3QXGA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron complexed with calcium, a closed cap conformation
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
222
structure length
222
Chain Sequence
KKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 84
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qxgA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qxgA01
4CF5A 2HO4A 1U7OA 2YMQA 2I7DA 2WF9A 2ODAA 3P96A 5ALIA 1ZOLA 5AM0A 1RQNA 4I9GA 2GO7A 3U7EB 3PGVA 4BYGA 4KNVA 2YJ4A 1RDFA 1EK1A 4QQFA 2CN1A 2O2XA 1CR6A 3OTQA 2EARA 1S2OA 3QU2A 3W5CA 3M9LA 3I28A 4OCZA 3KC2A 5A3SA 5AHXA 4CF4A 4NABA 5AKZA 2R8YA 2JAOA 4Y3UA 2VKQA 2YJ6A 4Y2RA 2D2VA 2OYCA 2B82A 2BDEA 2I54A 5AVVA 2G07A 2B8EA 4AS3A 3K1ZA 2HSZA 3QX7A 2G0AA 4QJBA 5AKYA 5AICA 3MN1A 1Q92A 3RFUA 2YY6A 3A1CA 3ZX4A 3WK8A 5AKLA 3L5KA 2P11A 3PCTA 2I34A 2B8JA 3B8EA 4RETA 1QQ7A 3PDWA 1ZJJA 3IRUA 1YNSA 3KDPA 3KZXA 2YJ5A 1RLTA 1ZRNA 5A3QA 1Z4PX 2CFTA 1L8LA 3UMGA 1RLOA 3UM9A 1MH9A 4UMDA 2YJ3A 3DAOA 3U7FB 2I55A 4YIKA 4HAIA 1YV9A 2B1QA 4JB3A 1LVHA 2ZXEA 3QXGA 1PW5A 2C4NA 2YMLA 1WVIA 2BY4A 2RBKA 3I6BA 5AI8A 3WK9A 3EWIA 5ALZA 1RLMA 3E81A 2G80A 4DCCA 3ZVNA 4AS2A 2WHEA 5AM2A 1QH9A 5IS2A 2C88A 3L8GA 3J7TA 4HGPA 4CE6A 1ZD4A 5ALOA 4BX3A 3MPOA 4E88A 5AI4A 5AKHA 5ALGA 4O8CA 3WKCA 4BEVA 1YJ5A 3W5DA 1L7PA 4G9BA 2G08A 5ALJA 4UW9A 5AW5A 2R8EA 3N1UA 4GXTA 3U7GA 2ZBFA 1NRWA 5AI5A 5ALHA 4HGRA 3CNHA 2JAWA 5ALUA 3SHQA 2ZBGA 3R09A 2B0CA 2WF8A 4CNQA 3L8HA 1AQ6A 4Y2YA 5AIBA 3I76A 3QU9A 1Q91A 2YFYA 3QUBA 1RKUA 1VJ5A 2Q4TA 4F71A 3ZX5A 3ZTYA 1Y8AA 3NASA 2IYEA 2YMPA 4NV0A 2ZBEA 4IG4A 1T5TA 5ALLA 2WF5A 5AKKA 2W11A 4YCMA 3KD3A 3KBBA 3QU7A 1U2SA 5AVYA 5ALRA 3QGMA 1TJ5A 4Y2PA 1IWOA 3L0BA 5AK4A 5AM5A 2C9MA 1S8OA 4Y2TA 4BEWA 2C8LA 2GFHA 4HYTA 3CZ4A 4ZEWA 3VAYA 3L0YA 1K1EA 3EF0A 5ALQA 3ZI4A 2IA5A 4FE3A 2CFSA 4AP9A 3IB6A 3L7YA 2P69A 3AR5A 3N5KA 2MU1A 4C4RA 4UMEA 3SLRA 4YH1A 2HX1A 2FPWA 2OBBA 3FPSA 3ZU6A 5ALYA 3NUQA 5AI6A 1WR8A 2W43A 5ALEA 2FUCA 5AW3A 3NANA 4KYTA 1TJ4A 3SKYA 2AGVA 3E58A 1N9KA 3OPXA 2HHLA 5ALTA 2AMYA 2PQ0A 3MMZA 2FPUA 2P9JA 2IOFA 2DQSA 3WKDA 2RAVA 4I9FA 1YDFA 3ZVMA 2O9JA 2Q5EA 5AVTA 5ALDA 5AW2A 1U02A 4XQ0A 4DFDA 5AVRA 1VJRA 2QLTA 2Q4RA 5AW0A 5ALVA 3R4CA 1T9ZA 2B30A 3ED5A 5AKEA 2PR7A 2YBDA 5ALNA 5AM1A 5AW4A 4KNWA 1SWWA 4Y2VA 1NNLA 3M1YA 4XPZA 4DWOA 3WK5A 5AK6A 4RESA 1Z4MA 2CFRA 2I33A 1RMYA 2NYVA 4FYPA 3QUCA 5AKJA 3OCWA 4EX7A 3W5BA 1X42A 1Z4JA 1KYTA 4UM7A 1L7OA 2RB5A 1L7NA 2PKEA 5AKXA 5ALXA 3ZWDA 3R9KA 3U7HB 3UMBA 3B9RA 3EPRA 5IT4A 1O03A 2FEAA 1NF2A 2C8KA 3L1VA 1U7PA 4EENA 4L6CA 5JJBA 5AM3A 3ET5A 1Z4KA 4BBJA 3QU5A 3U26A 4OD0A 2FPXA 3UMCA 4UU0A 4OHFA 4NAVA 1Z4QA 4IFTA 1N8NA 4NWIA 3QUTA 1QQ5A 4EX6A 4CF3A 3WK6A 2BDUA 4GIBA 5AKGA 4J03A 3WGVA 3WGUA 5AKIA 4EEKA 2HCFA 3IJ5A 3L1UA 4UMVA 4FFDA 5ALWA 3RF6A 2AUTA 5ALSA 3EF1A 4YCNA 3AR6A 5AW1A 1Z5UA 4DW8A 2G06A 1U2TA 3BA6A 4BNDA 5ALPA 3U19A 5IT0A 1TA0A 3HYCA 2FPSA 2JGAA 3N8GA 2WM8A 3FVVA 3SMVA 5AIAA 4YGYA 3OCXA 3WKEA 4Y2SA 2W4MA 2R8ZA 4XOUA 2WF6A 5ALMA 3ET4A 2IOFK 4UM5A 5AW8A 4UASA 2AH5A 4Y2XA 3DDHA 2HDOA 1YMQA 2FDRA 3MC1A 3I1YA 4Y2UA 2FUEA 4KN8A 4ZEVA 3ZTWA 2IOHA 3E8MA 3N07A 4NFLA 5AW9A 2JARA 1YS9A 3ZUPA 2B1RA 1QQ6A 4YCLA 1Z4LA 1ZD5A 2JAUA 5ALFA 2G1AA 1XPJA 2OM6A 3QU4A 5FP0A 3AR7A 3OCUA 3ONNA 4XE5A 3A3YA 3NIWA 4JDPA 5AVQA 3HLTA 4HGOA 3AR9A 1XVIA 3WK7A 1VFPA 2OA0A 2WFAA 3FZQA 4L6AA 5AVWA 1RRCA 3AR8A 5AK5A 2YN4A 3DNPA 3TLMA 4PNHA 3NAMA 5E0OA 3U13A 2ZBDA 3SD7A 3ESRA 4KX5A 1TE2A 3E84A 2X4DA 4C4SA 4UU1A 1SWVA 2NO5A 3S6JA 1RMQA 3AR2A 1XP5A 4H1WA 5AW7A 1J97A 4OFZA 4BX2A 5AVSA 3QYPA 5AK3A 2HF2A 4Y2JA 4UMFA 3OCYA 2R8XA 1O08A 5AI9A 1ZRMA 3ZWKA 2WF7A 2FI1A 4UAUA 3F9RA 3SKXA 1ZD2P 4C4TA 5AVUA 3L8EA 1ZD3A 3FPBA 4G63A 3PGLA 4BX0A 3QUQA 5ALKA 1EK2A 3ZVLA 2MU2A 5AW6A 2HF7A 3A1DA 2HI0A 3WK4A 2QYHA 1Z4OA 2G09A 1TJ3A 2FPRA 4YIHA 3NALA 1SU4A 4BKMA 2I6XA 3QNMA 1Z4NA 4UATA 2EATA 3L0CA 2GHTA 5AI0A 5AM4A 2HOQA 1Z88A 2EAUA 3ZW7A 3D6JA 1RC8A 4EELA 1FEZA 3B9BA 1LTQA 1WPGA 1QYIA 1T5SA 1L6RA 3ESQA 3OCZA 4ZEXA 3SF0A 3OCVA 1WZCA 1RKQA 3QLEA 4HGQA 4UAVA 2P27A 4B6JA 4UARA 1Z5GA 2MSNA 3A1EA 4HGNA 4MWOA 5T41A 3N28A 3DV9A 1CQZA 1L8OA 3KOOA 3WKBA 1RPZA 2GHQA 1ZS9A 2HEGA 3NRJA 3FGOA 1RMTA 3AR3A 5AESA 4F72A 1L7MA 3GYGA 2ZG6A 1F5SA 1Z4IA 3BWVA 1J8DA 1RQLA 1RKVA 4J2TA 4KX3A 4MUMA 3AR4A 2GMWA 5AVXA 3WKAA 4EZEA 4L57A 1JUDA 2NO4A 2ZOSA 3FM9A 4Y2QA 2RARA 3L8FA 5AVZA 5A3RA 3W5AA 4BNDB 2YMMA
chains in the Genus database with same CATH superfamily
4ARIA 1FS4A 1P7YA 3ZD8A 4LXTA 4N3CA 4GPTA 3KUXA 4O2RA 2WIGA 4US1R 3DHVA 5LQKA 3VR2D 9ICFA 1NBAA 1EDDA 1Q20A 3HZRA 2ECQA 5JRDS 4XQ8A 1OYVA 2OGTA 1Q7RA 1B6GA 4DA9A 2IEDA 5J2KA 5DMHA 3P20A 3DWGA 3RRZA 3NHMA 2E1FA 1L3CA 4IV8A 1M1NA 3UJCA 4REQA 2XXAB 5LQAA 2VCHA 1BMTA 3O8LA 4MHSA 5FWNA 4UMDA 3IT2A 4FBLA 1FSZA 3FSEA 4CMIA 5IM4A 4KQCA 1JNXX 2I22A 2W9XA 4LK3A 2QZSA 4J7CA 2GD2A 1LRKA 3Q8MA 1LK7A 5I7WA 1RAFA 3TLXA 3JATB 3M4NA 1J0DA 3ELDA 2W8KA 2EZTA 4GOXA 3U3ZA 4XUDA 5CG1A 2J9FB 4AY6A 5ALUA 3A32A 5H3CA 2G1UA 3UV6A 2AXQA 4BO1A 4PZAA 5AIBA 4PYRA 1K5DA 4AWXA 2EF0A 1XU4A 2VDWA 1U8YA 2QK4A 2QA5A 3EXHB 3OSNA 3NIDB 2NM0A 2Q3HA 1G5RA 1CJSA 1KHTA 2QM7A 3RS9A 4AP9A 4NI5A 1EFLA 2ZRFA 5FBHA 4FLEA 2M6LA 4HMOA 4MVJA 3GBSA 5BVHA 5GJBA 5IPFA 2BR3A 3T9AA 2W5UA 1AZTA 3RG8A 4QGFA 1ZK2A 1YK1A 3SR6A 1OXMA 1XD2B 5F23A 5A05A 3A37A 3Q7TA 1F9EA 1PV4A 2G17A 1AHPA 1H5UA 3WLFA 3KD2A 3N6RA 2CRXA 2EQAA 2WVAA 1XZPA 5CDUA 3HL0A 1HYGA 4BJ6A 2RH9B 3RTEA 2VZ9A 3SE0A 1UDCA 3S28A 5D5QA 2E5WA 1NNUA 1O03A 2WMDA 2HT6A 3UMVA 4J91A 4PSAA 5JJCA 2V4UA 3G17A 3A6DA 2WMOB 4O3OA 1Q74A 2N75A 2WK1A 3U6BA 1O0BA 4CF3A 5TGTA 1KMNA 3GR6A 4L5BA 2YYAA 2R48A 1TQ8A 5C1DA 5FOXA 2X5JO 4K6KA 3KELA 2W2KA 1A2QA 1CNFA 3ETRA 4URZR 2HRQA 1U2GA 4ZV7A 1XE3A 2DY0A 2L69A 4X7BA 3SMVA 1AQYA 2HZ7A 2GBPA 4EJSC 4RY9A 4DL4A 3MWJA 4DIEA 4Z8YA 1RAHA 2BGNA 3PW2A 2YX1A 2JFWA 5EMMA 3A4YA 3IURA 3NPAA 2AR0A 3ESZA 3TW8A 3PX6A 3CZ9A 1GZSA 4IGFA 1DV1A 4YCLA 3D5TA 1J42A 2XR1A 3UOWA 3Q7SA 1HDOA 2Q4DA 1OLSB 3THOA 4D8UA 1IHXA 4L4UA 3OH8A 5B3JC 1YGYA 1FL9A 2NQTA 1TVEA 4YHBA 3E15A 4F1WA 2RCNA 1OILA 3X1YA 1UOEA 4EF5A 1ZP6A 2QP9X 1U0HC 4HUQB 1G64A 3IIIA 4YAJA 1LS1A 3PVXA 2IYTA 5AI9A 1S4QA 2CZQA 2UYGA 3NVVA 3PQ4A 3RVJA 3GAAA 1ZW1A 2XCIA 1C20A 3ACCA 3IP8A 4W8HA 2B4QA 3OEWA 4YACA 3ZI0A 3E2PA 4U2KA 2AOWA 1R8XA 3UJNA 5E2IA 1LPNA 5JLJA 4WK0B 5IIOA 4RTRA 1YQUA 4H3KB 5FEUA 1Q44A 3WLAA 1NBMD 2HEGA 1T3HA 3JQBC 3TI0A 4QDKA 3T7KA 1NNSA 3H13A 1GR1A 3K6RA 1VDVA 2PFPA 2D8CA 5EZ6B 2QMOA 2ASDA 2A84A 1T9BA 4LYGA 1ZQZA 2UYOA 3RTDA 4R2LA 4BYGA 4IXMA 2ZUDA 4G36A 1UA0A 3TOVA 1XNRB 3IHKA 3V2GA 3BK7A 1ATIA 1I5EA 1PR9A 1A98A 3C7KA 3UAOA 3NRWA 3CKKA 4RQ0A 1WRBA 3VOBA 3N7PD 4P7BA 3ZD6A 4P3OA 2GNPA 3KKEA 4E2WA 1YA4A 1UZAA 2C99A 3WSTA 2G5HB 5ICEA 1JWBB 2ZVPX 2QRVB 2H2WA 1B23P 4A10A 4M9SA 1VXRA 3NYRA 1A5ZA 4ENTA 1PFKA 3QZ7A 1GV0A 3U3RA 2IEBA 1BHQ1 4Q5IA 3KCNA 3K0AB 4KQWA 3MZ0A 3RT7A 1RLOA 4ZGBA 1UCFA 5FTLA 3DQZA 5DG7A 5ERYA 4NDAA 3HBMA 3V34A 3L7BA 4H15A 3PA6A 3PNBA 1YFJA 1EE9A 1ZQWA 3LCMA 4AKIA 3C97A 2R25B 1R0WA 4R16A 3MFYA 3TSYA 2P4UA 3I09A 2G08A 1NRWA 3T12A 3PQDA 4YR0A 2HGSA 1COWD 4OFBA 3QU9A 5BW4A 1NUAA 1AT1A 3ZKAA 2QAGC 3QGMA 3U61B 4RWZA 4LBZA 1P2DA 1NZFA 2AGPA 1MA7A 1IONA 1SUFA 2AC4A 1LPSA 1J24A 2ON6A 1MP0A 2YR0A 4DMLA 5E6RA 1BE8A 3RPEA 1QSGA 2J67A 5J0QA 3LXXA 4YG2A 3IYLW 1TYZA 4OVKA 3CLVA 2GZRA 2AVDA 2WM9B 1IYZA 4DLGA 5AVRA 2QLTA 4BTEA 5ALNA 3U9SA 3F2DA 3A6KA 2QTVA 3VNSA 2YV2A 2JEZA 1N1DA 3LQYA 4BU1A 2NYVA 4CKXA 4MRRA 3KQYA 3OQPA 1BS2A 4D9FA 4LX8A 5IJ0B 2HWYA 4ITUA 4L9AA 5HHIA 2FZCA 1UK9A 4PGFA 5DB8A 4MP3A 3V9AA 5T3UA 4OHFA 1ST3A 1NXPA 3WL6A 1ISHA 4XCVA 3UJPA 2OP1A 2RG1A 5M29A 2QZZA 1H6BA 5C4IA 4J9QA 3MUFA 2O6KA 1JR3E 2WMYA 5FQOA 4C87A 1FRZA 1JQBA 5AIAA 1ZICA 3OIFA 4RHUA 3G0DA 3O82A 1AKTA 4FGSA 2QJWA 1Z6GA 3AILA 4GKKB 1L6IA 2QMZA 2YXLA 5LQSA 4IEFB 4XQEA 2F67A 3P1JA 3PL5A 3W8FA 4PGYA 4NMXB 1QQ6A 1SZDA 2C20A 4QG7A 5CT4A 4DILA 4F4ZA 3G2PA 1BEEA 1XK6A 3PT5A 4NU5A 3ZQUA 3WNDA 2ZUUA 3NTLA 2ADFA 2ZB7A 5F3XB 3AIOA 2I7CA 1JDUA 3DLTA 4FC6A 1MX1A 5C34B 1A9RA 1ZUWA 1QTRA 5DNCA 3LO5A 1BJKA 1E92A 3EQ7A 4KEAA 5ELXA 1USWA 1PE0A 4M04A 2DHEA 5B1SA 4P34A 5K99A 2VDRB 2OV2A 1XKTA 1RYFA 4G0VA 1ACLA 3K96A 1QRSA 2ZRKA 4RQ4A 3VR4H 4CQMA 4P3PA 2ZI5A 5F4BA 2D8AA 1XTSA 3TLGB 2DERA 1N7JA 5BO5A 1XQ9A 4DNXA 1JU4A 2OVFA 3DMTC 4LXHA 4OHKA 5EKDA 2IU6A 2GEDA 1L8OA 2OYSA 5C32A 5H80A 3OF5A 1IN8A 1G20E 3GFSA 4HDSA 4JEMA 5ITZB 2XIJA 4PVCA 3VMFA 4YMTA 3U56A 1U7WA 1HT1E 3UVEA 5JDCC 2BMVA 5LWQA 4L5YA 4GDFA 3OCCA 3K0KA 4BFWA 4QD3A 1I94B 1XDSA 3NNSA 4DF8A 3ZHVA 3FJOA 2QPLA 1X7YB 1M76A 2H5XA 3HT3A 1TYEB 5EMJA 3O5AA 2I6TA 4A82A 2B6HA 3L93A 4ME6A 2EZ9A 4QECA 3A25A 4BCCA 5AHRA 3KHRA 4USAA 1C1DB 3PEEA 4IVNA 1JHYA 4CIWA 2WYOA 5JCOA 1YJBA 4YJ2B 2CT8A 4OA5A 3T5HA 4FMCB 3QH4A 2ZB2A 4PGAA 5MDHA 1E77A 5DTRA 4XJTA 4EOGA 3BGIA 3NOXA 1OUQA 5I3CA 5AUPB 2I91A 2RKBA 1M73E 2D5CA 2ZROA 1VYUA 4BNWA 1K7SN 3WY9A 1UPFA 3AW9A 3ZWWA 1JLKA 1ZBDA 3CF0A 3VUFA 3BORA 4YASA 5K09A 3TOSA 1E7MA 4Q3OA 5ALHA 1JZSA 1MORA 1M1ZA 5IAEA 3W7VA 2XUGA 2ZWAA 3DD5A 4BNTA 3V7YA 5E6UA 1UJMA 4GMKA 1Y4UA 3RVQA 4CU5A 4ALLA 2OAEA 5K8IA 4TTAA 1UZNA 1BKYA 2OL4A 2Z3WA 5CIQA 4Q02A 2XCOA 3MT9A 4JQOA 4OIMA 3JR7A 2FPWA 2WLSA 1M6YA 4WJKB 1E3DA 4IUDS 1N2GA 5IIMA 1IZYA 3RJIA 1FP1D 5L1IA 3KJGA 3L7MA 3W79A 4PSCA 3LVFO 3HSKA 4PCVA 5ALTA 5LBUA 3OQIA 5FLXA 1CQPA 1Q5PA 3JRWA 1Z82A 2B5WA 2B3TA 4LISA 3SQWA 1NK4A 5B7QA 1Z5VA 2ZIWA 9ICPA 3CZAA 3MTJA 5AK6A 4QODA 4XVHA 5IBQA 3BXPA 3VPFA 1NW6A 2EKPA 4DXAA 3DEEA 1OIWA 3PC4A 5KYXA 4KLJA 1ORHA 3CUVA 2WPDA 3T1YB 4LDZA 1QV9A 1Z4KA 3BKXA 2QD1A 1X7ZB 4PBSA 3E2IA 3GGSA 2OYYA 3NDIA 2KSOB 1SBTA 3R3SA 1AS0A 4RLHA 5LJIA 3PJRA 4PZYA 2V9PA 4DW8A 1U2TA 3B48A 2XYHA 2EXXA 3KEOA 4F8RA 1BPXA 4M0UA 4U7JA 2ZXUA 3E9MA 2ZIXB 4DN6A 3CS3A 1KBQA 2Y8EA 5IF9A 1OZGA 4MDFA 3ZBPA 3BE6A 4YA6A 3PB3A 5HK9A 4NOLA 3RJTA 1WUDA 2CVHA 5J43A 3VPDA 1R0SA 3TBHA 4FS8A 4TLEA 4D9CA 3ONNA 1BGVA 2PGAA 2RFLA 5M5BA 1MO6A 1XYVA 3DZ8A 3HJCA 4NYIQ 3R5JA 1SKUA 3UEOA 1IJBA 5L1KA 1GUAA 1GFIA 3LP6A 1RTKA 1VOTA 4TWZA 2ILVA 4EVSA 4P5PA 5M04A 1TRHA 3RJGA 4ANFA 4RZQA 3CGWA 3A9CA 2DFTA 3TIFA 3JRXA 3LUAA 3VAAA 3UFXA 3AERB 3F98A 3LL4A 3DXXA 5IP5A 5DBHX 5T4FA 4HH3C 3ZQ6A 1KNQA 1VBKA 4TT3A 4ENQA 2ZAGA 4ZT3A 1UMCA 1GJRA 4HVCA 2HT1A 1Z2NX 3PZBA 2QUJA 1T5SA 5EHNA 5J0OA 1FXUA 2K4IA 3BWEA 4ESHA 3GJYA 1CY2A 5DLDA 4RZ2A 1JR3A 2ZYIA 4X9XA 2GCOA 4YWJA 2WAQF 1Z5ZA 1VPWA 5G4KB 1KTIA 2DFNA 1E2UA 3C8ZA 4L95C 2OUIA 4ICAA 4K1XA 5IW8A 4DJTA 3D4PA 1XMPA 3OC6A 3R7NA 1TRKA 4XDGA 2WWIA 2XCTB 3PQEA 3OQVA 1AF7A 3SC3A 1IHOA 2F1IA 4WASA 4P4MA 5G1NA 2R7LA 3GGJA 5JVDA 1HX7A 3EB9A 4B9MA 2R86A 2NTEA 5EKUA 3MBKA 1SQGA 4CF4A 2VUIB 4LF9B 4A6XA 1W0KA 4KL8S 4UXHA 1WIWA 4WESB 3T3IA 1TEZA 3NHJA 4HWSA 1JI7A 1EXDA 3WIUA 2DPXA 1TZCA 1ZZGA 3EXFB 3TNJA 1SBNE 3PC2A 1DJNA 1UFQA 4NYJR 3ZWXA 3KAJA 2WP0A 1U1CA 3KQSA 1KAOA 1FLAA 4RELA 2IPOA 2JLSA 1RWPA 3KXDA 3SF8B 1R5JA 1RYZA 2IYFA 3MJ4A 4ZVTA 3TADA 4LF8B 3VR4D 3H5LA 4I28A 4N7JA 1TT7A 2AJBA 2QMQA 3FOFC 3RAEC 3LUGA 5TNXA 1WXXA 4KN9S 4ZQIA 2AOUB 2QN1A 1JEDA 2AFIB 4HI0E 5TVKA 2UUPA 2G9UA 2X5XA 3FCEA 2G0TA 1XO0A 4JLKA 1U8AA 3D3EA 2IXBA 2XCQA 1N92A 1SC9A 5HRCA 1XLWA 2WG2A 1Z0JA 1ES9A 3NAZA 1SZJG 3L0BA 1XD8A 3EEBA 2JI7A 1QAQA 4V0RA 1TB4A 3DAPA 1JAZA 2XI4A 1E6MA 3HA2A 1TW3A 2Q3CA 4KRFA 3REQB 1WR8A 2W43A 1DO2A 3F73A 4KYTA 3OX3A 3G13A 2E1RA 4M55A 4I1OA 1ZD8A 2OWEA 4MNTA 4NBTA 6CHYA 5BYJA 3KB2A 3OM0A 3BZWA 4ZYWA 1WPRA 3CH6A 2AI1A 2QN8A 2D54A 1V9PA 3E8XA 1FU7A 2ZJ0A 5EP2A 2PV0A 4OAQA 2XQKA 5HF6A 3CNOA 3EZ6A 2HQ1A 5K0LA 1H2FA 1QK4A 4DSEA 1IQPA 2Z8YM 3JD3A 3FSJX 4Z49A 3I01M 3MS2A 3VVBA 1YQTA 2GOYA 1Q15A 2AS0A 5HVNA 1EINA 2B78A 4BN5A 4I8DA 2YZNA 2V6FA 1CDZA 1ZXIA 4MKIA 4UTNA 4R8RA 3ESYA 1KE1A 2DPHA 4M2LA 5IKXA 2A86A 2DPIA 1WXFA 3B5EA 4WVLA 1Q3KA 4RQ3A 3ZY4A 2ZM5A 1GA4A 1U3WA 4N54A 5JS8A 2QGNA 1RNLA 3G9UA 1BE6A 2V58A 1F1JA 4JYBA 1NT4A 2XB6A 3GAFA 2EKQA 3VNRA 5JFGA 3RAQA 5IKPA 3NIWA 4WHMA 1YKGA 2BV3A 2V96A 3LDGA 3AOGA 4QLBA 5L1JA 3RJ9A 1ULAA 4XZ3A 2RG7A 2BGRA 1E0JA 2EW2A 3VXKA 1Z38A 2IXAA 1J33A 2KZ3A 5A02A 2B5VA 1ED1A 3T7JA 3KV1A 3I2YX 3L3FX 2HJSA 3EVZA 3ETHA 2FDXA 2A78A 5IM4F 1LXCA 2BL4A 1MUUA 1SELA 2BFFA 2F1RA 4CKWA 3KYBA 4R81A 1WULS 3WDMA 1KRPA 4L0MA 1B22A 4G8JA 4UFOA 4LUCA 2LYHA 3ZIAA 3F1KA 3TLJA 5AW6A 4KSCA 4BCDA 5DDMA 1MO3A 2HMYB 1O77A 1T5HX 2CL5A 1N2EA 2Z2JA 1WCNA 1OBCA 1SCNE 3UA3A 5DLYA 3LY5A 4WUVA 2PZ8A 3QLVC 3M6VA 1TK5A 2DPGA 4O3RA 4LQCA 2ONZA 4PHGA 4G0UA 4AMBA 4EFDA 3B6MA 3IILA 4NDZA 4BZXA 2HBJA 3IFSA 1ZM2A 3T4UA 3F0TA 2E82A 1P0IA 1UDWA 1B4DA 3AUUA 4ZI7F 4O08A 4QDJA 1U1IA 2Y1JA 4AQYB 3ZCXA 5BN4B 1D1SA 4IGEA 4WIAA 4DIOA 3HABA 4P0QB 2IMWP 3R20A 1NSTA 2HQBA 4WPGA 1RBYA 3TG2A 4NMHA 3ZZUA 1GQFA 1LPOA 1M2FA 1V1JA 3DOHA 2HIGA 2KWIA 1V11A 4PAMA 4OCZA 3RC9A 1FBTA 1W76A 4MKHA 1FFEA 3KVOA 4HTFB 1PG5A 2IX9A 1FJXA 1C0EA 2IXFA 2LCQA 1VCMA 4YCBA 4QICA 5LUBA 5JBIA 2FOLA 2AHOB 3EGOA 4R83A 4P4SB 2B8JA 1LZLA 1RJGA 2YOHA 3DO6A 5KPJA 2GJSA 3QHAA 2I2BA 1DC8A 3T7CA 1TYCA 3D7SA 1LZKA 1KDRA 4GD3Q 4KB5A 3ORYA 5DP1A 4OYYA 4R8UB 5IKMA 1HMPA 3VO9A 2R3SA 4QREA 4HLUC 2X2EA 5C8XA 1GKLA 4YUWA 4XQCA 7ABPA 1S9FA 2GLXA 5B55A 1YJ5A 2EC5A 1KL9A 2Z7JA 4D3FA 5LP6F 1C7YA 3I1IA 2JVIA 3I04A 4DR5B 3KZOA 5BV7A 2JI8A 1KH3A 2FCAA 2IYRA 5CR9A 2ZPTX 2ZT7A 2HHHB 4TN1A 1MEJA 5MF6A 2FPPA 1DC6A 1QE0A 1A2BA 5JXWA 1W1UA 4JITA 5FLKA 3UENA 1YQGA 4RU9A 4HN9A 4H16A 5B58C 3C7AA 4M1SA 1EGMB 2FE1A 2PUJA 3PW4A 1G98A 1NKVA 4UCQA 1UPBA 4Z4CA 4AN1A 3C7CB 2I3ZA 3NTQA 4MVJM 1WETA 2QZ9A 4JL6A 4U7FA 1KJIA 3WL3A 3WC4A 4US8A 3H9UA 1I0LA 3B3FA 6NULA 4DGSA 1HLDA 2A6PA 5D3MB 1CERA 3TGPA 3LVVA 3FZEA 3F78A 3I6MA 2FAXA 5JAIA 2BGGA 4HUJA 2XWPA 3PEYA 3P2MA 1NF2A 3O8QB 5L3QB 4WK6A 1LD3A 2VJCA 4OHUA 1GRRA 2A9VA 4Y1FA 3TLYA 5CITA 2LE0A 4UFPA 5FFNA 1UCVA 3P9ZA 4E21A 3UPQA 2BQ3A 4OBBA 3IERA 4E51A 1XQWA 1DG1G 1GQQA 3LVRE 3RSGA 1E6KA 4Y2SA 2PVSA 1KSGA 3VR6A 4GKVA 1GYQA 3LT4A 2OGUA 4OLJA 1QGED 2A9KA 2JCYA 5CNIA 4RH1A 2P75A 2BZSA 4X62B 1OBOA 1NW9B 4PN7A 1F2TA 4YLYA 2JARA 2BT4A 2R8OA 1NOIA 2H0AA 1FRFS 2GBIA 2VHUA 4HGOA 2NUPB 3RNOA 3BZCA 2HQSA 3I2JA 1NPDA 4GNRA 5LZ9A 3RROA 4FHGA 2XDAA 3ONFA 1PL7A 3CWQA 1OZFA 3BL5A 4M54A 4UU1A 2DR2A 4RZUA 1Q57A 2JATA 5KJ1A 1NLMA 4Y2JA 3UAWA 2GXQA 4NZZA 3W9SA 3ZWKA 4AY4A 1C9YA 1PEKE 3BSFA 1TKAA 4KPGA 1QHYA 2IEAA 4KACA 2PZEA 2EFYA 1GSOA 3MWDB 4B17A 5EL0A 1QIGA 5ALKA 1H65A 3LYSA 4UDOA 4D5GA 2PFKA 4JK1A 3LWMA 4M87A 1TQ4A 1NUSA 2PMEA 5H16A 3A9UA 2GHTA 4G67A 2W8ZA 4IWYA 3L92A 3O8OA 4GECA 4OQZA 4ZEXA 4HZUB 2H5IA 3CVXA 4FGKA 1E5XA 2AGOA 4DTIA 1DAFA 5T41A 1G8KA 1RCFA 1QU2A 2PFNA 3AVYA 3NU1A 3ZJYA 1XI2A 1CZHA 4PR3A 1QIHA 3JX9A 3OQBA 2ZWVA 3S5UA 3L5OA 2ZATA 3AL0B 5JZOA 3E4DA 3QFRA 5FV7A 2NAPA 4DSUA 2QUIA 2OCEA 2YMMA 1NN1A 3QSGA 3GLIB 1KRWA 3THRA 4YXWA 3O26A 5DYYA 1RZRD 1SG9A 2UXCB 4JQYA 1IN4A 3V1LA 4B3CA 3QKTA 5E7QA 5E95A 1QO0D 3TTTA 3S2IA 1HNXB 4AAYA 4HYYA 1V85A 2H1WA 3M1LA 4KQ1A 4LTNA 3ZIDA 2ZIAA 2IZ1A 1V7ZA 4AY3A 3CRRA 4M99A 2EEZA 1ZJJA 2EQYA 4WBNB 2VJ5A 1NHGA 3ANXA 2FSFA 2PJDA 3UJ7A 3ENVA 5FPPA 3ELWA 5KFGA 4ZRMA 2Y77A 1VL5A 2IRWA 2OBYA 5J59A 5BSHA 1PR6A 5A3JA 1GADO 2QMEA 3LRTA 1XX6A 1F8YA 4KO2S 2HVHA 5A62A 4MUNA 2Z9BA 4KMRA 5ALJA 2MSCB 3U7GA 4GX0A 1D2EA 2OO5A 3UJ3X 4W5TA 2OORC 5CR0A 4FVTA 3V8RA 3MINA 5FH9A 1ZAKA 3URKA 2CZCA 2YMPA 4QZIA 3AFIA 3P9QA 4S1WA 4B1FA 4NBSA 5SICE 3S99A 3QOWA 1W88A 1ZJWA 4CM5A 3H5NA 1FUYB 2G71A 3HI4A 2C59A 3ZU3A 1EA5A 3ECAA 4HAOA 4DLYA 3QYAA 4LX0A 1F8GA 5AW3A 2JLUA 4MIEA 3JAKB 4F3YA 3GZNB 3GOQA 1F6WA 2E18A 3G2HA 1YH3A 3CLHA 1OWMA 4BQSA 1AXGA 2E55A 1PZFA 2KJ8A 5LSAA 3I5MA 5F1YA 4KV7A 3RHSA 3K9BA 5DLGA 1PRYA 1SBQA 5C1BA 2UYQA 2JEOA 2HA0A 1U94A 4HDCA 4L8WB 2CUTA 4LGVA 4R1UA 4A6DA 4ILKA 2OXFA 4DV2B 4EA8A 3PMNA 3O47A 4JHLA 2RHHA 4EYSA 2OPBA 3O4IA 2MIIA 4R9SA 1V6CA 1O87A 1ZI6A 4N9WA 2ZJ1A 3NT4A 4TVBA 4N03A 2YDXA 1JTFA 2SICE 3WGUA 1ZQAA 1NOMA 2A57A 5GTHU 1FVOA 2VP4A 1GD1O 4FKBA 2E4XA 3E3LA 5A4FS 1CZOA 2IITA 4J0EA 1BDBA 3BOSA 3I2FA 4IQUA 4CFSA 2F9LA 1HQYE 4BDSA 3ZZ1A 3DLHA 1GGMA 4QBFA 3DOJA 5DRTA 2VOEA 3T0GA 2G9VA 4AIIA 1G8FA 3CRZA 3AEQB 2GEKA 6LDHA 1BKSB 5FOSA 2GJ9A 4NICA 4DYHA 3IQDB 1POWA 1XZQA 1FP6A 2BJVA 3AR7A 4AF6A 1RM5A 3HMKA 3NVMB 8ICNA 4RJKA 1RYYA 3D0OA 4NZ9A 1WMAA 3N75A 3O03A 1RKXA 1MKYA 3AL2A 5AK5A 2V3CC 3TSOA 4HB4A 5JI2E 3K6SA 1XP5A 3LHDA 5HA5A 1X2IA 1MJ5A 4K3VA 2EKZA 5GOTA 1RM0A 3K4HA 2H65A 3FOCA 1FVHA 3AU2A 1AC5A 1XKXA 4G63A 4CUZA 2QSYA 3GARA 4JT9A 5K2OA 2WB4A 2V3WA 1DU4A 3L7JA 1U0LA 4E13A 5KJ6A 4DQRA 4INJA 3D0KA 5FAXA 1ZPDA 4XB2A 1G2PA 4MJ3A 1E7SA 5BN1A 4E1AA 4GNKA 3FZNA 3SPXA 1SCIA 3T41A 3CF4A 3PVZA 5GZ1A 1QZUA 3OHAA 3BCSA 1U0JA 4I1VA 2N0SA 8ICAA 3FGOA 3FHTA 1DTWA 4MLZA 1G7TA 3VUEA 3SIXA 2JLXA 2VWQA 4GOOD 4FI3C 3NKLA 1N2JA 1TZJA 3EC1A 4R1TA 5J2CA 1A9QA 2YTZA 5FOQA 2WFMA 3R1IA 4XYGA 4ND3A 1R6BX 1GR0A 1MO5A 4BAGA 2OCIA 4LJ5A 4IIVA 3WLQA 4RSGA 4Y6LA 2FGKA 4K7JA 3WNCA 2CL0X 3QP9A 3ZV4A 5IX8A 1Z68A 3AIIA 2EGUA 3RHFA 4Y6GB 4QXOA 2P91A 3H1FA 5BNTA 4P4UA 1KKXA 2J5KA 2C0QA 2H1FA 3O4VA 2W6PA 3DYIA 5L1MA 3PTLA 1AK9A 2H07A 3TNDA 8ICEA 5H7XA 5CWRA 3VFDA 3UATA 3HWTA 1AQUA 3UWSA 3PNKA 4KN4A 4W8GA 1FUEA 1HYEA 4CUKA 3KWJA 1ISGA 1WO8A 2G80A 4FQ5A 4OGKA 3RUFA 3ZW9A 3GV0A 4GOLD 1I80A 1OLXB 5TGDA 3P19A 2OK8A 1T4MA 3QY0A 4HB0A 5EWLA 3GA0A 2A88A 2BE7A 2WWWA 3IL2A 4X97A 4DOAA 3TVDA 4DLNA 4NVRA 5IH7A 5C1IA 5CFOA 1VJ5A 3H11A 1NDHA 1W35A 3RS2A 1EXMA 4FYIA 1VGQA 4OSEA 4H7PA 4MCIA 1PEDA 3CB4A 1U28C 1KARA 3JU3A 2E5SA 4MW1A 3TZLA 4J4BA 1E1RA 4ENVA 1Z08A 1IZ7A 1GUBA 1Q1EA 1JN3A 4DMGA 2UDPA 3PDIA 3H16A 3E22A 4ZYXA 2YRWA 3WL8A 4ZWNA 5A06A 4EG8A 3ERCA 3NTVA 1TMYA 2DQSA 1V4NA 4LJLA 4WZBB 4JI6B 3QEBZ 3CIOA 1T9ZA 1W0CA 1M2EA 2DPJA 3PZPA 4V24A 4RS3A 2E4YA 3SC2A 4URFA 2AN5A 1SXJD 4GEGA 1OFVA 1OAOA 2AV6A 1SOVA 4Y9UA 1RBQA 2XE8A 3KR2A 5HM6A 4BGVA 3RF7A 2Q99A 2OQVA 2F3RA 4EHIA 2ZETA 2HRCA 1YDMA 3GRZA 1O94D 4IDHA 4OD0A 2X86A 4W7HA 2CVQA 2JA1A 2HCJB 3L49A 4L8YA 4UNPA 3HNOA 4HDOB 5KFUA 4LRTB 3NBMA 4DQQA 2C4KA 1N32B 2LZ0A 2OY0A 1GO2A 4C80A 1QZXA 5J1TB 1M7BA 2EKLA 3DAHA 4P4OA 3BXEA 1BX0A 2GF2A 5KBYA 4B7CA 4YUZA 4RM2A 4GRAA 3T79A 4CMEA 1HWYA 3BS7A 5KYUB 1E94E 4JJEA 1XQYA 3JXEA 3UA4A 3ED1A 5BOMA 3MRTA 4URWR 2XD9A 5B30A 1S8FA 3NXSA 3PQFA 3LSYA 1NIJA 2WJWA 2H4HA 5DHPA 3E7XA 4IMRA 1O3YA 5BUCA 3MR6A 2Y1OA 3HHEA 2PUVA 3TLMA 1AMOA 1P61B 3CWCA 3JYPA 2VSFA 3U37A 4HQOA 2HJ9A 1P2SA 4N8DA 1Y1PA 4B6GA 2ERCA 1ZD3A 5HQ3B 2LCFA 2A1UB 4P35A 1K97A 3ZDRA 4ZCQA 2OZKA 4GE0A 1HGXA 3PXDA 3BE4A 4C0AC 2XWBF 3B70A 3SZGA 4Z0NA 1PQPA 1JA1A 1BH6A 3JTEA 4MV8A 2C1EA 2RHMA 1E4YA 3D3WA 2WYIA 3BIJA 2X1LA 4HVTA 4YJGA 1LV8A 1T8SA 3H3FA 3ZYCA 1RI2A 5BSWA 1P0CA 1NUHA 4U9HS 3PQ6A 1N1EA 1QE5A 5FPYA 2V7PA 3NTOA 3W5AA 4FK8A 3MFQA 4A7PA 3AI1A 3T1HB 4ZI7A 1JV2B 4F11A 3PGVA 2K2QB 4RU1A 4I1IA 1DJPA 3I1JA 1VMAA 2LGJA 4ZT6A 4LKRA 1H9AA 4GG1A 1Y1QA 4JXKA 3DT8A 4I4IA 4AUKA 4RGYA 5IAAA 1P62B 1QPGA 2R8YA 3GEBA 2DLCX 4COKA 3HH8A 3LVQE 1HZZA 1LPAB 3B6ZA 5DJ5A 4QXMA 1RQ7A 3ZD7A 4G3XA 1CY4A 6YASA 4HEJA 3KDPA 1KW4A 5A3QA 4RF4A 1N34B 5BSGA 4B0OA 2ASEA 2G36A 3ASYA 3WGIA 1SKYE 3OLZA 1GQOA 2HA4A 4XWYA 4YMUA 2BTQA 2PX8A 4Q4DA 1NXTA 1NK7A 5JI3E 4UB5A 1MVNA 3AP1A 3C3KA 5KDDA 3UWKA 4DS4A 1O95A 4PO9A 1OR8A 2J87A 5B3LA 1YCGA 4B35A 2WE7A 3RAFC 2G5IB 3ND6A 5K0CA 2OZLB 4MH0R 3KQLA 3EDOA 4NR0A 1AQ6A 1KK2A 2NO1A 2O8FB 2H0QA 4BTLA 4M36A 4MV3A 5CB8A 2FRDC 3RWMB 3AP2A 4IH1A 3HLYA 2F1JA 2Z56A 1IHUA 5AK4A 3FA2A 4A8JC 3H0RB 3L6DA 4P2HA 5IXYA 1N75A 5LP6A 3HVHA 1ADJA 1NG1A 1UBUS 4ITVA 1PX2A 4EHLA 1DV2A 4U6NA 3OMWA 4J49A 3D8BA 1X1DA 4JGIA 2JIZA 1YRHA 1JB9A 2YICA 5I7OA 2FRXA 1ZQPA 2CFOA 3IAUA 2WAOA 2GSDA 2IHVA 1PYGA 4KRGA 3HG7A 3RASA 5C8YB 3C1TA 1V96A 2YNMC 4C3VA 4CDGA 1T0JB 2O0KA 9ICMA 2AOTA 4CT0A 3F1LA 4KIUA 1DAIA 1WUJS 3TZEA 4PIPA 1QIDA 1VXOA 4DDUA 1D6SA 3UZUA 4BVHA 3R5HA 3IESA 1TAQA 5AXCA 3AKDA 1L3IA 1ZQYA 2W6JD 1XDGA 3GA5A 4Z0TA 3ENZA 4D26A 5ELMA 4V03A 4M46A 4PPQA 2CHFA 4NYIR 1KU0A 3TTYA 1IULA 3GV8B 1EHYA 2VCEA 4IDEA 1ORRA 3E5MA 2P62A 5A71A 4KMUA 1N5LA 2OHJA 4RSMA 2P30A 2C0CA 5JD4A 3GPLA 4YFYA 5EMNA 2G1KA 5ESDA 4HZGA 2WM8A 4EJSB 1JG1A 3TIVA 1TAGA 2IDKA 1U5BA 2C5AA 3RYHB 4J4HA 1M6VA 2ZTHA 3MJCA 3S44A 3S7TA 3T7IA 4PQGA 4XFKA 4IBOA 4QO8A 2GPJA 3JRNA 2XYQA 2OO3A 5J2UB 5JXGA 1YHYA 1VIMA 4YMMA 1QIKA 2XAAA 3EZ2A 4YV2A 4OHXA 3PVSA 3FDIA 3U0BA 1EX7A 3G8BA 3THYA 4Z3OA 2Y0BA 3UKOA 4GRDA 3ZN2A 4CVNA 1D9ZA 2I7XA 2VJDA 2SHKA 5KVQA 4AJ9A 1P9WA 3S6JA 2FHPA 4YP0A 1UWVA 4BLTA 4S24A 4R9RA 3C3JA 3QYJA 4WNAA 2GLUA 5IRCD 2FI1A 3SV4A 4NOJA 4E08A 3D1JA 3GLTA 4MI9A 1FTYA 2F8LA 1MAUA 1WU8A 5AOVA 2C83A 3H84A 1IE3A 1YC5A 1XTQA 1XL0A 4RPGA 2PJUA 1RC8A 4YXFA 1L7AA 5JC1A 1CEZA 3MUNA 7ICSA 4HYEA 2XUPA 3CONA 4IOLA 2GPAA 3FJYA 8ICCA 5T8KC 2RHDA 1X8LA 4FSHA 3VM6A 3QVLA 3TE7A 2P4SA 2IZOA 5T7BA 4B31A 5G0UA 2ZPUA 3AUAA 1E5LA 5I8WA 4L57A 2NO4A 1AKWA 4A73A 3MT0A 3A0RB 3EK2A 3KJQA 4J0DA 3LUBA 4BC1A 1UWCA 3JQ7A 4G25A 1GY8A 3UWOA 1KY5A 1BNOA 5D4BA 1UJ4A 2R9VA 4EGJA 2D0OB 1I3KA 5IARA 1B6TA 4PZEA 2IHUA 2DC1A 3OJLA 3EPJA 1ZRHA 5I9LA 3IAAA 4QZBA 2Y0SF 3GQBA 2V0GA 2RGEA 3QM1A 3Q9LA 4Q4AA 4KCGA 2FUNB 2QUZA 2BDEA 4MWBA 2ODEA 3QV1A 3BHJA 5L3SA 1WX1A 3WRWA 4HC4A 2YY6A 1AG9A 4HQ0A 3AB3A 2PRSA 2Q07A 3BK1A 1CJMA 4JWNA 1V8FA 4Y30A 2C2ZA 3Q6MA 3K72B 3HJTA 4M1YA 2I2DA 4ONEA 2RH4A 1OH6A 2IHNA 1NWCA 2NSHA 2ZB3A 2UYHA 2WB1C 4KIJA 3ZJUA 9GPBA 1SC4A 2AOVA 4QLOA 1L5HA 1JFSA 4U2FA 2ZWIA 2WF8A 2HW8A 1PVQA 4WNCA 3VYRB 3HNPA 1V95A 4IPTA 1Y1SA 3I04M 2QAGB 5LQNA 2BPFA 1TK2A 4F4JA 2ZSJA 2HHQA 5CFQA 5I9SA 2AKYA 3Q3EA 4C76A 2CLLB 2HRBA 2IU0A 5ALQA 4BO2A 5EIEA 3LY7A 4UNRA 3EYZA 4I7EA 1M0SA 2YS7A 3U49A 4KN5A 4D57A 3RS4A 3KHKA 2VPWA 2AG8A 5TX7A 3L0ZA 4R68A 2C7BA 3E7DA 2BP7A 1HOTA 4J9PA 3KG2A 3DFFA 1YS4A 4NKRA 2V7GA 4GC6A 2AF4C 2VFAA 1ZSYA 3R9XB 2FW8A 4DFDA 2Q4RA 3GB9A 3M5DA 3SJ7A 2FCRA 3OQNA 4CKEB 2XNDD 4LOLA 1DP4A 2FB9A 3PV0A 3I1FA 1F2UB 3AEKA 4B6FA 1ZI8A 5FWAA 2CSXA 4FFBA 1I2CA 1ZQBA 3ZHZA 1B3RA 1KEUA 1CETA 1IY1A 5JY6A 1MNQA 5BW6B 3VH2A 3BSYA 4B83A 4KLDA 1MIOB 3NFYA 3BS5A 4UULA 4IFTA 1ZKMA 2RJ3A 3IC5A 2WTNA 4QKQA 1O6CA 5EGSA 3NDBB 2FLLA 3MVEA 1Z5NA 3G8AA 2QHXA 3IXQA 3KOZA 3P5BA 3ASZA 3T9BA 3CP8A 5MN6A 4ED0A 2Q6OA 1KI7A 2F77X 2F76X 3FWPA 3KTFA 4ECVA 3USES 3ICWA 1PNOA 3ONDA 4IOMA 5CH3A 2KQUA 3OFND 2RP5A 4Q3BA 2QYOA 2MYUA 3WJ7A 1I33A 5ETJA 3N07A 2O0HA 3D4OA 4I2AA 3WGJA 3WP1B 5LBIA 3ZLUA 2CXNA 4I6EA 3RH6A 5AVQA 2VHWA 1YOVB 2PS9A 4QUGA 1VB5A 4CLHA 1ZHHA 2PEZA 4XUSA 4QGAA 3FDSA 4BVGA 4D4HA 2OT3B 4GVPA 4BKUA 4RE5A 4XIGS 1MX5A 5JAMA 1K9VF 1QHGA 1XHFA 1TPYA 1E61A 3PF8A 2R8JA 4PSKA 2W55A 2GRJA 1REQB 4KQ6A 8ICJA 4G0WA 1ZRMA 3VPBA 3UIEA 1GNSA 3R5FA 2IEYA 4OM7A 3ZW8A 1EBBA 2PZGA 3EASA 3TZHA 5B6PA 4G9EA 4ZD6A 2FV8A 4F5DA 1YVPA 2JD2A 3KZVA 3B1WA 3FN4A 1P9OA 4J3FA 4NCJA 1P60A 5BPHA 4YPFA 4A23A 1NN5A 5ICCA 5LQUA 5K0NA 3LD9A 1C7IA 1RQGA 4JYAB 2HF8A 3VSEA 1ZH0A 3D2NA 1E6UA 1YI1A 1MC4A 5U4XA 3OOJA 5DE3A 1BJRE 2DGZA 1W4ZA 1UWLA 2C7GA 1SMKA 4GI1A 2C95A 4EW2A 3G8CA 1ZMOA 2IW1A 4DT1B 3IP6A 1NVUQ 1NC3A 2AJDA 2J48A 4GVLA 1DWOA 1ZQFA 5EJEA 5C7OO 4FE4A 3HP1A 4PZDA 3LT0A 4R1SA 1NNEA 3RBXA 4RC9A 3F6PA 1ZKDA 2VXBA 4ERNA 1JXOA 2FLWA 3N7RC 2GBCA 1T9DA 1FQJA 2PX0A 3G8DA 5KL8B 4O4LF 5THXA 2R0QC 1CK4A 2J7PD 1SK9A 2WDZA 1Z18A 4OSPA 5AKLA 3WTCA 1EFRD 1G18A 1RSZA 4LC1A 5P21A 3KHUA 1J22A 1SQSA 5DNAA 3E9QA 3ZQJA 3AFMA 5LB4A 3BGOS 4X3CA 3C1AA 2I4RA 3VOTA 2DJ5A 2A5FA 1Y3FE 1BPEA 1YXMA 4L8GA 4I2IA 3IO3A 5AI8A 2JZNA 2JEJA 3A6FA 4BNIA 1HDXA 1FTNA 4QARA 1GZ6A 3HGMA 4NQZA 4DV7B 1F4PA 1XV5A 8ICGA 1M2OA 1C3JA 1UBFA 1CI4A 2WNIA 1MB4A 1ISSA 3RJJA 1NAHA 3TD6A 5C4MA 3M9XA 4ZYUA 1X3LA 2FFAA 1SIUA 1Q17A 2HK9A 3WMEA 1CRZA 1T5TA 3JYHA 4TT8A 4IR1A 1V2GA 1TTPB 2VDUE 4RKWA 9ICWA 5IF3A 4NFYA 4Y2PA 2RBEA 1BN7A 4N5DA 1C4XA 5EKXA 4DQIA 1GU1A 1JKMA 5AT1A 2CNLA 3BH0A 4BBAA 5JT1A 4XLZA 4C4RA 3C15C 2HN9A 2HWUA 2XVMA 3LK6A 1PWXA 5CYFA 3UJAA 5LFAA 3NGMA 3PIDA 5EZ5A 4QWCA 1BSVA 3HCPA 2P1ZA 2D6FA 1X6IA 4HY3A 2Z6QA 4B7ZA 2EVWX 4IEIA 2ZIGA 4PXSA 2HA5A 5HQJA 4CG3A 3N2KB 3N4MB 4GPIB 3BMCB 2O2EA 3QUCA 2P9QA 4DDVA 4P7KA 3AUTA 2FWIA 3T3NA 3R0JA 4B85A 4CM8A 4H35A 1NQXA 3CCFA 3KVRA 1CUHA 4Q03A 1J0AA 1MT3A 4ZVSA 4HAZA 3KKAA 4JWMA 2W2NA 4LF4B 4PAQA 1QQBA 3PR5B 1BYIA 1Z34A 4ETNA 4QOGA 2XVZA 3OM8A 1SVLA 5F76A 1FXWF 2SCUB 3TWOA 3J81A 1OLUB 1JJBA 4YBRA 2XF2A 3NI2A 4UNSA 2PI4A 4EA6A 2HOIA 2KVCA 4HL6A 3DZBA 4XUCA 4WLNA 3HR7A 2H4FA 1DKQA 3GEPA 1HUQA 4O59O 4Y9DA 1L5RA 4CU2A 2X15A 1HLGA 3G2MA 3K70C 3I0NA 3RYFB 1N5KA 3WK7A 1KO5A 3N05A 3H4IA 1JR2A 1H4VB 1MU0A 1XCMA 1E7RA 5AP9A 4TRJA 5J2EA 1KYWA 5J47A 4JJ6A 3KUCA 4TTRA 2FP4B 4IH9A 5IJAA 3JZAA 1JX4A 2KZMA 4CMHA 3RT9A 3DZDA 3DFMA 1ZD9A 4TQSA 4C4TA 5AVUA 2OGSA 1V2HE 1YC2A 2WOJA 4I14A 4OXKA 5JBQA 5FOWA 4HUTA 5JHHB 3VPCA 2M6SA 3Q12A 4DCVA 5HTOA 2TRSB 4F5RA 4MUKA 4ZRDA 5C5IA 2H3VA 4OK3A 4R2JA 3AYZB 1L5UA 4H6PA 5UKDA 4KMMA 5E6SA 4HRVA 4F2SA 1KKMA 4PO3X 3SJUA 1ZS9A 4R2XA 1NBIA 1WY5A 1QNFA 2WZQA 4DCPA 1Z19A 2ZYSA 5K8LA 3E3AA 3ZXUB 2WV9A 4B82A 3RBAA 1MZVA 1QH8A 4GICA 1M6EX 4C4YA 1Q3VA 3PEUA 5IXSA 1ZHOA 2P35A 3CQ9A 4D96A 1G20A 5KYYA 2JEFA 3RUEA 5DWDA 3X0DA 2JGKA 1SCBA 3C8MA 2CZGA 4QUJA 3JAMA 4V3CA 1DIRA 3WMFA 3CRVA 4DLSA 2VUUA 2P8SA 3VMMA 2HHCA 3M9LA 4ZAWA 2I2XB 1ICEA 4TYNA 3C5GA 2HRDA 4DCGA 1FJGB 1XTIA 2V98A 2BCJQ 2F1HA 4MUHA 5AVVA 2POQX 4RMNA 1GPWB 2DQZA 3WQQA 2EF1A 4HRAA 1S2IA 1X39A 2XMPA 3GRYA 3O31A 5KG4A 1I4OA 2GKOA 2A1TS 4CKZA 4ZAFA 3W04A 4IFEA 3U2QA 3OGUA 4H3HB 1ISPA 4DSNA 4TUQA 4KAJA 5E2AA 3T4XA 3HDTA 2DEUA 3U4IA 1X0XA 4AZTA 1K7YA 1MA0A 4P0PA 4JLVA 1TTHA 1Z1VA 1EQAA 1AQLA 5ED0A 4BDPA 4KMSA 3FUTA 3TK1A 3C2MA 4PPNA 3M9WA 3LAWA 5AWFC 2JVJA 1D8YA 2ZBEA 3V7WA 4NY8A 4R0NA 4HHEA 221PA 1QF9A 4X00A 3TQIA 4DRZA 2C28A 4KHPB 5BV2P 4XIJA 5CEFA 3U3OA 3ZI4A 5C0OE 5DM4A 3RFCA 1U98A 3A58B 4KGVA 2Q0XA 4RVNA 3CLUC 2NVOA 4BLPA 4XKJA 5KNCA 1W2HA 4Z51A 4FHDA 2FMFA 2P9JA 2XCLA 4U9UA 1YDGA 3ETDA 1CRXA 2W0SA 5AVTA 4P3XA 1VA4A 4OQXA 2OECA 4E3ZA 2KHVA 5B53A 2RGAA 4EI9A 3R3JA 2GZAA 3R5KA 4RQAA 1DCTA 3B3AA 3CB2A 4A0HA 4RFLA 2QBYA 4DIFA 3UMBA 3KSBC 3KTAA 5DISB 2ZB8A 2BLNA 2PLFA 2Z8ZA 1X92A 4CR7A 4NIMA 1VLMA 4UEOA 1WZUA 3SOPA 3UHJA 1S77D 3H99A 1SBYA 1DBVO 1QQ5A 1R3DA 1SKMA 1GNPA 4Z1MD 3GLFE 1HFJA 2HPHA 4IG9A 3WK6A 4GX5A 2RBGA 3EZ5A 4C4OA 1CRPA 2RK6A 2OQRA 3JQAB 1PJRA 3IRVA 4UQLA 3B85A 3KQMA 1Z5UA 1Z0UA 3BS4A 1PK7A 3B0YA 3P27A 2VDQB 4NCAA 4JYPA 2GN1A 4KBFA 3VV3A 4RY2A 2D06A 3ISVA 3OSPA 4KE7A 4PTYA 3BREA 1XZDA 5CH5A 1URJA 3O8BA 1RABA 3F3KA 2WUGA 2L5YA 4KVGA 4PEVA 2JH7A 5KVAA 3PL1A 5CLHA 1QR2A 4B9UA 2Q5HA 4GUAA 5K3CA 4WI1A 5ALFA 3EVDA 3H1PA 5I7RA 3DFKA 3OOHA 3WB1A 1VPTA 3UWMA 4YAIA 2BC9A 4LRSB 3K92A 2QVZX 1ML3A 4ZEMA 5E0OA 4QIHA 5JC8A 2ZXHA 4JROA 3V9PA 2VPPA 4AZVA 5I7UA 4BX2A 1WZ2A 2ZU6A 1DK3A 4F86A 4MJXA 13PKA 1JQDA 3U44A 5DYTA 1E1CA 2VJOA 3TAQA 4JJAA 1H0SA 5L95A 5JNLA 1J1IA 1VLVA 1KFBB 4BP1A 2EP5A 5C81A 1EBFA 1YI8A 2CGEA 4KH0A 3VC7A 4EQ6B 3QBVA 1Z4NA 2AFHB 1NUQA 2O7RA 1M66A 1SVNA 1G55A 4LOIA 2BH2A 3MILA 3HZHA 3O3CA 2BHNA 3MCVA 1CE8B 2GZ1A 4OHYA 4WKGA 4NX2A 3V42A 1FNMA 3L6OO 3NRBA 5BPFA 2VRBA 2Q0HA 5BR8B 3ZLBA 4BGEA 2IYZA 2BI8A 1IG6A 3B13B 3JPTA 3R0QA 2I4OA 4JI7B 5E4YA 4WOBA 1TNDA 1HO3A 4BAUA 3Q7QA 1DL5A 4E5VA 2WJJA 4YAUA 3DEKA 4YEDA 1FVXA 1C30B 1W19A 1P3Y1 2QD2A 3G5AA 2YJ4A 5IYZF 3N74A 2XD4A 4TSKA 3QU2A 4QXPA 5TB5A 2C77A 4ZZ3A 4BNKA 2W98A 5HFAA 1GQSA 1NMZA 1QP8A 2KPOA 1VHQA 1DRWA 3OURA 4PO8A 4XFDA 1HE2A 3A1CA 4Z4FA 4XYLA 3CLTD 2PGNA 1GGEA 1LBHA 1HT3A 3SAFA 1PT7A 4XWOA 3LLVA 5H83A 1DWQA 4OHWA 4JGBA 1DMSA 1O1YA 2H59A 1KY2A 3CEPB 3WK9A 3QFSA 3TJZA 2QARB 2IBMA 3HZZA 1DIGA 4X54A 4DABA 5I47A 4MRVA 2D1QA 4OKNA 3QVUA 5LZ4A 2LBOA 2FW9A 2RHCA 4OJQA 1YU9A 1G4AE 1B16A 4C01A 3CBGA 4JU8A 4ZZIA 1VBMA 1UKEA 4K3UA 5DOVA 5L9AA 1TGVA 4MULA 2FZEA 1SU6A 3V1TC 1M8KA 7ICKA 2IH4A 3C2QA 5JPCA 3SYTA 1HYBA 2PL1A 3R24A 3SX2A 2WICA 1BXKA 2HK8A 3T5GA 3SLRA 4HKTA 1BPZA 1TJ4A 1VYTA 5KC8A 3W9UA 2ZJ5A 2LI6A 1GPNA 5D3KA 4EGCB 3HN7A 2HD4A 1TZ2A 2XDWA 2HMSA 4FUQA 2KW5A 3KIPA 1BDMA 5TMEA 5JAZA 2PUAA 2FGJA 1YVDA 5JNRA 1SQFA 3PXEA 4K2AA 1QGZA 2BONA 3S2YA 4E4YA 1EUZA 3Q7EA 1KMHB 2HADA 2OV1A 4E2YA 2DHDA 4FOSA 3M5WA 3RJEA 2XKKA 5HF8A 1SD1A 4AO8A 5GM2A 1Q1QA 2PZKA 3RUIA 4F8JA 3UJHA 5EJ5A 1UPUA 5HHHA 4EEKA 5DN6A 1RAIA 2GPWA 1GXSA 1WB5A 1PNQA 3A2LA 3VAZA 2OXOA 2E3TA 1R50A 2EBWA 3FOZA 4QIWF 4GXJA 1PDWA 5A7HA 1JAXA 2DOKA 3BHIA 3PNMA 2PS3A 1SG0A 5E1MA 3M5PA 4B3DA 5ITWA 5A4JA 4G6ZA 4A0SA 1BXGA 3PPYA 4RZIA 3CF6R 5LMZA 4F3TA 1Q95A 4P2GA 4OJLA 3A06A 2GCIA 1YKSA 3STXA 4KWHA 2OP0A 2GM5A 1ISRA 2VJMA 4J7XA 4F97A 1G7RA 1RAAA 2UXDB 5LA6B 3FZQA 1UBLS 3SU8A 1AN9A 3K2BA 3E9ZA 1GCOA 1Y3HA 3DNPA 4UNIA 4Z6DA 3HV2A 1T9AA 3P2KA 4NBVA 5EJ6A 5DIFA 3T38A 2CXPA 5GJVC 3SFZA 4C7ZA 4YAGA 4B44A 4H0FA 4UUPA 3M7DA 3EIEA 2II6A 1RRFA 1VLLA 1YJ8A 3VR5H 2WILA 2BKLA 3BIXA 2NSDA 4MV6A 2GA9A 1E2DA 4EHDA 2PA3A 3F8TA 1IQUA 4EKYA 3IMCA 4AROA 3D4IA 4PRYA 3TQOA 4TZTA 5FTJA 2CBGA 3GGOA 2HC9A 1LBQA 3OWOA 3AETA 2RGRA 5K3FB 4DANA 4F4HA 2CVOA 3NRJA 2V45A 2WD8A 3VU9A 3VOAA 5AESA 4UFNA 3PCRB 4B3GA 4TUSA 1USKA 2WUDA 3AR4A 4AFNA 3FHOA 1JUDA 4C2TA 4R6XA 1F20A 5K9ZA 4PGQA 1HDCA 4DM7A 3QNWA 4EHNA 3FMFA 2HIAA 3X1DA 4LJSA 4FJ2A 3Q3CA 1G5HA 3GQVA 4RLFA 1QJCA 5IMSA 1A9TA 1IQ0A 3DEZA 4FZVA 3DL2A 3EXIB 4J0CA 3QFTA 4YFKA 3X43A 5EESA 1CS0B 4OQMA 5JH7F 5TXGA 3QVMA 2Y1LA 2XB2A 3VH4A 4IIYA 2NU8A 2GJAA 2ZRNA 3S55A 4XYBA 2H52A 1PZGA 2V4ZA 3ISTA 2C4NA 3HP6A 3AEXA 2TS1A 4O4LA 1BWQA 3AV0B 1LI5A 5HZGA 4P4LA 4BMPB 3BQ7A 4RF5A 1IRIA 5KTQA 4O5KA 4JD5A 4U5QA 5FTMA 1KEJA 2D1FA 2ZLBA 1TQ6A 5TT0A 2HU7A 4DAOA 1SUBA 2ZAIA 2DCUA 3WHKA 5JADA 3WOHA 1B3BA 4F6RB 1OB2A 4MW4A 5FULA 1W44A 3B89A 1UA1A 5EKSA 1W5BA 1E2LA 4UVHA 5HFNA 4O2BB 1PJAA 8ICUA 2VF7A 3PXCX 3STTA 3JAWB 4V0LA 3D6TB 1E98A 1VSVA 1NP3A 1K6XA 3FVQA 4YAFA 4DJDC 1NVBA 1QUEA 5DGIA 4I1UA 3B52X 2HPAA 4FFMA 4DZRA 5AW0A 1XU7A 3AF5A 2RHLA 2B4YA 1E1QA 4QU5A 2XBMA 1IZZA 4JP2A 1HDYA 2JA2A 1A72A 4FYPA 3IBYA 4IIBA 5JBNA 4MYDA 1XC9A 3A2NA 1E1YA 1U7UA 2JLWA 1I10A 3RSFA 3FYDA 3MXOA 2WU1A 1UZLA 4EDFA 4S05A 1KFCB 1NR1A 1B26A 2VF4X 3EXEA 3FAZA 4GMHA 1BWPA 5H81A 4FJ0A 4TKVA 4MDEA 3ETNA 2RI0A 4RT2A 5EINA 2ABWA 2J0UB 2V7QD 3EF1A 3QQPA 2OBMA 2PKRA 4E5MA 2UVRA 3ISBA 3EULA 5A9SA 4M4SA 1B41A 1ZC3A 3FSRA 1CJCA 1KF0A 5GOZA 4EPXA 3AINA 5EZYB 3O73A 5JPIA 1L8QA 1QGUB 1SA0B 3K09A 3EVGA 2X22A 1JIVA 4WJ3B 3DXZA 4L02A 4ODIA 5FF9A 3PXGA 1YAHA 5CDFE 2W6IA 2Y6VA 3EMVA 3MAAC 4FXPA 3QF4B 2YWCA 1FXWA 2I78A 2PKYX 1EB9A 2I4TA 2B34A 2ES6A 3U17A 3H04A 1RWMA 2XGQA 3SBDA 3TM4A 4X24A 4GH5A 4AO7A 2JBAB 3MUEA 3AWDA 1W87A 4QJ5A 5AUOB 1PUXA 4QGBA 3SD7A 3D6NB 5DCWA 4QDUA 2DB3A 4ZOLF 2B8NA 3H9CA 1SCQA 2R8HA 1N9GA 3M83A 2DKNA 2WF7A 3EUEA 1DX4A 1RYUA 2HMAA 5KNBH 4Q12A 3FPBA 3PHJA 2VP3A 5JXJA 2YWDA 5J63A 4Q18A 2ISCA 4ASUD 1ZA2A 5JJLA 3PR2B 1ZL2A 4RF2A 2DT8A 4UATA 2KEYA 3B7WA 5E2BA 5BRJA 2Y1XA 2C42A 3V6KA 2WHXA 1T4GA 4F04A 2A67A 1WHTB 2ZIEA 3RYCB 3EGEA 5HJ2A 4JBYA 3RS3A 3N28A 3DV9A 1TUBA 1VJDA 4RIGA 4IIGA 3V8NA 1H4QA 4PHDA 5LYJF 9ICOA 2I76A 3EVTA 4ED3A 1T2EA 3DLCA 3KDAA 4TTIA 1LDGA 5B7NA 2ZVJA 2PL3A 1BDJA 3EUFA 5JAHA 2FHSA 1WW3A 3M8KA 4F9EA 4OH7A 3HCOA 1KAQA 5EIWA 4AWAA 4LXYA 2NRXA 3AHJA 1F4LA 2XUIA 5IT9A 4XH9B 4LZPA 2XY4A 4DR6B 1SH7A 3KXIA 3KU1A 3K1ZA 1UOQA 4KLMA 4AG3A 1NW5A 2P4HX 1X7WB 2C9OA 4MWCA 1KI6B 4CN9A 3DR3A 3OHMA 1E0KA 3VR5D 2HTEA 1T0HB 2QT0A 3HKDB 4B2IA 4C8NA 3GMSA 4EG1A 3ZQ4A 2WVHA 2EX1A 4K05A 4JUBA 4BQPA 1LBTA 5FL7A 4P9NA 1KXZA 1L7VC 2G8NA 4QZVA 3TJRA 1T5IA 3CEMA 2DQYA 3PE3A 4TLCA 3R7DA 3DCJA 5DB4A 3NONA 2XTJA 5K6AA 3L7DA 1NBHA 4YJFA 5CA1A 1TD1A 3AIMA 3HBFA 1R6TA 4UAJA 5FI0B 1O5IA 1Z5PA 4WACA 3S81A 1VZ3A 3KBBA 4K88A 2IL1A 2WSMA 3LBYA 2O50A 3WGZA 2K4PA 1ACJA 6GPBA 1VLZA 4C4XA 3TRJA 5K01A 5DF1A 4B3BA 4Y1EA 2HBQA 2HBKA 1G16A 1JI3A 3SS7X 1FFXA 4D41A 5DNEA 5EIBC 3RSOA 4R5MA 2F59A 5G0VA 3LI2A 3I9JA 4RQBA 4B9NA 4R8SA 2X7JA 1VB3A 1JDSA 3R3WA 3R4CA 2H1RA 2XUFA 3BWMA 5KFMA 1OZAA 3IBCA 3UHFA 4KQGA 1HF3A 1PL0A 2QN9A 4DTCA 2BR0A 1XWIA 1AB5A 1H93A 5AKXA 4PHCA 1NONA 3K8YA 3H86A 3W7AA 5B6IA 1FYXA 4IR9A 3PJEA 2WA2A 1ABBA 2CLSA 4IF6A 3SK0A 5AD1A 4HXYA 3GJ3A 4WVFA 1JEJA 3WGVA 1EFPB 3FYTA 2WJVA 3VZPA 5FLYA 1JIJA 5H3LA 1QO9A 2TMGA 5AVJA 5HPYB 3UT6A 3HVRA 4MS4B 4KFCA 2Z0MA 3CCBA 1QGOA 3TLEA 3TL6A 3ZYZA 2XW6A 1KI2A 1D2AA 2X9QA 3E2MA 2IUFA 4YLGA 5CDSA 1ZQTA 4WERA 3PPXA 1J4AA 2P2ZA 2GWSA 3M6AA 3A2MA 2G1AA 3UHAA 1J7JA 3PC7A 2QL7A 3E5NA 3H97A 3ENKA 4J43A 1P1HA 4XE5A 5EQJB 4J2HA 2FPGA 1TKDA 3ZCPA 1F4VA 4FTWA 3OUTA 5FAKA 3I12A 4GGOA 2AJCA 1DBQA 4JBIA 2AVNA 4GPBA 1FP4B 2NVUA 4WCDA 4FHFA 1NMEA 3GFRA 1WV0A 1ZZEA 4YNBA 1XEXA 4PYQA 5DGCA 1YZYA 2IYPA 2FKNA 4UBOA 5JANA 2QX8A 4IF4A 4KWTA 5KG0A 5G0TA 1S3FA 2D59A 4ZCIA 3BMOA 1OWOA 1JAYA 1NW4A 4U6SA 3WRYA 4ELTA 2KKPA 5B36A 2H7VA 4FOOA 1UXJA 1W5EA 2PDAA 4EB3A 5GPBA 1PZNA 5COAA 2ZRBA 1RRPA 3LXRA 1ZIOA 2EFHB 2NZVG 3HU2A 3CLSD 4LE1A 2DYKA 1FPMA 1SZCA 3TADC 3A70A 5J8YC 3JW8A 3JPRA 1PJLA 4EJ2A 3C6BA 1EFVB 2PLAA 5J5CA 4P4PA 4C0BA 2V6GA 1VCOA 3CY6A 4CM4B 1OI4A 1DHTA 4RQNA 4LZNA 4QBHA 1Q0PA 4ZVOA 2UXBB 2ZR7A 4C78A 3C6QA 5IKOA 4Q4HB 4X71A 4F4CA 3G02A 1NJ8A 3NT2A 1GTSA 1T3TA 3SP1A 1LJUA 1FQWA 3VU0A 5REQB 1JIXA 2NXJA 4ND7A 3UQ2A 1Q77A 2ZI9A 4NOKA 3FBTA 5DHTA 3QWFA 2WU8A 2VBGA 2UVVA 1NUUA 2DWPA 4G4IA 4P31A 5KVSA 3RTCA 2W9CB 2PR2A 2VTBA 1F17A 4C0WA 1KZ4A 3U3DA 2N1BA 3H5AA 4ETMA 3RFUA 5IYZA 3ZZTA 1XO1A 3EIWA 4RQUA 1RE1A 2QLNA 3PBKA 4IEEA 3PJDA 3V00A 5LNK1 3JR3A 5K0ZA 4B3TB 2FK7A 4RK4A 1ECLA 1FYWA 2QUKA 4EFKA 4DM4A 3W2GA 1C1XB 3A7EA 4JB8A 3WYBA 1D7AA 4GPAA 4URUR 1AY0A 1ORDA 4PFKA 5IAGA 3JPOA 3GFQA 3LQ1A 5HKKA 3MK31 4FXOA 2QVLA 3M70A 1RS0A 2BTEA 5FA5A 2ARKA 3GHHA 1AOXA 2E49A 1MH1A 4EB6B 1V47A 5KWSA 4DSFA 5HF5A 2BGLA 3HP7A 1DAOA 2JDID 3CNBA 1SKSA 3IEUA 3JVEA 4JFRA 1T1IA 2ZIVA 1PUZA 3HKCB 3TL2A 2KG5A 1HLFA 1ZR4A 1FF9A 4A8JB 2FZ4A 1N1GA 2WB2A 4CIXA 2H7XA 1F2DA 5DGBA 4RVCA 2PSDA 4YRPA 5F98A 3DBVO 3KEQA 1Q50A 3ZBTA 1RJ9A 1OD6A 4Q3NA 1AZLA 5CNJA 4H4CA 3WA7A 4OB7A 4QAJA 1NKSA 1KIMA 4U2GA 7ICQA 3T5LA 5HXAA 4W9RA 4F5EA 2FE4A 4R31A 3H1TA 2KI5A 3FSGD 3ROTA 1KYTA 3CO0S 3KKZA 1JKJA 2EJUA 3VYVA 3FNQA 1TUIA 5ICSA 3OKPA 2XMQA 3U7HB 3LZ6A 1N0VC 2QSZA 1CJBA 2RHOA 4BV3A 1HFEL 2X4IA 2PQMA 3LLMA 3N8IA 4MPPA 1CY7A 3TDNA 2NAFA 2GBLA 4FBUA 3CPSA 2P4QA 1NI4B 4YXJA 4ZO6A 4E5YA 1L4BA 3FPLA 1CNEA 1TQDA 4RGQA 1HV8A 3LKZA 3L0SA 3CEHA 1EM6A 1GFZA 3C39A 4NENB 5BNIA 3RH0A 2DE0X 1HI9A 1JLLB 3TZBA 2P3SA 3E4CA 1ESZA 1BDHA 3T5BA 1I4LD 1OU0A 4KN8A 4F1JA 2O1XA 3EODA 1WCIB 2RHWA 2ISPA 5BVGA 1W59A 4BB6A 4NXZA 2VQ6A 1TVAA 4JLWA 4X6YA 3TLCA 4UE2A 2R6DA 2H3HA 3K1AA 5KX5B 2ISOA 2JFFA 4JJFA 4RA6B 1E0AA 3B82A 3PGA1 2VT7A 5JRJA 5AW7A 3GXBA 4JENA 1O08A 3IIJA 2VPIA 2NU6B 1ABFA 3ZBUA 4EYHB 5FI3A 4XDZA 4LY6A 4HDMA 3A8TA 3B1JA 5KAIU 4ZHQB 2EJCA 3IJEB 3BZKA 4QM6A 1DBSA 4RGVA 2NUBA 3QTBA 4KYVA 4JT8A 4N6NA 2E37A 4WZ6A 1NOKA 1RHKA 2AJQA 3ZW7A 1OXKB 4N48A 3ZDQA 5CVVA 2BEWB 4IP0A 3ND7A 3LZCA 5CLGA 2MR5A 3II6X 1YZ7A 4LZWA 4Z9YA 3IHWA 3DCNA 4ZARA 3LRXA 5KJEA 4M8KA 4ND8A 2BFBB 3GCDA 4KZPA 4MS3B 1JL3A 1AB6A 1OZ0A 2RGUA 3BXFA 8ICWA 1L7MA 3TXXA 2E6UX 4AURA 3EA5A 3KZ1E 4Q47A 4JLUA 4V0OA 2R1UA 1IOZA 1NU6A 2J3DA 1Z7WA 4V1CA 4DS5A 5FNVA 1W85B 1SN7A 1MC5A 4QNNA 2R4QA 4RAOA 2MAXA 1XHEA 4DSIA 5IK2A 4DCOA 1CFZA 3DDUA 2RQ5A 1NR7A 2HREA 1XCPA 1RWXA 4ND5A 4E3WA 1J2EA 1MV5A 1KAMA 1XRSB 2ZTSA 2KICA 2XOKA 4JS0A 2XZPA 1KJZA 1XVAA 4GXIA 2QE7A 4GO1A 1Z0AA 2VBFA 3VVCA 4JV5B 5A3VA 4WKOA 1KP9A 1BFKA 5CK4A 2AE2A 2YJ5A 3FZGA 2JGDB 3B3QA 4I4CA 4UHCA 3ENNA 3ZY2A 1DVRA 3BDAA 2VG8A 3PSHA 3DBHA 1CUUA 3E48A 5JH7A 3VHXA 3A4IA 1E69A 5WRFA 5KKAA 2MMGA 3KETA 2AT1A 1N2XA 4NM1A 1UH5A 1BNPA 1L4MA 4JWTA 4WY2A 3DUFB 1OIXA 2Q3FA 2WSSA 8ICQA 2XECA 1XPOA 1PK1B 3V8PA 4KXNA 1Z0ZA 4A6EA 4H7JA 3HKBA 2K8BB 1XDDA 1POXA 2I99A 1B1AA 1NXQA 4I2EA 5EJGA 5EUCA 3CN9A 2ROQA 4D3YA 4PL2A 1I2BA 3AEUA 1E9AA 1U65A 7REQB 2VYVD 3DTVA 2XXBA 1KDZA 4YCCA 1A9PA 2J7KA 1K86A 1XSLA 4DLWA 4BXOA 1K7XB 5I8ZA 1JNYA 3WGLA 4U7CA 2Y6UA 2YWBA 3M6MD 5B37A 1QB8A 1XMOB 2FEXA 4LJYA 2ODNA 1U7DA 2Q5CA 2VA3A 4X1YA 3P45A 4NJEB 2XTNA 2PUCA 4LBYA 3P0EA 1M2GA 4YAKA 3K0SA 3KZKA 3KP1A 2CXXA 5CX4A 3RSLA 5NLLA 4K9LA 3SLKA 2VQEB 4BO8A 3ZS8A 1BHO1 3MA0A 2O1EA 1RI3A 1CT9A 2OMKA 2E87A 1CUJA 1SVIA 2FPLA 1X3SA 4DSZA 3QU5A 1H23A 3RVKA 4QUBA 4JV0A 5TQ2A 2QSJA 4FQ7A 2H8KA 1C1HA 1B42A 3DBLB 1EXVA 1U2ZA 3MQFA 4YCNA 3FFWA 4BLVA 1C4KA 4KE8A 4O3SA 4DFPA 1Y88A 3FCCA 4ZC8A 4GSYA 1SVKA 2DXIA 1EK0A 2VP9A 4C6TB 2O8NA 2P1RA 1SBZA 3NWJA 4A4DA 3AVTA 4PXYA 4Q4JB 1ZGGA 4R54A 1Q3TA 3DM9B 1X13A 1VP9A 4RJ2A 3TZKA 2W4IA 2APJA 3T3EA 4I1RA 421PA 4RJIA 1ELOA 3QMMA 1QYWA 5AK0A 1UPXA 4F3CA 3D8UA 4TTVA 3R3VA 1USUA 4XI9A 2UVUA 4KQMA 5GZ6A 4XD2A 1WSAA 2Y0CA 3LCVB 3F46A 7ICPA 1PWEA 4RXUA 2K7ZA 1Z29A 3O94A 3D6FA 4BKOA 8ICPA 4YS6A 4YLEA 2WFLA 1I7NA 1JQEA 3NWBA 4K9MA 4UKDA 1N2IA 1DRKA 2IEIA 4R71A 4BKPA 4TLDA 3W4IA 3CX7A 1N5WA 5EYPB 5DBCA 1J39A 5I45A 4P7JA 4ZOLA 5EP4A 3QIAA 3QNMA 3TQTA 4LVOA 1PL8A 4D9EA 2QW0X 5AOCA 1GKKA 4RV5A 4G0YA 1A4XA 3C3PA 3DP9A 1Y82A 1NI5A 3O8NA 5BNFA 1H2RS 1YACA 1E20A 5IWCA 2YOGA 5A4AA 2AMJA 2WUVA 4EEZA 3EC7A 1H9BA 1W36C 1F5SA 3O0TA 2Q8QA 2I80A 2E7ZA 2NV0A 4EDHA 1JEYB 2CF5A 2WZCA 2OO5C 3AIKA 4BLSA 3PEWA 1R3UA 3GT3A 4ECSA 5LU8A 5EIHA 2C9CA 2H4JA 4N0EA 3PJFA 1WSDA 5ALIA 5EQFA 5LYJA 4DDTA 3Q3IA 3OI7A 4IWNA 2RDIA 4OQ4A 2PJZA 3WLHA 2KNJA 5DCUA 5AHXA 4HNQA 3IEMA 3N8HA 2H3EA 2BMDA 2GZ2A 1GGVA 3ITNA 1CIPA 8ICHA 1A5TA 4YCDA 1M5RA 5BMVB 1DDIA 3C21A 4DCJA 3IAS6 1GPH1 4MV7A 5L4LA 3OAAD 3F53A 3TO5A 3DMFA 4NH4A 4M9RA 2AE1A 2E9SA 2GO1A 2P79A 3TIGA 2DHRA 4MYCA 3HNRA 3JYNA 4BS9A 4IDNA 3WZMA 4D2IA 1W1WA 5CHYA 3EEQA 3QV2A 4D3XA 2PWPA 2CE2X 5FO1A 4HNGA 2XB9A 4F4IA 1FLNA 1LKZA 1PT8A 4RDIA 5HKAA 3UPUA 5GONB 3PJGA 3L1JA 1FA9A 2C3OA 4UW9A 2NIPA 4GXRA 2JV3A 1CEQA 4N39A 2Z2IA 3MTGA 4EKDA 1SV0C 2I8AA 3IEIA 4XOIA 4KUHA 1Y9DA 1EDOA 2FY8A 5B2FA 5LUAA 3KT6A 3A6LA 1IDOA 5I4IA 4W9NA 3SEIA 3MGCA 1NPYA 5JR3A 3KXLA 3S27A 2CUNA 3V1KA 3C4VA 2VRCD 3CNLA 3OQOA 3OJSA 4PNPA 2O1SA 1K68A 1S7GA 1OXSC 1BDIA 1KFSA 5TPZD 1DS6A 3FPSA 2A35A 3HCCA 5HZHA 5DTEA 1YVEI 2GUGA 3HEAA 4H27A 1RXWA 1J8YF 3NMUF 2GR9A 4OAOA 3UXMA 2G9ZA 3RABA 4F56A 3TYXA 3W9BA 1KVRA 2W54A 2CLDX 3ZLVA 4O33A 2I87A 1KC3A 1OAKA 4ZU6X 2FOXA 4P4TA 1IY2A 1EX6A 1Z7BA 4KMOB 3P4UA 2G6BA 1CUFA 4G4GA 5FPQA 1C9NA 2LIPA 5GIPE 2UU9B 4KIFA 4BJ3A 3RU3A 2Z30A 3PA8A 2ZPAA 2FFBA 2ESEA 1DUVG 3RHTA 3W6ZA 2PUBA 1XVVA 3VX4A 5EJMA 4M1OA 3L07A 1X8XA 4B40A 3G1UA 2GCEA 4PU0A 4F93B 1Q1ZA 3GMIA 5C7LO 3ASVA 4WKBA 1RXYA 5FTWA 4JOCA 4I0WB 3HDVA 1KVTA 5CB0A 2XMRA 2W3RA 1C3LA 3VR0A 3I3OA 4UASA 3UUWA 5A03A 2LYBA 1PFQA 2EWVA 2V7UA 1HETA 1PG2A 4DMMA 3K70B 3D5QA 3HEMA 4G89A 2X77A 4EBFA 2BI7A 5GTIU 5BNZA 2B6NA 4D0RA 3AGQA 3UJ9A 2PNJA 2VSNA 4LWOA 3LWNA 4KQXA 2Y0DA 2D5LA 4AJEA 3NWPA 3GXOA 5TRTA 4P32A 2IK8A 4B4VA 2PZFA 5EHGA 1FX0A 2WAQC 1J97A 1NYQA 2IT1A 3BFVA 1NF9A 2E6KA 4GMXA 4AZWA 3VGJA 3WWYA 2LTAA 3Q10A 3GNQA 3QX3A 1KSJA 4MO2A 3DHWC 2FEWB 5CLQA 4ZHSA 3COWA 4IO1A 5EIXA 5FB3A 2Y1DA 4IJ5A 4PFSA 2IY8A 3UMFA 3O4GA 2YH2A 4F45A 1NY5A 1FB5A 3CJRA 2ZTUA 1V5WA 4XWKA 1D0IA 3NIBA 5CA1F 5E8JA 3L0CA 1KI3A 4HNAB 1PVRA 3H2BA 4D8WA 1QIJA 5K3EA 4TSRA 3DT6A 4DMRA 2PE5A 2WM3A 1ECCA 2YWRA 3G68A 3ICCA 1L4UA 5GV8A 1HMYA 2HJHA 3RBZA 1T29A 3DNMA 2YVUA 4KV9A 4PG7A 4LGCA 4R05A 1HTTA 1SUCA 3LP5A 2H5JA 4YJHB 1DCFA 2YASA 1WDMA 3UFBA 2GAJA 3KTDA 2BGJA 3ZDBA 2QORA 3DHNA 1VPVA 1E4OA 4JUFA 1YTUA 1DC4A 9ICQA 1G6KA 1A50B 1Z73A 1GFWA 4XVQA 2A1TR 2YMQA 2CWWA 4MVJI 4W1QA 4FMPA 1T35A 2IW3A 3JQFA 3VSBA 3OG9A 4HATA 3RDPA 3P52A 4QC2A 3GEDA 1T5BA 2GEBA 5F21A 2QTTA 5J0WA 2VKQA 3V4PB 4PLHA 1XEAA 4U7PB 1Y8CA 3FD8A 1QP4A 3FROA 1X1QA 1HEIA 5ER6A 2GJ4A 3TB4A 1UKAA 4KC0A 3KL2A 4YAEA 3BKWA 4GX2A 3KLPX 3LPMA 1FZTA 5HRUA 4R8VA 4Y9TA 1RWBA 1V5EA 3KFUF 1LBEA 2G5GX 2EX0A 2BY4A 3I6BA 4O4IB 1XCOA 4IKPA 3OPQA 4Y8VA 1EIWA 3TFWA 2JH3A 4YP9A 4MYRA 4DOCA 5KG5A 2O5EA 1BRTA 2XA9A 4YQZA 2CDAA 2XIDA 3NFRA 2CWDA 3BJZA 4YDHB 1HDRA 3IR6A 3HVIA 1HRKA 2BRUA 1SK8A 2J30A 4FT4A 2R2AA 4IGKA 5K4GA 4YP1A 1U2DC 1J0BA 1WOYA 3NHZA 3V1YA 2PUHA 1H3FA 3HPRA 1CF2O 3HB9A 4YJ3B 4YR9A 4X3OA 1V1RA 1K0FA 2BCSA 2JHAA 4FQ8A 1SHZA 4EPTA 2ZWMA 1D8LA 1JA9A 4O3FA 4AJHA 1GDHA 2REXB 3K05A 2GRAA 2YZKA 2HHLA 1MFZA 2AMYA 1WJGA 4DJAA 4JBNA 2A33A 1WE2A 2X3FA 6REQA 2LMRA 3HJEA 5CM9C 2JHCA 3NJ8A 4WLOA 4PLGA 1X80A 1K8QA 2IY7A 4JB2A 3DOIA 1JEQA 4ZZ2A 1D2GA 4Q44A 2XUHA 4LMAA 3OX4A 1EFDN 2FVXA 2OOKA 4B9AA 5LOVB 1P4AA 1E99A 1BPBA 3H6GA 2Y4NA 2JAQA 5LMNB 4RIFA 2VH1A 3LE8A 5TV2A 1U2EA 2QN3A 2FFQA 1XN1A 3C5WP 2VJPA 1KI8A 1E7WA 3ORHA 4PZCA 4MGKR 2G4LA 1KORA 3VZDA 1UJNA 3GGCA 3B3JA 4LQLA 3AY6A 1JHUA 3NC0C 4ISCA 4PC6A 3EIQA 1LKYA 4N5LA 4D6YA 2MSKA 4MVXA 3N8NA 4JUIA 1W73A 3DKIA 3OEED 3KSRA 3NBKA 4L85A 1QFYA 2KFNA 1TYDE