3K1ZA

Crystal structure of human haloacid dehalogenase-like hydrolase domain containing 3 (hdhd3)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
MRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
publication title Crystal Structure of Human Haloacid Dehalogenase-like Hydrolase Domain containing 3 (HDHD3)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 87
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.720 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3k1zA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3k1zA01
2HEGA 3A1CA 3QUBA 1Z4KA 1QQ7A 4B6JA 5ALQA 5AVZA 3SKXA 2GMWA 4YCNA 3AR4A 1TA0A 3NASA 4ZEVA 4Y2XA 3U7FB 5AM4A 1MH9A 3L8EA 4UASA 1KYTA 3FPSA 4GXTA 4EX7A 3W5DA 2JAWA 2R8YA 2HHLA 1SWWA 1TJ4A 4UAUA 2C9MA 1TJ5A 4F71A 4MUMA 5AICA 1FEZA 4BNDB 1Z5UA 3DV9A 3OCWA 1LTQA 2NO4A 2EARA 3U26A 2BDUA 1X42A 4FE3A 4HGQA 3UMGA 4UU0A 3KBBA 3N28A 2G07A 3OCXA 2W4MA 1SWVA 2AH5A 4E88A 5ALFA 5A3SA 3WKCA 3SD7A 4CE6A 1L7PA 5AK4A 5AI5A 3L0CA 4Y2PA 5AW6A 2FI1A 5AKYA 4F72A 3W5CA 2FPRA 2AMYA 4EENA 4EX6A 4KNWA 4BBJA 1L8LA 3CZ4A 1L7OA 2IOHA 3L1VA 5AW8A 2B0CA 2YJ6A 5AK5A 2CFSA 2RAVA 4KNVA 4YCLA 1RKUA 3WKAA 3ZTYA 2C8LA 2QLTA 5AKXA 2P27A 4CF5A 1WR8A 3CNHA 5JJBA 5IT0A 3QLEA 4G63A 5T41A 2RARA 2ZXEA 1Z88A 1F5SA 5ALJA 3WK5A 4Y2SA 3W5BA 1RLMA 4UMFA 2B8EA 1U7OA 3WGUA 3ESQA 2HOQA 3IB6A 4YIKA 3ONNA 2NYVA 3DAOA 4KX3A 3WK6A 1QQ5A 3U7GA 1EK1A 2AGVA 3L1UA 1N8NA 2C8KA 2GHTA 2YMLA 3A1DA 3NALA 3PGVA 5AKJA 2JGAA 4DCCA 1S2OA 5AESA 4Y2JA 5AW2A 3QXGA 2YN4A 3FPBA 4XE5A 1IWOA 4OHFA 1Z4JA 4DWOA 2OBBA 4HGRA 2G08A 5AKGA 2GFHA 1TE2A 1ZD4A 5AK6A 2WF9A 4BYGA 2ZBEA 3E84A 3WK4A 2WF5A 1RLTA 3DNPA 3UMCA 2WF7A 3QU9A 4J2TA 3ZVLA 4ZEXA 3P96A 2Q5EA 1Z4OA 4UMEA 1ZOLA 4AS3A 1T5TA 4Y2VA 1AQ6A 1XP5A 3KD3A 1RQNA 5FP0A 3QNMA 4BX3A 5AVXA 3FZQA 4C4SA 2B82A 2CFRA 4MWOA 2ZG6A 4QQFA 4ZEWA 4OD0A 4YIHA 2MU1A 2P11A 3E8MA 3ZUPA 3L8HA 2X4DA 1RMYA 1T9ZA 1Z4LA 3UMBA 2ODAA 4XPZA 3B8EA 2YY6A 5AW3A 4BKMA 1Z4PX 3I6BA 4NV0A 4YCMA 4HGPA 3OPXA 2ZOSA 2DQSA 2HI0A 5AHXA 4DFDA 1RMQA 5ALRA 3N8GA 5AKHA 5ALSA 1PW5A 1XVIA 4AP9A 2NO5A 3DDHA 3WK9A 2GHQA 3EF0A 4OFZA 1ZD5A 5AI0A 2G06A 5ALGA 4Y2RA 3I76A 3ZX4A 2MSNA 5ALPA 5AIAA 4EEKA 4IFTA 1VJ5A 3KZXA 3U19A 1J97A 4FYPA 3NAMA 3OCUA 1RLOA 3AR5A 4HYTA 5AKLA 5ALIA 5ALYA 3SF0A 3AR9A 2BY4A 5ALTA 5ALUA 3WKDA 2YJ3A 3N5KA 1U02A 2BDEA 3NUQA 3IJ5A 4RESA 5AI9A 2EATA 1Q91A 4Y2QA 2G09A 1XPJA 4KX5A 4XQ0A 5AIBA 1J8DA 3ZWDA 3QU7A 3HLTA 3OCZA 2WF8A 3B9BA 4CNQA 3EWIA 1Z4NA 4CF3A 4BEVA 4BX0A 3W5AA 1NRWA 2CN1A 5ALLA 1WVIA 2I33A 2VKQA 5ALDA 1CQZA 3NRJA 2YMQA 4HGOA 4HAIA 2I54A 2IOFA 2ZBGA 2B30A 5AKKA 3QU5A 3L7YA 1QH9A 3L5KA 1YDFA 2YBDA 1L7NA 1L8OA 3PCTA 4L57A 3A1EA 5AVSA 2C4NA 5AW9A 5AVQA 3AR7A 2Q4TA 4UMDA 5AVWA 4KYTA 1O08A 2JARA 5A3QA 2D2VA 3QU4A 2PQ0A 2FPWA 4KN8A 4UATA 4XOUA 4BEWA 3L0YA 3ZVMA 2I34A 2W43A 1ZRMA 3AR3A 3NANA 3HYCA 3ED5A 1K1EA 3I28A 3S6JA 3KC2A 2EAUA 2YMMA 2HX1A 2AUTA 1YV9A 2Q4RA 2R8XA 1WZCA 5AM3A 1O03A 5AKEA 5AM0A 3A3YA 4C4TA 2G80A 4JB3A 2R8EA 2WHEA 2YFYA 3RFUA 1RKVA 1RRCA 4UM7A 2WF6A 1RC8A 1WPGA 4Y2UA 3AR6A 3FM9A 3GYGA 4H1WA 3B9RA 1U7PA 3ZWKA 2IA5A 2PR7A 4UAVA 1Y8AA 1YS9A 2G0AA 3WGVA 3KDPA 3E58A 4NAVA 2FEAA 2B1QA 5ALXA 4AS2A 3MMZA 1QQ6A 3L8GA 3ZVNA 1YMQA 3QX7A 5ALZA 4BNDA 1T5SA 3E81A 4GIBA 1NF2A 4L6CA 4EZEA 3M9LA 3QUTA 1ZS9A 2RB5A 3SHQA 5AVYA 3QU2A 1N9KA 2HF2A 5AKIA 2FPUA 2C88A 1ZRNA 4CF4A 3WKEA 2FPXA 3TLMA 2O2XA 3ZX5A 3OTQA 3PGLA 2FPSA 2P9JA 1RMTA 2B8JA 3WK7A 4Y2TA 3BWVA 2YJ5A 4UARA 2G1AA 2FUEA 3QUCA 4UW9A 5AW4A 2I6XA 3R4CA 3ZTWA 3R09A 2PKEA 4EELA 3SMVA 4O8CA 1S8OA 5ALHA 2I7DA 1VFPA 4OCZA 1U2SA 2B1RA 2YJ4A 1ZD2P 3ZI4A 5IS2A 3SLRA 4HGNA 3UM9A 2ZBFA 1RQLA 3PDWA 1Z4MA 1VJRA 5AVRA 2IOFK 5AKZA 5E0OA 3OCVA 3ET4A 5AW1A 3FVVA 3QYPA 1TJ3A 4NWIA 3R9KA 3U13A 1ZJJA 1NNLA 3K1ZA 3OCYA 3RF6A 2HF7A 2OM6A 1CR6A 3QGMA 3NIWA 3U7EB 1LVHA 2IYEA 2YMPA 2P69A 2JAUA 2ZBDA 3FGOA 1Q92A 5AM5A 2OA0A 3IRUA 4I9GA 5AM2A 2FDRA 3MC1A 5AVTA 5IT4A 3ZW7A 4UU1A 2HO4A 1RDFA 4C4RA 2W11A 1L7MA 4FFDA 2RBKA 2FUCA 5AI6A 4PNHA 3EPRA 3D6JA 3VAYA 5AK3A 1Z5GA 2R8ZA 5A3RA 3I1YA 4YH1A 4BX2A 5ALMA 5ALOA 3QUQA 5AI8A 3L8FA 3F9RA 4IG4A 5AW0A 5ALNA 1SU4A 4DW8A 3L0BA 4J03A 4NABA 3M1YA 5AM1A 1Z4IA 3AR8A 3WKBA 3ET5A 4L6AA 2I55A 1U2TA 5ALWA 1Z4QA 2HSZA 2CFTA 4UMVA 3SKYA 2HDOA 2GO7A 5ALEA 2O9JA 1RKQA 3N1UA 5ALVA 4G9BA 5AVUA 3WK8A 1EK2A 4I9FA 5ALKA 5AW7A 4Y2YA 1QYIA 2QYHA 3J7TA 2HCFA 1ZD3A 4NFLA 3ZU6A 3N07A 4QJBA 1L6RA 4Y3UA 5AI4A 4YGYA 1JUDA 3MN1A 3AR2A 3ESRA 3BA6A 2OYCA 1RPZA 4JDPA 4RETA 2JAOA 5AW5A 5AVVA 3MPOA 3EF1A 3U7HB 3KOOA 2WFAA 1YNSA 1YJ5A 4UM5A 2WM8A
chains in the Genus database with same CATH superfamily
1K5OA 3WX0A 4WGFA 1UZAA 2GMWA 1YK0A 2QZ4A 4BY9E 4WW0A 5JCOA 3QEOA 4LECA 4ZV4A 1GDTA 4BNDB 4M87A 5IVKA 3I01A 4FDTA 2WV9A 4BNWA 1AHNA 3I32A 4XSVA 1JEJA 4J1NA 5I4CA 2KYRA 1UAAA 2DKNA 2ECOA 4MCJA 2VJAA 4GVPA 4MDYA 4AZTA 2GF0A 3CPHA 1BSVA 3FCUB 5J23A 1OZFA 5A5DA 2LRHA 4U7DA 1L7OA 3FB4A 1I9CA 3V6KA 3SV4A 4PQRA 3IHLA 2VYVD 5EE3A 2P66A 4MRPA 3E6AA 1K5HA 1NK8A 1YQUA 1UQTA 5FNVF 1WCLA 2GK6A 4R0VA 3B82A 2GR9A 3KZCA 2YHIB 1PI3A 2E9SA 3H65A 4RNCA 4TSRA 4CDNA 3EA4A 4JH0A 4ECTA 4NOMA 1C29B 4EGSA 4DV5B 3ID6C 3GK3A 2WAOA 2LKDA 3H2YA 4DCCA 2OVFA 4EY4A 3D1JA 5CB4B 4AULA 4YMHA 3PJGA 4LXUA 4C4OA 4NCXA 3VYTB 4CG0A 2VHTA 3KEMA 1Z1VA 4RHTA 4GR9A 3SXUA 3OLYA 2ZVDA 1EVZA 1PR6A 5J58A 1DTEA 3ITEA 4B4WA 3ZHBA 3KVYA 1SPXA 1OT3A 1JKMA 2AX3A 1DBWA 1SQGA 4F6CA 2C2MA 4X71A 5KREA 4LOIA 3RTAA 3M1IA 3A9CA 5TS3A 1I3MA 2LCIA 3QFRA 3FCAA 1ZQGA 3KKKA 1RC1A 1GZVA 3ADOA 1TF5A 4LJ5A 4QGBA 1XSPA 3EFBA 4HTFA 1O95D 2Z98A 1CZUA 1U9YA 4BE4A 2VVTA 5H3HA 4LI3X 1SXJB 3KS9A 3P9XA 1Y8CA 5MN5A 1RXUA 3OHSX 3COPA 3AZOA 1EM8A 4PBTA 4C7JA 2N42A 2V6MA 4QICA 4JEIA 4WN3A 3K9HA 3HKDA 2GASA 3W04A 4S04A 4LX0A 2RONA 4D9BA 4I0WB 1DJNA 4JK3A 2P68A 3FZYA 4J0JA 1T4GA 3FA2A 3VTAA 2IYFA 4B8ZA 3KC2A 4DPKA 2C9OA 4ZVKA 1Z22A 3TMYA 3O03A 4UQLA 2IV2X 4G3XA 3DR5A 2AJDA 5CEFA 4ZQBA 3PGJA 3UUGA 2W83A 5KFCA 4CDRA 3C1AA 1ZNYA 3FPKA 2HREA 1B6RA 2F62A 4KITB 4DEXA 1RRMA 1OHHA 3KVOA 2PA0A 5E38A 3R7WA 4A2PA 4FDLA 1U7HA 2IP2A 4FMDF 4YXMA 1HY3A 4BLOA 4YCAA 1IZ9A 4G85A 4HMQA 1V1RA 2PRIA 2G8LA 4UVHA 1HFKA 4FX2A 3O95A 1WRBA 3L2OB 2GXUA 2EDCA 1EKXA 1T8WA 4RD6A 3HO8A 4XSHA 1PIWA 1G4UR 4WLVA 3K3PA 4EIWA 2CHGA 2W2OA 3OURA 1W73A 5NLLA 5CM2Z 3UJDA 3B89A 4HWOA 1PUIA 1GZHB 1Y7PA 4D79A 4TYWA 4NK4A 1L4BA 4QDTA 1RVDA 1J22A 5ALOA 3KTAA 5AW0A 1E9SA 3OKFA 1NP7A 1AUVA 2RP5A 4YT8A 2O8FB 2FDCA 3ZE7A 2G04A 2GX6A 5AVUA 2IU6A 3GG2A 2D1FA 2HW8A 2FEMA 1L4FA 4J29A 4K9QA 1K89A 2RIPA 1G8FA 3DCJA 3ANNA 1UWCA 4MVJM 1O4VA 2JAPA 1W36B 4CU5A 3SFVA 1HV8A 2NUTA 3BCRA 3L8EA 3G0GA 5L1IA 3PEWA 1ZGZA 1ZN9A 1DS6A 4FZNA 5CA7A 1E2EA 4WJKB 3NEYA 4FILA 5H2FU 3NS7A 1XMOB 3KFXA 4AYXA 4ROSA 1DAEA 4C3UA 1JLLA 4MI1A 4Y2PA 3FR7A 2P6OA 5GV8A 3RGGA 3W6UA 2FPRA 4I1UA 4EL0A 3PNOA 3BTSA 1ADBA 4AKTA 4RKFA 2AC4A 5AW8A 2P90A 3JQAA 4EGCB 1G3UA 5J2BA 3TDMA 2GI4A 1HLPA 1XA4A 3DL7A 1KFTA 1ZCFA 1Z62A 1HYEA 2MSKA 5D49A 1T2VA 4EY7A 2WTXA 2YWJA 4NF2A 4KQ2A 4ZANA 2XXBA 1TCUA 4FCWA 1SIBE 3DYIA 2ZPAA 2VH5R 5F4ZA 1G0NA 2GWRA 4M0UA 5J0SA 4YAJA 2JEGA 3CB2A 2J0EA 1DT3A 1JTFA 5CTAA 3PU6A 4BMSA 5DNAA 1YHYA 5ECDA 1SMKA 3DFIA 4BUJA 4PQEA 3WYCA 4MA0A 3OQBA 4LXIA 4Q3NA 3P96A 5FEUA 3BE4A 1GM5A 1NUSA 3ZU4A 4M53A 1JQDA 2JZNA 1Q17A 3DTNA 1S9DA 4F4YA 1I7SB 1UJ4A 2FPGB 2HPAA 3KDSE 3T5HA 2HNKA 3CPJB 1NJ1A 3N6VA 4CT4B 3FUVA 3GR6A 5EJGA 1G5IA 1L9XA 1D9XA 2ZBPA 2BFEA 4ZI7A 1MXFA 4B8YA 1Y8QB 3M9OB 1ZYUA 3WJ1A 5HF8A 4QOGA 3ND8A 4BX9A 1G18A 5FX2A 5FPYA 4CLOB 1XF1A 4IJUA 2I99A 1DCMA 1H4QA 3ND6A 1ARZA 4DHWA 4XWOA 2W4QA 2Q4OA 2NYUA 3Q8XB 3MERA 1PJQA 5CA0A 1G20B 3I2KA 1QCZA 1F12A 2ZBGA 2O8CA 3JQ9A 3RSZA 2VUTA 3JS5A 5TQJA 3RSLA 5JROA 2QG4A 3BRQA 4RD0A 2JARA 4IDEA 5U9CA 4B6PA 4ODIA 4AXBA 4IX1A 3N7AA 2I6GA 1JZSA 1ZN8A 4MUJA 4UZFA 2ZQYA 2GHRA 3LX5A 5IN4A 4YWHA 3WR5A 3WYNA 4Q9AA 1J70A 1DPFA 3C85A 1YS9A 3WNVA 2O8DA 3HNOA 4PO3X 2C4TA 2J9XB 5GINE 4IO0A 1HE3A 4NMXB 3T7AA 5HQ3B 3ZXUB 3WYEA 1XQWA 2D0PB 2O3SA 2PRZA 3DV0B 4C7ZA 2BELA 4RZRA 3JPYA 4DOBA 5KFYA 1RZRA 4DZRA 5KFVA 5FTMA 5FOUA 1HWYA 4CL0A 1QO0A 5JAOA 3LP5A 3F5FA 2Z1NA 3O5AA 4L3OA 2BGRA 3AEQB 3ELYA 4FLFA 3NHJA 1T13A 1SKWA 3AEKA 4WZAE 4LKOA 2OFXA 1QP8A 4FBLA 3GB9A 2XVXA 3OLQA 2HJVA 3EIOA 1UADA 2J32A 4YRQA 4JYBA 3QIVA 3MC1A 4RIHA 1R9GA 1SUEA 1LJLA 2LIVA 2WIBA 4A6PA 1SVLA 4ZYXA 7ICLA 5JUWA 4BCDA 2ZWMA 2OYSA 5AJYA 4M1EA 4LMAA 1J06A 3HKCB 3IP8A 2BKVA 3BS7A 2EFYA 3HUUA 1LBSA 3MQ2A 4ZYYA 3U09A 2PWBA 4IXDA 2PWZA 4WZAA 4BV8A 2ZRBA 3EQ9A 3GGGA 5KL1B 1WOMA 2C57A 3WIUA 4MR9B 2OR3A 1FQOA 3QJ5A 5IUKC 3N70A 3TGPA 2YYYA 5AI4A 1KC3A 3ULKA 2QL9A 4TTPA 5J40A 1V8ZA 5JCPA 3NTLA 1V71A 4JUZA 4EA8A 2VA9A 5KT3A 3DZDA 4GFDA 3AETB 4B3CA 1N5MA 2C42A 3TFRA 4XQ9A 1LI4A 2HYIC 5J2JA 4ED6A 2B25A 3JZAA 1IUKA 4WESA 5T4EA 3PZRA 4U2KA 1DBSA 5K8CA 5KTQA 4QZFA 4HOYA 2VFAA 4XVCA 4ER3A 9ICRA 2F3NA 4ZAZA 4FGKA 4AIIA 3D2LA 1E9VA 3UAWA 4G0YA 1SBTA 5IC4A 3MT7A 3EXG2 1HE5A 2NTJA 5ERXA 2P3OA 4RACA 4RY8A 3AP3A 4FIZA 2EJVA 5ES4B 3UYLA 1W0KA 4M36A 1TB4A 3AL0C 5HM6A 3TEFA 1D6NA 4DR3B 2BBSA 2FVXA 4DIDA 1P5RA 2OVBA 4F4UA 4Q48A 4KSYA 4RF2A 1T1IA 4BGVA 5SZJA 4BFTA 3TR0A 2HNAA 5EWJB 3TQSA 3OE5A 3REFA 2XNHA 4NG4A 1W5EA 3BH0A 1NBWB 2OGSA 1GWNA 3AFHA 4ILKA 3F98A 3ANYB 2H1IA 4QU5A 3AYXB 2JZCA 4GYKA 1DXOA 3ABIA 3KPWA 1KJQA 5I8PA 5CH3A 5ERGB 1SCAA 1M8PA 1QFJA 2F77X 4PVDA 4FM9A 4F2PA 5TPZA 2PZFA 2HCTA 3PITA 4NFHA 1BHO1 4YRJA 4F85A 4IDCA 2VT3A 1POWA 1SCBA 5CK5A 4D4IA 1H3EA 3AJDA 1OU0A 1VG0B 3OFND 4PRZA 2CV2A 5L1JA 3FDIA 1C3XA 1L5WA 2E4XA 5MGNA 3F2DA 4D0LB 3ZJUA 4N0MA 4KOAA 5TSDA 5K0FA 2GS9A 3WS7A 1B73A 4AKGA 4OYYA 3TADA 4IIEA 1K8XB 1AHHA 1M1YB 2BKLA 2W0SA 5FLXA 2GETA 3T0GA 1I3LA 5LZ5A 3D3WA 4Z4HA 5LYJB 1WD7A 1I10A 1TZMA 3WB0A 3H7IA 1NHWA 2AOUB 4FBUA 1RYDA 3GFGA 1DDIA 4LOAA 1ZHHA 3OUZA 2I54A 1QVVA 3GN2A 3BVPA 1TCBA 4P8RA 5JC1A 1KJNA 3PNKA 3IM1A 4Q8EA 2BGMA 1NQOA 2JIOA 3W90A 2REXB 2HK7A 2OO5C 2G70A 1MB9A 4X6UA 1A5SB 1I4EB 4E5VA 1OW3B 3DE3X 2GTIA 3N9IA 4BNJA 5LIPA 1AKQA 4IWXA 3M9NB 3KALA 1DUIA 2Z4TA 1IY9A 1ZGAA 2OQIA 3B1KA 1GAEO 2QUKA 4Q34A 5C5IA 3QVVA 4BO5A 3DMPA 3S1LA 4DYDA 1VZ3A 2AG8A 3FTCA 3PQFA 1YC2A 4PX5A 1WZ2A 2ZIGA 3DG9A 3L7AA 3RAGA 2J6BA 4LEIA 4MW4A 5K4LA 4KBYA 3GPLA 4TL6A 1KTQA 4OKSA 4EJ0A 4MTCA 5FB3A 2OXFA 2PD4A 3ALRA 1GGJA 1ZLXA 3BXFA 2AIRA 5CD1A 5IDVA 5B1YA 1W76A 1HFEL 3PDWA 1TCAA 3WRXA 2YWBA 4X65B 1NMQA 4KQ6A 3GRAA 3WGJA 1P4GA 4Z0HO 3V5NA 2XHZA 4AO7A 2K87A 2EP8A 1H2XA 3IDWA 4U9HS 2RGWA 4YRFA 3RS5A 2DLCX 2R6CA 5GOZA 3D6JA 5KT2A 1DOZA 1KYIA 2JLYA 3UAZA 4GZ3A 1EDBA 1FF9A 3PRJA 1CPYA 1TVMA 1G17A 2G1UA 5HE8A 3J81A 3NXKA 1L5MA 3BMQB 3OJXA 4OI1A 2QARA 1XRPA 2DGDA 1R50A 2WU3A 3CNOA 5CEHA 4QYSA 1ECJA 1W29A 5E7MA 2CRXA 1XJWA 4YCNA 1G5RA 3Q0IA 2OHIA 4JMUA 4H4DA 3HU3A 3TL6A 2I76A 4WMLA 2HT6A 4M1QA 1N62A 2LKYA 4EF5A 4MSUA 1TUEA 2G07A 3HKEB 2AH5A 2NLOA 3A7EA 3R5SA 5JNWA 2BZFA 1Q50A 4Y6GB 2Y93A 3RUEA 3MGCA 3N2EA 5KJFA 2IDZA 4KV7A 2B78A 3EH1A 5HDBB 4NNJA 3HO6A 4MAAA 4XB6B 4CLHA 1WXXA 3AUTA 4WDQA 4EKNB 2ENWA 3FWNA 1FCJA 4FD2A 4C5CA 5JS7A 5H68A 1XKXA 3S7ZA 1G7TA 1OC4A 2H65A 3Q8QB 2JMGA 2FZLA 2XUOA 4ZYVA 2HXYA 2Y77A 2F8KA 5L4SA 3LDHA 3QTBA 1URJA 4BNKA 3DOHA 2KFZA 1EEXB 2CHEA 5CLIA 1IRXA 3RLFA 1T1EA 4M8NE 4NCJA 3H4MA 5JQGF 3QIAA 4MA4A 2P2NA 2QAGB 1JHOA 4O6VA 5KMGA 3R44A 3C1ZA 1ZJNA 3ZI0A 1OAOA 1WDMA 1NVVR 4AJKA 1FVFA 1R0YA 4FSHA 5T4BA 3UJBA 5HIAA 4AS3A 1ZD9A 3OZBA 3ANSA 1KQOA 1NJZA 9ICVA 2WIGA 3NW9A 4E08A 2ASVA 2XE8A 3M9XA 3ESCA 1HYHA 2I2AA 1HTBA 1XR3A 1Z3CA 4YRSA 3N6XA 4A6DA 1I3OA 5KNCA 4RMHA 1WMFA 4TKZA 4K1XA 1ZQSA 1RHKA 3WHKA 4J0CA 2DQSA 5JXGA 1C0IA 1EFVA 3JX9A 3EXHC 1HLDA 2PM8A 4M7OA 1K3UB 1C0KA 5LOVA 3G2HA 1MIOB 1GEGA 4AMVA 2H8KA 3QVTA 3IAM1 3CE6A 3T4PA 3ZJ4A 2R00C 1GILA 3VSDA 4OO3A 3GIIA 1SL2A 4YG2A 5CITA 3NGLA 4ND1A 4I55A 4P4LA 1XZIA 1YMUA 4DOMA 5DOVA 5AVSA 3VAZA 2BE7A 3HUDA 5BSKA 2HOFA 1EJ6A 2EG5A 3PXEA 1QLNA 2VDPB 3VQTA 3DZCA 2C5GA 1QG2A 2VYVA 3VNQA 5BOLA 3OSNA 2XMZA 4K26A 1GRRA 2PLRA 2PZAA 2WSSA 2J30A 3RWMB 3MD9A 5EY5B 4D3FA 1C0PA 1PG5A 1VPWA 3LCCA 4AC9A 4XWTA 5F73A 3HGQA 4OQMA 3L40A 3QKTA 4KLFA 1ZUNB 4PV7A 3ZLBA 1YMQA 1KI1A 1RRFA 1XRSB 4YMIA 3D59A 3HE3A 2LYBA 4B7XA 3P2OA 2VTDA 2QUJA 2BHRA 3OTQA 1Z5PA 3GMDA 4KIWA 2V7EA 1L5HA 4G8CA 5F51A 1KSHA 1BG6A 2WOJA 3IUBA 1LF5A 4RUCA 4M0FA 1QH8A 4OCZA 4DJFC 2UYHA 3KUXA 4ZYTA 2RH9B 4EYHB 3WISA 3P2KA 2AG0A 1J1UA 1TKCA 3SZGA 1E2PA 3KT3A 4JHLA 2J6HA 3PUWA 2CL6X 2AC7A 2F8MA 2F43B 3COYA 1X7DA 5TR9A 1BA2A 5IKXA 3ZJTA 3LGSA 3RJIA 2BI4A 1ND6A 5NULA 1HTWA 2W11A 1Z08A 3PE4A 4K9DA 3DWGA 2GKSA 2IWRA 1YBFA 2JGFA 1CERA 4KK4A 1QNFA 1ILEA 4MS3A 1M6VB 5LA6F 1Y6ZA 2W22A 3AI3A 1OLSB 1F4LA 3I12A 4OQXA 2HMAA 5J47A 3D8SA 3TSAA 2BI8A 3IJRA 3B12A 4EYIB 3SBXA 3FTQA 2UVVA 2IYPA 5LPNA 4Y2YA 1W48A 1QYIA 5CPBA 1VGQA 3GLHB 8ICAA 3HXKA 4BWYA 2Q41A 3AERB 1QTNA 2ZU0C 5EESA 4M38A 1VBNA 1DKRA 1RM3A 3A1CA 3OPYI 4DBLE 2OCXA 5EJIA 1WIWA 2I2FA 2IC5A 3MFYA 4GXTA 3RGWS 3BXXA 3IESA 1WETA 2JAWA 2WM9B 2CVQA 3AW9A 4UM9D 4CM9D 3Q9NA 4JJFA 2WFLA 1LDMA 3CT6A 3UT5B 3K31A 3LP6A 2ADOA 3GVPA 1AGRA 2ECKA 2IF2A 4A10A 1WCYA 2NAPA 4YUXA 3KHTA 1KO4A 1YR9A 2NZYA 2OCAA 2BMEA 2XUGA 4NU5A 1EJBA 3FI0A 4CLDA 4KNVA 2ZR9A 3I04A 4R54A 3BK7A 4BC1A 2FUG1 4HNRA 5FUBA 3FUXA 3EVNA 1MJ5A 4TL8A 4ZVSA 4EYGA 4JV5B 3H6KA 3SSAA 1LRKA 3ZYZA 3KYJB 1I3CA 2HSDA 2OXEA 2PT7A 2QTWB 2UYCA 5KT7A 3NALA 3GD7A 1U9CA 3IT2A 3B9QA 1VKHA 1KHHA 2YN4A 1R10A 3C21A 4XE5A 1DAPA 5DNVA 4YJ2B 1K92A 1VP9A 3IHKA 4BLQA 3DVAB 4KQ1A 1ZL0A 5HBRA 2INGX 5LKRA 2H3ZA 5J59A 2C77A 3V7WA 4RF4A 1L4EA 3R8XA 5B6IA 5E2BA 3NNSA 4KR0A 5JZBA 1CDEA 5IH3A 4RUAA 1YRWA 4RD2A 3U39A 3BHMA 2YQEA 8ICGA 4ZA2A 2XUFA 2XVYA 5GV7A 2IHZA 2R8HA 2Q9AA 1AM4D 2KJ8A 1Z68A 3A05A 4C2BA 1T4CB 4JJKA 2RIRA 2EJUA 3NWPA 4FYMA 3BKWA 1OFGA 3BOSA 3EC1A 2AW5A 1N2SA 3EGDB 3HV0A 4CT5A 5JAIA 1CQJB 3HCBA 1T4DA 1J8DA 2ZFUA 4JLOA 1JVSA 1RE1A 1IAVA 5KG3A 1RXIA 2PMDA 3A0RB 3HEAA 1OI7A 2YMQA 3H05A 1NVXQ 4G0OA 4H0NA 5CWRA 4JZYA 3PWZA 2Q9CA 1Z83A 3KQPA 4M0KA 1PT7A 2UXBB 3C39A 2K2QB 4A8JB 3LT0A 5HF9A 3VH4A 3PFIA 2EW8A 3TLCA 4X62B 5C1PA 1OPRA 1S9HA 3DQZA 1NMYA 1F1JA 4RVHA 2Y9UA 2QPTA 3L7CA 1MX5A 1GNPA 4NBKA 1ZP6A 2ZAYA 3P9SA 4Y7CA 5EKSA 1PNQA 4NZPA 3F6PA 1N2JA 3DMHA 3G1WA 4F4KA 2IHUA 4LJXA 3OIWA 2Q5OA 4HNSA 4J1SA 1PT6A 3F53A 1GPH1 3NZEA 4UTPA 3L4BC 4ZWNA 1YTUA 4DR7B 2IZ1A 3NYIA 3CBQA 2BM9A 2YNMD 3ZZMA 4JOCA 1E89A 5KFAA 2O19A 1ZUD1 4IRKA 1Z3IX 2PFOA 3H9UA 2YIMA 1H2WA 3D6VA 4F4WA 2C04A 3ND5A 5FYDA 3T0FA 9ICEA 2HU8A 1RQLA 2VCHA 2NO1A 1YS4A 4LXXA 2WT9A 1YZ7A 2EFDB 3EZ9A 4MKFA 4B80A 1NNUA 5HOQA 3HW8A 4O0LA 4IQWA 4R9RA 3R6WA 3H4VA 4GP6A 5BR7A 3L8FA 4MKXA 5ALNA 5B1SA 4FSDA 4N7MA 5B1HA 4G2TA 3W2EA 1YZGA 5LQJA 1H0SA 2IS1A 2P4SA 8ICTA 4PZLA 1RYEA 1ZLYA 1ZD3A 2ZDGA 5K3DA 3PR5B 1PL6A 3R6DA 1YUMA 2IU4A 2CPRA 2H18A 2XKAA 1TYAE 3RJMA 4GSYA 1SBIA 3UKOA 4TMYA 1QVRA 3FNFA 2CLLB 4FONA 1ADJA 1DK2A 4Q3CA 2KN7A 3WYGA 1YU9A 2YW2A 3QLJA 2A0YA 5EWLA 2VO1A 3CKLA 4YRTA 5HCUA 2WUFA 4HCJA 1P9RA 3KHSA 3IMFA 4CCYA 2Z8XA 4I66A 5BR8B 3KJEA 3K0KA 3OC0A 3D0QA 1CUZA 1BDBA 5JZ9A 2HQBA 4I2NA 5KG0A 1YXMA 4DUPA 4MVWA 3IKTA 1NRXA 4IO1A 1P2BA 4ZVLA 4I2AA 3MINA 4YUWA 3USCS 2F6RA 3EA5A 1Z5ZA 2JRCA 1RKUA 5DW0A 2VK1A 5BQ3A 3BIJA 3K1AB 1TRKA 2EP5A 3EYWA 3H9JA 4Q1CA 1Y3DE 1UWVA 4Y2SA 2REOA 4QTYA 4RIIA 2FV8A 2RLTA 4I08A 1U7OA 1RTKA 1MG0A 3R6GA 3QV2A 2FZ4A 4M1TA 3UK1A 4FNOA 1FFDA 2J3LA 4R16A 1TUBB 3RB6A 2CF5A 3WNCA 3KL2A 4RMIA 3ELBA 5HEKA 1RM6C 4DLYA 4B7UA 2DFTA 4FOOA 3VSCA 3DEJA 3V2GA 2WNIA 3IBGA 3A3KA 2I1QA 1UOEA 1NQUA 3K70B 2PLNA 4TV9B 1Y3HA 1NDHA 1JALA 1XQ1A 1FRQA 3AVYA 3PV0A 4E07A 2C98A 3SJBA 3DKKA 4JIGA 4M98A 4C8KA 4Q4LA 1YZVA 2OLJA 1X94A 1G19A 2A8YA 4QWDA 2JA1A 4LXQA 3RS9A 1AKTA 4CLRB 3PHHA 4DFDA 3QBJA 2QTNA 2ZI3A 3WFJA 1K9SA 2ASEA 1V11B 1T3ZA 1Q1BA 5EKTA 4JBIA 1PR9A 3SF0A 4RIGA 5BT8A 2A5GA 5JSQA 1FX1A 3EPHA 3KAQA 2AVNA 3V9PA 4JQOA 4WY2A 2I4IA 1NXXA 1KDPA 1SUIA 4NRDA 4RPIA 3W5AA 3GXBA 3KKNA 5FLKA 4F9TA 1K5PA 4NBSA 2HA2A 1RJFA 1M72A 4IV0A 3FWPA 4DCVA 1TU4A 6LDHA 2HZBA 2H5LA 4QOIA 4YMGA 1JJFA 3UOWA 4O4HF 5ECYA 2X5JO 1ORDA 5C5CA 1NVUQ 1IJEA 3GDHA 1BQ3A 3ITNA 2AI3A 3VAAA 4AUNA 5HRAA 1E2NA 4UXIA 3NOVA 4DDKA 5IU6A 1RWXA 2HH9A 2VP5A 4FJ1A 3NRZA 2H31A 3OPQA 1JA0A 4HQNA 3ZDYB 1K4KA 3BDAA 2YASA 3CHYA 5JSHA 1BFKA 4BQPA 3AJ9A 1TK8A 5BSTA 3D0KA 1MUUA 1PAUA 3MWDB 3DMTC 4P4SB 1F6BA 4GF5A 1UMCB 1ZJ6A 3MRTA 4U5XA 1T36B 3EVBA 1I4OA 3QI7A 3ITDA 1F8FA 1KQFA 1SD5A 1SH7A 1VYTA 2FRVA 4UARA 1NW4A 4J0IA 1OIWA 3U9LA 5HTKA 1Y6FA 2IS6A 8AT1A 4QZEA 5BV2P 3PT9A 4RUKA 2XDWA 3P8ZA 4EJSA 4BVLA 3C3DA 4JU9A 3D3QA 1EE2A 9ICUA 1DKMA 1COWA 1J9GA 3RNOA 2YWDA 2NT3A 2WEKA 2LDXA 1CEQA 2JB9A 4BQIA 5JFTA 4KTQA 2B4RO 4Z6DA 4CXMA 4YO8A 2FDRA 4Q5IA 4L07A 4RLHA 3TTXA 1BNOA 3PDIB 3RAPR 3KPUA 2QNIA 4MGEA 3V1YA 3ZWYA 4C4PA 2JD1A 4LY3A 2ODEA 1P2TA 1I2BA 2IZ5A 3W6NA 4MAFA 2WB1C 3BZCA 3OEYA 1NQAO 1U94A 1P3DA 3DYBA 2GJKA 1SJ9A 5ITWA 4QIWF 4K28A 1W8DA 5IHXA 2ORIA 2Q07A 3BH6A 1B0UA 4Y6SA 5L53A 3CH4B 2KK0A 3WLEA 3PLRA 4RVSA 2NXNA 4KVGA 3VR4D 1J8YF 1YZFA 4G86A 2ZUEA 2D7CA 1KO8A 3A9SA 1D03A 4OMCA 4ZVNA 1OXTA 1OZHA 4ARZA 1P3JA 2HCJB 1NONA 2EOAA 3EGXA 1YVDA 3CSDA 3VUEA 1XD9A 3EWAA 1KZYC 2IYLD 1C30B 4F5EA 5EFZA 3OZCA 3B38A 5FNVA 4E6PA 2W2TA 2WWRA 1QXSA 1TIBA 3O74A 3QX8A 4ZGWA 1WXWA 4HN9A 3DLPX 4QW9A 1K6IA 4PYMA 1L4UA 2NU6A 3EIEA 1Y4UA 1D4AA 1L2TA 3OM0A 4QDUA 4JEMA 2EFCB 4D02A 2YXNA 3KZ1E 2H51A 4PGYA 1I0LA 4DIEA 5AJVB 5EHIA 2ZB3A 1YQXA 1ZA1A 1CRWG 2CZGA 3K1YA 4KN4A 2ZRPA 1BU8A 2BMVA 3ISCA 1GFZA 3G2MA 2KZ3A 3UY4A 2II6A 5DRYA 1V6SA 4EWLA 1E1YA 3PGVA 4ZOBA 3C70A 5E3IA 1KHTA 3LWLA 5U4XA 3GJ3A 2IHVA 4C20A 2NZXA 3T9DA 2DPIA 1OYWA 5F9FA 3RBXA 1E7RA 3CEHA 2ZB4A 1ZO8A 4G5HA 3PCXA 4BB6A 4OM7A 5BR1A 5JALA 4ARBA 3HKZF 2CW5A 2BFPA 1X6VA 3CVUA 1NVTA 4PQFA 1F3LA 2GPBA 1WW3A 3UV6A 2EW2A 1SHJA 1XU7A 4CM8A 4QPPA 5IIIA 2ZJ1A 1E4OA 1JN0A 2BCVA 4V1CA 3T1HB 1NLFA 5DHFA 5D00A 4AZVA 1CY6A 1RLOA 1LY1A 1A5BB 1PGPA 3T7JA 3D8NA 2AFIB 4JXJA 1AMOA 3R0QA 4URXR 1IEQA 5IIJA 2HDWA 4BP3A 5AIBA 5CAEA 1YR6A 3R3UA 4AQDA 4IZIA 3V4PB 1U0TA 2ZRHA 2GESA 9ICPA 3DHVA 5HKKD 4YDSA 2Z57A 2YRFA 2PXCA 1L8OA 1E9EA 4G1VA 1LNSA 2A0FA 2ARKA 3LHIA 2VUSA 2NWQA 2VSFA 4B46A 5AUNB 4YHHB 4O3PA 4YCBA 3ELUA 1JGTA 1MOZA 1T6XA 2R65A 4X7BA 3D7LA 3UAVA 3CLTC 3WLKX 1Z8NA 3CRNA 4OIMA 2Q3CA 4IV5A 1QYVA 3T54A 4MFFA 3GPDG 4RNNA 4XASA 2CJXA 1DKLA 3ONWA 2GCEA 4ZTBA 3OQ6A 4IIUA 3N2KB 3IQWA 3K92A 4RTSA 3V4OA 4QUHA 1FUIA 5HHIA 2O1SA 1RHJA 2Z8ZA 4OJLA 1UC9A 1RWVA 2HF2A 5HOEA 4BDTA 4R05A 2G28A 2D1TA 2NM0A 2YWHA 2QL6A 4RSRA 4EVQA 3QUCA 4G5QA 3K4QA 2XMDA 4YALA 4NATA 3FLEA 2Q5HA 4NCAA 4U6QA 2W9BA 4ESEA 5F78A 4DRYA 5CVJA 2WILA 4PSCA 3A11A 1H9AA 2OP0A 5LIRA 4Y7DA 3UGQA 4LC1A 1UPAA 3HCWA 2JASA 4OUDB 5E3JA 4MYSA 3GLGB 3PS9A 4I2BA 3DVSX 3OMWA 5A7GA 2WVHA 1BCRA 4DEYA 2FZGA 1ODLA 3SQNA 4CG1A 4B9MA 4BO6A 5FDFA 4NZMA 1MB2A 3GOQA 4HXEB 4JSRA 2XF8A 2WHXA 4YJHA 1FLAA 1ZISA 4OHXA 1NQXA 4NABA 3TW8B 2ZETA 2F8SA 4JI3B 4HZUB 3LXUX 2PMFA 5KYXA 4DY4A 4Y6QA 3SFTA 3WRWA 3CO0S 3LUHA 2VJDA 4NFLA 1HNWB 1U8AA 3ETLA 4F8EA 1B15A 5D8DA 2XAAA 5GPBA 5B7QA 4NOJA 1WTCA 1RWNA 4JLSA 4M8IA 1CULC 3AGPA 5AVZA 5JAMA 2GAOA 3K8ZA 1BDHA 1FTGA 1Y7IA 3MOGA 4MGYR 1M1XB 3PC8A 3C3JA 4FGUA 4LDAA 5A1JA 1JLSA 2MDTA 2PUVA 2E3TA 1Z5UA 1QS0B 2OZLB 1YS1X 4C22A 4LI0A 1AIPA 4Q02A 1MSWD 3H13A 1NZJA 3KO8A 1KFSA 3I62A 3FOFC 3F74A 1MQ8B 5ILOA 3GRKA 4E22A 3BGWA 4YTEA 1PT5A 2AMLA 4ND4A 4OREX 4MS1A 3DGEC 3NAZA 2ZVPX 4LPKA 2CFSA 1I6MA 3DWIA 3R5JA 1R4NA 2QN7A 2L42A 3W1VA 5C8ZA 5CFNA 4Q03A 5DDMA 1ZVKA 2WTMA 1EDZA 4PFSA 3L6BA 4WBXC 5J5CA 5JADA 4BWGA 3V00A 1CKEA 4EHKA 3HB9A 2ATCA 2PGOA 3UC9A 1S8AA 3TEMA 3NONA 2K8CB 1UFRA 2AQHA 5FPTA 4FZVA 1U9ZA 4LE2A 4NXMB 1KEVA 1DELA 1R2QA 2XY7A 1C2TA 1ZVJA 1GPWB 4IZHA 4X44A 4FMCB 3DQPA 3UW3A 3AJEA 2IL1A 2ROQA 2DG2A 5EPUA 1NUAA 4BZPA 4JLKA 5KEIA 2HA4A 3PQCA 5C8VA 5E6SB 5G0WA 3K0FB 1YOVB 1QKIA 4XQ8A 3LBFA 1H8HD 4HMPA 2FSVC 1PW5A 1ZNQO 5K45A 3TJRA 5FBZA 2Q3JA 2MOKA 2B6GA 3JQ7A 4IFTA 5DYGA 3KZXA 3OCUA 2F67A 4BPRA 5KYYB 1BX1A 4CODB 4RZQA 3VR3D 3T1YB 2EX4A 1QP7A 2WVGA 1H23A 1OWMA 2JJ8A 1QCCA 5A02A 2OORA 4CM9A 2YV5A 1QM5A 5CW2A 5IAKA 5ICCA 1TUIA 1HE8B 1SVOA 2AK3A 3P94A 1K88A 4HVLA 4M86A 4GLLA 2EBHX 3H3FA 4HRYA 5CDYA 3FBGA 3L9WA 1FP7A 4JI8B 5JPCA 1BAPA 1N5RA 1J24A 5KYKA 3L5OA 3KJQA 1KAGA 4IH4A 3AX6A 4RNOA 3P20A 3ZBTA 3I8XA 4U5QA 2B3TA 2UVDA 1U4NA 1SK9A 2SKCA 4KLTA 4KN6A 1EVIA 1HC7A 4KIJA 2NZVG 4M8SA 4W5JA 8MHTA 5ESRA 4DXAA 5EIBC 3MMZA 3WP1B 2WSBA 2DT8A 3TZ6A 4EA7A 2H7CA 3HJFA 4H7PA 1GUDA 1MQAA 1NF2A 5AJHA 4NENA 5BWCA 4ALMA 2EFGA 2CYBA 3VH3A 1K7SN 1X1EA 5EQTA 3RCBA 1UBEA 4N9WA 4Y1EA 1RFLA 1PUJA 2ZUUA 2E7ZA 2K89A 3MWJA 4M37A 4G0ZA 1TTTA 3AOEC 1OI3A 2BJWA 2VTBA 1NXSA 4LXYA 3NATA 1RU3A 1LS6A 1AQIA 1VL1A 2O57A 1F6WA 2O7VA 2VJCA 3EXG1 1BNCA 3PEUA 5DN9A 1VI2A 1TT5B 3FBWA 5EOVA 3JWEA 1BXKA 4LF6B 3FBTA 1XKTA 3RLIA 1O57A 1IH8A 5BRNA 4YDHB 1IXRA 5I3ZA 1CUYA 2XTAA 3VR2A 1NMZA 4YH1A 4RQ5A 4KLEA 4S35A 4RZSA 3EOBI 2XZOA 2C5LA 1DX6A 4MQ6A 3NFYA 4PLHA 2C5EA 2J1LA 4B2PA 4XUGB 1F4VA 3ZOKA 5C8YB 5FPQA 5DHUA 4KFCA 5J2DA 5B5SA 1R6UA 3ZU6A 4WBNF 4EUFA 3PV8A 4Q12A 1RYUA 3DVLA 3BK1A 5FPPA 3F7NA 1GPAA 5FHQA 4GYWA 1LPOA 2ZYGA 3UTDA 2WM8A 1E8DA 4XQGA 1JHDA 4EFMA 3UH1A 1TA0A 4YXWD 4NX2A 5JRTA 4K81B 3UK0A 3JQGB 3NFRA 3RC8A 3A1WA 4RJJA 1GPUA 3RBDA 1J90A 4ROTA 4ZT2A 1FNNA 1N8TA 3UZUA 4RMJA 3MGBA 3PHCA 4YR9A 4FYVA 4EG3A 5IKOA 4C8MA 3IKJA 4J7UA 1FU8A 5DKWA 1A7JA 5BV1A 1GGEA 4MP8A 3QE0A 4JENA 4MW1A 3L1VA 2ORED 2PYDA 4FYYA 3JATB 2W8BB 1NRJB 3PXXA 2NO9A 3ZLUA 2F76X 1O89A 1H42A 5KHLB 1DX4A 1E3JA 2Q0QA 1N2BA 1OLXA 2F1HA 2B1IA 3S2FA 2B8EA 2XGMA 5LP6A 2IGBA 4J9VA 2DKZA 4KLGA 1ZQVA 1ZUWA 5AESA 5EUBA 5J2TB 4UTRA 2ZS7A 1N4AA 1ZC4A 5C46F 4O2RA 4RADA 4TQ9A 2WIAA 1DU4A 5EE1A 3HC7A 4B44A 1P0QA 3GIDA 1KW4A 4PZZA 3R7NA 3BXPA 1FXUA 2Q5IA 2ZJ0A 3T95A 2JK1A 5CIYA 5KWVA 3Q8SB 3NJ8A 1NK5A 2XAUA 4D99A 5C4IA 1X80A 1GNRA 1DTWA 1XLTA 1EX1A 3I8SA 1IXKA 2I67A 3IAXA 7YASA 4X6LA 2PFKA 3TL3A 4AECA 3QHPA 1X7ZB 4NARA 4A8TA 3GAMA 3PX0A 3U40A 1YRBA 4WD3A 5FORA 2IEBA 3SEIA 1SL0A 2GZHA 3H2BA 1ORIA 3UATA 3MJFA 4C4YA 2FPIA 4X64B 4IXMA 3OT4A 3IJ5A 1FUEA 5IIOA 4F3KA 2QAJA 4YO7A 3FD8A 1FFYA 3Q8LA 1Q3KA 5LN1A 4RQMA 4AUMA 2PRSA 3D5QA 5AKKA 1XCJA 4QWEA 4LRWA 3U7QB 5E2IA 4XQEA 2GPWA 1VJ0A 2JFZA 1TI7A 2Z95A 5FTKA 3WV4A 1OH7A 3F96A 4NCIA 5CXUA 1XNJA 2G82A 2DT5A 1N5DA 1VZ2A 3P27A 5EXPA 3N75A 3CPEA 3ZHTA 4JL5A 4CM4B 4R4JA 1P2VA 1N78A 3VTZA 3JWGA 1I4LD 4U2CA 2XW6A 3MS2A 4JJAA 4YONB 3OEED 1NW5A 3HY3A 2W0MA 3SS9X 2Z6AA 3ZJ5A 1XV5A 3OQIA 2BTQA 3VNSA 3E2IA 4EZEA 3P71T 3BFPA 3QG5A 5DWVA 3BX1A 4CM1A 2H1CA 3I23A 3PNVA 5CH5A 5G1PA 1JQ3A 1IZ7A 3W77A 4J4TA 3TAUA 1ANKA 1Z6XA 2Y1DA 1FX0A 3NGXA 2AT1A 2G71A 5F7OA 2B1RA 4ER6A 2K2WA 5DTJA 1M2VB 3I58A 1GAQA 5E0OA 3P2MA 3HEBA 5DQGA 4ZK2A 3DPUA 3DLIA 4JT8A 3RF6A 3Q87B 2FMXA 3GBVA 3UN1A 4QUKA 1DXYA 2FRDC 2ERXA 2PGLA 1LQTA 4NM1A 5KTMA 3D6NB 1S89A 3KP1A 4JY7A 4B6QA 1UDWA 1SEPA 1FNCA 2O4CA 3OF2A 3UXHA 4WCFB 2GBLC 4XX0A 1DUVG 3T15A 1NK4A 3D3JA 4BJ1A 2Q0SA 1QG0A 5FADA 3V1TC 2MSEB 3QMWA 3LF2A 2AD5A 4OPMA 2I29A 2LV8A 4BNMA 1TJYA 2QR5A 4OYHA 4UM5A 1JWLA 2WWVD 1UPXA 9ICOA 3HJUA 1UBSB 3G9TA 1D8LA 4WLFA 1BW9A 1CNEA 5LP6F 1ZQFA 2EZYA 4W5QA 5KQSA 1VA5A 2Q7OE 3MDAA 3LOUA 1C0LA 1GDHA 1XYVA 4RT2A 3PC2A 1Y1TA 3QKRB 4CKEA 5F2OA 3AFNA 4KPUB 1UK9A 3LP8A 5G5GA 4ED3A 4L4UA 2AKEA 1MEJA 4D9NA 1GSHA 5JQGA 1HR0B 3OY2A 2FPKA 4OXNA 5IJXA 3I8OA 3PQ2A 1C9YA 4I5FA 1IFXA 5CP8A 3HH8A 5KG2A 2B5OA 4X1IB 1W30A 5G4LA 4C3OB 3QELB 3MTGA 3CZ9A 3ZS9A 1S8FA 1BXGB 1KJ8A 1SCQA 2RGNA 2XWQA 3QVMA 5KTPA 5JATA 1MC4A 4KI0A 4NFYA 4N0QA 1K7CA 2X76A 2ONJA 3M6XA 3OJWA 5BN4B 4ID3A 3SF8B 1HFWA 1MH1A 1QE3A 1ULHA 4OSPA 1YS6A 2V9WA 4BFZA 3KE8A 2JIDA 4HAVA 4OHFA 3FOCA 2GH1A 2JLWA 2GD0A 1C50A 1XCGB 2WF5A 1ODJA 3AF5A 5TZVA 4Q15A 1WA5A 1IB0A 2C5SA 4EEYA 3N7PD 2J67A 5DB4A 2OB1A 1WX1A 3DTVD 1N2CB 2HLDD 2PBRA 4WK0B 1SUSA 3UQ0A 4LAFA 3HVRA 4GX5A 3RVMA 1L9KA 1H85A 2VZ8A 2P9EA 1N48A 4J9UE 2C3MA 1Z4PX 3VR4A 2JIZA 3VZPA 4DR4B 1NLMA 5EWFA 1ZN7A 3KSDO 2N47A 3GYBA 4Z4FA 3ZOZA 4F84A 4RQTA 1IOVA 1GRQA 3HJHA 4L95C 2GM5A 5KOHA 4FNMA 2GCOB 2VSOA 2JCBA 1R6AA 3HCRA 2C2OA 3V4FA 4A3SA 4CMIB 2FW1A 5FBRB 3LXRA 1OQAA 3ONFA 1MQ3A 3HA2A 4W1QA 3II6X 2PDAA 4P58A 1U1DA 4EABA 1B16A 4RVDA 4HD8A 4MV5A 1ZKDA 4E5KA 1CQXA 2RQ5A 1FMJA 4JBNA 4DUGA 1USKA 4DQPA 3I28A 4RQ4A 2VQDA 2YW9A 5B3JC 1K6JA 2PYIA 3ZJYA 4JB3A 1OJLA 4DR2B 1VSUA 3HQ4O 1T3SA 3SIWA 1XHFA 2BZ0A 5LMCA 3U48A 2JVIA 4PGHA 5BURA 3LWMA 2EBUA 4XLZA 2P9BA 1K6MA 5BXQC 3OOHA 4FFBA 3H99A 2QORA 3KLPX 2P9FA 4DYHA 1PJCA 4IC9A 4YUVA 1P62B 3AFMA 1XA3A 5E1OA 1U63A 3VC2A 3CVWA 1QV9A 4DT1A 2P9CA 3QUTA 2F1OA 4DUZB 1ONPA 1BJTA 1V7ZA 1NJ8A 4M8KA 1ZVQA 4ZCQA 3RYCB 3QBEA 1ORHA 3TOXA 2FG5A 4P5PA 4CUKA 1EK5A 2X3UA 5LA6A 5IAAA 1QYRA 3K8QA 4OGGA 4ZOQI 3QEBZ 4KDRA 5A2GA 3Q3IA 3Q9UA 3G8BA 5IVIA 5BVHB 1SRQA 2ZVJA 2WM2A 4X7PA 3VZRA 3QI2A 3PFFA 1N7IA 4S1WA 5IIKA 3KSUA 3FGOA 2O05A 5LQCA 1PD0A 2R9VA 4M7PA 3SENA 3D2NA 2UYGA 4ND6A 2RBKA 4WK4B 1TEZA 3WAGA 3AM9A 2OCDA 2B4KA 1DOHA 3PUZA 5DI9A 1A8IA 4L76A 2WD9A 2HSZA 2HFJA 2QPAA 5CLQA 4G1FA 3F73A 1L6NA 1A95A 1ODKA 1YB5A 1O0CA 5HKKA 1MAVA 3EDYA 4LHXA 1T2CA 2O7RA 2OXCA 1SXJD 3BD6A 3OHPA 4GXIA 4F3CA 3HKBA 1KDOA 3TQFA 4N8SA 3QKIA 5ISMA 3LQYA 2PXAA 1R16A 3OIFA 4D26A 4X1OA 4EH1A 2A7XA 3ECCA 3AOGA 3G6WA 3F2BA 2AKYA 3I61A 1G41A 4MYUA 4DLBA 4DNQA 1JAHA 3FPSA 1WY5A 5ESWA 1CRPA 4JXXA 2OZKA 2YJGA 3Q6MA 1TKDA 3C8DA 1XN1A 1WB9A 4DL7A 2PK3A 2FZVA 1M1NB 3LTNC 2DBQA 3CUSA 3TB6A 1K63A 1G8MA 1F0KA 5CFLA 1RYSA 3NDIA 1FYWA 1T2NA 4Q47A 2VRCA 4ZAYA 5A3SA 4KCGA 5DRTA 1VG9B 2IPLA 2GAAA 3E2MA 4KHPB 4O4JF 2WFMA 4B79A 4JUFA 3OA0A 1QHGA 3E9RA 2D0DA 4ID9A 2C2YA 1E5VA 4RZ3A 1NBAA 4XUEA 1R8SA 1G16A 2HAEA 1AXRA 2YN2A 4PCUA 2JKVA 2DECA 4DLGA 1AA9A 4L85A 1UM9B 2HOQA 3RB4A 2FLPA 5C7YA 1UANA 1JDBC 2J4CA 4HVCA 3GV7B 3PVZA 4TTVA 3EASA 3NDRA 3MWLA 2F9LA 3PX3A 4OQQA 1I4DD 1K6EA 2H9IA 5BWOA 1N5IA 3W78A 1X0VA 1ISSA 1TQ8A 4J4BA 3OC6A 1OUQA 5EN4A 5FP0A 1WCIB 1V1MA 5KYUB 1PW7A 2HBJA 4WY5A 1TZJA 2P9ZA 3KZIU 4EJMA 4QYIA 1SV4A 3OLXA 3M6WA 2R60A 3I9NA 1Z37A 3IP7A 1AS2A 5BN5B 3PW0A 5EXDA 5DIFA 1B3BA 3ZS8A 3PEEA 2WUGA 1NUHA 1E63A 1T3NA 2JAQA 1KFEB 1P7YA 1EM6A 5THXA 4D0GA 4ZHSA 2O6LA 3D7KA 4IRUB 4RFSA 2H1HA 4FB4A 3DZFA 1WVIA 1TM3E 2PNFA 1MJNA 1GCUA 3MWEA 1VIDA 1QH9A 3Q0TA 1BS9A 4XVQA 2C2ZA 5JYBA 4N47A 7ABPA 1OYOA 4KFSA 4R1NA 3EHDA 1O95A 1KQQA 3NDJA 2ZYRA 4YXFA 2CEKA 3AKZA 4TUPA 4MKRA 5CB0A 1KEJA 4JKIA 3RFUA 3D8UA 5IN5A 5KFGA 1TRHA 2GYWA 3MOIA 3W05A 3B6JA 2GA9A 1R1DA 1G1MA 4BP8A 2EKPA 1H6AA 3AFGA 3Q2IA 4PQGA 4MKHA 2BPGA 2GVDC 1E59A 4CIVA 5ER6A 2BBOA 4FNGA 4P36A 4R0NA 2BHNA 3BMNA 3L1HA 1PZNA 2ES6A 2VTVA 5I45A 1ZWLA 1XG5A 3BWVA 3QKWA 4BFLA 4KN9S 1NV9A 5A4MS 3AKYA 1SZPA 2P91A 3ZTWA 3R09A 3NV7A 3NETA 4DWVA 3HFGA 2AR0A 4B81A 3LDAA 2G67A 4D5GA 2A9RA 2O3QA 2SKEA 2BOVA 3T3DA 4QAJA 1S2LA 1M34B 4JJ4A 1XZGA 5KNBH 4LTMA 5DG7A 3TAQA 4Y2HA 3AY0A 4KLHA 4CR6A 3AF4A 3MJCA 3VO1A 2A59A 4FEAA 3IRUA 4M9QA 5HFAA 4E94A 2PX5A 1I1OA 1OFVA 9ICWA 1JE0A 4JXZA 3LUCA 3QPAA 4LYDA 4CG3A 2CKMA 4I2JA 3SQLA 4I2HA 1JFFA 5HGJA 3JR3A 3UMFA 3VR3A 3EEOA 3M6VA 5T5QA 1AQUA 4CMEA 1R66A 3ZQKA 2H92A 4TWJA 5D3KA 2WVAA 4GFJA 4MW7A 4R2MA 3V33A 5JJ5A 5JR3A 3OJFA 3N6RA 4PZ9A 3FG9A 2NGRA 1EUYA 4X1YB 4G4JA 4EI8A 2V3CC 3PYMA 1DPGA 1WMBA 4I4TB 3IV7A 3PTLA 5C32A 1Z39A 4D9HA 4G5YA 1LVGA 2J6TA 4ME6A 1BE0A 2GLUA 3CX8A 1N2IA 4JLUA 2I9PA 5B6PA 3H8MA 4OG2A 2AMYA 2E0IA 4C0WA 5B2EA 4BFVA 2JI7A 4PBRA 4BGUA 3H2KA 1GSOA 1LX7A 1R12A 4QZVA 4F3YA 4C43A 3AZQA 3RV3A 1ZM4A 1QCKA 4YMLA 4JYCA 3M0EA 2CLDX 4M4SA 2IPXA 1S1CA 4RMGA 1DVRA 4IIVA 2WJWA 2XBLA 3EBOA 5H0IA 5AYVA 4LF4B 4WIAA 3DA8A 2O8EB 1VPDA 4JEUA 5JEEA 1QMPA 3ZDXB 1YJAA 1BXRA 3IULA 4M1YA 4TSKA 1KEKA 4TV8B 1CJSA 1P45A 3SV3A 3AUSA 4DPMA 5DB9A 2V65A 3ZWNA 3W2IA 2I4TA 3ZCPA 2JI6A 5CVDA 2V4MA 1VHLA 1T8TA 1GTVA 3QBTA 1DC5A 3ISVA 5I48A 3DAHA 3G13A 4NIMA 1QGED 2YTUA 3OWOA 2VSXA 4P5DA 1FOEB 1YIAA 4HGPA 5BPHA 3N3AC 4W5NA 2PMKA 5KINB 5FTNA 4O4HA 4OKIA 1ECFA 3EF0A 3IT3A 4URUR 3A26A 3IE1A 4YXWA 2LM1A 5FPHA 5DXFA 1RP7A 1FMTA 4INOA 3HILA 5K4GA 5H4HA 4ICAA 4GH5A 1HT0A 4WFJA 1K86A 4F2WA 2WF8A 2DLNA 2VBFA 4D97A 1XCOA 2J6IA 3N86A 4X45A 1JR6A 2NU7B 1KPHA 3CX7A 4FHFA 4BVAA 4JLVA 3H84A 1ZMOA 2R751 5I7OA 3KQOA 4TUQA 4J16C 3FPJA 1EBUA 2P8SA 5JNVA 2EAUA 4DJJA 5JH7F 2C3UA 2K7ZA 3AYZB 2R86A 5KJCA 3IV6A 1IDOA 5AUPB 2WHPB 3TG2A 2WSYB 2GRUA 1RRVA 2FY8A 2W2PA 4LW8A 1W85A 3U5ZB 4XYEA 2LWIA 3K6RA 4H3HB 1FRNA 3N2NA 5L6LB 4BXOB 1EP2B 3MA0A 4JYZA 5AXBA 4Z49A 4NMLA 5EJAA 1V8PA 5HM8A 4QNMA 3K0CC 4PGGA 3BXOA 4QHSA 2FPSA 2R7KA 2VF5X 4GBJA 4F1JA 2XGGA 1PJ2A 3TF5A 2OGZA 2PFQA 1YQGA 2WYIA 5BMVB 1Z1BA 2J3EA 4O8CA 2ZXUA 3PL1A 4A0SA 2IXEA 3WGNA 4WVLA 2JLZA 3BYZA 3R9KA 3AQ4A 3LCMA 1ZJJA 5J2UF 1SURA 3PPWA 3PUHA 2KFNA 1YA4A 2H1RA 3CZ5A 1QPZA 4JZKA 5FOXA 4MWTA 5E4TA 4ZI2A 1PK1B 3F3YA 1F9AA 3WL5A 1OGJA 3CVJA 3DFZA 4HLCA 2QSYA 3LWZA 4MYHA 4CL2A 4OSOA 2VANA 2AJQA 5DM60 4EGJA 5F7ZA 3HR4A 2NUPB 1QTMA 2GWSA 5K0NA 3RF7A 3AW8A 1FVXA 2CFTA 1JR3D 4W6QA 1FP6A 3GFRA 3RRJA 3L8ZA 1EWYA 2DUYA 4OK5A 3OU2A 2NQTA 4GQIA 1SC6A 1E3WB 1JIVA 3D4IA 1Q3TA 5CX4A 3AY7A 1L6RA 4BLUA 4JI2B 4M9UA 4H7IA 4PLGA 2I4MA 4WUTA 2I65A 4TKUB 3IOCA 4EB3A 5BYKA 5ENZA 3IQDB 1F2VA 3PENA 4Q4JA 3F3KA 5EHZA 4JUIA 1V25A 2CLSA 5C7LO 3DD1A 3KL4A 4CV3A 4PHFA 1U9JA 2XA9A 2XUJA 3FDJA 2RI6A 3PVCA 1M2NA 5A5GA 5CCBA 4DARA 4JYAB 1Y37A 1ISIA 4TZ0A 4J9SA 1NI4B 2J9FB 4DBVO 3FWKA 1JSCA 3DT9A 1COKA 1FK8A 3WRYC 3UGKA 3D7RA 2BM1A 1XZKA 2AQ4A 1E7WA 4RJKA 5CG2A 2WWYA 1N1GA 3RH5A 2YVUA 1U11A 1A8SA 1A69A 1E4EA 2ZYUX 5JWRA 3U4HA 3CCFA 2EJWA 4N01A 1ODSA 1E5DA 3WK5A 5AMXA 5B2ZA 5FBKA 2IEGA 1H5QA 1HEKA 1FSSA 2OENG 1UBMS 1O94D 1YRAA 2H3EA 4EF4A 1W9MA 2XLBA 5U4QA 2GHTA 1QNLA 5D7NA 1I7LA 3OZUA 4PYLA 4GKKB 1ETHA 3WGYA 1SD1A 1BPDA 1GUFA 3HM2A 2IYNA 1Y48E 1QSLA 2DOKA 4OBEA 3T7SA 5EP4A 3NIGB 4PLCA 5DPMA 4YT5A 5TB5A 1XTQA 4NJ8A 4GBED 1VE3A 1T5TA 3ASUA 5IZ4A 1ZW6A 2IZOA 1OAKA 1BJKA 1DEHA 5DNCA 4HJXA 2PLAA 3A04A 1GTZA 4JSYA 4ENQA 3ZQUA 4IIDA 1H8ED 2GF9A 3AEUA 1T1JA 5KFXA 4X20A 3V9AA 1OWPA 3T5PA 4G5RA 3BWEA 2A19A 4MICA 4EEKA 1E5XA 5FOSA 2H4WA 4QSMA 1ATZA 3Q7RA 1GQFA 3WKDA 2J3IA 4BKRA 1ULBA 2QZSA 2MR6A 3O3MB 3ZLTA 1U0OC 8ATCA 3RRXA 1Z4NA 4BL5A 3OFNA 4I4NA 1SBZA 8ICNA 4KODA 1DFGA 1MABB 3DV2A 3CZAA 4DQXA 3PKJA 1GZSA 2E85A 3HSSA 2WKPA 1MB0A 1BEZA 4IRXA 1P2FA 2CVFA 2A1AA 2H2IA 4OOEA 2DWOA 3ZH9B 5DSTA 4BEWA 5FUXA 5FAKA 3VKWA 3VYVA 5CA1B 3OMLA 4BMPB 5IPFA 1A4IA 3F6EX 1VE1A 1YI8A 2C00A 9ICSA 3HA7A 4OK6A 1KFCB 2REQA 3PTAA 1WG8A 3TNLA 4IIGA 1IHUA 1UMDA 2GLTA 2AWOA 2HYDA 7REQB 2B1QA 3NHKA 4IL5A 1I1QB 4DV6B 1XAIA 1W88A 3D3NA 1DUSA 4O5KA 4ZJZA 3IA7A 5CYOA 3TUJC 6NULA 4D45A 2HRRA 4NNPA 2PEZA 3VOSA 2ID8A 1M0WA 1C9KA 1IM5A 4R1TA 9ICAA 2Y76A 3O47A 1OXUA 3PFCA 2D6FC 1QR2A 1SHZA 4MLCA 1VYVA 1ZQQA 5F5LA 2PZJA 3FKQA 4PZOA 2HLDA 5CDUA 3B48A 2HPVA 2EZ9A 3R24A 1N0IA 1G1AA 4AJJA 2CY0A 1CUGA 2ZWVA 3W9SA 3VDXA 5DBEX 3UTCA 4DNFA 1ZSVA 3GJ0A 5DBAA 3A1FA 3AJRA 3F6YA 2P69A 5EEHA 2FXVA 4N48A 1VRVA 3AB8A 5AM2A 1GKIA 2Y4OA 4FFLA 2VYQA 3QOWA 4BBPA 4LG1A 3LVWA 1FBNA 3RK0A 2DR0A 3U31A 4YJFA 2F3SA 2R3SA 3GD5A 3WAKA 4HKTA 1EK6A 4YI3A 1KOJA 4YGXB 1V37A 4U39A 2YVLA 3AO0B 1IWBB 2ID4A 3O4JA 3FSEA 3OH8A 3G2KA 2IV3A 3BA6A 4I4IA 2I4NA 3WGHA 1XMVA 3EEFA 1LWNA 1DINA 4B5LA 3AQEA 1QBKC 4B6JA 3SFZA 1HDXA 1V4BA 2QW0X 1OFHA 4UNIA 3FYUB 2CLFB 2XKKA 2KVCA 3M82A 1Q12A 3IEXA 4M9JA 1E64A 5JNTA 3ZDBA 1PQ4A 3NYWA 4PIMA 3SXJA 5ALFA 5EJ7A 5JG7A 1EWTA 1KJYA 1CRXA 4XGQA 5KDOA 2BJVA 4U2DA 3SYLA 2QJFA 5JZMA 3TCXB 5KOYA 1BE1A 2J6SA 4OJPA 3GLIE 9ICTA 3CMMA 3C2QA 1G291 1FVHA 5THQA 4MJ7A 4FOPA 121PA 2EKBA 1F5SA 5DDYA 3RRNA 2P7HA 1FIUA 3VR5H 5EJ5A 2FW7A 5HF6A 1JAYA 3A4IA 4TS9A 1H6DA 3A10A 2UAGA 2IW3A 2DKXA 3GLIA 1EVQA 1QTIA 1GT91 2R25B 5B12A 1JJ7A 4UEKA 1UJBA 4P83A 3O3NB 4HT3B 3KIPA 1HYBA 4X8OA 4DIBA 5JAZA 1RYRA 5H83A 2QTVA 3S40A 2Z09A 3KD3A 4L5CA 1HOXA 2BPFA 3GLFB 1DKOA 3SCZA 5HVNA 1ZJ5A 3NCHA 4QNRA 1N5JA 1PJTA 3EOAI 5AH0A 2XUHA 4XGRA 3GCDA 4GRIA 1OXVA 1TYEB 7ICOA 6AT1A 4FJ0A 4NSNA 4LDQA 1D2HA 3KBOA 4DG5A 5LZ4A 3LFHA 3FSJX 1OFUA 3C3YA 3RYIB 3DAPA 4DSJA 2TMDA 3RJZA 3WO0A 1T6YA 2IW1A 5EIXA 1MC1A 2O1XA 3AT1A 2P4HX 3URKA 4RIEA 3F3SA 1RBZA 3VPSA 1GLGA 4O2AB 3TIIA 2XB6A 1II8B 1T1GA 3PTZA 4J0KA 2EU8A 3WDSA 5SV2A 1EP1B 2VKQA 4CM7A 4XUCA 5LQUA 3UHAA 2WU8A 2OY0A 2QSZA 7ICQA 4ZHQB 1I2AA 3HRKA 3HJEA 5CNKA 1WY7A 3KQHA 1PV4A 4LC9A 4EG6A 2L5YA 2ZE7A 3A6FA 4MVYA 3T4UA 1KY2A 3M33A 4FPXA 5D3ZA 4YR0A 1QIEA 5FWXA 3GRVA 3MJVA 4M2YA 3HPOA 4D3XA 4MK4A 2X4LA 2WNHA 1RC8A 1GTL1 1EG2A 2DP4E 2PR7A 1TZKA 4CUJA 4Q19A 3K1JA 3GJRA 2FEAA 4UHJA 4WOJA 4EW6A 3ICEA 1WWUA 1U3GA 2C5BA 4XDZA 4Z3OA 3NTUA 4M8LA 1B26A 1JDVA 4L6CA 3A9VA 1UZUA 2MJLA 4YY3B 3QU2A 3ZPXA 1VMKA 4RPZA 2HCBA 5JWOA 3VZSA 3KCNA 4N0EA 1NLYA 3C5CA 5AWFC 3V7UA 1QLWA 4H35A 1C0EA 3L77A 5EIHA 2G1JA 4INPA 1MAUA 2W9XA 2ZGVA 2H52A 2AZXA 3JPPA 1VYHA 5AW1A 2RGEA 1MNAA 3SE0A 4JLNA 3IDAA 4WBNA 3PX4A 3UPUA 2EYUA 1NKBA 3HJAA 2Y71A 1YT5A 2M1XA 3ACDA 4E12A 1NPTO 4BIMA 2PUTA 3V2IA 4OTZA 4Y9TA 4TRJA 5F2KA 4QA9A 2IYUA 2ZBQA 4K40A 3IL2A 5KQLA 3MRVA 1NI3A 3GY0A 3QVGB 1G8YA 2E8OA 5HMMA 3OE7D 4L72A 2QQEA 2X5OA 4OXXA 5C0OE 2EKLA 4A0QA 4ARIA 5TY0A 1BEUB 4JV2A 1IPFA 4I5IA 2ODGA 1IY0A 2RDMA 4LHZA 4UEWA 3AU2A 5D85A 5CB4F 3G17A 1XJQA 1B00A 2GOYA 4YEDA 4AZ3A 3W5DA 2YR0A 2LBPA 1AU9A 1D4OA 1Z2EA 1HEUA 4AK9A 1PR4A 1NRIA 4LNUB 4EVIA 4L3WA 1T25A 1LK0A 2A0XA 4AJ9A 1NN3A 4WQMA 2AUNA 3NM5A 4BOYA 4I5GA 2BKUA 2H00A 3GFVA 1T2AA 4KFTA 2HIHA 3A2NA 2QENA 4G1CA 4J9LA 1V16A 2RGCA 4HATA 2RC6A 2VXBA 2YFQA 3BZKA 1OFIA 4HBZA 4O4LB 4KIUA 4DV3B 2C99A 1Z75A 4LYYA 1WXQA 5FBWB 3M83A 4MQEA 3MYYA 5DP2A 2A9PA 4LY6A 4P2HA 4F4XA 1B2LA 3F5SA 5A05A 3T6KA 3UMYA 4Y1FA 5K0EA 1EX7A 1MRNA 4M9HA 1DJLA 2QGNA 3R40A 3GEPA 4J3NA 3ANTA 3V6HA 4DCMA 4C7OA 7ICTA 4MUGA 2GFHA 3FLAA 3EIUA 3E5MA 5JY6A 1QO9A 3ROXA 2QVXX 3CUKA 1A27A 2XUAA 3MWKA 2GXSA 4MVJF 3FF4A 1KDRA 4LDNA 1P1JA 4DZTA 5EJFA 1LK5A 2EL7A 3TDKA 4W5OA 4OY3A 1P39A 3OI7A 1HDIA 1RWPA 1ECLA 4WKCA 1FYVA 1Z4LA 3A6KA 4KE7A 4YRMA 3TLBA 1ZUHA 4IF6A 4MB6A 2YHUA 1T9DA 4MCHA 2PH7A 1XMPA 1UMKA 3TD6A 1BYIA 1IIRA 3EZ7A 3GZNB 1JIXA 1LLQA 1V48A 1G20A 4HYTA 1DHTA 4Y8VA 4YPOA 1ST2A 1YB6A 2QN2A 1RAEA 4S24A 3ZZTA 4OJQA 1XVAA 1CR2A 2H2DA 3PSHA 1GARA 3HP1A 1NJ6A 5CHGA 1KFBB 2JIBA 4GOND 2G9NA 4KIFA 1SULA 4OBBA 3GROA 2FFHA 1D0IA 4R1OA 2WYHA 1KU0A 1BPEA 1JDPA 1GA6A 3THWA 1OB5A 2HUPA 3M34A 5JTTA 4FWIB 1I7QB 4QTXA 4KIGA 1V38A 3A4MA 3HG7A 2E2WA 4MYDA 5KFRA 1SG6A 3RK1A 5JECA 5G2OA 2Y1CA 1H38A 3MFQA 2E4ZA 1SA0B 2LYHA 4INJA 1CJBA 1DK3A 3DAFA 3HADA 1J56A 1E4VA 4GPD1 3OY7A 4TXMA 3E81A 2XNDD 4R8RA 2Q6TA 1COZA 3Q9LA 2WTFA 4LUCA 5LUBA 3BMCB 3KYDB 1JQLB 4IRCA 1D8TA 2B83A 4F4FA 3A9UA 2KICA 2IPAB 4MMYB 2ZIXA 1V26A 4UPEA 1XK6A 4IIJA 2JPDA 2C29D 3HP7A 2CMGA 2EZ8A 1FTWA 4C2UA 3DTYA 5SY6A 3RR7A 4MPDA 3K94A 1P77A 3RVSA 3FTFA 1XQ6A 1OA0A 3K9LA 1SUBA 1XVVA 4B6OA 4Y1RA 4D2IA 2OV4A 1ML3A 4KFRA 4YUYA 1RQXA 1SHLA 1RBQA 1DC8A 1MGPA 2Z6QA 3K70D 4YQEA 4NLBA 4EYEA 4QEZA 2OM2A 2NU9A 2YNMA 2ZBDA 5TMDA 4B35A 3U9TA 2NOAA 1H2YA 2AD1A 4B83A 3V7FA 4TWRA 2YHSA 1VECA 5T4HA 2C22A 2L2QA 3FI9A 1ZJWA 1QZXA 5DTRA 3SZUA 3L0BA 3R3YA 4WL0A 4IH9A 4KH1A 4BEBA 4HDOB 2RK6A 2NRVA 4DCPA 2A7QA 3FIJA 2QRVA 4JA0A 1UBLS 3I72A 3HCEA 2ZW9A 3CLSC 4ON9A 3HV2A 1ADYA 1ZK4A 1K4YA 4R5HA 4G37A 2O8BB 5CRIA 1Q1QA 3U7HB 1E6MA 1KOLA 1WLYA 1L8QA 1HDRA 2P1DA 1A8QA 4BMYA 1VQ1A 3VKHA 1JFRA 3M4YA 6GPBA 3W8DA 4LZNA 2R48A 5FL7D 4L5BA 1Y9DA 3FOAA 4MZXA 3D0OA 5DCLA 4MUNA 3OZAA 3WOVA 2ZE8A 4P22A 2PKQP 3MMSA 4DSLA 1FPQA 1RQ2A 1U0LA 1L7PA 3OKAA 1G0OA 4E1BA 1EVYA 1NAHA 4GEKA 2IYTA 2GGSA 2JLCA 2OZPA 4ZP1A 1ACLA 8ICEA 4U1RA 5GMOA 3UJ6A 1PK8A 3UHJA 3CE9A 2FRXA 1HE4A 3HN2A 3TM4A 3FPCA 2G25A 3ROEA 1EIWA 4N6GA 5AJZA 3C14C 1HG0A 3NXSA 4G8DA 4D0RA 2KI5A 4LA4A 3QXGA 4RGBA 2VNIA 4DDWA 5EMNA 2J59A 4D0NA 5K3EA 3D64A 1TUGA 3X1YA 3EPLA 3IQXA 1ZQZA 4HYQA 3LPLA 2D7JA 1BOOA 3OQVA 1KA9H 1XP5A 5DGXA 5AOBA 1T8PA 2ZLBA 1FIQA 3BD8A 3GVXA 3IUNA 5LNK6 3DEHA 3SJCA 2J85A 1T9ZA 4PL2A 2GN6A 4AD8A 5KSYA 2OCPA 5K6TA 4DL9A 3DO5A 1XZCA 1ZIPA 2MTBA 5C1OA 3RREA 3GNSA 4DABA 4KEAA 1AZLA 5CFQA 1HNXB 3RIMA 3A1NA 4KFUA 4NE9A 1F7UA 3K4GA 4FN4A 4KVFA 3GW8A 1MQSA 3G89A 3C4VA 3H1TA 3HEMA 2C7OA 2FWJA 4TTRA 1NDQA 3LWDA 3O1IC 2ESRA 3W5IA 1YRQA 2XCRB 3O21A 1IBLB 1WUHS 2BSAA 3DEYX 2H2FA 1D6MA 2KSOA 2C84A 3RVLA 4IIJF 2NXCA 4KN8A 3TUZC 1UDRA 4PR3A 3VKGA 1UDAA 4CKBA 4RQUA 3ZWWA 2D0OB 4QBGB 1DX9A 3R8CA 3OAAD 3GQBA 2Z8YM 1P0IA 4ANFA 2IDMA 3FFWA 3ILVA 2DTEA 3U16A 3BCUA 2D7DA 1PN3A 2ECPA 5BW8A 2H2GA 1O94A 5HIKA 1C1XB 3B1XA 2Q1YA 5A4FS 1FO4A 4EDFA 5A9SB 4YP3A 2FR8A 1CU1A 3EDMA 4ALIA 3QSGA 4Q1DA 2EANA 2ZVQX 4AP5A 5JASA 1J7KA 2WLSA 1CVIA 4DRXB 4BRSA 4IW3B 3BTVA 3ZDFA 1WUJS 3CLVA 3OM9A 4FC7A 4C06A 4C05A 3AI7A 4Q4DA 3O6VA 1Q7RA 1JXEA 3LMKA 2BC9A 2O5VA 4UCFA 5K3AA 3T06B 5HJEA 4A27A 5JJCA 1AS3A 4KQCA 2ZBFA 4JGBA 1HYQA 1WUIS 3KKPA 4BQRA 1TMGE 3QM1A 4N3BA 2VPXA 1H8EA 4GXQA 5MFPA 3ZQ4A 3OLZA 4A0GA 3TBHA 1ZH2A 2C4KA 4JX8A 1NXOA 1IJFA 4D57A 1KRXA 3QBVA 2UUAB 2F17A 4I9GA 2XYVA 4UDOA 3SQXA 3D1LA 3NO4A 2P5UA 4D44A 3MAGA 5I9TA 3VAYA 2OWOA 1RHUA 2C28A 2WY2D 5I4KA 4OB8A 3TIGA 1PZGA 3QUQA 3QVOA 3SX0A 1YC5A 3AR8A 4R64A 4DGSA 3OZVA 3KX2A 4L5YA 3MK31 1CEZA 3FYHA 4CQLB 4A23A 3T3IA 1A4RA 3RW9A 2ZT6A 1YRHA 1ZI8A 2GVNA 3O9MA 2FPPA 4O4JA 5I47A 4LDRA 1LV7A 1P6QA 4H59A 4Q9JA 3FMFA 2EAPA 4LVSA 3SR0A 2BF4A 1BMFD 2I7TA 4IJWA 3CT4A 7ICIA 4AKHA 2N75A 3PBKA 5KQPA 1WDKA 2BDUA 4DQRA 3LQQA 2Y0DA 2VHJA 3N0WA 2KOBA 2JGEA 2DPGA 1O6FA 3GUYA 3MT9A 3ZV6A 2D5BA 3W8NA 1L8LA 3AWDA 2HK9A 3QFCA 3FKSD 4PW0A 5CB6A 3GUVA 1TO1E 1G55A 5IIMA 1LLCA 3AHCA 3QBDA 1J0BA 2R87A 4HDNA 2HRBA 2Q4DA 2RHBA 3QOXA 1G42A 2GAIA 1UEXC 3LNTA 1QK4A 4REQA 1ZCBA 4YIKA 1S3IA 3OZSA 1QQ5A 2DBZA 4N0DA 3BD9A 2C8KA 1PJ4A 4FCCA 1AO3A 4OJOA 3JAWB 1W0JD 3HJTA 3LLVA 4ENWA 5TQ0B 2P0EA 5L1MA 3PHJA 4F86A 2NP6A 3ZE9A 4PPGA 4EA6A 3RDPA 2AYYA 2FN4A 2Q5EA 3RHSA 3QE4A 1VE5A 5DHQA 4YRRA 5LB2A 4F4HA 4TL7A 3UW1A 1FXSA 3QYFA 2K4EA 1SEVA 1VG1A 3RS7A 1NW8A 1QRDA 1YZ6A 2ZRLA 2VSNA 2ENUA 1MJGA 3BSYA 1EFLA 3CNNA 4EYQA 3I6BA 1GYRA 1BPXA 4WK6A 1YQQA 4QQKA 4M60A 3SMQA 1PWZA 1TFUA 4QWAA 4HWKA 3OZXA 1X40A 5ALPA 1VMIA 1U2PA 5AXCA 2QL5A 3VC7A 3DOOA 2PJRA 5CT5A 3PQ7A 1E2HA 1LB2B 3UG7A 1W5SA 4M1SA 5AI9A 1PHRA 5B7PA 2HHCA 2DVMA 4EMSA 4CI9A 3VVMA 3QLTA 2JHFA 5YASA 4HV4A 3RH6A 3SX2A 2WB4A 4M1MA 3G3EA 1Y1PA 1J1ZA 3VO8A 1IEXA 3ER6A 3AG6A 1NG9A 2QVBA 2XCLA 3NPAA 4J7CA 4LMPA 1VB5A 1VYUA 5SY9A 2H48A 2O2HA 2R8XA 4IFBA 3TTTA 2MMGA 3CRVA 4UQGA 4MINA 2EJBA 3RJ5A 4IIYA 1YB2A 5ARBA 4ACOA 4N0PA 1BPYA 3E53A 3KEFA 2CYAA 3KHUA 1PUXA 1NMSA 2A35A 2R8BA 1ZNZA 4MIYA 5KFIA 4AZ0B 1I2CA 1W6RA 3IURA 5DHTA 4U6SA 4RK0A 3K9BA 3V1NA 3DCYA 1JA9A 1F17A 1JKJA 1P9WA 4ZCSA 2R44A 4HX5A 2QSJA 5IEJA 1EVJA 3VZCA 5LYYA 2G1AA 2FUEA 1XJCA 3ANXA 2HOIA 2ZK7A 2GPSA 4GMGA 4MVJD 1JG7A 1C7FA 4R7TA 3GMSA 3VM6A 1P72A 1T26A 2FEXA 4RKYA 2GZMA 2CXYA 3A1SA 1E1LA 2WJYA 2BFCB 3C48A 4D74A 2QBYA 4BWMA 2XJ4A 2JCGA 1AKRA 4Q8FA 4IL6U 4Q1AA 2X2EA 5DZSA 5LC1A 2PTGA 2A0KA 1L3TA 1X9SA 5IYZB 3CC8A 5IT4A 2X19A 2QM3A 2C9BA 2NTEA 2GK7A 4BUZA 3LDUA 2NUAB 2PFPA 4CLXA 3OLVA 5H80A 1Q1EA 3IMKA 4PC7A 1T94A 2VJLA 1F0NA 3JQBA 4R8VA 5B36A 1NM5A 1SD2A 3DCNA 8ADHA 4GUAA 3FJOA 1PSDA 4FX5A 1ETUA 7ICNA 3RTEA 2OK7A 3NAGA 1SCKA 1ULUA 4RS3A 1AS0A 3L8CA 4Z4GA 3O84A 3DDOA 5CIWA 4O1HA 2P5YA 3UOAB 4XPIB 4WECA 1R9MA 3KV3O 2C9MA 5KWIA 4A1FA 3O8QA 1JXMA 4K4IA 3W2TA 1PJZA 1F2TB 4KR9A 3OCXA 4HNHA 4F38A 4N3GA 4NLLA 1UJ5A 1KS2A 3GV8B 5LMUB 1DRGA 2WG1A 4K8RB 4RK4A 4GQBA 2A1JA 4D41A 3GGCA 2G88A 5JD6A 3KUUA 1SCUA 5IAEA 1XDGA 3C3MA 1DGJA 2BEVB 4ZT7A 2JJYA 3LA8A 1TV9A 2QYOA 3X1XA 3WKAA 4V2UA 3A32A 1T5OA 4G5SA 4XOIA 9ICNA 2XVMA 5H59A 4CF7A 1W36D 4JELA 3CZRA 4HRAA 4M1WA 2PU5A 2SKDA 2HLNA 4MUIA 3PR1A 4Z7NB 1CSEE 5CDSA 4MH0R 3GUZA 3RVOA 2WVJA 4LZZA 5DHSA 1S2OA 4GNKA 1KSPA 1QOQB 1OLOA 2ZIFA 1Z4JA 3C3PA 4LK2A 1QR6A 2QXTA 4R2KA 4IYRA 3THRA 3PDJA 2UVRA 2O3TA 5D1HA 1C7QA 1QGAA 1ZZGA 2LCFA 2HA3A 4ER7A 1N6KA 5FULA 3C5VA 3GGJA 1X86B 2CJFA 3TE6A 1KGSA 5CNMA 1HDYA 3TTVA 3M6AA 2CWWA 1MA0A 1TK0A 5HHHA 5JSFA 3OQHA 1B42A 2EQ5A 5DW3A 5KPJA 5IINA 4HLDA 1W8IA 2XWSA 3HLYA 1MPXA 3N87A 3T34A 1E2DA 3I76A 1SIWA 1Z00A 3V3TA 4LOHA 4V1CI 1KI9A 2P79A 3SI8A 5ALYA 1JYFA 2XA2A 5JH7A 3KWJA 4P0TA 4EFNA 1LLUA 4NAUA 2X0RA 3QF4B 5JNRA 1YZ3A 4C0HA 3FFTA 4GLOA 1ENZA 2JVKA 2QVCA 1NSTA 2IK8A 3M9WA 3EGEA 1H8HA 1L3VA 1X9WA 3X1KA 1Z8HA 4ZGGA 2FSUA 1ZQRA 2ZTVA 4UMDA 3IBCA 1E99A 1YQWA 3HBLA 3PO5A 1THGA 5BORA 3GEHA 4QWWA 5KWEA 1IPHA 4G25A 4XJXA 3V7LA 2BUBA 3EDQA 3L18A 1CQPA 2FSFA 5A7HA 4BIIA 1E20A 3MM4A 3LK7A 4QZDA 3Q7EA 2A3VA 1I0IA 2QQFA 1ZXLA 5J4HA 4NU8X 4XVRA 4GDFA 1EFHA 3R3VA 3C43A 1J2YA 3DPIA 3B0YA 2ZYHA 2PKWA 3L8GA 2P78A 5J2UA 1DBQA 2Q9UA 5JAHA 1REQB 4NYIR 2YN0A 4Y30A 3GDFA 1Z3EB 2A9OA 2XNSA 4JP5A 4RQ0A 4WN9B 3G2IA 3A3PA 1BGWA 3DSRA 3TTWA 1PTJC 2XYHA 1XZEA 4MB2A 1DARA