5G5GA

Escherichia coli periplasmic aldehyde oxidase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
175
Chain Sequence
PAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE XANTHINE DEHYDROGENASE YAGT IRON-SULFUR-BINDING SUB
publication title The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 49
structure length 175
sequence length 175
ec nomenclature ec 1.2.99.6: Carboxylate reductase.
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 5g5gA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5g5gA01
2MH7A 3P63A 3AE7B 3SR6A 1VJKA 3SFDB 4JX1C 1L0VB 1E6EB 4C7YA 1B9RA 3AM9A 3NVYA 2FBWB 3VR8B 4HROA 2W3RA 2PKOA 2M56B 1FIQA 1E10A 3W9CB 3HUIA 2WDVB 1FXAA 1QOGA 1NI3A 1FMAD 1JROA 1XLOA 1FO4A 3P4SB 3P4RB 5H92C 1XLPA 4YSZB 1N63A 2L52A 1ZUD2 1FFVA 2WDRB 4FXCA 5EE1A 4ZHPA 1GPXA 2EKIA 3BIID 1T3QA 2JX5A 3AEGB 3B2FA 1TKEA 1XLNA 3VR9B 1SB3C 3ETRA 4YSYB 3RPFC 1PUTA 2G1EA 1DOYA 1EWYC 1JRPA 3FAHA 3FC4A 2ACZB 3AMZA 5EE9A 4JWSC 4N59A 2QIEB 1J7CA 4HRSA 1JWBD 1V8CA 1VDVA 2W55A 1WRIA 1NYRA 3B2GA 5G5HA 2WLBA 2CJOA 3AEFB 1AWDA 4YXDB 2PIAA 3SFEB 1N5XA 2Y5CA 2AX5A 3EUB2 4YT0B 1L6VA 1QT9A 2H88B 1XO3A 4JWUC 1WGKA 1JWAD 2W3SA 4N6EB 1L6UA 4IDIA 2K5PA 4WWMA 2E3TA 4YTPB 1CJEA 5AUKA 2WDQB 3LB8C 3AEBB 1PDXA 2H89B 1E0ZA 3NS1A 3L4PA 2MJ3A 2WP9B 4LTUA 1FRDA 3WCQA 3B9JA 1F0ZA 3VRAB 2DWQA 2N0SB 3NRZA 2PVGC 3AV8A 1YJIA 2MJEA 1SIJA 1YQ3B 3AE9B 1AYFA 1ZOYB 4YTNB 1RWSA 1DOIA 5C3JB 1FRRA 1ROEA 3AE2B 1KF6B 1TKYA 3KWLA 1OQRA 4C7ZA 1TKGA 2K22A 1QF6A 2DBYA 1NENB 2M19A 5H8YE 3ZYYX 1N60A 1WWTA 1V97A 1E9MA 1FFUA 1WYGA 1E7PB 1DGJA 1JALA 1YQ4B 2WQYB 3PO0A 1N5WA 1QOAA 5AUIA 5C2TB 3AB5A 3NVVA 3HVZA 2L83A 2MJDA 1OQQA 4US8A 1NEKB 2BS2B 1FXIA 3VRBB 2HTME 1R7SA 1N62A 1KFYB 1PFDA 1ZXIA 2BS3B 1RFKA 2Q5WD 3AE8B 2QJLA 2OHFA 1QOBA 1RM6C 3P4PB 4A9AA 1YJJA 5G5GA 5EE3A 3ABVB 4N58A 4YTMB 5MPOA 2BS4B 1WXQA 3AE1B 1QOFA 2WU5B 3AEEB 3DWGC 5EE0A 2K9XA 3P4QB 1UWMA 3AN1A 1J7BA 3LXFA 1RYJA 3AEAB 1J7AA 1NVID 4USAA 1NYQA 1VLBA 4C80A 1XLQA 1L5PA 1GAQB 1ZP0B 4ITKA 1JW9D 2CU3A 4WQMA 2BT6A 1A70A 3AE6B 4ZHOA 3AE3B 3P1MA 1DOXA 4US9A 4ZOHC 3AE5B 3NVZA 2W54A 3HRDD 4YSXB 2PVOD 1JQ4A 1KRHA 2LEKA 2CJNA 3NVWA 1TYGB 3AH7A 3CWIA 4P6VF 1CZPA 2KAJA 1IUEA 1N61A 2B76B 2JQRB 1QLBB 2WS3B 5GXGB 3W5VB 4KX6B 2WU2B 3DWMA 1I7HA 3AE4B 2KMMA 1OFFA 3AEDB 3W5UB 3CIRB 1FM0D 1TJEA 3AECB 1SF0A
chains in the Genus database with same CATH superfamily
2LWPA 2FUHB 3I76A 4R63A 1LQBA 1I42A 1FCLA 3WK6A 1KBUA 3MR5A 3A4RA 3VR8B 4BKGA 4EZLA 4JV1A 3BK1A 2RHFA 5D7GA 5J18A 2BB6A 5EDSA 5AK4A 5AKZA 1FIQA 1ZQMA 3CF6E 2DAJA 3UIPB 3FILA 4M8MA 3OJ3A 5H92C 3BZCA 4O3NA 1MA7A 2AHOB 3LDAA 3S2AA 5J0QA 5IIKA 5BOLA 4B9TA 2Z59B 3ZDTA 5HFYA 4QZBA 5JTIA 2LM4A 3MP9A 1P0RA 4N59A 4M04A 1F44A 3ZJUA 3DBHB 3ZNHB 2D3DA 1BUIC 3WAMA 3M7DA 1H38A 2J0MA 3JYUA 4L23A 3MHSD 4F4ZA 2CHWA 4EUTA 3N28A 2W9CB 4MSQB 2FI1A 8ICJA 2NBWB 2ES6A 4XRHA 3A9KA 4XDCA 3L4PA 2NS5A 2QC8A 4DL7A 4GIVA 3CW2C 2V4RA 4KLMA 1P3QU 4DFPA 2LD9A 1L2NA 1ZQYA 2MU2A 1L4ZB 1QCKA 2L3ZA 3GZFA 5DKWA 1FRRA 4UAVA 2N1RA 2RRDA 5HR7A 1TS4A 2NVUI 1XCTL 2LHDA 4Q44A 1HUOA 3KWLA 5ALNA 2GBNA 2DQNB 2HDEA 1K8RB 4RQ6A 2LGIA 1QOAA 2VJ4A 4DSFA 1YX6B 1HZ6A 4US8A 4U7CA 1XSLA 4LNKA 3M3JA 3IM1A 1E7VA 5ALFA 1ZQAA 3VUWA 2A3VA 1DRGA 5AM4A 1X1MA 2OHFA 3PMLA 1RM6C 3O0FA 3A0HU 4QZAA 2IO1B 4GMVA 4B6WA 4AYBC 2HHUA 1WXQA 4YXJA 2HVIA 2RDBC 3MJ5A 2KFZA 2K9XA 3QK0A 3JPOA 1RYJA 3RN9C 2G9HD 3B0YA 3PSFA 2BCSA 4P16A 5KAFU 4HKQA 2BT6A 1A70A 1J2MA 4O9MA 2MSED 4W9IA 1SSNA 3UF8A 4JQWC 3HRDD 3SENA 3A9KB 4YMNA 3I63C 1FD6A 3MABA 4IRCA 4F7ZA 1I4HA 4NQLB 4F1SA 1IUEA 3VVWB 3UGBB 2WS3B 2C2RA 2IOHA 1MVKA 5D49A 4C00A 3AE4B 3RAQA 1P7DA 1WCLA 3J81j 4RGMA 8ICFA 4EX7A 3QUBA 1NZPA 3NASA 3QU4A 1TJEA 2Y3AA 4HPPA 4KLEA 1BT0A 1L0VB 2KTRA 4G0NB 2OOBB 4WQOB 2AQ1B 4J9OA 1SKWA 5HKHA 5BOMA 4P1CC 2BCUA 1COKA 4KLUA 5ALHA 1D5XC 1I4PA 1VR9A 1RPLA 1I4XA 2Z8LA 4P4MA 4KLHA 1EUVB 4B9UA 2ASQA 3VTUA 5LXHA 4J9SA 2KXJA 4WAFA 4AUQC 2J0JA 5DLGA 3PMNA 4YP3A 1U49A 2JUOA 1IGDA 1XLNA 2WXRA 5T8IA 1SB3C 5AI8A 1ZDVA 4BKSD 2XC9A 8ICRA 4MGZE 2G09A 2K8CA 4MACA 2IHMA 3G6XA 1QZEA 4J03A 5J29A 2JWZA 1ED1A 4W9JA 4F5PA 4F5OA 3OJSA 4PHDA 2JRIB 3KD3A 1PGXA 3UXNA 7ICJA 1DK3A 3Q3JA 4DQQA 5D3IB 4IWOA 1L0XB 2I5HA 1X9XA 4HLEA 1IYFA 3TFRA 2BR0A 4N6EB 2ZUDA 3HK0A 2J6TA 3QYPA 5JUMA 1SE4A 4JGHB 2E8NA 4CGZA 5CHFA 3PW5A 3KOOA 2Z0DB 3QZ8A 1PK3A 2J52A 3N7RC 2K89A 5JXVA 4QWBA 3SYZA 1YX5B 2HBJA 4G9BA 2V3PA 3Q8AA 4M02A 1RQLA 4PH5A 4R64A 4MELA 3T3OA 4NAWA 2CPRA 1ZRNA 3WA0A 5ALZA 9ICNA 2DX5B 1TS5A 1E5WA 3ZYYX 1S10A 4QAYA 4Y2RA 1DGJA 4A3OA 9ICPA 5C2TB 3V6HA 4FJVB 3RZWC 3AB5A 3VUYA 1OQQA 2W9BA 1Q3UA 4RF0A 3C29A 4Z6EA 5KT7A 4EBDA 2FMSA 2K0PA 3UM9A 2K25A 2M17A 3R7RA 4W9DA 2QJLA 2K8CB 1NK4A 4FJZA 3OSPA 2DKZA 4DF4A 2O2VA 5J0YA 2DYMA 2DUYA 4WURA 4BBNF 4YD1A 2XCPA 2WNMA 2W04A 4I29A 4ZRIA 5HHHA 3DBSA 4ECSA 4M0WA 8ICHA 1SEBD 5J2GA 2KX0A 2N7DA 5AKHA 1D8YA 9ICFA 3LVWA 3ZNGC 5E79U 4DFJA 3IT6B 4UDUC 1JMSA 3I3TB 1ZQNA 3RR8A 3ZKJC 1CK1A 4RT3A 4ZHOA 3P1MA 5JHBA 1NK6A 1TK0A 1KRPA 2WX0A 5AI5A 1WR1A 3KTQA 2Y0SC 3QNMA 3ISBA 1ZQOA 4OJLA 4P6VF 2BPGA 3W5VB 2BCRA 1QLBB 4W9LA 1HQRD 3EWAA 4AP9A 1VJ5A 2XGQA 4UB2A 4F50A 5KT5A 2PE9A 4DBGA 1NKBA 3RI7C 5KFGA 3CIRB 2P6RA 4UB8U 2C7HA 1SF0A 2UWQA 2KOBA 1PUZA 3SR6A 1VJKA 1E6EB 4ZYNA 2HDOA 1RXVA 3U30A 3NVYA 1JI7A 2HVHA 8ICUA 4C4RA 3OWEB 2UVUA 4HROA 1K1SA 2NYVA 2RP5A 1T7PA 3DBRI 2M0XA 3UMBA 4IRDA 2CN1A 1NI3A 2FE9A 3ALRA 1OGWA 4I6LB 5DPWA 3VFKA 4JWNA 2O2VB 4M8NA 5IOIA 2A19A 2K4IA 1L3UA 3U7ZA 3RPFC 1MPEA 2G1EA 4XDDA 4M0WB 3APFA 1P98A 3V7KA 3LWLA 3D32A 4RPYA 3Q8SB 1HTOA 2BHNA 4XWTA 1P1AA 4TSSA 1V85A 2UU7A 3EFCA 1TY0A 2D3GA 1O03A 2LYHA 3RAXA 3QJZA 2W8KA 1WGKA 2J6UA 1F0MA 4DOBA 3RTVA 1FEHA 7ICUA 3Q8KA 2B21A 1SGHA 2DYOA 3Q8EA 1B43A 1E8ZA 2PFNA 2HJ8A 2ZIUA 5D46A 4W9EA 4FZMA 3RJKA 2RPQA 2ZXIA 1I4GA 1SE3A 5D2MB 4QZ8A 3FYHA 4LZDA 2D10A 1WR6E 3NUQA 3M9OB 2L32A 4Q43A 1AYFA 3JPTA 4Y2VA 3DBHI 5D4BA 4DDGD 1Z00A 2ZVOA 4DCCA 5J0UA 3T5JA 5L1IA 2K22A 5DPSA 5FKAC 4A20A 4MGIE 3ECIA 2ZW1A 1ZD5A 2KN4A 5H8YE 2G5HB 1L7NA 1V97A 1EO6A 2ISOA 3Q3MC 2YY6A 1M6YA 3HX0A 2XY5A 1V5TA 3EHVA 3P42A 2FDRA 3IT4B 4NPNA 2XK5A 2MCNB 1JXEA 3E0FA 4JK1A 5AI4A 1EU3A 4AOFA 4ED2A 1QOBA 1T0SC 3TEXA 4C8KA 5AZGA 3VH4B 3ZDMC 4N58A 3RFAA 2C2EA 3IXSA 2WF8A 3EW9A 4YMOA 5ALTA 3SHQA 1UPHA 3SAHA 1IGCA 1HA5A 2KNJA 4DOCA 1K1QA 1BPDA 1SXDA 2HOQA 2Z7JA 1V1PA 4NLZA 2KYWA 3QA8A 4WJPA 4IC9A 4IQUA 1X9WA 3SAFA 4NLGA 4KDLB 3ICXA 1S3SG 9ICTA 3TL5A 4IR9A 2WXMA 1URJA 1GB1A 1CZPA 4CRXA 3ZW3A 3IN5A 5ALOA 3WK4A 4QJFB 2H3IA 2XVTA 2V4IB 3JSVA 3RT3B 4RMAA 2LBOA 4Y2YA 2RQ5A 5AI6A 4UAWA 4FHKA 5GMVA 2HOIA 1EF5A 1FM0D 4PJ0U 2KD1A 3AE7B 3PSIA 4JMUA 4YMMA 1VD2A 3WKDA 3E2EA 2ATLA 1SL1A 4BXOA 1WCNA 4Y2JA 4I28A 1IIPA 3WKBA 2JEGA 1A77A 1ZQQA 1E10A 2LKYA 2ZIVA 2XK5B 2ZUCA 3QXGA 5EE1A 5KFAA 4DL2A 3RH4A 2IYDB 4DHJB 3C21A 4NL9A 1SXTA 3QX7A 3ETRA 3JPQA 4DL3A 1PUTA 2LJIA 1WGRA 5D3DA 2C7MB 4PHAA 3RH5A 5J0RA 4NLBA 5CRXA 4PL1A 2WHIA 1JWBD 3BS5A 2WF9A 4TQRA 2KO3A 2WXKA 5KL1B 1TVAA 1N48A 2GLEA 5ALIA 8ICVA 3O13A 1ZQPA 2EMTA 1V1PB 4U6PA 4IS7A 1PZNA 3PO4A 1I4QA 4XQ8A 3K9PB 3K9OB 3SFEB 4B0MA 1QT9A 5KFXA 1RFAA 4W9FA 1MC8A 3AUOA 2INPE 2DNFA 4DS5A 2NPTA 1VZ6A 5KT3A 3Q8MA 3MHZA 4OHJA 2HHVA 1SJED 1PQSA 2GH1A 5AUKA 3JSVB 4C0ZA 4CDGA 1YIWA 5E6PA 2KTFA 5T14A 2JXXA 2N0SB 5BMIA 2KOXA 5CB1A 3AI5A 3GFKB 3BJYA 1YJIA 4XE0A 1QH9A 2F3NA 4Y2XA 3QARA 1SKSA 1KFSA 4J3OD 1UT8A 5KFWA 1IBXB 1FEZA 2K1FA 4BXOB 1TKYA 1WE7A 1WSPA 2LGDA 3BQ7A 1WWTA 4IM2A 4UASA 2RGFA 2YMPA 5JU5A 2GOLA 5CR0A 3GZNB 1C3TA 4F4YA 1L7OA 1TAMA 3UINB 3NGDA 9ICUA 2HBKA 4F5QA 4GLXA 5DG7A 2WF7A 3VCBA 4P7IA 1T3NA 5DGAA 2IZVB 2NRVA 4JB3A 3ZTDA 3JVZX 3A0BU 2NBUA 1RDFA 3QU5A 1GOZA 5EE0A 2F44A 2PPHA 3CSTA 2QILA 3PPAA 3Q8BA 4YL8A 4BKTA 1JX4A 3P4RB 3BZKA 4CF5A 2NPTB 7ICSA 1DOXA 2KKVA 4EZJA 1CMXB 5DPTA 2J7QB 1LGRA 5AKXA 3IHPC 1WH3A 1D5ZC 5BPCA 1QTMA 5J8YC 4DFDA 1MJDA 1XCQL 4URKA 2L76A 2LEKA 5J0SA 3NVWA 3AH7A 2REXA 4PT5A 3NZ3A 1WG8A 4ECYA 4K7UA 2CKHB 5G55A 5DCNA 3UQBA 2D8CA 2L5YA 4MJSB 8ICKA 3F2BA 3QE9Y 1UNSA 2MH7A 4BWJA 4ARIA 1JWSD 4TV3A 7ICIA 3F2CA 3KKAA 3BVZA 4F5NA 1E8YA 3TI0A 1SJHD 2BQRA 3L3FX 2LRUA 3HPOA 1S77D 1F2RC 1F52A 2JT4B 4KLTA 3MC8A 3F5AA 1V5OA 1S8OA 3RRGA 4LZGA 2HBMA 3QIJA 5KFUA 1Q1OA 3QZ7A 5IA7A 2LXAA 4YSZB 4M6WA 4QZGA 3HVDA 4K1RB 2JX5A 3S6JA 2KQSA 3ZNID 3B2FA 4QZIA 2EMSA 2ZXHA 2EKEC 3IAM1 3L16A 4ZRQA 5EE9A 5KFKA 4M9JA 2KVRA 2AQ2B 3GB1A 4RH6A 4LJOB 1AWDA 1F77A 5AK3A 4YXDB 2JV3A 4X5VA 3EUB2 2QARA 1L6VA 4E74A 7ICGA 2HSZA 3MGHA 4O3OA 4O3SA 1YMHE 1NKEA 2W3SA 2K5PA 4RQ4A 3HHMA 2KTQA 3NRWA 4J9QA 1PDXA 3NS1A 1FRDA 1TZOA 2D11A 3MC9A 4C8OA 1L6NA 1F5SA 3K1ZA 3W1SA 1SIJA 3AE9B 3GQCA 3DVGX 1ET9A 3Q3NC 2KDFB 4KITB 2F76X 3D2NA 1XU4A 4JWMA 1OEYJ 3BK2A 3BQ2A 2IOFA 2KC2A 4Q8EA 2PFOA 5AIBA 2GWSA 4UB3A 4IWPA 3V05A 2YX8A 4R8UA 1A6SA 4R3DA 3VUXA 1WX7A 2KN5A 4ICAA 4OD0A 2WQYB 4RGTA 2EDUA 2H3FA 4ELTA 2FCSA 4EOYA 4KGSA 4RZRA 5J2EA 1TK8A 4LVSA 1ZQZA 3PZ8A 4MGKE 3VRBB 2OXOA 4RQ2A 2WXHA 1N62A 4QZDA 3UPQA 1X9SA 1C7YA 3ZRFA 1JN3A 4P2HA 3BINA 3KUDB 2EZZA 4GSWA 4JIOU 2BYEA 5L1KA 4IG7B 3FDSA 1SXEA 4RQMA 1E8XA 2WXNA 3UI3A 4DSEA 2OJWA 2W7PA 1AW7A 3AEEB 4J9MA 2KT7A 3I9V1 2YTUA 2QARB 1WFYA 2LASA 3V6EB 3M62B 4UAUA 4USAA 4BFRA 4F92B 4RNOA 4ICUA 3A4SC 3C2LA 5JHAA 1S9FA 3BYTB 1RZTA 1WGYA 3KVFB 3SQIA 2BTEA 3SD5A 3UIOB 2W54A 4K4IA 3H40A 2BW2A 2K8HA 4RQ8A 3TCAA 3J9CA 2XBBC 5J2KA 2INDC 3R8BA 1MN8A 1ZD3A 2KAJA 1ZDXA 1N61A 1X66A 2E8OA 5AICA 8ICLA 2JQRB 4HDQA 3VTWA 3CP8A 4KKJA 1A76A 4UAYA 2C2DA 1U48A 2JU6X 4O5CA 5KFTA 1WX8A 4TKNA 4A55A 3LJ3A 2D6FC 9ICAA 1IV8A 4DK5A 4R8UB 4IUMB 4XWWA 4DQPA 1B9RA 3PHWB 4WJ3B 2N7EA 1IG6A 3W1SC 2ALZA 4KKIA 2WDVB 1Q8KA 2K60A 2NR2A 1PVQA 1J97A 2RPVA 7ICLA 4LNIA 5IO9A 1XLPA 2L52A 5L1JA 2PLPA 2KANA 2WXOA 2W03A 4GC6A 7ICOA 4A90A 4ZRPA 2FCQA 2EANA 4J9KA 2OH2A 2Y0SF 4P0QA 2W8LA 1JXLA 1RAXA 4ED8A 3H4BA 1TS3A 4YN4A 3GDXA 2ZUBA 2I9GA 4EKUA 2FAZA 3ZVVA 1L7MA 3AEFB 4CQNA 1U45A 3RBDA 4RGOS 2AX5A 1NOMA 4ICVA 2IA6A 4I27A 3ZDBA 1LM8B 1XO3A 2HHTA 4TQ0A 3V3XA 5HHDG 1T4GA 4WWMA 5BMHA 2Q4TA 3V7LA 3D2QA 4EBCA 4ECQA 4QZFA 3GILA 4B95A 2ZTDA 2D2QA 3NRZA 3VDZA 3TFSA 1WE6A 8ICBA 4YTNB 4GXIA 1D3ZA 3AU4A 2C5LC 2MBEA 4WJNA 2BYVE 4BZAA 5J2IA 1P9DU 1QF6A 4DSKA 4MFFA 4Y2TA 3KQ4A 3QU9A 5KFHA 3ZGZA 1ZQBA 1HEKA 4KX5A 5ALDA 2BKFA 2RDHA 4FADA 4B9KA 3QEAZ 7ICTA 3KBBA 2KJ6A 8ICCA 5KFDA 2HOFA 2B6GA 1YNTE 1AARA 4DQSA 1GNUA 1R7SA 5IIJA 4P0QB 4HPMB 4OZBA 1QLNA 1L8OA 2R2QA 5D6JB 4YFKA 5ALJA 4QZHA 3OG5A 2NV3A 3TEZA 3H8MA 4Z6DA 4QWDA 3MR6A 3EYZA 3WKAA 1T0RC 3V7JA 1T5XD 2JYEA 4K3CA 2XIDA 3DWGC 3BYYB 1UWMA 4PYZA 3R7QA 3RZFA 1HTQA 5KFLA 2LVOA 4ITKA 1VLBA 1Z3EB 2FPLA 1L5PA 1JW9D 2CU3A 2FCNA 2ZTCA 3GZNI 3AE3B 3AE5B 4JE3B 1WXMA 4XGAB 2YMMA 2PVOD 4YSXB 1KLUD 2KK8A 3Q8LA 3PGEA 4EX6A 2I2YA 1JCKB 2JSVX 3DWMA 2P35A 1XNSA 2PW9A 1P7FA 1C1YB 4MT5A 3DCGA 2QCZA 3C5FA 2K39A 4KLIA 1BMLC 2L0TA 3GV8B 4NZLB 3EPIA 4NJ8A 4HAIA 1GG3A 7ICVA 1CRXA 4EELA 4C7YA 3TIXA 3AM9A 1KTQA 3DHGC 1TK5A 1EWCA 2WTFA 2DFLA 1FNUA 5KG4A 2QSDA 3PLUA 1GUAB 5EWFA 1NJWA 1S76D 4EZ6A 4EYIB 1KJTA 3QAQA 2UYZB 4IC7B 4BJQA 2VZKD 3ENEA 3RJIA 2KD0A 1F2RI 3Q14C 4NY0A 4F4KA 4ACOA 1PK1A 5C0YA 2K6QA 1T3QA 4B6JA 4DHZE 4WJOA 5KNIA 4DXGA 5KFNA 3VR9B 2LYBA 5J2JA 3HW8A 1EWYC 3LK9A 3AMZA 5E6JA 5DQIA 2BPFA 3NZSA 2JXJA 3AXCA 4XX5A 2R8KA 1HE8A 2XO7A 1UD7A 3B1LX 3ZDAA 4ASWC 4DLGA 3I1YA 3WK7A 5KG3A 4DHJD 2NCNA 5DDMA 1X6JA 4OJ5A 4EEWA 4NLCA 2L8JA 4II3B 3LVVA 2A1JA 2DZIA 3WIMA 1WMHA 9ICGA 2BB5A 4UB4A 2WXLA 4AQ7A 1BNPA 3RNFC 4ED3A 2IY1B 4BOZB 4F4WA 1KF6B 2FLPA 2VJ5A 2VA3A 4M9NA 1XSPA 1SL0A 2DBYA 4PL2A 3RJFA 1KH0A 1PK1B 4LK0M 5J2FA 1Z1VA 4LCDE 4NWIA 1OXJA 2KSOA 1HIWA 1T8EA 1ECWA 5E6NA 4F71A 3RUIB 2KV2A 2QB0B 3N97B 2I6XA 1ZXIA 4C4VB 3R2IA 2DKXA 1DXSA 4FA6A 3QEBZ 4B9LA 2QLTA 2B3AA 5FP0A 3THVA 4X57B 3QUQA 5AKIA 4YTMB 2WFAA 3AE1B 1KL9A 3KHRA 4CHKA 2KZ3A 3P4QB 2AXTU 3DBLB 3IG5A 1ZOLA 3MDAA 2F8KA 1XLQA 2XY6A 2GI9A 2N9LA 2BZFA 4GFJA 4NNJB 4OW0A 4US9A 3H8JA 1WJ6A 4DXAB 1STEA 2VH1A 2A1JB 5HMLA 7ICNA 1WMHB 2PMVA 2QEJC 2C7NB 2BDUA 3KYDD 1FCCC 3U7DA 4AJWA 1B22A 4KX6B 2KQ4X 2WXFA 2N4FA 1DK2A 1MG8A 4ARCA 1TAUA 1V6EA 4B9VA 1WZ0A 2KEYA 4RQ3A 4O5KA 4PZOA 4KLOA 5L1MA 3D2SA 3DVNU 4O3MA 8ICWA 3V62A 2KSOB 4ANXA 2QKQA 3EECA 4OJPA 4KSLC 3HUIA 5HG2A 3RH6A 5DDYA 1GC6A 2OJRA 1CI4A 4RFBA 1SBBB 1XLOA 1FO4A 3C23A 2XGPA 1S0OA 2PE6B 4WWNA 3I5JC 4FXCA 3N20C 3OHAA 4O5EA 1L0YB 3AEGB 4OCZA 3C2KA 1KTKA 1S1QB 3DQVA 3TJPA 2HE7A 1A5RA 2DZMA 3WK5A 2JXTA 4GC7A 4FZNA 2G0AA 3X23A 2MRPA 3LYSA 1NJXA 4W9GA 4BAXA 4HKZE 4F3OA 2CJOA 2J4XA 1EU4A 2JH7A 2HW3A 4Y2PA 4PS3A 4Q45A 2RSUA 4YT0B 4KV2A 3RJEA 4IW0A 3T5HA 2GBRA 2D07B 3BS7A 4FHJA 2XI9A 1L6UA 3MFGA 5KFSA 5AZFA 4LDTB 4O3QA 4MH8A 3RB6A 2PVGC 4C4TA 5FK9C 3WAPA 2XNAC 3Q8PB 8ICGA 2KK0A 4ANWA 2K4PA 1XC9A 5IILA 2MWSB 5ALWA 1D5MC 2N9PC 5ALXA 2UVRA 3MR3A 1XS9D 2DYBA 2L0FA 1OUQA 5KFOA 2BCQA 2CR5A 5AUIA 9ICQA 3H7PA 3T3NA 4PGXA 1UGJA 3WK8A 8ICNA 1FXIA 1UZXB 4GXBA 4KGTA 5DG8A 1KFYB 1D4BA 4K7SA 1UT5A 1IXRA 7ICMA 3PX4A 2VKQA 1YJJA 5KT2A 5KTQA 3WAOA 5EE3A 3JPNA 4GXJA 7ICRA 3KFUF 1ET6A 2V3NA 5KAIU 3V6CB 1RYRA 3ZDEA 4I2CA 3JW0X 4UB6U 1SE2A 2WXQA 3C5GA 4WIPA 1D6EC 1WIAA 3GOEA 3QUCA 2L7RA 2HMXA 4A3PA 4ZOHC 2QB1A 7ICFA 4HEA1 2MEKA 1L5UA 2ODGA 2WXPA 1QQ5A 5KG5A 2JPHA 3EGRA 3L0WB 4MGYE 2LMCA 4NY8A 3U4EG 4AS1A 4KVGB 4AJYB 1KEJA 4HYKA 1M4VA 3QWZB 1TIFA 2F1IA 1KDHA 2M1MA 3G6YA 1ZQCA 4QIWC 5L95C 3KZXA 1V81A 2AL6A 1B1ZA 2LI5A 1DOQA 1HEZE 3PLVA 1T0YA 3H7PB 3AL0B 4NJCA 2NBVB 5F3XB 3EPGA 1E90A 2PKOA 1S5LU 3A33B 3RNBC 2OCEA 2IO3B 1L4DB 2N9KA 1EXNA 2I1QA 1JROA 4CF3A 2W7OA 1R4MB 3O65B 1FFVA 1JQ4A 9ICMA 3MR2A 3ALBA 1J19A 1DGSA 1KW4A 4LJXA 1JWUD 2NMQA 3DEEA 3M8RA 3A9JA 3GIKA 2N7JA 5IIMA 1ZETA 1Y56A 4P4PA 4YR3A 2N1VA 2WWZA 4YG2A 4XA5A 2C28A 1ISNA 2LUMA 2ASDA 5FR3A 2BQUA 2LGXA 2Y5BB 1GO3F 5J2CA 1SE9A 1IBXA 4RM8A 2F77X 5EWGA 3HJEA 4HPLB 1D8BA 4I2AA 4Y2SA 2H88B 3C2MA 2KP7A 4ECXA 3PR5B 3ETLA 3DHHC 3TBLD 2QMTA 2YQEA 4ECTA 4YTPB 4AP4C 2LGYA 3ZJVA 1SL2A 3ED5A 1XXGA 3OAWA 4W9KA 3VRAB 4PS8A 5AK5A 2BYFA 3L17A 2GRIA 4B0EA 4ZRJA 3OGUA 1ZOYB 3SZ2A 3W2DA 1RWSA 2BVCA 2PI4A 5J8YA 3NG0A 2ZPYA 2K4EA 3MTNB 1L3VA 2VA8A 1D9DA 3Q2AC 4ED0A 2Y1JA 3PSTA 1QILA 2M19A 1RQNA 5AI9A 1N60A 2HHSA 3IAS1 4KIKA 3MJWA 5AKLA 2KVCA 3IVFA 1WF9A 2YMLA 1NK0A 2IO0B 3UXPA 2MQJA 2FE8A 4GLSC 2BGFA 3RB0A 4RQ7A 3M6ZA 1LO5D 3A9JB 5L1LA 4LNNA 4XC2A 4EZKA 2V0GA 1G6JA 4FN2A 2KACA 4A9AA 4G50A 1PVPA 3HWTA 5CX3A 2BKRB 1GB4A 2BS4B 4L2YA 1U4BA 2Q0ZX 1QOFA 2KKCA 4CE6A 1B0XA 2WXJA 2L1AA 1KN5A 2BPCA 4TQSA 4MJSA 3TQ1A 4S0RA 4DQOC 1GAQB 2DGZA 1ZP0B 3ZTCA 4LNOA 3IFWB 3PRZA 3WKCA 2R2OA 2BCVA 3WU2U 7ICPA 3N3KB 1ZQFA 2ZEQA 4OJOA 3V6KA 2ZNVB 3ZIMA 4CNQA 3VC8A 3ZNZB 5HHIA 9ICXA 1WJ4A 4KMUA 4TUPA 4WWPA 1C77A 1NDDA 3H1UA 3M95A 8ICEA 2DAFA 3DBLI 4A8EA 5DBCA 2K3UA 3L54A 4GB9A 4OZCA 4NM1A 3BQ0A 2KDIA 4KIKB 4LNFA 3RNCC 2L05A 1NK5A 3TUOA 1Z5SB 2MRLA 5EWEA 1BPBA 1NKCA 1UBQA 2W3RA 2ZNVC 2WAQF 1RRBA 5DG9A 4F5RA 1JIHA 2DZKA 1X40A 1X2IA 5ALRA 2OEHA 5DB6A 3H7SA 5DBBA 2CS4A 5HR6A 2JZBB 1ZGUB 2KMCA 3R3MA 4KLJA 4DSIA 3PZ7A 4K3BA 4I2EA 4QZ9A 3KW5B 4IM0A 1U9LA 1RG6A 3K4GA 1BXTA 2XN9C 4FFDA 3RNGC 2JEIA 2NRTA 4I2JA 4CF4A 1NJZA 1CUKA 4K4GA 4RM9A 4ZH4A 1MI0A 4NM2A 4C8LA 5KFEA 4MH0E 4ACFA 3ZQ4A 2AU0A 1WWVA 2PMZC 2NRZA 2UVWA 1T6BX 2O6VA 1D9FA 1ZW7A 3LYYA 4F2RA 3KWVA 2A4ZA 2J53A 3QX1A 2HHQA 2FMQA 2WDQB 4GGQA 3KUZA 5KFBA 2DWQA 2G5IB 3ZDCA 3EC8A 3NHEB 3KHLA 2R8GA 2VIXA 3DPDA 2BGWA 1JWMD 2AGPA 2ZCBA 3H4DA 4KDIC 3M63B 1V2YA 1D8LA 2P66A 4IL6U 3PT2B 2AYOB 1COOA 1JUDA 2KFJA 5D94A 5DB9A 2BQ3A 3F53A 1N56A 5HNKA 1K5OA 2KJ9A 3HKZC 5DGBA 2MBHA 1JALA 2RLTA 1B4FA 3MBYA 4DFMA 2IBKA 1E7UA 2M0AA 2YN4A 1X9MA 5CWRA 4ZDVA 1ZYQA 1XD3B 4P1BC 4QZCA 3AQEA 5BO4B 5KT6A 2BS3B 2KE7A 4UARA 2V9WA 1MSWD 3PHXB 3OLMD 4BX9C 2ZW0A 1RYUA 1UQVA 4HJGE 5KFPA 3M6KA 4KSKC 2WU5B 1QSSA 2MUTA 3FKYA 1R4NB 1TV9A 1WWUA 4DLEA 2E1EA 3AN1A 2R8JA 4KGRA 2O6VB 1V80A 4K81A 5J2HA 3M8SA 3ZD9A 4BWMA 4MF2A 3AE6B 4UB1A 4DQIA 3TEWA 4OJ6A 1YZ7A 4DOAA 2R18A 1LFDA 2CHZA 2EQYA 5F9LA 2A5UA 4NQKE 1BPYA 2AWTA 4QW9A 2YMQA 5LLIA 2ZTEA 1F9JA 2KZRA 4GDLB 5IINA 3DHIC 1CEZA 3CNHA 9ICSA 3E9SA 1I7HA 5KHQA 1KLGD 3D6JA 4RGNA 2LRWA 1SIFA 1LVHA 4RPXA 1C79A 4MEMA 3P63A 3ZD8A 4FO6A 1YOVB 3GS2A 2KWCA 1IPGA 5KL8B 3C28A 3PW7A 5KG0A 4KLFA 8ICSA 4Y2UA 2DPIA 3ZO5B 3RMKC 4RPZA 1LXDA 2M56B 4BOSC 3APCA 1SZHA 4RUAA 1Z19A 1WUDA 4XUSA 4YQWA 1QOGA 4F72A 3KHGA 2ASJA 2LZ6A 1KLNA 1TS2A 1K51A 3C19A 1ZUD2 2H3ZA 1E8WA 3DDHA 5F9NA 3ISCA 2RDIA 1RXWA 3PO5A 2FMPA 1H4RA 1TKEA 4PPXA 1Q5WB 5J0TA 4AWJA 1XO1A 2MUTB 5KG1A 4F4XA 4EEYA 3FC4A 2AGQA 2JVCA 1TY2A 1VDVA 1GC7A 9ICEA 3PV1A 3RJHA 5DPRA 2WLBA 3UQ0A 1QSLA 5KFJA 5IKCM 2EZYA 2KX3A 2R61A 1ZQRA 2WYQA 4JWUC 1R4MI 4RF1A 4L1BA 2ZPNA 4DF8A 4M9LA 1V38A 1MQ3A 3UXOA 3N7PD 3ML8A 5J2RA 2H89B 2MJ3A 4HCNB 4LTUA 1F0ZA 2HJ1A 1HUZA 1QQ7A 2MJEA 3BDPA 2MW5A 4TUQA 2W9AA 1RLFA 2G3QB 1V49A 3CYMA 2CXYA 2G08A 5L9XA 4ELVA 3N1YC 2IDYA 3Q8QB 4QW8A 2KWUB 3AE2B 4M00A 4BVUC 2IBIB 5DQGA 4YVZA 4J6IA 4C8MA 1SV0A 3UMGA 8ICZA 3B0AA 3H9DA 1PGBA 3DOWA 1E9MA 5AHXA 1FFUA 2WF6A 3PTFC 2IPKD 1L8LA 3OTQA 2IOFK 4PK1A 4GDKA 2SEBD 3PR4A 3MGIA 2JMGA 2NRWA 5AM2A 1ZQSA 2JH1A 1RFKA 3VH3B 3HIZA 5AIAA 4TQ1A 4B9NA 1J0GA 3P4PB 4JUZA 3Q69A 2ZZPB 1I4RA 2KJHB 4CCHA 4FJYA 2INCC 2ONQA 3CMMB 2AQ0A 2AH5A 1Q3VA 2H5XA 1WXAA 2G4DB 4DSLA 2ISPA 2KWVB 1NK8A 3HP6A 3SV4A 4B9MA 4HCPB 4CYEA 2N9XA 4GXKA 2RMMA 2PTLA 1C9FA 4C8NA 5KFZA 1TAQA 4N9F4 4PHPA 4F93B 3NVZA 2LUEA 4REZA 5ALUA 2YB4A 5TZVA 4M9GA 5ALSA 5KT4A 2NO4A 3EZ5A 4M01A 2KICA 4YD2A 1X42A 2BWES 4OZAA 4H2AA 4MDKE 4MSMB 5GXGB 2PFQA 3QCAA 1YZ6A 2EAOA 5IIOA 4DL4A 1ZQWA 4B9SA 1XEEA 3AECB 4DFKA 2WAQC 3ZXRA 2ZJ5A 5KFQA 5DB7A 2DZJA 2QHOA 1T0QC 3H8WA 1GJZA 4BUGA 2FJ6A 3EA6A 3NTUA 4GDKB 1Z4OA 3PY8A 5AK6A 1BPEA 4Z6CA 5J17A 3L5KA 1N63A 4ZHPA 1ESFA 2DL0A 3BIID 1SV0C 2D3AA 3WANA 2MAXA 3R9KA 3M9MB 4RQNA 5BYSA 3SU8X 4WJQA 1SV4A 9ICJA 3QC8B 5ALLA 2AGOA 2WB1F 3K1RB 1J7CA 2P6UA 2CU1A 4JLCA 1WRIA 3B2GA 2MA1A 5ALEA 2W43A 4I2DA 4QIWF 5ALYA 2HHWA 3FILB 4HVBA 3PREA 4DL6A 2HCFA 1TGZB 5KFRA 3APDA 9ICHA 5DB8A 2PFPA 3LWMA 2LHEA 2RDJA 4EENA 8ICMA 3U2SC 4IDIA 5AM1A 4IRKA 2L00B 9ICRA 1N6ZA 3WCQA 4J9RA 1TBEA 2QB0A 2JZPA 4UQGA 4K7WA 3SEBA 3AU2A 1FNWA 3PRMB 4C4VA 3MC0B 3AULA 1UGMA 2E8MA 3N7SC 3HM6X 2ON8A 1OQRA 1Z4NA 3MC1A 5H2FU 2KDEB 4YR2A 4RT2A 1ACCA 3PZDA 5IAAC 1E7PB 3PO0A 4NJ6A 4UBBA 1V86A 1YQ4B 1V1OA 3F5EA 4E71A 4PYUA 1Y88A 2C9WB 4M9HA 4C56C 2PXIA 1KKXA 2Q5WD 3ZJTA 1PFDA 3GIIA 5J0PA 4IQWA 2KKPA 3M1YA 1UA0A 4RNAA 2GO7A 3BY4B 1KOTA 4EE2A 2ZIXA 1ZJNA 1YN5A 4HXDA 2W9NA 1EF1A 2VANA 2KVZA 5DBAA 4A8XC 4G3IA 2N1WA 1ZJMA 2I1KA 3I57A 2LYAA 3ZUNA 3PW4A 2MBQA 4HK2A 4LJPB 4O3PA 2GBKA 3WK9A 2NO5A 1J2NA 5C23A 5IN7A 2ZIWA 1YJ1A 2V9HA 5LNK1 4OO1J 5BYRA 1WXVA 4I2HA 3RFZB 3FM9A 4ECVA 3PX6A 1UELA 3TAPA 2XEWA 3RD2A 2B76B 4HDOA 4NLNA 2RDGA 1P7EA 3WKEA 2KDMA 3N1ZC 2ZJAA 4RQ5A 2FIDA 1ZD2P 2FCMA 4P0PA 1R4NI 4KMOB 2M0NA 2KJRA 2K8AA 1ZRMA 3SFDB 1ZQHA 3CSFA 4KN7A 2F8LA 2BBCA 5CHVC 4XZ4A 2PEAA 1BNOA 5GTHU 4CO7A 2KIWA 1ZQGA 3GP7A 2WF5A 5JRTA 3R66C 2LHTA 5CHWA 3VXWA 3QHTA 3ONSA 1JRUA 2GBJA 3AEVA 3P4SB 5BYQA 3GV5B 2V1YA 3V72A 2N9EB 2EKIA 2V3SA 3OHBA 3M9NB 3RNEC 8ICXA 3F2DA 4EYHB 2J0KA 3C8YA 2ZIXB 1XWLA 2F1HA 2TSSA 1DOYA 1BPZA 4YR0A 2KTRB 5HI1A 4NV0A 5B66U 3KHHA 3QU7A 5KG2A 2BQQA 1V8CA 5KG7A 2X8XX 3Q3FA 2OM6A 2C60A 5CJ7A 3PV8A 4IWQA 2PI5A 5C1ZA 5CP2A 2ZIWB 2YLMA 1N5XA 5HP4A 2Y5CA 2LM1A 4FULA 2E8PA 2KWDA 2HHXA 4TUUA 2W9MA 5J2AA 1TKDA 4R66A 3UQ2A 1KFDA 3RF9A 1O08A 2E3TA 2VA2A 2F2AB 1WGDA 1CJEA 2D5GA 1UWXA 5JH5C 3LB8C 2LXCA 3ZLZA 3N4MB 3PX0A 4TMAB 1HXYD 2WP9B 3KLSX 5ALQA 1CQVA 5CEHA 3IG3A 3Q8RB 4P0PB 4Y2QA 2VH2A 1TTNA 3RYTA 5TISU 3WALA 3H8SA 3UQAA 4WWOA 2YB1A 3N1XC 3RR7A 5C3JB 4O3RA 1ROEA 2YVCA 1ZQTA 3QUTA 1C78A 4PGQA 5AKYA 1SWVA 5AI0A 5CHGA 3PVLA 3JPPA 1IP9A 2ZCCA 3MDCA 2KC1A 2RR9A 2QDFA 4J9NA 4RQ1A 5KG6A 2WGSA 2BKEA 2KMAA 1NEKB 4UB5A 2PMZF 4P4OA 2JWUA 3URYA 9ICKA 4OVZA 3DV9A 2KFKA 2HI0A 4RNNA 2NTSA 5CA7A 4NAWB 4MM3A 1WM2A 3T8MA 2WX1A 3VAWA 5MPOA 1WYWB 1I35A 1TFRA 5KFMA 5KFFA 1ZQVA 4JV0A 3TADA 2W82A 4NAMA 3BQ1A 5TR5A 7ICQA 5J2DA 1NYQA 3TAQA 1C76A 3IP4B 1FXTB 1YQBA 2YEPF 2BDPA 4I6PA 2W9BB 3V61A 2JYTA 3T5KA 1Q46A 4LLGM 1KSPA 4ED7A 5AKJA 1PYWD 3HKZF 4BDPA 2INNE 3IBEA 3OPXA 4IM3A 5I4DA 3ZI4A 2KMMA 4F2SA 2E1FA 5J2BA 2IY0B 4FBUA 2KZZA 3V60A 4JX1C 1TT5B 4I2GA 1U47A 3UMCA 2O6VD 1KM7A 1XO0A 2WHEA 4PHEA 2AJQA 3KH0A 9ICOA 3B08A 5HMMA 3GE3C 3TKAA 3W9CB 1FXAA 1T94A 5KFVA 4ZYSA 4RNMA 1X6IA 2KLCA 2KFKB 3ML9A 2WDRB 2K8BA 4EBEA 2I38A 3RCZA 3HILA 3SEIA 1MQ2A 1TZ1A 4DQRA 2WB1C 4MM3B 2Y9TA 2OYYA 3ISDA 1HZ5A 4PZNA 1OTRB 1ZPSA 1JRPA 3X0WA 2IGGA 1SWWA 4JWSC 4IR1A 4HRSA 2EH9A 2W55A 2SAKA 4E0DA 3L08A 3A1QA 4ANVA 3EFUA 2GBMA 4KZCA 5C5JA 3ZXVA 4J9LA 2KHWB 3U52E 2VRRB 1Z1BA 2HBLA 3U26A 5ALPA 3TADC 3V6JA 3B0XA 4KLSA 5B5EU 3AU5A 4W9CA 3B9JA 4DS4A 4WH4A 1ZQIA 1EM7A 3R2TA 2NTTA 1YQ3B 2R8IA 4RQ0A 4DDID 3KUCB 2ZG6A 4ECWA 1UH6A 3PRPB 3HT3A 4KLDA 4BKSA 2R8HA 1ZQJA 9ICCA 1LB2B 4YWGG 2LMRA 5DLFA 1YN3A 2JY6A 3BQTA 4C4SA 4UW9A 2GLSA 2I1JA 5J0XA 2KDBA 3N9YC 4FLHA 2DF4B 1N5WA 2K8BB 3BWUD 3RB3A 1UHUA 2ZIUB 4QZEA 2VZKB 5KFIA 2MBOA 3TANA 2BS2B 4ECZA 1WGHA 4YCXA 2G06A 3BVMA 3N30A 4ECRA 2V4LA 1ZQUA 3OJ4B 1Z00B 3SAGA 3IDWA 2D3CA 4D2KA 4XYCA 3A1QB 4MF8A 1FNVA 2LFIA 4JPSA 2KG5A 3IG8A 1NBFC 3LDZE 4UATA 1YT3A 1UCVA 3AEAB 4KX3A 1VZ8A 1NVID 3IHQB 1WRDB 3GV7B 4HJKA 4RU9A 1WJUA 4WAAA 4ED1A 1K52A 5FR6A 3PSPA 1NJYA 5AKKA 2DPJA 3PS6A 1TYGB 2ZVNA 4EFOA 2K6DB 3IRUA 2EAPA 4M2YA 2PKEA 3SV3A 2KIVA 5TSSA 1S0NA 4MFCA 4G11A 2JZBA 1ZQKA 5EOZA 2JHDA 4DL5A 3T5LA 1C20A 2J42A 5KFYA 3RNAC 3SMVA 5KFCA 1S97A 1Q10A 4DO9A 1K50A 9ICLA 1UUPA 3NOBA 3TEYA 3H0MB 5AKGA 2FBWB 3PVXA 1BGXT 2CRXA 1KFTA 1VCBA 4IQTA 1L7YA 4K4HA 2KNBA 4FBTA 1WX9A 3TARA 4DSJA 2MA9B 4NXZA 1L3SA 2JR5A 1FMAD 2LI6A 5AZHA 2KMDA 1GPXA 1VZ7A 3RRHA 3KZIU 1ENFA 2OEDA 4GN1A 3ZRCA 2M9NA 2ASLA 1WY8A 4QWCA 2F1JA 3HM3A 5A0LA 3T79A 3PW0A 1V9JA 9ICIA 3L10B 4YSYB 1KLVA 1ZKHA 3NZUA 4A6QA 3FAHA 3SI8A 2ACZB 2ESEA 3MGVA 2IMWP 2FPMA 1UBIA 2E6XA 1MG4A 2KFNA 5G5HA 2ZIVB 2K4HA 5ALVA 2GB1A 1KQQA 2PIAA 1ZD4A 4FE3A 2JEFA 3AU6A 1YN4A 5CTRC 3PNCA 1IM4A 1YD8U 1H8CA 3BVGA 2MP2A 4QWAA 1JWAD 2XCAA 1BPXA 2HD5B 2H3VA 3Q3OC 2J6SA 4PS7A 2NRXA 1A0PA 5IP4D 3P2BA 1E0ZA 5AEKB 3AEBB 4BBNC 4TURA 4KZ0A 1AQ6A 1ZQDA 4O0IA 2KQ7A 4ZRKA 1LKYA 3BS5B 1L7PA 4FS2A 4MEXA 2Y5PA 3AV8A 3I28A 4ED6A 4S17A 5E6OA 2D3BA 5G2NA 4I6NB 2EELA 2AL3A 2V4QA 2KJ8A 4NL9C 2JGAA 5J0WA 3QU2A 4YXMA 2ZJ8A 2WDTB 4C7ZA 3H6NA 5GTIU 1ZQEA 4KLLA 1NENB 2BF8B 3RULA 3OSNA 4I2FA 1M94A 3SDLC 2AQ3B 3C1ZA 2PJHA 2YEPB 3TACB 4HWIB 2EAMA 3MFHA 3HVZA 2MJDA 3RB4A 1C4CA 3AE8B 3BZDB 1J8CA 4RUCA 1S0VA 1XSNA 1C4PA 1WI0A 3T9LA 3GIJA 1NZBA 2BYTA 2LGSA 3QQ8B 2XICA 5KHOA 1Z2MA 3GE8C 8ICTA 5G5GA 1UF0A 2BPSA 4IOIE 3VQIA 1ZQXA 3G6VA 4GDLA 3H7IA 1TE2A 3ONNA 3SD7A 1NK9A 2DENB 1SKRA 2XY7A 2G45B 3TSSA 1QKZA 1ZE3D 2G4SA 1FPYA 2KLGA 4QWEA 3MFIA 2EZXA 2KHVA 4EEKA 4PGYA 1J7BA 2IO2B 4AYBF 3LXFA 2KZMA 3H0RB 4C80A 5ALMA 2Y1IA 7ICKA 1MHHE 2MP2B 1Q0WB 4WQMA 1JMLA 8ICOA 1ZQ1C 4JV2A 2FLNA 4BGDA 4DEZA 2MLBA 1KRHA 1WGGA 2CJNA 2H3QA 4KLGA 1LKYB 2E5SA 1NNLA 3JPRA 4IKGA 8ICIA 2WU2B 2X38A 4DWIA 2IJ0A 1SGGA 2Z0EB 3W5UB 2IGHA 3ZDDA 3E58A 1WJNA 2O6KA 2GMIC 9ICBA 1PVRA 2KN7A 2A1AA 8ICPA 4R65A 1MFWA 2FUG1 4OVUA 3CRXA 1L3TA 2KVSA 4NLKA 3VHTC 2KHQA 1F1HA 3RJGA 4MHVA 4NJ7A 4O1NA 4Q2JA 2Y9UA 2WXIA 2ZJDA 2WXGA 3H0LB 3GIMA 2HTHA 2JF5A 4MFAA 1ZXHA 3L13A 5DQHA 1V9PA 1XT9B 3ORYA 2LVPA 1RYSA 2BWFA 1VRAB 4GOCA 2GOWA 4M47A 5JZEB 4IQVA 4I2BA 2QIEB 2JEJA 3PSEB 3C1YA 1NYRA 1OEYA 2JRZA 7ICEA 3Q8CA 4KLQA 4M0AA 4FBJB 2AEHA 4J9PA 3Q6BA 1QQ6A 5AKEA 4FZLA 4M6WB 5BMGA 4F8RA 4UBCA 8ICAA 2DLBA 3NUHB 3U8ZA 2M4NA 2UVVA 4F91B 4KTQA 3AQFA 8ICQA 9ICVA 3KKAC 5AM0A 1XQQA 3NY5A 4UAZA 1NK7A 1AROP 2MHJA 3H8HA 3OJUA 3VTVA 4DHZB 2IHNA 4FS1A 1QQRA 1WM3A 3E56A 2CHXA 9ICWA 4Z6FA 1LV5A 1DOIA 1K53A 1MHXA 4ANUA 5L83A 5ALGA 1SZPA 4RCOA 2MBBB 2KJ5A 1TKGA 1Y8RC 2LVQA 1WXSA 3K75D 4OVVA 3NJTA 1OW5A 1WYGA 1HJPA 3DVGY 3KYCD 5J0OA 3NVVA 2C22A 2L83A 5LXIB 4ELUA 4QNLA 3RJJA 1C4AA 1BVSA 2HTME 4DWFA 3IV6A 2IGDA 4I2IA 5AM3A 4ECUA 1NI2A 1WZ3A 2JZZA 4KN4A 1OQYA 2FLLA 1ZQLA 4F8CB 4G3XB 3ABVB 5AM5A 2B0CA 3GU3A 4GIBA 1AN8A 2ICIA 4W9HA 8ICYA 2FNJB 4EZ9A 2AQ4A 2M8SA 3DDCB 5ALKA 3PW2A 2OWOA 5IIIA 4TUSA 1J7AA 2FIFA 4MEYA 2G07A 3T3FA 1UA1A 3Q8FA 4GU2A 2FPKA 2MSNA 1U4AA 2DHZA 4JL9A 7ICHA 2LJ5A 4E3CA 2RD0A 1S0MA 5K4LA 2W9CA 3RBEA 3DBRB 4DXFA 1PGAA 2JZ3B 2JRHA 2W11A 3NS8A 3W1YA 1DYQA 1QSYA 3CWIA 3C0RB 3PZPA 4LDTD 3TMPB 3JPSA 1XF5L 1OFFA 4Q8FA 3AEDB 4II2B 2LPEA 1N2XA 3DVNV 3N32A 2MX2A
chains in the Genus database with same CATH topology
2MH7A 4ARIA 1B1ZA 1JWSD 1HEZE 3SFDB 3BVZA 1FCLA 1SJHD 3VR8B 2BBCA 3BK1A 5D7GA 4NJCA 1F2RC 2BB6A 2PKOA 3GP7A 1FIQA 1L4DB 2N9KA 3FILA 1JROA 5H92C 3P4SB 5BYQA 4YSZB 1FFVA 3HVDA 1JQ4A 2EKIA 2JX5A 3B2FA 5HFYA 1JWUD 2NMQA 3C8YA 3MP9A 2TSSA 3IAM1 1DOYA 2N7JA 4ZRQA 5HI1A 1Y56A 5EE9A 4N59A 1V8CA 2LUMA 3ZJUA 5FR3A 2AQ2B 1BUIC 3GB1A 4RH6A 4L23A 1AWDA 1F77A 4YXDB 1N5XA 2Y5CA 3EUB2 1IBXA 1L6VA 2KWDA 1YMHE 2H88B 2W3SA 2K5PA 2E3TA 2QMTA 2D5GA 4YTPB 1CJEA 3ZJVA 1UWXA 3LB8C 1PDXA 3NS1A 3L4PA 1HXYD 2WP9B 4TMAB 1FRDA 1TZOA 1CQVA 3KLSX 4XDCA 1XXGA 3VRAB 3W1SA 2GRIA 4B0EA 1SIJA 3AE9B 1ZOYB 1ET9A 1L4ZB 3W2DA 1RWSA 3BK2A 5C3JB 1FRRA 1ROEA 1TS4A 1XCTL 3V05A 2LHDA 3KWLA 1C78A 4R3DA 1QILA 2M19A 2HDEA 1N60A 2WQYB 3IAS1 4RGTA 2LGIA 1QOAA 4KGSA 1HZ6A 3PZ8A 4US8A 1NEKB 2FE8A 4GLSC 3VRBB 1LO5D 2JWUA 2WXHA 1N62A 3URYA 2V0GA 4OVZA 2KACA 2NTSA 2OHFA 4A9AA 1RM6C 2WXNA 4NAWB 3UI3A 1GB4A 5MPOA 2BS4B 1WXQA 4L2YA 1QOFA 1AW7A 3AEEB 2WXJA 3MJ5A 2K9XA 2L1AA 3I9V1 2W82A 4NAMA 1RYJA 2G9HD 4USAA 1NYQA 4P16A 4DQOC 1GAQB 1ZP0B 1C76A 2YEPF 4HKQA 3BYTB 2BT6A 1A70A 1SSNA 2JYTA 2BTEA 4LLGM 2W54A 3HRDD 2BW2A 1FD6A 1PYWD 3J9CA 3R8BA 1I4HA 2KAJA 2INNE 1IUEA 1N61A 1ZDXA 2JQRB 2WS3B 1MVKA 4KKJA 2JU6X 3AE4B 5I4DA 2KMMA 4RGMA 1C77A 4A55A 1TJEA 2Y3AA 2K3UA 4JX1C 1L0VB 4XWWA 4OZCA 1B9RA 2AQ1B 3TUOA 2W3RA 4KKIA 3W9CB 1D5XC 1I4PA 1FXAA 2WDVB 1VR9A 2RPVA 4ZYSA 1I4XA 2Z8LA 1XLPA 2WDRB 2L52A 2PLPA 4WAFA 2I38A 2WXOA 3PZ7A 1IGDA 1XLNA 2WXRA 4MM3B 1SB3C 4ZRPA 5T8IA 4A90A 1HZ5A 1ZDVA 1ZPSA 1JRPA 1BXTA 1TS3A 2XN9C 2IGGA 4JWSC 4MACA 4HRSA 2W55A 2SAKA 1MI0A 3AEFB 4CQNA 1PGXA 3ZQ4A 5D3IB 4RGOS 2AX5A 1L0XB 3U52E 1T6BX 1XO3A 3LYYA 4TQ0A 4N6EB 3V3XA 3KWVA 5HHDG 4WWMA 5BMHA 2J53A 1SE4A 2WDQB 3B9JA 2J52A 2DWQA 3NRZA 5JXVA 4WH4A 1EM7A 3R2TA 1JWMD 1YQ3B 2NTTA 2V3PA 3Q8AA 4YTNB 3T3OA 4YWGG 1YN3A 1QF6A 1TS5A 3N9YC 3ZYYX 3KQ4A 1DGJA 1JALA 3ZGZA 1N5WA 5C2TB 2RDHA 3BWUD 2M0AA 2VZKB 3AB5A 1OQQA 1YNTE 2BS2B 4RF0A 1R7SA 2BS3B 2K0PA 3BVMA 4OZBA 2QJLA 3TEZA 2DYMA 4WURA 4D2KA 2ZW0A 4HJGE 1FNVA 2LFIA 2WNMA 1T5XD 2WU5B 2JYEA 4JPSA 4M0WA 3DWGC 3BYYB 1SEBD 1UWMA 3AN1A 3AEAB 1VZ8A 4KGRA 1NVID 4ITKA 1VLBA 1L5PA 1JW9D 3IT6B 4UDUC 2CU3A 3AE6B 1CK1A 4ZHOA 3AE3B 3P1MA 3AE5B 1K52A 3TEWA 4JE3B 4YSXB 2PVOD 1KLUD 1TYGB 4P6VF 2I2YA 1JCKB 4GDLB 3W5VB 1QLBB 2JSVX 1HQRD 5TSSA 3DWMA 3E9SA 1I7HA 2PW9A 1P7FA 1KLGD 4MT5A 3CIRB 1BMLC 2J42A 4NZLB 4RGNA 1SF0A 1C79A 1Q10A 3P63A 3SR6A 1K50A 1UUPA 1VJKA 3TEYA 1E6EB 3GS2A 4C7YA 3AM9A 3NVYA 2FBWB 1EWCA 3OWEB 4HROA 1FNUA 2QSDA 2M56B 1QOGA 1NI3A 1FMAD 2VZKD 1TS2A 1K51A 1F2RI 1GPXA 1ZUD2 1VZ7A 1T3QA 1ENFA 2OEDA 1TKEA 4DXGA 3VR9B 3U7ZA 4YSYB 3RPFC 1MPEA 2G1EA 4XDDA 4A6QA 1EWYC 3FAHA 3FC4A 2ACZB 3AMZA 5E6JA 1TY2A 1VDVA 2E6XA 5G5HA 2WLBA 4XWTA 2GB1A 4TSSA 2PIAA 2R61A 1TY0A 1YN4A 3BVGA 4JWUC 1WGKA 1JWAD 4RF1A 4L1BA 1FEHA 2DYOA 3Q8EA 1E0ZA 3AEBB 2H89B 2MJ3A 4LTUA 1F0ZA 1I4GA 1SE3A 2BB5A 2WXLA 2Y5PA 3AV8A 2MJEA 4AQ7A 2L32A 1AYFA 2IDYA 2EELA 3AE2B 1KF6B 4C7ZA 2K22A 5FKAC 2DBYA 1NENB 2KN4A 2ZW1A 5H8YE 1PGBA 1V97A 1E9MA 1FFUA 2AQ3B 1KH0A 2IPKD 2YEPB 4LK0M 3HVZA 2SEBD 2MJDA 3P42A 3IT4B 1C4CA 3AE8B 3BZDB 1ZXIA 1RFKA 1C4PA 3R2IA 1EU3A 2BYTA 4TQ1A 1QOBA 3P4PB 3Q69A 3TEXA 5G5GA 1I4RA 4IOIE 3VQIA 4N58A 4YTMB 3AE1B 2ONQA 3IXSA 3TSSA 1QKZA 1ZE3D 3P4QB 1J7BA 3LXFA 1IGCA 1XLQA 4C80A 2GI9A 2N9LA 1MHHE 1HA5A 2RMMA 2PTLA 1C9FA 4WQMA 1JMLA 1DOXA 4OW0A 4US9A 1V1PA 3NVZA 4REZA 1STEA 1KRHA 2CJNA 2PMVA 2QEJC 2WXMA 1GB1A 1CZPA 1FCCC 4IKGA 4OZAA 4H2AA 5GXGB 4KX6B 2KQ4X 2WXFA 2WU2B 2V4IB 2X38A 2IJ0A 4ARCA 3W5UB 2IGHA 1FM0D 1XEEA 3AECB 3AE7B 2FUG1 3EA6A 4Q2JA 4O1NA 2WXIA 4GDKB 2WXGA 1E10A 5HG2A 3HUIA 4RFBA 1SBBB 1XLOA 1FO4A 1N63A 5EE1A 4ZHPA 4FXCA 1ESFA 3BIID 1L0YB 3AEGB 1ZXHA 1SXTA 1KTKA 3ETRA 5BYSA 1VRAB 1PUTA 5D3DA 2LJIA 2JXTA 2QIEB 1J7CA 1JWBD 1WRIA 1NYRA 2WXKA 3B2GA 4HKZE 2CJOA 3Q8CA 3O13A 2J4XA 1EU4A 3FILB 1V1PB 1I4QA 3SFEB 4YT0B 4B0MA 5BMGA 1QT9A 2LHEA 2DLBA 2INPE 3NUHB 3U2SC 1VZ6A 1L6UA 4IDIA 3MFGA 3MHZA 4OHJA 1SJED 5AUKA 3H8HA 3WCQA 4MH8A 1QQRA 3E56A 2N0SB 2PVGC 5BMIA 2JZPA 1YJIA 4XE0A 5FK9C 3SEBA 1FNWA 1DOIA 1K53A 1MHXA 4J3OD 3MC0B 2XNAC 1IBXB 1TKYA 4RCOA 2ON8A 1D5MC 1WSPA 1OQRA 1TKGA 1ACCA 1WWTA 1E7PB 1WYGA 3PO0A 5AUIA 1YQ4B 1V1OA 3T3NA 3NVVA 2L83A 4C56C 1UGJA 1FXIA 1C4AA 4KGTA 2HTME 2Q5WD 3ZJTA 1KFYB 1PFDA 1D4BA 2IGDA 1YJJA 4RNAA 5EE3A 1ET6A 2V3NA 3ABVB 4EE2A 1YN5A 1AN8A 2ICIA 1GOZA 4A8XC 2WXQA 1SE2A 5EE0A 2QILA 4WIPA 3I57A 3Q8BA 1D6EC 1J7AA 3P4RB 3Q8FA 4ZOHC 1D5ZC 4HEA1 4DXFA 1XCQL 5LNK1 2MEKA 1PGAA 2WXPA 5BYRA 2LEKA 3NVWA 1DYQA 3AH7A 3RFZB 3CWIA 3EGRA 3NZ3A 4PT5A 2B76B 2LMCA 3U4EG 4AS1A 2RDGA 1P7EA 1M4VA 2KDMA 1XF5L 1OFFA 3AEDB 1UNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MH7 A;  3P63 A;  3AE7 B;  3SR6 A;  1VJK A;  3SFD B;  4JX1 C;  1L0V B;  1E6E B;  4C7Y A;  1B9R A;  3AM9 A;  3NVY A;  2FBW B;  3VR8 B;  4HRO A;  2W3R A;  2PKO A;  2M56 B;  1FIQ A;  1E10 A;  3W9C B;  3HUI A;  2WDV B;  1FXA A;  1QOG A;  1NI3 A;  1FMA D;  1JRO A;  1XLO A;  1FO4 A;  3P4S B;  3P4R B;  5H92 C;  1XLP A;  4YSZ B;  1N63 A;  2L52 A;  1ZUD 2;  1FFV A;  2WDR B;  4FXC A;  5EE1 A;  4ZHP A;  1GPX A;  2EKI A;  3BII D;  1T3Q A;  2JX5 A;  3AEG B;  3B2F A;  1TKE A;  1XLN A;  3VR9 B;  1SB3 C;  3ETR A;  4YSY B;  3RPF C;  1PUT A;  2G1E A;  1DOY A;  1EWY C;  1JRP A;  3FAH A;  3FC4 A;  2ACZ B;  3AMZ A;  5EE9 A;  4JWS C;  4N59 A;  2QIE B;  1J7C A;  4HRS A;  1JWB D;  1V8C A;  1VDV A;  2W55 A;  1WRI A;  1NYR A;  3B2G A;  5G5H A;  2WLB A;  2CJO A;  3AEF B;  1AWD A;  4YXD B;  2PIA A;  3SFE B;  1N5X A;  2Y5C A;  2AX5 A;  3EUB 2;  4YT0 B;  1L6V A;  1QT9 A;  2H88 B;  1XO3 A;  4JWU C;  1WGK A;  1JWA D;  2W3S A;  4N6E B;  1L6U A;  4IDI A;  2K5P A;  4WWM A;  2E3T A;  4YTP B;  1CJE A;  5AUK A;  2WDQ B;  3LB8 C;  3AEB B;  1PDX A;  2H89 B;  1E0Z A;  3NS1 A;  3L4P A;  2MJ3 A;  2WP9 B;  4LTU A;  1FRD A;  3WCQ A;  3B9J A;  1F0Z A;  3VRA B;  2DWQ A;  2N0S B;  3NRZ A;  2PVG C;  3AV8 A;  1YJI A;  2MJE A;  1SIJ A;  1YQ3 B;  3AE9 B;  1AYF A;  1ZOY B;  4YTN B;  1RWS A;  1DOI A;  5C3J B;  1FRR A;  1ROE A;  3AE2 B;  1KF6 B;  1TKY A;  3KWL A;  1OQR A;  4C7Z A;  1TKG A;  2K22 A;  1QF6 A;  2DBY A;  1NEN B;  2M19 A;  5H8Y E;  3ZYY X;  1N60 A;  1WWT A;  1V97 A;  1E9M A;  1FFU A;  1WYG A;  1E7P B;  1DGJ A;  1JAL A;  1YQ4 B;  2WQY B;  3PO0 A;  1N5W A;  1QOA A;  5AUI A;  5C2T B;  3AB5 A;  3NVV A;  3HVZ A;  2L83 A;  2MJD A;  1OQQ A;  4US8 A;  1NEK B;  2BS2 B;  1FXI A;  3VRB B;  2HTM E;  1R7S A;  1N62 A;  1KFY B;  1PFD A;  1ZXI A;  2BS3 B;  1RFK A;  2Q5W D;  3AE8 B;  2QJL A;  2OHF A;  1QOB A;  1RM6 C;  3P4P B;  4A9A A;  1YJJ A;  5G5G A;  5EE3 A;  3ABV B;  4N58 A;  4YTM B;  5MPO A;  2BS4 B;  1WXQ A;  3AE1 B;  1QOF A;  2WU5 B;  3AEE B;  3DWG C;  5EE0 A;  2K9X A;  3P4Q B;  1UWM A;  3AN1 A;  1J7B A;  3LXF A;  1RYJ A;  3AEA B;  1J7A A;  1NVI D;  4USA A;  1NYQ A;  1VLB A;  4C80 A;  1XLQ A;  1L5P A;  1GAQ B;  1ZP0 B;  4ITK A;  1JW9 D;  2CU3 A;  4WQM A;  2BT6 A;  1A70 A;  3AE6 B;  4ZHO A;  3AE3 B;  3P1M A;  1DOX A;  4US9 A;  4ZOH C;  3AE5 B;  3NVZ A;  2W54 A;  3HRD D;  4YSX B;  2PVO D;  1JQ4 A;  1KRH A;  2LEK A;  2CJN A;  3NVW A;  1TYG B;  3AH7 A;  3CWI A;  4P6V F;  1CZP A;  2KAJ A;  1IUE A;  1N61 A;  2B76 B;  2JQR B;  1QLB B;  2WS3 B;  5GXG B;  3W5V B;  4KX6 B;  2WU2 B;  3DWM A;  1I7H A;  3AE4 B;  2KMM A;  1OFF A;  3AED B;  3W5U B;  3CIR B;  1FM0 D;  1TJE A;  3AEC B;  1SF0 A; 
#chains in the Genus database with same CATH topology
 2LWP A;  2FUH B;  3I76 A;  4R63 A;  1LQB A;  1I42 A;  1FCL A;  3WK6 A;  1KBU A;  3MR5 A;  3A4R A;  3VR8 B;  4BKG A;  4EZL A;  4JV1 A;  3BK1 A;  2RHF A;  5D7G A;  5J18 A;  2BB6 A;  5EDS A;  5AK4 A;  5AKZ A;  1FIQ A;  1ZQM A;  3CF6 E;  2DAJ A;  3UIP B;  3FIL A;  4M8M A;  3OJ3 A;  5H92 C;  3BZC A;  4O3N A;  1MA7 A;  2AHO B;  3LDA A;  3S2A A;  5J0Q A;  5IIK A;  5BOL A;  4B9T A;  2Z59 B;  3ZDT A;  5HFY A;  4QZB A;  5JTI A;  2LM4 A;  3MP9 A;  1P0R A;  4N59 A;  4M04 A;  1F44 A;  3ZJU A;  3DBH B;  3ZNH B;  2D3D A;  1BUI C;  3WAM A;  3M7D A;  1H38 A;  2J0M A;  3JYU A;  4L23 A;  3MHS D;  4F4Z A;  2CHW A;  4EUT A;  3N28 A;  2W9C B;  4MSQ B;  2FI1 A;  8ICJ A;  2NBW B;  2ES6 A;  4XRH A;  3A9K A;  4XDC A;  3L4P A;  2NS5 A;  2QC8 A;  4DL7 A;  4GIV A;  3CW2 C;  2V4R A;  4KLM A;  1P3Q U;  4DFP A;  2LD9 A;  1L2N A;  1ZQY A;  2MU2 A;  1L4Z B;  1QCK A;  2L3Z A;  3GZF A;  5DKW A;  1FRR A;  4UAV A;  2N1R A;  2RRD A;  5HR7 A;  1TS4 A;  2NVU I;  1XCT L;  2LHD A;  4Q44 A;  1HUO A;  3KWL A;  5ALN A;  2GBN A;  2DQN B;  2HDE A;  1K8R B;  4RQ6 A;  2LGI A;  1QOA A;  2VJ4 A;  4DSF A;  1YX6 B;  1HZ6 A;  4US8 A;  4U7C A;  1XSL A;  4LNK A;  3M3J A;  3IM1 A;  1E7V A;  5ALF A;  1ZQA A;  3VUW A;  2A3V A;  1DRG A;  5AM4 A;  1X1M A;  2OHF A;  3PML A;  1RM6 C;  3O0F A;  3A0H U;  4QZA A;  2IO1 B;  4GMV A;  4B6W A;  4AYB C;  2HHU A;  1WXQ A;  4YXJ A;  2HVI A;  2RDB C;  3MJ5 A;  2KFZ A;  2K9X A;  3QK0 A;  3JPO A;  1RYJ A;  3RN9 C;  2G9H D;  3B0Y A;  3PSF A;  2BCS A;  4P16 A;  5KAF U;  4HKQ A;  2BT6 A;  1A70 A;  1J2M A;  4O9M A;  2MSE D;  4W9I A;  1SSN A;  3UF8 A;  4JQW C;  3HRD D;  3SEN A;  3A9K B;  4YMN A;  3I63 C;  1FD6 A;  3MAB A;  4IRC A;  4F7Z A;  1I4H A;  4NQL B;  4F1S A;  1IUE A;  3VVW B;  3UGB B;  2WS3 B;  2C2R A;  2IOH A;  1MVK A;  5D49 A;  4C00 A;  3AE4 B;  3RAQ A;  1P7D A;  1WCL A;  3J81 j;  4RGM A;  8ICF A;  4EX7 A;  3QUB A;  1NZP A;  3NAS A;  3QU4 A;  1TJE A;  2Y3A A;  4HPP A;  4KLE A;  1BT0 A;  1L0V B;  2KTR A;  4G0N B;  2OOB B;  4WQO B;  2AQ1 B;  4J9O A;  1SKW A;  5HKH A;  5BOM A;  4P1C C;  2BCU A;  1COK A;  4KLU A;  5ALH A;  1D5X C;  1I4P A;  1VR9 A;  1RPL A;  1I4X A;  2Z8L A;  4P4M A;  4KLH A;  1EUV B;  4B9U A;  2ASQ A;  3VTU A;  5LXH A;  4J9S A;  2KXJ A;  4WAF A;  4AUQ C;  2J0J A;  5DLG A;  3PMN A;  4YP3 A;  1U49 A;  2JUO A;  1IGD A;  1XLN A;  2WXR A;  5T8I A;  1SB3 C;  5AI8 A;  1ZDV A;  4BKS D;  2XC9 A;  8ICR A;  4MGZ E;  2G09 A;  2K8C A;  4MAC A;  2IHM A;  3G6X A;  1QZE A;  4J03 A;  5J29 A;  2JWZ A;  1ED1 A;  4W9J A;  4F5P A;  4F5O A;  3OJS A;  4PHD A;  2JRI B;  3KD3 A;  1PGX A;  3UXN A;  7ICJ A;  1DK3 A;  3Q3J A;  4DQQ A;  5D3I B;  4IWO A;  1L0X B;  2I5H A;  1X9X A;  4HLE A;  1IYF A;  3TFR A;  2BR0 A;  4N6E B;  2ZUD A;  3HK0 A;  2J6T A;  3QYP A;  5JUM A;  1SE4 A;  4JGH B;  2E8N A;  4CGZ A;  5CHF A;  3PW5 A;  3KOO A;  2Z0D B;  3QZ8 A;  1PK3 A;  2J52 A;  3N7R C;  2K89 A;  5JXV A;  4QWB A;  3SYZ A;  1YX5 B;  2HBJ A;  4G9B A;  2V3P A;  3Q8A A;  4M02 A;  1RQL A;  4PH5 A;  4R64 A;  4MEL A;  3T3O A;  4NAW A;  2CPR A;  1ZRN A;  3WA0 A;  5ALZ A;  9ICN A;  2DX5 B;  1TS5 A;  1E5W A;  3ZYY X;  1S10 A;  4QAY A;  4Y2R A;  1DGJ A;  4A3O A;  9ICP A;  5C2T B;  3V6H A;  4FJV B;  3RZW C;  3AB5 A;  3VUY A;  1OQQ A;  2W9B A;  1Q3U A;  4RF0 A;  3C29 A;  4Z6E A;  5KT7 A;  4EBD A;  2FMS A;  2K0P A;  3UM9 A;  2K25 A;  2M17 A;  3R7R A;  4W9D A;  2QJL A;  2K8C B;  1NK4 A;  4FJZ A;  3OSP A;  2DKZ A;  4DF4 A;  2O2V A;  5J0Y A;  2DYM A;  2DUY A;  4WUR A;  4BBN F;  4YD1 A;  2XCP A;  2WNM A;  2W04 A;  4I29 A;  4ZRI A;  5HHH A;  3DBS A;  4ECS A;  4M0W A;  8ICH A;  1SEB D;  5J2G A;  2KX0 A;  2N7D A;  5AKH A;  1D8Y A;  9ICF A;  3LVW A;  3ZNG C;  5E79 U;  4DFJ A;  3IT6 B;  4UDU C;  1JMS A;  3I3T B;  1ZQN A;  3RR8 A;  3ZKJ C;  1CK1 A;  4RT3 A;  4ZHO A;  3P1M A;  5JHB A;  1NK6 A;  1TK0 A;  1KRP A;  2WX0 A;  5AI5 A;  1WR1 A;  3KTQ A;  2Y0S C;  3QNM A;  3ISB A;  1ZQO A;  4OJL A;  4P6V F;  2BPG A;  3W5V B;  2BCR A;  1QLB B;  4W9L A;  1HQR D;  3EWA A;  4AP9 A;  1VJ5 A;  2XGQ A;  4UB2 A;  4F50 A;  5KT5 A;  2PE9 A;  4DBG A;  1NKB A;  3RI7 C;  5KFG A;  3CIR B;  2P6R A;  4UB8 U;  2C7H A;  1SF0 A;  2UWQ A;  2KOB A;  1PUZ A;  3SR6 A;  1VJK A;  1E6E B;  4ZYN A;  2HDO A;  1RXV A;  3U30 A;  3NVY A;  1JI7 A;  2HVH A;  8ICU A;  4C4R A;  3OWE B;  2UVU A;  4HRO A;  1K1S A;  2NYV A;  2RP5 A;  1T7P A;  3DBR I;  2M0X A;  3UMB A;  4IRD A;  2CN1 A;  1NI3 A;  2FE9 A;  3ALR A;  1OGW A;  4I6L B;  5DPW A;  3VFK A;  4JWN A;  2O2V B;  4M8N A;  5IOI A;  2A19 A;  2K4I A;  1L3U A;  3U7Z A;  3RPF C;  1MPE A;  2G1E A;  4XDD A;  4M0W B;  3APF A;  1P98 A;  3V7K A;  3LWL A;  3D32 A;  4RPY A;  3Q8S B;  1HTO A;  2BHN A;  4XWT A;  1P1A A;  4TSS A;  1V85 A;  2UU7 A;  3EFC A;  1TY0 A;  2D3G A;  1O03 A;  2LYH A;  3RAX A;  3QJZ A;  2W8K A;  1WGK A;  2J6U A;  1F0M A;  4DOB A;  3RTV A;  1FEH A;  7ICU A;  3Q8K A;  2B21 A;  1SGH A;  2DYO A;  3Q8E A;  1B43 A;  1E8Z A;  2PFN A;  2HJ8 A;  2ZIU A;  5D46 A;  4W9E A;  4FZM A;  3RJK A;  2RPQ A;  2ZXI A;  1I4G A;  1SE3 A;  5D2M B;  4QZ8 A;  3FYH A;  4LZD A;  2D10 A;  1WR6 E;  3NUQ A;  3M9O B;  2L32 A;  4Q43 A;  1AYF A;  3JPT A;  4Y2V A;  3DBH I;  5D4B A;  4DDG D;  1Z00 A;  2ZVO A;  4DCC A;  5J0U A;  3T5J A;  5L1I A;  2K22 A;  5DPS A;  5FKA C;  4A20 A;  4MGI E;  3ECI A;  2ZW1 A;  1ZD5 A;  2KN4 A;  5H8Y E;  2G5H B;  1L7N A;  1V97 A;  1EO6 A;  2ISO A;  3Q3M C;  2YY6 A;  1M6Y A;  3HX0 A;  2XY5 A;  1V5T A;  3EHV A;  3P42 A;  2FDR A;  3IT4 B;  4NPN A;  2XK5 A;  2MCN B;  1JXE A;  3E0F A;  4JK1 A;  5AI4 A;  1EU3 A;  4AOF A;  4ED2 A;  1QOB A;  1T0S C;  3TEX A;  4C8K A;  5AZG A;  3VH4 B;  3ZDM C;  4N58 A;  3RFA A;  2C2E A;  3IXS A;  2WF8 A;  3EW9 A;  4YMO A;  5ALT A;  3SHQ A;  1UPH A;  3SAH A;  1IGC A;  1HA5 A;  2KNJ A;  4DOC A;  1K1Q A;  1BPD A;  1SXD A;  2HOQ A;  2Z7J A;  1V1P A;  4NLZ A;  2KYW A;  3QA8 A;  4WJP A;  4IC9 A;  4IQU A;  1X9W A;  3SAF A;  4NLG A;  4KDL B;  3ICX A;  1S3S G;  9ICT A;  3TL5 A;  4IR9 A;  2WXM A;  1URJ A;  1GB1 A;  1CZP A;  4CRX A;  3ZW3 A;  3IN5 A;  5ALO A;  3WK4 A;  4QJF B;  2H3I A;  2XVT A;  2V4I B;  3JSV A;  3RT3 B;  4RMA A;  2LBO A;  4Y2Y A;  2RQ5 A;  5AI6 A;  4UAW A;  4FHK A;  5GMV A;  2HOI A;  1EF5 A;  1FM0 D;  4PJ0 U;  2KD1 A;  3AE7 B;  3PSI A;  4JMU A;  4YMM A;  1VD2 A;  3WKD A;  3E2E A;  2ATL A;  1SL1 A;  4BXO A;  1WCN A;  4Y2J A;  4I28 A;  1IIP A;  3WKB A;  2JEG A;  1A77 A;  1ZQQ A;  1E10 A;  2LKY A;  2ZIV A;  2XK5 B;  2ZUC A;  3QXG A;  5EE1 A;  5KFA A;  4DL2 A;  3RH4 A;  2IYD B;  4DHJ B;  3C21 A;  4NL9 A;  1SXT A;  3QX7 A;  3ETR A;  3JPQ A;  4DL3 A;  1PUT A;  2LJI A;  1WGR A;  5D3D A;  2C7M B;  4PHA A;  3RH5 A;  5J0R A;  4NLB A;  5CRX A;  4PL1 A;  2WHI A;  1JWB D;  3BS5 A;  2WF9 A;  4TQR A;  2KO3 A;  2WXK A;  5KL1 B;  1TVA A;  1N48 A;  2GLE A;  5ALI A;  8ICV A;  3O13 A;  1ZQP A;  2EMT A;  1V1P B;  4U6P A;  4IS7 A;  1PZN A;  3PO4 A;  1I4Q A;  4XQ8 A;  3K9P B;  3K9O B;  3SFE B;  4B0M A;  1QT9 A;  5KFX A;  1RFA A;  4W9F A;  1MC8 A;  3AUO A;  2INP E;  2DNF A;  4DS5 A;  2NPT A;  1VZ6 A;  5KT3 A;  3Q8M A;  3MHZ A;  4OHJ A;  2HHV A;  1SJE D;  1PQS A;  2GH1 A;  5AUK A;  3JSV B;  4C0Z A;  4CDG A;  1YIW A;  5E6P A;  2KTF A;  5T14 A;  2JXX A;  2N0S B;  5BMI A;  2KOX A;  5CB1 A;  3AI5 A;  3GFK B;  3BJY A;  1YJI A;  4XE0 A;  1QH9 A;  2F3N A;  4Y2X A;  3QAR A;  1SKS A;  1KFS A;  4J3O D;  1UT8 A;  5KFW A;  1IBX B;  1FEZ A;  2K1F A;  4BXO B;  1TKY A;  1WE7 A;  1WSP A;  2LGD A;  3BQ7 A;  1WWT A;  4IM2 A;  4UAS A;  2RGF A;  2YMP A;  5JU5 A;  2GOL A;  5CR0 A;  3GZN B;  1C3T A;  4F4Y A;  1L7O A;  1TAM A;  3UIN B;  3NGD A;  9ICU A;  2HBK A;  4F5Q A;  4GLX A;  5DG7 A;  2WF7 A;  3VCB A;  4P7I A;  1T3N A;  5DGA A;  2IZV B;  2NRV A;  4JB3 A;  3ZTD A;  3JVZ X;  3A0B U;  2NBU A;  1RDF A;  3QU5 A;  1GOZ A;  5EE0 A;  2F44 A;  2PPH A;  3CST A;  2QIL A;  3PPA A;  3Q8B A;  4YL8 A;  4BKT A;  1JX4 A;  3P4R B;  3BZK A;  4CF5 A;  2NPT B;  7ICS A;  1DOX A;  2KKV A;  4EZJ A;  1CMX B;  5DPT A;  2J7Q B;  1LGR A;  5AKX A;  3IHP C;  1WH3 A;  1D5Z C;  5BPC A;  1QTM A;  5J8Y C;  4DFD A;  1MJD A;  1XCQ L;  4URK A;  2L76 A;  2LEK A;  5J0S A;  3NVW A;  3AH7 A;  2REX A;  4PT5 A;  3NZ3 A;  1WG8 A;  4ECY A;  4K7U A;  2CKH B;  5G55 A;  5DCN A;  3UQB A;  2D8C A;  2L5Y A;  4MJS B;  8ICK A;  3F2B A;  3QE9 Y;  1UNS A;  2MH7 A;  4BWJ A;  4ARI A;  1JWS D;  4TV3 A;  7ICI A;  3F2C A;  3KKA A;  3BVZ A;  4F5N A;  1E8Y A;  3TI0 A;  1SJH D;  2BQR A;  3L3F X;  2LRU A;  3HPO A;  1S77 D;  1F2R C;  1F52 A;  2JT4 B;  4KLT A;  3MC8 A;  3F5A A;  1V5O A;  1S8O A;  3RRG A;  4LZG A;  2HBM A;  3QIJ A;  5KFU A;  1Q1O A;  3QZ7 A;  5IA7 A;  2LXA A;  4YSZ B;  4M6W A;  4QZG A;  3HVD A;  4K1R B;  2JX5 A;  3S6J A;  2KQS A;  3ZNI D;  3B2F A;  4QZI A;  2EMS A;  2ZXH A;  2EKE C;  3IAM 1;  3L16 A;  4ZRQ A;  5EE9 A;  5KFK A;  4M9J A;  2KVR A;  2AQ2 B;  3GB1 A;  4RH6 A;  4LJO B;  1AWD A;  1F77 A;  5AK3 A;  4YXD B;  2JV3 A;  4X5V A;  3EUB 2;  2QAR A;  1L6V A;  4E74 A;  7ICG A;  2HSZ A;  3MGH A;  4O3O A;  4O3S A;  1YMH E;  1NKE A;  2W3S A;  2K5P A;  4RQ4 A;  3HHM A;  2KTQ A;  3NRW A;  4J9Q A;  1PDX A;  3NS1 A;  1FRD A;  1TZO A;  2D11 A;  3MC9 A;  4C8O A;  1L6N A;  1F5S A;  3K1Z A;  3W1S A;  1SIJ A;  3AE9 B;  3GQC A;  3DVG X;  1ET9 A;  3Q3N C;  2KDF B;  4KIT B;  2F76 X;  3D2N A;  1XU4 A;  4JWM A;  1OEY J;  3BK2 A;  3BQ2 A;  2IOF A;  2KC2 A;  4Q8E A;  2PFO A;  5AIB A;  2GWS A;  4UB3 A;  4IWP A;  3V05 A;  2YX8 A;  4R8U A;  1A6S A;  4R3D A;  3VUX A;  1WX7 A;  2KN5 A;  4ICA A;  4OD0 A;  2WQY B;  4RGT A;  2EDU A;  2H3F A;  4ELT A;  2FCS A;  4EOY A;  4KGS A;  4RZR A;  5J2E A;  1TK8 A;  4LVS A;  1ZQZ A;  3PZ8 A;  4MGK E;  3VRB B;  2OXO A;  4RQ2 A;  2WXH A;  1N62 A;  4QZD A;  3UPQ A;  1X9S A;  1C7Y A;  3ZRF A;  1JN3 A;  4P2H A;  3BIN A;  3KUD B;  2EZZ A;  4GSW A;  4JIO U;  2BYE A;  5L1K A;  4IG7 B;  3FDS A;  1SXE A;  4RQM A;  1E8X A;  2WXN A;  3UI3 A;  4DSE A;  2OJW A;  2W7P A;  1AW7 A;  3AEE B;  4J9M A;  2KT7 A;  3I9V 1;  2YTU A;  2QAR B;  1WFY A;  2LAS A;  3V6E B;  3M62 B;  4UAU A;  4USA A;  4BFR A;  4F92 B;  4RNO A;  4ICU A;  3A4S C;  3C2L A;  5JHA A;  1S9F A;  3BYT B;  1RZT A;  1WGY A;  3KVF B;  3SQI A;  2BTE A;  3SD5 A;  3UIO B;  2W54 A;  4K4I A;  3H40 A;  2BW2 A;  2K8H A;  4RQ8 A;  3TCA A;  3J9C A;  2XBB C;  5J2K A;  2IND C;  3R8B A;  1MN8 A;  1ZD3 A;  2KAJ A;  1ZDX A;  1N61 A;  1X66 A;  2E8O A;  5AIC A;  8ICL A;  2JQR B;  4HDQ A;  3VTW A;  3CP8 A;  4KKJ A;  1A76 A;  4UAY A;  2C2D A;  1U48 A;  2JU6 X;  4O5C A;  5KFT A;  1WX8 A;  4TKN A;  4A55 A;  3LJ3 A;  2D6F C;  9ICA A;  1IV8 A;  4DK5 A;  4R8U B;  4IUM B;  4XWW A;  4DQP A;  1B9R A;  3PHW B;  4WJ3 B;  2N7E A;  1IG6 A;  3W1S C;  2ALZ A;  4KKI A;  2WDV B;  1Q8K A;  2K60 A;  2NR2 A;  1PVQ A;  1J97 A;  2RPV A;  7ICL A;  4LNI A;  5IO9 A;  1XLP A;  2L52 A;  5L1J A;  2PLP A;  2KAN A;  2WXO A;  2W03 A;  4GC6 A;  7ICO A;  4A90 A;  4ZRP A;  2FCQ A;  2EAN A;  4J9K A;  2OH2 A;  2Y0S F;  4P0Q A;  2W8L A;  1JXL A;  1RAX A;  4ED8 A;  3H4B A;  1TS3 A;  4YN4 A;  3GDX A;  2ZUB A;  2I9G A;  4EKU A;  2FAZ A;  3ZVV A;  1L7M A;  3AEF B;  4CQN A;  1U45 A;  3RBD A;  4RGO S;  2AX5 A;  1NOM A;  4ICV A;  2IA6 A;  4I27 A;  3ZDB A;  1LM8 B;  1XO3 A;  2HHT A;  4TQ0 A;  3V3X A;  5HHD G;  1T4G A;  4WWM A;  5BMH A;  2Q4T A;  3V7L A;  3D2Q A;  4EBC A;  4ECQ A;  4QZF A;  3GIL A;  4B95 A;  2ZTD A;  2D2Q A;  3NRZ A;  3VDZ A;  3TFS A;  1WE6 A;  8ICB A;  4YTN B;  4GXI A;  1D3Z A;  3AU4 A;  2C5L C;  2MBE A;  4WJN A;  2BYV E;  4BZA A;  5J2I A;  1P9D U;  1QF6 A;  4DSK A;  4MFF A;  4Y2T A;  3KQ4 A;  3QU9 A;  5KFH A;  3ZGZ A;  1ZQB A;  1HEK A;  4KX5 A;  5ALD A;  2BKF A;  2RDH A;  4FAD A;  4B9K A;  3QEA Z;  7ICT A;  3KBB A;  2KJ6 A;  8ICC A;  5KFD A;  2HOF A;  2B6G A;  1YNT E;  1AAR A;  4DQS A;  1GNU A;  1R7S A;  5IIJ A;  4P0Q B;  4HPM B;  4OZB A;  1QLN A;  1L8O A;  2R2Q A;  5D6J B;  4YFK A;  5ALJ A;  4QZH A;  3OG5 A;  2NV3 A;  3TEZ A;  3H8M A;  4Z6D A;  4QWD A;  3MR6 A;  3EYZ A;  3WKA A;  1T0R C;  3V7J A;  1T5X D;  2JYE A;  4K3C A;  2XID A;  3DWG C;  3BYY B;  1UWM A;  4PYZ A;  3R7Q A;  3RZF A;  1HTQ A;  5KFL A;  2LVO A;  4ITK A;  1VLB A;  1Z3E B;  2FPL A;  1L5P A;  1JW9 D;  2CU3 A;  2FCN A;  2ZTC A;  3GZN I;  3AE3 B;  3AE5 B;  4JE3 B;  1WXM A;  4XGA B;  2YMM A;  2PVO D;  4YSX B;  1KLU D;  2KK8 A;  3Q8L A;  3PGE A;  4EX6 A;  2I2Y A;  1JCK B;  2JSV X;  3DWM A;  2P35 A;  1XNS A;  2PW9 A;  1P7F A;  1C1Y B;  4MT5 A;  3DCG A;  2QCZ A;  3C5F A;  2K39 A;  4KLI A;  1BML C;  2L0T A;  3GV8 B;  4NZL B;  3EPI A;  4NJ8 A;  4HAI A;  1GG3 A;  7ICV A;  1CRX A;  4EEL A;  4C7Y A;  3TIX A;  3AM9 A;  1KTQ A;  3DHG C;  1TK5 A;  1EWC A;  2WTF A;  2DFL A;  1FNU A;  5KG4 A;  2QSD A;  3PLU A;  1GUA B;  5EWF A;  1NJW A;  1S76 D;  4EZ6 A;  4EYI B;  1KJT A;  3QAQ A;  2UYZ B;  4IC7 B;  4BJQ A;  2VZK D;  3ENE A;  3RJI A;  2KD0 A;  1F2R I;  3Q14 C;  4NY0 A;  4F4K A;  4ACO A;  1PK1 A;  5C0Y A;  2K6Q A;  1T3Q A;  4B6J A;  4DHZ E;  4WJO A;  5KNI A;  4DXG A;  5KFN A;  3VR9 B;  2LYB A;  5J2J A;  3HW8 A;  1EWY C;  3LK9 A;  3AMZ A;  5E6J A;  5DQI A;  2BPF A;  3NZS A;  2JXJ A;  3AXC A;  4XX5 A;  2R8K A;  1HE8 A;  2XO7 A;  1UD7 A;  3B1L X;  3ZDA A;  4ASW C;  4DLG A;  3I1Y A;  3WK7 A;  5KG3 A;  4DHJ D;  2NCN A;  5DDM A;  1X6J A;  4OJ5 A;  4EEW A;  4NLC A;  2L8J A;  4II3 B;  3LVV A;  2A1J A;  2DZI A;  3WIM A;  1WMH A;  9ICG A;  2BB5 A;  4UB4 A;  2WXL A;  4AQ7 A;  1BNP A;  3RNF C;  4ED3 A;  2IY1 B;  4BOZ B;  4F4W A;  1KF6 B;  2FLP A;  2VJ5 A;  2VA3 A;  4M9N A;  1XSP A;  1SL0 A;  2DBY A;  4PL2 A;  3RJF A;  1KH0 A;  1PK1 B;  4LK0 M;  5J2F A;  1Z1V A;  4LCD E;  4NWI A;  1OXJ A;  2KSO A;  1HIW A;  1T8E A;  1ECW A;  5E6N A;  4F71 A;  3RUI B;  2KV2 A;  2QB0 B;  3N97 B;  2I6X A;  1ZXI A;  4C4V B;  3R2I A;  2DKX A;  1DXS A;  4FA6 A;  3QEB Z;  4B9L A;  2QLT A;  2B3A A;  5FP0 A;  3THV A;  4X57 B;  3QUQ A;  5AKI A;  4YTM B;  2WFA A;  3AE1 B;  1KL9 A;  3KHR A;  4CHK A;  2KZ3 A;  3P4Q B;  2AXT U;  3DBL B;  3IG5 A;  1ZOL A;  3MDA A;  2F8K A;  1XLQ A;  2XY6 A;  2GI9 A;  2N9L A;  2BZF A;  4GFJ A;  4NNJ B;  4OW0 A;  4US9 A;  3H8J A;  1WJ6 A;  4DXA B;  1STE A;  2VH1 A;  2A1J B;  5HML A;  7ICN A;  1WMH B;  2PMV A;  2QEJ C;  2C7N B;  2BDU A;  3KYD D;  1FCC C;  3U7D A;  4AJW A;  1B22 A;  4KX6 B;  2KQ4 X;  2WXF A;  2N4F A;  1DK2 A;  1MG8 A;  4ARC A;  1TAU A;  1V6E A;  4B9V A;  1WZ0 A;  2KEY A;  4RQ3 A;  4O5K A;  4PZO A;  4KLO A;  5L1M A;  3D2S A;  3DVN U;  4O3M A;  8ICW A;  3V62 A;  2KSO B;  4ANX A;  2QKQ A;  3EEC A;  4OJP A;  4KSL C;  3HUI A;  5HG2 A;  3RH6 A;  5DDY A;  1GC6 A;  2OJR A;  1CI4 A;  4RFB A;  1SBB B;  1XLO A;  1FO4 A;  3C23 A;  2XGP A;  1S0O A;  2PE6 B;  4WWN A;  3I5J C;  4FXC A;  3N20 C;  3OHA A;  4O5E A;  1L0Y B;  3AEG B;  4OCZ A;  3C2K A;  1KTK A;  1S1Q B;  3DQV A;  3TJP A;  2HE7 A;  1A5R A;  2DZM A;  3WK5 A;  2JXT A;  4GC7 A;  4FZN A;  2G0A A;  3X23 A;  2MRP A;  3LYS A;  1NJX A;  4W9G A;  4BAX A;  4HKZ E;  4F3O A;  2CJO A;  2J4X A;  1EU4 A;  2JH7 A;  2HW3 A;  4Y2P A;  4PS3 A;  4Q45 A;  2RSU A;  4YT0 B;  4KV2 A;  3RJE A;  4IW0 A;  3T5H A;  2GBR A;  2D07 B;  3BS7 A;  4FHJ A;  2XI9 A;  1L6U A;  3MFG A;  5KFS A;  5AZF A;  4LDT B;  4O3Q A;  4MH8 A;  3RB6 A;  2PVG C;  4C4T A;  5FK9 C;  3WAP A;  2XNA C;  3Q8P B;  8ICG A;  2KK0 A;  4ANW A;  2K4P A;  1XC9 A;  5IIL A;  2MWS B;  5ALW A;  1D5M C;  2N9P C;  5ALX A;  2UVR A;  3MR3 A;  1XS9 D;  2DYB A;  2L0F A;  1OUQ A;  5KFO A;  2BCQ A;  2CR5 A;  5AUI A;  9ICQ A;  3H7P A;  3T3N A;  4PGX A;  1UGJ A;  3WK8 A;  8ICN A;  1FXI A;  1UZX B;  4GXB A;  4KGT A;  5DG8 A;  1KFY B;  1D4B A;  4K7S A;  1UT5 A;  1IXR A;  7ICM A;  3PX4 A;  2VKQ A;  1YJJ A;  5KT2 A;  5KTQ A;  3WAO A;  5EE3 A;  3JPN A;  4GXJ A;  7ICR A;  3KFU F;  1ET6 A;  2V3N A;  5KAI U;  3V6C B;  1RYR A;  3ZDE A;  4I2C A;  3JW0 X;  4UB6 U;  1SE2 A;  2WXQ A;  3C5G A;  4WIP A;  1D6E C;  1WIA A;  3GOE A;  3QUC A;  2L7R A;  2HMX A;  4A3P A;  4ZOH C;  2QB1 A;  7ICF A;  4HEA 1;  2MEK A;  1L5U A;  2ODG A;  2WXP A;  1QQ5 A;  5KG5 A;  2JPH A;  3EGR A;  3L0W B;  4MGY E;  2LMC A;  4NY8 A;  3U4E G;  4AS1 A;  4KVG B;  4AJY B;  1KEJ A;  4HYK A;  1M4V A;  3QWZ B;  1TIF A;  2F1I A;  1KDH A;  2M1M A;  3G6Y A;  1ZQC A;  4QIW C;  5L95 C;  3KZX A;  1V81 A;  2AL6 A;  1B1Z A;  2LI5 A;  1DOQ A;  1HEZ E;  3PLV A;  1T0Y A;  3H7P B;  3AL0 B;  4NJC A;  2NBV B;  5F3X B;  3EPG A;  1E90 A;  2PKO A;  1S5L U;  3A33 B;  3RNB C;  2OCE A;  2IO3 B;  1L4D B;  2N9K A;  1EXN A;  2I1Q A;  1JRO A;  4CF3 A;  2W7O A;  1R4M B;  3O65 B;  1FFV A;  1JQ4 A;  9ICM A;  3MR2 A;  3ALB A;  1J19 A;  1DGS A;  1KW4 A;  4LJX A;  1JWU D;  2NMQ A;  3DEE A;  3M8R A;  3A9J A;  3GIK A;  2N7J A;  5IIM A;  1ZET A;  1Y56 A;  4P4P A;  4YR3 A;  2N1V A;  2WWZ A;  4YG2 A;  4XA5 A;  2C28 A;  1ISN A;  2LUM A;  2ASD A;  5FR3 A;  2BQU A;  2LGX A;  2Y5B B;  1GO3 F;  5J2C A;  1SE9 A;  1IBX A;  4RM8 A;  2F77 X;  5EWG A;  3HJE A;  4HPL B;  1D8B A;  4I2A A;  4Y2S A;  2H88 B;  3C2M A;  2KP7 A;  4ECX A;  3PR5 B;  3ETL A;  3DHH C;  3TBL D;  2QMT A;  2YQE A;  4ECT A;  4YTP B;  4AP4 C;  2LGY A;  3ZJV A;  1SL2 A;  3ED5 A;  1XXG A;  3OAW A;  4W9K A;  3VRA B;  4PS8 A;  5AK5 A;  2BYF A;  3L17 A;  2GRI A;  4B0E A;  4ZRJ A;  3OGU A;  1ZOY B;  3SZ2 A;  3W2D A;  1RWS A;  2BVC A;  2PI4 A;  5J8Y A;  3NG0 A;  2ZPY A;  2K4E A;  3MTN B;  1L3V A;  2VA8 A;  1D9D A;  3Q2A C;  4ED0 A;  2Y1J A;  3PST A;  1QIL A;  2M19 A;  1RQN A;  5AI9 A;  1N60 A;  2HHS A;  3IAS 1;  4KIK A;  3MJW A;  5AKL A;  2KVC A;  3IVF A;  1WF9 A;  2YML A;  1NK0 A;  2IO0 B;  3UXP A;  2MQJ A;  2FE8 A;  4GLS C;  2BGF A;  3RB0 A;  4RQ7 A;  3M6Z A;  1LO5 D;  3A9J B;  5L1L A;  4LNN A;  4XC2 A;  4EZK A;  2V0G A;  1G6J A;  4FN2 A;  2KAC A;  4A9A A;  4G50 A;  1PVP A;  3HWT A;  5CX3 A;  2BKR B;  1GB4 A;  2BS4 B;  4L2Y A;  1U4B A;  2Q0Z X;  1QOF A;  2KKC A;  4CE6 A;  1B0X A;  2WXJ A;  2L1A A;  1KN5 A;  2BPC A;  4TQS A;  4MJS A;  3TQ1 A;  4S0R A;  4DQO C;  1GAQ B;  2DGZ A;  1ZP0 B;  3ZTC A;  4LNO A;  3IFW B;  3PRZ A;  3WKC A;  2R2O A;  2BCV A;  3WU2 U;  7ICP A;  3N3K B;  1ZQF A;  2ZEQ A;  4OJO A;  3V6K A;  2ZNV B;  3ZIM A;  4CNQ A;  3VC8 A;  3ZNZ B;  5HHI A;  9ICX A;  1WJ4 A;  4KMU A;  4TUP A;  4WWP A;  1C77 A;  1NDD A;  3H1U A;  3M95 A;  8ICE A;  2DAF A;  3DBL I;  4A8E A;  5DBC A;  2K3U A;  3L54 A;  4GB9 A;  4OZC A;  4NM1 A;  3BQ0 A;  2KDI A;  4KIK B;  4LNF A;  3RNC C;  2L05 A;  1NK5 A;  3TUO A;  1Z5S B;  2MRL A;  5EWE A;  1BPB A;  1NKC A;  1UBQ A;  2W3R A;  2ZNV C;  2WAQ F;  1RRB A;  5DG9 A;  4F5R A;  1JIH A;  2DZK A;  1X40 A;  1X2I A;  5ALR A;  2OEH A;  5DB6 A;  3H7S A;  5DBB A;  2CS4 A;  5HR6 A;  2JZB B;  1ZGU B;  2KMC A;  3R3M A;  4KLJ A;  4DSI A;  3PZ7 A;  4K3B A;  4I2E A;  4QZ9 A;  3KW5 B;  4IM0 A;  1U9L A;  1RG6 A;  3K4G A;  1BXT A;  2XN9 C;  4FFD A;  3RNG C;  2JEI A;  2NRT A;  4I2J A;  4CF4 A;  1NJZ A;  1CUK A;  4K4G A;  4RM9 A;  4ZH4 A;  1MI0 A;  4NM2 A;  4C8L A;  5KFE A;  4MH0 E;  4ACF A;  3ZQ4 A;  2AU0 A;  1WWV A;  2PMZ C;  2NRZ A;  2UVW A;  1T6B X;  2O6V A;  1D9F A;  1ZW7 A;  3LYY A;  4F2R A;  3KWV A;  2A4Z A;  2J53 A;  3QX1 A;  2HHQ A;  2FMQ A;  2WDQ B;  4GGQ A;  3KUZ A;  5KFB A;  2DWQ A;  2G5I B;  3ZDC A;  3EC8 A;  3NHE B;  3KHL A;  2R8G A;  2VIX A;  3DPD A;  2BGW A;  1JWM D;  2AGP A;  2ZCB A;  3H4D A;  4KDI C;  3M63 B;  1V2Y A;  1D8L A;  2P66 A;  4IL6 U;  3PT2 B;  2AYO B;  1COO A;  1JUD A;  2KFJ A;  5D94 A;  5DB9 A;  2BQ3 A;  3F53 A;  1N56 A;  5HNK A;  1K5O A;  2KJ9 A;  3HKZ C;  5DGB A;  2MBH A;  1JAL A;  2RLT A;  1B4F A;  3MBY A;  4DFM A;  2IBK A;  1E7U A;  2M0A A;  2YN4 A;  1X9M A;  5CWR A;  4ZDV A;  1ZYQ A;  1XD3 B;  4P1B C;  4QZC A;  3AQE A;  5BO4 B;  5KT6 A;  2BS3 B;  2KE7 A;  4UAR A;  2V9W A;  1MSW D;  3PHX B;  3OLM D;  4BX9 C;  2ZW0 A;  1RYU A;  1UQV A;  4HJG E;  5KFP A;  3M6K A;  4KSK C;  2WU5 B;  1QSS A;  2MUT A;  3FKY A;  1R4N B;  1TV9 A;  1WWU A;  4DLE A;  2E1E A;  3AN1 A;  2R8J A;  4KGR A;  2O6V B;  1V80 A;  4K81 A;  5J2H A;  3M8S A;  3ZD9 A;  4BWM A;  4MF2 A;  3AE6 B;  4UB1 A;  4DQI A;  3TEW A;  4OJ6 A;  1YZ7 A;  4DOA A;  2R18 A;  1LFD A;  2CHZ A;  2EQY A;  5F9L A;  2A5U A;  4NQK E;  1BPY A;  2AWT A;  4QW9 A;  2YMQ A;  5LLI A;  2ZTE A;  1F9J A;  2KZR A;  4GDL B;  5IIN A;  3DHI C;  1CEZ A;  3CNH A;  9ICS A;  3E9S A;  1I7H A;  5KHQ A;  1KLG D;  3D6J A;  4RGN A;  2LRW A;  1SIF A;  1LVH A;  4RPX A;  1C79 A;  4MEM A;  3P63 A;  3ZD8 A;  4FO6 A;  1YOV B;  3GS2 A;  2KWC A;  1IPG A;  5KL8 B;  3C28 A;  3PW7 A;  5KG0 A;  4KLF A;  8ICS A;  4Y2U A;  2DPI A;  3ZO5 B;  3RMK C;  4RPZ A;  1LXD A;  2M56 B;  4BOS C;  3APC A;  1SZH A;  4RUA A;  1Z19 A;  1WUD A;  4XUS A;  4YQW A;  1QOG A;  4F72 A;  3KHG A;  2ASJ A;  2LZ6 A;  1KLN A;  1TS2 A;  1K51 A;  3C19 A;  1ZUD 2;  2H3Z A;  1E8W A;  3DDH A;  5F9N A;  3ISC A;  2RDI A;  1RXW A;  3PO5 A;  2FMP A;  1H4R A;  1TKE A;  4PPX A;  1Q5W B;  5J0T A;  4AWJ A;  1XO1 A;  2MUT B;  5KG1 A;  4F4X A;  4EEY A;  3FC4 A;  2AGQ A;  2JVC A;  1TY2 A;  1VDV A;  1GC7 A;  9ICE A;  3PV1 A;  3RJH A;  5DPR A;  2WLB A;  3UQ0 A;  1QSL A;  5KFJ A;  5IKC M;  2EZY A;  2KX3 A;  2R61 A;  1ZQR A;  2WYQ A;  4JWU C;  1R4M I;  4RF1 A;  4L1B A;  2ZPN A;  4DF8 A;  4M9L A;  1V38 A;  1MQ3 A;  3UXO A;  3N7P D;  3ML8 A;  5J2R A;  2H89 B;  2MJ3 A;  4HCN B;  4LTU A;  1F0Z A;  2HJ1 A;  1HUZ A;  1QQ7 A;  2MJE A;  3BDP A;  2MW5 A;  4TUQ A;  2W9A A;  1RLF A;  2G3Q B;  1V49 A;  3CYM A;  2CXY A;  2G08 A;  5L9X A;  4ELV A;  3N1Y C;  2IDY A;  3Q8Q B;  4QW8 A;  2KWU B;  3AE2 B;  4M00 A;  4BVU C;  2IBI B;  5DQG A;  4YVZ A;  4J6I A;  4C8M A;  1SV0 A;  3UMG A;  8ICZ A;  3B0A A;  3H9D A;  1PGB A;  3DOW A;  1E9M A;  5AHX A;  1FFU A;  2WF6 A;  3PTF C;  2IPK D;  1L8L A;  3OTQ A;  2IOF K;  4PK1 A;  4GDK A;  2SEB D;  3PR4 A;  3MGI A;  2JMG A;  2NRW A;  5AM2 A;  1ZQS A;  2JH1 A;  1RFK A;  3VH3 B;  3HIZ A;  5AIA A;  4TQ1 A;  4B9N A;  1J0G A;  3P4P B;  4JUZ A;  3Q69 A;  2ZZP B;  1I4R A;  2KJH B;  4CCH A;  4FJY A;  2INC C;  2ONQ A;  3CMM B;  2AQ0 A;  2AH5 A;  1Q3V A;  2H5X A;  1WXA A;  2G4D B;  4DSL A;  2ISP A;  2KWV B;  1NK8 A;  3HP6 A;  3SV4 A;  4B9M A;  4HCP B;  4CYE A;  2N9X A;  4GXK A;  2RMM A;  2PTL A;  1C9F A;  4C8N A;  5KFZ A;  1TAQ A;  4N9F 4;  4PHP A;  4F93 B;  3NVZ A;  2LUE A;  4REZ A;  5ALU A;  2YB4 A;  5TZV A;  4M9G A;  5ALS A;  5KT4 A;  2NO4 A;  3EZ5 A;  4M01 A;  2KIC A;  4YD2 A;  1X42 A;  2BWE S;  4OZA A;  4H2A A;  4MDK E;  4MSM B;  5GXG B;  2PFQ A;  3QCA A;  1YZ6 A;  2EAO A;  5IIO A;  4DL4 A;  1ZQW A;  4B9S A;  1XEE A;  3AEC B;  4DFK A;  2WAQ C;  3ZXR A;  2ZJ5 A;  5KFQ A;  5DB7 A;  2DZJ A;  2QHO A;  1T0Q C;  3H8W A;  1GJZ A;  4BUG A;  2FJ6 A;  3EA6 A;  3NTU A;  4GDK B;  1Z4O A;  3PY8 A;  5AK6 A;  1BPE A;  4Z6C A;  5J17 A;  3L5K A;  1N63 A;  4ZHP A;  1ESF A;  2DL0 A;  3BII D;  1SV0 C;  2D3A A;  3WAN A;  2MAX A;  3R9K A;  3M9M B;  4RQN A;  5BYS A;  3SU8 X;  4WJQ A;  1SV4 A;  9ICJ A;  3QC8 B;  5ALL A;  2AGO A;  2WB1 F;  3K1R B;  1J7C A;  2P6U A;  2CU1 A;  4JLC A;  1WRI A;  3B2G A;  2MA1 A;  5ALE A;  2W43 A;  4I2D A;  4QIW F;  5ALY A;  2HHW A;  3FIL B;  4HVB A;  3PRE A;  4DL6 A;  2HCF A;  1TGZ B;  5KFR A;  3APD A;  9ICH A;  5DB8 A;  2PFP A;  3LWM A;  2LHE A;  2RDJ A;  4EEN A;  8ICM A;  3U2S C;  4IDI A;  5AM1 A;  4IRK A;  2L00 B;  9ICR A;  1N6Z A;  3WCQ A;  4J9R A;  1TBE A;  2QB0 A;  2JZP A;  4UQG A;  4K7W A;  3SEB A;  3AU2 A;  1FNW A;  3PRM B;  4C4V A;  3MC0 B;  3AUL A;  1UGM A;  2E8M A;  3N7S C;  3HM6 X;  2ON8 A;  1OQR A;  1Z4N A;  3MC1 A;  5H2F U;  2KDE B;  4YR2 A;  4RT2 A;  1ACC A;  3PZD A;  5IAA C;  1E7P B;  3PO0 A;  4NJ6 A;  4UBB A;  1V86 A;  1YQ4 B;  1V1O A;  3F5E A;  4E71 A;  4PYU A;  1Y88 A;  2C9W B;  4M9H A;  4C56 C;  2PXI A;  1KKX A;  2Q5W D;  3ZJT A;  1PFD A;  3GII A;  5J0P A;  4IQW A;  2KKP A;  3M1Y A;  1UA0 A;  4RNA A;  2GO7 A;  3BY4 B;  1KOT A;  4EE2 A;  2ZIX A;  1ZJN A;  1YN5 A;  4HXD A;  2W9N A;  1EF1 A;  2VAN A;  2KVZ A;  5DBA A;  4A8X C;  4G3I A;  2N1W A;  1ZJM A;  2I1K A;  3I57 A;  2LYA A;  3ZUN A;  3PW4 A;  2MBQ A;  4HK2 A;  4LJP B;  4O3P A;  2GBK A;  3WK9 A;  2NO5 A;  1J2N A;  5C23 A;  5IN7 A;  2ZIW A;  1YJ1 A;  2V9H A;  5LNK 1;  4OO1 J;  5BYR A;  1WXV A;  4I2H A;  3RFZ B;  3FM9 A;  4ECV A;  3PX6 A;  1UEL A;  3TAP A;  2XEW A;  3RD2 A;  2B76 B;  4HDO A;  4NLN A;  2RDG A;  1P7E A;  3WKE A;  2KDM A;  3N1Z C;  2ZJA A;  4RQ5 A;  2FID A;  1ZD2 P;  2FCM A;  4P0P A;  1R4N I;  4KMO B;  2M0N A;  2KJR A;  2K8A A;  1ZRM A;  3SFD B;  1ZQH A;  3CSF A;  4KN7 A;  2F8L A;  2BBC A;  5CHV C;  4XZ4 A;  2PEA A;  1BNO A;  5GTH U;  4CO7 A;  2KIW A;  1ZQG A;  3GP7 A;  2WF5 A;  5JRT A;  3R66 C;  2LHT A;  5CHW A;  3VXW A;  3QHT A;  3ONS A;  1JRU A;  2GBJ A;  3AEV A;  3P4S B;  5BYQ A;  3GV5 B;  2V1Y A;  3V72 A;  2N9E B;  2EKI A;  2V3S A;  3OHB A;  3M9N B;  3RNE C;  8ICX A;  3F2D A;  4EYH B;  2J0K A;  3C8Y A;  2ZIX B;  1XWL A;  2F1H A;  2TSS A;  1DOY A;  1BPZ A;  4YR0 A;  2KTR B;  5HI1 A;  4NV0 A;  5B66 U;  3KHH A;  3QU7 A;  5KG2 A;  2BQQ A;  1V8C A;  5KG7 A;  2X8X X;  3Q3F A;  2OM6 A;  2C60 A;  5CJ7 A;  3PV8 A;  4IWQ A;  2PI5 A;  5C1Z A;  5CP2 A;  2ZIW B;  2YLM A;  1N5X A;  5HP4 A;  2Y5C A;  2LM1 A;  4FUL A;  2E8P A;  2KWD A;  2HHX A;  4TUU A;  2W9M A;  5J2A A;  1TKD A;  4R66 A;  3UQ2 A;  1KFD A;  3RF9 A;  1O08 A;  2E3T A;  2VA2 A;  2F2A B;  1WGD A;  1CJE A;  2D5G A;  1UWX A;  5JH5 C;  3LB8 C;  2LXC A;  3ZLZ A;  3N4M B;  3PX0 A;  4TMA B;  1HXY D;  2WP9 B;  3KLS X;  5ALQ A;  1CQV A;  5CEH A;  3IG3 A;  3Q8R B;  4P0P B;  4Y2Q A;  2VH2 A;  1TTN A;  3RYT A;  5TIS U;  3WAL A;  3H8S A;  3UQA A;  4WWO A;  2YB1 A;  3N1X C;  3RR7 A;  5C3J B;  4O3R A;  1ROE A;  2YVC A;  1ZQT A;  3QUT A;  1C78 A;  4PGQ A;  5AKY A;  1SWV A;  5AI0 A;  5CHG A;  3PVL A;  3JPP A;  1IP9 A;  2ZCC A;  3MDC A;  2KC1 A;  2RR9 A;  2QDF A;  4J9N A;  4RQ1 A;  5KG6 A;  2WGS A;  2BKE A;  2KMA A;  1NEK B;  4UB5 A;  2PMZ F;  4P4O A;  2JWU A;  3URY A;  9ICK A;  4OVZ A;  3DV9 A;  2KFK A;  2HI0 A;  4RNN A;  2NTS A;  5CA7 A;  4NAW B;  4MM3 A;  1WM2 A;  3T8M A;  2WX1 A;  3VAW A;  5MPO A;  1WYW B;  1I35 A;  1TFR A;  5KFM A;  5KFF A;  1ZQV A;  4JV0 A;  3TAD A;  2W82 A;  4NAM A;  3BQ1 A;  5TR5 A;  7ICQ A;  5J2D A;  1NYQ A;  3TAQ A;  1C76 A;  3IP4 B;  1FXT B;  1YQB A;  2YEP F;  2BDP A;  4I6P A;  2W9B B;  3V61 A;  2JYT A;  3T5K A;  1Q46 A;  4LLG M;  1KSP A;  4ED7 A;  5AKJ A;  1PYW D;  3HKZ F;  4BDP A;  2INN E;  3IBE A;  3OPX A;  4IM3 A;  5I4D A;  3ZI4 A;  2KMM A;  4F2S A;  2E1F A;  5J2B A;  2IY0 B;  4FBU A;  2KZZ A;  3V60 A;  4JX1 C;  1TT5 B;  4I2G A;  1U47 A;  3UMC A;  2O6V D;  1KM7 A;  1XO0 A;  2WHE A;  4PHE A;  2AJQ A;  3KH0 A;  9ICO A;  3B08 A;  5HMM A;  3GE3 C;  3TKA A;  3W9C B;  1FXA A;  1T94 A;  5KFV A;  4ZYS A;  4RNM A;  1X6I A;  2KLC A;  2KFK B;  3ML9 A;  2WDR B;  2K8B A;  4EBE A;  2I38 A;  3RCZ A;  3HIL A;  3SEI A;  1MQ2 A;  1TZ1 A;  4DQR A;  2WB1 C;  4MM3 B;  2Y9T A;  2OYY A;  3ISD A;  1HZ5 A;  4PZN A;  1OTR B;  1ZPS A;  1JRP A;  3X0W A;  2IGG A;  1SWW A;  4JWS C;  4IR1 A;  4HRS A;  2EH9 A;  2W55 A;  2SAK A;  4E0D A;  3L08 A;  3A1Q A;  4ANV A;  3EFU A;  2GBM A;  4KZC A;  5C5J A;  3ZXV A;  4J9L A;  2KHW B;  3U52 E;  2VRR B;  1Z1B A;  2HBL A;  3U26 A;  5ALP A;  3TAD C;  3V6J A;  3B0X A;  4KLS A;  5B5E U;  3AU5 A;  4W9C A;  3B9J A;  4DS4 A;  4WH4 A;  1ZQI A;  1EM7 A;  3R2T A;  2NTT A;  1YQ3 B;  2R8I A;  4RQ0 A;  4DDI D;  3KUC B;  2ZG6 A;  4ECW A;  1UH6 A;  3PRP B;  3HT3 A;  4KLD A;  4BKS A;  2R8H A;  1ZQJ A;  9ICC A;  1LB2 B;  4YWG G;  2LMR A;  5DLF A;  1YN3 A;  2JY6 A;  3BQT A;  4C4S A;  4UW9 A;  2GLS A;  2I1J A;  5J0X A;  2KDB A;  3N9Y C;  4FLH A;  2DF4 B;  1N5W A;  2K8B B;  3BWU D;  3RB3 A;  1UHU A;  2ZIU B;  4QZE A;  2VZK B;  5KFI A;  2MBO A;  3TAN A;  2BS2 B;  4ECZ A;  1WGH A;  4YCX A;  2G06 A;  3BVM A;  3N30 A;  4ECR A;  2V4L A;  1ZQU A;  3OJ4 B;  1Z00 B;  3SAG A;  3IDW A;  2D3C A;  4D2K A;  4XYC A;  3A1Q B;  4MF8 A;  1FNV A;  2LFI A;  4JPS A;  2KG5 A;  3IG8 A;  1NBF C;  3LDZ E;  4UAT A;  1YT3 A;  1UCV A;  3AEA B;  4KX3 A;  1VZ8 A;  1NVI D;  3IHQ B;  1WRD B;  3GV7 B;  4HJK A;  4RU9 A;  1WJU A;  4WAA A;  4ED1 A;  1K52 A;  5FR6 A;  3PSP A;  1NJY A;  5AKK A;  2DPJ A;  3PS6 A;  1TYG B;  2ZVN A;  4EFO A;  2K6D B;  3IRU A;  2EAP A;  4M2Y A;  2PKE A;  3SV3 A;  2KIV A;  5TSS A;  1S0N A;  4MFC A;  4G11 A;  2JZB A;  1ZQK A;  5EOZ A;  2JHD A;  4DL5 A;  3T5L A;  1C20 A;  2J42 A;  5KFY A;  3RNA C;  3SMV A;  5KFC A;  1S97 A;  1Q10 A;  4DO9 A;  1K50 A;  9ICL A;  1UUP A;  3NOB A;  3TEY A;  3H0M B;  5AKG A;  2FBW B;  3PVX A;  1BGX T;  2CRX A;  1KFT A;  1VCB A;  4IQT A;  1L7Y A;  4K4H A;  2KNB A;  4FBT A;  1WX9 A;  3TAR A;  4DSJ A;  2MA9 B;  4NXZ A;  1L3S A;  2JR5 A;  1FMA D;  2LI6 A;  5AZH A;  2KMD A;  1GPX A;  1VZ7 A;  3RRH A;  3KZI U;  1ENF A;  2OED A;  4GN1 A;  3ZRC A;  2M9N A;  2ASL A;  1WY8 A;  4QWC A;  2F1J A;  3HM3 A;  5A0L A;  3T79 A;  3PW0 A;  1V9J A;  9ICI A;  3L10 B;  4YSY B;  1KLV A;  1ZKH A;  3NZU A;  4A6Q A;  3FAH A;  3SI8 A;  2ACZ B;  2ESE A;  3MGV A;  2IMW P;  2FPM A;  1UBI A;  2E6X A;  1MG4 A;  2KFN A;  5G5H A;  2ZIV B;  2K4H A;  5ALV A;  2GB1 A;  1KQQ A;  2PIA A;  1ZD4 A;  4FE3 A;  2JEF A;  3AU6 A;  1YN4 A;  5CTR C;  3PNC A;  1IM4 A;  1YD8 U;  1H8C A;  3BVG A;  2MP2 A;  4QWA A;  1JWA D;  2XCA A;  1BPX A;  2HD5 B;  2H3V A;  3Q3O C;  2J6S A;  4PS7 A;  2NRX A;  1A0P A;  5IP4 D;  3P2B A;  1E0Z A;  5AEK B;  3AEB B;  4BBN C;  4TUR A;  4KZ0 A;  1AQ6 A;  1ZQD A;  4O0I A;  2KQ7 A;  4ZRK A;  1LKY A;  3BS5 B;  1L7P A;  4FS2 A;  4MEX A;  2Y5P A;  3AV8 A;  3I28 A;  4ED6 A;  4S17 A;  5E6O A;  2D3B A;  5G2N A;  4I6N B;  2EEL A;  2AL3 A;  2V4Q A;  2KJ8 A;  4NL9 C;  2JGA A;  5J0W A;  3QU2 A;  4YXM A;  2ZJ8 A;  2WDT B;  4C7Z A;  3H6N A;  5GTI U;  1ZQE A;  4KLL A;  1NEN B;  2BF8 B;  3RUL A;  3OSN A;  4I2F A;  1M94 A;  3SDL C;  2AQ3 B;  3C1Z A;  2PJH A;  2YEP B;  3TAC B;  4HWI B;  2EAM A;  3MFH A;  3HVZ A;  2MJD A;  3RB4 A;  1C4C A;  3AE8 B;  3BZD B;  1J8C A;  4RUC A;  1S0V A;  1XSN A;  1C4P A;  1WI0 A;  3T9L A;  3GIJ A;  1NZB A;  2BYT A;  2LGS A;  3QQ8 B;  2XIC A;  5KHO A;  1Z2M A;  3GE8 C;  8ICT A;  5G5G A;  1UF0 A;  2BPS A;  4IOI E;  3VQI A;  1ZQX A;  3G6V A;  4GDL A;  3H7I A;  1TE2 A;  3ONN A;  3SD7 A;  1NK9 A;  2DEN B;  1SKR A;  2XY7 A;  2G45 B;  3TSS A;  1QKZ A;  1ZE3 D;  2G4S A;  1FPY A;  2KLG A;  4QWE A;  3MFI A;  2EZX A;  2KHV A;  4EEK A;  4PGY A;  1J7B A;  2IO2 B;  4AYB F;  3LXF A;  2KZM A;  3H0R B;  4C80 A;  5ALM A;  2Y1I A;  7ICK A;  1MHH E;  2MP2 B;  1Q0W B;  4WQM A;  1JML A;  8ICO A;  1ZQ1 C;  4JV2 A;  2FLN A;  4BGD A;  4DEZ A;  2MLB A;  1KRH A;  1WGG A;  2CJN A;  2H3Q A;  4KLG A;  1LKY B;  2E5S A;  1NNL A;  3JPR A;  4IKG A;  8ICI A;  2WU2 B;  2X38 A;  4DWI A;  2IJ0 A;  1SGG A;  2Z0E B;  3W5U B;  2IGH A;  3ZDD A;  3E58 A;  1WJN A;  2O6K A;  2GMI C;  9ICB A;  1PVR A;  2KN7 A;  2A1A A;  8ICP A;  4R65 A;  1MFW A;  2FUG 1;  4OVU A;  3CRX A;  1L3T A;  2KVS A;  4NLK A;  3VHT C;  2KHQ A;  1F1H A;  3RJG A;  4MHV A;  4NJ7 A;  4O1N A;  4Q2J A;  2Y9U A;  2WXI A;  2ZJD A;  2WXG A;  3H0L B;  3GIM A;  2HTH A;  2JF5 A;  4MFA A;  1ZXH A;  3L13 A;  5DQH A;  1V9P A;  1XT9 B;  3ORY A;  2LVP A;  1RYS A;  2BWF A;  1VRA B;  4GOC A;  2GOW A;  4M47 A;  5JZE B;  4IQV A;  4I2B A;  2QIE B;  2JEJ A;  3PSE B;  3C1Y A;  1NYR A;  1OEY A;  2JRZ A;  7ICE A;  3Q8C A;  4KLQ A;  4M0A A;  4FBJ B;  2AEH A;  4J9P A;  3Q6B A;  1QQ6 A;  5AKE A;  4FZL A;  4M6W B;  5BMG A;  4F8R A;  4UBC A;  8ICA A;  2DLB A;  3NUH B;  3U8Z A;  2M4N A;  2UVV A;  4F91 B;  4KTQ A;  3AQF A;  8ICQ A;  9ICV A;  3KKA C;  5AM0 A;  1XQQ A;  3NY5 A;  4UAZ A;  1NK7 A;  1ARO P;  2MHJ A;  3H8H A;  3OJU A;  3VTV A;  4DHZ B;  2IHN A;  4FS1 A;  1QQR A;  1WM3 A;  3E56 A;  2CHX A;  9ICW A;  4Z6F A;  1LV5 A;  1DOI A;  1K53 A;  1MHX A;  4ANU A;  5L83 A;  5ALG A;  1SZP A;  4RCO A;  2MBB B;  2KJ5 A;  1TKG A;  1Y8R C;  2LVQ A;  1WXS A;  3K75 D;  4OVV A;  3NJT A;  1OW5 A;  1WYG A;  1HJP A;  3DVG Y;  3KYC D;  5J0O A;  3NVV A;  2C22 A;  2L83 A;  5LXI B;  4ELU A;  4QNL A;  3RJJ A;  1C4A A;  1BVS A;  2HTM E;  4DWF A;  3IV6 A;  2IGD A;  4I2I A;  5AM3 A;  4ECU A;  1NI2 A;  1WZ3 A;  2JZZ A;  4KN4 A;  1OQY A;  2FLL A;  1ZQL A;  4F8C B;  4G3X B;  3ABV B;  5AM5 A;  2B0C A;  3GU3 A;  4GIB A;  1AN8 A;  2ICI A;  4W9H A;  8ICY A;  2FNJ B;  4EZ9 A;  2AQ4 A;  2M8S A;  3DDC B;  5ALK A;  3PW2 A;  2OWO A;  5III A;  4TUS A;  1J7A A;  2FIF A;  4MEY A;  2G07 A;  3T3F A;  1UA1 A;  3Q8F A;  4GU2 A;  2FPK A;  2MSN A;  1U4A A;  2DHZ A;  4JL9 A;  7ICH A;  2LJ5 A;  4E3C A;  2RD0 A;  1S0M A;  5K4L A;  2W9C A;  3RBE A;  3DBR B;  4DXF A;  1PGA A;  2JZ3 B;  2JRH A;  2W11 A;  3NS8 A;  3W1Y A;  1DYQ A;  1QSY A;  3CWI A;  3C0R B;  3PZP A;  4LDT D;  3TMP B;  3JPS A;  1XF5 L;  1OFF A;  4Q8F A;  3AED B;  4II2 B;  2LPE A;  1N2X A;  3DVN V;  3N32 A;  2MX2 A; 
#chains in the Genus database with same CATH homology
 2MH7 A;  4ARI A;  1B1Z A;  1JWS D;  1HEZ E;  3SFD B;  3BVZ A;  1FCL A;  1SJH D;  3VR8 B;  2BBC A;  3BK1 A;  5D7G A;  4NJC A;  1F2R C;  2BB6 A;  2PKO A;  3GP7 A;  1FIQ A;  1L4D B;  2N9K A;  3FIL A;  1JRO A;  5H92 C;  3P4S B;  5BYQ A;  4YSZ B;  1FFV A;  3HVD A;  1JQ4 A;  2EKI A;  2JX5 A;  3B2F A;  5HFY A;  1JWU D;  2NMQ A;  3C8Y A;  3MP9 A;  2TSS A;  3IAM 1;  1DOY A;  2N7J A;  4ZRQ A;  5HI1 A;  1Y56 A;  5EE9 A;  4N59 A;  1V8C A;  2LUM A;  3ZJU A;  5FR3 A;  2AQ2 B;  1BUI C;  3GB1 A;  4RH6 A;  4L23 A;  1AWD A;  1F77 A;  4YXD B;  1N5X A;  2Y5C A;  3EUB 2;  1IBX A;  1L6V A;  2KWD A;  1YMH E;  2H88 B;  2W3S A;  2K5P A;  2E3T A;  2QMT A;  2D5G A;  4YTP B;  1CJE A;  3ZJV A;  1UWX A;  3LB8 C;  1PDX A;  3NS1 A;  3L4P A;  1HXY D;  2WP9 B;  4TMA B;  1FRD A;  1TZO A;  1CQV A;  3KLS X;  4XDC A;  1XXG A;  3VRA B;  3W1S A;  2GRI A;  4B0E A;  1SIJ A;  3AE9 B;  1ZOY B;  1ET9 A;  1L4Z B;  3W2D A;  1RWS A;  3BK2 A;  5C3J B;  1FRR A;  1ROE A;  1TS4 A;  1XCT L;  3V05 A;  2LHD A;  3KWL A;  1C78 A;  4R3D A;  1QIL A;  2M19 A;  2HDE A;  1N60 A;  2WQY B;  3IAS 1;  4RGT A;  2LGI A;  1QOA A;  4KGS A;  1HZ6 A;  3PZ8 A;  4US8 A;  1NEK B;  2FE8 A;  4GLS C;  3VRB B;  1LO5 D;  2JWU A;  2WXH A;  1N62 A;  3URY A;  2V0G A;  4OVZ A;  2KAC A;  2NTS A;  2OHF A;  4A9A A;  1RM6 C;  2WXN A;  4NAW B;  3UI3 A;  1GB4 A;  5MPO A;  2BS4 B;  1WXQ A;  4L2Y A;  1QOF A;  1AW7 A;  3AEE B;  2WXJ A;  3MJ5 A;  2K9X A;  2L1A A;  3I9V 1;  2W82 A;  4NAM A;  1RYJ A;  2G9H D;  4USA A;  1NYQ A;  4P16 A;  4DQO C;  1GAQ B;  1ZP0 B;  1C76 A;  2YEP F;  4HKQ A;  3BYT B;  2BT6 A;  1A70 A;  1SSN A;  2JYT A;  2BTE A;  4LLG M;  2W54 A;  3HRD D;  2BW2 A;  1FD6 A;  1PYW D;  3J9C A;  3R8B A;  1I4H A;  2KAJ A;  2INN E;  1IUE A;  1N61 A;  1ZDX A;  2JQR B;  2WS3 B;  1MVK A;  4KKJ A;  2JU6 X;  3AE4 B;  5I4D A;  2KMM A;  4RGM A;  1C77 A;  4A55 A;  1TJE A;  2Y3A A;  2K3U A;  4JX1 C;  1L0V B;  4XWW A;  4OZC A;  1B9R A;  2AQ1 B;  3TUO A;  2W3R A;  4KKI A;  3W9C B;  1D5X C;  1I4P A;  1FXA A;  2WDV B;  1VR9 A;  2RPV A;  4ZYS A;  1I4X A;  2Z8L A;  1XLP A;  2WDR B;  2L52 A;  2PLP A;  4WAF A;  2I38 A;  2WXO A;  3PZ7 A;  1IGD A;  1XLN A;  2WXR A;  4MM3 B;  1SB3 C;  4ZRP A;  5T8I A;  4A90 A;  1HZ5 A;  1ZDV A;  1ZPS A;  1JRP A;  1BXT A;  1TS3 A;  2XN9 C;  2IGG A;  4JWS C;  4MAC A;  4HRS A;  2W55 A;  2SAK A;  1MI0 A;  3AEF B;  4CQN A;  1PGX A;  3ZQ4 A;  5D3I B;  4RGO S;  2AX5 A;  1L0X B;  3U52 E;  1T6B X;  1XO3 A;  3LYY A;  4TQ0 A;  4N6E B;  3V3X A;  3KWV A;  5HHD G;  4WWM A;  5BMH A;  2J53 A;  1SE4 A;  2WDQ B;  3B9J A;  2J52 A;  2DWQ A;  3NRZ A;  5JXV A;  4WH4 A;  1EM7 A;  3R2T A;  1JWM D;  1YQ3 B;  2NTT A;  2V3P A;  3Q8A A;  4YTN B;  3T3O A;  4YWG G;  1YN3 A;  1QF6 A;  1TS5 A;  3N9Y C;  3ZYY X;  3KQ4 A;  1DGJ A;  1JAL A;  3ZGZ A;  1N5W A;  5C2T B;  2RDH A;  3BWU D;  2M0A A;  2VZK B;  3AB5 A;  1OQQ A;  1YNT E;  2BS2 B;  4RF0 A;  1R7S A;  2BS3 B;  2K0P A;  3BVM A;  4OZB A;  2QJL A;  3TEZ A;  2DYM A;  4WUR A;  4D2K A;  2ZW0 A;  4HJG E;  1FNV A;  2LFI A;  2WNM A;  1T5X D;  2WU5 B;  2JYE A;  4JPS A;  4M0W A;  3DWG C;  3BYY B;  1SEB D;  1UWM A;  3AN1 A;  3AEA B;  1VZ8 A;  4KGR A;  1NVI D;  4ITK A;  1VLB A;  1L5P A;  1JW9 D;  3IT6 B;  4UDU C;  2CU3 A;  3AE6 B;  1CK1 A;  4ZHO A;  3AE3 B;  3P1M A;  3AE5 B;  1K52 A;  3TEW A;  4JE3 B;  4YSX B;  2PVO D;  1KLU D;  1TYG B;  4P6V F;  2I2Y A;  1JCK B;  4GDL B;  3W5V B;  1QLB B;  2JSV X;  1HQR D;  5TSS A;  3DWM A;  3E9S A;  1I7H A;  2PW9 A;  1P7F A;  1KLG D;  4MT5 A;  3CIR B;  1BML C;  2J42 A;  4NZL B;  4RGN A;  1SF0 A;  1C79 A;  1Q10 A;  3P63 A;  3SR6 A;  1K50 A;  1UUP A;  1VJK A;  3TEY A;  1E6E B;  3GS2 A;  4C7Y A;  3AM9 A;  3NVY A;  2FBW B;  1EWC A;  3OWE B;  4HRO A;  1FNU A;  2QSD A;  2M56 B;  1QOG A;  1NI3 A;  1FMA D;  2VZK D;  1TS2 A;  1K51 A;  1F2R I;  1GPX A;  1ZUD 2;  1VZ7 A;  1T3Q A;  1ENF A;  2OED A;  1TKE A;  4DXG A;  3VR9 B;  3U7Z A;  4YSY B;  3RPF C;  1MPE A;  2G1E A;  4XDD A;  4A6Q A;  1EWY C;  3FAH A;  3FC4 A;  2ACZ B;  3AMZ A;  5E6J A;  1TY2 A;  1VDV A;  2E6X A;  5G5H A;  2WLB A;  4XWT A;  2GB1 A;  4TSS A;  2PIA A;  2R61 A;  1TY0 A;  1YN4 A;  3BVG A;  4JWU C;  1WGK A;  1JWA D;  4RF1 A;  4L1B A;  1FEH A;  2DYO A;  3Q8E A;  1E0Z A;  3AEB B;  2H89 B;  2MJ3 A;  4LTU A;  1F0Z A;  1I4G A;  1SE3 A;  2BB5 A;  2WXL A;  2Y5P A;  3AV8 A;  2MJE A;  4AQ7 A;  2L32 A;  1AYF A;  2IDY A;  2EEL A;  3AE2 B;  1KF6 B;  4C7Z A;  2K22 A;  5FKA C;  2DBY A;  1NEN B;  2KN4 A;  2ZW1 A;  5H8Y E;  1PGB A;  1V97 A;  1E9M A;  1FFU A;  2AQ3 B;  1KH0 A;  2IPK D;  2YEP B;  4LK0 M;  3HVZ A;  2SEB D;  2MJD A;  3P42 A;  3IT4 B;  1C4C A;  3AE8 B;  3BZD B;  1ZXI A;  1RFK A;  1C4P A;  3R2I A;  1EU3 A;  2BYT A;  4TQ1 A;  1QOB A;  3P4P B;  3Q69 A;  3TEX A;  5G5G A;  1I4R A;  4IOI E;  3VQI A;  4N58 A;  4YTM B;  3AE1 B;  2ONQ A;  3IXS A;  3TSS A;  1QKZ A;  1ZE3 D;  3P4Q B;  1J7B A;  3LXF A;  1IGC A;  1XLQ A;  4C80 A;  2GI9 A;  2N9L A;  1MHH E;  1HA5 A;  2RMM A;  2PTL A;  1C9F A;  4WQM A;  1JML A;  1DOX A;  4OW0 A;  4US9 A;  1V1P A;  3NVZ A;  4REZ A;  1STE A;  1KRH A;  2CJN A;  2PMV A;  2QEJ C;  2WXM A;  1GB1 A;  1CZP A;  1FCC C;  4IKG A;  4OZA A;  4H2A A;  5GXG B;  4KX6 B;  2KQ4 X;  2WXF A;  2WU2 B;  2V4I B;  2X38 A;  2IJ0 A;  4ARC A;  3W5U B;  2IGH A;  1FM0 D;  1XEE A;  3AEC B;  3AE7 B;  2FUG 1;  3EA6 A;  4Q2J A;  4O1N A;  2WXI A;  4GDK B;  2WXG A;  1E10 A;  5HG2 A;  3HUI A;  4RFB A;  1SBB B;  1XLO A;  1FO4 A;  1N63 A;  5EE1 A;  4ZHP A;  4FXC A;  1ESF A;  3BII D;  1L0Y B;  3AEG B;  1ZXH A;  1SXT A;  1KTK A;  3ETR A;  5BYS A;  1VRA B;  1PUT A;  5D3D A;  2LJI A;  2JXT A;  2QIE B;  1J7C A;  1JWB D;  1WRI A;  1NYR A;  2WXK A;  3B2G A;  4HKZ E;  2CJO A;  3Q8C A;  3O13 A;  2J4X A;  1EU4 A;  3FIL B;  1V1P B;  1I4Q A;  3SFE B;  4YT0 B;  4B0M A;  5BMG A;  1QT9 A;  2LHE A;  2DLB A;  2INP E;  3NUH B;  3U2S C;  1VZ6 A;  1L6U A;  4IDI A;  3MFG A;  3MHZ A;  4OHJ A;  1SJE D;  5AUK A;  3H8H A;  3WCQ A;  4MH8 A;  1QQR A;  3E56 A;  2N0S B;  2PVG C;  5BMI A;  2JZP A;  1YJI A;  4XE0 A;  5FK9 C;  3SEB A;  1FNW A;  1DOI A;  1K53 A;  1MHX A;  4J3O D;  3MC0 B;  2XNA C;  1IBX B;  1TKY A;  4RCO A;  2ON8 A;  1D5M C;  1WSP A;  1OQR A;  1TKG A;  1ACC A;  1WWT A;  1E7P B;  1WYG A;  3PO0 A;  5AUI A;  1YQ4 B;  1V1O A;  3T3N A;  3NVV A;  2L83 A;  4C56 C;  1UGJ A;  1FXI A;  1C4A A;  4KGT A;  2HTM E;  2Q5W D;  3ZJT A;  1KFY B;  1PFD A;  1D4B A;  2IGD A;  1YJJ A;  4RNA A;  5EE3 A;  1ET6 A;  2V3N A;  3ABV B;  4EE2 A;  1YN5 A;  1AN8 A;  2ICI A;  1GOZ A;  4A8X C;  2WXQ A;  1SE2 A;  5EE0 A;  2QIL A;  4WIP A;  3I57 A;  3Q8B A;  1D6E C;  1J7A A;  3P4R B;  3Q8F A;  4ZOH C;  1D5Z C;  4HEA 1;  4DXF A;  1XCQ L;  5LNK 1;  2MEK A;  1PGA A;  2WXP A;  5BYR A;  2LEK A;  3NVW A;  1DYQ A;  3AH7 A;  3RFZ B;  3CWI A;  3EGR A;  3NZ3 A;  4PT5 A;  2B76 B;  2LMC A;  3U4E G;  4AS1 A;  2RDG A;  1P7E A;  1M4V A;  2KDM A;  1XF5 L;  1OFF A;  3AED B;  1UNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...