5G5GA

Escherichia coli periplasmic aldehyde oxidase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
175
Chain Sequence
b'PAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE XANTHINE DEHYDROGENASE YAGT IRON-SULFUR-BINDING SUB
molecule tags Oxidoreductase
source organism Escherichia coli
publication title The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
pubmed doi rcsb
total genus 49
structure length 175
sequence length 175
ec nomenclature ec 1.2.99.6: Carboxylate reductase.
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 5g5gA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5g5gA01
5C3JB 1YJJA 3AH7A 1N62A 2M19A 2MJEA 3LXFA 4YTPB 3W5UB 1FFUA 1FXIA 3FC4A 2BS4B 1CZPA 3AEDB 3AV8A 1E10A 3HRDD 2WDVB 1YJIA 1TJEA 1I7HA 1WGKA 1N61A 4ZOHC 2WDRB 5AUKA 4IDIA 2H89B 2K9XA 1XLNA 1N63A 3SFEB 4ZHOA 5H8YE 1KRHA 1FO4A 1FIQA 1L6UA 1IUEA 2MJ3A 1AYFA 2EKIA 1JW9D 1E6EB 3AE7B 1DGJA 1J7BA 2WU2B 1AWDA 2K5PA 3AEAB 1DOIA 1V97A 2Y5CA 3B9JA 1ZOYB 4YSYB 1EWYC 1NEKB 1KFYB 2MH7A 2QJLA 1QOFA 4A9AA 4US8A 1L5PA 3AE3B 4YSXB 1DOXA 1SIJA 2WP9B 5G5GA 1VDVA 2PVGC 2MJDA 1QF6A 1JRPA 4LTUA 3NRZA 3ZYYX 2CJOA 2DWQA 3P4PB 4KX6B 3ETRA 1GAQB 2E3TA 4HROA 1SF0A 1ZXIA 1V8CA 3FAHA 2Q5WD 3AE2B 1NENB 2G1EA 1L0VB 1NI3A 2HTME 2K22A 3AEFB 3AE6B 1NYRA 2CJNA 2QIEB 3B2FA 3AE9B 1N5XA 4WWMA 5EE0A 1VLBA 1L6VA 1QOGA 1RYJA 1WWTA 1QOBA 3KWLA 4WQMA 2W3SA 3CIRB 5EE9A 3PO0A 4ITKA 1RFKA 5C2TB 4JWSC 3VR9B 3CWIA 2CU3A 3B2GA 3NVZA 1B9RA 3AEBB 2WQYB 5AUIA 4ZHPA 2WLBA 2H88B 3AN1A 1JQ4A 1TKEA 3HUIA 4YXDB 1OQRA 3NVYA 4HRSA 1RWSA 1NVID 4C7YA 3AEEB 4YTMB 5G5HA 2PKOA 3VR8B 1FFVA 1WRIA 3P4RB 3P63A 1E0ZA 1GPXA 1QT9A 3NVVA 1WXQA 1T3QA 3AEGB 1SB3C 1JROA 3VRAB 3DWMA 3SR6A 1XO3A 5GXGB 2L52A 1QLBB 5H92C 1XLPA 3NVWA 1J7CA 3AECB 4FXCA 4N6EB 3AE8B 4YTNB 1ZP0B 3LB8C 3NS1A 1N5WA 1WYGA 2M56B 4JWUC 4US9A 2N0SB 3WCQA 2ACZB 3P1MA 2PIAA 1PUTA 2BS3B 1FRDA 4JX1C 2KMMA 2WS3B 2JX5A 2OHFA 1XLQA 1KF6B 4YT0B 2LEKA 1E9MA 1JALA 5EE3A 1F0ZA 3ABVB 3DWGC 1CJEA 1PDXA 1QOAA 3AE4B 1OQQA 1TYGB 2JQRB 1PFDA 2KAJA 3BIID 1FRRA 3P4SB 4N59A 3RPFC 3W9CB 1VJKA 1ZUD2 2BT6A 2PVOD 2WU5B 1J7AA 2W55A 1YQ3B 3L4PA 1JWAD 1XLOA 4YSZB 1UWMA 4N58A 1YQ4B 1R7SA 5EE1A 3VRBB 3W5VB 3HVZA 2B76B 2DBYA 5MPOA 1FXAA 2FBWB 1N60A 3EUB2 3AE5B 1RM6C 3AM9A 3SFDB 3AE1B 2BS2B 2AX5A 1A70A 1OFFA 3P4QB 1ROEA 1DOYA 1FMAD 3AMZA 1NYQA 2WDQB 2W54A 2W3RA 4C7ZA 4P6VF 4USAA 1FM0D 1JWBD 3AB5A 4C80A 1E7PB 1TKGA 2L83A 1TKYA
chains in the Genus database with same CATH superfamily
4AJWA 1E0ZA 2HDEA 3ALRA 4O3MA 1Z1BA 2HD5B 1HTOA 1GB4A 3RRHA 2EZYA 3APDA 2J4XA 4HVBA 5KFUA 3VVWB 9ICHA 2QCZA 4GGQA 4FULA 1Z4OA 4W9FA 3DBSA 1F2RC 4ZYSA 3SFEB 1XCQL 1ZQLA 1QQRA 5EOZA 4KN4A 4FBTA 4TQRA 2KTRA 3MC8A 1V5OA 2NV3A 4U6PA 4EENA 2J6UA 3B9JA 2HVIA 3UQ2A 4UAUA 2V4RA 3M9NB 1B22A 1L3VA 4ANVA 2XY6A 2W9CB 2LXAA 3AE3B 4QZHA 1IM4A 2TSSA 2ZNVC 3PSIA 5ALZA 5KG3A 3C5GA 2HOFA 5KFFA 1VR9A 1ET6A 4OO1J 4F2SA 4FLHA 2M17A 2FLPA 4RU9A 2ZUDA 2ZTCA 5KFAA 2Q5WD 2AQ1B 2AYOB 1WE6A 3Q6BA 2G1EA 2IY0B 1WRDB 1MG8A 4DWIA 4TQ0A 1KOTA 4QAYA 1SKWA 2LUEA 4RQ5A 2MA1A 4PL1A 1O03A 2F8LA 1JCKB 5J2HA 1JRUA 3HJEA 4Y2XA 2KEYA 3G6VA 2FPKA 1D9FA 3BVMA 5TZVA 2VJ5A 4RQ7A 5I4DA 5FR6A 1KLGD 4P0QA 1L7PA 1UF0A 1F2RI 3PSEB 3Q8EA 3K4GA 2IOFK 4J9QA 1P7FA 3U52E 1MPEA 3T5JA 4J9KA 2WF9A 2LVQA 1ZDXA 3SI8A 1HJPA 2HDOA 2CXYA 3TAPA 2YMQA 3KZXA 3LB8C 3NS1A 1ZQNA 1KLVA 2C5LC 4RF0A 3MHSD 2ZJAA 4ANWA 2RHFA 3N7PD 1BPZA 3NUHB 2IO2B 4KZ0A 1LXDA 3TEZA 2ZIUB 3E58A 5JUMA 1AN8A 4G11A 4KKIA 1E7VA 2G07A 4CRXA 1TZOA 1QCKA 4NPNA 1L2NA 4PGXA 3ZDTA 5CHWA 3TCAA 3BIID 5KL1B 2W8KA 4L23A 5KFMA 9ICMA 2ZZPB 5AIBA 4HLEA 1SSNA 1JWAD 4JV2A 1XLOA 4U7CA 3PVXA 1D8YA 4IR1A 2LVPA 3KD3A 4JQWC 2L00B 4ZDVA 4HKQA 2W9BB 2B76B 4HCNB 2V9HA 1BVSA 1UGMA 2W04A 2BS2B 1KFTA 2NPTB 3P4QB 4OW0A 3SZ2A 3MR2A 3C8YA 3RRGA 1TGZB 3V72A 4KLOA 2O6VA 8ICCA 3BVZA 2MRPA 2C28A 1TKGA 1TIFA 1T94A 4LJPB 3Q8CA 1SE2A 2IOHA 4C0ZA 2PE9A 7ICNA 1R4MI 3H0RB 5CJ7A 4CHKA 1BMLC 3KUCB 2KLGA 2J6TA 2ZCBA 3GP7A 5H8YE 4Y2RA 3JPQA 1I4PA 2R8KA 2ZJ5A 4I2AA 2KDEB 1NI2A 2BWES 4NJ6A 8ICRA 2KKCA 4E74A 3ZD8A 1HUZA 5E6OA 2H3ZA 2G0AA 5BPCA 1KLNA 1GUAB 2M0AA 2R61A 5HNKA 3A9JB 2J7QB 4ZRJA 3WIMA 3UQ0A 4WH4A 2RGFA 1L3SA 1SKSA 2I2YA 3GIMA 2D2QA 2ICIA 4XZ4A 1VZ6A 4K7UA 1NZPA 3H8JA 1L7OA 3FAHA 3AE2B 3C5FA 2ZVOA 4DDGD 1WF9A 5KFKA 2KIVA 1RRBA 3C2MA 4FHJA 2H3QA 3RJHA 2LI5A 2KMAA 3H7PB 3AE9B 2G06A 3KHGA 2L76A 1SL2A 3S2AA 4UB6U 1LGRA 1URJA 1X2IA 2N9KA 5DB6A 4JWSC 2B0CA 3IHPC 3T9LA 8ICFA 2KVZA 2I38A 3AU4A 5ALNA 2MUTB 5DQIA 2GRIA 1X1MA 5KFBA 4UAYA 1V81A 1WUDA 2XCAA 3H6NA 3P4RB 3R7RA 1T0YA 2AXTU 3RR8A 3PTFC 4F2RA 3IG8A 2QKQA 2KNJA 2GLSA 3R3MA 4XYCA 3E56A 3N7SC 1HIWA 5B66U 1X9MA 2QSDA 1TBEA 2ASQA 1EU4A 2KYWA 8ICIA 3H8WA 2R8GA 4KIKA 3UQAA 3VQIA 1J2MA 4BUGA 2M56B 1A5RA 9ICLA 2CR5A 1C20A 2UU7A 1I4QA 1ZXHA 4B9SA 2D07B 3QXGA 3BQTA 2R18A 3HM3A 1V2YA 3BJYA 1K8RB 2LEKA 3UINB 2KDBA 5KFVA 4GXJA 2D3AA 2DX5B 1TYGB 1U49A 2XEWA 5AI6A 1L8OA 2KQ4X 2HHXA 2INPE 2ZIXB 2FUG1 4MFCA 3RB0A 5ALPA 2WXMA 4BZAA 2ASDA 5ALIA 5C0YA 3W5VB 3RB3A 3HVZA 4ED0A 5DLFA 1FXAA 3RMKC 4A90A 1X66A 4KLMA 2PW9A 2AH5A 5JRTA 2AL3A 4M0WB 2LI6A 3PZ7A 1OFFA 1QZEA 2KQ7A 4YR0A 3RNBC 2H5XA 4AJYB 2AQ3B 5ALVA 8ICJA 5KG6A 1TS2A 2G09A 3UPQA 3JPPA 3OJ4B 4M2YA 5ALQA 3TFSA 2V4IB 1QQ5A 1WCNA 5KFOA 5DB8A 2PEAA 4OZBA 1YZ6A 1TJEA 2EQYA 2ASJA 9ICPA 2L7RA 2ON8A 4FBUA 3KH0A 5IKCM 2YN4A 2H89B 4L2YA 4AP4C 4PT5A 5FK9C 2YVCA 3JSVA 1FO4A 1RPLA 4XDCA 2LHTA 4KIKB 3FM9A 4MDKE 3BQ7A 1SV4A 1ZQAA 9ICBA 3KUDB 1EM7A 3F2DA 1NJWA 1C4CA 2JYTA 2J53A 3M1YA 8ICBA 2A4ZA 5BYQA 4US8A 1SIJA 5L1IA 2VZKB 2LYHA 1JRPA 3QZ7A 1DGSA 1JWUD 2INNE 1WR1A 4HJGE 2KZRA 4GB9A 4X5VA 2ZVNA 2MP2B 3KFUF 4GIVA 1NI3A 5ALJA 2HTME 2K22A 3HK0A 3DV9A 5KAFU 2LVOA 3TJPA 2JZ3B 4YR3A 5AI4A 1RQLA 1UT5A 3IG3A 1OTRB 4F5NA 1K1QA 3H9DA 4OHJA 3RYTA 1XSLA 5AKZA 5JU5A 4GN1A 3RNGC 1ECWA 4UAVA 1NK4A 3ZDAA 2CU3A 4CF3A 1TK8A 4M9HA 3PSPA 2V3SA 2WTFA 3OAWA 7ICRA 4YXDB 2EMTA 5HMLA 4DQRA 2MBEA 3EPGA 8ICOA 3BK1A 3GS2A 1ZQWA 5D6JB 3RF9A 1RG6A 1WH3A 1BPBA 3IVFA 3APCA 4LNNA 9ICTA 1C77A 4MGYE 3TMPB 4UBBA 1X42A 4DSEA 1TS3A 1WGYA 4NM2A 2V3PA 1PK3A 2Y5PA 3L0WB 2ZPNA 3H4DA 4GFJA 1UPHA 2QC8A 2X8XX 4CGZA 2W7OA 3RCZA 1N6ZA 1XSPA 2PIAA 4HXDA 4EZKA 1L0XB 2WHEA 2JX5A 4DSKA 3ZD9A 2W43A 3R2TA 3PW4A 2K3UA 1T4GA 3LVWA 5AKXA 4O3PA 5KFXA 4I2HA 2CU1A 2JT4B 2K1FA 2FPLA 2Z59B 1OQQA 3W5UB 2SEBD 2W03A 1T7PA 3BZDB 4F7ZA 3VDZA 2PMVA 3JPNA 1P98A 2C9WB 4M02A 2DZKA 2O2VB 1IGDA 4S0RA 1WCLA 2J6SA 3RZWC 3PR5B 1YMHE 5AKGA 3DVNV 4YFKA 4M0AA 1HUOA 3B1LX 4ANUA 3L16A 4FJZA 4FBJB 1V80A 2K6QA 4OJLA 2WDQB 5DG7A 4Q8FA 4K81A 1ZQPA 2X38A 2NTTA 3V05A 8ICWA 8ICSA 3AH7A 1P0RA 2ZW1A 4F5RA 2CHWA 4IRCA 2K25A 3KYDD 1J19A 1LQBA 5J29A 4UDUC 4ZRIA 3H7IA 4DL3A 4NY8A 2QLTA 2WXFA 4LDTD 4JPSA 2KMDA 3MC0B 4F5PA 4BOSC 1L6UA 4DS5A 1NK5A 3C1ZA 1JW9D 3I28A 5ALLA 4IS7A 4FJVB 2DQNB 5ALTA 2G4DB 2JRHA 4IUMB 2VIXA 3IDWA 4DQQA 4J3OD 2WXHA 1WJNA 4ECTA 1NEKB 2MH7A 3O65B 4FS2A 3RFZB 1QSSA 3L08A 4LZDA 4QZ9A 4CDGA 3F2CA 2A1AA 3NRZA 2CJOA 1WXMA 3Q3FA 4JE3B 5F9NA 3NUQA 3VAWA 1X9SA 1V9PA 3BZKA 1ZDVA 1V9JA 4PHDA 3OJUA 4J9MA 3PW2A 1KKXA 5CHVC 4OCZA 4ED2A 3LVVA 3M62B 1MJDA 4RF1A 1O08A 4B9MA 2CJNA 3B08A 2XI9A 1WJ6A 3GE3C 2BDUA 2W7PA 4XE0A 2FE9A 1S0OA 4EE2A 2K8BB 4MFAA 1E7UA 3I57A 4M9NA 1CK1A 3M6ZA 2JEFA 4B9NA 4K4GA 4LZGA 3VUXA 3AN1A 2R8JA 1C79A 3A9KA 1IBXA 1ZD2P 2F8KA 3NG0A 3Q8LA 2KHQA 2D3BA 4QZ8A 4KGTA 4GXIA 1KM7A 1ZGUB 1GPXA 2GBMA 1D9DA 1SB3C 1JROA 3Q8BA 4XRHA 1S5LU 4NAWA 3IP4B 4QZCA 4O3NA 1QH9A 4RH6A 1X9XA 2KTRB 2JSVX 4XUSA 3KYCD 9ICQA 4YN4A 2PFNA 3VUYA 1SZHA 4UARA 1WZ3A 4I28A 4Y2QA 1A0PA 2JY6A 2F1JA 2JRZA 2XVTA 3UGBB 1HTQA 2OHFA 2XGPA 5KT6A 4QWEA 4YT0B 1D8LA 2WAQF 3ABVB 2MCNB 1Y56A 2NYVA 1F1HA 3A1QA 4MGZE 5JH5C 3H8SA 2ZIWA 3TADA 1SL1A 2J52A 3QUCA 2KSOB 4QWDA 3VXWA 3VRBB 3VUWA 4KKJA 2FBWB 2PE6B 2KOBA 1ISNA 4BKGA 3KBBA 2FMQA 3HIZA 1AROP 3ZRFA 4REZA 4DCCA 1UD7A 3MR3A 2JV3A 5AI5A 2W11A 2ZTEA 2C7MB 2EH9A 2KJ6A 4P6VF 3RFAA 1FM0D 3M63B 4B0MA 2YMPA 2BB5A 1FFUA 3AV8A 2WX1A 4HJKA 3TEYA 4Z6FA 3R9KA 2WXGA 1CQVA 2NPTA 2VA3A 5AUKA 1NKEA 4LNIA 5K4LA 3HT3A 1P7DA 2BPSA 1XSNA 5KL8B 4YXJA 3RB6A 5TR5A 1GC7A 4HCPB 2XNAC 2KMCA 3M7DA 1ZQDA 1T8EA 2EKIA 2WXOA 2IOFA 4BGDA 4MACA 2KDFB 3IBEA 2DHZA 3UQBA 1RZTA 5AZHA 3RZFA 1H8CA 3CMMB 4NM1A 3CSFA 2HBMA 3H4BA 1S0NA 3RBEA 4ZRPA 5J0QA 3QE9Y 1KDHA 1ZQEA 3N32A 1C3TA 2DUYA 2PVGC 3AU5A 1QF6A 3PRPB 4DSJA 4CCHA 1SE4A 1NJXA 1WY8A 2D3GA 2D3DA 2F76X 3CNHA 4ECYA 2DPIA 4JUZA 4Q45A 4LDTB 3WA0A 2G9HD 3RJKA 2C22A 2GBKA 1ZQYA 4DXGA 5DBCA 3KHLA 4Y2SA 4XDDA 2F3NA 4KN7A 3B2FA 3K75D 3BS7A 4RGMA 2HHWA 4Q44A 3GIJA 2KFZA 4NL9A 4YQWA 1QOBA 4B9TA 1MC8A 2W3SA 2NR2A 2CPRA 4MHVA 4I2EA 1K50A 2RR9A 2CKHB 2ZIVA 2C7NB 3BQ1A 4HRSA 1RWSA 4C7YA 2FMSA 3DQVA 4ARIA 2E1EA 1FFVA 5F3XB 1WRIA 1BT0A 2JEIA 3P63A 5JHAA 5ALWA 2AGPA 1QT9A 4JB3A 3AEGB 2CS4A 3OHAA 2MBBB 2ZXHA 3NVWA 1SE3A 3PW5A 4IKGA 1BPXA 1V1OA 1K52A 2EKEC 1LVHA 2RPVA 4Y2YA 4K1RB 4A3PA 3GZFA 1ZD3A 1KL9A 2Y9UA 3QYPA 2DF4B 4M00A 3MHZA 1CRXA 3MABA 1WX8A 2L0TA 4F4WA 3LYSA 5J2FA 3Q8FA 2HE7A 3RBDA 3BYYB 3C0RB 2KT7A 5JHBA 5CX3A 2L1AA 4M9GA 2ATLA 2MRLA 3LWLA 2W9CA 4ECWA 2KZ3A 3N1YC 1OW5A 1ZUD2 3SEBA 2JR5A 3HHMA 4R3DA 1L5UA 4A3OA 3M6KA 4YSZB 1C4AA 1ZQVA 5BYSA 3M9MB 4K7SA 3K1ZA 3TADC 3EW9A 3WAPA 3WANA 2ISPA 4GMVA 2R8HA 1UZXB 2AX5A 2PMZC 5KAIU 2J42A 3DVNU 3FILA 4IQWA 3AMZA 2FCMA 2HI0A 5HFYA 1XF5L 2BVCA 2JMGA 3NOBA 2NMQA 2ISOA 2KZZA 2QMTA 5CTRC 1SGHA 1MHHE 2KJRA 5KFZA 5J0YA 2V1YA 3C28A 4ICVA 1B0XA 3N28A 2BPCA 1Z4NA 2WDVB 4UAZA 2WXNA 5J2CA 1SE9A 5C5JA 3H7SA 5ALMA 4ECXA 1KRHA 5DG9A 4YD1A 4UBCA 4I6NB 1ZJMA 3BY4B 2GH1A 1VD2A 4NJCA 1V49A 4CF4A 4BWMA 4TUQA 3X23A 1I4XA 2ZUCA 3AUOA 4RNNA 1KFYB 2JUOA 2BYEA 5HHIA 3DHIC 1OEYA 2BGWA 2INCC 4WWNA 4QWAA 4IM0A 2K6DB 5AI0A 3VC8A 3VFKA 2LKYA 3TL5A 1GAQB 4TUUA 2NBUA 2FPMA 1M4VA 3OJ3A 1WIAA 5KFCA 1T0RC 4CYEA 1WXSA 3RH6A 2KN4A 1GB1A 4TURA 2MUTA 1ZQ1C 3IXSA 4YCXA 1MQ3A 1TE2A 1VLBA 2J0KA 3KWLA 2M8SA 5BO4B 1BUIC 2KJHB 3MFGA 3BWUD 5C23A 1AW7A 1RFKA 2E6XA 5CHFA 2BCRA 4KLUA 3ML8A 1LFDA 3OJSA 3GIKA 3PMNA 3HUIA 4EYIB 3TBLD 3ZDEA 2KG5A 2ALZA 4YD2A 4RM8A 1CEZA 4KV2A 2G4SA 4RUCA 1GOZA 2FJ6A 4ELTA 1TVAA 2C2EA 3L17A 3QJZA 2AHOB 3PO5A 4O3OA 5KFNA 1ACCA 4UB8U 3AECB 1YIWA 2A3VA 3OTQA 2UVUA 3SV3A 5KG2A 2RSUA 2KICA 2A1JA 2XIDA 1XCTL 2JPHA 1ZQZA 5J0UA 1I4RA 2KFKA 3PW7A 4HPLB 2PLPA 1A6SA 3DBHI 5KG7A 2DNFA 3Q3NC 2RDIA 3M8SA 1ZQRA 1Y8RC 4N59A 1DOQA 4DSLA 4GLSC 2PVOD 3I9V1 5IINA 3JPTA 1YQ3B 3L4PA 3PHXB 1E8ZA 1Q8KA 2E8NA 3V6KA 1L4DB 1WR6E 4M04A 4I2FA 2IGDA 1ZE3D 1JIHA 2DBYA 1C7YA 2KE7A 1GO3F 4DS4A 4ECZA 3B0AA 3IV6A 1YD8U 2D10A 3Q14C 4C8MA 4H2AA 2DKZA 5T8IA 3N30A 1ROEA 3ZDBA 5E79U 1SWVA 4MM3B 5KNIA 5DGAA 2QB0A 3BS5B 1MN8A 1WWVA 1JWBD 2N1WA 3NS8A 3PZ8A 1WX9A 3HWTA 1T3NA 3ORYA 7ICUA 3EA6A 2CN1A 1WZ0A 4AUQC 1VZ8A 1FNVA 2ES6A 2F2AB 2MBHA 3DBHB 4OZAA 2MW5A 4TKNA 4JWNA 2BYFA 2WF7A 9ICOA 4R66A 2ZEQA 4EZLA 4AYBF 3ZDDA 1Q5WB 2E8OA 1JXEA 5DCNA 2ZIUA 3V61A 1J7BA 3C23A 1RFAA 2Y0SF 3H8MA 5AKHA 4ED7A 9ICXA 4W9EA 1ZQCA 8ICGA 4KLTA 2JZBA 1QOFA 9ICSA 2N9PC 3A4SC 1SWWA 4P16A 1V38A 5J0SA 4IG7B 5DQGA 1VDVA 1UA0A 1L8LA 3JSVB 4J9OA 1TAMA 8ICXA 1TY0A 2IGHA 1ZQXA 2RD0A 5KG0A 2I1JA 3GZNB 2DWQA 3RNCC 3ZNHB 2Y9TA 1ENFA 2Q0ZX 3KQ4A 2GOLA 4HROA 4ED8A 4C4SA 4EZ6A 2GBRA 1WGHA 3ZJUA 2AJQA 1JMSA 3AEFB 2BZFA 3V7KA 1NZBA 1TAQA 1ET9A 5G2NA 3PLVA 4M47A 1WX7A 2BCQA 1Z00A 4KX5A 3FDSA 4LNKA 1HEZE 2HJ8A 4IC7B 4F92B 3Q8RB 1TAUA 2KWDA 3V6CB 3RULA 5EE9A 2I5HA 3UIOB 4RQ0A 1U4AA 3HP6A 2HVHA 2KZMA 1C1YB 3AEBB 4ZHPA 1E8YA 1KTQA 4M9JA 1TKEA 3VTUA 2P6RA 3RJGA 1D4BA 2KN5A 2PKOA 1Y88A 4QZGA 3QA8A 2WB1F 1IIPA 3CF6E 1S0VA 5J2DA 2OWOA 4BXOA 3V62A 3S6JA 3DBLB 4CQNA 1OUQA 3AL0B 3OSPA 1P7EA 1K53A 1XO3A 2JXJA 4FN2A 1BNPA 3WU2U 4E0DA 1KFDA 4DFDA 2FI1A 4RM9A 1J97A 1WYGA 3ONNA 5EWEA 4MGIE 2N0SB 2ACZB 4QIWF 2H3IA 4G3XB 5F9LA 1SXDA 2WS3B 4ZYNA 2KDMA 1EO6A 5J2EA 4I2BA 4MEXA 2NTSA 1KF6B 5EE3A 3IG5A 2RDHA 2K4HA 4RQ1A 3OWEB 2EANA 7ICSA 3N7RC 1ZQIA 1IG6A 3F53A 3RJEA 1Q10A 5D94A 3C2KA 1R4NI 4RGOS 4DL2A 1IGCA 3N3KB 2MWSB 3GE8C 3RAQA 4GU2A 3ISCA 7ICIA 2XBBC 5DB7A 1S76D 4JV1A 2YX8A 3TEWA 2I1QA 9ICVA 1OQYA 2W54A 2G5HB 1X6IA 3H1UA 2NVUI 1RYUA 2IO3B 2KHWB 2GO7A 4FADA 1DOIA 3LDAA 4RNMA 3RJIA 4BKSD 3AU6A 4NQKE 3DDHA 2QB0B 3BS5A 5CR0A 5DQHA 1FXIA 5T14A 4MM3A 3BDPA 1EUVB 4F71A 4RGNA 1E90A 3RR7A 2JZBB 2KFJA 2HHTA 4IWPA 2HHUA 4TSSA 2RDGA 3KW5B 4ZHOA 3U2SC 2WB1C 2O6VB 4KLFA 2JWZA 1XS9D 4JLCA 3UIPB 5AICA 4QJFB 3OGUA 4R8UA 4KLIA 1JWMD 3LYYA 1DGJA 2WU2B 2C2DA 4O1NA 3J9CA 2BGFA 2LGYA 2WXJA 3LDZE 5J0OA 3MR5A 4KVGB 4RNAA 1EWYC 3WAOA 2XGQA 4GDKA 1ESFA 2MEKA 3RD2A 2JZZA 3RNAC 3RT3B 4KMOB 1Z3EB 4Y2UA 2UWQA 4ECRA 1TZ1A 1Z2MA 4KDIC 2MP2A 5TISU 4FE3A 4BBNC 5HHHA 2ZXIA 2KN7A 2A5UA 2RDBC 2NRWA 4WWOA 4B6JA 5BMIA 1J2NA 5KG4A 1C76A 3Q8AA 4NWIA 4TQSA 2F1IA 4JIOU 3QWZB 1Q46A 4NV0A 4XQ8A 2RDJA 2BCVA 5DPTA 3SD7A 1N5XA 1WM3A 3N1ZC 3EC8A 1BPDA 4WIPA 4HDOA 4KGSA 1L6VA 4QZEA 5J2IA 3V6HA 2EAPA 2OM6A 4ICAA 2WYQA 4OVZA 3PSTA 1KSPA 2WHIA 1PZNA 2WQYB 2PXIA 3SYZA 1WMHA 1NDDA 4EX6A 3SQIA 3VHTC 5E6NA 2MSNA 5J8YA 5G5HA 4E71A 4PS3A 3VR8B 9ICKA 1RYSA 5G55A 3UM9A 5AI8A 2JU6X 1K5OA 1QQ6A 1QSYA 9ICAA 1YN5A 2KTFA 4GDLA 2UVRA 2AQ0A 3WKEA 1C78A 3SR6A 4AP9A 5A0LA 1ZD5A 2WWZA 3GILA 4DL6A 1J7CA 3QEAZ 2W8LA 4CF5A 4BDPA 4F3OA 3I1YA 1YOVB 3HX0A 1WI0A 2W82A 4DF4A 2D8CA 3OHBA 1D5XC 1SEBD 3M3JA 4OVVA 4BKTA 4KLDA 1XU4A 3DVGX 4W9LA 3DBRB 4K4HA 2IHNA 1ZW7A 4DOBA 1ZQMA 4RPXA 3ICXA 1QLNA 2KACA 1L7YA 2FCQA 5HHDG 3FKYA 4C00A 4K7WA 2JQRB 4Z6CA 3UMCA 1S0MA 2ZW0A 2WFAA 1PK1A 4A8EA 4KLEA 1UNSA 5KTQA 3MFHA 2B6GA 2VH2A 1R7SA 2UYZB 5BMHA 3T3OA 4PL2A 4UAWA 4GXKA 3FYHA 4I29A 2PI5A 2WNMA 5KFJA 3SFDB 2IO1B 3AE1B 2EZXA 1ZJNA 1WE7A 4C8NA 2M4NA 3L3FX 1DOYA 4RQ3A 4WURA 1NK9A 2BDPA 7ICMA 2L83A 3L10B 2M19A 3FC4A 5KFRA 1HZ6A 4WAAA 4QZDA 4WQOB 5GMVA 3ZIMA 4RUAA 2LMRA 2OEHA 1I7HA 4J9PA 2KJ5A 2VH1A 4PJ0U 5ALXA 5AM1A 2KOXA 2K39A 8ICMA 3PS6A 1IUEA 1G6JA 3IT6B 4QZFA 3AEAB 2J0JA 1VZ7A 2Z0EB 7ICOA 4P1CC 3ZTCA 9ICRA 5L1JA 3IN5A 3AQEA 3AU2A 2I9GA 2KO3A 5CP2A 4A9AA 9ICCA 5ALYA 2WP9B 2VA2A 2K8AA 4LTUA 4NJ7A 5J2KA 1S1QB 2EAMA 4NLZA 2M1MA 3KVFB 4KX6B 2EAOA 3TI0A 4NJ8A 3C2LA 4RZRA 2L8JA 2LWPA 1SV0C 2WAQC 1DRGA 2KV2A 9ICNA 2K8BA 2LMCA 2LFIA 2WXPA 2XO7A 4PYZA 1ZRMA 5KFHA 8ICVA 5J0RA 3A9JA 2PMZF 2BPFA 2PFOA 4DXFA 5KT7A 5JZEB 4M6WB 7ICTA 1RYJA 4WQMA 2KHVA 4FHKA 3JYUA 3PO0A 3VR9B 1LKYB 2FCSA 3UXOA 2IPKD 1BNOA 1H38A 2PKEA 2MA9B 4RQMA 3IAS1 3UI3A 5AUIA 4QZIA 3JPRA 3GFKB 4M9LA 2Y5BB 4M8NA 5ALDA 1LM8B 3DDCB 4BJQA 3GOEA 1WJUA 1X40A 3TKAA 5GTIU 4O5KA 3E2EA 2FAZA 2OCEA 1KW4A 2W9NA 1STEA 4QNLA 1WMHB 4I6LB 2WGSA 7ICJA 2H3FA 3UF8A 1XLPA 4E3CA 1PGXA 2AU0A 3KWVA 2O6VD 4JWUC 1B1ZA 3MDCA 4I27A 2HW3A 3PX0A 4DHJB 5DDMA 3RTVA 2QARA 3RUIB 3V60A 1U4BA 1E9MA 1JALA 2ODGA 1K1SA 4PS7A 1Z1VA 1QOAA 3AE4B 3BVGA 4KSKC 3A33B 2KAJA 3UXNA 1ZQHA 2RQ5A 1FRRA 2OH2A 3WK9A 4KLHA 2FIDA 2I1KA 2LM4A 3RAXA 4J9SA 1N56A 4II3B 4MJSA 5D3DA 1UWMA 2LYAA 7ICVA 3H40A 1LB2B 3H0LB 4KMUA 1V1PB 4Y2JA 4DLEA 5AK3A 3EUB2 4QZBA 3AM9A 2FLNA 2PFPA 3DPDA 3B0XA 3RJFA 3SAFA 4W9HA 2HSZA 2M0NA 1PYWD 4EUTA 2N1RA 5CA7A 1HZ5A 3MGHA 2RP5A 4IQVA 4NL9C 2BYVE 2LRWA 3WALA 1N62A 3LXFA 4P4PA 3R7QA 3SMVA 2DFLA 1JXLA 2HHSA 2N9LA 3HRDD 1ZQTA 3CSTA 4OZCA 4G50A 1KQQA 5ALUA 1YT3A 4I2IA 3ED5A 4Q8EA 1V6EA 3M9OB 2NBWB 2XCPA 1HQRD 2HTHA 2ZJDA 4FO6A 2WXLA 1VRAB 3WAMA 4GDKB 2Y5CA 1V97A 5DPRA 4AYBC 1WJ4A 4C4VB 4R8UB 1ZQJA 5G5GA 1B43A 1COKA 3IAM1 3PT2B 5L83A 3ZYYX 3MP9A 1JWSD 2G45B 2D11A 4OJPA 1WXVA 1ZQQA 2KANA 5DB9A 3TFRA 5HKHA 1Q1OA 9ICUA 1A77A 1T5XD 5E6PA 1PUZA 2R2QA 2NO5A 2YY6A 3MTNB 4LLGM 4WJPA 2B3AA 3ALBA 3HPOA 5KHQA 2GBJA 3T3FA 2Z0DB 1QOGA 5HP4A 3JW0X 1RXVA 1WWTA 2DL0A 2AWTA 3CIRB 4K4IA 1XXGA 4MFFA 3ZKJC 5KT3A 1VCBA 1N2XA 2WF5A 2JF5A 3B2GA 5KT2A 2GB1A 3DHHC 2BPGA 3A1QB 7ICEA 1S77D 4EEYA 2IA6A 4OD0A 5AKEA 4W9GA 3JPOA 8ICTA 2MHJA 2LM1A 3ZNID 4PZNA 4A20A 4GC7A 1XEEA 3AQFA 4RPYA 3ZXVA 1I4HA 5E6JA 1WWUA 2KP7A 4QW8A 1MI0A 1WXQA 2VANA 7ICFA 4FA6A 1RAXA 2Z7JA 3BZCA 2KVCA 5AZGA 4XA5A 4BVUC 3NASA 3T5HA 3AE8B 3PR4A 1ZP0B 4UB4A 4IM2A 1KEJA 4US9A 5AKKA 1BPEA 9ICIA 5CWRA 3NJTA 1FRDA 4JGHB 3GDXA 3KHHA 2XY5A 1SKRA 2KMMA 2BQRA 5H2FU 5KFWA 1XNSA 2JEGA 3KKAA 4UB2A 2C60A 1PK1B 4HAIA 3DWGC 2YLMA 1ZQSA 2A19A 3SEIA 3ECIA 4PHPA 3SD5A 3W9CB 3GV5B 5CB1A 4P1BC 4KLLA 2BT6A 2ONQA 4JMUA 4EEKA 1SJHD 5EE1A 1M6YA 4KLGA 1ZQFA 1NBFC 3IFWB 4BKSA 5AM4A 1RM6C 1BXTA 4HYKA 4ECQA 5AK4A 3U30A 2ZIXA 4TUPA 2XICA 1NYQA 3PZDA 1Z00B 2FDRA 2XN9C 4TUSA 4KTQA 3AB5A 2MAXA 1HXYD 3PV8A 3QC8B 5DBBA 3TEXA 1ZOLA 4YR2A 3DOWA 4YTPB 1UHUA 4B9LA 3BINA 3QARA 1HA5A 2OJWA 3T8MA 5LNK1 4W9IA 2DAFA 4F8CB 5AKIA 3NY5A 4ZOHC 5AI9A 4UB1A 2Y1IA 1XLNA 4F4ZA 4GOCA 5EDSA 5KFIA 1VJ5A 3GQCA 3O0FA 5HR7A 1DYQA 4NQLB 5EWFA 5IIOA 3AEVA 2O6KA 3CW2C 2QJLA 4J03A 5KG5A 4RQ8A 2WXRA 5DKWA 1BGXT 4KZCA 2MJDA 4EBCA 2DENB 4RT3A 7ICQA 2VRRB 2KD0A 4F5QA 1L3UA 4FFDA 1MA7A 1KBUA 2UVVA 3WK6A 1TTNA 1IV8A 3KZIU 1YX5B 1KTKA 2PPHA 5FKAC 2KFKB 4EZJA 2HBKA 1MHXA 4JV0A 4WJOA 2N7DA 2PTLA 4HWIB 2QILA 2VJ4A 3AI5A 4WWMA 2NO4A 5GTHU 5AKYA 2CHXA 1J0GA 3DBLI 5KFDA 3LK9A 4F72A 4IC9A 4O5CA 2KD1A 5CHGA 5HMMA 1UH6A 2YQEA 3APFA 5AKJA 1PVQA 4YL8A 2RPQA 1OEYJ 2XY7A 1OQRA 4MSMB 3NVYA 3BQ2A 1T0QC 3U4EG 1DK3A 4PYUA 3TANA 1SL0A 1RDFA 4UATA 4II2B 4A6QA 2AEHA 2XK5B 3LWMA 5L1LA 2G5IB 4IWOA 3DWMA 4W9CA 3HKZC 3ZNZB 5KFSA 3Q8SB 3PLUA 2N9XA 3GV7B 2A1JB 1N5WA 4BX9C 2FE8A 3QX7A 2BW2A 4YMOA 3U7ZA 3WCQA 1JUDA 4ELUA 2ZIWB 4EFOA 3TARA 2AQ2B 4WJQA 2KK8A 5DPSA 3HVDA 3URYA 4DQOC 3EFUA 3LJ3A 1R4MB 5J0PA 3K9PB 4GSWA 2LPEA 2KNBA 3BQ0A 3U7DA 3QEBZ 2OOBB 2IBKA 5IO9A 2DAJA 2XC9A 3OLMD 3ONSA 3I76A 1UBQA 1WXAA 2ZUBA 4KLJA 2V4LA 4X57B 3U26A 9ICEA 2IGGA 2WXKA 1I42A 1EF1A 5IA7A 4DQIA 3P42A 5DLGA 3V7LA 4DWFA 3KLSX 3QU4A 1F44A 7ICGA 4RPZA 1K51A 1R4NB 4MH0E 5DGBA 5AM3A 4NNJB 3RH5A 2MJEA 4RCOA 3PREA 1E10A 2E5SA 4ZRKA 4O9MA 1L0YB 5EWGA 1N61A 3M95A 4ED3A 2K9XA 4K3BA 3PZPA 3Q3JA 1N63A 3NZSA 1L7MA 1N48A 4A55A 3T3NA 2MBQA 4PHEA 4RFBA 5L1KA 3NTUA 3Q3MC 1GJZA 1NKCA 3QAQA 1SIFA 1ZOYB 3HKZF 1TV9A 1EXNA 5J2JA 3QIJA 4MSQB 1NK6A 4RGTA 2DPJA 2Q4TA 2LGIA 5DPWA 1DOXA 2KC2A 4MELA 2JGAA 4DDID 2NRZA 3DEEA 1EF5A 3ZI4A 4QW9A 1SBBB 2KFNA 4PZOA 2F44A 3R66C 3PX4A 2HJ1A 2WX0A 5AHXA 2JXXA 1LKYA 2OJRA 3W1SC 2REXA 3MR6A 5IAAC 4EELA 4M6WA 3A9KB 2BBCA 1IBXB 3QU9A 1WGGA 1WFYA 3D6JA 4PH5A 2QHOA 1PVPA 1CI4A 3SENA 4ZRQA 1QTMA 4Y2TA 3VTWA 3F5AA 4ITKA 2GOWA 1B4FA 3GU3A 4AS1A 2L5YA 1XD3B 2YB1A 5IN7A 4B9UA 9ICGA 3IT4B 4XC2A 4O5EA 3PX6A 2F1HA 1UA1A 4Q43A 4P7IA 1YJ1A 2W9MA 1C4PA 2DKXA 2F77X 1YNTE 1IPGA 1S10A 3L54A 3KOOA 5DDYA 3NVVA 4UB5A 1T3QA 2ZIVB 1F9JA 3VRAB 2P66A 1HEKA 4G9BA 3WK7A 2L52A 4YVZA 4QIWC 2JRIB 2LGSA 5BOMA 2JH7A 3PNCA 1ZQKA 2BKRB 3Q8PB 2LUMA 3VTVA 4OJ5A 2BS3B 4DHZE 2WXIA 4DL4A 4MF2A 4DXAB 2NS5A 1FXTB 3QX1A 4M01A 3GB1A 5KHOA 2LYBA 4DF8A 3VH3B 4MGKE 4XWWA 4ECVA 2C2RA 1E5WA 4RQ4A 2W55A 1U48A 3EZ5A 4KSLC 4QWCA 2BQUA 1X6JA 1NKBA 1YQ4B 2V0GA 3H7PA 3Q69A 4NAMA 3M8RA 4DFPA 2IY1B 5J2BA 2VKQA 4ELVA 4NLCA 3V6JA 2JWUA 2ZJ8A 3THVA 3QK0A 2E8PA 3GIIA 1NJZA 5KFPA 2LJIA 4RMAA 4F4YA 2NRXA 1NNLA 5FR3A 4FZNA 3V7JA 1JMLA 3ISDA 5ALFA 3D2SA 2O2VA 3MJWA 3QU2A 3QHTA 3AEDB 4W9JA 1Q0WB 4G3IA 3DVGY 4BOZB 4F8RA 1F5SA 4YP3A 4BFRA 1YJIA 4DOCA 5IIIA 4C4VA 5B5EU 2IDYA 3PGEA 4JK1A 1ZQOA 1D5ZC 3DHGC 4RQ2A 3PO4A 5J2GA 3CRXA 4WJ3B 5AM0A 3WKAA 1E8XA 2YTUA 2MJ3A 3W1YA 2LBOA 4I2JA 1E6EB 2KJ9A 3ML9A 5KFQA 1AWDA 4MJSB 1OXJA 4FS1A 4C8OA 2IMWP 1UT8A 3QUBA 5IIMA 1LO5D 1TK5A 2YMMA 1YN4A 1E8WA 2FNJB 1D5MC 2IO0B 5ALGA 2VA8A 8ICYA 3SU8X 3F5EA 3D32A 4CE6A 1IP9A 2IBIB 3KHRA 3SV4A 3P4PB 4DSFA 1LV5A 2RLTA 3QU5A 2N1VA 2E3TA 5BMGA 3QNMA 3D2QA 2KDIA 4OVUA 3UMGA 3KTQA 1NENB 1SV0A 4WAFA 5ALRA 8ICNA 5JTIA 3QU7A 1SZPA 4R64A 3TAQA 2W9BA 5D4BA 1GC6A 8ICHA 5EE0A 4EOYA 2KKVA 2BF8B 1T0SC 2LHEA 1Z19A 3ZTDA 4F1SA 3MC1A 4F4XA 4HKZE 5L1MA 5AK5A 4J9RA 4PPXA 3NVZA 4P0QB 1B9RA 3WK8A 4IR9A 2H88B 3Q2AC 2L3ZA 4IOIE 2N9EB 1RYRA 1UELA 2KSOA 3TACB 3AEEB 2QDFA 9ICFA 1MSWD 1YX6B 5J8YC 2K60A 1NK0A 5L9XA 4GXBA 5LLIA 2V3NA 4HK2A 4NZLB 4UB3A 1PVRA 3KUZA 4JL9A 3K1RB 5L95C 2MBOA 2DZIA 5J0TA 1TK0A 2LHDA 3BYTB 3FILB 5KFYA 2R2OA 5IIKA 4GLXA 4O3QA 4AWJA 5BYRA 4MH8A 2KVSA 1PGAA 1XLQA 2OYYA 5DBAA 4P4OA 2LXCA 1D6EC 3TSSA 3IM1A 1MFWA 1ZYQA 1QQ7A 1CJEA 4ICUA 2HMXA 3ZJVA 1NJYA 4W9DA 4CO7A 1A76A 4PGYA 5J2AA 1RLFA 4J6IA 1FD6A 4F93B 2J0MA 2KC1A 4F50A 1XWLA 4DK5A 3JPSA 1CMXB 1I4GA 4TMAB 3V6EB 3ZLZA 3TQ1A 5AEKB 1CUKA 4QZAA 4ARCA 1ZQBA 4F4KA 2LGXA 1FEHA 3B0YA 1ZD4A 4P2HA 2FCNA 1F0MA 4R63A 7ICKA 4Z6EA 3C1YA 2KWUB 3EPIA 4C80A 2L0FA 2YEPF 3ZNGC 1PQSA 2BQ3A 4KLSA 3PVLA 5C3JB 3UMBA 7ICPA 4RQ6A 2ASLA 2GWSA 2BS4B 4UW9A 2K4PA 4B95A 1V5TA 3MGVA 5AM5A 1Q3UA 4DQSA 1ZQGA 4EKUA 2L32A 4HPPA 4LCDE 1ZPSA 3R2IA 4IDIA 2G3QB 5HI1A 4OJ6A 3J81j 3QQ8B 2HBLA 4J9NA 1AYFA 3H8HA 2BTEA 3AE7B 5D46A 4I2DA 5D3IB 3PMLA 4KX3A 1HE8A 4ZH4A 4YSYB 2PI4A 1F77A 5IP4D 2MLBA 5J18A 3RNEC 2JXTA 4GIBA 2Y0SC 3P2BA 3RH4A 5AIAA 4L1BA 5BOLA 3L13A 1UBIA 3PPAA 3ZGZA 3A0HU 1J8CA 2KVRA 4IQUA 3PSFA 4P0PA 2HOQA 1YN3A 4K3CA 4C56C 7ICLA 4PGQA 4D2KA 1FEZA 1S97A 2YB4A 4MEYA 4LVSA 2K8CB 8ICQA 1NYRA 3PHWB 1UUPA 1TS5A 4OJOA 1WSPA 4FZLA 4Z6DA 9ICWA 3BK2A 2PFQA 5C2TB 2GBNA 3MJ5A 4IRDA 3G6YA 2OXOA 2IJ0A 2LD9A 4EBDA 3Q8MA 5D2MB 1V86A 1PGBA 1JI7A 2RMMA 3T79A 2G08A 1KH0A 2NBVB 4WWPA 2AL6A 7ICHA 1TT5B 2DLBA 2ZG6A 1QSLA 4YMNA 2K0PA 2BKEA 1KRPA 2ESEA 1JX4A 4R65A 2CHZA 4BAXA 5HR6A 1QLBB 5H92C 1SJED 5KT4A 2AGQA 2V4QA 4YTNB 3QUQA 4FZMA 1U9LA 3WKDA 3RN9C 4C8KA 5CEHA 3ENEA 4DBGA 2R8IA 1IXRA 1WM2A 3V3XA 4IQTA 4KITB 4P4MA 1PUTA 4JX1C 4KGRA 4CNQA 1ZETA 4WJNA 3RB4A 1KFSA 3NZUA 4UASA 3DCGA 3HILA 3EGRA 2QARB 5AM2A 2XK5A 3T5KA 2FIFA 2DGZA 1VJKA 2IZVB 2IYDB 4ED1A 2BWFA 1SXTA 2N7EA 4PK1A 1D3ZA 2KKPA 2ZCCA 2KWVB 1Q3VA 1NK8A 4RQNA 2GLEA 3T5LA 4PS8A 3PRMB 4S17A 1A70A 3U8ZA 1GG3A 1P1AA 4TQ1A 3E0FA 3PRZA 3EWAA 4C7ZA 4YMMA 1TY2A 3VH4B 8ICUA 4USAA 3CYMA 4NAWB 3ZVVA 1V1PA 4DFKA 1E7PB 2D5GA 2K4IA 2HBJA 3VCBA 3MC9A 1S8OA 2P6UA 2KK0A 2I6XA 1CZPA 1EWCA 2KX3A 2WF6A 2K8HA 4F91B 5DG8A 3MDAA 4IW0A 2P35A 1BPYA 5AKLA 2SAKA 3C19A 5TSSA 2WDRB 3Q8KA 2WDTB 4O0IA 3Q8QB 2K4EA 4URKA 2MQJA 3SDLC 4NXZA 3G6XA 2K5PA 1WG8A 2KWCA 3EECA 3I3TB 4Y2VA 3ZJTA 4MT5A 2NCNA 4XGAB 5ALHA 4LJXA 1ED1A 2BHNA 1L5PA 2LASA 3NZ3A 4IM3A 2WXQA 2YEPB 3ZRCA 2ZTDA 4HDQA 4EYHB 3C29A 1M94A 2M0XA 3NHEB 5J17A 3HW8A 1UCVA 4ECUA 4M8MA 2HCFA 3D2NA 8ICKA 2OEDA 3EFCA 4G0NB 2N7JA 4DHZB 4KLQA 3AE6B 3SAHA 4LNOA 1YZ7A 3RNFC 4A8XC 2D3CA 4YWGG 4ASWC 1XO0A 1FNUA 5CRXA 2HHVA 2EELA 2PJHA 5J0WA 1ZRNA 3OG5A 1FPYA 2K89A 4HPMB 1KN5A 4C4TA 1Z5SB 3CWIA 5AK6A 2JHDA 2MSED 1L7NA 4I2CA 3IRUA 2KLCA 4LK0M 2KTQA 3ZQ4A 5IIJA 4QWBA 1DXSA 1NVID 4AOFA 4YTMB 2IHMA 1YQBA 1MQ2A 1P9DU 2YMLA 3ISBA 4Y2PA 1KJTA 4NLGA 4DLGA 9ICJA 2L05A 4XX5A 5IOIA 3PV1A 3JVZX 4DSIA 3WKBA 4KDLB 4DEZA 4MF8A 4N6EB 1SXEA 2JH1A 2Y3AA 4LNFA 4MEMA 3NRWA 4C8LA 3NGDA 3P1MA 4ED6A 1WGRA 4F5OA 4BXOB 2LJ5A 2DYOA 1MG4A 1NOMA 3L5KA 1AARA 3CP8A 2AGOA 2INDC 1TS4A 3EHVA 4DHJD 1WGDA 4EX7A 1T6BX 2EZZA 4Q2JA 1OGWA 3MGIA 3ZDCA 1PDXA 4DOAA 4O3SA 2ZNVB 3DBRI 1XC9A 1PFDA 8ICZA 3RPFC 2N4FA 5JXVA 3PW0A 1J7AA 1GNUA 1U45A 4J9LA 1XT9B 3ETLA 8ICLA 3I63C 2D6FC 2UVWA 4FJYA 4DFJA 2GI9A 1FNWA 4RT2A 1UGJA 2QB1A 4IL6U 4HEA1 2B21A 3WKCA 2Y1JA 2WF8A 5MPOA 4IRKA 3ZXRA 1AQ6A 4NLNA 1N60A 3HM6X 4NLBA 3AE5B 4TV3A 4DFMA 5ALKA 1FMAD 5J0XA 4ECSA 1RQNA 2DZJA 3WK4A 3ZO5B 5KG1A 1U47A 2KJ8A 4RNOA 5KFTA 1TKYA 1YJJA 5FP0A 1TFRA 2NRTA 4ANXA 2EMSA 2HHQA 3RJJA 5D7GA 2MX2A 4DQPA 1WGKA 2DYBA 1TKDA 3H0MB 1RXWA 3R8BA 4DO9A 2AQ4A 1F52A 3I5JC 4XWTA 8ICEA 1V85A 1FIQA 2HOIA 2CRXA 3N9YC 2EDUA 4EEWA 1COOA 3W2DA 3ZW3A 1JN3A 2VZKD 2BYTA 4GC6A 4I6PA 4UQGA 3QZ8A 1L4ZB 3N97B 4LJOB 4W9KA 4B6WA 2JVCA 2W9AA 5KFLA 8ICPA 4YSXB 3TIXA 3AULA 2NRVA 1IYFA 1L3TA 1SGGA 2FUHB 4GDLB 3UXPA 4C4RA 3C21A 5KT5A 3ETRA 1H4RA 5KFGA 1UQVA 2Z8LA 1S3SG 3KKAC 1SF0A 4EBEA 1ZXIA 1V8CA 2BB6A 3A4RA 3AXCA 5ALEA 2LRUA 1QKZA 1L0VB 2KQSA 1ZKHA 3N1XC 5LXIB 1S9FA 4B0EA 2QIEB 2BCSA 2LZ6A 3IHQB 3ZDMC 1EU3A 1XQQA 4NLKA 2JZPA 4NY0A 5HG2A 4ACOA 3GV8B 2E8MA 2FLLA 3E9SA 3O13A 3Q3OC 2BCUA 2V9WA 2WLBA 3TUOA 1JQ4A 2KX0A 3N20C 4AQ7A 4DL7A 4B9KA 3A0BU 4N9F4 2E1FA 5IILA 4PHAA 2BKFA 2C7HA 3MBYA 2GMIC 3QCAA 3X0WA 3WK5A 1NK7A 4IWQA 3F2BA 2H3VA 5ALSA 5GXGB 3ZUNA 2K8CA 1XO1A 4O3RA 3MFIA 4FXCA 1KLUD 2BQQA 2QEJC 2LGDA 4YXMA 5AZFA 2ZPYA 2JEJA 3GZNI 2MU2A 4M0WA 3QUTA 1DK2A 1X9WA 2DZMA 2KXJA 3OPXA 1FCCC 4BWJA 3OSNA 5KFEA 3W1SA 4I2GA 1F0ZA 4DL5A 1WYWB 1P3QU 1C9FA 3P4SB 1I35A 1MVKA 5D49A 3RI7C 2WU5B 5J2RA 1UWXA 3SAGA 1FCLA 3K9OB 4BBNF 1QILA 1L6NA 4N58A 1ZQUA 2M9NA 2KIWA 8ICAA 2JYEA 4JWMA 5LXHA 3SHQA 3N4MB 2DYMA 1D8BA 4ACFA 4EZ9A 4YG2A 2RRDA 2W3RA 2BR0A 5C1ZA 4B9VA 4P0PB 3EYZA 5ALOA 2FMPA 3PY8A
chains in the Genus database with same CATH topology
4B0MA 2BB5A 2M19A 1E0ZA 2HDEA 1FFUA 3AEDB 3FC4A 3AV8A 1HZ6A 1GB4A 3TEYA 2WXGA 2J4XA 1YJIA 1I7HA 1CQVA 5AUKA 2IDYA 1F2RC 4ZYSA 3SFEB 1D5ZC 1XCQL 1QQRA 1IUEA 2XNAC 2MJ3A 2EKIA 2WXOA 1E6EB 3IT6B 4MACA 3AEAB 1AWDA 1VZ7A 3B9JA 1LO5D 4A9AA 1YN4A 3AE3B 4ZRPA 1D5MC 2WP9B 2TSSA 2PVGC 1QF6A 4LTUA 1SE4A 1VR9A 1ET6A 4KX6B 3P4PB 2E3TA 5BMGA 2G9HD 2Q5WD 2AQ1B 2WXPA 2LMCA 2LFIA 1NENB 2G1EA 4DXGA 4WAFA 4DXFA 4XDDA 3B2FA 4RGMA 4TQ0A 5EE0A 1RYJA 1QOBA 4WQMA 2LHEA 2W3SA 3PO0A 4HKZE 3VR9B 1K50A 2IPKD 1JCKB 3NVZA 1B9RA 3IAS1 3UI3A 5AUIA 3BVMA 2H88B 4IOIE 5I4DA 4HRSA 1RWSA 1KLGD 4C7YA 3AEEB 4ARIA 1F2RI 1FFVA 1WRIA 3P63A 2V3NA 3Q8EA 4NZLB 1QT9A 1P7FA 3U52E 3AEGB 1MPEA 1STEA 1ZDXA 1XLPA 3NVWA 1SE3A 4IKGA 2LHDA 1V1OA 1K52A 1PGXA 3NS1A 2RPVA 3BYTB 3FILB 3LB8C 3KWVA 4JWUC 4RF0A 1B1ZA 3NUHB 3MHZA 5BYRA 4MH8A 3TEZA 1AN8A 4KKIA 3Q8FA 1PGAA 1XLQA 3BYYB 1TZOA 3TSSA 1D6EC 1E9MA 1JALA 2L1AA 1CJEA 1QOAA 3AE4B 3ZJVA 3BVGA 2KAJA 3BIID 4L23A 1FRRA 1FD6A 1ZUD2 3SEBA 4R3DA 1SSNA 1JWAD 5D3DA 1XLOA 4YSZB 1UWMA 1C4AA 1I4GA 5BYSA 4TMAB 4HKQA 1V1PB 2B76B 3EUB2 4ARCA 3AM9A 1FEHA 2BS2B 2AX5A 2J42A 3P4QB 4OW0A 3FILA 3C8YA 3AMZA 1PYWD 5HFYA 1HZ5A 1XF5L 3BVZA 4C80A 2NMQA 1TKGA 2QMTA 5C3JB 1N62A 3LXFA 1MHHE 2BS4B 3Q8CA 1SE2A 2N9LA 3HRDD 2L32A 2WDVB 1ZPSA 3R2IA 4OZCA 2WXNA 1BMLC 4IDIA 5HI1A 3GP7A 5H8YE 1KRHA 1HQRD 2BTEA 1AYFA 3H8HA 1I4PA 2WXLA 3AE7B 1VRAB 4GDKB 2Y5CA 1V97A 5D3IB 4NJCA 1I4XA 4YSYB 1F77A 1KFYB 2JXTA 2M0AA 5G5GA 2R61A 4WH4A 3IAM1 4L1BA 3ZYYX 3ZGZA 2I2YA 3MP9A 1GAQB 2ICIA 1YN3A 1JWSD 1M4VA 1VZ6A 4C56C 3FAHA 3AE2B 2KN4A 4D2KA 1GB1A 1T5XD 1NYRA 3IXSA 4LLGM 1UUPA 3AE9B 1TS5A 1WSPA 1VLBA 1QOGA 1WWTA 3KWLA 3BK2A 1BUIC 3CIRB 3MFGA 1XXGA 3BWUD 1AW7A 1RFKA 2N9KA 3MJ5A 4JWSC 2E6XA 2IJ0A 5C2TB 3B2GA 2GB1A 2I38A 1PGBA 3HUIA 2GRIA 2RMMA 1KH0A 2DLBA 3P4RB 1XEEA 1I4HA 5E6JA 2K0PA 1GOZA 1WXQA 1MI0A 3E56A 2QSDA 1ACCA 1EU4A 1QLBB 5H92C 1SJED 3AECB 3AE8B 4YTNB 1ZP0B 3VQIA 2M56B 4US9A 1I4QA 1ZXHA 3V3XA 1PUTA 4JX1C 1FRDA 2KMMA 1XCTL 4KGRA 1I4RA 2PLPA 2LEKA 3DWGC 3EGRA 1TYGB 3W9CB 4N59A 2KQ4X 1VJKA 4GLSC 2ONQA 2BT6A 2PVOD 3I9V1 2INPE 1YQ3B 3L4PA 2FUG1 1SXTA 2WXMA 1SJHD 1L4DB 5EE1A 3W5VB 2IGDA 3HVZA 1ZE3D 2DBYA 1FXAA 4A90A 2PW9A 1RM6C 1BXTA 4H2AA 1A70A 1OFFA 3PZ7A 1ROEA 4TQ1A 5T8IA 1NYQA 2AQ3B 4C7ZA 1TY2A 4MM3B 2XN9C 4USAA 1TS2A 1JWBD 3AB5A 4NAWB 1V1PA 1HXYD 1E7PB 2D5GA 3PZ8A 3TEXA 4YTPB 3EA6A 1CZPA 1EWCA 1HA5A 2V4IB 5LNK1 1VZ8A 4OZBA 1FNVA 1TJEA 2ON8A 2SAKA 5TSSA 4ZOHC 2WDRB 4OZAA 2H89B 4L2YA 1XLNA 4PT5A 5FK9C 1FO4A 4XDCA 1DYQA 1J7BA 2K5PA 1EM7A 3ZJTA 1C4CA 4MT5A 2JYTA 2J53A 5BYQA 2QJLA 1QOFA 4US8A 1L5PA 4P16A 3NZ3A 2WXQA 1SIJA 2WXRA 2YEPB 1VDVA 2VZKB 2MJDA 1JRPA 1TY0A 2IGHA 1JWUD 2INNE 2DWQA 1ENFA 3KQ4A 4HJGE 4HROA 3ZJUA 1KTKA 2OEDA 5FKAC 3AEFB 1NI3A 1ET9A 2HTME 2K22A 2N7JA 3AE6B 4A8XC 1MHXA 4YWGG 2PTLA 1FNUA 2EELA 2QILA 4WWMA 1HEZE 2KWDA 4OHJA 5EE9A 3CWIA 2CU3A 3AEBB 4ZHPA 4LK0M 3ZQ4A 1TKEA 4YXDB 1OQRA 3NVYA 1NVID 3BK1A 4YTMB 3GS2A 3U4EG 1D4BA 2PKOA 4A6QA 4CQNA 1C77A 3DWMA 1XO3A 1P7EA 1K53A 2Y5PA 1TS3A 2V3PA 4N6EB 2Y3AA 1N5WA 1WYGA 2FE8A 2BW2A 3U7ZA 3WCQA 2N0SB 2ACZB 3P1MA 2AQ2B 2PIAA 2DYOA 1L0XB 2WS3B 3HVDA 2KDMA 1TS4A 2JX5A 3URYA 4DQOC 3R2TA 2K3UA 2NTSA 1KF6B 1T6BX 4Q2JA 5EE3A 1PDXA 2RDHA 1OQQA 3W5UB 1PFDA 2SEBD 3RPFC 3BZDB 3OWEB 2PMVA 5JXVA 1J7AA 1Q10A 4RGOS 2GI9A 1FNWA 1IGDA 1UGJA 1IGCA 4HEA1 1YMHE 5MPOA 1N60A 3AE5B 2IGGA 2WXKA 3P42A 3TEWA 1FMAD 2WDQB 2W54A 3KLSX 2X38A 2NTTA 3V05A 1DOIA 1K51A 1TKYA 1YJJA 3AH7A 2MJEA 2ZW1A 4RCOA 1FXIA 1E10A 4UDUC 4RGNA 5D7GA 1L0YB 1WGKA 1N61A 4TSSA 2WXFA 2K9XA 4JPSA 2RDGA 3R8BA 1N63A 4ZHOA 4XWTA 4A55A 3MC0B 3T3NA 1FIQA 1L6UA 3N9YC 4RFBA 2BYTA 1JWMD 3W2DA 3LYYA 1JW9D 2VZKD 1DGJA 2WU2B 4O1NA 3J9CA 2WXJA 4J3OD 1ZOYB 4RNAA 2WXHA 1EWYC 1L4ZB 1NEKB 2MH7A 4RGTA 3RFZB 1ESFA 2LGIA 4YSXB 1DOXA 2MEKA 3NRZA 4GDLB 2CJOA 1SBBB 3ETRA 4JE3B 2Z8LA 1ZDVA 1SF0A 2BB6A 1ZXIA 1V8CA 1QKZA 5BMIA 1L0VB 4RF1A 1IBXB 2BBCA 1C76A 3Q8AA 2CJNA 3U2SC 4B0EA 2QIEB 1N5XA 1EU3A 4ZRQA 4WIPA 4KGSA 4XE0A 1L6VA 2JZPA 4EE2A 5HG2A 4ITKA 3I57A 4OVZA 4AS1A 3E9SA 3O13A 1CK1A 2WQYB 2WLBA 3IT4B 3TUOA 1C79A 3AN1A 1IBXA 1JQ4A 4AQ7A 1C4PA 5G5HA 1YNTE 3VR8B 4KGTA 1GPXA 2JU6X 1YN5A 3NVVA 1T3QA 1SB3C 1JROA 1C78A 3Q8BA 3SR6A 3VRAB 5GXGB 2L52A 1J7CA 4FXCA 4RH6A 1KLUD 2JSVX 2QEJC 2W82A 4M0WA 1SEBD 1D5XC 2LUMA 2BS3B 1FCCC 2WXIA 2OHFA 4YT0B 3W1SA 2KACA 1F0ZA 3ABVB 5HHDG 3GB1A 1C9FA 4XWWA 2JQRB 1Y56A 3P4SB 1MVKA 2J52A 2WU5B 2W55A 1UWXA 2ZW0A 1FCLA 1QILA 1UNSA 4N58A 1YQ4B 1R7SA 3VRBB 5BMHA 2V0GA 3T3OA 2JYEA 4KKJA 3Q69A 2FBWB 2WNMA 4NAMA 3SFDB 2JWUA 3AE1B 4REZA 2DYMA 2LJIA 1DOYA 5FR3A 2W3RA 4WURA 4P6VF 1FM0D 1JMLA 2L83A 2YEPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3J B;  1YJJ A;  3AH7 A;  1N62 A;  2M19 A;  2MJE A;  3LXF A;  4YTP B;  3W5U B;  1FFU A;  1FXI A;  3FC4 A;  2BS4 B;  1CZP A;  3AED B;  3AV8 A;  1E10 A;  3HRD D;  2WDV B;  1YJI A;  1TJE A;  1I7H A;  1WGK A;  1N61 A;  4ZOH C;  2WDR B;  5AUK A;  4IDI A;  2H89 B;  2K9X A;  1XLN A;  1N63 A;  3SFE B;  4ZHO A;  5H8Y E;  1KRH A;  1FO4 A;  1FIQ A;  1L6U A;  1IUE A;  2MJ3 A;  1AYF A;  2EKI A;  1JW9 D;  1E6E B;  3AE7 B;  1DGJ A;  1J7B A;  2WU2 B;  1AWD A;  2K5P A;  3AEA B;  1DOI A;  1V97 A;  2Y5C A;  3B9J A;  1ZOY B;  4YSY B;  1EWY C;  1NEK B;  1KFY B;  2MH7 A;  2QJL A;  1QOF A;  4A9A A;  4US8 A;  1L5P A;  3AE3 B;  4YSX B;  1DOX A;  1SIJ A;  2WP9 B;  5G5G A;  1VDV A;  2PVG C;  2MJD A;  1QF6 A;  1JRP A;  4LTU A;  3NRZ A;  3ZYY X;  2CJO A;  2DWQ A;  3P4P B;  4KX6 B;  3ETR A;  1GAQ B;  2E3T A;  4HRO A;  1SF0 A;  1ZXI A;  1V8C A;  3FAH A;  2Q5W D;  3AE2 B;  1NEN B;  2G1E A;  1L0V B;  1NI3 A;  2HTM E;  2K22 A;  3AEF B;  3AE6 B;  1NYR A;  2CJN A;  2QIE B;  3B2F A;  3AE9 B;  1N5X A;  4WWM A;  5EE0 A;  1VLB A;  1L6V A;  1QOG A;  1RYJ A;  1WWT A;  1QOB A;  3KWL A;  4WQM A;  2W3S A;  3CIR B;  5EE9 A;  3PO0 A;  4ITK A;  1RFK A;  5C2T B;  4JWS C;  3VR9 B;  3CWI A;  2CU3 A;  3B2G A;  3NVZ A;  1B9R A;  3AEB B;  2WQY B;  5AUI A;  4ZHP A;  2WLB A;  2H88 B;  3AN1 A;  1JQ4 A;  1TKE A;  3HUI A;  4YXD B;  1OQR A;  3NVY A;  4HRS A;  1RWS A;  1NVI D;  4C7Y A;  3AEE B;  4YTM B;  5G5H A;  2PKO A;  3VR8 B;  1FFV A;  1WRI A;  3P4R B;  3P63 A;  1E0Z A;  1GPX A;  1QT9 A;  3NVV A;  1WXQ A;  1T3Q A;  3AEG B;  1SB3 C;  1JRO A;  3VRA B;  3DWM A;  3SR6 A;  1XO3 A;  5GXG B;  2L52 A;  1QLB B;  5H92 C;  1XLP A;  3NVW A;  1J7C A;  3AEC B;  4FXC A;  4N6E B;  3AE8 B;  4YTN B;  1ZP0 B;  3LB8 C;  3NS1 A;  1N5W A;  1WYG A;  2M56 B;  4JWU C;  4US9 A;  2N0S B;  3WCQ A;  2ACZ B;  3P1M A;  2PIA A;  1PUT A;  2BS3 B;  1FRD A;  4JX1 C;  2KMM A;  2WS3 B;  2JX5 A;  2OHF A;  1XLQ A;  1KF6 B;  4YT0 B;  2LEK A;  1E9M A;  1JAL A;  5EE3 A;  1F0Z A;  3ABV B;  3DWG C;  1CJE A;  1PDX A;  1QOA A;  3AE4 B;  1OQQ A;  1TYG B;  2JQR B;  1PFD A;  2KAJ A;  3BII D;  1FRR A;  3P4S B;  4N59 A;  3RPF C;  3W9C B;  1VJK A;  1ZUD 2;  2BT6 A;  2PVO D;  2WU5 B;  1J7A A;  2W55 A;  1YQ3 B;  3L4P A;  1JWA D;  1XLO A;  4YSZ B;  1UWM A;  4N58 A;  1YQ4 B;  1R7S A;  5EE1 A;  3VRB B;  3W5V B;  3HVZ A;  2B76 B;  2DBY A;  5MPO A;  1FXA A;  2FBW B;  1N60 A;  3EUB 2;  3AE5 B;  1RM6 C;  3AM9 A;  3SFD B;  3AE1 B;  2BS2 B;  2AX5 A;  1A70 A;  1OFF A;  3P4Q B;  1ROE A;  1DOY A;  1FMA D;  3AMZ A;  1NYQ A;  2WDQ B;  2W54 A;  2W3R A;  4C7Z A;  4P6V F;  4USA A;  1FM0 D;  1JWB D;  3AB5 A;  4C80 A;  1E7P B;  1TKG A;  2L83 A;  1TKY A; 
#chains in the Genus database with same CATH topology
 4AJW A;  1E0Z A;  2HDE A;  3ALR A;  4O3M A;  1Z1B A;  2HD5 B;  1HTO A;  1GB4 A;  3RRH A;  2EZY A;  3APD A;  2J4X A;  4HVB A;  5KFU A;  3VVW B;  9ICH A;  2QCZ A;  4GGQ A;  4FUL A;  1Z4O A;  4W9F A;  3DBS A;  1F2R C;  4ZYS A;  3SFE B;  1XCQ L;  1ZQL A;  1QQR A;  5EOZ A;  4KN4 A;  4FBT A;  4TQR A;  2KTR A;  3MC8 A;  1V5O A;  2NV3 A;  4U6P A;  4EEN A;  2J6U A;  3B9J A;  2HVI A;  3UQ2 A;  4UAU A;  2V4R A;  3M9N B;  1B22 A;  1L3V A;  4ANV A;  2XY6 A;  2W9C B;  2LXA A;  3AE3 B;  4QZH A;  1IM4 A;  2TSS A;  2ZNV C;  3PSI A;  5ALZ A;  5KG3 A;  3C5G A;  2HOF A;  5KFF A;  1VR9 A;  1ET6 A;  4OO1 J;  4F2S A;  4FLH A;  2M17 A;  2FLP A;  4RU9 A;  2ZUD A;  2ZTC A;  5KFA A;  2Q5W D;  2AQ1 B;  2AYO B;  1WE6 A;  3Q6B A;  2G1E A;  2IY0 B;  1WRD B;  1MG8 A;  4DWI A;  4TQ0 A;  1KOT A;  4QAY A;  1SKW A;  2LUE A;  4RQ5 A;  2MA1 A;  4PL1 A;  1O03 A;  2F8L A;  1JCK B;  5J2H A;  1JRU A;  3HJE A;  4Y2X A;  2KEY A;  3G6V A;  2FPK A;  1D9F A;  3BVM A;  5TZV A;  2VJ5 A;  4RQ7 A;  5I4D A;  5FR6 A;  1KLG D;  4P0Q A;  1L7P A;  1UF0 A;  1F2R I;  3PSE B;  3Q8E A;  3K4G A;  2IOF K;  4J9Q A;  1P7F A;  3U52 E;  1MPE A;  3T5J A;  4J9K A;  2WF9 A;  2LVQ A;  1ZDX A;  3SI8 A;  1HJP A;  2HDO A;  2CXY A;  3TAP A;  2YMQ A;  3KZX A;  3LB8 C;  3NS1 A;  1ZQN A;  1KLV A;  2C5L C;  4RF0 A;  3MHS D;  2ZJA A;  4ANW A;  2RHF A;  3N7P D;  1BPZ A;  3NUH B;  2IO2 B;  4KZ0 A;  1LXD A;  3TEZ A;  2ZIU B;  3E58 A;  5JUM A;  1AN8 A;  4G11 A;  4KKI A;  1E7V A;  2G07 A;  4CRX A;  1TZO A;  1QCK A;  4NPN A;  1L2N A;  4PGX A;  3ZDT A;  5CHW A;  3TCA A;  3BII D;  5KL1 B;  2W8K A;  4L23 A;  5KFM A;  9ICM A;  2ZZP B;  5AIB A;  4HLE A;  1SSN A;  1JWA D;  4JV2 A;  1XLO A;  4U7C A;  3PVX A;  1D8Y A;  4IR1 A;  2LVP A;  3KD3 A;  4JQW C;  2L00 B;  4ZDV A;  4HKQ A;  2W9B B;  2B76 B;  4HCN B;  2V9H A;  1BVS A;  1UGM A;  2W04 A;  2BS2 B;  1KFT A;  2NPT B;  3P4Q B;  4OW0 A;  3SZ2 A;  3MR2 A;  3C8Y A;  3RRG A;  1TGZ B;  3V72 A;  4KLO A;  2O6V A;  8ICC A;  3BVZ A;  2MRP A;  2C28 A;  1TKG A;  1TIF A;  1T94 A;  4LJP B;  3Q8C A;  1SE2 A;  2IOH A;  4C0Z A;  2PE9 A;  7ICN A;  1R4M I;  3H0R B;  5CJ7 A;  4CHK A;  1BML C;  3KUC B;  2KLG A;  2J6T A;  2ZCB A;  3GP7 A;  5H8Y E;  4Y2R A;  3JPQ A;  1I4P A;  2R8K A;  2ZJ5 A;  4I2A A;  2KDE B;  1NI2 A;  2BWE S;  4NJ6 A;  8ICR A;  2KKC A;  4E74 A;  3ZD8 A;  1HUZ A;  5E6O A;  2H3Z A;  2G0A A;  5BPC A;  1KLN A;  1GUA B;  2M0A A;  2R61 A;  5HNK A;  3A9J B;  2J7Q B;  4ZRJ A;  3WIM A;  3UQ0 A;  4WH4 A;  2RGF A;  1L3S A;  1SKS A;  2I2Y A;  3GIM A;  2D2Q A;  2ICI A;  4XZ4 A;  1VZ6 A;  4K7U A;  1NZP A;  3H8J A;  1L7O A;  3FAH A;  3AE2 B;  3C5F A;  2ZVO A;  4DDG D;  1WF9 A;  5KFK A;  2KIV A;  1RRB A;  3C2M A;  4FHJ A;  2H3Q A;  3RJH A;  2LI5 A;  2KMA A;  3H7P B;  3AE9 B;  2G06 A;  3KHG A;  2L76 A;  1SL2 A;  3S2A A;  4UB6 U;  1LGR A;  1URJ A;  1X2I A;  2N9K A;  5DB6 A;  4JWS C;  2B0C A;  3IHP C;  3T9L A;  8ICF A;  2KVZ A;  2I38 A;  3AU4 A;  5ALN A;  2MUT B;  5DQI A;  2GRI A;  1X1M A;  5KFB A;  4UAY A;  1V81 A;  1WUD A;  2XCA A;  3H6N A;  3P4R B;  3R7R A;  1T0Y A;  2AXT U;  3RR8 A;  3PTF C;  4F2R A;  3IG8 A;  2QKQ A;  2KNJ A;  2GLS A;  3R3M A;  4XYC A;  3E56 A;  3N7S C;  1HIW A;  5B66 U;  1X9M A;  2QSD A;  1TBE A;  2ASQ A;  1EU4 A;  2KYW A;  8ICI A;  3H8W A;  2R8G A;  4KIK A;  3UQA A;  3VQI A;  1J2M A;  4BUG A;  2M56 B;  1A5R A;  9ICL A;  2CR5 A;  1C20 A;  2UU7 A;  1I4Q A;  1ZXH A;  4B9S A;  2D07 B;  3QXG A;  3BQT A;  2R18 A;  3HM3 A;  1V2Y A;  3BJY A;  1K8R B;  2LEK A;  3UIN B;  2KDB A;  5KFV A;  4GXJ A;  2D3A A;  2DX5 B;  1TYG B;  1U49 A;  2XEW A;  5AI6 A;  1L8O A;  2KQ4 X;  2HHX A;  2INP E;  2ZIX B;  2FUG 1;  4MFC A;  3RB0 A;  5ALP A;  2WXM A;  4BZA A;  2ASD A;  5ALI A;  5C0Y A;  3W5V B;  3RB3 A;  3HVZ A;  4ED0 A;  5DLF A;  1FXA A;  3RMK C;  4A90 A;  1X66 A;  4KLM A;  2PW9 A;  2AH5 A;  5JRT A;  2AL3 A;  4M0W B;  2LI6 A;  3PZ7 A;  1OFF A;  1QZE A;  2KQ7 A;  4YR0 A;  3RNB C;  2H5X A;  4AJY B;  2AQ3 B;  5ALV A;  8ICJ A;  5KG6 A;  1TS2 A;  2G09 A;  3UPQ A;  3JPP A;  3OJ4 B;  4M2Y A;  5ALQ A;  3TFS A;  2V4I B;  1QQ5 A;  1WCN A;  5KFO A;  5DB8 A;  2PEA A;  4OZB A;  1YZ6 A;  1TJE A;  2EQY A;  2ASJ A;  9ICP A;  2L7R A;  2ON8 A;  4FBU A;  3KH0 A;  5IKC M;  2YN4 A;  2H89 B;  4L2Y A;  4AP4 C;  4PT5 A;  5FK9 C;  2YVC A;  3JSV A;  1FO4 A;  1RPL A;  4XDC A;  2LHT A;  4KIK B;  3FM9 A;  4MDK E;  3BQ7 A;  1SV4 A;  1ZQA A;  9ICB A;  3KUD B;  1EM7 A;  3F2D A;  1NJW A;  1C4C A;  2JYT A;  2J53 A;  3M1Y A;  8ICB A;  2A4Z A;  5BYQ A;  4US8 A;  1SIJ A;  5L1I A;  2VZK B;  2LYH A;  1JRP A;  3QZ7 A;  1DGS A;  1JWU D;  2INN E;  1WR1 A;  4HJG E;  2KZR A;  4GB9 A;  4X5V A;  2ZVN A;  2MP2 B;  3KFU F;  4GIV A;  1NI3 A;  5ALJ A;  2HTM E;  2K22 A;  3HK0 A;  3DV9 A;  5KAF U;  2LVO A;  3TJP A;  2JZ3 B;  4YR3 A;  5AI4 A;  1RQL A;  1UT5 A;  3IG3 A;  1OTR B;  4F5N A;  1K1Q A;  3H9D A;  4OHJ A;  3RYT A;  1XSL A;  5AKZ A;  5JU5 A;  4GN1 A;  3RNG C;  1ECW A;  4UAV A;  1NK4 A;  3ZDA A;  2CU3 A;  4CF3 A;  1TK8 A;  4M9H A;  3PSP A;  2V3S A;  2WTF A;  3OAW A;  7ICR A;  4YXD B;  2EMT A;  5HML A;  4DQR A;  2MBE A;  3EPG A;  8ICO A;  3BK1 A;  3GS2 A;  1ZQW A;  5D6J B;  3RF9 A;  1RG6 A;  1WH3 A;  1BPB A;  3IVF A;  3APC A;  4LNN A;  9ICT A;  1C77 A;  4MGY E;  3TMP B;  4UBB A;  1X42 A;  4DSE A;  1TS3 A;  1WGY A;  4NM2 A;  2V3P A;  1PK3 A;  2Y5P A;  3L0W B;  2ZPN A;  3H4D A;  4GFJ A;  1UPH A;  2QC8 A;  2X8X X;  4CGZ A;  2W7O A;  3RCZ A;  1N6Z A;  1XSP A;  2PIA A;  4HXD A;  4EZK A;  1L0X B;  2WHE A;  2JX5 A;  4DSK A;  3ZD9 A;  2W43 A;  3R2T A;  3PW4 A;  2K3U A;  1T4G A;  3LVW A;  5AKX A;  4O3P A;  5KFX A;  4I2H A;  2CU1 A;  2JT4 B;  2K1F A;  2FPL A;  2Z59 B;  1OQQ A;  3W5U B;  2SEB D;  2W03 A;  1T7P A;  3BZD B;  4F7Z A;  3VDZ A;  2PMV A;  3JPN A;  1P98 A;  2C9W B;  4M02 A;  2DZK A;  2O2V B;  1IGD A;  4S0R A;  1WCL A;  2J6S A;  3RZW C;  3PR5 B;  1YMH E;  5AKG A;  3DVN V;  4YFK A;  4M0A A;  1HUO A;  3B1L X;  4ANU A;  3L16 A;  4FJZ A;  4FBJ B;  1V80 A;  2K6Q A;  4OJL A;  2WDQ B;  5DG7 A;  4Q8F A;  4K81 A;  1ZQP A;  2X38 A;  2NTT A;  3V05 A;  8ICW A;  8ICS A;  3AH7 A;  1P0R A;  2ZW1 A;  4F5R A;  2CHW A;  4IRC A;  2K25 A;  3KYD D;  1J19 A;  1LQB A;  5J29 A;  4UDU C;  4ZRI A;  3H7I A;  4DL3 A;  4NY8 A;  2QLT A;  2WXF A;  4LDT D;  4JPS A;  2KMD A;  3MC0 B;  4F5P A;  4BOS C;  1L6U A;  4DS5 A;  1NK5 A;  3C1Z A;  1JW9 D;  3I28 A;  5ALL A;  4IS7 A;  4FJV B;  2DQN B;  5ALT A;  2G4D B;  2JRH A;  4IUM B;  2VIX A;  3IDW A;  4DQQ A;  4J3O D;  2WXH A;  1WJN A;  4ECT A;  1NEK B;  2MH7 A;  3O65 B;  4FS2 A;  3RFZ B;  1QSS A;  3L08 A;  4LZD A;  4QZ9 A;  4CDG A;  3F2C A;  2A1A A;  3NRZ A;  2CJO A;  1WXM A;  3Q3F A;  4JE3 B;  5F9N A;  3NUQ A;  3VAW A;  1X9S A;  1V9P A;  3BZK A;  1ZDV A;  1V9J A;  4PHD A;  3OJU A;  4J9M A;  3PW2 A;  1KKX A;  5CHV C;  4OCZ A;  4ED2 A;  3LVV A;  3M62 B;  1MJD A;  4RF1 A;  1O08 A;  4B9M A;  2CJN A;  3B08 A;  2XI9 A;  1WJ6 A;  3GE3 C;  2BDU A;  2W7P A;  4XE0 A;  2FE9 A;  1S0O A;  4EE2 A;  2K8B B;  4MFA A;  1E7U A;  3I57 A;  4M9N A;  1CK1 A;  3M6Z A;  2JEF A;  4B9N A;  4K4G A;  4LZG A;  3VUX A;  3AN1 A;  2R8J A;  1C79 A;  3A9K A;  1IBX A;  1ZD2 P;  2F8K A;  3NG0 A;  3Q8L A;  2KHQ A;  2D3B A;  4QZ8 A;  4KGT A;  4GXI A;  1KM7 A;  1ZGU B;  1GPX A;  2GBM A;  1D9D A;  1SB3 C;  1JRO A;  3Q8B A;  4XRH A;  1S5L U;  4NAW A;  3IP4 B;  4QZC A;  4O3N A;  1QH9 A;  4RH6 A;  1X9X A;  2KTR B;  2JSV X;  4XUS A;  3KYC D;  9ICQ A;  4YN4 A;  2PFN A;  3VUY A;  1SZH A;  4UAR A;  1WZ3 A;  4I28 A;  4Y2Q A;  1A0P A;  2JY6 A;  2F1J A;  2JRZ A;  2XVT A;  3UGB B;  1HTQ A;  2OHF A;  2XGP A;  5KT6 A;  4QWE A;  4YT0 B;  1D8L A;  2WAQ F;  3ABV B;  2MCN B;  1Y56 A;  2NYV A;  1F1H A;  3A1Q A;  4MGZ E;  5JH5 C;  3H8S A;  2ZIW A;  3TAD A;  1SL1 A;  2J52 A;  3QUC A;  2KSO B;  4QWD A;  3VXW A;  3VRB B;  3VUW A;  4KKJ A;  2FBW B;  2PE6 B;  2KOB A;  1ISN A;  4BKG A;  3KBB A;  2FMQ A;  3HIZ A;  1ARO P;  3ZRF A;  4REZ A;  4DCC A;  1UD7 A;  3MR3 A;  2JV3 A;  5AI5 A;  2W11 A;  2ZTE A;  2C7M B;  2EH9 A;  2KJ6 A;  4P6V F;  3RFA A;  1FM0 D;  3M63 B;  4B0M A;  2YMP A;  2BB5 A;  1FFU A;  3AV8 A;  2WX1 A;  4HJK A;  3TEY A;  4Z6F A;  3R9K A;  2WXG A;  1CQV A;  2NPT A;  2VA3 A;  5AUK A;  1NKE A;  4LNI A;  5K4L A;  3HT3 A;  1P7D A;  2BPS A;  1XSN A;  5KL8 B;  4YXJ A;  3RB6 A;  5TR5 A;  1GC7 A;  4HCP B;  2XNA C;  2KMC A;  3M7D A;  1ZQD A;  1T8E A;  2EKI A;  2WXO A;  2IOF A;  4BGD A;  4MAC A;  2KDF B;  3IBE A;  2DHZ A;  3UQB A;  1RZT A;  5AZH A;  3RZF A;  1H8C A;  3CMM B;  4NM1 A;  3CSF A;  2HBM A;  3H4B A;  1S0N A;  3RBE A;  4ZRP A;  5J0Q A;  3QE9 Y;  1KDH A;  1ZQE A;  3N32 A;  1C3T A;  2DUY A;  2PVG C;  3AU5 A;  1QF6 A;  3PRP B;  4DSJ A;  4CCH A;  1SE4 A;  1NJX A;  1WY8 A;  2D3G A;  2D3D A;  2F76 X;  3CNH A;  4ECY A;  2DPI A;  4JUZ A;  4Q45 A;  4LDT B;  3WA0 A;  2G9H D;  3RJK A;  2C22 A;  2GBK A;  1ZQY A;  4DXG A;  5DBC A;  3KHL A;  4Y2S A;  4XDD A;  2F3N A;  4KN7 A;  3B2F A;  3K75 D;  3BS7 A;  4RGM A;  2HHW A;  4Q44 A;  3GIJ A;  2KFZ A;  4NL9 A;  4YQW A;  1QOB A;  4B9T A;  1MC8 A;  2W3S A;  2NR2 A;  2CPR A;  4MHV A;  4I2E A;  1K50 A;  2RR9 A;  2CKH B;  2ZIV A;  2C7N B;  3BQ1 A;  4HRS A;  1RWS A;  4C7Y A;  2FMS A;  3DQV A;  4ARI A;  2E1E A;  1FFV A;  5F3X B;  1WRI A;  1BT0 A;  2JEI A;  3P63 A;  5JHA A;  5ALW A;  2AGP A;  1QT9 A;  4JB3 A;  3AEG B;  2CS4 A;  3OHA A;  2MBB B;  2ZXH A;  3NVW A;  1SE3 A;  3PW5 A;  4IKG A;  1BPX A;  1V1O A;  1K52 A;  2EKE C;  1LVH A;  2RPV A;  4Y2Y A;  4K1R B;  4A3P A;  3GZF A;  1ZD3 A;  1KL9 A;  2Y9U A;  3QYP A;  2DF4 B;  4M00 A;  3MHZ A;  1CRX A;  3MAB A;  1WX8 A;  2L0T A;  4F4W A;  3LYS A;  5J2F A;  3Q8F A;  2HE7 A;  3RBD A;  3BYY B;  3C0R B;  2KT7 A;  5JHB A;  5CX3 A;  2L1A A;  4M9G A;  2ATL A;  2MRL A;  3LWL A;  2W9C A;  4ECW A;  2KZ3 A;  3N1Y C;  1OW5 A;  1ZUD 2;  3SEB A;  2JR5 A;  3HHM A;  4R3D A;  1L5U A;  4A3O A;  3M6K A;  4YSZ B;  1C4A A;  1ZQV A;  5BYS A;  3M9M B;  4K7S A;  3K1Z A;  3TAD C;  3EW9 A;  3WAP A;  3WAN A;  2ISP A;  4GMV A;  2R8H A;  1UZX B;  2AX5 A;  2PMZ C;  5KAI U;  2J42 A;  3DVN U;  3FIL A;  4IQW A;  3AMZ A;  2FCM A;  2HI0 A;  5HFY A;  1XF5 L;  2BVC A;  2JMG A;  3NOB A;  2NMQ A;  2ISO A;  2KZZ A;  2QMT A;  5CTR C;  1SGH A;  1MHH E;  2KJR A;  5KFZ A;  5J0Y A;  2V1Y A;  3C28 A;  4ICV A;  1B0X A;  3N28 A;  2BPC A;  1Z4N A;  2WDV B;  4UAZ A;  2WXN A;  5J2C A;  1SE9 A;  5C5J A;  3H7S A;  5ALM A;  4ECX A;  1KRH A;  5DG9 A;  4YD1 A;  4UBC A;  4I6N B;  1ZJM A;  3BY4 B;  2GH1 A;  1VD2 A;  4NJC A;  1V49 A;  4CF4 A;  4BWM A;  4TUQ A;  3X23 A;  1I4X A;  2ZUC A;  3AUO A;  4RNN A;  1KFY B;  2JUO A;  2BYE A;  5HHI A;  3DHI C;  1OEY A;  2BGW A;  2INC C;  4WWN A;  4QWA A;  4IM0 A;  2K6D B;  5AI0 A;  3VC8 A;  3VFK A;  2LKY A;  3TL5 A;  1GAQ B;  4TUU A;  2NBU A;  2FPM A;  1M4V A;  3OJ3 A;  1WIA A;  5KFC A;  1T0R C;  4CYE A;  1WXS A;  3RH6 A;  2KN4 A;  1GB1 A;  4TUR A;  2MUT A;  1ZQ1 C;  3IXS A;  4YCX A;  1MQ3 A;  1TE2 A;  1VLB A;  2J0K A;  3KWL A;  2M8S A;  5BO4 B;  1BUI C;  2KJH B;  3MFG A;  3BWU D;  5C23 A;  1AW7 A;  1RFK A;  2E6X A;  5CHF A;  2BCR A;  4KLU A;  3ML8 A;  1LFD A;  3OJS A;  3GIK A;  3PMN A;  3HUI A;  4EYI B;  3TBL D;  3ZDE A;  2KG5 A;  2ALZ A;  4YD2 A;  4RM8 A;  1CEZ A;  4KV2 A;  2G4S A;  4RUC A;  1GOZ A;  2FJ6 A;  4ELT A;  1TVA A;  2C2E A;  3L17 A;  3QJZ A;  2AHO B;  3PO5 A;  4O3O A;  5KFN A;  1ACC A;  4UB8 U;  3AEC B;  1YIW A;  2A3V A;  3OTQ A;  2UVU A;  3SV3 A;  5KG2 A;  2RSU A;  2KIC A;  2A1J A;  2XID A;  1XCT L;  2JPH A;  1ZQZ A;  5J0U A;  1I4R A;  2KFK A;  3PW7 A;  4HPL B;  2PLP A;  1A6S A;  3DBH I;  5KG7 A;  2DNF A;  3Q3N C;  2RDI A;  3M8S A;  1ZQR A;  1Y8R C;  4N59 A;  1DOQ A;  4DSL A;  4GLS C;  2PVO D;  3I9V 1;  5IIN A;  3JPT A;  1YQ3 B;  3L4P A;  3PHX B;  1E8Z A;  1Q8K A;  2E8N A;  3V6K A;  1L4D B;  1WR6 E;  4M04 A;  4I2F A;  2IGD A;  1ZE3 D;  1JIH A;  2DBY A;  1C7Y A;  2KE7 A;  1GO3 F;  4DS4 A;  4ECZ A;  3B0A A;  3IV6 A;  1YD8 U;  2D10 A;  3Q14 C;  4C8M A;  4H2A A;  2DKZ A;  5T8I A;  3N30 A;  1ROE A;  3ZDB A;  5E79 U;  1SWV A;  4MM3 B;  5KNI A;  5DGA A;  2QB0 A;  3BS5 B;  1MN8 A;  1WWV A;  1JWB D;  2N1W A;  3NS8 A;  3PZ8 A;  1WX9 A;  3HWT A;  1T3N A;  3ORY A;  7ICU A;  3EA6 A;  2CN1 A;  1WZ0 A;  4AUQ C;  1VZ8 A;  1FNV A;  2ES6 A;  2F2A B;  2MBH A;  3DBH B;  4OZA A;  2MW5 A;  4TKN A;  4JWN A;  2BYF A;  2WF7 A;  9ICO A;  4R66 A;  2ZEQ A;  4EZL A;  4AYB F;  3ZDD A;  1Q5W B;  2E8O A;  1JXE A;  5DCN A;  2ZIU A;  3V61 A;  1J7B A;  3C23 A;  1RFA A;  2Y0S F;  3H8M A;  5AKH A;  4ED7 A;  9ICX A;  4W9E A;  1ZQC A;  8ICG A;  4KLT A;  2JZB A;  1QOF A;  9ICS A;  2N9P C;  3A4S C;  1SWW A;  4P16 A;  1V38 A;  5J0S A;  4IG7 B;  5DQG A;  1VDV A;  1UA0 A;  1L8L A;  3JSV B;  4J9O A;  1TAM A;  8ICX A;  1TY0 A;  2IGH A;  1ZQX A;  2RD0 A;  5KG0 A;  2I1J A;  3GZN B;  2DWQ A;  3RNC C;  3ZNH B;  2Y9T A;  1ENF A;  2Q0Z X;  3KQ4 A;  2GOL A;  4HRO A;  4ED8 A;  4C4S A;  4EZ6 A;  2GBR A;  1WGH A;  3ZJU A;  2AJQ A;  1JMS A;  3AEF B;  2BZF A;  3V7K A;  1NZB A;  1TAQ A;  1ET9 A;  5G2N A;  3PLV A;  4M47 A;  1WX7 A;  2BCQ A;  1Z00 A;  4KX5 A;  3FDS A;  4LNK A;  1HEZ E;  2HJ8 A;  4IC7 B;  4F92 B;  3Q8R B;  1TAU A;  2KWD A;  3V6C B;  3RUL A;  5EE9 A;  2I5H A;  3UIO B;  4RQ0 A;  1U4A A;  3HP6 A;  2HVH A;  2KZM A;  1C1Y B;  3AEB B;  4ZHP A;  1E8Y A;  1KTQ A;  4M9J A;  1TKE A;  3VTU A;  2P6R A;  3RJG A;  1D4B A;  2KN5 A;  2PKO A;  1Y88 A;  4QZG A;  3QA8 A;  2WB1 F;  1IIP A;  3CF6 E;  1S0V A;  5J2D A;  2OWO A;  4BXO A;  3V62 A;  3S6J A;  3DBL B;  4CQN A;  1OUQ A;  3AL0 B;  3OSP A;  1P7E A;  1K53 A;  1XO3 A;  2JXJ A;  4FN2 A;  1BNP A;  3WU2 U;  4E0D A;  1KFD A;  4DFD A;  2FI1 A;  4RM9 A;  1J97 A;  1WYG A;  3ONN A;  5EWE A;  4MGI E;  2N0S B;  2ACZ B;  4QIW F;  2H3I A;  4G3X B;  5F9L A;  1SXD A;  2WS3 B;  4ZYN A;  2KDM A;  1EO6 A;  5J2E A;  4I2B A;  4MEX A;  2NTS A;  1KF6 B;  5EE3 A;  3IG5 A;  2RDH A;  2K4H A;  4RQ1 A;  3OWE B;  2EAN A;  7ICS A;  3N7R C;  1ZQI A;  1IG6 A;  3F53 A;  3RJE A;  1Q10 A;  5D94 A;  3C2K A;  1R4N I;  4RGO S;  4DL2 A;  1IGC A;  3N3K B;  2MWS B;  3GE8 C;  3RAQ A;  4GU2 A;  3ISC A;  7ICI A;  2XBB C;  5DB7 A;  1S76 D;  4JV1 A;  2YX8 A;  3TEW A;  2I1Q A;  9ICV A;  1OQY A;  2W54 A;  2G5H B;  1X6I A;  3H1U A;  2NVU I;  1RYU A;  2IO3 B;  2KHW B;  2GO7 A;  4FAD A;  1DOI A;  3LDA A;  4RNM A;  3RJI A;  4BKS D;  3AU6 A;  4NQK E;  3DDH A;  2QB0 B;  3BS5 A;  5CR0 A;  5DQH A;  1FXI A;  5T14 A;  4MM3 A;  3BDP A;  1EUV B;  4F71 A;  4RGN A;  1E90 A;  3RR7 A;  2JZB B;  2KFJ A;  2HHT A;  4IWP A;  2HHU A;  4TSS A;  2RDG A;  3KW5 B;  4ZHO A;  3U2S C;  2WB1 C;  2O6V B;  4KLF A;  2JWZ A;  1XS9 D;  4JLC A;  3UIP B;  5AIC A;  4QJF B;  3OGU A;  4R8U A;  4KLI A;  1JWM D;  3LYY A;  1DGJ A;  2WU2 B;  2C2D A;  4O1N A;  3J9C A;  2BGF A;  2LGY A;  2WXJ A;  3LDZ E;  5J0O A;  3MR5 A;  4KVG B;  4RNA A;  1EWY C;  3WAO A;  2XGQ A;  4GDK A;  1ESF A;  2MEK A;  3RD2 A;  2JZZ A;  3RNA C;  3RT3 B;  4KMO B;  1Z3E B;  4Y2U A;  2UWQ A;  4ECR A;  1TZ1 A;  1Z2M A;  4KDI C;  2MP2 A;  5TIS U;  4FE3 A;  4BBN C;  5HHH A;  2ZXI A;  2KN7 A;  2A5U A;  2RDB C;  2NRW A;  4WWO A;  4B6J A;  5BMI A;  1J2N A;  5KG4 A;  1C76 A;  3Q8A A;  4NWI A;  4TQS A;  2F1I A;  4JIO U;  3QWZ B;  1Q46 A;  4NV0 A;  4XQ8 A;  2RDJ A;  2BCV A;  5DPT A;  3SD7 A;  1N5X A;  1WM3 A;  3N1Z C;  3EC8 A;  1BPD A;  4WIP A;  4HDO A;  4KGS A;  1L6V A;  4QZE A;  5J2I A;  3V6H A;  2EAP A;  2OM6 A;  4ICA A;  2WYQ A;  4OVZ A;  3PST A;  1KSP A;  2WHI A;  1PZN A;  2WQY B;  2PXI A;  3SYZ A;  1WMH A;  1NDD A;  4EX6 A;  3SQI A;  3VHT C;  5E6N A;  2MSN A;  5J8Y A;  5G5H A;  4E71 A;  4PS3 A;  3VR8 B;  9ICK A;  1RYS A;  5G55 A;  3UM9 A;  5AI8 A;  2JU6 X;  1K5O A;  1QQ6 A;  1QSY A;  9ICA A;  1YN5 A;  2KTF A;  4GDL A;  2UVR A;  2AQ0 A;  3WKE A;  1C78 A;  3SR6 A;  4AP9 A;  5A0L A;  1ZD5 A;  2WWZ A;  3GIL A;  4DL6 A;  1J7C A;  3QEA Z;  2W8L A;  4CF5 A;  4BDP A;  4F3O A;  3I1Y A;  1YOV B;  3HX0 A;  1WI0 A;  2W82 A;  4DF4 A;  2D8C A;  3OHB A;  1D5X C;  1SEB D;  3M3J A;  4OVV A;  4BKT A;  4KLD A;  1XU4 A;  3DVG X;  4W9L A;  3DBR B;  4K4H A;  2IHN A;  1ZW7 A;  4DOB A;  1ZQM A;  4RPX A;  3ICX A;  1QLN A;  2KAC A;  1L7Y A;  2FCQ A;  5HHD G;  3FKY A;  4C00 A;  4K7W A;  2JQR B;  4Z6C A;  3UMC A;  1S0M A;  2ZW0 A;  2WFA A;  1PK1 A;  4A8E A;  4KLE A;  1UNS A;  5KTQ A;  3MFH A;  2B6G A;  2VH2 A;  1R7S A;  2UYZ B;  5BMH A;  3T3O A;  4PL2 A;  4UAW A;  4GXK A;  3FYH A;  4I29 A;  2PI5 A;  2WNM A;  5KFJ A;  3SFD B;  2IO1 B;  3AE1 B;  2EZX A;  1ZJN A;  1WE7 A;  4C8N A;  2M4N A;  3L3F X;  1DOY A;  4RQ3 A;  4WUR A;  1NK9 A;  2BDP A;  7ICM A;  2L83 A;  3L10 B;  2M19 A;  3FC4 A;  5KFR A;  1HZ6 A;  4WAA A;  4QZD A;  4WQO B;  5GMV A;  3ZIM A;  4RUA A;  2LMR A;  2OEH A;  1I7H A;  4J9P A;  2KJ5 A;  2VH1 A;  4PJ0 U;  5ALX A;  5AM1 A;  2KOX A;  2K39 A;  8ICM A;  3PS6 A;  1IUE A;  1G6J A;  3IT6 B;  4QZF A;  3AEA B;  2J0J A;  1VZ7 A;  2Z0E B;  7ICO A;  4P1C C;  3ZTC A;  9ICR A;  5L1J A;  3IN5 A;  3AQE A;  3AU2 A;  2I9G A;  2KO3 A;  5CP2 A;  4A9A A;  9ICC A;  5ALY A;  2WP9 B;  2VA2 A;  2K8A A;  4LTU A;  4NJ7 A;  5J2K A;  1S1Q B;  2EAM A;  4NLZ A;  2M1M A;  3KVF B;  4KX6 B;  2EAO A;  3TI0 A;  4NJ8 A;  3C2L A;  4RZR A;  2L8J A;  2LWP A;  1SV0 C;  2WAQ C;  1DRG A;  2KV2 A;  9ICN A;  2K8B A;  2LMC A;  2LFI A;  2WXP A;  2XO7 A;  4PYZ A;  1ZRM A;  5KFH A;  8ICV A;  5J0R A;  3A9J A;  2PMZ F;  2BPF A;  2PFO A;  4DXF A;  5KT7 A;  5JZE B;  4M6W B;  7ICT A;  1RYJ A;  4WQM A;  2KHV A;  4FHK A;  3JYU A;  3PO0 A;  3VR9 B;  1LKY B;  2FCS A;  3UXO A;  2IPK D;  1BNO A;  1H38 A;  2PKE A;  2MA9 B;  4RQM A;  3IAS 1;  3UI3 A;  5AUI A;  4QZI A;  3JPR A;  3GFK B;  4M9L A;  2Y5B B;  4M8N A;  5ALD A;  1LM8 B;  3DDC B;  4BJQ A;  3GOE A;  1WJU A;  1X40 A;  3TKA A;  5GTI U;  4O5K A;  3E2E A;  2FAZ A;  2OCE A;  1KW4 A;  2W9N A;  1STE A;  4QNL A;  1WMH B;  4I6L B;  2WGS A;  7ICJ A;  2H3F A;  3UF8 A;  1XLP A;  4E3C A;  1PGX A;  2AU0 A;  3KWV A;  2O6V D;  4JWU C;  1B1Z A;  3MDC A;  4I27 A;  2HW3 A;  3PX0 A;  4DHJ B;  5DDM A;  3RTV A;  2QAR A;  3RUI B;  3V60 A;  1U4B A;  1E9M A;  1JAL A;  2ODG A;  1K1S A;  4PS7 A;  1Z1V A;  1QOA A;  3AE4 B;  3BVG A;  4KSK C;  3A33 B;  2KAJ A;  3UXN A;  1ZQH A;  2RQ5 A;  1FRR A;  2OH2 A;  3WK9 A;  4KLH A;  2FID A;  2I1K A;  2LM4 A;  3RAX A;  4J9S A;  1N56 A;  4II3 B;  4MJS A;  5D3D A;  1UWM A;  2LYA A;  7ICV A;  3H40 A;  1LB2 B;  3H0L B;  4KMU A;  1V1P B;  4Y2J A;  4DLE A;  5AK3 A;  3EUB 2;  4QZB A;  3AM9 A;  2FLN A;  2PFP A;  3DPD A;  3B0X A;  3RJF A;  3SAF A;  4W9H A;  2HSZ A;  2M0N A;  1PYW D;  4EUT A;  2N1R A;  5CA7 A;  1HZ5 A;  3MGH A;  2RP5 A;  4IQV A;  4NL9 C;  2BYV E;  2LRW A;  3WAL A;  1N62 A;  3LXF A;  4P4P A;  3R7Q A;  3SMV A;  2DFL A;  1JXL A;  2HHS A;  2N9L A;  3HRD D;  1ZQT A;  3CST A;  4OZC A;  4G50 A;  1KQQ A;  5ALU A;  1YT3 A;  4I2I A;  3ED5 A;  4Q8E A;  1V6E A;  3M9O B;  2NBW B;  2XCP A;  1HQR D;  2HTH A;  2ZJD A;  4FO6 A;  2WXL A;  1VRA B;  3WAM A;  4GDK B;  2Y5C A;  1V97 A;  5DPR A;  4AYB C;  1WJ4 A;  4C4V B;  4R8U B;  1ZQJ A;  5G5G A;  1B43 A;  1COK A;  3IAM 1;  3PT2 B;  5L83 A;  3ZYY X;  3MP9 A;  1JWS D;  2G45 B;  2D11 A;  4OJP A;  1WXV A;  1ZQQ A;  2KAN A;  5DB9 A;  3TFR A;  5HKH A;  1Q1O A;  9ICU A;  1A77 A;  1T5X D;  5E6P A;  1PUZ A;  2R2Q A;  2NO5 A;  2YY6 A;  3MTN B;  4LLG M;  4WJP A;  2B3A A;  3ALB A;  3HPO A;  5KHQ A;  2GBJ A;  3T3F A;  2Z0D B;  1QOG A;  5HP4 A;  3JW0 X;  1RXV A;  1WWT A;  2DL0 A;  2AWT A;  3CIR B;  4K4I A;  1XXG A;  4MFF A;  3ZKJ C;  5KT3 A;  1VCB A;  1N2X A;  2WF5 A;  2JF5 A;  3B2G A;  5KT2 A;  2GB1 A;  3DHH C;  2BPG A;  3A1Q B;  7ICE A;  1S77 D;  4EEY A;  2IA6 A;  4OD0 A;  5AKE A;  4W9G A;  3JPO A;  8ICT A;  2MHJ A;  2LM1 A;  3ZNI D;  4PZN A;  4A20 A;  4GC7 A;  1XEE A;  3AQF A;  4RPY A;  3ZXV A;  1I4H A;  5E6J A;  1WWU A;  2KP7 A;  4QW8 A;  1MI0 A;  1WXQ A;  2VAN A;  7ICF A;  4FA6 A;  1RAX A;  2Z7J A;  3BZC A;  2KVC A;  5AZG A;  4XA5 A;  4BVU C;  3NAS A;  3T5H A;  3AE8 B;  3PR4 A;  1ZP0 B;  4UB4 A;  4IM2 A;  1KEJ A;  4US9 A;  5AKK A;  1BPE A;  9ICI A;  5CWR A;  3NJT A;  1FRD A;  4JGH B;  3GDX A;  3KHH A;  2XY5 A;  1SKR A;  2KMM A;  2BQR A;  5H2F U;  5KFW A;  1XNS A;  2JEG A;  3KKA A;  4UB2 A;  2C60 A;  1PK1 B;  4HAI A;  3DWG C;  2YLM A;  1ZQS A;  2A19 A;  3SEI A;  3ECI A;  4PHP A;  3SD5 A;  3W9C B;  3GV5 B;  5CB1 A;  4P1B C;  4KLL A;  2BT6 A;  2ONQ A;  4JMU A;  4EEK A;  1SJH D;  5EE1 A;  1M6Y A;  4KLG A;  1ZQF A;  1NBF C;  3IFW B;  4BKS A;  5AM4 A;  1RM6 C;  1BXT A;  4HYK A;  4ECQ A;  5AK4 A;  3U30 A;  2ZIX A;  4TUP A;  2XIC A;  1NYQ A;  3PZD A;  1Z00 B;  2FDR A;  2XN9 C;  4TUS A;  4KTQ A;  3AB5 A;  2MAX A;  1HXY D;  3PV8 A;  3QC8 B;  5DBB A;  3TEX A;  1ZOL A;  4YR2 A;  3DOW A;  4YTP B;  1UHU A;  4B9L A;  3BIN A;  3QAR A;  1HA5 A;  2OJW A;  3T8M A;  5LNK 1;  4W9I A;  2DAF A;  4F8C B;  5AKI A;  3NY5 A;  4ZOH C;  5AI9 A;  4UB1 A;  2Y1I A;  1XLN A;  4F4Z A;  4GOC A;  5EDS A;  5KFI A;  1VJ5 A;  3GQC A;  3O0F A;  5HR7 A;  1DYQ A;  4NQL B;  5EWF A;  5IIO A;  3AEV A;  2O6K A;  3CW2 C;  2QJL A;  4J03 A;  5KG5 A;  4RQ8 A;  2WXR A;  5DKW A;  1BGX T;  4KZC A;  2MJD A;  4EBC A;  2DEN B;  4RT3 A;  7ICQ A;  2VRR B;  2KD0 A;  4F5Q A;  1L3U A;  4FFD A;  1MA7 A;  1KBU A;  2UVV A;  3WK6 A;  1TTN A;  1IV8 A;  3KZI U;  1YX5 B;  1KTK A;  2PPH A;  5FKA C;  2KFK B;  4EZJ A;  2HBK A;  1MHX A;  4JV0 A;  4WJO A;  2N7D A;  2PTL A;  4HWI B;  2QIL A;  2VJ4 A;  3AI5 A;  4WWM A;  2NO4 A;  5GTH U;  5AKY A;  2CHX A;  1J0G A;  3DBL I;  5KFD A;  3LK9 A;  4F72 A;  4IC9 A;  4O5C A;  2KD1 A;  5CHG A;  5HMM A;  1UH6 A;  2YQE A;  3APF A;  5AKJ A;  1PVQ A;  4YL8 A;  2RPQ A;  1OEY J;  2XY7 A;  1OQR A;  4MSM B;  3NVY A;  3BQ2 A;  1T0Q C;  3U4E G;  1DK3 A;  4PYU A;  3TAN A;  1SL0 A;  1RDF A;  4UAT A;  4II2 B;  4A6Q A;  2AEH A;  2XK5 B;  3LWM A;  5L1L A;  2G5I B;  4IWO A;  3DWM A;  4W9C A;  3HKZ C;  3ZNZ B;  5KFS A;  3Q8S B;  3PLU A;  2N9X A;  3GV7 B;  2A1J B;  1N5W A;  4BX9 C;  2FE8 A;  3QX7 A;  2BW2 A;  4YMO A;  3U7Z A;  3WCQ A;  1JUD A;  4ELU A;  2ZIW B;  4EFO A;  3TAR A;  2AQ2 B;  4WJQ A;  2KK8 A;  5DPS A;  3HVD A;  3URY A;  4DQO C;  3EFU A;  3LJ3 A;  1R4M B;  5J0P A;  3K9P B;  4GSW A;  2LPE A;  2KNB A;  3BQ0 A;  3U7D A;  3QEB Z;  2OOB B;  2IBK A;  5IO9 A;  2DAJ A;  2XC9 A;  3OLM D;  3ONS A;  3I76 A;  1UBQ A;  1WXA A;  2ZUB A;  4KLJ A;  2V4L A;  4X57 B;  3U26 A;  9ICE A;  2IGG A;  2WXK A;  1I42 A;  1EF1 A;  5IA7 A;  4DQI A;  3P42 A;  5DLG A;  3V7L A;  4DWF A;  3KLS X;  3QU4 A;  1F44 A;  7ICG A;  4RPZ A;  1K51 A;  1R4N B;  4MH0 E;  5DGB A;  5AM3 A;  4NNJ B;  3RH5 A;  2MJE A;  4RCO A;  3PRE A;  1E10 A;  2E5S A;  4ZRK A;  4O9M A;  1L0Y B;  5EWG A;  1N61 A;  3M95 A;  4ED3 A;  2K9X A;  4K3B A;  3PZP A;  3Q3J A;  1N63 A;  3NZS A;  1L7M A;  1N48 A;  4A55 A;  3T3N A;  2MBQ A;  4PHE A;  4RFB A;  5L1K A;  3NTU A;  3Q3M C;  1GJZ A;  1NKC A;  3QAQ A;  1SIF A;  1ZOY B;  3HKZ F;  1TV9 A;  1EXN A;  5J2J A;  3QIJ A;  4MSQ B;  1NK6 A;  4RGT A;  2DPJ A;  2Q4T A;  2LGI A;  5DPW A;  1DOX A;  2KC2 A;  4MEL A;  2JGA A;  4DDI D;  2NRZ A;  3DEE A;  1EF5 A;  3ZI4 A;  4QW9 A;  1SBB B;  2KFN A;  4PZO A;  2F44 A;  3R66 C;  3PX4 A;  2HJ1 A;  2WX0 A;  5AHX A;  2JXX A;  1LKY A;  2OJR A;  3W1S C;  2REX A;  3MR6 A;  5IAA C;  4EEL A;  4M6W A;  3A9K B;  2BBC A;  1IBX B;  3QU9 A;  1WGG A;  1WFY A;  3D6J A;  4PH5 A;  2QHO A;  1PVP A;  1CI4 A;  3SEN A;  4ZRQ A;  1QTM A;  4Y2T A;  3VTW A;  3F5A A;  4ITK A;  2GOW A;  1B4F A;  3GU3 A;  4AS1 A;  2L5Y A;  1XD3 B;  2YB1 A;  5IN7 A;  4B9U A;  9ICG A;  3IT4 B;  4XC2 A;  4O5E A;  3PX6 A;  2F1H A;  1UA1 A;  4Q43 A;  4P7I A;  1YJ1 A;  2W9M A;  1C4P A;  2DKX A;  2F77 X;  1YNT E;  1IPG A;  1S10 A;  3L54 A;  3KOO A;  5DDY A;  3NVV A;  4UB5 A;  1T3Q A;  2ZIV B;  1F9J A;  3VRA B;  2P66 A;  1HEK A;  4G9B A;  3WK7 A;  2L52 A;  4YVZ A;  4QIW C;  2JRI B;  2LGS A;  5BOM A;  2JH7 A;  3PNC A;  1ZQK A;  2BKR B;  3Q8P B;  2LUM A;  3VTV A;  4OJ5 A;  2BS3 B;  4DHZ E;  2WXI A;  4DL4 A;  4MF2 A;  4DXA B;  2NS5 A;  1FXT B;  3QX1 A;  4M01 A;  3GB1 A;  5KHO A;  2LYB A;  4DF8 A;  3VH3 B;  4MGK E;  4XWW A;  4ECV A;  2C2R A;  1E5W A;  4RQ4 A;  2W55 A;  1U48 A;  3EZ5 A;  4KSL C;  4QWC A;  2BQU A;  1X6J A;  1NKB A;  1YQ4 B;  2V0G A;  3H7P A;  3Q69 A;  4NAM A;  3M8R A;  4DFP A;  2IY1 B;  5J2B A;  2VKQ A;  4ELV A;  4NLC A;  3V6J A;  2JWU A;  2ZJ8 A;  3THV A;  3QK0 A;  2E8P A;  3GII A;  1NJZ A;  5KFP A;  2LJI A;  4RMA A;  4F4Y A;  2NRX A;  1NNL A;  5FR3 A;  4FZN A;  3V7J A;  1JML A;  3ISD A;  5ALF A;  3D2S A;  2O2V A;  3MJW A;  3QU2 A;  3QHT A;  3AED B;  4W9J A;  1Q0W B;  4G3I A;  3DVG Y;  4BOZ B;  4F8R A;  1F5S A;  4YP3 A;  4BFR A;  1YJI A;  4DOC A;  5III A;  4C4V A;  5B5E U;  2IDY A;  3PGE A;  4JK1 A;  1ZQO A;  1D5Z C;  3DHG C;  4RQ2 A;  3PO4 A;  5J2G A;  3CRX A;  4WJ3 B;  5AM0 A;  3WKA A;  1E8X A;  2YTU A;  2MJ3 A;  3W1Y A;  2LBO A;  4I2J A;  1E6E B;  2KJ9 A;  3ML9 A;  5KFQ A;  1AWD A;  4MJS B;  1OXJ A;  4FS1 A;  4C8O A;  2IMW P;  1UT8 A;  3QUB A;  5IIM A;  1LO5 D;  1TK5 A;  2YMM A;  1YN4 A;  1E8W A;  2FNJ B;  1D5M C;  2IO0 B;  5ALG A;  2VA8 A;  8ICY A;  3SU8 X;  3F5E A;  3D32 A;  4CE6 A;  1IP9 A;  2IBI B;  3KHR A;  3SV4 A;  3P4P B;  4DSF A;  1LV5 A;  2RLT A;  3QU5 A;  2N1V A;  2E3T A;  5BMG A;  3QNM A;  3D2Q A;  2KDI A;  4OVU A;  3UMG A;  3KTQ A;  1NEN B;  1SV0 A;  4WAF A;  5ALR A;  8ICN A;  5JTI A;  3QU7 A;  1SZP A;  4R64 A;  3TAQ A;  2W9B A;  5D4B A;  1GC6 A;  8ICH A;  5EE0 A;  4EOY A;  2KKV A;  2BF8 B;  1T0S C;  2LHE A;  1Z19 A;  3ZTD A;  4F1S A;  3MC1 A;  4F4X A;  4HKZ E;  5L1M A;  5AK5 A;  4J9R A;  4PPX A;  3NVZ A;  4P0Q B;  1B9R A;  3WK8 A;  4IR9 A;  2H88 B;  3Q2A C;  2L3Z A;  4IOI E;  2N9E B;  1RYR A;  1UEL A;  2KSO A;  3TAC B;  3AEE B;  2QDF A;  9ICF A;  1MSW D;  1YX6 B;  5J8Y C;  2K60 A;  1NK0 A;  5L9X A;  4GXB A;  5LLI A;  2V3N A;  4HK2 A;  4NZL B;  4UB3 A;  1PVR A;  3KUZ A;  4JL9 A;  3K1R B;  5L95 C;  2MBO A;  2DZI A;  5J0T A;  1TK0 A;  2LHD A;  3BYT B;  3FIL B;  5KFY A;  2R2O A;  5IIK A;  4GLX A;  4O3Q A;  4AWJ A;  5BYR A;  4MH8 A;  2KVS A;  1PGA A;  1XLQ A;  2OYY A;  5DBA A;  4P4O A;  2LXC A;  1D6E C;  3TSS A;  3IM1 A;  1MFW A;  1ZYQ A;  1QQ7 A;  1CJE A;  4ICU A;  2HMX A;  3ZJV A;  1NJY A;  4W9D A;  4CO7 A;  1A76 A;  4PGY A;  5J2A A;  1RLF A;  4J6I A;  1FD6 A;  4F93 B;  2J0M A;  2KC1 A;  4F50 A;  1XWL A;  4DK5 A;  3JPS A;  1CMX B;  1I4G A;  4TMA B;  3V6E B;  3ZLZ A;  3TQ1 A;  5AEK B;  1CUK A;  4QZA A;  4ARC A;  1ZQB A;  4F4K A;  2LGX A;  1FEH A;  3B0Y A;  1ZD4 A;  4P2H A;  2FCN A;  1F0M A;  4R63 A;  7ICK A;  4Z6E A;  3C1Y A;  2KWU B;  3EPI A;  4C80 A;  2L0F A;  2YEP F;  3ZNG C;  1PQS A;  2BQ3 A;  4KLS A;  3PVL A;  5C3J B;  3UMB A;  7ICP A;  4RQ6 A;  2ASL A;  2GWS A;  2BS4 B;  4UW9 A;  2K4P A;  4B95 A;  1V5T A;  3MGV A;  5AM5 A;  1Q3U A;  4DQS A;  1ZQG A;  4EKU A;  2L32 A;  4HPP A;  4LCD E;  1ZPS A;  3R2I A;  4IDI A;  2G3Q B;  5HI1 A;  4OJ6 A;  3J81 j;  3QQ8 B;  2HBL A;  4J9N A;  1AYF A;  3H8H A;  2BTE A;  3AE7 B;  5D46 A;  4I2D A;  5D3I B;  3PML A;  4KX3 A;  1HE8 A;  4ZH4 A;  4YSY B;  2PI4 A;  1F77 A;  5IP4 D;  2MLB A;  5J18 A;  3RNE C;  2JXT A;  4GIB A;  2Y0S C;  3P2B A;  3RH4 A;  5AIA A;  4L1B A;  5BOL A;  3L13 A;  1UBI A;  3PPA A;  3ZGZ A;  3A0H U;  1J8C A;  2KVR A;  4IQU A;  3PSF A;  4P0P A;  2HOQ A;  1YN3 A;  4K3C A;  4C56 C;  7ICL A;  4PGQ A;  4D2K A;  1FEZ A;  1S97 A;  2YB4 A;  4MEY A;  4LVS A;  2K8C B;  8ICQ A;  1NYR A;  3PHW B;  1UUP A;  1TS5 A;  4OJO A;  1WSP A;  4FZL A;  4Z6D A;  9ICW A;  3BK2 A;  2PFQ A;  5C2T B;  2GBN A;  3MJ5 A;  4IRD A;  3G6Y A;  2OXO A;  2IJ0 A;  2LD9 A;  4EBD A;  3Q8M A;  5D2M B;  1V86 A;  1PGB A;  1JI7 A;  2RMM A;  3T79 A;  2G08 A;  1KH0 A;  2NBV B;  4WWP A;  2AL6 A;  7ICH A;  1TT5 B;  2DLB A;  2ZG6 A;  1QSL A;  4YMN A;  2K0P A;  2BKE A;  1KRP A;  2ESE A;  1JX4 A;  4R65 A;  2CHZ A;  4BAX A;  5HR6 A;  1QLB B;  5H92 C;  1SJE D;  5KT4 A;  2AGQ A;  2V4Q A;  4YTN B;  3QUQ A;  4FZM A;  1U9L A;  3WKD A;  3RN9 C;  4C8K A;  5CEH A;  3ENE A;  4DBG A;  2R8I A;  1IXR A;  1WM2 A;  3V3X A;  4IQT A;  4KIT B;  4P4M A;  1PUT A;  4JX1 C;  4KGR A;  4CNQ A;  1ZET A;  4WJN A;  3RB4 A;  1KFS A;  3NZU A;  4UAS A;  3DCG A;  3HIL A;  3EGR A;  2QAR B;  5AM2 A;  2XK5 A;  3T5K A;  2FIF A;  2DGZ A;  1VJK A;  2IZV B;  2IYD B;  4ED1 A;  2BWF A;  1SXT A;  2N7E A;  4PK1 A;  1D3Z A;  2KKP A;  2ZCC A;  2KWV B;  1Q3V A;  1NK8 A;  4RQN A;  2GLE A;  3T5L A;  4PS8 A;  3PRM B;  4S17 A;  1A70 A;  3U8Z A;  1GG3 A;  1P1A A;  4TQ1 A;  3E0F A;  3PRZ A;  3EWA A;  4C7Z A;  4YMM A;  1TY2 A;  3VH4 B;  8ICU A;  4USA A;  3CYM A;  4NAW B;  3ZVV A;  1V1P A;  4DFK A;  1E7P B;  2D5G A;  2K4I A;  2HBJ A;  3VCB A;  3MC9 A;  1S8O A;  2P6U A;  2KK0 A;  2I6X A;  1CZP A;  1EWC A;  2KX3 A;  2WF6 A;  2K8H A;  4F91 B;  5DG8 A;  3MDA A;  4IW0 A;  2P35 A;  1BPY A;  5AKL A;  2SAK A;  3C19 A;  5TSS A;  2WDR B;  3Q8K A;  2WDT B;  4O0I A;  3Q8Q B;  2K4E A;  4URK A;  2MQJ A;  3SDL C;  4NXZ A;  3G6X A;  2K5P A;  1WG8 A;  2KWC A;  3EEC A;  3I3T B;  4Y2V A;  3ZJT A;  4MT5 A;  2NCN A;  4XGA B;  5ALH A;  4LJX A;  1ED1 A;  2BHN A;  1L5P A;  2LAS A;  3NZ3 A;  4IM3 A;  2WXQ A;  2YEP B;  3ZRC A;  2ZTD A;  4HDQ A;  4EYH B;  3C29 A;  1M94 A;  2M0X A;  3NHE B;  5J17 A;  3HW8 A;  1UCV A;  4ECU A;  4M8M A;  2HCF A;  3D2N A;  8ICK A;  2OED A;  3EFC A;  4G0N B;  2N7J A;  4DHZ B;  4KLQ A;  3AE6 B;  3SAH A;  4LNO A;  1YZ7 A;  3RNF C;  4A8X C;  2D3C A;  4YWG G;  4ASW C;  1XO0 A;  1FNU A;  5CRX A;  2HHV A;  2EEL A;  2PJH A;  5J0W A;  1ZRN A;  3OG5 A;  1FPY A;  2K89 A;  4HPM B;  1KN5 A;  4C4T A;  1Z5S B;  3CWI A;  5AK6 A;  2JHD A;  2MSE D;  1L7N A;  4I2C A;  3IRU A;  2KLC A;  4LK0 M;  2KTQ A;  3ZQ4 A;  5IIJ A;  4QWB A;  1DXS A;  1NVI D;  4AOF A;  4YTM B;  2IHM A;  1YQB A;  1MQ2 A;  1P9D U;  2YML A;  3ISB A;  4Y2P A;  1KJT A;  4NLG A;  4DLG A;  9ICJ A;  2L05 A;  4XX5 A;  5IOI A;  3PV1 A;  3JVZ X;  4DSI A;  3WKB A;  4KDL B;  4DEZ A;  4MF8 A;  4N6E B;  1SXE A;  2JH1 A;  2Y3A A;  4LNF A;  4MEM A;  3NRW A;  4C8L A;  3NGD A;  3P1M A;  4ED6 A;  1WGR A;  4F5O A;  4BXO B;  2LJ5 A;  2DYO A;  1MG4 A;  1NOM A;  3L5K A;  1AAR A;  3CP8 A;  2AGO A;  2IND C;  1TS4 A;  3EHV A;  4DHJ D;  1WGD A;  4EX7 A;  1T6B X;  2EZZ A;  4Q2J A;  1OGW A;  3MGI A;  3ZDC A;  1PDX A;  4DOA A;  4O3S A;  2ZNV B;  3DBR I;  1XC9 A;  1PFD A;  8ICZ A;  3RPF C;  2N4F A;  5JXV A;  3PW0 A;  1J7A A;  1GNU A;  1U45 A;  4J9L A;  1XT9 B;  3ETL A;  8ICL A;  3I63 C;  2D6F C;  2UVW A;  4FJY A;  4DFJ A;  2GI9 A;  1FNW A;  4RT2 A;  1UGJ A;  2QB1 A;  4IL6 U;  4HEA 1;  2B21 A;  3WKC A;  2Y1J A;  2WF8 A;  5MPO A;  4IRK A;  3ZXR A;  1AQ6 A;  4NLN A;  1N60 A;  3HM6 X;  4NLB A;  3AE5 B;  4TV3 A;  4DFM A;  5ALK A;  1FMA D;  5J0X A;  4ECS A;  1RQN A;  2DZJ A;  3WK4 A;  3ZO5 B;  5KG1 A;  1U47 A;  2KJ8 A;  4RNO A;  5KFT A;  1TKY A;  1YJJ A;  5FP0 A;  1TFR A;  2NRT A;  4ANX A;  2EMS A;  2HHQ A;  3RJJ A;  5D7G A;  2MX2 A;  4DQP A;  1WGK A;  2DYB A;  1TKD A;  3H0M B;  1RXW A;  3R8B A;  4DO9 A;  2AQ4 A;  1F52 A;  3I5J C;  4XWT A;  8ICE A;  1V85 A;  1FIQ A;  2HOI A;  2CRX A;  3N9Y C;  2EDU A;  4EEW A;  1COO A;  3W2D A;  3ZW3 A;  1JN3 A;  2VZK D;  2BYT A;  4GC6 A;  4I6P A;  4UQG A;  3QZ8 A;  1L4Z B;  3N97 B;  4LJO B;  4W9K A;  4B6W A;  2JVC A;  2W9A A;  5KFL A;  8ICP A;  4YSX B;  3TIX A;  3AUL A;  2NRV A;  1IYF A;  1L3T A;  1SGG A;  2FUH B;  4GDL B;  3UXP A;  4C4R A;  3C21 A;  5KT5 A;  3ETR A;  1H4R A;  5KFG A;  1UQV A;  2Z8L A;  1S3S G;  3KKA C;  1SF0 A;  4EBE A;  1ZXI A;  1V8C A;  2BB6 A;  3A4R A;  3AXC A;  5ALE A;  2LRU A;  1QKZ A;  1L0V B;  2KQS A;  1ZKH A;  3N1X C;  5LXI B;  1S9F A;  4B0E A;  2QIE B;  2BCS A;  2LZ6 A;  3IHQ B;  3ZDM C;  1EU3 A;  1XQQ A;  4NLK A;  2JZP A;  4NY0 A;  5HG2 A;  4ACO A;  3GV8 B;  2E8M A;  2FLL A;  3E9S A;  3O13 A;  3Q3O C;  2BCU A;  2V9W A;  2WLB A;  3TUO A;  1JQ4 A;  2KX0 A;  3N20 C;  4AQ7 A;  4DL7 A;  4B9K A;  3A0B U;  4N9F 4;  2E1F A;  5IIL A;  4PHA A;  2BKF A;  2C7H A;  3MBY A;  2GMI C;  3QCA A;  3X0W A;  3WK5 A;  1NK7 A;  4IWQ A;  3F2B A;  2H3V A;  5ALS A;  5GXG B;  3ZUN A;  2K8C A;  1XO1 A;  4O3R A;  3MFI A;  4FXC A;  1KLU D;  2BQQ A;  2QEJ C;  2LGD A;  4YXM A;  5AZF A;  2ZPY A;  2JEJ A;  3GZN I;  2MU2 A;  4M0W A;  3QUT A;  1DK2 A;  1X9W A;  2DZM A;  2KXJ A;  3OPX A;  1FCC C;  4BWJ A;  3OSN A;  5KFE A;  3W1S A;  4I2G A;  1F0Z A;  4DL5 A;  1WYW B;  1P3Q U;  1C9F A;  3P4S B;  1I35 A;  1MVK A;  5D49 A;  3RI7 C;  2WU5 B;  5J2R A;  1UWX A;  3SAG A;  1FCL A;  3K9O B;  4BBN F;  1QIL A;  1L6N A;  4N58 A;  1ZQU A;  2M9N A;  2KIW A;  8ICA A;  2JYE A;  4JWM A;  5LXH A;  3SHQ A;  3N4M B;  2DYM A;  1D8B A;  4ACF A;  4EZ9 A;  4YG2 A;  2RRD A;  2W3R A;  2BR0 A;  5C1Z A;  4B9V A;  4P0P B;  3EYZ A;  5ALO A;  2FMP A;  3PY8 A; 
#chains in the Genus database with same CATH homology
 4B0M A;  2BB5 A;  2M19 A;  1E0Z A;  2HDE A;  1FFU A;  3AED B;  3FC4 A;  3AV8 A;  1HZ6 A;  1GB4 A;  3TEY A;  2WXG A;  2J4X A;  1YJI A;  1I7H A;  1CQV A;  5AUK A;  2IDY A;  1F2R C;  4ZYS A;  3SFE B;  1D5Z C;  1XCQ L;  1QQR A;  1IUE A;  2XNA C;  2MJ3 A;  2EKI A;  2WXO A;  1E6E B;  3IT6 B;  4MAC A;  3AEA B;  1AWD A;  1VZ7 A;  3B9J A;  1LO5 D;  4A9A A;  1YN4 A;  3AE3 B;  4ZRP A;  1D5M C;  2WP9 B;  2TSS A;  2PVG C;  1QF6 A;  4LTU A;  1SE4 A;  1VR9 A;  1ET6 A;  4KX6 B;  3P4P B;  2E3T A;  5BMG A;  2G9H D;  2Q5W D;  2AQ1 B;  2WXP A;  2LMC A;  2LFI A;  1NEN B;  2G1E A;  4DXG A;  4WAF A;  4DXF A;  4XDD A;  3B2F A;  4RGM A;  4TQ0 A;  5EE0 A;  1RYJ A;  1QOB A;  4WQM A;  2LHE A;  2W3S A;  3PO0 A;  4HKZ E;  3VR9 B;  1K50 A;  2IPK D;  1JCK B;  3NVZ A;  1B9R A;  3IAS 1;  3UI3 A;  5AUI A;  3BVM A;  2H88 B;  4IOI E;  5I4D A;  4HRS A;  1RWS A;  1KLG D;  4C7Y A;  3AEE B;  4ARI A;  1F2R I;  1FFV A;  1WRI A;  3P63 A;  2V3N A;  3Q8E A;  4NZL B;  1QT9 A;  1P7F A;  3U52 E;  3AEG B;  1MPE A;  1STE A;  1ZDX A;  1XLP A;  3NVW A;  1SE3 A;  4IKG A;  2LHD A;  1V1O A;  1K52 A;  1PGX A;  3NS1 A;  2RPV A;  3BYT B;  3FIL B;  3LB8 C;  3KWV A;  4JWU C;  4RF0 A;  1B1Z A;  3NUH B;  3MHZ A;  5BYR A;  4MH8 A;  3TEZ A;  1AN8 A;  4KKI A;  3Q8F A;  1PGA A;  1XLQ A;  3BYY B;  1TZO A;  3TSS A;  1D6E C;  1E9M A;  1JAL A;  2L1A A;  1CJE A;  1QOA A;  3AE4 B;  3ZJV A;  3BVG A;  2KAJ A;  3BII D;  4L23 A;  1FRR A;  1FD6 A;  1ZUD 2;  3SEB A;  4R3D A;  1SSN A;  1JWA D;  5D3D A;  1XLO A;  4YSZ B;  1UWM A;  1C4A A;  1I4G A;  5BYS A;  4TMA B;  4HKQ A;  1V1P B;  2B76 B;  3EUB 2;  4ARC A;  3AM9 A;  1FEH A;  2BS2 B;  2AX5 A;  2J42 A;  3P4Q B;  4OW0 A;  3FIL A;  3C8Y A;  3AMZ A;  1PYW D;  5HFY A;  1HZ5 A;  1XF5 L;  3BVZ A;  4C80 A;  2NMQ A;  1TKG A;  2QMT A;  5C3J B;  1N62 A;  3LXF A;  1MHH E;  2BS4 B;  3Q8C A;  1SE2 A;  2N9L A;  3HRD D;  2L32 A;  2WDV B;  1ZPS A;  3R2I A;  4OZC A;  2WXN A;  1BML C;  4IDI A;  5HI1 A;  3GP7 A;  5H8Y E;  1KRH A;  1HQR D;  2BTE A;  1AYF A;  3H8H A;  1I4P A;  2WXL A;  3AE7 B;  1VRA B;  4GDK B;  2Y5C A;  1V97 A;  5D3I B;  4NJC A;  1I4X A;  4YSY B;  1F77 A;  1KFY B;  2JXT A;  2M0A A;  5G5G A;  2R61 A;  4WH4 A;  3IAM 1;  4L1B A;  3ZYY X;  3ZGZ A;  2I2Y A;  3MP9 A;  1GAQ B;  2ICI A;  1YN3 A;  1JWS D;  1M4V A;  1VZ6 A;  4C56 C;  3FAH A;  3AE2 B;  2KN4 A;  4D2K A;  1GB1 A;  1T5X D;  1NYR A;  3IXS A;  4LLG M;  1UUP A;  3AE9 B;  1TS5 A;  1WSP A;  1VLB A;  1QOG A;  1WWT A;  3KWL A;  3BK2 A;  1BUI C;  3CIR B;  3MFG A;  1XXG A;  3BWU D;  1AW7 A;  1RFK A;  2N9K A;  3MJ5 A;  4JWS C;  2E6X A;  2IJ0 A;  5C2T B;  3B2G A;  2GB1 A;  2I38 A;  1PGB A;  3HUI A;  2GRI A;  2RMM A;  1KH0 A;  2DLB A;  3P4R B;  1XEE A;  1I4H A;  5E6J A;  2K0P A;  1GOZ A;  1WXQ A;  1MI0 A;  3E56 A;  2QSD A;  1ACC A;  1EU4 A;  1QLB B;  5H92 C;  1SJE D;  3AEC B;  3AE8 B;  4YTN B;  1ZP0 B;  3VQI A;  2M56 B;  4US9 A;  1I4Q A;  1ZXH A;  3V3X A;  1PUT A;  4JX1 C;  1FRD A;  2KMM A;  1XCT L;  4KGR A;  1I4R A;  2PLP A;  2LEK A;  3DWG C;  3EGR A;  1TYG B;  3W9C B;  4N59 A;  2KQ4 X;  1VJK A;  4GLS C;  2ONQ A;  2BT6 A;  2PVO D;  3I9V 1;  2INP E;  1YQ3 B;  3L4P A;  2FUG 1;  1SXT A;  2WXM A;  1SJH D;  1L4D B;  5EE1 A;  3W5V B;  2IGD A;  3HVZ A;  1ZE3 D;  2DBY A;  1FXA A;  4A90 A;  2PW9 A;  1RM6 C;  1BXT A;  4H2A A;  1A70 A;  1OFF A;  3PZ7 A;  1ROE A;  4TQ1 A;  5T8I A;  1NYQ A;  2AQ3 B;  4C7Z A;  1TY2 A;  4MM3 B;  2XN9 C;  4USA A;  1TS2 A;  1JWB D;  3AB5 A;  4NAW B;  1V1P A;  1HXY D;  1E7P B;  2D5G A;  3PZ8 A;  3TEX A;  4YTP B;  3EA6 A;  1CZP A;  1EWC A;  1HA5 A;  2V4I B;  5LNK 1;  1VZ8 A;  4OZB A;  1FNV A;  1TJE A;  2ON8 A;  2SAK A;  5TSS A;  4ZOH C;  2WDR B;  4OZA A;  2H89 B;  4L2Y A;  1XLN A;  4PT5 A;  5FK9 C;  1FO4 A;  4XDC A;  1DYQ A;  1J7B A;  2K5P A;  1EM7 A;  3ZJT A;  1C4C A;  4MT5 A;  2JYT A;  2J53 A;  5BYQ A;  2QJL A;  1QOF A;  4US8 A;  1L5P A;  4P16 A;  3NZ3 A;  2WXQ A;  1SIJ A;  2WXR A;  2YEP B;  1VDV A;  2VZK B;  2MJD A;  1JRP A;  1TY0 A;  2IGH A;  1JWU D;  2INN E;  2DWQ A;  1ENF A;  3KQ4 A;  4HJG E;  4HRO A;  3ZJU A;  1KTK A;  2OED A;  5FKA C;  3AEF B;  1NI3 A;  1ET9 A;  2HTM E;  2K22 A;  2N7J A;  3AE6 B;  4A8X C;  1MHX A;  4YWG G;  2PTL A;  1FNU A;  2EEL A;  2QIL A;  4WWM A;  1HEZ E;  2KWD A;  4OHJ A;  5EE9 A;  3CWI A;  2CU3 A;  3AEB B;  4ZHP A;  4LK0 M;  3ZQ4 A;  1TKE A;  4YXD B;  1OQR A;  3NVY A;  1NVI D;  3BK1 A;  4YTM B;  3GS2 A;  3U4E G;  1D4B A;  2PKO A;  4A6Q A;  4CQN A;  1C77 A;  3DWM A;  1XO3 A;  1P7E A;  1K53 A;  2Y5P A;  1TS3 A;  2V3P A;  4N6E B;  2Y3A A;  1N5W A;  1WYG A;  2FE8 A;  2BW2 A;  3U7Z A;  3WCQ A;  2N0S B;  2ACZ B;  3P1M A;  2AQ2 B;  2PIA A;  2DYO A;  1L0X B;  2WS3 B;  3HVD A;  2KDM A;  1TS4 A;  2JX5 A;  3URY A;  4DQO C;  3R2T A;  2K3U A;  2NTS A;  1KF6 B;  1T6B X;  4Q2J A;  5EE3 A;  1PDX A;  2RDH A;  1OQQ A;  3W5U B;  1PFD A;  2SEB D;  3RPF C;  3BZD B;  3OWE B;  2PMV A;  5JXV A;  1J7A A;  1Q10 A;  4RGO S;  2GI9 A;  1FNW A;  1IGD A;  1UGJ A;  1IGC A;  4HEA 1;  1YMH E;  5MPO A;  1N60 A;  3AE5 B;  2IGG A;  2WXK A;  3P42 A;  3TEW A;  1FMA D;  2WDQ B;  2W54 A;  3KLS X;  2X38 A;  2NTT A;  3V05 A;  1DOI A;  1K51 A;  1TKY A;  1YJJ A;  3AH7 A;  2MJE A;  2ZW1 A;  4RCO A;  1FXI A;  1E10 A;  4UDU C;  4RGN A;  5D7G A;  1L0Y B;  1WGK A;  1N61 A;  4TSS A;  2WXF A;  2K9X A;  4JPS A;  2RDG A;  3R8B A;  1N63 A;  4ZHO A;  4XWT A;  4A55 A;  3MC0 B;  3T3N A;  1FIQ A;  1L6U A;  3N9Y C;  4RFB A;  2BYT A;  1JWM D;  3W2D A;  3LYY A;  1JW9 D;  2VZK D;  1DGJ A;  2WU2 B;  4O1N A;  3J9C A;  2WXJ A;  4J3O D;  1ZOY B;  4RNA A;  2WXH A;  1EWY C;  1L4Z B;  1NEK B;  2MH7 A;  4RGT A;  3RFZ B;  1ESF A;  2LGI A;  4YSX B;  1DOX A;  2MEK A;  3NRZ A;  4GDL B;  2CJO A;  1SBB B;  3ETR A;  4JE3 B;  2Z8L A;  1ZDV A;  1SF0 A;  2BB6 A;  1ZXI A;  1V8C A;  1QKZ A;  5BMI A;  1L0V B;  4RF1 A;  1IBX B;  2BBC A;  1C76 A;  3Q8A A;  2CJN A;  3U2S C;  4B0E A;  2QIE B;  1N5X A;  1EU3 A;  4ZRQ A;  4WIP A;  4KGS A;  4XE0 A;  1L6V A;  2JZP A;  4EE2 A;  5HG2 A;  4ITK A;  3I57 A;  4OVZ A;  4AS1 A;  3E9S A;  3O13 A;  1CK1 A;  2WQY B;  2WLB A;  3IT4 B;  3TUO A;  1C79 A;  3AN1 A;  1IBX A;  1JQ4 A;  4AQ7 A;  1C4P A;  5G5H A;  1YNT E;  3VR8 B;  4KGT A;  1GPX A;  2JU6 X;  1YN5 A;  3NVV A;  1T3Q A;  1SB3 C;  1JRO A;  1C78 A;  3Q8B A;  3SR6 A;  3VRA B;  5GXG B;  2L52 A;  1J7C A;  4FXC A;  4RH6 A;  1KLU D;  2JSV X;  2QEJ C;  2W82 A;  4M0W A;  1SEB D;  1D5X C;  2LUM A;  2BS3 B;  1FCC C;  2WXI A;  2OHF A;  4YT0 B;  3W1S A;  2KAC A;  1F0Z A;  3ABV B;  5HHD G;  3GB1 A;  1C9F A;  4XWW A;  2JQR B;  1Y56 A;  3P4S B;  1MVK A;  2J52 A;  2WU5 B;  2W55 A;  1UWX A;  2ZW0 A;  1FCL A;  1QIL A;  1UNS A;  4N58 A;  1YQ4 B;  1R7S A;  3VRB B;  5BMH A;  2V0G A;  3T3O A;  2JYE A;  4KKJ A;  3Q69 A;  2FBW B;  2WNM A;  4NAM A;  3SFD B;  2JWU A;  3AE1 B;  4REZ A;  2DYM A;  2LJI A;  1DOY A;  5FR3 A;  2W3R A;  4WUR A;  4P6V F;  1FM0 D;  1JML A;  2L83 A;  2YEP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...