2A19A

Pkr kinase domain- eif2alpha- amp-pnp complex.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
165
Chain Sequence
SSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
total genus 46
structure length 165
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a19A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a19A01
4C2MH 1GM5A 4QY7A 1VQJA 2DUDA 3RLOA 1I5FA 1WCMG 5HGQA 4DV7L 4UP7A 4DR2L 2NVTH 2VUMH 4DR6Q 3KYHC 1K0RA 1S3OA 4DV3L 2MFIA 4X65L 5C3EG 1WOCA 1QVFA 1VQCA 2N49A 1AE2A 3KF6B 2K5VA 4A3MG 4P74A 1E22A 1QVGA 1WCMH 3PUYA 4JI6L 3CXCA 2KCMA 3AQQA 4IOAA 4DPGA 2ZJRA 3KFUA 1KAWA 2ID0A 2ASBA 3HOVH 1CSQA 4EQ5A 3S1RH 1Q8KA 1UE1A 1LYLA 3M85A 5IYBG 3D0FA 1V43A 1SR3A 4DR7Q 2IY5B 1V1QA 4WJ3M 4JOIC 1MIUA 1E3PA 2R7DA 4DV1Q 1N36Q 1NE3A 4A3KG 4DV4L 4A3LH 1CSPA 5IYCH 4DV2Q 4AQYQ 4JI4L 4JI7Q 2JE6I 1HJPA 4MZ9A 5LMUL 4HJ5A 1PH3A 4LFCL 2BH2A 2K75A 1OTCA 4GKKQ 1X3GA 1OXUA 4GS3A 4L5QA 3NBHB 1SMXA 4JI4Q 4JI7L 1VQMA 1Q1EA 1VQ8A 1SN8A 1J5EL 4AYBG 1NBWA 1YVCA 3U50C 5GADC 4DV6Q 2KENA 2PQAA 2LXJA 3E0EA 2JA5H 5LMNW 4A3BG 2UXBQ 4LF7Q 3W5OA 4B3SL 4Y7NH 4JI8L 4Y52H 4X66L 4POFA 4DV6L 3GTJH 4APVA 2E8GA 2JA5G 3OTOL 3CAMA 1XMOQ 4JI2L 3BZKA 3A74A 2RCNA 4DV0Q 4DR3L 4OWTB 1S72A 1K73C 4HIMA 1X6OA 5FLXc 1JB7A 1HR0L 4LF4Q 3CCUA 1L1OA 1VQLA 4UY8C 5JJIA 2D62A 3MXNB 1I94Q 4QJFA 4C3HH 4DR4L 2R92H 1A63A 1K8AC 2VNUD 3FKIG 4IOCA 1XTDA 1KXLA 4X62Q 2GVBA 1GD7A 4DAMA 1PH2A 3CP0A 1HR0Q 1C7YA 4JYAQ 4KLKA 4R4IA 3FKIH 4GLXA 2R7FA 5J3BA 4IPCA 4L5RC 2UUBL 3K81C 3PUWA 3Q8DA 2KHIA 4LNQA 4O0AA 4A4IA 1T9HA 3S24A 2K52A 2OCEA 3S1MH 3GTKH 5C4XH 4NXML 2K14A 3G4SA 5M3MH 2OWOA 1U0LA 3G6EA 2MNAA 4QQBX 1VQKA 1BKBA 4A3MH 2E2IH 4NXNL 1CKNB 1OXSC 3CCRA 5JJKA 4K0KQ 1IBKL 2AMCB 4UP8A 1EUJA 2PMZE 1XNRL 1OXVA 1SRUA 3L0OA 3RN2A 1X55A 1SE8A 5LMNL 3IRBA 4L5TA 5FLMG 4AH6A 1PV4A 1NTGA 4OO1G 1N34Q 2IX0A 1Y1VG 1XNRQ 4JI0L 4EX5A 1TWFH 2RF4A 4DUYQ 4OWWB 4BA1I 1HNZL 4K0KL 3RZDH 3CQZH 1UWVA 1YZ6A 3RLFA 1PYBA 4A3BH 3UE0A 1XNQL 3D31A 1VQ6A 4GNXC 4A93H 4GKJQ 1OXXK 1PH7A 1NJIC 5H1SE 2V1CC 2C35B 3KF6A 4C3JH 3HOWH 4A3GG 3GTQH 4JV5L 4BY1G 3W1GA 5GAGC 4DAYB 4GKKL 5DLQE 1A0IA 4GKJL 4XIGS 2UU9Q 2ATWA 2I5HA 3VDYA 4A3JG 1L1OC 1Q12A 2Y0SE 4GOPB 4A3KH 3HOXG 1VQ5A 3K7UC 5GAHC 3NELA 2UXDQ 4YY3Q 1W3SA 4AIMA 4A3DG 1IBLQ 1YHBA 4LUZA 3H3VH 1KD1C 4GLAC 4X64Q 1WFQA 1PH5A 1HNXQ 5GQOA 4DR5Q 2JA9A 3ULPA 4XTCS 1VQBA 2IX1A 1U5KA 1N32L 4QGUA 1IBLL 5IP7G 4TVAB 2VQEQ 1N33L 1XMQL 4LFAL 2E5LL 3HOWG 4JCVE 3T1YL 1CKMA 1YJNA 4KI0A 3CCLA 1NMGA 3KOJA 4GN3B 3GTGH 3STBD 2IT1A 4KHZA 1RIPA 4OXPA 1L2FA 4GN5A 2JA8H 3PSIA 2NVQH 1FVIA 2VQFQ 3S16H 1A62A 1NMFA 2R6GA 3J7A5 4A3DH 4GN4B 1B70B 2CKZB 4JOIA 1JJ2A 3PO2H 4HJ8A 5AJ3Q 1FJGQ 3ZJYC 1XPUA 4GNXA 2UXCQ 3I4MH 1YEZA 1YJWA 4OONA 2R7ZH 3CCMA 4QIWE 1L1OB 2D0OA 4DUYL 4GOPC 1EIYB 1FJGL 1JJGA 5M5WH 3T1YQ 4JI5Q 1K3RA 4A3IH 1B8AA 3TS2A 3UDFA 4A3FH 1EFWA 1KC8C 2Q2TA 3KDFA 3PUVA 4PG3A 3TRZA 2I5MX 4LWCA 2WP8J 4JI5L 5M5YH 3HOYH 4BXXH 1UEBA 1KL9A 2IHEA 4YCUA 5BR8Q 3F2CA 3GTPH 4A3JH 3AEVA 1HZBA 5IP9H 4JI0Q 4FDBA 4OX9L 1VQEA 1G291 2GVAA 4JI1Q 3UDIA 3PO2G 5IE8A 4BY7H 2AWOA 2UXDL 2VZAA 3CMAA 1W2BA 2YYZA 1VS0A 3KLWA 3H0GH 5BR8L 3RNUA 1YI2A 1UE7A 1TWCH 1P16A 2UUCQ 2YTVA 5C44H 3PUZA 4R4QA 3AFPA 4B3MQ 4LF9Q 1VCIA 4X64L 1TXYA 2LXKA 3L2PA 3SGIA 3RN5A 2N78A 1N8RC 1KHIA 4A3LG 3H0GG 4JV5Q 3HKZE 4JI6Q 2JEAI 3I4OA 1EOVA 4OO1I 1D8LA 4PZ7A 4R4TA 4PMWA 4DK3C 2Y0SG 4JI8Q 1EIFA 3CCSA 2QGQA 3KDFB 4DR7L 1I50H 1VQOA 2DGYA 3FP9A 2CFMA 4RMFA 5JEAG 2A19A 2AKWB 1RL2A 5C3EH 3DLLA 2B63H 1PH1A 3PO3G 4O2DA 4DR1Q 2KBNA 4GNXB 4HIOA 1WI5A 2UUAQ 1TWAH 4B3TL 2WFWA 3J80i 2JA6G 3NENA 1Z47A 3STBC 4DR4Q 5LMUQ 2B3GA 3I4NH 3M3YH 3I55A 3PUXA 1HH2P 1VQ9A 5IWAQ 2R7ZG 2ZTEA 4YHHQ 1HR0W 3S1NH 2UUAL 4B3TQ 1H95A 1J5EQ 4A3CH 4JYAL 4J15A 4A3IG 1J6QA 1GKHA 3G48A 3M4PA 3J81i 2K5HA 2HHHQ 4KHPL 1FL0A 2NN6G 1EWIA 1XPRA 3RZOH 4LFCQ 1I94L 4X66Q 1YIJA 5JJLA 4NB3A 4HJAA 1MJEA 3HOUH 1GVPA 1HZAA 2R93G 4HJ7A 1YBYA 1P8LA 3TEHB 3PIPA 2Z6KA 4LF5L 3GTMH 4HJ9A 1HZCA 4ME3A 1VQGA 3HKZG 4LFBQ 4LF8L 3K80C 2R93H 4DV3Q 4PZ6A 4YHHL 1VQAA 3J81c 4BBSG 4X6AH 4IPHA 1IYJB 5ELOA 3T1HQ 5K36G 2NN6I 2UXCL 1JJCB 1HNWL 4BBRH 4X62L 5AJ3L 2A1AA 3I2ZA 4IFDJ 1Y1WG 2JEBI 2VL6A 3NEMA 1QUQA 2E5LQ 3S14H 3PV0A 1X65A 1XNQQ 1A8VA 4YCVA 3CC4A 2A8VA 4R1JA 2UUBQ 3HOUG 1G51A 3CPWA 1IBMQ 4JBJA 3CCQA 1QVCA 2KCTA 3A5ZB 4DUZL 4IFDI 3F2DA 3TS0A 4LFBL 2JK8A 1EQRA 4P73A 3F2BA 3M9BA 2NVXH 4JI3L 4NPSA 4HIKA 1V9PA 4LF6Q 1R9TH 1IZ6A 3GO5A 4YWKA 1PFSA 3LGJA 4X65Q 1Q82C 3S17H 4BBSH 1VQFA 2NZHA 3H15A 3CMEA 3M4QA 2Z0SA 4YWMA 2WAQG 3JAMc 1E1TA 4A3GH 5M3MG 5IYDG 3CD6A 1Y1WH 1VQNA 4L5SA 5GROA 3K0XA 2R92G 3HOZG 1PH8A 1WYDA 1KRTA 3WWVA 2ZJPA 2B63G 3L7ZC 1QUQB 3ULJA 2ES2A 4DR6L 4AYBE 2CQOA 3F1ZA 1VQDA 4DV4Q 1DGSA 1YNXA 1Y14B 3TQYA 4DV0L 4DR3Q 4DV1L 2ALYB 3OW2A 5JEAJ 4R4CA 2I0QA 3PGZA 1TWGH 2Z6KC 2OQ0A 1TWHH 1S40A 1Q81C 4TQUS 4WJ4A 1HZ9A 4R4OA 4B3SQ 2BA0A 4MTNA 4P72A 4C3IH 3J7ZC 3JAMi 4LF8Q 5M3FH 2EQSA 2CCZA 2HT1A 2ZJQA 4A76A 5C0XJ 4IJHA 3PCOB 4DKAC 3OTOQ 1X9NA 1E7ZA 5LMNQ 3ERSX 2NZOA 5IWAL 2I5LX 1PH6A 3PF4A 1HNWQ 1G6PA 1BBWA 1Z9FA 2VW9A 5FJ8H 2JQOA 3G71A 2JA8G 1N32Q 3AFQA 4DV5Q 1HNZQ 3KJOA 1VQHA 1Y1VH 3BZCA 3CCEA 2HHHL 1WJJA 4KHPQ 4PZ8A 4LUOA 1JT8A 2MO1A 3S1QH 4GLVB 3S2DH 1XMOL 1YJ9A 2AWNA 3CW2C 1LUZA 3DM3A 1OXTA 4YWLA 2F3IA 1GO3E 1YITA 1BVSA 4JBWA 4DV5L 1KIXA 2JJQA 3T1HL 4DK6C 1M1KC 3TREA 4A3EG 4IJLA 4UP9A 1E1OA 4P75A 3RLNA 2VS1A 3ULLA 4JI3Q 4LF6L 1PHJA 2K50A 2MQHA 5IYCG 1SLJA 4A3FG 5EAYA 1N34L 1YHQA 1ASZA 2OQKA 3M7NA 2BH8A 1IXRA 1CUKA 2OTLA 2K5NA 4IPGA 1D7QA 4OX9Q 1LM0A 3U4VA 5IYDH 1IBML 4A93G 3A0JA 2N3SA 2GN5A 1KRSA 2WB1E 1X54A 1M90C 1K8GA 1C9OA 2XTIA 1X56A 3U58A 2RHQB 1PVOA 1JMCA 1XJVA 2HQLA 2PI2E 3U4ZA 1NY4A 4LF5Q 5FLMH 4BY7G 4NXMQ 1EQQA 2JA6H 3F8TA 3PO3H 3CC7A 3K7AH 3HOXH 2YTYA 3I7FA 4P71A 5IP7H 2UUCL 4DUZQ 4A3EH 1IBKQ 3M4OH 1AH9A 5C0XG 4DV7Q 4DR2Q 5M5XH 4NXNQ 2N8NA 1VQPA 1Q7YC 1SROA 3KJPA 3UDXA 1PH4A 3ICEA 3OYYA 4B3RQ 5C4XG 2E2JH 2YV5A 4MNOA 2ZM6Q 1KQSA 1UE5A 2Q2IA 3J80c 4POGA 1Q46A 4A3CG 3GD7A 1X3FA 2Q2UA 1JE5A 1PYSB 3KF8B 3HOYG 4BXXG 2E2HH 4YCWA 4JBMA 5FJ8G 2CWPA 4BA2I 3RR5A 2QA4A 2VUMG 3EBEA 1XPOA 2KHJA 1VQ4A 3FHWA 1YHAA 3EN2A 3AYHB 1LTLA 4JI1L 1K83H 5GAEC 1I6HH 1N36L 2JA7H 2EXDA 1UE6A 3MEFA 5M3FG 3I4NG 2D0PA 2MO0A 3CCVA 1B7YB 5C44G 4RG1A 4B3ML 2PNHA 3HOVG 2WB1G 3HKSA 2JA7G 3I4MG 3J81j 1PA6A 1ASYA 2YU9H 2FXQA 2PQAB 3PIOA 2K4KA 2IHFA 4JI2Q 4DR1L 2ZTCA 3I56A 5IT9c 4BBRG 4GOPA 5C0XI 3UDGA 1X3EA 4JG2A 2B29A 2QEXA 4A75A 4DNIA 2BA1A 4JC0A 3A5UA 3PF5A 2UU9L 4LW1A 4LF7L 2LSSA 3UE1A 4LFAQ 3GDEA 3S15H 3HFZB 4QL5A 3S2HH 3H3VI 3E9HA 4IO9A 1K9MC 2EIFA 1E24A 5IYBH 5IP9G 2VY3A 2HIXA 1AE3A 1IL2A 4LF4L 1HNXL 1FGUA 1N9WA 1PH9A 2UXBL 2RHSB 4BY1H 2CWAA 3BU2A 2XGTA 2AHOB 5IY0A 2NVYH 4DV2L 4AQYL 1VQ7A 2Q2HA 2OTJA 2ZTDA 4YY3L 3W1BA 3CPFA 1XMQQ 1Q86C 1QZGA 3GTLH 3ER0A 1YZ7A 1MKHA 4OWXB 1VQIA 3JC66 2HIVA 4HIDA 5C4JH 1C0AA 2F4VL 3HOZH 4H02A 4LUVA 3CF5A 3EIVA 4DR5L 1BBUA 5E7NA 1O7IA 1Q1BA 2H5XA 4ALPA 1CKOA 2WAQE 5ELNA 2VQFL 2VQEL 1N33Q 1MJCA 1SFOH 1CKNA 2F52A 3E9IA 1L0WA 2F4VQ 3GTOH 1QZHA 4IFDG 1I3QH 4LF9L 3CCJA 3CC2A 3K8AA 2YTXA 4UPAA 5HY6A 4IPDA 2ZM6L 1EYGA 4B3RL 3B6YA 4JBKA 2L15A 2PI2A 3BJUA
chains in the Genus database with same CATH superfamily
5J0QA 4XT3B 1K8OA 4QY7A 2PCFB 4DO9A 3Q6SA 2KSOA 3TSSA 4DV7L 4DR2L 4DR6Q 1IW7C 3RH4A 1K0RA 2CN1A 1KDBA 3HRZC 3MXUA 4RGTA 1QVFA 2JV3A 1TVXA 1VQCA 5HR7A 1SV0C 2ZIVA 9ICFA 2K5VA 1S4ZA 3N6RA 1TS4A 1QVGA 4JI6L 1VLBA 2XSCA 4MEXA 4LZGA 3C46A 7ICOA 1RODA 4KLLA 3C2LA 3QU2A 1KABA 1UE1A 1LYLA 2RDFA 4JV1A 1V43A 4QIWC 4DR7Q 2MGSA 3LDAA 2B8FA 4J6HA 3D6WA 5ALWA 2K01A 4ED6A 1MD2D 2DY8A 2WKCA 1HFNA 1PDQA 2PZUA 1ZJNA 3T3FA 1SB3C 1PRTB 1JN3A 2RBMA 5L37A 3OWFA 1IIPA 3LVVA 4DV2Q 4QJFB 4JI7Q 3C1ZA 2JE6I 2C22A 4MZ9A 5LMUL 4LFCL 2MU2A 1MQ2A 5GTIU 3A8JE 2SNMA 1IKLA 4TQRA 4WJ3B 4GKKQ 1MQ3A 4KN7C 4ZRZA 2PXIA 4P0PA 3C1YA 2KFZA 1SMXA 3NWSA 4JI7L 1HCZA 4F93B 1T7PA 2AQ3B 1IM4A 1JWUD 1QQ7A 1F0MA 3U50C 3M6KA 1MN8A 3GIMA 5LMNW 2UXBQ 1UUPA 7ICSA 1J9OA 4B3SL 4Y52H 1S77D 2NTTA 2Z1CA 2E8GA 1NKBA 1RXWA 9ICKA 1ICFB 3I4LA 3OTOL 1XMOQ 5ALOA 3GTPB 1C20A 4TKOB 1S72A 1K73C 5DBAA 2XRSD 4OWTB 4HIMA 1X6OA 3NP8A 2BCUA 2BQ3A 5FLXc 4MN3A 2IOFA 3UXPA 3MGIA 2E5SA 3F53A 5D4BA 2F44A 1ZQBA 4DSIA 5AI0A 2D62A 4NMZA 1KLUD 2VNUD 4TUQA 2F77X 2LM4A 1KXLA 4X62Q 3BYYB 4OO1H 1GD7A 2Z7JA 1TK0A 3WK7A 2XGPA 3AQFA 3CP0A 1PH2A 1K3BC 4ECXA 1X66A 2UVWA 3Q8LA 3FKIH 2HHTA 3T5LA 4CDEC 4IPCA 1KDCA 2BCVA 3K81C 4RT2A 4MIUA 2FPLA 1GUWA 1GHJA 2K52A 1ZQJA 8ICGA 4UARA 1ZYQA 2K14A 2OWOA 4RKLA 5M3MH 1U0LA 3QIAA 2JGAA 2BDPA 4KLTA 3SE0A 4A3BB 1T5XD 3H91A 4I2GA 2PMZC 3CCRA 1L8OA 4P2HA 3IL8A 2G5IB 5ALSA 1IBKL 4K0KQ 2KNJA 1OXVA 4DQRA 1JOKA 1SRUA 4OEMB 3RN2A 5AKIA 1X55A 1I4GA 5LMNL 3IRBA 4L5TA 5FLMG 1V1OA 4UQGA 1PZJD 1Y1VG 2EE1A 4EX5A 3L4PA 2C2RA 3RJGA 1ENFA 2Q4TA 4XDXA 2PFNA 3TP8A 7ICFA 7ICGA 3CQZH 3FPPA 3RAXA 1YZ6A 2KG5A 3C5GA 3TACB 2KJ9A 3D31A 2RVLA 7ICUA 2I1QA 1ZQLA 1JC7A 1Y8NB 5G3LF 1VQ6A 4A93H 2FFKB 2A3VA 1OXXK 2ICEC 5H1SE 1R4QB 4YR2A 2ZIVB 4A3GG 3IP4B 3DWAA 1CEZA 4BY1G 5HURA 5M9OA 2OYYA 3M1YA 3QG1A 4DAYB 5GAGC 4GKKL 1A0IA 3JPPA 1QILA 2WB1F 4PHPA 2I5HA 5JTIA 2MRLA 3N97B 1SYBA 1BNZA 4RNNA 5IIKA 3RJJA 5GAHC 1LABA 2X69A 4KX3A 4YY3Q 4NLKA 4AYBC 3IKJA 3KOOA 3MGHA 1C8CA 4LUZA 1IBLQ 1VDZA 1KD1C 1WFQA 4HSVA 1NKCA 4EZ9A 1JWMD 1SXDA 2WV6D 1IW7D 1VQBA 5E3FA 3MDAA 2F1IA 5KFSA 5IIMA 4J9LA 3X3NA 2WACA 5ALDA 4FBUA 4HMJA 4TVAB 2VQEQ 3FRPB 4YMMA 1Q3UA 5EOZA 5KYIA 1JXEA 3EROA 4ED0A 1CA6A 4LFAL 4YD2A 4Z6EA 5ALZA 4EEKA 4Y2YA 4KI0A 4JUZA 4FF1A 3STBD 2PQEA 3IM1A 1DRGA 1EZ6A 4FVMA 9ICRA 3BQ1A 4GN5A 5DB9A 1H38A 4K14A 2VQFQ 3S16H 1NMFA 3J7A5 2WF7A 3K75D 2CKZB 3GV3A 1DZ1A 1S8OA 1FJGQ 3ZJYC 2UXCQ 3RMHA 5EPJA 1YJWA 1SJHD 3UPQA 5ALFA 1EIYB 3SEIA 4DUYL 2A74C 4GOPC 1FJGL 5M5WH 4A3EB 1PZNA 1T4GA 1B8AA 5DQGA 4FF2A 4X5VA 3TS2A 1U4MA 2Q2TA 3PW7A 3MABA 3KDFA 4PG3A 4DNTB 2KMDA 3TRZA 2I5MX 3PSPA 7ICNA 1RHPA 2EZYA 2ZT9C 5B66U 5M5YH 4C4RA 4B9TA 2JA6B 4BXXH 9ICTA 1KL9A 3AU7A 1TWGB 5BR8Q 1TWHB 4A3JH 3AEVA 5FLXL 5J0RA 2R7ZB 4JWNA 2M00A 3MVVA 1CRXA 1BF4A 2RHFA 4UAWA 3FDSA 2HCFA 3VA7A 1I50B 1VS0A 3RNUA 1HQMC 2HBKA 5KFJA 1UE7A 5LL6X 2BKEA 3A54A 3PUZA 3AFPA 4O1NA 2LXKA 1WTOA 2BQRA 4F2SA 4IQWA 2H3IA 1OW5A 3P7JA 4PZ7A 5C5JA 2PYKA 3UI2A 2L5TA 2JH1A 1FD7D 2QGQA 4NWIA 3S2HH 3H8MA 5EKIA 2CFMA 2KUMA 5C3EH 2A19A 2AKWB 4I2CA 1RL2A 2K5WA 1STHA 1S10A 1JB3A 1PFBA 2NTSA 2HHSA 2KBNA 4GNXB 2WTFA 1WI5A 3G6VA 4B3TL 3J80i 1N5WA 3NENA 4RCNA 4F87A 1NJWA 4NDXA 4DAYA 5KNCA 1HH2P 1J2NA 1VQ9A 4HAIA 2YTUA 2UUAL 1L3VA 2W9CB 1J5EQ 2DPIA 1ONLA 2B63B 2P5ZX 3J81i 3AU6A 8ICIA 2MSNA 5T1IA 4M6WB 2ZXIA 5DQHA 2NN6G 3NTKA 4CNQA 4YD1A 1Z19A 1XPRA 4LFCQ 4K8IA 1YIJA 3RZOH 5JJLA 1IYUA 5JRTA 1HZAA 5J0YA 2NRWA 3V72A 3TZUA 1SNMA 1V38A 4RUCA 2K04A 2LPEA 5J0WA 1XSLA 3TEHB 4IUUA 2JA5B 4P0QA 1BCPD 1HZCA 4ME3A 2MUTB 4PMBA 4WJWA 3H94A 4LF8L 2BZFA 2EJGC 3GTJB 3C2MA 2R8GA 3P20A 4CF4A 4DS4A 2E2JB 4CKBA 4IPHA 1IYJB 5K36G 5D3IB 2NN6I 3T5HA 2UXCL 4BBRH 2F0NA 2E5LQ 5KFNA 1SKSA 3NEMA 3Q8PB 2DNEA 3S17B 4R66A 1DK3A 1QSSA 2FLLA 3CC4A 1Y88A 5I9PA 1LVHA 1G51A 5DKWA 3I72A 3NVVA 2KSOB 3CPWA 1IBMQ 1EZ8A 3A5ZB 1TAMA 2JK8A 2RCFA 3GTGB 3MR6A 1RYSA 2PFPA 1BCPB 7ICKA 3AL0B 2NVXH 1STNA 4JI3L 4HIKA 4CDCC 5EE1A 1IZ6A 4C8NA 2R8HA 3IDWA 3GIKA 1T8EA 2NZHA 3U9SA 4ECZA 4FZNA 4UB4A 3UMGA 1KLGD 1PLFA 3JAMc 2JR5A 5A2QE 4A3GH 4IUVA 2ZXPA 5KFZA 1VQNA 3SEBA 5KRUA 4F7XA 4DL2A 2DQNB 5IGCA 4EENA 1PH8A 2WFAA 4FE3A 1D7QA 3BDOA 4A3IB 2QEJC 4KN4C 3B9JA 2J6UA 2O5JC 4OO1J 4V0BA 2O5IC 2RLTA 4X3TA 4RQ1A 3GZFA 9ICOA 1VQDA 4A3KB 1DGSA 4DV0L 4DR3Q 4CJ2C 1HR0Q 4ZAIA 2JA6H 8ICSA 4F92B 1EQVA 2I0QA 1TWGH 1Q81C 2OQ0A 1S40A 2W8LA 4ECQA 1S76D 2FINB 2LI6A 3PX4A 2R61A 3I73A 4F2RA 5ALTA 2OXPA 4PZOA 4M9JA 2BA0A 1N63A 4MTNA 5J22A 3HOWB 2KZZA 2MAXA 2ZJQA 4GC6A 2M9NA 1N61A 5CR0A 4J8QA 4DKAC 4DFPA 5AM4A 1CI3M 4RQ2A 3R2TA 2KTQA 1G6PA 2DWQA 1PH6A 2EVBA 2IMWP 2W55A 5ALEA 2K60A 5AIAA 2VW9A 4Q8FA 3IG8A 5FJ8H 1N32Q 4KJOA 2YN4A 3KJOA 1RDFA 1XSPA 1JT8A 3S1QH 1EY0A 4KX5A 3S2DH 1KBUA 2DKXA 1YJ9A 4F3OA 1X32A 2XC9A 1PTOH 3DM3A 2R92B 5ALMA 1HQRD 4YWLA 5CBEE 3L3FX 4TUSA 1A0PA 3F5AA 1YITA 4JBWA 2HD3A 4DV5L 3OWEB 3V6KA 5KFYA 4PJ0U 3HP6A 4GFJA 4P75A 3HPOA 4YXJA 2C2DA 4LF6L 2MQHA 4HCEA 3QU7A 4BJQA 5DQIA 1D1IA 5IYCG 2VUMB 3N7RC 1YHQA 1ZQFA 4C8OA 3M7NA 2BH8A 2M9VA 2QW7A 3KBXA 2L11A 5CP2A 1IBML 1YT3A 4R65A 2QDLA 3A0JA 5J2HA 2N3SA 4A93G 2E75C 1KRSA 2WB1E 1X54A 3E5SA 3VR3A 1K8GA 2XTIA 1X56A 5C44B 2RHQB 3W3AA 3S1RB 3WKAA 3D4RA 4LF5Q 2AQ0A 5FLMH 1TFRA 1EQQA 3I4MB 3KTQA 3F8TA 4YXMA 4QW8A 3FPUB 4E0DA 4NKLA 4PV1C 3DDHA 5IP7H 2K5QA 2BQUA 3L5KA 1TK5A 4R8IA 4DV7Q 4DR2Q 2JZBA 2BE5D 2FLNA 3S2HB 5AFWA 1SROA 2HBLA 2K33A 2QKIC 3BS5B 5CGKA 1SKRA 3I91A 1PH4A 4UB5A 2G5HB 3QOLA 4PGQA 1QH9A 4B3RQ 2ZIXA 2E2JH 4POGA 4MNOA 2ZJAA 2QARB 1NJXA 1TWAB 4J1MA 5IGEA 1KQSA 2GA4B 4F5OA 2P6UA 4BWMA 1N56A 3MXPA 4J9MA 3WDNA 3EBEA 4DS5A 1S0MA 9ICEA 2KHJA 1GO3F 3FHWA 4NP5A 3H0GB 1LTLA 5GAEC 1ZQDA 2E2DC 1JALA 4CGYB 2EXDA 2SNSA 2B21A 1X2IA 4C3IG 5KAIU 3A7LA 3LWEA 5M3FG 3NPPA 4J9RA 1KAAA 1Y8OB 2MO0A 5KG2A 4ED1A 4BXOB 3H8WA 4QCLA 4KLQA 1ET6A 4M47A 3K5MA 1S0OA 2FXQA 2K4KA 4JI2Q 5C4ZA 1TK8A 4GOPA 1HUOA 5C0XI 3OSOA 3UDGA 5DGBA 3E0FA 1LB2B 4KLEA 1L7MA 1NCVA 4BY1B 2B29A 4XUSA 4X3KA 4I7ZC 5DG8A 2L55A 4JV2A 4JC0A 3PF5A 4UB8U 1ZRNA 4USAA 3PY8A 2SOBA 3UE1A 2HCIA 3GDEA 5ISRA 1U4PA 3HFZB 4QL5A 4KMUA 4RGMA 4IUQA 4ZUJA 3N7PD 5KG7A 5C4JB 3FC4A 3BVGA 3JPNA 3W2DA 3KHRA 2EY1A 2HIXA 1AE3A 4LF4L 1N2XA 3PW0A 1FGUA 1LO5D 1N9WA 1PH9A 4FXDA 1S5BD 2CWAA 5EQ0A 2XGTA 4DV2L 3H40A 1KNAA 2KOLA 3MR2A 3V6JA 9ICXA 2Q2HA 4UAZA 5KFBA 9ICBA 4GIBA 4F91B 4JMUA 1C48A 1AN8A 2KHVA 1EWCA 2Z9HA 5AK6A 3GTLH 1A6XA 1B4OA 2Q8RE 5HHHA 3BZDB 1EQTA 2F4VL 4J9KA 4H02A 3EIVA 3PIP3 4JK1C 2W04A 4ALPA 4K5WA 4OJLA 1F2LA 3I76A 2WAQE 2HI0A 5ELNA 1Y1WB 1N33Q 1PK1A 4NLNA 1SFOH 2O2LD 1L0WA 3E9IA 1DXMA 3S1QB 1L6NA 2ENBA 5ELBA 2ZIWB 4I2JA 4F4YA 4IUTA 1PYWD 5J2FA 2ZM6L 1KDHA 1ZQEA 4A3KH 4IUNA 2PI2A 3C1EA 4JV0A 4C4TA 2WB1B 3Q24A 1GM5A 1VQJA 2DUDA 1I5FA 5KFGA 1EU4A 4UP7A 2K1BA 2VUMH 3KYHC 2K4IA 2D5DA 3FAHA 1RG6A 1S3OA 1PMRA 5I4DA 4X65L 4FO2A 4CKCA 5C3EG 4DV3L 1XWLA 4O9MA 1AE2A 1LT3D 1WCMH 2GO7A 2NUCA 3CXCA 3QEAZ 2KCMA 5ALYA 2ZJRA 8ICUA 4J9QA 2ID0A 2K32A 3HOVH 2OXOA 3S1RH 1XS9D 4RAUC 2KEDA 3M85A 5IYBG 5JUMA 3BDCA 5E1FA 3HJEA 1GJXA 2WB1C 4RT3A 4WJ3M 2AJQA 4JOIC 3PZPA 4J9OA 1U9LA 2C28A 1NE3A 4B08A 4HSPA 3N52A 4RQ0A 2JA8B 2CW0D 1SSOA 2JMGA 4JI4L 2JZBB 1O7YA 1STYA 5FLXE 1TS5A 3I8ZA 5KT4A 1PH3A 5FO9B 1I4QA 2K75A 2EAMA 3TP7A 1X3GA 2EYLA 5JPMC 5TZVA 3KHHA 3RB0A 2KHQA 1Q1EA 3GV5B 2CH4W 1SN8A 5TSSA 3UM9A 1F9PA 2RQ5A 3D2QA 2D2CC 5GADC 1QQ5A 4CE6A 1BNPA 3RD4A 2LXJA 3GTMB 4A3BG 2PMZF 4LF7Q 3W5OA 4DCCA 2E74C 5AICA 4Y7NH 2R93B 1G8ZD 1SEBD 4X66L 4DV6L 4APVA 2NZ1D 3SYZA 4EQNA 3CAMA 3BZKA 5HHIA 3ISDA 1M8AA 3EZ5A 4A3JB 4BWGB 3HG9A 1AFPA 3N7SC 1L1OA 1M4VA 1X6IA 3THVA 4MF2A 1ESRA 2Y9UA 5T1GA 1AZPA 3S1NB 5KG3A 4QJFA 4DR4L 2NRVA 4UAVA 5DG9A 4RPYA 3FKIG 2FPMA 4F4XA 2KQ3A 1XTDA 3WU2U 2Y9TA 2PI5A 2K03A 1TR5A 2O6KA 3IG5A 1ZEQX 4DAMA 4YMOA 5A2QL 1C7YA 2V9WA 1LTTD 2YX8A 1LT6D 4KLKA 4DL4A 4DQPA 1V1PA 2KIVA 4L5RC 2UUBL 4YN4A 4X3SA 4LNQA 3PR4A 4IR9A 1ZXTA 3GV7B 4O0AA 3A0HU 4A4IA 1I4PA 1RXVA 3GTKH 4NXML 3CRKC 2DUYA 2EYFA 1EY4A 1MSWD 1EYDA 2Q8TA 4DOAA 3LWUA 8ICWA 1CKNB 1HTPA 1L0XB 1XYIA 2AMCB 3RTVA 2PZWA 4UP8A 1RQLA 3L0OA 1RTNA 3F5EA 2IOHA 1ZOLA 4OL7A 1KDAA 4AH6A 4LJXA 1H9SB 1XNRQ 5CV8A 4OWWB 2RF4A 4CHTB 3M8RA 1F44A 3WK6A 3BYTB 5FOBB 3RLFA 1PYBA 3UE0A 2LBOA 2ICIA 3JPQA 1QTMA 3RAQA 3OSPA 2HDOA 1DK2A 3H0MB 2V1CC 5AIBA 4JV5L 3X3MA 5CJ7A 1BPEA 3AMZA 1LTRD 4XQ8A 4DL7A 3W1GA 1ZQWA 1PTOF 2PZTA 4Y2QA 5DLQE 3EPIA 4OELB 2UU9Q 3BDLA 1Q12A 1TWFB 2EY2A 2JXMB 7ICPA 2F0EA 2Y0SE 1DOKA 4GOPB 3R8BA 4QZDA 1MSHA 2UXDQ 3BVMA 3KUPA 1CTMA 3KD3A 3LK9A 2H3ZA 4RCOA 4A3DG 4IQTA 5D14A 4FXGC 3H3VH 5AKHA 1Z7TA 4GLAC 1NK9A 4Z9CB 4BBRB 3WKBA 1E2ZA 1RM6C 5GQOA 4DR5Q 2IX1A 4XTCS 3ALRA 3A7AB 4E6IA 2EJMA 4K8JA 5IP7G 2A1JA 1N33L 4C8KA 1XMQL 4I27A 3SAFA 3PO5A 3HOWG 3NUQA 4JCVE 3CRXA 3T1YL 1NMGA 4GN3B 4G7ZC 3GTGH 5BOMA 1SZHA 5KFAA 3OHXC 3R9KA 4RQNA 4KLJA 2JA8H 3DEEA 1O80A 1RYUA 5KG5A 4M9NA 3SI8A 1TS3A 4US8A 2M2LA 4X3UA 1BQQT 3CNHA 4JWMA 4CJ1B 4GN4B 4JOIA 3EUB2 4QWAA 3NVWA 1EWHA 2XN9C 4GXKA 3K4GA 1IHZA 4GNXA 1XPUA 3L9AX 2F3NA 1YEZA 1URJA 1SWWA 4OONA 2R7ZH 2R8KA 4QIWE 2YQEA 3VC8A 2D0OA 1UAPA 3C29A 4A3IH 4CF5A 1STGA 1WCMB 4KK7A 3UDFA 4A3FH 1EFWA 4QMGA 1KC8C 4UB1A 4M1UB 1ZD2P 3RB6A 4JI5L 1ESFA 1YNJC 2JSOA 1UEBA 4YCUA 4FO6A 2CXYA 3OHAA 3KF8A 1SDFA 1A15A 2RDHA 4N8FA 1BPYA 5IP9H 4JI0Q 1RJTA 9ICAA 5J2AA 1G291 4XYQA 4JI1Q 1WTRA 2ZUBA 3PO2G 1LT5D 2AWOA 2F0TA 1I3QB 4BY7H 1SE3A 2VZAA 3OGUA 1W2BA 3ZD8A 1PRTF 2ZXRA 2UUCQ 1SJED 2YTVA 4ICAA 4R4QA 1TKWB 4B3MQ 1VCIA 5ALXA 1Y8PB 2G9HD 3L2PA 1MI2A 2IW3A 4EELA 3H0GG 1BOSA 2Q0ZX 1FEZA 1X9XA 2P35A 2PFOA 1LV9A 1S9FA 9ICNA 2WHEA 3KKAC 1CZGA 4OO1I 1D8LA 5JOBA 4R4TA 3I4NB 2LYBA 4PMWA 1PK3A 1SIJA 2Y0SG 3S1MB 2OM6A 1W6KA 3KDFB 1WTPA 4DR7L 3FP9A 4RMFA 3E3XA 4Y7NB 4U7CA 5FO8B 2B63H 2XRQD 3PO3G 1QSYA 1BPBA 1L5UA 4O2DA 1S5CD 2EYOA 3NASA 2TMPA 1TQOA 3SK6A 2FJ6A 5CRXA 1SV0A 4HN7A 2WFWA 4NLCA 8ICXA 3S15B 1BCPF 5E79U 4I2EA 4DL3A 2ZTEA 8ICAA 4KY7A 2XY6A 7ICVA 2NV3A 4DWIA 3B0YA 3URYA 1HR0W 4Y2TA 4A3CH 1XC9A 4J15A 2GH1A 1LTAD 2JA7B 1PVPA 2HHHQ 1B4FA 1HUNA 3OSNA 2A69C 2DL0A 1Q90A 2F0MA 3SHLA 3FKIB 1QCBD 2KVSA 9ICWA 5AI6A 4OD0A 3GTQB 3PVXA 1PFMA 3A55A 1TAQA 4L6TB 3NGDA 1ZQVA 2IWHA 3NQTA 2XICA 1GUSA 3PIPA 3J7AF 4RQ7A 1X6JA 4HJ9A 4EYHB 5KFLA 4MFCA 2FJ2A 1FYCA 5K36H 3HKZG 1F5SA 4ECYA 1I4HA 3ITPA 3K80C 4PH5A 2EDGA 4DV3Q 2KZ3A 1VQAA 1N5XA 2YMPA 4Z6CA 3J81c 4X6AH 2A68C 3RH6A 2G9DA 7ICMA 1A6SA 3DM1A 4R64A 1JX4A 1JJCB 2B2TC 3JAME 1HNWL 1SZPA 2V4QA 4X62L 3QNMA 2QILA 1Y1WG 2DBYA 3G6XA 8ICTA 3KLRA 1RF2D 1MSGA 1X65A 3QB3A 3J80E 2Q8IB 4PZNA 4R1JA 3PX6A 1QB5D 1SYDA 3HOUG 5DB8A 3SD7A 4JBJA 1QVCA 2KCTA 4ZUIA 3RR7A 4P73A 3EA6A 2B2UA 3PX0A 2BOSA 2B2VC 1B22A 1ZQQA 5AKKA 2EH9A 4ED2A 2EYMA 4QIWB 3C3LA 3MFGA 4NPSA 4DXGA 1V9PA 1UA0A 5HGTA 4Y2JA 2F1JA 8ICVA 1EY9A 4YWKA 1MBYA 1H9SA 4IL6U 3ND8A 1CHPD 2VB3X 4BBSH 3H15A 3CP8A 4F4WA 2HHXA 4KHVA 5C5MA 1E1TA 1B43A 3RJHA 1WG8A 1TY0A 3MFIA 2P6RA 4I7AA 3CD6A 3C2KA 4BWJA 4L5SA 3HW8A 5GROA 4RQ6A 3SMVA 2L5YA 2B6GA 2K05A 4FF3A 2BPFA 3RRGA 5AM2A 3ULJA 5J2JA 2ATLA 2NN6H 4QW9A 2Y1JA 2KN7A 4DR6L 1X9MA 2CQOA 2K28A 3F1ZA 2XWJB 3TQYA 2KD1A 3OW2A 2ALYB 4QF4A 5JAVA 3Q0AA 2Z6KC 3B0XA 2EANA 4KD4A 1L7OA 3M4YA 1JUDA 4WJ4A 3SR1A 4QZEA 3OOCA 4QZ8A 4A93B 2CHBD 2PKEA 2VJ5A 3VA5A 5ELDA 4P72A 2HT1A 4I2AA 2CCZA 4A76A 1TU2B 3S16B 4US9A 2A73B 2VKQA 1X9NA 1Z6HA 5LMNQ 4TUPA 5IWAL 1COKA 2I5LX 5IGBA 1L0YB 4KTAA 1Z9FA 2ZIXB 1RDPD 3K58A 4PL2A 5JVH3 2JQOA 2JA8G 3EVQA 3AFQA 1PUZA 3SAGA 1R4PB 4EX7A 3VYRA 1E0BA 3CCEA 4RQMA 4ZH4A 2HHHL 1DONA 3SK4A 2WKDA 2MO1A 3DUZA 2RSNA 2AWNA 5M3FB 4C3HB 4JB3A 1SKWA 2F3IA 3LYSA 2EY5A 5KG6A 2LM1A 1NJYA 4DK6C 3T1HL 4Y2PA 5ALVA 3GV8B 3TADC 1E1OA 3CYMA 3ULLA 3MXGA 5KG4A 1PHJA 3PSFA 4YMNA 2RA4A 1SLJA 2JRZA 4OJ5A 5EAYA 4A3FG 1N34L 3V7JA 2OQKA 1CUKA 1K1QA 4CRXA 5J0SA 4DL5A 3U4VA 3SR6A 1MHWC 4FBTA 2F8LA 5M3MB 5IIJA 5AKJA 1M90C 4Q8EA 1BDOA 3EWAA 1C9OA 9ICUA 3ZDBA 3U58A 1JMCA 1XJVA 3PO2B 2E2IB 1B50A 2F0DA 2HQLA 4BY7G 2W7OA 4DA2A 3HZXA 4RNMA 2KK0A 4P71A 3SVMA 4DUZQ 4A3EH 4ED8A 3T79A 3M4OH 1AH9A 2B0CA 5I2YA 4NXNQ 5M5XH 2N8NA 4IC9A 3NTHA 1Q7YC 3CQZB 2L12A 2GLEA 1MC8A 3TAPA 3ICEA 4C7ZA 5J2BA 1CQFA 3LX0A 1ZYRD 3NBHA 3OYYA 4KLDA 2YV5A 3GD7A 4FNFA 1ZXIA 2Q2UA 4HTHA 3HOYG 3VR4A 5C6AA 1WYGA 2W54A 1SGGA 5FJ8G 2DJGC 5DGAA 1LTBD 3T56B 4BA2I 2BDNA 2V4DA 2ZJ8A 1VQ4A 1YHAA 5JU5A 3AYHB 4JI1L 1K83H 4ZQ3A 2A6EC 8ICNA 1UE6A 2VB2X 3PMLA 1QQ6A 3GU3A 2X6LA 1WUDA 2LKVA 1B7YB 2OHFA 2YY6A 4IS7A 1C4QA 1ZQCA 2WB1G 3HKSA 1JOOA 2JA7G 2YMQA 2E1EA 4YR3A 3HT3A 4NLBA 4ELUA 2ZTCA 3I56A 5IILA 4BBRG 1JICA 1VDVA 3FVQA 1SL1A 1OXJA 5L1MA 1QG7A 1ZQKA 4JG2A 3RJKA 2A5HA 4H13C 4F5QA 1JRPA 4V190 5E4XA 3A5UA 2W7PA 4LW1A 5CR3A 3G6JB 4KD3A 3OJUA 3TARA 1Z4OA 2AU0A 1CM9A 1F77A 4RFBA 8ICHA 1K9MC 4KKTA 1E24A 3GTKB 5IP9G 4A3DB 1S5ED 2VY3A 4IFDH 4HYKA 3Q8RB 4KKUA 3AMUA 1HNXL 5BOLA 2AGPA 1G6ZA 2UXBL 2CQAA 1XU4A 1SL2A 2RHSB 2D6FC 3QUBA 5IY0A 2OT2A 1ZD4A 4JK1A 1TV9A 2FLPA 4EX6A 3CPFA 3W1BA 1XMQQ 4Q43A 3H4BA 4RU9A 3GFKB 1Q86C 5C3XA 3HOUB 2HBMA 5H2FU 2PNRC 1D1KA 3JC66 3M9MB 3BS7A 1PVQA 4G57A 5CA7A 1HUMA 4LUVA 1K0SA 4F4KA 2A6ED 1BBUA 1Q1BA 3D3RA 1J8IA 1Z1VA 3V6HA 3QX7A 4IALA 2VQFL 3N28A 2VQEL 5KFKA 1MJCA 5D65A 1ZQUA 2F4VQ 2KJ8A 1H9MA 4WORA 4K4HA 2M0NA 1II3A 2A6HC 5HY6A 3BQ7A 4IPDA 4ULLA 3J80L 4DL6A 4K2KA 2L15A 3HOVB 3BJUA 3KFUF 5KAFU 2ZUCA 1I4RA 1KRPA 2IPKD 4K5XA 2GOLA 4C0ZA 4EZ6A 3JAML 2A68D 5HGQA 1WCMG 1EY7A 3PO4A 2DY7A 1Q8IA 5EE3A 1WOCA 3KF6B 3QUTA 1Q3VA 3H7IA 4A3MG 1E22A 3PQIA 3VYUA 1B2TA 4R8UA 5DLGA 3D4DA 4IOAA 3AQQA 4FYDA 5DDYA 4HMIA 3BDPA 4KLGA 5K5PA 1F9QA 1RQNA 4C80A 1CSQA 2E8NA 4EQ5A 2LFNA 1SNPA 1JORA 5AKYA 4KLOA 3D0FA 2F2AB 4RGOS 4JPBW 2ASDA 1MIUA 1X9SA 4DV1Q 1N36Q 4QZGA 4DV4L 1LTSD 4DFDA 4C1NK 5IYCH 2D8CA 4LJZC 4AQYQ 7ICHA 3S6JA 4AYBF 5AKZA 4EBEA 1EY5A 4ZLTF 1HA5A 3UMCA 4N9PA 2EAOA 3DEOA 1WCLA 2RDJA 1HIWA 1OXUA 2RDGA 4DEZA 3NBHB 1BO0A 1X3PA 4GS3A 3RZOB 2OH2A 3PMNA 1VQ8A 1U47A 2I07B 2XNAC 1YVCA 5IGGA 2QB1A 2XO7A 2PQAA 1ZQPA 1EEFD 1QJOA 3OJSA 9ICLA 1K83B 4EVOA 5HMMA 4POFA 2KFNA 2D3DA 3DHQA 1GUOA 2JA5G 2K8BB 1KQQA 2JEJA 1PTOD 4IRCA 8ICYA 5KFRA 3DWQA 2RCNA 3RJIA 4DV0Q 3Q8SB 4DR3L 1JB7A 1FFUA 3NUCA 1HR0L 4DLEA 1I6VC 4BS9A 4ECWA 3M9NB 4LMQD 4LF4Q 2XCAA 1VQLA 3K1ZA 1ZETA 4F88A 4BY7B 3MXNB 2ZIUA 5ALKA 4AP9A 1QE6A 1A63A 2EPBA 5DG7A 1IL8A 1TIID 1K8AC 4IOCA 3TKAA 3K5OA 4B6JA 2XCPA 2VJ4A 4KLMA 5EJWA 5C0YA 2PW5A 1RCVD 2G06A 2W9BB 5C4HA 1B1ZA 2JEIA 4GLXA 4R4IA 2FMCA 5KFTA 5J3BA 3I1YA 3JPTA 5KFHA 2F0FA 2NVXB 5AM5A 3FEWX 3HKZB 3A8KE 5L1IA 1UQVA 3S24A 3QZ7A 3KK7A 2OCEA 3S1MH 2F0GA 2EYHA 1O7LA 4FFDA 3G6EA 2MNAA 1Z3EB 4QQBX 4ZOHC 1AW7A 3VR2A 1DM0B 5LHY1 1VQKA 2I46A 1BKBA 5J2DA 4I2IA 5IIOA 4J9PA 2G09A 3EW9A 2ZXHA 3MEHA 1KTKA 3AU2A 2E8PA 2G08A 1SE8A 3R93A 2RSOA 2IX3A 4OO1G 3OHBA 2IX0A 1TWFH 1WWUA 4HAEA 1UWVA 1FGBD 1S5LU 3KBGA 4A3BH 1XNQL 4ECUA 5KFUA 3UQ2A 2WF8A 3QUQA 4DK0A 2EYJA 1NJIC 1IYVA 3KF6A 2C35B 4C3JH 5ALLA 2N88A 3GTQH 5EE0A 2R8JA 1WTQA 4ED3A 2Y0SC 2KEYA 4ELTA 4NLZA 5KT7A 4CDDC 1KN5A 1FFVA 1L8LA 1DOQA 2XY5A 1VQ5A 2HDLA 2B39A 4IR1A 1HPCA 3NELA 4Q5VA 1STAA 1W3SA 4NV0A 3N4MB 3KHGA 3QJYA 1ZKOA 1BPXA 1CT1D 2LYHA 4BXOA 1HNXQ 1PH5A 3ZI4A 1SXEA 4MHVA 2JA9A 3H8SA 2KJXA 3ULPA 2WINB 5I9OA 4YQWA 5IGFA 3ETRA 5KFMA 5AK3A 3MC0B 2Y0SB 1S5FD 1G2TA 4XQQA 2E5LL 4DFAA 4GXIA 2YMLA 3ONNA 1CKMA 1YJNA 2JHDA 3CCLA 3OTQA 2W9AA 1X42A 1BBXC 4KHZA 1RIPA 4OXPA 1L2FA 1RTOA 2FPKA 3PSIA 4A3FB 1GHKA 5AK4A 4IRDA 1A2TA 3WK5A 9ICJA 3NRWA 4OJOA 1SE4A 2N55A 3T4AC 5BN5A 3KLSX 5CEHA 1B70B 2BDUA 4I2FA 3NXWA 5AJ3Q 4GZYC 4NL9C 1A3TA 3A0BU 3D4WA 2X6GA 3L3OC 3HOXB 4ZCKA 4A8EA 3E2EA 1JJGA 3T1YQ 4ECVA 4GXJA 3BS1A 1J97A 2PO4A 3ICXA 5CV9A 1JXLA 3WK8A 1ECWA 3PUVA 1B53A 5FKAC 2WP8J 1SYGA 2NO4A 3HOYH 4OCZA 1BNOA 5DM63 1KFDA 2IHEA 4EBDA 2Y1IA 4IQUA 4Y2XA 2XGQA 1HZBA 1JI7A 1D5MC 3HS0C 5E4WC 1GUNA 5IIFA 1VQEA 3C5FA 3V2TA 2GVAA 5M5WB 1ZQYA 5IE8A 4PHDA 1XNSA 4WFN3 2UXDL 3P75A 3CMAA 3QZ8A 3KLWA 3UMBA 2QF7A 3H0GH 5CBAE 2ASJA 1JCKB 2LMRA 5JJZA 2KA7A 2AGQA 1P16A 1SXTA 4X64L 4KKSA 3SGIA 9ICVA 2KV2A 2EAPA 4P4MA 3BQ0A 3V7KA 3SV4A 5F9NA 1ZQOA 2HW3A 4Y2SA 4QWBA 4JV5Q 3HKZE 4JI6Q 1EOTA 4QZFA 2P66A 2JEAI 9ICCA 1EOVA 3AB9A 1O03A 1CQVA 1K5OA 8ICRA 2LKYA 4KLIA 1X3QA 1PFNA 5C4XB 4O3SA 3OIPA 1WWVA 4K6DA 5JEAG 3DLLA 4O3PA 3MA2B 2LYAA 1TWCB 1PH1A 4UBCA 2IL8A 4DR1Q 5CYUA 1ZQXA 4HIOA 4O3OA 2K5DA 5CC4A 4C1NI 1FNWA 4I65A 4O5EA 1Z47A 2NWGA 2DFLA 2F76X 1U4LA 2FMSA 2B8GA 3IFDA 3MFYA 5LMUQ 1OO9B 2F0KA 4CCHA 3I55A 1ZQIA 2F3VA 4QZ9A 3PUXA 2R7ZG 3M3YH 3GP7A 1S5DD 2TSSA 1NKEA 4YHHQ 3S1NH 1SNOA 2F0WA 4DQIA 3PSTA 3BVZA 4A3IG 7ICJA 1GKHA 3M4PA 2K5HA 4AYBB 5JVG3 8ICZA 1FL0A 2HVHA 1GOZA 1T3NA 2KE7A 1FNUA 1NSNS 1HFGA 1I94L 4X66Q 1AROP 4RQ3A 1XSNA 2FMPA 2SEBD 4HJAA 2KHSA 3K7AB 3WOFA 4HJ7A 1YBYA 4I28A 3IFTA 2YU9B 2FMMA 5NUCA 1D6EC 4LF5L 3GTMH 1ML0D 2G0AA 1L3UA 2ODGA 4IRKA 5M5XB 5HMLA 1TT2A 1VQGA 2R93H 4M9LA 2F0VA 2NRTA 4IQZA 1HRJA 4M6WA 1B3AA 4RQ5A 4KLSA 1SFOB 2QLTA 1CK1A 1CHQD 3TFSA 5TISU 2YMMA 4B9XA 4IFDJ 2A1AA 2NYZD 2CPRA 3I90A 1A76A 2ALZA 4B9NA 1QUQA 2ZJ5A 2HCCA 2VL6A 1AEXA 3DMUA 3PV0A 4HCSA 1KFTA 1K28A 3M6ZA 4UAUA 5FK9C 1XNQQ 1A8VA 2NYVA 1NUCA 3G7LA 2A8VA 2RP5A 5J29A 4H44C 3EYZA 3RF9A 4U6PA 1Z1BA 4DUZL 4IFDI 2NB0A 2HVIA 3SV3A 4LFBL 3SXHA 4I2BA 3V05A 1QOHA 5J2GA 3F2BA 4F5PA 1UT8A 2ZIWA 3ISCA 1ENCA 2ASLA 2MHVA 3NWTA 3GILA 1ZJMA 4WRDA 1L3SA 1R9TH 3MXNA 2ZIUB 1EYCA 3WK4A 3LGJA 3T5KA 4X65Q 4JVZA 1KSPA 3S17H 3CMEA 4CKEA 4EQOA 3M4QA 2Z0SA 2AQ1B 4YWMA 2KCNA 2ESEA 3HILA 4C3JG 5IYDG 5ALRA 4B9LA 4G4KA 4O3NA 2KZMA 4C3HG 7ICRA 3OIQA 2R92G 4RQ4A 4NY8A 1KRTA 3WWVA 3HOZG 2ZJPA 2B63G 3PR5B 3L7ZC 1NNLA 4TURA 2FI1A 4DF7A 2KICA 3U26A 4K5VA 2UVUA 1GUTA 2LS01 4AYBE 3SAHA 5DBBA 5J0XA 1YNXA 4LZDA 5L1JA 4DV1L 1JR0D 3PGZA 5KFWA 4I2HA 4KY5A 1PTOC 4R9WA 2K4EA 2F0PA 3KBBA 5AKLA 4PMCA 2I6XA 1HHVA 2N1RA 8ICKA 2AGOA 3VYTA 5DAUA 1NK7A 3J7ZC 3JAMi 3SQIA 2EQSA 5AI8A 3PW2A 5ALIA 4QZCA 1WTHA 4LK1C 3RUZA 3VR5A 2EDUA 4QZIA 4ELVA 2EZXA 1E7ZA 2F0JA 3NE5B 3JPSA 5IINA 4MHEA 4ODGA 4O3MA 5KFPA 9ICQA 1HNWQ 2UVVA 1UPHA 4H0LC 2IOFK 4QWCA 4H7BA 5KFDA 3OMCA 5D49A 3G71A 1HNZQ 2HMXA 4UASA 1VQHA 2B2YA 2WAQB 5J2KA 3M7GA 1WJJA 4PZ8A 3FYHA 1ZQAA 3RBEA 2QKQA 2J6SA 4GLVB 8ICJA 3CW2C 3K1RB 1LUZA 2HQEA 2W9CA 2BCRA 2A6HD 5EBCA 3HKZC 1GO3E 1ILPA 5ALQA 3NHHA 1KIXA 2HOQA 2JJQA 2RQXA 1M1KC 7ICEA 5G3LD 2A1JB 4O0IA 3RLNA 1SV4A 4EGVA 4F5RA 1DYQA 4KMUC 5EBDA 3R3OA 4MTKA 3U9OA 1IXRA 2OTLA 1RYRA 2I9GA 4IPGA 3M3YB 5EPLA 4B9WA 3IV6A 1H9KA 4F71A 1UT5A 2BR0A 2CRXA 1EU3A 1G91A 1XO1A 1ZQHA 2E8OA 2PI2E 3RBDA 1NY4A 1XTCD 1Z4NA 3NVZA 2BGWA 7ICTA 3CC7A 3K7AH 2Z6BA 3PO3H 3I7FA 4FP5D 5HR6A 3Q23A 1VJ5A 1RPLA 3J81E 2UUCL 2C2EA 1DOLA 5DEHA 5J8YA 5KNIA 5C0XG 4YR0A 3QXGA 1OUQA 5K4LA 1QNUA 4DXFA 2WAQC 1NAPA 3T13A 3KJPA 1ZQTA 2PPBC 5M5YB 5C4XG 3FM9A 5AKGA 2ZM6Q 1HTLD 2AUJD 2Q2IA 3J80c 3E0JA 5DDMA 1Q46A 5IT9E 4A3CG 2K8CB 5J0TA 1JE5A 1PYSB 3KF8B 2VA8A 4ILWA 3VR6A 4RPXA 1SE2A 3GDXA 1NK0A 3S14B 5KG1A 3RR5A 3OPXA 1S0VA 3EJIA 3D6JA 3LNNA 3AN1A 2DGZA 3H3VC 1KFSA 2B2VA 2BDOA 3LWMA 2EZVA 2CVRA 1N36L 2JA7H 1YNND 1SWVA 5CORA 3PMFA 2K8AA 1MA7A 5J8YC 1F2ZA 3TANA 1KTQA 5AKXA 1W6JA 2CH4A 2D0PA 4UW9A 5C44G 2PNHA 1K1SA 4B9UA 2L9HA 1FIQA 2DNCA 1R9TB 2YU9H 1LLRD 2F8KA 3PIOA 1WCNA 4DR1L 2IHFA 5J0UA 1U9RA 4PNYA 4BDPA 4EQPA 5C3EB 5AM3A 1N60A 3UQ0A 3RZDB 4RKBA 4K4GA 1SNCA 2QDBA 3VCBA 3WOEA 1BUVT 1V1PB 3T51B 4DNIA 3NSWA 1NZBA 4DAVA 2UU9L 2LSSA 2LHTA 2WAQF 5C3WA 3C1FA 2FHTA 3SK8A 2BPGA 3H3VI 2F3WA 2EIFA 1SL0A 3HRDD 3R2IA 2B2WC 5EWGA 1IL2A 2E76C 3KHLA 1PRTD 8ICLA 1COOA 1JIHA 5KFOA 4BY1H 2H3VA 4AQYL 1YNNC 4A3MB 1VQ7A 3H0LB 4J03A 3NK9A 2YB1A 2KECA 4DF4A 4R8NA 4C3IB 1QZGA 2F0UA 3NBIA 1D2BA 4G9BA 3SZ2A 2ISPA 1EY6A 1MKHA 2KCCA 4XQJA 1VQIA 1ZRMA 3AM9A 4HIDA 4DNRB 5C4JH 3RFAA 5J2EA 3WK9A 5CV7A 4BBSB 4DR5L 1NOMA 4Z6FA 4QZHA 4LVSA 5KGUA 1RZTA 2F1HA 2H5XA 2SDFA 3MC1A 3PNCA 2VIXA 4OIKA 1CKOA 4UATA 4K4IA 1HXYD 2Z8LA 1LKYA 3D2SA 4MFAA 4IURA 1ED1A 4NJ8A 1CKNA 1QSLA 3I70A 2K89A 3J81L 4LF9L 3CCJA 2NVQB 5EWFA 4UPAA 3DXJC 4M9GA 2W11A 3H09A 1EXNA 5CV6A 4JBKA 2OEHA 4I2DA 4C2MH 3I3CA 3RLOA 5DB6A 2KVCA 2NVTH 3TADA 4KLFA 3MBYA 5BPCA 1PRTC 1LTGD 1Q3LA 3ERQA 2IBKA 4P2CB 5J2IA 2MFIA 4FXKC 5JEAH 2N49A 5I6YA 3QU9A 5KL8B 3QOJA 4P74A 3K57A 5EKKA 3PUYA 2RKSA 1EY8A 5KFQA 3ND9A 5IIIA 2HHWA 4DPGA 1G2SA 3KFUA 1NJZA 2LMCB 2EYPA 1KAWA 3MWYW 2ASBA 1QNKA 1Q8KA 1SBBB 4BGDA 4ED7A 1SR3A 2Y0SF 1N62A 3GIIA 1V1QA 3CHBD 3H8JA 3PO3B 3BQ2A 2IY5B 4QB4A 5HNKA 1L7NA 5KG0A 1E2WA 1STEA 1E3PA 2R7DA 4ZYSA 4A3KG 4A3LH 3C21A 3E58A 1CSPA 2C9OA 5KFXA 4FS2A 3LVWA 4NXZA 2F0IA 1HJPA 5KNDA 4HJ5A 2BH2A 2J0TD 3EFXD 4DF8A 1D8YA 4ABNA 1OTCA 3AUOA 1S97A 4L5QA 2F03A 4JI4Q 1ZD3A 1VQMA 2NBFA 3QYPA 4UBBA 3TBIB 2XVTA 3V96A 2O4XA 4AYBG 1J5EL 2KOBA 1U4BA 1NBWA 1VF5C 5ALHA 1V8QA 4DV6Q 2KENA 1AP0A 2HDMA 3E0EA 2JA5H 1TY2A 1XXGA 4KN7A 1Y69U 3GQCA 1XWEA 2EQYA 4TQSA 4JI8L 3LWLA 1LT4D 4QZBA 4Z6DA 5J39A 3GTJH 1KKXA 3ZDAA 4M04A 2A69D 2G5DA 4PQXA 1CZWA 2JYOA 4JI2L 3A74A 3GV6A 1Z00B 4JW0A 1QWYA 1DCZA 3CCUA 4OIJA 3JPOA 4UY8C 3WKDA 5JJIA 1ENAA 4C7YA 4QWDA 5G5HA 5KT6A 4UB3A 4RA8A 4C3HH 1I94Q 4Q0FA 2WF6A 2OEOA 2IHMA 2BCOA 2R92H 1IKMA 3BG3A 2B2UC 3PW4A 2GVBA 4FS1A 3QUCA 5AI9A 1VMPA 3SK5A 2QCPX 4JYAQ 2D9UA 1E2VA 4UAIA 1TKDA 5C0XH 1Z00A 4XA5A 3TAQA 1YNJD 2R7FA 3T53B 1WTVA 3OW7A 4ZKCB 3PUWA 3Q8DA 2KHIA 1K8MA 1X9WA 5KT3A 5DLFA 1T9HA 3JPRA 1FR3A 1XX8A 1DD2A 9ICSA 1STBA 4CBVA 5C4XH 3G4SA 1H9RA 2EJFC 4ID6A 3Q8QB 4ECSA 2W3SA 4O3RA 2F0HA 4O42A 3TQ1A 2K6AA 3KZXA 4A3MH 5ELCA 4IZ8A 2E2IH 2E8MA 5L9XA 4NXNL 1OXSC 5JJKA 5KT2A 3ZYYX 1XNRL 1EUJA 2PMZE 3FMCA 1UEAB 4C3JB 4C8LA 4ZKBB 1GXDC 1PV4A 1NTGA 1N34Q 3HOZB 2HOIA 4JI0L 4DUYQ 4Q45A 5T14A 4BA1I 2MA1A 3GQBA 2G07A 1VF7A 3RZDH 1HNZL 4K0KL 1V97A 5KFEA 3T5JA 1PXUA 3H0RB 3C23A 4PHAA 1BXTA 1D5XC 4TSSA 4CJ0B 1X40A 4GNXC 4DQSA 4GKJQ 1PH7A 3RR8A 3GTOB 7ICIA 5EWEA 4L63B 4F8RA 3HOWH 4DFJA 4M0AA 4QIWF 4GKJL 4XIGS 3D8GA 1HA6A 5KFFA 3T16A 2ATWA 3VDYA 4DFMA 8ICBA 1F9SA 1L1OC 1RD9D 4RPZA 4A3JG 3M8SA 4DSEA 3HOXG 4BX9C 1BCPC 1EFID 3K7UC 3ONAB 1F2MA 4RQ8A 2F0LA 1NK5A 2DJFC 4AIMA 4XQNA 2E1FA 5J2CA 1EL0A 1CA5A 1YHBA 3CKIB 3K5NA 2AQ4A 3MFHA 4RNOA 4X64Q 4NM1A 3IN5A 2F1MA 4KMOB 2JEFA 4R63A 1B0XA 1U5KA 1DGJA 3K0YA 5AK5A 4RZRA 4NL9A 4K6LA 3CU7A 4DFKA 1BPZA 4LAAA 1N32L 4DSJA 3KKAA 4QGUA 1IBLL 4KY6A 1SYEA 3S9WA 2J7ZA 2KKPA 5A0LA 4IUPA 4S3SA 3BQTA 3Q8KA 2XI9A 3KOJA 5KNBA 4UHVA 3HWTA 2H3FA 2IT1A 4DK1A 1WVLA 2MP1A 2W9MA 4KV6A 2NVQH 2PFQA 1FVIA 2RRDA 3HX0A 1A62A 2NRZA 7ICLA 2R6GA 4UDUC 4A3DH 2B2TA 1JJ2A 3IAYA 3PO2H 3FDTA 1AZQA 4HJ8A 4C2MB 1A3UA 1O78A 3NTIA 5I6WA 1MGSA 4MFFA 3I4MH 4MEYA 5G5GA 2L0CA 1Y1VB 3CCMA 1ZQNA 1XO0A 1L1OB 1BGXT 3J7YW 4P4OA 4YG2A 4JI5Q 1K3RA 4RH6A 2WF5A 2ZG6A 1ZQRA 4QNLA 4G3IA 1QLNA 1D8BA 3OPOA 5DNFA 1JMSA 4LWCA 3C28A 2J6TA 3DEPA 4NM2A 3NVYA 5KYLA 4YVZA 1JE4A 5IODA 3F2CA 4YP3A 4G7OC 2VXWA 3GTPH 5KFCA 4RUAA 5DBCA 1NZPA 8ICPA 2MPMA 4FDBA 1EIHA 3RH5A 4OX9L 3AQEA 3Q8MA 3UDIA 4DSLA 4C8MA 2RDIA 2AH5A 5HP4A 4IQVA 2YYZA 5BR8L 1YI2A 2W8KA 3KLSA 3RJFA 1VMCA 3TFRA 1KLNA 1TWCH 4KJNA 4LF9Q 5C44H 3ORYA 1ET9A 7ICQA 1TXYA 3RN5A 2N78A 1N8RC 1KHIA 4A3LG 2YB4A 3HKZF 1T94A 3PW5A 3I4OA 3K5LA 3OMGA 9ICIA 4MF8A 5LL6S 2B2YC 3MDCA 1FNVA 1N48A 4JI8Q 4DK3C 1KNEA 1EIFA 3CCSA 2KP7A 4DOBA 4YCXA 1I50H 2DGYA 1VQOA 2HHUA 5AM1A 4P0QB 1CI4A 1NK8A 3TDQA 1B9NA 1V85A 5ALPA 2UUAQ 1TWAH 2OF1A 2DN8A 3EQLC 4M9HA 1PZKD 2JA6G 3QU5A 3KZIU 3M9OB 2E2HB 3STBC 3MTSA 4DR4Q 3O0FA 2B3GA 3I4NH 3EPGA 4PGXA 1S0NA 2GWSA 4KLHA 5IWAQ 3NQIA 5D46A 1KEJA 4O3QA 4B3TQ 1H95A 1RKNA 1NR2A 4JYAL 3TN2A 1HEKA 1T5EA 1J6QA 4F4ZA 2AXTU 4EEYA 2EXZA 3G48A 3D2NA 4XYOA 3TP6A 4KHPL 3A8IE 3G6YA 3PV8A 1CFMA 2DPJA 3A56A 2LY7A 3QU4A 5ALNA 4ECTA 1EWIA 1UHUA 4O5KA 1SAPA 1EYAA 3GTLB 4NB3A 1MJEA 3HOUH 2Z4IA 2JXJA 1GVPA 2IHNA 2R93G 1WTXA 4DN4M 2K4HA 2F0SA 3MAQA 2QB0A 4CDFC 1P8LA 2W03A 2HUGA 5CMDA 2Z6KA 4BUGA 2HSZA 5KT5A 4LFBQ 2H1EA 4PZ6A 1LV5A 3MZ5A 4RHSA 1TS2A 2JP1A 4YHHL 4BBSG 1PK1B 4O5CA 3RJEA 5COYA 4IN3A 5ELOA 5J1ZA 5KIXA 3T1HQ 2C5CA 2XIDA 2L1BA 2XIWA 3MGVA 1SNDA 1DXSA 5AJ3L 3SENA 3I2ZA 2JEBI 4F50A 2BCSA 3HGBA 3S14H 4HR7B 3VYSA 3CRLC 4YCVA 3O13A 2NRXA 4OJPA 1I6HB 2UUBQ 4DOCA 2VANA 3CCQA 3TZDA 4QWEA 1B44D 3F2DA 2NVYB 4DU9A 3PIO3 3TS0A 1EQRA 1A77A 3RB3A 3M9BA 4Q44A 4ZK9B 4RGNA 2XVSA 3NS1A 2ZXOA 4LF6Q 1LTID 3GO5A 5ELFA 5ALJA 1PFSA 1Q82C 2BHNA 1VQFA 1O7ZA 1DOMA 3K6OA 5CV5A 3I28A 4DGZA 5FO7B 2WAQG 4U673 3SDZA 5M3MG 4DSFA 5IOCA 1NR4A 4ME5A 1ZQZA 2V4RA 1Y1WH 3QWNA 4DSKA 3K0XA 2HOFA 1WYDA 4NW2A 3QR8A 4EYIB 1QUQB 1F9RA 4TRDA 2XWBB 3RB4A 1NI3A 4EBCA 4J9SA 3UXNA 1F2YA 2ES2A 4UB2A 2IJ0A 4DV4Q 5EKLA 1Y14B 4OX9Q 2PW7A 5JEAJ 4R4CA 3BJYA 4ECRA 4C4SA 2PI4A 1TWHH 1UA1A 4B9SA 2F0OA 2KVMA 1JROA 4TQUS 1HZ9A 2F4IA 9ICHA 4R4OA 1KW4A 1U48A 2AUKA 4B3SQ 1O08A 4U68A 1ZQSA 3HEJA 4C3IH 1L3TA 5IGDA 5M3FH 2H3QA 4FZMA 4LF8Q 4YFKA 2UVRA 2HBJA 8ICFA 4IJHA 4QUFA 5C0XJ 3PCOB 5F9LA 1ILQA 3OTOQ 5F3XB 4J9NA 3F2UA 5KL1B 3ERSX 3BS5A 2NZOA 4QZAA 3PF4A 3C2PA 1BBWA 2J4XA 2R3ZA 3V7LA 1ZQMA 2FE9A 3MHBA 4RWSC 2JEGA 2QARA 4DV5Q 5AI4A 2NO5A 1U45A 1L7PA 3BZCA 4DLGA 1SYCA 5AHXA 1Y1VH 4NLGA 4KITB 4LUOA 4KHPQ 1XMOL 1J2MA 4P4PA 2CW0C 1B3QA 1OXTA 1A3VA 4DAPA 4Y2RA 1ZYRC 1NK4A 1ICWA 2L4NA 1BVSA 8ICEA 3ETLA 2WIIB 5CV4A 8ICOA 3TREA 4KLUA 4IJLA 2R8IA 2ZUDA 4UP9A 1SMYC 4A3EG 1ZQ1C 4DQQA 2VS1A 4JI3Q 1WD1A 1T3QA 2K50A 2XY7A 1TAUA 1B9MA 2NVTB 5IT9L 3QEBZ 9ICMA 3HP3A 1ASZA 2BPCA 1M6YA 2K5NA 4B9MA 1BR9A 2JN4A 1LM0A 5AM0A 2PMZB 5DB7A 5J0OA 3WKEA 5IYDH 1PTOB 1GUGA 1FO4A 2BCQA 2GN5A 1JQYD 4PHEA 4YIJA 8ICCA 1PVOA 4OJ6A 4CF3A 5JPNC 4XT1B 3RRHA 3U4ZA 1D9DA 4I29A 4NXMQ 2AQ2B 1UCVA 5EE9A 5AKEA 1PZID 4C56C 3HOXH 3DV9A 2YTYA 1DJRD 1I4XA 3NRZA 3ISBA 5C5LA 1IBKQ 3E6ZX 2EOTA 5ELEA 4R8UB 8ICQA 4KN4A 2H4OA 1VQPA 1AQ6A 1SYFA 4G7HC 1EEID 3DWPA 3ZDEA 3UXOA 3UDXA 4P0PB 2W43A 3ZDDA 1UE5A 1X3FA 3WKCA 2MUYA 3IRUA 3ED5A 1SMYD 1WTWA 4KTQA 2E2HH 9ICPA 4YCWA 4BXXG 4JBMA 2FDRA 1PVRA 2CWPA 4PPXA 9ICGA 2QA4A 2VUMG 3J7AV 4OHJA 5CB1A 1H9JA 3M4OB 1XPOA 3IHQB 4K2LA 3Q22A 3EN2A 5B5EU 4L8JA 2IA6A 5BN4A 1I6HH 5KTQA 3TMEA 4PGYA 5KFIA 3MEFA 5KEEA 3I4NG 1LKYB 3CCVA 4QUCA 2F0QA 4RG1A 4B3ML 2EZZA 4M8AA 5D3DA 3HOVG 3ZD9A 4FF4A 3I4MG 3J81j 1PA6A 1TE2A 2DKZA 1QCKA 1ASYA 3MR3A 3QE9Y 2PQAB 4F72A 2ISOA 2DF4B 5CWRA 5L1KA 4CGZA 5EPKA 5IT9c 2KJ5A 5FP0A 5EGTA 5I2XA 2W9BA 1U4RA 3P1HA 4A3GB 1LACA 1X3EA 5A35A 2QEXA 4A75A 2K7VA 2BA1A 4LF7L 2HHQA 1ZQGA 4N8X1 1IG6A 1HUZA 4LFAQ 3S15H 3ZDCA 1P7DA 2BE5C 3E9HA 4UAYA 4IO9A 5IYBH 2VA3A 4XRHA 1NK6A 2E3TA 1D9FA 1SNQA 1EIGA 3M7DA 2WF9A 2MJ8A 3K59A 2KKVA 1WD0A 8ICMA 3BU2A 2AHOB 2K4PA 2VA2A 3H4DA 2NVYH 2Z4HA 2R18A 2OTJA 2ZTDA 4YY3L 3QO2A 1TVAA 5CHGA 2KEEA 4XXEA 4OGQC 4GC7A 5ALGA 1YZ7A 3ER0A 1NNXA 1A2UA 5KFVA 4OWXB 5DM73 1JOQA 2ES6A 4FZLA 2HIVA 4N9TA 1C0AA 5J0PA 1IV8A 3HOZH 3CF5A 2W3RA 3TI0A 1BPDA 4ACOA 3MR5A 2FMQA 2HHVA 1O7IA 2MUTA 5E7NA 5F2DA 3HOYB 4HEDA 4UB6U 5AI5A 4F8MA 4PL1A 5BN3A 5GTHU 3NTUA 5ALUA 5L1LA 3TP5A 4Y2UA 2EY6A 2F52A 1U49A 1ZD5A 4RHRA 2B2WA 3GTOH 3S2DB 3D6CA 1QZHA 4IFDG 1I3QH 2JH7A 3H6MA 4F5NA 2QB0B 3CC2A 3K8AA 4Y2VA 2YTXA 2KIWA 1JWSD 1EYGA 4B9VA 1D5ZC 4B3RL 3GIJA 4M2YA 3B6YA 1UNSA 4CDGA
chains in the Genus database with same CATH topology
4C2MH 1GM5A 4QY7A 1VQJA 2DUDA 3RLOA 1I5FA 1WCMG 5HGQA 4DV7L 4UP7A 4DR2L 2NVTH 2VUMH 4DR6Q 3KYHC 1K0RA 1S3OA 4DV3L 2MFIA 4X65L 5C3EG 1WOCA 1QVFA 1VQCA 2N49A 1AE2A 3KF6B 2K5VA 4A3MG 4P74A 1E22A 1QVGA 1WCMH 3PUYA 4JI6L 3CXCA 2KCMA 3AQQA 4IOAA 4DPGA 2ZJRA 3KFUA 1KAWA 2ID0A 2ASBA 3HOVH 1CSQA 4EQ5A 3S1RH 1Q8KA 1UE1A 1LYLA 3M85A 5IYBG 3D0FA 1V43A 1SR3A 4DR7Q 2IY5B 1V1QA 4WJ3M 4JOIC 1MIUA 1E3PA 2R7DA 4DV1Q 1N36Q 1NE3A 4A3KG 4DV4L 4A3LH 1CSPA 5IYCH 4DV2Q 4AQYQ 4JI4L 4JI7Q 2JE6I 1HJPA 4MZ9A 5LMUL 4HJ5A 1PH3A 4LFCL 2BH2A 2K75A 1OTCA 4GKKQ 1X3GA 1OXUA 4GS3A 4L5QA 3NBHB 1SMXA 4JI4Q 4JI7L 1VQMA 1Q1EA 1VQ8A 1SN8A 1J5EL 4AYBG 1NBWA 1YVCA 3U50C 5GADC 4DV6Q 2KENA 2PQAA 2LXJA 3E0EA 2JA5H 5LMNW 4A3BG 2UXBQ 4LF7Q 3W5OA 4B3SL 4Y7NH 4JI8L 4Y52H 4X66L 4POFA 4DV6L 3GTJH 4APVA 2E8GA 2JA5G 3OTOL 3CAMA 1XMOQ 4JI2L 3BZKA 3A74A 2RCNA 4DV0Q 4DR3L 4OWTB 1S72A 1K73C 4HIMA 1X6OA 5FLXc 1JB7A 1HR0L 4LF4Q 3CCUA 1L1OA 1VQLA 4UY8C 5JJIA 2D62A 3MXNB 1I94Q 4QJFA 4C3HH 4DR4L 2R92H 1A63A 1K8AC 2VNUD 3FKIG 4IOCA 1XTDA 1KXLA 4X62Q 2GVBA 1GD7A 4DAMA 1PH2A 3CP0A 1HR0Q 1C7YA 4JYAQ 4KLKA 4R4IA 3FKIH 4GLXA 2R7FA 5J3BA 4IPCA 4L5RC 2UUBL 3K81C 3PUWA 3Q8DA 2KHIA 4LNQA 4O0AA 4A4IA 1T9HA 3S24A 2K52A 2OCEA 3S1MH 3GTKH 5C4XH 4NXML 2K14A 3G4SA 5M3MH 2OWOA 1U0LA 3G6EA 2MNAA 4QQBX 1VQKA 1BKBA 4A3MH 2E2IH 4NXNL 1CKNB 1OXSC 3CCRA 5JJKA 4K0KQ 1IBKL 2AMCB 4UP8A 1EUJA 2PMZE 1XNRL 1OXVA 1SRUA 3L0OA 3RN2A 1X55A 1SE8A 5LMNL 3IRBA 4L5TA 5FLMG 4AH6A 1PV4A 1NTGA 4OO1G 1N34Q 2IX0A 1Y1VG 1XNRQ 4JI0L 4EX5A 1TWFH 2RF4A 4DUYQ 4OWWB 4BA1I 1HNZL 4K0KL 3RZDH 3CQZH 1UWVA 1YZ6A 3RLFA 1PYBA 4A3BH 3UE0A 1XNQL 3D31A 1VQ6A 4GNXC 4A93H 4GKJQ 1OXXK 1PH7A 1NJIC 5H1SE 2V1CC 2C35B 3KF6A 4C3JH 3HOWH 4A3GG 3GTQH 4JV5L 4BY1G 3W1GA 5GAGC 4DAYB 4GKKL 5DLQE 1A0IA 4GKJL 4XIGS 2UU9Q 2ATWA 2I5HA 3VDYA 4A3JG 1L1OC 1Q12A 2Y0SE 4GOPB 4A3KH 3HOXG 1VQ5A 3K7UC 5GAHC 3NELA 2UXDQ 4YY3Q 1W3SA 4AIMA 4A3DG 1IBLQ 1YHBA 4LUZA 3H3VH 1KD1C 4GLAC 4X64Q 1WFQA 1PH5A 1HNXQ 5GQOA 4DR5Q 2JA9A 3ULPA 4XTCS 1VQBA 2IX1A 1U5KA 1N32L 4QGUA 1IBLL 5IP7G 4TVAB 2VQEQ 1N33L 1XMQL 4LFAL 2E5LL 3HOWG 4JCVE 3T1YL 1CKMA 1YJNA 4KI0A 3CCLA 1NMGA 3KOJA 4GN3B 3GTGH 3STBD 2IT1A 4KHZA 1RIPA 4OXPA 1L2FA 4GN5A 2JA8H 3PSIA 2NVQH 1FVIA 2VQFQ 3S16H 1A62A 1NMFA 2R6GA 3J7A5 4A3DH 4GN4B 1B70B 2CKZB 4JOIA 1JJ2A 3PO2H 4HJ8A 5AJ3Q 1FJGQ 3ZJYC 1XPUA 4GNXA 2UXCQ 3I4MH 1YEZA 1YJWA 4OONA 2R7ZH 3CCMA 4QIWE 1L1OB 2D0OA 4DUYL 4GOPC 1EIYB 1FJGL 1JJGA 5M5WH 3T1YQ 4JI5Q 1K3RA 4A3IH 1B8AA 3TS2A 3UDFA 4A3FH 1EFWA 1KC8C 2Q2TA 3KDFA 3PUVA 4PG3A 3TRZA 2I5MX 4LWCA 2WP8J 4JI5L 5M5YH 3HOYH 4BXXH 1UEBA 1KL9A 2IHEA 4YCUA 5BR8Q 3F2CA 3GTPH 4A3JH 3AEVA 1HZBA 5IP9H 4JI0Q 4FDBA 4OX9L 1VQEA 1G291 2GVAA 4JI1Q 3UDIA 3PO2G 5IE8A 4BY7H 2AWOA 2UXDL 2VZAA 3CMAA 1W2BA 2YYZA 1VS0A 3KLWA 3H0GH 5BR8L 3RNUA 1YI2A 1UE7A 1TWCH 1P16A 2UUCQ 2YTVA 5C44H 3PUZA 4R4QA 3AFPA 4B3MQ 4LF9Q 1VCIA 4X64L 1TXYA 2LXKA 3L2PA 3SGIA 3RN5A 2N78A 1N8RC 1KHIA 4A3LG 3H0GG 4JV5Q 3HKZE 4JI6Q 2JEAI 3I4OA 1EOVA 4OO1I 1D8LA 4PZ7A 4R4TA 4PMWA 4DK3C 2Y0SG 4JI8Q 1EIFA 3CCSA 2QGQA 3KDFB 4DR7L 1I50H 1VQOA 2DGYA 3FP9A 2CFMA 4RMFA 5JEAG 2A19A 2AKWB 1RL2A 5C3EH 3DLLA 2B63H 1PH1A 3PO3G 4O2DA 4DR1Q 2KBNA 4GNXB 4HIOA 1WI5A 2UUAQ 1TWAH 4B3TL 2WFWA 3J80i 2JA6G 3NENA 1Z47A 3STBC 4DR4Q 5LMUQ 2B3GA 3I4NH 3M3YH 3I55A 3PUXA 1HH2P 1VQ9A 5IWAQ 2R7ZG 2ZTEA 4YHHQ 1HR0W 3S1NH 2UUAL 4B3TQ 1H95A 1J5EQ 4A3CH 4JYAL 4J15A 4A3IG 1J6QA 1GKHA 3G48A 3M4PA 3J81i 2K5HA 2HHHQ 4KHPL 1FL0A 2NN6G 1EWIA 1XPRA 3RZOH 4LFCQ 1I94L 4X66Q 1YIJA 5JJLA 4NB3A 4HJAA 1MJEA 3HOUH 1GVPA 1HZAA 2R93G 4HJ7A 1YBYA 1P8LA 3TEHB 3PIPA 2Z6KA 4LF5L 3GTMH 4HJ9A 1HZCA 4ME3A 1VQGA 3HKZG 4LFBQ 4LF8L 3K80C 2R93H 4DV3Q 4PZ6A 4YHHL 1VQAA 3J81c 4BBSG 4X6AH 4IPHA 1IYJB 5ELOA 3T1HQ 5K36G 2NN6I 2UXCL 1JJCB 1HNWL 4BBRH 4X62L 5AJ3L 2A1AA 3I2ZA 4IFDJ 1Y1WG 2JEBI 2VL6A 3NEMA 1QUQA 2E5LQ 3S14H 3PV0A 1X65A 1XNQQ 1A8VA 4YCVA 3CC4A 2A8VA 4R1JA 2UUBQ 3HOUG 1G51A 3CPWA 1IBMQ 4JBJA 3CCQA 1QVCA 2KCTA 3A5ZB 4DUZL 4IFDI 3F2DA 3TS0A 4LFBL 2JK8A 1EQRA 4P73A 3F2BA 3M9BA 2NVXH 4JI3L 4NPSA 4HIKA 1V9PA 4LF6Q 1R9TH 1IZ6A 3GO5A 4YWKA 1PFSA 3LGJA 4X65Q 1Q82C 3S17H 4BBSH 1VQFA 2NZHA 3H15A 3CMEA 3M4QA 2Z0SA 4YWMA 2WAQG 3JAMc 1E1TA 4A3GH 5M3MG 5IYDG 3CD6A 1Y1WH 1VQNA 4L5SA 5GROA 3K0XA 2R92G 3HOZG 1PH8A 1WYDA 1KRTA 3WWVA 2ZJPA 2B63G 3L7ZC 1QUQB 3ULJA 2ES2A 4DR6L 4AYBE 2CQOA 3F1ZA 1VQDA 4DV4Q 1DGSA 1YNXA 1Y14B 3TQYA 4DV0L 4DR3Q 4DV1L 2ALYB 3OW2A 5JEAJ 4R4CA 2I0QA 3PGZA 1TWGH 2Z6KC 2OQ0A 1TWHH 1S40A 1Q81C 4TQUS 4WJ4A 1HZ9A 4R4OA 4B3SQ 2BA0A 4MTNA 4P72A 4C3IH 3J7ZC 3JAMi 4LF8Q 5M3FH 2EQSA 2CCZA 2HT1A 2ZJQA 4A76A 5C0XJ 4IJHA 3PCOB 4DKAC 3OTOQ 1X9NA 1E7ZA 5LMNQ 3ERSX 2NZOA 5IWAL 2I5LX 1PH6A 3PF4A 1HNWQ 1G6PA 1BBWA 1Z9FA 2VW9A 5FJ8H 2JQOA 3G71A 2JA8G 1N32Q 3AFQA 4DV5Q 1HNZQ 3KJOA 1VQHA 1Y1VH 3BZCA 3CCEA 2HHHL 1WJJA 4KHPQ 4PZ8A 4LUOA 1JT8A 2MO1A 3S1QH 4GLVB 3S2DH 1XMOL 1YJ9A 2AWNA 3CW2C 1LUZA 3DM3A 1OXTA 4YWLA 2F3IA 1GO3E 1YITA 1BVSA 4JBWA 4DV5L 1KIXA 2JJQA 3T1HL 4DK6C 1M1KC 3TREA 4A3EG 4IJLA 4UP9A 1E1OA 4P75A 3RLNA 2VS1A 3ULLA 4JI3Q 4LF6L 1PHJA 2K50A 2MQHA 5IYCG 1SLJA 4A3FG 5EAYA 1N34L 1YHQA 1ASZA 2OQKA 3M7NA 2BH8A 1IXRA 1CUKA 2OTLA 2K5NA 4IPGA 1D7QA 4OX9Q 1LM0A 3U4VA 5IYDH 1IBML 4A93G 3A0JA 2N3SA 2GN5A 1KRSA 2WB1E 1X54A 1M90C 1K8GA 1C9OA 2XTIA 1X56A 3U58A 2RHQB 1PVOA 1JMCA 1XJVA 2HQLA 2PI2E 3U4ZA 1NY4A 4LF5Q 5FLMH 4BY7G 4NXMQ 1EQQA 2JA6H 3F8TA 3PO3H 3CC7A 3K7AH 3HOXH 2YTYA 3I7FA 4P71A 5IP7H 2UUCL 4DUZQ 4A3EH 1IBKQ 3M4OH 1AH9A 5C0XG 4DV7Q 4DR2Q 5M5XH 4NXNQ 2N8NA 1VQPA 1Q7YC 1SROA 3KJPA 3UDXA 1PH4A 3ICEA 3OYYA 4B3RQ 5C4XG 2E2JH 2YV5A 4MNOA 2ZM6Q 1KQSA 1UE5A 2Q2IA 3J80c 4POGA 1Q46A 4A3CG 3GD7A 1X3FA 2Q2UA 1JE5A 1PYSB 3KF8B 3HOYG 4BXXG 2E2HH 4YCWA 4JBMA 5FJ8G 2CWPA 4BA2I 3RR5A 2QA4A 2VUMG 3EBEA 1XPOA 2KHJA 1VQ4A 3FHWA 1YHAA 3EN2A 3AYHB 1LTLA 4JI1L 1K83H 5GAEC 1I6HH 1N36L 2JA7H 2EXDA 1UE6A 3MEFA 5M3FG 3I4NG 2D0PA 2MO0A 3CCVA 1B7YB 5C44G 4RG1A 4B3ML 2PNHA 3HOVG 2WB1G 3HKSA 2JA7G 3I4MG 3J81j 1PA6A 1ASYA 2YU9H 2FXQA 2PQAB 3PIOA 2K4KA 2IHFA 4JI2Q 4DR1L 2ZTCA 3I56A 5IT9c 4BBRG 4GOPA 5C0XI 3UDGA 1X3EA 4JG2A 2B29A 2QEXA 4A75A 4DNIA 2BA1A 4JC0A 3A5UA 3PF5A 2UU9L 4LW1A 4LF7L 2LSSA 3UE1A 4LFAQ