3KD3A

Crystal structure of a phosphoserine phosphohydrolase-like protein from francisella tularensis subsp. tularensis schu s4
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
216
structure length
216
Chain Sequence
MKNIIFDFDSTLIKKESLELILEPILQKSPAKLKEIEYITNLGMQGDISFRDSLQKRLAIASPTKQSIKEFSNKYCPNLLTDGIKELVQDLKNKGFEIWIFSGGLSESIQPFADYLNIPRENIFAVETIWNSDGSFKELDNSNGACDSKLSAFDKAKGLIDGEVIAIGDGYTDYQLYEKGYATKFIAYMEHIEREKVINLSKYVARNVAELASLIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Phosphoserine phosphohydrolase-like protein
publication title Crystal structure of a phosphoserine phosphohydrolase-like protein from Francisella tularensis subsp. tularensis SCHUS4
rcsb
source organism Francisella tularensis subsp. tularensis
total genus 74
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12710 HAD haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 3kd3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3kd3A01
5AVYA 1PW5A 4EX6A 2W4MA 5T41A 4DWOA 2W11A 5ALKA 5E0OA 2FEAA 4C4RA 3DV9A 1XPJA 4CF4A 3I28A 3E58A 3ZVMA 2HI0A 4I9FA 3ZU6A 3WGVA 3R9KA 4EEKA 5ALZA 2YJ6A 3MPOA 1Z4OA 2HCFA 3EWIA 3ET5A 1TJ5A 2G1AA 1Z4MA 3SF0A 5AI6A 1RC8A 1RLMA 2YJ5A 3NALA 2RB5A 2PR7A 4IG4A 5ALVA 3OCWA 5AVSA 1Z5UA 3QNMA 1KYTA 4YH1A 4UASA 3K1ZA 1ZJJA 4Y2UA 5AVWA 2G0AA 5AK3A 5ALSA 5JJBA 2C9MA 2O2XA 2WF5A 3DAOA 1ZD4A 2X4DA 1L7NA 5AKXA 1RRCA 1RDFA 4JDPA 4NWIA 3ZUPA 1J8DA 1XVIA 2WF9A 4UAUA 3NUQA 4NAVA 4Y2TA 3FPSA 2AMYA 1YMQA 3FM9A 4UM7A 2QLTA 5AVRA 3QU2A 3OCXA 5ALDA 2C88A 2MU1A 2YJ3A 4J2TA 5ALJA 4BNDB 4EELA 3KD3A 3P96A 1RMQA 2R8XA 2FUEA 3W5BA 1O03A 3HYCA 2JAOA 4UMEA 1Z4JA 2ODAA 1N9KA 3VAYA 3U7FB 5A3SA 4RETA 2PKEA 2B30A 3N28A 3N8GA 2C8KA 3NANA 4UMFA 2WFAA 5AM3A 3D6JA 2GHTA 4G9BA 3SKYA 2R8ZA 1RKUA 3OCZA 1YV9A 3AR8A 3GYGA 1TA0A 2HX1A 1QQ6A 2G06A 2RARA 5ALPA 2BDEA 3S6JA 3W5CA 5AW6A 1RKVA 5AKKA 4Y2SA 4B6JA 1X42A 2I33A 3QX7A 2ZXEA 5ALGA 5IS2A 3L1VA 2B1RA 4L57A 3WKDA 1Z88A 2WF7A 4UMDA 5ALTA 2YMLA 3SMVA 1QYIA 2AH5A 5AI5A 4BX0A 2FPRA 2G07A 5ALOA 1Y8AA 2C8LA 2FPSA 2P11A 3QXGA 4XOUA 3AR7A 1U2SA 1L6RA 1S2OA 3PDWA 3NIWA 5AW5A 2PQ0A 3RFUA 3ZW7A 1S8OA 4HYTA 5AVTA 4UATA 3E8MA 4HGPA 3NASA 4OCZA 5ALEA 1N8NA 2G80A 4Y2RA 2GFHA 3FVVA 2YBDA 1NNLA 3B9BA 3QGMA 2Q5EA 4FFDA 5AW3A 3R09A 2EATA 4JB3A 1RPZA 4UW9A 3NRJA 4GIBA 4F71A 1VJRA 3AR6A 5AK5A 1IWOA 4Y3UA 2HOQA 5ALMA 3QUCA 1TE2A 3QYPA 3AR2A 4UU0A 5AM0A 1AQ6A 2ZG6A 3KZXA 2B8EA 2HEGA 4XQ0A 5AI4A 2CFSA 1Z4IA 1YJ5A 4EX7A 2NO5A 1TJ4A 3ED5A 5ALIA 1RMTA 4OD0A 3SHQA 5AW0A 5AM4A 2FPWA 3EPRA 3PGLA 4E88A 5AW1A 3UMBA 2HSZA 4BEVA 4HGNA 3A1DA 5AM2A 3MN1A 3W5DA 1K1EA 3OCVA 1EK2A 1SWVA 1U2TA 2NO4A 4UAVA 3WK8A 5IT4A 3U13A 2OA0A 3N5KA 1JUDA 1LTQA 5AKZA 2DQSA 2IOHA 2CN1A 2FPUA 3UMCA 5A3RA 5ALQA 1WPGA 1MH9A 5A3QA 1RQNA 4G63A 4L6CA 3IB6A 3WGUA 4L6AA 1Z4QA 2YY6A 3E84A 3B9RA 4UARA 3ZTYA 5ALHA 3L8GA 4YIKA 5ALLA 3A1EA 4UU1A 2JAUA 2QYHA 3FZQA 4Y2VA 5AK6A 5AIAA 3MMZA 1T5TA 5AKGA 1LVHA 5AKHA 4BYGA 2HDOA 2GMWA 5AK4A 2IYEA 2I54A 4ZEXA 2RAVA 2JGAA 4RESA 3ZVLA 1WZCA 4YIHA 1ZRNA 1XP5A 2ZBFA 3QU5A 3TLMA 4QQFA 4BBJA 4YCNA 3E81A 3WKBA 1QH9A 3KBBA 4MUMA 2JARA 4CE6A 3I76A 4QJBA 5AKYA 2OYCA 4HGRA 1Z4LA 3ZWDA 4ZEWA 1YNSA 3J7TA 3AR4A 4KNWA 2ZOSA 2MSNA 1Z4NA 1ZS9A 5AHXA 3L0YA 2RBKA 4AS2A 2FDRA 2ZBEA 1NRWA 1TJ3A 3KC2A 1T5SA 3QU4A 3QUTA 2R8EA 3A1CA 3ZTWA 5AI0A 1Z4KA 3QU7A 3CNHA 4DCCA 2B82A 4J03A 5AI8A 2W43A 3CZ4A 1ZD5A 5AW4A 3SD7A 1L8OA 2O9JA 5AVUA 3OPXA 4YGYA 4PNHA 1Q92A 2C4NA 5ALUA 3WK9A 2WHEA 4CNQA 4MWOA 3WKCA 3B8EA 4Y2JA 4NFLA 1NF2A 2G09A 4BKMA 3WK7A 2I6XA 5AKEA 5AVXA 2D2VA 1YS9A 3ESQA 3AR5A 5ALRA 2Q4RA 3IRUA 2WF8A 2EARA 3NAMA 5ALWA 1T9ZA 2I55A 4AP9A 4DW8A 3L0BA 4UMVA 1U7OA 3OTQA 4KNVA 1L7PA 5AW7A 3I1YA 3PCTA 4BNDA 2FI1A 3EF1A 4I9GA 2ZBDA 3ZWKA 1J97A 4BEWA 3L8EA 3M1YA 4BX3A 2OM6A 3U7EB 4Y2YA 1CR6A 2AGVA 4Y2PA 5AKIA 2Q4TA 5AI9A 5AVQA 2HF7A 2FUCA 3DDHA 2HO4A 5ALFA 3WK5A 3ESRA 3SKXA 1VJ5A 3BWVA 4ZEVA 4C4TA 3U26A 1SU4A 1CQZA 1ZOLA 5AVZA 3IJ5A 2G08A 4HGQA 5IT0A 1Z4PX 3ZI4A 3SLRA 4H1WA 4OHFA 2CFRA 1RKQA 4C4SA 2R8YA 3WK6A 4NV0A 2YJ4A 3WKAA 4NABA 1YDFA 3A3YA 4HAIA 3F9RA 3QUQA 5AVVA 2FPXA 4Y2QA 3L7YA 4XPZA 2HF2A 3U7GA 3KOOA 3ZX5A 5AESA 4OFZA 1ZD2P 3M9LA 5AW8A 1Q91A 4HGOA 1EK1A 1RLOA 3HLTA 3R4CA 4DFDA 3L1UA 2BDUA 3WK4A 1ZRMA 5AM5A 1WVIA 2IA5A 5AW2A 2B1QA 3N07A 4F72A 3RF6A 1WR8A 3OCYA 1FEZA 1SWWA 2I34A 3L8HA 3OCUA 1QQ5A 1QQ7A 3AR3A 1U02A 5ALYA 3L0CA 4CF5A 2YMMA 3I6BA 3U19A 1L7OA 3U7HB 2I7DA 4YCMA 4KX5A 3AR9A 3UM9A 2YMQA 4UM5A 5ALNA 2GO7A 2VKQA 4O8CA 3FPBA 2YMPA 4YCLA 5ALXA 1F5SA 4EZEA 1ZD3A 5AICA 2B0CA 3L5KA 3BA6A 4BX2A 2BY4A 4XE5A 1L7MA 4FYPA 1Z5GA 2CFTA 2OBBA 5AM1A 3PGVA 3UMGA 3ONNA 4KN8A 1RQLA 2P9JA 3EF0A 2GHQA 5AIBA 3N1UA 4GXTA 3KDPA 5AKLA 1O08A 3L8FA 1RMYA 2HHLA 4FE3A 4Y2XA 2JAWA 3QU9A 2EAUA 1L8LA 5AKJA 3ZVNA 2WF6A 3FGOA 2B8JA 2YN4A 5FP0A 2IOFK 2NYVA 2P69A 3ET4A 3W5AA 3MC1A 4KYTA 1VFPA 2YFYA 4CF3A 2P27A 3DNPA 4IFTA 3ZX4A 5AW9A 3WKEA 4KX3A 2IOFA 1U7PA 2WM8A 2ZBGA 4AS3A 2AUTA 3QUBA 4EENA 3QLEA 1RLTA
chains in the Genus database with same CATH superfamily
1HRDA 1U0OC 2HLHA 2FOLA 2VC2B 2W98A 3COVA 2FQ1A 2W2PA 4BBAA 3PYMA 1TFUA 4NYJQ 4D9HA 1P0CA 4E1VA 1DBRA 4AMVA 4MP3A 1FSGA 2Q99A 1LLQA 1K6JA 3TD6A 5LQRA 1GYQA 4M8NE 4KN4A 4BNIA 1CLUA 3IAUA 1G2PA 1NBHA 4FIDA 4IIHA 3A1WA 4QGBA 2YJZA 4Y6PA 1JQBA 2HD4A 1VPLA 2I9KA 1L1RA 4NLZA 1ZCJA 1I13A 5CAEA 5HRAA 3OZCA 5IARA 3C23A 1Z28A 3RVJA 5LQCA 5TQ2A 3AZQA 4I3GA 4C80A 4JYPA 2H29A 1F1BA 4LWQA 5JYBA 2VSFA 4HUQA 2QNIA 5JCPA 2AQHA 2X8JA 4MEXA 1WUKS 5BWCA 2P1ZA 1QCYA 3IQDB 4FS3A 2YXNA 3GB9A 3FYHA 1V16A 4RU9A 4F5EA 5JADA 1KIMA 4C7XA 5HG0A 4NMXB 2WWTA 4PANA 2A92A 1WCWA 4IRXA 4E14A 4BASA 4TSFD 3UJ8A 3K0CC 2WNSA 2ISSD 4QXQA 5DQGA 3G8DA 2QTWB 4RSHA 2NXNA 1JXMA 3KELA 4EYGA 5GVRA 2FMIA 5DLGA 3V3TA 1CZUA 2W58A 4ADSG 1JZTA 2PZEA 4K1XA 2HIHA 4TWJA 1YR1A 1RCTE 4X92A 5IDXA 4U2EA 2HMVA 1MX9A 1FW6A 1KY2A 5A5GA 3VSCA 3IT2A 4E4YA 1BWQA 2JLQA 1E5VA 1GGJA 1ZNWA 3OZBA 3V32A 2V7BA 4C8OA 3ZDAA 1E9BA 2W6NA 3RSFA 1FK8A 3K0AA 1RYBA 4MWCA 1SZDA 3AI2A 4FYJA 2GVZC 2KKVA 4UAYA 1Q6ZA 3IMKA 4B6QA 1BKYA 1EUDB 2A1AA 4M22A 3E3NA 3UGTA 1DP4A 1ZQZA 2C0QA 1ZIYA 4IR7A 1HQYE 5CFMA 5C1DA 5J2JA 4CEJA 3SEIA 2AGOA 4KQXA 1JFLA 1KYZA 2DHCA 8ABPA 3B38A 4WX2B 2YJTD 5FWYA 2O2IA 2I6SA 1M72A 3HVUA 5JJIA 3HKCB 1PGOA 2WHPA 5HK9A 2IS1A 2ZUVA 5FF9A 2I4RA 3USES 4XCXA 1JLRA 3QV1A 1T5BA 1OXJA 4ZAWA 3LE8A 5I3ZA 2J30A 3VPSA 5EGNA 3NHKA 1RWPA 3LT2A 5TMEA 2XI9A 2Q3DA 1H9BA 5FQOA 1QIMA 3CSDA 3RU9A 1OE0A 1JXQA 4LJSA 3NLLA 4OGGA 4I7EA 2JXJA 2YX8A 2Z1MA 1S89A 1U0FA 3BQ2A 3OKAA 3ND7A 3FUVA 4CG0A 2Q21A 3GJTA 1YZKA 3T5AA 5SYMA 4MEYA 4AZ3B 1CJKC 4IJUA 2FZGA 2BDUA 1NATA 3WK4A 1FMTA 1B6TA 2BISA 3ZDRA 4JUCA 4HNAB 3GLKA 5E3HA 5BQ5A 1WHSA 2X19A 4MAFA 4I1SA 4ER0A 4MMXB 5ALNA 3BWMA 2AF3C 2GR9A 1LDBA 5CGZA 3PEWA 2FSSA 1M67A 2GD6A 3V4VB 4D9JA 4EL5A 3L0DA 1OC2A 3RTVA 4OSPA 4YRMA 4DR3B 4GKAA 2JGDA 1SD1A 1QG4A 4RH3A 3A1FA 4MRSA 5CM8B 1FCJA 2Y9PB 4EPRA 5K0LA 3NFRA 4E21A 2GAAA 2PV0A 1P7ZA 1F9EA 4FFMA 1L3CA 1QTQA 1Z6YA 2RJOA 2D2EA 4ZVTA 1ZQXA 4QW9A 3BB1A 3MRTA 2YJ6A 2PS3A 4DYDA 1EVIA 2DB3A 3GRVA 3A1TA 3IAEA 1ZQPA 1O4WA 1NI4A 1S96A 2NUBA 3H5TA 4YH1A 1D4ZA 2XQIA 3ZHYA 3ZU5A 5E7JA 3ENKA 3RIHA 3RC3A 3VDNB 3TW0A 1NK6A 5B3JA 3JQAD 3B12A 4UM7A 4AY4A 2JBHA 4WI1A 2HQSA 2PQ2A 3DO6A 3UMVA 1H2XA 3N6VA 4Y1FA 5KNCH 1X19A 2BHTA 2E1EA 1G7RA 5IJ9A 3WHKA 1R9JA 3B1JA 3KHRA 1IAQA 1NU6A 3R7LA 3DLBA 4G09A 5JD6A 3ESAA 1XCLA 1NJXA 4PGYA 1X42A 4ZMSA 2NADA 2WM2A 2D0DA 1HMYA 3UAGA 4HNVA 1VBFA 4FQ5A 1NN1A 5DK4A 1I1NA 3ILSA 1RPAA 4LJ4A 3OP4A 4X54A 1OLXA 3TLCA 1NAIA 4LY6A 2V7WA 3RJ5A 2Q5EA 4ALLA 3KLPX 2AL7A 3T9DA 3VO1A 5E4YA 4F1KA 4XJXA 5FRDA 1MOZA 3MGGA 3B82A 1ILWA 1K7SN 3IP7A 3G2KA 5GINE 1WKBA 4JV2A 4QIWC 1UBGA 4POAA 4BU0A 1P2FA 3KEGA 1B7GO 2EQAA 3SLKA 4ELTA 1DAMA 1PVQA 4US2R 5EFZA 1GV1A 3GH3A 4QZDA 2JH8A 4R9NA 2AT1A 4OKSA 4TXLA 2P0AA 1F60A 4N6NA 5IAJA 3RB3A 2WSBA 4PLHA 1TZKA 1VKRA 4GZ5A 4LBYA 3HDHA 5KMGA 2J3EA 5H3HA 2XKAA 3LZCA 1ADFA 1Y4ZA 3KZIU 4ES6A 1C2TA 4DSNA 2UZ4A 1GGNA 4EKNB 2Z0MA 2Y99A 1UQTA 4Q1AA 2FLPA 1OZGA 1HDGO 4A8JC 1DFIA 4M1ZA 4EM6A 1YJBA 5CTAA 2F4VB 2D1QA 3W1EA 3NOVA 3WI7A 1Q7EA 3LRPA 2ZSKA 2HF9A 3KXLA 4OBXA 1E60A 5CK4A 1CUXA 3RROA 3GP3A 3DVAB 1Q1NA 5DASA 2MR6A 3ELYA 1A9ZA 5AQ1A 4L78A 1J4AA 1P2VA 5J2UF 4DL3A 4UUMA 3N2EA 2H63A 4DF4A 2RD2A 4HQFA 5DTIA 5LOVF 2B4YA 3KYBA 3ZU4A 2IK8A 2VAMA 3PC3A 4IXWA 3WGHA 4X41A 3BE4A 1EIZA 1ZISA 2KHZA 2JCBA 4FKZA 3VHQA 3BWVA 1SU4A 1CQZA 3T61A 2RHWA 3HZOA 2UVRA 1MXFA 3BFJA 5DKWA 3PGJA 4MDFA 3SIXA 1XRPA 1Z17A 1PWYE 4OK3A 5A4MS 4LFBB 2J0SA 1XU7A 4NS4A 5HTOA 1N6RA 3Q7PA 1AV7A 4L1KA 4OHYA 4EMSA 3ZU2A 2P6RA 4NLCA 4MR8A 5ETJA 3DTTA 1HDRA 5ERXA 1T2FA 2RGWA 4MW9A 1Z5GA 2QP4A 4Z54A 3GZNB 4WXEA 4G1CA 1YBHA 3C5VA 2VUTA 2GBLC 2EAUA 3AF6A 3QVLA 4B3CA 3JWGA 1NVEA 4MARA 2M98A 1ZC3A 4JI4B 5BW8A 1RLJA 3ESCA 1O5IA 2AFIE 1K6MA 3U7RA 2RGGA 1V48A 5F73A 5IF3A 2O5CA 3SXUA 4R4JA 1XCBA 2RG7A 1XS9D 1CUKA 2VP5A 4IKOA 4LTDA 3BM5A 4GR4A 1QYDA 3X43A 1IBKB 4BQQA 1CEQA 3CUKA 3V4LA 1S0UA 5FPHA 2AXQA 4ZANA 1F4PA 2R68A 1YJQA 1F0NA 5AVOA 1M8JA 4LN1A 3A4TA 4RMHA 3OCWA 1TNDA 4Q05A 4DBLC 4J1NA 3AVXA 1PG0A 4BLVA 2AG8A 1N2BA 3PXAA 1S9HA 3DZBA 1ZQ9A 1E0SA 3CY6A 3NCHA 2XUZA 1VCMA 2XCUA 2O8NA 4MUXA 3AF5A 4MVJM 1U7UA 3ENZA 5GADl 5TPZD 3OC0A 2SNIE 1MMFB 5DKFA 3MQ4A 1H5QA 4DQKA 1GNQA 1K5DA 3RNLA 2XJ9A 4YV1A 4F8RA 3BMNA 5KFJA 1YASA 3I58A 2KPOA 1U47A 2C7OA 2R8ZA 5FA5A 5EIBC 3V4OA 5C18A 1SA0B 1ZEMA 5BSWA 3SP1A 3Q12A 1LTHR 4EG5A 3HA7A 1E1LA 1I4DD 2JFYA 2KSQA 5D5QA 1N2JA 2QB0A 1NNEA 4EEXA 2GI4A 2IEAA 2GD2A 821PA 4UNPA 4TLMB 3DMTA 1XCMA 2HBKA 3DXFA 3KYIB 4YD2A 9ICRA 2A5YB 3AG5A 2C1XA 3QY9A 3BB3A 3B5JA 2PZJA 1M6VB 1CY8A 4MV7A 1JWLA 1KI3A 4C76A 2NUAA 2CXQA 2NT4A 2JB9A 4NEQA 3TQRA 1G5QA 4CV1A 3IMEA 4ILEA 1H4QA 3G85A 2XMRA 2CLEB 3C85A 1DAPA 4GMHA 2BHLA 1FP1D 3FMOB 1NNI1 2PCLA 2QI9F 1B0XA 4K88A 2ZREA 3KFVA 1ZJMA 3AUJB 1ZP6A 2XEDA 3HXLA 3GEIA 3UAYA 2QN2A 4G63A 4HEJA 3VPCA 1IIPA 4Q3BA 5FOWA 3UGJA 5GMOA 1AS2A 2DBZA 2C5BA 2ERYA 3W3AD 4D3ZA 4EBDA 3GA5A 3IHKA 1LGYA 1V2HE 1T91A 4DHWA 3ROQA 4C29A 4H15A 4DSJA 4R83A 4MULA 2XD4A 4PGHA 4RESA 1ZXIA 3QEJA 3X1DA 1KZ6A 4BBJA 2V45A 2X40A 4FHDA 4BB9A 1LVGA 2IEIA 1T6BY 2DY0A 5EI5A 3NGMA 2QAGB 2OG2A 4QTXA 2WJJA 1KI8A 1LNQA 5LKRA 3HBAA 4P7BA 3G0OA 1OAKA 4NV1A 3DNFA 3ORSA 2R4TA 3GUCA 1M34E 1EFHA 1T4CA 1GQSA 2XWQA 4D92A 1OYWA 3UCXA 2PGLA 5CA0A 3OT5A 4KDEA 1JI7A 2QTRA 4OREX 2IS2A 3AUYA 4EF5A 1EWKA 2XGGA 1EFPA 3D8RA 3RVNA 2AVDA 3H5AA 3BRWD 1QS0A 5BPCA 2AFVA 4KGZA 3AMZA 5D46A 2JK1A 1W96A 4KO8A 1EXNA 3QEMA 2I2WA 4OQLA 2CMFA 2Y0SC 3F73A 1RM6C 1E8NA 4GG1A 5T7BA 4HGQA 4IX9A 2EAMA 2ONJA 3WNCA 1KY5A 2MT9A 3Q8MA 2V7QA 1SKAA 4J6EA 3G2HA 3HJCA 1NF3A 4PTYA 1M2OB 5LQKA 2OD9A 3DM5A 4TLDA 1WE2A 3HB7A 4BCBA 2AX4A 3K4QA 4BJ5A 4HV4A 1YR3A 2R66A 4C2BA 4D46A 3X1JA 1JXAA 2WB2A 3DV0B 2NQ2C 2Q4EA 2FSIA 3SVZA 2R8GA 2GBFA 2X4IA 1DELA 5DGIA 1V38A 2GEFA 3P9ZA 4RU1A 3QLUA 3U62A 2I8AA 4EZEA 1YNOA 2CNWA 2B0CA 2HCTA 4BQNA 3KV1A 4XE5A 4DXHA 3TAXA 1SM4A 3UMGA 1YCFA 1WLYA 1QRDA 3NM4A 1SHJA 1PJBA 4ZYWA 4UVEA 4M1WA 4X20B 5E79U 1SL0A 2MUTA 1QFMA 3KXPA 3OUZA 2HHUA 2P40A 3O90A 1YZHA 4M1KA 1V45E 1PTJA 1U7WA 2XMCA 5ER6A 2BM0A 2YFYA 1FUKA 3DOUA 3KVOA 2PGJA 3W9BA 4FDUA 3Q3GE 4QHTA 4CIYA 1MV8A 4ZT7A 1D8TA 2I4TA 3DTYA 2GF2A 3HADA 4Q01A 1XMXA 2UU9B 3TINA 4JX9A 4MPTA 2Y71A 2DPYA 5J2HA 5HILA 1T3HA 3U44A 1RQGA 2H16A 4ZD6A 2QB5A 4YHBA 1E8DA 5J2UB 1PLLA 2IU0A 4IOLA 5LOVB 4JQSA 4H27A 2SKDA 1KEPA 2FW6A 1KVQA 5G41A 2EWMA 2AI2A 5SYAA 5K0SA 1PJRA 1A98A 2R8IA 5DYTA 3K9LA 3RH5A 3U2QA 5LCXA 3TM5A 1C30A 5EXTA 4LY0A 1Q0TA 3AL3A 3REOA 4LZPA 1HE1C 1T1RA 4YBZA 2SKCA 5TQ0A 1WP9A 5HYVA 5AUNB 2AOWA 3FYCA 4JJFA 3PQEA 2NPOA 1CQPA 5E8JA 4Z4IA 5BWLA 1FTWA 2FPSA 7MDHA 1MABB 4FDLA 2B92A 1PU2A 1AE1A 1H5NA 1C4WA 1B1CA 5DN9A 3M5DA 5EJ2A 4QXPA 2AQ4A 2HLNA 1G8SA 4GOXA 4BWFB 4K6GA 1W6RA 5FO0A 4DSFA 3AI3A 1LD3A 5BMOA 2UYGA 1Z4IA 1EFAA 2XCIA 1UA0A 3UUWA 2R1VA 3FD8A 3CM0A 2VHJA 4UCQA 3LLCA 2PA0A 4EECA 2JVIA 3DPUA 1AMNA 1II9A 4DCNA 3CEPB 4YT4A 4F3KA 3IAS1 5EHIA 5I4BA 3HMKA 1EVJA 1SCAA 1Y80A 1WCXA 4ZI7F 2G9VA 3UOGA 3ODGA 5DTMA 3CNEA 3GN2A 3IURA 1YI0A 3OF2A 4HDRB 1PG5A 3B7WA 3OU6A 4EO7A 4KUGA 1WULS 1HQCA 3WIUA 3C98A 5DBOA 1TK0A 1MB4A 4FNMA 2QBYB 2Y1FA 4J1TA 1RAHA 5LIPA 1DS6A 2OK8A 2TRSB 3EFOA 4ZTBA 4BNZA 3SCZA 5B1IA 2FQYA 1MX3A 3EQ6A 2V65A 5DRTA 1PX0A 2JHDA 4LNAA 1EWQA 2H92A 2GCOA 3VAAA 1IB0A 4XPIA 2LZ0A 3QTBA 2XRMA 1U8ZA 4LXXA 2AGPA 4IR9A 1W87A 4RVUA 5D6OA 4BVHA 4GH5A 2QYSA 1ZMRA 3MBKA 2M1ZA 3ZBQA 3GDHA 4Q3OA 1MG0A 3DDNA 4K28A 5GVSA 1X6VA 3HR4A 4OYHA 5KNBD 2CK3D 4UHBA 3P9PA 1W0CA 3D64A 3SKXA 1L5NA 2ON6A 3AQ4A 3IDFA 4YCCA 3MCAA 4WLOA 4OFWA 3N2IA 2YW2A 2WTAA 2OPHA 1NJFA 2G5TA 3KSUA 4NCNA 3A31A 3Q7IA 3R5TA 4KCGA 1PLKA 5K99A 4X8MA 2ZJ6A 4LXQA 4R2MA 3E5MA 3I6QA 3VC1A 4JEMA 5MFZA 2OEPA 3JAKA 4L6IA 5L3RA 1XWWA 3EJ6A 1O89A 1CUUA 1X38A 4YJFA 1A7AA 3ABSB 2D1SA 2NPIA 2XIQA 4KLHA 2JH1A 5AR1A 3HRKA 3PIRA 2HHXA 5EWMB 4Z0PA 3ONVA 2YMQA 4TT3D 1NVWQ 4UM5A 2V5VA 1Y8QA 3ZCQA 4ED1A 1R66A 3DBIA 2DC1A 1PT5A 2BR5A 3O2NA 3Q8LA 3D4IA 4RIFA 3I9V1 2IYFA 2JRCA 4DA7A 4BUCA 1I4EB 1SVLA 3EIXA 3EVNA 1O08A 4YNBA 3WRVA 2I3ZA 3FGOA 2GT1A 3LQKA 1MAUA 3DVRX 4FBMA 3ADBA 4ZO9A 4UB4A 4TZKA 3JARA 2HVHA 3HNPA 1RZUA 1JECA 3DBVO 4LDNA 3EG9A 1XPJA 1D5WA 2X9LA 2J4DA 3UT5B 4F50A 3VPDA 3BIFA 3AEZA 3L4PA 4B2LA 2XYRA 3NVMB 4YJGA 1MVNA 5K0ZA 5EZ6B 1CNMA 3T35A 2I3AA 3FLBA 4CL2A 3K92A 3RSLA 1T1SA 1PL8A 1DJNA 1KZ1A 4D2IA 4YQFA 2LD4A 1T3TA 2WNHA 3GEBA 4YP7A 3IBYA 5KFLA 1Z56C 3VRHA 1BWSA 3PEFA 1ESEA 3FPSA 5EZYA 1W30A 4CYMA 3E5HA 1AHPA 4TLLB 1JPNA 3B2NA 4AWAA 1XKXA 2MIIA 4KTVE 1ISPA 4HPJB 3GJYA 3MMXA 3UUFA 2AEJA 3Q1KA 1RKUA 4X62B 3SZ2A 2ZUBA 4JFAA 4YR0A 3IIIA 4L0DA 3DVQX 1F38A 4L57A 1TZCA 3L02A 4AL4A 4ILKA 1GU7A 2F1KA 4GPZA 4A7PA 3H8WA 1KWKA 3MUNA 3VMMA 4B9MA 4WE3A 2O8FA 4IQ0A 1LWOA 4EY4A 4XSGA 3VJLA 4E7PA 3JQ9C 3M9NB 2FG6C 2KJ5A 4HZUA 4HL6A 3IQHX 3EW9A 4ZZIA 3QFTA 4HB4A 1N62A 3E23A 4ESHA 4NU6A 3B1VA 2OCXA 3OA2A 3G2NA 1A04A 1YD7A 1E6MA 1BE6A 4BP9A 4JL5A 3CRXA 3KCNA 7ICJA 1CP3A 4Q1DA 3C6XA 1WPXA 5BXQC 3C7TA 2GA9A 1P1JA 4L6AA 2CNDA 4BLTA 1H5UA 2QTAA 4ZO4A 5TRTA 4UTZA 1CUBA 5KFXA 2H3FA 4N0PA 3TZCA 2BFDA 2IZOA 3KE8A 2P9ZA 1BHO1 3KWFA 3BCSA 1UBEA 4J0QA 1OB2A 1HO3A 4FFWA 3PHLA 2OCYC 1VPWA 3K9FC 3ICPA 3NUZA 2YW9A 2ZVQX 1TJ3A 2GILA 2O23A 4BEJA 2EOAA 2OWDA 2CFOA 1IJBA 2JATA 3VR3D 2F62A 4EEYA 3ZGVA 1XQXA 4MV0A 4Q4JA 2RHTA 3BZUA 3J81j 1AF7A 1ID1A 5TARA 5DB6A 1HWYA 1E79A 2WUDA 1TQ4A 5F3RA 4MFCA 1UMBB 1JGTA 3KYCA 2ZKLA 4LJLA 4CR8A 2H5XA 1T8YA 3H1BA 4PCVA 5DEOA 4YYEA 2F8SA 2AR9A 1PT7A 1I51A 4WBSA 4YONB 1GTG1 2ZT8A 5IVHA 1E1NA 4Q3LA 5ITSA 5L3SB 4D4GA 2B2CA 2GLEA 4P54A 3TACB 1JIHA 4WK2B 2YNMC 2ECPA 3ISJA 3ESZA 2WZDA 3ICWA 2X9VA 2VDLB 1JTVA 1F4VA 5DWDA 3BXOA 3SWWA 2C7QA 2IXTA 2WABA 2F1JA 4OLHA 5KG3A 4GSLA 1XTPA 2ICAA 5KYWA 1KQQA 1K9VF 2HRCA 1L5QA 4GNKA 3CZMA 5JVDA 4MHSA 4BNKA 2GYVA 1F7VA 3KAKA 1WRBA 4C7KA 2AK2A 4ZI7B 4N47A 4RPJA 3DO5A 2C2MA 1CHDA 2CBXA 2XUAA 3TYXA 4KG7A 1L7DA 7ICVA 4CCWA 3O7WA 1GUBA 5SY9A 5DRYA 2A9JA 4W5QA 5KO2A 3CIOA 3KYDB 3L1IA 3V48A 2P27A 2VT3A 3OLXA 4JKYA 4P0PA 2XKBA 1Y6ZA 4ERXA 4DPLA 4ACBA 1H6AA 5T41A 3B0YA 3UXPA 6NULA 3L77A 1JN0A 5GOZA 4M9XA 3AI1A 2UVUA 3R6LA 1UZNA 1FQJA 3PUZA 1J8QA 2BFCB 1BEEA 1H22A 1L5RA 2IYLD 2GK7A 4Q37A 1IL0A 4CQMB 1M1NA 2C9MA 5DHTA 4QC2A 2WTMA 2P91A 2C22A 1WDMA 3B3QA 4HO1X 4HY3A 4HDNA 3HA3A 2P30A 4BAUA 4WCFC 3OQ6A 1A96A 3A1SA 2A1IA 3WC4A 3CBGA 1P91A 1TLLA 3HCRA 3OZRA 3K2BA 3SIPA 4DG9A 1E66A 4NCKA 1NG9A 2O6HA 3KL4A 5IDVA 4Z4HA 2WZQA 1TA9A 1BS9A 3OCJA 4HTFB 4D5EA 5EG5A 4MX8A 2NXWA 1UFOA 1EX1A 3K0FA 4LDZA 3PLNA 4CFSA 3TLBA 1JVBA 4MUGA 2ET6A 1RPNA 4WLUA 3LF2A 2PKYX 2R87A 4IHKA 4FHZA 1WPQA 4LY9A 1L5MA 2V0GA 4XVHA 4LHWA 4R40A 3TZHA 1QP0A 1SBCA 4LSGA 3B70A 3HXPA 4Y3UA 4YAEA 2ARKA 1E9FA 1X7ZB 1ORIA 1R6BX 5KDDA 2XRYA 5AI4A 3V80A 1U99A 4YS6A 1A5BB 4IUYA 5GOTA 3PVCA 2ECOA 2FHPA 3HP4A 5LU8A 2HA3A 1KO4A 2V7PA 4P7FA 4ZYXA 4HCJA 4F86A 4ZHQA 3DZDA 3KRTA 4OXYA 5LP6A 3N7SC 3DLPX 3QBEA 3QUAA 2HRBA 2C20A 1WCLA 3RG2A 2HIAA 2QA5A 4B0PA 2O8CA 4IIFA 4AO6A 1FDSA 2OGSA 5CYGA 1VL0A 4R16A 5JHGB 2IEGA 4E5MA 4ARZB 4HDMA 1AUQA 1YBVA 3QNUA 2J5KA 1GNPA 1L5HB 5EE9A 4BMZA 1E7SA 2PUGA 3HV2A 3OMWA 4YROA 3WQHA 2HSEA 3W7AA 2P6OA 4IXMA 3F4BA 1NZJA 5IKEA 2HCBA 2OBFA 3FRIA 1XZJA 1R0BA 4IF6A 3RJJA 4U6PA 1TKRA 4INOA 4AO7A 4LJKA 1OREA 4QVGA 1QH8B 4ZVOA 3HPQA 4IO1A 3RVQA 4HVTA 3GK3A 2E8MA 1H42A 1MOQA 5A4AA 3T34A 1D1PA 4R1QA 2RI1A 4KQFA 3IRUA 2VSNA 3U3JA 2HIMA 2ZYIA 5JY6A 3L0BA 2VEDA 2CFIA 1M1YB 4PGQA 1CUCA 3H5WA 2CXYA 2F9LA 3PDIB 1L8AA 1DI0A 5TB5A 3PK0A 1QHHB 2R6JA 3K8ZA 3BMOB 2X5JO 3QF7A 1U3UA 3C3MA 5FOXA 3NVAA 1O95C 3GLIE 4A2PA 1U28A 4EZ6A 4RD6A 1U7XA 4QL3A 2NU8A 3IOYA 4OQPA 4R65A 4ZOAA 2ZANA 3QFHA 5BQOA 1KJZA 4HZIA 5A04A 2G4VA 1R5NA 4G0PA 4RULA 1E2KA 1YGYA 1DPFA 4ETWA 3VFDA 4ZPJA 1ENPA 4PCLA 2FQWA 2QTVB 3WDKA 2QG4A 2Z5GA 1TFRA 2GTPA 2XAAA 2XMBA 4DIEA 5BSTA 4GPBA 4WMLA 1JDZA 2AOUB 5HM6A 4XUEA 2CLSA 2PS9A 3BQ1A 3I9FA 2R11A 5EJ7A 1EWVA 3O1HB 3AVWA 4XDHA 4C7VA 1WW2A 2EYUA 3HVKA 1FP7A 3ZQUA 1ZI9A 3WMFA 1O94D 3WGGA 3N1UA 3H2YA 4JMPA 1P7YA 4CJXA 4I2IA 3OECA 3OJWA 4QPZA 4XQGA 3JSAA 4X3OA 1NXSA 4I99A 4J9OA 2IKSA 2O0KA 2YN2A 2CEKA 3U31A 2W90A 3PNPA 4EITA 2ZWVA 3SQXA 1JXEA 4HWGA 3KOUA 4TYNA 3ZS9A 1SZPA 3A05A 4IDHA 4JVNA 3ONDA 3IE1A 2CV0A 1N1EA 3VI3B 1SCUA 5BSGA 3VSAA 3ZIDA 4MV8A 3K71B 1MNAA 4NCBA 2WE8A 1NLMA 1JH8A 4R69A 4BU1A 5IYZA 5JNTA 1UBKS 3ROXA 1T0JB 5CUQA 4C0HA 4EQ6B 4JXZA 8ICTA 5L1JA 2K4HA 3EA0A 3IN5A 2ZYDA 4GUAA 2H9AA 3FHTA 4KODA 4HK4A 2W00A 3KLOA 3RJKA 1P7VA 3GUYA 2OENG 3TZKA 5IAOA 1JLLB 5FTWA 2N9UA 2ZXUA 3B3AA 3WX0A 1RS0A 1CRWG 1C1DB 2LPEA 5J0SA 2CRXA 1WCIB 3QFCA 3S6JA 2G71A 3GMSA 2GZAA 3V8MA 1SQ0A 3EWSA 5DCLA 2ZDGA 2ZAYA 1AH2A 4FMCF 1OXKB 3ZHXA 1FYXA 2IE0A 3D2QA 2GEKA 5LNK6 5DGAA 1EGHA 3NASA 4OCZA 2VEOA 3MGVA 5U4XA 2D5AA 3BZKA 4EBBA 4P81A 2A5JA 1RZTA 4X8LA 9ICKA 3L6EA 1U1CA 5CFOA 4NXZA 3G89A 1WKVA 3EW7A 4KLLA 4G1FA 2Z2KA 1JQKA 1KGDA 4C8LA 3RREA 2J59A 4N3CA 3TAQA 5K6TA 4FJ0A 5LZ7A 4F4IA 3CH6A 3ZVKA 2ZBPA 5I47A 8ICVA 1BXRB 1GG2A 2QTLA 2CVFA 2Y68A 3CBQA 2DGZA 2GXUA 1G5IA 2CD7A 3NNSA 4BE7B 4IIDA 1U94A 1XHFA 3UT0A 3PC8C 2F44A 1N5MA 3U81A 3FZQA 4AP5A 1G1AA 4AJEA 3MOSA 4M89A 4KAFA 2K8AA 2B99A 2FLKA 4GI5A 3GCDA 4QNNA 3ZC3A 3JVEA 4K9NA 1P0IA 3BE8A 1PFGA 4ECWA 3O1JC 2XQFA 4QJIA 1ZS9A 4AIRA 5FUXA 1ZJ6A 1O96A 3KC2A 4CEIB 5KQLA 4N5DA 2JKYA 4RIGA 3G2IA 3KHTA 4BATA 2P79A 2VANA 1NKCA 3IPYA 5EQJB 5CFQA 2PI5A 4QEKA 4Y2JA 4B81A 1UJ2A 5C2JB 1WB6A 3S2EA 1ZGBA 1XP8A 1VOTA 3O8QB 2GA8A 3ERCA 5TJHA 3CPSA 2QLMA 1TF2A 4NOKA 4WNYA 5G0SA 2RKOA 2UXBB 2CMKA 1C3JA 2D74A 1M1ZA 4XWTA 3TR0A 3IOCA 1T2DA 2VPTA 4UEOA 5JATA 5THXA 4Y2GA 1NI3A 5HHHA 1ZH6A 2WA2A 5B57C 4RPCA 5FUVA 3LYAA 4YAJA 3C0KA 4AN1A 4RD1A 4A8HA 5KFCA 4QOJA 4S12A 4E3ZA 1SUFA 2Q5CA 4Q39A 1VB3A 2FYTA 4R8SA 3OCYA 3HI6A 3SC4A 1QANA 2PGDA 3U19A 3HRIA 3EC7A 4KXMA 4UVDA 3TADA 1NJ6A 3RIMA 4DM3A 1G6Q1 3LC0A 1SXJD 3N7TA 4DXAA 3KZVA 1FNDA 1USVA 1K66A 4ZVKA 3RGWS 1M76A 1SUBA 3LK9A 3DEFA 2GM3A 5BWNA 4ZVVA 3LTNC 3UNXA 4Q5IA 4RSMA 3DE3X 2V1UA 5C5IA 2OKCA 3L1JA 4QU9A 4MQ5A 2AMFA 2D3WA 4Q7QA 5K0BA 1G21E 3CZRA 3MYYA 2QV7A 4DMRA 3EUWA 5F2OA 3O4FA 2M1XA 3KEQA 3BQ7A 2ZQYA 4II7A 2Q3MA 2QQFA 1OJLA 1RI2A 4B8WA 2B20A 1FTQA 2GVNA 8ICJA 3ZE8A 2LKYA 4C4PA 2KW5A 3FW1A 5KREA 1E64A 5HIJA 2RHLA 2UYCA 4OH7A 5CIQA 1KYWA 2KG5A 2PMBA 3P27A 3VGJA 4V0SA 3MWEA 2CJPA 1SPXA 2PGOA 3IPRA 4OKNA 1U0LA 1UQRA 2E5WA 3GVCA 1KEEA 4NL9A 2EGGA 2EFJA 1OYYA 3DDSA 1IY0A 2YR0A 5ENZA 3DZ8A 3CWCA 1QG2A 1TK2A 4I4CA 1N8SA 3N87A 1PYDA 3KSBC 4F5OA 4RETA 4LRQA 1W581 1CVRA 3MJSA 5HEKA 3W6PA 1SHZA 3H3XA 4D8YA 1SD2A 4RFLA 2Y0EA 2Q1YA 5JJKA 4OMFG 4IVPA 2ZIVA 1KMHA 2M0NA 5AKKA 3CLRC 5CX1A 3DL4A 1HT3A 4EDFA 1YQXA 3WS7A 4M38A 3UAOA 3UBTA 1BGXT 2FPMA 4NYMQ 4CT0A 3UYLA 2E7ZA 4ZT3A 4XUGB 5EPEA 4Y0AA 4IFBA 3TN7A 3FVVA 4Z1MD 1NW9B 3OQOA 3FSEA 3AFNA 2JFNA 2O8DA 2XT9A 3BD8A 1IHYA 5AK5A 4O1HA 5G2OA 1TE2A 5CLQA 5I7FA 5IC4A 1JIXA 3WAJA 1QE5A 3LPAA 4YAWA 1ZOOA 3GZ4A 5J0YA 4HGNA 1F20A 1PEKE 3IFSA 2GCIA 1MJHA 5EIAA 3FHJA 3KKLA 4JUIA 3MJCA 4QA9A 2V0CA 3O03A 1FSFA 2DR0A 2L18A 2GAFA 1J21A 3PGXA 2WFZA 4KRGA 3VC3A 2WVJA 3PUVA 2WAYA 1KZ4A 2Y9MB 1M0WA 4DS3A 2J6TA 3G8YA 4L73A 2KSOA 3IE2A 1WHTA 1SG6A 1Q7TA 1RACA 1P77A 3A2LA 1KFJB 4MPDA 5REQB 3SBDA 5DCUA 2QB1A 3WJ1A 1HRKA 4UOEA 1NJZA 2PA3A 1PD1A 3R7AA 3PEEA 4JL6A 3QX3A 4F5DA 2FDRA 3RABA 2PHZA 4LRUA 2DFKB 2A9PA 1DCFA 4EJMA 1L4KA 1JMYA 1EEXB 3ZCSA 3IQEA 1JHZA 3K9WA 4XOIA 4KFTA 4Z6CA 4J16A 4DSEA 1GVNB 3DBRB 5IBCA 4O5CA 3UB3A 3IG5A 4HWTA 3N8KA 4DFPA 4RZHA 4FMCB 1OA1A 1XRRA 2A30A 4BQOA 1W36D 4PLWA 1Y3FE 3TDNA 4RK4A 1NGSA 2FEXA 3CCBA 3OTGA 4GS5A 3BE6A 1CR1A 4TL6A 3T7IA 3QV2A 3JY6A 4S1WA 4OI0A 2FKAA 1P4SA 3KKAC 1QHNA 3HFSA 4H7JA 3UT6A 5DX1A 4NNOA 1IQRA 2H4HA 3TE7A 4O3NA 2JGRA 3D7KA 1DQYA 3SDZA 3P9NA 3AUKA 3W06A 1GLVA 1Z1VA 3GRZA 4BP8A 1NZBA 2VATA 3I30X 1LPNA 1P1FA 1U2GC 3OJCA 1OAOA 2CWWA 2OB1A 1QP7A 2H7CA 1PJAA 2IYVA 1CJUC 2DWUA 3EX7C 1U8YA 1Z9BA 2JJ8A 5G0VA 2GYYA 5H0IA 5JAQA 3IAHA 4DLAA 5BN4A 1QH1A 4MROA 4KMRA 1Z73A 4FOOA 4J0IA 1VCNA 4B9NA 2K2WA 3SHVA 1THMA 5IVDA 4BUJA 4G1VA 4CM7A 5EJGA 2YHSA 3QUBA 3ANTA 3N74A 2XGJA 4NRDA 2EKPA 4CCHA 4ECZA 1MBZA 4RHXA 4KQEA 4U6SA 4IRUB 2PTGA 2IPAB 3BDPA 3KVVA 3LU1A 2BDPA 3JTMA 1BE1A 1GTZA 2VQSA 3PQ7A 3HKEB 5GZ1A 3B6EA 3RRJA 3OUTA 3MM4A 3ZJ5A 1H1TA 4M0CA 1RJDA 4DT1A 3PW7A 2W9CA 3AB7A 5DBGA 4YQYA 5KDLA 5KKNB 4MJLA 4JDPA 3AV3A 4S04A 4LECA 1JP7A 2Y93A 3KX2A 4DSKA 4W9MC 1ULTA 5IKXA 2FUG6 1J33A 3WYBA 1X3SA 1MNQA 1YRLA 3LYSA 4ZQIA 3IVAA 1Z82A 2WWRA 3HXQA 3SKYA 5DGTA 2PSSA 5TISU 4B9UA 4UFOA 3ZDZB 1DIBA 5I7EA 4DQQA 3CLSC 3OO0A 4OHKA 2E4WA 2HQRA 3I2JA 1XYYA 1LB2B 4PRZA 4A0SA 4NEGA 2AJ8A 2X15A 2VJAA 2VPPA 5AVTA 1EE1A 3OZVA 5ALEA 5DN6D 2EBHX 3SYKA 1SUSA 4DV6B 4DIDA 2P90A 5AW3A 1Y9EA 5K9ZA 3ZJUA 1EXMA 4TKZA 3BBPA 4BO8A 1PAUA 1IXRA 3FOWA 3AO0B 4B17A 3T9BA 2Z3VA 2NU7B 4ICAA 4ZAVA 4Y9UA 3IG8A 3IRVA 4DSTA 3G7SA 3VHXA 5KHLB 3H04A 4OQYA 4NU0A 3GW8A 2RI0A 2XNCA 3Q3EA 2XZLA 2VPXA 2EP5A 3HWWA 3T1TA 5KFBA 4JK3A 2I1VB 4N49A 2C9OA 1RM0A 4LZWA 4RAOA 3WGKA 3V55A 4R8KA 3BQTA 5KFIA 1KOGA 1T9DA 4FVTA 4YJDA 1KF0A 5T6BA 4MYCA 1U2DC 5DGHA 4BRWA 1YRBA 5JHHB 5JJ5A 3ZWCA 2FTKE 4ALJA 2DT5A 3BGSA 1J42A 2E48A 4E5DA 1A9RA 2HMAA 4CEHA 4ZEWA 2JH7A 2H31A 3J7TA 1SBNE 2C4KA 4BNWA 2WTNA 1YB6A 1BMQA 3UW1A 1NRWA 3DTVA 5KYUA 1MC4A 2ABWA 4UHJA 1QX4A 1ICIA 5KWIA 1VPDA 4UCXA 1PR2A 3OOYA 1YR6A 3QMPA 1YQDA 4Q1CA 4PTLA 3TS1A 4CIAA 3E03A 3FPHA 2BCSA 3SS8A 1CPYA 5J2BA 1HUQA 3NAMA 4GVLA 4DW8A 3EDYA 4KMOA 2L19A 2IYQA 3ENVA 2W7PA 3PO4A 5YASA 3DZFA 2F3PA 4UNIA 3NMUF 1GHTA 3TNJA 2FG5A 3AM3A 2YIVX 3LS2A 3VOBA 4MKGA 3A6PC 3QZ8A 1BMFD 1Z4PX 3NTRA 1UJ4A 3RBEA 1A3CA 2ZK7A 4OQFA 5A9SA 1N4AA 3RIXA 4D82A 1FQOA 1ECBA 5G1PA 4DQIA 3AX6A 4CKYA 4UE3S 4MQBA 2ZVJA 3RYIA 5I4CA 2Q8QA 2X3FA 4GLOA 4R05A 1QB8A 4L4ZA 3L84A 2FFQA 2ACVA 3IC5A 4XYBA 1SCQA 4WQMA 2BM8A 1PVVA 3TCKA 4OQDA 3O0TA 3ZWYA 3R9XA 3AESA 2QAJA 3WL8A 2EW1A 1H4VB 4IL5A 4RCVA 3GFSA 2SCUA 5F9FA 3R75A 3M81A 3P4UA 1CJSA 4GMGA 2DRIA 1G3RA 4OB7A 1F2UB 2PNFA 1ODFA 1RXUA 3AJRA 1NE2A 3C5EA 1A69A 4QG3A 3BS7A 4DOMA 3BJRA 4KBFA 4MP8A 4F6CA 3ZU6A 1XJWA 2Z43A 4EEKA 1N9GB 3GILA 3SDSA 2QG6A 3AEQB 3BMXA 2VWHA 3Q0EA 4L95C 2BEVA 3K1ZA 1RJ9B 2C8VA 3L07A 2X4DA 3C3WA 4A27A 4WV3A 1J2UA 4OBEA 4ZRMA 5CJJA 4QM6A 2AJDA 3GEPA 2I6GA 3LI2A 1OBHA 5KPJA 5BSVA 4IRKA 5BN3A 4FHFA 3UFBA 1I33A 1HDXA 3EEBA 2NVUA 3PHJA 3GRCA 4IS7A 1C4OA 3TB4A 3DMRA 1M6YA 2ID8A 4JVLA 1KRWA 4GFJA 2X0JA 4ED0A 3H6HA 5J3JA 1DAOA 3V6MA 3FPGA 5ICSA 3QX7A 2PFOA 3AQFA 1CC1S 2G28A 1TT7A 1U0RA 2DHQA 2AH5A 5AI5A 4K86A 1ZGAA 2XNSA 1ES9A 1IH8A 1V25A 4HNHA 3EZXA 5CVJA 1QRTA 2CPRA 3OMXA 4FDMA 4F3NA 3PHGA 1T0UA 3TSZA 3U17A 4C3UA 3VNSA 3E7XA 5D4BA 2PUBA 5A5VA 1FX0B 4FFRA 4C4ZA 3V8BA 4N6GA 4TKVA 1JH9A 4XQ0A 4Q7LA 2DQKA 1JKIA 4OBBA 3E7FA 1OKKA 2HHAA 3S2GA 3SHQA 1W49A 4NYIQ 2DCMA 4OHMA 4B79A 4DTCA 3G2OA 5E1BA 5DM1A 1M5TA 4UAVA 3KO8A 5EWGA 3N9IA 4B83A 3LPDA 4GI1A 2UVPB 3MB8A 5DLPA 3S8MA 3PWSA 5DLDA 1YZ3A 4J1QA 5FBVB 1C3OA 4G0NA 1VDVA 3UJHA 5HDQA 1JKFA 2X7JA 2ZXHA 5AKHA 1TOAA 2NTEA 1XLWA 1I8TA 3WKBA 3E81A 1VM6A 3FMFA 1B0AA 3R3YA 4P4UA 1STOA 3I9KA 3ZWXA 4TN5A 5D49A 3CURA 3CUWA 4MDHA 2OV1A 4RQNA 2WT9A 4Q21A 1XTIA 3RJIA 3MTDA 3COZA 4TYQA 5FHQA 5JROA 4FGSA 4XQEA 2QUIA 5LKAA 2NRVA 4H6XA 3MTJA 4QXRA 3DOHA 4C7OA 2ZIFA 5JOQA 1DWUA 2G09A 2VBIA 1G63A 2QRKA 4PZ0A 3A0HU 1VLZA 3GJ4A 2EZ4A 1DADA 1VSQA 2E5FA 5LLSA 4DWJA 4YV2A 3LF1A 3L2OB 3RTAA 4RVDA 2IXAA 2NSLA 4FYKA 1RYYA 3COPA 5L4NA 4BEWA 3VPAA 1JR3D 5ADUS 1GPDG 1K98A 3SYTA 5LQDA 1GU1A 3HR8A 1NBMD 4HAOA 5KHOC 2V03A 3KVYA 4J0HA 4GLBA 4ER6A 3AHIA 2HRZA 3EPGA 4Y9RA 2WNIA 1PKXA 4K87A 4EW1A 3NHWA 4NV0A 2YZGA 2W3RA 2ADMA 4P4NA 1T43A 2DQYA 3UUEA 1NC1A 4EPYA 5J23A 1T0HB 2OAP1 1K86A 3FTQA 1D7OA 4MKZA 3E0XA 4LYYA 1ZJZA 1QORA 3QE0A 2DETA 3UV3A 3L0PA 3HCWA 2XJ4A 3RD5A 1A72A 3D54D 2QPTA 4QXMA 4YMNA 2O0JA 1YUBA 1D2HA 4YP6A 3U3XA 1I0IA 4F8EA 4JI2B 4KV7A 2ZJ4A 3Q8RB 4TWAA 1N2CB 1TKCA 3M49A 2CFTA 2OBBA 1N32B 2ORED 2DSTA 4B4OA 4EO9A 1D2RA 1E2FA 1NXPA 2RAUA 4H1UA 4EO4A 2PFNA 4J3FA 4CKBA 1KMNA 4OMDA 1KPGA 3DLAA 3JPQA 3O2QB 3WMXA 3O4VA 1XHEA 4RJJA 1UBHS 1BHSA 2AHOB 1MC5A 5EY5B 5FNZA 3ENNA 1RWQA 4FJ1A 3T54A 1NW5A 4WKGA 4RXMA 4KKVA 2P8SA 5KG4A 3T7SA 4KZPA 2OSVA 3ET5A 5KFKA 1ANKA 1HOTA 2JI7A 2YJ5A 2G5IB 4X6UA 1SXDA 3L0OA 3RJTA 4MW7A 1MEOA 4U8GA 5DW0A 2TMDA 4J2OA 3RS0A 1NFQA 1KTIA 1YSCA 5JJBA 1Z3EB 2VYQA 4IDEA 2ZDQA 2ZBQA 4MQFA 4DLXA 4FEYA 4DM4A 3O4IA 3P2IA 3UO8B 4C6SA 1QHSA 4C3ZA 5F9NA 2CXRA 4FOSA 1H1DA 1PV2A 4DDMA 2CLFB 3HABA 4BQEA 4Z9XA 3BUSA 1TO1E 4NICA 3DG9A 3N6XA 2DR2A 1SV0A 5H02A 1UBSB 4EGJA 3B1ZA 1N7JA 4G9BA 1L4UA 1G2QA 2CZQA 3PFFA 3TMKA 1JHYA 3ZQKA 1ZUHA 3T3FA 4H7DA 3HB0A 1NK7A 4EVRA 3NVYA 3G9UA 3A26A 4TWZA 2KFNA 5CGQB 4US0R 3LCJA 4RZ2A 3HB5X 4MGYR 1S5LU 4EY8A 2XRZA 1JBKA 3LO5A 4J0KA 3PQDA 3D8UA 4GI3A 1E1QA 3ZZ0A 5DNWA 1HEUA 3UVEA 1JN3A 2PV7A 2CT8A 4FCTA 4LF5B 1VKJA 4EA6A 4U7JA 4DFJA 1XTUA 4UEWA 1KKXA 1KYVA 1A50B 1JZQA 1ZM2A 5BUCA 2G3YA 3HPOA 3F1LA 3U5ZB 2VJOA 5KPDA 1GL3A 1LRJA 5C9ZA 4XGQA 1W1IA 5B1HA 3I6ZA 3ZJ4A 2L17A 4F84A 4OLJA 1I6WA 1GFZA 2REXB 5EIFA 4RQTA 1Y8RA 4G2TA 4WUTA 8ICOA 1XSPA 4BLQA 2XY5A 2BR3A 3G2PA 1VIAA 2NV6A 2Q2OA 4TYPA 1BYUA 2DKNA 3LVWA 1DAFA 4UHKA 4JJEA 4BJ6A 1YVRA 3FOAA 3BIJA 1NQTA 3M33A 1ZVJA 1YS7A 5K8TA 3GG9A 3DEKA 1GARA 2QU7A 1M75A 3GVPA 3IP9A 1BXGA 3T38A 4FONA 1V43A 2FETA 3GN1A 1ESCA 3LPNA 4V38A 1O97D 2QHXA 1NULA 5CAEB 1S7CA 2OPBA 4Z3KA 3BTUA 1J0AA 3PZRA 4QAQA 2G4CA 5TQ2B 1Z0JA 1VLLA 3BL6A 1Q8KA 2Q1WA 4HUQB 2IBSA 3EY4A 4EB3A 2X8JB 2IHJA 4A4DA 2E4UA 1GZ4A 4NPCA 1T5LA 2ID9A 4D3FA 3QW2A 2X41A 1V16B 1GTMA 5KI6A 2W6OA 2QKYA 5E1MA 3BILA 4ZEVA 2YQ5A 1BJKA 4QUGA 1RWWA 4DDKA 4DMLA 3MHTA 1MP0A 1SO8A 4B9TA 3GNQA 2IZ7A 2GUWA 5EXEA 1YZVA 1NC3A 2OHVA 1R74A 2EERA 2NRWA 2P66A 4KH1A 4ZREA 2VTEA 4DJ5X 3B8HA 2HGZA 1N36B 3O8CA 4RWZA 1D7AA 4OFZA 1TVAA 2FSPA 4MW0A 4PS0A 5IU6A 3VR4D 1QOZA 4LI0A 5ALYA 3L0CA 4EJ6A 5KOHA 2ORVA 5ENDA 4B9LA 4UREA 1NKSA 1MF7A 1YB4A 2V7UA 2Q1XA 2EL9A 4URWR 3RS2A 2ONCA 5DB8A 1PI3A 3D0OA 1RP7A 5C1BA 2DX7A 4ZZ0A 6REQA 5CCEA 2OEHA 2X0IA 3TWOA 2YWCA 2ZJ3A 2Q8PA 4Q9NA 5LQNA 5J63A 4UZFA 4QLBA 2FZLA 3K0AB 1NFRA 1QLHA 4E5YA 4MCIA 2HJSA 3BAZA 1P29A 4F5WA 4LJ5A 1QLNA 3AF0A 4HNGA 5E0OA 5K3AA 3JQRA 2FHSA 1UPHA 3PD7A 3ISBA 2WU1A 1X74A 2H1VA 2BONA 2ORIA 4R8LA 2ZTEA 4CEJB 4U5XA 4F91B 2OAEA 1J56A 2ATCA 1NW7A 1QHXA 3IDQA 1ETUA 5FWYB 3V8PA 3Q9LA 4KR0A 4QYSA 3NEAA 2WHPB 1Y1KE 3ZHBA 4OK6A 1Z8DA 3U61B 2R2AA 5T14A 4LRYA 4EHFA 5B12A 3I09A 3KD3A 1HNNA 3LKVA 3JQFA 2NZVG 3BJIC 3U80A 4GGMX 4QBTA 2QUZA 3BXFA 2HX1A 5K0FA 2R25B 4H7HA 3R3WA 1DTWA 4MUKA 4R1TA 5T4BA 3RS3A 4PLVA 7MHTA 3KAQA 2JD2A 3SFVA 1UC4B 3JVUA 2FPPA 5KQPA 1ZNQO 1DJQA 3Q6IA 1WHSB 2O50A 2CXHA 3KJHA 4CQJA 1RRVA 4OAPA 4HAYA 1XIVA 5TPZA 2BSAA 4H0NA 3JALA 3LMKA 4X91A 1YULA 2WVGA 5E9JA 4R9SA 2YH2A 3ROMA 2BQUA 3GNLA 2Z8YM 2BOVA 2OA0A 4DILA 2FMKA 1N60A 3KEOA 4NOLA 5BO5A 2JGDB 5A4DA 1IMOA 3RFTA 5KU1A 3BOSA 1RC1A 1DXQA 3BXPA 4BZWA 4NX2A 4IJMA 1Q0UA 1SZCA 3IELA 1R4NA 1WU7A 4ZDIA 1SHUX 1QGYA 4EBCA 3PA8A 1QCKA 1PJTA 2C4HA 2YWJA 4HQ6A 3WLIA 1GCUA 4X90A 4JODA 3WLSA 1N8TA 1XAGA 5B1YA 1CQIA 3H40A 4G5SA 3KHSA 2ACWA 4S1PA 1NI4B 3TOXA 3K5PA 1DC6A 2WTFA 2CB0A 1U2EA 1LF5A 1IJKA 2HDHA 4TQ9A 2WD7A 4FYWA 4UHHA 2GF9A 1FE8A 3BCRA 1BQ4A 1Y1SA 1OFHA 2HR1A 2XUDA 3CLHA 3IMCA 4KBGA 1J09A 4R6XA 2OXFA 4ED3A 4ZKDA 4F2DA 4MVJP 3KFXA 5IJ9B 5CA0F 2GERA 4AY2A 5IEJA 2C58A 1T9ZA 1XLUA 4PQEA 4P38A 3W3AA 4F5PA 1ISJA 1J8FA 1OMOA 1U8AA 1PQPA 2NO9A 3L4JA 5F51A 1D2CA 1Q3VA 3ZDYB 1XGKA 2YHBA 4E12A 4KHPB 1JIUA 2OZVA 4LEIA 4D4HA 3BWBA 1KYIA 3AJ9A 4UHDA 4MDEA 1ORTA 2W9MA 3CVJA 5A0LA 3Q98A 4ENTA 4BGDA 4Z3OA 1OLXB 4CPDA 2NYAA 2B2NA 4YRKA 3FR8A 4FLFA 4NBLA 4BQRA 2JFQA 2O6LA 4URVR 5H8WA 4BV2A 3CF4G 4OJ6A 1DNPA 1UBRS 2WJVA 3D8HA 2X76A 1QOPB 3O82A 1ZUWA 3WICA 5C35A 1SHTX 3PXBA 4ALKA 4CV0A 2P5SA 4F4YA 2OILA 5ICFA 1T5IA 2P68A 2V7TA 5A1TA 4JI0B 3BRWA 1T10A 4GYJA 5IDYA 3MBYA 2G6BA 2I03A 4S0XA 4Y6SA 4KLQA 4Q1BA 5KMGB 5KYTA 1C14A 4I5DA 4N1AA 2Q6KA 2A0KA 2PKCA 5L1KA 2ZS8A 1TK8A 2WT8A 2A3NA 4Q47A 1VFPA 4CXMA 5HPYB 1Y33E 3UMSA 3FCXA 3FSGD 3D8BA 1BD3A 4PAMA 5HJ5A 1EDDA 4D81A 3UXMA 3NV7A 4UQGA 3UK1A 2VTVA 4EFKA 4XWAA 4GL2A 1JDBC 4BMNA 4CF6A 1SRQA 1IWPB 4RTMA 3DOJA 4R98A 1GZVA 4XJSA 1CS0A 5E6RA 2H65A 2F3QA 4FT2A 1VRVA 4DLYA 2O2EA 4GOND 3DE6X 1X39A 4B31A 3U1BA 2IQIA 5CVEA 2DQ4A 4RY9A 2GM4A 2AWOA 5B3KA 3NBQA 1DRKA 2JA2A 5I7HA 2NACA 4X1KA 2DP4E 4DUGD 5ALJA 4MW4A 1O77A 4K2AA 3JD2A 2IF0A 4UNNA 1Y5LA 5KFAA 3MTEA 5JCJA 3CRQA 4RTSA 2D5BA 4G4JA 3ETNA 4II3A 4PJ0U 2ZWPA 5B2ZA 4MWDA 3D59A 3ICXA 4OYRA 3OJFA 1K5HA 2JVJA 4UMDA 5TQVA 2HLPA 1WMBA 3SY8A 5CDFA 3SMVA 1QYIA 4X7RA 4AZWA 3EFEA 3EYWA 4L8WB 1S1CA 1B74A 4GD3Q 3ZW7A 4DABA 4GXRA 4NQZA 1V47A 4ENVA 4JUDX 1VYTA 3WLPA 2YYAA 3RR2A 2QARA 4MR8B 4N3NA 4BDTA 5CEFA 2UUCB 1E2NA 4Q00A 1WUYA 4ZOCA 1U9IA 1ZN8A 4KXYA 3KZMA 2EQYA 1YFKA 3S5UA 2NQ8A 3SHTA 1P5RA 4H6PA 4UCFA 1ZONA 4X9XA 2KV2A 4G86A 2NMVA 3OE7A 2CFCA 1ZBDA 4B2YA 3LDHA 2YFQA 4L76A 3AJEA 5IASA 4BKRA 3H11A 2JJ2A 3L9WA 2YY6A 4L27A 4W6ZA 1Y48E 3SXUB 2WJHA 3BRSA 3R7NA 4UNSA 4KVGA 4UHFA 3MLEA 3HCPA 3ECAA 4Q12A 4UDNA 4D26A 4IV0A 2X4LA 4JI5B 3ZVLA 1RXYA 4TV8A 1Y5RA 2GFIA 3ZHOA 3LP5A 5EHZA 1R12A 5J8YC 2AV6A 3ZXIA 1RWNA 5LZ9A 2RBKA 4I19A 1Y89A 1F2VA 2OHFA 3GRRA 1TEHA 1GKYA 1XTZA 5A9RA 1WA5A 3MTAA 2F1OA 1WBJB 1NW6A 1C8LA 3R5JA 1A9QA 3BMNB 3PQ6A 1DLIA 1E63A 3INNA 4NK4A 3P20A 1HYGA 2C78A 1ONOA 4M0PA 3OZGA 2ZZMA 1C50A 3VNQA 4AG6A 4LWOA 1QRRA 1Q44A 2DR3A 5KHAA 3RRNA 2PFGA 2J87A 3ICVA 1F2DA 2QB0B 2POQX 1FJ2A 1E3IA 4TLEA 2VBCA 3D2CA 4JLSA 5JLAA 3H83A 2CFRA 1G0NA 3T3HA 4QTZA 3LT1A 3MR6A 5IXYA 4KXVA 4D97A 2FPXA 2O8BA 1YQ9A 1EK1A 2WAMA 4X3PA 5EXXA 1ECPA 2NUAB 1REQA 4UUNA 3SR3A 4QZBA 3CZ9A 3UOAB 1X1DA 4LY3A 1A5AB 2WG1A 1WTCA 2XBMA 1OTHA 2K89A 1HY3A 2VSQA 2ZS7A 3O3NB 1YFZA 1F0MA 3QKIA 3MTGA 3L8YA 4RVCA 2JI4A 1VA4A 1MJGM 3H0EA 2J3QA 3SNHA 2PLNA 5DULA 2PWPA 3WWPA 2VJMA 3A2KA 3OFND 4DEVA 1LBIA 4L16A 4WFQA 2ZBGA 3HB9A 3TUIC 3HDGA 5KSOA 3QWHA 3SC3A 3AL2A 2E4VA 4NATA 3D3NA 4QZGA 3HCNA 5K45A 5KJ6A 4YXMA 3J80A 3BS5A 3O5AA 3AP2A 1T4CB 1PGQA 1U7ZA 3V2GA 3KXKA 5KNCD 5CA0B 1HYBA 1F3LA 2XOEA 3B1KA 2DWPA 1EFPB 2CXTA 1T9HA 1SU6A 3U4DA 3QM1A 1QS0B 2QIOA 1WCNA 1SZHA 4RVHA 3WQBA 2NNWB 4MGIR 1T5DX 5EZYF 3TKAA 5I51A 2QXTA 3QEMB 5LC1A 1NOJA 3EGEA 2VXBA 3KUCA 4L7VA 4C20A 4NCHA 2ISOA 5DM2A 1OIWA 4D3DA 2WM9B 4CM8A 5ALTA 3CN9A 1A76A 3HP1A 2BCGY 1UXOA 2AE1A 2D1TA 4QNLA 3QXGA 3MRXA 4XX1A 3GPBA 4NDNE 2PJRA 5G1OA 1NUSA 5FL7D 3QWBA 3AETA 4URHA 3OETA 3RTBA 2R5WA 4IS3A 2GJ8A 2JHPA 5E7MA 2ISPA 3IBGA 4DLZA 4LW8A 2V97A 2GH1A 4O3OA 5C5JA 2ZRLA 8AT1A 4ZIRA 3CV3A 1BPDA 3OEWA 4FUTA 3CZCA 3UXNA 1W4BA 3NI2A 1GOTA 2ID7A 4I6EA 2MUTB 2POCA 3KSZO 3OQNA 2D6FC 3CH4B 2FPUA 1KQ3A 4K9KA 1JU3A 1HTTA 2PYDA 1PR5A 1Z2AA 2G5PA 4UARA 1S2GA 1DRWA 3JD4A 1J0BA 3QXXA 5A62A 4Y2VA 2XV1A 2IUTA 2PU5A 5AK4A 1NKTA 1XKTA 1A6SA 4UEKA 4DL9A 1AUPA 2H57A 5F2KA 1K06A 4B8YA 3U44B 3HCCA 1ZNZA 2XNDD 1E9SA 4AJHA 1SHKA 3IO5A 1G8GA 5C8VA 4MIOA 1OX4A 4MJ3A 3VR2D 2P0EA 5KWJA 4D1YA 1YJCA 4OJNA 5T8KA 5CHGA 4BFWA 1XQ6A 2FJUA 1KSJA 2X6RA 1FDWA 5KYGA 1XNSA 1GO3F 5DTRA 1Z5ZA 3FFAA 3RM3A 4BO4A 2HYIC 3C4VA 4LRSB 5EMJA 1X1BA 3E48A 1C30B 1JMVA 5AVXA 4ZU6X 4HAWA 1LDYA 4HPXB 4P7JA 2JAPA 3PD1A 4WJZA 3TQ1A 1YKGA 2X77A 4AW9A 4TRJA 4AJPA 3SQIA 4GPD1 3ZWKA 2ZAMA 5TQ0B 3KKEA 3S2FA 2Q49A 3UFXA 1N6NA 5KKCA 2FUCA 3WK5A 1RQPA 4V39A 3RK1A 3JQGA 3ZV4A 3U26A 4E32A 1HG0A 2KHQA 1TPYA 4YEDA 3A9RA 1Z0KA 2PUDA 3ST7A 2XGPA 4DAEA 4MV6A 3KZNA 4CT5A 2JK0A 1GPLA 1Y4DE 1X7DA 3DHWC 3C3PA 5AVVA 4BAGA 4G26A 4HGOA 1K89A 4R8RA 1XFAA 2C94A 5CJPA 2Y4OA 2WYVA 4RE6A 1EM8A 1P19A 5KYXA 1JG1A 2R1VB 4PSUA 1KOJA 5JASA 2VI5A 5I4IA 2WJYA 1ZH0A 3CF4A 3PQ4A 3FNBA 4YP0A 1MHTA 3OIGA 3DBHA 3L9XA 5E9QA 5JVDF 2YWRA 1SVKA 4RF5A 3EWAA 1TQ6A 1JDNA 4YMGA 3RFCA 2W2KA 4GXTA 1JF8A 1B42A 4RANA 1E0AA 4B8ZA 2VA9A 3ZPXA 2H59A 4A0FA 3RAEC 3QG5A 2OZPA 3H0LB 2E4ZA 1IC6A 1XLTC 4JOSA 3FWKA 1B0ZA 1BN6A 4PZUA 2VA2A 1I7LA 3IBSA 3VHLB 1PV1A 4EP1A 1MUUA 4O1IA 1PP4A 4JITA 4DWOA 5K3OA 4J0FA 4C9BA 2XBLA 1N3BA 4GX2A 4K46A 3WL5A 2R8PA 2JS7A 3VKWA 1VLQA 4BKUA 3EFOB 1E5XA 1W35A 2OO7A 1X7WA 3FPFA 3FR7A 1TQ2A 2CNLA 1II0A 3CNBA 2XF8A 4YJ3A 2D8MA 3IALA 4UAGA 2ZPAA 4C7MA 2BT4A 1JE0A 3LKDA 3EISA 3U3RA 1WCV1 2FZEA 1UODA 2GCOB 3INGA 7ICEA 4R64A 4XPIB 2Z56A 5JW6A 2WHYA 4OJTA 4F9TA 4UB3A 3IIKA 1V6AA 1N5IA 1MAWA 1UHUA 1AK9A 1I4LD 2IYZA 4FTWA 2NSHA 4P34A 4K9OA 4Q82A 3FAHA 3VOTA 4D9IA 1JDJA 4XJVA 2YVKA 4O3RA 2W6IA 3RJMA 2Y8EA 5DGCA 1QRUA 2FWNA 3C6KA 2G06A 3PCXA 3ES9A 4B4DA 4BWYA 3O4RA 3TZBA 2B1RA 1IN6A 3H65A 4C8KA 1XCJA 4J9VA 3GMDA 1YBFA 1W5EA 4AG5A 3MB5A 1W85A 1MSWD 2D3DA 3L4KA 4NAUA 3V6JA 5M2QA 3JAKB 3OIWA 4MGKR 1GXSA 2C61A 1ABBA 1E3DA 3PUJA 4YJFB 2F3UA 1PL6A 4NBTA 3MTIA 3HJRA 4I5IA 2O7RA 4BTEA 2GPTA 4IVQA 5J4HA 3PL5A 1UJ6A 2I3DA 2VHTA 4YD1A 2BAGA 4PYOA 1Y8QB 2ZIAA 1Q1EA 1XMQB 3ED5A 2WLSA 5HIKA 4LZAA 2RHOA 3LPCA 1EWTA 4HJXA 3HJNA 3NTXA 4XRGA 1HE3A 5G0WA 2XZOA 5AOBA 4BX9A 1H3NA 1WIWA 4QICA 1ZQNA 2JIZA 3H97A 3VR5H 5L9XA 1CG6A 4RVNA 1EGVB 2H2IA 4U7HA 1QIFA 4ZHQF 4G0ZA 1NT2A 2M9MA 1Q17A 2EJTA 5LP6F 1DOZA 5DYWA 3JARB 4F1JA 2GB4A 4A1OA 1NJ2A 4DL7A 3CNOA 3EG9B 3B5EA 3SQNA 4DOBA 2ZTHA 6AT1A 4EGCB 3H9BA 3GFQA 3O2SB 3SZGA 1YA8A 4YJGB 5L8VA 3H1TA 4DRXA 4NM1A 1Z4LA 2B83A 4RXTA 2WYHA 4P7GA 2VPWA 1GTSA 4FXPA 4N9WA 3LK6A 3WWOA 3KB8A 4OJ5A 3LCRA 1Z2EA 4RAQA 1OWLA 5KAIU 1GA6A 4CMEA 5EZYB 5EWLA 4CRWB 4J0GA 4B9EA 4ZK2A 2PGXA 1DDGA 4EUEA 3JQQA 5EL0A 2P0YA 1U4NA 2ECFA 3CU5A 5KNIA 4H59A 4CUZA 1YDEA 4L4RA 1BRMA 1KVRA 4QWCA 4N3AA 3ISVA 1G5FA 3HA5A 1C7EA 1SY7A 1E1CA 4XTRA 4AJ1A 2W0MA 5BUZA 4PRLA 3QEAZ 3D2AA 4RQ2A 5C80A 4A15A 4Y9DA 2AB0A 1TM5E 4PHFA 4DNPA 4I1PA 1VYHA 4G0XA 4WOKA 1VMKA 4JSTA 4QZ9A 5E9AA 1BU8A 3CX4A 1HEYA 4RA9A 1SQ6A 4I0WB 3SENA 2RAFA 3AG6A 5FLKA 2O8FB 3IP5A 3GLGE 4KLDA 4HZUB 2GESA 5HZGA 3HVJA 4UBOA 5HDBB 3FROA 2OC9A 1SIJA 3U09A 5BR4A 4CWAA 3D2LA 3GJZA 4LE2A 1QDUA 2QUHA 2VJYA 9ICHA 2K4MA 2DFNA 4HWKA 4NZOA 4D6XA 1OPRA 1NPTO 3CRMA 1D6SA 1HLPA 3PBKA 1GGEA 2D59A 2ZRJA 1R6DA 1KY3A 4HH3C 4F3OA 4L72A 4BLUA 3OU7A 1ORWA 2NYVA 2BFDB 2CF6A 3BXEA 3TLGA 2DGDA 4I1OA 3SS9X 2I76A 5MHTA 1QP4A 9ICNA 4KFRA 1GUAA 1RU3A 1W73A 3QLEA 3F74A 4NAHA 1GNSA 5ALKA 2QVBA 2XT0A 1I2MA 1FDRA 5JZBA 1I5RA 4EDHA 2N46A 3HZZA 3QQ5A 2CLIB 3KALA 5CXXA 4LMBA 1FMJA 4U7CA 5AK3A 2HBQA 4Q4JB 3JR3A 2WTUA 3NIGB 4LAFA 4P3YA 1JFTA 2WIFA 4CIVA 2WF9A 5IYZF 3NFYA 3ZLBA 4TM8A 1Q1AA 3KYCB 3ONFA 3EODA 1BGWA 3KR2A 5GPBA 4A10A 1C7RA 3ABOB 2F43A 4WOCA 3QE9Y 3UA4A 4H35A 2ZRBA 2VK1A 3I05A 2Q9BA 1KS9A 3G5AA 1K3TA 4Q7JB 4YP5A 1WXWA 2FEKA 5MGBA 1TD9A 1PIWA 1YZUA 4BMDA 2B4KA 3D3KA 9ICFA 2PBZA 1KJNA 3OVMA 4ASUA 3OPYA 2JEFA 4F3TA 2C83A 4UM9B 4DL2A 4FUQA 5HUHA 4PGGA 1V39A 2C8JA 2IXGA 3STYA 3L4EA 1ZQUA 1NFFA 3VNUA 1Z75A 3RAFC 4M0EA 4L5YA 3C1OA 3VH4A 2WWXA 5KYWB 2AI1A 3R5KA 4F4DA 4JB3A 1IK4A 3DPIA 5JVDB 3GV8B 1P31A 2B8EA 2PNJA 4K9RA 4JXKA 2HJHA 2C2KA 2QX6A 2CE2X 1LSJA 3O38A 3BXXA 3WB2A 1SOUA 1YS4A 1FP6A 5KFUA 3KUXA 1LI7A 3TCNA 5F4ZA 5C5DA 3BS4A 1WTAA 2NU6A 2PH5A 1VP9A 4HXGA 4LFCB 3S55A 2Q5OA 2G5GX 3VOAA 1Y9JA 5F3DA 2GETA 4GXNA 1WXHA 4P0PB 4RM3A 1XAIA 1JJBA 4JAVC 3U9TA 4D96A 3KQKA 2Z8XA 4F96A 1DQNA 5AKGA 1FYWA 1PSDA 4L4XA 1RSZA 2O07A 4YCNA 1BQEA 2WAXA 3DKRA 3NNNA 3C87A 1E5LA 2GAIA 3HP6A 1JILA 1D2GA 2OB2A 5I5GA 4NNPA 3KB1A 1Z2PX 4L15A 1M1NB 5AHXA 1NM5C 3VDQA 3FCSB 3QU4A 1QWOA 2P7HA 2YHUA 5JV5A 4HDNB 2ZCVA 2ES6A 1XX6A 2VDVE 3WGNA 4U6QA 4G0WA 5AW4A 1KR2A 4TOIA 5ELLA 3RR7A 4DE5A 3WK9A 3DFKA 5D3QA 4DLTA 3GJ6A 2DECA 1GQOA 3GH1A 5LQMA 4IGEA 2IP4A 5ALRA 3K72B 3D1LA 1SXIA 4RGBA 2G04A 4U8HA 3WLHA 2FF7A 5JAMA 5C0YA 3LD9A 2PUFA 1XC7A 3CJRA 1YXMA 5JC8A 1VG8A 4A8EA 3AI7A 5BW4A 3A70A 1YZYA 4D4JA 3GNTA 2OMKA 1QCZA 1FFDA 3K0FB 3WGQA 4DA0A 3EE6A 2YIMA 3SLRA 3T5HA 2XVZA 2DKFA 3PL1A 4MO2A 3GBVA 4ML3A 4KVFA 3LQFA 4Q6WA 1QFYA 4YN4A 5JYEA 5KTOA 2Q46A 1A9OA 1E2QA 3ADKA 4D3YA 1J1IA 3FKSA 3ALRA 3EIEA 3I92A 4XVRA 1X9IA 2PXXA 2EDAA 2PGIA 4ZHQB 4QYWA 3MQ2A 4Z9BA 1HDCA 3KQQA 4RPHA 3L5KA 4LGYA 4IOMA 5LP6B 2BBTA 4JJZA 2PSDA 4CM5A 4OXKA 3QBVA 2Z58A 3NKFA 4M36A 5MDHA 2O8CB 4AYWA 1TUBA 2QRVA 1KRPA 2B8JA 4A23A 1ZQAA 4HDMB 1NASA 2CJXA 3M9OB 3GWGA 2IUSA 3EQ7A 5HQ3A 4EFDA 3UUGA 2D5CA 2ZSBA 3F5DA 2PWYA 2F3TA 2EGUA 1LJUA 3E35A 3VYTB 3KSAC 1UBOS 1XTTA 5EN4A 1S9DA 3AHCA 3Q8XB 3PF9A 4N8SA 1B3BA 4CBVA 1I7DA 1XA4A 4OHVA 4MKXA 3GG2A 4C87A 2XYVA 3K20A 4R51A 3AU2A 3FSJX 5B58C 2AU0A 2ZJ5A 3NUQA 4NAVA 1U7HA 3OI7A 1FYEA 1T94A 1O8BA 1X8KA 3IXLA 4I9HA 4A5OA 4RJTA 2H2HA 1EFLA 3ZE2B 2H1HA 2NTJA 2V6BA 4ATNA 5KFOA 1EHCA 1P0PA 4RSRA 2P6MA 2XCSB 3H2KA 2RI6A 3GV5B 1CULC 4TSFA 2OQ2A 1SUAA 5KTMA 4HQNA 1H38A 2GK4A 5AW6A 2AFHA 1N57A 1OYOA 1IBSA 2E8NA 2NU8B 3K7EA 4ND2A 4KUEA 5JNVA 2Y0CA 2UKDA 4XAQA 4MCJA 2XDQA 4BB6A 3KKOA 1RZRD 4CTMA 1T7PA 1F17A 3IO3A 1K08A 4BBPA 3KQVA 1BCSA 3DF9A 2GXQA 3CLTD 3DYBA 1BRTA 2O7QA 5JS8A 5GGXA 4DBLE 4AVYA 4M9HA 1AQ6A 3V1UA 3PFNA 7ICLA 4L50A 1U3GA 2QAGC 3GL9A 4LZZA 3W5IA 3CX6A 4QX6A 1NJGA 3UC9A 1GU0A 3RRXA 1CQJA 1EK2A 1QFZA 3ZZMA 4PWYA 2QKQA 3HR7A 4PL2A 3I8XA 2JFUA 1LLCA 2H00A 2B8NA 4BNVA 1YE3A 4W5HA 1ND5A 3P0JA 3FRJA 4FGJA 1LPMA 1UDRA 1G64A 1YZLA 4ROSA 2ASDA 1YA4A 4KLAA 4PLPA 2PMDA 1XP5A 5IXSA 1SCUB 3BREA 2FEPA 1DCTA 4XCVA 4Z1MA 1QH9A 4EHKA 4JP3A 1JXLA 3TE6A 4OQZA 3ETEA 3HN7A 1E9AA 4XRRA 2H1SA 4M83A 4ZGBA 5IYZB 4IIGA 4I2DA 3PXGA 5ADWA 1VC2A 1GPUA 1LKZA 3C1AA 4KMUA 5FV7A 3EVZA 5CDHA 2VUSA 3BVPA 2A5FA 5CITA 1W8IA 5IILA 2GEVA 3DPSA 1DJPA 1J00A 1OT5A 1JWAB 3AOGA 4DV2B 2FLLA 2ATEA 1XCOA 5KEIA 4F2SA 3TGLA 3KLMX 2PFQA 3WYGA 5JY1A 1F8GA 4JLOA 1LDEA 2IIVA 5TVGA 4CMJA 4KIWA 4JDUA 1A0PA 1K1SA 1R64A 4DNOA 3DW1X 4P5EA 2V96A 5KNLA 1WZUA 2PPVA 2RCNA 3KLNA 4RD0A 3MQFA 2TMYA 1N5JA 4MS3A 1DX4A 2BW0A 1YU6A 4WTOA 2KD1A 4O4JA 4E13A 4ZT5A 2BGGA 4YP9A 1WV0A 3IR6A 1KDPA 2G17A 5B2FA 2AN4A 3HS3A 4WXMA 9ICVA 4O1MA 4C14A 3WB9A 1T6XA 1KNQA 4X5OA 3WRYA 2W2VA 4N5IX 1MRZA 2BZSA 3CPHA 3PUXA 3W05A 3H5RA 5B7QA 4Q1VA 1UXKA 2XE6A 2YV3A 1C1YA 1HFWA 1V7CA 3ECCA 1X70A 2ANCA 3OHBA 3W1WA 3FPBA 1W4RA 4J6FA 1HLDA 3L8CA 2VHQA 2JBAA 5GZ6A 4KLMA 4FZLA 8GPBA 4BO5A 2A86A 3RTGA 1RYMA 2C5FA 3IDOA 5FTLA 1USUA 1BYIA 1RHKA 1C1XA 1JEAA 1KP9A 1TK3A 1R8QA 2ZSEA 1K7EB 1NHWA 1Z6QA 2XNKA 2Z3ZA 5KSPA 3C2LA 4FMBB 4NNJA 2NT3A 3AYZB 3OU2A 3LC7O 1DXYA 4KLJA 4I9FA 3UV6A 3GBSA 3JQAA 4KE8A 4OM8A 5K3EA 5AT1A 1EESA 2E4YA 4CKZA 1O96B 4L7QA 1Z47A 1P2TA 2RGNC 1IN7A 5TXGA 3NTOA 2FMUA 1RLIA 2W22A 2XUKA 5LQUA 3ZHTA 1M0TA 4D80A 2OD7A 1KQPA 3ISTA 5HSGA 1LC3A 2DBRA 2UDPA 2D7JA 3FAZA 3IL2A 3KB2A 2FFAA 3TANA 4E2ZA 2AMYA 3M3DA 5U4QA 4QXOA 3NOXA 5K6RA 1YRWA 3UWSA 1P5ZB 1NK4A 1IK6A 3GJ0A 3T7TA 2HPAA 5GM1A 2DWQA 4MYRA 4JBIA 3QI7A 2P2GA 4TL9A 3GT7A 2HQBA 2HXSA 9ICBA 2AI3A 3RC2A 4ECSA 1FRNA 3RFXA 2R8RA 1AKWA 2Q2QA 3D5QA 3R6GA 4YVFA 5JECA 5KVCA 2RHBA 4MRRA 3L93A 1PQUA 5DPMA 1JDVA 3OE1A 3SSNA 4G23A 2R00C 1N8NA 3RR8A 1TYEB 1DOQA 1IBRA 1X7YA 5LMUB 1OZ0A 3CUSA 3R74A 3GBPA 2VJBA 1WEKA 3VYSB 2FMSA 5CBKA 3FMIA 5A0FA 1OBOA 4MITA 1S2NA 2QUAA 2H8KA 3G02A 4EX7A 2NO5A 2OYYA 2VOEA 5KG1A 4YO7A 3I8OA 3G2QA 2G1KA 1YH3A 4USAA 3EQZA 3ZG6A 4DA4A 1LBQA 3IESA 4IINA 3RIYA 4ZJZA 1WDTA 2R6R1 2H3IA 3LP6A 2ZDHA 1C9NA 4S2UA 5D7BA 1MPXA 4F5YA 3TFSA 4F5NA 2OCBA 2XCQA 1L5GB 9ICGA 4UOQA 1QTMA 2R86A 3HXOA 2QR2A 1XZBA 4TXJA 3T3OA 3VZRA 3LUBA 3B20A 1TU0A 1HEKA 3MWEB 4QJBA 2OYCA 1E6WA 4XSHA 3CLKA 4NP6A 4WVFA 3KVNA 5D5HA 3OQPA 2HW3A 3FDFA 1HYHA 1I6KA 1AZSC 1KEEB 4BMOB 2QP9X 1MRSA 3NNDA 4HWPA 3F67A 4JYBA 3R1IA 4JYCA 4INJA 5PGMA 3BB4A 4K03A 3JPRA 4BO2A 4ECQA 3B8EA 2HJRA 4KQ2A 4Z6KA 1U6IA 3NTLA 3F5QA 3B0XA 1CJTC 3EVGA 4UMVA 3QFSA 2QI9C 1AXRA 2ZIVB 9ICXA 3IVCA 1KMHB 3THWA 1NYQA 2GKGA 4X8HA 5CX1B 4H2DA 3IDAA 4GXJA 1TYDE 4U4AA 1EDOA 2XCLA 5HJ7A 4CKCA 1EFCA 3CT6A 1D09A 2AD5A 4GM0A 4BGVA 4MI9A 8ICAA 1D9DA 3MINA 3FDJA 2YJ4A 4LC0A 4JLDA 4FDTA 1RXIA 4HAIA 2BWJA 3L7JA 3Q3VA 2O8DB 1FW8A 3VUEA 3OHAA 2HXYA 2YWHA 4JLVA 2AE2A 2CLMB 3TNFA 2QTNA 4OM7A 4RJ2A 3ZWQA 4A8TA 1WWUA 2IYUA 5CVVA 4XWWA 1LSSA 1XZ8A 3K5HA 4KACA 4ECTA 4B9SA 4YDSA 2XCAA 4Q19A 2BN4A 3AFMA 3A2MA 4DC9A 2IU4A 1E62A 3ZK9A 3SJZA 1ZD3A 5TR9A 2VHWA 2ZIGA 3GHYA 1LC0A 2E2WA 2V98A 5KFPA 1ZCFA 3NUGA 3ORQA