 3EWAA 3IV6A 4OIJA 8ICVA 4DWIA 1W3SA 3J7AV 3S15H 2W3SA 4BY7G 1YHBA 4G7HC 3RD4A 4FF3A 3I4NB 2JSOA 2PI5A 2CRXA 1N32Q 3WKCA 1O08A 2FINB 1T3QA 4M1UB 4NW2A 3E0JA 2ASJA 2Z6KC 2IHNA 3PUVA 4HAEA 2UU9L 1L3VA 2FLLA 2JEGA 2E1EA 3BS1A 4QZGA 4O5EA 1LTRD 5FKAC 3CC2A 2QEJC 4L5TA 3BDOA 1W6JA 3SK4A 5CBEE 2NVQB 4ECRA 5ELOA 4A3JG 2K33A 3PF4A 3HOZH 4FNFA 4YWMA 2PMZE 1A3UA 4OGQC 2E8OA 2XO7A 1HR0L 2KV2A 5AICA 2KN7A 7ICKA 4K2KA 2R8HA 4LWCA 3NTIA 3EROA 1HNZL 2NZHA 1JR0D 4RQ6A 3D0FA 2XGTA 2B29A 3GV6A 2EQYA 2YTYA 5J0PA 3GTGH 1I6HH 3T3FA 1XJVA 2BHNA 2VQEQ 4KKUA 3NUQA 4Y2QA 1AE2A 2Z6BA 4I28A 3ITPA 1PH8A 2B8FA 2YYZA 4POGA 2NV3A 4DF8A 2WKCA 2BDUA 3GU3A 3URYA 1I3QH 5I9OA 3QXGA 4O3SA 1X9NA 2YV5A 4L8JA 1N60A 3H4DA 1PHJA 2A69C 7ICFA 1YVCA 5ALGA 1SYBA 5CR3A 3D2QA 2KD1A 3GTKH 4M8AA 4QZIA 4LVSA 3AM9A 5EQ0A 2VB3X 1ZQVA 4YXMA 4AYBB 4PZ7A 4ECYA 4DR5Q 3CCSA 1UAPA 3ND9A 4F4XA 3PVXA 5KFOA 4CJ2C 3Q8QB 2K4PA 4UB8U 3HJEA 5LMNL 1ZQSA 1H9MA 1WTOA 2HHTA 1T4GA 1GD7A 2JA7H 3NPPA 5DGBA 3QJYA 2VUMG 3S16B 2LPEA 2FLNA 2KNJA 9ICLA 1QCKA 1KIXA 3GP7A 4QZ8A 1PLFA 1FFUA 2R8JA 2L5TA 1J2MA 3M4OB 2XICA 1VQLA 1EWHA 4DV7L 1LYLA 1Q46A 3A55A 1IKMA 3NBIA 1BPZA 3V6KA 2C2RA 2HHVA 5FLXc 3AUOA 1K1QA 2F8LA 1HNWL 3J80E 1UQVA 1FL0A 1MN8A 1E2VA 1TAUA 1Z9FA 3K5LA 3WK9A 2HHSA 4MFAA 3IAYA 3HOWH 4FZNA 2RRDA 8ICBA 4Y2YA 1KRSA 1R4QB 4F4YA 1GUGA 3MEFA 3TQYA 4QGUA 5M3MG 4LF6Q 5IGCA 1B43A 4DOCA 3CHBD 3ERSX 4O1NA 4N8FA 4PZ8A 3JPQA 2RDFA 4PMBA 4EYIB 4M9LA 3ND8A 2F1HA 5IT9E 1RDPD 4CCHA 5M9OA 2W03A 4DR7L 1XO0A 4Q43A 3N52A 4PG3A 4RQ0A 4KD4A 1G6PA 3PX4A 2FMCA 4DR6L 4G9BA 4R8UB 3M3YH 2N8NA 3QYPA 2CPRA 3Q8DA 3HOXH 4QW8A 2ZM6L 1Z4OA 4A3KH 1C9OA 1HFGA 1TR5A 5IINA 3KLSX 4P73A 4PHDA 2AUJD 2EYHA 4P2CB 1G2TA 5DQIA 2K75A 1UEAB 2NO5A 1ZD4A 2RQXA 1VQDA 1F5SA 3MC0B 4RUCA 2Z8LA 1RTOA 3B0YA 3C23A 5L37A 1CKNA 2Y0SF 3T16A 3M3YB 5DG9A 1B3QA 4RQ7A 1NNLA 3A7AB 3RZDB 4DL6A 3T1YL 2BA1A 1K1SA 1BVSA 5AKKA 2PCFB 3I3CA 4QB4A 4APVA 1KC8C 4M6WB 1BPDA 3MR6A 4PV1C 5C4XG 3A7LA 4WORA 4CF5A 3RR8A 2RCNA 3BZCA 2GLEA 1X6JA 8ICRA 4CF3A 2XI9A 1B3AA 4KHZA 5CV9A 3S15B 4OIKA 7ICOA 4JI3Q 2G06A 4MEXA 4NDXA 3PY8A 1N36L 1LKYA 1SB3C 2EYMA 9ICKA 1QVGA 2Z7JA 2KECA 1MJEA 3M8RA 4MIUA 2I5MX 4J9QA 3I56A 4YXJA 1KTKA 2G5IB 2LHTA 4BJQA 2IX1A 4JI8L 3RNUA 4I2IA 2HBMA 2MUTA 1KRPA 1IYJB 2CFMA 2EQSA 4A8EA 1UNSA 4KKTA 4LF7L 1EYCA 1Y8PB 2KEYA 3V6HA 3KZXA 4FBTA 2FDRA 2JGAA 1HPCA 1TQOA 3KOJA 1CHQD 4NXMQ 1SNMA 1QSYA 5EPJA 2BPGA 3NQIA 4YMNA 1IW7D 4QZ9A 4CJ0B 3JAML 4A3IH 3NSWA 1NNXA 2UVRA 1WYDA 4NM2A 4DUZQ 4JI1Q 4I65A 4RHSA 3F53A 2WFWA 1DD2A 4ED8A 3TFRA 4IQVA 4EBCA 1BCPD 1U9LA 2F77X 5ALHA 4X3SA 4C1NI 2MP1A 5AKLA 1QOHA 2KTQA 2R7ZH 5DAUA 1Q8IA 2LMCB 1PVPA 1VQOA 1EIYB 1NKBA 3CYMA 1G291 4H02A 3HOYB 4FVMA 4IO9A 4K8IA 2LKYA 5ALSA 1PMRA 1CI4A 4YR0A 3K7UC 4AYBE 3T53B 2WP8J 1KFSA 1IL8A 4ZUIA 5J2CA 1ZXIA 1QUQB 4QMGA 2RHSB 2YY6A 1ZQCA 5KL8B 4JK1C 2PFQA 3J81c 3W3AA 3SI8A 2IPKD 3E0FA 3V6JA 1T3NA 2JJQA 1JWUD 3EVQA 2W7OA 4P0QA 1JWMD 3CP8A 4BBSH 4N9TA 1NK7A 1PTOC 1TU2B 1B9NA 2G9DA 1X9XA 3RN5A 3K1ZA 5G5HA 2JEAI 3A0JA 2LM4A 1TT2A 3DEOA 1MHWC 5JPMC 2FMMA 2FFKB 2K89A 3M1YA 2OXOA 3GIJA 1Q3LA 3QOJA 1G91A 1YJNA 5AI9A 4RH6A 3QB3A 7ICUA 4QWAA 5CRXA 1S40A 4DSKA 1DOLA 1XTCD 4DR3L 4DFJA 1X9SA 1I94Q 1NI3A 1ZQHA 2IW3A 2TSSA 4ZK9B 3AB9A 1K0RA 2BKEA 2W9CA 5AIAA 4UBCA 3W5OA 5AJ3Q 3QU7A 4EYHB 1MD2D 4A3LH 3I1YA 3AFPA 4AP9A 5KFAA 9ICQA 2RA4A 2R61A 2SNMA 1ZRNA 1ZJNA 2QF7A 3QZ8A 4PPXA 1PVRA 2A68D 4ZRZA 1HJPA 5EBCA 4J1MA 2F0LA 4CRXA 3VYSA 2CHBD 4JUZA 5HMLA 3HKZC 2BA0A 3G6XA 4MFFA 5I2YA 3PSTA 2DJGC 4DV3Q 4QIWF 2MUTB 3K75D 1WJJA 2QB0A 2X69A 4K5WA 4ZCKA 1KW4A 4DV4L 2R7FA 1IYVA 1DXSA 3H0GG 3JPSA 2W43A 3V72A 5IP9H 4ULLA 2E8NA 1L1OC 3ALRA 1L0XB 4QIWB 4ACOA 4FF2A 3BZDB 1T7PA 1YNNC 4KY6A 4IRKA 1S0OA 2WB1B 5I4DA 1ASYA 2JA7B 3PX6A 9ICBA 5J2EA 1L3UA 4UAVA 2UVWA 1RTNA 2B2TC 1C0AA 1Z7TA 4ILWA 1WCMH 1KD1C 4FO2A 3C1YA 1BCPB 2FMPA 4TSSA 3FRPB 1NJWA 5LHY1 2CCZA 1QE6A 4DV4Q 4CNQA 4GXKA 3SV4A 4JI2Q 3I4LA 2ZJQA 4KJOA 4JV1A 4YD1A 3Q8KA 4A3EH 3EBEA 2Z4HA 5DBCA 1S4ZA 1LKYB 3UXPA 2K32A 5ALYA 3KF8A 7ICJA 2VY3A 2OQKA 2JR5A 5IYDG 4MZ9A 4XDXA 1F2YA 3I7FA 5IWAQ 4QCLA 4C3HH 1ZQXA 7ICSA 4RGOS 1MSHA 1RXVA 3O0FA 3QIAA 3LWMA 1UT5A 4OWTB 4B3SL 3D6WA 4KLSA 5IT9c 5KG5A 5FJ8G 1PH2A 2JXMB 1PFBA 4LUOA 5J0WA 1B8AA 1SR3A 1SXEA 4ZUJA 1CQVA 4B9VA 3D2SA 4F8MA 1F2MA 5DM73 3CRXA 5C4JB 2HOIA 1Z1VA 3M7NA 2SOBA 1WWVA 4LF5Q 1PTOH 2JA9A 3UI2A 4K6LA 4TUQA 4BBRH 1S0VA 2KG5A 4H0LC 2MO1A 4EX5A 2YQEA 1E22A 4GN4B 1SMYC 1IBKL 2AXTU 5BOMA 5KT7A 7ICHA 1TVXA 3OMCA 1F9RA 2P66A 2KICA 3LVWA 4NKLA 4J9NA 1ZD5A 4RGMA 4OWWB 3ETRA 3PR4A 4QNLA 1BPYA 1ENCA 1WFQA 3FKIB 1Q12A 3ONAB 1QQ6A 2N55A 5DDMA 4JVZA 3GTQB 3H8WA 4DXFA 4UAZA 3VA5A 1CSPA 4KLJA 3F1ZA 1C48A 1YNXA 4QWEA 4YVZA 1DOKA 2F1MA 3MXNB 5COYA 2UXCL 1KFTA 2K6AA 5HHIA 3M4PA 3TZUA 2JH7A 1XPOA 4I27A 3SK5A 1VQ5A 5G5GA 1LUZA 3CPFA 4A3LG 2B63G 3SQIA 4IJLA 2EZXA 2IOHA 3BU2A 3SYZA 2KFZA 3MDCA 2EXZA 5AI4A 3IFDA 4DL2A 2BQ3A 3LWLA 2CWPA 2VJ5A 4BBRB 1U4MA 3C21A 1PRTB 2XC9A 3M6ZA 2KUMA 3BG3A 1T8EA 1T5XD 3I90A 5L9XA 1LTSD 3PMFA 1LVHA 1MI2A 1Z47A 1N62A 1STBA 3AU2A 2H3VA 2L55A 2W54A 5JRTA 4QZDA 3RJKA 1SFOH 4DCCA 4LF5L 4R1JA 4OD0A 4KHPL 5L1MA 1HQMC 3PQIA 1VMPA 1QG7A 4IJHA 2W04A 3KKAA 2QDBA 3PO3B 3IM1A 3SENA 4RMFA 4WJ3B 3PNCA 2HI0A 4Y2UA 5AM0A 3PW7A 1ZQBA 1PYWD 2BDOA 1R4PB 5ELNA 4QZFA 3GQCA 1RL2A 4PHAA 5IWAL 4I2AA 3WWVA 1X3GA 3A5ZB 1JIHA 2Q2HA 2VS1A 3F8TA 5EBDA 1EZ8A 4TURA 1KDHA 1JMCA 4A3DB 1TV9A 4IUVA 4BWGB 3I4MH 1KHIA 3AL0B 5BR8Q 2NRVA 2P5ZX 2NWGA 4IOCA 1NE3A 4AH6A 5M3MB 3HOXG 1YJ9A 3OHAA 3BVZA 1J2NA 3U58A 1P8LA 4GC7A 3C2MA 1K83H 1QQ5A 4XT3B 1KXLA 2V4QA 4A4IA 4JI2L 1NOMA 4DFPA 4NLCA 1O7IA 9ICXA 4QZAA 2XNAC 3PUZA 3T1YQ 4RGNA 5JEAH 2A3VA 4WJ3M 4A3IG 2ZIVA 2PNHA 3M8SA 4S3SA 1PTOF 2VL6A 1RF2D 4KLLA 2PMZB 3HOYG 4U6PA 3I91A 5M3MH 4RU9A 3J80i 1WCMB 4F4ZA 3CAMA 2ODGA 3G6YA 4F2RA 2F0SA 1S0NA 2PMZF 1A2UA 2EAOA 1JC7A 4EZ9A 2WF7A 2KBNA 1YT3A 2ZM6Q 2KJ9A 2NN6H 1YHQA 3RN2A 1Y1VH 5J0XA 2KCTA 4DR6Q 3TADA 1FVIA 1TFRA 1PK1B 3NEMA 5AK3A 4F88A 5ALUA 4F91B 1SDFA 3MFGA 4YCUA 2PZUA 4ABNA 2HT1A 2NZ1D 2W9BA 2LKVA 2K5VA 2W9BB 1KDCA 3IRBA 1IV8A 4XUSA 1X66A 4J9PA 5F9NA 4LF6L 3VC8A 3CXCA 3PZPA 2QB1A 3ZDBA 1PXUA 4OO1I 2VW9A 1SWVA 3KJOA 3Q23A 4A3BB 2D6FC 4KLGA 3NHHA 2OCEA 1ZKOA 2YMMA 1EY6A 4Y2JA 3HILA 2R8KA 1LTGD 4QZHA 1SJED 2F0HA 1PDQA 1UHUA 5D3IB 3KFUF 3QX7A 4DR3Q 1I94L 2RHQB 1LM0A 4JB3A 3FC4A 4C4SA 4R8NA 3MR3A 4OWXB 3QZ7A 5EGTA 3BVMA 2Q0ZX 2JEBI 4YIJA 2OHFA 4RAUC 3J7YW 3KHHA 4UB1A 2JA5H 4DFKA 2H3FA 4V190 4DFDA 2YN4A 4OELB 3ZYYX 4EQNA 4R64A 4J9KA 4HMJA 2ZIXB 2K50A 2W3RA 3BYYB 4EX7A 3H6MA 2PPBC 2OWOA 4HTHA 4XT1B 2JA6B 5ALEA 3H0GH 3CCEA 3ZD9A 2EZVA 4LJXA 4DR5L 4A3BG 1JOQA 3OIPA 1VQPA 4C8OA 3EA6A 5GTIU 4J03A 2UVVA 4EGVA 3CPWA 4JCVE 3HGBA 2JZBA 3TP8A 3MXGA 2BH2A 4A3JH 5J3BA 3H8JA 2KIVA 3DM1A 3IHQB 5I6WA 1A77A 1QTMA 8ICAA 1VDVA 4O3MA 3NWSA 3M4OH 1PZNA 3C3LA 4HJAA 2YTVA 4FP5D 5IGFA 2F0IA 3NVWA 1XX8A 3BZKA 4CKCA 2AU0A 1OXVA 3ULLA 3TBIB 4AQYL 2OTJA 4GKJQ 3NTUA 1QWYA 2H1EA 3E9HA 2JEJA 1HZBA 1E3PA 5LMNW 1NJXA 3T56B 1J9OA 1URJA 3S6JA 4UARA 2QILA 4UAIA 4OO1H 3GO5A 3J7AF 1HR0Q 3H0RB 3RBEA 1QCBD 5KNBA 4GNXB 5KFHA 3WK6A 2RDJA 4IQZA 2PQAA 1L0WA 1COKA 4OONA 5HURA 2ZJ8A 3K5OA 1QZHA 5AHXA 2ZT9C 4FZLA 5HR7A 2LFNA 1A6XA 3S1NB 1OXUA 1PZJD 2F3WA 4JI8Q 4CJ1B 4XQNA 1TIID 4JI5Q 1JXLA 1C7YA 2P6UA 2RLTA 2XGQA 2AQ0A 1S5CD 1UEBA 1X65A 2KCCA 2PI2A 1EIHA 2C5CA 3S9WA 2JZBB 2F0EA 4A3GH 1D5ZC 1N36Q 1SSOA 1P7DA 4EZ6A 2HDLA 2A5HA 5CYUA 1KNAA 4GKKL 1VQNA 5ALMA 4MHVA 1IKLA 1DK2A 1A6SA 2YB1A 1SV0A 4NY8A 1AN8A 1MKHA 5CB1A 5KNDA 3WK7A 2HUGA 2G9HD 4P71A 5G3LD 3GV5B 3DWPA 5KG6A 5CV4A 1JJCB 1TS2A 2UXCQ 2F0UA 5DG8A 3HOZG 3TP5A 2FPLA 1L7NA 1XSLA 1UWVA 1QLNA 2DN8A 2Z6KA 4DUYL 3AN1A 3WKAA 2EY1A 3CCMA 2B63B 1XSPA 2D3DA 3C1FA 3RJEA 1U4BA 1OO9B 5KRUA 4ALPA 2V1CC 4HYKA 5BN5A 2IMWP 1Q3UA 3F5EA 1XU4A 4BUGA 2KZMA 4NB3A 1WD0A 1J5EQ 2FXQA 4K5XA 4MFCA 4K14A 1ZYQA 4M47A 1HUOA 1YZ6A 5JOBA 1GM5A 4XIGS 2QGQA 3GIKA 3HKZE 1K28A 1XTDA 2AWOA 1VF7A 2ZIVB 1HIWA 2OEOA 4IS7A 3H3VH 2K28A 2EYOA 4C8MA 4Z6DA 2WF9A 2ZTCA 1ZQJA 5C0XJ 1XNRL 4GZYC 4NM1A 4KJNA 4JI4Q 1B0XA 4M9HA 4Q8FA 2AMCB 4P75A 5GADC 1AH9A 3WKDA 4C4TA 4M9JA 3PV8A 4OJ5A 3DM3A 2ZJPA 1SZHA 5ELEA 2K4KA 2F0DA 3I4NG 3EIVA 5IGBA 2IHFA 1J97A 3DDHA 4BX9C 3BQ2A 1A2TA 2B39A 1ENFA 1VQFA 4A3FB 4EENA 3TANA 4UP9A 4BBSB 1STEA 2PQEA 4Y2TA 4RQ8A 1FYCA 1GUNA 4DV7Q 4FBUA 2A73B 4DL5A 1I50H 2K03A 2JA6H 1IM4A 2RDIA 5AI0A 1IW7C 2HCCA 1JUDA 4AYBF 3OSNA 8ICWA 1WTRA 1TWAH 2HHQA 1MJCA 4XXEA 4GNXC 3U9SA 2F3IA 4A3FH 2KP7A 4I2DA 4XA5A 1TAQA 2KVSA 3HRDD 4EELA 4G3IA 2FHTA 2O4XA 1V8QA 1XNQQ 2R93H 1X55A 1Z4NA 1SXTA 3FPPA 3VDYA 4ED1A 1KEJA 1MA7A 4J9MA 2F0WA 1LACA 1BNPA 3TARA 2K8BB 9ICVA 4TQUS 2LYHA 4DSJA 3QE9Y 4DLGA 3V7JA 1QVCA 2WAQB 2MO0A 3RB4A 2F8KA 2E2DC 1JMSA 3OMGA 4U673 3TQ1A 3DLLA 4FF4A 5JJLA 4O3PA 5J8YA 3EJIA 1KDAA 1E2WA 2D5DA 1Z00B 3LVVA 2HHWA 1FGUA 4P4OA 1RKNA 1TWHB 4Y52H 1BXTA 4DNIA 5I6YA 3K7AB 4TVAB 3D31A 4RHRA 2VQEL 5D49A 1SNOA 1JQYD 3L3OC 1ZQLA 1H9RA 3S2DB 2HOQA 1JXEA 2ZTDA 1MQ2A 2N49A 2PNRC 1K8GA 2BDNA 4NXNL 4X64Q 3GZFA 1SNQA 1KLUD 1KTQA 5KFUA 2JA5B 5KG4A 1ZQPA 4UY8C 3EPIA 2Y1JA 4BY1G 5CGKA 2JA7G 4G7OC 3BDLA 5J2HA 5IIIA 5KFSA 1S5ED 2ZXPA 5M3FB 3D4RA 3A8IE 4YMOA 5HHHA 4YHHQ 1PZKD 3AMZA 3GV7B 3SE0A 1JB3A 1U0LA 1K73C 3WK4A 2WAQC 4LZDA 2MUYA 1XWEA 1D8YA 2JA8H 1N32L 1LO5D 1KFDA 3DWAA 4DQQA 1FD7D 1HNXQ 1NJYA 5M5YB 8ICOA 4R4CA 1STNA 3P1HA 3R93A 3QUQA 5JEAG 5B66U 3H40A 2NO4A 5ALRA 4IN3A 3SK6A 2RDGA 3KHLA 1JX4A 2MA1A 1E1OA 1SAPA 1MIUA 4POFA 1F2ZA 2Y0SC 4TUSA 1SE3A 4ZOHC 2VA2A 2F52A 1X56A 2K4HA 1DOQA 4B3TL 3A54A 2N78A 3CCUA 3HW8A 1J6QA 4EEYA 5GROA 5IIJA 4RQ3A 5EE1A 3PW0A 1X42A 1SYEA 3C1EA 1PH9A 1VQ6A 4H7BA 2GN5A 5E1FA 2HHXA 2KENA 1KBUA 4KITB 1JJ2A 1Q1BA 1E2ZA 1XO1A 2XRSD 1D9FA 3TI0A 2CH4A 1I4GA 2X6GA 1VQ9A 3W2DA 4KLFA 4V0BA 1BUVT 5IYCH 4IUPA 4EQOA 3JC66 3ED5A 2AJQA 1ML0D 4B3MQ 3S14B 2OH2A 1ZETA 1EL0A 2R8IA 4YCWA 2QARA 1VQEA 4YHHL 4U68A 2IA6A 4JI0Q 4A3CG 3I28A 1L5UA 1S9FA 3OWEB 3C29A 3J81j 3N97B 2KEDA 1YI2A 4NP5A 4JWMA 2RSNA 2XVSA 1PRTF 8ICGA 1M6YA 2EJMA 1JI7A 5CP2A 2O5JC 2C22A 1ZQAA 4DFMA 4C8NA 2R92B 5GQOA 4X64L 2ID0A 4NXNQ 2RP5A 4NJ8A 4WJ4A 2F0KA 1JCKB 4YFKA 2E76C 1Y69U 4IPCA 2A8VA 1I6VC 1HUZA 3HOVG 2SEBD 2G09A 3NTHA 1XS9D 1CK1A 3GTMB 3G4SA 1SMXA 3QO2A 5EE9A 7ICLA 1BNZA 1KLNA 4A3GG 4PHEA 3S17B 2K60A 2LI6A 3A74A 1SV4A 2DGZA 3MFHA 4Y7NH 4A3EB 4P0PB 5JJKA 2V4RA 3K0XA 3KYHC 5T1GA 3N7PD 3G71A 2ES2A 3NRZA 2I07B 4KLDA 1B7YB 3GFKB 3MFYA 4WRDA 2H3QA 4I2JA 5KYIA 2EPBA 3NASA 1RQLA 4F71A 2HBJA 5HY6A 4PGXA 3CCQA 2EAPA 2WFAA 4DNTB 3FKIH 2JK8A 3C5GA 5BOLA 2I5LX 1Y8NB 2F03A 3T4AC 2P35A 2K14A 3GTOB 1FEZA 4Y2XA 1CZWA 3CP0A 1X9MA 1XNQL 1NSNS 2HIXA 3D6JA 5KL1B 4RZRA 2D9UA 2OXPA 4A93H 3I8ZA 1NK0A 1HHVA 3ETLA 3I76A 1F9QA 1PTOB 5L1KA 1ILQA 9ICAA 2KOLA 2VQFQ 4OO1G 4F72A 2LXKA 3OTOQ 2O5IC 3NGDA 5L1LA 3Q22A 3TFSA 5ALWA 4DSIA 1X3PA 2EYJA 2MPMA 3UPQA 1N8RC 2GA4B 1SYGA 1SE4A 3ULPA 5C3EG 1A3TA 4MEYA 2PW5A 1EYDA 5J2AA 2F3VA 3HPOA 4JBWA 4JOIC 4ED0A 1YBYA 2UXDL 1CQFA 9ICTA 2PZTA 3KLRA 3SD7A 1L1OA 2NB0A 4J8QA 1PH7A 5C3WA 3G6JB 1X3EA 9ICIA 2GVBA 2AHOB 4JI4L 4K0KQ 2KMDA 5DLQE 1ZQUA 2Q8TA 1QZGA 2IX3A 1GO3F 2GH1A 1XNRQ 3K4GA 2HW3A 3N7SC 1JOKA 3Q0AA 1VQ8A 1U47A 4DV5L 4DFAA 3QEAZ 2PFNA 1OXSC 1VQAA 3VR4A 3H8MA 4WJWA 4C3JH 2J6SA 5KAFU 5J2DA 4DR1Q 2AH5A 8ICLA 1FR3A 1TK5A 2E2HB 3THVA 5J8YC 4HAIA 2DUYA 4M2YA 4O42A 3G7LA 2RBMA 3UDIA 4YWKA 4YY3Q 3NS1A 3TAPA 2BE5C 4DS4A 1O7YA 1K8AC 3QNMA 4KY7A 4QJFA 1IG6A 2ZXOA 3GDEA 4A3BH 3K7AH 4RCOA 2XCPA 4DUYQ 2WINB 4R4OA 3TEHB 1FJGL 1H9SB 1NR4A 5JEAJ 4QWBA 1PVQA 1SFOB 2QARB 4JMUA 2BPFA 1I50B 1LABA 1N9WA 4DAMA 4LF4L 4O3RA 4I2FA 4US8A 4F4WA 4OJOA 1ENAA 3GD7A 3GQBA 4B3RL 5IGGA 1RZTA 3M4YA 5ALQA 4ED2A 1XPRA 2UUBL 3I4NH 4HJ8A 2DQNB 2IJ0A 1ECWA 4ECVA 4QF4A 1EU4A 4HIDA 3A0HU 2LSSA 5DQGA 2CN1A 3D4WA 5A35A 2E2JB 5LL6X 4QZCA 4E6IA 2VJ4A 2JP1A 1PA6A 2JV3A 5KFKA 3MBYA 3A8JE 4EBEA 2K8CB 4R66A 2XSCA 3L0OA 3GIIA 1A0IA 7ICRA 2C28A 4O9MA 2IHEA 3M9OB 2B3GA 2N3SA 3H15A 4B9SA 2BPCA 1H9SA 2O2LD 4R4IA 5KGUA 3DXJC 4RQNA 4C3HB 4PJ0U 3R9KA 2F0OA 3CRLC 2NYZD 3OPXA 5E4WC 3RR7A 4JI5L 5ALTA 2EIFA 3R2IA 1NKCA 2Q2IA 3WU2U 2UUBQ 3ZI4A 2VNUD 2PQAB 4R8UA 1JE5A 2B6GA 3FM9A 3HWTA 1WTXA 1QSLA 4I7AA 1XNSA 1BPEA 2QLTA 3D3RA 4GLAC 5C4JH 4B3RQ 4TUPA 1BBUA 4I7ZC 2ZIWA 5K4LA 3MR5A 5C0YA 5C3XA 3U26A 5AK4A 1EZ6A 1TS4A 4ED6A 4OJLA 5HGQA 2IHMA 5KFGA 4CGYB 3SDZA 4B9TA 5TSSA 2JE6I 4IQTA 4WFN3 3ISCA 4YY3L 1VJ5A 2H3ZA 3HX0A 3CW2C 2KHVA 4GKJL 3RAXA 4R9WA 1D8LA 4AQYQ 1G6ZA 4B6JA 3GTKB 4F5OA 5AI8A 2Q4TA 1B22A 4EBDA 1LTLA 1TS5A 3MXPA 3W1BA 1SNDA 3DEEA 1ASZA 3MR2A 5D3DA 2QKQA 2K7VA 3MABA 3KHRA 3RB3A 2EAMA 5KNCA 4DV5Q 3Q8PB 4P0PA 4JBMA 3B6YA 3ZJYC 1ESRA 3VR6A 1Q82C 5J2FA 1K8MA 4K0KL 5J29A 5FLXL 3RJHA 2KEEA 1ZQRA 3SEIA 5FO8B 4LNQA 1VQCA 3SXHA 4UB6U 3ZD8A 4X65L 3OHBA 2DPIA 1V1OA 3W1GA 3TKAA 2A68C 2GVAA 3PMLA 4JWNA 5M5YH 2R92G 4XQQA 4UW9A 4BY7B 3I4MG 3HEJA 2PO4A 2KOBA 1U4LA 1Y8OB 4RA8A 4M04A 5JJIA 1L1OB 2ASBA 3HOZB 2KSOA 2CW0D 4KLKA 4HCSA 4CDDC 2F1JA 5KFBA 4RPYA 2M9NA 4O0AA 4IFDI 3UDGA 1ZQDA 4EVOA 2DKZA 1DK3A 3PR5B 8ICQA 4OCZA 4RCNA 2VQFL 2A1JB 3FDSA 2EZYA 4GXJA 5CV7A 5KFEA 2Y9TA 3V7LA 1ICFB 4F87A 4OO1J 3CKIB 4C7ZA 1TY2A 4IUNA 3LYSA 3PUWA 5HNKA 5KT2A 2LYBA 5DDYA 4DEZA 3GTJB 2A69D 4FS1A 2ZIUA 1EQQA 2OTLA 3UDFA 2B2UA 2H3IA 3NRWA 1PK3A 5H2FU 3K57A 3QUTA 4CBVA 2W9AA 4OX9L 3PUXA 1NZBA 1EEFD 1LV5A 1EY9A 1TWGB 2HDOA 2KHIA 1F77A 3F2UA 2H4OA 1F0MA 1CUKA 5AI5A 1Y1WH 3NVYA 4ECTA 1S97A 3TSSA 2D0PA 3FPUB 3VYUA 5DLGA 1BPBA 3OW7A 4KN7A 4L63B 4QUFA 3M9BA 2HSZA 4F7XA 4I2BA 2EYFA 4QY7A 2ASLA 4AYBG 3FAHA 1D6EC 1NY4A 3RRGA 3I70A 1QH9A 3BS7A 9ICRA 1L6NA 1EUJA 4YR2A 1WCNA 1F44A 1Y14B 3FEWX 2R92H 5L1JA 3KF8B 4U7CA 7ICTA 1BPXA 3WOEA 4DXGA 2K04A 2JH1A 2KE7A 2JMGA 4RNMA 2HCIA 2XWJB 5FJ8H 4QQBX 4ZLTF 1QSSA 2E5SA 5IGEA 3RFAA 3KF6A 3GTMH 1T94A 1SRUA 1S3OA 1UE1A 4J9OA 2B2WC 4F5PA 2A1AA 2Q8IB 2I1QA 4GOPC 2RQ5A 2CWAA 4JI0L 4IFDG 1X6OA 2EJFC 4UAUA 2R8GA 2EOTA 1N34Q 2EDGA 5EKIA 1YZ7A 1EFID 1TWGH 3G6VA 2W11A 3RF9A 4B3ML 4TRDA 1QNKA 3RMHA 4HSVA 3ISBA 5DB9A 3OTQA 3R3OA 5BR8L 3L7ZC 5GAEC 5ELFA 1NMGA 3RUZA 4B9LA 5FLMH 2E3TA 4KD3A 4A3GB 5DNFA 1L3TA 1ZXTA 4IZ8A 4X66Q 2KVCA 4Y2VA 3STBD 3PIPA 1S5BD 1LTTD 4BY1H 3MTSA 3KTQA 4LJZC 3RH5A 2VZAA 3PSIA 2FE9A 1LT3D 3BJUA 5KFMA 5C0XH 2JEFA 8ICFA 3MHBA 2IBKA 4O5KA 9ICGA 1EOVA 9ICFA 1K3BC 1T5EA 3PIP3 2J6TA 1TS3A 2AQ3B 4NLGA 2XY6A 2ENBA 4LFAQ 4LFBL 4DV0L 4JYAL 4DOAA 4PZNA 8ICTA 4F5RA 2W9MA 3KD3A 4NL9A 1RXWA 4DR4L 5C3EH 5C44B 4Q45A 2DBYA 4IURA 2WF6A 4GLXA 2CQOA 1D1KA 1KDBA 2EY2A 2R18A 8ICSA 2KJ5A 3SR1A 3HOVB 4DF7A 3RLFA 4ECXA 3UQ0A 5J0QA 5CMDA 3M85A 2FMQA 4P74A 1VQMA 5BPCA 3S2HH 4K4HA 2HVIA 3TDQA 3T1HL 2B0CA 2X6LA 4A75A 2ZJAA 4BXOB 1BGXT 4HJ7A 1HUNA 4LMQD 1EY7A 2Q2UA 4CDGA 3WDNA 2A6EC 2F4IA 3L4PA 3H4BA 3BJYA 2CW0C 4RFBA 4C2MB 4HJ5A 5IP9G 2ICIA 2G08A 2K4EA 3AQFA 4JV0A 4NLNA 3FMCA 4DGZA 1TWCB 1X2IA 5AKXA 1BO0A 1Z00A 3LDAA 2HHHL 2C35B 3IG8A 2W9CB 1Y1WG 1ZQTA 1DGSA 1EY4A 3NBHB 4B08A 1D5XC 3VCBA 1SLJA 4XQ8A 4JV5Q 5IIMA 4R4TA 1WTPA 5KT4A 4J6HA 3LK9A 3KLSA 1FFVA 3EFXD 1TVAA 2KKVA 5JVH3 3HOVH 3MZ5A 3BYTB 1EEID 1U4RA 1N61A 5AKGA 4R65A 3J7A5 4J9RA 4BS9A 3GTJH 1TE2A 5ALOA 2B2VC 5G3LF 2L4NA 3FHWA 3MGHA 3HFZB 5JJZA 4NWIA 2YU9B 1BR9A 5EPKA 4UBBA 2VA8A 5DBBA 2YTUA 4C0ZA 4QZEA 4KK7A 2PKEA 3F2DA 1HQRD 4XQJA 3CF5A 1SL0A 3TREA 1GHKA 4RNOA 1TXYA 2ZJRA 5KG7A 4DSLA 1MC8A
chains in the Genus database with same CATH topology
1N36L 1Q86C 1QVGA 4TQUS 1MJEA 3AQQA 5C0XI 1QVCA 2I5MX 3I56A 4JI3L 3PO3G 2MO0A 1IL2A 2IX1A 3M4QA 4JI8L 1K9MC 4IOAA 2MNAA 3RNUA 2CFMA 1IYJB 3DLLA 2QA4A 4LF8Q 2EQSA 1EFWA 3KF6B 5JJLA 4ME3A 4LF7L 4JI7L 1H95A 1N34L 2UXBQ 1FGUA 4Y52H 3UDXA 3A5UA 3KOJA 4DNIA 2UUAQ 4TVAB 3D31A 2VQEL 2NVTH 4LF9L 4A3IH 3PCOB 1WYDA 4DUZQ 4JI1Q 2WFWA 2ZTDA 1KAWA 1VQIA 2YU9H 2D62A 3S1QH 2Q2TA 2N49A 1K8GA 4LF4Q 4NXNL 4GOPB 2ALYB 4X64Q 2R7ZH 4UPAA 1XMOQ 3TS0A 4UY8C 1VQOA 1EIYB 4BY1G 2JA7G 1G291 4H02A 3CMEA 4IO9A 4DR1L 4IPGA 4AYBE 3K7UC 1A63A 2UUCL 3AFQA 2WP8J 3HOYH 4BBSG 2JA6H 1QUQB 4YHHQ 2RHSB 2NZOA 3G6EA 1K73C 1U0LA 3J81c 2R7ZG 4DV6Q 2JA8H 2F4VL 1N32L 2WAQE 1YEZA 2H5XA 2JJQA 1IBML 1HNXQ 1RIPA 1V9PA 2K52A 4DV1Q 1IBLQ 4BA1I 4GNXA 4R4CA 1CKOA 5C4XH 2ATWA 2UXDQ 2NN6I 1UE7A 4BBSH 3JAMi 5JEAG 4GS3A 3FKIG 2HIVA 3RN5A 2JEAI 3A0JA 1E1OA 1VQKA 1MIUA 4X62L 4POFA 2K5HA 2UXCL 1NTGA 3RLOA 2F52A 3KLWA 1X56A 1GVPA 3S1NH 1PYSB 4LFCL 3K81C 3OTOL 1YJNA 4B3TL 2N78A 4BXXG 3CD6A 3CCUA 1S40A 1J6QA 5GROA 1I94Q 3J80c 4DR3L 2IY5B 2A19A 1PH9A 4L5QA 1VQ6A 5IYCG 3KDFA 1X3FA 2GN5A 5LMNQ 4GKKQ 2KENA 4GOPA 1K0RA 4J15A 1EQRA 3U4VA 4L5RC 1JJ2A 5AJ3Q 3W5OA 1Q1BA 3CCLA 4A3LH 1VQGA 1XMQQ 2E5LQ 3AFPA 3EN2A 4DK3C 1VQ9A 5M3FH 5IYCH 1N33Q 1S72A 1HJPA 3JC66 4OXPA 3H3VI 4HIOA 1GKHA 4B3MQ 3L2PA 1JT8A 2BA0A 2EXDA 4YCWA 1Q1EA 1VQEA 2YTXA 3AYHB 4YHHL 4DV3Q 1WJJA 4JI0Q 4DV4L 4A3CG 2R7FA 3H0GG 3J81j 3HOUH 5IYBH 5IP9H 1YI2A 1IZ6A 1L1OC 4A3DH 2R93G 3ER0A 3RZOH 4DR2Q 1ASYA 4FDBA 5GQOA 4X64L 4JBJA 2ID0A 4A3KG 3I2ZA 4NXNQ 1QVFA 1VQ7A 4WJ4A 2VUMH 1CKNB 1EWIA 2QEXA 2OQ0A 4DR2L 2NVXH 2JA8G 1EIFA 4IPCA 3HOVG 4C3IH 1C0AA 3E9IA 3PIOA 4LF9Q 1WCMH 1KD1C 3G4SA 1SMXA 4JBKA 2CCZA 4A3GG 4C2MH 4DV4Q 3U4ZA 1PVOA 4JI2Q 3CQZH 2ZJQA 3A74A 5JJKA 4Y7NH 4LF7Q 3GTPH 3HOWG 2R6GA 2Z0SA 3K0XA 3KYHC 3EBEA 4BBRG 3G71A 4A3EH 2ES2A 4LF8L 1B7YB 1VQ4A 2I0QA 3HKZG 1X54A 2D0OA 2VY3A 2OQKA 5HY6A 1OTCA 2JA6G 5IYDG 4MZ9A 4A93G 3CCQA 2R7DA 3I7FA 3FKIH 2JK8A 5IWAQ 4C3HH 1IBLL 2I5LX 1CKMA 2E2HH 2K14A 3SGIA 1PFSA 1OXXK 4OWTB 4B3SL 4A3MG 5IT9c 3CP0A 1XNQL 2HIXA 2MQHA 5FJ8G 1V43A 1PH2A 5IYDH 4A93H 3GTLH 4LUOA 1B8AA 1HZAA 1SR3A 2HQLA 4QIWE 2XTIA 4DKAC 2VQFQ 4OO1G 3LGJA 3NELA 3M7NA 2LXKA 3OTOQ 4LF5Q 4B3TQ 4JG2A 2JA9A 4BBRH 3WWVA 4A3EG 1E7ZA 1VCIA 2ZTEA 3PGZA 5IP7G 2MO1A 3PF5A 4EX5A 1VQJA 4NXMQ 1JJGA 1E22A 1N8RC 4GN4B 1Q81C 3CMAA 3ULPA 1PH1A 1IBKL 4A3DG 2E2IH 5C3EG 3RR5A 4JOIC 4YCVA 4JBWA 1P16A 4OWWB 4GLVB 1YBYA 2UXDL 1WFQA 1E1TA 1Q12A 1L1OA 4DV1L 1SN8A 1T9HA 2DUDA 1PH7A 1HNXL 1CSPA 3F1ZA 1YNXA 1X3EA 5LMUQ 1VQHA 2GVBA 3MXNB 2AHOB 4JI4L 4K0KQ 5DLQE 4DV6L 1PH6A 3M4PA 1XPOA 1QZGA 1XNRQ 1K3RA 4R4QA 1OXTA 1VQ8A 4DV2Q 1VQ5A 1TWHH 4DV5L 4DR7Q 1SROA 4GN3B 4IFDJ 1LUZA 3CPFA 4A3LG 1OXSC 1VQAA 4C3JH 4AIMA 2B63G 2UUCQ 1HZCA 4IJLA 4HIKA 4DR1Q 3BU2A 5E7NA 1VS0A 3TRZA 5LMUL 1XMOL 2RF4A 1WOCA 2CWPA 3UDIA 4BXXH 1HZ9A 4YWKA 4YY3Q 2LXJA 1K8AC 4QJFA 1EYGA 3GDEA 1HNWQ 4A3BH 3K7AH 4BY7H 3F2CA 4DUYQ 4R4OA 3TEHB 1FJGL 1Z47A 5JEAJ 3PO2G 4MTNA 1N9WA 4NXML 4DAMA 5C44G 1Q8KA 3I4OA 1SFOH 3GD7A 4LF4L 4B3RL 4LF5L 4R1JA 2I5HA 1Q7YC 4KHPL 1YHAA 4A3FG 1B70B 1XPRA 1HH2P 4JI7Q 2UUBL 4IJHA 3I4NH 4HJ8A 4NPSA 3S14H 1NMFA 1U5KA 4RMFA 4HIDA 2LSSA 2CKZB 3K80C 5ELNA 1PA6A 1BBWA 2E8GA 4QL5A 4A3CH 1RL2A 3L0OA 3RLFA 5IWAL 1A0IA 2IHEA 4JC0A 1X3GA 3A5ZB 2Q2HA 2B3GA 2N3SA 2VS1A 3F8TA 4PZ6A 4DK6C 3H15A 4R4IA 1YITA 1JMCA 3ICEA 3I4MH 1KHIA 5BR8Q 1M90C 1PYBA 4JI5L 4JOIA 4IOCA 1NE3A 2EIFA 2KHJA 4AH6A 3HOXG 2Q2IA 1YJ9A 2UUBQ 3U58A 2VNUD 2PQAB 1P8LA 1JE5A 4XTCS 1K83H 5EAYA 3F2BA 1KXLA 4IPDA 4JI2L 4A4IA 1O7IA 4GLAC 5C4JH 4B3RQ 4KHPQ 3CC4A 1BBUA 3PUZA 3T1YQ 1QUQA 3G48A 4A3IG 4WJ3M 2PNHA 2VL6A 3HOYG 5HGQA 2PI2E 5M3MH 2Y0SE 3J80i 3PV0A 3CAMA 3J81i 5GAHC 3KJPA 2Y0SG 3KDFB 2JE6I 1HNZQ 4YY3L 1XPUA 3CW2C 1SE8A 4GKJL 2KBNA 4A3MH 1D8LA 2ZM6Q 4AQYQ 2HHHQ 1YHQA 3RN2A 2BH8A 1Y1VH 4PMWA 3NENA 2KCTA 4DR6Q 1FVIA 3STBC 1LTLA 3ULJA 3W1BA 3NEMA 1ASZA 3CCJA 1G51A 4YCUA 1PH3A 2HT1A 5FLMG 1PV4A 2UU9Q 3S17H 5IP7H 4X6AH 4DV5Q 3GTOH 2K5VA 1R9TH 4JBMA 5K36G 3B6YA 3IRBA 3ZJYC 1BKBA 1Q82C 4K0KL 4HJ9A 1KL9A 3T1HQ 4LF6L 3CXCA 4OO1I 3U50C 4LNQA 1VQCA 1PH5A 4X65L 1N33L 2VW9A 1J5EL 3W1GA 2AKWB 4KI0A 2GVAA 5M5YH 3OW2A 5GAGC 2R92G 1PH4A 1XMQL 3KJOA 4LUZA 2E5LL 3I4MG 5JJIA 3CCRA 2OCEA 1L1OB 1HR0W 2ASBA 3UE1A 1IBKQ 5IYBG 5H1SE 3HOZH 1WI5A 4KLKA 3UE0A 4JI6Q 2NN6G 3J7ZC 4IFDI 1YJWA 4O0AA 4DR3Q 3UDGA 1I94L 2RHQB 1LM0A 2IX0A 4DV0Q 4OWXB 4LFBQ 3GTQH 1TWFH 3HKSA 2WB1E 2DGYA 2JEBI 1GO3E 4LFCQ 2VQFL 3PO3H 4LW1A 4P72A 2IT1A 1JB7A 2JA5H 4YWLA 4X62Q 1KRTA 3RZDH 4JI6L 3OYYA 2NVYH 1I5FA 3PUWA 4B3SQ 1A62A 5IY0A 5C44H 1YIJA 2K50A 1EQQA 2OTLA 2MFIA 3UDFA 2E2JH 2OWOA 3PO2H 3S2DH 3RLNA 3S1RH 2AWNA 3CCEA 3H0GH 4X66L 1W3SA 3S15H 4DR5L 4OX9L 3PUXA 1YHBA 4A3BG 4BY7G 1VQPA 1IBMQ 3CPWA 2KHIA 2JA5G 4JCVE 2F4VQ 1N32Q 4L5SA 1CUKA 2BH2A 1IXRA 1Y1WH 4A3JH 5J3BA 2D0PA 2Z6KC 3PUVA 4DPGA 2UU9L 3HOUG 3CCVA 1W2BA 3M4OH 3CC2A 5M5WH 3M9BA 4HJAA 2YTVA 4L5TA 4QY7A 1KQSA 3TS2A 3BZKA 5ELOA 4AYBG 4A3JG 3PF4A 1OXVA 3ULLA 4YWMA 2PMZE 1NY4A 4AQYL 4UP7A 1HR0L 4GKJQ 2OTJA 1AE3A 3E9HA 1EUJA 4LWCA 1HZBA 1Y14B 2R92H 1E3PA 5LMNW 1HNZL 2NZHA 3KF8B 4MNOA 2K5NA 3D0FA 2XGTA 2B29A 3GO5A 2YTYA 4GN5A 1HR0Q 4LUVA 3GTGH 2B63H 1I6HH 5FJ8H 4GNXB 1XJVA 4QQBX 2WAQG 3E0EA 3K8AA 3GTMH 3KF6A 2VQEQ 3JAMc 1AE2A 1SRUA 1S3OA 1UE1A 2PQAA 4OONA 1L0WA 2A1AA 4GOPC 2UUAL 1PH8A 1QZHA 2CWAA 2YYZA 5IE8A 1X6OA 4JI0L 4POGA 4IFDG 1X9NA 4DV3L 1I3QH 3S1MH 2KCMA 1N34Q 2UXBL 1YZ7A 2YV5A 1OXUA 1TWGH 1PHJA 1Y1VG 1YVCA 4B3ML 2NVQH 4JI8Q 2L15A 4JI5Q 3GTKH 5BR8L 3L7ZC 5GAEC 1NMGA 1C7YA 4PZ7A 5FLMH 4DR5Q 4OX9Q 1UEBA 1X65A 3CCSA 2PI2A 4X66Q 3S24A 4A76A 4A3GH 3STBD 3PIPA 1N36Q 5AJ3L 4BY1H 2VZAA 3PSIA 3BJUA 5LMNL 1VQNA 4GKKL 4O2DA 1GD7A 2JA7H 1EOVA 3FP9A 1MKHA 2JQOA 2VUMG 1CSQA 1UE5A 4BA2I 1KIXA 2WB1G 4LFAQ 4P71A 4DV0L 3S16H 3KFUA 1A8VA 1NJIC 4JYAL 4LFBL 1JJCB 4DV7L 1VQLA 4DR4L 1LYLA 1Q46A 3HOZG 5C3EH 2UXCQ 1TWCH 5FLXc 1FJGQ 1UWVA 4DUYL 2CQOA 2Z6KA 4GLXA 4IPHA 3CCMA 1HNWL 1FL0A 4ALPA 1Z9FA 2V1CC 4HIMA 3M85A 4JV5L 4P74A 2A8VA 1VQBA 4NB3A 1VQMA 1J5EQ 3S2HH 4X65Q 2FXQA 3HOWH 3TQYA 1YZ6A 1KRSA 3MEFA 5C0XG 3T1HL 1GM5A 4LF6Q 4QGUA 5M3MG 4A75A 4XIGS 4HJ7A 2QGQA 3HKZE 3ERSX 1XTDA