5G5GA

Escherichia coli periplasmic aldehyde oxidase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
175
Chain Sequence
PAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PUTATIVE XANTHINE DEHYDROGENASE YAGT IRON-SULFUR-BINDING SUB
publication title The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
pubmed doi rcsb
source organism Escherichia coli
total genus 49
structure length 175
sequence length 175
ec nomenclature ec 1.2.99.6: Carboxylate reductase.
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 5g5gA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5g5gA01
3HUIA 3W5UB 2WDQB 2WLBA 4LTUA 3RPFC 1ZXIA 2B76B 1JWAD 3AEEB 4WWMA 1N63A 1SIJA 2HTME 2K9XA 2MJEA 4JWSC 5AUKA 1JRPA 2W3SA 2W54A 1V97A 1JWBD 3LB8C 3P63A 2QIEB 3P4PB 4FXCA 5EE9A 1PDXA 2H89B 3LXFA 5EE0A 5C2TB 2QJLA 1N5XA 1FFVA 1JALA 2ACZB 2M19A 1N62A 1E9MA 2MJDA 4ZHOA 3ABVB 3NS1A 3EUB2 3VRBB 2H88B 3P4SB 1XLNA 1FRRA 3AEDB 1V8CA 3AH7A 3NVZA 3B2FA 3SFDB 3VRAB 1DGJA 4YTNB 1YQ4B 2Q5WD 3NVWA 3KWLA 1NVID 4KX6B 1NENB 5C3JB 1CJEA 3ZYYX 1ZUD2 3P4RB 3P4QB 3AE8B 3SR6A 2KMMA 1TJEA 5H92C 1WGKA 1VJKA 3SFEB 1E0ZA 1FMAD 2WP9B 1XLOA 1NEKB 3WCQA 1KFYB 1AWDA 5AUIA 1QOBA 1WYGA 2KAJA 1YJJA 4C7YA 1L6UA 3HVZA 1AYFA 1R7SA 1SF0A 3ETRA 3FAHA 2CJNA 1F0ZA 2E3TA 1QLBB 1TKGA 3VR8B 1FM0D 1T3QA 2DWQA 3B2GA 3P1MA 1WRIA 5EE3A 1JW9D 3AEAB 4JX1C 3NVYA 2FBWB 1TKEA 2MJ3A 3PO0A 2M56B 2LEKA 3AB5A 2PVOD 1QOGA 5G5HA 2WS3B 1YJIA 1J7BA 2W55A 1DOIA 1VLBA 1FXIA 1DOXA 1NYRA 2JX5A 3AE5B 3AE6B 4YSZB 4US9A 1QOAA 1L6VA 3AECB 3AE3B 5G5GA 3AN1A 2OHFA 3AE1B 4YSXB 1N61A 1VDVA 1OFFA 3AE9B 5EE1A 3CWIA 3AE2B 3VR9B 3AE7B 2K5PA 1TYGB 4N58A 3BIID 3L4PA 3AM9A 1KF6B 1TKYA 2PIAA 1RFKA 2BS3B 2JQRB 3AEGB 2PKOA 4ZOHC 1FRDA 1UWMA 4P6VF 4YSYB 4HRSA 3B9JA 1FXAA 4C7ZA 1J7AA 1GAQB 2BS2B 2BT6A 2K22A 3W5VB 1ROEA 1QOFA 2WDVB 3W9CB 1WXQA 2G1EA 4YTPB 2BS4B 1QF6A 1SB3C 1XO3A 1OQRA 2CJOA 2WU2B 1JROA 3AMZA 4USAA 1FO4A 1WWTA 1QT9A 1XLQA 2WDRB 3DWMA 3AEBB 1OQQA 2PVGC 4ZHPA 1B9RA 3HRDD 1A70A 1KRHA 1NI3A 3AV8A 2CU3A 4US8A 1I7HA 4N59A 1E10A 4ITKA 4WQMA 3AE4B 3NVVA 1ZP0B 1ZOYB 4A9AA 1RM6C 1L5PA 1J7CA 5GXGB 1CZPA 5MPOA 4JWUC 4IDIA 1PFDA 2WQYB 3AEFB 1GPXA 1FIQA 2W3RA 1EWYC 2L83A 3FC4A 2AX5A 2EKIA 1PUTA 2DBYA 1E7PB 4N6EB 1N60A 1YQ3B 1DOYA 1L0VB 4YT0B 4YXDB 3DWGC 1FFUA 1N5WA 3CIRB 1XLPA 1E6EB 4HROA 4C80A 1JQ4A 1IUEA 4YTMB 3NRZA 2N0SB 5H8YE 1RWSA 2MH7A 1RYJA 2WU5B 2Y5CA 2L52A 1NYQA
chains in the Genus database with same CATH superfamily
4C8OA 2XY7A 3ZW3A 4JWSC 3NZUA 4UASA 2JZBB 2K8BB 2AH5A 4IRKA 2ASLA 7ICMA 2W3SA 3DVNV 4LK0M 5AUKA 1Q3VA 2MP2B 1MSWD 3WKAA 3D6JA 3Q8RB 1A76A 4LZGA 4O1NA 5J0OA 1SJED 5KHOA 2ZW1A 4QZFA 5ALNA 3Q3OC 2R8GA 3RNEC 2Y0SC 5E6NA 4BKSA 2JXXA 2KHQA 3C0RB 2JEJA 4HK2A 1ZQZA 4R3DA 2LI6A 3TSSA 4KDIC 4JWMA 5DBAA 1NJYA 3V6HA 2AJQA 5CHGA 1EM7A 4J9NA 5BYQA 3PW7A 4L2YA 1DGSA 2HJ1A 4ECVA 3KVFB 2KIWA 1WWVA 2KWVB 1TZ1A 3FM9A 4PL2A 1RQNA 4ECXA 4G3IA 3ML8A 3A9JA 4O3MA 3I3TB 2D07B 4PK1A 3RH4A 1X1MA 1QZEA 2X38A 4NY8A 5IP4D 4RQ4A 7ICUA 2IPKD 4DF4A 5IOIA 4TMAB 4I6LB 4LZDA 3Q8MA 3S6JA 1C78A 2V3NA 1U9LA 1QOAA 4KLOA 3LDZE 3QWZB 2ZEQA 5G5GA 2LYHA 4Y2YA 3IAS1 4EBEA 1N61A 2IGGA 2LMRA 3PX0A 1S10A 4GC6A 2KDEB 3AE9B 2AQ3B 4OHJA 4XX5A 3U7DA 2OJWA 4RQ1A 2KDMA 1KLVA 4MHVA 3VC8A 3Q8LA 3MR3A 5CA7A 3HJEA 3SAGA 2FAZA 4I28A 1F52A 3T5HA 3ZRFA 5J2DA 5KFUA 4W9GA 2M8SA 1NK0A 2BT6A 4JB3A 8ICFA 1S97A 3RB6A 2OXOA 3TAPA 4PHDA 4W9IA 4KN7A 3JPSA 2BGFA 4QZBA 4AYBC 3I9V1 5AK5A 4DOBA 1NK8A 4E71A 5ALFA 4XWTA 1F2RC 4GB9A 4ECUA 4ZHPA 1TY2A 4CDGA 1NI3A 3RI7C 1F44A 2W82A 2LM4A 4ITKA 7ICSA 3N30A 1SZHA 3O65B 4NLKA 3NHEB 3L0WB 4I6PA 2FE9A 3M6ZA 2JZPA 1YNTE 3RR7A 3C28A 5TR5A 3PMNA 8ICJA 3WK4A 5KFIA 4ED7A 3TI0A 3A0HU 2EKIA 1D5XC 4KGRA 1WRDB 3RJFA 3RAXA 1KBUA 2KFZA 3DHIC 1SL2A 1E90A 4K3BA 3TMPB 5AM5A 2J53A 4GGQA 1AW7A 5J0UA 1NZBA 2BQ3A 3G6VA 2M0XA 4TKNA 2J6UA 4KLQA 1F5SA 2JR5A 1E5WA 1XD3B 2LUMA 4HCPB 2A1JA 4EUTA 9ICBA 1ZXIA 3AEEB 9ICXA 4AJWA 2MJEA 2EMSA 5J17A 2KC2A 3V62A 1BPZA 5EE9A 2WNMA 2HW3A 1PDXA 3RBDA 1M4VA 4FADA 3J9CA 4MGZE 5C0YA 3MJ5A 2JEFA 2WFAA 4DOAA 2L8JA 3V6EB 4DXAB 4NLBA 1NK5A 3BS5B 2BPFA 4MEYA 1KKXA 1YQBA 2RGFA 3APCA 3ML9A 3PZDA 3I28A 5AM2A 4FS1A 3KKAC 4KLFA 4J3OD 1SJHD 2I1QA 4IRCA 2D3GA 3KW5B 3GIMA 3QIJA 4RUCA 3GQCA 1RLFA 3MGIA 4HPLB 3UF8A 3TADC 1BPXA 2OH2A 2QDFA 4YVZA 3DHHC 1S3SG 3KKAA 5ALEA 4ANVA 1ZRMA 2W9BA 2KSOB 4ED8A 1J2NA 2R61A 4KLUA 4OVUA 4B95A 2XK5A 4UB1A 4JLCA 3JPPA 1XF5L 4OJ6A 2HDOA 3V6JA 2PTLA 5AM3A 3V72A 1SGHA 1QLBB 3RJHA 1FM0D 2LRWA 2E8MA 1TTNA 3P1MA 4WJNA 1Z19A 5AEKB 3HT3A 4QZ8A 2KFJA 1YJIA 5J0WA 1WXAA 2JWUA 3VFKA 3T79A 2W7PA 4LJOB 2HOFA 4AUQC 4ECSA 4M9LA 4W9DA 3AN1A 1TK8A 2FLNA 2PI4A 7ICJA 5HP4A 9ICKA 2IYDB 4QJFB 3H7PA 1MA7A 1GUAB 2NO4A 4PHEA 3TANA 1FNVA 2Y9UA 2OYYA 2ATLA 4J9MA 1A5RA 1AN8A 4P6VF 3L13A 4P1CC 1ZQLA 4C7ZA 3N9YC 3PREA 4P4PA 2LVOA 3WKBA 4YTPB 4FJYA 1TFRA 2KO3A 4UB6U 3ZI4A 4CRXA 3HK0A 1NZPA 4ED3A 1L8OA 3B08A 1T8EA 5IIIA 4KVGB 2JHDA 2EQYA 5IIOA 5KFNA 2L00B 2MHJA 4US8A 4QZDA 4YL8A 4DQSA 3PO5A 3V6CB 3E58A 5KNIA 2CHXA 2ZCBA 1FIQA 4F91B 2ZJ8A 3NS8A 1ZQWA 3UGBB 7ICHA 1NBFC 4DXFA 4A8EA 4KKJA 1E8WA 2KZRA 1D8BA 1OXJA 5KFJA 1SXTA 3CIRB 1O08A 3MDAA 2M1MA 2HI0A 2ISOA 2NBUA 5H8YE 1RYJA 1XXGA 2WXPA 4FFDA 2HBLA 4XRHA 2MBOA 3BQ1A 5LXHA 3ZGZA 2L52A 3TCAA 4JUZA 1AARA 1NKBA 3KUDB 1GB4A 2FUG1 3TKAA 2PFNA 4F92B 2B76B 1JWAD 3HIZA 3K9OB 1YZ6A 1TAUA 2K4HA 8ICLA 1FEHA 2DNFA 5AI5A 4X5VA 3GZNI 2MSED 2C7MB 4LNFA 4NJ6A 5EWGA 2MU2A 4DL4A 2NPTA 4PYUA 1UA1A 1N5XA 2JZBA 2GO7A 4DL2A 1DYQA 1WXVA 8ICVA 2K8BA 3D32A 3H7IA 5ALKA 1CQVA 2WXKA 2C2RA 4JV1A 4F4ZA 4BDPA 3SHQA 3UI3A 3Q8SB 1D6EC 1GJZA 4PGQA 4DWIA 4LJPB 2L32A 2WF9A 1VD2A 2XNAC 5KFFA 2LKYA 4YR0A 2Z59B 4M8MA 4BWJA 5B66U 2REXA 2RP5A 4MT5A 5C3JB 1IXRA 8ICGA 4EX7A 1ZPSA 5AI9A 1ZW7A 5DLFA 2KMMA 4P0PA 2DYMA 4URKA 3OTQA 1FMAD 2CN1A 2WP9B 1KTQA 1R4NI 3I63C 3QXGA 1NJZA 5J0QA 3LYSA 2XC9A 1KRPA 1NJWA 2QEJC 3SV3A 4FJZA 3M9MB 4ASWC 3WK8A 2KDBA 2ZUDA 2PE6B 4DSEA 2EAPA 3JPOA 3THVA 4KLSA 4GXIA 4GXBA 3C8YA 3OJSA 3E2EA 5E6OA 3MFHA 2DGZA 4MEMA 2E8OA 1BPBA 3UIPB 4A3PA 4DWFA 4QZCA 4KLDA 5F9NA 4ZRKA 3B0YA 1VDVA 3C29A 3K75D 2R2OA 4YSXB 3LVWA 3AE2B 5L1JA 2K5PA 3B0XA 2KJ6A 4M0WA 4KX3A 2HHUA 1Q46A 1L5UA 4UBCA 8ICEA 1IPGA 3AEGB 1P3QU 1D3ZA 3TQ1A 4QZHA 1NJXA 4YR3A 2WB1F 5T8IA 3EECA 5DLGA 4YCXA 4BKTA 1QF6A 4F2RA 2FNJB 1XS9D 4F93B 5J18A 4LDTD 1MC8A 2HHTA 2OEDA 1FD6A 2IO0B 2HHXA 2MBHA 3EPGA 4PGYA 1SBBB 3VAWA 1PK1B 2JH1A 1UD7A 5D94A 5AKEA 1L4DB 2A1AA 1S9FA 4DL6A 1RM6C 3UMGA 1C7YA 4F4WA 1SGGA 4HEA1 1GPXA 4TQRA 2VA2A 3RH5A 3NG0A 2K60A 3Q3MC 4M47A 2N1VA 2DPIA 2N9KA 1N60A 2JXTA 3PHXB 2JXJA 1YIWA 4GIVA 4B6WA 2AL3A 2FE8A 4ZRJA 3PV8A 5KFTA 3H40A 2PJHA 3NRZA 2PMZC 9ICGA 2MH7A 2N0SB 1XQQA 2BPGA 4P7IA 3L54A 3ZJVA 4OZBA 1NKEA 5KFAA 2LMCA 3WK5A 5KT5A 4KZCA 1X42A 4F4YA 1S77D 2C28A 2GBNA 4J9QA 4L23A 2KQ4X 2N4FA 3IM1A 3IG8A 2WXHA 4RPZA 1D8LA 1JRPA 2FMQA 4QAYA 2VANA 5KG0A 3BS7A 2MW5A 1XCQL 2KK8A 2FCMA 4IL6U 1JALA 1YX5B 2KX0A 4A8XC 3SYZA 5DB7A 5AM0A 1U4BA 3DVGX 2ISPA 3T3FA 3SAFA 1YQ4B 4J9RA 2ZIUB 2GH1A 3BS5A 2WWZA 5BOLA 4IOIE 1PGAA 4FA6A 1T3NA 3QEBZ 1QH9A 4OO1J 5G55A 3SV4A 1KFDA 3BJYA 1S76D 2MX2A 2ZG6A 4DOCA 5BPCA 2RDBC 1LV5A 2KQSA 4F5OA 2K8AA 3H0RB 3ZNGC 2D6FC 4JV2A 1YJJA 1UT8A 3GDXA 1C1YB 4UDUC 2JEIA 4ECWA 4Q45A 1NKCA 2HHQA 3C23A 3C1YA 5KG5A 2KSOA 3OJ3A 2QILA 1WRIA 1Q10A 2DKXA 5KFRA 1JW9D 4I2FA 4DDGD 4I2BA 4RF1A 2WS3B 1NYRA 5D3IB 4XGAB 1LKYB 3F5EA 2AQ0A 2VH1A 3PV1A 3K9PB 2OHFA 3Q6BA 5JH5C 2AQ2B 9ICHA 3CWIA 3HP6A 3N3KB 4OW0A 3CW2C 4DHZE 3TBLD 1S5LU 3AM9A 4IM2A 4I2JA 2CRXA 4IQUA 3HWTA 2XI9A 4ANWA 4DSFA 3K1ZA 3MC8A 3MFGA 3LJ3A 5DBBA 2MRLA 1ZJNA 3HKZC 2G1EA 2LASA 3A4RA 4HVBA 5C1ZA 4LVSA 1OQRA 1JI7A 3DBSA 3Q3FA 2BF8B 2YQEA 2F1IA 5L1IA 4ANUA 5KT3A 5E6PA 4ACFA 5ALMA 1NNLA 3ISCA 4FHKA 3CYMA 5J2FA 4CQNA 4TUPA 1M94A 3VCBA 4U6PA 4WAFA 4KKIA 5DPTA 1PUTA 4EZ9A 4DL5A 4YFKA 4AS1A 3DBHB 1I4RA 3DBHI 2N9LA 4NQKE 2F3NA 3GV8B 2Y9TA 5HR6A 2BKFA 9ICVA 1Y56A 3QC8B 1L7PA 2K25A 3AU5A 1V2YA 4MELA 4KLMA 2LVPA 1ZETA 3VXWA 3N1YC 4HDOA 2WXNA 2A4ZA 2IO3B 2HTME 2KN4A 3NUHB 2MQJA 2KD1A 1JWBD 2XGQA 1TK5A 2J0MA 1K51A 5AKZA 1UBIA 2F1JA 4UAUA 4CYEA 2A3VA 1WJ4A 2H5XA 4NWIA 5J0PA 2BZFA 2WXQA 2V9WA 2H3VA 2NBVB 3QQ8B 3ZDMC 3QARA 2NR2A 2FMSA 4ZHOA 1TKDA 2UU7A 2GB1A 2NYVA 3O0FA 4DSJA 1UQVA 1J8CA 3GB1A 4YTNB 3WALA 4C8LA 1ZE3D 2EZYA 1NI2A 5KFBA 1QSYA 3G6XA 2QCZA 2MAXA 3SI8A 3ZJTA 3MR2A 3TJPA 1OW5A 1HZ5A 4Y2XA 5DKWA 3WK6A 1KW4A 1FEZA 4J9LA 4ECRA 1XLOA 2KVRA 8ICXA 2Z0EB 1ZDVA 9ICNA 3V6KA 3ENEA 2G07A 9ICSA 3PY8A 7ICOA 1T3QA 4MSQB 3OG5A 1TKEA 2KTFA 2WXMA 3BVZA 2M56B 2W7OA 2WGSA 1DOIA 3X0WA 3TACB 4DLEA 1QILA 3BQ7A 3PRPB 3NGDA 2Q4TA 1RDFA 2FCSA 4NNJB 4KITB 1KJTA 3NUQA 5KG1A 3HM3A 4RNAA 2KDFB 3GFKB 3QX1A 3RUIB 1WWUA 2O2VA 1TKYA 4GLSC 4IG7B 1EU3A 3DBRI 2KEYA 2ZTDA 4RGOS 2JPHA 5C23A 2J7QB 4YN4A 4WIPA 3TEZA 2D3DA 2R2QA 3L17A 1FXAA 2R8KA 1GAQB 2EDUA 4C8KA 5KT4A 2GLSA 1TY0A 5GMVA 4OZCA 4W9JA 1BGXT 1T0QC 1ZQYA 3WKEA 2DYOA 1UGJA 4AQ7A 5AIBA 1FO4A 2LJ5A 2WDRB 5AHXA 2WXIA 1B4FA 3N7PD 3HRDD 3DVNU 1Z4NA 2QSDA 2RQ5A 2YMMA 2ZVNA 4GFJA 4O3PA 5KFGA 4F5QA 4FO6A 2FJ6A 4JWUC 4XE0A 4ICAA 9ICQA 4NLNA 1MFWA 3DV9A 1ZQXA 3ZRCA 5ALHA 8ICMA 2AEHA 8ICRA 4UATA 1GC7A 4EEWA 5EWEA 3JPTA 1GNUA 2BCUA 4RNMA 2FDRA 1OUQA 1T94A 2J6TA 2GLEA 2D8CA 3PSIA 1L3TA 2Z7JA 5HHHA 3H1UA 2X8XX 1TAQA 5ALSA 1HTOA 2V3PA 2MRPA 4C8MA 2OJRA 4TV3A 2WDQB 2WLBA 3RPFC 5TSSA 5IIMA 2INDC 2EELA 5D2MB 3QJZA 3PZ8A 4I2HA 3B0AA 4QWBA 7ICLA 5EE0A 2AGPA 1SKWA 4W9LA 2ALZA 2Z8LA 2QJLA 2LHTA 1FFVA 2Y0SF 1PVQA 2ACZB 2WXFA 4GOCA 4E74A 3RZWC 4IR1A 3NS1A 7ICFA 2KVCA 3R7QA 1XLNA 4B9VA 1ZQHA 3AH7A 3CMMB 1VRAB 5HFYA 2WXRA 3VTUA 4C56C 4KLGA 2JYTA 4K7UA 2Q5WD 1DOQA 5AKYA 2QHOA 1YMHE 1Q1OA 4KX6B 4QW8A 2DL0A 2YB1A 2RR9A 3P4QB 2KIVA 5AKLA 1WM3A 1WE6A 4M9GA 3U52E 3CNHA 4Y2QA 1TJEA 1C76A 4DHJD 2ZIUA 4FE3A 1MVKA 1WUDA 2WX1A 4RQ7A 2MBBB 4KIKB 1GOZA 2C5LC 3IT6B 2KAJA 2ZIXB 1L6UA 2JWZA 4NM2A 1F0ZA 3ETLA 2KJ9A 1TE2A 4RNNA 2LFIA 2KICA 3PO0A 5TZVA 3PSFA 4ACOA 1ZQDA 1HE8A 4HWIB 1X9XA 2HTHA 3FILA 4CHKA 2Y1IA 1WJ6A 3GP7A 3X23A 1D4BA 3WK7A 4BUGA 1TV9A 4MEXA 4AJYB 1SWVA 1V9JA 4PJ0U 4US9A 3KYCD 2ZUCA 4BX9C 5KG6A 2PXIA 1Z00B 3MGVA 3JSVA 2FPKA 4K4IA 2DF4B 2ZUBA 3DHGC 1L7MA 1LKYA 3BINA 3R9KA 2N7EA 3GIIA 2IGHA 1ZQMA 4AYBF 4YD1A 4B9MA 1UWMA 1ZD4A 8ICPA 3MTNB 4M02A 3QU4A 4EZLA 3LDAA 3NZ3A 4Y2RA 2K22A 3W5VB 1KDHA 2KOXA 3W9CB 2G5IB 1WYWB 2VRRB 5D4BA 1RXWA 2HBMA 3R7RA 1XO3A 4XDCA 5D49A 3C19A 4F7ZA 1JROA 2KNJA 3BZCA 2LJIA 4DFJA 2KVSA 5K4LA 9ICOA 2ZJAA 2YLMA 3NY5A 5EOZA 4KLLA 1PGBA 3KD3A 2LBOA 2G09A 4M9NA 4O3RA 2F8KA 4A55A 4IWQA 5KFYA 1SE3A 3SDLC 1CZPA 1FCLA 4PL1A 5J2IA 2CS4A 4II3B 1JXEA 3V60A 4ELUA 1OGWA 4TUSA 3IFWB 1F0MA 2KJRA 3IRUA 3A9KA 3LK9A 2WF7A 1ZQPA 1ZGUB 1K5OA 1WH3A 2IMWP 3LWMA 5C5JA 2E6XA 4NLZA 1JQ4A 4YR2A 4G3XB 5F3XB 3MBYA 2KZ3A 2WX0A 1IM4A 2O6VB 3EYZA 2RPQA 3AU4A 4WWMA 3NTUA 2OEHA 4A20A 2OCEA 4I2CA 2KJ8A 2WXJA 4FBJB 1SWWA 1X9SA 3VUXA 5ALIA 3ONNA 4JL9A 3BDPA 4DLGA 1RPLA 4RQMA 1N62A 1S0MA 4JK1A 3ZKJC 1OQYA 1QSSA 4BXOB 1UBQA 3NOBA 1FRRA 2C7HA 3Q8AA 2KTRB 2V4RA 2ZW0A 4R65A 3WU2U 4UBBA 4YQWA 3TEXA 5IN7A 2K0PA 5D46A 5ALQA 1ZQIA 1HJPA 1V80A 2BHNA 3NRWA 3L3FX 3PSTA 2RMMA 1FCCC 2IY0B 4F5PA 4DSIA 5J0XA 3RFAA 5H92C 4C8NA 1EF1A 2M4NA 3M63B 4RF0A 2MUTB 3BYTB 3ZLZA 1L7OA 4G50A 5CJ7A 2IOHA 4C7YA 5H2FU 2KJHB 2KHVA 1EU4A 4ECTA 2KHWB 2HOQA 3GS2A 1V86A 2JF5A 4BFRA 1S0OA 4WQOB 2K1FA 2MJ3A 1KFTA 9ICAA 2PVOD 3U2SC 2QB1A 4J03A 1Z3EB 2D2QA 1RZTA 2JX5A 3AE6B 1ZYQA 4P2HA 4QZAA 2RLTA 2BCRA 2KK0A 2V3SA 3T5KA 2JMGA 4NJ8A 4OD0A 3GE3C 5ALGA 3QUCA 1SXDA 4GDLB 1MHHE 3ZXRA 3PW0A 3PRZA 2DAFA 1TS5A 3KOOA 3JPRA 4HDQA 5ALLA 3MJWA 2JY6A 5HMLA 2FCQA 5ALUA 1ZKHA 3BK2A 4WJQA 3ISBA 3B9JA 2WYQA 2BS2B 1JWUD 1XWLA 4PS7A 2I1JA 4Q8EA 1V9PA 3MGHA 2JGAA 3QEAZ 3N4MB 3DOWA 5D7GA 3M6KA 1JWMD 4LCDE 3ZXVA 4PS3A 4BZAA 4TQ1A 3F53A 4R66A 4W9KA 1X66A 4Q44A 1K52A 5D3DA 2XEWA 3GOEA 1L3SA 2KDIA 1XSLA 5IIJA 2KXJA 2L05A 1ZOYB 1TS3A 4NPNA 3IHPC 1XSPA 2AGOA 4M04A 4DBGA 4O5CA 1N48A 2W3RA 2JUOA 8ICKA 1MJDA 5AK4A 1L4ZB 4QWDA 3IT4B 3M9OB 2DAJA 9ICUA 1V1OA 2LHDA 2L0FA 4RQ8A 1FFUA 4ECQA 1N5WA 2F1HA 4MF2A 3APFA 3MFIA 2W9CB 1XC9A 5EWFA 2WU5B 9ICJA 4L1BA 3QU9A 1ZQRA 3PTFC 3RJGA 1QLNA 1NYQA 2G4SA 4NZLB 4F72A 2IO2B 2QB0A 5ALTA 1WMHB 4DCCA 3AQEA 1TIFA 2P6UA 2WXOA 3H9DA 2V4QA 1ZQEA 4FXCA 1HTQA 3HHMA 3PO4A 1D9FA 1YJ1A 4OJLA 4UB2A 1LGRA 1YN5A 2INNE 2BQRA 2YVCA 3MC9A 1SE4A 4BVUC 1CRXA 1WGDA 3PRMB 3SU8X 3NVZA 1ZQGA 3KZXA 5ALZA 3A1QB 2KZMA 3DPDA 1SV4A 3OJ4B 2MLBA 2YEPB 3WAPA 5TISU 5KFEA 1TS2A 3E0FA 3IAM1 4Y2SA 1ZUD2 2G0AA 4YWGG 3ALRA 2BPCA 4OJPA 4CO7A 3GU3A 1VJKA 4GU2A 1Y88A 2YB4A 2ICIA 3OPXA 3TL5A 3RULA 3C5FA 4F8RA 1AWDA 2XIDA 1QOBA 1WYGA 2QARB 1IG6A 2BYFA 1R7SA 3BY4B 5CX3A 3PR5B 2QKQA 1SZPA 2NCNA 4KTQA 2DWQA 4NAMA 5EE3A 4W9CA 3ZNHB 3KZIU 2MP2A 2G9HD 4IR9A 2NRWA 3N7RC 2ZIXA 4MGIE 2JVCA 4KZ0A 1FXIA 3AUOA 5FKAC 1E8ZA 2NBWB 2G06A 4RFBA 3AI5A 1BNOA 1KSPA 4MM3B 4CNQA 2YMQA 5KG2A 3R2IA 1GC6A 5JZEB 1OFFA 5DB8A 1D5MC 5J2RA 9ICPA 5DG7A 3PPAA 3Q69A 4N58A 3EFCA 4NJ7A 5EDSA 2NV3A 1RFKA 1N56A 1HQRD 4KSKC 1I4PA 2PKOA 2ZNVB 5J2HA 2IZVB 3E9SA 2Y5PA 2CXYA 4BGDA 1J7AA 4EE2A 4TQ0A 1QOFA 8ICTA 3R3MA 4M9HA 2V4IB 5KG7A 5DQIA 2PFQA 1SB3C 2K8CB 5G2NA 2WF8A 1X2IA 1QQ7A 1XLQA 4G0NB 1K50A 4IM0A 5AK6A 2PVGC 5BMIA 2NTSA 1V38A 1ZQTA 1KRHA 3GV7B 1VCBA 3QU5A 3AEVA 4QIWC 2BGWA 1EO6A 2KJ5A 1GO3F 2KMCA 3GILA 2ZVOA 1J97A 1PVPA 1SE2A 3QHTA 3MABA 1AROP 2EAOA 2E8NA 2PMZF 5JTIA 8ICNA 4UAVA 3U26A 2E1EA 2FMPA 3A0BU 2M0AA 3ZJUA 5E79U 5AK3A 1YN4A 2D11A 2WF5A 2DYBA 4FJVB 3URYA 3R2TA 1SSNA 4HROA 3MDCA 3H6NA 3WAMA 1UWXA 1RWSA 4MDKE 5KG4A 2V9HA 4HJKA 4DQQA 2KYWA 5BYRA 2Y3AA 2LXCA 3UIOB 1E7UA 3AU2A 1MI0A 1XEEA 2BTEA 4M0AA 2SEBD 1R4MB 1R4MI 1ZD2P 2L7RA 4EYIB 2HMXA 4B9LA 3P63A 3P4PB 2RPVA 2H89B 2HDEA 3N20C 4IC9A 4MH8A 2D3CA 4NLCA 4RQ2A 1T4GA 3F5AA 1KL9A 2M0NA 2R8IA 2NO5A 2R8JA 2BWFA 4NJCA 1TVAA 5IILA 3UMCA 3RJIA 3PW2A 2WHIA 4M01A 1KFSA 5AI0A 1RFAA 1T0YA 4I2GA 4RM9A 4ED2A 3W1YA 4WJ3B 1K8RB 4R64A 5HR7A 3QZ7A 5T14A 2INCC 2GBMA 3EFUA 2AU0A 1BUIC 5DGBA 5L1LA 5HI1A 2ZCCA 4BXOA 2RDHA 1NVID 3PLVA 3L16A 2HHWA 2CR5A 4WH4A 1UUPA 2KLGA 1TK0A 3VVWB 2NTTA 2GWSA 4DSLA 5BO4B 3VTVA 3BQ0A 2DZKA 4PPXA 2BB5A 5CTRC 2BQUA 3WA0A 1SXEA 4ED0A 1TKGA 4P16A 1N2XA 2BDPA 3T9LA 4JX1C 2Q0ZX 2RRDA 4PH5A 3H4DA 1U49A 2LI5A 3IBEA 2D10A 1VZ8A 3ALBA 1QOGA 1J7BA 3MR5A 1B0XA 4DF8A 1WGHA 2HOIA 2PI5A 3IN5A 2ONQA 8ICZA 4GXKA 3C2KA 4NL9C 5KFLA 2ZIVB 4J9OA 5EE1A 4EZKA 2J52A 2K39A 1MPEA 5DB6A 3EWAA 1NK7A 5AI4A 1DK3A 9ICTA 1PGXA 5JRTA 4A6QA 3V61A 3HKZF 3OHAA 8ICCA 2BS3B 4B0EA 4J9PA 4TUUA 2CPRA 4YSYB 4NL9A 2J0JA 4DXGA 3MP9A 3U8ZA 4I2IA 3BVGA 3K4GA 1WXQA 4NLGA 2C22A 5KFOA 4B9KA 3RB4A 3MHZA 5DPSA 2I2YA 3PR4A 4HCNB 5AIAA 2F44A 1DXSA 2J0KA 5LXIB 2HVHA 2NS5A 2KTQA 4EEKA 5DDMA 2KOBA 3ZDBA 5KFVA 2UYZB 3SD5A 1V5TA 4WAAA 4C4VB 1J7CA 5MPOA 1ZQJA 3AQFA 3PLUA 4AWJA 5KFMA 3F2DA 1MQ2A 5FR3A 4P1BC 9ICLA 2AX5A 1B1ZA 4UAZA 3JW0X 1E7PB 4N6EB 5ALVA 4DFDA 2P6RA 3GIKA 5KHQA 4YXDB 3DWGC 4DS5A 3V05A 4YMNA 4C00A 3UQ0A 1JN3A 8ICUA 3ZDTA 4DDID 4RGMA 4KSLC 1HEZE 3RT3B 4PT5A 4NXZA 2VH2A 3P42A 1B22A 3WKCA 1CMXB 4QNLA 4F4KA 2W54A 2DZIA 2RD0A 4RQ5A 4W9FA 1KTKA 9ICIA 2QLTA 4UAYA 4YMOA 2KNBA 2ASJA 1BXTA 2MJDA 4AP4C 3KFUF 4HPMB 5KAFU 3F2CA 2XO7A 5I4DA 3AEDB 4ECYA 2DFLA 3KUZA 3KBBA 3TIXA 3HPOA 5AKJA 1Z1VA 1VZ7A 3KWLA 2GRIA 3ED5A 3QE9Y 5KFKA 2WAQC 4PGXA 4UB3A 5J2JA 2KWCA 3UXPA 1CEZA 2EZXA 5AICA 4E0DA 5HG2A 4IC7B 3RNBC 1WGRA 5L83A 4P0QB 1AYFA 3QA8A 4LDTB 3TEYA 1TBEA 4QZ9A 8ICWA 2GBJA 5DQHA 5JHBA 4ELTA 5KFHA 2L0TA 2W9MA 4XUSA 4ZRPA 2K3UA 1S0VA 2XN9C 1ZQUA 1WX8A 1RYUA 3GV5B 5DG9A 1E8YA 1LO5D 3AE3B 2LYBA 2B6GA 3NZSA 1SV0C 5KL1B 5CHVC 5AKXA 3H8JA 2V1YA 4ZDVA 2IOFK 4IKGA 2IHMA 3N28A 2F8LA 4I29A 3LWLA 4REZA 2ZTCA 3OHBA 2JZZA 4WJOA 5ALJA 1UNSA 2A1JB 1SV0A 3IG5A 5L1KA 3VHTC 1ZXHA 2I38A 3CRXA 2CJOA 3AMZA 1T7PA 1ENFA 5KT6A 1WWTA 2JZ3B 3T8MA 1OQQA 2MBEA 3CSFA 2KMAA 2BQQA 4K4HA 3PNCA 2CU3A 3BWUD 1E10A 1HUZA 1IIPA 4OZAA 2BKRB 4ZH4A 1KLNA 5AZFA 3RB3A 4ZYSA 4CF4A 5GXGB 3RJJA 9ICWA 4DQOC 2NRVA 4DEZA 5CRXA 3QNMA 4PZNA 4F50A 2KQ7A 1WX7A 1PZNA 2IY1B 4HLEA 4FBTA 4EOYA 2J6SA 3BZDB 4YT0B 3GE8C 5AZHA 8ICQA 1ZD5A 1QSLA 1XLPA 4GDKB 2K6QA 2P35A 2INPE 5CB1A 4YG2A 3SENA 2W9BB 4MFCA 4X57B 4OJOA 5IO9A 4XZ4A 2LRUA 1X9WA 4LTUA 2ES6A 2GOLA 4F71A 2K9XA 5L9XA 1WR6E 3UQAA 4XWWA 1ZQQA 1WGGA 3NJTA 3T5JA 1PK1A 3ZDAA 1MN8A 2RDJA 1ZD3A 4GC7A 4PZOA 5J29A 3Q8PB 3OGUA 3Q8EA 3D2NA 1LB2B 2JU6X 1D9DA 3BZKA 1UA0A 3P4SB 3PGEA 3IV6A 2W43A 2W9NA 4KN4A 9ICFA 3H7PB 2AGQA 5J2AA 1QQ6A 3Q8QB 3PW5A 3ZD9A 3NVWA 2CHZA 2NVUI 4MF8A 2HHVA 2LWPA 4WJPA 4R8UB 3PHWB 1WGYA 1CJEA 2XICA 4P4OA 3SMVA 2BB6A 2FCNA 4BAXA 4B0MA 1SE9A 4F1SA 4KMOB 1H8CA 2EAMA 2BBCA 2K6DB 1T5XD 2MSNA 4Z6EA 1WFYA 2W8LA 3RNCC 5L95C 2JSVX 2IGDA 4U7CA 4HYKA 1UGMA 1SF0A 2FLPA 1BVSA 3CSTA 3H4BA 2GI9A 2KT7A 1S8OA 2OOBB 1UH6A 4EZ6A 4FZLA 3VR8B 2K4EA 3ISDA 2RDGA 3ZUNA 7ICNA 3E56A 1I4GA 2MBQA 3DBLB 5KFZA 4IRDA 3V7JA 1JIHA 4FN2A 2WHEA 5JXVA 2W8KA 4EBDA 4DQRA 1K1SA 3MR6A 3Q8KA 2GBRA 4BBNC 4KX5A 5DQGA 2G08A 1L3UA 4DS4A 1O03A 5KAIU 2KMDA 2E5SA 2PIAA 4BOZB 2GOWA 2XGPA 1U48A 5IA7A 4QZIA 4XDDA 2DENB 2W11A 4UB8U 1WSPA 2KKCA 1MG4A 5ALYA 2LGYA 1UPHA 2KKVA 3KHRA 2PEAA 4KGTA 2AL6A 1SKRA 1YT3A 3KHLA 2WDVB 3O13A 1C79A 2R18A 3DCGA 1IGCA 2ASDA 2KFKB 2FUHB 5IAAC 3AU6A 4RT2A 2NPTB 2XY5A 2BYTA 1F9JA 3M62B 1TT5B 3AV8A 3AL0B 3U4EG 4D2KA 1Z1BA 3PVLA 1BPDA 5J0TA 2VIXA 5J8YC 2BCVA 1K1QA 2DPJA 1XU4A 2I1KA 3H8MA 3IXSA 4RGTA 2JYEA 5CWRA 3C21A 2WQYB 1X6IA 3RJKA 2WXGA 3AULA 1QTMA 4ICUA 3A33B 3CF6E 4OVVA 2L76A 4PYZA 5ALDA 4F5RA 4C4VA 3LVVA 3VH4B 5J8YA 3MC0B 4ZYNA 3RH6A 4DQIA 1YQ3B 5HMMA 2XCPA 4O3SA 4P0PB 4JE3B 2Y5CA 3R66C 3PMLA 1KLGD 2JV3A 3KH0A 1GB1A 4W9HA 4LNNA 3D2QA 1ACCA 2LGIA 3PT2B 5CEHA 3HUIA 4NV0A 4ZRIA 3V3XA 1ET6A 3ZNID 2PW9A 1BNPA 3GIJA 1SIJA 4K4GA 4NAWB 4O3OA 3K1RB 1FPYA 2DHZA 4CGZA 2KVZA 3FDSA 2B21A 2OWOA 1V97A 1IP9A 1ZJMA 5E6JA 3L08A 4QZGA 2H3FA 3Q8BA 3ECIA 2WXLA 2N7JA 5BMGA 7ICKA 1C20A 4R63A 2LD9A 3ZNZB 2DUYA 1FNWA 1MG8A 4K7WA 3EUB2 4YD2A 2EANA 2JT4B 2ZIWB 4JQWC 4WWPA 3B2FA 1STEA 1YOVB 3PW4A 4M0WB 4YXMA 5D6JB 4OCZA 3OSPA 3RN9C 5J2KA 3PSEB 3T3OA 1Z4OA 3KLSX 1DK2A 3HM6X 1C4PA 1HZ6A 3IVFA 3SR6A 4Y2JA 4J6IA 2V0GA 4LNIA 5AUIA 2CHWA 3RBEA 2AXTU 2E1FA 4Z6FA 3Q3NC 5IIKA 4I2DA 3H8SA 4FZMA 3DDHA 4S0RA 4IS7A 2ASQA 2VZKB 1E8XA 3Q3JA 2NMQA 4P0QA 1DOXA 4I6NB 3I76A 3RRGA 3RTVA 5JU5A 1S1QB 4YSZB 2KC1A 1AQ6A 4RCOA 5FR6A 1D5ZC 3KQ4A 2IJ0A 4Y2UA 1JX4A 3N1ZC 4A3OA 5CHFA 1TYGB 2KD0A 4MJSB 3TAQA 2L5YA 3I1YA 3L4PA 1ZQOA 1ZQKA 2E8PA 1IBXB 5BMHA 2JQRB 3QYPA 1ZQ1C 2W9AA 4RM8A 1COKA 3BQTA 4ZOHC 4YP3A 2SAKA 3H8HA 1P9DU 5IKCM 3G6YA 4Y2VA 1Z2MA 4RZRA 2JH7A 1OEYA 4ARCA 4RPXA 5KFPA 2BS4B 2LPEA 2ODGA 2HCFA 4KLJA 1NDDA 2IBIB 1UT5A 7ICVA 3DWMA 4TSSA 2W04A 2A5UA 1BT0A 5DDYA 1J19A 4C0ZA 4DL7A 2UVWA 1U4AA 4A9AA 1L5PA 1IV8A 1QCKA 1EWYC 4RNOA 1U45A 1I4HA 4W9EA 4Q8FA 2BDUA 5KL8B 4DHZB 2BWES 4HKZE 3W2DA 1QKZA 1RXVA 2KP7A 2PFPA 1DOYA 1X40A 2HJ8A 4RQNA 1X9MA 3QUTA 3OLMD 3RNGC 1L0XB 3C1ZA 1Z5SB 4UARA 4XYCA 3M9NB 1RG6A 1IUEA 4YTMB 2IHNA 4DHJB 4I2EA 4O0IA 4LJXA 4CE6A 1KN5A 4EX6A 5BOMA 3TEWA 3PX6A 4GDKA 2KV2A 1V49A 3N97B 4Q2JA 4ELVA 3OJUA 4PHAA 3PX4A 2N9PC 1L3VA 2B3AA 3LB8C 1QQRA 2NRTA 1B43A 1F1HA 4G9BA 3TADA 1C4AA 1PUZA 1X6JA 1L7YA 4PS8A 4A90A 2K89A 2JRIB 4K1RB 3ZIMA 2FLLA 4B9SA 1PYWD 3VRBB 2H3IA 1V8CA 4XA5A 2XCAA 1A0PA 4O3NA 2C9WB 4F8CB 4JMUA 3Q8FA 4IWPA 2VA8A 4K7SA 2XY6A 8ICSA 8ICYA 1NENB 4Z6CA 4M6WB 3D2SA 3WIMA 2PLPA 4B9TA 2ZPNA 2O6KA 1E0ZA 1Q5WB 2KANA 1H4RA 4QWEA 4LNKA 2J42A 2LXAA 1LFDA 4R8UA 2QMTA 3HVZA 1J0GA 4GIBA 2JEGA 2ON8A 3FAHA 1OTRB 1TS4A 3EPIA 1JCKB 1P98A 3RMKC 3FKYA 2C2EA 3T3NA 5DB9A 4ZRQA 3B2GA 3AEAB 1RYRA 2LEKA 2YN4A 4TUQA 4B9UA 1P7DA 4M2YA 4B9NA 3EZ5A 1NOMA 3RAQA 2RDIA 2F77X 1V1PB 1RQLA 3IDWA 8ICIA 7ICRA 1V5OA 7ICGA 3IP4B 4RT3A 3AE7B 2I6XA 5ALRA 1M6YA 4F3OA 2KN5A 2DLBA 4QWCA 1JMLA 1XSNA 1FRDA 1GG3A 2LGSA 1JWSD 1WM2A 3WK9A 1EWCA 4IUMB 1WZ3A 2XVTA 4J9SA 1J2MA 1WY8A 3TUOA 9ICCA 5KFSA 1I4QA 5IINA 2DX5B 5LLIA 2K4PA 3DEEA 4CCHA 4KIKA 3OSNA 3C2LA 4QIWF 1NK6A 4MH0E 2WU2B 3SEBA 3PSPA 3VTWA 1HEKA 4USAA 1S0NA 1XT9B 2XBBC 3IG3A 3N1XC 7ICTA 4KDLB 4K81A 3H8WA 4N59A 4EBCA 2KFKA 3GZNB 3ZVVA 3SAHA 2HHSA 3JPQA 4AP9A 1L0YB 4IDIA 3SZ2A 5KFXA 2KE7A 2CU1A 1L7NA 1ZRNA 5J2GA 3EA6A 1ZOLA 3QU2A 1A6SA 5BYSA 4EZJA 2DBYA 8ICOA 3WAOA 1Z00A 1P1AA 4Y2TA 4GMVA 3I57A 1C9FA 2C7NB 2M9NA 2RHFA 1E6EB 4C80A 4Z6DA 2BR0A 4P4MA 3RFZB 1L2NA 4BKSD 4KLTA 4IQTA 5KFCA 2ZXHA 2WTFA 1NK4A 1C77A 1F77A 1I4XA 4LLGM 3W5UB 2ZXIA 1N63A 4OVZA 4FLHA 2H3ZA 3UQBA 2WF6A 3L10B 1R4NB 2EKEC 3UPQA 2QIEB 1ESFA 2UVRA 4WWNA 3BQ2A 1SKSA 8ICHA 4ARIA 2HSZA 4CF5A 3UM9A 5C2TB 5KTQA 1WJUA 1WXSA 4NAWA 1KH0A 7ICQA 1E9MA 5DPWA 4JWNA 5AI6A 3Q8CA 5FK9C 2H88B 1IGDA 1WCLA 1XO1A 2C2DA 1KQQA 3VRAB 3RF9A 4I27A 4S17A 2ZPYA 2O2VB 2Y5BB 3JYUA 3HW8A 2YTUA 2ZIWA 3M3JA 7ICPA 4IW0A 2N1RA 3P4RB 4Y2PA 3AE8B 1RRBA 1EF5A 3U30A 5KT7A 3M95A 3TFRA 4BOSC 5J0SA 1Y8RC 1PQSA 1KFYB 3WCQA 1C3TA 4FULA 2UVUA 5DGAA 2O6VA 1FXTB 4GLXA 3HX0A 1Q3UA 4GSWA 3ETRA 3UINB 2DQNB 5HKHA 2VJ4A 3BYYB 2LYAA 3PZ7A 4LNOA 2QC8A 2BCQA 4TURA 5DPRA 9ICRA 2FIFA 1VLBA 5GTIU 1JMSA 1TAMA 5KFWA 2D5GA 4H2AA 5J2CA 1L6VA 2DZJA 3ORYA 1E7VA 3RJEA 3AE1B 3W1SC 2KTRA 4ANXA 5CHWA 1ZQBA 3R8BA 2FPMA 3ZDCA 5AKIA 5F9LA 3B1LX 4MGYE 4RMAA 4WURA 3P2BA 1ET9A 4RH6A 3BK1A 4F4XA 4MJSA 3W1SA 2EZZA 4JV0A 4RUAA 2ZJDA 2A19A 1IBXA 5JUMA 4FZNA 1WJNA 2MUTA 1P7FA 2IBKA 3V7LA 3H0MB 5DBCA 1EUVB 2MA9B 2WB1C 3VH3B 1PVRA 3H0LB 1WIAA 1LVHA 2VJ5A 3AEBB 3OWEB 2KLCA 1N6ZA 1B9RA 1BMLC 2AYOB 1TZOA 1RAXA 3ICXA 1ZDXA 3QUBA 3VDZA 2NRZA 4EKUA 1K53A 1WCNA 1L6NA 4UQGA 3BVMA 4KGSA 2KKPA 4I2AA 1WI0A 4EENA 4PHPA 3QZ8A 1HXYD 3TARA 3ZO5B 4O5KA 4GDLA 1JXLA 3GZFA 2LM1A 2VKQA 5AI8A 4UAWA 2N1WA 4IQVA 1HUOA 4KLEA 3ZTDA 4FBUA 4TQSA 8ICAA 3ZQ4A 3ZDEA 1OEYJ 2LVQA 1ZQNA 1ZQSA 4O3QA 2KX3A 3RCZA 5J2BA 4RQ3A 2D3BA 7ICIA 3N32A 1IYFA 3FYHA 3F2BA 1P7EA 4MSMB 4UW9A 5ALXA 3LXFA 2F2AB 2Z0DB 1WZ0A 3FILB 1KLUD 4K3CA 2BPSA 2YEPF 1XO0A 4XC2A 1BPYA 2KWUB 3ONSA 3JVZX 3V7KA 3H7SA 9ICEA 4HJGE 2WAQF 2HD5B 4F2SA 3JSVB 4IQWA 1DRGA 1DGJA 4DFMA 1WXMA 3SFDB 1A77A 1LQBA 3M8SA 3M1YA 1CK1A 1LM8B 1V6EA 2RSUA 2M17A 5JHAA 3EC8A 4ECZA 5HHDG 9ICMA 1SEBD 2UVVA 2MCNB 2H3QA 4IWOA 4JPSA 1KOTA 2HVIA 2W9CA 3IHQB 3RNAC 2L3ZA 2R8HA 3A9JB 2KG5A 2V4LA 3DQVA 1XCTL 3OAWA 3RZFA 1HA5A 1TGZB 3U7ZA 3EGRA 3WKDA 5HHIA 2DZMA 1G6JA 1UCVA 4M6WA 1EXNA 1H38A 4QWAA 1WMHA 4N9F4 1VJ5A 5ALOA 2N9XA 2AWTA 2CJNA 4QW9A 2PMVA 5DG8A 2IDYA 1PK3A 3DVGY 3PVXA 2ESEA 2KACA 3AB5A 4J9KA 2W55A 3QCAA 5KG3A 2HBJA 3SEIA 4GN1A 3ZDDA 3AE5B 4M8NA 1SL1A 8ICBA 1NK9A 2YX8A 2HBKA 3AECB 4G11A 3PZPA 3VR9B 1Q8KA 3A9KB 1WE7A 4NQLB 3A1QA 3BIID 2YMPA 4RQ0A 4AOFA 4EYHB 1V1PA 1UELA 4RQ6A 2KFNA 3J81j 3L5KA 5AKGA 4MGKE 1ZQVA 3VQIA 1ISNA 2G3QB 2BYEA 3Q14C 2AQ4A 2MEKA 2VA3A 4MFFA 3TFSA 2QARA 1WF9A 2IA6A 4UB5A 4O5EA 4ED1A 1CI4A 1QT9A 2AQ1B 3HVDA 4KV2A 1YZ7A 3QX7A 1P0RA 3ZD8A 1F2RI 4C4RA 3NVVA 1ZP0B 3AE4B 5CR0A 3UQ2A 2K4IA 3HILA 1I42A 4FHJA 1L8LA 1PFDA 1V85A 2ZNVC 1WG8A 5ALPA 1I35A 1YN3A 3FC4A 3RR8A 1URJA 4KLIA 4HXDA 4MM3A 2MA1A 2N9EB 3KHHA 2G45B 3QUQA 1T0SC 5GTHU 1V81A 4II2B 3M8RA 2CKHB 2LHEA 4MACA 5L1MA 3EW9A 1QQ5A 2OM6A 1JRUA 1MQ3A 3JPNA 1MHXA 1BPEA 4CF3A 4UB4A 4KMUA 3CP8A 1FNUA 4Q43A 5AM4A 1Q0WB 4JGHB 2NRXA 1COOA 4B6JA 3T5LA 4OJ5A 3LYYA 2K8CA 2FPLA 4YMMA 1UF0A 5J0YA 1WR1A 2YMLA 4M00A 4NY0A 2D3AA 1UHUA 4M9JA 2BW2A 3SQIA 1WX9A 3UXOA 2ZTEA 3KTQA 3RD2A 5ALWA 4HKQA 2GBKA 3SD7A 4FS2A 5HNKA 4DL3A 4F5NA 2LGDA 2M19A 1ZQFA 5FP0A 3ABVB 4ED6A 2Y1JA 3UMBA 3QU7A 2IOFA 3RRHA 2ZJ5A 2LUEA 5AKHA 3PS6A 3DDCB 4DO9A 1YD8U 1ECWA 2PPHA 3AXCA 2KN7A 2WDTB 2FI1A 3EHVA 1XNSA 4NM1A 4BWMA 2L1AA 3KYDD 3Q2AC 1U47A 2LGXA 4DFPA 2XK5B 3ZYYX 3RNFC 1SL0A 2BKEA 5KFQA 3I5JC 2EMTA 4MFAA 4RGNA 1WGKA 1HIWA 3DBRB 3SFEB 5J2EA 2C60A 4YXJA 1NEKB 3WANA 2O6VD 4HAIA 2B0CA 1CUKA 2I9GA 2E3TA 4WWOA 5KT2A 1JUDA 3NASA 3RB0A 4RU9A 3KUCB 3NVYA 2FBWB 4BBNF 4XQ8A 7ICEA 4C4TA 2GMIC 5G5HA 4BKGA 2IO1B 2KWDA 1VR9A 2G5HB 2BVCA 1LXDA 2VZKD 4KLHA 4EELA 2JRZA 4IM3A 3MC1A 5KFDA 5CP2A 4HPPA 4ICVA 2YY6A 3C5GA 2MWSB 3QAQA 1T0RC 3A4SC 2KZZA 1KF6B 5B5EU 5AM1A 4BJQA 1ZQCA 1UZXB 1ED1A 1RYSA 4E3CA 2K8HA 4HRSA 4EFOA 5AKKA 2P66A 4GXJA 2I5HA 1T6BX 1VZ6A 2PE9A 4DQPA 2QB0B 1ROEA 1SIFA 1KM7A 3UXNA 2ZZPB 3APDA 2JRHA 3C2MA 2TSSA 3VUWA 2BYVE 3M7DA 3DBLI 4DFKA 3VUYA 4DSKA 2FIDA 3ZTCA 1A70A 3KHGA 2LZ6A 4DK5A 2PFOA 1I7HA 2AHOB 1C4CA 4WQMA 4O9MA 4RPYA 4QZEA 3KWVA 5A0LA 3AEFB 1KEJA 2L83A 3QK0A 5DCNA 4EEYA 4C4SA 1YX6B 2ZIVA 5J0RA 2N7DA 2BCSA 2W03A 5AZGA 1L0VB 2HE7A 2DKZA 4JIOU 2G4DB 2EH9A 2UWQA 5LNK1 2J4XA 2PKEA 1ZQAA 3MHSD 1D8YA 3RYTA 3N7SC 3S2AA 2F76X
chains in the Genus database with same CATH topology
3TEWA 1MI0A 1XEEA 2WXNA 2BTEA 3NUHB 2HTME 2KN4A 2SEBD 4JWSC 4Q2JA 5AUKA 2W3SA 4LK0M 1JWBD 3LB8C 3P63A 3P4PB 1K51A 1QQRA 2RPVA 2H89B 2HDEA 4MH8A 1C4AA 4O1NA 4A90A 2WXQA 1SJED 4NJCA 4ZHOA 2ZW1A 1PYWD 3VRBB 1V8CA 2GB1A 3GB1A 4YTNB 1ZE3D 3Q8FA 1BUIC 3TSSA 5HI1A 4R3DA 2RDHA 1NVID 3ZJTA 1NENB 1HZ5A 2PLPA 4WH4A 1EM7A 1UUPA 5BYQA 2NTTA 1E0ZA 4L2YA 1XLOA 2J42A 1ZDVA 2QMTA 3HVZA 2ON8A 2BB5A 3FAHA 1TS4A 1JCKB 1TKGA 3T3NA 4P16A 1T3QA 3B2GA 4ZRQA 3AEAB 4JX1C 1TKEA 2WXMA 3BVZA 2X38A 2M56B 2LEKA 1VZ8A 1QOGA 1J7BA 1DOIA 1QILA 2IPKD 2ONQA 4TMAB 1C78A 2V3NA 1QOAA 5G5GA 1V1PB 3IAS1 1N61A 2IGGA 4RNAA 3AE9B 5EE1A 2J52A 2AQ3B 3AE7B 4OHJA 1MPEA 2KDMA 2DLBA 1PGXA 1TKYA 4GLSC 4A6QA 4B0EA 1EU3A 2BS3B 4RGOS 1JMLA 1FRDA 3TEZA 4WIPA 4YSYB 1JWSD 4DXGA 1EWCA 3MP9A 1FXAA 1GAQB 3TUOA 2BT6A 1I4QA 1TY0A 3BVGA 4OZCA 1WXQA 3MHZA 2I2YA 2DYOA 1UGJA 3I9V1 2WU2B 3SEBA 4AQ7A 4USAA 1FO4A 2WDRB 4XWTA 1F2RC 2WXIA 4ZHPA 1TY2A 3HRDD 1NI3A 2W82A 2QSDA 4N59A 4ITKA 1J7CA 5MPOA 4JWUC 4XE0A 4IDIA 1L0YB 2JZPA 1YNTE 5FR3A 3EA6A 5BYSA 2AX5A 1B1ZA 1D5XC 2DBYA 2EKIA 4KGRA 1E7PB 4N6EB 2J53A 4YXDB 3DWGC 1AW7A 3I57A 3V05A 1C9FA 1E6EB 4C80A 3RFZB 4RGMA 1F77A 1C77A 1I4XA 1HEZE 2V3PA 4LLGM 3W5UB 2LUMA 2WDQB 2WLBA 4PT5A 3RPFC 1ZXIA 3AEEB 5TSSA 1N63A 2MJEA 2EELA 3P42A 4OVZA 2W54A 3PZ8A 5EE9A 2QIEB 1ESFA 2WNMA 1PDXA 1KTKA 1M4VA 5EE0A 4ARIA 3J9CA 2Z8LA 3MJ5A 5C2TB 2QJLA 1FFVA 2ACZB 1KH0A 2WXFA 1E9MA 1BXTA 2MJDA 3NS1A 5I4DA 3Q8CA 5FK9C 2H88B 1XLNA 3AEDB 1IGDA 3AH7A 4J3OD 1SJHD 1VRAB 3VRAB 5HFYA 2WXRA 4C56C 2JYTA 2Q5WD 1VZ7A 3KWLA 2GRIA 1YMHE 4KX6B 3P4QB 3P4RB 3AE8B 3U52E 1TJEA 1C76A 2R61A 1MVKA 3WCQA 1KFYB 1GOZA 3IT6B 2KAJA 5HG2A 1XF5L 1L6UA 2PTLA 1AYFA 3ETRA 1F0ZA 1QLBB 3TEYA 1FM0D 3BYYB 3P1MA 2LFIA 3PZ7A 3PO0A 3FILA 1D4BA 1YJIA 3GP7A 1VLBA 4ZRPA 2JWUA 2K3UA 2D5GA 4H2AA 4US9A 2XN9C 1L6VA 3AE3B 3AN1A 1LO5D 3AE1B 3R8BA 2IGHA 1FNVA 4IKGA 4WURA 1AN8A 1UWMA 4P6VF 1ET9A 4RH6A 4REZA 3BK1A 4C7ZA 3N9YC 3W1SA 3NZ3A 2K22A 3W5VB 1UNSA 1IBXA 3W9CB 4YTPB 1P7FA 1XO3A 1ZXHA 2I38A 4XDCA 2CJOA 1JROA 3AMZA 1ENFA 2LJIA 1WWTA 3AEBB 1OQQA 3OWEB 1PGBA 1B9RA 1BMLC 1TZOA 2CU3A 3BWUD 4US8A 4A55A 1E10A 4OZAA 1SE3A 4ZYSA 1ZDXA 5GXGB 1CZPA 4DQOC 1K53A 1FCLA 1FIQA 3BVMA 4KGSA 4DXFA 4KKJA 1HXYD 3BZDB 4YT0B 1SXTA 2E6XA 3CIRB 1XLPA 4GDKB 1JQ4A 2INPE 5H8YE 1RYJA 1XXGA 2WXPA 3ZGZA 3ZQ4A 2L52A 1GB4A 2FUG1 4LTUA 2B76B 1JWAD 4WWMA 2K9XA 1FEHA 1P7EA 2WXJA 4XWWA 3LXFA 3FILB 1KLUD 1N5XA 1DYQA 2YEPF 1N62A 1CQVA 2WXKA 3Q8EA 2JU6X 3UI3A 3P4SB 1D6EC 1FRRA 3Q8AA 4HJGE 2ZW0A 3SFDB 1DGJA 2L32A 2XNAC 3TEXA 2K0PA 1CK1A 3NVWA 4MT5A 5C3JB 2RMMA 1SEBD 5HHDG 1FCCC 1CJEA 4JPSA 2BB6A 1ZPSA 4B0MA 2KMMA 5H92C 2DYMA 1XCTL 1FMAD 1HA5A 2BBCA 1T5XD 2WP9B 3EGRA 4RF0A 3U7ZA 2JSVX 2IGDA 3BYTB 4C7YA 2PMVA 1SF0A 2QEJC 2CJNA 1EU4A 2GI9A 3VR8B 2IDYA 2RDGA 3GS2A 2MJ3A 3E56A 1I4GA 2KACA 3AB5A 2PVOD 3C8YA 3U2SC 2W55A 5JXVA 2JX5A 3AE5B 3AE6B 3AECB 4YSXB 1VDVA 3VR9B 3AE2B 2K5PA 4GDLB 1MHHE 3BIID 4M0WA 2PIAA 1TS5A 3AEGB 1V1PA 4XDDA 3BK2A 1WSPA 3B9JA 5T8IA 2BS2B 1JWUD 4KGTA 3VQIA 2WDVB 3O13A 1C79A 2MEKA 1QF6A 5D7GA 1JWMD 1IGCA 4TQ1A 2OEDA 1QT9A 1FD6A 2AQ1B 3HVDA 5D3DA 1SBBB 1K52A 2BYTA 3U4EG 3AV8A 4D2KA 1L4DB 1F2RI 3IXSA 3AE4B 3NVVA 1ZP0B 1TS3A 1ZOYB 1RM6C 4RGTA 2JYEA 4HEA1 1PFDA 2WQYB 1GPXA 2W3RA 2WXGA 1YN3A 1L4ZB 3FC4A 2N9KA 3IT4B 1N60A 3MC0B 2JXTA 1YQ3B 1V1OA 2LHDA 2LHEA 4MACA 1FFUA 1N5WA 2FE8A 3NRZA 2N0SB 2MH7A 2WU5B 1MHXA 2Y5CA 4JE3B 1KLGD 4L1BA 3ZJVA 1GB1A 4OZBA 1NYQA 4NZLB 1ACCA 2LGIA 1FNUA 2LMCA 3HUIA 3V3XA 1ET6A 2PW9A 4L23A 1SIJA 2KQ4X 2WXOA 2WXHA 3LYYA 4NAWB 1JRPA 1V97A 4FXCA 5E6JA 2BW2A 3Q8BA 2WXLA 2N7JA 1XCQL 5BMGA 4HKQA 1JALA 1YN5A 2INNE 2M19A 4A8XC 1FNWA 3ABVB 1SE4A 3EUB2 3NVZA 3B2FA 1STEA 1YQ4B 2YEPB 4IOIE 1PGAA 2L1AA 3T3OA 3KLSX 1TS2A 3IAM1 1C4PA 3ZYYX 1ZUD2 4YWGG 1HZ6A 3SR6A 4RGNA 1WGKA 1VJKA 3SFEB 2ICIA 2V0GA 1NEKB 1AWDA 5AUIA 1QOBA 1WYGA 1YJJA 1R7SA 4UDUC 2E3TA 2DWQA 4NAMA 5EE3A 2QILA 1WRIA 1Q10A 1JW9D 2G9HD 3NVYA 2FBWB 2VZKB 2NMQA 5G5HA 2WS3B 4RF1A 2KWDA 1FXIA 1VR9A 1DOXA 5FKAC 1NYRA 5D3IB 4YSZB 4RFBA 4RCOA 2VZKD 1D5ZC 3KQ4A 2OHFA 4MM3B 3R2IA 2IJ0A 1OFFA 2AQ2B 3CWIA 1D5MC 1TYGB 4N58A 3Q69A 4OW0A 3L4PA 3AM9A 1KF6B 1IBXB 5BMHA 1RFKA 2JQRB 1HQRD 1I4PA 2PKOA 2SAKA 4ZOHC 3E9SA 2Y5PA 4HRSA 3H8HA 1J7AA 4EE2A 1T6BX 4TQ0A 1VZ6A 3MFGA 4ARCA 1ROEA 1QOFA 2G1EA 2V4IB 2BS4B 1SB3C 1OQRA 2TSSA 1XLQA 1K50A 3DWMA 2PVGC 5BMIA 4TSSA 2NTSA 1A70A 1KRHA 1I7HA 1C4CA 4WQMA 4A9AA 1L5PA 4CQNA 3KWVA 3AEFB 1SE2A 1EWYC 2L83A 1I4HA 4WAFA 4KKIA 1PUTA 4HKZE 3W2DA 1QKZA 4AS1A 1I4RA 2M0AA 1DOYA 1L0VB 3ZJUA 2N9LA 1YN4A 3URYA 1L0XB 5LNK1 2J4XA 1SSNA 3R2TA 4HROA 1IUEA 4YTMB 1UWXA 1RWSA 1Y56A 5BYRA 2Y3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUI A;  3W5U B;  2WDQ B;  2WLB A;  4LTU A;  3RPF C;  1ZXI A;  2B76 B;  1JWA D;  3AEE B;  4WWM A;  1N63 A;  1SIJ A;  2HTM E;  2K9X A;  2MJE A;  4JWS C;  5AUK A;  1JRP A;  2W3S A;  2W54 A;  1V97 A;  1JWB D;  3LB8 C;  3P63 A;  2QIE B;  3P4P B;  4FXC A;  5EE9 A;  1PDX A;  2H89 B;  3LXF A;  5EE0 A;  5C2T B;  2QJL A;  1N5X A;  1FFV A;  1JAL A;  2ACZ B;  2M19 A;  1N62 A;  1E9M A;  2MJD A;  4ZHO A;  3ABV B;  3NS1 A;  3EUB 2;  3VRB B;  2H88 B;  3P4S B;  1XLN A;  1FRR A;  3AED B;  1V8C A;  3AH7 A;  3NVZ A;  3B2F A;  3SFD B;  3VRA B;  1DGJ A;  4YTN B;  1YQ4 B;  2Q5W D;  3NVW A;  3KWL A;  1NVI D;  4KX6 B;  1NEN B;  5C3J B;  1CJE A;  3ZYY X;  1ZUD 2;  3P4R B;  3P4Q B;  3AE8 B;  3SR6 A;  2KMM A;  1TJE A;  5H92 C;  1WGK A;  1VJK A;  3SFE B;  1E0Z A;  1FMA D;  2WP9 B;  1XLO A;  1NEK B;  3WCQ A;  1KFY B;  1AWD A;  5AUI A;  1QOB A;  1WYG A;  2KAJ A;  1YJJ A;  4C7Y A;  1L6U A;  3HVZ A;  1AYF A;  1R7S A;  1SF0 A;  3ETR A;  3FAH A;  2CJN A;  1F0Z A;  2E3T A;  1QLB B;  1TKG A;  3VR8 B;  1FM0 D;  1T3Q A;  2DWQ A;  3B2G A;  3P1M A;  1WRI A;  5EE3 A;  1JW9 D;  3AEA B;  4JX1 C;  3NVY A;  2FBW B;  1TKE A;  2MJ3 A;  3PO0 A;  2M56 B;  2LEK A;  3AB5 A;  2PVO D;  1QOG A;  5G5H A;  2WS3 B;  1YJI A;  1J7B A;  2W55 A;  1DOI A;  1VLB A;  1FXI A;  1DOX A;  1NYR A;  2JX5 A;  3AE5 B;  3AE6 B;  4YSZ B;  4US9 A;  1QOA A;  1L6V A;  3AEC B;  3AE3 B;  5G5G A;  3AN1 A;  2OHF A;  3AE1 B;  4YSX B;  1N61 A;  1VDV A;  1OFF A;  3AE9 B;  5EE1 A;  3CWI A;  3AE2 B;  3VR9 B;  3AE7 B;  2K5P A;  1TYG B;  4N58 A;  3BII D;  3L4P A;  3AM9 A;  1KF6 B;  1TKY A;  2PIA A;  1RFK A;  2BS3 B;  2JQR B;  3AEG B;  2PKO A;  4ZOH C;  1FRD A;  1UWM A;  4P6V F;  4YSY B;  4HRS A;  3B9J A;  1FXA A;  4C7Z A;  1J7A A;  1GAQ B;  2BS2 B;  2BT6 A;  2K22 A;  3W5V B;  1ROE A;  1QOF A;  2WDV B;  3W9C B;  1WXQ A;  2G1E A;  4YTP B;  2BS4 B;  1QF6 A;  1SB3 C;  1XO3 A;  1OQR A;  2CJO A;  2WU2 B;  1JRO A;  3AMZ A;  4USA A;  1FO4 A;  1WWT A;  1QT9 A;  1XLQ A;  2WDR B;  3DWM A;  3AEB B;  1OQQ A;  2PVG C;  4ZHP A;  1B9R A;  3HRD D;  1A70 A;  1KRH A;  1NI3 A;  3AV8 A;  2CU3 A;  4US8 A;  1I7H A;  4N59 A;  1E10 A;  4ITK A;  4WQM A;  3AE4 B;  3NVV A;  1ZP0 B;  1ZOY B;  4A9A A;  1RM6 C;  1L5P A;  1J7C A;  5GXG B;  1CZP A;  5MPO A;  4JWU C;  4IDI A;  1PFD A;  2WQY B;  3AEF B;  1GPX A;  1FIQ A;  2W3R A;  1EWY C;  2L83 A;  3FC4 A;  2AX5 A;  2EKI A;  1PUT A;  2DBY A;  1E7P B;  4N6E B;  1N60 A;  1YQ3 B;  1DOY A;  1L0V B;  4YT0 B;  4YXD B;  3DWG C;  1FFU A;  1N5W A;  3CIR B;  1XLP A;  1E6E B;  4HRO A;  4C80 A;  1JQ4 A;  1IUE A;  4YTM B;  3NRZ A;  2N0S B;  5H8Y E;  1RWS A;  2MH7 A;  1RYJ A;  2WU5 B;  2Y5C A;  2L52 A;  1NYQ A; 
#chains in the Genus database with same CATH topology
 4C8O A;  2XY7 A;  3ZW3 A;  4JWS C;  3NZU A;  4UAS A;  2JZB B;  2K8B B;  2AH5 A;  4IRK A;  2ASL A;  7ICM A;  2W3S A;  3DVN V;  4LK0 M;  5AUK A;  1Q3V A;  2MP2 B;  1MSW D;  3WKA A;  3D6J A;  3Q8R B;  1A76 A;  4LZG A;  4O1N A;  5J0O A;  1SJE D;  5KHO A;  2ZW1 A;  4QZF A;  5ALN A;  3Q3O C;  2R8G A;  3RNE C;  2Y0S C;  5E6N A;  4BKS A;  2JXX A;  2KHQ A;  3C0R B;  2JEJ A;  4HK2 A;  1ZQZ A;  4R3D A;  2LI6 A;  3TSS A;  4KDI C;  4JWM A;  5DBA A;  1NJY A;  3V6H A;  2AJQ A;  5CHG A;  1EM7 A;  4J9N A;  5BYQ A;  3PW7 A;  4L2Y A;  1DGS A;  2HJ1 A;  4ECV A;  3KVF B;  2KIW A;  1WWV A;  2KWV B;  1TZ1 A;  3FM9 A;  4PL2 A;  1RQN A;  4ECX A;  4G3I A;  3ML8 A;  3A9J A;  4O3M A;  3I3T B;  2D07 B;  4PK1 A;  3RH4 A;  1X1M A;  1QZE A;  2X38 A;  4NY8 A;  5IP4 D;  4RQ4 A;  7ICU A;  2IPK D;  4DF4 A;  5IOI A;  4TMA B;  4I6L B;  4LZD A;  3Q8M A;  3S6J A;  1C78 A;  2V3N A;  1U9L A;  1QOA A;  4KLO A;  3LDZ E;  3QWZ B;  2ZEQ A;  5G5G A;  2LYH A;  4Y2Y A;  3IAS 1;  4EBE A;  1N61 A;  2IGG A;  2LMR A;  3PX0 A;  1S10 A;  4GC6 A;  2KDE B;  3AE9 B;  2AQ3 B;  4OHJ A;  4XX5 A;  3U7D A;  2OJW A;  4RQ1 A;  2KDM A;  1KLV A;  4MHV A;  3VC8 A;  3Q8L A;  3MR3 A;  5CA7 A;  3HJE A;  3SAG A;  2FAZ A;  4I28 A;  1F52 A;  3T5H A;  3ZRF A;  5J2D A;  5KFU A;  4W9G A;  2M8S A;  1NK0 A;  2BT6 A;  4JB3 A;  8ICF A;  1S97 A;  3RB6 A;  2OXO A;  3TAP A;  4PHD A;  4W9I A;  4KN7 A;  3JPS A;  2BGF A;  4QZB A;  4AYB C;  3I9V 1;  5AK5 A;  4DOB A;  1NK8 A;  4E71 A;  5ALF A;  4XWT A;  1F2R C;  4GB9 A;  4ECU A;  4ZHP A;  1TY2 A;  4CDG A;  1NI3 A;  3RI7 C;  1F44 A;  2W82 A;  2LM4 A;  4ITK A;  7ICS A;  3N30 A;  1SZH A;  3O65 B;  4NLK A;  3NHE B;  3L0W B;  4I6P A;  2FE9 A;  3M6Z A;  2JZP A;  1YNT E;  3RR7 A;  3C28 A;  5TR5 A;  3PMN A;  8ICJ A;  3WK4 A;  5KFI A;  4ED7 A;  3TI0 A;  3A0H U;  2EKI A;  1D5X C;  4KGR A;  1WRD B;  3RJF A;  3RAX A;  1KBU A;  2KFZ A;  3DHI C;  1SL2 A;  1E90 A;  4K3B A;  3TMP B;  5AM5 A;  2J53 A;  4GGQ A;  1AW7 A;  5J0U A;  1NZB A;  2BQ3 A;  3G6V A;  2M0X A;  4TKN A;  2J6U A;  4KLQ A;  1F5S A;  2JR5 A;  1E5W A;  1XD3 B;  2LUM A;  4HCP B;  2A1J A;  4EUT A;  9ICB A;  1ZXI A;  3AEE B;  9ICX A;  4AJW A;  2MJE A;  2EMS A;  5J17 A;  2KC2 A;  3V62 A;  1BPZ A;  5EE9 A;  2WNM A;  2HW3 A;  1PDX A;  3RBD A;  1M4V A;  4FAD A;  3J9C A;  4MGZ E;  5C0Y A;  3MJ5 A;  2JEF A;  2WFA A;  4DOA A;  2L8J A;  3V6E B;  4DXA B;  4NLB A;  1NK5 A;  3BS5 B;  2BPF A;  4MEY A;  1KKX A;  1YQB A;  2RGF A;  3APC A;  3ML9 A;  3PZD A;  3I28 A;  5AM2 A;  4FS1 A;  3KKA C;  4KLF A;  4J3O D;  1SJH D;  2I1Q A;  4IRC A;  2D3G A;  3KW5 B;  3GIM A;  3QIJ A;  4RUC A;  3GQC A;  1RLF A;  3MGI A;  4HPL B;  3UF8 A;  3TAD C;  1BPX A;  2OH2 A;  2QDF A;  4YVZ A;  3DHH C;  1S3S G;  3KKA A;  5ALE A;  4ANV A;  1ZRM A;  2W9B A;  2KSO B;  4ED8 A;  1J2N A;  2R61 A;  4KLU A;  4OVU A;  4B95 A;  2XK5 A;  4UB1 A;  4JLC A;  3JPP A;  1XF5 L;  4OJ6 A;  2HDO A;  3V6J A;  2PTL A;  5AM3 A;  3V72 A;  1SGH A;  1QLB B;  3RJH A;  1FM0 D;  2LRW A;  2E8M A;  1TTN A;  3P1M A;  4WJN A;  1Z19 A;  5AEK B;  3HT3 A;  4QZ8 A;  2KFJ A;  1YJI A;  5J0W A;  1WXA A;  2JWU A;  3VFK A;  3T79 A;  2W7P A;  4LJO B;  2HOF A;  4AUQ C;  4ECS A;  4M9L A;  4W9D A;  3AN1 A;  1TK8 A;  2FLN A;  2PI4 A;  7ICJ A;  5HP4 A;  9ICK A;  2IYD B;  4QJF B;  3H7P A;  1MA7 A;  1GUA B;  2NO4 A;  4PHE A;  3TAN A;  1FNV A;  2Y9U A;  2OYY A;  2ATL A;  4J9M A;  1A5R A;  1AN8 A;  4P6V F;  3L13 A;  4P1C C;  1ZQL A;  4C7Z A;  3N9Y C;  3PRE A;  4P4P A;  2LVO A;  3WKB A;  4YTP B;  4FJY A;  1TFR A;  2KO3 A;  4UB6 U;  3ZI4 A;  4CRX A;  3HK0 A;  1NZP A;  4ED3 A;  1L8O A;  3B08 A;  1T8E A;  5III A;  4KVG B;  2JHD A;  2EQY A;  5IIO A;  5KFN A;  2L00 B;  2MHJ A;  4US8 A;  4QZD A;  4YL8 A;  4DQS A;  3PO5 A;  3V6C B;  3E58 A;  5KNI A;  2CHX A;  2ZCB A;  1FIQ A;  4F91 B;  2ZJ8 A;  3NS8 A;  1ZQW A;  3UGB B;  7ICH A;  1NBF C;  4DXF A;  4A8E A;  4KKJ A;  1E8W A;  2KZR A;  1D8B A;  1OXJ A;  5KFJ A;  1SXT A;  3CIR B;  1O08 A;  3MDA A;  2M1M A;  2HI0 A;  2ISO A;  2NBU A;  5H8Y E;  1RYJ A;  1XXG A;  2WXP A;  4FFD A;  2HBL A;  4XRH A;  2MBO A;  3BQ1 A;  5LXH A;  3ZGZ A;  2L52 A;  3TCA A;  4JUZ A;  1AAR A;  1NKB A;  3KUD B;  1GB4 A;  2FUG 1;  3TKA A;  2PFN A;  4F92 B;  2B76 B;  1JWA D;  3HIZ A;  3K9O B;  1YZ6 A;  1TAU A;  2K4H A;  8ICL A;  1FEH A;  2DNF A;  5AI5 A;  4X5V A;  3GZN I;  2MSE D;  2C7M B;  4LNF A;  4NJ6 A;  5EWG A;  2MU2 A;  4DL4 A;  2NPT A;  4PYU A;  1UA1 A;  1N5X A;  2JZB A;  2GO7 A;  4DL2 A;  1DYQ A;  1WXV A;  8ICV A;  2K8B A;  3D32 A;  3H7I A;  5ALK A;  1CQV A;  2WXK A;  2C2R A;  4JV1 A;  4F4Z A;  4BDP A;  3SHQ A;  3UI3 A;  3Q8S B;  1D6E C;  1GJZ A;  4PGQ A;  4DWI A;  4LJP B;  2L32 A;  2WF9 A;  1VD2 A;  2XNA C;  5KFF A;  2LKY A;  4YR0 A;  2Z59 B;  4M8M A;  4BWJ A;  5B66 U;  2REX A;  2RP5 A;  4MT5 A;  5C3J B;  1IXR A;  8ICG A;  4EX7 A;  1ZPS A;  5AI9 A;  1ZW7 A;  5DLF A;  2KMM A;  4P0P A;  2DYM A;  4URK A;  3OTQ A;  1FMA D;  2CN1 A;  2WP9 B;  1KTQ A;  1R4N I;  3I63 C;  3QXG A;  1NJZ A;  5J0Q A;  3LYS A;  2XC9 A;  1KRP A;  1NJW A;  2QEJ C;  3SV3 A;  4FJZ A;  3M9M B;  4ASW C;  3WK8 A;  2KDB A;  2ZUD A;  2PE6 B;  4DSE A;  2EAP A;  3JPO A;  3THV A;  4KLS A;  4GXI A;  4GXB A;  3C8Y A;  3OJS A;  3E2E A;  5E6O A;  3MFH A;  2DGZ A;  4MEM A;  2E8O A;  1BPB A;  3UIP B;  4A3P A;  4DWF A;  4QZC A;  4KLD A;  5F9N A;  4ZRK A;  3B0Y A;  1VDV A;  3C29 A;  3K75 D;  2R2O A;  4YSX B;  3LVW A;  3AE2 B;  5L1J A;  2K5P A;  3B0X A;  2KJ6 A;  4M0W A;  4KX3 A;  2HHU A;  1Q46 A;  1L5U A;  4UBC A;  8ICE A;  1IPG A;  3AEG B;  1P3Q U;  1D3Z A;  3TQ1 A;  4QZH A;  1NJX A;  4YR3 A;  2WB1 F;  5T8I A;  3EEC A;  5DLG A;  4YCX A;  4BKT A;  1QF6 A;  4F2R A;  2FNJ B;  1XS9 D;  4F93 B;  5J18 A;  4LDT D;  1MC8 A;  2HHT A;  2OED A;  1FD6 A;  2IO0 B;  2HHX A;  2MBH A;  3EPG A;  4PGY A;  1SBB B;  3VAW A;  1PK1 B;  2JH1 A;  1UD7 A;  5D94 A;  5AKE A;  1L4D B;  2A1A A;  1S9F A;  4DL6 A;  1RM6 C;  3UMG A;  1C7Y A;  4F4W A;  1SGG A;  4HEA 1;  1GPX A;  4TQR A;  2VA2 A;  3RH5 A;  3NG0 A;  2K60 A;  3Q3M C;  4M47 A;  2N1V A;  2DPI A;  2N9K A;  1N60 A;  2JXT A;  3PHX B;  2JXJ A;  1YIW A;  4GIV A;  4B6W A;  2AL3 A;  2FE8 A;  4ZRJ A;  3PV8 A;  5KFT A;  3H40 A;  2PJH A;  3NRZ A;  2PMZ C;  9ICG A;  2MH7 A;  2N0S B;  1XQQ A;  2BPG A;  4P7I A;  3L54 A;  3ZJV A;  4OZB A;  1NKE A;  5KFA A;  2LMC A;  3WK5 A;  5KT5 A;  4KZC A;  1X42 A;  4F4Y A;  1S77 D;  2C28 A;  2GBN A;  4J9Q A;  4L23 A;  2KQ4 X;  2N4F A;  3IM1 A;  3IG8 A;  2WXH A;  4RPZ A;  1D8L A;  1JRP A;  2FMQ A;  4QAY A;  2VAN A;  5KG0 A;  3BS7 A;  2MW5 A;  1XCQ L;  2KK8 A;  2FCM A;  4IL6 U;  1JAL A;  1YX5 B;  2KX0 A;  4A8X C;  3SYZ A;  5DB7 A;  5AM0 A;  1U4B A;  3DVG X;  2ISP A;  3T3F A;  3SAF A;  1YQ4 B;  4J9R A;  2ZIU B;  2GH1 A;  3BS5 A;  2WWZ A;  5BOL A;  4IOI E;  1PGA A;  4FA6 A;  1T3N A;  3QEB Z;  1QH9 A;  4OO1 J;  5G55 A;  3SV4 A;  1KFD A;  3BJY A;  1S76 D;  2MX2 A;  2ZG6 A;  4DOC A;  5BPC A;  2RDB C;  1LV5 A;  2KQS A;  4F5O A;  2K8A A;  3H0R B;  3ZNG C;  2D6F C;  4JV2 A;  1YJJ A;  1UT8 A;  3GDX A;  1C1Y B;  4UDU C;  2JEI A;  4ECW A;  4Q45 A;  1NKC A;  2HHQ A;  3C23 A;  3C1Y A;  5KG5 A;  2KSO A;  3OJ3 A;  2QIL A;  1WRI A;  1Q10 A;  2DKX A;  5KFR A;  1JW9 D;  4I2F A;  4DDG D;  4I2B A;  4RF1 A;  2WS3 B;  1NYR A;  5D3I B;  4XGA B;  1LKY B;  3F5E A;  2AQ0 A;  2VH1 A;  3PV1 A;  3K9P B;  2OHF A;  3Q6B A;  5JH5 C;  2AQ2 B;  9ICH A;  3CWI A;  3HP6 A;  3N3K B;  4OW0 A;  3CW2 C;  4DHZ E;  3TBL D;  1S5L U;  3AM9 A;  4IM2 A;  4I2J A;  2CRX A;  4IQU A;  3HWT A;  2XI9 A;  4ANW A;  4DSF A;  3K1Z A;  3MC8 A;  3MFG A;  3LJ3 A;  5DBB A;  2MRL A;  1ZJN A;  3HKZ C;  2G1E A;  2LAS A;  3A4R A;  4HVB A;  5C1Z A;  4LVS A;  1OQR A;  1JI7 A;  3DBS A;  3Q3F A;  2BF8 B;  2YQE A;  2F1I A;  5L1I A;  4ANU A;  5KT3 A;  5E6P A;  4ACF A;  5ALM A;  1NNL A;  3ISC A;  4FHK A;  3CYM A;  5J2F A;  4CQN A;  4TUP A;  1M94 A;  3VCB A;  4U6P A;  4WAF A;  4KKI A;  5DPT A;  1PUT A;  4EZ9 A;  4DL5 A;  4YFK A;  4AS1 A;  3DBH B;  1I4R A;  3DBH I;  2N9L A;  4NQK E;  2F3N A;  3GV8 B;  2Y9T A;  5HR6 A;  2BKF A;  9ICV A;  1Y56 A;  3QC8 B;  1L7P A;  2K25 A;  3AU5 A;  1V2Y A;  4MEL A;  4KLM A;  2LVP A;  1ZET A;  3VXW A;  3N1Y C;  4HDO A;  2WXN A;  2A4Z A;  2IO3 B;  2HTM E;  2KN4 A;  3NUH B;  2MQJ A;  2KD1 A;  1JWB D;  2XGQ A;  1TK5 A;  2J0M A;  1K51 A;  5AKZ A;  1UBI A;  2F1J A;  4UAU A;  4CYE A;  2A3V A;  1WJ4 A;  2H5X A;  4NWI A;  5J0P A;  2BZF A;  2WXQ A;  2V9W A;  2H3V A;  2NBV B;  3QQ8 B;  3ZDM C;  3QAR A;  2NR2 A;  2FMS A;  4ZHO A;  1TKD A;  2UU7 A;  2GB1 A;  2NYV A;  3O0F A;  4DSJ A;  1UQV A;  1J8C A;  3GB1 A;  4YTN B;  3WAL A;  4C8L A;  1ZE3 D;  2EZY A;  1NI2 A;  5KFB A;  1QSY A;  3G6X A;  2QCZ A;  2MAX A;  3SI8 A;  3ZJT A;  3MR2 A;  3TJP A;  1OW5 A;  1HZ5 A;  4Y2X A;  5DKW A;  3WK6 A;  1KW4 A;  1FEZ A;  4J9L A;  4ECR A;  1XLO A;  2KVR A;  8ICX A;  2Z0E B;  1ZDV A;  9ICN A;  3V6K A;  3ENE A;  2G07 A;  9ICS A;  3PY8 A;  7ICO A;  1T3Q A;  4MSQ B;  3OG5 A;  1TKE A;  2KTF A;  2WXM A;  3BVZ A;  2M56 B;  2W7O A;  2WGS A;  1DOI A;  3X0W A;  3TAC B;  4DLE A;  1QIL A;  3BQ7 A;  3PRP B;  3NGD A;  2Q4T A;  1RDF A;  2FCS A;  4NNJ B;  4KIT B;  1KJT A;  3NUQ A;  5KG1 A;  3HM3 A;  4RNA A;  2KDF B;  3GFK B;  3QX1 A;  3RUI B;  1WWU A;  2O2V A;  1TKY A;  4GLS C;  4IG7 B;  1EU3 A;  3DBR I;  2KEY A;  2ZTD A;  4RGO S;  2JPH A;  5C23 A;  2J7Q B;  4YN4 A;  4WIP A;  3TEZ A;  2D3D A;  2R2Q A;  3L17 A;  1FXA A;  2R8K A;  1GAQ B;  2EDU A;  4C8K A;  5KT4 A;  2GLS A;  1TY0 A;  5GMV A;  4OZC A;  4W9J A;  1BGX T;  1T0Q C;  1ZQY A;  3WKE A;  2DYO A;  1UGJ A;  4AQ7 A;  5AIB A;  1FO4 A;  2LJ5 A;  2WDR B;  5AHX A;  2WXI A;  1B4F A;  3N7P D;  3HRD D;  3DVN U;  1Z4N A;  2QSD A;  2RQ5 A;  2YMM A;  2ZVN A;  4GFJ A;  4O3P A;  5KFG A;  4F5Q A;  4FO6 A;  2FJ6 A;  4JWU C;  4XE0 A;  4ICA A;  9ICQ A;  4NLN A;  1MFW A;  3DV9 A;  1ZQX A;  3ZRC A;  5ALH A;  8ICM A;  2AEH A;  8ICR A;  4UAT A;  1GC7 A;  4EEW A;  5EWE A;  3JPT A;  1GNU A;  2BCU A;  4RNM A;  2FDR A;  1OUQ A;  1T94 A;  2J6T A;  2GLE A;  2D8C A;  3PSI A;  1L3T A;  2Z7J A;  5HHH A;  3H1U A;  2X8X X;  1TAQ A;  5ALS A;  1HTO A;  2V3P A;  2MRP A;  4C8M A;  2OJR A;  4TV3 A;  2WDQ B;  2WLB A;  3RPF C;  5TSS A;  5IIM A;  2IND C;  2EEL A;  5D2M B;  3QJZ A;  3PZ8 A;  4I2H A;  3B0A A;  4QWB A;  7ICL A;  5EE0 A;  2AGP A;  1SKW A;  4W9L A;  2ALZ A;  2Z8L A;  2QJL A;  2LHT A;  1FFV A;  2Y0S F;  1PVQ A;  2ACZ B;  2WXF A;  4GOC A;  4E74 A;  3RZW C;  4IR1 A;  3NS1 A;  7ICF A;  2KVC A;  3R7Q A;  1XLN A;  4B9V A;  1ZQH A;  3AH7 A;  3CMM B;  1VRA B;  5HFY A;  2WXR A;  3VTU A;  4C56 C;  4KLG A;  2JYT A;  4K7U A;  2Q5W D;  1DOQ A;  5AKY A;  2QHO A;  1YMH E;  1Q1O A;  4KX6 B;  4QW8 A;  2DL0 A;  2YB1 A;  2RR9 A;  3P4Q B;  2KIV A;  5AKL A;  1WM3 A;  1WE6 A;  4M9G A;  3U52 E;  3CNH A;  4Y2Q A;  1TJE A;  1C76 A;  4DHJ D;  2ZIU A;  4FE3 A;  1MVK A;  1WUD A;  2WX1 A;  4RQ7 A;  2MBB B;  4KIK B;  1GOZ A;  2C5L C;  3IT6 B;  2KAJ A;  2ZIX B;  1L6U A;  2JWZ A;  4NM2 A;  1F0Z A;  3ETL A;  2KJ9 A;  1TE2 A;  4RNN A;  2LFI A;  2KIC A;  3PO0 A;  5TZV A;  3PSF A;  4ACO A;  1ZQD A;  1HE8 A;  4HWI B;  1X9X A;  2HTH A;  3FIL A;  4CHK A;  2Y1I A;  1WJ6 A;  3GP7 A;  3X23 A;  1D4B A;  3WK7 A;  4BUG A;  1TV9 A;  4MEX A;  4AJY B;  1SWV A;  1V9J A;  4PJ0 U;  4US9 A;  3KYC D;  2ZUC A;  4BX9 C;  5KG6 A;  2PXI A;  1Z00 B;  3MGV A;  3JSV A;  2FPK A;  4K4I A;  2DF4 B;  2ZUB A;  3DHG C;  1L7M A;  1LKY A;  3BIN A;  3R9K A;  2N7E A;  3GII A;  2IGH A;  1ZQM A;  4AYB F;  4YD1 A;  4B9M A;  1UWM A;  1ZD4 A;  8ICP A;  3MTN B;  4M02 A;  3QU4 A;  4EZL A;  3LDA A;  3NZ3 A;  4Y2R A;  2K22 A;  3W5V B;  1KDH A;  2KOX A;  3W9C B;  2G5I B;  1WYW B;  2VRR B;  5D4B A;  1RXW A;  2HBM A;  3R7R A;  1XO3 A;  4XDC A;  5D49 A;  3C19 A;  4F7Z A;  1JRO A;  2KNJ A;  3BZC A;  2LJI A;  4DFJ A;  2KVS A;  5K4L A;  9ICO A;  2ZJA A;  2YLM A;  3NY5 A;  5EOZ A;  4KLL A;  1PGB A;  3KD3 A;  2LBO A;  2G09 A;  4M9N A;  4O3R A;  2F8K A;  4A55 A;  4IWQ A;  5KFY A;  1SE3 A;  3SDL C;  1CZP A;  1FCL A;  4PL1 A;  5J2I A;  2CS4 A;  4II3 B;  1JXE A;  3V60 A;  4ELU A;  1OGW A;  4TUS A;  3IFW B;  1F0M A;  2KJR A;  3IRU A;  3A9K A;  3LK9 A;  2WF7 A;  1ZQP A;  1ZGU B;  1K5O A;  1WH3 A;  2IMW P;  3LWM A;  5C5J A;  2E6X A;  4NLZ A;  1JQ4 A;  4YR2 A;  4G3X B;  5F3X B;  3MBY A;  2KZ3 A;  2WX0 A;  1IM4 A;  2O6V B;  3EYZ A;  2RPQ A;  3AU4 A;  4WWM A;  3NTU A;  2OEH A;  4A20 A;  2OCE A;  4I2C A;  2KJ8 A;  2WXJ A;  4FBJ B;  1SWW A;  1X9S A;  3VUX A;  5ALI A;  3ONN A;  4JL9 A;  3BDP A;  4DLG A;  1RPL A;  4RQM A;  1N62 A;  1S0M A;  4JK1 A;  3ZKJ C;  1OQY A;  1QSS A;  4BXO B;  1UBQ A;  3NOB A;  1FRR A;  2C7H A;  3Q8A A;  2KTR B;  2V4R A;  2ZW0 A;  4R65 A;  3WU2 U;  4UBB A;  4YQW A;  3TEX A;  5IN7 A;  2K0P A;  5D46 A;  5ALQ A;  1ZQI A;  1HJP A;  1V80 A;  2BHN A;  3NRW A;  3L3F X;  3PST A;  2RMM A;  1FCC C;  2IY0 B;  4F5P A;  4DSI A;  5J0X A;  3RFA A;  5H92 C;  4C8N A;  1EF1 A;  2M4N A;  3M63 B;  4RF0 A;  2MUT B;  3BYT B;  3ZLZ A;  1L7O A;  4G50 A;  5CJ7 A;  2IOH A;  4C7Y A;  5H2F U;  2KJH B;  2KHV A;  1EU4 A;  4ECT A;  2KHW B;  2HOQ A;  3GS2 A;  1V86 A;  2JF5 A;  4BFR A;  1S0O A;  4WQO B;  2K1F A;  2MJ3 A;  1KFT A;  9ICA A;  2PVO D;  3U2S C;  2QB1 A;  4J03 A;  1Z3E B;  2D2Q A;  1RZT A;  2JX5 A;  3AE6 B;  1ZYQ A;  4P2H A;  4QZA A;  2RLT A;  2BCR A;  2KK0 A;  2V3S A;  3T5K A;  2JMG A;  4NJ8 A;  4OD0 A;  3GE3 C;  5ALG A;  3QUC A;  1SXD A;  4GDL B;  1MHH E;  3ZXR A;  3PW0 A;  3PRZ A;  2DAF A;  1TS5 A;  3KOO A;  3JPR A;  4HDQ A;  5ALL A;  3MJW A;  2JY6 A;  5HML A;  2FCQ A;  5ALU A;  1ZKH A;  3BK2 A;  4WJQ A;  3ISB A;  3B9J A;  2WYQ A;  2BS2 B;  1JWU D;  1XWL A;  4PS7 A;  2I1J A;  4Q8E A;  1V9P A;  3MGH A;  2JGA A;  3QEA Z;  3N4M B;  3DOW A;  5D7G A;  3M6K A;  1JWM D;  4LCD E;  3ZXV A;  4PS3 A;  4BZA A;  4TQ1 A;  3F53 A;  4R66 A;  4W9K A;  1X66 A;  4Q44 A;  1K52 A;  5D3D A;  2XEW A;  3GOE A;  1L3S A;  2KDI A;  1XSL A;  5IIJ A;  2KXJ A;  2L05 A;  1ZOY B;  1TS3 A;  4NPN A;  3IHP C;  1XSP A;  2AGO A;  4M04 A;  4DBG A;  4O5C A;  1N48 A;  2W3R A;  2JUO A;  8ICK A;  1MJD A;  5AK4 A;  1L4Z B;  4QWD A;  3IT4 B;  3M9O B;  2DAJ A;  9ICU A;  1V1O A;  2LHD A;  2L0F A;  4RQ8 A;  1FFU A;  4ECQ A;  1N5W A;  2F1H A;  4MF2 A;  3APF A;  3MFI A;  2W9C B;  1XC9 A;  5EWF A;  2WU5 B;  9ICJ A;  4L1B A;  3QU9 A;  1ZQR A;  3PTF C;  3RJG A;  1QLN A;  1NYQ A;  2G4S A;  4NZL B;  4F72 A;  2IO2 B;  2QB0 A;  5ALT A;  1WMH B;  4DCC A;  3AQE A;  1TIF A;  2P6U A;  2WXO A;  3H9D A;  2V4Q A;  1ZQE A;  4FXC A;  1HTQ A;  3HHM A;  3PO4 A;  1D9F A;  1YJ1 A;  4OJL A;  4UB2 A;  1LGR A;  1YN5 A;  2INN E;  2BQR A;  2YVC A;  3MC9 A;  1SE4 A;  4BVU C;  1CRX A;  1WGD A;  3PRM B;  3SU8 X;  3NVZ A;  1ZQG A;  3KZX A;  5ALZ A;  3A1Q B;  2KZM A;  3DPD A;  1SV4 A;  3OJ4 B;  2MLB A;  2YEP B;  3WAP A;  5TIS U;  5KFE A;  1TS2 A;  3E0F A;  3IAM 1;  4Y2S A;  1ZUD 2;  2G0A A;  4YWG G;  3ALR A;  2BPC A;  4OJP A;  4CO7 A;  3GU3 A;  1VJK A;  4GU2 A;  1Y88 A;  2YB4 A;  2ICI A;  3OPX A;  3TL5 A;  3RUL A;  3C5F A;  4F8R A;  1AWD A;  2XID A;  1QOB A;  1WYG A;  2QAR B;  1IG6 A;  2BYF A;  1R7S A;  3BY4 B;  5CX3 A;  3PR5 B;  2QKQ A;  1SZP A;  2NCN A;  4KTQ A;  2DWQ A;  4NAM A;  5EE3 A;  4W9C A;  3ZNH B;  3KZI U;  2MP2 A;  2G9H D;  4IR9 A;  2NRW A;  3N7R C;  2ZIX A;  4MGI E;  2JVC A;  4KZ0 A;  1FXI A;  3AUO A;  5FKA C;  1E8Z A;  2NBW B;  2G06 A;  4RFB A;  3AI5 A;  1BNO A;  1KSP A;  4MM3 B;  4CNQ A;  2YMQ A;  5KG2 A;  3R2I A;  1GC6 A;  5JZE B;  1OFF A;  5DB8 A;  1D5M C;  5J2R A;  9ICP A;  5DG7 A;  3PPA A;  3Q69 A;  4N58 A;  3EFC A;  4NJ7 A;  5EDS A;  2NV3 A;  1RFK A;  1N56 A;  1HQR D;  4KSK C;  1I4P A;  2PKO A;  2ZNV B;  5J2H A;  2IZV B;  3E9S A;  2Y5P A;  2CXY A;  4BGD A;  1J7A A;  4EE2 A;  4TQ0 A;  1QOF A;  8ICT A;  3R3M A;  4M9H A;  2V4I B;  5KG7 A;  5DQI A;  2PFQ A;  1SB3 C;  2K8C B;  5G2N A;  2WF8 A;  1X2I A;  1QQ7 A;  1XLQ A;  4G0N B;  1K50 A;  4IM0 A;  5AK6 A;  2PVG C;  5BMI A;  2NTS A;  1V38 A;  1ZQT A;  1KRH A;  3GV7 B;  1VCB A;  3QU5 A;  3AEV A;  4QIW C;  2BGW A;  1EO6 A;  2KJ5 A;  1GO3 F;  2KMC A;  3GIL A;  2ZVO A;  1J97 A;  1PVP A;  1SE2 A;  3QHT A;  3MAB A;  1ARO P;  2EAO A;  2E8N A;  2PMZ F;  5JTI A;  8ICN A;  4UAV A;  3U26 A;  2E1E A;  2FMP A;  3A0B U;  2M0A A;  3ZJU A;  5E79 U;  5AK3 A;  1YN4 A;  2D11 A;  2WF5 A;  2DYB A;  4FJV B;  3URY A;  3R2T A;  1SSN A;  4HRO A;  3MDC A;  3H6N A;  3WAM A;  1UWX A;  1RWS A;  4MDK E;  5KG4 A;  2V9H A;  4HJK A;  4DQQ A;  2KYW A;  5BYR A;  2Y3A A;  2LXC A;  3UIO B;  1E7U A;  3AU2 A;  1MI0 A;  1XEE A;  2BTE A;  4M0A A;  2SEB D;  1R4M B;  1R4M I;  1ZD2 P;  2L7R A;  4EYI B;  2HMX A;  4B9L A;  3P63 A;  3P4P B;  2RPV A;  2H89 B;  2HDE A;  3N20 C;  4IC9 A;  4MH8 A;  2D3C A;  4NLC A;  4RQ2 A;  1T4G A;  3F5A A;  1KL9 A;  2M0N A;  2R8I A;  2NO5 A;  2R8J A;  2BWF A;  4NJC A;  1TVA A;  5IIL A;  3UMC A;  3RJI A;  3PW2 A;  2WHI A;  4M01 A;  1KFS A;  5AI0 A;  1RFA A;  1T0Y A;  4I2G A;  4RM9 A;  4ED2 A;  3W1Y A;  4WJ3 B;  1K8R B;  4R64 A;  5HR7 A;  3QZ7 A;  5T14 A;  2INC C;  2GBM A;  3EFU A;  2AU0 A;  1BUI C;  5DGB A;  5L1L A;  5HI1 A;  2ZCC A;  4BXO A;  2RDH A;  1NVI D;  3PLV A;  3L16 A;  2HHW A;  2CR5 A;  4WH4 A;  1UUP A;  2KLG A;  1TK0 A;  3VVW B;  2NTT A;  2GWS A;  4DSL A;  5BO4 B;  3VTV A;  3BQ0 A;  2DZK A;  4PPX A;  2BB5 A;  5CTR C;  2BQU A;  3WA0 A;  1SXE A;  4ED0 A;  1TKG A;  4P16 A;  1N2X A;  2BDP A;  3T9L A;  4JX1 C;  2Q0Z X;  2RRD A;  4PH5 A;  3H4D A;  1U49 A;  2LI5 A;  3IBE A;  2D10 A;  1VZ8 A;  3ALB A;  1QOG A;  1J7B A;  3MR5 A;  1B0X A;  4DF8 A;  1WGH A;  2HOI A;  2PI5 A;  3IN5 A;  2ONQ A;  8ICZ A;  4GXK A;  3C2K A;  4NL9 C;  5KFL A;  2ZIV B;  4J9O A;  5EE1 A;  4EZK A;  2J52 A;  2K39 A;  1MPE A;  5DB6 A;  3EWA A;  1NK7 A;  5AI4 A;  1DK3 A;  9ICT A;  1PGX A;  5JRT A;  4A6Q A;  3V61 A;  3HKZ F;  3OHA A;  8ICC A;  2BS3 B;  4B0E A;  4J9P A;  4TUU A;  2CPR A;  4YSY B;  4NL9 A;  2J0J A;  4DXG A;  3MP9 A;  3U8Z A;  4I2I A;  3BVG A;  3K4G A;  1WXQ A;  4NLG A;  2C22 A;  5KFO A;  4B9K A;  3RB4 A;  3MHZ A;  5DPS A;  2I2Y A;  3PR4 A;  4HCN B;  5AIA A;  2F44 A;  1DXS A;  2J0K A;  5LXI B;  2HVH A;  2NS5 A;  2KTQ A;  4EEK A;  5DDM A;  2KOB A;  3ZDB A;  5KFV A;  2UYZ B;  3SD5 A;  1V5T A;  4WAA A;  4C4V B;  1J7C A;  5MPO A;  1ZQJ A;  3AQF A;  3PLU A;  4AWJ A;  5KFM A;  3F2D A;  1MQ2 A;  5FR3 A;  4P1B C;  9ICL A;  2AX5 A;  1B1Z A;  4UAZ A;  3JW0 X;  1E7P B;  4N6E B;  5ALV A;  4DFD A;  2P6R A;  3GIK A;  5KHQ A;  4YXD B;  3DWG C;  4DS5 A;  3V05 A;  4YMN A;  4C00 A;  3UQ0 A;  1JN3 A;  8ICU A;  3ZDT A;  4DDI D;  4RGM A;  4KSL C;  1HEZ E;  3RT3 B;  4PT5 A;  4NXZ A;  2VH2 A;  3P42 A;  1B22 A;  3WKC A;  1CMX B;  4QNL A;  4F4K A;  2W54 A;  2DZI A;  2RD0 A;  4RQ5 A;  4W9F A;  1KTK A;  9ICI A;  2QLT A;  4UAY A;  4YMO A;  2KNB A;  2ASJ A;  1BXT A;  2MJD A;  4AP4 C;  3KFU F;  4HPM B;  5KAF U;  3F2C A;  2XO7 A;  5I4D A;  3AED B;  4ECY A;  2DFL A;  3KUZ A;  3KBB A;  3TIX A;  3HPO A;  5AKJ A;  1Z1V A;  1VZ7 A;  3KWL A;  2GRI A;  3ED5 A;  3QE9 Y;  5KFK A;  2WAQ C;  4PGX A;  4UB3 A;  5J2J A;  2KWC A;  3UXP A;  1CEZ A;  2EZX A;  5AIC A;  4E0D A;  5HG2 A;  4IC7 B;  3RNB C;  1WGR A;  5L83 A;  4P0Q B;  1AYF A;  3QA8 A;  4LDT B;  3TEY A;  1TBE A;  4QZ9 A;  8ICW A;  2GBJ A;  5DQH A;  5JHB A;  4ELT A;  5KFH A;  2L0T A;  2W9M A;  4XUS A;  4ZRP A;  2K3U A;  1S0V A;  2XN9 C;  1ZQU A;  1WX8 A;  1RYU A;  3GV5 B;  5DG9 A;  1E8Y A;  1LO5 D;  3AE3 B;  2LYB A;  2B6G A;  3NZS A;  1SV0 C;  5KL1 B;  5CHV C;  5AKX A;  3H8J A;  2V1Y A;  4ZDV A;  2IOF K;  4IKG A;  2IHM A;  3N28 A;  2F8L A;  4I29 A;  3LWL A;  4REZ A;  2ZTC A;  3OHB A;  2JZZ A;  4WJO A;  5ALJ A;  1UNS A;  2A1J B;  1SV0 A;  3IG5 A;  5L1K A;  3VHT C;  1ZXH A;  2I38 A;  3CRX A;  2CJO A;  3AMZ A;  1T7P A;  1ENF A;  5KT6 A;  1WWT A;  2JZ3 B;  3T8M A;  1OQQ A;  2MBE A;  3CSF A;  2KMA A;  2BQQ A;  4K4H A;  3PNC A;  2CU3 A;  3BWU D;  1E10 A;  1HUZ A;  1IIP A;  4OZA A;  2BKR B;  4ZH4 A;  1KLN A;  5AZF A;  3RB3 A;  4ZYS A;  4CF4 A;  5GXG B;  3RJJ A;  9ICW A;  4DQO C;  2NRV A;  4DEZ A;  5CRX A;  3QNM A;  4PZN A;  4F50 A;  2KQ7 A;  1WX7 A;  1PZN A;  2IY1 B;  4HLE A;  4FBT A;  4EOY A;  2J6S A;  3BZD B;  4YT0 B;  3GE8 C;  5AZH A;  8ICQ A;  1ZD5 A;  1QSL A;  1XLP A;  4GDK B;  2K6Q A;  2P35 A;  2INP E;  5CB1 A;  4YG2 A;  3SEN A;  2W9B B;  4MFC A;  4X57 B;  4OJO A;  5IO9 A;  4XZ4 A;  2LRU A;  1X9W A;  4LTU A;  2ES6 A;  2GOL A;  4F71 A;  2K9X A;  5L9X A;  1WR6 E;  3UQA A;  4XWW A;  1ZQQ A;  1WGG A;  3NJT A;  3T5J A;  1PK1 A;  3ZDA A;  1MN8 A;  2RDJ A;  1ZD3 A;  4GC7 A;  4PZO A;  5J29 A;  3Q8P B;  3OGU A;  3Q8E A;  3D2N A;  1LB2 B;  2JU6 X;  1D9D A;  3BZK A;  1UA0 A;  3P4S B;  3PGE A;  3IV6 A;  2W43 A;  2W9N A;  4KN4 A;  9ICF A;  3H7P B;  2AGQ A;  5J2A A;  1QQ6 A;  3Q8Q B;  3PW5 A;  3ZD9 A;  3NVW A;  2CHZ A;  2NVU I;  4MF8 A;  2HHV A;  2LWP A;  4WJP A;  4R8U B;  3PHW B;  1WGY A;  1CJE A;  2XIC A;  4P4O A;  3SMV A;  2BB6 A;  2FCN A;  4BAX A;  4B0M A;  1SE9 A;  4F1S A;  4KMO B;  1H8C A;  2EAM A;  2BBC A;  2K6D B;  1T5X D;  2MSN A;  4Z6E A;  1WFY A;  2W8L A;  3RNC C;  5L95 C;  2JSV X;  2IGD A;  4U7C A;  4HYK A;  1UGM A;  1SF0 A;  2FLP A;  1BVS A;  3CST A;  3H4B A;  2GI9 A;  2KT7 A;  1S8O A;  2OOB B;  1UH6 A;  4EZ6 A;  4FZL A;  3VR8 B;  2K4E A;  3ISD A;  2RDG A;  3ZUN A;  7ICN A;  3E56 A;  1I4G A;  2MBQ A;  3DBL B;  5KFZ A;  4IRD A;  3V7J A;  1JIH A;  4FN2 A;  2WHE A;  5JXV A;  2W8K A;  4EBD A;  4DQR A;  1K1S A;  3MR6 A;  3Q8K A;  2GBR A;  4BBN C;  4KX5 A;  5DQG A;  2G08 A;  1L3U A;  4DS4 A;  1O03 A;  5KAI U;  2KMD A;  2E5S A;  2PIA A;  4BOZ B;  2GOW A;  2XGP A;  1U48 A;  5IA7 A;  4QZI A;  4XDD A;  2DEN B;  2W11 A;  4UB8 U;  1WSP A;  2KKC A;  1MG4 A;  5ALY A;  2LGY A;  1UPH A;  2KKV A;  3KHR A;  2PEA A;  4KGT A;  2AL6 A;  1SKR A;  1YT3 A;  3KHL A;  2WDV B;  3O13 A;  1C79 A;  2R18 A;  3DCG A;  1IGC A;  2ASD A;  2KFK B;  2FUH B;  5IAA C;  3AU6 A;  4RT2 A;  2NPT B;  2XY5 A;  2BYT A;  1F9J A;  3M62 B;  1TT5 B;  3AV8 A;  3AL0 B;  3U4E G;  4D2K A;  1Z1B A;  3PVL A;  1BPD A;  5J0T A;  2VIX A;  5J8Y C;  2BCV A;  1K1Q A;  2DPJ A;  1XU4 A;  2I1K A;  3H8M A;  3IXS A;  4RGT A;  2JYE A;  5CWR A;  3C21 A;  2WQY B;  1X6I A;  3RJK A;  2WXG A;  3AUL A;  1QTM A;  4ICU A;  3A33 B;  3CF6 E;  4OVV A;  2L76 A;  4PYZ A;  5ALD A;  4F5R A;  4C4V A;  3LVV A;  3VH4 B;  5J8Y A;  3MC0 B;  4ZYN A;  3RH6 A;  4DQI A;  1YQ3 B;  5HMM A;  2XCP A;  4O3S A;  4P0P B;  4JE3 B;  2Y5C A;  3R66 C;  3PML A;  1KLG D;  2JV3 A;  3KH0 A;  1GB1 A;  4W9H A;  4LNN A;  3D2Q A;  1ACC A;  2LGI A;  3PT2 B;  5CEH A;  3HUI A;  4NV0 A;  4ZRI A;  3V3X A;  1ET6 A;  3ZNI D;  2PW9 A;  1BNP A;  3GIJ A;  1SIJ A;  4K4G A;  4NAW B;  4O3O A;  3K1R B;  1FPY A;  2DHZ A;  4CGZ A;  2KVZ A;  3FDS A;  2B21 A;  2OWO A;  1V97 A;  1IP9 A;  1ZJM A;  5E6J A;  3L08 A;  4QZG A;  2H3F A;  3Q8B A;  3ECI A;  2WXL A;  2N7J A;  5BMG A;  7ICK A;  1C20 A;  4R63 A;  2LD9 A;  3ZNZ B;  2DUY A;  1FNW A;  1MG8 A;  4K7W A;  3EUB 2;  4YD2 A;  2EAN A;  2JT4 B;  2ZIW B;  4JQW C;  4WWP A;  3B2F A;  1STE A;  1YOV B;  3PW4 A;  4M0W B;  4YXM A;  5D6J B;  4OCZ A;  3OSP A;  3RN9 C;  5J2K A;  3PSE B;  3T3O A;  1Z4O A;  3KLS X;  1DK2 A;  3HM6 X;  1C4P A;  1HZ6 A;  3IVF A;  3SR6 A;  4Y2J A;  4J6I A;  2V0G A;  4LNI A;  5AUI A;  2CHW A;  3RBE A;  2AXT U;  2E1F A;  4Z6F A;  3Q3N C;  5IIK A;  4I2D A;  3H8S A;  4FZM A;  3DDH A;  4S0R A;  4IS7 A;  2ASQ A;  2VZK B;  1E8X A;  3Q3J A;  2NMQ A;  4P0Q A;  1DOX A;  4I6N B;  3I76 A;  3RRG A;  3RTV A;  5JU5 A;  1S1Q B;  4YSZ B;  2KC1 A;  1AQ6 A;  4RCO A;  5FR6 A;  1D5Z C;  3KQ4 A;  2IJ0 A;  4Y2U A;  1JX4 A;  3N1Z C;  4A3O A;  5CHF A;  1TYG B;  2KD0 A;  4MJS B;  3TAQ A;  2L5Y A;  3I1Y A;  3L4P A;  1ZQO A;  1ZQK A;  2E8P A;  1IBX B;  5BMH A;  2JQR B;  3QYP A;  1ZQ1 C;  2W9A A;  4RM8 A;  1COK A;  3BQT A;  4ZOH C;  4YP3 A;  2SAK A;  3H8H A;  1P9D U;  5IKC M;  3G6Y A;  4Y2V A;  1Z2M A;  4RZR A;  2JH7 A;  1OEY A;  4ARC A;  4RPX A;  5KFP A;  2BS4 B;  2LPE A;  2ODG A;  2HCF A;  4KLJ A;  1NDD A;  2IBI B;  1UT5 A;  7ICV A;  3DWM A;  4TSS A;  2W04 A;  2A5U A;  1BT0 A;  5DDY A;  1J19 A;  4C0Z A;  4DL7 A;  2UVW A;  1U4A A;  4A9A A;  1L5P A;  1IV8 A;  1QCK A;  1EWY C;  4RNO A;  1U45 A;  1I4H A;  4W9E A;  4Q8F A;  2BDU A;  5KL8 B;  4DHZ B;  2BWE S;  4HKZ E;  3W2D A;  1QKZ A;  1RXV A;  2KP7 A;  2PFP A;  1DOY A;  1X40 A;  2HJ8 A;  4RQN A;  1X9M A;  3QUT A;  3OLM D;  3RNG C;  1L0X B;  3C1Z A;  1Z5S B;  4UAR A;  4XYC A;  3M9N B;  1RG6 A;  1IUE A;  4YTM B;  2IHN A;  4DHJ B;  4I2E A;  4O0I A;  4LJX A;  4CE6 A;  1KN5 A;  4EX6 A;  5BOM A;  3TEW A;  3PX6 A;  4GDK A;  2KV2 A;  1V49 A;  3N97 B;  4Q2J A;  4ELV A;  3OJU A;  4PHA A;  3PX4 A;  2N9P C;  1L3V A;  2B3A A;  3LB8 C;  1QQR A;  2NRT A;  1B43 A;  1F1H A;  4G9B A;  3TAD A;  1C4A A;  1PUZ A;  1X6J A;  1L7Y A;  4PS8 A;  4A90 A;  2K89 A;  2JRI B;  4K1R B;  3ZIM A;  2FLL A;  4B9S A;  1PYW D;  3VRB B;  2H3I A;  1V8C A;  4XA5 A;  2XCA A;  1A0P A;  4O3N A;  2C9W B;  4F8C B;  4JMU A;  3Q8F A;  4IWP A;  2VA8 A;  4K7S A;  2XY6 A;  8ICS A;  8ICY A;  1NEN B;  4Z6C A;  4M6W B;  3D2S A;  3WIM A;  2PLP A;  4B9T A;  2ZPN A;  2O6K A;  1E0Z A;  1Q5W B;  2KAN A;  1H4R A;  4QWE A;  4LNK A;  2J42 A;  2LXA A;  1LFD A;  4R8U A;  2QMT A;  3HVZ A;  1J0G A;  4GIB A;  2JEG A;  2ON8 A;  3FAH A;  1OTR B;  1TS4 A;  3EPI A;  1JCK B;  1P98 A;  3RMK C;  3FKY A;  2C2E A;  3T3N A;  5DB9 A;  4ZRQ A;  3B2G A;  3AEA B;  1RYR A;  2LEK A;  2YN4 A;  4TUQ A;  4B9U A;  1P7D A;  4M2Y A;  4B9N A;  3EZ5 A;  1NOM A;  3RAQ A;  2RDI A;  2F77 X;  1V1P B;  1RQL A;  3IDW A;  8ICI A;  7ICR A;  1V5O A;  7ICG A;  3IP4 B;  4RT3 A;  3AE7 B;  2I6X A;  5ALR A;  1M6Y A;  4F3O A;  2KN5 A;  2DLB A;  4QWC A;  1JML A;  1XSN A;  1FRD A;  1GG3 A;  2LGS A;  1JWS D;  1WM2 A;  3WK9 A;  1EWC A;  4IUM B;  1WZ3 A;  2XVT A;  4J9S A;  1J2M A;  1WY8 A;  3TUO A;  9ICC A;  5KFS A;  1I4Q A;  5IIN A;  2DX5 B;  5LLI A;  2K4P A;  3DEE A;  4CCH A;  4KIK A;  3OSN A;  3C2L A;  4QIW F;  1NK6 A;  4MH0 E;  2WU2 B;  3SEB A;  3PSP A;  3VTW A;  1HEK A;  4USA A;  1S0N A;  1XT9 B;  2XBB C;  3IG3 A;  3N1X C;  7ICT A;  4KDL B;  4K81 A;  3H8W A;  4N59 A;  4EBC A;  2KFK A;  3GZN B;  3ZVV A;  3SAH A;  2HHS A;  3JPQ A;  4AP9 A;  1L0Y B;  4IDI A;  3SZ2 A;  5KFX A;  2KE7 A;  2CU1 A;  1L7N A;  1ZRN A;  5J2G A;  3EA6 A;  1ZOL A;  3QU2 A;  1A6S A;  5BYS A;  4EZJ A;  2DBY A;  8ICO A;  3WAO A;  1Z00 A;  1P1A A;  4Y2T A;  4GMV A;  3I57 A;  1C9F A;  2C7N B;  2M9N A;  2RHF A;  1E6E B;  4C80 A;  4Z6D A;  2BR0 A;  4P4M A;  3RFZ B;  1L2N A;  4BKS D;  4KLT A;  4IQT A;  5KFC A;  2ZXH A;  2WTF A;  1NK4 A;  1C77 A;  1F77 A;  1I4X A;  4LLG M;  3W5U B;  2ZXI A;  1N63 A;  4OVZ A;  4FLH A;  2H3Z A;  3UQB A;  2WF6 A;  3L10 B;  1R4N B;  2EKE C;  3UPQ A;  2QIE B;  1ESF A;  2UVR A;  4WWN A;  3BQ2 A;  1SKS A;  8ICH A;  4ARI A;  2HSZ A;  4CF5 A;  3UM9 A;  5C2T B;  5KTQ A;  1WJU A;  1WXS A;  4NAW A;  1KH0 A;  7ICQ A;  1E9M A;  5DPW A;  4JWN A;  5AI6 A;  3Q8C A;  5FK9 C;  2H88 B;  1IGD A;  1WCL A;  1XO1 A;  2C2D A;  1KQQ A;  3VRA B;  3RF9 A;  4I27 A;  4S17 A;  2ZPY A;  2O2V B;  2Y5B B;  3JYU A;  3HW8 A;  2YTU A;  2ZIW A;  3M3J A;  7ICP A;  4IW0 A;  2N1R A;  3P4R B;  4Y2P A;  3AE8 B;  1RRB A;  1EF5 A;  3U30 A;  5KT7 A;  3M95 A;  3TFR A;  4BOS C;  5J0S A;  1Y8R C;  1PQS A;  1KFY B;  3WCQ A;  1C3T A;  4FUL A;  2UVU A;  5DGA A;  2O6V A;  1FXT B;  4GLX A;  3HX0 A;  1Q3U A;  4GSW A;  3ETR A;  3UIN B;  2DQN B;  5HKH A;  2VJ4 A;  3BYY B;  2LYA A;  3PZ7 A;  4LNO A;  2QC8 A;  2BCQ A;  4TUR A;  5DPR A;  9ICR A;  2FIF A;  1VLB A;  5GTI U;  1JMS A;  1TAM A;  5KFW A;  2D5G A;  4H2A A;  5J2C A;  1L6V A;  2DZJ A;  3ORY A;  1E7V A;  3RJE A;  3AE1 B;  3W1S C;  2KTR A;  4ANX A;  5CHW A;  1ZQB A;  3R8B A;  2FPM A;  3ZDC A;  5AKI A;  5F9L A;  3B1L X;  4MGY E;  4RMA A;  4WUR A;  3P2B A;  1ET9 A;  4RH6 A;  3BK1 A;  4F4X A;  4MJS A;  3W1S A;  2EZZ A;  4JV0 A;  4RUA A;  2ZJD A;  2A19 A;  1IBX A;  5JUM A;  4FZN A;  1WJN A;  2MUT A;  1P7F A;  2IBK A;  3V7L A;  3H0M B;  5DBC A;  1EUV B;  2MA9 B;  2WB1 C;  3VH3 B;  1PVR A;  3H0L B;  1WIA A;  1LVH A;  2VJ5 A;  3AEB B;  3OWE B;  2KLC A;  1N6Z A;  1B9R A;  1BML C;  2AYO B;  1TZO A;  1RAX A;  3ICX A;  1ZDX A;  3QUB A;  3VDZ A;  2NRZ A;  4EKU A;  1K53 A;  1WCN A;  1L6N A;  4UQG A;  3BVM A;  4KGS A;  2KKP A;  4I2A A;  1WI0 A;  4EEN A;  4PHP A;  3QZ8 A;  1HXY D;  3TAR A;  3ZO5 B;  4O5K A;  4GDL A;  1JXL A;  3GZF A;  2LM1 A;  2VKQ A;  5AI8 A;  4UAW A;  2N1W A;  4IQV A;  1HUO A;  4KLE A;  3ZTD A;  4FBU A;  4TQS A;  8ICA A;  3ZQ4 A;  3ZDE A;  1OEY J;  2LVQ A;  1ZQN A;  1ZQS A;  4O3Q A;  2KX3 A;  3RCZ A;  5J2B A;  4RQ3 A;  2D3B A;  7ICI A;  3N32 A;  1IYF A;  3FYH A;  3F2B A;  1P7E A;  4MSM B;  4UW9 A;  5ALX A;  3LXF A;  2F2A B;  2Z0D B;  1WZ0 A;  3FIL B;  1KLU D;  4K3C A;  2BPS A;  2YEP F;  1XO0 A;  4XC2 A;  1BPY A;  2KWU B;  3ONS A;  3JVZ X;  3V7K A;  3H7S A;  9ICE A;  4HJG E;  2WAQ F;  2HD5 B;  4F2S A;  3JSV B;  4IQW A;  1DRG A;  1DGJ A;  4DFM A;  1WXM A;  3SFD B;  1A77 A;  1LQB A;  3M8S A;  3M1Y A;  1CK1 A;  1LM8 B;  1V6E A;  2RSU A;  2M17 A;  5JHA A;  3EC8 A;  4ECZ A;  5HHD G;  9ICM A;  1SEB D;  2UVV A;  2MCN B;  2H3Q A;  4IWO A;  4JPS A;  1KOT A;  2HVI A;  2W9C A;  3IHQ B;  3RNA C;  2L3Z A;  2R8H A;  3A9J B;  2KG5 A;  2V4L A;  3DQV A;  1XCT L;  3OAW A;  3RZF A;  1HA5 A;  1TGZ B;  3U7Z A;  3EGR A;  3WKD A;  5HHI A;  2DZM A;  1G6J A;  1UCV A;  4M6W A;  1EXN A;  1H38 A;  4QWA A;  1WMH A;  4N9F 4;  1VJ5 A;  5ALO A;  2N9X A;  2AWT A;  2CJN A;  4QW9 A;  2PMV A;  5DG8 A;  2IDY A;  1PK3 A;  3DVG Y;  3PVX A;  2ESE A;  2KAC A;  3AB5 A;  4J9K A;  2W55 A;  3QCA A;  5KG3 A;  2HBJ A;  3SEI A;  4GN1 A;  3ZDD A;  3AE5 B;  4M8N A;  1SL1 A;  8ICB A;  1NK9 A;  2YX8 A;  2HBK A;  3AEC B;  4G11 A;  3PZP A;  3VR9 B;  1Q8K A;  3A9K B;  1WE7 A;  4NQL B;  3A1Q A;  3BII D;  2YMP A;  4RQ0 A;  4AOF A;  4EYH B;  1V1P A;  1UEL A;  4RQ6 A;  2KFN A;  3J81 j;  3L5K A;  5AKG A;  4MGK E;  1ZQV A;  3VQI A;  1ISN A;  2G3Q B;  2BYE A;  3Q14 C;  2AQ4 A;  2MEK A;  2VA3 A;  4MFF A;  3TFS A;  2QAR A;  1WF9 A;  2IA6 A;  4UB5 A;  4O5E A;  4ED1 A;  1CI4 A;  1QT9 A;  2AQ1 B;  3HVD A;  4KV2 A;  1YZ7 A;  3QX7 A;  1P0R A;  3ZD8 A;  1F2R I;  4C4R A;  3NVV A;  1ZP0 B;  3AE4 B;  5CR0 A;  3UQ2 A;  2K4I A;  3HIL A;  1I42 A;  4FHJ A;  1L8L A;  1PFD A;  1V85 A;  2ZNV C;  1WG8 A;  5ALP A;  1I35 A;  1YN3 A;  3FC4 A;  3RR8 A;  1URJ A;  4KLI A;  4HXD A;  4MM3 A;  2MA1 A;  2N9E B;  3KHH A;  2G45 B;  3QUQ A;  1T0S C;  5GTH U;  1V81 A;  4II2 B;  3M8R A;  2CKH B;  2LHE A;  4MAC A;  5L1M A;  3EW9 A;  1QQ5 A;  2OM6 A;  1JRU A;  1MQ3 A;  3JPN A;  1MHX A;  1BPE A;  4CF3 A;  4UB4 A;  4KMU A;  3CP8 A;  1FNU A;  4Q43 A;  5AM4 A;  1Q0W B;  4JGH B;  2NRX A;  1COO A;  4B6J A;  3T5L A;  4OJ5 A;  3LYY A;  2K8C A;  2FPL A;  4YMM A;  1UF0 A;  5J0Y A;  1WR1 A;  2YML A;  4M00 A;  4NY0 A;  2D3A A;  1UHU A;  4M9J A;  2BW2 A;  3SQI A;  1WX9 A;  3UXO A;  2ZTE A;  3KTQ A;  3RD2 A;  5ALW A;  4HKQ A;  2GBK A;  3SD7 A;  4FS2 A;  5HNK A;  4DL3 A;  4F5N A;  2LGD A;  2M19 A;  1ZQF A;  5FP0 A;  3ABV B;  4ED6 A;  2Y1J A;  3UMB A;  3QU7 A;  2IOF A;  3RRH A;  2ZJ5 A;  2LUE A;  5AKH A;  3PS6 A;  3DDC B;  4DO9 A;  1YD8 U;  1ECW A;  2PPH A;  3AXC A;  2KN7 A;  2WDT B;  2FI1 A;  3EHV A;  1XNS A;  4NM1 A;  4BWM A;  2L1A A;  3KYD D;  3Q2A C;  1U47 A;  2LGX A;  4DFP A;  2XK5 B;  3ZYY X;  3RNF C;  1SL0 A;  2BKE A;  5KFQ A;  3I5J C;  2EMT A;  4MFA A;  4RGN A;  1WGK A;  1HIW A;  3DBR B;  3SFE B;  5J2E A;  2C60 A;  4YXJ A;  1NEK B;  3WAN A;  2O6V D;  4HAI A;  2B0C A;  1CUK A;  2I9G A;  2E3T A;  4WWO A;  5KT2 A;  1JUD A;  3NAS A;  3RB0 A;  4RU9 A;  3KUC B;  3NVY A;  2FBW B;  4BBN F;  4XQ8 A;  7ICE A;  4C4T A;  2GMI C;  5G5H A;  4BKG A;  2IO1 B;  2KWD A;  1VR9 A;  2G5H B;  2BVC A;  1LXD A;  2VZK D;  4KLH A;  4EEL A;  2JRZ A;  4IM3 A;  3MC1 A;  5KFD A;  5CP2 A;  4HPP A;  4ICV A;  2YY6 A;  3C5G A;  2MWS B;  3QAQ A;  1T0R C;  3A4S C;  2KZZ A;  1KF6 B;  5B5E U;  5AM1 A;  4BJQ A;  1ZQC A;  1UZX B;  1ED1 A;  1RYS A;  4E3C A;  2K8H A;  4HRS A;  4EFO A;  5AKK A;  2P66 A;  4GXJ A;  2I5H A;  1T6B X;  1VZ6 A;  2PE9 A;  4DQP A;  2QB0 B;  1ROE A;  1SIF A;  1KM7 A;  3UXN A;  2ZZP B;  3APD A;  2JRH A;  3C2M A;  2TSS A;  3VUW A;  2BYV E;  3M7D A;  3DBL I;  4DFK A;  3VUY A;  4DSK A;  2FID A;  3ZTC A;  1A70 A;  3KHG A;  2LZ6 A;  4DK5 A;  2PFO A;  1I7H A;  2AHO B;  1C4C A;  4WQM A;  4O9M A;  4RPY A;  4QZE A;  3KWV A;  5A0L A;  3AEF B;  1KEJ A;  2L83 A;  3QK0 A;  5DCN A;  4EEY A;  4C4S A;  1YX6 B;  2ZIV A;  5J0R A;  2N7D A;  2BCS A;  2W03 A;  5AZG A;  1L0V B;  2HE7 A;  2DKZ A;  4JIO U;  2G4D B;  2EH9 A;  2UWQ A;  5LNK 1;  2J4X A;  2PKE A;  1ZQA A;  3MHS D;  1D8Y A;  3RYT A;  3N7S C;  3S2A A;  2F76 X; 
#chains in the Genus database with same CATH homology
 3TEW A;  1MI0 A;  1XEE A;  2WXN A;  2BTE A;  3NUH B;  2HTM E;  2KN4 A;  2SEB D;  4JWS C;  4Q2J A;  5AUK A;  2W3S A;  4LK0 M;  1JWB D;  3LB8 C;  3P63 A;  3P4P B;  1K51 A;  1QQR A;  2RPV A;  2H89 B;  2HDE A;  4MH8 A;  1C4A A;  4O1N A;  4A90 A;  2WXQ A;  1SJE D;  4NJC A;  4ZHO A;  2ZW1 A;  1PYW D;  3VRB B;  1V8C A;  2GB1 A;  3GB1 A;  4YTN B;  1ZE3 D;  3Q8F A;  1BUI C;  3TSS A;  5HI1 A;  4R3D A;  2RDH A;  1NVI D;  3ZJT A;  1NEN B;  1HZ5 A;  2PLP A;  4WH4 A;  1EM7 A;  1UUP A;  5BYQ A;  2NTT A;  1E0Z A;  4L2Y A;  1XLO A;  2J42 A;  1ZDV A;  2QMT A;  3HVZ A;  2ON8 A;  2BB5 A;  3FAH A;  1TS4 A;  1JCK B;  1TKG A;  3T3N A;  4P16 A;  1T3Q A;  3B2G A;  4ZRQ A;  3AEA B;  4JX1 C;  1TKE A;  2WXM A;  3BVZ A;  2X38 A;  2M56 B;  2LEK A;  1VZ8 A;  1QOG A;  1J7B A;  1DOI A;  1QIL A;  2IPK D;  2ONQ A;  4TMA B;  1C78 A;  2V3N A;  1QOA A;  5G5G A;  1V1P B;  3IAS 1;  1N61 A;  2IGG A;  4RNA A;  3AE9 B;  5EE1 A;  2J52 A;  2AQ3 B;  3AE7 B;  4OHJ A;  1MPE A;  2KDM A;  2DLB A;  1PGX A;  1TKY A;  4GLS C;  4A6Q A;  4B0E A;  1EU3 A;  2BS3 B;  4RGO S;  1JML A;  1FRD A;  3TEZ A;  4WIP A;  4YSY B;  1JWS D;  4DXG A;  1EWC A;  3MP9 A;  1FXA A;  1GAQ B;  3TUO A;  2BT6 A;  1I4Q A;  1TY0 A;  3BVG A;  4OZC A;  1WXQ A;  3MHZ A;  2I2Y A;  2DYO A;  1UGJ A;  3I9V 1;  2WU2 B;  3SEB A;  4AQ7 A;  4USA A;  1FO4 A;  2WDR B;  4XWT A;  1F2R C;  2WXI A;  4ZHP A;  1TY2 A;  3HRD D;  1NI3 A;  2W82 A;  2QSD A;  4N59 A;  4ITK A;  1J7C A;  5MPO A;  4JWU C;  4XE0 A;  4IDI A;  1L0Y B;  2JZP A;  1YNT E;  5FR3 A;  3EA6 A;  5BYS A;  2AX5 A;  1B1Z A;  1D5X C;  2DBY A;  2EKI A;  4KGR A;  1E7P B;  4N6E B;  2J53 A;  4YXD B;  3DWG C;  1AW7 A;  3I57 A;  3V05 A;  1C9F A;  1E6E B;  4C80 A;  3RFZ B;  4RGM A;  1F77 A;  1C77 A;  1I4X A;  1HEZ E;  2V3P A;  4LLG M;  3W5U B;  2LUM A;  2WDQ B;  2WLB A;  4PT5 A;  3RPF C;  1ZXI A;  3AEE B;  5TSS A;  1N63 A;  2MJE A;  2EEL A;  3P42 A;  4OVZ A;  2W54 A;  3PZ8 A;  5EE9 A;  2QIE B;  1ESF A;  2WNM A;  1PDX A;  1KTK A;  1M4V A;  5EE0 A;  4ARI A;  3J9C A;  2Z8L A;  3MJ5 A;  5C2T B;  2QJL A;  1FFV A;  2ACZ B;  1KH0 A;  2WXF A;  1E9M A;  1BXT A;  2MJD A;  3NS1 A;  5I4D A;  3Q8C A;  5FK9 C;  2H88 B;  1XLN A;  3AED B;  1IGD A;  3AH7 A;  4J3O D;  1SJH D;  1VRA B;  3VRA B;  5HFY A;  2WXR A;  4C56 C;  2JYT A;  2Q5W D;  1VZ7 A;  3KWL A;  2GRI A;  1YMH E;  4KX6 B;  3P4Q B;  3P4R B;  3AE8 B;  3U52 E;  1TJE A;  1C76 A;  2R61 A;  1MVK A;  3WCQ A;  1KFY B;  1GOZ A;  3IT6 B;  2KAJ A;  5HG2 A;  1XF5 L;  1L6U A;  2PTL A;  1AYF A;  3ETR A;  1F0Z A;  1QLB B;  3TEY A;  1FM0 D;  3BYY B;  3P1M A;  2LFI A;  3PZ7 A;  3PO0 A;  3FIL A;  1D4B A;  1YJI A;  3GP7 A;  1VLB A;  4ZRP A;  2JWU A;  2K3U A;  2D5G A;  4H2A A;  4US9 A;  2XN9 C;  1L6V A;  3AE3 B;  3AN1 A;  1LO5 D;  3AE1 B;  3R8B A;  2IGH A;  1FNV A;  4IKG A;  4WUR A;  1AN8 A;  1UWM A;  4P6V F;  1ET9 A;  4RH6 A;  4REZ A;  3BK1 A;  4C7Z A;  3N9Y C;  3W1S A;  3NZ3 A;  2K22 A;  3W5V B;  1UNS A;  1IBX A;  3W9C B;  4YTP B;  1P7F A;  1XO3 A;  1ZXH A;  2I38 A;  4XDC A;  2CJO A;  1JRO A;  3AMZ A;  1ENF A;  2LJI A;  1WWT A;  3AEB B;  1OQQ A;  3OWE B;  1PGB A;  1B9R A;  1BML C;  1TZO A;  2CU3 A;  3BWU D;  4US8 A;  4A55 A;  1E10 A;  4OZA A;  1SE3 A;  4ZYS A;  1ZDX A;  5GXG B;  1CZP A;  4DQO C;  1K53 A;  1FCL A;  1FIQ A;  3BVM A;  4KGS A;  4DXF A;  4KKJ A;  1HXY D;  3BZD B;  4YT0 B;  1SXT A;  2E6X A;  3CIR B;  1XLP A;  4GDK B;  1JQ4 A;  2INP E;  5H8Y E;  1RYJ A;  1XXG A;  2WXP A;  3ZGZ A;  3ZQ4 A;  2L52 A;  1GB4 A;  2FUG 1;  4LTU A;  2B76 B;  1JWA D;  4WWM A;  2K9X A;  1FEH A;  1P7E A;  2WXJ A;  4XWW A;  3LXF A;  3FIL B;  1KLU D;  1N5X A;  1DYQ A;  2YEP F;  1N62 A;  1CQV A;  2WXK A;  3Q8E A;  2JU6 X;  3UI3 A;  3P4S B;  1D6E C;  1FRR A;  3Q8A A;  4HJG E;  2ZW0 A;  3SFD B;  1DGJ A;  2L32 A;  2XNA C;  3TEX A;  2K0P A;  1CK1 A;  3NVW A;  4MT5 A;  5C3J B;  2RMM A;  1SEB D;  5HHD G;  1FCC C;  1CJE A;  4JPS A;  2BB6 A;  1ZPS A;  4B0M A;  2KMM A;  5H92 C;  2DYM A;  1XCT L;  1FMA D;  1HA5 A;  2BBC A;  1T5X D;  2WP9 B;  3EGR A;  4RF0 A;  3U7Z A;  2JSV X;  2IGD A;  3BYT B;  4C7Y A;  2PMV A;  1SF0 A;  2QEJ C;  2CJN A;  1EU4 A;  2GI9 A;  3VR8 B;  2IDY A;  2RDG A;  3GS2 A;  2MJ3 A;  3E56 A;  1I4G A;  2KAC A;  3AB5 A;  2PVO D;  3C8Y A;  3U2S C;  2W55 A;  5JXV A;  2JX5 A;  3AE5 B;  3AE6 B;  3AEC B;  4YSX B;  1VDV A;  3VR9 B;  3AE2 B;  2K5P A;  4GDL B;  1MHH E;  3BII D;  4M0W A;  2PIA A;  1TS5 A;  3AEG B;  1V1P A;  4XDD A;  3BK2 A;  1WSP A;  3B9J A;  5T8I A;  2BS2 B;  1JWU D;  4KGT A;  3VQI A;  2WDV B;  3O13 A;  1C79 A;  2MEK A;  1QF6 A;  5D7G A;  1JWM D;  1IGC A;  4TQ1 A;  2OED A;  1QT9 A;  1FD6 A;  2AQ1 B;  3HVD A;  5D3D A;  1SBB B;  1K52 A;  2BYT A;  3U4E G;  3AV8 A;  4D2K A;  1L4D B;  1F2R I;  3IXS A;  3AE4 B;  3NVV A;  1ZP0 B;  1TS3 A;  1ZOY B;  1RM6 C;  4RGT A;  2JYE A;  4HEA 1;  1PFD A;  2WQY B;  1GPX A;  2W3R A;  2WXG A;  1YN3 A;  1L4Z B;  3FC4 A;  2N9K A;  3IT4 B;  1N60 A;  3MC0 B;  2JXT A;  1YQ3 B;  1V1O A;  2LHD A;  2LHE A;  4MAC A;  1FFU A;  1N5W A;  2FE8 A;  3NRZ A;  2N0S B;  2MH7 A;  2WU5 B;  1MHX A;  2Y5C A;  4JE3 B;  1KLG D;  4L1B A;  3ZJV A;  1GB1 A;  4OZB A;  1NYQ A;  4NZL B;  1ACC A;  2LGI A;  1FNU A;  2LMC A;  3HUI A;  3V3X A;  1ET6 A;  2PW9 A;  4L23 A;  1SIJ A;  2KQ4 X;  2WXO A;  2WXH A;  3LYY A;  4NAW B;  1JRP A;  1V97 A;  4FXC A;  5E6J A;  2BW2 A;  3Q8B A;  2WXL A;  2N7J A;  1XCQ L;  5BMG A;  4HKQ A;  1JAL A;  1YN5 A;  2INN E;  2M19 A;  4A8X C;  1FNW A;  3ABV B;  1SE4 A;  3EUB 2;  3NVZ A;  3B2F A;  1STE A;  1YQ4 B;  2YEP B;  4IOI E;  1PGA A;  2L1A A;  3T3O A;  3KLS X;  1TS2 A;  3IAM 1;  1C4P A;  3ZYY X;  1ZUD 2;  4YWG G;  1HZ6 A;  3SR6 A;  4RGN A;  1WGK A;  1VJK A;  3SFE B;  2ICI A;  2V0G A;  1NEK B;  1AWD A;  5AUI A;  1QOB A;  1WYG A;  1YJJ A;  1R7S A;  4UDU C;  2E3T A;  2DWQ A;  4NAM A;  5EE3 A;  2QIL A;  1WRI A;  1Q10 A;  1JW9 D;  2G9H D;  3NVY A;  2FBW B;  2VZK B;  2NMQ A;  5G5H A;  2WS3 B;  4RF1 A;  2KWD A;  1FXI A;  1VR9 A;  1DOX A;  5FKA C;  1NYR A;  5D3I B;  4YSZ B;  4RFB A;  4RCO A;  2VZK D;  1D5Z C;  3KQ4 A;  2OHF A;  4MM3 B;  3R2I A;  2IJ0 A;  1OFF A;  2AQ2 B;  3CWI A;  1D5M C;  1TYG B;  4N58 A;  3Q69 A;  4OW0 A;  3L4P A;  3AM9 A;  1KF6 B;  1IBX B;  5BMH A;  1RFK A;  2JQR B;  1HQR D;  1I4P A;  2PKO A;  2SAK A;  4ZOH C;  3E9S A;  2Y5P A;  4HRS A;  3H8H A;  1J7A A;  4EE2 A;  1T6B X;  4TQ0 A;  1VZ6 A;  3MFG A;  4ARC A;  1ROE A;  1QOF A;  2G1E A;  2V4I B;  2BS4 B;  1SB3 C;  1OQR A;  2TSS A;  1XLQ A;  1K50 A;  3DWM A;  2PVG C;  5BMI A;  4TSS A;  2NTS A;  1A70 A;  1KRH A;  1I7H A;  1C4C A;  4WQM A;  4A9A A;  1L5P A;  4CQN A;  3KWV A;  3AEF B;  1SE2 A;  1EWY C;  2L83 A;  1I4H A;  4WAF A;  4KKI A;  1PUT A;  4HKZ E;  3W2D A;  1QKZ A;  4AS1 A;  1I4R A;  2M0A A;  1DOY A;  1L0V B;  3ZJU A;  2N9L A;  1YN4 A;  3URY A;  1L0X B;  5LNK 1;  2J4X A;  1SSN A;  3R2T A;  4HRO A;  1IUE A;  4YTM B;  1UWX A;  1RWS A;  1Y56 A;  5BYR A;  2Y3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...