3K1ZA

Crystal structure of human haloacid dehalogenase-like hydrolase domain containing 3 (hdhd3)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
MRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Haloacid Dehalogenase-like Hydrolase Domain containing 3 (HDHD3)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
total genus 87
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.720 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3k1zA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3k1zA01
2WF5A 5ALPA 1Z4KA 1S8OA 1TJ4A 2JAUA 3DV9A 3EF1A 3NANA 4NV0A 5ALOA 3N1UA 3OCZA 3UMGA 1YDFA 5AK5A 3NASA 2C9MA 1U7OA 4YIKA 1F5SA 4DFDA 4XQ0A 2HSZA 1L7PA 1ZOLA 3ONNA 4Y2TA 3R09A 1Q91A 2JAWA 2FPUA 5ALDA 3I76A 4HYTA 3PDWA 1NF2A 2BY4A 1Z4OA 4HGPA 3WK7A 2R8XA 3L0BA 3SLRA 1ZD3A 1U7PA 4NFLA 5IS2A 3NIWA 4ZEVA 4MWOA 2VKQA 3D6JA 3QUQA 4E88A 2C4NA 2NYVA 3SHQA 1MH9A 2BDUA 2FEAA 2GO7A 3U7GA 1L6RA 2GMWA 1L7MA 2RB5A 2IOFA 2W4MA 3BWVA 3L8FA 2IYEA 5ALWA 2RAVA 2FDRA 3P96A 1QYIA 1T5TA 1FEZA 2JAOA 5ALXA 5AICA 2WHEA 5AM2A 2FUEA 1RKQA 5AW4A 3N5KA 3L7YA 3QGMA 1QQ5A 2ZOSA 2YY6A 3N8GA 5ALZA 3PCTA 3ESRA 3MMZA 3AR5A 4EELA 1Z4MA 4IFTA 5AVWA 3WGUA 5AW2A 5AI5A 1VJRA 3SMVA 4HGOA 1RMTA 5AI9A 5ALIA 1KYTA 3U13A 2YMLA 2FI1A 4CNQA 4XE5A 2YMMA 3IRUA 3WKDA 4I9GA 2B1RA 2YN4A 1ZRMA 5AW5A 2GHQA 3AR2A 4HAIA 1CQZA 3CNHA 2BDEA 1YNSA 2HEGA 2JGAA 4GIBA 2OBBA 4YGYA 3AR9A 3QLEA 2FPSA 1Q92A 3W5AA 5AIAA 3FPBA 2ZG6A 5AKGA 4ZEXA 1RRCA 1T5SA 4EENA 3I28A 3A3YA 2HDOA 4I9FA 3IB6A 2I33A 3ZU6A 4KNVA 3PGLA 2ODAA 1PW5A 3OCWA 4L6AA 4UATA 4EX6A 1RLMA 2CFTA 3UM9A 4Y2XA 4J2TA 2I6XA 2P9JA 3NUQA 2ZBDA 4L6CA 4UM5A 3U26A 4YH1A 4AP9A 2EAUA 2YMPA 5ALFA 4BX2A 3IJ5A 3QU2A 2NO5A 4AS3A 5AI4A 4UARA 2C8LA 3R9KA 3I6BA 1RMYA 3B9BA 2G08A 3HLTA 3QXGA 5ALKA 1LTQA 2FUCA 1U2SA 3QNMA 5AVTA 3AR8A 5ALEA 4OD0A 4JDPA 3L0YA 2D2VA 3OCUA 4BEVA 4Y2QA 3NAMA 2MSNA 3R4CA 5AW9A 5AW8A 1YMQA 1O08A 2QYHA 3N07A 4Y2YA 3U7FB 1Z5UA 1WPGA 2ZBEA 5AW3A 2ZBGA 5FP0A 3ZVNA 1L8OA 3QX7A 5AVRA 3L1VA 3MC1A 5AK4A 5AKJA 1TJ5A 2RARA 2HF7A 3MPOA 2NO4A 3E8MA 3SF0A 5AVYA 3VAYA 2CFSA 1N8NA 1JUDA 3UMBA 2OYCA 1ZJJA 3AR6A 4NWIA 2I34A 1Y8AA 4J03A 4G63A 3NALA 2YJ5A 5AM4A 5AW7A 5AVXA 1RQLA 2IOFK 4Y2SA 1O03A 4CF4A 4Y2PA 5ALQA 1ZD5A 2HI0A 3ZVLA 3OPXA 2HHLA 1VJ5A 5AI0A 1N9KA 3QUCA 3ZTWA 4RETA 4B6JA 1ZS9A 4QQFA 5AESA 3B8EA 1Z4LA 3WK8A 2P11A 3AR4A 1Z4PX 2WF8A 3FVVA 4YCNA 4ZEWA 4FE3A 3L8HA 2YJ6A 4BBJA 3FZQA 2IOHA 3UMCA 3U7EB 5AIBA 4HGRA 2EATA 4EEKA 2R8YA 2OM6A 3NRJA 5ALGA 5ALSA 2Q4TA 5AVQA 2FPRA 5AVSA 3WK4A 1U2TA 3WKAA 3QU9A 1YS9A 1XP5A 3W5BA 1ZRNA 5AKEA 2YJ3A 3CZ4A 3FPSA 2HOQA 2O2XA 1RLOA 1EK1A 1ZD2P 4GXTA 4C4SA 3RFUA 5AW6A 2P27A 1RKUA 2PR7A 1EK2A 2W11A 1Z5GA 4BNDA 1XPJA 3WK6A 5AI6A 2JARA 3PGVA 4AS2A 2HO4A 1TJ3A 1Z4NA 5AVVA 4FYPA 5ALNA 2QLTA 1NRWA 3ET5A 3ZW7A 2G80A 1CR6A 3L0CA 3HYCA 1RQNA 2YBDA 3DNPA 4RESA 4CE6A 5AM1A 1QH9A 5AKYA 4UAUA 5AM0A 3QU5A 2P69A 4L57A 2R8ZA 1RC8A 2W43A 2G07A 1Z4QA 5AM5A 4UM7A 3ZWKA 2EARA 2HF2A 2WF7A 3QUTA 3M9LA 2C8KA 2YMQA 2G09A 2MU1A 3A1DA 4UU1A 4F71A 1NNLA 4CF3A 5AKIA 3A1EA 4UW9A 5ALRA 3WGVA 1TE2A 3ZWDA 3BA6A 3KBBA 2FPWA 3KD3A 4KNWA 5ALHA 2YJ4A 2I54A 1S2OA 3GYGA 4UMDA 2AMYA 4UU0A 1J8DA 4Y2VA 3WKBA 1Z4IA 3TLMA 4NAVA 2B82A 4BKMA 2RBKA 3I1YA 2I7DA 4DWOA 3ESQA 3ZTYA 5ALYA 2GFHA 3OCXA 1WZCA 5AVUA 4UMEA 4JB3A 4YCMA 3DDHA 1QQ7A 4KYTA 2B30A 4O8CA 5A3QA 2WM8A 4H1WA 2CN1A 5AVZA 3QU7A 1WR8A 2GHTA 3ZVMA 2Q4RA 4UMFA 1L8LA 5ALJA 3ZX4A 1U02A 5AKKA 5ALVA 1RMQA 2AH5A 4BNDB 1IWOA 4CF5A 3EF0A 4PNHA 5ALLA 3EWIA 5AKZA 5AW1A 5JJBA 4QJBA 3ZUPA 3KDPA 5AK6A 5AKLA 5A3SA 3QU4A 5A3RA 1RLTA 4BYGA 1QQ6A 2B8JA 5AKHA 4EZEA 1YJ5A 1K1EA 2X4DA 1RKVA 2G1AA 2HCFA 2WF9A 2Q5EA 2WFAA 4UAVA 4MUMA 5AK3A 4OHFA 3AR7A 3FM9A 2C88A 4NABA 3L8GA 3E81A 4DW8A 3MN1A 3U7HB 3M1YA 3J7TA 4DCCA 3QUBA 5AKXA 1RPZA 3N28A 3SKXA 1Z4JA 3FGOA 1VFPA 2YFYA 2G06A 3L8EA 4XPZA 3W5CA 4UMVA 4BX0A 3EPRA 4YCLA 4F72A 2B1QA 2AGVA 1SWVA 3S6JA 3WK5A 5T41A 4Y2UA 1AQ6A 2B0CA 2HX1A 4Y3UA 3A1CA 4OCZA 1LVHA 5IT0A 3E84A 4KX3A 3KC2A 3OTQA 3WK9A 5AM3A 2WF6A 4KX5A 1ZD4A 4FFDA 4OFZA 2I55A 5ALUA 3WKEA 4BX3A 4EX7A 3QYPA 4Y2JA 2FPXA 5E0OA 1L7OA 2PQ0A 1YV9A 4KN8A 5AI8A 2CFRA 4C4RA 5AHXA 5AW0A 4HGNA 4BEWA 1WVIA 3ET4A 3K1ZA 4G9BA 3ZI4A 2ZBFA 2OA0A 2IA5A 3L5KA 2DQSA 4YIHA 1XVIA 3WKCA 3DAOA 4XOUA 5ALTA 3OCYA 3KZXA 3AR3A 3OCVA 3ZX5A 1T9ZA 2B8EA 2ZXEA 1L7NA 1SWWA 3U19A 3KOOA 3SD7A 2AUTA 1Z88A 1X42A 3SKYA 2R8EA 4HGQA 3L1UA 4IG4A 2G0AA 3E58A 4Y2RA 1J97A 1SU4A 1RDFA 4UASA 1TA0A 5IT4A 2O9JA 3B9RA 5ALMA 4C4TA 3F9RA 3RF6A 2PKEA 3W5DA 3ED5A
chains in the Genus database with same CATH superfamily
3PEUA 5KL1B 1IPEA 1JVSA 5ECYA 1Z4KA 4HN2A 4Q7LA 4BVLA 1OI2A 4RA9B 1P17A 4C07A 1N1GA 2OORA 2PH3A 3O2SB 3OCZA 3QE0A 3DF9A 3IAS6 4FOTA 4L4RA 5H7XA 5CA0A 1EE2A 3RIEA 1C29B 4B4OA 1ABEA 4E22A 1YQGA 4NE9A 3ZH2A 4B45A 5BW8A 2J9ZB 1EZ4A 2HZBA 3UICA 4M9SA 1MC4A 2GBFA 4FIDA 2QG6A 4DCVA 3FR7A 2V45A 1B43A 4GT1A 1PJBA 5KTNA 1Y8ZA 4KR6A 1BYUA 3GA5A 3R09A 2OCIA 1QR2A 2A3RA 4ND5A 2PUVA 5DTJA 2KYRA 1EZ1A 2MYNA 4QLBA 4MRVA 3R5XA 2Q62A 3IG5A 1D2AA 3ZWYA 2MSCB 3HVUA 4XIGS 2H4ZA 1ZK1A 3MB5A 4JT8A 4QQKA 4DWJA 5I7HA 2WM2A 3K0AB 4CFZA 2AC7A 1OIWA 3R8XA 3MG9A 2I5PO 1EUCB 1WZUA 3UVEA 2JLSA 4D9CA 1JSLA 2DF4B 1I32A 3NGXA 1Q17A 1W94A 3D5QA 2IHJA 3JQDA 4AJIA 1B8PA 2GD1O 1QZUA 2PKXA 3I61A 4E0BA 5MN5A 3ER9A 4B34A 1G20E 3EDOA 4FC7A 5TPWA 3WLPA 4ESHA 5LQKA 3AVXA 4IR1A 3U9LA 3ROFA 4NLCA 1N5IA 1W85A 3B8HA 5HIKA 4F91B 3U40A 3MMNA 3TTSA 3VPSA 3W5SA 4TYPA 1RTTA 4P0TA 4E5YA 4UB4A 3LYUA 2BJVA 4D45A 3NKVA 4CMHA 3FUXA 1Y5LA 3O83A 4MYCA 2WSMA 3RTGA 1IPFA 1JKXA 4OQ4A 4XVRA 4U7WA 1YVDA 1SIBE 1GAJA 3GO4A 2O3JA 4B2IA 4LMBA 2YZMA 3A9RA 4A91A 1JFSA 4R0MA 2FCAA 4N47A 2VH1A 2VIIA 1XDZA 4YR9A 2WHYA 1U9CA 3LKVA 1N34B 2H5XA 1QGOA 4KXYA 4NLKA 2GSWA 3C21A 2R6FA 3MCTA 4TL7A 2MSKA 1GLNA 4ERNA 3MFIA 3L4EA 3DJFA 3PDUA 3I5YA 1L7VC 5BNIA 2FMTA 4N6OA 2O0HA 4UBIA 2Q1YA 4IRKA 1A8UA 4CNQA 4ML3A 2JGDB 3BBPA 3GXOA 2HNKA 2LRHA 3VH4A 4C7JA 1M9NA 5FO1A 2G28A 2CGEA 2IY8A 2OR3A 3VNUA 4DLAA 3TRIA 4AMUA 3HJNA 3PTZA 4RQ3A 4EM6A 3HABA 1B22A 1NPYA 3R0XA 5EFOA 1Q0ZA 1PZEA 4WLOA 1G8AA 2QG9A 2MUTA 4WCDA 1CQZA 4ZDKA 2G71A 3PC8C 4TN5A 1QG2A 2SICE 4U7GA 4DS4A 3B1JA 3A1SA 1D2EA 2VUTA 4LYAA 5IEBA 1O5IA 3P1JA 5C8ZA 1AK1A 2GN2A 3WGTA 5DN6D 2H1FA 1TX4B 2E9SA 3DV2A 2ZIXA 1KEEB 2CMHA 3COSA 2FMFA 4Y9RA 3ZV4A 4IEIA 5FXMA 5MGBA 2CRXA 3CJQA 4ENTA 4R3NA 4N6GA 4N76A 3C5FA 3U3XA 1TYAE 3BJZA 5AKGA 1OMOA 3GL9A 2NO9A 3UOAB 3VZBA 1PK9A 5EJFA 4ETIA 3AHJA 2Q8QA 4KSBA 5LP6B 3MNFA 3I28A 5JZBA 5BSTA 3ZDBA 5K0ZA 1CQIB 3RB3A 2VXYA 2V7XA 3EVZA 4L22A 1X74A 1R12A 5DISB 4AMGA 3UPTA 3AFHA 2VDWB 5CYGA 1PW5A 4F9EA 1XNRB 5ADWA 5EZYA 3T52A 5A7FA 1QRSA 1H85A 1R4MB 4Y2XA 2C5GA 2EZ8A 2A14A 2D1FA 3PW7A 2QRQA 3L7DA 4ND3A 3WL5A 3NDRA 3P5BA 1KQ3A 4Z3KA 8ADHA 3B6ZA 5HUJA 1QV7A 3AUKA 4Z6KA 1LWNA 3JPWA 3KQHA 5FI5A 4B40A 3RRBA 2ECFA 3OUUA 3CUVA 4NK5A 3JQAD 3SI7A 3U7RA 3OFSA 3GLGE 3JVIA 3FGPA 4IJUA 4O59O 3KT8A 5CEHA 5M04A 3DE6X 3QW4B 1RMYA 1P4JA 4EUNA 2W0MA 1OXTA 1XD8A 4U2EA 5H0IA 5C8YF 2XRZA 3DUFA 3HCBA 4DLKA 2I9PA 1DBIA 3HMQA 2XTJA 2YOHA 1R16A 1H2FA 2W03A 2O2SA 2ZXUA 3PNCA 4I6JA 1QP4A 3GEEA 5BYAA 4P7FA 4OAQA 1MV8A 1AT1A 4L3VA 4ZOLB 1O94D 1TIPA 3FJ1A 4RTSA 5EMKA 3FPAA 2IX3A 1V45E 5KYTA 1ZAKA 4LQ4A 1NRIA 2BH9A 3I9LA 2D2VA 3MF4A 4MDEA 1Z73A 2AG5A 3TSOA 1QGYA 2YYAA 1SXPA 1CC1S 2PWBA 3WR5A 2W42A 3AIKA 3R9IA 1UEJA 1PUXA 3ETNA 3KALA 3QZUA 5EQDA 3QIAA 3OQBA 4CQMB 4H7PA 4PXSA 4RGBA 2WFLA 4Y2YA 1D09A 4O4IF 1K68A 2BPFA 1R9MA 4BMNA 4D2IA 3DT8A 2XGPA 2JH8A 2QZ4A 2DKOA 5ERXA 3UJBA 4DC9A 3Q3VA 5AQEA 1WZIA 3WNBA 1YD7A 4OQYA 1O6FA 3IDZA 4N9WA 3URMA 2QHXA 1DPFA 2GS9A 4U5XA 4EG5A 1E3MA 4OUKX 2IEAA 1O94A 4BQOA 3ROTA 3KVYA 4L73A 3AQFA 3FIJA 2FWAA 1CDDA 2JGEA 2HLDA 2IOQA 3CRXA 4H0CA 4N9QA 3X1WA 1NVFA 2ZQYA 3PIRA 4C3UA 1FIUA 4F8RA 1T8PA 1GRRA 3A70A 3RJZA 1XRJA 3DYBA 1QJ4A 2VHQA 3JARA 3OJEA 1L5RA 3TFSA 3JD3A 3AR6A 3TE7A 3U3OA 4FGUA 4ZQIA 5ERGB 4M98A 4AG5A 3S70A 4MVJG 4QJIA 3WYDA 1XZNA 5AVXA 2GPYA 2QKQA 1PYOA 4JVOA 4ES6A 1YF3A 2ZUFA 2YQEA 2XIJA 2IH2A 2QZJA 3OPXA 1MJGA 2J0SA 1XLUA 3PD7A 2ZIZA 1H8HD 3UMMA 4K9NA 2Y2VA 5F7JA 1E8DA 1BX1A 1E9DA 3G82C 5DSXA 5AESA 4F5NA 1BE6A 4IIJA 2KPOA 1LDBA 1M8KA 3H2JA 5BUZA 5J0SA 1CETA 8AT1A 2CXOA 2ZVDA 3DR3A 1PKEA 1UPUA 1RHRA 2ODWA 1U8CB 3H99A 1G1AA 3TRDA 1S2IA 2IC5A 3LP5A 4TM8A 3NM5A 5KNCD 3PRHA 5E9AA 5FFFA 5G0VA 3B2NA 1OJ7A 1Q15A 1UJ4A 4WKCA 1XXLA 2VVTA 2XQVA 3FVRA 3OX3A 4N0MA 1UANA 2XY6A 3FZQA 4QDZA 2IOHA 4B85A 4DB2A 4GF5A 3U80A 3ZV7A 4AY4A 3H2YA 2XB6A 3COVA 5JSUA 3FSJX 5LZ9A 3MTIA 4FC6A 1JSXA 1QIGA 2FMIA 4G67A 2BH2A 2VJ4A 1KH3A 2OM6A 2PH5A 2YH2A 1KC1A 2WB1F 4LZZA 3PDHA 4G07A 2NRWA 3AG5A 3VH1A 2BVNA 1VHLA 2Q4TA 3GZFA 5DYYA 5CM8B 5HKLA 4GH5A 3P7MA 1GSHA 1KP9A 5F9MA 4UDXX 3NWOA 5B2FA 5L7YA 5ARBA 1JHZA 3U7QB 1SRQA 1DGQA 3M4YA 3PLRA 1Q19A 4QTXA 2KBEA 2NO0A 3SEZA 3W9YA 4W6ZA 1FW6A 1TUEA 1V39A 1Y63A 5TXGA 3SENA 4Z0PA 2A30A 1ZD2P 4TUQA 1XSPA 2FSVA 1NW9B 1ZN2A 3WBBA 3L7KA 2C1XA 1TPYA 5EPOA 1M76A 4G36A 4P2BA 5KVCA 3OLWA 1PNQA 3TOVA 1R8QA 3E5MA 2NUAA 3DFKA 4I46A 3I1IA 2BEVB 3AHEA 1WRBA 3C1OA 4KFSA 4URFA 3WG9A 2A0YA 3K5HA 4OK3A 5FTJA 4WOBA 4YRLA 2IVFA 1BDMA 5B1IA 1RHKA 4FYPA 3GEIA 3VU8A 4F96A 5JS6A 1LBEA 3D2SA 5EINA 3DZIA 5A7GA 2P2ZA 3OT5A 3L05A 1P9NA 3Q7PA 4KJXA 3O8LA 1TCAA 1SXDA 1JFRA 2PX5A 5CDTA 3GP8A 1CRLA 1IDN1 1WABA 5FYDA 3GN2A 3Q6IA 2PKWA 3L0CA 3KXDA 5EWMB 4ARIA 3LV8A 3PC4A 5KSWB 3PK0A 4O8ZA 3O93A 1DWUA 4ELTA 1GZDA 3E3AA 4D9GA 3WP1B 3T1TA 3O7WA 3RREA 1CQWA 1CRWG 5F7OA 5IKXA 1CQPA 5IJ9B 2O2ZA 2C4TA 4RMGA 4MP8A 1DV1A 2LPEA 3K4GA 4BUZA 3IPLA 4DMMA 3REQB 4QXMA 4DQRA 1NJ6A 4R3UC 1BQEA 3QJGA 1NF9A 1YQTA 3LPCA 1E0KA 3KKAA 4HN9A 3FPKA 3ADPA 2EARA 1J9EA 1EGMB 1M6WA 4C0JA 1H0RA 2C8KA 3JQFC 4NVRA 3SYKA 4WGGA 1PR2A 3R7WB 4YDHB 4ZVNA 1DEKA 4EPXA 4X95A 2Z08A 5HKKA 2WSYB 3B70A 2JKVA 2ZZKA 2OBXA 4QYSA 2B1IA 1MTZA 2DQZA 4Y2HA 4HN4B 2W37A 3WY9A 3H5WA 1ZCAA 3QJ5A 4REQA 1LK0A 1ST2A 2AMYA 3TKLA 1XB2A 4C01A 4FUQA 1C30B 2WV9A 3OLZA 2R3SA 3CM0A 4HC4A 1HG0A 3UH0A 4N7RA 5IP5A 3O5AA 3D5TA 4DSFA 4LJ9A 1T9KA 4MIEA 3ZNOA 2CDCA 1KDRA 2CFCA 1TEXA 5DGDA 4IY1A 1ECPA 2GFHA 3WBFA 3PQDA 1D5WA 2KS6A 3ZIAD 4UMEA 3PIIA 2OXTA 1U4SA 1LJUA 3EHEA 3HXLA 3O2QB 1Q1AA 2QU7A 1SBNE 1SA0B 2XVXA 3GJ6A 1NYQA 3GRVA 3KJZA 5CUQA 4XRRA 2FZGA 3LWDA 1K7EB 5HKKD 1CEXA 3PJDA 4EYOA 4H6PA 3C24A 1QIHA 1J2TA 3VC2A 4CLDA 3FA2A 3DC2A 4LY0A 4GOLD 4CHGA 2ZJOA 2VF2A 3FI9A 4MJLA 4F4HA 2XUDA 3DHYA 2GD0A 3C41J 3ZD6A 3AEKB 1BD4A 2VZEA 3G8YA 3KXKA 4TXHA 3VQTA 4XW2A 2RQ5A 4N0PA 1CS0A 2QI9C 2IK8A 1SCUB 1IRIA 3GR6A 2ZB4A 5FR1A 8ICZA 1IWOA 4CF5A 1JIKA 1N3YA 2ZKLA 4PR0A 3OOYA 4BMZA 5K3DA 3EWIA 4IH1A 1Z2NX 2IKSA 3KSAC 5CFQA 2GRJA 2MYPA 1XEWY 3SDBA 1TZKA 4WCFB 3SM3A 2D2IA 3C48A 2Z2ZA 2ZTMA 3T3NA 1S6YA 1P5JA 2OFFA 1JG6A 1ZMRA 1LDYA 3OOWA 4NJEB 4GBED 4LHWA 4WNIA 3UAOA 4KQEA 2NXWA 2XUQA 1AGXA 3VPFA 2KHZA 1YK0A 3PPYA 4RX1A 3PMNA 3ZDCA 4QAJA 4QEZA 2J32A 3DQZA 3QF4B 4LXUA 4ZOBA 4IQVA 1EIWA 3I9V1 4H1UA 4OBWA 2R11A 1Z12A 2F6RA 4K6HA 1J4AA 2RH4A 4WZZA 3MR2A 2F3QA 1A04A 5AK3A 1ODFA 3AR7A 3A3KA 5FBWB 4MRSA 4JI1B 5BO5A 2CHQA 1JFVA 2CDAA 1ADFA 4HV4A 2WUWE 5KU7A 4J7CA 3JCZA 3PC3A 3NEPX 3PDIA 1PK1A 4BMSA 2N42A 1XVTA 3NHMA 5HXAA 2EP7A 2JAXA 1PE0A 4AW9A 2VEDA 1REQB 4IXNA 3ZHVA 1TADA 1PO7A 5C7OO 1GKLA 4DDVA 2G88A 2YWEA 3IUQA 2FPKA 4TWRA 3RS0A 4MWSA 4KQCA 4QWDA 2C5EA 3UA3A 3ZC3A 2I6FA 4PRKA 4FZRA 3ZVLA 3CYFA 3I6MA 3PVSA 1W85B 4DRXA 2JLWA 3L8CA 3FTQA 3WIVA 5HNKA 2XY7A 2BFFB 1E2MA 3DG9A 1JBQA 3A0UA 2Q3MA 3MSXA 1AQUA 1PEDA 1T29A 4LCJA 1GXSA 4QC2A 5CM9C 3DFZA 3IVAA 4AG3A 3OM9A 4H1TA 2H7VA 4OCZA 1FDTA 3Q11A 4Y3UA 1H38A 2QY9A 4XTRA 5J2BA 3GWZA 1GO3F 5C3UA 4AP6A 4J43A 5ILGA 4YMMA 4NLGA 3COWA 4K9QA 1ZQRA 4L1KA 5KJFA 1HC7A 1PEKE 1UBFA 3NEYA 4FILA 2V0NA 2NPFA 4M1SA 2WZQA 2P2GA 4YJDA 3STXA 4ALLA 4UOEA 4HWOA 2EKBA 4QIWC 4C4RA 3CMMA 2C0PA 3SZUA 3T1YB 2QPLA 3N59A 2EIHA 4HQLA 1QIDA 4PZYA 4G9BA 3RR7A 1QRRA 2A59A 2H9AA 1M6HA 1BPEA 1YJXA 3LPAA 2OA0A 2F44A 2BEWA 2Q8PA 3PLNA 3JWIA 4JHXA 2XA2A 1C3EA 1E5VA 2GTHA 2XYRA 3RB6A 4LJ5A 3L6RA 4JKIA 4I2NA 4LQLA 4TVBA 5C1IA 5TX7A 4D8UA 1HTBA 1T6XA 4DCSA 4MPJA 3QXJA 3RC2A 3S1AA 4GI7A 3HDTA 3K0BA 3R8CA 3E9YA 1UBEA 3BD8A 4XDHA 3GV8B 1BJKA 4AIRA 1N6HA 1KOJA 5D49A 1YRLA 4I08A 2PBRA 2WM3A 3QPAA 1UF9A 1XE3A 3LPMA 3BC1A 3HEAA 3SEIA 1IHYA 1X8KA 3AEYA 1D03A 2R4UA 4RVDA 4LI3X 3JZIA 1Y34E 1LDNA 1Z88A 5KYNA 2C9CA 4GNKA 3FYHA 3KKLA 1N3LA 3AU8A 5KFPA 4IG4A 4RV4A 4N49A 3TVYA 4XVQA 2VAPA 4PG7A 4EHBA 4INZA 3H11A 3G7UA 2J59A 2YR0A 3HU1A 9ATCA 1RXVA 3SV4A 1RDFA 3O31A 4R1OA 1XCGB 4G84A 3DA8A 3KB1A 1UCVA 5C7LO 3W6ZA 2EQYA 3G1WA 2XCQA 4U2GA 1YE5A 2J7PD 2RHLA 3HR7A 3P9NA 4UUMA 5CLQA 1W25A 2CVFA 4GKAA 4W1SA 4KR2A 3AF0A 4NV0A 1GDDA 3ZJTA 1NJXA 1R4NA 2EBHX 3WDKA 5F4ZA 3CU5A 1OHHA 1SIWA 2GVZC 2UDPA 4I4LA 3VGJA 3F5AA 3V48A 1XR3A 2ZT5A 3AUFA 3WAKA 4CL3A 1O0BA 3GFQA 5BSFA 2M9NA 1AOXA 1Z8HA 2HSZA 2JLBA 4UQLA 1N3IA 5E4JA 2CV0A 1JIVA 3AQEA 2ZDHA 1GOTA 3C87A 2CNKA 2G76A 3QBTA 4KLGA 3FPJA 2GN9A 4FOSA 3T5JA 1EX9A 2BM0A 3JQFA 4JBLA 3I76A 2FN8A 4QUEA 4HLUA 4DY4A 3C1ZA 3G9TA 1TK9A 3I6ZA 3D0OA 4WKBA 3A1WA 5SYAA 4UHDA 3EA4A 4F93B 2QN2A 3DULA 3EVBA 1VL1A 2LNDA 4ZZ0A 3WK7A 4OHKA 1C4WA 5IAOA 1ZR4A 2HT1A 3EZLA 3EGEA 4JUFA 1ZJ6A 3VR5D 4TTIA 2UVVA 1XTIA 1FY2A 2EGUA 2PL3A 4EVSA 1EK6A 3PG5A 5IS2A 2P5UA 2IJGX 3AW8A 4PPXA 1P1KA 1KVRA 3FETA 5BT9A 1AD2A 2V6JA 3HJGA 3PE4A 4L5JA 1DTSA 3F5MA 3TAXA 5EJ9A 1JDSA 5GJVC 3UT5A 1T8TA 4R31A 5JSHA 2NYVA 7ICQA 1GL3A 1EP9A 2WJGA 3NJ8A 4WGFA 1DKMA 1PFVA 3ITEA 4MR9B 3SHQA 2IIVA 3GARA 4ZCMA 2C2HA 2CF5A 4XQGA 1RYFA 1XIVA 2C31A 2WIBA 2HMYB 1XV5A 2L18A 3BL6A 3AVPA 3NYRA 1NY5A 3W06A 3D59A 4JI7B 4NICA 1FYFA 4ESVA 1T26A 1ACLA 4U7FA 2QD5A 3GHYA 5IWAB 2DYKA 1HJPA 1MGPA 5HR5A 2ONJA 3PA6A 2OD9A 2ZQZA 4ICAA 3E2EA 1WUYA 3W5JA 4TYNA 5A4DA 5K0NA 2HHHB 1XZJA 3GA0A 1CZUA 2BCEA 2ZI3A 1RVV1 3D31A 3ZDQA 2FMPA 3RC9A 3R7AA 2YXDA 3EISA 1PSZA 3DE1X 1L3IA 3ODGA 2CUKA 4Q37A 3IEXA 4XWOA 4C89A 3JSXA 3WSTA 1TVKA 5FLEX 2ZP1A 2Q9BA 2WJWA 1UMDB 1WW2A 5AI5A 1VCOA 4O25A 5LDGA 4C21A 2X0KA 1GVHA 3BXPA 4DR4B 1U04A 3DM5A 4MVJP 5JNRA 8ICCA 5BT8A 4B5LA 5B6IA 3GZ4A 2NU6B 1KEKA 3VNQA 1UMBB 1BCSB 1N6KA 5CBPB 2NP6A 5L53A 4LXGA 3K1RB 1AN9A 4IICA 3DT6A 1ADJA 1W6RA 1DHTA 4KZKA 4TZTA 1G7SA 1XRMA 2CMDA 2J7KA 1WOMA 1BXGA 3MWDB 4DO9A 2JFZA 4PRLA 1KE2A 4I2EA 2W2MA 2R84A 4O2RA 3WLRA 3IXMA 3O1JC 2UVPA 1I1OA 1R37A 1SCAA 2FP4A 1F51E 3EAFA 4O1IA 2ZVPX 1JKJA 5DO9A 3E27A 3GWGA 1RQ2A 1E77A 5I8ZA 4YBZA 2GEFA 4J3FA 2DWQA 4EYQA 1U1EA 4G0VA 1V5GA 4NULA 1SB8A 4FFNA 3D6VA 2QZ9A 5AP9A 1VE9A 4BCDA 1IOLA 3LRXA 4AKHA 5BV2P 4MA0A 2WKQA 2ZSDA 3UEOA 2NNLD 2COKA 4ZEXA 2BLNA 5A1TA 1KY2A 5EHXA 4C0LA 1RRCA 2QYTA 3QX3A 4O9MA 4CTNA 1ZKDA 4D79A 5KJ1A 3THXB 5H8WA 5DB6A 3IV9A 5ETJA 4M60A 4W5NA 3GQBB 4QDUA 4MI1A 4LHYA 2JJ8A 1DRWA 6REQA 4PAGA 4H60A 3IIMA 2CE7A 4QM7A 1VL8A 4KQWA 4CKWA 1IM2A 4YQFA 4YXMA 3TNDA 4NF2A 3CNOA 3W7BA 3LO8A 3M3PA 1C9DB 3ECAA 1BX0A 2ZUSA 4PTZA 2Y0PA 2HXYA 4IHKA 4RHTA 5DSTA 1P9OA 1JVNA 1ZGBA 1JLMA 3HACA 1DKOA 5FAXA 1YVUA 4HDNB 1B23P 2GAAA 4EH1A 4F06A 4KQXA 4YRCA 3C3JA 3JATB 3E1KA 2G4LA 3ORSA 4ZOEA 3Q88A 4DIMA 5C32A 1CUDA 1U4NA 1YFJA 4EUFA 4ABTA 2ZIWA 2J45A 3HYLA 5REQA 2JATA 5JBQA 2F59A 4OHCA 3H0MB 1UXOA 3N2IA 1O9BA 7REQA 5BNFA 1X9WA 2E5FA 2FPPB 5J4KA 3QYJA 4PFSA 2PZKA 4MV6A 4P3PA 5A71A 1NBOA 3DGFC 2ASDA 2RG7A 3FMGA 3D43A 2OYSA 3GAFA 4TUYB 2BSXA 2MJLA 3GLIA 1YFZA 2REQA 1RQXA 4IR7A 1N2CE 3NQ41 2MSNA 4U4AA 4XX0A 5AXAA 4KOAA 2VSQA 3H1TA 2D5LA 4MXDA 5AW8A 2ATVA 4MUKA 4Y6OA 1GTL1 4F85A 1LBQA 2POQX 4ER7A 1E3JA 1L4LA 3GFKB 1LK5A 2QG4A 2AK2A 3DOOA 3KQQA 3NS1A 1H8EA 5JLAA 1QUFA 2OXCA 3H8VA 3KHUA 5LM3A 4TZ0A 5CH3A 1FNCA 1PLKA 2PGNA 3L84A 3CPSA 3KJXA 4C4AA 4CQJA 1T4CB 4RSRA 4EARA 1MG5A 4MR9A 1M34A 4NCBA 3DZCA 5E9QA 1CERA 3ADDA 1RI3A 1E63A 4MW0A 1YI8A 1S9FA 1JNYA 3MWDA 5KFJA 4WFKA 1Z45A 3FCAA 3D2AA 1AG9A 3KQSA 4X71A 3OTGA 4M1YA 1A1VA 4YMOA 1X94A 1OUMA 1U7TA 1U8FO 2XDAA 3LWBA 5DDYA 9ICUA 3H11B 2QOEA 3ZV3A 3IYLW 4AUMA 4RQ7A 3A6ZA 3QVMA 2GAIA 3RAQA 6Q21A 2KW5A 1JUDA 1Z6ZA 4P7GA 3RVDA 3WQBA 2DPXA 1HZZC 2X8AA 5LB2A 2KJQA 1H0HA 3KOZA 5K4LA 4Y67A 4DN6A 4HEA1 1K8XB 2OB2A 5DRTA 4CTOA 2ES4A 1ODKA 4JIGA 5ELMA 3ADCA 1NKSA 3CLKA 5IW8A 4WERA 2EDAA 3DMTC 3N58A 3E7WA 1N6NA 1C5KA 1E3TA 1JXOA 1NT4A 2JJ1A 2Z5LA 1VQ1A 3V7NA 4C8OA 1TTQB 2OZKA 3OFND 3PNOA 4LZJA 3O0FA 3SFZA 3LZ6A 4RETA 1VYTA 1C7RA 1HEKA 4DMRA 4DSLA 3T5AA 1S2MA 1T4BA 2KQUA 4ZCIA 4GXKA 3P0EA 4JLMA 2PZBA 2JI7A 5JI2E 2ZE5A 4EOGA 1WUDA 4P4PA 5J0OA 1TCUA 4ZV7A 2GUWA 4YJFB 4ANFA 3AHDA 4X1IA 1LDGA 3LFUA 1JE1A 2H00A 3WIOA 3FVVA 4EHDA 4O5KA 2JJYA 1THMA 2ZS7A 3BTVA 2E5LB 3ETRA 4LSMA 4TM7A 1XEXA 4DC0A 4RY2A 5SY9A 1VKZA 4KXLA 1MX1A 1GN8A 1DX6A 3ZY2A 1YR6A 1QGUB 3AJDA 5EHGA 3PPWA 5KPJA 1RADA 2CKDA 5EWJA 3O38A 4EEKA 2JJ1D 1HURA 4YCJA 1E2DA 4MICA 1P5HA 3VV2A 1NATA 3DFUA 3MQ2A 1XAJA 4RKQA 3URKA 4O08A 3ZHXA 2I3BA 1H42A 3IT0A 1HO3A 2OSVA 3EXHB 3BSFA 1M1YE 2DHEA 3VC1A 4EYSA 1ZHFA 3I12A 3QU9A 3LQFA 3MOIA 4N5LA 1FRNA 5AD1A 4N41A 5F9LA 1N2OA 2CL7X 2PCLA 2PEZA 3MFHA 2YJ3A 4JBWA 1NKTA 2VYFA 2HOQA 2GT1A 1OPRA 3VR4H 1SHLA 4O2AB 4C4OA 5JZSA 1HFEL 2I6TA 1U0LA 3VMMA 1BMQA 1N2BA 1ZKMA 4B3GA 4BDSA 3NRWA 3M6IA 2HIGA 1G42A 4OA8A 1QDUA 3HDQA 1U65A 5EWLB 1JHDA 1SVSA 1XPJA 4M1EA 2NRTA 4YG2A 1EVIA 2EC5A 1FB5A 1LRKA 5EMJA 3UJ9A 3K0FB 3O8NA 1BIFA 1LC0A 3IBFA 4Z54A 1QZZA 2V7GA 2AFIB 2XTMA 4UXHA 3PSIA 4M6WA 2QROA 3I2JA 4Y6QA 4HH0A 1ZI9A 1HDZA 1C1DB 2AJ8A 1E2PA 1FU7A 1Q7GA 2V5VA 3Q8PB 3G88A 3QK7A 4E07A 4F4KA 4IJVA 3RPEA 4E5PA 1M2WA 3OE4A 1MJNA 4EB0A 1ID8A 3RJKA 1EFCA 3FTCA 3QUSA 2ZJFA 4OLFA 3TW8A 3T4EA 4PC1A 2JVIA 5IAKA 3HQ4O 4PTLA 4WBXC 3N8IA 2X3UA 2XMGA 1YWGO 2Z4TA 2AW3A 3KLPX 4ASUD 4US2R 5BN3A 5CNMA 4P32A 4M7OA 2QTLA 4ZYYA 1M0SA 2ZITA 3PWKA 5EP1A 1K5OA 2VQ3A 3G0OA 4PIMA 8GPBA 4MH0R 3LECA 2JAQA 2OCEA 1V1RA 3NHRA 5GTDA 5HIAA 4MEBA 1SO8A 2QJTA 4ZQCB 3SN6A 1NBWB 2W6PA 4QUAA 3IPAA 1WVMA 3DP7A 3MSCA 1H1LB 2BRUA 1Z34A 3QPVA 2XI9A 1LLQA 1R10A 3UB3A 3PPXA 1C3OA 4K05A 5HRUA 3D2QA 4NK4A 1OGJA 3DXZA 4Y0NA 4BNFA 5AJWA 5BRJA 1V38A 1EFRD 4YCAA 2WZDA 3AMVA 3GDFA 4KNWA 4CVNA 3I1JA 4D0GA 7MDHA 2NV6A 1Z62A 2YJ4A 2A33A 3BRSA 3RS9A 1WSDA 1I2BA 2W54A 2BDTA 4ECZA 1T2VA 1CKEA 1ZCBA 3FFTA 3GFFA 3IAM1 5HGJA 3TEFA 3CRZA 5A62A 2FLKA 1EHCA 1Z4IA 3TLMA 1J0EA 4D56A 4EW1A 3QWHA 4FTWA 4WCFA 1RWOA 4A15A 5KT2A 2RI1A 4FEGA 9ICXA 4UHKA 1GXSB 3M7DA 3WHIA 2DPYA 8ICBA 2XE6A 5C1DA 5DX1A 3VZDA 1HFKA 4X54A 5KI6A 5DNCA 1U94A 2WB2A 2JKYA 2QLFA 2EF0A 4LDPA 5KQLA 3RGWS 4CEHA 5K1ZA 4HWPA 1HY3A 3FYCA 4BKUA 4FINA 4K2AA 4MWGA 4YO7A 3UTCA 3ZD9A 3FZGA 1U9IC 3IP1A 2OESA 3TLJA 3AEUA 2FPMA 5A9RA 2BCJQ 1RJWA 1SCKA 2IYOA 2PVCA 2DF8A 4FYVA 2Q4RA 3X2SA 3ISCA 3MCZA 4B5KA 5ES4B 3HKBB 1IVYA 4QJFB 2GA9A 1N75A 1TJPB 2R44A 1XRQA 2AXQA 3E48A 4FIZA 1LDEA 4FYXA 1HNNA 4NPHA 1WQ3A 3AM1A 3EIQA 4ILKA 1SHJA 5BR4A 5A4MS 1R3UA 5CW2A 4BVKA 2JFWA 1KPHA 1AN0A 3KPUA 2QU8A 3FFWA 1GCAA 2Z1MA 3E82A 5KDLA 3TL3A 3W9BA 1YS4A 4C0HA 4BNTA 4COOA 5JSFA 5F21A 4YJ3B 2G5GX 2PKQO 3WQQA 3MVEA 2ASLA 5DN6A 2HOFA 1YQQA 3KDPA 3RVLA 1LD3A 1G3QA 1KZ7B 2NSJA 8ICNA 3AFNA 5A3SA 2V96A 5JAZA 4NHOA 4FS3A 3W4KA 1F3OA 3RC7A 2H31A 3KAJA 3EG9A 3KPVA 4XA8A 3IHQB 3TLYA 4EZEA 3ZD8A 4OLJA 3EZ5A 3QRWA 4QFBA 4GFDA 4QU8A 3VVCA 1X9SA 1ZH8A 3B78A 1Q83A 1VJ1A 2RHFA 2VT6A 4FMDF 3DCYA 4G0YA 3VYUB 3K2EA 3CEMA 5FULA 1M2JA 3WYEA 1NJ5A 1OLSB 5KG0A 5IMBA 3N7AA 3T34A 3ZKWB 1PK8A 1U48A 1QTQA 3FYUB 3ZU2A 1VL6A 1KDPA 4Y8VA 4KMRA 1N1DA 3RW9A 2X22A 3BK1A 3M1YA 2ZBUA 2ZROA 4XLTA 5C81A 4AP5A 1ZNZA 2JGRA 4RKRA 1N2JA 2HKIA 4KGXA 3FPCA 1JB1A 5CLIA 5CAEB 3U7JA 2OZLB 4UE3S 3JQAA 3C39A 2DH5A 2IXFA 4C88A 2FN7A 4WEOA 1KI8A 5AJVB 5THKA 2CSXA 2O8BB 1XZIA 5COQA 1U0FA 4OHOA 5DQGA 3WTBA 4BL5A 3FF1A 4JK1A 3CPHA 3B20A 4TTRA 1R5NA 4UBKA 3ZCVA 3M9NB 2R65A 1HORA 1L1RA 5A05A 2YVUA 1VI6A 4I5IA 4EA7A 1E5TA 1GR0A 1BU8A 2CXHA 2ORWA 5FYQA 3HB5X 4GYWA 3CNQS 1ZXIA 2ONCA 2F1KA 4KLNA 2DFPA 1DIOB 3NJRA 3WFIA 2JRZA 3NOQA 2C1ZA 4ON9A 4TSFA 2BEVA 2L17A 3JXEA 5ECDA 1FP7A 2RB4A 2ZSJA 3BJIC 1SD2A 5AI8A 1CHDA 1C8KA 4TT3D 2LD4A 5DJ5A 3FUUA 3T94A 1UPAA 1QHIA 2OFXA 3G9ZA 4HGNA 1FRFS 5IDVA 5HM6A 3ZI4A 1I6LA 1RZVA 3E1SA 4GMHA 4XUEA 5ULLA 1N6PA 4HNTA 1V1JA 3VNAA 3WO0A 3F2VA 1XD2A 3WLMA 1Z6XA 2NU7A 1WEKA 1UDBA 2ATLA 4IP0A 3T99A 2HHJA 2JD2A 4H35A 4CLXA 1QKKA 3PW5A 2P2SA 1IRXA 4RSMA 4EB8A 2B35A 4J9RA 1O0CA 3MTBA 1LBHA 1JIJA 1K97A 2M6SA 1P45A 5HZGA 1AKRA 3L6BA 1IK6A 4US9A 3MMXA 3PA8A 4ED6A 4P84A 1XYVA 4FQ7A 5E2IA 4ARAA 5JBNA 2XADA 7ICNA 8ICKA 3THWA 2OP1A 2P66A 2Q2OA 3DKPA 3ZYZA 1JHYA 3F98A 1K63A 4P4SB 5L7WA 1I1NA 3U19A 3HXMA 3SD7A 2H5JA 2AUTA 4K0KB 2NVBA 3A7DA 3AK4A 4TT3A 2RKBA 3SKYA 3DYIA 2R8EA 4KIFA 3WI7A 4AWXA 5CH8A 1Y3FE 2OXFA 3P9CA 2A0FA 4LDZA 1BS1A 1XCMA 2CVOA 1UPBA 3MWEB 3SNHA 5DGBA 4I28A 1DRJA 2OHOA 3OKAA 5F1OA 1QTNA 1V2GA 3OH8A 3Q6NA 3CX4A 2EZ9A 2IDZA 4KE6A 4M1MA 4OHZA 9MHTA 2P77A 2Y93A 2KFNA 1YQUA 4X8MA 3OMWA 3BHMA 3QMVA 4YP0A 5DI9A 3LGXA 4ZTBA 4AM8A 5F23A 2HUPA 1YVPA 5K0SA 5J2GA 1PG2A 3UMGA 5J63A 1BROA 3BKXA 3RK4A 1IHPA 1IFXA 2VZ0A 5EJMA 2BKXA 1PS8A 3QVLA 4JVLA 4YRRA 1IXZA 2E8MA 3LQ4A 1KR5A 4Y6LA 4CF6A 4F6RA 5MHTA 4MVJD 4MP6A 3M6UA 4B43A 2KE7A 4E4YA 1NKBA 1GTZA 5D87A 1D6JA 2J3KA 1TCBA 3P19A 1ZQQA 1U0EA 2FHPA 2I4LA 2Y6VA 3QUAA 5AJXA 1Z15A 2H5IA 1UKAA 3HJAA 1MB2A 3CPJB 3HWWA 2KWIA 4QWWA 4Z7JA 3FNHA 4YS6A 1T9GR 4II7A 4AJ9A 5CIYA 1QUEA 2LDBA 4DV6B 1OD6A 5B1DA 2A1JA 4YEDA 1IUKA 4QZBA 5HF9A 1KJQA 1G21A 3E9QA 4RGVA 3DWGA 1WVGA 1MFPA 2Z3VA 1NE2A 2XH8A 1D4ZA 2XMCA 3BB1A 1ISIA 2P6OA 4LE0A 3ULKA 3V2GA 4I2GA 3F71A 1JHOA 1T0IA 1QSYA 2BDUA 2QTWB 3KJGA 3CX3A 4MGKR 3WB0A 2HVHA 3PQ3A 2FN3A 2E82A 5JFTA 4CEJA 3TTXA 1L7MA 1D1SA 1VBNA 5KFRA 2DHDA 5DBOA 2RB5A 2CC2A 3E0FA 2VH2A 1R7RA 5B66U 4X9XA 5KKNB 1GTSA 4FGLA 1DAHA 2QVZX 2PLNA 1Z8FA 3QV1A 1Z0FA 1TK8A 2VJCA 3CEJA 1GYQA 5JO9A 1U4OA 1PFKA 4I1PA 1PWXA 3S2YA 1JIHA 2YWJA 4HHEA 2D0OB 2QVLA 5EHIA 3V8MA 4BLOA 1IBKB 2OEHA 1QNLA 1KGDA 3ABSB 3AEZA 2QN7A 2XRYA 3O21A 3U4AA 2E49A 4IJWA 4QPCA 3K5IA 4RLHA 4RS3A 2ZIUA 2NSYA 4IV0A 5HS6A 3RAEC 1C9JA 3VPAA 1SKYE 2CVQA 1CPYA 1ZGZA 3MMZA 2GRUA 4NL4H 4D0SA 4QDOA 2D13A 4IFTA 5CX4A 2MIIA 4IDBA 3PMLA 3T38A 4V24A 4YWHA 1Z22A 2BKLA 2Q1UA 4AUEA 4D8VA 1FVHA 3ZDRA 2MA1A 1X7ZA 5ALIA 1ZQHA 4ZQBA 4RANA 2FMUA 2P0YA 3HB4X 1FMTA 3UN1A 1MEEA 2K4EA 2ZB3A 4KPUA 4II2A 1UM9B 4F7WA 2H63A 2YYYA 3KQWA 4U9UA 4DQQA 5JISA 2BKVA 3UXYA 3WMGA 3UXMA 2PS0A 2JI4A 2B1RA 1MA0A 3KJNA 3M70A 2Q3JA 3WGKA 3ZGVA 4C8MA 3DBIA 2VO1A 4UAGA 2BBWA 1SVMA 2GXQA 4UFNA 2H17A 3IM1A 1IH8A 5L95A 1ZBQA 2B37A 2OCDA 3DBOB 3T9AA 1QJCA 2X1VA 3DEHA 4IUCS 2JCGA 1HE3A 3P9ZA 1Z0JA 2VDWA 4WJKB 4F56A 4GEKA 4POOA 4BWFB 1FTWA 2FPSA 4GI1A 1XFDA 3KLMX 3OT4A 3T7AA 5LIPA 2PMDA 1C0LA 2WQ7A 1ONPA 4LVUA 4BBZA 4AQDA 1XCOA 1ZK4A 3C3DA 3IAS1 5CJ7A 4CMEA 4EENA 1COKA 4GSKA 3ENZA 3ETEA 3OU7A 3HM2A 5GOZA 3A3YA 4NARA 1CNEA 1CYDA 1RJEA 3VV3A 4HQNA 4ZRMA 4E1VA 1RP7A 2WDZA 5DB9A 1CQJB 1T0BA 1F0PA 2G04A 3JTEA 1VHWA 3GVCA 3MJHA 5KNBA 4UATA 1WQ4A 4IEEA 4QFCA 4KFUA 5JSKA 3LYAA 4Q02A 2ZXIA 1K3UB 2O1SA 3D7NA 4J07A 2HA7A 1A72A 1IOVA 1QSGA 2KG5A 2G6BA 3EMBA 3IQWA 3O8OB 2W48A 3PVZA 3L7LA 3ZDAA 4GO1A 1P3Y1 1WUHS 3RE1A 3HN7A 3T7CA 5LUAA 4J9PA 1NDHA 4EG6A 5EZSA 1GTVA 3EPPA 3RYHA 1ZYUA 4ER0A 1H9BA 4EY3A 1CNFA 3ORRA 4D6PA 1I2MA 2AEEA 4H7IA 4BLTA 3PW0A 3E9NA 5A4IS 4G2NA 4F5QA 1M67A 1P4SA 3JAWB 4IDHA 3K09C 4P7BA 2R60A 4UKDA 1RXSA 3JQGA 4B6SA 1AXEA 1VKHA 2OFOA 4OO3A 4V0RA 3BQ1A 4QASA 1CDOA 3HSSA 5EC8A 4BN0A 5AVWA 1ZQWA 2PAAA 4PX9A 4D8TA 5HA5A 1C2YA 3JRWA 1BZYA 3P9YA 4UU7A 2XQFA 1JR2A 3PDJA 2I5HA 2GLTA 3IXLA 3LC1O 2AOTB 5JAHA 1NN0A 5B6PA 1QE5A 3A31A 3IR5A 3QF7A 2D8AA 2GJ9A 1BE1A 1UC5B 2IYZA 2OXEA 3DDWA 3NRCA 3FPFA 4JLJA 4BO5A 3ETHA 2QBYB 2UYGA 3PF8A 5C52B 4TL9A 2XICA 5LLDA 1HXHA 3PLAE 1FX1A 1TZJA 4RQNA 2HJWA 3BA1A 4HLNA 3SVTA 4X1YB 1YZVA 4A26A 3DTVA 2VKTA 1R8JA 2JAPA 4FI3C 3LCCA 2EWMA 4I2AA 4OX9Y 3BMNB 4DJ5X 1DIGA 4JD5A 3SJBA 4BXOB 3LUJA 3OZUA 4PQYA 1NI4A 5BYJA 3SQXA 1L5MA 4CRWB 3U4HA 3S2GA 1XGKA 3IILA 3MAAC 1ODJA 1UBGA 2G1JA 4CKEB 1LPPA 1EP2B 2H7YA 4DQPA 3R20A 5FTLA 1T1SA 1QKIA 1QWSA 3LPDA 3EARA 3GIMA 1JQKA 3IAM6 3QVVA 2GN0A 1URPA 4LGYA 5E6SB 3WP0A 4B9AA 2D2FA 1YQDA 3L02A 3IMCA 1NW6A 2PQMA 2IV7A 1QFJA 4YFVA 4RELA 4KZPA 4ZI7F 3C6QA 3PX4A 1ZJJA 5CLHA 3M9XA 3AW9A 4QDKA 5B7PA 1O0SA 4WZBE 4OSOA 3RQIA 1QGDA 1SV4A 2Y0SF 2ATXA 2PD3A 3D2LA 3OESA 3TRFA 4DQUA 4QO8A 1T36B 1OB5A 1G16A 1G8YA 1RWBA 2XEDA 3S28A 1KWGA 3U44B 1O03A 4UNNA 4DSKA 2F17A 5J2KA 1VLMA 2ZE8A 2DG2A 3GJ5A 3H9EO 3QH4A 5FF9A 1PJRA 3IPXA 2FE9A 4J0QA 4Y30A 3WJ2A 4CKBB 2V9WA 1YDWA 3BRQA 3CZMA 3F9CA 1W59A 1W4LA 2E85A 4Y18A 1LS1A 1OXMA 2E55A 4RZUA 3T9CA 4MWDA 2IBSA 5D8DA 2RKWA 4R0NA 1NRXA 1UPFA 5EMHA 2B7LA 4IMJB 2CLOB 1FZTA 2Q3EA 3FHLA 3MABA 1QANA 3QPWA 2GWSA 1GZHB 1WCWA 1I4TD 4KYVA 2LW7A 1TF7A 4IFEA 1JA9A 1TT7A 1NUHA 1WIWA 3SIXA 3ZQKA 4C0QC 2W8ZA 4OY3A 4JVSB 1UBKS 3T35A 3QV2A 2IF2A 1QE3A 1L5VA 2QAJA 3PQ7A 1ZSNA 2OHIA 1LTHR 2ZYRA 1HUQA 3ITKA 3JYOA 1TC1A 3LJKA 5U4XA 4U7DA 1OA0A 4O1HA 1ZUIA 3FNQA 3HI6A 3UOGA 2EP5A 1JL3A 1MIOA 1Z56C 2M1XA 1V8OA 3EDYA 3RH6A 721PA 5JROA 1E5XA 2W6ZA 8MHTA 3BMQA 2W71A 3T9FA 4EKEA 2F3PA 1OT5A 5JNVA 4LDJA 1JTEA 2WHRA 5HF5A 4HFJA 3P2MA 5LDHA 1U2QA 1G7CA 1U6IA 4BNVA 1M66A 3FRHA 2XCRB 1AKQA 2WJIA 2IXBA 3ZU5A 3VKVA 5CFRA 1K7CA 3R6WA 4PS1A 1DK2A 1MORA 1EFPA 3AJ8A 5K3OA 3OQIA 3DLHA 2PBFA 5IJ0A 9ICJA 4O63O 4NYMQ 5CFLA 5C5DA 2BBSA 2Q6KA 3CH4B 4LC1A 4URUR 4YV1A 1X1EA 1MTOA 1WKCA 3JWEA 1ZHHA 3KSDO 3NNDA 3O2NA 4JUCA 4GQIA 2B0JA 1RKUA 3ADKA 3EK2A 3C70A 2HWXA 1QVZA 1EVYA 1JG1A 1FSPA 3H3XA 1NVAA 2AT1A 3BZCA 2OY0A 2HMAA 2WTEA 2XKBA 1OYOA 4JGIA 1X9IA 4MX8A 4TRJA 5FQOA 2TECE 4CF7A 1Q14A 2PX4A 3FHOA 4JCCA 2XGSA 1OHHD 2B9EA 2O7NA 4RWEA 1YFLA 3RRJA 2FSPA 4NZ9A 1MZVA 1ORHA 2DHRA 2AFHB 1G64A 1YS7A 2VTBB 3H6HA 4NG5A 4PCUA 2QLTA 3ET5A 4LDAA 4CPDA 1YUBA 3EWNA 4PE5B 4X6XA 4AO8A 1N0IA 1JR4A 3FSEA 2FPLA 1V9PA 2KZZA 3ZWCA 4HO1X 1UXKA 1A5AB 1BMDA 2W04A 1GU0A 1CIPA 3H2GA 2Z4RA 2VSFA 2O8DA 2JLQA 3SC4A 5AKYA 2WJJA 4Z0TA 1ACMA 3F96A 4BNUA 3RU9A 2C54A 2ZPAA 4BB0A 2P69A 3VR5A 4IUYA 2CXPA 4NBTA 1QF6A 5I4CA 1AX9A 5HF6A 1I7SB 4RL4A 1Z4QA 3F5QA 1ND5A 1K4MA 3LW7A 2CYCA 4ND2A 1CIVA 1AA6A 1B4DA 4KMOA 2JPDA 1OQAA 2ATEA 3IOMA 3WE7A 2FKAA 2ZTDA 4D97A 4MJ7A 1F0MA 1JQEA 1I14A 4ZVSA 3HZZA 2F67A 3VPGA 2BBTA 2FEOA 1CLEA 1WXDA 1TGYA 5SZKB 3KZKA 2DSTA 3V2IA 1IK4A 1YL7A 2L42A 4FYIA 4N5MA 2WIGA 4K1LA 4MS1B 1EDZA 3K9NA 4FCWA 4R2WA 1GSAA 4HAWA 4C76A 3VYWA 1I51A 5KFIA 3HU5A 4A8EA 3RBDA 1ABFA 5CNIA 1KDVA 1C4XA 4X91A 9ICWA 3I1YA 5B1SA 4ILEA 4R9NA 4C6TA 4TYYA 2VJOA 3WRXC 2YXEA 4W1PA 3OKPA 2ZRIA 1AMUA 2VOEA 1NJ2A 4GC6A 1QP7A 3OPYI 1KXZA 4NBSA 2CNOA 1FUYB 2PZEA 5EYPA 3UGKA 4QTYA 1NLUA 5AVUA 3O2JA 5K4AA 3INRA 4J9SA 2XECA 5L51A 1LF0A 1HDIA 1ZZEA 3GDOA 1N36B 4L5CA 4J0FA 1PHRA 1YIDA 2B92A 2QTMA 1SL2A 4OEHA 4PL2A 5HQTA 3P2EA 1XTUA 4YY3B 1YRQA 4YB8A 4ZK2A 3I42A 3EY4A 2ZIUB 1Z13A 1W8IA 4DWWA 2IXTA 2BZFA 1LPNA 3HNPA 3GYBA 3N05A 2FUG6 1AHPA 2Q9AA 2W2VA 3G5UA 4NPCA 3SQDA 4HDOB 3IO3A 3KM0A 3AM5A 2J08A 4NOMA 2YB1A 4NH0A 5JD4A 1YRWA 2XITA 4WSOA 4GDFA 3A05A 3EF0A 4I4TF 3MUNA 4ELUA 3DR5A 3LO5A 7ICHA 1DAPA 1TYCA 4FBUA 3G6WA 3Q98A 2OKCA 1WXGA 4PHPA 1M1XB 3H4DA 3VX4A 1ECLA 4DS3A 1DJMA 4G1CA 2XYQA 3VR1A 2GF2A 1PJ3A 1Z38A 2FEWB 3OIDA 4TS4A 2ERYA 4ENSA 5IF3A 4BO7A 3OKCA 3S1SA 4HGZA 1D2HA 4H7HA 2XA1A 4MGHA 3MGBA 1F44A 4JWMA 1U7HA 2YYSA 4GUDA 1QONA 2XMQA 4EJSA 4QZ9A 2W6OA 2VA3A 1KJYA 2ERCA 2AOUA 3FUTA 2ZE6A 4EECA 2X4DA 3AILA 2WHPA 1H22A 1N0UA 3UBTA 3LI2A 1A7KA 3IKJA 4OHFA 3L0SA 1TK3A 3ZVKA 9ABPA 2GBLA 2OAQ1 1PNTA 2WC1A 4M86A 1B26A 4I2HA 1XAIA 1XSLA 2RFLA 3QTBA 4C04A 2JJMA 4KXWA 1NJFA 3OT1B 1NW4A 3ZIUA 1ZBDA 2OCXA 2V5AA 2XE4A 4DV5B 4GLBA 1QYRA 2ATCA 4E5DA 1RPZA 1FJ2A 1Y48E 1HSOA 1ZIXA 2JC3A 4LTDA 1GADO 2JGNA 3A1VA 1P2DA 3E9ZA 4KDFA 2OL4A 3F5DA 3JZDA 4F5YA 3AF3A 2LKYA 4JP8A 4PONA 4DR7B 4ZGWA 1T9CA 2NXJA 3OJWA 4H15A 3CLSC 4JB0A 1P6QA 4BX0A 1TV9A 1UOOA 1DRVA 4XD7D 3TX2A 5H3CA 4KGVA 2BYTA 3IQIX 4DY6A 2EKQA 2VANA 2AUMA 3C4QA 5EQTA 2ZJAA 1EDBA 1FQOA 4FSXA 5EPUA 3SU8A 2O48X 1TUGA 1EDDA 1OLSA 2Z04A 3TZEA 1MXFA 1KFCB 2VP3A 3G2JA 1T3ZA 4XB2A 4GL4A 4NJ8A 2OYRA 3SY8A 4CCYA 1QO9A 1WCYA 2QX9A 2MSLA 2VUSA 5JD6A 3C3CA 4OFZA 1AKYA 2I55A 1Y9DA 4BX3A 1DJOA 4LFBB 3UFXB 3ZHTA 1L7OA 1NTOA 1PJQA 1ZN9A 2YIMA 1GUFA 1XCLA 2ZQ5A 3IQGX 4MGYR 3C2KA 2XEXA 1J1ZA 1SPXA 3WSWA 3OHMA 2ZRAA 1A8HA 3T9EA 3COZA 1ZWKA 2QT1A 2NZVG 5T6MA 4A6EA 3UGQA 1W4ZA 1IB0A 5HZKA 1UFRA 5P8WA 4CEJB 1XZAA 3LA8A 4XOUA 4D0NA 2Y1LA 4Z53A 2HB6A 3EFHA 3TZCA 4K6CA 5JH7F 4L2IA 2JHGA 5CIWA 4XJXA 3MINB 4WZBB 4L27A 5MN4A 4N01A 4BV3A 4TMXA 3MW8A 2HA4A 4F5RA 1XCJA 4A6XA 2QN8A 1AQYA 2I1WA 1T9ZA 1LY1A 16PKA 1THGA 4YYEA 3VZRA 4NBRA 1UKZA 2JANA 1AY0A 1CFZA 5E3JA 5H16A 4BGDA 3STTA 5DYTA 3ZWXA 3TG2A 2K6GA 1L5KA 4QOJA 4M0FA 3D9QX 3H9JA 2ANBA 3WGZA 3SCZA 3GEHA 4JI0B 1YR9A 3OWXA 5EQFA 3CJRA 3ZU3A 4UBLA 2B6GA 2HBYA 2WZCA 4IDPA 4B79A 4YD1A 4RFVA 3V7JA 1YIOA 2ZRKA 4PO8A 3VUFA 2CBGA 2RD2A 1QLWA 1CYEA 3F9RA 4II3A 4WKNA 3Q3IA 1PSDA 1ILWA 2A92A 4LJ8A 1NJ1A 1MO3A 4C2AA 5BQ5A 3KVOA 2PFGA 1YULA 4GP9A 4NOLA 5EERA 1X19A 3RADC 5CCBA 2I9GA 4Q7JB 2QSUA 1CUZA 1H2AS 2I2BA 3E9EA 1KO8A 5AK5A 2C9MA 4S1NA 2O5EA 1F5SA 2FEKA 4CKXA 1UBHS 1N62A 2FOIA 1E32A 2WJAA 4P4UA 1LPOA 3A4MA 1OLUA 3EXG2 4YV0A 2I6GA 3AV3A 4L8FA 4R9VA 4DV1B 5EXDA 4LPSA 3C3YA 3F6EX 3GLKA 2JAWA 2FPUA 4KPGA 4EYGA 2AD1A 3OM1A 4LNUB 4R2MA 3SXUB 1YMVA 3PDWA 2V98A 4D7AA 2AR9A 4BCBA 5KWIA 3U4MA 5IC4A 1A5ZA 1FFXA 1KTQA 3OD5A 3QQPA 4L9RA 2AQKA 4KB5A 4OMDA 4UB2A 1DCTA 2JLZA 5K3EA 1BWRA 1DQPA 1U7PA 3ZHQA 1E4EA 1E7SA 4TX1A 3BZUA 4UVHA 1T2CA 3LT0A 3WLOA 4F6CA 5KYKA 1GAEO 3QUQA 3R3VA 4LJXA 4YAIA 1WHSA 2RGRA 4CTJA 1L7QA 2EZXA 1BG6A 1SG9A 1WDWB 1G291 4K7JA 5I9MA 2VOJA 3LP6A 1GQQA 2J5KA 2FWPA 1BXRB 1OFTA 3VI4B 3PWZA 3T5GA 5H9WA 1VL0A 1TUBA 4IIDA 3G2HA 5A4AA 3PXDA 4ZJYA 2DETA 5GZ6A 3RBVA 1Y9JA 5CRXA 2WYWA 4HWGA 2JLVA 3EN0A 2PZGA 4G0UA 2IYAA 2JH9A 3L9WA 2H5EA 1T15A 1NN3A 1VHDA 2B4QA 1CDZA 1J2YA 1POXA 2O0MA 2WD8A 4PC3A 2ESEA 3VTFA 4UB8U 4QIHA 4XLLA 4BMCA 1LBTA 1ZQNA 1EKXA 2PK3A 4QDTA 4W99A 4JJEA 3VZCA 3LG2A 3PCTA 4CM9A 3DOUA 5FBZA 5GIPE 4RVOA 5DIFA 5FUYA 1DBQA 2VPZA 3FRIA 2YFKA 3BFJA 3WQHA 1DTWA 3VJMA 4NBWA 4AYTA 4XJTA 3TRJA 1KFSA 1RMTA 2Q6LA 3RYCB 3OMLA 3T06B 1ORRA 2V59A 5F1PA 2YMLA 1R0CA 2W2NA 1E2NA 1LVGA 5CGZA 1UT6A 1OC2A 8ICYA 3ZEIA 4EP1A 2KEYA 2LHTA 2PWYA 4OGWA 4TL6A 2ON6A 1UOEA 4W1RA 5DGIA 5DBGA 4BNJA 3PHGA 1ZQEA 4DL9A 4TUPA 1NAIA 1LBSA 2JZBB 4NSNA 1P5FA 1LBIA 4OOFA 4DQ0A 3MUFA 4DMCA 3AR2A 2GZ3A 1AGPA 1RPJA 2RCYA 1QYWA 3D4NA 3MWYW 4PW0A 4BMYA 4FR0A 1PJSA 2Y1EA 5GIOE 4AO6A 5KTQA 3T9DA 3N2GB 2WVHA 1ZRSA 1WBJB 4U6QA 2QTGA 3IVCA 1SU6A 2X1MA 2JFYA 4WPGA 3GJZA 4EIWA 1U2DA 1X1TA 3LHIA 3L8ZA 4LHSA 4PLHA 5F12A 4HQFA 1ZITA 3VJLA 4KAJA 1T4GA 1K8ZB 3JPRA 3M8KA 3WLJA 1QH8A 2P2DA 2V54A 2I3GA 1N1EA 2QSJA 3NDIA 5CD9A 2RIRA 2NTNA 2C00A 3KLOA 4J9OA 2VPWA 5JSYA 1ONSA 3UWSA 1WTCA 2X5JO 4INAA 1E9BA 3FDZA 4MCAA 1WYGA 4TZKA 4LGCA 3S8YA 2GNPA 3HHPA 1RXIA 3BOSA 2YJTD 4QVGA 4M99A 4BQRA 1G5TA 1FX0B 2FCRA 2CUNA 2P4EA 5FUVA 3X43A 4KLSA 3WGMA 4JT4A 2P9JA 3EF3A 4INPA 4Q1BA 3E1GA 1OLXB 2EAUA 5DSZA 4QM6A 1DBVO 2GWRA 5ALFA 1C20A 2PD6A 4GM1A 3RRNA 2G40A 3I0MA 5H3HA 4F4CA 3QU2A 4PZ9A 2NO1A 2DLCX 1IY2A 2DPJA 1ODLA 2WIJA 2XSZA 4ZN6A 5IVIA 3R9KA 2PVSA 4FKZA 3MRSA 3FW1A 2G08A 4A0QA 4NS4A 2G9VA 4JV0A 4WOPA 1RLIA 4P7JA 3Q8QB 1U31A 2ISCA 2QX6A 3ITNA 2IE0A 3TVDA 3UXHA 4OM8A 3H0LB 5E7MA 4KK4A 3AY3A 1EVEA 5ALEA 4KVGA 4XUSA 3AI7A 3GNLA 3FDIA 1BDBA 5IIMA 1T5LA 3NTRA 2FGJA 5TJ9A 2RGEA 4I4TB 5LA6F 3FDFA 1WX1A 3CZPA 3OECA 3T3EA 3SBXA 2MMGA 2QRGA 4QUJA 4QYIB 4YDSA 3VR5H 3WZLA 1K4KA 3GGJA 3CINA 1VLHA 2MR5A 1GEEA 1XWWA 3R5KA 2X8BA 5DLPA 4IOLA 2PUFA 4BGUA 5DKWA 2P90A 2WYOA 5EHNA 3RRHA 4BTVA 3W7AA 4EJ2A 4LRSB 4BE9A 1Z5UA 4UAWA 4N3CA 4RM2A 2JIZD 5JCXA 4Q9IA 1EFAA 5E1OA 3O94A 5LQNA 1JI3A 5E4TA 4OG2A 1P3DA 1R74A 2BJWA 2BP7B 2HDHA 2ZSUA 3IMKA 3V8VA 3LH5A 4FBGA 5KFUA 4FFSA 2I29A 5F1YA 2ZIWB 3VU1A 3CYMA 3OIUA 4HI0E 4KQKA 5CHEA 5AKJA 4IJKA 1O6CA 3E35A 3SJZA 1GDTA 1RHJA 4L3WA 3U7IA 1TF5A 5LIRA 3USES 3ZQJA 1TLTA 5GV8A 1S2NA 2ZT6A 1C3LA 3OWHA 3VR4D 2OHXA 3QTLA 4PO9A 2XCLA 4BASA 5CDFE 1SVKA 4KLQA 1E6MA 2IP1A 3HN6A 2CFSA 3PNLA 3TLKA 1SCIA 4F92B 4E08A 3UMBA 7ICVA 2VT2A 3HCFA 5CU7A 5J4VA 4WBNB 1GO2A 5JXJA 1X0XA 1GNPA 2GCOB 2IZ1A 4IRUB 1ZGGA 4G63A 5AOVA 4X90A 2YJ5A 4RVFA 1E4VA 4BQEA 3WNVA 3FHCB 1KZ9A 4I14A 4LRUA 1XKQA 3C97A 4NS1A 3VR6A 3EGOA 2BMJA 3IOYA 5TQJA 2F48A 1ZQTA 2VAXA 1ZD5A 3FY4A 4L51A 1GRNA 5IJXA 3X44A 3OP1A 1W46A 3GQBA 3UUEA 1BVHA 2OQRA 3D2CA 1CSEE 2GAFA 3AUYA 3D6NB 3ZTWA 1ISGA 1CJKC 5I4BA 3MJDA 1DELA 1IEVA 2RI6A 2P8JA 1JR3D 4NFYA 1DDIA 1NUSA 4CFYA 1H2HA 4UVGA 3JPTA 3T5LA 3S7TA 3VR4A 5HM8A 2QL6A 4LHVA 3NIBA 2X7HA 1V95A 3JATA 5A5EA 5IUJC 4HX2A 3AU2A 1Z4PX 1GA1A 1GZ7A 2I8LA 4QJ4A 3L7MA 5GONF 3AWIA 4TLAA 3W6OA 3ZHSA 5FUMA 5CR9A 1ZJMA 2IPXA 2R8RA 3FSGA 1MG0A 1QO0A 3L8HA 5FA8A 1H2RS 3FYSA 1KA9H 3BMOB 4ROSA 1D4OA 3DS8A 4EDFA 2BFPA 1C3VA 3BGSA 3HGMA 4K87A 2IELA 3JU3A 2ZIVA 3WLLA 2VWGA 1H65A 4DUGD 4TQRA 3H5RA 5JD5A 1Q84A 4YRIA 4K46A 1SKRA 1AKVA 4S04A 3G68A 2EDCA 4FPXA 3GDGA 4FFBB 1XKLA 1UMBA 1VA5A 2RGNC 3C5EA 4ZO9A 1EFHA 3WBKA 1NOMA 1QFMA 2ZSHA 4K3VA 4MS4B 4AJLA 1M6VA 3NP9A 1Z08A 4H31A 4IQ4A 4W8OA 5F9NA 1CY4A 1JSRA 3VTAA 1ZRNA 4BVJA 1QAQA 1RTKA 3JPNA 1OTYA 1AZSC 4EBEA 5KFVA 2A1TR 2HF9A 2IHUA 2A5GA 4MEJA 2EZUA 3F53A 1A2BA 1RLOA 3C1AA 3PQ5A 1A9ZA 2WT8A 1I24A 4Q48A 2VZLA 2I2AA 1QO0D 3NAGA 1RM6C 1W73A 2P27A 3Q5EA 1JV2B 4RJ2A 3WL7A 4DWVA 4Z7QB 1FQJA 3CGWA 3OWOA 4Z2YA 4MB6A 1OFUA 4RF4A 4JZKA 4JV2A 4YO8A 3USCS 1LV5A 4R7GA 3A4LA 2C7RA 3P4XA 3SBDA 5CNJA 3OIYA 1JEQA 4YR0A 2GJKA 4UDNA 2QF7A 4J0KA 4F4WA 3I2HA 1FJGB 3S4YA 1AUXA 4C8NA 3QE3A 4ZOHC 4JI4B 1X1SA 1HQCA 2FLNA 2PCJA 5AOCA 1M1NB 1EE9A 3THXA 1S0NA 5CBPA 3IUMA 3VC7A 4FXOA 2J0QA 4L0DA 1QLNA 1EZZA 4ECAA 1HL3A 4RQ2A 2XB4A 5CT6A 4FZVA 4RUAA 2X0NA 4HMQA 2BUAA 5D5HA 4X60A 2HNAA 3L2OB 2B3DA 4OL9A 1H0KA 3ETLA 3N5CA 3TFQA 3VDMA 1SCJA 4WQMA 2B20A 4BTEA 5JU5A 3VKGA 1TNDA 2CF6A 4I1SA 1Y8QA 5K3SA 4BVHA 3UKDA 1NNEA 3DBRA 4XM1A 3ZGYA 1PR4A 1SBHA 2CCJA 2O2HA 4P3OA 5KCMA 5GONA 2I71A 2YMQA 5EKUA 1S01A 1BSVA 4TROA 3EVAA 2Z43A 3L6EA 4F45A 5KWJA 1SIOA 4CF3A 5CA7A 1DXYA 3ZZUA 4Z6FA 5HW0A 1ZM2A 2J9RA 3OZGA 3PSHA 4PN7A 5DX8A 1JR3E 1NM5C 4J0CA 5K01A 3UG6A 2VP0A 1ESEA 3AHGA 4QU0A 4F5WA 1U7WA 1F4VA 2Q4EA 5FPYA 2P5SA 4DWIA 1B8NA 3N2NA 4MA5A 3Q3EA 3RUAA 4NAVA 5CP8A 5JZ9A 5L3QA 4LMAA 4H6WA 3GT3A 4TLEA 2PUHA 2ZR8A 1SBYA 4W7IA 4Z4EA 1J56A 2YDXA 3H05A 3WB1A 4DARA 4QQRA 2P4UA 5EWJB 4RM3A 1FMFA 1DDGA 3RKSA 3N39C 5ENZA 7ICFA 3IQZA 2AEFA 4HZIA 5KJEA 1S7GA 4QXAA 1TZBA 4PYIA 2VP5A 3UHFA 2IT1A 2WTMA 4F8EA 1FDIA 3R6DA 3MGKA 1QHGA 2LMRA 2XUIA 4ZTZB 2JRLA 3DAGA 2OM2A 4ECYA 2YB4A 3D1JA 4F60A 4DNOA 2VSOA 4E09A 2ZSFA 4AYWA 2R7NA 5KDOA 5HP4A 4CT5A 2BONA 5K51A 4S2UA 3VJKA 2FR1A 1MEOA 1IUPA 3QEKA 1FXWF 2VDQB 3FCCA 4US8A 9ICBA 1E4YA 2HU8A 1JILA 4BFVA 2QM8A 4MW7A 4RHXA 3UT5B 1MQ8B 5HYVA 3EA0A 4JY7A 5DBFA 5E8RA 3QE9Y 1XQ1A 4HEQA 2WV7A 3I2IA 1TQ2A 4JC4A 4MDHA 4CL8A 1TKCA 3AESA 1O58A 4YP3A 4LBYA 4D46A 1C41A 2DKZA 1II9A 4EHIA 4M9JA 1BCRA 1MKYA 1NW8A 3CB4A 5MFZA 4Y1RA 5AK6A 4YONB 4IV8A 4B8ZA 3VSBA 4PLTA 4H6XA 5C7IO 2P4SA 2WVAA 1VL5A 4E21A 1LJ8A 3M2TA 4Z3OA 3NMUF 3IR6A 5KSOA 3RJFA 3KXIA 3PUXA 1B7GO 2YTZA 1NULA 2CHFA 4A8HA 3EFBA 2G1AA 3FFXA 2A8YA 2XCSB 3LCUA 1CUCA 1QK5A 2GRAA 1KBUA 2BT4A 2J6HA 2O6LA 2RSLA 2W2PA 1SJ9A 1Q7RA 2K4MA 3LC7O 3IXQA 4UNQA 4YMNA 1E2UA 3G02A 4IIEA 2ID4A 3ME5A 5CG1A 4OJKA 1QVWA 1CFJA 2CD7A 1FXSA 4NNJA 1BEZA 4ITUA 1DE0A 1I2DA 1XZBA 3O03A 1TTTA 1Z4JA 2R87A 1R5JA 2HTEA 3KB2A 1JHVA 2YFYA 4ACAA 3MYRA 2ILVA 2VJNA 3AZPA 3L8EA 1R9GA 1RNLA 3HN2A 5JAOA 4R65A 2AOTA 9ICGA 1FMLA 1L5WA 3HR4A 1PKXA 4ZC1A 5NLLA 1AK2A 1L5NA 3P9PA 4DUZB 2V7VA 4KREA 1Y1SA 3FOAA 4JLDA 1GUYA 3WYFA 5HKBA 1B14A 4F4XA 4J7XA 1EBFA 1OLXA 1IQRA 3NCHA 3R24A 3E6AA 3B48A 1N9ZA 4YAUA 4G65A 5MF6A 1KAMA 1A95A 1S8FA 3UK6A 4QJ5A 3KOXA 1JAZA 3MWLA 1XLWA 2QUJA 5IH3A 5JWRA 1V7CA 2D4AA 5GJCA 1OV6A 4OUDB 2R7LA 3CEHA 2JMGA 4F4YA 2K87A 3OZSA 3RVSA 3THYA 5A7HA 5IUNC 1CUJA 2JZOA 4D6YA 3NCTA 1YV9A 1IHOA 2XQKA 4ZAWA 1XKTA 4BEJA 2QMUA 1CF2O 2FFHA 4MCHA 1NE7A 2YWDA 1QO7A 4LDNA 2R68A 2J4CA 3STYA 1WVIA 1Z7BA 4M9GA 2PXIA 2Y0EA 3LK7A 1DP4A 3B1ZA 4ND6A 4QYWA 2XUJA 1L3UA 4PZCA 1GCUA 4HL6A 4HTFA 4B2LA 4I3GA 4LYYA 1CDEA 7MHTA 2VCYA 2XVMA 1TVEA 1XN4A 2FZ5A 2J6SA 4K8RB 5KHOC 1R64A 5K4GA 4TMKA 3ESZA 4Z3DA 4LF6B 4ADSG 1T5BA 2AZXA 1TK0A 2BV3A 3HCRA 4IVNA 1RFLA 3PD0A 4F3RA 3M9WA 4ECVA 5EPEA 2QS9A 3KD2A 3Q12A 3UUGA 5CFZA 5LQCA 3PR3A 4FKMA 4L4ZA 4WDRA 3VFDA 2C2YA 2PMKA 2Q0SA 4K6FA 5KFYA 3NTQA 3H4IA 4MS3A 3REGA 5TMDA 1N5KA 3UB2A 5DP1A 2OWDA 3Q3CA 3UMVA 1G6KA 4QU9A 3M7IA 5FOTA 4D5GA 3HO8A 2SNIE 4KE9A 1NBHA 3GFTA 1K7FB 1I7QB 1PJZA 2P9EA 3IQEA 2ZYWX 1KJ9A 3A2KA 2KTQA 1YOVA 2DUJA 2JD1A 2QMYA 2O9JA 3B3AA 4WK4B 5AH0A 2YY5A 3ISJA 3OAAA 4GEGA 4MO2A 2IEYA 3CF4G 4UVIA 2AKAB 1I9GA 2G9QA 4P98A 5CYFA 2JAUA 4ZAZA 4JP1A 1R6VA 4M2LA 4ENWA 4HUQA 5LCXA 1PAUA 1TI7A 3DBHB 3B38A 2FY8A 4AQYB 1RYMA 4HB3A 4HOYA 4EQ6A 3ZK8A 4PYJA 5LQUA 1E1LA 1O5TA 4EJSC 3V8EA 3W3AA 2Q29A 1MX5A 5FRDA 2YIJA 4RXTA 2YZ7A 3T7KA 5IX8A 1WUJS 1K75A 4BVGA 1ECGA 3V2HA 1CUBA 1D0IA 2W7TA 4Z99A 1OREA 2QTVA 3HA5A 8ICJA 3A1NA 1U3UA 2IEDA 4AWAA 4IBOA 1R0KA 3V7WA 1LX7A 4WUVA 2RG1A 4H1WA 1NF2A 4OI1A 2WD9A 5JFOA 1S10A 2BY4A 2R18A 8ICVA 1X86B 3HVJA 1SVWA 1WHSB 1D8AA 5D6NA 2P91A 3GT0A 3EXHC 3F6RA 3NIWA 4MWOA 1KE1A 5A2GA 3GFOA 3D1LA 3H86A 2IYUA 5AJYA 2MR6A 3VU0A 1KY5A 2P30A 1UBRS 1FFHA 2RHCA 3C7TA 3PB3A 1MAAA 1HDEA 4KRYA 4W5HA 1FFXB 1NXQA 2XYPA 4HUJA 3U48A 2N75A 3KG2A 2W9CA 4C7BA 2JHAA 3GROA 5JIBA 3GZJA 2CLEB 4HXEB 3OM8A 4EMUA 2F3UA 2R2GA 2QARB 1VE5A 3HUFA 4O29A 2W4IA 3UUWA 5CURA 2QGFA 2IUFA 2ZAOA 1Z2AA 2ICAA 3LPLA 1KJWA 1R5BA 2W3SA 1KDTA 2H52A 5G02A 2EQBA 1U2EA 4ZDJA 2I3DA 2IA6A 3DD1A 4EJMA 3UC5A 1HQKA 4YHBA 4A10A 1T25A 3FWNA 3GLQA 3O4FA 3RKRA 4ZD6A 4ZICA 3V4SA 1APBA 1K7XB 2AXNA 2FRXA 1GVNB 1W5EA 1DG3A 2AB0A 3JQ8B 4QDJA 1GGKA 2X9QA 5IYZF 2UXBB 1NMEA 4ZDWA 5THQA 1E9CA 3EC7A 3K6KA 1T3LA 3ZNNA 3GD5A 3SMVA 2LUOA 5DHAA 4GZLA 3D7KA 2CV2A 1D4FA 1Q1ZA 5B55A 3R3SA 1SHUX 4H0FA 1TMYA 3HZOA 2AYZA 1RAHA 4YWJA 1Z0AA 5KFLA 4UUOA 1N5JA 2HJ9A 3DEEA 2R47A 2QW0X 2HWWA 4JNKA 1J6UA 1NU8A 1WG8A 1U2PA 2YXLA 4IQ0A 1L5FA 1ZVQA 1YACA 2I66A 1B0ZA 2PX6A 1XTBA 3PGA1 1ZQAA 1A0OA 1I33A 1UPTA 3JVEA 4I3HA 2C98A 3A0HU 1FA9A 1DEOA 3FAKA 4IUDS 1WMBA 4CM1A 2A0UA 3T0FA 1NXWA 1STOA 3CKKA 5KFGA 2QUKA 4C0SA 2NP7A 1FFCA 1VC2A 1N4AA 4CI9A 3ANNA 4N1AA 1BOOA 5FPQA 3TAPA 4P7KA 1G5HA 1RW4A 2FW7A 2BQRA 3CEPB 5B4UA 1NF8A 4B8YA 2CYBA 4UD2A 1TZCA 2NV2B 1U9ZA 1HX7A 3T8YA 4HH1A 4QXRA 4UUQA 4XGNA 2UUAB 1SUAA 2UYCA 2K8CB 2G5PA 5KT4A 3OZAA 1KOGA 1RPTA 2JIRA 3G17A 2BM9A 4NE7A 1KZGB 2BKUA 1PDOA 2NO6A 4GI3A 3SVLA 3FPBA 3R7WA 3V7KA 3NXSA 3DWFA 5JALA 3VCBA 1WY7A 3KHHA 1JIQA 4DAOA 3F74A 4DLLA 5E6UB 3H4BA 2BQUA 2J9FB 2Z2XA 2X40A 1USWA 3LUKA 1IUOA 3IAEA 4M9NA 3OC6A 3D4BA 4LPKA 4MI3A 5JCOA 1H6CA 1NW5A 4C6HA 5ICMA 2LVBA 3JR3A 2XBLA 1MB4A 3ZZNA 5I4KA 1H3EA 2NSHA 4JJZA 4RF2A 3B13B 2VI5A 4MP3A 4AZ3B 2VH5R 1ESNA 3OY7A 1XD2B 1SY7A 1ZESA 3IUEA 2ATIA 4ED8A 1M34E 3MJRA 1OX4B 3TL2A 2EKZA 5CWRA 5DE3A 1J20A 2O1WA 4IYJA 3CQ9A 5H02A 2ZRHA 3KXLA 4BX2A 4F3YA 3VZPA 4DZZA 4YUAA 3E3LA 3TACB 3V00A 4DBLE 4DAEA 4JLKA 4NBKA 2E48A 2BR0A 1EG7A 3H19A 4MQMA 1MT3A 2AJQA 1F2VA 2VNAA 2ZW9A 2A9KA 3A14A 1DIRA 3G8BA 4L0MA 4TS1A 3A3PA 5SV2A 3ROXA 2FUCA 5DTRA 3TVTA 2GHIA 1E5LA 4B9NA 3CH5A 1KNQA 5KNCH 3OQMA 3NTOA 1E89A 2O50A 2FQ1A 3BXXA 5FLKA 2DOKA 2FFRA 1NI3A 5BWOA 5JSZB 4Z4CA 2PT6A 5LYYA 1KI9A 1S97A 3SOPA 5SZJA 1WETA 3WXBA 2P6NA 2X0RA 3E7PA 4TKVA 1S2LA 2H51A 4TUSA 1KI7A 4OMUA 2IYSA 1VIMA 4BO9A 4NLNA 2H92A 3LPNA 2PHZA 3NHBA 3IDQA 1GNQA 2ZSIA 1Q7EA 3LUFA 1Y9AA 1XSEA 4L8LA 4AYXA 2ZBGA 5E4FA 4GLXA 3GGOA 4G5GA 2A5JA 2W9BB 4B73A 4L4UA 5LBTA 5K0GA 5KSZA 5CCXA 3QX7A 3UAVA 4Q3BA 4GMKA 2O5CA 3EGXB 3IJRA 1EXNA 2NAFA 3DPSA 5C8YA 5KOHA 1TRKA 5KYXB 1TJ5A 1LNZA 2RARA 3SBOA 3QXHA 3REQA 4JLNA 5KFZA 2AZMA 9ICFA 1EGVB 1H2WA 1HZJA 2R4TA 5G0UA 2Q7OE 4CZ2A 4F1KA 5L4LA 4D9JA 1SC4A 5AVYA 3FLEA 4XWGA 5IASA 2VNHA 3TW8B 1USIA 1H4QA 1V25A 5E6UA 1MABA 2WY2D 3T0GA 1YZFA 3BMXA 2LTAA 2A5YB 4UQGA 1Q3TA 2RGXA 1MRZA 3BG5A 3GJ7A 5KG2A 2Q0HA 1B73A 3MWFA 2KNJA 3PUKA 3V8RA 5B30A 4K2HA 1PUZA 1B3RA 3G6VA 1NM5A 1L7XA 2BIFA 5K0JA 3B1KA 3GJ4A 4EHJA 1FFVA 2B94A 2V9PA 4B9LA 1OU0A 4ECWA 4GPTA 2K2QB 1MB0A 1G6OA 1WXQA 1UPHA 2ZT7A 2PSHA 2P5TB 2C28A 2J09A 4NMWA 1L5YA 2G77B 5EY5B 4BGIA 3UENA 4F86A 3DBHA 3AUAA 5CIQA 3GW8A 4C0XA 2BGKA 2F00A 3BWBA 3SAFA 5LPNA 3CC8A 1ZQ1A 3HLYA 1G3MA 2CD9A 4KLUA 1L4GA 4KLMA 4OMFG 1D6MA 3P9SA 3WOVA 3JYLA 1N63A 1XZGA 2HFJA 3G5MA 4O5AA 1Y3BE 3PE3A 4UB1A 3NTVA 3U17A 1HLPA 5FV4A 4FE3A 1AO0A 3TDNA 3K71B 4C0WA 3P2OA 4BBJA 4J6FA 3PWTA 1X7YA 2F3RA 3IUYA 5JTTA 2E2WA 2MUTB