3QXGA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron complexed with calcium, a closed cap conformation
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
222
structure length
222
Chain Sequence
KKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 84
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qxgA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qxgA01
4C4TA 3ZVLA 4BNDA 3CNHA 4CNQA 2WF5A 4DFDA 4XPZA 5AW3A 2HF7A 4BX2A 3R09A 2YJ5A 5AI5A 4AS3A 4KX5A 1YNSA 5AKGA 4XOUA 1Z4QA 5AI8A 3M1YA 2X4DA 2WHEA 5AK6A 3R9KA 2B1QA 3K1ZA 3E81A 3WK6A 5AKXA 4OHFA 4J2TA 1SWVA 1RRCA 2FUEA 3AR5A 1RMTA 1YDFA 1WVIA 2FPSA 5AW1A 3B8EA 3SLRA 5AHXA 1F5SA 2PQ0A 1IWOA 3AR4A 1ZRMA 2I34A 2HF2A 3W5BA 1U02A 4Y2SA 5ALDA 4H1WA 4YIHA 2RARA 1L7OA 3OPXA 4EX7A 4E88A 3SD7A 2CN1A 4KX3A 4BX3A 4QQFA 3WGUA 4HGPA 4BYGA 3QGMA 3KBBA 4EX6A 2R8EA 4YCLA 1TA0A 1VJ5A 3TLMA 2G06A 2YJ6A 3N1UA 2HHLA 5AW8A 3N28A 1Z88A 3L1UA 4UM5A 3PDWA 4KN8A 5ALQA 3RF6A 1YS9A 4OFZA 1LVHA 1XPJA 2B1RA 1XP5A 5AW2A 5ALVA 2R8XA 3MMZA 5IS2A 2ZXEA 3B9RA 1NRWA 3OTQA 3FVVA 3SKXA 4UMDA 1CR6A 1Q92A 3PGLA 4YH1A 4UAUA 3U7EB 3L7YA 2FPUA 2FPWA 2YMPA 3U26A 1RKUA 2IYEA 1EK1A 3A1DA 5AVSA 4ZEWA 4CE6A 5A3SA 1TJ4A 3KOOA 1J8DA 2RAVA 3DAOA 3OCVA 1L7MA 2ZBEA 4RETA 3B9BA 3RFUA 4UU1A 5AK4A 4UM7A 5AW9A 1LTQA 4HYTA 5AVRA 5AVQA 3FGOA 4ZEXA 5AI9A 2NO4A 2YJ3A 5ALUA 3L0YA 4YCNA 3D6JA 2JARA 5ALMA 2R8YA 3WK8A 5AESA 5AKLA 4L6AA 2B30A 5AKJA 3L8FA 2YMLA 2YJ4A 4HGNA 3DNPA 4UAVA 3AR6A 2ZBGA 4UATA 5AVWA 4FYPA 3E58A 1Z4IA 3QU2A 1U7OA 4RESA 3QUTA 2AGVA 5IT0A 5IT4A 3IJ5A 2WF7A 2ZOSA 4L57A 4Y3UA 3I28A 5ALYA 2MU2A 1WPGA 4AS2A 3KC2A 5AVUA 1U2TA 2HI0A 1RKVA 2ZBDA 3VAYA 3BA6A 3L0CA 2O9JA 2YMMA 3OCXA 4YIKA 1Z5UA 3UMBA 4FFDA 2EATA 1Q91A 4UMEA 2BY4A 3QU9A 4XQ0A 1N8NA 1S8OA 2QLTA 3WGVA 4BEWA 4ZEVA 2IOFK 1QYIA 2MSNA 5AICA 5ALZA 4BX0A 2G0AA 2YFYA 2QYHA 2HO4A 2AH5A 3ZX5A 3EF0A 3WK4A 3U7FB 5AM3A 1ZOLA 1RLOA 1QQ7A 4NV0A 2W11A 4UMFA 4CF4A 1L7PA 3L1VA 2IOFA 3AR7A 4GXTA 4L6CA 3SHQA 3WKEA 1FEZA 3W5AA 1T9ZA 3SKYA 4BKMA 3AR8A 4GIBA 3HLTA 1NNLA 5ALSA 3OCZA 5ALIA 4Y2UA 1RMQA 5ALHA 2I54A 4AP9A 4DW8A 3L0BA 3MPOA 1ZD5A 2YN4A 4XE5A 3ONNA 1Z4PX 3CZ4A 3QYPA 5AKYA 1U7PA 1YMQA 2W4MA 5ALLA 3M9LA 3AR3A 2RBKA 3E8MA 5AI6A 2OBBA 4IG4A 3PCTA 4OCZA 3NIWA 1T5SA 4BNDB 2HOQA 1RLTA 4QJBA 1XVIA 1QH9A 2HX1A 5AK3A 1L8OA 2P27A 3WKCA 2C9MA 2FPXA 5ALOA 4CF3A 5ALTA 3NRJA 3DV9A 5ALFA 2PR7A 2OM6A 2HSZA 1K1EA 3EWIA 4Y2PA 2P11A 5ALJA 2NYVA 3E84A 2I6XA 5E0OA 2VKQA 4EELA 2JAOA 2MU1A 4UMVA 2ODAA 5AI4A 3U7GA 4Y2JA 2EARA 5AKZA 4PNHA 3ZWKA 2Q5EA 3IRUA 4Y2QA 4FE3A 4O8CA 3ZX4A 5AVTA 4UARA 3NAMA 2I55A 5JJBA 5AI0A 2WF8A 5AK5A 5AM1A 1S2OA 2Q4RA 4NWIA 1ZD4A 3L5KA 2EAUA 2GO7A 3FPBA 2R8ZA 1Z4KA 3U19A 3N5KA 4UU0A 4HGQA 1RPZA 5AW7A 1RDFA 2FDRA 2HEGA 4JB3A 2B82A 4G63A 3S6JA 1QQ5A 3GYGA 2GHQA 3WK9A 2B8JA 4KNWA 1RC8A 3UM9A 3ESQA 2O2XA 4IFTA 3QUBA 2GMWA 2I33A 3MN1A 3J7TA 1ZRNA 1ZS9A 4Y2VA 1RMYA 4BEVA 1MH9A 2B0CA 4YCMA 5AVZA 4C4RA 3AR2A 3I76A 3QU4A 4BBJA 1YJ5A 2C8LA 4EENA 1RLMA 1Y8AA 1TE2A 2P69A 1O08A 5AM4A 3SF0A 3QU7A 3EF1A 3L8HA 2AUTA 4HGRA 3WK5A 4I9FA 5AVVA 1Z4OA 2BDEA 3U7HB 3L8GA 3ZI4A 3OCWA 1EK2A 3EPRA 1YV9A 3W5DA 2FPRA 3PGVA 5AW6A 4B6JA 1SU4A 1SWWA 5ALPA 5AM2A 3ZW7A 4Y2YA 2C4NA 2ZBFA 5AVYA 4G9BA 3A3YA 3FM9A 4OD0A 2ZG6A 4DWOA 2WF9A 2C88A 5AIAA 2HCFA 2YY6A 4MWOA 3N8GA 1NF2A 1WR8A 2HDOA 4UASA 1ZJJA 3QXGA 2D2VA 2WF6A 3FZQA 2PKEA 1Z5GA 2G09A 2BDUA 3HYCA 3WKAA 5AM5A 3NANA 5ALRA 3UMGA 2AMYA 2OA0A 1ZD2P 1TJ5A 1KYTA 2I7DA 5AKHA 2GHTA 3WKDA 1J97A 3P96A 2W43A 4NFLA 5ALXA 4EEKA 5ALEA 1PW5A 3QLEA 1RQLA 2WFAA 4HGOA 2WM8A 3QUCA 5A3QA 3A1CA 3NALA 2GFHA 4F72A 2JAUA 3AR9A 2IA5A 3NASA 5FP0A 3WKBA 2G07A 3ZVNA 3QNMA 1VFPA 5T41A 1RQNA 5ALKA 2DQSA 2G80A 2YBDA 2CFSA 2JAWA 3ZWDA 3DDHA 4EZEA 2IOHA 2JGAA 4CF5A 2FUCA 3ZTYA 1Z4MA 3FPSA 5AIBA 2FEAA 5AVXA 2CFRA 3A1EA 5A3RA 3I6BA 3I1YA 3ZUPA 3SMVA 3ZVMA 1L7NA 2G1AA 3ET4A 2NO5A 2OYCA 2YMQA 4KYTA 3OCYA 3F9RA 1RKQA 4DCCA 4JDPA 5AKIA 3IB6A 1CQZA 3NUQA 5AKKA 1JUDA 3W5CA 2CFTA 1L8LA 3U13A 3UMCA 3ZTWA 3N07A 5ALWA 4UW9A 1L6RA 3MC1A 4Y2XA 5ALGA 3WK7A 4NAVA 3ESRA 3KZXA 4HAIA 5AW0A 4C4SA 1ZD3A 3QUQA 3ET5A 5ALNA 3KD3A 3BWVA 2RB5A 4YGYA 1Z4LA 1X42A 1VJRA 4Y2RA 1AQ6A 2FI1A 1N9KA 2B8EA 3KDPA 1O03A 3ED5A 1Z4JA 3ZU6A 2P9JA 3L8EA 5AM0A 1T5TA 5AKEA 1WZCA 4I9GA 2Q4TA 4F71A 4Y2TA 3QX7A 1TJ3A 1QQ6A 4NABA 1Z4NA 4MUMA 3QU5A 4KNVA 2G08A 3R4CA 4J03A 5AW4A 5AW5A 1U2SA 3OCUA 2C8KA
chains in the Genus database with same CATH superfamily
2JZBB 1GL6A 2N3ZA 1GZHB 4AW9A 2AEFA 4BNDA 2A1TS 3BXZA 3D4IA 1JYSA 3WYBA 3E53A 1W85B 4RFSB 3UH1A 5DN9A 1QV6A 5EERA 4B4KA 3IXLA 4LKOA 5HCIA 1YNSA 2QMYA 2R2AA 3I1IA 4I3FA 3O31A 5J3JA 2YWEA 4GBJA 2XYRA 2X0NA 1QHYA 2B35A 3G82C 4DCVA 5ED4A 1WYGA 3H2HA 3DKVA 4MEBA 3EIEA 3LK6A 2NRWA 3M8RA 9ICRA 3N5CA 4X1IA 5EZSA 5JISA 1ECWA 4U4AA 2XCIA 5CIQA 3R9KA 1A4RA 1NJWA 3LLVA 2UV8A 2I8CA 4UREA 1JG4A 1HKUA 4TGLA 2VSQA 2ZP1A 3RVOA 1KS2A 1Z5OA 4Q3LA 4ISCA 3BJIC 5B1YA 4RTMA 3L4JA 2FUEA 4IYRA 3O95A 2VTBA 1BPYA 1PK9A 2C59A 2ORED 3TZQA 5AW1A 4DR3B 3RU2A 2Q2VA 4A8TA 5A4MS 5JD6A 1C9MA 8ICKA 2BCUA 1B8NA 3HR7A 3JD3A 1I6LA 3KUDA 1ZRMA 3AM9A 4RZSA 2E4XA 5CDHA 4F5NA 1DP4A 2QUJA 1KBQA 1KRWA 1KEEB 2ZIUB 4ZVKA 1U02A 4IICA 1KAMA 3H7IA 2QMUA 3ND9A 1Q0ZA 4DG8A 5KYUB 3ER9A 3GIKA 3TM4A 1RFGE 5KOHB 4CEHA 3M34A 3A0HU 1J2TA 1KI2A 1RCTE 1PQ4A 3FDFA 2POCA 3K09A 1IEVA 5LDDC 1CZRA 3SPXA 3KKNA 3ML1A 4R2XA 1CVIA 2IL1A 1VXRA 5ILGA 3VAAA 3UGTA 1WPXA 2RGRA 3KT8A 5L3RA 1RPLA 2OHVA 1W7AA 1KYIA 4RQMA 4AO8A 2ODTX 3LGAA 2OO5C 3SXUB 2A86A 4LFCB 3A9VA 4DCTA 4IJKA 1ETHA 3E2PA 5LKRA 3T15A 3WGHA 1GNPA 2ESRA 2PGDA 4PX3A 3N1UA 1WXIA 2HU5A 2DPLA 2F8SA 5IAOA 4BLTA 4UAJA 1ECJA 3H19A 5JD5A 5A4KA 5BUCA 1MVNA 1VA4A 2Z4TA 2QI9F 1TK0A 4IIFA 3OPMA 1E2NA 3CTMA 5I47A 4XFJA 3W8RA 3K0FB 1C14A 5JFGA 4KN6A 2WIBA 3N76A 1AHHA 4HI0E 4IVPA 5EQTA 4B83A 1ZUNA 1IXSB 3HV2A 3O4GA 3NPAA 1D7OA 3IP1A 3CUKA 1E3IA 5BSVA 1AB5A 2SCUB 3HVHA 3MZ0A 5HE9A 2H16A 5H80A 4OQXA 4R8KA 3LCCA 2Y1JA 3LX8A 1JX6A 1RRKA 3E4CA 4TPKA 5E4FA 5TF4A 2KYRA 3TLEA 2FPWA 2C57A 4Q1BA 1IM8A 1P8JA 1A9PA 1XD2B 2P8JA 5D86A 4Y67A 5EVJA 5D51S 1YQUA 2C98A 3LOQA 1PWXA 2GCOB 1SY7A 2GKSA 4PVCA 4YR2A 2A92A 1VB5A 3HEAA 3MRTA 5G40A 5K3BA 5AQ1A 1N33B 4M1KA 4UCFA 4I1YA 3E3AA 3RFUA 1N34B 5DU2A 5AW9A 3RV4A 3T3FA 3GEDA 3BQMB 4J9MA 1DSSG 1TF7A 2EOAA 3HH8A 4HEA1 2PKCA 1YVPA 4DIOA 1EXWA 1UFQA 3ECSA 2QX8A 1NFRA 2PXIA 3ABSB 4A8EA 2XZPA 3D2QA 5FOWA 3RSFA 2ZJBA 4PZDA 3T9EA 3WK8A 4CM8A 4EO4A 4BNVA 2P9YA 1J70A 4RPKA 2KZ3A 3ONWA 1Z0AA 3VAZA 4XPIA 4RDCA 1XELA 3SE0A 3ADBA 4F11A 5BURA 4ZKEA 2GM9A 1V4VA 1YGPA 3BRQA 1R4ZA 5KI6A 1HT1E 1GVHA 4WZBE 2BKXA 3AKYA 3IVXA 1JVBA 3UWPA 2OWOA 1GTVA 5KQLA 4FS8A 1UDXA 2KKPA 4GUDA 4A1OA 2P3QA 1H2EA 3WQHA 3I28A 4D8UA 1ISMA 3EK2A 1W73A 2MU2A 1SQ0A 5IDWA 2CLCX 2DULA 4QOJA 3AEZA 1FMCA 1U1IA 4ZD6A 4JC0A 3O8RA 4OFXA 4C01A 5JWHA 3P71T 3PRYA 3RYIB 4P0PB 2O06A 3NHYA 5D5PA 3EGDA 5DNYB 1RKVA 1ZBQA 3DOUA 3LPDA 2IQIA 1S01A 4R1LA 2Y0CA 4C04A 3PFNA 2G04A 3OBBA 2KSQA 4M38A 4NLBA 5LYJA 4Q5IA 3EPGA 2PYIA 1D0VA 2WT9A 3R76A 3SFVA 4BTEA 2HR1A 3UMBA 1NQOA 1ZQ1A 2FP4B 2JJ1D 2AFHB 2VJYA 2GPTA 3G0HA 3UPUA 3GHYA 3PYXA 4WXRA 3X1KA 4NATA 5BSKA 1YL5A 2XYQA 1J0AA 1NJ5A 1RACA 4POOA 4L8FA 1X0XA 3R40A 4DHWA 4ZFNA 2OKGA 1UL1X 2C4VA 2QG9A 3JATA 3K15A 2RGAA 5KSPA 1CUHA 2CKMA 1I80A 3QLTA 1W88B 2D2IA 4G0OA 4WCVA 5KU1A 3I12A 3H5RA 3JYHA 3Q8WA 1JQDA 3A1TA 5ALZA 1X74A 2EKDA 2IXGA 3PUKA 5T4BA 3IEKA 2FEKA 1BOFA 1VMDA 2O5EA 3WK4A 5EKTA 2OB2A 2W0MA 3FSGD 3PIDA 5LLTA 1ZQGA 3OTIA 3PFHA 3CR3C 2RB4A 5IIKA 2QSZA 2WV7A 5J4YA 2FCRA 4MUAA 3TEJA 4IJ5A 4OUDA 4YYZA 2MSCB 3IA7A 2Q8PA 4L6CA 3C5FA 1CUGA 3OPQA 3F8TA 2ZAIA 4U7WA 4B5LA 4ZGWA 3KHUA 3C6QA 1XZKA 1FEZA 2HU2A 3KR2A 3QKSA 4L95C 4EFMA 4YJ3F 4FE7A 4BKMA 1XAJA 1NK8A 1VL8A 1KYQA 1N9GB 3CUTA 1N78A 4JBYA 3M6VA 5E4TA 1SRQA 2JIQA 3SJBA 5FUQA 2ZXUA 3STVA 1NW4A 4C4XA 7ICGA 4FNMA 2WHXA 2AT1A 3QVSA 1L6NA 1AQLA 1GL3A 1OF1A 1ZLYA 2EIXA 4RORA 1PFWA 4L78A 4PHDA 2XOKA 4R9SA 1D09A 4F5OA 3SHFA 4BU0A 3OHMA 2J6IA 1SIBE 4ECTA 4WBNB 3G0GA 1GG5A 2NNLD 4FGZA 3KSZO 2AX3A 3AUFA 1K6MA 1NMZA 3FNIA 3IDQA 4EHJA 3ZKWA 4K9QA 2JH8A 2ZBVA 4WWHA 2NG1A 5I8PA 1U3GA 4EG0A 1E0AA 1VDVA 3FBWA 2OBBA 2V03A 1S9FA 1IBLB 3TQHA 1XZDA 2JHCA 2WB4A 3CKMA 3G6WA 4I50A 3VC3A 4KRFA 3D6AA 1L8QA 3B7GA 2DRIA 3RB4A 1QONA 5AVOA 1WCWA 3JR3A 5LL6P 3RT7A 1BE8A 1T6YA 3S2ZA 3JYOA 1X8XA 4J0KA 1X7ZA 2OWEA 1G98A 1UBGA 2IHYA 2VDUE 2Z3VA 3LO8A 4JP8A 3M5DA 4QLOA 5CM9C 1YJQA 2JPDA 3DC7A 3WBFA 3CUEF 5ALOA 1FRFS 4Z54A 1HORA 4LWOA 3CZMA 3GVPA 3KTAA 4KAXA 4OFBA 3C1UA 7ICIA 4WLVA 4Q9LA 1Z63A 1EUYA 2OHHA 3T5JA 3LKBA 3LP6A 1G8HA 4Q82A 2OXOA 2W2TA 5FFFA 5A5FA 3T7RA 1JHVA 5H8WA 4PNPA 1K1EA 4PO1A 1XS9D 1VLBA 3RJJA 3OEWA 4GI7A 4UU7A 5PGMA 3S8EA 5TS2A 4BVBA 5THXA 1PFGA 1E6LA 2IZ7A 2EBFX 4LY6A 1T9GR 2X5XA 1F3OA 4MS1B 4HLUC 4UMVA 1QPGA 2DPIA 3H5WA 2NUAB 1XL1A 4LYDA 2A1IA 2NO9A 5ERYA 3UUGA 2CDNA 3KSRA 3UCEA 1UF9A 2C4UA 4HDNA 5JS2A 3RHSA 2JGFA 2WB1F 1NVDA 3H9UA 1DDGA 5I7FA 5F7ZA 1G7TA 5CFPA 3FXAA 4H4DA 5AK5A 2GEUA 1IOWA 1A7KA 4JJIA 4OQQA 4OYYA 5FWDA 5EIBD 1U0BB 4IP0A 3PGJA 5KJEA 1X2EA 1FUUA 3DOIA 1FLNA 4I2AA 1Z4KA 1ZIDA 1D6NA 1G5RA 3OQ1A 1GKKA 3ZHRA 2HU8A 1JXLA 4QZEA 1PYGA 2AYYA 1XWIA 2I71A 4B9SA 2Q45A 2XQKA 3DYIA 3K16A 4UU0A 5TC4A 2PZ8A 3TOXA 8ICBA 3G7SA 2CLSA 2BCSA 1UXOA 3DEHA 2VUIB 2R6DA 3OCJA 4WEOA 3GPLA 1DEAA 1Z2NX 3SQNA 1U7WA 3VVLA 2LYAA 1CWUA 4TKVA 3I83A 2AXPA 1QCDA 2WE8A 3VHXB 2AQ0A 1LJLA 3DP9A 4F2PA 3DE5X 3S6JA 8ICXA 1OVMA 3SQWA 3WK9A 1EQAA 1R5OA 1T8SA 1WPRA 2NSDA 3F9IA 4MVJD 5EWLB 3LK9A 4P7GA 2HIMA 4YRJA 2IELA 4OI0A 3X43A 2BGUA 1X7HA 3LLCA 2CBZA 3KUCA 5JARA 2R87A 4O5OA 4EARA 2BDPA 1ADBA 3J7TA 4YI3A 2WSSD 1TJPB 5TPWB 3GX1A 1JNXX 2V58A 3ZV7A 3RVNA 4DARA 3KQKA 1UZNA 3OX3A 1QG4A 1NBIA 4JV0A 1H4QA 1MW9X 3HY6A 1E2HA 1ZQKA 1I01A 3AHFA 1MQSA 5IRCD 4PO8A 3L3FX 3ISCA 4WY5A 3G8YA 2CNWD 3KLMX 1ZYUA 2W7OA 1NKCA 2PJUA 4FCTA 4HGRA 4I81A 4P5DA 4Q39A 4TTVA 5EFZA 5FPYA 5AXAA 1NSTA 3CKKA 3IUJA 4IXNA 3SQDA 1EZ1A 2CEAA 4WKCA 5JPCA 5E79U 1NRXA 2AEJA 3EMBA 4QYSA 1I0ZA 1M2VB 2C04A 3NVWA 3DONA 3I5XA 4Y1EA 3BXGA 2G0TA 2P9HA 4E1BA 1MGOA 3GQCA 1AZTA 3LSTA 4KLAA 1RWPA 1R50A 4WNAB 2I3DA 1E4VA 1L4LA 3NWJA 4B6JA 4A2WA 5JI2E 2V74B 1T1JA 1J21A 1GPMA 2HQ1A 2C2WA 2W6ZA 1ZQBA 2XCLA 3PFBA 4ZO4A 1HF3A 4DDKA 2V9WA 5AFSA 3RT1A 3RYFA 1AMUA 4NEGA 4RJJA 5E7IA 4EYSA 2ZVDA 5P8WA 5BN3A 1WX1A 4LQDA 4IDAA 5KYKA 3T1TA 1UT8A 1G41A 1UDWA 4C7ZA 4DA8A 2WYWA 2E8NA 2QE6A 1WKBA 2X13A 3TFSA 1ONPA 3X2FA 4HAWA 4PTZA 4GGOA 2QX9A 2HV8A 2NRTA 2IY9A 4PL2A 1QHHB 3PNVA 4TQUS 4XA5A 4S1TA 5DGXA 1KU6A 1TECE 1YZKA 4CMGA 2QE7A 3P20A 2PFKA 4ER7A 4N7MA 4FJ0A 1ZHHA 1Y8RB 4V3BA 4X62B 4GM4A 3U61B 1V9CA 3P2JA 3EVEA 1QH1A 1XVVA 2G70A 4IEIA 3SX4A 4FHDA 1IHXA 5CA1F 5IPFA 4U6PA 1J2RA 3K2IA 3STWA 4ARZA 4KLJA 1P77A 1TAQA 1ENZA 3DZCA 4BVLA 2D8MA 3RRHA 1EWRA 5JATA 1YK1A 3OE7D 4WQMA 1WULS 5CHEA 2YX8A 3QHAA 3G13A 4H3HB 4F04A 4JUCA 5LP1A 4G0ZA 1DEOA 3HWX1 1I30A 1YSCA 3RF7A 5FBQB 4FEAA 5B37A 3WL8A 4UHKA 1Z75A 2EJBA 3OPNA 5JWRA 1B0PA 1EGAA 1T9KA 4N40A 2ZRQA 2RD2A 2V9PA 4G41A 1QE3A 5KTMA 5HZKA 3IDAA 1E9BA 2HBZA 2NZ2A 2B99A 4H7EA 1WD5A 3OZEA 4R9RA 5EZYF 3ZHXA 5LZ2A 1Q19A 1QAQA 1V11B 1J1UA 4CFZA 5GTHU 1JDUA 5KTSA 3N6VA 2OOSA 2V4MA 1U0NA 2FLVA 3BSWA 3DAFA 4TYPA 4WXEA 4TRMA 1KSGA 2PUDA 4FCVA 3PQEA 1ZI8A 1YJBA 3WLQA 1QRTA 3M6FA 1MHPA 1UBTS 1PDWA 2K7ZA 5TQJA 1ZETA 2GPSA 3DL0A 4AWAA 1Q1QA 1RYUA 1UA0A 4R83A 3L92A 4ZHQF 1FFBA 2MCFA 1T43A 3FHCB 1DWQA 1M72A 2DQZA 1PV1A 2GEVA 3PO5A 1GSIA 2RBGA 5H83A 4M6WB 3CM0A 3UHFA 2EFGA 4TTJA 3KJGA 4RQ8A 3C5HA 4B85A 5G0SA 3WQSB 1D2CA 4G89A 4LOLA 5GIOE 2XD9A 1PK7A 4PICA 2BQRA 3RS0A 2DTEA 4OQ4A 2DKNA 3OFVA 4DKXA 2B7BA 2OHXA 1Q2UA 5C5EA 5IXJA 3ME5A 1Z62A 4JOBA 4OOFA 1Y3BE 3S0JA 1NBHA 5F73A 2Q27A 4ZT4A 4KPGA 3N7SC 2QMOA 2AOWA 3SIRA 4PG5A 3NT2A 1MAAA 4PZYA 3O4JA 1P7CA 5CNKA 1CEYA 4RIFA 3KNZA 2QTRA 3OZBA 3ZWOA 2WJ3A 4UUPA 2X0JA 3OOSA 3W3ZB 3DVAB 1UPXA 3N0WA 3W5VA 3WGGA 2UVPB 5C32A 3ZDXB 1XMIA 1CQZA 2X15A 1XMQB 2UXCB 4R8UA 1KZHA 3VU9A 1IV8A 2QOEA 2C92A 1P29A 3MJDA 1YBHA 2IVFA 3D4LA 4M9RA 5E3IA 3V1YA 2B5VA 4YV1A 1ZGBA 2F48A 5CVDA 3ZTTA 3MWJA 3KLBA 2VQ6A 3WU2U 2NPFA 2G5HB 3WTCA 3B1YA 3E7WA 1PG2A 2JHDA 2OZKA 1VYTA 4ICAA 1GL7A 2CXSA 2WJ6A 4H18A 2E18A 5BUSA 2R0QC 4URVR 3LBNA 3I6IA 2JIMA 4INZA 1L6RA 5KYVA 4TSFD 4DADA 3RVSA 2FPPA 2WU1A 1OWPA 5C1DA 2Q7XA 4YQZA 1C7FA 2E7ZA 1YAHA 3G8BA 1XI2A 3PQFA 4J2OA 3RB3A 2V4RA 4YG2A 1IYZA 4C6SA 4DDHA 3EVZA 4RFSA 3QUQA 1ZGGA 3GCGA 2XQVA 5HJ7A 5KTNA 4JEIA 4DV3B 2WDPA 5J5CA 4L5YA 1US8B 1GNRA 2PKRA 4D02A 3R77A 1W2HA 4KLLA 2GPWA 3QLVC 3N2YA 4BBZA 4BNFA 3MM4A 1E60A 1SPXA 1KORA 1BKDR 2O7QA 4N3GA 4MKXA 3BGIA 1KOLA 3RS8A 5D3ZA 3MT0A 1P73A 4I1SA 1MTOA 4DLSA 2Q6TA 4MV7A 2TS1A 4DZZA 2C5LA 3L05A 1J09A 1XSLA 4O2AB 1SCIA 4Y2TA 2KX7A 1BYIA 4PYIA 2PLAA 4QZ9A 2Z2XA 2O2HA 3FRHA 2Z2IA 3WYCA 5G3ZA 1M2WA 3NWOA 2XMDA 4QNRA 3SC4A 2VR1A 1P5HA 1JI7A 1C81A 4XM0A 3TQRA 5BV0A 3H87A 1PDVA 2PD3A 8ICNA 3ZDEA 2QTWB 4K3VA 2P0EA 1RI2A 4RFLA 4RK1A 4EO9A 4EG6A 5FWNA 1T2FA 1ZQNA 2JFXA 1YQWA 4R9VA 2FAXA 2AUMA 3W6ZA 2XSZD 4RJIA 1XTVA 1S2DA 3MF4A 3BQ7A 1M2NA 1RCUA 3D43A 3FHLA 3WMFA 4BO5A 4AAYA 3W9BA 4EYOA 1D6MA 2BH9A 2ZSEA 4NXMB 4YX9A 3U4AA 1KZYC 4TQGA 2P9CA 2QPOA 2YS7A 1WXXA 1K8QA 2ZIUA 2BMDA 5JE8A 3PJGA 2W2KA 5KAFU 2R84A 2A1TR 4G5QA 5AKGA 4HB4A 5K0SA 3MHPA 5HM6A 1F1JA 2Q3MA 4B0OA 4N0MA 1IRXA 1Z4QA 1BC5A 4XX0B 5TQVA 2AVNA 1N6RA 2GZMA 3TLYA 1HQKA 3KV1A 3EXHC 3GBSA 4I2FA 1IVSA 4ER5A 4F93B 2O8NA 3KPJA 4EB3A 1ZUIA 3K35A 3OEHA 4OYHA 2Z6QA 4YMMA 2HLPA 4QW8A 1QAOA 2IIBA 4RKFA 4KBYA 1O94D 1T36A 1K6IA 1M1XB 4M53A 1PZXA 3AR5A 4AS1A 4EYEA 3EOAI 5BOLA 2PZJA 4JV1A 1GGKA 2HSJA 2AEEA 4MGYR 2NSHA 2W6MA 2RAUA 1NKSA 1XYYA 2Z1MA 5EI5A 1IWOA 5FA5A 2G25A 3ZQ4A 4H3VA 2JFWA 5DO9A 2HF2A 3ZWPA 2HXYA 3KQLA 1BH2A 3G5UA 9LDBA 3RANA 1VE3A 1CS0A 3ADKA 7ICNA 3R5HA 3W3AH 3VH3A 1FFCA 2C9DA 1JWLA 4KQ6A 4QA9A 2CSXA 3DQZA 1I2DA 4MB2A 4YIHA 1OE0A 3D2BA 1EK6A 1ISGA 5JRTA 2JKZA 4HRAA 4TTPA 4JR2A 3CF4G 3OP4A 4P1ZA 5C5DA 5MFZA 2WTXA 2ZR7A 1P0PA 3V55A 1TDJA 4WOJA 4YMUA 1B43A 3JU3A 1BRTA 3DJYA 2ZJ8A 2JEOA 5LOVB 3LYHA 2W48A 2BR5A 2FZ5A 5BORA 5IZ4A 3PITA 1QR2A 3C85A 1I4LD 5J2UB 1BYUA 4YMVA 3BL5A 4PM4A 5CM2Z 2E5FA 5FBWB 4YRSA 1GZ4A 5BN5A 2GCOA 3FNBA 3PXDA 3U6BA 2NSYA 1DFIA 2NO7A 3CU5A 3QPCA 4NH4A 4QUJA 2QGZA 4MJXA 4UBKA 1SIJA 1QZTA 2SECE 5CHGA 1DVRA 2Z30A 3MWDA 2COUA 4Q00A 3V5NA 4ARVA 5IABA 4M9SA 4DMGA 4BXOA 1VHQA 4E0BA 2R1ZA 4L8YA 4B6FA 1K2VN 3BIXA 3WZ2A 3ZHQA 3R9XB 1U7UA 3HY3A 1P62B 5I45A 1L4NA 4M37A 4HYQA 4HRVA 2IX3A 2R96A 2KZZA 3GH1A 2WMDA 4YH1A 1XPUA 2AYZA 3EZ9A 4KYIB 5JS6A 1A7UA 1AF4A 2B98A 2DBVO 1ZAKA 3PYLA 4NDAA 4WN9B 1COZA 3N3BC 1XDWA 2KP7A 3VX4A 1QPBA 5F3XB 1O6FA 4JI0B 4Z4GA 4J7UA 4LIPD 2FRVA 3NVAA 1IG3A 1WEHA 2QYOA 2W9XA 4RHUA 5EKUA 3HCFA 3U3OA 1QCCA 3CXRA 1P8AA 4PYNA 3CNLA 2UXDB 4H1HA 4HH4A 1EXDA 2I2XB 2FZEA 2F1RA 4FKBA 1Q3HA 3FR8A 4AJEA 2X58A 2NO4A 4IIVA 4UHFA 3FUWA 5ALUA 1GZ6A 1Z17A 1ZVKA 2VT6A 4X54A 1PBNA 4NJ8A 2PYDA 3H7AA 2D62A 4C8NA 1C4WA 4GI1A 3AKCA 1CXZA 4TMXA 5BQXA 3GJ7A 1D6SA 3QFHA 3DNPA 3TZBA 2M1ZA 3BRSA 4ERNA 3E9MA 3NO4A 4Q9DA 3DFKA 4JBLA 4YALA 1MZVA 4OGKA 3CZPA 3NEAA 3JPOA 3GZNA 2Q1TA 3IOMA 5TMEA 2JL1A 3PEEA 3HPQA 4Z0TA 2PU5A 2Z3ZA 4BO1A 2DHCA 3DAPA 4L57A 1G6KA 3MJHA 1O4WA 5EQFA 5DBCA 1A77A 1FU7A 2GJSA 2Z2YA 4I99A 4B6GA 1HM5A 1ZPDA 3O84A 2E4YA 3NGDA 9ICNA 2ZREA 1GPUA 2OQRA 3PMNA 3NWPA 1YIAA 3M9XA 2C61A 3GD7A 1KP3A 3IVRA 4EYIB 5BQOA 3ZH2A 1EA7A 3ESZA 1D2MA 1QG0A 4H3KB 4NIMA 2IS1A 4YDQA 4IUYA 2RGYA 3K0CA 4IH4A 4OXQA 4O5AA 3PJDA 2I29A 5DBBA 1T0JB 1Q91A 1S0MA 1ZH2A 1NF9A 4BWJA 1FQKA 4NU6A 4Q9KA 4Q9HA 3D64A 4GYKA 3HKCB 2RGNC 5DGIA 4HFRA 1SK9A 1G6Q1 4KWEA 1E2GA 1LBEA 4QOFA 3V4PB 3DTVD 1HE8B 2A4KA 2Y6VA 4HQKA 3V8MA 5C5IA 4LI0A 1VGRA 3N05A 2H0QA 2CGEA 4BX8A 2R25B 2HO4A 4O6VA 2FN3A 4O9MA 2REOA 3EF0A 1MO4A 1M8JA 4R2HA 3AJ9A 2W37A 5BRAA 5IVHA 4C0ZA 2FPIB 5KL1B 1VIYA 3O94A 3QOWA 3RKSA 3DEZA 4BLPA 5J29A 1KMCA 1GAXA 4OB8A 3RJIA 5IKPA 2BFPA 2GNPA 3DDWA 5ELLA 4WDRA 1HT3A 4I2VA 4GG1A 5KBYA 2PCLA 3EVGA 4B9AA 3HRIA 2O14A 5K5EA 1EAYA 4H7FA 3A6HA 4YP5A 3AUOA 2GYWA 2X8AA 3BZUA 3REQA 3LTNC 5EIWA 5A2QA 1KJZA 1U11A 5C8YB 5JRJA 1JDTA 1KI7A 9MHTA 2Q5FA 4JY7A 1R6VA 3F5AA 1IM2A 4XIIA 4XR4A 1EM8A 4XE5A 4EGFA 5KT7A 1VBNA 1XZAA 1U7PA 2DVMA 2QKQA 1CDDA 2II6A 3DKPA 4GU5A 4Q1EA 1PW7A 2MT9A 3TLCA 4R66A 2D8AA 4Q43A 1NYQA 2FMIA 3E5NA 2PMBA 2H9YA 5IM4A 2JLYA 1W93A 2XBMA 3CVVA 1UJNA 3EISA 4I4TA 2CNNA 3W3AA 2V55B 4E2XA 2PCJA 4N0DA 3ZNQA 1O77A 3SSOA 4HDRA 1HEYA 4JB8A 4OCZA 1NBME 2LBOA 1Q3UA 1M2FA 3A9RA 3RYCB 1L5OA 1MQAA 5A5EA 5CH8A 2BFOA 2BZ0A 1CT9A 4YP6A 3C3EA 4KUGA 4P2HA 1QTMA 4O2LA 3RAXA 3OKFA 4V0ME 1NJYA 4HSEA 5TPZA 3UICA 6LDHA 2OGSA 4YCDA 4BWYA 5IMSA 4Z49A 2HBLA 1DK2A 4P08A 5FL7A 3W7AA 5J4LA 2C9MA 1D4OA 1XZQA 7ICUA 2I2AA 1OH7A 4Z6CA 3CRNA 1JBEA 4RABA 4DUPA 3NRJA 3H2IA 3NQ41 4QFBA 3DV9A 3ELYA 3L82B 1KU0A 4RGBA 2X1LA 4CG3A 1RM4A 5JZSA 4KL8S 2Y1IA 3L06A 2JFVA 4I6JA 1BKYA 1P6QA 2OCIA 1Z6GA 2XYPA 3OWOA 4WAUA 5EOVA 1NM5A 4CKYA 4EM6A 3MXOA 1R4MA 4V0MA 2DH6A 2NUBA 3PK0A 3W05A 1FNDA 1BMFD 2HQBA 1E2BA 1XA0A 4CETA 4JGIA 2NVBA 3U1VA 1K88A 3SJCA 1A96A 2F3RA 3ZWKA 4Z9BA 1Y3FE 4O8CA 2XWSA 5J0TA 1WSDA 2R7LA 2O8CA 2F9MA 2J9YB 2X3FA 3H11B 4B34A 1OA0A 4XRRA 5AM1A 4PCLA 1ZSNA 2I4MA 3DDSA 4YMHA 4EDFA 1ZD4A 2KD1A 3KYJB 4HD8A 2XUDA 3IOBA 2LV8A 5IJAA 4BP1A 4XDHA 3D6VA 1GLNA 4QTUB 4YEDA 3U19A 3IUYA 5MF6A 5L4LA 1A6SA 4ZQFA 3U2QA 3LYAA 3IIEA 2QT0A 4HNAB 1IUNA 4P80A 3WVNA 4ND2A 2GH1A 3OLZA 4C8KA 4M99A 4Z3DA 4BTVA 4KNYA 1HIWA 4ELVA 3EGXB 3LUPA 5KG4A 3GQVA 4FB4A 2DJIA 3Q8XB 4O1IA 1XNQB 3TFWA 2B82A 3U4DA 2MOKA 2NYUA 3H5AA 3O5AA 2GHQA 3HMKA 4LYEA 4JI2B 4LY9A 2R5NA 2OEHA 1L0BA 2AQIA 4RT2A 2VI5A 1B8UA 5JC8A 4PG4A 7ICRA 4FP9A 3DGFC 1L7VC 3Q1KA 5E9QA 5EYPB 2XVZA 1FJXA 2OCKA 5DNAA 2RH4A 3CW9A 1H2ZA 3RRZA 2XVYA 4DLVA 1W0JA 5GTDA 2P91A 3SM9A 4DV0B 1I1NA 4ZRDA 3ZWAA 1W5AA 4GLBA 4W4TA 2BPCA 1E6MA 4K9MA 2WI8A 1O3YA 5K0GA 3AP1A 4ZREA 1FYVA 2BGWA 4BZWA 4UB6U 1YIDA 3FKQA 1ISRA 3S4YA 1Y9JA 2JFPA 4G0YA 2V0GA 4Z4HA 1JHUA 1YR9A 1LCIA 3T12A 2BDEA 3ORQA 3CW8X 4N6OA 4CF7A 1WLSA 2O8CB 4Q47A 3W4KA 1EHCA 5HMMA 3ZI4A 3CSDA 3D6TB 1DC8A 2ORIA 4N9QA 1GUDA 2IKQA 3NHBA 4WE3A 5B7GA 1O94A 5CBPA 4MMXB 4JSYA 3A2KA 1BQ3A 1H66A 3HABA 1IBCA 4R0MA 3G0IA 3EZGA 4DS4A 1W4CA 3NHZA 3EZLA 1NJSA 3KUXA 2ZJ2A 1OYYA 5AM2A 2JJ2A 5L3ZA 1E1QA 1GZ3A 4DJJA 4AY2A 2QRVB 4G23A 3OU7A 2A1AA 4U39A 2FY8A 1VJ1A 4G8CA 2QUBA 4YO7A 4UUQA 3PBKA 2Z9DA 5TGDA 1AU9A 1RQGA 4D9EA 1JSCA 3A3YA 3O8OB 1JIIA 7ABPA 4CKCB 1SU6A 5E6SB 5A71A 4HJRA 3TG8A 1U3CA 3R7BA 3UOAB 4JUDX 1Z18A 4X00A 4DWOA 4M0PA 2GJ9A 3TX2A 4ZOLA 2HCFA 1HSOA 3V8VA 1LUAA 5ISMA 2IYSA 1HL3A 1GGFA 3A6ZA 3R0JA 4C03A 3JAWB 3TO5A 5JW6A 1B26A 2BRUC 2QLLA 2DR2A 3SXJA 2Z2ZA 4GQBA 5CNJA 4O2BF 2BDUA 1T8WA 4DCOA 5JNUA 3ZE0B 2BFWA 2H4FA 3WBBA 4IUCS 4RVUA 5A03A 1SC4A 1JA0A 5IH7A 4LG1A 4II2A 2D3WA 5JAPA 2RK3A 2Z9CA 3PW4A 3AYXB 4IDGA 3WWZA 1E96A 1QGDA 1XQVA 3MDCA 5FR1A 1R8XA 4PRLA 1LNQA 3ZDQA 1CSEE 1CJKC 4F5ZA 3C8MA 3LF1A 4IHJF 2EEPA 3DZGA 5IBPA 2AUNA 2QS9A 4MDEA 3FYUB 4S1VA 4C0SA 1T2DA 3MUFA 2AN9A 1AX9A 2IVZA 3Q3JB 3RRFA 3V4FA 1JEYA 1NYLA 1Q3KA 1QMPA 2CUKA 3C3DA 3LW8A 3QJYA 4N49A 5DOZA 1L9XA 1KVQA 2E82A 3R2JA 3C8UA 1UMBA 2X9NA 1NQAO 3EC1A 3GAZA 3HUEA 4MW9A 2MYUA 3FDJA 2F00A 1TFRA 1REQB 3IOCA 2P2CA 2DOKA 2GFHA 3DZHA 4P5EA 1FNCA 3RJKA 4EYQA 1QWOA 4K8OA 5FR2A 3RS3A 4A15A 4IJ6A 1P5ZB 2K7FA 1FMLA 2CDCA 2ZUBA 2NXCA 4FX2A 3AWIA 4HEQA 3K0AA 4HN9A 1RQNA 4IDBA 3FCOA 1KJIA 4MQFB 1XYGA 2GAOA 3F5FA 5F33A 1VPLA 3E18A 2GDZA 2YW9A 5C9ZA 5J2GA 4I2EA 1CF2O 4TTTS 2Q6OA 2W2LD 1UKVY 1X80B 1SEVA 2VDVE 2HHCA 1WDKA 2PLNA 3JPWA 1DO0A 4CMIA 2JGAA 3ORHA 3G85A 4IHJB 1DE0A 1NZFA 4OX9Y 2YVAA 4WK0B 3FBGA 5J2EA 3CIFA 2ZT7A 2EWVA 3IHLA 3GNSA 3TSAA 3ZCPA 4BY9E 2LYHA 2ZYGA 3BWDD 3O1JC 3PA8A 3H8VA 3PX2A 2WAMA 1L4HA 2Z95A 4ZA2A 1Z2AA 3KFVA 4MWEA 4OJNA 3L0DA 3WBJA 3ABOB 4RA6B 1E2QA 5CA0F 3RH6A 5K8JB 3FAZA 2Y27A 4C7KA 4KLSA 1G0NA 3I53A 5JCZA 3ZLUA 4Y1RB 2DR3A 3S7ZA 4MUJA 1JWBB 1NWCA 4OHMA 4Z7QB 4OJMX 4B6PA 1DPGA 1UWKA 3EW9A 1FX0B 1QC5B 3BD8A 1BTOA 3EXAA 4FYHA 3WJ1A 2BAGA 1YGYA 1QO0D 1NK5A 3SU8A 2ZSJA 5KX5F 3D3WA 1ZQRA 2X5JO 2QB5A 2CHFA 2CFTA 2OLEA 5ARCA 3RVQA 3ON5A 1E2DA 1SUEA 1CEQA 1ZNYA 2FEMA 3NNNA 2PXHA 3O26A 4QU5A 3ZTWA 1GHTA 5BNIA 1HEUA 2GAJA 4ZV7A 1L4UA 5FOVA 2BP7B 4BO8A 3ESXA 2HW8A 3CGWA 1U1EA 16PKA 4NXZA 1M76A 4ECAA 3VDXA 2P1RA 4QPZA 3C70A 3I9V6 4ECQA 3QA3E 2CK3D 4INAA 2CZQA 2OUIA 2ZU0C 1BHJA 3GFFA 1BX3A 2PT6A 3BIOA 3KEOA 3TH5A 3TL6A 2C31A 4UVDA 5LZ8A 4M9LA 1JXAA 1YA4A 1L7DA 5ICMA 3KD3A 2W2KB 4I2BA 2GYVA 1TO6A 3UXYA 3V9AA 3EE6A 1P7VA 1USKA 4Y2RA 5SY9A 4PSDA 3ENKA 2WWYA 2O8FA 3HYTA 3OO1A 1GWNA 2QSUA 3BF7A 5DLFA 4R54A 3HKZC 5FI1B 5KVSA 3AFHA 2EAMA 4JT4A 5J2UF 1U8FO 4IVRA 4F4DA 1IEWA 2ZUDA 3RI3A 1UKBA 1BD3A 3FW1A 4MUMA 4XWKA 3G1WA 5AW4A 1AS2A 2PKQP 3C41J 5BYAA 2DFKB 3ZW8A 4F2RA 1XZFA 1Y1RA 4G0XA 3W2TA 4GL2A 2IEAA 1MA3A 5EN4A 1UBEA 3IR5A 1YD7A 3KZOA 2F90A 1T3ZA 1U4BA 4PXAA 2VA9A 2V5VA 2PLWA 3ZVLA 5CHYA 4RWZA 2OCGA 4NDNE 2P6UA 2ZIGA 2BQ3A 1RKXA 4ZQHA 3K31A 3JAMA 2QGFA 5LKAA 1I14A 1JHRA 1DNPA 2JJQA 3DUWA 2XZTA 4UEQA 3AM3A 4B5KA 5IUJC 3S2EA 4F12A 1WXQA 1UEJA 3F4KA 3AF1A 3JQDA 4RVDA 5JNWA 4N9WA 1Q95A 4K86A 1GPBA 4Q4JA 4YCCA 5CDTA 1FC0A 2O2GA 4G5OA 4EFKA 2YRWA 3T3IA 3ORYA 3PDHA 2ZZNA 3KJZA 2QN2A 1ZQFA 1CS4C 2NZUG 5JYEA 4ZT7A 1WU7A 2H1HA 3ETEA 3KALA 3OMXA 3JALA 4MXDA 4CL8A 1TT5B 1GPWB 1IN4A 3G2JA 2J32A 4B4UA 3JD4A 4MWZA 1JIUA 3PLRA 4F4KA 2J0UA 4Q18A 4E94A 1YDFA 4GMFA 2H3HA 3JZAA 4RYDA 3LY9A 3OJOA 4WTOA 3S2UA 4PHTA 1NFQA 4BFXA 1E66A 1V1RA 3UN1A 4FXOA 3Q7SA 4BFSA 4RPXA 9ICLA 1XZCA 2AR0A 2Z6VA 4QGAA 3SQOA 1SN7A 2XBLA 4RJTA 4KIUA 1N5WA 4IQTA 1Z0JA 4GXRA 2MSEB 4CJXA 4PZEA 2ASDA 2IOQA 4IYJA 5CT4A 1F0NA 1GKIA 1BE1A 1ESNA 3K9NA 1DAHA 1TM3E 4FDMA 5DHTA 5B3AA 2C3OA 4DNOA 3L7MA 4CTKA 4ESHA 3SP1A 3E9QA 3IQXA 3ZGYA 2AA3A 1X2IA 1FFXB 2EL7A 3PP8A 4ZCLA 1J8MF 1AKNA 1L1RA 3FJ1A 3R3VA 1KLNA 4K9KA 4KGDA 2JGIA 5EL0A 2DYKA 4PYRA 4PIVA 3G1UA 2PPLA 2J0QA 1R0LA 1ULHA 1N32B 1COWA 3E6AA 1DMSA 1BH6A 1URJA 3TR5A 4ND5A 1QIEA 4PQYA 4BGIA 4CG2A 1YR8A 2AI3A 2E2WA 4JLKA 4RXMA 1CRPA 4GPAA 1ZP6A 1YKGA 3KTQA 4KB5A 3R7WA 3RVKA 4L5IA 1U8AA 1WCIB 3WJ7A 4AUKA 4CV0A 2PQMA 1T2UA 4EYGA 2IS2A 4KQEA 4PYQA 1D8LA 4EPWA 4O0MA 5ALQA 3SSMA 4F46A 3DUFA 4NOJA 1YS9A 4ZV9A 3WNVA 4TWBA 1MX5A 4AUNA 3UMYA 3ENWA 1QGOA 4QXOA 4QYXA 1EFVA 4IFIA 4C0JA 4MV3A 7MDHA 4F3RA 3OTQA 2KG5A 3DWGA 4J4HA 1I3MA 1V37A 2GXUA 1A2OA 1IUPA 1N25A 3DKIA 1GT91 4LBWA 4RQAA 4X24A 1RAFA 1FP1D 4MUEA 2ZYIA 1I1HA 4ARBA 5KFTA 1LKZA 3FLAA 3VU9B 1ZGHA 2EP5A 3EASA 4LRSB 3RK4A 4A7PA 3BH7A 2CY0A 1BGWA 3TEFA 1N48A 1UK7A 3K0KA 2F67A 3CZ5A 4EBEA 3C3CA 3QBTA 3K9WA 4K26A 3P5BA 3DCNA 1T0IA 2WIGA 5DYIA 2NUTB 3SZMA 4EI8A 1IOZA 3CHYA 4OGLA 4BJ1A 4PN7A 3JQBA 2GVZC 3JPTA 1L3SA 1UOQA 2Q4OA 2Z08A 2ZBEA 4XVCA 4Z86A 3CVYA 3HACA 1RABA 1CQPA 4RK0A 1UC4B 2A19A 4Y8VA 1MRZA 3N8HA 2WD7B 5KFFA 3K72B 3PO4A 4KLUA 2CNBA 3O90A 5DV9A 3L0YA 1GUBA 3UA4A 3OEHD 2GWSA 4EKGA 1TAMA 2VDWB 2Y0SC 1MRSA 3AWDA 4FD3A 5LZ5A 1K1SA 3I8XA 4IDFA 3A4MA 2CL0X 3K0FA 3IHKA 4CMAA 1QQAA 2XB9A 3TZ6A 2PZGA 1JPJA 1W6RA 3R0VA 5I9MA 5HA5A 3JY6A 4QOGA 4Z0NA 3AV3A 2WKWA 4EZBA 1V3TA 3N6XA 3HVJA 4RESA 4CN9A 2UUBB 1U4OA 3ACCA 2YZNA 1HFKA 2NZ8A 2VP3A 3QKRA 5B57C 5JJLA 5HMLA 4NLNA 4D0GA 5KTPA 4M0LA 3VR4A 3I04M 3TWOA 2XZOA 5KFKA 2Q62A 7ICPA 1IK4A 4TV8A 3KHRA 3H0RB 1G20A 2CVQA 2PL3A 3F6BX 3HNPA 4PHEA 4PGHA 5AVUA 3QEOA 4EG4A 3WRXC 2IZZA 1NW5A 2AK3A 2WPNA 4QUBA 4BZPA 1SXPA 5D7NA 3LD9A 1UFRA 3CRVA 1ZR4A 5ILOA 2IH2A 3V4VB 2O9JA 1XO1A 3PQCA 2J87A 2R62A 1E8MA 1IH8A 1Y1KE 3OQJA 1KFSA 4EJSA 3WO1A 3PQ6A 3MOSA 1C4OA 4LHYA 2LBPA 4I8DA 2VXYA 1N57A 1V11A 1DBRA 1SFRA 1N4DA 3QU9A 2J9XB 2W6OA 4P4UA 2FN7A 4EWLA 5DLQC 5JOQA 1S8OA 2J6CA 2GD6A 2L17A 2PWYA 4MEJA 1ZK1A 4YDSA 5A4IS 1D4AA 2ERCA 5LBIA 5H16A 2J31A 3OJWA 1UC5B 2AFHE 4R1SA 5T4FA 4F4XA 1X94A 3CCFA 4MWSA 1QB7A 5DRYA 3N0TA 4F3NA 4KW7A 1ZN8A 2GBGA 3B6JA 5EE5B 3LXRA 1FS6A 4XFKA 5CMLA 1G5HA 1F6BA 4FZ3A 1OR8A 1XLVA 1R5BA 1VI2A 3U3DA 2VHEA 5KFPA 4J3NA 2FWIA 1OPRA 3NTVA 5TJ9A 2XQGA 4DBLC 4YWJA 4NYJR 1VSTA 3X1YA 1G7RA 1NW9B 3BQ9A 2GZHA 1E1RD 2HCTA 1VHWA 2P9FA 5KG5A 4AP9A 1Y5IA 4RK7A 4O3MA 3BREA 3L2OB 4NEHB 1YZVA 2OPBA 1U3VA 2VK8A 3T0FA 3CUUA 1UFOA 1EIZA 4N7JA 3QYPA 1SBYA 3LP5A 3PPWA 4TKUA 5B58T 2F1OA 3PQDA 4XA8A 5B1SA 1LSOA 3M9LA 1DZ3A 4YR9A 3CVUA 4TLDA 2O48X 2Z98A 3E8MA 4YBZA 3D6MA 1ECFA 4IQFA 4PCAA 5KG1A 1J9EA 3L0ZA 3VTAA 1D9XA 3WNBA 1YS1X 3NP9A 1NTOA 1RI1A 3U7RA 4MVJF 1E8DA 1FCJA 3ZY6A 2PJRA 1BJKA 4QPNA 1RLTA 5J0UA 1CHDA 2P9EA 3MWDB 3R3WA 5J2HA 4M76B 3LT1A 4CVNA 2CLHB 4NLCA 1UCFA 1QSSA 1S7CA 4PPQA 3AIIA 3MJEA 5EKXA 2ID7A 2DB3A 2YNMA 3VPFA 3ZI7A 4CF3A 4EZ6A 2P2LA 3MIZA 1DEHA 4J2HA 4MX8A 1EKXA 2A0FA 3PKZA 3V42A 1UXIA 3JQ9C 2A9OA 2ZI7A 4D8XA 3WRYC 2YIMA 1XTJA 5HF8A 5L8VA 3R8CA 2PGJA 2CC2A 4JQYA 1X6JA 1AUQA 1FSZA 2WT4A 4Q24A 4QZGA 3E84A 8ADHA 1KPGA 2MTBA 2EF1A 5DYTA 2ODAA 4MQ4A 3DMNA 3Q15C 2ISSD 4Q37A 2F62A 3RAQA 2QA5A 4D56A 2D54A 3O38A 2P79A 1PJQA 4II3A 1CERA 2YXBA 4JL6A 2Q5JA 4AN0A 3NAMA 3OTWA 1OH6A 3FPEA 2WAQF 3WJ2A 1V8OA 2ROQA 4GRDA 2GO7A 4KXMA 3BCHA 1I13A 1TOAA 3FTCA 4UTXA 2QZ4A 3AFNA 5CCEA 5K6RA 5EMMA 3L7KA 1WHSA 4HX5A 3HDGA 3A2LA 1N6NA 5CWRA 4GMDA 4AD8A 5LQDA 5EJAA 3VR5A 2D00A 3VSCA 4YMGA 4NEQA 5C8YF 1XQ6A 2EBHX 1TKBA 3QMVA 1KQGA 3ZJUA 2JFYA 4KOAA 1UJ5A 4D79A 1GQSA 1RWQA 1D5WA 3KWLA 4IJVA 3SAFA 5K20A 2CXPA 1GA6A 4D8WA 3I2GA 1QQ5A 1QKIA 3VOTA 1U28A 2PXAA 5HKAA 4KQWA 5D3MB 5LMUB 5C5CA 1YK0A 2PT7A 3CUWA 1IEXA 4R1OA 3TD2A 2I65A 2MDTA 5JI3E 2HL6A 4LJ4A 4CT4B 2X7JA 4QDKA 4L4ZA 5IX8A 3LUDA 4L76A 4NE9A 2G4LA 4K40A 3C3XA 4NYIR 3HCAA 4YRCA 2HBQA 2K87A 9ICFA 3WSTA 2EV9A 3GLFA 4QT0A 5AVZA 1J42A 4G26A 2RCNA 2QN3A 4V39A 3F5MA 1J2UA 2WJZB 3CH6A 3PDJA 4H4CA 4OA8A 2XGSA 3GPDG 1G6OA 2GI4A 3ZCSA 5IG2A 1WXDA 4S05A 2AOXA 1JHMA 1HNNA 4G2TA 2A7QA 3AGPA 3NHKA 4UOQA 3IBGA 5I3ZA 3B12A 1JH9A 3DMPA 1CQIA 2JI9A 4TRJA 3P0JA 3ORRA 3WK5A 1W1WA 1FJ2A 3HG7A 4NV3A 3T9DA 2XOEA 2XKKA 3VU3A 1OXMA 3N58A 4L5AA 5FWXB 5IFKA 3U7HB 4B3RB 1KL9A 1QVWA 4ZT6A 4J9RA 3UA3A 5K8CA 2EW1A 3MUNA 5CCBA 1YRYE 3INTA 1ODKA 2B20A 2EDCA 2ZI9A 3ITDA 4MA0A 2NQTA 2DPYA 3RWOA 4E08A 2I78A 4YBRA 4N18A 3ADCA 3ED1A 3V8BA 5DIZA 3FHJA 2OECA 2QRGA 5CA1B 1EDZA 6YASA 5JAIA 3PXAA 3CEAA 5FB3A 4ZGBA 4DRZA 4TS9A 3QBEA 1GL9B 4MUYA 1U0SY 2EZ4A 5THKA 3VUFA 1FA9A 3RRMA 3T3DA 4UOZA 1Q7GA 2RJ3A 1G8MA 1U4SA 3BYZA 1LDNA 3M83A 4KQFA 2FOXA 4WT7A 3VYUB 3KK0A 4TM8A 1MC4A 1TQHA 2WM3A 5LU9A 4GLJA 4XJXA 4KRYA 2V6GA 3SJUA 2A8YA 1ZRSA 2IUYA 3D81A 4UBCA 1LV7A 2FZKA 2FMSA 4N8SA 2HZBA 4NPAA 4BWVA 2QR2A 1X7WB 5KWEA 3JAKA 4EPXA 3SBOA 3OQBA 4C8MA 1A5AB 2VPPA 1EM8B 1XTBA 3TIIA 1UDRA 3OOWA 2DWCA 2FK7A 4OHWA 2A58A 2EHJA 2Q21A 1NXVA 1CYDA 2WWXA 3FRIA 1H3FA 2D2VA 2ZWIA 4HOYA 5HQJA 4D4MA 2VJMB 4CTNA 3LWNA 3WMGA 4MW2A 3WSWA 4WLNA 2FKAA 1TK9A 4LZGA 2IW1A 3FUVA 1KWGA 4C0AC 3ZHYA 3HJTA 1NBEA 1LFDB 4MV0A 3F9CA 5TT0A 3WLRA 2EFEB 3EYAA 5DQGA 1U0TA 2NU7A 2O1XA 4IM7A 4OF4A 8ICTA 4FN4A 2G67A 2HXGA 1OJLA 3HR8A 4FEYA 2R8HA 1AG9A 1ZMTA 4BLOA 3DHYA 5D00A 2CV1A 2C4MA 4EL0A 4NONA 2SKDA 3BFXA 2OXTA 3TLAA 1JT2A 1W34A 4Z51A 1FRQA 4QZIA 2VUUA 2WIJA 2Y4NA 2BM8A 1M8GA 5DGCA 4MVWA 4MR8A 3L04A 2AFHA 2YWXA 4HDSB 4XX1A 5KVVA 5EA2A 1QGED 1NNSA 1Q7TA 5A62A 2I3AA 2QMHA 1QO9A 4FR0A 3BGWA 5GVRA 4OSPA 1XZPA 4CZ2A 2IDMA 1K5GA 1QPZA 2IA5A 3NJ8A 3FA2A 4HB0A 4K87A 2C58A 4NHEA 1A4IA 4KWIA 4X44A 3WLEA 3DLPX 1X9GA 3PQ4A 1DXQA 3ZVNA 1RWOA 4P7JA 2N1BA 4B75A 7ICEA 3OY2A 4J1SA 5B58C 1UK9A 4BMXA 1H0SA 3AVTA 3VPDA 4FT4A 3GFKB 4KR3A 4DEXA 2ZIVB 1TZ2A 2GZDA 2R2GA 4GPBA 4I08A 1NF3A 1MG0A 1W0KA 2AQ8A 5AIBA 2EP8A 1ISSA 1MQ3A 5AJWA 5H1YA 5CITA 3H9BA 3KOUA 1KVUA 4OM8A 4TS1A 1KEUA 5BSRA 1JJFA 1QO7A 3OM9A 4QQNA 4ERXA 1OX4A 1XVTA 3KKZA 4KE8A 4NHOA 1HEIA 4CM7A 3FVTA 2HA2A 4QL3A 5HIMA 2C7BA 2H2FA 3UYKA 3A9CA 4ZI2A 1CJBA 3S2YA 1UJ6A 2SKCA 2MJLA 2OHFA 5J2JA 4EBDA 1WWKA 2I80A 3DW1X 3WFJA 1HTWA 4E46A 2YOGA 4GBGA 2W0SA 1BRMA 4IMIB 5KNCA 1KI4A 1XJ5A 1DCMA 1FNNA 3KKPA 4JDPA 4MGIR 4DZRA 3M89A 3I58A 4X1KB 2VQSA 3QYAA 5CLGA 3RUEA 4KE9A 5DYGA 5JYDA 1USWA 1JUDA 3MA0A 1CG6A 3MK31 4MJ3A 2O6HA 4N01A 4F4WA 1IZ9A 5IIJA 1W6UA 2KLHA 2OZLB 3LKDA 5COAA 4QWMA 5D5QA 2NQ8A 1ZO8A 5DFAA 8ICGA 1PS9A 5DI3A 2HIHA 3IFSA 3JVIA 4M21A 3U3MA 4DM7A 5B3KA 4WNYA 4YFVA 5EPUA 1ULZA 2R1VB 4Q05A 2R68A 3FCAA 3FROA 1UUFA 3MB5A 3W5IA 1ZD8A 1YVRA 4RKEA 3RADC 1S2GA 3HB9A 4BC0A 1BD4A 3JQBC 5ALGA 5DXJA 3NKVA 4NLKA 3GDGA 5CLFA 4BUZA 3C3KA 3R0ZA 4JOQA 4R1TA 3MD9A 1Z6YA 2REQB 4RQBA 4BFLA 1TMYA 2B5WA 1B14A 4LWQA 4N5IX 3M4XA 5IKOA 2BCGY 2OC4A 5DX8A 5ALNA 3ZZNA 3RSHA 3KELA 1Z25A 4B3FX 5JLJA 2RB5A 4OXYA 3ZI0A 4GD3Q 3FIUA 3KDPA 3MPUA 1WBDA 3NI2A 3WLIA 3AINA 4ECWA 5F1OA 2CXNA 5C51B 3NVYA 1T5TA 1SKBA 4Q19A 2BJHA 1S2NA 5CFZA 1HE5A 2WA1A 2VEOA 1AZLA 1DX9A 2C2GA 3FUXA 3KE8A 3KFXA 1P75A 1VJGA 3RIYA 2FWRA 3FKSA 3WB9A 2G08A 3R4CA 2QL9A 1YFLA 2YHSA 2RGUA 2AC7A 3AETB 8ICUA 2XWQA 4KXNA 3J81A 1KR5A 1OXUA 1U47A 3DV0B 3GRZA 1FTSA 2C8KA 3EGDB 2IPLA 4B73A 4YXFA 1RP7A 2H65A 5CD1A 2J4FA 1DV1A 3C14C 2WF5A 5IJ0B 5KNBA 3UV7A 2CLEB 1GN9A 3I6QA 2Q5QA 3MCUA 2VK4A 3B0YA 3EOZA 4D9HA 4CFSA 3V7KA 2CE7A 3UGJA 1I7PA 9ICQA 1S9DA 1NZDA 2QAIA 4IW3B 4L4XA 4UE6A 1DBSA 3EAFA 4G4GA 4XGIA 4QBKA 5CUQA 4F7DA 4A8JA 1TQ4A 1JT9A 2RHWA 3GGSA 4C0BA 2X4DA 2CV0A 2OE2A 5ECWA 2WHEA 3VHXA 2B1QA 4QVGA 1EVJA 5JPIA 3WK6A 1NUQA 2GD0A 3OE5A 3PNSA 1NP6A 3BE6A 2A3VA 1TCAA 1TM4E 4MWTA 3OESA 2B5OA 5DM0A 5LXTF 3P8ZA 4A5OA 2OAQ1 3G2QA 2X2PA 3HGMA 3PFFA 1I5EA 3G89A 3AGQA 1MA0A 2E5WA 3H11A 3S40A 3W5BA 1JP7A 1R64A 4ZARA 2EJUA 2BFMA 1ZH8A 3HL0A 4J07A 5HRAA 2FJ0A 1XZMA 2JJYA 1E89A 2CZCA 4PGYA 2KHVA 1CQWA 1RD4A 1V96A 1XDGA 2P3SA 3Q8MA 3CF0A 3D2LA 3WL7A 3GUHA 4U1RA 2QTZA 3LBAA 4HADA 3HNRA 1EVEA 2H07A 3SSNA 3KD2A 1QZUA 4ZVRA 3PUXA 3KCNA 2ZUWA 4LY0A 3FNFA 1QNFA 3HDVA 4F5QA 1YRHA 4ZCPA 5DOVA 3AVOA 1ORDA 3B2EA 4J9VA 1BPBA 1K4YA 5DDMA 2V7QA 5FWAA 4KSCA 3WB2A 5TQ0B 1KOFA 3FG9A 5EZ5A 1YASA 3KRTA 4QHSA 1QFXA 4LOJA 4EITA 3O73A 4CTJA 4NY1A 5ER9A 4Z0PA 2JHGA 1MV8A 2D2XA 4TV9B 2W9AA 2WWRA 1VLJA 2P7IA 3H8MA 1T4BA 2VEDA 2C94A 4R1PA 4F60A 3QE3A 4P3XA 2HH9A 2RDIA 1Y7HA 1XBTA 1O8BA 1XP5A 2O3UA 3KZKA 2LIPA 1P31A 1ST2A 1NMSA 3TINA 2Q0HA 3VHLB 4ZICA 3UC5A 4FZRA 2C77A 2XW6A 1RVV1 3DWFA 2A1JB 3GBVA 1TD1A 3SAGA 3V6JA 3IPAA 1X39A 3ECCA 4Z0HO 1Q57A 2HJSA 3NNSA 4UAUA 3IELA 3OAAA 1QHGA 4EVRA 2C2EA 5DLEA 3ZGOA 1PJSA 2XHZA 4F45A 4ZOLF 5FTJA 5J5AA 3LQKA 3AQ4A 2H2DA 1LK7A 5TARA 1F9EA 4U2FA 3TDMA 2KTQA 2V0NA 3UGKA 3IN5A 2GO1A 3W1WA 1U2RA 2ZDQA 3OCVA 1MOSA 1NPDA 2DUUA 2ENWA 5KKAA 3LI2A 3TLKA 2XGPA 5FYQA 1QF6A 4LEIA 3L7BA 1DRKA 5EMNA 4DDUA 3UMFA 1EP9A 4YRLA 5JC1A 1SOVA 1PJLA 5I4IA 2BMAA 1UZUA 2ASJA 2Q6KA 4RZXA 5C35A 4GEGA 3ILHA 2HOFA 1MJ5A 1XNJA 5LB4A 1Q8KA 4YXWD 1NVWQ 4IHAA 2ZWPA 2VKTA 3SZOA 2ZIEA 2HPHA 2O8EB 2HJRA 1MNQA 1TRHA 3VPGA 4CIDA 5DBOA 1ISHA 2YJ4A 3GHHA 2QTVA 2JH3A 4O3NA 3IBTA 1E8NA 1GEGA 1U5BB 3LBIA 3NJ4A 1MENA 3NDJA 4U7TB 5LB2A 4UATA 2CF5A 4M1SA 5AVWA 3I0ZA 5CB1A 2QTTA 2D7JA 3CLKA 3CONA 3D5EA 4R2LA 3HJGA 2BZFA 3KPUA 1E2MA 2FUG1 3AI3A 3EXIA 2AGVA 3KFUF 1JDSA 2PKQO 4DT1A 4WN9A 1ILWA 5CX4A 3N9IA 3OHBA 1HZJA 4UBJA 3KKQA 1KIFA 4ZAVA 1Z74A 2HJGA 3T1NA 1HE3A 3NUZA 4Y18A 1G8GA 1HYBA 5EP4A 4FK8A 1C7JA 2I1WA 5M29A 5KNDD 3RBEA 1ZY2A 1U2TA 3R7NA 1TC1A 2H7VA 5EY5B 2JRLA 3H6GA 3TARA 3DH0A 3GO4A 5LUBA 2VWPA 2YHIA 3AMZA 4J0FA 2HBJA 1ZK0A 3CE9A 4CMJA 3MJSA 1EH5A 2QVZX 3KUUA 4Z2YA 4G01B 1CX9B 3GUCA 3LHSA 2I9PA 2O8VA 3HO6A 4Z4EA 4W82A 3FDSA 2PUBA 3O3OB 4C8OA 1JTFA 3KSAC 4TTIA 1TEVA 3O3NB 2UVPA 2WD8A 4FFRA 1MCZA 2E87A 4L9SA 3UJ7A 2VYVD 4LGVA 3PICA 4Y6LA 4ZEVA 1ULAA 3V7LA 1KFBB 1Z15A 2QQEA 1QYIA 3IEXA 4ZVLA 4BAUA 5C8ZA 4M60A 4UQLA 2EYUA 1NT4A 3NFRA 3QEMA 3PCRB 3LYSA 3ZY2A 1FDOA 1VE6A 2GQ0A 1F12A 3QITA 3T1QA 1V2GA 4YXWA 1XD9A 3RYIA 1RLOA 4AZSA 4J3FA 5BN3B 4JIGA 3G23A 4M8SA 4BV2A 1E3WA 3PT5A 1E18A 1WDWB 4HL6A 1CY8A 5K3SA 4JI6B 3HA7A 1Z7WA 2AS0A 4FHZA 1KEVA 5CPBA 3DDUA 5DSTA 2P9QA 2Y71A 1NU6A 1R4NA 1W8IA 3SKYA 5SZHB 3RTVA 2IXEA 4R40A 4CU5A 1PR6A 1GGNA 1RJ9B 2XUFA 5ALIA 4FWBA 4DC1A 5FPKA 4CQMD 2HQSA 3P9XA 1SVNA 1GLGA 2ES4A 5EJ2A 4X7BA 3R8XA 4DW8A 4HVCA 3UHOA 1BW9A 1RS0A 2QNBA 3RBVA 2R00A 1ZUWA 1NN0A 5LA6F 2GEJA 3V6MA 1IJBA 1AGYA 1DI0A 3M6XA 3HKEA 4RSGA 4CKBA 2D5CA 1UBOS 1QH1B 3OZVA 1YQEA 1B0ZA 3CVJA 4PAGA 2HHWA 4AROA 2VHUA 4OREX 2X1HA 3O8CA 1U7DA 5J2CA 3AP3A 3MWLA 1RWXA 2AD5A 4K9LA 1D8YA 4PC6A 3TTVA 3W2HA 2ET6A 2GAIA 2XTMA 4Q16A 5LR6A 3QVTA 1BDHA 4OQNA 2VNAA 1T5SA 3GRPA 2AW5A 3QPDA 2OV3A 4X45A 4GFDA 4JLAA 4BV3A 5KNCH 4X97A 2DAPA 4C5AA 3M33A 4V0RA 5BOMA 4A03A 7REQB 1EFTA 1J8QA 4FE4A 3R7FA 5C8DA 2P2YA 3LDGA 3A4LA 1X1CA 1VP9A 3WMEA 4B2PA 2HRQA 3TSOA 4M83A 1V5EA 1KDTA 1YQGA 4TWIA 5KDOA 4OHYA 1Q17A 4S0ZA 1J8YF 5JO9A 4RGYA 3GLGE 5IWCA 1Q0TA 3DZIA 2JEZA 3BMOB 9ICKA 1FMFA 4ZZ0A 2PR7A 4F50A 4DSUA 5ERGB 2F77X 3W78A 3N7PD 2DTXA 2VIIA 3PTLA 4IEEA 4GQAA 3ASUA 4F4HA 4HT3B 4QGHA 3OLQA 8AT1A 3CYMA 2R6CA 1CE8B 1F60A 4A3SA 4Y2QA 1IL0A 3NS7A 3Q85A 1KAHA 4U3JB 3NTQA 3W2GA 1DQSA 3PIRA 4D5EA 4W9MC 4UBBA 5J4KA 2WSLA 3BHJA 3FTEA 3NAGA 1MOZA 1CLEA 1DO2A 2DKOA 3PHCA 1ZOIA 3D3JA 4LMPA 3TTXA 1H5NA 3V4OA 4ZRNA 5F76A 3L5KA 1I7LA 1ZQZA 1HMPA 1RC1A 5I5EA 2CNLA 1S97A 1FVOA 1B8OA 1DAOA 1LNSA 2PIAA 2UYYA 5AMXA 3DEYX 1QLJA 3JQRA 3N5KA 1Y42X 1GPLA 2O1WA 1PK8A 1GT6A 4CKEB 2A33A 3IEVA 3RR2A 5I6DA 1VG8A 5CP8A 5HIIA 1JAXA 1FYFA 1FSSA 1MXHA 3HYLA 1I2BA 2R751 2LGJA 2PTHA 4BKPA 5AVJA 4UM9D 5CVJA 1J8VA 4P4NA 1DB3A 1F51E 4A36A 4HAUA 4EB0A 5IAKA 2VAXA 5DHAA 1KJJA 4PRYA 3JALB 3P2EA 1MJGA 4E11A 2E48A 1G3MA 2XUJA 1CF4A 3GR6A 2OAP1 3EUFA 5BV2P 3LDHA 1T34A 1AUVA 2A5GA 1F0PA 3OKCA 1J06A 4O25A 3IJPA 2A9QA 1ISPA 1MH1A 3QJ5A 3QV1A 4ZVOA 1JXMA 3SGLA 1XN4A 1XTIA 5AVKA 3EG5A 2DPJA 4MUFA 1GKLA 1T5HX 2B0CA 2PI5A 3L9WA 3NKFA 5HZGA 5KTQA 2YFHA 1D1TA 1DCKA 1TU4A 3F7OA 3VTKA 4CDGA 1CQJA 4ZRMA 4PCUA 3ZDZB 4E0DA 1N6OA 1NG9A 1N3LA 3PLAE 1V8FA 4ECSA 3BQ1A 2DFPA 4EGSA 1ITZA 1E9RA 2FQXA 2Z0MA 1Q7CA 3LUHA 2NVOA 4IO1A 5DSXA 2BEUB 5LLSA 3L0SA 2FG5A 2JGDB 3G0OA 4KAJA 4LNUA 3JAWA 3HUFA 1DBPA 4PQGA 2XC9A 5JCOC 2NU9B 1IMJA 3BDIA 4PBRA 3RNOA 1P1FA 4AU1A 4B48A 1PV2A 3AVWA 2KW5A 3FPLA 3T7IA 1D04A 5BR1A 1L5SA 2KOBA 1Z83A 1P2BA 1TUBA 2A5JA 2A0KA 4O4JF 3KHLA 4Q4DA 1PZMA 4AWXA 2I99A 4BJQA 5BVHB 3AJ8A 2H85A 3UMVA 2BPGA 4DLLA 5B55A 1KAQA 4CGZA 1USUA 2UUPA 4G85A 2BEVB 5JJIA 2C5AA 1GDDA 2W58A 2OCLA 2ZI5A 3GROA 3LDUA 2ZT6A 1QM5A 3N2GB 2N1MA 3GDWA 4QOEA 4JJ4A 1S10A 4MHOA 4DMMA 3AFGA 3H16A 1QTNA 3FJYA 4GC6A 1J0EA 2QYSA 3M6LA 4BGDA 1QF7A 2XE8A 4P33A 3TNYA 3UJCA 4AG6A 4DQ0A 3RBXA 4MVXA 1DKOA 3GV8B 2O57A 3ZCXA 3NHRA 4WEQA 3OLWA 3EVAA 3DZFA 1BXKA 4HH1A 4R2JA 4D3FA 1YZLA 3QXXA 2WOOA 1DG9A 1GZ5A 1RAGA 1JG1A 4RENA 2HHAA 4XX0A 3NORA 3RIHA 3TXXA 4Y6SA 4EY5A 2V59A 1DQPA 2EVWX 4JD5A 1R66A 1SM4A 1Z5GA 2D8CA 2RFLA 2BUAA 3UJ6A 4OP1A 2HCRA 2IITA 4E6PA 1Q15A 2Y99A 5IP5A 1J7KA 2HLNA 1RHJA 4PG7A 2IF2A 4F8YA 1S77D 2PBRA 5LUAA 4YLYA 4DQIA 1NQUA 1JYEA 1PLJA 3AL0B 3HGQA 3F5SA 4NV1A 3V7FA 3VV3A 2FMQA 4EQ6B 4QWDA 4KLEA 4MGKR 3WP1B 3GLIB 1DRVA 2Y9MB 3S81A 1KYTA 4ED1A 3GRAA 3LQFA 3LGXA 4LZAA 2CMKA 1N2JA 2VO1A 5T8KA 5CAEA 4AQYB 1P7DA 1YMVA 3WLAA 1PTKA 4RQ4A 2W43A 3ESDA 3ZC3A 5EKDA 2W9CB 1RRMA 1HL7A 2CMFA 5IHPA 1Y5RA 1UXJA 3JPPA 5LQAA 1HT0A 3QOYA 4C0KA 5LVAA 4ZQEA 3PKIA 1AM4D 3RARA 2JLXA 5K0CA 3O8OA 4AJNA 1FP2A 1U94A 3AESA 2OH2A 1K5OA 2WLSA 4LGCA 3RVJA 5FWYA 2VUHB 4GKVA 3ZE6A 4FYJA 4HTAA 1A1SA 1OHHD 2CDRA 3AR9A 4IDNA 4K28A 3WQQA 4GRIA 4B4VA 5HSGA 5C7LO 1XSPA 1GQ2A 4ZYXA 4FQ7A 2C82A 2E1FA 5JDIC 2MSKA 1VFPA 4A6XA 1N4AA 4CM9A 1PCXA 1IY0A 1YS7A 1PJ2A 4ZT5A 3FMGA 3URMA 3PFGA 6AT1A 4GMXA 1SZCA 2GK7A 1FVFA 3AF5A 3I2IA 4URZR 1A9YA 3WICA 2G5PA 1NK9A 2IU6A 3IMCA 1K3TA 1Y5NA 2WP0A 4LZJA 4MUBA 4FX5A 1YR6A 3MMSA 4R8VA 2FLLA 2FHSA 4DZTA 4RLFA 4CEJB 4B09A 4BVGA 4K7JA 2BF4A 4AIRA 4L7VA 5LD2C 2HRCA 4FDUA 3UT5B 2PUHA 4YQEA 2FLKA 4QO8A 3B38A 3TR6A 1YE5A 1H9CA 4WESA 1QFYA 1U8XX 2VA8A 2MYTA 2NAPA 4BGUA 2NO1A 8ICWA 3RSOA 4K2HA 5TT1A 1BXZA 2WJGA 1WUTA 2NO5A 3B60A 3KU4A 3QXSA 4P98A 2VP2A 3TRHA 3ZZMA 3PR5B 1C9DB 1GGEA 1MORA 4UXJA 1REQA 5E6UB 1Q5PA 4PHFA 3M6KA 4YAJA 5U4QA 4YHHB 1XPRA 2IEGA 4URWR 4HMQA 2M2IA 1SKMA 1EFRA 2BFAA 4X85A 1SVSA 2XMGA 3AUXA 4QDOA 3TN7A 1ZITA 2UZAA 3HCDA 2G4VA 3R5JA 2HUNA 1UDCA 1QP7A 5A4FS 2QTLA 1X9IA 3W2IA 4DWVA 4O0IA 1QYXA 2W93A 2WIKA 4XWWA 2D2EA 4R7ZA 5LP6F 4QOIA 4C0XA 1V7CA 2VYFA 1YFJA 4BPBA 3RW9A 3T61A 2HSDA 3MC1A 2GM3A 4QFMA 4U6NA 1YZQA 3DB1A 1DAFA 2PVPA 2YHBA 4G1UC 1WV0A 3A3NA 1E2KA 5BWOA 3OZ7A 2H2WA 4XIGS 4O2AF 1SV0C 1QVRA 5LBTA 2PBFA 3SC3A 3UK7A 4PNEA 3GP8A 3EFOB 1ZCZA 1SUAA 1Y1TA 4AN1A 4C6HA 2DZDA 3OF3A 3U7QB 1VJRA 1W4RA 1W36D 2DUYA 1N9KA 1QYWA 3TW8A 1A1VA 2WAYA 4ZO6A 1KEWA 3WNQA 3S7TA 5IAJA 1KY4A 1V6AA 2AV6A 5J0QA 2EYQA 2HA6A 2VJNA 4QPJC 2Y05A 1C3JA 1LRLA 3UJ3X 3WNCA 2HBKA 1DBQA 1U80A 1YS2X 1T10A 1ZI6A 2BBOA 4QNMA 1QGZA 1PZGA 1IY9A 1RWKA 4R01A 4IQVA 2DJ5A 3COVA 2CW5A 5P21A 1F20A 1YWGO 4G1BA 4JYZA 3DF9A 2CJPA 1WW8A 4XWGA 4OQFA 4Z1MA 4HQOA 4YFYA 5TEVA 4EJ0A 3VNBA 1PUIA 3BJYA 1GAQA 4M8KA 2CUZA 4DAEA 4Z6DA 1AKEA 3LRXA 3QH4A 4BRZA 3JPNA 5KYXB 1UJ2A 3TADA 2HNKA 2ZJYA 3GQBB 1SC9A 3IC5A 3IP8A 3R09A 4JP3A 2BPFA 4P2BA 2P5SA 4AS3A 1X7WA 3AOEC 3EJWA 4C6RA 2XOKD 1WXFA 2JRCA 3LQRA 3WGMA 4F96A 2H5EA 1YAJA 3RH4A 4RVCA 4I19A 5BMOA 1I4EB 3W2EA 1Z6AA 3ASVA 4QD3A 3RS2A 1F8FA 4B45A 1NI4A 3W6OA 1KARA 5CG1A 2RC5A 4EO7A 5KFMA 2OWDA 1TK3A 2DKFA 3FOBA 5F64A 4IVNA 5TPZD 3RREA 1JS1X 2ATCA 1O6CA 9ICHA 3H2SA 3HU3A 4MYSA 2ECOA 7MHTA 4L50A 3NV7A 1ZMOA 3EGEA 2PL9A 1ECCA 3Q0IA 4OXXA 4ZTBA 1GTSA 1VI6A 1Q44A 2F9LA 2C95A 1XMJA 4C80A 1YRWA 4P4GA 5TF0A 5CB4A 3VOAA 1JEQA 3NDPA 1SA0B 1RPAA 4I29A 1RYYA 4DNXA 3USZA 1KDVA 1JTEA 4US9A 2Y9UA 1CQXA 1J4AA 4O5KA 4WVFA 4JVOA 2GWHA 4MWCA 4D5GA 3NC1C 2GBCA 2X41A 4FBGA 4RZQA 3ZIAA 4CRWB 2ODBA 4E4TA 4DYVA 4OLBA 1NDUA 1IZ7A 4DREA 3SV3A 1KMHB 1V8BA 3K73O 3NBUA 5GV7A 4EX7A 1ESCA 4EHFA 4J1TA 5KQGA 5JU5A 1GG8A 3QNUA 2CN1A 2VLIA 4BJ3A 4D3XA 2HB6A 2GN9A 3EGVA 2D1FA 4BS9A 1T3HA 1Z5VA 4Z1MD 1U0EA 3NDIA 4XB6B 1Q20A 3EX7C 2EGHA 4CU2A 3FFBA 1W87A 2ZS9A 2PY6A 1I51A 1ZCAA 1NULA 4MUIA 3ZZTA 2R8GA 1TA0A 3CURA 4BNZA 1XB2A 3HRHA 3K8OE 4NZZA 5D3MA 5J47A 4RQ2A 2XLCA 1X14A 4OQPA 4BMOB 3BEDA 5EEGA 2RIPA 1JVNA 1BPXA 1QBKC 2C42A 5HJEA 5KTYA 1OBOA 3DR5A 3BAFA 1Z12A 1X1AA 2LW7A 4BRSA 4M49A 5EWJB 4W8GA 2E37A 4P9NA 5HF5A 5IIMA 4D74A 1NZJA 1LJUA 3W7VA 2XHEA 4N7RA 1ES9A 8ICPA 3PJRA 1W9MA 3CWZA 1XEXB 1EU1A 1N0VC 4F21A 2FLNA 1VIVA 2PUWA 3IDSA 4YDHB 3R7AA 3SZUA 3B20A 1NM5C 1EGHA 5KFYA 4I2GA 2XNJA 3UW1A 1BEUB 1QU3A 1J0XO 2BRUA 5ESWA 5HYVA 9ICBA 2YMPA 4GGMX 3IEMA 2ZDHA 1ZM3A 4HFJA 2G0NA 3HNOA 3OD1A 4FKMA 5A3SA 1PGJA 3NG1A 5KT6A 1X8KA 4Q66C 4CIBA 3DAOA 2RP5A 1N2ZA 2IHUA 3C43A 3MGGA 4ITUA 4OI4A 4UEKA 1IRIA 1KNQA 4N3CA 3SDBA 1L7QA 2FMTA 2ZSBA 3B36A 1YCFA 4DOCA 2QUKA 3UXNA 1KZ7B 1PR5A 1XU9A 2C4KA 5EIFA 1LZLA 1JI3A 2WWFA 4HAXA 4K9DA 5FBLB 5DHSA 3TIXB 5AVQA 4PCVA 4V3CA 5FEUA 1R1DA 2F4NA 5AJXA 2EXXA 3BILA 4CW7A 5ALMA 1J1ZA 4ECEA 2AHOA 1PSDA 1GRVA 2HPVA 4TKZA 4XTCS 1NXWA 2G4CA 3OIUA 5EJFA 3WLKX 2TSYB 4HGNA 4OLJA 4TZKA 4ZPJA 5DBGA 3WDMA 4OGGA 4Z7NB 1YZ6A 4L02A 4A2PA 5EJGA 3T54A 1Y6QA 1NOMA 2P4UA 2QR5A 4YJ2A 2P2NA 4JSRA 3S1AA 4IIXA 1ZINA 3T9FA 4C2UA 2BFBA 4HGYA 4C7YA 4UVIA 3ITKA 3FCSB 3EGXA 2C5EA 5B53A 1WHTA 4K6FA 5IBQA 1UT5A 1FE8A 2WK1A 4XD7A 3MQFA 3OC6A 3HVUA 2XDQA 4LBZA 4RCVA 1JRLA 2R7NA 2VT7A 3QPWA 2IHTA 2QI9C 2ZZMA 4B2LA 5JASA 4UB8U 1CIJA 3AI1A 4GLLA 2C29D 3FTDA 5G0TA 4DQSA 3LPCA 3UC9A 1EEXB 3MXTA 2F64A 4ASUA 3TOVA 1KVSA 4QW9A 2CYBA 1XRMA 4DFKA 1Y8QA 2VDNB 2H7CA 2XB6A 1HQYE 1T4MA 3CUSA 3CW2A 1PNTA 2OORA 3IKMB 3UWOA 5F9LA 1MW8X 5BW5A 1AKYA 4AL4A 3LL4A 1X92A 1G3UA 4W7HA 2JFHA 4YRBA 4Q3AA 1VKZA 3VH2A 5JXWA 3I9V1 3PUZA 3D0RA 4B6SA 4AYWA 1WMDA 4D3DA 2IOFK 4F2WA 1M0EA 2C83A 4IX9A 5JAQA 4ZIRB 1EJ0A 4YK7A 1FTGA 4XJTA 5G4KA 5EZ6B 1E6EA 2HMYB 2G6BA 2I0FA 5HXAA 1J2EA 2J6UA 3QKRB 2HNBA 4EG7A 1WQ1R 3FB1A 1E2EA 2I6GA 3ZX5A 1F4LA 3VXKA 1ZOLA 1SCBA 3GT7A 1KOJA 1S3FA 5HUJA 3W8FA 2RHTA 1FYEA 4MLDA 1L7PA 3JWHA 2IOFA 4RPGA 1UPCA 5AHOA 4GOOD 5DASA 1H6DA 3RVLA 1XZ8A 2AI2A 3NXSA 3VA7A 3Q11A 4MB6A 5JAHA 1P7WA 4I6GA 1JQKA 3O8NA 3RTCA 4JK3A 4KYVA 4EYKA 1XA4A 4HYKA 1PP4A 2Q7OE 3KTDA 2FSHA 3AU2A 1KGDA 4IGAA 4C30A 3BAZA 1KEKA 2YWDA 3OKPA 4LXIA 1NE7A 1AN9A 4B44A 1OPXA 2UVRA 4FJ1A 4V02A 1V25A 3PNPA 2AFIE 1PVRA 3K09C 5AJUA 4CM9D 5JDIA 3USCS 1V7PC 3CZ4A 1Z37A 1F17A 3OJUA 3DULA 4FGUA 2EZ8A 2RHLA 1NTRA 2GVNA 2VHTA 2XE6A 4DC0A 3WG9A 4G1CA 4AMGA 4DCSA 2VBCA 4FI3C 2VHYA 1XWFA 3A4IA 3DDZX 1XZJA 2P40A 3L3BA 4RVGA 1Y5LA 4DLWA 3ZDBA 4YCSA 3CR7A 2I2CA 1QH8B 1YR7A 2AMVA 3AHJA 3MCZA 1KI9A 4H6XA 3O2QB 5E8RA