1KFTA

Solution structure of the c-terminal domain of uvrc from e-coli
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TSSLETIEGVGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIFWSLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Excinuclease ABC subunit C
publication title Solution structure and DNA-binding properties of the C-terminal domain of UvrC from E.coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1kftA00
1A76A 1IXRA 4F4XA 4ECUA 3MDCA 1TK5A 1JXLA 1ZQOA 2R8JA 4DSKA 1QTMA 4X5VA 1K1SA 1ZQMA 4DOBA 1ZQSA 1Z3EB 1ZQEA 5KFIA 5J2GA 2PI4A 5DB8A 5DDMA 1LB2B 5KFEA 3G6VA 4DL5A 1ZQLA 2ZUDA 4K4GA 4RT2A 3RR7A 2VA2A 3IHQB 1ZQDA 5DDYA 9ICIA 5KFNA 5J2IA 1L3SA 4DLEA 4BDPA 1T7PA 8ICSA 3RAXA 4F2SA 4PGYA 4ECTA 4XUSA 1X9MA 5KFFA 3G6XA 4J9MA 4I2BA 4P4MA 4PGQA 3H7IA 4DQSA 8ICIA 2VANA 4QZEA 4UBCA 4TUQA 3BQ2A 3UQ0A 1HUZA 4MFCA 4YXJA 1X2IA 3TQ1A 2XC9A 1QSLA 5J2FA 4IQTA 2F1JA 3ETLA 3PW7A 3PX6A 5KFJA 3LK9A 5CB1A 3HX0A 1HUOA 4TQSA 8ICBA 1TAQA 4XRHA 3T5HA 2Q0ZX 7ICLA 2AQ0A 4O3RA 5KT7A 5DG9A 3AU2A 2DFLA 2ASDA 2BCUA 1D8YA 8ICUA 2V4RA 9ICLA 2VA8A 3PX0A 5J2EA 1NKCA 4QWBA 1SL2A 2JZBA 5J0SA 5J2CA 2FPLA 4BXOA 8ICFA 4QWCA 4KLHA 8ICZA 5KTQA 4BWJA 1KFDA 3AU6A 3ZDEA 4YMMA 2R8GA 2VA3A 2NRWA 5J29A 2MUTA 3EWAA 2BCQA 4FS2A 4DSFA 4ECXA 4ED3A 3C1YA 4NM2A 4QWEA 4M9NA 4DQIA 2UVRA 4O3SA 4YVZA 3RJGA 2XGQA 4MF2A 2J6SA 3RH5A 5DGAA 4MF8A 3V6KA 4KN7A 4C8LA 3HWTA 9ICVA 2W9BB 1Z00A 2R8HA 4ED2A 1IM4A 2C28A 7ICTA 2IHNA 2FLPA 8ICMA 4J9KA 8ICAA 1X9SA 1PZNA 2R8KA 2UVVA 2XCAA 3MDAA 1S97A 1D8LA 3Q8KA 5KG3A 8ICLA 4J9NA 2HHVA 3ZDCA 4EZ9A 3OHAA 4DSLA 2HVIA 5IILA 5KFPA 1ZQBA 8ICPA 4UBBA 3TAPA 3FYHA 3PNCA 1RZTA 4I2AA 2KFNA 4RNOA 1ZQNA 2XY6A 1H38A 1JXEA 4KN4A 1JN3A 2I9GA 3OSPA 5J2DA 5DBAA 5J0WA 3JPRA 1EXNA 4YD2A 3ISBA 3TAQA 1KEJA 4B9MA 3ISCA 2A1JA 1NK0A 4GXIA 5BPCA 3JPQA 3TARA 4BWMA 1XC9A 1SKSA 3KTQA 1XS9D 5KFOA 4KLLA 1ZETA 4G3IA 4ECVA 3H40A 1T4GA 4UB4A 1U48A 1NK6A 4DL7A 4ECRA 9ICAA 1RXWA 3UXOA 8ICOA 4RQ1A 8ICWA 5CHGA 9ICEA 5J0OA 4F50A 4JK1A 2ZTEA 1ZQIA 3QEAZ 4PH5A 1B22A 5J2HA 3SI8A 4DLGA 1U4BA 3BQ0A 1X9WA 5KFCA 4DSJA 3V72A 2P66A 5KFAA 1ZQXA 3FDSA 5HMLA 1BPXA 4NLKA 3MGHA 2HHTA 9ICRA 4XA5A 5DKWA 1XSNA 1SZPA 9ICCA 5D49A 3RJFA 2ZTCA 5KT5A 4DOCA 5HP4A 4MEYA 3ORYA 5DBBA 4QZIA 2HHWA 5HNKA 2DPJA 1NK5A 3SV4A 2ISPA 9ICSA 4QWDA 3PY8A 4FBUA 1JIHA 9ICXA 3TANA 1Y88A 1ZQWA 2PXIA 1V9PA 1KSPA 2BHNA 4DQRA 3Q8MA 4R64A 2J6TA 3LWMA 4P4OA 5DG8A 4ELVA 2NRXA 5KFSA 1JX4A 2BQUA 2NRZA 5EOZA 3TFSA 4TQRA 4O5KA 8ICGA 2HHQA 4KMUA 4C8OA 4MFFA 1XSLA 1K1QA 5J2KA 3RH4A 2IA6A 4O9MA 2IHMA 3B0YA 5KG2A 1ZQYA 4M9LA 4I29A 4EYIB 5DQIA 4YR3A 4ELTA 5IIIA 3BQ1A 1ZQAA 3EW9A 2RDJA 4ED1A 2HHUA 3GIIA 3RJJA 4LVSA 1QSSA 4TURA 3PV8A 2IMWP 4DFPA 1KTQA 4R8UB 4UAWA 4DSEA 1TKDA 4NY8A 3PO5A 5BOMA 3C23A 5DQGA 2BKEA 3GV7B 3MR2A 2WTFA 4PHPA 4P4PA 4EBCA 2PFPA 2P6UA 4RPZA 2W9CA 3V7JA 3MFHA 2XY7A 4KLSA 2F1HA 4QZCA 3ZD8A 3BDPA 4RPYA 1KDHA 4QZFA 2ISOA 4YMNA 4RQ8A 4K4HA 4JV0A 1UA1A 4F4WA 4KLIA 3Q8RB 4Q44A 2FLNA 4JUZA 7ICFA 2W8KA 3RR8A 8ICRA 1DOQA 3JPPA 1WCNA 4GC7A 3QEBZ 4B9UA 4KITB 7ICMA 4RNNA 8ICEA 4YFKA 5KFWA 2FPKA 2V9WA 5KG4A 4F92B 4M47A 4FS1A 4NLZA 4GLXA 4M9JA 5F9NA 4YMOA 3GILA 3M8SA 5HHIA 9ICNA 4KLDA 4RQ0A 5KFRA 3RB0A 2JEJA 3H8JA 4B9NA 4YCXA 5J2JA 3LDAA 4ECSA 5EWFA 4UB3A 2BR0A 4RQ2A 4JV2A 4DL4A 3LWLA 1NJYA 1TVAA 2JEFA 4DEZA 4IRDA 2KZMA 4UB1A 4GC6A 4F5NA 1U45A 4M6WA 3RTVA 5KT2A 2FMSA 3SZ2A 3OSNA 4J9QA 3UPQA 3PO4A 4IR1A 4RQ4A 2J6UA 1S0MA 4I2IA 1SKWA 8ICNA 4I2FA 1ZQUA 3GQCA 4ECYA 1NK4A 4PGXA 2BCVA 3OGUA 8ICJA 3UXPA 4RPXA 2W9MA 1LV5A 8ICYA 1MQ2A 1ZYQA 8ICXA 4J9OA 1N56A 8ICHA 3C21A 1KFTA 2B21A 5KG7A 5KFTA 3Q8PB 4R63A 3ZD9A 3GV8B 3K4GA 4PHDA 4B9TA 2IBKA 4RUAA 4I2HA 4RU9A 4O0IA 4F5OA 2HVHA 3JPSA 4EBEA 2P6RA 2KFZA 9ICHA 5IIKA 4C8MA 2XCPA 1NK8A 3H8WA 4Z6CA 4F93B 3UQ2A 4ED7A 8ICVA 4FO6A 2F1IA 2RDIA 3AUOA 1SKRA 3C5FA 4DWIA 1U49A 1BPZA 3GDXA 1RPLA 3GIKA 4MFAA 1U47A 1QLNA 1TK8A 3MGIA 3MABA 4IQVA 4RNMA 4HYKA 2BPFA 4RQ5A 4Z6DA 2FPMA 3GFKB 1T8EA 1ZQGA 4K4IA 7ICVA 1ZQRA 1KLNA 4QZAA 5HHHA 9ICTA 1XU4A 2OWOA 1NOMA 2XY5A 4M2YA 4DQPA 4JWMA 4YN4A 2BPGA 4DL3A 2NRTA 1XO1A 8ICQA 5KFUA 1MC8A 3QE9Y 4F91B 4RUCA 5KFBA 1ZJNA 3PVXA 3JPTA 3EYZA 7ICNA 2NRVA 3GV5B 2UVWA 1RXVA 4LZDA 9ICOA 3PR4A 4DL6A 9ICKA 3RH6A 3M8RA 4DS4A 2ALZA 5BOLA 3MR6A 3M9NB 3H4DA 4YD1A 9ICJA 4KLMA 4QW9A 4DL2A 7ICRA 1BPBA 4KLFA 1JMSA 5DGBA 4DQQA 5KFKA 1UT5A 1XWLA 3H8SA 2AGQA 4KLEA 1S76D 5JUMA 2W9BA 2AJQA 1TFRA 1CUKA 4YR2A 2ZJAA 3PW2A 4O5EA 3THVA 2LYHA 5HMMA 4I27A 2ZTDA 5KFGA 4Q43A 1MSWD 1A77A 2ZJ5A 2H5XA 5J0XA 3C2LA 4IQUA 2XO7A 2XGPA 3HPOA 5KFZA 4I2EA 3PW5A 1ZQZA 4KTQA 4M9GA 5CJ7A 4R66A 4F5PA 3PR5B 1ZQQA 4C8NA 4TUPA 3T5LA 1L3VA 4IRCA 1UA0A 1WCLA 4NXZA 9ICUA 2UVUA 2PFQA 4EZ6A 2JZBB 3RRGA 2MAXA 4BGDA 5KT4A 4BXOB 5KFXA 2C2RA 4EYHB 3T5JA 2BQRA 4QZ8A 4QZGA 3V7LA 1ZQTA 4DS5A 4B9VA 2MUTB 4QZHA 5J0PA 4DSIA 4YG2A 4TUSA 3V6HA 1T3NA 1QSYA 4UAZA 4F5QA 3C5GA 4PHEA 2PFNA 4UQGA 5L1LA 4I2JA 4R65A 3PW4A 9ICQA 1ZQCA 2DPIA 3N4MB 4FBTA 4NM1A 7ICKA 5J0TA 3HP6A 3KHLA 2Y1IA 3RB6A 1NK9A 4B9SA 2AGOA 4I2DA 3Q8SB 3M9MB 4ECZA 4RT3A 4ECQA 1Z00B 5D4BA 3E2EA 4Q45A 9ICBA 5KFMA 3RB3A 1SL1A 3MR5A 4P2HA 5L1IA 3V7KA 7ICEA 3UXNA 1DGSA 4CCHA 4KLOA 4DFKA 4B9LA 3V6JA 4UB5A 2Y1JA 3KHRA 5KT3A 3BQTA 4O3NA 4Z6EA 4Q8FA 3NGDA 2HHSA 2M9NA 3N97B 2AU0A 3EPGA 3PW0A 4IR9A 4YR0A 5C5JA 1HJPA 2HHXA 3QZ8A 5KG1A 1S0OA 4ELUA 5KFQA 3RAQA 3ZDAA 5IIOA 4RZRA 1ZQFA 2A1JB 4F2RA 1NKEA 3KHHA 2ZUBA 3HW8A 4M04A 3RJIA 5IINA 2R8IA 2KZ3A 1MQ3A 1BVSA 3SV3A 3JPOA 5EWEA 1TAUA 5DB7A 3T3FA 3PMLA 4I2CA 4EBDA 5KG0A 5F9LA 3RBEA 4J9PA 2BGWA 4QZ9A 1NJZA 4LZGA 4RQ3A 4KLUA 4F5RA 1D9FA 4XQ8A 3K75D 2AQ4A 3OHBA 4R8UA 4YXMA 1RYSA 3ZDBA 9ICFA 3RJKA 1D9DA 4GXJA 3EZ5A 2ASJA 7ICIA 8ICTA 5J0RA 1TK0A 7ICHA 1ZQHA 5J0QA 3PMNA 4IQWA 3JPNA 2BCRA 2PFOA 5IIJA 4DOAA 4RQ7A 4EEYA 4KLGA 3ZDDA 4Z6FA 4KLQA 2FLLA 4PPXA 3RRHA 4RQ6A 1SL0A 3T5KA 2C2EA 3MR3A 4PHAA 3MFIA 2BDPA 4DO9A 4QW8A 5DLGA 3OJSA 2GWSA 4GXKA 4M9HA 2ZJ8A 4DFJA 1S9FA 3M9OB 5DG7A 7ICSA 1BPDA 4ED0A 1UT8A 5J0YA 4O3OA 3G6YA 4F8RA 2FMPA 2JEIA 3RJHA 9ICPA 4JWNA 2BCSA 5EWGA 5J2BA 4J9SA 1ZJMA 3HT3A 1COOA 1S0VA 1CEZA 1NK7A 8ICKA 5KG6A 5IIMA 4ED6A 1RYRA 1ZQPA 4ZH4A 5KFHA 1BPEA 2FMQA 4F4ZA 4I2GA 2KTQA 5DB6A 2HW3A 4ECWA 1KFSA 7ICJA 4DF8A 5KFVA 3TI0A 1S10A 4KLJA 2BPCA 5L9XA 2ASLA 2JEGA 4F3OA 4NLGA 1BGXT 1S0NA 1U9LA 1TV9A 3RB4A 1ZQKA 2PI5A 9ICMA 3BJYA 9ICGA 3GIJA 2W9CB 4F4KA 2AGPA 4I28A 3C1ZA 3KHGA 4DF4A 1XSPA 3NTUA 3QZ7A 1NJXA 4JV1A 3H4BA 7ICGA 3C2MA 4J9RA 1NKBA 7ICPA 4QWAA 3OJUA 1BPYA 4YP3A 5DLFA 4O5CA 3GIMA 3SYZA 5KFYA 4QZDA 4J9LA 3Q8LA 2KN7A 3ISDA 5CWRA 5KG5A 8ICCA 5CP2A 4YQWA 3MBYA 3EPIA 4C8KA 7ICUA 5DB9A 3RBDA 4IRKA 1L5UA 5L1JA 2BQ3A 1L3UA 3B0XA 3Q8QB 4M0AA 3C2KA 2V4QA 1N48A 1S77D 2C22A 7ICQA 1AROP 9ICWA 2W8LA 4O3QA 2W9AA 2ATLA 4KLTA 5D46A 2C2DA 5CA7A 3TFRA 4F4YA 3IM1A 5DBCA 5DQHA 3RJEA 5KFLA 4UAYA 1KRPA 4NLNA 1NJWA 2KZZA 4M6WB 5CR0A 4UB2A 2ZUCA 1ZQJA 1ZQVA 4E0DA 5J0UA 5L1KA 2I1QA 5TZVA 5J2AA 1C7YA 3PX4A 1B43A 4DFMA 4ED8A 7ICOA 4MEXA 4O3PA 4Q8EA 4QZBA 5KFDA 5KT6A 1L3TA
chains in the Genus database with same CATH superfamily
1A76A 2G08A 4C0ZA 1WYGA 4DOBA 3WK7A 5KFIA 4KLMA 1LB2B 4JMUA 4C80A 1PK1B 1F44A 4UATA 1ZQDA 9ICIA 4BDPA 2F44A 1KW4A 3WKAA 3H7IA 8ICIA 1ZD5A 5T14A 4UBCA 3UQ0A 4IQTA 3ETLA 3BS7A 3LK9A 2JRZA 1PVQA 2Q0ZX 7ICLA 2BCUA 3A0BU 9ICLA 2VA8A 3PX0A 1NKCA 1L7MA 2JZBA 5J0SA 2K4HA 3ZDEA 2VA3A 2F76X 4FS2A 4DSFA 2LM1A 4ECXA 4M9NA 4YVZA 2XGQA 2ZIVB 2ODGA 2XI9A 2FLPA 8ICMA 2UVVA 8ICLA 2MU2A 2YY6A 5ALPA 5KG3A 3IG5A 3Q8KA 3ZDCA 3NASA 2KJ9A 4DSLA 2HVIA 5IILA 1ZQBA 8ICPA 3PSPA 3FYHA 2JR5A 3H0LB 3PNCA 1RZTA 4I2AA 2XY6A 1ECWA 2I9GA 3OPXA 2WF8A 4YD2A 3ISBA 1Q3VA 4B9MA 3ISCA 2QKQA 3AM9A 3IP4B 1T4GA 4UB4A 1NK6A 1X66A 4ECRA 3ZI4A 1X40A 8ICWA 4RQ1A 1RYUA 1ZQIA 2LHTA 4EX7A 1B22A 4Y2QA 2OCEA 3SI8A 4GIBA 5ALMA 5AI0A 3FDSA 1BPXA 3MGHA 2HHTA 9ICCA 5D49A 3RJFA 3PSFA 2AHOB 3ORYA 2WF7A 3E58A 2HHWA 2ISPA 9ICSA 4QWDA 1X6IA 4FBUA 1JIHA 9ICXA 1YZ7A 3TANA 5JRTA 2KSOA 2J6TA 4R64A 3BZCA 2NO5A 4P4OA 2HBMA 1PVRA 2HHQA 1K1QA 5J2KA 3PSTA 3HKZC 3LVVA 4I29A 2D6FC 4EYIB 2RDJA 3GIIA 2OHFA 1QSSA 4TURA 4NY8A 3GV7B 3MR2A 4P0QA 2PFPA 3V7JA 4KLSA 4QZFA 1J2MA 4K4HA 1UA1A 5A0LA 4F4WA 4ACOA 3RR8A 1WCNA 1Z19A 3QEBZ 4B9UA 3QUBA 8ICEA 3I76A 2PKEA 2FE9A 5KG4A 3M8SA 5HHIA 1YZ6A 1JUDA 2HBJA 1L8OA 2CN1A 1SIJA 4YCXA 3S6JA 5EWFA 2YMQA 5ALJA 4UB3A 1NZPA 4DL4A 4DEZA 3QUTA 5AKXA 2H3FA 2LYAA 2KJ5A 1S0MA 4UB8U 1ZQUA 4IC9A 4ECYA 1NK4A 4PGXA 2Y0SC 8ICJA 3UXPA 2H3QA 4RPXA 3AL0B 1L7NA 8ICYA 1IV8A 4EEKA 2MA1A 3IV6A 3IDWA 4IL6U 2B21A 1PK1A 5KFTA 3GV8B 3ZD9A 2G5HB 2IBKA 4RUAA 2HVHA 5IIKA 4Z6CA 2K8AA 8ICVA 1VDVA 1SKRA 4DWIA 4CNQA 1U49A 1U47A 1TK8A 3MGIA 5EE1A 1ZQGA 1XU4A 4CF3A 4JWMA 4YN4A 4RUCA 2JXJA 3JPTA 3EYZA 2Y9UA 3GV5B 1RXVA 4LZDA 9ICOA 2MRLA 9ICKA 3RH6A 3M8RA 5BOLA 2AH5A 3M9NB 9ICJA 4QW9A 2HDOA 1BPBA 1JMSA 2G06A 2ZIVA 5KFKA 2AGQA 2JMGA 4JB3A 1TFRA 1CUKA 4YR2A 2FDRA 5HMMA 2RRDA 4I27A 4OJ6A 3FC4A 4PZOA 2H5XA 4EX6A 5J0XA 2XGPA 3PW5A 4KTQA 4M9GA 4F5PA 3T5LA 4TUPA 1WCLA 4NXZA 2PFQA 2CXYA 5KT4A 4FE3A 5KFXA 2C2RA 4QZ8A 5C0YA 2G09A 1ZQTA 4DS5A 4B9VA 5J0PA 1L7OA 3V6HA 1QSYA 1L6NA 4F5QA 2JGAA 3SAGA 4I2JA 4R65A 2FJ6A 3KHLA 3RB6A 1NK9A 4B9SA 4UW9A 4I2DA 2M0NA 5J8YC 3Q8SB 4ECZA 5AM5A 2VIXA 2HBKA 2KHVA 4P2HA 5L1IA 7ICEA 3ETRA 5ALWA 4AP9A 4DFKA 4UB5A 3IN5A 2Y1JA 4Q8FA 2IOFK 5C5JA 5AHXA 4Y2XA 3M6KA 5KG1A 3CYMA 5KFQA 3ZDAA 5IIOA 3C29A 1FFUA 2A1JB 2K8BB 3HW8A 5IINA 1MQ3A 2KZ3A 3NRWA 1UPHA 4US9A 4UARA 5DB7A 3T3FA 3RBEA 1N2XA 1ZD3A 4RQ3A 4UASA 4XQ8A 3K75D 3SQIA 1C20A 9ICFA 3RJKA 4GXJA 3EZ5A 5J0RA 1TK0A 3PMNA 2JH1A 4DOAA 1J97A 1SL0A 3MR3A 3MFIA 1NNLA 5DLGA 3OJSA 4GXKA 1J2NA 4DFJA 3LVWA 4ED0A 3G6YA 1TE2A 5J2BA 4J9SA 1COOA 8ICKA 1NK7A 1ZQPA 3O0FA 2KMDA 4F4ZA 4I2GA 2WF9A 3NS1A 3KBBA 3NVYA 4ECWA 3TI0A 1U9LA 1TV9A 4F4KA 3C28A 5ALOA 1XO0A 3OJUA 3N7PD 2XIDA 2XVTA 4O5CA 3SYZA 4QZDA 3Q8LA 3SEIA 2KN7A 4UAVA 4YQWA 4PL1A 5DB9A 3RBDA 4FZMA 4IRKA 3T79A 5ALNA 2DQNB 3B0XA 1N48A 1RQNA 1S77D 7ICQA 2ATLA 2C2DA 2NYVA 1FFVA 2KZZA 2W55A 2ZUCA 1ZQJA 4E0DA 5L1KA 4OJPA 1C7YA 3PX4A 1B43A 4DFMA 7ICOA 4USAA 4J9PA 1L3TA 2DKXA 2R8JA 1ZQOA 1ZQMA 1ZQSA 4QIWF 1ZQEA 4K4GA 5KFEA 3G6VA 5EE3A 4RT2A 3RR7A 3IHQB 5DDYA 5KFNA 2G5IB 1T7PA 2VKQA 4PGYA 1X9MA 4J9MA 4PGQA 3GZFA 2VANA 3BQ2A 4TUQA 4YXJA 1X2IA 1QSLA 5ALFA 5J2FA 2NV3A 1O03A 1QCKA 4Y2SA 4TQSA 8ICBA 4XRHA 3EUB2 5KT7A 1RDFA 2DFLA 2ASDA 8ICUA 2B6GA 2V4RA 5AICA 1Q3UA 4QWBA 5J2CA 2FPLA 8ICFA 1SV0A 5GTIU 8ICZA 5KTQA 4BWJA 2ZXIA 3F2DA 2BCQA 4F71A 4ED3A 3C1YA 2CRXA 2W7PA 2RHFA 3RH5A 2J6SA 5DGAA 4Y2YA 4C8LA 3HWTA 7ICTA 2IHNA 8ICAA 1RG6A 1X9SA 5FP0A 2I6XA 4OJOA 1AQ6A 5KFPA 5KNIA 2QB1A 2WF5A 1MA7A 1ZQNA 1JXEA 1JN3A 2N1RA 1OUQA 1KEJA 2A1JA 1NK0A 5BPCA 1XC9A 4KLLA 5KFOA 5B66U 4ECVA 2WAQF 2IOHA 4DL7A 2GH1A 9ICAA 3OTQA 3UXOA 5CHGA 2LYBA 5J2HA 2ZIWB 3QU7A 3BQ0A 1X9WA 4ZOHC 5KFCA 2PMZC 3K1RB 5KT5A 4DOCA 5HP4A 5ALTA 3SV4A 2VJ4A 1ZQWA 2EAPA 3Q8MA 3LWMA 5DG8A 4ELVA 1JX4A 4C7ZA 2EZYA 3TFSA 1V97A 5AK6A 1XSLA 5AIBA 4NWIA 3RH4A 3F2CA 2IA6A 3B0YA 4F72A 4UAUA 4ELTA 2HHUA 2KKVA 2VJ5A 2F3NA 3E0FA 4Y2PA 3RJJA 4LVSA 1TKDA 4R8UB 4UAWA 4DSEA 2E3TA 3PO5A 4P0PB 5ALRA 5E79U 4EBCA 2QB0B 4QZCA 4RPYA 5AI4A 2ISOA 4RQ8A 4JV0A 3Q8RB 2FLNA 7ICFA 1LKYB 3JPPA 1DXSA 4PL2A 2FPKA 4Y2TA 3D6JA 4O3MA 4KLDA 4RQ0A 3RB0A 2JEJA 2FI1A 4B9NA 2K89A 1WWVA 2YN4A 1Z4OA 2K4EA 5H2FU 5KT2A 3D2NA 2FMSA 3OSNA 4J9QA 3UPQA 3PO4A 4IR1A 4RQ4A 3QXGA 4I2IA 1SKWA 8ICXA 1N56A 1KFTA 3Q8PB 4PHDA 4B9TA 3UMBA 4F5OA 4O0IA 2P6RA 2KFZA 2W43A 4FFDA 2RP5A 4NL9A 2RDIA 2Z7JA 1BPZA 1QLNA 4MFAA 3BQ7A 2KG5A 5ALZA 4K4IA 7ICVA 2EDUA 4QZAA 9ICTA 2OWOA 1Q46A 2XY5A 2KIVA 4DQPA 2H3ZA 1WG8A 2BPGA 2NRTA 1ZJNA 3PVXA 7ICNA 3BS5B 2DUYA 2NRVA 5L1MA 3VCBA 4DL6A 4DS4A 3MR6A 4YD1A 4KLFA 5DGBA 1XWLA 4KLEA 1S76D 5ALDA 4O5EA 3ONNA 2LYHA 4Q43A 1MSWD 1KN5A 2ZJ5A 3NVVA 3HPOA 5KFZA 5AM4A 5CJ7A 4R66A 1ZQQA 3PR5B 4C8NA 4EZ6A 3AMZA 2KP7A 4BXOB 3T5JA 2MUTB 4DSIA 4TUSA 3L5KA 2PFNA 4PHEA 1VLBA 3PW4A 2DPIA 3N4MB 5J0TA 2Y1IA 3ED5A 5JTIA 3MGVA 2AGOA 3M9MB 2QARB 4RT3A 4ECQA 2ZIWA 4Q45A 5KFMA 5EE0A 5AKEA 1SL1A 3MR5A 5TISU 2DKZA 3UXNA 1DGSA 4U6PA 3K1ZA 2EAMA 4B9LA 3V6JA 5KT3A 4Z6EA 2HHSA 3PW0A 3KZIU 1SB3C 4C4SA 1PK3A 4ELUA 2Y0SF 4RZRA 4F2RA 2YMPA 5KL8B 3KHHA 3SAHA 4M04A 3RJIA 2MSNA 3SV3A 3PMLA 5AM3A 4EBDA 5F9LA 2BGWA 5G5HA 4LZGA 4KLUA 3R9KA 4F5RA 3QU4A 4R8UA 4P0PA 2LI6A 7ICIA 5AI6A 2W7OA 2LKYA 3IRUA 2QB0A 3WKDA 4RQ7A 4EEYA 4HAIA 4KLGA 3RRHA 2C2EA 4DO9A 3M9OB 5DG7A 1UQVA 5AI5A 1LKYA 1UT8A 5J0YA 4O3OA 2FMPA 2JEIA 9ICPA 5AK5A 2BCSA 2JHDA 5KG6A 1A6SA 5IIMA 1RYRA 3I28A 4ZH4A 2FMQA 4AYBC 2OH2A 2KOBA 5KFVA 1BNPA 3KOOA 2ASLA 3IG8A 1JRPA 2DBYA 1BGXT 1S0NA 3KKAC 4FZLA 2PI5A 9ICGA 3BJYA 2W9CB 3KD3A 4DF4A 3NTUA 1NJXA 2O6KA 4JV1A 2E8PA 5AKYA 7ICPA 4QWAA 5DLFA 3GIMA 2OM6A 8ICCA 3BZKA 3MBYA 2E1EA 2HOFA 5L1JA 2YMMA 4M0AA 2V4QA 4O3QA 2LBOA 4KLTA 1CRXA 5D46A 5CA7A 3TFRA 4F4YA 3N28A 1NJWA 4ED8A 3NRZA 1ED1A 4O3PA 1GO3F 1HEKA 4RQMA 4QZBA 5KT6A 1IXRA 4ECUA 1TK5A 1QTMA 4C4RA 4X5VA 1Z3EB 3BS5A 1PVPA 4DL5A 1X9XA 2VA2A 1L3SA 4DLEA 2RLTA 3TADC 4FZNA 8ICSA 3RAXA 2WB1C 4ECTA 2KVSA 3G6XA 2ZIXB 4DQSA 2HOIA 4MFCA 3TQ1A 3D2SA 5ALLA 4QJFB 3QX7A 1QQ7A 2F8LA 1QQ6A 1TAQA 3T5HA 4ICAA 4OCZA 2AQ0A 4O3RA 5DG9A 3AU2A 1SL2A 4BXOA 4QWCA 2RQ5A 4YMMA 2NRWA 2MUTA 5B5EU 4IS7A 4NM2A 4DQIA 2UVRA 4O3SA 4MF2A 5EE9A 3V6KA 4KN7A 3WK6A 2QARA 1FEZA 2KVCA 2W9BB 2R8HA 1IM4A 4KX3A 4J9KA 1F0MA 2DGZA 1PZNA 2R8KA 3MDAA 1D8LA 2HHVA 3OHAA 2DWQA 4UBBA 4DCCA 2KFNA 5AM2A 4RNOA 2W54A 3OSPA 5DBAA 5J0WA 3JPRA 3TAQA 4GXIA 3TARA 3L4PA 1ZETA 4NLBA 9ICEA 2YMLA 3HRDD 5J0OA 4F50A 4JK1A 4WJ3B 3QEAZ 2KD1A 4DLGA 4C4TA 3V72A 4DSJA 2A3VA 2P66A 5KFAA 5HMLA 3QUQA 4XA5A 3QU5A 1XSNA 1SZPA 2XICA 4CDGA 2ZTCA 1X6JA 4MEYA 5DBBA 4QZIA 2YB4A 5HNKA 2DPJA 1NK5A 3PY8A 1Y88A 1KSPA 2BHNA 4DQRA 3F53A 5ALGA 2KNJA 2BQUA 4O5KA 5EOZA 8ICGA 3KZXA 4EELA 4KMUA 2G07A 5J8YA 4C8OA 4O9MA 2IHMA 2YTUA 2JH7A 1JI7A 5KG2A 1ZQYA 4DFDA 5DQIA 5IIIA 3BQ1A 3EW9A 4B6JA 4ED1A 1SXEA 2IMWP 3WKCA 5DQGA 3KFUF 2NO4A 1NZBA 2WTFA 4PHPA 2HOQA 2W9CA 1COKA 3MFHA 2XY7A 2F1HA 2E8NA 1LVHA 4YMNA 5ALXA 4BJQA 3CW2C 2HI0A 4GC7A 4KITB 5KFWA 2V9WA 4M47A 4FS1A 4NLZA 4YMOA 5G5GA 5J2JA 4RQ2A 4QIWC 1NJYA 1TVAA 2K4PA 2KZMA 2JV3A 4GC6A 4F5NA 1U45A 1Z1VA 2EAOA 3SZ2A 1DGJA 3NVWA 3U26A 2J6UA 2CPRA 1NI3A 5AK4A 3GQCA 1T3QA 3RF9A 1MQ2A 1ZYQA 3DDHA 5KG7A 4R63A 1ZD4A 4I2HA 1F5SA 2ZIXA 4C8MA 2XCPA 4F93B 3UQ2A 4ED7A 1SZHA 2F1IA 4FO6A 3C5FA 1B0XA 3MC1A 3GDXA 2KEYA 2KJ8A 1FO4A 2F2AB 1ZOLA 2BPFA 1V85A 1T8EA 1YT3A 5HHHA 1NOMA 4M2YA 2W11A 4U7CA 5AIAA 4DL3A 1XO1A 1MC8A 4F91B 3WKBA 5KFBA 1S5LU 1SWWA 2E8MA 2UVWA 1T94A 2ALZA 4P0QB 2KKPA 7ICRA 4DL2A 5K4LA 5AKLA 1UT5A 3H8SA 5JUMA 2W9BA 5HR7A 2ZJAA 2F77X 5KFGA 1A77A 2EH9A 3C2LA 2LMRA 3WKEA 4I2EA 1L3VA 1MN8A 1UA0A 9ICUA 2UVUA 3RRGA 4BGDA 2MAXA 2ZIUB 3SD7A 1N5XA 1IIPA 2BQRA 2K4IA 4G9BA 4QZHA 3F2BA 4YG2A 2B0CA 4UAZA 3C5GA 5L1LA 9ICQA 4FBTA 4NM1A 5AKGA 3GU3A 5D4BA 1Z00B 1QH9A 9ICBA 3TKAA 4NJ8A 4CCHA 4KLOA 3KHRA 2K8CB 2M9NA 2H3VA 4IR9A 4YR0A 1HJPA 2HHXA 1L8LA 3QZ8A 2YB1A 3QU2A 2D3DA 3RAQA 1X42A 2E1FA 5AKJA 1NKEA 3J81j 1TAUA 3JPOA 2L5YA 5EWEA 5KG0A 4NLCA 4QZ9A 1VJ5A 1D9FA 3SAFA 5KAIU 4PJ0U 2AQ4A 3OHBA 4YXMA 1SWVA 3B9JA 1D9DA 8ICTA 4J03A 7ICHA 1ZQHA 5J0QA 3JPNA 2BCRA 2KK0A 3WK9A 5AKZA 3ZDDA 4Z6FA 2FLLA 2BDPA 4M9HA 7ICSA 1V38A 1BPDA 5EWGA 4Y2RA 1S0VA 4RQNA 4ED6A 1BPEA 4US8A 5DB6A 2HW3A 4DF8A 1S10A 3LYSA 4F3OA 4CGZA 3GIJA 1XNSA 1ZQ1C 3HKZF 3WK8A 2AGPA 3C1ZA 2OYYA 3KHGA 1XSPA 4Y2UA 3H4BA 7ICGA 5CEHA 4J9RA 1NKBA 1RQLA 1BPYA 4J9LA 5GTHU 5CWRA 4C8KA 7ICUA 2BQ3A 4OJ5A 3Q8QB 3C2KA 2W3RA 2C22A 2WHEA 1AROP 3A0HU 2W8LA 2W9AA 1WWUA 5DQHA 3RJEA 4UAYA 4NLNA 4M6WB 4UB2A 3N7SC 5J0UA 1URJA 3ALRA 5J2AA 2I5HA 4Y2JA 1FIQA 4Q8EA 3CP8A 5KFDA 2ES6A 1Q8KA 1N60A 4F4XA 1JXLA 3MDCA 2F8KA 2GOLA 1HIWA 4DSKA 1K1SA 4CF5A 3FAHA 5J2GA 1KQQA 5DB8A 5DDMA 3HILA 2PI4A 1ZQLA 2ZUDA 1DRGA 3UM9A 5J2IA 3QYPA 2D8CA 4F2SA 4A8EA 4XUSA 5KFFA 4I2BA 4P4MA 5KAFU 2HCFA 4QZEA 1HUZA 2XC9A 1ZD2P 2H3IA 3M1YA 2F1JA 3PW7A 3PX6A 5KFJA 4CE6A 5CB1A 3HX0A 1B4FA 1HUOA 2HBLA 2WFAA 1D8YA 5J2EA 2A1AA 2ZIUA 4KLHA 1KFDA 3AU6A 2R8GA 2OEHA 3EWAA 5J29A 1JALA 5AM1A 4QWEA 3RJGA 4QNLA 2HMXA 4MF8A 1DK3A 9ICVA 5ALYA 3NUQA 1Z00A 4ED2A 4AYBF 2C28A 4KMOB 1SGGA 2WF6A 3AQFA 2XCAA 1S97A 4J9NA 4EZ9A 4OO1J 3TAPA 3WU2U 1BNOA 1IG6A 1H38A 4KN4A 3AN1A 4CF4A 4UB6U 5J2DA 4KX5A 1EXNA 4Y2VA 4MHVA 3JPQA 1SKSA 4BWMA 3KTQA 1XS9D 4G3IA 3H40A 1U48A 2KE7A 1RXWA 8ICOA 2ZTEA 3SMVA 3H0RB 1SXDA 2OXOA 4PH5A 2HSZA 1U4BA 1N63A 1Z4NA 1ZQXA 4NLKA 2Y9TA 9ICRA 2P35A 5DKWA 2QLTA 1L7PA 3PSIA 1A0PA 1N5WA 4KLJA 2PXIA 1V9PA 2LM4A 5AKIA 2NRXA 5KFSA 2NRZA 4TQRA 4MFFA 3H0MB 1ZRMA 4M9LA 2WB1F 1JROA 4YR3A 1ZQAA 1CI4A 1KKXA 4GFJA 2GO7A 3PV8A 4DFPA 1KTQA 2BDUA 5BOMA 3F5AA 3C23A 2BKEA 4OJLA 4BUGA 2EZZA 4P4PA 2P6UA 4RPZA 3AQEA 3BDPA 3ZD8A 1KDHA 4KLIA 5ALSA 4Q44A 3F5EA 2K60A 4JUZA 2W8KA 8ICRA 1DOQA 2EZXA 3WK5A 7ICMA 4RNNA 4YFKA 5CRXA 1ZXIA 3PZPA 4F92B 3D2QA 4GLXA 4M9JA 5F9NA 2W04A 3GILA 9ICNA 5KFRA 3H8JA 2BR0A 4ECSA 3LDAA 4JV2A 3LWLA 2JEFA 4IRDA 5HR6A 5ALHA 1QQ5A 4UB1A 2EANA 4M6WA 3RTVA 5JU5A 4LJXA 3NVZA 3ICXA 2BZFA 4I2FA 2W3SA 8ICNA 5ALVA 1P7DA 2BCVA 3OGUA 2W9MA 1LV5A 1UHUA 4J9OA 4CRXA 8ICHA 2KV2A 3C21A 3K4GA 5ALQA 1SV0C 4RU9A 9ICHA 3JPSA 4EBEA 1NK8A 2KICA 3H8WA 3AUOA 3KKAA 4C7YA 2LPEA 5KL1B 1RPLA 3GIKA 3FM9A 3TACB 3MABA 4IQVA 4RNMA 1M6YA 4HYKA 4RQ5A 4Z6DA 2FPMA 3GFKB 1ZQRA 1KLNA 4OD0A 2A19A 3M7DA 3VC8A 8ICQA 5KFUA 3QE9Y 3DV9A 3PR4A 2EQYA 5F3XB 5AKHA 1D8BA 3H4DA 1KBUA 4DQQA 2AJQA 3PW2A 1UCVA 3THVA 1N61A 2W03A 2ZTDA 4NV0A 4IQUA 2XO7A 1DK2A 1ZQZA 4IRCA 1OW5A 5ALEA 2JZBB 5AI9A 3TADA 4EYHB 1ZRNA 1K5OA 4QZGA 3V7LA 5AK3A 1T3NA 4BX9C 4UQGA 1ZQCA 7ICKA 1RM6C 3HP6A 5AKKA 3I1YA 2E5SA 3E2EA 3RB3A 2E8OA 3V7KA 5AM0A 3AEVA 3BQTA 4O3NA 1TAMA 3NGDA 1O08A 3N97B 2AU0A 3EPGA 1OXJA 2GLEA 2R18A 3N7RC 1S0OA 3QU9A 2DF4B 1ZQFA 2ZUBA 2R8IA 1BVSA 5ALUA 4I2CA 3SENA 3HJEA 1SV4A 3H8MA 1NJZA 1WUDA 1RYSA 1N62A 3ZDBA 1PUZA 2G0AA 2ASJA 2ESEA 2KIWA 4IQWA 2PFOA 5IIJA 4PPXA 4KLQA 4RQ6A 3T5KA 1S8OA 5AI8A 4PHAA 4QW8A 2GWSA 2ZJ8A 1Z1BA 1S9FA 2KSOB 4F8RA 2PMZF 3RJHA 4JWNA 3CRXA 1ZJMA 3HT3A 1CEZA 5KFHA 3DEEA 2KTQA 1KFSA 7ICJA 2BPCA 2IOFA 5L9XA 2JEGA 2Q4TA 4NLGA 4NL9C 3QUCA 3UMGA 3RB4A 1ZQKA 2DL0A 9ICMA 4PZNA 3L3FX 3UMCA 4I28A 3M6ZA 3QZ7A 3CNHA 3RFAA 3C2MA 4YP3A 5KFYA 1KL9A 3ISDA 5KG5A 5CP2A 2WAQC 3EPIA 5ALKA 1L5UA 1L3UA 5ALIA 9ICWA 2ZG6A 3QNMA 2YX8A 2ZXHA 2KHQA 3IM1A 5DBCA 2AXTU 5KFLA 1KRPA 5CR0A 1ZQVA 3SR6A 2I1QA 4EENA 5TZVA 2YQEA 4MEXA 3WK4A
chains in the Genus database with same CATH topology
1A76A 1IXRA 4F4XA 4ECUA 3MDCA 1TK5A 1JXLA 1ZQOA 2R8JA 4DSKA 1QTMA 4X5VA 1K1SA 1ZQMA 4DOBA 1ZQSA 1Z3EB 1ZQEA 5KFIA 5J2GA 2PI4A 5DB8A 5DDMA 1LB2B 5KFEA 3G6VA 4DL5A 1ZQLA 2ZUDA 4K4GA 4RT2A 3RR7A 2VA2A 3IHQB 1ZQDA 5DDYA 9ICIA 5KFNA 5J2IA 1L3SA 4DLEA 4BDPA 1T7PA 8ICSA 3RAXA 4F2SA 4PGYA 4ECTA 4XUSA 1X9MA 5KFFA 3G6XA 4J9MA 4I2BA 4P4MA 4PGQA 3H7IA 4DQSA 8ICIA 2VANA 4QZEA 4UBCA 4TUQA 3BQ2A 3UQ0A 1HUZA 4MFCA 4YXJA 1X2IA 3TQ1A 2XC9A 1QSLA 5J2FA 4IQTA 2F1JA 3ETLA 3PW7A 3PX6A 5KFJA 3LK9A 5CB1A 3HX0A 1HUOA 4TQSA 8ICBA 1TAQA 4XRHA 3T5HA 2Q0ZX 7ICLA 2AQ0A 4O3RA 5KT7A 5DG9A 3AU2A 2DFLA 2ASDA 2BCUA 1D8YA 8ICUA 2V4RA 9ICLA 2VA8A 3PX0A 5J2EA 1NKCA 4QWBA 1SL2A 2JZBA 5J0SA 5J2CA 2FPLA 4BXOA 8ICFA 4QWCA 4KLHA 8ICZA 5KTQA 4BWJA 1KFDA 3AU6A 3ZDEA 4YMMA 2R8GA 2VA3A 2NRWA 5J29A 2MUTA 3EWAA 2BCQA 4FS2A 4DSFA 4ECXA 4ED3A 3C1YA 4NM2A 4QWEA 4M9NA 4DQIA 2UVRA 4O3SA 4YVZA 3RJGA 2XGQA 4MF2A 2J6SA 3RH5A 5DGAA 4MF8A 3V6KA 4KN7A 4C8LA 3HWTA 9ICVA 2W9BB 1Z00A 2R8HA 4ED2A 1IM4A 2C28A 7ICTA 2IHNA 2FLPA 8ICMA 4J9KA 8ICAA 1X9SA 1PZNA 2R8KA 2UVVA 2XCAA 3MDAA 1S97A 1D8LA 3Q8KA 5KG3A 8ICLA 4J9NA 2HHVA 3ZDCA 4EZ9A 3OHAA 4DSLA 2HVIA 5IILA 5KFPA 1ZQBA 8ICPA 4UBBA 3TAPA 3FYHA 3PNCA 1RZTA 4I2AA 2KFNA 4RNOA 1ZQNA 2XY6A 1H38A 1JXEA 4KN4A 1JN3A 2I9GA 3OSPA 5J2DA 5DBAA 5J0WA 3JPRA 1EXNA 4YD2A 3ISBA 3TAQA 1KEJA 4B9MA 3ISCA 2A1JA 1NK0A 4GXIA 5BPCA 3JPQA 3TARA 4BWMA 1XC9A 1SKSA 3KTQA 1XS9D 5KFOA 4KLLA 1ZETA 4G3IA 4ECVA 3H40A 1T4GA 4UB4A 1U48A 1NK6A 4DL7A 4ECRA 9ICAA 1RXWA 3UXOA 8ICOA 4RQ1A 8ICWA 5CHGA 9ICEA 5J0OA 4F50A 4JK1A 2ZTEA 1ZQIA 3QEAZ 4PH5A 1B22A 5J2HA 3SI8A 4DLGA 1U4BA 3BQ0A 1X9WA 5KFCA 4DSJA 3V72A 2P66A 5KFAA 1ZQXA 3FDSA 5HMLA 1BPXA 4NLKA 3MGHA 2HHTA 9ICRA 4XA5A 5DKWA 1XSNA 1SZPA 9ICCA 5D49A 3RJFA 2ZTCA 5KT5A 4DOCA 5HP4A 4MEYA 3ORYA 5DBBA 4QZIA 2HHWA 5HNKA 2DPJA 1NK5A 3SV4A 2ISPA 9ICSA 4QWDA 3PY8A 4FBUA 1JIHA 9ICXA 3TANA 1Y88A 1ZQWA 2PXIA 1V9PA 1KSPA 2BHNA 4DQRA 3Q8MA 4R64A 2J6TA 3LWMA 4P4OA 5DG8A 4ELVA 2NRXA 5KFSA 1JX4A 2BQUA 2NRZA 5EOZA 3TFSA 4TQRA 4O5KA 8ICGA 2HHQA 4KMUA 4C8OA 4MFFA 1XSLA 1K1QA 5J2KA 3RH4A 2IA6A 4O9MA 2IHMA 3B0YA 5KG2A 1ZQYA 4M9LA 4I29A 4EYIB 5DQIA 4YR3A 4ELTA 5IIIA 3BQ1A 1ZQAA 3EW9A 2RDJA 4ED1A 2HHUA 3GIIA 3RJJA 4LVSA 1QSSA 4TURA 3PV8A 2IMWP 4DFPA 1KTQA 4R8UB 4UAWA 4DSEA 1TKDA 4NY8A 3PO5A 5BOMA 3C23A 5DQGA 2BKEA 3GV7B 3MR2A 2WTFA 4PHPA 4P4PA 4EBCA 2PFPA 2P6UA 4RPZA 2W9CA 3V7JA 3MFHA 2XY7A 4KLSA 2F1HA 4QZCA 3ZD8A 3BDPA 4RPYA 1KDHA 4QZFA 2ISOA 4YMNA 4RQ8A 4K4HA 4JV0A 1UA1A 4F4WA 4KLIA 3Q8RB 4Q44A 2FLNA 4JUZA 7ICFA 2W8KA 3RR8A 8ICRA 1DOQA 3JPPA 1WCNA 4GC7A 3QEBZ 4B9UA 4KITB 7ICMA 4RNNA 8ICEA 4YFKA 5KFWA 2FPKA 2V9WA 5KG4A 4F92B 4M47A 4FS1A 4NLZA 4GLXA 4M9JA 5F9NA 4YMOA 3GILA 3M8SA 5HHIA 9ICNA 4KLDA 4RQ0A 5KFRA 3RB0A 2JEJA 3H8JA 4B9NA 4YCXA 5J2JA 3LDAA 4ECSA 5EWFA 4UB3A 2BR0A 4RQ2A 4JV2A 4DL4A 3LWLA 1NJYA 1TVAA 2JEFA 4DEZA 4IRDA 2KZMA 4UB1A 4GC6A 4F5NA 1U45A 4M6WA 3RTVA 5KT2A 2FMSA 3SZ2A 3OSNA 4J9QA 3UPQA 3PO4A 4IR1A 4RQ4A 2J6UA 1S0MA 4I2IA 1SKWA 8ICNA 4I2FA 1ZQUA 3GQCA 4ECYA 1NK4A 4PGXA 2BCVA 3OGUA 8ICJA 3UXPA 4RPXA 2W9MA 1LV5A 8ICYA 1MQ2A 1ZYQA 8ICXA 4J9OA 1N56A 8ICHA 3C21A 1KFTA 2B21A 5KG7A 5KFTA 3Q8PB 4R63A 3ZD9A 3GV8B 3K4GA 4PHDA 4B9TA 2IBKA 4RUAA 4I2HA 4RU9A 4O0IA 4F5OA 2HVHA 3JPSA 4EBEA 2P6RA 2KFZA 9ICHA 5IIKA 4C8MA 2XCPA 1NK8A 3H8WA 4Z6CA 4F93B 3UQ2A 4ED7A 8ICVA 4FO6A 2F1IA 2RDIA 3AUOA 1SKRA 3C5FA 4DWIA 1U49A 1BPZA 3GDXA 1RPLA 3GIKA 4MFAA 1U47A 1QLNA 1TK8A 3MGIA 3MABA 4IQVA 4RNMA 4HYKA 2BPFA 4RQ5A 4Z6DA 2FPMA 3GFKB 1T8EA 1ZQGA 4K4IA 7ICVA 1ZQRA 1KLNA 4QZAA 5HHHA 9ICTA 1XU4A 2OWOA 1NOMA 2XY5A 4M2YA 4DQPA 4JWMA 4YN4A 2BPGA 4DL3A 2NRTA 1XO1A 8ICQA 5KFUA 1MC8A 3QE9Y 4F91B 4RUCA 5KFBA 1ZJNA 3PVXA 3JPTA 3EYZA 7ICNA 2NRVA 3GV5B 2UVWA 1RXVA 4LZDA 9ICOA 3PR4A 4DL6A 9ICKA 3RH6A 3M8RA 4DS4A 2ALZA 5BOLA 3MR6A 3M9NB 3H4DA 4YD1A 9ICJA 4KLMA 4QW9A 4DL2A 7ICRA 1BPBA 4KLFA 1JMSA 5DGBA 4DQQA 5KFKA 1UT5A 1XWLA 3H8SA 2AGQA 4KLEA 1S76D 5JUMA 2W9BA 2AJQA 1TFRA 1CUKA 4YR2A 2ZJAA 3PW2A 4O5EA 3THVA 2LYHA 5HMMA 4I27A 2ZTDA 5KFGA 4Q43A 1MSWD 1A77A 2ZJ5A 2H5XA 5J0XA 3C2LA 4IQUA 2XO7A 2XGPA 3HPOA 5KFZA 4I2EA 3PW5A 1ZQZA 4KTQA 4M9GA 5CJ7A 4R66A 4F5PA 3PR5B 1ZQQA 4C8NA 4TUPA 3T5LA 1L3VA 4IRCA 1UA0A 1WCLA 4NXZA 9ICUA 2UVUA 2PFQA 4EZ6A 2JZBB 3RRGA 2MAXA 4BGDA 5KT4A 4BXOB 5KFXA 2C2RA 4EYHB 3T5JA 2BQRA 4QZ8A 4QZGA 3V7LA 1ZQTA 4DS5A 4B9VA 2MUTB 4QZHA 5J0PA 4DSIA 4YG2A 4TUSA 3V6HA 1T3NA 1QSYA 4UAZA 4F5QA 3C5GA 4PHEA 2PFNA 4UQGA 5L1LA 4I2JA 4R65A 3PW4A 9ICQA 1ZQCA 2DPIA 3N4MB 4FBTA 4NM1A 7ICKA 5J0TA 3HP6A 3KHLA 2Y1IA 3RB6A 1NK9A 4B9SA 2AGOA 4I2DA 3Q8SB 3M9MB 4ECZA 4RT3A 4ECQA 1Z00B 5D4BA 3E2EA 4Q45A 9ICBA 5KFMA 3RB3A 1SL1A 3MR5A 4P2HA 5L1IA 3V7KA 7ICEA 3UXNA 1DGSA 4CCHA 4KLOA 4DFKA 4B9LA 3V6JA 4UB5A 2Y1JA 3KHRA 5KT3A 3BQTA 4O3NA 4Z6EA 4Q8FA 3NGDA 2HHSA 2M9NA 3N97B 2AU0A 3EPGA 3PW0A 4IR9A 4YR0A 5C5JA 1HJPA 2HHXA 3QZ8A 5KG1A 1S0OA 4ELUA 5KFQA 3RAQA 3ZDAA 5IIOA 4RZRA 1ZQFA 2A1JB 4F2RA 1NKEA 3KHHA 2ZUBA 3HW8A 4M04A 3RJIA 5IINA 2R8IA 2KZ3A 1MQ3A 1BVSA 3SV3A 3JPOA 5EWEA 1TAUA 5DB7A 3T3FA 3PMLA 4I2CA 4EBDA 5KG0A 5F9LA 3RBEA 4J9PA 2BGWA 4QZ9A 1NJZA 4LZGA 4RQ3A 4KLUA 4F5RA 1D9FA 4XQ8A 3K75D 2AQ4A 3OHBA 4R8UA 4YXMA 1RYSA 3ZDBA 9ICFA 3RJKA 1D9DA 4GXJA 3EZ5A 2ASJA 7ICIA 8ICTA 5J0RA 1TK0A 7ICHA 1ZQHA 5J0QA 3PMNA 4IQWA 3JPNA 2BCRA 2PFOA 5IIJA 4DOAA 4RQ7A 4EEYA 4KLGA 3ZDDA 4Z6FA 4KLQA 2FLLA 4PPXA 3RRHA 4RQ6A 1SL0A 3T5KA 2C2EA 3MR3A 4PHAA 3MFIA 2BDPA 4DO9A 4QW8A 5DLGA 3OJSA 2GWSA 4GXKA 4M9HA 2ZJ8A 4DFJA 1S9FA 3M9OB 5DG7A 7ICSA 1BPDA 4ED0A 1UT8A 5J0YA 4O3OA 3G6YA 4F8RA 2FMPA 2JEIA 3RJHA 9ICPA 4JWNA 2BCSA 5EWGA 5J2BA 4J9SA 1ZJMA 3HT3A 1COOA 1S0VA 1CEZA 1NK7A 8ICKA 5KG6A 5IIMA 4ED6A 1RYRA 1ZQPA 4ZH4A 5KFHA 1BPEA 2FMQA 4F4ZA 4I2GA 2KTQA 5DB6A 2HW3A 4ECWA 1KFSA 7ICJA 4DF8A 5KFVA 3TI0A 1S10A 4KLJA 2BPCA 5L9XA 2ASLA 2JEGA 4F3OA 4NLGA 1BGXT 1S0NA 1U9LA 1TV9A 3RB4A 1ZQKA 2PI5A 9ICMA 3BJYA 9ICGA 3GIJA 2W9CB 4F4KA 2AGPA 4I28A 3C1ZA 3KHGA 4DF4A 1XSPA 3NTUA 3QZ7A 1NJXA 4JV1A 3H4BA 7ICGA 3C2MA 4J9RA 1NKBA 7ICPA 4QWAA 3OJUA 1BPYA 4YP3A 5DLFA 4O5CA 3GIMA 3SYZA 5KFYA 4QZDA 4J9LA 3Q8LA 2KN7A 3ISDA 5CWRA 5KG5A 8ICCA 5CP2A 4YQWA 3MBYA 3EPIA 4C8KA 7ICUA 5DB9A 3RBDA 4IRKA 1L5UA 5L1JA 2BQ3A 1L3UA 3B0XA 3Q8QB 4M0AA 3C2KA 2V4QA 1N48A 1S77D 2C22A 7ICQA 1AROP 9ICWA 2W8LA 4O3QA 2W9AA 2ATLA 4KLTA 5D46A 2C2DA 5CA7A 3TFRA 4F4YA 3IM1A 5DBCA 5DQHA 3RJEA 5KFLA 4UAYA 1KRPA 4NLNA 1NJWA 2KZZA 4M6WB 5CR0A 4UB2A 2ZUCA 1ZQJA 1ZQVA 4E0DA 5J0UA 5L1KA 2I1QA 5TZVA 5J2AA 1C7YA 3PX4A 1B43A 4DFMA 4ED8A 7ICOA 4MEXA 4O3PA 4Q8EA 4QZBA 5KFDA 5KT6A 1L3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A76 A;  1IXR A;  4F4X A;  4ECU A;  3MDC A;  1TK5 A;  1JXL A;  1ZQO A;  2R8J A;  4DSK A;  1QTM A;  4X5V A;  1K1S A;  1ZQM A;  4DOB A;  1ZQS A;  1Z3E B;  1ZQE A;  5KFI A;  5J2G A;  2PI4 A;  5DB8 A;  5DDM A;  1LB2 B;  5KFE A;  3G6V A;  4DL5 A;  1ZQL A;  2ZUD A;  4K4G A;  4RT2 A;  3RR7 A;  2VA2 A;  3IHQ B;  1ZQD A;  5DDY A;  9ICI A;  5KFN A;  5J2I A;  1L3S A;  4DLE A;  4BDP A;  1T7P A;  8ICS A;  3RAX A;  4F2S A;  4PGY A;  4ECT A;  4XUS A;  1X9M A;  5KFF A;  3G6X A;  4J9M A;  4I2B A;  4P4M A;  4PGQ A;  3H7I A;  4DQS A;  8ICI A;  2VAN A;  4QZE A;  4UBC A;  4TUQ A;  3BQ2 A;  3UQ0 A;  1HUZ A;  4MFC A;  4YXJ A;  1X2I A;  3TQ1 A;  2XC9 A;  1QSL A;  5J2F A;  4IQT A;  2F1J A;  3ETL A;  3PW7 A;  3PX6 A;  5KFJ A;  3LK9 A;  5CB1 A;  3HX0 A;  1HUO A;  4TQS A;  8ICB A;  1TAQ A;  4XRH A;  3T5H A;  2Q0Z X;  7ICL A;  2AQ0 A;  4O3R A;  5KT7 A;  5DG9 A;  3AU2 A;  2DFL A;  2ASD A;  2BCU A;  1D8Y A;  8ICU A;  2V4R A;  9ICL A;  2VA8 A;  3PX0 A;  5J2E A;  1NKC A;  4QWB A;  1SL2 A;  2JZB A;  5J0S A;  5J2C A;  2FPL A;  4BXO A;  8ICF A;  4QWC A;  4KLH A;  8ICZ A;  5KTQ A;  4BWJ A;  1KFD A;  3AU6 A;  3ZDE A;  4YMM A;  2R8G A;  2VA3 A;  2NRW A;  5J29 A;  2MUT A;  3EWA A;  2BCQ A;  4FS2 A;  4DSF A;  4ECX A;  4ED3 A;  3C1Y A;  4NM2 A;  4QWE A;  4M9N A;  4DQI A;  2UVR A;  4O3S A;  4YVZ A;  3RJG A;  2XGQ A;  4MF2 A;  2J6S A;  3RH5 A;  5DGA A;  4MF8 A;  3V6K A;  4KN7 A;  4C8L A;  3HWT A;  9ICV A;  2W9B B;  1Z00 A;  2R8H A;  4ED2 A;  1IM4 A;  2C28 A;  7ICT A;  2IHN A;  2FLP A;  8ICM A;  4J9K A;  8ICA A;  1X9S A;  1PZN A;  2R8K A;  2UVV A;  2XCA A;  3MDA A;  1S97 A;  1D8L A;  3Q8K A;  5KG3 A;  8ICL A;  4J9N A;  2HHV A;  3ZDC A;  4EZ9 A;  3OHA A;  4DSL A;  2HVI A;  5IIL A;  5KFP A;  1ZQB A;  8ICP A;  4UBB A;  3TAP A;  3FYH A;  3PNC A;  1RZT A;  4I2A A;  2KFN A;  4RNO A;  1ZQN A;  2XY6 A;  1H38 A;  1JXE A;  4KN4 A;  1JN3 A;  2I9G A;  3OSP A;  5J2D A;  5DBA A;  5J0W A;  3JPR A;  1EXN A;  4YD2 A;  3ISB A;  3TAQ A;  1KEJ A;  4B9M A;  3ISC A;  2A1J A;  1NK0 A;  4GXI A;  5BPC A;  3JPQ A;  3TAR A;  4BWM A;  1XC9 A;  1SKS A;  3KTQ A;  1XS9 D;  5KFO A;  4KLL A;  1ZET A;  4G3I A;  4ECV A;  3H40 A;  1T4G A;  4UB4 A;  1U48 A;  1NK6 A;  4DL7 A;  4ECR A;  9ICA A;  1RXW A;  3UXO A;  8ICO A;  4RQ1 A;  8ICW A;  5CHG A;  9ICE A;  5J0O A;  4F50 A;  4JK1 A;  2ZTE A;  1ZQI A;  3QEA Z;  4PH5 A;  1B22 A;  5J2H A;  3SI8 A;  4DLG A;  1U4B A;  3BQ0 A;  1X9W A;  5KFC A;  4DSJ A;  3V72 A;  2P66 A;  5KFA A;  1ZQX A;  3FDS A;  5HML A;  1BPX A;  4NLK A;  3MGH A;  2HHT A;  9ICR A;  4XA5 A;  5DKW A;  1XSN A;  1SZP A;  9ICC A;  5D49 A;  3RJF A;  2ZTC A;  5KT5 A;  4DOC A;  5HP4 A;  4MEY A;  3ORY A;  5DBB A;  4QZI A;  2HHW A;  5HNK A;  2DPJ A;  1NK5 A;  3SV4 A;  2ISP A;  9ICS A;  4QWD A;  3PY8 A;  4FBU A;  1JIH A;  9ICX A;  3TAN A;  1Y88 A;  1ZQW A;  2PXI A;  1V9P A;  1KSP A;  2BHN A;  4DQR A;  3Q8M A;  4R64 A;  2J6T A;  3LWM A;  4P4O A;  5DG8 A;  4ELV A;  2NRX A;  5KFS A;  1JX4 A;  2BQU A;  2NRZ A;  5EOZ A;  3TFS A;  4TQR A;  4O5K A;  8ICG A;  2HHQ A;  4KMU A;  4C8O A;  4MFF A;  1XSL A;  1K1Q A;  5J2K A;  3RH4 A;  2IA6 A;  4O9M A;  2IHM A;  3B0Y A;  5KG2 A;  1ZQY A;  4M9L A;  4I29 A;  4EYI B;  5DQI A;  4YR3 A;  4ELT A;  5III A;  3BQ1 A;  1ZQA A;  3EW9 A;  2RDJ A;  4ED1 A;  2HHU A;  3GII A;  3RJJ A;  4LVS A;  1QSS A;  4TUR A;  3PV8 A;  2IMW P;  4DFP A;  1KTQ A;  4R8U B;  4UAW A;  4DSE A;  1TKD A;  4NY8 A;  3PO5 A;  5BOM A;  3C23 A;  5DQG A;  2BKE A;  3GV7 B;  3MR2 A;  2WTF A;  4PHP A;  4P4P A;  4EBC A;  2PFP A;  2P6U A;  4RPZ A;  2W9C A;  3V7J A;  3MFH A;  2XY7 A;  4KLS A;  2F1H A;  4QZC A;  3ZD8 A;  3BDP A;  4RPY A;  1KDH A;  4QZF A;  2ISO A;  4YMN A;  4RQ8 A;  4K4H A;  4JV0 A;  1UA1 A;  4F4W A;  4KLI A;  3Q8R B;  4Q44 A;  2FLN A;  4JUZ A;  7ICF A;  2W8K A;  3RR8 A;  8ICR A;  1DOQ A;  3JPP A;  1WCN A;  4GC7 A;  3QEB Z;  4B9U A;  4KIT B;  7ICM A;  4RNN A;  8ICE A;  4YFK A;  5KFW A;  2FPK A;  2V9W A;  5KG4 A;  4F92 B;  4M47 A;  4FS1 A;  4NLZ A;  4GLX A;  4M9J A;  5F9N A;  4YMO A;  3GIL A;  3M8S A;  5HHI A;  9ICN A;  4KLD A;  4RQ0 A;  5KFR A;  3RB0 A;  2JEJ A;  3H8J A;  4B9N A;  4YCX A;  5J2J A;  3LDA A;  4ECS A;  5EWF A;  4UB3 A;  2BR0 A;  4RQ2 A;  4JV2 A;  4DL4 A;  3LWL A;  1NJY A;  1TVA A;  2JEF A;  4DEZ A;  4IRD A;  2KZM A;  4UB1 A;  4GC6 A;  4F5N A;  1U45 A;  4M6W A;  3RTV A;  5KT2 A;  2FMS A;  3SZ2 A;  3OSN A;  4J9Q A;  3UPQ A;  3PO4 A;  4IR1 A;  4RQ4 A;  2J6U A;  1S0M A;  4I2I A;  1SKW A;  8ICN A;  4I2F A;  1ZQU A;  3GQC A;  4ECY A;  1NK4 A;  4PGX A;  2BCV A;  3OGU A;  8ICJ A;  3UXP A;  4RPX A;  2W9M A;  1LV5 A;  8ICY A;  1MQ2 A;  1ZYQ A;  8ICX A;  4J9O A;  1N56 A;  8ICH A;  3C21 A;  1KFT A;  2B21 A;  5KG7 A;  5KFT A;  3Q8P B;  4R63 A;  3ZD9 A;  3GV8 B;  3K4G A;  4PHD A;  4B9T A;  2IBK A;  4RUA A;  4I2H A;  4RU9 A;  4O0I A;  4F5O A;  2HVH A;  3JPS A;  4EBE A;  2P6R A;  2KFZ A;  9ICH A;  5IIK A;  4C8M A;  2XCP A;  1NK8 A;  3H8W A;  4Z6C A;  4F93 B;  3UQ2 A;  4ED7 A;  8ICV A;  4FO6 A;  2F1I A;  2RDI A;  3AUO A;  1SKR A;  3C5F A;  4DWI A;  1U49 A;  1BPZ A;  3GDX A;  1RPL A;  3GIK A;  4MFA A;  1U47 A;  1QLN A;  1TK8 A;  3MGI A;  3MAB A;  4IQV A;  4RNM A;  4HYK A;  2BPF A;  4RQ5 A;  4Z6D A;  2FPM A;  3GFK B;  1T8E A;  1ZQG A;  4K4I A;  7ICV A;  1ZQR A;  1KLN A;  4QZA A;  5HHH A;  9ICT A;  1XU4 A;  2OWO A;  1NOM A;  2XY5 A;  4M2Y A;  4DQP A;  4JWM A;  4YN4 A;  2BPG A;  4DL3 A;  2NRT A;  1XO1 A;  8ICQ A;  5KFU A;  1MC8 A;  3QE9 Y;  4F91 B;  4RUC A;  5KFB A;  1ZJN A;  3PVX A;  3JPT A;  3EYZ A;  7ICN A;  2NRV A;  3GV5 B;  2UVW A;  1RXV A;  4LZD A;  9ICO A;  3PR4 A;  4DL6 A;  9ICK A;  3RH6 A;  3M8R A;  4DS4 A;  2ALZ A;  5BOL A;  3MR6 A;  3M9N B;  3H4D A;  4YD1 A;  9ICJ A;  4KLM A;  4QW9 A;  4DL2 A;  7ICR A;  1BPB A;  4KLF A;  1JMS A;  5DGB A;  4DQQ A;  5KFK A;  1UT5 A;  1XWL A;  3H8S A;  2AGQ A;  4KLE A;  1S76 D;  5JUM A;  2W9B A;  2AJQ A;  1TFR A;  1CUK A;  4YR2 A;  2ZJA A;  3PW2 A;  4O5E A;  3THV A;  2LYH A;  5HMM A;  4I27 A;  2ZTD A;  5KFG A;  4Q43 A;  1MSW D;  1A77 A;  2ZJ5 A;  2H5X A;  5J0X A;  3C2L A;  4IQU A;  2XO7 A;  2XGP A;  3HPO A;  5KFZ A;  4I2E A;  3PW5 A;  1ZQZ A;  4KTQ A;  4M9G A;  5CJ7 A;  4R66 A;  4F5P A;  3PR5 B;  1ZQQ A;  4C8N A;  4TUP A;  3T5L A;  1L3V A;  4IRC A;  1UA0 A;  1WCL A;  4NXZ A;  9ICU A;  2UVU A;  2PFQ A;  4EZ6 A;  2JZB B;  3RRG A;  2MAX A;  4BGD A;  5KT4 A;  4BXO B;  5KFX A;  2C2R A;  4EYH B;  3T5J A;  2BQR A;  4QZ8 A;  4QZG A;  3V7L A;  1ZQT A;  4DS5 A;  4B9V A;  2MUT B;  4QZH A;  5J0P A;  4DSI A;  4YG2 A;  4TUS A;  3V6H A;  1T3N A;  1QSY A;  4UAZ A;  4F5Q A;  3C5G A;  4PHE A;  2PFN A;  4UQG A;  5L1L A;  4I2J A;  4R65 A;  3PW4 A;  9ICQ A;  1ZQC A;  2DPI A;  3N4M B;  4FBT A;  4NM1 A;  7ICK A;  5J0T A;  3HP6 A;  3KHL A;  2Y1I A;  3RB6 A;  1NK9 A;  4B9S A;  2AGO A;  4I2D A;  3Q8S B;  3M9M B;  4ECZ A;  4RT3 A;  4ECQ A;  1Z00 B;  5D4B A;  3E2E A;  4Q45 A;  9ICB A;  5KFM A;  3RB3 A;  1SL1 A;  3MR5 A;  4P2H A;  5L1I A;  3V7K A;  7ICE A;  3UXN A;  1DGS A;  4CCH A;  4KLO A;  4DFK A;  4B9L A;  3V6J A;  4UB5 A;  2Y1J A;  3KHR A;  5KT3 A;  3BQT A;  4O3N A;  4Z6E A;  4Q8F A;  3NGD A;  2HHS A;  2M9N A;  3N97 B;  2AU0 A;  3EPG A;  3PW0 A;  4IR9 A;  4YR0 A;  5C5J A;  1HJP A;  2HHX A;  3QZ8 A;  5KG1 A;  1S0O A;  4ELU A;  5KFQ A;  3RAQ A;  3ZDA A;  5IIO A;  4RZR A;  1ZQF A;  2A1J B;  4F2R A;  1NKE A;  3KHH A;  2ZUB A;  3HW8 A;  4M04 A;  3RJI A;  5IIN A;  2R8I A;  2KZ3 A;  1MQ3 A;  1BVS A;  3SV3 A;  3JPO A;  5EWE A;  1TAU A;  5DB7 A;  3T3F A;  3PML A;  4I2C A;  4EBD A;  5KG0 A;  5F9L A;  3RBE A;  4J9P A;  2BGW A;  4QZ9 A;  1NJZ A;  4LZG A;  4RQ3 A;  4KLU A;  4F5R A;  1D9F A;  4XQ8 A;  3K75 D;  2AQ4 A;  3OHB A;  4R8U A;  4YXM A;  1RYS A;  3ZDB A;  9ICF A;  3RJK A;  1D9D A;  4GXJ A;  3EZ5 A;  2ASJ A;  7ICI A;  8ICT A;  5J0R A;  1TK0 A;  7ICH A;  1ZQH A;  5J0Q A;  3PMN A;  4IQW A;  3JPN A;  2BCR A;  2PFO A;  5IIJ A;  4DOA A;  4RQ7 A;  4EEY A;  4KLG A;  3ZDD A;  4Z6F A;  4KLQ A;  2FLL A;  4PPX A;  3RRH A;  4RQ6 A;  1SL0 A;  3T5K A;  2C2E A;  3MR3 A;  4PHA A;  3MFI A;  2BDP A;  4DO9 A;  4QW8 A;  5DLG A;  3OJS A;  2GWS A;  4GXK A;  4M9H A;  2ZJ8 A;  4DFJ A;  1S9F A;  3M9O B;  5DG7 A;  7ICS A;  1BPD A;  4ED0 A;  1UT8 A;  5J0Y A;  4O3O A;  3G6Y A;  4F8R A;  2FMP A;  2JEI A;  3RJH A;  9ICP A;  4JWN A;  2BCS A;  5EWG A;  5J2B A;  4J9S A;  1ZJM A;  3HT3 A;  1COO A;  1S0V A;  1CEZ A;  1NK7 A;  8ICK A;  5KG6 A;  5IIM A;  4ED6 A;  1RYR A;  1ZQP A;  4ZH4 A;  5KFH A;  1BPE A;  2FMQ A;  4F4Z A;  4I2G A;  2KTQ A;  5DB6 A;  2HW3 A;  4ECW A;  1KFS A;  7ICJ A;  4DF8 A;  5KFV A;  3TI0 A;  1S10 A;  4KLJ A;  2BPC A;  5L9X A;  2ASL A;  2JEG A;  4F3O A;  4NLG A;  1BGX T;  1S0N A;  1U9L A;  1TV9 A;  3RB4 A;  1ZQK A;  2PI5 A;  9ICM A;  3BJY A;  9ICG A;  3GIJ A;  2W9C B;  4F4K A;  2AGP A;  4I28 A;  3C1Z A;  3KHG A;  4DF4 A;  1XSP A;  3NTU A;  3QZ7 A;  1NJX A;  4JV1 A;  3H4B A;  7ICG A;  3C2M A;  4J9R A;  1NKB A;  7ICP A;  4QWA A;  3OJU A;  1BPY A;  4YP3 A;  5DLF A;  4O5C A;  3GIM A;  3SYZ A;  5KFY A;  4QZD A;  4J9L A;  3Q8L A;  2KN7 A;  3ISD A;  5CWR A;  5KG5 A;  8ICC A;  5CP2 A;  4YQW A;  3MBY A;  3EPI A;  4C8K A;  7ICU A;  5DB9 A;  3RBD A;  4IRK A;  1L5U A;  5L1J A;  2BQ3 A;  1L3U A;  3B0X A;  3Q8Q B;  4M0A A;  3C2K A;  2V4Q A;  1N48 A;  1S77 D;  2C22 A;  7ICQ A;  1ARO P;  9ICW A;  2W8L A;  4O3Q A;  2W9A A;  2ATL A;  4KLT A;  5D46 A;  2C2D A;  5CA7 A;  3TFR A;  4F4Y A;  3IM1 A;  5DBC A;  5DQH A;  3RJE A;  5KFL A;  4UAY A;  1KRP A;  4NLN A;  1NJW A;  2KZZ A;  4M6W B;  5CR0 A;  4UB2 A;  2ZUC A;  1ZQJ A;  1ZQV A;  4E0D A;  5J0U A;  5L1K A;  2I1Q A;  5TZV A;  5J2A A;  1C7Y A;  3PX4 A;  1B43 A;  4DFM A;  4ED8 A;  7ICO A;  4MEX A;  4O3P A;  4Q8E A;  4QZB A;  5KFD A;  5KT6 A;  1L3T A; 
#chains in the Genus database with same CATH topology
 1A76 A;  2G08 A;  4C0Z A;  1WYG A;  4DOB A;  3WK7 A;  5KFI A;  4KLM A;  1LB2 B;  4JMU A;  4C80 A;  1PK1 B;  1F44 A;  4UAT A;  1ZQD A;  9ICI A;  4BDP A;  2F44 A;  1KW4 A;  3WKA A;  3H7I A;  8ICI A;  1ZD5 A;  5T14 A;  4UBC A;  3UQ0 A;  4IQT A;  3ETL A;  3BS7 A;  3LK9 A;  2JRZ A;  1PVQ A;  2Q0Z X;  7ICL A;  2BCU A;  3A0B U;  9ICL A;  2VA8 A;  3PX0 A;  1NKC A;  1L7M A;  2JZB A;  5J0S A;  2K4H A;  3ZDE A;  2VA3 A;  2F76 X;  4FS2 A;  4DSF A;  2LM1 A;  4ECX A;  4M9N A;  4YVZ A;  2XGQ A;  2ZIV B;  2ODG A;  2XI9 A;  2FLP A;  8ICM A;  2UVV A;  8ICL A;  2MU2 A;  2YY6 A;  5ALP A;  5KG3 A;  3IG5 A;  3Q8K A;  3ZDC A;  3NAS A;  2KJ9 A;  4DSL A;  2HVI A;  5IIL A;  1ZQB A;  8ICP A;  3PSP A;  3FYH A;  2JR5 A;  3H0L B;  3PNC A;  1RZT A;  4I2A A;  2XY6 A;  1ECW A;  2I9G A;  3OPX A;  2WF8 A;  4YD2 A;  3ISB A;  1Q3V A;  4B9M A;  3ISC A;  2QKQ A;  3AM9 A;  3IP4 B;  1T4G A;  4UB4 A;  1NK6 A;  1X66 A;  4ECR A;  3ZI4 A;  1X40 A;  8ICW A;  4RQ1 A;  1RYU A;  1ZQI A;  2LHT A;  4EX7 A;  1B22 A;  4Y2Q A;  2OCE A;  3SI8 A;  4GIB A;  5ALM A;  5AI0 A;  3FDS A;  1BPX A;  3MGH A;  2HHT A;  9ICC A;  5D49 A;  3RJF A;  3PSF A;  2AHO B;  3ORY A;  2WF7 A;  3E58 A;  2HHW A;  2ISP A;  9ICS A;  4QWD A;  1X6I A;  4FBU A;  1JIH A;  9ICX A;  1YZ7 A;  3TAN A;  5JRT A;  2KSO A;  2J6T A;  4R64 A;  3BZC A;  2NO5 A;  4P4O A;  2HBM A;  1PVR A;  2HHQ A;  1K1Q A;  5J2K A;  3PST A;  3HKZ C;  3LVV A;  4I29 A;  2D6F C;  4EYI B;  2RDJ A;  3GII A;  2OHF A;  1QSS A;  4TUR A;  4NY8 A;  3GV7 B;  3MR2 A;  4P0Q A;  2PFP A;  3V7J A;  4KLS A;  4QZF A;  1J2M A;  4K4H A;  1UA1 A;  5A0L A;  4F4W A;  4ACO A;  3RR8 A;  1WCN A;  1Z19 A;  3QEB Z;  4B9U A;  3QUB A;  8ICE A;  3I76 A;  2PKE A;  2FE9 A;  5KG4 A;  3M8S A;  5HHI A;  1YZ6 A;  1JUD A;  2HBJ A;  1L8O A;  2CN1 A;  1SIJ A;  4YCX A;  3S6J A;  5EWF A;  2YMQ A;  5ALJ A;  4UB3 A;  1NZP A;  4DL4 A;  4DEZ A;  3QUT A;  5AKX A;  2H3F A;  2LYA A;  2KJ5 A;  1S0M A;  4UB8 U;  1ZQU A;  4IC9 A;  4ECY A;  1NK4 A;  4PGX A;  2Y0S C;  8ICJ A;  3UXP A;  2H3Q A;  4RPX A;  3AL0 B;  1L7N A;  8ICY A;  1IV8 A;  4EEK A;  2MA1 A;  3IV6 A;  3IDW A;  4IL6 U;  2B21 A;  1PK1 A;  5KFT A;  3GV8 B;  3ZD9 A;  2G5H B;  2IBK A;  4RUA A;  2HVH A;  5IIK A;  4Z6C A;  2K8A A;  8ICV A;  1VDV A;  1SKR A;  4DWI A;  4CNQ A;  1U49 A;  1U47 A;  1TK8 A;  3MGI A;  5EE1 A;  1ZQG A;  1XU4 A;  4CF3 A;  4JWM A;  4YN4 A;  4RUC A;  2JXJ A;  3JPT A;  3EYZ A;  2Y9U A;  3GV5 B;  1RXV A;  4LZD A;  9ICO A;  2MRL A;  9ICK A;  3RH6 A;  3M8R A;  5BOL A;  2AH5 A;  3M9N B;  9ICJ A;  4QW9 A;  2HDO A;  1BPB A;  1JMS A;  2G06 A;  2ZIV A;  5KFK A;  2AGQ A;  2JMG A;  4JB3 A;  1TFR A;  1CUK A;  4YR2 A;  2FDR A;  5HMM A;  2RRD A;  4I27 A;  4OJ6 A;  3FC4 A;  4PZO A;  2H5X A;  4EX6 A;  5J0X A;  2XGP A;  3PW5 A;  4KTQ A;  4M9G A;  4F5P A;  3T5L A;  4TUP A;  1WCL A;  4NXZ A;  2PFQ A;  2CXY A;  5KT4 A;  4FE3 A;  5KFX A;  2C2R A;  4QZ8 A;  5C0Y A;  2G09 A;  1ZQT A;  4DS5 A;  4B9V A;  5J0P A;  1L7O A;  3V6H A;  1QSY A;  1L6N A;  4F5Q A;  2JGA A;  3SAG A;  4I2J A;  4R65 A;  2FJ6 A;  3KHL A;  3RB6 A;  1NK9 A;  4B9S A;  4UW9 A;  4I2D A;  2M0N A;  5J8Y C;  3Q8S B;  4ECZ A;  5AM5 A;  2VIX A;  2HBK A;  2KHV A;  4P2H A;  5L1I A;  7ICE A;  3ETR A;  5ALW A;  4AP9 A;  4DFK A;  4UB5 A;  3IN5 A;  2Y1J A;  4Q8F A;  2IOF K;  5C5J A;  5AHX A;  4Y2X A;  3M6K A;  5KG1 A;  3CYM A;  5KFQ A;  3ZDA A;  5IIO A;  3C29 A;  1FFU A;  2A1J B;  2K8B B;  3HW8 A;  5IIN A;  1MQ3 A;  2KZ3 A;  3NRW A;  1UPH A;  4US9 A;  4UAR A;  5DB7 A;  3T3F A;  3RBE A;  1N2X A;  1ZD3 A;  4RQ3 A;  4UAS A;  4XQ8 A;  3K75 D;  3SQI A;  1C20 A;  9ICF A;  3RJK A;  4GXJ A;  3EZ5 A;  5J0R A;  1TK0 A;  3PMN A;  2JH1 A;  4DOA A;  1J97 A;  1SL0 A;  3MR3 A;  3MFI A;  1NNL A;  5DLG A;  3OJS A;  4GXK A;  1J2N A;  4DFJ A;  3LVW A;  4ED0 A;  3G6Y A;  1TE2 A;  5J2B A;  4J9S A;  1COO A;  8ICK A;  1NK7 A;  1ZQP A;  3O0F A;  2KMD A;  4F4Z A;  4I2G A;  2WF9 A;  3NS1 A;  3KBB A;  3NVY A;  4ECW A;  3TI0 A;  1U9L A;  1TV9 A;  4F4K A;  3C28 A;  5ALO A;  1XO0 A;  3OJU A;  3N7P D;  2XID A;  2XVT A;  4O5C A;  3SYZ A;  4QZD A;  3Q8L A;  3SEI A;  2KN7 A;  4UAV A;  4YQW A;  4PL1 A;  5DB9 A;  3RBD A;  4FZM A;  4IRK A;  3T79 A;  5ALN A;  2DQN B;  3B0X A;  1N48 A;  1RQN A;  1S77 D;  7ICQ A;  2ATL A;  2C2D A;  2NYV A;  1FFV A;  2KZZ A;  2W55 A;  2ZUC A;  1ZQJ A;  4E0D A;  5L1K A;  4OJP A;  1C7Y A;  3PX4 A;  1B43 A;  4DFM A;  7ICO A;  4USA A;  4J9P A;  1L3T A;  2DKX A;  2R8J A;  1ZQO A;  1ZQM A;  1ZQS A;  4QIW F;  1ZQE A;  4K4G A;  5KFE A;  3G6V A;  5EE3 A;  4RT2 A;  3RR7 A;  3IHQ B;  5DDY A;  5KFN A;  2G5I B;  1T7P A;  2VKQ A;  4PGY A;  1X9M A;  4J9M A;  4PGQ A;  3GZF A;  2VAN A;  3BQ2 A;  4TUQ A;  4YXJ A;  1X2I A;  1QSL A;  5ALF A;  5J2F A;  2NV3 A;  1O03 A;  1QCK A;  4Y2S A;  4TQS A;  8ICB A;  4XRH A;  3EUB 2;  5KT7 A;  1RDF A;  2DFL A;  2ASD A;  8ICU A;  2B6G A;  2V4R A;  5AIC A;  1Q3U A;  4QWB A;  5J2C A;  2FPL A;  8ICF A;  1SV0 A;  5GTI U;  8ICZ A;  5KTQ A;  4BWJ A;  2ZXI A;  3F2D A;  2BCQ A;  4F71 A;  4ED3 A;  3C1Y A;  2CRX A;  2W7P A;  2RHF A;  3RH5 A;  2J6S A;  5DGA A;  4Y2Y A;  4C8L A;  3HWT A;  7ICT A;  2IHN A;  8ICA A;  1RG6 A;  1X9S A;  5FP0 A;  2I6X A;  4OJO A;  1AQ6 A;  5KFP A;  5KNI A;  2QB1 A;  2WF5 A;  1MA7 A;  1ZQN A;  1JXE A;  1JN3 A;  2N1R A;  1OUQ A;  1KEJ A;  2A1J A;  1NK0 A;  5BPC A;  1XC9 A;  4KLL A;  5KFO A;  5B66 U;  4ECV A;  2WAQ F;  2IOH A;  4DL7 A;  2GH1 A;  9ICA A;  3OTQ A;  3UXO A;  5CHG A;  2LYB A;  5J2H A;  2ZIW B;  3QU7 A;  3BQ0 A;  1X9W A;  4ZOH C;  5KFC A;  2PMZ C;  3K1R B;  5KT5 A;  4DOC A;  5HP4 A;  5ALT A;  3SV4 A;  2VJ4 A;  1ZQW A;  2EAP A;  3Q8M A;  3LWM A;  5DG8 A;  4ELV A;  1JX4 A;  4C7Z A;  2EZY A;  3TFS A;  1V97 A;  5AK6 A;  1XSL A;  5AIB A;  4NWI A;  3RH4 A;  3F2C A;  2IA6 A;  3B0Y A;  4F72 A;  4UAU A;  4ELT A;  2HHU A;  2KKV A;  2VJ5 A;  2F3N A;  3E0F A;  4Y2P A;  3RJJ A;  4LVS A;  1TKD A;  4R8U B;  4UAW A;  4DSE A;  2E3T A;  3PO5 A;  4P0P B;  5ALR A;  5E79 U;  4EBC A;  2QB0 B;  4QZC A;  4RPY A;  5AI4 A;  2ISO A;  4RQ8 A;  4JV0 A;  3Q8R B;  2FLN A;  7ICF A;  1LKY B;  3JPP A;  1DXS A;  4PL2 A;  2FPK A;  4Y2T A;  3D6J A;  4O3M A;  4KLD A;  4RQ0 A;  3RB0 A;  2JEJ A;  2FI1 A;  4B9N A;  2K89 A;  1WWV A;  2YN4 A;  1Z4O A;  2K4E A;  5H2F U;  5KT2 A;  3D2N A;  2FMS A;  3OSN A;  4J9Q A;  3UPQ A;  3PO4 A;  4IR1 A;  4RQ4 A;  3QXG A;  4I2I A;  1SKW A;  8ICX A;  1N56 A;  1KFT A;  3Q8P B;  4PHD A;  4B9T A;  3UMB A;  4F5O A;  4O0I A;  2P6R A;  2KFZ A;  2W43 A;  4FFD A;  2RP5 A;  4NL9 A;  2RDI A;  2Z7J A;  1BPZ A;  1QLN A;  4MFA A;  3BQ7 A;  2KG5 A;  5ALZ A;  4K4I A;  7ICV A;  2EDU A;  4QZA A;  9ICT A;  2OWO A;  1Q46 A;  2XY5 A;  2KIV A;  4DQP A;  2H3Z A;  1WG8 A;  2BPG A;  2NRT A;  1ZJN A;  3PVX A;  7ICN A;  3BS5 B;  2DUY A;  2NRV A;  5L1M A;  3VCB A;  4DL6 A;  4DS4 A;  3MR6 A;  4YD1 A;  4KLF A;  5DGB A;  1XWL A;  4KLE A;  1S76 D;  5ALD A;  4O5E A;  3ONN A;  2LYH A;  4Q43 A;  1MSW D;  1KN5 A;  2ZJ5 A;  3NVV A;  3HPO A;  5KFZ A;  5AM4 A;  5CJ7 A;  4R66 A;  1ZQQ A;  3PR5 B;  4C8N A;  4EZ6 A;  3AMZ A;  2KP7 A;  4BXO B;  3T5J A;  2MUT B;  4DSI A;  4TUS A;  3L5K A;  2PFN A;  4PHE A;  1VLB A;  3PW4 A;  2DPI A;  3N4M B;  5J0T A;  2Y1I A;  3ED5 A;  5JTI A;  3MGV A;  2AGO A;  3M9M B;  2QAR B;  4RT3 A;  4ECQ A;  2ZIW A;  4Q45 A;  5KFM A;  5EE0 A;  5AKE A;  1SL1 A;  3MR5 A;  5TIS U;  2DKZ A;  3UXN A;  1DGS A;  4U6P A;  3K1Z A;  2EAM A;  4B9L A;  3V6J A;  5KT3 A;  4Z6E A;  2HHS A;  3PW0 A;  3KZI U;  1SB3 C;  4C4S A;  1PK3 A;  4ELU A;  2Y0S F;  4RZR A;  4F2R A;  2YMP A;  5KL8 B;  3KHH A;  3SAH A;  4M04 A;  3RJI A;  2MSN A;  3SV3 A;  3PML A;  5AM3 A;  4EBD A;  5F9L A;  2BGW A;  5G5H A;  4LZG A;  4KLU A;  3R9K A;  4F5R A;  3QU4 A;  4R8U A;  4P0P A;  2LI6 A;  7ICI A;  5AI6 A;  2W7O A;  2LKY A;  3IRU A;  2QB0 A;  3WKD A;  4RQ7 A;  4EEY A;  4HAI A;  4KLG A;  3RRH A;  2C2E A;  4DO9 A;  3M9O B;  5DG7 A;  1UQV A;  5AI5 A;  1LKY A;  1UT8 A;  5J0Y A;  4O3O A;  2FMP A;  2JEI A;  9ICP A;  5AK5 A;  2BCS A;  2JHD A;  5KG6 A;  1A6S A;  5IIM A;  1RYR A;  3I28 A;  4ZH4 A;  2FMQ A;  4AYB C;  2OH2 A;  2KOB A;  5KFV A;  1BNP A;  3KOO A;  2ASL A;  3IG8 A;  1JRP A;  2DBY A;  1BGX T;  1S0N A;  3KKA C;  4FZL A;  2PI5 A;  9ICG A;  3BJY A;  2W9C B;  3KD3 A;  4DF4 A;  3NTU A;  1NJX A;  2O6K A;  4JV1 A;  2E8P A;  5AKY A;  7ICP A;  4QWA A;  5DLF A;  3GIM A;  2OM6 A;  8ICC A;  3BZK A;  3MBY A;  2E1E A;  2HOF A;  5L1J A;  2YMM A;  4M0A A;  2V4Q A;  4O3Q A;  2LBO A;  4KLT A;  1CRX A;  5D46 A;  5CA7 A;  3TFR A;  4F4Y A;  3N28 A;  1NJW A;  4ED8 A;  3NRZ A;  1ED1 A;  4O3P A;  1GO3 F;  1HEK A;  4RQM A;  4QZB A;  5KT6 A;  1IXR A;  4ECU A;  1TK5 A;  1QTM A;  4C4R A;  4X5V A;  1Z3E B;  3BS5 A;  1PVP A;  4DL5 A;  1X9X A;  2VA2 A;  1L3S A;  4DLE A;  2RLT A;  3TAD C;  4FZN A;  8ICS A;  3RAX A;  2WB1 C;  4ECT A;  2KVS A;  3G6X A;  2ZIX B;  4DQS A;  2HOI A;  4MFC A;  3TQ1 A;  3D2S A;  5ALL A;  4QJF B;  3QX7 A;  1QQ7 A;  2F8L A;  1QQ6 A;  1TAQ A;  3T5H A;  4ICA A;  4OCZ A;  2AQ0 A;  4O3R A;  5DG9 A;  3AU2 A;  1SL2 A;  4BXO A;  4QWC A;  2RQ5 A;  4YMM A;  2NRW A;  2MUT A;  5B5E U;  4IS7 A;  4NM2 A;  4DQI A;  2UVR A;  4O3S A;  4MF2 A;  5EE9 A;  3V6K A;  4KN7 A;  3WK6 A;  2QAR A;  1FEZ A;  2KVC A;  2W9B B;  2R8H A;  1IM4 A;  4KX3 A;  4J9K A;  1F0M A;  2DGZ A;  1PZN A;  2R8K A;  3MDA A;  1D8L A;  2HHV A;  3OHA A;  2DWQ A;  4UBB A;  4DCC A;  2KFN A;  5AM2 A;  4RNO A;  2W54 A;  3OSP A;  5DBA A;  5J0W A;  3JPR A;  3TAQ A;  4GXI A;  3TAR A;  3L4P A;  1ZET A;  4NLB A;  9ICE A;  2YML A;  3HRD D;  5J0O A;  4F50 A;  4JK1 A;  4WJ3 B;  3QEA Z;  2KD1 A;  4DLG A;  4C4T A;  3V72 A;  4DSJ A;  2A3V A;  2P66 A;  5KFA A;  5HML A;  3QUQ A;  4XA5 A;  3QU5 A;  1XSN A;  1SZP A;  2XIC A;  4CDG A;  2ZTC A;  1X6J A;  4MEY A;  5DBB A;  4QZI A;  2YB4 A;  5HNK A;  2DPJ A;  1NK5 A;  3PY8 A;  1Y88 A;  1KSP A;  2BHN A;  4DQR A;  3F53 A;  5ALG A;  2KNJ A;  2BQU A;  4O5K A;  5EOZ A;  8ICG A;  3KZX A;  4EEL A;  4KMU A;  2G07 A;  5J8Y A;  4C8O A;  4O9M A;  2IHM A;  2YTU A;  2JH7 A;  1JI7 A;  5KG2 A;  1ZQY A;  4DFD A;  5DQI A;  5III A;  3BQ1 A;  3EW9 A;  4B6J A;  4ED1 A;  1SXE A;  2IMW P;  3WKC A;  5DQG A;  3KFU F;  2NO4 A;  1NZB A;  2WTF A;  4PHP A;  2HOQ A;  2W9C A;  1COK A;  3MFH A;  2XY7 A;  2F1H A;  2E8N A;  1LVH A;  4YMN A;  5ALX A;  4BJQ A;  3CW2 C;  2HI0 A;  4GC7 A;  4KIT B;  5KFW A;  2V9W A;  4M47 A;  4FS1 A;  4NLZ A;  4YMO A;  5G5G A;  5J2J A;  4RQ2 A;  4QIW C;  1NJY A;  1TVA A;  2K4P A;  2KZM A;  2JV3 A;  4GC6 A;  4F5N A;  1U45 A;  1Z1V A;  2EAO A;  3SZ2 A;  1DGJ A;  3NVW A;  3U26 A;  2J6U A;  2CPR A;  1NI3 A;  5AK4 A;  3GQC A;  1T3Q A;  3RF9 A;  1MQ2 A;  1ZYQ A;  3DDH A;  5KG7 A;  4R63 A;  1ZD4 A;  4I2H A;  1F5S A;  2ZIX A;  4C8M A;  2XCP A;  4F93 B;  3UQ2 A;  4ED7 A;  1SZH A;  2F1I A;  4FO6 A;  3C5F A;  1B0X A;  3MC1 A;  3GDX A;  2KEY A;  2KJ8 A;  1FO4 A;  2F2A B;  1ZOL A;  2BPF A;  1V85 A;  1T8E A;  1YT3 A;  5HHH A;  1NOM A;  4M2Y A;  2W11 A;  4U7C A;  5AIA A;  4DL3 A;  1XO1 A;  1MC8 A;  4F91 B;  3WKB A;  5KFB A;  1S5L U;  1SWW A;  2E8M A;  2UVW A;  1T94 A;  2ALZ A;  4P0Q B;  2KKP A;  7ICR A;  4DL2 A;  5K4L A;  5AKL A;  1UT5 A;  3H8S A;  5JUM A;  2W9B A;  5HR7 A;  2ZJA A;  2F77 X;  5KFG A;  1A77 A;  2EH9 A;  3C2L A;  2LMR A;  3WKE A;  4I2E A;  1L3V A;  1MN8 A;  1UA0 A;  9ICU A;  2UVU A;  3RRG A;  4BGD A;  2MAX A;  2ZIU B;  3SD7 A;  1N5X A;  1IIP A;  2BQR A;  2K4I A;  4G9B A;  4QZH A;  3F2B A;  4YG2 A;  2B0C A;  4UAZ A;  3C5G A;  5L1L A;  9ICQ A;  4FBT A;  4NM1 A;  5AKG A;  3GU3 A;  5D4B A;  1Z00 B;  1QH9 A;  9ICB A;  3TKA A;  4NJ8 A;  4CCH A;  4KLO A;  3KHR A;  2K8C B;  2M9N A;  2H3V A;  4IR9 A;  4YR0 A;  1HJP A;  2HHX A;  1L8L A;  3QZ8 A;  2YB1 A;  3QU2 A;  2D3D A;  3RAQ A;  1X42 A;  2E1F A;  5AKJ A;  1NKE A;  3J81 j;  1TAU A;  3JPO A;  2L5Y A;  5EWE A;  5KG0 A;  4NLC A;  4QZ9 A;  1VJ5 A;  1D9F A;  3SAF A;  5KAI U;  4PJ0 U;  2AQ4 A;  3OHB A;  4YXM A;  1SWV A;  3B9J A;  1D9D A;  8ICT A;  4J03 A;  7ICH A;  1ZQH A;  5J0Q A;  3JPN A;  2BCR A;  2KK0 A;  3WK9 A;  5AKZ A;  3ZDD A;  4Z6F A;  2FLL A;  2BDP A;  4M9H A;  7ICS A;  1V38 A;  1BPD A;  5EWG A;  4Y2R A;  1S0V A;  4RQN A;  4ED6 A;  1BPE A;  4US8 A;  5DB6 A;  2HW3 A;  4DF8 A;  1S10 A;  3LYS A;  4F3O A;  4CGZ A;  3GIJ A;  1XNS A;  1ZQ1 C;  3HKZ F;  3WK8 A;  2AGP A;  3C1Z A;  2OYY A;  3KHG A;  1XSP A;  4Y2U A;  3H4B A;  7ICG A;  5CEH A;  4J9R A;  1NKB A;  1RQL A;  1BPY A;  4J9L A;  5GTH U;  5CWR A;  4C8K A;  7ICU A;  2BQ3 A;  4OJ5 A;  3Q8Q B;  3C2K A;  2W3R A;  2C22 A;  2WHE A;  1ARO P;  3A0H U;  2W8L A;  2W9A A;  1WWU A;  5DQH A;  3RJE A;  4UAY A;  4NLN A;  4M6W B;  4UB2 A;  3N7S C;  5J0U A;  1URJ A;  3ALR A;  5J2A A;  2I5H A;  4Y2J A;  1FIQ A;  4Q8E A;  3CP8 A;  5KFD A;  2ES6 A;  1Q8K A;  1N60 A;  4F4X A;  1JXL A;  3MDC A;  2F8K A;  2GOL A;  1HIW A;  4DSK A;  1K1S A;  4CF5 A;  3FAH A;  5J2G A;  1KQQ A;  5DB8 A;  5DDM A;  3HIL A;  2PI4 A;  1ZQL A;  2ZUD A;  1DRG A;  3UM9 A;  5J2I A;  3QYP A;  2D8C A;  4F2S A;  4A8E A;  4XUS A;  5KFF A;  4I2B A;  4P4M A;  5KAF U;  2HCF A;  4QZE A;  1HUZ A;  2XC9 A;  1ZD2 P;  2H3I A;  3M1Y A;  2F1J A;  3PW7 A;  3PX6 A;  5KFJ A;  4CE6 A;  5CB1 A;  3HX0 A;  1B4F A;  1HUO A;  2HBL A;  2WFA A;  1D8Y A;  5J2E A;  2A1A A;  2ZIU A;  4KLH A;  1KFD A;  3AU6 A;  2R8G A;  2OEH A;  3EWA A;  5J29 A;  1JAL A;  5AM1 A;  4QWE A;  3RJG A;  4QNL A;  2HMX A;  4MF8 A;  1DK3 A;  9ICV A;  5ALY A;  3NUQ A;  1Z00 A;  4ED2 A;  4AYB F;  2C28 A;  4KMO B;  1SGG A;  2WF6 A;  3AQF A;  2XCA A;  1S97 A;  4J9N A;  4EZ9 A;  4OO1 J;  3TAP A;  3WU2 U;  1BNO A;  1IG6 A;  1H38 A;  4KN4 A;  3AN1 A;  4CF4 A;  4UB6 U;  5J2D A;  4KX5 A;  1EXN A;  4Y2V A;  4MHV A;  3JPQ A;  1SKS A;  4BWM A;  3KTQ A;  1XS9 D;  4G3I A;  3H40 A;  1U48 A;  2KE7 A;  1RXW A;  8ICO A;  2ZTE A;  3SMV A;  3H0R B;  1SXD A;  2OXO A;  4PH5 A;  2HSZ A;  1U4B A;  1N63 A;  1Z4N A;  1ZQX A;  4NLK A;  2Y9T A;  9ICR A;  2P35 A;  5DKW A;  2QLT A;  1L7P A;  3PSI A;  1A0P A;  1N5W A;  4KLJ A;  2PXI A;  1V9P A;  2LM4 A;  5AKI A;  2NRX A;  5KFS A;  2NRZ A;  4TQR A;  4MFF A;  3H0M B;  1ZRM A;  4M9L A;  2WB1 F;  1JRO A;  4YR3 A;  1ZQA A;  1CI4 A;  1KKX A;  4GFJ A;  2GO7 A;  3PV8 A;  4DFP A;  1KTQ A;  2BDU A;  5BOM A;  3F5A A;  3C23 A;  2BKE A;  4OJL A;  4BUG A;  2EZZ A;  4P4P A;  2P6U A;  4RPZ A;  3AQE A;  3BDP A;  3ZD8 A;  1KDH A;  4KLI A;  5ALS A;  4Q44 A;  3F5E A;  2K60 A;  4JUZ A;  2W8K A;  8ICR A;  1DOQ A;  2EZX A;  3WK5 A;  7ICM A;  4RNN A;  4YFK A;  5CRX A;  1ZXI A;  3PZP A;  4F92 B;  3D2Q A;  4GLX A;  4M9J A;  5F9N A;  2W04 A;  3GIL A;  9ICN A;  5KFR A;  3H8J A;  2BR0 A;  4ECS A;  3LDA A;  4JV2 A;  3LWL A;  2JEF A;  4IRD A;  5HR6 A;  5ALH A;  1QQ5 A;  4UB1 A;  2EAN A;  4M6W A;  3RTV A;  5JU5 A;  4LJX A;  3NVZ A;  3ICX A;  2BZF A;  4I2F A;  2W3S A;  8ICN A;  5ALV A;  1P7D A;  2BCV A;  3OGU A;  2W9M A;  1LV5 A;  1UHU A;  4J9O A;  4CRX A;  8ICH A;  2KV2 A;  3C21 A;  3K4G A;  5ALQ A;  1SV0 C;  4RU9 A;  9ICH A;  3JPS A;  4EBE A;  1NK8 A;  2KIC A;  3H8W A;  3AUO A;  3KKA A;  4C7Y A;  2LPE A;  5KL1 B;  1RPL A;  3GIK A;  3FM9 A;  3TAC B;  3MAB A;  4IQV A;  4RNM A;  1M6Y A;  4HYK A;  4RQ5 A;  4Z6D A;  2FPM A;  3GFK B;  1ZQR A;  1KLN A;  4OD0 A;  2A19 A;  3M7D A;  3VC8 A;  8ICQ A;  5KFU A;  3QE9 Y;  3DV9 A;  3PR4 A;  2EQY A;  5F3X B;  5AKH A;  1D8B A;  3H4D A;  1KBU A;  4DQQ A;  2AJQ A;  3PW2 A;  1UCV A;  3THV A;  1N61 A;  2W03 A;  2ZTD A;  4NV0 A;  4IQU A;  2XO7 A;  1DK2 A;  1ZQZ A;  4IRC A;  1OW5 A;  5ALE A;  2JZB B;  5AI9 A;  3TAD A;  4EYH B;  1ZRN A;  1K5O A;  4QZG A;  3V7L A;  5AK3 A;  1T3N A;  4BX9 C;  4UQG A;  1ZQC A;  7ICK A;  1RM6 C;  3HP6 A;  5AKK A;  3I1Y A;  2E5S A;  3E2E A;  3RB3 A;  2E8O A;  3V7K A;  5AM0 A;  3AEV A;  3BQT A;  4O3N A;  1TAM A;  3NGD A;  1O08 A;  3N97 B;  2AU0 A;  3EPG A;  1OXJ A;  2GLE A;  2R18 A;  3N7R C;  1S0O A;  3QU9 A;  2DF4 B;  1ZQF A;  2ZUB A;  2R8I A;  1BVS A;  5ALU A;  4I2C A;  3SEN A;  3HJE A;  1SV4 A;  3H8M A;  1NJZ A;  1WUD A;  1RYS A;  1N62 A;  3ZDB A;  1PUZ A;  2G0A A;  2ASJ A;  2ESE A;  2KIW A;  4IQW A;  2PFO A;  5IIJ A;  4PPX A;  4KLQ A;  4RQ6 A;  3T5K A;  1S8O A;  5AI8 A;  4PHA A;  4QW8 A;  2GWS A;  2ZJ8 A;  1Z1B A;  1S9F A;  2KSO B;  4F8R A;  2PMZ F;  3RJH A;  4JWN A;  3CRX A;  1ZJM A;  3HT3 A;  1CEZ A;  5KFH A;  3DEE A;  2KTQ A;  1KFS A;  7ICJ A;  2BPC A;  2IOF A;  5L9X A;  2JEG A;  2Q4T A;  4NLG A;  4NL9 C;  3QUC A;  3UMG A;  3RB4 A;  1ZQK A;  2DL0 A;  9ICM A;  4PZN A;  3L3F X;  3UMC A;  4I28 A;  3M6Z A;  3QZ7 A;  3CNH A;  3RFA A;  3C2M A;  4YP3 A;  5KFY A;  1KL9 A;  3ISD A;  5KG5 A;  5CP2 A;  2WAQ C;  3EPI A;  5ALK A;  1L5U A;  1L3U A;  5ALI A;  9ICW A;  2ZG6 A;  3QNM A;  2YX8 A;  2ZXH A;  2KHQ A;  3IM1 A;  5DBC A;  2AXT U;  5KFL A;  1KRP A;  5CR0 A;  1ZQV A;  3SR6 A;  2I1Q A;  4EEN A;  5TZV A;  2YQE A;  4MEX A;  3WK4 A; 
#chains in the Genus database with same CATH homology
 1A76 A;  1IXR A;  4F4X A;  4ECU A;  3MDC A;  1TK5 A;  1JXL A;  1ZQO A;  2R8J A;  4DSK A;  1QTM A;  4X5V A;  1K1S A;  1ZQM A;  4DOB A;  1ZQS A;  1Z3E B;  1ZQE A;  5KFI A;  5J2G A;  2PI4 A;  5DB8 A;  5DDM A;  1LB2 B;  5KFE A;  3G6V A;  4DL5 A;  1ZQL A;  2ZUD A;  4K4G A;  4RT2 A;  3RR7 A;  2VA2 A;  3IHQ B;  1ZQD A;  5DDY A;  9ICI A;  5KFN A;  5J2I A;  1L3S A;  4DLE A;  4BDP A;  1T7P A;  8ICS A;  3RAX A;  4F2S A;  4PGY A;  4ECT A;  4XUS A;  1X9M A;  5KFF A;  3G6X A;  4J9M A;  4I2B A;  4P4M A;  4PGQ A;  3H7I A;  4DQS A;  8ICI A;  2VAN A;  4QZE A;  4UBC A;  4TUQ A;  3BQ2 A;  3UQ0 A;  1HUZ A;  4MFC A;  4YXJ A;  1X2I A;  3TQ1 A;  2XC9 A;  1QSL A;  5J2F A;  4IQT A;  2F1J A;  3ETL A;  3PW7 A;  3PX6 A;  5KFJ A;  3LK9 A;  5CB1 A;  3HX0 A;  1HUO A;  4TQS A;  8ICB A;  1TAQ A;  4XRH A;  3T5H A;  2Q0Z X;  7ICL A;  2AQ0 A;  4O3R A;  5KT7 A;  5DG9 A;  3AU2 A;  2DFL A;  2ASD A;  2BCU A;  1D8Y A;  8ICU A;  2V4R A;  9ICL A;  2VA8 A;  3PX0 A;  5J2E A;  1NKC A;  4QWB A;  1SL2 A;  2JZB A;  5J0S A;  5J2C A;  2FPL A;  4BXO A;  8ICF A;  4QWC A;  4KLH A;  8ICZ A;  5KTQ A;  4BWJ A;  1KFD A;  3AU6 A;  3ZDE A;  4YMM A;  2R8G A;  2VA3 A;  2NRW A;  5J29 A;  2MUT A;  3EWA A;  2BCQ A;  4FS2 A;  4DSF A;  4ECX A;  4ED3 A;  3C1Y A;  4NM2 A;  4QWE A;  4M9N A;  4DQI A;  2UVR A;  4O3S A;  4YVZ A;  3RJG A;  2XGQ A;  4MF2 A;  2J6S A;  3RH5 A;  5DGA A;  4MF8 A;  3V6K A;  4KN7 A;  4C8L A;  3HWT A;  9ICV A;  2W9B B;  1Z00 A;  2R8H A;  4ED2 A;  1IM4 A;  2C28 A;  7ICT A;  2IHN A;  2FLP A;  8ICM A;  4J9K A;  8ICA A;  1X9S A;  1PZN A;  2R8K A;  2UVV A;  2XCA A;  3MDA A;  1S97 A;  1D8L A;  3Q8K A;  5KG3 A;  8ICL A;  4J9N A;  2HHV A;  3ZDC A;  4EZ9 A;  3OHA A;  4DSL A;  2HVI A;  5IIL A;  5KFP A;  1ZQB A;  8ICP A;  4UBB A;  3TAP A;  3FYH A;  3PNC A;  1RZT A;  4I2A A;  2KFN A;  4RNO A;  1ZQN A;  2XY6 A;  1H38 A;  1JXE A;  4KN4 A;  1JN3 A;  2I9G A;  3OSP A;  5J2D A;  5DBA A;  5J0W A;  3JPR A;  1EXN A;  4YD2 A;  3ISB A;  3TAQ A;  1KEJ A;  4B9M A;  3ISC A;  2A1J A;  1NK0 A;  4GXI A;  5BPC A;  3JPQ A;  3TAR A;  4BWM A;  1XC9 A;  1SKS A;  3KTQ A;  1XS9 D;  5KFO A;  4KLL A;  1ZET A;  4G3I A;  4ECV A;  3H40 A;  1T4G A;  4UB4 A;  1U48 A;  1NK6 A;  4DL7 A;  4ECR A;  9ICA A;  1RXW A;  3UXO A;  8ICO A;  4RQ1 A;  8ICW A;  5CHG A;  9ICE A;  5J0O A;  4F50 A;  4JK1 A;  2ZTE A;  1ZQI A;  3QEA Z;  4PH5 A;  1B22 A;  5J2H A;  3SI8 A;  4DLG A;  1U4B A;  3BQ0 A;  1X9W A;  5KFC A;  4DSJ A;  3V72 A;  2P66 A;  5KFA A;  1ZQX A;  3FDS A;  5HML A;  1BPX A;  4NLK A;  3MGH A;  2HHT A;  9ICR A;  4XA5 A;  5DKW A;  1XSN A;  1SZP A;  9ICC A;  5D49 A;  3RJF A;  2ZTC A;  5KT5 A;  4DOC A;  5HP4 A;  4MEY A;  3ORY A;  5DBB A;  4QZI A;  2HHW A;  5HNK A;  2DPJ A;  1NK5 A;  3SV4 A;  2ISP A;  9ICS A;  4QWD A;  3PY8 A;  4FBU A;  1JIH A;  9ICX A;  3TAN A;  1Y88 A;  1ZQW A;  2PXI A;  1V9P A;  1KSP A;  2BHN A;  4DQR A;  3Q8M A;  4R64 A;  2J6T A;  3LWM A;  4P4O A;  5DG8 A;  4ELV A;  2NRX A;  5KFS A;  1JX4 A;  2BQU A;  2NRZ A;  5EOZ A;  3TFS A;  4TQR A;  4O5K A;  8ICG A;  2HHQ A;  4KMU A;  4C8O A;  4MFF A;  1XSL A;  1K1Q A;  5J2K A;  3RH4 A;  2IA6 A;  4O9M A;  2IHM A;  3B0Y A;  5KG2 A;  1ZQY A;  4M9L A;  4I29 A;  4EYI B;  5DQI A;  4YR3 A;  4ELT A;  5III A;  3BQ1 A;  1ZQA A;  3EW9 A;  2RDJ A;  4ED1 A;  2HHU A;  3GII A;  3RJJ A;  4LVS A;  1QSS A;  4TUR A;  3PV8 A;  2IMW P;  4DFP A;  1KTQ A;  4R8U B;  4UAW A;  4DSE A;  1TKD A;  4NY8 A;  3PO5 A;  5BOM A;  3C23 A;  5DQG A;  2BKE A;  3GV7 B;  3MR2 A;  2WTF A;  4PHP A;  4P4P A;  4EBC A;  2PFP A;  2P6U A;  4RPZ A;  2W9C A;  3V7J A;  3MFH A;  2XY7 A;  4KLS A;  2F1H A;  4QZC A;  3ZD8 A;  3BDP A;  4RPY A;  1KDH A;  4QZF A;  2ISO A;  4YMN A;  4RQ8 A;  4K4H A;  4JV0 A;  1UA1 A;  4F4W A;  4KLI A;  3Q8R B;  4Q44 A;  2FLN A;  4JUZ A;  7ICF A;  2W8K A;  3RR8 A;  8ICR A;  1DOQ A;  3JPP A;  1WCN A;  4GC7 A;  3QEB Z;  4B9U A;  4KIT B;  7ICM A;  4RNN A;  8ICE A;  4YFK A;  5KFW A;  2FPK A;  2V9W A;  5KG4 A;  4F92 B;  4M47 A;  4FS1 A;  4NLZ A;  4GLX A;  4M9J A;  5F9N A;  4YMO A;  3GIL A;  3M8S A;  5HHI A;  9ICN A;  4KLD A;  4RQ0 A;  5KFR A;  3RB0 A;  2JEJ A;  3H8J A;  4B9N A;  4YCX A;  5J2J A;  3LDA A;  4ECS A;  5EWF A;  4UB3 A;  2BR0 A;  4RQ2 A;  4JV2 A;  4DL4 A;  3LWL A;  1NJY A;  1TVA A;  2JEF A;  4DEZ A;  4IRD A;  2KZM A;  4UB1 A;  4GC6 A;  4F5N A;  1U45 A;  4M6W A;  3RTV A;  5KT2 A;  2FMS A;  3SZ2 A;  3OSN A;  4J9Q A;  3UPQ A;  3PO4 A;  4IR1 A;  4RQ4 A;  2J6U A;  1S0M A;  4I2I A;  1SKW A;  8ICN A;  4I2F A;  1ZQU A;  3GQC A;  4ECY A;  1NK4 A;  4PGX A;  2BCV A;  3OGU A;  8ICJ A;  3UXP A;  4RPX A;  2W9M A;  1LV5 A;  8ICY A;  1MQ2 A;  1ZYQ A;  8ICX A;  4J9O A;  1N56 A;  8ICH A;  3C21 A;  1KFT A;  2B21 A;  5KG7 A;  5KFT A;  3Q8P B;  4R63 A;  3ZD9 A;  3GV8 B;  3K4G A;  4PHD A;  4B9T A;  2IBK A;  4RUA A;  4I2H A;  4RU9 A;  4O0I A;  4F5O A;  2HVH A;  3JPS A;  4EBE A;  2P6R A;  2KFZ A;  9ICH A;  5IIK A;  4C8M A;  2XCP A;  1NK8 A;  3H8W A;  4Z6C A;  4F93 B;  3UQ2 A;  4ED7 A;  8ICV A;  4FO6 A;  2F1I A;  2RDI A;  3AUO A;  1SKR A;  3C5F A;  4DWI A;  1U49 A;  1BPZ A;  3GDX A;  1RPL A;  3GIK A;  4MFA A;  1U47 A;  1QLN A;  1TK8 A;  3MGI A;  3MAB A;  4IQV A;  4RNM A;  4HYK A;  2BPF A;  4RQ5 A;  4Z6D A;  2FPM A;  3GFK B;  1T8E A;  1ZQG A;  4K4I A;  7ICV A;  1ZQR A;  1KLN A;  4QZA A;  5HHH A;  9ICT A;  1XU4 A;  2OWO A;  1NOM A;  2XY5 A;  4M2Y A;  4DQP A;  4JWM A;  4YN4 A;  2BPG A;  4DL3 A;  2NRT A;  1XO1 A;  8ICQ A;  5KFU A;  1MC8 A;  3QE9 Y;  4F91 B;  4RUC A;  5KFB A;  1ZJN A;  3PVX A;  3JPT A;  3EYZ A;  7ICN A;  2NRV A;  3GV5 B;  2UVW A;  1RXV A;  4LZD A;  9ICO A;  3PR4 A;  4DL6 A;  9ICK A;  3RH6 A;  3M8R A;  4DS4 A;  2ALZ A;  5BOL A;  3MR6 A;  3M9N B;  3H4D A;  4YD1 A;  9ICJ A;  4KLM A;  4QW9 A;  4DL2 A;  7ICR A;  1BPB A;  4KLF A;  1JMS A;  5DGB A;  4DQQ A;  5KFK A;  1UT5 A;  1XWL A;  3H8S A;  2AGQ A;  4KLE A;  1S76 D;  5JUM A;  2W9B A;  2AJQ A;  1TFR A;  1CUK A;  4YR2 A;  2ZJA A;  3PW2 A;  4O5E A;  3THV A;  2LYH A;  5HMM A;  4I27 A;  2ZTD A;  5KFG A;  4Q43 A;  1MSW D;  1A77 A;  2ZJ5 A;  2H5X A;  5J0X A;  3C2L A;  4IQU A;  2XO7 A;  2XGP A;  3HPO A;  5KFZ A;  4I2E A;  3PW5 A;  1ZQZ A;  4KTQ A;  4M9G A;  5CJ7 A;  4R66 A;  4F5P A;  3PR5 B;  1ZQQ A;  4C8N A;  4TUP A;  3T5L A;  1L3V A;  4IRC A;  1UA0 A;  1WCL A;  4NXZ A;  9ICU A;  2UVU A;  2PFQ A;  4EZ6 A;  2JZB B;  3RRG A;  2MAX A;  4BGD A;  5KT4 A;  4BXO B;  5KFX A;  2C2R A;  4EYH B;  3T5J A;  2BQR A;  4QZ8 A;  4QZG A;  3V7L A;  1ZQT A;  4DS5 A;  4B9V A;  2MUT B;  4QZH A;  5J0P A;  4DSI A;  4YG2 A;  4TUS A;  3V6H A;  1T3N A;  1QSY A;  4UAZ A;  4F5Q A;  3C5G A;  4PHE A;  2PFN A;  4UQG A;  5L1L A;  4I2J A;  4R65 A;  3PW4 A;  9ICQ A;  1ZQC A;  2DPI A;  3N4M B;  4FBT A;  4NM1 A;  7ICK A;  5J0T A;  3HP6 A;  3KHL A;  2Y1I A;  3RB6 A;  1NK9 A;  4B9S A;  2AGO A;  4I2D A;  3Q8S B;  3M9M B;  4ECZ A;  4RT3 A;  4ECQ A;  1Z00 B;  5D4B A;  3E2E A;  4Q45 A;  9ICB A;  5KFM A;  3RB3 A;  1SL1 A;  3MR5 A;  4P2H A;  5L1I A;  3V7K A;  7ICE A;  3UXN A;  1DGS A;  4CCH A;  4KLO A;  4DFK A;  4B9L A;  3V6J A;  4UB5 A;  2Y1J A;  3KHR A;  5KT3 A;  3BQT A;  4O3N A;  4Z6E A;  4Q8F A;  3NGD A;  2HHS A;  2M9N A;  3N97 B;  2AU0 A;  3EPG A;  3PW0 A;  4IR9 A;  4YR0 A;  5C5J A;  1HJP A;  2HHX A;  3QZ8 A;  5KG1 A;  1S0O A;  4ELU A;  5KFQ A;  3RAQ A;  3ZDA A;  5IIO A;  4RZR A;  1ZQF A;  2A1J B;  4F2R A;  1NKE A;  3KHH A;  2ZUB A;  3HW8 A;  4M04 A;  3RJI A;  5IIN A;  2R8I A;  2KZ3 A;  1MQ3 A;  1BVS A;  3SV3 A;  3JPO A;  5EWE A;  1TAU A;  5DB7 A;  3T3F A;  3PML A;  4I2C A;  4EBD A;  5KG0 A;  5F9L A;  3RBE A;  4J9P A;  2BGW A;  4QZ9 A;  1NJZ A;  4LZG A;  4RQ3 A;  4KLU A;  4F5R A;  1D9F A;  4XQ8 A;  3K75 D;  2AQ4 A;  3OHB A;  4R8U A;  4YXM A;  1RYS A;  3ZDB A;  9ICF A;  3RJK A;  1D9D A;  4GXJ A;  3EZ5 A;  2ASJ A;  7ICI A;  8ICT A;  5J0R A;  1TK0 A;  7ICH A;  1ZQH A;  5J0Q A;  3PMN A;  4IQW A;  3JPN A;  2BCR A;  2PFO A;  5IIJ A;  4DOA A;  4RQ7 A;  4EEY A;  4KLG A;  3ZDD A;  4Z6F A;  4KLQ A;  2FLL A;  4PPX A;  3RRH A;  4RQ6 A;  1SL0 A;  3T5K A;  2C2E A;  3MR3 A;  4PHA A;  3MFI A;  2BDP A;  4DO9 A;  4QW8 A;  5DLG A;  3OJS A;  2GWS A;  4GXK A;  4M9H A;  2ZJ8 A;  4DFJ A;  1S9F A;  3M9O B;  5DG7 A;  7ICS A;  1BPD A;  4ED0 A;  1UT8 A;  5J0Y A;  4O3O A;  3G6Y A;  4F8R A;  2FMP A;  2JEI A;  3RJH A;  9ICP A;  4JWN A;  2BCS A;  5EWG A;  5J2B A;  4J9S A;  1ZJM A;  3HT3 A;  1COO A;  1S0V A;  1CEZ A;  1NK7 A;  8ICK A;  5KG6 A;  5IIM A;  4ED6 A;  1RYR A;  1ZQP A;  4ZH4 A;  5KFH A;  1BPE A;  2FMQ A;  4F4Z A;  4I2G A;  2KTQ A;  5DB6 A;  2HW3 A;  4ECW A;  1KFS A;  7ICJ A;  4DF8 A;  5KFV A;  3TI0 A;  1S10 A;  4KLJ A;  2BPC A;  5L9X A;  2ASL A;  2JEG A;  4F3O A;  4NLG A;  1BGX T;  1S0N A;  1U9L A;  1TV9 A;  3RB4 A;  1ZQK A;  2PI5 A;  9ICM A;  3BJY A;  9ICG A;  3GIJ A;  2W9C B;  4F4K A;  2AGP A;  4I28 A;  3C1Z A;  3KHG A;  4DF4 A;  1XSP A;  3NTU A;  3QZ7 A;  1NJX A;  4JV1 A;  3H4B A;  7ICG A;  3C2M A;  4J9R A;  1NKB A;  7ICP A;  4QWA A;  3OJU A;  1BPY A;  4YP3 A;  5DLF A;  4O5C A;  3GIM A;  3SYZ A;  5KFY A;  4QZD A;  4J9L A;  3Q8L A;  2KN7 A;  3ISD A;  5CWR A;  5KG5 A;  8ICC A;  5CP2 A;  4YQW A;  3MBY A;  3EPI A;  4C8K A;  7ICU A;  5DB9 A;  3RBD A;  4IRK A;  1L5U A;  5L1J A;  2BQ3 A;  1L3U A;  3B0X A;  3Q8Q B;  4M0A A;  3C2K A;  2V4Q A;  1N48 A;  1S77 D;  2C22 A;  7ICQ A;  1ARO P;  9ICW A;  2W8L A;  4O3Q A;  2W9A A;  2ATL A;  4KLT A;  5D46 A;  2C2D A;  5CA7 A;  3TFR A;  4F4Y A;  3IM1 A;  5DBC A;  5DQH A;  3RJE A;  5KFL A;  4UAY A;  1KRP A;  4NLN A;  1NJW A;  2KZZ A;  4M6W B;  5CR0 A;  4UB2 A;  2ZUC A;  1ZQJ A;  1ZQV A;  4E0D A;  5J0U A;  5L1K A;  2I1Q A;  5TZV A;  5J2A A;  1C7Y A;  3PX4 A;  1B43 A;  4DFM A;  4ED8 A;  7ICO A;  4MEX A;  4O3P A;  4Q8E A;  4QZB A;  5KFD A;  5KT6 A;  1L3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...