5G5GA

Escherichia coli periplasmic aldehyde oxidase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
175
Chain Sequence
PAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords PUTATIVE XANTHINE DEHYDROGENASE YAGT IRON-SULFUR-BINDING SUB
total genus 49
structure length 175
sequence length 175
ec nomenclature ec 1.2.99.6: Carboxylate reductase.
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 5g5gA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5g5gA01
4C7ZA 3ZYYX 4YTPB 1DOIA 4P6VF 1OFFA 5AUKA 3AE2B 1N62A 5GXGB 3HVZA 4YXDB 4C80A 2QIEB 2AX5A 1J7AA 4USAA 1WYGA 1JWBD 1RYJA 2DWQA 2EKIA 3AEDB 2WQYB 3RPFC 3P63A 2W3SA 1WRIA 3PO0A 2W54A 2WS3B 2WLBA 4ZOHC 3AE4B 5MPOA 1T3QA 3NRZA 2LEKA 1EWYC 1N5XA 3AMZA 3HRDD 3B9JA 2K5PA 4US9A 1FMAD 2WU2B 4YSZB 2G1EA 4YTMB 1F0ZA 4JWSC 2WP9B 1FRDA 4KX6B 2KMMA 3AEAB 2BS3B 2OHFA 3AEGB 5EE9A 1JQ4A 3NVVA 4YSXB 2CJOA 3AV8A 3B2FA 1DOXA 3NVZA 4JX1C 1V97A 4ZHOA 1JWAD 1YQ4B 4WQMA 1ROEA 2BS4B 1XLOA 2DBYA 3LXFA 1J7BA 3B2GA 4YSYB 1CJEA 1FO4A 1RFKA 1SB3C 3AECB 1KRHA 1NYQA 3P4QB 1FFUA 1FRRA 1N5WA 1XLPA 5H92C 1PFDA 2FBWB 4FXCA 1AYFA 4WWMA 1L6UA 1GAQB 1L6VA 1TJEA 1UWMA 2MJ3A 3W5VB 3AN1A 2PVOD 1NEKB 1QOGA 1N60A 1E6EB 1NI3A 1TYGB 2Q5WD 3AB5A 3L4PA 1ZUD2 4YTNB 3SFDB 1VLBA 3CWIA 1E0ZA 1B9RA 1JALA 4LTUA 1WXQA 1L0VB 1JW9D 1NVID 3AE8B 1QOFA 4N58A 1YJJA 1KFYB 1XO3A 1E9MA 2MJEA 4C7YA 2WDQB 2Y5CA 1DGJA 1PDXA 3AE7B 1FXIA 3AE1B 2N0SB 2MJDA 1ZOYB 2B76B 1TKEA 2W55A 1SF0A 2H88B 1ZXIA 1XLNA 5EE1A 5G5GA 3NVWA 2BS2B 2KAJA 3AM9A 3FAHA 1GPXA 3P1MA 1QOAA 1XLQA 1VJKA 1FIQA 3VRBB 3LB8C 2CJNA 1NYRA 1VDVA 3AEBB 3EUB2 5H8YE 1E10A 2PIAA 5EE3A 1JROA 3P4SB 3NVYA 1TKYA 3AH7A 3W9CB 3AE5B 5G5HA 5EE0A 4YT0B 1R7SA 3CIRB 2WDVB 1SIJA 1N61A 1OQQA 2BT6A 2MH7A 2QJLA 3BIID 3AE9B 5AUIA 1FFVA 1NENB 2CU3A 4HRSA 4US8A 3FC4A 1WWTA 1JRPA 1TKGA 2WDRB 3VRAB 2L52A 3W5UB 3P4RB 1I7HA 2E3TA 1QLBB 1V8CA 1DOYA 1AWDA 2M19A 1ZP0B 1J7CA 3AEEB 3KWLA 3WCQA 1YQ3B 1QOBA 3ABVB 3P4PB 1YJIA 1RWSA 2PVGC 3SFEB 4N6EB 2JQRB 2K22A 3VR9B 3NS1A 3VR8B 4IDIA 3ETRA 1L5PA 1QT9A 2H89B 2M56B 1RM6C 2WU5B 3SR6A 3DWMA 3AE6B 1FXAA 1KF6B 1OQRA 1E7PB 4ITKA 1PUTA 1FM0D 2K9XA 2PKOA 1N63A 2HTME 5C3JB 3AE3B 2JX5A 2L83A 1WGKA 1IUEA 3AEFB 4N59A 1CZPA 4JWUC 1QF6A 2W3RA 4HROA 4ZHPA 2ACZB 3HUIA 4A9AA 1A70A 5C2TB 3DWGC
chains in the Genus database with same CATH superfamily
4EBDA 1Z3EB 3UMCA 1J7AA 1WH3A 5L1MA 3ZNZB 4REZA 3PW5A 1TE2A 4G11A 4MT5A 2O6KA 2P6UA 4NV0A 1WGYA 1WIAA 3T9LA 1N5XA 1C3TA 3B9JA 2K5PA 4A3OA 3U52E 4BDPA 5D3DA 2Z8LA 1D9FA 1X9MA 4FBUA 3CRXA 4JB3A 4ELTA 3SHQA 1CI4A 5GTHU 2L0TA 3V6KA 3R2TA 5D46A 2PFQA 2RPVA 3B2FA 4JX1C 3VTWA 1DOXA 3QU7A 5ALHA 2LUEA 3JSVB 3MHZA 3SAHA 1XLOA 1ZJNA 2MBBB 2RQ5A 8ICPA 3B2GA 3VDZA 4MSMB 3GV8B 5J2KA 1IV8A 2NBVB 1K52A 4FS1A 3P4QB 3ICXA 1PFDA 2K89A 3ZJTA 1SE9A 1UWMA 4S0RA 2ZZPB 2K4PA 2K8CB 2AGPA 7ICRA 1DK3A 8ICEA 2KQSA 4W9CA 4NL9A 4YG2A 2KJ5A 4OJ6A 1HA5A 3BZDB 4QWEA 4ANVA 3ZKJC 5KG3A 4N58A 1Q1OA 5ALMA 4EENA 4UB1A 4K3BA 2EKEC 4RGTA 4KLLA 3PZ8A 2KFKA 1K53A 1M6YA 5KG0A 2RHFA 2NRZA 1ZXIA 3E0FA 1ZQEA 2FIFA 5KHQA 5LXHA 3HHMA 3AM9A 1DGSA 5FR3A 5DLGA 3A4RA 4QZGA 5B66U 4RQMA 2R61A 3T79A 3GILA 2KLGA 3NASA 4OZBA 4L23A 5DQIA 1COKA 4WWNA 2ZUBA 2BDUA 2K4HA 1HUOA 4I2GA 3MGVA 3WAOA 1ZQRA 1WXSA 1BPBA 3MBYA 1HQRD 3KUDB 4K1RB 1WY8A 4ED3A 5KL8B 2KO3A 2W8KA 1VR9A 4GC6A 3NTUA 1IG6A 1I35A 1I4GA 2XK5B 3QQ8B 3P42A 4GGQA 2MUTB 2R2OA 1KLVA 8ICHA 1SBBB 4P2HA 3TFSA 3SFEB 3QZ7A 1UUPA 2AEHA 2H3ZA 2D3AA 4FA6A 1T5XD 4DBGA 4F4ZA 4G0NB 4AJYB 1ZDXA 4NJ6A 2ZVNA 3Q8QB 2KVCA 2Y1IA 3DEEA 2N7EA 5KFZA 3GDXA 1ZXHA 2JRIB 3T5JA 2ZPYA 4Q2JA 3PR5B 2H3FA 3N4MB 2F3NA 4MDKE 3BY4B 3UINB 1PQSA 3RAQA 4PT5A 1XC9A 1NK5A 2ZJ8A 2QIEB 5DG8A 3H0LB 4OZCA 5DDMA 1DYQA 4EBCA 2YMMA 3PLUA 3BQ7A 1UGMA 1WGHA 3NS8A 3UF8A 2VRRB 3M9MB 1TT5B 1UH6A 4CO7A 4I2AA 1FNUA 3PW0A 2HDEA 3PO5A 3SD7A 1BPYA 2OHFA 1ET9A 1WZ3A 2NCNA 4WJPA 5AM1A 2XY5A 1KTQA 4LVSA 2BVCA 1Y88A 5TSSA 1ROEA 2NYVA 3PT2B 4FS2A 1ZQLA 4ECWA 4F5QA 3ZXVA 1Q8KA 4OZAA 3GIIA 4W9EA 2KDMA 1AYFA 3UQAA 3EFCA 1YQBA 3O65B 2KKPA 4IR1A 4Y2UA 3RJFA 5DCNA 1F9JA 4AWJA 4GN1A 2LHEA 2G0AA 3ALRA 3NHEB 2WXKA 1MFWA 4I29A 4YTNB 1F1HA 3V61A 3CWIA 3WK8A 3CP8A 1CUKA 3M9OB 1WXQA 4IWPA 3X0WA 3JPQA 2DGZA 3OPXA 4DOAA 2BCVA 2DPJA 1L3UA 2C22A 3V6EB 3RNGC 1K5OA 2MA9B 3AE7B 5D6JB 2G3QB 2IO1B 2B76B 3F2DA 2YEPB 2R8IA 4ED7A 1SGHA 2LWPA 4YR2A 3QUBA 5KFIA 4XRHA 3BWUD 2LYHA 4ECQA 2OOBB 5AKJA 1C78A 2KE7A 2PJHA 1BPXA 1QH9A 3QYPA 1L7OA 3UIPB 5J29A 8ICZA 1UA1A 1WX7A 3Q8FA 4DFMA 1TK0A 5G5HA 7ICUA 1LXDA 2D07B 1XWLA 3LYSA 4CF3A 4BXOB 2N9PC 3CIRB 3OJ4B 4ANUA 3TBLD 1EF5A 2WXOA 3W5UB 7ICKA 4FJYA 3LJ3A 4X5VA 2C5LC 5J0YA 4KX3A 2NRTA 3ONNA 4YD2A 3UXPA 1Z00A 2M19A 1A0PA 3V6CB 1T94A 2AWTA 1VRAB 4MGZE 4JV2A 3TMPB 3VR8B 1L2NA 4ED1A 2N9LA 2KTQA 3PS6A 3HWTA 4TV3A 4XGAB 2YY6A 3T8MA 5KFQA 2LJIA 2WXPA 1NK8A 3H8HA 4DL5A 2FCQA 8ICQA 1STEA 3QU2A 2ZNVB 3PREA 2BQQA 5ALIA 1TY2A 4PHDA 3MFIA 2K8AA 2OEHA 2LPEA 3TUOA 3CNHA 4PL2A 5KG5A 1SL2A 2WXJA 5GXGB 4YQWA 2O6VA 3RCZA 5HMLA 2F2AB 4DLGA 5DPRA 4LDTD 1B1ZA 3A9JB 2JR5A 2KMAA 3R7RA 4QWBA 1R4NB 4TKNA 3MR3A 4Q44A 2WS3B 4GDKA 4O3OA 4KKJA 4AOFA 5BOMA 4RQ0A 1LKYB 4PS7A 3HRDD 8ICBA 3OSNA 3ZNGC 1MN8A 2KTRB 4LCDE 3C1ZA 2KMMA 3PSIA 3GU3A 4EE2A 1JQ4A 1T7PA 1T6BX 1SJHD 1Q0WB 4QW8A 4ANXA 2XEWA 3V7JA 1UBIA 2ZEQA 1WCNA 5J2EA 3IG3A 4M9GA 5IILA 2I6XA 4YSYB 9ICOA 7ICOA 1FO4A 2BHNA 1SB3C 4UAZA 3RTVA 1CJEA 1KRHA 1RFKA 4TQSA 5AKXA 1NKEA 2O2VA 4PYUA 3UGBB 4YN4A 3JPSA 3KZIU 1D8BA 2K0PA 7ICQA 1HZ6A 3IT4B 3AQEA 2M4NA 4IRDA 2JZBB 4Y2XA 4ECRA 3ZTCA 5DB9A 1VLBA 1TZOA 4MFFA 1MI0A 2PE6B 4LTUA 3T3FA 1L0VB 4ELVA 2KP7A 3NZUA 1KFYB 3LYYA 4QZCA 3ZDMC 5KFNA 1PDXA 4DWFA 3HJEA 4R66A 2MP2A 3GIMA 4E0DA 4FE3A 2W9MA 1N2XA 2FDRA 1KM7A 2BS2B 4P7IA 2J0KA 2FNJB 3ZNHB 1ZYQA 2KFKB 1VJKA 3M8SA 3A1QA 4J9RA 4XUSA 1U4BA 5L1IA 2EANA 2ONQA 3JPNA 3SEIA 5H8YE 2DZJA 5C1ZA 2LM4A 2Z0EB 2BCRA 3GIJA 4ICAA 1KLUD 5AEKB 1M4VA 1BVSA 2YLMA 2K25A 4EX6A 4UDUC 2NMQA 3EA6A 4MGYE 3PSPA 4ZRIA 5KFAA 3ZGZA 4RNOA 2V3NA 2WB1F 1WYWB 5D3IB 1FEHA 1WMHB 3IT6B 4PZNA 3PVXA 3WK9A 2PW9A 1EO6A 3N3KB 1YJIA 4RFBA 4NQLB 3ETLA 5BYQA 3T5KA 2YB1A 2V4IB 3T3OA 1P3QU 1T0SC 3QARA 4O3SA 3RH5A 3SR6A 3L54A 2K4EA 2GBKA 1XS9D 5IN7A 3NUHB 2BPCA 2K9XA 4HYKA 2HTME 5IIIA 2J52A 3N20C 4KGSA 5C3JB 4MHVA 2XC9A 3RH4A 3QXGA 4DF8A 3B0XA 2R8JA 3QU9A 3UI3A 4M04A 3DWGC 3ZYYX 4FJVB 2W8LA 2ZTDA 1U47A 2ZIUB 2JPHA 4Y2RA 2ZIVA 3SI8A 2BQRA 4AQ7A 1KFDA 2FUG1 4IR9A 1P98A 2JEIA 2JU6X 2HHSA 5KAFU 1JCKB 5DQGA 1E7VA 1F2RI 1WM2A 4F5NA 4Q43A 1WUDA 5EE9A 3AEAB 4W9DA 3U7ZA 5KFHA 3AI5A 4O5CA 2N9XA 1QKZA 1ZKHA 1Y8RC 3TARA 5DLFA 5HR7A 2YB4A 1J7BA 1FNWA 3KLSX 3LXFA 3I3TB 1QQ5A 4DL7A 4ZRKA 4F72A 3Q8SB 5AZFA 3TIXA 2Y0SC 5DB8A 4YMNA 4CF5A 1LB2B 2G06A 2HHVA 1KL9A 1L6VA 5KT4A 2HOFA 2PVOD 4HJGE 4J9QA 1XQQA 2Q5WD 1DOQA 4FZMA 1LV5A 4RUAA 2RPQA 1QQ7A 3KZXA 1U49A 1ZUD2 2ZIUA 5AM3A 3RNAC 3RUIB 4X57B 3CF6E 1B9RA 2XI9A 5KFFA 1MVKA 4RPZA 4O9MA 4ECVA 1S77D 5L1JA 4J9OA 4NAWB 5J2BA 5AM0A 4ACFA 3RZWC 4NXZA 1ZQBA 1TAUA 2MJEA 4C7YA 2H5XA 2XK5A 4XWWA 3NG0A 3IVFA 3EC8A 4AP4C 9ICLA 4OVVA 3GZFA 2GBRA 3I1YA 4RQ4A 3L13A 5G5GA 4MF8A 3A9KA 5KFOA 1LGRA 3P1MA 2Y1JA 7ICVA 2ZTCA 1FIQA 1WX8A 3M7DA 8ICGA 4BZAA 3AH7A 3E56A 2KG5A 1I4HA 2SEBD 5EE0A 3SAFA 3IRUA 1JXLA 1SXTA 4TQRA 1ZD4A 3EPIA 2GI9A 2WWZA 1M94A 1V5TA 2G45B 2HBJA 2J0MA 4PL1A 3RRGA 1ZQMA 2LMRA 4YR3A 2MBOA 4IQTA 5IIKA 4DFJA 5F9LA 5EWEA 1RWSA 2HJ1A 2K1FA 4QWAA 4DQQA 3PZPA 4GOCA 4IDIA 2O2VB 5IKCM 4RCOA 3ZJVA 3DQVA 1P7DA 1TY0A 5GMVA 5HMMA 2JHDA 2L00B 1KN5A 2G09A 3VCBA 4ANWA 3N7RC 2W9NA 2DL0A 3QZ8A 1N63A 3QX1A 3IBEA 4FULA 2VKQA 3H0RB 1FNVA 2K39A 4KTQA 1NK7A 2VH2A 4EZKA 1YZ6A 1ZQKA 3AU4A 3F53A 5LLIA 2WXGA 2LXAA 5HFYA 3F5AA 3HVZA 4NQKE 4DS5A 5AM5A 7ICJA 1WYGA 3CW2C 1LO5D 2C2DA 1K1QA 3N32A 4JMUA 5AI8A 3TEYA 4DLEA 2O6VB 1FMAD 4URKA 3KHLA 3TQ1A 2K60A 1CK1A 1BPZA 4NM1A 3PPAA 5ALLA 4P4MA 1VCBA 2RDBC 2FJ6A 4KLHA 3VTUA 2VIXA 2ZW0A 3K75D 3QUQA 3G6YA 1SV4A 1VZ8A 4ZRJA 2WGSA 1JWAD 3Q3MC 4QAYA 4KKIA 3C8YA 3TEZA 3PVLA 1UNSA 3HM6X 4BGDA 2GLSA 4M9JA 4WH4A 2RD0A 5LXIB 2MAXA 5ALPA 3Q8LA 1SKRA 1KJTA 4H2AA 3KFUF 5CRXA 9ICPA 2QARB 2N4FA 3IFWB 2V3SA 4KITB 1T4GA 2W03A 2IMWP 2ZG6A 1TYGB 3C19A 4UB8U 4Z6EA 3MDAA 2FLLA 4O1NA 4WQOB 2D11A 3V62A 4M6WB 1RYUA 5IIMA 1X9WA 2FPKA 2KDFB 3ML9A 3C2LA 1NVID 3AE8B 4RGMA 5DG7A 3VQIA 4UB2A 2A5UA 4N9F4 1NJZA 2MJDA 3AULA 3KVFB 1X40A 2WTFA 4IQUA 2KZZA 1C1YB 2ASLA 2H88B 2E8OA 1WG8A 2F1HA 4PZOA 4JLCA 3OLMD 2PMVA 3NVWA 5CA7A 4F3OA 1ZQAA 3WK5A 5KG7A 1WXAA 5JHBA 1L3SA 3ZDCA 1KQQA 3RYTA 5L1LA 1V85A 4GLXA 5CJ7A 3PY8A 2PIAA 4HVBA 3IHQB 5HI1A 5AIAA 3PW4A 2GO7A 2KKVA 3PSFA 2KJRA 4PYZA 2HDOA 3RFZB 4KX5A 3NZ3A 4C4VB 4F50A 7ICEA 1BXTA 3C28A 8ICSA 4NZLB 1WWTA 1MPEA 4B9UA 2KC2A 4IWQA 4KZ0A 4DQPA 3Q69A 3HW8A 7ICHA 4BOZB 1QZEA 1ZP0B 4F4WA 3IG5A 1UCVA 1J0GA 2IGHA 1JMLA 1QOBA 5K4LA 3GIKA 1EUVB 4B9LA 1K1SA 2REXA 1A76A 2G9HD 1VD2A 4HCPB 2ON8A 9ICXA 1QT9A 2JZZA 5E79U 1X6IA 2MRLA 4B9SA 7ICPA 4AP9A 2RLTA 2ZJAA 2LI5A 1XD3B 3DVNV 2KVZA 3MC9A 5FR6A 1OQRA 4DFKA 2RGFA 4EZJA 5JZEB 3QA8A 3DBRI 2JX5A 4B9MA 3WKDA 2NRVA 4R64A 3OJUA 3ZXRA 4OHJA 4F5OA 3V72A 2BZFA 1C4PA 1LM8B 4A9AA 4FADA 4BAXA 3TADC 4DSIA 2TSSA 1PYWD 4EEKA 2VJ4A 1TS3A 2EKIA 2PE9A 4MM3B 2NVUI 1ISNA 2WF5A 1OQYA 3UQ0A 5ALQA 4M9LA 3I63C 1S0OA 1UGJA 5MPOA 4HLEA 1PUZA 1GB4A 5H2FU 2OCEA 1X42A 4US9A 2JEFA 3U8ZA 1KSPA 1F0ZA 5ALUA 5KT5A 3RZFA 1YN3A 1C9FA 3GZNI 3ZQ4A 1D8LA 1X2IA 1K50A 2C7NB 4YWGG 4UAVA 1WR6E 1CRXA 3AEGB 5KFKA 1V9PA 2WDTB 4RF0A 5IAAC 2CJOA 3VH4B 3VVWB 2ASQA 3NUQA 2WX0A 2JMGA 2HBKA 2BQUA 2HHXA 5D7GA 3EW9A 1UBQA 2KYWA 2ALZA 1BUIC 2UU7A 3JPPA 4O3RA 1GOZA 5CHWA 4I2IA 2EELA 4JIOU 4KDIC 2V0GA 1XLPA 3MC1A 3EHVA 5BMGA 1L6UA 5EDSA 2DQNB 4BVUC 3AN1A 2RDIA 2KACA 5LNK1 5IP4D 9ICMA 1S0VA 4IOIE 1ED1A 3RNFC 1FEZA 4DL2A 2QB0B 5HG2A 1WE7A 2XBBC 2HSZA 3CSTA 3RH6A 3KWVA 2JRHA 1XO3A 3DBSA 3ONSA 2WXIA 2ISPA 2KJ9A 4TQ1A 1E8ZA 2HTHA 4QIWF 4ECYA 3RBEA 4M2YA 1PVRA 4F92B 3OJSA 4W9IA 9ICAA 1P7FA 2J53A 2JXJA 5EE1A 4DHZE 2XGQA 4I2CA 1BGXT 5ALJA 4I2DA 1F44A 2J42A 4KMUA 3V6HA 3O13A 3ZIMA 1JIHA 3ZDEA 2R18A 3VRBB 4J9PA 4HPLB 2GOWA 1VDVA 2KFJA 3C21A 1QLNA 2DZMA 1MG4A 5J2DA 3BVMA 2KJ6A 4K4HA 1WRDB 3JVZX 1E10A 3OHAA 3G6VA 1UD7A 4GXKA 1SL0A 3U4EG 1TZ1A 3V6JA 4BFRA 4DEZA 2E8NA 1ZOLA 5AI5A 5DG9A 3Q8RB 1JRPA 4F93B 2P66A 4QZ8A 2PMZF 3VRAB 2JZBA 3AEEB 3K1RB 2CR5A 1C79A 1B0XA 2IHMA 4MSQB 2AGQA 3GB1A 3THVA 4QZAA 1MG8A 3KHHA 2DNFA 3WA0A 4GXIA 1VZ7A 3BINA 3J81j 2OYYA 3VTVA 4BWMA 3N1XC 3PZ7A 2YVCA 4FZLA 4JWNA 5JRTA 2N1RA 4F4YA 4ZHPA 2HCFA 4FHJA 1VJ5A 4YP3A 5KNIA 8ICOA 5FK9C 1OTRB 4WJOA 1OFFA 3ZDAA 4YXDB 2G08A 7ICSA 4JUZA 3D32A 1GUAB 3RNBC 2WQYB 4RPXA 1WRIA 2DX5B 2K8CA 3S6JA 4MELA 1WGDA 4NLNA 3UMBA 3VUYA 2KT7A 4I2EA 2LBOA 4LJXA 4IM2A 2V1YA 4JWSC 3E2EA 4NWIA 4IUMB 2MUTA 1C20A 1QSYA 2NO5A 1XF5L 5HHIA 4DF4A 2EH9A 4PH5A 2A19A 3AV8A 2RMMA 3A33B 2Z59B 4ZHOA 1YQ4B 1I4QA 1XSLA 1ZQNA 1UT8A 3ZO5B 4M8MA 4TUPA 1NYQA 3CMMB 5DPWA 4LJPB 4HDQA 2K6DB 5HKHA 2KDBA 5AK5A 1JWSD 3W5VB 2MSNA 4UATA 2EMTA 3R3MA 3WKAA 1NZBA 5J0QA 2AXTU 1NK4A 4W9LA 2WHIA 1D5XC 2F1IA 1YJJA 1F2RC 3TCAA 2R2QA 2Y5PA 3GV7B 2GWSA 3ZTDA 4WURA 2KVRA 3PW2A 2O6VD 4YL8A 1BNOA 3MR6A 8ICVA 1FXIA 4MGKE 2JV3A 4IQVA 4Z6DA 5C5JA 1UA0A 3URYA 1A77A 4M00A 2C2RA 1V2YA 3OAWA 4HKQA 4F1SA 3PNCA 5F9NA 2MCNB 3QAQA 2AQ0A 1VZ6A 4GIBA 4ZRQA 2K8BB 3MABA 3LB8C 4RNNA 1KOTA 2C2EA 2LKYA 4DSFA 3DDHA 4I2FA 1LKYA 5D2MB 1JROA 4PS3A 1TKYA 2BKRB 2CHZA 2J7QB 4KGRA 3NJTA 1V86A 3Q8BA 2PFOA 4MEMA 3VH3B 4P1CC 4M47A 2HVIA 1ZD2P 2HW3A 3BDPA 4F4XA 1MA7A 2OEDA 4ICVA 2W9BA 2H3IA 4RT2A 3HT3A 1AWDA 4AJWA 2B21A 2KIVA 2ZIWB 5KG1A 1SXDA 3ML8A 3P4PB 2L5YA 9ICKA 1L5PA 4B95A 4JL9A 1E8YA 1YT3A 3IG8A 2R8HA 1X9SA 4NAMA 3N9YC 4EZ9A 3ZRCA 4CE6A 3TFRA 2WXMA 1WGKA 3QUTA 1K51A 4RQ2A 1Y56A 2HJ8A 2W3RA 1QF6A 4WAAA 2KN4A 3C2KA 5C2TB 1WM3A 1HJPA 1C76A 2D8CA 4AYBC 1DOIA 1PZNA 2K4IA 1I4RA 2QMTA 2KHQA 3AEDB 1EM7A 2XCAA 5BYSA 2JT4B 4M9HA 3H4BA 2W54A 3M6KA 2DZIA 2LYAA 1URJA 4P0PB 3AE4B 1T3QA 3AU5A 1H4RA 8ICJA 1Q3VA 3N1ZC 4KX6B 1Z00B 4Z6FA 3IP4B 1RLFA 3R66C 3KUZA 2ESEA 1OEYJ 4K3CA 2MQJA 4NY0A 2KIWA 2OH2A 9ICTA 3SDLC 1XNSA 4BWJA 1SXEA 4KLFA 1P1AA 4QWCA 2HOIA 1A5RA 2LYBA 2BDPA 2GB1A 3MGIA 1NI2A 4C4SA 1GNUA 2KLCA 3LDZE 1ECWA 5T8IA 2XVTA 2G07A 4FXCA 5KFYA 3TEXA 4EEYA 8ICUA 3IAM1 5J0XA 1ZD3A 4P0PA 1WGGA 1HXYD 2ZIXB 2KOXA 5AK3A 1E6EB 3RJGA 3MTNB 3H4DA 4A6QA 2E6XA 4UAYA 3L3FX 4BXOA 5J8YC 1KFSA 2CU1A 2N7JA 4XC2A 5ALFA 5CTRC 4FFDA 5ALZA 5J2CA 3ZDDA 4EBEA 2KK8A 4E3CA 3RN9C 4IG7B 5CWRA 3R2IA 2LGIA 2QCZA 2VANA 1E9MA 2KQ7A 3C5FA 4IS7A 2D10A 4B9VA 1WXMA 5KT3A 1D5MC 2MBQA 1OGWA 4XDCA 5AZGA 1XLNA 1C4CA 4JE3B 2KQ4X 3Q3OC 2XICA 2J6UA 4ECSA 1HIWA 3AL0B 5BYRA 3FYHA 3K4GA 4UW9A 5B5EU 1WWUA 4BBNF 2NPTB 4B0MA 1KFTA 2MEKA 4DQRA 3L16A 1KLNA 2PLPA 2W9BB 1U48A 2MBEA 2UVVA 1RXWA 3APFA 3PV8A 1R7SA 4UBBA 2MH7A 2SAKA 3AE9B 4LNFA 4RQ7A 2LASA 2L52A 2HHUA 3P4RB 2Z7JA 4CDGA 5AICA 5CHVC 1H8CA 1TS5A 2JH1A 1CQVA 2DF4B 4RQ5A 3UPQA 2WF6A 4F5RA 2PI4A 4DSLA 2QDFA 3TADA 1J2MA 5BOLA 1R4MI 4HPPA 3W1YA 2V4QA 1AROP 1ZW7A 2IO2B 1V1OA 2M56B 3QIJA 4W9JA 4DDID 1NJWA 3DWMA 2AQ2B 2IOFK 4AYBF 1YN5A 2JYEA 4P4PA 3AU2A 2W7OA 1N48A 3ISBA 4B9KA 4Y2TA 5EWFA 3PMLA 2BR0A 3AE3B 4B6JA 1TS2A 1ZQZA 2DKXA 4GMVA 5EWGA 2E5SA 2XO7A 3MGHA 4HPMB 2NR2A 2INDC 4C7ZA 2CXYA 1X1MA 2OWOA 4I6NB 4Q8EA 3AXCA 3DCGA 4IM0A 3IN5A 1BT0A 4ZYSA 2YN4A 4FZNA 2GOLA 1QSSA 3C2MA 4II2B 1L0XB 5J0RA 4IQWA 4A90A 1ESFA 4B0EA 1WI0A 5J18A 5FP0A 1ZQGA 2KZMA 2CS4A 1JXEA 4IKGA 2I2YA 2YMQA 4K7SA 8ICIA 3H7SA 4EUTA 4UASA 5DBAA 4XZ4A 4BOSC 3PHWB 1ENFA 1WMHA 3ZW3A 2PPHA 4HK2A 4DS4A 3ENEA 4Y2JA 3AU6A 4EELA 5ALOA 1FXTB 4IC9A 4J9LA 1FD6A 2KN7A 2HOQA 3H1UA 5CR0A 4F5PA 2IBIB 2VH1A 2VA2A 1ZDVA 4O3QA 4KLUA 3QWZB 4FLHA 3ZD9A 3A1QB 5J0UA 2KMCA 2MJ3A 2RP5A 4W9FA 1NI3A 1RZTA 4K4IA 2G4SA 3GV5B 2XY7A 1Q46A 2C9WB 3ALBA 1JALA 4DQSA 4K7WA 4PPXA 4O5EA 4DHJB 1XCTL 4NNJB 2PXIA 4Y2YA 2WF8A 3GZNB 4RNAA 1ZD5A 1L5UA 2VZKB 3AE1B 4ECUA 3AQFA 4I2HA 1ZOYB 1TKEA 2ISOA 1HEZE 1PK1B 5ALYA 3H8MA 2F1JA 5AKKA 2EZXA 3WK6A 2EAMA 4RQ8A 8ICWA 1GG3A 2JXTA 1D5ZC 3Q8AA 4NPNA 2DZKA 5IIOA 1ZQWA 2E8MA 3BS7A 1KBUA 3EUB2 5L95C 3KHRA 5IOIA 3RR7A 3H6NA 3TKAA 3JPTA 5EE3A 2LFIA 2M8SA 3E9SA 5BPCA 7ICMA 4YT0B 1OQQA 3BIID 2NRXA 4CGZA 2QJLA 4LDTB 3C29A 2INNE 3V7LA 5AKLA 2ASDA 4OJPA 4R65A 2CRXA 1QSLA 4NY8A 5KG6A 3C5GA 1L7YA 2E3TA 2ZIVB 9ICCA 3AUOA 5J2AA 3TAQA 4B9NA 2EMSA 1YQ3B 5J0TA 2B3AA 3DDCB 3WCQA 5AKEA 5HNKA 3OHBA 2UVWA 1TIFA 2KXJA 4RQNA 3KUCB 3QE9Y 2K22A 3E58A 3NS1A 4KIKB 3NZSA 1OEYA 3PMNA 2WU5B 3MP9A 2P35A 3VC8A 3JW0X 4M8NA 4WWOA 2FLNA 2IYDB 3EYZA 3T3NA 2ZJ5A 5TISU 4QJFB 1JRUA 4L2YA 3VFKA 8ICMA 3M8RA 1QTMA 3Q14C 1SWVA 3EWAA 2F76X 2KK0A 2LJ5A 1NKBA 3B0AA 3MJ5A 9ICJA 4TURA 2KTFA 4RPYA 3RR8A 2KNJA 3M62B 3BS5A 1V9JA 2Y0SF 3PO0A 3FKYA 1U4AA 4ZOHC 3U2SC 4NJ8A 1TVAA 1YX5B 1NDDA 2BCQA 2W9CA 2F77X 4QWDA 1L3VA 3RJIA 4QZEA 2FIDA 1FRDA 1JWMD 2RDHA 3HKZF 2BS3B 4YSXB 4TSSA 4NJCA 1SL1A 9ICQA 5ALDA 1XEEA 1J2NA 2WXRA 5D4BA 2BKFA 2BTEA 2KWVB 2XN9C 2B0CA 3B08A 1TS4A 2RDJA 2J6SA 2LXCA 4LZDA 4CCHA 2FBWB 3Q8MA 1GAQB 1RDFA 1WX9A 3MFGA 3D2QA 3NY5A 4OJ5A 2KWCA 1N60A 4QIWC 8ICRA 4P0QA 4RZRA 4DXGA 2ZUDA 4U6PA 3Q8EA 3SU8X 3SFDB 1J19A 3BZCA 4U7CA 4KVGB 1XO0A 2N1WA 4DFDA 1TTNA 1IGCA 1IM4A 8ICYA 2BW2A 2D3BA 5BMHA 4EX7A 2MHJA 5AHXA 5J8YA 1JWUD 1QQRA 2C60A 3N30A 3OWEB 2DUYA 3DBHI 1I4XA 2ASJA 3ISCA 5DQHA 3H8JA 2KWDA 2NS5A 5KFXA 1EU4A 4C8NA 1V81A 4WWPA 4BX9C 2BYEA 4LJOB 4ZYNA 2LRWA 2FCSA 2LGDA 4MACA 2KHVA 1SE3A 4GFJA 2IJ0A 5TR5A 4HJKA 1SV0A 4KN7A 1DK2A 4A20A 1AW7A 3BJYA 1YD8U 2CJNA 3RAXA 4LNKA 2WNMA 3RBDA 2DAFA 1OW5A 2Y9TA 2KEYA 4YXMA 3P4SB 3A9JA 4KLGA 1P7EA 2F44A 4AS1A 4OVUA 4A55A 2A1AA 1D9DA 3WALA 1SIJA 3H0MB 1HZ5A 2BT6A 2GH1A 5KFDA 3FM9A 2BGWA 1NENB 2BGFA 1GB1A 1NK0A 2QB1A 4EEWA 5KL1B 2DHZA 1S76D 2WF7A 4I6PA 3L17A 4K7UA 3IXSA 4HXDA 3M95A 3N1YC 5DGBA 4ECZA 3QU5A 1N56A 3NGDA 3V7KA 4XDDA 4ARIA 2WHEA 2WXFA 3RB3A 4C8MA 4RGNA 5ALNA 3H7IA 2JSVX 4R3DA 4BKTA 2J6TA 4YFKA 2WAQF 1TKDA 4DSKA 1ZQYA 2BKEA 4C0ZA 2JVCA 4OO1J 2N7DA 5FKAC 1IGDA 2EAPA 2ZXIA 1GC7A 2AQ1B 2NO4A 2KTRA 2M9NA 2ZTEA 3WANA 2FE9A 5AIBA 3SENA 3BQ1A 4XQ8A 4C80A 4J9KA 2DWQA 1RYJA 1JWBD 4RGOS 3RNEC 1L7MA 4KLEA 2K3UA 5DPSA 1WGRA 1DRGA 8ICFA 2LEKA 5GTIU 1EWYC 5IO9A 2LMCA 8ICAA 4ASWC 2G1EA 3DVNU 2VJ5A 1HE8A 3QJZA 2C28A 9ICUA 3KTQA 2N9EB 3NVVA 2YMLA 4IW0A 3GOEA 3ORYA 2WXQA 1E8WA 1YZ7A 3APDA 2AGOA 5ALGA 2BS4B 4C00A 4GDKB 1Z1BA 3VUXA 3F2BA 4LLGM 3KKAA 3T5HA 4HKZE 5KFVA 4GIVA 3AECB 2DYBA 1QCKA 4QZDA 4B9TA 4OVZA 5E6PA 4WWMA 2KSOB 4ELUA 4KDLB 5AI6A 1RYRA 3RF9A 2IGGA 1NEKB 3I5JC 3N28A 3ECIA 4KLSA 2BPFA 1AQ6A 2WXLA 4LNOA 1Z4OA 3Q8CA 4YR0A 2BCUA 3JYUA 1Z1VA 2HHTA 4Y2SA 4MEYA 4MGIE 5ALWA 2KX3A 1V5OA 2F8LA 2L32A 4GXBA 4KLIA 4O3PA 2C7MB 2KX0A 3SV3A 4CYEA 2MRPA 4FO6A 1IXRA 4GU2A 2ES6A 5IIJA 4JPSA 1HTOA 2QKQA 4AUQC 2BB6A 3A9KB 3RFAA 1EXNA 3FAHA 3QNMA 1FCCC 2GBNA 2KSOA 1ZQTA 2MLBA 3KOOA 5JH5C 4KLJA 2K8HA 5DBCA 1J97A 1V38A 2YMPA 5AM4A 2AU0A 2ZJDA 1TGZB 2E1FA 2BWFA 2JYTA 3OTQA 5KFCA 2N1VA 3H8WA 1EU3A 4QZHA 2CU3A 2LZ6A 2LGSA 5G2NA 3W1SA 3D6JA 5JTIA 1TKGA 2VA3A 3DBLI 4ED6A 1S10A 3TANA 4OJLA 5KFRA 1MJDA 4R8UB 3L0WB 2I38A 2N9KA 4I2JA 2W82A 4KSKC 1ACCA 4BKSA 1JI7A 1B43A 1RG6A 2H89B 3Q3FA 1RM6C 2LVQA 3VHTC 3TL5A 2MA1A 3IM1A 5J0PA 1WSPA 2ZNVC 1IPGA 5E6JA 2BYFA 2D5GA 4KIKA 3BQ0A 1IIPA 1ZRNA 4CF4A 4GB9A 4PHAA 1X9XA 4TQ0A 2L83A 4C4RA 1IUEA 3AEFB 2V9WA 4PHPA 4RUCA 3ZI4A 4UB5A 3W2DA 1ZQUA 5E6OA 2NBWB 3MR2A 1CEZA 1D6EC 3BVZA 4EZLA 4P6VF 5AUKA 1N62A 1ZQQA 2IOHA 5JU5A 4XWTA 1L0YB 2ICIA 2IY0B 2LD9A 2Q4TA 4RM8A 3I28A 4MH0E 2BPGA 1PGBA 4FN2A 3QCAA 3LVWA 2WXNA 4XYCA 4G50A 4YD1A 2LHDA 4KV2A 2GBMA 3MHSD 1UF0A 2IO3B 1E7UA 2DKZA 5KFSA 4KLQA 4ED0A 1B22A 1V97A 9ICHA 4G3IA 5ALRA 4GLSC 2JH7A 1SV0C 4M02A 2WYQA 4DL6A 4MJSB 2EQYA 2FMSA 3O0FA 4DOBA 1Q5WB 1L7PA 2M17A 3B0YA 3GFKB 1XO1A 3PTFC 1HEKA 3WU2U 1L4DB 2D3DA 1SKSA 5C23A 4F8RA 1YMHE 2QSDA 4GSWA 2OM6A 4BJQA 1I4PA 4F7ZA 4I28A 1BNPA 1SE4A 1I42A 4JQWC 2F8KA 1QOFA 4F2RA 3N7SC 3Q8PB 2VA8A 2DAJA 4KLTA 2Y5CA 1SZHA 5A0LA 2OJWA 1TBEA 2PMZC 2FCMA 4DDGD 1LQBA 3N97B 1UPHA 4KLOA 3I9V1 3PRMB 3LVVA 2L8JA 2UWQA 2QLTA 5AI9A 1O03A 2KAJA 4EFOA 2LHTA 2YTUA 1WJ6A 3G6XA 1QOAA 5D49A 4S17A 2E1EA 1ZQSA 5CHFA 3U30A 1QILA 4P4OA 3UQBA 1NYRA 3AEBB 4ED8A 1P0RA 4NAWA 3PHXB 4MJSA 2ODGA 2XCPA 3KD3A 5D94A 4XE0A 3AE5B 1MQ3A 1KTKA 3PX0A 1SKWA 1AN8A 1N61A 2WF9A 4HRSA 4DO9A 4J9MA 5ALKA 5AKZA 1T0YA 4US8A 1AARA 2RR9A 2K8BA 1RXVA 4PK1A 4NLKA 2BF8B 2I1KA 4HAIA 3LK9A 1Q10A 4HCNB 3F5EA 1J7CA 3C0RB 2AHOB 1L7NA 5J0WA 2Y3AA 4A3PA 1RRBA 2W9CB 3VR9B 1GC6A 4OJOA 1BMLC 3BK2A 1UWXA 3WKBA 1PK3A 4DSEA 5KFJA 7ICIA 3AE6B 2KZRA 3RT3B 4K81A 2JEGA 2DFLA 1X6JA 1PK1A 9ICVA 1E7PB 4IM3A 2XIDA 2PKOA 1OUQA 2D3CA 2QARA 2JGAA 1U9LA 2L0FA 4JWUC 2ZIWA 5KFPA 4ECTA 2L1AA 4PJ0U 1D3ZA 1YOVB 1Z2MA 3I76A 4B6WA 2W04A 1XCQL 3TSSA 5CEHA 3A0HU 5DKWA 1PVQA 3AE2B 4J9NA 2QC8A 3TAPA 3HP6A 1S0MA 4JV0A 9ICGA 3KBBA 5CP2A 1ZE3D 3P63A 4QZ9A 3PR4A 4KZCA 1ZQIA 4C8LA 2JZ3B 1S97A 2BQ3A 3DPDA 3FILB 2WFAA 5DB6A 2V4LA 3SMVA 3PRPB 3MC8A 2KV2A 2WU2B 3QUCA 3M3JA 2QEJC 2EDUA 3ZDTA 3H7PA 2JF5A 1NKCA 5DDYA 5KG2A 3DVGY 1ZQJA 4NLBA 1HTQA 2V9HA 2HHQA 3EZ5A 4EKUA 4M01A 5IINA 3IHPC 4QNLA 3K1ZA 3DHHC 3WKCA 2BBCA 1XSPA 3L08A 9ICRA 1BPEA 1FFUA 3PX4A 1FRRA 1YNTE 2DLBA 5H92C 7ICGA 4ACOA 4IRKA 2JY6A 3UQ2A 3KYCD 2HI0A 4ED2A 4II3B 5KFMA 3HM3A 1WR1A 3WAPA 3N7PD 3BYTB 1EWCA 2AYOB 4UAWA 1Z19A 3ZDBA 2QB0A 4O0IA 3V60A 1E0ZA 3BQ2A 3TJPA 3OG5A 3H7PB 1JX4A 5I4DA 1NK9A 1SSNA 4A8XC 2FUHB 2OJRA 9ICEA 2KD0A 1RYSA 4Q8FA 3PGEA 3SD5A 2L7RA 1DGJA 1X66A 1T8EA 7ICTA 2HHWA 2PI5A 1T0RC 4NLZA 5AKIA 2G5HB 3GS2A 3C1YA 4L1BA 2IDYA 1PVPA 1C7YA 3QEAZ 2DENB 1MSWD 1RQNA 2XGPA 1NBFC 5KT2A 5DBBA 5L83A 1PGXA 1L4ZB 4M0WB 3PV1A 4DHZB 2IO0B 5J2HA 2K6QA 4RT3A 2HBLA 3CSFA 2JRZA 9ICSA 4RNMA 2KANA 1E8XA 3A0BU 1F0MA 2Q0ZX 1YIWA 3RB4A 4Z6CA 4W9KA 2WDVB 2AL6A 1SZPA 4TUUA 5L1KA 2XNAC 3PLVA 4ZRPA 4C8OA 3CYMA 3SV4A 2WDRB 4DSJA 2NTTA 1S3SG 9ICNA 2KWUB 8ICLA 2D6FC 1MC8A 4M9NA 2NPTA 3Q3JA 3Q3NC 1J8CA 5AI4A 3P2BA 1V1PB 1L8OA 2GLEA 2L3ZA 2KJHB 3RI7C 3ETRA 3BVGA 3HK0A 4P16A 4CRXA 1D4BA 2LRUA 5KAIU 1R4NI 3PO4A 2AL3A 1Q3UA 4ITKA 1RPLA 1C77A 2J0JA 3W1SC 2X8XX 2ZPNA 3GE3C 1L8LA 4N59A 4DWIA 5J2FA 3DBLB 4JV1A 1E5WA 3J9CA 3RNCC 2WB1C 1TAQA 3RJEA 2KDEB 5KG4A 3FILA 4YTPB 3RB0A 3QC8B 3R8BA 1S9FA 4GDLA 4K4GA 5BMIA 4GXJA 2AX5A 2Y9UA 2NRWA 4USAA 3RPFC 2L05A 2M0AA 4NL9C 1TAMA 2M1MA 2H3QA 3ZRFA 2HE7A 3QK0A 4BKGA 3NRZA 4YVZA 4W9HA 2NTSA 2BWES 3AMZA 5J0OA 4KLDA 1JMSA 2DYOA 2MBHA 2I9GA 8ICNA 2INCC 2KN5A 2WP9B 2WXHA 1NJXA 2ZCBA 2INPE 2C7HA 3DV9A 4F8CB 2ZUCA 4P1BC 1COOA 2CPRA 1XSNA 3NVZA 4O3NA 2ZW1A 1TK5A 1JN3A 2KMDA 2KDIA 2W11A 4WQMA 4FJZA 4UB6U 1S5LU 2G5IB 4F91B 4Q45A 4R63A 2R8GA 3OSPA 2IGDA 3ZJUA 5KFWA 3MDCA 2HMXA 1Z4NA 2D3GA 4JGHB 1KW4A 4Y2PA 2GRIA 3F2CA 1QOGA 2YEPF 4P0QB 2W7PA 3L4PA 2HD5B 2CHWA 4M6WA 4J3OD 4ZH4A 1V49A 3KYDD 1JW9D 2IHNA 1K8RB 2ZCCA 5KT7A 4PGXA 4TUSA 2IOFA 3IDWA 5HP4A 2WAQC 2N0SB 3PX6A 5AZHA 2NV3A 2W55A 1SF0A 2MSED 3HILA 3BYYB 4J9SA 3QX7A 1WXVA 3S2AA 4RH6A 4DQIA 1TK8A 1UZXB 2KD1A 2NBUA 2LM1A 3RB6A 4FBTA 2V3PA 1XLQA 3BK1A 3V3XA 4KN4A 3UIOB 2FE8A 1KDHA 2PFPA 1NNLA 2PTLA 4EYHB 2CN1A 4UB4A 5F3XB 3M63B 1BPDA 3HKZC 3H8SA 4O5KA 8ICTA 4E74A 3W9CB 4UQGA 5ALSA 2FCNA 3U7DA 3SEBA 4UAUA 9ICFA 3TACB 3K9OB 2M0NA 3C23A 2KFNA 4A8EA 9ICIA 2I1JA 4WAFA 1PGAA 1QLBB 1V8CA 1DOYA 1NZPA 3L10B 1WWVA 3LWLA 5J2JA 3PSTA 4DFPA 1ZQDA 1WJ4A 2JUOA 3LDAA 3KWLA 4IC7B 2RRDA 3ABVB 2KFZA 5HHDG 5KFGA 4F4KA 4WJ3B 1ZQXA 2J4XA 4QZFA 4RQ1A 1KH0A 2PFNA 3EPGA 2XY6A 4NM2A 2P6RA 1FM0D 1PUTA 4KSLC 2AQ3B 4PGQA 2D2QA 3SAGA 4FHKA 3T5LA 4HWIB 4W9GA 7ICLA 3SQIA 3R9KA 1B4FA 2KOBA 1H38A 3UXOA 1ZQFA 4CNQA 2DYMA 2JWUA 1QQ6A 1D8YA 3GQCA 4NLGA 1SJED 1A70A 3RULA 4I6LB 4PHEA 5ALEA 1L3TA 2I5HA 5KFUA 1KEJA 8ICXA 4C8KA 4MM3A 5IA7A 2KJ8A 1L6NA 2W3SA 3UM9A 4BUGA 1F77A 1S8OA 3U26A 3SZ2A 1ZGUB 3ZD8A 2WLBA 3GE8C 3I57A 3M1YA 4YXJA 1S0NA 2DPIA 3ZVVA 3WKEA 3ZLZA 2BPSA 4EZ6A 4YSZB 2KVSA 1FCLA 4M0WA 1IBXB 1MQ2A 2KNBA 5BO4B 2UVUA 3PSEB 9ICWA 2RDGA 3IV6A 4IWOA 5KFTA 3D2NA 1YN4A 1KKXA 2G4DB 3QU4A 1O08A 4QZBA 2KKCA 7ICNA 4PS8A 4YCXA 4QZIA 4KMOB 4DXAB 2FI1A 3TI0A 5AKYA 3IAS1 4RM9A 1XU4A 1T3NA 1T0QC 1ZQ1C 2LVPA 4HEA1 2V4RA 4XX5A 1TJEA 1F52A 1ZQHA 2ZIXA 3WAMA 2JZPA 5CX3A 2RSUA 2MU2A 3OJ3A 2GBJA 2FLPA 1WCLA 5KFLA 1NK6A 1SEBD 4DOCA 1ZJMA 3RD2A 4OCZA 4MF2A 2JWZA 4LNNA 1S1QB 4F2SA 2BCSA 4F71A 5J2GA 2CHXA 3PZDA 3GP7A 4WJQA 1ZETA 2VZKD 4E71A 3D2SA 3HIZA 1SWWA 2MWSB 2WDQB 5AK6A 2FPMA 3DOWA 1WE6A 4IL6U 2MP2B 3H40A 2EZZA 4MFAA 8ICCA 4ECXA 1OXJA 3AEVA 4G3XB 2A4ZA 3SYZA 2Y5BB 4ARCA 5DB7A 5HR6A 2W43A 1GPXA 2FMQA 4KGTA 3BZKA 4TUQA 3HVDA 2CKHB 5C0YA 1WJUA 1RFAA 1SIFA 1R4MB 4M0AA 2QHOA 1IYFA 1RQLA 4NJ7A 2BYTA 3PRZA 3NVYA 2KICA 3RJJA 5ALVA 3ED5A 4DL3A 4DHJD 1CMXB 3JSVA 2AQ4A 3NRWA 3BQTA 2KC1A 4LNIA 2UVRA 4OW0A 3NOBA 1F5SA 1V6EA 3VAWA 3KW5B 3HX0A 3UMGA 2BYVE 5AKHA 4RQ3A 1I7HA 4R8UA 4DQOC 1E90A 1ZPSA 3BS5B 5KTQA 1EF1A 5AK4A 2LUMA 5E6NA 7ICFA 5T14A 3RMKC 3OGUA 2HBMA 2JQRB 3V05A 1C4AA 5CHGA 4BBNC 3MJWA 3DHGC 1ET6A 1KF6B 2JEJA 5DPTA 1JUDA 1V1PA 1MHXA 2LVOA 5ALTA 3KKAC 5JXVA 5G55A 3JPOA 2ATLA 4CHKA 1ZQOA 2AH5A 4RU9A 4DK5A 2H3VA 2QILA 3HUIA 4PGYA 3KHGA 4DL4A 1G6JA 5J17A 5CB1A 3ZNID 2LI6A 2JXXA 4UBCA 5AI0A 5DGAA 1IBXA 1KLGD 4JK1A 3ISDA 3WK4A 2IBKA 1WZ0A 3EECA 2I1QA 1YX6B 2YQEA 3RJHA 4WJNA 2EZYA 2R8KA 4YTMB 4DXFA 3UXNA 2IZVB 3K9PB 2X38A 4IRCA 3FDSA 1XT9B 3VUWA 1TV9A 2WX1A 1GO3F 1ZQCA 4JWMA 4WIPA 3A4SC 5HHHA 5KHOA 3QEBZ 1P9DU 3R7QA 4LK0M 2DBYA 2PEAA 4C4TA 3DBHB 3M9NB 1UHUA 4FBJB 2KHWB 1GJZA 4J6IA 4KLMA 2LGYA 1N5WA 3APCA 4RF1A 4RQ6A 9ICBA 3X23A 1YJ1A 4EOYA 2IPKD 2MW5A 3KQ4A 3B1LX 3RJKA 5AKGA 3MFHA 1WF9A 2IY1B 3AB5A 8ICKA 3EGRA 2A1JA 1U45A 1N6ZA 3PW7A 5KFEA 2UYZB 3VXWA 5AM2A 5KT6A 2IA6A 1XXGA 3ZUNA 3QHTA 1ZQVA 2YX8A 3WK7A 3WIMA 4CQNA 3Q2AC 4Y2QA 4LZGA 4HDOA 1TFRA 4ICUA 1UQVA 2A3VA 3DHIC 1ZQPA 4GC7A 4QW9A 1FPYA 4J03A 4RMAA 2PKEA 5KFBA 5ALXA 2FMPA 4C4VA 3LWMA 4C56C 1ZRMA 3MR5A 1UELA 4BKSD 3DBRB 2BB5A 2AJQA 4MFCA 1LVHA 3Q6BA 1NOMA 4NLCA 3TEWA 3MC0B 5L9XA 2A1JB 4MEXA 1Z5SB 4O3MA 4I2BA 2ZXHA 2KZ3A 2ZVOA 1DXSA 1RAXA 1WJNA 4DCCA 4ZDVA 3M6ZA 5J0SA 5AUIA 2M0XA 4TMAB 1FFVA 4UB3A 4YMMA 3FC4A 4GDLB 1A6SA 2EAOA 1WFYA 4G9BA 2L76A 4Y2VA 3Q8KA 3H9DA 3DVGX 2OXOA 3RRHA 1IP9A 2HVHA 4I27A 2MX2A 5EOZA 5J2RA 2PVGC 4N6EB 1KRPA 4MH8A 4OD0A 2FAZA 1MHHE 2LGXA 3KH0A 1NJYA 1FXAA 3EFUA 4XA5A 5JHAA 1HUZA 2W9AA 2Z0DB 2B6GA 3L5KA 3JPRA 4EYIB 3HPOA 1SGGA 1UT5A 5JUMA 2FPLA 1CZPA 4UARA 4YMOA 1V80A 4HROA 2GMIC 5TZVA 1LFDA 2ACZB 2E8PA 1SE2A 4D2KA 5J2IA
chains in the Genus database with same CATH topology
4C7ZA 2WXGA 3AE2B 5HFYA 3HVZA 1J7AA 1WYGA 1LO5D 4ZYSA 1ZE3D 3P63A 4REZA 1L0XB 4MT5A 4A90A 3TEYA 1ESFA 3FILB 4B0EA 1N5XA 2I2YA 4IKGA 3B9JA 2K5PA 1FMAD 2WU2B 3U52E 5D3DA 2QEJC 2Z8LA 1CK1A 1ENFA 2ZW0A 1VZ8A 3R2TA 2RPVA 3B2FA 1DOXA 4JX1C 1JWAD 1FD6A 3MHZA 4KKIA 1XLOA 3C8YA 3TEZA 1UNSA 3B2GA 4WH4A 2BBCA 1K52A 1ZDVA 3P4QB 1FFUA 1FRRA 1YNTE 2DLBA 4H2AA 5H92C 1PFDA 3ZJTA 1UWMA 2MJ3A 1NI3A 1TYGB 3BYTB 1EWCA 4O1NA 1E0ZA 1HA5A 1JALA 3BZDB 5I4DA 1SSNA 4RGMA 1NVID 3AE8B 4A8XC 4N58A 1XCTL 3VQIA 4RNAA 1DGJA 4RGTA 2VZKB 3AE1B 3PZ8A 1K53A 2MJDA 1ZOYB 1TKEA 3GS2A 1HEZE 4L1BA 2IDYA 2H88B 1ZXIA 3Q8AA 2PMVA 3NVWA 2JXTA 3AM9A 1D5ZC 5FR3A 1PGXA 1L4ZB 2R61A 3EUB2 4OZBA 4L23A 2PIAA 2LFIA 5EE3A 5HI1A 3E9SA 4YT0B 2WDVB 1OQQA 3BIID 3RFZB 1HQRD 3NZ3A 2QJLA 1BXTA 2INNE 2XNAC 4ZRPA 4NZLB 1WWTA 1MPEA 2WDRB 2NTTA 3Q69A 1VR9A 2E3TA 1I4GA 1ZP0B 3P42A 2IGHA 3WCQA 1JMLA 1QOBA 1SBBB 1YQ3B 1V1PB 3SFEB 2K22A 3NS1A 2G9HD 1UUPA 2ON8A 3ETRA 1QT9A 3BVGA 1T5XD 2WU5B 3MP9A 4P16A 1D4BA 1ZDXA 1OQRA 3T3NA 4L2YA 4ITKA 1C77A 2JX5A 1ZXHA 4N59A 4OHJA 3J9CA 4Q2JA 1C4PA 4A9AA 4YTPB 2TSSA 3FILA 3MJ5A 4PT5A 3R8BA 1PYWD 5BMIA 1TS3A 2QIEB 2AX5A 2EKIA 4USAA 4MM3B 3RPFC 2M0AA 3PO0A 4ZOHC 4OZCA 3U2SC 1UGJA 5MPOA 1DYQA 3NRZA 1GB4A 2NTSA 3AMZA 4US9A 1F0ZA 2DYOA 1YN3A 2WP9B 2WXHA 1FRDA 3ZQ4A 1FNUA 2HDEA 4YWGG 1JWMD 1K50A 2RDHA 1ET9A 2BS3B 2OHFA 3AEGB 2INPE 4RF0A 4YSXB 2CJOA 4TSSA 4NJCA 3NVZA 2ZW1A 5D7GA 5TSSA 4WQMA 1ROEA 1XEEA 2WXRA 1BUIC 1GOZA 2BTEA 2XN9C 2EELA 4OZAA 2V0GA 1TS4A 2IGDA 1XLPA 3ZJUA 2KDMA 2FBWB 1AYFA 5BMGA 1L6UA 3MFGA 1GAQB 2GRIA 3AN1A 1QOGA 2KACA 1N60A 2YEPF 5LNK1 2LHEA 4DXGA 3L4PA 2WXKA 3Q8EA 4IOIE 4YTNB 3SFDB 3CWIA 5HG2A 4J3OD 1IGCA 1WXQA 2BW2A 1JW9D 5BMHA 3KWVA 3OWEB 1JWUD 1QQRA 1I4XA 1XO3A 2WXIA 3AE7B 4TQ1A 2N0SB 2KWDA 2B76B 2W55A 1SF0A 1EU4A 1P7FA 3BYYB 2J53A 2YEPB 5EE1A 4RH6A 2J42A 4MACA 3O13A 1SE3A 2IJ0A 3BWUD 2V3PA 1XLQA 3BK1A 3V3XA 2FE8A 3VRBB 1AW7A 2CJNA 1C78A 1VDVA 3BVMA 2WNMA 2PTLA 1E10A 3P4SB 3U4EG 3W9CB 1P7EA 4AS1A 3Q8FA 5G5HA 3SEBA 4A55A 3CIRB 1SIJA 1HZ5A 2BT6A 1GB1A 1NENB 2WXOA 1JRPA 4WAFA 3W5UB 3VRAB 1PGAA 1QLBB 1V8CA 1DOYA 2M19A 3AEEB 1C79A 3KWLA 3ABVB 3IXSA 3GB1A 5HHDG 1VRAB 3VR8B 1VZ7A 4XDDA 4ARIA 2N9LA 2WXFA 2J4XA 4RGNA 2JSVX 2LJIA 3PZ7A 4R3DA 1KH0A 2WXPA 3H8HA 1PUTA 1FM0D 1STEA 2AQ3B 1TY2A 2DYMA 2JWUA 5FKAC 1IGDA 4ZHPA 2AQ1B 3TUOA 1SJED 1A70A 5FK9C 2WXJA 1OFFA 5GXGB 4YXDB 4C80A 1B1ZA 1RYJA 1JWBD 2DWQA 4RGOS 2WQYB 2W3SA 1WRIA 4RF1A 2WS3B 1F77A 2WLBA 2K3UA 3I57A 4KKJA 2LEKA 1EWYC 3HRDD 2LMCA 4YSZB 2G1EA 4JWSC 1FCLA 4M0WA 1IBXB 2KMMA 2RDGA 1XF5L 4EE2A 3NVVA 1JQ4A 1T6BX 1SJHD 1YN4A 3AV8A 2RMMA 2WXQA 4ZHOA 1YQ4B 1I4QA 2BS4B 4GDKB 4LLGM 4HKZE 4YSYB 1CJEA 1FO4A 1RFKA 1SB3C 3AECB 1KRHA 1NYQA 3IAS1 4OVZA 4WWMA 4HEA1 1TJEA 1JWSD 3W5VB 2K0PA 1HZ6A 2JZPA 2IGGA 1NEKB 3IT4B 3TSSA 1VLBA 1SEBD 1TZOA 1MI0A 2WXLA 3Q8CA 4LTUA 1L0VB 1D5XC 1YJJA 1F2RC 2Y5PA 3GP7A 2VZKD 1KFYB 4WURA 3LYYA 2WDQB 1PDXA 1FXIA 2L32A 3URYA 4JPSA 4HKQA 2BB6A 4ARCA 2BS2B 1VZ6A 3FAHA 4ZRQA 1FCCC 1GPXA 4KGTA 1VJKA 3LB8C 3HVDA 2ONQA 5H8YE 2BYTA 1JROA 3NVYA 1TKYA 4KGRA 1KLUD 3Q8BA 1M4VA 2JYTA 4UDUC 2NMQA 3EA6A 3W1SA 1EU3A 2CU3A 4OW0A 3ZGZA 1TKGA 2OEDA 2V3NA 4DQOC 1I7HA 1ZPSA 5D3IB 1AWDA 2I38A 2N9KA 1FEHA 2W82A 3IT6B 1ACCA 2PW9A 2LUMA 4RFBA 3P4PB 1YJIA 3V05A 2JQRB 5BYQA 1C4AA 3T3OA 1L5PA 2H89B 2V4IB 1RM6C 3SR6A 1ET6A 1KF6B 1WSPA 5E6JA 4NAMA 3N9YC 2D5GA 1V1PA 3NUHB 1MHXA 2K9XA 5JXVA 2WXMA 2HTME 4TQ0A 2J52A 4KGSA 2L83A 5C3JB 1WGKA 1IUEA 3AEFB 1K51A 1Y56A 1QF6A 2W3RA 2QILA 3HUIA 2KN4A 3UI3A 3W2DA 5C2TB 3DWGC 3ZYYX 1C76A 1D6EC 1DOIA 2QMTA 3BVZA 4P6VF 1I4RA 1N62A 5AUKA 4XWTA 1L0YB 2ICIA 3AEDB 1EM7A 5BYSA 4AQ7A 1IBXA 2FUG1 1KLGD 2W54A 2JU6X 3AE4B 1T3QA 1JCKB 1PGBA 1F2RI 4YTMB 2WXNA 4DXFA 2LHDA 4KX6B 3AEAB 2X38A 5EE9A 3U7ZA 1QKZA 4WIPA 1V97A 4LK0M 2DBYA 3KLSX 1J7BA 3LXFA 4GLSC 1FNWA 2GB1A 1N5WA 5T8IA 4FXCA 3TEXA 2IPKD 1L6VA 3IAM1 2PVOD 3KQ4A 1HXYD 4HJGE 2Q5WD 1E6EB 3AB5A 3EGRA 1L4DB 4A6QA 1ZUD2 2E6XA 1YMHE 2QSDA 2N7JA 1I4PA 1B9RA 1XXGA 1MVKA 1SE4A 4CQNA 1QOFA 3R2IA 4NAWB 2LGIA 1E9MA 2MJEA 4C7YA 2Y5CA 4XWWA 1D5MC 3I9V1 4XDCA 1XLNA 4C56C 5G5GA 1C4CA 4JE3B 2KAJA 2KQ4X 5BYRA 3P1MA 1QOAA 1FIQA 2BB5A 1QILA 1NYRA 3AEBB 3TEWA 3MC0B 4B0MA 2MEKA 2PLPA 3AH7A 3E56A 1I4HA 2SEBD 4XE0A 3AE5B 1KTKA 5EE0A 1R7SA 1AN8A 5AUIA 1N61A 2MH7A 1SXTA 2SAKA 3AE9B 4TMAB 1FFVA 2GI9A 4HRSA 4US8A 3FC4A 4GDLB 2L52A 3P4RB 1Q10A 1TS5A 1CQVA 1J7CA 2Y3AA 1RWSA 2PVGC 4N6EB 4MH8A 3VR9B 3BK2A 1BMLC 4IDIA 1UWXA 3ZJVA 1MHHE 1V1OA 2M56B 4RCOA 3DWMA 1TY0A 2AQ2B 3AE6B 1FXAA 1YN5A 2JYEA 1E7PB 1C9FA 2PKOA 1N63A 3AE3B 1TS2A 1CZPA 4JWUC 1FNVA 4HROA 2ACZB 2L1AA 1SE2A 4D2KA 1XCQL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7Z A;  3ZYY X;  4YTP B;  1DOI A;  4P6V F;  1OFF A;  5AUK A;  3AE2 B;  1N62 A;  5GXG B;  3HVZ A;  4YXD B;  4C80 A;  2QIE B;  2AX5 A;  1J7A A;  4USA A;  1WYG A;  1JWB D;  1RYJ A;  2DWQ A;  2EKI A;  3AED B;  2WQY B;  3RPF C;  3P63 A;  2W3S A;  1WRI A;  3PO0 A;  2W54 A;  2WS3 B;  2WLB A;  4ZOH C;  3AE4 B;  5MPO A;  1T3Q A;  3NRZ A;  2LEK A;  1EWY C;  1N5X A;  3AMZ A;  3HRD D;  3B9J A;  2K5P A;  4US9 A;  1FMA D;  2WU2 B;  4YSZ B;  2G1E A;  4YTM B;  1F0Z A;  4JWS C;  2WP9 B;  1FRD A;  4KX6 B;  2KMM A;  3AEA B;  2BS3 B;  2OHF A;  3AEG B;  5EE9 A;  1JQ4 A;  3NVV A;  4YSX B;  2CJO A;  3AV8 A;  3B2F A;  1DOX A;  3NVZ A;  4JX1 C;  1V97 A;  4ZHO A;  1JWA D;  1YQ4 B;  4WQM A;  1ROE A;  2BS4 B;  1XLO A;  2DBY A;  3LXF A;  1J7B A;  3B2G A;  4YSY B;  1CJE A;  1FO4 A;  1RFK A;  1SB3 C;  3AEC B;  1KRH A;  1NYQ A;  3P4Q B;  1FFU A;  1FRR A;  1N5W A;  1XLP A;  5H92 C;  1PFD A;  2FBW B;  4FXC A;  1AYF A;  4WWM A;  1L6U A;  1GAQ B;  1L6V A;  1TJE A;  1UWM A;  2MJ3 A;  3W5V B;  3AN1 A;  2PVO D;  1NEK B;  1QOG A;  1N60 A;  1E6E B;  1NI3 A;  1TYG B;  2Q5W D;  3AB5 A;  3L4P A;  1ZUD 2;  4YTN B;  3SFD B;  1VLB A;  3CWI A;  1E0Z A;  1B9R A;  1JAL A;  4LTU A;  1WXQ A;  1L0V B;  1JW9 D;  1NVI D;  3AE8 B;  1QOF A;  4N58 A;  1YJJ A;  1KFY B;  1XO3 A;  1E9M A;  2MJE A;  4C7Y A;  2WDQ B;  2Y5C A;  1DGJ A;  1PDX A;  3AE7 B;  1FXI A;  3AE1 B;  2N0S B;  2MJD A;  1ZOY B;  2B76 B;  1TKE A;  2W55 A;  1SF0 A;  2H88 B;  1ZXI A;  1XLN A;  5EE1 A;  5G5G A;  3NVW A;  2BS2 B;  2KAJ A;  3AM9 A;  3FAH A;  1GPX A;  3P1M A;  1QOA A;  1XLQ A;  1VJK A;  1FIQ A;  3VRB B;  3LB8 C;  2CJN A;  1NYR A;  1VDV A;  3AEB B;  3EUB 2;  5H8Y E;  1E10 A;  2PIA A;  5EE3 A;  1JRO A;  3P4S B;  3NVY A;  1TKY A;  3AH7 A;  3W9C B;  3AE5 B;  5G5H A;  5EE0 A;  4YT0 B;  1R7S A;  3CIR B;  2WDV B;  1SIJ A;  1N61 A;  1OQQ A;  2BT6 A;  2MH7 A;  2QJL A;  3BII D;  3AE9 B;  5AUI A;  1FFV A;  1NEN B;  2CU3 A;  4HRS A;  4US8 A;  3FC4 A;  1WWT A;  1JRP A;  1TKG A;  2WDR B;  3VRA B;  2L52 A;  3W5U B;  3P4R B;  1I7H A;  2E3T A;  1QLB B;  1V8C A;  1DOY A;  1AWD A;  2M19 A;  1ZP0 B;  1J7C A;  3AEE B;  3KWL A;  3WCQ A;  1YQ3 B;  1QOB A;  3ABV B;  3P4P B;  1YJI A;  1RWS A;  2PVG C;  3SFE B;  4N6E B;  2JQR B;  2K22 A;  3VR9 B;  3NS1 A;  3VR8 B;  4IDI A;  3ETR A;  1L5P A;  1QT9 A;  2H89 B;  2M56 B;  1RM6 C;  2WU5 B;  3SR6 A;  3DWM A;  3AE6 B;  1FXA A;  1KF6 B;  1OQR A;  1E7P B;  4ITK A;  1PUT A;  1FM0 D;  2K9X A;  2PKO A;  1N63 A;  2HTM E;  5C3J B;  3AE3 B;  2JX5 A;  2L83 A;  1WGK A;  1IUE A;  3AEF B;  4N59 A;  1CZP A;  4JWU C;  1QF6 A;  2W3R A;  4HRO A;  4ZHP A;  2ACZ B;  3HUI A;  4A9A A;  1A70 A;  5C2T B;  3DWG C; 
#chains in the Genus database with same CATH topology
 4EBD A;  1Z3E B;  3UMC A;  1J7A A;  1WH3 A;  5L1M A;  3ZNZ B;  4REZ A;  3PW5 A;  1TE2 A;  4G11 A;  4MT5 A;  2O6K A;  2P6U A;  4NV0 A;  1WGY A;  1WIA A;  3T9L A;  1N5X A;  1C3T A;  3B9J A;  2K5P A;  4A3O A;  3U52 E;  4BDP A;  5D3D A;  2Z8L A;  1D9F A;  1X9M A;  4FBU A;  3CRX A;  4JB3 A;  4ELT A;  3SHQ A;  1CI4 A;  5GTH U;  2L0T A;  3V6K A;  3R2T A;  5D46 A;  2PFQ A;  2RPV A;  3B2F A;  4JX1 C;  3VTW A;  1DOX A;  3QU7 A;  5ALH A;  2LUE A;  3JSV B;  3MHZ A;  3SAH A;  1XLO A;  1ZJN A;  2MBB B;  2RQ5 A;  8ICP A;  3B2G A;  3VDZ A;  4MSM B;  3GV8 B;  5J2K A;  1IV8 A;  2NBV B;  1K52 A;  4FS1 A;  3P4Q B;  3ICX A;  1PFD A;  2K89 A;  3ZJT A;  1SE9 A;  1UWM A;  4S0R A;  2ZZP B;  2K4P A;  2K8C B;  2AGP A;  7ICR A;  1DK3 A;  8ICE A;  2KQS A;  4W9C A;  4NL9 A;  4YG2 A;  2KJ5 A;  4OJ6 A;  1HA5 A;  3BZD B;  4QWE A;  4ANV A;  3ZKJ C;  5KG3 A;  4N58 A;  1Q1O A;  5ALM A;  4EEN A;  4UB1 A;  4K3B A;  2EKE C;  4RGT A;  4KLL A;  3PZ8 A;  2KFK A;  1K53 A;  1M6Y A;  5KG0 A;  2RHF A;  2NRZ A;  1ZXI A;  3E0F A;  1ZQE A;  2FIF A;  5KHQ A;  5LXH A;  3HHM A;  3AM9 A;  1DGS A;  5FR3 A;  5DLG A;  3A4R A;  4QZG A;  5B66 U;  4RQM A;  2R61 A;  3T79 A;  3GIL A;  2KLG A;  3NAS A;  4OZB A;  4L23 A;  5DQI A;  1COK A;  4WWN A;  2ZUB A;  2BDU A;  2K4H A;  1HUO A;  4I2G A;  3MGV A;  3WAO A;  1ZQR A;  1WXS A;  1BPB A;  3MBY A;  1HQR D;  3KUD B;  4K1R B;  1WY8 A;  4ED3 A;  5KL8 B;  2KO3 A;  2W8K A;  1VR9 A;  4GC6 A;  3NTU A;  1IG6 A;  1I35 A;  1I4G A;  2XK5 B;  3QQ8 B;  3P42 A;  4GGQ A;  2MUT B;  2R2O A;  1KLV A;  8ICH A;  1SBB B;  4P2H A;  3TFS A;  3SFE B;  3QZ7 A;  1UUP A;  2AEH A;  2H3Z A;  2D3A A;  4FA6 A;  1T5X D;  4DBG A;  4F4Z A;  4G0N B;  4AJY B;  1ZDX A;  4NJ6 A;  2ZVN A;  3Q8Q B;  2KVC A;  2Y1I A;  3DEE A;  2N7E A;  5KFZ A;  3GDX A;  1ZXH A;  2JRI B;  3T5J A;  2ZPY A;  4Q2J A;  3PR5 B;  2H3F A;  3N4M B;  2F3N A;  4MDK E;  3BY4 B;  3UIN B;  1PQS A;  3RAQ A;  4PT5 A;  1XC9 A;  1NK5 A;  2ZJ8 A;  2QIE B;  5DG8 A;  3H0L B;  4OZC A;  5DDM A;  1DYQ A;  4EBC A;  2YMM A;  3PLU A;  3BQ7 A;  1UGM A;  1WGH A;  3NS8 A;  3UF8 A;  2VRR B;  3M9M B;  1TT5 B;  1UH6 A;  4CO7 A;  4I2A A;  1FNU A;  3PW0 A;  2HDE A;  3PO5 A;  3SD7 A;  1BPY A;  2OHF A;  1ET9 A;  1WZ3 A;  2NCN A;  4WJP A;  5AM1 A;  2XY5 A;  1KTQ A;  4LVS A;  2BVC A;  1Y88 A;  5TSS A;  1ROE A;  2NYV A;  3PT2 B;  4FS2 A;  1ZQL A;  4ECW A;  4F5Q A;  3ZXV A;  1Q8K A;  4OZA A;  3GII A;  4W9E A;  2KDM A;  1AYF A;  3UQA A;  3EFC A;  1YQB A;  3O65 B;  2KKP A;  4IR1 A;  4Y2U A;  3RJF A;  5DCN A;  1F9J A;  4AWJ A;  4GN1 A;  2LHE A;  2G0A A;  3ALR A;  3NHE B;  2WXK A;  1MFW A;  4I29 A;  4YTN B;  1F1H A;  3V61 A;  3CWI A;  3WK8 A;  3CP8 A;  1CUK A;  3M9O B;  1WXQ A;  4IWP A;  3X0W A;  3JPQ A;  2DGZ A;  3OPX A;  4DOA A;  2BCV A;  2DPJ A;  1L3U A;  2C22 A;  3V6E B;  3RNG C;  1K5O A;  2MA9 B;  3AE7 B;  5D6J B;  2G3Q B;  2IO1 B;  2B76 B;  3F2D A;  2YEP B;  2R8I A;  4ED7 A;  1SGH A;  2LWP A;  4YR2 A;  3QUB A;  5KFI A;  4XRH A;  3BWU D;  2LYH A;  4ECQ A;  2OOB B;  5AKJ A;  1C78 A;  2KE7 A;  2PJH A;  1BPX A;  1QH9 A;  3QYP A;  1L7O A;  3UIP B;  5J29 A;  8ICZ A;  1UA1 A;  1WX7 A;  3Q8F A;  4DFM A;  1TK0 A;  5G5H A;  7ICU A;  1LXD A;  2D07 B;  1XWL A;  3LYS A;  4CF3 A;  4BXO B;  2N9P C;  3CIR B;  3OJ4 B;  4ANU A;  3TBL D;  1EF5 A;  2WXO A;  3W5U B;  7ICK A;  4FJY A;  3LJ3 A;  4X5V A;  2C5L C;  5J0Y A;  4KX3 A;  2NRT A;  3ONN A;  4YD2 A;  3UXP A;  1Z00 A;  2M19 A;  1A0P A;  3V6C B;  1T94 A;  2AWT A;  1VRA B;  4MGZ E;  4JV2 A;  3TMP B;  3VR8 B;  1L2N A;  4ED1 A;  2N9L A;  2KTQ A;  3PS6 A;  3HWT A;  4TV3 A;  4XGA B;  2YY6 A;  3T8M A;  5KFQ A;  2LJI A;  2WXP A;  1NK8 A;  3H8H A;  4DL5 A;  2FCQ A;  8ICQ A;  1STE A;  3QU2 A;  2ZNV B;  3PRE A;  2BQQ A;  5ALI A;  1TY2 A;  4PHD A;  3MFI A;  2K8A A;  2OEH A;  2LPE A;  3TUO A;  3CNH A;  4PL2 A;  5KG5 A;  1SL2 A;  2WXJ A;  5GXG B;  4YQW A;  2O6V A;  3RCZ A;  5HML A;  2F2A B;  4DLG A;  5DPR A;  4LDT D;  1B1Z A;  3A9J B;  2JR5 A;  2KMA A;  3R7R A;  4QWB A;  1R4N B;  4TKN A;  3MR3 A;  4Q44 A;  2WS3 B;  4GDK A;  4O3O A;  4KKJ A;  4AOF A;  5BOM A;  4RQ0 A;  1LKY B;  4PS7 A;  3HRD D;  8ICB A;  3OSN A;  3ZNG C;  1MN8 A;  2KTR B;  4LCD E;  3C1Z A;  2KMM A;  3PSI A;  3GU3 A;  4EE2 A;  1JQ4 A;  1T7P A;  1T6B X;  1SJH D;  1Q0W B;  4QW8 A;  4ANX A;  2XEW A;  3V7J A;  1UBI A;  2ZEQ A;  1WCN A;  5J2E A;  3IG3 A;  4M9G A;  5IIL A;  2I6X A;  4YSY B;  9ICO A;  7ICO A;  1FO4 A;  2BHN A;  1SB3 C;  4UAZ A;  3RTV A;  1CJE A;  1KRH A;  1RFK A;  4TQS A;  5AKX A;  1NKE A;  2O2V A;  4PYU A;  3UGB B;  4YN4 A;  3JPS A;  3KZI U;  1D8B A;  2K0P A;  7ICQ A;  1HZ6 A;  3IT4 B;  3AQE A;  2M4N A;  4IRD A;  2JZB B;  4Y2X A;  4ECR A;  3ZTC A;  5DB9 A;  1VLB A;  1TZO A;  4MFF A;  1MI0 A;  2PE6 B;  4LTU A;  3T3F A;  1L0V B;  4ELV A;  2KP7 A;  3NZU A;  1KFY B;  3LYY A;  4QZC A;  3ZDM C;  5KFN A;  1PDX A;  4DWF A;  3HJE A;  4R66 A;  2MP2 A;  3GIM A;  4E0D A;  4FE3 A;  2W9M A;  1N2X A;  2FDR A;  1KM7 A;  2BS2 B;  4P7I A;  2J0K A;  2FNJ B;  3ZNH B;  1ZYQ A;  2KFK B;  1VJK A;  3M8S A;  3A1Q A;  4J9R A;  4XUS A;  1U4B A;  5L1I A;  2EAN A;  2ONQ A;  3JPN A;  3SEI A;  5H8Y E;  2DZJ A;  5C1Z A;  2LM4 A;  2Z0E B;  2BCR A;  3GIJ A;  4ICA A;  1KLU D;  5AEK B;  1M4V A;  1BVS A;  2YLM A;  2K25 A;  4EX6 A;  4UDU C;  2NMQ A;  3EA6 A;  4MGY E;  3PSP A;  4ZRI A;  5KFA A;  3ZGZ A;  4RNO A;  2V3N A;  2WB1 F;  1WYW B;  5D3I B;  1FEH A;  1WMH B;  3IT6 B;  4PZN A;  3PVX A;  3WK9 A;  2PW9 A;  1EO6 A;  3N3K B;  1YJI A;  4RFB A;  4NQL B;  3ETL A;  5BYQ A;  3T5K A;  2YB1 A;  2V4I B;  3T3O A;  1P3Q U;  1T0S C;  3QAR A;  4O3S A;  3RH5 A;  3SR6 A;  3L54 A;  2K4E A;  2GBK A;  1XS9 D;  5IN7 A;  3NUH B;  2BPC A;  2K9X A;  4HYK A;  2HTM E;  5III A;  2J52 A;  3N20 C;  4KGS A;  5C3J B;  4MHV A;  2XC9 A;  3RH4 A;  3QXG A;  4DF8 A;  3B0X A;  2R8J A;  3QU9 A;  3UI3 A;  4M04 A;  3DWG C;  3ZYY X;  4FJV B;  2W8L A;  2ZTD A;  1U47 A;  2ZIU B;  2JPH A;  4Y2R A;  2ZIV A;  3SI8 A;  2BQR A;  4AQ7 A;  1KFD A;  2FUG 1;  4IR9 A;  1P98 A;  2JEI A;  2JU6 X;  2HHS A;  5KAF U;  1JCK B;  5DQG A;  1E7V A;  1F2R I;  1WM2 A;  4F5N A;  4Q43 A;  1WUD A;  5EE9 A;  3AEA B;  4W9D A;  3U7Z A;  5KFH A;  3AI5 A;  4O5C A;  2N9X A;  1QKZ A;  1ZKH A;  1Y8R C;  3TAR A;  5DLF A;  5HR7 A;  2YB4 A;  1J7B A;  1FNW A;  3KLS X;  3LXF A;  3I3T B;  1QQ5 A;  4DL7 A;  4ZRK A;  4F72 A;  3Q8S B;  5AZF A;  3TIX A;  2Y0S C;  5DB8 A;  4YMN A;  4CF5 A;  1LB2 B;  2G06 A;  2HHV A;  1KL9 A;  1L6V A;  5KT4 A;  2HOF A;  2PVO D;  4HJG E;  4J9Q A;  1XQQ A;  2Q5W D;  1DOQ A;  4FZM A;  1LV5 A;  4RUA A;  2RPQ A;  1QQ7 A;  3KZX A;  1U49 A;  1ZUD 2;  2ZIU A;  5AM3 A;  3RNA C;  3RUI B;  4X57 B;  3CF6 E;  1B9R A;  2XI9 A;  5KFF A;  1MVK A;  4RPZ A;  4O9M A;  4ECV A;  1S77 D;  5L1J A;  4J9O A;  4NAW B;  5J2B A;  5AM0 A;  4ACF A;  3RZW C;  4NXZ A;  1ZQB A;  1TAU A;  2MJE A;  4C7Y A;  2H5X A;  2XK5 A;  4XWW A;  3NG0 A;  3IVF A;  3EC8 A;  4AP4 C;  9ICL A;  4OVV A;  3GZF A;  2GBR A;  3I1Y A;  4RQ4 A;  3L13 A;  5G5G A;  4MF8 A;  3A9K A;  5KFO A;  1LGR A;  3P1M A;  2Y1J A;  7ICV A;  2ZTC A;  1FIQ A;  1WX8 A;  3M7D A;  8ICG A;  4BZA A;  3AH7 A;  3E56 A;  2KG5 A;  1I4H A;  2SEB D;  5EE0 A;  3SAF A;  3IRU A;  1JXL A;  1SXT A;  4TQR A;  1ZD4 A;  3EPI A;  2GI9 A;  2WWZ A;  1M94 A;  1V5T A;  2G45 B;  2HBJ A;  2J0M A;  4PL1 A;  3RRG A;  1ZQM A;  2LMR A;  4YR3 A;  2MBO A;  4IQT A;  5IIK A;  4DFJ A;  5F9L A;  5EWE A;  1RWS A;  2HJ1 A;  2K1F A;  4QWA A;  4DQQ A;  3PZP A;  4GOC A;  4IDI A;  2O2V B;  5IKC M;  4RCO A;  3ZJV A;  3DQV A;  1P7D A;  1TY0 A;  5GMV A;  5HMM A;  2JHD A;  2L00 B;  1KN5 A;  2G09 A;  3VCB A;  4ANW A;  3N7R C;  2W9N A;  2DL0 A;  3QZ8 A;  1N63 A;  3QX1 A;  3IBE A;  4FUL A;  2VKQ A;  3H0R B;  1FNV A;  2K39 A;  4KTQ A;  1NK7 A;  2VH2 A;  4EZK A;  1YZ6 A;  1ZQK A;  3AU4 A;  3F53 A;  5LLI A;  2WXG A;  2LXA A;  5HFY A;  3F5A A;  3HVZ A;  4NQK E;  4DS5 A;  5AM5 A;  7ICJ A;  1WYG A;  3CW2 C;  1LO5 D;  2C2D A;  1K1Q A;  3N32 A;  4JMU A;  5AI8 A;  3TEY A;  4DLE A;  2O6V B;  1FMA D;  4URK A;  3KHL A;  3TQ1 A;  2K60 A;  1CK1 A;  1BPZ A;  4NM1 A;  3PPA A;  5ALL A;  4P4M A;  1VCB A;  2RDB C;  2FJ6 A;  4KLH A;  3VTU A;  2VIX A;  2ZW0 A;  3K75 D;  3QUQ A;  3G6Y A;  1SV4 A;  1VZ8 A;  4ZRJ A;  2WGS A;  1JWA D;  3Q3M C;  4QAY A;  4KKI A;  3C8Y A;  3TEZ A;  3PVL A;  1UNS A;  3HM6 X;  4BGD A;  2GLS A;  4M9J A;  4WH4 A;  2RD0 A;  5LXI B;  2MAX A;  5ALP A;  3Q8L A;  1SKR A;  1KJT A;  4H2A A;  3KFU F;  5CRX A;  9ICP A;  2QAR B;  2N4F A;  3IFW B;  2V3S A;  4KIT B;  1T4G A;  2W03 A;  2IMW P;  2ZG6 A;  1TYG B;  3C19 A;  4UB8 U;  4Z6E A;  3MDA A;  2FLL A;  4O1N A;  4WQO B;  2D11 A;  3V62 A;  4M6W B;  1RYU A;  5IIM A;  1X9W A;  2FPK A;  2KDF B;  3ML9 A;  3C2L A;  1NVI D;  3AE8 B;  4RGM A;  5DG7 A;  3VQI A;  4UB2 A;  2A5U A;  4N9F 4;  1NJZ A;  2MJD A;  3AUL A;  3KVF B;  1X40 A;  2WTF A;  4IQU A;  2KZZ A;  1C1Y B;  2ASL A;  2H88 B;  2E8O A;  1WG8 A;  2F1H A;  4PZO A;  4JLC A;  3OLM D;  2PMV A;  3NVW A;  5CA7 A;  4F3O A;  1ZQA A;  3WK5 A;  5KG7 A;  1WXA A;  5JHB A;  1L3S A;  3ZDC A;  1KQQ A;  3RYT A;  5L1L A;  1V85 A;  4GLX A;  5CJ7 A;  3PY8 A;  2PIA A;  4HVB A;  3IHQ B;  5HI1 A;  5AIA A;  3PW4 A;  2GO7 A;  2KKV A;  3PSF A;  2KJR A;  4PYZ A;  2HDO A;  3RFZ B;  4KX5 A;  3NZ3 A;  4C4V B;  4F50 A;  7ICE A;  1BXT A;  3C28 A;  8ICS A;  4NZL B;  1WWT A;  1MPE A;  4B9U A;  2KC2 A;  4IWQ A;  4KZ0 A;  4DQP A;  3Q69 A;  3HW8 A;  7ICH A;  4BOZ B;  1QZE A;  1ZP0 B;  4F4W A;  3IG5 A;  1UCV A;  1J0G A;  2IGH A;  1JML A;  1QOB A;  5K4L A;  3GIK A;  1EUV B;  4B9L A;  1K1S A;  2REX A;  1A76 A;  2G9H D;  1VD2 A;  4HCP B;  2ON8 A;  9ICX A;  1QT9 A;  2JZZ A;  5E79 U;  1X6I A;  2MRL A;  4B9S A;  7ICP A;  4AP9 A;  2RLT A;  2ZJA A;  2LI5 A;  1XD3 B;  3DVN V;  2KVZ A;  3MC9 A;  5FR6 A;  1OQR A;  4DFK A;  2RGF A;  4EZJ A;  5JZE B;  3QA8 A;  3DBR I;  2JX5 A;  4B9M A;  3WKD A;  2NRV A;  4R64 A;  3OJU A;  3ZXR A;  4OHJ A;  4F5O A;  3V72 A;  2BZF A;  1C4P A;  1LM8 B;  4A9A A;  4FAD A;  4BAX A;  3TAD C;  4DSI A;  2TSS A;  1PYW D;  4EEK A;  2VJ4 A;  1TS3 A;  2EKI A;  2PE9 A;  4MM3 B;  2NVU I;  1ISN A;  2WF5 A;  1OQY A;  3UQ0 A;  5ALQ A;  4M9L A;  3I63 C;  1S0O A;  1UGJ A;  5MPO A;  4HLE A;  1PUZ A;  1GB4 A;  5H2F U;  2OCE A;  1X42 A;  4US9 A;  2JEF A;  3U8Z A;  1KSP A;  1F0Z A;  5ALU A;  5KT5 A;  3RZF A;  1YN3 A;  1C9F A;  3GZN I;  3ZQ4 A;  1D8L A;  1X2I A;  1K50 A;  2C7N B;  4YWG G;  4UAV A;  1WR6 E;  1CRX A;  3AEG B;  5KFK A;  1V9P A;  2WDT B;  4RF0 A;  5IAA C;  2CJO A;  3VH4 B;  3VVW B;  2ASQ A;  3NUQ A;  2WX0 A;  2JMG A;  2HBK A;  2BQU A;  2HHX A;  5D7G A;  3EW9 A;  1UBQ A;  2KYW A;  2ALZ A;  1BUI C;  2UU7 A;  3JPP A;  4O3R A;  1GOZ A;  5CHW A;  4I2I A;  2EEL A;  4JIO U;  4KDI C;  2V0G A;  1XLP A;  3MC1 A;  3EHV A;  5BMG A;  1L6U A;  5EDS A;  2DQN B;  4BVU C;  3AN1 A;  2RDI A;  2KAC A;  5LNK 1;  5IP4 D;  9ICM A;  1S0V A;  4IOI E;  1ED1 A;  3RNF C;  1FEZ A;  4DL2 A;  2QB0 B;  5HG2 A;  1WE7 A;  2XBB C;  2HSZ A;  3CST A;  3RH6 A;  3KWV A;  2JRH A;  1XO3 A;  3DBS A;  3ONS A;  2WXI A;  2ISP A;  2KJ9 A;  4TQ1 A;  1E8Z A;  2HTH A;  4QIW F;  4ECY A;  3RBE A;  4M2Y A;  1PVR A;  4F92 B;  3OJS A;  4W9I A;  9ICA A;  1P7F A;  2J53 A;  2JXJ A;  5EE1 A;  4DHZ E;  2XGQ A;  4I2C A;  1BGX T;  5ALJ A;  4I2D A;  1F44 A;  2J42 A;  4KMU A;  3V6H A;  3O13 A;  3ZIM A;  1JIH A;  3ZDE A;  2R18 A;  3VRB B;  4J9P A;  4HPL B;  2GOW A;  1VDV A;  2KFJ A;  3C21 A;  1QLN A;  2DZM A;  1MG4 A;  5J2D A;  3BVM A;  2KJ6 A;  4K4H A;  1WRD B;  3JVZ X;  1E10 A;  3OHA A;  3G6V A;  1UD7 A;  4GXK A;  1SL0 A;  3U4E G;  1TZ1 A;  3V6J A;  4BFR A;  4DEZ A;  2E8N A;  1ZOL A;  5AI5 A;  5DG9 A;  3Q8R B;  1JRP A;  4F93 B;  2P66 A;  4QZ8 A;  2PMZ F;  3VRA B;  2JZB A;  3AEE B;  3K1R B;  2CR5 A;  1C79 A;  1B0X A;  2IHM A;  4MSQ B;  2AGQ A;  3GB1 A;  3THV A;  4QZA A;  1MG8 A;  3KHH A;  2DNF A;  3WA0 A;  4GXI A;  1VZ7 A;  3BIN A;  3J81 j;  2OYY A;  3VTV A;  4BWM A;  3N1X C;  3PZ7 A;  2YVC A;  4FZL A;  4JWN A;  5JRT A;  2N1R A;  4F4Y A;  4ZHP A;  2HCF A;  4FHJ A;  1VJ5 A;  4YP3 A;  5KNI A;  8ICO A;  5FK9 C;  1OTR B;  4WJO A;  1OFF A;  3ZDA A;  4YXD B;  2G08 A;  7ICS A;  4JUZ A;  3D32 A;  1GUA B;  3RNB C;  2WQY B;  4RPX A;  1WRI A;  2DX5 B;  2K8C A;  3S6J A;  4MEL A;  1WGD A;  4NLN A;  3UMB A;  3VUY A;  2KT7 A;  4I2E A;  2LBO A;  4LJX A;  4IM2 A;  2V1Y A;  4JWS C;  3E2E A;  4NWI A;  4IUM B;  2MUT A;  1C20 A;  1QSY A;  2NO5 A;  1XF5 L;  5HHI A;  4DF4 A;  2EH9 A;  4PH5 A;  2A19 A;  3AV8 A;  2RMM A;  3A33 B;  2Z59 B;  4ZHO A;  1YQ4 B;  1I4Q A;  1XSL A;  1ZQN A;  1UT8 A;  3ZO5 B;  4M8M A;  4TUP A;  1NYQ A;  3CMM B;  5DPW A;  4LJP B;  4HDQ A;  2K6D B;  5HKH A;  2KDB A;  5AK5 A;  1JWS D;  3W5V B;  2MSN A;  4UAT A;  2EMT A;  3R3M A;  3WKA A;  1NZB A;  5J0Q A;  2AXT U;  1NK4 A;  4W9L A;  2WHI A;  1D5X C;  2F1I A;  1YJJ A;  1F2R C;  3TCA A;  2R2Q A;  2Y5P A;  3GV7 B;  2GWS A;  3ZTD A;  4WUR A;  2KVR A;  3PW2 A;  2O6V D;  4YL8 A;  1BNO A;  3MR6 A;  8ICV A;  1FXI A;  4MGK E;  2JV3 A;  4IQV A;  4Z6D A;  5C5J A;  1UA0 A;  3URY A;  1A77 A;  4M00 A;  2C2R A;  1V2Y A;  3OAW A;  4HKQ A;  4F1S A;  3PNC A;  5F9N A;  2MCN B;  3QAQ A;  2AQ0 A;  1VZ6 A;  4GIB A;  4ZRQ A;  2K8B B;  3MAB A;  3LB8 C;  4RNN A;  1KOT A;  2C2E A;  2LKY A;  4DSF A;  3DDH A;  4I2F A;  1LKY A;  5D2M B;  1JRO A;  4PS3 A;  1TKY A;  2BKR B;  2CHZ A;  2J7Q B;  4KGR A;  3NJT A;  1V86 A;  3Q8B A;  2PFO A;  4MEM A;  3VH3 B;  4P1C C;  4M47 A;  2HVI A;  1ZD2 P;  2HW3 A;  3BDP A;  4F4X A;  1MA7 A;  2OED A;  4ICV A;  2W9B A;  2H3I A;  4RT2 A;  3HT3 A;  1AWD A;  4AJW A;  2B21 A;  2KIV A;  2ZIW B;  5KG1 A;  1SXD A;  3ML8 A;  3P4P B;  2L5Y A;  9ICK A;  1L5P A;  4B95 A;  4JL9 A;  1E8Y A;  1YT3 A;  3IG8 A;  2R8H A;  1X9S A;  4NAM A;  3N9Y C;  4EZ9 A;  3ZRC A;  4CE6 A;  3TFR A;  2WXM A;  1WGK A;  3QUT A;  1K51 A;  4RQ2 A;  1Y56 A;  2HJ8 A;  2W3R A;  1QF6 A;  4WAA A;  2KN4 A;  3C2K A;  5C2T B;  1WM3 A;  1HJP A;  1C76 A;  2D8C A;  4AYB C;  1DOI A;  1PZN A;  2K4I A;  1I4R A;  2QMT A;  2KHQ A;  3AED B;  1EM7 A;  2XCA A;  5BYS A;  2JT4 B;  4M9H A;  3H4B A;  2W54 A;  3M6K A;  2DZI A;  2LYA A;  1URJ A;  4P0P B;  3AE4 B;  1T3Q A;  3AU5 A;  1H4R A;  8ICJ A;  1Q3V A;  3N1Z C;  4KX6 B;  1Z00 B;  4Z6F A;  3IP4 B;  1RLF A;  3R66 C;  3KUZ A;  2ESE A;  1OEY J;  4K3C A;  2MQJ A;  4NY0 A;  2KIW A;  2OH2 A;  9ICT A;  3SDL C;  1XNS A;  4BWJ A;  1SXE A;  4KLF A;  1P1A A;  4QWC A;  2HOI A;  1A5R A;  2LYB A;  2BDP A;  2GB1 A;  3MGI A;  1NI2 A;  4C4S A;  1GNU A;  2KLC A;  3LDZ E;  1ECW A;  5T8I A;  2XVT A;  2G07 A;  4FXC A;  5KFY A;  3TEX A;  4EEY A;  8ICU A;  3IAM 1;  5J0X A;  1ZD3 A;  4P0P A;  1WGG A;  1HXY D;  2ZIX B;  2KOX A;  5AK3 A;  1E6E B;  3RJG A;  3MTN B;  3H4D A;  4A6Q A;  2E6X A;  4UAY A;  3L3F X;  4BXO A;  5J8Y C;  1KFS A;  2CU1 A;  2N7J A;  4XC2 A;  5ALF A;  5CTR C;  4FFD A;  5ALZ A;  5J2C A;  3ZDD A;  4EBE A;  2KK8 A;  4E3C A;  3RN9 C;  4IG7 B;  5CWR A;  3R2I A;  2LGI A;  2QCZ A;  2VAN A;  1E9M A;  2KQ7 A;  3C5F A;  4IS7 A;  2D10 A;  4B9V A;  1WXM A;  5KT3 A;  1D5M C;  2MBQ A;  1OGW A;  4XDC A;  5AZG A;  1XLN A;  1C4C A;  4JE3 B;  2KQ4 X;  3Q3O C;  2XIC A;  2J6U A;  4ECS A;  1HIW A;  3AL0 B;  5BYR A;  3FYH A;  3K4G A;  4UW9 A;  5B5E U;  1WWU A;  4BBN F;  2NPT B;  4B0M A;  1KFT A;  2MEK A;  4DQR A;  3L16 A;  1KLN A;  2PLP A;  2W9B B;  1U48 A;  2MBE A;  2UVV A;  1RXW A;  3APF A;  3PV8 A;  1R7S A;  4UBB A;  2MH7 A;  2SAK A;  3AE9 B;  4LNF A;  4RQ7 A;  2LAS A;  2L52 A;  2HHU A;  3P4R B;  2Z7J A;  4CDG A;  5AIC A;  5CHV C;  1H8C A;  1TS5 A;  2JH1 A;  1CQV A;  2DF4 B;  4RQ5 A;  3UPQ A;  2WF6 A;  4F5R A;  2PI4 A;  4DSL A;  2QDF A;  3TAD A;  1J2M A;  5BOL A;  1R4M I;  4HPP A;  3W1Y A;  2V4Q A;  1ARO P;  1ZW7 A;  2IO2 B;  1V1O A;  2M56 B;  3QIJ A;  4W9J A;  4DDI D;  1NJW A;  3DWM A;  2AQ2 B;  2IOF K;  4AYB F;  1YN5 A;  2JYE A;  4P4P A;  3AU2 A;  2W7O A;  1N48 A;  3ISB A;  4B9K A;  4Y2T A;  5EWF A;  3PML A;  2BR0 A;  3AE3 B;  4B6J A;  1TS2 A;  1ZQZ A;  2DKX A;  4GMV A;  5EWG A;  2E5S A;  2XO7 A;  3MGH A;  4HPM B;  2NR2 A;  2IND C;  4C7Z A;  2CXY A;  1X1M A;  2OWO A;  4I6N B;  4Q8E A;  3AXC A;  3DCG A;  4IM0 A;  3IN5 A;  1BT0 A;  4ZYS A;  2YN4 A;  4FZN A;  2GOL A;  1QSS A;  3C2M A;  4II2 B;  1L0X B;  5J0R A;  4IQW A;  4A90 A;  1ESF A;  4B0E A;  1WI0 A;  5J18 A;  5FP0 A;  1ZQG A;  2KZM A;  2CS4 A;  1JXE A;  4IKG A;  2I2Y A;  2YMQ A;  4K7S A;  8ICI A;  3H7S A;  4EUT A;  4UAS A;  5DBA A;  4XZ4 A;  4BOS C;  3PHW B;  1ENF A;  1WMH A;  3ZW3 A;  2PPH A;  4HK2 A;  4DS4 A;  3ENE A;  4Y2J A;  3AU6 A;  4EEL A;  5ALO A;  1FXT B;  4IC9 A;  4J9L A;  1FD6 A;  2KN7 A;  2HOQ A;  3H1U A;  5CR0 A;  4F5P A;  2IBI B;  2VH1 A;  2VA2 A;  1ZDV A;  4O3Q A;  4KLU A;  3QWZ B;  4FLH A;  3ZD9 A;  3A1Q B;  5J0U A;  2KMC A;  2MJ3 A;  2RP5 A;  4W9F A;  1NI3 A;  1RZT A;  4K4I A;  2G4S A;  3GV5 B;  2XY7 A;  1Q46 A;  2C9W B;  3ALB A;  1JAL A;  4DQS A;  4K7W A;  4PPX A;  4O5E A;  4DHJ B;  1XCT L;  4NNJ B;  2PXI A;  4Y2Y A;  2WF8 A;  3GZN B;  4RNA A;  1ZD5 A;  1L5U A;  2VZK B;  3AE1 B;  4ECU A;  3AQF A;  4I2H A;  1ZOY B;  1TKE A;  2ISO A;  1HEZ E;  1PK1 B;  5ALY A;  3H8M A;  2F1J A;  5AKK A;  2EZX A;  3WK6 A;  2EAM A;  4RQ8 A;  8ICW A;  1GG3 A;  2JXT A;  1D5Z C;  3Q8A A;  4NPN A;  2DZK A;  5IIO A;  1ZQW A;  2E8M A;  3BS7 A;  1KBU A;  3EUB 2;  5L95 C;  3KHR A;  5IOI A;  3RR7 A;  3H6N A;  3TKA A;  3JPT A;  5EE3 A;  2LFI A;  2M8S A;  3E9S A;  5BPC A;  7ICM A;  4YT0 B;  1OQQ A;  3BII D;  2NRX A;  4CGZ A;  2QJL A;  4LDT B;  3C29 A;  2INN E;  3V7L A;  5AKL A;  2ASD A;  4OJP A;  4R65 A;  2CRX A;  1QSL A;  4NY8 A;  5KG6 A;  3C5G A;  1L7Y A;  2E3T A;  2ZIV B;  9ICC A;  3AUO A;  5J2A A;  3TAQ A;  4B9N A;  2EMS A;  1YQ3 B;  5J0T A;  2B3A A;  3DDC B;  3WCQ A;  5AKE A;  5HNK A;  3OHB A;  2UVW A;  1TIF A;  2KXJ A;  4RQN A;  3KUC B;  3QE9 Y;  2K22 A;  3E58 A;  3NS1 A;  4KIK B;  3NZS A;  1OEY A;  3PMN A;  2WU5 B;  3MP9 A;  2P35 A;  3VC8 A;  3JW0 X;  4M8N A;  4WWO A;  2FLN A;  2IYD B;  3EYZ A;  3T3N A;  2ZJ5 A;  5TIS U;  4QJF B;  1JRU A;  4L2Y A;  3VFK A;  8ICM A;  3M8R A;  1QTM A;  3Q14 C;  1SWV A;  3EWA A;  2F76 X;  2KK0 A;  2LJ5 A;  1NKB A;  3B0A A;  3MJ5 A;  9ICJ A;  4TUR A;  2KTF A;  4RPY A;  3RR8 A;  2KNJ A;  3M62 B;  3BS5 A;  1V9J A;  2Y0S F;  3PO0 A;  3FKY A;  1U4A A;  4ZOH C;  3U2S C;  4NJ8 A;  1TVA A;  1YX5 B;  1NDD A;  2BCQ A;  2W9C A;  2F77 X;  4QWD A;  1L3V A;  3RJI A;  4QZE A;  2FID A;  1FRD A;  1JWM D;  2RDH A;  3HKZ F;  2BS3 B;  4YSX B;  4TSS A;  4NJC A;  1SL1 A;  9ICQ A;  5ALD A;  1XEE A;  1J2N A;  2WXR A;  5D4B A;  2BKF A;  2BTE A;  2KWV B;  2XN9 C;  2B0C A;  3B08 A;  1TS4 A;  2RDJ A;  2J6S A;  2LXC A;  4LZD A;  4CCH A;  2FBW B;  3Q8M A;  1GAQ B;  1RDF A;  1WX9 A;  3MFG A;  3D2Q A;  3NY5 A;  4OJ5 A;  2KWC A;  1N60 A;  4QIW C;  8ICR A;  4P0Q A;  4RZR A;  4DXG A;  2ZUD A;  4U6P A;  3Q8E A;  3SU8 X;  3SFD B;  1J19 A;  3BZC A;  4U7C A;  4KVG B;  1XO0 A;  2N1W A;  4DFD A;  1TTN A;  1IGC A;  1IM4 A;  8ICY A;  2BW2 A;  2D3B A;  5BMH A;  4EX7 A;  2MHJ A;  5AHX A;  5J8Y A;  1JWU D;  1QQR A;  2C60 A;  3N30 A;  3OWE B;  2DUY A;  3DBH I;  1I4X A;  2ASJ A;  3ISC A;  5DQH A;  3H8J A;  2KWD A;  2NS5 A;  5KFX A;  1EU4 A;  4C8N A;  1V81 A;  4WWP A;  4BX9 C;  2BYE A;  4LJO B;  4ZYN A;  2LRW A;  2FCS A;  2LGD A;  4MAC A;  2KHV A;  1SE3 A;  4GFJ A;  2IJ0 A;  5TR5 A;  4HJK A;  1SV0 A;  4KN7 A;  1DK2 A;  4A20 A;  1AW7 A;  3BJY A;  1YD8 U;  2CJN A;  3RAX A;  4LNK A;  2WNM A;  3RBD A;  2DAF A;  1OW5 A;  2Y9T A;  2KEY A;  4YXM A;  3P4S B;  3A9J A;  4KLG A;  1P7E A;  2F44 A;  4AS1 A;  4OVU A;  4A55 A;  2A1A A;  1D9D A;  3WAL A;  1SIJ A;  3H0M B;  1HZ5 A;  2BT6 A;  2GH1 A;  5KFD A;  3FM9 A;  2BGW A;  1NEN B;  2BGF A;  1GB1 A;  1NK0 A;  2QB1 A;  4EEW A;  5KL1 B;  2DHZ A;  1S76 D;  2WF7 A;  4I6P A;  3L17 A;  4K7U A;  3IXS A;  4HXD A;  3M95 A;  3N1Y C;  5DGB A;  4ECZ A;  3QU5 A;  1N56 A;  3NGD A;  3V7K A;  4XDD A;  4ARI A;  2WHE A;  2WXF A;  3RB3 A;  4C8M A;  4RGN A;  5ALN A;  3H7I A;  2JSV X;  4R3D A;  4BKT A;  2J6T A;  4YFK A;  2WAQ F;  1TKD A;  4DSK A;  1ZQY A;  2BKE A;  4C0Z A;  2JVC A;  4OO1 J;  2N7D A;  5FKA C;  1IGD A;  2EAP A;  2ZXI A;  1GC7 A;  2AQ1 B;  2NO4 A;  2KTR A;  2M9N A;  2ZTE A;  3WAN A;  2FE9 A;  5AIB A;  3SEN A;  3BQ1 A;  4XQ8 A;  4C80 A;  4J9K A;  2DWQ A;  1RYJ A;  1JWB D;  4RGO S;  3RNE C;  1L7M A;  4KLE A;  2K3U A;  5DPS A;  1WGR A;  1DRG A;  8ICF A;  2LEK A;  5GTI U;  1EWY C;  5IO9 A;  2LMC A;  8ICA A;  4ASW C;  2G1E A;  3DVN U;  2VJ5 A;  1HE8 A;  3QJZ A;  2C28 A;  9ICU A;  3KTQ A;  2N9E B;  3NVV A;  2YML A;  4IW0 A;  3GOE A;  3ORY A;  2WXQ A;  1E8W A;  1YZ7 A;  3APD A;  2AGO A;  5ALG A;  2BS4 B;  4C00 A;  4GDK B;  1Z1B A;  3VUX A;  3F2B A;  4LLG M;  3KKA A;  3T5H A;  4HKZ E;  5KFV A;  4GIV A;  3AEC B;  2DYB A;  1QCK A;  4QZD A;  4B9T A;  4OVZ A;  5E6P A;  4WWM A;  2KSO B;  4ELU A;  4KDL B;  5AI6 A;  1RYR A;  3RF9 A;  2IGG A;  1NEK B;  3I5J C;  3N28 A;  3ECI A;  4KLS A;  2BPF A;  1AQ6 A;  2WXL A;  4LNO A;  1Z4O A;  3Q8C A;  4YR0 A;  2BCU A;  3JYU A;  1Z1V A;  2HHT A;  4Y2S A;  4MEY A;  4MGI E;  5ALW A;  2KX3 A;  1V5O A;  2F8L A;  2L32 A;  4GXB A;  4KLI A;  4O3P A;  2C7M B;  2KX0 A;  3SV3 A;  4CYE A;  2MRP A;  4FO6 A;  1IXR A;  4GU2 A;  2ES6 A;  5IIJ A;  4JPS A;  1HTO A;  2QKQ A;  4AUQ C;  2BB6 A;  3A9K B;  3RFA A;  1EXN A;  3FAH A;  3QNM A;  1FCC C;  2GBN A;  2KSO A;  1ZQT A;  2MLB A;  3KOO A;  5JH5 C;  4KLJ A;  2K8H A;  5DBC A;  1J97 A;  1V38 A;  2YMP A;  5AM4 A;  2AU0 A;  2ZJD A;  1TGZ B;  2E1F A;  2BWF A;  2JYT A;  3OTQ A;  5KFC A;  2N1V A;  3H8W A;  1EU3 A;  4QZH A;  2CU3 A;  2LZ6 A;  2LGS A;  5G2N A;  3W1S A;  3D6J A;  5JTI A;  1TKG A;  2VA3 A;  3DBL I;  4ED6 A;  1S10 A;  3TAN A;  4OJL A;  5KFR A;  1MJD A;  4R8U B;  3L0W B;  2I38 A;  2N9K A;  4I2J A;  2W82 A;  4KSK C;  1ACC A;  4BKS A;  1JI7 A;  1B43 A;  1RG6 A;  2H89 B;  3Q3F A;  1RM6 C;  2LVQ A;  3VHT C;  3TL5 A;  2MA1 A;  3IM1 A;  5J0P A;  1WSP A;  2ZNV C;  1IPG A;  5E6J A;  2BYF A;  2D5G A;  4KIK A;  3BQ0 A;  1IIP A;  1ZRN A;  4CF4 A;  4GB9 A;  4PHA A;  1X9X A;  4TQ0 A;  2L83 A;  4C4R A;  1IUE A;  3AEF B;  2V9W A;  4PHP A;  4RUC A;  3ZI4 A;  4UB5 A;  3W2D A;  1ZQU A;  5E6O A;  2NBW B;  3MR2 A;  1CEZ A;  1D6E C;  3BVZ A;  4EZL A;  4P6V F;  5AUK A;  1N62 A;  1ZQQ A;  2IOH A;  5JU5 A;  4XWT A;  1L0Y B;  2ICI A;  2IY0 B;  2LD9 A;  2Q4T A;  4RM8 A;  3I28 A;  4MH0 E;  2BPG A;  1PGB A;  4FN2 A;  3QCA A;  3LVW A;  2WXN A;  4XYC A;  4G50 A;  4YD1 A;  2LHD A;  4KV2 A;  2GBM A;  3MHS D;  1UF0 A;  2IO3 B;  1E7U A;  2DKZ A;  5KFS A;  4KLQ A;  4ED0 A;  1B22 A;  1V97 A;  9ICH A;  4G3I A;  5ALR A;  4GLS C;  2JH7 A;  1SV0 C;  4M02 A;  2WYQ A;  4DL6 A;  4MJS B;  2EQY A;  2FMS A;  3O0F A;  4DOB A;  1Q5W B;  1L7P A;  2M17 A;  3B0Y A;  3GFK B;  1XO1 A;  3PTF C;  1HEK A;  3WU2 U;  1L4D B;  2D3D A;  1SKS A;  5C23 A;  4F8R A;  1YMH E;  2QSD A;  4GSW A;  2OM6 A;  4BJQ A;  1I4P A;  4F7Z A;  4I28 A;  1BNP A;  1SE4 A;  1I42 A;  4JQW C;  2F8K A;  1QOF A;  4F2R A;  3N7S C;  3Q8P B;  2VA8 A;  2DAJ A;  4KLT A;  2Y5C A;  1SZH A;  5A0L A;  2OJW A;  1TBE A;  2PMZ C;  2FCM A;  4DDG D;  1LQB A;  3N97 B;  1UPH A;  4KLO A;  3I9V 1;  3PRM B;  3LVV A;  2L8J A;  2UWQ A;  2QLT A;  5AI9 A;  1O03 A;  2KAJ A;  4EFO A;  2LHT A;  2YTU A;  1WJ6 A;  3G6X A;  1QOA A;  5D49 A;  4S17 A;  2E1E A;  1ZQS A;  5CHF A;  3U30 A;  1QIL A;  4P4O A;  3UQB A;  1NYR A;  3AEB B;  4ED8 A;  1P0R A;  4NAW A;  3PHX B;  4MJS A;  2ODG A;  2XCP A;  3KD3 A;  5D94 A;  4XE0 A;  3AE5 B;  1MQ3 A;  1KTK A;  3PX0 A;  1SKW A;  1AN8 A;  1N61 A;  2WF9 A;  4HRS A;  4DO9 A;  4J9M A;  5ALK A;  5AKZ A;  1T0Y A;  4US8 A;  1AAR A;  2RR9 A;  2K8B A;  1RXV A;  4PK1 A;  4NLK A;  2BF8 B;  2I1K A;  4HAI A;  3LK9 A;  1Q10 A;  4HCN B;  3F5E A;  1J7C A;  3C0R B;  2AHO B;  1L7N A;  5J0W A;  2Y3A A;  4A3P A;  1RRB A;  2W9C B;  3VR9 B;  1GC6 A;  4OJO A;  1BML C;  3BK2 A;  1UWX A;  3WKB A;  1PK3 A;  4DSE A;  5KFJ A;  7ICI A;  3AE6 B;  2KZR A;  3RT3 B;  4K81 A;  2JEG A;  2DFL A;  1X6J A;  1PK1 A;  9ICV A;  1E7P B;  4IM3 A;  2XID A;  2PKO A;  1OUQ A;  2D3C A;  2QAR A;  2JGA A;  1U9L A;  2L0F A;  4JWU C;  2ZIW A;  5KFP A;  4ECT A;  2L1A A;  4PJ0 U;  1D3Z A;  1YOV B;  1Z2M A;  3I76 A;  4B6W A;  2W04 A;  1XCQ L;  3TSS A;  5CEH A;  3A0H U;  5DKW A;  1PVQ A;  3AE2 B;  4J9N A;  2QC8 A;  3TAP A;  3HP6 A;  1S0M A;  4JV0 A;  9ICG A;  3KBB A;  5CP2 A;  1ZE3 D;  3P63 A;  4QZ9 A;  3PR4 A;  4KZC A;  1ZQI A;  4C8L A;  2JZ3 B;  1S97 A;  2BQ3 A;  3DPD A;  3FIL B;  2WFA A;  5DB6 A;  2V4L A;  3SMV A;  3PRP B;  3MC8 A;  2KV2 A;  2WU2 B;  3QUC A;  3M3J A;  2QEJ C;  2EDU A;  3ZDT A;  3H7P A;  2JF5 A;  1NKC A;  5DDY A;  5KG2 A;  3DVG Y;  1ZQJ A;  4NLB A;  1HTQ A;  2V9H A;  2HHQ A;  3EZ5 A;  4EKU A;  4M01 A;  5IIN A;  3IHP C;  4QNL A;  3K1Z A;  3DHH C;  3WKC A;  2BBC A;  1XSP A;  3L08 A;  9ICR A;  1BPE A;  1FFU A;  3PX4 A;  1FRR A;  1YNT E;  2DLB A;  5H92 C;  7ICG A;  4ACO A;  4IRK A;  2JY6 A;  3UQ2 A;  3KYC D;  2HI0 A;  4ED2 A;  4II3 B;  5KFM A;  3HM3 A;  1WR1 A;  3WAP A;  3N7P D;  3BYT B;  1EWC A;  2AYO B;  4UAW A;  1Z19 A;  3ZDB A;  2QB0 A;  4O0I A;  3V60 A;  1E0Z A;  3BQ2 A;  3TJP A;  3OG5 A;  3H7P B;  1JX4 A;  5I4D A;  1NK9 A;  1SSN A;  4A8X C;  2FUH B;  2OJR A;  9ICE A;  2KD0 A;  1RYS A;  4Q8F A;  3PGE A;  3SD5 A;  2L7R A;  1DGJ A;  1X66 A;  1T8E A;  7ICT A;  2HHW A;  2PI5 A;  1T0R C;  4NLZ A;  5AKI A;  2G5H B;  3GS2 A;  3C1Y A;  4L1B A;  2IDY A;  1PVP A;  1C7Y A;  3QEA Z;  2DEN B;  1MSW D;  1RQN A;  2XGP A;  1NBF C;  5KT2 A;  5DBB A;  5L83 A;  1PGX A;  1L4Z B;  4M0W B;  3PV1 A;  4DHZ B;  2IO0 B;  5J2H A;  2K6Q A;  4RT3 A;  2HBL A;  3CSF A;  2JRZ A;  9ICS A;  4RNM A;  2KAN A;  1E8X A;  3A0B U;  1F0M A;  2Q0Z X;  1YIW A;  3RB4 A;  4Z6C A;  4W9K A;  2WDV B;  2AL6 A;  1SZP A;  4TUU A;  5L1K A;  2XNA C;  3PLV A;  4ZRP A;  4C8O A;  3CYM A;  3SV4 A;  2WDR B;  4DSJ A;  2NTT A;  1S3S G;  9ICN A;  2KWU B;  8ICL A;  2D6F C;  1MC8 A;  4M9N A;  2NPT A;  3Q3J A;  3Q3N C;  1J8C A;  5AI4 A;  3P2B A;  1V1P B;  1L8O A;  2GLE A;  2L3Z A;  2KJH B;  3RI7 C;  3ETR A;  3BVG A;  3HK0 A;  4P16 A;  4CRX A;  1D4B A;  2LRU A;  5KAI U;  1R4N I;  3PO4 A;  2AL3 A;  1Q3U A;  4ITK A;  1RPL A;  1C77 A;  2J0J A;  3W1S C;  2X8X X;  2ZPN A;  3GE3 C;  1L8L A;  4N59 A;  4DWI A;  5J2F A;  3DBL B;  4JV1 A;  1E5W A;  3J9C A;  3RNC C;  2WB1 C;  1TAQ A;  3RJE A;  2KDE B;  5KG4 A;  3FIL A;  4YTP B;  3RB0 A;  3QC8 B;  3R8B A;  1S9F A;  4GDL A;  4K4G A;  5BMI A;  4GXJ A;  2AX5 A;  2Y9U A;  2NRW A;  4USA A;  3RPF C;  2L05 A;  2M0A A;  4NL9 C;  1TAM A;  2M1M A;  2H3Q A;  3ZRF A;  2HE7 A;  3QK0 A;  4BKG A;  3NRZ A;  4YVZ A;  4W9H A;  2NTS A;  2BWE S;  3AMZ A;  5J0O A;  4KLD A;  1JMS A;  2DYO A;  2MBH A;  2I9G A;  8ICN A;  2INC C;  2KN5 A;  2WP9 B;  2WXH A;  1NJX A;  2ZCB A;  2INP E;  2C7H A;  3DV9 A;  4F8C B;  2ZUC A;  4P1B C;  1COO A;  2CPR A;  1XSN A;  3NVZ A;  4O3N A;  2ZW1 A;  1TK5 A;  1JN3 A;  2KMD A;  2KDI A;  2W11 A;  4WQM A;  4FJZ A;  4UB6 U;  1S5L U;  2G5I B;  4F91 B;  4Q45 A;  4R63 A;  2R8G A;  3OSP A;  2IGD A;  3ZJU A;  5KFW A;  3MDC A;  2HMX A;  1Z4N A;  2D3G A;  4JGH B;  1KW4 A;  4Y2P A;  2GRI A;  3F2C A;  1QOG A;  2YEP F;  4P0Q B;  2W7P A;  3L4P A;  2HD5 B;  2CHW A;  4M6W A;  4J3O D;  4ZH4 A;  1V49 A;  3KYD D;  1JW9 D;  2IHN A;  1K8R B;  2ZCC A;  5KT7 A;  4PGX A;  4TUS A;  2IOF A;  3IDW A;  5HP4 A;  2WAQ C;  2N0S B;  3PX6 A;  5AZH A;  2NV3 A;  2W55 A;  1SF0 A;  2MSE D;  3HIL A;  3BYY B;  4J9S A;  3QX7 A;  1WXV A;  3S2A A;  4RH6 A;  4DQI A;  1TK8 A;  1UZX B;  2KD1 A;  2NBU A;  2LM1 A;  3RB6 A;  4FBT A;  2V3P A;  1XLQ A;  3BK1 A;  3V3X A;  4KN4 A;  3UIO B;  2FE8 A;  1KDH A;  2PFP A;  1NNL A;  2PTL A;  4EYH B;  2CN1 A;  4UB4 A;  5F3X B;  3M63 B;  1BPD A;  3HKZ C;  3H8S A;  4O5K A;  8ICT A;  4E74 A;  3W9C B;  4UQG A;  5ALS A;  2FCN A;  3U7D A;  3SEB A;  4UAU A;  9ICF A;  3TAC B;  3K9O B;  2M0N A;  3C23 A;  2KFN A;  4A8E A;  9ICI A;  2I1J A;  4WAF A;  1PGA A;  1QLB B;  1V8C A;  1DOY A;  1NZP A;  3L10 B;  1WWV A;  3LWL A;  5J2J A;  3PST A;  4DFP A;  1ZQD A;  1WJ4 A;  2JUO A;  3LDA A;  3KWL A;  4IC7 B;  2RRD A;  3ABV B;  2KFZ A;  5HHD G;  5KFG A;  4F4K A;  4WJ3 B;  1ZQX A;  2J4X A;  4QZF A;  4RQ1 A;  1KH0 A;  2PFN A;  3EPG A;  2XY6 A;  4NM2 A;  2P6R A;  1FM0 D;  1PUT A;  4KSL C;  2AQ3 B;  4PGQ A;  2D2Q A;  3SAG A;  4FHK A;  3T5L A;  4HWI B;  4W9G A;  7ICL A;  3SQI A;  3R9K A;  1B4F A;  2KOB A;  1H38 A;  3UXO A;  1ZQF A;  4CNQ A;  2DYM A;  2JWU A;  1QQ6 A;  1D8Y A;  3GQC A;  4NLG A;  1SJE D;  1A70 A;  3RUL A;  4I6L B;  4PHE A;  5ALE A;  1L3T A;  2I5H A;  5KFU A;  1KEJ A;  8ICX A;  4C8K A;  4MM3 A;  5IA7 A;  2KJ8 A;  1L6N A;  2W3S A;  3UM9 A;  4BUG A;  1F77 A;  1S8O A;  3U26 A;  3SZ2 A;  1ZGU B;  3ZD8 A;  2WLB A;  3GE8 C;  3I57 A;  3M1Y A;  4YXJ A;  1S0N A;  2DPI A;  3ZVV A;  3WKE A;  3ZLZ A;  2BPS A;  4EZ6 A;  4YSZ B;  2KVS A;  1FCL A;  4M0W A;  1IBX B;  1MQ2 A;  2KNB A;  5BO4 B;  2UVU A;  3PSE B;  9ICW A;  2RDG A;  3IV6 A;  4IWO A;  5KFT A;  3D2N A;  1YN4 A;  1KKX A;  2G4D B;  3QU4 A;  1O08 A;  4QZB A;  2KKC A;  7ICN A;  4PS8 A;  4YCX A;  4QZI A;  4KMO B;  4DXA B;  2FI1 A;  3TI0 A;  5AKY A;  3IAS 1;  4RM9 A;  1XU4 A;  1T3N A;  1T0Q C;  1ZQ1 C;  2LVP A;  4HEA 1;  2V4R A;  4XX5 A;  1TJE A;  1F52 A;  1ZQH A;  2ZIX A;  3WAM A;  2JZP A;  5CX3 A;  2RSU A;  2MU2 A;  3OJ3 A;  2GBJ A;  2FLP A;  1WCL A;  5KFL A;  1NK6 A;  1SEB D;  4DOC A;  1ZJM A;  3RD2 A;  4OCZ A;  4MF2 A;  2JWZ A;  4LNN A;  1S1Q B;  4F2S A;  2BCS A;  4F71 A;  5J2G A;  2CHX A;  3PZD A;  3GP7 A;  4WJQ A;  1ZET A;  2VZK D;  4E71 A;  3D2S A;  3HIZ A;  1SWW A;  2MWS B;  2WDQ B;  5AK6 A;  2FPM A;  3DOW A;  1WE6 A;  4IL6 U;  2MP2 B;  3H40 A;  2EZZ A;  4MFA A;  8ICC A;  4ECX A;  1OXJ A;  3AEV A;  4G3X B;  2A4Z A;  3SYZ A;  2Y5B B;  4ARC A;  5DB7 A;  5HR6 A;  2W43 A;  1GPX A;  2FMQ A;  4KGT A;  3BZK A;  4TUQ A;  3HVD A;  2CKH B;  5C0Y A;  1WJU A;  1RFA A;  1SIF A;  1R4M B;  4M0A A;  2QHO A;  1IYF A;  1RQL A;  4NJ7 A;  2BYT A;  3PRZ A;  3NVY A;  2KIC A;  3RJJ A;  5ALV A;  3ED5 A;  4DL3 A;  4DHJ D;  1CMX B;  3JSV A;  2AQ4 A;  3NRW A;  3BQT A;  2KC1 A;  4LNI A;  2UVR A;  4OW0 A;  3NOB A;  1F5S A;  1V6E A;  3VAW A;  3KW5 B;  3HX0 A;  3UMG A;  2BYV E;  5AKH A;  4RQ3 A;  1I7H A;  4R8U A;  4DQO C;  1E90 A;  1ZPS A;  3BS5 B;  5KTQ A;  1EF1 A;  5AK4 A;  2LUM A;  5E6N A;  7ICF A;  5T14 A;  3RMK C;  3OGU A;  2HBM A;  2JQR B;  3V05 A;  1C4A A;  5CHG A;  4BBN C;  3MJW A;  3DHG C;  1ET6 A;  1KF6 B;  2JEJ A;  5DPT A;  1JUD A;  1V1P A;  1MHX A;  2LVO A;  5ALT A;  3KKA C;  5JXV A;  5G55 A;  3JPO A;  2ATL A;  4CHK A;  1ZQO A;  2AH5 A;  4RU9 A;  4DK5 A;  2H3V A;  2QIL A;  3HUI A;  4PGY A;  3KHG A;  4DL4 A;  1G6J A;  5J17 A;  5CB1 A;  3ZNI D;  2LI6 A;  2JXX A;  4UBC A;  5AI0 A;  5DGA A;  1IBX A;  1KLG D;  4JK1 A;  3ISD A;  3WK4 A;  2IBK A;  1WZ0 A;  3EEC A;  2I1Q A;  1YX6 B;  2YQE A;  3RJH A;  4WJN A;  2EZY A;  2R8K A;  4YTM B;  4DXF A;  3UXN A;  2IZV B;  3K9P B;  2X38 A;  4IRC A;  3FDS A;  1XT9 B;  3VUW A;  1TV9 A;  2WX1 A;  1GO3 F;  1ZQC A;  4JWM A;  4WIP A;  3A4S C;  5HHH A;  5KHO A;  3QEB Z;  1P9D U;  3R7Q A;  4LK0 M;  2DBY A;  2PEA A;  4C4T A;  3DBH B;  3M9N B;  1UHU A;  4FBJ B;  2KHW B;  1GJZ A;  4J6I A;  4KLM A;  2LGY A;  1N5W A;  3APC A;  4RF1 A;  4RQ6 A;  9ICB A;  3X23 A;  1YJ1 A;  4EOY A;  2IPK D;  2MW5 A;  3KQ4 A;  3B1L X;  3RJK A;  5AKG A;  3MFH A;  1WF9 A;  2IY1 B;  3AB5 A;  8ICK A;  3EGR A;  2A1J A;  1U45 A;  1N6Z A;  3PW7 A;  5KFE A;  2UYZ B;  3VXW A;  5AM2 A;  5KT6 A;  2IA6 A;  1XXG A;  3ZUN A;  3QHT A;  1ZQV A;  2YX8 A;  3WK7 A;  3WIM A;  4CQN A;  3Q2A C;  4Y2Q A;  4LZG A;  4HDO A;  1TFR A;  4ICU A;  1UQV A;  2A3V A;  3DHI C;  1ZQP A;  4GC7 A;  4QW9 A;  1FPY A;  4J03 A;  4RMA A;  2PKE A;  5KFB A;  5ALX A;  2FMP A;  4C4V A;  3LWM A;  4C56 C;  1ZRM A;  3MR5 A;  1UEL A;  4BKS D;  3DBR B;  2BB5 A;  2AJQ A;  4MFC A;  1LVH A;  3Q6B A;  1NOM A;  4NLC A;  3TEW A;  3MC0 B;  5L9X A;  2A1J B;  4MEX A;  1Z5S B;  4O3M A;  4I2B A;  2ZXH A;  2KZ3 A;  2ZVO A;  1DXS A;  1RAX A;  1WJN A;  4DCC A;  4ZDV A;  3M6Z A;  5J0S A;  5AUI A;  2M0X A;  4TMA B;  1FFV A;  4UB3 A;  4YMM A;  3FC4 A;  4GDL B;  1A6S A;  2EAO A;  1WFY A;  4G9B A;  2L76 A;  4Y2V A;  3Q8K A;  3H9D A;  3DVG X;  2OXO A;  3RRH A;  1IP9 A;  2HVH A;  4I27 A;  2MX2 A;  5EOZ A;  5J2R A;  2PVG C;  4N6E B;  1KRP A;  4MH8 A;  4OD0 A;  2FAZ A;  1MHH E;  2LGX A;  3KH0 A;  1NJY A;  1FXA A;  3EFU A;  4XA5 A;  5JHA A;  1HUZ A;  2W9A A;  2Z0D B;  2B6G A;  3L5K A;  3JPR A;  4EYI B;  3HPO A;  1SGG A;  1UT5 A;  5JUM A;  2FPL A;  1CZP A;  4UAR A;  4YMO A;  1V80 A;  4HRO A;  2GMI C;  5TZV A;  1LFD A;  2ACZ B;  2E8P A;  1SE2 A;  4D2K A;  5J2I A; 
#chains in the Genus database with same CATH homology
 4C7Z A;  2WXG A;  3AE2 B;  5HFY A;  3HVZ A;  1J7A A;  1WYG A;  1LO5 D;  4ZYS A;  1ZE3 D;  3P63 A;  4REZ A;  1L0X B;  4MT5 A;  4A90 A;  3TEY A;  1ESF A;  3FIL B;  4B0E A;  1N5X A;  2I2Y A;  4IKG A;  3B9J A;  2K5P A;  1FMA D;  2WU2 B;  3U52 E;  5D3D A;  2QEJ C;  2Z8L A;  1CK1 A;  1ENF A;  2ZW0 A;  1VZ8 A;  3R2T A;  2RPV A;  3B2F A;  1DOX A;  4JX1 C;  1JWA D;  1FD6 A;  3MHZ A;  4KKI A;  1XLO A;  3C8Y A;  3TEZ A;  1UNS A;  3B2G A;  4WH4 A;  2BBC A;  1K52 A;  1ZDV A;  3P4Q B;  1FFU A;  1FRR A;  1YNT E;  2DLB A;  4H2A A;  5H92 C;  1PFD A;  3ZJT A;  1UWM A;  2MJ3 A;  1NI3 A;  1TYG B;  3BYT B;  1EWC A;  4O1N A;  1E0Z A;  1HA5 A;  1JAL A;  3BZD B;  5I4D A;  1SSN A;  4RGM A;  1NVI D;  3AE8 B;  4A8X C;  4N58 A;  1XCT L;  3VQI A;  4RNA A;  1DGJ A;  4RGT A;  2VZK B;  3AE1 B;  3PZ8 A;  1K53 A;  2MJD A;  1ZOY B;  1TKE A;  3GS2 A;  1HEZ E;  4L1B A;  2IDY A;  2H88 B;  1ZXI A;  3Q8A A;  2PMV A;  3NVW A;  2JXT A;  3AM9 A;  1D5Z C;  5FR3 A;  1PGX A;  1L4Z B;  2R61 A;  3EUB 2;  4OZB A;  4L23 A;  2PIA A;  2LFI A;  5EE3 A;  5HI1 A;  3E9S A;  4YT0 B;  2WDV B;  1OQQ A;  3BII D;  3RFZ B;  1HQR D;  3NZ3 A;  2QJL A;  1BXT A;  2INN E;  2XNA C;  4ZRP A;  4NZL B;  1WWT A;  1MPE A;  2WDR B;  2NTT A;  3Q69 A;  1VR9 A;  2E3T A;  1I4G A;  1ZP0 B;  3P42 A;  2IGH A;  3WCQ A;  1JML A;  1QOB A;  1SBB B;  1YQ3 B;  1V1P B;  3SFE B;  2K22 A;  3NS1 A;  2G9H D;  1UUP A;  2ON8 A;  3ETR A;  1QT9 A;  3BVG A;  1T5X D;  2WU5 B;  3MP9 A;  4P16 A;  1D4B A;  1ZDX A;  1OQR A;  3T3N A;  4L2Y A;  4ITK A;  1C77 A;  2JX5 A;  1ZXH A;  4N59 A;  4OHJ A;  3J9C A;  4Q2J A;  1C4P A;  4A9A A;  4YTP B;  2TSS A;  3FIL A;  3MJ5 A;  4PT5 A;  3R8B A;  1PYW D;  5BMI A;  1TS3 A;  2QIE B;  2AX5 A;  2EKI A;  4USA A;  4MM3 B;  3RPF C;  2M0A A;  3PO0 A;  4ZOH C;  4OZC A;  3U2S C;  1UGJ A;  5MPO A;  1DYQ A;  3NRZ A;  1GB4 A;  2NTS A;  3AMZ A;  4US9 A;  1F0Z A;  2DYO A;  1YN3 A;  2WP9 B;  2WXH A;  1FRD A;  3ZQ4 A;  1FNU A;  2HDE A;  4YWG G;  1JWM D;  1K50 A;  2RDH A;  1ET9 A;  2BS3 B;  2OHF A;  3AEG B;  2INP E;  4RF0 A;  4YSX B;  2CJO A;  4TSS A;  4NJC A;  3NVZ A;  2ZW1 A;  5D7G A;  5TSS A;  4WQM A;  1ROE A;  1XEE A;  2WXR A;  1BUI C;  1GOZ A;  2BTE A;  2XN9 C;  2EEL A;  4OZA A;  2V0G A;  1TS4 A;  2IGD A;  1XLP A;  3ZJU A;  2KDM A;  2FBW B;  1AYF A;  5BMG A;  1L6U A;  3MFG A;  1GAQ B;  2GRI A;  3AN1 A;  1QOG A;  2KAC A;  1N60 A;  2YEP F;  5LNK 1;  2LHE A;  4DXG A;  3L4P A;  2WXK A;  3Q8E A;  4IOI E;  4YTN B;  3SFD B;  3CWI A;  5HG2 A;  4J3O D;  1IGC A;  1WXQ A;  2BW2 A;  1JW9 D;  5BMH A;  3KWV A;  3OWE B;  1JWU D;  1QQR A;  1I4X A;  1XO3 A;  2WXI A;  3AE7 B;  4TQ1 A;  2N0S B;  2KWD A;  2B76 B;  2W55 A;  1SF0 A;  1EU4 A;  1P7F A;  3BYY B;  2J53 A;  2YEP B;  5EE1 A;  4RH6 A;  2J42 A;  4MAC A;  3O13 A;  1SE3 A;  2IJ0 A;  3BWU D;  2V3P A;  1XLQ A;  3BK1 A;  3V3X A;  2FE8 A;  3VRB B;  1AW7 A;  2CJN A;  1C78 A;  1VDV A;  3BVM A;  2WNM A;  2PTL A;  1E10 A;  3P4S B;  3U4E G;  3W9C B;  1P7E A;  4AS1 A;  3Q8F A;  5G5H A;  3SEB A;  4A55 A;  3CIR B;  1SIJ A;  1HZ5 A;  2BT6 A;  1GB1 A;  1NEN B;  2WXO A;  1JRP A;  4WAF A;  3W5U B;  3VRA B;  1PGA A;  1QLB B;  1V8C A;  1DOY A;  2M19 A;  3AEE B;  1C79 A;  3KWL A;  3ABV B;  3IXS A;  3GB1 A;  5HHD G;  1VRA B;  3VR8 B;  1VZ7 A;  4XDD A;  4ARI A;  2N9L A;  2WXF A;  2J4X A;  4RGN A;  2JSV X;  2LJI A;  3PZ7 A;  4R3D A;  1KH0 A;  2WXP A;  3H8H A;  1PUT A;  1FM0 D;  1STE A;  2AQ3 B;  1TY2 A;  2DYM A;  2JWU A;  5FKA C;  1IGD A;  4ZHP A;  2AQ1 B;  3TUO A;  1SJE D;  1A70 A;  5FK9 C;  2WXJ A;  1OFF A;  5GXG B;  4YXD B;  4C80 A;  1B1Z A;  1RYJ A;  1JWB D;  2DWQ A;  4RGO S;  2WQY B;  2W3S A;  1WRI A;  4RF1 A;  2WS3 B;  1F77 A;  2WLB A;  2K3U A;  3I57 A;  4KKJ A;  2LEK A;  1EWY C;  3HRD D;  2LMC A;  4YSZ B;  2G1E A;  4JWS C;  1FCL A;  4M0W A;  1IBX B;  2KMM A;  2RDG A;  1XF5 L;  4EE2 A;  3NVV A;  1JQ4 A;  1T6B X;  1SJH D;  1YN4 A;  3AV8 A;  2RMM A;  2WXQ A;  4ZHO A;  1YQ4 B;  1I4Q A;  2BS4 B;  4GDK B;  4LLG M;  4HKZ E;  4YSY B;  1CJE A;  1FO4 A;  1RFK A;  1SB3 C;  3AEC B;  1KRH A;  1NYQ A;  3IAS 1;  4OVZ A;  4WWM A;  4HEA 1;  1TJE A;  1JWS D;  3W5V B;  2K0P A;  1HZ6 A;  2JZP A;  2IGG A;  1NEK B;  3IT4 B;  3TSS A;  1VLB A;  1SEB D;  1TZO A;  1MI0 A;  2WXL A;  3Q8C A;  4LTU A;  1L0V B;  1D5X C;  1YJJ A;  1F2R C;  2Y5P A;  3GP7 A;  2VZK D;  1KFY B;  4WUR A;  3LYY A;  2WDQ B;  1PDX A;  1FXI A;  2L32 A;  3URY A;  4JPS A;  4HKQ A;  2BB6 A;  4ARC A;  2BS2 B;  1VZ6 A;  3FAH A;  4ZRQ A;  1FCC C;  1GPX A;  4KGT A;  1VJK A;  3LB8 C;  3HVD A;  2ONQ A;  5H8Y E;  2BYT A;  1JRO A;  3NVY A;  1TKY A;  4KGR A;  1KLU D;  3Q8B A;  1M4V A;  2JYT A;  4UDU C;  2NMQ A;  3EA6 A;  3W1S A;  1EU3 A;  2CU3 A;  4OW0 A;  3ZGZ A;  1TKG A;  2OED A;  2V3N A;  4DQO C;  1I7H A;  1ZPS A;  5D3I B;  1AWD A;  2I38 A;  2N9K A;  1FEH A;  2W82 A;  3IT6 B;  1ACC A;  2PW9 A;  2LUM A;  4RFB A;  3P4P B;  1YJI A;  3V05 A;  2JQR B;  5BYQ A;  1C4A A;  3T3O A;  1L5P A;  2H89 B;  2V4I B;  1RM6 C;  3SR6 A;  1ET6 A;  1KF6 B;  1WSP A;  5E6J A;  4NAM A;  3N9Y C;  2D5G A;  1V1P A;  3NUH B;  1MHX A;  2K9X A;  5JXV A;  2WXM A;  2HTM E;  4TQ0 A;  2J52 A;  4KGS A;  2L83 A;  5C3J B;  1WGK A;  1IUE A;  3AEF B;  1K51 A;  1Y56 A;  1QF6 A;  2W3R A;  2QIL A;  3HUI A;  2KN4 A;  3UI3 A;  3W2D A;  5C2T B;  3DWG C;  3ZYY X;  1C76 A;  1D6E C;  1DOI A;  2QMT A;  3BVZ A;  4P6V F;  1I4R A;  1N62 A;  5AUK A;  4XWT A;  1L0Y B;  2ICI A;  3AED B;  1EM7 A;  5BYS A;  4AQ7 A;  1IBX A;  2FUG 1;  1KLG D;  2W54 A;  2JU6 X;  3AE4 B;  1T3Q A;  1JCK B;  1PGB A;  1F2R I;  4YTM B;  2WXN A;  4DXF A;  2LHD A;  4KX6 B;  3AEA B;  2X38 A;  5EE9 A;  3U7Z A;  1QKZ A;  4WIP A;  1V97 A;  4LK0 M;  2DBY A;  3KLS X;  1J7B A;  3LXF A;  4GLS C;  1FNW A;  2GB1 A;  1N5W A;  5T8I A;  4FXC A;  3TEX A;  2IPK D;  1L6V A;  3IAM 1;  2PVO D;  3KQ4 A;  1HXY D;  4HJG E;  2Q5W D;  1E6E B;  3AB5 A;  3EGR A;  1L4D B;  4A6Q A;  1ZUD 2;  2E6X A;  1YMH E;  2QSD A;  2N7J A;  1I4P A;  1B9R A;  1XXG A;  1MVK A;  1SE4 A;  4CQN A;  1QOF A;  3R2I A;  4NAW B;  2LGI A;  1E9M A;  2MJE A;  4C7Y A;  2Y5C A;  4XWW A;  1D5M C;  3I9V 1;  4XDC A;  1XLN A;  4C56 C;  5G5G A;  1C4C A;  4JE3 B;  2KAJ A;  2KQ4 X;  5BYR A;  3P1M A;  1QOA A;  1FIQ A;  2BB5 A;  1QIL A;  1NYR A;  3AEB B;  3TEW A;  3MC0 B;  4B0M A;  2MEK A;  2PLP A;  3AH7 A;  3E56 A;  1I4H A;  2SEB D;  4XE0 A;  3AE5 B;  1KTK A;  5EE0 A;  1R7S A;  1AN8 A;  5AUI A;  1N61 A;  2MH7 A;  1SXT A;  2SAK A;  3AE9 B;  4TMA B;  1FFV A;  2GI9 A;  4HRS A;  4US8 A;  3FC4 A;  4GDL B;  2L52 A;  3P4R B;  1Q10 A;  1TS5 A;  1CQV A;  1J7C A;  2Y3A A;  1RWS A;  2PVG C;  4N6E B;  4MH8 A;  3VR9 B;  3BK2 A;  1BML C;  4IDI A;  1UWX A;  3ZJV A;  1MHH E;  1V1O A;  2M56 B;  4RCO A;  3DWM A;  1TY0 A;  2AQ2 B;  3AE6 B;  1FXA A;  1YN5 A;  2JYE A;  1E7P B;  1C9F A;  2PKO A;  1N63 A;  3AE3 B;  1TS2 A;  1CZP A;  4JWU C;  1FNV A;  4HRO A;  2ACZ B;  2L1A A;  1SE2 A;  4D2K A;  1XCQ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...