5G5GA

Escherichia coli periplasmic aldehyde oxidase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
175
Chain Sequence
PAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords PUTATIVE XANTHINE DEHYDROGENASE YAGT IRON-SULFUR-BINDING SUB
total genus 49
structure length 175
sequence length 175
ec nomenclature ec 1.2.99.6: Carboxylate reductase.
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 5g5gA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5g5gA01
1F0ZA 2QJLA 2B76B 3P1MA 3AE1B 3RPFC 1NENB 5GXGB 3VR9B 1E10A 1TKGA 1ROEA 3B2FA 3CIRB 3L4PA 1A70A 2G1EA 1N61A 3ETRA 1OQRA 4JX1C 1R7SA 3AMZA 3B9JA 1TJEA 1QT9A 1FM0D 2N0SB 5AUIA 3BIID 4YXDB 4YTNB 1JQ4A 2L83A 2Q5WD 1JW9D 3VRBB 2WQYB 2QIEB 3AE7B 1UWMA 3AEDB 3KWLA 4P6VF 1E0ZA 2E3TA 1L5PA 1SIJA 1XLNA 1WWTA 4C7ZA 2OHFA 3AE6B 1VDVA 2PKOA 3AE2B 4FXCA 5AUKA 4YSXB 1QLBB 2W54A 1YJIA 2MJDA 4KX6B 1CJEA 1N62A 2JX5A 2WDVB 3AE4B 3P4QB 3P63A 3AE5B 2K22A 1FRDA 2WP9B 1AWDA 1V97A 3AEFB 4HRSA 1EWYC 1GAQB 4JWSC 2H88B 4IDIA 3AN1A 1XLOA 3CWIA 5C3JB 1JWAD 1PFDA 3NVVA 2CJOA 3AEGB 2LEKA 4YT0B 3ABVB 3W5UB 1JWBD 2Y5CA 1QOAA 1ZXIA 2PVGC 1E7PB 4ZHOA 3WCQA 1V8CA 3W5VB 5EE0A 2AX5A 1FO4A 3AEEB 3AECB 3HVZA 1N60A 3NVZA 4ITKA 1JRPA 1VLBA 1YQ3B 3P4PB 4HROA 4WWMA 4YTMB 1FFUA 2W3RA 1FFVA 2W55A 1RM6C 1L0VB 4YSZB 3NVWA 1FMAD 1FXAA 4JWUC 1ZUD2 2FBWB 2BS4B 2DWQA 1I7HA 1L6UA 3AV8A 5EE3A 1VJKA 2DBYA 1QOGA 4WQMA 1TKYA 5MPOA 1WGKA 3VR8B 2KMMA 2ACZB 1WRIA 1JALA 3LB8C 1N63A 1YJJA 2BT6A 4YTPB 3P4RB 1FIQA 4USAA 3AE8B 3AE3B 1NYQA 1SF0A 2MJ3A 2CU3A 1IUEA 5EE1A 1RWSA 3VRAB 1TYGB 2BS3B 1J7AA 1KF6B 3NRZA 1TKEA 3SFEB 1PUTA 4A9AA 1DOIA 1NVID 1XO3A 3AEAB 2M19A 2PVOD 3DWMA 1QF6A 1PDXA 1ZOYB 1JROA 2W3SA 3FAHA 2HTME 3DWGC 5G5HA 3NS1A 1OFFA 2KAJA 3SFDB 1YQ4B 1RFKA 2L52A 3LXFA 3FC4A 4N59A 1E9MA 2WU5B 3HUIA 1QOFA 4LTUA 4YSYB 1GPXA 1AYFA 2MH7A 3ZYYX 1ZP0B 2PIAA 5EE9A 2WS3B 2K5PA 5H8YE 3AM9A 1J7CA 5C2TB 3W9CB 4C80A 2BS2B 1WYGA 3AB5A 3AH7A 2K9XA 3B2GA 1NEKB 4US9A 2CJNA 3PO0A 3SR6A 1SB3C 4C7YA 1NYRA 1NI3A 3NVYA 1KRHA 1B9RA 1QOBA 3AE9B 5H92C 2WLBA 2WDQB 2EKIA 3P4SB 4ZHPA 4ZOHC 1CZPA 1WXQA 1XLQA 1DOYA 1L6VA 1OQQA 2M56B 2H89B 1FXIA 1T3QA 2WDRB 1E6EB 1J7BA 2WU2B 2JQRB 4N58A 1DGJA 1N5XA 3AEBB 1RYJA 4N6EB 5G5GA 1FRRA 3EUB2 1KFYB 1XLPA 3HRDD 1DOXA 1N5WA 2MJEA 4US8A
chains in the Genus database with same CATH superfamily
1M6YA 4IM0A 4Z6DA 3DDHA 1G6JA 2N9LA 1YX5B 2LZ6A 3I63C 1J97A 3QUBA 2JZ3B 1SEBD 5KT4A 4R63A 2MSNA 3Q3MC 5E79U 4RGNA 2M0NA 1Z00B 4RQ7A 4KSKC 3K75D 2BCSA 8ICBA 2LMCA 2ES6A 4EBDA 2JV3A 1S97A 4A90A 1YN4A 4EKUA 5KFNA 2NR2A 2Y0SF 2V3SA 2Y9UA 2PFNA 1EU3A 1JWUD 3M9MB 2C22A 2OOBB 3NJTA 3PZDA 5CHGA 1TY0A 4RMAA 4YD1A 2XI9A 1U4BA 2R18A 1CEZA 1KM7A 1UHUA 4UARA 2FLPA 4DSLA 4GC6A 5G55A 2XNAC 7ICLA 3AEFB 2EDUA 4KLTA 2ATLA 1GAQB 2I38A 3J81j 4XWWA 3FILB 2Q4TA 3N7SC 3KHGA 1WWVA 2FE8A 4DEZA 1I4QA 3KQ4A 2NRZA 2V9WA 2WB1F 2LEKA 3LDAA 2LJ5A 4LLGM 2Y5CA 5HFYA 2G45B 4CCHA 4ECRA 2KC1A 3QE9Y 5IKCM 5ALZA 3QK0A 4KLUA 2FCSA 4UBBA 3WKCA 1CK1A 3V7JA 3ML9A 4ED7A 4II2B 4EX6A 1ED1A 2M1MA 2I1QA 4NJ7A 1VLBA 4O1NA 1DOQA 4FULA 2WXHA 1TFRA 3WAOA 3K1RB 1ZQXA 3IHQB 3AL0B 5ALYA 4KKIA 1K51A 1SXDA 4Z6FA 2IJ0A 1SGGA 2NTSA 4G3XB 4I2DA 8ICGA 4CRXA 2KNBA 3A4RA 1ZQEA 8ICCA 2HBMA 5EE1A 4UQGA 1XO1A 1HA5A 8ICPA 3ZO5B 1U45A 2FPLA 4I2EA 2K6DB 4GXBA 1RYRA 3TARA 2WF9A 3NZUA 3MC9A 4IW0A 5KFTA 2WXLA 1QCKA 5BPCA 2WB1C 2F44A 5KFXA 1WX9A 2UYZB 2XVTA 2VA3A 1ZP0B 3TMPB 2J0JA 3ZLZA 2OWOA 4NLNA 2DL0A 1T94A 2A1JB 1D9DA 1BMLC 2ASQA 1VZ7A 1L7YA 2RRDA 3RMKC 9ICAA 5AKEA 1C1YB 3DV9A 1NEKB 1Z5SB 4WJOA 2KANA 1U4AA 4AQ7A 3T8MA 1IBXB 4MH8A 2AGOA 3EW9A 4Q8FA 3M62B 4ED8A 2EKIA 2W43A 2JSVX 1U47A 1F1HA 4F5RA 3D2NA 1H4RA 4PS8A 5J0RA 1WR1A 3BVZA 4A20A 3K9OB 4R8UB 4Y2JA 3RI7C 1UCVA 5J2BA 4GLSC 1WZ3A 3MR6A 3QAQA 3RNCC 2AQ4A 1RYJA 1NK9A 2IO3B 4GIBA 1I4XA 3H7IA 1FRRA 2QCZA 3S6JA 1N5WA 4GFJA 1MI0A 3IAS1 1NK7A 1SL2A 1NK4A 1EF5A 2K8BA 2RPVA 3Q8LA 2PXIA 4DFPA 5L1JA 4KLFA 3PRMB 3BK2A 4HLEA 1ZQSA 3WKDA 4RPZA 8ICTA 3KZIU 3H0MB 4HVBA 4QZ9A 1TZ1A 1VCBA 9ICEA 2C28A 2LGDA 1LV5A 4DWFA 3C5GA 2ZIUB 9ICLA 4J9SA 1E7VA 1ZXHA 3OJ4B 3IP4B 4ECUA 5KFLA 5KFEA 2TSSA 3N97B 1N62A 4QWAA 3P4QB 2W9BA 2XY5A 2KWUB 3BQTA 4EZJA 2MCNB 4MEYA 3VTWA 1FNVA 5AI6A 1SKSA 2D3AA 3Q3OC 3L08A 1WIAA 3X0WA 2EZYA 2K4HA 5DB6A 3HT3A 1IGDA 1JRUA 1V49A 4G11A 4XX5A 3RNFC 4ASWC 2WF5A 3C2KA 3AEEB 4GXIA 4E0DA 2X8XX 1V85A 3T3OA 3QU4A 3HVZA 3NVZA 1WH3A 2LWPA 3OSNA 4DL4A 3GIIA 1SWWA 4PGQA 1X42A 2NYVA 2W04A 1L0VB 1RM6C 2HHSA 5D7GA 3BZKA 2WHIA 4QWCA 4DQPA 1QLNA 4YMNA 1AN8A 5KT3A 3U52E 2AQ1B 2LYAA 1TKYA 2BVCA 3QC8B 2KNJA 4TUUA 5BOMA 3LB8C 1N63A 5AI9A 2G4SA 4MSQB 5E6NA 5KFSA 5J0UA 3RAQA 3AE8B 3AE3B 1AQ6A 3B0AA 3ZDTA 3APDA 2N9XA 3PGEA 4R3DA 2KKPA 3VAWA 3PZ8A 2KD1A 1XQQA 4NL9A 3AEAB 5C23A 3MABA 4Y2XA 2W3SA 2L05A 5G5HA 1SKRA 3ZJVA 4RQ4A 3GE8C 2ON8A 2Z7JA 2GBKA 4OHJA 4O5CA 4BBNC 2WF8A 3VC8A 3CF6E 2P35A 2O6VB 2K4PA 4PYUA 3AQFA 3RNBC 3RJHA 1ZOLA 1J7CA 5C2TB 4A6QA 4ARCA 3IT4B 2MUTB 1ZQVA 3R7QA 3UGBB 4KMUA 2O6KA 2KACA 4FA6A 1S1QB 5BYSA 4DFKA 1FD6A 4K1RB 1RG6A 2JRZA 1XLQA 1V1PA 5GTIU 2CHXA 5KFJA 3MGIA 4DL6A 3L10B 5J2DA 2KN4A 5FP0A 2DLBA 2ZW1A 4LVSA 2PPHA 5L1KA 3Q8FA 2I1KA 3RRGA 1NDDA 1I4GA 4W9LA 5CA7A 2UVWA 1V80A 4PK1A 1ZQNA 1XD3B 3RPFC 5J0QA 2NRTA 1HZ5A 4DQIA 1P7EA 3DVNV 4F5OA 3UXPA 4BGDA 4S17A 3WAMA 3PX0A 5EOZA 3IN5A 2ISPA 5ALTA 5AUIA 4FZNA 3PSIA 7ICPA 4FBUA 1XCQL 2VANA 2BWES 3UIPB 3ZD8A 3A1QB 4J9PA 4BFRA 1U49A 8ICMA 7ICRA 1S10A 4C4TA 2V1YA 3R9KA 2W9CB 2ASDA 2RSUA 4DFDA 5KG7A 5BMGA 5KFGA 2W7PA 4RPYA 4P1BC 2XGQA 2LHEA 3HP6A 2K22A 2KJ6A 3N4MB 4DCCA 2ZIWB 3ML8A 1WJNA 2GBNA 3UM9A 2ZCBA 4GDKA 2N4FA 8ICVA 2ASLA 2O6VD 5IAAC 1PVPA 3BYYB 4GDKB 4PZNA 3RH6A 3RNEC 2E8PA 2MBHA 3ZNID 1ZXIA 3N28A 4EZ6A 1E7PB 1BNOA 2C9WB 4W9EA 5EE0A 4S0RA 3PRZA 3WK4A 5J0SA 1JXLA 1KQQA 3MC0B 4RF1A 4HROA 3P4PB 5B66U 4LK0M 2R8KA 3C23A 4WJ3B 2KHQA 2GOLA 5TISU 1KFDA 1ZUD2 1COKA 1TE2A 8ICLA 5EE3A 1ZJMA 2INNE 4UB4A 3U7ZA 1WZ0A 1ZRNA 1CQVA 4B9KA 2MBEA 1MJDA 4W9GA 2RHFA 2ZIXB 1J2MA 3EGRA 4HKZE 2G3QB 2JRIB 3LJ3A 3DVGX 4UASA 1PUTA 3GIJA 2WF7A 4Q43A 2KD0A 1UT5A 1WCLA 2HTHA 1SE3A 2L52A 3FC4A 4DK5A 1E9MA 3HUIA 2NBWB 2R8IA 3SZ2A 4Z6CA 2KDEB 4KTQA 5ALVA 2P6RA 3T5JA 4M47A 3T79A 3QYPA 3SDLC 3D6JA 3W9CB 2GB1A 1ZQMA 3GQCA 2AGPA 1TVAA 3LDZE 2DYMA 1Q10A 4C7YA 2ICIA 3UF8A 5D49A 4I2FA 3AI5A 3DBRB 4KLOA 4F92B 4NLKA 2YMMA 2ZPNA 3H8HA 3M3JA 4ZHPA 4B6JA 1A5RA 1VJ5A 5CJ7A 1JMSA 4IQVA 3I1YA 3SYZA 1BPEA 4ED2A 1SV0A 8ICRA 1J7BA 1TK5A 2FJ6A 3L17A 4DQOC 1CMXB 1E8XA 4N6EB 4UAWA 5J0OA 2BQQA 2OJRA 4P16A 1C4AA 1L6NA 2WFAA 1S0VA 2KWCA 2XK5B 4F2RA 3M6ZA 2J6TA 4M02A 5L83A 2JZZA 1UZXB 3N3KB 4M0WA 2OXOA 5DG7A 2NCNA 3L4PA 2QILA 4KLDA 3VUYA 4YQWA 1MSWD 3IG5A 8ICAA 5LXHA 1S77D 1Z00A 1TJEA 2VRRB 2JH7A 2HBKA 3I28A 2E8MA 4I2AA 1UA1A 2I6XA 3DHIC 4ICVA 2XY7A 3QX1A 4B0MA 1HEZE 3P1MA 1SIJA 4DF8A 1L3SA 2OHFA 2MBOA 2PKOA 2QC8A 4YSXB 4RQNA 1L5UA 4ZH4A 4IM2A 3Q8MA 3MBYA 3DCGA 2AEHA 2INPE 4KN7A 3AE5B 2W03A 4ZRIA 4IUMB 4ECSA 2Z0EB 1JN3A 3Q8KA 5BO4B 4DBGA 1N56A 1WY8A 4IWOA 3DHGC 4PS7A 3V6KA 4EBCA 1HEKA 4EZ9A 5A0LA 7ICVA 1ZETA 4OVVA 5J2CA 2AX5A 3AECB 4OZBA 5J8YC 3JSVB 1L7NA 1WMHA 4NQKE 1UGMA 4O3OA 1XCTL 4RNMA 2PFOA 4I2IA 4RNAA 2WXKA 4KX3A 3KW5B 1XWLA 3M8RA 5G2NA 1SV4A 2OEHA 3EFCA 3RB3A 3DQVA 3PHXB 2MAXA 2ZVOA 2BT6A 1ZQIA 4OO1J 4I2JA 3PT2B 3BS5A 2RLTA 4ZRPA 4MJSB 4DHZE 2NPTA 1TS5A 4IWQA 3UXOA 8ICXA 1J7AA 2LXAA 4W9HA 2MRLA 2NV3A 2KHWB 2JZBA 1WG8A 1HTOA 2RDGA 3PTFC 1A0PA 4KLEA 1VD2A 2FIFA 2KN5A 2HHUA 4QIWC 2KKVA 2KLGA 4DQSA 5KHOA 4ZYSA 1FEHA 4WWOA 4BXOA 2V0GA 3V6JA 2K5PA 4DF4A 1OQYA 3SEIA 5LLIA 4YR3A 1FEZA 2IA6A 3PMLA 3NHEB 3N1XC 4TQ0A 2BKRB 2MHJA 1KRHA 4AS1A 1SE9A 3H4BA 3GZNB 4IKGA 3Q3JA 3I57A 3V7LA 1P0RA 4KIKB 2M17A 4ZOHC 1SJED 5AZFA 4M9HA 4J9QA 5AKIA 7ICSA 3EECA 2DAJA 1D5XC 4AUQC 2R2OA 1E6EB 2A1AA 1XSPA 1N5XA 2E5SA 2MRPA 4KN4A 4I2HA 2LBOA 2DAFA 4XZ4A 3IAM1 1XLPA 4NM2A 1S0MA 1TK0A 7ICQA 4QWBA 4NJ6A 5KAIU 3SD7A 3H0LB 4DS5A 8ICKA 2D3DA 3MHSD 2MEKA 4PH5A 2F1HA 1ZQGA 1FCLA 4M0WB 2YX8A 5J2IA 3MR3A 3G6YA 4BKGA 1AARA 3C8YA 1QT9A 5IO9A 3OAWA 2W8KA 4MM3B 4NAWA 1JW9D 1NBFC 4HCPB 2XO7A 1QTMA 2ZVNA 2D6FC 4PL1A 9ICRA 4P0PB 4K3CA 4C7ZA 5J2FA 3QU2A 5KHQA 2JGAA 2WXGA 2PKEA 3OPXA 5DQHA 4HWIB 1CJEA 5TZVA 2DPJA 3AE4B 3JPNA 4EENA 3WAPA 3NY5A 3RB6A 5D94A 2F1IA 3H7SA 4JWSC 1RQLA 3SAFA 2BGWA 4AP4C 1QQ7A 2VH1A 8ICYA 2C60A 3AU4A 2IY1B 5IN7A 4MGKE 4ECQA 2XN9C 5AM5A 1V86A 5KFDA 4IQWA 1NK5A 5KFAA 4K4IA 4IC7B 1PZNA 1WJ6A 2CR5A 2JF5A 3DBLB 4J9OA 1P7DA 1S76D 2RGFA 3K4GA 1PYWD 1FFUA 1U9LA 4FJYA 3NVWA 3LWLA 3L0WB 2BS4B 4IM3A 2YMPA 3KD3A 5FK9C 4K4GA 1NJWA 1B1ZA 3TADA 3QIJA 2BKEA 4YD2A 4RGMA 2M0XA 1YT3A 5KG2A 5J17A 4NWIA 5CHFA 2EQYA 5ALWA 1IG6A 4C8OA 2BS3B 1Q3VA 1QZEA 4I6NB 4ANWA 1LKYB 2L32A 5HG2A 3RZFA 1NVID 5KAFU 1XO3A 3C1YA 2PVOD 4NZLB 1LKYA 3N7PD 1SXTA 3O13A 9ICXA 2ZEQA 1KLNA 3ZD9A 2BPCA 2OEDA 1HZ6A 4K4HA 5IIKA 1HIWA 3PS6A 1QQ5A 3PW5A 3RB0A 4UB3A 2LGSA 4BXOB 5ALNA 3AB5A 3AH7A 4XE0A 2E8OA 1GNUA 1B9RA 5AKJA 4OVUA 2PMZF 2VZKB 4ICAA 3KUDB 4GMVA 3RN9C 2ZJ5A 5AM1A 1L7MA 1KOTA 4UW9A 4P0QA 4FBJB 4C4RA 4YWGG 5J0YA 2JUOA 2AGQA 1I4HA 3RYTA 1NKEA 2WDRB 2JWZA 4QW8A 2FPMA 2OJWA 1ZQHA 2M0AA 1XXGA 2M8SA 3I9V1 5AK4A 4ED6A 3BYTB 3KOOA 3V7KA 3EUB2 2O2VB 2HJ1A 2GRIA 2DZIA 1COOA 4OCZA 4US8A 5HHIA 1TY2A 3VVWB 4AJWA 1H8CA 3UMBA 4MACA 2F76X 1NENB 2DZMA 5GXGB 2JMGA 1V9PA 1TKGA 4QZDA 5DGBA 4XRHA 4YN4A 1ROEA 4I2GA 1UGJA 4LZDA 5AK3A 2HD5B 3C2LA 4PS3A 4QZGA 4MHVA 4B9NA 1A77A 3ETRA 1KDHA 3MTNB 4HXDA 1KJTA 4TV3A 1SV0C 2R8JA 1OEYJ 4XC2A 2NS5A 1Y56A 7ICKA 2KJ9A 3A33B 2HE7A 1MC8A 5DBCA 1UPHA 5ALOA 1UWMA 2PMZC 4JV1A 3OLMD 3MGVA 2FI1A 2PJHA 3RFAA 4Q44A 1ZQAA 4TURA 1LGRA 2SAKA 2WXIA 3N20C 1JX4A 3U26A 2K60A 4Y2VA 3TANA 2C2RA 5HR6A 5HR7A 4B95A 4EFOA 3H8JA 2JHDA 1TV9A 1URJA 2V3NA 2GLSA 3IG8A 4HRSA 4EYIB 3F2BA 3ZQ4A 3QU5A 3A9KA 1I42A 3JPQA 3DBSA 1C9FA 1X40A 1KLVA 2XCAA 4KKJA 2GOWA 1MFWA 3NS8A 5KFZA 2IGDA 2AYOB 1NK0A 1PVRA 3KH0A 3CYMA 4FHJA 2JEGA 2VZKD 3VCBA 1JRPA 1QSLA 3EWAA 3WKBA 4B6WA 1SE2A 3ZGZA 5T14A 7ICNA 8ICNA 1NI2A 2ZJAA 3IT6B 4QAYA 4JUZA 5KFWA 1L6UA 2HW3A 4W9JA 5KFOA 7ICTA 1K1QA 9ICFA 2Y3AA 1QOGA 2PTLA 4WQMA 3KZXA 2HHWA 3HHMA 1MPEA 4O3PA 4QIWF 3NZ3A 1BPZA 2W82A 3P4RB 1TAQA 4KZ0A 2LASA 2HDOA 4A9AA 2XY6A 5LNK1 4CNQA 4ECYA 4B9MA 4G3IA 4JQWC 4OJLA 4G9BA 2NBVB 4LNOA 1JROA 3MR2A 1E90A 4EYHB 2IBIB 5J29A 5B5EU 1RFKA 3TEYA 1A76A 3F2CA 1QOFA 3SHQA 3MP9A 1PUZA 2MA9B 3C2MA 1KTQA 5D4BA 1SBBB 2VKQA 1YD8U 3CW2C 2LVQA 2EAMA 4JB3A 3GV7B 4C80A 4DL3A 4ZYNA 3UQBA 4W9KA 4US9A 2WXOA 3S2AA 1SB3C 5DGAA 1NYRA 3TSSA 2EANA 3LWMA 3TAPA 4DWIA 1K52A 2JXTA 5KFQA 3Q8PB 2WDQB 4JMUA 3UPQA 3ZI4A 3VXWA 1L0XB 5IA7A 1F2RC 2E1EA 5KG5A 1A6SA 4WWNA 4BKSA 4WWPA 4NLCA 2A4ZA 2LVOA 4KITB 4M01A 2MW5A 2KOBA 3B0XA 4WIPA 1KFYB 3HRDD 2ODGA 3DBRI 3N32A 3TKAA 1B4FA 5DG9A 2ZXHA 3PW7A 1PQSA 4WJPA 5JXVA 2M4NA 4FLHA 5AI5A 1VZ6A 2GH1A 2HCFA 4BWMA 4ECTA 2BZFA 3Q8AA 1QSYA 4M2YA 1WI0A 3NUHB 2KIWA 1D3ZA 3PR4A 2DFLA 4FHKA 8ICQA 9ICHA 2C7HA 3BIID 4XDDA 3L13A 2E6XA 4RQ8A 2K6QA 3PZ7A 1ZD3A 3AE7B 2K8HA 1YZ7A 4DFMA 2UVRA 4KLSA 2L7RA 5AKHA 3A1QA 4MEMA 2E3TA 1XLNA 4FXCA 3AE6B 4PPXA 3RJIA 2LI5A 4K7SA 8ICSA 2QMTA 4Y2UA 1YJIA 2MJDA 2G09A 2XK5A 5BMIA 2LM1A 1C78A 1P3QU 2WP9B 3H7PA 1E8ZA 2AJQA 2CHZA 4I6PA 1EWYC 7ICIA 2K8AA 4C8NA 3AN1A 5KFVA 1XT9B 1WX8A 2NRWA 3PSFA 3WK7A 1D4BA 2CJOA 4KLLA 3GB1A 1WSPA 3W5UB 2MBQA 5IOIA 4QZFA 2DPIA 3E2EA 4ZHOA 1V8CA 3QUCA 1WMHB 3BDPA 4JWMA 1WJUA 4F4YA 2KDMA 4DQRA 2WXMA 4II3B 1YQ3B 8ICFA 5KT6A 3SU8X 2W3RA 2EMTA 2CHWA 3A0BU 2B6GA 1X66A 4LNIA 5CHVC 2BPFA 5L95C 4F5PA 4J3OD 1C4CA 4UAVA 3UXNA 2KTQA 2ZUCA 1WRIA 4O0IA 4B9SA 1N2XA 4BKSD 1GB4A 4JPSA 1F77A 5E6PA 4O3MA 3RBDA 1S5LU 4F71A 2ZIVB 1SL0A 2HJ8A 2K39A 1WXAA 2RDBC 5AKGA 1K50A 1MN8A 2RDHA 1KSPA 2HOFA 1V6EA 4DDID 3SFEB 1O03A 1DOIA 1WX7A 5D3IB 4A55A 2M19A 3QX7A 4ELTA 2IO2B 2QDFA 3V6EB 1OEYA 1FPYA 3U30A 4MGIE 1CI4A 2N1VA 4C8LA 1X1MA 3TADC 4QZAA 4YP3A 1AYFA 1ZW7A 4BVUC 4PGXA 2WS3B 3GIKA 5CP2A 8ICZA 1ZGUB 2INDC 4RFBA 2GLEA 5H8YE 3PV1A 5DCNA 2E8NA 3RJEA 1IXRA 1I4PA 5KFYA 1F0ZA 4PHPA 2K9XA 3U4EG 4ARIA 1UUPA 2CJNA 1ZQ1C 1PK3A 3PNCA 3R2IA 3M8SA 2KZ3A 1VRAB 3K9PB 2ONQA 3BQ7A 4CE6A 3QA8A 2LJIA 1RYSA 7ICEA 4DO9A 3WA0A 3PLVA 2D10A 1XS9D 2H89B 3Q3NC 2JEJA 5DLFA 2WU2B 1JXEA 2VJ5A 5HHDG 2AHOB 3RJGA 3PO4A 4MDKE 9ICQA 2LVPA 5AIBA 1HXYD 3RH5A 1YQBA 1L3UA 1Z19A 4KLIA 3ZUNA 5CB1A 4F4XA 3EHVA 2QARB 5KFPA 1V2YA 4BOSC 1GJZA 4PGYA 3GV8B 3H8WA 5J2HA 1BPYA 2FLNA 2QARA 2JPHA 4YL8A 1EXNA 3LYYA 3BJYA 4NY0A 1NK8A 4MM3A 1YNTE 3KYCD 5L1IA 1HTQA 1B43A 2W9AA 2EELA 1WYWB 1JQ4A 4WH4A 2Q5WD 3WKAA 3DVNU 4P1CC 5J2GA 4FO6A 3TL5A 7ICFA 2UU7A 3QCAA 4U7CA 4HK2A 3ONNA 4MFAA 1WJ4A 1SWVA 2R8GA 1TBEA 1U48A 2UWQA 4N9F4 1AWDA 2J4XA 9ICNA 3ICXA 3NGDA 1XLOA 1Q0WB 4RM8A 4EUTA 3W1SC 2ZJDA 3AEGB 4K81A 9ICMA 3DPDA 3KLSX 3KFUF 5ALMA 4BOZB 2BQRA 1ESFA 2KT7A 4F8CB 2JU6X 3Q69A 4I2CA 3SD5A 2CXYA 3HX0A 1WE7A 3D32A 1PK1B 1OUQA 2KMMA 1N6ZA 2ISOA 4GLXA 4URKA 1R4NI 2N1RA 3IXSA 4BBNF 3VTVA 4USAA 2BF8B 4F7ZA 4O3RA 5JH5C 4O3QA 2XGPA 2FIDA 2NO4A 2IYDB 2HHTA 4NY8A 4M9LA 4KGSA 3PSPA 4F72A 2BCVA 4X5VA 1UF0A 4HDQA 3FAHA 1AROP 3WK5A 3WK6A 3CNHA 2QSDA 4TQ1A 2G4DB 1B22A 3GP7A 5BOLA 5CWRA 3JYUA 4TKNA 3N1YC 2A5UA 3ALRA 2ZUBA 3QUQA 4B9VA 1HJPA 4BAXA 1YX6B 4PHEA 5DDMA 4M04A 2DYBA 3PO0A 3U7DA 1KEJA 5ALEA 4IRCA 1SSNA 1VZ8A 3E9SA 3SENA 4C00A 5AEKB 3ZNGC 1K1SA 3Q8QB 4KDIC 3R66C 4BJQA 4W9DA 4EOYA 5AI0A 2AH5A 1WXQA 4QZIA 1SZHA 3F5AA 4M9NA 3UINB 1DOYA 4NQLB 4ANVA 1SL1A 2JR5A 2IO0B 3RTVA 4AP9A 2Z59B 2JQRB 2HOIA 4IL6U 1MA7A 1Z3EB 3OG5A 2HOQA 4L23A 5DKWA 5HI1A 2G9HD 1J2NA 2YMQA 4JV2A 2LHTA 2A1JA 2WGSA 3ZDCA 2JZPA 3IBEA 2KIVA 4YSYB 3T5LA 4R64A 1YN3A 2D3GA 4YXJA 3MFHA 4QZHA 1BPDA 1TKDA 1JWMD 2QJLA 2KYWA 4NAMA 3ZXVA 4R65A 1RXWA 2KQ7A 4KGTA 2CU1A 3C5FA 5DPRA 1WCNA 4FZLA 8ICOA 1YZ6A 3VDZA 4HKQA 2G1EA 4E71A 1F52A 2YLMA 4BKTA 1GC7A 4GXJA 3MC8A 2WXRA 4F4WA 2QB1A 7ICUA 1J8CA 1YN5A 4YXDB 2L83A 1BUIC 8ICUA 3ZIMA 5ALPA 2AL3A 2MQJA 4NJCA 3UQ2A 2OYYA 4GN1A 2O2VA 5EDSA 2WNMA 5AUKA 2AQ0A 2AQ3B 3HPOA 2F1JA 3BVGA 1NJXA 7ICMA 2EH9A 4F5NA 2C7MB 4FN2A 2EKEC 1RQNA 5J0XA 1F2RI 1TIFA 3RR8A 3QUTA 3PO5A 1I35A 5ALHA 1QILA 4RQ6A 1WFYA 4JGHB 4PL2A 4RUAA 5AM0A 1C7YA 1OGWA 2PVGC 5CX3A 1RDFA 2BYTA 2GWSA 5D46A 2KK8A 1ZD4A 1KBUA 2L1AA 2JEFA 1R4NB 9ICGA 1ZQUA 3OJ3A 1EU4A 2WDTB 3WU2U 4YFKA 2JEIA 3LVVA 4JWUC 2LYBA 1TS2A 9ICUA 5AI8A 4YCXA 4M0AA 1VJKA 1I4RA 1UBQA 2LGYA 3U2SC 5F9NA 4ECVA 4YTPB 2L0FA 4BZAA 2YMLA 2IGGA 4DQQA 3NTUA 2H3VA 4I29A 2HHVA 1SF0A 2CU3A 1KTKA 5C1ZA 5ALGA 1UA0A 5KG6A 1EUVB 2J7QB 3GILA 3APFA 1TS3A 5F9LA 4EZKA 2G5IB 4Y2YA 5LXIB 2GI9A 1PDXA 1ZOYB 1ZQWA 1RZTA 5AHXA 3ZDBA 3EZ5A 1OFFA 2F77X 4A8EA 4N59A 1R4MB 4MT5A 1ET6A 2CS4A 3RULA 3MGHA 4ED1A 1ECWA 3KBBA 1KN5A 2KFKA 1PGBA 1ZQYA 1ZYQA 2KQSA 3L54A 2QHOA 1ZJNA 2LKYA 5CEHA 4I27A 5AI4A 9ICSA 2D8CA 2AWTA 2YY6A 1V81A 3OJUA 3NVYA 2WXNA 4IC9A 1HUOA 3IV6A 3RFZB 3MFIA 2Z0DB 3P4SB 1NNLA 4DFJA 1ZDVA 4KGRA 3RD2A 1DXSA 3PMNA 3JPOA 2D3CA 2G06A 1D5ZC 1OQQA 4AYBC 4P0QB 3TJPA 2KTRB 4IG7B 2EZZA 4TUQA 1P98A 1DGJA 3GOEA 4TQSA 4RQ5A 3ETLA 4RQ1A 3N7RC 9ICJA 1SJHD 2KZZA 4JLCA 3CMMB 3C1ZA 4PYZA 4WAFA 2B76B 2BB6A 4QNLA 5IP4D 2HDEA 3QU9A 3Q8BA 3A0HU 4DLGA 4NM1A 4MFFA 2QEJC 2INCC 2N7JA 2BTEA 1X2IA 4C0ZA 3B9JA 3WK8A 5KFCA 3V6HA 1FM0D 2KOXA 3KWVA 1SZPA 4F8RA 3C28A 8ICIA 2QIEB 1C76A 3PHWB 4L2YA 3RNGC 5D3DA 3TBLD 2IDYA 1IPGA 4LJXA 3C21A 2DENB 1WWTA 1RRBA 2KZMA 1RLFA 1YJ1A 1PVQA 3IG3A 3U8ZA 4M8NA 1D8BA 2KDBA 1ZE3D 2FAZA 3LYSA 5AK5A 3M9NB 3IVFA 4H2AA 4KDLB 2KWDA 2JWUA 5KFMA 3H8MA 1Y88A 3OGUA 4OJ6A 2IZVB 2D2QA 2E1FA 2IPKD 3NVVA 4OJ5A 4D2KA 5EWFA 3E58A 9ICOA 5IIJA 4LNNA 4B0EA 4XA5A 3ZW3A 2PMVA 5FR6A 2HHXA 3AQEA 2FLLA 3APCA 3AXCA 2KE7A 1FFVA 4DOCA 4YSZB 2V4LA 3RB4A 9ICPA 2DWQA 2DBYA 4M00A 2BQ3A 2REXA 2ACZB 3TAQA 2XIDA 4EEKA 7ICGA 2F8KA 1NZBA 1ACCA 2KMAA 1FIQA 2W7OA 1Q1OA 1T7PA 3UI3A 1RWSA 2VIXA 2MA1A 1T8EA 3VRAB 3VTUA 3SV4A 1OW5A 2N1WA 2N9PC 4PJ0U 3BVMA 3OHBA 3KUCB 2GBRA 4IRDA 3TEZA 2H3FA 4RNNA 1NOMA 3J9CA 3GZFA 2BKFA 4RF0A 5HKHA 1UT8A 2I9GA 2IOHA 4KLQA 1MQ3A 2CKHB 5TR5A 4ED3A 1BT0A 3AM9A 2G08A 2KVSA 1X9XA 1ZQRA 1F5SA 4GGQA 2L3ZA 5AM3A 3PREA 4JE3B 2F3NA 5IIIA 2PW9A 2J0KA 2A19A 4XQ8A 5ALUA 4MJSA 1HE8A 1DGSA 1UD7A 3RF9A 2KXJA 3DBHI 2XICA 3NASA 2K8CB 5J0TA 4IOIE 1MVKA 1KFSA 4W9FA 1CZPA 1AW7A 2K8CA 3H9DA 3UMCA 4MFCA 3ORYA 2AXTU 1X9MA 3PW2A 1FXIA 5KG1A 4Y2TA 3MJ5A 4M8MA 2BCQA 3PRPB 4J6IA 3NRWA 1GUAB 2GO7A 3VHTC 1L2NA 4C4SA 3MR5A 4F3OA 5J0WA 2JXJA 1P1AA 2YQEA 1M4VA 2YN4A 2VA8A 8ICEA 2WTFA 2LHDA 3B2FA 1TTNA 1Z2MA 1A70A 4J9MA 3W1YA 2KJRA 3NOBA 3UIOB 1ZDXA 2XC9A 2WXPA 4P4MA 2PFQA 1STEA 1NJYA 5J2JA 4TUSA 4HEA1 4GSWA 3ISBA 1J0GA 4Z6EA 1MQ2A 1T0QC 4HPMB 1E0ZA 3P2BA 1L5PA 4ZRKA 2N7DA 1PGXA 3FKYA 1ZKHA 3VH3B 1WGYA 4TMAB 1HUZA 3PY8A 3WKEA 4C8MA 4NV0A 1VR9A 2BHNA 3SAGA 1KLGD 4TUPA 5EWGA 2KO3A 3BQ2A 2KSOA 1YIWA 3HJEA 2GBJA 3H7PB 1ZD5A 2FDRA 3ECIA 5BMHA 2ZTDA 4FFDA 2KVZA 2W8LA 4DXAB 1QOAA 3TACB 2DZKA 2PE6B 1E5WA 4CHKA 1ZRMA 4NPNA 1PGAA 3GU3A 5JTIA 1L3VA 1KLUD 4X57B 3PZPA 4OJOA 4ITKA 4C4VB 4LCDE 2ZCCA 4XGAB 4QW9A 1YMHE 3V6CB 2LUMA 1P7FA 4RCOA 1BVSA 4LJOB 5DPSA 1PK1A 3AV8A 4F50A 2NBUA 3QQ8B 4GU2A 2C2EA 3ZDMC 2MP2A 1WGKA 2K4EA 1RPLA 1OXJA 1Q3UA 1Q5WB 1ZQLA 4O3SA 5KT2A 3MJWA 4A3PA 2MUTA 4OZAA 2W9MA 2KX3A 3PVXA 2FMQA 4F91B 1C79A 4ZRJA 2V4QA 3QZ8A 1ZQDA 1WGRA 4XDCA 4UB2A 2DX5B 4ICUA 5T8IA 5KT5A 1V1PB 2WX1A 3DWGC 3JPSA 1KKXA 1QQRA 3C0RB 2WHEA 4BX9C 4R8UA 2L8JA 2WU5B 5KL8B 3LXFA 1GPXA 3Q6BA 4UAUA 5HMMA 3IM1A 4ELVA 2H3IA 2PIAA 4PT5A 4DL5A 1KL9A 4QZBA 1NKBA 4AYBF 3TFRA 1ZQBA 3PSEB 4OD0A 4UB6U 1GG3A 3A4SC 3BS5B 5JUMA 1DRGA 4YMMA 4C8KA 2NPTB 2BCUA 2FNJB 3R3MA 2JY6A 4OW0A 4DSEA 1Y8RC 4DL2A 2FMPA 2GMIC 4JK1A 3PW4A 3VUXA 5FR3A 4RU9A 4IR9A 3HW8A 4BDPA 3ONSA 1L8LA 5AKLA 1ZQOA 3KKAC 3T5KA 5AKKA 2XBBC 2X38A 3ENEA 3Q14C 3TEWA 2BDPA 3T5HA 3AEBB 2FE9A 4MSMB 1Z4OA 2B21A 3TFSA 2PFPA 3R7RA 2WAQC 5C0YA 1IM4A 4QJFB 3M63B 4EEWA 1FNUA 1LB2B 2L0TA 2OM6A 1EWCA 2KQ4X 1T0RC 4CF5A 3DBLI 5DQGA 2WXJA 2RQ5A 2KFNA 2ZIWA 3M7DA 5KL1B 3EPIA 3HWTA 2Z8LA 4DOBA 4O5KA 1K53A 3ZJTA 2PE9A 2AQ2B 2JH1A 3ZDEA 4LNKA 3AUOA 4YTNB 3ZNHB 5AZHA 2BCRA 2F8LA 3R2TA 3AEDB 2LI6A 1K8RB 3MDCA 5ALSA 2LM4A 4KZCA 2J6SA 2PLPA 1B0XA 5CHWA 5J2KA 2V9HA 8ICHA 2KJHB 1MHXA 4PZOA 2W54A 1UWXA 4OVZA 4KX6B 4PHAA 3RJJA 2WDVB 4EX7A 5KNIA 2L5YA 3T3FA 5J18A 2H88B 2K3UA 5J2EA 4IDIA 2IO1B 1Q46A 3O0FA 2IOFK 2WAQF 2YTUA 3H0RB 2BQUA 1WE6A 3V62A 3WCQA 3LVWA 1FO4A 4J9NA 3D2SA 2Y5BB 7ICHA 1N60A 5AZGA 3QJZA 2ZTCA 1ZQZA 5HHHA 2DUYA 3BZCA 1CUKA 5JU5A 1XF5L 3ZRCA 2I2YA 3Q8SB 3EYZA 4IRKA 2ZXIA 5AK6A 2A3VA 2HHQA 2IY0B 2ZG6A 4I2BA 1WUDA 4UDUC 2LUEA 3RBEA 2MP2B 5EWEA 2RMMA 4XYCA 1SKWA 3IHPC 1V38A 2MLBA 2DF4B 2MJ3A 3VFKA 2F2AB 3RZWC 5H2FU 5DBAA 3EA6A 3CSFA 3NRZA 4RGTA 2LRWA 9ICCA 3F5EA 3THVA 4CQNA 3PPAA 1T0YA 3T9LA 4ACOA 2H3ZA 2Y1JA 5ALQA 3Q8CA 3PSTA 4LTUA 4AJYB 4JWNA 3E0FA 3JPTA 3PV8A 5JHAA 5K4LA 2MWSB 4M9JA 9ICWA 2FCQA 2P6UA 3CP8A 3I5JC 4CF4A 3GV5B 3PR5B 4I28A 4NL9C 1V5OA 1QOBA 2WYQA 1KW4A 1V5TA 5KFKA 3C19A 5H92C 3ZNZB 1WGDA 2C2DA 3ZRFA 1V1OA 1ET9A 3ZKJC 2Y9TA 3GFKB 3QZ7A 1BXTA 1L6VA 4HDOA 4GOCA 5KFBA 1T3QA 3ALBA 4J03A 4L1BA 2MX2A 2EAOA 2CPRA 4QWEA 4KSLC 3D2QA 2RDJA 3TI0A 4TSSA 3FM9A 3OJSA 2HMXA 2KFJA 2CN1A 2OH2A 1BGXT 4DSKA 1KH0A 2MJEA 5CRXA 3AULA 2M9NA 4YT0B 4F1SA 3UQAA 2LXCA 2KX0A 3B08A 3GIMA 3OTQA 1MG4A 5KG0A 4U6PA 1KFTA 3T3NA 2DKZA 3H4DA 3L16A 4B9LA 3NG0A 3RCZA 2KZRA 4IQUA 3HM3A 1L7PA 4JX1C 5JHBA 1DK2A 4M9GA 2IBKA 4FZMA 1M94A 1QQ6A 3VRBB 1WM2A 5HNKA 3V05A 5AM4A 1L4ZB 2MBBB 1Z1VA 4W9CA 3P42A 4P6VF 3A9JB 2VA2A 1QSSA 4FADA 5L9XA 1EM7A 1FXTB 1GB1A 5AKYA 4EE2A 5KG3A 4XUSA 1MHHE 2WXFA 4E3CA 5KFRA 3L3FX 4EBEA 2V3PA 4DOAA 2DGZA 4I6LB 4REZA 3AU2A 5C5JA 2K89A 1R4MI 5IIMA 1FCCC 2DNFA 4GC7A 3JVZX 2DKXA 3ABVB 1JWBD 3ISDA 4GDLA 2P66A 1SE4A 2ZIVA 2HSZA 2YEPF 5DPWA 1S0OA 3ED5A 4O3NA 2AU0A 1TZOA 4RH6A 2I1JA 2PEAA 4RPXA 3I3TB 1IIPA 2ZZPB 4NLBA 4EEYA 4OJPA 3B1LX 3B0YA 1D5MC 3HIZA 5DPTA 4JV0A 4DXFA 4LDTD 1WR6E 1FMAD 1XC9A 2KEYA 2DHZA 2FBWB 4WURA 2KV2A 8ICWA 4CYEA 3A9KB 3GS2A 3HVDA 3VR8B 2N7EA 2YB1A 4YR0A 1HQRD 3BY4B 3SQIA 1IUEA 7ICOA 4DXGA 2FCMA 2FCNA 5KFUA 1C3TA 9ICVA 3C29A 3HKZC 4KIKA 1ZD2P 1E8WA 3BZDB 2KKCA 1S0NA 1SIFA 2Y5PA 2KAJA 4Y2PA 2ESEA 2ASJA 2KVRA 4ACFA 2KTFA 2D07B 2FUG1 2MH7A 9ICTA 5DLGA 3DEEA 3MHZA 1JIHA 4HYKA 5TSSA 1T5XD 2ZIXA 3H40A 4WAAA 2HBJA 3RNAC 4M6WB 2JYEA 4DSFA 2KLCA 3SR6A 2ZTEA 4TQRA 1UNSA 4FJZA 1WF9A 4HPLB 3QEBZ 5E6OA 1GO3F 5AM2A 1EF1A 4F4KA 4JIOU 3SAHA 3PW0A 2PI4A 4O9MA 4W9IA 1IP9A 3HILA 3MDAA 1NK6A 4N58A 2BW2A 4CO7A 5I4DA 4RM9A 5AKZA 2ZW0A 3HKZF 4ECWA 2ZPYA 3DBHB 5AKXA 1DOXA 3CRXA 2RDIA 4EELA 2K8BB 4UBCA 5ALJA 4QZCA 4CDGA 5HP4A 5DB8A 1QH9A 4K7UA 5ALFA 4RNOA 2J6UA 4LDTB 4NLGA 1TT5B 3CIRB 4DHJB 1ZQQA 2BPGA 4HAIA 3KKAA 5KTQA 3BK1A 3FILA 2B0CA 4J9RA 1R7SA 4DL7A 5CTRC 3AMZA 2N0SB 2I5HA 3K1ZA 3W1SA 2ZIUA 3UQ0A 4J9LA 3QWZB 4MGYE 3N9YC 4RUCA 2AL6A 2ZUDA 3KTQA 3KWLA 3QNMA 3N30A 2ZNVC 1LM8B 1L8OA 3QXGA 2KDIA 1WM3A 4DS4A 3RH4A 5BYQA 2KSOB 4UAYA 3RJFA 2JX5A 4A8XC 1FRDA 1K5OA 1V97A 3DHHC 4KLGA 3EFUA 2K1FA 3RAXA 4B9UA 3URYA 1JWAD 2WF6A 5ALKA 3F53A 1D8YA 1O08A 2FPKA 3PVLA 1NZPA 3TQ1A 1LXDA 5KG4A 2J42A 2FMSA 4GDLB 1UBIA 3AU6A 4KX5A 4FS1A 4F2SA 4F5QA 3HK0A 4G0NB 4IQTA 5ALLA 4YVZA 3BS7A 1V9JA 5E6JA 4Y2QA 3SMVA 1FXAA 4HJKA 3TEXA 1ISNA 1IYFA 5ALIA 1I7HA 2HI0A 2KJ5A 4BUGA 5MPOA 1Q8KA 2DZJA 8ICJA 4PHDA 2D11A 2K25A 3Q2AC 3WANA 2ZJ8A 4P4OA 1ZQTA 3GDXA 5J8YA 1IBXA 5F3XB 4QZ8A 2MU2A 1Z4NA 3EPGA 4ANXA 1TKEA 1QF6A 1C4PA 3IDWA 4DSIA 3OSPA 2BBCA 3QHTA 4DHJD 2KHVA 2J52A 3GE3C 2V4RA 3TCAA 4WJNA 2HVHA 4UB1A 5J2AA 4Q8EA 4HPPA 3TIXA 3JPRA 2BPSA 2JYTA 4GB9A 4Q2JA 4NXZA 2R2QA 3JPPA 4KV2A 1T6BX 2LPEA 3B2GA 1GC6A 2LMRA 2YEPB 2IHNA 4G50A 4ZRQA 4M6WA 4J9KA 3DVGY 4UB5A 1ZQJA 5D6JB 2D5GA 1J19A 1IGCA 4RQMA 1S8OA 1T4GA 3Q3FA 1L0YB 3H8SA 3KHLA 2DYOA 2EMSA 5D2MB 5DB7A 3W2DA 2J0MA 3M95A 5GTHU 5DBBA 2B3AA 3RRHA 4YMOA 2C7NB 1UQVA 1JI7A 1GOZA 4ELUA 3AE1B 2BDUA 4DHZB 4HJGE 3VR9B 2VJ4A 1E10A 3QEAZ 3UMGA 3O65B 1C77A 3SV3A 5J0PA 3WALA 3V72A 5GMVA 1OQRA 1LQBA 3HM6X 4RZRA 2NTTA 7ICJA 1ZQCA 4P2HA 4BWJA 2G07A 3NUQA 2QKQA 2UVVA 2LFIA 3AE2B 1X6JA 2V4IB 5AICA 4C56C 3ZXRA 3VUWA 1BNPA 2RD0A 2QLTA 2JVCA 4O5EA 3BQ1A 2JT4B 2KK0A 1WWUA 1RYUA 2W9BB 2YB4A 4KLHA 2KMCA 3M1YA 5FKAC 2WX0A 1X9SA 4DSJA 1PFDA 4YR2A 5AIAA 3ZDDA 1P9DU 1WXSA 4NAWB 4UAZA 3JW0X 3BQ0A 1EO6A 2JXXA 3W5VB 4NJ8A 4KVGB 3X23A 3ZTCA 1DK3A 3F2DA 4P0PA 2QB0B 2GBMA 4P7IA 2LYHA 4YTMB 2KVCA 1ZQFA 4C4VA 2W55A 4Y2RA 3KHHA 5IINA 3DOWA 2HBLA 4P4PA 1F9JA 1LVHA 1TK8A 4LNFA 4ZDVA 2DQNB 2N9EB 2BGFA 1L3TA 2KFKB 2IMWP 2XEWA 2SEBD 2G5HB 3MFGA 3OWEB 1D8LA 3SI8A 1NJZA 4HCNB 3LK9A 4RT3A 1KF6B 1TGZB 2JRHA 3QARA 1X6IA 2HTME 3ZTDA 3NS1A 3SFDB 4LZGA 1JWSD 5J2RA 2BWFA 3KVFB 4IS7A 1Z1BA 2KG5A 4A3OA 4KMOB 9ICIA 3R8BA 4NNJB 4FJVB 3RJKA 3RT3B 5CR0A 4YXMA 4RQ3A 2BS2B 2O6VA 4LJPB 4K7WA 2G0AA 4RQ0A 3KHRA 2RPQA 1L7OA 1T3NA 2CRXA 9ICBA 1NI3A 1TAUA 1ZPSA 3AE9B 4MH0E 4MEXA 2FUHB 3M9OB 2WLBA 2IGHA 4IWPA 2H5XA 1NKCA 4ECZA 1X9WA 2M56B 5KFFA 5DDYA 3MC1A 1F0MA 4Y2SA 2IHMA 2K0PA 3TUOA 3EC8A 4KLMA 2WXQA 3WIMA 1IV8A 2LD9A 1SGHA 1D9FA 4NLZA 1JMLA 1WXVA 1N48A 2RP5A 3V60A 3RR7A 1T0SC 4QZEA 4B9TA 5L1LA 2MSED 3DDCB 2BYFA 4F4ZA 1TAMA 1ENFA 2ALZA 3FDSA 5JRTA 5IIOA 1XSLA 1LO5D 1QKZA 1N61A 2L76A 4WJQA 3G6XA 4CGZA 2KJ8A 2XCPA 1L4DB 5KFHA 4RGOS 1XU4A 5HMLA 2KTRA 4FS2A 1F44A 4XWTA 2Y1IA 2WQYB 2PI5A 1H38A 3E56A 5ALRA 1TS4A 1RXVA 3QU7A 4OZCA 2UVUA 5BYRA 1ZQKA 3SEBA 2LGXA 2NVUI 1VDVA 2KC2A 1QLBB 2NRXA 2W9CA 3G6VA 1RFAA 3P63A 2KP7A 3AEVA 3N1ZC 5KFIA 4GXKA 1E8YA 3PLUA 5DQIA 2IOFA 1XO0A 4DLEA 2NMQA 2N9KA 3CWIA 4EZLA 5C3JB 2R8HA 4K3BA 1UH6A 4F93B 4RT2A 4AOFA 3WK9A 4E74A 2K4IA 3V61A 1D6EC 3ZVVA 2KFZA 3GZNI 2KN7A 3JSVA 3BINA 3Q8RB 3Q8EA 3OHAA 3H6NA 2OCEA 1S9FA 3L5KA 3A9JA 3NZSA 4MELA 4KLJA 4FBTA 2ZNVB 4WWMA 4QWDA 4IR1A 4R66A 1XEEA 1DYQA 2QB0A 2YVCA 2C5LC 3IFWB 3KUZA 4MF2A 2R61A 2EZXA 1BPXA 2NRVA 4CF3A 1WGGA 2BYVE 4GIVA 4MF8A 3FYHA 5ALDA 1LFDA 2KDFB 1JALA 1YJJA 2EAPA 3ISCA 1CRXA 1E7UA 3KYDD 3VQIA 4YG2A 1NYQA 1OTRB 4FE3A 1SXEA 2KMDA 1UELA 3PX6A 3ZDAA 4UB8U 4ECXA 2JZBB 2LGIA 1TYGB 2WWZA 3ZJUA 1BPBA 5KT7A 2KICA 3IRUA 3M6KA 1JCKB 1S3SG 2BB5A 3DWMA 1FNWA 4ED0A 1ZQPA 4UATA 2J53A 2D3BA 3V3XA 1YOVB 1YQ4B 3VH4B 1WGHA 3BWUD 2L00B 1C20A 4AWJA 5JZEB 2BR0A 1XNSA 3ZYYX 2RR9A 5EE9A 5DB9A 1MG8A 1JUDA 3AU5A 1KRPA 1WYGA 4RQ2A 2W11A 2Q0ZX 5IILA 1RAXA 2KWVB 4DDGD 4Q45A 3H1UA 1XSNA 2Y0SC 2BYEA 5ALXA 5DG8A 3RUIB 2HVIA 4JL9A 4WQOB 3PX4A 4ANUA 9ICKA 2W9NA 5G5GA 3I76A 2VH2A 1WRDB 2H3QA 1WXMA 5L1MA 3CSTA 4MGZE 2LRUA 2NO5A
chains in the Genus database with same CATH topology
1F0ZA 1JWMD 2QJLA 2MEKA 4NAMA 3T3NA 4KGTA 2N9LA 1FCLA 4HKQA 2G1EA 1SEBD 4JX1C 3C8YA 2WXRA 1QT9A 4RGNA 4MM3B 1YN5A 4YXDB 2LMCA 2L83A 3VRBB 1JW9D 1BUIC 3V05A 1L4ZB 4A90A 4NJCA 1YN4A 3P42A 4P6VF 4C7ZA 2WNMA 1EU3A 5AUKA 1JWUD 1EM7A 2AQ3B 1GB1A 1TY0A 3BVGA 4EE2A 2WXGA 1MHHE 1CJEA 2WXFA 3AE4B 2XNAC 1F2RI 3AEFB 2V3PA 1GAQB 4JWSC 2I38A 4REZA 1QILA 4XWWA 3FILB 2FE8A 1I4QA 3KQ4A 1FCCC 2LEKA 4LLGM 3ABVB 1JWBD 2XN9C 2Y5CA 5HFYA 2BYTA 1SE4A 2PVGC 2YEPF 4RH6A 1CK1A 1TZOA 2L1AA 1EU4A 1VLBA 4O1NA 1PYWD 1FFUA 1D5MC 2WXHA 4DXFA 3NVWA 1FMAD 4JWUC 1TS2A 2FBWB 2BS4B 4WURA 5FK9C 1VJKA 4KKIA 1K51A 1I4RA 3GS2A 1B1ZA 3HVDA 2IJ0A 3U2SC 3VR8B 2NTSA 4RGMA 4YTPB 2IGGA 1HQRD 1SF0A 5EE1A 2CU3A 1IUEA 1KTKA 1HA5A 4DXGA 2BS3B 2L32A 5HG2A 1TS3A 1NVID 1XO3A 2PVOD 4NZLB 1SXTA 2GI9A 1PDXA 1ZOYB 2WXLA 3O13A 3BZDB 2Y5PA 1OFFA 2KAJA 4N59A 4MT5A 2OEDA 1ET6A 1HZ6A 2MH7A 2FUG1 1ZP0B 3MHZA 1PGBA 1BMLC 1VZ7A 5TSSA 1T5XD 3AB5A 3AH7A 1NEKB 2JYEA 4XE0A 3SR6A 4AQ7A 1B9RA 1IBXB 1UNSA 3NVYA 4MH8A 2WXNA 2VZKB 3RFZB 3P4SB 2EKIA 2JSVX 1ZDVA 4KGRA 4YWGG 1D5ZC 1I4HA 1OQQA 3BVZA 2WDRB 2M0AA 1XXGA 4GLSC 4N58A 1DGJA 2BW2A 3I9V1 1RYJA 3BYTB 5I4DA 1I4XA 1SJHD 1FRRA 2ZW0A 3EUB2 1DOXA 2GRIA 1TY2A 1MI0A 1N5WA 4US8A 3IAS1 4WAFA 2B76B 2BB6A 4MACA 1NENB 2RPVA 5GXGB 2HDEA 1TKGA 1ROEA 1UGJA 3Q8BA 3CIRB 3BK2A 2QEJC 3ETRA 3BK1A 3FILA 2N7JA 1R7SA 2BTEA 3AMZA 3B9JA 2N0SB 1FM0D 3KWVA 1Y56A 3W1SA 2QIEB 1C76A 1UWMA 4L2YA 3N9YC 2WXIA 3KWLA 5D3DA 2SAKA 2IDYA 1WWTA 1ZXHA 2TSSA 1ZE3D 4H2AA 5BYQA 1N62A 2JX5A 2JWUA 2KWDA 2V3NA 3P4QB 4HRSA 4A8XC 1FRDA 1V97A 3ZQ4A 3URYA 1FNVA 2IPKD 1C9FA 1JWAD 3NVVA 4D2KA 4KKJA 1IGDA 2J42A 2IGDA 4GDLB 4B0EA 3AEEB 3T3OA 2PMVA 3HVZA 2VZKD 3NVZA 1JRPA 1SE2A 5E6JA 3ZGZA 1FFVA 1L0VB 1RM6C 4YSZB 5D7GA 1FXAA 3TEXA 3IT6B 2DWQA 1AN8A 1I7HA 1L6UA 3U52E 2AQ1B 2Y3AA 2DBYA 1QOGA 2PTLA 1TKYA 4WQMA 5MPOA 2ACZB 1MPEA 1N63A 3LB8C 3NZ3A 1ACCA 2W82A 1FIQA 3P4RB 3AE8B 3AE3B 3UI3A 4R3DA 5LNK1 1IBXA 1RWSA 3VRAB 3PZ8A 1TKEA 1QF6A 1C4PA 2BBCA 3AEAB 3BVMA 1JROA 2W3SA 2J52A 3TEZA 5G5HA 3ZJVA 1RFKA 3J9CA 3TEYA 2ON8A 4RF0A 4OHJA 1QOFA 3MP9A 1SBBB 2JYTA 3AM9A 4Q2JA 1J7CA 5C2TB 4C80A 1T6BX 4A6QA 4JE3B 2PW9A 4ARCA 3B2GA 3IT4B 4US9A 2WXOA 2YEPB 1SB3C 1NYRA 3TSSA 4ZRQA 2KACA 1K52A 2JXTA 2D5GA 2WDQB 5BYSA 4IOIE 1FD6A 1MVKA 1CZPA 1IGCA 1AW7A 1XLQA 1V1PA 1L0XB 1F2RC 1L0YB 1FXIA 2DYOA 3MJ5A 3W2DA 2KN4A 2DLBA 2ZW1A 4WIPA 1KFYB 3Q8FA 3HRDD 1I4GA 1GOZA 5JXVA 1M4VA 3AE1B 3RPFC 4HJGE 3VR9B 1HZ5A 1E10A 1VZ6A 1P7EA 2LHDA 3B2FA 1C77A 3Q8AA 1A70A 3NUHB 1OQRA 2NTTA 1ZDXA 5AUIA 2WXPA 1XCQL 1STEA 3BIID 4XDDA 2E6XA 3PZ7A 4HEA1 3AE7B 1E0ZA 2E3TA 1L5PA 1XLNA 1PGXA 4FXCA 3AE6B 2LFIA 3AE2B 2V4IB 2QMTA 4TMAB 4C56C 1YJIA 2MJDA 1VR9A 5BMGA 1KLGD 5BMIA 1C78A 2LHEA 2K22A 2WP9B 1EWYC 3AN1A 5FKAC 5BMHA 1PFDA 1D4BA 2CJOA 3GB1A 1WSPA 3BYYB 4GDKB 3W5UB 4NAWB 1QOAA 1ZXIA 1E7PB 4ZHOA 1V8CA 3W5VB 5EE0A 1PGAA 2KDMA 1KLUD 4ITKA 4RF1A 3MC0B 2WXMA 4HROA 1YQ3B 3P4PB 4LK0M 1YMHE 4YTMB 2W3RA 2W55A 2LUMA 1P7FA 4RCOA 1ZUD2 4J3OD 3AV8A 5EE3A 1C4CA 2INNE 3U7ZA 1WGKA 1CQVA 1WRIA 2SEBD 1GB4A 3MFGA 4JPSA 1F77A 3OWEB 3EGRA 4OZAA 4HKZE 1K50A 2RDHA 1C79A 1KF6B 3SFEB 1PUTA 1DOIA 4XDCA 5D3IB 4A55A 2M19A 2HTME 3DWGC 1V1PB 5T8IA 3NS1A 3SFDB 1QQRA 1SE3A 1JWSD 2L52A 3LXFA 3FC4A 1E9MA 2WU5B 3HUIA 1GPXA 1AYFA 2PIAA 4PT5A 2WS3B 4RFBA 5H8YE 3R8BA 1I4PA 3W9CB 2BS2B 2GB1A 2K9XA 3U4EG 4ARIA 1UUPA 2CJNA 1Q10A 2DYMA 4C7YA 1NI3A 1ZPSA 2ICIA 3R2IA 3AE9B 4OW0A 1VRAB 2WLBA 2ONQA 3H8HA 4ZHPA 2IGHA 5FR3A 2LJIA 2M56B 2H89B 2X38A 1J7BA 2WU2B 5HHDG 3TEWA 3AEBB 4DQOC 2K0PA 3TUOA 4N6EB 2WXQA 4P16A 1HXYD 1JMLA 1C4AA 1FNUA 1EWCA 2KQ4X 2WXJA 4M0WA 1ENFA 3L4PA 2QILA 1LO5D 1QKZA 2Z8LA 1N61A 3LYYA 1K53A 3ZJTA 1YNTE 1L4DB 1TJEA 2AQ2B 4RGOS 2EELA 4YTNB 1JQ4A 4WH4A 2Q5WD 4XWTA 2WQYB 3R2TA 3AEDB 3E56A 1TS4A 4B0MA 1HEZE 4OZCA 5BYRA 2PLPA 3P1MA 1SIJA 3SEBA 2OHFA 1VDVA 2PKOA 4YSXB 1QLBB 1MHXA 1UWXA 2W54A 4OVZA 4KX6B 2WDVB 3P63A 2INPE 3AE5B 1AWDA 2J4XA 2H88B 2K3UA 2NMQA 4IDIA 1XLOA 5C3JB 2N9KA 3CWIA 3AEGB 4YT0B 1D6EC 3KLSX 3WCQA 3Q8EA 2AX5A 1FO4A 3AECB 4OZBA 1N60A 1ESFA 1XCTL 4WWMA 2I2YA 1XEEA 4RNAA 1XF5L 1DYQA 2JU6X 2R61A 3Q69A 2WXKA 2KMMA 4UDUC 1JALA 1YJJA 2BT6A 3IXSA 3VQIA 4USAA 2RMMA 1NYQA 2MJ3A 4ZRPA 2LGIA 3EA6A 1TS5A 1TYGB 4KGSA 3ZJUA 1J7AA 3NRZA 4RGTA 4A9AA 3DWMA 1JCKB 2BB5A 1FNWA 3FAHA 4CQNA 2J53A 2RDGA 3V3XA 1YQ4B 2QSDA 4TQ1A 3BWUD 3Q8CA 4LTUA 4YSYB 3GP7A 3ZYYX 4ZYSA 1FEHA 5EE9A 2V0GA 2K5PA 1WYGA 3PO0A 4TQ0A 1VZ8A 1SSNA 3E9SA 1KRHA 4AS1A 1QOBA 4IKGA 5H92C 3I57A 4ZOHC 1SJED 1WXQA 1V1OA 1ET9A 1DOYA 1BXTA 1L6VA 1D5XC 1T3QA 1E6EB 2JQRB 4L1BA 5HI1A 1N5XA 4L23A 2G9HD 5G5GA 3IAM1 1XLPA 2JZPA 4TSSA 1KH0A 2MJEA 1YN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F0Z A;  2QJL A;  2B76 B;  3P1M A;  3AE1 B;  3RPF C;  1NEN B;  5GXG B;  3VR9 B;  1E10 A;  1TKG A;  1ROE A;  3B2F A;  3CIR B;  3L4P A;  1A70 A;  2G1E A;  1N61 A;  3ETR A;  1OQR A;  4JX1 C;  1R7S A;  3AMZ A;  3B9J A;  1TJE A;  1QT9 A;  1FM0 D;  2N0S B;  5AUI A;  3BII D;  4YXD B;  4YTN B;  1JQ4 A;  2L83 A;  2Q5W D;  1JW9 D;  3VRB B;  2WQY B;  2QIE B;  3AE7 B;  1UWM A;  3AED B;  3KWL A;  4P6V F;  1E0Z A;  2E3T A;  1L5P A;  1SIJ A;  1XLN A;  1WWT A;  4C7Z A;  2OHF A;  3AE6 B;  1VDV A;  2PKO A;  3AE2 B;  4FXC A;  5AUK A;  4YSX B;  1QLB B;  2W54 A;  1YJI A;  2MJD A;  4KX6 B;  1CJE A;  1N62 A;  2JX5 A;  2WDV B;  3AE4 B;  3P4Q B;  3P63 A;  3AE5 B;  2K22 A;  1FRD A;  2WP9 B;  1AWD A;  1V97 A;  3AEF B;  4HRS A;  1EWY C;  1GAQ B;  4JWS C;  2H88 B;  4IDI A;  3AN1 A;  1XLO A;  3CWI A;  5C3J B;  1JWA D;  1PFD A;  3NVV A;  2CJO A;  3AEG B;  2LEK A;  4YT0 B;  3ABV B;  3W5U B;  1JWB D;  2Y5C A;  1QOA A;  1ZXI A;  2PVG C;  1E7P B;  4ZHO A;  3WCQ A;  1V8C A;  3W5V B;  5EE0 A;  2AX5 A;  1FO4 A;  3AEE B;  3AEC B;  3HVZ A;  1N60 A;  3NVZ A;  4ITK A;  1JRP A;  1VLB A;  1YQ3 B;  3P4P B;  4HRO A;  4WWM A;  4YTM B;  1FFU A;  2W3R A;  1FFV A;  2W55 A;  1RM6 C;  1L0V B;  4YSZ B;  3NVW A;  1FMA D;  1FXA A;  4JWU C;  1ZUD 2;  2FBW B;  2BS4 B;  2DWQ A;  1I7H A;  1L6U A;  3AV8 A;  5EE3 A;  1VJK A;  2DBY A;  1QOG A;  4WQM A;  1TKY A;  5MPO A;  1WGK A;  3VR8 B;  2KMM A;  2ACZ B;  1WRI A;  1JAL A;  3LB8 C;  1N63 A;  1YJJ A;  2BT6 A;  4YTP B;  3P4R B;  1FIQ A;  4USA A;  3AE8 B;  3AE3 B;  1NYQ A;  1SF0 A;  2MJ3 A;  2CU3 A;  1IUE A;  5EE1 A;  1RWS A;  3VRA B;  1TYG B;  2BS3 B;  1J7A A;  1KF6 B;  3NRZ A;  1TKE A;  3SFE B;  1PUT A;  4A9A A;  1DOI A;  1NVI D;  1XO3 A;  3AEA B;  2M19 A;  2PVO D;  3DWM A;  1QF6 A;  1PDX A;  1ZOY B;  1JRO A;  2W3S A;  3FAH A;  2HTM E;  3DWG C;  5G5H A;  3NS1 A;  1OFF A;  2KAJ A;  3SFD B;  1YQ4 B;  1RFK A;  2L52 A;  3LXF A;  3FC4 A;  4N59 A;  1E9M A;  2WU5 B;  3HUI A;  1QOF A;  4LTU A;  4YSY B;  1GPX A;  1AYF A;  2MH7 A;  3ZYY X;  1ZP0 B;  2PIA A;  5EE9 A;  2WS3 B;  2K5P A;  5H8Y E;  3AM9 A;  1J7C A;  5C2T B;  3W9C B;  4C80 A;  2BS2 B;  1WYG A;  3AB5 A;  3AH7 A;  2K9X A;  3B2G A;  1NEK B;  4US9 A;  2CJN A;  3PO0 A;  3SR6 A;  1SB3 C;  4C7Y A;  1NYR A;  1NI3 A;  3NVY A;  1KRH A;  1B9R A;  1QOB A;  3AE9 B;  5H92 C;  2WLB A;  2WDQ B;  2EKI A;  3P4S B;  4ZHP A;  4ZOH C;  1CZP A;  1WXQ A;  1XLQ A;  1DOY A;  1L6V A;  1OQQ A;  2M56 B;  2H89 B;  1FXI A;  1T3Q A;  2WDR B;  1E6E B;  1J7B A;  2WU2 B;  2JQR B;  4N58 A;  1DGJ A;  1N5X A;  3AEB B;  1RYJ A;  4N6E B;  5G5G A;  1FRR A;  3EUB 2;  1KFY B;  1XLP A;  3HRD D;  1DOX A;  1N5W A;  2MJE A;  4US8 A; 
#chains in the Genus database with same CATH topology
 1M6Y A;  4IM0 A;  4Z6D A;  3DDH A;  1G6J A;  2N9L A;  1YX5 B;  2LZ6 A;  3I63 C;  1J97 A;  3QUB A;  2JZ3 B;  1SEB D;  5KT4 A;  4R63 A;  2MSN A;  3Q3M C;  5E79 U;  4RGN A;  2M0N A;  1Z00 B;  4RQ7 A;  4KSK C;  3K75 D;  2BCS A;  8ICB A;  2LMC A;  2ES6 A;  4EBD A;  2JV3 A;  1S97 A;  4A90 A;  1YN4 A;  4EKU A;  5KFN A;  2NR2 A;  2Y0S F;  2V3S A;  2Y9U A;  2PFN A;  1EU3 A;  1JWU D;  3M9M B;  2C22 A;  2OOB B;  3NJT A;  3PZD A;  5CHG A;  1TY0 A;  4RMA A;  4YD1 A;  2XI9 A;  1U4B A;  2R18 A;  1CEZ A;  1KM7 A;  1UHU A;  4UAR A;  2FLP A;  4DSL A;  4GC6 A;  5G55 A;  2XNA C;  7ICL A;  3AEF B;  2EDU A;  4KLT A;  2ATL A;  1GAQ B;  2I38 A;  3J81 j;  4XWW A;  3FIL B;  2Q4T A;  3N7S C;  3KHG A;  1WWV A;  2FE8 A;  4DEZ A;  1I4Q A;  3KQ4 A;  2NRZ A;  2V9W A;  2WB1 F;  2LEK A;  3LDA A;  2LJ5 A;  4LLG M;  2Y5C A;  5HFY A;  2G45 B;  4CCH A;  4ECR A;  2KC1 A;  3QE9 Y;  5IKC M;  5ALZ A;  3QK0 A;  4KLU A;  2FCS A;  4UBB A;  3WKC A;  1CK1 A;  3V7J A;  3ML9 A;  4ED7 A;  4II2 B;  4EX6 A;  1ED1 A;  2M1M A;  2I1Q A;  4NJ7 A;  1VLB A;  4O1N A;  1DOQ A;  4FUL A;  2WXH A;  1TFR A;  3WAO A;  3K1R B;  1ZQX A;  3IHQ B;  3AL0 B;  5ALY A;  4KKI A;  1K51 A;  1SXD A;  4Z6F A;  2IJ0 A;  1SGG A;  2NTS A;  4G3X B;  4I2D A;  8ICG A;  4CRX A;  2KNB A;  3A4R A;  1ZQE A;  8ICC A;  2HBM A;  5EE1 A;  4UQG A;  1XO1 A;  1HA5 A;  8ICP A;  3ZO5 B;  1U45 A;  2FPL A;  4I2E A;  2K6D B;  4GXB A;  1RYR A;  3TAR A;  2WF9 A;  3NZU A;  3MC9 A;  4IW0 A;  5KFT A;  2WXL A;  1QCK A;  5BPC A;  2WB1 C;  2F44 A;  5KFX A;  1WX9 A;  2UYZ B;  2XVT A;  2VA3 A;  1ZP0 B;  3TMP B;  2J0J A;  3ZLZ A;  2OWO A;  4NLN A;  2DL0 A;  1T94 A;  2A1J B;  1D9D A;  1BML C;  2ASQ A;  1VZ7 A;  1L7Y A;  2RRD A;  3RMK C;  9ICA A;  5AKE A;  1C1Y B;  3DV9 A;  1NEK B;  1Z5S B;  4WJO A;  2KAN A;  1U4A A;  4AQ7 A;  3T8M A;  1IBX B;  4MH8 A;  2AGO A;  3EW9 A;  4Q8F A;  3M62 B;  4ED8 A;  2EKI A;  2W43 A;  2JSV X;  1U47 A;  1F1H A;  4F5R A;  3D2N A;  1H4R A;  4PS8 A;  5J0R A;  1WR1 A;  3BVZ A;  4A20 A;  3K9O B;  4R8U B;  4Y2J A;  3RI7 C;  1UCV A;  5J2B A;  4GLS C;  1WZ3 A;  3MR6 A;  3QAQ A;  3RNC C;  2AQ4 A;  1RYJ A;  1NK9 A;  2IO3 B;  4GIB A;  1I4X A;  3H7I A;  1FRR A;  2QCZ A;  3S6J A;  1N5W A;  4GFJ A;  1MI0 A;  3IAS 1;  1NK7 A;  1SL2 A;  1NK4 A;  1EF5 A;  2K8B A;  2RPV A;  3Q8L A;  2PXI A;  4DFP A;  5L1J A;  4KLF A;  3PRM B;  3BK2 A;  4HLE A;  1ZQS A;  3WKD A;  4RPZ A;  8ICT A;  3KZI U;  3H0M B;  4HVB A;  4QZ9 A;  1TZ1 A;  1VCB A;  9ICE A;  2C28 A;  2LGD A;  1LV5 A;  4DWF A;  3C5G A;  2ZIU B;  9ICL A;  4J9S A;  1E7V A;  1ZXH A;  3OJ4 B;  3IP4 B;  4ECU A;  5KFL A;  5KFE A;  2TSS A;  3N97 B;  1N62 A;  4QWA A;  3P4Q B;  2W9B A;  2XY5 A;  2KWU B;  3BQT A;  4EZJ A;  2MCN B;  4MEY A;  3VTW A;  1FNV A;  5AI6 A;  1SKS A;  2D3A A;  3Q3O C;  3L08 A;  1WIA A;  3X0W A;  2EZY A;  2K4H A;  5DB6 A;  3HT3 A;  1IGD A;  1JRU A;  1V49 A;  4G11 A;  4XX5 A;  3RNF C;  4ASW C;  2WF5 A;  3C2K A;  3AEE B;  4GXI A;  4E0D A;  2X8X X;  1V85 A;  3T3O A;  3QU4 A;  3HVZ A;  3NVZ A;  1WH3 A;  2LWP A;  3OSN A;  4DL4 A;  3GII A;  1SWW A;  4PGQ A;  1X42 A;  2NYV A;  2W04 A;  1L0V B;  1RM6 C;  2HHS A;  5D7G A;  3BZK A;  2WHI A;  4QWC A;  4DQP A;  1QLN A;  4YMN A;  1AN8 A;  5KT3 A;  3U52 E;  2AQ1 B;  2LYA A;  1TKY A;  2BVC A;  3QC8 B;  2KNJ A;  4TUU A;  5BOM A;  3LB8 C;  1N63 A;  5AI9 A;  2G4S A;  4MSQ B;  5E6N A;  5KFS A;  5J0U A;  3RAQ A;  3AE8 B;  3AE3 B;  1AQ6 A;  3B0A A;  3ZDT A;  3APD A;  2N9X A;  3PGE A;  4R3D A;  2KKP A;  3VAW A;  3PZ8 A;  2KD1 A;  1XQQ A;  4NL9 A;  3AEA B;  5C23 A;  3MAB A;  4Y2X A;  2W3S A;  2L05 A;  5G5H A;  1SKR A;  3ZJV A;  4RQ4 A;  3GE8 C;  2ON8 A;  2Z7J A;  2GBK A;  4OHJ A;  4O5C A;  4BBN C;  2WF8 A;  3VC8 A;  3CF6 E;  2P35 A;  2O6V B;  2K4P A;  4PYU A;  3AQF A;  3RNB C;  3RJH A;  1ZOL A;  1J7C A;  5C2T B;  4A6Q A;  4ARC A;  3IT4 B;  2MUT B;  1ZQV A;  3R7Q A;  3UGB B;  4KMU A;  2O6K A;  2KAC A;  4FA6 A;  1S1Q B;  5BYS A;  4DFK A;  1FD6 A;  4K1R B;  1RG6 A;  2JRZ A;  1XLQ A;  1V1P A;  5GTI U;  2CHX A;  5KFJ A;  3MGI A;  4DL6 A;  3L10 B;  5J2D A;  2KN4 A;  5FP0 A;  2DLB A;  2ZW1 A;  4LVS A;  2PPH A;  5L1K A;  3Q8F A;  2I1K A;  3RRG A;  1NDD A;  1I4G A;  4W9L A;  5CA7 A;  2UVW A;  1V80 A;  4PK1 A;  1ZQN A;  1XD3 B;  3RPF C;  5J0Q A;  2NRT A;  1HZ5 A;  4DQI A;  1P7E A;  3DVN V;  4F5O A;  3UXP A;  4BGD A;  4S17 A;  3WAM A;  3PX0 A;  5EOZ A;  3IN5 A;  2ISP A;  5ALT A;  5AUI A;  4FZN A;  3PSI A;  7ICP A;  4FBU A;  1XCQ L;  2VAN A;  2BWE S;  3UIP B;  3ZD8 A;  3A1Q B;  4J9P A;  4BFR A;  1U49 A;  8ICM A;  7ICR A;  1S10 A;  4C4T A;  2V1Y A;  3R9K A;  2W9C B;  2ASD A;  2RSU A;  4DFD A;  5KG7 A;  5BMG A;  5KFG A;  2W7P A;  4RPY A;  4P1B C;  2XGQ A;  2LHE A;  3HP6 A;  2K22 A;  2KJ6 A;  3N4M B;  4DCC A;  2ZIW B;  3ML8 A;  1WJN A;  2GBN A;  3UM9 A;  2ZCB A;  4GDK A;  2N4F A;  8ICV A;  2ASL A;  2O6V D;  5IAA C;  1PVP A;  3BYY B;  4GDK B;  4PZN A;  3RH6 A;  3RNE C;  2E8P A;  2MBH A;  3ZNI D;  1ZXI A;  3N28 A;  4EZ6 A;  1E7P B;  1BNO A;  2C9W B;  4W9E A;  5EE0 A;  4S0R A;  3PRZ A;  3WK4 A;  5J0S A;  1JXL A;  1KQQ A;  3MC0 B;  4RF1 A;  4HRO A;  3P4P B;  5B66 U;  4LK0 M;  2R8K A;  3C23 A;  4WJ3 B;  2KHQ A;  2GOL A;  5TIS U;  1KFD A;  1ZUD 2;  1COK A;  1TE2 A;  8ICL A;  5EE3 A;  1ZJM A;  2INN E;  4UB4 A;  3U7Z A;  1WZ0 A;  1ZRN A;  1CQV A;  4B9K A;  2MBE A;  1MJD A;  4W9G A;  2RHF A;  2ZIX B;  1J2M A;  3EGR A;  4HKZ E;  2G3Q B;  2JRI B;  3LJ3 A;  3DVG X;  4UAS A;  1PUT A;  3GIJ A;  2WF7 A;  4Q43 A;  2KD0 A;  1UT5 A;  1WCL A;  2HTH A;  1SE3 A;  2L52 A;  3FC4 A;  4DK5 A;  1E9M A;  3HUI A;  2NBW B;  2R8I A;  3SZ2 A;  4Z6C A;  2KDE B;  4KTQ A;  5ALV A;  2P6R A;  3T5J A;  4M47 A;  3T79 A;  3QYP A;  3SDL C;  3D6J A;  3W9C B;  2GB1 A;  1ZQM A;  3GQC A;  2AGP A;  1TVA A;  3LDZ E;  2DYM A;  1Q10 A;  4C7Y A;  2ICI A;  3UF8 A;  5D49 A;  4I2F A;  3AI5 A;  3DBR B;  4KLO A;  4F92 B;  4NLK A;  2YMM A;  2ZPN A;  3H8H A;  3M3J A;  4ZHP A;  4B6J A;  1A5R A;  1VJ5 A;  5CJ7 A;  1JMS A;  4IQV A;  3I1Y A;  3SYZ A;  1BPE A;  4ED2 A;  1SV0 A;  8ICR A;  1J7B A;  1TK5 A;  2FJ6 A;  3L17 A;  4DQO C;  1CMX B;  1E8X A;  4N6E B;  4UAW A;  5J0O A;  2BQQ A;  2OJR A;  4P16 A;  1C4A A;  1L6N A;  2WFA A;  1S0V A;  2KWC A;  2XK5 B;  4F2R A;  3M6Z A;  2J6T A;  4M02 A;  5L83 A;  2JZZ A;  1UZX B;  3N3K B;  4M0W A;  2OXO A;  5DG7 A;  2NCN A;  3L4P A;  2QIL A;  4KLD A;  3VUY A;  4YQW A;  1MSW D;  3IG5 A;  8ICA A;  5LXH A;  1S77 D;  1Z00 A;  1TJE A;  2VRR B;  2JH7 A;  2HBK A;  3I28 A;  2E8M A;  4I2A A;  1UA1 A;  2I6X A;  3DHI C;  4ICV A;  2XY7 A;  3QX1 A;  4B0M A;  1HEZ E;  3P1M A;  1SIJ A;  4DF8 A;  1L3S A;  2OHF A;  2MBO A;  2PKO A;  2QC8 A;  4YSX B;  4RQN A;  1L5U A;  4ZH4 A;  4IM2 A;  3Q8M A;  3MBY A;  3DCG A;  2AEH A;  2INP E;  4KN7 A;  3AE5 B;  2W03 A;  4ZRI A;  4IUM B;  4ECS A;  2Z0E B;  1JN3 A;  3Q8K A;  5BO4 B;  4DBG A;  1N56 A;  1WY8 A;  4IWO A;  3DHG C;  4PS7 A;  3V6K A;  4EBC A;  1HEK A;  4EZ9 A;  5A0L A;  7ICV A;  1ZET A;  4OVV A;  5J2C A;  2AX5 A;  3AEC B;  4OZB A;  5J8Y C;  3JSV B;  1L7N A;  1WMH A;  4NQK E;  1UGM A;  4O3O A;  1XCT L;  4RNM A;  2PFO A;  4I2I A;  4RNA A;  2WXK A;  4KX3 A;  3KW5 B;  1XWL A;  3M8R A;  5G2N A;  1SV4 A;  2OEH A;  3EFC A;  3RB3 A;  3DQV A;  3PHX B;  2MAX A;  2ZVO A;  2BT6 A;  1ZQI A;  4OO1 J;  4I2J A;  3PT2 B;  3BS5 A;  2RLT A;  4ZRP A;  4MJS B;  4DHZ E;  2NPT A;  1TS5 A;  4IWQ A;  3UXO A;  8ICX A;  1J7A A;  2LXA A;  4W9H A;  2MRL A;  2NV3 A;  2KHW B;  2JZB A;  1WG8 A;  1HTO A;  2RDG A;  3PTF C;  1A0P A;  4KLE A;  1VD2 A;  2FIF A;  2KN5 A;  2HHU A;  4QIW C;  2KKV A;  2KLG A;  4DQS A;  5KHO A;  4ZYS A;  1FEH A;  4WWO A;  4BXO A;  2V0G A;  3V6J A;  2K5P A;  4DF4 A;  1OQY A;  3SEI A;  5LLI A;  4YR3 A;  1FEZ A;  2IA6 A;  3PML A;  3NHE B;  3N1X C;  4TQ0 A;  2BKR B;  2MHJ A;  1KRH A;  4AS1 A;  1SE9 A;  3H4B A;  3GZN B;  4IKG A;  3Q3J A;  3I57 A;  3V7L A;  1P0R A;  4KIK B;  2M17 A;  4ZOH C;  1SJE D;  5AZF A;  4M9H A;  4J9Q A;  5AKI A;  7ICS A;  3EEC A;  2DAJ A;  1D5X C;  4AUQ C;  2R2O A;  1E6E B;  2A1A A;  1XSP A;  1N5X A;  2E5S A;  2MRP A;  4KN4 A;  4I2H A;  2LBO A;  2DAF A;  4XZ4 A;  3IAM 1;  1XLP A;  4NM2 A;  1S0M A;  1TK0 A;  7ICQ A;  4QWB A;  4NJ6 A;  5KAI U;  3SD7 A;  3H0L B;  4DS5 A;  8ICK A;  2D3D A;  3MHS D;  2MEK A;  4PH5 A;  2F1H A;  1ZQG A;  1FCL A;  4M0W B;  2YX8 A;  5J2I A;  3MR3 A;  3G6Y A;  4BKG A;  1AAR A;  3C8Y A;  1QT9 A;  5IO9 A;  3OAW A;  2W8K A;  4MM3 B;  4NAW A;  1JW9 D;  1NBF C;  4HCP B;  2XO7 A;  1QTM A;  2ZVN A;  2D6F C;  4PL1 A;  9ICR A;  4P0P B;  4K3C A;  4C7Z A;  5J2F A;  3QU2 A;  5KHQ A;  2JGA A;  2WXG A;  2PKE A;  3OPX A;  5DQH A;  4HWI B;  1CJE A;  5TZV A;  2DPJ A;  3AE4 B;  3JPN A;  4EEN A;  3WAP A;  3NY5 A;  3RB6 A;  5D94 A;  2F1I A;  3H7S A;  4JWS C;  1RQL A;  3SAF A;  2BGW A;  4AP4 C;  1QQ7 A;  2VH1 A;  8ICY A;  2C60 A;  3AU4 A;  2IY1 B;  5IN7 A;  4MGK E;  4ECQ A;  2XN9 C;  5AM5 A;  1V86 A;  5KFD A;  4IQW A;  1NK5 A;  5KFA A;  4K4I A;  4IC7 B;  1PZN A;  1WJ6 A;  2CR5 A;  2JF5 A;  3DBL B;  4J9O A;  1P7D A;  1S76 D;  2RGF A;  3K4G A;  1PYW D;  1FFU A;  1U9L A;  4FJY A;  3NVW A;  3LWL A;  3L0W B;  2BS4 B;  4IM3 A;  2YMP A;  3KD3 A;  5FK9 C;  4K4G A;  1NJW A;  1B1Z A;  3TAD A;  3QIJ A;  2BKE A;  4YD2 A;  4RGM A;  2M0X A;  1YT3 A;  5KG2 A;  5J17 A;  4NWI A;  5CHF A;  2EQY A;  5ALW A;  1IG6 A;  4C8O A;  2BS3 B;  1Q3V A;  1QZE A;  4I6N B;  4ANW A;  1LKY B;  2L32 A;  5HG2 A;  3RZF A;  1NVI D;  5KAF U;  1XO3 A;  3C1Y A;  2PVO D;  4NZL B;  1LKY A;  3N7P D;  1SXT A;  3O13 A;  9ICX A;  2ZEQ A;  1KLN A;  3ZD9 A;  2BPC A;  2OED A;  1HZ6 A;  4K4H A;  5IIK A;  1HIW A;  3PS6 A;  1QQ5 A;  3PW5 A;  3RB0 A;  4UB3 A;  2LGS A;  4BXO B;  5ALN A;  3AB5 A;  3AH7 A;  4XE0 A;  2E8O A;  1GNU A;  1B9R A;  5AKJ A;  4OVU A;  2PMZ F;  2VZK B;  4ICA A;  3KUD B;  4GMV A;  3RN9 C;  2ZJ5 A;  5AM1 A;  1L7M A;  1KOT A;  4UW9 A;  4P0Q A;  4FBJ B;  4C4R A;  4YWG G;  5J0Y A;  2JUO A;  2AGQ A;  1I4H A;  3RYT A;  1NKE A;  2WDR B;  2JWZ A;  4QW8 A;  2FPM A;  2OJW A;  1ZQH A;  2M0A A;  1XXG A;  2M8S A;  3I9V 1;  5AK4 A;  4ED6 A;  3BYT B;  3KOO A;  3V7K A;  3EUB 2;  2O2V B;  2HJ1 A;  2GRI A;  2DZI A;  1COO A;  4OCZ A;  4US8 A;  5HHI A;  1TY2 A;  3VVW B;  4AJW A;  1H8C A;  3UMB A;  4MAC A;  2F76 X;  1NEN B;  2DZM A;  5GXG B;  2JMG A;  1V9P A;  1TKG A;  4QZD A;  5DGB A;  4XRH A;  4YN4 A;  1ROE A;  4I2G A;  1UGJ A;  4LZD A;  5AK3 A;  2HD5 B;  3C2L A;  4PS3 A;  4QZG A;  4MHV A;  4B9N A;  1A77 A;  3ETR A;  1KDH A;  3MTN B;  4HXD A;  1KJT A;  4TV3 A;  1SV0 C;  2R8J A;  1OEY J;  4XC2 A;  2NS5 A;  1Y56 A;  7ICK A;  2KJ9 A;  3A33 B;  2HE7 A;  1MC8 A;  5DBC A;  1UPH A;  5ALO A;  1UWM A;  2PMZ C;  4JV1 A;  3OLM D;  3MGV A;  2FI1 A;  2PJH A;  3RFA A;  4Q44 A;  1ZQA A;  4TUR A;  1LGR A;  2SAK A;  2WXI A;  3N20 C;  1JX4 A;  3U26 A;  2K60 A;  4Y2V A;  3TAN A;  2C2R A;  5HR6 A;  5HR7 A;  4B95 A;  4EFO A;  3H8J A;  2JHD A;  1TV9 A;  1URJ A;  2V3N A;  2GLS A;  3IG8 A;  4HRS A;  4EYI B;  3F2B A;  3ZQ4 A;  3QU5 A;  3A9K A;  1I42 A;  3JPQ A;  3DBS A;  1C9F A;  1X40 A;  1KLV A;  2XCA A;  4KKJ A;  2GOW A;  1MFW A;  3NS8 A;  5KFZ A;  2IGD A;  2AYO B;  1NK0 A;  1PVR A;  3KH0 A;  3CYM A;  4FHJ A;  2JEG A;  2VZK D;  3VCB A;  1JRP A;  1QSL A;  3EWA A;  3WKB A;  4B6W A;  1SE2 A;  3ZGZ A;  5T14 A;  7ICN A;  8ICN A;  1NI2 A;  2ZJA A;  3IT6 B;  4QAY A;  4JUZ A;  5KFW A;  1L6U A;  2HW3 A;  4W9J A;  5KFO A;  7ICT A;  1K1Q A;  9ICF A;  2Y3A A;  1QOG A;  2PTL A;  4WQM A;  3KZX A;  2HHW A;  3HHM A;  1MPE A;  4O3P A;  4QIW F;  3NZ3 A;  1BPZ A;  2W82 A;  3P4R B;  1TAQ A;  4KZ0 A;  2LAS A;  2HDO A;  4A9A A;  2XY6 A;  5LNK 1;  4CNQ A;  4ECY A;  4B9M A;  4G3I A;  4JQW C;  4OJL A;  4G9B A;  2NBV B;  4LNO A;  1JRO A;  3MR2 A;  1E90 A;  4EYH B;  2IBI B;  5J29 A;  5B5E U;  1RFK A;  3TEY A;  1A76 A;  3F2C A;  1QOF A;  3SHQ A;  3MP9 A;  1PUZ A;  2MA9 B;  3C2M A;  1KTQ A;  5D4B A;  1SBB B;  2VKQ A;  1YD8 U;  3CW2 C;  2LVQ A;  2EAM A;  4JB3 A;  3GV7 B;  4C80 A;  4DL3 A;  4ZYN A;  3UQB A;  4W9K A;  4US9 A;  2WXO A;  3S2A A;  1SB3 C;  5DGA A;  1NYR A;  3TSS A;  2EAN A;  3LWM A;  3TAP A;  4DWI A;  1K52 A;  2JXT A;  5KFQ A;  3Q8P B;  2WDQ B;  4JMU A;  3UPQ A;  3ZI4 A;  3VXW A;  1L0X B;  5IA7 A;  1F2R C;  2E1E A;  5KG5 A;  1A6S A;  4WWN A;  4BKS A;  4WWP A;  4NLC A;  2A4Z A;  2LVO A;  4KIT B;  4M01 A;  2MW5 A;  2KOB A;  3B0X A;  4WIP A;  1KFY B;  3HRD D;  2ODG A;  3DBR I;  3N32 A;  3TKA A;  1B4F A;  5DG9 A;  2ZXH A;  3PW7 A;  1PQS A;  4WJP A;  5JXV A;  2M4N A;  4FLH A;  5AI5 A;  1VZ6 A;  2GH1 A;  2HCF A;  4BWM A;  4ECT A;  2BZF A;  3Q8A A;  1QSY A;  4M2Y A;  1WI0 A;  3NUH B;  2KIW A;  1D3Z A;  3PR4 A;  2DFL A;  4FHK A;  8ICQ A;  9ICH A;  2C7H A;  3BII D;  4XDD A;  3L13 A;  2E6X A;  4RQ8 A;  2K6Q A;  3PZ7 A;  1ZD3 A;  3AE7 B;  2K8H A;  1YZ7 A;  4DFM A;  2UVR A;  4KLS A;  2L7R A;  5AKH A;  3A1Q A;  4MEM A;  2E3T A;  1XLN A;  4FXC A;  3AE6 B;  4PPX A;  3RJI A;  2LI5 A;  4K7S A;  8ICS A;  2QMT A;  4Y2U A;  1YJI A;  2MJD A;  2G09 A;  2XK5 A;  5BMI A;  2LM1 A;  1C78 A;  1P3Q U;  2WP9 B;  3H7P A;  1E8Z A;  2AJQ A;  2CHZ A;  4I6P A;  1EWY C;  7ICI A;  2K8A A;  4C8N A;  3AN1 A;  5KFV A;  1XT9 B;  1WX8 A;  2NRW A;  3PSF A;  3WK7 A;  1D4B A;  2CJO A;  4KLL A;  3GB1 A;  1WSP A;  3W5U B;  2MBQ A;  5IOI A;  4QZF A;  2DPI A;  3E2E A;  4ZHO A;  1V8C A;  3QUC A;  1WMH B;  3BDP A;  4JWM A;  1WJU A;  4F4Y A;  2KDM A;  4DQR A;  2WXM A;  4II3 B;  1YQ3 B;  8ICF A;  5KT6 A;  3SU8 X;  2W3R A;  2EMT A;  2CHW A;  3A0B U;  2B6G A;  1X66 A;  4LNI A;  5CHV C;  2BPF A;  5L95 C;  4F5P A;  4J3O D;  1C4C A;  4UAV A;  3UXN A;  2KTQ A;  2ZUC A;  1WRI A;  4O0I A;  4B9S A;  1N2X A;  4BKS D;  1GB4 A;  4JPS A;  1F77 A;  5E6P A;  4O3M A;  3RBD A;  1S5L U;  4F71 A;  2ZIV B;  1SL0 A;  2HJ8 A;  2K39 A;  1WXA A;  2RDB C;  5AKG A;  1K50 A;  1MN8 A;  2RDH A;  1KSP A;  2HOF A;  1V6E A;  4DDI D;  3SFE B;  1O03 A;  1DOI A;  1WX7 A;  5D3I B;  4A55 A;  2M19 A;  3QX7 A;  4ELT A;  2IO2 B;  2QDF A;  3V6E B;  1OEY A;  1FPY A;  3U30 A;  4MGI E;  1CI4 A;  2N1V A;  4C8L A;  1X1M A;  3TAD C;  4QZA A;  4YP3 A;  1AYF A;  1ZW7 A;  4BVU C;  4PGX A;  2WS3 B;  3GIK A;  5CP2 A;  8ICZ A;  1ZGU B;  2IND C;  4RFB A;  2GLE A;  5H8Y E;  3PV1 A;  5DCN A;  2E8N A;  3RJE A;  1IXR A;  1I4P A;  5KFY A;  1F0Z A;  4PHP A;  2K9X A;  3U4E G;  4ARI A;  1UUP A;  2CJN A;  1ZQ1 C;  1PK3 A;  3PNC A;  3R2I A;  3M8S A;  2KZ3 A;  1VRA B;  3K9P B;  2ONQ A;  3BQ7 A;  4CE6 A;  3QA8 A;  2LJI A;  1RYS A;  7ICE A;  4DO9 A;  3WA0 A;  3PLV A;  2D10 A;  1XS9 D;  2H89 B;  3Q3N C;  2JEJ A;  5DLF A;  2WU2 B;  1JXE A;  2VJ5 A;  5HHD G;  2AHO B;  3RJG A;  3PO4 A;  4MDK E;  9ICQ A;  2LVP A;  5AIB A;  1HXY D;  3RH5 A;  1YQB A;  1L3U A;  1Z19 A;  4KLI A;  3ZUN A;  5CB1 A;  4F4X A;  3EHV A;  2QAR B;  5KFP A;  1V2Y A;  4BOS C;  1GJZ A;  4PGY A;  3GV8 B;  3H8W A;  5J2H A;  1BPY A;  2FLN A;  2QAR A;  2JPH A;  4YL8 A;  1EXN A;  3LYY A;  3BJY A;  4NY0 A;  1NK8 A;  4MM3 A;  1YNT E;  3KYC D;  5L1I A;  1HTQ A;  1B43 A;  2W9A A;  2EEL A;  1WYW B;  1JQ4 A;  4WH4 A;  2Q5W D;  3WKA A;  3DVN U;  4P1C C;  5J2G A;  4FO6 A;  3TL5 A;  7ICF A;  2UU7 A;  3QCA A;  4U7C A;  4HK2 A;  3ONN A;  4MFA A;  1WJ4 A;  1SWV A;  2R8G A;  1TBE A;  1U48 A;  2UWQ A;  4N9F 4;  1AWD A;  2J4X A;  9ICN A;  3ICX A;  3NGD A;  1XLO A;  1Q0W B;  4RM8 A;  4EUT A;  3W1S C;  2ZJD A;  3AEG B;  4K81 A;  9ICM A;  3DPD A;  3KLS X;  3KFU F;  5ALM A;  4BOZ B;  2BQR A;  1ESF A;  2KT7 A;  4F8C B;  2JU6 X;  3Q69 A;  4I2C A;  3SD5 A;  2CXY A;  3HX0 A;  1WE7 A;  3D32 A;  1PK1 B;  1OUQ A;  2KMM A;  1N6Z A;  2ISO A;  4GLX A;  4URK A;  1R4N I;  2N1R A;  3IXS A;  4BBN F;  3VTV A;  4USA A;  2BF8 B;  4F7Z A;  4O3R A;  5JH5 C;  4O3Q A;  2XGP A;  2FID A;  2NO4 A;  2IYD B;  2HHT A;  4NY8 A;  4M9L A;  4KGS A;  3PSP A;  4F72 A;  2BCV A;  4X5V A;  1UF0 A;  4HDQ A;  3FAH A;  1ARO P;  3WK5 A;  3WK6 A;  3CNH A;  2QSD A;  4TQ1 A;  2G4D B;  1B22 A;  3GP7 A;  5BOL A;  5CWR A;  3JYU A;  4TKN A;  3N1Y C;  2A5U A;  3ALR A;  2ZUB A;  3QUQ A;  4B9V A;  1HJP A;  4BAX A;  1YX6 B;  4PHE A;  5DDM A;  4M04 A;  2DYB A;  3PO0 A;  3U7D A;  1KEJ A;  5ALE A;  4IRC A;  1SSN A;  1VZ8 A;  3E9S A;  3SEN A;  4C00 A;  5AEK B;  3ZNG C;  1K1S A;  3Q8Q B;  4KDI C;  3R66 C;  4BJQ A;  4W9D A;  4EOY A;  5AI0 A;  2AH5 A;  1WXQ A;  4QZI A;  1SZH A;  3F5A A;  4M9N A;  3UIN B;  1DOY A;  4NQL B;  4ANV A;  1SL1 A;  2JR5 A;  2IO0 B;  3RTV A;  4AP9 A;  2Z59 B;  2JQR B;  2HOI A;  4IL6 U;  1MA7 A;  1Z3E B;  3OG5 A;  2HOQ A;  4L23 A;  5DKW A;  5HI1 A;  2G9H D;  1J2N A;  2YMQ A;  4JV2 A;  2LHT A;  2A1J A;  2WGS A;  3ZDC A;  2JZP A;  3IBE A;  2KIV A;  4YSY B;  3T5L A;  4R64 A;  1YN3 A;  2D3G A;  4YXJ A;  3MFH A;  4QZH A;  1BPD A;  1TKD A;  1JWM D;  2QJL A;  2KYW A;  4NAM A;  3ZXV A;  4R65 A;  1RXW A;  2KQ7 A;  4KGT A;  2CU1 A;  3C5F A;  5DPR A;  1WCN A;  4FZL A;  8ICO A;  1YZ6 A;  3VDZ A;  4HKQ A;  2G1E A;  4E71 A;  1F52 A;  2YLM A;  4BKT A;  1GC7 A;  4GXJ A;  3MC8 A;  2WXR A;  4F4W A;  2QB1 A;  7ICU A;  1J8C A;  1YN5 A;  4YXD B;  2L83 A;  1BUI C;  8ICU A;  3ZIM A;  5ALP A;  2AL3 A;  2MQJ A;  4NJC A;  3UQ2 A;  2OYY A;  4GN1 A;  2O2V A;  5EDS A;  2WNM A;  5AUK A;  2AQ0 A;  2AQ3 B;  3HPO A;  2F1J A;  3BVG A;  1NJX A;  7ICM A;  2EH9 A;  4F5N A;  2C7M B;  4FN2 A;  2EKE C;  1RQN A;  5J0X A;  1F2R I;  1TIF A;  3RR8 A;  3QUT A;  3PO5 A;  1I35 A;  5ALH A;  1QIL A;  4RQ6 A;  1WFY A;  4JGH B;  4PL2 A;  4RUA A;  5AM0 A;  1C7Y A;  1OGW A;  2PVG C;  5CX3 A;  1RDF A;  2BYT A;  2GWS A;  5D46 A;  2KK8 A;  1ZD4 A;  1KBU A;  2L1A A;  2JEF A;  1R4N B;  9ICG A;  1ZQU A;  3OJ3 A;  1EU4 A;  2WDT B;  3WU2 U;  4YFK A;  2JEI A;  3LVV A;  4JWU C;  2LYB A;  1TS2 A;  9ICU A;  5AI8 A;  4YCX A;  4M0A A;  1VJK A;  1I4R A;  1UBQ A;  2LGY A;  3U2S C;  5F9N A;  4ECV A;  4YTP B;  2L0F A;  4BZA A;  2YML A;  2IGG A;  4DQQ A;  3NTU A;  2H3V A;  4I29 A;  2HHV A;  1SF0 A;  2CU3 A;  1KTK A;  5C1Z A;  5ALG A;  1UA0 A;  5KG6 A;  1EUV B;  2J7Q B;  3GIL A;  3APF A;  1TS3 A;  5F9L A;  4EZK A;  2G5I B;  4Y2Y A;  5LXI B;  2GI9 A;  1PDX A;  1ZOY B;  1ZQW A;  1RZT A;  5AHX A;  3ZDB A;  3EZ5 A;  1OFF A;  2F77 X;  4A8E A;  4N59 A;  1R4M B;  4MT5 A;  1ET6 A;  2CS4 A;  3RUL A;  3MGH A;  4ED1 A;  1ECW A;  3KBB A;  1KN5 A;  2KFK A;  1PGB A;  1ZQY A;  1ZYQ A;  2KQS A;  3L54 A;  2QHO A;  1ZJN A;  2LKY A;  5CEH A;  4I27 A;  5AI4 A;  9ICS A;  2D8C A;  2AWT A;  2YY6 A;  1V81 A;  3OJU A;  3NVY A;  2WXN A;  4IC9 A;  1HUO A;  3IV6 A;  3RFZ B;  3MFI A;  2Z0D B;  3P4S B;  1NNL A;  4DFJ A;  1ZDV A;  4KGR A;  3RD2 A;  1DXS A;  3PMN A;  3JPO A;  2D3C A;  2G06 A;  1D5Z C;  1OQQ A;  4AYB C;  4P0Q B;  3TJP A;  2KTR B;  4IG7 B;  2EZZ A;  4TUQ A;  1P98 A;  1DGJ A;  3GOE A;  4TQS A;  4RQ5 A;  3ETL A;  4RQ1 A;  3N7R C;  9ICJ A;  1SJH D;  2KZZ A;  4JLC A;  3CMM B;  3C1Z A;  4PYZ A;  4WAF A;  2B76 B;  2BB6 A;  4QNL A;  5IP4 D;  2HDE A;  3QU9 A;  3Q8B A;  3A0H U;  4DLG A;  4NM1 A;  4MFF A;  2QEJ C;  2INC C;  2N7J A;  2BTE A;  1X2I A;  4C0Z A;  3B9J A;  3WK8 A;  5KFC A;  3V6H A;  1FM0 D;  2KOX A;  3KWV A;  1SZP A;  4F8R A;  3C28 A;  8ICI A;  2QIE B;  1C76 A;  3PHW B;  4L2Y A;  3RNG C;  5D3D A;  3TBL D;  2IDY A;  1IPG A;  4LJX A;  3C21 A;  2DEN B;  1WWT A;  1RRB A;  2KZM A;  1RLF A;  1YJ1 A;  1PVQ A;  3IG3 A;  3U8Z A;  4M8N A;  1D8B A;  2KDB A;  1ZE3 D;  2FAZ A;  3LYS A;  5AK5 A;  3M9N B;  3IVF A;  4H2A A;  4KDL B;  2KWD A;  2JWU A;  5KFM A;  3H8M A;  1Y88 A;  3OGU A;  4OJ6 A;  2IZV B;  2D2Q A;  2E1F A;  2IPK D;  3NVV A;  4OJ5 A;  4D2K A;  5EWF A;  3E58 A;  9ICO A;  5IIJ A;  4LNN A;  4B0E A;  4XA5 A;  3ZW3 A;  2PMV A;  5FR6 A;  2HHX A;  3AQE A;  2FLL A;  3APC A;  3AXC A;  2KE7 A;  1FFV A;  4DOC A;  4YSZ B;  2V4L A;  3RB4 A;  9ICP A;  2DWQ A;  2DBY A;  4M00 A;  2BQ3 A;  2REX A;  2ACZ B;  3TAQ A;  2XID A;  4EEK A;  7ICG A;  2F8K A;  1NZB A;  1ACC A;  2KMA A;  1FIQ A;  2W7O A;  1Q1O A;  1T7P A;  3UI3 A;  1RWS A;  2VIX A;  2MA1 A;  1T8E A;  3VRA B;  3VTU A;  3SV4 A;  1OW5 A;  2N1W A;  2N9P C;  4PJ0 U;  3BVM A;  3OHB A;  3KUC B;  2GBR A;  4IRD A;  3TEZ A;  2H3F A;  4RNN A;  1NOM A;  3J9C A;  3GZF A;  2BKF A;  4RF0 A;  5HKH A;  1UT8 A;  2I9G A;  2IOH A;  4KLQ A;  1MQ3 A;  2CKH B;  5TR5 A;  4ED3 A;  1BT0 A;  3AM9 A;  2G08 A;  2KVS A;  1X9X A;  1ZQR A;  1F5S A;  4GGQ A;  2L3Z A;  5AM3 A;  3PRE A;  4JE3 B;  2F3N A;  5III A;  2PW9 A;  2J0K A;  2A19 A;  4XQ8 A;  5ALU A;  4MJS A;  1HE8 A;  1DGS A;  1UD7 A;  3RF9 A;  2KXJ A;  3DBH I;  2XIC A;  3NAS A;  2K8C B;  5J0T A;  4IOI E;  1MVK A;  1KFS A;  4W9F A;  1CZP A;  1AW7 A;  2K8C A;  3H9D A;  3UMC A;  4MFC A;  3ORY A;  2AXT U;  1X9M A;  3PW2 A;  1FXI A;  5KG1 A;  4Y2T A;  3MJ5 A;  4M8M A;  2BCQ A;  3PRP B;  4J6I A;  3NRW A;  1GUA B;  2GO7 A;  3VHT C;  1L2N A;  4C4S A;  3MR5 A;  4F3O A;  5J0W A;  2JXJ A;  1P1A A;  2YQE A;  1M4V A;  2YN4 A;  2VA8 A;  8ICE A;  2WTF A;  2LHD A;  3B2F A;  1TTN A;  1Z2M A;  1A70 A;  4J9M A;  3W1Y A;  2KJR A;  3NOB A;  3UIO B;  1ZDX A;  2XC9 A;  2WXP A;  4P4M A;  2PFQ A;  1STE A;  1NJY A;  5J2J A;  4TUS A;  4HEA 1;  4GSW A;  3ISB A;  1J0G A;  4Z6E A;  1MQ2 A;  1T0Q C;  4HPM B;  1E0Z A;  3P2B A;  1L5P A;  4ZRK A;  2N7D A;  1PGX A;  3FKY A;  1ZKH A;  3VH3 B;  1WGY A;  4TMA B;  1HUZ A;  3PY8 A;  3WKE A;  4C8M A;  4NV0 A;  1VR9 A;  2BHN A;  3SAG A;  1KLG D;  4TUP A;  5EWG A;  2KO3 A;  3BQ2 A;  2KSO A;  1YIW A;  3HJE A;  2GBJ A;  3H7P B;  1ZD5 A;  2FDR A;  3ECI A;  5BMH A;  2ZTD A;  4FFD A;  2KVZ A;  2W8L A;  4DXA B;  1QOA A;  3TAC B;  2DZK A;  2PE6 B;  1E5W A;  4CHK A;  1ZRM A;  4NPN A;  1PGA A;  3GU3 A;  5JTI A;  1L3V A;  1KLU D;  4X57 B;  3PZP A;  4OJO A;  4ITK A;  4C4V B;  4LCD E;  2ZCC A;  4XGA B;  4QW9 A;  1YMH E;  3V6C B;  2LUM A;  1P7F A;  4RCO A;  1BVS A;  4LJO B;  5DPS A;  1PK1 A;  3AV8 A;  4F50 A;  2NBU A;  3QQ8 B;  4GU2 A;  2C2E A;  3ZDM C;  2MP2 A;  1WGK A;  2K4E A;  1RPL A;  1OXJ A;  1Q3U A;  1Q5W B;  1ZQL A;  4O3S A;  5KT2 A;  3MJW A;  4A3P A;  2MUT A;  4OZA A;  2W9M A;  2KX3 A;  3PVX A;  2FMQ A;  4F91 B;  1C79 A;  4ZRJ A;  2V4Q A;  3QZ8 A;  1ZQD A;  1WGR A;  4XDC A;  4UB2 A;  2DX5 B;  4ICU A;  5T8I A;  5KT5 A;  1V1P B;  2WX1 A;  3DWG C;  3JPS A;  1KKX A;  1QQR A;  3C0R B;  2WHE A;  4BX9 C;  4R8U A;  2L8J A;  2WU5 B;  5KL8 B;  3LXF A;  1GPX A;  3Q6B A;  4UAU A;  5HMM A;  3IM1 A;  4ELV A;  2H3I A;  2PIA A;  4PT5 A;  4DL5 A;  1KL9 A;  4QZB A;  1NKB A;  4AYB F;  3TFR A;  1ZQB A;  3PSE B;  4OD0 A;  4UB6 U;  1GG3 A;  3A4S C;  3BS5 B;  5JUM A;  1DRG A;  4YMM A;  4C8K A;  2NPT B;  2BCU A;  2FNJ B;  3R3M A;  2JY6 A;  4OW0 A;  4DSE A;  1Y8R C;  4DL2 A;  2FMP A;  2GMI C;  4JK1 A;  3PW4 A;  3VUX A;  5FR3 A;  4RU9 A;  4IR9 A;  3HW8 A;  4BDP A;  3ONS A;  1L8L A;  5AKL A;  1ZQO A;  3KKA C;  3T5K A;  5AKK A;  2XBB C;  2X38 A;  3ENE A;  3Q14 C;  3TEW A;  2BDP A;  3T5H A;  3AEB B;  2FE9 A;  4MSM B;  1Z4O A;  2B21 A;  3TFS A;  2PFP A;  3R7R A;  2WAQ C;  5C0Y A;  1IM4 A;  4QJF B;  3M63 B;  4EEW A;  1FNU A;  1LB2 B;  2L0T A;  2OM6 A;  1EWC A;  2KQ4 X;  1T0R C;  4CF5 A;  3DBL I;  5DQG A;  2WXJ A;  2RQ5 A;  2KFN A;  2ZIW A;  3M7D A;  5KL1 B;  3EPI A;  3HWT A;  2Z8L A;  4DOB A;  4O5K A;  1K53 A;  3ZJT A;  2PE9 A;  2AQ2 B;  2JH1 A;  3ZDE A;  4LNK A;  3AUO A;  4YTN B;  3ZNH B;  5AZH A;  2BCR A;  2F8L A;  3R2T A;  3AED B;  2LI6 A;  1K8R B;  3MDC A;  5ALS A;  2LM4 A;  4KZC A;  2J6S A;  2PLP A;  1B0X A;  5CHW A;  5J2K A;  2V9H A;  8ICH A;  2KJH B;  1MHX A;  4PZO A;  2W54 A;  1UWX A;  4OVZ A;  4KX6 B;  4PHA A;  3RJJ A;  2WDV B;  4EX7 A;  5KNI A;  2L5Y A;  3T3F A;  5J18 A;  2H88 B;  2K3U A;  5J2E A;  4IDI A;  2IO1 B;  1Q46 A;  3O0F A;  2IOF K;  2WAQ F;  2YTU A;  3H0R B;  2BQU A;  1WE6 A;  3V62 A;  3WCQ A;  3LVW A;  1FO4 A;  4J9N A;  3D2S A;  2Y5B B;  7ICH A;  1N60 A;  5AZG A;  3QJZ A;  2ZTC A;  1ZQZ A;  5HHH A;  2DUY A;  3BZC A;  1CUK A;  5JU5 A;  1XF5 L;  3ZRC A;  2I2Y A;  3Q8S B;  3EYZ A;  4IRK A;  2ZXI A;  5AK6 A;  2A3V A;  2HHQ A;  2IY0 B;  2ZG6 A;  4I2B A;  1WUD A;  4UDU C;  2LUE A;  3RBE A;  2MP2 B;  5EWE A;  2RMM A;  4XYC A;  1SKW A;  3IHP C;  1V38 A;  2MLB A;  2DF4 B;  2MJ3 A;  3VFK A;  2F2A B;  3RZW C;  5H2F U;  5DBA A;  3EA6 A;  3CSF A;  3NRZ A;  4RGT A;  2LRW A;  9ICC A;  3F5E A;  3THV A;  4CQN A;  3PPA A;  1T0Y A;  3T9L A;  4ACO A;  2H3Z A;  2Y1J A;  5ALQ A;  3Q8C A;  3PST A;  4LTU A;  4AJY B;  4JWN A;  3E0F A;  3JPT A;  3PV8 A;  5JHA A;  5K4L A;  2MWS B;  4M9J A;  9ICW A;  2FCQ A;  2P6U A;  3CP8 A;  3I5J C;  4CF4 A;  3GV5 B;  3PR5 B;  4I28 A;  4NL9 C;  1V5O A;  1QOB A;  2WYQ A;  1KW4 A;  1V5T A;  5KFK A;  3C19 A;  5H92 C;  3ZNZ B;  1WGD A;  2C2D A;  3ZRF A;  1V1O A;  1ET9 A;  3ZKJ C;  2Y9T A;  3GFK B;  3QZ7 A;  1BXT A;  1L6V A;  4HDO A;  4GOC A;  5KFB A;  1T3Q A;  3ALB A;  4J03 A;  4L1B A;  2MX2 A;  2EAO A;  2CPR A;  4QWE A;  4KSL C;  3D2Q A;  2RDJ A;  3TI0 A;  4TSS A;  3FM9 A;  3OJS A;  2HMX A;  2KFJ A;  2CN1 A;  2OH2 A;  1BGX T;  4DSK A;  1KH0 A;  2MJE A;  5CRX A;  3AUL A;  2M9N A;  4YT0 B;  4F1S A;  3UQA A;  2LXC A;  2KX0 A;  3B08 A;  3GIM A;  3OTQ A;  1MG4 A;  5KG0 A;  4U6P A;  1KFT A;  3T3N A;  2DKZ A;  3H4D A;  3L16 A;  4B9L A;  3NG0 A;  3RCZ A;  2KZR A;  4IQU A;  3HM3 A;  1L7P A;  4JX1 C;  5JHB A;  1DK2 A;  4M9G A;  2IBK A;  4FZM A;  1M94 A;  1QQ6 A;  3VRB B;  1WM2 A;  5HNK A;  3V05 A;  5AM4 A;  1L4Z B;  2MBB B;  1Z1V A;  4W9C A;  3P42 A;  4P6V F;  3A9J B;  2VA2 A;  1QSS A;  4FAD A;  5L9X A;  1EM7 A;  1FXT B;  1GB1 A;  5AKY A;  4EE2 A;  5KG3 A;  4XUS A;  1MHH E;  2WXF A;  4E3C A;  5KFR A;  3L3F X;  4EBE A;  2V3P A;  4DOA A;  2DGZ A;  4I6L B;  4REZ A;  3AU2 A;  5C5J A;  2K89 A;  1R4M I;  5IIM A;  1FCC C;  2DNF A;  4GC7 A;  3JVZ X;  2DKX A;  3ABV B;  1JWB D;  3ISD A;  4GDL A;  2P66 A;  1SE4 A;  2ZIV A;  2HSZ A;  2YEP F;  5DPW A;  1S0O A;  3ED5 A;  4O3N A;  2AU0 A;  1TZO A;  4RH6 A;  2I1J A;  2PEA A;  4RPX A;  3I3T B;  1IIP A;  2ZZP B;  4NLB A;  4EEY A;  4OJP A;  3B1L X;  3B0Y A;  1D5M C;  3HIZ A;  5DPT A;  4JV0 A;  4DXF A;  4LDT D;  1WR6 E;  1FMA D;  1XC9 A;  2KEY A;  2DHZ A;  2FBW B;  4WUR A;  2KV2 A;  8ICW A;  4CYE A;  3A9K B;  3GS2 A;  3HVD A;  3VR8 B;  2N7E A;  2YB1 A;  4YR0 A;  1HQR D;  3BY4 B;  3SQI A;  1IUE A;  7ICO A;  4DXG A;  2FCM A;  2FCN A;  5KFU A;  1C3T A;  9ICV A;  3C29 A;  3HKZ C;  4KIK A;  1ZD2 P;  1E8W A;  3BZD B;  2KKC A;  1S0N A;  1SIF A;  2Y5P A;  2KAJ A;  4Y2P A;  2ESE A;  2ASJ A;  2KVR A;  4ACF A;  2KTF A;  2D07 B;  2FUG 1;  2MH7 A;  9ICT A;  5DLG A;  3DEE A;  3MHZ A;  1JIH A;  4HYK A;  5TSS A;  1T5X D;  2ZIX A;  3H40 A;  4WAA A;  2HBJ A;  3RNA C;  4M6W B;  2JYE A;  4DSF A;  2KLC A;  3SR6 A;  2ZTE A;  4TQR A;  1UNS A;  4FJZ A;  1WF9 A;  4HPL B;  3QEB Z;  5E6O A;  1GO3 F;  5AM2 A;  1EF1 A;  4F4K A;  4JIO U;  3SAH A;  3PW0 A;  2PI4 A;  4O9M A;  4W9I A;  1IP9 A;  3HIL A;  3MDA A;  1NK6 A;  4N58 A;  2BW2 A;  4CO7 A;  5I4D A;  4RM9 A;  5AKZ A;  2ZW0 A;  3HKZ F;  4ECW A;  2ZPY A;  3DBH B;  5AKX A;  1DOX A;  3CRX A;  2RDI A;  4EEL A;  2K8B B;  4UBC A;  5ALJ A;  4QZC A;  4CDG A;  5HP4 A;  5DB8 A;  1QH9 A;  4K7U A;  5ALF A;  4RNO A;  2J6U A;  4LDT B;  4NLG A;  1TT5 B;  3CIR B;  4DHJ B;  1ZQQ A;  2BPG A;  4HAI A;  3KKA A;  5KTQ A;  3BK1 A;  3FIL A;  2B0C A;  4J9R A;  1R7S A;  4DL7 A;  5CTR C;  3AMZ A;  2N0S B;  2I5H A;  3K1Z A;  3W1S A;  2ZIU A;  3UQ0 A;  4J9L A;  3QWZ B;  4MGY E;  3N9Y C;  4RUC A;  2AL6 A;  2ZUD A;  3KTQ A;  3KWL A;  3QNM A;  3N30 A;  2ZNV C;  1LM8 B;  1L8O A;  3QXG A;  2KDI A;  1WM3 A;  4DS4 A;  3RH4 A;  5BYQ A;  2KSO B;  4UAY A;  3RJF A;  2JX5 A;  4A8X C;  1FRD A;  1K5O A;  1V97 A;  3DHH C;  4KLG A;  3EFU A;  2K1F A;  3RAX A;  4B9U A;  3URY A;  1JWA D;  2WF6 A;  5ALK A;  3F53 A;  1D8Y A;  1O08 A;  2FPK A;  3PVL A;  1NZP A;  3TQ1 A;  1LXD A;  5KG4 A;  2J42 A;  2FMS A;  4GDL B;  1UBI A;  3AU6 A;  4KX5 A;  4FS1 A;  4F2S A;  4F5Q A;  3HK0 A;  4G0N B;  4IQT A;  5ALL A;  4YVZ A;  3BS7 A;  1V9J A;  5E6J A;  4Y2Q A;  3SMV A;  1FXA A;  4HJK A;  3TEX A;  1ISN A;  1IYF A;  5ALI A;  1I7H A;  2HI0 A;  2KJ5 A;  4BUG A;  5MPO A;  1Q8K A;  2DZJ A;  8ICJ A;  4PHD A;  2D11 A;  2K25 A;  3Q2A C;  3WAN A;  2ZJ8 A;  4P4O A;  1ZQT A;  3GDX A;  5J8Y A;  1IBX A;  5F3X B;  4QZ8 A;  2MU2 A;  1Z4N A;  3EPG A;  4ANX A;  1TKE A;  1QF6 A;  1C4P A;  3IDW A;  4DSI A;  3OSP A;  2BBC A;  3QHT A;  4DHJ D;  2KHV A;  2J52 A;  3GE3 C;  2V4R A;  3TCA A;  4WJN A;  2HVH A;  4UB1 A;  5J2A A;  4Q8E A;  4HPP A;  3TIX A;  3JPR A;  2BPS A;  2JYT A;  4GB9 A;  4Q2J A;  4NXZ A;  2R2Q A;  3JPP A;  4KV2 A;  1T6B X;  2LPE A;  3B2G A;  1GC6 A;  2LMR A;  2YEP B;  2IHN A;  4G50 A;  4ZRQ A;  4M6W A;  4J9K A;  3DVG Y;  4UB5 A;  1ZQJ A;  5D6J B;  2D5G A;  1J19 A;  1IGC A;  4RQM A;  1S8O A;  1T4G A;  3Q3F A;  1L0Y B;  3H8S A;  3KHL A;  2DYO A;  2EMS A;  5D2M B;  5DB7 A;  3W2D A;  2J0M A;  3M95 A;  5GTH U;  5DBB A;  2B3A A;  3RRH A;  4YMO A;  2C7N B;  1UQV A;  1JI7 A;  1GOZ A;  4ELU A;  3AE1 B;  2BDU A;  4DHZ B;  4HJG E;  3VR9 B;  2VJ4 A;  1E10 A;  3QEA Z;  3UMG A;  3O65 B;  1C77 A;  3SV3 A;  5J0P A;  3WAL A;  3V72 A;  5GMV A;  1OQR A;  1LQB A;  3HM6 X;  4RZR A;  2NTT A;  7ICJ A;  1ZQC A;  4P2H A;  4BWJ A;  2G07 A;  3NUQ A;  2QKQ A;  2UVV A;  2LFI A;  3AE2 B;  1X6J A;  2V4I B;  5AIC A;  4C56 C;  3ZXR A;  3VUW A;  1BNP A;  2RD0 A;  2QLT A;  2JVC A;  4O5E A;  3BQ1 A;  2JT4 B;  2KK0 A;  1WWU A;  1RYU A;  2W9B B;  2YB4 A;  4KLH A;  2KMC A;  3M1Y A;  5FKA C;  2WX0 A;  1X9S A;  4DSJ A;  1PFD A;  4YR2 A;  5AIA A;  3ZDD A;  1P9D U;  1WXS A;  4NAW B;  4UAZ A;  3JW0 X;  3BQ0 A;  1EO6 A;  2JXX A;  3W5V B;  4NJ8 A;  4KVG B;  3X23 A;  3ZTC A;  1DK3 A;  3F2D A;  4P0P A;  2QB0 B;  2GBM A;  4P7I A;  2LYH A;  4YTM B;  2KVC A;  1ZQF A;  4C4V A;  2W55 A;  4Y2R A;  3KHH A;  5IIN A;  3DOW A;  2HBL A;  4P4P A;  1F9J A;  1LVH A;  1TK8 A;  4LNF A;  4ZDV A;  2DQN B;  2N9E B;  2BGF A;  1L3T A;  2KFK B;  2IMW P;  2XEW A;  2SEB D;  2G5H B;  3MFG A;  3OWE B;  1D8L A;  3SI8 A;  1NJZ A;  4HCN B;  3LK9 A;  4RT3 A;  1KF6 B;  1TGZ B;  2JRH A;  3QAR A;  1X6I A;  2HTM E;  3ZTD A;  3NS1 A;  3SFD B;  4LZG A;  1JWS D;  5J2R A;  2BWF A;  3KVF B;  4IS7 A;  1Z1B A;  2KG5 A;  4A3O A;  4KMO B;  9ICI A;  3R8B A;  4NNJ B;  4FJV B;  3RJK A;  3RT3 B;  5CR0 A;  4YXM A;  4RQ3 A;  2BS2 B;  2O6V A;  4LJP B;  4K7W A;  2G0A A;  4RQ0 A;  3KHR A;  2RPQ A;  1L7O A;  1T3N A;  2CRX A;  9ICB A;  1NI3 A;  1TAU A;  1ZPS A;  3AE9 B;  4MH0 E;  4MEX A;  2FUH B;  3M9O B;  2WLB A;  2IGH A;  4IWP A;  2H5X A;  1NKC A;  4ECZ A;  1X9W A;  2M56 B;  5KFF A;  5DDY A;  3MC1 A;  1F0M A;  4Y2S A;  2IHM A;  2K0P A;  3TUO A;  3EC8 A;  4KLM A;  2WXQ A;  3WIM A;  1IV8 A;  2LD9 A;  1SGH A;  1D9F A;  4NLZ A;  1JML A;  1WXV A;  1N48 A;  2RP5 A;  3V60 A;  3RR7 A;  1T0S C;  4QZE A;  4B9T A;  5L1L A;  2MSE D;  3DDC B;  2BYF A;  4F4Z A;  1TAM A;  1ENF A;  2ALZ A;  3FDS A;  5JRT A;  5IIO A;  1XSL A;  1LO5 D;  1QKZ A;  1N61 A;  2L76 A;  4WJQ A;  3G6X A;  4CGZ A;  2KJ8 A;  2XCP A;  1L4D B;  5KFH A;  4RGO S;  1XU4 A;  5HML A;  2KTR A;  4FS2 A;  1F44 A;  4XWT A;  2Y1I A;  2WQY B;  2PI5 A;  1H38 A;  3E56 A;  5ALR A;  1TS4 A;  1RXV A;  3QU7 A;  4OZC A;  2UVU A;  5BYR A;  1ZQK A;  3SEB A;  2LGX A;  2NVU I;  1VDV A;  2KC2 A;  1QLB B;  2NRX A;  2W9C A;  3G6V A;  1RFA A;  3P63 A;  2KP7 A;  3AEV A;  3N1Z C;  5KFI A;  4GXK A;  1E8Y A;  3PLU A;  5DQI A;  2IOF A;  1XO0 A;  4DLE A;  2NMQ A;  2N9K A;  3CWI A;  4EZL A;  5C3J B;  2R8H A;  4K3B A;  1UH6 A;  4F93 B;  4RT2 A;  4AOF A;  3WK9 A;  4E74 A;  2K4I A;  3V61 A;  1D6E C;  3ZVV A;  2KFZ A;  3GZN I;  2KN7 A;  3JSV A;  3BIN A;  3Q8R B;  3Q8E A;  3OHA A;  3H6N A;  2OCE A;  1S9F A;  3L5K A;  3A9J A;  3NZS A;  4MEL A;  4KLJ A;  4FBT A;  2ZNV B;  4WWM A;  4QWD A;  4IR1 A;  4R66 A;  1XEE A;  1DYQ A;  2QB0 A;  2YVC A;  2C5L C;  3IFW B;  3KUZ A;  4MF2 A;  2R61 A;  2EZX A;  1BPX A;  2NRV A;  4CF3 A;  1WGG A;  2BYV E;  4GIV A;  4MF8 A;  3FYH A;  5ALD A;  1LFD A;  2KDF B;  1JAL A;  1YJJ A;  2EAP A;  3ISC A;  1CRX A;  1E7U A;  3KYD D;  3VQI A;  4YG2 A;  1NYQ A;  1OTR B;  4FE3 A;  1SXE A;  2KMD A;  1UEL A;  3PX6 A;  3ZDA A;  4UB8 U;  4ECX A;  2JZB B;  2LGI A;  1TYG B;  2WWZ A;  3ZJU A;  1BPB A;  5KT7 A;  2KIC A;  3IRU A;  3M6K A;  1JCK B;  1S3S G;  2BB5 A;  3DWM A;  1FNW A;  4ED0 A;  1ZQP A;  4UAT A;  2J53 A;  2D3B A;  3V3X A;  1YOV B;  1YQ4 B;  3VH4 B;  1WGH A;  3BWU D;  2L00 B;  1C20 A;  4AWJ A;  5JZE B;  2BR0 A;  1XNS A;  3ZYY X;  2RR9 A;  5EE9 A;  5DB9 A;  1MG8 A;  1JUD A;  3AU5 A;  1KRP A;  1WYG A;  4RQ2 A;  2W11 A;  2Q0Z X;  5IIL A;  1RAX A;  2KWV B;  4DDG D;  4Q45 A;  3H1U A;  1XSN A;  2Y0S C;  2BYE A;  5ALX A;  5DG8 A;  3RUI B;  2HVI A;  4JL9 A;  4WQO B;  3PX4 A;  4ANU A;  9ICK A;  2W9N A;  5G5G A;  3I76 A;  2VH2 A;  1WRD B;  2H3Q A;  1WXM A;  5L1M A;  3CST A;  4MGZ E;  2LRU A;  2NO5 A; 
#chains in the Genus database with same CATH homology
 1F0Z A;  1JWM D;  2QJL A;  2MEK A;  4NAM A;  3T3N A;  4KGT A;  2N9L A;  1FCL A;  4HKQ A;  2G1E A;  1SEB D;  4JX1 C;  3C8Y A;  2WXR A;  1QT9 A;  4RGN A;  4MM3 B;  1YN5 A;  4YXD B;  2LMC A;  2L83 A;  3VRB B;  1JW9 D;  1BUI C;  3V05 A;  1L4Z B;  4A90 A;  4NJC A;  1YN4 A;  3P42 A;  4P6V F;  4C7Z A;  2WNM A;  1EU3 A;  5AUK A;  1JWU D;  1EM7 A;  2AQ3 B;  1GB1 A;  1TY0 A;  3BVG A;  4EE2 A;  2WXG A;  1MHH E;  1CJE A;  2WXF A;  3AE4 B;  2XNA C;  1F2R I;  3AEF B;  2V3P A;  1GAQ B;  4JWS C;  2I38 A;  4REZ A;  1QIL A;  4XWW A;  3FIL B;  2FE8 A;  1I4Q A;  3KQ4 A;  1FCC C;  2LEK A;  4LLG M;  3ABV B;  1JWB D;  2XN9 C;  2Y5C A;  5HFY A;  2BYT A;  1SE4 A;  2PVG C;  2YEP F;  4RH6 A;  1CK1 A;  1TZO A;  2L1A A;  1EU4 A;  1VLB A;  4O1N A;  1PYW D;  1FFU A;  1D5M C;  2WXH A;  4DXF A;  3NVW A;  1FMA D;  4JWU C;  1TS2 A;  2FBW B;  2BS4 B;  4WUR A;  5FK9 C;  1VJK A;  4KKI A;  1K51 A;  1I4R A;  3GS2 A;  1B1Z A;  3HVD A;  2IJ0 A;  3U2S C;  3VR8 B;  2NTS A;  4RGM A;  4YTP B;  2IGG A;  1HQR D;  1SF0 A;  5EE1 A;  2CU3 A;  1IUE A;  1KTK A;  1HA5 A;  4DXG A;  2BS3 B;  2L32 A;  5HG2 A;  1TS3 A;  1NVI D;  1XO3 A;  2PVO D;  4NZL B;  1SXT A;  2GI9 A;  1PDX A;  1ZOY B;  2WXL A;  3O13 A;  3BZD B;  2Y5P A;  1OFF A;  2KAJ A;  4N59 A;  4MT5 A;  2OED A;  1ET6 A;  1HZ6 A;  2MH7 A;  2FUG 1;  1ZP0 B;  3MHZ A;  1PGB A;  1BML C;  1VZ7 A;  5TSS A;  1T5X D;  3AB5 A;  3AH7 A;  1NEK B;  2JYE A;  4XE0 A;  3SR6 A;  4AQ7 A;  1B9R A;  1IBX B;  1UNS A;  3NVY A;  4MH8 A;  2WXN A;  2VZK B;  3RFZ B;  3P4S B;  2EKI A;  2JSV X;  1ZDV A;  4KGR A;  4YWG G;  1D5Z C;  1I4H A;  1OQQ A;  3BVZ A;  2WDR B;  2M0A A;  1XXG A;  4GLS C;  4N58 A;  1DGJ A;  2BW2 A;  3I9V 1;  1RYJ A;  3BYT B;  5I4D A;  1I4X A;  1SJH D;  1FRR A;  2ZW0 A;  3EUB 2;  1DOX A;  2GRI A;  1TY2 A;  1MI0 A;  1N5W A;  4US8 A;  3IAS 1;  4WAF A;  2B76 B;  2BB6 A;  4MAC A;  1NEN B;  2RPV A;  5GXG B;  2HDE A;  1TKG A;  1ROE A;  1UGJ A;  3Q8B A;  3CIR B;  3BK2 A;  2QEJ C;  3ETR A;  3BK1 A;  3FIL A;  2N7J A;  1R7S A;  2BTE A;  3AMZ A;  3B9J A;  2N0S B;  1FM0 D;  3KWV A;  1Y56 A;  3W1S A;  2QIE B;  1C76 A;  1UWM A;  4L2Y A;  3N9Y C;  2WXI A;  3KWL A;  5D3D A;  2SAK A;  2IDY A;  1WWT A;  1ZXH A;  2TSS A;  1ZE3 D;  4H2A A;  5BYQ A;  1N62 A;  2JX5 A;  2JWU A;  2KWD A;  2V3N A;  3P4Q B;  4HRS A;  4A8X C;  1FRD A;  1V97 A;  3ZQ4 A;  3URY A;  1FNV A;  2IPK D;  1C9F A;  1JWA D;  3NVV A;  4D2K A;  4KKJ A;  1IGD A;  2J42 A;  2IGD A;  4GDL B;  4B0E A;  3AEE B;  3T3O A;  2PMV A;  3HVZ A;  2VZK D;  3NVZ A;  1JRP A;  1SE2 A;  5E6J A;  3ZGZ A;  1FFV A;  1L0V B;  1RM6 C;  4YSZ B;  5D7G A;  1FXA A;  3TEX A;  3IT6 B;  2DWQ A;  1AN8 A;  1I7H A;  1L6U A;  3U52 E;  2AQ1 B;  2Y3A A;  2DBY A;  1QOG A;  2PTL A;  1TKY A;  4WQM A;  5MPO A;  2ACZ B;  1MPE A;  1N63 A;  3LB8 C;  3NZ3 A;  1ACC A;  2W82 A;  1FIQ A;  3P4R B;  3AE8 B;  3AE3 B;  3UI3 A;  4R3D A;  5LNK 1;  1IBX A;  1RWS A;  3VRA B;  3PZ8 A;  1TKE A;  1QF6 A;  1C4P A;  2BBC A;  3AEA B;  3BVM A;  1JRO A;  2W3S A;  2J52 A;  3TEZ A;  5G5H A;  3ZJV A;  1RFK A;  3J9C A;  3TEY A;  2ON8 A;  4RF0 A;  4OHJ A;  1QOF A;  3MP9 A;  1SBB B;  2JYT A;  3AM9 A;  4Q2J A;  1J7C A;  5C2T B;  4C80 A;  1T6B X;  4A6Q A;  4JE3 B;  2PW9 A;  4ARC A;  3B2G A;  3IT4 B;  4US9 A;  2WXO A;  2YEP B;  1SB3 C;  1NYR A;  3TSS A;  4ZRQ A;  2KAC A;  1K52 A;  2JXT A;  2D5G A;  2WDQ B;  5BYS A;  4IOI E;  1FD6 A;  1MVK A;  1CZP A;  1IGC A;  1AW7 A;  1XLQ A;  1V1P A;  1L0X B;  1F2R C;  1L0Y B;  1FXI A;  2DYO A;  3MJ5 A;  3W2D A;  2KN4 A;  2DLB A;  2ZW1 A;  4WIP A;  1KFY B;  3Q8F A;  3HRD D;  1I4G A;  1GOZ A;  5JXV A;  1M4V A;  3AE1 B;  3RPF C;  4HJG E;  3VR9 B;  1HZ5 A;  1E10 A;  1VZ6 A;  1P7E A;  2LHD A;  3B2F A;  1C77 A;  3Q8A A;  1A70 A;  3NUH B;  1OQR A;  2NTT A;  1ZDX A;  5AUI A;  2WXP A;  1XCQ L;  1STE A;  3BII D;  4XDD A;  2E6X A;  3PZ7 A;  4HEA 1;  3AE7 B;  1E0Z A;  2E3T A;  1L5P A;  1XLN A;  1PGX A;  4FXC A;  3AE6 B;  2LFI A;  3AE2 B;  2V4I B;  2QMT A;  4TMA B;  4C56 C;  1YJI A;  2MJD A;  1VR9 A;  5BMG A;  1KLG D;  5BMI A;  1C78 A;  2LHE A;  2K22 A;  2WP9 B;  1EWY C;  3AN1 A;  5FKA C;  5BMH A;  1PFD A;  1D4B A;  2CJO A;  3GB1 A;  1WSP A;  3BYY B;  4GDK B;  3W5U B;  4NAW B;  1QOA A;  1ZXI A;  1E7P B;  4ZHO A;  1V8C A;  3W5V B;  5EE0 A;  1PGA A;  2KDM A;  1KLU D;  4ITK A;  4RF1 A;  3MC0 B;  2WXM A;  4HRO A;  1YQ3 B;  3P4P B;  4LK0 M;  1YMH E;  4YTM B;  2W3R A;  2W55 A;  2LUM A;  1P7F A;  4RCO A;  1ZUD 2;  4J3O D;  3AV8 A;  5EE3 A;  1C4C A;  2INN E;  3U7Z A;  1WGK A;  1CQV A;  1WRI A;  2SEB D;  1GB4 A;  3MFG A;  4JPS A;  1F77 A;  3OWE B;  3EGR A;  4OZA A;  4HKZ E;  1K50 A;  2RDH A;  1C79 A;  1KF6 B;  3SFE B;  1PUT A;  1DOI A;  4XDC A;  5D3I B;  4A55 A;  2M19 A;  2HTM E;  3DWG C;  1V1P B;  5T8I A;  3NS1 A;  3SFD B;  1QQR A;  1SE3 A;  1JWS D;  2L52 A;  3LXF A;  3FC4 A;  1E9M A;  2WU5 B;  3HUI A;  1GPX A;  1AYF A;  2PIA A;  4PT5 A;  2WS3 B;  4RFB A;  5H8Y E;  3R8B A;  1I4P A;  3W9C B;  2BS2 B;  2GB1 A;  2K9X A;  3U4E G;  4ARI A;  1UUP A;  2CJN A;  1Q10 A;  2DYM A;  4C7Y A;  1NI3 A;  1ZPS A;  2ICI A;  3R2I A;  3AE9 B;  4OW0 A;  1VRA B;  2WLB A;  2ONQ A;  3H8H A;  4ZHP A;  2IGH A;  5FR3 A;  2LJI A;  2M56 B;  2H89 B;  2X38 A;  1J7B A;  2WU2 B;  5HHD G;  3TEW A;  3AEB B;  4DQO C;  2K0P A;  3TUO A;  4N6E B;  2WXQ A;  4P16 A;  1HXY D;  1JML A;  1C4A A;  1FNU A;  1EWC A;  2KQ4 X;  2WXJ A;  4M0W A;  1ENF A;  3L4P A;  2QIL A;  1LO5 D;  1QKZ A;  2Z8L A;  1N61 A;  3LYY A;  1K53 A;  3ZJT A;  1YNT E;  1L4D B;  1TJE A;  2AQ2 B;  4RGO S;  2EEL A;  4YTN B;  1JQ4 A;  4WH4 A;  2Q5W D;  4XWT A;  2WQY B;  3R2T A;  3AED B;  3E56 A;  1TS4 A;  4B0M A;  1HEZ E;  4OZC A;  5BYR A;  2PLP A;  3P1M A;  1SIJ A;  3SEB A;  2OHF A;  1VDV A;  2PKO A;  4YSX B;  1QLB B;  1MHX A;  1UWX A;  2W54 A;  4OVZ A;  4KX6 B;  2WDV B;  3P63 A;  2INP E;  3AE5 B;  1AWD A;  2J4X A;  2H88 B;  2K3U A;  2NMQ A;  4IDI A;  1XLO A;  5C3J B;  2N9K A;  3CWI A;  3AEG B;  4YT0 B;  1D6E C;  3KLS X;  3WCQ A;  3Q8E A;  2AX5 A;  1FO4 A;  3AEC B;  4OZB A;  1N60 A;  1ESF A;  1XCT L;  4WWM A;  2I2Y A;  1XEE A;  4RNA A;  1XF5 L;  1DYQ A;  2JU6 X;  2R61 A;  3Q69 A;  2WXK A;  2KMM A;  4UDU C;  1JAL A;  1YJJ A;  2BT6 A;  3IXS A;  3VQI A;  4USA A;  2RMM A;  1NYQ A;  2MJ3 A;  4ZRP A;  2LGI A;  3EA6 A;  1TS5 A;  1TYG B;  4KGS A;  3ZJU A;  1J7A A;  3NRZ A;  4RGT A;  4A9A A;  3DWM A;  1JCK B;  2BB5 A;  1FNW A;  3FAH A;  4CQN A;  2J53 A;  2RDG A;  3V3X A;  1YQ4 B;  2QSD A;  4TQ1 A;  3BWU D;  3Q8C A;  4LTU A;  4YSY B;  3GP7 A;  3ZYY X;  4ZYS A;  1FEH A;  5EE9 A;  2V0G A;  2K5P A;  1WYG A;  3PO0 A;  4TQ0 A;  1VZ8 A;  1SSN A;  3E9S A;  1KRH A;  4AS1 A;  1QOB A;  4IKG A;  5H92 C;  3I57 A;  4ZOH C;  1SJE D;  1WXQ A;  1V1O A;  1ET9 A;  1DOY A;  1BXT A;  1L6V A;  1D5X C;  1T3Q A;  1E6E B;  2JQR B;  4L1B A;  5HI1 A;  1N5X A;  4L23 A;  2G9H D;  5G5G A;  3IAM 1;  1XLP A;  2JZP A;  4TSS A;  1KH0 A;  2MJE A;  1YN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...