3QXGA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron complexed with calcium, a closed cap conformation
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
222
structure length
222
Chain Sequence
KKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 84
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qxgA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qxgA01
1Z4JA 1T9ZA 3B8EA 2I7DA 5ALFA 5AI8A 2RARA 4GIBA 3L8GA 5AM2A 1L7MA 3WKAA 3U7EB 3IRUA 1RC8A 3FZQA 3DV9A 2FI1A 3OCYA 1CQZA 3ZX4A 3ZVNA 1RKVA 4UAVA 2G06A 3QUTA 4BX3A 5ALOA 4CE6A 2GHTA 2YJ4A 3L7YA 1U2TA 3FGOA 1O08A 3AR3A 2JARA 2YY6A 2W4MA 2ZBFA 5ALQA 5AK4A 3QUBA 3RFUA 3SKYA 1CR6A 2IOHA 1T5TA 3OCUA 4L6AA 5ALPA 5ALMA 3PDWA 2Q4TA 4RETA 2FPUA 5AM0A 2FPRA 3NIWA 1TJ4A 3RF6A 5AW0A 3ZU6A 3R4CA 3HYCA 2I54A 3MN1A 5ALUA 1S8OA 4I9FA 3U19A 5AW2A 4YCLA 1MH9A 2PQ0A 3OCZA 1YNSA 4UMFA 2JAWA 5ALVA 3ZI4A 2B1RA 5AKJA 3U26A 3WKBA 1LVHA 3W5DA 3WK4A 2QYHA 4F71A 3SLRA 4C4RA 2O9JA 3P96A 2P69A 2R8ZA 1YV9A 2NYVA 1SU4A 5AK6A 2B0CA 2C88A 5ALEA 2WF8A 2Q4RA 5AW6A 3N8GA 1ZJJA 2RAVA 3QNMA 4IG4A 3ED5A 3AR8A 1QH9A 3VAYA 5AW9A 1RMQA 1X42A 3DDHA 2CFTA 5AVVA 2EARA 2FPXA 2HEGA 2WF6A 2BDEA 3FPBA 3OCVA 4ZEXA 1VJRA 5AHXA 2AUTA 1YMQA 2HSZA 4G9BA 3ZWKA 4BX2A 5AVZA 2YJ6A 5AI0A 3QUQA 5AKGA 4YCMA 1FEZA 3L8HA 4KYTA 5ALZA 3M9LA 3OCXA 5AM3A 1Z4MA 4KNWA 3DAOA 1O03A 3UMBA 4UAUA 2ZBEA 3QX7A 2GMWA 1RLTA 3K1ZA 4UMEA 5ALRA 3QGMA 5AVSA 3QU2A 1ZRMA 4UU0A 1U7PA 2MU2A 4YCNA 3E8MA 3L1UA 1YS9A 3L0BA 1YDFA 5IS2A 3U7HB 3WK5A 5E0OA 4BBJA 3EF1A 2I55A 3L5KA 3U13A 1RMTA 1RRCA 1TA0A 2OM6A 2NO4A 2VKQA 3ZTYA 1Y8AA 1T5SA 2YJ5A 2W11A 1RLMA 3SKXA 5ALIA 3FVVA 3L8FA 4XQ0A 1Z4PX 3NALA 5T41A 1NRWA 3CZ4A 3QU4A 1L8OA 2IYEA 2FUEA 1ZD5A 1Z4OA 3UMCA 2RB5A 4NAVA 5A3SA 2CFSA 4BEWA 4DFDA 3WK8A 1RDFA 2X4DA 5ALGA 5AW1A 5AKHA 4EZEA 3WKCA 1QYIA 3AR4A 4Y2SA 2ZG6A 1RMYA 4UM5A 1Z4IA 4AS3A 4OD0A 4BNDA 4OCZA 3EWIA 3BWVA 2B30A 1J97A 5AVYA 1ZD4A 1RKQA 2I33A 1TJ5A 5AKKA 3MMZA 3PGLA 4FFDA 5AVWA 2WF5A 4DWOA 2B8EA 1ZOLA 3SMVA 1EK1A 3KC2A 3ESQA 1SWWA 3SF0A 4FE3A 4CF5A 2YFYA 4HAIA 3I6BA 3B9RA 2W43A 2P27A 2YMPA 3GYGA 2WF9A 1Z4KA 4QQFA 3OTQA 3L0YA 2P11A 4Y3UA 2R8EA 3WK9A 5ALWA 4NV0A 1RKUA 3QYPA 3I1YA 4UMVA 2IOFA 2AGVA 3ET4A 3DNPA 1VJ5A 4CF4A 1SWVA 4Y2XA 5ALNA 2MU1A 2Q5EA 3KBBA 3QLEA 4YH1A 4HGNA 3N1UA 1Q91A 3SHQA 5AW8A 1Z4LA 3NUQA 4UARA 2C4NA 1N9KA 4UM7A 2WHEA 4BYGA 1ZD2P 1Z88A 3NRJA 2OBBA 2HF2A 1VFPA 3L8EA 5AIBA 4HGRA 5AKYA 1L7PA 3FM9A 4HGOA 5AKXA 4EEKA 3IB6A 3W5CA 2ZOSA 5AI6A 1Z4QA 2G1AA 4Y2QA 2G80A 2IOFK 4MWOA 5AVRA 5AK5A 4UW9A 3E84A 1TJ3A 4HGPA 2I34A 3NAMA 1F5SA 5AW4A 4FYPA 3R09A 3E58A 2HOQA 4B6JA 2EATA 3U7GA 1RLOA 1Q92A 4OHFA 4XPZA 4MUMA 4H1WA 3PCTA 4HGQA 3S6JA 5AI4A 1U2SA 2FEAA 5ALJA 3ONNA 2GFHA 5AM5A 4OFZA 2CN1A 1ZRNA 4J2TA 3WK7A 2CFRA 2BY4A 5ALTA 3I76A 1TE2A 2ODAA 3BA6A 5AW5A 1NNLA 1L8LA 3M1YA 4C4TA 4KX5A 4BEVA 3ZX5A 4EX7A 2R8XA 4HYTA 4DCCA 3ESRA 4KN8A 4C4SA 4O8CA 1U7OA 5AIAA 3W5AA 1AQ6A 2JGAA 4IFTA 5A3RA 4J03A 5ALHA 2OA0A 1PW5A 3U7FB 4JDPA 3OPXA 3AR5A 4EX6A 4YIHA 2QLTA 5ALXA 5JJBA 4AS2A 2O2XA 4Y2JA 2B82A 3MPOA 5AVQA 1NF2A 1RPZA 2YMMA 4YIKA 2JAOA 5ALYA 4BNDB 4F72A 4BX0A 2ZXEA 3WK6A 2YN4A 2HHLA 2RBKA 1L7OA 2ZBGA 3N28A 2D2VA 2ZBDA 4I9GA 2GHQA 2GO7A 3QU5A 4G63A 1XVIA 3OCWA 1EK2A 4Y2TA 5AICA 5ALKA 3AR7A 3AR6A 3R9KA 1LTQA 1U02A 2C8LA 2HO4A 5FP0A 3EF0A 3TLMA 5AVTA 2FUCA 1Z5GA 1QQ5A 4E88A 4AP9A 3CNHA 5IT4A 3ZUPA 2PR7A 2FPWA 4UATA 2YMLA 2MSNA 4Y2YA 3KZXA 2WF7A 3ZVMA 1JUDA 4Y2UA 1YJ5A 1QQ6A 1Z5UA 2HF7A 3I28A 5AKLA 3NANA 2G09A 3J7TA 4L6CA 1ZD3A 2OYCA 4NABA 4L57A 2DQSA 2YBDA 2NO5A 3UMGA 5AM1A 3NASA 4Y2VA 3ZWDA 3WKDA 5AKEA 2YJ3A 2G0AA 5AW7A 2FDRA 3ZW7A 3W5BA 4EELA 2FPSA 4EENA 1ZS9A 1J8DA 4BKMA 2C8KA 5AI9A 4KNVA 3EPRA 2AMYA 4Y2PA 1XPJA 2WM8A 2WFAA 4XOUA 1Z4NA 2HX1A 4GXTA 3WGVA 5A3QA 5AK3A 5AKZA 2G08A 2HDOA 2PKEA 5ALSA 3KD3A 4YGYA 4ZEVA 4Y2RA 1WR8A 4QJBA 1KYTA 3WGUA 3UM9A 4XE5A 5AVUA 4UU1A 2IA5A 3L0CA 2YMQA 2AH5A 3ZVLA 5AI5A 2B1QA 1RQLA 3A1CA 3MC1A 2R8YA 4ZEWA 1QQ7A 5IT0A 1N8NA 4CNQA 3ET5A 4CF3A 1K1EA 1L7NA 1WVIA 5ALLA 2B8JA 4DW8A 1XP5A 3HLTA 3SD7A 1S2OA 3WKEA 3KOOA 2I6XA 3QU9A 3QXGA 4NWIA 1RQNA 3QUCA 2EAUA 3AR2A 5AM4A 4UASA 1IWOA 2G07A 3PGVA 5AW3A 2P9JA 4RESA 3QU7A 5AVXA 5ALDA 3D6JA 1L6RA 4NFLA 3B9BA 4JB3A 3IJ5A 3FPSA 3L1VA 4UMDA 1WPGA 2HCFA 2BDUA 3N07A 3N5KA 3A3YA 3E81A 2C9MA 3AR9A 4PNHA 2JAUA 3F9RA 4KX3A 5AESA 2HI0A 3KDPA 3A1EA 3A1DA 1WZCA 3ZTWA 5AKIA
chains in the Genus database with same CATH superfamily
2VSXA 1DGJA 2B4YA 1ZYQA 2WYUA 4MWBA 3LPLA 3WU2U 4B6PA 4EQZA 2R97A 3H97A 3KKAC 4Q8FA 9ICKA 3K0AA 3KKNA 1PKEA 4MW5A 3R8CA 1ZGGA 3PNVA 4Q8EA 2NOAA 3PL1A 2W6CX 4OJTA 3MTQA 3V8RA 3WB0A 2GCOB 3AVQA 4MPPA 3W6UA 1RADA 4X1KA 3HYCA 4BV9A 4I4CA 3LUBA 5CG2A 3RVMA 2PKWA 3ROQA 1DI0A 4Z9YA 1WTAA 3U3XA 3THYA 3BXHA 2DBRA 2Z57A 5T7BA 4PQEA 3FRIA 1QR2A 3W4JA 2J09A 4HTFB 1BS1A 4LHYA 1XTIA 1V45E 1J2UA 2BRUA 3REQA 3SYKA 4Z4CA 1CDEA 5EYPA 3MAGA 5BW8A 4XWKA 3PFFA 3KDSE 2VTEA 2EWMA 2GFQA 4HDSA 1NW3A 3P97A 2R1VA 4RF2A 3G0OA 4L0MA 4RF4A 3I1JA 4YAIA 3L4SO 1IEWA 4RUCA 4W9MC 4EMTA 4AFNA 1M1ZA 4RM3A 4ARZB 4C89A 4QZ8A 4R8SA 1DTWB 2VDUE 2R2GA 4KRGA 2AFHA 1SN7A 3B5EA 4NICA 2XY4A 2Z83A 4HQLA 3ZIUA 4FT4A 4OJPA 3QI2A 3EVBA 4LSZA 3PQCA 1HYEA 4D3YA 2BFFB 5KKAA 1JMYA 4R68A 4QT0A 5C8DA 4QUIA 3WMFA 1XWIA 3G59A 1EB8A 1FYVA 1L7BA 4LOHA 2GFIA 2HHSA 4KR2A 4Q3BA 3P52A 4B47A 2V7QA 3NTRA 3QHQA 2QMOA 1S2DA 4UUMA 1Z1VA 2J4FA 4YREA 2Q5EA 3FZYA 1PJ3A 2CYAA 5BP7A 5FOQA 4L9AA 4JP3A 9ICPA 4Z9BA 4MUYA 2H3FA 1W36C 3UFXA 3AX6A 5KT7A 2XUJA 2EP7A 2E1EA 4O59O 5JQGA 5IN4A 2O0HA 3RT9A 3TPZA 5ITVA 2FPPB 1D6JA 2CUTA 1MQSA 4RD0A 2XPCA 4UVGA 3VR2D 1DRUA 1NZBA 3QENA 4FKBA 2M1XA 2H3QA 4KGDA 3IHTA 1KL7A 1NZPA 4J9SA 5KFIA 2UZ1A 1E7WA 4EZ6A 1FMFA 3BWEA 4XRRA 5D7BA 4E12A 2MSEB 2D5IA 2QUBA 2VEDA 3TFQA 4J7CA 4IRDA 4F4CA 5COAA 1IEVA 5TE9A 2KZMA 4B9LA 5EWLB 3C14C 1VXOA 2WTNA 3G5AA 3A1WA 3SZOA 3IAXA 5KNDD 4WBNB 4HADA 3UUGA 3WLOA 4DN6A 1RHUA 4RTNA 3MR5A 3V8MA 2MA1A 2P4UA 3EIFA 4XQEA 5B5SA 4RUKA 2JFFA 2CHEA 2UXBB 2QWXA 4JAVC 1JUDA 1H6CA 3CCCA 4DCGA 4HYKA 3AUOA 5HKLA 4N01A 1LDYA 3RVNA 4FW8A 4CKBA 2W8BA 2BBOA 5U9CA 1MJHA 5E2IA 3SNHA 4FNMA 4PR0A 2Y1WA 3CZCA 2HYDA 5ADHA 4XWWA 3KJZA 1O54A 5HUQA 5EJGA 3HWX1 3KJXA 5F7JA 2DVMA 3OZWA 1T4BA 2YR0A 1EDDA 3E9RA 3R0JA 1LI5A 2ACVA 1W6UA 3UJCA 1PFYA 3CEMA 4QZFA 4JBGA 2B7BA 2YNMA 5AJTA 1P3Y1 3MQ2A 3WSTA 4LZNA 3FPJA 2VPPA 3GUHA 3PO5A 4QU9A 2NO6A 5BOLA 1K86A 4G1VA 3U4QB 4EG4A 5AESA 4X1IB 4OFBA 1QCYA 2O3QA 4JLJA 5ALFA 2C7RA 4DQDA 1E0AA 4YRZA 3Q6IA 3GJSA 1HYQA 1KH1A 2GF0A 1SCUA 4J9LA 2ZR0A 1G5PA 2E4WA 2Y1DA 3QX9A 4KE6A 3G2HA 5JASA 2AC2A 4MZXA 3BIJA 1XZAA 1GA6A 3M6FA 2WB4A 1T15A 2I22A 2VT2A 3ZDBA 1NK9A 2J9FA 3FYUA 2XTNA 2IUSA 1SKSA 3OZCA 4JOBA 4XXHA 3SC3A 4QJ4A 3BICA 1Y5LA 3WRVA 4QSHA 1YV9A 2PFNA 4QEDA 3D1LA 4M9RA 2R751 2WSMA 5HZHA 5CJ2A 3AXSA 4UTOA 1NQUA 1YBFA 5FNZA 1FCJA 1FXWA 3QXHA 2YKGA 1ISIA 2IIQA 4GP6A 1KJZA 3MCVA 2B98A 1WEHA 3TAPA 3CYFA 4AF6A 1PGPA 3GEMA 4OB7A 3JYPA 5IASA 4PLVA 1ZUIA 2FLWA 2P9YA 1V2GA 2MINB 2FDXA 5FPSA 2R5FA 4P4MA 4HWPA 5J4KA 3UJ8A 4J7UA 1DU4A 4RO0A 2GD1O 3H7IA 5F35A 2C7VA 3TE6A 2CVZA 1QLWA 3JD3A 1TUBB 4RBNA 3NOXA 4Z9XA 4MF8A 3HN2A 4EK9A 1HDRA 4J0QA 3D31A 2OZPA 1XLVA 4QA9A 3EZYA 1RI3A 1Z6TA 3HR4A 1PD1A 3H2HA 3FG9A 2RB4A 2I3ZA 3TRJA 5DN6D 1UBTS 3GIJA 1JQBA 1UJ4A 1ZZGA 4IZIA 3VPSA 2W2MA 1XZKA 5BN3A 3H0MB 3FVQA 1LPNA 5DHFA 3PNLA 4B6RA 1X14A 3WLHA 5EY5B 4LZGA 2WP0A 1CXZA 4BFXA 1FB5A 2XIJA 1SHLA 3O7MA 3O95A 5K9ZA 5LJIA 2OZVA 1ORHA 3ZJ5A 2NP6A 1IU9A 3OO1A 1F8GA 4UDNA 4GT1A 3LPNA 5JS7A 1BAPA 3ERCA 1B26A 2LM4A 3IVCA 1QS0B 4QU8A 4QEZA 5BQPA 1DJPA 1K8YB 3PQ3A 3L6OO 3ZHRA 2WU1A 3HSYA 4I3HA 1BROA 2BMEA 3F6PA 2XAAA 4A0RA 1CV2A 5K0SA 3FPFA 4FP9A 3WFJA 4YR9A 2BEVA 5HKBA 4E4TA 1GCIA 3DYBA 2FYTA 3G5LA 1D03A 5B3JA 1EUQA 3NNNA 5DO9A 4TL7A 4KLHA 3V4FA 5CVEA 4RVFA 4JLNA 4JVSB 4ZI2A 2JLQA 4Y2YA 4Y1RB 1L4HA 4ON9A 1CULC 5BWCA 1VL6A 3JQDA 5C7YA 5I6DA 1BN7A 3O9VA 1Z6GA 2IBMA 2JHPA 4M4SA 3P2JA 4PCVA 2VATA 1AK1A 3AIMA 1VBNA 9LDBA 1EX1A 2H85A 3ADDA 3I09A 4D3FA 3PR3A 1F17A 1E7QA 2GN6A 3MOGA 2DZDA 4JJ4A 2V6GA 4BKPA 2XF2A 4OK6A 2AR7A 5BYAA 4P4OA 2EV9A 3FSGA 4F3CA 5JFGA 1FYXA 4QUEA 4Q9HA 1VKOA 4EUKA 5KT2A 2I6UA 4HN4B 3OHBA 1D5WA 1YQTA 4NLCA 3IDZA 2F8KA 4YS6A 3Q5GA 1DOAA 2MUTB 2DRIA 2W2OA 2CXHA 2HLNA 2YQ4A 5KTOA 2GRUA 2J0UA 5IC5A 2DULA 4UB6U 3IJPA 1DQYA 2E3TA 3IRUA 1FUEA 1ADFA 1RWKA 3D4IA 4MYCA 1YA6A 3TRDA 3DR3A 2GI4A 4M2LA 1AB6A 1N78A 3WIVA 5KWSA 1L5LA 4YRDA 2WAYA 3WXMA 4L2IA 2G9ZA 1THTA 1MAWA 3JSXA 2ZANA 3TLKA 4UUBA 4B46A 2H4YA 3HUTA 4WXYB 5IPFA 5AUPB 2HLDD 3Q7TA 5D85A 1NNEA 1DUSA 1H1DA 2GVNA 1QRDA 1J8MF 3OE1A 2I2CA 4K1LA 4K88A 2N75A 5JYBA 5KHOC 4HMOA 4MAMA 4N7JA 1FDVA 3K0BA 5EKXA 1A9RA 3W7BA 1A5ZA 4DDWA 4PSVA 4QWBA 2HAEA 3GF4A 5MN4A 1VI5A 1YC2A 1GTZA 3VSDA 3U4DA 3MS4A 1A9TA 1OX6A 3I3SR 1UXIA 3IQGX 1BCSA 4S1WA 3RU2A 2G88A 2AX4A 1E6MA 3KSUA 1YQ9A 2UV8A 4D0GA 4F21A 3FX2A 5ENDA 1NBMD 1GP2A 2BEJA 3TL3A 2C77A 2I4OA 6REQB 2O23A 5A5EA 1G9XA 3QF4B 1SOVA 3LHKA 3NNSA 3E7XA 2YYZA 2I7XA 1SGWA 1R8JA 5CVCA 5FORA 4F2RA 3FPAA 3I2KA 4PANA 5CLIA 2D59A 2VJMB 4I9NA 3NCTA 4FEYA 3OG9A 4MHTA 5BRNA 1WSBA 3RSCA 4JOCA 4LXHA 4XYEA 2V8BA 2DKXA 3U1VA 4WFQA 5CR9A 3NIBA 4PQYA 4YP5A 5E3JA 2NQ2C 2P9BA 1VFPA 3AI2A 1W29A 4CEIB 1L7PA 4RL4A 4PLWA 2ZOSA 4XJTA 5G1PA 2YYSA 2VDQB 3W5HA 3CRVA 4Y30A 4MKIA 5ERXA 3MUNA 1LCIA 5AXAA 1N2OA 5IKEA 2QD1A 1Z2DA 3KVVA 3TQ1A 1P19A 3EEBA 3I0ZA 3S8YA 1JE1A 2ORVA 1G63A 2LTAA 4EQ6B 4WADA 2WZCA 4RA6B 2XITA 1EDBA 4C7VA 3JQCA 2VSNA 2WFLB 3ZV4A 4RMHA 4J2TA 4MUHA 4IKEA 4UNIA 3T9EA 2E8NA 4LFCB 4UU7A 1MZVA 2FR8A 4Q3DA 4NCAA 3C97A 4KLOA 2FWJA 3HU3A 1XGKA 3HZRA 3TLYA 1CUJA 1QF6A 3LXMA 4KO8A 2PX5A 3I32A 3DMGA 5F98A 4W5JA 1X3LA 5BSEA 4NBLA 2XNKA 6Q21A 1WZIA 3N8NA 3HL0A 5EZ5A 2JH8A 3OCWA 4KLIA 4QE3A 4GM4A 1M34A 3CX3A 4PRYA 4MV4A 3LS2A 2HNAA 1KDVA 2FWRA 4BCDA 4I1PA 3BJIC 4IOLA 2LRHA 1VL8A 3KE8A 3ANSA 2Q4EA 1AV6A 2XYRA 1ZQVA 5BV2P 3GUZA 2CFOA 1CIPA 5FL7A 3WY9A 3IC5A 1B3RA 4LPSA 3D5EA 5CM8B 3L7CA 2B20A 5C1DA 3H5VA 2W58A 4Y2PA 4C7JA 5H82A 3VPHA 2B1IA 4BL5A 4GC9A 3V97A 4LG1A 2VHEA 3OT4A 4OP1A 3NRCA 4KQ9A 3GMDA 1FQKA 2WG2A 1W73A 1EFDN 4X84A 4BLSA 1JX4A 1GRNA 2G9NA 3Q88A 2Q9AA 3WNBA 3W1EA 3HBLA 4Z1MD 4H7DA 1NQAO 2BMJA 2J0VA 2XUZA 3OWHA 3BZBA 4CI9A 4ROSA 1LVUA 1TM7E 4N5IX 2GRAA 3P1JA 3KTAA 4QIHA 2EYUA 1OR8A 4G1FA 1A98A 2OZEA 4H3HB 2P5YA 1DRVA 1NKTA 3ZCPA 4DM7A 1U0JA 4P32A 1HORA 3R7WB 1HC7A 1HQDA 3U7JA 3A2KA 5HIJA 5HS6A 4FWBA 4N6GA 5FWAA 3KU4A 3O8LA 1AH2A 2ZJ6A 1MO2A 4MUKA 4BO5A 1XQ9A 4P3YA 3QFHA 4J91A 1N6NA 3HKDA 5CDFA 4RTLA 1EWYA 2GCNA 4E5DA 1LPPA 2Y1OA 3ZWPA 1SCKA 2CJWB 3NHWA 1F0MA 1UWVA 4TMKA 1JRLA 1F2TB 5B6PA 3AEKA 1DPGA 3K0CC 3OEHA 1OKKD 5CA7A 3Q3GE 3C39A 3I9V6 5KDOA 4IWNA 1SA0B 3OSZA 2BSXA 3EXFA 4BMNA 1X8KA 5PGMA 4HWTA 1UT5A 2XIDA 4UNSA 3AJAA 4O8ZA 1WZEA 2Q6IA 3ZCUA 1F8YA 3H5IA 1R16A 5IM4A 4OHCA 1S0NA 3CUYA 2C2EA 1Q74A 4QTTB 4C03A 3TMAA 5JS6A 2MJLA 1CR1A 5DSZA 4RPKA 1OIWA 1Q7BA 4OIMA 3I73A 3SQMA 2I1WA 3T4UA 3LJKA 4CMEA 1A2OA 1JDPA 3NHYA 3KCQA 3O2SB 3DA8A 4U2BA 3QPWA 1N0UA 5J63A 1DFGA 3KQSA 2JK0A 1QOZA 1BWSA 4EUNA 3L1IA 4Z7QB 4YACA 4LJ8A 5A06A 5DGBA 3IELA 4DARA 3R76A 3AR4A 4R9RA 5HGJA 3LC0A 4MUXA 1BC5A 3G9XA 4JYAB 2YZMA 5FLYA 1KKUA 4K87A 4EG5A 2WMYA 1TFRA 2GDZA 1B8UA 3U37A 2H63A 2AGPA 1ZZEA 1LLDA 3VHLB 2H5IA 1IBLB 5LA6A 3LW7A 2Q07A 1CQWA 4TXMA 2XI9A 4RC9A 2ZXUA 3A11A 5EPEA 3AILA 3NU1A 4AZ0A 4E15A 5CLQA 4KWIA 2C7GA 1XCOA 1Z0DA 2Q0SA 4FS8A 4DDUA 5EZSA 3B6MA 2R7MA 1WWKA 4DM3A 4DHEA 2J6BA 3H7AA 5GVSA 2I1QA 2YW2A 1G0NA 1TMGE 3RS5A 4CQJA 5K6RA 1AO3A 1WU8A 4DLEA 4E4RA 4MIKA 5ELXA 4AUMA 3O0DA 3QKSA 1RYMA 1G6HA 3HV0A 4KRYA 3WK7A 2SCUA 3P0JA 1Z19A 4NS4A 4GBGA 3VC1A 2C2GA 1RKXA 2Y0SC 5JYDA 3OP4A 4IVRA 3AERB 2IXFA 4UXIA 3AW8A 2VK2A 3Q6MA 2JGAA 2YXEA 3DXZA 1NM5C 4D5EA 4DQPA 3X2SA 4YPOA 3QIVA 4NJOA 3OZFA 2ASLA 5CIYA 4DQUA 5CT5A 2P9QA 4X5OA 1H2BA 3WAJA 2D0DA 2B4QA 2VZ9A 1IXKA 4MUJA 3C48A 3AR7A 1RRMA 2VDNB 5J0WA 4WK4B 2PQ2A 1T4MA 4R1SA 2CLKB 3E0FA 3KL4A 2HRQA 3UVEA 3ETNA 4MMZB 1S2GA 3IUQA 2D74A 1YIDA 4UE3S 7ICIA 4B9MA 3AU6A 3C8ZA 5J2UA 1N77A 1RM3A 2WWFA 3FGZA 1DIHA 2AE1A 3SHWA 5CLGA 2B1JA 1YHYA 3WRXA 3M3DA 1HNXB 2AQ8A 1RYSA 3LFHA 4YAUA 1YR1A 2BFEA 3IIIA 3KELA 2JZCA 4DNOA 4DMUB 3EFOB 2C95A 5KYUB 1RCUA 4UQPA 4XX1A 4AJNA 1RQLA 1Z16A 4IQ4A 3ZGZA 1N6IA 1D9ZA 3PR5B 3EASA 4MB6A 1TU4A 1ECWA 3X1DA 4XTCS 3LUCA 3IJEB 3M7DA 4EYSA 4AJOA 1SHJA 4CQLA 2YCBA 3ND5A 1COKA 3DB1A 1UDXA 3JARA 1GY8A 4M36A 4MLZA 4OKSA 1CS0A 1SZHA 1VYUA 2OBLA 3Q7IA 4EMBA 1WTCA 2BAGA 3DV0B 1ZICA 3VZPA 1Z74A 4CVNA 3E9MA 4LZWA 3AI1A 4YTEA 5DP2A 3HLKA 3FYTA 3DBLA 2ZIFA 2WMOB 2OCPA 3H9UA 3WMGA 3AL0B 3V34A 1PN3A 1XP8A 2M6KA 2WJGA 1GAQA 3NDPA 1Z06A 3DDWA 4AK9A 3QNUA 4BQPA 1YR6A 3S81A 2YXLA 5IKPA 4AJEA 1LXCA 1SPXA 3OF2A 3F5FA 1SIUA 4C6RA 4ZU3A 4WUVA 3KYIB 3UBMA 5FWXA 1RJFA 4DV0B 5EAIA 4ZVTA 2MWMA 1BPXA 4AROA 1YBVA 2R1UA 2O7NA 3WLKX 3KR1A 5AMXA 1XD9A 1R5JA 3UWKA 1GL3A 4UAUA 4A8PA 4HD8A 2E21A 1W96A 3TDMA 3MDAA 1HFWA 2XRZA 5CAEB 4JX8A 3CB2A 2RAFA 4ZOQI 4EAQA 3TB6A 1FRNA 3WGTA 1TGYA 3UXHA 4IXWA 4PYLA 2WINI 4JP8A 1XD2A 3PW4A 4PSUA 1U2GC 2UZAA 3D8UA 4YHBA 4EB3A 4CMHA 2PA0A 2DPJA 2V7WA 4H7KA 5EMHA 1QYIA 2R48A 3EG9A 3ZKAA 3PEYA 3MRXA 1HQYE 1ZM9A 2QRVA 3AKDA 5B58C 4ZZ0A 3QLJA 4RMIA 3IDWA 4JKIA 1HZZA 3D4BA 2I2BA 2WNHA 4L3VA 4MGYR 2P78A 5EQTA 3UJBA 3SS9X 3RT1A 2M6LA 1ETUA 3FVRA 4O4IB 4HFNA 4EOGA 3SIWA 4AKIA 1V39A 4YRSA 4YH1A 1LWNA 2AW5A 4BNUA 2QSYA 1XJQA 4HDAA 4HEQA 4EO7A 1D2RA 5TARA 3GVHA 1G9TA 2WJWA 4ZGWA 4MPDA 4QASA 4ND3A 5DCYA 4QLBA 4ENVA 1B8OA 3W6ZA 3SV4A 2C5GA 3JQ8B 3PW7A 3WMRA 1F20A 2HOQA 3JALA 3HCEA 1Y6RA 3W05A 1WKBA 1YGPA 2FMUA 1U8CB 1XTTA 3CR7A 3B9PA 7ICUA 1CJUC 4BNJA 6ADHA 1G3QA 2FZWA 2AOTB 2W9MA 4CL0A 3ER8A 1E18A 1JI3A 1NXWA 3M49A 4MV7A 4F4XA 5JSUA 4YJKA 4RA9A 2JVIA 4O4HB 4KLTA 4HXFB 1N2CA 5EMJA 2RJ3A 4Z0HO 3MMNA 1Q0ZA 1IZ9A 5JCOC 5KG7A 3P20A 1ONSA 2BHTA 4QFBA 3UH1A 2HA6A 3UV7A 3OKFA 1ORVA 3ZWNA 2C9ZA 4ZYTA 4L8VA 3VR5A 4FHFA 2CNWD 2PMBA 2B82A 1XMJA 4IIEA 4CR8A 1RPZA 3CE6A 4TVOA 1KAMA 4FTWA 4QECA 4ZCTA 1WXXA 1V48A 3ACBA 5I5EA 3WGNA 2NSYA 5DQGA 3R9KA 4O4HF 3JPOA 3WWCA 1B8NA 3SAHA 5BOMA 3OHSX 2BGKA 4HNVA 1GITA 1DEXA 4IL6U 5EJFA 1NJ5A 1BG6A 1P7YA 3D6MA 4XD7D 1MD9A 1WU7A 1EWKA 3A6FA 1S8FA 3ABRB 4MR8B 5HZGA 4NI5A 2LD4A 5AHOA 8ICJA 1QTMA 5LNK6 1IBCA 3PUKA 1YU6A 1NC3A 1IZ0A 3AN1A 5LJLA 4IR1A 1RQNA 2FX2A 4EPTA 4JC5A 1DAEA 4I28A 3EEQA 4R1PA 4BBPA 5TGZA 1Z25A 2OCEA 2XB2A 3OD5A 4G26A 2ODWA 4TTIA 1ZQCA 3CT6A 4ASUA 2IH5A 4BECA 1V8BA 4G0YA 5GP1A 3VKWA 3F2BA 3G8CA 1UMBA 3TIVA 4K3VA 1GSHA 3ZX4A 3GDXA 4Y18A 3ZKWA 1PL0A 3T7IA 2GHTA 5A9RA 3T3PB 3RSGA 4YRNA 2FZ4A 1U47A 1M2GA 4NBRA 2OV3A 2OXCA 2G83A 2ZJ0A 3QFSA 5KYVA 1HQCA 4WZBA 1Q3TA 4KPUB 4K8RB 4KAJA 4JH0A 2UXCB 4CL2A 1V37A 3GAFA 1L5ZA 4KR9A 4X24A 1UQVA 4QYTA 3T1YB 1KIFA 3MMPA 4YQEA 4JXXA 4I46A 2DPGA 2WE7A 3WGHA 3E4CA 1VCMA 4KGXA 1X42A 4UBLA 1NN5A 5AVVA 4TS9A 3JAWB 2H54A 4C7MA 3OKPA 3BCSA 3IYLW 2ZZKA 3NC1C 2VNKA 2VKTA 5MFPA 4OOFA 3G0DA 2FW1A 4R1OA 2O5RA 2P2GA 3PQ6A 4BVEA 3G0BA 1GRCA 2FSPA 4L15A 1MXHA 2ERCA 3TKLA 4V02A 2ABWA 1VP9A 1FP7A 3KQUA 1CF2O 5JISA 2F77X 4ZCSA 1E9VA 1P2GA 1G5TA 1KK1A 3N05A 2DOKA 1M75A 3R5TA 4H1HA 2X23A 1DO2A 2YVUA 1E0JA 4YBRA 4HZUB 1XI2A 2AFVA 3O4FA 1L4NA 4R6XA 3VFDA 3ASZA 2QJRA 1HBJA 3FLMA 1DDIA 2EJTA 4LXYA 1TQ6A 3MAAC 1N5RA 2PO5A 4YRGA 2BM0A 5FBRB 5A9SB 3ONWA 1W0JD 3LZ6A 1FFXA 3BRWD 4MI1A 5LZ2A 4PF1A 4N40A 4NATA 4HQ0A 4UDXX 1IH8A 2GJ9A 4JEIA 1WMFA 4C0AC 5T5QA 5JNSA 4IDQA 2PA3A 3H13A 1DX4A 2JLUA 4KN5A 4LXGA 3IB6A 3AL2A 4GWLA 4WHMA 2XZDA 1N1GA 5FRDA 4KQ6A 3QEKA 1N5JA 1Q44A 3FNFA 1NI4A 3V4OA 2WUWE 4QATA 2YWEA 1W5EA 5JWOA 3W3AH 2IH2A 2IT1A 1N2EA 2Z58A 3T41A 3Q9LA 4G36A 4KTTE 4P0QA 1BDMA 2H3IA 2NQ8A 4YNBA 2IEGA 3ZCSA 1E62A 4GI1A 4RQBA 2A5GA 4C7YA 3VCBA 4G0QA 3JYQA 4RKYA 4HUTA 1ECLA 4AZ3A 1TIBA 1D8AA 3OIVA 4OGKA 3TXYA 1RM5A 3UPTA 1XTJA 4D9NA 2C42A 3CRRA 3NHSA 1CEEA 1KSGA 4W5WA 2GZSA 2O2XA 4BN0A 3FRHA 3ISVA 3RTBA 5L1JA 3B1FA 1A8SA 3H1AA 2Y0SF 4Q4AB 4V0RA 1YZFA 3N0RA 3F53A 3CP8A 1I3MA 2QUAA 3S27A 1XLTA 3A3KA 3MLEA 4IV8A 2XX3A 1RZUA 2RHCA 4EHDA 4C43A 1W5SA 3BJYA 2CNBA 2D1YA 2CW5A 5I4KA 1Q3UA 2LVBA 4ZOEA 2OB2A 5DTIA 2VJOA 4HUJA 8ICAA 1U2QA 1XPJA 1A8IA 1ZDMA 2Z30A 4B2LA 1A9QA 4XRGA 3L5OA 5ALSA 1SH7A 1L4FA 4IS2A 4GKAA 3KJNA 1HYBA 1O4WA 2A5YB 4BQNA 3ZOKA 2C96A 2R3SA 1O2DA 3L2OB 3ZDXB 1PYDA 3HP6A 4GI2A 1KDTA 1FP4A 4J2HA 1NUQA 3TSZA 3MBOA 4H1UA 5G4KA 2P9JA 3CLKA 3OZGA 3QU7A 3BBLA 1N6HA 1NQWA 2F1JA 3I72A 3OJUA 3RB3A 4P93A 3UHPA 3IP9A 5JHHB 1SUAA 1QV6A 1UKVY 3TQHA 4OI0A 4TTAA 4DMMA 2M9NA 2DHDA 2H8KA 3DV9A 5A6SB 2O0LA 2AJDA 2VYND 3ADKA 2V4UA 3ZGXA 3KXLA 5CA1B 2NRVA 4WWHA 2KSOA 4W6ZA 1N7IA 2DBZA 1EZ1A 2Q0HA 4M8IA 5TMBA 1KAHA 3MCTA 5FV4A 1T10A 3EIXA 4K0KB 4KPFC 4F8RA 4I4IA 3GW8A 2JAWA 4IZHA 3OU7A 3B3QA 2PG3A 1LVHA 1Q50A 2JH1A 1PI3A 1NN1A 1O57A 4C4YA 3IT3A 5EHNA 3AB8A 4F56A 3DCJA 2B0CA 2PGOA 1LS6A 3BIWA 1U7TA 7ICOA 1CG6A 3GNTA 4WKBA 2CCJA 5CA1F 3A37A 1Z36A 2SKCA 5FQOA 3STUA 3QOWA 3BJRA 5FWNA 4NJEA 3GMSA 4JOSA 3AK4A 2ZBEA 2R8JA 3JASA 3QJGA 1ZRMA 5HOEA 5C7OO 2Q0XA 2Q3HA 1U90A 4E22A 1H4VB 2DCMA 2IH4A 4FN5A 4Q45A 1JQ5A 3PDJA 1R6XA 4WOCA 4L8FA 2VKQA 2ZYHA 3H11A 4OEHA 2R25B 4BVKA 4D6YA 2I7TA 4IQ8A 4JR0A 4LVCA 3ICOA 3OC6A 2VH2A 1HY3A 3D2CA 4JK3A 4NY8A 1WE2A 2FMQA 5IT9A 3NH6A 3TECE 2B30A 4GX5A 2OO7A 2GNPA 3QVSA 4QBKA 3C1YA 1DTEA 3AHGA 4DLVA 1PT7A 1R3UA 3GH1A 5COQA 2PS3A 3PW2A 4HNAA 3T7AA 3TOCA 1M1NB 4LN1A 1EP1B 1ZQRA 2JIPA 3AI7A 5JWRA 2DUUA 4TL8A 1JXLA 1K63A 2BL4A 1ULZA 2XQKA 3I0NA 4ZVQA 4HTAA 3F71A 3K9HA 4MRSA 5JATA 3HCNA 2ZR7A 3AY7A 1NKEA 2OHJA 3FZNA 1T0PA 2O48X 4AMZA 3GZFA 3HLYA 2B4RO 4I27A 3DR5A 2V59A 4FUTA 3OIGA 4QYIA 3VA7A 4RQ5A 4CV2A 3A06A 4OHFA 3RR8A 1QYVA 1VE5A 4IIJA 4P6VF 4FOPA 1JFVA 1DAPA 3RFTA 2FK7A 4OLHA 2QV7A 4B9TA 4LEIA 5DSXA 1X7XB 2Z98A 3JQ6A 3C7CB 1KJIA 1G4HA 2DKFA 4IDDA 4N12A 4EW2A 2IZ0A 3WGQA 8ICEA 3TTXA 5KFUA 3D4LA 4DDTA 5LXTB 4RK6A 2ZRFA 4ZO4A 4EX6A 3HB9A 1T6BY 4J0IA 3VVMA 1GNSA 1GZ5A 5KG1A 3GHYA 4FN4A 4AW9A 1QMPA 2GA9A 5FV7A 1N3YA 3BMNB 4ICIA 3GZNA 1FJGB 5T67A 2I76A 1RC1A 3QEJA 3NTOA 3EF0A 1V71A 2ZS9A 4LZJA 4O4JA 2M32A 1XXLA 3T7RA 4OHOA 3EPHA 4HDMA 2BV3A 1C4KA 5LXTF 1JF8A 4G5HA 3A4LA 5DM70 1F12A 2Q5FA 5EP1A 3L18A 1PS8A 3FHOA 1D4AA 1YCGA 4BV8A 1N1EA 1LZKA 4KNVA 4MAAA 1TVAA 1UP4A 2B83A 2DY1A 3L40A 4HVTA 5K4HA 2NSLA 2PKEA 3KLMX 1U1DA 4PZAA 2HIGA 1GPLA 2QIOA 3IOYA 1OYVA 2IYTA 1TEXA 2WOOA 4DUYB 3RAXA 4MQEB 2QJWA 4B31A 5T8KA 1E6WA 4BY9E 4CF3A 1XE3A 4JEUA 1R9MA 4FLEA 5ADVA 2X4GA 1VHTA 5AQ1A 2K8AA 3NGXA 2Z6VA 4GPTA 2R9VA 1BPZA 2GUGA 3ZDAA 2XYVA 5HIAA 4NEHB 1OXXK 1N2BA 4AM8A 4QM6A 3ZWWA 1JQJC 2W9CA 2VSYA 2Y99A 3ZXIA 1IPFA 3L8GA 5A4FS 1WG8A 1PL8A 4TQ9A 3A6LA 3NBAA 1V6CA 1HTWA 1CR2A 4OI4A 1RKVA 3CRZA 5EKTA 3RRMA 1CJCA 4BWJA 3MTEA 4Z6EA 4RDHA 5EGNA 3OIUA 3SX0A 3R5JA 1H93A 4KQEA 1VHJA 1U3UA 3VZBA 4KWEA 2ZPUA 3GZ4A 2IUEA 1C20A 2QN6A 1AMUA 3MGKA 2CMHA 2ERYA 1HRKA 4RZIA 2Q5QA 4AY5A 2OMKA 4G0NA 3UICA 5CT9A 2JGEA 3L3BA 4KZPA 1GKKA 1QMGA 4TRJA 2V0GA 3GJ5A 4DCTA 1KNXA 3H83A 5CH8A 4PLCA 4IH1A 1W5FA 3QVXA 4F5YA 2ZBQA 4R8VA 4UD6A 1KP2A 3R3YA 1YXMA 1BPBA 3I2HA 4M7WA 3BE4A 3LBFA 1JJVA 5KVAA 4QPNA 2ZWMA 3K9LA 4Q4JA 1QM5A 4A2PA 1RZTA 2OFWA 1BXKA 2RRDA 2O4CA 4KFTA 4QNLA 1BVUA 1SCBA 4RPIA 4CDRA 1YL6A 4KPYA 1K6XA 3ZTYA 1ZQJA 4MI6A 4X64B 3CW2C 3KNZA 3GA5A 3LL7A 3FYCA 4KXMA 2CDNA 2RC5A 2RB5A 5EIBD 4LJXA 4B8ZA 2G8NA 3TE7A 3AIIA 1QRAA 2RHRA 5HZMA 1X7GA 3O03A 3ESQA 1Y5RA 1UXHA 3ZY3A 4AWAA 2GM4A 4DPKA 4DT1A 4UCXA 1M0SA 1KWGA 4GSKA 4NFHA 3T4XA 2C3YA 3JQFC 2BGUA 1QGUB 3GLHA 1BXGA 3K9WA 3QWHA 4RVDA 2MU1A 2P68A 4WLOA 1D1QA 5CFOA 3FCUB 2YRFA 3K1YA 2QVYX 4JLPA 4PPGA 1A97A 3LTNC 3T1TA 4O0LA 1M72A 2P66A 1DVRA 3E84A 1BDHA 3M3HA 2FU5C 1QSSA 4C6TB 4WBNF 1XKLA 3ELDA 2JD0A 3H0CA 1V5IA 4E5KA 3J81k 3RJGA 1E1QD 3RV4A 2IHNA 4I81A 1B0ZA 1XPOA 1JDUA 1TEVA 3GEHA 3D6UA 2JHAA 5J2IA 1L5OA 5GVRA 4JCCA 3RRFA 4DLYA 4AJ4A 2Z2JA 4EHKA 1EFVA 3FMOB 4H35A 2CXQA 4P9NA 1BKSB 3QQ5A 2OZLB 1UIMA 4L51A 4KMMA 3CF2A 2EW8A 3WLJA 3G1TA 2C8VA 4M53A 4G8JA 1COWD 3BGSA 4UKDA 3I62A 4UTZA 3N6VA 4WKOA 4ABYA 5EOVA 3D8BA 5BNIA 5A4DA 1XL0A 3N28A 1GARA 1NK8A 2GWHA 2PQ6A 1I1QB 3AH8A 2GXUA 2QBYA 4IFBA 4G0VA 2Z9DA 3ZGVA 1U1GA 1EK5A 2QX4A 4G0OA 1IN8A 1RYBA 2WKSA 3HNPA 4CM8A 1LY1A 1YFKA 4Q03A 7ICRA 3V9AA 4C3UA 3E8XA 2QN7A 3TZBA 2XHEA 5IKMA 3H1PA 4H15A 5KFRA 3JWGA 4IQFA 5AKEA 4DVJA 3OHAA 1WXIA 5IZCA 2P6UA 3WLEA 1KVQA 4C9BA 4ECUA 2MYNA 4D41A 5JS8A 2HQSA 3N53A 3STTA 4FFSA 5B3KA 4IQGA 4FBLA 3PLNA 3OKAA 4OPMA 2QSJA 4LOIA 3OU2A 5GWXA 1MQAA 2XCPA 4KSCA 4KLFA 2QRGA 3F47A 4U2CA 4CLEA 4G85A 3QP9A 3G7UA 4AJKA 4BUZA 2CZQA 3QXGA 4DREA 5HRAA 4OTZA 2NUTA 2P79A 3B0XA 4P4SB 1VG8A 1U0EA 3BVPA 2O5CA 4MS1B 3EIUA 1QIHA 1EE2A 4YD2A 4PPYA 1E8NA 5DGTA 1GUZA 2HJWA 2LE0A 5G5GA 5D3QA 3I34X 4OQZA 2ECKA 4YJ2B 4N5HX 4ZAZA 4WOPA 1JZSA 3AJRA 1B76A 4HRVA 1JEDA 5EQFA 1MGOA 4YI5A 5K3DA 4ZAWA 2CNDA 3A3OA 2QRKA 4QC2A 3PDWA 3DWIA 1X9MA 5CBPB 3LE8A 5AM0A 5JNVA 3A58B 1D3AA 3HXMA 4ZT4A 5J8YA 4MEAA 3EX7C 3GU3A 4EHLA 4URVR 3TJZA 3VKVA 1IXYA 2YHIA 3WJ2A 4P22A 5CB4A 2BFWA 4FYXA 2QMZA 3PE3A 4YJ2F 2NV0A 2Z4SA 1SM4A 2OCIA 3GFOA 3E7PA 4YMGA 3T9CA 4KBFA 2Y9UA 1KJYA 2G0NA 1FMTA 4IKOA 4XIGS 3K09A 4TOIA 3Q41A 1YS9A 1E6LA 3WGIA 1MENA 4JBWA 2GTPA 4NZMA 3ZWAA 4CTKA 3KUUA 1U8EA 4QQRA 5SY6A 1L7QA 3BN3A 1XK6A 4ZZIA 5EP4A 1ULTA 6AT1A 3DZJA 3K5PA 4P0TA 4H6XA 4K8OA 4RIFA 3I6YA 4BVHA 2PT6A 4NMLA 1ZMRA 1N36B 4KN7A 2NUAA 1TJYA 1HL7A 3B6JA 1QH1B 4J9UE 2B99A 2WHYA 3GB9A 4F38A 3NYQA 1NK0A 4EHFA 3G2QA 1OLXA 3BQNB 1NVWQ 4ZP1A 4E5PA 2MSCB 1XDDA 3ZLBA 2ERXA 3MSXA 2V7PA 1UBHS 3QE9Y 3GFPA 4TZ6A 2A57A 1RWWA 2GEDA 3LOQA 2GUWA 3A9SA 3HCDA 1D2EA 4YUXA 3COWA 2J08A 3FWKA 4W5TA 3JD2A 3WXBA 4MGHA 2XCOA 1O89A 1URJA 1U3GA 2WJJA 2GKGA 3W5CA 3VPAA 4XDZA 2K7ZA 4RPHA 3SEIA 4BLQA 4RHXA 4K9NA 5IC4A 1KP9A 1XTZA 2Q41A 1JAIA 1G2OA 2WJVA 5GZ1A 3IHKA 5C3MA 2VHCA 2P2SA 3PX3A 1KEVA 1BW9B 5K8CA 3AUYA 3E8SA 2BFOA 2NXNA 4RVOA 5DX8A 1TQ4A 2ODAA 4C8KA 3NR2A 3SC4A 3NCHA 3NC4A 1P1IA 2DR0A 3GRRA 4ZO8A 2ZBVA 1YKGA 5F33A 4KG7A 1A76A 5KTTA 1ZMBA 3DBHA 4I55A 3BREA 3AINA 4J03A 2OA0A 4ZVMA 5FWYB 1J7JA 4LBZA 2LZ0A 3TWOA 1RI4A 1KR2A 1XZEA 3BJMA 1FTSA 3WO1A 3WRWA 4R8UA 2XXAB 2LDXA 3MWLA 2ZETA 3IHLA 2FE9A 2I6QA 1P80A 3LPAA 1OB5A 2VPXA 4A6DA 1GV0A 1ZD9A 5G0VA 1NY6A 1GSIA 3QKTA 3AL0C 4K4IA 3QV1A 2BGNA 4ZQCB 2HF7A 4QVGA 3T5DA 3OVMA 4F6CA 2WTUA 4JCOA 1EM8A 5AW7A 1G291 5CW1A 1ESDA 4F04A 3OFSA 4L5IA 3PX2A 1Z6ZA 4PQRA 2C82A 1MOSA 1S8NA 4PE5B 1E1KA 3MC1A 2RK3A 4QG3A 2IBKA 2ZUUA 4GZ5A 5EWMB 1OAOA 4O5KA 5JS2A 4V24A 1ZVJA 4MQMA 1K68A 3HMQA 5ERGB 4Z8XA 5EWFA 4UASA 2EHJA 3QKIA 2V9PA 1I9CA 4MQFB 4GYWA 3CEHA 2NX2A 3CVWA 4JUBA 3REFA 1Z62A 2GD6A 4F4DA 1D2MA 4W5RA 5E9JA 3FHCB 4V1CI 1OHHD 2EKZA 3RS3A 3VKHA 4CUKA 2H31A 3W1VA 1R50A 5HWSA 1PNTA 3JQ9A 2O8DB 4MKHA 1LRKA 4I1VA 1JSZA 1KRWA 1XZGA 2HA0A 5LM3A 4KO1S 1B4DA 3H5LA 3L05A 2JJMA 5EIBC 1KY3A 2A1TS 4S0ZA 1ISPA 5HR7A 1TB4A 4HNQA 8ICRA 4GKJB 2XUPA 1CT9A 2G6TA 2UAGA 1HFEL 4I2CA 1XEXB 4RNMA 2N3ZA 3Q11A 5MF6A 3PFCA 5HRUA 2NYVA 5EHZA 4M8KA 4M99A 1UJCA 4WDQA 4CM7A 1JDBB 4HGYA 2KX7A 3AEUA 1YT3A 1NFRA 1GFWA 2PY6A 4DADA 4F4IA 1KYQA 3JQGA 1Q2UA 5DKWA 4KDCA 3Q0IA 1I5RA 4H31A 2X4IA 1SXJB 3U39A 2WPNA 1ECFA 1ST3A 2YJZA 1PV2A 1J07A 2W2LD 1T1EA 3IIJA 3MMXA 2OYYA 2R1TB 2A0FA 4WXPA 1BXRB 2Z6UA 3CM0A 3LT2A 1S6YA 3C2KA 1E7MA 2PAAA 3TD9A 5DT2A 4MSUA 3KQTA 5ER9A 3AKYA 4PZUA 3O1JC 1PP4A 3DTTA 1KVRA 2JZOA 3C8MA 4JROA 1RLUA 5AVOA 1F51E 4HB4A 3UOAB 3H3XA 4WY8A 3ZK8A 2QEQA 3OJOA 5KG5A 3IOEA 4GR9A 3MZ0A 4IM7A 3ZEAA 2OKGA 1U7XA 1TD9A 2A30A 3GLVA 9ICLA 1OILA 2PD4A 2YV5A 1AQIA 4GO1A 4DR7B 2WTMA 2PYIA 1XZ8A 1XTQA 4UBNA 3MG9A 4PZEA 2R00A 3VVCA 3L7KA 1HT3A 4EYKA 1H2FA 2B8NA 4D9GA 2A2ZA 4Q44A 4Y6QA 3LKVA 2ZXFA 3RJJA 2C99A 1C3VA 3VR6D 2H5JA 5JALA 1CHNA 1PVPA 3H9GA 4BFSA 3FOFC 1OI7A 1ITZA 5FPYA 2PZ8A 1HMYA 4HDCA 2WJAA 1U0FA 1FRVA 3H2JA 1IV8A 1XRJA 1Y1RA 3PW0A 1E8MA 3CSSA 2JHGA 3C2MA 3ZIAA 1GTRA 5E2AA 1JYEA 4Q82A 5EJAA 3AU8A 5K99A 3F2CA 2I8LA 3I2FA 1E3EA 4DRXB 3KZ1E 1INLA 3ND7A 3TM4A 1KDYA 3TOVA 4TROA 4MRMB 4F7WA 3S8EA 1BMFA 3UZUA 1QX3A 2OHVA 3ZE1B 2DPLA 5BR4A 3DYVA 1X9HA 3EXHB 1OLSA 3Q87B 2HTFA 1FP2A 3LCRA 2G5HB 2FUG1 2NU9B 3TH5A 4BVAA 1NSYA 4DQLA 1JWLA 3HKBA 1PYOA 3TLZA 3AVXA 2FFRA 4X3OA 1EGAA 1QFZA 5EHGA 3O9ZA 3NPMA 1DIAA 4ECEA 4HKTA 1REQB 1N5KA 3RHTA 4QPCA 1B1CA 3N8DA 3EVEA 1R6AA 2GF9A 2K7FA 4XOUA 4PC2A 4GOND 1SFRA 4A16A 1GL6A 1GG9A 3D3QA 4FFVA 3JX9A 3UXEA 1PEAA 4ITVA 4R7ZA 3GQCA 2FSVC 1EZZA 2Q8QA 4L4RA 3DV2A 1GTL1 1WVIA 2PU5A 4P35A 1TRKA 2BMFA 4G24A 3UAXA 1QDUA 2NZ8A 2ZDHA 2IHVA 2CLDX 4ETWA 3B51X 2RGNC 3GJ6A 2E1RA 3MQ4A 1TJPB 4FMCB 1QRRA 521PA 2F9MA 1GG2A 3U5TA 3C6YA 5JNRA 2PIDA 2JEGA 3HCPA 1X7YB 2GYWA 3TTWA 2CJXA 2PZBA 1V8PA 5ADUS 1Z0UA 2PEZA 1VYTA 4PGMA 2FZCA 2JARA 2QRQA 5HBGA 3FTDA 2ZBFA 2HWYA 1MT0A 2AV6A 3H2BA 4TV9B 4BO7A 5CR0A 1NLFA 5HCIA 1G16A 3U6BA 1FYDA 3F3MA 2ZBUA 1JSXA 1QDEA 4BZQA 1ZD1A 3KPUA 2C5HA 4QXRA 3AEQB 4TWBA 3THWA 3NP9A 3UGTA 1U63A 3SWWA 4O3NA 1W52X 4IIBA 1DNPA 1YVUA 1ZN2A 3K0KA 5HFAA 1DHRA 3H4MA 4H3SA 2Q3FA 4WN3A 4OX9Y 1AHHA 1Z2AA 5DQIA 4N76A 3M2PA 5DNYB 2C31A 2VYQA 4PLTA 1DWOA 1YR8A 4NG4A 4BQEA 1E1RD 2CVHA 2XVMA 2AFRA 2DUWA 1EXWA 2R66A 4Y9SA 5J59A 2V7XA 3ZGYA 1SZJG 1JH9A 2PT5A 2P8SA 3KHGA 4EFKA 5FKJA 5FTLA 1XX6A 1VPVA 3QVTA 3UW3A 3VHXB 1L4KA 1W46A 1JIVA 4C7OA 3G2LA 3JWJA 4CKXA 4TV8A 1NUHA 2LNDA 4KAXA 2PM8A 3RHSA 1KC1A 4LGVA 4I3GA 2OCBA 3EJ6A 1Z6XA 3EUB2 4L9SA 1Z26A 4CN9A 2WNSA 3INTA 4PLHA 3TEFA 3OUZA 3OJ0A 2W98A 1J20A 4IUBS 4D8YA 4ZZ3A 1UWKA 5KFAA 5JRZA 3M3PA 3LRTA 2CDCA 4D81A 1YD7A 1Z0ZA 2AJ8A 4Y3UA 2NU7A 4JQCA 3KOXA 2C3UA 3L8YA 1VJ5A 4I8DA 3V7NA 4TM8A 2G7ZA 2G9VA 1WZ2A 2I87A 2ZI3A 3CLRD 3OWOA 2AA3A 3D0OA 1TAGA 3NRJA 3KZCA 1W8IA 2OVFA 4EB6A 1NVXQ 1H4SA 2KLBA 1DRJA 3K31A 5EZYB 1GKIA 2APJA 2G5TA 2C2KA 2WHPB 3QITA 4OHBA 4CDGA 1JTEA 3EGIA 1CY8A 2FRDA 4DSZA 5C51B 2VAMA 2AG1A 4QNRA 4LJ7A 5KNCH 3LL4A 3A6HA 4RLSA 3VTAA 2HSGA 1Q11A 2VT7A 4LXIA 3IA7A 2A1AA 1LBHA 1PQPA 4LECA 2CVQA 5EN4A 4ED0A 3KAJA 1G4UR 3MRVA 4B44A 2W4QA 4RPZA 1FU8A 1PJSA 3LKZA 1H1TA 3MAJA 4F1KA 2ZYUX 2EX4A 5KAIU 4Y9TA 2R6R1 3MGIA 1P5JA 3SVZA 4OU5A 4LAFA 3C87A 4IBOA 5FOVA 4MGEA 2KZ3A 2VPQA 4RZRA 2GILA 1XROA 1SBZA 4BNDB 1TPYA 1UHUA 1KF0A 3HABA 2GKSA 4N54A 1RRKA 2EXXA 4PAQA 2F3QA 1TF5A 3I39X 3GRUA 4UUPA 4JMLA 4XM0A 2BPFA 4LDQA 1Q1QA 2D00A 3OUTA 1XAHA 1W2HA 5BN4B 3TW0A 3X3HA 5C80A 1T3TA 4JYCA 4RQ1A 2QU7A 4MQ6A 4BRUA 1S1CA 3V8VA 2YJ3A 4M9LA 3LY5A 3NWOA 4RHYA 4XWOA 1CE8B 5CURA 4TLAA 4UBJA 2ZSKA 4ZZ1A 4DSUA 2DBYA 1PDVA 2NVUB 3CN9A 3FHJA 1LW6E 3G2MA 4F2PA 4MWSA 3IEPA 1XYGA 3L3FX 1WR8A 2AKEA 4ZVOA 3TZHA 3TI9A 1H6BA 2IA5A 3HA3A 4B5LA 2YXBA 1RW4A 3MVEA 2I5HA 3OIYA 4AF8A 3V32A 1NBIA 1KYZA 1XAIA 4J9QA 2ZJFA 2IZ7A 1PGQA 4NAUA 3H16A 3IULA 2PPLA 4JK1A 3GEIA 3PIRA 3BGOS 2H1OA 4XARA 2C9BA 2VO1A 4X20B 3PPYA 3K2BA 2DG2A 1UF9A 2QVLA 4BQFA 2C4UA 2JS7A 2QD5A 1L7XA 2H11A 3K9FC 1KK2A 1RC8A 2NZWA 4OAOA 3HJNA 1VMAA 5TGDA 3FOAA 2ZJOA 3IT2A 4PZZA 1NVVQ 4QUAA 1R4NA 1XAGA 2V7VA 1QJ4A 2BHSA 3DMNA 3V6LA 1XMXA 4D4KA 3S1LA 4JT8A 4CW7A 2O8CB 2QUZA 1MMFB 5KG0A 3L0SA 3DEZA 2WUVA 1SO8A 4BO3A 2XV1A 2R8ZA 4L27A 4FS1A 4LWZA 2WWVD 1PSZA 3FLAA 1ZJJA 3G1WA 4IG4A 1M0TA 4X7PA 2FPXA 4Z6KA 5CM9C 1TECE 5KSWB 5DK4A 2YJ6A 4GOLD 2GARA 4NDAA 3N74A 2XT6A 3N0WA 1I3KA 4OGWA 1EAMA 2I2AA 3GPBA 4O4IF 4MDYA 4LHWA 4G5QA 1J2EA 1CJBA 3U31A 3PI7A 4R81A 3STWA 5BOSA 1Y3CE 4S05A 3FCEA 4L4UA 4CEHB 5EE3A 1NGSA 4GGOA 4R0NA 4OBWA 3BA1A 1R6VA 3FC4A 2DKOA 5FTWA 3BHIA 3RYHB 3VNQA 1T8UA 1TC2A 2VJKA 3KV3O 1Q0TA 1QF9A 1F14A 2HCRA 3NEJA 3OZIA 2DKZA 1MLDA 1E9CA 1KEJA 2FN4A 2E2WA 4ZT5A 2YC2C 2JH9A 3U1TA 3BK2A 2A7QA 3PC8A 3WV5A 2P27A 1Y7LA 3ZDEA 1KJQA 1NXXA 1OAAA 3CJRA 1CUIA 1GR0A 4D0RA 1XZCA 3KOUA 1N0IA 1KH2A 1HEIA 4L6IA 3HEMA 1YTLA 2Z43A 5B2EA 1EIZA 3ZWQA 2ZAIA 3E61A 2WHEA 3Q7PA 5DDMA 3UJ9A 1G0OA 1R4MB 4ZQEA 2FMIA 3BT7A 4IDAA 5EVJA 5C3UA 1T0HB 1DIOB 2ECQA 2C4TA 1NI5A 3ZHQA 1PGNA 5DB9A 1P81A 1PVDA 1SZPA 3U7GA 4CJXA 5J0YA 2IU6A 2RHOA 1NR7A 3ZD9A 4KFCA 4FDAA 1M6EX 1Y0BA 4AG5A 1NBAA 3JZMA 1IQUA 1L4BA 2HFJA 4I4TA 1S3FA 1IIBA 3F5SA 1MIOB 1GQFA 1T9BA 3TUIC 4WXHA 3QUAA 3DTNA 2PH7A 4IUCS 4O25A 2P67A 2O7VA 1N2GA 1ODLA 1KXJA 3TVTA 4B33A 3LBNA 3UJPA 2ZW9A 2J46A 4YIHA 3N0VA 1CF4A 3T35A 2HADA 1M5UA 3ZI7A 2O2JA 4DBVO 1NP3A 2BFBA 4BNKA 2H4JA 2DHEA 2VH1A 2JFNA 1G4AE 2GHRA 2HRZA 3CE9A 1MRNA 4DB2A 1A9XA 5CP2A 3T06B 5J2GA 1XQ6A 2CLSA 1PYGA 4ZYZA 3PFNA 5AQEA 1K7YA 1FSSA 1H4TA 3WRYA 5BWNA 1Q7RA 5IJ9A 3NH9A 4R7TA 2PBFA 2G09A 2BEWA 2C2DA 3DZIA 1KAQA 1H8HA 3B8HA 3PJFA 3OLWA 4ZPJA 3U7IA 1J2NA 3W5BA 1WF6A 2WTEA 3WMWA 1P5RA 9ICTA 5B6JA 2H2FA 2VHUA 3C3KA 2QNIA 2B9VA 1E0SA 4DUGA 4GUAA 5EP2A 3PSTA 3PC6A 2WIFA 3CJQA 1GTMA 4ECZA 3JQAA 3H5NA 4JBYA 4ZHSA 3GP3A 4CTMA 4IILA 3BD8A 3RROA 3WVNA 2FW0A 1DL5A 1JIQA 3R23A 3RR2A 2ZB4A 3OMWA 3RABA 5DM1A 1DBRA 5AVXA 4NFLA 3VV2A 1YH3A 3ZLTA 1WPGA 1SXJE 3GCWA 3K32A 2R8KA 1P7DA 1KYVA 4P4NA 3KDPA 1OIXA 1Y82A 3MT8A 4X5VA 3CQ9A 1G8SA 3B8EA 3S4YA 3KLNA 3FOBA 1D2AA 1YKFA 2YZKA 3SSOA 1MAVA 4C0JA 2CXXA 1O08A 5B58T 3RSHA 5EXDA 4BO8A 4GPIB 4BO9A 3KKZA 4X92A 2CJPA 2EGGA 4LYYA 4O29A 1DKUA 4ATNA 1RM6C 4OQDA 1V8DA 4ABTA 2I54A 3DFIA 5H0IA 4RY0A 3HFSA 1YSCA 3M0EA 9ICMA 1K4KA 2P3OA 4DNFA 3U7QB 1KRPA 5FXMA 3DMDA 3UOWA 1KDRA 2Q2OA 4L3OA 1SG0A 4BNMA 4YQZA 5AW6A 4LV6A 4ACBA 2VWHA 4EKYA 4PO9A 1E2HA 4GZ3A 4YN4A 1NW8A 1SXJD 2RGGA 4NYJQ 2WJHA 4QTZA 5ALZA 3SMQA 4EKDA 4HH1A 1LU9A 3VU3A 3CLRC 4AX4A 1KGSA 4BKOA 2OSVA 5CFQA 2ID9A 3P2YA 2DHQA 1ESNA 4U7CA 2BGWA 1V1RB 1WVMA 4C1BA 1C7FA 2IVZA 2W6JA 4C3OB 5HXAA 1VE1A 3BWXA 4MKRA 1TA0A 4M88A 3VO9A 3ZW8A 3BXZA 2W11A 1JBEA 5JAIA 1UINA 3KZMA 3BE5A 3I6IA 2QMQA 3CZ4A 1GEEA 5HNKA 3QYJA 1TUGA 3TRKA 2XOEA 3DZHA 5FHRA 1RXEA 1H05A 3OE7D 4ZQHA 5DXFA 2KLHA 4L3WA 5KFHA 1DOZA 4Z3OA 5JR3A 2XUQA 1I2ZA 2C5AA 5EVCA 4NDZA 3OQ1A 3MDCA 4M37A 2A5FA 1QONA 2J9XB 2VP5A 4TL9A 4HAIA 4PAMA 1YUBA 2PQMA 4BO1A 2WIDA 5JD3A 5HMLA 2P11A 1UT8A 4EL0A 3KKOA 1WBBA 2ZGVA 2J59A 3QPDA 3GJ7A 1KOJA 3LGAA 5T57A 1P4SA 5AHWA 4LNHA 1UBMS 1DAOA 3NUQA 4I2EA 3F2IA 2DTXA 3RC3A 2AN1A 2CWWA 1YRBA 3I23A 1EPUA 5GZ3A 4R2XA 2H51A 5CDHA 3N6XA 3PXXA 3KXKA 3KKQA 3OPYI 2IOFK 3D8SA 1HF3A 2EDAA 4R1TA 3G79A 4AWXA 5DNUA 3AKEA 1Z2PX 4E6EA 1L3SA 4TWIA 1XALA 5M7EA 1UEXC 4AP6A 2I3BA 4AO7A 1O94A 4HDRB 5F9MA 1RAGA 2PKYX 2ZJ7A 3R6DA 4ED6A 1Z15A 3GJ4A 1GUYA 3TJMA 4MLDA 4Y6RA 1CY2A 2Q3BA 5THQA 1VLQA 5AH0A 4CU5A 3ACDA 1XZQA 1V7ZA 5DKFA 1GCGA 3RTCA 5DHAA 2CYCA 4GVPA 2GWSA 1PJTA 1XO0A 3LYHA 1DUVG 2BHRA 1SIBE 1Q0PA 4ZVPA 1CEQA 1CY1A 2H5EA 4J4TA 5D46A 2IS2A 2GX6A 3KQYA 2WTBA 2C4KA 4DL4A 1ZQLA 2AOWA 4WBXC 3RJTA 4MLCA 4D97A 4DCVA 3LWZA 1QAMA 4IGFA 1QH8A 4MKGA 2HA4A 4YPVA 3NYRA 4CIVA 4AKTA 3G9QA 2NYAA 2EFCB 1J0AA 2R6GA 4UB1A 2PV0A 3IEVA 3KQMA 4KE9A 3RYFB 1SU7A 1EA5A 1T5OA 2GAJA 2YJGA 3QM1A 2XLBA 2YUIA 2XB6A 5B7QA 1L7NA 3RKUA 2FSIA 2FF5A 1E3QA 2EG9A 5TISU 2IXDA 3QYAA 4F9EA 3MRSA 2QW0X 3PBKA 3L7BA 3NVWA 5TV2A 3AR2A 2F4VB 3Q9NA 2EKPA 1AQNA 4RCVA 2GPTA 1QANA 4JB3A 4QPZA 4CHGA 2V1UA 3BF8A 3N5KA 3ONEA 5CM2Z 1DQSA 3LH5A 5F7XA 4TLMB 3K2IA 5TQ2A 2X1HA 1X87A 3U7EB 2QR5A 2XE6A 3FH0A 5CEHA 5KT6A 3AJDA 1IM4A 1UQUA 4BXOB 1GZDA 5DYNA 2W4MA 5ALQA 2NVBA 3PRYA 4NZOA 4EO9A 2EOAA 3UIEA 2EW2A 1QPGA 4K26A 4USAA 4UEJA 5BMVB 2JFBA 2B6NA 1IJBA 1MFZA 2WYOA 3NFRA 2JAQA 1DK3A 1UUFA 1PX0A 5JADA 5L9AA 4ENUA 4XW2A 2BQRA 1KAEA 3FJYA 3ND9A 5GPBA 1GVHA 4PHHA 4B2IA 5TPZD 2VN8A 2P69A 3G88A 4MWGA 5L7TA 1YB1A 5JSKA 1RRPA 3I8XA 1W8DA 2XADA 3AFNA 3RRGA 1EJ2A 3Q8XB 2PYDA 1W19A 1IUNA 1W88B 1AVTA 2QVBA 4A15A 3ZHCA 3CSDA 2V3VA 4H7FA 4YRTA 5F51A 3CCFA 3A1FA 4DL5A 5AVSA 2ANCA 2PRZA 4R1UA 2BFMA 5CTAA 4YCNA 3KP1A 2X5KO 1GO3F 2ONYA 3AJ8A 2PMDA 4R2IA 4RK7A 2AXPA 2Z2YA 4Z2AA 4I29A 1YB4A 4NL9A 4DFJA 5KHLB 1BEZA 3EBOA 4L1KA 1KO4A 1JIUA 1SQ6A 4J0GA 1C1XA 4MB2A 2F2AB 4BEWA 2VDWB 4R4JA 1J7KA 3INRA 1JLRA 1X92A 3WIBA 2OHHA 4QBGB 4BRSA 4FFDA 1K8QA 9ABPA 3KPJA 3ADBA 2C00A 4PPXA 1V3TA 2RHMA 1SWWA 4QUKA 4K03A 2OYRA 1A1VA 3WQRA 2GYUA 1TUEA 1XTKA 1JKFA 5CRXA 1IHXA 3OBIA 3F6CA 3CWQA 4TUYB 2XUGA 1US8B 3OA0A 1SQ0A 1GEGA 2C4NA 3UMMA 3JATA 4YMNA 3ZCRA 5IUKC 1ZM4A 5U4QA 3I05A 1I30A 5DEIA 1VB3A 3PFGA 2D6FA 5IIOA 4MWOA 1NASA 4OYRA 3H3FA 4U00A 2A3VA 5BYBA 3E35A 4ZV4A 1NLUA 2GKOA 1OC2A 3SC2B 5E38A 4EHBA 4TUYF 2JJQA 4XZ3A 1OE0A 5G4LA 1M1UA 3TARA 4DZTA 3G1UA 2KIWA 2CCKA 1KORA 3I76A 3NYWA 3ALRA 8ICPA 3FSJX 2D5BA 3MWGA 3OQ6A 2FMKA 4IJUA 5EJ5A 4CHTA 4BUJA 2WHXA 4JV5B 3SQNA 4KK3A 2W70A 4KKXB 3KYDB 1FFGA 2M2IA 4QWEA 5KYWB 2JIMA 1TIKA 1VB5A 5E7MA 2GHQA 3EQZA 5KG6A 2TRSB 2HSEA 3GDWA 3PCXA 2QL5A 4XX0A 3OECA 1WDLA 3ZQUA 3C3WA 4BMXA 1FLNA 4DY4A 4KE7A 4RZ3A 3LF2A 3SJUA 1PQUA 5NULA 3PS9A 2WM3A 4XLZA 1T13A 4ZPXA 3ZW7A 5FI3A 3SICE 3LW8A 5KU1A 4MP6A 3RRXA 3DUFB 1SKWA 4MS4B 3OX1A 3DDZX 2C2YA 1WCLA 2PAFA 3ZU5A 1JDBC 5JJLA 5D2CA 4JSYA 4C6HA 4H3VA 2ASEA 5K51A 3FOWA 4FO6A 3IE2A 4J1TC 3F49S 4LFAB 3CH6A 3U7RA 3V1NA 2Q8NA 1W1WA 1Y4AE 4WMLA 1LSJA 2CT8A 1G3MA 2UZ4A 2FWAA 3SEAA 3PA8A 2PBZA 1SXJC 2KMLA 1HR0B 1JQLB 4RTPA 3VZQA 5CU7A 2HOIA 1QYDA 2Z4RA 2A33A 2RKOA 5BQOA 3FB4A 3LA8A 3H5AA 4JJZA 1SRRA 4C8OA 4E21A 2WM9B 3DE4X 2O8VA 5IF3A 1B73A 3H2KA 3VZCA 3V8PA 5I7VA 3O8CA 1B00A 3LCVB 4ND8B 1GRRA 4V0QA 3COPA 1IG0A 1OZ0A 4LF5B 3LAWA 1E0DA 3GT4A 3ZE6A 3AFOA 5ALVA 4X62B 5KOHA 1SHZA 1IOVA 3KHHA 5FUXA 4X6UA 4TSKA 3WFZA 3WTBA 1MB3A 1UBLS 2VBIA 5EXEA 3FZEA 4TN1A 5ICCA 3KTQA 4L7QA 3NV9A 1R10A 4W82A 5H3CA 4RIEA 1P7WA 3BF7A 4KVGA 3MFYA 1G2QA 4KNWA 3NM4A 4YMTA 1JFTA 3SIPA 5AXCA 4BLRA 1KTVA 4GR5A 5C8VA 3KOMA 2I66A 2RK6A 1SKYB 3E22B 4UAYA 5KDLA 5E0OA 1DK2A 3KKAA 2RH4A 2HQRA 3UXNA 3DVSX 3SBOA 4R9SA 1L2TA 4LNAA 5ALIA 3GFVA 1MW8X 1R6TA 4H7IA 4AMBA 4GPZA 4KLEA 2CFSA 3F8WA 4TLCA 3V33A 4B8YA 5BSRA 4EI9A 1FIQA 1Y3AA 3O8OB 4FOTA 4UOQA 3L79A 1KY5A 1ECPA 1DLJA 4W8HA 4RVNA 4DA0A 1LGYA 1WZUA 2F3UA 3K9BA 4U9UA 5AOAA 4L8LA 2P6NA 3GRVA 2ALZA 1CFZA 4A7PA 2YICA 2QGFA 5JW6A 4KDRA 2B5OA 4Q9IA 3CT4A 1M6VA 3EXHC 3DD5A 1XHEA 4I5FA 3QYPA 4EI7A 2HGZA 3OIFA 1PSDA 2WU3A 3T7TA 1T4CB 4D02A 1I4WA 3B78A 1L1QA 1JILA 2GWRA 1YHZA 3ENZA 2OV6A 3IO5A 4Q1CA 2CFIA 5DWDA 2AYZA 4GXJA 3PD0A 4K6CA 1EFUA 1NU8A 1EVKA 5F3XB 4RT3A 2ZJ4A 1RJ9B 3V6JA 4Q02A 4OP3A 3R09A 2AJQA 4FHEA 2A9PA 2V6IA 3OBBA 2D3DA 1XCPA 3QEAZ 4A92A 1B6RA 5BWOA 3VOBA 1N6KA 5AM5A 4DA4A 3CXUA 3GRCA 4G0UA 5C46F 3UWSA 1F4VA 2F3PA 1T6XA 3EAGA 1P5ZB 3U62A 5ULLA 2XDQB 1ZR4A 1KOGA 5CDUA 5LZ4A 2OQVA 1ID1A 4M0EA 4MJLA 4NCNA 2J3MA 2EZZA 3BKWA 3OPXA 2J30A 3IIKA 4YECA 3E9NA 1JAYA 4H0FA 4B6SA 5UKDA 2I91A 3H4BA 1DZ3A 2P0EA 3VH4A 1KIAA 4YJ3A 4OM7A 4Y2TA 5KX5B 5IAAA 1UQTA 1UA1A 2IPLA 1I1NA 1AUXA 2C7OA 2CB0A 3RBXA 5IT4A 821PA 2NU6B 1Z2NX 7ICSA 3TZEA 1CW2B 2WR8A 2OGZA 1E9RA 4O2AA 4AJHA 4KQIA 4PG5A 1UFQA 4JUCA 1E2MA 1FRFS 2E9SA 4QODA 2J0QA 4COKA 5JARA 4NV1A 2F48A 1X2IA 3C21A 1P8JA 5BRAA 1L9KA 2G3YA 2PZJA 4I9HA 5KTPA 1U80A 5IKXA 3K53A 1RVV1 1UCFA 4LNUB 1JG7A 4EBFA 2Y0EA 5KX5F 5JBNA 1Y8CA 3FYHA 2X5NA 4JLOA 4XIIA 1FSPA 3ZE9A 3DZBA 4ECVA 2QSUA 1AMOA 2W6NA 4RMGA 2VQSA 3C24A 2V65A 2VDJA 5HJ2A 1RJGA 1KW4A 5B30A 4BLWA 5KBYA 3AUUA 3FPEA 2C7QA 4FJ0A 2OE2A 3NETA 2H4HA 2ZIXB 1SVNA 3LI2A 2DWPA 1VDVA 8ICQA 1S8AA 3DHYA 4QPDA 1XXHA 4REMA 2IRWA 3JVDA 4PL2A 1XVVA 2QMYA 2WSLA 4RORA 4Z9FA 1LPMA 2IYLD 3S99A 3G2OA 5KYKA 3A9RA 3ZVNA 4R8RA 4CLHA 1N5LA 5ALOA 1I5OA 1YB6A 2CL0X 1S5LU 1ZNXA 2Q1WA 3P8ZA 2YVKA 3JRXA 1MORA 2D8CA 2FOXA 1GRQA 4MMXB 5A5GA 3OETA 4TKUA 1ONOA 2YFHA 5ABPA 3K15A 2C2HA 1Y4ZA 4PH5A 1ISGA 3DNFA 3COSA 4E7PA 3ZU6A 4X94A 4M21A 1R88A 3U26A 1HI9A 1A95A 3IAAA 3JAKB 1Y98A 1NJSA 2G5IB 3GLQA 2GD2A 4HEHA 2ZSDA 3F2DA 4RMNA 4L76A 4X9XA 3VAAA 1G6OA 3EMVA 3FIJA 2GZRA 3W8EA 3FPBA 2X76A 1IHYA 2KM1A 3MWDA 3VTKA 4G25A 4F06A 2VUTA 1Q20A 3KWJA 2ZUTA 3O3CA 5JPCA 3L9WA 1O03A 3LBIA 2QUHA 1MF7A 1QHFA 1IQRA 5JZBA 1EP3B 2ZSEA 2OAP1 4EKEA 4ECRA 4G1EB 2Y4OA 3REGA 4ESEA 2HV8A 3BQ9A 3SHFA 4AB1A 1WWUA 4YT4A 1Z4PX 3UAOA 1Y8QB 3ESAA 4ZMRA 5HFJA 1ZD5A 3K4QA 1TQ8A 5I9BA 1WSWA 3PQ5A 1MABB 1JU3A 4JI1B 4B4WA 3GP8A 3HQ4O 2IS1A 2KTQA 3F90A 3CWZA 2UVDA 3ZCVA 2ZRJA 1ZD4A 2QNRA 4ZI5A 2R8HA 3PD7A 4JENA 3KC2A 2WV9A 1L5YA 2LDBA 5J0XA 2FJ0A 4Z53A 4GYYA 3UQYS 2IWRA 2FW6A 5GJBA 4IFIA 1FNCA 1UKCA 5JQWA 5FBKA 3VKGA 3VYVA 2JLVA 4HWKA 2BN4A 5KFVA 5AW8A 1WO8A 3FTCA 2DWCA 1RHQA 2GEBA 2HK9A 4A8JB 5CVJA 2ZYRA 4YP6A 4ESHA 4BMPB 1JJBA 3OT1A 2X2OA 3FDSA 2WHQA 5JZVA 4NE9A 3RB6A 1MH1A 4L5BA 2I65A 2R4QA 5HILA 4BKUA 2JFVA 3D7RA 2G36A 2E4YA 3W77A 3E58A 1UOQA 4FGKA 4Q3EA 3AHCA 3DE5X 3JQ7A 4FJ1A 1KMHA 3N2IA 2QW8A 1ZRNA 3N4MB 3HYSA 3F8SA 3BPSA 3DEHA 1G38A 1UBRS 3LVQE 2O19A 1P1JA 3OAAD 3EXIB 2VUHB 2L5YA 1XELA 2ORWA 2GYVA 1E79D 3OJEA 4YAJA 5J1SB 3Q3EA 3AF6A 5HS4A 3U4MA 4YVFA 1U5BB 1I13A 2Q6LA 5H70A 1TQHA 2QLTA 4BLTA 4U39A 5GMOA 5IEJA 3D0RA 4UHKA 4M89A 1GDHA 4ENTA 2WQ7A 3QA9A 4F4WA 4XIJA 2K4HA 5KO2A 5ECYA 3W2IA 3Q3HA 2ZYTX 4AP9A 3NIDB 3MFQA 1ZM3A 3W5SA 3H4VA 3JV7A 2GZ2A 1HJPA 3EXG2 2PWBA 2WWGA 2H1VA 5J2DA 1TKBA 3A3NA 1J99A 1C30A 1QHIA 3B6ZA 3ZHSA 3DM9B 5BXYA 4Y0VA 4V0LA 4OXRA 2NSDA 1YK1A 3HILA 3TM5A 3KM0A 2JI4A 2Q62A 4P5DA 3D3EA 3PEFA 3OEEA 4ALIA 4E46A 2YVAA 2OV4A 1NAHA 4Z4QA 3V4PB 1M7BA 1W48A 4WZAB 1X8XA 2QAIA 1Q0LA 2AF4C 4MVJG 1HOTA 2JV3A 1JMVA 1KKLA 5A3JA 1U5AA 2ZTMA 3ECAA 9MHTA 4UHBA 1YQUA 2OESA 3U4AA 3UCEA 1R9GA 4DS5A 1IJEA 2Z5GA 5JSZB 3RAFC 5BMOA 1GPKA 3S1AB 3ZXYA 5FEUA 2ZE8A 2H1HA 2JIZD 4KLQA 2A14A 1PEKE 1J56A 2UUPA 4E2XA 1EFHA 2IKSA 2D8AA 1EWRA 2IYZA 3C23A 1NMQA 5BSVA 4KBGA 1YRYE 4M86A 4V2UA 3GVIA 3ETRA 2H08A 1ATIA 1TJ4A 3GEBA 4MCIA 5L51A 3MN1A 3WQSB 4AQYB 3EA4A 2JH3A 1EK0A 1XF1A 1SHUX 3ZI4A 2BQ3A 4IGKA 2W2XA 4U6QA 2DWQA 3RRHA 3O0FA 2UVWA 3U4IA 2P2ZA 4Q18A 4D8WA 1HL3A 4CLRB 2AXTU 2XODA 4U1RA 2BBWA 2JNWA 2P2CA 3C3CA 4X8LA 4P38A 3ASYA 1BKYA 5KFJA 2PZMA 2ZWAA 2P6MA 3ADOA 4H6VA 2ZVDA 4D4MA 1I14A 1QIGA 1SVLA 3ST7A 5AKGA 3SR4A 3I2GA 4FBMA 5F3RA 1SG6A 3CKMA 1SVSA 2E18A 5IABA 5I3ZA 4LC9A 3PNPA 1XTRA 2ZTVA 3FDFA 3K70B 4O3FA 4N3BA 1AUQA 2I29A 3E27A 2R87A 2CNKA 1K8ZB 1P2SA 2IIVA 3CURA 1BHSA 4G5RA 3RWBA 3AJEA 5DB7A 1GA4A 3QXXA 3ICWA 3K5WA 4N0EA 1FW6A 3B6KA 2PUBA 3IBYA 1XSNA 3IURA 4XDHA 4AS3A 2JG3A 4OCZA 1J21A 1JU9A 4BASA 1YDWA 1U9YA 1TJ5A 1XMOB 5GONB 1IB6A 4S2EA 1PUXA 5HKAA 1IY0A 2HHVA 2FWBA 2XMRA 2J67A 1TM5E 1JIIA 5TQ0A 3I1YA 4DIUA 5E9QA 4G5YA 1NVGA 3ET4A 3L46A 5FUMA 4JUDX 1FTWA 4L4ZA 3G17A 2OEPA 1QHSA 1KLNA 3GT7A 3ONDA 4YC7A 4Z54A 3GLFE 1WHSB 4RK0A 3P2KA 5E1OA 1G60A 4AT1A 3WHPA 3ASVA 2NLOA 5DLQC 3EBLA 2L18A 1YAHA 1DJNA 4KXUA 4FGUA 3VR3A 4KR3A 1J0EA 4Q1AA 1B1AA 3M7IA 2HFKA 1OXJA 4RW0A 4B4DA 2PS0A 5G0SA 4DLWA 4FZMA 4OAPA 4FYYA 4LS3A 1I24A 5KL8B 3CF6R 4N03A 2JHDA 5CCXA 1IK4A 1OPXA 1IAQA 3RREA 3U56A 2Y0DA 2J5BA 3E05A 1DBVO 4IDCA 4E5MA 3C3DA 2D1RA 5BPCA 1JR6A 1ZBQA 2H16A 3EGCA 1RG6A 3OTGA 4HNGA 1MNQA 1Z3IX 1T2NA 2RBEA 4YDSA 2GASA 3BGWA 4KL8S 4NZZA 2HO4A 5CD9A 3MJTA 4X44A 3WHLA 1GU0A 3GN1A 5FOTA 5DBEX 4JLKA 3R5KA 4DKXA 4FMCF 3C8UA 3BQ0A 3VO2A 2XOXA 2K6GA 2PS1A 3KLBA 3C7DB 5HQJA 1ZQEA 3NASA 3DWGA 4LKOA 3RQIA 3CNOA 3CRW1 4LRXA 1ZS9A 1YFZA 4J90A 4QO8A 4JLWA 3KFLA 4NC9A 3GQBB 1Y9EA 3JPQA 2IEDA 4K3UA 4HLUC 2Z95A 3L6BA 1DJLA 5LD2B 2V7GA 2IOQA 4LMPA 2F90A 2ZBPA 2O54A 3LPMA 3D3JA 3FI0A 4EYGA 4TV9F 4N48A 5TMDA 3QVVA 2EFEB 1I4LD 4GXNA 3ZZ0A 4KWHA 1C7ZA 3C28A 1WNTA 5C4IA 2G07A 4E5YA 2W6OA 3KYCA 4ZAXA 3O92A 2DT5A 1ND6A 1SKYE 1RAFA 4KTQA 4C05A 2QTVA 1JA0A 1MRSA 3LGSA 3IUYA 3UMSA 2FP4B 3UGQA 5TLSA 2N42A 2IS4A 4YAKA 2YJ4A 1TQ2A 1M2OA 5IDVA 3W3AD 4J29A 4J8PA 4BCCA 2ADMA 3P9KA 4NJMA 4M1ZA 2E4ZA 5FEMA 2CLIB 4ECXA 1NYQA 2NXJA 1N7HA 5IUNC 1TW3A 5EGSA 4TLDA 4GUDA 1RI5A 2YCLA 5ALUA 5G2OA 2VUSA 1UJ5A 3GLIB 4M7RA 5BNWA 5J0RA 2BGGA 4P5EA 5EJIA 1RXUA 3RBVA 1OFGA 5IK2D 5LP1A 4CLDA 1JFFB 3ITDA 1K5OA 4ZOHC 3TW8A 1QZTA 2KPOA 4N9QA 5AFSA 4MW7A 3MEQA 2W37A 3A26A 2W9BB 4TVKA 3BTOA 3C1TA 2R84A 4L73A 1JQEA 3F3KA 5JRDS 1JKXA 1YULA 2HF8A 4TQSA 3L06A 4Z0TA 3K8ZA 3T9DA 1BN6A 5K8TA 4HK4A 4RQ0A 3U7HB 2OD9A 2JFHA 4FCCA 5L4SA 1DP4A 4RNCA 4P7BA 4U0KA 1T5SA 4H3KB 1I4TD 4MWCA 2O2GA 4HGZA 2OFXA 4U3JB 3JY6A 5EZYF 4B2PA 4KDFA 5K6TA 3B1VA 5H9VA 4MPJA 3DAHA 4Y2SA 1EFCA 5B37A 5GV7A 1J97A 1YL7A 4GLFA 4KSBA 3K0CA 2UVUA 4WUTA 2H92A 1K1QA 4ONEA 3EGVA 2V58A 5EUBA 4D9CA 3TYXA 4IJ5A 1Z4KA 2I6FA 1NVKA 4GMDA 1SY7A 4NCBA 1GXSA 2VUUA 2ZTSA 3N39C 5HM6A 1TFUA 4A5SA 1OAKA 2QTBA 1PJQA 5DN6A 1WUTA 3D1JA 3O2JA 3HRDD 1GKLA 4K81B 3R8XA 3F6EX 2PUWA 2P75A 2XBUA 3UKOA 3L4JA 1Y6GA 3G6KA 4HPXB 4M60A 1QGDA 4JI3B 1SEVA 2V5AA 4U2EA 2PZLA 2HMWA 3ZDFA 3DEJA 4FZ3A 1H22A 1PWHA 3WO0A 1MHTA 1AF7A 4D0NA 4C2AA 4MA4A 1II8B 4P8RA 1U2RA 1N3BA 3HB7A 1WSDA 1FXSA 3E3OA 2XZOA 2ALJA 3RKRA 4YLYA 1X74A 2QZ9A 4WACA 2OHGA 3RYCA 3TSCA 4D57A 4EBEA 1B23P 3BH0A 5LYJB 2RMKA 1EHCA 3K4GA 2IW1A 1G66A 3OTHA