2A19A

Pkr kinase domain- eif2alpha- amp-pnp complex.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
165
Chain Sequence
SSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 46
structure length 165
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a19A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a19A01
4MZ9A 1TWFH 1EIYB 4B3RQ 3L7ZC 1X3EA 3GTJH 1Y1VG 4DV4Q 2OCEA 1JB7A 3AQQA 1IBKL 3G48A 3TEHB 1I3QH 4DR2L 2IY5B 4GLVB 4UP7A 5M3MH 2K14A 3F2BA 5IWAQ 2MNAA 3G6EA 3GTQH 1S3OA 1KAWA 2K5VA 2R6GA 5JEAJ 4BA1I 4X62Q 2KCTA 2VL6A 4K0KQ 4KHZA 2JA7G 3J7ZC 4X64Q 5M3FG 2BA0A 4JV5Q 4JG2A 1K3RA 1IBMQ 3HOWH 4DV7L 2B63G 4IPCA 1YJWA 3RLNA 1Y1VH 5C0XI 2WB1E 4LWCA 5GAHC 2ZTDA 4JI7L 3ULLA 4JI5Q 2HQLA 3D31A 4NB3A 4HIDA 1ASZA 3S1NH 3OW2A 1N9WA 5GQOA 1B7YB 4XIGS 4B3SL 2JA7H 3CQZH 5M3FH 2E2HH 2EXDA 1TXYA 4DR4L 4C2MH 2JK8A 4JI4Q 3TS0A 2B63H 3GDEA 4GOPB 4QL5A 4PMWA 4A3FG 2N78A 3S1MH 1FJGL 3M4PA 3S17H 4APVA 3J80i 2UUAL 1KQSA 2VQFL 5ELNA 2IHFA 5M5WH 4BBSG 2VY3A 3STBC 1HZ9A 4MTNA 3FKIG 2VQEQ 3BZCA 3CCRA 1KHIA 3ZJYC 4DAMA 3UDIA 2QA4A 4AQYQ 4JBKA 4AYBE 4A3FH 1Z9FA 2KHJA 3S16H 4J15A 3H15A 4L5QA 2JA8G 1GO3E 1XTDA 3S24A 4DK6C 3F2CA 4BY7G 1VQHA 3K80C 3A5ZB 4JCVE 2H5XA 4BBSH 1NBWA 3FKIH 1JT8A 2BH8A 5LMNL 1BBWA 1C9OA 2I5MX 2UXBQ 3PF5A 2JA5G 2YTXA 4RMFA 2KCMA 3GD7A 2JEAI 2NVYH 1P16A 3I56A 2UXDQ 2ID0A 5IYCG 5C4XG 4DR5Q 3J81i 1VS0A 1AH9A 1WJJA 2JA8H 5IE8A 2AWNA 2WAQE 4X66Q 4GNXA 1S40A 1FVIA 3NBHB 1VQLA 4BY7H 3AEVA 4IJLA 2XGTA 3BJUA 4YHHL 1N34L 2R7FA 4R4CA 2C35B 2NZOA 1Q81C 3KDFA 2F4VL 3M7NA 1L0WA 2JA5H 1HNWL 3U58A 1XPRA 4DR3L 1VQJA 4DUYL 2EIFA 5IYCH 1A62A 5C4XH 2MO1A 1I6HH 3TRZA 4P72A 4A3KG 5C3EG 2K5NA 2HIXA 3M4QA 2E2JH 2UUBL 1HR0L 1SN8A 1XNQL 1V9PA 5FLXc 1MJEA 3U4ZA 3NELA 1PH7A 2CCZA 2UUAQ 2BH2A 1N8RC 4GN4B 4JI3Q 4LF6L 4YCWA 2ZTEA 4R1JA 1TWHH 4YY3Q 5IYBH 2E2IH 3JAMi 4NXNL 4LF7L 3S1QH 1MIUA 5GAGC 3CCUA 5M5XH 1O7IA 1W2BA 1PH3A 4B3MQ 4GN3B 1OXSC 1G51A 5C44G 5IY0A 1QVCA 1HR0W 1U0LA 3BU2A 4A3KH 5C3EH 1JMCA 1KD1C 1VQNA 4GNXC 4DR1L 2ATWA 5IP7G 1NY4A 1E22A 2QEXA 1VQMA 4P75A 4JI8L 2JA6G 2UU9Q 3L2PA 1WOCA 1IBLQ 4BY1G 2PQAA 3RZOH 3HFZB 4A3EG 1D7QA 1I50H 1A8VA 1UWVA 5DLQE 5E7NA 3UE0A 2A1AA 2YV5A 3J81c 3T1HQ 4JC0A 4DV5L 2UUCQ 2ALYB 3CC2A 3PO2H 1OTCA 1WFQA 4DV0L 5IP7H 5AJ3Q 3OTOL 2HHHL 1M90C 2LSSA 2F4VQ 2JA6H 4EX5A 1XNRQ 2V1CC 1Q7YC 4ALPA 3NENA 4DV2L 2B29A 4BY1H 1N32L 3ERSX 1A0IA 4LUOA 2R92G 1L2FA 4DUYQ 4DUZQ 4A3EH 2CWAA 3GTOH 4GKJQ 1G6PA 1RIPA 3HKZG 3RLOA 4L5RC 1YI2A 1VQDA 4A75A 2OWOA 2E5LL 1IZ6A 1HR0Q 5C0XJ 1UEBA 1GKHA 4OWWB 1XNQQ 2DGYA 3FHWA 2IHEA 4IJHA 3TREA 1EQQA 1TWAH 1OXXK 4LF6Q 1WCMG 4IO9A 1L1OC 1HNZL 1Y14B 3JAMc 1XMOQ 4A3DG 5GAEC 1FGUA 2R92H 4QQBX 4HJ5A 4A3CH 1XMQQ 4LF5L 4YWLA 3CCVA 5LMUL 4DR7L 3K81C 1VQ8A 4A93G 3MEFA 2VUMG 1SR3A 3CCJA 4DR1Q 3KFUA 1HNXL 1YITA 4NXMQ 1SMXA 4DR6Q 1LM0A 3CCMA 1X56A 4JI8Q 3D0FA 2HT1A 2NVTH 1WCMH 1VQOA 4DPGA 1EWIA 4GNXB 1D8LA 3CC4A 4A3DH 1QUQB 5JJLA 3KF8B 4JI2Q 3F8TA 3S15H 3EN2A 1PV4A 3KDFB 4UY8C 4PZ8A 3RN2A 4R4OA 1J5EQ 4HJ8A 4A93H 3PSIA 1E7ZA 1PH8A 2LXKA 2VUMH 4JOIC 2DUDA 2D0OA 3HKZE 2A19A 1W3SA 5IP9G 1N36L 1PVOA 2K5HA 2FXQA 3OYYA 3RZDH 1PHJA 4WJ3M 3CP0A 3A74A 3PCOB 4UPAA 4DV2Q 4JI6L 1YBYA 5FLMG 1VQPA 1IBKQ 1CKNB 2Q2TA 1K9MC 2YTVA 1I5FA 3T1YL 4HJAA 1X6OA 4GKKL 1N32Q 1I94L 1VQIA 1VQEA 1YNXA 3AYHB 3PUVA 4DR2Q 3DLLA 4LNQA 1N33L 2VS1A 1KC8C 5FJ8G 1X3GA 4QJFA 4HJ9A 1EIFA 3ICEA 5BR8L 4X65L 4PG3A 2GVBA 1MKHA 3HOZG 1Q1BA 2K50A 3PUWA 4OX9L 1WI5A 1YHQA 2Q2IA 5IP9H 2LXJA 2R7ZG 2WP8J 4DV7Q 1PYSB 4ME3A 4QY7A 3PUZA 2MQHA 2UXCL 1B70B 3CXCA 5FLMH 2KBNA 3E9HA 1HNZQ 4LF4L 1X3FA 4LF8L 3B6YA 1PH4A 4JI7Q 1HZBA 5IT9c 5C4JH 3I4MG 4X6AH 3HKSA 4DR7Q 4LFCL 2JQOA 4UP8A 1L1OB 5FJ8H 2K4KA 1JJ2A 4B3SQ 1GD7A 3GO5A 2YU9H 2PQAB 2B3GA 3HOZH 1EFWA 1QUQA 5LMNW 4A3LG 5JJKA 1OXVA 4OWTB 4DR4Q 2R7ZH 5IYBG 4DV3L 5EAYA 4A76A 1VQ4A 1YZ7A 3CF5A 3I55A 1H95A 3H3VH 1X65A 1BBUA 2CWPA 2UXDL 5GADC 4JBJA 3F2DA 2NN6G 4R4QA 4GS3A 3I4MH 3K0XA 1PFSA 1PH2A 3M3YH 1VQ5A 5GROA 1FJGQ 1JE5A 2PNHA 3M85A 2Z6KC 3E0EA 1DGSA 3KOJA 1CKNA 2F3IA 1SE8A 4O2DA 4DK3C 4HJ7A 4A3LH 4L5TA 2VQFQ 3CCLA 1N36Q 1A63A 4C3IH 2JA9A 1LUZA 4LF9L 3ULPA 1UE1A 4NPSA 1EOVA 3AFPA 1VQ9A 4JI6Q 3W1GA 4R4TA 3VDYA 2OQKA 3ULJA 3T1YQ 1V43A 4JI1L 4TQUS 3PF4A 4BXXG 1J6QA 1EYGA 2YTYA 4B3TL 3H3VI 2KHIA 2IX1A 3PO2G 3CPWA 2E8GA 1Q46A 3G4SA 3TS2A 3HOUH 2GN5A 1IYJB 1NMGA 5IWAL 1X54A 1MJCA 5LMNQ 1EUJA 1L1OA 1YEZA 4MNOA 5H1SE 2XTIA 4X64L 4K0KL 4IFDG 3AFQA 4A3MG 4LF4Q 4LF8Q 1NMFA 1EQRA 1M1KC 2I5HA 2N8NA 4LW1A 4BXXH 1VQFA 1JJGA 3K7AH 2JE6I 1XJVA 1K8AC 3PV0A 4JI5L 3KLWA 4UP9A 2NN6I 3CCSA 4QIWE 1FL0A 2OQ0A 4YHHQ 1N34Q 3CMAA 3S2DH 2MFIA 3UDFA 4DV3Q 3M9BA 3Q8DA 5JEAG 4C3HH 4P71A 2MO0A 4EQ5A 4GOPC 4A4IA 2WB1G 1NE3A 1HNWQ 4YCUA 4A3MH 4DR3Q 2I5LX 1Q86C 1NJIC 1B8AA 3FP9A 3ER0A 4JI4L 2A8VA 4A3CG 4KHPL 4A3BG 1CKOA 4Y52H 1X9NA 1UE5A 2RCNA 3STBD 2F52A 2VZAA 1E1TA 3GTGH 1T9HA 3K8AA 4JOIA 4HIKA 5JJIA 4YWKA 1XPOA 2UUBQ 1PH5A 3CMEA 2NVQH 1VQGA 1CSPA 2KENA 4LF9Q 4JI0L 3LGJA 4LF7Q 4IFDJ 4NXNQ 4AIMA 3PIOA 2YYZA 2Q2UA 2ZM6L 3L0OA 4JI1Q 2VQEL 2AKWB 3MXNB 4A3JG 1Q82C 1ASYA 1E1OA 4A3BH 1SROA 4IFDI 1OXUA 2HIVA 1QZGA 2QGQA 3U4VA 4HIMA 4AQYL 1C7YA 4B3TQ 4JYAL 3I4NG 1YVCA 4H02A 3TQYA 1AE2A 1Z47A 1Q1EA 1SRUA 3BZKA 1E3PA 1K8GA 1RL2A 1C0AA 4HIOA 3SGIA 5ELOA 1Y1WG 3CW2C 1UE6A 1VQ7A 1WYDA 2JJQA 4AYBG 4A3JH 3E9IA 2UXBL 2RF4A 3KF6A 5HGQA 1AE3A 3WWVA 2IT1A 4DV5Q 1KIXA 4L5SA 4DV1L 4IOCA 3I4NH 1KXLA 4DV0Q 4DR5L 3W1BA 2CQOA 3A0JA 3OTOQ 3GTLH 2HHHQ 3CC7A 1YJ9A 3GTPH 4X66L 4TVAB 2N3SA 5HY6A 5J3BA 3EBEA 1Y1WH 4KHPQ 1VQ6A 4LFAL 1LYLA 3S14H 2PI2A 4GN5A 1PH6A 1E24A 1VQCA 2WAQG 2IX0A 2Q2HA 2Z6KA 4BBRG 4AH6A 2Z0SA 4XTCS 2E5LQ 4Y7NH 3GTKH 1BVSA 3U50C 3PGZA 3UE1A 3CCQA 2R93G 1CSQA 1U5KA 3RLFA 4JI0Q 3I4OA 4PZ7A 3KJPA 2ASBA 2ZJQA 4RG1A 4YWMA 4BA2I 1CKMA 4JI3L 4DKAC 2ZM6Q 1YHBA 3CCEA 3CAMA 3M4OH 1OXTA 4YY3L 3H0GG 2ZJPA 1YHAA 1VQAA 4JBMA 4LF5Q 1KL9A 2K75A 1PH1A 5LMUQ 1CUKA 4B3ML 1LTLA 4LUZA 4OXPA 4JYAQ 1V1QA 4BBRH 2EQSA 2PI2E 1VCIA 1KRSA 1PH9A 1HNXQ 4LFBL 1JJCB 3PUXA 3HOYG 3PO3G 2R93H 4POFA 3G71A 4PZ6A 4KI0A 1K73C 2BA1A 2GVAA 2UU9L 4WJ4A 1GM5A 3H0GH 1HJPA 3F1ZA 1IBLL 1YJNA 4A3GG 3RN5A 1Q12A 1TWGH 2Y0SG 4JBWA 4DV1Q 4OO1G 3RNUA 4GLXA 3IRBA 3HOUG 4DV6L 3T1HL 2WFWA 3HOVG 4QGUA 2UUCL 3HOYH 3PO3H 4GOPA 1X55A 2VW9A 5AJ3L 2K52A 1KRTA 1P8LA 1S72A 1XPUA 2CFMA 4P73A 4DNIA 4GKKQ 1XNRL 1I94Q 4B3RL 4LUVA 4LFAQ 2L15A 1N33Q 4A3GH 4DV4L 3I7FA 3I2ZA 2PMZE 1SLJA 3NEMA 5BR8Q 4X65Q 4DUZL 4DAYB 2D62A 1NTGA 2ZTCA 2R7DA 4OX9Q 3J7A5 4GKJL 3GTMH 1HZAA 4IPGA 3KJOA 4OWXB 3HOVH 4X62L 1IL2A 2CKZB 1Q8KA 3HOXG 4YCVA 2UXCQ 3J80c 5K36G 4O0AA 4JV5L 3PUYA 4GLAC 3A5UA 4KLKA 2N49A 1IBML 3UDGA 1SFOH 1TWCH 1VQBA 1R9TH 1XMOL 4LFCQ 4IPDA 1QVGA 1QZHA 3J81j 3DM3A 1XMQL 4IOAA 1YIJA 1PA6A 4OONA 4LFBQ 1K83H 2AMCB 2Y0SE 3KF6B 1UE7A 4OO1I 2OTJA 3HOXH 3K7UC 3RR5A 2ZJRA 5IYDG 4A3IG 2OTLA 4NXML 5C0XG 2I0QA 3CD6A 4DR6L 1K0RA 1HZCA 1YZ6A 2NZHA 5M5YH 2JEBI 1G291 3JC66 1PYBA 3S1RH 4POGA 1IXRA 3EIVA 2AHOB 4R4IA 2D0PA 4JI2L 2RHQB 3S2HH 3UDXA 4C3JH 5C44H 5M3MG 2VNUD 1BKBA 4P74A 3W5OA 4FDBA 2RHSB 1J5EL 4DV6Q 1VQKA 2AWOA 1HH2P 2NVXH 1GVPA 3KYHC 3CPFA 4A3IH 2ES2A 5IYDH 4IPHA 3PIPA 1QVFA 3HOWG
chains in the Genus database with same CATH superfamily
4MZ9A 2KHQA 5AKKA 4QZHA 1HTPA 2PNRC 4GXIA 1X3EA 3L7ZC 4XT1B 2CVRA 3PW0A 8ICQA 3EYZA 2F0MA 4IC9A 1Q3VA 4DNTB 1A0PA 3L3FX 3ALRA 3GV7B 1QSSA 2KIWA 2W9AA 1I3QH 2NYVA 2WF7A 1S5DD 2HQEA 4GLVB 2ZJ8A 1JOKA 2MNAA 3IG5A 3GTQH 1HUNA 1TY0A 5KG4A 3EZ5A 2JA7G 4X64Q 2EYPA 1ZQKA 1PXUA 2BA0A 4JV5Q 3I8ZA 1P7DA 2XICA 2WACA 1YJWA 3RLNA 1S5BD 5D3IB 2ZTDA 1II3A 4HIDA 3N28A 5GTHU 5J2JA 1ASZA 1SEBD 1I4PA 5GQOA 4WORA 4IUQA 4FP5D 2W3SA 4O0IA 9ICGA 2Z7JA 3R9KA 2DY8A 3DDHA 2JA7H 5J0OA 2UVWA 2EXDA 2E2HH 1NNLA 4DR4L 2F0NA 1KN5A 3TANA 5J0QA 4PHEA 3K0YA 4ED0A 4NY8A 4QB4A 3K75D 3C1EA 4PMWA 2NRXA 4DGZA 1LV9A 1JE4A 3VA7A 3ORYA 2F0KA 4APVA 2C2EA 2Y0SB 2PPBC 1OO9B 4UB4A 2W9BA 2IHFA 2VY3A 4NW2A 2VQEQ 2R8KA 3HOUB 1JOQA 1KEJA 1SSOA 2BDOA 3OW7A 5KFAA 7ICQA 4JBKA 1G2SA 3TZDA 3ZJYC 3U26A 2KK0A 1NK5A 5HHIA 1LTTD 4KLFA 2JH1A 4L5QA 2JA8G 1G91A 3HX0A 5NUCA 3S9WA 3M9NB 1F2YA 1SV0C 1DRGA 1VQHA 3K80C 2W55A 3VR3A 5CMDA 5EWFA 5LHY1 3A55A 1E2VA 2V4DA 2BH8A 2F3NA 1BBWA 3LWUA 2UXBQ 2JA5G 5KG1A 4BGDA 3T5KA 2YTXA 4RMFA 1TAMA 5F9LA 1A77A 1SKSA 4ELTA 1B53A 5C4XG 3J81i 5G5GA 1LTID 2R61A 1WJJA 5J2AA 4YR3A 1UT8A 3S1RB 2JA8H 2F1IA 2J6UA 2WAQE 1S40A 3RB4A 1FVIA 1VQLA 4YHHL 3GTGB 4DS4A 1N34L 3S2HB 1PYWD 3Q22A 3KDFA 1N60A 2BZFA 4AYBF 4QZIA 3N6RA 4BWJA 4KN4C 2JA5H 5IIOA 1SB3C 4IL6U 4JWMA 2GO7A 4OIJA 1XPRA 4DR3L 1VQJA 2W8LA 4DUYL 4KITB 3M7GA 3R8BA 1NJWA 4C8OA 5C4XH 4KJOA 3GV8B 3IFTA 2E2JH 3M4QA 5BN5A 3NQTA 1ZQVA 4KLMA 1SN8A 1V9PA 5FLXc 2KJ5A 3IM1A 3OPXA 3U4ZA 1MJEA 1SYDA 4PHDA 4GN4B 4JI3Q 4LF6L 3HEJA 3MZ5A 4YCWA 4UB6U 4LF7L 1U48A 4J9NA 4FVMA 4UAYA 2QW7A 5FK9C 4B3MQ 2X69A 4GN3B 1OXSC 2AQ2B 4QF4A 1N2XA 1G51A 3NBIA 1C8CA 5I9PA 3RH5A 4XQNA 1U0LA 1JUDA 5AI4A 2KCNA 4ECXA 1KD1C 1Y1VB 4GNXC 5CA7A 3BQ0A 2A73B 1O78A 1E22A 2A68D 3AM9A 3V2TA 2UU9Q 2MPMA 3AN1A 1IBLQ 5EJWA 1H38A 4BY1G 1HCZA 5ALZA 3UQ0A 2D6FC 2KZ3A 2JXMB 3HFZB 5CC4A 3CQZB 3PW5A 4A3EG 1D7QA 1A8VA 2FDRA 4HMIA 3I70A 5LL6X 2A1AA 4XXEA 2YV5A 3J81c 3CC2A 4DV5L 2ALYB 4F2SA 2IX3A 4DV0L 2NTSA 3Q8RB 2A6HD 4DNRB 2W43A 3NVZA 3OTOL 3BDPA 4QWEA 2B2TC 5J0PA 2Z4HA 3TZUA 4DK1A 4R8IA 2KMDA 2F4VQ 3BQ2A 3ZDCA 4KLLA 4BY1H 2Y0SF 2WV6D 3QZ7A 2QF7A 3ERSX 2R92G 4NM1A 4DUZQ 5CHGA 2CWAA 5L37A 3RH4A 4A3EH 1KSPA 1G6PA 3HKZG 4QIWC 4L5RC 1YI2A 1VQDA 1WG8A 1LACA 4A75A 1IZ6A 2VKQA 1UEBA 1DJRD 2WAQB 1EQQA 1DXSA 4I27A 1KDCA 1WWUA 1GHJA 5ALYA 1BNOA 2F4IA 4PGQA 1Y14B 1SYBA 1DD2A 1GJXA 1S8OA 5KFSA 2R92H 4NJ8A 4TRDA 4A3CH 3F2UA 2N1RA 4K5WA 2PO4A 3CCVA 4BBSB 5KT5A 1XSNA 3TP5A 3K81C 3WK9A 4F88A 1Q90A 5I9OA 2ZUCA 1ET9A 1X66A 4DR1Q 4XRHA 4ED7A 1C20A 4DR6Q 3CCMA 3QUCA 8ICWA 4PNYA 3AMUA 2NVTH 3PMFA 1D8LA 3CC4A 2BCQA 3KKAA 5JJLA 4LZDA 1ZD4A 2SNSA 3EN2A 2B0CA 1ICFB 1PV4A 5CJ7A 4UY8C 1J5EQ 3T53B 3UMGA 2BPGA 4QWAA 1E7ZA 3D6WA 4J9SA 2LXKA 1RKNA 1PH8A 1BBXC 3OTQA 3AQFA 3N52A 5IP9G 1XWLA 3HZXA 1N36L 1PVOA 4WJ3M 4RUCA 4UPAA 1N61A 1B50A 4X3TA 2FI1A 4TUSA 2L1BA 5FLMG 3TACB 1IBKQ 4J03A 5JVH3 1K9MC 1N32Q 3C5FA 4YD2A 1X6OA 4DQSA 1VQIA 1I94L 1YNXA 2VS1A 3MVVA 2BE5D 3P75A 1TWHB 9ICBA 4QJFA 2E2IB 2Q4TA 4ECVA 2JZBA 1MKHA 1Q1BA 4OX9L 4EVOA 3GILA 3UMBA 7ICNA 1WI5A 2Q2IA 1YHQA 5IP9H 3MXNA 3WK4A 1KAAA 1RCVD 2E5SA 3M1YA 4I2IA 3V96A 5DM63 4HCSA 3QNMA 4A3KB 2B2YA 5EQ0A 5FLMH 4UAZA 4K4IA 5AK3A 4LF4L 4F4XA 1BPYA 3B6YA 4I7AA 3E6ZX 5IT9c 1NK0A 1K5OA 1K8MA 1MBYA 3HKSA 1PRTB 4QZAA 2OHFA 1JN3A 3VC8A 4B3SQ 2ES6A 1BUVT 4XQJA 1QUQA 3KF8A 1ZQWA 2K89A 3FAHA 2HHSA 1RYSA 4RQ8A 4A76A 3ZDDA 3CF5A 1TY2A 1ECWA 2XRSD 4KN7C 3I55A 1ZD2P 3X3NA 3JPOA 1X9WA 4Q45A 2KZMA 1BPBA 1NKEA 3BDCA 2IHMA 4RU9A 2AGQA 3MA2B 2LBOA 3I3CA 2K33A 3EFXD 3E0EA 2F3IA 2DQNB 3SMVA 1IYUA 4L5TA 1ZQDA 3BG3A 2B2UC 5M3MB 3ULPA 4YXJA 4BDPA 1CQVA 4JI6Q 5CV7A 2LM4A 5KFEA 2HVIA 2MGSA 3W1GA 3ULJA 5KFJA 2YN4A 1V43A 1L3VA 3NVVA 5DDYA 4CJ2C 3T79A 4OHJA 1J6QA 4KLQA 4BXXG 5KG2A 4B3TL 4B9NA 5DKWA 1TAQA 2UVVA 5EOZA 1KBUA 4RQ5A 2MJ8A 3G6YA 1EYAA 3EROA 4CKCA 2QEJC 3HOUH 2RLTA 1X54A 2ASDA 1MJCA 5KYLA 3S1NB 3RD4A 5LMNQ 1EUJA 3ZI4A 4F71A 3AFQA 5AI8A 4A3MG 2W8KA 3M9MB 2K8CB 1VDVA 2NRZA 1EQRA 1PZJD 3H3VC 2L5YA 2I5HA 1CZWA 2N8NA 4LW1A 4BXXH 1A6XA 1XJVA 1GHKA 4JI5L 4UP9A 3BJYA 2EZXA 4J9LA 1FL0A 3TP7A 4LVSA 1NNXA 3EA6A 5F9NA 1L7PA 2E74C 2XIDA 3UDFA 1DCZA 4EQ5A 1XSPA 2MO0A 5EKLA 1STGA 1ESFA 4YCUA 4A3MH 2OT2A 3OPOA 2A8VA 4KHPL 1EY4A 5KFMA 5M5WB 4C7ZA 1X9NA 2KV2A 1LTGD 3ZYYX 2HHQA 2K01A 3GTGH 2AU0A 2KFNA 4HIKA 3NASA 5JJIA 1XPOA 5HR6A 2UUBQ 5EKIA 3SEBA 2K03A 2Z1CA 4BWGB 3CMEA 1YT3A 3KZXA 1S9FA 4K5XA 2KENA 4LF9Q 4I2GA 2A1JB 1LTRD 4PJ0U 2KJ9A 4Y2RA 1ZRMA 2EDUA 4UASA 4Y2VA 4YR0A 1E1OA 1EY9A 5IOCA 2XY6A 3QJYA 1J8IA 3JPQA 2HIVA 5J29A 4J9KA 1PLFA 4BJQA 3CKIB 3OIPA 3Q8PB 5JOBA 1KQQA 4HIMA 9ICIA 3TQYA 4B9XA 2PFNA 5HGTA 3ERQA 2B2VA 2NVYB 9ICHA 1E3PA 2JHDA 1PRTF 1Q8IA 1RL2A 4I2BA 4XUSA 4HIOA 1LT6D 4KD3A 2YU9B 4BX9C 4QZDA 1VQ7A 4EYIB 3CW2C 1UE6A 2X6LA 2Z8LA 1L5UA 2RQXA 1AW7A 3TP6A 3FYHA 3VYSA 5KNBA 2RF4A 4UB8U 1CQFA 3OHXC 3E0FA 4DV1L 4IOCA 3ED5A 4IURA 2FLLA 1KXLA 3GIIA 8ICAA 3W1BA 2CQOA 1PTOB 1BPZA 2OXOA 3GTPH 3N4MB 3I4MB 3LVVA 4L63B 1HTLD 1MSGA 3VA5A 4J8QA 5J3BA 2GLEA 2HD3A 2Q8TA 4DF8A 3EBEA 3Q23A 1ZQJA 3HILA 3RBDA 4N9PA 1NZPA 1VQ6A 2TMPA 3BQ1A 5DLFA 2BQUA 1JCKB 1LYLA 4UBCA 2K5DA 3ZD8A 4GN5A 3IHQB 4ICAA 5DB9A 1PH6A 1E24A 3S1QB 2WAQG 5CYUA 2Z0SA 4XTCS 2IA6A 4LJXA 4ELVA 1TT2A 4NLKA 1U5KA 4JI0Q 4CHTB 3TN2A 2EY6A 5C3EB 5F3XB 4UQGA 3V05A 4ZLTF 4GC7A 2AGOA 5D46A 7ICIA 3CAMA 4K4HA 4YY3L 3M4OH 4IR9A 4RQ7A 2V4QA 1PH1A 1LT5D 3FPPA 3PNCA 5ALMA 1ZQFA 1LTLA 1N62A 1ZXTA 1QQ7A 1V1QA 3A8JE 1UPHA 1PFBA 1KRSA 3RZOB 3C1YA 3PX4A 3NTHA 4GZYC 1XNSA 5A2QE 1BCPB 1I50B 4ZCKA 3JPTA 3G71A 2B8GA 1M6YA 4UAVA 3UXNA 5BN3A 1IKLA 4KI0A 1WTRA 5D49A 1RODA 1SNDA 3PO2B 1HRJA 4DFAA 3K59A 1HJPA 4F8RA 4KMUA 4A3GG 4CE6A 3A56A 3RN5A 2XGPA 2FLPA 1TWGH 7ICPA 4KHVA 4C3HB 1S5FD 2X6GA 1JRPA 1EY8A 3NQIA 4IUVA 1HIWA 1W6JA 2OEOA 3MAQA 5L1JA 3MXPA 4EGVA 4RQ3A 5C5LA 3WU2U 2EOTA 4CDFC 3HOVG 5KFFA 8ICEA 4Z6EA 2DFLA 3Q8KA 2F76X 1X9MA 1AEXA 3D8GA 4LMQD 4RCNA 4ED3A 3GV3A 1P8LA 1RDPD 2TSSA 4B3RL 4Q5VA 1CI4A 9ICOA 2L15A 4A3GH 2HOQA 5DQGA 2YQEA 1N5XA 5BOLA 3NEMA 2K04A 3QU5A 1FNVA 3QXGA 1X40A 5A0LA 2K8BB 2YMLA 3GZFA 4GKJL 1HHVA 5KFIA 2R7DA 4R9WA 7ICLA 1WTVA 4USAA 3HOVH 1Z00B 3CRKC 4DL5A 1D9FA 1Q8KA 9ICRA 3HRZC 5KFKA 4NMZA 3HOXG 1PVPA 2BHNA 1BCPD 1EU4A 3J80c 4GLAC 5HR7A 2YX8A 4ED6A 1IHZA 3VR6A 1IBML 1F9RA 1XWEA 1SFOH 1VQBA 3QUTA 2XNAC 5IGDA 3MC1A 3EPIA 1XMOL 2F0FA 1WCMB 3Q6SA 2ZIVB 2E3TA 1ZQAA 1YIJA 1PA6A 4IOAA 4LFBQ 4OCZA 5LL6S 3S15B 2RDGA 2DNEA 2QDLA 3LX0A 1IV8A 1EY6A 3HOXH 1VDZA 2B6GA 3RR5A 4RWSC 1H9SA 2EE1A 2L0CA 4G9BA 3HT3A 3OOCA 1DZ1A 3A0HU 1QILA 1PTOF 3SAHA 1KFTA 1G291 1PYBA 5KFWA 1T5XD 4H44C 5FLXE 2DGZA 4J9OA 3RZDB 5KAIU 3PY8A 5CR0A 2D0PA 4JI2L 4RFBA 2RHQB 3NGDA 5M3MG 2N55A 3W5OA 3I91A 4FDBA 4FNFA 2HCCA 4EEKA 5G3LD 5DBAA 3IFDA 4RGMA 3OMGA 3PZPA 3PIPA 4DSKA 4C8KA 2HHVA 2AUKA 5IGCA 5DAUA 2W11A 5IINA 1EIYB 3HOWG 5DBBA 2J6SA 2F0PA 3AQQA 4DV4Q 2IJ0A 1JB7A 3TEHB 1KABA 5CB1A 4I29A 5M3MH 3MFGA 4FF2A 2EVBA 4OD0A 3G6EA 4AP9A 1S3OA 1KAWA 1NK6A 2K5VA 4BA1I 2HDLA 7ICTA 4K8JA 4QMGA 3J7ZC 2EJMA 3J81E 3RBEA 3N97B 1U4PA 2O2LD 1K3RA 2K8AA 3WKCA 3HOWH 4DV7L 8ICBA 1BCPF 2QB1A 2G5DA 4QCLA 1CI3M 3BVMA 1K1QA 2C2RA 2VJ5A 2E1EA 2HQLA 1S0NA 3D31A 3S1NH 4F3OA 2N88A 1N9WA 5T1IA 4XIGS 1RQNA 4B9UA 4V190 7ICGA 3TFSA 2DUYA 3PW7A 5K4LA 1A3UA 2O4XA 1IW7C 1ZQZA 2PQEA 3R3OA 5BPCA 2E1FA 4DL3A 1TXYA 4C2MH 4RGNA 4OJ6A 1W6KA 3RJKA 3HW8A 3MABA 3PO3B 1SIJA 4GOPB 2HBKA 1LVHA 5AHXA 4A3FG 1JICA 3EPGA 1FJGL 4UB1A 4M9NA 3S17H 5KNDA 2RDFA 3H0LB 1ZQXA 1GUOA 9ICCA 3C3LA 2PFOA 9ICUA 5HHHA 5ELNA 3DEPA 5M5WH 2VQFL 5AKGA 1JMSA 4ME5A 3GTMB 3BZCA 5FLXL 2W7OA 3CCRA 1ZEQX 3DWPA 9ICNA 2K4HA 5BN4A 3ONNA 3GIJA 4C0ZA 3M4YA 2QA4A 2RDHA 4HR7B 2KHJA 4AYBE 4DSLA 4A3FH 4J15A 3SEIA 1UT5A 3E2EA 9ICVA 4ULLA 2YMMA 4PL2A 5HMMA 4DF4A 5DGAA 3S24A 2C28A 4QZCA 4BY7G 1T4GA 3EW9A 2F0OA 3K7AB 2L11A 4EENA 2YMQA 3TFRA 1NBWA 1JT8A 1N63A 3WK7A 1SYFA 2I5MX 2RDJA 4DOBA 3PF5A 3TI0A 3S2DB 5D4BA 1DM0B 3KKAC 3GD7A 2QLTA 2MUTA 3NS1A 2NVYH 3NWTA 4IUPA 3PR4A 1ZQIA 3W3AA 4DR5Q 1QWYA 1VS0A 1IYVA 5ALHA 3RFAA 3ICXA 2BDPA 3T16A 2ZXOA 2AWNA 3RB0A 3BDOA 2G08A 4BY7H 1HXYD 3J7AF 4YXMA 4IJLA 1IKMA 2IOFK 3SAFA 1WTQA 2R7FA 3KLSX 1EL0A 2V4RA 4C3JB 2RQ5A 4R4CA 1Q81C 5IIKA 3T13A 4US8A 5IGGA 4PHPA 2NVXB 1RDFA 1J9OA 3EUB2 3NRWA 2DJGC 1GO3F 4Z6DA 1UHUA 5DEHA 1I6HH 3H8MA 2Q8RE 5C3EG 3H0RB 4U6PA 1L3TA 2A6ED 2PI4A 4ECRA 3RRGA 1HR0L 5EPJA 1PH7A 1AROP 2HDOA 1S76D 1STYA 5IYBH 4R1JA 3S1QH 2KVSA 3JAMi 2WIIB 5KT7A 4IRDA 1MIUA 2B2YC 4DCCA 1O7IA 3QU2A 1K1SA 4GFJA 3MFHA 1V85A 3SENA 5CBAE 2HHUA 4OJOA 1LKYA 5C3EH 5HURA 1PFNA 1A76A 1GUGA 5E4WC 2ZIWB 1NY4A 7ICRA 4RCOA 4HAEA 4FZLA 4JI8L 4P0PB 1WTWA 4FXDA 4CCHA 3NXWA 2L12A 3RZOH 1NK9A 5KFQA 5M3FB 1I50H 2EAMA 1E0BA 4ECUA 5KG7A 2F0QA 3T1HQ 2PYKA 4QWDA 3GP7A 1XU4A 3PO2H 4P0QA 1NUCA 2XY5A 1Y8OB 5AJ3Q 1XYIA 1EXNA 4N9TA 2HHHL 1M90C 3TKAA 2E8PA 1F5SA 1XNRQ 2NO5A 3NENA 4DV2L 1BGXT 2B29A 3W2DA 4H7BA 3U9SA 3PV8A 1VF5C 4DFMA 4DF7A 1L2FA 4KKTA 4KY5A 5L1KA 5E3FA 4DUYQ 1S0VA 3QB3A 1RIPA 4F91B 3C23A 4ZH4A 2W9CA 1ZQQA 4PMCA 4KLGA 2RSNA 2OWOA 4CDEC 1H9RA 2E5LL 4RQ0A 2M00A 3FHWA 2F03A 4IJHA 1FFVA 1NK4A 4LF6Q 3S16B 2JP1A 1WCMG 3GQCA 3JAMc 2R93B 1Y8PB 4DLEA 1QCKA 2WKDA 1XMQQ 4FXGC 4YWLA 3K6OA 2NRWA 5LMUL 4ECZA 1NR4A 2NBFA 3TAPA 1H9JA 1VQ8A 4A93G 1HFNA 1QCBD 3HOZB 3CCJA 9ICEA 1HA6A 2MA1A 2HHWA 1RD9D 1SMXA 1YITA 1LM0A 1SJHD 9ICSA 1X56A 1WWVA 4ZKBB 4NL9A 1WCMH 4QZBA 1EWIA 3LNNA 4GNXB 3F8TA 2ASJA 3S15H 3OIQA 3CRLC 4KLSA 3RN2A 4R4OA 5DLGA 2QB0A 3PSIA 1ZQMA 2HW3A 3Q0AA 4A93H 4ECQA 1IIPA 2DUDA 4IZ8A 2MAXA 1DXMA 4G7HC 3C2MA 3QZ8A 3UI2A 4JUZA 2EJFC 3MXUA 3RZDH 3CP0A 3A74A 3NTKA 3PCOB 1PHJA 1GUWA 4GIBA 5TSSA 5I2XA 3A0BU 4M6WA 4FF3A 1CM9A 1I5FA 3T1YL 1ZQSA 1WCNA 1DOLA 4DOAA 8ICFA 4DR2Q 4LNQA 1NJYA 1X3GA 4HJ9A 3HKZC 2A1JA 1EIFA 5KRUA 5BR8L 2PFPA 4PG3A 2B2WC 3G6VA 2K50A 3GIKA 4PMBA 2B2VC 4QZFA 1C4QA 3KHRA 2R7ZG 2WP8J 3MFIA 4QY7A 2MQHA 2UXCL 1B70B 5KFLA 1SMYD 4RAUC 3CXCA 2NO4A 1PH4A 4JI7Q 1HZBA 1WTPA 4DL6A 9ICAA 2EJGC 1JJ2A 1EIGA 1QH9A 1L7OA 5KFVA 1GD7A 5KEEA 3BS7A 3QEAZ 3EJIA 3IKJA 3NTIA 5JAVA 1EFWA 5JJKA 5LMNW 2QILA 3NE5B 1QTMA 1V1PA 1L7MA 3MC0B 4C3IG 5C44B 2DN8A 2K6AA 2F0IA 2R7ZH 2KG5A 3OSOA 1YZ7A 4RHSA 4ZOHC 3D6CA 2UXDL 4CGZA 3VR4A 2B8FA 4M47A 4GS3A 3K0XA 3I73A 4LZGA 5GROA 2KVCA 3GTJB 4RUAA 1BPEA 3M85A 2XSCA 4DK3C 4O3PA 1CKNA 1IM4A 4OONA 3PX0A 1A63A 1N36Q 4C3IH 2JA9A 4MN3A 5FP0A 2RRDA 8ICPA 2FMQA 1S0OA 4ECWA 1KW4A 4Q43A 4FYDA 3G6JB 1KTKA 5TISU 1JROA 1TU2B 4QZGA 3BVGA 4JI1L 4UB3A 3PF4A 1JWSD 3D2SA 3M8SA 1EYGA 2YTYA 2EAPA 4JV0A 2ESEA 3H3VI 4IQUA 4E6IA 1JQYD 4M9JA 2L9HA 5I4DA 3G4SA 3TS2A 2GN5A 5J8YA 3HPOA 2FLNA 1YEZA 1L1OA 2J4XA 4MNOA 4NXZA 4X64L 5AI5A 3C1ZA 3DMUA 8ICZA 1BDOA 4LF4Q 4PGXA 4YG2A 4KMUC 5DB8A 5AKLA 2WTFA 2B63B 1T5EA 5ALFA 2JE6I 3DHQA 3K7AH 3PV0A 5DNFA 4TQSA 2NN6I 4PL1A 4CNQA 1L7NA 4R63A 2MP1A 1NI3A 2OQ0A 4CRXA 1ZXIA 2IOFA 5ALLA 3S2DH 1D8BA 4R8UA 2KFZA 1SL0A 2Y1IA 3BS1A 4IQTA 4IS7A 1MA7A 3RB6A 3GDXA 4A4IA 4F4WA 1HNWQ 2I5LX 1GXDC 1NJIC 1B8AA 3ER0A 4A3CG 2HMXA 4Y52H 3STBD 1SXDA 2ZUDA 1E1TA 1T9HA 1PH5A 4F50A 1ED1A 5EE0A 5DG9A 3RR8A 2NVQH 3KHGA 3UPQA 2W04A 5DBCA 1RPLA 4QZ8A 3QO2A 2BDUA 4IFDJ 2BR0A 4NXNQ 3AL0B 4DWIA 4NLBA 3RUZA 3BYTB 3L0OA 2VQEL 3TAQA 2AKWB 4A3JG 4XYQA 4QIWF 4IFDI 2YTUA 3FKIB 1OXUA 4B3TQ 1Z4OA 3RB3A 1C7YA 2KKPA 2HHXA 5AM3A 3H91A 5GTIU 1JX4A 2PCFB 1Z47A 3KUPA 4PV1C 1EFID 1S4ZA 1OXJA 1MHWC 5C4JB 5EGTA 1K8GA 1C0AA 1SWVA 5ELOA 1J2NA 2W3RA 5E79U 4AYBG 4A3JH 3E9IA 2CXYA 2UXBL 4DK0A 5ISRA 4HMJA 1AE3A 8ICIA 2WF8A 1ILQA 2A68C 1FD7D 1A6SA 3M6ZA 1TK8A 5EPKA 3WWVA 1AP0A 1NZBA 3H0MB 2F0SA 3CYMA 1ZQHA 4V0BA 3ND9A 5IODA 1YJ9A 1ET6A 2FPMA 3M3YB 1NK7A 1JXLA 1G8ZD 2IL8A 4DS5A 1EWHA 1Y88A 1U4LA 4KHPQ 3H8WA 1SKRA 1KDBA 3WOFA 2A6HC 4FZNA 1VQCA 1X42A 2I46A 1U49A 4CDGA 4JVZA 3QR8A 4AH6A 4Y7NH 1L8OA 3MHBA 1AZPA 1CA5A 4A3DB 3U50C 3PGZA 2H3FA 1KLNA 2R93G 2F77X 4A8EA 1ZJNA 2F0EA 2QKIC 2XRQD 5FO7B 2ASBA 3MDAA 4WFN3 4ACOA 4F93B 1SYGA 1CKMA 1EEID 4JI3L 5AI9A 5ALGA 4FS2A 1MD2D 1YHBA 4DKAC 3CCEA 2ZJPA 2I1QA 1YHAA 2FPLA 4LF5Q 1KL9A 2B21A 4B3ML 4LUZA 4JYAQ 1TR5A 2EQSA 4CGYB 3KFUF 2PI2E 1VCIA 3A8KE 1HNXQ 2P6RA 1COOA 4DFKA 2NWGA 1XO0A 5KFBA 3BQ7A 1K3BC 4POFA 2RCFA 2R93H 3D3RA 4YVZA 4Z6CA 4FXKC 3K58A 2BA1A 2JSOA 1EIHA 1N48A 4DQIA 2PKEA 2UU9L 3SYZA 5T14A 2KSOB 2Q0ZX 4R65A 1KFDA 2G5IB 4KX5A 2BQRA 2Z4IA 1B4FA 3QU4A 1DK3A 3JPRA 2JA6B 2Y0SG 1I4RA 4JBWA 1Z6HA 1J97A 4C8MA 2CRXA 4DV1Q 2EDGA 1ZQOA 4CF4A 2P35A 1B1ZA 3HOUG 1ESRA 8ICMA 4Z6FA 3HS0C 5KGUA 3H40A 3C2LA 2G9HD 2NV3A 4S3SA 3HP6A 2F2AB 5KFHA 3SZ2A 4GOPA 3NTUA 2CH4A 2VW9A 1N56A 1KRTA 1B9MA 5B5EU 2V9WA 4CDCC 1NAPA 4DSEA 4DNIA 4GKKQ 3TSSA 1ICWA 2QARA 1N33Q 1TWAB 3I2ZA 3H94A 3DEOA 4X65Q 1TV9A 4DUZL 4DAYB 2NRVA 1PRTD 2WAQC 1ZKOA 3CU7A 1WCLA 1HZAA 4IPGA 3KJOA 4OWXB 1AZQA 4A3BB 4X62L 2CKZB 5KT3A 1A2UA 1GUSA 5ALDA 3RJIA 4JV2A 2EYHA 2RVLA 2SNMA 3T51B 5JPMC 2BE5C 5AKXA 1PVRA 4C8LA 2AQ1B 2C2DA 2PMZC 4TUQA 5C0YA 3FDTA 2UVRA 4ABNA 3MFYA 1YNND 5C4ZA 3MXGA 2XC9A 4LFCQ 1TK5A 4C1NI 4IPDA 1PK1A 3GFKB 5JU5A 3J81j 1U4MA 3DM3A 3WKAA 2LFNA 2M9NA 3QX7A 1O7YA 2JYOA 3BS5A 3L9AX 4OO1I 2XCPA 1S0MA 2KJ8A 2ZJRA 1OW5A 4B6JA 2EY1A 2I0QA 5C4HA 4DR6L 4N8X1 2FFKB 1RZTA 4YP3A 1HZCA 4M9HA 1YZ6A 3OMCA 3S1RH 2JEBI 3D2NA 5EE3A 3GTLB 1L8LA 1MI2A 2J7ZA 3BQTA 1IXRA 7ICEA 3NHHA 1SZHA 4BWMA 3S2HH 3UDXA 5C44H 1ZQ1C 1TVAA 1J5EL 2OF1A 2LPEA 1F77A 2XIWA 3TDQA 1A15A 3KYHC 2AGPA 1S5CD 4XT3B 3GTKB 5EBDA 3GTJH 4B3RQ 4HN7A 1Y1VG 1MC8A 4LF8Q 1IBKL 3G48A 4O5EA 2Z9HA 1NSNS 4UP7A 2M0NA 3M8RA 1FR3A 2K14A 3F2BA 2Y9UA 5IWAQ 1SE4A 2R6GA 2KCTA 4DL4A 7ICJA 4KHZA 4K0KQ 3V6JA 1IL8A 1RHPA 1HUZA 1I4QA 1IBMQ 4I2AA 1IBLL 4NLZA 1UAPA 2KNJA 2B63G 4IPCA 3QOJA 1Y1VH 3C46A 2AQ4A 5C0XI 3N7PD 3MBYA 4MEXA 4LWCA 1TE2A 2ZIWA 3ULLA 4KLHA 2LHTA 4P2HA 3OW2A 3UM9A 2XCAA 1MQ2A 1WTOA 4B3SL 4IUNA 5AK6A 5DG8A 3CQZH 4RNMA 3BZDB 4F4ZA 2WB1C 5IIJA 2JK8A 4JI4Q 4O5KA 2B63H 2I9GA 2ATLA 3RRHA 1FIQA 1O7LA 4QL5A 3F53A 4C8NA 1X6IA 3OHAA 4QW9A 2ISPA 2DBYA 3ZDAA 1XXGA 2E76C 1NKBA 1YNJD 3RR7A 4O1NA 4MHEA 4I7ZC 3J80i 4DQPA 2UUAL 4BBSG 5AM4A 1ZYRD 4KTQA 3UXOA 3FKIG 1F44A 4KN4A 2H4OA 2LMRA 3KTQA 4XDXA 3DUZA 4ZQ3A 8ICGA 1KHIA 4DAMA 3UDIA 1D1KA 4FO6A 5CV6A 4FF1A 4F5PA 3MR6A 3IG8A 2ASLA 3H15A 4I2CA 1TWCB 4M0AA 2RDIA 1GO3E 2HI0A 3F2CA 1BOSA 1PTOD 4FBTA 1SDFA 2H5XA 3PIO3 3WK8A 4UAWA 4BBSH 3GIMA 3FKIH 1CA6A 1D5XC 5LMNL 4NL9C 1C9OA 3SQIA 4DSJA 3I72A 1AQ6A 1QE6A 5AFWA 2VANA 3R2TA 3X3MA 2JEAI 1D5ZC 1P16A 4JK1A 2ID0A 1GOZA 2MU2A 2NZ1D 4BS9A 5M5YB 2FJ2A 2R8GA 1OUQA 5IE8A 2F0VA 2LMCB 1B2TA 5AKIA 5KFTA 5J2FA 4XYOA 4X66Q 3NBHB 1HEKA 2NYZD 8ICHA 4GNXA 2CPRA 3BJUA 4O3RA 2C35B 2NZOA 3OSNA 3O13A 2A74C 1TAUA 3C28A 1B3QA 1D6EC 1SYEA 4K4GA 4IALA 4R66A 2F0LA 2EIFA 9ICTA 5M9OA 3D4DA 1A62A 1MSWD 3TRZA 4Y2QA 5CWRA 3QOLA 4P72A 4A3KG 1T94A 3G6XA 1STNA 2UUBL 1XNQL 2CCZA 5KG0A 3L5KA 3NELA 1AFPA 4DFDA 1N8RC 2B2TA 1I3QB 2VB2X 4KMOB 3SXHA 2QKQA 2ZTEA 4FFDA 1X6JA 1IG6A 1TWHH 4UBBA 2E2IH 5JRTA 3PR5B 5CV4A 3NVYA 1VF7A 5AIBA 3GTQB 5ALPA 3RJFA 2YB1A 1F2LA 1EZ8A 4Y7NB 3CCUA 1W2BA 5J2IA 5KG6A 1TK0A 3FRPB 1PDQA 3J7YW 2P66A 5KNIA 4A3KH 5CRXA 1XO1A 1VQNA 4DQQA 4F2RA 4HCEA 4DAPA 3FM9A 3QU7A 4BXOB 2QEXA 4P75A 2JA6G 3AU7A 3GU3A 2JEFA 4HSVA 3SV3A 1ILPA 3ZDEA 1EYDA 4ZAIA 3FMCA 2G07A 3FVQA 4CDDC 4H13C 2FPKA 2O5IC 5KL8B 4EZ9A 4ZUIA 4TQRA 5E7NA 3UE0A 3UQ2A 4ED1A 2UUCQ 3NSWA 1EU3A 2GWSA 3PO4A 3VR2A 5IGBA 5A2QL 1OTCA 2IPKD 1B44D 1WD1A 3RJGA 2JA6H 2BCUA 5ALEA 4EX5A 1X2IA 4YR2A 2V1CC 1Q7YC 5J0WA 4LJZC 4ALPA 3FC4A 4DA2A 2KCCA 4LUOA 1A0IA 2HSZA 4EX7A 2ICIA 3D6JA 3TADA 3RLOA 1SE3A 4G7OC 2KKVA 1HR0Q 1GKHA 1I4GA 3PVXA 3TARA 4BBRB 2P6UA 3SDZA 3TREA 5J8YC 1OXXK 1PZNA 1TWAH 1G2TA 3C21A 5JVG3 4IO9A 1L1OC 5J0TA 1HQMC 2JZBB 3RMHA 1JIHA 1HNZL 1A3TA 3SR1A 1TKWB 5GAEC 2A3VA 4I2EA 4QQBX 4HJ5A 2EYOA 1XTCD 4DR7L 3LYSA 3O0FA 4EYHB 4KV6A 2F0GA 3V6HA 1MSHA 1SR3A 4Q8EA 3KFUA 5KT4A 4NXMQ 4CJ1B 1AN8A 1JC7A 2EANA 1CZGA 3NPPA 5CV8A 4JI8Q 2HT1A 4RQ1A 4EQOA 9ICMA 1JR0D 2KVMA 2K05A 3BYYB 4K8IA 4DPGA 1VQOA 3SK6A 4P4MA 3OWEB 3HOYB 1QUQB 3DM1A 3KF8B 5ELCA 1ML0D 3V7JA 2EZVA 1S97A 1U45A 2CHBD 3MGHA 4O5CA 5DQHA 4PQXA 4JWNA 4HJ8A 1LO5D 2JA5B 3VR5A 1X3QA 2CW0C 2VB3X 5AKYA 2D0OA 3STBC 4CKBA 2KD1A 2A19A 3HKZE 4Y2JA 2A69D 1W3SA 2C9OA 1NJZA 2K5HA 2RSOA 4DL7A 2EPBA 5J0RA 4DV2Q 3PW2A 4G57A 4OJLA 3PSPA 1YBYA 1VQPA 4WJWA 2YTVA 4C1NK 8ICJA 4RPXA 1PZKD 3KD3A 4GC6A 1I6VC 3VYTA 1O08A 3AYHB 3HGBA 5I6WA 4EEYA 1A2TA 5IILA 3DLLA 5FJ8G 4FBUA 5J22A 1FFUA 3HOZG 1SXEA 1K8OA 4DAVA 5KFNA 1FNUA 4QZEA 4F92B 3HJEA 3VCBA 1I4XA 1PYSB 2KBNA 1SKWA 4LF8L 3WDNA 4RPYA 3I4MG 3I28A 4CJ0B 1PZID 3ZDBA 3M7DA 1ZQGA 2IMWP 4UP8A 5FJ8H 3KZIU 4UB5A 3GO5A 3H8SA 3A7AB 4HEDA 2PQAB 2JN4A 2YU9H 1MN8A 3HOZH 4A3LG 1OXVA 2FMCA 1QNKA 4KD4A 4ID6A 5DGBA 7ICKA 4OWTB 1STAA 4DR4Q 2KUMA 3J81L 5IYBG 4DV3L 5KFZA 4RKLA 5D3DA 1VQ4A 3UXPA 2K4PA 4G7ZC 5FO8B 3QG1A 2ZIXB 1ZQYA 2CWPA 8ICCA 4WJ3B 1PTOH 4KTAA 3P20A 3K5OA 2Y1JA 3I4MH 4CF5A 1KDAA 1PFSA 1PH2A 3SAGA 2R3ZA 3QWNA 3IP4B 4J9MA 1TWFB 5ALVA 1VQ5A 4YCXA 4NP5A 5IT9E 2PNHA 1CTMA 2HUGA 4RQ6A 1DGSA 3NUQA 4BY1B 1UUPA 1SE8A 4O2DA 4A3LH 4K6LA 5KNCA 1VJ5A 3NVWA 1LUZA 4MFCA 1UE1A 1RG6A 3WK5A 5AIAA 4NPSA 1EOVA 3AFPA 4R4TA 4FE3A 4TSSA 2LM1A 4DFJA 3T1YQ 2NTTA 1U9RA 4DU9A 4F5QA 3DXJC 2XO7A 1SYCA 2KHIA 1EOTA 2VA8A 2IX1A 3DWQA 3PO2G 3VYRA 1Q46A 2R92B 1NMGA 4I2FA 3P7JA 4J9RA 2PZUA 3HKZB 4JW0A 2XTIA 4C3HG 5L1IA 4B9MA 1RTNA 2ZXIA 1QB5D 1NKCA 2WF5A 2BQ3A 1M1KC 1ZQNA 2K4IA 4UAIA 1RYUA 3GV5B 3QEBZ 1BXTA 2MUYA 5ALSA 1K8AC 3KLWA 1WTXA 3OSPA 4QIWE 3AMZA 4YHHQ 4J9QA 3WKEA 4ZYSA 1N34Q 1KLGD 1ZQTA 2WKCA 2MFIA 2H3QA 4RQ4A 5L1MA 2OH2A 3S1MB 1ZQUA 4C3HH 4GOPC 2HCFA 2BPCA 3RAQA 3E3XA 1MQ3A 4C80A 4DR3Q 2B39A 4KY6A 3FP9A 1VLBA 1QVGA 2UXDQ 4RA8A 4C7YA 3RTVA 1UE5A 3RF9A 4NDXA 1RM6C 2VZAA 5HP4A 2JRZA 5JJZA 2XVTA 2VA2A 4JOIA 4NV0A 4YWKA 2CN1A 5AK5A 1Y8NB 1D2BA 1T3NA 2PI5A 1VQGA 3V7LA 1G6ZA 1ZQRA 3LWMA 2P5ZX 4RT2A 5IGFA 3LGJA 4LF7Q 2BKEA 5ELFA 5AM0A 4AIMA 4JB3A 2YYZA 4IRCA 3T3FA 2ZM6L 4DAYA 4JI1Q 1KLUD 1Q82C 2A6EC 5D65A 1SROA 4F5OA 4KK7A 1KRPA 1KFSA 4M8AA 5J0XA 3K5LA 4AQYL 8ICKA 1YVCA 1Z3EB 5IT9L 2I6XA 5EWGA 1ZQBA 1QQ5A 4F87A 1ZD3A 4EBDA 3T4AC 4L8JA 2VXWA 3SGIA 1TKDA 3T5HA 3V7KA 1STBA 5J39A 3QUQA 3IRUA 2K32A 3VYUA 4EZ6A 1TS4A 5J2EA 5HGQA 4X3SA 4RKBA 2IT1A 2PW5A 5AKEA 1SE2A 4DV5Q 1KIXA 4FO2A 1ZQCA 4L5SA 4DV0Q 4EQPA 4DR5L 1L0XB 1ONLA 3OTOQ 4F5RA 4UB2A 3C2KA 4KJNA 3K1RB 4KLJA 2KOLA 4RNOA 2J6TA 5DQIA 4TKOB 3AQEA 2KHVA 4PPXA 4X3UA 4LFAL 1S5ED 4R8NA 1SNCA 2PI2A 2XWBB 5C3XA 2F8KA 2MSNA 2IX0A 2Z6KA 4BBRG 5M5XB 3RJEA 5KAFU 4KLIA 4QWBA 3CCQA 3UE1A 1TS2A 1CEZA 4QIWB 2EY2A 1X32A 2ZJQA 4RG1A 4YWMA 5EBCA 3PW4A 5KFYA 1QSLA 3ONAB 3THVA 2OYYA 4UATA 5EE1A 4JBMA 1CUKA 3HKZF 3HWTA 4N8FA 4OXPA 4KKUA 4NWIA 4ELUA 4BBRH 2UVUA 4JV1A 3HG9A 1Y69U 1EZ6A 3PUXA 2H3VA 3T5LA 3P1HA 4UDUC 3HOYG 3PO3G 2Q8IB 1HA5A 4ODGA 4PZ6A 5ALQA 3PMNA 2HVHA 1FEZA 5DB6A 2ENBA 2DF4B 1DONA 2R8JA 9ICJA 2JXJA 2KN7A 2GA4B 1GM5A 3F1ZA 4ED2A 4AYBC 2VJ4A 1Q12A 3ZD9A 1H9SB 3URYA 5JUMA 2DPJA 5KYIA 4GLXA 1CHPD 4HAIA 4A3MB 2W54A 2BDNA 5AICA 2YY6A 2NB0A 2ODGA 4DV6L 3T1HL 3GTOB 2WFWA 4QGUA 3HOYH 3PO3H 3WKDA 3AB9A 5CV5A 3NWSA 5AJ3L 3KHLA 3A7LA 4X3KA 4M04A 2CFMA 1CHQD 1XNRL 1I94Q 2KZZA 4LUVA 5J0YA 3I7FA 2FINB 1UEAB 3ISBA 2PMZE 2WHEA 2LI6A 2DKXA 2ZXRA 2ZTCA 1NTGA 5DDMA 1SWWA 2D62A 4OX9Q 3J7A5 3GTMH 1JWMD 1JALA 5J2BA 1IL2A 1Q3LA 1ZQPA 5FO9B 1XSLA 3OWFA 4YIJA 5K36G 3D4RA 4JV5L 5EE9A 3PUYA 2N49A 1Z1BA 1L3UA 2C5CA 2XWJB 1SXTA 3ISCA 3RAXA 4B9WA 4IUTA 4B9LA 1H9KA 4C3JG 4JK1C 4O42A 1XMQL 4DQRA 2M9VA 4B9TA 1URJA 5KTQA 4NLGA 1TIID 1S77D 1SMYC 2EAOA 2AMCB 3BVZA 3KF6B 3PMLA 4KLOA 2OTJA 3CD6A 2KA7A 5IYDG 1ASYA 5K36H 2H3ZA 2VUMB 1K0RA 2KQ3A 2YB4A 1PVQA 2DWQA 4DSIA 2NZHA 3JC66 3PQIA 4J6HA 4U68A 3J80E 2SOBA 5ELBA 3Q8SB 3GTPB 3NBHA 1SJED 2Y0SC 2PFQA 2AH5A 4C3JH 2HHTA 5J2CA 3PO5A 9ICFA 1RJTA 1BKBA 1TS3A 2CQAA 4P74A 5ELDA 1L3SA 4EQNA 3Q8LA 2RBMA 1VQKA 8ICYA 2AXTU 2AWOA 2NVXH 2DNCA 1GVPA 1DYQA 5I2YA 4I28A 1O80A 1B9NA 4IR1A 4C4TA 5IYDH 3B9JA 2F0HA 2O6KA 1O03A 4I2DA 4IPHA 1PUZA 4DXGA 1QVFA 1TWFH 4EBEA 4ECSA 1ENAA 1Z00A 2OCEA 3MDCA 3C2PA 5ALOA 4CBVA 2JMGA 2NUCA 3BDLA 2JEGA 1SV4A 4DR2L 2IY5B 1U9LA 2HOFA 2ZIUB 3FEWX 3M4OB 1B22A 3I4LA 1UQVA 3WKBA 1LT3D 4X62Q 5JEAJ 2VL6A 3SI8A 1DOKA 4I65A 5IIIA 5C5MA 2ZIVA 5M3FG 3OJSA 3IAYA 4JG2A 5KFGA 1JB3A 9ICXA 4DO9A 4HYKA 2JEIA 1D5MC 5EWEA 4MF8A 5AM5A 2WB1E 5GAHC 4JI7L 3SR6A 4JI5Q 4BXOA 4NB3A 1FNWA 2PMZB 3PSTA 1RF2D 3KBGA 4AQYQ 1B7YB 2JR5A 4LAAA 1NR2A 1PMRA 5DB7A 4PHAA 1DK2A 2MUTB 4PZOA 1TWGB 5M3FH 5HNKA 2F3VA 2WF6A 3K57A 2PZTA 3TS0A 5CV9A 2E8MA 2BCRA 2HDMA 9ICKA 3GDEA 1DOQA 2EXZA 4YMNA 1FO4A 4E0DA 2XN9C 2FMMA 5AKJA 4C4SA 5ALKA 4DL2A 1RXWA 1EWCA 2G09A 2N78A 3TADC 2WINB 3S1MH 4MIUA 3M4PA 3K5MA 4A3GB 1ZQEA 9ICPA 1KQSA 1U4BA 4B9VA 8ICXA 5KT2A 1LB2B 1HZ9A 2XVSA 4MTNA 4X5VA 2PW7A 2CH4W 3E0JA 4RT3A 5H2FU 3I76A 4IUUA 4EBCA 1C48A 3H7IA 3H8JA 5KFDA 1ENCA 1EQTA 3HOVB 3J80L 4KLTA 2LKVA 5DM73 1D8YA 3I1YA 1Z9FA 3M6KA 3S16H 2QCPX 2JA7B 1SFOB 1XTDA 5CORA 4DK6C 2XY7A 2F0DA 4P4OA 3A5ZB 4JCVE 4IQZA 4FS1A 4MFFA 3UMCA 3MR5A 4I2HA 1KNEA 1K0SA 1F9PA 4NLCA 4OELB 1LKYB 1WYGA 3ETLA 4NLNA 5AKZA 2KCMA 2GH1A 5ALXA 3C5GA 1CK1A 3HRDD 3I56A 3HOXB 1SNOA 1L6NA 5IYCG 1AH9A 2FMPA 8ICUA 3CRXA 2OXPA 3AEVA 2XGTA 5B66U 2R8HA 1B43A 1NCVA 2F4VL 3M7NA 1B4OA 1L0WA 5KT6A 4P0QB 2K28A 3U58A 1HNWL 1T3QA 2Y9TA 4NM2A 1NK8A 5FOBB 2WB1B 5IYCH 2BCSA 2MO1A 5E4XA 1SZPA 2KOBA 1LLRD 3T5JA 4O3SA 1X3PA 3MR3A 2HIXA 2K5NA 3K5NA 3J7AV 1JOOA 5CEHA 5J2KA 2LY7A 2UUAQ 3G7LA 2BH2A 2RHFA 3S6JA 4DLGA 2W9CB 4H0LC 4YY3Q 1NJXA 3KHHA 4Q8FA 4NXNL 2L5TA 5GAGC 5M5XH 1UA1A 1PH3A 3LWLA 4DEZA 4OO1J 5IIFA 3AU2A 4U7CA 2WAQF 7ICOA 3E5SA 5C44G 4K2KA 4XQ8A 3NP8A 5IY0A 3HOWB 1LTSD 1QVCA 3PX6A 1HR0W 3BU2A 5J2HA 4QZ9A 1JMCA 4DR1L 2ATWA 1F9QA 1TS5A 5IP7G 2KP7A 3ETRA 2XI9A 4US9A 2ICEC 5KFPA 1VQMA 2R8IA 2PMZF 1EYCA 4Y2TA 5KG5A 3I4NB 3JPSA 3L2PA 4EELA 1V8QA 4Y2YA 1SGGA 3OHBA 5L1LA 1KNAA 1WOCA 3H6MA 3Q24A 4O9MA 3QUBA 4F4YA 2PQAA 2ZT9C 1DOMA 1B0XA 4PGYA 1F2ZA 5K5PA 1UWVA 5DLQE 1WVLA 4C2MB 1Y1WB 1WD0A 4MHVA 4JC0A 3S14B 1EY0A 3Q8QB 1WFQA 2ZIXA 4CF3A 4KY7A 3IL8A 2F0TA 5IP7H 2G9DA 4MEYA 2D2CC 2LSSA 3GV6A 2QB0B 4GXJA 1Z4NA 2VA3A 4KLUA 3D2QA 1SNMA 4YMOA 3S17B 5KFXA 5AI6A 5AM1A 1QNUA 1N32L 2G06A 2W9BB 4RQNA 2R18A 3GTOH 4GKJQ 3RH6A 2L4NA 3WK6A 1WTHA 4M6WB 5KFRA 2K5WA 7ICVA 4OWWB 3FPUB 5C0XJ 1XNQQ 2DGYA 3MTSA 5T1GA 4FZMA 2IHEA 4A3FB 1SNQA 2D9UA 1PRTC 3B0YA 2BGWA 4U673 1XMOQ 4A3DG 2DJFC 4Q0FA 1FGUA 1LTBD 1DGJA 5ALTA 3AUOA 1STEA 5A35A 4LF5L 4JYAL 4P0PA 4K2LA 4BY7B 1GUNA 3H0GB 3TBIB 2IOHA 1LABA 2B2WA 2L55A 3MEFA 2VUMG 1SV0A 1HNXL 3QE9Y 1YNNC 1R4QB 3TP8A 8ICLA 3D0FA 4OL7A 2ZJ5A 2YMPA 1SNPA 2F8LA 2O5JC 3EQLC 4A3DH 1NOMA 3QYPA 2KJXA 5J2GA 1ZJMA 4JI2Q 3EWAA 1V1PB 3JAME 1JXEA 4P2CB 3KDFB 2IHNA 4K5VA 4PZ8A 1LT4D 4DOCA 4QNLA 1KKXA 2EQYA 4JOIC 2VUMH 3JPPA 1XS9D 4KKSA 3H09A 4J1MA 2JV3A 2WB1F 2FXQA 3OYYA 2F44A 1I6HB 1XC9A 4JI6L 5C5JA 1ZRNA 1HUMA 1V38A 1CKNB 5D14A 2Q2TA 1JI7A 1CT1D 4HJAA 4GKKL 1TVXA 1VQEA 3PUVA 1N33L 1SL2A 5J0UA 7ICUA 3H4BA 1ENFA 1VMPA 1BR9A 2EYJA 1KC8C 3ICEA 4X65L 3DV9A 1R4PB 4F4KA 1R9TB 2GVBA 1E2WA 3PUWA 3A54A 1LV5A 2LXJA 4DFPA 3KOOA 7ICFA 3PIP3 4DV7Q 3ITPA 3ND8A 4ME3A 1EY5A 1K83B 3PUZA 4XQQA 3RJHA 1HNZQ 2PXIA 4Q44A 3E9HA 4ILWA 1X9SA 2K4EA 2OEHA 1X3FA 4F72A 5AM2A 7ICHA 1EQVA 3NUCA 4K6DA 4TUPA 3SE0A 4RHRA 5C4JH 4X6AH 4DR7Q 4LFCL 2JQOA 1L1OB 2K4KA 1QOHA 8ICTA 2MHVA 3ISDA 4TURA 5CBEE 2DPIA 2B3GA 4M1UB 8ICOA 4ZKCB 3KBBA 3K1ZA 4O3MA 1HFGA 4RGOS 3V72A 5EAYA 1QLNA 3MGVA 1Q3UA 1H95A 3H3VH 1X65A 4EX6A 3QU9A 1BBUA 4ZRZA 5GADC 3GQBA 4JBJA 4A3IB 2AQ0A 3F2DA 5CP2A 1I4HA 1E2ZA 4R8UB 1SL1A 2NN6G 3LWEA 4R4QA 3M3YH 1V97A 2E75C 8ICSA 5C3WA 1FJGQ 1BPXA 5COYA 1JE5A 4Z9CB 4UAUA 3OGUA 5KIXA 1RTOA 2Z6KC 3CP8A 3KOJA 5ELEA 4R64A 1TQOA 2ZJAA 2LS01 3PSFA 4HJ7A 1BF4A 2VQFQ 1TFRA 3CCLA 2ZUBA 3WOEA 4LF9L 4DSFA 1JWUD 1VQ9A 1EY7A 5L9XA 4IQWA 2KEDA 3EVQA 5ALWA 4PZNA 3TQ1A 1O7ZA 2H1EA 2OQKA 3VDYA 3SK8A 1SBBB 1YNJC 4TQUS 3T56B 2E8OA 2NN6H 4LK1C 2F0WA 2W7PA 4M2YA 9ICWA 1ZYRC 4YMMA 3K4GA 3JAML 3CPWA 2E8GA 4O3OA 7ICSA 2IWHA 1IYJB 3KK7A 5IWAL 3KBXA 4PH5A 4Y2XA 5G5HA 2PZWA 4C56C 1V1OA 5H1SE 4BUGA 4ECTA 4K0KL 4IFDG 4B08A 1PFMA 4M9GA 2IBKA 4GXKA 1BPDA 2VIXA 4P4PA 1T7PA 1NMFA 2Z6BA 3LDAA 1FYCA 3KLRA 1IW7D 1PTOC 2E2HB 3Q8MA 3OJUA 1VQFA 1JJGA 2FHTA 2ZXPA 3CCSA 3E58A 4O3NA 2E8NA 5KFUA 2E2DC 1F0MA 3HP3A 3CMAA 4B9SA 2G0AA 5JPNC 5EPLA 4DV3Q 1QSYA 3M9BA 3Q8DA 5JEAG 4A93B 4P71A 4IFDH 1RXVA 1NE3A 2ISOA 2WB1G 2AUJD 1Q86C 4JI4L 2BCOA 2CW0D 1QZHA 4A3BG 1BNPA 1CKOA 1ZOLA 3LVWA 5KG3A 2LYAA 2RCNA 2F52A 9ICQA 1HUOA 3A8IE 1S10A 2FE9A 3IV6A 5ALUA 3K8AA 3MWYW 1KTQA 1CSPA 4UW9A 3JPNA 2KE7A 4RNNA 4QJFB 4JI0L 5KFOA 4M9LA 1F2MA 5JEAH 3PIOA 2Q2UA 1UA0A 3C29A 2FMSA 2EYLA 2K7VA 4DXFA 2HBMA 2MRLA 3MXNB 5J0SA 4A3BH 1BCPC 1UCVA 2OM6A 5IIMA 1QZGA 2QGQA 3IDWA 3U4VA 5E1FA 4IN3A 1M8AA 2AQ3B 2RA4A 3R2IA 4H02A 1UNSA 3I4NG 1AE2A 4F5NA 1Q1EA 1SRUA 3BZKA 4Y2UA 4G4KA 4YFKA 1M4VA 5AK4A 4MFAA 1Z7TA 2JA8B 4UARA 3AU6A 3CNHA 3M9OB 1Y1WG 4HSPA 1WYDA 2JJQA 4RQMA 3DWAA 4Y2PA 4RQ2A 3SVMA 3KF6A 3L3OC 4CKEA 2R7ZB 2EYFA 2HBLA 1Z19A 4OEMB 4MF2A 3NRZA 8ICNA 2JEJA 2WFAA 3I4NH 1STHA 1H9MA 2ZXHA 4QW8A 3A0JA 3GTLH 1K28A 1Z1VA 4HTHA 2HHHQ 3CC7A 4X66L 5C4XB 4C4RA 2RP5A 1PK3A 2N3SA 4JMUA 2EH9A 4KN7A 4TVAB 5HY6A 2E2JB 2M2LA 2KIVA 4I2JA 5AKHA 1T8EA 4KLDA 1GUTA 1Y1WH 2K60A 3V6KA 3S14H 4C3IB 5C6AA 2C22A 4QUFA 3NK9A 1ZD5A 2J0TD 2Q2HA 2E5LQ 1XX8A 4O3QA 1D9DA 2F1MA 4ECYA 3C1FA 1BVSA 1LTAD 3R93A 3GTKH 1F9SA 4IQVA 2EY5A 2B2UA 2QARB 2SDFA 2JH7A 1CSQA 4DN4M 3RLFA 2G5HB 3I4OA 4ZK9B 4PZ7A 1VMCA 3KJPA 4BA2I 4ZUJA 3TMEA 3QIAA 4MTKA 2ZM6Q 1OXTA 1BQQT 3H0GG 5G3LF 2ZIUA 4FF4A 1VQAA 2D8CA 2K75A 5LMUQ 4F7XA 3SK5A 2KHSA 2EZYA 4IRKA 2F1HA 4RH6A 3N7SC 1B3AA 3I90A 3U9OA 3L4PA 1PH9A 2LYHA 1J2MA 4LFBL 3MR2A 5J2DA 3FDSA 5F2DA 5CGKA 1JJCB 1BNZA 2ALZA 5ALJA 2BCVA 5ALNA 2I07B 1PK1B 5CR3A 2K5QA 3RJJA 2JGAA 1K73C 2HOIA 2GVAA 4WJ4A 2AJQA 2GOLA 2KECA 3H0GH 7ICMA 1YJNA 3SHLA 3BS5B 2QDBA 4UHVA 4NKLA 4OJ5A 2H3IA 4JPBW 2A5HA 4YD1A 3MGIA 1L0YB 2W9MA 2WF9A 2F1JA 4QUCA 3RNUA 4OO1G 4RPZA 3IRBA 2BPFA 5J1ZA 4A3EB 5DG7A 2UUCL 2EZZA 1WUDA 1KDHA 1HPCA 1MGSA 1X55A 3SV4A 2K52A 1S72A 5ALIA 1U47A 1XPUA 4P73A 4ED8A 3LK9A 4LFAQ 2NVQB 8ICVA 2XGQA 4DV4L 2HCIA 5BOMA 2A69C 5AI0A 1D1IA 1SLJA 5BR8Q 1U4RA 2F0UA 1ZETA 4OO1H 2HBJA 3B0XA 2K1BA 5KFCA 1RQLA 1EEFD 2KICA 2ZG6A 3SK4A 3F5AA 1A3VA 3SD7A 4YCVA 4QWCA 2UXCQ 4YN4A 4O0AA 2W03A 4L6TB 1N5WA 4KLKA 3A5UA 2LYBA 8ICRA 1CFMA 3UDGA 3H4DA 2KEYA 4G3IA 1TWCH 4F8MA 2D3DA 3IN5A 1R9TH 2NVTB 3DEEA 2SEBD 3MEHA 1ZQLA 4OIKA 3F5EA 3D4WA 1HQRD 1QQ6A 3KLSA 4OGQC 4OJPA 1K83H 2F0JA 2KSOA 2Y0SE 4A3JB 2DY7A 1UE7A 2IW3A 4WRDA 4YQWA 4J9PA 1BO0A 1SAPA 3K7UC 4A3IG 2OTLA 5ALRA 4NXML 5KL1B 5EKKA 9ICLA 2D5DA 5JTIA 1CRXA 5HMLA 1COKA 5C0XG 5M5YH 5TZVA 4POGA 2LKYA 4Y2SA 3CHBD 3EIVA 2AHOB 4RZRA 4R4IA 2NRTA 4KX3A 4XA5A 2DL0A 1FGBD 4RGTA 5I6YA 1QJOA 2VNUD 2EYMA 2KEEA 2RHSB 4AYBB 3N7RC 4DV6Q 2DKZA 1HH2P 1S5LU 1ZYQA 1JORA 5FKAC 2KTQA 3CPFA 4A3IH 2BOSA 1RYRA 2RKSA 1X9XA 5C0XH 2F3WA 2ES2A 4K14A 1QG7A 4KLEA 5IGEA 2FJ6A
chains in the Genus database with same CATH topology
4MZ9A 1TWFH 1EIYB 4B3RQ 3L7ZC 1X3EA 3GTJH 1Y1VG 4DV4Q 2OCEA 1JB7A 3AQQA 1IBKL 3G48A 3TEHB 1I3QH 4DR2L 2IY5B 4GLVB 4UP7A 5M3MH 2K14A 3F2BA 5IWAQ 2MNAA 3G6EA 3GTQH 1S3OA 1KAWA 2K5VA 2R6GA 5JEAJ 4BA1I 4X62Q 2KCTA 2VL6A 4K0KQ 4KHZA 2JA7G 3J7ZC 4X64Q 5M3FG 2BA0A 4JV5Q 4JG2A 1K3RA 1IBMQ 3HOWH 4DV7L 2B63G 4IPCA 1YJWA 3RLNA 1Y1VH 5C0XI 2WB1E 4LWCA 5GAHC 2ZTDA 4JI7L 3ULLA 4JI5Q 2HQLA 3D31A 4NB3A 4HIDA 1ASZA 3S1NH 3OW2A 1N9WA 5GQOA 1B7YB 4XIGS 4B3SL 2JA7H 3CQZH 5M3FH 2E2HH 2EXDA 1TXYA 4DR4L 4C2MH 2JK8A 4JI4Q 3TS0A 2B63H 3GDEA 4GOPB 4QL5A 4PMWA 4A3FG 2N78A 3S1MH 1FJGL 3M4PA 3S17H 4APVA 3J80i 2UUAL 1KQSA 2VQFL 5ELNA 2IHFA 5M5WH 4BBSG 2VY3A 3STBC 1HZ9A 4MTNA 3FKIG 2VQEQ 3BZCA 3CCRA 1KHIA 3ZJYC 4DAMA 3UDIA 2QA4A 4AQYQ 4JBKA 4AYBE 4A3FH 1Z9FA 2KHJA 3S16H 4J15A 3H15A 4L5QA 2JA8G 1GO3E 1XTDA 3S24A 4DK6C 3F2CA 4BY7G 1VQHA 3K80C 3A5ZB 4JCVE 2H5XA 4BBSH 1NBWA 3FKIH 1JT8A 2BH8A 5LMNL 1BBWA 1C9OA 2I5MX 2UXBQ 3PF5A 2JA5G 2YTXA 4RMFA 2KCMA 3GD7A 2JEAI 2NVYH 1P16A 3I56A 2UXDQ 2ID0A 5IYCG 5C4XG 4DR5Q 3J81i 1VS0A 1AH9A 1WJJA 2JA8H 5IE8A 2AWNA 2WAQE 4X66Q 4GNXA 1S40A 1FVIA 3NBHB 1VQLA 4BY7H 3AEVA 4IJLA 2XGTA 3BJUA 4YHHL 1N34L 2R7FA 4R4CA 2C35B 2NZOA 1Q81C 3KDFA 2F4VL 3M7NA 1L0WA 2JA5H 1HNWL 3U58A 1XPRA 4DR3L 1VQJA 4DUYL 2EIFA 5IYCH 1A62A 5C4XH 2MO1A 1I6HH 3TRZA 4P72A 4A3KG 5C3EG 2K5NA 2HIXA 3M4QA 2E2JH 2UUBL 1HR0L 1SN8A 1XNQL 1V9PA 5FLXc 1MJEA 3U4ZA 3NELA 1PH7A 2CCZA 2UUAQ 2BH2A 1N8RC 4GN4B 4JI3Q 4LF6L 4YCWA 2ZTEA 4R1JA 1TWHH 4YY3Q 5IYBH 2E2IH 3JAMi 4NXNL 4LF7L 3S1QH 1MIUA 5GAGC 3CCUA 5M5XH 1O7IA 1W2BA 1PH3A 4B3MQ 4GN3B 1OXSC 1G51A 5C44G 5IY0A 1QVCA 1HR0W 1U0LA 3BU2A 4A3KH 5C3EH 1JMCA 1KD1C 1VQNA 4GNXC 4DR1L 2ATWA 5IP7G 1NY4A 1E22A 2QEXA 1VQMA 4P75A 4JI8L 2JA6G 2UU9Q 3L2PA 1WOCA 1IBLQ 4BY1G 2PQAA 3RZOH 3HFZB 4A3EG 1D7QA 1I50H 1A8VA 1UWVA 5DLQE 5E7NA 3UE0A 2A1AA 2YV5A 3J81c 3T1HQ 4JC0A 4DV5L 2UUCQ 2ALYB 3CC2A 3PO2H 1OTCA 1WFQA 4DV0L 5IP7H 5AJ3Q 3OTOL 2HHHL 1M90C 2LSSA 2F4VQ 2JA6H 4EX5A 1XNRQ 2V1CC 1Q7YC 4ALPA 3NENA 4DV2L 2B29A 4BY1H 1N32L 3ERSX 1A0IA 4LUOA 2R92G 1L2FA 4DUYQ 4DUZQ 4A3EH 2CWAA 3GTOH 4GKJQ 1G6PA 1RIPA 3HKZG 3RLOA 4L5RC 1YI2A 1VQDA 4A75A 2OWOA 2E5LL 1IZ6A 1HR0Q 5C0XJ 1UEBA 1GKHA 4OWWB 1XNQQ 2DGYA 3FHWA 2IHEA 4IJHA 3TREA 1EQQA 1TWAH 1OXXK 4LF6Q 1WCMG 4IO9A 1L1OC 1HNZL 1Y14B 3JAMc 1XMOQ 4A3DG 5GAEC 1FGUA 2R92H 4QQBX 4HJ5A 4A3CH 1XMQQ 4LF5L 4YWLA 3CCVA 5LMUL 4DR7L 3K81C 1VQ8A 4A93G 3MEFA 2VUMG 1SR3A 3CCJA 4DR1Q 3KFUA 1HNXL 1YITA 4NXMQ 1SMXA 4DR6Q 1LM0A 3CCMA 1X56A 4JI8Q 3D0FA 2HT1A 2NVTH 1WCMH 1VQOA 4DPGA 1EWIA 4GNXB 1D8LA 3CC4A 4A3DH 1QUQB 5JJLA 3KF8B 4JI2Q 3F8TA 3S15H 3EN2A 1PV4A 3KDFB 4UY8C 4PZ8A 3RN2A 4R4OA 1J5EQ 4HJ8A 4A93H 3PSIA 1E7ZA 1PH8A 2LXKA 2VUMH 4JOIC 2DUDA 2D0OA 3HKZE 2A19A 1W3SA 5IP9G 1N36L 1PVOA 2K5HA 2FXQA 3OYYA 3RZDH 1PHJA 4WJ3M 3CP0A 3A74A 3PCOB 4UPAA 4DV2Q 4JI6L 1YBYA 5FLMG 1VQPA 1IBKQ 1CKNB 2Q2TA 1K9MC 2YTVA 1I5FA 3T1YL 4HJAA 1X6OA 4GKKL 1N32Q 1I94L 1VQIA 1VQEA 1YNXA 3AYHB 3PUVA 4DR2Q 3DLLA 4LNQA 1N33L 2VS1A 1KC8C 5FJ8G 1X3GA 4QJFA 4HJ9A 1EIFA 3ICEA 5BR8L 4X65L 4PG3A 2GVBA 1MKHA 3HOZG 1Q1BA 2K50A 3PUWA 4OX9L 1WI5A 1YHQA 2Q2IA 5IP9H 2LXJA 2R7ZG 2WP8J 4DV7Q 1PYSB 4ME3A 4QY7A 3PUZA 2MQHA 2UXCL 1B70B 3CXCA 5FLMH 2KBNA 3E9HA 1HNZQ 4LF4L 1X3FA 4LF8L 3B6YA 1PH4A 4JI7Q 1HZBA 5IT9c 5C4JH 3I4MG 4X6AH 3HKSA 4DR7Q 4LFCL 2JQOA 4UP8A 1L1OB 5FJ8H 2K4KA 1JJ2A 4B3SQ 1GD7A 3GO5A 2YU9H 2PQAB 2B3GA 3HOZH 1EFWA 1QUQA 5LMNW 4A3LG 5JJKA 1OXVA 4OWTB 4DR4Q 2R7ZH 5IYBG 4DV3L 5EAYA 4A76A 1VQ4A 1YZ7A 3CF5A 3I55A 1H95A 3H3VH 1X65A 1BBUA 2CWPA 2UXDL 5GADC 4JBJA 3F2DA 2NN6G 4R4QA 4GS3A 3I4MH 3K0XA 1PFSA 1PH2A 3M3YH 1VQ5A 5GROA 1FJGQ 1JE5A 2PNHA 3M85A 2Z6KC 3E0EA 1DGSA 3KOJA 1CKNA 2F3IA 1SE8A 4O2DA 4DK3C 4HJ7A 4A3LH 4L5TA 2VQFQ 3CCLA 1N36Q 1A63A 4C3IH 2JA9A 1LUZA 4LF9L 3ULPA 1UE1A 4NPSA 1EOVA 3AFPA 1VQ9A 4JI6Q 3W1GA 4R4TA 3VDYA 2OQKA 3ULJA 3T1YQ 1V43A 4JI1L 4TQUS 3PF4A 4BXXG 1J6QA 1EYGA 2YTYA 4B3TL 3H3VI 2KHIA 2IX1A 3PO2G 3CPWA 2E8GA 1Q46A 3G4SA 3TS2A 3HOUH 2GN5A 1IYJB 1NMGA 5IWAL 1X54A 1MJCA 5LMNQ 1EUJA 1L1OA 1YEZA 4MNOA 5H1SE 2XTIA 4X64L 4K0KL 4IFDG 3AFQA 4A3MG 4LF4Q 4LF8Q 1NMFA 1EQRA 1M1KC 2I5HA 2N8NA 4LW1A 4BXXH 1VQFA 1JJGA 3K7AH 2JE6I 1XJVA 1K8AC 3PV0A 4JI5L 3KLWA 4UP9A 2NN6I 3CCSA 4QIWE 1FL0A 2OQ0A 4YHHQ 1N34Q 3CMAA 3S2DH 2MFIA 3UDFA 4DV3Q 3M9BA 3Q8DA 5JEAG 4C3HH 4P71A 2MO0A 4EQ5A 4GOPC 4A4IA 2WB1G 1NE3A 1HNWQ 4YCUA 4A3MH 4DR3Q 2I5LX 1Q86C 1NJIC 1B8AA 3FP9A 3ER0A 4JI4L 2A8VA 4A3CG 4KHPL 4A3BG 1CKOA 4Y52H 1X9NA 1UE5A 2RCNA 3STBD 2F52A 2VZAA 1E1TA 3GTGH 1T9HA 3K8AA 4JOIA 4HIKA 5JJIA 4YWKA 1XPOA 2UUBQ 1PH5A 3CMEA 2NVQH 1VQGA 1CSPA 2KENA 4LF9Q 4JI0L 3LGJA 4LF7Q 4IFDJ 4NXNQ 4AIMA 3PIOA 2YYZA 2Q2UA 2ZM6L 3L0OA 4JI1Q 2VQEL 2AKWB 3MXNB 4A3JG 1Q82C 1ASYA 1E1OA 4A3BH 1SROA 4IFDI 1OXUA 2HIVA 1QZGA 2QGQA 3U4VA 4HIMA 4AQYL 1C7YA 4B3TQ 4JYAL 3I4NG 1YVCA 4H02A 3TQYA 1AE2A 1Z47A 1Q1EA 1SRUA 3BZKA 1E3PA 1K8GA 1RL2A 1C0AA 4HIOA 3SGIA 5ELOA 1Y1WG 3CW2C 1UE6A 1VQ7A 1WYDA 2JJQA 4AYBG 4A3JH 3E9IA 2UXBL 2RF4A 3KF6A 5HGQA 1AE3A 3WWVA 2IT1A 4DV5Q 1KIXA 4L5SA 4DV1L 4IOCA 3I4NH 1KXLA 4DV0Q 4DR5L 3W1BA 2CQOA 3A0JA 3OTOQ 3GTLH 2HHHQ 3CC7A 1YJ9A 3GTPH 4X66L 4TVAB 2N3SA 5HY6A 5J3BA 3EBEA 1Y1WH 4KHPQ 1VQ6A 4LFAL 1LYLA 3S14H 2PI2A 4GN5A 1PH6A 1E24A 1VQCA 2WAQG 2IX0A 2Q2HA 2Z6KA 4BBRG 4AH6A 2Z0SA 4XTCS 2E5LQ 4Y7NH 3GTKH 1BVSA 3U50C 3PGZA 3UE1A 3CCQA 2R93G 1CSQA 1U5KA 3RLFA 4JI0Q 3I4OA 4PZ7A 3KJPA 2ASBA 2ZJQA 4RG1A 4YWMA 4BA2I 1CKMA 4JI3L 4DKAC 2ZM6Q 1YHBA 3CCEA 3CAMA 3M4OH 1OXTA 4YY3L 3H0GG 2ZJPA 1YHAA 1VQAA 4JBMA 4LF5Q 1KL9A 2K75A 1PH1A 5LMUQ 1CUKA 4B3ML 1LTLA 4LUZA 4OXPA 4JYAQ 1V1QA 4BBRH 2EQSA 2PI2E 1VCIA 1KRSA 1PH9A 1HNXQ 4LFBL 1JJCB 3PUXA 3HOYG 3PO3G 2R93H 4POFA 3G71A 4PZ6A 4KI0A 1K73C 2BA1A 2GVAA 2UU9L 4WJ4A 1GM5A 3H0GH 1HJPA 3F1ZA 1IBLL 1YJNA 4A3GG 3RN5A 1Q12A 1TWGH 2Y0SG 4JBWA 4DV1Q 4OO1G 3RNUA 4GLXA 3IRBA 3HOUG 4DV6L 3T1HL 2WFWA 3HOVG 4QGUA 2UUCL 3HOYH 3PO3H 4GOPA 1X55A 2VW9A 5AJ3L 2K52A 1KRTA 1P8LA 1S72A 1XPUA 2CFMA 4P73A 4DNIA 4GKKQ 1XNRL 1I94Q 4B3RL 4LUVA 4LFAQ 2L15A 1N33Q 4A3GH 4DV4L 3I7FA 3I2ZA 2PMZE 1SLJA 3NEMA 5BR8Q 4X65Q 4DUZL 4DAYB 2D62A 1NTGA 2ZTCA 2R7DA 4OX9Q 3J7A5 4GKJL 3GTMH 1HZAA 4IPGA 3KJOA 4OWXB