2A19A

Pkr kinase domain- eif2alpha- amp-pnp complex.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
165
Chain Sequence
b'SSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
total genus 46
structure length 165
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a19A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a19A01
2JA6H 1SRUA 4A3IH 5LMUL 4DUZQ 2CQOA 1K9MC 2VUMH 2K52A 4AIMA 1QUQA 2ALYB 3DLLA 3CMAA 1FVIA 4LF9L 1G51A 2XGTA 1TWGH 4NXML 2WB1G 5J3BA 4A4IA 3S1QH 3CPFA 5GAGC 2F4VL 2PQAA 1X56A 1K8AC 4IPDA 4GKJQ 2PI2E 4X64L 1LM0A 3D31A 5M3FG 1S40A 4BXXG 1Q46A 1UE5A 1AE2A 2UXDQ 3ULLA 5M5XH 2UUBQ 3F8TA 2AHOB 3J81j 5E7NA 1VQKA 2IT1A 3PUWA 1YI2A 1L1OB 2GVBA 4MNOA 2UUAL 3BJUA 4DKAC 1NTGA 3T1HL 4IFDI 3AFQA 2VS1A 4LFBQ 2UXBQ 1EWIA 3GDEA 3PUVA 4RG1A 1R9TH 1X9NA 4BBRG 2IHEA 5JJIA 4A3CG 4YHHQ 3Q8DA 3F1ZA 2R7ZG 1CKNA 3GTQH 1X3EA 4GOPC 3CCVA 1TWHH 3I4OA 1NBWA 1SR3A 3NELA 4NXNL 3J7ZC 1VQPA 5IWAQ 2R7DA 1HJPA 2ID0A 3SGIA 2KCTA 4DUZL 2ZTDA 1JJCB 3HOZG 2JQOA 2Z6KA 5ELNA 2PNHA 2YV5A 3HOWG 2EXDA 1HR0W 1VQIA 3NENA 1Y1WH 4LF7L 1EYGA 4DR3Q 1VQDA 4B3SQ 3M9BA 1LTLA 2MQHA 3S17H 3RZDH 4L5RC 4YCVA 4A3BG 1AH9A 3KJPA 4K0KQ 5LMNQ 4A93G 1MJCA 2VW9A 4JI1Q 1WCMH 2UUBL 1N36Q 3CAMA 1BBUA 4POGA 4GOPB 3PO3G 3U50C 2VQEL 2NZOA 4JC0A 1MIUA 2NN6I 2RHQB 2N49A 4LNQA 5C44G 3E9HA 1HZBA 2DUDA 2MO0A 5FLMH 5GAEC 1Q86C 4FDBA 3PUXA 1HR0Q 4R4TA 4RMFA 2HT1A 3MEFA 4A3GG 2K75A 5C3EG 5HGQA 3HOVH 1IBKL 1WJJA 3OTOQ 1KRTA 1KD1C 3AFPA 2N3SA 3UDGA 4ME3A 1XJVA 3L0OA 3CC4A 1I5FA 3KFUA 4DR6L 5AJ3L 4DUYQ 1PV4A 1IL2A 2OTJA 1EOVA 1Y1VH 4NPSA 1XTDA 3NBHB 3CCEA 2ES2A 3J81i 4BY1G 1IBMQ 2WB1E 4R4QA 4DV2Q 1G6PA 1BVSA 2CKZB 1YHQA 4OO1I 4R4IA 4POFA 4DR2Q 1WCMG 4B3SL 4JYAQ 1MJEA 1LYLA 4OONA 4EX5A 3I4MG 2BA1A 2HIXA 3TEHB 4K0KL 4QY7A 4KHPL 1Q1EA 2D62A 3KF6A 4X62L 4ALPA 2OTLA 3H0GG 3ICEA 1FJGL 1Q12A 1D8LA 4IOCA 1WOCA 1VQFA 3GTKH 3PO2H 1YJ9A 2YTXA 4P72A 3CCUA 4DV0L 3GTGH 4HJAA 1U0LA 3W5OA 1HR0L 2KCMA 5HY6A 3S2DH 4IJHA 4A3MH 4LF8Q 5IE8A 3KDFA 3RZOH 2R6GA 2N78A 4C3JH 4A3DG 3CF5A 3OTOL 1RL2A 2I5LX 2HIVA 3PIOA 1XNQL 1SE8A 1SLJA 1JB7A 3PF4A 4KHZA 2UUCL 2L15A 2MFIA 4P71A 1YHAA 2LXJA 1VQGA 5IYDG 1KQSA 1XPUA 1N32L 1IBML 4DV2L 1VQHA 2ZTCA 1NY4A 2BH8A 4JI3Q 1N8RC 1VQAA 2NVQH 3GTLH 4DV4Q 1FL0A 4JYAL 2KHJA 2MNAA 4PZ7A 2E8GA 2R93H 3PF5A 5IYBG 2KENA 1LUZA 3E0EA 3FKIG 1Q81C 2JA5H 3S1MH 4AQYL 4JI6Q 2A1AA 5IT9c 2I5MX 2NZHA 2JJQA 3JAMc 5M3MG 1TXYA 3FHWA 4LF5Q 4C3IH 2AWNA 3PSIA 4JI8Q 4JI5L 3CD6A 1GO3E 1C7YA 4WJ4A 3PCOB 5DLQE 4LF8L 2E5LQ 1VS0A 1VQ6A 1QUQB 2MO1A 1GD7A 4OXPA 3H15A 4GNXA 1KIXA 3FP9A 2RHSB 3BZKA 3IRBA 2BH2A 4A3EH 1EUJA 2OCEA 4GLVB 4DV5Q 3HOYH 4JI7Q 5C0XG 4QJFA 2PQAB 5JEAJ 4P74A 2Z6KC 3K7UC 1FGUA 2GN5A 1BKBA 4L5QA 1IXRA 4A3JH 1YBYA 1Z9FA 3M85A 2K14A 3CCRA 1QVGA 4BBSG 1PH4A 1VQ5A 2VQFQ 4GLAC 2JEAI 1WYDA 1P8LA 1PH3A 2YTVA 2B63H 3CCQA 1W3SA 4JBJA 4A3FH 4XTCS 1I94L 3S24A 4DR4Q 4GS3A 4LWCA 1PH6A 4BY7H 2R92G 2JA6G 5M5YH 2JA9A 3M4OH 1UE1A 5LMNW 4DV6Q 1YEZA 4DR5Q 4A3IG 1K83H 3CQZH 2UU9Q 4OX9L 4DR1Q 2VUMG 4IFDJ 2KBNA 2UXCL 1CKNB 2ASBA 3MXNB 1YITA 4A3LH 3M4PA 3AQQA 3I4NH 1MKHA 2K4KA 2A8VA 2AMCB 4UPAA 4JI4Q 4LF4Q 4B3RQ 2E2JH 4JI0Q 1J6QA 3CCSA 4HJ5A 4MTNA 4H02A 4LFAQ 1V43A 5BR8Q 5C4XH 1CSQA 4JOIA 3ZJYC 3CC2A 3HOXH 4UP9A 1Q8KA 4YWKA 1X65A 4LW1A 4EQ5A 2ZJRA 3STBD 4HJ8A 1SROA 3T1YQ 4DV5L 4Y7NH 1PH9A 1U5KA 2Y0SE 3PIPA 3A5UA 4JI7L 4DAYB 1VQ9A 2I0QA 4UY8C 4IPHA 4A3FG 4LFCQ 1OTCA 3H3VI 1NMGA 2OWOA 1GKHA 1PH2A 1VQ8A 4LFBL 2UXBL 2VQFL 3J80i 1Q82C 4TVAB 2VZAA 1VQBA 4YHHL 3S2HH 1YHBA 4C3HH 1UE6A 5FJ8H 1VQCA 2OQKA 3L2PA 4DV7Q 4GKKQ 5JJKA 2R7FA 1XPRA 4A3KH 4YY3Q 1K0RA 3AYHB 3CCMA 4MZ9A 3OW2A 4DR1L 1QVFA 5IWAL 1HNWQ 1CUKA 4DV3Q 1UE7A 1NE3A 5IYCH 4BA2I 3WWVA 2ZM6Q 3G4SA 2K5VA 5GQOA 4YWMA 1Y1WG 1TWFH 1EIYB 1YZ7A 2C35B 2K50A 3I7FA 2JA8H 4LF4L 4B3RL 3UE0A 1HNXQ 1V1QA 2JA7H 1Q1BA 4LFAL 4DR3L 4P73A 5BR8L 1EQRA 3KF8B 1S72A 2VL6A 2CWPA 3F2CA 1HNWL 5EAYA 3W1BA 2ZJPA 3CP0A 3T1YL 2NVYH 4JI2Q 5LMNL 4JI1L 3G71A 2Q2HA 1N36L 5FLMG 1OXTA 1HH2P 1UWVA 5H1SE 5C4JH 4WJ3M 5GAHC 4IOAA 3ER0A 3KF6B 3F2DA 3GTMH 4PMWA 1SMXA 5GROA 1X6OA 3HOVG 3F2BA 4DR7Q 3CMEA 1YIJA 1M1KC 3RN2A 2LSSA 4GKKL 1IZ6A 1X3FA 5IY0A 4LF6Q 1Y1VG 2B29A 3S1RH 1KC8C 1W2BA 1EIFA 2LXKA 3B6YA 2CWAA 2QA4A 3KDFB 4DV3L 4DUYL 1X55A 4HIMA 1K73C 1NJIC 1N33Q 1VQNA 1I6HH 3TREA 2GVAA 5IP7H 1VQEA 2ZTEA 4YWLA 3PGZA 1PH8A 1GVPA 3GTOH 5IP9H 2NVTH 4HJ9A 1HNXL 1J5EQ 4DK6C 1SN8A 2Y0SG 2YU9H 4L5SA 4Y52H 3OYYA 4OWWB 4A75A 4DR2L 5C0XI 4GNXC 1BBWA 4LF9Q 1PVOA 1PH5A 1TWAH 4JI2L 1OXVA 1A8VA 4JG2A 4R4CA 4JV5Q 1N34Q 3ULJA 4JCVE 5M5WH 3PO2G 1XPOA 4LUVA 3UDFA 4GLXA 2F4VQ 2HQLA 4A3MG 4X64Q 1H95A 4YCUA 3TQYA 1KRSA 3A5ZB 2K5HA 1JJ2A 2KHIA 2PMZE 1UEBA 2YYZA 3HKSA 5K36G 2CCZA 2UXDL 3KJOA 5M3FH 2CFMA 4BXXH 1RIPA 1X54A 4JBWA 3T1HQ 4LF6L 2XTIA 1N9WA 1E3PA 3S1NH 2VNUD 3I2ZA 4B3TQ 1GM5A 4UP7A 3NEMA 4X66Q 1L2FA 4GNXB 1VQMA 4AYBG 3U4VA 2EIFA 3CPWA 4A3CH 4NXNQ 2R93G 4JI3L 4C2MH 1J5EL 3LGJA 2R7ZH 3JC66 3S14H 3PV0A 2IX0A 3CC7A 4DV4L 1Z47A 3I56A 4YCWA 3GD7A 3J81c 4HIOA 2JA5G 2RCNA 4JOIC 2NVXH 1E1TA 3U4ZA 2IX1A 4IPCA 3A0JA 4LF7Q 4JV5L 3G48A 3HOZH 1N34L 2YTYA 2WAQE 1KHIA 4O2DA 4JI6L 3RN5A 4AH6A 3HOWH 1QZHA 1KAWA 1L1OA 2D0OA 4DK3C 3VDYA 4LF5L 1OXSC 2QGQA 1JJGA 3A74A 1JE5A 1PYSB 4JI8L 4KLKA 4LUZA 3PUYA 1QVCA 3KLWA 2VQEQ 3CW2C 4A3EG 4A3BH 1D7QA 2BA0A 3GO5A 3TS2A 2RF4A 4R4OA 2E5LL 4A93H 1HNZQ 4DNIA 4OWTB 3UDXA 2E2IH 1KXLA 1V9PA 2DGYA 1B8AA 3KYHC 4NB3A 3GTJH 3HOYG 3PO3H 5JJLA 3K80C 4B3TL 4GKJL 4X66L 3G6EA 1VQLA 5C44H 1PFSA 4A3JG 1IBKQ 4X6AH 1I3QH 3HFZB 4QQBX 4HIDA 4DR6Q 2B63G 5ELOA 1CKOA 3HKZG 5AJ3Q 3DM3A 1KL9A 4DAMA 5C3EH 1YZ6A 3HOUH 4A3GH 3U58A 4BY7G 3AEVA 1PA6A 2JE6I 5JEAG 1HZ9A 1I50H 2I5HA 1Y14B 1E24A 4B3MQ 4DR4L 1JT8A 1Q7YC 2V1CC 1B7YB 4HJ7A 2AKWB 4A3LG 1P16A 4DV6L 2Q2TA 2UU9L 1K8GA 2FXQA 3I55A 4PG3A 1A0IA 4DR5L 2ZJQA 4BY1H 3S16H 3STBC 4XIGS 2Q2UA 2N8NA 1WI5A 4L5TA 3JAMi 4QGUA 4DV1Q 4GOPA 1XMQQ 4IFDG 2EQSA 4KHPQ 1YNXA 3BU2A 4R1JA 4GN4B 4X62Q 2IY5B 5C4XG 3I4MH 3H3VH 4JI4L 4PZ8A 4JI0L 1FJGQ 3ERSX 3HOXG 2F52A 1HNZL 2PI2A 3RLNA 1XNRQ 3H0GH 3D0FA 2B3GA 1T9HA 4AYBE 4DV0Q 3W1GA 3HOUG 4O0AA 3M7NA 2JEBI 3M4QA 1ASZA 4DPGA 1OXXK 1B70B 1XNQQ 4LFCL 3RLFA 1SFOH 2UUCQ 3CCJA 5FJ8G 4A3DH 3UDIA 1DGSA 3EN2A 2WAQG 2WP8J 4GN5A 4P75A 4X65Q 4A3KG 2E2HH 1N32Q 3K81C 4B3ML 2HHHQ 1EFWA 3CCLA 3EBEA 4DV7L 3I4NG 5IYCG 3RR5A 1E22A 5IYDH 3RNUA 1PYBA 4YY3L 2AWOA 4OWXB 1AE3A 3ULPA 1OXUA 4A76A 2JA8G 4IPGA 4BA1I 4HIKA 1IBLQ 3EIVA 4DV1L 2A19A 2NN6G 1XMOQ 1HZAA 2ZM6L 1XMQL 1PH1A 1PH7A 4JBMA 1TWCH 2OQ0A 2JA7G 1C9OA 1VQJA 2F3IA 1YJNA 1K3RA 3UE1A 4AQYQ 3TRZA 3TS0A 1CSPA 5IYBH 3CXCA 1ASYA 2QEXA 2JK8A 2K5NA 3FKIH 3L7ZC 3RLOA 5FLXc 1G291 5LMUQ 4JBKA 1XNRL 4JI5Q 3E9IA 1CKMA 3HKZE 4APVA 5M3MH 4QIWE 1A63A 2H5XA 4NXMQ 3M3YH 4LUOA 3K0XA 1A62A 5C0XJ 1NMFA 4OO1G 5GADC 4IJLA 1X3GA 1PHJA 4X65L 3KOJA 4DR7L 2Q2IA 1C0AA 3K8AA 1WFQA 4J15A 3GTPH 2VY3A 2HHHL 1EQQA 1E7ZA 1L0WA 1VQOA 1IYJB 2UUAQ 4QL5A 1E1OA 3PUZA 1HZCA 3S15H 4TQUS 3BZCA 4GN3B 1VCIA 5IP7G 1QZGA 3J80c 1VQ7A 2Z0SA 5IP9G 1I94Q 1IBLL 1JMCA 1N33L 1XMOL 4KI0A 4PZ6A 4IO9A 1S3OA 1YVCA 3K7AH 4BBSH 1M90C 4UP8A 1L1OC 3J7A5 4OX9Q 1VQ4A 4BBRH 2IHFA 2ATWA 2D0PA 2UXCQ 1O7IA 2R92H 2WFWA 1YJWA
chains in the Genus database with same CATH superfamily
2JA6H 4KK7A 3TP8A 4AYBF 3Q8QB 1FNWA 1SRUA 5LMUL 4DUZQ 4F4YA 2CQOA 5ELCA 1U4PA 1K9MC 2ALYB 2F1HA 3HP6A 3CMAA 4OEMB 4LF9L 5J39A 5KG7A 2YQEA 4KLUA 1ZYRC 1PFMA 3NASA 3PNCA 4DFDA 3TANA 1ZQSA 1IKLA 1SYGA 2XI9A 2AH5A 2F4VL 1X56A 5E4WC 5T1GA 4B9SA 4BS9A 1LTBD 2R8IA 2IBKA 5GTHU 1Q46A 1D2BA 3D6JA 1S5LU 1SNMA 3ULLA 3HX0A 2B63B 2UUAL 2J4XA 1Z1VA 2L0CA 4DKAC 3T1HL 3AFQA 2VS1A 4LFBQ 4BY7B 3HGBA 2F0LA 5AKIA 4KLEA 2B21A 4A8EA 4BJQA 3CYMA 2IHEA 4RG1A 3SI8A 4Q8EA 1TWHB 1X9NA 4M47A 4A3CG 3N52A 3SK4A 1CKNA 5BOLA 3BQ7A 4EEYA 5IODA 3PY8A 9ICVA 2K5QA 4F92B 3HP3A 3RJEA 1CRXA 1SR3A 4XDXA 1KSPA 3TQ1A 5J2DA 2DJFC 3R2TA 2KIVA 4G7ZC 3QU4A 5DM63 5J2HA 1ICWA 4ECUA 1XWLA 2JQOA 2Z6KA 5FO7B 4J9QA 4AP9A 1SKSA 2CH4W 3FPUB 2F0DA 4YCXA 5B66U 1BNPA 1EWHA 4LF7L 3IG8A 4DXFA 8ICGA 2NV3A 3V05A 2BCUA 3RZDH 2HDMA 1AH9A 3JPQA 1ECWA 2Z9HA 5HGTA 5LMNQ 1JRPA 2AQ0A 2UUBL 3PO3G 3RJFA 3D2NA 3U50C 2HOFA 2KZMA 2QKQA 4HAEA 2L9HA 2E3TA 3KFUF 4FXDA 4LNQA 3WK6A 4K4HA 2DF4B 2BQRA 4O5EA 2E8MA 5ALDA 2KUMA 4QZBA 1IM4A 3I72A 5FLMH 1TFRA 3JAML 1WTHA 4ZYSA 1ZQBA 4RMFA 5I6WA 3KUPA 1IBKL 2IMWP 3WK8A 2AQ1B 2N3SA 5ALGA 2LFNA 3D6WA 4ME3A 1XJVA 1LLRD 2CQAA 1I5FA 3W3AA 1SGGA 3PO4A 1XYIA 2LM4A 2YN4A 1XTDA 3NBHB 2E1FA 4K5XA 2K4EA 2VJ4A 1IBMQ 2KSOB 4R4QA 1KQQA 1V38A 2HHUA 1C4QA 1NKBA 2B2VC 4MF2A 2CKZB 3ITPA 4KHVA 4R4IA 5DM73 2JV3A 4K5WA 2W9MA 1WCMG 2IL8A 1PFBA 1LYLA 2J0TD 5E1FA 2HIXA 1U9RA 3D3RA 1G8ZD 4K0KL 5ALZA 3BG3A 4UHVA 1Q1EA 1HUMA 1CT1D 5KNDA 1XXGA 2EYOA 4B9VA 4U68A 3H09A 3M8RA 5ELEA 1D8LA 3V6KA 1AP0A 3PW5A 1KFSA 3PO2H 3M4YA 4KD3A 1I4RA 1PYWD 2QCPX 4HJAA 1U0LA 2KCMA 4MFAA 8ICEA 1HTPA 4IJHA 3KDFA 1XSPA 2R6GA 2N78A 5IE8A 4A3MH 2NRTA 1VJ5A 7ICFA 4A3DG 8ICVA 1J9OA 1KAAA 1S5ED 2I5LX 4DNTB 1NI3A 1KABA 1SLJA 1U9LA 4KHZA 1QQ5A 2MFIA 1WCNA 4J6HA 4V0BA 3AMUA 1YHAA 3EZ5A 2K05A 1KQSA 1LT4D 2RSOA 3PW4A 2NVQB 1BDOA 3Q8PB 8ICWA 8ICUA 5EBDA 4I28A 2D5DA 1TWAB 2XVTA 1F2YA 4DV4Q 2KHJA 3ISBA 3UQ0A 1F77A 1B44D 2JA5B 2KN7A 3PF5A 5IYBG 2KENA 1ZQLA 1IW7C 3RJHA 3KZXA 4GIBA 5J0WA 2W8KA 3IV6A 4QIWC 2BR0A 2EY6A 2JEFA 1CA5A 2BQ3A 1PVRA 1BOSA 4O3QA 1BQQT 2L55A 4DN4M 2I5MX 2NZHA 4CHTB 3E6ZX 1DK3A 4LF5Q 2L1BA 2W7OA 5M3FB 3PSIA 3A0BU 5C4ZA 2GWSA 3CD6A 1GO3E 1C7YA 4WJ4A 3QUBA 2KV2A 2F0PA 5DBBA 2G5DA 3PW0A 2F1MA 4LK1C 4XT3B 5FKAC 4LF8L 3DEOA 5I2XA 1GD7A 2VIXA 9ICFA 1SE3A 2RHSB 3NWSA 1EUJA 1MGSA 2K8BB 1ZQEA 2BCQA 1FD7D 3SXHA 2LBOA 4C2MB 3BDLA 3HOYH 4B9NA 3S14B 5ALJA 3LWMA 1NK0A 4C4RA 4QJFA 2PQEA 4P74A 2Z6KC 3K7UC 3I28A 4RUCA 4KX3A 1X40A 1BKBA 1NK6A 1PTOH 1QCBD 2ZJ8A 2GN5A 2HQEA 4QIWB 4NM1A 3CCRA 3MR6A 3QJYA 4EBDA 2JYOA 7ICNA 4CF3A 2MU2A 2JEAI 2YTVA 4CDDC 4A3FH 4JBJA 1L7OA 2K8CB 4XTCS 3VR6A 1I94L 1U4RA 2F0HA 2PFPA 1KRPA 1L0YB 5KFSA 3E5SA 2G0AA 1YEZA 5ALHA 5DB8A 4F2SA 2MGSA 2QLTA 3I4NB 1CKNB 2K60A 5J2IA 2W03A 1F0MA 1SJED 1UUPA 3M4PA 1MKHA 2Z4IA 1MSGA 1QE6A 5EBCA 3MR3A 3I1YA 5KAIU 2K4KA 5FLXE 5CRXA 1C8CA 4IQWA 5CORA 2AMCB 3I91A 4HTHA 1M4VA 2B39A 4JI4Q 2E2IB 5KYLA 1XO1A 4ZAIA 4H02A 1NK4A 3B9JA 5AI6A 2F0QA 5C4XH 4JOIA 5C44B 1WD0A 4LJXA 1P7DA 1RDFA 3ZDBA 4K4GA 1IHZA 5CWRA 3HOXH 4YWKA 3QIAA 2KMDA 3IHQB 3QE9Y 4Y7NH 1TE2A 1PH9A 2F0SA 4JI7L 1L7NA 3EPGA 3RJJA 9ICUA 2JEJA 1Y8PB 3OSOA 4EYHB 5EOZA 4LFCQ 2V4RA 2XO7A 4ELTA 1QLNA 4UAVA 2OWOA 3ZD8A 3MFYA 2UXBL 2VQFL 4BY1B 4YHHL 1ZRMA 3S2HH 4F72A 4EZ9A 5FJ8H 4UB2A 3RR8A 2QILA 4DV7Q 4GKKQ 3GIJA 3FPPA 5D49A 4IUTA 1XPRA 4YY3Q 4YD2A 4OGQC 3CCMA 1QB5D 5CBAE 3N7SC 1L8OA 2XN9C 1QVFA 1T3NA 1SB3C 4Y2JA 1DYQA 1NE3A 4TUSA 5GQOA 1Y1WG 1GO3F 4PHDA 1OUQA 2C35B 2JA7B 2W3RA 4LF4L 5JOBA 3H8WA 1S5DD 2NN6H 2Z6BA 5EQ0A 1L3UA 3H4DA 2RDIA 3RAXA 2Z7JA 1FIQA 5IINA 3W1BA 1Y8NB 2Q8TA 2ZJPA 5ISRA 1K1QA 2W9CA 1T8EA 5KT4A 2E2HB 3DWQA 1UT5A 2DL0A 4DNRB 3F2DA 3R93A 3GTMH 3RB4A 4DR7Q 4KLSA 3HG9A 3CMEA 4ED2A 1T5XD 2FDRA 3ZI4A 1X3FA 1CA6A 1Y1VG 5C5LA 2OEHA 5DDYA 1W2BA 4GC7A 2XCAA 4G4KA 5I9OA 4XQNA 3ZDAA 3B6YA 2EVBA 1HNWL 1K73C 3KDFB 4DUYL 1NJIC 4JK1A 1CK1A 3TREA 1HEKA 5IP7H 1VQEA 4YWLA 1XU4A 2G07A 3AU7A 2VA2A 4CCHA 1X6JA 4HJ9A 1HNXL 1NJZA 2FLPA 1ZQNA 4OJPA 4Q44A 3RFAA 3MFHA 2Y0SG 3OYYA 5DBAA 5KFTA 1PZID 5M3MB 3TKAA 3H8MA 2A3VA 1WTOA 3E2EA 1B43A 1BPEA 4LF9Q 3M3YB 1N61A 2H3IA 2JHDA 2HBKA 1A8VA 1OXVA 4JG2A 4C1NK 1ET9A 1SDFA 4JI2L 5EKKA 5DQGA 3BYTB 4LUVA 2HCIA 2L5TA 2F4VQ 2EZXA 1TAMA 3C1ZA 4Y2VA 5COYA 2HQLA 2PCFB 4FVMA 3F5EA 4CF4A 1H38A 3A54A 3C1FA 4YCUA 1KRSA 4ECYA 3S15B 2M0NA 3QUTA 1DONA 2KHIA 3HKSA 1UEBA 3MVVA 3P75A 4DLEA 1NZBA 1T7PA 2IPKD 1DOKA 3BVZA 3KJOA 1X54A 4QB4A 3OPXA 2C28A 3T1HQ 1S8OA 3M8SA 1ZYRD 4CDFC 1RTOA 5G3LD 1Z00A 4DSKA 5F2DA 4B3TQ 1GM5A 1X9XA 2KECA 1YT3A 3LDAA 4BDPA 4F5OA 1VQMA 2R7ZB 1X6IA 4AYBG 2NVTB 1RODA 3CPWA 4A3IB 4A3CH 4OD0A 1S0NA 2R93G 2O2LD 1J5EL 3LGJA 2LKYA 5GTIU 2K8AA 2NZ1D 4QJFB 1PVQA 4Y2XA 2NTSA 2JA5G 4HIOA 2RCNA 4JOIC 3TARA 1SMYC 5EKIA 2KZZA 2OH2A 2IX1A 1EQVA 3A0JA 4LF7Q 1N34L 2YTYA 3FDSA 3RN5A 1QZHA 1MHWC 3I90A 2EYHA 4DK3C 3VC8A 3MABA 1JE5A 2AU0A 4LUZA 2YMPA 3T5LA 2W9BA 2K5DA 5HURA 3CW2C 5KFCA 1GUOA 2BA0A 2RF4A 4F3OA 3PR4A 1O7IA 5KFQA 3UDXA 3VYSA 3H3VC 1PZKD 3R9KA 3PO3H 4Y2YA 4CKCA 3GDXA 4IRCA 3TZUA 4X66L 1MC8A 5KFRA 1DK2A 4IURA 1IBKQ 4X6AH 1KTQA 2LMCB 1SYFA 3C2KA 1KL9A 5J0RA 3H94A 1YZ6A 4NY8A 8ICAA 1XO0A 5D14A 3AEVA 1EYCA 1JWMD 5J2EA 3K57A 3ONAB 1I50H 2HHWA 3L3FX 1Y14B 2ATLA 1E24A 5DBCA 2KD1A 1RYUA 4DL5A 2AKWB 2H1EA 4B9UA 3I4NG 2ZJQA 1W6JA 2WKDA 4RWSC 3STBC 4XIGS 4FZMA 4L5TA 4GOPA 1HPCA 8ICHA 1N5WA 2KFNA 2P6UA 4FZLA 2QKIC 1HCZA 3K5MA 2IY5B 2C5CA 2F03A 3TSSA 4PZ8A 3ERSX 3TADA 1A77A 1HNZL 2PI2A 4DAPA 4RQ6A 2GOLA 4NLCA 3E3XA 3HOVB 2WF5A 2QW7A 3D0FA 1KDCA 1MSWD 1SXEA 3W1GA 1Q3VA 3ICXA 3KLRA 4F5QA 2BGWA 3M4QA 4JK1C 1HTLD 1PRTC 3NVWA 1SXDA 3OHAA 2W9CB 5EPKA 2KFZA 2AJQA 3FYHA 4A3DH 2W43A 5JVH3 1DGSA 5J29A 2WP8J 4P75A 4RKBA 3I70A 2C9OA 2CXYA 1A0PA 4B3ML 3J81E 2HHHQ 3CCLA 2KKPA 4F91B 2EAOA 1IL8A 4I29A 1EEFD 3EBEA 5TISU 4YFKA 5CR3A 4ELVA 3RR5A 5FOBB 3NXWA 4QZCA 1STYA 3RMHA 1TWCB 3ULPA 1STGA 3K59A 4IPGA 2HBMA 4P0PA 4DV1L 2X6GA 1BPZA 2ZM6L 2HCCA 2JA7G 1C9OA 5EWGA 4KN7A 1YJNA 2O5JC 4FZNA 3TP6A 3FKIB 1SL2A 5EJWA 3UE1A 3C2PA 1CSPA 1NJYA 5IYBH 4ED3A 3GTGB 2KZ3A 3RLOA 2KJ8A 2ZIUA 3RZOB 1PRTB 4DL4A 5J2AA 2KQ3A 2SOBA 4C3JB 3RH6A 1I4PA 4APVA 1TK8A 3RAQA 5KT5A 4U6PA 1TV9A 4IQVA 1D8BA 4NP5A 5JPMC 4KJOA 1IW7D 4BGDA 2L11A 3PMNA 4WJWA 4OO1G 2Z4HA 4IJLA 1PHJA 2HCFA 2PPBC 2HD3A 3KOJA 2BCOA 1DOMA 2SEBD 3K8AA 2MAXA 5ALUA 1K8MA 1O78A 3GU3A 3QUCA 1GXDC 4RT2A 5B5EU 3Q6SA 4QL5A 9ICPA 3PUZA 2P66A 4OJ6A 3QO2A 4KJNA 5I6YA 1VCIA 4IS7A 2G09A 4ECWA 1I94Q 3H0MB 4B9TA 1IBLL 1XMOL 1D1KA 1BPDA 4I27A 7ICOA 1JMSA 3EA6A 4CDCC 3HKZC 1Z00B 3HILA 4CGZA 1QOHA 2F3NA 3RB0A 1V1PA 4BBRH 2A68C 2JXMB 3Q8MA 2KVSA 4C3IB 1SE8A 4MN3A 1PH6A 2QARA 4P2CB 5AKEA 3DDHA 3MBYA 4EQPA 1HA5A 3H40A 8ICBA 4AIMA 4DSIA 2CW0C 3NRZA 5KNCA 4YP3A 2WACA 3IG5A 3H8SA 4ZUJA 4C7ZA 3W2DA 4RNOA 4A3EB 4KLMA 2IOFK 1KBUA 4A4IA 5C0YA 1RYRA 4JWNA 3S1QH 5KFBA 3CPFA 2PQAA 3OGUA 4IPDA 1DXMA 4X64L 5KFLA 2JH1A 1S40A 5HP4A 2A6HC 4A3JB 1AQ6A 4DXGA 2NB0A 2AHOB 4DK0A 2EH9A 9ICRA 2F3WA 2GVBA 1XX8A 3HKZB 3SK8A 4QCLA 2Y9TA 2BQUA 1NTGA 1L3SA 2UXBQ 4DEZA 1EXNA 3GDEA 4PMBA 1F5SA 2VKQA 3M9MB 3M4OB 4YHHQ 1AROP 1K83B 5EWFA 3Q8DA 3F1ZA 2R7ZG 2F1IA 1SE4A 4GOPC 3MXNA 2PYKA 2GH1A 3KK7A 3GTQH 1TWHH 4EQNA 5CV9A 4F4KA 1LTAD 1NBWA 4N8FA 1VQPA 3K0YA 1B4FA 1S97A 1NUCA 3ALRA 3TADC 4UB8U 3SGIA 2E2JB 2KCTA 1JJCB 3HOZG 5ELNA 4C8KA 1KDBA 4QZFA 4DSEA 3P20A 5EE0A 3HOWG 3S17B 1ML0D 1VQIA 1Y1WH 5DAUA 4QUFA 4HCSA 5L1MA 1VQDA 4B3SQ 4DLGA 3M9BA 3AQFA 3Q8KA 4PGQA 4DAYA 4L5RC 5KT2A 2VW9A 2KOBA 2AGQA 4O9MA 4GOPB 4G7OC 2JH7A 5HR7A 2NZOA 1DCZA 1DM0B 4ZUIA 2DWQA 1R4PB 2NN6I 2SNSA 3KBGA 4C3HB 3E9HA 1KNEA 1HZBA 3PSFA 4NJ8A 3JPSA 4G9BA 1C48A 2MO0A 3LVWA 3PUXA 1HR0Q 4QF4A 3TI0A 3MEFA 2KVCA 5AK6A 5HGQA 4FF3A 1WJJA 4Z6DA 1KD1C 2RDHA 3UDGA 3LWEA 3CC4A 4KN7C 3EPIA 1CHPD 1CZWA 1L6NA 4DUYQ 1PV4A 1IL2A 5HNKA 1Y1VH 2AXTU 4RUAA 1FFVA 2FLLA 4TSSA 2XNAC 4OJ5A 3J81i 4F7XA 2YB4A 4K6LA 4ABNA 1U4LA 3I8ZA 3KTQA 2PFNA 3F2UA 4ME5A 1EOTA 4POFA 2NVYB 3MEHA 3RB3A 2NO4A 4ECQA 1MJEA 1Z7TA 1IKMA 2BA1A 1N48A 4ECZA 5FK9C 5KEEA 4QY7A 5CB1A 2D62A 4X62L 2MRLA 3CP8A 3ICEA 1L7MA 3GIKA 1HUZA 5AM1A 3HPOA 1GUNA 4CRXA 3BS5A 1SJHD 1LVHA 4QZ9A 1MD2D 1VQFA 4BWGB 1B3QA 3T4AC 3WK5A 5BOMA 3D8GA 3PSTA 4P72A 3TBIB 3T5KA 4DV0L 2KICA 3V7KA 5HY6A 2ZIUB 1JUDA 3H0RB 3CF5A 4KY5A 3WOEA 3OTOL 1S10A 3KHHA 1B0XA 3K4GA 4F4WA 3PIOA 4RCOA 4KN4A 1SNPA 4K8IA 1ENCA 3DWAA 1JB7A 3R2IA 3M6KA 4PGXA 2E5SA 4P71A 4FF2A 1JALA 1XPUA 1N32L 1L5UA 1BF4A 2IW3A 3KLSX 4BXOA 1VQHA 4DV2L 3M1YA 3K5LA 2BH8A 4GXIA 2PFQA 4C8OA 3DM1A 1VLBA 2NVQH 3GTLH 1ZQRA 1ZQMA 1SIJA 8ICIA 4JYAL 4FS1A 4PZ7A 5AICA 2E8GA 4QWAA 3OW7A 2R93H 1A2TA 5M5WB 3PV8A 2O4XA 3S1MB 4IQUA 4Z6FA 3RR7A 5AM0A 1IBLQ 3FKIG 1RJTA 5EPLA 2F0WA 2JA5H 8ICYA 1ZXIA 3KD3A 2JJQA 4B08A 3SR1A 5IGBA 1TXYA 5KFKA 1V1PB 3NHHA 3X3NA 5EE3A 4BWMA 4TQRA 4NLZA 5KAFU 2QARB 3S1NB 1F9RA 2KEDA 1SMYD 3K6OA 3ZD9A 4UB6U 2DGZA 3NRWA 3BQ1A 4DS4A 3P1HA 2WKCA 4OXPA 4GNXA 3IRBA 1D6EC 2DY7A 2FFKB 4M9HA 1EY6A 3MWYW 4DV5Q 1I4HA 1LTRD 4CJ0B 3MXUA 4GXJA 2PQAB 4QZAA 1FGUA 1FYCA 1IXRA 3GIIA 4ED0A 1YBYA 1Z9FA 2K14A 4O3OA 1QVGA 2EE1A 4KLGA 4U7CA 1PH4A 3BS1A 1WYDA 4PHEA 1P8LA 1DOLA 3M7GA 3SAHA 3EUB2 1KEJA 9ICOA 4C8MA 4U673 2I1QA 4XA5A 1JOOA 1C20A 4ZLTF 1MBYA 5I9PA 5M5YH 9ICTA 4IUNA 4EEKA 2ZIVA 2VUMG 3CQZH 2PFOA 2PW7A 3CRKC 4DR1Q 2AGPA 1UT8A 8ICRA 2ASBA 4FE3A 3HRZC 3MXNB 4S3SA 4A3BB 3AQQA 3I4NH 4A93B 4DFJA 4DOCA 1NK9A 1SSOA 4QIWF 4UPAA 2RCFA 4B3RQ 2J6SA 2KJ9A 2EY1A 4CDEC 3GTJB 4QWDA 1ZJMA 5KRUA 4HJ5A 2F77X 1NKEA 2EY5A 4C8NA 1V43A 4NV0A 2M00A 2G08A 3Q8RB 1PLFA 3ZJYC 4ED1A 2ZT9C 4LW1A 1SXTA 3STBD 1ZQ1C 3HOUB 1ED1A 4A3GB 5C3EB 3BYYB 3D6CA 1COOA 3D2SA 2FI1A 2EYFA 4DAYB 3PIPA 3A5UA 1VQ9A 2I0QA 2KP7A 2WF7A 1TAUA 2I9GA 1LTID 3FDTA 3JPNA 1URJA 2ASLA 1S4ZA 4ECSA 4J9SA 4Q43A 2BZFA 4A3KB 2XY6A 4MEXA 1EYDA 1JWUD 1VQBA 1YHBA 3L2PA 3KZIU 1VQCA 2JN4A 3C46A 1WTRA 3C2MA 5JJKA 5CJ7A 2K4IA 3VYRA 4DFAA 4TQSA 5ALXA 1SYEA 4DAVA 4F88A 1WVLA 3KBXA 3OW2A 1L0XB 2E8NA 4DQRA 3DWPA 4HSPA 1VDVA 4NDXA 4DV3Q 3DHQA 1UE7A 4BA2I 3WWVA 2ZM6Q 1PRTD 3ND8A 5IT9E 1JICA 2F44A 1X3PA 2K50A 1RXWA 4HR7B 3LVVA 3H0GB 3H4BA 5IIOA 2OT2A 2JA7H 4LFAL 4DR3L 5BR8L 4JB3A 3F2CA 1ZQGA 5EAYA 3EW9A 1TY2A 1O08A 2ZUCA 3CP0A 3T1YL 2CRXA 8ICQA 4KV6A 4PV1C 4JI1L 2RP5A 1QWYA 1CHQD 3TP5A 1LV9A 4ELUA 1GUGA 3AUOA 1N36L 3NUQA 1VMPA 3NWTA 1HH2P 2KIWA 3SENA 4CGYB 5H1SE 5C4JH 4WJ3M 4XYQA 2J6TA 1FNUA 3UPQA 2VNUD 5C5MA 1SMXA 5GROA 1YIJA 1M1KC 4Y2TA 2LSSA 4OO1H 3BS5B 1F9PA 1EZ6A 5IY0A 8ICNA 3S1RH 2B29A 2BCRA 1DD2A 5KNIA 1EIFA 2LXKA 3I4LA 3GP7A 4UAWA 4IR1A 4HIMA 4RCNA 3I3CA 3HT3A 1M6YA 3QUQA 2JEGA 4J9PA 1JXEA 2GVAA 1PH8A 5L1JA 1PK1A 2FPKA 2ZTEA 3GTOH 1PDQA 4USAA 2EZYA 1IV8A 5KG0A 1SN8A 2B2WA 5DB7A 1GUSA 3GIMA 3U9OA 5C4HA 5DNFA 1JCKB 2YU9H 5FO8B 4Y52H 4DR2L 4BXOB 1QNKA 4RQ0A 4O0IA 4GNXC 1BBWA 1PVOA 2LYHA 1HQRD 3K75D 4PMCA 5KG1A 5KFDA 2ZXPA 4UW9A 3ULJA 3GQBA 1N5XA 5KFXA 1XPOA 4GLXA 4RHRA 4B6JA 2ZUDA 5JVG3 1BCPC 5J0UA 2A68D 3VR5A 2Q2UA 4X64Q 3Q0AA 3B0XA 5AHXA 4XQ8A 3JPRA 1NZPA 3TQYA 3A5ZB 1UEAB 2BPGA 3IRUA 2PMZE 1J2NA 2K4PA 2W7PA 3I76A 2CW0D 3AU6A 4IUUA 5ALQA 3D4WA 2EZVA 2UXDL 1HIWA 1EY0A 4LF6L 1NR2A 4HSVA 1Z4OA 3L5KA 3SV4A 4QWEA 2HHQA 2HHVA 5DLGA 3BJYA 1N9WA 2ZXHA 3ZYYX 3IAYA 1WYGA 2F0OA 4UP7A 2K01A 4YR0A 1F9SA 4NLBA 3BDPA 2FE9A 1UAPA 3LNNA 4GNXB 2JA6B 3U4VA 1EQTA 3OPOA 3C5GA 2DQNB 2W9AA 1MSHA 3A8IE 2R7ZH 4Y2UA 4UAZA 1N62A 2NVXB 2IX0A 4MIUA 3CC7A 4IQZA 1Z47A 2J6UA 1ZQHA 1ZD4A 3SQIA 1BCPB 3J81c 2OXOA 2GO7A 3KKAA 4RQ2A 4O1NA 1IYVA 3WKAA 5KFAA 1H9SA 5AI9A 3QOLA 2PKEA 3G48A 3HOZH 4JV5L 1NSNS 3F5AA 4PZNA 4O3NA 1JI7A 4YMMA 1TS3A 2WAQE 3VR3A 4I2AA 4O2DA 3TMEA 2HW3A 4FXKC 4AH6A 3HOWH 4CF5A 2PI4A 2H4OA 3NUCA 2ZIVB 3D4DA 1OXSC 3BQ2A 5IILA 1FGBD 2K6AA 3A74A 1JJGA 3QOJA 4KLKA 3PUYA 4KTAA 2CN1A 1QTMA 2FLNA 5KFZA 3TS2A 5AI0A 4NXZA 2E5LL 2TSSA 3MXPA 2FPMA 1B8AA 4F8RA 1XSLA 2IJ0A 5LHY1 4C80A 1BNOA 1PFSA 3RRGA 3M9NB 4QZEA 1I3QH 2VB2X 5CV5A 5KFIA 4HIDA 4QQBX 3T3FA 4DFMA 3G6YA 2B63G 1CKOA 2Q8RE 5ALSA 1JXLA 3CKIB 3L4PA 5KG5A 2LM1A 4BY7G 5JEAG 1HZ9A 1RXVA 3PQIA 2MSNA 2G9HD 2XIDA 1KDHA 4IUPA 3RB6A 4DR4L 2NO5A 1JT8A 5IIIA 4BUGA 2DNEA 3N7PD 3RZDB 4GFJA 1P16A 4DV6L 2Q2TA 2CVRA 4YD1A 4P4PA 3I55A 4DR5L 2UU9L 3S16H 4JMUA 1KN5A 1J2MA 2HHXA 2Q4TA 4J9RA 1IYUA 1XMQQ 4XQJA 4IFDG 4YG2A 3FMCA 4GN4B 8ICXA 2EJMA 2EQYA 1JROA 2KHVA 1BPXA 2QEJC 3NP8A 4X62Q 1RHPA 3GQCA 3H3VH 1HHVA 4JI0L 4IRDA 4ULLA 4F2RA 1XNRQ 1D5ZC 4DV0Q 3HOUG 3HZXA 1SWVA 3JPTA 4QMGA 4DSJA 3FRPB 1KW4A 5E4XA 9ICAA 1LV5A 4XXEA 4DPGA 1OXXK 2DNCA 4KITB 2OYYA 2VA3A 3RLFA 4RPYA 1SFOH 3BVMA 2B2WC 4JVZA 4X65Q 3C21A 4A3KG 1N32Q 1ZEQX 2MHVA 2ODGA 3WKEA 1EFWA 4FP5D 1PZNA 5IYCG 1PYBA 3G7LA 1ZQZA 2FPLA 1X2IA 4RQ8A 2XWBB 1OXUA 2Q8IB 4A76A 4Z6EA 5J2GA 3HW8A 2L5YA 2A19A 1Y88A 2YY6A 1EY8A 1PH1A 1TWCH 5HHHA 2EJFC 4RGMA 3WK7A 2JR5A 3TRZA 3H8JA 5KT6A 7ICJA 4OIKA 3PO2B 2RDFA 1ASYA 3ERQA 5J0XA 4LZDA 1PK1B 4DQPA 3FKIH 5LMUQ 4UASA 4A3MB 1KFTA 1SNQA 5L1KA 1A3UA 2K1BA 4ZKBB 7ICEA 1CKMA 5LL6X 1HQMC 2V4QA 4M04A 3HKZE 3OWEB 4ZH4A 4I2JA 5KFMA 1NOMA 3QNMA 4OJLA 2RBMA 2PNRC 4I2CA 3KOOA 4M9NA 4K2LA 5GADC 5JAVA 1X3GA 4DFKA 2R8GA 5AKGA 1ZQIA 2FMCA 4DF4A 4J15A 1C0AA 1Y69U 3GTPH 5DGBA 2VY3A 1PUZA 1EQQA 1E7ZA 3PO5A 3OHBA 1PRTF 2PZWA 5KFHA 2D2CC 2UUAQ 4HMJA 3P7JA 4TQUS 1ZQPA 3BZCA 5ALLA 2AQ2B 4GN3B 1NR4A 1E0BA 1VQ7A 4E0DA 4RHSA 1JMCA 4HYKA 2F2AB 4L63B 4J9OA 2IOHA 1MQ2A 3K7AH 5D65A 5IGEA 5T14A 1M90C 2H3VA 2F8LA 2R92B 1B1ZA 4DS5A 4KLHA 1V8QA 4KLQA 2IHFA 4RQMA 4PL1A 2WFWA 4Q0FA 2IX3A 1V85A 7ICRA 2VUMH 2RQ5A 8ICPA 1ICFB 1QUQA 5AK3A 1CQFA 2Z1CA 5A2QE 1EFID 1O80A 4P0QA 5KGUA 1ZQFA 2PMZC 2XIWA 4KLIA 2BCVA 3G6JB 1TWGH 9ICCA 3VYTA 4NXML 2BE5C 4LJZC 5K5PA 3CU7A 4RU9A 4ICAA 3HOYB 5J2KA 3C29A 3QR8A 1H9SB 1LTSD 1Q90A 2PI2E 3D31A 5M3FG 4BXXG 4I2HA 1AE2A 5EWEA 5DB9A 1K5OA 5M5XH 1ZOLA 8ICJA 3MA2B 3J81j 2UUBQ 3PUWA 4QZDA 1R9TB 4N9TA 4A3FB 2ISOA 3BJUA 4K8JA 3TFRA 8ICCA 3BZDB 3T53B 3S9WA 5L9XA 3NTKA 3J7AF 3GV6A 3PUVA 5JJIA 2EXZA 3OOCA 1S9FA 1BR9A 3UXOA 1SV0A 4Q8FA 4MTKA 4H7BA 5FLXL 2B2YA 1ZQYA 2P5ZX 2WF6A 3PX4A 1F2MA 2WTFA 4R66A 1HXYD 3QU2A 4XYOA 2PI5A 4YXJA 4YN4A 3MR5A 1ZQQA 5AKHA 2PMZB 5IIFA 2WAQC 3K58A 1RPLA 2RHFA 2R7DA 3ISCA 1LACA 1HJPA 2ID0A 2R8JA 5KFNA 2G5HB 4DUZL 1TIID 3HKZF 4PHPA 3H6MA 5C4XB 3THVA 4DSLA 5C5JA 5BN4A 1HR0W 1U47A 3NENA 1EYGA 4LZGA 3RH5A 4DR3Q 4Y7NB 3S17H 2IHNA 2HHSA 3VA7A 2V9WA 4O5KA 2FINB 1T4GA 3R8BA 4K0KQ 2KJ5A 2BDOA 4DF7A 4DOAA 3F53A 1WCMH 4JI1Q 3SR6A 3TFSA 2B2TA 4Q5VA 1N36Q 1LT5D 3CAMA 2HVIA 1BBUA 3QB3A 1UA1A 4POGA 3QU9A 1MIUA 4TKOB 5DGAA 3S2HB 2RHQB 5C44G 1SE2A 2WAQB 5KFVA 2DUDA 5GAEC 2QDLA 1Q86C 3QU7A 2RDGA 3RUZA 2QB1A 4YXMA 1COKA 2SNMA 3J80E 2HT1A 9ICKA 3V7JA 4MFFA 4YIJA 4R63A 1LTGD 3AFPA 4WFN3 1RZTA 5KFOA 1MA7A 1JN3A 2ES6A 3KHGA 8ICLA 2K03A 5CV6A 4O5CA 2E1EA 1JR0D 9ICEA 4M9LA 1TR5A 4BY1G 1HRJA 3MDCA 1NK8A 2KCNA 2WB1E 3KF8A 1BVSA 3EFXD 1NJWA 4J1MA 5CC4A 3KBBA 3GFKB 5DB6A 3N97B 4QUCA 5ELFA 4OO1I 2K4HA 4DR2Q 4OONA 4TUQA 4FF4A 1EY5A 3TEHB 1CI4A 3IKJA 2K7VA 2KG5A 2LYBA 4NL9A 4F4XA 2KE7A 3KF6A 4ALPA 2OTLA 4XRHA 3E58A 2W3SA 3GTMB 2JSOA 4F8MA 1FJGL 8ICTA 2AQ3B 4IOCA 3D4RA 2KCCA 4KLDA 4HAIA 3GTKH 4DL2A 1GHJA 4EBEA 2EYJA 2YTXA 3CCUA 3S2DH 1JQYD 4DOBA 4TRDA 3W5OA 3AQEA 3WK4A 4R8UA 4EELA 3C2LA 1WTPA 4LF8Q 2UXDQ 3PMFA 4K6DA 4KKSA 1LT3D 3GV8B 5CV7A 1RL2A 3NQTA 2ISPA 2B2UA 2HIVA 1F2ZA 1CEZA 2M9NA 3MDAA 3V2TA 3MGHA 2UVRA 2JRZA 4I7AA 1RCVD 5AFWA 1YNJC 2LXJA 2ASJA 4IZ8A 2VANA 2ASDA 1IBML 2ZTCA 1NY4A 4O3MA 4RQ3A 1VQAA 5IOCA 1N8RC 1ESRA 2EPBA 2XY5A 1FL0A 4KY6A 5DQHA 1SZPA 4K4IA 3GTQB 3E0EA 1Q81C 3QX7A 3S1MH 4EX6A 1O03A 5IT9c 1JIHA 2MUTA 2BCSA 4UB5A 1JB3A 3NTIA 5M3MG 4QWBA 2NRVA 2AWNA 3OIPA 3V72A 4JI5L 7ICPA 1I4XA 1FR3A 2A6EC 2RLTA 5AKKA 1SV0C 1MI2A 3DUZA 2A69C 2E2DC 2B2YC 2E5LQ 1VS0A 1ZQTA 1QUQB 2MO1A 4Z9CB 3EYZA 1AFPA 4P0QB 1X9MA 4I7ZC 2OCEA 4ED6A 7ICSA 2RDJA 2G9DA 4GLVB 3SEBA 2WB1F 3E0FA 2F0VA 2PXIA 5C6AA 5KG2A 4JI7Q 5C0XG 1X9WA 1H9JA 2A1JA 4F5PA 2XICA 4IQTA 5AI4A 4G3IA 1AW7A 2LMRA 1PFNA 1WTWA 3M85A 1TKDA 4PHAA 1SL0A 8ICZA 1VQ5A 3QEBZ 2W9BB 5FP0A 4F50A 2P6RA 3KHLA 1E2WA 2CH4A 2NUCA 4GLAC 1W3SA 5IGGA 3CCQA 5D4BA 1PH3A 3S24A 4DR4Q 4LWCA 5HMMA 4F71A 4BY7H 2R92G 5JEAH 2K32A 3VA5A 2JA9A 4MHVA 4DV6Q 5LMNW 4A3IG 1WWUA 3K1ZA 1A15A 3OSNA 2QF7A 4DR5Q 2UU9Q 4OX9L 2B2TC 2KBNA 1TQOA 2UXCL 5T1IA 2ZJ5A 1YITA 3H0LB 1SV4A 1KFDA 3C5FA 1S5FD 3NGDA 5AIAA 4NMZA 1KTKA 4ACOA 3T51B 4LF4Q 1UPHA 4JI0Q 1PVPA 5KL1B 3RD4A 1J6QA 3PO3B 4IFDH 4O3PA 4L6TB 9ICGA 1G6ZA 2R3ZA 2QB0A 1BNZA 4DCCA 3OSPA 2NBFA 1SNDA 4UAIA 4MFCA 1CFMA 1CI3M 4GKJL 1Q8KA 4HJ8A 1X65A 2K28A 1ZETA 2N88A 5L1LA 1ZD2P 1KDAA 2DFLA 1U5KA 5KG3A 2Y0SE 3RBDA 4UY8C 3SAGA 2OEOA 4LMQD 4A3FG 1I50B 1OTCA 3H3VI 3NE5B 1GKHA 1SAPA 1PH2A 3D2QA 3ORYA 4OJOA 4UAUA 4C4TA 4EBCA 3J80i 5TSSA 1RG6A 4KTQA 2VZAA 1STBA 4HMIA 5DG8A 4TVAB 2J7ZA 1S0MA 2F0GA 3TDQA 1NK5A 2B8FA 2R7FA 4A3KH 4EENA 3MC1A 3PZPA 3PR5B 1PMRA 1JORA 1HFNA 4NL9C 2E75C 5KTQA 1TWFB 5KFUA 4RA8A 5IWAL 4B9XA 1CUKA 1HNWQ 5IYCH 2JA8B 3G4SA 1QSLA 3JAME 3TN2A 1IG6A 3AB9A 1EIYB 1X3QA 4C8LA 3I7FA 3MC0B 4FNFA 3UE0A 4J9LA 1HNXQ 2D8CA 1T94A 3OTQA 5D46A 1Q1BA 1PZJD 5CV8A 2YB1A 1ZQOA 1EQRA 3LYSA 5KFYA 4KLFA 1TVXA 2ZIWA 4CE6A 9ICBA 2I6XA 1JE4A 5I4DA 2B2UC 4UDUC 3MAQA 4RH6A 4PNYA 3SD7A 4JI2Q 3J81L 3KF8B 4OO1J 4GZYC 2Z8LA 3NBHA 2BKEA 2Q2HA 4A3DB 5CEHA 7ICTA 3ND9A 4YR3A 4P0PB 1ENAA 1DGJA 4Y2QA 1OXTA 1RM6C 2JXJA 3IFTA 4ZOHC 1TS2A 5GAHC 5CP2A 2VB3X 4C1NI 3KF6B 3HOVG 4IOAA 1EY7A 4PMWA 4ILWA 3F2BA 9ICHA 9ICNA 5JTIA 4KLLA 4GKKL 3IP4B 2WB1C 4M0AA 1IZ6A 1F44A 4XUSA 4ZK9B 4DGZA 1KC8C 3SMVA 1I6HB 5DDMA 4R8UB 1W6KA 2ICEC 2RSNA 1JOQA 1VQNA 5CMDA 2XGQA 1BO0A 1ZQWA 5ALOA 1QG7A 5ALKA 3S6JA 2JMGA 4BX9C 2KHQA 3PGZA 1B9MA 1GVPA 5D3IB 4IUQA 5ALWA 1J5EQ 4DK6C 5BN3A 4L5SA 3RJIA 4OWWB 2F0EA 1A3TA 2UVVA 4IL6U 1STAA 4I2IA 3ZDDA 1TWAH 1Y8OB 4QZHA 4EYIB 3V7LA 1PH5A 1BUVT 4R4CA 1Z6HA 2G06A 9ICIA 1N34Q 3QG1A 1TKWB 4JCVE 1WUDA 2WB1B 1Q3LA 3UDFA 1CTMA 1RQLA 5I2YA 3NVYA 3NVVA 4C3JG 1STHA 2K5HA 4C4SA 1E2ZA 2YYZA 4OELB 3VCBA 1S5BD 5D3DA 5K36G 2CCZA 2LYAA 5M3FH 3C1EA 4YVZA 2CFMA 3SK5A 1RIPA 4O3SA 4JBWA 4BXXH 2ZIXA 4CKBA 1E3PA 3T79A 2WF8A 7ICGA 1S72A 2BE5D 1ZQAA 3I2ZA 3PW2A 2FMQA 4BBRB 4X66Q 1GUWA 3LK9A 1L2FA 5F9NA 3QYPA 3V6HA 1CQVA 1NCVA 4XT1B 1JOKA 2DPJA 2P35A 1RQNA 4FBUA 4FBTA 3RJKA 4JI3L 2XSCA 4C2MH 3S14H 2OXPA 3SHLA 4DL3A 1V97A 4R9WA 3T16A 3I56A 1PK3A 2A1JB 4YQWA 3MXGA 2NVXH 1E1TA 1STNA 2NRZA 3S1QB 2XRSD 4WJ3B 2HDLA 4OIJA 4IPCA 3UXNA 5KFEA 1G2SA 2MPMA 1ZQUA 1QNUA 4C3IG 4RKLA 1SNOA 4DK1A 2BDPA 4JW0A 4JI6L 5J2JA 4UB4A 1CZGA 2F0FA 3C1YA 1EYAA 1KAWA 1L1OA 2D0OA 3K5OA 3VR4A 3VDYA 2QGQA 3G6XA 3FVQA 1PYSB 5ELBA 4JI8L 1N2XA 2TMPA 5J0YA 1QVCA 3KLWA 5DQIA 1D7QA 5M9OA 4A3EG 1K1SA 3GO5A 1BCPF 3VR2A 1HNZQ 1B3AA 1BXTA 4DNIA 2E2IH 3PMLA 1KXLA 5CA7A 3KYHC 5JU5A 4NB3A 2VXWA 1XS9D 4QNLA 2HI0A 5HHIA 4B3TL 3SVMA 4PPXA 1VQLA 3FC4A 3QWNA 5C44H 4A3JG 2QB0B 2LI6A 3IM1A 2KJXA 4CJ2C 4KLTA 3HFZB 1LKYA 2N1RA 3UMBA 4FS2A 5J0TA 4R8NA 4I65A 5ELOA 3KFUA 3HKZG 4KKTA 3BS7A 2YMMA 4ED7A 3DM3A 1V1OA 2R8KA 3U58A 4UBBA 1PA6A 3SZ2A 3UMGA 1XSNA 4KLOA 1Y1WB 5L1IA 2I5HA 2PO4A 4LAAA 2D6FC 4ZQ3A 4B3MQ 4RQ1A 2XRQD 4HJ7A 1DZ1A 5AM5A 1TAQA 3BQTA 3BQ0A 4BY1H 1K8GA 9ICJA 5AKXA 2I46A 4PG3A 4E6IA 5CBEE 5C3XA 3BDCA 7ICMA 2G5IB 5KG4A 4R64A 3IFDA 5J22A 3JAMi 1EY4A 4DV1Q 3I4MB 4PGYA 2N55A 3OMGA 1RD9D 2EQSA 5ALTA 2LKVA 5F3XB 2KOLA 2Y0SC 2BHNA 1Z1BA 1FJGQ 1UCVA 1HUNA 3CRXA 1K0SA 3QXGA 1D8YA 3DXJC 2WFAA 1LB2B 1PXUA 1T9HA 3LWUA 3EWAA 4KN4C 3T5JA 4O0AA 3M7NA 2ZIWB 5JJZA 1Y1VB 1B70B 2XVSA 4ID6A 4C3HG 1SWWA 4JUZA 3UDIA 4O3RA 3T5HA 3E0JA 2E2HH 3EVQA 1HFGA 2ICIA 4IRKA 1E2VA 5C3WA 2FJ6A 4B9LA 5AM2A 3WDNA 1E22A 4HCEA 3RNUA 2Y9UA 2Y0SB 2E8OA 2AWOA 2F0JA 4OWXB 2H3QA 1EL0A 3A0HU 5ALNA 3NTHA 7ICIA 2JA8G 4HIKA 4CDGA 3UXPA 1Z19A 3EIVA 4X3UA 4AYBC 1RKNA 2GLEA 1QCKA 1XMOQ 1PH7A 1G91A 5KT3A 3MHBA 8ICOA 1VQJA 2F3IA 1QSSA 2VA8A 3SV3A 1K3RA 4M1UB 3TP7A 1YNJD 2NTTA 3TS0A 5CYUA 3NSWA 4ECVA 1R4QB 3L7ZC 4FF1A 4IC9A 1G291 4JI5Q 5KFFA 3GV5B 3AL0B 2HSZA 2EOTA 2D9UA 5M3MH 2H5XA 4ECRA 3MFGA 1YNNC 5EE1A 2DKZA 3M3YH 1D1IA 4LUOA 1ZJNA 3SDZA 3HJEA 4DSFA 1A62A 1A2UA 1SYDA 3RH4A 4X3TA 4LVSA 2Q2IA 5IGFA 2MA1A 1WFQA 3GTLB 1L3VA 4AYBB 1ZYQA 3J7YW 2HHHL 5H2FU 1L0WA 1IYJB 2WINB 1SKRA 2R93B 4PH5A 3MGIA 1E1OA 1HZCA 2A6ED 2LS01 3T13A 3S15H 5C0XH 2A5HA 4DL6A 2A69D 4BBSB 1QZGA 4ODGA 3J80c 2F0TA 1X66A 2Z0SA 5IP9G 3L3OC 2JGAA 4NM2A 3H7IA 1N33L 4KI0A 2MP1A 4PZ6A 2ZIXB 1RYSA 1S3OA 4EGVA 2X6LA 4UP8A 2E74C 1LT6D 1L1OC 3J7A5 1D5XC 4OX9Q 4P4OA 1VQ4A 4M9GA 1QILA 2A6HD 2EYMA 2ATWA 1SYCA 5J2FA 3Q24A 2UXCQ 2R92H 2W54A 2NVTH 4NLKA 4A3IH 1Z3EB 3AN1A 1A6XA 2K52A 3DLLA 3PW7A 3O13A 1I4QA 4RQ4A 1FVIA 4TUPA 1G51A 2QDBA 2Y1JA 2XGTA 1DJRD 2WF9A 4NKLA 2WB1G 5J3BA 1ZD3A 3U26A 4X3KA 5IGCA 5GAGC 1K8AC 4GKJQ 7ICKA 1TS4A 2KHSA 4C56C 1FFUA 5AKJA 1LM0A 4ZKCB 1LABA 1UE5A 4P2HA 5IGDA 4RZRA 1NK7A 5ALFA 3UQ2A 3F8TA 3OIQA 5E7NA 1ILQA 7ICHA 2IT1A 1VQKA 1YI2A 4US9A 7ICVA 1L1OB 4RPZA 4MNOA 1ET6A 4IFDI 1EWIA 1R9TH 5M5YB 2XC9A 4BBRG 9ICQA 3TACB 2MJ8A 2I07B 3WK9A 3PSPA 3CQZB 1EIHA 2RKSA 1X3EA 3WKBA 4RGNA 3CCVA 4UB3A 3I4OA 1GJXA 3NELA 5AM4A 3GILA 4NXNL 3J7ZC 5IWAQ 1PTOF 5TZVA 2W8LA 3C28A 4DQSA 4DF8A 4ZRZA 1T3QA 3RRHA 4NW2A 2W11A 1LKYB 4NWIA 4K5VA 4DL7A 2ZTDA 1KLNA 2H3ZA 2KKVA 5J0SA 2PNHA 2YV5A 5ALYA 4MF8A 4OL7A 2FJ2A 5CR0A 2EXDA 2F1JA 1H9MA 1H9RA 3CRLC 1U45A 5KG6A 1LTLA 2MQHA 3MZ5A 5DEHA 4YCVA 2F0KA 4A3BG 1QSYA 3KJPA 4A93G 2PMZF 4UBCA 1MJCA 5KT7A 3ONNA 1ZD5A 4QWCA 2D3DA 5J0OA 5KFJA 3NS1A 2VQEL 2K33A 4JC0A 3Q8SB 1X32A 2N49A 1ZQVA 3I73A 1N60A 2WHEA 5IT9L 3H91A 3V6JA 4FDBA 4R4TA 1CM9A 3MGVA 4A3GG 2K75A 5KNBA 5C3EG 3R3OA 3HOVH 1A6SA 2V4DA 2XWJB 1HUOA 1KRTA 5KIXA 3OTOQ 4YMNA 4PQXA 3L0OA 4DR6L 5AJ3L 3QZ7A 1EEID 2R8HA 1EOVA 4NPSA 3CCEA 2OTJA 1TY0A 2ES2A 3SE0A 4KKUA 4I2GA 2M9VA 4DV2Q 1G6PA 4QZ8A 2PW5A 2HVHA 5ALRA 2WAQF 1YHQA 4NLGA 5HR6A 3DEEA 3QEAZ 3FM9A 2A74C 1ZQKA 4B3SL 4JYAQ 2OM6A 5ELDA 2RQXA 4EX5A 3I4MG 2ZXOA 4DU9A 3PIO3 4FXGC 5AK4A 1K8OA 4X3SA 3KHRA 4NLNA 2HOQA 2E76C 1Q3UA 5CV4A 4KHPL 5C4JB 1STEA 5CGKA 2FMSA 3H0GG 1QQ6A 2C2DA 4QW9A 2YMLA 1BPYA 1Q12A 2B8GA 1ZRNA 4R65A 3AU2A 2R61A 4RGTA 1DRGA 1WOCA 4F4ZA 3A7LA 1SKWA 1YJ9A 3S1RB 3LX0A 4TURA 3GTGH 1HR0L 3RZOH 4C3JH 3G6VA 3WU2U 1TT2A 8ICMA 5K36H 2NRXA 1XNQL 3PF4A 3GTOB 4JV1A 2UUCL 2L15A 3OMCA 4F93B 7ICLA 5IYDG 1VQGA 2YU9B 3NVZA 4JI3Q 3KKAC 4R8IA 5ALIA 1EY9A 3AMZA 2JP1A 4EX7A 4ECTA 2MNAA 1QH9A 1PTOC 4FFDA 3N28A 2RA4A 1ZQXA 1LUZA 5ALEA 1NNLA 3RF9A 2BPCA 3MTSA 4AQYL 1F2LA 3DEPA 2XY7A 4JI6Q 2A1AA 4F5RA 1RTNA 1XNSA 3JAMc 3FHWA 4C3IH 2KEYA 1U4MA 1WTQA 4YR2A 4JI8Q 2ZG6A 1J97A 2O6KA 4UATA 5KL8B 2IHMA 3M7DA 3PCOB 5DLQE 5EGTA 8ICKA 4OCZA 1G2TA 1VQ6A 2O5IC 3H15A 2F76X 3VYUA 1KIXA 1O7ZA 2EZZA 2DUYA 2EYPA 3A55A 3FP9A 3BZKA 1EU4A 3QZ8A 4A3EH 2BH2A 2AGOA 3NPPA 2EAPA 1PTOB 3EQLC 4FO2A 1MN8A 2C2EA 5JUMA 1LO5D 5JEAJ 1AZPA 2EY2A 3ETLA 4RNMA 2R18A 5KFWA 2ZUBA 4IN3A 5ALMA 4B9MA 4L5QA 4A3JH 3M6ZA 4M6WA 2EJGC 4BBSG 4H13C 4F87A 2Q0ZX 3HOZB 4DQIA 5NUCA 5AI8A 5AI5A 1N56A 1D9DA 4GS3A 1FNVA 4KD4A 3RJGA 2BDUA 2BOSA 2RVLA 2JA6G 3HRDD 2HOIA 3HOWB 3M4OH 4RT3A 5DG7A 1UE1A 4J03A 4IFDJ 2ZXRA 2EDUA 1K83H 4H44C 4I2DA 3PIP3 1VF7A 4HN7A 3PX0A 3TAPA 2F0IA 1L8LA 1GUTA 4ECXA 3IN5A 1JWSD 4KX5A 3U9SA 4UAYA 3NBIA 2A8VA 2DJGC 5J8YA 7ICUA 2E2JH 1UA0A 3X3MA 2B0CA 3CCSA 4MTNA 4CNQA 4LFAQ 2HMXA 3HOXB 4Y2SA 5BR8Q 3WKDA 1A76A 1U48A 1CSQA 4OHJA 3CC2A 1K3BC 1I3QB 2ZJRA 4UP9A 1UHUA 3T1YQ 4H0LC 4EQ5A 3L9AX 1KKXA 1SROA 4DV5L 2AUKA 4UQGA 1DOQA 1JC7A 3DMUA 1H9KA 4KLJA 4IPHA 1B4OA 3GV7B 2ZXIA 1NMGA 1NNXA 9ICSA 9ICLA 1XWEA 4I2EA 3Q22A 1VQ8A 1ENFA 8ICFA 4JV0A 4LFBL 1B50A 1VF5C 1Q82C 1WG8A 3N4MB 4C3HH 1UE6A 3S16B 2OQKA 1WTVA 3GZFA 1TK5A 3HS0C 2H3FA 2LPEA 3MFIA 4X5VA 2LHTA 1EIGA 4JV2A 1K0RA 1M8AA 3AYHB 4MZ9A 2IA6A 1LTTD 4DR1L 3J7AV 1QQ7A 1B9NA 1SL1A 1K28A 2K5VA 3NK9A 4US8A 1TWFH 2PZUA 4YWMA 1YZ7A 5IIMA 2JA8H 2CHBD 4B3RL 3Q23A 1AZQA 3PVXA 2ENBA 1V1QA 2JZBA 3OWFA 4EQOA 4P73A 2LY7A 2VL6A 2BPFA 2CWPA 4KMUA 4DWIA 3FEWX 4QZIA 1F9QA 2KTQA 1AN8A 2NVYH 5LMNL 1X42A 4MHEA 2Y1IA 3G71A 1SFOB 2DY8A 1L7PA 1S76D 4WRDA 4GXKA 5FLMG 3K1RB 1TVAA 3ZDCA 1UWVA 3V96A 3UMCA 1B22A 2M2LA 4PJ0U 3UM9A 3ER0A 1WCLA 3OHXC 3LWLA 1GOZA 1X6OA 2DPIA 3RN2A 1I6VC 1EU3A 4JWMA 1S5CD 4DFPA 1ESFA 5ALPA 5IIKA 3C23A 3ZDEA 5A0LA 4LF6Q 2C22A 3K5NA 1UNSA 4DQQA 1YNND 3Q8LA 2CWAA 3EJIA 2QA4A 2L4NA 4DV3L 1X55A 4XQQA 2VQFQ 1N33Q 1I6HH 4QW8A 1GHKA 1EZ8A 1BCPD 2B63H 4PZOA 3NTUA 5IP9H 3C3LA 4I2BA 1ZQDA 2OF1A 2ZJAA 4KY7A 3B0YA 4A75A 2X69A 4N8X1 2KK0A 5C0XI 1A3VA 1L3TA 4IR9A 5AKLA 1BBXC 4Y2PA 1UQVA 5BPCA 1T5EA 4JV5Q 3OJUA 5M5WH 3PO2G 3ED5A 3M9OB 1II3A 2ALZA 3HEJA 5E79U 3GTPB 2NYZD 4RQ7A 5JRTA 1I4GA 4A3MG 1H95A 4C7YA 3CHBD 3N7RC 2NYVA 2L12A 4RAUC 1JJ2A 5G5GA 2FMPA 1O7LA 3TZDA 1D9FA 1FEZA 4DO9A 5FO9B 4CBVA 2XTIA 2W55A 3BDOA 3S1NH 3K7AB 4M8AA 2XCPA 4MEYA 4M2YA 2IOFA 1SYBA 4A3LH 3URYA 1HA6A 5A2QL 3NEMA 1QJOA 4P4MA 1VDZA 2EIFA 4DA2A 3NQIA 4NXNQ 2VUMB 9ICMA 9ICXA 2DN8A 1IIPA 5J8YC 2WIIB 3JC66 2HDOA 3PV0A 4PL2A 2KNJA 4DV4L 4IALA 2YMQA 1TU2B 4YCWA 3GD7A 4RPXA 1TWGB 3IDWA 4RQNA 4RNNA 1DXSA 2KA7A 2F3VA 3U4ZA 1RDPD 4M6WB 1KLUD 7ICQA 5ALVA 1D5MC 1O7YA 4O42A 4IUVA 4C0ZA 5A35A 1S0OA 1KHIA 1RF2D 2AQ4A 2GA4B 5EPJA 3OJSA 2JEIA 1N63A 3JPPA 1S0VA 4V190 4M9JA 3IL8A 5M5XB 2EYLA 4LF5L 5K4LA 4EVOA 1JX4A 5L37A 3DV9A 5DKWA 3RBEA 5DLFA 2VQEQ 4G57A 4A3BH 4A93H 4R4OA 5J2BA 2UVUA 2F4IA 3KLSA 4K2KA 4OWTB 5F9LA 3A56A 4CKEA 1V9PA 1X9SA 2DGYA 3GTJH 1BPBA 3HOYG 5JJLA 2CPRA 3K80C 1XC9A 5AKZA 4K14A 5AKYA 5CHGA 3G6EA 5HMLA 2F0UA 3GV3A 2FHTA 3JPOA 2F0MA 4DR6Q 3SYZA 3HOUH 1NAPA 4DAMA 1AEXA 5AJ3Q 5C3EH 4A3GH 2JE6I 2KEEA 4UB1A 5E3FA 1Z4NA 2HBLA 1TS5A 2VJ5A 4G7HC 1B2TA 4KMUC 3UI2A 3O0FA 2ESEA 4JPBW 1WD1A 3QU5A 2V1CC 1U49A 2YX8A 1B7YB 5KYIA 1Q7YC 4A3LG 9ICWA 2FXQA 4ED8A 2IWHA 1A0IA 1WCMB 2HHTA 1KLGD 1Q8IA 3BVGA 2N8NA 2DBYA 4Z6CA 1WI5A 5JPNC 3SAFA 4QGUA 3J80L 4KHPQ 1SEBD 1YNXA 4I2FA 3BU2A 2DKXA 2F0NA 4R1JA 4RGOS 5G3LF 5C4XG 3I4MH 2SDFA 4J8QA 4JI4L 2B6GA 2EAMA 3EROA 3HOXG 2C2RA 2F52A 4YMOA 3RLNA 2YTUA 1EWCA 2MUYA 5J0PA 3H0GH 1ZQJA 2B3GA 4RQ5A 5AK5A 2WV6D 2EDGA 3A8KE 4AYBE 2JZBB 3ETRA 4B9WA 2NRWA 5EKLA 1NJXA 4UARA 4EZ6A 2JEBI 4L8JA 1ASZA 1BGXT 5EE9A 1FO4A 1XNQQ 4LFCL 2KSOA 1MQ3A 2UUCQ 3CCJA 5FJ8G 1TK0A 3EN2A 2WAQG 5AIBA 4GN5A 1ZKOA 5BN5A 5J1ZA 5AM3A 4F5NA 3K81C 1SZHA 2NWGA 3A8JE 4FYDA 4RFBA 4DV7L 5KFPA 1WTXA 5IYDH 4J9KA 8ICSA 4YY3L 1SBBB 4CJ1B 1AE3A 3WKCA 3SEIA 5J0QA 4BA1I 1XMQL 1XTCD 2NN6G 1HZAA 5KFGA 4JBMA 1SNCA 2OQ0A 1OXJA 2EANA 4BWJA 4AQYQ 4WORA 2HBJA 2K89A 1WWVA 3TAQA 3GTKB 3CXCA 1ZQCA 2QEXA 3S2DB 2JK8A 2F8KA 2K5NA 5FLXc 4JBKA 1XNRL 4HEDA 4Q45A 2AUJD 2OHFA 2B2VA 4KMOB 5DG9A 3E9IA 3T56B 2Y0SF 4GC6A 2XGPA 4N9PA 4J9MA 3MR2A 1PTOD 4QIWE 1A63A 4NXMQ 1NKCA 4FO6A 3CNHA 5G5HA 1U4BA 1S77D 2E8PA 3K0XA 3SK6A 1NMFA 5C0XJ 2KVMA 1VMCA 2A73B 4X65L 1ZXTA 4DR7L 3HWTA 2HUGA 2W04A 2MUTB 4QZGA 1VQOA 1KNAA 4ZCKA 3FAHA 3RTVA 1B53A 5IP7G 3PX6A 3AM9A 2FMMA 5J2CA 2K04A 2UVWA 1ONLA 3WOFA 4IO9A 1YVCA 4BBSH 2RRDA 3ISDA 2K5WA 1OW5A 3N6RA 1OO9B 2BDNA 2PZTA 5LL6S 4J9NA 5IIJA 1ILPA 3A7AB 1J8IA 2D0PA 4Y2RA 1YJWA
chains in the Genus database with same CATH topology
2JA6H 1SRUA 4A3IH 5LMUL 4DUZQ 2CQOA 1K9MC 2VUMH 2K52A 4AIMA 1QUQA 2ALYB 3DLLA 3CMAA 1FVIA 4LF9L 1G51A 2XGTA 1TWGH 4NXML 2WB1G 5J3BA 4A4IA 3S1QH 3CPFA 5GAGC 2F4VL 2PQAA 1X56A 1K8AC 4IPDA 4GKJQ 2PI2E 4X64L 1LM0A 3D31A 5M3FG 1S40A 4BXXG 1Q46A 1UE5A 1AE2A 2UXDQ 3ULLA 5M5XH 2UUBQ 3F8TA 2AHOB 3J81j 5E7NA 1VQKA 2IT1A 3PUWA 1YI2A 1L1OB 2GVBA 4MNOA 2UUAL 3BJUA 4DKAC 1NTGA 3T1HL 4IFDI 3AFQA 2VS1A 4LFBQ 2UXBQ 1EWIA 3GDEA 3PUVA 4RG1A 1R9TH 1X9NA 4BBRG 2IHEA 5JJIA 4A3CG 4YHHQ 3Q8DA 3F1ZA 2R7ZG 1CKNA 3GTQH 1X3EA 4GOPC 3CCVA 1TWHH 3I4OA 1NBWA 1SR3A 3NELA 4NXNL 3J7ZC 1VQPA 5IWAQ 2R7DA 1HJPA 2ID0A 3SGIA 2KCTA 4DUZL 2ZTDA 1JJCB 3HOZG 2JQOA 2Z6KA 5ELNA 2PNHA 2YV5A 3HOWG 2EXDA 1HR0W 1VQIA 3NENA 1Y1WH 4LF7L 1EYGA 4DR3Q 1VQDA 4B3SQ 3M9BA 1LTLA 2MQHA 3S17H 3RZDH 4L5RC 4YCVA 4A3BG 1AH9A 3KJPA 4K0KQ 5LMNQ 4A93G 1MJCA 2VW9A 4JI1Q 1WCMH 2UUBL 1N36Q 3CAMA 1BBUA 4POGA 4GOPB 3PO3G 3U50C 2VQEL 2NZOA 4JC0A 1MIUA 2NN6I 2RHQB 2N49A 4LNQA 5C44G 3E9HA 1HZBA 2DUDA 2MO0A 5FLMH 5GAEC 1Q86C 4FDBA 3PUXA 1HR0Q 4R4TA 4RMFA 2HT1A 3MEFA 4A3GG 2K75A 5C3EG 5HGQA 3HOVH 1IBKL 1WJJA 3OTOQ 1KRTA 1KD1C 3AFPA 2N3SA 3UDGA 4ME3A 1XJVA 3L0OA 3CC4A 1I5FA 3KFUA 4DR6L 5AJ3L 4DUYQ 1PV4A 1IL2A 2OTJA 1EOVA 1Y1VH 4NPSA 1XTDA 3NBHB 3CCEA 2ES2A 3J81i 4BY1G 1IBMQ 2WB1E 4R4QA 4DV2Q 1G6PA 1BVSA 2CKZB 1YHQA 4OO1I 4R4IA 4POFA 4DR2Q 1WCMG 4B3SL 4JYAQ 1MJEA 1LYLA 4OONA 4EX5A 3I4MG 2BA1A 2HIXA 3TEHB 4K0KL 4QY7A 4KHPL 1Q1EA 2D62A 3KF6A 4X62L 4ALPA 2OTLA 3H0GG 3ICEA 1FJGL 1Q12A 1D8LA 4IOCA 1WOCA 1VQFA 3GTKH 3PO2H 1YJ9A 2YTXA 4P72A 3CCUA 4DV0L 3GTGH 4HJAA 1U0LA 3W5OA 1HR0L 2KCMA 5HY6A 3S2DH 4IJHA 4A3MH 4LF8Q 5IE8A 3KDFA 3RZOH 2R6GA 2N78A 4C3JH 4A3DG 3CF5A 3OTOL 1RL2A 2I5LX 2HIVA 3PIOA 1XNQL 1SE8A 1SLJA 1JB7A 3PF4A 4KHZA 2UUCL 2L15A 2MFIA 4P71A 1YHAA 2LXJA 1VQGA 5IYDG 1KQSA 1XPUA 1N32L 1IBML 4DV2L 1VQHA 2ZTCA 1NY4A 2BH8A 4JI3Q 1N8RC 1VQAA 2NVQH 3GTLH 4DV4Q 1FL0A 4JYAL 2KHJA 2MNAA 4PZ7A 2E8GA 2R93H 3PF5A 5IYBG 2KENA 1LUZA 3E0EA 3FKIG 1Q81C 2JA5H 3S1MH 4AQYL 4JI6Q 2A1AA 5IT9c 2I5MX 2NZHA 2JJQA 3JAMc 5M3MG 1TXYA 3FHWA 4LF5Q 4C3IH 2AWNA 3PSIA 4JI8Q 4JI5L 3CD6A 1GO3E 1C7YA 4WJ4A 3PCOB 5DLQE 4LF8L 2E5LQ 1VS0A 1VQ6A 1QUQB 2MO1A 1GD7A 4OXPA 3H15A 4GNXA 1KIXA 3FP9A 2RHSB 3BZKA 3IRBA 2BH2A 4A3EH 1EUJA 2OCEA 4GLVB 4DV5Q 3HOYH 4JI7Q 5C0XG 4QJFA 2PQAB 5JEAJ 4P74A 2Z6KC 3K7UC 1FGUA 2GN5A 1BKBA 4L5QA 1IXRA 4A3JH 1YBYA 1Z9FA 3M85A 2K14A 3CCRA 1QVGA 4BBSG 1PH4A 1VQ5A 2VQFQ 4GLAC 2JEAI 1WYDA 1P8LA 1PH3A 2YTVA 2B63H 3CCQA 1W3SA 4JBJA 4A3FH 4XTCS 1I94L 3S24A 4DR4Q 4GS3A 4LWCA 1PH6A 4BY7H 2R92G 2JA6G 5M5YH 2JA9A 3M4OH 1UE1A 5LMNW 4DV6Q 1YEZA 4DR5Q 4A3IG 1K83H 3CQZH 2UU9Q 4OX9L 4DR1Q 2VUMG 4IFDJ 2KBNA 2UXCL 1CKNB 2ASBA 3MXNB 1YITA 4A3LH 3M4PA 3AQQA 3I4NH 1MKHA 2K4KA 2A8VA 2AMCB 4UPAA 4JI4Q 4LF4Q 4B3RQ 2E2JH 4JI0Q 1J6QA 3CCSA 4HJ5A 4MTNA 4H02A 4LFAQ 1V43A 5BR8Q 5C4XH 1CSQA 4JOIA 3ZJYC 3CC2A 3HOXH 4UP9A 1Q8KA 4YWKA 1X65A 4LW1A 4EQ5A 2ZJRA 3STBD 4HJ8A 1SROA 3T1YQ 4DV5L 4Y7NH 1PH9A 1U5KA 2Y0SE 3PIPA 3A5UA 4JI7L 4DAYB 1VQ9A 2I0QA 4UY8C 4IPHA 4A3FG 4LFCQ 1OTCA 3H3VI 1NMGA 2OWOA 1GKHA 1PH2A 1VQ8A 4LFBL 2UXBL 2VQFL 3J80i 1Q82C 4TVAB 2VZAA 1VQBA 4YHHL 3S2HH 1YHBA 4C3HH 1UE6A 5FJ8H 1VQCA 2OQKA 3L2PA 4DV7Q 4GKKQ 5JJKA 2R7FA 1XPRA 4A3KH 4YY3Q 1K0RA 3AYHB 3CCMA 4MZ9A 3OW2A 4DR1L 1QVFA 5IWAL 1HNWQ 1CUKA 4DV3Q 1UE7A 1NE3A 5IYCH 4BA2I 3WWVA 2ZM6Q 3G4SA 2K5VA 5GQOA 4YWMA 1Y1WG 1TWFH 1EIYB 1YZ7A 2C35B 2K50A 3I7FA 2JA8H 4LF4L 4B3RL 3UE0A 1HNXQ 1V1QA 2JA7H 1Q1BA 4LFAL 4DR3L 4P73A 5BR8L 1EQRA 3KF8B 1S72A 2VL6A 2CWPA 3F2CA 1HNWL 5EAYA 3W1BA 2ZJPA 3CP0A 3T1YL 2NVYH 4JI2Q 5LMNL 4JI1L 3G71A 2Q2HA 1N36L 5FLMG 1OXTA 1HH2P 1UWVA 5H1SE 5C4JH 4WJ3M 5GAHC 4IOAA 3ER0A 3KF6B 3F2DA 3GTMH 4PMWA 1SMXA 5GROA 1X6OA 3HOVG 3F2BA 4DR7Q 3CMEA 1YIJA 1M1KC 3RN2A 2LSSA 4GKKL 1IZ6A 1X3FA 5IY0A 4LF6Q 1Y1VG 2B29A 3S1RH 1KC8C 1W2BA 1EIFA 2LXKA 3B6YA 2CWAA 2QA4A 3KDFB 4DV3L 4DUYL 1X55A 4HIMA 1K73C 1NJIC 1N33Q 1VQNA 1I6HH 3TREA 2GVAA 5IP7H 1VQEA 2ZTEA 4YWLA 3PGZA 1PH8A 1GVPA 3GTOH 5IP9H 2NVTH 4HJ9A 1HNXL 1J5EQ 4DK6C 1SN8A 2Y0SG 2YU9H 4L5SA 4Y52H 3OYYA 4OWWB 4A75A 4DR2L 5C0XI 4GNXC 1BBWA 4LF9Q 1PVOA 1PH5A 1TWAH 4JI2L 1OXVA 1A8VA 4JG2A 4R4CA 4JV5Q 1N34Q 3ULJA 4JCVE 5M5WH 3PO2G 1XPOA 4LUVA 3UDFA 4GLXA 2F4VQ 2HQLA 4A3MG 4X64Q 1H95A 4YCUA 3TQYA 1KRSA 3A5ZB 2K5HA 1JJ2A 2KHIA 2PMZE 1UEBA 2YYZA 3HKSA 5K36G 2CCZA 2UXDL 3KJOA 5M3FH 2CFMA 4BXXH 1RIPA 1X54A 4JBWA 3T1HQ 4LF6L 2XTIA 1N9WA 1E3PA 3S1NH 2VNUD 3I2ZA 4B3TQ 1GM5A 4UP7A 3NEMA 4X66Q 1L2FA 4GNXB 1VQMA 4AYBG 3U4VA 2EIFA 3CPWA 4A3CH 4NXNQ 2R93G 4JI3L 4C2MH 1J5EL 3LGJA 2R7ZH 3JC66 3S14H 3PV0A 2IX0A 3CC7A 4DV4L 1Z47A 3I56A 4YCWA 3GD7A 3J81c 4HIOA 2JA5G 2RCNA 4JOIC 2NVXH 1E1TA 3U4ZA 2IX1A 4IPCA 3A0JA 4LF7Q 4JV5L 3G48A 3HOZH 1N34L 2YTYA 2WAQE 1KHIA 4O2DA 4JI6L 3RN5A 4AH6A 3HOWH 1QZHA 1KAWA 1L1OA 2D0OA 4DK3C 3VDYA 4LF5L 1OXSC 2QGQA 1JJGA 3A74A 1JE5A 1PYSB 4JI8L 4KLKA 4LUZA 3PUYA 1QVCA 3KLWA 2VQEQ 3CW2C 4A3EG 4A3BH 1D7QA 2BA0A 3GO5A 3TS2A 2RF4A 4R4OA 2E5LL 4A93H 1HNZQ 4DNIA 4OWTB 3UDXA 2E2IH 1KXLA 1V9PA 2DGYA 1B8AA 3KYHC 4NB3A 3GTJH 3HOYG 3PO3H 5JJLA 3K80C 4B3TL 4GKJL 4X66L 3G6EA 1VQLA 5C44H 1PFSA 4A3JG 1IBKQ 4X6AH 1I3QH 3HFZB 4QQBX 4HIDA 4DR6Q 2B63G 5ELOA 1CKOA 3HKZG 5AJ3Q 3DM3A 1KL9A 4DAMA 5C3EH 1YZ6A 3HOUH 4A3GH 3U58A 4BY7G 3AEVA 1PA6A 2JE6I 5JEAG 1HZ9A 1I50H 2I5HA 1Y14B 1E24A 4B3MQ 4DR4L 1JT8A 1Q7YC 2V1CC 1B7YB 4HJ7A 2AKWB 4A3LG 1P16A 4DV6L 2Q2TA 2UU9L 1K8GA 2FXQA 3I55A 4PG3A 1A0IA 4DR5L 2ZJQA 4BY1H 3S16H 3STBC 4XIGS 2Q2UA 2N8NA 1WI5A 4L5TA 3JAMi 4QGUA 4DV1Q 4GOPA 1XMQQ 4IFDG 2EQSA 4KHPQ 1YNXA 3BU2A 4R1JA 4GN4B 4X62Q 2IY5B 5C4XG 3I4MH 3H3VH 4JI4L 4PZ8A 4JI0L 1FJGQ 3ERSX 3HOXG 2F52A 1HNZL 2PI2A 3RLNA 1XNRQ 3H0GH 3D0FA 2B3GA 1T9HA 4AYBE 4DV0Q 3W1GA 3HOUG 4O0AA 3M7NA 2JEBI 3M4QA 1ASZA 4DPGA 1OXXK 1B70B 1XNQQ 4LFCL 3RLFA 1SFOH 2UUCQ 3CCJA 5FJ8G 4A3DH 3UDIA 1DGSA 3EN2A 2WAQG 2WP8J 4GN5A 4P75A 4X65Q 4A3KG 2E2HH 1N32Q 3K81C 4B3ML 2HHHQ 1EFWA 3CCLA 3EBEA 4DV7L 3I4NG 5IYCG 3RR5A 1E22A 5IYDH 3RNUA 1PYBA 4YY3L 2AWOA 4OWXB 1AE3A 3ULPA 1OXUA 4A76A 2JA8G 4IPGA 4BA1I 4HIKA 1IBLQ 3EIVA 4DV1L 2A19A 2NN6G 1XMOQ 1HZAA 2ZM6L 1XMQL 1PH1A 1PH7A 4JBMA 1TWCH 2OQ0A 2JA7G 1C9OA 1VQJA 2F3IA 1YJNA