3QXGA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron complexed with calcium, a closed cap conformation
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
222
structure length
222
Chain Sequence
KKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 84
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qxgA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qxgA01
4BBJA 4BNDB 3WK7A 1RMYA 5AKZA 1YDFA 2FUEA 3FZQA 5AW7A 1O08A 1VJ5A 3MC1A 1Z4LA 1WPGA 3AR8A 3B9BA 1PW5A 3OCUA 3E81A 5AM4A 1X42A 2GMWA 4KNVA 3NANA 1T9ZA 2FPSA 5AI8A 3NIWA 3L1UA 3E8MA 4G9BA 3PCTA 2AGVA 1L7OA 2HX1A 3WK6A 1L8OA 1EK2A 3EPRA 4O8CA 5IT4A 3OTQA 1TJ5A 3K1ZA 4EELA 1NF2A 4YH1A 2MU2A 3WGVA 3W5BA 4F72A 2JARA 2B30A 4Y2UA 3B8EA 2FPRA 2WHEA 1Z4MA 1L7PA 2HSZA 3L5KA 1Q92A 2HCFA 3N5KA 4GXTA 4NV0A 3QUTA 4IFTA 3OCVA 1RPZA 5AW6A 2ODAA 3QYPA 5ALKA 2MSNA 5ALGA 3QUBA 2HI0A 3SLRA 1XPJA 5ALJA 3OCWA 1U7OA 4FFDA 4UU1A 5AM2A 1ZS9A 5ALWA 1LVHA 4CF5A 3UMBA 3ONNA 4IG4A 1RQLA 1TJ3A 1J8DA 4I9GA 3IRUA 4AP9A 4BX0A 3ZUPA 3A1CA 4DWOA 2HF2A 1Z88A 5AVQA 2I7DA 2ZG6A 1ZJJA 2ZBGA 2YJ5A 2O2XA 5ALFA 4XQ0A 4YGYA 3QU9A 3BWVA 1Z4KA 2AUTA 3QLEA 4DCCA 3W5AA 1NNLA 3GYGA 3NUQA 2P69A 5AESA 5AK3A 1O03A 4L6AA 5ALLA 5AKIA 2GFHA 2IOHA 1S2OA 3N8GA 5ALOA 1L8LA 1Z4JA 1Z5GA 1Z5UA 3TLMA 2HHLA 2Q4RA 3N28A 1RKQA 1KYTA 2I34A 2EARA 2WF9A 2W11A 3HLTA 4UW9A 5AVUA 4JDPA 5AW2A 5ALXA 4ZEWA 2WFAA 2R8XA 5AVXA 4C4TA 2PQ0A 4BYGA 4YCMA 1RLMA 2WF6A 4DW8A 1K1EA 2QLTA 5AI9A 5AM5A 4QQFA 2I55A 1RKVA 2CFRA 4UM5A 4YIKA 3HYCA 4AS3A 5A3QA 3R9KA 4H1WA 2I54A 1WR8A 3RF6A 3ED5A 2ZBDA 5ALRA 3AR6A 4Y2JA 2I6XA 3QNMA 3VAYA 1CR6A 1T5TA 3WK8A 2GHTA 5AW1A 1ZD4A 1SWWA 3ZWKA 1RMQA 5ALDA 5AI0A 3NAMA 2FEAA 5T41A 3SD7A 2Q5EA 5A3RA 5A3SA 2FDRA 3E58A 4CE6A 2DQSA 3KZXA 2CN1A 1QQ5A 4UARA 4B6JA 3QU2A 2ZBFA 1ZD5A 2G1AA 3KDPA 3QU4A 2YN4A 4Y2VA 3M9LA 5AKHA 3WK4A 3F9RA 1MH9A 2FPXA 4BX3A 1QYIA 2FUCA 2B0CA 1VFPA 3QUQA 1FEZA 4HYTA 2ZXEA 4NFLA 1LTQA 3ZVNA 3U13A 3AR4A 3L8GA 5AKEA 1N8NA 3NASA 3L1VA 3QUCA 3FVVA 2AH5A 3L8EA 3ZI4A 4Y2RA 4UASA 4ZEXA 3L0CA 2G07A 2G09A 1YJ5A 3E84A 5ALSA 3UMGA 1JUDA 2B8EA 3W5DA 2YJ4A 4CF3A 1Z4PX 2WF5A 3BA6A 3KC2A 1Z4IA 2JGAA 4EX7A 1N9KA 2JAWA 5AVZA 1VJRA 1WVIA 4XPZA 1CQZA 2C4NA 5ALZA 3J7TA 4UATA 5ALVA 2R8ZA 4OD0A 3WKDA 5AKYA 3ET5A 3QU5A 3EF1A 4PNHA 3DAOA 2RB5A 2X4DA 3L8HA 5ALYA 2OA0A 2PKEA 4RETA 4BEVA 1U2SA 2NO4A 4KNWA 4BKMA 5AKKA 1J97A 3FPSA 5E0OA 3SF0A 5AW3A 5AKLA 3U19A 4I9FA 3IJ5A 1F5SA 1L6RA 4UAUA 2IOFK 3OCZA 4HGPA 2WF8A 5AKJA 3KD3A 5AVVA 2YFYA 1TJ4A 3PDWA 2YJ3A 1L7MA 3P96A 5ALMA 3UMCA 3FGOA 1U02A 3MPOA 2OYCA 4BEWA 2O9JA 5AW8A 2Q4TA 3I1YA 4OCZA 3I76A 4FE3A 3N07A 2B1RA 3WKBA 4UU0A 3I28A 2YJ6A 1RLOA 2D2VA 4NWIA 3AR7A 1YNSA 3ZW7A 3A3YA 5ALTA 1Z4QA 4EEKA 4DFDA 3ESRA 2C8LA 3W5CA 2P27A 2ZBEA 3L0YA 4L6CA 3AR5A 2OM6A 2HDOA 3ZX4A 4MUMA 2IOFA 1YV9A 2VKQA 3MMZA 2HEGA 3U26A 3U7FB 1XVIA 3L7YA 4YCNA 4RESA 4C4RA 1WZCA 5AW0A 2B1QA 3ZX5A 1EK1A 4NAVA 4UMEA 5AVRA 3QX7A 3KOOA 3OCYA 1Y8AA 4KX3A 3I6BA 3S6JA 1SU4A 4HGRA 2ZOSA 3QXGA 5ALIA 4C4SA 3CNHA 4Y2TA 3KBBA 4Y3UA 3EWIA 5AW9A 1RKUA 2P11A 2W43A 4F71A 4ZEVA 2IYEA 4HGOA 2RAVA 3U7EB 1XP5A 2NYVA 1TE2A 3SKXA 2NO5A 4Y2XA 5AM1A 1YS9A 4E88A 3ZTYA 2EAUA 3NRJA 3RFUA 5AIBA 4YIHA 3WGUA 3WKAA 2YMMA 5AI5A 4KN8A 3MN1A 5AW5A 4UMDA 3SHQA 2BDUA 5AM3A 5ALNA 2R8EA 5JJBA 1QH9A 2I33A 5AM0A 5AVSA 3DDHA 3EF0A 4Y2SA 2P9JA 4CF4A 3ZTWA 5AKGA 2YBDA 2HF7A 1RC8A 5ALHA 2RBKA 2AMYA 3SMVA 4UAVA 1QQ6A 3OPXA 5FP0A 3R4CA 4XE5A 5AK5A 1NRWA 4QJBA 2HOQA 5ALPA 3UM9A 5AI4A 1T5SA 1YMQA 3ZVLA 4AS2A 1AQ6A 1ZRNA 2C9MA 4UM7A 5AW4A 1RQNA 4OHFA 2CFTA 3PGLA 4NABA 4BNDA 2B82A 3OCXA 4HGNA 2BDEA 2C8KA 1IWOA 2C88A 3ESQA 1Z4OA 3SKYA 5AVYA 3IB6A 5AVTA 2FI1A 1L7NA 3QU7A 5IT0A 1RMTA 2JAOA 2RARA 2GHQA 5ALUA 3ZWDA 3U7GA 2R8YA 1ZRMA 4EX6A 3CZ4A 1ZD3A 2QYHA 2GO7A 2WM8A 2HO4A 2W4MA 4UMVA 2CFSA 3ZU6A 1RDFA 1Z4NA 1RLTA 1U7PA 4BX2A 2FPUA 4L57A 3FM9A 4OFZA 2YY6A 5ALQA 1QQ7A 2PR7A 4Y2PA 1Q91A 2FPWA 3U7HB 3D6JA 2G06A 5AVWA 4YCLA 2B8JA 3L8FA 1ZOLA 3L0BA 3DV9A 5ALEA 3A1DA 1RRCA 3WK5A 3AR3A 3DNPA 4HAIA 3N1UA 1ZD2P 5AICA 3ET4A 3WKEA 4EENA 2G08A 5AK4A 2YMPA 3ZVMA 2EATA 3NALA 3AR9A 3WK9A 1S8OA 2YMQA 3B9RA 3R09A 4Y2QA 5AKXA 5IS2A 3FPBA 4UMFA 1U2TA 3PGVA 4KX5A 5AI6A 3AR2A 5AHXA 2BY4A 2OBBA 4KYTA 3M1YA 2WF7A 5AK6A 4HGQA 4Y2YA 2IA5A 4J03A 3A1EA 4MWOA 5AIAA 4FYPA 2G80A 4GIBA 4CNQA 4J2TA 4JB3A 2JAUA 4XOUA 1TA0A 2MU1A 2G0AA 4EZEA 3QGMA 3WKCA 2YMLA 1SWVA 4G63A
chains in the Genus database with same CATH superfamily
4PYKA 3L79A 1EBUA 4M0PA 1JEEA 5BR8B 4MQLA 1AO0A 2O0MA 2V7XA 5KOJB 1JJ7A 4Z4QA 1TRKA 4NBWA 3LRXA 1A5TA 5DQGA 3RJJA 2OCXA 1JH8A 4QQRA 3DC7A 5J2FA 3VR3A 4JJ6A 2B30A 2EEPA 1NVUQ 5B1EA 3A6DA 2FEXA 3P32A 1S2DA 1ZRSA 1ZH6A 4K81B 1HQDA 2X8BA 5EMKA 3I1FA 3D02A 1C14A 4YGXB 3OQMA 2PJRA 2C9YA 4KSYA 1GNTA 3B5EA 5AUOB 3DVLA 2YQ5A 3FUXA 4RF2A 4FHZA 2M6LA 1CJTC 3PT5A 5F5LA 1PL0A 2PD3A 3C1OA 5I9BA 4EBDA 5I48A 3W3AH 3IQZA 3H5NA 3NRZA 1P2TA 2IW1A 2BFEB 2QRUA 2H6EA 3Q6IA 3RU2A 3ZI7A 1ZAKA 2G5HB 5J2UA 3FPHA 3C6ZA 5ALRA 4HY3A 4XA5A 1D8AA 4ZAFA 3SZGA 5ALDA 2YQ4A 1X13A 5SY6A 4RMHA 2KLHA 4HZUB 3M9LA 4RJKA 1HDGO 3BZWA 5D6OA 5J4LA 1H2RS 1B0ZA 1ZQTA 1SN7A 4HS4A 5G2OA 1KSFX 3R3YA 5IDQA 1KFEB 2X7HA 2EW2A 1E4VA 4BFXA 1GGKA 5IVHA 1J0BA 1X2IA 5IIIA 3FCYA 1BE1A 4CIYA 2B99A 2E4VA 3ZK7A 4W5TA 3W2GA 4LOKA 4X41A 4N9WA 2WB1C 5KKNB 3DAOA 2CNNA 3ZZUA 1Y8ZA 3ZQKA 1Q5PA 3ZXYA 5FBLB 5DV9A 1SXHA 4FKMA 4RQBA 3DGFC 1R5OA 3S7ZA 4UNNA 1X6JA 4F3CA 3VO2A 4LZWA 3D9QX 3Q8PB 2PWBA 2YFYA 3JSAA 1JG7A 3PJFA 4C7VA 2VYQA 3VPSA 4TMVA 4X44A 2CVQA 1XAIA 4N03A 1QTMA 3DO6A 1I3CA 2Q62A 1Q84A 4Q43A 4R7GA 3A3YA 2W8ZA 4X5VA 4Y9DA 2X6TA 2IIQA 4UTVA 2XOEA 1SCDA 3TH5A 2TMYA 1MO5A 1KFDA 3K9QO 3A0HU 1MZVA 3CNEA 1CIPA 2EFYA 1CYDA 3ZLUA 2JHGA 1SXPA 3MS7A 2GOLA 5IILA 2CD9A 4GRIA 5BNFA 4FT4A 4AO7A 1SXJE 4DFMA 2JD2A 4MO9A 4H2DA 3PDIA 3GLHB 3DBVO 4Y3UA 1N61A 1T15A 2OCGA 2NYVA 3Q2KA 3CF2A 1V43A 4LX8A 4LW8A 1CW2B 3ODPA 2GCOA 4YY3B 4TWJA 3EXAA 4USAA 8ICRA 4PCVA 5FTNA 4WOBA 3FYUB 2Y2UA 4ESOA 4UAVA 3QBEA 3HJEA 4TWRA 1MOSA 5HTOA 3H0RB 2PWPA 4GPAA 2OZKA 3GFGA 5JI3E 3SFVA 4QWDA 1Z4OA 5KFTA 3A4VA 2BHSA 3GIDA 4HDRA 1BQ3A 4O4HF 5J58A 3SIRA 4RS3A 1B0PA 2PXCA 4TUYF 5HJ7A 3THVA 1UMDB 4M9LA 2FPUA 4NYMR 4OB8A 2H3VA 3H4BA 3UNXA 1LS1A 1MJGM 3JVVA 4JT4A 2WE7A 3IAEA 4BZXA 3JD2A 3B6IA 1P72A 1CNMA 3ZDYB 1GZHB 3ALRA 2XGPA 4RX1A 4HDNB 3KPUA 1M1YA 1VKOA 4HOYA 2Z6VA 1G4HA 2F6RA 3R7BA 2BY4A 2PL1A 3Q0TA 4TT3A 4J03A 3LMKA 3KHKA 3ITEA 1T9CA 4BTVA 1DTSA 3G9ZA 1XYYA 2V45A 4ZJYA 5NLLA 3UENA 5JU6A 2C7VA 2BEWA 4C8LA 1RABA 4BNDB 4Z4EA 2GJKA 1CDOA 2DY0A 5FTJA 3TIFA 2AWOA 2G8NA 1ID8A 2P1ZA 4Q3KA 2R0QC 1O8CA 3OICA 4OA5A 2ORED 4GDMA 2ZI9A 2CZCA 1VRCA 3PDUA 4H7KA 3BXOA 1ZQXA 3DP7A 4I2CA 2F8KA 2JI9A 3OCVA 2QVYX 4EIWA 1BVRA 1RAIA 2IZ6A 2GK6A 1JTFA 3QF7A 1N60A 4NCIA 5DRTA 1G42A 3VPGA 4PX9A 4LVSA 3WIOA 2I34A 3MCZA 1ZW6A 1JDNA 2D54A 2XIDA 4QWCA 1GQRA 4BYGA 2J4CA 2X41A 4X60A 1K8YB 1LDEA 2GX6A 2WTMA 3LOUA 1W6RA 4OI1A 3ZNOA 3VV3A 1TPYA 1RVV1 1SL1A 5BSFA 3CVXA 4G81A 4XSGA 2KBFA 3Q15C 3K3PA 3IMGA 2QN1A 2VNAA 4HNAA 4O2AF 3HG7A 5DHAA 1VLVA 1ULUA 3WWOA 2NPOA 2J48A 3FVQA 4OK6A 2A88A 1YS1X 2A0UA 1P9OA 2AZXA 1CR1A 5KFMA 4JCCA 4QUDA 3GIIA 3WBKA 3UMGA 4A6XA 1T8WA 3GZFA 2HRRA 1BFUA 1SZCA 4HMQA 1P5JA 3BJIC 4P4TA 4JI6B 2R8ZA 5GTHU 1E8DA 4UHEA 2OEPA 2HVIA 4YJ2F 2A59A 4FDMA 1BJKA 4FYVA 3SF0A 4QNNA 2PZMA 5EP1A 4LBWA 4OLBA 4R66A 4KDCA 1PVDA 1QVAA 3DTVD 1A7UA 2QTGA 3GPLA 1KKLA 1T34A 3ZCPA 4DOAA 1OI7A 3TSAA 3BK2A 5E6SB 3WTBA 3B7WA 5IK2A 3BL8A 3EUFA 1W36D 1ZM7A 4P31A 1VIVA 5CVCA 5LP1A 4JOSA 1K7SN 1AHNA 1PO7A 1OD6A 2IV2X 4GMFA 2C03A 1ZNYA 2WWIA 3MINB 1S8NA 1FFYA 3GLHE 2C2KA 3WXBA 3GQCA 3V6KA 1DRUA 1P4JA 4OGLA 1K1QA 2AVNA 5G5HA 1OWOA 1O97D 1QMGA 4EYKA 2EFGA 4MGEA 2KJ5A 3E9RA 1OA1A 1YH3A 2YC2C 3T5DA 2WWFA 3SJCA 1F51E 2DPMA 5JR3A 5K0CA 1GSAA 1QQ6A 1SU7A 2J0VA 4KGDA 4AULA 3ZJ5A 2PUGA 3CVOA 4B6RA 2DWOA 3F67A 4MP3A 4BJQA 5L95A 1AA6A 5JVDB 5KFBA 2GETA 1NQWA 2IH5A 3CLSC 1DUIA 3BN3A 1PZHA 2ZI7A 4CDMA 3N0XA 4D6PA 3UQZA 5KFKA 3JPNA 4JJFA 3MTQA 4CLXA 3AHIA 4O29A 1KE1A 1GKKA 4NLLA 2PV7A 1QCZA 1JSCA 1BGVA 4E5MA 3RWMB 3NBYC 4M1EA 2XQFA 3W05A 3T7SA 3IIMA 4OX9B 5LMNB 4PYOA 5DHUA 1CYEA 2VP4A 3IE1A 1A76A 3WOVA 3PITA 1AY0A 2CFCA 4WTOA 3C43A 3OQIA 1KP2A 1X9GA 3KWMA 2JR5A 1L9XA 3RC1A 3QEKA 4EPXA 2AJ8A 1QC5B 4BBJA 3NM5A 3E27A 4NZNA 1CZNA 3KXKA 1A0OA 5B66U 3EMDA 1NOIA 2B7LA 4DL5A 1XC7A 2N1RA 1IL0A 4BS9A 3UKJA 3A1SA 3M6KA 4YQZA 5JT1A 1X3SA 2IXBA 3UOWA 4YRKA 1T3TA 2J46A 5CTJA 1Z4MA 4HG2A 5AUNB 2HSZA 3MNFA 2IEDA 4Z2AA 1V8PA 4KR6A 1IV8A 3HXOA 3AEQA 1QRAA 2QRPA 2XT0A 4FQ8A 1UZLA 3CZ5A 3WICA 3GUVA 2Z1DA 4KE9A 1XR3A 4AP9A 1WYGA 1XYGA 4B73A 3BCHA 5U9CA 3BIOA 1D8TA 1YTUA 3F71A 3F5MA 1T4GA 3W2HA 2WU1A 1S3SA 2OZEA 4P4LA 5KHLB 2UYYA 2FEMA 4CT0A 5LYJB 3LUBA 3HU1A 4J4BA 2XTAA 5FOVA 1F1JA 1Z75A 2YIMA 1GV0A 4LCEA 3U4DA 4N1AA 3PPXA 4HTFB 3WXMA 5TIIA 3R9WA 3FDJA 3PF8A 2NU6A 3LVVA 5IM4A 3RUAA 5DJ5A 1Z1VA 3X1YA 4OXQA 3D2LA 4L4RA 2GAJA 4N0DA 4K0RA 1E60A 5EPUA 1E92A 3HV0A 3TJMA 3HUTA 3PEYA 1KBOA 4QOHA 2Q41A 1O6ZA 4FX2A 1BXKA 1Z19A 2OD7A 1WXFA 4BXOA 5JTUA 4EO7A 2JJ1D 3D5EA 4LJRA 4OI2A 2VS1A 1SH7A 2VYVD 2UU9B 5JFTA 2GNPA 3BEOA 4Q1BA 4MKZA 4W5QA 4PHFA 3S5UA 3LXUX 4DV1B 4KITB 3FAHA 4CFZA 1BO6A 1MQAA 2WMNB 3QA9A 4YHHB 2IRWA 3K20A 1XELA 1QE5A 1XSPA 3QLUA 4HTAA 4AW9A 4B7ZA 3L7IA 1PWYE 3GLFA 4ZYYA 3E8XA 5LN1A 4ND8A 3WYNA 5F35A 4O2LA 1D07A 1FP6A 4OYLA 4DL4A 2BDPA 4E14A 2WAXA 4PZ9A 5A5DA 3DLTA 3FGPA 1C7QA 4D81A 1GSIA 2VHEA 4BO0A 2AHOB 4BNJA 4QFDA 1KI8A 1NBME 3N4MB 2VPIA 4D4HA 5AVRA 1TT5A 3BJZA 2K6GA 4GLXA 4IXDA 4QZHA 2KBEA 1LC0A 3U3OA 1U3WA 3PDJA 1NKSA 1X9IA 2DUNA 2IZ7A 5JNTA 1UKAA 2VSXA 2VUTA 5G0TA 4KO2S 2YNMA 2VN8A 4WNIA 1QNFA 1W0KA 5BT8A 1ZQFA 2V4ZA 1P0PA 1PK8A 1AB5A 2HZBA 4NY8A 1YDHA 4F5EA 4MKHA 1KPHA 1N5MA 2O2EA 2VJOA 3E9QA 5ALPA 3A4MA 2O7NA 1CUSA 4KIUA 4D6YA 1YHZA 3ICWA 1LWOA 4L0DA 2FSVA 1Z2NX 1YDWA 1ONBA 3HCAA 2NUAB 4J0HA 1GPJA 3IB6A 3HN6A 5FBHA 2OXEA 3CWCA 3HJGA 3OQNA 5KYYB 3LNTA 4JOQA 4D74A 1DTWA 1KK1A 2GEVA 1G0NA 3WIVA 3JRNA 1JN3A 1NATA 1QYRA 2HXSA 2JZNA 4I1VA 4KH0A 3HO8A 1TAGA 2IEYA 5TMDA 3R09A 2H4YA 4OKNA 3D2SA 1QF6A 1UM9B 3PGVA 1HYBA 3PI6A 4K9NA 2ZB3A 1TTTA 4DJFC 1YJBA 1OB2A 1YZKA 1U9YA 4L85A 2AZ4A 3CNNA 4R1SA 4UAJA 4FEEA 5KYUA 3A1NA 1V9SA 2XB8A 2QBYA 1OY1A 2R2GA 3I04M 5CVEA 3I5UA 4CEHB 4H0FA 4EG0A 4EELA 2GPWA 2XCAA 5DTRA 4EJSC 1ISMA 3K0SA 4UE2A 1VLJA 1UUFA 2H8KA 5KX5A 5F33A 2G6BA 2SBTA 3NFYA 4WERA 4MUBA 1U63A 3K1TA 3PKIA 4J4HA 3E9MA 4RORA 1ZQGA 3ROPA 1DBWA 4P33A 1F1BA 2I66A 1NSFA 4ACBA 2H0AA 2ZBQA 2JGLA 2Y6VA 3SE7A 1QPGA 2I1QA 2PXHA 4M1YA 2O57A 3EWAA 7ICIA 4JWMA 1V5WA 1JSLA 3GAAA 4DM7A 4LK3A 3TOZA 4II3A 3AM9A 1USIA 3NKFA 4DXHA 3WJ1A 1LKYA 1JA9A 5K0BA 4ZQFA 3QG1A 5ANRB 4PLPA 4GOMD 3I3SR 8ICEA 1TM1E 3D6FA 2FMPA 2AL7A 3VR4A 2BL4A 3NJ4A 3QKSB 3WTCA 4FHEA 4PTYA 5B7PA 2ZIGA 4M36A 1OFTA 2YXNA 4UTRA 4JUZA 4U7DA 4HO1X 1Z62A 2P6NA 3VGPA 1KVQA 4PL1A 5LBUA 4Y2VA 1VCOA 1ZUD1 2CUZA 3LLMA 2CW5A 1E96A 2BGTA 4DYHA 4ACOA 2YRXA 3OZFA 2C42A 5HIKA 3DFUA 5AVOA 3I0NA 5J0TA 1Q2XA 1TUEA 1I6KA 1G2IA 4BTEA 2CVFA 3JATA 2O23A 2O2IA 4JP2A 3DBLB 4UHJA 5BW5A 4CLHA 3WY9A 2AIRA 1THZA 3NP9A 4G0PA 1T0BA 3LUDA 2WILA 2P2DA 5HKOA 5K05A 2NZYA 1I2ZA 3SLGA 2W6MA 2FMHA 4Z9XA 2I2FA 3OFKA 2OO7A 5I5EA 4DLXA 3TXXA 2CDRA 1OQAA 1JP7A 3T3GA 4RLSA 1G20A 3I37X 3QLVC 2EF1A 5GM2A 3JYQA 1Z00B 1U2EA 1UBLS 5E3HA 1OREA 5K0TA 1NKCA 5LQJA 2BH2A 4MUMA 1QRRA 4OH7A 2GZAA 3V32A 4UE6A 1SRQA 1X0XA 4DMCA 5HIAA 3I2GA 4XDGA 3V97A 3DW3X 3L8DA 4AKTA 2P2CA 1X74A 4PTZA 1HYQA 2CCKA 1TVKB 4UFOA 4MWEA 4E0BA 4KNYA 1DC5A 4ZQBA 1ZESA 2ST1A 2XCTB 5BYBA 1VI5A 1VL2A 4X6XA 2PWAA 4MR9A 1E9EA 1DQPA 5AUPB 5AVJA 3WGYA 3CRRA 3GL9A 4D97A 1IN5A 3RS0A 1QXSA 3S8MA 1OAKA 1HUZA 1TK5A 4WH0A 2TECE 3EUAA 5IAOA 1Z6ZA 1XQXA 4UM7A 1IY2A 3EUEA 3S2GA 1RQNA 4LGMA 1NKVA 2W03A 3F6EX 4BNZA 3S81A 3G59A 3HL0A 4GGPA 4EBCA 1VG8A 2R11A 4D9EA 3IBSA 1NZBA 2BTOA 3AFOA 4EX6A 3MOIA 3BWMA 1O7JA 1RDFA 1OZFA 4JP8A 1DNPA 3NOXA 1MR3F 1NLYA 5MN5A 1ODJA 1XZQA 2X8JA 2PYDA 1KFJB 4IS7A 2ONYA 4OI4A 3Q2OA 2YNMC 4ZO7A 1L1EA 2XY6A 2YWXA 4M86A 2A9VA 5EKDA 3O1JC 2PMEA 1TQHA 1T2CA 5BW8A 1LLUA 4DOMA 1Z0FA 4C0AC 3VVBA 3IDQA 4WBNF 4X94A 3AZPA 3Q7TA 2O7VA 2DU8A 1NVTA 1Q17A 4CG0A 4I1OA 4EG5A 2HO5A 3E70C 1SWVA 4MICA 4UAGA 1GYRA 2C58A 3SZUA 7ICNA 1NMXA 5E1DA 2O6LA 4W82A 2BCSA 1Z15A 4HXGA 3EFOB 5HE9A 3HYNA 3T38A 5AHOA 2O3JA 3CS3A 1NNEA 1YFKA 4PICA 7GPBA 3V2GA 4UFNA 1M0EA 4I4TB 3FTFA 4OI0A 2RHBA 5I47A 1G2OA 3ZE7A 1GPLA 2OBNA 3H4DA 4HNGA 2D8MA 1ECGA 2LBPA 5B6IA 1T0HB 5EIBC 3RFAA 3FNRA 3TQFA 2REQA 3QMMA 3OEHD 3P2YA 4NK5A 1DBPA 3M2PA 2WJYA 1J2YA 2OV4A 4F1WA 3VHRA 2FFRA 5KNCA 3AV3A 1Q46A 4IR1A 5C7LO 3A7EA 5ALXA 1XQ1A 3TLGA 4V0RA 1A8PA 2RHCA 4KN6A 3EEBA 2XXAA 2O7SA 2I55A 2CFRA 5CXSA 3SV3A 2OMKA 3EQ6A 5DB7A 1D1PA 4P2GA 2QTCA 3RKSA 1POXA 3KTAB 1G21E 1NMZA 5CVTA 5IZ4A 1X92A 3NV9A 1M2NA 1J9ZA 3H9GA 1HDXA 1XU4A 4MGKR 3FI0A 3HJCA 1JKJA 4DSKA 1KHHA 3T35A 2NG1A 3AIIA 1EUDB 4O59O 4UARA 2JGKA 1B6TA 2WVHA 3JD0A 5D3QA 1EVLA 3KOXA 3K9BA 3TFWA 1W35A 1M8KA 4IKEA 4IZHA 4AIRA 3WHKA 4HPWA 1TOAA 4ED2A 2D3TA 4OLFA 1XEWX 4NLZA 2WV9A 2QZZA 4BWMA 2ZE6A 3E84A 2WFLB 3W5DA 5IU6A 1HX7A 4Y9SA 2FLKA 2QMUA 4OQQA 5BY2A 4EYHB 1WZUA 2FQ1A 3VU3A 3HVJA 1H4SA 1CY1A 3IXLA 4BV8A 5AJVB 3H1AA 1P4RA 2HA0A 4JIMA 5EINA 1P0CA 3URMA 1OX6A 4I5EA 2WFMA 2K5UA 4X8MA 4S05A 5D3KA 1Z8NA 2G83A 2YJ3A 4M9UA 4I55A 1T6XA 2BFOA 4GF5A 3EDCA 4RCZA 3ZWYA 1DIAA 1WV1A 1IMOA 5E9QA 1P31A 2GBLA 4ZV9A 3WG9A 1P4AA 2CRXA 1KLNA 3VH3A 3UW1A 1ZW1A 4KFUA 1EGAA 5TVKA 2BUCA 1E6UA 1AGXA 1PSWA 1O95C 5JV5A 1KVRA 2WYIA 4B4DA 1VJTA 2FE1A 3OC6A 2LD4A 3JAKB 2PMWB 3DMPA 2YVLA 2J0UB 1MRNA 1XK7A 3MDAA 2FMTA 2OHJA 2GZ2A 2W2MA 3COZA 4URUR 4C0QC 5HCNA 2TSYB 1X70A 1N33B 4UNRA 3TADA 2VAVA 1GQYA 2QWXA 1GKIA 4KXVA 1T9GR 3UM9A 2V97A 5DGIA 4ZOHC 3MTEA 4YPFA 1G8KA 1B16A 1ZK1A 1F8GA 3BD7A 1ATIA 4R98A 1TKAA 3WGOA 5I4CA 4DILA 5B4TA 2C7RA 4QPZA 2WUGA 5AH0A 3L7LA 3M8KA 1K4MA 1QQ7A 4EBFA 1P2GA 2WJIA 3G13A 1S0UA 5JY1A 2DERA 5CA0F 4K46A 4D9IA 1PZGA 2DWQA 4KRXA 3O21A 2NUPB 2VYND 4FQ5A 2NZWA 1N6OA 2VNKA 3ILSA 4PNPA 2H5XA 2UVVA 3P0HA 4J91A 1X9WA 3KVYA 4TLBA 3VAAA 2HA6A 1GG5A 4KLFA 2P2GA 3MRSA 4XGNA 1ZITA 2XWQA 1L4YA 3AOGA 2AMVA 2O0LA 3EXHB 2R7KA 1RD4A 1B73A 4DSOA 2LYHA 5BWLA 2EX1A 3JZFA 3OOSA 3O2JA 1TQDA 1BWSA 5DM60 1NF2A 3L77A 4LN1A 3SQDA 1H8EA 4BOYA 1PHRA 5JYDA 2H3IA 2OXRA 2V5AA 1U7OA 3AL2A 3UN1A 3DLAA 1G3MA 4JP1A 3H2GA 3AUXA 3GROA 3BQ0A 1AZTA 2OHGA 2ZKLA 3TR0A 2H4FA 2WYHA 3KAPA 3ZHYA 1ETHA 2RGEA 4I81A 5BSHA 3Q7EA 2QYOA 1IJEA 3GD7A 1RPJA 4G85A 2VTBA 1YIOA 3NDIA 1D2AA 3PTAA 3BFXA 1NI4B 2X0IA 3HDTA 2WSMA 5C0YA 3TZ6A 4LTMA 1BOOA 3OOWA 1NBOA 4E2YA 1NVAA 4AZVA 3UMMA 1L8XA 3OFNA 3OAAD 3H5IA 3WQBA 4EL0A 4CQMB 2J5BA 1CY2A 1VBKA 4YA6A 1RWBA 4R2XA 1WB6A 4RM3A 3COVA 1BTOA 1NQUA 2PMFA 1PIWA 1XMSA 2OKCA 3H2BA 5CEFA 4ZGWA 1F06A 1R4NB 2EDAA 1XCOA 2VTVA 1PAUA 3T5MA 2G07A 2I2XB 3U39A 3FSGD 1D9XA 3FPFA 1T5LA 4LDJA 3GG9A 2V98A 1ZQHA 1QVRA 1EAMA 5C1OA 2CF5A 3U09A 1ZNZA 1XXHA 2ZYTX 3WLJA 1J25A 1I5EA 1C7JA 2C92A 2O8EB 1NMYA 5LQKA 2OGSA 3ZEAA 3TTSA 2P5YA 3TW0A 5F9FA 4M9SA 3WHIA 5IFLA 1BHQ1 4R3UC 1SKUA 1E6EA 1WOYA 3K70D 3Q6MA 1FDSA 2OZLA 4Y1RA 4JLNA 3C6XA 2FUKA 4R65A 4BVGA 4PFJA 4R84A 9ICIA 2BC9A 5KT3A 2ONCA 1JHOA 1ZUNB 4QPPA 3Q0EA 3GQVA 2QENA 4WASA 2W2KB 3B1ZA 2XVZA 2ZT8A 5LXTF 2WWXA 5TF0A 5AW0A 2H7XA 5BUSA 5IEJA 4ZGBA 4IH9A 3M7DA 4NAVA 2ZBVA 3L9XA 5TZVA 1T6YA 1Q16A 3DWGA 4F4IA 1Z0IA 5TS3A 2CK3A 5AW9A 5JPDA 4N6NA 3O3MB 1SA0B 1XP5A 3WDSA 2C5EA 4D9NA 2VNHA 4B0OA 2GVNA 3C1ZA 1VECA 3N6XA 1MIOA 2MYUA 2AB0A 3H83A 1PJAA 2VUSA 1IHYA 3LX8A 1WPRA 2Q4DA 2PGIA 2NPIA 2Z8YA 1CE8A 5EJIA 5GY7A 1YQQA 5B2EA 3EZ7A 2B37A 5I4KA 1W0JA 1KP3A 3RAJA 3FOZA 4C22A 1OBCA 3TAHA 4LC0A 3RYFB 2B82A 5CK4A 1AMUA 3T9DA 3DMYA 2D1FA 3V34A 2AZMA 5K5EA 5EE1A 2VRBA 5C46F 1RBYA 1Q44A 1N4DA 3WYFA 8ICUA 4HJRA 3EVTA 2IEGA 3OU6A 3HU3A 4NPHA 2H1LA 3PC8C 3PUZA 2PTHA 3I2JA 4ZJPA 2GM3A 4KLJA 2XVAA 3TADC 5CX1B 2UVWA 4DJEC 2YMQA 4BL5A 1U3FA 1KEJA 5HCIA 8ICHA 3FCCA 4WFQA 3PC2A 1BMTA 5EPEA 2XSZD 4O3NA 1KDRA 2QM8A 4D25A 5CRIA 4YCXA 1QH8B 2P6OA 2D2IA 1QSGA 3IILA 4RENA 2WD7A 3A6HA 2FZWA 1N25A 2J3MA 3WB1A 3R7AA 1G5PA 2NW6A 1P5HA 2Y1OA 5HHHA 3ZZ1A 2C2WA 3DOCA 4Q21A 4F6RA 3D54D 2E5FA 3TS1A 1D2GA 3N3BC 1AURA 1ZMBA 1QH1A 3F9IA 2WVGA 4URXR 3F7NA 2X9LA 1CK4A 3DLBA 1FQKA 3WGVA 3S5JA 2VQFB 4ZI3A 4OKSA 1KR5A 1ZH8A 3THRA 4O4JB 3H13A 2VP9A 2MSNA 1JDZA 1CT9A 5KNBD 3GJ6A 4RQ0A 2VDWB 1U1EA 1NASA 3IPXA 3GBVA 4AZ3A 4B3BA 1V9PA 2HHAA 5ELLA 4UEWA 2QG6A 1FX0A 2WOJA 1YJ8A 2H2IA 1WX1A 4ZT3A 3U2QA 3VZPA 4B0PA 3K6SB 5ALLA 4AJKA 1YSCA 4V3BA 5CCDA 1P2BA 1T2DA 1WBBA 3STXA 3PWZA 1U0SY 3EW7A 4DLKA 4DIMA 1JH9A 1H8HD 2REBA 4ED1A 1TRHA 2I5PO 1J0DA 1OT5A 4YTEA 3OZGA 1DBVO 2JJ2A 3F1KA 2HMWA 4L8WB 1R1DA 5KFEA 1XRLA 4MWSA 5L3SB 4QW8A 1X7XA 4KWIA 1Y5NA 1KPIA 1UEXC 4MO2A 1KJYA 1YUMA 2EGGA 3G5TA 4JJKA 1MH9A 5HR6A 1LLCA 2H9AA 2P8SA 1H0HA 2QN9A 2XGGA 3AFHA 3QXJA 4KL8S 3R0VA 1LTQA 4TSRA 4DR6B 4WZAB 3EQ2A 2HJ9A 2ZI5A 2YV4A 4PHAA 3LX4A 3M6IA 3MUEA 4XIYA 2PUDA 4FCVA 3EC7A 3W06A 1JQEA 2HK6A 4M1TA 4P22A 1K75A 2W00A 2YTZA 3CZMA 1TA9A 4IBOA 2HBLA 1UJ4A 3MT8A 3BILA 4TKLA 4RZUA 3KD3A 3DTTA 4RA6A 3B6ZA 1ZCJA 1XZKA 4DXAA 3MAGA 2ABWA 4Z53A 2Q4TA 3ZQUA 3WIDA 5K03A 4YX9A 5JECA 1M34B 4CEJA 5KS2A 1T3GA 3EXIA 1OC2A 2JI7A 2HTEA 4AY5A 1UK7A 2IEAA 1Z6YA 3VPXA 4AN4A 2QUHA 4NE7A 3GFOA 3CEPB 4L2IA 2C1ZA 5KYXA 4QRDA 4B48A 3F2CA 4GX1A 3BTOA 3TSYA 3K9NA 5DLFA 5BWOA 5JMWA 1W9HA 4UTPA 1U0JA 3FYDA 1BOFA 4QYWA 3WAGA 2DLDA 3IIEA 2DB3A 2XQIA 2W43A 3CZPA 5COBA 1JDJA 3I8SA 1PG2A 4IQ0A 2NADA 5AM3A 3W2EA 3C70A 4UAZA 1QIMA 4UBLA 1UIMA 3Q3IA 4C08A 1XNJA 2DWPA 4XYBA 2OV8A 3H9EO 4BVEA 5DYNA 1M6YA 1TF7A 3MGVA 5HQ3B 3V7WA 5FBRB 2WTFA 2JCVA 5H3CA 2I6QA 2E4ZA 4BVHA 1IN8A 5BW4A 3RW9A 2BRUA 2IJGX 1GP2A 4CMCA 4FR2A 1IZ9A 4REOA 3ZDZB 4EG8A 1BXRB 3OZWA 4GZMA 4QQ8A 3SM9A 3U6KA 2WWVD 3B9PA 5HF6A 1RWQA 3ZWAA 2AOTB 4TV8F 4AS1A 1GNVA 3KXIA 2ZROA 2XKAA 4UB4A 1K9VF 4WAUA 3VYRB 4ETIA 2IE8A 4DRZA 1QG2A 3G9QA 4HGZA 4QLAA 2O8FB 1P29A 1VDVA 1ZJMA 3RBZA 5CPFA 3WGMA 1X7ZA 1T36B 4HQOA 1T9HA 1JJVA 3LPMA 1V5FA 3VKUA 3EPIA 3G2JA 1H94A 3LCCA 4C29A 4F7WA 2W6IA 4C43A 1X42A 1IEXA 1NQOA 4XYGA 2VA8A 3SE0A 1JZSA 5LR6A 3AF0A 3WWPA 3EPRA 1IG3A 1N7JA 1JHYA 1NWHA 2I1LA 2BONA 5KFFA 4WJKB 5KWEA 1Q3KA 3QYPA 2PSHA 2P1DA 1OIXA 1VYVA 1A88A 3DAFA 3M8RA 1NVGA 1IHOA 2LGJA 4ENPA 4K2HA 1WSBA 3SSAA 3BD8A 5I01A 2ZBGA 2YB1A 3FPCA 5J2TA 4OJMX 1RPAA 1U3VA 4OYRA 3NHAA 3AVVA 5LSAA 2WIBA 4GP7A 3TOSA 4L8VA 2Y9PB 4M0LA 2MDTA 4BKPA 3R0JA 3I9LA 4AKEA 4X7PA 3N2ZB 2FMUA 3UWMA 5AM5A 4L1KA 2VL7A 2CBZA 2RG1A 3D2AA 5F1PA 5C4GB 3OQPA 3D2NA 3LCRA 2OCKA 1E2EA 2DEUA 1F2UB 3QNMA 5BXQC 4CKEA 2O2CA 4LBYA 1WSDA 4B3XA 4O08A 3PPVA 5DWVA 4NEGA 3VBCA 2R6CA 3WV5A 4GM4A 3WC4A 4O4HB 2EZXA 3DMDA 3PT9A 3K5PA 5DK4A 4WEQA 3PR1A 1ADYA 1JMVA 3ISTA 4TUYB 4F2SA 2M6SA 4XCVA 4EHDA 3VX4A 3GV0A 2PIDA 2EZYA 1IQPA 3BQ1A 8ICZA 4WZAE 1D9DA 1GGFA 4QVIA 4NBUA 2FOIA 2OFPA 1R3DA 1FRZA 2JDID 3WMEA 2VP5A 4RH0A 1LFDB 1Y1LA 1CQPA 5IDWA 2PUFA 5G0VA 2HFKA 1JIUA 4HH1A 5KYWB 5J0WA 2JKYA 5FD8A 2VA3A 2HMTA 5EJ7A 4TXJA 3SVLA 1I5OA 3AF2A 4KH1A 3GUZA 3IVMA 1W4AA 5LNK6 5LD2C 3UMCA 2W6QA 1Q3UA 1AKNA 1FS6A 2H29A 3VHXA 3QK7A 1M34E 1U9LA 2BOVA 3MCTA 2W2PA 2WD9A 3M2TA 1ZPDA 3IH5A 4DR3B 3DYIA 1Q7EA 4PGYA 1ZM4A 2ZUUA 2AXNA 4AWXA 1IM2A 2R97A 2XBUA 1A8SA 2PX0A 4TT8A 4FS1A 3GLUA 1MX5A 1OAOC 4MDYA 3U9SA 1SOVA 3EIHA 4JEIA 3KKZA 5TQ0B 1HOXA 1DC7A 3QVTA 3CLUD 4LY6A 1R9GA 1OBFO 1WCV1 1N2OA 1G6OA 4FPXA 2HADA 3E82A 3PYLA 1UZAA 4M47A 4POAA 2PUHA 1DIRA 4LMPA 1SCUB 4RKWA 3AM1A 5HK9A 1E0SA 4W7IA 3TQSA 2DUJA 1OI2A 1YJAA 3V9PA 7AT1A 1L1RA 4W9MC 1ODFA 1SV4A 1YGPA 4OQZA 1ZIXA 1V7ZA 3L1KA 3KDAA 2Y0DA 4N3GA 4U8GA 3FPLA 3W4KA 3RADC 2R7MA 2ONKA 5J1SB 5H0IA 1VZ2A 4UU7A 4PZDA 3JPTA 2HCRA 2JIQA 2NZUG 3TLZA 3B13B 3QKUA 4DQKA 1RJEA 1ZQCA 3SNHA 5AVTA 2XDQB 1NDQA 4GC5A 3NIGB 3GJTA 4Z6EA 5B3LA 4O2AB 2O1WA 4JXKA 4KUHA 1N92A 3RC3A 2ZAYA 1B74A 2G36A 2ANBA 1KU6A 2FR1A 5I9SA 2IHUA 5JDCA 3TDMA 4Z1OA 1CS0B 3AHGA 2BM1A 1BKYA 3SWWA 4EEYA 2HBMA 2QD1A 3QI2A 5BV0A 2OILA 2G08A 3K5WA 1TUBA 4DL7A 1OF1A 4FX5A 4JUAA 2YXPX 1G5HA 3WK9A 4RVFA 3L4BA 4C7KA 3V1YA 2HWYA 1XMOB 3BBPA 1SBIA 3T1NA 2D74A 2PFQA 3RRJA 4Y6PA 4YJ2B 4OHBA 3H5RA 5J29A 4MS4B 5KEIA 3GCWA 3LTEA 5HOQA 1ZXXA 1ILWA 1RZTA 3G2MA 1A2QA 4TYQA 3DL7A 2W7OA 5AW7A 4M21A 1DWOA 4XA8A 1TK9A 2O2ZA 3BUSA 1XVUA 4EUFA 3GEBA 2O8CA 3HA3A 3I58A 4YJGB 3HKZF 2JBAA 3EE6A 4O8CA 3DNMA 2NO6A 1KYYA 4DA0A 5KG0A 1N2JA 3BBLA 4QFBA 2BISA 4HVTA 1LQTA 1KQQA 3OZ7A 3HX0A 1G7SA 3Q9NA 2J0EA 2R6R1 3FRJA 3PX0A 3IP5A 1MT0A 1BWPA 1TCUA 4UB1A 2FMIA 4A8TA 1JE1A 3K5HA 2VZ8A 3CZAA 4UKDA 4N5LA 5JEDA 4Z6KA 3M9OB 4CIAA 2REOA 3MBOA 3UBTA 4B9AA 2WB4A 2ZSFA 2D7JA 3FTEA 3HVIA 1JIHA 1FIUA 1NJ8A 3DOOA 3RIEA 5HP4A 1N0UA 3TWOA 4GM1A 5BN5B 1XQVA 1J99A 1RYNA 1CB7A 5FXMA 3GW8A 3RQIA 1KQ3A 1QGDA 3PHHA 1GQQA 1GU1A 4AUMA 2RHLA 1UPFA 3PPWA 3QG5A 2C7GA 4KJXA 3T7JA 5J2JA 4GQAA 3A37A 1CUWA 2I03A 1KAHA 1R4AA 4G1UC 2KE5A 4M9GA 1WE2A 2EZZA 4GXJA 5I9IA 2GRAA 4YMHA 4E7PA 2ZBFA 1TLFA 1YASA 3CG4A 2P6UA 2HF8A 3AQ4A 3OA0A 4DBZA 2BKVA 3BT7A 4UHHA 2QB0A 1ZEJA 3DW1X 4OOFA 9ATCA 3LUCA 3MAJA 3A9WA 3DQPA 1P19A 1VQ1A 1HE4A 3BIJA 1N6IA 3G0HA 4OO1J 2ODEA 1VMKA 1Z25A 1PWHA 2PRYA 3VH1A 3RABA 5KL1B 3J7TA 3N2GB 3ISVA 1WPXA 4U5QA 1QM5A 3MT7A 3HRIA 2QPLA 1SQ6A 1KJ9A 2XZPA 2OCIA 4FR5A 1RXIA 4INZA 2V6JA 5AKJA 3TZQA 4DG9A 4K9QA 4DLLA 2HPZA 1IVSA 1Y8RA 4HDOB 4GECA 2F43B 1NAIA 4LOLA 4CL0A 1FVOA 3SBEA 3N07A 4DCOA 1RPTA 3AEZA 3QV2A 2RDJA 8ICXA 4J0QA 3PR2B 4DR7B 1H2XA 1NM5A 1EK5A 5J5CA 2VK8A 1P18A 2C1EA 3SI7A 4PAQA 4M9XA 3NBKA 1D03A 3LWDA 4YK7A 2B4QA 3PUVA 2C5HA 3QE3A 1JTEA 4GYYA 4TTRA 3RS5A 2GVZC 3P45A 2C9OA 2W2TA 1IVNA 1OLOA 1T0PA 3CNHA 4RZSA 5JXJA 1P7ZA 2FN8A 3KLPX 1PGQA 4KXYA 1ZY2A 3B1YA 2Q46A 5E6UA 1MABB 2QUIA 4XYLA 1JEQA 4JJZA 2DRIA 3DZFA 2CCJA 4EDHA 2H5EA 4AMGA 3E53A 3DV0B 3RUHA 1PUIA 2DHRA 4NVRA 1A2BA 3BFKA 4HDMB 3SSNA 1UJ6A 2HU7A 2KSQA 4YLEA 1SXJD 5AJWA 2VF2A 5KL8B 5F51A 2DJ5A 1IVYA 3W3ZB 5LMUB 2FXVA 1ZO8A 3IT2A 4BQRA 1KRXA 3KWFA 2VK4A 3ZBTA 2E8PA 3BK1A 4N0MA 1ZI9A 2GERA 1JN0A 4GZ3A 3OTGA 3DEZA 1PJ4A 3G1TA 3FIJA 1UDXA 2VT7A 2H1OA 2YKGA 1ZFNA 2PMZC 2O3RA 1U9JA 4NZYA 1CRLA 3R3ZA 3PW2A 1C7FA 1G1AA 4JLUA 1Q95A 4O8ZA 4QULA 2HWUA 4HNSA 1W88B 3RJTA 3NWOA 4DEYA 1H5UA 2VUIB 2ZZMA 2QP4A 1I32A 5AICA 2ZIUA 5LOVF 2G40A 5TNXA 3SC2A 4DPLA 8ICPA 4AMBA 3K9HA 1TCVA 3LBHA 1L3SA 3CR8A 5L7TA 1LPPA 5J0OA 5BSGA 1MQ9A 3RH4A 2BHRA 3GEEA 4GC9A 1O0BA 5KHOC 4C21A 1Z5PA 5FIUA 4MV1A 2M98A 1LB2B 5FV7A 2MU1A 1O58A 1JWLA 3PJEA 2F1RA 1PR9A 4G0VA 2FX5A 3TFRA 4HLUA 4BNIA 4IO1A 4NXNB 4L76A 1VGQA 1GGMA 5JRTA 1X1BA 4PPFA 3WL6A 2WZDA 3O5AA 1U65A 4ZWNA 1RW4A 5IT4A 4P4NA 3P2KA 2JARA 1I51A 2FPGB 3O8NA 9ICRA 4U2FA 4P3PA 3A28A 1U7HA 2BKEA 2BBWA 4FE4A 4F8YA 2FGKA 1Q83A 4K6FA 1WW8A 1G5QA 1RKXA 5H70A 1EX7A 3C3MA 5EWJA 1SKAA 3VV2A 2VHXA 1BVHA 1SKRA 3C3YA 1DQRA 1VP3A 4W99A 1Y63A 2V7BA 1Q7TA 3UAGA 2LUOA 3VR2A 1A9OA 1E1RD 2B5VA 1DGJA 2Y0CA 2D2XA 4X97A 3NNSA 2C54A 1VSBA 3QKTA 2HREA 4HDCA 1U6IA 1FSSA 2XQKA 4C04A 3WGIA 1LSUA 4MKXA 1DINA 4B9TA 1EDZA 4DC0A 3UMJA 1QQ5A 4ZU6X 1ENYA 1EWVA 3UF0A 1V7PC 4LISA 3RK4A 4HWOA 3ENKA 1JS1X 1XZMA 4U39A 4F96A 2ATXA 2R7AA 4HN4B 4ZRDA 3VXKA 5EMLA 4EHIA 4OJKA 2FW6A 4NOKA 1KY5A 1BX1A 5IT9A 4FEGA 4ILEA 1CEYA 5EWMA 3L1VA 5JXHA 5FTKA 3V3TA 4Y2RA 3BMCB 3Q98A 3N87A 3SAGA 5ALSA 3QEMA 5IARA 2PLAA 3IYLW 3DFKA 3L7NA 4ZZ1A 1RCTE 3T1HB 2QN2A 2PHZA 4MWTA 4XPZA 4BJ6A 3GA7A 1XPUA 3VPFA 5FPTA 2VDQB 4EQ6B 1NQXA 1NKTA 3DTNA 1HEYA 4QNLA 4R8UB 2O5VA 1VMEA 4FN4A 2WF8A 4GLOA 4ZOAA 5FFFA 2LWIA 1W8IA 1G7CA 1MA3A 3LTNC 2GN9A 1TW3A 2JFFA 3KP1A 3RVMA 2RK3A 2C2ZA 4WV3A 2VHVA 1P1CA 1GUDA 1PJBA 4J1QA 3S8EA 2PLWA 4KPGA 2C4WA 3M6VA 3KAQA 3MJTA 4AP5A 4KP7A 4REMA 3PWSA 3RARA 5HZHA 5FT9A 3RH6A 3EGXA 3OX3A 4R9VA 4WK4B 4EUSA 3EDYA 5JYBA 2V6GA 3DYVA 1GL6A 5E95A 1GA6A 3KZOA 4LFCB 2R18A 3USES 2VPWA 2WC1A 4XSVA 4ZVUA 2P11A 3IPYA 5B7QA 3K0AA 2IYEA 4ZYLA 2IF0A 2GKOA 1UXIA 3KR1A 1N0VC 3ZXIA 4LDZA 1NUAA 4PG8A 1JVNA 6CHYA 3BQ9A 5ITWA 5IT5A 5DXFA 3IJPA 4RPJA 2R25B 5IP5A 4EVQA 1RXSA 1BW9A 4S0XA 4XFDA 2P3LA 1OJ7A 1EXVA 5IDVA 2R5NA 3FKQA 5HHTA 1GEEA 4II7A 2XCUA 3E9CA 3AEVA 1XSLA 3KTDA 4U6QA 3QX8A 1QX4A 2XPCA 3D6TB 5TMBA 4CKZA 3R6GA 3LPCA 1IBLB 2IUEA 1P7PA 1K4KA 4C7BA 1PRYA 4BLTA 1LDBA 4NU5A 1ZR4A 3DEEA 5LIPA 1X7WA 1EUYA 4HWRA 2HLHA 3KZVA 5C18A 4U7HA 2XMRA 4ITUA 2DF4B 3LRPA 1LNQA 2BCGY 5AK4A 3ABZA 2HMUA 1O96A 3EH1A 2C7QA 1MU0A 3MFHA 4MW1A 1RJFA 3U44B 4HD8A 2ET6A 4HAXA 4FMCF 3FE2A 4LXHA 4L8GA 4Y18A 1YI8A 4MWOA 3AGPA 5HYVA 2P9BA 2WKSA 1JPUA 3WA6A 4GPZA 5CHEA 3A3OA 1FW8A 1YI1A 5EJAA 5H82A 3KHGA 1AGRA 1R5NA 5ICCA 2HCTA 4Z4CA 1KAOA 3NRWA 4HB4A 2FG5A 3RO7A 1U0GA 4WCVA 2QJTA 1Z83A 2BJVA 2WQ6A 1PX2A 3OX4A 2ZIZA 4PIPA 4Q9DA 4NU8X 3WBFA 1KOLA 4XD2A 4FGSA 2X77A 5G02A 3W3AD 4HDSA 3HWWA 1IJKA 2V5UA 3ICPA 4JEHA 1Z33A 2LIPA 1Q92A 1EGHA 3STWA 2EL7A 1TM2A 3V1MA 3PU6A 5F2EA 3OPYA 3TKAA 4HZGA 2HJRA 4EO4A 1N5WA 1NLMA 3BC1A 3IOCA 4DOBA 4OXXA 3TW6A 1Q12A 3R5KA 2GLUA 4UM9D 5IBPA 4LHXA 1M2VA 2HB6A 3BCRA 1KYIA 3VTZA 5IIMA 5HUQA 4I19A 5AKIA 1S10A 1V1MA 3CGGA 4XUEA 1DLIA 2Y0PA 1SUDA 2B6HA 1OLSA 1X8JA 3GOHA 3H17A 3AKEA 1JV2B 4O4IA 1QCDA 4FM9A 5ADUS 5DASA 4RPXA 4CKBB 2O5EA 1ADJA 4LWPA 5EKXA 1GR0A 5FPSA 4OM7A 4K6KA 3FWNA 3L7AA 5KMGA 3W6NA 2CMHA 5BN3A 5C8YF 2ZJ1A 3L6UA 3LHFA 2OFXA 1D6MA 2X8AA 4R1MA 2H17A 1U3TA 1KNQA 4MRSA 1L4KA 3PW5A 3HKDA 2NAFA 3TVDA 2QZSA 3UANA 3KLBA 2AG1A 3O82A 2GM9A 4D8YA 3KHRA 4X1YB 4BQPA 3K31A 2ZSBA 3RG2A 3V00A 3QLUC 4D6XA 4M6WB 1CERA 4BZWA 4FOTA 1C0KA 5KTPA 1V39A 1SXEA 5TB5A 2BFAA 2IEBA 3DLPX 3CWZA 4I2HA 5HIIA 1VJRA 2AG6A 4WBNB 5LP6F 1JX6A 4UATA 4F50A 2CLLB 2QROA 1NK6A 4RIGA 1HT2E 3MD0A 1SC9A 3HACA 1NL3A 1UKCA 7ICLA 4A8HA 1N2CB 1FDVA 4L02A 1MB0A 2YTUA 1EWYA 2NU7A 1HLPA 3RRGA 2CJWA 3SS8A 3N2EA 5C1DA 3SYRA 2XKJE 2ZXHA 2JVIA 3V1KA 4FN5A 1JIKA 4BE4A 3V8EA 3ICEA 1W87A 2Q6LA 4F5OA 4E21A 2C8LA 5B64A 1TIPA 3PW7A 3AR5A 4NEQA 4RY2A 3V1TC 9ICHA 1Y1SA 3DS8A 1W29A 3QX9A 3CEMA 2A1UA 2FP4A 1WUDA 3FCEA 4I4NA 5KFAA 1IZ8A 2X86A 3BXZA 1JXOA 1J7JA 4FI3F 2ZOSA 2FSVC 1OIVA 2AQ8A 4DTIA 1TB4A 2OG2A 2VT3A 2I4NA 2ZB7A 5C8ZA 4D8WA 1GR1A 3OURA 3P0EA 2QX8A 2ZUEA 5L4SA 3TINA 1IN1A 4EI7A 4JKOA 4ROSA 1L7QA 4B45A 1TZKA 1T4CA 1X87A 1E1QA 4X71A 4WOJA 4ZVVA 2L18A 2Q9CA 5D49A 1ZN7A 2AOVA 1M74A 5DSTA 4EY5A 1ECCA 2DH5A 2GJ9A 2Q1UA 4Z5XA 1B4FA 5T3YA 5ICSA 3FIUA 3KKQA 5F7OA 4DGQA 4LBVA 4NKRA 3V46A 2RGDA 2X5KO 2VJ4A 4OU4A 5CLLA 1DL5A 4I1PA 1Y82A 1BA2A 3DAYA 4ZYZA 1U6JA 4JB0A 3OIYA 1GAWA 2CHFA 4A03A 2J9FA 3A1TA 4CV0A 2CBGA 2YFKA 3GQBB 1YBMA 1ZGAA 3PUIA 3A6ZA 4KQHA 4C3OB 2WB2A 3PNLA 5JSYA 2VIXA 3ROFA 4MR8B 3ZJ4A 2B61A 2G80A 1WTAA 5FBVB 1J24A 2ID7A 4R3WA 1HE8B 4IFIA 5IAKA 2A7QA 4LYEA 2PMKA 4J49A 4TZ0A 4NV3A 3T34A 4XPIA 1I9CA 5JWOA 3RGWS 1T1JA 4HP8A 4Z4FA 1MAUA 4YXJA 2QUJA 3TZLA 2OB1A 4IJ5A 3EQ7A 4JJGA 5EHZA 4D0GA 2QL7A 1R0RE 1VA4A 2PX3A 3UAYA 3SYKA 3AUKA 3KOZA 3OPYI 4WZZA 4AO8A 3H7AA 3AIKA 4Q9NA 3KQKA 3M5PA 4MCJA 4M9QA 4O6VA 4BDPA 1CUHA 3JWPA 2GAFA 1BN7A 2PGAA 1AA9A 7ABPA 3OVMA 5DTJA 1E7MA 2GZSA 1ZJJA 1B22A 4TRJA 4COKA 2PI5A 4V2UA 2WZCA 3SZMA 2ORWA 1Z38A 2P90A 4E5SA 2DFNA 2UYOA 2I3AA 4NU0A 4U9UA 5CJ2A 2IOHA 2X2FA 3EGOA 4MULA 1X0VA 3T5AA 2GSWA 5B1IA 2CB9A 5B12A 5HF8A 3AMZA 5ENVA 5C51B 2XRYA 5E9WA 1V48A 2O19A 1DXYA 4KIJA 4E3ZA 2ZBDA 2IHVA 2H3EA 2KZZA 5KFQA 3SIPA 2F4VB 4EGFA 1PUXA 2AZTA 3EIUA 1F8YA 1OI4A 4J9NA 4TN5A 2W5UA 1WDMA 2PO7A 3RHFA 4I8IA 3NHSA 1V4NA 2FFJA 3STUA 3RG8A 1XD2B 3H75A 2AV6A 3O3OB 3ELDA 5B4UA 4NH0A 4L4SA 5LMZA 1OH5A 2ZZKA 1DKUA 4OXRA 2IE0A 2WFZA 3O26A 1TYDE 3D1LA 3GCZA 3L8EA 2O2GA 2HOIA 5CA0B 3N2KB 2G0TA 5K2OA 4QU9A 1CY0A 5JSZA 4I2BA 3HY3A 3T8YA 5IJ9A 2OV1A 5K6AA 1FIQA 5JE8A 3CT6A 5JZBA 2CMFA 2PT9A 4CM3A 1G98A 2D5AA 2P67A 3OFSA 3BRWA 3RBAA 1ETUA 2VNJA 4RE5A 4JBYA 1NJGA 2AF4C 4QHYA 1H1LB 1NJZA 4B9MA 1J07A 3GIKA 1NK9A 2CHEA 5FRDA 2HT1A 1K6JA 1T1EA 3FHOA 3NOQA 2R44A 4CKCA 2ZTUA 1PQ4A 1QRUA 9ICPA 5I8WA 1CTQA 2XVMA 2O0HA 1B1AA 4JASB 1ZGHA 2LCQA 4PZEA 2QZPA 4R05A 2N3ZA 1KDHA 1VCMA 5L3RA 1EHYA 3RRFA 5DFAA 4INJA 5IC5A 4AZSA 5A0TA 4H17A 4R54A 4OHOA 4QJ3A 2PAAA 3MTDA 7ICEA 5EQDA 3OIUA 7MHTA 1Y8AA 5H3LA 2PXIA 2UZ4A 1AU9A 4FWTA 2X1MA 4BP1A 2Q21A 5C7YA 4DAOA 4L50A 1C9DB 3MS4A 1X66A 3LO8A 2PQMA 7ICSA 1Y4SA 2CCGA 3RVSA 4MW5A 3KKPA 5JRJA 5AM0A 3G7NA 3BXXA 3A0UA 4IS2A 1MX9A 1U8TA 3D5QA 3OF5A 1SVMA 2NNLD 2G1UA 4KI7A 4UOEA 2YW9A 1GXSB 4ED0A 1EVKA 3W78A 3QVSA 4QU8A 5DEOA 5GP1A 4KR0A 4UU8A 2XY5A 3SBOA 4XZ3A 3KZIU 2GHQA 5E1OA 1I01A 2XGMA 4FNOA 2QAGA 3ZHUA 2I29A 4M1MA 2YASA 4ND4A 4E5UA 1ZA1A 4Y7DA 4JKYA 2B25A 3NHLA 3PXXA 2WVAA 4Q9LA 4U7JA 5IMSA 1VYTA 4HADA 3WYCA 3A3NA 2UYHA 2MINB 3WQHA 4DQLA 3DV9A 1NK4A 3RU3A 4PLZA 4N6OA 1P17A 2RCNA 3M6WA 2YJZA 1GNPA 1UBMS 1U2TA 4KYTA 3M1YA 4JC0A 2HPVA 4EF4A 4CTMA 2XNJA 2E4UA 4JR2A 3JQCA 1E3IA 1U8XX 4G4JA 2YMLA 3JQ7B 4X3OA 1MQ2A 3DE4X 2FF5A 4TM8A 1JIVA 1Z2EA 1KIAA 4HJXA 3I6ZA 4UCWA 4NM2A 3TZKA 2CV1A 2E37A 4WEOA 5D00A 3RANA 3WJ7A 1T5OA 2ZJ0A 4YPVA 3U40A 5SZJA 1UPXA 2IZZA 2AA3A 1HEIA 3ZHOA 1C1XB 3R77A 4O5EA 2QARA 1ZS9A 5LXTB 2IHJA 3UAOA 4JYZA 3RM3A 3UB3A 3EVFA 4YO8A 1FC0A 1Z6QA 4CU5A 1ZJ5A 3QBTA 2H2HA 1OZ0A 2V8BA 2IX9A 3DKRA 4PVDA 5GAJA 1CWUA 2ZETA 1R27A 3VR5H 3VH2A 3T7RA 3B1FA 4C0WA 5JNWA 3UO8B 4AT1A 1XP8A 4GE3A 1XNHA 4JDPA 4V0QA 2AUNA 3IOYA 2JPDA 4TYPA 1KIFA 3W1VA 3IBFA 3ZXUB 2XIJA 1FMCA 1REQA 1H4VB 4EA6A 2VWGA 1QSSA 2HAEA 1L5UA 5JHGB 2FDXA 3FMIA 1XN1A 3L0IB 4FWIB 3UT6A 2VHCA 2FYTA 2YHUA 4CCSA 3AF3A 1EZZA 1JJAA 2AXQA 4CLRB 4EI2A 4JSTA 3EHDA 2AFHB 4DR4B 2X58A 4PQRA 2AN9A 3KQYA 1P81A 2FZ5A 2Q3CA 2BBSA 4OFXA 2Q3EA 1B8VA 2WWWA 5KFJA 1S3FA 5E7MA 2QT0A 3QZUA 4OMCA 1R0BA 3WYGA 1QMPA 5DG9A 1ZN8A 2G71A 5BV2P 4KMMA 2C0CA 2D5LA 2G4LA 2ZXEA 2W9AA 2G63A 1M2OA 4U4AA 4DJ5X 2QW1A 5FFMA 3NASA 2H1VA 5BSRA 1PJ8A 2R8PA 3G2IA 1PKEA 4MVJE 7ICHA 5GJVC 2Q2VA 4MWDA 3BRCA 4WXRA 2GBLC 5B1SA 4I2IA 1NY5A 5AKYA 3KZ1E 1XPOA 2ZSDA 3THSA 4JVSB 3WLPA 2ILTA 3DFIA 4IJKA 3NC1C 5G3YA 1WD7A 3HYSA 3HI6A 4MW2A 1OVGA 5TGDA 5JC1A 3K9WA 4L5JA 4PZPA 1FA9A 3CLRC 2W8BB 1OLUA 3EXG1 5AJXA 3S70A 4IIXA 5CYFA 3ND9A 2OWOA 4KPEC 3REQA 5AVKA 2ZTMA 1MAAA 2ODQA 3CBQA 4O3PA 2IYPA 3T54A 1SL0A 3AI1A 3IP4B 4UCQA 4ELVA 3CV3A 3KUDA 5IVIA 5BV7A 1QHSA 3X1MA 2V8OA 5K6AC 3N74A 1M8JA 1U11A 4BWYA 4PAOA 1AHIA 4MA4A 5K0EA 1S9DA 2KE7A 3J7AC 4B3RB 3L4KA 3UBMA 3OA2A 2JFPA 3L7DA 2EH9A 4NENA 4RNDB 3VVLA 1B43A 1A6SA 3TJZA 1COZA 4DG5A 1FUKA 4HT3B 3TN7A 1ODCA 3K9FC 2VTKA 1GVNB 8ICYA 3LA6A 4UBNA 3VPBA 1OZGA 5ALHA 4TS9A 3H65A 4KPUB 4KOAA 2XT9A 4ZU1X 3ZLBA 1VCHA 2UUOA 3AHHA 3QOFA 2ZUDA 1CJMA 4XLZA 1ADFA 3X2EA 3B5JA 4C1BA 5ADHA 3NBZC 2YY5A 3N8KA 4Q05A 3D0KA 1S2MA 3MR3A 1AT1A 1A9XA 4URYR 3CW2A 2ZM6B 5FEMA 3IAAA 2FG7C 2VRCD 2H57A 4L8FA 2ZTLA 2DAPA 2ZZNA 3GLGA 3RAFC 4H4EA 3FWZA 4FFMA 2M1ZA 1LUAA 4BIIA 2L19A 3FR8A 3NX4A 4BX8A 2CNBA 1EVJA 4EHNA 4PVCA 4EF5A 1JMYA 1STOA 1ODIA 4X3PA 1KYWA 4LRWA 3EVDA 3DG9A 4WNAA 4S1NA 3RASA 1E3WB 3SZLA 1W4BA 3ERCA 1J7KA 5IKOA 3E7FA 1XPRA 4R7ZA 3A1EA 4AC9A 2C4KA 3H8WA 3DC2A 1DQNA 3WKCA 2WPDD 3QXCA 1LK5A 4E30A 3TD2A 1FSGA 5KQGA 1E9BA 1CNEA 1IPFA 4BLUA 1KO8A 2YYZA 5M7EA 1WMAA 4M49A 5BVHB 2C8JA 3V6HA 4N7BA 5TF4A 4ECTA 4QQNA 1NXVA 4X63A 1ECBA 4AU1A 3A9SA 1BSVA 5KBYA 1KYQA 1CEQA 2B8TA 3O73A 2ASJA 4CKXA 2FPOA 5FJIA 3HSSA 3ZHXA 3KEGA 3U4AA 4AWAA 4NOLA 4N48A 2HQOA 1FJXA 3IA2A 1BVYF 4B4UA 3OOEA 3D3WA 3WGNA 3UMSA 1T3NA 4YDHB 2FPIB 3G2HA 2HRBA 5KVQA 1PV1A 3R9KA 3L9WA 4H1WA 1QGAA 1VIYA 4G5FA 4WLNA 2R751 2BM0A 4MZXA 4I50F 2XY7A 1GQSA 1I6LA 3CTMA 2JJ8A 3M7IA 3PEUA 5GZ6A 1AQIA 1J06A 2M0NA 1KMMA 3NVMB 1CUJA 2AFHE 5IVDA 2ZYHA 1SVIA 2OTCA 4HNHA 4B6JA 3MWGA 3M33A 1E2QA 2Q5HA 4OGKA 5JG7A 2YV3A 2FK8A 1R8JA 3B51X 5JH7A 2V0GA 3TSCA 2XVTA 3ZVNA 4GI3A 4TV8B 4LGCA 4AXBA 4ZCQA 3BB3A 1XTJA 1ICEA 3PD7A 2F64A 2IZ1A 1EXDA 3D2CA 4A15A 1SCJA 3O74A 3V8NA 3DXZA 4XWYA 2A1JB 3ONFA 1CJVC 3EPLA 2OYYA 4RETA 4WA8A 1PZXA 1FMLA 1C30A 4BMOB 3R8XA 2AYXA 3DAHA 1JPNA 1ORDA 3K2EA 2UZIR 2ECOA 1QCYA 2GR9A 4FW9A 3C97A 3OT4A 3K1RB 2LKCA 3WGJA 4TL6A 1UT8A 3RYIB 4GSYA 4H9GA 2G1KA 4YP0A 2H63A 1VKNA 4F06A 3ND8A 5I4IA 5FAKA 5JS1A 3IL2A 1NDHA 3V6JA 3UT5B 4N8SA 1ORTA 2V0NA 3BE4A 3VYWA 2AN3A 2QLFA 2NYUA 3EZ2A 4JJEA 1L4NA 2PRZA 3D8HA 5HKBA 3UV6A 3VOSA 3QX7A 4LMAA 1MXFA 1V11B 3GDWA 4FLMA 5AK0A 2VZ9A 1XOIA 3MIIA 4MSUA 4B9UA 5CRXA 4QXQA 1FFWA 3L4JA 3EQ8A 1CS4C 1RQ7A 2TYSB 2PVSA 3VU9B 3S99A 1FSZA 4FGWA 4R0MA 2AHRA 1CHDA 1DHTA 3K0BA 1J2JA 1T1IA 2PLFA 1U47A 1Z9BA 3H6KA 5CMLA 2ZSIA 3F3KA 2MUTA 1QP0A 3GRZA 5F1KA 4BZZA 1RLIA 1V6AA 4ASUA 4FR0A 2VDMB 2AVDA 4DTCA 4JI0B 3DE7X 3P4XA 5EXSA 5T7BA 3ZY4A 1E3TA 3MUOA 3ZS9A 3UTDA 3ESAA 2RBGA 1TJPB 1LRLA 3KSZO 2JFBA 3KQHA 4C0KA 3UC9A 4ZC8A 4L6IA 5AVWA 4TV9F 1ESZA 1OXKB 4XWTA 2Q8NA 5CFLA 2ALJA 1EE1A 2W9CB 5ES4B 2YZGA 5CLGA 3RUPA 2JZBA 4P58A 3UCXA 2PPLA 1A1SA 2C3YA 2C5BA 4FYKA 3P9NA 4CF7A 4KQWA 2PU7A 2JJYA 1SY7A 5I7OA 4DREA 3G7UA 4IIJF 2ZR8A 2HOFA 4TXNA 9ICEA 1CD5A 1EXNA 4JB2A 4RZ3A 1QIDA 3SX4A 2DFKB 4IPTA 5FCDA 4DPMA 4MUXA 3SM3A 1T5BA 4WLOA 5BSTA 4IQ4A 3NHZA 5DDMA 1Z39A 4ECWA 1VJ5A 3MWDA 5GOZA 4IQVA 1EM6A 1T9ZA 1NF3A 3KETA 3BA1A 5FTMA 1KQPA 3T95A 3NB0A 3OHPA 3PFFA 2QDKA 1TGVA 1TXGA 3GT4A 2OZPA 2HI0A 3R7DA 1T26A 5ALWA 1TZ2A 4RVGA 2W04A 1ZQKA 3IE0A 1GNLA 3FUWA 4UBMA 1N77A 4IQFA 5I7AA 5TE9A 3RNOA 3H2ZA 3SY8A 1V38A 3DBIA 1F44A 1RI3A 2DKNA 3WGLA 4BGDA 1HQYE 4PCUA 3D0OA 4HVCA 1UK9A 3HLTA 1XTPA 2BR4A 1Z0DA 4U2DA 1QQBA 2Q49A 1TEZA 5DB4A 2QSYA 3RREA 2O4CA 3K15A 4FFVA 2IPAB 3PRYA 4CEIA 2YDYA 1M2HA 4GLFA 1NN5A 4DRXB 3MTIA 4GGOA 4K4GA 2VRWA 2W2OA 3C1AA 3EODA 1G4UR 1XJCA 2CE2X 4EMUA 2PV0A 4OJQA 2XAUA 1Z13A 4K87A 1SBHA 3OZRA 2PL9A 4S04A 1E7YA 5I8ZA 4DHWA 2H1WA 2J6CA 2Z2ZA 3II6X 4Z9FA 1NWCA 3TKYA 4ZYWA 4U7GA 4IVNA 3SQNA 1BAPA 3KZMA 1Y7PA 4W1QA 1UAGA 2B78A 4KBYA 2P5SA 4CCYA 3H87A 1EUCA 4U2GA 5HM6A 3G9XA 4D9HA 3IQDB 1QVVA 4NXMB 1CUIA 1JB9A 2MA1A 4PNHA 1HC7A 1RFLA 3R8FA 1FUYB 5DX8A 4BNGA 5LB4A 5FV4A 2NO4A 4DV2B 4OK5A 1NXWA 4ZH4A 2GZMA 3TEMA 4L3OA 4F2WA 1XZFA 1RBQA 1XVAA 1QFMA 5KYNA 4CRXA 2IBKA 1G63A 4LZAA 3KQLA 3BMQB 3ZQ4A 5B55A 4CM8A 3SDZA 4C88A 4NF2A 3GEMA 3IEMA 1WMEA 1NKBA 5F4BA 1V47A 4UUMA 4LI0A 5A5FA 2XEXA 4K86A 2GUGA 1C9EA 1E2KA 4M9NA 3MJRA 2IDJA 4YAKA 4DL3A 3TAUA 2A0YA 1SBZA 2ZBEA 3BZBA 2FH5B 3QYFA 2ZSAA 3EZ6A 5DN6D 1PEKE 2JLYA 2AOUB 2N9UA 1T2EA 3NOVA 1KE2A 4QEZA 4NE9A 2H0RA 1GZ4A 3KOOA 4R83A 3ZIAA 1ZD9A 1L0BA 2BZ1A 3E7XA 1H42A 1VE3A 5ABPA 3MB8A 3SR6A 2BCJQ 1DARA 1HOTA 4OYHA 1ZQBA 9ICFA 4BATA 3S4YA 3T3IA 3G8DA 1PN3A 1ZQDA 5EJ4A 3DP9A 1ZM9A 2COUA 2BRUC 1QU3A 5TGTA 4EPTA 5LC1A 3VC1A 3QTTA 2RSLA 1OWNA 1RLJA 1MB4A 3BFJA 1FQWA 1RQ2A 2VJDA 3FSGA 1OLXA 1ISHA 5TPWB 2D13A 3JQAD 2GOYA 1RNLA 3AVUA 4FB5A 3UV7A 4HQ0A 1RC8A 4KU4A 1XCPA 1GN9A 1PI3A 1P7DA 3N2NA 4JUCA 1UZMA 1L5KA 2HMVA 3WB9A 1UC4B 3AKYA 3OCXA 1L6NA 3LF1A 3OZEA 5CDFA 3TQIA 3BFPA 5FWXA 3F5QA 3WR5A 3H8JA 3LBFA 2P6MA 2JLAA 5JY6A 2WM9B 1L5FA 3KU4A 3ST7A 4NBNA 3KX2A 3DR5A 3P4YA 3OJEA 1U3GA 3ZVMA 2YV5A 5G5GA 2E4AA 3MR6A 3VOAA 5JAPA 3FUUA 2HHSA 4CUJA 2OT3B 2O4UX 2W8KA 1DO0A 2WU8A 1U49A 2Z6AA 1KMIY 2DULA 4MMXB 5ECDA 1YE8A 4JITA 2YV1A 3AEKA 3R3JA 3SR3A 3ZWBA 1T8RA 1K88A 4XB6B 1QAMA 3OBBA 2JFXA 5DLQC 4B85A 2FUEA 1JU3A 2OCPA 5EMJA 3FPJA 1O5OA 9MHTA 2EFCB 5JC8A 1FFSA 4EUKA 3HVKA 3IEIA 1A69A 5DX1A 5B57C 3ZW9A 5DNVA 1TQ2A 4TVOA 1JRPA 1P7WA 3TTUA 1LSJA 3FWPA 4MJLA 5KTRA 1VMAA 5CX4A 3ZCTA 2NUBA 2H16A 3IJEB 3CEHA 2CDBA 3UMBA 4FKBA 3RFVA 4HAVA 4EMBA 4KO1S 3DZGA 3RUCA 1ZLYA 3FCUB 3D7SA 4Z7NB 4XGQA 1Q0RA 4J7CA 3OHSX 2OO5A 2GK4A 1P7VA 2IXTA 2BTQA 1P6XA 1E66A 5K3DA 4RPYA 2BDTA 2PZ8A 5KG3A 5H5JA 4LHWA 2H2DA 1NXQA 2NQ8A 4UTNA 1M7BA 5K9ZA 1QHGA 4TKMA 4KXLA 4CMGA 4EPYA 2QP9X 2PKYX 4EG7A 3NI2A 1ABBA 2GN0A 2KS6A 4JLOA 4B87A 2SNIE 3G8YA 3HPRA 4R8SA 4PPXA 4KLCA 2BKXA 3DZKA 5TR9A 3SDSA 1LPBB 2OBYA 3WK4A 2QGNA 5EMMA 1YZHA 4RPIA 1Y5MA 3H0CA 4BUZA 1XZHA 3COYA 1EFUA 3KAKA 3IMKA 1SC3A 3E5HA 5EAIA 4A0HA 3TOCA 3OPNA 3P5BA 5DX0A 1YZUA 3ZI4A 4JSRA 3IT3A 3LVFO 5LOVB 1KFCB 1X15A 2WF5A 1Y1QA 3C28A 1VMIA 3QEBZ 4FFBB 5ALVA 1MEEA 1KH3A 3CIOA 4X62B 5HW0A 4U0KA 5DLYA 3PC4A 3BPSA 4G1VA 3GV5B 3PSPA 3O84A 1L6RA 3RRXA 4F8JA 5KQPA 4HPJB 2R3SA 1ZJWA 1K68A 4HQFA 4D57A 1SU8A 1YCFA 5AW8A 2DTXA 1RWVA 1R6XA 4EQZA 3AQEA 1NW4A 3RB6A 2YJ6A 2FSHA 1W4CA 5BYKA 4M0AA 3QOYA 5HM8A 1UDBA 5EOZA 2GNOA 4MQEA 2RMKA 4JLSA 4LOIA 2AJBA 1ZZEA 1QIFA 3ZY3A 3U7FB 1F6DA 3NHPA 3H5TA 2BELA 1M10A 4PZUA 3PYXA 1SU4A 1YKSA 4KXWA 3STVA 4ZEVA 4M1OA 1PK1B 4BC0A 3SKXA 1M2EA 4F5PA 4UVDA 4WN3A 3QVOA 1C0IA 3T7AA 3ONWA 1X1TA 5J2EA 1Z22A 1SV0A 4D9BA 1ZJ6A 3TW8B 3JZIA 1LDYA 1FU7A 4Z0NA 2W2XA 2JZOA 4U9IS 3AESB 3BGSA 3BGVA 3UXPA 5JDCC 1TVMA 3K0FB 1MVNA 4S1PA 1Q0UA 2JKVA 4JEMA 3L4BC 3WMGA 4UZFA 3RIMA 4IIGA 2IHMA 1TMGE 4BAZA 3IJRA 4BVAA 3EGDA 1YOVA 3T3NA 3JQBA 3RVJA 4TSFA 3CZ4A 4X66B 1JG6A 1ZN9A 1AD2A 1DI0A 1L5RA 4OV6B 2LYAA 3MBKA 2F1OA 2VBCA 4YYZA 4BNNA 1LVUA 2Y92A 5LUAA 2J9XB 1QIHA 4MQFB 2J9ZB 2I78A 2OESA 4ARZB 4DM3A 3JSXA 3WQQA 3T9AA 1S8OA 4KMRA 3FD8A 2FF7A 2CMKA 4IY1A 3FG9A 1YS7A 2ZRIA 1UJNA 2C3MA 4B46A 4PO3X 6AT1A 2UZ3A 3WBBA 4K9LA 5H7XA 1I7SB 4BP9A 4BE9A 3ZHSA 3MWEA 3QH4A 2R47A 6ADHA 4GBMA 5EKUA 1TECE 3J80A 3HB0A 4CM9D 3CRXA 3FDSA 3ZLJA 3SK0A 3TZBA 4FHGA 1FXWF 3HCEA 2B5OA 4XUDA 1RHMA 2W2NA 1MV5A 2ZPUA 3W4IA 4CF5A 4LHSA 1E2NA 1NI5A 3Q5GA 1I80A 1B2RA 1K7EB 2ZG6A 4XX0B 3HMQA 1XEWY 3NAZA 5JANA 3GYGA 4J9OA 3SQLA 1S2LA 4BV9A 2HSJA 1RPLA 3CBGA 3OIVA 2GCGA 3EF3A 4EB8A 2ZPAA 3G6VA 3PPIA 3E9NA 2H3HA 2ZIFA 3EEOA 1U0LA 9ICGA 5KG6A 1WF6A 2UVPB 3QHPA 4J0GA 4KQKA 1GPKA 4I2JA 1SHKA 4DWVA 1IQUA 3WYBA 5JCPA 1P3Y1 4QTUB 2E1FA 2ZP1A 3QOXA 5A3SA 1JQDA 2HWXA 2OHXA 2EYQA 4CE6A 4PN3A 5BPFA 5CD9A 3BXFA 5J0QA 1ZD5A 3ETGA 2LR0A 3SHWA 3CKLA 4W5WA 4J9SA 2PH5A 1KFBB 1WABA 1GSOA 2G5TA 2K8BB 4G23A 3S1SA 4JVOA 3EGCA 3O95A 3HBNA 1V41E 4GBJA 1SOAA 4YRZA 3B9QA 4TL7A 4LZLA 1NM5C 2J6HA 4F56A 3BTVA 4FMCB 2HKIA 3GVHA 3D8NA 4QOSA 2IXAA 1YRQA 3R5SA 4BBZA 2OG1A 2PFSA 1NF8A 3TARA 3O0DA 2VH2A 3HWRA 3QVLA 3KKLA 2PBLA 2QF7A 2PS3A 4PE5B 2BP7A 2B4TO 1Y89A 3RRYA 5DLEA 3WKBA 1M6NA 3SZ2A 2DXIA 2FWMX 4HWPA 3F90A 3B2QA 2CLFB 1WBJB 3V6LA 1PBTA 2I2DA 1YIDA 1VPVA 4O25A 1ZP6A 2QSUA 4RV5A 4MA5A 3RVLA 3IKVA 4FYMA 3U7QB 1N8KA 1UJ2A 4BEBA 1VZ3A 3NONA 1CZLA 3GJ0A 3D0QA 1JFRA 1R12A 5KOHB 3CSUA 4HDAA 3UOGA 3WLRA 1TD9A 3LUKA 3HPOA 3THWB 4HCJA 2G5GX 4NECA 4Y0NA 4J2OA 1B8NA 4LZZA 4J6EA 3ZNNA 5M5BA 1KBZA 2QLLA 4YJHA 1Z0JA 3HGTA 4V1CB 2ASLA 4HAOA 2KJQA 4QODA 1OYVA 5A04A 3LT5A 4WSOA 1SGGA 1BXZA 5C8YB 4HYQA 4Q1VA 1TU4A 4IRUB 1V0JA 1E1CB 5ILGA 2AI1A 3GGJA 3DCYA 3VI4B 2E8NA 4AY3A 3NGLA 4F92B 2IH4A 3OBIA 3MS2A 3H2KA 5FF9A 3N7RC 3R7WB 4DLPA 3RWBA 2OVFA 1WUYA 3CU5A 5K3FA 2VJLA 3E7WA 3O94A 2J9GA 2W93A 1CUVA 1L4BA 1OPXA 2GRUA 5KHAA 4HLUC 3LQ2A 5HFNA 2CXUA 4HEJA 4FYHA 4JK3A 2DGDA 3A2LA 2ZIWB 1ZGGA 1HKUA 2BFBA 5KB3A 4JSYA 5JNLA 4MRMA 1P9RA 3NUZA 4DT1A 2ZDGA 5AHXA 5LP6B 3INGA 4DXDA 1D0IA 5EUCA 2SKEA 3AETA 1DG1G 2Q6OA 4JUIA 2CE7A 3O8RA 1T9GS 4J4TA 4OQ4A 4TUQA 3JQBC 4C2BA 2O0JA 4GW3A 1HRKA 2XJ4A 4GPTA 1QR6A 3RAGA 1LLDA 3NIWA 1EK2A 4WXEA 2VVTA 4EF6A 1FZTA 1JFFA 4IQGA 2ISSD 4H0NA 1HV8A 4QZVA 3HYTA 1RPZA 3VPAA 1RHUA 5ALKA 3BB4A 2Q9AA 7ICMA 3U3MA 4RVSA 2E4YA 3WGZA 4A36A 4LRUA 4ENRA 4INPA 4GPEA 3SEIA 3PFBA 1KRHA 1RYMA 2FGJA 3C3CA 3ESZA 3G5AA 1S76D 1A8UA 5JCOA 1JDPA 1KMHB 3CT4A 3ADDA 3OU7A 4P3KA 5B3AA 5TV2A 3SYTA 5JCJD 2ETVA 4YRTA 2O2HA 3IV7A 1JXMA 1B8PA 1YA8A 1QP7A 2C2HA 3PIRA 5L3QB 4RMIA 3FSJX 5BWMA 3M3DA 2BFCB 3VKGA 5DNDA 4RY9A 1WZIA 2OY0A 4FHFA 3JPYA 4IOJA 4GYJA 3ZD9A 3D2BA 3VYTB 2RGWA 5C1PA 4U0JA 2OECA 4I4IA 4H6WA 5KOIA 8ICAA 3LA8A 2I76A 5LA6F 2IS1A 2QTVB 1I2BA 2HK8A 4H27A 4MVJH 4L15A 4YN3A 1L7XA 1UXOA 3DDNA 4M8NE 2ZU6A 1TW2A 2PXAA 5I8PA 1F8FA 3R5HA 4RYLA 3P26A 1NBMD 7REQB 3PXEA 3EQ9A 4HBGA 2GQ0A 1IBKB 2Q0HA 2BEUA 1VJCA 3QU5A 3DWFA 2HBRA 1UOQA 3ETLA 2SCUA 3AILA 5T57A 3NCTA 4F4KA 2HRZA 3DTVA 1Z6AA 3KJFA 3SX0A 4ZOLF 4O5OA 4OHRA 1KK2A 1QBGA 4UXHA 3EXG2 9ICLA 4DLYA 4UDYX 1ENPA 4TLEA 5CNIA 4I6EA 2E9SA 5CFPA 3FNBA 4GI7A 4NIMA 3I30X 1XCMA 1NULA 1J8VA 4FJ2A 3EAGA 5FBQB 2ZYGA 1JXLA 1BXGA 3U48A 4PLVA 4MYHA 2PMDA 2KHVA 4FGJA 2IUYA 4YJKA 3DE0X 1PFVA 3T7TA 1AN9A 2J3DA 1JLLB 1T6BY 4O5AA 5JJKA 3BJYA 3BK7A 2BEKA 1NOJA 4CTJA 4J3FA 5C4MA 3HCDA 3N8DA 4E1AA 3MEQA 4O3MA 1BYIA 2QV7A 5DDIP 5T4HA 6GPBA 4LWQA 4YQEA 1T1RA 2NU8B 1UK8A 4BKRA 4N49A 2OQ2A 4IMRA 1W8DA 3ZCVA 4G07A 4RA9B 3ISDA 5SYNA 4HDQB 4RNMA 3W1EA 3AEUB 1L7NA 3GP8A 4JXXA 3P7MA 1E77A 4IRDA 1ZD3A 2IKQA 3KB6A 2WM8A 2QM7A 4P4OA 3V72A 1NJXA 2BHNA 3FYSA 1Z3IX 4C20A 3S1LA 1TZMA 1ZQMA 1W1WA 3L18A 2PR7A 3S0JA 1B6SA 1MGOA 4GUAA 4UBKA 1D9ZA 1C20A 5LQUA 1OFVA 4UUBA 4U6SA 1XTIA 5LZ7A 4NPCA 3UJAA 1AK9A 5JZMA 2Z9CA 1XNGA