3KD3A

Crystal structure of a phosphoserine phosphohydrolase-like protein from francisella tularensis subsp. tularensis schu s4
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
216
structure length
216
Chain Sequence
MKNIIFDFDSTLIKKESLELILEPILQKSPAKLKEIEYITNLGMQGDISFRDSLQKRLAIASPTKQSIKEFSNKYCPNLLTDGIKELVQDLKNKGFEIWIFSGGLSESIQPFADYLNIPRENIFAVETIWNSDGSFKELDNSNGACDSKLSAFDKAKGLIDGEVIAIGDGYTDYQLYEKGYATKFIAYMEHIEREKVINLSKYVARNVAELASLIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a phosphoserine phosphohydrolase-like protein from Francisella tularensis subsp. tularensis SCHUS4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Unknown function
molecule keywords Phosphoserine phosphohydrolase-like protein
total genus 74
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12710 HAD haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 3kd3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3kd3A01
1Z4QA 4CNQA 3NIWA 4I9FA 3SLRA 1RMTA 4F72A 2YY6A 1ZRMA 5ALDA 5AVQA 3PDWA 4KNWA 4I9GA 2AH5A 4CF4A 2G0AA 3WK5A 4HGNA 2HOQA 1RC8A 2CFTA 3AR7A 4BEVA 2OA0A 3U7GA 3QU2A 2HO4A 5FP0A 1QQ5A 3WKCA 5AI8A 4Y2VA 2FI1A 1J97A 5AESA 2EAUA 2QLTA 3PGVA 3IB6A 1S8OA 4XOUA 3L8FA 2PKEA 5AVWA 5AK6A 2G80A 1Q91A 1L8OA 5ALGA 1RDFA 2HCFA 3HLTA 2WF6A 3L8HA 4XPZA 4RESA 3AR4A 5ALVA 2W4MA 4MWOA 5AKLA 2VKQA 3FZQA 5AW2A 4B6JA 1O03A 3EF1A 5AIAA 1RKQA 4BX0A 1TJ5A 2C4NA 2B82A 4UU0A 2YBDA 2B8EA 3OTQA 2I34A 3WKBA 2AMYA 3BA6A 5ALUA 4BX3A 3NRJA 3NAMA 3OCVA 2ZOSA 4Y2QA 3I28A 4L6AA 3DDHA 2JAUA 2FDRA 2PQ0A 2PR7A 5ALSA 2R8ZA 1VJRA 2C88A 5AW5A 3N8GA 4GXTA 5AM4A 2YJ4A 5AI6A 4YCMA 2X4DA 1U02A 2BY4A 5AVTA 4JDPA 1SU4A 2ZBDA 4HGQA 2HX1A 4HGPA 3P96A 2Q5EA 3NANA 3HYCA 3NASA 4XQ0A 1VJ5A 4IFTA 5A3QA 3E58A 3VAYA 1YV9A 2C8KA 2HHLA 3MN1A 5ALNA 4PNHA 2NYVA 2QYHA 1F5SA 3R09A 3ZI4A 4E88A 2YJ6A 2CFSA 4CE6A 4UAUA 3WKDA 2HSZA 2YJ5A 3ED5A 4XE5A 3KOOA 5ALWA 2FEAA 5AW6A 4KN8A 2NO5A 1SWWA 1X42A 3DV9A 3N28A 2R8YA 3AR6A 2YMQA 3AR5A 2G08A 4BEWA 2OBBA 3ZX4A 3N07A 1QQ6A 4J03A 3UMCA 2YJ3A 2JARA 1XPJA 1YNSA 2FPWA 1NRWA 4QQFA 4MUMA 4UAVA 3L1VA 3WKEA 4Y2XA 3MC1A 1QYIA 5AKGA 5E0OA 4G63A 4BNDB 2RARA 4Y2JA 5ALOA 2FUEA 2GO7A 5AICA 1ZS9A 2MU1A 4QJBA 2FPRA 3FPBA 2GHQA 1ZD5A 1WPGA 5AI9A 3U7HB 3KDPA 5AK5A 1VFPA 3BWVA 2BDEA 1L6RA 1U2TA 2I7DA 3UMGA 3PCTA 3QNMA 4AS2A 5AK4A 5ALLA 3I6BA 3QU7A 4OD0A 5ALFA 2HF7A 1NNLA 5AW4A 3OCWA 3FM9A 4UM7A 4F71A 1WZCA 3U7EB 4Y2UA 3L7YA 1WVIA 1Z5GA 5IS2A 4KYTA 3J7TA 1O08A 1N9KA 2CN1A 4EELA 3I76A 2O9JA 1Z5UA 3EPRA 1KYTA 2D2VA 4Y2SA 5ALXA 2CFRA 4DFDA 5IT0A 4UMVA 3SD7A 2WF9A 3L8EA 2I33A 3R9KA 3OCYA 5ALQA 1ZJJA 5AW7A 3SKXA 1Z4KA 3ESRA 3M9LA 1T9ZA 4G9BA 5AVUA 5AW8A 4EX6A 2JAWA 3WK6A 4H1WA 2ZBGA 3A1DA 4BYGA 1QH9A 3QXGA 2YN4A 1YS9A 4HAIA 3ZTWA 2G09A 2G07A 3QUBA 4YGYA 2OM6A 1ZD3A 1XVIA 2YMPA 1L7OA 5AVRA 1Z88A 2C9MA 2B1QA 4EEKA 1Z4NA 5AKJA 1JUDA 2GMWA 1TA0A 3WGUA 4UW9A 5ALIA 3WK7A 3QUCA 3SHQA 4UMEA 1RLOA 1RLTA 1ZD4A 1Z4PX 4Y2RA 3WKAA 4Y2YA 1TE2A 4UMDA 1LVHA 2BDUA 4HYTA 4ZEVA 2IOFK 3ZUPA 5AIBA 2P27A 4UARA 4EZEA 5AVZA 2EARA 5ALTA 5IT4A 3QYPA 5AKIA 3ZTYA 1RQLA 1RQNA 2WFAA 5ALEA 4OHFA 2RAVA 3ZVLA 4YCLA 5A3RA 5AI0A 5AVYA 5ALZA 3WK4A 1CR6A 3E81A 2P9JA 1Z4OA 3MPOA 5AW1A 5AW9A 1L7NA 3SKYA 3OPXA 3FPSA 1WR8A 3AR2A 2ZBEA 1Z4MA 4EX7A 3ZW7A 3NUQA 2YMLA 3L8GA 3W5CA 2HF2A 2WF7A 4L57A 2IA5A 3E8MA 5AKKA 1L7PA 2WM8A 2WF8A 3CZ4A 3KZXA 3A3YA 3B9RA 3MMZA 4O8CA 4YCNA 3L0CA 3QUTA 3WGVA 3U7FB 3ZU6A 5AKZA 2MSNA 4UM5A 4YIHA 3ONNA 1RKUA 3AR8A 1K1EA 3WK8A 5AW0A 3W5AA 3QU5A 2NO4A 1TJ4A 1RMQA 2EATA 3L5KA 4YIKA 3FVVA 4Y2PA 3QUQA 3S6JA 5AM5A 5AVSA 5AI4A 4EENA 1ZRNA 1IWOA 4Y2TA 5ALHA 2B8JA 3FGOA 4NWIA 1YDFA 5AM3A 2C8LA 3KD3A 3ET4A 4C4TA 1U7PA 3OCUA 2IOHA 3EF0A 5ALKA 1SWVA 2ZXEA 5T41A 4C4RA 1RKVA 1N8NA 2YMMA 2P69A 3ET5A 5ALRA 1FEZA 3SF0A 5AM1A 4RETA 4FE3A 1NF2A 2ODAA 3L1UA 1AQ6A 3IJ5A 4OCZA 2B30A 1T5TA 2I6XA 1QQ7A 1T5SA 5AM0A 3WK9A 3TLMA 2GHTA 1ZOLA 4DCCA 3E84A 4BKMA 4DWOA 5ALMA 3M1YA 4CF5A 1EK1A 3DNPA 3KC2A 4OFZA 2FPUA 2FPXA 2Q4TA 3OCZA 1RLMA 1PW5A 1MH9A 2FUCA 2GFHA 2IOFA 3RF6A 1RPZA 4KX3A 4AP9A 3ESQA 4AS3A 3N1UA 3ZVNA 2W43A 2OYCA 2DQSA 5ALJA 5A3SA 3UMBA 3UM9A 4L6CA 3KBBA 2HDOA 4UASA 4GIBA 3U19A 4FFDA 2O2XA 5AW3A 3W5BA 2FPSA 4Y3UA 2JAOA 2AUTA 5AM2A 4HGOA 4CF3A 5AK3A 5AKXA 1Z4LA 3AR3A 1CQZA 2JGAA 4ZEWA 3QGMA 2HI0A 4HGRA 1U2SA 2I54A 2RB5A 3W5DA 1Z4JA 4C4SA 4JB3A 1U7OA 3DAOA 3R4CA 1S2OA 3PGLA 4NV0A 4J2TA 2ZG6A 3NALA 5AKEA 1RMYA 3K1ZA 4KNVA 3ZWKA 2Q4RA 4UMFA 2AGVA 3F9RA 5AI5A 2WHEA 5ALYA 3QX7A 2B1RA 3B9BA 5JJBA 2G06A 3L0BA 3U26A 4YH1A 3B8EA 5AKYA 2HEGA 1L7MA 3QLEA 1EK2A 1Q92A 4DW8A 2B0CA 5AVXA 3CNHA 2YFYA 5AHXA 2I55A 4BNDA 3SMVA 1LTQA 3QU9A 1YMQA 4FYPA 4KX5A 2ZBFA 3GYGA 3RFUA 3ZVMA 2RBKA 4NFLA 2W11A 5AVVA 3I1YA 1TJ3A 2G1AA 2IYEA 1RRCA 3ZWDA 2R8EA 3A1EA 3D6JA 4BBJA 3U13A 1J8DA 4NABA 3EWIA 1L8LA 3OCXA 1ZD2P 1Z4IA 4BX2A 3L0YA 4IG4A 4NAVA 3IRUA 1YJ5A 2R8XA 4ZEXA 4UU1A 3AR9A 3QU4A 3N5KA 1Y8AA 3A1CA 2P11A 5ALPA 2WF5A 5AKHA 3ZX5A 4UATA 1XP5A
chains in the Genus database with same CATH superfamily
1KN5A 1SC4A 4JLMA 2IYYA 3IMEA 4RXUA 5LC1A 1FDVA 1MVOA 4EHAA 3STWA 3TARA 4BXOB 2EX4A 3G9TA 4PGMA 4WEQA 1S0VA 2A8YA 3E9MA 3MIIA 2FEWB 4X6UA 1DFHA 4G4IA 5JNVA 1FQJA 3KT8A 4RAQA 4WCFB 5I9IA 3KJHA 1W35A 3BRSA 3RR8A 3T99A 1PD0A 1ZM2A 2ODWA 2XZDA 5T3YA 5A4JA 3R76A 4PONA 4YRRA 5F7XA 3T95A 4WA7A 4UHKA 3PMLA 1MMFB 5KOIA 3MCUA 5HILA 3SF8B 1W88B 2GB4A 4E4RA 1U8TA 2IY7A 4RHXA 2WJHA 4N8SA 1TU0A 2PJZA 2JFQA 2WUVA 4I29A 2FFJA 5HZKA 3QG5A 2FZ5A 5CX1A 2LI6A 2DPMA 2W2KB 2DXIA 5L1IA 1TK3A 1CCWA 5L1JA 4HDRB 1JZSA 3EHEA 3Q9NA 1GADO 1XV5A 4YV1A 3FTQA 3AFGA 1Y8QB 3WWPA 1SKUA 3JS5A 1E5QA 3JRXA 4IXDA 2OSVA 2P65A 1D9ZA 3ZY2A 2ZWVA 3TD2A 3INGA 3ZBQA 5KYWA 2PXIA 3C41J 2BM1A 1BG6A 1NSTA 3QI2A 4UCWA 1GG8A 1GCOA 4J6EA 1Y8RA 4ZCLA 2W03A 3SLKA 1PAUA 2B5VA 3LX4A 1L4EA 4TMZA 3RR7A 5AW2A 3EPIA 3H42B 3JZAA 2O2EA 2F67A 1UIMA 2XUDA 2Q62A 4U7JA 4ZRNA 3H2KA 3BSFA 4WACA 1TJ5A 2VRNA 2XNKA 4XCQA 4D9NA 1BPBA 3MINB 3PGMA 1JWBB 3BXZA 4R6XA 4DUGD 2K7ZA 4BJHB 2PANA 3SIXA 3H8JA 3OWOA 3OZFA 4QW8A 3TBFA 1F0MA 1X9GA 1NLMA 1YASA 3PFHA 4GRDA 4M98A 4RFVA 4XX0A 3RIXA 1XMQB 3TNLA 5AVOA 4OIMA 4CM6A 4QTYA 2CB0A 1UA0A 2EGUA 1KJNA 3FFWA 3ML1A 5LXTF 3NC1C 1V5IA 3OE5A 4UNPA 1Z5PA 1TCBA 4MQ5A 4GL4A 4RFSB 1Y7PA 5T57A 1JSRA 3SFVA 5AI6A 4E5YA 2IXEA 3JZIA 3IAAA 1U02A 3W5JA 2RBGA 3U62A 3R3JA 4Y6OA 2AOUA 4B44A 5C7LO 4GKBA 1BMTA 1JN3A 2QRZA 3HQ4O 2HWYA 3RARA 4D8YA 1N6PA 1HE1C 1RI2A 2R4QA 3BVPA 3DD1A 3I9NA 3P96A 4HFMA 4NH4A 2XUFA 3PC2A 1BHQ1 2BE7A 2RH4A 1TAMA 2FLKA 4BU0A 1VJ5A 1QGAA 8OHMA 4PHAA 1JI7A 2XVTA 4KE6A 4LISA 3BQ0A 4R5MA 5KFJA 3TTWA 3H5AA 5LLDA 4I5IA 4GOKA 3UB3A 3WJ2A 5HJ7A 2W6OA 4LNUA 4DUGA 3BKWA 1EK6A 2X9GA 4JYCA 4QVGA 2AW5A 1QYCA 4ARCA 3K9QO 1L4MA 3CJQA 2W8KA 3ZI4A 4P4UA 3ULKA 3JYHA 3TAQA 4JI6B 2O2ZA 5L3QA 1QYVA 2PE5A 1Z8FA 2A5JA 2GDZA 4DF3A 4CMEC 2XOKD 1YB4A 2ZAGA 2W8LA 3ECAA 4HAUA 1I4OA 2H9AA 3KYCA 1EFTA 2XJ9A 3RAXA 4QDKA 5KDOA 1YFLA 1H4QA 1ZQVA 1PJZA 4IH9A 3UAZA 2OQ2A 1GT6A 1H2XA 1R0CA 1Z83A 1HYHA 3ZQUA 3IBFA 2IUTA 3IJPA 3R23A 3G6KA 4CFSA 4DLNA 3NG1A 3AU2A 4FNAA 4LQDA 3EG5A 2QTHA 1KJJA 1H23A 1EVQA 2YMQA 1M2KA 5CXUA 1AUPA 1MABB 2ZRJA 3R8CA 3U4MA 1CQWA 4YXJA 2QE6A 1TQ4A 2H1VA 5CVCA 1MB3A 4M9XA 2D74A 4LBZA 5DYIA 1SXJA 3OF3A 1EP1B 1VTKA 3RJKA 1D6MA 4JC4A 3W3AA 2I7TA 3JAKB 5BSWA 4NCIA 4D92A 3C2MA 1NLZA 4FHEA 3PA6A 4ONEA 1H05A 4DLXA 4MQFB 4KFUA 2RCYA 3PXUA 3V2UA 3VR3A 4HPWA 2WKWA 3DP7A 4UUMA 4HLDA 5FWYA 3F2IA 5J2AA 1Y8QA 2HWWA 3BFXA 3BUSA 2FPRA 2OCBA 2OY0A 3WGMA 3RAQA 1MVLA 3RU2A 4TSKA 1XWLA 1TAQA 1YR3A 4ENTA 5AI9A 3NPMA 4YJDA 4ZN6A 2WAXA 5KG4A 1VI2A 3J81k 2B37A 4YACA 1LLQA 3GW8A 3QI7A 1B6SA 4A2CA 2MYUA 4O3QA 4YLYA 4W9MC 2BKUA 2CHEA 1XRQA 4NYJR 2LMRA 3PCTA 2JLQA 4TL6A 4Y9DA 4DY6A 1EKXA 4F4IA 3NT2A 1KK0A 1S97A 4DLYA 1TD1A 1CF2O 4EG0A 1E2NA 1JQDA 4QOHA 4KBYA 1GCUA 1SCJA 2FFQA 3L3FX 1JJIA 4RQ2A 1YQGA 3RTDA 4CNBA 1PFKA 3VR1A 4FLMA 1YAJA 4XX0B 3L7YA 2VPXA 2P2SA 4EHKA 1GWNA 2I3ZA 3MUNA 2O2JA 4MVXA 1A9PA 4JYBA 3EOAI 4EELA 1KNXA 4PG5A 2C7RA 1Z5UA 5KJ6A 3UG7A 2ZSBA 5DHQA 4EA6A 2DL0A 3BCUA 2C58A 4WE3A 3KCQA 2QRNA 2NQ8A 3CIFA 3M4YA 1WXIA 2O0KA 1R9MA 2Z2XA 1A4IA 1E1LA 3B1ZA 2W93A 2XY7A 1WXFA 3CTMA 2V45A 3M1IA 3PNOA 2D8CA 4HSEA 1ARZA 2CZQA 1X7XA 2YIDA 4IAOA 4JLUA 2IW3A 4O3RA 4XD7D 4JGBA 1XWIA 3ZY5A 5J2UA 1YKFA 3DZJA 3CNLA 2CKMA 3O0DA 1QFXA 1E20A 1RLIA 1MB2A 3UHJA 4K9RA 9GPBA 5F7JA 1Y6GA 3NYQA 4N39A 1NX6A 1LWOA 2HQOA 3QENA 4DPLA 2FK8A 4JP2A 3SC4A 2WIDA 3TRDA 1QDEA 4ZYWA 1JEQA 1E2LA 2C78A 3CEJA 3B8HA 4G23A 3VPFA 3K8YA 3IMFA 4TSFA 1U45A 1GT91 2UVUA 1WZUA 2A67A 2PSSA 3GMIA 4YS6A 1TKRA 3TSCA 3BS5A 5LQDA 2I6TA 1VDMA 3RF7A 4TRJA 1L7OA 3M5CA 3EODA 2XUZA 4D97A 4FR0A 2QB1A 1J7KA 3I37X 2Y92A 3D9QX 4OUDA 2BPOA 2DUUA 1KXZA 1LW6E 4R2MA 4RM3A 1Z75A 3TMAA 3WWZA 5K8VA 3QUCA 4TL9A 2ZQYA 4FBGA 2DBRA 5BSFA 1P18A 1ZSVA 1ZD4A 1SB9A 2X2EA 2XD4A 1YD7A 2CJWA 3HA2A 4AX4A 2V97A 3P8ZA 4A27A 3PUKA 3F7MA 1Z8DA 4IV5A 2VSQA 5KNCD 4ZARA 1LVHA 1UWLA 4QUDA 4ZZ0A 4RTQA 4E2FA 4BX9C 4YAFA 4ZEVA 4L8LA 4CLDA 4F7DA 4KR0A 4Q9IA 5AIBA 2BCVA 3VC3A 1UFVA 1RAEA 1BFUA 1DXOA 1ESMA 1XK7A 2M1ZA 4UARA 2XB8A 3LC1O 1ZO8A 3GA0A 3PGJA 2Z95A 3QTBA 1ZSNA 3UO8B 3RAGA 2CBXA 2HBMA 2JEIA 1PTKA 3GIDA 3HWSA 3KHLA 1KAHA 4Q4JB 3C8UA 4TTJA 2LPMA 3KETA 3A2KA 3AJAA 1XMSA 4NU5A 4PXSA 4BU1A 3FBWA 1TM3E 4PG4A 3CT4A 4WECA 2ASLA 1QIEA 2CLCX 3DWFA 3EC7A 4CMHA 1HE4A 2HRCA 3CU5A 4NPAA 5LQKA 2VK1A 4JSTA 3GVCA 5JFTA 1E3EA 1F0YA 2C3OA 2YVQA 3WGTA 2FMKA 1H85A 1RYYA 3E9RA 4AVYA 5BPCA 1U8UA 3HXOA 1VHDA 4TKZA 3C1YA 8ICIA 3QWAA 2GPAA 3R5HA 2OO7A 2PFKA 4Z0PA 3SSOA 1R6VA 1R10A 3TOCA 2D5AA 5KFSA 3NTQA 5AW9A 2OAGA 4NAUA 3UXEA 4FJ1A 2W9XA 1OXMA 3JWHA 5C4IA 4DM3A 1OXSC 3DMGA 3NPAA 4H08A 1YA6A 1EX6A 5FIUA 4TSRA 1IIBA 2OE2A 3WLPA 1IZ7A 3CO0S 4KI7A 4N6OA 4NCKA 3ZS8A 4O3PA 1CY8A 5TSDA 2EZZA 2W9CB 2PFNA 5CXXA 2H08A 3HXPA 2VA2A 2GJKA 3FAHA 4MR8B 2G9NA 3V8MA 1L7PA 5HKBA 2YTUA 1FQKA 1HDIA 3JPYA 3Q9LA 3DLHA 1TB4A 3KVRA 3PZBA 1DEOA 4NKRA 4PPQA 3OECA 1JHMA 2I6SA 2NUPB 1FXUA 2X9QA 1HTBA 2QF7A 2ZYIA 3BXGA 3RC9A 5IXJA 3KOXA 3BOSA 1AKRA 1T3NA 1BJTA 1ORWA 3DMTA 3NKLA 4IJUA 4IS3A 4LK3A 3PEYA 4ZU3A 5BQPA 4Q9KA 4I66A 3NDRA 4AJNA 3SHFA 5AH0A 3ZBUA 5A2QA 1UBFA 5DHAA 1IMOA 3PBKA 4GG1A 3VKFA 5COAA 3AW8A 4IZOA 4Q12A 1X38A 4J16A 3NBZC 4Q7KA 4LA4A 5JCZA 2KPOA 1DQZA 2W8ZA 4COOA 1M72A 4REQA 4OHKA 4MXDA 3V48A 4B40A 1SOWA 3TEFA 3H5VA 1DKRA 3R3VA 3RRNA 1R9JA 2Y1DA 4N3BA 2FUNB 4AWBA 3ITNA 4E5DA 1JVBA 4R2KA 5L3ZA 1C7QA 1L1QA 1A95A 3RTEA 1SC9A 4YRJA 4FHGA 1C29B 1UFQA 1IWOA 2Y68A 3HJGA 4MYCA 1YK1A 5LZ7A 3BREA 3X1YA 2EP7A 2II6A 2X15A 4RKQA 5A3VA 1Z16A 2AV6A 4RA6A 3ZWQA 4A9AA 4ANFA 2KMLA 3TKAA 3Q6NA 3LWMA 5K3EA 2DWUA 3ZV5A 4G1EB 3X43A 2JW5A 1F20A 3VZQA 4BATA 4BN0A 5H4GA 2X4GA 3B3JA 3LRTA 5ALKA 3N0RA 4PYQA 3U9SA 5T14A 3E7FA 4RNOA 4ZT3A 1NE2A 2CVHA 5ALRA 3ET5A 3FAZA 1U8EA 2O20A 1GUDA 3LZ6A 3KZMA 2GEUA 1ZIXA 1JIKA 4GBED 1TA9A 4PZLA 3JTEA 4FE3A 1N5OX 4P4LA 4AO7A 4EVSA 4OLBA 2H3IA 1P4SA 2HHQA 1EX7A 2BEWA 2ODAA 5EWLA 3ZHBA 1V4NA 2GILA 3HYNA 4PVDA 4TWZA 1DO0A 4EEXA 4DDWA 4J07A 1OW3B 5BSKA 5BWNA 4MR7B 5DHFA 2IL1A 2ZR8A 2K87A 3BDVA 3PRKE 4LXXA 4E11A 3ZHOA 3ITDA 3E84A 1DG3A 2F62A 4RPGA 1DQYA 2KIVA 3EMBA 5AYVA 4LMRA 1TKAA 4TXJA 1ZWKA 3DNPA 2JLAA 1A1SA 1IH8A 3DVAA 4BJ6A 3GVPA 2H5IA 1T2UA 1S9FA 2AI3A 2FPUA 4C7MA 1KZHA 4EB3A 1M2FA 2O1SA 4RD2A 4WZZA 3M0EA 1USVA 3TLXA 3UW1A 3L18A 4L4RA 2CJYA 1EESA 4ZAXA 1V6SA 3K53A 3VR2D 1E8NA 3QVOA 4KR2A 2BFWA 2PUGA 2H4ZA 2X5NA 5F78A 2WJ3A 2IPMA 3AIOA 3M4XA 4NCJA 2OYCA 1J2RA 2GEFA 4WLVA 3L9XA 2VUHB 1SXHA 4XIFA 5C35A 5DXAA 3T9AA 4UASA 1PFGA 1W5FA 2B8NA 3E2PA 4DC1A 1SXIA 1THMA 2H52A 2XCLA 1MOQA 5AW3A 1YOVA 4Y3UA 3AB8A 1F38A 1ZVQA 4ZVNA 1WDMA 3QG1A 4O4LA 4KRXA 3UIEA 1NFRA 2BFNA 4M22A 4BO1A 4DL9A 2EX0A 5DASA 3OH8A 2RHLA 3LUCA 2PL9A 3REGA 3MCTA 2VDWA 1CR2A 2LYHA 1XN1A 3HV0A 3IG5A 3GLIE 4KLLA 5CX4A 4XGQA 2Z6VA 1N8SA 3IODA 1JG4A 3H0MB 1QS0A 2AJBA 2NSHA 4WTOA 3HJNA 3E03A 2EL9A 4QBFA 4X5OA 1I4TD 3I32A 4IJQA 3ZIUA 2J9GA 3KZIU 4RHTA 1ZHFA 4CDGA 4H3KB 1WPXA 2VXCA 4PLHA 1FW6A 1U7OA 1BA3A 5DM4A 5M29A 1KQFA 3HCBA 3VYRB 3PLRA 4FIDA 2Q0HA 5AKEA 4WKBA 1YDEA 4H4CA 3A3PA 2IPNA 4PYNA 4XLLA 1F8FA 3FSGA 2A0YA 2AGVA 5AI5A 1MABA 2B20A 2WJGA 2YTZA 3ESXA 3HSSA 3KU1A 3SP1A 2HHSA 4D0LB 1QPZA 5IWAB 1AH2A 3WLJA 4TVSA 4HYQA 2NN3C 5SZJA 2Q2OA 4TZKA 4CGYA 2COUA 2QUZA 3H1GA 3QH4A 4MA5A 4N3CA 3R7DA 4V1CA 5A6VA 1WBJB 3GLKA 2GK7A 4CCWA 3BJZA 3RHTA 4A8TA 1SBZA 4LI0A 1NSYA 1E9SA 1KIMA 5HIIA 5J0TA 4DLKA 4YPVA 3EZYA 4KU4A 3A3NA 4LI3X 4JJAA 4CR8A 4IDHA 4CI0B 4MKHA 2CUKA 4WNCA 4DV2B 2H5LA 3BZBA 1H0SA 1NBEA 3TIXB 5LFAA 1K6XA 2Q7OE 5CG2A 2ZBFA 1Q1BA 4RJJA 4OXNA 2LHTA 5CWRA 2KTQA 4R3UC 5BXQC 1A88A 1RZ3A 1IY1A 1E9RA 1NXWA 4G26A 4C7XA 1ZW6A 3NBFA 5HKKD 4GX5A 2UV8A 2ZIVB 4B3RB 3VRHA 1G2IA 1ODSA 3M3DA 4ZI2A 2JANA 1JEDA 1I3NA 1PNQA 3A37A 3CURA 3ECCA 3TIGA 1DE0A 2DQ4A 2Q27A 1NVAA 5LA6F 3LY5A 5K5EA 1XTQA 1JMKC 5TF0A 3ODPA 1PG0A 1M8PA 1F3OA 1SCQA 1Z4IA 3DPUA 5KFDA 1Y1PA 1N0UA 6GPBA 5KG3A 1YTLA 3RJJA 1VJCA 1AGXA 1MT3A 3HS3A 2LRHA 3B9PA 1ZM4A 3ZCXA 4RK4A 5HKAA 3I8SA 3B0YA 1RYRA 3NIDB 5DWVA 2D13A 4B79A 3VPXA 4CBVA 4DIKA 4NK4A 1EU1A 1TI7A 2B6NA 2WF5A 5KNCH 3FOCA 1M83A 2PYZA 1UT5A 1DOZA 1Z6ZA 2BL4A 2ZS9A 4XCVA 5J4HA 3AVTA 2P5YA 2EDAA 4GOLD 4D3FA 3ANTA 2JI4A 1FYDA 4RPCA 2GN1A 5A0VA 4U9UA 5ENVA 1XS9D 4BFWA 3ENZA 3NS1A 3ZWVA 4OJ6A 1ZQNA 1U9CA 1JHVA 2FVYA 1UXHA 4MR9B 4YVZA 1M8FA 3E15A 2B3TA 2HXYA 2R79A 2EZ8A 5FTNA 2BM8A 1NVBA 1E64A 1T2NA 1T36B 2VZLA 1NBHA 5HMLA 3IELA 4RKYA 5LZ9A 4YUXA 3I5XA 4DL3A 1RC8A 1DS6A 4DSUA 3U5ZB 3OZBA 1YOVB 5CRIA 4ECVA 2WIFA 1GAWA 1GDHA 5ILOA 1OB2A 1K5DA 2IYWA 3TPFA 1DBVO 1GU7A 3N7AA 3R5JA 2Y93A 2VRWA 4XIGS 3JAKA 5J40A 2VF4X 2WAOA 3N74A 2WU1A 4LPSA 3S1LA 1L5VA 4YMUA 2EAUA 2JZNA 4R05A 2N0SA 1E9DA 1NJGA 1MNAA 3WGNA 4TLBA 3N8HA 1KKMA 3PGKA 4ZVUA 2BEKA 2Q6VA 4IQ0A 4XDZA 4OQ4A 3G2MA 2MSCB 5AHRA 3WX0A 1MA7A 3VR6H 1QG4A 3PXEA 2VRCD 4PLZA 1AZWA 2NVUA 4X1OA 2HHWA 3KUCA 5KOJB 1TJPB 4S0XA 2QX8A 1E77A 5CB6A 1P2FA 4RABA 3FNIA 3N6XA 4KXVA 4RPYA 3RSGA 1K7SN 1T9BA 4AJJA 5INTA 4YP1A 3CMCO 4BE9A 1HMPA 4OJLA 5MGBA 2W4MA 3D3KA 2QBYB 1AUXA 4ELTA 3MCZA 3AUJB 1N3BA 3EDCA 3F5SA 4WRRA 1H0RA 4M89A 3LGSA 3WGZA 3DNMA 4BFXA 3T5AA 2OD9A 2OQIA 5KX5F 2IXFA 4QXPA 4R1OA 4YCXA 2I34A 3WKBA 2C2OA 3A2MA 4I2VA 2XY6A 3BA6A 4LYFA 4ZQCB 5ALUA 4D98A 4EF4A 5L53A 5FPTA 2IXDA 1R16A 1ZGJA 3WRYC 4OB8A 4YX9A 4QPCA 2BKEA 5JCPA 1ZU4A 2GSDA 3UWOA 6NULA 1EFPB 4IQVA 1S0NA 4YRMA 2PZLA 1UK7A 3H9JA 1H3NA 4KVAA 4G4GA 2Y9UA 4RKWA 2WVGA 3ZHVA 4BVLA 1SQ0A 4LZZA 4E03A 4DR7B 3RIMA 4FM9A 4JWTA 3C2QA 3K0BA 3H0KA 4HGPA 2FTKE 2WUEA 3THRA 3G59A 1OV6A 4GHWA 3HYCA 3NASA 2W7OA 2R44A 4ALMA 1NJWA 2AZDA 3HO8A 5IAKA 2Q29A 3KEGA 2ZBVA 4CG1A 1K68A 3D7KA 4FN4A 4KIUA 2WWIA 1S4MA 3IVRA 3WMXA 3NDPA 4PNHA 4K0KB 1XD9A 4R3WA 5AJWA 3WLHA 4G3IA 1XRJA 2XNCA 5KSPA 4LZOA 3LDUA 1F5SA 3P2EA 4D8WA 5BT8A 2WA1A 2GM4A 4DHWA 4IIFA 1BPDA 4HQ0A 2XGJA 2XQFA 4FFPA 3FOEC 3NVAA 4UAUA 3DEIA 2HSZA 3NYRA 4TN5A 3MGAA 4YRQA 2AOWA 5DNEA 4UBLA 1PV1A 5E6UB 3IDFA 1MX1A 1UL1X 2Y0BA 4M87A 2CVFA 1CI4A 1XDSA 2QUAA 4RVSA 2CV2A 4K1XA 4ZCPA 1OFUA 2AMFA 3IESA 3IH5A 3DV9A 1XNJA 2Q4OA 1ECBA 1BQEA 1EBBA 4QOSA 5BRNA 3DHVA 2YDYA 1PD1A 2OAP1 2YWRA 5CR9A 5M04A 3T1OA 5L7YA 4PIVA 5CNIA 4IRDA 1CRXA 1ISSA 5BR8B 2I8AA 3LT4A 5G0SA 3FYUB 2QIOA 1M2VB 1QQ6A 1AXRA 4G1FA 5DG7A 2GBCA 3PEFA 4G1BA 1MX5A 5J9FA 1DGJA 3P0JA 3ZWCA 1QCCA 4JYAB 1Z6TA 5GZ1A 4HI0E 1QE0A 2D00A 5B6JA 4QNNA 5GJWC 5KT5A 4O5EA 2I8CA 2IV7A 4WNAB 5TQ0B 4KXMA 5IJ0A 1MXFA 2XCSB 3ESYA 3SBEA 5TEWA 1Z47A 4M9JA 2PFPA 4LCJA 3UK1A 1DINA 4Q43A 1C7ZA 1L4HA 1LV7A 1WPRA 2ASEA 1CJCA 2XWQA 4QELA 4RLSA 3RS8A 3H2BA 3HJFA 5BO5A 3OZVA 2OB1A 3V6JA 5EE0A 1M6VA 1WPGA 1WDTA 2XQVA 1NKSA 4JJGA 2GLEA 1NZJA 2PMZC 2VSYA 1KE1A 4YMHA 4KPGA 1VZ2A 2IBMA 3G8CA 4AUKA 3PX4A 4RVUA 1OBOA 4I1IA 3WBBA 2OBNA 3WGHA 4CHTA 2GN2A 3KZNA 5D3MB 2H06A 3L93A 3C23A 1WYGA 2L17A 5CM8B 1QE5A 1R0ZA 1CBUA 1N8KA 1U7DA 4OJQA 1V9PA 2IIVA 2Y71A 2BJHA 5BQXA 3G3EA 3ICVA 5DW3A 3MTBA 3SQMA 4EGSA 4Y2UA 2UZ1A 2V7PA 3K4PA 3QVMA 1W59A 3Q8RB 1D04A 2VYNA 1A9OA 4HWSA 1O6GA 3VVMA 5HVNA 2J3HA 2NT3A 3TEMA 2ZB7A 2O8FB 3EPRA 2PKYX 4RTMA 2B8TA 3K35A 5EQTA 1RQPA 4W7SA 4XQCA 1K7EB 4OAPA 1OIVA 3SD7A 1D07A 1QHEA 5ECDA 2B8WA 2P6UA 3ZCPA 4E51A 1PJCA 4MW2A 1XLWA 2FMFA 5ALQA 2PBLA 3CSDA 5TQVA 1OBCA 1NONA 1D1PA 1U04A 3OCJA 4RZ2A 3E22B 5K3SA 1VLHA 5AK0A 4HN4B 2ZS8A 2ZXFA 3CH7A 5IDXA 1U0RA 5E8JA 5KFWA 1I4DD 4BUZA 1TZ2A 2CHUA 4XQGA 4ZA2A 4TKLA 3TUJC 4U9IS 5HCNA 1XDZA 1ZLYA 2ANBA 3DZBA 1S9DA 4L3OA 1PKXA 5I9SA 2BGUA 2X22A 1O0CA 1ULHA 3VZSA 5BMOA 4M1EA 9ICFA 3SDSA 1OHHD 1J06A 3WB9A 1XR3A 4GOJA 5CLHA 3SC2B 4HO1X 1SHJA 4ES6A 5J3JA 4MAAA 5IYZF 3E9ZA 1LD3A 4PQYA 3WYDA 2WFMA 1W25A 3VGPA 5JJLA 4UVGA 3QNWA 2C2YA 3D8NA 1QCDA 2CW5A 2EKPA 2G4LA 1VJ0A 2HNKA 1FPMA 2JXJA 1RC0A 1T2EA 1ZGBA 5EIOA 3B6EA 1I2DA 3BBLA 3NVZA 4KXWA 5DHPA 4R6WA 1VFNA 5ALIA 3FLBA 2QRVB 3KVNA 4X85A 5LZ5A 5CDUA 3HPOA 1WZEA 4PICA 1JH9A 3A6DA 1P3Y1 2GN9A 5IKEA 1JI0A 4R1PA 5KQGA 1TZCA 1DDGA 4K4HA 2D3DA 1J0XO 2BMFA 5J0RA 3CLUC 3FUXA 3HGQA 3PTLA 1U3WA 2BRUA 2VEDA 3FY4A 3RQIA 3S2UA 1JAHA 4L22A 5HIJA 4Q7QA 3X1KA 3CUUA 1IBKB 4XA5A 2IOFK 4D0SA 3SS8A 5E4TA 4M6WB 3U44A 3TSAA 5H68A 5FTLA 3TTXA 3I12A 1R4NA 3GRCA 2D2FA 3NQ41 1HORA 1LPBB 3R9XA 5ALTA 1KI9A 3HPQA 2HA6A 2W04A 1LPMA 3T3FA 2XB9A 4OXRA 3S2SA 2RD2A 4KN4A 5JWRA 3OA0A 1OX5A 3R3WA 3L8ZA 1CNFA 1TTQB 2PKRA 4GI3A 3DC7A 3EX7C 1RQNA 4R2XA 1KJ9A 5EG5A 5K0JA 1M6EX 1I1OA 2VDUE 1FMTA 4KE7A 3UPUA 1DCFA 4TXNA 2DLDA 3C4QA 1V26A 2PSDA 2IY9A 1MPTA 4I4TB 3H8WA 3ROMA 1JKXA 1V3TA 3MGBA 4JP3A 1IWPB 4RW0A 1KQNA 4E7OA 1UJMA 2PZEA 2XMCA 3KYIB 1G7RA 5DNWA 2C9CA 3WHLA 4FSXA 4XTRA 4EO7A 1RKBA 1NMEA 3FVRA 5DNVA 5HZGA 1TUEA 2EJUA 1WHTB 5KNCA 4NZZA 2W58A 4GP9A 5P21A 1OB5A 3UY4A 1ZK0A 1EJBA 1RQ2A 3LOPA 1BU8A 2HJHA 3AFOA 3TLZA 2ZBEA 4OJKA 4RANA 3OOSA 3ZTTA 3WV4A 3EZ5A 3COSA 1M6NA 3N59A 1P74A 2QTNA 5AWFC 1MIHA 2P7IA 1T8EA 2FWNA 5EPUA 3AINA 4LEIA 1L4YA 3JQ7B 3SSNA 5BXYA 3STHA 1F2TB 2P91A 3IDQA 3VR5H 2YV1A 1SEVA 1QNFA 3ODGA 4MVJE 3ZZ1A 4CI9A 1M2NA 1ZH0A 2BUBA 2NU7B 3I0ZA 1FYWA 1AK9A 2D8MA 1E18A 4CQMD 3SZMA 5EKUA 3SDZA 1U63A 1MD9A 2QVCA 4W8OA 1YMUA 4O9MA 2B9VA 2F90A 3H2HA 4U6PA 1WXXA 1R8XA 1AV6A 1C9MA 4MKGA 3DW1X 2OKCA 4GW3A 3UICA 2D59A 5KSOA 3JYQA 1TQ2A 4PINA 2H31A 5F33A 4CTJA 4NARA 3T7SA 3DLAA 3ROEA 4P4SB 3GLFB 2P9HA 5DBCA 3Q5DA 1SHUX 3LUPA 4KFSA 3GUVA 3SIRA 2FMIA 2Z4TA 1IFXA 2DMRA 5CM9C 4A23A 4DA4A 4X3PA 4YUZA 4N0MA 4KL8S 4XYEA 1QLWA 1IK6A 1QVAA 4EG7A 5HUJA 2X4LA 4UHCA 5HKLA 3DQPA 1HDEA 1SU6A 5AI4A 5E4FA 3QWHA 1DOAA 1RRVA 1GNPA 4HGZA 4F6LA 2VA3A 2KLHA 4Q05A 2ORED 3ESCA 2CSUA 1FSZA 3JD4A 3LC7O 3QPWA 5ICFA 2A0KA 1UXGA 5PNTA 4WNYA 5AOVA 2GZRA 3DAPA 1Z0JA 4R9NA 3WNCA 2H54A 1VGQA 3HM2A 2PCLA 3KD3A 2PZBA 4UVIA 3DA8A 4A0HA 5C1OA 4D0RA 2GVNA 1IIPA 2JGNA 1AD2A 4X8HA 3ZV3A 4ZODA 5NLLA 1R0RE 3PEWA 1JPUA 4NQRA 2V7XA 4W9RA 1EWQA 4ED7A 2OCEA 2YMMA 1JW9B 4GAEA 1FEZA 5KCZA 2FPMA 1E3QA 4UREA 3A4IA 2BEVB 3RUHA 4CRWB 1J8VA 2NQTA 1XPUA 1DC4A 1RWOA 2P2YA 3OLXA 2QAGC 4OLJA 3ISTA 1QR6A 4RMHA 3OF2A 1R4NB 2PYDA 2P9QA 5LYJF 3RH0A 3NZEA 2NGRA 1JS1X 1IN4A 2Q3EA 1GNVA 1GZUA 4XWKA 4DWOA 1GTMA 1RI5A 3CPHA 5ALMA 2YVUA 5DI9A 1CE8A 4NJEA 2WUDA 2W70A 2CLKB 4JJ7A 2QSJA 2HC9A 3KHTA 3KHKA 2NSYA 4BP3A 1DJOA 1H8ED 3AP2A 4MAMA 4AK9A 2GD6A 2DKXA 1XL1A 4I1OA 4I2GA 2VH2A 1NUQA 2H2WA 3BX1A 3DT9A 3DTTA 3IS3A 2O8FA 1Z25A 4UAZA 2IYQA 4JVMA 2J3JA 4LECA 4AP9A 3NDBB 5AVKA 1HQKA 4G4JA 3ZWYA 2D2IA 4BO4A 5I8PA 2DQSA 4FZRA 2BD0A 4JT2A 3IBCA 1QX4A 3FYTA 1ZNYA 5B3JC 1U47A 4V0LA 2BCSA 1PR3A 5KTKA 8ICZA 2K60A 2XQKA 4JITA 5J59A 5FUVA 1SCIA 3RREA 3N4MB 2HRZA 4O0IA 1E79A 1X87A 2J3LA 1BMFD 1AS0A 3BULA 1ORVA 1NJZA 1F2TA 2WSLA 1B0ZA 1JQJC 5DU2A 5AVJA 1V38A 4M49A 2XIDA 5EY5B 1AU9A 1EPUA 4OXYA 1JHOA 3AR3A 1T4GA 1SKBA 4PNPA 2JKVA 3C5GA 1SVMA 4B9SA 3L0PA 4MV5A 5FF9A 4BFZA 1II0A 4R66A 2ZJ3A 1GNLA 2UVPB 4MOWA 4Q01A 3A9CA 9ICJA 5B2EA 4CXMA 1N7IA 3E5RA 1BGVA 7ICRA 8ICSA 5GIPE 2HWXA 4L6IA 1H1LA 3M2PA 4I7EA 4PFKA 3AI2A 3GIWA 3EEBA 2KHZA 4I4IA 4RF4A 2ZTLA 1QVZA 5EQDA 3BF7A 2QRVA 1PK1A 1DBWA 1ZNXA 4NYIQ 1Y6JA 5CLJA 2B9EA 2BZ0A 3BD6A 2FGJA 1FBNA 4WZBA 4W1QA 4EHFA 3AWDA 1N7JA 3MGKA 1I4WA 4CGZA 2B92A 1U9YA 4S1NA 4O08A 2XNSA 4BFVA 5I9LA 1I3LA 5FDFA 3SHTA 2HJ9A 3C43A 3N0VA 4IUCS 4JLNA 5B1HA 2JH9A 4BAUA 5BQ3A 4KDCA 3F5EA 1UPXA 5DYGA 1MRZA 3RYHA 5JHGB 3G6VA 1K4KA 2IHJA 5CA7A 3E5HA 1ENZA 3F5DA 5J5CA 2RRDA 5BN5B 3WBFA 4E3ZA 1SELA 2XTNA 3HH8A 4OQMA 3RS7A 3CRW1 5BOLA 2HU2A 4D74A 4GI5A 3ZV6A 4HWRA 4PM4A 4PLFA 5A2GA 2O8EB 3BB4A 1USWA 3ND7A 4GF5A 3VOBA 2KWIA 1T1GA 3DZDA 1W96A 4DMKA 2WIGA 4RLQA 1XNRB 3T6KA 1V6CA 4JLAA 3A2NA 5IIIA 4J2OA 3OJXA 4RY9A 3IOYA 5M2QA 5G4LA 1DCKA 1JLSA 4I27A 1QG6A 3S99A 5B37A 2YBEA 3UH0A 3B12A 3O7WA 2VDRB 2OHHA 2VQ6A 3KAJA 4F21A 2HSDA 3CBQA 1J1ZA 3RC3A 2QI9C 1N61A 3FNFA 3GLIB 1EHCA 1NGSA 2R86A 3G2LA 4MPPA 3A26A 4JOBA 1CJVC 2V5VA 4NAVA 2BE9A 1XJWA 3IULA 1OVGA 4BN5A 3OI7A 1RM3A 4A1OA 3C7KA 1DHTA 3AR9A 3LAWA 2F1HA 1UJNA 3D3QA 3FOBA 4UU1A 3TDKA 2JJ8A 1UA1A 3I5MA 1B4FA 4XGIA 4M1WA 1IULA 2P11A 2RC5A 3VZCA 4NRDA 4NBTA 3EFOA 3O75A 1F06A 5KG5A 2H0RA 4JSRA 2WVJA 3N76A 4RKEA 4TV8F 4I9FA 2F9MA 3U4GA 2ZJ2A 1RAAA 1VXRA 3OPNA 3EFHA 5E6UA 1ZD1A 3HJRA 4YQWA 1SL0A 1HSZA 2CJWB 2VR1A 3ORFA 5CHYA 1GTZA 1Q3KA 4H6PA 1QNLA 4I5DA 3SQDA 3BZUA 1E3MA 2PQ2A 8ICTA 4G5RA 1NULA 5TT1A 4BGEA 1NVVR 4A10A 1RM4A 4RV9A 4HGNA 5DW0A 1HSOA 3RT7A 1SUIA 4NSNA 4KHPB 2NU6B 3LA8A 4NV3A 5FTWA 4HEHA 2ECFA 3CB4A 4K3UA 2WTEA 3AR7A 5DTEA 3TRFA 3IEMA 4WJ3B 1J00A 1OJ7A 2C7VA 4BEVA 1ZQPA 4DOBA 4XWTA 4FOPA 2SICE 4UB2A 2WJPA 3U7GA 1J33A 4UVHA 1SVWA 1I8TA 5CNKA 2JGJA 3ZNOA 4Z9XA 4AO8A 3HJAA 4FI3F 5G02A 3WJ1A 4I2CA 2VYFA 4HLCA 5DPMA 1T0BA 4EYKA 1P6XA 2V7WA 5FBZA 3BE8A 5DT2A 5CYOA 1E2QA 4ZT7A 2PR2A 1FVHA 4MB6A 4OHCA 3IDSA 4ROTA 3FFXA 1VDVA 1QU3A 2G5HB 2V9ZA 3S5JA 3B1YA 3LRXA 3PSAA 3QKUA 5CDHA 5L51A 3LUHA 4TTSA 3AT1A 1OLUB 5A7HA 2PQ6A 3B3GA 3A1FA 4PN3A 1MAVA 4NE2A 4UFOA 5J5AA 2P4SA 4HSGA 2C3YA 2CMDA 4ZICA 5LBUA 3AERB 3HLTA 4D96A 1HYEA 2R8BA 3C97A 4NLBA 3P1JA 2WKSA 4OK6A 3WWDA 4YAKA 4HWKA 2I5HA 3Q3CA 1E63A 4M8SA 1Z2OX 3E1SA 2A0XA 1T1EA 2PH5A 3A9UA 3HYLA 4YRTA 5FOUA 3EF1A 3Q7IA 4YREA 4A6EA 4XRGA 4A91A 2YW2A 1R0SA 2B82A 3LF1A 1M0EA 2WAYA 3R7BA 3OEEA 3CVWA 3C5VA 3OQHA 4MGKR 9ICXA 2CFIA 2YV3A 3B38A 1W0KA 4LOAA 4D4HA 4AF8A 2QZ9A 3L7NA 4L27A 4YT5A 4AO6A 5DGTA 5G4KA 1NY6A 4BNGA 2E18A 4WBXC 1XDBA 5HM6A 3WA6A 5FRDA 4X71A 4J7XA 4EUHA 1GTL1 1P1BA 3ORHA 3LLVA 3PQ3A 1HTTA 4DBZA 1DAFA 1J2YA 2EKZA 2IP1A 4KCGA 1QZ3A 4B9NA 1RPNA 2IEZA 4GXTA 3VNBA 4K4IA 3KELA 4GM4A 2I6FA 1M54A 4QBTA 1SU4A 2QJOA 4L0MA 4Q47A 3ROFA 4BP8A 4LSGA 5BQFA 1Q20A 4AL4A 2AEFA 2RDJA 3M8KA 4G07A 3EAGA 3PFFA 4PSUA 3RNOA 4DV6B 5EGSA 4CYMA 3TLCA 4CMEA 4OYYA 2W6IA 1P0PA 3IV7A 3U4HA 4TMWA 1KQGA 1WU8A 4ZXPA 1MX3A 4MYRA 3D7MA 1MIOB 3E58A 2Y6VA 2HUNA 3FVTA 1NQAO 4IIEA 4D8XA 2AA3A 2NTNA 3HZOA 4IDNA 4U39A 4MDEA 1HC7A 3T3GA 4FS1A 1N32B 2R2GA 3OX3A 4UPDA 1XBTA 3I30X 3QX8A 4DMGA 5JS6A 1VRVA 3L4SO 3OZGA 4X6XA 2IWHA 2FSHA 5LQNA 1QVRA 5CJ2A 1DP4A 5AQEA 4BLTA 4RTOA 4QIWC 1T9DA 1S76D 2JDID 4KXLA 2J48A 5FOTA 5KC8A 3WGYA 4EFNA 1IZZA 5FL7D 2B3DA 1N3LA 4F3CA 3SZOA 5JRDS 5BNTA 1X42A 1HOXA 5COBA 3TQRA 4MYUA 3F0TA 3G49A 1JAYA 3TS1A 1K8QA 3RFAA 4IHJF 4ESOA 1EGAA 4U2CA 3G8AA 4X45A 4HVLA 1SD2A 4K9KA 5JXGA 3S7ZA 3BA1A 2XQGA 3KFVA 4YMSA 2AEJA 3OZAA 4M6WA 4M7WA 3AKYA 3L06A 1HZJA 1NKTA 1XB2A 2IHTA 2YJ3A 3I0MA 2AC7A 2Z4SA 4HAOA 3H84A 1D8AA 1U7HA 1J2NA 4A8JC 4AQ7A 3LQRA 4CM1A 4O8ZA 3NHYA 1Z37A 4BV9A 3RW9A 1RLUA 2CRXA 1ZQJA 2Z9DA 3IXQA 3QPUA 3I2JA 3HU3A 4UDOA 3GDFA 4CEJA 4K03A 3W05A 5JTUA 1K1SA 1Q7TA 2ZYRA 3P4XA 3SZUA 4YYZA 4GKJB 1ECJA 4IDPA 3IAM1 2AHOB 5KTNA 1UR5A 1K88A 3HFGA 1MJNA 2DBQA 2TECE 4ICIA 1HK7A 2QSYA 1O9GA 3HKDB 5GPBA 2BMDA 4CKEA 2RHHA 4I4TA 1U80A 3S4YA 1GL7A 1DWUA 1D2NA 2RDMA 3IB3A 3LXUX 4H0FA 2FCRA 4QXQA 1QHIA 1ZCJA 1KTIA 2CE2X 4XM1A 1M8JA 3I6BA 2H1RA 4JB2A 3AU9A 2EANA 5ALFA 3UJBA 2GN0A 2ES6A 3Q6IA 3UHOA 1F8UA 5F73A 3H9UA 2CNKA 3I9JA 2XVYA 4NMHA 4Q3NA 2PGLA 3GD5A 2WFLA 1DT5A 3FNBA 4J49A 3E35A 4QBHA 5JPIA 2Q1XA 4MRNA 1J0DA 1YQWA 5MN6A 2ERXA 1GAQA 2G28A 4JLJA 4P93A 4RS4A 1CUHA 1RI1A 3MELA 3P9YA 3KU4A 4FKZA 1H1TA 2ZCVA 1P0MA 3FB1A 1W2HA 3I62A 4RTRA 1PNOA 2A5DA 3L8EA 3UUWA 4DA8A 3I6QA 5CU7A 1AE1A 2P2DA 4UFNA 4XVHA 3ZE9A 1NG9A 5AW7A 4YQZA 1YRYE 1N25A 1ZK3A 2F8LA 4ZT4A 1Y89A 2LP4Y 3OZTA 4JY7A 3V4SA 1BX0A 5JI2E 2PM8A 1GY8A 4LYGA 5I7RA 4GXJA 1WF6A 1ZH4A 2CLDX 2QTZA 2K2QB 3QNUA 1SK9A 4GOND 4XI9A 5D7NA 4RK1A 5I01A 2C0CA 4ZXFA 2CVPA 3BF8A 4G84A 1Z18A 4HG2A 4PEVA 4YP7A 1V7QA 4EI2A 8ICCA 2C84A 1VHWA 1NF9A 1FNMA 2E3JA 2G1KA 2WRZA 3IT3A 5TR9A 3H8SA 3C74A 3L7BA 4UHFA 4BLOA 3QE3A 1KS2A 1GPBA 4ER3A 3CS3A 4KKXB 3QQ5A 3IAM6 1JHAA 2X14A 3CT6A 1OC2A 3DFMA 3KAQA 1SXPA 2K8AA 3B1JA 3HABA 2B1QA 2ZROA 2ZIXB 3JX9A 4HXFB 4WKOA 1Z3IX 4YPFA 3TZCA 3AP1A 2ISOA 4IX9A 5IJAA 3M33A 2L2QA 1U9IC 1ZQFA 2J0EA 4G0YA 4B9LA 5KIAA 2QR2A 1PYGA 5JAQA 3BQ2A 1YGYA 2IIBA 2DFLA 4UQPA 4QJ3A 1XSNA 4MJXA 1PK9A 3WRXA 2GPJA 5DM0A 1XF9A 4GWKA 2WJVA 1RHRA 2JFVA 3ANYB 4K40A 3HILA 4H6XA 2AU0A 4Y2YA 1II8B 3PGA1 3TZHA 2YOGA 1DC6A 1WP9A 1WCYA 9ICAA 4O2LA 4W5WA 3O4GA 4F1WA 4U7CA 5E7QA 2Q5IA 3JQ6A 2AMJA 2P1ZA 3L77A 1C8KA 2WD8A 2AOTB 3O9ZA 3PDHA 4QT4A 4NZYA 3WIEA 3H0CA 1ZK2A 4E5UA 3TOZA 1IVYA 2GZ2A 1BD4A 1KC3A 2M6SA 3T5PA 2IS6A 1ESZA 1Z74A 3E2EA 2Q28A 1AGRA 1U2DC 3FYCA 2PJRA 3BKXA 3D43A 3TVDA 1OBHA 4YMMA 1ML3A 4S1OA 5AKIA 1KL9A 3S68A 2WWRA 1BH6A 1TVKA 1U5BA 3MCAA 1Z06A 3Q41A 1MOZA 1OV4A 1U0TA 4O3SA 3MTQA 4LNAA 4TS3A 4EQ6B 1H2HA 1QXSA 1TC2A 4PVCA 1GM5A 1NKBA 1JKIA 3QEMB 2GK4A 4F46A 7ICHA 1G3MA 1KGSA 1ISPA 4K6MA 3NETA 5FKJA 3IKJA 4DIOA 1K7CA 2PLWA 1OWMA 4JASB 4ZO4A 5KWSA 2V6JA 2X13A 1V45E 1KDHA 4G8DA 4B83A 4D02A 1COWD 1FP7A 1PT7A 2WTMA 2O8DA 1U0BB 2C04A 4YMTA 2DWOA 1LFDB 1N2BA 1ZCAA 4DLGA 1RHQA 2GNPA 4YDSA 4AMGA 5CA1F 3WZ2A 3MRTA 2EZYA 5K2MA 1CW2B 4GYJA 3QFRA 1OFGA 2GF2A 4DV3B 4E32A 1URPA 5A9RA 3ZW7A 5KYGA 1ST2A 2VPWA 3EPKA 3Q8KA 5LOVF 3RUFA 2NU9A 4QQRA 1W34A 2HVHA 1U0LA 2C4WA 1JSLA 3WB0A 1E9VA 2G67A 3OZRA 5AKKA 4I8DA 5L1KA 4DJ5X 5I7WA 4LF4B 2GCGA 2X6QA 3SVTA 2QSUA 1CFJA 5IUJC 4BNTA 5LJLA 5FUMA 4V0NA 4Y0NA 2BPGA 1GUBA 4LXTA 4ZQGA 2QTMA 1UH5A 3K1JA 1GCIA 3EIWA 3QLVA 2IFTA 2WZQA 2HZBA 4V0RA 1SY7A 4MSUA 2CXHA 1Z63A 1NMZA 3UA4A 2JLUA 3F73A 1YR9A 1RBZA 5KEIA 2BH9A 4OMFG 2IZ6A 5CCDA 3GRFA 2A9OA 4MWTA 3IAXA 1FQWA 1XZDA 4NYMR 3RRYA 4LVSA 1UPUA 1TJ4A 2BFDB 2ZJOA 3GMDA 1YWGO 4MVYA 2HA4A 5KDLA 4NTZA 4D8UA 1JYSA 2NNLD 1WV1A 5GONF 1EJ2A 2FPGA 3L5KA 3F6EX 1H2AS 3KQTA 4HYKA 4NICA 4EA8A 4C4YA 2IHYA 2VXYA 3BXXA 5CH8A 3ZWXA 1IC6A 3LCVB 2FZ4A 5GONA 4FUQA 5T8KC 3RD5A 3HY3A 5FWDA 4ARZB 5J29A 3K2EA 1L7EA 4HL6A 3VBCA 2G70A 3EW9A 4RJLA 4S1PA 4CCHA 1DKLA 4JKOA 3UWSA 1SL1A 4NVRA 2YN2A 4MCHA 4Y2TA 1CYDA 3DTVD 1K89A 2O7NA 2WICA 1I94B 1ACMA 3AIKA 5DM2A 3D4OA 1TQ6A 1U9JA 1J39A 2PMBA 3G68A 4B8ZA 3N3AC 1S1MA 4DZRA 1P5ZB 5CIWA 3IQHX 3QE4A 2VHEA 3A4LA 4X00A 3VDMA 2AG0A 2EW2A 4AS1A 2OV2A 1H94A 4HUQA 1JRLA 4ZZ1A 4C7OA 1Z3EB 1P3DA 1SCBA 4FXPA 3AZOA 3UB4A 3UFXB 4B3DA 4A6XA 2QYTA 2AS0A 5FQOA 3IJ5A 2B4RO 3R3YA 4OCZA 2EWMA 1XVLA 1SIWA 1ZJZA 2A35A 4QU9A 4DLUA 1F7VA 2BJWA 4CM3A 4CUKA 4O4IA 5A6SA 4EJSB 4MRAA 3QBVA 3M1YA 1SD1A 1IJFA 3DYIA 4IXNA 2OZKA 1TVKB 1U5BB 2HSEA 4F60A 3UA3A 1N5JA 2GESA 1LA2A 2P90A 1UT8A 4J3NA 3TAHA 2XUHA 3QVGB 4QNMA 2HBYA 4XVRA 3V4FA 4HZUB 1FS4A 4K26A 4TTRA 2GN4A 1FFXB 3DV2A 4N5HX 4TTTS 1V37A 4EBFA 3JQGA 1QRDA 4RQBA 4KX3A 1SFRA 4HCJA 2CF5A 4NV1A 1D6JA 1C0PA 4A7PA 3KQLA 1JLHA 1U2DA 1IDN1 2CZGA 2XC9A 2N1RA 1K2WA 1JVNA 1XNGA 2WUWE 3DOHA 4QEKA 4DCVA 2DJ5A 3CRQA 4XW2A 4DS3A 4HB0A 5DTIA 3DE2X 3QKIA 4L73A 2NU6A 3BGOS 1SUPA 3B1KA 2WIBA 2JAHA 1I24A 2CNBA 4IHKA 4Q1VA 2IP2A 2Z8YA 4OQQA 5K4AA 1XSPA 1E3DA 1NG1A 4HVAA 1Z2DA 5CVVA 1T24A 2GDJA 5EWMB 1G8KA 5JO0A 3F53A 3LPMA 3MB5A 3MG9A 3QMWA 1FOEB 1COWA 5L45A 1HJPA 5EWJB 5IFKA 3BCRA 2VUUA 3IEUA 2B6GA 3P4YA 2XKAA 4N9QA 4RQTA 4YI5A 5C3UA 3T7AA 1RFGE 2GAOA 2ZBPA 3HR4A 1H8EA 4C89A 5I5EA 2E8MA 1D1QA 3EJ6A 3A1WA 1E98A 4EMSA 3HG7A 2EFEB 1I7QB 621PA 2I4IA 2MA1A 3DYVA 2BFFB 3GVHA 1HUOA 5IF9A 3I4LA 1LC0A 1Y5IA 3LKVA 1Q46A 5IAGA 1I3OA 4HN9A 4P4NA 4DM4A 3CKKA 1GL6A 3T5HA 2OBYA 4BQFA 4DRXA 2Y1WA 4FPXA 4RV5A 1US8A 3CNBA 3AC0A 1KEWA 4B7UA 1GZ5A 1N77A 4JXZA 4D2IA 1C9NA 1BVHA 1EK5A 4LJ4A 5FT9A 4B3JA 4PGHA 2G04A 2FFHA 2Q4RA 1LLUA 2QTVA 3RC7A 3TBKA 3OPYI 3ROTA 2VL7A 1JDPA 3VTAA 4HPXB 3F9RA 1FDRA 4ZAVA 4RV4A 5IVHA 4ZYLA 1B8UA 3ILYA 4HNQA 2IU6A 2V6MA 2XCUA 2ZI4A 2XKJE 4MV4A 3TFQA 3VFDA 4KJZA 4UTOA 1G8FA 4KQCA 3FYDA 3VTZA 4P33A 5THXA 5M34A 1EK2A 1B8NA 5C1BA 3JVIA 4QJ5A 5LB4A 1Z2NX 4DMMA 5AVXA 1WWVA 4ZVOA 4CRXA 1R6DA 2ECQA 3K1RB 3DGEC 2KJ8A 3EA0A 1ZQHA 5J2BA 1EB9A 4BNDA 1T2VA 3H6HA 1ZOOA 3PZPA 2FPIB 2KBEA 5CFNA 5BR1A 2RB4A 3ZWBA 3ZXUB 1YB7A 4WSOA 4IGKA 2AG8A 2JCGA 5B7QA 2FMTA 2X42A 5TJHA 2XE4A 1WB4A 3EH2A 3G7UA 3L0SA 4OP3A 3CWQA 3DDOA 3H5TA 4Q9JA 3OU6A 5TLSA 4JB8A 4BJ1A 1V9LA 4K9QA 3TLJA 1M2VA 2DFPA 1Z7BA 3D6JA 4YAOA 4ZQFA 3MFIA 5J63A 3U3RA 4C7KA 2AFRA 4IVRA 1XQWA 2LXNA 2BGJA 4JV2A 2PUHA 4D7AA 1NI4B 4JGIA 3M70A 3GG9A 4ENWA 5IRCD 2XKKA 4J1QA 3PJDA 4CV0A 1RZVA 1ZN9A 3IBGA 2HY7A 3FF4A 4G09A 3AHFA 1U4OA 3PO5A 1QIIA 2MSWA 2OYSA 3I4FA 3LCRA 4BO0A 2GUGA 2W0SA 4G41A 1U7XA 3C1TA 4HAXA 4M04A 5K51A 3ZX5A 2XODA 5IINA 1GKYA 2IHMA 5JVDB 3S2EA 3VX4A 4ZCMA 1ULAA 1Y9EA 5CFRA 3WDMA 2PMWB 1M33A 3HUUA 4ND6A 1OLXA 4DARA 2BI8A 2PFQA 1G8GA 5JLJA 1QHHB 4F5ZA 1ITZA 2OC9A 5B1EA 4Q3OA 3EEYA 3FAKA 3DMYA 4D9EA 1UKYA 2HIHA 3RBDA 4WCFA 4F9GA 3L7OA 2R8IA 1SUBA 2BGTA 2ZFUA 1JI3A 2HPHA 4EKGA 4GEGA 2A33A 3WQHA 4C2UA 2PWYA 5IAJA 3OUZA 2GZDA 2QD1A 3RRHA 1HH4A 3GGDA 3K1AB 1OXTA 2JZCA 3DHWC 3QEKA 3JATA 4MEYA 4OBWA 4DIFA 2ZPUA 2ERCA 2QRQA 1WPQA 3GGJA 2JI9A 3KYBA 4PRZA 3AIIA 5CG1A 1T94A 1WQ4A 1V95A 1ZM9A 2KI5A 2W37A 4RENA 4K9OA 4F6RB 2HF9A 3IB6A 1BQ4A 4OXQA 3QHQA 3MWDB 1J07A 3HDGA 2OCGA 3AUXA 1EP9A 4GC9A 4OGWA 4OA5A 2CEAA 4US2R 4UTPA 1O0SA 4RQ0A 3F3YA 1MFPA 5AOCA 1N6IA 2FSFA 4MVJI 2HMWA 4DWJA 3AR4A 4RGBA 4C5BA 2FKNA 2HBJA 1JQBA 1M1NA 2Z2KA 2HMYB 2OENG 1HTWA 1WUYA 4F93B 3FZQA 1KAGA 1ULTA 4MTLA 4HQ6A 1K7XB 4MV1A 3RVPA 4I2DA 3QVKA 5LLSA 4AM8A 4C6RA 1J49A 2KW5A 1AGPA 3PO4A 2XOEA 5AXDA 5EGNA 2AMVA 2ZB4A 2AQIA 3OZ7A 1GPYA 4EY3A 5D4BA 3RAPR 1PT6A 3D6AA 2WJYA 5CFQA 1RS0A 2IVZA 3G6XA 5AOAA 4YONB 3KR0A 3GFFA 3ZG6A 3OG9A 4QGGA 2QW1A 1UEXC 1L5UA 4FCVA 1TUBA 1IDOA 4B0OA 1CLEA 5KG2A 3DJFA 5AVTA 2XICA 3SVLA 4JJFA 4YRSA 1OY1A 4LV6A 3VU0A 1ECGA 1QCZA 5FUQA 2JH8A 4FYIA 2IK8A 1GRRA 3IVCA 3VZDA 1QVVA 3NANA 4O3FA 4OUKX 3EMDA 3HCWA 4UBMA 5ERXA 1FP6A 4YHBA 3CN7A 3ZU3A 3LVVA 1X1BA 4TUYA 1UJ5A 4RO0A 1KI4A 1N33B 2P9CA 2KQUA 2R6GA 1UCFA 3OESA 5ALNA 4IQWA 1IPHA 5IKOA 2HJVA 5IVPA 4KPEC 5CLIA 4B6OA 4F0JA 1STOA 4BNFA 1I1NA 1XKXA 2ZW9A 4O4JF 5LQJA 1XZIA 4K4GA 4IINA 3LL7A 2QLFA 3BL5A 4QZIA 1M6VB 1MB9A 1LZLA 1XTBA 5J2TA 4RF2A 3QXCA 1XRLA 4OXXA 3T1TA 1HNXB 3N7SC 4M47A 1AKTA 2PX2A 3QMMA 4WQMA 5CBPA 2A88A 5I7VA 1MC1A 3DR3A 2J9YB 2AFHA 2QVZX 4YNBA 1TPZA 3QVUA 3O4JA 5T6MA 2HCRA 2F3UA 1FZQA 4X9XA 2R00A 2Y3IA 4F5QA 2C2HA 2P4UA 4MFFA 4LY6A 5KYYA 2EP8A 4NX2A 3TW8B 3FUWA 2R8HA 1VIVA 2MOKA 3HEBA 4HATA 4N7JA 3DWGA 2OYYA 1VL5A 3H7IA 2CBZA 3H2JA 1UPTA 1YRHA 1FTNA 5F1YA 3QLTA 2UZ1B 2PL3A 4GXNA 1A7KA 1LQTA 4RJ2A 4JCCA 2BEJA 1BPXA 2DUJA 1FNSA 3O2JA 2R4TA 1JXLA 4BNJA 3KSBC 2OGUA 2ODNA 3VR4A 4QOJA 2JA2A 3DUWA 1HRKA 2AVDA 4F4UA 4Y9TA 2I65A 2QTCA 3BSYA 3EGIA 1CJTC 3MTAA 5F76A 4ZVQA 5IVKA 5JROA 4G63A 3DMDA 5HK9A 1PFQA 3H2YA 3E9EA 4KWEA 2GPNA 3TACB 1PQYA 4PX2A 2FHPA 3IP3A 2OGTA 3QBEA 4OFXA 4QJBA 1IUPA 1DDIA 4WD3A 1ZGAA 3SJZA 1T3GA 1ZD5A 3ABQB 2KG5A 1NUUA 4X1IB 4IQUA 3V8NA 1S0MA 1UZUA 3Q5EA 2MWMA 4HUTA 2R68A 3E7DA 4OYRA 4R1SA 2ZJFA 3SR3A 5KX5B 4QT0A 1YCHA 1VB5A 3E1KA 1OIXA 4OI2A 2I9KA 3KQWA 3V8BA 2HRQA 3EY4A 5FD8A 2E4XA 1GU1A 2YXEA 3BYZA 3ZE1B 4AS2A 4XX1A 5HR7A 1NXQA 1EP2B 3DXXA 1HEYA 3VV3A 1EQUA 1Q15A 3BHNA 4IRUB 3CX7A 4R84A 1PQWA 5T4BA 5TARA 1IG3A 1EDDA 5EMKA 5DM70 1FK8A 1HG1A 2ZTCA 3C85A 4C4XA 5H16A 1BOOA 3OZIA 1O97C 3FYUA 4DWIA 1OROA 2VPPA 3OZSA 4PG8A 5CCXA 5CT6A 4KUHA 2OFWA 3ZE8A 1L5LA 4ZJPA 2HHAA 4FGZA 2A1UB 2OG2A 1TT5B 3TJRA 2LBOA 4C1NA 4CT4B 2XRYA 1C1YA 3LCCA 4CIDA 4KLMA 3GV5B 1KI1A 5C52B 2ZTUA 1HNNA 2C94A 3OCCA 4B80A 4W1RA 4CKWA 1ZUD1 2JHAA 1XRPA 3PQ6A 3MTEA 4PLYA 3JW8A 1GZ3A 5JMWA 2O8CA 1OA1A 2BTQB 2G0NA 4M0AA 3KKPA 3QFHA 1R6UA 4RZ3A 5AVUA 1G21E 3UJ8A 3QFCA 1LSJA 4NP6A 2ZBGA 3TLAA 3IJRA 3NCTA 4IUYA 4Q7JB 4HMOA 5K0FA 4LRXA 2QJFA 4XB6B 3R7LA 2HIAA 2RKOA 3EYZA 1D4FA 4EB6B 1I2CA 1DAIA 3E3AA 4G0PA 2AC4A 1XT6A 2A9KA 4O5AA 4ITRC 2AXQA 4INOA 4N0PA 3MFYA 1I13A 1B16A 2RGBA 5KTPA 1DHRA 5HQ3A 2O2YA 4L51A 4FB4A 5F3WB 1H6DA 1YGPA 3AB7A 1YJCA 3FHOA 2NADA 2ZSDA 3G2QA 3RT1A 1EUDB 5I7FA 4RX1A 1YTUA 2Q5LA 3AN1A 2WU4A 3F67A 3D4LA 4RL6A 1X6JA 2VEOA 3QF4B 4M9ZA 2Y0SC 3I2HA 1RAGA 4KN5A 2C4KA 4WUVA 4WVLA 5FBHA 4F6RA 1YRAA 1AF7A 3CUVA 4ZRDA 5A3JA 4JQCA 3LPNA 2X3YA 5FBWB 4KBFA 4U2EA 4U3JB 5JMPA 5DK6A 4X60A 3M6ZA 1YI8A 3DEHA 3PY8A 2LWIA 3WHKA 4I9HA 3RS2A 2FPPB 4JNCA 1JFRA 2O1EA 1I10A 3ER9A 1YC2A 2VOEA 3BWBA 4JI1B 3NHBA 4ZDWA 2P27A 3TM5A 1IOWA 2Y1JA 3C39A 3EY9A 4KITB 1P75A 1YONA 1KO7A 3ICXA 3IP4B 1Q0UA 2QMEA 2W6MA 1HDRA 5IXYA 1A1VA 4KQEA 4KGXA 3DLBA 3HUDA 3NVWA 2BP7A 4MFCA 1KYQA 3EGOA 1UXKA 4P84A 3V7LA 2UVPA 4HJXA 3TPZA 4G2NA 2H16A 2CUTA 1YB2A 2WFAA 1MAWA 1AQIA 4TL7A 1G16A 4UUAA 3NTOA 1KP9A 3RH6A 4RQ8A 1ORHA 2HA3A 2A5LA 2FEMA 4QXRA 3UAOA 2QRPA 4POAA 4X6LA 3UT6A 1JIHA 1COZA 1J8YF 2XRMA 3DNFA 1QORA 5HJEA 3JD2A 5B6PA 4CKCB 1P9LA 3MQ2A 5LYYA 2Y1KA 1SRQA 3B5EA 1SCKA 2OO5A 2MYTA 2J6SA 1WZ2A 1IUNA 3BRQA 3FJ1A 2QE7A 4DQVA 3DOEA 3SKYA 3NH6A 1MKYA 3VMFA 3EUWA 3F71A 1CUSA 2B4QA 1QHSA 1OFTA 2OECA 2YX8A 1RXVA 3SS9X 5K8IA 3NUQA 2YMLA 3FWZA 3H1EA 2E9SA 4RNCA 1C81A 2ZUCA 5DB9A 1RJ9A 1UOOA 1E9FA 2J1LA 2Y4NA 4TQUS 5F1PA 5BT9A 2M2IA 3IVAA 4BWMA 1L4GA 3PX2A 2I2AA 4KAXA 4ESEA 4C80A 1IZYA 4DBLC 1TIKA 5SYMA 1WXGA 3CZ4A 5BRJA 1NK9A 1T4CB 4M54A 4YC7A 1M9NA 2OESA 2YL2A 1M2EA 4BRUA 1SZDA 3U7FB 2V54A 2G36A 4WZBE 1UXJA 2PBRA 4QNRA 3JPOA 1E5TA 1U0HC 1S01A 2A5GA 5G1NA 2FPLA 3TW4A 3WQSB 3N0TA 5KWJA 1EIZA 2QNIA 2AIRA 2OBLA 2GBLA 4L2IA 1Z56C 4E1AA 3KQNA 3EAQA 1UJBA 3GB9A 1Q6YA 2AJLI 4JBNA 2HMUA 2XX3A 1A71A 3AJ8A 5IDQA 1B74A 2VZ0A 2CHFA 3FPHA 5E6RB 1YACA 2R62A 3BRWD 3H5RA 3VJKA 4CIYA 2ZRIA 4K1LA 3B85A 4L75A 2C8VA 4E5SA 4KQHA 1F2DA 5FHQA 4RTKA 4Y2PA 3PDCA 1LI4A 1L3TA 3R0XA 4DSZA 4ZOLF 3M1LA 4K8OA 4BLRA 4CG0A 5MFZA 3T7DA 4OKIA 3C7DB 3JQAD 2O0JA 1KJIA 3JV7A 2W48A 3F5FA 3KSMA 3LWLA 3NLLA 4GQBA 4WK0B 1MEEA 1T1RA 3ZDXB 1X9SA 2YWBA 5CXSA 2Q7XA 5TPZD 3JQ7A 2AJCA 2ECPA 4OAOA 1YDFA 4MQFA 5FTMA 1G5PA 4DA9A 3M9OB 2FJPA 5KCMA 3VO9A 1U7PA 1PK7A 2UUOA 3WIBA 3ZXXA 2HMVA 3ESAA 3NEAA 4IILA 4LY0A 4U5XA 1X1CA 4KOEC 1KP2A 1MDFA 2IIPA 721PA 1NJSA 4RM2A 1L3UA 4CF6A 4NG5A 5FQNA 3EVEA 2OORA 3BGDA 3U48A 1RBMA 5JYEA 1WKVA 3RSFA 4EHBA 4N7BA 2C22A 5EXEA 1XEXA 5EHXA 3TFOA 5J2EA 3NCHA 3TLGA 2IBSA 1AQ6A 4AYBF 1KDTA 3UCFA 4P7FA 1TQHA 3L84A 4KQXA 2I6XA 3GLFA 4FYKA 2QQGA 3HBAA 1E0DA 1T1JA 4EGCB 1NOMA 1WLSA 1PF7E 3F1LA 2BJVA 4N76A 1FSFA 3EEIA 3M6MD 4KMMA 4NMMA 1S3SA 1KU0A 2GD1O 4FI3C 3IBSA 3AI1A 4JI4B 1EK1A 5I9NA 3KUKA 2G40A 3GV0A 4BJQA 2EFJA 2J9ZB 3NO4A 3K96A 3AHDA 3GFGA 2IPOA 1F12A 2FPXA 2FX5A 3C15C 1N4DA 1Z29A 2W9MA 1SV0C 1VG8A 3DFFA 4X20A 2IWRA 3A1VA 4FYJA 5TPZA 3VMMA 1XD8A 2CFOA 3AHEA 4YMOA 1ILWA 2BEUA 3PC3A 2UVDA 3GD7A 4MS1A 2SKDA 1W0JD 1JJFA 2UYYA 2X8BA 3MRSA 5TGTA 1H42A 1R1DA 3KJXA 1W6UA 1HL7A 2WKRA 4ZRMA 4MQ4A 5T7BA 2J9FB 1NK0A 1FB5A 2PMDA 1LVUA 4MKXA 2CXUA 4F4XA 5HZMA 1HIWA 1E7QA 1M7GA 3AXTA 1NJ1A 1U7TA 4ALNA 3K71B 2YN0A 4FFDA 4J76A 3FJYA 4G0MA 3C45A 3G17A 3ZK7A 4KR3A 2UVVA 2YV4A 2YZGA 1XTZA 2DBZA 3EQ6A 4I2EA 4DUZB 5I8WA 4M9HA 1VMEA 4RA9B 1P4GA 4X95A 5CLQA 1P1KA 2XTJA 1UPHA 2VNAA 3AI3A 3C3JA 3I42A 1OI3A 2BGGA 4LOJA 4L4SA 2H63A 1XQVA 1IM4A 2FZCA 2VJOA 5EJ6A 2P6MA 4J0IA 4DL7A 1WW8A 2AR0A 2Q2NA 3GK3A 3DT8A 5AXAA 2VUIB 2P75A 4IWNA 3SOPA 4WXPA 3ZQJA 4N3AA 5EMLA 3B2QA 1DEHA 4W5OA 2PWZA 5J2JA 4HGRA 5DBEX 1JIUA 3OICA 5TRTA 2W2VA 5J0OA 3O1HB 4KLSA 4UEQA 4HQRA 5LZ2A 4H59A 1E5DA 3NTVA 2EL7A 1ENOA 3F74A 2KFZA 1Y8RB 3EVZA 3ZI7A 2BSQA 2GTIA 2WVAA 3FUUA 3CKLA 4Y2GA 3KALA 1EFRD 3RRMA 1IXRC 4K9SA 2JZOA 1K98A 3KZVA 3G0BA 4O02B 3WGKA 1EUYA 2NZVG 4CKBB 3FOZA 1RRFA 1SVOA 1XAHA 1TX4B 4BTEA 1NF3A 5DISB 3H1PA 3WGIA 2FZGA 2VZ9A 4MYHA 1VPDA 3ASYA 3BMQB 2W4IA 3O5AA 4JQZA 5BNFA 2C2GA 3ZVRA 4EA7A 2FZVA 3H2ZA 1PFVA 4PAGA 2OAEA 3TE7A 1GITA 4A73A 1Q16A 5BVHA 1I3KA 1DTWB 4FWTA 1C4XA 2WMNB 3FRIA 3M3PA 4FHDA 3A4TA 4WK4B 3UJNA 3PVSA 4DEYA 4UEKA 2WYWA 1KEUA 5CT9A 9ICVA 2OCXA 4J0JA 4B2YA 1HT3A 1BE6A 2QJTA 3EIUA 3GJ7A 4Q4HB 1P1CA 3UMRA 4EG3A 2IITA 5G5HA 4L8VA 1JQKA 3KL4A 3OUUA 3PD1A 5AUQA 1IZ8A 3ZVMA 2X2FA 3E23A 3IIMA 1KZ9A 1V85A 4WA8A 1NN3A 2ZIVA 2YRXA 5B1DA 4YJ3F 1KZYC 4UJ3A 2WD7A 4A5OA 1D2EA 4DQXA 1HL3A 2G1AA 3F2CA 3SXJA 4QWCA 4ER6A 4H77A 5JZMA 3KQHA 3D8RA 1UOEA 2Z04A 4M1QA 1EGQA 4HDKB 4I1RA 4J1TA 4MI3A 4QA9A 1W44A 2H4HA 2XGQA 3OOYA 3U13A 5CXQA 4ZAWA 3O31A 2E3TA 5K01A 1NBIA 4YMNA 1HE2A 3ORQA 3R44A 2C82A 1NUHA 3OFND 3SS7X 3WGGA 5CP2A 2OOSA 4HS4A 1QSSA 2QRGA 4XRHA 2PS3A 2RHDA 5KPJA 4LNUB 1FF9A 3SM9A 2DBVO 3QU4A 2DJIA 2L69A 3T54A 2HHHB 1TO1E 3TO5A 2UYQA 3OPYA 3A1CA 1V97A 5EPEA 4TV8B 5ALPA 4MWZA 1G6Q1 3SVZA 3ZGOA 3ICWA 3A1SA 2V96A 5SZKB 4P31A 1KO5A 2OYRA 4QOEA 3LP5A 3CX4A 3OTIA 5H59A 2A1UA 2FW1A 4NH0A 3TN7A 1RC1A 3KSAC 2WHQA 3LC0A 1JG6A 4FGWA 1W75A 4IVQA 3T7EA 4I4LA 1TFUA 2QP9X 1NZFA 2BM9A 1XYYA 2WAQF 4J4BA 1X9IA 1E1QD 5EIXA 5KT2A 3WK5A 1X1AA 3BSSA 3K32A 3M6FA 4XIJA 3KE8A 4OGKA 4FFMA 1NXPA 3THWA 2GX6A 2O8DB 2BGLA 2IDJA 1HG0A 5CB8A 2UYCA 1ST3A 4PHPA 4JROA 1EVIA 4HNSA 4JUDX 1UQRA 4Y1RA 2LYAA 1CUZA 4ZT6A 4JIGA 4MLDA 3LUKA 3ETLA 1PX0A 2GNAA 4O63O 2H3QA 2TMKA 2XA9A 3CG0A 1DWPA 3O90A 5EIFA 1QQ5A 5J0SA 3AQEA 3AUAA 4JQOA 3QKRB 3U3OA 1Y3FE 2VDWB 4R0NA 3AY3A 1H5UA 2IZOA 1DGSA 2TMDA 1COOA 2IS2A 1PUIA 3HA5A 4E09A 3TGPA 4URFA 4HRAA 3IIKA 1SKAA 3V5NA 1AKVA 2HW8A 3BICA 5EE3A 2PKEA 3AG6A 5DQHA 1OPXA 1PTJA 3JD3A 3T94A 3ZCUA 4F4FA 4AY2A 3KSDO 5G0WA 3DBHA 4ZZ3A 2L18A 1LFAA 1KFEB 1ODLA 1U98A 1L8OA 1XZEA 2GLUA 2PVSA 2F8KA 4MUGA 4O2AB 4IXWA 5DGHA 2HCFA 1AIPA 2Z3ZA 2QVLA 1G8PA 5FHRA 2DPJA 4DREA 3EXFB 1IBCA 2XYHA 3O9VA 3IEVA 5FOXA 4ZV9A 3L7LA 3NTLA 2CXPA 2WDZA 4NC9A 4AP5A 1ISMA 4MHOA 2EF1A 2IUSA 5LP6B 2O3SA 4QPJC 4Q3LA 5JDCA 2O59A 3I2KA 3D2LA 4XWOA 4N6GA 1BNCA 2IOQA 3HA7A 4R8LA 2XDWA 1O9BA 4MVJF 5EKSA 4ZVSA 1E9BA 2ZIXA 3QVSA 2EKLA 3SM3A 1P60A 2MMCA 4IQGA 3TQQA 4CIAA 4LHEA 4RTJA 2QG4A 3TQIA 3I28A 1ZXLA 4P3NA 4MWDA 4QGFA 1W48A 3DDHA 2IEAA 2FDRA 1NT4A 3B3QA 2XZLA 3UGQA 3M82A 3IP6A 1VXOA 1KH1A 3ENKA 1G2PA 5JAOA 2ZP1A 5IUNC 3HRHA 1ZOSA 3KYDA 2FY8A 2XECA 1JKFA 1NVTA 1RPTA 3A70A 3C3XA 3V8RA 1GPMA 4IZHA 2D1QA 2BY4A 4JDPA 5B2FA 3M8RA 2G9UA 4URYR 5TJ9A 3VI4B 4QJFB 1YDWA 1R6AA 2YJGA 2V03A 2Y27A 4ZO8A 4EF6A 1ACLA 5H2FU 1FTWA 3M6WA 3OKAA 7MHTA 5EC8A 3K31A 2VDMB 4A03A 5K4GA 4G5QA 3L4KA 2IZ7A 4DXDA 4FGKA 5J2HA 1EZZA 5DKWA 1O7JA 2CDRA 4L8YA 5HF5A 2Q0ZX 4HH3C 3UANA 4YJ2B 5C5EA 4DWWA 4RSHA 4XDGA 3MN1A 4I50A 1VYUA 1Z1BA 3SQLA 3RS5A 4BJ5A 3M9XA 3AOEA 4ZANA 3PG5A 1Z5OA 3MHTA 3DBOB 3OPYB 4JJEA 5B1IA 4CV1A 3PVCA 2IH4A 2V0CA 2FXVA 1YO6A 4L85A 4L72A 4RA9A 4FFNA 2QMUA 4EHLA 4DFKA 4V0QA 1AURA 1A5SB 2AHOA 2GTHA 3CZMA 1GG5A 1U8FO 1RYUA 2PWPA 4KREA 1EAYA 3FN4A 4M9CA 2PU7A 4L4YA 3PJEA 3I6ZA 1B4DA 1V0JA 2Q9AA 4II3A 1OI4A 5J0UA 4OJPA 2QJWA 3KOOA 4LK2A 5ENDA 1RYHA 1T4CA 3OE1A 3Q1LA 4EQZA 3GLTA 3R6GA 5KZMB 1XLTA 5JD6A 2Q8NA 4E5VA 4J75A 1WEHA 4OXKA 3F9CA 4MHTA 1TCUA 3QOWA 4I6JA 4PU0A 5I51A 4QM7A 5KYVA 2FZWA 1CEYA 3UH1A 1O2DA 2G08A 3GG2A 3G1WA 1BX3A 1MQ9A 2ZYSA 3JD0A 1P29A 1YULA 3C1OA 4NOLA 1A76A 1G3IA 5TS2A 3AM4A 4HX2A 3D7LA 4BBPA 2FUG6 2DF8A 4MRSA 4RPLA 2NYRA 1Q1ZA 3LHIA 3FC4A 4KTTE 3L1VA 4YAWA 2ZLBA 1JBEA 1LJ8A 5IH7A 3VR0A 3BC1A 3DMNA 3RABA 2XUIA 3MJFA 5F4BA 3ZJ4A 4B6FA 1NT2A 3JAWB 5TX7A 3QF7A 2E49A 5JBNA 1MO6A 4IH1A 2J6BA 4D9KA 4KMOA 2EHDA 5C5CA 1HA3A 5ESXA 5T64A 3TI9A 2PGOA 2YASA 3C3CA 4D41A 3EC2A 4F2DA 1T25A 5JRZA 2B1JA 2VPIA 3A25A 4H15A 5BMVF 1DZIA 3DJYA 2QY9A 3KFLA 2QGFA 5AK5A 4NK5A 4NBRA 4QDXA 3RS9A 2HL6A 1AC5A 1FUKA 2J9RA 3LW8A 2RH5A 3WWEA 1Z8NA 4C87A 3KZCA 4H7PA 4N8EA 1U2TA 3RLIA 4LRSB 1MVNA 2DKOA 1UC5B 2DFKB 3ZDYB 2ZVDA 2O48X 3QU7A 1OFHA 4PTZA 5ITZB 3MERA 3IKTA 1QIDA 1CC1S 2HF7A 2JAXA 3VPAA 5AW4A 4RQUA 4DCGA 1EXDA 1Y9JA 2PZKA 2VPTA 4IYJA 2BIFA 1X1QA 3U7EB 1NU8A 2ORVA 3G9XA 3KE9A 1X1EA 3SPXA 3PTAA 1OYYA 1Z5GA 3WAJA 1E9CA 4OB6A 4OH7A 4ADSG 5BWOA 2HQ1A 2AD5A 1U6JA 4NCNA 4MQLA 1ZQRA 3E6AA 5HF9A 1C8LA 2EBUA 1CUAA 1Y37A 1SUDA 3INTA 4GZ5A 1X0VA 3T3MB 2ZUVA 4F86A 3ZDAA 1FRFS 1SOUA 2XUKA 3ZIAA 2C7PA 3GEIA 3OCYA 3O82A 4C2BA 1PFWA 1F8XA 2YVLA 3DONA 2EJWA 5KFXA 4DIDA 5CYFA 2E6KA 3HDYA 5C7IO 4DR6B 4CCAA 1JG2A 1X6VA 1CZKA 4G9BA 4EYHB 4PV7A 3PJRA 4FLFA 5AW8A 3CJTA 4S1TA 1R8JA 3KTDA 2DRIA 4XSGA 5G40A 1J21A 1F4LA 3H5WA 4ELUA 4OJTA 3O8NA 4IJ5A 3EQ8A 1CDEA 4JKYA 3QBDA 2QZJA 1T4MA 4EY7A 3A6JA 2WTBA 1Q0HA 4IHJA 4B5LA 5AFSA 2XTMA 4CM8A 4UU8A 2EGGA 1GILA 2G07A 2NXCA 4P22A 4ZMSA 1YAHA 4NCAA 3OAAA 2CWWA 4IMJB 1GGJA 3CZ9A 1YBFA 4EEKA 3MLBA 3B51X 4FU0A 2V7EA 4H6WA 3EDQA 1WS6A 2YXNA 1CIPA 1T3HA 3ITEA 3GO4A 3SX2A 4U63A 4UW9A 2F1OA 1VI5A<