2A19A

Pkr kinase domain- eif2alpha- amp-pnp complex.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
165
Chain Sequence
SSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
total genus 46
structure length 165
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a19A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a19A01
4FDBA 4P75A 3L2PA 4A3EH 1MKHA 2IHEA 5IY0A 1PH7A 1GM5A 3J7ZC 1RL2A 2K5HA 3TEHB 5LMUL 4A3BG 3HKZG 4DR5L 3S17H 3H3VI 2NZHA 4BBSG 2K4KA 2K5VA 4AYBE 4LF9Q 2VUMH 3CP0A 4GNXC 4AIMA 1OXXK 1BVSA 2ASBA 1HR0W 4OO1G 2ID0A 2NZOA 1YI2A 1JMCA 1Q1EA 3BZKA 3RLFA 5EAYA 1VQGA 1SFOH 5JJLA 4IPHA 2NVTH 4LF4Q 3CCUA 2R93H 2EQSA 3S14H 4JBKA 4X62L 4LUOA 3K8AA 3PV0A 4DPGA 3MEFA 2KENA 2E5LL 4OX9Q 4LW1A 2KCMA 2VY3A 4IOAA 3I4MG 4DV4L 1XTDA 3K80C 5C4XG 3CCLA 5IWAQ 1J5EL 4TQUS 5C0XI 1YHAA 4MTNA 1G6PA 5JEAG 3ZJYC 4GLXA 1XNRL 2D0OA 1XMOQ 1K9MC 2JA5H 1PH9A 1IBLL 4UP8A 4X65Q 2N49A 3G48A 4DR3Q 3FP9A 4DUYL 1YJ9A 3KF6A 3G71A 3J81i 3J80c 4A3BH 1TWHH 2ATWA 1AE2A 3HOUG 2UXBL 3E9IA 4DV3Q 2UXCQ 1JB7A 3UDGA 2JE6I 3CCJA 4XIGS 3H0GG 2GVAA 3TQYA 3TS0A 2Q2TA 4JI2L 1UEBA 4KHZA 2PQAA 4KHPQ 2R7ZG 3G4SA 1L1OC 4DUZQ 2I0QA 5C3EG 3A74A 1QUQA 4A3KG 5JJKA 2A19A 1EQRA 4JG2A 3ULLA 3CCQA 4JI7Q 1X3FA 2MO0A 5IP7G 2JA8G 3GTOH 1EFWA 2VQFL 3CPWA 4BXXH 2KCTA 4RG1A 4DK6C 2OWOA 3I4NG 2B3GA 3GDEA 2OQ0A 2DGYA 2PNHA 3PSIA 1VQIA 3PO3G 4YY3Q 1B70B 5C4XH 2YTXA 4JI6L 3OTOQ 1Y1WG 4LF6L 1VQEA 3GTGH 1PH6A 1IBKQ 2KBNA 1UE5A 1VQOA 1YVCA 4DV2Q 4JBJA 4HIKA 4DV0L 4A3GH 2RF4A 1HZ9A 1PV4A 2UU9Q 4P73A 3GTLH 3D0FA 4GN5A 4LWCA 1X3EA 4DV6L 1TWFH 1MIUA 5AJ3L 4GOPB 3HOUH 4K0KL 5IT9c 5JEAJ 1Q81C 5C44H 4MNOA 4IFDI 4YWLA 1NMGA 2NN6I 1EQQA 1LYLA 2R6GA 1HNWQ 4JI4Q 3H0GH 2IX0A 1CSQA 3CCVA 1CKNA 2BH8A 3UE1A 2JQOA 4X66Q 4AQYQ 2YV5A 4DR4Q 5C3EH 1XNQQ 4B3RQ 4LFCQ 4GN3B 4WJ4A 2HHHQ 3FKIG 3U58A 2A1AA 2PI2E 5IP7H 4HJ9A 4POGA 1TWCH 4HIOA 4JOIA 3I4OA 4LUZA 1N9WA 5H1SE 5IYDG 1XMQL 3JAMi 4RMFA 4JI0Q 4LNQA 4AH6A 3T1HQ 3PO3H 4LF5Q 4R4IA 4BBRH 4LF7Q 2I5HA 4IFDG 1Y1WH 4L5RC 4APVA 2D62A 1CKMA 2E2HH 4BA1I 1SR3A 4OWXB 1V43A 2GN5A 3Q8DA 1YZ7A 1I3QH 4DV5L 4DKAC 2FXQA 3PO2H 4OONA 4DK3C 4Y52H 4B3TQ 1H95A 5IYCG 1ASYA 4GS3A 1EOVA 2UUAL 4LF9L 3HOVH 2WFWA 4A93G 2WAQG 2N8NA 2CQOA 3AEVA 4YHHL 1Q86C 2ZJQA 2HT1A 1UWVA 4NXNQ 4QGUA 1C0AA 1E1TA 1E22A 1WYDA 1HNZQ 3H15A 4DV7L 3F1ZA 1Q1BA 1I94Q 1WI5A 1EIFA 1B8AA 3KF8B 4LF4L 5JJIA 4JI1Q 4A3CG 3CPFA 2AWNA 3RNUA 1XPUA 3B6YA 4IJLA 2D0PA 3CC2A 1TWGH 1HNXQ 5HGQA 3GTMH 5FLMH 1K73C 4JI3Q 3JC66 3DLLA 5ELOA 4IPDA 2ZM6Q 4LFBQ 1MJCA 1SROA 4HIMA 1IBMQ 4UP7A 1SE8A 3PF4A 5LMNQ 4JV5L 5C4JH 2JEBI 1HH2P 3KYHC 2ZJPA 4B3SL 3T1YL 1N34Q 1X6OA 1XMOL 1NBWA 4A4IA 4GNXA 1NMFA 2C35B 2WB1E 1QZHA 3GTPH 4LUVA 1WCMG 1OXUA 4JCVE 4C3JH 1FJGQ 1Z9FA 3BJUA 4OWTB 4KLKA 4WJ3M 4X6AH 5M5YH 2Q2UA 1VQFA 5FJ8H 3KJOA 4LF8Q 5DLQE 4A93H 4IFDJ 1PYBA 1SMXA 4KI0A 2CCZA 1VQBA 5K36G 1EWIA 4GKKL 4UY8C 4UPAA 1YIJA 2XTIA 3G6EA 4A76A 5J3BA 3S1MH 4QQBX 4NXMQ 4UP9A 5BR8L 3HOXG 3S1RH 1N32Q 4DR2L 4JYAL 2A8VA 3S2HH 4B3ML 2JA7G 2OTJA 3I2ZA 4IJHA 4R1JA 5LMUQ 2JA6G 4DR5Q 3PF5A 1LUZA 4BBSH 2HQLA 2K14A 1KRSA 3D31A 1YHQA 1R9TH 4DR6L 1FGUA 2UXDL 1S3OA 2UUBQ 4MZ9A 4POFA 1Z47A 3CCMA 3J80i 4A3FG 2UUCQ 4AYBG 4NPSA 4NB3A 4DR7L 1E24A 5LMNW 1VQMA 1G291 1C9OA 5C0XG 4JI8L 1X9NA 3KDFA 3EIVA 4X62Q 1QVCA 3F8TA 1I6HH 1UE6A 1GD7A 1L1OA 2E5LQ 4L5QA 2B63G 2Z6KA 4GOPC 2VNUD 1VQDA 3ULJA 2WB1G 2F4VQ 4H02A 3I4MH 3CD6A 3CCSA 1J5EQ 3W1GA 4IOCA 1PH5A 3KF6B 1IYJB 4PZ7A 3CMAA 3E0EA 2QA4A 4DV1L 3H3VH 3TS2A 1KIXA 2E2JH 4GKJL 3CQZH 1XNRQ 3I55A 1IBLQ 1XNQL 2IX1A 3BZCA 4A3DG 3HOXH 1E7ZA 4A3MG 1CKOA 1Y1VG 1W3SA 4HJAA 2PQAB 1HR0L 1KL9A 4X64L 4DUYQ 1VQKA 1OXVA 2VQEL 1GKHA 3CW2C 1BBWA 1J6QA 4GLAC 1VQPA 1X3GA 1QUQB 2K52A 3TREA 1S72A 2JA6H 3U4ZA 2R92G 1N33L 2ZTEA 3EBEA 3NBHB 2KHIA 1PA6A 3GTKH 4A3LG 1P8LA 2N3SA 1IZ6A 4JI2Q 2HIVA 5M3FG 4PG3A 4YCVA 4IO9A 2R7ZH 3ICEA 4LF7L 1A63A 3PIOA 3PIPA 2JEAI 5M3MG 4A3KH 3KLWA 3STBD 4LFAL 1I50H 1E3PA 1U0LA 3PCOB 2E2IH 1CSPA 1UE7A 5GQOA 2JA8H 1K8GA 2JJQA 1YBYA 3K7AH 5IYBG 2IHFA 2VQFQ 5GROA 1I5FA 2I5MX 3RN5A 3K0XA 2NVQH 3I4NH 4QY7A 4JI5L 1SRUA 2AHOB 3BU2A 2YTYA 5C0XJ 2CKZB 4JI6Q 4GN4B 4DR1L 2QGQA 3HKZE 3KFUA 4LF6Q 1JJ2A 1KXLA 2NN6G 3UDXA 1N36L 4JOIC 4A3EG 3ERSX 3PUXA 1JE5A 4A3IG 1EYGA 3M9BA 1FVIA 2F52A 3NENA 3JAMc 4DV0Q 3PUVA 1PH1A 1JJCB 1Y1VH 2ZTCA 1VQ6A 2VUMG 1PVOA 1CKNB 4DV6Q 2YTVA 1HJPA 1DGSA 1VS0A 5AJ3Q 1XMQQ 1VQ7A 2Z0SA 4QIWE 1VQNA 2BH2A 4K0KQ 4YWKA 4A3JG 3CC7A 1WOCA 2OTLA 2JK8A 1KRTA 4C3IH 4EX5A 3RLOA 5E7NA 2AWOA 2K75A 4P72A 3W5OA 5GAEC 1Q82C 2AMCB 1KD1C 2Q2HA 5GADC 3CC4A 3S1QH 1GO3E 4BY1G 3I56A 4R4TA 4B3RL 3FKIH 1X65A 5M5XH 3KJPA 3HFZB 4JBMA 4HJ5A 4OX9L 4L5TA 2JA9A 2N78A 3NEMA 5IYDH 3CAMA 1VCIA 2WP8J 1P16A 5M5WH 3OW2A 3S24A 2VZAA 5IWAL 4HJ8A 1PH3A 1IL2A 3RZDH 3CMEA 2AKWB 1C7YA 3HKSA 4A75A 1XPRA 3HOZG 1LTLA 4JBWA 3S1NH 1PFSA 4X65L 1L2FA 2CFMA 4DR3L 1N32L 1N8RC 1VQ8A 2CWAA 4A3IH 2KHJA 4DV5Q 1QVFA 3K81C 3DM3A 1YJNA 2MO1A 4O0AA 4DV3L 5IP9G 5IYCH 2PMZE 2UXCL 1AH9A 4XTCS 2UUAQ 1IXRA 3ULPA 3HOWG 3M4OH 3AFQA 4YHHQ 1YITA 2UUBL 1RIPA 4KHPL 4A3JH 3STBC 1G51A 2ZJRA 1B7YB 4DV7Q 4DUZL 3J7A5 2UUCL 2YU9H 4DNIA 1E1OA 4OXPA 4JC0A 4A3CH 1VQCA 4P71A 2VL6A 1K3RA 4R4QA 3RN2A 4JI7L 3VDYA 1QZGA 4BXXG 4BY1H 5ELNA 1S40A 1O7IA 3WWVA 1FL0A 4GNXB 2BA1A 1VQJA 1VQ5A 1X56A 3HOYG 4L5SA 1WJJA 1Q8KA 2F4VL 3SGIA 4OWWB 4YY3L 1VQ4A 1NE3A 4J15A 2ALYB 4C2MH 3OTOL 4BY7G 4JV5Q 2L15A 1OTCA 1KAWA 3J81c 3I7FA 4PZ6A 1XJVA 1K8AC 1IBKL 2Y0SE 4B3SQ 3T1YQ 4ALPA 3HOZH 2E8GA 4DV2L 4HJ7A 2V1CC 4A3GG 1L0WA 5GAGC 2UU9L 3F2BA 2H5XA 1WCMH 3TRZA 4IPGA 3UE0A 3RLNA 3F2CA 4BA2I 1V9PA 5C44G 1HZBA 4IPCA 5IP9H 4DV4Q 1YHBA 3HOWH 3GTQH 3J81j 1X54A 1HNWL 4R4CA 4JI4L 3CCRA 2I5LX 1OXTA 3L7ZC 1TWAH 1PH2A 4GKKQ 4X66L 2OQKA 4AQYL 4DR4L 1JT8A 4GOPA 1QVGA 1V1QA 2Z6KC 1EUJA 4LFCL 5BR8Q 4TVAB 3F2DA 1W2BA 4DR2Q 1KC8C 2LSSA 2HHHL 4JYAQ 3PUWA 3M7NA 1TXYA 4B3MQ 2JA7H 1NTGA 3FHWA 1VQAA 1SN8A 3GO5A 1Q7YC 1XPOA 1MJEA 4DAMA 2R7DA 4JI0L 2DUDA 3MXNB 5HY6A 4DR6Q 3KDFB 2UXDQ 3AQQA 1Q12A 3AFPA 3HOYH 1NY4A 5FLXc 3T1HL 2UXBQ 2B29A 3U4VA 1HZAA 4LF5L 1PYSB 4BBRG 1L1OB 1Q46A 1YJWA 3RZOH 1M1KC 4A3FH 1VQ9A 4BY7H 4DR7Q 3UDIA 2VS1A 3NELA 1D8LA 3CXCA 2WAQE 3A5UA 4JI8Q 2ZTDA 1BBUA 3PO2G 1AE3A 2LXKA 1Y14B 5IE8A 4HIDA 2LXJA 4B3TL 1VQHA 4QJFA 3ER0A 2IY5B 3HOVG 2Y0SG 1PH8A 3M85A 2B63H 2RHQB 2RHSB 4NXNL 3PUZA 4GLVB 3PUYA 1HNZL 4YCUA 1VQLA 2K5NA 4O2DA 1NJIC 1I94L 4DV1Q 1U5KA 2EXDA 4P74A 4GKJQ 4JI1L 1YNXA 1D7QA 2MFIA 4YCWA 1A62A 5GAHC 3CF5A 3M3YH 1GVPA 1HNXL 1UE1A 3EN2A 5FLMG 4A3DH 4A3MH 2F3IA 4C3HH 1HR0Q 4JI3L 3U50C 2ES2A 4X64Q 3S2DH 3S16H 1CUKA 2VQEQ 3IRBA 2MNAA 2ZM6L 2YYZA 3AYHB 3UDFA 1WFQA 2QEXA 1A8VA 4LFBL 1T9HA 4Y7NH 3S15H 1IBML 2R92H 1N33Q 5LMNL 2VW9A 2PI2A 2MQHA 2R7FA 4A3LH 4PMWA 4EQ5A 3GD7A 5M3FH 2R93G 4YWMA 2IT1A 1A0IA 3KOJA 1N34L 1BKBA 2NVXH 2GVBA 4DAYB 3CCEA 3LGJA 1K83H 1EIYB 1YEZA 5M3MH 1SLJA 4LFAQ 1K0RA 2HIXA 3W1BA 1FJGL 4OO1I 1PHJA 2XGTA 5IYBH 3K7UC 4ME3A 3L0OA 2K50A 1KHIA 3PGZA 1KQSA 4R4OA 2Q2IA 1OXSC 3RR5A 2BA0A 2EIFA 3A5ZB 1HZCA 3E9HA 4QL5A 5FJ8G 1ASZA 4JI5Q 4LF8L 1JJGA 2CWPA 2RCNA 3M4QA 2OCEA 1LM0A 3GTJH 1M90C 2JA5G 3OYYA 1X55A 4PZ8A 4DR1Q 2NVYH 3M4PA 4NXML 1YZ6A 1PH4A 1N36Q 3A0JA
chains in the Genus database with same CATH superfamily
4JMUA 1SNMA 3MXGA 3NUCA 4C2MB 2CHBD 2ZIUA 3I28A 1C8CA 5ELEA 3J7ZC 4A3BG 4QZHA 2K60A 2K5HA 3JPTA 1FNVA 2RKSA 4FZMA 3JAML 3S17H 2IWHA 3RB0A 4LF9Q 5J2JA 2K89A 4GNXC 5CC4A 1PRTF 4ZAIA 4AIMA 1HR0W 4Y2JA 3GDXA 1Q1EA 3RLFA 2HVHA 1SFOH 2YB1A 4BJQA 2CH4W 5AK5A 2NVTH 4LF4Q 3I4MB 2GH1A 1A15A 2B0CA 4DFMA 4ECUA 3K8AA 3VCBA 4RT2A 9ICOA 1F9PA 4DL7A 2KENA 2BPGA 5KAIU 5ALRA 4AYBC 8ICQA 8ICIA 5DLGA 2VY3A 2L0CA 4R8IA 4DLGA 4DV4L 4DO9A 5HHIA 2HBJA 1H9MA 2WHEA 5J2AA 1CM9A 1J5EL 1HUZA 4TQUS 1S4ZA 4OEMB 3DWQA 4GLXA 5JEAG 1XNRL 2JA5H 4Q44A 2NUCA 1Z4NA 1KLNA 1EYCA 1IBLL 1ESFA 2N49A 3G48A 3N6RA 1SEBD 2F0IA 3G71A 3VYSA 4AYBB 4A3BH 5KG6A 2LMRA 1HEKA 3SAFA 8ICFA 1I50B 8ICOA 4OGQC 4DV3Q 2H3FA 1SKRA 2XRSD 2C28A 3CCJA 4A3EB 4ED7A 3N28A 1EFID 3FPUB 2PQAA 4KHZA 2R7ZG 1L8OA 4LK1C 3G4SA 5KFEA 1Q3LA 2ES6A 3RJHA 1L1OC 1STGA 1ZEQX 2B63B 3RH4A 1WTRA 1FFVA 3H40A 2KIVA 2VA2A 1EQRA 3R2TA 1BCPF 4JG2A 3J81E 4MF8A 5IP7G 1IKLA 1K1QA 2JA8G 1EFWA 4OO1J 2AU0A 2UVVA 3CPWA 5IIMA 5KFOA 1A6SA 4ZLTF 1CQVA 5C5JA 2B3GA 3NVYA 2AH5A 3UMBA 2AQ2B 2A68D 3E0JA 3EFXD 1BUVT 4DN4M 5A0LA 1G6ZA 4CJ2C 3PO3G 3A7LA 3S16B 2YTXA 2RDJA 4TUPA 2KJ9A 3D6JA 1S5CD 3S15B 2QB0B 4PNYA 2JP1A 4LZDA 4Z9CB 3VA7A 5JEAH 1NNXA 2EZVA 4HIKA 4KITB 5ELBA 4CDCC 2FPLA 4P4MA 5CORA 1KW4A 3M8RA 1JWMD 4LWCA 2NVXB 4XQ8A 1MIUA 5IGBA 4PQXA 4GOPB 1D5MC 3NSWA 4IFDI 5C44H 3FKIB 4I2BA 4YWLA 1LTTD 5M5XB 3KBBA 4BS9A 4NL9C 5EWEA 4PZOA 2WAQC 4ECVA 4X66Q 4AQYQ 4BXOB 3BDOA 3RZDB 3HG9A 4RZRA 4N9PA 3WKBA 9ICJA 2F76X 1V97A 5J2KA 2R8GA 2NVYB 2PI2E 3QJYA 5IP7H 4POGA 3MGHA 2MUTA 3C23A 3T79A 1TWCH 3P75A 3TN2A 4EQOA 2JXMB 1TAMA 2HHVA 2HD3A 2WACA 3I4OA 4KD3A 4KJOA 1TK0A 1XMQL 4LZGA 9ICIA 4JI0Q 2O5JC 1QSLA 2HUGA 4NLGA 4RCNA 3T1HQ 1SNCA 3PO3H 3IP4B 4QJFB 4IR1A 1ZD3A 1XS9D 2K32A 4LF7Q 3V6JA 4ILWA 2D62A 2VIXA 4ZH4A 1ZQFA 2XWBB 4A3JB 1H9RA 3ICXA 2NTSA 2CQAA 2XN9C 4J9QA 2WFAA 4JV0A 5EBDA 1H95A 4GS3A 1EOVA 4QUFA 1SL1A 5CV9A 2WFWA 3S14B 3OW7A 1PZJD 2CQOA 4YHHL 2ZJQA 2HT1A 1NUCA 4ECWA 2FE9A 1E1TA 1WYDA 3H8JA 5ALEA 4XXEA 3H15A 3W2DA 3N7SC 2ALZA 3M1YA 2QARB 4M9JA 1EIFA 4RQ8A 4CGZA 1WI5A 2HCIA 3EVQA 5D65A 5JJIA 2SNMA 1FD7D 2D0PA 1TWGH 3MR5A 5T1IA 4DSFA 5HGQA 5FLMH 1D6EC 2XY6A 4KLIA 3U26A 3EA6A 4IPDA 4RQMA 4EZ9A 2ZM6Q 2F8LA 3RH5A 2K8CB 1MJCA 4R64A 5ALIA 4Z6EA 1S97A 3CKIB 2G06A 3PF4A 4C7ZA 4TKOB 5KAFU 4GXKA 1HTPA 1JALA 4J1MA 2WF6A 2JEBI 4JV5L 4IQUA 3R8BA 3UXNA 8ICRA 3KYHC 2XO7A 2I1QA 2F0TA 4EBCA 3DM1A 1X6OA 1XMOL 4KN4A 2Z9HA 2W9MA 2C35B 2W43A 3GTPH 4EGVA 2JZBB 1IM4A 1WCMG 4C3JH 4DQQA 2CPRA 2K05A 1FJGQ 1GJXA 1L3SA 3IAYA 3WDNA 2PYKA 2QILA 4NP5A 3H6MA 5DNFA 3WKDA 1VQFA 5BOLA 5FJ8H 1E0BA 1RXVA 1SMXA 4IRKA 2F4IA 5K36G 1BPXA 1K28A 3E3XA 1YIJA 5IIIA 4MFCA 2WB1C 5J2EA 5EQ0A 3S1RH 1Y88A 2B8FA 1TFRA 2G09A 2MAXA 1F77A 1CT1D 4EVOA 2A8VA 4B3ML 3RZOB 3UQ2A 2DQNB 5LMUQ 1ZQGA 9ICCA 4QUCA 4DSIA 1X40A 1YHQA 4H13C 4A3GB 3BDPA 1R9TH 5DEHA 4HTHA 5IIOA 2UUBQ 3ND9A 1JORA 2J6TA 1TWFB 5CR0A 2KA7A 1I4GA 3WKAA 4AYBG 3DEEA 1CA6A 1E24A 4PHAA 3UI2A 5LMNW 1C9OA 4JI8L 2E3TA 3KDFA 3EIVA 5KFSA 3X3MA 5L9XA 2TMPA 4KY5A 2F1HA 4GC7A 1UE6A 1I6HH 1GD7A 3RB6A 1IYVA 2B63G 4US9A 1U48A 2K8AA 5ELCA 4QIWF 1LTSD 4H02A 2KKPA 3WK4A 4M9LA 2K01A 3TADC 3AB9A 5EE1A 4BWGB 3I4MH 3QWNA 2RA4A 5C6AA 4PGQA 4IOCA 3H3VH 1KXLA 3E0EA 5K36H 3TACB 2DGZA 3KBXA 1PZNA 3HRDD 3IDWA 4EELA 3RJJA 3GP7A 2PNRC 2K33A 2W9AA 1BPDA 1E7ZA 4C8MA 4GZYC 5AKLA 4HJAA 4BBRB 1NK6A 1RM6C 4DUYQ 2E2HB 1FEZA 2UXBQ 4DSKA 1J6QA 1IHZA 2EJMA 2K4EA 1X3GA 2CW0D 5C3XA 1S72A 4UB4A 3U4ZA 2DF4B 4CKCA 1XO0A 1ZQNA 1V1PB 3J80L 1PVRA 3EBEA 2HBKA 3NBHB 1N33L 4CJ0B 3TKAA 2A73B 3K5MA 1ZKOA 4IO9A 9ICSA 3A55A 3HOVB 4M1UB 1BBXC 2WF8A 2JGAA 3ICEA 3GV3A 2RLTA 2JEAI 5M3MG 4A3KH 2H3VA 4KTAA 1I50H 3GTJB 1TU2B 1U0LA 4RFBA 4EQNA 3KHGA 1CSPA 1RG6A 4UQGA 2JJQA 3K7AH 5IYBG 2W54A 3GU3A 2IHFA 4IL6U 2VQFQ 4F5OA 4UBBA 4FS2A 1SXEA 3FC4A 3GTMB 2VANA 2AQ0A 3BQ0A 2RSNA 2YTYA 1WUDA 3B9JA 3HGBA 2D9UA 4JI6Q 5JVG3 1X9WA 2QGQA 4F5PA 4LF6Q 1AROP 8ICLA 2J0TD 3UDXA 1M6YA 4JOIC 4LJXA 1QCKA 1IIPA 1KSPA 3RJEA 3ERSX 4A3EG 4IQWA 4DV0Q 4BXXH 3PUVA 3FDTA 1L7OA 5AKGA 2H4OA 3IV6A 2R93B 2UVUA 2ZTCA 1LT5D 2R8KA 3FDSA 1CKNB 5H2FU 4DV6Q 1HJPA 1VS0A 2PI4A 1EY0A 1VQ7A 4RPXA 5CP2A 4QIWE 3E2EA 5KG0A 1U4BA 4A3JG 2OTLA 3BQ7A 3LDAA 1T5XD 2F0QA 2BCQA 5M5YB 4UB8U 3RLOA 1BCPC 2EXZA 2M0NA 4PZNA 1KD1C 2Q2HA 3BS7A 4DU9A 5FOBB 3HX0A 1L0XB 3GIKA 3FKIH 5KNIA 3IFTA 5M5XH 3S1MB 5AIBA 4FBUA 4OX9L 2FINB 1WTHA 1ZYQA 3NEMA 4C4RA 4IQVA 1VCIA 1IL2A 4HJ8A 2VZAA 2EH9A 2BQ3A 2KZMA 2DNCA 2FMMA 3RZDH 5D4BA 3CU7A 4FXGC 3VYRA 2WINB 2K4PA 1MD2D 5CGKA 1OUQA 1J2MA 2G5HB 2KV2A 1SJHD 1VQ8A 4ZKBB 3SAHA 4L6TB 5KT7A 3C5FA 1HTLD 2EVBA 2KHJA 3QNMA 2XIWA 3QE9Y 5LHY1 1QVFA 3K81C 1GUWA 5IOCA 4QF4A 4NV0A 2QF7A 3ND8A 5CV8A 5IYCH 2FPKA 3QB3A 4XTCS 1AH9A 3GTOB 3ULPA 1N5WA 4O3OA 5KFAA 1LV9A 2VA8A 4A3JH 2H1EA 4DUZL 1KDAA 4DNIA 1XXGA 5I9OA 2JH1A 5EE9A 4UAWA 4A3CH 5C4XB 1ZD2P 3QZ7A 4F4YA 4R4QA 4ZQ3A 1QWYA 1SV4A 1QZGA 2B2YC 5J2DA 1B3AA 5AKHA 5AM1A 1O7IA 4Q43A 9ICVA 3VR3A 4L5SA 1BO0A 2P6RA 4F8MA 4Z6DA 4YY3L 4C4TA 4I2GA 3M3YB 2DJFC 3I3CA 3HOUB 1H9JA 4B3SQ 4MIUA 3T1YQ 3OTQA 4ALPA 4DV2L 2NRTA 3K58A 3H0GB 8ICVA 3OWEB 4UAZA 3TI0A 1YT3A 1ZQVA 2F3NA 1SMYD 5GAGC 4MEYA 2E8PA 3TRZA 2RP5A 1QQ5A 3C1ZA 4IPGA 4QY7A 1MN8A 4UB5A 4X3KA 1NK7A 5EKLA 5A2QL 2ISOA 2OT2A 4JPBW 5D3DA 1V9PA 4KK7A 1MSGA 2A6HC 2J7ZA 1DOQA 4UATA 4F91B 2BPFA 5ALHA 4DOAA 4F4KA 9ICPA 2C5CA 5BOMA 2FLPA 4R4CA 1AZQA 2ZIVB 4C1NK 1X6IA 3I4NB 3V7KA 5L1MA 3PO4A 3KLSX 4XA5A 1ZQYA 4DR4L 3C3LA 4FNFA 4EEKA 2E8OA 1PYWD 3NXWA 4TVAB 4LFCL 9ICLA 1W2BA 2HHHL 5HGTA 4JYAQ 3PUWA 2K03A 1K0SA 1PUZA 2W8KA 1L6NA 2B2UC 2JA7H 1NTGA 3FHWA 4IS7A 1KDBA 3GO5A 1MJEA 1Q7YC 1II3A 1CTMA 4KLQA 1ONLA 1XWEA 3PO2B 2H3IA 1ZJMA 2PZTA 2W9CB 4DR6Q 4PPXA 4ECTA 2NV3A 2W03A 4YD2A 1NY4A 4GFJA 5FLXc 1GUGA 1I4QA 4YVZA 4BBRG 1N63A 3RZOH 1M1KC 2IPKD 3NELA 5CV4A 5TSSA 2ZTDA 8ICBA 7ICHA 2BDNA 5KT5A 5HMMA 2LXKA 1U4LA 5IE8A 4HIDA 4B3TL 1IYUA 1HXYD 3SK6A 4H44C 3HOVG 2IA6A 2Y0SG 2OXOA 4AYBF 3M85A 3S1QB 2RHQB 3PUZA 4RGMA 3QU7A 1HNZL 1ZQXA 5DB9A 4WORA 5IGEA 2BQUA 1QH9A 2K5NA 4O3PA 4O2DA 2BCSA 1TY2A 5C4JB 1O80A 4P74A 4DV1Q 8ICHA 2BQRA 2X69A 5GAHC 2GOLA 5KG5A 3F5AA 3CYMA 3JPOA 7ICLA 1GVPA 1RHPA 1S5DD 1UAPA 1UE1A 4O42A 1HNXL 2EANA 2ZXHA 2EE1A 1ENCA 2EJGC 1HR0Q 3S1NB 3UXPA 2QEXA 4TQRA 1WFQA 3I70A 3H0MB 1PZKD 1ET6A 4RNMA 1T9HA 4F72A 2EYJA 2F0UA 2NB0A 3RBEA 1IBML 1BQQT 7ICMA 1NK0A 3NWTA 4IALA 2MGSA 2R7FA 4MTKA 2A6HD 2PI5A 2K5QA 4EQ5A 4ED3A 2R93G 1SWWA 4ECQA 1NJZA 1BKBA 1BNOA 1ESRA 4RQ7A 3BDCA 1GXDC 2A74C 1TE2A 1K83H 1YEZA 4XT3B 3W1BA 3KLRA 1LTAD 1ILQA 1AQ6A 1ZETA 4KLGA 1QSYA 3QOLA 3C46A 2K50A 3NGDA 3PGZA 3MZ5A 1MSWD 4XUSA 2BA0A 4JI5Q 1HZCA 1ASZA 4LF8L 5L1LA 4F2SA 4RPZA 2RCNA 4EYHB 4DOBA 3NE5B 1A0PA 4Q8EA 3GTJH 4O5CA 3OYYA 4ELTA 2ZUCA 2AQ3B 9ICWA 1FYCA 2FPMA 3M4PA 1OTCA 4NXML 3A0JA 1SYDA 5BN3A 4QNLA 4JV2A 2K5WA 5EKKA 1GM5A 4DLEA 1A2UA 4YQWA 3GIIA 1LACA 1RL2A 3TEHB 3AU7A 1B50A 4DR5L 3H3VI 4GXIA 4QZ8A 4ED2A 4ODGA 5EPJA 4AYBE 3CP0A 4Q0FA 5KFNA 1BVSA 2HCFA 3QX7A 4OO1G 2IMWP 2NZOA 1ET9A 4YR3A 3RJGA 1VQGA 2R93H 2D2CC 4X62L 4EX7A 1ZQ1C 3RUZA 1TK5A 3WKEA 2VA3A 3PV0A 3MEFA 4TRDA 2E5LL 4DQSA 3HOXB 4KLOA 4IOAA 2BCVA 3AMZA 1CHPD 1SE2A 5C4XG 4KLSA 1VLBA 4DV4Q 2PQEA 5CV7A 1SV0C 5J0OA 2OM6A 1NNLA 4J9NA 2AGPA 5DBAA 3OHXC 1SXDA 3X3NA 1G6PA 4CDFC 1UCVA 3I4LA 4PGYA 1A3TA 1T5EA 5I4DA 1PH9A 2WF5A 3A0BU 3IG5A 4OD0A 4M9HA 4EQPA 4DR3Q 4KN7A 3KHRA 1YJ9A 2W9BA 4F5NA 1TR5A 3H91A 2ATWA 3HOUG 4XDXA 3K1ZA 8ICTA 3BQTA 1EWCA 2F0DA 4M8AA 2D6FC 3GV6A 3PR5B 3UDGA 1JMSA 3H0GG 3HP6A 3TS0A 2OEHA 4JI2L 4KHPQ 1RD9D 3Q22A 1T8EA 1IW7D 3MC0B 3E0FA 1QUQA 3QXGA 3C2LA 4IUPA 2KP7A 3RF9A 2KFZA 4JI7Q 3GTOH 3AL0B 3UMGA 2OWOA 4RG1A 3RJFA 3I4NG 3GDEA 5DG7A 2DGYA 3FAHA 3PSIA 1D2BA 1VQIA 3S2DB 4F7XA 5FP0A 5C4XH 3MGVA 1VQEA 4FFDA 2RRDA 3GTGH 1IBKQ 2R92B 1ENFA 1STAA 2KBNA 1UE5A 3FRPB 1VQOA 4UAUA 1YVCA 3HRZC 3PW5A 4C3IB 4M9NA 2BDPA 1HZ9A 1PV4A 4UASA 1JOQA 4CDEC 9ICNA 5KFFA 3D0FA 1L7MA 1FR3A 1JQYD 1UUPA 3G7LA 3BS5A 2IL8A 3HOUH 4CKEA 1SB3C 2ODGA 2OEOA 3OIQA 5IT9c 1Q81C 4QWBA 1NMGA 3D3RA 4K14A 3IG8A 4XQQA 3GFKB 5DM63 4JI4Q 2XVTA 1B43A 5KFJA 2PXIA 2EPBA 2KMDA 3H0GH 1T4GA 2IX0A 4R65A 4TUQA 2BH8A 3T16A 2JQOA 1J9OA 5FLXE 1JIHA 2WB1F 1EU4A 4DAVA 3R93A 2EYFA 3U58A 1EXNA 2OHFA 2XWJB 3HILA 4LUZA 5H1SE 5IYDG 5CHGA 4A3IB 2BKEA 1X2IA 1R4QB 4OJLA 3S6JA 2XY7A 3NTUA 1CZGA 3E5SA 4AH6A 2WF7A 1G2SA 4LF5Q 2JHDA 2EZXA 2VUMB 3NVWA 1N61A 2I5HA 3MAQA 4L5RC 5JUMA 2KIWA 4C8OA 2KK0A 1ZQHA 2L12A 1NKBA 3Q8DA 1YZ7A 1C20A 4DKAC 3PO2H 1SIJA 2XIDA 1XSNA 3D4WA 1Z00A 4JUZA 1I6VC 4P0PA 3TARA 4XQJA 1ASYA 3GV5B 2FLLA 4I27A 4LF9L 2B2TC 4KTQA 4HCSA 1F9QA 3AEVA 4EEYA 2OH2A 5T1GA 3Q0AA 5EPKA 4BY1B 4NXNQ 1C0AA 3NVZA 2XGPA 1ZQZA 4DV7L 3HPOA 5HP4A 4LF4L 4JI1Q 3IRUA 3CPFA 4A8EA 3B6YA 1KBUA 3MWYW 4NLCA 3JPSA 1UHUA 4ID6A 4IJLA 3H3VC 3F53A 2A68C 2Q8IB 1RZTA 3AM9A 3SXHA 7ICOA 5ALSA 2KJ8A 4K4IA 1B2TA 1MI2A 3H0LB 4DOCA 2BDUA 3SK8A 2JR5A 4LFBQ 1MGSA 1H9KA 1SROA 1RTOA 1WCMB 4OCZA 4YR2A 3OGUA 7ICQA 2ZIXB 5LMNQ 4IUQA 4R8NA 1V8QA 2A1JA 3TMEA 5IGFA 2ZJPA 3HOWB 3SR6A 4YD1A 1NBWA 4A4IA 4GNXA 1JWUD 3BVGA 1NMFA 2WB1E 4ME5A 4OJOA 3JPPA 2AJQA 2Z7JA 2JH7A 1XTCD 2DFLA 4DSLA 1EYAA 4KLKA 1LO5D 2XRQD 4YR0A 1V85A 5L1KA 3QR8A 5J2HA 3MVVA 1QOHA 1RF2D 5DLQE 4IFDJ 4QWCA 2LPEA 2ZIUB 3E58A 1PYBA 4R8UA 3QZ8A 2F0SA 4KI0A 4QZEA 3SD7A 5IIKA 1EWIA 3DWAA 3I4NH 3VYTA 5EE0A 5J3BA 4QQBX 1CA5A 1ZOLA 4UP9A 3C2KA 3HOXG 1H9SA 4DXFA 1URJA 1Z1VA 4DL5A 4BDPA 4BY7B 3I2ZA 4IJHA 1WCLA 1DXSA 5ALWA 3U9SA 2ICIA 4U6PA 1ZD4A 4HMJA 4NM2A 5K5PA 2K14A 1KRSA 4QZBA 4K4GA 4ABNA 1JRPA 2JRZA 4RQ4A 2UXDL 2YX8A 4HYKA 8ICYA 2B8GA 7ICJA 2IW3A 4MZ9A 1Z47A 3AQFA 1EIGA 2DY7A 3CCMA 1K5OA 3OOCA 3J80i 2UUCQ 4KLTA 2EYMA 2FMCA 3D6CA 3KTQA 4ZRZA 1G291 1COOA 1VQMA 1KEJA 2I07B 1VDVA 3WU2U 9ICXA 1RJTA 4EBDA 2F0MA 3MFYA 3PNCA 1QVCA 3F8TA 1L8LA 4YCXA 3UXOA 1X9MA 8ICGA 3RR8A 5BPCA 1L1OA 2NZ1D 1Q8IA 4FO6A 2Z6KA 3SYZA 4GOPC 1WYGA 2RDGA 4LMQD 2O5IC 2F4VQ 2EDUA 3ALRA 1WWVA 4FVMA 1G2TA 4IURA 3CCSA 3CD6A 1SSOA 1TKDA 4IUNA 2KSOA 3TSSA 1J5EQ 5D46A 2IHNA 9ICBA 1PH5A 5ALXA 2DY8A 3TS2A 1BPYA 4DFAA 2E2JH 5D14A 4DEZA 3NQTA 1XNRQ 4PMCA 1IBLQ 2IX1A 3U9OA 5J0XA 5CEHA 1GO3F 3HOXH 2WTFA 1ICWA 1W3SA 2PQAB 2MJ8A 2ZT9C 2Q8TA 4X64L 1H38A 3CW2C 2P6UA 3NP8A 5M3MB 2FI1A 2R92G 3SV3A 2FMSA 4CGYB 1SNOA 4HSVA 3GTKH 4G3IA 4FP5D 3Q8RB 4C3IG 4O3SA 1IZ6A 3HW8A 2HIVA 3B0YA 4DL4A 2R7ZH 1QSSA 2HOIA 3QU5A 8ICAA 2BCOA 5I2XA 3PIPA 4LF7L 3C2MA 3C29A 1JR0D 1DD2A 2YMMA 2XCAA 1Z7TA 3KLWA 1EY7A 3D6WA 3A54A 3PIO3 3PCOB 4LFAL 4ED8A 2JA8H 2PFOA 2KSOB 5IILA 2M9NA 1JOOA 2ZUDA 4NL9A 1F9SA 5LL6X 4IR9A 8ICCA 4DAYA 4F3OA 3QEAZ 1B3QA 2KJ5A 1ZQAA 3Q8MA 3M7GA 1WTQA 4C1NI 1JOKA 5C0XJ 3P1HA 2MP1A 3ONAB 3PQIA 4GN4B 4DR1L 1Z19A 1JJ2A 1TIID 2NN6G 3I91A 1AZPA 5KL8B 3T51B 4A3IG 3V2TA 1FVIA 2F52A 3RJKA 3NENA 5KFTA 4HCEA 5JOBA 3JAMc 1BF4A 4IUTA 5KFWA 5ALKA 3WK6A 3T5HA 1ZQCA 2C2EA 2VUMG 1TAUA 3G6JB 4P0QA 2LYHA 3A8JE 2YTVA 4X3TA 4NW2A 1ZQBA 4QZ9A 5ALJA 2VJ4A 2G5DA 1WOCA 4GIBA 4M47A 1HHVA 1PK1A 4C3IH 4EX5A 3T13A 2K5DA 2MUTB 2WKDA 4UB3A 3W5OA 4P72A 1XX8A 2PKEA 4H7BA 5DB8A 2W55A 1XSPA 1GO3E 5IGDA 4BY1G 4JB3A 4Y2XA 5KL1B 5DQHA 4R4TA 4YFKA 2ZJ5A 3DMUA 3KJPA 4JBMA 4QWDA 2EY2A 3W3AA 4HJ5A 2JA9A 2N78A 5DBCA 2WIIB 2A69D 5AKXA 3CAMA 1XMQQ 2WP8J 1PH3A 5IWAL 1TWHB 1B1ZA 3NBIA 3CMEA 3HS0C 4B9LA 4F4WA 4G7ZC 4FZNA 5HNKA 2HOQA 5TISU 2LI6A 4DL2A 4X65L 5E1FA 1L2FA 4OL7A 3NASA 2CW0C 2RDHA 1CEZA 4J9SA 4A3IH 2B2VA 5ALDA 2MO1A 1RXWA 2UXCL 2OTJA 1KDHA 1GUOA 5J29A 1IXRA 2PW7A 1WTVA 3HOWG 4YHHQ 2UUBL 4FF1A 3K5NA 1K3BC 2SEBD 1U49A 2KZZA 2WF9A 4RQNA 2AGOA 2YU9H 1IL8A 1TVAA 9ICTA 4RCOA 4OXPA 4RUCA 9ICHA 1ECWA 3D2QA 4G57A 1K3RA 3RN2A 5CV5A 4BXXG 3H94A 4FXKC 4BY1H 1S40A 2PMZC 1KN5A 1O78A 4Y2UA 3BYYB 2KCNA 3GTKB 5IINA 1JICA 4F8RA 3KFUF 3SQIA 3EPIA 1S5LU 2FFKB 1L7PA 3SE0A 3I1YA 1UA1A 1L3UA 4J8QA 3SGIA 4OWWB 4JK1C 3WOEA 2ZIWA 1KABA 2F0NA 4C2MH 3OTOL 4BY7G 4JV5Q 1KAWA 3I7FA 9ICRA 4Q8FA 4MFFA 1SKWA 1BNZA 4KX5A 7ICTA 1LT4D 2V4RA 2UU9L 4DF7A 3C5GA 2E2DC 4Y2QA 1WCMH 3PMLA 2PMZB 1PLFA 5C3EB 3F2CA 2HHXA 5ELFA 3SMVA 4CRXA 1ZXIA 4J9PA 1ZQEA 2VB3X 3KHHA 3NWSA 4G4KA 4X3UA 5CYUA 3SEBA 3HOWH 1HNWL 1KKXA 1LT6D 2I5LX 3A8IE 3G6VA 1SXTA 1PH2A 2Y0SC 4KKSA 1JT8A 4B3RL 1D1KA 2F0OA 3DEPA 3TADA 1FGBD 3Q8PB 3DUZA 1Y1WB 4B3MQ 1KQQA 3PMFA 5DKWA 1VQAA 1XPOA 3F5EA 2KEEA 1ZQRA 3PY8A 3MBYA 2KOBA 2HHUA 1I3QB 3O13A 4QZDA 2B2WC 2A6EC 4YMNA 1MA7A 1O7YA 1PFBA 2DUDA 5AI4A 4MFAA 3KDFB 1Q12A 5IGCA 4TURA 4V190 3PO5A 3RRHA 5J1ZA 1NJWA 2Y0SB 2G9HD 1DYQA 2ZXRA 5CR3A 4PHEA 1YJWA 4BY7H 3F2UA 3UDIA 1AFPA 1XC9A 1BNPA 2K4IA 3PIP3 4JI8Q 1HRJA 3SENA 1VQHA 4DQIA 3B0XA 2PW5A 2F2AB 1KTKA 3FMCA 2B63H 3CCQA 1UA0A 4RH6A 3V6HA 3H7IA 3DV9A 2O4XA 1ZQKA 4KLUA 2N55A 4HAEA 5C3WA 5KNDA 1NJIC 1I94L 2IBKA 1AW7A 4QMGA 1PDQA 2EYLA 4G7HC 5M5WB 1N2XA 1D7QA 4PL1A 2DJGC 3QO2A 2PPBC 3EN2A 3HZXA 4QZAA 2F3IA 1DZ1A 4JI3L 3IFDA 1IKMA 4CDGA 3S16H 4ECSA 4OHJA 3IRBA 3OHBA 3KF8A 2YYZA 5ALTA 3V6KA 1QNUA 1S5BD 4LJZC 3S15H 1N33Q 1NZBA 4YXMA 2EAMA 2EQYA 2F3VA 2PI2A 2LS01 4PMWA 1VF7A 1Z1BA 1SMYC 2MUYA 3M4OB 1JX4A 1UPHA 2HHQA 1COKA 2DPJA 3BDLA 1N34L 2NVXH 2J6SA 4YXJA 3LGJA 1EIYB 5M3MH 1SLJA 5EWGA 5KYLA 2HIXA 3DXJC 4ZUIA 3QUQA 2QCPX 5EKIA 5KGUA 2XGTA 5IYBH 2XSCA 4BWJA 1Q3VA 3TANA 3ISDA 3QU4A 4FF2A 4R4OA 3M9MB 3RR5A 3CNHA 3K59A 3GV7B 2SOBA 3E9HA 4OELB 2V4DA 1JJGA 2Z6BA 1SL0A 3RTVA 3BQ2A 1LM0A 2F3WA 2A6ED 2F03A 1TQOA 3V7JA 2NVYH 3IN5A 3PX0A 4DA2A 1PH4A 3ZDDA 4FDBA 2QLTA 4P75A 4A3EH 3RB4A 1S76D 1MKHA 5IY0A 3H8WA 3FM9A 2DUYA 5KRUA 4J9OA 4WJWA 4BBSG 2NZHA 2O6KA 1XU4A 2F0VA 2K5VA 4F93B 3K57A 4M0AA 5KFLA 1DOLA 2ASBA 3OPOA 2KE7A 1CI4A 1YI2A 1HA6A 3NVVA 1JMCA 3BZKA 2Z4IA 3JPRA 5EAYA 5JJLA 5J2GA 7ICNA 2D8CA 5CV6A 3AU6A 3CCUA 4DAPA 3S14H 4JBKA 4DF8A 4LUOA 4N9TA 2XC9A 4DPGA 1PK3A 4JV1A 5AI0A 4OX9Q 1SGGA 4B9XA 2AQ1B 4LW1A 2KCMA 5KG4A 2QKIC 3PSPA 1CHQD 2YMLA 3PW0A 1XTDA 2QDLA 3K80C 3VR6A 5HHHA 3K75D 2I6XA 2B39A 5J8YC 2B2YA 4RGTA 1BPBA 4TQSA 5CBAE 1WG8A 2D0OA 1K9MC 5JTIA 2Z1CA 3BYTB 1S5FD 3DDHA 5C0YA 2F0WA 4DNTB 4RGOS 5AI5A 2QEJC 3GV8B 3KF6A 2HHSA 3J80c 1HIWA 1TWHH 1AE2A 3EROA 3WOFA 1T3NA 3OHAA 2RSOA 4FE3A 1KAAA 1X42A 4XIGS 2E76C 2GVAA 2R61A 5DAUA 3TQYA 1UEBA 5I9PA 2Q2TA 1GHKA 5AM3A 1LTRD 5IIFA 9ICAA 4P4OA 1Q90A 1RCVD 1KNAA 3K5LA 4DUZQ 3ZD9A 5C3EG 4FS1A 1STNA 3D8GA 5ALNA 4NLNA 2NRVA 3ULLA 3MXPA 9ICEA 1LT3D 1LLRD 1X3FA 1GUNA 2MO0A 4R63A 3S9WA 3H09A 2L5YA 3LNNA 3RD4A 5ALOA 3SAGA 3T3FA 2EY5A 5D3IB 5AI6A 4A3MB 1ZD5A 2Q0ZX 4CF3A 4YY3Q 4XYQA 1WTXA 3MFHA 2B2UA 2F0JA 2W3SA 4AP9A 4O5KA 8ICPA 3K6OA 3BS1A 5K4LA 1Y1WG 3J7AV 4U68A 1GUTA 1QG7A 1M4VA 4C7YA 4USAA 1HFGA 3J81L 1ZQPA 3MFGA 4JBJA 3RFAA 2JV3A 3TQ1A 4DV2Q 4A3GH 5M3FB 4O3NA 4P73A 2EYHA 3N52A 2F1MA 3ZI4A 4BUGA 2CVRA 2PFPA 2BR0A 1TWFH 5AJ3L 4K0KL 1NSNS 1I4XA 1PXUA 4MNOA 5KG7A 2NN6I 3ZDAA 1LYLA 4O3QA 2R6GA 4JW0A 4TUSA 5ELDA 1EQQA 2W7OA 3ZDEA 3Q8LA 4M04A 5ALYA 1X6JA 1DXMA 2JSOA 4DR4Q 2YV5A 1KTQA 5C3EH 1XNQQ 1S10A 4MEXA 4LFCQ 4GN3B 3EJIA 5AK3A 5I2YA 5KNCA 2HHHQ 2K6AA 4KKTA 2A1AA 3KZIU 1NK9A 3VYUA 4UAVA 4HIOA 2IOFK 1B22A 1OO9B 3HP3A 1N9WA 4LNQA 2W7PA 4RMFA 3JAMi 1CZWA 5KFDA 1Z6HA 2F77X 2MRLA 3CRLC 2F44A 3J7YW 4UB2A 4BBRH 3QU9A 1Y1WH 4IFDG 4APVA 3E6ZX 2E2HH 1RQNA 1D8BA 2KZ3A 4F92B 5DQGA 2RDIA 4DS4A 2KVCA 2NWGA 1I3QH 4DV5L 5ALLA 3RJIA 4OONA 2NVTB 2VJ5A 4B3TQ 4YMOA 3PW7A 3MR6A 5C4ZA 2UUAL 3Q8QB 4C8KA 3HOVH 1IW7C 5J0PA 2BPCA 5EJWA 4RHSA 2G07A 5DQIA 2KNJA 1U47A 1UWVA 2FMPA 3VA5A 4QGUA 1HNZQ 5KT2A 2NBFA 1QLNA 8ICEA 3F1ZA 4QZIA 9ICUA 4M6WA 1Q1BA 5ALFA 1B8AA 1NJYA 3C1EA 2NTTA 2AWNA 1XPUA 2MSNA 3OJSA 1HNXQ 2YTUA 4CKBA 1EEID 5HMLA 3GTMH 2O2LD 2HHWA 4WJ3B 4S3SA 3HOZB 1XWLA 1Z3EB 3I8ZA 4ZYSA 1CFMA 4N8X1 2N1RA 3MDCA 1IBMQ 7ICSA 3H8SA 2KN7A 4PV1C 5KG1A 3ZYYX 1HH2P 4IQTA 3GTQB 1U9RA 1QZHA 4J9RA 4LUVA 4J9LA 1OXUA 4JCVE 2CN1A 3MFIA 1Z9FA 2HMXA 4QCLA 1TKWB 3MABA 2JEFA 2HHTA 4OIJA 4OWTB 4WJ3M 4J9MA 3OWFA 1SKSA 4C80A 4PHPA 5E4XA 2I46A 5M5YH 1J2NA 3WK7A 2J4XA 4LF8Q 1TT2A 1NR2A 5IGGA 3JPQA 1ZQLA 2L5TA 4UY8C 4GKKL 5EGTA 5KYIA 3N7RC 4Y2TA 1ZQMA 4UPAA 2IJ0A 3G6EA 3S1MH 1U4RA 4C3JB 4F87A 5BR8L 4NXMQ 1N32Q 4DR2L 5F9NA 5NUCA 1SV0A 3AU2A 4XQNA 2BDOA 3VR5A 4R1JA 4FYDA 4NLBA 3OMCA 4B9UA 3V05A 4DR5Q 1LUZA 3PF5A 2HQLA 1D1IA 1UNSA 1B0XA 2H3ZA 1S3OA 1W6KA 4OO1H 5F3XB 4POFA 5ALPA 5J39A 3HEJA 3UM9A 4A3FG 1KRPA 3PSFA 4DR7L 4CF5A 5C44B 3R3OA 1QJOA 5C0XG 3CRXA 2ENBA 3MXNA 1X9NA 1D5XC 4X62Q 4B9NA 5AKZA 1MSHA 4N8FA 1NK5A 5KFKA 2E5LQ 4L5QA 5KG3A 3C1FA 2VNUD 2C9OA 3WKCA 2PCFB 3ULJA 4C3HB 4I2FA 2ZXIA 3LK9A 5KFCA 3EYZA 3J80E 3KKAC 2KD1A 1EOTA 1TWCB 3QUBA 2W9BB 3K0YA 4KMUC 1HQMC 3SV4A 4Y7NB 3CMAA 4GKJL 2UVWA 3ED5A 3I55A 1XYIA 3KUPA 2D3DA 1RDPD 5KFUA 1STBA 4DXGA 3BZCA 5FO8B 4A3DG 1STEA 5LL6S 4A3MG 4OIKA 3MR3A 1KL9A 1NKEA 1VQKA 1OXVA 2VQEL 2PZUA 2EZYA 1BBWA 4GLAC 1VQPA 3M3YH 3AQEA 1QUQB 3TREA 4ECZA 5KFZA 2ZTEA 1PA6A 1S8OA 4Q45A 4A3LG 2OF1A 4JI2Q 5M3FG 3PIOA 1LKYA 3H4BA 4Y2VA 2L4NA 3LVVA 4UW9A 3D4DA 1O03A 1E3PA 1EY5A 4K8IA 3STBD 1MQ2A 3VR2A 5C0XH 1UE7A 4MN3A 3RRGA 4I65A 1YBYA 1FFUA 1SWVA 1EIHA 5GROA 1JN3A 1I5FA 3RN5A 3K0XA 1NKCA 5L37A 2JMGA 2PMZF 5CB1A 3M4YA 4F71A 1EY4A 1SRUA 2EY1A 4FO2A 2AHOB 1NCVA 3FEWX 2EZZA 4F4ZA 4NMZA 3BU2A 1NJXA 2JN4A 5G5HA 1WVLA 4KLFA 2FJ6A 3RB3A 2CKZB 5FO7B 1RQLA 4YIJA 3L5KA 1B44D 1N36L 1FIQA 1ZRMA 3BS5B 3PUXA 1JE5A 5I6YA 1EYGA 3M9BA 4KLJA 3NPPA 4K6DA 1PH1A 4FBTA 1JJCB 1G91A 1VQ6A 1ZYRC 5E79U 5DB6A 1SYFA 2AUJD 3MGIA 3LWEA 3LWLA 5AM0A 1SZPA 1HCZA 2XCPA 1A77A 2KUMA 1CK1A 4IQZA 1JROA 7ICRA 3LWUA 4C4SA 4RAUC 5E3FA 4YWKA 1PFMA 4RHRA 4I2HA 2JK8A 1KRTA 3CC7A 1Y8OB 4DCCA 5J0UA 4QW9A 3JPNA 4ED0A 4E6IA 2Y0SF 4FF3A 2KKVA 5GAEC 2LMCB 3C21A 2AMCB 1Q82C 1LB2B 3IL8A 5GADC 3S1QH 1F2ZA 2Y9UA 1X65A 3HFZB 1KLGD 5AKEA 4A3GG 3S1RB 3T53B 5AIAA 5IYDH 3SK5A 5EPLA 4J03A 1P16A 4I29A 3CP8A 3S24A 1STHA 1JE4A 3HKZB 1Z00B 1C7YA 4P0PB 2E75C 1XPRA 1VDZA 1SNDA 2QKQA 4NXZA 2ZXOA 3HOZG 2L11A 4JBWA 1R9TB 3S1NH 1PFSA 2E8MA 3L4PA 5CA7A 2C2RA 2CFMA 3MA2B 1N8RC 5KEEA 1RYRA 3NUQA 4G7OC 4JVZA 4X3SA 1F2YA 5J22A 2JEJA 1LVHA 1YJNA 1NI3A 5DDYA 4DV3L 1I4HA 5IP9G 3LYSA 2PMZE 1RDFA 1A6XA 1I6HB 1JI7A 2HBLA 2Y1JA 2Y1IA 2HDOA 1VQ5A 4YG2A 5AK6A 4UB1A 7ICIA 4DV7Q 2UUCL 2JEIA 2F1JA 1E1OA 1F0MA 3M9OB 4YN4A 1JWSD 4JC0A 4Y2RA 2VL6A 1HA5A 4ZUJA 3OIPA 3T4AC 3PX6A 2DL0A 5KFPA 5CRXA 3NRZA 2NO5A 3VDYA 1K8OA 1WTWA 5ELNA 2A1JB 1YNJD 3WWVA 8ICXA 3C28A 3RBDA 5A2QE 1JC7A 1FL0A 4RWSC 4GNXB 2BA1A 4FZLA 2HSZA 4PJ0U 4EBEA 5KT6A 1VQJA 1X56A 3DEOA 1Q8KA 4F4XA 3SI8A 1ZYRD 3KHLA 2F4VL 1T94A 2BHNA 4CF4A 2ALYB 2HCCA 4IN3A 1A3UA 2L15A 2NYVA 1SNPA 1XJVA 2PZWA 4US8A 2Y0SE 1EQTA 3GQBA 3EWAA 2KOLA 3HOZH 3CHBD 3V72A 4JWMA 2V1CC 2Z4HA 2CXYA 4RA8A 4R8UB 1O7LA 1B4FA 4EZ6A 2RHFA 3ISCA 5CJ7A 3UE0A 2KHVA 3MDAA 2KHSA 3N7PD 2QB0A 4A3KB 5C44G 2P35A 1HZBA 5IP9H 1ILPA 1ZJNA 3Q8SB 2QB1A 1H9SB 1YHBA 5A35A 3J81j 1X54A 3K5OA 3K7AB 2HOFA 2FJ2A 4O3MA 3GTQH 3CCRA 2XY5A 2GLEA 2HDMA 4PL2A 3V7LA 1U4MA 1BR9A 2OQKA 2RDFA 4X66L 4GOPA 4AQYL 4IZ8A 1ZQDA 1V1QA 2Z6KC 4MHVA 1Z4OA 3F2DA 4RNOA 4ECXA 1KC8C 4R66A 3EZ5A 4L63B 4C3HG 1HPCA 3L3OC 2A69C 2LYAA 2DKXA 5KFYA 5CWRA 2BOSA 2NRWA 3RH6A 1TY0A 2AXTU 2KJXA 3PMNA 3P7JA 4DAMA 2R7DA 4BXOA 4JI0L 2AUKA 2ZJAA 5HY6A 2UXDQ 3AQQA 2GA4B 1EZ8A 3AFPA 3T1HL 1HZAA 4HR7B 1PYSB 2SNSA 1L1OB 2F0EA 1EU3A 1S0MA 1T7PA 2NYZD 2VS1A 2HQEA 1D5ZC 1D8LA 2RQXA 3CXCA 4QZFA 1BBUA 4CDDC 1EL0A 1AE3A 1E2ZA 3TZUA 2W8LA 1Y14B 1E2VA 1JXLA 1MHWC 2LXJA 4QJFA 2IY5B 5J2IA 2KG5A 1PFNA 5AKYA 3TDQA 2K04A 4EYIB 4FF4A 2RHSB 3UPQA 1MQ3A 1X3PA 2G5IB 3PUYA 3T5KA 1KNEA 3KZXA 2W3RA 4LVSA 3QOJA 5IT9E 5M9OA 4RKLA 1U5KA 5IODA 4DK0A 4UARA 2MFIA 1PVQA 1A62A 1XSLA 4UAYA 1ZQSA 1BDOA 2RBMA 4Z6CA 4RQ5A 3RAXA 4KY6A 5FLMG 2P5ZX 5ALMA 4C3HH 4NLZA 4X64Q 3S2DH 2HVIA 1CUKA 1VJ5A 1WCNA 2QARA 1QCBD 2ZM6L 3UDFA 9ICFA 1WTPA 1IV8A 3PV8A 1A8VA 4Y7NH 2F0HA 3RMHA 2R92H 5AKKA 1L5UA 1PTOC 3HJEA 4EENA 5HR7A 2BZFA 4ZKCB 3OSNA 4U7CA 3IKJA 5J0SA 4YWMA 4YMMA 5G5GA 2WAQB 4A93B 1F5SA 2ASJA 4DAYB 3CCEA 2MA1A 5KFRA 2NO4A 4C3JG 4LFAQ 1FJGL 4Y2PA 1L3VA 3SDZA 4OO1I 1PHJA 3TZDA 5L1IA 3L0OA 1KHIA 2XICA 1N56A 3KLSA 1WTOA 5FJ8G 3S2HB 1M8AA 1SYEA 3A5ZB 4KLLA 1PTOB 3G6YA 4DL6A 2JZBA 2BGWA 4B08A 2CWPA 3KD3A 3MC1A 3M4QA 4BBSB 2OCEA 1NOMA 5J0TA 2UVRA 2Q8RE 4KY7A 1DONA 4PZ8A 1TS5A 5DM73 4DR1Q 4P0QB 1STYA 2F1IA 3H8MA 2EDGA 2NN6H 4L8JA 3L2PA 1ENAA 2KTQA 5KFMA 2IHEA 3EW9A 1PH7A 5LMUL 1PK1B 1EYDA 3HKZG 1O7ZA 2ASDA 1LABA 2K4KA 5DLFA 2VUMH 4KN4C 1OXXK 1TV9A 1B9NA 2ID0A 1RPLA 3RAQA 1X32A 2HI0A 3THVA 1DM0B 4FXDA 2B2VC 2VXWA 3A0HU 5AK4A 4IPHA 1DOKA 2EQSA 3P20A 3NQIA 1X9SA 2MHVA 4RT3A 7ICVA 3CQZB 1UQVA 1A76A 2XGQA 4DS5A 2PFNA 4UBCA 4BGDA 2R8HA 3TP8A 2OYYA 3I4MG 2QDBA 4KV6A 3KBGA 2YN4A 3CCLA 2G08A 5IWAQ 2JA7B 5C0XI 2KEYA 2MPMA 1Y69U 4BX9C 1YHAA 2FHTA 4K6LA 3HT3A 4MTNA 2JA6B 3ZJYC 1PTOD 2XNAC 4KJNA 1XMOQ 4UP8A 4X65Q 1NK8A 4UHVA 4ELVA 5KT3A 1VMPA 4JK1A 2F0FA 4DFJA 3FP9A 4DUYL 2L9HA 4CCHA 5B66U 3NTIA 3J81i 2UXBL 1JXEA 5J0QA 3E9IA 2UXCQ 7ICGA 2C22A 2E2IB 3M8SA 1JCKB 1JB7A 2JE6I 2C2DA 4HMIA 1F2MA 3TAPA 3TAQA 3N4MB 5AHXA 9ICMA 1EEFD 3GQCA 1TS3A 2TSSA 2DN8A 5EBCA 2NVQB 4RQ1A 1ZQQA 5KT4A 3QG1A 2I0QA 1B9MA 3A74A 2VKQA 3SHLA 1DCZA 4A3KG 4OJPA 2A19A 2WB1B 3CRKC 1V1PA 5JJKA 3NBHA 4B6JA 4PHDA 1CRXA 2YY6A 2ZIWB 4LAAA 1WD0A 2VQFL 5HR6A 2ZG6A 5DGAA 2KCTA 4BWMA 4DF4A 4DK6C 3ZDCA 2KHQA 2D5DA 2XVSA 3NHHA 1P7DA 3M6ZA 5C5LA 1QQ6A 2OQ0A 3NS1A 2ASLA 2PNHA 4DFPA 1Y1VB 1AN8A 4J9KA 1B70B 2JYOA 4JI6L 3OTOQ 1N60A 5TZVA 4LF6L 5KFGA 1PH6A 3D4RA 5GTHU 2CH4A 3ETRA 4B9TA 2B2WA 2EAPA 3BVMA 3I73A 5DGBA 1HQRD 4DV0L 2RF4A 2GWSA 5C5MA 1EQVA 2UU9Q 3GTLH 3AN1A 1KDCA 3SEIA 4GN5A 5BN5A 2F8KA 1X3EA 4DV6L 4I2DA 3EPGA 3D2SA 4I2AA 1PRTC 1K83B 1QILA 3BJYA 4U673 3SR1A 5JEAJ 1PZID 1GUSA 1HNWQ 4CBVA 1XO1A 4Y2YA 2DBYA 1SE4A 5ALZA 5HURA 1CSQA 3CCVA 2DPIA 1CKNA 3UE1A 1PVPA 1U9LA 4DL3A 4DK1A 4QW8A 1B53A 2LKVA 4B3RQ 4WJ4A 2YMQA 2RQ5A 3FKIG 2KVMA 3GZFA 1QNKA 4HJ9A 4ACOA 1PRTB 3IHQB 9ICKA 4JOIA 4V0BA 5G3LD 5FKAC 3C1YA 4G9BA 3ITPA 4HAIA 5D49A 1SJED 2K4HA 3MR2A 1EWHA 2BE5C 2KVSA 3A7AB 4R4IA 4GKJQ 4DSJA 5FLXL 4I7AA 5ALVA 1CKMA 4BA1I 7ICEA 2E1EA 3OPXA 3NRWA 1SR3A 4OWXB 4RPYA 1V43A 2GN5A 2DWQA 2IHMA 2G9DA 4Q5VA 2FXQA 4RQ0A 4DK3C 4Y52H 3K4GA 1OW5A 1A2TA 5AKIA 3N97B 4HSPA 5IYCG 3JAME 1D9FA 1BPZA 1Q3UA 5CMDA 4R9WA 1JUDA 1LTGD 2AQ4A 5ISRA 1ZQIA 2WAQG 4A93G 2N8NA 1Q86C 9ICGA 1SZHA 3TP7A 5DBBA 3C2PA 5J0YA 4I2CA 1E22A 1MBYA 1TS2A 3VC8A 2L55A 1I94Q 4K5VA 2J6UA 3KF8B 4IRDA 4YP3A 2K28A 4CJ1B 4A3CG 2A3VA 1D9DA 1S9FA 1KFTA 3RNUA 4M2YA 3CC2A 4M9GA 7ICUA 3GILA 1EY9A 5J2BA 5FO9B 3M6KA 4NM1A 2HBMA 1K73C 3ISBA 3JC66 5KFVA 3DLLA 4NJ8A 5ELOA 4JI3Q 1ZQOA 3ONNA 4F2RA 1C4QA 4HIMA 2KCCA 1SE8A 2IOFA 5DB7A 4UP7A 1L7NA 4RQ6A 1PRTD 5KIXA 5C4JH 5AICA 3PVXA 4B3SL 4RQ2A 1N62A 3T1YL 1N34Q 1BCPB 5J2CA 1F44A 5AFWA 2PO4A 3URYA 2K8BB 3QIAA 4B9SA 1S0OA 1RKNA 2P66A 1TWAB 4KX3A 3SZ2A 2EYPA 1FO4A 3NTKA 4O0IA 3BJUA 4X6AH 5J0RA 2KQ3A 2M9VA 4X5VA 3Q8KA 2Q2UA 5AI9A 3H0RB 3KJOA 4A93H 2CCZA 1VQBA 1SBBB 2E8NA 5J2FA 3MXUA 2XTIA 4A76A 2R3ZA 4B9VA 3HOYB 5EOZA 5AM5A 3NTHA 2BE5D 3BQ1A 1BGXT 4JYAL 2KFNA 3S2HH 3PSTA 5KFQA 2JA7G 4C0ZA 5J8YA 2ZIVA 3RR7A 1S77D 1TK8A 1PTOH 4A3FB 3GTGB 2JA6G 4I2IA 4KLHA 1L3TA 2EYOA 4PMBA 4BBSH 3D31A 5AM4A 1FNUA 4DR6L 1FGUA 3TP5A 2WKCA 3A8KE 5IIJA 1CI3M 1HFNA 3HKZF 5J0WA 4NPSA 1AEXA 1R4PB 4NB3A 2LHTA 1J8IA 2ATLA 2EJFC 5DG8A 1I4RA 4K5WA 4KHVA 2W9CA 5JAVA 5KFBA 5DDMA 1G8ZD 4NKLA 1QQ7A 1BCPD 3TBIB 4C8NA 3NK9A 5I6WA 1YNNC 2RCFA 1X3QA 3OSPA 1VQDA 4A3DB 2WB1G 1NR4A 2F0LA 3I90A 4GXJA 4DSEA 5KTQA 2DKZA 4I7ZC 4DFKA 1IYJB 3KF6B 4PZ7A 3W1GA 2F0PA 4HEDA 3R9KA 2QA4A 4DV1L 1KIXA 1BPEA 3CQZH 1RTNA 4I2EA 2R18A 1XNQL 3UQ0A 2A5HA 1CKOA 2W11A 1Y1VG 1HR0L 2XI9A 2LM1A 1WD1A 1GKHA 1AP0A 7ICPA 2K52A 2JA6H 3TFSA 4KLDA 2KHIA 4C56C 1P8LA 5ALQA 8ICWA 5JU5A 2YQEA 5KFIA 1LTID 2HDLA 3QUCA 4O5EA 1TVXA 2N3SA 2RVLA 4PG3A 4DFDA 1ZRNA 4YCVA 5BN4A 3QUTA 1A63A 1SNQA 3OJUA 3T5JA 1GHJA 3SK4A 1O08A 2LFNA 1WWUA 4P4PA 4F5RA 2E2IH 1RYUA 4RU9A 5EWFA 2ZJ8A 5GQOA 4MF2A 1K8GA 1VF5C 2R8IA 2I5MX 3I76A 4RQ3A 4WRDA 2NVQH 2ESEA 4QWAA 2AGQA 4I28A 4JI5L 3OMGA 3A56A 4NLKA 3S17B 3WK8A 4UAIA 1HUNA 4ZK9B 4P2HA 3HKZE 3ORYA 1QB5D 3KFUA 4MHEA 1F9RA 2ZXPA 2G0AA 1FNWA 1SFOB 3UMCA 3PW4A 4UB6U 2BCUA 5COYA 3I72A 1Y1VH 3D2NA 1PVOA 1TAQA 5AJ3Q 1DGSA 4C8LA 1VQNA 2BH2A 2Z0SA 3GIMA 4K5XA 4K0KQ 3DHQA 3PR4A 8ICJA 1BOSA 1YNND 1QE6A 3LWMA 5IT9L 1X9XA 3IM1A 1UT8A 2L1BA 2I9GA 4H0LC 2B21A 5E7NA 4KD4A 2AWOA 2K75A 3Q6SA 1SYGA 3BG3A 5JRTA 1S0VA 1UEAB 4KKUA 3CC4A 5E4WC 3MTSA 2KICA 4OJ6A 3I56A 1E2WA 4WFN3 2JA5B 3FYHA 1U4PA 2EAOA 4K2LA 2M00A 4L5TA 3WK9A 4KMOB 3ZD8A 1EZ6A 4QIWC 4DQPA 3FPPA 3J7AF 1QTMA 2H3QA 1ML0D 5M5WH 4IUUA 3OW2A 5JPNC 4QWEA 4A3BB 2YB4A 1NZPA 1I4PA 2F0GA 2AKWB 2SDFA 2X6LA 5AKJA 1KFSA 3HKSA 4A75A 3V96A 1LTLA 1F2LA 4IFDH 4DR3L 1T3QA 1N32L 4ED1A 4NDXA 3G6XA 1PMRA 4ED6A 1DGJA 2CWAA 2W04A 4DV5Q 8ICZA 5KNBA 3DM3A 4M6WB 4PH5A 1DOMA 4O0AA 4OJ5A 4QIWB 3M9NB 4RUAA 3BVZA 2UUAQ 3M4OH 3AFQA 1TS4A 4XYOA 2K7VA 1YITA 1SYCA 3OSOA 1N48A 2FDRA 1RIPA 4KHPL 1X66A 1GOZA 3STBC 2LBOA 1G51A 2ZJRA 1B7YB 5KFXA 5T14A 3J7A5 2YMPA 5AM2A 5AI8A 4PGXA 2KEDA 4EX6A 4F5QA 4IC9A 2WAQF 5ALGA 1V1OA 1VQCA 4J6HA 1DK3A 5DG9A 4P71A 4B9WA 4CE6A 3LVWA 4JI7L 2PFQA 1S5ED 1SYBA 4F50A 2EOTA 2E2JB 1ICFB 4P2CB 4DGZA 4Y2SA 5L1JA 2ISPA 4IUVA 1OXJA 2Q4TA 1HUMA 3HOYG 1WJJA 3EQLC 8ICMA 4RGNA 4ULLA 4ELUA 4KN7C 3VR4A 1D8YA 1VQ4A 1NE3A 4O3RA 1PTOF 4J15A 2GO7A 1JB3A 4NY8A 4DQRA 4TSSA 3J81c 2WV6D 4PZ6A 1K8AC 1IBKL 2Y9TA 5EE3A 1HUOA 1C48A 1ZQWA 2E5SA 1ZQJA 1CQFA 1K8MA 4RKBA 2E8GA 9ICQA 4Z6FA 2V4QA 3MEHA 4HJ7A 5CBEE 1L0WA 5B5EU 3F2BA 8ICUA 4ZCKA 2H5XA 2R7ZB 3BZDB 1SE3A 1ZQUA 1RYSA 3RLNA 1KFDA 2NRZA 2B6GA 2FMQA 5KG2A 5GTIU 4BA2I 3T56B 1LTBD 4IPCA 2JA8B 2EY6A 4RNNA 1VMCA 4KLEA 4JI4L 4E0DA 1OXTA 3L7ZC 4CHTB 1TWAH 4GKKQ 4XRHA 4I2JA 1W6JA 2E1FA 3DWPA 1QVGA 1ZXTA 4GC6A 1EUJA 2N88A 5BR8Q 3PO3B 4DR2Q 2LSSA 1UT5A 2V9WA 3M7NA 3KKAA 4K4HA 2KECA 1TXYA 4KMUA 3MHBA 2IOHA 1DK2A 3AMUA 2HW3A 1SN8A 2M2LA 3L3FX 4K2KA 2JEGA 3KOOA 2OXPA 4IRCA 5JPMC 3ZDBA 2ICEC 3O0FA 3MXNB 1NK4A 3HOYH 5KFHA 3KK7A 2B29A 3U4VA 4LF5L 8ICKA 1Y8NB 3TFRA 1Q46A 3AUOA 4O9MA 1EY8A 5F2DA 4A3FH 1VQ9A 4DR7Q 1SAPA 3Q24A 1J97A 3ETLA 2Z8LA 2WAQE 3A5UA 4ICAA 2R8JA 4QZCA 5F9LA 3PO2G 2DNEA 4KLMA 4UDUC 2LY7A 1K1SA 1SDFA 3ER0A 4O1NA 1S0NA 3PW2A 1A3VA 1TWGB 1PH8A 1XNSA 8ICNA 4K8JA 4NXNL 4GLVB 2VB2X 4ZOHC 1ED1A 1KLUD 5JVH3 4YCUA 1VQLA 2JXJA 2LYBA 3PZPA 1U45A 3WK5A 1SL2A 2CRXA 4B9MA 2EXDA 1YNXA 4JI1L 2LM4A 4QB4A 4YCWA 5JJZA 2MU2A 1YNJC 1NAPA 3CF5A 4JWNA 8ICSA 4A3DH 3LX0A 1B4OA 4A3MH 1DJRD 2ES2A 3U50C 1MC8A 4CNQA 5G3LF 3M7DA 3GIJA 2FLNA 2VQEQ 2MNAA 4LFBL 3TP6A 3AYHB 3GTPB 1LKYB 3SVMA 1IG6A 1BXTA 5LMNL 2VW9A 3Q23A 3T5LA 3HWTA 4XT1B 2MQHA 4A3LH 3HKZC 3GD7A 2IX3A 5M3FH 2X6GA 3H4DA 1A0IA 2IT1A 3ERQA 3KOJA 4ECRA 4HN7A 2E74C 2B2TA 2GVBA 1DRGA 3QU2A 1EY6A 7ICKA 4DNRB 1L0YB 2F0KA 1K0RA 2ZIXA 5FK9C 7ICFA 2YU9B 3R2IA 1Y8PB 5C4HA 4DWIA 3K7UC 4ME3A 3GTLB 1N5XA 1KQSA 2NRXA 1V38A 2Q2IA 2LKYA 1OXSC 3QEBZ 2EIFA 4QL5A 3PX4A 3L9AX 3K1RB 3FVQA 4F88A 1RODA 1LV5A 2ZUBA 4QZGA 2K1BA 1X55A 3EUB2 1M90C 2JA5G 4NWIA 4ECYA 5ALUA 2QW7A 1ZQTA 3QYPA 1YZ6A 2BCRA 1N36Q
chains in the Genus database with same CATH topology
4FDBA 4P75A 3L2PA 4A3EH 1MKHA 2IHEA 5IY0A 1PH7A 1GM5A 3J7ZC 1RL2A 2K5HA 3TEHB 5LMUL 4A3BG 3HKZG 4DR5L 3S17H 3H3VI 2NZHA 4BBSG 2K4KA 2K5VA 4AYBE 4LF9Q 2VUMH 3CP0A 4GNXC 4AIMA 1OXXK 1BVSA 2ASBA 1HR0W 4OO1G 2ID0A 2NZOA 1YI2A 1JMCA 1Q1EA 3BZKA 3RLFA 5EAYA 1VQGA 1SFOH 5JJLA 4IPHA 2NVTH 4LF4Q 3CCUA 2R93H 2EQSA 3S14H 4JBKA 4X62L 4LUOA 3K8AA 3PV0A 4DPGA 3MEFA 2KENA 2E5LL 4OX9Q 4LW1A 2KCMA 2VY3A 4IOAA 3I4MG 4DV4L 1XTDA 3K80C 5C4XG 3CCLA 5IWAQ 1J5EL 4TQUS 5C0XI 1YHAA 4MTNA 1G6PA 5JEAG 3ZJYC 4GLXA 1XNRL 2D0OA 1XMOQ 1K9MC 2JA5H 1PH9A 1IBLL 4UP8A 4X65Q 2N49A 3G48A 4DR3Q 3FP9A 4DUYL 1YJ9A 3KF6A 3G71A 3J81i 3J80c 4A3BH 1TWHH 2ATWA 1AE2A 3HOUG 2UXBL 3E9IA 4DV3Q 2UXCQ 1JB7A 3UDGA 2JE6I 3CCJA 4XIGS 3H0GG 2GVAA 3TQYA 3TS0A 2Q2TA 4JI2L 1UEBA 4KHZA 2PQAA 4KHPQ 2R7ZG 3G4SA 1L1OC 4DUZQ 2I0QA 5C3EG 3A74A 1QUQA 4A3KG 5JJKA 2A19A 1EQRA 4JG2A 3ULLA 3CCQA 4JI7Q 1X3FA 2MO0A 5IP7G 2JA8G 3GTOH 1EFWA 2VQFL 3CPWA 4BXXH 2KCTA 4RG1A 4DK6C 2OWOA 3I4NG 2B3GA 3GDEA 2OQ0A 2DGYA 2PNHA 3PSIA 1VQIA 3PO3G 4YY3Q 1B70B 5C4XH 2YTXA 4JI6L 3OTOQ 1Y1WG 4LF6L 1VQEA 3GTGH 1PH6A 1IBKQ 2KBNA 1UE5A 1VQOA 1YVCA 4DV2Q 4JBJA 4HIKA 4DV0L 4A3GH 2RF4A 1HZ9A 1PV4A 2UU9Q 4P73A 3GTLH 3D0FA 4GN5A 4LWCA 1X3EA 4DV6L 1TWFH 1MIUA 5AJ3L 4GOPB 3HOUH 4K0KL 5IT9c 5JEAJ 1Q81C 5C44H 4MNOA 4IFDI 4YWLA 1NMGA 2NN6I 1EQQA 1LYLA 2R6GA 1HNWQ 4JI4Q 3H0GH 2IX0A 1CSQA 3CCVA 1CKNA 2BH8A 3UE1A 2JQOA 4X66Q 4AQYQ 2YV5A 4DR4Q 5C3EH 1XNQQ 4B3RQ 4LFCQ 4GN3B 4WJ4A 2HHHQ 3FKIG 3U58A 2A1AA 2PI2E 5IP7H 4HJ9A 4POGA 1TWCH 4HIOA 4JOIA 3I4OA 4LUZA 1N9WA 5H1SE 5IYDG 1XMQL 3JAMi 4RMFA 4JI0Q 4LNQA 4AH6A 3T1HQ 3PO3H 4LF5Q 4R4IA 4BBRH 4LF7Q 2I5HA 4IFDG 1Y1WH 4L5RC 4APVA 2D62A 1CKMA 2E2HH 4BA1I 1SR3A 4OWXB 1V43A 2GN5A 3Q8DA 1YZ7A 1I3QH 4DV5L 4DKAC 2FXQA 3PO2H 4OONA 4DK3C 4Y52H 4B3TQ 1H95A 5IYCG 1ASYA 4GS3A 1EOVA 2UUAL 4LF9L 3HOVH 2WFWA 4A93G 2WAQG 2N8NA 2CQOA 3AEVA 4YHHL 1Q86C 2ZJQA 2HT1A 1UWVA 4NXNQ 4QGUA 1C0AA 1E1TA 1E22A 1WYDA 1HNZQ 3H15A 4DV7L 3F1ZA 1Q1BA 1I94Q 1WI5A 1EIFA 1B8AA 3KF8B 4LF4L 5JJIA 4JI1Q 4A3CG 3CPFA 2AWNA 3RNUA 1XPUA 3B6YA 4IJLA 2D0PA 3CC2A 1TWGH 1HNXQ 5HGQA 3GTMH 5FLMH 1K73C 4JI3Q 3JC66 3DLLA 5ELOA 4IPDA 2ZM6Q 4LFBQ 1MJCA 1SROA 4HIMA 1IBMQ 4UP7A 1SE8A 3PF4A 5LMNQ 4JV5L 5C4JH 2JEBI 1HH2P 3KYHC 2ZJPA 4B3SL 3T1YL 1N34Q 1X6OA 1XMOL 1NBWA 4A4IA 4GNXA 1NMFA 2C35B 2WB1E 1QZHA 3GTPH 4LUVA 1WCMG 1OXUA 4JCVE 4C3JH 1FJGQ 1Z9FA 3BJUA 4OWTB 4KLKA 4WJ3M 4X6AH 5M5YH 2Q2UA 1VQFA 5FJ8H 3KJOA 4LF8Q 5DLQE 4A93H 4IFDJ 1PYBA 1SMXA 4KI0A 2CCZA 1VQBA 5K36G 1EWIA 4GKKL 4UY8C 4UPAA 1YIJA 2XTIA 3G6EA 4A76A 5J3BA 3S1MH 4QQBX 4NXMQ 4UP9A 5BR8L 3HOXG 3S1RH 1N32Q 4DR2L 4JYAL 2A8VA 3S2HH 4B3ML 2JA7G 2OTJA 3I2ZA 4IJHA 4R1JA 5LMUQ 2JA6G 4DR5Q 3PF5A 1LUZA 4BBSH 2HQLA 2K14A 1KRSA 3D31A 1YHQA 1R9TH 4DR6L 1FGUA 2UXDL 1S3OA 2UUBQ 4MZ9A 4POFA 1Z47A 3CCMA 3J80i 4A3FG 2UUCQ 4AYBG 4NPSA 4NB3A 4DR7L 1E24A 5LMNW 1VQMA 1G291 1C9OA 5C0XG 4JI8L 1X9NA 3KDFA 3EIVA 4X62Q 1QVCA 3F8TA 1I6HH 1UE6A 1GD7A 1L1OA 2E5LQ 4L5QA 2B63G 2Z6KA 4GOPC 2VNUD 1VQDA 3ULJA 2WB1G 2F4VQ 4H02A 3I4MH 3CD6A 3CCSA 1J5EQ 3W1GA 4IOCA 1PH5A 3KF6B 1IYJB 4PZ7A 3CMAA 3E0EA 2QA4A 4DV1L 3H3VH 3TS2A 1KIXA 2E2JH 4GKJL 3CQZH 1XNRQ 3I55A 1IBLQ 1XNQL 2IX1A 3BZCA 4A3DG 3HOXH 1E7ZA 4A3MG 1CKOA 1Y1VG 1W3SA 4HJAA 2PQAB 1HR0L 1KL9A 4X64L 4DUYQ 1VQKA 1OXVA 2VQEL 1GKHA 3CW2C 1BBWA 1J6QA 4GLAC 1VQPA 1X3GA 1QUQB 2K52A 3TREA 1S72A 2JA6H 3U4ZA 2R92G 1N33L 2ZTEA 3EBEA 3NBHB 2KHIA 1PA6A 3GTKH 4A3LG 1P8LA 2N3SA 1IZ6A 4JI2Q 2HIVA 5M3FG 4PG3A 4YCVA 4IO9A 2R7ZH 3ICEA 4LF7L 1A63A 3PIOA 3PIPA 2JEAI 5M3MG 4A3KH 3KLWA 3STBD 4LFAL 1I50H 1E3PA 1U0LA 3PCOB 2E2IH 1CSPA 1UE7A 5GQOA 2JA8H 1K8GA 2JJQA 1YBYA 3K7AH 5IYBG 2IHFA 2VQFQ 5GROA 1I5FA 2I5MX 3RN5A 3K0XA 2NVQH 3I4NH 4QY7A 4JI5L 1SRUA 2AHOB 3BU2A 2YTYA 5C0XJ 2CKZB 4JI6Q 4GN4B 4DR1L 2QGQA 3HKZE 3KFUA 4LF6Q 1JJ2A 1KXLA 2NN6G 3UDXA 1N36L 4JOIC 4A3EG 3ERSX 3PUXA 1JE5A 4A3IG 1EYGA 3M9BA 1FVIA 2F52A 3NENA 3JAMc 4DV0Q 3PUVA 1PH1A 1JJCB 1Y1VH 2ZTCA 1VQ6A 2VUMG 1PVOA 1CKNB 4DV6Q 2YTVA 1HJPA 1DGSA 1VS0A 5AJ3Q 1XMQQ 1VQ7A 2Z0SA 4QIWE 1VQNA 2BH2A 4K0KQ 4YWKA 4A3JG 3CC7A 1WOCA 2OTLA 2JK8A 1KRTA 4C3IH 4EX5A 3RLOA 5E7NA 2AWOA 2K75A 4P72A 3W5OA 5GAEC 1Q82C 2AMCB 1KD1C 2Q2HA 5GADC 3CC4A 3S1QH 1GO3E 4BY1G 3I56A 4R4TA 4B3RL 3FKIH 1X65A 5M5XH 3KJPA 3HFZB 4JBMA 4HJ5A 4OX9L 4L5TA 2JA9A 2N78A 3NEMA 5IYDH 3CAMA 1VCIA 2WP8J 1P16A 5M5WH 3OW2A 3S24A 2VZAA 5IWAL 4HJ8A 1PH3A 1IL2A 3RZDH 3CMEA 2AKWB 1C7YA 3HKSA 4A75A 1XPRA 3HOZG 1LTLA 4JBWA 3S1NH 1PFSA 4X65L 1L2FA 2CFMA 4DR3L 1N32L 1N8RC 1VQ8A 2CWAA 4A3IH 2KHJA 4DV5Q 1QVFA 3K81C 3DM3A 1YJNA 2MO1A 4O0AA 4DV3L 5IP9G 5IYCH 2PMZE 2UXCL 1AH9A 4XTCS 2UUAQ 1IXRA 3ULPA 3HOWG 3M4OH 3AFQA 4YHHQ 1YITA 2UUBL 1RIPA 4KHPL 4A3JH 3STBC 1G51A 2ZJRA 1B7YB 4DV7Q 4DUZL 3J7A5 2UUCL 2YU9H 4DNIA 1E1OA 4OXPA 4JC0A 4A3CH 1VQCA 4P71A 2VL6A 1K3RA 4R4QA 3RN2A 4JI7L 3VDYA 1QZGA 4BXXG 4BY1H 5ELNA 1S40A 1O7IA 3WWVA 1FL0A 4GNXB 2BA1A 1VQJA 1VQ5A 1X56A 3HOYG 4L5SA 1WJJA 1Q8KA 2F4VL 3SGIA 4OWWB 4YY3L 1VQ4A 1NE3A 4J15A 2ALYB 4C2MH 3OTOL 4BY7G 4JV5Q 2L15A 1OTCA 1KAWA 3J81c 3I7FA 4PZ6A 1XJVA 1K8AC 1IBKL 2Y0SE 4B3SQ 3T1YQ 4ALPA 3HOZH 2E8GA 4DV2L 4HJ7A 2V1CC 4A3GG 1L0WA 5GAGC 2UU9L 3F2BA 2H5XA 1WCMH 3TRZA 4IPGA 3UE0A 3RLNA 3F2CA 4BA2I 1V9PA 5C44G 1HZBA 4IPCA 5IP9H 4DV4Q 1YHBA 3HOWH 3GTQH 3J81j 1X54A 1HNWL 4R4CA 4JI4L 3CCRA 2I5LX 1OXTA 3L7ZC 1TWAH 1PH2A 4GKKQ 4X66L 2OQKA 4AQYL 4DR4L 1JT8A 4GOPA 1QVGA 1V1QA 2Z6KC 1EUJA 4LFCL 5BR8Q 4TVAB 3F2DA 1W2BA 4DR2Q 1KC8C 2LSSA 2HHHL 4JYAQ 3PUWA 3M7NA 1TXYA 4B3MQ 2JA7H 1NTGA 3FHWA 1VQAA 1SN8A 3GO5A 1Q7YC 1XPOA 1MJEA 4DAMA 2R7DA 4JI0L 2DUDA 3MXNB 5HY6A 4DR6Q 3KDFB 2UXDQ 3AQQA 1Q12A 3AFPA 3HOYH 1NY4A 5FLXc 3T1HL 2UXBQ 2B29A 3U4VA 1HZAA 4LF5L 1PYSB 4BBRG 1L1OB 1Q46A 1YJWA 3RZOH 1M1KC 4A3FH 1VQ9A 4BY7H 4DR7Q 3UDIA 2VS1A 3NELA 1D8LA 3CXCA 2WAQE 3A5UA 4JI8Q 2ZTDA 1BBUA 3PO2G 1AE3A 2LXKA 1Y14B 5IE8A 4HIDA 2LXJA 4B3TL 1VQHA 4QJFA 3ER0A 2IY5B 3HOVG 2Y0SG 1PH8A 3M85A 2B63H 2RHQB 2RHSB 4NXNL 3PUZA 4GLVB 3PUYA 1HNZL 4YCUA 1VQLA 2K5NA 4O2DA 1NJIC 1I94L 4DV1Q 1U5KA 2EXDA 4P74A 4GKJQ 4JI1L 1YNXA 1D7QA 2MFIA 4YCWA 1A62A 5GAHC 3CF5A 3M3YH 1GVPA 1HNXL 1UE1A 3EN2A 5FLMG 4A3DH 4A3MH 2F3IA 4C3HH 1HR0Q 4JI3L