3QXGA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron complexed with calcium, a closed cap conformation
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
222
structure length
222
Chain Sequence
b'KKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
molecule tags Hydrolase
source organism Bacteroides thetaiotaomicron
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
total genus 84
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qxgA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qxgA01
1YS9A 4UMDA 3ZTWA 2D2VA 5A3SA 4Y3UA 1Z4PX 1J97A 3PCTA 1KYTA 4HAIA 1LVHA 3AR8A 4JDPA 2YJ5A 4E88A 5ALVA 3QUTA 3PGLA 3IJ5A 3WGUA 3WKCA 3QYPA 2FI1A 5AIAA 3OCWA 5ALQA 2EAUA 4XOUA 3RF6A 3W5AA 2ZG6A 4I9GA 2YJ3A 3ET4A 5AKEA 2WF5A 5ALHA 1XPJA 4NAVA 1XP5A 4GXTA 3AR2A 4YCNA 3QU2A 2FUCA 3L5KA 3ZX5A 1EK1A 2O9JA 2NO5A 3E58A 2CFSA 3U7EB 5ALMA 3WK6A 2I34A 1ZD5A 3ZVMA 2YJ6A 2WF9A 5AKXA 5AM1A 4UMFA 1ZS9A 2X4DA 3L7YA 1RQNA 1QQ7A 3E84A 5AVWA 5ALNA 1VJ5A 3MPOA 5AVUA 3KBBA 2IYEA 1JUDA 3U26A 2Q5EA 5AM4A 2CFRA 2VKQA 3WK5A 5AM2A 3N07A 3NUQA 1U2TA 3KD3A 4YCMA 4J2TA 4QQFA 5JJBA 1Z4QA 2I55A 1AQ6A 3SMVA 4YH1A 3AR6A 3AR3A 4OHFA 3ZVLA 3WKDA 1TJ5A 3J7TA 3QUQA 2MU1A 2R8YA 3ZTYA 2I7DA 3SD7A 4XQ0A 3ZVNA 3OCVA 2WF8A 1QYIA 1FEZA 1VJRA 2BDEA 1N9KA 4Y2PA 2QYHA 3OCYA 3ZUPA 3WK7A 5AKHA 5ALTA 4G63A 2ZBFA 2IOHA 3OCZA 3P96A 2GHTA 2G07A 4BEWA 5AVYA 2ZXEA 3DAOA 2WM8A 3QX7A 1QQ6A 2G08A 4UM7A 4AS2A 5AW0A 2JAUA 1RQLA 2IA5A 2EARA 2CN1A 2ODAA 3U19A 4EZEA 2C8KA 2AUTA 3M1YA 2GMWA 4Y2RA 4G9BA 5ALEA 1ZD3A 3L8FA 4UU0A 1Z4IA 5AKGA 5AVVA 1Y8AA 5AM0A 4MWOA 3UM9A 1QH9A 3L1UA 4PNHA 3ZW7A 3QUCA 3I1YA 1SU4A 5E0OA 5AM5A 5AKIA 4C4TA 5AI8A 2FPUA 4KNVA 5AK3A 3WK4A 2AMYA 4F71A 3N28A 2RB5A 3ZWKA 1J8DA 2HOQA 1RLMA 1T9ZA 2G06A 2W11A 2JAOA 5AW9A 1SWVA 2MSNA 3EF0A 3KDPA 3FGOA 2FPXA 5ALYA 1RKVA 2B1RA 3MMZA 3EWIA 3EPRA 5AW3A 4L6CA 4FFDA 3ONNA 1QQ5A 2OBBA 2HCFA 3WGVA 4C4RA 5AIBA 3AR4A 3FZQA 4ZEXA 3E81A 4BKMA 2FUEA 1RMQA 3L1VA 3MN1A 4BX2A 4UM5A 3WKEA 3QGMA 2HO4A 1NF2A 1T5SA 2P27A 4FE3A 2C9MA 3SKYA 4EEKA 4NFLA 4Y2SA 5ALOA 3NASA 2P9JA 4ZEVA 1EK2A 3WKAA 2I6XA 3ZWDA 4UATA 2O2XA 2JGAA 4RETA 4F72A 1RKUA 3B9BA 4CF3A 2WHEA 3M9LA 1Q91A 3QU7A 5AVSA 3ET5A 2ZOSA 1O03A 4BEVA 1L7OA 1VFPA 4KNWA 3BA6A 3I6BA 3SLRA 1ZD4A 3NAMA 5ALPA 3W5BA 3F9RA 4JB3A 1Z5UA 2DQSA 4IFTA 4QJBA 2B1QA 4ZEWA 1RPZA 1LTQA 3DDHA 4HGOA 1L8LA 3N5KA 4UU1A 2B0CA 2R8ZA 2ZBDA 5AVRA 3W5DA 3U7GA 3ESRA 2C8LA 1L8OA 1U7PA 3SF0A 2YMLA 1Z5GA 5AVXA 4Y2TA 1YMQA 2AH5A 5AVTA 4DCCA 4HGPA 2R8XA 4KYTA 4OD0A 5ALFA 1S8OA 4HGNA 2WF7A 3N1UA 4YIKA 2YFYA 5AW8A 2GHQA 5IT4A 4CF5A 3K1ZA 1Q92A 3OTQA 3L0BA 2YY6A 1Z4LA 4HGRA 5AW4A 4Y2UA 2HHLA 1SWWA 2FPSA 3CNHA 5AKJA 4J03A 1L6RA 4RESA 3W5CA 1ZRNA 2YMMA 5AI0A 5AKZA 3NRJA 3DV9A 1YJ5A 4B6JA 1L7MA 1TJ4A 2FPRA 2G1AA 5AKYA 1Z4MA 2MU2A 3IB6A 5ALIA 4Y2YA 3SKXA 1TA0A 1XVIA 1Z88A 1YV9A 3U13A 3QLEA 1ZRMA 4DW8A 1X42A 3PGVA 2RAVA 3B9RA 2YJ4A 2Q4RA 2RBKA 3BWVA 4AP9A 4BX0A 5AI9A 4YIHA 2Q4TA 5FP0A 3N8GA 2NO4A 3L8HA 2FDRA 3R4CA 1Z4NA 4BBJA 4IG4A 2CFTA 3R09A 5AK6A 2B8JA 2BDUA 3B8EA 5A3RA 3ZI4A 5AESA 2YN4A 3AR9A 2WF6A 5AKKA 2W43A 4O8CA 3D6JA 4EX6A 3HLTA 4Y2XA 2IOFK 3QU4A 1WZCA 3R9KA 4YCLA 4KX3A 1YDFA 4BX3A 3AR5A 2PQ0A 4EENA 1CR6A 1RMTA 4L57A 3MC1A 1N8NA 2W4MA 2G0AA 2YMPA 2HF2A 2YMQA 1U2SA 1PW5A 1YNSA 5AI6A 5AM3A 4H1WA 5ALUA 4NABA 3KOOA 3TLMA 5AI5A 2EATA 2GO7A 1ZOLA 4UAVA 1Z4KA 5AVZA 3WKBA 2HSZA 2PKEA 2AGVA 3ESQA 3FPBA 4NV0A 3ZU6A 3FPSA 1WVIA 3AR7A 3SHQA 1RDFA 2C88A 4UAUA 3ZX4A 3OPXA 3I76A 2G09A 2PR7A 1TE2A 1CQZA 3IRUA 2HI0A 3I28A 1K1EA 5ALJA 1Z4OA 3UMGA 2OM6A 3KC2A 5AICA 2BY4A 4HYTA 2JARA 5T41A 4BNDA 1RKQA 1U02A 2ZBGA 3L8EA 3PDWA 2IOFA 4FYPA 2GFHA 4EELA 3L8GA 4BNDB 1WPGA 2B8EA 3NALA 5AI4A 4HGQA 2B82A 5ALSA 1NNLA 3EF1A 5ALKA 5AW5A 3OCUA 1T5TA 1L7NA 1RLOA 3A1DA 1L7PA 1RRCA 5ALWA 2YBDA 2JAWA 3FM9A 4Y2QA 2I54A 2RARA 4OFZA 3UMCA 4XE5A 3U7HB 2FEAA 5AK5A 3RFUA 1TJ3A 3KZXA 2WFAA 5ALGA 4AS3A 1WR8A 2R8EA 4DWOA 5ALLA 3QU5A 4GIBA 5ALDA 3CZ4A 4KX5A 4UMEA 1ZJJA 5AW6A 5AK4A 4KN8A 2OA0A 1S2OA 2P11A 3GYGA 4CF4A 5ALRA 5IT0A 4C4SA 4BYGA 4UW9A 4Y2JA 3L0CA 3A1EA 4OCZA 3NIWA 4YGYA 4MUMA 3QUBA 2HEGA 3QXGA 4NWIA 2P69A 2FPWA 2I33A 3ED5A 3S6JA 5ALZA 5AW7A 3NANA 2HX1A 4UMVA 5ALXA 5IS2A 4UARA 3UMBA 4EX7A 2B30A 4Y2VA 1ZD2P 4L6AA 2NYVA 1RMYA 3FVVA 5AW1A 5AHXA 1NRWA 3QU9A 4I9FA 1U7OA 3WK8A 3L0YA 5AVQA 1O08A 4DFDA 1F5SA 2HF7A 3QNMA 5AW2A 1MH9A 4CE6A 4CNQA 2QLTA 1Z4JA 3U7FB 3A1CA 2G80A 3WK9A 5AKLA 3HYCA 3VAYA 2C4NA 4UASA 2OYCA 1RC8A 3OCXA 5A3QA 3A3YA 1IWOA 3DNPA 2ZBEA 4XPZA 1RLTA 2HDOA 3E8MA
chains in the Genus database with same CATH superfamily
2JA1A 2AR7A 4OP3A 1VDVA 2R5WA 3UJDA 3U1TA 2O5EA 2QD3A 4HMOA 4EA6A 4F6RA 1WETA 3DMHA 4NENA 4MDEA 2R2GA 3JCZA 1T3GA 1K7SN 2W6JA 4B8ZA 2VYQA 2HU5A 1CNFA 4BX3A 2HU8A 4GWLA 2H1SA 4UULA 4JHXA 5F33A 1ADGA 3TLGB 4DA4A 3KB8A 3RF6A 3GH3A 1RSZA 2ZG6A 1D07A 2ALZA 3C5GA 1G7TA 2RHOA 1Z38A 3D5EA 3HY3A 3NBFA 1N2EA 4MB2A 2D2FA 4OI2A 4YI5A 1MG5A 4DQDA 1XPJA 5JARA 2BCSA 1ZU5A 4FE4A 3RKRA 3Q5GA 5BN3B 4DIOA 5ED4A 4PXSA 5AP9A 1KK2A 4X85A 1CUWA 4HJXA 1CK4A 2VQEB 1KARA 3NVZA 1XSEA 1YIAA 3BXZA 1DDOA 4WBSA 3VC2A 3P5BA 2WC1A 3THYB 1KO5A 4ZT4A 2ARKA 1EVEA 2O3RA 2QSUA 1ONSA 3IP7A 3U7EB 4YG2A 5ALMA 1H23A 5ICEA 3I53A 2ES4A 1DKQA 2WMNB 1XV5A 5CRXA 3HU3A 3LFUA 3FWHA 5EY5B 3ZZUA 3D4BA 4DMUB 4ZICA 4NKRA 4TKUB 3KHSA 1JDBB 1H8EA 3WGHA 3TIFA 1GGKA 4IIJA 3H18A 5AVWA 4JYZA 4A6EA 5BUSA 1MRZA 3CLVA 3LYUA 1WUYA 3R7NA 4J4TA 3ER9A 3N2GB 1AH2A 1QH0A 3NDRA 3D64A 2VP5A 3H1EA 5KYYB 2DBVO 4FZMA 1C1DB 4DUGD 1C4XA 2CJFA 2JCXA 2K5UA 3KTOA 2HXYA 1MX5A 3I8SA 5FR1A 4ESVA 1T9HA 2VXYA 2HRDA 4B0PA 6LDHA 1FFGA 1JJAA 2JHFA 5KYXA 4Q9NA 3O9VA 1K5GA 5L9AA 4DKJA 1EFVB 2NXNA 4EBDA 4M9XA 1WU7A 1E5TA 1PK7A 1Z4QA 4KR2A 4IL6U 3JR3A 1E63A 5EE0A 1GSIA 4JXJA 5HSGA 2EAPA 2DHEA 1ZK1A 1P4GA 4HXEB 5IEJA 4HATA 3IEXA 4QPZA 5D51S 1FRFS 5HUHA 2VH2A 3K0SA 3UHJA 5KX5A 1N2BA 3DV0A 2KHZA 1UMDB 3NH6A 3WL5A 4BIMA 3SF8A 1WIWA 2GCEA 1Z6PA 2ADOA 1ZQXA 5FORA 5FT9A 2M98A 4KQKA 2FHPA 2VP2A 2ZYUX 3AV0B 4LECA 4QBKA 5A5FA 5BXQC 3B38A 2QWXA 4CKXA 4H0FA 4KW7A 3AOEA 2BDEA 3KQMA 1K6MA 4IQ4A 2AOTB 5FPPA 3GG9A 2BJHA 1VE5A 2MDTA 3HRIA 1OV6A 2NXCA 3HP1A 4G63A 4ZCQA 1ND6A 1LI7A 2PGAA 1KWKA 2CKMA 2JFOA 4NLKA 2F90A 5FUQA 4RADA 5IS2A 2GAAA 2C7VA 2Z5VA 3FHCB 1CEYA 2W2KA 2FLPA 2YXBA 1LPMA 4D26A 3CJRA 3CLUD 2L17A 2OORA 1X74A 2ODNA 3OQ6A 3G8DA 3EMBA 3NVDA 4Z3DA 1OZ0A 1PUZA 2F1HA 1DIGA 1PDOA 2G5CA 2JAUA 2EARA 3HUEA 2OWEA 4FOOA 4UZSA 2BGNA 5J59A 5F12A 3I6IA 1R7RA 1I7LA 3AI1A 3G88A 2C8KA 4FC7A 1KORA 2FRVA 5H7XA 3QKWA 3D6NB 4X7RA 3OC6A 2ZVDA 1L1FA 3P9CA 4X7BA 3EZGA 4I2DA 3ZHCA 4EPTA 4LJ4A 2VI5A 1V4VA 3F5QA 3AL3A 5AM0A 1JIIA 3HDQA 1EFPA 2H8GA 2I8AA 4Q45A 1YVDA 3AJAA 4M49A 1KJQA 3PUYA 3ICOA 5CFPA 5C8XA 3FWYA 3NXKA 1P7WA 1QRSA 2EZTA 4LYHA 4KQXA 1YOVA 5BV0A 4I0WB 2G3YA 2PXXA 3AVXA 4ARVA 2ZB7A 3W3AA 5CD9A 4J9QA 1Z19A 1T3HA 1AQYA 3OTIA 2ZIWB 1UK8A 2PJZA 3VPSA 3ZHYA 1XN1A 4R2IA 4RAQA 2COKA 2PRYA 2CL5A 4FX5A 3NVKI 3LMKA 3IPYA 5KNBA 4LYGA 4ZMSA 3E0FA 2RB5A 1DQYA 2OAP1 4AJNA 1KFDA 4M0AA 4DO9A 1N5MA 1J8DA 3JPNA 1K5PA 2PGXA 2JK0A 3B1VA 3AQFA 2XVMA 4KE7A 4FUQA 5CFNA 1D8AA 4FHCA 2RC5A 3DF7A 3FKJA 4NJOA 4YV2A 3JPPA 2I6FA 3FPEA 3L07A 4DMKA 1DMSA 4DB4A 1Q14A 4QXRA 1SWVA 5CRIA 4JQOA 1OYOA 3KDPA 4X1KA 2DUNA 4NEHB 4DMFA 2JIZD 4Q03A 3AWIA 1BQEA 2CL7X 1QRAA 5JVDA 3FH0A 1HNNA 3EPRA 2PIDA 5DWVA 3RVRA 4FFDA 1DARA 1WZEA 3EH2A 3LQKA 4KV7A 3GVHA 4MJLA 1ECGA 3PJFA 5DSXA 4F11A 2OBBA 3H7AA 2B99A 4RWZA 1M2FA 3GLFB 2Z58A 1GADO 3FZQA 3V32A 4BLVA 4H3HB 4U7TB 2WW8A 2I3DA 3E7XA 4R8UA 3E9DA 3SC4A 1E2JA 4AP6A 8ICYA 3P9PA 5INTA 4C8OA 5KYVA 1ZMXA 4AQDA 1SQ6A 1A27A 2OQIA 2QM0A 4YJHA 4GEGA 5MFPA 4PQRA 1KL9A 3LUPA 4J3JA 2DWOA 1S89A 2R8RA 3HBMA 2GJKA 2O2YA 4JZYA 4QELA 5CA0B 5TB5A 5IWAB 4V3CA 3CHYA 3PLRA 1NF2A 1UQUA 5L3SB 2R11A 2WNIA 2V5VA 3EF3A 2X4LA 1ZXLA 2JVJA 1W29A 4AZWA 2Z2JA 4C78A 1UP4A 2OFPA 1NF9A 3NR2A 4XDZA 1Y63A 3WKAA 4UQGA 4GP7A 3ZWDA 4BB9A 8ICCA 4NYMR 3UBTA 3WDSA 4RHCA 4KNYA 3G0BA 1Q91A 1E3IA 3I64A 4DCOA 4W5OA 5H59A 1CIPA 4MPJA 4RIGA 5GV7A 1ZEJA 5JZVA 4AWXA 2BRUA 3MCVA 3UJ6A 4ZCRA 4FMPA 1T94A 4P54A 4KNWA 1DQPA 1PS8A 4KFTA 1JWLA 4AO6A 4QWCA 1DOAA 4F85A 3VKGA 4Y98A 3LHIA 4M0EA 1R16A 2J0UA 1CUCA 2K8BB 3MS4A 1TF7A 2NO7A 2C1EA 4WA7A 3LBFA 3LGXA 3IIMA 2H2FA 2Z5LA 4GXQA 4M9QA 4REOA 1XEXA 4S1WA 1NMYA 4UDNA 4AXXA 4Z6KA 1EBBA 3BMCA 3F2IA 3H5LA 4TPKA 4WKBA 1Z3IX 4P7KA 3MGKA 4UU1A 4U8GA 5AOVA 5C31A 1CRZA 1QRRA 2H1CA 1ZK0A 3CLUC 1EVLA 4XFJA 3U80A 4JUAA 3YASA 2PYZA 1YZVA 2AJDA 3EY4A 4Y9TA 3T38A 5KDDA 2JDID 4DDVA 5AVXA 5IDXA 4BQFA 1Z17A 5BT8A 1CRXA 1YR3A 5ICMA 4DF4A 5IILA 3AX6A 4G5RA 4OB6A 4HDCA 3QITA 3L1JA 5H8WA 1OXSC 1SZHA 3EDCA 3LK6A 3UJ3X 5ICSA 4J16A 5LYJB 2PUEA 2PMZC 1IXKA 1YR6A 1D2AA 4GVXA 3L4BA 3X1ZA 4RNCA 2P6UA 3L0OA 4RE6A 4UTNA 5K3DA 1V0JA 4WZAA 2YOGA 3ZWVA 3M6WA 3LIPA 4LBZA 4JC4A 4OGKA 3R5SA 1GLGA 4FYMA 3X0DA 4EKEA 5JVDB 4YV1A 4RDIA 3QH4A 3D3QA 4RA6A 3TE7A 2N47A 4IIFA 2IY9A 8ABPA 1PSWA 1QG0A 3FE2A 9ICTA 5EUQB 3TADA 1ZA2A 3E1KA 3FCYA 1YA8A 4ZT7A 1SBIA 3CW8X 3OF5A 4ZV4A 4JLWA 3O2NA 5MF6A 2P7HA 1KTQA 5G4KB 1BMTA 3A7DA 3FCOA 5LLSA 1DDIA 1R0WA 1LWOA 2OPBA 3AUJB 3KG2A 2YJNA 5JY1A 3CM0A 1A9XB 3OZBA 4Q7KA 2IPLA 3HCRA 1RPNA 1YVUA 1Q2UA 1WEKA 1Z74A 1SUCA 4TQ9A 1Q1AA 2PHZA 1FOEB 1ITZA 3JATA 1B0XA 4IZOA 1N92A 4DLZA 1H94A 5F9MA 4MUAA 1TA0A 4BJ6A 5B7NA 3I09A 4HXFB 4C2UA 2HTFA 3G49A 3PNPA 4QIHA 1BWRA 5SYAA 3LXRA 3BXEA 2VLIA 4IPTA 2Z4RA 4P3NA 1KEJA 4DNOA 2PUGA 1PP4A 5E6RB 4B84A 1ESEA 1XZMA 2RAVA 3DYVA 1NWCA 5HKAA 4FFWA 2CXHA 2FX5A 2Y0SF 5CB1A 3VISA 3FYDA 2EOAA 5KYYA 1R6AA 3RIHA 4ZU1X 3UZUA 2CV2A 2W8LA 1A6SA 4KFRA 1IBSA 2FSVC 1DC3A 4YIHA 4II7A 3V7JA 1F2VA 3ZWWA 2OK8A 1F3LA 1FDSA 1OZAA 3KUXA 1NVEA 4FCTA 2VDVE 3H99A 2OXOA 1T6NA 2ZUUA 5DM2A 3OPYI 4WGGA 4OLAA 1H9CA 4JV2A 2HSWA 5K03A 3HJNA 1STOA 3PUWA 3UO8B 1XDWA 4RVOA 3R09A 2WYOA 5KTKA 2J3KA 4BFCA 2F4NA 5EE3A 2LHTA 2WKRA 2NV3A 3BZWA 2BFCB 2TS1A 3OPYB 3QFHA 3R0XA 4H7JA 3PR4A 4XWKA 5ADHA 3RTVA 3RRYA 3RUAA 1PUXA 4YXJA 5KT4A 1ZM3A 2FPPA 3H1AA 1QMGA 1SGWA 4J1TC 3HM2A 5C80A 4C0AC 4XVUA 3SXJA 3I1FA 5DG8A 3GVXA 3L7MA 2VZLA 3OO0A 4MP6A 3T3DA 4EUKA 1BC5A 1ND5A 2H5JA 3A3NA 5GPBA 1ONBA 4FMCB 1VHQA 2HJRA 5HDQA 2P7IA 2EP5A 5LZ8A 4YCLA 5BNWA 1ZOPA 1G7SA 3IAS6 2V8OA 4GSLA 5CDGA 5TLSA 1CX9B 3HI4A 4IXWA 2DP4E 2VHTA 4KAAA 2P65A 3VHRA 4NCJA 2Y0BA 2J09A 3V4PB 1TO6A 5B3AA 1LK5A 1KJWA 1DTWA 1HTBA 2WJIA 1EK6A 4KXLA 2OYYA 2HF2A 2XYGA 3RVLA 3M9MB 2KBEA 2NZ8A 1U2SA 1HMPA 2G36A 4CRWB 3RTCA 1A0PA 3ROEA 1QK5A 2I8LA 4Y2HA 2YOFA 5HGXA 4DADA 3L7AA 5EESA 1V5GA 3R6WA 4M83A 1F2TB 3KJZA 2ZUSA 3HCWA 3OA0A 4CWAA 5D6OA 2FFHA 1ZOLA 5SY6A 3EEQA 2GD0A 4M1ZA 3PQ8A 4MW9A 2NP6A 4ZYVA 1EFAA 4WXRA 4E5VA 3ISTA 2REXB 1Q6YA 1P2SA 1WCIA 5T5QA 1LX6A 6NULA 1COZA 4GI5A 2PL3A 4FYIA 5K0TA 4MKIA 2ATVA 4OA5A 1FJXA 3OLQA 1EUCB 5BQXA 3Q4GA 4KITB 4DZZA 1II8B 2OCYC 1B74A 1B1CA 2WD8A 1I01A 4L4SA 3BWYA 5H81A 4R9NA 3T5LA 3Q8LA 1PVDA 1R4MB 3F1LA 3WGGA 4ZI7B 4P7GA 3DT6A 2IS2A 3UMGA 1Y9EA 1LBTA 1Y1KE 3RVDA 2P9GA 4XWAA 2CC2A 1U98A 1PT6A 4Z0HO 5FTLA 5JZ9A 3UGTA 4TKUA 1NOIA 2IHYA 1FL9A 2B8EA 2ORYA 3AI2A 3IUBA 4G5HA 2QI9F 4ZV7A 5H5JA 3VR0A 5EWGA 1QS0B 5LDHA 3DFUA 3K0CA 3AZOA 4JD5A 5EMNA 1C81A 2BFWA 3H5NA 3RYIB 3NATA 3ECSA 1D9XA 1RKBA 3A1NA 1PTKA 3M6MD 5HW0A 4U6PA 2ZATA 1L7PA 2GPWA 1J24A 2IEAA 4RHFA 4Q02A 2BSAA 2ZW9A 5HTOA 4IXDA 1GITA 5B55A 2BM0A 1B8UA 3W78A 5J4YA 5ECYA 2IUTA 4L4YA 1K0FA 1UODA 4P7JA 3QVTA 3O8DA 3KUDA 4PTZA 5J2UA 1JBQA 3PW7A 1MSWD 1OXTA 1LVGA 3IPCA 3SGLA 3KZXA 3F4LA 3NDPA 1E3EA 3L82B 4GLXA 1VBFA 1ZU4A 4YMVA 2ZVPX 3PFWO 2B4QA 3AIMA 3D81A 3FWPA 4PFQA 4KQ2A 3FX2A 5B6IA 1M8PA 5KMGA 4RT2A 2ENUA 3JQ9C 4NENB 2QPTA 3UAYA 3HU1A 5AW6A 4B3HA 3RAQA 1DTEA 1NV9A 1O9HA 1S2OA 3MYRA 3PXUA 1YGPA 1H1DA 1RRGA 1N7HA 3MMSA 1SV4A 3F73A 5HS6A 3FUVA 3AFNA 3FB1A 1XZGA 3Q6MA 1SUFA 4KQIA 5JVDF 4OX9B 2JB9A 1XQYA 2GHRA 2HGSA 1R6TA 3N2KB 3NGXA 4X20B 2NUAA 4G5SA 3UB3A 1NXSA 3P97A 1NY5A 3DPUA 1NBIA 1V8ZA 3IAAA 3IBYA 4FKMA 3V8VA 4L0MA 5EIEA 2GM4A 4GSKA 4R8VA 2X3YA 2CB9A 2GPTA 2WWWA 5FOSA 3GLGB 1ODTC 4HRXA 4P38A 1J33A 1L8QA 3NS1A 1M33A 2E8MA 3E9RA 4QLAA 4IQUA 5KDLA 2OL4A 5E2BA 2F1JA 3I4FA 5TQ2B 3PO5A 3NANA 1XZ8A 2E6UX 5L1IA 3DULA 1YUNA 2OFFA 2BCRA 4C4XA 3PCXA 1BQ4A 5ESWA 3A3PA 1UWKA 5DI9A 1F3OA 4M0UA 3BWXA 9ICSA 1FBTA 1M2OA 2WIGA 4TM8A 3UUFA 3ZDEA 1AGYA 2FR0A 1VIVA 1L3SA 1UA0A 1C29B 3I92A 1ZWKA 5J29A 3ISJA 4I9FA 4MITA 4A16A 1PV4A 3LVVA 3L0YA 1W7AA 4YQFA 1CZKA 3EEBA 3LF2A 4YK7A 2AOWA 3GJXC 1EGMB 3KYDA 3N2GA 3P4YA 3AL0B 2HT1A 4OHKA 5TX7A 3HKEA 4Q4JA 3PU6A 3WLOA 3BB4A 3G23A 4D9NA 4XD2A 1W76A 4C0JA 1U2QA 2X40A 3DBOB 3F96A 3IQZA 2K6GA 1YA4A 1SVMA 4Z9YA 3BS5B 1V9SA 4MI3A 2Z04A 3MGIA 5LZ9A 3BVPA 1LBQA 2MYPA 2WG1A 3G2LA 4UBLA 2QTRA 2UUCB 4NJEB 4A0RA 1QSLA 3VDMA 1BN6A 2XQIA 3GAFA 1KSHA 2QYOA 2I3AA 4Z1MD 4D46A 1VKOA 1ZI9A 3BMXA 3GA7A 5CLGA 5EE9A 3RC8A 2P9YA 1M1NB 3A4TA 4PCVA 5KFSA 1J97A 1I6WA 4Y1FA 1WA5A 1KYTA 3IC5A 5L7TA 4D4HA 3RS3A 2QQEA 2JD1A 1FUYB 1TC2A 5A5EA 1BPXA 1ZQHA 1CUEA 3KKQA 4QATA 5JJLA 3O0TA 1Q3VA 3IJ5A 1D2CA 4I4CA 4AICA 5EXPA 3P1JA 2EW2A 4BL5A 1MT3A 3DQPA 3KLPX 2V54A 5M5BA 5J8YA 2LCFA 5EE5B 3G2JA 1Q0HA 4XJXA 4E2YA 1NLUA 1T4BA 4G84A 3Q7PA 2TMGA 1FYDA 4RK6A 3R9IA 5IFKA 4IIBA 2QZJA 1QORA 3NHJA 2QLMA 4QZGA 2Z2IA 4EBFA 3P4UA 5BR7A 4GC9A 4KXNA 5JI3E 1JKMA 3TADC 1RI5A 1T1GA 4LRSB 1UBRS 4GWGA 2VDNB 2YY5A 5IF3A 2PFSA 6PFKA 3ZDQA 4XEHA 3UUGA 1A2OA 4P0PB 4HWSA 4FKBA 3VR4H 3PR3A 1L5QA 1WSDA 3TW4A 4YRSA 4ZDKA 3RTEA 2CFSA 4CCHA 2NW6A 4ZCLA 1QVZA 2XKBA 1S1MA 3B6KA 4HH3C 3I8OA 3JPOA 2YWHA 2IBKA 1FTQA 1PZXA 1E60A 3OLVA 3L7DA 3GZ4A 2UYGA 3VOAA 5DNCA 4QU9A 1PR4A 5BR1A 5J40A 2GFIA 1J2UA 1YB1A 4YFYA 5KFUA 3E84A 5DBEX 4MQ4A 5IC4A 3AVUA 4YASA 3VR5D 1N2GA 1YF3A 4GE3A 2IYEA 2YQEA 3EWNA 2WIJA 2LIPA 3TQTA 4BKOA 1U2ZA 4YJ3B 3U7IA 4QQKA 3LFTA 4G5XA 4HB4A 4HNAA 4RQ2A 4Q3AA 3COPA 4WBXC 1HLGA 1JDNA 3GLFE 2BPGA 1I5EA 4OM8A 4XB2A 2AOXA 2DB3A 3UMJA 5C8YF 4D4GA 5JC1A 2YW2A 3RASA 5LOVB 1K6EA 2DKZA 1VP9A 3JAKB 2IHJA 4QQFA 1TAUA 3AERA 3U7QB 3EIHA 4KYUA 3L4JA 1VLZA 1ZM2A 3RK1A 3H42B 4RTSA 4REQA 4BBZA 3SMVA 1NR5A 1VL2A 1DHTA 3LHFA 4YH1A 4DL9A 2QPLA 4C5BA 1NKVA 3AF0A 4DT1B 4Z1OA 3MIIA 1LPAB 3PFKA 4D56A 3WKDA 3IDOA 4HV4A 3I3SR 5CBPA 2I2CA 1RTTA 2NOAA 3FDSA 4J9SA 1EJ2A 1JKJA 3B2NA 1J2NA 2IDMA 4HX9A 1B8NA 2B69A 2NU8A 1ZXXA 3A37A 4YMHA 3EZ5A 4OA8A 4B6RA 3CTPA 4FFOA 2X0JA 1K7YA 4G1EB 1XTIA 5L4NA 1CF2O 3M5CA 5LLTA 2DUYA 5JJKA 1D4AA 4EDHA 5BMVA 3CX4A 1WBDA 1WHSA 3PNSA 3W8DA 3HMKA 3P96A 3CKMA 3HG7A 2MMGA 3ONEA 5EXDA 1M7HA 3CKLA 1GKUB 4M86A 4CL3A 2UVPA 4AJLA 1JQDA 1KDRA 4QVGA 1Z8HA 6CHYA 2G08A 3O9ZA 1H2HA 4MYUA 4AS2A 5AW0A 3MFIA 4INAA 1ADCA 3ZDBA 3K15A 2A0YA 2A7XA 3KTFA 1HG1A 3M6VA 3NLLA 4FFLA 3ICQB 3VBEA 2PFNA 2K2QB 4YHHB 2ICAA 5F3XB 1KMMA 3B2EA 3M1YA 4OJTA 4BC1A 3JD1A 2B98A 2W2LD 4JGIA 2E4WA 1I32A 4BX9C 1QYCA 3GP5A 2R8GA 1ZP6A 1EP1B 1Z4IA 4FR0A 4Q1DA 2X0EA 4ARZB 2PL1A 4CIAA 3PXBA 4X3OA 2KJ9A 4ATNA 3GP8A 1FMFA 5I9SA 4BB0A 1MX1A 1QAOA 1QWSA 2EEZA 3K75D 3C3DA 3V4ZA 1E64A 1V9CA 5T8KA 4NLNA 1YS7A 1LV5A 2WT4A 3M3DA 1GFIA 5IKXA 2E55A 4O5KA 3GIJA 1VJTA 3ANYB 4LJYA 4OOEA 1EXNA 1JZQA 4E5MA 1UJCA 3W1VA 2MUTB 2I2XB 4U0KA 5FTWA 4I28A 4RPZA 4WK6A 4TLLB 3GG2A 1T2EA 2QT9A 4MWTA 3T34A 3WLRA 2VAWA 3P2JA 1TYBE 1LDEA 13PKA 5AKIA 1GRNA 3L0IB 4TSFA 1LFDB 3IBSA 1PVQA 4E5UA 2AMYA 4RPCA 1CS0A 2RGUA 4MYCA 2CFOA 3E48A 5EN4A 3GJ0A 3KQWA 1OI2A 1FLAA 1X77A 2EW1A 3P9ZA 2EF1A 1NUQA 1Z2NX 1W5SA 3PKIA 4ZVTA 2C42A 4MWEA 2G06A 1N2JA 1Y7HA 4KLIA 2JAOA 2WABA 2J4DA 5AJVB 3MD9A 5KNBH 4EMBA 3EARA 2J0QA 2VPXA 3ZV3A 3I5YA 3JD2A 2VYND 1SCQA 4NP6A 4QW8A 1YT5A 3GCZA 1GQQA 3HP4A 2X7XA 4OHPA 4BQQA 4QFDA 3RRBA 1PJCA 2GF0A 5DM60 3S8EA 4UXIA 1RKVA 2JLUA 3EWIA 5F3DA 1X9XA 3ZQJA 4ZCTA 1VE6A 1L5VA 5EJ7A 2XNCA 3FUWA 5J43A 2O0HA 3DCNA 3QF4B 2KNJA 4QYIB 1C1YA 4PLYA 2OXEA 4WLUA 4ACBA 4J9RA 1H2XA 2H2WA 1YS4A 1R66A 2JZBA 1UA1A 3H2KA 3LPLA 5DQIA 4LBWA 4Q34A 5IJWA 3OCJA 2I4OA 4DARA 5KYWA 1VPWA 1Q1BA 4DWVA 1XI2A 1XZCA 4RUAA 2AHRA 3HXQA 1USWA 5HUQA 5KYWB 1GZVA 4F92B 2JVIA 2QAGB 3CX8A 4FEEA 2C5FA 5BN5B 1FIQA 4BFTA 4GE0A 4MR7B 1XHFA 4L4ZA 2YVLA 7ICUA 1BDJA 2BZ1A 3JYPA 3MAJA 4N3AA 4D1YA 2BLNA 2QN8A 3EXHA 5B1HA 1UPXA 4EB3A 5C5EA 2P27A 3ZEIA 5HF5A 3F6YA 3MF4A 4KLFA 1A9TA 1ORDA 3QEMA 4NFLA 2OQVA 1QDLB 5EJ8A 3ISCA 2P1RA 4LK3A 2UYYA 4WUVA 3LD9A 1C8VB 4YPVA 1ADFA 5C8DA 2ZTCA 4RBNA 4NCBA 4IO0A 3KKLA 1E1QA 1KK3A 4KWCA 3SICE 4PCLA 1BAPA 4C7KA 4DRZA 1JI7A 3MOIA 2ID7A 1WTCA 2ZXUA 3B9BA 1KI2A 3FNQA 5CMLA 1L5KA 4AL4A 4KHPB 2QX8A 4G23A 3TB4A 2GSDA 1G8FA 4EB6A 2G7MC 1KO7A 4LRUA 1SC9A 2ZUTA 5DBHX 1JQKA 5JEEA 3GELA 1VKJA 4JB0A 2P6OA 4WFQA 2B0JA 5JAIA 2Z8ZA 5KJ6A 4DR1B 3G9QA 2GCNA 1GTVA 1U4OA 1OASA 3QKSB 2ACWA 4E3ZA 3M8RA 5IULC 5LUBA 2C7QA 4OQZA 3WGYA 3RJFA 2W71A 1EVQA 1U3TA 2NU7A 3U40A 1YJXA 1LPNA 4JB3A 2DQSA 5EIBD 2B1QA 4TV8B 2QD4A 1NP7A 3C97A 3U3OA 1P4HA 4DWJA 2GA9A 3MGBA 1AXEA 4JUDX 5CB4F 1XQVA 2CK3D 1E6WA 1QO7A 3FVRA 3EXFA 3PG5A 3W5DA 3U4CA 4D97A 3IB3A 1Z2PX 4B79A 1UINA 1Q8KA 1R50A 4AULA 1GR1A 1JEQA 2CVOA 3T6KA 4PAGA 2AYXA 1YFLA 1E2QA 2F3RA 1BX1A 1KH2A 2CUKA 2OG1A 2JBAB 3G0CA 5JSZA 2CNBA 3DBIA 1M67A 1PZEA 1RPAA 3D5QA 1EVKA 2BMAA 3FOZA 4M1WA 2HW8A 3RU7A 1RI4A 4WFIA 1U3GA 1MR3F 3TZKA 3TQSA 1JX4A 1MW8X 4CQMA 3R5JA 4KYTA 4ZTZB 3Q15C 2AWOA 4RY8A 5SYNA 4EL5A 2APJA 5KC8A 4TTRA 3RUCA 2KWIA 1O87A 1UEXC 4E14A 1WKBA 2ZJYA 5KL8B 2UUPA 3KELA 2YFYA 3QXXA 4JYPA 3Q8MA 2ZTMA 3PJDA 4JI6B 4DA0A 4CF5A 1I7SB 5IBRA 2I6UA 4TMFA 3HO1A 4A2CA 4W5JA 2Q8QA 3IE0A 4PBSA 4E5DA 2QU7A 3OIDA 2I03A 1IQ0A 1ZQJA 1CS4C 1NOMA 3UPTA 1NTRA 3Q8SB 3RF9A 3WYCA 1BE1A 4DCGA 4LYYA 4TTJA 1TTHA 3G9UA 1L6RA 1S2GA 2NU9A 4NPCA 7ICHA 1SKYE 5JLJA 1Z37A 3TG2A 2CJWB 4BJHB 2Z3WA 3A04A 2J3HA 3IAFA 1D5CA 4WGFA 3ZW8A 2ZXIA 3K5IA 4JLAA 3X1YA 1XCLA 4ZEOA 1FC0A 1RAIA 2H54A 2DMRA 2W2OA 3C70A 4G89A 4C22A 1NXOA 4OJYA 5CVCA 1DX4A 3HZZA 1M2VA 2OUIA 3H3JA 3A9WA 1GNPA 1DKOA 4M54A 2C7RA 3AG6A 2ZSEA 4MLCA 1Z88A 2J0UB 4AYBC 3OLYA 3D31A 4N0QA 2Q7DA 4J3NA 3A6JA 3H2GA 1L5HB 4B6QA 4W9MC 5AJUA 4RQUA 5LQDA 1NBMD 1OZFA 2O07A 1E77A 3LY7A 3D4IA 4MGHA 2Q29A 3SNHA 4OMCA 1J2TA 1TKDA 2HDNB 3NVAA 4AP9A 4NCAA 2V7QA 4BC0A 2X6RA 2ZTSA 3DR3A 4G0QA 2MSCB 3NWPA 3C1OA 3I5XA 1XWWA 5DCLA 5DTIA 1CJCA 4EPXA 2CJYA 1RAFA 1USUA 2Q3BA 1LBHA 3BSWA 3IPAA 3RS9A 4DG5A 3OJSA 2OV3A 4BGIA 3D5TA 4DUYB 3BMNA 2L19A 4TYNA 3UQZA 2YN2A 3GFSA 2R6JA 2ZU6A 4G8CA 4ALKA 4YMIA 2PT5A 2EZ8A 1A5TA 2QRVA 4LJAA 3ZI4A 3FVWA 5CIYA 3OP1A 4ZI2A 2F9LA 2ZT5A 1FUUA 2PKQP 5CGZA 5EHXA 1DJNA 2GEFA 1PZGA 1N7IA 3D3JA 4IEFB 1P2TA 2EV9A 3OX1A 2CWDA 2VXOA 3RB3A 1IQUA 1FTGA 3D6JA 4PHDA 1CFJA 1SCNE 1MQSA 2GUWA 2ZJOA 3I32A 4DEVA 1JJFA 3N6RA 1RWOA 1WZCA 1CG6A 3KE8A 4RZ2A 3M83A 2OP1A 3EQ7A 2YVUA 4KX3A 2FPIB 2BHNA 4CRXA 2Y1FA 1U1FA 4C8KA 1A0OA 1PAUA 2XVZA 3GRAA 3AR5A 1VMKA 4G5OA 3E6AA 5DLGA 1W6RA 2GN4A 3E9YA 3IE2A 3SV4A 4HTFB 4OUKX 2O2SA 5DM70 4DV4B 3SOPA 1AKEA 3KQTA 2LM4A 4WQMA 1KR5A 1Y3AA 2Z3VA 4FZ3A 2C2ZA 2I6TA 2VAMA 3K5HA 4HMQA 2O0LA 4TMXA 1KI8A 1NASA 1R0BA 1OW5A 2X1MA 3GJYA 2QBYB 4FYXA 4TKZA 1I1NA 4NABA 4BU0A 3PRHA 2ET6A 3JPTA 4PVCA 1VL1A 4QYMA 2CD7A 2GPYA 4E03A 4ZYLA 4HAXA 2ZI5A 4MKRA 1B23P 1WWUA 3EA0A 2BTQA 4FOSA 3HVUA 4H3SA 4ADSG 3UJPA 2ZYVX 3B82A 3E3LA 3OIUA 1JBKA 3TANA 2GN9A 4WL0A 5B7QA 2W8ZA 1H2ZA 3ILVA 5M04A 1FA9A 3I39X 1E4EA 4P33A 4RCVA 3AM1A 5L1KA 3A4LA 2KV2A 3CPJB 2FVXA 1D5WA 3G17A 1D9DA 3I04A 4DFKA 4KRGA 3SCZA 1J0CA 3N7SC 1KAGA 3BJZA 3QOXA 4P34A 1KOJA 4Y6PA 4I1SA 1SZJG 1M5RA 1TKRA 1NVKA 3F6SA 4P31A 1CETA 2V9CA 4JELA 2R8PA 5CP8A 4IZ6A 2OM6A 4F3OA 1HI9A 1ZXBA 3O83A 4YJFA 3TZ6A 5FBRB 1X8JA 3B6IA 1K89A 4I5FA 3GZNB 3KZOA 2W2TA 3U31A 4CMCA 3NVVA 1XZNA 3AFOA 1WB6A 3ICWA 1YAJA 3QM1A 4Y0AA 3GV7B 3NOVA 1KIFA 5DN6A 5JPCA 5ALKA 1PW7A 3WV4A 2AG6A 4UVIA 5SICE 3LKZA 2HPHA 1WP9A 2KD1A 4WLOA 3SXUB 1GCOA 5DH9A 2A9OA 4R8SA 5FADA 5DB4A 4M9GA 3BUSA 3X1KA 1KS9A 1GZ6A 3EVCA 1KJIA 1NVBA 1OOEA 2ZCJA 1ISRA 1WMDA 3NTVA 2AU0A 3TVYA 5KTMA 3QQ5A 2WAMA 3KTAA 1I9GA 2C99A 1ZJZA 3OLCX 4E1BA 2PD3A 3A4NA 2OAEA 4NRDA 1TJ3A 4LFCB 5J2TA 1EGVB 1JVSA 4N0DA 5GVRA 3TSOA 4Z9BA 4AJKA 4AS3A 3EQZA 2OCDA 2PKYX 3QUAA 2EBWA 4I4TA 4DWOA 1U7UA 4NXZA 5DN6D 3LDAA 1C14A 1R6DA 3QU5A 1RPJA 5LB2A 3GFKB 3ZY5A 4BMSA 4WJ3B 1OX6A 1FFXA 1M73E 1PJ2A 2JNWA 2HLNA 4Z1MA 1NPDA 1P18A 4M37A 4X8OA 3VR6A 1N33B 3X1DA 4UE2A 1G63A 2R87A 1E1CB 2YKGA 1WB9A 3MG9A 2KQUA 3L05A 2VP0A 4EHDA 1ULTA 4U00A 4ELTA 3A2NA 5IVIA 3A4VA 1N75A 2YZGA 4UHBA 1GTL1 1R6BX 3WNDA 5MHTA 3BGDA 1NMQA 4YGYA 4HEHA 4C5AA 3EPJA 3GNSA 4W7HA 1JXAA 3N7UA 4RW0A 4DPLA 1XWLA 3BRQA 3R7BA 3MQ4A 5EWLA 3DMFA 2FLKA 2HD4A 3OJOA 1QLWA 2I33A 1GG9A 4WPGA 3SLGA 1T3TA 3OLZA 3MJCA 4B45A 1CB0A 1MO2A 4XJVA 3K31A 3B1JA 1JN0A 3FF1A 3VNRA 4DZTA 4UARA 4HUJA 3UMBA 1PGJA 1Z7YA 2F17A 2QTNA 3M82A 4GOLD 4UBOA 4D41A 2NO1A 4P4MA 1CWUA 4P2HA 1W85A 1X13A 2R4QA 4N4AA 4RKYA 3HVIA 4TSKA 4V2IA 4R01A 5TF0A 3GAAA 1Y0BA 5JS6A 4MYRA 5IT9A 1IEXA 1R6VA 4URUR 5BNZA 4UTOA 2VZ8A 2XYPA 1SKSA 3GFQA 3NWJA 4N9WA 1S8AA 4NBSA 1PEKE 3CCBA 1X6IA 3ACBA 5IIOA 1FS6A 1CU1A 3ZH9B 4GKAA 5GM1A 3JQ7B 2V4MA 4MR8A 4KN9S 1Q0LA 1OX4B 3RBAA 2G63A 5J0SA 1IG0A 1N5LA 2IW3A 3HABA 3VAYA 3KB2A 4PSAA 4KLSA 3OCXA 3KXKA 4JMLA 2HHUA 2C07A 4BMVA 3PLNA 1XRSB 1OYVA 2PQ2A 1WVMA 1P9RA 1OBFO 1GPAA 2H4WA 4MQEB 2FKAA 2W93A 3WVNA 4TRNA 2UXDB 1DPGA 2B37A 2EDUA 4ZKDA 4OVKA 1F0KA 2ID4A 3DZJA 1QX3A 1YBFA 3EJWA 2CUTA 2XODA 3F5SA 1H42A 3NHFA 4HWKA 1T9GS 5DBAA 1FNNA 3I72A 4G0PA 3P9IA 3TXAA 1C7ZA 2VJ4A 3PNOA 5CK4A 1NVFA 5CT8A 3W5UA 1JDJA 1IG3A 4KN4A 4AZ0A 2QMYA 4C07A 4TYMA 7MHTA 4XSGA 4J9NA 1J99A 4HLNA 1ZEMA 1JYSA 5B1EA 4XOUA 5GJWC 3Q8WA 1U5AA 4QTXA 4NS1A 5CYFA 4ZQIA 4A7PA 3NYQA 4IHAA 1RI1A 4WECA 4X8LA 3UQYS 2AN9A 1ZVJA 2IL1A 2I4LA 2WFLB 5ALHA 2C77A 3TCXB 4F9GA 5C5DA 5FAXA 3W2GA 1HQCA 3PQ7A 1XPOA 1YMUA 2AKEA 2G40A 1KJNA 2XVXA 3QLVA 1X94A 4YAEA 3LXXA 2X4IA 3OQ1A 5AYVA 1U28C 9ATCA 1NXTA 2V7GA 4JOSA 4XR9A 1RJDA 2O2EA 3U17A 2ALJA 4BRSA 1JIUA 1FDIA 3HBLA 4BLOA 1IBMB 2IRWA 1VLVA 3ANNA 5B1DA 9LDTA 5KG3A 4RQ7A 2B94A 4Z7QB 5IJ0A 1TDJA 1ST3A 3PWKA 2YJ6A 2WF9A 3I2KA 1QGDA 4IDFA 4YRRA 4PYNA 2F2TA 4M87A 4UHKA 1KFEB 2CHQA 3CKYA 2QE6A 4K6CA 4Z51A 2OCIA 3GEBA 3H2BA 4IUDS 4MQFB 3ZV5A 9ICJA 1HYBA 1XVAA 2RCNA 3T9CA 2Z57A 3C85A 4M7OA 2A1TR 3SS9X 1Y1RA 4G01B 2TRSB 4DQLA 2NTYC 3MYYA 1GNTA 2CHEA 2NT4A 3ZBUA 1NNEA 3EXIB 2J3MA 2C0QA 4JV0A 4U1RA 2YNMA 4V0NA 3EQ8A 1MAVA 4WOBA 1MORA 3W4JA 1NJ8A 4C7MA 1UCVA 1FNSA 4GICA 5D2CA 4UNQA 2HA5A 3KPVA 4V0KA 1N60A 2HFJA 5C4GB 1A3CA 4RJTA 4CHGA 4LWPA 4BGDA 3PO4A 3WYEA 1L3IA 4IH1A 4QNMA 3RVNA 5JD3A 4ESOA 1YCGA 1ZKDA 2AHOB 1H0SA 1RVV1 2OHFA 2YZ7A 4L5CA 4ZO7A 3RAPR 4WN9A 3GQBA 1UOEA 1ZICA 2WHPB 2Q5HA 3WLTA 3OTWA 1M1YE 1E9EA 3VSEA 1Z5ZA 3QPDA 1BA2A 2VF8A 5D3KA 3Q2OA 5FHQA 5TXGA 3RUFA 1YA6A 1UPUA 1OUMA 2GEUA 2I7DA 3AV3A 1WZNA 4NR0A 4RPKA 4WNYA 4R7GA 2ZVJA 1E2KA 1VLMA 2UVUA 2RBGA 4Z0TA 4QUDA 1MJGA 1U8YA 3FLAA 3H04A 3NTOA 3FW1A 4M8LA 3FDXA 4WDQA 3DL4A 4EHHA 4YRGA 3GW8A 3RYTC 2DHRA 2CBZA 2G1UA 4UVGA 1X7WB 4LYEA 2QU8A 3KQVA 1NVTA 3OZGA 4FGLA 3DUFA 3LC1O 1U9CA 3NETA 2IV2X 3MCZA 4RXMA 3WWCA 4BEWA 1F2DA 4INZA 3BRWA 4JKYA 4LSMA 5KMGB 3U09A 5FOVA 1EB8A 2ZIUB 4UCXA 1T36B 1VSTA 2HBMA 3KB6A 2W2XA 4DC0A 3ROGA 2FZEA 2IITA 3KPJA 4F2DA 1OC4A 2X6QA 4OO1J 1CNMA 1R88A 2J3IA 2X6TA 2EKPA 4KWIA 3R7FA 1EFRD 2V3VA 1YS1X 4PNEA 2O8EB 1ORVA 2AFIE 1A7KA 2XA2A 1LSJA 4V0LA 1DIBA 1R9MA 4WN3A 3RC3A 4B2IA 4EOGA 4JGBA 2FJPA 1C4KA 3TSWA 2WSLA 1TQ4A 1GM5A 2P9FA 9ICFA 3D2BA 1WDWB 5JR3A 1R9NA 4M6WA 1X86B 3PXCX 4MICA 3CSDA 3WWEA 4DMLA 4EGSA 5BSGA 3F2DA 1JNYA 2HIHA 4Q3DA 1R0CA 5KFXA 1TMYA 2R96A 1V41E 5B3JA 4A73A 4F4FA 3EASA 5COQA 1FP1D 4OXKA 4EHNA 2X1HA 4BWMA 4PLVA 4R6XA 3FG9A 4EM6A 2V0NA 3DE0X 2C8VA 3EA4A 4J4BA 4Q7EA 4U39A 2VT3A 4MGZR 3OA2A 1RM4A 3FOEC 3EOBI 2QX6A 5FWXB 3ZXXA 3AI7A 3SEIA 3U0BA 4Z53A 1D1PA 3JPQA 3C1ZA 2V96A 1JHYA 2Y3IA 3F9IA 4JJ4A 3UV7A 1VYHA 2VWPA 5EL0A 1W9MA 1IM4A 2ZQ5A 4MO9A 3PSHA 1XDUA 2MT9A 3RVKA 1L4KA 2ASDA 3WK4A 3G13A 4MROA 1OB2A 4RF4A 4ZT3A 1CUXA 1L3UA 5F9FA 3VPCA 4TXHA 1JA1A 2VYCA 3JVUA 4HL6A 4ARUA 2OVBA 4YQZA 1H65A 2Y92A 5D46A 1HOTA 3C6XA 1QIDA 1WPQA 4MR9B 4BO7A 2C98A 4HDSA 4AROA 1YHZA 1A8HA 1E4OA 2RHCA 2BHTA 4BDPA 2XNSA 3N0XA 4QHYA 2ILVA 1YZFA 1X1AA 2I99A 4FSDA 4JJFA 4XDHA 3ZCXA 4C0KA 3T61A 4P4OA 3UJCA 1EDEA 4RZIA 1XRLA 1ZSVA 3FGOA 3KQQA 3OEHD 3GDFA 3MSXA 1O6FA 1YQUA 3KRTA 4N9QA 4CN8A 3DR5A 4BAUA 5FI0B 5HKBA 1NX9A 4YQYA 2WOJA 4WLNA 4IRUB 2PXIA 3O8OA 4FHFA 1QQ5A 5J2EA 2EG5A 1NI5A 5CXXA 2W6CX 2Y4NA 4LGMA 4OV6B 4OUDB 3WXMA 4CGYA 4EECA 1PZNA 2IK8A 1XLUA 2YVAA 5H16A 1VIMA 4AUMA 2PLAA 2PUCA 3K9QO 2W54A 1H1TA 3HYRA 3IR7A 2YXDA 4RNMA 3QXJA 3MILA 5G0UA 2VHUA 4TKVB 2FUEA 2IPAB 3T7DA 3KQUA 2JFYA 4AT1A 4V03A 3B52X 4WFKA 4E33A 2WWXA 3UUWA 5JXIA 1OBCA 1VFNA 4BFLA 3WB2A 1UBGA 1C7EA 3BGOS 3FLMA 8ICMA 2FOIA 4PQEA 6REQB 3HQ4O 3JWEA 3F9CA 1ZH8A 4JMPA 1BJTA 4EEZA 2A78A 3GIMA 1UBLS 4K2HA 4Y67A 4F45A 4LDRA 5JFOA 1KO4A 4DMGA 4EH1A 2EKDA 4FOPA 4WLEA 3AVTA 2D0OB 4L74A 4L3OA 4LYJA 4UHHA 1HFWA 2JGAA 2WQ7A 1TCBA 4CF3A 1GPKA 2CMKA 2W7PA 3ETEA 4YO8A 1LV8A 1P9OA 5D84A 4GRAA 4LJ9A 5AFSA 3C5VA 3ZCUA 1G8SA 1K27A 1XD8A 3KNZA 3NAMA 3PNLA 1I6MA 2QMEA 1NDUA 3HILA 3U1BA 5HCIA 3DLHA 4G0UA 4BNVA 1H22A 3QPCA 1F2UA 3L6DA 5JH7A 5JWRA 1K3UB 1PVOA 2C4KA 4HGOA 4YR0A 2JFQA 2WQZA 3AO0B 3A0RB 3VVCA 2G83A 1TO1E 2FN3A 2FE1A 2KLHA 3CNOA 4ZVKA 1Q7CA 2W9BB 4YR2A 1A5BB 3MTEA 2QSYA 1BCRB 1M8KA 2OXRA 1QVVA 1MVOA 1ZK3A 1MB9A 4Y2TA 5LP6A 2Z95A 2HF8A 3LZDA 4UBMA 2R5FA 4AMUA 3V7LA 3V2GA 2Y0PA 3MGVA 1CR2A 2AJQA 4PGXA 1L5MA 1Y82A 1J0AA 3LWBA 4OQEA 3OMWA 4QBHA 5FPSA 3BWEA 1S96A 1T9KA 4RH3A 4AZ3A 3NYIA 1Z6QA 1U99A 3NG1A 2VPTA 5E7QA 3DOCA 2NAFA 2WZDA 4B5KA 5BN1A 4KDRA 5DT9A 4MHOA 4OQQA 4O4HB 4XFKA 3P2OA 5IRCD 3R24A 3OZ7A 4H7PA 2HHQA 3SFZA 4CJXA 1BMFD 4NBTA 4D4JA 3GGGA 1WXWA 1UQTA 5F52A 4O1MA 4RNOA 4F8JA 1AXGA 2Y1JA 4KXVA 2FG5A 3B7WA 1TC1A 2INGX 3UV3A 4LISA 3UV6A 3CT6A 3HN2A 3PC2A 4O3SA 4JBHA 4R2WA 1VMEA 1XU7A 5BMVF 1SNYA 4HN9A 2EGUA 4GLJA 3WRXC 5CVJA 3K0BA 1BEUB 4DB2A 1SWWA 2FE9A 3IH5A 4E09A 4ED9A 3RU9A 3OQOA 4JLBA 1V5EA 1BNPA 1U2RA 2ZB4A 3LQ1A 2A9PA 1TT7A 4G8DA 2P40A 3BZKA 4B6JA 1DAHA 2P3SA 5CW1A 5DISB 3THXB 2P79A 1UBOS 2CEAA 3FPGA 4NU0A 4TUYF 4BFWA 4N6NA 1K8YB 1E5QA 1DU4A 1RAAA 4QECA 3UCXA 4DQSA 1NZPA 1ML3A 2FW7A 2YXPX 4FOTA 4RFLA 1KP9A 2PKXA 4DIMA 1XVIA 4PGFA 3VU9A 4CM8A 4B9UA 1U1EA 2YYZA 1KEEB 1ZRMA 4DW8A 1DX6A 1E4EB 2OB2A 4GU5A 3M1IA 4AG6A 3ZHZA 4A6DA 1E3MA 2Y1DA 2DFDA 1X42A 2X5XA 5DEIA 3MUNA 5EJ9A 4RFSB 1QP0A 3M8SA 2E4ZA 2H52A 4NYIR 4BX0A 2BFDB 2NG1A 4ZT2A 4Q44A 4ZCMA 4H3KB 1G6KA 4B3DA 2J85A 2P6PA 3GGCA 1S5PA 1YNOA 2D06A 4RXTA 2CF6A 2GPBA 2O48X 3NAGA 3WGNA 2PS0A 2EFDB 3BN3A 2W4IA 3NQ41 1ENZA 1EYZA 4BVAA 1P5ZB 3C1UA 4J0GA 2YRFA 1I6LA 2ODQA 2KBFA 4OHOA 4UKDA 3GGDA 1JQEA 4GGPA 2WBLC 2GR9A 2LYAA 4ED0A 1P6QA 3R6TA 2G0TA 3NBZC 2N9UA 1G8JA 2W7TA 3KEGA 3SQXA 4Q15A 1NQVA 2WIDA 4LAFA 1U7WA 2R1TA 2IHKA 4Y2XA 2IOFK 2C61A 2P8JA 4MWDA 4PQFA 3VC3A 5HA5A 1PR2A 2VJYA 5A4KA 2Y2UA 3OF2A 3IUEA 3WS7A 4JVOA 1LJLA 2HLHA 3A28A 5A5DA 2ZUCA 3LDUA 1B8VA 2KYRA 3AB7A 4WUTA 2GFQA 1G41A 2WJAA 4XSHA 4DOCA 1COKA 1CFZA 5F51A 3H0RB 1L5RA 3KZMA 3L84A 3N3BC 5T67A 4R54A 4AZSA 4UTRA 2KHQA 1IWPB 1F7UA 1FRVA 4D3FA 1ZMOA 4ND4A 3T1OA 3HNOA 1T34A 4QZDA 5B37A 3WSWA 5AQEA 4RZUA 4IEEA 3T7EA 5IZCA 3NHPA 1WBBA 5I5GA 2CHUA 1V7QA 3WKBA 2AJLI 2DG2A 3GI1A 3CF6R 2OFOA 3CJQA 1XD2B 3FPSA 3WMGA 3AR7A 2RQ5A 2G5PA 4U5QA 1RDFA 1E18A 2DTDA 2FQWA 1RLUA 2QTTA 1II8A 2QLLA 2XZTA 3LQQA 3PQ5A 4PIMA 1CY6A 2G9RA 5E9WA 2OMKA 1T7PA 4F97A 1BXGB 4R2MA 4ZO6A 3ROTA 2E1FA 2DECA 3HKEB 2ZT7A 5ALJA 4R8MA 1NSFA 1WSWA 1JEYA 1VYTA 3NHAA 3FY4A 1ZIXA 1KSFX 2VP6A 3T1TA 4BNDA 2IIQA 4BZWA 1P8AA 3R5XA 5EVJA 1TMGE 3KSBC 2GFHA 4F3RA 2H57A 2AI3A 2W6OA 3ZVRA 1W93A 4JWNA 3GX1A 1M2EA 4NBWA 2B82A 3ZBTA 4L16A 1OZGA 5JMTA 1OYYA 1P9WA 3SYLA 1N63A 2NAPA 5ADVA 5DULA 3H9CA 4WWHA 4IY1A 1JHXA 4KE9A 3DAHA 1JDTA 2HK7A 2XSZA 2OG2A 4DIDA 4OHWA 1X19A 3K2QA 4TQUS 4BO9A 3U3ZA 3BQMB 3OIWA 4PGHA 3RYHA 3PQFA 2ES6A 3Q3CA 5K0GA 1IFXA 3C3CA 2YUIA 4MPDA 4MUNA 2OKGA 8ICPA 4JHLA 4EFMA 3BXOA 4JEHA 3H3FA 4ZQHA 4DOMA 5K2OA 4QASA 5E2AA 1GRRA 1EQAA 3EAQA 1NW3A 3E7WA 4GFJA 3EPPA 4HQRA 5TT1A 3LOPA 3K92A 5J0QA 4YJHB 3RFUA 3GIDA 4PGGA 2ZDQA 1IDOA 1UZLA 2DR3A 3QW2A 2EZZA 4IVRA 4M7WA 5IXYA 1PFUA 2QTFA 3DVAB 2RGNC 1ZN9A 1XDDA 4YJ2A 1Y3CE 1CRWG 1M9NA 2B1GA 1C9NA 1FDUA 1GARA 4X6YA 4N7JA 4UFOA 1KI6B 5EFZA 1Q0SA 4PHEA 3ETCA 2VK2A 1Z35A 5EMLA 4FFMA 3CE9A 1OUQA 1YACA 1J49A 2WTFA 1B00A 1JZSA 1QR2A 1V6SA 4IV5A 5K6RA 3C3EA 3HH8A 4WZ6A 3SHVA 4EPYA 4BO8A 3SBOA 2W3RA 3CA8A 4OCZA 4NV3A 2J6HA 5GOTA 3ESCA 4BLTA 5J1SB 1UBFA 3E2EA 4HGZA 3VKHA 4J9PA 4PHTA 1FXWA 1CDZA 1M5UA 4RPXA 2WJ3A 4P81A 3ED5A 4DS4A 3T41A 3AJ9A 2C2BA 4DIKA 2D5AA 1KAOA 2NTVA 2EP8A 5JG7A 5I7RA 4QWEA 4KWTA 5HK9A 5DOVA 4UUPA 3T9EA 4QD3A 3DZDA 1Z8DA 2E82A 4C6TB 3B1WA 1UJBA 3DOOA 3ZQ4A 4LJLA 4ECYA 1V25A 1KO1A 2PS9A 4EUFA 4EVSA 4BWGA 1ZOSA 3ZW9A 1XJQA 4L9RA 1Q3UA 5AVQA 2VP9A 2GK6A 4QM6A 1R12A 2ONYA 2I78A 3I58A 3WISA 4INOA 1ZETA 2WJ6A 3K9HA 4MVCA 5A7FA 2G88A 1N5JA 5BOSA 5AW2A 1J2EA 1MH9A 3CP8A 3L46A 2VJ5A 2QLTA 2ZTHA 1JR3A 4J0QA 4I2JA 4NYJR 1AN0A 1LBEA 1OXUA 4OPMA 4L9WA 9ICMA 3AETA 3HJTA 4B47A 4HLUC 5IMBA 4R65A 1IB0A 4QOHA 4OXRA 7ICGA 3GZTB 3K1JA 3QE3A 4RV5A 1E2GA 3MRVA 2I9KA 2HBRA 1C2YA 1NMSA 4PWYA 2HDOA 4C6HA 2R6ZA 4DBLC 4X1IA 3F71A 4B3GA 3IFSA 4NBRA 1TZMA 2BMEA 3F1KA 4G5QA 3JARB 1P74A 1V3VA 1R8JA 1WM1A 1BKSB 1QHYA 5IDVA 1C3JA 3PCTA 4PLWA 3TEJA 4DXAA 1LS1A 3TOZA 3JQ7A 1I0ZA 4BMDA 4QRIA 4AYTA 2NZJA 2D5LA 3BCUA 3CRNA 3EGCA 4NICA 1RIIA 5F2NA 2GKSA 5IPFA 3QUTA 3AHJA 1NYRA 4H1VA 5KTSA 3O90A 4ZRNA 1J5EB 5GMOA 2X7JA 1RE1A 1U8ZA 3OD5A 3R9XB 5K0BA 4BNYA 5JRTA 3OKPA 4HZUB 1ZUHA 4JJ8A 4C1BA 4YAKA 4KI0A 4NCHA 4E5YA 1AB6A 1GAQA 1J8VA 1N0IA 4MJ3A 3ET4A 4PV7A 5IJ0B 3NOOA 4FP9A 1G3UA 4XQ8A 1PJAA 3PPIA 1QPGA 3AUTA 1UMCA 4JVNA 4ECSA 1MIHA 3SYTA 4ZPXA 3V8QA 5C7IO 3L5KA 1EE1A 4U2GA 1PNRA 1EBFA 4OXIA 3TGWA 1SIOA 1EK1A 3NP9A 3EQ9A 1ES9A 1SOVA 5D7NA 3E9ZA 3L2OB 5DB8A 1BNCA 3LWZA 3PPVA 4LNUA 5C1IA 4OXXA 4RU9A 3MBIA 4M8NE 4LTMA 4LEIA 1V1MB 4MA5A 4F3KA 1PZHA 2XLCA 1OAAA 2QRMA 3I61A 2OCBA 3V1YA 3NEPX 2LGJA 2DWUA 3QVMA 5FJJA 5AVUA 1NHWA 2O8VA 1JUDA 1AKQA 2DPYA 3CE6A 1U1CA 3I12A 4H1UA 2JAQA 2NUTA 4B7AA 5LIPA 4K8RB 5AM4A 2C3YA 4BNXA 5DYWA 2IU4A 2GJ8A 2BBSA 3D6VA 3O75A 1FYFA 1ZY2A 5DCWA 1DGSA 5KYTA 4P93A 2HWYA 4MKGA 1D9FA 3ZY6A 1BMDA 1AD2A 4DLWA 4FYJA 2H7XA 3A6DA 2JKYA 5D85A 4PRLA 5A7HA 2XGPA 1R5OA 1R6UA 5T14A 4S05A 1Q16A 5IANA 3DB2A 1EWTA 1SVSA 1RWQA 2WE8A 1LEHA 2Q2WA 3A1WA 4R3NA 3TRKA 4F60A 3VNVA 5DGBA 1RR6A 2PBRA 3LP8A 4C6RA 2HHHB 1AQ6A 2HMWA 1T91A 1NK6A 4JS0A 4O0LA 1HDIA 2JI9A 2QAIA 2W0MA 2K4HA 2IS4A 1HZZA 2R7KA 3JRNA 3V6LA 2ZWVA 3LY8A 3V48A 1OROA 4TTSA 4I7EA 1XTKA 2FUG6 4CR7A 5KNDH 4DCPA 3IPXA 3LLMA 4LC9A 5KTPA 2DY0A 2LBOA 5CBPB 2RKBA 2JV3A 3CISA 1VLJA 5DXAA 3O1HB 1JFRA 1VJRA 2E18A 5KFRA 4BP8A 5B4TA 1H38A 8ICEA 2D6FC 5SZIA 1EHYA 1L6IA 3RSSA 1AS3A 3HHEA 3A6KA 1SIBE 4PNPA 1ZR4A 2V7EA 2V0CA 4O4IB 1Y8QA 1U8TA 1UDRA 5DDMA 3AB3A 3JAWA 5KFTA 2FEPA 3O8QA 4RYDA 5MN5A 1AF7A 3L41A 4C8NA 2X8JB 4Y1RB 5JE8A 5KFWA 1J9GA 4KBGA 4L02A 2I5HA 1E2PA 4F04A 5KYUB 1AS2A 1BWSA 2WYUA 1SCAA 1RM0A 2C59A 1QVAA 4UM7A 5B7GA 4IQ8A 1G7RA 4N3CA 4YJKA 4EI8A 2VQFB 2IA5A 3M0EA 5I7SA 4GOJA 4R05A 1G3IA 1QSSA 1D6SA 1YB2A 2QGZA 4NU5A 1N2ZA 3SQNA 1XCGB 2C97A 4FQ5A 5CLFA 1RWKA 2R60A 5FKJA 4Q43A 3Q7QA 1AX9A 4PZ0A 2BGWA 2O4CA 4QFMA 3TQIA 4B7UA 1RI2A 4PICA 3V7WA 3ZCPA 1CZOA 4BATA 5AVVA 4RIFA 2XTNA 3RLFA 4DQQA 3VYVA 5EXSA 5ICGA 1D03A 4L4UA 8ICIA 4K3VA 3CVXA 1X40A 4QE3A 3RU3A 4OFXA 4LVSA 5G1PA 1KGSA 4K05A 3PIIA 1XFDA 2CNDA 3P8ZA 3WL6A 4H15A 3ZDYB 3U3JA 4A10A 4ZOAA 2E5LB 1N1EA 1EFRA 2Q27A 1C9JA 2XT6A 7ICVA 2QL9A 1JU9A 2FPUA 2YS7A 1CYDA 1BPZA 3OICA 4WVLA 3BBPA 3WSVA 3I05A 3AGPA 3SVLA 1AV7A 1G4AE 5FNVA 1U6KA 3G8CA 4F6LA 3LAWA 4HVCA 1GAJA 2ZJFA 5F78A 5KJFA 3NBKA 1N25A 2X86A 3LQYA 1T9ZA 5DYNA 1IUNA 2CNKA 3NT2A 3C16C 3P26A 3PYLA 4AJ2A 2W04A 4YRDA 1Y7LA 4HFMA 5KREA 3RNLA 3AG5A 4W5HA 4ZO9A 4LHEA 4CMBA 2H3HA 3EF0A 4MAMA 1H2RS 2I3GA 2YQ4A 5TY0A 3TLGA 1UC4B 4J0IA 4JKOA 3A6ZA 5P8WA 5JOQA 5GZ3A 4FDVA 2UXCB 4G5GA 2X0NA 3O0FA 2CDRA 2KI5A 2H3ZA 2VHXA 3GRZA 1NONA 3EGIA 4GI3A 2PYIA 4I1VA 2LKCA 5GAJA 3RHZA 2R1TB 1TKAA 3NPMA 3BMOA 4JT9A 2EZUA 5BXYA 1DSSG 1PFWA 2GN2A 3BKWA 2SECE 3OOEA 1W6UA 1WMFA 1NSTA 1U11A 1WUDA 1DJQA 4KO8A 4NZMA 5F1OA 3ZV7A 1YR1A 1R4NA 4KO4S 1OQAA 2FY8A 3AHHA 4GHWA 1IK4A 1KVUA 2RGBA 2Y9PB 2O3QA 4PGQA 3OPQA 3HJCA 1T1EA 3ZDDA 1Q3TA 1EZ1A 4TLDA 5L4LA 2XCSB 1FQWA 2C58A 2PI5A 1O89A 1UBMS 2VEDA 3DYBA 3IUMA 2PUJA 5J2AA 3LX8A 3ADKA 4RSGA 1XHEA 4IFEA 3DFMA 3EIUA 4JB8A 4UM8B 3G5LA 2OC9A 4PANA 3GRKA 1UKZA 1ZJ5A 2B4RO 2F55A 5SY9A 3U3KA 1U0LA 4D5EA 1WOYA 4EG5A 5KVQA 4M1QA 2WILA 1SU6A 2REQB 4M1KA 2P2YA 2PO5A 4UXJA 4XZ3A 4Y6LA 2R18A 3VVMA 4B9AA 5IKMA 1RHMA 1QB7A 3PW0A 1F44A 3EZFA 1DXHA 4AM8A 1QLHA 4UEQA 4ZA2A 4G24A 4RDXA 2ZULA 4UB3A 2PRKA 2X9NA 5EI5A 4PE5B 4LOLA 5J63A 1F06A 5KFFA 1G2OA 1PJLA 1ZIYA 4IFTA 1FDVA 2WEKA 1ZQIA 1XNHA 1Y6QA 3CEHA 3H5AA 1OWPA 3H9GA 3IMEA 3BXFA 4TMZA 3WRVA 3Q9UA 3WGKA 1P62B 1TUEA 4IHQA 2QDXA 1TK2A 3BE6A 3FFBA 2VK8A 3GRUA 1X9SA 4P84A 4QUEA 2AXQA 3ESRA 3JWJA 4FFSA 4GT1A 2XB9A 3S5JA 3EZ6A 4DLSA 4OL0A 1MB4A 2OFXA 5K1ZA 1V37A 4O3FA 7ABPA 2QVYX 2FEXA 4HNGA 1Z36A 4IIGA 4IVNA 5K4GA 4YD1A 3VR2A 3WRYC 1X6JA 4D43A 4CMJA 4EYHB 1WY5A 2R8XA 3GQBB 3O4GA 3C5WP 4EBCA 3HBAA 4LJ7A 4B2PA 1VIYA 2W2KB 3OQPA 2PX8A 1X7XB 5HX7A 4BQRA 2FEWB 5KNCH 3RFFA 2KG5A 4US8A 4RACA 4YIKA 4BHTA 2P6RA 4Z9FA 4MVYA 3S1AB 3SSNA 1OWLA 3AFIA 5AW8A 4M04A 1NGSA 1AXRA 2YWXA 4WHMA 4QEDA 2Q3FA 3AI3A 4P3YA 3PV8A 4O5EA 3C6KA 1JHOA 3G0OA 4MUXA 3CUYA 4TT8A 3RVJA 1Z2AA 2KX7A 3AOGA 2D8CA 3MT7A 3KHGA 3EFEA 1HL7A 2HHLA 5GY7A 4FSXA 1E61A 3CNHA 4PBRA 3RRNA 3VH2A 4DLEA 1FP4A 3F6CA 3I6YA 1ID8A 2BFOA 3KKAC 5AKZA 3A3OA 3LWDA 4E94A 1CUBA 3R6LA 4KQMA 1DAOA 1UPBA 3ITDA 2FPRA 2F9MA 1MQ3A 4Q7QA 2X1VA 5LZ5A 1U0OC 4LNUB 2OH2A 2DPLA 2C2XA 2N46A 4J0FA 3U3XA 3VSAA 4A1OA 1GL3A 4LMRA 1VA4A 2K7ZA 4Q21A 4PGAA 4A27A 4NZOA 1UBJS 1V6AA 3WB9A 5C0YA 1GNLA 4DYDA 2B21A 2IW1A 2IYTA 1AVTA 2OQRA 2UKDA 3A9UA 5LZ7A 4BTLA 4BFZA 2FOXA 4BNIA 5JPIA 1S1CA 5DQGA 3PGVA 1YJ8A 1TQDA 4MPRA 4TWBA 5K3AA 2JFWA 1NQUA 3OT4A 3WIOA 1XVUA 4F3NA 4LZNA 3C3KA 2HCJB 4YMTA 3SAHA 5F1YA 4QZAA 4X7PA 1Y5NA 4XUDA 1XSLA 1OKKA 3OHBA 1H9BA 3UQ0A 2O06A 2C00A 2OR3A 3KOXA 3VPFA 2W6JD 4Q19A 4XRHA 1W75A 3ENVA 2WVHA 4W4TA 3TM5A 1ABEA 3WI7A 4DCTA 4F4UA 2O8DB 5GVSA 1CHDA 1LB1B 3SHWA 1SZPA 1UEIA 2GCOB 3JTEA 3KFVA 4I50F 2QNIA 3PL1A 5KOYA 5CP2A 2B9EA 2K89A 2FF7A 4WNAB 5JATA 3TG8A 5IVKA 2MINA 2JZOA 2WHPA 3ETHA 5ENDA 5T7BA 1E99A 3T1QA 2H59A 4AYBF 3L1HA 3VC7A 4L4XA 3GLFA 4K28A 4RHUA 2FFQA 5ITWA 4W9RA 5IC6A 4WDRA 3UWOA 2GZ2A 3RAFC 2QR2A 4K1XA 3MHPA 3N8NA 4EGFA 5DU2A 5JS2A 2E4YA 4R1UA 3I04M 4EO4A 2XB2A 1PZFA 2F64A 5F7ZA 3GLIB 1XPUA 3KJFA 1UKAA 4B2YA 5M29A 3OQMA 3QHQA 3JQBC 1AUVA 4IMRA 4UCFA 2PQ0A 1M1XB 3NT5A 1Y6JA 4GAEA 4BO6A 1NVWQ 1B14A 1N8NA 4OBBA 2XXBA 3G2KA 4DIUA 1NYQA 5G4LA 3MINB 4I55B 1UOOA 5HIIA 1N2XA 2V98A 4DQ0A 4DNXA 4URVR 1MO4A 7ADHA 6ABPA 2WHYA 2EQ5A 4HRYA 4XAQA 4IDNA 1Q7GA 1YQ9A 4QPJC 2N1MA 4MMZB 4KXYA 4G8BA 4M1OA 4TZKA 1FXWF 3E0QA 4XYGA 4ZDIA 3CGGA 3HU2A 5EC8A 3T52A 2PUDA 3BQ2A 2RJOA 1RWMA 2Y1KA 2VNJA 1G5TA 2N75A 3DWIA 4AJJA 3A9CA 1YI1A 4QAQA 3TIVA 4J9OA 1Z4KA 5FPKA 2FMIA 5AVZA 2FG7C 3LNCA 5HKOA 2WM2A 1XJCA 5C51B 1FJGB 1PUJA 2X8WA 3TACB 3G8BA 3VCBA 3WGQA 3HRHA 4HBZA 3FPKA 1TJNA 3KVNA 1N1GA 2A9QA 2D8AA 2QEQA 2Q3LA 2GBCA 4X3PA 5F1PA 3WYNA 1NU6A 2GF2A 4CEIA 5KQLA 1WDLA 2DCUA 2QG9A 4YJGB 1JLLB 1CUDA 1S02A 3TTYA 3K73O 4BY9E 1CQZA 4RTLA 2ZKIA 3EIWA 5A62A 5FV4A 1VOTA 5LD2C 1XK6A 1QR6A 1JLRA 1RWWA 3PFNA 5IH7A 1JIXA 1EFTA 3PVZA 4BNJA 1HKUA 1PQYA 4ZTBA 5HQJA 2Y27A 4OQFA 2ORVA 2QW1A 3QY0A 3LP5A 3Q0TA 3T5AA 4ZIRA 2XIDA 2A1AA 1NK4A 1DX9A 3GLTA 3WJ2A 2VA9A 1K68A 1FP2A 2O50A 1HX7A 1XYYA 2OZLA 1WQ4A 3CLKA 2AUMA 2CJPA 4RQ5A 3JQ8B 1YK1A 3V1MA 4GDFA 4NMHA 4U9IS 5DG9A 4Z0PA 2BGMA 1XP8A 4RQAA 5AW5A 4DL2A 1C3OA 1LQTA 1TM1E 3EVAA 3RWMB 4ZZ1A 5BWMA 3GEEA 1SHZA 4WJZA 1DC6A 3OAAD 3CLHA 3V3KA 2GZ1A 3PC7A 1JH9A 1C7FA 3Q2IA 3SI8A 1IEQA 3EDRA 3Q1KA 4NEQA 4ZAYA 2WICA 4RVHA 5DT2A 4Z5XA 4P22A 3DDZX 2FEAA 1AGPA 3AERB 3F6EX 4GM0A 3TRHA 3U7QA 5JYCA 1L4NA 1LC3A 1ML4A 3KTAB 5EGNA 5DTMA 4F4ZA 3MJDA 3NBMA 4QWWA 4FLFA 5ALGA 4PHPA 3ZGXA 5I7VA 1QF7A 5JFTA 3SVZA 2J3QA 1WXEA 4I9UA 4MW4A 5J0WA 1VBNA 3C2LA 3RQSA 3L8YA 4JCCA 5KWIA 2GBLA 1ZUD1 3ZNNA 3RVPA 2X0KA 1WCYA 2HWKA 8LDHA 4FNGA 3HKCB 4KX5A 5K0LA 3ZPXA 3IR5A 3MTQA 5GV8A 1G8GA 2HW3A 1R0RE 1XXLA 2WJYA 4HNHA 5BOVA 3NOQA 2DPIA 3OVMA 4IDHA 4MUKA 5JSUA 4L8LA 4GMFA 3K7EA 2LTAA 3C6ZA 3MMNA 5DYGA 3FHTA 3V5NA 4F4HA 1DAMA 4Y2JA 4PX3A 1G5HA 2XIQA 3MLAA 5TJ9A 3AHDA 2XKAA 3TL3A 3QX3A 3ASVA 2ECPA 4D2IA 2WJHA 3BAFA 1CLUA 3IQWA 2HEGA 4IIHA 4ZXFA 2HYDA 4RCZA 1W44A 4MA0A 1FYXA 3OE1A 4ZQEA 4DSNA 5L6MB 1Z68A 2PGIA 3JQAB 4HWRA 3PS9A 1EX9A 2ZRNA 4G37A 3INTA 3C3YA 1R4MA 3T3OA 1VC2A 3ODGA 4LDAA 3IVMA 2MMCA 4JYMA 2BI7A 1VHLA 2GCIA 3UKDA 4H4EA 3CUKA 3AH8A 4KXWA 1Z6GA 5AXBA 5TPZD 5IAJA 4KHZA 3SU8A 1OI4A 2IH5A 2NYVA 5IKPA 3JYOA 4MWGA 1GPWB 3VHXA 3ZNPA 2JAPA 4AVYA 3WL4A 3UHOA 3F2CA 5BORA 2CXQA 2XWJI 5DF1A 2BHRA 4KCGA 4P92A 5DMHA 3V2IA 1P44A 3INNA 1KFCB 4PG6A 4M9UA 3HUFA 3CRZA 1SA0B 4KXMA 3I2JA 3SC3A 2EAOA 1R0ZA 1XMPA 1J7KA 1HT3A 2WWFA 4RLHA 5C1OA 1PJZA 1KP2A 1RQ2A 1C7YA 1RBZA 2WU1A 3MBKA 4A23A 2NVWA 3H1GA 3A4IA 3D3NA 1AS0A 1LX7A 1X7XA 1Y8RA 3IYLW 3OSNA 2XRFA 2V6GA 4KYVA 5A3QA 1IPHA 3DJYA 4XPZA 2IV3A 5LOVA 3ZC3A 3A2MA 5J0UA 1UP6A 1W30A 2H7CA 1M10A 4PLGA 5BOSB 5DM4A 5FYQA 1GUFA 3GEMA 4RD0A 5CIQA 5A3SA 1RM6C 3WIVA 5KT5A 1GZUA 3UOGA 1NW5A 4KIJA 4UPEA 4QKQA 3T7CA 3ZLJA 2NNWB 4F6RB 4LZDA 4KL8S 5THQA 5FNZA 2YUTA 2PZAA 2UZ0A 4KTVE 2OO5C 3QOWA 4KO2S 3WGUA 3UICA 4UQPA 4LGCA 1DCKA 3IP6A 1SXEA 1P73A 5LQRA 5T4HA 4QZHA 5B57C 1R3UA 2Z5GA 1FMTA 5C1BA 2F1KA 3ZOKA 5HPYB 2C9OA 1LKZA 2AKYA 2HA4A 5JROA 5CEEA 5L3VA 3ELUA 4R1NA 8ICVA 5L1LA 3RT1A 4NNPA 4NFYA 3RF7A 2FUCA 3ZJYA 2P4SA 2X5JO 3P32A 2YHIB 3MMPA 2RI0A 1SOAA 2Q07A 1MVNA 1WOMA 1CCWA 4IOMA 4Q4LA 4UU8A 1TK5A 2VPQA 3CPSA 1A82A 3F6BX 3E58A 4GOND 2CNOA 2F43B 4MV8A 4UNPA 1E4VA 2QRKA 1HURA 3KWJA 2YWRA 4CM4B 2PE5A 5IAKA 3BIFA 4ICAA 4D4LA 3IERA 3GFTA 3AQ4A 3N2NA 4YVFA 4V1CI 3T3HA 1NMXA 4KXQA 1YQQA 5KG1A 1C9YA 1QHNA 2V45A 3OQJA 2C4MA 2EERA 1HSZA 3CXUA 3GHYA 3JWHA 2J4FA 3N0VA 3VSBA 5JYEA 1LRKA 2IS6A 2ASLA 3JQBA 4I5EA 4X92A 4KSYA 4ED7A 1PF7E 2PX0A 2X13A 1ZI8A 3BTVA 2FW0A 3S70A 3VHLB 1X8XA 2WWIA 3PWZA 3T4UA 5JS1A 2PPLA 4JN6B 4HD8A 2BFMA 3QFRA 1ZQDA 4URXR 1W88A 5TIIA 3S1SA 2MHCA 1U65A 4RHEA 2AC4A 1XDBA 4TL7A 4XASA 5B6PA 1H2BA 3CNBA 3IJEB 4LVUA 4NJEA 4JYBA 3F3KA 2RHJA 3ZTTA 3NAZA 2HGZA 3TSYA 1SXIA 4P3PA 3H2IA 5HR6A 3NI2A 1C0KA 3DTVB 4ETMA 4KR3A 2H3QA 4UBKA 5CH5A 3U44A 1H05A 4DKXA 4PLTA 1D1QA 1MP0A 4AUEA 1BE8A 1R6XA 3H8JA 4H08A 2EZYA 1GEGA 4K7JA 4BO2A 2DL0A 2EW8A 2HN9A 1AKUA 4P4TA 3NGDA 1MXFA 3RYHB 2MU1A 3I2YX 1PX2A 1Y7PA 2CLSA 5E1OA 2A0FA 3AINA 4RH0A 3QKUA 3K35A 3C2KA 5KCZA 5CLHA 1E2IA 3IEKA 1FEZA 2J3EA 5EVCA 1GUBA 2AZ4A 2E9SA 1NOKA 2GD2A 3S55A 3NHYA 5THXA 3KQSA 1OKKD 3GEDA 4EABA 3IT1A 1KC3A 3B85A 1NW9B 3A1VA 3RVSA 3I0NA 3BF8A 5KFZA 3AEKA 2WINI 4G6ZA 4LQDA 1Y4ZA 1M8JA 3SOZA 5A71A 4BRWA 2HUNA 3MTBA 4AD8A 2G07A 4XB6B 1P6UA 4RDHA 1RXIA 2V55B 1B2LA 2ZXEA 4Z6FA 3NCHA 3MT9A 4ZYXA 1W5TA 4WOCA 2J0SA 3FNFA 3O6VA 2C5LA 2F3UA 1JI0A 3K20A 4TRRA 4TXNA 2IHZA 3MD0A 5J0PA 1Q2XA 3B3FA 4B6SA 4F84A 3LC0A 3RVBA 4QZVA 4WY8A 1ZM9A 4YDRA 2W03A 2J9ZB 4OGGA 2CXNA 2EBFX 1WCIB 3BFVA 4J4HA 5DDIP 3I4CA 3SJZA 2XYVA 2A3VA 1I10A 3B89A 3F98A 4OM7A 4OJ6A 3ZXYA 4OL9A 3R74A 2ZANA 4D9IA 5HF8A 3V8EA 4NK5A 2QNBA 1JAXA 1T3ZA 1HKHA 1Y1PA 4MWZA 4EFLA 1HRKA 5I9LA 5EP2A 4CM9D 1E0JA 1EJ6A 3ONFA 4JDUA 3TGLA 2C29D 1J00A 1T6XA 1GNQA 2O1WA 2HA3A 2O1XA 1XZLA 1U0HC 4PNHA 4DQUA 3QOFA 4PRZA 3HYTA 2YB4A 3QUCA 1UBNA 2JFXA 2D74A 4B4UA 2J6SA 4AXBA 2JH1A 2IU0A 5KJEA 4OP1A 4XIYA 2PT7A 3LLSA 2GCOA 5CVDA 3UWPA 5ADUS 3U6KA 2V1UA 4Y30A 5JUWA 1D04A 5JYDA 3D1LA 4CUJA 4EJFA 1Q0TA 5DOZA 4YTEA 4DJ5X 5J0OA 4I6JA 1T2NA 2H5IA 1YT3A 4XPIB 2IEBA 3IEVA 3EIFA 1OD6A 1TVEA 1U9YA 2F3QA 4AY3A 1GZ3A 4QYIA 3EPLA 3KSRA 3GLHE 4YMSA 4ZANA 3KJGA 2WYVA 5KAMA 4NS4A 2AXPA 1IJBA 1I36A 2DQYA 2C7GA 1R00A 4DREA 3BJEA 1A8SA 2MSNA 3KAKA 2RGAA 1SQ5A 1A04A 2HJ9A 4A36A 2J30A 2V4QA 2R6CA 4ICIA 3EZNA 1X2IA 5FTKA 1UFOA 2NTNA 1VDZA 4YA6A 4BP1A 3U2QA 3OOJA 1UBSB 4UHFA 1XNGA 2Q8NA 3JARA 4C4RA 3NH9A 3TVDA 4RENA 2C0PA 2CT8A 3C5HA 4S35A 4XRRA 4F91B 1E8NA 1JJIA 4KGVA 2D2IA 2A9JA 1AJEA 5DHQA 3CCCA 1L7XA 4K2AA 3PHHA 2J48A 4WCFB 2DPXA 1B4FA 3E7DA 4F8EA 5K0JA 1VYUA 4UAYA 2J07A 3EB9A 3IQIX 2XF8A 1P9NA 2VPWA 4O3NA 8ICGA 2MA1A 4R1MA 5FLEX 3PDHA 4DNPA 3PNVA 4GMDA 2ZE7A 5ERGB 1LD3A 1UT6A 4ELUA 1MQ8B 5H02A 1THGA 1RYDA 4CTOA 4H1HA 1ZUNB 2HR1A 1KQQA