3QXGA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron complexed with calcium, a closed cap conformation
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
222
structure length
222
Chain Sequence
KKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 84
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qxgA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qxgA01
1O08A 3SD7A 1IWOA 1N8NA 3AR4A 2HEGA 5A3RA 1ZRNA 5ALEA 2YMQA 4HGNA 1XP5A 4KYTA 3BWVA 4YGYA 4UMVA 4HGPA 2JAUA 2R8YA 2C8LA 3K1ZA 2HF7A 1RLMA 2IOFA 2ZBEA 5AKKA 3QUCA 3ZW7A 2P27A 2VKQA 1EK2A 2G08A 4BNDA 2WF7A 2G09A 1RKUA 2O9JA 2NO5A 2P69A 2EAUA 2OA0A 3FPSA 3OCYA 4F72A 2AGVA 3KD3A 2OM6A 1QQ6A 3L5KA 5AK6A 1L7OA 2WF9A 3WK5A 2B30A 5A3SA 3QU7A 1CQZA 5AHXA 3WKBA 3U7HB 3QUQA 4UAVA 2CFSA 4BYGA 3ZUPA 4OHFA 2B8JA 5ALRA 1Z4PX 2BY4A 1L7MA 3PCTA 3SF0A 3UMBA 1Z5UA 2YJ4A 3WK7A 4DFDA 3ZTYA 3NAMA 3QLEA 4NAVA 3B8EA 2YJ3A 3ET5A 1RMTA 5AICA 5AW4A 4HGRA 1RDFA 2W11A 5AKEA 1YDFA 1PW5A 3ET4A 4HAIA 1S2OA 3EWIA 5AW9A 3F9RA 2B82A 3I28A 4J2TA 3E58A 1J8DA 5ALPA 3HYCA 4JDPA 1RKVA 1ZD5A 1RQLA 3ZWDA 4L6AA 1U7OA 5ALVA 1Z4OA 2HX1A 1TJ3A 5ALWA 3UM9A 4C4TA 5AI9A 4Y2JA 3PDWA 1QQ7A 4RETA 3WKCA 3DNPA 4BEWA 1L7PA 2GFHA 2Q4RA 2HCFA 5AKLA 3UMCA 2I33A 2OBBA 1ZRMA 5ALHA 3R9KA 4Y2YA 2GHTA 2NYVA 4I9GA 1U7PA 4DCCA 2RB5A 3QYPA 3ZVNA 3SKYA 4Y3UA 2IYEA 5AI8A 4Y2XA 3R4CA 4AS2A 2RARA 5AM5A 5AM0A 5AKIA 3W5DA 4L57A 5AESA 3U19A 1Z4QA 1RMYA 3VAYA 2JAWA 1N9KA 3SLRA 2HSZA 5AW6A 3OCWA 3CZ4A 3M9LA 2G80A 5AIAA 1RPZA 1YMQA 2WF5A 3D6JA 2X4DA 4FE3A 2ZBFA 4DWOA 1T5TA 5AVVA 2RAVA 5ALLA 2ZBDA 4F71A 3NASA 1Z88A 4XE5A 5AVSA 2YJ6A 1RKQA 1WR8A 1AQ6A 4OD0A 4DW8A 4J03A 3QU4A 4HYTA 4GIBA 1SU4A 4G63A 3EPRA 4JB3A 4NABA 4H1WA 2WF8A 3OCVA 3EF1A 2YBDA 5AVYA 2AMYA 1YV9A 2QYHA 3L7YA 3KDPA 2C4NA 1J97A 2Q5EA 5IS2A 4Y2SA 3P96A 5AK3A 1F5SA 1ZD2P 2FDRA 5AW2A 2B1QA 4CF3A 2YMLA 3ZWKA 1ZD3A 4YCLA 5ALJA 2JGAA 3L0CA 3OCXA 4L6CA 5AK4A 4AP9A 3MN1A 1FEZA 1RLTA 3L0BA 3E84A 2AH5A 3SMVA 3FM9A 4G9BA 4YCNA 1L6RA 3N07A 3WKEA 2BDUA 2G0AA 2EATA 3WGVA 5AW8A 4YH1A 3U13A 1RC8A 5ALUA 2IOHA 5ALGA 3EF0A 5AW7A 4CF4A 3W5CA 5AKZA 3KOOA 3IB6A 4QJBA 4BX2A 3ZU6A 2YY6A 1U02A 4BNDB 3DDHA 1RRCA 5AI6A 5FP0A 4EELA 4I9FA 3N1UA 2AUTA 2C88A 4GXTA 5ALXA 4OFZA 1L8LA 3I6BA 1U2SA 1T9ZA 1TA0A 2B0CA 3NALA 5ALKA 4UW9A 1VJ5A 2Q4TA 4EZEA 2W4MA 5AVUA 1QQ5A 3IRUA 2HF2A 2I34A 5AM3A 1Z4IA 4YIHA 4Y2VA 4E88A 4MUMA 2EARA 1CR6A 1YS9A 2C8KA 4KX5A 5AW5A 1Z4LA 1L8OA 1WPGA 3L8EA 4UMEA 2FI1A 2I55A 1K1EA 2P11A 2YFYA 2ZBGA 5AI0A 4C4RA 3AR3A 3QU5A 1MH9A 1VFPA 1Z4JA 2YJ5A 3ED5A 3DV9A 1WZCA 2G1AA 4UATA 2W43A 4UAUA 4BX3A 3ZI4A 3N8GA 4NV0A 5AVXA 3WK6A 3SHQA 3BA6A 3QGMA 1NNLA 3WK8A 4XOUA 4EX6A 3OCZA 4UASA 2MU1A 3N28A 3AR9A 3A1CA 2RBKA 2I54A 1ZS9A 2BDEA 5E0OA 3U7FB 5AK5A 2FPXA 2HI0A 4XQ0A 2ZOSA 3NIWA 1S8OA 3TLMA 4ZEVA 3FGOA 2GO7A 3OPXA 3RF6A 3SKXA 3I76A 5AW3A 3R09A 5ALZA 3L8HA 3NUQA 3U7EB 4Y2PA 3L8GA 4YCMA 3CNHA 3FVVA 2PQ0A 3NANA 2FPWA 2FUEA 2IA5A 4YIKA 3IJ5A 3J7TA 2P9JA 4UMDA 5A3QA 3KC2A 4UM5A 4CF5A 5AI4A 3L8FA 3ZVLA 5AKXA 3AR7A 1Y8AA 1LVHA 3QXGA 3WKAA 2YMMA 1ZOLA 3FZQA 3NRJA 2C9MA 1Q91A 1RLOA 4KX3A 3HLTA 5ALNA 1TJ4A 1Z5GA 1NF2A 4PNHA 1Q92A 1YJ5A 5ALDA 4BX0A 4HGOA 4ZEXA 4IFTA 2G07A 4MWOA 1U2TA 2FPSA 5AM4A 3ZX4A 5ALYA 5AW1A 4FFDA 2ZXEA 1VJRA 4HGQA 3AR5A 3PGLA 2WHEA 4CNQA 5AVZA 5AI5A 1ZJJA 3W5BA 2GMWA 2HOQA 4BEVA 2DQSA 2CN1A 2FPRA 3L1VA 1TE2A 3W5AA 1EK1A 4UU0A 1Z4MA 5AVWA 4NFLA 4XPZA 3WKDA 4CE6A 3L1UA 4UM7A 4EEKA 2WF6A 4KN8A 1O03A 3A1DA 3KZXA 4C4SA 1RMQA 4EENA 2FPUA 2R8EA 2HHLA 4O8CA 4KNWA 4IG4A 2WFAA 2R8ZA 3B9BA 2MU2A 3A3YA 3U26A 4EX7A 1QH9A 5AVTA 1Z4KA 3QUTA 5AKHA 3QX7A 3WK4A 3KBBA 3L0YA 3ZTWA 5ALOA 4NWIA 2HDOA 2WM8A 3UMGA 2ZG6A 3I1YA 1T5SA 4BBJA 3GYGA 1QYIA 5IT4A 4Y2RA 2FEAA 2YN4A 1SWWA 5AIBA 2O2XA 1XVIA 3AR8A 1X42A 1TJ5A 1RQNA 2OYCA 1SWVA 3MMZA 3U7GA 5ALQA 3QU9A 5AW0A 3WK9A 3ESQA 2B8EA 5AKGA 1JUDA 5AM2A 3OCUA 3ONNA 1ZD4A 2ODAA 5AVQA 5ALMA 2JAOA 1NRWA 5ALFA 2HO4A 4QQFA 3AR6A 3DAOA 3E8MA 3AR2A 4BKMA 3WGUA 3MC1A 3QNMA 3E81A 1KYTA 4Y2TA 3B9RA 4Y2UA 5ALIA 3S6JA 3A1EA 3MPOA 3RFUA 2CFTA 4B6JA 1YNSA 3FPBA 2I6XA 4OCZA 2PR7A 4UARA 2R8XA 3QUBA 3PGVA 5AKYA 1Z4NA 2IOFK 2GHQA 2B1RA 4UMFA 3ESRA 4AS3A 5T41A 2QLTA 5AM1A 5AVRA 5JJBA 2CFRA 2NO4A 3QU2A 5ALSA 2FUCA 4Y2QA 3N5KA 4UU1A 4KNVA 2D2VA 4FYPA 4RESA 2YMPA 1L7NA 3M1YA 1XPJA 2JARA 3ZX5A 3ZVMA 4ZEWA 5ALTA 3OTQA 2I7DA 5IT0A 1WVIA 2MSNA 2G06A 5AKJA 1LTQA 2PKEA
chains in the Genus database with same CATH superfamily
3ZNNA 4UB1A 1L2TA 1YRAA 1JAHA 3I64A 1N8NA 2VXYA 2PKWA 2ZUSA 3ZDEA 1P75A 5HA5A 1LPMA 4KIFA 3LCRA 3V8BA 4XARA 3LF1A 1SUEA 4S0XA 5ED0A 4DJEC 5C4IA 2GD1O 1A69A 1UDWA 1DFHA 5ALEA 1B23P 3LLVA 1N1EA 1J1IA 4YJ3F 2X1HA 4JFAA 1E5VA 4KR2A 2IEZA 3Q8LA 1T35A 2CNKA 3Q3VA 4OK6A 4QFBA 4ADSG 5C8XA 2A8YA 4IL6U 1KY3A 4NLNA 2R8YA 1MBZA 3FFTA 4P0PB 3NTVA 4AY4A 1UPBA 3SDZA 2PT7A 5AJHA 3C8HA 1ND5A 2C58A 5A03A 3NHFA 1PZXA 1R2QA 2VYVA 4MLPA 3RARA 1XAGA 4OI4A 4DR2B 5CFMA 2C22A 3EJ6A 5DP2A 4EAAA 3B1WA 5KMGA 1Y3BE 8ICKA 1ZESA 2FU5C 1SUWA 3GP3A 3P9YA 1N5LA 2ZRDA 3VOBA 2IZ5A 3KTOA 3FCCA 2QTVB 1T7PA 3FTPA 1EWVA 1O2DA 4M9NA 4MVJM 1TECE 1N8SA 2WF9A 2W2VA 3FWYA 3AGPA 3GIDA 4EQ6A 3P2KA 3HYRA 4GXIA 3BWCA 4QOHA 3J81A 2CLEB 4NQZA 5IVIA 5AO9A 3VPHA 1QRRA 2K4HA 2C8VA 2FSVC 3TD6A 4EGCB 3ZUPA 5IJ0B 5CH8A 4BE4A 4JR1A 1BDMA 1RWWA 1XTQA 2A2ZA 2P1RA 4DWVA 3AVQA 1GZDA 3Q3GE 4R64A 1CUBA 4L3WA 5T7BA 3TVDA 2J9XB 3A27A 1A3CA 4NESA 1RJFA 3LYUA 4M1ZA 4A5OA 1UFQA 1MO3A 2YJ4A 3VDXA 3LH5A 4EO7A 1JKMA 3ZTYA 1C3OA 4QFCA 3TI0A 4FFMA 3BL5A 3MYRA 3TFOA 1EA7A 1OWMA 1DSSG 1X8XA 3KZMA 3X2FA 2LZ0A 2XMZA 1DG1G 4MF2A 2IYPA 4GGOA 3VR1A 3O5AA 5DLFA 4HPWA 1CX9B 2CNDA 3JTEA 3KXKA 2EBWA 1AMNA 3OFND 2WZQA 1ULAA 1E2IA 3JWHA 2ASVA 4HDQB 2WKWA 1PLKA 1E1QA 1DBPA 4B3TB 2H3EA 3AUAA 5ER6A 2WMOB 4HGRA 1IDN1 2CV2A 4ES6A 1PNOA 5C2JB 5LVAA 3CKMA 2FN7A 5IC6A 1DKUA 2QUKA 1NUPA 2WABA 1JKXA 3I28A 5KNIA 3W5IA 1R4MA 3H18A 4L95C 4YRNA 4DV7B 1E2BA 2GK3A 3BRWA 1FVOA 3EXEA 5GP1A 5DHFA 2MINA 1C2YA 2JLCA 3ZWDA 3LCMA 4GMHA 5E6UB 3B5JA 3X43A 2PU7A 1XNSA 4Q4DA 5KG4A 5F9HA 1M83A 3UM9A 1W5FA 1I4TD 2ZRBA 2DGZA 5FOQA 1VKHA 2Z3VA 4Y2JA 1JP7A 2V9PA 3OFVA 3TXXA 3D2BA 3LAWA 1VIAA 5C8ZA 3OJWA 4FXPA 4M1EA 3ORYA 4XSVA 4DVGA 5EJ6A 2PXCA 4W5NA 4BAZA 1Z5WA 5TSDA 5A5EA 4O2AB 1YRYE 3F5QA 4R8SA 5JJCA 4U9HS 1TC2A 1ID1A 3CZ9A 3L7KA 4XI9A 1C3XA 3UJNA 3R9WA 2IV7A 1FMLA 3RYIA 3NBAA 4XEUA 1Z63A 1BN6A 3OA0A 3DZKA 4IGKA 3W5VA 3GFSA 4JI8B 4P31A 1T2NA 3L0PA 4YVZA 4RPJA 5ERXA 2ZUFA 2PR2A 2JIDA 3WL6A 1XCPA 1FYXA 5HQ3B 4NCBA 1W5SA 3K1AB 3R44A 3ZY2A 5G02A 2Y9PB 1F7UA 3D3EA 4J0QA 2LR0A 2B3TA 2BVNA 2LD4A 3T1QA 1A82A 1DCFA 4AZVA 4LJ7A 3H4BA 1IN7A 4BNYA 2ZJ8A 2XA9A 4RHUA 5JMOA 4TLEA 3BE6A 2NSYA 3BH0A 1YQUA 4KQJA 3LBHA 4P08A 2JFBA 3BG5A 3RJ9A 2RFLA 2Z2IA 3V2UA 1VI5A 2IELA 3TOVA 2RGXA 4M7RA 4LVOA 4DBVO 3X1YA 1G7SA 3EVEA 2C9OA 4C89A 3QITA 4AF8A 5DRTA 3F0TA 3KSBC 3RFXA 3O4FA 2WEKA 4FYWA 3F8SA 2H65A 1H9BA 3CGWA 4MMXB 1Z6QA 5P8WA 1VXOA 1L1FA 3B0YA 3COVA 3X1KA 4ETWA 3HW8A 1D1SA 4YCCA 5C7YA 5AVSA 3VYWA 5IM5A 2E4AA 4OXXA 2RGGA 4P54A 3C2QA 2VP2A 1U3WA 5BXQC 1XEXA 5DI3A 1R8YA 5FXMA 2Q07A 2WNIA 3P52A 2W6MA 4BX8A 2JEFA 2ORYA 4NABA 3HP6A 1CDOA 1WXWA 3G82C 1U6IA 1W0KA 3MGKA 5I7SA 1E1NA 1JT2A 3ZXSA 4BMZA 2A5DA 3BXOA 2UVQA 1FXSA 1M8KA 4G1UC 4RORA 2PFNA 1XS9D 2BJHA 4NDNE 4D4IA 2C4KA 3PVZA 4BU0A 1IMOA 3SC2A 5LNK6 1B22A 2RHMA 4PEVA 1WVMA 3IQFA 1HFKA 5JPIA 4XWAA 4B3FX 3EGIA 4EWLA 2V74B 1XD8A 4ZA2A 4ROSA 1WUDA 5ALJA 4Z9BA 4E6EA 2Q4DA 2OGUA 1ZN2A 1Y6RA 3ZI0A 2H2GA 1AKYA 2C5AA 2X76A 1D2AA 4QZ9A 3OCXA 3IKTA 3I4LA 2IKSA 2HREA 3WFZA 1NJ5A 2IVFA 2DBYA 1OPXA 1WUKS 4KUHA 4U7CA 1VRCA 2X9VA 3O90A 3QKWA 2ZTEA 1Y8QB 4O2AA 2AH5A 4X85A 1FRQA 3S1AB 3GJRA 3O94A 4G9BA 4ZCMA 1HMPA 4IW3B 4GRDA 1VA4A 3D1JA 3G6KA 4D3SA 1MOSA 2OZLA 5K3SA 3PTLA 1NW9B 5JSYA 1YBAA 3IE1A 3U13A 2ZKIA 2B21A 4KWEA 3FW1A 4PE5B 1N32B 1I5RA 2RDJA 4Q1CA 1H8HA 3SJAA 1FF9A 1SQ6A 4BNDB 1MC8A 1V35A 3H9BA 4DM4A 3RUDA 5K1ZA 2O06A 2Z43A 3OURA 3V1NA 4MQ4A 3FAHA 2A59A 1IONA 2AUTA 4Z51A 1YMVA 2BBSA 4C2UA 2FFBA 4MR7A 1KZGB 4F5QA 3T3FA 3M9OB 3OSPA 1ABEA 1NMZA 4LXXA 1RXWA 1NYLA 2JKVA 4P81A 5IAEA 3IQIX 3CRXA 3RANA 3UXYA 3HA3A 1QQ5A 2Z30A 3TZHA 4LRTB 4UM8B 5K3CA 3DHEA 4RJIA 3S28A 1JIVA 2OEHA 3HADA 3FPLA 4JJ4A 1E4OA 2VA2A 3LIPA 4HLQB 1CUKA 1W9MA 4YQFA 1TM1E 3LWZA 2X4IA 5FUQA 4KFCA 1COWA 1B3BA 4LDPA 2FZ5A 1GTVA 5H80A 1N6IA 4KQEA 1JQ3A 1NGSA 1ORWA 2AQ0A 1IATA 2APJA 2Z08A 3OU7A 5IJ0A 2NUTA 4RHYA 1SUIA 1ZEMA 1XEWX 1VKNA 1K3TA 2WZCA 3G8AA 3TYXA 2YB1A 1YJQA 2H9IA 3EVTA 3H05A 2X9GA 2H48A 3NVWA 2RG7A 2XWPA 2BTEA 2PFSA 2B5WA 2Z8XA 4UXHA 1U0EA 1II8B 3GBVA 4M0CA 4II7A 4BATA 1SOUA 2H8KA 4JHXA 4XD2A 3DL0A 1P5FA 2B61A 4OLHA 2ANCA 2CL6X 1GSIA 2YJZA 4ZT5A 1EZ4A 3U1BA 1KMCA 2JJ2D 3GJQA 4FX2A 1JA9A 4TLBA 1BCSB 4QJ4A 5KFHA 2WTAA 5CXUA 3V1YA 4RVUA 1TOAA 3P9ZA 1DV1A 2HJSA 3HMQA 4NYJQ 3VC2A 3I52A 3UCFA 3WK8A 3CT4A 3QNUA 1E94E 4PC2A 4RD1A 5SYNA 5U4XA 1HWYA 3R7NA 3FUTA 2DLNA 1U5BB 3A1CA 3PZRA 1XDUA 4OJKA 5EJMA 4AWAA 1MRSA 4P93A 2DY1A 2XCPA 4NG5A 2C2DA 2ZJ2A 5EIAA 4DLPA 4P98A 4EZBA 3U7FB 2WNHA 1Z8NA 4GXRA 3BFPA 2BLLA 2D5AA 3SEAA 3MQ2A 3MT0A 3W1EA 2K8BB 1YA4A 3OTGA 3LUHA 3TLMA 3ZE9A 5DQIA 5IILA 1N56A 3ILYA 2GO7A 3LDAA 1XD2B 3D5TA 1UKYA 3DBOB 4LOAA 3ZGOA 2IYFA 4TQGA 2VAVA 3VR3A 1HI9A 1UFRA 2KX7A 2PWYA 2XKBA 3O4JA 3S5JA 2B9EA 2PGDA 1VL6A 2IYLD 3MIZA 4TV8B 1DINA 3STTA 1SGWA 3VPFA 4G0VA 1KNQA 3MGAA 1M1YB 2CHUA 2DQNB 5GV8A 5ILGA 2D2IA 4DDVA 4NJMB 1C0EA 5KDOA 4MCHA 4DDMA 1SA0B 4U0JA 4BV8A 1DEKA 5AHOA 5KFSA 4MEYA 1UA1A 2ECQA 5J63A 4DGSA 4LYDA 1UJ5A 4DOAA 1XA4A 4MVCA 3RC1A 2O4UX 4ZDIA 2BHTA 4Q1VA 4MUFA 2FLPA 1I7PA 3VNBA 2QGZA 4RF4A 2PUEA 4RW0A 4DV0B 2C5EA 1AGYA 4DSIA 3AR7A 3ECCA 3JQGA 3H40A 3BB1A 2DOKA 1JAIA 2W0SA 3M2TA 3DZBA 2EAOA 4EO4A 3QBEA 2CDNA 3PL5A 3TM5A 1RM5A 4BKUA 1DRWA 1GZUA 1NATA 3DV0A 3K1YA 1X9WA 3S2EA 2VJ5A 2OZEA 2EU8A 3GILA 3JV7A 4YDHB 3M9NB 2CY0A 2M32A 3AUYA 2ERCA 3HO1A 1JYEA 4B9NA 2IEYA 4K03A 3FDZB 3UMMA 2V6BA 3V7KA 3CUYA 4TS3A 4DB2A 5LWHA 5LKRA 3W2HA 4Q4LA 4P3NA 1CT9A 4HQKA 4N5NA 1GXSA 4JK3A 1T4CB 4JB0A 3S2IA 2PGXA 3JAKB 5C8YF 2HBZA 2WJZB 1TCUA 3QW4B 4OHMA 3KZNA 1FTQA 1U2RA 4U02A 4OM7A 1I9CA 1PR5A 1VJDA 2EIXA 4G24A 5EIHA 3TSOA 1R0YA 4F50A 2GDJA 1J2NA 4KI0A 3HFGA 1X74A 2PZEA 5BSVA 1YZTA 1L3SA 1DAPA 3IDAA 4YQZA 2MR5A 1NBWB 4BFWA 4KXNA 1I24A 1XUOA 3DOIA 3C2MA 3PUYA 5ILOA 4JXXA 4ZU6X 4V1CA 1APBA 3NXKA 1SY7A 1OUQA 3U0VA 3LUAA 3GLTA 2CMFA 1QG2A 2XODA 2FZLA 4EYHB 1FUEA 5KDDA 3D8HA 4F4ZA 2JH9A 2AZMA 2L5YA 4MV7A 4HGZA 1T29A 2QU7A 2ZJAA 2YIMA 2CPRA 1J1ZA 2V9ZA 3PUHA 1XTBA 2DQSA 3L1VA 2WKPA 1V16A 1ICIA 1IEXA 2AA3A 3GDHA 4KAFA 3W2IA 1RLUA 2YNMD 4BFCA 4NJEA 4EJFA 1UBLS 1FUIA 3DG9A 1O8BA 2F3UA 3GT4A 2W6QA 4D9FA 1NTRA 3O3MB 4DCGA 4F5WA 2WD9A 5K5EA 3SXUB 2QLLA 1ZH8A 2Y9MB 3AXTA 4X7PA 4TWJA 4ZT4A 4YV7A 5MFZA 1K98A 3AF4A 2KJ8A 1Y98A 2OPBA 4OF4A 2UYGA 3QJGA 2Q45A 4MP6A 4R3UC 4RFVA 4F2GA 1B8VA 1TQDA 4OJMX 1DKQA 4MI3A 4CV3A 2PT5A 2W9MA 3B52X 2BGUA 3PZBA 4Q15A 3NKFA 4EVIA 3M6FA 3BGIA 3IVAA 4NK4A 4XOIA 5J5AA 3VZRA 2JIPA 1PSZA 1SEPA 1J2YA 1D4AA 1OUMA 2JAQA 3RRNA 1NM5A 2A0XA 4NOKA 4WN3A 3HBJA 3KPYA 4O29A 1QYWA 2IWHA 1MXFA 3RI3A 5KU1A 3BQNB 3HEBA 4G84A 4LI3X 3MQ4A 4KQHA 3PYLA 1E9BA 3UPDA 3LLSA 3DPUA 2O52A 1B8PA 1ZJ4A 4Q1AA 4B6SA 3J81k 3SYZA 1JBQA 3DAGA 3IUPA 1N5DA 2HSGA 1GRQA 2P2DA 2XIJA 3GV0A 4MVJP 4P4TA 4RMHA 4RTKA 3O6VA 2UYOA 1LSUA 4CDRA 1W49A 1Z36A 5FOTA 1XHEA 2YN4A 2PMBA 3MMPA 3ETDA 4LRUA 1TM7E 5JBNA 5K01A 4KIUA 3GN2A 3EGXB 2BC9A 4NZOA 3IH5A 1G8KA 5FWXA 1B6SA 1A5ZA 1M54A 2D6FA 2GZHA 2XZOA 3MYYA 3AB8A 3K9QO 4QU5A 1YC2A 4PR0A 1Y4DE 2O6HA 1A9RA 3NPMA 5COQA 1LRKA 5HDQA 5LXTA 4RTRA 2C7BA 1ZD9A 3PNYA 4GMGA 3QWAA 3AKYA 3WGJA 4UNQA 1ZQVA 4WKOA 1HYBA 5AVQA 1P80A 2XD9A 3CC8A 4QUHA 4V0SA 4XUSA 2OHHA 2BGIA 4HY3A 5L8VA 3FD8A 5CD1A 3E8MA 3AR2A 2V4ZA 1FDUA 2Q0SA 3G9TA 4O3PA 3WQHA 2QY9A 2FWAA 1TRKA 1SVKA 2VJMB 3M70A 1KYTA 1MVLA 3PQ4A 3EDOA 4L4XA 3A58B 3OEHA 5EJ4A 4BMPB 2A9KA 1L3BA 3LFTA 2F43A 3SG0A 3WLPA 4NEHB 4NM1A 1NWHA 3A9CA 4IRUB 1OI2A 4LNUA 5EEHA 3RSFA 3TSZA 1ZQFA 3U49A 2EJVA 1PWHA 1Z4NA 1IM5A 3K75D 1SJ9A 1R27A 2IS4A 3T3HA 4RT3A 1D2EA 1AT1A 3G1WA 3IQHX 5DASA 3AU2A 3TNFA 2X9LA 3ITKA 3KB1A 2ZI3A 4JGBA 3UW3A 3IUJA 3FUCA 2ZIFA 4PGGA 4DUGD 2AW3A 2K4EA 3ABQB 3DM5A 4S1PA 1OZHA 4C8MA 4I5FA 4P4GA 1ZO8A 3ZDRA 4IV0A 2CFRA 2NO4A 6Q21A 5HKKD 1P2TA 3EVZA 2XH8A 3BWYA 3L6CA 4LSGA 5IDYA 3F97A 4PBRA 4UU1A 3KTAB 4EB6B 1NVFA 3AF2A 4RESA 1Y88A 3DTYA 1OZFA 5J2HA 4EFDA 3DWFA 4JT9A 4XCXA 2ONZA 3RTEA 1M2VA 3TANA 1PS8A 5DRYA 3O9MA 3C8DA 3RTDA 5EUQB 1U8YA 3WL7A 4N8EA 2AOUA 3H65A 1RZRA 3A6ZA 5ALTA 4TSFD 4GXQA 3T5TA 1W48A 3V6LA 3VZDA 2F1IA 1P2DA 5FTNA 2IQ5A 4KXUA 3SQOA 3CWZA 2X2PA 3VH3A 4F2HA 1RJGA 1AQNA 1OTHA 3FWNA 3OTIA 3OHBA 3GVCA 1Y33E 1F60A 3D2SA 4MUXA 5IDXA 2UU9B 5MFPA 1KBOA 3F5MA 3RRJA 1Q5PA 3DYIA 4QAJA 5KCMA 3TTUA 1KIAA 1EG2A 5BNTA 4FQ8A 8ICLA 4DF4A 2JMGA 3ROGA 5A3RA 2RBGA 1UEJA 4PSAA 1CEZA 2PN1A 4BB9A 1H1LA 3EYAA 5C35A 2O1WA 4HX5A 4TSFA 1WBJB 3PYMA 1WZ2A 4B2LA 2IL1A 2QRUA 3RD5A 3EUB2 1WNFA 3LNTA 3ZS9A 1HYHA 2R7LA 1VSQA 3QI2A 3K1ZA 3K9NA 2AN1A 5IXJA 1RLMA 3HM9A 3JVVA 2FPKA 4GP7A 5G0WA 4KHPB 1K7XB 3HR4A 3OC6A 2A14A 4BVFA 5JD4A 4ROTA 2ZJ7A 1NXWA 2PJZA 2BFMA 1NYQA 2NT4A 2EEZA 3KOYA 5I51A 4CM7A 3THWB 2PUAA 1T5DX 2H29A 2VDQB 4BB0A 1Q7CA 2HCBA 2YQ5A 5K51A 3GWZA 3MFHA 3DMTA 1TW3A 3JU3A 4FZVA 3NRBA 4W5JA 3RRZA 1XPOA 3MWYW 1YB4A 3WX0A 2D8AA 4IR9A 5J2EA 4CQLB 3WK5A 2B30A 3MHTA 2HHQA 4LZAA 1B73A 2IEAA 3B12A 7ICKA 1ZAKA 3OOYA 4OLFA 3E9RA 1SM4A 3K5WA 3L6EA 1Z7EA 5K4LA 1FU8A 3VKWA 4ZGWA 3TQSA 4NHOA 1UPFA 3DMNA 4S3MA 4W1PA 1V5IA 2ATIA 2A67A 3DA8A 4RK7A 4L9RA 1Y1TA 2B8JA 4MICA 5COAA 1HEKA 2PSDA 2B4KA 3VNSA 3P2IA 2OYRA 1AUOA 5CT8A 1OVMA 4FZLA 1UF9A 1OBCA 4FFLA 3FYCA 4N0DA 3WIVA 3K70C 3UMBA 1Z5UA 2BD0A 1VBMA 4MZDA 3F5EA 5JJKA 3KKOA 2NTEA 3VKFA 4AZWA 4CQMB 1N2IA 4ITUA 1MLDA 2BT4A 3P0RA 2OCDA 5EZYB 1SZJG 2VH2A 4E14A 1CRPA 3KZCA 2ZJFA 2DPLA 5CB8A 5AICA 3D1LA 5FNVF 2BFPA 2PBFA 2GXQA 5CDTA 2CV1A 3D2AA 2I4OA 4IM7A 1DKRA 1E4EA 7ICLA 1EGVB 1VI2A 1KMMA 2X41A 4XM0A 3ZC3A 4D8TA 4MV6A 2XYGA 2KP7A 3NLLA 3QV2A 3K9HA 3WWZA 4EKYA 3CLTD 3MJ4A 2PHZA 3NHKA 2PE5A 2H31A 3TLAA 4JDPA 2JI7A 2DM6A 1TO1E 1P3JA 4ZO6A 3ZDQA 7ADHA 1U7OA 3HDJA 4IFBA 2XAUA 3AOEC 3RU9A 1J42A 1OFIA 4TM8A 6LDHA 3VR4D 4WESA 3OPMA 1KK2A 3I39X 4NL4H 4MS4B 3EQZA 2AOTA 4IS3A 4MWTA 4RETA 4EKNB 1WU8A 4JKYA 2SKEA 2CE7A 4U2DA 2PSEA 4BTVA 1Q1BA 3GMIA 3FC4A 4YLYA 4EI7A 3WYGA 4F84A 5DF1A 4CMJA 1IHXA 2AS0A 2EKPA 3WYAA 1GZ5A 1H8ED 2V3WA 4JEUA 1XZKA 2FA9A 1EB8A 2FP4A 1AS3A 1RLJA 2IYRA 4GI1A 4YV0A 5KNLA 1WW2A 4U8GA 4B76A 2FFJA 1S0VA 2G5GX 4DEVA 1T9DA 1PJZA 1QXSA 1YQWA 4ZXPA 2JHFA 2X0FA 2RDMA 3WMFA 4OBXA 3OQOA 2PL1A 8ICVA 2YJTD 4OU5A 4QRIA 3U0BA 3NM5A 2ZM5A 5KT4A 4JT8A 5A1JA 3G6VA 2MT9A 4ZYUA 3GLIB 5T6MA 4PRKA 4ECQA 3PR4A 1PR0A 1QH8B 4HB4A 5KFWA 4ZVNA 3IL2A 5AESA 5HF5A 3PXGA 1YIOA 4R05A 4DJTA 5FIUA 2I4TA 2D0DA 3L0IB 4OQXA 2ARKA 4IHQA 2Q0QA 3SHVA 2QP4A 2RI1A 4FFBA 3KCQA 3L18A 4Q00A 4DWOA 4E3WA 5BSEA 1VZ3A 7ICVA 3ESBA 3FMGA 1ZIYA 4HPJB 1U9LA 4PFKA 1ARZA 5T14A 3PS9A 1VL8A 4RPGA 3WQQA 2Y27A 2CF6A 5U4QA 1LPSA 3K4HA 4BVGA 4XRHA 3DEHA 1MC1A 4TYYA 4IS2A 3BSSA 4K9SA 3EW7A 2VHYA 3GL9A 4QOGA 2PPLA 5E7QA 3ZWMA 1NNI1 1RZTA 1G3MA 1RWNA 4C7MA 2JBHA 3NU1A 4MDHA 1CB7A 5E0KB 5J4HA 3UXMA 3WGYA 3PNCA 5KTNA 4OSPA 3M2PA 4YREA 3OUZA 1YZYA 2H8GA 2YBDA 3OOSA 2GNOA 4ARUA 3E0FA 1FLVA 1M34A 3C3PA 4FN4A 4ERXA 3DJYA 3LQKA 3VR5D 1J97A 1G7TA 2Z2YA 2DBRA 5C0OE 4HNVA 1ZIXA 1GUFA 5D3ZA 1J8VA 4DSZA 5J0RA 5IHXA 3N0TA 3I5YA 1GL6A 1AM4D 2YYAA 1MRZA 3D1VA 4C0BA 3WMEA 4UHCA 3SFVA 2BFNA 3VSEA 4BV9A 1K92A 4AX4A 1T1JA 3HKBB 2I2XB 3M4ZA 1Z62A 2F3QA 4N7BA 4YCLA 5DTIA 4XYLA 3PMLA 2QMYA 2YN0A 2GSWA 4TL9A 3K6SA 5KG5A 1OV4A 3K15A 2HOIA 4G8CA 2PMFA 3GDFA 2PL9A 2XRFA 5E8RA 5B2EA 4JUZA 3UTDA 2CVQA 3MR3A 4N6GA 3DOHA 2HDNB 3QWHA 5ITSA 2PFKA 4KMSA 3CPHA 4HDKA 4LVNA 2XYPA 3T3EA 3KVRA 3DD5A 4MWDA 3TCNA 1B00A 3E84A 3FM9A 1W5EA 3GV5B 4EPRA 5IWCA 3FSGA 1W581 4I9NA 1K4KA 3B89A 3OWOA 1DU4A 1NLYA 1WQ1R 3LKBA 3GD5A 3NVYA 5DLGA 2WU0A 3BAZA 1TM3E 4K6OA 1E20A 2WUDA 4LIPD 3CA8A 4WBSA 5BV7A 1TRHA 4BGEA 4P32A 4CTOA 2FQXA 3GT0A 5AW7A 4C29A 1KOFA 3H2HA 4W8GA 1V3QE 4EG7A 2VJCA 2OESA 1UK8A 4AJ4A 1ZJWA 3RS2A 2XSZD 3K0KA 4DJAA 1KTQA 4C03A 3GA5A 1SG0A 4OM8A 3FKQA 4OP2A 3LU1A 1P1FA 1YKSA 2GAAA 4I9FA 5IN4A 3GRZA 3T52A 5KPDA 1O5IA 2JEIA 2HHSA 1JXQA 4GXTA 1EFVB 2E82A 5E1DA 3RUEA 3UCEA 4C0XA 3I9LA 3T38A 4Q3LA 1TA0A 1JXAA 2OAQ1 2OC9A 3FOZA 4KK3A 3S70A 2EFDB 2POQX 2XGMA 1PQPA 1E2PA 1U0GA 5LZ5A 4UPDA 4G0UA 3LK9A 5IYZA 1SOMA 2IZ7A 2Y0EA 5KFBA 1DAHA 1HNNA 2HHUA 5EMKA 3IT2A 4QQRA 3RSHA 3RSSA 1PKXA 2IIBA 3ZI7A 1Z4IA 4R0MA 1IH8A 1ZSNA 4AJKA 5JXIA 4B6OA 3OZAA 2ECOA 3ZHRA 1J9EA 4RIGA 4KLFA 4FBUA 2CWWA 1ZQSA 3TOCA 1WJGA 4BO5A 4DSNA 3OE5A 1XVLA 3DDWA 1QRUA 3PQ5A 1NFQA 4KX5A 2QV0A 4X1OA 2C7OA 3ZTTA 3AP3A 5JJIA 1N5RA 4LDJA 3CLTC 4PPQA 3T5PA 1KVSA 2WFZA 4RIHA 1NLFA 2IUYA 2PZMA 4QU8A 1YMUA 3BB3A 2I55A 4UAZA 3LPNA 3G89A 2R7KA 3AU8A 3P9XA 4BKRA 4YUWA 1G8HA 2HHHB 2OHGA 3KZKA 2EX4A 3E7WA 3PC3A 4G25A 5BN1A 4XTCS 4PYQA 3C1OA 4FGWA 1GR1A 2A9VA 1NVWQ 2QU8A 5K20A 1JDBC 3I32A 5GM1A 3F6PA 8ICYA 1MQSA 4JJIA 1X15A 4QBTA 7ICQA 1IOZA 1R0KA 1UMBA 1XLVA 5BWCA 1LW7A 4LFBB 3OETA 4I1OA 3MFYA 4P80A 4MV4A 3WB9A 4F6CA 2CLDX 3SHQA 1DK3A 4U5XA 1U49A 5GZ3A 1EFHA 4HFJA 5KOHB 1NK6A 3OY2A 3H2IA 2YRWA 1FVHA 1B26A 3W8FA 5FUMA 3F5FA 4R5HA 5KFAA 3AF1A 5DN9A 1F2DA 1Z0KA 3QFSA 1E7WA 1P7VA 4M46A 2QSYA 4EARA 3ZLJA 2PRKA 2YX8A 3PXAA 3UUEA 3HKCB 2ZR0A 4HAWA 4I99A 4ZP1A 2ZS9A 2D13A 5F1PA 2VP4A 5IBPA 3C23A 4YR0A 4UAWA 2YWEA 1TZCA 2F9FA 4DIMA 3V7LA 5D8DA 5A71A 4PTLA 4G0XA 4PBSA 2OV1A 3K0CA 3K8OE 4MA5A 4OA5A 5DLDA 5J8YC 2Z6VA 2FWJA 3MLBA 3ZDBA 1P31A 3Q98A 3BS5B 3PDCA 5EZYF 4C0WA 5CA0B 1EESA 3N4MB 5SZIA 1NONA 4RVNA 5FOUA 2FZGA 2OOKA 4JL8A 3OJSA 4EB3A 2XUKA 3ANTA 3ECAA 5LA6B 4BKOA 1C0KA 1OI3A 1JWLA 4CL2A 1ZVKA 2RHHA 3SNKA 1ZQGA 5J40A 3O4IA 2LE0A 4OIFA 3J7TA 1XLUA 3WS7A 2EZTA 5CIQA 4C3VA 3OIVA 3CEPB 1NW8A 3SE0A 5JQGF 5JEEA 1VIDA 2XPCA 3IXMA 3FWZA 4KXQA 3SX4A 5BSTA 4NMWA 1IZ8A 5BSGA 2VHXA 4CLOA 1CP2A 3S8MA 3FOFC 4YASA 4BZQA 3QMWA 4PZ0A 3U5ZB 1R4NA 2ONJA 3VR0A 4EUSA 3H3FA 2WA2A 3H0EA 3THYB 4AAYA 5T4BA 5TMEA 4LHSA 4ARVA 1AURA 4ML3A 3GIWA 4UREA 2H2AA 1B0AA 3SCZA 4Z4IA 2AJBA 4X24A 4MWOA 3AEQA 3TOZA 4ZTZB 1DQNA 4D96A 4IFEA 1VCHA 3PE3A 2X3YA 3P20A 3DCIA 3ZQUA 3EPHA 2BI8A 4J0KA 5A0VA 4J7UA 4RVHA 2HQOA 4L0QA 4CKCB 1NJGA 4FFDA 2O2ZA 1R3UA 3ASVA 4C1NA 4W5OA 3LHSA 4LQCA 3HX0A 1BCRB 4OH1A 1EJ2A 1T1IA 5AI5A 1TU4A 1JQKA 1PFVA 3HZOA 2A3VA 5DM4A 5BN5B 5LLTA 2R8OA 2XF2A 2H1HA 4RBNA 5J29A 4JYBA 4QEZA 1WCXA 3RHTA 4H7FA 3LTNC 2GMWA 1FCJA 2FR0A 2Y1GA 2C9BA 1I01A 2RK4A 3PC6A 4ABYA 1ZD1A 2AFHA 4MW2A 4P34A 5CFPA 5KJ1A 2P5TB 2HF8A 5DNUA 4RUAA 1WKCA 1B42A 4X8LA 2ZITA 2ZANA 2E8PA 1OLXB 2G9VA 2GOYA 1RPTA 4O3RA 1KPHA 2H6EA 3HYSA 2C61A 2FAXA 4FFWA 4CEJB 4O4IA 5CJ7A 4MHOA 4Q4CA 5KNCA 1NVUQ 5F98A 4D6XA 4QIWC 3L5OA 3VGPA 4M9SA 4FCCA 3LVQE 5MN4A 1E5DA 4J9RA 4G41A 1Z6XA 4JP8A 1YZ6A 4C4SA 1NVKA 2CW5A 1TUBB 3NETA 2ZCVA 5DGIA 2A1UB 1QHHB 2HDHA 5JZVA 3L6DA 1L1QA 1Z5OA 3K0AA 3ISBA 1HFWA 4CFSA 3THOA 1SXJA 3B9BA 2QENA 5DBAA 3DPSA 1O6ZA 2N46A 3N59A 4LQDA 1NQAO 3ROQA 3UV3A 5KZMB 1VFNA 5J2KA 3OBIA 2HB6A 5IVKA 3NRWA 3JAWA 2F3SA 1L4FA 3BWDD 2P5SA 2PMZC 3EA5A 1MTZA 3ETHA 2XA2A 2I2WA 5C1BA 2GEKA 4JQSA 2CMDA 16PKA 3VSAA 4OA8A 2UZAA 1JXMA 1XL0A 2XGPA 2AFIB 3TQIA 3L7OA 1RXSA 3QMMA 3DVLA 2PKQO 2QJTA 5D01A 1QYIA 2XNDA 3RVRA 4AXBA 4CM5A 4ZOLF 1J0EA 1N0VC 3DAHA 4LN1A 4CMAA 4D3XA 4D42A 1YA8A 4LW8A 2J08A 1T0IA 3PL1A 1ZQHA 2BQUA 3SVTA 4DL6A 3TLKA 1R1DA 4CT4B 2C1ZA 2VNSA 3JD0A 5J4VA 5IBCA 1VI6A 4RZQA 1RQNA 1SRRA 1TM4E 1FSZA 2FMQA 3PHLA 3EQ6A 1C9EA 2VDLB 4LRQA 4ENQA 3PR5B 1T5IA 1YE5A 5CLJA 1U28C 3ED1A 1WV0A 5LLSA 5HE8A 2V9CA 4DE5A 2FLVA 3T35A 4YFYA 3MCVA 5DI9A 3WSWA 3VO1A 1AQYA 2GARA 3G2QA 4JCCA 3NKLA 5EIBD 2F90A 3FE2A 3QIVA 3SPXA 2A5JA 3VV2A 5J2UF 2YW9A 2FUKA 4QSMA 1YVDA 2P62A 4BVEA 4KSYA 1ZVVA 2BRUA 2DETA 4I50F 2DCMA 2MJLA 3DOJA 3V8EA 4Y2UA 2OD9A 3MPOA 4QDJA 1U47A 3JYLA 3NRCA 3N7PD 2WVHA 4RD2A 2E1FA 1W4LA 2N1BA 4E31A 5IDVA 5IVPA 3R9XB 4BQRA 4G97A 3T5HA 1GPYA 2EYQA 2JA1A 1PHPA 4KBYA 3QFFA 3PGVA 3IE0A 2PLNA 3GLUA 1ZQAA 4HZUB 1UC4B 4H7EA 5TGDA 1XI2A 1KOLA 3NPAA 3OEED 2RC6A 4GO1A 4XJTA 5GV7A 2OVFA 1YHNA 4JIGA 1QONA 3KHLA 2IYNA 3L84A 3IUMA 3O26A 5FOVA 2I2CA 3H99A 3ZBUA 2V7XA 2FX3A 3SHOA 4H18A 3QVUA 3I73A 1SVUA 1DXOA 1U9JA 2XQGA 3U17A 5JJBA 1CJVC 4YRAA 2QG9A 2FUCA 4QXAA 3QE4A 3N2YA 1HEIA 2BKAA 2CXPA 1A0OA 1H4TA 4FN5A 4KNVA 2QDXA 5K2MA 4DC1A 5DXJA 1F20A 3T9DA 2ODWA 3NGXA 1N5XA 3EUFA 2ZSBA 3FCXA 3TE6A 2YMPA 4Q12A 2QD2A 2QZ9A 2CKDA 3EMDA 1M1XB 1A71A 3DE0X 1DKNA 3PPXA 3PXCX 3ZVMA 1DRGA 4LV5B 4JYAB 1M76A 1PR6A 2PUHA 1XD9A 5CYOA 3SNHA 1MQAA 4NNOA 2MSNA 1ZYUA 3IDWA 1O9HA 3V33A 1CSEE 1NT2A 4K2AA 4B3XA 1GTRA 3BZKA 4QWDA 1ISJA 3WHPA 1HUQA 2UXCB 2DWQA 1Q84A 2QJOA 4MLCA 2HBJA 3W79A 1RTTA 3ZZMA 5LZ4A 3NVVA 4GX5A 4MS3B 5EINA 1LPOA 1IB6A 1ZRNA 2H2FA 1ZN8A 4R8MA 3AHDA 1WBDA 5EL0A 1SVMA 3U4GA 4HLDA 3KJXA 3LDHA 3MD0A 4KYTA 4CIYA 4OAOA 3VR2D 3OIUA 4HGPA 1NVAA 4KU4A 2ONKA 4TYPA 1HRDA 3KV3O 4U7JA 4BNVA 4BCDA 3WJ7A 4C0JA 4DEYA 5C5EA 3WWOA 1UOEA 1ZOSA 2EDCA 1NW5A 1G18A 2FPPA 2Y8EA 2VHVA 2J7PA 1W8DA 3KHKA 3PX6A 3NEYA 4DMHA 1YC5A 2XGQA 1XRRA 4QM7A 1MF7A 1T91A 1Z15A 3D6AA 4DIOA 3D4IA 1IY9A 4HYKA 1HDYA 1E8DA 1QSLA 1ZL0A 2ISOA 1QRAA 4N01A 1TVCA 3HDVA 1FFEA 4RY9A 3ZDYB 4AYBC 5EHQA 1R5BA 2C2WA 3SDSA 2AGVA 4CU5A 1QIEA 2H2HA 3UJ8A 5B7GA 1NU6A 3B7WA 4B5KA 1AUVA 3IAS6 2ODGA 4R8UB 4X1KB 3RREA 3EZFA 3KKMA 5ELLA 5A3SA 1CS0A 5AXBA 3QU7A 2B5OA 2YS6A 4QG7A 1KAMA 3TIFA 1MENA 3QBJA 5AFSA 1VPEA 2BR4A 2FVYA 1FL9A 3FYDA 5E2BA 1NMYA 5I9IA 1NV9A 2R8RA 1Y42X 3NOXA 1ZM9A 4WIAA 7ICNA 1TLLA 1YS2X 4I19A 3GRAA 3BHJA 4MQFB 3U7QA 2R00A 5L53A 1EWYA 1SC9A 4RMJA 4CM4A 4I3FA 1I6LA 3GZNA 1I4EB 2K8CB 2CXQA 2JKYA 2WKSA 3HJTA 3PT5A 3WK7A 3QYAA 4BKPA 2P8SA 1AKMA 1ZK0A 2Z3WA 1PFUA 2WJVA 3NAMA 4W6ZA 4ZPXA 5LD2B 4Z4EA 3FGZA 2D8CA 4URWR 5F4ZA 1P7DA 2X1MA 3MMNA 3L05A 2X5KO 4J4BA 4N03A 4XVQA 4YP7A 3RVSA 3W3AD 3NHMA 2IYQA 3T1VA 5TQ0A 1HQKA 4FWIB 1LC3A 1DIOB 3V1UA 4B2PA 4C4XA 1LDEA 4OKIA 4ZI3A 4DHWA 3FPHA 3IP5A 4DSKA 1SKUA 3X1XA 5AW4A 3GLGE 1HDIA 3DLHA 2O8FA 1T36B 3PPIA 3CUVA 4JR2A 1KF0A 2PKQP 4UPVA 4H6XA 2W9AA 3UAVA 1AO0A 2CGEA 2FGJA 2Q41A 2B82A 2QARB 1LCIA 4OG2A 5DSXA 3E9MA 1NM5C 4I1RA 4AYWA 1JKIA 3LGAA 2J0EA 1RJEA 3S44A 3H11A 2DE0X 3E9DA 5E95A 5EXEA 1MMFB 5H68A 5IP5A 3VSDA 4TKMA 4FW9A 1HK7A 3RFFA 1WOYA 4RTSA 2WTMA 1M1ZA 4CM8B 1TJ3A 4PVCA 3U16A 2QUAA 2P9HA 2JZBA 1ZGJA 1QYDA 2YRXA 3PDWA 3QENA 4L3VA 1CS4C 2XUDA 4LSZA 5EHIA 3RASA 3ZGNA 1GG5A 2GVDC 3NBFA 5F1KA 5FWDA 5B3KA 7MDHA 3RBDA 1EFCA 1MUUA 3UQ2A 2PCJA 1R9GA 2EWMA 1V48A 4I2FA 5ALHA 1JQBA 1D2MA 3IBCA 5D5QA 1NBAA 5JASA 1SXHA 3NHBA 3QYPA 3AM5A 1KFSA 3PXXA 1I3LA 1Y5LA 3AFIA 2O2GA 2H00A 5KT6A 1P91A 1JEOA 2ZIEA 3RIYA 5FA8A 4D45A 3H1BA 1XNRB 4BV2A 5DDYA 4KMOB 2XWSA 1R00A 2UUPA 1UCFA 4UAGA 4BMVA 5GAJA 3VSBA 3G2NA 1QBGA 5AM5A 1E0AA 1OPRA 5JT1A 2DB3A 2WHRA 1UWLA 2WJAA 4QUKA 1CY1A 5DKWA 4ZAYA 1N5OX 3WIBA 3KKQA 1OH7A 3GLIA 1RFLA 2R6GA 3OD1A 2GZDA 4JHLA 5GJVC 1XMOB 1DAKA 4YTEA 2BEKA 4UBJA 1FBTA 2R11A 2O5RA 1F0MA 3AFHA 4KDFA 4UXIA 5JMWA 5IRCD 5DP1A 4J9UE 2PAAA 3WWDA 2J5BA 1B14A 2WG2A 4L85A 2LRHA 5DX0A 3TIGA 3TZCA 2A33A 1XDWA 4I66A 4S1WA 1E92A 4HYQA 3ZJUA 5ALLA 3CRMA 4DCOA 3F8WA 1NBMD 3JATB 1YZ7A 1A9XA 4N5LA 3G6XA 4EFNA 5G4KB 3U6BA 1MO4A 3MINA 2PUTA 4H0NA 2O6LA 2AOTB 1VKOA 3A3NA 4DW8A 4DQQA 2JLWA 1OWLA 3OD5A 3HXTA 4IIYA 4HN2A 2Q5OA 2HDWA 2PH5A 3FDIA 5C1IA 4HVAA 1N60A 5A4AA 5A5GA 1T6NA 1DGJA 2WF8A 1AZWA 3CRW1 5KTYA 1VPDA 2VPWA 4TPKA 3SS7X 4ND8B 1QKKA 2REQB 3SV4A 3HBLA 4UNNA 3RGWS 1KC1A 4IZ6A 4IIHA 5KFCA 1U5AA 3DNMA 3R3XA 4CJXA 3HCDA 1C4OA 1XT6A 1CQWA 1RIIA 1ZQYA 2RGCA 3AM3A 3OAAA 1PWEA 2NVWA 1BVRA 2W4QA 4MUHA 1ORTA 2A5FA 2NOAA 2I6FA 3RSGA 5C8YB 1Q3VA 3TJRA 3ZD7A 1CNMA 3VJMA 3T3IA 4G2TA 4Y1RB 4A6XA 4HXEB 4DV6B 1D8TA 2A4KA 5F1OA 4LJ9A 2D00A 2EGGA 3DSRA 1OGJA 4Q03A 4DTCA 4Q4HA 4WOJA 2GEUA 5JRZA 1HYQA 5T3UA 4FDUA 1JWBB 3OJXA 3GJ7A 3I6ZA 1EJ0A 2BMEA 1JSLA 2QRPA 1SBNE 3OF5A 4CLHA 4DA6A 9ICIA 2RHFA 3GIMA 3E5RA 3UHAA 1OI4A 4E08A 5CLFA 3BH6A 3HQ4O 1CZLA 1L5WA 1X19A 1WYGA 3HABA 1ZMTA 5BV1A 2O8BA 4C7YA 2GGSA 2ODNA 3PIDA 2ZS7A 3TX6A 3DKPA 2P3OA 1TFRA 1RLTA 4RXMA 2R751 3THSA 4ESVA 1MG5A 2B5VA 4ND4A 4RM3A 1C4XA 5DCUA 1XZ8A 3NM6B 4OSEA 1EFPB 2IU4A 3ESYA 4FDAA 3MJCA 4JELA 1D5CA 3KSMA 3WLNA 2ZWVA 1NOKA 4QPPA 4B9EA 1RE1A 4TKVB 1Z2OX 3UJ9A 5GOTA 5F3DA 5KWIA 3M6XA 1VM6A 3FB4A 4BVAA 5LUAA 3PC4A 1QP4A 4RZSA 2DT8A 1NF9A 1J23A 2HIGA 2CLOB 2OV8A 4D6PA 3RU2A 5EWLB 3I6MA 3X44A 1IVYA 1G9XA 3C6MA 4J1SA 4Y0VA 3G2OA 3TQHA 4F21A 1G8YA 3NBQA 3STVA 3ZXYA 2AWOA 1IXRA 4CLXA 5HUQA 4GOOD 4GMXA 1U2SA 1VHJA 4CZ2A 3K0EA 3FPCA 4IFIA 3UK2A 2XY5A 4K9KA 2M9MA 4OI2A 1C1DB 4CN8A 5BYAA 3SZUA 4PS1A 3BTVA 3HL0A 3O03A 4PZCA 1CDEA 2FHPA 1E89A 3OM9A 1W87A 3TTSA 3OCJA 4X6XA 2R8GA 1N0IA 4LOKA 1F0NA 1SKMA 1QG4A 4RUCA 3FSRA 3LC1O 4O25A 4YIHA 3JASB 1RYZA 2Y1LA 4NU5A 3QELB 3ZW9A 3MJHA 3DP7A 4EL0A 1OX4B 3MRTA 5JZOA 2W0MA 4UTXA 2OGZA 1H2HA 1PYDA 1HKHA 1Z35A 1SUDA 4ETIA 4BY9E 8ICSA 3H83A 1ISHA 3RJHA 2FFHA 1L8OA 3DBHB 2W8KA 4BU1A 2IFTA 4LNAA 5THXA 1F6BA 2Q3BA 4NE9A 4R1PA 1BWSA 1E3TA 3IB3A 2NPIA 1N5JA 3C5CA 3KSRA 2E2WA 5I9NA 4HYEA 4IHAA 5AI0A 4KLOA 1BW9B 4V0OA 3UQYS 3I2KA 1F1BA 1CUJA 1BO6A 2J6CA 3M6MD 3PJDA 4YJ3B 3D2QA 2OXFA 4IQ4A 1AGNA 2G28A 1Y89A 3I5UA 1KWKA 3J7AC 2BEJA 3TI9A 3HJCA 2AG0A 4HX2A 3H7AA 3TFQA 2E1PA 4J4TA 1XTKA 3U7QB 2WAOA 2HHXA 3N8GA 5AVXA 4ZIRA 1TA4A 1PVDA 4R51A 4OHYA 4G5FA 4X7BA 1S5LU 2D06A 1NOJA 1T13A 5A6SB 4UCQA 1IN5A 3WIUA 1KPIA 4MVJA 5E9JA 4KFSA 2O8FB 2G8NA 1ZI8A 2J7KA 3OLVA 4RWEA 4D9NA 5EJIA 1V41E 1QF6A 1DO0A 3KFVA 4U7HA 4WHMA 2PZ8A 3KXIA 1ZCBA 2I54A 5TQ0B 3VNRA 2EW2A 2QL9A 3EG5A 3VVCA 2VYVD 4QGAA 3JX9A 3Q2KA 4RVDA 1R66A 1JQJC 2WAQC 3AC0A 3T7AA 4ED1A 3OTHA 4OXQA 5EN4A 4MIYA 5ADVA 2VA8A 1G5PA 3FNGA 2C9YA 5BO5A 3UXEA 3UKDA 4GZLA 3RUFA 1GT91 3R0IA 1HE8B 1PW7A 3QZUA 3SY8A 4KMUA 3U7EB 4Q39A 3IPYA 1E59A 1CWUA 4XQCA 2OORA 1IV8A 4V24A 2GJKA 1R4AA 4ZVVA 2QRGA 4Z3OA 1DO8A 1H9AA 4C8OA 3E15A 2OFFA 5KHOC 1JJAA 2YXPX 5KYWA 5CLHA 1VCNA 2VLBA 3A6KA 3BGVA 1KQNA 4DGQA 3PK0A 2CJYA 3K0CC 5JNVA 3CLKA 5GTIU 4RCZA 3K8YA 4CF5A 3QM1A 5AI4A 3L8FA 5F33A 5AKXA 1GV1A 2LCFA 3PXDA 3V4LA 5ISMA 1Q17A 5L7WA 2WDPA 2ZUUA 3SS8A 1ZQEA 2ZPUA 1OCEA 2I7XA 5JVDF 1UWKA 1EGAA 3BSWA 1IJBA 5DGBA 1WHSA 4TN5A 1SZPA 2CMKA 2HBMA 9ICAA 2JCBA 3A4NA 3U61B 3DUFA 4B3RB 2O5CA 3MSCA 5JQWA 3UWMA 1GG2A 2PLRA 1GRRA 2OQ2A 5KTKA 4IJWA 1A9XB 3MMSA 2BGKA 3UXOA 2X77A 1BQEA 4M9ZA 1IC6A 2VUSA 5F21A 4USAA 3Q8RB 4AG6A 1X66A 5K6AC 3PLNA 4CCHA 3HCCA 5BN3A 1KNXA 2J0SA 1I2BA 1UK7A 3ETNA 4CFZA 1UBHS 2QT0A 2QTTA 1SD1A 4UB3A 2WR8A 3L4SO 4HO1X 5DLEA 3NHJA 1MO6A 2W37A 3C8UA 1DT3A 4KOAA 3U6KA 4DQDA 1QDEA 2AG5A 3N2LA 4ACOA 2O07A 2A9QA 3H97A 1L3IA 5D86A 4EI8A 1V39A 3BK2A 4Z54A 2C7RA 4YMTA 1ENOA 4IJ6A 1BYUA 1UDXA 1U4OA 4ENRA 2G40A 3C6BA 3LGSA 3CGGA 1G0OA 3GV7B 3BB4A 2OCYC 2WI8A 3EPIA 2WUWE 3NWBA 4MGZR 2XB4A 1SXEA 1EK1A 2EKLA 1NBEA 4ASUA 2J41A 2BFEB 3HEMA 4EJSA 1A8UA 1P77A 2FWRA 3X2SA 2OXIA 2V54A 1J0DA 1X9XA 1JHDA 2AX3A 3IAS1 5HM8A 3I9OA 3RB6A 1P1JA 1Z2PX 3KQPA 5FUYA 4M9CA 1S8FA 3R76A 3DOFA 3H8JA 2W4IA 1QWSA 4PC1A 3RYHA 1DRJA 2QG4A 2Q49A 2O4CA 2WIBA 3NHUA 3PVSA 3W5HA 5BXYA 3DHYA 2CE2X 2QYOA 2XX3A 1N33B 3G7UA 1ZYQA 4PIMA 3PVXA 3GAAA 4YRSA 1FTYA 2HWXA 4BFXA 1HOXA 1T3HA 4GDFA 1BAPA 5CTAA 2CK3A 2WHPB 3LK6A 5FBKA 5GJCA 1JPVA 4IJKA 4E4YA 2GBFA 4K46A 3DV0B 3KKKA 3KHGA 4TZ0A 3U4DA 3S3TA 2DERA 1VLJA 3CF4A 3WISA 1GQSA 4WKPA 2QRNA 1H0KA 2CEAA 5HW0A 4KQKA 1SL1A 2QTNA 3LOPA 3BQ9A 1PJ2A 3GCXA 1FP6A 1OOEA 2AI3A 1LJLA 2FDXA 4NTZA 3TIIA 4B8YA 4DLWA 2ZFUA 3MFIA 4MRMA 1OGIA 4TV9B 5E3IA 1QB8A 1NL3A 3LUKA 1NNEA 4PGYA 3NRZA 3QVLA 1VYUA 2H06A 2A0FA 3HFSA 4ZYLA 4KJXA 1YUNA 3V8RA 1SWVA 3QOWA 2I76A 1T9GR 4BXOB 2XNSA 4X63A 4LXTA 1QUFA 3U7GA 2HMTA 4IVPA 3FZNA 3AFMA 2ADOA 4FPXA 5LDHA 2GWSA 3FETA 3OCUA 4IDHA 4ZU1X 1LDYA 3AIOA 1XVTA 4I6GA 4J07A 1TAMA 1A5BB 3RRFA 3K73O 4Q9AA 3TMYA 2W2XA 1KHHA 2ZYIA 1CEXA 3DKIA 4UOZA 4HMPA 4ISBA 2X6TA 5A4DA 4EYOA 2ZR7A 4YT5A 1U11A 1QCCA 4RGQA 2PX0A 3RFVA 3CRNA 1LPAB 3FKSA 4YAGA 4Y2TA 2GPTA 5TQ2B 4DMLA 1LNSA 4F4DA 3DF7A 1CJKC 1RKBA 3O8QB 5GVRA 1U5BA 3CN9A 1GADO 1OLSA 1YJXA 3CW8X 4JI7B 4B3GA 2J31A 4C22A 3H5IA 4WSOA 5FV4A 2X40A 1BHQ1 5IANA 1OKKD 5LFAA 3LK7A 3IFSA 2I1QA 3B20A 2YXBA 4XRRA 3BFJA 5IXSA 3IJPA 3OZEA 5C37A 5TEWA 2JLZA 3KZVA 5NULA 2QI9F 4U2FA 4EA9A 2EF1A 3GLFE 1ZQRA 1NKBA 3WR5A 2WJ4A 1JEAA 4ARZB 1ZQLA 4C1BA 5D3QA 3RE1A 2G1PA 1RYBA 4MUJA 3G23A 5EKTA 3TAQA 2GNAA 2X8AA 3NEAA 4GC9A 3MOIA 5F5LA 1E9EA 1NPYA 1QZZA 3F6YA 4IDQA 3SIPA 4H59A 1Y1SA 1YOBA 3HCWA 2Y6UA 4YV1A 3ZX5A 1T5LA 5I3ZA 1WD7A 2CNOA 3ZGYA 4ZODA 2UVPA 3EN0A 3ANMA 3PHBE 4JSTA 4QDTA 3DVAA 4GQAA 5FJIA 5AKJA 4QW8A 4H7DA 1A2OA 3TO5A 3BULA 5CXQA 1JBEA 2VPXA 2H54A 1NUSA 1C9NA 1PJ4A 2NO9A 3D2CA 3EXHC 3VPXA 2RIRA 3MMXA 5L3QA 2IYUA 2D3WA 1HE5A 2CL5A 3ZY4A 1WETA 5E9AA 4DQVA 1NDQA 3DT6A 4GX2A 3HI4A 4YRKA 2RHRA 4M8KA 3CNEA 1IHUA 2NO1A 4MAFA 4Q3BA 4UMVA 4YI3A 5K0LA 4BEBA 5J4YA 2PS3A 2FETA 5F7OA 4GE3A 2BH9A 2BWJA 3F5AA 2YZMA 3AVOA 4MR7B 4XJXA 4ZVOA 2XJ9A 2ZYSA 1FVFA 3NCTA 3MUNA 1GTSA 3ODGA 1WMBA 3C15C 3AHJA 4N3BA 2MSLA 1OU4A 5DBEX 3VYSB 1M6VA 1UEXC 2P27A 2A78A 2JS7A 3NFRA 4BNDA 5JNRA 4Y9TA 2NO5A 3IT0A 4X1IA 2HMVA 4KQWA 4B87A 3NP7A 1QF9A 1VSTA 3OZGA 2VYNA 3L5KA 5J2CA 1OROA 3SZRA 1C9KA 2YN2A 2P9QA 3WBKA 5DLYA 3F8TA 4CN9A 1LWNA 4L4UA 3UV7A 4M0PA 2ZI7A 2XNHA 4LV6A 1NJ8A 5IIMA 3DV2A 4A0FA 4BN0A 5IVHA 1G63A 1XO0A 3IAM1 2VQFB 3U7HB 2P6UA 1N1MA 4E0DA 2CFSA 4K9MA 4WBNA 2XQIA 3H5WA 1UMBB 4I6JA 3OZXA 4M98A 4HX9A 4Y1EA 4JJ8A 3RIEA 3KL2A 1SAYA 2IHKA 3MVEA 1NKSA 1F2UA 3HP4A 3R3WA 3FMIA 1BH6A 1SC3A 4QOIA 2C2MA 5F7ZA 3ILSA 2NUAA 4DFDA 3DCNA 5JJLA 5I9TA 4ODIA 3HG7A 3W6PA 4BMDA 4TLDA 3B3JA 2FMHA 2Q6TA 5CK4A 1OJ7A 3HKCA 3OJEA 2XTJA 1WHTB 3RTAA 3CU5A 4XM2A 1QIMA 1L7DA 1G1AA 5BWNA 5EVJA 4YYZA 1GPWB 3NIFB 4QUAA 1D2GA 1EFRA 1GFWA 3AUOA 3NR2A 4H3SA 5HRUA 4RH1A 2PBRA 2M9NA 5IARA 5JARA 3RJ5A 3RRXA 1USGA 4KN4A 1D5WA 1OW3B 2P90A 5DE3A 4H6VA 4TQRA 3EHEA 2UUAB 5JSFA 4CM9D 1RQLA 9ICJA 1O0CA 4L6AA 5FYQA 5GZ1A 1EE2A 1P4JA 1JECA 1KJWA 3O95A 3UJAA 5LQUA 3ZCUA 4HF7A 1GPKA 2GAFA 4JVLA 4HKTA 4DQSA 1QQ7A 5H70A 1ZK4A 1D8LA 1GGNA 1DWPA 3UMVA 2X8WA 2L2QA 1PZGA 1YR6A 1PT5A 2OCIA 2RONA 1FFCA 3HNOA 4DDHA 4FS3A 2BFCA 2ZBQA 3DZDA 3Q5GA 2VDWA 2I33A 1II0A 2XUPA 4LPKA 4YR9A 4ZI7A 3I62A 2GAJA 2OORC 1HC7A 3O47A 4PVDA 3V7WA 1BE1A 2BPGA 4D5EA 4D9KA 4A15A 3AEVA 2REXB 1QJCA 3DONA 4JAVC 1UBUS 2DECA 3DZGA 1F0KA 2ALJA 2XTNA 3ICPA 4OHCA 4Y18A 4G5YA 3D3WA 2PA0A 1KY4A 1DBVO 1M7HA 3SKYA 3QPWA 4OVKA 1CQPA 4DA9A 1YKGA 1LZLA 2I66A 2IYEA 4Q02A 3ZG6A 3UV6A 1OLSB 1U45A 4GVLA 3OLXA 4HFMA 5F51A 2MMCA 4OPMA 3ZNQA 3ZQJA 5IG2A 1I1NA 3QXHA 1UUFA 3TQOA 1BXRA 1RMYA 1RU3A 4OXYA 1KP9A 2QRJA 2JAWA 2VDJA 1R6UA 3R5TA 1JTEA 4MIKA 5E38A 3GW8A 3RC7A 3SLRA 4B81A 2RAUA 2WP0A 1Q0SA 1WMDA 2J67A 2VWGA 3OSUA 4LECA 5HOEA 3OCWA 4S04A 2XQJA 3CZ4A 5IAJA 2NVUB 4NULA 1ZKMA 3UB2A 2UZ4A 3ETJA 3KWFA 4J0CA 2W9BB 1SBIA 1N0HA 1VLVA 1X40A 1S3FA 2D1SA 5IJ9B 5E6RA 1L3UA 3EXHA 1JHQA 4BXOA 5KNCH 4ZCTA 3PV8A 1OJLA 4FMDF 2FV8A 1TKDA 4ZCSA 1IU9A 1LRLA 1VE3A 2HU7A 4C0KA 3RQIA 1KOGA 3HY3A 3IMKA 2YJ6A 5CT9A 1OIXA 2EBHX 1DKMA 1JDSA 1M2OA 2VEDA 2YNMA 1DOHA 3NIDB 2UZ3A 4E30A 6REQA 3HBFA 4UUNA 4WAUA 2IDJA 3NIGB 4CG0A 4DDUA 2N3ZA 3OE4A 4AMZA 3VDRA 4I3HA 1R4NB 3KOMA 1LX6A 2PZKA 2ZSDA 1Q7RA 3DT9A 3A32A 4HDAA 4HLCA 3BEOA 2Z09A 4LCBA 3ZJTA 1FJGB 1H2RS 1R6VA 1JEYB 3W5SA 5LC1A 4EGQA 1PCXA 1GO2A 2ZYGA 2MINB 3N6XA 4BJ1A 4FFRA 3SX2A 1QQBA 5EHGA 5T67A 4BB5A 1POXA 3P9SA 3BREA 3V46A 2W6NA 3A4TA 5CA7A 3A0BU 2R8JA 4RZRA 1A4IA 4E3ZA 1FLNA 2VAWA 3AI3A 4KN5A 4X8MA 3UG7A 1Q3HA 3RKUA 3DZIA 1A9YA 1P1CA 1WKVA 2DKNA 3WLJA 3H0RB 3V72A 2YZKA 3KEMA 4QODA 3BJMA 5ICCA 1J00A 1LBTA 4JWTA 2H1SA 3TZ6A 5BSWA 4CLRB 1FRVA 3E9EA 4LMPA 1SXDA 2CXYA 2BFBA 3GJ0A 1S2LA 3BE5A 3EFBA 2C4VA 3PW0A 2W90A 2HK9A 4DA0A 4AP9A 2G9UA 5BNFA 1A5SB 4DLNA 4PNPA 2NRZA 3DD1A 1TF2A 4JOBA 2EZ4A 3AUKA 3QTBA 2C3OA 3FI9A 4RPLA 5DCWA 2EL9A 5FF9A 1Z19A 5JJ5A 2YR0A 4ZZ0A 1YTLA 4QARA 2C83A 2D1TA 1GG8A 2ZIVB 1J0XO 2IW1A 2YUTA 1VE9A 3EGWA 2ZVQX 1O94A 2VTEA 4YAWA 2NV6A 3WKEA 3OO0A 3VYTB 3OJUA 1KU6A 1XTPA 3NJ4A 2F3PA 2Q1WA 1M75A 3HWTA 1XNQB 5M29A 4CIBA 4FTWA 2ZSKA 4E5MA 3CINA 3GAZA 3JQBC 2V5UA 4M36A 5LDGA 3CRVA 4YC7A 3V2HA 3DBHA 4GQBA 2DTEA 4NBLA 5G1PA 1KMHA 1I7LA 4TQSA 5FP0A 1DC3A 2OFOA 2PO7A 3GR6A 1BE0A 2RLTA 1R6TA 5EJ2A 3NVKI 5EMNA 3DXYA 3I6BA 3E35A 4RPYA 3A1VA 3AVPA 4MVYA 4O08A 1ISFA 1E64A 3K5PA 1RVV1 3TK1A 3AN1A 4BNGA 3HEAA 1NK7A 1CUYA 1T8YA 2LDXA 2CRXA 4KLSA 3C5EA 4UU8A 4W4TA 5DHUA 2PJDA 1YS4A 3AJDA 4ZOLB 1SNYA 3LQ4A 4RIIA 2Y76A 1PK1A 4I50A 1KAGA 1U5CA 1P6UA 1ZWLA 2QTMA 1X1AA 2PD3A 5CM2Z 1GGMA 1LI4A 2M6SA 3G1TA 1D2RA 1D4OA 1GNLA 3P4XA 3VYVA 4KTVE 3DVSX 2DHCA 5C5IA 3RHZA 5J1TB 2FOIA 1NI3A 3PUWA 3RVMA 4EHAA 3RAPR 2H2IA 1H3EA 1IXKA 4YCBA 1I36A 4A16A 2V0NA 3GPCA 2LYHA 1MP0A 3HNPA 5CBKA 1MV5A 1HE2A 1O8CA 2CYAA 1QO0A 3L3BA 4H35A 3HCRA 2O5EA 1IQRA 1G5TA 1I7QB 2RP5A 3GT7A 1XZMA 4PXSA 1PG5A 3DO8A 1RBQA 1TUGA 5DZSA 5F52A 3EIOA 1Q95A 3CCBA 3FNQA 4TZKA 2BUAA 3O1LA 4EATA 4F4FA 1D4FA 4B5LA 1KZHA 3IJRA 5JAPA 1VDVA 1Z39A 2QAGA 2GWHA 1ZW6A 4IP0A 4IUCS 5PGMA 1DK2A 1A4UA 3NDIA 2I65A 1JIKA 3B1ZA 5KSPA 5A3JA 1Z5NA 3GGOA 4GI7A 4JU9A 5GOZA 2AFHE 1P9WA 4H4CA 4KH1A 1NK5A 1W88A 4A8JB 2NP6A 1M66A 5F4BA 3BQ1A 5HR7A 2QJRA 1RXUA 4MVJH 4S1VA 3T1OA 5A6SA 4AZ3A 3RYTC 1DRVA 2R8HA 1VBKA 2BDEA 5TV2A 1RADA 1DZIA 1GCAA 1WPXA 3PFBA 3QOFA 4E5YA 3A2LA 5JNLA 2MR6A 1Y1QA 1CJBA 4Y6LA 4EHIA 2WJWA 5IYZF 1NULA 2ZOSA 1NIPA 4LK2A 2REOA 3CVOA 4A0HA 4CQLA 4CUZA 3M1LA 4XW2A 1QWOA 1QMGA 1Y7TA 3JVDA 2BGJA 2XOKD 1VE7A 1FJHA 4H15A 4MP8A 1JE1A 1JJ7A 4Y9UA 4CI0B 5EFOA 1Y3FE 1CPYA 4WEQA 1G38A 5K3FB 3OLZA 4ND8A 4GNKA 4BTLA 3CLSC 5KVQA 4OJ6A 2UVRA 2V7GA 4DQIA 4JA0A 4IWNA 4IQWA 3CKLA 1RP1A 2GBCA 4RQ8A 1U1GA 4FNAA 4RDCA 4RH0A 3JRWA 4X94A 4YIKA 4KVZA 4TYQA 5GM2A 2JGNA 1DXSA 2JPDA 3D6MA 5AOAA 1Z37A 4BQSA 1OLUA 5CT6A 1PLLA 3H4MA 4AZSA 4DPLA 2X5XA 1G8MA 4WERA 5C5DA 2Q9CA 1Y8AA 4RFLA 2XUQA 3LY7A 4DMKA 1RWKA 3L8CA 5FUWA 3ADDA 5K6AA 2VCYA 2ZRCA 1O95D 1Q91A 3BK7A 4FSXA 4IXMA 5TISU 2W2OA 4E4TA 3TNDA 3JW8A 3EF3A 3O8DA 4N4AA 1T8UA 1WDLA 2RHBA 2ZVDA 3RAQA 2C98A 1Y9ZA 4BWFB 2JGDB 5KI6A 2IUFA 3BWBA 5LDDC 3EC1A 4KLUA 2CHVA 5KFIA 5LP6A 1SV0A 1FUYB 1DNPA 4FGLA 4JZKA 4Q3OA 5AOCA 2HMYB 2KLHA 3JQBA 4RX1A 4ANFA 2G5IB 4R41A 3U5TA 5LMNB 4E94A 3LUPA 1QVAA 4LZGA 1YQQA 4YJDA 2C4TA 1TCCA 4ZARA 5A9RA 3L7NA 5CNJA 3TGWA 3PI6A 4PLVA 1K8RA 5ALYA 3BCRA 4ZYZA 1L4UA 1U8ZA 2AOVA 2BM9A 4D8XA 5EXPA 1K5PA 3O4RA 3TH5A 2W6IA 1XCOA 5JFGA 1L7QA 3H0KA 2HSWA 2JLXA 2ORED 2K8AA 2ZR9A 4L15A 5T4EA 1Y6JA 4OOFA 5JALA 2IEBA 3KQMA 4EF5A 5KG6A 2AOUB 5CWRA 1XRSB 1LK0A 1YI8A 3MTAA 3EGDA 4MVJG 1N2JA 3U40A 5SYAA 3LFHA 3W2EA 1P29A 1IG0A 3P2OA 2OO7A 1BQ4A 1O89A 1G42A 5DK4A 2CN1A 1B2LA 2QBYA 8ICFA 4LHZA 1ZJMA 4YXJA 1N8KA 4IO0A 1SVWA 4WJ3B 4V1CI 5HJ5A 3M8KA 4AO7A 4ECWA 5BNWA 1UKZA 3VX4A 1AK2A 3C29A 1C3EA 2WF6A 5KAIU 2FLKA 2VDRB 5GY7A 3QKTA 1RMQA 3R74A 1OLOA 2GESA 5CB4A 2UZIR 3ZWPA 2GCPA 5JD5A 1FO4A 3TIXB 2AQIA 2ASEA 4HH1A 4KNWA 1HMYA 4KN6A 2GA8A 1JHUA 4R8UA 5IIIA 2GEBA 5C7OO 4QASA 3VNQA 5DBHX 2ZKLA 5ICEA 3AIIA 3QPCA 5REQB 3AM9A 1Z5PA 2GRUA 3ICWA 4I3GA 1RACA 1L5FA 1PO7A 2VF8A 1D09A 3ABSB 1J2JA 2ZLBA 1H0RA 1H8EA 3NNSA 1Z8FA 2OCLA 4D7AA 1IQPA 2CUZA 4U7FA 1AKRA 5F3RA 1WL8A 2OBNA 3KBBA 3T6KA 1PVPA 1C7JA 1T9HA 2G72A 2QLFA 2Z98A 3A70A 3DGEC 4BE9A 5D3KA 4IILA 4B9VA 1WCIB 3KAPA 1FP1D 1W94A 3ZNOA 4CKEB 3GLIE 4Y2RA 621PA 5CYGA 3R3YA 1SWWA 2AGQA 1G7CA 3LXUX 2HJVA 4GG1A 5AIBA 2B6HA 1NPDA 2FZ4A 4OXNA 1HUZA 3A0UA 3KYIB 3E7FA 4KRXA 1X42A 4AKTA 1KJNA 3HB1A 1J0CA 3RV3A 4LYEA 1TAUA 4YPOA 4GSYA 4GZ5A 5ALQA 2QUJA 3IBGA 3W04A 3GELA 4F8YA 1NA5A 1B74A 3HPQA 5I6DA 5HMLA 5AKGA 1I3OA 4GUDA 4EW2A 3PEWA 5FTJA 5TS3A 4N7MA 3KETA 2B36A 1GAWA 2WPDA 2A6PA 3IAAA 4RKFA 1NW4A 1KDTA 2GZRA 4CV1A 4O4IF 2FG6C 1ZAYA 3WGZA 3HR8A 4PZOA 2G5HB 3EZ2A 3GRKA 5EJGA 3HPRA 3T1NA 4D0NA 4QZFA 1B8OA 1UIMA 2NVUA 4BQEA 1XFAA 1JFVA 1C9YA 3BFXA 3G9ZA 2PRIA 4GICA 3N7RC 4JSYA 3T3NA 1DPFA 2WSLA 3EZ5A 4RVGA 3MGHA 5KDLA 4KLMA 5CXSA 4UU7A 1KDYA 3F73A 1SH7A 1V47A 2BCJQ 3CX4A 2K7FA 2GZ1A 3W4JA 1UAGA 3C16C 4H1VA 2VNIA 1QZTA 2L69A 1K08A 4UMFA 5ICFA 2IE0A 3PDUA 1DI0A 4KREA 1RXYA 2GQ0A 1GXSB 3PVCA 4PBTA 1H05A 4MW0A 4JQCA 5G2OA 2QLTA 2ZYHA 3N53A 3QIAA 4OFWA 1Z0AA 1FQWA 2YTZA 1T15A 3DC2A 4HFNA 2FWNA 1U7HA 1EGHA 2FLNA 3GNTA 1T8WA 1MOPA 3ER9A 2IEIA 4KGXA 4FCWA 4G67A 4D9MA 2CT8A 1E1RD 4C4ZA 1UBNA 4OY3A 3CXRA 4Q3KA 3LI2A 2Y66A 2W03A 1CUHA 1WQ4A 1OMOA 1XQXA 4HLUA 2EGUA 2O2EA 1O0BA 2BFAA 1KSFX 2PGJA 2YV2A 3K9LA 4PYLA 4WL0A 3WWYA 4DG9A 2OCPA 3PA6A 2GN4A 2Y1JA 1U8XX 2Y2VA 4IGAA 3TBHA 5KWVA 2W71A 4DM3A 2IYXA 4XX0A 5LXTF 1BPXA 2JI6A 1T0JB 1LDGA 5BVGA 4US2R 1X1TA 3W8RA 2C3PA 4E5VA 4AQYB 3CVYA 2FSSA 3BYZA 3PFGA 8MHTA 2Q3MA 2X7JA 3BWVA 4FZNA 4FZ3A 4NAHA 1R10A 4W5QA 1XK6A 4MZXA 2WJ3A 4OX9Y 1N5MA 1GPNA 2OGTA 2VK1A 1EZ1A 1XXHA 2QR3A 3FDFA 3L40A 2A86A 1ACMA 4M0MA 1PD1A 4IVQA 4WWHA 1ESEA 1NZFA 2YYZA 2PUVA 3EIXA 3GZNB 4YA6A 5D00A 5DM0A 4W9MC 4CCWA 2OO5A 3E6AA 3REQB 3CLRD 3FYUB 5KG1A 1EK2A 3GJTA 4G5QA 1V8BA 1MN8A 5CLQA 4IQVA 1L4LA 1M6EX 3KYBA 5DN6A 1FFVA 3KD3A 1P7ZA 2FZEA 3AM4A 2WHXA 3KOWA 1TU3A 4YRIA 1DT5A 5TARA 1EFLA 4F8RA 2GRAA 2H4WA 1NVDA 2IPNA 2W3RA 3EVNA 4JBWA 5B12A 3HJAA 2QL7A 1AK1A 2F43B 2PYZA 2WKRA 4IICA 1HQCA 4WXYB 1GZ3A 4XFKA 1PR3A 2P5UA 3JPYA 4G65A 4IMPA 4W82A 4DIDA 3EARA 3DOCA 2RE8A 4UVGA 4QAQA 4URZR 4EF6A 1WPRA 2XHEA 3EFEA 1R8XA 4ZAVA 3I45A 4EG3A 3L1KA 2QW8A 4F06A 1MORA 1KYWA 3DL7A 4R9UC 3I6IA 9ICLA 4EITA 3OKFA 2FPPB 1XTRA 2KEYA 3CW2C 5HVNA 4Z2AA 3A6PC 1OU0A 2DVMA 3SHFA 2IIVA 3FMVA 3G5AA 4IHJF 5AJTA 4YPFA 4DRXA 4IEFB 4EG6A 4BNXA 3O8LA 3F4KA 5JW6A 4BBJA 2F3NA 3C1YA 2F1JA 2DPXA 1Y9AA 3CKKA 2O3RA 3ET5A 3R5XA 2FZCA 2PL3A 3K92A 4QFMA 4XUDA 4EB0A 4J0GA 1GO3F 1QHFA 3G0IA 5CVVA 2VDNB 3DLIA 1EFKA 3DL4A 3BF7A 3FAZA 3IAHA 3PNLA 2XZLA 1NC3A 2JIOA 4WXMA 3UVEA 4DXAA 4L4RA 2ZB8A 1N3LA 2IKQA 3FPKA 2KE5A 1KKMA 4MB0A 4TS1A 5C52B 2AJCA 2VBGA 5KFDA 3I04M 3QLJA 4B6QA 1NN3A 2A7XA 4Y2GA 5E4JA 5JLJA 1Z4OA 4UCXA 2I4LA 2R5FA 1L4NA 2WE8A 1E3WA 3E22A 4OGGA 2J09A 5LZ2A 2VDMB 4HEQA 1E0JA 4ZZ3A 3M6UA 5IJZA 2WG1A 1WSAA 1I7NA 1XA0A 3D4PA 1NNUA 2VHCA 1YZ3A 4QZ8A 1KO8A 4RQ3A 2E18A 4HB3A 4MIOA 2WG0A 2GJ9A 2BDPA 5BYBA 1S8AA 1MB4A 2GHTA 1N2CA 4P1ZA 3GP8A 4I5EA 4OYLA 2QSUA 4GPIB 3KUKA 4N3CA 5LR6A 1KY2A 3TL6A 3JVEA 4BMXA 3TQCA 3TJMA 4HZUA 1Z00A 1X92A 3CCCA 4LY0A 3SSOA 1ZQJA 1H9CA 2OFXA 3TDMA 4Z2YA 1A8PA 1H42A 3MK31 1OREA 1GGJA 2DU8A 5K0FA 3IBSA 2VPZA 1ZXLA 2O2YA 1GYQA 2IZ0A 4MQBA 3AY7A 3SIWA 5I01A 5LL6P 2Q1YA 4WNCA 3SBOA 3PMNA 4HB2A 4EY5A 1ZOIA 3TEJA 2QYSA 1R0CA 4EBDA 1H6CA 4I2BA 1ODCA 3MTQA 3Q9NA 4MRMB 4YWJA 5BUSA 5J0TA 1NG9A 1PS9A 3AEYA 3C21A 1JKJA 5FUVA 3ELWA 5B37A 3VKVA 4DBLC 3CFYA 5AIAA 3QK7A 3RWBA 4EMSA 2YIJA 3R9IA 2E49A 3SZGA 4HMOA 3FMPB 5CLLA 2Q2WA 3H6KA 3GCWA 1ODSA 4CW7A 1EZZA 4D44A 4DLZA 2HEIA 3NASA 3RSQA 4ETNA 5BMOA 4Q47A 5I8WA 4ZYXA 2H5JA 1DQPA 1EJ6A 2IHTA 2OXRA 1H22A 2W8BB 2WVAA 3FDZA 4NBVA 3TLZA 4C4AA 1YBVA 1GNTA 2Y9TA 2J6BA 2JFVA 4JLUA 2WB2A 4Q1DA 4KLDA 2PUWA 4HS9A 1U2DC 2Q9BA 2YC4C 1TUEA 3PPYA 4G63A 9ICFA 4H1WA 2RH8A 4HL6A 2P7IA 1BA3A 1HG1A 4MRSA 1ETHA 2XYHA 2NTNA 2QVLA 1VA5A 4DKXA 1GY8A 3NDPA 4QDUA 3ZWQA 9ICHA 5CHGA 2JHAA 3REFA 1PQYA 2HA6A 4CG3A 3VZCA 1SXJB 5TQJA 4TT8A 1BXZA 3IPRA 1GLNA 4KQ9A 1NQVA 1OTXA 5IJXA 1E98A 4EJ0A 1KEJA 5KL8B 3E2EA 4OXIA 4NLGA 4XWTA 3IPAA 4EBCA 2I22A 4JMPA 4XFJA 1GTMA 3MRSA 4DYDA 1PGPA 3DFIA 4ZDKA 2FZVA 5L95A 4N0PA 5BPCA 3STHA 1KQOA 4WXHA 1XVVA 2JLBA 3P2EA 3QY9A 4EG4A 1NI4A 3AY3A 5ES3A 1QORA 1Y7LA 5M04A 2BHRA 5L3RA 2WD7A 3C5HA 3KKNA 1QVRA 3LYHA 3WIEA 4QWAA 1KDHA 5IYZB 3PXEA 5BNIA 5H82A 4B8ZA 2YHIA 2YIDA 2CSXA 1GIAA 2GKGA 2BFEA 3G13A 1OH6A 1VSVA 3GFKB 1ST3A 1ZQKA 1L7EA 2GN1A 1S2IA 3RC2A 3MRVA 3UK0A 4GRAA 1DCTA 1MXHA 2XKKA 4RQ1A 1QHYA 1DMRA 1GQFA 2Z8ZA 1E3IA 4M1OA 5IAAA 1UP4A 1RWMA 4P0QA 4HQLA 4POOA 2O0HA 1M5UA 2WINI 3BEDA 4I81A 4TV8F 4WDRA 5EHNA 3LUGA 1DAIA 5CJPA 3TTYA 3REOA 3EYWA 3ZU6A 3KQYA 3ZOZA 4BBZA 2C2GA 5DLQC 5E8JA 4FEAA 5LQDA 1ZA1A 1BCSA 4YXFA 4C8LA 1GKKA 4JXZA 3IGFA 5I8ZA 2AMFA 3AEXA 3RVPA 1XZHA 3LT5A 4N7JA 4OX9B 1QPGA 1M9NA 4M1KA 4YB8A 2J3IA 4PWZA 4NNJA 4UEJA 1LSJA 4CIAA 4CKWA 4IKPA 1IUNA 3QFTA 3IO3A 4PC7A 1U3UA 4KN7A 3BC1A 1VJTA 4YG2A 1EVIA 1SKQA 2QE7A 4QWCA 8ADHA 1VJ5A 1KO1A 4DXHA 2VT6A 4IIJB 4RL4A 1SHTX 1GQOA 1J21A 1EP1B 5K4AA 5C8DA 4DL3A 3GFTA 3OJFA 1DADA 3IRUA 4PZ9A 3EVCA 1RRFA 1BMDA