3KD3A

Crystal structure of a phosphoserine phosphohydrolase-like protein from francisella tularensis subsp. tularensis schu s4
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
216
structure length
216
Chain Sequence
MKNIIFDFDSTLIKKESLELILEPILQKSPAKLKEIEYITNLGMQGDISFRDSLQKRLAIASPTKQSIKEFSNKYCPNLLTDGIKELVQDLKNKGFEIWIFSGGLSESIQPFADYLNIPRENIFAVETIWNSDGSFKELDNSNGACDSKLSAFDKAKGLIDGEVIAIGDGYTDYQLYEKGYATKFIAYMEHIEREKVINLSKYVARNVAELASLIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a phosphoserine phosphohydrolase-like protein from Francisella tularensis subsp. tularensis SCHUS4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Unknown function
molecule keywords Phosphoserine phosphohydrolase-like protein
total genus 74
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12710 HAD haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 3kd3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3kd3A01
4HGQA 5AI6A 4EZEA 4ZEVA 5ALKA 2HHLA 1FEZA 3N8GA 2AH5A 1RQNA 5AESA 4DW8A 1RKUA 3ZX5A 3EWIA 5AKJA 1RC8A 2PKEA 1ZD4A 2ZBDA 3QXGA 4XE5A 2CFRA 1Z88A 2OYCA 1RDFA 2JARA 3AR6A 1QQ6A 3PCTA 1NF2A 4KNWA 1TJ3A 3QGMA 1Q91A 5AM0A 4FYPA 4AP9A 2WF5A 2YJ5A 3QU5A 5AKEA 1QQ7A 2WHEA 4L57A 3W5DA 3QUQA 3AR2A 3L8GA 2HCFA 2B1QA 1SWWA 5A3RA 1L6RA 4G9BA 2IOFK 3KBBA 2P27A 5AVVA 4KNVA 1YNSA 5AW5A 4UMVA 3UM9A 3WK4A 4CF4A 1ZS9A 3OCYA 4OCZA 3WK8A 5AI4A 2I54A 1J8DA 4JB3A 3J7TA 5ALGA 3GYGA 4FE3A 2YJ4A 3ZUPA 2VKQA 3UMCA 3IRUA 5AVWA 1N9KA 5AVRA 3DNPA 3EF0A 1VFPA 4OD0A 2EAUA 2ZG6A 3KZXA 4KX3A 5ALWA 2R8ZA 3VAYA 3R09A 2G07A 3ZVLA 5A3QA 5AHXA 4UM5A 2PR7A 4BKMA 3SKYA 1RMYA 5ALJA 2FPXA 2C9MA 4DFDA 4HGPA 5AI8A 3WK9A 3U7HB 2OA0A 2G80A 3MMZA 2FPRA 2B0CA 3N5KA 5AM4A 3A3YA 5ALHA 3PGVA 4NFLA 2ZBGA 3QNMA 4I9GA 2YY6A 4CF5A 1L7PA 3AR5A 3DAOA 4GIBA 4EENA 4Y2QA 1RMQA 2R8YA 1XVIA 5AW1A 4DCCA 4QQFA 4MWOA 2AMYA 3MPOA 2FUEA 4EX7A 1J97A 5AW3A 2ZOSA 5AVUA 1ZOLA 3WKDA 2B82A 1SWVA 3U7EB 2G09A 3AR7A 3WKEA 4UASA 2HOQA 3OCVA 2OBBA 3NASA 3W5AA 2IOFA 3QUTA 1L7MA 4KX5A 5ALLA 3L1VA 4C4RA 2Q5EA 2I55A 1X42A 4YH1A 3I28A 4OFZA 1WZCA 2ZBEA 3N1UA 3SMVA 3F9RA 1N8NA 3ZTYA 3BWVA 3W5CA 1RKQA 1Z4KA 5E0OA 3FPBA 3ET4A 3QUBA 4HYTA 1U2TA 2CN1A 1EK1A 4G63A 4BBJA 1JUDA 2OM6A 3ZTWA 1T5TA 4EEKA 3UMBA 2HEGA 1RKVA 5ALPA 3ESRA 1ZD3A 3FPSA 5AKGA 1YV9A 2O9JA 1RPZA 2RARA 3QLEA 4RESA 4IFTA 3E81A 3L8EA 3ZU6A 4O8CA 3WK7A 4YCMA 3ZWDA 3SD7A 2B30A 2R8XA 3SHQA 3E8MA 1YS9A 3S6JA 3FM9A 3OCXA 2G08A 2FPUA 5ALTA 1KYTA 3A1DA 4CE6A 4BEWA 3FGOA 3BA6A 1F5SA 3N28A 5JJBA 1S2OA 5AVSA 3AR4A 3FZQA 1WR8A 2GHQA 3CZ4A 2NYVA 3RFUA 2RBKA 1ZD2P 1Z5GA 3NALA 4UM7A 5ALRA 4DWOA 2FI1A 4L6AA 1Z4NA 5AW0A 2IOHA 3ZW7A 2HF7A 1ZRNA 4Y2RA 2B8EA 2IA5A 5AVTA 1SU4A 1WPGA 4HGRA 3OCWA 3M1YA 4F72A 4BNDB 3WGUA 1YJ5A 3DDHA 3ZVMA 3QU7A 5AM5A 1ZJJA 3ESQA 5AI0A 4H1WA 4CNQA 4YIHA 5AVQA 1NRWA 3EPRA 1VJ5A 1YMQA 1O03A 3WKAA 5ALNA 3DV9A 2YJ3A 1CQZA 1L7OA 1VJRA 2W43A 1LTQA 4KN8A 1QQ5A 3N07A 5A3SA 2CFTA 2NO5A 5AW7A 4PNHA 3U26A 1S8OA 1K1EA 1Z4MA 3L8HA 4NWIA 2B8JA 5AK6A 2BY4A 5ALFA 5AK4A 2I6XA 4BX3A 4CF3A 2WF6A 3NRJA 4EELA 1RRCA 4J03A 3PGLA 2ODAA 4BEVA 2FEAA 1Z4QA 2MU1A 3NUQA 3OCZA 3IJ5A 1TJ5A 5AKYA 2CFSA 2DQSA 3E84A 4J2TA 2JAUA 2HO4A 1Z4PX 4BNDA 2GFHA 4HGOA 3UMGA 2W11A 1ZD5A 1CR6A 5ALDA 3QX7A 2YMLA 3ONNA 5AKZA 2YMMA 3P96A 2C4NA 2C8LA 2RAVA 3WKBA 1TE2A 2HDOA 1Z4JA 3ED5A 3AR8A 2I33A 4XQ0A 1U2SA 2YN4A 3ZVNA 2C88A 4ZEXA 4Y2XA 3L5KA 4Y2SA 2HX1A 5AKHA 4UARA 1AQ6A 1Z5UA 4UAVA 1IWOA 3L0CA 3E58A 4Y3UA 5AKIA 1TJ4A 3WKCA 5AW9A 1RQLA 5AKXA 2W4MA 2GHTA 5AI9A 1L8OA 1T9ZA 3MC1A 2YBDA 5AW4A 4UATA 4HAIA 5AIAA 1Z4LA 4C4SA 4YCLA 4HGNA 1T5SA 2YFYA 1XPJA 1EK2A 4C4TA 5ALOA 1MH9A 1LVHA 3QYPA 4KYTA 3K1ZA 2WF9A 4RETA 2JGAA 4QJBA 3WK5A 4I9FA 4UW9A 5ALVA 3AR9A 5IS2A 1Z4IA 1NNLA 3I1YA 3U19A 3IB6A 4Y2JA 3W5BA 2G1AA 2EATA 3U13A 1TA0A 5AK5A 2QYHA 3RF6A 2P9JA 1YDFA 4NV0A 2BDEA 2D2VA 2JAOA 2ZXEA 3TLMA 2AGVA 5ALQA 2BDUA 4Y2VA 4OHFA 2WF7A 2HSZA 5AW8A 3L0BA 3L8FA 2RB5A 2YJ6A 5AK3A 4BYGA 3ZWKA 3AR3A 4ZEWA 4UMEA 2WFAA 4BX2A 3OCUA 2Q4TA 2YMPA 3KD3A 5ALYA 1RLMA 2P11A 3FVVA 3OPXA 4MUMA 3U7FB 3MN1A 3QUCA 5IT4A 4UAUA 5ALMA 1RLTA 3NIWA 2FUCA 1Q92A 2FDRA 3I76A 2HF2A 4E88A 4YIKA 2YMQA 4Y2PA 2HI0A 2JAWA 3WK6A 1Z4OA 2NO4A 3B9BA 3OTQA 2C8KA 2WM8A 3ZI4A 5IT0A 1O08A 2GMWA 5AW2A 5AKKA 3EF1A 4YCNA 3SKXA 5AVZA 3NAMA 4XPZA 3ET5A 4Y2UA 4Y2TA 4UU0A 2O2XA 4FFDA 2QLTA 5ALUA 3SF0A 1PW5A 1Y8AA 3B8EA 5T41A 4UU1A 5AW6A 5AM2A 2FPSA 5AICA 5AM1A 4UMFA 5AI5A 5AM3A 2I34A 4IG4A 1XP5A 2EARA 3L0YA 1U7PA 2PQ0A 3SLRA 1QYIA 2I7DA 5FP0A 5ALXA 3A1EA 1RMTA 3D6JA 3KC2A 5ALSA 1L8LA 1QH9A 3KDPA 3PDWA 3KOOA 5AIBA 1WVIA 4EX6A 3A1CA 5ALIA 4JDPA 4F71A 1U02A 3U7GA 5AKLA 2B1RA 2MSNA 2R8EA 5AVXA 3WGVA 3R9KA 1RLOA 2Q4RA 1U7OA 2GO7A 4GXTA 3ZX4A 3HYCA 3M9LA 2FPWA 3L1UA 4AS3A 3HLTA 2AUTA 2P69A 3R4CA 4NAVA 4XOUA 3B9RA 3QU9A 1ZRMA 2WF8A 4YGYA 5ALEA 5ALZA 5AVYA 3L7YA 3QU2A 2IYEA 3CNHA 4UMDA 4BX0A 3QU4A 4Y2YA 4AS2A 1L7NA 4B6JA 2X4DA 2G0AA 4L6CA 4NABA 2G06A 3I6BA 3NANA 2ZBFA
chains in the Genus database with same CATH superfamily
1GV0A 5COBA 2NV2B 3MTJA 3VKWA 4BQQA 1FEZA 2Z5LA 2O7NA 4P3XA 5EINA 4B80A 3KQNA 4BUJA 4TUYF 5FTNA 2PBFA 3CR8A 4JSYA 3RV4A 2C2DA 1DXQA 4QW9A 1SMKA 3HN7A 5EMLA 3SE0A 2OV6A 5BWBA 5T4EA 1IQPA 4Q37A 1DK3A 1JEOA 3N8IA 2H5JA 2O6KA 2Q2QA 1Z29A 1Q7GA 5CK5A 1E6LA 2O20A 5GTDA 5K45A 4RXUA 2X40A 2ALJA 2EC5A 4TTPA 1RXWA 2FGKA 3W3ZB 1DSSG 4DC1A 4MRSA 4TROA 3IV7A 4YMVA 4C0JA 1XEWY 1SPBS 3CE9A 2QYSA 4UKDA 3ZJVA 2ET6A 1A8SA 1R10A 1W4RA 3LQRA 1N6KA 2DY1A 2RC5A 4FC6A 1LF5A 3PEYA 4USAA 1DS6A 3DNMA 1X1BA 4DNQA 3NTOA 4PQRA 3TFSA 2BRUA 5FAXA 3H0EA 4O4HA 2O52A 2CYCA 3TAUA 5CU7A 5FUMA 3IAAA 4FBMA 4W6QA 3HKDB 1JLHA 4MRVA 3Q0EA 1Y1LA 3W4IA 1X19A 3L8GA 3EISA 4UE3S 3IELA 2CB0A 2B1QA 3WWYA 2BTEA 1OSNA 3ZDCA 4R2JA 3V2GA 3MBYA 3PUHA 1X74A 3D4IA 4YRQA 1LDBA 1VXRA 1ZSNA 4KLUA 2V7WA 4UUPA 8ICHA 2VF4X 4XSGA 3H3FA 4XGNA 3RJGA 1EFVB 1T0PA 2SNIE 3OLXA 4OCZA 3C5GA 2IIPA 1JXMA 2XXBA 3R7LA 1P80A 3SU8A 2A6PA 3KXKA 3NO4A 2GA9A 4KIFA 4ALIA 1DOAA 4BEJA 4U7HA 4EA8A 5JYBA 4GP9A 5CNKA 2YJ4A 4UTVA 3EE6A 4OQZA 2F3RA 4YJ3B 3X0DA 1ISSA 4KLGA 1D7AA 4GZ6A 5E3JA 1A96A 2OYYA 1BRMA 3NGDA 2VPTA 1J0CA 1XV5A 3O0DA 2GZ3A 1VKHA 2E1RA 3QE3A 4MYRA 4TLCA 4R98A 2YS7A 3Q0TA 1S7GA 4U6PA 1Y1KE 2NVUB 1VFPA 1XVTA 1ODJA 4KBFA 2ONZA 4A0RA 1TGYA 4BLQA 5IF9A 4GC6A 2BI8A 4DOMA 3DDSA 4WX2B 2YWFA 3MG9A 5TZVA 5DQGA 4D99A 5LJIA 4JEMA 5JXJA 4OUKX 2GWSA 4UM5A 2WE8A 1SPXA 1U9LA 1JAIA 1RMYA 3V8QA 2ZJFA 2XNCA 5BPCA 4YFKA 1RQXA 3KWMA 4PLPA 1NYLA 4JB0A 2WIFA 1NSFA 1QF6A 1HKUA 1YBAA 2FPRA 1F48A 2X6QA 4F4ZA 4KTQA 1M9NA 2RGAA 5CG1A 4YR9A 1WNFA 5ALHA 5E2AA 5F5XA 4I6GA 2BPOA 4R01A 3HY4A 3HO6A 5DGBA 2AC2A 3WLHA 3Q4GA 2ZR9A 4P1ZA 2HO5A 3D1LA 3ETNA 3GJSA 4L6IA 1EINA 7ICJA 1NWHA 2LR0A 2O1WA 4GSKA 4GIBA 4PAWA 2O6LA 4RDCA 3DBRA 3TOZA 4Y2QA 4RO0A 2WWGA 3WGGA 1EESA 1MVLA 4DCCA 3O21A 2DHEA 4B9SA 3DZHA 4UD6A 4D5GA 1CUKA 2FKAA 3GQVA 2VDVE 5A5EA 4KWIA 3SSNA 3TPZA 3Q8SB 4NU5A 1NK5A 2M6SA 4Q1VA 1FVHA 2BCGY 3BSFA 3C3AA 3KXDA 1A0OA 2J4CA 3OPQA 4UUQA 1OQAA 3RYIA 4YO8A 1KN5A 2IYZA 1WW2A 3UV3A 1QP7A 4NMHA 2XB2A 4PGYA 1AN0A 4LSGA 2W9MA 3M82A 2O2DA 5IT5A 1G6KA 2QVGA 5IXJA 4CXMA 5CVEA 1GQSA 1M2NA 3BZKA 1W75A 1Z28A 2F43A 3RHFA 2EOAA 1TK9A 2YNMD 2KD1A 4RJTA 2PV7A 2PZAA 3TL3A 1MPTA 1HLFA 3C7DB 2HOQA 3M1AA 4AFNA 1ZI6A 4OGFA 2NUAA 4S1PA 4RKFA 5K51A 2XQKA 5BY2A 5IYZA 1QG6A 2ZRNA 1WG8A 4V24A 2W00A 3GZNB 2E4YA 2B6GA 3DHVA 4O5CA 5K0EA 2J5KA 4JLBA 4EYSA 3LUDA 1BE6A 4MARA 4HFJA 4EAAA 3I1JA 3SXPA 1BTOA 2AK2A 2EEPA 5F5LA 3TSCA 1U9CA 3H9EO 1VPTA 3SZGA 4E07A 5FPSA 2X0DA 2C28A 1GXSB 3VU1A 1XZNA 1RQRA 3MGHA 1UKCA 2GRAA 3HB0A 3RYIB 2PV0A 3MRVA 4YRGA 3PPVA 2V9WA 5H83A 3RABA 2D1YA 1XO0A 2JHDA 2P8JA 2VSXA 4WCDA 3RVMA 3VOSA 2XWPA 4TYWA 1L3CA 3W5CA 1RRMA 3BWVA 1U45A 1X80A 1O0BA 3UQZA 3H84A 4ZI7A 5JJLA 4OUDA 4RPLA 1M2VB 3K1JA 4LGCA 2OWOA 2QPOA 1KOJA 3B1JA 3D8BA 3ET4A 3T5DA 2WSSA 4OHVA 1TCBA 4V39A 3ZTTA 4PSKA 1U0JA 5HIAA 2C95A 2BGRA 2RCNA 1DKOA 1I0ZA 2P4QA 4CIDA 1EFVA 1E3MA 4EBEA 4IS2A 4X8OA 1C3EA 4GD3Q 4IDPA 1GG9A 3O2NA 5B37A 4LE1A 1CEQA 4NPAA 4RF2A 3UMBA 3VHRA 4AX4A 4F1JA 1NT2A 3F7NA 3E9CA 3I1IA 1Y8RA 3CCFA 3FPSA 3LPMA 4P34A 3WMRA 2O9JA 2RHMA 3NIBA 1XG5A 1YB2A 2PX6A 4QYMA 4ZKDA 2VYND 3RAEC 1W8DA 3KLNA 1UMCB 3OWOA 3HVUA 5FIUA 1SHLA 3L8EA 4YCMA 1KJNA 4J2OA 2VSYA 4UHBA 5B7NA 1Z0KA 1RQGA 1E2KA 3M5DA 5L4SA 3CX6A 1Y9AA 4CHGA 1D9DA 1WQ3A 3F67A 2L5YA 1ZQHA 1Z3EB 2BPCA 4F4KA 3LYUA 3O4RA 2I8AA 5DCYA 2E87A 3W4KA 5ESWA 2WAAA 3PV8A 2V55B 4BNZA 1KYTA 3JYNA 3OU6A 2Z8XA 1X15A 2GM3A 5LBUA 3ZNQA 1XX6A 1I51A 5JNWA 4ECTA 1OREA 3PXCX 5LQKA 1N8KA 3EBLA 3TFOA 1VBFA 2DE0X 3KR9A 2AN4A 1I36A 3INRA 1EFDN 3I0MA 4TWJA 5L40A 4HGZA 2WKPA 4OG2A 3C41J 5CH3A 2K2WA 2Q5FA 4BMVA 3GEBA 1USVA 1DJQA 3CW9A 4TMZA 3IC5A 4AWAA 5J4YA 2OHGA 3HYNA 1W5EA 1CJCA 2TMKA 1L8AA 4RH0A 4LGMA 1JVBA 3NP9A 1UINA 1Y3DE 2ZI3A 1H23A 2IOHA 1U0GA 3ZW7A 3BK1A 5HGJA 4A10A 2FZGA 4KXUA 2XAAA 4Q4HB 3AHCA 3GD5A 2ZITA 1XMVA 1AN9A 1B42A 4HDMA 4Q3EA 4GBJA 2GM9A 4PZZA 2UUBB 3BMOB 1JQLB 4ND1A 5BQPA 4PL2A 2AJQA 2VLBA 1M1YE 1E4EB 1SK9A 2A5YB 3ROEA 4YUYA 4BGUA 4Z4GA 2IKSA 3UXOA 1DUIA 3JZMA 1ZY2A 2B3TA 4HDRB 1XAHA 4X1KA 5B2ZA 1D2AA 4IH1A 4KE6A 2VN8A 3ESAA 4E7OA 1XZPA 1HDXA 2W8BB 2UYHA 4DSAA 1VLHA 5ICGA 1PWYE 1Z5PA 4G5GA 5DLQC 3TG8A 3GVXA 2XUQA 3OO0A 2I2WA 1Y6QA 4BX9A 2H00A 4PU0A 4EKGA 1A4IA 4CEJB 4UB4A 2PFNA 3JPPA 4PX9A 3C23A 4IUCS 2WB4A 2HDNB 3N07A 4MPJA 1LBHA 1X0VA 2JPDA 5GY7A 4GC7A 4G0ZA 4OFBA 2OV2A 1P9NA 5IX8A 3GUHA 1UK7A 3A1TA 1M7BA 3I5UA 4JC5A 1T2UA 1W73A 3TQRA 2FR8C 2A1JB 2R68A 3G8DA 4GBGA 4RE5A 3AVUA 4M4SA 3HU5A 1LLUA 1TF5A 3VPDA 4ALMA 1JHYA 2DHCA 1Q21A 3ONWA 4V0NA 4DDVA 3FCSB 1GR0A 4Q3KA 3MJHA 2B5VA 2OV8A 4JBLA 4C78A 1DCTA 4M46A 3VAAA 3EGDA 2RGYA 9ICFA 3FOBA 2ERYA 4HDKB 4ZQIA 2ZR8A 5BNWA 3D4NA 3PCRB 5CX4A 4MB0A 2YY5A 2YY7A 3KZMA 1YL7A 1YCHA 3PUXA 5JD6A 3NHLA 4BTEA 2BFEB 4IQGA 5CYGA 3O0TA 1QS0B 4UCWA 2HBLA 4OSEA 2PMDA 2J5QA 3ISVA 5GOTA 1G5QA 3WKBA 3EQ8A 2FQ1A 3L0DA 4PCLA 1KZ7B 1L7BA 1QLJA 3LQYA 5KEIA 2I3GA 4INZA 1MGPA 3TADC 1EKXA 1MTZA 1YHYA 2AG0A 3OZCA 3A4NA 3ZIDA 3FWPA 3E3NA 1ONNA 3ND8A 3W2EA 5HSGA 1UCFA 3LCCA 4N3NA 5TF0A 2XQIA 5ED4A 3TOXA 4QT0A 1G3IA 2WLTA 2LXNA 4NR0A 1O4VA 3QVTA 3PKIA 3HJEA 1WE2A 2OHJA 2VJ5A 3N75A 4TVOA 4Y3UA 3C39A 1ZQ1C 3WB0A 4X64B 2H2IA 1XXHB 3JS5A 2DXIA 5ER6A 1ILWA 9MHTA 1ZAKA 4IZIA 3LP5A 4ECVA 1RQLA 3HJUA 2OR3A 4MYHA 3UXMA 2VS1A 4WJKB 1WM1A 2UVVA 3M8SA 1T9ZA 2FWJA 2TRSB 1VMKA 2IFTA 1W5FA 3FB1A 2OKCA 5JQGF 4PS1A 4PHFA 5BOSA 2R4TA 5KYUB 4JI7B 1V16A 5F77A 4S24A 4C4SA 4CM1A 1K5PA 4IXDA 4GOLD 2CDNA 2GOLA 1KK1A 1XTUA 4M7WA 1FMTA 2DPYA 4R9UC 4Q16A 1IIPA 4EJSA 3FYDA 3G82C 4R2WA 5KYGA 4QUEA 1SU7A 4ZCQA 5KFWA 3SMQA 5CFLA 4J9PA 3W04A 1ZMOA 1XTKA 3PITA 3K9NA 4UAWA 4DBLE 1NURA 3TZBA 1NNLA 3TFRA 5KFHA 1K8RA 4AZVA 3MFIA 2VP9A 2YWCA 1NHGA 1WXWA 2JLXA 4QZIA 1XE3A 2CXPA 5ILGA 1AMOA 1LBEA 2EFGA 3TRJA 2PZKA 2QMUA 3N2KA 1F1JA 3CF6R 3F5AA 7ICEA 1O8BA 3LA8A 4YJHB 5DFAA 2VBFA 4RMNA 3TINA 4CV0A 4ZOLA 4HKTA 1TQ6A 4C30A 3WWPA 1B6TA 4RSRA 4FI3F 4D6XA 1BX0A 2J5XA 4KQCA 4RAOA 4CKEB 5EZSA 4CQJA 1PL8A 1CUGA 2JAOA 3AUTA 1SXJA 1IY8A 2EGGA 3CNEA 3MS4A 3DLCA 1U3CA 4G4GA 4UNNA 3W78A 3ZNOA 4I14A 3T7KA 2KZ3A 1QK5A 4CVNA 3PQEA 2YKGA 5A62A 4LIPD 1H3EA 3HT3A 4KIWA 5E1MA 2XECA 2NT4A 1Y7PA 2Q3MA 1OXXK 1U0FA 1Q1AA 1YA8A 2XCLA 3G2PA 3HP1A 2Z6AA 3LZ6A 4DLVA 3KSAC 1LDYA 3AFOA 4HMPA 4UMEA 3EC7A 2Y05A 3BRCA 4UCXA 5D7BA 3T5HA 1BO6A 3AEKA 3DE3X 3T06B 1FLAA 3PICA 1AKQA 2B61A 2GBIA 3ZVKA 1XFDA 2G04A 2P7HA 2RH5A 4NKRA 4OXQA 3C8UA 2C4MA 2ZIXA 1XMQB 8ICUA 4B4OA 4LS3A 4EB6A 4YG2A 5AQ1A 2CDAA 2CXOA 3WLTA 4BGEA 5JD4A 5ESXA 5J0SA 1WEHA 3FMOB 1JXEA 3ZD8A 1N5XA 4H35A 4NFHA 5FOSA 2VA2A 5GZ6A 3TRDA 2VP3A 3E61A 1I1HA 1I3LA 2FN4A 1QFMA 1R3DA 2QQ5A 4YBRA 3TB4A 3WOVA 4E88A 5EJ4A 1QC5A 1V26A 3I39X 4TTTS 1IY1A 4FDVA 3WK6A 4R7GA 2DWPA 2H2WA 4O8ZA 4QTTB 4A5SA 5AUOB 2YWXA 4HSEA 1ZCZA 3BXHA 5H0IA 5KNBH 6GPBA 4IYJA 4LF6B 1JQ5A 2H29A 2BCJQ 4M9HA 2K4PA 1EP3B 1QDUA 5KVSA 5KYTA 4A15A 3C6QA 3GUVA 5DKFA 1KORA 4JV0A 3BJEA 3CNQS 3D7MA 3WRVA 4I19A 4BKQA 1UFVA 1FRZA 3HBLA 3R23A 1DIOB 3FKJA 2E5LB 2E21A 1EUQA 5T41A 4UU1A 5J2TA 3MOSA 3CRQA 3OFSA 4K0RA 4RF4A 5AW6A 1NXTA 3A0BU 3RFCA 5DSTA 4I2HA 5KNBD 1M1NB 5AM3A 3F5SA 4GPEA 4KL8S 2FMFA 3GDGA 1I24A 4IG4A 4LBWA 4BZZA 2BZGA 2XMCA 4BQIA 3NORA 1AROP 2GJSA 3ABOB 721PA 1N3BA 2FZWA 3Q41A 4JBHA 5L95A 5IABA 3F3MA 3LT4A 1Y81A 1HTWA 3KELA 3TZ6A 3KC2A 3SEZA 2ZUBA 1AY0A 4MQ6A 4HEA6 2YB1A 1IRXA 2RB4A 3KOOA 2DSNA 5AIBA 4RF5A 3SX4A 1RCUA 4Y67A 3UG7A 2Z2XA 4CRXA 1EHCA 2PZJA 3FSEA 3CN9A 1ZQ1A 4BC0A 2VJYA 2YX8A 2Z8YM 3BDIA 2XWJI 5C8YF 1K8YB 2PMWB 2ZIVA 3B5JA 3OX2A 2MSNA 4R2KA 5TQVA 3WYEA 1DBSA 1NX6A 3H7AA 4B3XA 3AP2A 2DHQA 5TVKA 4ENRA 4L3VA 2G5PA 1L6IA 4EFDA 2DWQA 1QB8A 1YR3A 5DI9A 5HKKD 3IEXA 2VBGA 4TQRA 3T5CA 4IAOA 1V8FA 2A92A 4MUFA 2OXIA 4WACA 4CNBA 4KRFA 4FNAA 1RJ9A 1V9SA 2NSYA 1F1BA 4F56A 3KG2A 3JPQA 3U17A 2F55A 3FHJA 4L27A 3V4VB 2KBEA 5FR1A 3GZFA 4JENA 3TANA 5G4KA 5KG5A 2QRPA 3ZDYB 4LSWA 3VX4A 4GXKA 1QU2A 1GCUA 2QNBA 3RANA 1CUBA 2COKA 1ND6A 4GFDA 4O5OA 4HWSA 5KDDA 2Y0DA 1KKMA 1IB6A 1NG1A 2O8NA 3PYMA 4RHUA 1W1UA 4WECA 1XSLA 1GNLA 4GPD1 3QTTA 5LZ4A 2WKQA 1SOVA 4LISA 2Q4BA 3U3MA 4M0UA 4QPDA 3TGLA 1XVAA 4FKZA 3NAZA 2VZ0A 2ZBUA 2EVWX 1P73A 1GGHA 5KTNA 3GLGB 1KK3A 1MFPA 1Z16A 2BVNA 5HNKA 1Y7LA 3ISJA 4BB9A 2ZRLA 3KP1A 4TVBA 2ZYWX 1I6MA 1YZUA 1ABFA 3F7TA 3KWJA 1RT9A 4WN9B 5DHFA 5EPOA 3UEOA 1U7DA 5DW3A 2EKPA 3W2HA 1MOSA 1A9TA 3VO9A 4M0PA 4QZBA 4N03A 1W6RA 1BGWA 3NC0C 3USES 2NSHA 1S02A 1MQ2A 2PKEA 1DUVG 1G2IA 3N0WA 4U7TB 3ALRA 2QIPA 2YV2A 5TGDA 1J2TA 4BVEA 3DCJA 3ILHA 2P9BA 3QE4A 1T8TA 4ZYXA 2GDJA 1BPDA 1NPDA 2NO9A 5I48A 3N5CA 2WNSA 3PCTA 2RGBA 5CT4A 1JSCA 2B4QA 4W8GA 5NULA 1CV2A 1FRVA 2CCGA 4MKFA 4QYWA 5JD3A 1AV6A 3KOMA 3QGMA 4R41A 3SJAA 4LBVA 2XMSA 3KTAA 1SUCA 3JALA 2AMVA 3AFIA 5LYYA 1FS6A 5C0YA 3Q7QA 1PVOA 5AKEA 3HYSA 3K9WA 1BN6A 3SC2A 4NF2A 1J2UA 5F7OA 5DM2A 2B3DA 2C2EA 1MSWD 1YR6A 3A10A 3AUXA 4PPNA 4JUDX 3BL6A 4M47A 3PUKA 4ZK2A 4PZPA 4H6WA 4NBWA 3EDRA 1PVRA 1QE3A 5DX1A 5KFTA 1ZN9A 1P1KA 1SCIA 1SR8A 5DDYA 4WNYA 2PPVA 4L8FA 4LHVA 4RMIA 1M8PA 1GO2A 2BFOA 1S0NA 2ZM6B 4NLBA 5J2TF 3FSGA 3SVZA 1DIRA 2YFKA 2PUEA 1EXWA 1E2NA 1YNSA 4G81A 5DBGA 1J33A 3QA9A 1GSAA 2Q49A 2F4VB 1C7ZA 3L6OO 1ZS9A 3IPYA 1QG4A 1C0LA 1V0JA 2H9IA 1VLZA 1MD9A 1YDMA 1NWCA 2AXPA 2MSCB 3HEAA 5ES3A 3CLRC 3L9XA 3QWHA 1WZEA 1KZHA 3VH1A 3GYGA 2QLJA 1EXNA 5J2DA 1HGXA 3RS0A 3S5JA 4QO7A 1K08A 1SVNA 1RE1A 2C3OA 3GUCA 3ZU5A 3DTYA 3I2IA 3K16A 1TI7A 4P7JA 4X63A 4EVIA 5CLQA 4IHQA 2FHPA 4ITRC 3WIBA 4E33A 2XZLA 2ZIXB 3QXSA 4FGUA 3VSCA 4D74A 1Y1RA 3PW4A 2R4QA 1AS0A 1RLJA 1Y5IA 2VDPB 5CAEA 1YBVA 1KAHA 4NIMA 4ED3A 2K5UA 4LRUA 2WUWE 4ER6A 4XUGB 2DCMA 2W2XA 5KFXA 5KAFU 1PUZA 1MOPA 3D2NA 3RYCB 4JBNA 4B6OA 2FPXA 4FYIA 3V6KA 4MWEA 2IHZA 5HQJA 5AI8A 4TT3D 4RJJA 1DTWA 4BLTA 1AHIA 3HLKA 4LZJA 3EMDA 4RA9A 3DAHA 4KLAA 1YIAA 1JEDA 3GV5B 5B7PA 2WHQA 3DBVO 4D81A 2JIQA 3LUCA 4I9GA 5C7LO 4IY1A 4NQRA 2Q0SA 5KJ1A 1L7PA 3AF2A 1VE6A 4D9IA 3G9QA 3HY3A 5B30A 2NYAA 2XT0A 3VV3A 4QDJA 2GRUA 2EZXA 4H08A 4ZANA 4CN8A 9ICXA 4ZJZA 2CW5A 2VQFB 4DDHA 4MEXA 1HRKA 1Z08A 3UKOA 2HA3A 3B6EA 1E94E 1FB5A 2GPJA 2QN1A 2XGGA 3FI0A 3ORFA 4FZLA 4H1HA 4MVJH 1Q44A 3PXDA 5AH0A 3DB1A 4IR9A 2HU5A 1P1CA 2IDJA 2J4FA 2C9CA 2VAXA 4V1CB 5KZMB 1Z22A 1A4RA 1HY3A 9LDBA 4FBUA 1TJNA 2ZRMA 1JW9B 5I7AA 3U4GA 4I9HA 6REQB 2ZT5A 4WH0A 1JDUA 5IIIA 4NEQA 3DEFA 3MGBA 1XRMA 2F48A 3RS2A 1JJFA 1ODCA 4INAA 5TEWA 3S7ZA 3WLNA 1Z06A 4WZBB 1EM8B 2P9ZA 3MWGA 4PBRA 4H77A 3SC3A 3HV0A 1ZEMA 3SPXA 1OW3B 1X0XA 1L5SA 3RI3A 1RYHA 2PLNA 3KPVA 2AOTA 3OCCA 2W6MA 3DXXA 1A50B 3FRJA 2WJZB 4FFWA 3GGDA 2FTKE 4YXJA 2PLRA 1XZKA 3DKIA 3GDHA 3TKAA 2X5NA 2XB8A 3OHMA 3RS4A 1UFQA 4LZGA 4DT1A 5ARDA 3L7MA 3IKLA 3WU2U 1AMNA 2BC9A 3LVQE 3ZKWB 1GDTA 3F3KA 5BN3A 4GC9A 2QHXA 1YBHA 5EHGA 2IYPA 2R6DA 3A31A 4RW0A 1O94A 2B99A 2EAPA 2HJGA 1IDOA 4ZVLA 1YQQA 3CX3A 2EIHA 1VPEA 2CJYA 4XWYA 3ZCXA 1TUBA 3CB2A 4JEUA 4CMHA 2CV0A 4R8KA 5DYWA 1SQGA 1XWLA 2JA2A 3ICEA 2JHFA 3WB1A 5IHPA 4TPKA 4BFVA 4UTXA 2G25A 1H0SA 3O2SB 4BNHA 1YL6A 2B20A 1U3FA 3HGQA 3HTXA 2J07A 5K0GA 4YO7A 3OH8A 4PO1A 2X5KO 2E18A 4D26A 3KVRA 1X1EA 5I7HA 3GFBA 1UBLS 1IC6A 2DBVO 4H59A 2ZRQA 5HA5A 3BE5A 3DV0A 2KOBA 4HZIA 5BR4A 3RAXA 3SC4A 1QO0A 3T99A 3GFFA 1CRZA 3ZU6A 1GPMA 1YUBA 2Q5IA 5EERA 5FOUA 4JP5A 2O1EA 4M0DA 4RZIA 2YZ7A 3FDZA 4PYKA 3T9FA 3PDIA 3PUIA 2I2BA 1XU9A 5BV8A 1K3FA 2KFNA 3R77A 4Z9AA 5E8JA 4ZALA 3ZWWA 3N53A 2PG3A 3E1SA 1U0OC 1K75A 1NXQA 1DV2A 2HN9A 4FHDA 3O8RA 1OH5A 2A1JA 4R9VA 3RTCA 5F9HA 3PFBA 2NTNA 2VBCA 1RYMA 1Q2XA 2PXXA 1Q3HA 4KDRA 4EZBA 3CVXA 4I28A 3ENQA 1N0WA 3ZIUA 5A9SB 1C4OA 1EVZA 4TV9B 3T1OA 4D79A 4Z3OA 1TKRA 3E9RA 5AK0A 3RFUA 3M4ZA 4Y2GA 4RQBA 3HXOA 4WY2A 1M10A 1UZMA 2IYAA 5LMCA 4M1ZA 2AFIA 4GKJB 5EE9A 1MP0A 1XHEA 3AQ4A 4WKCA 5MGNA 2C94A 1YIOA 4OAQA 1Q7CA 1ZOSA 4D4HA 3NVZA 2JGDA 1OJLA 1EFLA 4DNXA 3OC6A 4YXWA 1S4MA 2GEBA 5KTRA 2ZEJA 2ZPUA 3L7OA 4KG7A 3UK6A 4D9FA 3QOWA 2JH7A 2FCRA 2WSMA 5BN4B 2E2WA 2PT9A 4XYLA 2G71A 1G6OA 3KOUA 1NPYA 2DKFA 5JZSA 4IS7A 1R00A 3A4IA 1IOVA 3K0AB 3P0JA 4YONB 3UANA 5HM6A 1W581 3QPCA 4EQ6B 4BLUA 4DF3A 4Y7CA 4O3RA 2VZLA 4R8UA 3ICWA 3GY0A 2ZIWB 3RT9A 1XN1A 2FWAA 1KKXA 2NACA 1Z5ZA 4Q21A 1X2EA 2VUSA 4ZQFA 3R5SA 2WWWA 1JEYA 2VDUE 2UVWA 4D57A 1L7QA 4B9EA 1U11A 3C97A 5SZKB 3K1AA 2YJ3A 1ULSA 4IIJF 5LB4A 3ZBQA 3SVTA 3I8OA 4URFA 4W7IA 3VYSB 1CQZA 1GCOA 4FNOA 2BR3A 4M9SA 4EG1A 3KPUA 3QVVA 5DJ5A 3RVBA 4XQCA 3NOVA 4XQ9A 5T14A 4ARVA 4F4JA 2BLLA 3VX3A 2WQ7A 4Q44A 1JLRA 1NGSA 3B1ZA 3U26A 2W2MA 5F7ZA 5AK6A 2UVUA 1Z6ZA 3DL0A 1NOIA 2Q45A 2KV2A 4NCAA 1RIIA 1C7YA 2RDMA 1CY2A 3EVTA 4DG9A 1Z7GA 2IHJA 5H80A 4J03A 5EXEA 4KQEA 4EGSA 2IZ5A 3I04A 1BXKA 1NOKA 3ANLA 3Q9SA 3QVGB 1RYYA 4GECA 1K98A 1M83A 2BFDB 5LQRA 1RR6A 1IULA 5EP4A 1OA1A 5CA1B 4LI3X 3E53A 3JQ7B 4MVYA 4Z2YA 2JGMA 4DVJA 2WUFA 2J30A 4MRPA 5JJCA 4HQNA 1KFDA 1IXSB 2IWRA 1T3LA 1AHHA 1T4CA 3UYKA 3G59A 3RKUA 4G0MA 4EFLA 4KPUB 2OGSA 1SCAA 5AKZA 4DSZA 4OI1A 1E3SA 2QPTA 2C4NA 2UYOA 3FDXA 3I0NA 4O1IA 1Q0SA 4RFVA 2JB9A 4RTRA 4HLDA 2HW8A 4MHOA 1UHUA 2QIOA 3KBOA 3AF5A 4L4SA 2N1BA 5IBQA 3UJCA 3ZWCA 1QFZA 2LZ0A 5CDHA 2R62A 2ZTLA 3UMYA 3U9TA 2OEPA 2WIAA 3U7QA 3HQ4O 4F7DA 1T6ZA 2FMQA 2HVHA 1TLLA 2BOVA 4Y2SA 2X0JA 2W90A 1OTHA 1LA2A 1W5AA 3B1XA 4I4LA 4UAVA 2AHOA 3E5HA 5G5HA 2XCIA 3AUKA 4L9RA 3WO1A 5ITVA 3GQBA 4WUTA 4WLNA 3PO4A 4EBFA 1V9PA 2XUHA 2XNDD 3DEYX 3FYUC 4BLSA 4RIIA 2YUTA 1VRWA 3FNEA 1O95C 2ZRJA 3H86A 1VCIA 2DPGA 4A8JA 1MX9A 1NFFA 4ER5A 3BZBA 3ENKA 5ENDA 1IHOA 5JYEA 4HAIA 1KFKB 1G41A 4JUIA 2XOEA 3GRVA 1VLBA 3VHQA 3GU3A 3LT0A 4UM9D 4TWAA 2VK2A 4C4TA 3KSUA 5DWQA 5HF8A 3D9QX 1LVHA 2Q0HA 4IX1A 1N9GB 4M76B 5CT6A 3K9FC 2NSDA 2NOAA 4XLZA 3FCAA 3HJBA 2O7QA 3DR3A 4DUGD 5KSOA 4LRWA 1HQYE 2NU6B 3FDIA 3K7EA 3M8KA 4P0TA 3BFXA 4I9UA 5E4YA 5JH7B 5L8VA 1R15A 3H9QA 3KQTA 3F2IA 5FBLB 3U19A 4EYQA 1FXSA 4Z4CA 4MYDA 4BVAA 3BG5A 2QK4A 4KGXA 5L53A 1FUYB 5KREA 2PXHA 2KE7A 1YXMA 2RHWA 4O0LA 5EWLB 2IOYA 4EQ6A 1JXLA 1NAIA 1Z34A 1DWPA 1W85A 5J5CA 2VIXA 4ENQA 3P4UA 4TSFA 2J0EA 5CRIA 1Q77A 3LCRA 4DIOA 3KQLA 4NV0A 1NATA 4RANA 4JJ6A 4R69A 1X8KA 1XSPA 3HSSA 2HDHA 1IM4A 4LX8A 2I2FA 4TRMA 1DRJA 7REQB 5DYTA 3L0BA 3N8KA 3BDPA 4NP6A 4NVRA 4LK3A 5IU6A 2D4AA 4QWEA 3H2IA 1ZGJA 5FLKA 3CEJA 2D4HA 1AB5A 6ABPA 1ZQDA 4FZMA 3JZFA 2QM8A 4JFAA 1QP8A 2GPWA 4JJIA 4I2BA 1ZM9A 1PK3A 2GT1A 3C14C 4LOKA 3VO2A 2ZUDA 4FB4A 1YR2A 1NKVA 1CQJA 3K94A 2JCBA 3RVKA 5CM2Z 3CRRA 3A58B 3FVVA 3OPXA 2I80A 5DE3A 3PNCA 1Z6YA 3EPLA 1H6BA 1YBMA 4KRYA 4DS5A 1MHTA 1NQVA 5KT3A 2HA7A 1V7PC 2AN5A 1YB7A 3BMCB 1E2QA 2VNKA 3DOCA 4F5PA 2E8OA 1E3QA 2JJ2A 2AYYA 5H68A 5CIYA 2FDRA 2K4IA 3TIVA 3QBVA 4B76A 1Y3AA 1FFXB 2OAP1 4NATA 2J0QA 1FDOA 4FN4A 1ML4A 1J9ZA 5JEDA 2PMKA 1Z26A 3SHWA 5DCUA 4F5RA 4DIFA 5DXJA 1SUWA 3BB1A 4QIHA 2F90A 4DPMA 3PZRA 3G1TA 5B3JC 1IUOA 4IRDA 3OTQA 1RM3A 5EQJB 3EXEA 3SZLA 2W6OA 4R0VA 3V4PB 4J75A 3MQ2A 3UFXB 3KYJB 3GFVA 1ZQCA 1UMDA 1NNI1 4RY9A 3S2UA 1TL7C 5AKKA 2PFKA 1KZ9A 3KEMA 4JNKA 3TQQA 4M1KA 2ZWPA 1UBGA 3DZIA 3FLBA 3RJMA 2DLCX 1KDZA 2XLBA 3SQWA 3EIEA 4UBBA 1KNQA 3A2MA 2ST1A 3IAHA 1QH8A 2VUUA 4YAJA 3E9ZA 5JO9A 5JPIA 2Q7OE 4BFYA 5KOJB 5CX1A 7ICUA 1OBCA 6LDHA 2BPFA 1R12A 4JVMA 1D1PA 4O2LA 5AM2A 1QHNA 5AICA 2VYQA 3D4PA 4M7PA 4U63A 4MOWA 4OSPA 2QM3A 5EUCA 4Q3DA 3R9IA 4B6EA 3U6BA 4AS1A 1L4MA 2HHQA 1DKPA 2VDRB 2HHSA 1OLSA 4RPYA 1F2TA 1N6RA 1SC3A 2HYDA 3EJ6A 1U7PA 2PQ0A 1JR3D 4IJ5A 4K9KA 4K9QA 4NARA 4QWMA 3WWEA 4TWIA 5ALXA 2AFHA 3DE5X 3N0RA 4DCNA 2LPEA 1F44A 1OTYA 1QHFA 4HWPA 4IFEA 4REOA 5K6AC 5B66U 1OPXA 3R6DA 2K7ZA 4GGPA 5EAIA 3QNWA 1ZK4A 2AR0A 3LLSA 2IPAB 4CT0A 2JRCA 3ITDA 2D62A 2OAEA 4MJXA 4DCOA 3DVRX 4XSVA 3FJYA 3HG7A 3DAPA 3MXTA 3I9JA 5JVDF 1TLTA 4YK7A 4YJHA 2Q6OA 1QCKA 1COWD 1O4WA 1R6TA 3NBFA 3P8ZA 2I2AA 4JLVA 4KOAA 4MI1A 1NULA 2VHCA 3S1AA 5K8TA 4GLBA 1X1QA 2PJRA 2CZGA 5HHIA 5J0OA 1GNQA 1ZMBA 3MLAA 4B5LA 3GAFA 2Q4RA 3DJFA 1AK1A 3RBAA 3ETRA 2H6EA 4JI3B 4DFJA 1QLWA 3DV2A 4JAVC 2EKLA 5KG3A 1QIGA 4LHYA 3C1ZA 3W5UA 2GVZC 3OPNA 4UUAA 1JI0A 5H70A 1XZGA 4S0XA 4TMTA 1NC1A 3P9CA 1E99A 1BXZA 1YS4A 2FPWA 3P9IA 3WVNA 3TTYA 3LBHA 3L1JA 2QTVB 2AG1A 1L4EA 2Y1KA 3QZ7A 3HKDA 2MA1A 2F4NA 4AMYA 4DA8A 3H2GA 4HH0A 3KQKA 1BD3A 1DWQA 1ZQZA 1A76A 1SH7A 1XJCA 2KMDA 2V6BA 1IHUA 2WD9A 1ISRA 2W6QA 3H2HA 2FZ4A 3PTLA 4NESA 4UMDA 2PZMA 4Y6RA 1ZM2A 5G40A 2KNJA 2JIMA 5ICFA 3COJA 3HFSA 3P20A 2C5FA 4TMFA 4DABA 4YAGA 2IHNA 2ID4A 2EF0A 1FSGA 2C5GA 2EQ5A 2ISQA 3DVAB 2ZBFA 4I4TF 3RR8A 3RYFB 1MC8A 1PSZA 5AI6A 2NPIA 4LVCA 1NBAA 3AU6A 2FEPA 5AESA 4Q47A 3KHKA 3TTXA 1WD7A 1FP4B 2IGTA 3GWZA 2BTOA 2ZB8A 4XEHA 6NULA 2K4HA 1CS4C 2C4KA 4UNIA 4LJ6A 3ACCA 2GPYA 2K7FA 1JJBA 3MR5A 4XR9A 5LZ2A 3T5LA 3TLXA 3DCIA 4WLFA 1ZQUA 4RQ2A 4AJOA 3E7DA 3Q8KA 2JARA 4P7KA 1M74A 4KDFA 4V0QA 1BN7A 3HUDA 3QVLA 2PI5A 2VHXA 1AJEA 1IWBB 4H6VA 4LDZA 5JZOA 1LB1B 1EBBA 2VTKA 1Z1BA 3KFUF 2HBKA 1N2JA 1KY4A 1Z0AA 2XWQA 3OESA 3PNKA 4TMXA 3AQIA 3G88A 1FW6A 2BUAA 2HLDD 4TMKA 3KZKA 4U3JA 5FL7A 3KSBC 5G1OA 1CR2A 1CY0A 3K6SB 1PO7A 1PFQA 1VL1A 1P3Y1 3EA0A 4N76A 3VKUA 3P7MA 2ZJAA 4CPDA 3QVOA 4LF9B 1GPBA 2Y66A 4QDOA 1Y8CA 2FW7A 3NB0A 4X60A 4Z0NA 3AHFA 1ZIDA 2BBTA 2GBGA 3RRHA 3D6TB 3SYMA 3TUIC 1V71A 5C8DA 4GMGA 3OEEA 1BEEA 3OT1A 4HH1A 2ZT6A 3QF4B 1FLVA 4C3VA 3A1NA 3CJTA 1U2EA 2QMHA 1XL1A 3EULA 3GOQA 4MRMB 5LP1A 3FCCA 2F9FA 2HLDA 2Q29A 3GT3A 3S2SA 3WLIA 2VT2A 1EXDA 4O9MA 2W54A 1JG6A 3A0HU 2I54A 1ZQJA 2LNDA 3JVVA 4KI0A 4PSDA 5COQA 5BW6B 2YOHA 4AJJA 1Z36A 3H11B 1ZQBA 1Y42X 3IDOA 1PU2A 2RGWA 3GIDA 1QR6A 1SO8A 3NDIA 3ZUPA 1OIWA 5HKAA 1LI5A 1SXJE 1Y3BE 3PW2A 2GWHA 3EDCA 3L8MA 4NDNE 5GONF 3F6YA 2OPHA 3STVA 4AJLA 4CM6A 4AG5A 5D84A 1F0PA 2IH2A 2JLZA 2QN7A 1N9KA 4YT2A 2MYUA 2V0GA 3SBDA 3BXPA 3WDKA 1GLNA 3DNPA 2XEDA 1RZRA 1HFKA 2IODA 5LP6A 2Z30A 4LDPA 2AQKA 4RK0A 4M1EA 4U2KA 1YR1A 4RH1A 5FJIA 1X66A 4X1OA 1JAZA 1KH3A 1WSBA 2QBYB 2G07A 1EK5A 3I4CA 4EKYA 3DBIA 1BOOA 2Q3DA 3EZGA 1E1RD 5BSKA 1JQJC 5LDGA 2ZRDA 4ENUA 1ZD9A 3I64A 1S2IA 4EJ6A 3F2BA 4NYMQ 2MSWA 4V0LA 3SJUA 5JXHA 2TMDA 3WK9A 5FXMA 4FKMA 3ZCPA 9ICAA 1MABB 4EATA 2R44A 3LHSA 5IMSA 1MDBA 3N2GA 4RPCA 4BZWA 4DR6B 5G3ZA 1XRJA 4P83A 4EZ6A 3SS7X 3TE6A 1QZZA 4LHXA 3PNYA 1Z18A 2QTVA 2OAQ1 3RIGA 3N2KB 4XH9B 3R0VA 4OIMA 3PC8A 1FFCA 1RRVA 4H0NA 4KXWA 1JLLA 2B36A 4BTLA 2IBMA 3PO5A 1BH6A 1SVWA 1XNHA 4GPZA 4I3GA 1Z5NA 2JVIA 3ASZA 3IKMB 4Z6KA 4P08A 2ES4A 3ICXA 3BIJA 3RAPR 5IH7A 5J3JA 3H4MA 1E1QD 2GZ2A 4DA9A 2B2XA 1B8NA 1OI3A 3SJ7A 2H08A 4AYTA 4H7JA 2YWRA 1GL3A 1J8MF 3CHYA 5AW3A 2O1XA 2RSLA 3KJZA 5JWHA 1U8FO 2ZB3A 5CTJA 4FHCA 4QLAA 3Q9UA 1GPUA 3NOXA 5TQ2A 1GUDA 2Y1IA 3P2OA 2HF9A 5LLDA 3RF9A 4A0QA 5AP9A 4C7KA 2JC3A 4A9AA 4DTCA 1D6SA 4K8OA 4UDNA 3HXTA 4EUHA 5K99A 3C2MA 5HUHA 2WD8A 2VHWA 3ETCA 2OFFA 4HDQB 4I3HA 3C6BA 5J2KA 1GAWA 4ED2A 3QVJA 2B1GA 5ALLA 2W9BA 1H65A 2OCBA 1LX7A 2ZYIA 3EXFA 4OHWA 2J9XB 4R54A 3L1VA 4QVIA 2XGMA 5KYWA 4CFYA 5HRUA 2DR2A 4ZOHC 3MJ4A 4D8YA 3IL2A 1PJSA 1JH9A 3D0KA 4ZO7A 2M9MA 2FEKA 2Q3HA 4RLHA 5F1PA 2XKKA 2W2KA 3ZZ0A 2AJ8A 3I5XA 4MRMA 1XDUA 1Y4SA 4YCXA 1OXBB 2DT5A 2E4UA 2QNRA 1T4DA 2DQYA 2V7GA 3SAGA 5J8YA 2P5UA 2PH1A 1ZIPA 3MGCA 3ROQA 3V8EA 2J08A 3H8WA 3LWMA 5LQMA 4CUZA 4QX6A 4DJFC 2ATLA 3VR4H 4GX1A 1JKMA 4D4KA 5J0XA 1U2TA 3B5EA 3RIHA 2ZIWA 3OUUA 1G8GA 2BH2A 5CA0F 5KG0A 4EABA 3LT2A 2I6FA 4JJAA 4BBJA 1CW2B 3F8TA 5M29A 3HKZF 1K88A 2V6IA 1P29A 5DBAA 4PTYA 1GAJA 4LE2A 4UB3A 1XRSB 3A6HA 3MBOA 3ANMA 4N5DA 3W8EA 2VUIB 3GR6A 3WMEA 4C5CA 4OA5A 5JCJA 3NV7A 3U37A 1GL9B 3TQSA 3DM9B 5HEKA 1HE3A 3IJPA 5HPYB 2INGX 4LCEA 2Y76A 7ICKA 5TS3A 4F2DA 4E5KA 4ZICA 1F12A 1M73E 2C8VA 2O54A 2R4UA 3SAFA 1C5KA 2WTBA 1SG6A 1PJCA 3WV4A 3SV3A 1AB6A 2JJMA 3EXHA 4M3NA 3HI4A 2EFCB 2AW3A 4PSVA 2W2OA 5BMVB 4BLOA 2VOEA 5E6SA 1BKDR 1IG0A 1OLXB 1RZ3A 4UU7A 2WWVD 2ZSFA 4CTOA 4F6CA 3B38A 1DRUA 2G08A 1NAHA 3OQ6A 2WJHA 4FR2A 3A1DA 3K0FA 4WLUA 1WL8A 5JH7F 1SKBA 4BNFA 1IXRA 1V48A 3UQ2A 4FGSA 4KBGA 3B3GA 3V00A 4DWIA 2WIGA 5JJBA 1L3IA 1Y5RA 2GUGA 2CLIB 1B14A 2PKCA 3KJXA 1ZQVA 3K1YA 3PIIA 4M9UA 3N0TA 3A3NA 1QPGA 3GMSA 2DUJA 3KAQA 3F5DA 4G4SO 5I7VA 5HDQA 5LOVA 2F8TA 3FTEA 1PD0A 4ICIA 3PD7A 3GH1A 3P0FA 4BBZA 3HLYA 2E7ZA 4E1BA 2QW1A 4KR3A 4ZVVA 4DWOA 3KKMA 2DC1A 1XU7A 2I6GA 4DHWA 1HQKA 3HBAA 4MR9B 4P4TA 5C1BA 4LY6A 3H2KA 5CXUA 4M38A 5HJ7A 3DTVA 2PEYA 5IILA 1XLTA 3HEMA 2CNWD 4XUEA 1XZIA 4LK2A 1L3BA 4M53A 8ICRA 2EIXA 1PJ3A 4CQMD 2ASEA 5HKLA 1U0LA 3O3CA 1YIDA 2GB4A 3BIXA 3QJGA 3T3HA 4DM3A 1UKZA 4BNDB 2QTBA 4PGMA 1K6EA 4JOSA 1F9AA 1HEYA 1L4HA 1JIUA 1CUIA 2LDBA 3ID6C 2FQQA 3AV3A 3OO1A 1P5FA 4GWLA 5B2EA 1Y6GA 2Q7XA 3FC4A 1JMVA 3KTAB 3TAPA 1P6UA 1ECPA 3DOEA 3NJ4A 3NATA 4J49A 2ZJ2A 2W6ID 3AU9A 2D3DA 1V43A 3PXGA 1MRNA 1R4AA 2QRVA 3HFGA 5LBTA 2C8JA 4REQB 3DV9A 4E0DA 4DFKA 4DWJA 1NXWA 4F4HA 2RAFA 2HHXA 9ICJA 4F8RA 3RC7A 3GPLA 1ISMA 4OJMX 4L9WA 3SXJA 3TRKA 2CFTA 1A8HA 2XT9A 3ZV7A 4KQ9A 1XAIA 1Y4AE 2I1LA 2C98A 2LVBA 4RFLA 4ZYYA 2B8JA 1RYUA 3I2YX 4IGFA 1YGYA 4LKRA 4GO1A 4CIVA 1JVNA 4RELA 1DXOA 1LKZA 4WLEA 1URJA 1ZXIA 2I6XA 4K2HA 2QBYA 3FF4A 1EDDA 1CDOA 5HZMA 1RRCA 4HJRA 1S9FA 1PW7A 3B60A 9ICIA 2QVXX 4N7BA 3ZHTA 1Z4QA 2QM0A 1TKBA 1ZU5A 2HHCA 3LFTA 4YACA 1SUIA 3H1EA 3AN1A 1F4LA 1Y6RA 2ZRIA 3IJ5A 4B3GA 3VPCA 2ISOA 4CRWB 2FK7A 5EWFA 1XA3A 1TYBE 4M0KA 4WCFC 1HYQA 5KYXA 2VWGA 3B53X 2RONA 2M2IA 1PYGA 2OGUA 4X71A 3RSHA 4HDOB 4PHAA 1VHJA 5D7NA 5KJ6A 2QX6A 4FD3A 3SWWA 2V3VA 1DCKA 3VVMA 2YMLA 3UHPA 2YWJA 8ICLA 3LZDA 2P3OA 4GL2A 3AL0B 3ZD9A 1U8TA 2X8JB 4DRYA 4N54A 1MG0A 1E60A 3ETJA 4MGIR 3ADPA 5JVDA 1Z6TA 2QY9A 3O83A 4O4HB 4B3BA 3NWOA 3AR8A 5D5PA 3AEUA 2GPBA 4OQNA 5C52B 1MNAA 4KLOA 2QXTA 4UOZA 4RTQA 3OIDA 1JU4A 3GIIA 2P65A 1PUXA 4UCFA 4YP7A 5JALA 5LQAA 2JEFA 4GE3A 4ZEOA 1HDIA 1CQJB 4R1SA 4P0PB 5DTMA 1Q12A 2QM7A 3D7LA 3LUKA 3VNQA 2GD0A 3CO0S 5KQPA 3WFZA 2H3HA 1FP2A 2RI1A 1M6VA 4WKBA 4JOQA 4OA8A 3ZNNA 2FUG1 1RFGE 7MDHA 4QO8A 5BMVA 5AW4A 5LKRA 3HR7A 3D3NA 1C14A 3MB5A 3RUIA 1AMUA 3QX9A 5HFJA 2AIRA 2JRLA 1A9PA 5MF6A 3NDBB 1FS4A 3PHGA 2BAGA 2BGKA 2ZYHA 4KMSA 5D85A 1GCAA 3O8OB 4F4XA 3MWDB 1MH9A 2ZJ6A 3F71A 4NOKA 5DTJA 3RAJA 3ONVA 4CM7A 1R27A 1F17A 1BDJA 2GN9A 3JQDA 2CXNA 5I7EA 4BKRA 4OB7A 4KACA 4TRRA 2JJ1D 2JD2A 1CF9A 3S2EA 2ZRCA 3TZCA 1WCWA 3FA2A 3STTA 4EDHA 4LNUB 3GPCA 2DYKA 1WCLA 3MBIA 3WQQA 3JPSA 5JE8A 1RBYA 4RM3A 5EWLA 2FCAA 1TZJA 2LBOA 5DX0A 2KTQA 1II9A 3U13A 2CNDA 1J1ZA 4B9TA 3FN4A 3HCOA 5LU8A 1DDIA 2R8GA 4I2CA 3DDUA 1T6NA 3EIUA 3BX1A 1DFHA 1E4EA 3OHPA 1RRFA 4X20B 4KODA 2AFIB 2XCPA 2VUTA 5EGSA 1XCLA 2NT3A 3WQSB 4Z99A 1GPAA 3B1KA 4ZYWA 3F3YA 1TEHA 3R0ZA 4OGWA 3ABQB 3NMUF 5BWMA 1A9SA 2A3VA 4XTCS 1O9BA 3LK7A 4J1NA 4ZC1A 4BNUA 4V0SA 3Q87B 2ZRFA 4J29A 1PHRA 1TM2A 2CNBA 2JZBA 3KHGA 3L41A 3L6BA 2ZRHA 3GUUA 2QTHA 3T6KA 2QTTA 4WAUA 1EP9A 4ZRNA 1RJGA 2AZXA 2I9GA 1V37A 1DNPA 4QW8A 5KL8B 1II8B 2PL5A 4J1SA 5AK3A 3RC1A 4EHIA 1Y8ZA 1TZCA 3AR3A 4ZVMA 4JWTA 1E2BA 1FNBA 2RG7A 3OCUA 1XELA 4KIJA 2PNFA 3RK1A 4EJ0A 2ZZKA 3JATA 2CLOB 3NGMA 1C0EA 3BA1A 3DE0X 3LVRE 4OKSA 2QUAA 1L5WA 5TX7A 1UK6A 3FD8A 4MVJM 3ROZA 2IH4A 2FXIA 1S76D 2DFTA 3G13A 2LMRA 4QFBA 4JGIA 2PX3A 3CUUA 2JK1A 3UQ0A 2VHEA 3VDNB 4TV8A 1WA5A 5ANRB 2YRFA 4DL5A 3M4YA 4KGDA 2PWYA 5KG6A 8ICTA 1CUHA 2SHKA 1Q92A 4QRDA 2PYZA 2NQ2C 3PP8A 3RBXA 3WTBA 1IPEA 1QM5A 2XMQA 4G23A 4A8TA 1MW9X 4RLSA 3ZHBA 4ZTZB 2LE0A 5CEHA 9ICCA 3IYLW 2X0FA 4MYTA 5FNVA 5L7WA 1BD4A 1OI7A 4Z54A 4CBVA 3IPRA 2J3QA 3H9UA 3GLQA 4ZDKA 5DBBA 4TQGA 3PXXA 4G2NA 1WABA 5K3CA 3CUEF 2MAXA 1HE2A 1HWYA 1ZK0A 4CLEA 2HK9A 5KG4A 4DL7A 2VTEA 1S8NA 3GG9A 3UHJA 3W8FA 3GDXA 4E5UA 2XX3A 3ZWPA 4EIWA 5B57C 2UYQA 4UXIA 1X1SA 4YTEA 1IUPA 3URKA 4NFSA 1MX3A 4P5EA 1SIWA 3HVIA 4BN4A 5LIPA 3O4HA 3F73A 4KH0A 1KQQA 1DJPA 4ZFNA 4YAUA 3RAGA 1JA1A 2QDXA 1FBTA 2X6TA 4ZPXA 1SELA 5J2GA 1P4SA 4P33A 1PK1B 5KL1B 1V96A 4UBOA 2GBPA 3MYYA 1W9MA 5JHGB 1FXUA 2H7VA 3W7AA 2AN3A 4NBSA 4FNMA 3C5EA 4FYVA 4ZVPA 1SZHA 3PQ3A 5FBRB 2PZLA 3DE4X 2FPPA 3L0YA 4JLWA 1QYIA 2VTVA 5FP0A 2FSSA 2GD1O 1FBNA 2KIVA 4O3SA 1ULTA 2O2YA 4NEGA 4L9AA 4X00A 5FPTA 4BZPA 4WFIA 8GPBA 1KA9H 3R3SA 5AJYA 1SXEA 1C4WA 2VQ6A 1L8LA 3T5GA 5I3ZA 3E3AA 2P0EA 3EFBA 1FDSA 3JWEA 3U1VA 3UC5A 3H0LB 1PGNA 4LOHA 1KEUA 3C74A 3WL4A 4ALJA 1K9SA 1UEJA 3L79A 4E1VA 3U7GA 4H3KB 5T4HA 4MVJA 3B9JA 2WJIA 4C9BA 1XGKA 2RJNA 4KLFA 1HE8B 3IHKA 4PYRA 4P3KA 2JZCA 4TTRA 4Z9XA 2CY0A 2IXDA 1OVMA 1X38A 2D59A 3T52A 2AQ4A 4IJMA 3WGLA 5IN4A 1UAAA 1Z8NA 3OOYA 4DSEA 3F7OA 1UKBA 1PLLA 3QF4A 3DUFB 5FA5A 4DLSA 4C7MA 2GPNA 4KQ2A 4E51A 2QT9A 2ZTUA 5FEMA 2VF7A 1XQ1A 4WN3A 1E7MA 1WXFA 1Y3CE 1ZKMA 3OQHA 3WSVA 2JH1A 3DKVA 4LE0A 1SKRA 3E9YA 4K05A 3VTAA 2IXEA 4FZ5A 4G26A 5BSFA 3BH0A 5C7OO 4BRWA 1VG8A 1S2GA 2R8PA 3SQOA 1CE8B 1FLDA 4IMJB 3BSWA 4OM7A 4E15A 1GTSA 1CBUA 4D56A 1BXGB 2ZIGA 4U9HS 1V95A 1OWPA 3L7YA 3CSSA 2C2MA 3H2JA 5IAEA 5CGZA 1PUJA 4CF7A 5AQEA 5LM3A 2ZRBA 5FUQA 2GEJA 9ICUA 1H69A 1DAPA 3B82A 4KRXA 5DLFA 1HK7A 2JATA 2AQ0A 2XMPA 1M67A 3KV3O 2PO7A 3OLQA 4G8BA 5KJFA 1JZTA 4G2TA 1GFWA 4JP2A 3K09A 3WWZA 4X7PA 4EZEA 4KTTE 3TCKA 1IN1A 1AUOA 3DEKA 3TLKA 1VYVA 2G63A 4X92A 4HYEA 1V4BA 2HAEA 4GUAA 1NTRA 1G8SA 5LOVF 5TMPA 4EUSA 2NZWA 5LPNA 4GICA 1U8YA 1H2RS 3IQDB 5G5GA 3AIOA 4A2PA 1BDHA 2JEYA 1ICIA 3ORYA 5LBIA 3K72B 3VRHA 1H1DA 3OM1A 1LWNA 2GF9A 2OP1A 3KJNA 5FAKA 4ZTBA 3VR2D 1AF4A 4NENA 3AHIA 4LHZA 1XN4A 1N32B 1P6QA 1N5WA 1JF8A 1Z7WA 3M6ZA 2A1TR 2BP7A 2FN3A 3BTUA 3NTVA 5FYDA 4C2UA 1H66A 2SKCA 3ZWXA 2WF5A 3WAJA 1Q3VA 3WL3A 2IEAA 3U44B 4W5NA 5TQ0A 5KOYA 5LKAA 1N6PA 3OWXA 3D0OA 5KQSA 1DPGA 2BHRA 4MQEB 2X15A 1W0KA 3IURA 3ZJ5A 2OV4A 4N0QA 2XODA 5DYNA 1RSZA 1M1UA 4GLOA 4YXFA 3T7RA 3BH7A 3GLKA 5DNWA 5A4JA 3WJ1A 1NV9A 3LCUA 1BX3A 4KJZA 2J46A 1TCUA 1CYDA 3VR3D 4KFRA 3I42A 4I5GA 1KU6A 5AW5A 3NW9A 3O4JA 3LDUA 4Y9UA 4FE7A 2Y77A 3EVDA 4XA8A 5CVCA 4XVCA 3ORSA 5J2FA 3ICPA 4G5XA 1L5UA 1JLKA 4JJ7A 4Q4AB 5H16A 2Q4EA 4EBBA 1KP2A 1ACLA 4Z7JA 4I1OA 4RKWA 1CWUA 121PA 3NGXA 2P68A 2PCLA 2V3CC 1A88A 4FE3A 1I3CA 1MO3A 4EZIA 5JCOA 3QWAA 3WGMA 2MHCA 4QPJC 2Y93A 3VC1A 1FUUA 3RVDA 4AJ9A 1RWXA 3MFHA 5M5BA 4OMFG 3P2JA 1R8QA 1D2NA 2I4MA 4H3SA 1N2OA 3L7BA 5JG7A 2D5IA 5F2NA 2MMCA 3NRWA 1AOXA 2GCEA 3S2IA 3DFZA 4ZI2A 1GR1A 3RNOA 4KFCA 3NEPX 1KY5A 2O0JA 3TNJA 1DKLA 4JLJA 5F7XA 2V7BA 5CA0A 1RHJA 4E31A 4EECA 2GZMA 4DQVA 3QVKA 5KOJA 3EA5A 3INNA 3S8EA 1MO4A 3TI0A 4P54A 4E70A 2KHQA 4NU8X 4D7AA 4M89A 3DULA 3UA3A 2D0PB 3FSJX 5C35A 5TE9A 3PQ6A 1Q57A 3OZWA 5I9MA 4M9GA 1CK4A 1QUEA 3D0RA 1CY1A 2XUJA 2EKZA 2ONKA 4YR7A 4WFKA 4RULA 3UCEA 1DP4A 1QO9A 1DQPA 1UJ4A 5KKCA 1IQUA 1IM2A 3N3BC 1IJBA 1GILA 1U5CA 2BFAA 2XGSA 3JQGB 3KHUA 3N2NA 4TTIA 1BXGA 2Q3FA 2WOJA 2HHAA 3P52A 2Y68A 3T0IA 3V3KA 4ARAA 3AF6A 2OO3A 4CU5A 1DE0A 1EU1A 1MAUA 2HJWA 1QU3A 4QVGA 5KFNA 1ZK2A 1WUDA 3IVXA 2BZ0A 1NBMA 3QJ5A 2FQXA 3BHJA 4HWOA 2A2ZA 3LOUA 4JASB 2BKEA 4F3CA 2OGWA 4EGJA 2EF1A 3MVEA 2RP5A 2FPOA 1OYVA 3D6MA 3BQ2A 5DBEX 3UW1A 4UEOA 3RYCA 5KYNA 1A04A 3HXMA 5IKMA 4K0KB 3DEJA 4J6FA 4WOJA 3P9NA 3GZNA 4Z9YA 2UVRA 2RGXA 1A9RA 2FR0A 2GJAA 2IYQA 3LIIA 4MAFA 1ZCFA 1RJWA 2WTMA 4IKOA 4QULA 2W6JA 1I3MA 4BMNA 1QGZA 3D8RA 5EJ5A 4Z8YA 3K0SA 1C29B 2H1SA 9ICBA 3C4JA 4G56A 4X8HA 3RRJA 4EJ2A 4ICAA 1U7UA 1GNSA 2XVAA 1FSZA 2PX4A 2XF8A 3C3KA 3PNMA 1WMFA 4KMRA 4V3BA 1ZRSA 3RRNA 3GV7B 3AF0A 5FORA 4NZZA 1G16A 5CXSA 3EUWA 1E1YA 5CVUA 5I7SA 3KVVA 1IUNA 4NJEA 3WZLA 3ZI0A 1Z74A 3SDZA 3SJZA 4ED6A 2RGRA 1NN3A 2QS9A 1JHOA 1T6YA 2QPAA 2XHEA 5KFBA 4PX5A 3WNZA 1KF0A 1TUEA 3ZTYA 3ZU4A 4DDTA 4GAEA 1K3TA 5GOZA 3X2FA 4EI2A 1W85B 2RHRA 1UH5A 3OA2A 3DMGA 5EMJA 3T8YA 2V54A 2Z5FA 4B44A 3ERCA 4B34A 3PQ2A 1WU8A 2PTGA 4BMPB 5ADWA 2Q3LA 3AI1A 1J2JA 1FYDA 2BT4A 4BBAA 2YOGA 3OX3A 4UHKA 2BZ1A 1O87A 1WY5A 3ESDA 5ARCA 2JKVA 1I4WA 1XMJA 3AW8A 3TIGA 3ON5A 1ZYQA 1USGA 2YYYA 4PJ0U 3G2QA 4YDSA 3PW0A 4MJLA 1ORTA 1QK3A 2FW8A 3IALA 1RPZA 3QLEA 4XDGA 3AG6A 3D4LA 4N3GA 4UC0A 5BRJA 1TVKA 3WLOA 4AY6A 4OL9A 5BYAA 3H2ZA 3O4GA 2OUKA 4RSMA 3SEFA 1ZUD1 3ED1A 2QRUA 3QUSA 5LYJA 2RH9B 3BERA 2XBLA 5I8ZA 1MH1A 1LF0A 3HXLA 3X1WA 1V8ZA 3FM9A 1NBHA 3L0PA 1UM9A 3JQFA 3OEWA 3QKUA 1JJAA 2AA3A 1DZ3A 1F0YA 1M7HA 1E1KA 1PN3A 2OCPA 3FPJA 4Q6BA 3FGOA 2IXBA 1WXIA 2AWOA 4KLNA 1DINA 3NHAA 3OPYB 4MIEA 5FL3A 2IKQA 2AW5A 4LXXA 2O3JA 4BYMA 4MVWA 1B7GO 3C29A 5K2MA 3E8SA 2WFZA 4RMGA 4E11A 2I71A 1OU0A 4PFKA 4AN4A 2A9QA 4M8NE 4C43A 3H8MA 1L1FA 3U0BA 1QRAA 4HN9A 4PYNA 2SICE 3T3PB 2CMKA 2XLCA 1RAGA 1Z4NA 3A6EA 1Y7TA 3U7RA 1NG9A 1PT5A 1VECA 5EIXA 1LJUA 4AUMA 2I03A 4NLNA 4KR0A 2XGQA 2YRXA 4C0LA 1EVLA 4C0WA 2BJVA 2NU9A 4AY5A 1MPXA 1WPGA 2OZLB 5J0WA 2NTJA 1RM6C 2FMSA 3GBVA 5DTRA 1KWGA 3OJCA 4NONA 4AY4A 1ZQKA 1GRNA 2W4IA 3MGAA 1A77A 4JL6A 1ZMXA 3ZHCA 1SQFA 4EHAA 4N1AA 1A1VA 1V38A 3WDLA 1ETHA 1TZMA 3KHRA 2WUEA 4QIWF 4L5AA 4GQBA 3AVVA 1BQ4A 1ULHA 5AVQA 4NLGA 3U4AA 5K8UA 1PNRA 4OXNA 4HQ6A 2H2FA 1DXYA 2Q0ZX 4HRYA 4N9WA 2ZVJA 2B5WA 4PRLA 4BLRA 4DLEA 4ECYA 1JPVA 2AEJA 5DPMA 4GXIA 3OMWA 3T95A 3HXQA 3LQFA 1L7OA 2WFLA 3CBGA 3NHZA 3T4PA 4EG8A 3UGJA 5DBCA 4MPDA 5BYKA 2UVQA 3FZYA 1XC9A 1SBCA 1KR5A 1XALA 3C3DA 3O75A 4I36A 4QOJA 1S8OA 1J49A 1DEAA 2HXGA 1OXMA 3CEMA 2D8MA 2DKXA 1JE1A 1XD2B 1NR5A 1NW7A 2MDTA 2RI0A 3FNFA 2C9ZA 5E4TA 5E95A 4DA6A 3HWTA 2ZI5A 3DOUA 1SCUB 5FUVA 4C5AA 3LK6A 5DTEA 4LY0A 4XUSA 4RQNA 2HRCA 2H2HA 4HTAA 2PBZA 3E7PA 4L15A 4C76A 1EB9A 1OZHA 1DMRA 4PO8A 2XVTA 4C87A 3R0JA 3CSUA 4DLUA 3RCBA 3FYUB 3F74A 1U7WA 1TM1E 3FFTA 4JLAA 4FINA 3UOGA 4UEKA 4BP3A 4FGZA 1VBKA 3K0HA 1EHIA 4RZ2A 3UMGA 1F2UA 2GZAA 1J0EA 1SKMA 8ICOA 1R50A 3ADOA 2O5CA 2IZ0A 4P7BA 4YJKA 4URVR 3NIGB 3I5AA 1GUBA 1CNEA 2C8LA 2QSJA 4RVFA 1ZOPA 5GJBA 5JSZA 3O38A 1TE2A 3PTZA 4OK3A 3VZDA 4M60A 1WETA 1VPLA 4E21A 3U4MA 4AUEA 1W2WB 2B35A 3EEFA 3EMKA 3KJQA 3MTGA 3MTAA 4HUJA 4LY9A 3E9DA 4PGGA 3REQA 4B3MB 5K09A 2V4QA 2IPMA 1C8BA 1YVDA 3X2EA 4OLAA 3K92A 3LUBA 4Y2XA 4WQMA 1SXPA 2FRDC 3HO8A 4FFNA 4QGBA 3ELDA 5JH7A 4Q3NA 1QTRA 1UDRA 4X6XA 4CQMB 3RSOA 3NJRA 4PG6A 2BFBA 5YASA 2PRJA 3D6FA 1NJWA 1E58A 5HXAA 3D02A 1RACA 2ZRKA 4IMRA 2WYVA 4Q66C 2GCOA 2J3LA 4ITUA 3LOQA 3AFHA 4IUBS 3Q2IA 3P9XA 5H81A 1H38A 1H5NA 1PNQA 2ZIFA 3VCBA 1V9CA 2VPYA 4NX2A 3G8YA 3C3CA 3UAZA 2HRRA 8ICWA 4HVTA 2OZPA 1BHQ1 1MV8A 4PY2A 1EI9A 3RJKA 5CCEA 4X65B 8MHTA 1FUIA 4OOFA 1Y33E 4PPXA 4BKUA 4GX5A 2AFHB 3O9ZA 2OSBA 5GIOE 3INYA 3UJBA 3E9EA 1Y8QB 1DHTA 1EDBA 1M34E 3DLHA 4ZRMA 3AZOA 4DWWA 3DWEX 1WP9A 1T9AA 1VKRA 2X4IA 3W6ZA 4Z49A 5K6RA 1GLVA 3KHTA 2J0UA 3PVSA 3K0EA 5IS2A 2P5TB 3PW5A 2XA1A 2YXEA 4KO4S 3VBCA 3VPHA 1NM5A 1TW3A 2GD6A 3ICVA 5SZJA 3UW3A 1TRKA 2R60A 3UJ8A 2QG9A 2V6MA 4WXYB 5C37A 1AH2A 1F7VA 1EQAA 2A0UA 2Q5CA 2EGHA 5IDQA 2HK7A 5HHTA 1XO1A 2OORC 4OBEA 1P39A 1L4BA 1TCCA 4S1TA 1FTSA 1UJ5A 2AOUB 1J7KA 2OAGA 3PA8A 3Q5EA 4ZV7A 3VAZA 4EHFA 2GASA 3G7UA 4IPTA 4A36A 4GZ5A 3ZY2A 3RBZA 3C8MA 2YTUA 4TV8F 1V8PA 2BDEA 3L82B 3VMMA 5I7OA 4YWHA 1T25A 3ZU2A 3I73A 3HI6A 4MKHA 3I23A 5JIBA 2B9EA 4L3OA 5G4LA 4N8EA 5FUYA 4XX0A 1YJCA 1SXDA 5EZYF 5C5EA 3FAHA 1RD4A 1B3BA 2QEQA 2R85A 5CPBA 5P8WA 5KPJA 1SCJA 4PTZA 4RTMA 3L8FA 1K68A 1X6IA 2XI9A 3RC2A 4HLCA 1G6Q1 4CLXA 4AKHA 1XQVA 1Y8QA 5B58T 1T9GR 2P62A 2VCEA 3N59A 4U00A 1ZQFA 4LXGA 3M9NB 2OO7A 2G4LA 1JS1X 1G63A 1A5BB 1O2DA 2E4WA 1L5MA 4O4JA 4DQPA 1GZSA 4EZ9A 2BCVA 2ORED 2P11A 3LJKA 5CDYA 4LF4B 4QHSA 2EEZA 2L69A 4C4AA 2IYXA 3PSPA 1JXQA 3VUFA 4KVFA 4B2LA 3GFPA 3VKHA 1G5FA 4CL2A 5ESDA 1FQWA 1M1YB 2PU7A 1Q0TA 4HN2A 2B98A 3VU8A 1ZJYA 4IL6U 4IDGA 1P31A 4KAAA 2MWMA 1K6JA 4DPKA 4EY3A 3CA8A 3A0UA 4MX8A 1DZIA 1INLA 1TLFA 2Z09A 3HDJA 3RW9A 3E0XA 1JSZA 1AUVA 2E3TA 4QNLA 2E48A 4NNJA 2R79A 5E38A 2LCIA 1SHTX 5HS4A 3TQIA 3T5JA 2HW3A 1GZUA 4G0UA 5JPCA 1FSSA 2GXQA 3P94A 2J31A 5G1NA 2EDAA 1XZDA 3S2ZA 4A27A 2BISA 5IT0A 4Y98A 1IZZA 2GMWA 3KSDO 3UXNA 1E5DA 3OOSA 3WGNA 5J43A 4B87A 1PX2A 4QZAA 3L7AA 4YCBA 3EF1A 1UPHA 4YR2A 3F96A 1TV9A 2FOXA 4Q48A 3QHAA 5ECYA 1LD3A 4DILA 5T8KA 3A1VA 1GGEA 4YR0A 1CNFA 2GK3A 4MB2A 4JS0A 4RD2A 1IV8A 1LSJA 1VRCA 3TTWA 4BFWA 5DNUA 4MWZA 4E5NA 3A3PA 4KR7A 1UPCA 4ED8A 1DCMA 2E1FA 4UMFA 1EUCB 3CE6A 4A6DA 5J2CA 3PG5A 1Q7RA 3IVGA 2CBZA 1G291 3K0FB 4URYR 2YXPX 3H4DA 3BF8A 4P8RA 5ELMA 3SR4A 1A8PA 4WASA 1NA5A 4C2BA 4O2BF 1ES9A 3GJRA 3HYRA 3S44A 5BXQC 1TU0A 3MAAC 3OEYA 5KFDA 1YCFA 3FCUB 3OPYI 2F43B 1N2CA 2GFQA 3OSZA 5LUBA 1GN8A 1P0PA 1XEXB 5BSWA 1U1IA 2J5RA 2W2LD 3FVTA 3KTDA 4JI8B 3FHLA 2NUBA 3OP1A 3OJUA 2XD9A 3CIOA 1RWKA 2XCTB 4BP8A 9ICOA 3FDZB 2XE4A 4IJQA 3AT1A 3TNDA 4QQKA 4HEJA 3M33A 1K8QA 4ZYLA 1V6CA 2POQX 4OB6A 4U1RA 5JVDB 1CZNA 1OB2A 4QYXA 5T8KC 4JQZA 3PFCA 4R51A 2GO7A 2H3FA 1PVDA 1KZYC 2WU0A 4KN5A 1TECE 3ZCRA 4BMSA 1RJDA 5HW0A 2WILA 1JAXA 3MAJA 1H4QA 1USKA 2ZYGA 2EJVA 2AN1A 3F3SA 3PGA1 2H31A 2QSUA 1YZGA 3BICA 4OXRA 1QFJA 2ALZA 4F5NA 1A72A 2AVNA 1T15A 3I9KA 5BV7A 3FMFA 3EG5A 5A9TA 3P9ZA 3PNLA 3TDKA 1QCCA 3MS7A 2X14A 3AWIA 2AOUA 2QRGA 1NVKA 4NS4A 4QDZA 3CX8A 2XRYA 3GNQA 4LCBA 1F7UA 5HQ3A 5LP6F 1G8MA 1I94B 2YBEA 3QU4A 3A9VA 2JRZA 2W0SA 3M8RA 3AOEA 4Z4QA 5C8YA 3GVHA 4B09A 3RWBA 2QLFA 4N0PA 3IHTA 2G7MC 3K96A 1F8UA 2RI6A 4L16A 5DK4A 4EEYA 3THYB 4IXWA 1WWUA 3FROA 1VSTA 2V9CA 1YBFA 3GJ8A 4ZO4A 5HWSA 1TF7A 4D46A 2AH5A 1RU3A 4ZHQF 3KYBA 1IVYA 2L2QA 3BL5A 1ZSVA 3VR4A 4HQLA 1UT5A 2BHSA 2IF2A 4MUIA 4FNGA 2J3MA 1SEVA 4G5RA 2QR2A 2UZ1A 5KT7A 3ZYZA 3O74A 3TEFA 2X9LA 4DJTA 2VQDA 2PH3A 3QEOA 5L3RA 4XQ8A 1G8HA 2EW2A 1VRVA 3GEPA 1PR6A 3PRKE 4LSMA 1UBOS 2XY5A 2DKNA 2Y92A 3JRXA 3R4VA 2M0NA 1R5NA 2GN4A 1VJTA 3NHJA 3WNVA 3FBWA 4HX2A 3KWLA 4ZMBA 1J7JA 3F46A 3UT6A 1KSHA 3MW8A 4FHGA 4L51A 1NZJA 1YMUA 5A3JA 1PEAA 4LF7B 5KQRA 5G1PA 1FDRA 5KTMA 2XKJE 5IARA 4FCVA 3K53A 2P2ZA 2CWWA 4YMHA 1Q0UA 2WHEA 4UBCA 1STOA 4EY5A 1N2BA 3H05A 4IO0A 4QNRA 1FJXA 3QUQA 4V1CA 3OJWA 4IIVA 3STUA 4X54A 1B23P 4PHEA 3HM2A 2Z95A 2RJ3A 4QZ8A 1HRDA 1ED1A 1AV7A 1OBFO 3KB6A 3M5PA 3D6UA 1PRYA 1X92A 2IOFK 3G1WA 3GA0A 2R6HA 3QEKA 1N4AA 1V11A 2HWXA 4B84A 1MG5A 1BOFA 1DBVO 4F93B 1LDEA 2QGFA 1R4MB 4QHYA 4UDYX 4YLGA 4WBSA 1X87A 7ADHA 2QAGB 4YQWA 3NTRA 1Q20A 1VGQA 2HQBA 2PD3A 4JB3A 2QAIA 3OLCX 3K6SA 2XTAA 1NVAA 2HHTA 1OYOA 1VKOA 3ORRA 4EF5A 5L7TA 2FR1A 3A7DA 2PQMA 1AQIA 1RPJA 3B0XA 4H1VA 4M8SA 4X91A 5DVZA 4F12A 5DHSA 2RMKA 5J0TA 5IJZA 1HH4A 3O47A 4CZ2A 5AVWA 1OI4A 2BR4A 4CV2A 1U80A 3LECA 4QOSA 3GEGA 2VJLA 3DXYA 1YDWA 1H3NA 3DEZA 3KYDA 3VAYA 1PHPA 2DH6A 4O1HA 2HXSA 5CYOA 4Q43A 3SQIA 4DN6A 1FVFA 1FFUA 2XUAA 1KI1A 4BNJA 4PL1A 4QZDA 1DG3A 5DHAA 3V1TC 5FQNA 4DKXA 1Z37A 2I4NA 1EQ2A 2JD1A 1P44A 3QFHA 3UTDA 5AO9A 3B2EA 2TECE 1DC3A 2GR9A 3K5WA 1F6DA 4G1VA 4ZXPA 2DFLA 1YD7A 2C9MA 2O8EB 1GZ6A 1VE5A 3PIDA 2C2HA 3MINA 1KFSA 4Z53A 1KEWA 4H15A 4TLEA 1HE1C 3X44A 1EXMA 4HQFA 1NBIA 5IAAA 5A4AA 3A3YA 2HT6A 3EXG2 1PV2A 5K0NA 1N5OX 3X1XA 1PWZA 4X61A 4BO7A 1NP6A 4W9RA 2XB4A 4QD3A 1C30A 2C2YA 4MDFA 2CD7A 3B70A 4DS4A 2P2DA 4J7AA 3RG8A 3RKRA 5IT9A 3UKDA 2O3TA 4KH1A 5AFSA 5B2FA 2IEDA 2QL5A 3KQYA 4H4EA 1CUCA 5A7HA 5BVHB 3JQGA 2AEMA 2HBRA 4TGLA 2FUEA 1YDHA 3TQFA 3NTXA 1BSVA 1U48A 4EX7A 1EP2B 1S5PA 2WTXA 1WAMA 3CB4A 1C7QA 4FYXA 1NJXA 4Z4EA 1KY3A 2QSZA 4MNTA 1CUVA 1XOIA 3RS9A 2WWHA 1MB2A 2FX2A 1NQ5A 3H8SA 4PLGA 1P2BA 4WEQA 3N7RC 3WKEA 2EWWA 1OFUX 4U2FA 3MJTA 3TZLA 4DLYA 1GTVA 4KVAA 4MK4A 4CEHB 1U1CA 1SVKA 4HI0E 3EZYA 2BIFA 3A1FA 3LY9A 2WQZA 4IRXA 2AMJA 5KU1A 5KTPA 4A0SA 4M1OA 5EWJB 2AOTB 2ZVDA 3COZA 2YHBA 3BGVA 4FW8A 3BJRA 4JD5A 2BJHA 2I55A 4MZDA 2VA3A 5F23A 4OYLA 3U09A 1DUSA 2OZKA 2ZPTX 3BD7A 4EGQA 5C5CA 1I14A 1FFEA 3ECAA 3WHIA 4JYAB 3KKPA 5GGXA 3G5UA 3N0XA 4EI8A 4DR5B 1X1DA 2QVCA 8ICFA 4ZOLB 1RKQA 1T1SA 2DZDA 5AOVA 3GDFA 4YREA 5CVDA 2XGOA 3JZAA 5E0OA 2XB6A 1FFAA 4D0LB 1IM8A 5DCLA 5CFPA 1JEJA 3DGEC 3UCXA 4GU5A 3LK9A 2JH3A 3DHYA 4LYHA 5EOVA 4M0CA 3OX1A 4FZNA 4DSTA 2Z6QA 3ZK7A 1RWPA 2ZUUA 1VDZA 1ADFA 4O6VA 1O95A 5SYNA 2R5FA 2BE7A 5DB8A 4B6PA 4L8WB 5IJ0B 4B4WA 4Y6QA 1SKYE 4MV0A 1DWUA 1SU8A 4IDBA 4E13A 4EHDA 5JTIA 2O19A 2GZDA 2UYYA 4F5EA 5J1SB 4Y9RA 5B58C 5D3QA 4TLDA 5BV2P 3EPJA 2D13A 1EVYA 1KYZA 4O3MA 1XF9A 3G0GA 1EDZA 3NM6B 3ZWVA 2FGJA 1HM5A 3KRTA 1PR3A 1TMGE 4NCNA 2Q4DA 4W8OA 2OWDA 4J9NA 1P2FA 4KO1S 1FFXA 2NZYA 4GX2A 4CUJA 4Z2AA 4RJIA 5TEVA 4M83A 4TKUA 1CIJA 2GZRA 1X9MA 1ITZA 2J45A 3SHQA 2P4UA 3E8MA 3R5XA 4BLWA 3P27A 4CV3A 1EM8A 1OHHA 3UGTA 4ZZ0A 3E3MA 5ALTA 3V9AA 1X2BA 3ZIAD 5LNK6 4FIZA 3ZE6A 5C7YA 4XM2A 4MVJE 4N8SA 1ZA2A 1Z82A 3K35A 2C7OA 1RYZA 4Y0NA 3ANYB 4YUZA 4BKOA 1S2OA 5GIPE 4Q3BA 1PR4A<