3KD3A

Crystal structure of a phosphoserine phosphohydrolase-like protein from francisella tularensis subsp. tularensis schu s4
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
216
structure length
216
Chain Sequence
MKNIIFDFDSTLIKKESLELILEPILQKSPAKLKEIEYITNLGMQGDISFRDSLQKRLAIASPTKQSIKEFSNKYCPNLLTDGIKELVQDLKNKGFEIWIFSGGLSESIQPFADYLNIPRENIFAVETIWNSDGSFKELDNSNGACDSKLSAFDKAKGLIDGEVIAIGDGYTDYQLYEKGYATKFIAYMEHIEREKVINLSKYVARNVAELASLIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoserine phosphohydrolase-like protein
publication title Crystal structure of a phosphoserine phosphohydrolase-like protein from Francisella tularensis subsp. tularensis SCHUS4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Unknown function
total genus 74
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12710 HAD haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 3kd3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3kd3A01
1Z4QA 2GHTA 3ZWKA 3ZI4A 4J03A 3OCUA 2RAVA 5AW0A 3WKEA 1IWOA 1Z5UA 3WGVA 5ALOA 3A1DA 3U13A 4EENA 2IOFA 5AKJA 1ZOLA 3I1YA 4Y2TA 5JJBA 2GO7A 3IRUA 1XPJA 4MUMA 2GHQA 4EEKA 4YCLA 2YJ6A 4F71A 5ALIA 1Z4IA 4Y2RA 3A1CA 1NF2A 1YMQA 1S2OA 4L57A 2YY6A 4Y3UA 3L8HA 4G9BA 2IA5A 5ALYA 3PGLA 5AM4A 2Q5EA 3VAYA 3U19A 1S8OA 3KOOA 2NO4A 1ZD3A 5AI4A 3N1UA 3WK9A 5A3QA 2HO4A 5ALQA 3AR5A 2FDRA 5AI9A 3KZXA 2C8LA 4ZEWA 5AI6A 5AW4A 3WK8A 1T5SA 2D2VA 4KYTA 4OFZA 2HI0A 2G0AA 5AKIA 5ALUA 3N28A 4OHFA 4XPZA 5ALGA 1ZD4A 2BDEA 2W43A 5AKHA 3P96A 3R4CA 3AR9A 4EELA 4HGNA 1XP5A 3IB6A 4UAUA 1YNSA 5AESA 2PKEA 2C8KA 2YFYA 3W5DA 2I6XA 3AR7A 2HHLA 3FM9A 3ZU6A 3QGMA 3NAMA 1L8LA 1L6RA 1U2TA 3I28A 3HYCA 5AW7A 2YJ3A 2IOHA 4HGQA 1U7PA 5ALMA 4I9FA 3DDHA 3NALA 1J97A 2HEGA 4FFDA 4Y2XA 3RF6A 2B1QA 2OYCA 1ZD5A 3MC1A 3AR2A 4L6AA 4AS3A 1T5TA 5ALEA 2BDUA 4BNDA 5ALDA 3BWVA 3OTQA 3GYGA 1U02A 1Y8AA 5IT0A 1X42A 2HF2A 1WR8A 3S6JA 4UMDA 3L8GA 2DQSA 3OCYA 2PR7A 4Y2PA 3FPBA 5AIAA 3U26A 5AVZA 3L7YA 2HSZA 3SLRA 5AW8A 2R8ZA 3IJ5A 1U7OA 4C4RA 1Z4MA 3QU2A 3QU4A 3AR8A 2ZXEA 3MMZA 3E8MA 2AMYA 4ZEXA 2WF6A 2YJ5A 3QU9A 1ZRNA 1RMQA 4XE5A 4Y2SA 2FPSA 3W5BA 4EZEA 3R9KA 5AKEA 4FE3A 1L7MA 3OCXA 2W4MA 1J8DA 4Y2VA 5AK6A 5ALKA 5ALNA 4HGRA 1NNLA 1L8OA 1NRWA 2JAUA 2OA0A 3ZW7A 2WF8A 2ZBFA 1Z4NA 1QQ7A 2QLTA 4KX3A 4IFTA 2IYEA 1TJ5A 5AVSA 5E0OA 2R8EA 1ZRMA 1ZS9A 2G06A 2I7DA 3WK6A 2FEAA 1MH9A 3FVVA 3OCWA 4UAVA 2YN4A 4B6JA 3QUTA 3TLMA 3WKAA 4UU1A 3RFUA 2R8XA 2YMPA 1TE2A 2IOFK 5AK3A 2YMQA 2YMMA 2G08A 2P11A 3QX7A 4UARA 4Y2UA 4XOUA 3L5KA 1JUDA 3L0YA 3EF0A 3ONNA 2AH5A 3OPXA 5AW2A 3E81A 1YJ5A 1ZD2P 1RQLA 2O9JA 4DW8A 1ZJJA 2RB5A 3QUQA 3WK4A 1RC8A 3I76A 1RLOA 2CFRA 2I34A 4JDPA 2GFHA 3QLEA 4YCNA 1Z4OA 3OCZA 3B9BA 3QU5A 3ZTWA 4OCZA 2EARA 4XQ0A 3F9RA 2CN1A 1VFPA 4CNQA 3L0CA 2FPXA 3ZVMA 3L1VA 4Y2JA 3W5AA 1CQZA 2HCFA 2R8YA 2WM8A 2YBDA 3NRJA 3QXGA 3B8EA 3QU7A 1N9KA 2I54A 1RMTA 1U2SA 4UASA 2EATA 4UM5A 4NABA 2FUEA 5AKKA 1LTQA 4HGPA 4BNDB 3E58A 4BX0A 4J2TA 1VJ5A 2AUTA 3QUBA 3CNHA 1YDFA 2X4DA 5ALVA 2NYVA 2OBBA 4E88A 1L7OA 2C4NA 4ZEVA 3E84A 4BEWA 3U7GA 4GXTA 5IS2A 5AVRA 4MWOA 3AR4A 2ZG6A 1RKQA 2AGVA 3ESRA 1PW5A 2FUCA 2CFTA 5AVUA 4BX3A 3L1UA 3QNMA 5AK5A 3ZUPA 5AW3A 3PDWA 1TJ4A 4YIKA 2ZBGA 2YMLA 2P69A 3L0BA 3QYPA 3ZVNA 2ODAA 5ALWA 2G80A 1RKVA 3DV9A 3SD7A 4UATA 2MU1A 1CR6A 1YS9A 3FGOA 4AP9A 3NASA 4GIBA 3U7FB 2P9JA 3EF1A 4UW9A 2C9MA 4O8CA 4YIHA 3HLTA 2G07A 1RMYA 1LVHA 3MPOA 3SKXA 3MN1A 2GMWA 5T41A 3WGUA 5AW5A 5AM1A 5AK4A 2ZOSA 1SU4A 1TA0A 3AR6A 5AI5A 2HX1A 3ET5A 3ESQA 2BY4A 4C4SA 3SHQA 5AVXA 1VJRA 3ET4A 1QYIA 2B0CA 1N8NA 4BEVA 5AKYA 4DFDA 4DCCA 5ALJA 1TJ3A 3M1YA 2YJ4A 4CF3A 3BA6A 3AR3A 3QUCA 1AQ6A 5AVTA 5AVYA 4UMFA 3J7TA 3PGVA 2MSNA 2WHEA 4KNVA 5AW6A 3ZX4A 3DAOA 1O03A 1SWWA 3U7HB 5AI0A 2B8JA 5ALLA 3U7EB 5AM0A 1QQ5A 2JARA 2B1RA 5ALPA 4Y2YA 5AICA 5AIBA 2EAUA 4CE6A 2QYHA 4HGOA 4KX5A 5AW1A 1Z4JA 2FPUA 3K1ZA 2Q4TA 4C4TA 3WK5A 4QQFA 5AKGA 3ZWDA 4UM7A 2Q4RA 1RPZA 1RKUA 2B82A 3EWIA 1RRCA 2G09A 2FPWA 4PNHA 1Q91A 1RDFA 2WF9A 5AI8A 1KYTA 3L8FA 2WF5A 4I9GA 4QJBA 5AM5A 2NO5A 2OM6A 4YGYA 2I55A 5AVWA 3UM9A 4EX7A 1Z5GA 2HF7A 3NUQA 2JGAA 3OCVA 1RLTA 1Z4PX 1WZCA 3WKCA 2FI1A 3M9LA 4HAIA 1XVIA 1FEZA 1EK1A 5ALHA 3ZX5A 3R09A 4UU0A 3UMCA 2RBKA 5AVQA 1T9ZA 3ZTYA 5ALXA 2W11A 5AM3A 4AS2A 4KN8A 4CF4A 4NAVA 2JAWA 3DNPA 1QQ6A 2P27A 2B30A 5ALZA 2G1AA 3UMGA 2HOQA 1WPGA 4JB3A 4KNWA 2JAOA 2HDOA 3FZQA 1K1EA 4NV0A 4G63A 4EX6A 3KC2A 2CFSA 1YV9A 3EPRA 1WVIA 2I33A 3A1EA 3SF0A 5FP0A 1RLMA 3ZVLA 5ALTA 3D6JA 2C88A 3WK7A 1F5SA 3WKDA 1QH9A 3N8GA 4UMVA 2WFAA 3SKYA 4UMEA 3KBBA 4Y2QA 4NWIA 3NIWA 1Z4LA 3UMBA 2O2XA 5AKZA 5AVVA 3CZ4A 5AW9A 1Z88A 4L6CA 4F72A 4IG4A 4OD0A 2VKQA 5ALSA 3ED5A 5AKLA 5AKXA 1Q92A 2WF7A 4YH1A 4HYTA 1SWVA 3WKBA 4BX2A 2ZBEA 4NFLA 3KDPA 3PCTA 3N07A 4DWOA 2B8EA 5ALFA 1O08A 5IT4A 5A3SA 3FPSA 4BYGA 4BBJA 2FPRA 5A3RA 1Z4KA 4YCMA 3KD3A 3W5CA 4RESA 1L7NA 3A3YA 3B9RA 4BKMA 5AM2A 1L7PA 4FYPA 4RETA 3NANA 2PQ0A 2RARA 3I6BA 1RQNA 5ALRA 3N5KA 2ZBDA 3L8EA 1EK2A 3SMVA 5AHXA 4CF5A 4H1WA
chains in the Genus database with same CATH superfamily
5EP2A 1ZSNA 4A6PA 2WWIA 1W44A 3H0EA 3TKAA 3C3JA 3RTVA 3BH0A 4CTNA 5LR6A 4GRDA 4PZOA 2AGOA 1H0KA 5IILA 2RGGA 3QVVA 3L6CA 3RS3A 2ZRJA 1BVHA 4YXJA 3QWFA 5BW8A 1YFLA 5KJ6A 1LQUA 1KIMA 5F3RA 2HSWA 3ER8A 1MV5A 5AKHA 3BF7A 1PR0A 3GRCA 2F8LA 4N7JA 2G1UA 3PX6A 2VDUE 3IIJA 4I99A 3CWCA 4N5DA 1Z75A 4WUTA 5SZJA 1XO1A 4EI2A 4GOND 2W6OA 5KJFA 1IJEA 3PP8A 2C61A 2Z6UA 4ED2A 5TT0A 4U8HA 2HSZA 2BH9A 1LS1A 1UUFA 4OHBA 2WE7A 1KI6A 1NN0A 2JDID 3ZS9A 3BCRA 3FVTA 4L85A 3IYLW 1XALA 5LWHA 1NC3A 5IH3A 4DQQA 4IOJA 4RZ2A 5CM8B 3G7SA 1NJYA 1B16A 1ZRMA 3P45A 4PQYA 5B4TA 2KJ5A 3KPJA 4YREA 4ZCLA 2O0MA 5LU9A 3CWQA 3HN6A 1IXZA 3FUTA 4FE7A 2X0KA 1YVUA 4B3RB 1IG3A 1ZCJA 3RTDA 3C4VA 4D0NA 4NR0A 1SUFA 2JXJA 5EZ5A 1W0KD 3ITEA 3MLEA 3TZQA 4CL3A 2GTIA 2D54A 4HH4A 1ML4A 2WDPA 3H5TA 5MHTA 3R1IA 4GZ3A 4YRAA 1SIJA 1WWKA 2FLKA 3WZLA 2QTZA 3Q3CA 1A8UA 1I6KA 3Q2OA 3LQFA 2CLMB 4KWTA 1H66A 5THXA 4QTYA 5D8DA 4NMLA 2G9NA 4BS9A 3PUJA 4RWEA 3OZGA 4G23A 1MSWD 5JJIA 4HDKA 1M0SA 2VP0A 4QFBA 1RPAA 1BQ4A 3KYDB 5BQPA 1QHFA 2IS6A 1Z12A 3HFSA 1U9CA 3KJXA 4AXXA 1POWA 2BV3A 2CDBA 4QWBA 4KLUA 1V11A 4GNKA 1T5BA 4QX6A 1BKYA 1XHFA 2ZRCA 4RJKA 1LJLA 1DCFA 3ZBUA 1DBVO 3DVAA 4EBBA 2QBYA 2EBUA 2V0NA 2BFBA 1GNRA 4EW1A 1E2JA 4YUAA 3U5TA 1Z2DA 1QHIA 3S5UA 3O5AA 4Q9IA 2I67A 4AXBA 3SHTA 1HUQA 2PNJA 3OX4A 3EC1A 2OM2A 3G3EA 4DNQA 1GU7A 2KOBA 3WS7A 3CG0A 3I09A 2F8SA 1A9QA 2PRSA 4TRNA 4PXYA 5DM0A 4PGMA 3HW8A 1IXSB 2I6TA 6GPBA 4L72A 3QEMB 5HM6A 1KI7A 1A82A 2PM8A 3G2OA 1Z5GA 3LQ4A 4NXNB 1OX4B 5EY5B 3U3KA 2WOOA 5J2JA 3SFZA 5KT4A 2Z8YM 3IDZA 1C9JA 2YXEA 2BM9A 1IM5A 3PJFA 2W93A 5CW2A 1RQ7A 2BPCA 4CW7A 4K9LA 2AVDA 3LPDA 3AU2A 5CEHA 4HJXA 1USGA 4MJ7A 3HB7A 4D9KA 3HYNA 1E98A 4DR7B 8ICMA 1KSHA 4EHHA 4MJXA 3C16C 3IEPA 1BPYA 2JEGA 3LSTA 4JBGA 2VBCA 2W00A 1ZQSA 4LC1A 5KDOA 2WB4A 4R9UC 4PW0A 2JPDA 2AFIB 4I4TB 2WTFA 1WOYA 1O08A 4JJZA 4HB3A 4FZMA 3BKWA 4I4TF 1OYYA 1KI8A 5FBWB 3DWGA 3THYA 1M2KA 1TM5E 3L1KA 4REOA 2XTAA 4Y9SA 4F5NA 1TAMA 2L42A 4RTJA 4RA6B 3U13A 3PD1A 2YZKA 4R6WA 4ZAVA 2HDHA 3ZYZA 1WMBA 1TK0A 5CG2A 1NW3A 1T3HA 5DRYA 2A1IA 1NUTA 3H3FA 8ICYA 1VCNA 1ILEA 2EJUA 1H23A 1F2VA 3N2IA 4G5SA 3PLAE 3L6DA 4YLYA 2VIIA 5LZ8A 2YWRA 1ESEA 3BXHA 1NVTA 3PXEA 4HGNA 4KK3A 4M3NA 1X40A 1Y6GA 1Q3KA 2YJ3A 1PV4A 5KYXA 1Q0RA 1NYRA 1QK5A 1YZTA 3IHWA 1KVUA 1J8QA 4RZUA 4KXLA 5TGTA 1L5MA 4BJHB 5HCNA 2GWHA 4W5QA 4JWTA 1PK1A 4F0JA 3BFPA 1EVIA 2FWPA 1GPWB 1UMBA 3M6ZA 2VDKB 1S2MA 4DAEA 2E82A 4NZOA 2GN4A 1PJSA 2OVBA 4RQ7A 1N36B 4XJSA 1DX9A 1VPWA 3UANA 2A9QA 5AK6A 2EW8A 4MKXA 2P1RA 2BGWA 5AVOA 3UJ9A 3EPIA 5KO2A 3VC3A 3E27A 3N2ZB 1UR5A 3LUHA 3F97A 3FSJX 3G9XA 1K8XB 5LBUA 3A27A 2IVFA 1SK9A 4CKEB 4J75A 3NH6A 2QVXX 3EF0A 4ZJUA 1TQHA 2IHNA 3E81A 4FOLA 4V0LA 1GTZA 5ICMA 4TT8A 1K27A 1E63A 2G0NA 2ZRPA 3S68A 3D3WA 5D86A 5TV2A 4NS4A 4B9VA 3HP4A 1LDMA 1N9KA 2I54A 1SXJB 2PZFA 4I6GA 1S6YA 3SDSA 3ZWNA 3KXPA 3QEAZ 2P75A 1M6NA 3HBLA 5TQ2B 1E2KA 4DWWA 1IPEA 4ZV9A 5EP3A 2Q0SA 1VMIA 4AROA 1T3TA 1YRWA 4M1EA 1OVMA 1M1YB 5KOIA 4D8XA 3QV2A 5BRNA 3UWPA 3SD7A 1XZNA 2C9ZA 2O23A 3L04A 3M6IA 4Q4JB 5DCWA 1XQ9A 2WNIA 5A4DA 3OPMA 1RM4A 3EBPA 1MMFB 4DR5B 1T6ZA 5D3ZA 2PH3A 4UC0A 3THWB 3PKIA 4YBZA 5BSKA 3IUPA 4OHPA 3KJEA 5KSYA 3F47A 2P79A 4HP8A 2ADMA 5D3QA 3B52X 5LOVB 1C1XB 4WIAA 4J91A 1ETHA 5LOVF 2ZTUA 4RDIA 3TZEA 3ZBQA 4IRCA 2CLDX 2WKRA 4K5QA 4FKMA 3G0GA 1DJQA 2CLSA 1H6CA 5BYKA 1Y89A 5I9MA 5HG0A 1WXFA 2O07A 4BVLA 5DK6A 1BKDR 1DRGA 2D5BA 1RPZA 4HAYA 1F14A 1IY2A 2IUFA 2OC9A 5KNDA 3IT0A 2HUPA 3WLQA 4BB5A 3PC7A 1DG9A 1HE4A 2ZM6B 1UBHS 3V00A 4UUMA 3VR1A 5KTQA 1T1IA 5FR2A 2XUQA 1R74A 4RPKA 2W83A 4GVPA 4FCCA 4J49A 4Z8YA 1A8SA 3KQLA 2CL6X 2IYTA 1AF4A 1JTEA 4G4SO 3A26A 1TM1E 2GAIA 4OOEA 4KJZA 4URHA 1C2TA 1XJ5A 3T7SA 4W9MC 4BMZA 3SAHA 3CE6A 1QH9A 2HO5A 4QDKA 1JEYA 3F7TA 4D1YA 1T2VA 1Z88A 1FU4A 1KDTA 3I32A 1QIGA 1CUXA 4HVTA 4DA7A 4AMZA 1XYGA 2B92A 5A3SA 3TZHA 2IEAA 2NZJA 3KJFA 4KQEA 2GNOA 3WL5A 4AVYA 2CPRA 2KE5A 3SI7A 1T9KA 3OX1A 1EK2A 5LIPA 2GHTA 3STUA 1MC1A 4JQOA 4JS0A 1CB7A 2VCYA 5AKJA 2VRCA 2CF6A 2PVPA 3LCRA 2PUDA 3HADA 5DIFA 3K70C 2HM7A 2B0JA 1UT8A 2Q5EA 2Y27A 2P2NA 4KQKA 4DSOA 4KR0A 4G37A 5JDIC 4QUJA 2WWWA 2H1SA 2ACKA 3KNZA 2D5IA 1H2BA 2WFMA 1FO4A 1OB2A 4ATNA 5ALUA 4B2PA 3ZWYA 2OHOA 2B4TO 5JZSA 5IIJA 1SHLA 4KQWA 3GJ6A 1X80B 4PGGA 1GEGA 3OLWA 5KT3A 3GVIA 2BLLA 3R44A 4EMSA 2W70A 2R8KA 3OFSA 4DSIA 4YCAA 1FVXA 1QFJA 4ZO8A 4ZODA 3CEMA 3LHSA 3RS8A 4DUGA 1RHRA 4N9WA 3AR8A 3E23A 3D3KA 1A8PA 1U8ZA 3S27A 3GLRA 3IUQA 3K7EA 3PO4A 3HRDD 1YONA 5KFJA 1G19A 4NECA 5LP6C 3ZY6A 3KZNA 1ESCA 5IAAA 4NI5A 4A8PA 4KUHA 3MXTA 3BYZA 1DOQA 2XQJA 4EF4A 4GNRA 1K7FB 1IVNA 2IZ1A 5ER6A 4Y0VA 5CDHA 2R751 3OETA 4N41A 2AI3A 4NMXB 3E0XA 3PR2B 3I05A 3L4BA 4HDSB 5YASA 1GPKA 2NXWA 1XMQB 4QRHA 4E2ZA 3VNBA 4DFMA 3GLUA 5L9AA 2OORC 9LDBA 3D6FA 4HDNA 2WM2A 2O9JA 4X60A 1XIVA 4KYUA 4FYHA 2P9YA 1F2UB 4CMGA 4MQLA 9ICTA 1JDBB 4O5KA 2X13A 2Q9AA 1JPNA 4HQKA 1MGPA 2QXUA 4G8CA 1UKVY 5EQFA 4ZOLA 1GYPA 4LRTB 4ND6A 4WZAB 1XGKA 3SEAA 1SKWA 2BCUA 1S10A 2JJ2D 1L5OA 1L5HA 1YCDA 3HPOA 1UEJA 3ZUPA 5LMNB 4ZIRA 2IHVA 4A8TA 3R9IA 3O4FA 1NXSA 4QEDA 1QKJA 1SBQA 5D1NA 5CJPA 1FLDA 2WIDA 5DASA 1XSEA 4TLMB 3OOHA 4Y98A 2GB4A 3UKOA 1RYYA 4AKIA 3U80A 4V3BA 2QSYA 4TTPA 5TARA 4QZIA 4B82A 4F4YA 5AVTA 2P4HX 1GGHA 1JAZA 4AUMA 3PMNA 2IPLA 1KO4A 2XA1A 2MYPA 4DNXA 2CMHA 3RADC 4WINA 4Q1VA 1VHLA 1G16A 4EG3A 1KW4A 3T35A 5DQIA 4YACA 4QPCA 1B14A 4UEWA 2EBHX 4PLCA 2NT4A 4RVHA 1CEEA 1OPRA 3H2HA 3R75A 2X1MA 3THXB 4LS3A 4ZI2A 3FAKA 4DDMA 1O5IA 1BOFA 5DOZA 1I13A 4MRNA 5K51A 1N25A 2L19A 5KNIA 5A5EA 1T3NA 4KP7A 1EE9A 4D80A 1NQVA 3NKLA 2NUAB 3V8PA 1WHTA 4DGSA 2Q9CA 3RUEA 4RMHA 4WLVA 1TPYA 1T0BA 2DP4E 5AUOB 3QI2A 1TZMA 3BH7A 2IXFA 2P35A 1Z5OA 1PEDA 1CY6A 1Y48E 4JP8A 3SEZA 1MQ2A 4LSZA 5HHIA 2PSFA 1MJNA 3WIDA 3WOHA 2UKDA 1GUDA 4AC9A 4KO1S 1PJCA 3LIPA 1YA4A 4CCYB 2BJWA 1F0YA 4OFWA 1S1CA 4TS4A 1KK2A 4N3AA 2Q27A 4OKNA 1L7EA 2PMBA 1RE1A 4G01B 1GO2A 1T29A 2MUTB 2KICA 1SVWA 4UBMA 1P0CA 2AW3A 4DM4A 1LNQA 3PNCA 4UFOA 4B87A 1UH5A 3O8OB 1YI8A 3WKEA 1ESDA 3C1ZA 3AM3A 3BQMB 4ODIA 3OESA 4EFMA 5JMPA 4EEKA 3CWZA 1F51E 1LI5A 4RQTA 2B2NA 1X0VA 5IN5A 4XYLA 4RGYA 2EAOA 2NZUG 1AOXA 2HRRA 1KF0A 2FSVA 4AN1A 2HWXA 2W2LD 5IINA 1A2KC 1LI7A 3F74A 3LVVA 1KO5A 5ALGA 1GUAA 5KYYB 5FWDA 4H0NA 2NZ8A 3OP4A 3OJLA 5JRDS 3ZU6A 3MFIA 1ECGA 3BWBA 5AJWA 4YRKA 1J1ZA 2ONCA 1UBMS 2BHNA 2IFTA 3VQTA 1GZ3A 3SF8B 5KNCA 3TW4A 2X3UA 3G0IA 5I9TA 1THTA 2WZQA 4HMOA 3AJ8A 4PX2A 4D4IA 1AGYA 2R8ZA 3L9WA 4U6NA 2J33A 4QWDA 4HN9A 4GXIA 3F98A 4NCKA 4MCAA 1C29B 3QPDA 2WUDA 1JHPA 2O5VA 3FOWA 2VJQA 4IKEA 2FSHA 1EKXA 3TZLA 3UAGA 2G06A 3C23A 1CNFA 1RIFA 4ZI7A 4KN6A 2IU4A 4H77A 1U6IA 3RVQA 2ENUA 4OAQA 1JUDA 2C22A 4Y67A 3LBYA 4MVXA 1YQUA 5LVAA 3KB1A 4MVJH 2J5RA 4BVAA 4DUYB 1QDLB 4ZCTA 1LNSA 1N5KA 1J2NA 3L93A 1MBZA 3SHOA 1DEXA 2UAGA 2VT6A 1JECA 1U9IA 4FSDA 1D6SA 4KQJA 4RK6A 1KDOA 4WOCA 4DF8A 3JQ7A 1FTWA 3IR5A 2ADOA 2NV0A 2DR0A 3E84A 2YR0A 3AXTA 2I2WA 3OE1A 2M6KA 1PW5A 2UZAA 2VRNA 2HWWA 1IQRA 3L1UA 1E1YA 4I1RA 2BFOA 1XEXA 3T5LA 4JA0A 3VXKA 4TRMA 3RFTA 4GW3A 4UATA 3KFUF 2PRJA 4PHCA 5TJHA 4AP9A 1VCHA 3CLRD 3RSHA 4UZEA 5AFSA 4JX9A 3KHGA 5FD8A 4ED9A 5AW5A 2G17A 2Q2VA 4KIGA 2G5HB 1TA0A 4MVYA 4LX8A 1UOOA 1IN8A 3HWWA 2PX2A 5KG2A 4NY1A 4HDCA 5IJAA 2M9NA 3PW7A 4DJJA 2NU9B 3LF2A 3KX2A 4X95A 2EAUA 5DGXA 3H8WA 2FDXA 3CY6A 4RADA 3FNQA 3ZNOA 3TNLA 1MAHA 3KCNA 2R8RA 4ZO4A 3G9TA 1GQRA 1CFJA 3ZVRA 1HZZC 1OSNA 1VE5A 4DHWA 4HAIA 3A3PA 4I50B 1UANA 3UYLA 2PX4A 3ZXYA 3MHTA 1A9XB 2IX3A 3QEOA 2XIDA 2YTZA 4I50F 3CX7A 1CQIA 4JKOA 1SCBA 1GR0A 4C2UA 1X19A 1E3QA 3UH0A 3PVCA 4QG7A 1NBIA 3KZIU 1CRLA 3IKLA 7REQA 1RLMA 4ZT4A 4FNAA 4QUDA 3EVFA 1V1RB 4MDHA 1M72A 3S2SA 4NWIA 3L0SA 5KFQA 4H0CA 6YASA 1NHGA 4CMAA 1P5FA 3CF0A 3FDJA 1Z5PA 2P77A 2AXTU 1ST2A 4K1XA 5ITZA 2D06A 3KDPA 3N07A 4L8FA 3IPXA 1QANA 1K6EA 2HLDD 4N54A 1KEWA 5GTDA 5J2TA 3RH5A 2RARA 3FNHA 1Y3FE 2VP5A 3PTAA 3LY7A 1I7QB 5DYNA 2I80A 1T5IA 1V38A 2A59A 1UODA 2VP9A 4HQOA 4NENB 4JXKA 2G70A 1K0UA 4ZYXA 1QO0A 1DUSA 1YZHA 4LXHA 3DZKA 3EDQA 3EZXA 2PWYA 4PPNA 5JRTA 3NHKA 5AUQA 1T3SA 1AQLA 4GP9A 3M8KA 3K20A 3NU1A 2BFFA 2AFVA 4DABA 4BCDA 2PZBA 4FT2A 2HBJA 3ROXA 3SQLA 2X19A 4V24A 3NAQA 5A7HA 1EJ6A 1TZ2A 1L8AA 4XZ3A 1RZUA 1C0LA 3ZN2A 4HEQA 4C3VA 2JGNA 4E2FA 1NMEA 3NCHA 4JR2A 1L1QA 5HHTA 3QA9A 3I0ZA 2GD0A 4IGAA 3SLRA 5AW8A 3MINA 4PGXA 4EL0A 5HQ3A 3IELA 2R47A 2YC4C 3V1LA 1EHIA 1SMKA 4BJ1A 4FZRA 2NG1A 3C2LA 3AMVA 1V5IA 4ZT2A 3VSBA 4KLFA 2QLJA 2C57A 3SFVA 1HETA 1KFSA 4Z9AA 2BQRA 3LPAA 4JQZA 3E9YA 3EPHA 2W8BB 2QLTA 1FRZA 3TGWA 3C2KA 1X66A 1KMHA 1ADGA 2CXHA 3BTVA 3BCHA 1JNXX 2XUAA 1GZ7A 3H86A 1O9BA 3QE3A 4JI5B 2QRHA 4YMIA 5GOTA 3D4LA 1NW7A 1ZQVA 4S04A 7ICRA 2X58A 1M10A 3B9BA 1VM6A 3O4VA 3FAZA 5AVKA 3HSKA 2NU7A 4RGBA 3PEYA 3E7DA 1CQZA 3NVKI 5HIKA 3NRJA 3T3MB 2DUWA 4LRWA 5BT8A 2H2DA 4NHEA 3M5DA 3M6FA 3GRPA 4RM3A 1QJCA 2PPVA 5A5VA 2LM1A 3K70B 2H3IA 5T6BA 4DNFA 1YHNA 1DKMA 5H1YA 1YUBA 4E12A 4DB2A 1R0CA 1EUCA 3ELUA 2NYVA 1M8FA 3E6AA 3UCEA 5IPFA 3KVYA 5IJ0B 2B7CA 1EQ2A 2PZEA 4WMLA 1QVVA 1TQ6A 1TW3A 1Y9JA 1R4NA 5CIYA 1FFAA 4KIUA 1R9NA 4F1WA 5IYZB 4R51A 1Q0UA 3GROA 4AP5A 1D1SA 2WIFA 2VVTA 5CA0A 3FDZA 2HQOA 4HB2A 2P2YA 3NB0A 1SXDA 5IYZF 4AZ3A 2VQEB 4OI2A 1RXSA 1RQPA 3IQEA 1ZLYA 2G07A 1F2TA 4CETA 5COAA 3RBEA 2XNCA 3C3CA 4AY6A 1G6HA 2SCUA 5DRTA 3KQTA 2P9TA 3JR7A 1NVFA 1DC5A 4CM1A 3RBXA 4Z5XA 1UCFA 2KS6A 3H1PA 1FNCA 1HH4A 3IEIA 4PC1A 3AR3A 4NCIA 4NOJA 3N76A 5IX8A 1MOZA 3H0KA 4DMGA 4MDYA 3E7WA 4IKOA 1C7IA 2K7ZA 2GXSA 3DC7A 4D98A 3Q7TA 1GU0A 1C8BA 2FPUA 2IXGA 1T4MA 4Z9FA 1JBEA 1NUQA 3DHVA 5FHRA 3WK5A 1N8SA 3NRBA 3L8CA 1NR7A 2H3QA 2Y67A 3R3HA 3DSRA 3AZPA 4YJGA 3AJAA 4C4PA 4FWTA 4TQSA 2WA2A 1KQGA 3PENA 3HFJA 1AKEA 4NAVA 3E9ZA 1M8GA 2ATXA 4J07A 4P4UA 4DLYA 2IITA 1M2FA 1T1EA 4OV6B 4R6XA 5CJ7A 3BEDA 4B6GA 1SVKA 2WSSD 1KL7A 1W1IA 3KBBA 2HEIA 4O3OA 1M2VA 4NJEB 5JXGA 1Q92A 3BREA 3BZWA 2AQ8A 1RM6C 1U6JA 2V54A 4R64A 3PFBA 3UV3A 3ZV6A 4OG2A 4XUDA 1YZLA 1OB5A 3OTOB 1W5SA 4PTLA 4M38A 4RIIA 3VPBA 1RI4A 2AXEA 3SS9X 4RCZA 4JI7B 5F64A 3G02A 1MLDA 3GFBA 3CGGA 3BRWD 4QWEA 4CYMA 5KVQA 3PC2A 1JAHA 3RJKA 4QUBA 3GJ8A 3ZHRA 4LXXA 1E64A 4P4OA 5FO0A 3A6DA 2QMOA 1OROA 3RSLA 2K4MA 2XWSA 4UXJA 2XCUA 4HWGA 4B3BA 4PLWA 2C8LA 2QF7A 1VL1A 2CGEA 3HJHA 2DVMA 1V9LA 3EZYA 4IDQA 4AD8A 3D2AA 4B85A 1E3DA 2P3LA 3JPWA 3TIVA 5KINB 2KHZA 4LOJA 3G68A 5EWFA 4B3FX 3ZY5A 4BNWA 2H54A 3CUWA 4L76A 1ZH8A 2CJXA 5IIIA 2JASA 1R64A 5TF4A 3IPAA 3C3DA 4ONEA 5EYPA 3I6YA 1HDRA 3FNFA 3SWWA 1JHDA 3ZDEA 5G41A 4R3UC 1E2NA 3FJ1A 1SVSA 4JJEA 1BVYF 4RH0A 4DSTA 4EJMA 3L43A 2DFPA 1E1KA 3FR8A 4PZAA 2H8GA 5HE9A 5JCOA 1RW4A 2IZOA 3NP9A 4KMOB 3GBVA 3T8YA 3EEYA 3G2NA 4H7EA 4KXUA 5BPFA 3ZI0A 4QZFA 2GPYA 1TE2A 5HDQA 1FRVA 2CJYA 4C07A 4JDUA 1NVVR 3PEWA 2R18A 4YEDA 3WNDA 3VZRA 1YGYA 2PU7A 4XM2A 4CUKA 4OU5A 1D6NA 4R66A 2QN7A 2NXEA 3QIVA 1WXIA 4KQ6A 1ABFA 2IYVA 5IARA 3A6KA 1SNYA 2ECFA 3JARA 3LUFA 2E49A 1VFPA 2Y71A 2DAPA 4F50A 1XD2A 2FWRA 5K6RA 2P9HA 4NJMA 4OB7A 3A1NA 4OJQA 4NABA 4P22A 2MSEB 3E58A 1E96A 2ZSJA 4Q1DA 4IRUB 5ER9A 2H7YA 3KOZA 1GFWA 1NPTO 3H2YA 3AW8A 1T36A 1EP3B 2G7ZA 3H5VA 4YAWA 4EB8A 1LPNA 1XTTA 4WBXC 2WV9A 4KN5A 3SIPA 4F5OA 2XC9A 1N57A 2HWUA 4BQRA 1E32A 1IJFA 1QGDA 1T5LA 4BGVA 8ICRA 4Q45A 3UPQA 4A0GA 2ZKLA 3B3AA 1LSUA 4KTTE 2NTJA 2KHVA 3NHAA 2W90A 4LBVA 4XVUA 4PZPA 3CKLA 5M2QA 3ETRA 5H81A 1G60A 2J3IA 2XKAA 1UZLA 3ZGYA 2RG1A 4N8DA 1PVDA 2VF8A 3VV2A 3PCXA 3NTLA 2BBTA 3BDVA 4L5JA 1NLUA 1ZVJA 3RYCB 4Q9NA 2HSGA 2BKUA 2ZJYA 3C48A 5E79U 2RI1A 5KKNB 4MUAA 2F8MA 2XCPA 2BF4A 1P5JA 1X13A 4Q4CA 4D02A 4L4UA 1X8JA 2KI5A 4K88A 2FI1A 1PF7E 4ESHA 4FDVA 5K3AA 3PW0A 3MXOA 1S2DA 2BFDB 4AS2A 3TQIA 1ACMA 5HIMA 3T38A 3ZXXA 4OJKA 5DSXA 4BZQA 1U5BA 1QLHA 4KC0A 1UJCA 4R1QA 1ODLA 3QBJA 1OYOA 2EKQA 1UADA 2F44A 3FSEA 4YRRA 1U80A 2GETA 2IEIA 4B4DA 2G9ZA 2Y1FA 3OO1A 3DAHA 3I1FA 1MB2A 5TC4A 1ZL2A 2OGWA 2KVSA 5TNXA 1CWUA 4ED8A 5HE8A 1KAEA 1OZ0A 1T0PA 4DY6A 2ZBRA 2IY7A 4GXKA 1C3EA 4PRYA 4Q7MB 2FMQA 1R0XA 2Q6TA 3OVMA 3I12A 1JSCA 4NCXA 2P6OA 3G5TA 4GC7A 3CN9A 4AQYB 1J1IA 5FI5A 3I37X 2FU5C 2J5KA 2DHCA 1R12A 1LI4A 1AA9A 4QSMA 3H2ZA 1ADBA 1N3BA 2GYWA 3HVJA 3WL6A 2NAFA 3CX8A 2H5IA 3KETA 1C3XA 1U48A 3GIWA 1NUAA 3OEEA 1ZPDA 2K8AA 3TTTA 4QU8A 4HFNA 1DMSA 1PZEA 4Q16A 1AXRA 1PE0A 3KWFA 1IN1A 3FCYA 1KBQA 5EMJA 4YLGA 2O7SA 5A05A 4TSRA 4QBTA 2AOUA 1GPNA 8ICWA 4H31A 4EUEA 1HDOA 2QSZA 2C5EA 4RHYA 1PJLA 1LFAA 2FQ1A 2O5EA 2J0EA 4M9GA 3GRUA 1CIJA 4EY7A 2BC9A 1TVMA 2GJ4A 5H4HA 1M2OA 1EVQA 3I4FA 5TQJA 2XNDA 2O20A 2QSJA 2BCEA 3LDFA 2F90A 4G67A 4GBED 3FDFA 1K63A 3PQ4A 3WC4A 2ID8A 1U28A 2OESA 1XWLA 3Q9NA 3G2KA 2R87A 4X3OA 3NKVA 3GJ3A 4JIMA 4H2DA 4BP1A 4DCVA 1KMNA 1SFRA 2VF2A 5J0WA 1A72A 3PWSA 3ZHXA 3VNQA 4OHOA 4KR2A 2HA5A 5L7YA 4ZVVA 3RSOA 2SICE 1TVKA 4EHJA 3I04A 2X1HA 5FTNA 4F3NA 5AQ1A 1JQKA 1B2LA 1PS0A 2PNFA 3QVMA 1N63A 4KYVA 5ENDA 2KZZA 1OREA 2Q3CA 1D2GA 3QXSA 3VO8A 4E11A 3HJUA 4YPVA 1W48A 5IAOA 3VO2A 2P6UA 1KI3A 2CN1A 3KBOA 5F33A 4FMDB 5J0YA 2O3QA 5LDDC 1UMDA 1CNMA 3L0PA 4FMDF 4NHOA 2A0WA 2Z0MA 1A7UA 1R6AA 3BK1A 1BS9A 1KYWA 1SJ9A 2HH9A 4OBBA 2M9MA 5F7OA 3UWMA 2GZ1A 1QRDA 2BLNA 1R4AA 1N2BA 1JTVA 5LP1A 5KFEA 4IW3B 3QYPA 1HXHA 3H65A 3NHSA 1I7NA 1BCRB 1OXTA 3HY3A 5L6LB 3OSPA 1E1QA 1JIXA 3K6RA 4LSWA 4XWAA 3GDXA 3EAGA 5BOVA 1U49A 1D8YA 2YXLA 3RROA 5EZSA 5EXTA 4IVRA 1WOMA 1YB4A 5AM1A 2ORYA 4Q37A 3AERB 2OILA 3G7NA 3ILXA 1P6UA 1O95C 3IO5A 3K1RB 1UM9B 3B3JA 1YXMA 3F6BX 2Q07A 1Q3VA 3VU8A 5E9QA 1Z33A 5FV4A 2A57A 3DLIA 5D6NA 4H16A 3DZDA 3LBFA 2H1IA 3ES9A 2ZJ4A 3ZZMA 4HZGA 1ZCAA 3I5AA 4M6WB 5JAIA 2NTNA 2PX8A 4E4RA 3EVBA 3E9MA 3QFCA 3GJRA 1BE8A 2D5LA 2KIWA 4KX5A 4CIBA 4U5XA 3RJFA 4MZDA 4RZ3A 5G2OA 5HA5A 1IEQA 5BSHA 2B82A 3KB2A 2UVDA 1HI9A 5P8WA 4QGSA 2JVKA 3UOGA 2O2CA 2BGNA 4ACAA 2WPNA 3SFTA 1IEWA 2V74B 3PHCA 4UU8A 3LWZA 2OQVA 1UINA 1I3LA 4YK7A 2P27A 2QJFA 1YB6A 3T9BA 3DLCA 5CTAA 2Q49A 3D1VA 1IQUA 3A0UA 2ZVJA 5EIBC 3TCXB 4DOCA 4ZAYA 3ZV4A 3L4KA 1YOVA 2E5LB 1SZPA 2G25A 5DTQA 3T15A 4RA9A 1AS2A 3NIWA 5K0ZA 2PUAA 4BJQA 3SBXA 4LMPA 4WKOA 3ZWMA 3COVA 3CC8A 4EPTA 4R68A 5CWRA 3ERCA 5ILOA 2KSOA 3VPAA 4LJAA 5FTMA 4TM7A 3V1UA 4MW4A 4BFLA 1PLJA 2EANA 3RW9A 2YWGA 3O95A 2HU2A 1DTSA 4CM7A 3CNLA 2ZBDA 5GZ1A 1FRFS 4G25A 2J5BA 1TADA 4X00A 3SSNA 1YBHA 3LTEA 2OP0A 4P34A 3I0MA 3UUGA 5C3MA 2JATA 4PQEA 3RQIA 2QTFA 3JQGB 1Q1GA 1Q0TA 3U19A 2Q29A 5DU2A 4EWLA 1JSXA 1Q1ZA 2YFQA 2HO4A 4BEJA 2ZIVB 3PHLA 4MV4A 4PGHA 1MZPA 1E99A 2D2VA 3P2JA 2C0QA 4QECA 1FFYA 4ZPJA 4PGYA 4ZJYA 5FOTA 5G1PA 2YNMA 3LL4A 4YV2A 2G5CA 4OY3A 5EMLA 4Z1MA 3OLXA 1UK8A 4GL4A 4HGQA 4H15A 3RR8A 4WD3A 4RV4A 3JYPA 3IJPA 3PEEA 1VZ3A 2WILA 3MQ2A 3SM3A 3AFIA 3EMDA 3EFOB 4CIAA 1BXGB 3PZRA 4J90A 1UXGA 2D2EA 4YR9A 3LUJA 3QNWA 3W8DA 1MQ9A 4GC6A 5LJLA 4G84A 2HA7A 4IDEA 4WWHA 2CXPA 5L4SA 3KV3O 5HILA 4WKPA 2GPAA 2QGFA 3EXHA 3EC7A 3RLIA 1ECCA 3PYMA 1NM5A 2COEA 5KU7A 4B40A 3H5WA 4OYHA 3WL7A 2H1CA 4A82A 1PJQA 3F9CA 4MV5A 1CG6A 4N5LA 4M7RA 1BPZA 1USIA 1DBRA 5J2AA 4OP3A 1X70A 3D4OA 3K5WA 3SSAA 4FOOA 4WY8A 3JYOA 2JCXA 3TW8B 4EP1A 1Z3EB 3U48A 3NUZA 2WU8A 2G9RA 2RK6A 3ADKA 3AUKA 1U3GA 3RVLA 2XNSA 5K8JB 2I2AA 4Y6RA 5FULA 1NBHA 1MQ8B 2W7OA 1KL9A 3EDMA 4IS7A 4ICIA 2WWYA 2X8AA 2IHYA 4IBOA 1NK8A 1D7AA 4DQDA 1XZBA 1Z22A 5FA8A 3F8SA 2XYPA 4MS4A 1X1QA 3ESXA 1WV1A 4DLVA 1EUQA 5GTIU 2JFGA 2NO0A 4LZJA 3EIOA 1JAIA 4K8OA 3RAFC 3VR6D 1D8BA 2UZ1B 3A7EA 5KEIA 3IX7A 4YMVA 4C0BA 3PR3A 4U00A 1P73A 2OHIA 1ZK3A 3ZEAA 3UY4A 3EJWA 3UJPA 2V03A 2M1XA 2JEYA 1JWAB 2X4GA 4O4JB 2FPGA 1N5LA 4KLLA 4UBCA 4ALKA 4M8NE 4O4JF 1MV8A 2PY6A 3R7WB 3W2IA 2WWFA 1UK9A 4O8CA 3H9CA 3H3XA 4HLDA 1V7PC 1A5TA 1W4BA 2Q6IA 4M9QA 2W5UA 4J4TA 1EE2A 1US8B 5DHSA 4PSKA 3BHJA 1Q0LA 1LLFA 3GNLA 1KI9A 3VTKA 3INGA 1WXWA 1RRPA 4MPTA 1NVDA 3CUYA 2QL7A 3GJZA 1F44A 1BO6A 4LJ9A 1LD3A 4JBXA 2PXHA 2QDKA 4C0LA 4LV8B 1J9GA 3ZIDA 5KC9A 2OCIA 4LDJA 5JS2A 4M9RA 1LPPA 4TS9A 2JJ1D 1Y3CE 1Q1NA 4FW8A 4HBGA 4H6VA 2H85A 5BQXA 4HNGA 1G8MA 5IBRA 3ZJ4A 2D0DA 2J48A 4EA8A 3FXAA 4ILEA 1E4EB 1EX6A 3WKCA 3GB9A 3ICPA 1F6WA 1G6Q1 5I7SA 5K3BA 2CD7A 5AVQA 2FLVA 4IRDA 3B5JA 3A9WA 1YZQA 3LHDA 3LAWA 4EW3A 1TJNA 3JPNA 1LDNA 1V47A 2C4WA 5JZOA 1XQ1A 3IP1A 3GZ4A 4DVJA 1HNZB 4DRYA 1ECBA 4QRDA 2B36A 4I36A 2VEDA 5G02A 3HP6A 1ONBA 1UKAA 1T8TA 2H31A 1VYUA 1ODFA 3HJAA 1KK1A 1BEUB 2WFAA 2O3RA 1LLQA 4HEA1 1QIDA 3RLFA 3VYSB 3JQ6A 2YVLA 3MK31 3NS1A 1WHSB 3QVOA 3I23A 1YTLA 1PHPA 5ALFA 2VDNB 4F21A 2YOFA 5AJTA 3PSHA 5JWOA 1ZQXA 3M5WA 1TFUA 1L7PA 3T1YB 4BDTA 2BF7A 4NX2A 3TZKA 2J3DA 3UJ7A 4PCLA 4Q3CA 1QFYA 5HBGA 1XD8A 4WT7A 1G1MA 1JQLB 2CUNA 1M5UA 4MUMA 3LY5A 5F52A 3DAGA 4MEAA 2I6GA 5TE9A 4TMYA 1N0WA 3VJLA 1GCUA 4O4LB 1U8AA 1XTRA 2FJ0A 3GNTA 2Y1EA 4O4LF 3T0GA 2YIMA 4OFZA 5JU6A 2XCAA 4P32A 3ENWA 2IBSA 1ICEA 5C9ZA 1MCZA 4JJGA 1DIRA 5JEDA 4C80A 3SZOA 4TSKA 3L1IA 3SQNA 1AS0A 4UHKA 4CQNA 1U2TA 1GFSA 1U7PA 4XGKA 1JI3A 1KRPA 3E3MA 4DSFA 4G0ZA 2RDIA 2NV2B 3NYIA 3H05A 2VIXA 1WDTA 4QTUB 2ZR9A 2MCFA 3NJ4A 4PZ0A 3ZDYB 4HWRA 5CR0A 3O38A 1J25A 1HFJA 2A2ZA 3NVWA 4B6PA 4R7GA 4D8TA 3DOFA 3GVXA 5JANA 1KQQA 4FGKA 2WHQA 1DIHA 4XE5A 2AG8A 3AVYA 4DV5B 4G41A 3F71A 1IXRA 4HEA6 4WRRA 2A5FA 4QXQA 2MINA 4V0RA 2F1HA 5KKCA 4AQDA 5K0CA 4PE5B 4LSGA 3PI6A 5LQNA 4DAOA 2VQDA 3WKAA 4B4OA 4B75A 5A1JA 4IZHA 2R9VA 1RYRA 1NW4A 3AU6A 2PWZA 3LBNA 4DG8A 5L4NA 1AN0A 2IIQA 1YJ5A 1Z6YA 2CLKB 2PSJA 4A8HA 2WJ4A 2H4JA 4BB9A 2GN1A 2QD1A 3AKDA 1PVVA 2VDMB 1G42A 4YPFA 1F0PA 3H6HA 4Y1RB 1UL1X 4NLNA 2H3EA 2XCLA 4WLNA 2AOVA 1LBQA 3EGIA 2FZ4A 3CKKA 3M9WA 3IUYA 3TX6A 2Q0ZX 4ZCIA 3FCXA 4CZ2A 1N5JA 1QYXA 4EEZA 2H57A 5D00A 4L4ZA 3EXFA 2O05A 1GCOA 4WFQA 4PXSA 5JSYA 1LZLA 1CPYA 3I34X 1TJ4A 4KLIA 2NRXA 5DYTA 3K4HA 2HREA 2I2CA 1JT2A 5I9LA 4J0DA 4GIBA 4RNNA 2R11A 4BGIA 2AFHA 1COKA 1IHOA 3QLUA 1A5ZA 2V45A 3RIXA 1LVHA 3H5IA 5CYGA 4E15A 1MQAA 1NQTA 4CLOA 1H4VB 3TVYA 1BFKA 4LZOA 1QSYA 1K7SN 4BC1A 1Z0UA 2BY4A 4PLFA 2FB9A 3CW2C 1QO9A 4MQEB 4CLHA 1CJUC 2UUAB 3LNCA 3OJOA 3IILA 1CRQA 4MHOA 2D1RA 2C3OA 3TUJC 1JZSA 3MZ0A 3BGIA 3U7HB 5LM3A 3HKEB 1JTFA 3ANXA 9ICLA 1VECA 4JLVA 2COUA 2DWPA 3EX7C 4CV1A 5FNVA 2EYUA 4NE9A 1XXLA 5CBKA 1FQKA 1PWXA 5EPUA 3DDOA 5IVHA 3JZIA 2JC3A 4RVOA 5JQGF 1DXYA 2D13A 2BKXA 4JI2B 1WNFA 1NW6A 3KEMA 4AU1A 4HV4A 3GHYA 1QDUA 2E3TA 1TA4A 4YP6A 3DTVB 1SCIA 2PH1A 3W78A 1PUZA 1YH3A 4MYDA 5KQRA 4W8OA 1LRJA 2ZSBA 4YJ2B 1J22A 2TMDA 1IXYA 4RHEA 3AVQA 4A8JC 4YJ2F 3A1EA 5E2IA 5D5QA 1EAMA 4UKDA 1FTSA 2FSGA 4JGBA 4DC0A 5ECWA 4EJFA 3STXA 2IUUA 3NRCA 3EAFA 4XR4A 2CE2X 2GBFA 5EE0A 1V37A 2X7JA 3G23A 4GR5A 1RJGA 2NZXA 3NI2A 3T5JA 1Q7BA 4FBGA 2VAXA 1ZQ1C 1R9MA 3KQMA 4IRXA 1VG1A 1QH1A 4JJ6A 2OHHA 5TF0A 4UU7A 4M37A 4YP3A 5KC8A 4DRXB 5TVGA 7GPBA 4BMXA 2ZUTA 4L9RA 3A0BU 2XB6A 3LT5A 1YR9A 1UWLA 3TS1A 2XIJA 4LCJA 2O2IA 2Q0HA 1DJLA 3FLAA 3ITKA 4MV0A 4DL3A 3DEIA 5J63A 1V41E 2QVGA 4LC9A 1R9JA 5T57A 3BXEA 4KU4A 2W6MA 3E5MA 2J3QA 3ENQA 2ZSIA 3JQAA 1NQ5A 1N0IA 5CCDA 3U7IA 1IZZA 1P19A 2F64A 4RPZA 2JHDA 1DZ3A 1LV8A 1IBLB 2Y0PA 3N2KB 1EINA 3RJ5A 3WRXA 3T4UA 1TT5A 5KFGA 3BQ2A 4AIIA 3UEOA 1K0FA 4OH7A 3TL3A 4KLCA 1K6JA 1YQWA 1V7CA 1WEKA 3UKJA 3AVWA 5E6SA 4JOCA 4N12A 3WLEA 1XNJA 3PU6A 4OSEA 1JFSA 1IY0A 2IZ0A 2Z5FA 2GZMA 4KV7A 4J9MA 1JQAA 1PQPA 1S0UA 5BSGA 5GPBA 5HKBA 1Q1EA 5FA5A 2B9VA 1V8OA 1T9GR 4BNNA 4QHTA 2Y1XA 3OPYA 3I5XA 5CFRA 4CUJA 2BUBA 4L0MA 1G8KA 2HQBA 4RK4A 4ZT3A 1ECLA 1S3GA 2XOKA 3ZWQA 1FP6A 1XLWA 2W2TA 3BMCB 4U7PB 3WBBA 1SU8A 1YWGO 5AXAA 5GM2A 4G0QA 4ZTZB 1CEYA 2CFRA 4NBKA 3R0ZA 4PAMA 1Y3AA 1F1BA 3QF4B 2YHBA 2Z43A 2B4KA 3F9IA 2Y4NA 2IDJA 2VSFA 3B7PA 3FOZA 3G1TA 1J8VA 3D8BA 4FDLA 4R2KA 5CEJA 3O0TA 5AKKA 2YIJA 1NN3A 5EJMA 3QUBA 2BEVA 1N9ZA 2DTXA 4G5OA 1W75A 4ZQHA 3DFZA 1TLFA 3HBNA 1N0VC 1JKXA 2IPXA 3RVSA 5WRFA 1RABA 3AVVA 3NTOA 1NK9A 1ZAYA 4F9GA 3Q8KA 3A4NA 5DYIA 2MYTA 1FNMA 4TKMA 3LD9A 1M6HA 5FPSA 4U2GA 3FGOA 4IS3A 2I4MA 3HLYA 4D9BA 1KZHA 1H5QA 2QT9A 5DHAA 4D4GA 1HT0A 1H8ED 2ZTMA 2YFHA 1KNQA 5AOAA 3OJXA 3EQ6A 5AOVA 4MVJM 4PCVA 1KFDA 3LDAA 4BGDA 4IMJB 3SQIA 4AM8A 1P72A 4ZWNA 4C3ZA 1ORHA 4EUSA 4WKGA 2A33A 1FDUA 4P1ZA 1Z8DA 4BLUA 2FUG1 3GUZA 5CDUA 3FYUA 4BX9A 5JMWA 2QT0A 2HJ9A 4Q19A 2VSQA 4XXHA 1V9SA 4CKBB 3HB9A 1EFTA 2BONA 4KZPA 1NU8A 3L8FA 5KTPA 3U17A 5TEVA 1GRNA 5G40A 1DTWB 2ORWA 2H2WA 4QGAA 4NBUA 3Q41A 3HG7A 3CH4B 3FSGA 3W06A 2O8DB 4BWYA 2Z2KA 4X5VA 1P4AA 1YFJA 3DP7A 2PDAA 3ZE2B 4TWRA 3OA0A 3ZJ5A 3TEFA 2I03A 1TV9A 1DG3A 3JQ8A 5JC8A 4TKVA 1RZVA 2RGBA 4RZHA 5LZ9A 2VFAA 3FZQA 2WHPB 1Q19A 3HY6A 4AIRA 2WR8A 1WVIA 4LNHA 2YH2A 3CZMA 4WESB 4H1VA 4WQMA 1IK4A 8ABPA 5I48A 1ZONA 3FFTA 4UAYA 3K6SA 3Q12A 4KVZA 1PVPA 2B6HA 3SE0A 2ODGA 3FBWA 3JU3A 4YN4A 1Q57A 4QYIB 3DOUA 4LI0A 2HCTA 1VLZA 4MV3A 1FP4B 4M0PA 4BY9E 1JXAA 4CRWB 3I9NA 2A9VA 4X20A 4AECA 5A6SA 3KB6A 2D3TA 4YJKA 5ERXA 1OKKA 2OCGA 2BEWA 5LB4A 4NLGA 3MOGA 3RRZA 4AMBA 3BIJA 3IMFA 4EUFA 3T9DA 2DFLA 4PTZA 4CMCA 3HDGA 3CEAA 2HBRA 1A96A 2I66A 3RT1A 3WMWA 4G5GA 4YA6A 2JH8A 2FUG6 2VDJA 3BXGA 3OZAA 4P0QA 1UFQA 3P26A 4AJHA 1W76A 1GGVA 3GJ5A 1PDVA 2NNLD 2VTEA 3EY4A 4RTOA 4K0RA 1P3JA 4E1BA 4N76A 1L8LA 5HF5A 2IOYA 2VBGA 4IQVA 2QMYA 4PXAA 4X1KA 2FG7C 4CIDA 2ZPTX 4JYMA 1TZCA 3MUFA 2KP7A 1G8SA 5G4KA 1IDN1 4N3GA 3S40A 1K2VN 3L7YA 4F91B 4KFCA 3GQBA 7ICEA 1EVJA 4BO1A 3OI7A 3E9EA 2GD1O 3ZE6A 4NG4A 4X6UA 1O94A 3RSSA 1S2GA 2R4TA 3QZUA 1VP9A 3SXJA 3BMNB 3OUZA 4DYVA 4R4JA 5EQTA 3EGVA 2EW2A 3VNUA 3T5MA 4JD5A 4HFMA 4ZC1A 4XYGA 2WEKA 3R74A 2AOTB 5BW6B 1GT91 3ZU2A 3U56A 2HPVA 4URYR 4ZOHC 1OI4A 1TUGA 4M0CA 4V0MA 2ZI6A 3RJHA 3VR3A 1ISSA 1O6GA 4XFKA 2PEZA 1E6MA 3FUWA 4CEIB 3B7GA 3BWYA 1DBWA 3HZOA 3MCTA 4NZYA 4YECA 4PNPA 2VSOA 1CKEA 4OLJA 5JS6A 1NBMA 1BCSA 3L1JA 1KPHA 4F4ZA 3ROZA 3PT5A 2YXPX 2JZBB 1FDRA 4F4HA 4C7OB 3FGPA 2ZXFA 5IDYA 4AKTA 3NDRA 1YZ6A 2X5OA 5D3MB 4R05A 3ZCSA 3W6UA 1YJ8A 3VM6A 1JLLB 4HAUA 3IE1A 6NULA 3H4DA 1WP4A 3GN1A 4BNDB 4I6JA 1ZC4A 5ADHA 4N4AA 4TV9B 2A1JB 3VPHA 4A0RA 4DYDA 2BJVA 4UCFA 4X6LA 4TV9F 2JV3A 2FWNA 4GQAA 2UV8A 4CM8A 4PRLA 2HHTA 3RF7A 1L5QA 4BMPB 2J30A 3GLFE 1WCIB 4MVJF 3SZMA 4RTQA 1Z38A 1B1AA 3SLGA 3HZZA 4E46A 4ARCA 4QBKA 3H42B 5F1YA 2ZJ7A 3CZQA 3PMLA 1TC1A 1Y1TA 5LDHA 2RCNA 1UFRA 2VHJA 3ET5A 1OU4A 1RQ2A 4HH3C 4RTPA 1IULA 4DR4B 2B0CA 1BHQ1 4D8VA 4F85A 2R8OA 4RVNA 3L6OO 5BN3A 2QB1A 5KG5A 4L7QA 2YWBA 2GCOB 4WACA 1Z6GA 1P4HA 4NYJR 4IFIA 1QFSA 5K3SA 4QOIA 1LPMA 4R41A 1SG9A 5EQJB 2YXBA 3DO5A 2BSXA 2Q5JA 4GBGA 1QCDA 3G0BA 4F5PA 1E7SA 1EMDA 1H5NA 1JWBB 4O4HB 3RB8A 4Y6OA 5I4KA 2REQA 1OGIA 3IR7A 2JAPA 1W49A 2BCGY 4O4HF 4G3IA 3EOAI 2BKAA 1GQQA 2VJNA 5KAFU 1YOBA 3IFSA 3BL6A 5CNKA 1G7TA 5A4MS 1V5EA 4L8GA 1N2GA 4NCNA 1SGGA 1XTJA 2WVJA 1FMJA 1ZISA 4WERA 3TRHA 1QLJA 4IICA 4B6SA 5CBPB 1DIBA 3NLLA 3U1BA 3CCBA 3HJBA 4R69A 4LEIA 2D1FA 1ZM3A 3R3UA 3PV0A 4KLAA 3V6JA 1Z6QA 1LNZA 3A4TA 3TFOA 1L4YA 4UM9B 2ZRLA 3BUSA 3LGSA 4FZJA 1V97A 4QDXA 1KKUA 5CVEA 3A3KA 4X1IA 1WMEA 1HSZA 2OCBA 3L4SO 2PJUA 3CINA 3ZZTA 2VUIB 1BDJA 1E8DA 3C98A 4RVDA 1HEKA 1U47A 3PIIA 3Q5EA 3RSQA 3YASA 4X9XA 1C8LA 2C4MA 3BKXA 4QL3A 1ECWA 3L8MA 4PYOA 4KAFA 4UPDA 2WIJA 4PHDA 1HQKA 5CLFA 3K2IA 4GI3A 1QF7A 2BEKA 4C8OA 3I45A 4QG3A 1E1CB 3RHTA 3OZUA 4AKGA 2O7RA 2YTUA 4MWSA 2NRVA 3RREA 1JJFA 1GSAA 5BW5A 1Y3HA 2WYOA 1OH8A 3ZQJA 4X24A 5DB8A 1DQYA 3SZUA 5ALMA 3LGXA 4L0CA 1L9KA 5FWNA 1P60A 1ZETA 2LXNA 2XF8A 2VHZA 5SY9A 3ZGNA 1L1RA 1AGRA 4KPUA 3DBOB 1OR8A 2V0GA 2JIPA 4BFWA 3IG8A 3DVSX 1S76D 3EVCA 2VDRB 5AK0A 4BXOA 4JB2A 3TLKA 2W6ZA 2EZXA 1QGAA 5KCZA 3LGAA 1PAUA 2ZSUA 4JC5A 1O0SA 4D4KA 4J8PA 4MKIA 3B1FA 4A8JB 1AA6A 1PJAA 2ES4A 2IEYA 3HSSA 4JX8A 5LSAA 4W9RA 4UUQA 3PEVA 2G67A 2O6HA 2OO5A 1ZLXA 1RM3A 1JVBA 4JU8A 5JJCA 5KX5A 3VU9B 3ZUGA 1E89A 3LC2O 4N8SA 2Z6VA 4BMNA 5B57C 4E21A 3S7ZA 3PNOA 4UARA 3OMLA 3Q3GE 4WCFC 5LP6B 1A2OA 5FBRB 4ECUA 2KM1A 3OTGA 4BV2A 5LP6F 2FRDC 1N5MA 1W5FA 1VRWA 3M0EA 3O26A 5DHTA 4RD1A 3W04A 4N03A 1E2QA 1TO6A 1Q84A 4FFWA 5BVGB 1U2SA 4F5EA 3JVIA 1IYZA 1S4MA 4QIWC 4YD2A 1KIAA 4K81B 1KA9H 4BX0A 2P4UA 4HR7A 3MR3A 4LHZA 2PZJA 3WIVA 1ZN7A 5CFPA 3MGVA 3CPSA 2B35A 1NYQA 3F73A 1D2EA 1ZNQO 5LYJA 2GRJA 2XUIA 1CUSA 3B36A 2ZBGA 1X9IA 5FTLA 1TB4A 1SIUA 5IFLA 1W0JD 3I73A 1JQDA 4PAWA 2VQ3A 4GI2A 4EG7A 3RB6A 5D46A 3BZUA 3F5SA 3BICA 4QJ5A 5REQB 3ZE8A 2PV0A 9ICUA 2PLWA 2P9GA 3K0AA 1RR6A 1XEFA 3FTPA 1I3OA 4BP9A 2X4IA 5JATA 3CFYA 4MP3A 1MJGA 2Z1DA 5FNZA 2FMTA 1LC0A 5THKA 4CUZA 2N46A 1CNEA 1TLLA 2P9BA 1GAWA 5AIBA 1ZCZA 4Z7JA 4IIJB 3TFRA 5J0PA 1ULZA 1NXPA 3RUDA 1NR1A 4IIJF 5TEWA 3AF3A 4EKNB 3PUKA 1Q91A 3ZIAA 4CM6A 2JRZA 3CJRA 3WMGA 2NO5A 3OTIA 5I8ZA 4QFDA 3SHVA 3IAHA 2D4HA 2QKQA 1PLKA 3DE7X 1T94A 3PR4A 2OTCA 3PG5A 3ASVA 1D03A 3GQVA 3K15A 3FBGA 3BQ0A 2PKWA 4WEOA 4BRUA 1E2UA 5G3YA 1XDZA 2CFSA 3OEHA 4B3XA 4X61A 4TXNA 4GPIB 1XTQA 1XA4A 1L9XA 1JFVA 2UZ0A 2BZSA 3FPHA 2G6BA 7ABPA 1HJPA 1P6QA 4P7JA 2H5LA 3L6EA 1VE7A 1OWMA 1CJKC 3EGXB 1X6JA 3EFHA 4Z6KA 3HV2A 3DBIA 2QTCA 2FPRA 2E5SA 5AP9A 4LDPA 3IHTA 3T4PA 5KQSA 4LW8A 5ALRA 2Q1TA 4DQUA 3GV8B 5FI1B 1PT9A 4ENTA 4XQCA 2ZXIA 2IS2A 2GHQA 2AC7A 3REGA 5I8WA 3H5NA 4EO4A 1Z2EA 3GLGA 3O3NB 2QTBA 3K5IA 2ZU6A 1PBTA 3ETJA 1COWA 4HVAA 1N2CE 3Q8MA 4ZXPA 8ICLA 1NZDA 5KTNA 1RQRA 2A58A 3KTQA 1FU7A 1QP8A 2ECKA 1XZHA 4FMPA 3L46A 3M7IA 3DMHA 2RGNA 4NNOA 1XNQB 5EL0A 2PXIA 1XCJA 4NLZA 1BE6A 3T5PA 3D3EA 2HA3A 2YFYA 3IQGX 3ZH9B 4CQLB 1BRMA 4XVCA 3KXIA 4M9HA 4YI5A 1R6TA 3ZE9A 1TO2E 3JPRA 3OQJA 2X41A 4IMRA 3KZKA 1E9FA 2FJPA 4BFSA 1GCIA 2UVQA 1JHMA 1D8LA 3HE3A 3D2NA 2XICA 4DF4A 2ALZA 3C0KA 3QZ7A 3IQWA 3PFIA 2ZE7A 3SR4A 2FLNA 3EG9A 3F1LA 5EJEA 1LVUA 1XWFA 4TT3D 4O2AA 5JARA 1IUOA 1A4IA 2XNHA 1W4ZA 3LPMA 1TYDE 1MB9A 4C4YA 2PUWA 2IYEA 3WQQA 2Y1JA 3HU2A 4K05A 2O14A 3WHLA 3JVDA 2QYOA 4MHTA 3OPYI 1BNCA 2VA2A 4YGXB 2YMMA 4R5HA 4DIKA 1ZI6A 2H1WA 3WYGA 4BQOA 4J9LA 1OLXA 2Q5QA 5H3LA 3BMQB 1E4YA 4MYSA 4D9HA 4RX1A 1E59A 4FGWA 1BZYA 2GFHA 3CSUA 3V7NA 3RC3A 4FLEA 4N0PA 2PMKA 1JDJA 3V97A 1VCMA 3KZOA 1J20A 2YASA 5M29A 3LM8A 3B8EA 4P80A 5HKKA 4IYJA 3PSPA 3M6AA 3DL7A 4HGZA 3WYNA 5KFRA 1EX1A 1FS5A 2PKCA 3IA2A 4Q9AA 3T7TA 3MMPA 3K5PA 1Q1AA 2J9FB 4JL8A 3VPFA 4LXTA 3KL4A 1DAEA 2KJ8A 2O0KA 4ZI5A 1X9HA 1KERA 2RHLA 1KBUA 3VNSA 4TLAA 2WTEA 1WBBA 4NBRA 3VUEA 2KNJA 3ZHYA 5L8VA 1FXUA 2FN7A 4BHTA 2C07A 4C0WA 2HTFA 1IOVA 1IUKA 2F7SA 1O54A 1JQJC 3E3AA 3GLHE 3TZCA 4R2LA 3SKXA 1CZLA 4RJ2A 1YQTA 2DH5A 4NCAA 4RLHA 4Y6PA 5EXDA 4GVLA 3QI7A 2G9QA 3BHNA 3CLUD 3PRYA 1N60A 1QYIA 1Z18A 3FIJA 3SCZA 5ED0A 1M83A 2R6CA 4AKSA 2DBYA 5D01A 1KH1A 1SQ6A 3QRWA 4MNTA 5DWVA 3KR0A 2XH8A 4C6TB 2X1VA 4FNOA 1N77A 2LR0A 4WJKB 2D1TA 4M49A 1TTHA 2KPOA 1NKVA 1UDAA 5F9FA 2HIGA 1A0OA 1DINA 4D79A 1WYGA 4IIYA 1FSZA 1IL0A 2KK0A 1LDBA 4YAUA 3UWSA 3HJRA 3EXEB 2V6IA 1XVLA 4C0AC 3PFWO 4NYMQ 1SPBS 2BCSA 3EC2A 5JTTA 3G5LA 4XFJA 4NLCA 5HJEA 4DDHA 1S3FA 1AMOA 3EUB2 4F4JA 2WINI 4FDUA 3DPUA 4DB4A 1ZGGA 3KC2A 1ZH2A 2EF1A 5DB4A 2UVWA 2EF0A 3A7DA 1IM2A 1OAOA 2DF8A 3GJSA 3A1SA 3IBFA 2JFZA 4OI0A 1NKSA 2QLMA 1KQ3A 3RQSA 1DADA 1GN8A 1CZKA 5C18A 4YH1A 2GILA 1Y1PA 4TKUA 3GV5B 621PA 3REFA 4N3BA 2W98A 1TDJA 1VRVA 4FYPA 1WDMA 2J45A 2D6FC 4M04A 3ACDA 5AHXA 3JATB 4R54A 9ATCA 4N3NA 1E8NA 4C4XA 3KL2A 3A1DA 4ND8A 2ZVDA 1Q11A 2QRVA 1J70A 4HNTA 3TACB 4RD0A 3G5AA 1W73A 3ENVA 4IF4A 2AOXA 3IVGA 4G0PA 2QRKA 2CXOA 3LHIA 1N2JA 1OFUA 3TBFA 5JISA 1G41A 1BN7A 1T2CA 4KB5A 3RJEA 5L40A 1WUHS 2GZDA 3HVKA 2ZB4A 2P6MA 3TAXA 2JG3A 3WK8A 1MB0A 4BO7A 4W7IA 3TUZC 1E2IA 1TUBA 2Z04A 1H1LB 1X2BA 4F4XA 3USCS 2LWIA 1EXNA 2GM5A 4B44A 1JS1X 2ENWA 3DFMA 3AB8A 2P90A 4JV2A 1W29A 1JIJA 3KEQA 1ZESA 2ZT7A 2WM3A 4DSAA 4H7PA 1F3LA 2HU5A 5AXDA 3SMQA 2VNSA 3BRSA 3DA8A 1P9WA 2HRBA 4MLPA 2C1ZA 2YHIB 3RS9A 4IVPA 2GTHA 1CFZA 4RVGA 1ITZA 4OMUA 4JLJA 2AB0A 1RPTA 5CH8A 3KVVA 2J9GA 1XN1A 1EQUA 2NUPB 4QFMA 1EVYA 3W4KA 4H4EA 2XQGA 2VNHA 1OBVA 3X2SA 3UATA 3UTDA 1QTMA 1TQ2A 3OCWA 1F8GA 1PQWA 3O6VA 1EFVA 2HA6A 1NYLA 1TAHA 1F20A 3GFQA 4KGZA 4UNIA 3EQ9A 4MV6A 2DKOA 3ZVKA 1KSGA 4L8WB 1QNLA 3BM5A 1B41A 2RGWA 4P38A 1FX0A 2XI9A 3QLEA 5TGZA 1A69A 5I5GA 1NQOA 4ZVOA 1NR5A 1WZ2A 2O8FA 4UTVA 1FFXA 3BXPA 3AKZA 4XDZA 3RB0A 5BPHA 2F1JA 3K75D 2XKBA 4U6SA 4R16A 2EDAA 1QSSA 4TMXA 3KT6A 2GGSA 1P91A 3N0RA 7ICGA 1KKXA 3EZLA 5DLGA 5T14A 1SUPA 3CNHA 1QC5B 1SQGA 3GFVA 1XZEA 4QUIA 1QQBA 1XN4A 4UNPA 4I3HA 2RK4A 5AW3A 1FDSA 2OLEA 4FFRA 3W2HA 1AKQA 2POCA 1NIJA 1I3NA 4BMYA 4WZBA 1RMYA 3QXXA 3WQHA 4MWDA 2B37A 3JD4A 4LE1A 5FXMA 3LECA 2UUBB 4HLUC 1TQ8A 2HMUA 1TJYA 1AKRA 2ZZKA 2EKDA 4BN5A 1Y8QB 1USVA 4K7JA 3EWNA 2DF4B 4JSRA 2C95A 1P45A 1BHJA 3DAOA 3O4IA 2Y93A 1O7JA 4BLSA 4RY0A 4E6PA 1PR1A 4BB6A 2VDOB 1X86B 1A6SA 1QRRA 2W8KA 3OJUA 3VKVA 4EFDA 1G20B 1SB9A 3NZEA 1RVV1 5BN5A 3BZKA 2ASDA 4OHUA 2PD3A 3P52A 3V5NA 1I8TA 4F6RB 4DUPA 1X1BA 4TS1A 2F48A 4R8UB 1KOLA 5CT4A 2O5CA 5D3KA 1ZA1A 2CLOB 5HTKA 2ZR0A 1KMMA 2XHZA 2JAOA 2B6GA 2HA2A 2H4ZA 2N42A 4F2HA 2HA0A 2R48A 1JXMA 3HHEA 1JPUA 4DIOA 4EYSA 4RJIA 3RARA 4KXFB 3K6KA 5I7UA 1OXJA 1T91A 3FOBA 4QJ4A 1AUOA 3N8GA 4B35A 4ETWA 1JIHA 2VJOA 3D2QA 5EA2A 4UBIA 1L5VA 4IG4A 4F7DA 3SC2B 1UKBA 1Z6ZA 4KRXA 3K3PA 1H05A 3CX6A 1VIYA 3BS5B 2DY1A 4DQRA 4YT8A 2GEBA 3C15C 3UNXA 3DZ8A 1Z29A 1OUMA 3QKUA 1I4EB 1KOGA 2VUTA 4E2WA 5FJJA 3V1YA 1A2QA 2VYQA 4QSHA 4DLPA 3REQA 3SMVA 5HFAA 4LF4B 5BVHB 2WAYA 5H02A 2WUGA 8ICZA 4EB6B 4E4YA 4LV6A 4JELA 3A2KA 3CNOA 2PS1A 1C50A 4JI0B 3PD0A 5IVPA 4RXMA 3E9QA 2J85A 1G291 1DAMA 4GKBA 3AM9A 3CGWA 1XRMA 3V46A 4CT5A 2CZCA 4WOPA 5CURA 2VN8A 1EM8B 1YNSA 2AJQA 3HKBA 4GXJA 4DS3A 3BXOA 4EJ0A 1NMYA 5FTWA 5HDBB 3RTGA 1V48A 5C2JB 2BHTA 2FMUA 3ROKA 4B09A 4DNPA 2HPAA 2NXNA 5I5EA 4EG6A 3SP1A 4AF8A 3OLZA 5CUQA 3TXAA 4KGVA 2UYYA 1B8PA 1APBA 4Q1BA 4BNXA 3PQ2A 3X1XA 2QQFA 4JODA 4DDTA 4A23A 1QPGA 1W34A 4HATA 1KXZA 5DBEX 4Z6EA 2XXBA 4X44A 4UFPA 4MZXA 1UJ4A 2DHRA 4CKCB 3IIMA 3I61A 4MMZB 5DSTA 1PIWA 1NDUA 3ISBA 5JS7A 3PUXA 1NXWA 1Q7TA 3P0HA 5EJGA 3SX2A 2X0FA 3OO0A 3C1YA 2PH7A 3QJGA 4ZU1X 3MWEB 4M1SA 1PVQA 4LYEA 2VL7A 3H84A 2MSLA 2DWCA 1T4CA 1DQPA 8ICFA 1PWEA 1AC5A 3C5WP 1N5OX 4XTCS 2WYUA 5KG3A 3M6UA 3NHYA 2CVFA 4Q1FA 4M8IA 2JI4A 1SUIA 5J0XA 2HXYA 4QXMA 4K9MA 3H04A 3B2EA 1DKLA 3TTVA 1N9GA 2F3TA 4Q3NA 2ZXUA 2GA8A 3L0BA 1FBNA 4ZVPA 2PRYA 3OF3A 1DQRA 1GGKA 3H2KA 4L15A 2BISA 3UHOA 1DPFA 3ICCA 3G79A 1PD0A 3FB1A 2BI7A 2PT6A 3SZ2A 4Q7LA 3HV0A 2BR5A 1H6DA 4LF8B 4LF9B 5FO1A 4UJ3A 2C04A 4DSZA 1T9GS 2HBQA 2P66A 3I8OA 2PGAA 4EUNA 2OBMA 4FEYA 5JNTA 1SXHA 5CLHA 1F12A 3JD3A 4EKYA 4S1NA 1X2EA 3GLVA 4UE6A 1V9CA 2PQ2A 1DC4A 4QRIA 1BMFD 4N39A 4ARIA 1KJJA 1E18A 3W77A 4RD3A 5C8YA 3KUDA 3Q7IA 1D5CA 1E69A 1NZBA 1V6SA 1VE1A 2Y0SC 2EWVA 2JS7A 4UUAA 2BSQA 1WM1A 3RUCA 2W11A 8ICOA 1UP7A 1X74A 1XYYA 1R0LA 3E0FA 5GY7A 4XUSA 2B34A 4MKGA 1B0ZA 4U8GA 2JH3A 4YJFB 4TYQA 1USKA 4AMVA 1SXJD 2TMYA 3UOWA 2FWIA 1KH2A 4MK4A 5E7QA 3GT0A 1YCHA 4ZREA 3AVOA 1S5PA 5JNLA 2ZVPX 4C0KA 1GUBA 1KEPA 1YVDA 1FU8A 3V4PB 4QLAA 4R1SA 4OOFA 4LMAA 1TYCA 3GUVA 4CN8A 2B8TA 3TDNA 2PCLA 3H2IA 3GJ0A 3WDSA 2I76A 1K66A 4G5FA 3SJ7A 4OYLA 3M1AA 4FDTA 1RBZA 3DBRA 4B6EA 4GYJA 3VOSA 3PQ6A 1E3MA 1T5HX 3GRRA 4UD2A 3VFDA 4J03A 2QJRA 4CKXA 2OV2A 2MSWA 2WNHA 5CNIA 3GDFA 3M9OB 3W4JA 2EFGA 3LZ6A 3I1YA 2Q6KA 3PJRA 4GZLA 1P1IA 1UCVA 1QRAA 2J3KA 4Z4CA 1JXQA 3VAYA 1ODIA 1B1CA 4KPFC 1M6WA 5IIKA 4ZEWA 2QR5A 3W3ZB 4JENA 2YUIA 1XC9A 3WBKA 2ZJ3A 1NI4B 3BD8A 4TLDA 3BJMA 1UOEA 4X45A 2B8NA 2VK8A 2HEGA 1ZQPA 4BPBA 4Y2XA 3HN2A 5G5GA 1SVIA 1XXHE 4WEQA 4P58A 2IH5A 2WKPA 3LW8A 1DK3A 5ERYA 4KAAA 1M1NA 5DFAA 5LIRA 2WJGA 2LDXA 5BWCA 1KAMA 1T8EA 5DO9A 2ECOA 1X7YA 5EUMA 4LYJA 2GAAA 2RJ3A 1TAQA 3OCXA 3RYIB 3OC0A 3K9FC 3KOUA 3U3MA 3LC1O 2EFDB 1KQPA 2OFFA 3OQIB 4J9SA 3C3XA 1N8TA 1RFGE 4JYPA 4MUGA 4F8YA 1EZ4A 3O91A 4FX2A 3DLHA 4BZXA 1GPYA 2YMQA 2D62A 3AOEC 4BLWA 3P4UA 3MGHA 2V4RA 1JZQA 3FKSA 1P9LA 4DW8A 4BKOA 4AJ1A 2EV9A 2XEDA 4F4CA 1ODCA 5EP1A 5JQGB 3ZTWA 1ZUNB 4CNQA 3UJNA 3KJIA 4TPKA 2YBDA 4BVGA 2CL5A 3DQPA 1SCAA 2DJ5A 4MMXB 3HZHA 2A9RA 4I29A 5PNTA 1QWOA 3N7SC 3NBZC 3MJEA 3WGGA 3I30X 2JVIA 4IOKA 4JYZA 1C30A 1SCQA 2FOIA 4F2RA 2NRWA 2ODAA 3M6VA 2OCXA 2FOXA 2GZ2A 1GAXA 3R0VA 4YRFA 2R66A 3VAAA 2Y3IA 1K08A 2OBYA 3S1LA 4AYTA 3H1TA 2JIZD 2R6JA 3HLTA 3HYLA 1P4GA 3P5BA 2AZMA 1LVGA 3RFAA 2A19A 2GMWA 3TPZA 4FYWA 4P8RA 3PFFA 3H0RB 3AY7A 5AXCA 1FOEB 5HGJA 1XU9A 1XRQA 3EPJA 4ICAA 4RBNA 3VKGA 3IERA 3N7UA 3BA6A 4GS5A 1OW3B 1T34A 1DC8A 3AEKA 3SZ3A 3WB1A 5I6DA 4L5AA 2GZAA 4YROA 2FPPA 3IKTA 2ZZNA 5BV0A 3WJ7A 3TBKA 3EQ8A 4NS1A 5JNVA 2Z58A 1GKKA 4JU9A 1MEJA 4RTMA 4M53A 1XLTC 2DG2A 2PXCA 5ARCA 4X6XA 3RI3A 3V4LA 1QONA 1L6NA 1II9A 3NUQA 3IOEA 4GPZA 1CTQA 2O57A 2R8IA 3P9PA 2GUGA 4ZOQI 4I9NA 4F92B 3DZGA 4FN5A 1UF9A 4Q66C 2EZ4A 4RCYA 2HYDA 3AY0A 3QPVA 3WXMA 2CHGA 1ZO8A 4KREA 4DA4A 2QTVB 1U3CA 3ZI7A 4DZTA 3ZK7A 2XMZA 2DPGA 2WF7A 2QD5A 1V7QA 2PUVA 2H0QA 4JYCA 5C3UA 1ZN9A 4EGFA 2D0PB 3LV8A 1SHJA 5EJ6A 2VF4X 4PSVA 1M66A 3NEPX 4BZZA 2XBUA 1QS0A 4B3MB 2HKIA 4EJ6A 4BL5A 4FP9A 1A8HA 1VXRA 4PYJA 4UHHA 4KN9S 5B12A 5DHUA 1BD3A 4LRQA 2DPHA 4RHFA 1E9BA 5AYVA 3SJAA 3P94A 1DAFA 3VMMA 5FBHA 5BR8B 2WD7A 1ZJMA 3GZNB 3OJ0A 1TM2A 1HT1E 2ZYGA 1KYYA 4P3XA 4YUZA 4ZFNA 1JMVA 1J1UA 2Z2ZA 3RS0A 5HFNA 5J47A 5CDFE 5C1OA 3II6X 2JRCA 3TXYA 4A6XA 1JBQA 1BGXT 5CA7A 4ECWA 1SKBA 1SUAA 3RM3A 5JSHA 1A76A 4GQBA 4FOTA 1WO8A 4URVR 1GFIA 3K1JA 1P0PA 3FPBA 2VYCA 4ARZA 1UBKS 3FYDA 2VJCA 5C1PA 3N53A 4PWYA 1U7OA 4XEHA 3ZDDA 4ZVQA 1Z5ZA 1Y81A 7ICSA 2UXDB 4K40A 2CUTA 3F2DA 2NVWA 3IP7A 2JLZA 4PO9A 3DE6X 3PVZA 4QDJA 1OC2A 1MEOA 3AHCA 4YV1A 5CVVA 4DV3B 4TLBA 1Z73A 3JQRA 2ZJAA 4YT5A 4MS1A 3IP9A 4G0OA 2NIPA 2Y1CA 2RHMA 5KYUB 1S9DA 4UU1A 5D6OA 3W1WA 1KJWA 5FYQA 5T67A 4ND7A 1F8YA 2ZKIA 3TOVA 4KNYA 1W85B 4FQ5A 2SHKA 5BR4A 3R9XB 1ZQBA 4WGGA 4XQGA 2BTQB 4B5LA 1E62A 2ZETA 3RH4A 3DWEX 2GKSA 4Q9KA 2AJ8A 4DL5A 3L1VA 2FZ5A 4ZZ3A 2R8YA 1NNSA 5U9CA 2WG1A 5KOYA 4JI6B 4F6LA 4LRSB 2CXNA 1B76A 4KYIB 4GX5A 4AUEA 3B3FA 3GV0A 4CM9A 4PZLA 4DV0B 4G1FA 2F2TA 2WSMA 2O2DA 3K71B 3QXHA 1E61A 2DSNA 3QNMA 2XIQA 1ORIA 1WULS 1PZHA 3ZZ1A 3ODGA 2RC5A 2O7VA 1UKZA 4POOA 4S0ZA 1QIFA 3FA2A 1EXDA 2NZWA 3KJQA 1CE8B 4IIEA 2P9JA 4WCDA 1QFZA 3T7DA 1UJBA 2PMCA 3CTMA 1ISJA 1TU4A 1CF2O 3U5ZB 3TIXB 2MJLA 2ZRKA 1TUIA 2LCIA 4RQ1A 2A7XA 1CQPA 5K2OA 5HCUA 4C0ZA 3MCWA 3ZNNA 4Q24A 2W7PA 1IB0A 2RGUA 3PUHA 4MO9A 3VHLB 2WHEA 4RIGA 5DE3A 1E2FA 1ZQZA 1MG0A 4MW1A 1R27A 4ZP1A 4YAIA 1N6PA 2GFIA 5H4GA 2JIMA 2P30A 4PYMA 1D4OA 2FV8A 4NRDA 3AG5A 2WG0A 3X3HA 1I94B 1E79A 2JNWA 3QVGB 4XIGS 4AAYA 4OUDB 3AESB 4NEGA 1LF0A 1XEWX 3TSWA 1UQUA 2R7AA 1JHYA 3RBVA 1RHQA 2BFCA 3GLIB 4HX5A 3PQ3A 2GLUA 3VPSA 3W34A 4V0NA 4GL2A 3MTBA 1E6UA 3TX2A 3FYCA 3H2BA 3NBMA 5GONA 3HA2A 2LVBA 2BFNA 2HLPA 2YVUA 1XDWA 4FOSA 1CY4A 5DLPA 2QG4A 2YYYA 5KAPA 1EDDA 4UZSA 2BI4A 3G1WA 4E3ZA 4ZZIA 5CU7A 3H4TA 3E5RA 4RFSB 4XDGA 5BUSA 2YZ7A 5EHZA 1HLPA 1F5SA 2KKVA 3N9IA 4AMYA 4CNBA 3VGJA 3T12A 2Z2JA 3LVRE 2I5PO 2I1LA 1E3SA 2OBXA 1GSIA 3O73A 1H3EA 1VJDA 1GV0A 4G97A 2ZBEA 3C97A 3SIXA 4BNJA 2JLXA 1RYUA 1JAYA 2V65A 2RGXA 4IKPA 5KFUA 1ABBA 3N2GB 1IM4A 6CHYA 4R01A 1NOIA 1XTPA 2PIAA 3ZBTA 4E88A 1M2NA 4JVLA 3A25A 2I87A 1BW9B 4G5QA 2ZUFA 4LN1A 1D4ZA 3DGFC 1U8XX 3GVHA 4OP2A 4WBNB 1JDUA 1ZDMA 4ED6A 1TC2A 4YJHA 3LLSA 1NLZA 1OMOA 4WBNF 4CIYA 2OH2A 5TZVA 4C6HA 1TYZA 4FCVA 3VI4B 2NO4A 2HCBA 4LXYA 2VDQB 4YMUA 2W3SA 3QF7A 5EOVA 3BMOB 1G8FA 2PE5A 1VHQA 5EKSA 2DR3A 5A2GA 5A02A 2NU6A 2EG5A 1FXWA 3O92A 4I9FA 3RF6A 1DGJA 1L6IA 1MJFA 1LFDB 1EFDN 3N8NA 2O8CA 5IMBA 3QKWA 4RIHA 1XZQA 4B81A 2QRZA 5K6AA 2Y0SF 2E3JA 3RSGA 1SGWA 3ADOA 4ZHQA 4GRAA 2EGGA 5L3SB 1AK9A 5DDMA 2CXRA 1QGED 3KT0A 2ZCVA 3R9KA 4BIIA 1YR7A 3WV4A 1P9RA 1FW8A 4CU5A 3N2NA 1KDRA 1KFEB 3ADPA 3WOVA 5AUPB 3EYZA 1QVWA 3R8FA 2AF3C 5A4KA 4WJLA 4D81A 2OECA 4D9FA 3M8RA 3PX3A 1EFPA 3JQCA 5EJ4A 3JX9A 4IOLA 2I0FA 2GYYA 5K3DA 1E9SA 4FR2A 3RIGA 2XXAA 4IH4A 1ZQDA 1R7RA 4CV3A 2P41A 4UBLA 4EHNA 2J46A 5ECDA 4CGYA 3RVMA 2V4ZA 3WK4A 5CDTA 4B46A 4I4CA 4YUWA 5H70A 4LDRA 3HK2A 6AT1A 3OJEA 2VP4A 3BAFA 4LZZA 1SIWA 2RHFA 4E70A 1QIEA 3E3OA 1G66A 5C8XA 4J9KA 3IUNA 2C58A 3CVJA 1TD1A 2DY0A 1U2DC 3R2JA 1EB9A 4XM1A 4DS4A 1BMQA 2Y6UA 5DHFA 3ZDCA 1QZUA 3RV4A 4DOMA 4MYRA 2IY9A 1T2NA 1SBCA 4YASA 1O89A 5AVRA 2YYSA 5DLYA 4GMDA 3FJYA 1RZTA 2YZNA 3ZCVA 1SKUA 2ASVA 3IAM6 2CZQA 4XCQA 4HB4A 3NVDA 4R9NA 4YDSA 5KWIA 3N7TA 1QVZA 1JFRA 3HJTA 4ABYA 3MW8A 5LQAA 4XJTA 5AQEA 1E1LA 1SV0C 4JLDA 2BMEA 3C3BA 4W5JA 4IHJF 5K8CA 3BJZA 5IMSA 3WWDA 5ALJA 2PFKA 1HYQA