1KFTA

Solution structure of the c-terminal domain of uvrc from e-coli
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TSSLETIEGVGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIFWSLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Excinuclease ABC subunit C
publication title Solution structure and DNA-binding properties of the C-terminal domain of UvrC from E.coli
pubmed doi rcsb
source organism Escherichia coli
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1kftA00
3HT3A 2FPKA 2C2DA 3H4DA 1TK5A 4J9LA 4J9SA 4DSLA 4DL2A 9ICIA 4LVSA 5JUMA 4I2AA 4KLMA 3T5KA 4BWMA 5KG3A 4UB2A 1UA1A 2HHSA 4Z6CA 3ZDCA 1UT5A 4Q8EA 4QWCA 4HYKA 1LV5A 1WCNA 4P4MA 2W9AA 3PY8A 4IR9A 3QEAZ 4RQ8A 1XS9D 2MUTA 4O5EA 2UVRA 4LZDA 4XA5A 7ICMA 5KFAA 4ECUA 5IIJA 4C8LA 2V4RA 8ICJA 3RR8A 5KFSA 1EXNA 4FS2A 1IM4A 4RT2A 3RRHA 2XGQA 5DB8A 3TFSA 4Q44A 5DG7A 3RJJA 5DB6A 3RBEA 3PX4A 1XWLA 5DQHA 5J2HA 8ICRA 5KFEA 4F2RA 4M9LA 2UVUA 4R63A 2HHXA 4I27A 4PHEA 1UA0A 2FMSA 4UAZA 4DQRA 1BPZA 2KTQA 4RNOA 3KHLA 5EWGA 4UAWA 5J0PA 9ICAA 1ZQWA 4J9OA 2Y1IA 3RJEA 3Q8RB 1ZQGA 3C23A 1N48A 2HHVA 1NKBA 1ZQOA 4R8UB 5DLFA 4EZ6A 4JUZA 5KFHA 4RPZA 1MQ2A 3PV8A 4ED2A 1ZQQA 3KTQA 5KFCA 4B9MA 1L3SA 4O0IA 4F5QA 5KG5A 4DQSA 4TUSA 4B9SA 4ECXA 5CWRA 3PO5A 5D46A 5KFIA 3B0XA 2A1JB 7ICIA 3MFIA 5KG4A 3TANA 4F2SA 5J2DA 3NGDA 4GXJA 2ALZA 1ZQHA 1L5UA 3MBYA 5DQIA 3UQ2A 1V9PA 1NJYA 3C21A 2DPJA 2R8IA 1JN3A 3RB6A 4KLUA 4DQQA 2ASDA 2FPMA 3H7IA 1QTMA 2OWOA 4UB1A 4I2FA 2BKEA 5F9NA 9ICKA 1U49A 1S77D 4UB5A 4DS5A 4R64A 4RUAA 3M9NB 5HMMA 4RNNA 4FO6A 1ZJNA 1A76A 4YMNA 9ICVA 2KZMA 2NRXA 1MC8A 3MFHA 4F5NA 4QZ9A 2RDJA 3V7JA 8ICFA 5DG9A 3HWTA 3H8WA 3RH4A 4YR3A 4MF2A 5L1KA 5KFBA 8ICKA 2NRVA 4K4HA 4KLDA 3FYHA 3BQ0A 3LDAA 4DL6A 1RPLA 3V72A 1SKRA 1ZQCA 4DSJA 2BCVA 4MFAA 3C5FA 1KSPA 4B9VA 4RQ3A 5KT2A 9ICEA 1ZQSA 4QZ8A 5KT5A 7ICJA 5KFRA 4IRKA 1BPXA 1TFRA 4ED6A 1WCLA 4RQ7A 1X2IA 9ICWA 3GV8B 4F5PA 5IILA 8ICSA 1L3TA 1JXLA 4JWMA 4Z6DA 5EOZA 3SV3A 1ZQDA 2BPGA 4PHAA 5CR0A 2IBKA 1NKCA 1K1SA 4FS1A 4O5KA 4IQVA 4NLKA 3RJHA 2ZJAA 2W9MA 3T5HA 1NK6A 3T5LA 9ICQA 7ICVA 4F93B 4F4YA 4F5OA 4KLQA 4ECYA 2HVIA 2FLNA 1S0OA 5KFYA 3RAXA 4TUQA 1ZQMA 1HUZA 2UVVA 9ICJA 4YQWA 2KFZA 7ICUA 1BPEA 3NTUA 2IMWP 4E0DA 5J2IA 1COOA 1ZQNA 1T4GA 4R65A 4NM1A 4QZBA 1ZQJA 8ICPA 2BR0A 3IHQB 3TARA 3V7KA 4O9MA 2ZUBA 2P6UA 4NM2A 1ZQXA 2F1HA 4Q43A 5KFQA 3KHHA 2GWSA 8ICUA 5KFTA 4KLLA 4RU9A 1X9MA 4IRCA 4F8RA 5IIIA 3ETLA 1QSYA 1ZJMA 3JPQA 2AGQA 1S10A 4M04A 1Z00B 5KG0A 4YMMA 1ZQRA 2XO7A 2BQUA 4GLXA 1JXEA 5KFNA 1KFTA 2BPCA 4PH5A 3KHRA 4I2CA 4KN7A 3KHGA 1NK0A 2JEJA 9ICBA 4R8UA 4UAYA 4J9KA 3UXPA 3OHAA 5KG1A 4DSEA 1ZQLA 8ICQA 5DKWA 4TQSA 5IIMA 4QZGA 4F4KA 9ICRA 2I1QA 1NK9A 4DFKA 5HNKA 5L9XA 5IINA 2AJQA 2XY7A 5KG2A 4MF8A 2JEGA 4RPXA 2A1JA 4DL5A 4M9GA 3MGHA 4KLEA 5J0UA 4BGDA 1KLNA 5BPCA 3BQTA 4Q45A 2BHNA 2C2RA 2P6RA 4M47A 4DSIA 3GV5B 4K4IA 1A77A 2VA8A 4I2JA 3MR3A 5KFDA 8ICXA 2HHUA 4DOCA 2UVWA 5DBAA 2FMPA 3Q8KA 1D9FA 4UBCA 3B0YA 1HJPA 1Y88A 3LWLA 2ZJ5A 4GC7A 3Q8MA 2ATLA 1NK7A 3MR6A 7ICOA 7ICNA 4O3SA 5J0WA 4QZEA 4PHDA 3G6XA 2ISOA 3HPOA 4MEYA 5KFWA 4YP3A 3JPOA 1S0NA 8ICWA 4ECRA 4P2HA 1NK5A 4ZH4A 5J0RA 9ICUA 4ELUA 1RXVA 3EZ5A 1D8LA 1JX4A 1AROP 3AUOA 4DSKA 3GIMA 7ICQA 4QZIA 3RB4A 5F9LA 4QWDA 7ICTA 3QEBZ 4YR2A 2MAXA 1XU4A 1RXWA 3QE9Y 2NRWA 2C2EA 3T3FA 4F4ZA 1TAQA 1KFDA 2W9CB 4K4GA 5KFLA 3Q8QB 5KTQA 9ICSA 5J29A 7ICPA 3Q8SB 2AGOA 5L1IA 3MABA 3UPQA 4EYHB 2JZBB 4F5RA 3SZ2A 5CHGA 4ELTA 3TQ1A 5HHHA 3H40A 5KFPA 5KT4A 4M9JA 3Q8LA 4QZFA 1N56A 4BWJA 3GV7B 5J0QA 4FBTA 4DL7A 1KDHA 2LYHA 5J2GA 4Z6FA 3PNCA 4DO9A 1ZQFA 2R8KA 4GXKA 1JIHA 4YFKA 4G3IA 3GQCA 1X9SA 3UQ0A 4QZAA 3RH5A 2PFNA 4KTQA 3LWMA 1SKWA 2J6SA 2Y1JA 4FBUA 2JEIA 1KFSA 5L1LA 2HW3A 2KZ3A 3K75D 4X5VA 4M0AA 4RNMA 3PMLA 4KMUA 1C7YA 2BPFA 3JPTA 2V9WA 4RUCA 5KT6A 4ED3A 1ZETA 1CUKA 2AQ0A 2Q0ZX 4F4WA 4KLIA 2BCUA 1Z00A 1KRPA 8ICVA 4QWBA 3HW8A 5J0YA 3C2LA 2ZTCA 4DSFA 9ICTA 3AU6A 3BJYA 4P4PA 4GXIA 1S9FA 2P66A 1NKEA 4I2BA 3ZD8A 5DGAA 1U48A 1ZQAA 8ICLA 5C5JA 8ICHA 4YCXA 2BDPA 1L3UA 4C8NA 2ZJ8A 4ED1A 1U45A 9ICNA 3PX6A 4I29A 3C2MA 3M8RA 3RJKA 4YD1A 4MEXA 3UXOA 7ICKA 8ICZA 3OJSA 4DLEA 3RH6A 1NJWA 3MDCA 2BCSA 3M9OB 2C28A 4I28A 3PW0A 1NOMA 4ED0A 4DWIA 4M9NA 3C5GA 4NLZA 5KFMA 4DEZA 4YR0A 3QZ8A 4M2YA 5DBBA 4ELVA 4EEYA 3JPNA 5KFXA 4DLGA 3TI0A 3K4GA 4TQRA 7ICGA 4RQ1A 4DL4A 3ZDDA 2AU0A 4C8KA 8ICGA 1DGSA 4DS4A 1NJXA 4EYIB 3V6JA 5KFVA 2M9NA 4J9PA 2H5XA 5J2KA 4CCHA 4PGXA 2FLPA 3H8JA 1QLNA 3JPPA 1ZQYA 3OHBA 5KT3A 2XY5A 4B9TA 1MQ3A 2HVHA 7ICHA 5DG8A 2AQ4A 4JV2A 5J0OA 5KFJA 1ZQBA 4IQTA 1S0MA 4ECZA 2FLLA 3M9MB 4O3NA 4M6WB 8ICIA 2XCPA 1RZTA 4YVZA 1T8EA 1QSSA 1XSNA 4P4OA 4O3OA 4J9RA 3RB0A 2KZZA 5J2AA 3GIKA 1ZQEA 1BPBA 4QW9A 1ZQTA 5DB7A 2IHMA 4DFMA 5J2JA 3MDAA 2ASLA 4EZ9A 4XUSA 1TK8A 2W9CA 4DL3A 4F91B 3OGUA 4QZDA 4MFFA 3RJFA 1X9WA 5CP2A 3G6VA 2W8KA 2ZTDA 3SV4A 3EPIA 2ZUCA 4YN4A 2JZBA 3H8SA 4RQ2A 3HX0A 4RT3A 1RYRA 2PFPA 4RPYA 3OSNA 1TKDA 4KLGA 3PR5B 3PMNA 4RQ5A 4UBBA 3H4BA 8ICCA 3N97B 2B21A 4UB4A 3ZDAA 4I2DA 1CEZA 4Z6EA 4TUPA 4DFJA 8ICAA 1SL2A 4KLJA 5D49A 4NXZA 5J2CA 4PGQA 3TAPA 1TV9A 2DPIA 3M8SA 3RRGA 5KFGA 5BOLA 3OJUA 3RTVA 3BQ1A 5HHIA 1U4BA 4ECTA 4BXOB 4QW8A 5BOMA 8ICTA 4IRDA 5KFOA 2PI4A 4O3QA 4KN4A 3RJIA 2W9BB 3RAQA 4BDPA 3FDSA 1NK4A 2J6UA 3IM1A 1SZPA 3V6KA 3GIJA 3ZDBA 4ECQA 1D9DA 5DB9A 3ISBA 5DLGA 4TURA 8ICYA 5DDYA 4QWAA 4IQUA 4DF8A 2VA3A 3SYZA 2VA2A 2BQ3A 9ICPA 4EBEA 4IR1A 5KFUA 4RZRA 2R8GA 3OSPA 3BDPA 1BVSA 1NJZA 4J9MA 4QWEA 5KT7A 1L3VA 4O3RA 4I2GA 1JMSA 4NLGA 3UXNA 1XO1A 3C2KA 3C1YA 4YXMA 4B9LA 1ZQUA 1SL0A 4NY8A 8ICOA 4JV0A 3PX0A 3PW4A 2WTFA 8ICEA 3Q8PB 4PPXA 3C1ZA 1ZQZA 1BPYA 5J0TA 2XGPA 4QZHA 1XC9A 4PHPA 5J2BA 4UQGA 2AGPA 5DQGA 4ED8A 5J2EA 2BGWA 2PXIA 4DFPA 1NK8A 1MSWD 3BQ2A 1XSLA 3E2EA 5CA7A 3GFKB 4C8MA 1S0VA 7ICSA 2F1IA 3PO4A 4IQWA 3JPRA 1T7PA 4F92B 1BGXT 3G6YA 1ZQIA 4DQPA 5EWFA 2MUTB 1TVAA 4I2EA 2BCQA 2IHNA 7ICLA 9ICCA 1B43A 1BPDA 9ICXA 2VANA 5DGBA 2PFQA 4MFCA 3EW9A 5KG6A 2HHWA 3RR7A 3AU2A 3GDXA 9ICOA 4R66A 3PR4A 2C22A 3LK9A 3V6HA 5D4BA 2BQRA 3ZDEA 2XY6A 3GILA 4F4XA 4B9UA 3MR2A 3GIIA 3QZ7A 2ISPA 4ECWA 2XC9A 1IXRA 5HMLA 5J0SA 3PW2A 2J6TA 7ICRA 4M6WA 4JK1A 1PZNA 3N4MB 1ZQVA 4ECSA 3ORYA 3ZD9A 1U47A 3PW7A 2FMQA 8ICBA 1SL1A 2IA6A 9ICHA 1LB2B 2ZTEA 8ICMA 4XQ8A 5EWEA 1T3NA 3T5JA 1S97A 3MR5A 4LZGA 4UB3A 1QSLA 3TFRA 4I2HA 4F3OA 4JV1A 4KLFA 1HUOA 1S76D 4RQ4A 2KN7A 3ISCA 4RQ6A 3RJGA 4B9NA 1RYSA 2F1JA 4J9NA 4KLTA 1TAUA 5CJ7A 4DQIA 4KLOA 4ECVA 1UT8A 4J9QA 2XCAA 4C8OA 1ZYQA 1Z3EB 4YMOA 2JEFA 9ICGA 1D8YA 3PW5A 5L1JA 1ZQPA 3ISDA 7ICFA 9ICMA 2ZUDA 1DOQA 2HHTA 2FPLA 3EWAA 5DDMA 4YG2A 2NRTA 4I2IA 3MGIA 2BCRA 4NLNA 7ICEA 4GC6A 3V7LA 4KITB 5KFFA 5CB1A 5HP4A 3RBDA 1KTQA 2ASJA 5IIKA 4YD2A 3JPSA 2I9GA 5KG7A 4ED7A 4BXOA 4Q8FA 2KFNA 2DFLA 2RDIA 3EYZA 3SI8A 4JWNA 4EBDA 2W9BA 9ICLA 9ICFA 5KFZA 1SKSA 1H38A 5J2FA 2PFOA 1TK0A 8ICNA 1B22A 3EPGA 2R8HA 4XRHA 4DF4A 5IIOA 2W8LA 1XSPA 2R8JA 1KEJA 4F50A 4O5CA 5TZVA 4QZCA 4KLHA 2PI5A 4RQ0A 4EBCA 5J0XA 2V4QA 5DBCA 5KFKA 2NRZA 1K1QA 3RB3A 3THVA 4DOAA 2HHQA 4KLSA 1U9LA 4DOBA 4O3PA 3HP6A 3PVXA 3TAQA 1ZQKA 4YXJA 4PGYA 4M9HA
chains in the Genus database with same CATH superfamily
2FPKA 2KKPA 5JUMA 3QX7A 5T14A 1GO3F 3PY8A 4PZNA 4ACOA 4XA5A 5KFAA 8ICJA 2G08A 5ALYA 1WWVA 5ALFA 4EX6A 3RJJA 1B0XA 5DQHA 1RQLA 2KIVA 4I27A 1BPZA 4RNOA 5AKEA 3KHLA 2YB4A 9ICAA 1SXEA 1ZQOA 5DLFA 2BDUA 3FAHA 3ALRA 5EE1A 4O0IA 5KG5A 2WFAA 2KKVA 4B9SA 5CWRA 3WK7A 5AK3A 1S5LU 1ZOLA 4F2SA 5AICA 3NGDA 1V9PA 3H7IA 2BKEA 5F9NA 4PJ0U 1OUQA 3I28A 5K4LA 2ZIXB 3V7JA 5DG9A 3HWTA 2ES6A 2KV2A 5L1KA 1A0PA 5KFBA 1FO4A 8ICKA 1FFVA 1YZ7A 3WK6A 3ZI4A 1RPLA 1SKRA 2G5HB 2KVSA 2B6GA 4OJ5A 5KT5A 7ICJA 4IRKA 1TFRA 1WCLA 1Z4OA 3GV8B 1X6JA 2H3ZA 4QIWC 2W7PA 4NL9A 4IQVA 3TACB 2ZJAA 5AM1A 4KMOB 4F5OA 2HVIA 2FLNA 5KFYA 2BZFA 2YTUA 1ZQMA 1TAMA 7ICUA 1QQ5A 1BPEA 2IMWP 5CRXA 1COOA 1T4GA 5TISU 4R65A 4NM1A 2H3QA 3WK8A 2BR0A 2ZUBA 2P6UA 2GWSA 8ICUA 5KFQA 1X9MA 4F8RA 4M04A 1ZQRA 5KFNA 2BPCA 1OXJA 4PH5A 1BNPA 4KN7A 1FEZA 5ALIA 2YN4A 2JEJA 4J9KA 1ZXIA 8ICQA 4TQSA 2CRXA 2D3DA 5J8YA 4MF8A 4FZMA 2A1JA 2F44A 4USAA 4BJQA 4Q45A 2P6RA 1V85A 2QLTA 2KOBA 3LYSA 5DBAA 4GC7A 1KW4A 1NK7A 4CF5A 2A19A 3F2BA 4FZNA 5KL8B 4O3SA 4PHDA 3G6XA 3HPOA 5KFWA 2QB0B 8ICWA 3DV9A 4ZH4A 4ELUA 2RP5A 3BQ7A 1D8LA 2ZIVA 2JMGA 3QUTA 3AUOA 2QB1A 4QZIA 3RB4A 4YR2A 1XU4A 2F8KA 1TAQA 1KFDA 5ALJA 3Q8SB 1X6IA 2DKXA 3IV6A 3F2DA 5AKJA 5AIBA 4GFJA 4Y2YA 2DQNB 3GV7B 3PSFA 2LYHA 3PNCA 5C0YA 4GXKA 4QZAA 2PKEA 2MSNA 2WF7A 2CXYA 5ALNA 2IOFK 3AMZA 4FBUA 2HW3A 5L1LA 5A0LA 2BPFA 1L8LA 2V9WA 4RUCA 1CUKA 2AQ0A 2Y9TA 1WG8A 3NRZA 3HW8A 5J0YA 3UMBA 3BJYA 4P4PA 1ZQAA 5C5JA 2ZJ8A 4C7YA 4ED1A 1U45A 9ICNA 3PX6A 5ALOA 3M8RA 5L1MA 3RJKA 4MEXA 7ICKA 4G9BA 2ESEA 3MDCA 3QXGA 3M9OB 4M9NA 4NLZA 4DEZA 4M2YA 1SWWA 4EEYA 4DLGA 3K4GA 4DL4A 3PSTA 5AKIA 1DGSA 3V6JA 3BZCA 3M7DA 4C4TA 5KNIA 3AM9A 1COKA 3H8JA 1QLNA 3JPPA 1ZQYA 3OHBA 7ICHA 1S0MA 2ZIUB 2FLLA 8ICIA 4YVZA 2W7OA 1RG6A 4QW9A 1ZQTA 5DB7A 4XUSA 5ALHA 2E8PA 2W8KA 3EPIA 3H8SA 4QIWF 4RQ2A 4RPYA 5ALXA 8ICCA 3N97B 1PK1B 4I2DA 5F3XB 1CEZA 4DFJA 4KLJA 3RRGA 3QU4A 3M6ZA 4ECTA 4QW8A 1VDVA 2W9BB 2W03A 1SZPA 3IM1A 5DB9A 8ICYA 4UB6U 1N62A 1PK3A 5KFUA 4RZRA 2R8GA 4OJOA 4J9MA 4QWEA 5AKYA 4O3RA 3UXNA 3C2KA 4NY8A 2MU2A 2WTFA 2W3SA 1BPYA 4BUGA 1IIPA 4PHPA 4DFPA 3NASA 3I1YA 3PO4A 5ALGA 1T7PA 1T94A 3WKDA 2MUTB 7ICLA 5G5HA 2IHNA 9ICCA 9ICXA 4MFCA 1MA7A 1SB3C 3QU2A 4NLBA 3TADC 3QZ7A 4CNQA 2XC9A 1IXRA 5J0SA 2J6TA 4M6WA 4JK1A 4FZLA 4P0QB 1PZNA 5AKLA 4B6JA 3ZD9A 2LM1A 2FMQA 1S97A 4LZGA 2JH7A 2HBJA 4U7CA 5EE0A 4KLFA 1S76D 4RQ6A 4KLTA 3O0FA 4OD0A 1TAUA 3ED5A 5CJ7A 4DQIA 4KLOA 4J9QA 2JEFA 5ALSA 3PW5A 3WK5A 2FPLA 4YG2A 3MGIA 3IDWA 1UHUA 3JPSA 4ED7A 2DWQA 3SD7A 2DFLA 2KFNA 1LKYB 3SI8A 4QNLA 9ICLA 2FDRA 1SKSA 3L5KA 1SV0C 4DF4A 3WKEA 5IIOA 1XSPA 1KEJA 4F50A 2ZXHA 4KLHA 2GH1A 4EBCA 3RB3A 3THVA 5AI4A 2EQYA 5KAFU 3NS1A 4PGYA 4I2GA 4M9HA 3HT3A 3HJEA 2C2DA 3UMCA 1FIQA 4DL2A 5ALPA 4KLMA 1UA1A 4UB2A 3ZDCA 1UT5A 3WK9A 2YY6A 3QEAZ 2UVRA 5AK6A 2P35A 4ECUA 4UB8U 1EXNA 4RT2A 2XGQA 2G0AA 3RBEA 3PX4A 4F2RA 1NZBA 1ECWA 2Q4TA 2HHXA 2FMSA 4DQRA 4UAWA 4CE6A 5J0PA 1L7NA 2NYVA 3Q8RB 1ZQGA 1N48A 4JB3A 3LVVA 4RPZA 1MQ2A 3K1RB 3PV8A 1ZQQA 3KTQA 4UASA 2ZIWB 4TUSA 2I5HA 3B0XA 2G06A 2E5SA 4P0PA 3WKBA 1RQNA 3TANA 5J2DA 2ALZA 3CP8A 1NJYA 1K5OA 2D6FC 2R8IA 2OEHA 4I2FA 2ASDA 2OWOA 5AM5A 1SGGA 9ICKA 4UAVA 4RUAA 2L5YA 3MFHA 2RDJA 4NJ8A 3RH4A 4MF2A 4RQNA 3LVWA 2E1EA 4K4HA 1DXSA 4KLDA 3FYHA 3BQ0A 4B9VA 1A6SA 2JRZA 5KT2A 4ED6A 5AI8A 2OHFA 1L3TA 1JXLA 4JWMA 2BPGA 4PHAA 2IBKA 4C0ZA 4DFDA 4O5KA 2W9MA 3KKAA 1NK6A 2EZXA 3T5LA 4KLQA 3QYPA 4AYBC 2F8LA 1HUZA 2KFZA 3PZPA 1ZQJA 1TE2A 3IHQB 3V7KA 4O9MA 2KNJA 3BS5B 2F1HA 1AQ6A 5AM4A 3M1YA 3JPQA 2AGQA 1S10A 5KG0A 2CPRA 2XO7A 1JXEA 3KHGA 1NK0A 2ZXIA 4R8UA 3UXPA 3OHAA 5KG1A 4DSEA 2NV3A 1ZQLA 4LJXA 4F4KA 9ICRA 1NK9A 4DFKA 5IINA 3VCBA 2MA1A 3N28A 4RPXA 2YX8A 2Y9UA 4M47A 2VJ4A 1X42A 1A77A 4I2JA 3ONNA 2HHUA 4DOCA 2Y0SC 2DKZA 1HJPA 3LWLA 2ZJ5A 4PZOA 2HOQA 2DL0A 4QZEA 2JH1A 1Q46A 4YP3A 1S0NA 4US9A 2FJ6A 4P2HA 1NK5A 3KZIU 2JR5A 9ICUA 1RXVA 2LI6A 4DSKA 3GIMA 7ICQA 1Q8KA 2HBKA 4U6PA 5B66U 3F53A 4KX3A 1N5XA 2NRWA 1M6YA 2W9CB 5KFLA 1F44A 5J29A 7ICPA 4EYHB 2JZBB 5CHGA 1HIWA 1UPHA 2AH5A 5KT4A 3L3FX 5J0QA 4DL7A 1KDHA 3IN5A 4DO9A 1ZQFA 2R8KA 1X9SA 5HR6A 2PFNA 5AI9A 5G5GA 2YMQA 3PSIA 2DUYA 2MRLA 2Q0ZX 2BCUA 1Z00A 4Y2JA 2M0NA 5ALVA 3C2LA 2ZTCA 3AU6A 2ZIUA 1S9FA 5AM3A 8ICLA 2BDPA 1WUDA 4KX5A 4ICAA 4I29A 3C2MA 3IRUA 4YD1A 3OJSA 4ED0A 3C5GA 5KFMA 4YR0A 4ELVA 4C7ZA 4TQRA 4DS4A 1NJXA 4EYIB 5CEHA 3KOOA 4NL9C 1L6NA 2QARA 5KT3A 1MQ3A 5KFJA 1ZQBA 2OXOA 4NLCA 3M9MB 1T8EA 4P4OA 4Y2UA 1BPBA 2IHMA 4EEKA 4CGZA 1N63A 4EZ9A 1SIJA 3F2CA 3IG5A 4MFFA 3RJFA 1X9WA 4Y2XA 2ZTDA 4YN4A 3AL0B 3HX0A 4RT3A 2PFPA 3OSNA 3H4BA 1PVRA 2B21A 4AYBF 3KFUF 3WKCA 5D49A 4PGQA 1QQ6A 5J2CA 3M8SA 5J8YC 3RTVA 5HHIA 2F76X 1U4BA 3QUCA 2KHQA 5KFOA 4BDPA 3RAQA 3FDSA 2J6UA 3V6KA 3ISBA 5DLGA 4TURA 2JHDA 5DDYA 4QWAA 2H3FA 2KJ9A 4DF8A 2VA2A 2R18A 2XVTA 4CDGA 1ED1A 1J2MA 3OSPA 2XIDA 4UW9A 1NJZA 3PSPA 5KT7A 3C1YA 4B9LA 8ICOA 3PX0A 8ICEA 4EX7A 1ZQZA 4QZHA 2AGPA 4UQGA 2PXIA 1MSWD 2K8CB 1XSLA 1L8OA 4C8MA 1S0VA 2F1IA 4IQWA 3H8MA 5EE3A 4F92B 4DQPA 3WK4A 2W43A 5EWFA 2ZG6A 2K8BB 2Y0SF 5DGBA 3KBBA 1O03A 3EW9A 2HHWA 3GDXA 2KG5A 2KICA 3LK9A 2A1AA 2LKYA 2BQRA 2XY6A 2WF9A 3GILA 4B9UA 3SAFA 1N5WA 3MR2A 3GIIA 1URJA 2A3VA 1VLBA 7ICRA 3N4MB 2LYAA 5KL1B 3ORYA 2JGAA 2IA6A 2ZTEA 5EWEA 2YQEA 3MR5A 4UB3A 1P7DA 4JV1A 2KE7A 1N2XA 2GO7A 2HCFA 1RYSA 4J9NA 1UT8A 1ZYQA 1Z3EB 4A8EA 3AQEA 1UQVA 1DOQA 2XICA 5DDMA 2CN1A 5AI0A 2ASJA 5IIKA 4YD2A 4CF4A 4BXOA 4OO1J 2RDIA 4JWNA 9ICFA 1H38A 2PFOA 4RQMA 4O3MA 1TK0A 8ICNA 1B22A 4IS7A 2W8LA 5J0XA 5KFKA 2NRZA 5JTIA 4DOAA 2WF6A 1U9LA 3HP6A 2LPEA 3H4DA 2I6XA 2AXTU 3L4PA 4J9SA 2OM6A 9ICIA 3T5KA 2ZIWA 2HHSA 4Z6CA 2K4PA 4QWCA 4HYKA 4P4MA 2D8CA 4IR9A 2EDUA 1XS9D 4O5EA 2B0CA 1MN8A 3RR8A 4FS2A 1IM4A 3NVWA 3RRHA 4BX9C 5DB8A 3TFSA 2GLEA 5DB6A 2ODGA 8ICRA 4M9LA 4R63A 4PHEA 1UA0A 4UAZA 2KTQA 3SAHA 5EWGA 2OCEA 2O6KA 3C23A 2HHVA 4EZ6A 4PL1A 4JUZA 5KFHA 4B9MA 4ED2A 4F71A 4OJPA 2RQ5A 4DCCA 3PO5A 5KFIA 2KSOA 2A1JB 3MFIA 1Q3VA 1ZQHA 3MBYA 3UQ2A 2WB1C 3RF9A 1JN3A 2KJ8A 1SV4A 5HR7A 1U49A 4UB5A 4R64A 3M9NB 5HMMA 4FO6A 2RHFA 1A76A 4YMNA 9ICVA 2EAOA 2KZMA 3NVYA 1MC8A 1Z1VA 4YR3A 2K4EA 1T3QA 2NRVA 2ZIVB 4DL6A 1FFUA 1NNLA 3V72A 5JRTA 3C5FA 9ICEA 4QZ8A 1BPXA 3SENA 1V38A 4RQ7A 1J2NA 5IILA 8ICSA 1SWVA 1RDFA 4Z6DA 1VJ5A 5EOZA 3SV3A 1ZQDA 1K1SA 3T5HA 3UMGA 9ICQA 5AKGA 9ICJA 1IG6A 1QCKA 1QH9A 8ICPA 4NM2A 1L7PA 5AI6A 2IOHA 4KLLA 1ZD5A 4IRCA 1CRXA 5IIIA 3ETLA 1QSYA 1ZJMA 2BQUA 1DGJA 1X9XA 4I2CA 9ICBA 2KIWA 3SR6A 2I1QA 5HNKA 5L9XA 1DK2A 3DDHA 5KG2A 2JEGA 4DL5A 4KLEA 5J0UA 4BGDA 1KLNA 2BHNA 4DSIA 4FE3A 4K4IA 3MR3A 2VA8A 2W55A 5EE9A 3ICXA 3Q8KA 1D9FA 2E8OA 4UBCA 2W04A 2ATLA 3VC8A 3A0HU 7ICOA 3MR6A 1F5SA 7ICNA 4C80A 2ZIXA 1UCVA 3JPOA 1XO0A 1JI7A 5J0RA 3EZ5A 7ICTA 4QWDA 2MAXA 1LVHA 2H3IA 4K4GA 3Q8QB 5L1IA 3MABA 3UPQA 1RYUA 4F5RA 3SZ2A 4ELTA 3NVVA 3H40A 5KFPA 4IL6U 1JALA 4M9JA 3Q8LA 1YZ6A 4FBTA 4BWJA 4Z6FA 4YFKA 2E1FA 3QU5A 4KTQA 1SKWA 3NUQA 2J6SA 1KFSA 2WF8A 4KMUA 5AK4A 1C7YA 3JPTA 4Y2SA 3N7PD 4ED3A 4KLIA 8ICVA 5AM2A 4WJ3B 1NI3A 4DSFA 9ICTA 4UAUA 1NKEA 4I2BA 1U48A 1V97A 8ICHA 4YCXA 1L3UA 2EAMA 4OCZA 1PVQA 3UXOA 4DLEA 3RH6A 1NJWA 2C28A 3PW0A 1NOMA 4DWIA 3SMVA 5DBBA 2EZYA 3EUB2 3JPNA 5KFXA 3TI0A 4RQ1A 2WB1F 3ZDDA 4C8KA 3U26A 2VIXA 3WU2U 5KFVA 2M9NA 3UM9A 4J9PA 5J2KA 2FLPA 2XY5A 1DK3A 2HVHA 3KZXA 5ALRA 5DG8A 2QB0A 4JV2A 4ECZA 4O3NA 4M6WB 1X40A 2XCPA 1Q3UA 1RZTA 1XSNA 4O3OA 4J9RA 5FP0A 5JU5A 4F72A 3GIKA 1ZQEA 3AEVA 3M6KA 4DFMA 5J2JA 1XNSA 1TK8A 3OGUA 1KKXA 5CP2A 3G6VA 3SV4A 1QQ7A 3H0RB 1N60A 3H0MB 1TKDA 4KLGA 3PR5B 3PMNA 4RQ5A 4UBBA 2F3NA 4Y2TA 4Z6EA 4TUPA 8ICAA 2DPIA 4NXZA 1TV9A 1YT3A 3TAPA 3BQ1A 1ZD4A 5BOMA 4IRDA 2PI4A 3RJIA 2YMLA 3IP4B 3GIJA 3ZDBA 1PUZA 2DF4B 3WKAA 3FC4A 3IG8A 4NLGA 1XO1A 4J03A 1SL0A 5AM0A 3PW4A 2OYYA 3Q8PB 2NO4A 3S6JA 2KK0A 2EAPA 5J2BA 5J2EA 2BGWA 2JV3A 3BQ2A 3E2EA 3T79A 3JPRA 1TVAA 4I2EA 4FFDA 1B43A 5AKXA 2VANA 2PFQA 5E79U 5KG6A 9ICOA 2C22A 3V6HA 3ZDEA 4F4XA 4ECWA 5HMLA 1HEKA 3HKZC 2H3VA 3HRDD 5AIAA 3SQIA 4EELA 8ICBA 2EANA 1LB2B 8ICMA 1T3NA 2VJ5A 4I2HA 1QSLA 3TFRA 4F3OA 1HUOA 1L7OA 3ISCA 1KQQA 4B9NA 1B4FA 2W54A 3CW2C 4P0PB 3C29A 4ECVA 1X66A 3CYMA 1PK1A 4C8OA 9ICGA 5L1JA 7ICFA 1D8BA 2HHTA 3EWAA 4UARA 4NLNA 2BCRA 3R9KA 7ICEA 4KITB 5KFFA 1S8OA 2LBOA 5HP4A 3RBDA 1IV8A 5KG7A 3AQFA 3EYZA 2W9BA 2LM4A 5KFZA 5J2FA 3EPGA 2Z7JA 4XRHA 2VKQA 5TZVA 4QZCA 2PI5A 4RQ0A 2V4QA 1K1QA 2OH2A 2E8MA 3SAGA 2W3RA 4O3PA 3TAQA 4YXJA 1Z1BA 1TK5A 4J9LA 4DSLA 4LVSA 4I2AA 1WYGA 4BWMA 5KG3A 4HAIA 3MGVA 4Q8EA 1LV5A 1WCNA 1JROA 2W9AA 1WWUA 4RQ8A 2MUTA 7ICMA 4LZDA 5IIJA 4C8LA 1ZD3A 2V4RA 5KFSA 4Q44A 5DG7A 3I76A 1XWLA 1L7MA 1DRGA 2LHTA 5J2HA 5KFEA 2UVUA 1BNOA 1O08A 4P0QA 1ZQWA 2E8NA 5AKHA 4J9OA 2Y1IA 3BZKA 3RJEA 3DEEA 1F0MA 1NKBA 4R8UB 4EENA 1ZRNA 2HI0A 2RRDA 2K89A 5KFCA 1L3SA 4F5QA 2EZZA 4DQSA 2K8AA 5ALLA 4ECXA 5D46A 4Y2RA 7ICIA 1RM6C 1PVPA 5KG4A 5ALMA 5KAIU 4GXJA 1L5UA 5DQIA 2KD1A 3C21A 2DPJA 3D2QA 1JUDA 3RB6A 4KLUA 5ALDA 4DQQA 2FPMA 1QTMA 4UB1A 1S77D 3AN1A 3OTQA 4DS5A 1J97A 4RNNA 1ZJNA 4Y2QA 1LKYA 2NRXA 4F5NA 4C4RA 2G09A 3D6JA 4QZ9A 8ICFA 3H8WA 5AK5A 3RFAA 3QNMA 2HDOA 4DSJA 3LDAA 1ZQCA 3B9JA 4MHVA 2WAQC 2BCVA 4MFAA 5ALKA 1KSPA 4RQ3A 1ZQSA 3OPXA 1JRPA 5KFRA 9ICWA 1X2IA 1KN5A 4F5PA 5GTIU 3A0BU 3C28A 5CR0A 1NKCA 4FS1A 4NLKA 3RJHA 1SZHA 7ICVA 4F93B 3ETRA 4IC9A 4F4YA 4ECYA 2N1RA 1S0OA 3RAXA 2DGZA 4TUQA 2KP7A 2UVVA 4YQWA 1OW5A 3NTUA 4E0DA 5J2IA 1ZQNA 4QZBA 3BS7A 3TARA 3KHHA 1ZQXA 4Q43A 5KFTA 4RU9A 3HKZF 1Z00B 4YMMA 5ALTA 4GLXA 1KFTA 3KHRA 4UAYA 5DKWA 5IIMA 3D2NA 4QZGA 2AJQA 4C4SA 2XY7A 4JMUA 2HOIA 4M9GA 3MGHA 4PL2A 5BPCA 3BQTA 1SXDA 2C2RA 3GV5B 8ICXA 5KFDA 2HMXA 2LMRA 2UVWA 2FMPA 3B0YA 1Y88A 1N61A 3Q8MA 3CRXA 2QARB 3MC1A 5J0WA 2ISOA 4MEYA 2QKQA 2KJ5A 4ECRA 3F5AA 4AP9A 1JX4A 1AROP 4CF3A 4Y2VA 5F9LA 3QEBZ 1RXWA 3SEIA 3QE9Y 2C2EA 3T3FA 4F4ZA 3N7RC 9ICSA 5KTQA 2AGOA 2HSZA 5GTHU 4ZOHC 5HHHA 3TQ1A 4Y2PA 4QZFA 1N56A 2YB1A 5J2GA 2KMDA 3TADA 1JIHA 4G3IA 3GQCA 2YMPA 3UQ0A 2NO5A 3RH5A 5AKKA 3LWMA 2Y1JA 2JEIA 2KZ3A 3BS5A 3K75D 4X5VA 4M0AA 4RNMA 3PMLA 5KT6A 2RLTA 4NV0A 1ZETA 4F4WA 1KRPA 4QWBA 2LYBA 3KD3A 3TKAA 4GXIA 2P66A 2HBMA 2PMZC 3ZD8A 5DGAA 5AHXA 1C20A 4C8NA 5ALUA 3HILA 2IOFA 2K4IA 2KEYA 8ICZA 3QUBA 3NVZA 2KVCA 2EH9A 4OJLA 2BCSA 4I28A 3QZ8A 2JXJA 7ICGA 1SV0A 2AU0A 8ICGA 2DBYA 2E3TA 2H5XA 2WHEA 4CCHA 4PGXA 3N7SC 5B5EU 4B9TA 4QJFB 2AQ4A 5J0OA 4IQTA 5AI5A 3D2SA 1ZRMA 1QSSA 1Z19A 2KZZA 3RB0A 2WAQF 5AKZA 5J2AA 3MDAA 2ASLA 2F77X 2HBLA 2W9CA 4DL3A 4F91B 4QZDA 4US8A 2ZUCA 2JZBA 1RYRA 3ZDAA 4UB4A 1SL2A 2HOFA 5KFGA 5BOLA 3OJUA 2FE9A 4BXOB 8ICTA 4O3QA 4KN4A 2G5IB 3GZFA 1ZQ1C 1NK4A 4ECQA 3J81j 1D9DA 4IQUA 4OJ6A 2VA3A 3SYZA 9ICPA 2BQ3A 4EBEA 1ZD2P 4IR1A 3QUQA 4UATA 3BDPA 1BVSA 1CI4A 1Z4NA 1L3VA 2XI9A 1JMSA 4YXMA 1ZQUA 4JV0A 3E0FA 4PPXA 3C1ZA 2F2AB 2XGPA 5J0TA 1XC9A 5DQGA 4ED8A 3H0LB 1NK8A 2K60A 5CA7A 3GFKB 5ALWA 7ICSA 3F5EA 1KBUA 1BGXT 3G6YA 1ZQIA 2BCQA 2YMMA 5ALQA 4CRXA 1BPDA 2FI1A 3RR7A 2W11A 3AU2A 4R66A 3PR4A 5D4BA 2AHOB 2ISPA 3PW2A 1KL9A 4GIBA 1ZQVA 3GU3A 5ALZA 4ECSA 1U47A 3PW7A 1SL1A 9ICHA 4XQ8A 3T5JA 5ALEA 4RQ4A 2KN7A 3RJGA 2KSOB 2F1JA 2XCAA 4YMOA 1D8YA 3K1ZA 1ZQPA 3ISDA 9ICMA 3KKAC 2ZUDA 2NRTA 4I2IA 4NWIA 4GC6A 3V7LA 5CB1A 2I9GA 1KTQA 2G07A 5H2FU 2KHVA 4Q8FA 3E58A 4EBDA 2GOLA 3FM9A 2R8HA 3CNHA 2R8JA 4O5CA 3QU9A 3NRWA 2K4HA 5DBCA 2PMZF 2HHQA 2WF5A 4KLSA 4DOBA 1NZPA 1ZQKA 3PVXA 3QU7A
chains in the Genus database with same CATH topology
3HT3A 2FPKA 2C2DA 3H4DA 1TK5A 4J9LA 4J9SA 4DSLA 4DL2A 9ICIA 4LVSA 5JUMA 4I2AA 4KLMA 3T5KA 4BWMA 5KG3A 4UB2A 1UA1A 2HHSA 4Z6CA 3ZDCA 1UT5A 4Q8EA 4QWCA 4HYKA 1LV5A 1WCNA 4P4MA 2W9AA 3PY8A 4IR9A 3QEAZ 4RQ8A 1XS9D 2MUTA 4O5EA 2UVRA 4LZDA 4XA5A 7ICMA 5KFAA 4ECUA 5IIJA 4C8LA 2V4RA 8ICJA 3RR8A 5KFSA 1EXNA 4FS2A 1IM4A 4RT2A 3RRHA 2XGQA 5DB8A 3TFSA 4Q44A 5DG7A 3RJJA 5DB6A 3RBEA 3PX4A 1XWLA 5DQHA 5J2HA 8ICRA 5KFEA 4F2RA 4M9LA 2UVUA 4R63A 2HHXA 4I27A 4PHEA 1UA0A 2FMSA 4UAZA 4DQRA 1BPZA 2KTQA 4RNOA 3KHLA 5EWGA 4UAWA 5J0PA 9ICAA 1ZQWA 4J9OA 2Y1IA 3RJEA 3Q8RB 1ZQGA 3C23A 1N48A 2HHVA 1NKBA 1ZQOA 4R8UB 5DLFA 4EZ6A 4JUZA 5KFHA 4RPZA 1MQ2A 3PV8A 4ED2A 1ZQQA 3KTQA 5KFCA 4B9MA 1L3SA 4O0IA 4F5QA 5KG5A 4DQSA 4TUSA 4B9SA 4ECXA 5CWRA 3PO5A 5D46A 5KFIA 3B0XA 2A1JB 7ICIA 3MFIA 5KG4A 3TANA 4F2SA 5J2DA 3NGDA 4GXJA 2ALZA 1ZQHA 1L5UA 3MBYA 5DQIA 3UQ2A 1V9PA 1NJYA 3C21A 2DPJA 2R8IA 1JN3A 3RB6A 4KLUA 4DQQA 2ASDA 2FPMA 3H7IA 1QTMA 2OWOA 4UB1A 4I2FA 2BKEA 5F9NA 9ICKA 1U49A 1S77D 4UB5A 4DS5A 4R64A 4RUAA 3M9NB 5HMMA 4RNNA 4FO6A 1ZJNA 1A76A 4YMNA 9ICVA 2KZMA 2NRXA 1MC8A 3MFHA 4F5NA 4QZ9A 2RDJA 3V7JA 8ICFA 5DG9A 3HWTA 3H8WA 3RH4A 4YR3A 4MF2A 5L1KA 5KFBA 8ICKA 2NRVA 4K4HA 4KLDA 3FYHA 3BQ0A 3LDAA 4DL6A 1RPLA 3V72A 1SKRA 1ZQCA 4DSJA 2BCVA 4MFAA 3C5FA 1KSPA 4B9VA 4RQ3A 5KT2A 9ICEA 1ZQSA 4QZ8A 5KT5A 7ICJA 5KFRA 4IRKA 1BPXA 1TFRA 4ED6A 1WCLA 4RQ7A 1X2IA 9ICWA 3GV8B 4F5PA 5IILA 8ICSA 1L3TA 1JXLA 4JWMA 4Z6DA 5EOZA 3SV3A 1ZQDA 2BPGA 4PHAA 5CR0A 2IBKA 1NKCA 1K1SA 4FS1A 4O5KA 4IQVA 4NLKA 3RJHA 2ZJAA 2W9MA 3T5HA 1NK6A 3T5LA 9ICQA 7ICVA 4F93B 4F4YA 4F5OA 4KLQA 4ECYA 2HVIA 2FLNA 1S0OA 5KFYA 3RAXA 4TUQA 1ZQMA 1HUZA 2UVVA 9ICJA 4YQWA 2KFZA 7ICUA 1BPEA 3NTUA 2IMWP 4E0DA 5J2IA 1COOA 1ZQNA 1T4GA 4R65A 4NM1A 4QZBA 1ZQJA 8ICPA 2BR0A 3IHQB 3TARA 3V7KA 4O9MA 2ZUBA 2P6UA 4NM2A 1ZQXA 2F1HA 4Q43A 5KFQA 3KHHA 2GWSA 8ICUA 5KFTA 4KLLA 4RU9A 1X9MA 4IRCA 4F8RA 5IIIA 3ETLA 1QSYA 1ZJMA 3JPQA 2AGQA 1S10A 4M04A 1Z00B 5KG0A 4YMMA 1ZQRA 2XO7A 2BQUA 4GLXA 1JXEA 5KFNA 1KFTA 2BPCA 4PH5A 3KHRA 4I2CA 4KN7A 3KHGA 1NK0A 2JEJA 9ICBA 4R8UA 4UAYA 4J9KA 3UXPA 3OHAA 5KG1A 4DSEA 1ZQLA 8ICQA 5DKWA 4TQSA 5IIMA 4QZGA 4F4KA 9ICRA 2I1QA 1NK9A 4DFKA 5HNKA 5L9XA 5IINA 2AJQA 2XY7A 5KG2A 4MF8A 2JEGA 4RPXA 2A1JA 4DL5A 4M9GA 3MGHA 4KLEA 5J0UA 4BGDA 1KLNA 5BPCA 3BQTA 4Q45A 2BHNA 2C2RA 2P6RA 4M47A 4DSIA 3GV5B 4K4IA 1A77A 2VA8A 4I2JA 3MR3A 5KFDA 8ICXA 2HHUA 4DOCA 2UVWA 5DBAA 2FMPA 3Q8KA 1D9FA 4UBCA 3B0YA 1HJPA 1Y88A 3LWLA 2ZJ5A 4GC7A 3Q8MA 2ATLA 1NK7A 3MR6A 7ICOA 7ICNA 4O3SA 5J0WA 4QZEA 4PHDA 3G6XA 2ISOA 3HPOA 4MEYA 5KFWA 4YP3A 3JPOA 1S0NA 8ICWA 4ECRA 4P2HA 1NK5A 4ZH4A 5J0RA 9ICUA 4ELUA 1RXVA 3EZ5A 1D8LA 1JX4A 1AROP 3AUOA 4DSKA 3GIMA 7ICQA 4QZIA 3RB4A 5F9LA 4QWDA 7ICTA 3QEBZ 4YR2A 2MAXA 1XU4A 1RXWA 3QE9Y 2NRWA 2C2EA 3T3FA 4F4ZA 1TAQA 1KFDA 2W9CB 4K4GA 5KFLA 3Q8QB 5KTQA 9ICSA 5J29A 7ICPA 3Q8SB 2AGOA 5L1IA 3MABA 3UPQA 4EYHB 2JZBB 4F5RA 3SZ2A 5CHGA 4ELTA 3TQ1A 5HHHA 3H40A 5KFPA 5KT4A 4M9JA 3Q8LA 4QZFA 1N56A 4BWJA 3GV7B 5J0QA 4FBTA 4DL7A 1KDHA 2LYHA 5J2GA 4Z6FA 3PNCA 4DO9A 1ZQFA 2R8KA 4GXKA 1JIHA 4YFKA 4G3IA 3GQCA 1X9SA 3UQ0A 4QZAA 3RH5A 2PFNA 4KTQA 3LWMA 1SKWA 2J6SA 2Y1JA 4FBUA 2JEIA 1KFSA 5L1LA 2HW3A 2KZ3A 3K75D 4X5VA 4M0AA 4RNMA 3PMLA 4KMUA 1C7YA 2BPFA 3JPTA 2V9WA 4RUCA 5KT6A 4ED3A 1ZETA 1CUKA 2AQ0A 2Q0ZX 4F4WA 4KLIA 2BCUA 1Z00A 1KRPA 8ICVA 4QWBA 3HW8A 5J0YA 3C2LA 2ZTCA 4DSFA 9ICTA 3AU6A 3BJYA 4P4PA 4GXIA 1S9FA 2P66A 1NKEA 4I2BA 3ZD8A 5DGAA 1U48A 1ZQAA 8ICLA 5C5JA 8ICHA 4YCXA 2BDPA 1L3UA 4C8NA 2ZJ8A 4ED1A 1U45A 9ICNA 3PX6A 4I29A 3C2MA 3M8RA 3RJKA 4YD1A 4MEXA 3UXOA 7ICKA 8ICZA 3OJSA 4DLEA 3RH6A 1NJWA 3MDCA 2BCSA 3M9OB 2C28A 4I28A 3PW0A 1NOMA 4ED0A 4DWIA 4M9NA 3C5GA 4NLZA 5KFMA 4DEZA 4YR0A 3QZ8A 4M2YA 5DBBA 4ELVA 4EEYA 3JPNA 5KFXA 4DLGA 3TI0A 3K4GA 4TQRA 7ICGA 4RQ1A 4DL4A 3ZDDA 2AU0A 4C8KA 8ICGA 1DGSA 4DS4A 1NJXA 4EYIB 3V6JA 5KFVA 2M9NA 4J9PA 2H5XA 5J2KA 4CCHA 4PGXA 2FLPA 3H8JA 1QLNA 3JPPA 1ZQYA 3OHBA 5KT3A 2XY5A 4B9TA 1MQ3A 2HVHA 7ICHA 5DG8A 2AQ4A 4JV2A 5J0OA 5KFJA 1ZQBA 4IQTA 1S0MA 4ECZA 2FLLA 3M9MB 4O3NA 4M6WB 8ICIA 2XCPA 1RZTA 4YVZA 1T8EA 1QSSA 1XSNA 4P4OA 4O3OA 4J9RA 3RB0A 2KZZA 5J2AA 3GIKA 1ZQEA 1BPBA 4QW9A 1ZQTA 5DB7A 2IHMA 4DFMA 5J2JA 3MDAA 2ASLA 4EZ9A 4XUSA 1TK8A 2W9CA 4DL3A 4F91B 3OGUA 4QZDA 4MFFA 3RJFA 1X9WA 5CP2A 3G6VA 2W8KA 2ZTDA 3SV4A 3EPIA 2ZUCA 4YN4A 2JZBA 3H8SA 4RQ2A 3HX0A 4RT3A 1RYRA 2PFPA 4RPYA 3OSNA 1TKDA 4KLGA 3PR5B 3PMNA 4RQ5A 4UBBA 3H4BA 8ICCA 3N97B 2B21A 4UB4A 3ZDAA 4I2DA 1CEZA 4Z6EA 4TUPA 4DFJA 8ICAA 1SL2A 4KLJA 5D49A 4NXZA 5J2CA 4PGQA 3TAPA 1TV9A 2DPIA 3M8SA 3RRGA 5KFGA 5BOLA 3OJUA 3RTVA 3BQ1A 5HHIA 1U4BA 4ECTA 4BXOB 4QW8A 5BOMA 8ICTA 4IRDA 5KFOA 2PI4A 4O3QA 4KN4A 3RJIA 2W9BB 3RAQA 4BDPA 3FDSA 1NK4A 2J6UA 3IM1A 1SZPA 3V6KA 3GIJA 3ZDBA 4ECQA 1D9DA 5DB9A 3ISBA 5DLGA 4TURA 8ICYA 5DDYA 4QWAA 4IQUA 4DF8A 2VA3A 3SYZA 2VA2A 2BQ3A 9ICPA 4EBEA 4IR1A 5KFUA 4RZRA 2R8GA 3OSPA 3BDPA 1BVSA 1NJZA 4J9MA 4QWEA 5KT7A 1L3VA 4O3RA 4I2GA 1JMSA 4NLGA 3UXNA 1XO1A 3C2KA 3C1YA 4YXMA 4B9LA 1ZQUA 1SL0A 4NY8A 8ICOA 4JV0A 3PX0A 3PW4A 2WTFA 8ICEA 3Q8PB 4PPXA 3C1ZA 1ZQZA 1BPYA 5J0TA 2XGPA 4QZHA 1XC9A 4PHPA 5J2BA 4UQGA 2AGPA 5DQGA 4ED8A 5J2EA 2BGWA 2PXIA 4DFPA 1NK8A 1MSWD 3BQ2A 1XSLA 3E2EA 5CA7A 3GFKB 4C8MA 1S0VA 7ICSA 2F1IA 3PO4A 4IQWA 3JPRA 1T7PA 4F92B 1BGXT 3G6YA 1ZQIA 4DQPA 5EWFA 2MUTB 1TVAA 4I2EA 2BCQA 2IHNA 7ICLA 9ICCA 1B43A 1BPDA 9ICXA 2VANA 5DGBA 2PFQA 4MFCA 3EW9A 5KG6A 2HHWA 3RR7A 3AU2A 3GDXA 9ICOA 4R66A 3PR4A 2C22A 3LK9A 3V6HA 5D4BA 2BQRA 3ZDEA 2XY6A 3GILA 4F4XA 4B9UA 3MR2A 3GIIA 3QZ7A 2ISPA 4ECWA 2XC9A 1IXRA 5HMLA 5J0SA 3PW2A 2J6TA 7ICRA 4M6WA 4JK1A 1PZNA 3N4MB 1ZQVA 4ECSA 3ORYA 3ZD9A 1U47A 3PW7A 2FMQA 8ICBA 1SL1A 2IA6A 9ICHA 1LB2B 2ZTEA 8ICMA 4XQ8A 5EWEA 1T3NA 3T5JA 1S97A 3MR5A 4LZGA 4UB3A 1QSLA 3TFRA 4I2HA 4F3OA 4JV1A 4KLFA 1HUOA 1S76D 4RQ4A 2KN7A 3ISCA 4RQ6A 3RJGA 4B9NA 1RYSA 2F1JA 4J9NA 4KLTA 1TAUA 5CJ7A 4DQIA 4KLOA 4ECVA 1UT8A 4J9QA 2XCAA 4C8OA 1ZYQA 1Z3EB 4YMOA 2JEFA 9ICGA 1D8YA 3PW5A 5L1JA 1ZQPA 3ISDA 7ICFA 9ICMA 2ZUDA 1DOQA 2HHTA 2FPLA 3EWAA 5DDMA 4YG2A 2NRTA 4I2IA 3MGIA 2BCRA 4NLNA 7ICEA 4GC6A 3V7LA 4KITB 5KFFA 5CB1A 5HP4A 3RBDA 1KTQA 2ASJA 5IIKA 4YD2A 3JPSA 2I9GA 5KG7A 4ED7A 4BXOA 4Q8FA 2KFNA 2DFLA 2RDIA 3EYZA 3SI8A 4JWNA 4EBDA 2W9BA 9ICLA 9ICFA 5KFZA 1SKSA 1H38A 5J2FA 2PFOA 1TK0A 8ICNA 1B22A 3EPGA 2R8HA 4XRHA 4DF4A 5IIOA 2W8LA 1XSPA 2R8JA 1KEJA 4F50A 4O5CA 5TZVA 4QZCA 4KLHA 2PI5A 4RQ0A 4EBCA 5J0XA 2V4QA 5DBCA 5KFKA 2NRZA 1K1QA 3RB3A 3THVA 4DOAA 2HHQA 4KLSA 1U9LA 4DOBA 4O3PA 3HP6A 3PVXA 3TAQA 1ZQKA 4YXJA 4PGYA 4M9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HT3 A;  2FPK A;  2C2D A;  3H4D A;  1TK5 A;  4J9L A;  4J9S A;  4DSL A;  4DL2 A;  9ICI A;  4LVS A;  5JUM A;  4I2A A;  4KLM A;  3T5K A;  4BWM A;  5KG3 A;  4UB2 A;  1UA1 A;  2HHS A;  4Z6C A;  3ZDC A;  1UT5 A;  4Q8E A;  4QWC A;  4HYK A;  1LV5 A;  1WCN A;  4P4M A;  2W9A A;  3PY8 A;  4IR9 A;  3QEA Z;  4RQ8 A;  1XS9 D;  2MUT A;  4O5E A;  2UVR A;  4LZD A;  4XA5 A;  7ICM A;  5KFA A;  4ECU A;  5IIJ A;  4C8L A;  2V4R A;  8ICJ A;  3RR8 A;  5KFS A;  1EXN A;  4FS2 A;  1IM4 A;  4RT2 A;  3RRH A;  2XGQ A;  5DB8 A;  3TFS A;  4Q44 A;  5DG7 A;  3RJJ A;  5DB6 A;  3RBE A;  3PX4 A;  1XWL A;  5DQH A;  5J2H A;  8ICR A;  5KFE A;  4F2R A;  4M9L A;  2UVU A;  4R63 A;  2HHX A;  4I27 A;  4PHE A;  1UA0 A;  2FMS A;  4UAZ A;  4DQR A;  1BPZ A;  2KTQ A;  4RNO A;  3KHL A;  5EWG A;  4UAW A;  5J0P A;  9ICA A;  1ZQW A;  4J9O A;  2Y1I A;  3RJE A;  3Q8R B;  1ZQG A;  3C23 A;  1N48 A;  2HHV A;  1NKB A;  1ZQO A;  4R8U B;  5DLF A;  4EZ6 A;  4JUZ A;  5KFH A;  4RPZ A;  1MQ2 A;  3PV8 A;  4ED2 A;  1ZQQ A;  3KTQ A;  5KFC A;  4B9M A;  1L3S A;  4O0I A;  4F5Q A;  5KG5 A;  4DQS A;  4TUS A;  4B9S A;  4ECX A;  5CWR A;  3PO5 A;  5D46 A;  5KFI A;  3B0X A;  2A1J B;  7ICI A;  3MFI A;  5KG4 A;  3TAN A;  4F2S A;  5J2D A;  3NGD A;  4GXJ A;  2ALZ A;  1ZQH A;  1L5U A;  3MBY A;  5DQI A;  3UQ2 A;  1V9P A;  1NJY A;  3C21 A;  2DPJ A;  2R8I A;  1JN3 A;  3RB6 A;  4KLU A;  4DQQ A;  2ASD A;  2FPM A;  3H7I A;  1QTM A;  2OWO A;  4UB1 A;  4I2F A;  2BKE A;  5F9N A;  9ICK A;  1U49 A;  1S77 D;  4UB5 A;  4DS5 A;  4R64 A;  4RUA A;  3M9N B;  5HMM A;  4RNN A;  4FO6 A;  1ZJN A;  1A76 A;  4YMN A;  9ICV A;  2KZM A;  2NRX A;  1MC8 A;  3MFH A;  4F5N A;  4QZ9 A;  2RDJ A;  3V7J A;  8ICF A;  5DG9 A;  3HWT A;  3H8W A;  3RH4 A;  4YR3 A;  4MF2 A;  5L1K A;  5KFB A;  8ICK A;  2NRV A;  4K4H A;  4KLD A;  3FYH A;  3BQ0 A;  3LDA A;  4DL6 A;  1RPL A;  3V72 A;  1SKR A;  1ZQC A;  4DSJ A;  2BCV A;  4MFA A;  3C5F A;  1KSP A;  4B9V A;  4RQ3 A;  5KT2 A;  9ICE A;  1ZQS A;  4QZ8 A;  5KT5 A;  7ICJ A;  5KFR A;  4IRK A;  1BPX A;  1TFR A;  4ED6 A;  1WCL A;  4RQ7 A;  1X2I A;  9ICW A;  3GV8 B;  4F5P A;  5IIL A;  8ICS A;  1L3T A;  1JXL A;  4JWM A;  4Z6D A;  5EOZ A;  3SV3 A;  1ZQD A;  2BPG A;  4PHA A;  5CR0 A;  2IBK A;  1NKC A;  1K1S A;  4FS1 A;  4O5K A;  4IQV A;  4NLK A;  3RJH A;  2ZJA A;  2W9M A;  3T5H A;  1NK6 A;  3T5L A;  9ICQ A;  7ICV A;  4F93 B;  4F4Y A;  4F5O A;  4KLQ A;  4ECY A;  2HVI A;  2FLN A;  1S0O A;  5KFY A;  3RAX A;  4TUQ A;  1ZQM A;  1HUZ A;  2UVV A;  9ICJ A;  4YQW A;  2KFZ A;  7ICU A;  1BPE A;  3NTU A;  2IMW P;  4E0D A;  5J2I A;  1COO A;  1ZQN A;  1T4G A;  4R65 A;  4NM1 A;  4QZB A;  1ZQJ A;  8ICP A;  2BR0 A;  3IHQ B;  3TAR A;  3V7K A;  4O9M A;  2ZUB A;  2P6U A;  4NM2 A;  1ZQX A;  2F1H A;  4Q43 A;  5KFQ A;  3KHH A;  2GWS A;  8ICU A;  5KFT A;  4KLL A;  4RU9 A;  1X9M A;  4IRC A;  4F8R A;  5III A;  3ETL A;  1QSY A;  1ZJM A;  3JPQ A;  2AGQ A;  1S10 A;  4M04 A;  1Z00 B;  5KG0 A;  4YMM A;  1ZQR A;  2XO7 A;  2BQU A;  4GLX A;  1JXE A;  5KFN A;  1KFT A;  2BPC A;  4PH5 A;  3KHR A;  4I2C A;  4KN7 A;  3KHG A;  1NK0 A;  2JEJ A;  9ICB A;  4R8U A;  4UAY A;  4J9K A;  3UXP A;  3OHA A;  5KG1 A;  4DSE A;  1ZQL A;  8ICQ A;  5DKW A;  4TQS A;  5IIM A;  4QZG A;  4F4K A;  9ICR A;  2I1Q A;  1NK9 A;  4DFK A;  5HNK A;  5L9X A;  5IIN A;  2AJQ A;  2XY7 A;  5KG2 A;  4MF8 A;  2JEG A;  4RPX A;  2A1J A;  4DL5 A;  4M9G A;  3MGH A;  4KLE A;  5J0U A;  4BGD A;  1KLN A;  5BPC A;  3BQT A;  4Q45 A;  2BHN A;  2C2R A;  2P6R A;  4M47 A;  4DSI A;  3GV5 B;  4K4I A;  1A77 A;  2VA8 A;  4I2J A;  3MR3 A;  5KFD A;  8ICX A;  2HHU A;  4DOC A;  2UVW A;  5DBA A;  2FMP A;  3Q8K A;  1D9F A;  4UBC A;  3B0Y A;  1HJP A;  1Y88 A;  3LWL A;  2ZJ5 A;  4GC7 A;  3Q8M A;  2ATL A;  1NK7 A;  3MR6 A;  7ICO A;  7ICN A;  4O3S A;  5J0W A;  4QZE A;  4PHD A;  3G6X A;  2ISO A;  3HPO A;  4MEY A;  5KFW A;  4YP3 A;  3JPO A;  1S0N A;  8ICW A;  4ECR A;  4P2H A;  1NK5 A;  4ZH4 A;  5J0R A;  9ICU A;  4ELU A;  1RXV A;  3EZ5 A;  1D8L A;  1JX4 A;  1ARO P;  3AUO A;  4DSK A;  3GIM A;  7ICQ A;  4QZI A;  3RB4 A;  5F9L A;  4QWD A;  7ICT A;  3QEB Z;  4YR2 A;  2MAX A;  1XU4 A;  1RXW A;  3QE9 Y;  2NRW A;  2C2E A;  3T3F A;  4F4Z A;  1TAQ A;  1KFD A;  2W9C B;  4K4G A;  5KFL A;  3Q8Q B;  5KTQ A;  9ICS A;  5J29 A;  7ICP A;  3Q8S B;  2AGO A;  5L1I A;  3MAB A;  3UPQ A;  4EYH B;  2JZB B;  4F5R A;  3SZ2 A;  5CHG A;  4ELT A;  3TQ1 A;  5HHH A;  3H40 A;  5KFP A;  5KT4 A;  4M9J A;  3Q8L A;  4QZF A;  1N56 A;  4BWJ A;  3GV7 B;  5J0Q A;  4FBT A;  4DL7 A;  1KDH A;  2LYH A;  5J2G A;  4Z6F A;  3PNC A;  4DO9 A;  1ZQF A;  2R8K A;  4GXK A;  1JIH A;  4YFK A;  4G3I A;  3GQC A;  1X9S A;  3UQ0 A;  4QZA A;  3RH5 A;  2PFN A;  4KTQ A;  3LWM A;  1SKW A;  2J6S A;  2Y1J A;  4FBU A;  2JEI A;  1KFS A;  5L1L A;  2HW3 A;  2KZ3 A;  3K75 D;  4X5V A;  4M0A A;  4RNM A;  3PML A;  4KMU A;  1C7Y A;  2BPF A;  3JPT A;  2V9W A;  4RUC A;  5KT6 A;  4ED3 A;  1ZET A;  1CUK A;  2AQ0 A;  2Q0Z X;  4F4W A;  4KLI A;  2BCU A;  1Z00 A;  1KRP A;  8ICV A;  4QWB A;  3HW8 A;  5J0Y A;  3C2L A;  2ZTC A;  4DSF A;  9ICT A;  3AU6 A;  3BJY A;  4P4P A;  4GXI A;  1S9F A;  2P66 A;  1NKE A;  4I2B A;  3ZD8 A;  5DGA A;  1U48 A;  1ZQA A;  8ICL A;  5C5J A;  8ICH A;  4YCX A;  2BDP A;  1L3U A;  4C8N A;  2ZJ8 A;  4ED1 A;  1U45 A;  9ICN A;  3PX6 A;  4I29 A;  3C2M A;  3M8R A;  3RJK A;  4YD1 A;  4MEX A;  3UXO A;  7ICK A;  8ICZ A;  3OJS A;  4DLE A;  3RH6 A;  1NJW A;  3MDC A;  2BCS A;  3M9O B;  2C28 A;  4I28 A;  3PW0 A;  1NOM A;  4ED0 A;  4DWI A;  4M9N A;  3C5G A;  4NLZ A;  5KFM A;  4DEZ A;  4YR0 A;  3QZ8 A;  4M2Y A;  5DBB A;  4ELV A;  4EEY A;  3JPN A;  5KFX A;  4DLG A;  3TI0 A;  3K4G A;  4TQR A;  7ICG A;  4RQ1 A;  4DL4 A;  3ZDD A;  2AU0 A;  4C8K A;  8ICG A;  1DGS A;  4DS4 A;  1NJX A;  4EYI B;  3V6J A;  5KFV A;  2M9N A;  4J9P A;  2H5X A;  5J2K A;  4CCH A;  4PGX A;  2FLP A;  3H8J A;  1QLN A;  3JPP A;  1ZQY A;  3OHB A;  5KT3 A;  2XY5 A;  4B9T A;  1MQ3 A;  2HVH A;  7ICH A;  5DG8 A;  2AQ4 A;  4JV2 A;  5J0O A;  5KFJ A;  1ZQB A;  4IQT A;  1S0M A;  4ECZ A;  2FLL A;  3M9M B;  4O3N A;  4M6W B;  8ICI A;  2XCP A;  1RZT A;  4YVZ A;  1T8E A;  1QSS A;  1XSN A;  4P4O A;  4O3O A;  4J9R A;  3RB0 A;  2KZZ A;  5J2A A;  3GIK A;  1ZQE A;  1BPB A;  4QW9 A;  1ZQT A;  5DB7 A;  2IHM A;  4DFM A;  5J2J A;  3MDA A;  2ASL A;  4EZ9 A;  4XUS A;  1TK8 A;  2W9C A;  4DL3 A;  4F91 B;  3OGU A;  4QZD A;  4MFF A;  3RJF A;  1X9W A;  5CP2 A;  3G6V A;  2W8K A;  2ZTD A;  3SV4 A;  3EPI A;  2ZUC A;  4YN4 A;  2JZB A;  3H8S A;  4RQ2 A;  3HX0 A;  4RT3 A;  1RYR A;  2PFP A;  4RPY A;  3OSN A;  1TKD A;  4KLG A;  3PR5 B;  3PMN A;  4RQ5 A;  4UBB A;  3H4B A;  8ICC A;  3N97 B;  2B21 A;  4UB4 A;  3ZDA A;  4I2D A;  1CEZ A;  4Z6E A;  4TUP A;  4DFJ A;  8ICA A;  1SL2 A;  4KLJ A;  5D49 A;  4NXZ A;  5J2C A;  4PGQ A;  3TAP A;  1TV9 A;  2DPI A;  3M8S A;  3RRG A;  5KFG A;  5BOL A;  3OJU A;  3RTV A;  3BQ1 A;  5HHI A;  1U4B A;  4ECT A;  4BXO B;  4QW8 A;  5BOM A;  8ICT A;  4IRD A;  5KFO A;  2PI4 A;  4O3Q A;  4KN4 A;  3RJI A;  2W9B B;  3RAQ A;  4BDP A;  3FDS A;  1NK4 A;  2J6U A;  3IM1 A;  1SZP A;  3V6K A;  3GIJ A;  3ZDB A;  4ECQ A;  1D9D A;  5DB9 A;  3ISB A;  5DLG A;  4TUR A;  8ICY A;  5DDY A;  4QWA A;  4IQU A;  4DF8 A;  2VA3 A;  3SYZ A;  2VA2 A;  2BQ3 A;  9ICP A;  4EBE A;  4IR1 A;  5KFU A;  4RZR A;  2R8G A;  3OSP A;  3BDP A;  1BVS A;  1NJZ A;  4J9M A;  4QWE A;  5KT7 A;  1L3V A;  4O3R A;  4I2G A;  1JMS A;  4NLG A;  3UXN A;  1XO1 A;  3C2K A;  3C1Y A;  4YXM A;  4B9L A;  1ZQU A;  1SL0 A;  4NY8 A;  8ICO A;  4JV0 A;  3PX0 A;  3PW4 A;  2WTF A;  8ICE A;  3Q8P B;  4PPX A;  3C1Z A;  1ZQZ A;  1BPY A;  5J0T A;  2XGP A;  4QZH A;  1XC9 A;  4PHP A;  5J2B A;  4UQG A;  2AGP A;  5DQG A;  4ED8 A;  5J2E A;  2BGW A;  2PXI A;  4DFP A;  1NK8 A;  1MSW D;  3BQ2 A;  1XSL A;  3E2E A;  5CA7 A;  3GFK B;  4C8M A;  1S0V A;  7ICS A;  2F1I A;  3PO4 A;  4IQW A;  3JPR A;  1T7P A;  4F92 B;  1BGX T;  3G6Y A;  1ZQI A;  4DQP A;  5EWF A;  2MUT B;  1TVA A;  4I2E A;  2BCQ A;  2IHN A;  7ICL A;  9ICC A;  1B43 A;  1BPD A;  9ICX A;  2VAN A;  5DGB A;  2PFQ A;  4MFC A;  3EW9 A;  5KG6 A;  2HHW A;  3RR7 A;  3AU2 A;  3GDX A;  9ICO A;  4R66 A;  3PR4 A;  2C22 A;  3LK9 A;  3V6H A;  5D4B A;  2BQR A;  3ZDE A;  2XY6 A;  3GIL A;  4F4X A;  4B9U A;  3MR2 A;  3GII A;  3QZ7 A;  2ISP A;  4ECW A;  2XC9 A;  1IXR A;  5HML A;  5J0S A;  3PW2 A;  2J6T A;  7ICR A;  4M6W A;  4JK1 A;  1PZN A;  3N4M B;  1ZQV A;  4ECS A;  3ORY A;  3ZD9 A;  1U47 A;  3PW7 A;  2FMQ A;  8ICB A;  1SL1 A;  2IA6 A;  9ICH A;  1LB2 B;  2ZTE A;  8ICM A;  4XQ8 A;  5EWE A;  1T3N A;  3T5J A;  1S97 A;  3MR5 A;  4LZG A;  4UB3 A;  1QSL A;  3TFR A;  4I2H A;  4F3O A;  4JV1 A;  4KLF A;  1HUO A;  1S76 D;  4RQ4 A;  2KN7 A;  3ISC A;  4RQ6 A;  3RJG A;  4B9N A;  1RYS A;  2F1J A;  4J9N A;  4KLT A;  1TAU A;  5CJ7 A;  4DQI A;  4KLO A;  4ECV A;  1UT8 A;  4J9Q A;  2XCA A;  4C8O A;  1ZYQ A;  1Z3E B;  4YMO A;  2JEF A;  9ICG A;  1D8Y A;  3PW5 A;  5L1J A;  1ZQP A;  3ISD A;  7ICF A;  9ICM A;  2ZUD A;  1DOQ A;  2HHT A;  2FPL A;  3EWA A;  5DDM A;  4YG2 A;  2NRT A;  4I2I A;  3MGI A;  2BCR A;  4NLN A;  7ICE A;  4GC6 A;  3V7L A;  4KIT B;  5KFF A;  5CB1 A;  5HP4 A;  3RBD A;  1KTQ A;  2ASJ A;  5IIK A;  4YD2 A;  3JPS A;  2I9G A;  5KG7 A;  4ED7 A;  4BXO A;  4Q8F A;  2KFN A;  2DFL A;  2RDI A;  3EYZ A;  3SI8 A;  4JWN A;  4EBD A;  2W9B A;  9ICL A;  9ICF A;  5KFZ A;  1SKS A;  1H38 A;  5J2F A;  2PFO A;  1TK0 A;  8ICN A;  1B22 A;  3EPG A;  2R8H A;  4XRH A;  4DF4 A;  5IIO A;  2W8L A;  1XSP A;  2R8J A;  1KEJ A;  4F50 A;  4O5C A;  5TZV A;  4QZC A;  4KLH A;  2PI5 A;  4RQ0 A;  4EBC A;  5J0X A;  2V4Q A;  5DBC A;  5KFK A;  2NRZ A;  1K1Q A;  3RB3 A;  3THV A;  4DOA A;  2HHQ A;  4KLS A;  1U9L A;  4DOB A;  4O3P A;  3HP6 A;  3PVX A;  3TAQ A;  1ZQK A;  4YXJ A;  4PGY A;  4M9H A; 
#chains in the Genus database with same CATH topology
 2FPK A;  2KKP A;  5JUM A;  3QX7 A;  5T14 A;  1GO3 F;  3PY8 A;  4PZN A;  4ACO A;  4XA5 A;  5KFA A;  8ICJ A;  2G08 A;  5ALY A;  1WWV A;  5ALF A;  4EX6 A;  3RJJ A;  1B0X A;  5DQH A;  1RQL A;  2KIV A;  4I27 A;  1BPZ A;  4RNO A;  5AKE A;  3KHL A;  2YB4 A;  9ICA A;  1SXE A;  1ZQO A;  5DLF A;  2BDU A;  3FAH A;  3ALR A;  5EE1 A;  4O0I A;  5KG5 A;  2WFA A;  2KKV A;  4B9S A;  5CWR A;  3WK7 A;  5AK3 A;  1S5L U;  1ZOL A;  4F2S A;  5AIC A;  3NGD A;  1V9P A;  3H7I A;  2BKE A;  5F9N A;  4PJ0 U;  1OUQ A;  3I28 A;  5K4L A;  2ZIX B;  3V7J A;  5DG9 A;  3HWT A;  2ES6 A;  2KV2 A;  5L1K A;  1A0P A;  5KFB A;  1FO4 A;  8ICK A;  1FFV A;  1YZ7 A;  3WK6 A;  3ZI4 A;  1RPL A;  1SKR A;  2G5H B;  2KVS A;  2B6G A;  4OJ5 A;  5KT5 A;  7ICJ A;  4IRK A;  1TFR A;  1WCL A;  1Z4O A;  3GV8 B;  1X6J A;  2H3Z A;  4QIW C;  2W7P A;  4NL9 A;  4IQV A;  3TAC B;  2ZJA A;  5AM1 A;  4KMO B;  4F5O A;  2HVI A;  2FLN A;  5KFY A;  2BZF A;  2YTU A;  1ZQM A;  1TAM A;  7ICU A;  1QQ5 A;  1BPE A;  2IMW P;  5CRX A;  1COO A;  1T4G A;  5TIS U;  4R65 A;  4NM1 A;  2H3Q A;  3WK8 A;  2BR0 A;  2ZUB A;  2P6U A;  2GWS A;  8ICU A;  5KFQ A;  1X9M A;  4F8R A;  4M04 A;  1ZQR A;  5KFN A;  2BPC A;  1OXJ A;  4PH5 A;  1BNP A;  4KN7 A;  1FEZ A;  5ALI A;  2YN4 A;  2JEJ A;  4J9K A;  1ZXI A;  8ICQ A;  4TQS A;  2CRX A;  2D3D A;  5J8Y A;  4MF8 A;  4FZM A;  2A1J A;  2F44 A;  4USA A;  4BJQ A;  4Q45 A;  2P6R A;  1V85 A;  2QLT A;  2KOB A;  3LYS A;  5DBA A;  4GC7 A;  1KW4 A;  1NK7 A;  4CF5 A;  2A19 A;  3F2B A;  4FZN A;  5KL8 B;  4O3S A;  4PHD A;  3G6X A;  3HPO A;  5KFW A;  2QB0 B;  8ICW A;  3DV9 A;  4ZH4 A;  4ELU A;  2RP5 A;  3BQ7 A;  1D8L A;  2ZIV A;  2JMG A;  3QUT A;  3AUO A;  2QB1 A;  4QZI A;  3RB4 A;  4YR2 A;  1XU4 A;  2F8K A;  1TAQ A;  1KFD A;  5ALJ A;  3Q8S B;  1X6I A;  2DKX A;  3IV6 A;  3F2D A;  5AKJ A;  5AIB A;  4GFJ A;  4Y2Y A;  2DQN B;  3GV7 B;  3PSF A;  2LYH A;  3PNC A;  5C0Y A;  4GXK A;  4QZA A;  2PKE A;  2MSN A;  2WF7 A;  2CXY A;  5ALN A;  2IOF K;  3AMZ A;  4FBU A;  2HW3 A;  5L1L A;  5A0L A;  2BPF A;  1L8L A;  2V9W A;  4RUC A;  1CUK A;  2AQ0 A;  2Y9T A;  1WG8 A;  3NRZ A;  3HW8 A;  5J0Y A;  3UMB A;  3BJY A;  4P4P A;  1ZQA A;  5C5J A;  2ZJ8 A;  4C7Y A;  4ED1 A;  1U45 A;  9ICN A;  3PX6 A;  5ALO A;  3M8R A;  5L1M A;  3RJK A;  4MEX A;  7ICK A;  4G9B A;  2ESE A;  3MDC A;  3QXG A;  3M9O B;  4M9N A;  4NLZ A;  4DEZ A;  4M2Y A;  1SWW A;  4EEY A;  4DLG A;  3K4G A;  4DL4 A;  3PST A;  5AKI A;  1DGS A;  3V6J A;  3BZC A;  3M7D A;  4C4T A;  5KNI A;  3AM9 A;  1COK A;  3H8J A;  1QLN A;  3JPP A;  1ZQY A;  3OHB A;  7ICH A;  1S0M A;  2ZIU B;  2FLL A;  8ICI A;  4YVZ A;  2W7O A;  1RG6 A;  4QW9 A;  1ZQT A;  5DB7 A;  4XUS A;  5ALH A;  2E8P A;  2W8K A;  3EPI A;  3H8S A;  4QIW F;  4RQ2 A;  4RPY A;  5ALX A;  8ICC A;  3N97 B;  1PK1 B;  4I2D A;  5F3X B;  1CEZ A;  4DFJ A;  4KLJ A;  3RRG A;  3QU4 A;  3M6Z A;  4ECT A;  4QW8 A;  1VDV A;  2W9B B;  2W03 A;  1SZP A;  3IM1 A;  5DB9 A;  8ICY A;  4UB6 U;  1N62 A;  1PK3 A;  5KFU A;  4RZR A;  2R8G A;  4OJO A;  4J9M A;  4QWE A;  5AKY A;  4O3R A;  3UXN A;  3C2K A;  4NY8 A;  2MU2 A;  2WTF A;  2W3S A;  1BPY A;  4BUG A;  1IIP A;  4PHP A;  4DFP A;  3NAS A;  3I1Y A;  3PO4 A;  5ALG A;  1T7P A;  1T94 A;  3WKD A;  2MUT B;  7ICL A;  5G5H A;  2IHN A;  9ICC A;  9ICX A;  4MFC A;  1MA7 A;  1SB3 C;  3QU2 A;  4NLB A;  3TAD C;  3QZ7 A;  4CNQ A;  2XC9 A;  1IXR A;  5J0S A;  2J6T A;  4M6W A;  4JK1 A;  4FZL A;  4P0Q B;  1PZN A;  5AKL A;  4B6J A;  3ZD9 A;  2LM1 A;  2FMQ A;  1S97 A;  4LZG A;  2JH7 A;  2HBJ A;  4U7C A;  5EE0 A;  4KLF A;  1S76 D;  4RQ6 A;  4KLT A;  3O0F A;  4OD0 A;  1TAU A;  3ED5 A;  5CJ7 A;  4DQI A;  4KLO A;  4J9Q A;  2JEF A;  5ALS A;  3PW5 A;  3WK5 A;  2FPL A;  4YG2 A;  3MGI A;  3IDW A;  1UHU A;  3JPS A;  4ED7 A;  2DWQ A;  3SD7 A;  2DFL A;  2KFN A;  1LKY B;  3SI8 A;  4QNL A;  9ICL A;  2FDR A;  1SKS A;  3L5K A;  1SV0 C;  4DF4 A;  3WKE A;  5IIO A;  1XSP A;  1KEJ A;  4F50 A;  2ZXH A;  4KLH A;  2GH1 A;  4EBC A;  3RB3 A;  3THV A;  5AI4 A;  2EQY A;  5KAF U;  3NS1 A;  4PGY A;  4I2G A;  4M9H A;  3HT3 A;  3HJE A;  2C2D A;  3UMC A;  1FIQ A;  4DL2 A;  5ALP A;  4KLM A;  1UA1 A;  4UB2 A;  3ZDC A;  1UT5 A;  3WK9 A;  2YY6 A;  3QEA Z;  2UVR A;  5AK6 A;  2P35 A;  4ECU A;  4UB8 U;  1EXN A;  4RT2 A;  2XGQ A;  2G0A A;  3RBE A;  3PX4 A;  4F2R A;  1NZB A;  1ECW A;  2Q4T A;  2HHX A;  2FMS A;  4DQR A;  4UAW A;  4CE6 A;  5J0P A;  1L7N A;  2NYV A;  3Q8R B;  1ZQG A;  1N48 A;  4JB3 A;  3LVV A;  4RPZ A;  1MQ2 A;  3K1R B;  3PV8 A;  1ZQQ A;  3KTQ A;  4UAS A;  2ZIW B;  4TUS A;  2I5H A;  3B0X A;  2G06 A;  2E5S A;  4P0P A;  3WKB A;  1RQN A;  3TAN A;  5J2D A;  2ALZ A;  3CP8 A;  1NJY A;  1K5O A;  2D6F C;  2R8I A;  2OEH A;  4I2F A;  2ASD A;  2OWO A;  5AM5 A;  1SGG A;  9ICK A;  4UAV A;  4RUA A;  2L5Y A;  3MFH A;  2RDJ A;  4NJ8 A;  3RH4 A;  4MF2 A;  4RQN A;  3LVW A;  2E1E A;  4K4H A;  1DXS A;  4KLD A;  3FYH A;  3BQ0 A;  4B9V A;  1A6S A;  2JRZ A;  5KT2 A;  4ED6 A;  5AI8 A;  2OHF A;  1L3T A;  1JXL A;  4JWM A;  2BPG A;  4PHA A;  2IBK A;  4C0Z A;  4DFD A;  4O5K A;  2W9M A;  3KKA A;  1NK6 A;  2EZX A;  3T5L A;  4KLQ A;  3QYP A;  4AYB C;  2F8L A;  1HUZ A;  2KFZ A;  3PZP A;  1ZQJ A;  1TE2 A;  3IHQ B;  3V7K A;  4O9M A;  2KNJ A;  3BS5 B;  2F1H A;  1AQ6 A;  5AM4 A;  3M1Y A;  3JPQ A;  2AGQ A;  1S10 A;  5KG0 A;  2CPR A;  2XO7 A;  1JXE A;  3KHG A;  1NK0 A;  2ZXI A;  4R8U A;  3UXP A;  3OHA A;  5KG1 A;  4DSE A;  2NV3 A;  1ZQL A;  4LJX A;  4F4K A;  9ICR A;  1NK9 A;  4DFK A;  5IIN A;  3VCB A;  2MA1 A;  3N28 A;  4RPX A;  2YX8 A;  2Y9U A;  4M47 A;  2VJ4 A;  1X42 A;  1A77 A;  4I2J A;  3ONN A;  2HHU A;  4DOC A;  2Y0S C;  2DKZ A;  1HJP A;  3LWL A;  2ZJ5 A;  4PZO A;  2HOQ A;  2DL0 A;  4QZE A;  2JH1 A;  1Q46 A;  4YP3 A;  1S0N A;  4US9 A;  2FJ6 A;  4P2H A;  1NK5 A;  3KZI U;  2JR5 A;  9ICU A;  1RXV A;  2LI6 A;  4DSK A;  3GIM A;  7ICQ A;  1Q8K A;  2HBK A;  4U6P A;  5B66 U;  3F53 A;  4KX3 A;  1N5X A;  2NRW A;  1M6Y A;  2W9C B;  5KFL A;  1F44 A;  5J29 A;  7ICP A;  4EYH B;  2JZB B;  5CHG A;  1HIW A;  1UPH A;  2AH5 A;  5KT4 A;  3L3F X;  5J0Q A;  4DL7 A;  1KDH A;  3IN5 A;  4DO9 A;  1ZQF A;  2R8K A;  1X9S A;  5HR6 A;  2PFN A;  5AI9 A;  5G5G A;  2YMQ A;  3PSI A;  2DUY A;  2MRL A;  2Q0Z X;  2BCU A;  1Z00 A;  4Y2J A;  2M0N A;  5ALV A;  3C2L A;  2ZTC A;  3AU6 A;  2ZIU A;  1S9F A;  5AM3 A;  8ICL A;  2BDP A;  1WUD A;  4KX5 A;  4ICA A;  4I29 A;  3C2M A;  3IRU A;  4YD1 A;  3OJS A;  4ED0 A;  3C5G A;  5KFM A;  4YR0 A;  4ELV A;  4C7Z A;  4TQR A;  4DS4 A;  1NJX A;  4EYI B;  5CEH A;  3KOO A;  4NL9 C;  1L6N A;  2QAR A;  5KT3 A;  1MQ3 A;  5KFJ A;  1ZQB A;  2OXO A;  4NLC A;  3M9M B;  1T8E A;  4P4O A;  4Y2U A;  1BPB A;  2IHM A;  4EEK A;  4CGZ A;  1N63 A;  4EZ9 A;  1SIJ A;  3F2C A;  3IG5 A;  4MFF A;  3RJF A;  1X9W A;  4Y2X A;  2ZTD A;  4YN4 A;  3AL0 B;  3HX0 A;  4RT3 A;  2PFP A;  3OSN A;  3H4B A;  1PVR A;  2B21 A;  4AYB F;  3KFU F;  3WKC A;  5D49 A;  4PGQ A;  1QQ6 A;  5J2C A;  3M8S A;  5J8Y C;  3RTV A;  5HHI A;  2F76 X;  1U4B A;  3QUC A;  2KHQ A;  5KFO A;  4BDP A;  3RAQ A;  3FDS A;  2J6U A;  3V6K A;  3ISB A;  5DLG A;  4TUR A;  2JHD A;  5DDY A;  4QWA A;  2H3F A;  2KJ9 A;  4DF8 A;  2VA2 A;  2R18 A;  2XVT A;  4CDG A;  1ED1 A;  1J2M A;  3OSP A;  2XID A;  4UW9 A;  1NJZ A;  3PSP A;  5KT7 A;  3C1Y A;  4B9L A;  8ICO A;  3PX0 A;  8ICE A;  4EX7 A;  1ZQZ A;  4QZH A;  2AGP A;  4UQG A;  2PXI A;  1MSW D;  2K8C B;  1XSL A;  1L8O A;  4C8M A;  1S0V A;  2F1I A;  4IQW A;  3H8M A;  5EE3 A;  4F92 B;  4DQP A;  3WK4 A;  2W43 A;  5EWF A;  2ZG6 A;  2K8B B;  2Y0S F;  5DGB A;  3KBB A;  1O03 A;  3EW9 A;  2HHW A;  3GDX A;  2KG5 A;  2KIC A;  3LK9 A;  2A1A A;  2LKY A;  2BQR A;  2XY6 A;  2WF9 A;  3GIL A;  4B9U A;  3SAF A;  1N5W A;  3MR2 A;  3GII A;  1URJ A;  2A3V A;  1VLB A;  7ICR A;  3N4M B;  2LYA A;  5KL1 B;  3ORY A;  2JGA A;  2IA6 A;  2ZTE A;  5EWE A;  2YQE A;  3MR5 A;  4UB3 A;  1P7D A;  4JV1 A;  2KE7 A;  1N2X A;  2GO7 A;  2HCF A;  1RYS A;  4J9N A;  1UT8 A;  1ZYQ A;  1Z3E B;  4A8E A;  3AQE A;  1UQV A;  1DOQ A;  2XIC A;  5DDM A;  2CN1 A;  5AI0 A;  2ASJ A;  5IIK A;  4YD2 A;  4CF4 A;  4BXO A;  4OO1 J;  2RDI A;  4JWN A;  9ICF A;  1H38 A;  2PFO A;  4RQM A;  4O3M A;  1TK0 A;  8ICN A;  1B22 A;  4IS7 A;  2W8L A;  5J0X A;  5KFK A;  2NRZ A;  5JTI A;  4DOA A;  2WF6 A;  1U9L A;  3HP6 A;  2LPE A;  3H4D A;  2I6X A;  2AXT U;  3L4P A;  4J9S A;  2OM6 A;  9ICI A;  3T5K A;  2ZIW A;  2HHS A;  4Z6C A;  2K4P A;  4QWC A;  4HYK A;  4P4M A;  2D8C A;  4IR9 A;  2EDU A;  1XS9 D;  4O5E A;  2B0C A;  1MN8 A;  3RR8 A;  4FS2 A;  1IM4 A;  3NVW A;  3RRH A;  4BX9 C;  5DB8 A;  3TFS A;  2GLE A;  5DB6 A;  2ODG A;  8ICR A;  4M9L A;  4R63 A;  4PHE A;  1UA0 A;  4UAZ A;  2KTQ A;  3SAH A;  5EWG A;  2OCE A;  2O6K A;  3C23 A;  2HHV A;  4EZ6 A;  4PL1 A;  4JUZ A;  5KFH A;  4B9M A;  4ED2 A;  4F71 A;  4OJP A;  2RQ5 A;  4DCC A;  3PO5 A;  5KFI A;  2KSO A;  2A1J B;  3MFI A;  1Q3V A;  1ZQH A;  3MBY A;  3UQ2 A;  2WB1 C;  3RF9 A;  1JN3 A;  2KJ8 A;  1SV4 A;  5HR7 A;  1U49 A;  4UB5 A;  4R64 A;  3M9N B;  5HMM A;  4FO6 A;  2RHF A;  1A76 A;  4YMN A;  9ICV A;  2EAO A;  2KZM A;  3NVY A;  1MC8 A;  1Z1V A;  4YR3 A;  2K4E A;  1T3Q A;  2NRV A;  2ZIV B;  4DL6 A;  1FFU A;  1NNL A;  3V72 A;  5JRT A;  3C5F A;  9ICE A;  4QZ8 A;  1BPX A;  3SEN A;  1V38 A;  4RQ7 A;  1J2N A;  5IIL A;  8ICS A;  1SWV A;  1RDF A;  4Z6D A;  1VJ5 A;  5EOZ A;  3SV3 A;  1ZQD A;  1K1S A;  3T5H A;  3UMG A;  9ICQ A;  5AKG A;  9ICJ A;  1IG6 A;  1QCK A;  1QH9 A;  8ICP A;  4NM2 A;  1L7P A;  5AI6 A;  2IOH A;  4KLL A;  1ZD5 A;  4IRC A;  1CRX A;  5III A;  3ETL A;  1QSY A;  1ZJM A;  2BQU A;  1DGJ A;  1X9X A;  4I2C A;  9ICB A;  2KIW A;  3SR6 A;  2I1Q A;  5HNK A;  5L9X A;  1DK2 A;  3DDH A;  5KG2 A;  2JEG A;  4DL5 A;  4KLE A;  5J0U A;  4BGD A;  1KLN A;  2BHN A;  4DSI A;  4FE3 A;  4K4I A;  3MR3 A;  2VA8 A;  2W55 A;  5EE9 A;  3ICX A;  3Q8K A;  1D9F A;  2E8O A;  4UBC A;  2W04 A;  2ATL A;  3VC8 A;  3A0H U;  7ICO A;  3MR6 A;  1F5S A;  7ICN A;  4C80 A;  2ZIX A;  1UCV A;  3JPO A;  1XO0 A;  1JI7 A;  5J0R A;  3EZ5 A;  7ICT A;  4QWD A;  2MAX A;  1LVH A;  2H3I A;  4K4G A;  3Q8Q B;  5L1I A;  3MAB A;  3UPQ A;  1RYU A;  4F5R A;  3SZ2 A;  4ELT A;  3NVV A;  3H40 A;  5KFP A;  4IL6 U;  1JAL A;  4M9J A;  3Q8L A;  1YZ6 A;  4FBT A;  4BWJ A;  4Z6F A;  4YFK A;  2E1F A;  3QU5 A;  4KTQ A;  1SKW A;  3NUQ A;  2J6S A;  1KFS A;  2WF8 A;  4KMU A;  5AK4 A;  1C7Y A;  3JPT A;  4Y2S A;  3N7P D;  4ED3 A;  4KLI A;  8ICV A;  5AM2 A;  4WJ3 B;  1NI3 A;  4DSF A;  9ICT A;  4UAU A;  1NKE A;  4I2B A;  1U48 A;  1V97 A;  8ICH A;  4YCX A;  1L3U A;  2EAM A;  4OCZ A;  1PVQ A;  3UXO A;  4DLE A;  3RH6 A;  1NJW A;  2C28 A;  3PW0 A;  1NOM A;  4DWI A;  3SMV A;  5DBB A;  2EZY A;  3EUB 2;  3JPN A;  5KFX A;  3TI0 A;  4RQ1 A;  2WB1 F;  3ZDD A;  4C8K A;  3U26 A;  2VIX A;  3WU2 U;  5KFV A;  2M9N A;  3UM9 A;  4J9P A;  5J2K A;  2FLP A;  2XY5 A;  1DK3 A;  2HVH A;  3KZX A;  5ALR A;  5DG8 A;  2QB0 A;  4JV2 A;  4ECZ A;  4O3N A;  4M6W B;  1X40 A;  2XCP A;  1Q3U A;  1RZT A;  1XSN A;  4O3O A;  4J9R A;  5FP0 A;  5JU5 A;  4F72 A;  3GIK A;  1ZQE A;  3AEV A;  3M6K A;  4DFM A;  5J2J A;  1XNS A;  1TK8 A;  3OGU A;  1KKX A;  5CP2 A;  3G6V A;  3SV4 A;  1QQ7 A;  3H0R B;  1N60 A;  3H0M B;  1TKD A;  4KLG A;  3PR5 B;  3PMN A;  4RQ5 A;  4UBB A;  2F3N A;  4Y2T A;  4Z6E A;  4TUP A;  8ICA A;  2DPI A;  4NXZ A;  1TV9 A;  1YT3 A;  3TAP A;  3BQ1 A;  1ZD4 A;  5BOM A;  4IRD A;  2PI4 A;  3RJI A;  2YML A;  3IP4 B;  3GIJ A;  3ZDB A;  1PUZ A;  2DF4 B;  3WKA A;  3FC4 A;  3IG8 A;  4NLG A;  1XO1 A;  4J03 A;  1SL0 A;  5AM0 A;  3PW4 A;  2OYY A;  3Q8P B;  2NO4 A;  3S6J A;  2KK0 A;  2EAP A;  5J2B A;  5J2E A;  2BGW A;  2JV3 A;  3BQ2 A;  3E2E A;  3T79 A;  3JPR A;  1TVA A;  4I2E A;  4FFD A;  1B43 A;  5AKX A;  2VAN A;  2PFQ A;  5E79 U;  5KG6 A;  9ICO A;  2C22 A;  3V6H A;  3ZDE A;  4F4X A;  4ECW A;  5HML A;  1HEK A;  3HKZ C;  2H3V A;  3HRD D;  5AIA A;  3SQI A;  4EEL A;  8ICB A;  2EAN A;  1LB2 B;  8ICM A;  1T3N A;  2VJ5 A;  4I2H A;  1QSL A;  3TFR A;  4F3O A;  1HUO A;  1L7O A;  3ISC A;  1KQQ A;  4B9N A;  1B4F A;  2W54 A;  3CW2 C;  4P0P B;  3C29 A;  4ECV A;  1X66 A;  3CYM A;  1PK1 A;  4C8O A;  9ICG A;  5L1J A;  7ICF A;  1D8B A;  2HHT A;  3EWA A;  4UAR A;  4NLN A;  2BCR A;  3R9K A;  7ICE A;  4KIT B;  5KFF A;  1S8O A;  2LBO A;  5HP4 A;  3RBD A;  1IV8 A;  5KG7 A;  3AQF A;  3EYZ A;  2W9B A;  2LM4 A;  5KFZ A;  5J2F A;  3EPG A;  2Z7J A;  4XRH A;  2VKQ A;  5TZV A;  4QZC A;  2PI5 A;  4RQ0 A;  2V4Q A;  1K1Q A;  2OH2 A;  2E8M A;  3SAG A;  2W3R A;  4O3P A;  3TAQ A;  4YXJ A;  1Z1B A;  1TK5 A;  4J9L A;  4DSL A;  4LVS A;  4I2A A;  1WYG A;  4BWM A;  5KG3 A;  4HAI A;  3MGV A;  4Q8E A;  1LV5 A;  1WCN A;  1JRO A;  2W9A A;  1WWU A;  4RQ8 A;  2MUT A;  7ICM A;  4LZD A;  5IIJ A;  4C8L A;  1ZD3 A;  2V4R A;  5KFS A;  4Q44 A;  5DG7 A;  3I76 A;  1XWL A;  1L7M A;  1DRG A;  2LHT A;  5J2H A;  5KFE A;  2UVU A;  1BNO A;  1O08 A;  4P0Q A;  1ZQW A;  2E8N A;  5AKH A;  4J9O A;  2Y1I A;  3BZK A;  3RJE A;  3DEE A;  1F0M A;  1NKB A;  4R8U B;  4EEN A;  1ZRN A;  2HI0 A;  2RRD A;  2K89 A;  5KFC A;  1L3S A;  4F5Q A;  2EZZ A;  4DQS A;  2K8A A;  5ALL A;  4ECX A;  5D46 A;  4Y2R A;  7ICI A;  1RM6 C;  1PVP A;  5KG4 A;  5ALM A;  5KAI U;  4GXJ A;  1L5U A;  5DQI A;  2KD1 A;  3C21 A;  2DPJ A;  3D2Q A;  1JUD A;  3RB6 A;  4KLU A;  5ALD A;  4DQQ A;  2FPM A;  1QTM A;  4UB1 A;  1S77 D;  3AN1 A;  3OTQ A;  4DS5 A;  1J97 A;  4RNN A;  1ZJN A;  4Y2Q A;  1LKY A;  2NRX A;  4F5N A;  4C4R A;  2G09 A;  3D6J A;  4QZ9 A;  8ICF A;  3H8W A;  5AK5 A;  3RFA A;  3QNM A;  2HDO A;  4DSJ A;  3LDA A;  1ZQC A;  3B9J A;  4MHV A;  2WAQ C;  2BCV A;  4MFA A;  5ALK A;  1KSP A;  4RQ3 A;  1ZQS A;  3OPX A;  1JRP A;  5KFR A;  9ICW A;  1X2I A;  1KN5 A;  4F5P A;  5GTI U;  3A0B U;  3C28 A;  5CR0 A;  1NKC A;  4FS1 A;  4NLK A;  3RJH A;  1SZH A;  7ICV A;  4F93 B;  3ETR A;  4IC9 A;  4F4Y A;  4ECY A;  2N1R A;  1S0O A;  3RAX A;  2DGZ A;  4TUQ A;  2KP7 A;  2UVV A;  4YQW A;  1OW5 A;  3NTU A;  4E0D A;  5J2I A;  1ZQN A;  4QZB A;  3BS7 A;  3TAR A;  3KHH A;  1ZQX A;  4Q43 A;  5KFT A;  4RU9 A;  3HKZ F;  1Z00 B;  4YMM A;  5ALT A;  4GLX A;  1KFT A;  3KHR A;  4UAY A;  5DKW A;  5IIM A;  3D2N A;  4QZG A;  2AJQ A;  4C4S A;  2XY7 A;  4JMU A;  2HOI A;  4M9G A;  3MGH A;  4PL2 A;  5BPC A;  3BQT A;  1SXD A;  2C2R A;  3GV5 B;  8ICX A;  5KFD A;  2HMX A;  2LMR A;  2UVW A;  2FMP A;  3B0Y A;  1Y88 A;  1N61 A;  3Q8M A;  3CRX A;  2QAR B;  3MC1 A;  5J0W A;  2ISO A;  4MEY A;  2QKQ A;  2KJ5 A;  4ECR A;  3F5A A;  4AP9 A;  1JX4 A;  1ARO P;  4CF3 A;  4Y2V A;  5F9L A;  3QEB Z;  1RXW A;  3SEI A;  3QE9 Y;  2C2E A;  3T3F A;  4F4Z A;  3N7R C;  9ICS A;  5KTQ A;  2AGO A;  2HSZ A;  5GTH U;  4ZOH C;  5HHH A;  3TQ1 A;  4Y2P A;  4QZF A;  1N56 A;  2YB1 A;  5J2G A;  2KMD A;  3TAD A;  1JIH A;  4G3I A;  3GQC A;  2YMP A;  3UQ0 A;  2NO5 A;  3RH5 A;  5AKK A;  3LWM A;  2Y1J A;  2JEI A;  2KZ3 A;  3BS5 A;  3K75 D;  4X5V A;  4M0A A;  4RNM A;  3PML A;  5KT6 A;  2RLT A;  4NV0 A;  1ZET A;  4F4W A;  1KRP A;  4QWB A;  2LYB A;  3KD3 A;  3TKA A;  4GXI A;  2P66 A;  2HBM A;  2PMZ C;  3ZD8 A;  5DGA A;  5AHX A;  1C20 A;  4C8N A;  5ALU A;  3HIL A;  2IOF A;  2K4I A;  2KEY A;  8ICZ A;  3QUB A;  3NVZ A;  2KVC A;  2EH9 A;  4OJL A;  2BCS A;  4I28 A;  3QZ8 A;  2JXJ A;  7ICG A;  1SV0 A;  2AU0 A;  8ICG A;  2DBY A;  2E3T A;  2H5X A;  2WHE A;  4CCH A;  4PGX A;  3N7S C;  5B5E U;  4B9T A;  4QJF B;  2AQ4 A;  5J0O A;  4IQT A;  5AI5 A;  3D2S A;  1ZRM A;  1QSS A;  1Z19 A;  2KZZ A;  3RB0 A;  2WAQ F;  5AKZ A;  5J2A A;  3MDA A;  2ASL A;  2F77 X;  2HBL A;  2W9C A;  4DL3 A;  4F91 B;  4QZD A;  4US8 A;  2ZUC A;  2JZB A;  1RYR A;  3ZDA A;  4UB4 A;  1SL2 A;  2HOF A;  5KFG A;  5BOL A;  3OJU A;  2FE9 A;  4BXO B;  8ICT A;  4O3Q A;  4KN4 A;  2G5I B;  3GZF A;  1ZQ1 C;  1NK4 A;  4ECQ A;  3J81 j;  1D9D A;  4IQU A;  4OJ6 A;  2VA3 A;  3SYZ A;  9ICP A;  2BQ3 A;  4EBE A;  1ZD2 P;  4IR1 A;  3QUQ A;  4UAT A;  3BDP A;  1BVS A;  1CI4 A;  1Z4N A;  1L3V A;  2XI9 A;  1JMS A;  4YXM A;  1ZQU A;  4JV0 A;  3E0F A;  4PPX A;  3C1Z A;  2F2A B;  2XGP A;  5J0T A;  1XC9 A;  5DQG A;  4ED8 A;  3H0L B;  1NK8 A;  2K60 A;  5CA7 A;  3GFK B;  5ALW A;  7ICS A;  3F5E A;  1KBU A;  1BGX T;  3G6Y A;  1ZQI A;  2BCQ A;  2YMM A;  5ALQ A;  4CRX A;  1BPD A;  2FI1 A;  3RR7 A;  2W11 A;  3AU2 A;  4R66 A;  3PR4 A;  5D4B A;  2AHO B;  2ISP A;  3PW2 A;  1KL9 A;  4GIB A;  1ZQV A;  3GU3 A;  5ALZ A;  4ECS A;  1U47 A;  3PW7 A;  1SL1 A;  9ICH A;  4XQ8 A;  3T5J A;  5ALE A;  4RQ4 A;  2KN7 A;  3RJG A;  2KSO B;  2F1J A;  2XCA A;  4YMO A;  1D8Y A;  3K1Z A;  1ZQP A;  3ISD A;  9ICM A;  3KKA C;  2ZUD A;  2NRT A;  4I2I A;  4NWI A;  4GC6 A;  3V7L A;  5CB1 A;  2I9G A;  1KTQ A;  2G07 A;  5H2F U;  2KHV A;  4Q8F A;  3E58 A;  4EBD A;  2GOL A;  3FM9 A;  2R8H A;  3CNH A;  2R8J A;  4O5C A;  3QU9 A;  3NRW A;  2K4H A;  5DBC A;  2PMZ F;  2HHQ A;  2WF5 A;  4KLS A;  4DOB A;  1NZP A;  1ZQK A;  3PVX A;  3QU7 A; 
#chains in the Genus database with same CATH homology
 3HT3 A;  2FPK A;  2C2D A;  3H4D A;  1TK5 A;  4J9L A;  4J9S A;  4DSL A;  4DL2 A;  9ICI A;  4LVS A;  5JUM A;  4I2A A;  4KLM A;  3T5K A;  4BWM A;  5KG3 A;  4UB2 A;  1UA1 A;  2HHS A;  4Z6C A;  3ZDC A;  1UT5 A;  4Q8E A;  4QWC A;  4HYK A;  1LV5 A;  1WCN A;  4P4M A;  2W9A A;  3PY8 A;  4IR9 A;  3QEA Z;  4RQ8 A;  1XS9 D;  2MUT A;  4O5E A;  2UVR A;  4LZD A;  4XA5 A;  7ICM A;  5KFA A;  4ECU A;  5IIJ A;  4C8L A;  2V4R A;  8ICJ A;  3RR8 A;  5KFS A;  1EXN A;  4FS2 A;  1IM4 A;  4RT2 A;  3RRH A;  2XGQ A;  5DB8 A;  3TFS A;  4Q44 A;  5DG7 A;  3RJJ A;  5DB6 A;  3RBE A;  3PX4 A;  1XWL A;  5DQH A;  5J2H A;  8ICR A;  5KFE A;  4F2R A;  4M9L A;  2UVU A;  4R63 A;  2HHX A;  4I27 A;  4PHE A;  1UA0 A;  2FMS A;  4UAZ A;  4DQR A;  1BPZ A;  2KTQ A;  4RNO A;  3KHL A;  5EWG A;  4UAW A;  5J0P A;  9ICA A;  1ZQW A;  4J9O A;  2Y1I A;  3RJE A;  3Q8R B;  1ZQG A;  3C23 A;  1N48 A;  2HHV A;  1NKB A;  1ZQO A;  4R8U B;  5DLF A;  4EZ6 A;  4JUZ A;  5KFH A;  4RPZ A;  1MQ2 A;  3PV8 A;  4ED2 A;  1ZQQ A;  3KTQ A;  5KFC A;  4B9M A;  1L3S A;  4O0I A;  4F5Q A;  5KG5 A;  4DQS A;  4TUS A;  4B9S A;  4ECX A;  5CWR A;  3PO5 A;  5D46 A;  5KFI A;  3B0X A;  2A1J B;  7ICI A;  3MFI A;  5KG4 A;  3TAN A;  4F2S A;  5J2D A;  3NGD A;  4GXJ A;  2ALZ A;  1ZQH A;  1L5U A;  3MBY A;  5DQI A;  3UQ2 A;  1V9P A;  1NJY A;  3C21 A;  2DPJ A;  2R8I A;  1JN3 A;  3RB6 A;  4KLU A;  4DQQ A;  2ASD A;  2FPM A;  3H7I A;  1QTM A;  2OWO A;  4UB1 A;  4I2F A;  2BKE A;  5F9N A;  9ICK A;  1U49 A;  1S77 D;  4UB5 A;  4DS5 A;  4R64 A;  4RUA A;  3M9N B;  5HMM A;  4RNN A;  4FO6 A;  1ZJN A;  1A76 A;  4YMN A;  9ICV A;  2KZM A;  2NRX A;  1MC8 A;  3MFH A;  4F5N A;  4QZ9 A;  2RDJ A;  3V7J A;  8ICF A;  5DG9 A;  3HWT A;  3H8W A;  3RH4 A;  4YR3 A;  4MF2 A;  5L1K A;  5KFB A;  8ICK A;  2NRV A;  4K4H A;  4KLD A;  3FYH A;  3BQ0 A;  3LDA A;  4DL6 A;  1RPL A;  3V72 A;  1SKR A;  1ZQC A;  4DSJ A;  2BCV A;  4MFA A;  3C5F A;  1KSP A;  4B9V A;  4RQ3 A;  5KT2 A;  9ICE A;  1ZQS A;  4QZ8 A;  5KT5 A;  7ICJ A;  5KFR A;  4IRK A;  1BPX A;  1TFR A;  4ED6 A;  1WCL A;  4RQ7 A;  1X2I A;  9ICW A;  3GV8 B;  4F5P A;  5IIL A;  8ICS A;  1L3T A;  1JXL A;  4JWM A;  4Z6D A;  5EOZ A;  3SV3 A;  1ZQD A;  2BPG A;  4PHA A;  5CR0 A;  2IBK A;  1NKC A;  1K1S A;  4FS1 A;  4O5K A;  4IQV A;  4NLK A;  3RJH A;  2ZJA A;  2W9M A;  3T5H A;  1NK6 A;  3T5L A;  9ICQ A;  7ICV A;  4F93 B;  4F4Y A;  4F5O A;  4KLQ A;  4ECY A;  2HVI A;  2FLN A;  1S0O A;  5KFY A;  3RAX A;  4TUQ A;  1ZQM A;  1HUZ A;  2UVV A;  9ICJ A;  4YQW A;  2KFZ A;  7ICU A;  1BPE A;  3NTU A;  2IMW P;  4E0D A;  5J2I A;  1COO A;  1ZQN A;  1T4G A;  4R65 A;  4NM1 A;  4QZB A;  1ZQJ A;  8ICP A;  2BR0 A;  3IHQ B;  3TAR A;  3V7K A;  4O9M A;  2ZUB A;  2P6U A;  4NM2 A;  1ZQX A;  2F1H A;  4Q43 A;  5KFQ A;  3KHH A;  2GWS A;  8ICU A;  5KFT A;  4KLL A;  4RU9 A;  1X9M A;  4IRC A;  4F8R A;  5III A;  3ETL A;  1QSY A;  1ZJM A;  3JPQ A;  2AGQ A;  1S10 A;  4M04 A;  1Z00 B;  5KG0 A;  4YMM A;  1ZQR A;  2XO7 A;  2BQU A;  4GLX A;  1JXE A;  5KFN A;  1KFT A;  2BPC A;  4PH5 A;  3KHR A;  4I2C A;  4KN7 A;  3KHG A;  1NK0 A;  2JEJ A;  9ICB A;  4R8U A;  4UAY A;  4J9K A;  3UXP A;  3OHA A;  5KG1 A;  4DSE A;  1ZQL A;  8ICQ A;  5DKW A;  4TQS A;  5IIM A;  4QZG A;  4F4K A;  9ICR A;  2I1Q A;  1NK9 A;  4DFK A;  5HNK A;  5L9X A;  5IIN A;  2AJQ A;  2XY7 A;  5KG2 A;  4MF8 A;  2JEG A;  4RPX A;  2A1J A;  4DL5 A;  4M9G A;  3MGH A;  4KLE A;  5J0U A;  4BGD A;  1KLN A;  5BPC A;  3BQT A;  4Q45 A;  2BHN A;  2C2R A;  2P6R A;  4M47 A;  4DSI A;  3GV5 B;  4K4I A;  1A77 A;  2VA8 A;  4I2J A;  3MR3 A;  5KFD A;  8ICX A;  2HHU A;  4DOC A;  2UVW A;  5DBA A;  2FMP A;  3Q8K A;  1D9F A;  4UBC A;  3B0Y A;  1HJP A;  1Y88 A;  3LWL A;  2ZJ5 A;  4GC7 A;  3Q8M A;  2ATL A;  1NK7 A;  3MR6 A;  7ICO A;  7ICN A;  4O3S A;  5J0W A;  4QZE A;  4PHD A;  3G6X A;  2ISO A;  3HPO A;  4MEY A;  5KFW A;  4YP3 A;  3JPO A;  1S0N A;  8ICW A;  4ECR A;  4P2H A;  1NK5 A;  4ZH4 A;  5J0R A;  9ICU A;  4ELU A;  1RXV A;  3EZ5 A;  1D8L A;  1JX4 A;  1ARO P;  3AUO A;  4DSK A;  3GIM A;  7ICQ A;  4QZI A;  3RB4 A;  5F9L A;  4QWD A;  7ICT A;  3QEB Z;  4YR2 A;  2MAX A;  1XU4 A;  1RXW A;  3QE9 Y;  2NRW A;  2C2E A;  3T3F A;  4F4Z A;  1TAQ A;  1KFD A;  2W9C B;  4K4G A;  5KFL A;  3Q8Q B;  5KTQ A;  9ICS A;  5J29 A;  7ICP A;  3Q8S B;  2AGO A;  5L1I A;  3MAB A;  3UPQ A;  4EYH B;  2JZB B;  4F5R A;  3SZ2 A;  5CHG A;  4ELT A;  3TQ1 A;  5HHH A;  3H40 A;  5KFP A;  5KT4 A;  4M9J A;  3Q8L A;  4QZF A;  1N56 A;  4BWJ A;  3GV7 B;  5J0Q A;  4FBT A;  4DL7 A;  1KDH A;  2LYH A;  5J2G A;  4Z6F A;  3PNC A;  4DO9 A;  1ZQF A;  2R8K A;  4GXK A;  1JIH A;  4YFK A;  4G3I A;  3GQC A;  1X9S A;  3UQ0 A;  4QZA A;  3RH5 A;  2PFN A;  4KTQ A;  3LWM A;  1SKW A;  2J6S A;  2Y1J A;  4FBU A;  2JEI A;  1KFS A;  5L1L A;  2HW3 A;  2KZ3 A;  3K75 D;  4X5V A;  4M0A A;  4RNM A;  3PML A;  4KMU A;  1C7Y A;  2BPF A;  3JPT A;  2V9W A;  4RUC A;  5KT6 A;  4ED3 A;  1ZET A;  1CUK A;  2AQ0 A;  2Q0Z X;  4F4W A;  4KLI A;  2BCU A;  1Z00 A;  1KRP A;  8ICV A;  4QWB A;  3HW8 A;  5J0Y A;  3C2L A;  2ZTC A;  4DSF A;  9ICT A;  3AU6 A;  3BJY A;  4P4P A;  4GXI A;  1S9F A;  2P66 A;  1NKE A;  4I2B A;  3ZD8 A;  5DGA A;  1U48 A;  1ZQA A;  8ICL A;  5C5J A;  8ICH A;  4YCX A;  2BDP A;  1L3U A;  4C8N A;  2ZJ8 A;  4ED1 A;  1U45 A;  9ICN A;  3PX6 A;  4I29 A;  3C2M A;  3M8R A;  3RJK A;  4YD1 A;  4MEX A;  3UXO A;  7ICK A;  8ICZ A;  3OJS A;  4DLE A;  3RH6 A;  1NJW A;  3MDC A;  2BCS A;  3M9O B;  2C28 A;  4I28 A;  3PW0 A;  1NOM A;  4ED0 A;  4DWI A;  4M9N A;  3C5G A;  4NLZ A;  5KFM A;  4DEZ A;  4YR0 A;  3QZ8 A;  4M2Y A;  5DBB A;  4ELV A;  4EEY A;  3JPN A;  5KFX A;  4DLG A;  3TI0 A;  3K4G A;  4TQR A;  7ICG A;  4RQ1 A;  4DL4 A;  3ZDD A;  2AU0 A;  4C8K A;  8ICG A;  1DGS A;  4DS4 A;  1NJX A;  4EYI B;  3V6J A;  5KFV A;  2M9N A;  4J9P A;  2H5X A;  5J2K A;  4CCH A;  4PGX A;  2FLP A;  3H8J A;  1QLN A;  3JPP A;  1ZQY A;  3OHB A;  5KT3 A;  2XY5 A;  4B9T A;  1MQ3 A;  2HVH A;  7ICH A;  5DG8 A;  2AQ4 A;  4JV2 A;  5J0O A;  5KFJ A;  1ZQB A;  4IQT A;  1S0M A;  4ECZ A;  2FLL A;  3M9M B;  4O3N A;  4M6W B;  8ICI A;  2XCP A;  1RZT A;  4YVZ A;  1T8E A;  1QSS A;  1XSN A;  4P4O A;  4O3O A;  4J9R A;  3RB0 A;  2KZZ A;  5J2A A;  3GIK A;  1ZQE A;  1BPB A;  4QW9 A;  1ZQT A;  5DB7 A;  2IHM A;  4DFM A;  5J2J A;  3MDA A;  2ASL A;  4EZ9 A;  4XUS A;  1TK8 A;  2W9C A;  4DL3 A;  4F91 B;  3OGU A;  4QZD A;  4MFF A;  3RJF A;  1X9W A;  5CP2 A;  3G6V A;  2W8K A;  2ZTD A;  3SV4 A;  3EPI A;  2ZUC A;  4YN4 A;  2JZB A;  3H8S A;  4RQ2 A;  3HX0 A;  4RT3 A;  1RYR A;  2PFP A;  4RPY A;  3OSN A;  1TKD A;  4KLG A;  3PR5 B;  3PMN A;  4RQ5 A;  4UBB A;  3H4B A;  8ICC A;  3N97 B;  2B21 A;  4UB4 A;  3ZDA A;  4I2D A;  1CEZ A;  4Z6E A;  4TUP A;  4DFJ A;  8ICA A;  1SL2 A;  4KLJ A;  5D49 A;  4NXZ A;  5J2C A;  4PGQ A;  3TAP A;  1TV9 A;  2DPI A;  3M8S A;  3RRG A;  5KFG A;  5BOL A;  3OJU A;  3RTV A;  3BQ1 A;  5HHI A;  1U4B A;  4ECT A;  4BXO B;  4QW8 A;  5BOM A;  8ICT A;  4IRD A;  5KFO A;  2PI4 A;  4O3Q A;  4KN4 A;  3RJI A;  2W9B B;  3RAQ A;  4BDP A;  3FDS A;  1NK4 A;  2J6U A;  3IM1 A;  1SZP A;  3V6K A;  3GIJ A;  3ZDB A;  4ECQ A;  1D9D A;  5DB9 A;  3ISB A;  5DLG A;  4TUR A;  8ICY A;  5DDY A;  4QWA A;  4IQU A;  4DF8 A;  2VA3 A;  3SYZ A;  2VA2 A;  2BQ3 A;  9ICP A;  4EBE A;  4IR1 A;  5KFU A;  4RZR A;  2R8G A;  3OSP A;  3BDP A;  1BVS A;  1NJZ A;  4J9M A;  4QWE A;  5KT7 A;  1L3V A;  4O3R A;  4I2G A;  1JMS A;  4NLG A;  3UXN A;  1XO1 A;  3C2K A;  3C1Y A;  4YXM A;  4B9L A;  1ZQU A;  1SL0 A;  4NY8 A;  8ICO A;  4JV0 A;  3PX0 A;  3PW4 A;  2WTF A;  8ICE A;  3Q8P B;  4PPX A;  3C1Z A;  1ZQZ A;  1BPY A;  5J0T A;  2XGP A;  4QZH A;  1XC9 A;  4PHP A;  5J2B A;  4UQG A;  2AGP A;  5DQG A;  4ED8 A;  5J2E A;  2BGW A;  2PXI A;  4DFP A;  1NK8 A;  1MSW D;  3BQ2 A;  1XSL A;  3E2E A;  5CA7 A;  3GFK B;  4C8M A;  1S0V A;  7ICS A;  2F1I A;  3PO4 A;  4IQW A;  3JPR A;  1T7P A;  4F92 B;  1BGX T;  3G6Y A;  1ZQI A;  4DQP A;  5EWF A;  2MUT B;  1TVA A;  4I2E A;  2BCQ A;  2IHN A;  7ICL A;  9ICC A;  1B43 A;  1BPD A;  9ICX A;  2VAN A;  5DGB A;  2PFQ A;  4MFC A;  3EW9 A;  5KG6 A;  2HHW A;  3RR7 A;  3AU2 A;  3GDX A;  9ICO A;  4R66 A;  3PR4 A;  2C22 A;  3LK9 A;  3V6H A;  5D4B A;  2BQR A;  3ZDE A;  2XY6 A;  3GIL A;  4F4X A;  4B9U A;  3MR2 A;  3GII A;  3QZ7 A;  2ISP A;  4ECW A;  2XC9 A;  1IXR A;  5HML A;  5J0S A;  3PW2 A;  2J6T A;  7ICR A;  4M6W A;  4JK1 A;  1PZN A;  3N4M B;  1ZQV A;  4ECS A;  3ORY A;  3ZD9 A;  1U47 A;  3PW7 A;  2FMQ A;  8ICB A;  1SL1 A;  2IA6 A;  9ICH A;  1LB2 B;  2ZTE A;  8ICM A;  4XQ8 A;  5EWE A;  1T3N A;  3T5J A;  1S97 A;  3MR5 A;  4LZG A;  4UB3 A;  1QSL A;  3TFR A;  4I2H A;  4F3O A;  4JV1 A;  4KLF A;  1HUO A;  1S76 D;  4RQ4 A;  2KN7 A;  3ISC A;  4RQ6 A;  3RJG A;  4B9N A;  1RYS A;  2F1J A;  4J9N A;  4KLT A;  1TAU A;  5CJ7 A;  4DQI A;  4KLO A;  4ECV A;  1UT8 A;  4J9Q A;  2XCA A;  4C8O A;  1ZYQ A;  1Z3E B;  4YMO A;  2JEF A;  9ICG A;  1D8Y A;  3PW5 A;  5L1J A;  1ZQP A;  3ISD A;  7ICF A;  9ICM A;  2ZUD A;  1DOQ A;  2HHT A;  2FPL A;  3EWA A;  5DDM A;  4YG2 A;  2NRT A;  4I2I A;  3MGI A;  2BCR A;  4NLN A;  7ICE A;  4GC6 A;  3V7L A;  4KIT B;  5KFF A;  5CB1 A;  5HP4 A;  3RBD A;  1KTQ A;  2ASJ A;  5IIK A;  4YD2 A;  3JPS A;  2I9G A;  5KG7 A;  4ED7 A;  4BXO A;  4Q8F A;  2KFN A;  2DFL A;  2RDI A;  3EYZ A;  3SI8 A;  4JWN A;  4EBD A;  2W9B A;  9ICL A;  9ICF A;  5KFZ A;  1SKS A;  1H38 A;  5J2F A;  2PFO A;  1TK0 A;  8ICN A;  1B22 A;  3EPG A;  2R8H A;  4XRH A;  4DF4 A;  5IIO A;  2W8L A;  1XSP A;  2R8J A;  1KEJ A;  4F50 A;  4O5C A;  5TZV A;  4QZC A;  4KLH A;  2PI5 A;  4RQ0 A;  4EBC A;  5J0X A;  2V4Q A;  5DBC A;  5KFK A;  2NRZ A;  1K1Q A;  3RB3 A;  3THV A;  4DOA A;  2HHQ A;  4KLS A;  1U9L A;  4DOB A;  4O3P A;  3HP6 A;  3PVX A;  3TAQ A;  1ZQK A;  4YXJ A;  4PGY A;  4M9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...