3KD3A

Crystal structure of a phosphoserine phosphohydrolase-like protein from francisella tularensis subsp. tularensis schu s4
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
216
structure length
216
Chain Sequence
b'MKNIIFDFDSTLIKKESLELILEPILQKSPAKLKEIEYITNLGMQGDISFRDSLQKRLAIASPTKQSIKEFSNKYCPNLLTDGIKELVQDLKNKGFEIWIFSGGLSESIQPFADYLNIPRENIFAVETIWNSDGSFKELDNSNGACDSKLSAFDKAKGLIDGEVIAIGDGYTDYQLYEKGYATKFIAYMEHIEREKVINLSKYVARNVAELASLIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoserine phosphohydrolase-like protein
publication title Crystal structure of a phosphoserine phosphohydrolase-like protein from Francisella tularensis subsp. tularensis SCHUS4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Unknown function
total genus 74
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12710 HAD haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 3kd3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3kd3A01
4YGYA 5AVVA 5AESA 2YMPA 5AKHA 2QLTA 1Z4NA 5AK6A 1Z88A 4L6CA 1LTQA 4HGNA 5AW3A 3KD3A 2WF6A 3N5KA 2JAWA 3J7TA 2R8ZA 2FPRA 3RFUA 1Z5UA 2PQ0A 5AVUA 3QU7A 5AM5A 3WK8A 5AKJA 1U02A 5A3QA 3MMZA 2P11A 2I7DA 2CFSA 3R09A 4UARA 2WF9A 1FEZA 4EEKA 3L0BA 1YNSA 2YJ4A 1L7NA 5ALNA 2EATA 3UMBA 1ZD5A 4YCNA 4XE5A 1VJRA 4J03A 3WKAA 3U7FB 1Q91A 2FI1A 1L7PA 3DNPA 5AM3A 4UMVA 5ALRA 3W5DA 4DW8A 3MN1A 4OCZA 2Q4TA 2WHEA 2JGAA 1RMYA 1Z4OA 1VFPA 2C88A 1TJ4A 1RLTA 3L1VA 3OCXA 1VJ5A 4KX5A 4GIBA 4Y2UA 1NRWA 4Y2QA 4YIHA 1CQZA 1ZJJA 2PKEA 5JJBA 5ALTA 3ZTWA 3OPXA 1Z4LA 1L7MA 4HYTA 2FDRA 4ZEXA 3L0YA 3F9RA 3SHQA 2OYCA 3WGUA 2NYVA 4BX0A 2I55A 2FUEA 4C4TA 2P69A 3FPSA 5AKKA 2B82A 3PDWA 2W43A 4XOUA 2HCFA 2CFTA 1QQ6A 3I28A 3W5CA 1K1EA 3QX7A 3A1EA 4CF3A 3D6JA 4H1WA 2G09A 5AW6A 3NANA 3L8GA 2BDEA 3ET5A 5AVXA 3WK5A 3BWVA 2B1QA 2Q4RA 4BKMA 2NO5A 3GYGA 2HSZA 2B1RA 5AICA 5AI0A 1ZOLA 3UMCA 4UATA 2EARA 3QU9A 3SMVA 1L8OA 1RQLA 3SD7A 3ET4A 2IOFK 1YJ5A 4L6AA 3WK7A 4JB3A 2HF2A 4C4SA 3OCYA 5IT0A 2FPSA 4UASA 5ALGA 1WZCA 3OCUA 4CF5A 4F71A 3WK6A 4YH1A 1KYTA 4KYTA 3NRJA 3EWIA 1J8DA 2NO4A 3ED5A 3SKXA 2GO7A 2HDOA 4G63A 1XP5A 3L0CA 3AR4A 2FPWA 2HOQA 1RPZA 4Y2TA 5ALPA 2IYEA 1T5TA 1L7OA 2FPXA 5FP0A 3PCTA 3EF0A 3ZU6A 3WK9A 4DWOA 3WGVA 1YMQA 2I54A 1U7OA 5ALWA 4EX7A 1QYIA 3VAYA 5ALIA 1Z4MA 3CZ4A 3FM9A 1IWOA 4ZEVA 2JAUA 2B0CA 5AW1A 4GXTA 5AW5A 3U13A 3ZI4A 3ZVNA 3FPBA 3L8EA 4CE6A 4YCLA 4UAVA 3NALA 2OA0A 2RB5A 2RBKA 3R4CA 4ZEWA 5ALFA 5AHXA 1U7PA 1QH9A 3ZX4A 3P96A 1RDFA 3R9KA 4L57A 3ONNA 2GFHA 3FVVA 3N8GA 1Z4QA 1ZD4A 2MU1A 4CF4A 2B8EA 4Y2YA 3I6BA 3AR2A 5AW0A 5AVSA 4AP9A 2OBBA 3WKBA 1RMQA 2W11A 1YS9A 2X4DA 1QQ7A 3WKCA 1EK1A 1YV9A 2HX1A 5IT4A 5AKZA 4YIKA 2G80A 4YCMA 3IRUA 3QXGA 3ZVMA 4BEWA 3M1YA 3A1CA 3HYCA 1U2TA 3KDPA 3SKYA 2DQSA 1YDFA 3OCWA 3CNHA 5ALJA 5ALVA 3DV9A 2EAUA 2I33A 3W5BA 4DFDA 2P27A 2YJ5A 1Y8AA 5ALUA 5AM0A 2ODAA 5AW8A 1NNLA 3U7HB 3NAMA 1WPGA 3RF6A 4BBJA 5AKEA 2B30A 5AI9A 1RKVA 4Y2XA 3A3YA 4RESA 1Z4IA 1ZRNA 3OCZA 1RLMA 2JARA 4Y2PA 2HF7A 4HGRA 4XPZA 3AR7A 4NV0A 5ALEA 3KOOA 2AUTA 2OM6A 4UAUA 5ALHA 3ZWDA 2G1AA 3U7GA 5ALYA 4BNDA 4UM7A 5AW4A 1ZS9A 4KNWA 2Q5EA 5A3RA 5AI8A 2BDUA 3L7YA 1L8LA 2FUCA 5ALKA 3B9BA 1EK2A 3AR9A 5AVZA 5ALSA 4UMFA 4FFDA 2JAOA 3N28A 2ZXEA 1XVIA 1N9KA 3DDHA 3SF0A 5AIBA 2D2VA 4UM5A 1LVHA 1L6RA 3QLEA 3U7EB 3ZTYA 5A3SA 2G07A 4HAIA 5AW7A 3ZWKA 5T41A 5AM4A 1JUDA 1NF2A 2IOFA 3ZUPA 4NFLA 2ZBEA 3L8FA 4PNHA 1Z4PX 5AM1A 3ZW7A 3AR5A 3IJ5A 1MH9A 2I34A 2C4NA 5ALZA 2G08A 4IG4A 3B8EA 3E58A 2IOHA 4NWIA 5ALOA 4HGQA 2O2XA 3WKDA 3NASA 2G06A 2YJ3A 3N07A 5AW9A 3K1ZA 2R8YA 3ESQA 1S2OA 3OCVA 2B8JA 4E88A 5ALMA 4KNVA 4Y2SA 1SU4A 1T5SA 4HGPA 2RAVA 3WKEA 2IA5A 5AI4A 4KN8A 3A1DA 3ZX5A 1Q92A 3KBBA 5AKIA 2I6XA 3FZQA 3QU5A 3QNMA 2PR7A 5E0OA 4DCCA 2ZBGA 4Y2RA 3E81A 2C8KA 2HHLA 3QGMA 2HI0A 4FE3A 4QQFA 5AI5A 4OFZA 4BYGA 3KC2A 3NIWA 3DAOA 4HGOA 3QUQA 2C8LA 2W4MA 4BNDB 2WFAA 5AK4A 4OHFA 4CNQA 3OTQA 3QUTA 4JDPA 1SWVA 3MPOA 4G9BA 3AR3A 2VKQA 1TJ5A 4BX3A 5AK5A 2YN4A 1TA0A 3U19A 2MSNA 4B6JA 4I9FA 2YMLA 3AR8A 5AM2A 1Z4JA 4UMDA 2AGVA 2O9JA 2YY6A 3IB6A 2BY4A 5AVWA 3QU2A 2WF5A 1Z4KA 1X42A 2ZBFA 2WF7A 1XPJA 2CN1A 1WR8A 1O08A 3E84A 3KZXA 5AVTA 4J2TA 2YMQA 2WM8A 3L1UA 1U2SA 3PGLA 2YMMA 2FEAA 1RLOA 2RARA 3I76A 5ALQA 4BEVA 3MC1A 4FYPA 3QUBA 3FGOA 3NUQA 3L5KA 4MWOA 1ZRMA 3QUCA 1RKQA 1TE2A 4RETA 2P9JA 5AVRA 4UMEA 4Y2VA 4UU0A 4BX2A 1T9ZA 5AKXA 3B9RA 3U26A 2AMYA 3ESRA 3QYPA 2GHQA 3AR6A 3EF1A 4OD0A 5AVQA 4F72A 2R8EA 4NABA 3E8MA 3UM9A 5ALLA 1SWWA 1WVIA 2GMWA 2ZBDA 2HEGA 2G0AA 2WF8A 3N1UA 5ALDA 4IFTA 3HLTA 3WK4A 2AH5A 2YJ6A 5AKGA 1ZD3A 1CR6A 4O8CA 1ZD2P 5AKYA 4EELA 4AS3A 3ZVLA 3L8HA 2GHTA 5AVYA 1RMTA 5AIAA 3TLMA 5AW2A 2CFRA 1N8NA 4UU1A 4EX6A 4I9GA 1TJ3A 3UMGA 4MUMA 2YBDA 5AK3A 3I1YA 4KX3A 2FPUA 3SLRA 1Z5GA 1RQNA 2YFYA 1RRCA 3S6JA 2ZG6A 1RKUA 3PGVA 1J97A 4UW9A 4XQ0A 1S8OA 3W5AA 4EENA 4Y3UA 1F5SA 2ZOSA 2HO4A 4EZEA 3BA6A 1RC8A 3M9LA 2QYHA 4QJBA 3EPRA 1AQ6A 5AI6A 4C4RA 2R8XA 2C9MA 1QQ5A 5IS2A 3QU4A 1O03A 5ALXA 4Y2JA 1PW5A 4NAVA 4AS2A 5AKLA
chains in the Genus database with same CATH superfamily
3D0OA 5HOQA 4RD6A 4ZRMA 4KR2A 2YN0A 4L8YA 4IIJB 3ZLUA 3B6JA 3IDWA 3ZHRA 1GFWA 4A92A 2LV8A 2MUTA 1EZ4A 4WXEA 3U3ZA 3I72A 8ICGA 3LPNA 2DBVO 1NOJA 2YWFA 1ECLA 5GTHU 4B9SA 5E3IA 3AW8A 3FOCA 1I32A 1OI3A 3TB4A 1TF2A 1XAIA 4B7UA 4ILEA 4BE7B 3MGHA 5JSUA 3GIJA 1AGYA 4O0MA 2FMIA 1WZEA 4NECA 1ZJJA 1KJJA 2ZCJA 1LJ8A 2BD0A 1F1BA 4JCCA 3LK9A 2X58A 4OU4A 3BRQA 2D8AA 5CVTA 1E2FA 3QITA 1W6RA 4QYSA 4AB1A 2XUDA 3WRYA 5C5IA 4EA8A 4HCJA 2P62A 2BUAA 4RQUA 1L0BA 2BGNA 4RQ7A 2VJYA 3OU2A 4EG1A 3MMPA 3KJFA 5KWEA 3OZIA 3DEAA 5EKDA 3LFHA 1NK6A 3A58B 3RYFB 4PQFA 2FEWB 3PCTA 1YR1A 1ULTA 3OIWA 3OX2A 3VM6A 2VJLA 4RENA 2YZ7A 1OY1A 3R6GA 2GBGA 2A7XA 4KK4A 3UXYA 7ADHA 4ZFNA 1JHVA 4U00A 1MT0A 4EPYA 1U7TA 4NE7A 2WSLA 4J9NA 3OA0A 5DDMA 3M6LA 2JA1A 4ZREA 2O2YA 5GONB 2HX1A 1OCEA 2Z30A 3I1JA 4YCMA 4EEYA 1X8LA 3KTDA 5G40A 1YDGA 2VTEA 4I4CA 1YIAA 3TI0A 2CNDA 4Q9LA 1HYHA 4PX3A 3I5UA 2KNJA 1H23A 4ECVA 2DF4B 1U2PA 1WP9A 2HBLA 1CDEA 4G1EB 2OR3A 1Q16A 4R8UA 3MSCA 2QTWB 3U3KA 1E0DA 1OH6A 1SKAA 1UANA 2BKEA 4AN4A 2XCLA 3DMRA 1UIRA 1NOMA 5EXTA 2OXFA 4FSDA 1R74A 1SCQA 3ITEA 4BIIA 2BF7A 2HHAA 1VE6A 4YCDA 1EYZA 1AMOA 4HMQA 2GFIA 3H5TA 5FNVA 1GADO 4P9NA 1NG9A 2C4NA 5ALOA 4HGQA 4MDHA 5REQA 1JSRA 3GO4A 2K4EA 1PTJA 3T0FA 3HZRA 2OLJA 3CRW1 1NQOA 2JLBA 1WYGA 2O19A 2J9ZB 4QZFA 1A4IA 4JWTA 1M72A 3KKQA 1ULSA 1OHHA 7ICOA 1Z6TA 1IY1A 4I2JA 1W48A 3L4SO 1AV7A 3NIWA 1YRHA 4DYVA 3UB2A 1LKYB 2W4MA 1N3YA 3FOFC 3OTQA 1RZVA 4UTXA 4KLDA 2DTEA 1DPFA 5C31A 1QV7A 4L2IB 4G0QA 1RNLA 4WFQA 4WESA 4DIMA 3PJGA 1H0HA 3HP4A 2OG2A 1WKVA 2CXHA 3NT4A 2CZQA 1SKSA 4DSUA 5DWVA 2PMBA 4ER6A 4DZRA 1LSOA 3DDWA 1SQ5A 3KP1A 4M9ZA 3DWGA 4JYCA 1RKQA 3FMGA 5M29A 5CRIA 2ZTEA 3WRYC 1NXSA 5BT8A 3GUZA 3I9V6 1NOKA 2V7TA 1SWWA 3B2EA 2B4AA 2IY9A 1U2ZA 2F3UA 4YXWA 2JJ8A 1QVRA 3OPQA 3HJCA 1Z0KA 4CODB 5HW0A 4AIIA 4LA4A 2PZJA 1Y8QB 1JIIA 1A50B 3KXLA 3U0VA 1U0FA 3STUA 3FZYA 2Z1DA 2ZJ5A 4XVRA 2PX3A 1IPHA 4M8IA 4YAJA 4ZALA 4HV4A 1YS4A 3N7AA 4WNCA 3PEYA 3LL4A 3ISCA 2HVHA 5BP7A 2X0KA 1TYAE 3EASA 1VJTA 5A4IS 3DMPA 1CNFA 1T5HX 1Z0SA 1DP4A 1PQPA 1J8YF 4EO7A 5C7YA 4U2DA 5F2OA 1KFSA 3RQIA 3SQDA 3DPUA 1MQ9A 3GZNB 4DVGA 4JXKA 1TKBA 1OWLA 2XB4A 5AK0A 1NKCA 2G5CA 4QKQA 1AA6A 2ISPA 4LZDA 2YFHA 4BQPA 2QD5A 3NT2A 4JGBA 5EKTA 2FG7C 5BW5A 3T0GA 1EKXA 4UB1A 1D07A 3LKDA 3IM1A 1G8SA 4OAPA 1L5NA 3BEOA 5IJ0B 4LZZA 2HJ9A 4R5HA 3EXHB 3MUOA 5IF9A 1UK6A 4UTVA 2TSYB 3HNRA 3OF2A 4MCAA 3H9CA 3ET5A 4JBGA 5BSFA 2QVZX 4Z2YA 3HGMA 5KT2A 3H2JA 3UMCA 1XWLA 2Q5HA 4EARA 4RQMA 3IS3A 2PT6A 1L5QA 3A1WA 3BJRA 2PA3A 2VXCA 4I4TB 1GCUA 4JR0A 5LD2B 3HI6A 4CXMA 2P6UA 1P6UA 1ZN7A 2QV0A 4PLHA 4XB1A 2C28A 4WKBA 3MVEA 1Y8RA 1PTJC 3AVYA 2VHTA 3FCXA 2VP4A 5A06A 1VECA 4G5GA 4RD2A 2K8AA 4MRNA 3S2GA 1C9YA 1QH9A 4P86A 3JY6A 1CQIA 1V11B 2Z8ZA 3LCVB 2QRNA 4X6XA 1NXVA 3ZV3A 1QGED 4FUQA 1NOIA 3ABZA 2LBOA 4QZGA 1P2VA 3DDZX 5JNRA 3LWZA 4QU0A 2COEA 3WADA 3UB3A 4OGKA 2VRBA 1YL7A 3IBGA 2QTCA 4QXMA 2GCOB 2JAHA 3G6YA 4F3RA 1E7MA 1Z0UA 5AW4A 4ZI3A 4JC0A 2QN7A 2IMWP 3B9BA 2RAUA 2Z9DA 3DYVA 3DV2A 4N5LA 3OCCA 2Y6VA 4JL6A 1Z18A 1OFHA 4WZ6A 5GZ3A 2ORVA 5J2UF 2XBUA 1QRDA 3T7IA 5CAEA 4DIFA 4PNEA 2KJ8A 5CFMA 3DE3X 2COKA 1PTKA 1DIOB 1KI8A 3U3RA 4E0BA 3I42A 4EG3A 4UZSA 1M1NA 2PRZA 2P90A 2P77A 2Z3VA 4IGKA 2Y9TA 2VSFA 4WJLA 4YP1A 5F7OA 4MWZA 2A4KA 3V7FA 1HLGA 4QOGA 4JV0A 3QE2A 4HJXA 2DMRA 4K9PA 3QNMA 4NS4A 5FUBA 3NVWA 5JSZA 5H9WA 1U2QA 3R41A 4FFLA 3DMGA 5IEBA 3T3HA 1NFQA 4TYWA 2PFOA 2CXOA 4KPYA 1C0KA 1DQYA 1OHHD 4R7GA 4FW8A 3AR3A 2GJSA 1TJ5A 5JAUA 4BN5A 2BZ1A 2KHQA 3IURA 5LQKA 2W2XA 2Z98A 3U39A 2PM8A 3SAHA 1NVFA 4X00A 2DH6A 2WMDA 2QQEA 4JUZA 4J7AA 5A5FA 1XK7A 2ESRA 1A97A 1KLNA 1X1DA 3BAFA 2G9NA 4NBSA 1YB1A 5DTMA 3ZCTA 2CXPA 2WFMA 5AJUA 1NF8A 1UOPA 4S1TA 3LLSA 3K70C 1VBNA 3NXKA 3N1UA 3SV3A 1DBIA 3VYSB 1NT2A 2RH4A 4UTOA 3TLMA 5KVAA 4OGLA 2XCTB 2IBTA 4KZPA 1I2ZA 4MPJA 4YXWD 1R50A 4K9KA 2ODPA 1JLSA 1O96B 1P80A 1TF7A 1Y4AE 3ZY5A 4OY3A 2QM0A 3EPRA 4ZOLA 5KFYA 2C2XA 4MA4A 5B1YA 3USZA 2HXSA 1RHMA 2ZVPX 4DWVA 1P7WA 4AJLA 1NYQA 3CRRA 2JFFA 3GJTA 4XGNA 5LFAA 2I7DA 3WSVA 2OP0A 4HDNA 4HT3B 2OC4A 3SHTA 3HPQA 2H4JA 4M87A 3L6CA 1OWMA 1Q5PA 2PFNA 3W78A 1SUAA 2IEGA 1WF6A 4AJHA 1GEGA 3EZ2A 4XUGB 2C95A 4G4IA 3K9HA 5DGIA 1E6LA 4RYDA 2G1KA 2OVBA 3UPQA 1Y9EA 4HQ6A 1J90A 4CMJA 3TSOA 2WHQA 2ZT8A 4B5KA 2QD1A 4B75A 1Z5WA 2XCRB 3T7AA 5A4DA 3AI3A 1OFVA 2JEIA 4NLGA 1V3VA 4ZDKA 1G3RA 3M9MB 3WK5A 1E94E 1R88A 2OUKA 3FSJX 4Q37A 2IYTA 2H5IA 3SGLA 4AY5A 3RVBA 3DL0A 1BPEA 3MYRA 5HJEA 1G6HA 3K70D 1I8TA 2WNIA 4MFFA 5F51A 3WVNA 3M9NB 1VLMA 2UUOA 2IQIA 2PEZA 2GO7A 2D62A 2ZULA 3KWLA 4Y7CA 5IN4A 4RTJA 1JLKA 3ROPA 5K0LA 2DH5A 3B48A 3JQBA 3COYA 3IXQA 4J9UE 2GNOA 2Z6VA 3SJCA 5E7MA 1P60A 2VQFB 4FS1A 1V2GA 4ZYTA 2PZFA 4AUEA 2W4IA 2WJAA 2DWUA 3OC0A 1N7GA 3GXOA 4FLMA 5U1PA 4MGKR 2YV5A 5HK8A 3GIDA 3MWKA 2AX4A 4JVLA 2XDAA 4TVKA 5KT7A 4URUR 2RK3A 3SN6A 4K4HA 1GAEO 2B8NA 1HXHA 2QR5A 3OQMA 4PO3X 3I92A 4FDUA 2VZ8A 1QTNA 4G5QA 2A84A 1QP4A 5JJIA 3DHYA 1Z7BA 4L4UA 2W8LA 3LDHA 5HIKA 3DT9A 4L3WA 1N78A 4Z6EA 2OOSA 3EGDA 1XSLA 4UQGA 1UDRA 3K0FB 1CUUA 2UKDA 3KQLA 5ALKA 2FUCA 4LJ8A 4I1IA 2BEUB 2JGDB 3GLTA 1SIUA 1FYVA 1Q0LA 2W3RA 3BHNA 4RY8A 4Z0PA 4ZZ3A 3QF4B 1LK5A 2HBRA 2JEZA 4I81A 5DYNA 6Q21A 2KM1A 5SY4A 4NJMA 5JTUA 3IXLA 1AO0A 2W2KB 4HAZA 4ZVSA 1H6AA 1Z07A 2PS9A 3T7RA 3BIXA 2O3QA 2OCPA 2HIGA 3GFOA 4IUDS 5K8CA 2G71A 3UK6A 3RR8A 1XTBA 4EJMA 1VKZA 4NULA 4Y1FA 2C2RA 1P3DA 4AG3A 2QZZA 3BKWA 3IDZA 3U4IA 2B0JA 1GNSA 4BO2A 5FTNA 2XWJI 1M0WA 2O20A 3JQ7A 4FZNA 4O0LA 4F2HA 4HYKA 1P1HA 2OAGA 1V1MA 4BXOA 3ZIDA 1P3Y1 1MO3A 2QNRA 1X7WA 3K0AB 4MVJM 4RT2A 2BM9A 5AK5A 1NW4A 1TMYA 2BMAA 5EWFA 1ABBA 3USCS 3BH7A 3PFKA 4XSHA 1F0YA 4CF6A 1G16A 5DLEA 3T95A 2KG5A 1WX1A 1G17A 3UPDA 1RJFA 1OW3B 4I1UA 4OXYA 3ZGOA 3DE1X 1VL5A 2C5BA 4JQOA 2CSUA 3R1IA 1F06A 1ESCA 1QSGA 2HHUA 4BFVA 1DQPA 1KL9A 2HRRA 2DFTA 1Z8DA 5E4JA 3T5PA 2RHWA 2M9MA 4ZCMA 5AIAA 1SG6A 4GDMA 4ZYYA 5IT9A 1Z26A 2QB0B 2JIQA 2AK2A 3MGAA 3TTSA 4ASUA 2I62A 3K72B 2OQ2A 2PQ2A 1ZKDA 2XMQA 5C3MA 4UEJA 5ALXA 2Y1IA 2YY7A 2O57A 3TRJA 3OJ0A 1PR2A 3C6MA 1ISFA 1T2UA 5IC5A 3LWMA 2P1DA 1KK2A 5DRYA 4ITVA 4R2HA 3DE7X 2ZQZA 1Z5UA 1BA2A 4OSEA 1YR9A 4YXJA 2JHGA 3C1OA 3WGJA 3M4ZA 4EB6A 5CD9A 3CPEA 2OZLB 1P74A 1E3WA 2N75A 3IQIX 3NRWA 5E2BA 4PXYA 3GLFE 5EWMA 2HNAA 2QUHA 2RGEA 8ICLA 3WWOA 1LF5A 4HY3A 5JVDF 4LZAA 3H2HA 3VTFA 3TI9A 1NJ1A 3E9MA 4EGAA 1BXZA 2ZITA 4YAWA 2CDBA 5KHOC 8ICXA 2QQFA 3L8CA 2W9XA 1XRLA 2IYZA 1C5KA 5CDGA 1RYUA 3CEPB 4RPLA 2PTHA 1Y6GA 2HCFA 3P0IA 5JLAA 4AF7A 2YS6A 1CUZA 2C9YA 2G28A 1OXMA 1SO8A 3QM1A 3DEHA 1HF3A 5TMPA 4DA8A 1Y63A 4PU0A 2XMZA 3ZWMA 5DM4A 4B6OA 4TMKA 1M7GA 1YMVA 5ULLA 1CF2O 1VC2A 1WZ2A 3CC8A 3TYXA 3NTOA 3F4BA 2PUGA 4LKOA 5J4YA 4D3SA 3ECAA 4F3NA 3GLHA 2VJPA 4DS3A 1V97A 4Q8FA 4N49A 4RMNA 4ZV4A 3CWQA 3A1VA 4EGFA 2CVQA 2WB1F 3UGTA 3NS1A 2HOIA 2A5LA 3JASA 4JP8A 4G3IA 3HCWA 3P96A 3P0HA 3SQLA 2G9VA 2X8WA 4INPA 3UT5B 3ETDA 2W11A 4BDSA 1ZQIA 4KPGA 5CB4F 4YT2A 1PG2A 3DZKA 3DYIA 3PO5A 3ZVMA 4JLSA 4MV6A 4ZODA 4TQRA 4DQDA 3V1MA 4YC7A 3T3IA 5K4HA 4UHEA 5KTOA 2XQFA 3GFVA 4UCFA 1Q3KA 2ISCA 4BP3A 1HTBA 1YKFA 3WICA 3O8LA 2YNMA 4Z0NA 2NVOA 4HVCA 3NDIA 3RUHA 3UAYA 2IYQA 3ENKA 4J0DA 4FBTA 4RA6B 3G5LA 2PMKA 3C45A 4WL0A 2P7HA 4AK9A 5DCWA 2O7NA 3KXIA 3BSYA 3MTJA 4IJ6A 5CLGA 3CRZA 3AQIA 2IS2A 1UPAA 4C04A 1R00A 4Z1MA 3EW7A 5FB3A 2YVKA 4BRWA 3ZR4B 1ZR2A 1T6YA 3FDIA 3DT6A 4II3A 5IW8A 3EJWA 3DH0A 1CEXA 4DWJA 3PC3A 3A28A 4HB3A 1TM7E 1XTTA 3X0DA 3RJ5A 3ZDXB 4R2XA 2ZZKA 2KHVA 1Z75A 4QJFB 3MR3A 3D0QA 1GJRA 3JSXA 4OJ6A 5HQ3A 3LMKA 2WKQA 3LXMA 4FYXA 1KF0A 2ACKA 3RSZA 4W6QA 4WY5A 3NONA 1VSQA 1N33B 2DQKA 4Y6GB 5FNVF 3ZS8A 4YWJA 4V0KA 3WNVA 1P9RA 3U4GA 1VPTA 1UFOA 2R5WA 1RS0A 1QTRA 2O9JA 1WKBA 3OO0A 1JS1X 3G5MA 2PH1A 3HP7A 3P0FA 4MRRA 2G9ZA 4DBLE 1XQXA 5EVJA 4PX5A 4WASA 5CK5A 3C2LA 4YXFA 1X7XA 1KSPA 1SK9A 1GILA 4QFCA 2AOTA 3N7UA 3D64A 3I6MA 3S27A 4HHEA 2WF8A 5LPNA 3LDGA 1X8XA 4EF5A 2IUUA 4RD1A 4FWIB 3WFIA 5J2TB 4IAOA 4JWMA 1JF8A 3GV0A 1JDVA 1LQUA 4ECSA 4XSGA 3IE2A 4BX8A 4EENA 1XRJA 2J0EA 4URFA 1T4GA 2I9PA 4ASUD 3AQ4A 4PWYA 4MV5A 4J0JA 4CV1A 1R9NA 4D0LB 1PR0A 3IMKA 5EFOA 3H7AA 4DQRA 2V6MA 1QKJA 4RKFA 1QRAA 1OKKA 2LM1A 1ZM7A 2C42A 5JQGB 5JROA 1GQQA 1GG9A 2BFEB 2JBAA 4M6WB 3C3WA 4QLBA 3AL0C 5IDXA 3D3NA 4ADSG 2HZ7A 1BVRA 3VR6H 2VJNA 4FDLA 4EHAA 2RE8A 5AHRA 5DBEX 3HWRA 1I36A 1C0LA 1SHJA 4LJSA 2QHXA 2IITA 4I5DA 5CA0B 2GASA 4G24A 3Q7TA 5AHOA 1X94A 3RNOA 4I3FA 1CRXA 4BGEA 2HSZA 1EWTA 2AR9A 4M9XA 4J94A 1O94D 2D59A 4KIUA 3LZDA 3TN7A 4JDUA 3TADA 5DLYA 2ALZA 2AK3A 4F21A 4J9MA 1RI1A 3CKKA 1Q1BA 1A2KC 1DG9A 4XYEA 1IHPA 2KBEA 2P78A 2GEFA 2V96A 3F3MA 1Y4UA 4GAEA 4O2AB 3IEUA 1JQLB 4GXTA 2TMYA 1GUAA 1GPLA 1II9A 2KP7A 2XXJA 5FA8A 5DLPA 5DNVA 1M67A 2LD4A 1VMAA 3WE7A 3A6ZA 1B74A 4P93A 2QI9F 2O3UA 5BXQC 4GOND 5KJFA 4DR1B 1Y1PA 1U0LA 4IXTA 4V3BA 3UF0A 2H52A 1E4VA 3TM4A 1M1YE 5JZMA 4DBZA 3N58A 4NFHA 1HO3A 5KAPA 5PGMA 4LEIA 1X7ZB 1YQDA 3U7HB 4MYCA 1X80B 4NFYA 2JAXA 1NAHA 3CZPA 3KZKA 5EHGA 4JLKA 2HBYA 2WINI 2Q50A 5ISMA 4Z6FA 4WHMA 2DBYA 5K8UA 3E8XA 2C61A 5FBWB 1EUQA 3W6PA 3IPRA 4N3AA 4OKNA 4XB2A 4RTPA 2YNMD 5F7JA 2F9MA 4X92A 1ZH8A 1Q3TA 1IAQA 4J16A 2GSWA 5DYIA 1WCIB 5CK4A 2NO1A 5DG8A 4R68A 3HBLA 4GKKB 1SCIA 2NRWA 3ZUPA 3RG2A 4B7ZA 2X14A 1E2EA 4KI0A 4ZVUA 3KZCA 3ZV5A 1ZL0A 5LBUA 4Z1MD 2V4UA 2JJ1A 1VRCA 2MTBA 4RGQA 3MIIA 3H0EA 1BGWA 2GZ1A 3D4PA 1RZUA 2V58A 4KNVA 2O06A 4PLVA 1SU4A 4D9JA 2LE0A 5FWDA 1W1WA 4YD1A 1K98A 2H2DA 3MR5A 4D6YA 1KFJB 3JWEA 1CW2B 1XMPA 1E5TA 1THMA 4EYGA 2NT3A 1PZXA 1ZQHA 2P9CA 3WGYA 3EVBA 3G0IA 1RPNA 4D0RA 1A7UA 4RA9A 4HAOA 3LSYA 4BX3A 5EESA 1T3SA 1T9GR 2IK8A 3TCKA 1IIBA 3ZDRA 1F2DA 1U99A 4FHFA 3B52X 4YDRA 1HFEL 2GVZC 2ZBFA 3LW7A 3ACBA 5DGHA 3L0SA 2DQ4A 2YMMA 1OT5A 1V1RB 4FX2A 1Z3EB 3PG5A 4HKTA 2OSBA 2EQBA 4ZZ0A 2QVBA 5ICFA 1II0A 1BFDA 1F0MA 2VF5X 4Q21A 2DWCA 4OD0A 4BWFB 4KXUA 2MYNA 1D0VA 1KJZA 5J4HA 4QWDA 3NKFA 3FRIA 4DYHA 4FS2A 2A14A 2VKTA 1BGVA 5AW2A 2MT9A 1EP2B 3PTZA 4UDXX 3TADC 5FF9A 2OCXA 2R66A 3KB6A 2JK0A 4G97A 2YRWA 4AUNA 1Q3HA 2OHOA 2CLCX 1JAHA 1MG0A 2OCBA 1GRQA 3BCHA 1JPJA 2VP0A 3H2YA 3R8CA 1N5JA 1CZRA 4OI0A 3N5KA 3GUHA 3ZZTA 1Y0BA 4F91B 1QUEA 1TUEA 4B33A 3MGCA 1HUOA 3VOSA 2X6QA 1A2QA 4XX0B 4X71A 4LYJA 2EQYA 2AZXA 5G2OA 3ITNA 4WT7A 4V0QA 5BOSA 1WUIS 4P92A 5A5EA 4C7OB 2CDRA 2ZI3A 3BICA 3PUYA 3QVGA 5J2UA 1OKKD 5KOJB 4RC9A 4ZOLF 4OBEA 3STHA 1R0XA 2HHSA 2IPNA 1GGVA 3G6VA 5FH9A 1T5LA 4FYWA 3BWCA 2XUPA 5TQVA 1OH8A 1II8B 2EKBA 1EUYA 4TRNA 4PZAA 5DSXA 3SM3A 1W36D 2XUZA 4D9EA 1YOVA 4JB0A 2CFTA 1CULC 5EJ5A 1RW4A 4CZ2A 1NVTA 3ROXA 1TGYA 1PHPA 4TL6A 3D6JA 3JAWB 1NK9A 5KKNB 3GJ7A 4Z54A 4J16C 1G3UA 4S1OA 4AY6A 3PO4A 4BMNA 1CB0A 1Q0UA 3T6KA 3OJXA 2A0WA 5J0XA 1CIJA 3ZUGA 3JYQA 1SZPA 4P7GA 1DXQA 3BERA 3KVYA 2P9ZA 1G5PA 4DSTA 4W5NA 1DIRA 4DMUB 1U5BB 1QK3A 4KBFA 3GG9A 4WN9B 2BM8A 2XGJA 4ED1A 4OV6B 1ZONA 4ND6A 3CWCA 2KOBA 5HJ5A 3NKVA 4RD4A 2OGZA 5JECA 1PD0A 3RU7A 1AY0A 2RBKA 2ZI5A 1EIZA 2B9EA 2FF5A 3CN7A 4QYIB 3I3SR 3PA8A 2P3SA 3RS2A 1BPDA 4ZVRA 3N7TA 1L6IA 3C8DA 2NMVA 3L6UA 5L95A 4I6EA 3C5WP 1MB9A 4HO1X 1NK5A 4MQEA 2X1VA 3CPHA 2IP1A 2JF0A 1BXRA 1I10A 5JALA 4XRRA 2FSUA 1YRLA 5LP1A 3O0DA 4FGJA 4JJKA 4LBYA 4E14A 4DSZA 4YXMA 1IG0A 1K63A 4L1KA 3BH0A 1GO3F 2D1SA 3PW2A 3WTCA 4XDYA 3ANSA 1L4NA 2F1KA 3EZXA 4O4LF 3KHUA 4FCWA 1WIWA 3HU1A 3IAHA 1SHUX 1KSGA 1SD2A 1MNAA 4D6PA 4DFJA 4IXMA 3P4YA 1XTKA 1CPYA 4TROA 3HB4X 2XEDA 2HWUA 3B5IA 3DF9A 1FVOA 3A3OA 4OJQA 4ACOA 3PUZA 5IKPA 3AEQB 1MH9A 1M76A 4UXHA 5CT4A 2EXXA 2RGYA 3SYKA 3EAFA 3RUPA 5D6NA 5DI3B 1TT7A 3U62A 2QZSA 4E1BA 2EDUA 1L5MA 2HCJB 5CFNA 1DO8A 4MEAA 3W8EA 4ZAYA 1W34A 1GR0A 4Q4HB 2FEXA 3IVRA 4XCQA 4U2KA 1S0OA 1QFZA 2O1EA 1XB2A 1GSHA 1XRSB 3PNVA 4YK7A 5KCZA 1IHUA 4W1PA 2GBFA 5MN4A 1PGPA 2HRBA 4KHZA 2NO0A 2NTVA 3K32A 3JPRA 5D3MA 1YBHA 4MR7A 4LOKA 4LI3X 4L4SA 3D3JA 1TJYA 2RARA 2PV0A 2ES4A 4ZICA 3JRXA 1P1JA 4PQEA 5HRCA 1ZRMA 4WJ3B 3EIEA 5SYNA 1G20A 4EKIA 1Z0IA 2VDPB 1R37A 2IV7A 3V2IA 4NJEA 5BVGB 3S2FA 4ELTA 2CV0A 2DUNA 3RVDA 4ZKDA 2W9AA 3G0DA 5EIFA 4M7PA 1DELA 5K0ZA 4FI3C 5CDUA 2FZLA 1B3RA 1BQ4A 4CCHA 3SSAA 1W581 4IGIA 5FPYA 4FUTA 1RCFA 2J45A 2FMQA 5BN3A 5J29A 3QLUC 2Y4NA 1I51A 1EDOA 3RV4A 3GL9A 4LOIA 3LLCA 4X24A 4QVKA 4UPEA 3DGEC 1LTHR 5DM1A 1SCKA 1YQXA 3IILA 3T5GA 4RQ2A 1MCZA 2HPVA 4XLLA 4H6XA 2BT4A 4MI1A 1XYYA 1NR1A 4YMGA 2MSWA 2A1JA 2ZWMA 1DJMA 3C48A 2J6IA 4CKXA 1N61A 1I2AA 3TE7A 4QO7A 3OEEA 1WAMA 5AM5A 1M34B 2MWMA 1JL3A 2D5AA 3FTCA 5KX5A 4S2UA 9ICNA 4PPGA 1U7DA 2BPFA 4TQ9A 2XGGA 2NZ8A 3DR5A 4XWYA 3SJUA 5BY2A 1RC1A 2R1ZA 1V0JA 2I71A 5CFOA 1Y37A 5TGDA 1GPNA 4WLEA 2RBEA 3GV5B 2Z95A 3KEOA 2I55A 2DUJA 3QWFA 2DBRA 4MUBA 1PQWA 521PA 3FTQA 3N74A 2NVWA 1KFBB 3IEXA 4ZAFA 1QCZA 5D4BA 5C53B 3EDCA 5GINE 2CT8A 2PGOA 2CRXA 3DEIA 2C9BA 4KFCA 2Z6UA 2UZ3A 3ZGYA 5F5LA 7ICVA 2EX1A 2O8EB 1ZY2A 1OBCA 5TC4A 1QLJA 2HF2A 2IYNA 1LGYA 3P5BA 4K46A 1WZCA 3EXG1 1N5LA 4BMZA 2HGZA 1BMQA 4X9XA 4YDSA 3UTDA 1JG4A 4HNAA 3KRTA 3S1SA 4JUFA 4Q1VA 3UYKA 3SJZA 4BC1A 4QJ3A 2J4CA 3FCEA 9ICIA 3HBNA 4TXJA 2EAOA 1G38A 2V7EA 5JASA 4US8A 2GM3A 3JQ9A 3LU1A 4MB6A 4A0SA 2B20A 3T7JA 3D8RA 3K4PA 2CW5A 4NPAA 4YRZA 1QFYA 3IIIA 3I05A 4C07A 1NJ5A 1DB3A 1DO2A 8ICJA 1H5NA 1WWKA 1FS5A 1ZQMA 3GA7A 1LBTA 4F96A 4A7PA 5KYWB 3H42B 3L43A 2JARA 3S5JA 4NV0A 1EE1A 2F3NA 1GY8A 2P68A 4J0QA 3EISA 3BGVA 5CT8A 2C2DA 10MHA 4N3GA 1Q84A 1VL8A 4FFBA 3TIGA 3TW4A 4HN9A 1UJ5A 1VJ0A 2GZAA 4JUAA 1AM4D 3QX8A 1K6EA 3DKPA 4EL5A 1DQNA 1OPRA 4ZAWA 4NFLA 3WMXA 4MR8B 2Q41A 3V3TA 3I9KA 1TM1E 4EHBA 1JDPA 4F6CA 2P6OA 5KG6A 1L9XA 4UHDA 1SBQA 2JFXA 3NASA 5H4GA 4E5PA 1ZZEA 4WVFA 3RRXA 1UBSB 2WWHA 5J0TA 3TLKA 2P6NA 4DJJA 4MKHA 3P9RA 1QF9A 1XMQB 5JXWA 2H9IA 2VYFA 4JXJA 3ALRA 3ESBA 3SFTA 3OQOA 3KEGA 2CL7X 1RYHA 4N0PA 1UT6A 4ZMSA 1KMNA 2C0QA 4JP1A 1OI7A 1U8AA 2POQX 1HNXB 1NASA 1MIOA 2BUCA 4C4AA 2AUNA 5L3SA 3C15C 1A0OA 3ZN2A 2FDXA 2ATIA 4OUKX 4ZGWA 3BQ9A 4I9FA 5MN6A 2ACEA 2J3QA 3GGSA 1XTIA 1LBHA 2XI9A 3TDNA 4A6PA 1G4HA 4LPSA 2VRCA 1ESZA 3QOXA 5EWLA 4JD5A 3SJBA 1F51E 2N3ZA 2WU1A 2WIFA 2KLBA 4A0GA 5F23A 2GHQA 3O83A 2QV7A 1UP7A 2P41A 3VH4A 1UBGA 3T7EA 1OU4A 2ZSKA 4BKRA 4R8VA 1E3IA 4NL4H 4EQZA 4XQGA 1V2HE 2B69A 2HMVA 1NX6A 4EPRA 1RQXA 1URJA 2JLAA 5BWLA 2WTMA 3PQ5A 1SELA 2Z4SA 3D3KA 5CB4A 4ZI5A 4XD7A 4QLOA 2MINA 3JVUA 4DILA 3VC3A 1KKLA 3GT0A 4QQ8A 2YMPA 3G0GA 3QRWA 4ND8B 4L0DA 2GEKA 2AXQA 3IEMA 4C22A 4X5VA 2CD9A 3JQ9C 4D43A 1TGVA 2GESA 4QYMA 2XVZA 3LQ2A 1DAGA 1MH1A 2PD6A 3MJFA 1QP7A 3VC8A 5L1MA 4FN5A 2Q3HA 4HBGA 3OEED 2J85A 2ISQA 4LXGA 1CC1S 4G6ZA 3VVMA 1KL7A 3EIXA 4UBOA 1NJSA 2FN3A 1K5HA 1AC5A 4M22A 4RVNA 1IAVA 1N5IA 3CHYA 3V8BA 3F5QA 5KNBH 3CVVA 1D4AA 1O0BA 1N7JA 4RTKA 1MNQA 4N9WA 3DAYA 1OUMA 2VZLA 1Q1GA 3S7ZA 3E82A 4GMDA 1DXOA 1QQTA 2BEKA 2ARKA 3GAFA 2R18A 4KGXA 1FX1A 3WIVA 3PWZA 2UYGA 4BFSA 1RYNA 1Z2PX 2JCXA 3SIWA 4C7MA 1M6VA 2QD3A 2Q5IA 4B48A 4INJA 1Z8FA 3NRJA 2WVHA 3JQQA 4LGMA 5AJWA 3DQQA 4C5CA 1W85A 4E4YA 4LECA 4QGSA 4OREX 3M5CA 4OHMA 5KFJA 2B0CA 2R25B 4JENA 4KBGA 3R6LA 3MUNA 5LBIA 1BKYA 2Q9BA 4GXKA 3P0JA 4Q4LA 1XTZA 2CLKB 1ZNQO 4XLZA 2C7OA 3H5IA 4BNTA 3O8CA 4IY1A 3N0TA 1XX6A 3CZQA 5IAKA 4C14A 5DO9A 4AMBA 7ABPA 1IBRA 3OIYA 3TKYA 4CM7A 1GGKA 2KQUA 3LQFA 1NVWQ 2IRWA 1MA3A 5D7NA 3WQSB 3ND8A 3NTRA 1FDSA 3HK2A 1ODFA 3N39C 4J1SA 4PFQA 4OGGA 3PJEA 4F5YA 4O4JB 4RL6A 1WXFA 2EJCA 4JKYA 1Z6AA 4QASA 2RHCA 1PZFA 1XEWX 1CQWA 4O3MA 1ADGA 5ALSA 3G79A 1TW3A 1F9AA 4MVCA 1KEJA 5AIBA 3R5TA 5FR1A 2WB1C 1JJBA 4GSLA 5FUVA 4XVCA 4JMLA 4I4IA 3N05A 5TQ0A 2NG1A 1QLHA 5DN6A 3H1TA 4RKWA 5M34A 1M3SA 3BS5B 3ZGZA 4INAA 2YJTD 1QLWA 3C1ZA 1QMGA 2YJ3A 5KJ6A 2FOXA 3CNBA 1U2GA 3IEKA 1IBCA 1UT5A 2J9YB 2LMRA 3HU3A 3DTTA 4TZKA 4B4KA 4RQ0A 4JAVC 1RKBA 5LMCA 1C1HA 1CEQA 2QLNA 3OTHA 1JPUA 1XD2B 2ZR8A 1O87A 3DAOA 4OQZA 1RADA 1I7QB 1DC3A 1SWVA 2QMUA 2CUZA 3M7IA 3HFRA 4E4RA 3FTFA 3Q8KA 3MCZA 2F8TA 1O6BA 3ZY3A 1GCIA 4PBSA 2QSUA 4GMGA 4PYIA 2HU8A 5A4FS 4G5XA 2OH2A 1D09A 2G1UA 3NHKA 4B1FA 2EKDA 2Q5OA 2EGUA 1V6AA 3ZGVA 3VSBA 4AJ2A 5HIMA 1Y7HA 1EFLA 3WL5A 5BR1A 1E2LA 1ZOPA 3W4JA 1YJQA 3BIWA 1Y1SA 3HDTA 3OQIB 5CEFA 1XBTA 3BX1A 1PX0A 1R0SA 1P31A 2VRCD 1P4GA 9ICPA 3DW3X 3CF2A 2Q29A 1QHEA 1PNTA 1N32B 1V7QA 1NVVQ 3H5RA 2J6HA 1R5BA 3LPMA 1PFQA 3KOUA 1Q6YA 1AHPA 1A8SA 4ZQGA 1N7HA 1JVBA 3UICA 3HS3A 4CR7A 4BHTA 4CDRA 1JHOA 5A5DA 4F04A 4XD7D 3ROMA 2K2WA 1U3FA 1A9PA 1G9TA 3TLGB 4M4SA 3C7TA 4ERNA 2D2FA 3O3NB 2YIDA 1PT6A 1ZCBA 2QN2A 1KBOA 3OETA 5DBOA 1WUHS 2KVCA 2QW8A 2LPEA 3PDIA 4P8RA 3OCXA 1QS0B 2EW2A 4XWGA 1QE0A 1QK5A 2VTBA 3MBIA 4CV0A 2UVUA 3HZOA 5CNIA 3JAKB 1JE1A 3C6BA 1WA5A 3RF9A 5JS1A 5L9XA 4UZFA 3WOVA 5IHXA 3MQ4A 4BCDA 3DMYA 3FVTA 5LMZA 5G4KB 4CDNA 1ENOA 1IEWA 3K2BA 2F59A 3PEFA 4BKOA 4JOCA 3HFJA 3G2OA 4G5YA 4PTLA 2CUKA 1YWGO 1YJ5A 2R4TA 2NRXA 4YRLA 4L6AA 2ECPA 4X95A 2A1UB 5MHTA 3MB5A 2ZRKA 1I3OA 3C29A 1L4KA 3BQ0A 4FQ7A 3GLGE 2FR1A 5HQTA 1V38A 2H1VA 5EVCA 5EXXA 2X0NA 1SCDA 1BU5A 4MFAA 2E4ZA 2X41A 1U2GC 4H7EA 2IT1A 5J5AA 5ALIA 2YWBA 1V5FA 2REQA 4UE2A 4CMKA 4FI3F 4PZ9A 2CVPA 1ZD4A 3RJFA 2XT9A 1L7BA 1J23A 2JGJA 5BWMA 3VZBA 1QRRA 1GNPA 1CD5A 3NVYA 4IVPA 2XGMA 2AQ8A 1MO4A 3WL8A 3VO8A 3QXHA 2H54A 4DUZB 1WP4A 3DAHA 4BEWA 3KDPA 2F7SA 1K3UB 2H51A 1VLJA 1VMDA 3PR2B 3W2EA 3RABA 5HGJA 4B6RA 3FB1A 1IL0A 5F7ZA 1Z4IA 1HK7A 5K2OA 4QBKA 1LBEA 3QX9A 5DHUA 4CEIB 2BEJA 3HA2A 3PD0A 4NESA 2DFDA 1JH9A 1V6CA 2DPHA 5DHTA 5AVZA 1NATA 4CTOA 4S1PA 1RZ3A 1H65A 4CMHA 1G1MA 2ZT6A 1L3BA 3O75A 1G7SA 4TSKA 2IYLD 1P4JA 3QBJA 5DULA 1CEZA 1G19A 3VISA 3E1SA 3ML1A 1R8SA 4LE2A 3HJFA 4RLSA 2QI9C 3RB4A 3SZMA 2FHSA 3AR5A 5A0FA 1NG1A 2SCUB 3A1NA 1CT9A 4B2PA 2CZGA 2JHFA 5DN6D 4U0KA 2XPCA 1KFKB 1J9GA 4S0ZA 5KFQA 1YQTA 3W5SA 1SMKA 2EZZA 1JZTA 2CZCA 1D2HA 5D01A 4H31A 4K1XA 5EHXA 4DCCA 2XD4A 1A95A 3Q4GA 3UK0A 4EMTA 2BLLA 2YWGA 1Q3UA 5C34B 3T7TA 4OX9B 4ZHQA 5CEEA 4PS1A 4JH0A 5C35A 2C9OA 2OPBA 2CE7A 4AYBF 3KVNA 4PGMA 2IYAA 1IUKA 3TVYA 3GJRA 3D0RA 1EWYA 2G4CA 1M2GA 3CUKA 2FP4A 4UBCA 1T8SA 1PUXA 1WCNA 4POAA 2IS1A 1XMJA 1RYSA 1KMCA 2HU5A 4UUOA 3W9SA 3H99A 4LYEA 4UMEA 1P6QA 3B7GA 2AEFA 2AMYA 1X6VA 5H83A 4IHKA 1XSEA 4C8OA 2ZRHA 4NBUA 1QB8A 4B6GA 1DAPA 2VYVA 3C5FA 4YQEA 3RVPA 1GRRA 4CEHB 4DDUA 2Y6UA 5HCNA 4DDHA 2H4HA 1CNEA 2ORED 1CHNA 1E7RA 1C1DA 2I9KA 3STYA 2GCPA 3PXAA 3SEFA 1QG6A 4Q39A 1RYFA 4ZI2A 1RC8A 2J33A 1OX6A 2AYZA 1PZNA 1J25A 4DM3A 2NTEA 3CISA 1V39A 4PPYA 5KG2A 5FBZA 3U56A 1XDWA 2VP2A 1OXJA 1L3VA 1XLVA 5JEDA 4G8JA 3N8NA 4G2TA 3IUBA 1J70A 4NATA 2OMEA 3GJ3A 2PWPA 2XOKA 4O4LA 1QPGA 4PANA 4C7JA 1PLKA 3BPSA 1LH0A 4EGQA 3KYJB 2PZKA 4UMVA 1P7YA 3HKDB 1LWOA 3PYMA 3EVZA 3DVSX 3HCAA 5C8XA 1GV1A 2KMLA 1W5AA 2QU7A 1CUHA 4IJ5A 3C3XA 2K89A 1FO4A 4AKSA 5BW6B 1S76D 3TZKA 4ZN6A 1X19A 1N2CA 2BEVB 2O6HA 3F73A 4YJGB 8ICEA 3WDMA 3ERCA 1A72A 2WT8A 2V7VA 2VBGA 4I2HA 5EQDA 4NICA 1W29A 4N5HX 2YV3A 5KX5F 4PE5B 1M1ZA 3ZNOA 4C6HA 3BD7A 1B8NA 3AINA 4AULA 3KYCB 4G36A 3MT7A 4J9OA 5KFFA 4EY7A 4WFJA 1AB6A 4JB3A 1P0QA 1AUVA 2QARA 5LIRA 1B7GO 2FPWA 1F9EA 5CH5A 1I1HA 3SZOA 4YRTA 2JIMA 3NBKA 1T8TA 5I5GA 5BRNA 1G6KA 3MDCA 2V6JA 3IC5A 2EOAA 1GR1A 4BO5A 3K0EA 4C3VA 1MKYA 4FCCA 4TSRA 3ER8A 1L5YA 1AROP 4AZSA 1T3ZA 5FBHA 4E6EA 3K6KA 4ZMRA 4DUYB 1CR2A 1FPQA 4ARBA 4MEYA 3ROFA 3OM1A 4P4SB 1E20A 4RTLA 5F7XA 1IUOA 2JRCA 2PN1A 4C0LA 5C9ZA 5KG7A 1MHPA 2W4QA 4RF4A 4QGFA 4LJKA 1B43A 2C00A 3K0SA 3TZBA 1Z17A 5COBA 1FLNA 2Y99A 2B4KA 4JHLA 2FPMA 5IIIA 4FFNA 1VOTA 3ZDEA 3AL3A 3N6VA 4MAMA 2VSYA 3MEQA 5B4VA 1BMDA 4DDMA 1O4WA 6ADHA 3PUIA 4JQSA 4KTTE 1VGRA 3ZNNA 4ARCA 3TRHA 4FKZA 4YMSA 4CI9A 3ROEA 3EPGA 1A3CA 2G0TA 3N8HA 4IOLA 1I80A 4A2CA 1F4VA 2KI5A 2Q3DA 3ZHYA 3WU2U 5F21A 4F06A 1LY1A 2BMVA 3K31A 5U4XA 1N75A 1PWXA 1GAJA 2ZIFA 1WCXA 4Y6RA 1JDBC 2P9QA 4DDWA 1EP9A 4MHOA 1NKTA 1OYYA 5JYEA 1UC4B 4DL9A 3W8FA 1ECFA 1XKQA 1N92A 3LYAA 4W8OA 1H0RA 3IP6A 2HPAA 3JQBC 5DSZA 3RRNA 3PQ7A 1UQRA 1ZQOA 4DLUA 2PR7A 1ZBQA 4FE3A 3AFMA 3DDNA 5AFSA 3FWPA 4EBFA 1EGHA 1AX9A 4DREA 1JT9A 3BD8A 5I4BA 2XRZA 4RJIA 5TGZA 1U9JA 2W83A 2ZYRA 4LFAB 2VL7A 1GNVA 1L4YA 2V7BA 3OJFA 5AVWA 2C0CA 2HA4A 5FTWA 3DEYX 4KSCA 4RULA 2Z56A 4UTRA 3UTCA 3SENA 1VG1A 1ZN9A 2Y0SF 3MC1A 1JP7A 2X23A 1FFHA 3L5KA 5I9TA 2QY6A 4Z7OB 1JB9A 4RTSA 3FMFA 3B60A 4C0AC 5J0YA 1O5IA 2EKZA 3T8YA 3QYPA 1EJBA 1JG1A 4JN6B 3FH0A 1O94A 4KMSA 3R9XA 3WK4A 2AH5A 2ZTUA 2HNBA 2M98A 1ZUNA 2XYRA 3SE7A 4W7SA 5DTRA 1BDBA 4X65B 2VYVD 3SQIA 2PV7A 1A8UA 3DTYA 4P33A 4Y3UA 2RGWA 2ZB3A 4DOBA 2OBYA 2QYHA 1HQDA 2VUTA 3QZ8A 4D8VA 1J9ZA 5DYWA 4P84A 1E7SA 2R8PA 1S7GA 4P4UA 4GLXA 2Q2VA 2C03A 4RK4A 1PS8A 2CF6A 2JAWA 2JCBA 2DR0A 2ZR7A 3S2UA 4G67A 4K1LA 3FNEA 4YCNA 2G5IB 3GVCA 3HL4A 1L1RA 1IM5A 2OCDA 3P45A 3CJRA 1QC5B 1NDQA 4DPMA 3KWMA 1OLUB 3EEBA 2XOKD 3SVTA 4IUBS 3FYSA 2BEWA 3VKGA 4ZGBA 4BFCA 4FINA 3WLIA 5HGXA 2WAXA 3B20A 1DWPA 1O1YA 4NK5A 4MVJH 4CG2A 3WGIA 1DOHA 1Q0SA 3KOMA 4YRMA 4K6HA 2AT1A 3PX2A 1KZ4A 2OV2A 4TUQA 3CLRD 4JY7A 3HEAA 4FHEA 5GVRA 3JQFA 3DZCA 1FVHA 4QUEA 1K4YA 1Z47A 3U4QB 3BB4A 3HX0A 1N57A 2X9NA 1C9KA 2JEOA 2WFZA 4PBTA 4KN4A 3WLNA 2PXIA 3ZHVA 1ESMA 3SKXA 1PK7A 3EYWA 4RDXA 2V6GA 4CT5A 3RROA 3Q85A 2LKCA 1PKEA 5T4BA 3AU2A 3BCRA 3OIGA 3SX4A 4M2LA 3WGVA 5KG3A 1JHXA 5AOAA 4RY2A 1JQDA 3TINA 2A6PA 4GR4A 1ZOOA 4E0DA 3KXDA 5EPEA 3K71B 2I66A 3ROTA 3HR8A 4Q82A 1Z4QA 4EYHB 5JC8A 3E1GA 3GAAA 3A04A 2NTJA 1I94B 2GM9A 2OAQ1 4S35A 4DNFA 2AOUB 2ZKLA 1GVHA 4K3UA 1YBFA 2BBTA 1QV6A 1B0ZA 4X8OA 2FRDA 3L9XA 3TR6A 3PR5B 3PLRA 4LX0A 3W5VA 4OXKA 3AX6A 5JHHB 1H2BA 4MMXB 1TK9A 1ZA1A 1LV5A 3BZUA 4YPVA 1E9BA 2AG8A 5IRCD 2D1YA 3HACA 1BAPA 3OEYA 3DE4X 1L8LA 4NBWA 2LCIA 3N28A 1CQJB 4YJ2B 2R7NA 4CCSA 5EE3A 1Y7PA 4MQFB 9LDTA 1O94C 2CLMB 1Y1RA 1EHYA 1PL6A 3ZU4A 4J29A 4DEVA 1SXGA 1JI0A 1E66A 3DXFA 2LYAA 2C2BA 1FNCA 3HKCA 4L6IA 4QNNA 4AJ4A 1J5PA 4L8GA 4YS6A 5J59A 2K4PA 3GBPA 1U0JA 3ZE7A 1ZQDA 4HVAA 3FROA 2NSHA 2PLNA 5E9AA 5SZKB 5AUOB 1TA4A 5C0YA 3GQBB 1MF7A 3E61A 1TMKA 4LXHA 5BV1A 2W6PA 4IWXA 1DXHA 4QZ8A 2HQSA 1KTQA 1H4TA 4PPFA 3DD1A 2JZBA 4AZVA 3I4FA 3KLOA 2QW1A 5DT9A 2IYVA 4O1HA 4L7VA 3TUIC 1NZPA 4G8DA 2NU6B 3JWJA 2EYQA 1JDUA 3QV1A 1WEHA 2QVYX 4NCIA 4GR5A 4WVLA 1NF9A 5EE0A 1JROA 4O6VA 2YNMC 5T4FA 3TKAA 2JH9A 2FN8A 5BV0A 5JATA 3JQFC 1E2NA 1O6GA 5HRAA 3ZCQA 1U9IA 1WVIA 4AF8A 4IQTA 4EOGA 1G21B 3H05A 3V4FA 5T6BA 4HDRB 1YCFA 4H6WA 3RK4A 3QPCA 2WB2A 2QYTA 2XYVA 4X84A 4M37A 4KCGA 4IQ8A 1SB3C 5K8VA 2J31A 3PF9A 1KEPA 4OGWA 4X91A 2A57A 2A7QA 1UM9A 5IS2A 1SXEA 2G67A 5EMJA 1E6KA 4S12A 3OHBA 4ENVA 3WYBA 3X2SA 3F6RA 2QJFA 1FVXA 3A2MA 4MQLA 4QZ9A 1ZQ9A 2C2MA 2V74B 1HWYA 3AY0A 2GLXA 3BXOA 2WM2A 4TTQA 3IDQA 3SIRA 1NVAA 2E85A 5I3CA 2INGX 2J6UA 2AYXA 3DM5A 1CFJA 1VZ2A 1F7UA 1PFGA 2Z2KA 1U4OA 2QRMA 3FKSA 3RKRA 2V7WA 1J56A 3NAGA 5G53C 3UFXA 5LSAA 2FRDC 2Q7XA 2CXNA 3A9CA 4DYDA 1RBQA 3IO5A 1OLOA 2C4VA 3PEUA 3LYUA 1Q17A 2E55A 4G0YA 3ZD9A 4P3XA 1NVVR 1TD1A 1YFJA 4RS4A 3KSMA 2P91A 2AI2A 3V1LA 2P69A 2DC1A 1W2HA 2A94A 3DL2A 5KI6A 1P7ZA 1VBKA 1F2VA 1S2NA 1T91A 3EPLA 1R9MA 2C83A 2IJGX 4YR2A 1IRXA 1IXZA 2G5TA 1P4RA 1L8OA 2EBFX 1M33A 1XKLA 3MWGA 1OA1A 1YZTA 3CUEF 1TT5B 5KG1A 1W87A 2HA2A 2XUFA 4JWNA 3K3PA 3WGOA 5T4HA 1JNYA 3ZHZA 1JAIA 2X0JA 2IWHA 3VAYA 1KNQA 5HKOA 3BUSA 4GWGA 1ZD9A 3GRAA 2BFPA 1EQUA 4QM6A 2CLFB 4O1MA 3E2PA 3HVUA 4L27A 3F7MA 3F8WA 3TNDA 2VHWA 4QICA 5MFPA 1ULHA 2XKKA 3MCUA 1TM5E 1XDUA 1H85A 4KLGA 4EMBA 3WAKA 3KJIA 1XPUA 3AJ8A 1YV9A 3IHQB 1YB2A 2QUJA 2A19A 3BMXA 3DOFA 3WLFA 4XIYA 1UODA 4NU8X 3N7PD 5DPMA 2QXYA 4IL6U 2EVWX 4BWYA 4U39A 1KAEA 4HDQB 5KTNA 3DWEX 3HB9A 4RNMA 3E9EA 4EB3A 2W9CB 5GIPE 3A6FA 2WZQA 1W36C 3LBNA 2I78A 4BNDA 5A3RA 3DXXA 1E3QA 2CHFA 2XUKA 5IWAB 4MO9A 5EQJB 2Q6LA 4IDAA 2HBKA 4F0JA 2NTYC 3I62A 2PZMA 3MRSA 1S02A 1BDHA 4NG5A 2NNLD 5I3ZA 1U48A 3RFAA 3KL2A 2PH3A 1E3LA 4P32A 3GUVA 3FFBA 2PUHA 1EFRA 3A0UA 4PTYA 3ZWNA 2PL9A 3O21A 2QVLA 4RVHA 4V0LA 2O2XA 5KKCA 4F5OA 5EHQA 3AHJA 4ESEA 1Z22A 6AT1A 5J2HA 4Q93A 2D5LA 2K6GA 4IQWA 1SGGA 3E7XA 4CQLA 3LO8A 2I2FA 3OHPA 4FOTA 1MOSA 1NWCA 5AOVA 4MWDA 1CUYA 2XE7A 4AUKA 4R54A 4MWEA 2CNKA 3MBKA 5IM5A 2EZXA 1HE1C 3LBYA 3OLCX 4DHEA 4R0MA 1TIPA 4XJTA 1F8GA 4RGBA 3W4KA 4FYYA 4DXHA 2VBFA 3CSSA 5IILA 2XMRA 3PXEA 2DECA 4MJ3A 2VH2A 3KZOA 2VJCA 5FLXA 8ICAA 4RHTA 2Q1WA 2H1IA 4X63A 4ACBA 4FNAA 2QG9A 3UGJA 1ULBA 2MR5A 4MRPA 2XE8A 1SVLA 3F7NA 1SXPA 3PQFA 2HHTA 2ZAIA 1GA4A 3LT2A 2I87A 2GF2A 4TMTA 3LCJA 3DXYA 2QVGA 4FFWA 3M6VA 4P6VF 1CTQA 3VX4A 3WYCA 4ZHQF 4QL3A 4UXIA 3FNBA 5F1YA 4BQIA 4FWBA 4L5CA 4KGZA 1L7QA 1RMTA 2XTZA 3D4OA 1OI4A 1O54A 1F1JA 2YDYA 3RUIA 1X7YB 4UW9A 2Q2QA 2X7HA 4X94A 3UW3A 1ZG3A 3KDSE 3RAJA 3KYDA 3WLQA 3LHKA 1PVDA 3A4YA 4Y2JA 2RHRA 4LZOA 4YO7A 3OF5A 1NVMB 1U2DA 3WJ2A 4MCIA 1VPDA 2F3QA 1Z3IX 2NZUG 3V7YA 1W30A 5K9ZA 3T5DA 2ZIXB 4QPNA 3AIIA 5THKA 1E1CA 4D0SA 4F86A 4KLIA 5CBPA 2QRLA 4CWAA 3V4PB 1IWPB 2VNSA 2XUAA 5CIQA 2AGQA 2PGIA 4ZVLA 1Z45A 4YRBA 1C8VB 4F84A 4BP8A 1NMQA 3Q7SA 3PZBA 3I9NA 3RB3A 4OHOA 5A0VA 1UJNA 3FKSD 2PH5A 3HJRA 3THXB 1V85A 4G4GA 1RFLA 4PONA 4J4BA 3ASZA 3GJ0A 1QIIA 4RQBA 3PHJA 2PUAA 5F77A 4KLQA 5J2CA 5FO0A 3QWHA 1AKUA 1ZI9A 5BV7A 1IN7A 2HMXA 4BVBA 2CWDA 3MHPA 4D3ZA 1EE9A 1MABB 4L28A 5KMGB 2GNPA 1WDWB 3GN1A 2PXHA 4UATA 5DKWA 3QMWA 1J2MA 2TYSB 2J0UA 1KQFA 4LJ6A 2WIKA 1ZGAA 3LOUA 2ZU0C 4TZ0A 1OXVA 2QLBA 4R8MA 1RHRA 1P0MA 3AF3A 2YYYA 1Z7GA 1SVNA 1CEEA 4C29A 3U09A 1Q15A 4F4XA 3CMCO 1L3IA 4EHJA 4TLEA 1TF5A 2QM3A 2OWDA 3NTUA 4R1UA 4GYYA 1VHQA 3GH1A 1IYZA 5AXBA 1BNCA 2HO5A 1IXRA 3TKLA 2LTAA 5LJLA 2AIRA 4QZIA 4C05A 2OBBA 1D9FA 5G4LA 4BNJA 3PX7A 5GY7A 2J48A 3IMEA 3OKFA 4PNPA 2EL7A 5CW2A 4BO1A 5HEKA 1BH2A 2QAGB 2WSSA 1QF7A 1NVKA 4BJ5A 4Y98A 2ZWAA 1C0IA 1YS1X 1NV8A 2P27A 5K0TA 4ZOCA 5CFQA 2C5FA 1USUA 3A3YA 2BP7A 3ORFA 2WWVD 1PBNA 1QP0A 3ABRB 4HGRA 3NATA 3IBTA 3P0EA 1TZCA 1YQQA 3OICA 5L8VA 3PQ6A 4G4JA 3ZI0A 2D4HA 3RB0A 1XCPA 4M04A 4ZO6A 3K1YA 1UZMA 4XWWA 1ZVJA 1SVKA 2XDWA 5I7UA 1MJGA 2I1WA 5MGBA 5EWEA 2HD4A 2RGBA 1S0NA 4OFWA 3C3CA 4E4TA 3VV2A 4JJEA 1NAIA 2YOHA 4YR9A 1TTTA 4RV5A 1ZCFA 1HTTA 5B4UA 5E6UA 1U5CA 3O38A 4YJHA 2XA9A 1YOBA 4MP3A 1EFRD 3T3DA 2KJ9A 1P1FA 3KXKA 1KI2A 2Q0SA 3K92A 2HAEA 4OMUA 3PDJA 1UK9A 2QZ4A 3A1DA 4LRYA 1D2CA 1U2DC 2DZDA 4QUJA 2A3NA 1FDVA 2HTEA 5IARA 2RSLA 4IV5A 4KQ9A 3FHTA 1HE3A 4XLTA 2SICE 4DLEA 5ELLA 1C3OA 1ODIA 1M8GA 3FMVA 4MS3B 1NQ5A 4UFOA 3AT1A 4ZZIA 5AM2A 1TEZA 1DL5A 3JARB 3AB7A 5DGCA 1FU4A 1TUGA 5TIIA 5IMSA 3QFFA 4QJ5A 3NYRA 4CLXA 4RCYA 1ZI8A 3CN9A 4TV9B 1UOOA 5KSPA 1ELOA 3T9EA 4XYGA 5D7BA 2R8BA 3AHHA 3X1DA 1JFRA 2C7VA 3LIIA 1B1AA 3GRCA 4BLUA 3IA7A 3VHRA 3AKEA 1XHLA 3D8TA 5HBRA 3C28A 2UZ1B 4MR9B 4QIWF 3ETCA 4A8TA 3B1WA 4ZMBA 4JLMA 3I5MA 3M9LA 1JVSA 4UCXA 3IP4B 1S8FA 3QU4A 3IA2A 4BBZA 1X9SA 1N3BA 5CB1A 4AYBC 3B1ZA 1JDNA 3BWEA 1MA0A 3EUFA 3WR5A 2E6KA 1QTIA 3TECE 4DDTA 2GVDC 3BC1A 4DCOA 4BE9A 1IXRC 3GRUA 1FNNA 1WV0A 2XIJA 1ZW1A 1G8KA 2OLKA 4LK2A 1RVV1 4KP7A 2VF8A 1HJPA 1DC8A 1KAGA 3UMBA 4KODA 4IIVA 3NV9A 3M6FA 2EX4A 3ZEIA 3RFXA 4YECA 3AETB 3HCDA 3GPBA 1V47A 1U0SY 2C4MA 5KNCH 3T5CA 3FR7A 1MEJA 2PKXA 2HHXA 1AQNA 2VPPA 4B6FA 4FFPA 2OCKA 1ICIA 2HXYA 2X8AA 4A8PA 5KOYA 3L7AA 4JQCA 3QXXA 3L7OA 1UAGA 4RTOA 4UZEA 1P62B 4AM8A 5KFMA 1QQ6A 4P7JA 2OAEA 5JY1A 3BGWA 1JXEA 2O6KA 4GFDA 3OT5A 4KK3A 2CDCA 3CIFA 4L73A 1T5OA 3FWHA 3F2VA 4YT5A 1QIHA 3I45A 1N1MA 5EMMA 3I9MA 2GXAA 1F2TB 1Z28A 3BHMA 2X22A 3VNUA 1SQ0A 2D6FA 3KJEA 5KKAA 1IDOA 1FU7A 4RPJA 5A0TA 3QI7A 3BRSA 4YUZA 2QG6A 2Y1WA 1WULS 4XDGA 1FP7A 2YC4C 4BNGA 3MGIA 4RDCA 1U7UA 5ALWA 2FMPA 1B0UA 1VHWA 3H16A 5H68A 3VKHA 4R3UC 4X1OA 4C87A 1NXOA 4GE0A 1Y8CA 2WRZA 4AP6A 1EESA 5JWHA 1WHTA 3K5IA 4AP9A 1BCSA 3ZW8A 4M9LA 4U7GA 4LZLA 1E3EA 2R1VA 3IQWA 2E5FA 3T38A 2HRCA 4XARA 1SB8A 3PSPA 3BZCA 3CBQA 2Q1UA 2ZJYA 4E1AA 1G8FA 2HK9A 4EUKA 2WSSD 3DFMA 4XFKA 3G1TA 4PZ0A 1I30A 4HH3C 2GUWA 2R1TB 4WLVA 3W6OA 1RP1A 3EUB2 5CX1B 3D2BA 4OUDA 5DX0A 2Q4EA 9ICCA 4X64B 5IXJA 4HXEB 2VDWA 3LT4A 4U7CA 3DLPX 1IE3A 4P2HA 1IVNA 2VF7A 3GN2A 5LQCA 4HAIA 2ZYGA 2QRUA 1NXWA 2RRDA 3A4NA 3EVGA 4WRRA 1TX4B 4M0DA 4E30A 1ZH6A 2JLZA 3HXOA 4R05A 4W5RA 3NM6B 4XASA 4XVQA 2FGJA 3OUZA 3ZI7A 2IPXA 4YUXA 5F4BA 1ULZA 2PL1A 1U7HA 3G8AA 2GN1A 1KRPA 5D51S 1AK1A 1LRLA 5TMBA 3QXSA 3K1ZA 2XR1A 4IDQA 3EX7C 3AUTA 5H80A 3L4PA 2ZRQA 4GEGA 4JMPA 3L8YA 1FW6A 3NEPX 3GX1A 1ENPA 2Z5GA 1D9XA 2PX8A 3Q72A 3KSBC 2AKYA 3PITA 3NWJA 4AL4A 4BO7A 3THOA 3ZWWA 2W70A 2R44A 2HQ1A 1ZLXA 3KTFA 1I7NA 3HC7A 3JZAA 1TK0A 2ASLA 2BY4A 1YL6A 4YHHB 4HJRA 1NJXA 4FHZA 3P7MA 4BB6A 5HZKA 4F6RA 4JT9A 2DY1A 2Q1SA 2PBRA 3JVEA 1URPA 4ND4A 1KVUA 3GFPA 1RM5A 5CRXA 2AQHA 1YT3A 1SC1A 4F9TA 1Y9ZA 3MMSA 4UNNA 3PSHA 2QT1A 2CV1A 1N3IA 2J3HA 4LNAA 5JXHA 2BFCA 2PBZA 4XWAA 2GD0A 1I13A 3BCSA 1AQLA 1W47A 5DFAA 3FY4A 2I67A 4R2WA 1FRZA 1QZ3A 1V16B 4IZ6A 1AS3A 2NGRA 2D6FC 2AG1A 4TTRA 4CQMA 3K5PA 3JPQA 5AD1A 3H8VA 3L0ZA 1DARA 3T9DA 1ORRA 1YI8A 5TS3A 1KC1A 1PW5A 4MF8A 4Q1FA 3RVQA 4ELVA 5A9TA 2A9PA 4PN3A 1V3QE 5GM1A 3BJYA 5T3YA 4EZ9A 4OGFA 4G1FA 5GOZA 2Y0SC 5L40A 1MA7A 4KPUB 5BVHA 2I6GA 5EA2A 1SXJB 1EZ1A 1S01A 4ZT2A 3R3VA 4H4CA 4BC0A 2W37A 2EFDB 3C23A 5EMLA 3L46A 4QG7A 2YVAA 1P2BA 3ZCVA 2NVUB 1DAKA 4DL2A 1XTQA 3FJYA 1Y34E 2PHZA 1RYDA 4IH4A 4OOFA 2CBXA 4DRXB 3O4IA 2B82A 3ABOB 4RVCA 4PZPA 3Q9SA 1XDBA 3HB0A 1R8JA 3TVTA 2OO7A 1MOZA 4KLZA 4LNUA 3RRGA 3HKEB 8ICZA 1BNOA 1C30A 1NXPA 3RKUA 2BJVA 4QDUA 3TTYA 3IUNA 3NHUA 4TL7A 2BBSA 2FWRA 2WZBA 1ZMOA 2XGOA 3N2GB 5FX2A 3ZJTA 4YCJA 3KNZA 2X42A 2J6SA 1EXDA 2G7ZA 3RFVA 3EGCA 5JFTA 4LGCA 2G6BA 2QM8A 3H11A 5P8WA 4OQXA 4DL4A 5GP1A 3UWPA 2Y2VA 4HQOA 3CKMA 4KN7A 1MX9A 4PQRA 1DRUA 4DF3A 1VG9B 3LCRA 4AJPA 3ZBPA 3AM3A 5D3QA 4P34A 3DJFA 1LNZA 2G25A 4Q48A 2OCGA 3GFSA 1NTOA 5IEJA 1NW3A 3ZDFA 4B3XA 3D0KA 4F5RA 3UOWA 4RU1A 1H66A 4ED3A 3CM0A 2HHQA 3GFGA 4FR2A 2LIVA 2I33A 1CKEA 4KQ2A 3ZDYB 1VJGA 1SFRA 3EEOA 3LXUX 4Y2XA 3E4CA 3M4JA 4CTKA 3INNA 2H1RA 3KOOA 1QX4A 1FFXA 4ETNA 4L78A 4PCAA 5I7AA 1BMFA 4LBZA 5KFGA 3JD1A 3KBOA 1NPDA 2WU3A 1QJCA 3B0YA 3T3NA 2WOOA 3M2TA 5EIOA 3ZHCA 1GPMA 4MEJA 4BPRA 2A9VA 3FBGA 2X7XA 2Q6IA 3K75D 4P3NA 1T36B 2W6JA 5JUMA 3JQAB 4P4LA 2C98A 4DR7B 1JXOA 4EZIA 4FSHA 1U0OC 2KZZA 2DKZA 3EOBI 3R9WA 4O5CA 3SV4A 2RHGB 3KKAA 3NG1A 4BVLA 3CG4A 1JEYA 1B2LA 2WNSA 2BMEA 2H3FA 1S8AA 4B3FX 4ZA2A 2GTHA 5T4EA 4IGFA 621PA 2WOJA 3I5YA 4C0JA 3KCNA 4F7DA 3LP6A 1FK8A 1LV8A 2DT8A 4MP6A 3BBLA 2AMFA 1L3TA 2JFPA 3IOYA 4PIMA 4UQPA 2YMLA 2EW1A 4KWEA 1P73A 5EIBD 4WZAA 4LC1A 1V5GA 2KHZA 1AUPA 1S8NA 3C6ZA 4AJNA 1GV0A 2BKVA 2V5VA 3V8MA 4DIEA 2RAPA 1E59A 4DSEA 3G6WA 1Y1QA 4WOJA 4X3PA 1B14A 1ODJA 2ODTX 4YJFB 1F2UA 2BM0A 2NO7A 3BRCA 4B81A 4DF8A 2HEGA 2C4UA 2WJ3A 2V45A 2BH2A 4CDMA 5KHLB 4AY3A 2O2SA 1Z7YA 3HEBA 1D0SA 2FPUA 3GJYA 3QBDA 4N39A 4NZ9A 3BXPA 1IEVA 2BHLA 1DBSA 1RM4A 2VZEA 5KNLA 3HN2A 4HH1A 5B36A 4XRHA 2JEFA 2GK3A 1IXYA 4CQMD 3FWNA 2QN1A 2D0IA 1GOTA 1TUIA 1KKUA 3JQ8A 5B3LA 5LQDA 2JAPA 1T1SA 3KEMA 4M21A 2V9WA 2PO7A 1KDRA 3R75A 4F4CA 4NBTA 4KAFA 3LHFA 4R64A 3QE9Y 1BZYA 4DTIA 4MCHA 5EYPB 1ZUHA 4P2BA 3TIFA 2I7CA 2SKEA 3CH6A 4EMUA 2Z9CA 4S1VA 1YNSA 2NU7B 3QSYA 5F9FA 1JE0A 1NYRA 4C2UA 3KPVA 4K0RA 4HX9A 2HIAA 5ALRA 5IU6A 4E11A 3QH4A 1YE3A 2WHEA 4MB2A 4LRXA 1Z68A 2XMCA 2CD7A 2ADMA 2BFFB 3RW9A 3SCZA 4ZDWA 3W2TA 1D5WA 1KZ6A 1TYZA 1WUDA 1KORA 5EJIA 3M5PA 3GNLA 3M2PA 2DWQA 4QXRA 1R0CA 2DUWA 1K97A 2MA1A 1REQA 5HZGA 1KJIA 2B25A 2YX1A 2JLCA 1QDUA 1RAFA 2H57A 2FWJA 4K05A 4TYMA 3G0CA 4KO2S 9ICTA 5IC6A 1FCJA 4AKIA 2IYOA 4EHFA 4J0FA 1WPQA 1FLDA 1RZRA 4BVGA 1KU0A 2ZSFA 1R64A 2ZWVA 4BATA 4CKBA 3U7RA 1QGZA 4R63A 4FOOA 1CZKA 3MRXA 2A9QA 4V0NA 1U1IA 4TQAA 3MDAA 3ONVA 5FPQA 3AG5A 2Q7DA 3DHWC 1UKYA 1KAHA 1YS7A 3AJ9A 1PFWA 4PG8A 4KOEC 3DBRA 2R4QA 5BN4A 8GPBA 4MZDA 3AXTA 3NYWA 3PA6A 3QVKA 1QRTA 4CF4A 1JU9A 1K1QA 1XZBA 3RYHB 1EVKA 6REQA 2WQ7A 2FZWA 4B4VA 4I28A 3F5DA 1UH5A 4Y6QA 1WJGA 4YG2A 3O8BA 5FIUA 4EHHA 3BH6A 1P0PA 1JTFA 1DX9A 1KSFX 3FGPA 3QI2A 1K7EB 3COZA 3H1EA 3ORSA 1HURA 4DJTA 3BZKA 4AZ0B 1U1GA 3V46A 3RB6A 5FBVB 3CH7A 2ZYUX 1SVOA 4XUSA 2BDUA 3L7YA 5EJAA 3OSZA 7ICSA 3Q3CA 4JITA 5TLSA 4OG2A 1W44A 4AYTA 2OGTA 4KMOB 5LXTB 3UB4A 3UMYA 1ZJNA 1BMFD 4M7WA 1O58A 3WGGA 3SR3A 5I9BA 2VRNA 3D6MA 1EBBA 3LQQA 1NLYA 4MI6A 2QENA 2VJKA 1TVKA 2HF9A 4GX0A 1E4OA 1Z37A 3PLNA 1K4MA 2W6JD 3FFAA 1C4OA 4KTVE 3GI1A 2ZP1A 1U7WA 3SDZA 4RJ2A 4RHCA 1H05A 5BN1A 4D56A 1YO6A 4DA6A 2C8KA 3L6OO 1FQWA 3EVNA 1GM5A 2H5XA 3KUKA 5KTKA 1VI6A 3U3JA 4CNQA 3CH5A 3EXFB 1Z2CA 5IDWA 4KDFA 4L8WB 4IDHA 1LC0A 3DOIA 2OTCA 3RJGA 1I6MA 3GEBA 1VIMA 4K03A 3CX8A 4RX1A 1KMQA 5L7TA 1Z4KA 4ZQCB 2BUBA 4KLUA 1XELA 1OVMA 4F97A 3PGA1 3R4VA 3RH5A 3O84A 3EH1A 2XYGA 1TU0A 3UZUA 3KT6A 1WVGA 2EAPA 5CA7A 4WCDA 3ZVKA 1PGOA 5AKXA 3ZNPA 2ZRNA 5A62A 2PGNA 4WLFA 2ZE6A 2D3TA 3QPUA 4BMSA 4BNIA 2WFLA 1VSTA 4WY8A 4YP7A 1G41A 3KE8A 4ZVOA 1VDVA 4GKAA 3TQIA 4XX1A 1L5HB 4N0MA 1SZHA 4K2AA 3QX3A 5E38A 4P7KA 5KVQA 2RIPA 4MDYA 1H2XA 4GI2A 1HMYA 4YRQA 4LMBA 1WXXA 5KOHA 2B7BA 1PT9A 4Q18A 1EIWA 3ILVA 5LM3A 4KITB 3CZCA 4KR6A 2H17A 2XVAA 5J2FA 2Q3EA 5CG1A 4PJ0U 3FKQA 5JS6A 2WYWA 4EK9A 4KU4A 4CR6A 3HSSA 4BGVA 5AXCA 2X6RA 3ZK9A 2F3PA 2VP6A 1N7IA 3LL7A 1JEJA 3ESXA 3L0BA 4U8HA 1VA5A 2WTAA 4LRUA 4DCUA 5JU5A 1GSOA 1UUFA 2WHRA 2A0KA 4DB2A 1GPYA 3PHGA 2C77A 1I7SB 1QGAA 4Y2UA 3OLQA 3WNBA 1NN0A 2NAFA 4H3HB 4QU5A 2NIPA 4PLCA 2M0NA 1A5AB 3SHQA 4D97A 3I2IA 2R8RA 4Z2AA 1RACA 5KTSA 2O8NA 4V0OA 3DLCA 1IUPA 3GUCA 4DFMA 3MOSA 2PZAA 3H87A 2I4MA 1BPXA 4DMLA 1W4LA 3Q8RB 2Q46A 3Q7QA 1T25A 3RT7A 1CY1A 5AI0A 4DSJA 9ATCA 2X2FA 2JD1A 1MLDA 2ZRMA 3T61A 2WIBA 3NHAA 3RC3A 5HHHA 4FFMA 3NOQA 4HNSA 1PU2A 4NV1A 3SQXA 2FFBA 4MS4B 2R6ZA 1JIKA 4LZPA 1UHUA 3Q9NA 1RZRD 3OOJA 3TLJA 3DDUA 1FFSA 2RI1A 3PNLA 5FWAA 2XF8A 2KE5A 4BWVA 5LKRA 1B1CA 2QTBA 3EXAA 4A91A 4RFSA 2LI6A 4MKIA 4U3JB 3KSUA 5DGBA 3X1YA 5J2AA 5BMVB 5K03A 5E1BA 1JPVA 3GMSA 3C3DA 1U0GA 3JVIA 2WKPA 4G56A 1E6WA 3OM9A 4OJ5A 2VXBA 2J4FA 2FPPB 3H13A 5ALJA 2PUTA 5JRDS 3RTBA 3FCCA 1D3AA 3TSWA 1BEZA 5BV2P 4YO8A 7MDHA 3NAMA 2NN3C 2ZRBA 3HJEA 4DRYA 1K75A 3BDVA 1COKA 4FM9A 4GRAA 5IYZB 3CLRC 5F1PA 4BGIA 2W0MA 3ZHTA 3CX6A 5EMKA 5D46A 2BOVA 2W7OA 4X90A 4EAAA 3OWXA 4UM5A 2HQBA 1OPXA 1JU4A 4X3OA 3L7KA 1N4DA 2QL5A 3D6TB 1ZQQA 3IP5A 5JO9A 5DIZA 3T52A 2IOFA 3IKJA 4ENSA 2H65A 1PP4A 3ROGA 5ALZA 1T6BY 2YZGA 4JODA 2XBLA 4Z6DA 2FETA 4P08A 1J1ZA 2RCYA 4BKPA 3LO5A 1DC7A 5BW4A 4PHFA 3K73O 3EG9A 4MKGA 1EGAA 2GTIA 4J1QA 1ZLYA 4LE0A 5BYJA 4YX9A 2F8LA 1VQ1A 5IJWA 3OJUA 1WW2A 2OP1A 2YICA 1H1LB 3NI2A 3GMTA 4P5PA 3RU9A 3BTOA 4C6TB 4MMYB 3VVCA 4NENA 1Z2NX 4TWBA 5TQ2B 4A6EA 4B6JA 4UMDA 4IHJB 3PRJA 5H82A 5DM70 1CF4A 1QR2A 1XSNA 1PJLA 3V7KA 4IDPA 2PNFA 3JATA 5DBGA 4LRQA 4PGAA 2YHBA 2CJFA 2CJWB 4MA5A 4LF9B 5DXAA 5D2CA 1HKUA 4RZXA 1Z38A 1X70A 2C5GA 5B53A 1KI6B 1WB4A 1O97C 5EJFA 4EW6A 4D25A 2VO1A 2NZWA 4KW7A 4P4PA 4BRUA 1OFIA 3C1TA 3OSUA 1G7RA 1N9ZA 5DYYA 3M6UA 3X1JA 2FU5C 4OQDA 4A2WA 5HR7A 4MB0A 1KEKA 5J2DA 3QIAA 2PLAA 3CRMA 3E5HA 4I1SA 1ZGJA 3HVIA 2AX3A 2C2YA 2N47A 1F20A 3ZE9A 1X1EA 2A86A 2ZRGA 2QKYA 1SBHA 3UW1A 4GPZA 2NXCA 1OBOA 3ORQA 4BEBA 3PUVA 4DVJA 3FLEA 3PC8A 1A76A 2P65A 1GZ5A 4ZU6X 1P9OA 2P9FA 1AXEA 1BOFA 2QMEA 1FJGB 3PNCA 2HZBA 2R8ZA 4JXZA 3OJEA 3H5VA 4LJ7A 2BQUA 4IMPA 5F98A 2WF9A 5FLYA 1CJUC 3JSAA 3EG5A 4D8XA 1KO1A 4BNUA 2JGLA 4BTEA 4AJ1A 2OM2A 1Y42X 2HDWA 4KX5A 1NGSA 4KGDA 3MWEA 1C9DB 1GFIA 3E22A 3AILA 1NR5A 3C74A 3I53A 4YQWA 3G2IA 4GSKA 3H3JA 2DEUA 1UZAA 1E1KA 3IG8A 3PGKA 4LGVA 4R1SA 3RBXA 1C14A 1R4ZA 3QJGA 4QIWC 1NVUQ 2ZJFA 4AJIA 1VJ1A 5JTTA 1M2EA 4TL8A 1O5OA 1NBME 4AVYA 4KXFB 1K1EA 1T0JB 2B3DA 3CNQS 4TQUS 1PVRA 1D4ZA 1O97D 3GH3A 2V3VA 3CRNA 3I12A 3DZFA 2YFQA 3ASYA 4P3YA 1M7HA 3ELUA 4LI0A 1E69A 3N6RA 3DO5A 4XA8A 3VU0A 3AR4A 1PUZA 1GPBA 3PQ8A 3DCNA 3SQOA 3VYUB 1C2TA 1GGNA 1PS0A 5DF1A 3IESA 4K9SA 3FCOA 1XI2A 4PLGA 4MW1A 1XL0A 1WXQA 3D7RA 4M9UA 1ADCA 4M1KA 1TL7C 4ZIRB 2HHCA 2BW0A 5KJ1A 4GKBA 1EI9A 1I14A 1I1QB 1YS9A 3CZAA 4OJNA 1L4MA 1GTL1 2RHJA 2I1VB 1AQIA 4PXSA 3SQMA 5HCUA 1YDMA 5E9JA 1DMRA 4D1YA 3K1JA 4HDSA 3HCOA 1AS0A 1D2MA 2QN9A 2K60A 1YGYA 4US0R 1RJEA 5AI9A 2OV1A 1G1AA 2R60A 3F4LA 4Z5XA 4LCEA 2PUFA 2CCKA 5E6RB 5HYVA 3WI7A 5KWIA 4Y2GA 2IH4A 5K6TA 2VDNB 2H8GA 1DBQA 2CJPA 3CGWA 2GARA 3FUCA 4K2HA 3KR2A 2A9JA 3FDJA 1NJ2A 1QCKA 1ORIA 3F2CA 1KOJA 2ORYA 1R0LA 5EUCA 4B83A 2NUBA 2V7QD 1PRYA 2XA1A 3B3JA 4DV3B 3F2DA 2LIPA 5LYJB 3M6WA 3DE5X 3RO7A 2QX7A 2VI5A 1H4QA 4CCYA 4L15A 4DLAA 1BC5A 1NW6A 3SSMA