5G5GA

Escherichia coli periplasmic aldehyde oxidase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
175
Chain Sequence
PAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE XANTHINE DEHYDROGENASE YAGT IRON-SULFUR-BINDING SUB
publication title The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 49
structure length 175
sequence length 175
ec nomenclature ec 1.2.99.6: Carboxylate reductase.
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 5g5gA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5g5gA01
4YXDB 1XO3A 5GXGB 4HRSA 1FXAA 1JWAD 2CJOA 2L83A 1AYFA 3AEAB 3AEBB 3L4PA 2PVOD 5EE0A 3KWLA 1FIQA 3P4SB 4FXCA 1JWBD 2OHFA 1PFDA 2BT6A 3DWGC 1OQQA 2WU5B 4N58A 3AN1A 4ZOHC 1YJJA 3PO0A 3SFEB 1YJIA 2K9XA 4WQMA 4JX1C 3B9JA 4C80A 3AMZA 1IUEA 1NVID 4LTUA 3ZYYX 2MJEA 3AE3B 1WYGA 1ZUD2 2KMMA 3NVYA 1SB3C 4A9AA 4YTMB 2FBWB 2WP9B 2B76B 1NENB 3VR9B 1J7CA 3SFDB 1GPXA 3AEEB 4P6VF 2CU3A 3ETRA 1J7AA 1RM6C 1RWSA 3AE5B 2K22A 1ZP0B 5G5GA 3AEDB 3CIRB 3P63A 2K5PA 1WWTA 3NVZA 1B9RA 3ABVB 4ZHOA 3AE1B 2CJNA 4N6EB 5EE3A 1E0ZA 1E6EB 5G5HA 1FFUA 4N59A 4YT0B 2BS2B 2PVGC 1N5WA 3WCQA 2WDQB 3AE2B 1KRHA 1OQRA 3CWIA 2HTME 4WWMA 3SR6A 4JWUC 2W3SA 3RPFC 3LB8C 1RFKA 2L52A 1DGJA 3HRDD 2KAJA 4YSZB 3AE7B 1YQ3B 1ROEA 3W5UB 1VJKA 1UWMA 5C3JB 2M19A 2W3RA 4USAA 1FRRA 2H88B 2PIAA 2Y5CA 3W5VB 4YSYB 1T3QA 1FXIA 1SIJA 1FM0D 2WS3B 5EE9A 1F0ZA 1QOAA 1E7PB 1JROA 1WRIA 1FMAD 1KFYB 5MPOA 1L6VA 2H89B 4ITKA 1VDVA 1N62A 3HUIA 2W54A 1XLPA 2N0SB 1QOFA 1PDXA 2DWQA 3NVVA 1NYRA 2MH7A 3AV8A 3P4RB 2QIEB 1N61A 1OFFA 2DBYA 1ZXIA 2WDRB 3B2FA 1FFVA 1KF6B 2M56B 2MJDA 5C2TB 2WDVB 1QF6A 1A70A 4C7ZA 2QJLA 1QT9A 3AB5A 4YTNB 1JW9D 4IDIA 5EE1A 1TKGA 1DOYA 1ZOYB 1VLBA 1NI3A 1SF0A 1TKYA 2Q5WD 3HVZA 1XLQA 3AH7A 1JRPA 2WU2B 3BIID 3VRBB 2WQYB 1DOXA 2E3TA 5H8YE 3VRAB 1EWYC 1FRDA 4US8A 3NS1A 1RYJA 5AUKA 1PUTA 2BS3B 3W9CB 1QOGA 1TYGB 2EKIA 3EUB2 4C7YA 1CJEA 1XLOA 1N60A 1QOBA 1TKEA 4JWSC 1QLBB 1I7HA 3P1MA 4KX6B 2W55A 3P4QB 3B2GA 1N5XA 4YTPB 1J7BA 1NEKB 5AUIA 3AECB 1CZPA 1DOIA 3AE9B 1FO4A 1NYQA 1V8CA 3NRZA 1AWDA 1L0VB 3AE8B 3FAHA 1V97A 1E9MA 3AE6B 3AEFB 2G1EA 3LXFA 3P4PB 3AM9A 4YSXB 4ZHPA 3NVWA 1L5PA 1L6UA 1WGKA 2BS4B 3AE4B 2PKOA 2ACZB 1YQ4B 1TJEA 4HROA 3VR8B 1JQ4A 1XLNA 2JX5A 3FC4A 1WXQA 3AEGB 2WLBA 4US9A 5H92C 2JQRB 1N63A 1E10A 2AX5A 1R7SA 2MJ3A 1GAQB 1JALA 3DWMA 2LEKA
chains in the Genus database with same CATH superfamily
3QU7A 2O6VA 2V3SA 3Q8FA 4HRSA 3N7RC 4TUQA 3NGDA 3TFSA 4BXOB 1JWAD 2KQ7A 2L3ZA 2L8JA 4RGNA 4NL9C 4GDKB 2C7NB 8ICJA 4IKGA 1QSYA 4QZHA 1ZQLA 4IRKA 3N97B 1SEBD 4D2KA 5E6NA 4AYBF 3ORYA 4EZ9A 3H40A 2PFQA 2KEYA 2V4IB 4JL9A 3Q3JA 1ZDXA 3BJYA 4FULA 1UA1A 1OEYJ 2ZJAA 1WWUA 2FLNA 2FI1A 4UDUC 1KOTA 1VJ5A 3QU4A 3NVYA 5KG5A 1ZQVA 5EWEA 1Z19A 4QZFA 3BS5A 3BQ2A 2XY7A 1XSLA 3VR9B 3Q6BA 4C8OA 3N20C 1DOQA 1RXWA 3MGVA 2GBNA 4GN1A 4ASWC 2DLBA 1QLNA 3EFUA 5ALUA 3RT3B 1B4FA 2LUEA 3C19A 3QUTA 3IFWB 1XT9B 1A77A 3SAHA 3KYCD 2RLTA 1STEA 2BDPA 4L2YA 5F9LA 2FE9A 3N7SC 3MJ5A 1EXNA 1L7OA 4JWUC 3ZKJC 4Z6DA 3APDA 2UVRA 5DBCA 2IGGA 2WF6A 3IG5A 4I2DA 1ZQIA 3O65B 1FNWA 3OSNA 4LDTD 1TS3A 1WXVA 5JRTA 4IS7A 5CX3A 1QSSA 1L0YB 5AZHA 2W3RA 4ZRIA 1HXYD 2H88B 4C8KA 1ZRMA 4DF4A 5EE9A 5KFLA 1YMHE 1K5OA 1NK5A 5BOMA 4DL2A 2H89B 2NBWB 3BVZA 3NRWA 4I2HA 3HWTA 3UGBB 5KFZA 2L76A 3NVVA 1D8YA 4RZRA 7ICIA 4W9JA 4II3B 3QEBZ 1ZJMA 3KYDD 3M8SA 2VJ4A 5BYQA 5LXIB 3AB5A 1QT9A 1ZE3D 1QKZA 3WKBA 4PZNA 4DBGA 1NZBA 5LLIA 4RF0A 3M8RA 7ICMA 4ED3A 1TKYA 4L1BA 4ZRJA 4FBJB 5IILA 1V86A 1WXSA 2BQRA 2I1JA 2LI6A 3VRAB 2KLCA 1UA0A 5CR0A 3PX6A 4A8EA 3T5KA 2N9LA 5KAIU 1JMLA 2AJQA 2YEPF 1MSWD 4NY8A 1UWXA 2ZJ8A 3SD5A 4GXKA 9ICBA 4IWPA 3Q3OC 1TZ1A 1PVPA 3UINB 5KFGA 3ZQ4A 3PSPA 3TAPA 4W9GA 2WXKA 5DCNA 1KFDA 2L0TA 3GIKA 3ZDDA 2FCNA 4J9NA 2VKQA 2HE7A 1T0SC 5J0QA 2BQUA 1SZPA 3BQ1A 3AE4B 3VR8B 4CQNA 2JX5A 4F93B 3A0BU 3FC4A 4KV2A 4IG7B 3DCGA 3V6EB 4B6WA 4LK0M 2ZIWA 4JLCA 9ICKA 4BOSC 1KW4A 2KDMA 3ML8A 2IO0B 3AEBB 4EBEA 1IBXA 2IO1B 3F2CA 1SSNA 1TTNA 9ICVA 2HTHA 1VZ7A 1RYUA 2KSOA 3PSTA 3QEAZ 2LHEA 2WAQC 2JV3A 4QZDA 1E8XA 4N58A 4ANUA 3PO0A 4BZAA 4C4VB 1L6NA 4QZAA 1IYFA 2N9PC 2KMDA 2MJEA 4RQNA 1SB3C 4DL7A 1A6SA 3W1SC 5HHIA 3AXCA 4UAZA 2IO2B 1LM8B 1BPBA 1XO0A 4GSWA 3L3FX 3RBDA 4IM0A 1D6EC 1LFDA 2DZJA 2MA1A 5EE3A 4NLBA 3H9DA 3NZSA 4DSIA 1XEEA 2KTRB 2LMCA 1ZD3A 2WDQB 4M47A 2VIXA 3AE2B 2OM6A 2AQ0A 5FR6A 3UPQA 5DKWA 2NTTA 3DHGC 1CI4A 1RFKA 1KH0A 4I2JA 2NTSA 4PL1A 4NAWB 2J6TA 4WWNA 3OWEB 3OHAA 1TK0A 4B0EA 4OVVA 3TBLD 3VTVA 4TKNA 1NK8A 5ALLA 1F0ZA 3AUOA 2D2QA 3UQAA 2YLMA 1GC6A 1FPYA 2RD0A 1MQ2A 4Y2TA 4R8UB 1L4ZB 1YQBA 3L17A 1RYRA 4DHZB 4UARA 1BNOA 1B43A 3C2MA 4EEYA 2ZCCA 3AU2A 3H8SA 1Q1OA 1L3TA 4NXZA 1N61A 3UMCA 3VCBA 1ZQOA 2L05A 2ZVNA 3ZJVA 2F1IA 3C2KA 5AI6A 1F52A 4PH5A 1WR1A 2MWSB 1SKSA 1T5XD 2K8HA 4HDOA 2KHWB 3GIJA 4B9LA 3JPOA 5IN7A 2NPTB 4OCZA 3RJIA 4PGXA 3B0AA 4CHKA 2LYAA 4OVZA 4CYEA 1PUTA 1CEZA 3DOWA 3DV9A 2W03A 2W9CA 2BCSA 1CJEA 1F77A 5J2HA 3V3XA 4KLOA 1L0XB 3NZ3A 4B0MA 1YX6B 3V6KA 4KX6B 3T5JA 1H8CA 4RQ8A 4RT3A 3KD3A 3KHLA 2NV3A 2MLBA 3Q69A 5KT4A 4UASA 3ZTCA 2ZG6A 2BDUA 1RDFA 3NRZA 4G11A 2PW9A 2JUOA 3LXFA 3P4PB 3AE6B 3EWAA 3HVDA 1V1PB 3ALBA 1LQBA 2K6QA 3AEGB 1QQ6A 3JPQA 4P4PA 2GBMA 4J9SA 2P66A 4B9TA 3RJGA 4AYBC 1FXAA 1OGWA 3AEAB 3PR5B 1ZQKA 3JPTA 2KICA 3Q8KA 2HHSA 2OHFA 2AXTU 1DRGA 2VA8A 4YG2A 2KHQA 4PS3A 5KFFA 2CS4A 4I2BA 2IOHA 5DGAA 1BPYA 2WB1F 1YJJA 4KITB 4C80A 3TADA 4ECZA 1K52A 4ANXA 2KG5A 5T8IA 2BYEA 1NJWA 1UGMA 2BZFA 3Q8RB 4HCNB 4NV0A 2DYOA 9ICQA 3KUDB 4ANWA 4JUZA 3PW0A 3UQ0A 8ICOA 1NK0A 1J19A 4ZRKA 4FZMA 1TS4A 2JHDA 2JEIA 4MH8A 2CJNA 3VUYA 2XVTA 3OJSA 1E0ZA 4EX7A 4QZBA 1LKYB 1K51A 5G5HA 3SI8A 1WZ0A 1PK1A 2FIDA 2KYWA 2LWPA 4REZA 1N5WA 3A33B 4BKGA 2M0XA 2G07A 2W7OA 1MA7A 2NRZA 3SR6A 3H0RB 4JV2A 5T14A 4WWMA 2ATLA 4M2YA 3LB8C 2FCQA 1J0GA 5ALQA 2I38A 1DGJA 2MSNA 3AE7B 5D2MB 2EH9A 4QIWF 3K75D 1V5TA 3SDLC 4KLQA 3KHHA 8ICMA 5F9NA 1ENFA 4YCXA 1FM0D 2O6VD 3JSVB 2W9AA 1I4GA 2G0AA 2XY5A 5J0TA 1Z2MA 1KTQA 2EZZA 8ICFA 4MHVA 4RQ2A 3D2SA 3FILB 3H0LB 2LBOA 2QIEB 4QWCA 4FADA 2M56B 4ZRPA 1K1SA 2BCRA 3L10B 3UM9A 2HHVA 1VLBA 3DDHA 2J0KA 2FCSA 2J52A 3EPIA 4EKUA 4KKJA 9ICJA 7ICLA 1FCCC 2GLEA 4CNQA 3H7PB 4W9KA 2J6UA 5AUKA 4ED7A 3V6HA 2DENB 5DDMA 4Q8FA 3I1YA 4Y2QA 4PGQA 4ZDVA 2E8NA 1WGHA 2BYTA 2NS5A 4EBDA 4RGOS 1UNSA 4NNJB 5CP2A 2AQ1B 1ET9A 1ZPSA 4HYKA 1E8ZA 4ECWA 1P98A 4YMNA 3M7DA 2BCQA 3TQ1A 2MSED 4P0PB 2NR2A 5BMHA 4KDLB 5J0UA 1WJ6A 2PKEA 4GIBA 4Q44A 1HE8A 2OEDA 7ICTA 4BKTA 3RJJA 1F5SA 1ZQDA 2K8CB 1ZQ1C 1XLNA 3T3NA 1COKA 2KMCA 5D7GA 2TSSA 2PMVA 5H92C 2JQRB 3B08A 1N63A 5DG7A 1ZD5A 3RNFC 4M8MA 1C1YB 4BKSD 2IOFK 4DL5A 2F8KA 4JPSA 4DO9A 1U48A 2HOFA 5J8YA 8ICHA 3EFCA 3JPNA 2UVWA 3URYA 5DPWA 4ARIA 4II2B 4NJ7A 4FXCA 4Q45A 4EX6A 4TUSA 4KN4A 1ZDVA 2G08A 5AIAA 9ICUA 2KZRA 3I3TB 1TAUA 5KFPA 5HP4A 2HVIA 2L5YA 2MHJA 3TUOA 4NJ8A 1JXEA 4NZLB 2WXJA 1NVID 1ZQQA 8ICSA 2IHNA 3QHTA 4LTUA 2BTEA 7ICSA 1P0RA 2GI9A 4MF2A 3A9JA 4MM3A 3C21A 2DYBA 3RH4A 4RUAA 3EW9A 2DF4B 1QQRA 1WXAA 2BB6A 4BXOA 1VR9A 2CU3A 2K22A 5G5GA 2LGIA 2LXCA 2KC2A 8ICAA 2EQYA 2PE6B 3DBHI 3NG0A 2LVPA 3QX1A 1JIHA 5L1LA 4BUGA 3PX0A 2ZXIA 4KN7A 1X66A 4Y2RA 4PJ0U 5ALEA 2PJHA 3IT6B 2YY6A 3MGIA 2O6KA 3CMMB 3EECA 1JMSA 2ON8A 2KIWA 5HHHA 3HK0A 2JF5A 4AP9A 3M9NB 1MG8A 1C7YA 4KSKC 4OD0A 3ZDTA 1KFYB 3G6VA 1TIFA 3CSFA 2AYOB 3Q8PB 1ZKHA 4GXJA 3HKZF 4NQKE 1E8YA 2D5GA 4B95A 2NBUA 2DKXA 1EU3A 3L08A 2G5IB 2BCUA 4ICAA 1V6EA 1L7YA 1NJYA 4I2CA 3TI0A 1TKGA 4P2HA 5C1ZA 3SV4A 7ICVA 4F2RA 4A55A 4RNAA 2QILA 1V38A 2Y9TA 5KFTA 1SL0A 2E8PA 1FRDA 2MUTB 2WXNA 4M00A 3UF8A 4QNLA 2XEWA 3BVGA 2LGSA 8ICKA 5J2JA 5DQHA 4BX9C 2HBJA 5AKXA 5KG3A 1JXLA 1QOBA 8ICNA 2ALZA 1SJHD 1L2NA 3PV8A 3EPGA 4F5OA 3IDWA 1KLVA 3AQEA 2FLLA 1N2XA 3NTUA 2ES6A 3DBSA 1AWDA 3P42A 4YXJA 5HMLA 3Q8SB 1S8OA 5AM5A 1I4HA 4N9F4 4G9BA 4QWBA 1YQ4B 4KIKB 1Z1VA 2GOLA 3LJ3A 3H4BA 1B22A 3QU9A 5ALPA 3OLMD 4JIOU 1DK3A 3EGRA 1E7UA 3LDAA 4LNNA 4O5EA 4P1CC 2OJRA 2LKYA 4JMUA 2HD5B 4FBUA 2UVVA 1HEZE 2Z0EB 2W9BA 3JPPA 5A0LA 4P7IA 1L3VA 2JXTA 3PLUA 2BWES 2KX3A 4UB3A 1KDHA 3WAPA 4O1NA 1P7FA 1TS5A 3KLSX 5AM2A 5ALYA 1Y8RC 1SBBB 2BW2A 3TEZA 1FEZA 5ALRA 1RPLA 9ICMA 2ZNVB 4GMVA 4EOYA 3TEXA 5AKKA 2RDBC 2XIDA 5KNIA 1L3SA 5AZFA 4M0WA 4N59A 2HVHA 2DQNB 4J9RA 2V4LA 2YVCA 4I6PA 3M1YA 2QKQA 4XA5A 2AQ4A 2W3SA 5DBBA 3RPFC 3HJEA 2ZW0A 2GLSA 1VJKA 2KO3A 3RMKC 3I76A 5ALZA 1DK2A 4JB3A 4C4TA 4QWDA 1T6BX 4GGQA 4UAUA 2PXIA 2QDFA 1WWVA 4RQMA 2P6RA 3RRGA 2GOWA 3PMLA 2FPKA 2CHZA 3Q3FA 2D3DA 1XQQA 1XNSA 4IQTA 3RJHA 1ZQYA 5E6PA 3RRHA 2KTRA 4JV1A 2OJWA 1RRBA 4M0AA 2RGFA 3GILA 2JU6X 3ZRCA 4M02A 2ZIXA 4IRDA 3L0WB 2BWFA 2QJLA 4A20A 2JGAA 2W8LA 2KKCA 1HUZA 3ZD9A 1T0RC 1NI3A 4QW8A 4IQVA 3HT3A 2GBJA 3E56A 2DGZA 4AWJA 4HLEA 2WU2B 2JZBB 2IHMA 2CRXA 4HEA1 5J2RA 1O03A 1PGBA 3GOEA 2WHIA 5ALMA 3BYTB 4NM2A 2A1JA 4KLFA 2HJ1A 1VRAB 4W9CA 3MC1A 5KTQA 4R8UA 4HWIB 3UIPB 3FDSA 4C7YA 4GB9A 3VUXA 5AI9A 2CR5A 4ECUA 1WXMA 5D3DA 4IC9A 3OJUA 9ICHA 1WJUA 4IM2A 4DDID 2PLPA 4LNKA 3ZJTA 3U7ZA 4KSLC 1O08A 2R8HA 2WXHA 4XYCA 2Y9UA 3V05A 5ALNA 2XNAC 4JWMA 4J9QA 3AQFA 4W9HA 1JX4A 4BWJA 5L9XA 2B21A 3M63B 3AM9A 5BOLA 1SIFA 3NVWA 1VCBA 4IQWA 3H8MA 4F7ZA 3SENA 2FAZA 3PSEB 4OO1J 3IV6A 1D9DA 2H3ZA 2Y0SF 1L8OA 2WX1A 5C0YA 3R66C 4ACFA 3DWMA 1DGSA 1ZQBA 2KNBA 5J0YA 4DLEA 1XO3A 2R8JA 3DQVA 1WF9A 1QZEA 4P4MA 1S0NA 3V6CB 3ZNGC 3PRZA 2N1RA 2BBCA 3PHXB 3RH5A 4EELA 1TT5B 4I29A 1GB1A 1WGGA 3G6XA 3KHRA 2HMXA 1HUOA 1S1QB 2KJ6A 2C5LC 5HHDG 4ZOHC 3T3OA 5J29A 1BT0A 1YJIA 1V1PA 3KZXA 3ZDAA 2WNMA 4HPLB 5AKEA 2C9WB 4J3OD 1V49A 3ZJUA 3A1QA 3SQIA 1VZ8A 1D5MC 4BWMA 2ESEA 4DS4A 4JWNA 1UT5A 4IWOA 4WH4A 2DAFA 4W9IA 3N3KB 4U6PA 4F4ZA 3EYZA 4NWIA 3ABVB 4Y2XA 4I2AA 3RZFA 2INNE 4B9NA 4UAWA 1WM2A 1V2YA 1F9JA 4Q43A 2IA6A 5CRXA 5DG8A 2MA9B 2LRWA 4HK2A 2ZTCA 9ICNA 4OZBA 1ZRNA 2ZJDA 2KQ4X 4W9EA 4UBCA 3I57A 2LZ6A 2IMWP 2GBRA 2HBLA 4LDTB 3THVA 3HKZC 5BYSA 1J2MA 1SIJA 4KZCA 1HTQA 3N7PD 2QB0B 4J6IA 2XCPA 2JEJA 1X9XA 1ZQRA 2V3PA 4NLCA 4IUMB 1ZXHA 2BQ3A 1LKYA 3V60A 2W54A 3A9KB 2JEGA 4K7UA 1TAMA 4ECSA 3MC0B 3DEEA 4YWGG 2R2QA 4Z6EA 3D2NA 4KLUA 3JPSA 1IPGA 2ZPNA 3RJEA 2BCVA 3TJPA 4FJZA 4O5CA 5J0PA 4K1RB 3M6ZA 2N1WA 5IA7A 1SF0A 4KLTA 3MGHA 2ZIUB 1E8WA 2QCZA 1WG8A 3HM6X 3JSVA 4ZYNA 2MBOA 4DL3A 2EKIA 8ICUA 2BGWA 1SE2A 2K8BA 4R64A 1NKBA 3IXSA 1KBUA 1PZNA 2MRPA 2IY0B 3FILA 1C20A 3JVZX 4M9NA 1PUZA 2ZIVA 5KFBA 2WTFA 2V4RA 2DPJA 1R4MI 2IZVB 4YTPB 2Q0ZX 4A3OA 4PS7A 4DF8A 3QU5A 1D3ZA 4DHJD 1IM4A 4YR2A 5EWFA 1NYQA 4DXFA 1EO6A 1PGAA 4K7SA 4YSXB 5FKAC 1ZQSA 4EYHB 3K9OB 5ALOA 7ICRA 4F71A 2I2YA 1WXQA 3GV5B 3ICXA 1OTRB 4S0RA 1Z3EB 2KJ5A 4DOAA 4XC2A 2KJRA 3RJFA 1RQLA 1PK3A 3DDCB 4UW9A 3DVNV 4WJ3B 2R18A 2L83A 3PLVA 1S0VA 5KFYA 1I4PA 1YJ1A 5DQIA 3PW2A 4RNOA 1BPZA 3WK4A 9ICSA 4RH6A 4J9KA 4P0PA 2K4PA 3RCZA 4O3SA 2XK5A 2VRRB 3Q8LA 2KN7A 2LXAA 2AGQA 8ICEA 2KFJA 4HDQA 4LNIA 2IBIB 3T79A 2WF8A 5JHAA 4KMUA 3PZDA 3QC8B 3PSIA 2HSZA 1TZOA 4RNNA 3GP7A 3GIIA 4KLSA 2J4XA 3MTNB 1AROP 4O3QA 3RAXA 9ICXA 2JPHA 2YTUA 2KFKB 3WKCA 3L16A 3RULA 4TUPA 2H5XA 1EWCA 1RXVA 3HILA 1ZQTA 1RWSA 4MGIE 1IIPA 3TEYA 4OJ6A 2PI5A 3IAM1 2KOBA 1R4NI 2CN1A 5KFVA 5DGBA 1V80A 4O3PA 3QUCA 5KT5A 4MACA 4YT0B 1ZQAA 2JWUA 1A76A 2K0PA 3MABA 3LDZE 1NKEA 4IW0A 5E6OA 1FD6A 2F1JA 1T3NA 1QTMA 3H7IA 4CF5A 3HW8A 1SXEA 1XU4A 2KAJA 3U52E 5AK4A 1TS2A 2DYMA 4BOZB 4FE3A 2EAPA 5HMMA 5C5JA 1UWMA 4KGSA 3LYYA 5AKLA 4WWOA 2J0JA 4MFAA 3DBHB 2YMLA 2M0NA 3QQ8B 5G55A 3SD7A 1FXIA 4FZNA 2C7HA 3PVLA 3MR6A 4YXMA 3DPDA 5LXHA 2YQEA 3MR5A 5DPTA 2H3IA 3Q8CA 3H7SA 2N7JA 1J8CA 5B5EU 8ICLA 1CRXA 1YD8U 3HUIA 2WWZA 3AV8A 2MH7A 1SE3A 3IG3A 1RLFA 5KFKA 2LYBA 4CE6A 4HJKA 2WDVB 2C60A 4CGZA 3D32A 2F2AB 3B0YA 2FPMA 2KJ8A 3WK8A 2N7DA 4WURA 1AW7A 2KACA 1K53A 3NS1A 3Q8MA 1S77D 2KMAA 3EC8A 3H8JA 5J0OA 1WR6E 1ECWA 2UWQA 1L3UA 3DBLI 4W9LA 3E2EA 2HHUA 4JK1A 5J2KA 4KGTA 3M9MB 1U49A 1N60A 3DVGY 2NRWA 4UB1A 4XDCA 2Y1IA 3VFKA 1TKEA 2A5UA 1WIAA 2KJ9A 1MHXA 3OPXA 2ZXHA 2L7RA 4WIPA 1VD2A 4F2SA 1L4DB 5KT6A 4NQLB 5AI8A 3KQ4A 2NRVA 3AE8B 5AM1A 2KN4A 1V97A 1ISNA 3VVWB 2C2RA 3A4RA 4F8CB 2M9NA 1WGKA 4GC7A 2MBBB 2Z7JA 5KL8B 2DFLA 2XY6A 5ALHA 5E6JA 4RQ6A 1WGYA 4FJVB 4AP4C 3U4EG 1LGRA 4Z6CA 3PW4A 1ZW7A 4YXDB 2BVCA 2D6FC 3PS6A 4RM8A 3PZPA 2W9MA 1MJDA 4ANVA 3VXWA 1AYFA 4XWTA 1SXDA 5AKGA 2Z8LA 2RMMA 4ZH4A 2UVUA 2CHWA 1X9SA 4EZJA 1FNVA 4IOIE 1XCTL 2FMSA 2KZMA 2L0FA 1ZYQA 2JY6A 2D8CA 7ICGA 5J2AA 2VANA 1TK8A 2F77X 4MGZE 4WQMA 4KIKA 4XDDA 1DYQA 4P4OA 4M9HA 2IGDA 4BAXA 1ED1A 1BUIC 3QK0A 2KMMA 4RT2A 4O0IA 3S2AA 4KX3A 3AEEB 2AGPA 4DQPA 3AEDB 4MDKE 2WX0A 2VH2A 3KFUF 1KJTA 1VZ6A 5KFIA 2KDBA 3H8HA 5D6JB 2KKPA 2G3QB 3TADC 3OGUA 2ZCBA 1QSLA 5GMVA 1P9DU 1RZTA 3UXNA 8ICCA 1KFTA 5JUMA 3ISDA 1GUAB 5HR6A 2JZ3B 5J2CA 3J9CA 3TEWA 3IHPC 2E1FA 3W5UB 4ECTA 3QYPA 4F4WA 4UQGA 2M19A 2BGFA 2PEAA 4YQWA 3OTQA 2V4QA 2CKHB 3RNAC 4DQQA 1UGJA 3M62B 4F50A 2ISOA 3RBEA 2O6VB 4F72A 3TACB 2G4SA 3RNGC 2IJ0A 2J7QB 3C5FA 4DQSA 2J42A 1I35A 4MEYA 1PDXA 1RAXA 2M1MA 1NYRA 3TANA 4M6WA 1X42A 1FNUA 4OJPA 1UPHA 2EANA 8ICWA 2WDRB 3H1UA 5HG2A 2MJDA 2AQ2B 2K89A 3QARA 2DNFA 3ZTDA 4FJYA 2XICA 4E71A 1WCNA 3ZI4A 8ICIA 1XC9A 3HHMA 4KDIC 4TQRA 4RU9A 2E3TA 3A4SC 2INPE 5IIJA 4DSLA 1KM7A 3N9YC 3KWVA 4IM3A 2DZKA 5AKZA 3WA0A 4DL6A 2HBMA 1D8LA 4O3MA 3VQIA 4Y2VA 3ECIA 2W7PA 5FP0A 1QLBB 2I1KA 2IYDB 2R8GA 2WHEA 5CHGA 4Y2SA 1YN4A 3VDZA 3VUWA 5KFSA 3KOOA 1KL9A 3B0XA 1LXDA 4DFMA 4B6JA 4I2FA 2OCEA 2C28A 1L0VB 1UD7A 5KFRA 4ZHPA 5IINA 5BMIA 4GFJA 2PKOA 4F5PA 3MP9A 1EF1A 3PO5A 1S5LU 2WLBA 5DPRA 4XRHA 3VH3B 2JVCA 3PRPB 1IGCA 4PGYA 4YP3A 3LYSA 2KOXA 3I9V1 3Q8BA 3GV8B 5KHQA 4AUQC 2INDC 3PHWB 2PVOD 3UQ2A 1MHHE 2K6DB 3P4SB 2MAXA 4BBNF 4MFCA 1PFDA 2JRZA 1AARA 4FHJA 3C23A 1WJ4A 4YFKA 3DVNU 1HQRD 2I1QA 5DB7A 1JN3A 3C2LA 1WMHB 2RR9A 2IY1B 4WJOA 2RDHA 2K60A 4A6QA 4JX1C 1I4RA 3RN9C 2V0GA 5J8YC 5HFYA 1SL1A 5IIOA 1NBFC 2AGOA 2FBWB 2CPRA 2P6UA 4J03A 2DPIA 1GPXA 1D8BA 5TISU 3PV1A 3X23A 1S3SG 4EUTA 1GNUA 3A0HU 3KUCB 5JHBA 3MR3A 2BF8B 3OG5A 2E5SA 3CRXA 2JXXA 2G06A 4Q2JA 9ICPA 5LNK1 1OQRA 2I6XA 3BZCA 2B6GA 2YB4A 2RDIA 2A4ZA 5ALSA 1Z1BA 2JZZA 4YSZB 3HRDD 1RG6A 2R61A 4G50A 2H3QA 2C2DA 3F5AA 2B3AA 4OJOA 3SHQA 1QCKA 5DQGA 1UZXB 2Y5CA 3N32A 2QARB 1TFRA 3RB0A 1K8RB 2GBKA 1QOAA 5D4BA 5TZVA 3B1LX 2ZIWB 3TARA 3OAWA 2JT4B 1SJED 4FHKA 2M4NA 4GDKA 1AN8A 5IOIA 2NVUI 2QLTA 2KIVA 1WY8A 2ZJ5A 4CF4A 2MRLA 2FMQA 2EMSA 1QF6A 1OXJA 2BQQA 2HOQA 5J0RA 4M8NA 2NCNA 3T5HA 3O13A 3CYMA 5KFWA 1JWUD 4DK5A 3C5GA 5ALTA 4WJPA 1EWYC 4ZRQA 3IBEA 5KFQA 2JEFA 4OJLA 2KANA 3QWZB 1M6YA 3QU2A 3EZ5A 1LO5D 3A9KA 2KVZA 1C3TA 3JYUA 1I7HA 1QQ7A 4RUCA 2CU1A 2FUG1 5CA7A 2IPKD 2QC8A 3VH4B 4DSKA 2KNJA 2EELA 2G4DB 4I6LB 4NY0A 4DXAB 5KFOA 7ICKA 2BKRB 2QSDA 1AQ6A 2QHOA 1CK1A 1ZQHA 1N56A 1Q0WB 2ZIUA 3T9LA 1U47A 4MEMA 4KTQA 3T8MA 4QAYA 1MVKA 4KLHA 2AX5A 2RRDA 2ASJA 5CJ7A 3F2DA 1S9FA 2QMTA 3KW5B 4EENA 5IO9A 3SAFA 1GB4A 4RQ1A 3LWLA 1FIQA 4GOCA 3HP6A 4LJXA 1V1OA 2UU7A 3GFKB 2BPCA 2MBEA 2KVCA 4F5QA 3E0FA 3WKEA 5C23A 1OQQA 3PPAA 4UAVA 2E8MA 4IR9A 5AKYA 2A19A 4MFFA 1ZQUA 2ASDA 3PT2B 2LD9A 2V1YA 4IR1A 5J0XA 1YN3A 4F3OA 3Q2AC 4QZGA 2YB1A 5AZGA 2B76B 3RH6A 2K3UA 3H0MB 1ZOLA 2M0AA 1ET6A 1F1HA 3ISCA 1K50A 5KG4A 1RM6C 3AE5B 4MJSB 2IBKA 4I2GA 1ZP0B 2K5PA 2WXOA 2MP2B 4DL4A 2LFIA 1S0OA 2XN9C 3HM3A 1KN5A 4HPMB 1E6EB 2V9HA 2RQ5A 4OZCA 2WB1C 4C56C 1XD3B 3WCQA 4YMOA 1H38A 3BINA 3MHZA 4ED6A 3QE9Y 3N30A 3K4GA 1B1ZA 4KGRA 1YQ3B 1R4NB 2D3AA 2JYEA 8ICTA 2KTFA 3WAMA 2SAKA 7ICPA 2KFKA 4GIVA 3ZNZB 4P0QB 1BMLC 1X40A 5J2GA 2WS3B 3RFAA 3ZD8A 2WYQA 1JROA 3E58A 3FM9A 3MBYA 1G6JA 5KFXA 4ITKA 1X9WA 4KLDA 3L54A 4GC6A 2G09A 1WH3A 3W1YA 3MHSD 1HTOA 4KLJA 2B0CA 3G6YA 3NJTA 3P4RB 4MT5A 2MEKA 3B2FA 2L00B 4QIWC 2AL3A 1XWLA 1Z00B 2WXIA 4MGKE 4I28A 4C4VA 3PY8A 5DDYA 1UH6A 3PGEA 1NI2A 3FKYA 3VRBB 1DOXA 3QXGA 1T8EA 4B9SA 3GZNI 3W9CB 3NY5A 5KT2A 4ED1A 1X9MA 1XLOA 3TFRA 5JH5C 4I6NB 3O0FA 4EYIB 3IT4B 2W43A 3GZFA 5KG7A 2D11A 4ELTA 3WALA 1J7BA 1DOIA 4DEZA 3SZ2A 4C8NA 2WGSA 2JZPA 2D3GA 3DBLB 2PTLA 2NMQA 4HKZE 4KLIA 2FNJB 4NAWA 4EEWA 1SKRA 2BS4B 4HROA 4IRCA 5KFCA 4EFOA 4DWIA 1ZGUB 3U8ZA 4M9JA 1Q46A 2K4EA 1R7SA 4BBNC 3C0RB 5KFMA 4I2EA 5BMGA 1WFYA 5GXGB 2KE7A 3VHTC 3NASA 4BJQA 1ZQMA 3QZ7A 4DQIA 8ICGA 2KJHB 1SV4A 3SEBA 4FZLA 2Z59B 3BK2A 4G0NB 5J0SA 1JUDA 1I4QA 4BFRA 2QB1A 4IL6U 3ZXVA 9ICAA 3AN1A 1KQQA 3RZWC 3RNEC 4RPXA 2ISPA 4AS1A 2KZZA 4F5RA 3B9JA 1IUEA 3AMZA 3C1ZA 4FFDA 2NPTA 4R63A 1ZUD2 2QEJC 2WXFA 3AU4A 1NJXA 8ICYA 3V61A 1SV0A 4YD1A 5AK6A 1XF5L 2DZMA 3EHVA 2EDUA 5ALWA 4J9OA 4TV3A 3ZXRA 2F3NA 2EZXA 1P1AA 2NRTA 4F91B 1KKXA 5ALXA 4DOCA 3NOBA 3QA8A 3GDXA 1UCVA 4UB6U 4ARCA 4QJFB 2YEPB 4RQ3A 3RAQA 2XGQA 3UMBA 3RB6A 2PVGC 2RPVA 1YIWA 2KVRA 3GQCA 4ED8A 3U30A 1X6IA 1IXRA 4FBTA 3AU5A 2AL6A 2IGHA 4F92B 5HNKA 4M9GA 1TKDA 2KC1A 4MELA 2W8KA 1KSPA 4OJ5A 1MG4A 2AH5A 2OXOA 2BR0A 5KFNA 2R8KA 2PIAA 2VZKD 2WXLA 2SEBD 3W5VB 3C29A 4ECXA 1NKCA 4FLHA 4XZ4A 3WANA 4PS8A 4DFKA 2D3BA 1S0MA 1JWMD 2JR5A 5EDSA 2XI9A 2YN4A 4F5NA 4J9LA 3RB3A 4I27A 1HZ6A 1QOFA 4NLZA 2AU0A 2E6XA 1ZQEA 2HI0A 4AJWA 3PW7A 3QX7A 4M04A 4RCOA 3CSTA 3QUQA 3W2DA 5DLGA 5EOZA 2OYYA 2H3VA 9ICTA 3KKAA 1C9FA 3I28A 3LWMA 1X1MA 4NM1A 2KWVB 5AI4A 2Q5WD 1P3QU 1XLQA 3MR2A 3BIID 3F5EA 4YR0A 3RNBC 5D49A 1X2IA 3SV3A 2JWZA 3U2SC 1Q3VA 2G45B 4NLKA 3KH0A 4GXIA 4WQOB 1KLNA 3A9JB 4CDGA 4K4GA 3I5JC 4KZ0A 4NLNA 1WX8A 5GTIU 3RR8A 2OOBB 5EWGA 2JYTA 4YL8A 3NS8A 5DG9A 2W55A 4QZIA 3BDPA 4K81A 1MPEA 2ZTDA 2XCAA 2K4IA 1E5WA 1OW5A 3UXOA 4ECRA 3BZDB 4C4SA 1OEYA 5AUIA 4DFPA 8ICVA 2JRIB 1NK6A 5CHFA 2MX2A 1XS9D 3AEVA 1CMXB 4DHJB 1P7EA 2G1EA 9ICCA 2KDFB 4NL9A 3V7LA 2J6SA 2LHDA 3R7RA 2LYHA 2E8OA 2GH1A 2BPGA 1J2NA 3GU3A 4RQ0A 1PYWD 1JALA 3T3FA 1PQSA 3H8WA 3GIMA 5KFAA 1YZ7A 1SE4A 3F53A 5AEKB 5DLFA 2EKEC 5EE0A 2FPLA 9ICFA 2KTQA 3SEIA 4J9MA 1WZ3A 2F76X 2GWSA 5D94A 3DWGC 3ONNA 2N9XA 4URKA 2LJIA 1QQ5A 1YOVB 3KUZA 1EU4A 2D3CA 3MC9A 4GU2A 4NJCA 4YVZA 3N1ZC 7ICUA 1WX9A 3BVMA 1QH9A 1ZJNA 4JGHB 2O2VB 4EZLA 1SKWA 3APCA 3IG8A 3H7PA 1TK5A 3N28A 2NO5A 4O3NA 2G9HD 4P6VF 2LI5A 2ZUCA 3IVFA 2EAOA 3SYZA 3P63A 4BKSA 2V9WA 4RQ4A 9ICIA 2D07B 1WSPA 4DWFA 1C4PA 3ZUNA 4PYZA 3GE3C 1JWSD 4KVGB 1NK4A 1BXTA 2E1EA 4LZDA 2M8SA 4ECVA 1WMHA 4NPNA 1MN8A 2PI4A 3ZDBA 3DHHC 2HJ8A 3FYHA 4RM9A 2K8CA 3Q3NC 3PRMB 7ICOA 4ICVA 1H4RA 1XO1A 5AHXA 4Y2PA 1C76A 1SWVA 3K1RB 4I2IA 4YSYB 1CQVA 4FS2A 3AU6A 1E7PB 2JRHA 1WRIA 4AJYB 4QZ9A 2HBKA 1FMAD 5MPOA 1L6VA 2LM4A 2HW3A 1XXGA 4TSSA 4FO6A 1JRUA 1ZQJA 1JCKB 1RQNA 1S76D 1L8LA 2W9BB 3C1YA 1UQVA 1L5UA 7ICEA 7ICJA 2YX8A 1FFVA 3NZUA 1TAQA 2ZTEA 1WUDA 2DAJA 4WJQA 2I5HA 1I4XA 2EZYA 2PFPA 9ICOA 1JW9D 3RNCC 5EE1A 3K1ZA 2HHWA 1L7NA 2M17A 3PR4A 2WQYB 2K4HA 2QARA 2WFAA 4PL2A 4US8A 5J2EA 3QNMA 2J53A 4X57B 4GDLB 2VH1A 1X6JA 3EUB2 2LASA 1MI0A 4Y2JA 2FCMA 4F1SA 3SU8X 9ICEA 1U4AA 4DDGD 2G5HB 2KFNA 3BQ0A 3MDAA 1SGGA 1Z4NA 1ZQWA 2ONQA 4OHJA 3N1XC 4K3CA 5KG1A 4M0WB 5IKCM 2DL0A 5AM4A 2DZIA 1CZPA 2KN5A 1KRPA 3JW0X 1P7DA 3SMVA 3KBBA 3ZDCA 3OJ4B 3AEFB 4LZGA 1L6UA 2P35A 2AEHA 3M95A 4NAMA 3GE8C 2LUMA 1BNPA 4US9A 5KAFU 3PO4A 4BVUC 3Q8EA 2BPSA 5KFHA 1WRDB 1T94A 2C2EA 2ODGA 1Q10A 4O3RA 5IIIA 3R7QA 2OEHA 1I42A 3W1SA 1LV5A 5ALVA 4ACOA 5JTIA 3IAS1 2ZIXB 3UMGA 4PHPA 1V85A 4K4HA 2KQSA 2WU5B 1UF0A 1PGXA 4DSFA 1IV8A 2Y0SC 5DBAA 2K9XA 4LNOA 5DPSA 1U45A 3MFHA 3MFIA 4DQRA 5KG0A 2LGYA 2PE9A 3E9SA 3CF6E 4YTMB 1TBEA 2MUTA 1KLGD 1L7PA 1NENB 8ICRA 4PHDA 3KHGA 1J7CA 1ZQCA 4C8MA 4GXBA 2L32A 2A1JB 2MU2A 3ETRA 1J7AA 4LLGM 2JH1A 5L1IA 2I9GA 4QZ8A 2N1VA 3VC8A 9ICWA 4MSQB 4EEKA 3AE1B 2FMPA 4Q8EA 4CRXA 2NO4A 2OWOA 2KWDA 2Z0DB 2MW5A 5L83A 5J17A 5AI5A 3ZGZA 3HPOA 3ZDEA 1C77A 3IHQB 4F4KA 1J97A 1EM7A 1KRHA 2ICIA 2HTME 4W9FA 1FEHA 1T4GA 2UYZB 4RNMA 2LGXA 5KFUA 4E74A 2WXGA 2YMPA 1GJZA 1FCLA 4KX5A 1V5OA 4KKIA 2R8IA 1ZD4A 3U7DA 1ZD2P 2K8AA 3NHEB 1T3QA 7ICFA 2REXA 4KLEA 4MJSA 4HKQA 2N4FA 5DB9A 2MP2A 3TCAA 1Z4OA 3M9OB 5K4LA 3QZ8A 4K4IA 3RI7C 4MH0E 3ED5A 1B0XA 3CW2C 1KF6B 3RR7A 2KFZA 4HXDA 1U9LA 3ZRFA 1SL2A 4C7ZA 3D2QA 2ZNVC 4O3OA 2J0MA 4MEXA 1S10A 1MQ3A 2DX5B 5TSSA 4X5VA 1SZHA 4TURA 3AH7A 9ICGA 5KT3A 7ICNA 2Y5BB 5H8YE 4P0QA 4C8LA 3A1QB 1WM3A 4WAFA 4DQOC 4MGYE 3DBRI 3HIZA 5F3XB 2BS3B 2PMZF 1WCLA 2C7MB 2CHXA 2WXMA 3ZIMA 4Y2UA 1PVRA 1MFWA 1KTKA 2IOFA 2ZPYA 2X38A 3WIMA 3UXPA 3WK7A 4QZEA 4UATA 3P4QB 1N5XA 4QZCA 2KVSA 5KT7A 2WF9A 3LVWA 1IGDA 3AECB 2IDYA 1C79A 5KG2A 4TQSA 4O5KA 2Y3AA 3AE9B 1Z00A 3GZNB 7ICHA 3APFA 1XSPA 2GB1A 3DVGX 3BY4B 3L13A 2KX0A 5I4DA 2H3FA 1RFAA 2CXYA 1TJEA 4E0DA 4HPPA 2JH7A 5AKHA 1C78A 3TIXA 1M94A 3PX4A 3BS5B 2NYVA 2OH2A 1GAQB 1WI0A 4ECQA 3QIJA 2DUYA 3VAWA 5CWRA 1JI7A 4DS5A 4JV0A 2V3NA 3L4PA 2KWUB 2WDTB 2K25A 4NLGA 3C28A 1T0YA 4KMOB 2Y1JA 4ECYA 2C22A 9ICLA 4K3BA 3M3JA 4J9PA 1NOMA 8ICZA 3RD2A 4JE3B 4R66A 3MDCA 3SFEB 1BGXT 1BPEA 3R2IA 3KZIU 4M01A 2HHTA 4UAYA 3WAOA 3ZYYX 5FK9C 4CO7A 4UB8U 4YN4A 2JZBA 4LJPB 5KL1B 2KT7A 2WP9B 2ZVOA 3L5KA 4TQ0A 3PNCA 4B9UA 3CNHA 2KD0A 1M4VA 4L23A 1D5XC 3BZKA 1SE9A 2KK0A 2K8BB 2Q4TA 3WK6A 2GO7A 1S97A 1WWTA 3CIRB 1V9JA 1D4BA 1URJA 4EZ6A 3MJWA 2ZIVB 1A5RA 8ICXA 4PK1A 1HJPA 4AOFA 2BS2B 2X8XX 5JU5A 4H2AA 2HHQA 1SGHA 3VTUA 3RYTA 5L1KA 2BKEA 1UHUA 5AKJA 2XGPA 1ACCA 4M9LA 5J2IA 3PTFC 2WXRA 1ROEA 5ALFA 2ZZPB 3Q3MC 2AHOB 3D6JA 3KVFB 3ZLZA 5C3JB 2R2OA 4WJNA 5L1JA 3TKAA 1Z5SB 4TQ1A 2ZW1A 1TY2A 9ICRA 1KEJA 1D9FA 2RP5A 2KD1A 4U7CA 2BHNA 1N62A 2N0SB 5GTHU 2XBBC 1TGZB 4RGMA 3BK1A 2KDIA 2BKFA 2DBYA 1NDDA 4LNFA 2XK5B 1A70A 5AIBA 5AKIA 2VA3A 4IDIA 2BPFA 3WKDA 1DOYA 5HKHA 1Y56A 1TE2A 1SWWA 4UB2A 2KWCA 1WGRA 3AULA 4B9MA 1IP9A 5FR3A 4LCDE 4KLGA 4B9VA 4ED2A 5ALGA 4PHAA 4G3XB 1K1QA 2LM1A 5IIKA 1YX5B 3F2BA 5J18A 4MSMB 5KFDA 3BWUD 5JZEB 2FLPA 1EF5A 2K1FA 3IRUA 3B2GA 4FN2A 1IBXB 2IO3B 1GOZA 1NEKB 1D5ZC 5ALIA 2XO7A 4C4RA 3WK5A 2KSOB 3ML9A 3ONSA 3M6KA 1E9MA 4GLXA 1HA5A 1MC8A 5KHOA 4CF3A 2FUHB 5JXVA 2A1AA 4PYUA 5CEHA 4RQ5A 4KLMA 2RDGA 1E10A 3SAGA 1LB2B 4DOBA 2QB0A 4KLLA 3RTVA 4ZYSA 3V72A 2NBVB 3I63C 3LVVA 5H2FU 2CJOA 2LJ5A 3OHBA 2KZ3A 5ALDA 8ICBA 3ZO5B 4ED0A 1Q5WB 2WXPA 2HDEA 2KK8A 5CTRC 2DHZA 4XQ8A 3TAQA 2BT6A 5ALKA 5L1MA 3Q8QB 2BYVE 3RUIB 4Z6FA 2K39A 3GS2A 4OW0A 4RMAA 1QILA 3PREA 5IAAC 2JSVX 1WYGA 2A3VA 4A9AA 1NNLA 1R4MB 4E3CA 1N48A 4ELVA 2KXJA 2FJ6A 3IM1A 3RF9A 4A8XC 2EMTA 4EE2A 4UBBA 2D10A 5E79U 3BYYB 1ZETA 5BYRA 4XWWA 1ZQZA 3ZNID 1N6ZA 4ELUA 3WK9A 4IC7B 1UUPA 1HZ5A 4K7WA 5AI0A 1HEKA 4N6EB 3PW5A 1GO3F 2ASLA 4A90A 1EUVB 3BQTA 1TV9A 1GC7A 4W9DA 3T5LA 2ASQA 3HX0A 3CWIA 3AI5A 1WE6A 5L95C 4OVUA 4YMMA 3JPRA 2Y5PA 2L52A 4FS1A 3V6JA 1NK7A 2O2VA 3OJ3A 3ZNHB 4AQ7A 1UT8A 4P16A 3PVXA 2W82A 1HIWA 3MFGA 4NJ6A 2RPQA 3NUQA 1V9PA 1ZQXA 4GLSC 1CUKA 4YD2A 5HR7A 5CHVC 3TL5A 1GG3A 3IN5A 4RPZA 2W9CB 2LRUA 1OQYA 1VDVA 4QW9A 3R2TA 3GB1A 2VA2A 2ZUBA 2DWQA 4OZAA 4XGAB 5J2FA 1ZQFA 1OFFA 3AL0B 1WE7A 2PFNA 1ESFA 2LGDA 3K9PB 2RDJA 1C4CA 2L1AA 4YTNB 1FXTB 2HCFA 4HJGE 1ZOYB 2PMZC 1T0QC 3ZW3A 3N4MB 2KLGA 4PHEA 3ENEA 3R8BA 4QWAA 7ICQA 2F44A 1U4BA 3X0WA 5TR5A 2JMGA 4FA6A 2F8LA 5AK3A 4HCPB 4JWSC 2YMQA 3S6JA 3EA6A 4DSJA 4R3DA 2ZUDA 4PZOA 1UBQA 1ZQGA 1RYSA 5BPCA 5CB1A 2N9EB 4S17A 2N9KA 2DKZA 4DHZE 3PSFA 1FO4A 3RJKA 2W04A 1NK9A 1TVAA 3QCAA 1L5PA 2LPEA 2PFOA 1E90A 4DSEA 2ACZB 3ZDMC 5AK5A 4ICUA 4GDLA 1ZQNA 3TSSA 4WAAA 1C4AA 2FE8A 4F4XA 4P1BC 3J81j 4PT5A 1YNTE 1F2RI 3V7KA 1NJZA 2WF5A 2LEKA 2EAMA 5KFJA 1A0PA 2F1HA 4UB4A 1V81A 3KWLA 4TUUA 3GV7B 1WGDA 1JWBD 4DXGA 4M6WB 4BDPA 4C00A 3U26A 5IIMA 4R65A 1PK1B 4RPYA 8ICPA 1F0MA 2KKVA 4LVSA 2N7EA 5AM3A 2LMRA 1TY0A 4DFJA 1Q3UA 4HAIA 4F8RA 3Q14C 4LJOB 2RHFA 3AE3B 2WXQA 1DXSA 2WAQF 1L7MA 1UELA 2W11A 5HI1A 4O9MA 4C0ZA 3SFDB 1XSNA 3ISBA 2LHTA 1Y88A 3NUHB 5ALJA 1XCQL 5AICA 3QAQA 3UQBA 3NVZA 1KLUD 4ZHOA 4RF1A 3VTWA 4WWPA 2KHVA 1COOA 3ZVVA 1WJNA 2VJ5A 3PMNA 1FFUA 3H6NA 4DLGA 4YR3A 4RFBA 1SV0C 4PPXA 2HDOA 2FIFA 2KV2A 1YT3A 4CCHA 4XX5A 1NZPA 4G3IA 4QWEA 2GRIA 5IP4D 4DCCA 4DFDA 4B9KA 3MC8A 3IP4B 1YN5A 1LVHA 4MF8A 4USAA 4Y2YA 4UB5A 1FRRA 3V7JA 1WX7A 2GMIC 1OUQA 2JXJA 4EZKA 5DB8A 1T7PA 1BPDA 2VZKB 1BVSA 2AQ3B 3R9KA 4IWQA 2MBQA 2BB5A 4JQWC 3PZ8A 3ALRA 4RQ7A 2AWTA 3LK9A 5B66U 1XLPA 3P2BA 3ETLA 3UIOB 1PVQA 1ZXIA 1BPXA 2HHXA 5C2TB 2MQJA 3V62A 2W9NA 8ICQA 3R3MA 5G2NA 2ZEQA 2XC9A 3Q8AA 3WKAA 3KTQA 5DB6A 2PPHA 2LVOA 3HVZA 3DHIC 3C8YA 1JRPA 1WYWB 4XUSA 3N1YC 1KFSA 5AM0A 1RYJA 2HOIA 3UI3A 1IG6A 1UBIA 3OSPA 1QOGA 1TYGB 5KG6A 1SXTA 3QJZA 1F2RC 4EBCA 1F44A 3QUBA 3RB4A 4F4YA 3KKAC 4A3PA 2LVQA 1YZ6A 2YMMA 3P1MA 2BYFA 2NRXA 4HVBA 2KP7A 1E7VA 2INCC 4TMAB 3BS7A 3DBRB 1V8CA 5KFEA 3CP8A 5BO4B 2FDRA 2MBHA 3PZ7A 1B9RA 3FAHA 2WF7A 3BQ7A 3WU2U 5D3IB 5J0WA 1JQ4A 5D46A 4IQUA 5J2BA 2MCNB 4RGTA 3H4DA 2RSUA 5CHWA 1Q8KA 5J2DA 3RFZB 2MJ3A 3TMPB 2KDEB 4XE0A 1ZQPA 4BGDA 4MM3B
chains in the Genus database with same CATH topology
1Q10A 3Q8FA 4HRSA 1JWAD 4RGNA 2PVOD 4GDKB 1MHHE 1HEZE 3W1SA 4IKGA 3P4SB 1PFDA 2JXTA 1SEBD 4D2KA 3IAS1 1HQRD 2V4IB 2WU5B 1PGXA 4O1NA 2RDHA 2K9XA 1ZDXA 4A6QA 4JX1C 1I4RA 1P7FA 1TS5A 2V0GA 3E9SA 4UDUC 3KLSX 5HFYA 3NVYA 4YTMB 2FBWB 2BW2A 1SBBB 1KLGD 1NENB 3TEZA 3VR9B 1J7CA 1GPXA 2L32A 3ETRA 1J7AA 2DLBA 4LLGM 3TEXA 3AE1B 2KWDA 1STEA 4L2YA 4M0WA 4N59A 3ZGZA 4Q2JA 1C77A 3MJ5A 1EM7A 5LNK1 1KRHA 1OQRA 2ICIA 2HTME 4JWUC 2W3SA 1FEHA 3RPFC 2ZW0A 2IGGA 4YSZB 3HRDD 1FNWA 1TS3A 2R61A 1VJKA 2WXGA 1FCLA 1L0YB 1T6BX 2W3RA 1HXYD 4KKIA 2H88B 2Y5CA 1T3QA 5EE9A 4HKQA 1QOAA 1YMHE 2H89B 3BVZA 1SJED 1AN8A 3NVVA 2JU6X 1KF6B 5BYQA 1QF6A 2QJLA 4C7ZA 3AB5A 1QT9A 1ZE3D 1QKZA 4RF0A 1NI3A 5TSSA 1TKYA 3E56A 3O13A 4L1BA 3AH7A 2WU2B 1JWUD 5H8YE 3VRAB 4ZRQA 1EWYC 4HEA1 1PGBA 4WAFA 4DQOC 3BYTB 2BS3B 2N9LA 1VRAB 1JMLA 2WXMA 2YEPF 4C7YA 1KTKA 1UWXA 1LO5D 2X38A 5D3DA 1I7HA 2PLPA 3ZJTA 3P4QB 3U7ZA 2FUG1 1N5XA 3ZQ4A 2IPKD 3AECB 1IGDA 2EELA 2IDYA 2WXKA 2WXHA 1C79A 3AE9B 3V05A 2Y3AA 2QSDA 2GB1A 2XNAC 1CK1A 5I4DA 3AM9A 3NVWA 3AE4B 1TJEA 3VR8B 4CQNA 2JX5A 3FC4A 1MVKA 1C78A 2AX5A 4LK0M 1GAQB 3DWMA 2QMTA 1XO3A 2KDMA 1GB4A 2V3NA 3L4PA 3AEBB 1IBXA 1FIQA 1V1OA 2BBCA 1SSNA 1GB1A 1VZ7A 2LHEA 1OQQA 4JE3B 4N58A 5HHDG 4ZOHC 3PO0A 3SFEB 3T3OA 1YJIA 1V1PA 2WNMA 3R2IA 3ZYYX 5FK9C 2MJEA 4J3OD 3ZJUA 1SB3C 1YN3A 1VZ8A 1D5MC 2WP9B 2B76B 2K3UA 4TQ0A 2M0AA 1ET6A 1M4VA 1K50A 4L23A 1D5XC 1RM6C 3AE5B 4WH4A 1ZP0B 3CIRB 2K5PA 1WWTA 2WXOA 2XN9C 2LFIA 3ABVB 1D4BA 1D6EC 2INNE 5EE3A 1E6EB 4OZCA 1XEEA 4C56C 2BS2B 2LMCA 3WCQA 4H2AA 2WDQB 3AE2B 3MHZA 2NTTA 1ACCA 1B1ZA 1RFKA 1KH0A 2NTSA 4OZBA 2WXRA 4KGRA 4NAWB 2KQ4X 1YQ3B 1ROEA 3OWEB 2JYEA 3I57A 5C3JB 2SAKA 4B0EA 4TQ1A 1BMLC 2ZW1A 1TY2A 5BYSA 1SIJA 2WS3B 1F0ZA 1JROA 1L4ZB 2V3PA 4ITKA 1ZXHA 1N62A 2W54A 2N0SB 4RGMA 3BK1A 4MT5A 4YWGG 3P4RB 3MC0B 2MEKA 1N61A 2DBYA 3B2FA 3ZJVA 1A70A 4IDIA 2WXIA 1DOYA 1T5XD 1SF0A 1Y56A 3VRBB 1DOXA 5FR3A 4OVZA 1PUTA 3W9CB 2EKIA 1SE2A 1CJEA 1XLOA 3IXSA 1F77A 3FILA 3V3XA 3BWUD 1L0XB 3NZ3A 4B0MA 3IT4B 4KX6B 3B2GA 4YTPB 1IBXB 1J7BA 1GOZA 1NEKB 1D5ZC 3Q69A 1DOIA 1NYQA 2JZPA 3NRZA 4DXFA 2PTLA 1PGAA 2NMQA 2PW9A 1E9MA 3LXFA 3AE6B 3P4PB 4HKZE 1HA5A 5FKAC 4YSXB 2BS4B 4HROA 3HVDA 1V1PB 2I2YA 1WXQA 5JXVA 3AEGB 2RDGA 1E10A 1R7SA 4ZYSA 5BMGA 5GXGB 1FXAA 2CJOA 2L83A 3AEAB 1I4PA 3SEBA 2WXPA 2OHFA 2HDEA 4RH6A 3BK2A 1I4QA 2BT6A 3AN1A 1YJJA 3GS2A 4OW0A 4AS1A 1QILA 3B9JA 4C80A 3AMZA 1IUEA 2JSVX 1WYGA 1TZOA 1K52A 1ZUD2 2QEJC 2WXFA 3GP7A 4A9AA 5T8IA 2J4XA 1XF5L 4A8XC 4EE2A 2DYOA 3BYYB 1EWCA 5BYRA 4XWWA 1RWSA 3TEYA 3IAM1 1UUPA 1HZ5A 1TS4A 4MH8A 2CJNA 4N6EB 4ARCA 2YEPB 1E0ZA 4A90A 1K51A 5G5HA 4REZA 4MACA 4YT0B 2JWUA 1N5WA 2K0PA 2PVGC 2RPVA 1FD6A 3CWIA 4WWMA 3SR6A 3LB8C 2IGHA 2Y5PA 2I38A 1DGJA 2KAJA 2L52A 3U52E 3AE7B 4AQ7A 1TS2A 2DYMA 1UWMA 4XE0A 4KGSA 3LYYA 4P16A 2W82A 2VZKD 1ENFA 2PIAA 2WXLA 3MFGA 3W5VB 2SEBD 1FXIA 1FM0D 4GLSC 1JWMD 1I4GA 3Q8CA 2N7JA 1VDVA 3R2TA 3HUIA 1HZ6A 3GB1A 3FILB 1QOFA 2DWQA 3AV8A 2MH7A 1SE3A 4OZAA 2QIEB 1OFFA 2E6XA 1ESFA 2M56B 4ZRPA 2WDVB 4RCOA 2L1AA 1C4CA 3W2DA 4YTNB 1C9FA 4HJGE 1ZOYB 1VLBA 2Q5WD 2J52A 1XLQA 1AW7A 4WURA 3R8BA 3BIID 4KKJA 2KACA 1FCCC 1K53A 3U2SC 3NS1A 5AUKA 4KGTA 1N60A 2BYTA 4XDCA 1TKEA 4JWSC 4RGOS 2JYTA 1UNSA 3EA6A 2AQ1B 2W55A 1MHXA 4R3DA 1MPEA 1ET9A 1ZPSA 4WIPA 3BZDB 5AUIA 1L4DB 2N9KA 1FO4A 3KQ4A 5BMHA 3AE8B 2KN4A 1V97A 1P7EA 2G1EA 2OEDA 1L5PA 1WGKA 2LHDA 2ACZB 1XLNA 3T3NA 5D7GA 2TSSA 5E6JA 2PMVA 5H92C 3TSSA 2JQRB 1C4AA 1N63A 2FE8A 4PT5A 1PYWD 1YNTE 1JALA 1F2RI 3U4EG 2LEKA 4YXDB 4JPSA 1SE4A 1AYFA 5EE0A 3URYA 3KWLA 4XWTA 4ARIA 2Z8LA 4FXCA 2RMMA 1JWBD 1ZDVA 4DXGA 1FNVA 4IOIE 1XCTL 3DWGC 2LJIA 1EU4A 4NJCA 3TUOA 1TY0A 4NZLB 4WQMA 2WXJA 1DYQA 1NVID 2IGDA 3BVMA 4LTUA 4XDDA 2BTEA 1BUIC 3AE3B 2KMMA 2WXQA 2GI9A 5HI1A 3SFDB 2G9HD 3AEEB 3NUHB 1QQRA 2BB6A 2CU3A 4P6VF 1XCQL 1VR9A 2K22A 2LGIA 5G5GA 3AEDB 3P63A 3NVZA 1KLUD 4ZHOA 1VZ6A 4RF1A 1WSPA 3H8HA 1C4PA 1JWSD 1FFUA 1BXTA 4RFBA 2GRIA 3J9CA 3TEWA 3W5UB 3IT6B 1YN5A 2M19A 4USAA 1FRRA 1C76A 2ON8A 4YSYB 1CQVA 2VZKB 2AQ3B 1E7PB 1UGJA 1WRIA 1FMAD 1KFYB 2BB5A 1L6VA 5MPOA 3PZ8A 2IJ0A 1XXGA 4TSSA 1XLPA 2J42A 1PDXA 1JCKB 2D5GA 1NYRA 1FNUA 1EU3A 2WDRB 1ZXIA 5HG2A 1FFVA 5C2TB 2MJDA 2AQ2B 1I4XA 1JW9D 3Q8AA 5EE1A 1TKGA 3HVZA 4A55A 3C8YA 1JRPA 2WQYB 2E3TA 4RNAA 2INPE 2QILA 1FRDA 2WXNA 4US8A 1RYJA 2J53A 3BVGA 3UI3A 4GDLB 1QOGA 1TYGB 1SXTA 3N9YC 3KWVA 1F2RC 3EUB2 1MI0A 1QOBA 1SJHD 3VQIA 1QLBB 3P1MA 1YN4A 2ONQA 4OHJA 1CZPA 4TMAB 1V8CA 3P42A 1AWDA 3PZ7A 1L0VB 1B9RA 3FAHA 3AEFB 4ZHPA 5BMIA 1I4HA 1L6UA 5D3IB 4NAMA 2PKOA 1YQ4B 1JQ4A 2LUMA 3MP9A 2WLBA 4US9A 4RGTA 3Q8EA 1IGCA 3RFZB 2MJ3A 3EGRA 3I9V1 4MM3B 3Q8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXD B;  1XO3 A;  5GXG B;  4HRS A;  1FXA A;  1JWA D;  2CJO A;  2L83 A;  1AYF A;  3AEA B;  3AEB B;  3L4P A;  2PVO D;  5EE0 A;  3KWL A;  1FIQ A;  3P4S B;  4FXC A;  1JWB D;  2OHF A;  1PFD A;  2BT6 A;  3DWG C;  1OQQ A;  2WU5 B;  4N58 A;  3AN1 A;  4ZOH C;  1YJJ A;  3PO0 A;  3SFE B;  1YJI A;  2K9X A;  4WQM A;  4JX1 C;  3B9J A;  4C80 A;  3AMZ A;  1IUE A;  1NVI D;  4LTU A;  3ZYY X;  2MJE A;  3AE3 B;  1WYG A;  1ZUD 2;  2KMM A;  3NVY A;  1SB3 C;  4A9A A;  4YTM B;  2FBW B;  2WP9 B;  2B76 B;  1NEN B;  3VR9 B;  1J7C A;  3SFD B;  1GPX A;  3AEE B;  4P6V F;  2CU3 A;  3ETR A;  1J7A A;  1RM6 C;  1RWS A;  3AE5 B;  2K22 A;  1ZP0 B;  5G5G A;  3AED B;  3CIR B;  3P63 A;  2K5P A;  1WWT A;  3NVZ A;  1B9R A;  3ABV B;  4ZHO A;  3AE1 B;  2CJN A;  4N6E B;  5EE3 A;  1E0Z A;  1E6E B;  5G5H A;  1FFU A;  4N59 A;  4YT0 B;  2BS2 B;  2PVG C;  1N5W A;  3WCQ A;  2WDQ B;  3AE2 B;  1KRH A;  1OQR A;  3CWI A;  2HTM E;  4WWM A;  3SR6 A;  4JWU C;  2W3S A;  3RPF C;  3LB8 C;  1RFK A;  2L52 A;  1DGJ A;  3HRD D;  2KAJ A;  4YSZ B;  3AE7 B;  1YQ3 B;  1ROE A;  3W5U B;  1VJK A;  1UWM A;  5C3J B;  2M19 A;  2W3R A;  4USA A;  1FRR A;  2H88 B;  2PIA A;  2Y5C A;  3W5V B;  4YSY B;  1T3Q A;  1FXI A;  1SIJ A;  1FM0 D;  2WS3 B;  5EE9 A;  1F0Z A;  1QOA A;  1E7P B;  1JRO A;  1WRI A;  1FMA D;  1KFY B;  5MPO A;  1L6V A;  2H89 B;  4ITK A;  1VDV A;  1N62 A;  3HUI A;  2W54 A;  1XLP A;  2N0S B;  1QOF A;  1PDX A;  2DWQ A;  3NVV A;  1NYR A;  2MH7 A;  3AV8 A;  3P4R B;  2QIE B;  1N61 A;  1OFF A;  2DBY A;  1ZXI A;  2WDR B;  3B2F A;  1FFV A;  1KF6 B;  2M56 B;  2MJD A;  5C2T B;  2WDV B;  1QF6 A;  1A70 A;  4C7Z A;  2QJL A;  1QT9 A;  3AB5 A;  4YTN B;  1JW9 D;  4IDI A;  5EE1 A;  1TKG A;  1DOY A;  1ZOY B;  1VLB A;  1NI3 A;  1SF0 A;  1TKY A;  2Q5W D;  3HVZ A;  1XLQ A;  3AH7 A;  1JRP A;  2WU2 B;  3BII D;  3VRB B;  2WQY B;  1DOX A;  2E3T A;  5H8Y E;  3VRA B;  1EWY C;  1FRD A;  4US8 A;  3NS1 A;  1RYJ A;  5AUK A;  1PUT A;  2BS3 B;  3W9C B;  1QOG A;  1TYG B;  2EKI A;  3EUB 2;  4C7Y A;  1CJE A;  1XLO A;  1N60 A;  1QOB A;  1TKE A;  4JWS C;  1QLB B;  1I7H A;  3P1M A;  4KX6 B;  2W55 A;  3P4Q B;  3B2G A;  1N5X A;  4YTP B;  1J7B A;  1NEK B;  5AUI A;  3AEC B;  1CZP A;  1DOI A;  3AE9 B;  1FO4 A;  1NYQ A;  1V8C A;  3NRZ A;  1AWD A;  1L0V B;  3AE8 B;  3FAH A;  1V97 A;  1E9M A;  3AE6 B;  3AEF B;  2G1E A;  3LXF A;  3P4P B;  3AM9 A;  4YSX B;  4ZHP A;  3NVW A;  1L5P A;  1L6U A;  1WGK A;  2BS4 B;  3AE4 B;  2PKO A;  2ACZ B;  1YQ4 B;  1TJE A;  4HRO A;  3VR8 B;  1JQ4 A;  1XLN A;  2JX5 A;  3FC4 A;  1WXQ A;  3AEG B;  2WLB A;  4US9 A;  5H92 C;  2JQR B;  1N63 A;  1E10 A;  2AX5 A;  1R7S A;  2MJ3 A;  1GAQ B;  1JAL A;  3DWM A;  2LEK A; 
#chains in the Genus database with same CATH topology
 3QU7 A;  2O6V A;  2V3S A;  3Q8F A;  4HRS A;  3N7R C;  4TUQ A;  3NGD A;  3TFS A;  4BXO B;  1JWA D;  2KQ7 A;  2L3Z A;  2L8J A;  4RGN A;  4NL9 C;  4GDK B;  2C7N B;  8ICJ A;  4IKG A;  1QSY A;  4QZH A;  1ZQL A;  4IRK A;  3N97 B;  1SEB D;  4D2K A;  5E6N A;  4AYB F;  3ORY A;  4EZ9 A;  3H40 A;  2PFQ A;  2KEY A;  2V4I B;  4JL9 A;  3Q3J A;  1ZDX A;  3BJY A;  4FUL A;  1UA1 A;  1OEY J;  2ZJA A;  1WWU A;  2FLN A;  2FI1 A;  4UDU C;  1KOT A;  1VJ5 A;  3QU4 A;  3NVY A;  5KG5 A;  1ZQV A;  5EWE A;  1Z19 A;  4QZF A;  3BS5 A;  3BQ2 A;  2XY7 A;  1XSL A;  3VR9 B;  3Q6B A;  4C8O A;  3N20 C;  1DOQ A;  1RXW A;  3MGV A;  2GBN A;  4GN1 A;  4ASW C;  2DLB A;  1QLN A;  3EFU A;  5ALU A;  3RT3 B;  1B4F A;  2LUE A;  3C19 A;  3QUT A;  3IFW B;  1XT9 B;  1A77 A;  3SAH A;  3KYC D;  2RLT A;  1STE A;  2BDP A;  4L2Y A;  5F9L A;  2FE9 A;  3N7S C;  3MJ5 A;  1EXN A;  1L7O A;  4JWU C;  3ZKJ C;  4Z6D A;  3APD A;  2UVR A;  5DBC A;  2IGG A;  2WF6 A;  3IG5 A;  4I2D A;  1ZQI A;  3O65 B;  1FNW A;  3OSN A;  4LDT D;  1TS3 A;  1WXV A;  5JRT A;  4IS7 A;  5CX3 A;  1QSS A;  1L0Y B;  5AZH A;  2W3R A;  4ZRI A;  1HXY D;  2H88 B;  4C8K A;  1ZRM A;  4DF4 A;  5EE9 A;  5KFL A;  1YMH E;  1K5O A;  1NK5 A;  5BOM A;  4DL2 A;  2H89 B;  2NBW B;  3BVZ A;  3NRW A;  4I2H A;  3HWT A;  3UGB B;  5KFZ A;  2L76 A;  3NVV A;  1D8Y A;  4RZR A;  7ICI A;  4W9J A;  4II3 B;  3QEB Z;  1ZJM A;  3KYD D;  3M8S A;  2VJ4 A;  5BYQ A;  5LXI B;  3AB5 A;  1QT9 A;  1ZE3 D;  1QKZ A;  3WKB A;  4PZN A;  4DBG A;  1NZB A;  5LLI A;  4RF0 A;  3M8R A;  7ICM A;  4ED3 A;  1TKY A;  4L1B A;  4ZRJ A;  4FBJ B;  5IIL A;  1V86 A;  1WXS A;  2BQR A;  2I1J A;  2LI6 A;  3VRA B;  2KLC A;  1UA0 A;  5CR0 A;  3PX6 A;  4A8E A;  3T5K A;  2N9L A;  5KAI U;  1JML A;  2AJQ A;  2YEP F;  1MSW D;  4NY8 A;  1UWX A;  2ZJ8 A;  3SD5 A;  4GXK A;  9ICB A;  4IWP A;  3Q3O C;  1TZ1 A;  1PVP A;  3UIN B;  5KFG A;  3ZQ4 A;  3PSP A;  3TAP A;  4W9G A;  2WXK A;  5DCN A;  1KFD A;  2L0T A;  3GIK A;  3ZDD A;  2FCN A;  4J9N A;  2VKQ A;  2HE7 A;  1T0S C;  5J0Q A;  2BQU A;  1SZP A;  3BQ1 A;  3AE4 B;  3VR8 B;  4CQN A;  2JX5 A;  4F93 B;  3A0B U;  3FC4 A;  4KV2 A;  4IG7 B;  3DCG A;  3V6E B;  4B6W A;  4LK0 M;  2ZIW A;  4JLC A;  9ICK A;  4BOS C;  1KW4 A;  2KDM A;  3ML8 A;  2IO0 B;  3AEB B;  4EBE A;  1IBX A;  2IO1 B;  3F2C A;  1SSN A;  1TTN A;  9ICV A;  2HTH A;  1VZ7 A;  1RYU A;  2KSO A;  3PST A;  3QEA Z;  2LHE A;  2WAQ C;  2JV3 A;  4QZD A;  1E8X A;  4N58 A;  4ANU A;  3PO0 A;  4BZA A;  4C4V B;  1L6N A;  4QZA A;  1IYF A;  2N9P C;  2KMD A;  2MJE A;  4RQN A;  1SB3 C;  4DL7 A;  1A6S A;  3W1S C;  5HHI A;  3AXC A;  4UAZ A;  2IO2 B;  1LM8 B;  1BPB A;  1XO0 A;  4GSW A;  3L3F X;  3RBD A;  4IM0 A;  1D6E C;  1LFD A;  2DZJ A;  2MA1 A;  5EE3 A;  4NLB A;  3H9D A;  3NZS A;  4DSI A;  1XEE A;  2KTR B;  2LMC A;  1ZD3 A;  2WDQ B;  4M47 A;  2VIX A;  3AE2 B;  2OM6 A;  2AQ0 A;  5FR6 A;  3UPQ A;  5DKW A;  2NTT A;  3DHG C;  1CI4 A;  1RFK A;  1KH0 A;  4I2J A;  2NTS A;  4PL1 A;  4NAW B;  2J6T A;  4WWN A;  3OWE B;  3OHA A;  1TK0 A;  4B0E A;  4OVV A;  3TBL D;  3VTV A;  4TKN A;  1NK8 A;  5ALL A;  1F0Z A;  3AUO A;  2D2Q A;  3UQA A;  2YLM A;  1GC6 A;  1FPY A;  2RD0 A;  1MQ2 A;  4Y2T A;  4R8U B;  1L4Z B;  1YQB A;  3L17 A;  1RYR A;  4DHZ B;  4UAR A;  1BNO A;  1B43 A;  3C2M A;  4EEY A;  2ZCC A;  3AU2 A;  3H8S A;  1Q1O A;  1L3T A;  4NXZ A;  1N61 A;  3UMC A;  3VCB A;  1ZQO A;  2L05 A;  2ZVN A;  3ZJV A;  2F1I A;  3C2K A;  5AI6 A;  1F52 A;  4PH5 A;  1WR1 A;  2MWS B;  1SKS A;  1T5X D;  2K8H A;  4HDO A;  2KHW B;  3GIJ A;  4B9L A;  3JPO A;  5IN7 A;  2NPT B;  4OCZ A;  3RJI A;  4PGX A;  3B0A A;  4CHK A;  2LYA A;  4OVZ A;  4CYE A;  1PUT A;  1CEZ A;  3DOW A;  3DV9 A;  2W03 A;  2W9C A;  2BCS A;  1CJE A;  1F77 A;  5J2H A;  3V3X A;  4KLO A;  1L0X B;  3NZ3 A;  4B0M A;  1YX6 B;  3V6K A;  4KX6 B;  3T5J A;  1H8C A;  4RQ8 A;  4RT3 A;  3KD3 A;  3KHL A;  2NV3 A;  2MLB A;  3Q69 A;  5KT4 A;  4UAS A;  3ZTC A;  2ZG6 A;  2BDU A;  1RDF A;  3NRZ A;  4G11 A;  2PW9 A;  2JUO A;  3LXF A;  3P4P B;  3AE6 B;  3EWA A;  3HVD A;  1V1P B;  3ALB A;  1LQB A;  2K6Q A;  3AEG B;  1QQ6 A;  3JPQ A;  4P4P A;  2GBM A;  4J9S A;  2P66 A;  4B9T A;  3RJG A;  4AYB C;  1FXA A;  1OGW A;  3AEA B;  3PR5 B;  1ZQK A;  3JPT A;  2KIC A;  3Q8K A;  2HHS A;  2OHF A;  2AXT U;  1DRG A;  2VA8 A;  4YG2 A;  2KHQ A;  4PS3 A;  5KFF A;  2CS4 A;  4I2B A;  2IOH A;  5DGA A;  1BPY A;  2WB1 F;  1YJJ A;  4KIT B;  4C80 A;  3TAD A;  4ECZ A;  1K52 A;  4ANX A;  2KG5 A;  5T8I A;  2BYE A;  1NJW A;  1UGM A;  2BZF A;  3Q8R B;  4HCN B;  4NV0 A;  2DYO A;  9ICQ A;  3KUD B;  4ANW A;  4JUZ A;  3PW0 A;  3UQ0 A;  8ICO A;  1NK0 A;  1J19 A;  4ZRK A;  4FZM A;  1TS4 A;  2JHD A;  2JEI A;  4MH8 A;  2CJN A;  3VUY A;  2XVT A;  3OJS A;  1E0Z A;  4EX7 A;  4QZB A;  1LKY B;  1K51 A;  5G5H A;  3SI8 A;  1WZ0 A;  1PK1 A;  2FID A;  2KYW A;  2LWP A;  4REZ A;  1N5W A;  3A33 B;  4BKG A;  2M0X A;  2G07 A;  2W7O A;  1MA7 A;  2NRZ A;  3SR6 A;  3H0R B;  4JV2 A;  5T14 A;  4WWM A;  2ATL A;  4M2Y A;  3LB8 C;  2FCQ A;  1J0G A;  5ALQ A;  2I38 A;  1DGJ A;  2MSN A;  3AE7 B;  5D2M B;  2EH9 A;  4QIW F;  3K75 D;  1V5T A;  3SDL C;  4KLQ A;  3KHH A;  8ICM A;  5F9N A;  1ENF A;  4YCX A;  1FM0 D;  2O6V D;  3JSV B;  2W9A A;  1I4G A;  2G0A A;  2XY5 A;  5J0T A;  1Z2M A;  1KTQ A;  2EZZ A;  8ICF A;  4MHV A;  4RQ2 A;  3D2S A;  3FIL B;  3H0L B;  2LBO A;  2QIE B;  4QWC A;  4FAD A;  2M56 B;  4ZRP A;  1K1S A;  2BCR A;  3L10 B;  3UM9 A;  2HHV A;  1VLB A;  3DDH A;  2J0K A;  2FCS A;  2J52 A;  3EPI A;  4EKU A;  4KKJ A;  9ICJ A;  7ICL A;  1FCC C;  2GLE A;  4CNQ A;  3H7P B;  4W9K A;  2J6U A;  5AUK A;  4ED7 A;  3V6H A;  2DEN B;  5DDM A;  4Q8F A;  3I1Y A;  4Y2Q A;  4PGQ A;  4ZDV A;  2E8N A;  1WGH A;  2BYT A;  2NS5 A;  4EBD A;  4RGO S;  1UNS A;  4NNJ B;  5CP2 A;  2AQ1 B;  1ET9 A;  1ZPS A;  4HYK A;  1E8Z A;  4ECW A;  1P98 A;  4YMN A;  3M7D A;  2BCQ A;  3TQ1 A;  2MSE D;  4P0P B;  2NR2 A;  5BMH A;  4KDL B;  5J0U A;  1WJ6 A;  2PKE A;  4GIB A;  4Q44 A;  1HE8 A;  2OED A;  7ICT A;  4BKT A;  3RJJ A;  1F5S A;  1ZQD A;  2K8C B;  1ZQ1 C;  1XLN A;  3T3N A;  1COK A;  2KMC A;  5D7G A;  2TSS A;  2PMV A;  5H92 C;  2JQR B;  3B08 A;  1N63 A;  5DG7 A;  1ZD5 A;  3RNF C;  4M8M A;  1C1Y B;  4BKS D;  2IOF K;  4DL5 A;  2F8K A;  4JPS A;  4DO9 A;  1U48 A;  2HOF A;  5J8Y A;  8ICH A;  3EFC A;  3JPN A;  2UVW A;  3URY A;  5DPW A;  4ARI A;  4II2 B;  4NJ7 A;  4FXC A;  4Q45 A;  4EX6 A;  4TUS A;  4KN4 A;  1ZDV A;  2G08 A;  5AIA A;  9ICU A;  2KZR A;  3I3T B;  1TAU A;  5KFP A;  5HP4 A;  2HVI A;  2L5Y A;  2MHJ A;  3TUO A;  4NJ8 A;  1JXE A;  4NZL B;  2WXJ A;  1NVI D;  1ZQQ A;  8ICS A;  2IHN A;  3QHT A;  4LTU A;  2BTE A;  7ICS A;  1P0R A;  2GI9 A;  4MF2 A;  3A9J A;  4MM3 A;  3C21 A;  2DYB A;  3RH4 A;  4RUA A;  3EW9 A;  2DF4 B;  1QQR A;  1WXA A;  2BB6 A;  4BXO A;  1VR9 A;  2CU3 A;  2K22 A;  5G5G A;  2LGI A;  2LXC A;  2KC2 A;  8ICA A;  2EQY A;  2PE6 B;  3DBH I;  3NG0 A;  2LVP A;  3QX1 A;  1JIH A;  5L1L A;  4BUG A;  3PX0 A;  2ZXI A;  4KN7 A;  1X66 A;  4Y2R A;  4PJ0 U;  5ALE A;  2PJH A;  3IT6 B;  2YY6 A;  3MGI A;  2O6K A;  3CMM B;  3EEC A;  1JMS A;  2ON8 A;  2KIW A;  5HHH A;  3HK0 A;  2JF5 A;  4AP9 A;  3M9N B;  1MG8 A;  1C7Y A;  4KSK C;  4OD0 A;  3ZDT A;  1KFY B;  3G6V A;  1TIF A;  3CSF A;  2AYO B;  3Q8P B;  1ZKH A;  4GXJ A;  3HKZ F;  4NQK E;  1E8Y A;  2D5G A;  4B95 A;  2NBU A;  2DKX A;  1EU3 A;  3L08 A;  2G5I B;  2BCU A;  4ICA A;  1V6E A;  1L7Y A;  1NJY A;  4I2C A;  3TI0 A;  1TKG A;  4P2H A;  5C1Z A;  3SV4 A;  7ICV A;  4F2R A;  4A55 A;  4RNA A;  2QIL A;  1V38 A;  2Y9T A;  5KFT A;  1SL0 A;  2E8P A;  1FRD A;  2MUT B;  2WXN A;  4M00 A;  3UF8 A;  4QNL A;  2XEW A;  3BVG A;  2LGS A;  8ICK A;  5J2J A;  5DQH A;  4BX9 C;  2HBJ A;  5AKX A;  5KG3 A;  1JXL A;  1QOB A;  8ICN A;  2ALZ A;  1SJH D;  1L2N A;  3PV8 A;  3EPG A;  4F5O A;  3IDW A;  1KLV A;  3AQE A;  2FLL A;  1N2X A;  3NTU A;  2ES6 A;  3DBS A;  1AWD A;  3P42 A;  4YXJ A;  5HML A;  3Q8S B;  1S8O A;  5AM5 A;  1I4H A;  4N9F 4;  4G9B A;  4QWB A;  1YQ4 B;  4KIK B;  1Z1V A;  2GOL A;  3LJ3 A;  3H4B A;  1B22 A;  3QU9 A;  5ALP A;  3OLM D;  4JIO U;  1DK3 A;  3EGR A;  1E7U A;  3LDA A;  4LNN A;  4O5E A;  4P1C C;  2OJR A;  2LKY A;  4JMU A;  2HD5 B;  4FBU A;  2UVV A;  1HEZ E;  2Z0E B;  2W9B A;  3JPP A;  5A0L A;  4P7I A;  1L3V A;  2JXT A;  3PLU A;  2BWE S;  2KX3 A;  4UB3 A;  1KDH A;  3WAP A;  4O1N A;  1P7F A;  1TS5 A;  3KLS X;  5AM2 A;  5ALY A;  1Y8R C;  1SBB B;  2BW2 A;  3TEZ A;  1FEZ A;  5ALR A;  1RPL A;  9ICM A;  2ZNV B;  4GMV A;  4EOY A;  3TEX A;  5AKK A;  2RDB C;  2XID A;  5KNI A;  1L3S A;  5AZF A;  4M0W A;  4N59 A;  2HVH A;  2DQN B;  4J9R A;  2V4L A;  2YVC A;  4I6P A;  3M1Y A;  2QKQ A;  4XA5 A;  2AQ4 A;  2W3S A;  5DBB A;  3RPF C;  3HJE A;  2ZW0 A;  2GLS A;  1VJK A;  2KO3 A;  3RMK C;  3I76 A;  5ALZ A;  1DK2 A;  4JB3 A;  4C4T A;  4QWD A;  1T6B X;  4GGQ A;  4UAU A;  2PXI A;  2QDF A;  1WWV A;  4RQM A;  2P6R A;  3RRG A;  2GOW A;  3PML A;  2FPK A;  2CHZ A;  3Q3F A;  2D3D A;  1XQQ A;  1XNS A;  4IQT A;  3RJH A;  1ZQY A;  5E6P A;  3RRH A;  2KTR A;  4JV1 A;  2OJW A;  1RRB A;  4M0A A;  2RGF A;  3GIL A;  2JU6 X;  3ZRC A;  4M02 A;  2ZIX A;  4IRD A;  3L0W B;  2BWF A;  2QJL A;  4A20 A;  2JGA A;  2W8L A;  2KKC A;  1HUZ A;  3ZD9 A;  1T0R C;  1NI3 A;  4QW8 A;  4IQV A;  3HT3 A;  2GBJ A;  3E56 A;  2DGZ A;  4AWJ A;  4HLE A;  2WU2 B;  2JZB B;  2IHM A;  2CRX A;  4HEA 1;  5J2R A;  1O03 A;  1PGB A;  3GOE A;  2WHI A;  5ALM A;  3BYT B;  4NM2 A;  2A1J A;  4KLF A;  2HJ1 A;  1VRA B;  4W9C A;  3MC1 A;  5KTQ A;  4R8U A;  4HWI B;  3UIP B;  3FDS A;  4C7Y A;  4GB9 A;  3VUX A;  5AI9 A;  2CR5 A;  4ECU A;  1WXM A;  5D3D A;  4IC9 A;  3OJU A;  9ICH A;  1WJU A;  4IM2 A;  4DDI D;  2PLP A;  4LNK A;  3ZJT A;  3U7Z A;  4KSL C;  1O08 A;  2R8H A;  2WXH A;  4XYC A;  2Y9U A;  3V05 A;  5ALN A;  2XNA C;  4JWM A;  4J9Q A;  3AQF A;  4W9H A;  1JX4 A;  4BWJ A;  5L9X A;  2B21 A;  3M63 B;  3AM9 A;  5BOL A;  1SIF A;  3NVW A;  1VCB A;  4IQW A;  3H8M A;  4F7Z A;  3SEN A;  2FAZ A;  3PSE B;  4OO1 J;  3IV6 A;  1D9D A;  2H3Z A;  2Y0S F;  1L8O A;  2WX1 A;  5C0Y A;  3R66 C;  4ACF A;  3DWM A;  1DGS A;  1ZQB A;  2KNB A;  5J0Y A;  4DLE A;  1XO3 A;  2R8J A;  3DQV A;  1WF9 A;  1QZE A;  4P4M A;  1S0N A;  3V6C B;  3ZNG C;  3PRZ A;  2N1R A;  2BBC A;  3PHX B;  3RH5 A;  4EEL A;  1TT5 B;  4I29 A;  1GB1 A;  1WGG A;  3G6X A;  3KHR A;  2HMX A;  1HUO A;  1S1Q B;  2KJ6 A;  2C5L C;  5HHD G;  4ZOH C;  3T3O A;  5J29 A;  1BT0 A;  1YJI A;  1V1P A;  3KZX A;  3ZDA A;  2WNM A;  4HPL B;  5AKE A;  2C9W B;  4J3O D;  1V49 A;  3ZJU A;  3A1Q A;  3SQI A;  1VZ8 A;  1D5M C;  4BWM A;  2ESE A;  4DS4 A;  4JWN A;  1UT5 A;  4IWO A;  4WH4 A;  2DAF A;  4W9I A;  3N3K B;  4U6P A;  4F4Z A;  3EYZ A;  4NWI A;  3ABV B;  4Y2X A;  4I2A A;  3RZF A;  2INN E;  4B9N A;  4UAW A;  1WM2 A;  1V2Y A;  1F9J A;  4Q43 A;  2IA6 A;  5CRX A;  5DG8 A;  2MA9 B;  2LRW A;  4HK2 A;  2ZTC A;  9ICN A;  4OZB A;  1ZRN A;  2ZJD A;  2KQ4 X;  4W9E A;  4UBC A;  3I57 A;  2LZ6 A;  2IMW P;  2GBR A;  2HBL A;  4LDT B;  3THV A;  3HKZ C;  5BYS A;  1J2M A;  1SIJ A;  4KZC A;  1HTQ A;  3N7P D;  2QB0 B;  4J6I A;  2XCP A;  2JEJ A;  1X9X A;  1ZQR A;  2V3P A;  4NLC A;  4IUM B;  1ZXH A;  2BQ3 A;  1LKY A;  3V60 A;  2W54 A;  3A9K B;  2JEG A;  4K7U A;  1TAM A;  4ECS A;  3MC0 B;  3DEE A;  4YWG G;  2R2Q A;  4Z6E A;  3D2N A;  4KLU A;  3JPS A;  1IPG A;  2ZPN A;  3RJE A;  2BCV A;  3TJP A;  4FJZ A;  4O5C A;  5J0P A;  4K1R B;  3M6Z A;  2N1W A;  5IA7 A;  1SF0 A;  4KLT A;  3MGH A;  2ZIU B;  1E8W A;  2QCZ A;  1WG8 A;  3HM6 X;  3JSV A;  4ZYN A;  2MBO A;  4DL3 A;  2EKI A;  8ICU A;  2BGW A;  1SE2 A;  2K8B A;  4R64 A;  1NKB A;  3IXS A;  1KBU A;  1PZN A;  2MRP A;  2IY0 B;  3FIL A;  1C20 A;  3JVZ X;  4M9N A;  1PUZ A;  2ZIV A;  5KFB A;  2WTF A;  2V4R A;  2DPJ A;  1R4M I;  2IZV B;  4YTP B;  2Q0Z X;  4A3O A;  4PS7 A;  4DF8 A;  3QU5 A;  1D3Z A;  4DHJ D;  1IM4 A;  4YR2 A;  5EWF A;  1NYQ A;  4DXF A;  1EO6 A;  1PGA A;  4K7S A;  4YSX B;  5FKA C;  1ZQS A;  4EYH B;  3K9O B;  5ALO A;  7ICR A;  4F71 A;  2I2Y A;  1WXQ A;  3GV5 B;  3ICX A;  1OTR B;  4S0R A;  1Z3E B;  2KJ5 A;  4DOA A;  4XC2 A;  2KJR A;  3RJF A;  1RQL A;  1PK3 A;  3DDC B;  4UW9 A;  3DVN V;  4WJ3 B;  2R18 A;  2L83 A;  3PLV A;  1S0V A;  5KFY A;  1I4P A;  1YJ1 A;  5DQI A;  3PW2 A;  4RNO A;  1BPZ A;  3WK4 A;  9ICS A;  4RH6 A;  4J9K A;  4P0P A;  2K4P A;  3RCZ A;  4O3S A;  2XK5 A;  2VRR B;  3Q8L A;  2KN7 A;  2LXA A;  2AGQ A;  8ICE A;  2KFJ A;  4HDQ A;  4LNI A;  2IBI B;  3T79 A;  2WF8 A;  5JHA A;  4KMU A;  3PZD A;  3QC8 B;  3PSI A;  2HSZ A;  1TZO A;  4RNN A;  3GP7 A;  3GII A;  4KLS A;  2J4X A;  3MTN B;  1ARO P;  4O3Q A;  3RAX A;  9ICX A;  2JPH A;  2YTU A;  2KFK B;  3WKC A;  3L16 A;  3RUL A;  4TUP A;  2H5X A;  1EWC A;  1RXV A;  3HIL A;  1ZQT A;  1RWS A;  4MGI E;  1IIP A;  3TEY A;  4OJ6 A;  2PI5 A;  3IAM 1;  2KOB A;  1R4N I;  2CN1 A;  5KFV A;  5DGB A;  1V80 A;  4O3P A;  3QUC A;  5KT5 A;  4MAC A;  4YT0 B;  1ZQA A;  2JWU A;  1A76 A;  2K0P A;  3MAB A;  3LDZ E;  1NKE A;  4IW0 A;  5E6O A;  1FD6 A;  2F1J A;  1T3N A;  1QTM A;  3H7I A;  4CF5 A;  3HW8 A;  1SXE A;  1XU4 A;  2KAJ A;  3U52 E;  5AK4 A;  1TS2 A;  2DYM A;  4BOZ B;  4FE3 A;  2EAP A;  5HMM A;  5C5J A;  1UWM A;  4KGS A;  3LYY A;  5AKL A;  4WWO A;  2J0J A;  4MFA A;  3DBH B;  2YML A;  2M0N A;  3QQ8 B;  5G55 A;  3SD7 A;  1FXI A;  4FZN A;  2C7H A;  3PVL A;  3MR6 A;  4YXM A;  3DPD A;  5LXH A;  2YQE A;  3MR5 A;  5DPT A;  2H3I A;  3Q8C A;  3H7S A;  2N7J A;  1J8C A;  5B5E U;  8ICL A;  1CRX A;  1YD8 U;  3HUI A;  2WWZ A;  3AV8 A;  2MH7 A;  1SE3 A;  3IG3 A;  1RLF A;  5KFK A;  2LYB A;  4CE6 A;  4HJK A;  2WDV B;  2C60 A;  4CGZ A;  3D32 A;  2F2A B;  3B0Y A;  2FPM A;  2KJ8 A;  3WK8 A;  2N7D A;  4WUR A;  1AW7 A;  2KAC A;  1K53 A;  3NS1 A;  3Q8M A;  1S77 D;  2KMA A;  3EC8 A;  3H8J A;  5J0O A;  1WR6 E;  1ECW A;  2UWQ A;  1L3U A;  3DBL I;  4W9L A;  3E2E A;  2HHU A;  4JK1 A;  5J2K A;  4KGT A;  3M9M B;  1U49 A;  1N60 A;  3DVG Y;  2NRW A;  4UB1 A;  4XDC A;  2Y1I A;  3VFK A;  1TKE A;  2A5U A;  1WIA A;  2KJ9 A;  1MHX A;  3OPX A;  2ZXH A;  2L7R A;  4WIP A;  1VD2 A;  4F2S A;  1L4D B;  5KT6 A;  4NQL B;  5AI8 A;  3KQ4 A;  2NRV A;  3AE8 B;  5AM1 A;  2KN4 A;  1V97 A;  1ISN A;  3VVW B;  2C2R A;  3A4R A;  4F8C B;  2M9N A;  1WGK A;  4GC7 A;  2MBB B;  2Z7J A;  5KL8 B;  2DFL A;  2XY6 A;  5ALH A;  5E6J A;  4RQ6 A;  1WGY A;  4FJV B;  4AP4 C;  3U4E G;  1LGR A;  4Z6C A;  3PW4 A;  1ZW7 A;  4YXD B;  2BVC A;  2D6F C;  3PS6 A;  4RM8 A;  3PZP A;  2W9M A;  1MJD A;  4ANV A;  3VXW A;  1AYF A;  4XWT A;  1SXD A;  5AKG A;  2Z8L A;  2RMM A;  4ZH4 A;  2UVU A;  2CHW A;  1X9S A;  4EZJ A;  1FNV A;  4IOI E;  1XCT L;  2FMS A;  2KZM A;  2L0F A;  1ZYQ A;  2JY6 A;  2D8C A;  7ICG A;  5J2A A;  2VAN A;  1TK8 A;  2F77 X;  4MGZ E;  4WQM A;  4KIK A;  4XDD A;  1DYQ A;  4P4O A;  4M9H A;  2IGD A;  4BAX A;  1ED1 A;  1BUI C;  3QK0 A;  2KMM A;  4RT2 A;  4O0I A;  3S2A A;  4KX3 A;  3AEE B;  2AGP A;  4DQP A;  3AED B;  4MDK E;  2WX0 A;  2VH2 A;  3KFU F;  1KJT A;  1VZ6 A;  5KFI A;  2KDB A;  3H8H A;  5D6J B;  2KKP A;  2G3Q B;  3TAD C;  3OGU A;  2ZCB A;  1QSL A;  5GMV A;  1P9D U;  1RZT A;  3UXN A;  8ICC A;  1KFT A;  5JUM A;  3ISD A;  1GUA B;  5HR6 A;  2JZ3 B;  5J2C A;  3J9C A;  3TEW A;  3IHP C;  2E1F A;  3W5U B;  4ECT A;  3QYP A;  4F4W A;  4UQG A;  2M19 A;  2BGF A;  2PEA A;  4YQW A;  3OTQ A;  2V4Q A;  2CKH B;  3RNA C;  4DQQ A;  1UGJ A;  3M62 B;  4F50 A;  2ISO A;  3RBE A;  2O6V B;  4F72 A;  3TAC B;  2G4S A;  3RNG C;  2IJ0 A;  2J7Q B;  3C5F A;  4DQS A;  2J42 A;  1I35 A;  4MEY A;  1PDX A;  1RAX A;  2M1M A;  1NYR A;  3TAN A;  4M6W A;  1X42 A;  1FNU A;  4OJP A;  1UPH A;  2EAN A;  8ICW A;  2WDR B;  3H1U A;  5HG2 A;  2MJD A;  2AQ2 B;  2K89 A;  3QAR A;  2DNF A;  3ZTD A;  4FJY A;  2XIC A;  4E71 A;  1WCN A;  3ZI4 A;  8ICI A;  1XC9 A;  3HHM A;  4KDI C;  4TQR A;  4RU9 A;  2E3T A;  3A4S C;  2INP E;  5IIJ A;  4DSL A;  1KM7 A;  3N9Y C;  3KWV A;  4IM3 A;  2DZK A;  5AKZ A;  3WA0 A;  4DL6 A;  2HBM A;  1D8L A;  4O3M A;  3VQI A;  4Y2V A;  3ECI A;  2W7P A;  5FP0 A;  1QLB B;  2I1K A;  2IYD B;  2R8G A;  2WHE A;  5CHG A;  4Y2S A;  1YN4 A;  3VDZ A;  3VUW A;  5KFS A;  3KOO A;  1KL9 A;  3B0X A;  1LXD A;  4DFM A;  4B6J A;  4I2F A;  2OCE A;  2C28 A;  1L0V B;  1UD7 A;  5KFR A;  4ZHP A;  5IIN A;  5BMI A;  4GFJ A;  2PKO A;  4F5P A;  3MP9 A;  1EF1 A;  3PO5 A;  1S5L U;  2WLB A;  5DPR A;  4XRH A;  3VH3 B;  2JVC A;  3PRP B;  1IGC A;  4PGY A;  4YP3 A;  3LYS A;  2KOX A;  3I9V 1;  3Q8B A;  3GV8 B;  5KHQ A;  4AUQ C;  2IND C;  3PHW B;  2PVO D;  3UQ2 A;  1MHH E;  2K6D B;  3P4S B;  2MAX A;  4BBN F;  4MFC A;  1PFD A;  2JRZ A;  1AAR A;  4FHJ A;  3C23 A;  1WJ4 A;  4YFK A;  3DVN U;  1HQR D;  2I1Q A;  5DB7 A;  1JN3 A;  3C2L A;  1WMH B;  2RR9 A;  2IY1 B;  4WJO A;  2RDH A;  2K60 A;  4A6Q A;  4JX1 C;  1I4R A;  3RN9 C;  2V0G A;  5J8Y C;  5HFY A;  1SL1 A;  5IIO A;  1NBF C;  2AGO A;  2FBW B;  2CPR A;  2P6U A;  4J03 A;  2DPI A;  1GPX A;  1D8B A;  5TIS U;  3PV1 A;  3X23 A;  1S3S G;  4EUT A;  1GNU A;  3A0H U;  3KUC B;  5JHB A;  3MR3 A;  2BF8 B;  3OG5 A;  2E5S A;  3CRX A;  2JXX A;  2G06 A;  4Q2J A;  9ICP A;  5LNK 1;  1OQR A;  2I6X A;  3BZC A;  2B6G A;  2YB4 A;  2RDI A;  2A4Z A;  5ALS A;  1Z1B A;  2JZZ A;  4YSZ B;  3HRD D;  1RG6 A;  2R61 A;  4G50 A;  2H3Q A;  2C2D A;  3F5A A;  2B3A A;  4OJO A;  3SHQ A;  1QCK A;  5DQG A;  1UZX B;  2Y5C A;  3N32 A;  2QAR B;  1TFR A;  3RB0 A;  1K8R B;  2GBK A;  1QOA A;  5D4B A;  5TZV A;  3B1L X;  2ZIW B;  3TAR A;  3OAW A;  2JT4 B;  1SJE D;  4FHK A;  2M4N A;  4GDK A;  1AN8 A;  5IOI A;  2NVU I;  2QLT A;  2KIV A;  1WY8 A;  2ZJ5 A;  4CF4 A;  2MRL A;  2FMQ A;  2EMS A;  1QF6 A;  1OXJ A;  2BQQ A;  2HOQ A;  5J0R A;  4M8N A;  2NCN A;  3T5H A;  3O13 A;  3CYM A;  5KFW A;  1JWU D;  4DK5 A;  3C5G A;  5ALT A;  4WJP A;  1EWY C;  4ZRQ A;  3IBE A;  5KFQ A;  2JEF A;  4OJL A;  2KAN A;  3QWZ B;  1M6Y A;  3QU2 A;  3EZ5 A;  1LO5 D;  3A9K A;  2KVZ A;  1C3T A;  3JYU A;  1I7H A;  1QQ7 A;  4RUC A;  2CU1 A;  2FUG 1;  5CA7 A;  2IPK D;  2QC8 A;  3VH4 B;  4DSK A;  2KNJ A;  2EEL A;  2G4D B;  4I6L B;  4NY0 A;  4DXA B;  5KFO A;  7ICK A;  2BKR B;  2QSD A;  1AQ6 A;  2QHO A;  1CK1 A;  1ZQH A;  1N56 A;  1Q0W B;  2ZIU A;  3T9L A;  1U47 A;  4MEM A;  4KTQ A;  3T8M A;  4QAY A;  1MVK A;  4KLH A;  2AX5 A;  2RRD A;  2ASJ A;  5CJ7 A;  3F2D A;  1S9F A;  2QMT A;  3KW5 B;  4EEN A;  5IO9 A;  3SAF A;  1GB4 A;  4RQ1 A;  3LWL A;  1FIQ A;  4GOC A;  3HP6 A;  4LJX A;  1V1O A;  2UU7 A;  3GFK B;  2BPC A;  2MBE A;  2KVC A;  4F5Q A;  3E0F A;  3WKE A;  5C23 A;  1OQQ A;  3PPA A;  4UAV A;  2E8M A;  4IR9 A;  5AKY A;  2A19 A;  4MFF A;  1ZQU A;  2ASD A;  3PT2 B;  2LD9 A;  2V1Y A;  4IR1 A;  5J0X A;  1YN3 A;  4F3O A;  3Q2A C;  4QZG A;  2YB1 A;  5AZG A;  2B76 B;  3RH6 A;  2K3U A;  3H0M B;  1ZOL A;  2M0A A;  1ET6 A;  1F1H A;  3ISC A;  1K50 A;  5KG4 A;  1RM6 C;  3AE5 B;  4MJS B;  2IBK A;  4I2G A;  1ZP0 B;  2K5P A;  2WXO A;  2MP2 B;  4DL4 A;  2LFI A;  1S0O A;  2XN9 C;  3HM3 A;  1KN5 A;  4HPM B;  1E6E B;  2V9H A;  2RQ5 A;  4OZC A;  2WB1 C;  4C56 C;  1XD3 B;  3WCQ A;  4YMO A;  1H38 A;  3BIN A;  3MHZ A;  4ED6 A;  3QE9 Y;  3N30 A;  3K4G A;  1B1Z A;  4KGR A;  1YQ3 B;  1R4N B;  2D3A A;  2JYE A;  8ICT A;  2KTF A;  3WAM A;  2SAK A;  7ICP A;  2KFK A;  4GIV A;  3ZNZ B;  4P0Q B;  1BML C;  1X40 A;  5J2G A;  2WS3 B;  3RFA A;  3ZD8 A;  2WYQ A;  1JRO A;  3E58 A;  3FM9 A;  3MBY A;  1G6J A;  5KFX A;  4ITK A;  1X9W A;  4KLD A;  3L54 A;  4GC6 A;  2G09 A;  1WH3 A;  3W1Y A;  3MHS D;  1HTO A;  4KLJ A;  2B0C A;  3G6Y A;  3NJT A;  3P4R B;  4MT5 A;  2MEK A;  3B2F A;  2L00 B;  4QIW C;  2AL3 A;  1XWL A;  1Z00 B;  2WXI A;  4MGK E;  4I28 A;  4C4V A;  3PY8 A;  5DDY A;  1UH6 A;  3PGE A;  1NI2 A;  3FKY A;  3VRB B;  1DOX A;  3QXG A;  1T8E A;  4B9S A;  3GZN I;  3W9C B;  3NY5 A;  5KT2 A;  4ED1 A;  1X9M A;  1XLO A;  3TFR A;  5JH5 C;  4I6N B;  3O0F A;  4EYI B;  3IT4 B;  2W43 A;  3GZF A;  5KG7 A;  2D11 A;  4ELT A;  3WAL A;  1J7B A;  1DOI A;  4DEZ A;  3SZ2 A;  4C8N A;  2WGS A;  2JZP A;  2D3G A;  3DBL B;  2PTL A;  2NMQ A;  4HKZ E;  4KLI A;  2FNJ B;  4NAW A;  4EEW A;  1SKR A;  2BS4 B;  4HRO A;  4IRC A;  5KFC A;  4EFO A;  4DWI A;  1ZGU B;  3U8Z A;  4M9J A;  1Q46 A;  2K4E A;  1R7S A;  4BBN C;  3C0R B;  5KFM A;  4I2E A;  5BMG A;  1WFY A;  5GXG B;  2KE7 A;  3VHT C;  3NAS A;  4BJQ A;  1ZQM A;  3QZ7 A;  4DQI A;  8ICG A;  2KJH B;  1SV4 A;  3SEB A;  4FZL A;  2Z59 B;  3BK2 A;  4G0N B;  5J0S A;  1JUD A;  1I4Q A;  4BFR A;  2QB1 A;  4IL6 U;  3ZXV A;  9ICA A;  3AN1 A;  1KQQ A;  3RZW C;  3RNE C;  4RPX A;  2ISP A;  4AS1 A;  2KZZ A;  4F5R A;  3B9J A;  1IUE A;  3AMZ A;  3C1Z A;  4FFD A;  2NPT A;  4R63 A;  1ZUD 2;  2QEJ C;  2WXF A;  3AU4 A;  1NJX A;  8ICY A;  3V61 A;  1SV0 A;  4YD1 A;  5AK6 A;  1XF5 L;  2DZM A;  3EHV A;  2EDU A;  5ALW A;  4J9O A;  4TV3 A;  3ZXR A;  2F3N A;  2EZX A;  1P1A A;  2NRT A;  4F91 B;  1KKX A;  5ALX A;  4DOC A;  3NOB A;  3QA8 A;  3GDX A;  1UCV A;  4UB6 U;  4ARC A;  4QJF B;  2YEP B;  4RQ3 A;  3RAQ A;  2XGQ A;  3UMB A;  3RB6 A;  2PVG C;  2RPV A;  1YIW A;  2KVR A;  3GQC A;  4ED8 A;  3U30 A;  1X6I A;  1IXR A;  4FBT A;  3AU5 A;  2AL6 A;  2IGH A;  4F92 B;  5HNK A;  4M9G A;  1TKD A;  2KC1 A;  4MEL A;  2W8K A;  1KSP A;  4OJ5 A;  1MG4 A;  2AH5 A;  2OXO A;  2BR0 A;  5KFN A;  2R8K A;  2PIA A;  2VZK D;  2WXL A;  2SEB D;  3W5V B;  3C29 A;  4ECX A;  1NKC A;  4FLH A;  4XZ4 A;  3WAN A;  4PS8 A;  4DFK A;  2D3B A;  1S0M A;  1JWM D;  2JR5 A;  5EDS A;  2XI9 A;  2YN4 A;  4F5N A;  4J9L A;  3RB3 A;  4I27 A;  1HZ6 A;  1QOF A;  4NLZ A;  2AU0 A;  2E6X A;  1ZQE A;  2HI0 A;  4AJW A;  3PW7 A;  3QX7 A;  4M04 A;  4RCO A;  3CST A;  3QUQ A;  3W2D A;  5DLG A;  5EOZ A;  2OYY A;  2H3V A;  9ICT A;  3KKA A;  1C9F A;  3I28 A;  3LWM A;  1X1M A;  4NM1 A;  2KWV B;  5AI4 A;  2Q5W D;  1P3Q U;  1XLQ A;  3MR2 A;  3BII D;  3F5E A;  4YR0 A;  3RNB C;  5D49 A;  1X2I A;  3SV3 A;  2JWZ A;  3U2S C;  1Q3V A;  2G45 B;  4NLK A;  3KH0 A;  4GXI A;  4WQO B;  1KLN A;  3A9J B;  4CDG A;  4K4G A;  3I5J C;  4KZ0 A;  4NLN A;  1WX8 A;  5GTI U;  3RR8 A;  2OOB B;  5EWG A;  2JYT A;  4YL8 A;  3NS8 A;  5DG9 A;  2W55 A;  4QZI A;  3BDP A;  4K81 A;  1MPE A;  2ZTD A;  2XCA A;  2K4I A;  1E5W A;  1OW5 A;  3UXO A;  4ECR A;  3BZD B;  4C4S A;  1OEY A;  5AUI A;  4DFP A;  8ICV A;  2JRI B;  1NK6 A;  5CHF A;  2MX2 A;  1XS9 D;  3AEV A;  1CMX B;  4DHJ B;  1P7E A;  2G1E A;  9ICC A;  2KDF B;  4NL9 A;  3V7L A;  2J6S A;  2LHD A;  3R7R A;  2LYH A;  2E8O A;  2GH1 A;  2BPG A;  1J2N A;  3GU3 A;  4RQ0 A;  1PYW D;  1JAL A;  3T3F A;  1PQS A;  3H8W A;  3GIM A;  5KFA A;  1YZ7 A;  1SE4 A;  3F53 A;  5AEK B;  5DLF A;  2EKE C;  5EE0 A;  2FPL A;  9ICF A;  2KTQ A;  3SEI A;  4J9M A;  1WZ3 A;  2F76 X;  2GWS A;  5D94 A;  3DWG C;  3ONN A;  2N9X A;  4URK A;  2LJI A;  1QQ5 A;  1YOV B;  3KUZ A;  1EU4 A;  2D3C A;  3MC9 A;  4GU2 A;  4NJC A;  4YVZ A;  3N1Z C;  7ICU A;  1WX9 A;  3BVM A;  1QH9 A;  1ZJN A;  4JGH B;  2O2V B;  4EZL A;  1SKW A;  3APC A;  3IG8 A;  3H7P A;  1TK5 A;  3N28 A;  2NO5 A;  4O3N A;  2G9H D;  4P6V F;  2LI5 A;  2ZUC A;  3IVF A;  2EAO A;  3SYZ A;  3P63 A;  4BKS A;  2V9W A;  4RQ4 A;  9ICI A;  2D07 B;  1WSP A;  4DWF A;  1C4P A;  3ZUN A;  4PYZ A;  3GE3 C;  1JWS D;  4KVG B;  1NK4 A;  1BXT A;  2E1E A;  4LZD A;  2M8S A;  4ECV A;  1WMH A;  4NPN A;  1MN8 A;  2PI4 A;  3ZDB A;  3DHH C;  2HJ8 A;  3FYH A;  4RM9 A;  2K8C A;  3Q3N C;  3PRM B;  7ICO A;  4ICV A;  1H4R A;  1XO1 A;  5AHX A;  4Y2P A;  1C76 A;  1SWV A;  3K1R B;  4I2I A;  4YSY B;  1CQV A;  4FS2 A;  3AU6 A;  1E7P B;  2JRH A;  1WRI A;  4AJY B;  4QZ9 A;  2HBK A;  1FMA D;  5MPO A;  1L6V A;  2LM4 A;  2HW3 A;  1XXG A;  4TSS A;  4FO6 A;  1JRU A;  1ZQJ A;  1JCK B;  1RQN A;  1S76 D;  1L8L A;  2W9B B;  3C1Y A;  1UQV A;  1L5U A;  7ICE A;  7ICJ A;  2YX8 A;  1FFV A;  3NZU A;  1TAQ A;  2ZTE A;  1WUD A;  2DAJ A;  4WJQ A;  2I5H A;  1I4X A;  2EZY A;  2PFP A;  9ICO A;  1JW9 D;  3RNC C;  5EE1 A;  3K1Z A;  2HHW A;  1L7N A;  2M17 A;  3PR4 A;  2WQY B;  2K4H A;  2QAR A;  2WFA A;  4PL2 A;  4US8 A;  5J2E A;  3QNM A;  2J53 A;  4X57 B;  4GDL B;  2VH1 A;  1X6J A;  3EUB 2;  2LAS A;  1MI0 A;  4Y2J A;  2FCM A;  4F1S A;  3SU8 X;  9ICE A;  1U4A A;  4DDG D;  2G5H B;  2KFN A;  3BQ0 A;  3MDA A;  1SGG A;  1Z4N A;  1ZQW A;  2ONQ A;  4OHJ A;  3N1X C;  4K3C A;  5KG1 A;  4M0W B;  5IKC M;  2DL0 A;  5AM4 A;  2DZI A;  1CZP A;  2KN5 A;  1KRP A;  3JW0 X;  1P7D A;  3SMV A;  3KBB A;  3ZDC A;  3OJ4 B;  3AEF B;  4LZG A;  1L6U A;  2P35 A;  2AEH A;  3M95 A;  4NAM A;  3GE8 C;  2LUM A;  1BNP A;  4US9 A;  5KAF U;  3PO4 A;  4BVU C;  3Q8E A;  2BPS A;  5KFH A;  1WRD B;  1T94 A;  2C2E A;  2ODG A;  1Q10 A;  4O3R A;  5III A;  3R7Q A;  2OEH A;  1I42 A;  3W1S A;  1LV5 A;  5ALV A;  4ACO A;  5JTI A;  3IAS 1;  2ZIX B;  3UMG A;  4PHP A;  1V85 A;  4K4H A;  2KQS A;  2WU5 B;  1UF0 A;  1PGX A;  4DSF A;  1IV8 A;  2Y0S C;  5DBA A;  2K9X A;  4LNO A;  5DPS A;  1U45 A;  3MFH A;  3MFI A;  4DQR A;  5KG0 A;  2LGY A;  2PE9 A;  3E9S A;  3CF6 E;  4YTM B;  1TBE A;  2MUT A;  1KLG D;  1L7P A;  1NEN B;  8ICR A;  4PHD A;  3KHG A;  1J7C A;  1ZQC A;  4C8M A;  4GXB A;  2L32 A;  2A1J B;  2MU2 A;  3ETR A;  1J7A A;  4LLG M;  2JH1 A;  5L1I A;  2I9G A;  4QZ8 A;  2N1V A;  3VC8 A;  9ICW A;  4MSQ B;  4EEK A;  3AE1 B;  2FMP A;  4Q8E A;  4CRX A;  2NO4 A;  2OWO A;  2KWD A;  2Z0D B;  2MW5 A;  5L83 A;  5J17 A;  5AI5 A;  3ZGZ A;  3HPO A;  3ZDE A;  1C77 A;  3IHQ B;  4F4K A;  1J97 A;  1EM7 A;  1KRH A;  2ICI A;  2HTM E;  4W9F A;  1FEH A;  1T4G A;  2UYZ B;  4RNM A;  2LGX A;  5KFU A;  4E74 A;  2WXG A;  2YMP A;  1GJZ A;  1FCL A;  4KX5 A;  1V5O A;  4KKI A;  2R8I A;  1ZD4 A;  3U7D A;  1ZD2 P;  2K8A A;  3NHE B;  1T3Q A;  7ICF A;  2REX A;  4KLE A;  4MJS A;  4HKQ A;  2N4F A;  5DB9 A;  2MP2 A;  3TCA A;  1Z4O A;  3M9O B;  5K4L A;  3QZ8 A;  4K4I A;  3RI7 C;  4MH0 E;  3ED5 A;  1B0X A;  3CW2 C;  1KF6 B;  3RR7 A;  2KFZ A;  4HXD A;  1U9L A;  3ZRF A;  1SL2 A;  4C7Z A;  3D2Q A;  2ZNV C;  4O3O A;  2J0M A;  4MEX A;  1S10 A;  1MQ3 A;  2DX5 B;  5TSS A;  4X5V A;  1SZH A;  4TUR A;  3AH7 A;  9ICG A;  5KT3 A;  7ICN A;  2Y5B B;  5H8Y E;  4P0Q A;  4C8L A;  3A1Q B;  1WM3 A;  4WAF A;  4DQO C;  4MGY E;  3DBR I;  3HIZ A;  5F3X B;  2BS3 B;  2PMZ F;  1WCL A;  2C7M B;  2CHX A;  2WXM A;  3ZIM A;  4Y2U A;  1PVR A;  1MFW A;  1KTK A;  2IOF A;  2ZPY A;  2X38 A;  3WIM A;  3UXP A;  3WK7 A;  4QZE A;  4UAT A;  3P4Q B;  1N5X A;  4QZC A;  2KVS A;  5KT7 A;  2WF9 A;  3LVW A;  1IGD A;  3AEC B;  2IDY A;  1C79 A;  5KG2 A;  4TQS A;  4O5K A;  2Y3A A;  3AE9 B;  1Z00 A;  3GZN B;  7ICH A;  3APF A;  1XSP A;  2GB1 A;  3DVG X;  3BY4 B;  3L13 A;  2KX0 A;  5I4D A;  2H3F A;  1RFA A;  2CXY A;  1TJE A;  4E0D A;  4HPP A;  2JH7 A;  5AKH A;  1C78 A;  3TIX A;  1M94 A;  3PX4 A;  3BS5 B;  2NYV A;  2OH2 A;  1GAQ B;  1WI0 A;  4ECQ A;  3QIJ A;  2DUY A;  3VAW A;  5CWR A;  1JI7 A;  4DS5 A;  4JV0 A;  2V3N A;  3L4P A;  2KWU B;  2WDT B;  2K25 A;  4NLG A;  3C28 A;  1T0Y A;  4KMO B;  2Y1J A;  4ECY A;  2C22 A;  9ICL A;  4K3B A;  3M3J A;  4J9P A;  1NOM A;  8ICZ A;  3RD2 A;  4JE3 B;  4R66 A;  3MDC A;  3SFE B;  1BGX T;  1BPE A;  3R2I A;  3KZI U;  4M01 A;  2HHT A;  4UAY A;  3WAO A;  3ZYY X;  5FK9 C;  4CO7 A;  4UB8 U;  4YN4 A;  2JZB A;  4LJP B;  5KL1 B;  2KT7 A;  2WP9 B;  2ZVO A;  3L5K A;  4TQ0 A;  3PNC A;  4B9U A;  3CNH A;  2KD0 A;  1M4V A;  4L23 A;  1D5X C;  3BZK A;  1SE9 A;  2KK0 A;  2K8B B;  2Q4T A;  3WK6 A;  2GO7 A;  1S97 A;  1WWT A;  3CIR B;  1V9J A;  1D4B A;  1URJ A;  4EZ6 A;  3MJW A;  2ZIV B;  1A5R A;  8ICX A;  4PK1 A;  1HJP A;  4AOF A;  2BS2 B;  2X8X X;  5JU5 A;  4H2A A;  2HHQ A;  1SGH A;  3VTU A;  3RYT A;  5L1K A;  2BKE A;  1UHU A;  5AKJ A;  2XGP A;  1ACC A;  4M9L A;  5J2I A;  3PTF C;  2WXR A;  1ROE A;  5ALF A;  2ZZP B;  3Q3M C;  2AHO B;  3D6J A;  3KVF B;  3ZLZ A;  5C3J B;  2R2O A;  4WJN A;  5L1J A;  3TKA A;  1Z5S B;  4TQ1 A;  2ZW1 A;  1TY2 A;  9ICR A;  1KEJ A;  1D9F A;  2RP5 A;  2KD1 A;  4U7C A;  2BHN A;  1N62 A;  2N0S B;  5GTH U;  2XBB C;  1TGZ B;  4RGM A;  3BK1 A;  2KDI A;  2BKF A;  2DBY A;  1NDD A;  4LNF A;  2XK5 B;  1A70 A;  5AIB A;  5AKI A;  2VA3 A;  4IDI A;  2BPF A;  3WKD A;  1DOY A;  5HKH A;  1Y56 A;  1TE2 A;  1SWW A;  4UB2 A;  2KWC A;  1WGR A;  3AUL A;  4B9M A;  1IP9 A;  5FR3 A;  4LCD E;  4KLG A;  4B9V A;  4ED2 A;  5ALG A;  4PHA A;  4G3X B;  1K1Q A;  2LM1 A;  5IIK A;  1YX5 B;  3F2B A;  5J18 A;  4MSM B;  5KFD A;  3BWU D;  5JZE B;  2FLP A;  1EF5 A;  2K1F A;  3IRU A;  3B2G A;  4FN2 A;  1IBX B;  2IO3 B;  1GOZ A;  1NEK B;  1D5Z C;  5ALI A;  2XO7 A;  4C4R A;  3WK5 A;  2KSO B;  3ML9 A;  3ONS A;  3M6K A;  1E9M A;  4GLX A;  1HA5 A;  1MC8 A;  5KHO A;  4CF3 A;  2FUH B;  5JXV A;  2A1A A;  4PYU A;  5CEH A;  4RQ5 A;  4KLM A;  2RDG A;  1E10 A;  3SAG A;  1LB2 B;  4DOB A;  2QB0 A;  4KLL A;  3RTV A;  4ZYS A;  3V72 A;  2NBV B;  3I63 C;  3LVV A;  5H2F U;  2CJO A;  2LJ5 A;  3OHB A;  2KZ3 A;  5ALD A;  8ICB A;  3ZO5 B;  4ED0 A;  1Q5W B;  2WXP A;  2HDE A;  2KK8 A;  5CTR C;  2DHZ A;  4XQ8 A;  3TAQ A;  2BT6 A;  5ALK A;  5L1M A;  3Q8Q B;  2BYV E;  3RUI B;  4Z6F A;  2K39 A;  3GS2 A;  4OW0 A;  4RMA A;  1QIL A;  3PRE A;  5IAA C;  2JSV X;  1WYG A;  2A3V A;  4A9A A;  1NNL A;  1R4M B;  4E3C A;  1N48 A;  4ELV A;  2KXJ A;  2FJ6 A;  3IM1 A;  3RF9 A;  4A8X C;  2EMT A;  4EE2 A;  4UBB A;  2D10 A;  5E79 U;  3BYY B;  1ZET A;  5BYR A;  4XWW A;  1ZQZ A;  3ZNI D;  1N6Z A;  4ELU A;  3WK9 A;  4IC7 B;  1UUP A;  1HZ5 A;  4K7W A;  5AI0 A;  1HEK A;  4N6E B;  3PW5 A;  1GO3 F;  2ASL A;  4A90 A;  1EUV B;  3BQT A;  1TV9 A;  1GC7 A;  4W9D A;  3T5L A;  2ASQ A;  3HX0 A;  3CWI A;  3AI5 A;  1WE6 A;  5L95 C;  4OVU A;  4YMM A;  3JPR A;  2Y5P A;  2L52 A;  4FS1 A;  3V6J A;  1NK7 A;  2O2V A;  3OJ3 A;  3ZNH B;  4AQ7 A;  1UT8 A;  4P16 A;  3PVX A;  2W82 A;  1HIW A;  3MFG A;  4NJ6 A;  2RPQ A;  3NUQ A;  1V9P A;  1ZQX A;  4GLS C;  1CUK A;  4YD2 A;  5HR7 A;  5CHV C;  3TL5 A;  1GG3 A;  3IN5 A;  4RPZ A;  2W9C B;  2LRU A;  1OQY A;  1VDV A;  4QW9 A;  3R2T A;  3GB1 A;  2VA2 A;  2ZUB A;  2DWQ A;  4OZA A;  4XGA B;  5J2F A;  1ZQF A;  1OFF A;  3AL0 B;  1WE7 A;  2PFN A;  1ESF A;  2LGD A;  3K9P B;  2RDJ A;  1C4C A;  2L1A A;  4YTN B;  1FXT B;  2HCF A;  4HJG E;  1ZOY B;  2PMZ C;  1T0Q C;  3ZW3 A;  3N4M B;  2KLG A;  4PHE A;  3ENE A;  3R8B A;  4QWA A;  7ICQ A;  2F44 A;  1U4B A;  3X0W A;  5TR5 A;  2JMG A;  4FA6 A;  2F8L A;  5AK3 A;  4HCP B;  4JWS C;  2YMQ A;  3S6J A;  3EA6 A;  4DSJ A;  4R3D A;  2ZUD A;  4PZO A;  1UBQ A;  1ZQG A;  1RYS A;  5BPC A;  5CB1 A;  2N9E B;  4S17 A;  2N9K A;  2DKZ A;  4DHZ E;  3PSF A;  1FO4 A;  3RJK A;  2W04 A;  1NK9 A;  1TVA A;  3QCA A;  1L5P A;  2LPE A;  2PFO A;  1E90 A;  4DSE A;  2ACZ B;  3ZDM C;  5AK5 A;  4ICU A;  4GDL A;  1ZQN A;  3TSS A;  4WAA A;  1C4A A;  2FE8 A;  4F4X A;  4P1B C;  3J81 j;  4PT5 A;  1YNT E;  1F2R I;  3V7K A;  1NJZ A;  2WF5 A;  2LEK A;  2EAM A;  5KFJ A;  1A0P A;  2F1H A;  4UB4 A;  1V81 A;  3KWL A;  4TUU A;  3GV7 B;  1WGD A;  1JWB D;  4DXG A;  4M6W B;  4BDP A;  4C00 A;  3U26 A;  5IIM A;  4R65 A;  1PK1 B;  4RPY A;  8ICP A;  1F0M A;  2KKV A;  4LVS A;  2N7E A;  5AM3 A;  2LMR A;  1TY0 A;  4DFJ A;  1Q3U A;  4HAI A;  4F8R A;  3Q14 C;  4LJO B;  2RHF A;  3AE3 B;  2WXQ A;  1DXS A;  2WAQ F;  1L7M A;  1UEL A;  2W11 A;  5HI1 A;  4O9M A;  4C0Z A;  3SFD B;  1XSN A;  3ISB A;  2LHT A;  1Y88 A;  3NUH B;  5ALJ A;  1XCQ L;  5AIC A;  3QAQ A;  3UQB A;  3NVZ A;  1KLU D;  4ZHO A;  4RF1 A;  3VTW A;  4WWP A;  2KHV A;  1COO A;  3ZVV A;  1WJN A;  2VJ5 A;  3PMN A;  1FFU A;  3H6N A;  4DLG A;  4YR3 A;  4RFB A;  1SV0 C;  4PPX A;  2HDO A;  2FIF A;  2KV2 A;  1YT3 A;  4CCH A;  4XX5 A;  1NZP A;  4G3I A;  4QWE A;  2GRI A;  5IP4 D;  4DCC A;  4DFD A;  4B9K A;  3MC8 A;  3IP4 B;  1YN5 A;  1LVH A;  4MF8 A;  4USA A;  4Y2Y A;  4UB5 A;  1FRR A;  3V7J A;  1WX7 A;  2GMI C;  1OUQ A;  2JXJ A;  4EZK A;  5DB8 A;  1T7P A;  1BPD A;  2VZK B;  1BVS A;  2AQ3 B;  3R9K A;  4IWQ A;  2MBQ A;  2BB5 A;  4JQW C;  3PZ8 A;  3ALR A;  4RQ7 A;  2AWT A;  3LK9 A;  5B66 U;  1XLP A;  3P2B A;  3ETL A;  3UIO B;  1PVQ A;  1ZXI A;  1BPX A;  2HHX A;  5C2T B;  2MQJ A;  3V62 A;  2W9N A;  8ICQ A;  3R3M A;  5G2N A;  2ZEQ A;  2XC9 A;  3Q8A A;  3WKA A;  3KTQ A;  5DB6 A;  2PPH A;  2LVO A;  3HVZ A;  3DHI C;  3C8Y A;  1JRP A;  1WYW B;  4XUS A;  3N1Y C;  1KFS A;  5AM0 A;  1RYJ A;  2HOI A;  3UI3 A;  1IG6 A;  1UBI A;  3OSP A;  1QOG A;  1TYG B;  5KG6 A;  1SXT A;  3QJZ A;  1F2R C;  4EBC A;  1F44 A;  3QUB A;  3RB4 A;  4F4Y A;  3KKA C;  4A3P A;  2LVQ A;  1YZ6 A;  2YMM A;  3P1M A;  2BYF A;  2NRX A;  4HVB A;  2KP7 A;  1E7V A;  2INC C;  4TMA B;  3BS7 A;  3DBR B;  1V8C A;  5KFE A;  3CP8 A;  5BO4 B;  2FDR A;  2MBH A;  3PZ7 A;  1B9R A;  3FAH A;  2WF7 A;  3BQ7 A;  3WU2 U;  5D3I B;  5J0W A;  1JQ4 A;  5D46 A;  4IQU A;  5J2B A;  2MCN B;  4RGT A;  3H4D A;  2RSU A;  5CHW A;  1Q8K A;  5J2D A;  3RFZ B;  2MJ3 A;  3TMP B;  2KDE B;  4XE0 A;  1ZQP A;  4BGD A;  4MM3 B; 
#chains in the Genus database with same CATH homology
 1Q10 A;  3Q8F A;  4HRS A;  1JWA D;  4RGN A;  2PVO D;  4GDK B;  1MHH E;  1HEZ E;  3W1S A;  4IKG A;  3P4S B;  1PFD A;  2JXT A;  1SEB D;  4D2K A;  3IAS 1;  1HQR D;  2V4I B;  2WU5 B;  1PGX A;  4O1N A;  2RDH A;  2K9X A;  1ZDX A;  4A6Q A;  4JX1 C;  1I4R A;  1P7F A;  1TS5 A;  2V0G A;  3E9S A;  4UDU C;  3KLS X;  5HFY A;  3NVY A;  4YTM B;  2FBW B;  2BW2 A;  1SBB B;  1KLG D;  1NEN B;  3TEZ A;  3VR9 B;  1J7C A;  1GPX A;  2L32 A;  3ETR A;  1J7A A;  2DLB A;  4LLG M;  3TEX A;  3AE1 B;  2KWD A;  1STE A;  4L2Y A;  4M0W A;  4N59 A;  3ZGZ A;  4Q2J A;  1C77 A;  3MJ5 A;  1EM7 A;  5LNK 1;  1KRH A;  1OQR A;  2ICI A;  2HTM E;  4JWU C;  2W3S A;  1FEH A;  3RPF C;  2ZW0 A;  2IGG A;  4YSZ B;  3HRD D;  1FNW A;  1TS3 A;  2R61 A;  1VJK A;  2WXG A;  1FCL A;  1L0Y B;  1T6B X;  2W3R A;  1HXY D;  4KKI A;  2H88 B;  2Y5C A;  1T3Q A;  5EE9 A;  4HKQ A;  1QOA A;  1YMH E;  2H89 B;  3BVZ A;  1SJE D;  1AN8 A;  3NVV A;  2JU6 X;  1KF6 B;  5BYQ A;  1QF6 A;  2QJL A;  4C7Z A;  3AB5 A;  1QT9 A;  1ZE3 D;  1QKZ A;  4RF0 A;  1NI3 A;  5TSS A;  1TKY A;  3E56 A;  3O13 A;  4L1B A;  3AH7 A;  2WU2 B;  1JWU D;  5H8Y E;  3VRA B;  4ZRQ A;  1EWY C;  4HEA 1;  1PGB A;  4WAF A;  4DQO C;  3BYT B;  2BS3 B;  2N9L A;  1VRA B;  1JML A;  2WXM A;  2YEP F;  4C7Y A;  1KTK A;  1UWX A;  1LO5 D;  2X38 A;  5D3D A;  1I7H A;  2PLP A;  3ZJT A;  3P4Q B;  3U7Z A;  2FUG 1;  1N5X A;  3ZQ4 A;  2IPK D;  3AEC B;  1IGD A;  2EEL A;  2IDY A;  2WXK A;  2WXH A;  1C79 A;  3AE9 B;  3V05 A;  2Y3A A;  2QSD A;  2GB1 A;  2XNA C;  1CK1 A;  5I4D A;  3AM9 A;  3NVW A;  3AE4 B;  1TJE A;  3VR8 B;  4CQN A;  2JX5 A;  3FC4 A;  1MVK A;  1C78 A;  2AX5 A;  4LK0 M;  1GAQ B;  3DWM A;  2QMT A;  1XO3 A;  2KDM A;  1GB4 A;  2V3N A;  3L4P A;  3AEB B;  1IBX A;  1FIQ A;  1V1O A;  2BBC A;  1SSN A;  1GB1 A;  1VZ7 A;  2LHE A;  1OQQ A;  4JE3 B;  4N58 A;  5HHD G;  4ZOH C;  3PO0 A;  3SFE B;  3T3O A;  1YJI A;  1V1P A;  2WNM A;  3R2I A;  3ZYY X;  5FK9 C;  2MJE A;  4J3O D;  3ZJU A;  1SB3 C;  1YN3 A;  1VZ8 A;  1D5M C;  2WP9 B;  2B76 B;  2K3U A;  4TQ0 A;  2M0A A;  1ET6 A;  1M4V A;  1K50 A;  4L23 A;  1D5X C;  1RM6 C;  3AE5 B;  4WH4 A;  1ZP0 B;  3CIR B;  2K5P A;  1WWT A;  2WXO A;  2XN9 C;  2LFI A;  3ABV B;  1D4B A;  1D6E C;  2INN E;  5EE3 A;  1E6E B;  4OZC A;  1XEE A;  4C56 C;  2BS2 B;  2LMC A;  3WCQ A;  4H2A A;  2WDQ B;  3AE2 B;  3MHZ A;  2NTT A;  1ACC A;  1B1Z A;  1RFK A;  1KH0 A;  2NTS A;  4OZB A;  2WXR A;  4KGR A;  4NAW B;  2KQ4 X;  1YQ3 B;  1ROE A;  3OWE B;  2JYE A;  3I57 A;  5C3J B;  2SAK A;  4B0E A;  4TQ1 A;  1BML C;  2ZW1 A;  1TY2 A;  5BYS A;  1SIJ A;  2WS3 B;  1F0Z A;  1JRO A;  1L4Z B;  2V3P A;  4ITK A;  1ZXH A;  1N62 A;  2W54 A;  2N0S B;  4RGM A;  3BK1 A;  4MT5 A;  4YWG G;  3P4R B;  3MC0 B;  2MEK A;  1N61 A;  2DBY A;  3B2F A;  3ZJV A;  1A70 A;  4IDI A;  2WXI A;  1DOY A;  1T5X D;  1SF0 A;  1Y56 A;  3VRB B;  1DOX A;  5FR3 A;  4OVZ A;  1PUT A;  3W9C B;  2EKI A;  1SE2 A;  1CJE A;  1XLO A;  3IXS A;  1F77 A;  3FIL A;  3V3X A;  3BWU D;  1L0X B;  3NZ3 A;  4B0M A;  3IT4 B;  4KX6 B;  3B2G A;  4YTP B;  1IBX B;  1J7B A;  1GOZ A;  1NEK B;  1D5Z C;  3Q69 A;  1DOI A;  1NYQ A;  2JZP A;  3NRZ A;  4DXF A;  2PTL A;  1PGA A;  2NMQ A;  2PW9 A;  1E9M A;  3LXF A;  3AE6 B;  3P4P B;  4HKZ E;  1HA5 A;  5FKA C;  4YSX B;  2BS4 B;  4HRO A;  3HVD A;  1V1P B;  2I2Y A;  1WXQ A;  5JXV A;  3AEG B;  2RDG A;  1E10 A;  1R7S A;  4ZYS A;  5BMG A;  5GXG B;  1FXA A;  2CJO A;  2L83 A;  3AEA B;  1I4P A;  3SEB A;  2WXP A;  2OHF A;  2HDE A;  4RH6 A;  3BK2 A;  1I4Q A;  2BT6 A;  3AN1 A;  1YJJ A;  3GS2 A;  4OW0 A;  4AS1 A;  1QIL A;  3B9J A;  4C80 A;  3AMZ A;  1IUE A;  2JSV X;  1WYG A;  1TZO A;  1K52 A;  1ZUD 2;  2QEJ C;  2WXF A;  3GP7 A;  4A9A A;  5T8I A;  2J4X A;  1XF5 L;  4A8X C;  4EE2 A;  2DYO A;  3BYY B;  1EWC A;  5BYR A;  4XWW A;  1RWS A;  3TEY A;  3IAM 1;  1UUP A;  1HZ5 A;  1TS4 A;  4MH8 A;  2CJN A;  4N6E B;  4ARC A;  2YEP B;  1E0Z A;  4A90 A;  1K51 A;  5G5H A;  4REZ A;  4MAC A;  4YT0 B;  2JWU A;  1N5W A;  2K0P A;  2PVG C;  2RPV A;  1FD6 A;  3CWI A;  4WWM A;  3SR6 A;  3LB8 C;  2IGH A;  2Y5P A;  2I38 A;  1DGJ A;  2KAJ A;  2L52 A;  3U52 E;  3AE7 B;  4AQ7 A;  1TS2 A;  2DYM A;  1UWM A;  4XE0 A;  4KGS A;  3LYY A;  4P16 A;  2W82 A;  2VZK D;  1ENF A;  2PIA A;  2WXL A;  3MFG A;  3W5V B;  2SEB D;  1FXI A;  1FM0 D;  4GLS C;  1JWM D;  1I4G A;  3Q8C A;  2N7J A;  1VDV A;  3R2T A;  3HUI A;  1HZ6 A;  3GB1 A;  3FIL B;  1QOF A;  2DWQ A;  3AV8 A;  2MH7 A;  1SE3 A;  4OZA A;  2QIE B;  1OFF A;  2E6X A;  1ESF A;  2M56 B;  4ZRP A;  2WDV B;  4RCO A;  2L1A A;  1C4C A;  3W2D A;  4YTN B;  1C9F A;  4HJG E;  1ZOY B;  1VLB A;  2Q5W D;  2J52 A;  1XLQ A;  1AW7 A;  4WUR A;  3R8B A;  3BII D;  4KKJ A;  2KAC A;  1FCC C;  1K53 A;  3U2S C;  3NS1 A;  5AUK A;  4KGT A;  1N60 A;  2BYT A;  4XDC A;  1TKE A;  4JWS C;  4RGO S;  2JYT A;  1UNS A;  3EA6 A;  2AQ1 B;  2W55 A;  1MHX A;  4R3D A;  1MPE A;  1ET9 A;  1ZPS A;  4WIP A;  3BZD B;  5AUI A;  1L4D B;  2N9K A;  1FO4 A;  3KQ4 A;  5BMH A;  3AE8 B;  2KN4 A;  1V97 A;  1P7E A;  2G1E A;  2OED A;  1L5P A;  1WGK A;  2LHD A;  2ACZ B;  1XLN A;  3T3N A;  5D7G A;  2TSS A;  5E6J A;  2PMV A;  5H92 C;  3TSS A;  2JQR B;  1C4A A;  1N63 A;  2FE8 A;  4PT5 A;  1PYW D;  1YNT E;  1JAL A;  1F2R I;  3U4E G;  2LEK A;  4YXD B;  4JPS A;  1SE4 A;  1AYF A;  5EE0 A;  3URY A;  3KWL A;  4XWT A;  4ARI A;  2Z8L A;  4FXC A;  2RMM A;  1JWB D;  1ZDV A;  4DXG A;  1FNV A;  4IOI E;  1XCT L;  3DWG C;  2LJI A;  1EU4 A;  4NJC A;  3TUO A;  1TY0 A;  4NZL B;  4WQM A;  2WXJ A;  1DYQ A;  1NVI D;  2IGD A;  3BVM A;  4LTU A;  4XDD A;  2BTE A;  1BUI C;  3AE3 B;  2KMM A;  2WXQ A;  2GI9 A;  5HI1 A;  3SFD B;  2G9H D;  3AEE B;  3NUH B;  1QQR A;  2BB6 A;  2CU3 A;  4P6V F;  1XCQ L;  1VR9 A;  2K22 A;  2LGI A;  5G5G A;  3AED B;  3P63 A;  3NVZ A;  1KLU D;  4ZHO A;  1VZ6 A;  4RF1 A;  1WSP A;  3H8H A;  1C4P A;  1JWS D;  1FFU A;  1BXT A;  4RFB A;  2GRI A;  3J9C A;  3TEW A;  3W5U B;  3IT6 B;  1YN5 A;  2M19 A;  4USA A;  1FRR A;  1C76 A;  2ON8 A;  4YSY B;  1CQV A;  2VZK B;  2AQ3 B;  1E7P B;  1UGJ A;  1WRI A;  1FMA D;  1KFY B;  2BB5 A;  1L6V A;  5MPO A;  3PZ8 A;  2IJ0 A;  1XXG A;  4TSS A;  1XLP A;  2J42 A;  1PDX A;  1JCK B;  2D5G A;  1NYR A;  1FNU A;  1EU3 A;  2WDR B;  1ZXI A;  5HG2 A;  1FFV A;  5C2T B;  2MJD A;  2AQ2 B;  1I4X A;  1JW9 D;  3Q8A A;  5EE1 A;  1TKG A;  3HVZ A;  4A55 A;  3C8Y A;  1JRP A;  2WQY B;  2E3T A;  4RNA A;  2INP E;  2QIL A;  1FRD A;  2WXN A;  4US8 A;  1RYJ A;  2J53 A;  3BVG A;  3UI3 A;  4GDL B;  1QOG A;  1TYG B;  1SXT A;  3N9Y C;  3KWV A;  1F2R C;  3EUB 2;  1MI0 A;  1QOB A;  1SJH D;  3VQI A;  1QLB B;  3P1M A;  1YN4 A;  2ONQ A;  4OHJ A;  1CZP A;  4TMA B;  1V8C A;  3P42 A;  1AWD A;  3PZ7 A;  1L0V B;  1B9R A;  3FAH A;  3AEF B;  4ZHP A;  5BMI A;  1I4H A;  1L6U A;  5D3I B;  4NAM A;  2PKO A;  1YQ4 B;  1JQ4 A;  2LUM A;  3MP9 A;  2WLB A;  4US9 A;  4RGT A;  3Q8E A;  1IGC A;  3RFZ B;  2MJ3 A;  3EGR A;  3I9V 1;  4MM3 B;  3Q8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...