3KD3A

Crystal structure of a phosphoserine phosphohydrolase-like protein from francisella tularensis subsp. tularensis schu s4
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
216
structure length
216
Chain Sequence
MKNIIFDFDSTLIKKESLELILEPILQKSPAKLKEIEYITNLGMQGDISFRDSLQKRLAIASPTKQSIKEFSNKYCPNLLTDGIKELVQDLKNKGFEIWIFSGGLSESIQPFADYLNIPRENIFAVETIWNSDGSFKELDNSNGACDSKLSAFDKAKGLIDGEVIAIGDGYTDYQLYEKGYATKFIAYMEHIEREKVINLSKYVARNVAELASLIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoserine phosphohydrolase-like protein
publication title Crystal structure of a phosphoserine phosphohydrolase-like protein from Francisella tularensis subsp. tularensis SCHUS4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Unknown function
total genus 74
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12710 HAD haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 3kd3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3kd3A01
3AR8A 3FZQA 2RAVA 4F72A 1Q92A 2YFYA 1IWOA 5AIAA 1U2TA 2PKEA 2GFHA 1TJ5A 1J97A 2C88A 4ZEVA 3UMBA 5AVRA 3AR6A 5AVTA 3L8FA 3ZUPA 2RB5A 5ALNA 5AVWA 3ZVLA 2HHLA 5AM5A 2JAOA 5ALVA 1ZOLA 5AKIA 3W5DA 3QLEA 2FPXA 3QU4A 1Z5UA 5AK5A 2HX1A 2CN1A 1PW5A 2NO4A 2G09A 2B1QA 2I34A 2B1RA 5ALFA 4KX5A 5AM0A 2IA5A 4UU1A 3OTQA 5AK3A 3ESQA 2G08A 3HLTA 4HYTA 3F9RA 3QU2A 1O08A 5AKZA 4Y2TA 1X42A 4YCNA 4XPZA 4AP9A 3IRUA 3K1ZA 4KNVA 5AKEA 2R8XA 3ZU6A 1RQLA 5AVXA 1QQ5A 5ALHA 4UM5A 2HF2A 2ODAA 4YIHA 2EATA 3L1VA 5AM4A 2DQSA 1LTQA 1ZD4A 4YH1A 1RKUA 1ZD5A 1RMQA 2CFSA 2AGVA 1EK1A 2FPWA 3L0CA 4OFZA 1TJ3A 2IOFA 1RDFA 2P27A 1NF2A 5A3SA 2WHEA 3I76A 1WPGA 3L0BA 5AW9A 3WK6A 3PCTA 1RMYA 4XQ0A 1YDFA 3U7GA 2RARA 1RLMA 3KOOA 1WVIA 3R09A 4KNWA 5AVUA 1SWWA 4ZEXA 4UW9A 2Q4TA 5AW6A 3U7EB 2WM8A 4UMEA 4UM7A 4RETA 3NUQA 2GO7A 3FPSA 3WK9A 3TLMA 2FPSA 3MPOA 1RRCA 3KDPA 1LVHA 5AW2A 2PR7A 2YN4A 2HEGA 4FE3A 4KN8A 3DDHA 3I1YA 1RQNA 2ZG6A 3L7YA 4I9GA 5ALMA 1YMQA 3ZWKA 3S6JA 2D2VA 3SKXA 3QU7A 3E8MA 1Z4LA 4G9BA 3AR2A 3W5CA 4OHFA 5AKHA 5IT4A 3FGOA 3N1UA 4BX2A 1ZJJA 1T5TA 1T5SA 3A3YA 3WKAA 4KYTA 3ET5A 4IG4A 4I9FA 4C4TA 1N8NA 5AW3A 3ZW7A 3EF1A 3ZX5A 3W5BA 1RLTA 1Z4QA 1VFPA 2Q4RA 3ESRA 3OCXA 1YJ5A 1RLOA 3WK4A 3NANA 1XP5A 4UMDA 5JJBA 3NIWA 2R8ZA 4AS3A 2NO5A 4GIBA 3MN1A 1FEZA 3QXGA 4HAIA 3ET4A 5AICA 2AUTA 2FI1A 3NASA 2I7DA 3QUBA 4H1WA 5A3QA 1Z4KA 1Q91A 2O9JA 5ALPA 5T41A 3SD7A 4BEWA 5AI8A 2MU1A 3UMGA 5ALOA 1ZRNA 1QQ7A 1L7NA 3QGMA 3SKYA 2ZBFA 3PDWA 2G1AA 4HGNA 3ZWDA 2C4NA 4G63A 2IOHA 1NRWA 3SHQA 5ALUA 5IS2A 4UATA 4UAUA 2OM6A 4NAVA 5ALDA 4HGQA 3U19A 2QLTA 1U7PA 5AIBA 3WK5A 3M1YA 3DV9A 3FVVA 1Z4JA 4AS2A 1VJ5A 1YV9A 2ZBDA 2EAUA 3WKDA 4L6CA 1TJ4A 1XPJA 3IJ5A 2AMYA 3SF0A 1J8DA 5AKKA 2EARA 3AR7A 3L8EA 4BNDB 2FPRA 4CE6A 2HSZA 1RKVA 2ZXEA 4QQFA 3IB6A 4EEKA 2Q5EA 2HCFA 5AVYA 4QJBA 3OPXA 3U26A 5AESA 1K1EA 3OCVA 3QYPA 1Z5GA 1ZD2P 4J2TA 2HF7A 4UASA 3N8GA 5AKXA 5AVQA 2HI0A 3L8HA 3R9KA 3E58A 3SLRA 2B8JA 5AHXA 1U2SA 4XE5A 4BNDA 4UU0A 4IFTA 3QU9A 3GYGA 3AR3A 2FUEA 5AK6A 1L7PA 2BDUA 2OYCA 4Y2JA 4F71A 1U02A 5AM3A 2FDRA 3I6BA 1L7MA 4NWIA 5ALZA 5AVVA 2PQ0A 3KBBA 2HDOA 3KC2A 3QNMA 4YCMA 4UAVA 2BDEA 2B8EA 3EPRA 3R4CA 3DNPA 4BKMA 4FYPA 2C8KA 2YY6A 5AW4A 3P96A 4EX7A 3N5KA 3WKEA 2YJ3A 3FPBA 1RKQA 2NYVA 4CNQA 1RC8A 2HOQA 2OBBA 3QU5A 5ALIA 1Z88A 4Y2XA 3U13A 3UM9A 4E88A 1EK2A 3W5AA 3A1DA 4CF4A 4YIKA 2G0AA 5IT0A 4DW8A 3L5KA 3N07A 3WKCA 2W11A 2WFAA 5AW0A 1VJRA 5AK4A 4DWOA 5AVSA 2G07A 2HO4A 3L0YA 3ZTYA 3QUQA 4C4RA 1L7OA 3RF6A 1SU4A 2RBKA 4MWOA 3N28A 3CNHA 4Y2RA 1F5SA 5ALYA 2I55A 4YCLA 2JARA 1MH9A 3ZTWA 2P69A 1QH9A 2IOFK 4CF3A 3VAYA 1Z4NA 3MMZA 1L6RA 1O03A 2I6XA 4EZEA 2WF6A 2WF9A 2AH5A 4EELA 2B82A 4Y3UA 3ZVNA 3B8EA 1QYIA 2YMPA 3FM9A 1QQ6A 2CFRA 3AR9A 3WGVA 4FFDA 4MUMA 4CF5A 3OCWA 2MSNA 1Z4OA 2P9JA 4OD0A 2C8LA 3ZVMA 3ZX4A 4Y2VA 5AKJA 2WF7A 3QX7A 3ONNA 2JAWA 4EX6A 4JDPA 4Y2PA 5AI5A 4C4SA 3BWVA 2X4DA 2WF5A 5FP0A 1RMTA 5ALTA 3OCZA 5ALJA 4BYGA 2YJ4A 3E81A 1S2OA 2YMMA 4NFLA 1CQZA 3ED5A 1RPZA 3PGLA 5ALXA 1ZD3A 3CZ4A 5ALWA 3WGUA 3RFUA 1Y8AA 1TE2A 3QUTA 3M9LA 5AI9A 1L8LA 3WK8A 2GHQA 2ZBEA 2I54A 4Y2UA 2IYEA 3J7TA 4O8CA 4BX3A 4HGRA 3KD3A 1TA0A 3WK7A 3UMCA 5AKGA 2BY4A 2FEAA 4DFDA 3EWIA 3MC1A 5AVZA 5AM1A 5ALGA 2W43A 3ZI4A 3AR5A 5AW1A 2B0CA 5AW5A 2R8YA 4Y2QA 3HYCA 1Z4MA 1KYTA 2QYHA 4L6AA 4BEVA 2JGAA 3EF0A 1WZCA 2R8EA 4HGPA 3OCYA 2GMWA 5AKLA 2VKQA 2C9MA 4OCZA 1YS9A 5ALEA 4XOUA 3WKBA 1T9ZA 1U7OA 5ALLA 1SWVA 4EENA 2ZOSA 2CFTA 2ZBGA 3B9RA 5AM2A 2YMQA 5AW8A 2W4MA 3QUCA 5AI4A 5ALSA 3PGVA 2O2XA 2P11A 1L8OA 4DCCA 4JB3A 3A1EA 2YJ5A 5ALKA 5AKYA 3KZXA 4RESA 4UMFA 4Y2SA 4NV0A 4NABA 3I28A 5AI0A 1Z4PX 4BX0A 3A1CA 5AW7A 2B30A 3L8GA 1ZRMA 3BA6A 3NAMA 2JAUA 5ALQA 1NNLA 3D6JA 4YGYA 1WR8A 3SMVA 3E84A 3NALA 3U7FB 4ZEWA 4UMVA 1AQ6A 2FUCA 3AR4A 4HGOA 5ALRA 1ZS9A 1XVIA 2YMLA 2GHTA 1S8OA 1YNSA 2G06A 4GXTA 4L57A 1Z4IA 4B6JA 3DAOA 1CR6A 2WF8A 3U7HB 4KX3A 4UARA 4PNHA 4Y2YA 2G80A 1N9KA 4J03A 2YJ6A 2OA0A 1JUDA 3NRJA 5E0OA 2YBDA 3L1UA 5AI6A 2I33A 3B9BA 5A3RA 2FPUA 4BBJA 3OCUA
chains in the Genus database with same CATH superfamily
1Y8CA 4F8JA 1R4AA 3HUFA 2R8IA 2ZI7A 2Q5LA 1QOZA 5AM5A 4NLBA 1N6KA 5G4LA 2CK3A 3AKEA 1UWKA 3DHVA 4NBSA 2NADA 3UJ8A 3LWNA 3D3NA 1LLFA 1W85A 3IODA 3P5BA 1DEKA 1T5HX 4EA6A 1YRWA 5F9HA 4RD1A 5F2OA 4YRQA 4GPAA 2X22A 3D9QX 4LNUA 1HV8A 1ZRSA 4CM1A 5M5BA 4NS4A 1F0YA 1XZHA 2OKGA 3VPCA 3HJTA 2RBEA 1NURA 3OMXA 2NZUG 2PZAA 3HJEA 4KFTA 1KQNA 1JIUA 4IS7A 4KXYA 3T41A 4ZOLF 5C5EA 1ZIDA 4LYJA 1FTQA 4I2DA 3EN0A 4CLDA 4DQDA 1YCGA 4C20A 4WBNA 1I7NA 4WASA 5DXJA 3O95A 4HAZA 4PINA 1Z0IA 3K0KA 3FVTA 2KLHA 2HXYA 4HR7A 3TQQA 1SXQA 4IV8A 2IUUA 1PJBA 4F4DA 3JTEA 1AGRA 5DBEX 9ABPA 4KLQA 2OGUA 4A8JB 4JUDX 1TLTA 2GWHA 3GRCA 2B6GA 4KLFA 2O4UX 4CIXA 4LGYA 4L4SA 3IBFA 1VLZA 2JHFA 4M76B 4LYGA 1NW4A 4HGNA 1ZVKA 5BWNA 2ZJ3A 1ZQVA 2H9AA 3G6XA 2P1ZA 1XCBA 5IBQA 5DKFA 1G2OA 1S01A 4J2HA 1BO6A 3OM0A 5AVYA 4C3UA 4OL9A 2H54A 3NS1A 3DE1X 3TLGA 4IJWA 2JKVA 5LM3A 3NHKA 2P3OA 3T4UA 1T5DX 4H3KB 1BXRB 3IQWA 3RU9A 3AOGA 2W83A 4MQFB 1U7UA 2VZ0A 1XCPA 3QWFA 1OAOA 3OEYA 5F21A 3BJRA 4D98A 4AB1A 1V4VA 2QL6A 2Z4TA 1W0CA 4KWHA 5DT9A 3H3FA 3T5LA 2V97A 7MHTA 3LT5A 3GFOA 4D3ZA 4CR6A 4REOA 4JX9A 4JVNA 1T4MA 4QDXA 3TE7A 3ZTWA 5TV2A 2V7XA 5G5HA 2KHQA 4M9RA 3E27A 4UM9B 1IZ9A 4QLAA 1SPXA 3VH3A 4NXNB 1CU1A 5JCJD 3NPMA 3K6KA 1BE6A 6PFKA 4AKEA 2JZNA 2HRQA 2HLNA 2QN3A 3BJYA 3HZZA 1J5EB 3K9WA 2QAGA 3CNEA 2OZLA 4MRVA 2W93A 5AHWA 3G68A 1PHPA 3KUUA 4E03A 1KHHA 1H0RA 2J9XB 3NTUA 3A6GA 5JIBA 1ZY2A 4I55B 4IEEA 3VMMA 1AG9A 4CKXA 3EWIA 3D59A 3WQHA 3Q7EA 4Y2QA 4EYSA 4JU9A 4OLHA 4AW9A 2V45A 4Q37A 2RHGB 2Z3ZA 1SELA 4HWRA 5FL3A 4B3IA 1A9PA 3G8DA 4ND8B 2QJOA 4NC9A 2AKYA 4D5GA 1TB4A 4OQZA 5E3HA 3W8DA 2P75A 4B5KA 4JA0A 3DWIA 5ENZA 4AYTA 3ANXA 2TECE 1IOWA 1ZG3A 4DABA 4XUGB 1SN7A 1Q11A 1KKXA 3UAWA 4DC1A 4BPBA 1K5GA 2JH7A 1PD1A 2F8KA 1M7BA 2W2TA 3CX7A 3RYHB 3TNDA 4WBNF 4E5UA 2Z2XA 1J2JA 2EZZA 3NWJA 4ZCMA 4YJ2F 1WUDA 3DB2A 1XRRA 3D5EA 4TMFA 4IQUA 4QOEA 3TI9A 3BZKA 4CWAA 2HX1A 4Q47A 4KWIA 1C9YA 3JSXA 3GEGA 3NIGB 4TLAA 4CDNA 2Y1CA 1M72A 1NZPA 1J25A 1JSRA 5BN4A 1W25A 1IUKA 4M0MA 1E5QA 2M9MA 3K1ZA 4KNVA 5IT9A 3R3HA 3DTYA 3GILA 3MR6A 1EFDN 1IY0A 4J9KA 1O1YA 5DGAA 1J0EA 3V7WA 4RJLA 3FDXA 4BVKA 1YO6A 3TK1A 3ZE6A 1XZCA 1DK3A 3EA5A 1QCYA 3O8NA 3T34A 3OM8A 5KFKA 1XK7A 2QY9A 1QDLB 4LRWA 3BL8A 2FXIA 3GRRA 2PLAA 2VPYA 4CZ2A 2G1JA 4J1SA 1RM3A 1RRCA 2H17A 2F1HA 1IXRA 2ZT8A 1HBJA 5CAEA 5JO0A 2FFRA 3G85A 1EIWA 3BMNB 3TI0A 1XHEA 4EF5A 3F98A 4F3OA 4HATA 1MN8A 2EQAA 2Q3JA 3TQFA 1YDEA 3STTA 4E08A 3A8TA 2BISA 3GBSA 5HG0A 3QWAA 4DF8A 4I66A 4LTNA 4IOLA 4AZVA 3SCZA 4RO0A 1RAEA 2BTEA 2V6BA 1WIWA 2J0EA 5EEGA 1T10A 3F96A 1ADJA 1SIBE 3DD1A 5JVDA 3H9BA 2H0QA 1FA9A 4AUKA 1YZTA 2I8LA 2X86A 2HW8A 5U4QA 2BJHA 4QEKA 2VZEA 2ZB8A 4MQMA 3SHQA 3MELA 5D51S 3JAKB 4BZZA 1TJ4A 1MHTA 5BPCA 3WQBA 2OYYA 1HYBA 3DAPA 2WWWA 2HHQA 1SIJA 4IQ8A 2V4ZA 1U3WA 3L7AA 3EJWA 4FR2A 3TH5A 1C3EA 1QG2A 1TA4A 2J3KA 2MWMA 5K0FA 1QBGA 1XL0A 3RT7A 1QDUA 3M6FA 2IHBA 2FSPA 1A5AB 1N2JA 3DONA 4ID3A 5EJ6A 5BYAA 1HEUA 5DN6A 1HKUA 1GA4A 1T3TA 2CB0A 5BW8A 4JC5A 4MR9A 2DZDA 4JB2A 4R1LA 1GJRA 4UVIA 4YDHB 4TZKA 4KSCA 2HNAA 4MA5A 4FZLA 4B3HA 3P4UA 4XGNA 3CNHA 5DM1A 5KYWB 3UAOA 3RGGA 3R7DA 9ICTA 3AEKA 3G2PA 2M6SA 1QQ6A 1T2FA 1C1XB 2NRWA 1WULS 2CXRA 2GFIA 1JQ3A 3KPUA 1YL7A 3OZFA 4HVLA 1KGDA 2FP4A 4B76A 2CKDA 4JBIA 3UXOA 3CA8A 4BGVA 4KODA 1GNTA 1UC4B 4PVCA 1VBKA 1JHQA 2UXCB 1E1MA 4H0CA 2HWXA 4M7PA 4PRZA 4AQYB 2KVCA 3MUEA 5JPIA 4Q00A 2ON6A 1T24A 2ZBRA 2HA7A 3GBPA 2I54A 4DNPA 4Y2UA 1ZQPA 3E22B 1I5OA 1RFLA 2RK6A 4YUYA 3HO8A 4N03A 2AFIB 4R6XA 2IXGA 3EZFA 5IINA 2KYRA 1DV2A 1NW6A 1AKEA 2FUKA 2ERYA 2VXOA 5AW5A 3S99A 2VDJA 2JIBA 3OPMA 4KLOA 3W5IA 3F78A 2F8MA 3GIMA 4N49A 1OF1A 4GF5A 4B45A 1E3WA 1KNXA 4ZYWA 1FSGA 2J5KA 4E1AA 4UMFA 3NWOA 3UW1A 1R7RA 1GL9B 4OX9Y 4HADA 2EIHA 1MO6A 2ZRHA 2A5FA 3I73A 1ZRMA 3X1YA 4D26A 1WPQA 1UBHS 3NRZA 1X2BA 3E84A 4J1NA 3E0FA 3HZOA 3QPVA 1T2VA 1A6SA 2KIWA 2DP4E 1DAFA 1B8PA 3EGIA 2YYSA 3G0OA 1Z1BA 3Q5DA 3PIIA 3RYCB 2F9MA 4GPZA 4B7UA 1TUIA 1SJ9A 1QSYA 4F6LA 2FZEA 4DCVA 4DT1B 2GFHA 2JI9A 5HZMA 3AR6A 2ZTUA 3H13A 1DWUA 2CXXA 4KYVA 2C5AA 3RHTA 4DV3B 1JHXA 1P4GA 2I65A 4URYR 5AM0A 4UU1A 1I6KA 3PUXA 3MS7A 4GSKA 3SHFA 3SHOA 2CL6X 1JALA 2O3TA 1HZZC 4JGGA 5JVDF 3IAM1 1ODIA 4R31A 3PFIA 1X6JA 4LXHA 5CDHA 3I30X 2G71A 4KJXA 4JP2A 1RRGA 2P27A 3DC7A 3LBNA 2FF5A 1BJTA 3V4RA 1F06A 3A3OA 5CHGA 3DR5A 4EZ9A 1LKZA 2RSLA 3D0OA 2ZSDA 2W03A 2DJ5A 2BT4A 4DFPA 2XEDA 2YYYA 3KR0A 3F6EX 5G1PA 5KTKA 2ALZA 3M7IA 4LEIA 1SXJD 2EZ8A 4FI3C 2QVLA 1DKUA 2J6BA 4A23A 2K87A 5TARA 4ZKEA 5K4AA 4NL9A 2E1FA 2SCUA 1JHPA 3KYDB 3RC1A 3LXRA 5EWEA 2UUPA 1HGXA 2Q5FA 5HF6A 5DB4A 5TISU 3O94A 3OPYI 4B47A 3PF8A 4YBZA 2X3FA 1KFCB 2EFCB 4K9QA 2BZ1A 1DUIA 1GGJA 2Q21A 4NJEA 3ZYZA 1PFWA 3PHBE 4B9AA 3W1VA 4TSFD 5F7OA 2O8CA 5C8XA 3A32A 3NVKI 3IG5A 3IFSA 1WWKA 1Z2PX 1PNQA 4IL5A 3NHMA 3BYZA 1KLNA 1E6UA 2C2MA 1GZ3A 5TPZD 1Z29A 4L6CA 4PYRA 4JXKA 4LYHA 3O7WA 5AKKA 1PBTA 4X5VA 3AR7A 3ISTA 4HNGA 1J09A 1T9AA 1WBJB 3JQ8A 1DOAA 3EZ9A 4LJSA 3KQLA 3TXAA 1ORTA 1JN3A 1AUOA 4UASA 4XUSA 1A9OA 1Y8QA 1AUVA 1ADCA 5JNWA 2PQ0A 2A30A 2IYUA 3QJYA 3MT7A 4HWGA 4MS3B 3CWZA 3ZVKA 3WZLA 4TUQA 4G5HA 4ZMSA 2KD1A 3HVKA 5BNZA 1N1DA 1DLIA 2AZDA 2PH7A 1JNXX 4L2IB 1CT9A 4DW8A 4TMKA 1VGRA 3R7BA 3VDRA 1WCYA 1Q7RA 1T8UA 4ZVPA 2EJBA 3D6FA 4HYYA 1NBIA 2ATXA 3CNOA 4OB8A 3IT0A 3EEBA 4RK0A 4BLTA 3FE2A 2NUBA 2PH3A 4OJPA 4KTVE 1O87A 3C1AA 1PF7E 2R7NA 4Z9XA 4OHUA 2QRKA 5F4BA 1OFGA 2AMJA 3WWCA 5C53B 3IEUA 4LSMA 2KMDA 3IMCA 3EYZA 4N5HX 2QTFA 1HXHA 1CQZA 3PGLA 9ICPA 4NLCA 1EUYA 3CEPB 3E18A 4MMYB 3F97A 4IVQA 4C01A 2FMPA 2AYXA 3RBVA 4GH5A 1E2LA 1BFDA 3HC7A 3EG5A 5EIXA 3GT4A 1BRTA 1TU3A 3GROA 4V3BA 2BQ3A 2ZFUA 1XTKA 1NM5A 4UZSA 1W1WA 4OP2A 1GSIA 1QZZA 2P67A 2J6UA 5EJ4A 2BFEB 1GDTA 2LKDA 1R10A 3P9PA 1E5LA 1HE5A 1T9ZA 1U7OA 1DIRA 3H65A 3H11A 3BJIC 4YRKA 2DBQA 3C23A 4MI9A 2W4MA 3ZU3A 3M6MD 4FFLA 3C8UA 2Z09A 1KK0A 2OCIA 5BSKA 2JGDB 1OASA 2HBLA 5KT3A 2YJ5A 1OC4A 1Z7WA 3E2IA 5IKOA 3H19A 3CS3A 3B7GA 3B85A 2BCSA 1L5RA 4EAAA 5CT9A 2FFHA 3C7TA 7ICQA 2Q9UA 4Q9HA 4UAZA 4GE0A 3VBCA 2WIBA 1COKA 2QJTA 5BOSB 1A77A 5BOVA 4B83A 2AJQA 2GX6A 3DZDA 3JARB 3NDBB 4A7PA 1RAHA 4E70A 2C3PA 3MM4A 4FZRA 2FSVA 4G4SP 1U48A 3GUZA 2J41A 2BMVA 2R8BA 2ZP1A 3PYXA 4LNUB 2QGZA 2CNOA 2ZJ0A 2I34A 2KKVA 4MF8A 3IQEA 1VQ1A 5JEDA 3X1ZA 3BF8A 2HUPA 1K6MA 2HAEA 4LS3A 5JADA 5DIFA 4LQCA 4RGBA 5KNDA 1QIHA 3WBBA 1TXGA 5JAHA 3A27A 4NJMA 1N5JA 1G20E 1ZI6A 3VR5A 3OHMA 3KQTA 3LPLA 4IUCS 1DBSA 2X0FA 1NBOA 3IDOA 2DAPA 3A6DA 1RMYA 1U9ZA 4ARZA 4MUIA 2NTYC 1ECPA 3A05A 2QM0A 2QS9A 3Q12A 2VBIA 4DJEC 4Y6SA 3KZVA 3GIWA 3GUVA 3HP6A 3LYAA 2JLCA 4ADSG 4FE3A 1L3BA 4WKCA 1JFTA 4M0DA 1MORA 5A7GA 1JEAA 2IV3A 4J0FA 2B4RO 5BRNA 3OETA 4P7KA 2ZR7A 1MC8A 5UKDA 3A9TA 4CMJA 5A9TA 3MILA 2R6FA 1QRAA 2XR1A 1T5TA 4I4TA 5KFQA 5KT2A 5KFJA 3BE6A 4DS3A 3UQ2A 1DADA 4KLNA 4YHHB 4C0JA 3TFRA 5GZ1A 5EHQA 3HHEA 3B20A 1U1DA 3DHNA 2HQSA 1LNZA 3F5AA 1UBJS 2GPSA 2CC2A 4FBGA 2Z3VA 3TLGB 2X4IA 1M2KA 1OKKD 2ZBDA 2D7CA 1BOOA 4EYHB 3HM2A 4IJ5A 3ZHQA 4EEKA 3C3DA 3KYCA 3F53A 4WEOA 3STYA 3B0XA 1WO8A 3D31A 3GJ8A 1JZQA 3UPUA 5CEHA 1JQBA 1MDFA 3OTHA 2GARA 3JYPA 4RIHA 1SA0A 4QUHA 3JPPA 1OTXA 1D8YA 4UZEA 4NE7A 3BZBA 2XTNA 3EIWA 5B3AA 1WUTA 3JVVA 4OYLA 5CLJA 1IZ0A 1DQSA 1OI7A 1VGVA 5KFPA 3VV3A 1USGA 1KMHA 3NDIA 1Z3IX 2DPJA 4LRXA 3VKVA 3ZK7A 5KHAA 3VH2A 2QN7A 1T94A 2DECA 3KOZA 3R5SA 3NT5A 3MWEB 1MMFB 1UP7A 4M0EA 3CGGA 4DWJA 1GAEO 2ZBQA 1PV2A 1JT2A 2G82A 4YGXB 1QM5A 2P9ZA 2EWMA 5KFCA 3NS7A 4UUQA 1C80A 2CFRA 3RU2A 2QAGB 2QRMA 2OZLB 2UVWA 2V3CC 1GU1A 3ND6A 2VSFA 1OA1A 2CXSA 4RA9A 2BZGA 3OD5A 2XDQA 4HNVA 3UYKA 4YI3A 4UM9D 1B6RA 3ZLUA 1G16A 4MUGA 4EJMA 3ZH9B 1PJCA 3E81A 4XB6B 2VTKA 5L3SB 3W2EA 5TQ0B 3ENNA 4E51A 3RH4A 1OV6A 1LDYA 1LI5A 2BKEA 1V39A 4RLFA 1GGMA 2RD2A 2NXEA 3WK7A 4OIMA 4ZO7A 1Z3CA 4EHDA 1JQKA 1Y3BE 5F2NA 5TT1A 2NO0A 5HKOA 3MT8A 3A4MA 2IYYA 4EWLA 2Y1FA 4BO6A 2F67A 4WX2B 5G2OA 4ZKDA 2GOLA 1O9GA 1RT9A 3Q4GA 4MS4A 4RPCA 4AURA 4HXFB 3P4YA 4UFNA 4CYMA 1PZFA 4JB0A 1Y7IA 1CETA 4NV0A 4ASUA 3U9TA 4AN4A 1Z38A 1YSCA 3B89A 4JLJA 2QUHA 3NALA 3FOWA 3L7IA 1YRYE 1GL6A 4RSMA 2EF1A 1WKCA 4KIWA 3T5HA 3CH4B 1CIVA 3ZE1B 1LF0A 1YB6A 5SYNA 1RYMA 1UQUA 2F9LA 3DXFA 1FVFA 2ZQYA 2OECA 1VSVA 1S1MA 4KIGA 2LD4A 3MXTA 2I6UA 3L1JA 3O4FA 4I4TF 5JCOA 1HEKA 3RTGA 1Y7PA 4QODA 2HSWA 3Q10A 2ZS8A 2P6NA 1G8FA 1JV2B 3MWJA 3A0BU 1W44A 2ONKA 3WFJA 1G5HA 4Z6CA 3NHAA 2W6ZA 5T4EA 3U6KA 5JPDA 5CR9A 3BSYA 4JJAA 1X8XA 4KR7A 3KFLA 3OF2A 5CYOA 3S2FA 1TADA 1UFRA 4AWAA 5E9WA 2BFFB 1G8MA 2FGKA 1M2NA 1CE8A 1MC4A 4GC7A 2QL9A 4Q12A 1H0HA 5CAEB 5K3CA 4ENTA 1BDHA 4YI5A 2W2NA 2FRDA 3OBBA 4B1FA 3F6CA 3TLMA 4WVLA 4TTRA 4H4CA 3S1AB 4I29A 4CCAA 2W2LD 5H81A 1SKYB 4FMBB 3C3AA 2WIKA 1BXRA 3S6JA 2AXTU 1ONNA 4CUKA 1N2SA 2I4MA 4MQFA 4A0FA 2YTZA 3D2QA 1DAIA 4PR3A 4AP5A 5AOAA 1GILA 1GPUA 3W34A 3V6KA 2HH9A 4EYOA 4RSGA 4OKIA 3UWMA 2PYDA 2BN4A 2IHUA 3GNSA 3OZAA 2OGWA 1ZWKA 2V6JA 3LPMA 4ZQCB 4BFSA 2C4UA 4I9UA 1HLPA 2JJMA 4W7SA 1S8AA 4P32A 4ZTUB 5KFHA 3TW4A 2KIVA 1L4FA 1JAHA 5ALUA 3PQEA 3HDYA 3H5IA 3SYKA 3QIVA 2QN6A 4Q4JB 4D42A 5A02A 3LA8A 1U7DA 3EMKA 3N4MB 3T4XA 2O5RA 4H1TA 1GFSA 4B4WA 1NU6A 1U2DC 4TVKA 1XZLA 4QQFA 1GZ5A 4Q3LA 3M8SA 2RIRA 1ZJWA 2NSJA 2W42A 3KOWA 1J99A 4IZ6A 1Y5LA 4YREA 1JHDA 1YU9A 3HUUA 4L8VA 3O0FA 3GYGA 4AJ4A 3G1TA 3UT5A 2BPGA 1HURA 4MVWA 1SBCA 1OUQA 3I9V6 3ILYA 5DG7A 2Y1OA 2AXQA 1CUBA 1EDZA 1QB8A 2C8KA 3C28A 4KLJA 3C1UA 3WKEA 1TGVA 3H17A 2G0NA 4Y1GA 1NJ8A 1R6AA 1HL3A 1KC1A 5F77A 4OU4A 3AEKB 4EBDA 5FV4A 2OHJA 4DWWA 2IHKA 3ZWXA 2GHIA 3PQ2A 3N0VA 5ULLA 5KINB 4TM7A 4UBKA 2G63A 3QELA 3B6KA 1FDTA 1GFIA 4A5OA 1O03A 2IYLD 3ZVNA 5CLGA 3F2IA 2O1SA 3BE5A 1TGYA 1TAUA 3K92A 4YMUA 4HFMA 4C4SA 3H1BA 3X2FA 5ALJA 3RYHA 2PD6A 2FQQA 5C5DA 2DPHA 1S0OA 1GGVA 2QB1A 2W98A 2B5VA 3LO5A 3M33A 4B17A 4U8HA 4XPIB 4RS3A 5BPFA 3P9ZA 4MAFA 1ZGGA 4MVJG 1O95D 4XVUA 5EPOA 3DEFA 1E3WB 2ZSEA 3JWHA 2R8EA 2RGBA 1FMFA 2JFUA 1H2ZA 1FNMA 1XSPA 4P58A 1SEVA 3BREA 3KB2A 4KKXB 2RHBA 4BX9A 1YHZA 1Y34E 3VI3B 1NQUA 2MRLA 2PQ6A 4C4PA 3HDGA 3W2FA 4OVKA 2P65A 3AXSA 3MYYA 2AG1A 4OY3A 3ONDA 1Z2NX 3SAFA 2HTEA 5HCNA 3BK7A 1Y6GA 5AOCA 1I7SB 4K9KA 3P2YA 2IU6A 4F12A 3CZMA 4GXTA 4DSFA 3AJEA 5JQWA 2LGJA 1LPOA 3RBAA 1SL2A 2BM8A 3GJYA 1N5XA 3BMNA 3CW2C 1PR3A 2GD2A 5K3OA 1ZQBA 2GYYA 2OUIA 1ZU5A 3DT8A 3GD5A 1W2WB 1Q12A 1QRDA 1EGAA 3PVZA 1GTG1 2IY9A 3AYXB 3IEVA 4N7BA 1YIOA 1QQ5A 3DL4A 3KQQA 1GNRA 1N36B 3L7JA 3LUGA 4IOJA 3FFXA 3JAKA 4XDGA 1IB6A 2XRMA 4M9LA 3S55A 2GLTA 4L27A 3TTXA 3G9TA 2CDBA 2W6CX 3M2PA 1ZW1A 2I4TA 4I1YA 3OSUA 2GN0A 3CLTC 1X7WB 5CLIA 3DQPA 2SCUB 3SR0A 4BAGA 4BMZA 2V7UA 1DPFA 3UA3A 3I6ZA 2FZCA 5L9AA 3FZNA 4DFMA 4Q24A 2ZK7A 1MABB 3T1OA 4MS1B 7ICMA 3PGMA 1C20A 5ARDA 1T5SA 1OZAA 3GJ4A 4I55F 4IH9A 4RY2A 2VK8A 4MIKA 4Y2HA 1EJ2A 5EPEA 4NJEB 1CFJA 3M81A 2YHBA 4OO1J 1YC2A 2HMWA 2O8CB 2Q9CA 5D6OA 1YRAA 1I3NA 2X7XA 4H7EA 3RIHA 3HJCA 1D8TA 4G1MB 1R5BA 4QEZA 2IGBA 4XDZA 1GN9A 1TJNA 3JQ8B 1SG6A 2P66A 3M1YA 1L2TA 1C1XA 1IDN1 2G0TA 4P4MA 3TM4A 3BWXA 3L8EA 3C5HA 2GVZC 4DLRA 1G8JA 4B6PA 4PFKA 2XGMA 1XTZA 5F23A 4XXHA 3IIMA 5K0JA 2XVMA 5K20A 3OCVA 5BN5A 4RELA 2UVQA 3HA5A 1HI9A 2IYWA 5FR2A 1A8IA 2JFPA 2MYNA 3ILHA 5AVVA 3FDIA 5DGDA 1GTVA 4TT3A 3HQ4O 1Q6YA 2B8EA 1M2WA 4BKMA 1WDMA 4U5QA 5EN4A 4WJKB 4EX7A 1C4OA 1VMDA 1U04A 3WVNA 1UAGA 3UMYA 1ZQOA 4NMHA 4B3FX 3WFZA 5CH5A 1LEHA 4EJSA 1L1QA 1Z8NA 1RJEA 2PUHA 2GB4A 2NTVA 3ZDDA 2JATA 4IIUA 2I55A 1JJ7A 5CRIA 2X5NA 2K8BB 1C4WA 4C0KA 1A9QA 4D45A 3IRVA 3TOCA 3CZQA 2ZS7A 5MN4A 2CJFA 4EYIB 1VL8A 1NU8A 5JD3A 3VZRA 4C0LA 3IKLA 1QHHB 3KXKA 4JC0A 1EINA 3GLFB 2VUTA 1J8FA 4MI1A 2WZBA 3B3FA 2P41A 1T1SA 3DOOA 4B5LA 5KKNB 5CRXA 3REOA 5SYAA 2I2DA 3RYCA 4RVSA 4IFIA 3G3EA 3EVEA 4W5WA 3INYA 4EW2A 1CLUA 2ZQ5A 3PW7A 3ZZTA 2BF7A 1QHNA 2QNIA 1OYWA 4D02A 4BMPB 2F4NA 4EHBA 1VPTA 4EVRA 5I9BA 3HJUA 2SKDA 1A97A 3ZI4A 4NU8X 2W7TA 1P5HA 2P7IA 2UKDA 3AI3A 2TMDA 3LBHA 3KJIA 2AHRA 5E9AA 4DMFA 3FAZA 3DEZA 4EENA 1Q0SA 5EVJA 1CRXA 4CF7A 2VIXA 1D4FA 1V37A 1LB2B 5ILOA 4U7GA 2QG9A 4URHA 1ODJA 4N41A 3C21A 3WGMA 2PJZA 4YUVA 3AWIA 4KCGA 3QX8A 3M6IA 3MF4A 5DDMA 3SAJA 3UJCA 2JJYA 3OLQA 3PNQA 4NMXB 4LGVA 4MF2A 2ZE5A 4CM8A 3WR5A 1QIDA 1P2DA 2GHTA 1KO1A 5FBZA 1M1NB 3SJZA 1SL0A 4NCAA 3LP5A 4FDMA 1M2OB 4HDAA 1L1EA 4DRYA 1AK2A 3LKZA 3GIIA 3KYDA 4M0CA 3FCUB 3ONFA 4NBLA 4EEZA 4O29A 5TMDA 4MNTA 3ICPA 4DFKA 4PZPA 4ED8A 1ZOLA 2W4QA 3L0OA 5D7NA 1ZN7A 5H59A 5AK5A 4IQ0A 3GVXA 4EY8A 4I1OA 4X6YA 4UOZA 4URXR 3AK4A 3OTQA 4XVRA 2G08A 2Q41A 2B8TA 3T7AA 2FZKA 5GONA 3U31A 2BIFA 3FA2A 5DTQA 4P53A 5BQOA 4CCSA 3O9VA 4ARZB 1AQYA 2EATA 3H8MA 1RKUA 3M6WA 2HR1A 3C4VA 3HYTA 1KAEA 3OX2A 5J1SB 4IDNA 2GVDC 3HWWA 2HK7A 3FB1A 2PA3A 2A88A 4RCVA 1LX6A 4GPTA 1T3QA 1Z6QA 1B2RA 2X1VA 1J22A 2E4YA 5L6MB 2EGGA 1X7YA 3VVBA 4ECZA 2DTEA 2C5SA 1ZUWA 4ZYYA 4B44A 2JS7A 3NC4A 3V2IA 2ERXA 4DNQA 1PS8A 2CDAA 3FCEA 5D49A 2ZUTA 4Q01A 1NC3A 2VJPA 3IA2A 2YXDA 4BX2A 4RACA 2GPNA 3U60B 3FWZA 4ALNA 2XUKA 1XLWA 2EQ5A 4J8PA 5B5SA 2P5YA 4QJ3A 3IDWA 1N7HA 3CWQA 5FUXA 4GI2A 1PNRA 2RHHA 4L2IA 3WV5A 1TPYA 1TCAA 3EQZA 4I28A 5HE8A 4YWJA 2PUJA 4I4LA 4IW3B 4HAIA 2OHVA 4C08A 3UG6A 2IUEA 2NV0A 3WNQA 1E8NA 1M1YB 3EZYA 1B0UA 4QUJA 3KYCB 2SBTA 4HCJA 3EZXA 3SZ3A 3DV9A 4FC6A 1KR5A 4YUAA 4NDZA 3NTRA 4HXYA 4GC5A 3GZ4A 1EE9A 2VANA 5KYYB 2KZZA 3HW8A 1RWNA 8ICFA 4FMPA 5D6NA 1E4VA 3RBEA 2HKIA 1U8AA 3BUSA 3AL0C 1GSOA 2H8KA 4CN9A 3EW9A 2EZ4A 2IUTA 4XYMA 4KTTE 5KVVA 4IFTA 3O4IA 2O7NA 3AEVA 4KDCA 4ANFA 4RGVA 1KMHB 5TNXA 2D7DA 2VDQB 2K4PA 2OYSA 1ISSA 1UQTA 2WG2A 1JTFA 2GM4A 3AJ8A 4JEUA 4LFCB 4CNQA 2Z2ZA 1TD9A 1XN1A 2FZGA 5E95A 3R0IA 4GBED 2RHWA 4DA0A 3IXLA 2BFEA 5EERA 2CLDX 4XCVA 2EJCA 3FY4A 4Q44A 1U0TA 1QWSA 1SOWA 4RY8A 3K9HA 5YASA 4DWOA 1NTRA 2JGDA 3M1IA 1MB3A 1KI1A 4BWVA 3IDSA 2Q3HA 1AXRA 1HTTA 1KEEB 4RA9B 1F1BA 4G26A 2XDQB 4W9NA 2VPQA 2O23A 3K4HA 1ZH2A 2Y8EA 2JAWA 1SMKA 2BFWA 5BOSA 3EZLA 1TK2A 4B35A 3JARA 4CDGA 1H1TA 1OVGA 1CPYA 4FLMA 3NHSA 1SIOA 3RAPR 2KNJA 2XT0A 3GN2A 1XROA 4RLHA 4I8XA 3THVA 2QX8A 4BNJA 2VA3A 2NG1A 3UV6A 1DC6A 3ZU2A 1UQVA 4HGRA 3QVWA 2PY6A 1FLAA 3MB5A 1XJWA 3KZMA 2AEFA 4MS4B 2WD8A 1N63A 4DLLA 2P2GA 1GO2A 4DC9A 3CN9A 3UZUA 1HUOA 2NSYA 5AKLA 2JL1A 4YB8A 3X1DA 3I0ZA 4Z2YA 1KU6A 5GONF 3MCUA 3K8OE 2GEDA 1YA4A 3BAZA 3NCHA 4B9NA 3GFBA 1SCUA 3RRGA 1N34B 1JDVA 4Z7NB 1JPNA 4OA5A 3LHIA 2BM1A 2VSNA 5AQEA 5IWCA 1KPGA 2OLKA 3NGDA 2A0YA 1Q7EA 2XCTB 2XICA 4DCTA 3EPKA 5AVRA 2BAGA 2RB5A 2BCQA 1XAGA 1QF7A 3CZRA 1Y37A 2FE9A 1Z2OX 1Z19A 5DNUA 2G09A 3U3KA 4Z4EA 3O1IC 5KDDA 1ZR2A 3IP1A 5EWJB 3AVXA 3PFCA 1M7GA 1OT3A 5AKZA 2PUVA 1CE8B 5HF8A 4D3YA 3DE5X 4TLCA 1LI4A 3S8EA 4DN6A 2IW1A 1AKTA 1VIYA 4QTXA 1DC5A 3D7MA 4K4HA 2JVIA 5EWGA 2QGNA 1CVRA 3S40A 2HJWA 4YBRA 3VKHA 4G5OA 1JP7A 1P9NA 1BPXA 4Q16A 2W5UA 3RTVA 3H0LB 1RQNA 4QWDA 2JAPA 2I78A 3QEJA 2E1RA 2ATEA 3U62A 1COWD 1N5MA 2ZRMA 1MA0A 4RDCA 3TEMA 1YT3A 2XOKA 4H9GA 3E3LA 1HQCA 4B3SB 1LLCA 1CKEA 1OH6A 4QNLA 5AVJA 4GIBA 2LV8A 3C6ZA 3Q9NA 4UQOA 4IGAA 3ZLBA 3PRHA 3MWEA 1WP4A 1FL9A 4FEAA 5CFQA 4R1PA 2JANA 1LRLA 4ZVNA 1VLHA 3MNFA 2PGOA 1GCUA 3G82C 1DS6A 2FDXA 3FZYA 3RSCA 1PWXA 1BPBA 2OORC 2YNMC 4IG9A 3UT5B 3GVHA 1MU0A 3WSWA 1K89A 2HRDA 2XVAA 4QE3A 5L3SA 4EFMA 1GDDA 3D6HA 5TQ0A 2YZMA 2J32A 4XB1A 1E1CA 4DGSA 4G1VA 2AZTA 2QW8A 3HKZF 4X84A 2PGIA 1VLMA 3KC2A 1KBOA 4N5LA 2CB9A 2XX3A 3DNPA 1G5QA 3PLRA 2Q1YA 1JDTA 2WSSA 2CLFB 1OPXA 3QELB 3O8RA 1JYEA 3DL0A 3WGJA 2K4IA 4ZJYA 3KJEA 2OC9A 1D0IA 3RHSA 3EUFA 1XQ6A 6REQA 3WQSB 4G8BA 3JQ6A 4O9MA 1CZOA 3RW9A 3ZJTA 2OHHA 1XLTC 1Q1ZA 2F7SA 2IOFK 4E5YA 1CWUA 5KQGA 1IU9A 3U3RA 3N39C 2ZCJA 5LMCA 2VZLA 5I9IA 3BERA 1FE8A 2FEMA 1FU4A 3EA4A 1T8RA 4JUBA 1IHPA 3FR8A 4EY4A 3T1QA 4M9JA 1P2VA 5LDHA 4F56A 4YO7A 3K70C 1JRLA 1X15A 1ZI8A 2R6R1 1N3LA 1XIVA 5J5AA 1FFVA 3E0QA 4BX3A 1ZQAA 2VDMB 4WOCA 2YB1A 2IX9A 2VEDA 3AJDA 4QIWC 4B46A 5HUQA 1U2QA 2IPNA 2MMGA 4QW9A 2FPOA 1WOYA 2CBXA 1OXUA 4K3UA 1O8BA 3G59A 1N1GA 5FO0A 4PZUA 4S0ZA 2R62A 1DBRA 2G25A 3JS5A 2BFFA 5TGTA 5LD2C 5FHQA 1OXMA 1QU3A 2MR5A 1CR1A 1KVUA 221PA 3V33A 3OJCA 5CYFA 3RYIB 2G7MC 3RRNA 3G9QA 3AB8A 5U9CA 5C34B 2ISQA 5IDQA 3S1AA 5CM8B 4V02A 1GV1A 1Z4IA 3HR7A 3TWOA 5LIRA 3SXPA 4OXIA 5IAEA 2R7LA 2JASA 1DCKA 2IIBA 2LPEA 3RH5A 2HDNB 4PIPA 3S28A 4KR3A 2V54A 1GNSA 4KLEA 3BPSA 3LTNC 4J16A 3DUFB 2JH3A 3FBGA 2XQVA 4MVJP 4ZHQB 1U2RA 4L73A 4INAA 9ICQA 1HQDA 3C8MA 5GTIU 4GRAA 4AC9A 5DN9A 3EGWA 2RHFA 1HUZA 5IN5A 4CN8A 3KR1A 3SC6A 2EIXA 4EJ0A 4KH0A 2FLVA 3R74A 2O3UA 4MJLA 3H1GA 4K9SA 4Q4JA 1TD1A 1OXSC 3LCVB 3MRVA 3KOOA 1CIJA 4MSUA 4B9SA 4LZNA 3GLTA 3VC8A 4PYJA 3N0RA 3I6MA 4IQFA 4WFJA 1ZCFA 1SVIA 2ISCA 3P9XA 4O5CA 1Q0TA 3G0CA 3SKXA 4P7FA 1P17A 3RS2A 1Z4LA 3CXRA 1CV2A 3N76A 4CKCB 3FDZB 5IASA 5HZKA 1AHNA 3BA1A 3HHPA 4JT8A 1Q5PA 1RLTA 2E7ZA 1I4LD 1BH2A 4JYBA 3OCXA 5B2EA 5JH7B 4V3CA 3OE5A 4R0NA 4XWGA 3D8TA 1G41A 4V2UA 4F3KA 4Z6DA 1N8KA 4RHCA 1O94A 3IHWA 3PRYA 4DL2A 1BWSA 3K94A 1XDSA 2PUBA 1G7TA 2R6ZA 3ERCA 1NRXA 3FJOA 3EEIA 4A8PA 3TR0A 1B93A 3P19A 5BN5B 3UKOA 1HJPA 4L16A 4IXWA 1ZGCA 2ODBA 1SV0A 4JASB 1ZVMA 1GTL1 1M75A 3KR9A 1Z6PA 4XCXA 1PJLA 2IYAA 3PFWO 2GBLA 4PC7A 4LYAA 4QYSA 5MHTA 1JX6A 1QV7A 1DQNA 2PM8A 4HTFB 5DB6A 3IJPA 3U49A 5BN1A 1JRPA 3CLHA 4XPIA 4UU8A 1T8WA 4EJSB 2RDJA 3RIEA 1CS4C 4JOSA 4F5ZA 4UUNA 1A1SA 5JCZA 1U9IA 1V5IA 3LWBA 1N2OA 4QUAA 1DCFA 1Z83A 1NJWA 1QUEA 2R44A 3OG9A 2W11A 2GD0A 3AY3A 1WUHS 4RMGA 1MGPA 1X1CA 1ISFA 4RORA 5AK4A 3T7EA 2PVSA 4TVSA 4JHLA 2Z6AA 1N0WA 4MA4A 3B5JA 1H0SA 3HYNA 3H6KA 4PGXA 1QYIA 3E3MA 3GFSA 3CN7A 2E3JA 1JEEA 1SCQA 3SY8A 1FMCA 2YVUA 2WP0A 2B36A 2VT7A 2YFKA 3BTUA 1BE1A 4ND2A 2P9CA 4DM7A 1RTKA 3LRTA 2EC5A 4HB2A 3RFUA 4OHMA 1WA5A 5DSTA 3ESXA 1CEZA 2GJAA 2O6KA 5DX1A 1OH7A 3M9LA 3RAEC 3SZGA 4PL1A 1OFIA 2Z4SA 4DSOA 3KJGA 3ORSA 3P20A 3TADA 3BCRA 2BY4A 2Q1SA 3TLYA 2NACA 3W3ZB 1YU6A 5THQA 5HHHA 2Y0CA 3UPTA 1QAMA 1VKNA 2M98A 5J4VA 1UZMA 2C7RA 4UHCA 5JALA 1WXDA 4F4YA 1YR7A 4EMSA 5KWEA 1DC7A 3PSHA 4CM8B 4EPXA 1VI6A 4JJIA 3RBDA 3VTZA 4W5QA 3PI6A 2C7OA 2NXCA 4X3OA 4ERXA 3GB9A 1WUJS 1XS9D 4EVSA 3EHDA 1OXTA 1IYZA 1X7WA 4GI7A 4BU0A 1KMCA 4NCNA 2V7EA 4EGSA 1A88A 4Q93A 3TTUA 3DAOA 2G9UA 4UBLA 2W2OA 4QJ5A 3L1UA 1MABA 5G02A 4MS1A 3ANLA 2AT1A 3WGTA 1MVLA 3PX0A 5GONB 4BLVA 2YIMA 3JQDA 2O8DA 3IOCA 3VOTA 5AJXA 2P2ZA 1DZ3A 3ORRA 1B0XA 4PSCA 2XADA 1OD6A 1QH1B 1NJ1A 4IMPA 5B2ZA 1DGQA 1O08A 4UFPA 4AZ3A 3VNVA 4J9SA 4OOFA 5KNDD 3OOSA 1G18A 3ICVA 2VUUA 4DWVA 1OBOA 4LG1A 3IIEA 3EEFA 3R8FA 5E1BA 1X7YB 3WMFA 1R0LA 1XE3A 1FLDA 2X14A 2HU7A 2YCLA 1SU8A 1ETUA 4YCDA 4DEVA 5KI6A 2WHXA 3QXSA 3IEMA 3MTIA 2XQFA 1FJXA 1GPLA 1OR8A 1LJ8A 2WUVA 3TTTA 3F5SA 1FIUA 1J1UA 2ZRKA 4M7RA 3ZXYA 5KYXB 1F20A 1R27A 5CXUA 4RV4A 4KVAA 4UBMA 3L7YA 2Z9CA 3ZGLA 2Q4BA 7ICGA 2HIGA 2YDXA 3NJ8A 2J3EA 3PMLA 4JZYA 5HOEA 2ZIFA 4Q1VA 1YQEA 5TY0A 3NDJA 4MRAA 1RLOA 2BUAA 3T9FA 5M2QA 4JGIA 4IGFA 4OAPA 4FYYA 3PKJA 2FI1A 1TZCA 4HRAA 4QW8A 5K0CA 1QTQA 2G3YA 2ZUVA 4FOSA 3SD7A 4BEWA 4A6XA 3FTPA 3L4JA 2WT8A 4XX0A 3RJTA 4EJFA 2ZWIA 1GPH1 2WNSA 5ITZB 2VNIA 1HC7A 4OJKA 1X70A 1QHHA 3FDFA 3GLFA 2AMYA 4D56A 2NTNA 3D4IA 4NYIR 2AU0A 3QEMA 3KQVA 4CLHA 3BZCA 4E13A 1NAHA 1PI3A 4Z4CA 1N6OA 2HF8A 3FTQA 3M9OB 4ZAVA 2YV3A 4DJJA 3UMJA 2JJ2A 4AMUA 3RK4A 4UPVA 2P3QA 3NWEA 3KHGA 4B4KA 4BO9A 3PHIA 1TQ8A 1E2PA 2WIDA 3AHEA 1YHYA 2P1DA 3OE1A 4L78A 3JQ7B 5C4MA 2LR0A 2PGAA 3TAUA 4J7AA 3T9DA 3TQIA 1Z7YA 5JAMA 2ZR8A 3X2SA 1WSWA 5LBIA 4BX8A 1R0RE 1L7OA 1OQAA 1X0VA 1XC7A 4B7ZA 3ZE7A 2V98A 5LN1A 4B8YA 4C0WA 1GPBA 3BTSA 2JFWA 2W3SA 3B8EA 2YHIA 3UUEA 1NOIA 2C8LA 1LSSA 3U80A 2Z1MA 1WD5A 4ZZ1A 1V5WA 4A73A 4MLZA 1LQUA 4O4LB 4MEYA 1F17A 3N0TA 4P38A 3CX6A 3M4NA 1M1NA 1QGUA 1NF9A 4NZPA 2H4JA 3ETDA 4QVGA 1M2OA 2IZ5A 1FU7A 4QATA 1XTIA 1IY1A 1XZGA 1SG0A 3TO5A 1SU6A 1XYVA 2PZJA 5JI3E 1XMXA 2XWBF 3HCDA 3KAPA 4JYZA 2WFLA 2SICE 1DXYA 2CZCA 2IS6A 2ZTDA 1P6UA 1WAMA 2DTDA 4P54A 3H0CA 2R8PA 1JQLB 5AUNB 2NP7A 3WHKA 1SCUB 5IKEA 2BMAA 4RZRA 2IXDA 4L72A 4N65A 3Q40A 4PSUA 4E4RA 4UNPA 1BTOA 1TCBA 2PI5A 1VG9B 5ALKA 1T0BA 5L53A 4B40A 2NSHA 2LYBA 3QFSA 4XGIA 2PH5A 5HILA 2PAFA 3FMFA 3DCNA 4GLXA 2QTZA 1RPLA 1WR8A 3RJEA 1B16A 5KWSA 3UH1A 3EH1A 2W2KB 1H8HA 2Z98A 3RUFA 1F0MA 1TM5E 2A84A 1M8KA 5TMPA 2DT5A 1IPHA 3NGMA 4L0DA 3JQEA 2HU8A 5IFLA 4XEHA 3RWMB 2C97A 1TJ5A 1UPBA 2EW2A 2F17A 4QPCA 1TZBA 4QKQA 1ZESA 1TO2E 4ZCLA 2LI6A 5KU7A 3J81j 1HT0A 3UXHA 1R0BA 2Q1WA 3F47A 5H3CA 4Q7MB 2C57A 2IF0A 2PX4A 4Z0HO 1CERA 1IEVA 3IRUA 2QMYA 5AVXA 5DTRA 3R77A 3VCBA 1M1YA 3Q7SA 4FD2A 4LV5B 4L08A 5JOQA 3GHYA 1NF2A 2BSXA 2XRZA 3DZGA 5C31A 1EUCB 2EDCA 1L7VC 2LP4Y 3PE4A 2X42A 1WRBA 5KYYA 3SDSA 2FW0A 1ZMTA 1VLVA 1PCXA 1S2LA 5DFAA 1FF9A 2KZMA 5K3FA 8ICWA 1JVBA 3EXFA 4RKFA 4RHTA 3QQPA 5EZSA 2YYZA 4M1QA 3CEMA 1TIBA 2VF8A 3OX4A 3SX4A 2HOIA 2B69A 2HPAA 4M9CA 3VYRB 2L0XA 1EJ6A 1E4YA 1Z6TA 4ZV9A 5B4UA 5CDFE 3LOUA 4OLAA 1EAYA 2PGLA 1QCKA 4RZ2A 4TYNA 4HY3A 4IUBS 1N5OX 2PZEA 3PX3A 4K46A 5IC6A 1AIPA 4PG6A 1FUIA 2O50A 1KEEA 3IVAA 1ZX1A 4BB6A 3BGOS 2QTRA 2OM6A 2H4XA 4F96A 3G5MA 4P4NA 5JS2A 3JPTA 1JMSA 4HDSA 3C41J 4GEKA 1L7BA 1E1CB 2BGLA 3AB3A 4EBBA 1JQ5A 4HH4A 4QJBA 5BQFA 5HXAA 1K1EA 3GLQA 1YB5A 4K9MA 1J0AA 1ZCZA 5J63A 3LT2A 2GKGA 1ZH6A 1WB6A 5AHXA 5D86A 3IQDB 4NX2A 4UU0A 3HVRA 4KYUA 5CXQA 1XZPA 3D4OA 3IAS1 2YCBA 3KBBA 5CLFA 3AQIA 1NBMA 2JZOA 1JFSA 3R4CA 5F1YA 2LYHA 6REQB 2A9OA 4U7CA 3VQTA 5K8VA 4Q6BA 2A7QA 1ZZEA 4B74A 4IL6U 1NVWQ 2EHJA 1GFWA 1SUEA 1VYUA 4KIJA 2QT0A 2HTFA 4G56A 2BH9A 3JWIA 1DARA 1RXIA 4KDRA 2G5IB 3PFFA 2BHSA 2FVYA 1PVQA 2JCSA 3FM9A 2WJYA 3W5VA 4X3CA 4BNUA 2WUWE 1ZSNA 4RXUA 1NWHA 2HA4A 9ICJA 3A3NA 1X7DA 5FQNA 3NOVA 1G8GA 3RV3A 4C5BA 1KDOA 1ATZA 4UPEA 4J91A 1KXJA 3LCCA 4DAOA 3DL7A 4Y1RA 4ESHA 1P9LA 4OBXA 4DSKA 3N6RA 2C2ZA 5KG6A 2PUTA 4B2YA 4NBTA 4Q5IA 3PR5B 4RQ4A 4O4IB 5J0QA 2H2WA 3EVNA 1AMUA 4FCWA 4Q1EA 4JWMA 3PR3A 1T7PA 4I5EA 3DW3X 5EWJA 3VNSA 2JHDA 1YS9A 2XYRA 3TDMA 5K3AA 1SOVA 4DV6B 4M60A 4BO3A 1YGYA 4N0QA 3AY7A 4MRMA 5F1PA 2BI4A 4YP1A 3T52A 5I9TA 2IDKA 3GWGA 3E7XA 1RI3A 3UFBA 4EFDA 1A27A 2H07A 1IQ0A 1E0SA 2QWXA 3NEAA 4RY0A 5ENDA 2GBIA 3ASZA 9ICXA 5JZVA 3EMDA 5DBFA 4HGYA 2L2QA 4FKMA 4GDFA 5LQJA 4IQ4A 1NFFA 2IYXA 3HCOA 3OURA 5H5JA 1F14A 3SQXA 5AIAA 5CM9C 4BCCA 3FJ1A 4LA4A 3LGXA 1YC5A 2C2WA 5AKIA 3R5KA 1I2AA 4L51A 3DMTA 1W8DA 3N3AC 4DE5A 4V39A 4M7OA 5K45A 4U6QA 2QTBA 4F5OA 1Y3IA 3C74A 3DYIA 4DQ0A 2XUDA 1X42A 4LHZA 4TWRA 4I0WB 3GAMA 3FLAA 2XWJI 1SXDA 7ICUA 4JS0A 4JOBA 3WWOA 2R6HA 1PYDA 5B1HA 4HAYA 2AGOA 3RU3A 1KTQA 5DM70 2HV8A 5FEUA 1HO3A 4D9EA 1Z07A 2C9CA 4PG4A 3H04A 4OQFA 5IJWA 4KH1A 4IDHA 2R48A 4P4LA 4REQB 5DX0A 3GRZA 2QSYA 5MN6A 3URMA 2AOVA 1IOVA 5CVJA 1CHDA 3GI1A 3I9MA 1T0JB 1DE0A 4NARA 3AT1A 1K6XA 3QFRA 2G9VA 3KYBA 3PUWA 1I2CA 4J9UE 2WWTA 3R5FA 4QUEA 2VWHA 1J4AA 4JGBA 3MK31 5DM60 2BBTA 1FXUA 3W7VA 1AF4A 1V5GA 5DXAA 4R81A 4N6NA 4RL4A 4DJTA 2CF6A 1G7SA 3I37X 2GLXA 2FLKA 3IS3A 2QARA 1LWNA 4MRSA 3QWIA 4YAJA 3V4FA 1VFNA 1JR2A 3PIRA 1VJ5A 1KYVA 4YWHA 5CJ7A 1VL6A 4C03A 3FIJA 3CSDA 2FMQA 1ECFA 4CV1A 1UAAA 2AC7A 1AXGA 1U0SY 4W8HA 1S1CA 1DKOA 3F5EA 2Q5EA 1NV8A 4PLYA 2XT9A 3BDPA 3I62A 1YB2A 3ENKA 1I51A 1FRVA 2IEZA 3QXHA 3L8HA 2QD5A 2FQYA 3K2QA 4JI0B 1WDKA 4O3PA 3T9BA 5IH7A 4QXAA 1GU0A 1U1IA 3LKDA 1WVMA 1MBZA 3WGGA 2GBPA 4TT3D 2Y77A 5FBKA 5DM2A 4R84A 4IDGA 3CB2A 1JG7A 1W93A 4G5XA 3T1TA 1AGPA 3QW4B 4HFJA 2OHFA 2G5GX 2C84A 1YBHA 2VTDA 3P2JA 5DHFA 1QRSA 1VBNA 4B2LA 3FJYA 1H9BA 5T14A 1TT7A 2XPCA 4US1R 4J3FA 2JAQA 4FLEA 2UVUA 2DH5A 1F5SA 2CHUA 1PKEA 4C0ZA 3FHLA 1CIPA 1T36A 1RRPA 4WCFC 3H5NA 2I4RA 2WF9A 5K01A 3MMPA 3AKZA 4KGVA 3KKQA 4JUFA 1GTMA 2H3IA 3RYIA 4FFBA 2H18A 3HXTA 5ETJA 3QBJA 1P1JA 2XZDA 2W6IA 4IZOA 1GNQA 3E2MA 3TLXA 1LI7A 5IH3A 2J6IA 2XWPA 5BW6B 2YZGA 5KWIA 2V1UA 2W00A 2GD1O 3DUFA 2VOJA 1Q0RA 3QWHA 3TZCA 5DNDA 1ACMA 4ZHQA 4PCLA 1K27A 3P2EA 1RACA 4YCXA 3LP8A 3ROEA 4YRSA 2VP9A 4D3DA 4WESB 1GPJA 1VKJA 2WZCA 4FCCA 4G4IA 3GPBA 2I80A 4B48A 5CXSA 5G3YA 1BMQA 4PZOA 3JQQA 3QUCA 3VXKA 4O3FA 1CR0A 2O2XA 3DO8A 3GLIE 3Q1KA 4EI2A 3RVDA 5C0OE 2IIPA 5H1YA 4ZOHC 4HQOA 2WE8A 5IDXA 4RNNA 4EYQA 3KZNA 5FLEX 1G8YA 1C3VA 4DDWA 1OREA 4XQGA 1C1HA 3NHRA 3HVHA 3QPBA 2WV7A 3C5FA 1J6UA 4IXTA 2XNDD 4DR2B 2NRVA 5H8WA 5FKJA 3MJCA 2W8LA 5CB0A 3TPZA 3T0GA 1Z2EA 2O8DB 3ZV3A 4CKCA 3FDZA 1UMBB 4CQMB 1J0DA 4UDOA 3SZUA 3EFEA 2ZIVA 4AZ3B 3PXEA 4BASA 3I5AA 1M76A 5JH7A 1U1EA 2GNAA 2RFLA 1E1NA 1PLLA 2JEYA 1EFHA 4FOTA 2OUKA 3PWTA 1QP4A 2WVHA 2QR5A 1CRZA 1P0QA 4F2HA 1JR3A 3DP9A 1QORA 4TL6A 4EG5A 4LJYA 3NGXA 3N2NA 3H05A 3NNSA 2FPWA 4MI3A 1R18A 2H1SA 4GFDA 2FW1A 4KQKA 2M6LA 1DFHA 3FPCA 1DRUA 3L7CA 3BWDD 2RKBA 4RHUA 3LAWA 4WNAB 3CVVA 2HHVA 5KYGA 1IHUA 2PMEA 4N01A 3EPHA 4X92A 2PRKA 1Z6YA 5BR4A 1N2BA 4R3WA 3A2MA 4I2JA 4HTFA 2VSXA 2DLCX 3F9CA 3KRTA 3BEOA 1GAJA 3UWOA 4PL2A 2D5CA 4M7WA 5CCDA 1QUFA 4QICA 4KO1S 2Q5OA 3GJZA 2A59A 1P1FA 1W4AA 4FM9A 4MW9A 4YDQA 1MZPA 3R2JA 1B0AA 3VJRA 4XX0B 3QYFA 3I01A 2OHGA 1H2XA 2K4HA 1WEHA 3R3SA 2QY6A 1N2HA 1H66A 2ZBFA 4X94A 1JBEA 3QEMB 1GLGA 3PLNA 2AA3A 3PSPA 2VT6A 3TFQA 4QGHA 3IHQB 1Q2XA 2BHNA 3UQZA 3FH0A 1MO4A 3GX1A 4TURA 3M6KA 4KWTA 1SC3A 5EHZA 3FDSA 5IU6A 4O0MA 2A1TR 3I9NA 3QYPA 1X9HA 2PJDA 1TKCA 2EBHX 4X90A 4ECYA 5DCLA 1WXWA 3I6BA 2YWGA 1VBFA 2RE8A 3FW1A 2QUZA 2BDEA 4EFLA 3KEGA 4FNOA 2BONA 1TQ6A 2WU8A 4ZHQF 3BILA 3OOHA 1UM8A 5A62A 1V6AA 1VDVA 3O4GA 1E9EA 2JIPA 5J0WA 5DK6A 4WVFA 3O3MB 1K06A 4S1VA 1J9ZA 4KXNA 1SUAA 3MBKA 2YHIB 1D9ZA 4KI7A 4U6PA 2DQYA 3Q7TA 2G07A 4FFRA 3VDMA 3BGIA 3FRJA 1AK9A 5KNBH 2IS1A 1T29A 3T5MA 1MH9A 1NLMA 5DBIA 1TDJA 3BEDA 2FPIB 4Z6EA 2R25B 5J2JA 3A1TA 1QGUB 4E31A 3PUZA 4RF5A 2A3VA 2PZFA 1ZJ6A 3DTVB 4G0MA 3QX7A 3TARA 1NY6A 3EQ7A 2YQ4A 1OZ0A 9ICMA 1VE7A 1QGAA 3N2YA 3OIUA 2WFLB 1Q16A 5ALTA 4KK3A 3EFOB 3EAQA 1PL6A 4HUJA 2CK3D 1GSHA 5FAXA 5IZCA 5F9LA 5B7GA 4LZAA 3PNKA 1PV1A 2Q2WA 4J9LA 16PKA 4O4HA 2IVZA 2Z57A 4DSIA 2C92A 5DSZA 4F3RA 1OH5A 2BDPA 4IRCA 3B1WA 5KFOA 4PC3A 3UCXA 1VPEA 4LF4B 4WACA 1QH0A 2QZ9A 3FAHA 5EA2A 4EA8A 3AF5A 3BHMA 5CXXA 2OV6A 4Q1AA 5JH7F 4QOFA 1D0SA 4NPHA 4G85A 1QH1A 2LBPA 1KKLA 4ND5A 2P5UA 5HS6A 3SS7X 2Z4RA 4LF5B 1BXKA 1T5OA 3OJFA 3N8IA 4H0NA 3SVTA 3WG9A 9ICWA 1CD5A 1G8HA 2GZSA 2EGUA 3S81A 2HM7A 1SHZA 2QKQA 2HJVA 5LNK1 3SK0A 1UPFA 3P94A 5T6BA 5J0OA 5A9RA 3KOUA 3KVRA 2DYKA 1R5NA 4EG3A 2ZJ1A 4ZI5A 9ICGA 4N0MA 4NCJA 1YS1X 2W6JA 1AQUA 2V59A 3D3QA 1USWA 4JKIA 5TLSA 1OU0A 3QEAZ 4HGOA 1T9CA 3V8RA 2DBZA 1QX3A 2QJWA 5KYXA 4CM9A 4YRPA 3TOVA 1N6LA 5KTTA 1YNSA 5F2KA 5CDUA 3LNCA 3OZRA 2D4AA 1H2YA 5FI5A 1PWZA 1HL7A 1V9SA 2QP9X 1EA5A 5JZ9A 4C7KA 4KO3S 4IDCA 4MVYA 4IFBA 3NVYA 4DL7A 3DFMA 4S24A 4XQ8A 2I0FA 2NO4A 1U11A 3F67A 1DP4A 1DJNA 4JYCA 2RH5A 1TM3E 4DUYB 2VF2A 4FN5A 3HTXA 4M88A 1NVKA 2KHVA 2D59A 4MGYR 3A06A 1RI1A 4MW5A 3DOUA 1V41E 1JZSA 3AF0A 4FSHA 5ITZA 5JRZA 4ZVRA 4TXJA 2ZUCA 5BQ3A 3F5FA 4U7PB 4HYEA 5JSHA 5K3FB 3EXFB 1JI3A 1SUPA 7ICLA 2Q9AA 2NQTA 1SXEA 1LBHA 3LNTA 3K0SA 2VK2A 2P2LA 3GGOA 1R9JA 1BGWA 5KFIA 4IKOA 1SQ6A 1PL8A 4TYWA 2LE0A 1V71A 4X97A 5KHOC 4J9RA 2J5BA 2H5IA 4DANA 2P2NA 3SF8B 3QVMA 4YRMA 4MUBA 1PG5A 3WL3A 1OWOA 5F2EA 3BCHA 4KRFA 2RHCA 1AROP 2OVFA 1E62A 4ALIA 5ITWA 3JQ7A 2R6AA 4N5MA 3SU8A 4IILA 4UBNA 2X6RA 4AY5A 1IOLA 3N97B 1VXOA 4FZMA 5FUWA 5IM5A 1ZXLA 4HDSB 2F8SA 1ZNXA 4BTLA 3TIXB 3FGZA 3E3NA 2ORWA 2OO5C 3TTSA 4G63A 3UT0A 2PUGA 2Z6UA 2BPCA 1YD7A 1SHTX 3B2NA 4O4LA 4CE6A 5F98A 4PXSA 3L8MA 3Q5GA 4JROA 5DSXA 5KVAA 2LDBA 3C3CA 1DI0A 3O2QB 4DA6A 4H7IA 4E1VA 1GGEA 3KOXA 4Y2JA 2V6IA 4G3XA 5ALZA 2R8JA 3MJDA 1PZHA 1JDZA 1P9WA 4QSHA 3ECCA 2IEIA 1I3KA 2FY8A 1DG9A 5JLAA 1YTUA 3FPBA 4GXRA 2NYVA 5BOLA 4Z2AA 3O82A 2EKQA 4TPKA 2XGOA 3B13B 2BP7A 1GZ4A 3QG1A 1HPLA 1ZC4A 4EFKA 2ZDQA 4ZI7B 7ICHA 1MW8X 4MUAA 1VLLA 4YMOA 1V3TA 1PSZA 2VSOA 2XYVA 3D4PA 4Y9UA 4KO4S 5DM4A 3J81k 5K05A 1JQEA 2JA2A 2X4GA 4B3RB 2DQZA 3B38A 3C6YA 1EX1A 2F76X 3TXXA 1MQ9A 4Y1RB 4AYWA 2Q4OA 1JIIA 1L3IA 3GCDA 2W2KA 4MRNA 3T38A 3CUSA 4L74A 1USKA 1CUHA 2D8AA 3PXCX 2KJ9A 2H7YA 3ZQUA 2QLLA 2JLXA 1RPZA 4G25A 5F7JA 5A7FA 3OD1A 4O5EA 1CJCA 2P9EA 4QBFA 1G19A 1SKWA 3U4IA 3EIUA 3ZDCA 4EJ2A 2QLBA 2H5LA 2ZIUA 1UCVA 4IJKA 2Z2IA 4O3SA 3AFNA 1JEJA 4LZJA 4MRMB 5A06A 3K9BA 1JHVA 3OPNA 3KALA 3WYFA 5HDBB 1L6NA 2PTHA 1ULAA 1S5LU 2DUYA 2J6HA 4Q9LA 1M34A 3UKDA 1KDHA 4CM6A 1ABBA 1ZH8A 1PR1A 4GLLA 3BB4A 3QKRB 3BX1A 1KGSA 1Q3UA 3GWZA 1EUCA 4WDRA 3JQBC 1FO4A 1JMKC 4NHOA 2NV2B 2BEUB 1Q0QA 1JZTA 4JSYA 2SKEA 3R8CA 4OQ4A 4DIEA 3QX3A 5JUWA 2HLPA 4NATA 3EPIA 3NM6B 4J03A 3CIOA 1OW5A 2IP1A 5DH9A 4FUTA 2VHYA 1L7RA 4RY9A 2H48A 1YDMA 4UTXA 3BCSA 3I6IA 3S7TA 4D9GA 3JQGA 3R3UA 1XD9A 1RWWA 3A14A 4D0NA 2XE4A 3ONEA 2Y4OA 2FZVA 4B3DA 4B9TA 2E2WA 5IKPA 4ZC1A 1D2HA 4IO0A 2FPLA 3TZQA 3ZDAA 4PZLA 4A2CA 3L0SA 1U45A 4GG1A 4MPJA 1TNDA 3GQVA 2B4AA 2VI5A 4YH1A 3EW7A 2Q99A 3ZGYA 2XMSA 3BQMB 1OXJA 3MMXA 2IOFA 2B1IA 1PZNA 4X1KB 2PXXA 1NK0A 2WICA 4BJ5A 3AQEA 4RDHA 2PRSA 4IC9A 2OMKA 3OLWA 2JJQA 2RH8A 1YDFA 3LWLA 3FFAA 1HDZA 3SX0A 3RVRA 2A35A 4O4LF 1N2GA 1VP9A 4EABA 2KX7A 5GTHU 1N6IA 4MYDA 1H4QA 3FG9A 5DN6D 4DADA 1SRRA 3T94A 5I5EA 3WIVA 3HJGA 2HGZA 3DUWA 2F1RA 4D99A 4BP8A 4G9BA 1SXIA 4U9UA 4LYFA 1X94A 3A7EA 1I30A 1ZLYA 4IDDA 3V6LA 3GELA 4IVNA 1F7VA 4PWYA 5TR9A 3VPFA 3RS0A 1JLMA 3LY7A 5KFVA 2Q49A 2ZR9A 5HBRA 3DOHA 2YN2A 3FAKA 2QARB 2Y1JA 4IH4A 1O94D 3NASA 1YVEI 3G2OA 3KJFA 4QYXA 4M8IA 1SZPA 1SHKA 2JMGA 1ST3A 3PFBA 2PU5A 5FJJA 1L7NA 4X1YA 2ZYUX 4FWTA 1M2GA 2CV2A 1GGKA 3DHWC 5KZMB 1IM5A 2X0RA 2J0SA 2VJMB 2W90A 1HNNA 3PWSA 3IOEA 1FP4B 2GUWA 4RHYA 2P4SA 4X5OA 1KMMA 1ILWA 3I5YA 1P7DA 3QOXA 2H1FA 2YB4A 1ZOIA 3D2NA 2YQZA 3F5MA 2JK1A 2Q6KA 1UXOA 2FVXA 4LDNA 2Y0SF 4Z9AA 4CM5A 1FTYA 3BD9A 4O4IA 5AM3A 1J8YF 1QE3A 1U3FA 3O4HA 5MGNA 3NVZA 3MQ2A 4F2PA 4MV4A 4YT4A 4Q0MA 5T3UA 3C87A 1AJEA 2G1KA 3M5WA 4NMLA 4C8MA 3I32A 5KT6A 5DB8A 4DCMA 1T36B 1PUJA 4QA9A 2O2JA 1AV6A 1SBTA 4HAXA 3KFUF 4DAEA 4RNOA 4Z4GA 1SGGA 3HCEA 5ALYA 4FFBB 3VO1A 4OHOA 5KWJA 2Z04A 4R0MA 2PMCA 2AH5A 5EEHA 4R2HA 2MIIA 2FPKA 3TW8B 2QJRA 3V4LA 3ZDYB 4YPFA 2IT1A 3ZX4A 2FFQA 3N3BC 3NHBA 1V9CA 3TRKA 1EGHA 2A1UB 4FJ1A 1SIWA 4ZT4A 3W2TA 1W9MA 3KVNA 2PRIA 1J8MF 4P84A 1BN6A 2OSBA 3CUTA 2JNWA 4PHHA 4YHBA 4YRGA 3BQNB 1JIHA 1Y4AE 4RQ7A 4GD3Q 2AG8A 1WZ2A 1EZZA 4MYTA 5CFZA 5D85A 5AM1A 1HKHA 4LBWA 5F7XA 1HRDA 3AR5A 4QWMA 4JVSB 4BEVA 2KTQA 2IU3A 2VKQA 2PNJA 2C9MA 3UKJA 5EMMA 1MXFA 2C42A 3IPCA 2EL9A 1X8KA 1EFRA 1RXWA 3AZOA 2GA8A 1R0WA 3BFVA 3DOIA 5J2CA 1MCZA 4K1XA 4BE9A 4UZFA 3CWCA 2X0KA 1BX1A 4GWGA 4TOIA 3Q8RB 1A71A 5JW6A 3QVLA 2A9QA 4XJSA 1KJJA 3D6JA 3U6BA 3E2EA 6CHYA 2DOKA 3HBNA 3LVRE 4REQA 5CT4A 2ZIVB 1D3AA 3ZEIA 5CDYA 1XL1A 2E49A 1YZ7A 4C8LA 4LDZA 5FBVB 4D6YA 2W48A 1HDEA 3K1YA 5T7BA 3OFVA 3KQYA 1I13A 3ROGA 2GEBA 5BV2P 5AUQA 4EF6A 4LHSA 3I2IA 1Z13A 1EHIA 1BCSA 3A6KA 5AUOB 4P4SA 2HIMA 4PLTA 5U4XA 3WZ2A 1HNZB 3UJBA 1OLUB 2AJ8A 3JVIA 1P62B 1Z74A 3H8SA 1RI5A 4XIFA 1VM6A 3AUAA 4F46A 5TXGA 4K9PA 3H5OA 4YR2A 5A1JA 1GA1A 2QRGA 2ZSIA 3TLKA 5CLQA 3VKWA 4HQKA 1YFLA 4OX9B 1RZVA 3MAGA 2OZEA 4UCXA 4TTTS 3X44A 3SZOA 1WNTA 4ZYTA 1XEWX 3GK3A 1J00A 1AN0A 2KE5A 2YC4C 3ZWKA 2D2VA 4Z5XA 3AR2A 3RRFA 3E1SA 4O4IF 2ACKA 3I2GA 2GAAA 1IEXA 3ZXIA 4NOJA 3HA7A 3QRWA 1XTVA 1XI2A 4RZQA 4YLEA 5KFWA 4MKIA 3RK1A 3IOMA 4MUHA 2AKEA 1CZHA 3K30A 1ODCA 5EP2A 2O1XA 3H5RA 1MHPA 2J5RA 2QLJA 3IMGA 2R8ZA 4BY9E 4JI7B 2PWYA 3PUIA 4DXAA 3SVZA 1ZQIA 1W5BA 1EG7A 4LBZA 2CXOA 2WA1A 3FKSA 3MUNA 2ZVDA 4AN1A 5EJ9A 4LZGA 2ZYHA 4JEIA 2IYZA 4DA9A 3I72A 1RM6C 1T4CB 1J42A 5HJ5A 5ALDA 1XHLA 5AIBA 2RGXA 2IZOA 4Q03A 2LM1A 5B5EU 1IMOA 2BGUA 4WY5A 1NYTA 3J80A 2O3QA 3PXGA 3SS9X 3SR6A 3K0HA 4P3PA 1Y9EA 3C7KA 3IYLW 1SPBS 3QTTA 2JJ2D 1WMSA 4F9TA 4M53A 4JP8A 4DKJA 4CEIB 5LQNA 4ZU6X 4RQNA 3ZWQA 2WPNA 1JDSA 3I1JA 4YCBA 3SFZA 1HOTA 1THMA 2R7AA 1U9JA 2C5FA 2BCUA 1SXJC 4Q45A 1ZAKA 4PSKA 4WESA 4HDCA 5KQLA 3N6VA 3FOZA 3KKZA 4AULA 2HGSA 1GYQA 5K8JB 1A95A 2ZXUA 3UHOA 3O90A 1FW6A 4GC6A 3F6PA 1JXEA 4BNMA 3OSNA 2VTVA 4DSLA 1XNHA 3NJRA 2CJPA 2X0DA 4V1CB 3VAYA 1W0JA 3GH1A 1WXGA 5HUHA 2JFFA 1LNQA 4KWCA 1PVPA 1VE1A 2JLRA 1T2CA 1S7CA 3UPDA 5GJCA 1I7PA 4UHJA 5ES3A 3TCKA 3A6LA 2H00A 1N48A 4O4HB 4JBXA 1KF0A 1AUPA 2WM9B 5FL7A 4G0WA 1F60A 2M1XA 4BJ3A 821PA 2RI6A 4B87A 4OHPA 1UBOS 4BO2A 1PX0A 4U7TB 5B3KA 4BQIA 2OCDA 3S2GA 3NT2A 1UMBA 4CQMA 2VJAA 4EA7A 3CRMA 5EJEA 3PD1A 4X8LA 3JQRA 4IPTA 1B14A 4IHJB 3MTAA 4FTWA 1L5FA 3BTVA 4IV5A 3VR5D 1K8RA 4U2GA 3BWBA 4XSGA 2G5CA 2OAEA 3KLNA 3FI0A 4WN3A 1RLJA 3QKSB 5SICE 5J1TB 3OP1A 4RPYA 4FN4A 4IDAA 1QVZA 1X9WA 3GR6A 2I6TA 4YT5A 3VU9A 5K6RA 1GG2A 2GAIA 3H1PA 1DAKA 4RESA 2J59A 4KQJA 2C2GA 2H9IA 1I32A 2H3EA 4RHFA 1SXGA 3AI1A 1CJUC 3ORYA 1JU9A 1BS9A 5FAKA 2B34A 4MYCA 3T5TA 5AXBA 1HE2A 3KT3A 4WNAA 1VDZA 3NEYA 4ZEWA 3QK7A 1YUBA 5KFMA 3NW9A 4ZQFA 4LWPA 4E09A 4JT9A 4IJUA 2WFMA 1DX6A 1GRNA 3TPFA 1TX4B 5IBRA 5DTIA 2VBFA 4US0R 5KREA 2ZBVA 2RCYA 1WWVA 5TF0A 4NOMA 2O0MA 5FYDA 4C0QC 2SECE 1A69A 3WGOA 5M7EA 1JSCA 2D2XA 3BE4A 4NQRA 4NFHA 3JRNA 1RJDA 1E58A 1IVSA 1DKNA 2DWQA 1FDVA 4TMVA 1C7EA 3OZ7A 4Q34A 3PWZA 2HF2A 2AQIA 1NZJA 4BHTA 4JYAB 1A2KC 2XITA 1NVTA 3B6MA 2OV2A 3ZWAA 4F04A 1O7JA 1E96A 4OI2A 3U7GA 4ARIA 1NUHA 2JLWA 5CWRA 1Z15A 3K35A 4ZEXA 4XQEA 3NU1A 1OROA 3ABRB 5KFEA 1I0ZA 1Z34A 1UDCA 2DWOA 3D1JA 1ZJYA 4J6EA 1U7WA 4C7JA 4QXMA 2JD0A 1BYIA 1M8FA 2NPIA 3KM0A 3HGTA 1W96A 2AZXA 3C2LA 1EI9A 3GZJA 3ELBA 3D64A 4AXBA 1N75A 4RKEA 3TUJC 4G41A 1W30A 4UB3A 3H40A 3VHQA 4O33A 5F5NA 5LBTA 4PG5A 4BWFB 3U5TA 1JKMA 1I33A 1CC1S 2ZRGA 4MLDA 8ICIA 4NTZA 5EXDA 3PEFA 4LE2A 3AU2A 1D8BA 3UGQA 4DL4A 2O2IA 4Z3DA 3EK2A 2WNHA 3SJUA 4PN3A 1ZGJA 2FPIA 4RKRA 2C4WA 2AC4A 1RIIA 3WGZA 1QVVA 3DTVA 3BWCA 5EUCA 2IYRA 3EVGA 4FDLA 3KP1A 4WZAA 3LVFO 5I7FA 3TAHA 1WSBA 1QK3A 3EFOA 2OT3B 4M1OA 3VU0A 2AN1A 4YUWA 4GQIA 3FNQA 4CV0A 4ZAZA 3KEOA 1YACA 2P1RA 1BZYA 1NR5A 3ZWPA 2DR0A 4LGCA 4BV3A 1RFGE 2BP7B 5HKKA 3EARA 4E7OA 4U5XA 4R68A 3M9WA 3L5OA 3KPWA 4ASUD 1PEDA 5CT8A 3EPPA 4MW0A 1ZQUA 4QXPA 1ZM3A 1ULUA 4FZJA 3GRYA 1PE0A 2N3ZA 2OGSA 1Q1EA 3T7JA 2JGKA 1BHSA 3IUYA 4DSUA 3ZWMA 2ZT6A 3ULKA 3GFQA 4CL8A 3LLCA 2X5OA 1XVVA 1DCMA 4IIHA 4R2WA 3FNGA 1OFUA 4F1JA 3KX2A 3ONNA 5L3ZA 4FW9A 3QBDA 1MOZA 1IN5A 5FJIA 3H8WA 4L85A 5KJEA 3AL2A 1U0RA 3BGVA 3UJHA 4K3VA 2ZIUB 3ZNOA 3LW8A 4OJYA 3VSCA 1G0OA 3HFRA 2KLBA 2XOXA 1SOUA 1HLGA 1WQ4A 3H84A 2GCIA 1XU7A 2WAXA 3PW5A 2R4UA 3OQMA 4BRUA 1WXHA 1FUKA 4X7BA 2YQ5A 1M34B 4I2BA 4F4KA 2FMKA 4EHKA 4F3NA 4G84A 3ZHYA 3S7ZA 1GDHA 3P32A 1DHTA 1L4KA 1XYYA 3L7OA 1OT5A 5LBUA 2K5UA 4X6LA 1W49A 3JD2A 4LHVA 2W6OA 5THKA 2J1LA 3RUEA 3B82A 2GCGA 4KL8S 4KMRA 4DIFA 7ICOA 2YMQA 4BNHA 5FTNA 4TTPA 2XKBA 4DCCA 1P4SA 1TZ2A 1ZLXA 4QO7A 2K4EA 3X0DA 2JFNA 5KFBA 3I28A 4BATA 3V8NA 4FO6A 2Q62A 2ZUSA 4OGFA 4RF3A 4DRZA 1R0SA 4TMXA 4GT1A 1AC5A 1GU7A 3S70A 5A7HA 2Q5HA 3VYWA 2FQXA 1N2CE 3JQGB 3M34A 2WAQC 1VRWA 2CF5A 2BMEA 1HDXA 1N9KA 4TRJA 4BMCA 1I4TD 2KMLA 4PSVA 4TROA 3SF8A 1PTJC 3RVBA 3QM1A 4UUOA 4COOA 5EJ2A 2NU6A 2DUNA 1RQ7A 1DB3A 2NXWA 5G1OA 3K0AA 5AVWA 3BRWA 1VLBA 3KJHA 3MB8A 1XZAA 3AC0A 3AG5A 5EG5A 4BEJA 5JJKA 2IA5A 3O26A 5DLDA 3DGEC 3G8AA 3U4AA 2ZIZA 2OB2A 1XTRA 2AOWA 4HH0A 4GFJA 2L82A 3RIXA 2OFOA 5J0XA 2FXVA 1H1DA 3GFRA 1P1CA 3M82A 2PQ2A 4XA8A 3TLJA 5BR7A 2BSAA 1PJ3A 4BFUA 5DW3A 3HL0A 1J7KA 1WVGA 1U49A 3VHXB 3WA7A 1J5XA 3SHWA 3QPDA 4F8EA 1XMPA 5AW6A 5T64A 2NZYA 3IJEB 4JYPA 4M1TA 1TO1E 3AUKA 1KEZA 4PZNA 4X65B 1SKMA 1MPXA 1VMIA 3FIUA 3NI2A 1ADYA 1IBKB 1DFIA 4AKTA 2XGPA 4NY1A 4GNKA 2GI4A 4OHFA 3PSFA 2Z9BA 4HPXB 1ZN8A 1EXNA 3IBCA 3BHJA 4DDHA 5IM4A 1YASA 4KITB 1NMYA 1A50B 4F4FA 4X1YB 1S5PA 3B52X 3VH1A 2R66A 5LL6P 2VPZA 8ICSA 2BW0A 1ZQXA 4MWGA 8ICJA 2Z1DA 5CNJA 4ZI7A 2WWXA 3FROA 2NYAA 3HXLA 1V7PC 2QM8A 4QYIB 1K8XB 1D6NA 4LECA 4I2EA 2P4EA 7ICKA 1NASA 4B32A 1J7JA 5JTIA 4H35A 3NHJA 2TYSB 3E70C 3WKDA 5FNZA 4NRDA 5A2GA 3CPJB 2IYSA 2CVFA 1G55A 2FGJA 4F4WA 2DE0X 4ZDJA 3QSYA 4AF7A 4RBNA 5BVHB 3NOXA 3R7FA 1N1EA 1CLEA 1FDWA 1ZICA 2WTEA 2R79A 3RAQA 4RTKA 2WTFA 2ZU0C 4QEDA 4AY2A 2FHSA 3K9QO 1V48A 1Q3HA 2XD4A 4R1QA 6ABPA 1NVVR 3BKWA 2K6GA 1L5ZA 4USAA 1PJ8A 2RKOA 2PX8A 4BWGA 4U2KA 1Z88A 5TJHA 2O14A 4EVIA 4E88A 2QF7A 3V7YA 4J9NA 2ZDHA 2ZSFA 2GJKA 1Z7BA 1G8KA 4ESEA 1P6XA 2QQEA 1FNDA 5FPQA 1B22A 3DV0B 3QKRA 3C45A 2HA0A 4XQCA 5C35A 1UOQA 2N1MA 4Q4AB 1ZXBA 3QMVA 2BEUA 4PH5A 3H2ZA 5DNVA 3Q8PB 1OU4A 1ZWLA 5F51A 4MFAA 3AI2A 2W6ID 1F8UA 4GS5A 2H16A 1OYYA 1TTPB 4XM0A 4ECWA 4Z7QB