3K1ZA

Crystal structure of human haloacid dehalogenase-like hydrolase domain containing 3 (hdhd3)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
MRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Haloacid Dehalogenase-like Hydrolase Domain containing 3 (HDHD3)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
total genus 87
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.720 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3k1zA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3k1zA01
2CFTA 3PGVA 4BEWA 1RKUA 2MSNA 2ZOSA 3IRUA 3A1DA 1LTQA 3KOOA 5AKXA 3FM9A 5ALWA 1EK2A 4KYTA 5AW8A 3ZW7A 2RBKA 4OHFA 5AKGA 1L7PA 5ALEA 3RF6A 3M1YA 3QNMA 4UW9A 1RRCA 3WK6A 3QLEA 3E58A 3OCYA 2I6XA 2GFHA 5AESA 3I6BA 4KNVA 5AVVA 1F5SA 1J97A 4UAVA 1IWOA 2ZG6A 4AS2A 2HOQA 1RLMA 3QXGA 3SKXA 5IT0A 3NALA 5ALDA 1YNSA 1QQ5A 1N9KA 3ZTWA 3A3YA 4NAVA 3DV9A 1Z88A 2W4MA 1VFPA 3A1CA 4UM7A 3CNHA 5ALLA 2HHLA 1RC8A 3AR4A 4CF5A 4Y3UA 4IG4A 2IOFA 1Z4LA 1U7OA 1WR8A 3NUQA 4B6JA 3DNPA 1U2TA 2Q5EA 3W5AA 3E8MA 1QYIA 3L1VA 3IJ5A 2G07A 3N28A 4UU1A 5AKZA 4Y2XA 1TJ5A 1Y8AA 2FPWA 5ALPA 1RQLA 3AR5A 2BDUA 3OCWA 1XP5A 1L8LA 4ZEWA 5AIAA 3QUBA 1L7NA 5AK4A 3HLTA 4Y2QA 4HGOA 3AR8A 3WK5A 3L8EA 1L8OA 3ZX5A 5ALYA 3ET5A 4HGQA 4Y2SA 2IOHA 1JUDA 2AH5A 3L8HA 4CF4A 2I55A 1S8OA 2AUTA 2CFRA 4I9GA 1RDFA 5AKKA 2ZBDA 3BA6A 3OCZA 1Z4MA 5A3SA 4HGPA 1ZJJA 1VJ5A 2WF8A 1ZD4A 1ZOLA 5AW9A 5AKLA 2HI0A 5AHXA 2JAOA 5AI8A 2OA0A 2G06A 3FVVA 2R8ZA 5AM0A 3UMGA 2WFAA 2OYCA 5AW6A 3SF0A 5AI4A 2P69A 3QX7A 1RMTA 2O2XA 3KDPA 5AW7A 3CZ4A 1QQ7A 1YMQA 3B9RA 4BX2A 5ALIA 2ZBFA 4C4SA 3E84A 3U7GA 3D6JA 4Y2RA 4NV0A 2AGVA 1WPGA 5AW0A 2BY4A 2YMPA 2B82A 4HYTA 1YS9A 1N8NA 1ZD3A 3U7FB 1ZD2P 3L1UA 5AI6A 4Y2JA 3OTQA 4AS3A 4BEVA 3N8GA 4BYGA 5JJBA 4L57A 3FPBA 4PNHA 5IT4A 3BWVA 4F72A 2B1RA 2RAVA 1QQ6A 5FP0A 4L6AA 2YN4A 3WKAA 3SKYA 5AW5A 5AKHA 4YIKA 2I33A 5AM3A 4DCCA 4XE5A 4AP9A 2W11A 3R9KA 1X42A 2YMMA 2WHEA 1ZS9A 2IA5A 4EEKA 1U02A 4UU0A 4UAUA 3ZVLA 3WGUA 2B8JA 3MPOA 2I7DA 2FEAA 2RB5A 5AM2A 1NNLA 2ZXEA 1MH9A 1QH9A 1EK1A 1O08A 5AVUA 2BDEA 2I54A 5AM5A 4L6CA 4XOUA 3ZU6A 5AM4A 5AK3A 3NIWA 2CN1A 4GIBA 5AK5A 1RMYA 5A3QA 3I28A 1WZCA 4J2TA 3B9BA 5AW1A 2YJ5A 1RPZA 3S6JA 4I9FA 1NRWA 4OFZA 2R8YA 3AR9A 3OCXA 4UATA 5T41A 2GO7A 3L8FA 3WGVA 1CR6A 3L7YA 3ET4A 3UMBA 3I76A 3WKBA 4CNQA 4YCLA 2YBDA 4G9BA 2HDOA 4BNDB 3KD3A 4XQ0A 1Z4QA 1RLOA 1ZD5A 1VJRA 2IYEA 4FE3A 5ALSA 2GHTA 4YH1A 3WKDA 4HAIA 4EELA 3HYCA 3L0YA 2JGAA 1Z4PX 4NWIA 1TA0A 4EENA 1SU4A 1YJ5A 4KX3A 1Z4JA 3P96A 3TLMA 5ALTA 1WVIA 3PGLA 1TE2A 3UM9A 2FDRA 3FPSA 4H1WA 2FPXA 2G1AA 2NO5A 3M9LA 3QU9A 2I34A 4NFLA 2B8EA 3L5KA 4ZEXA 4C4TA 5E0OA 2YFYA 3SMVA 4UMFA 2R8EA 2YJ3A 3R4CA 5AVQA 2YMQA 2G80A 1TJ3A 4MUMA 5ALKA 4QQFA 1RQNA 3ZVMA 1Q91A 3ED5A 2FUCA 2PKEA 4FFDA 4BX0A 3U13A 5AIBA 3NAMA 2YMLA 4Y2YA 3QU7A 5ALMA 3E81A 3EF1A 2WF7A 4YGYA 5ALGA 4UMEA 2ODAA 3EF0A 2D2VA 4EX7A 3L8GA 4ZEVA 3NASA 3ZI4A 1T5TA 4J03A 2PQ0A 3A1EA 3WK9A 5ALJA 2FI1A 3KZXA 2HF2A 4UMDA 5AKJA 3RFUA 3R09A 2YJ6A 2W43A 3ESRA 4Y2TA 5AM1A 1SWVA 2WF5A 2C88A 3QGMA 3QUTA 2C8KA 3U19A 2B0CA 4EZEA 3WK7A 3SD7A 4GXTA 1Z4NA 2FUEA 1Z4KA 4QJBA 4UASA 4C4RA 2AMYA 2CFSA 1O03A 4UARA 2C9MA 4G63A 4DFDA 3F9RA 1XPJA 3OPXA 5ALFA 4XPZA 3K1ZA 5ALNA 3QU5A 1SWWA 5ALRA 2NYVA 3EWIA 1TJ4A 1K1EA 1Z4IA 3FGOA 4Y2UA 5AKEA 2VKQA 1PW5A 3QU2A 2QLTA 3B8EA 2R8XA 4IFTA 2EARA 2ZBGA 3AR3A 5AVWA 3NANA 2GMWA 3IB6A 3L0BA 4YCMA 3N5KA 2HF7A 2Q4RA 1RLTA 4BNDA 1J8DA 2HSZA 2JAUA 2Q4TA 3N07A 3VAYA 4JDPA 2WM8A 3WKCA 2WF9A 3OCVA 4KNWA 3KBBA 2OBBA 3QUCA 5AI5A 1LVHA 3ZUPA 2YJ4A 5AICA 2EATA 4F71A 3DDHA 1S2OA 3NRJA 3N1UA 1Z5UA 2FPUA 1T9ZA 2G08A 3QUQA 2JARA 2MU1A 2HEGA 1XVIA 3AR7A 4Y2VA 5AW2A 3ZTYA 4OD0A 4MWOA 3ZVNA 3AR6A 3DAOA 1YDFA 3PDWA 5AI0A 2RARA 1Q92A 3FZQA 1RKVA 2DQSA 1FEZA 3OCUA 5ALZA 5AVSA 2B1QA 3ESQA 2QYHA 2O9JA 4JB3A 1KYTA 5ALQA 3W5CA 4UMVA 1AQ6A 2P27A 5AKYA 4BX3A 4CE6A 1ZRMA 5ALUA 4BKMA 2B30A 3PCTA 4OCZA 3WKEA 2IOFK 5ALXA 2HO4A 1YV9A 5AVZA 3MC1A 2X4DA 4RESA 4E88A 3WK8A 5AK6A 3U26A 4CF3A 2C8LA 3GYGA 1Z5GA 1RKQA 1NF2A 3J7TA 2NO4A 2OM6A 1L7MA 4BBJA 5AW4A 1CQZA 2HCFA 3SLRA 3ONNA 1ZRNA 5A3RA 3U7HB 2C4NA 3MN1A 4UM5A 4FYPA 4KX5A 3KC2A 1U7PA 3EPRA 2EAUA 2GHQA 2FPRA 5AVTA 3ZWDA 5ALVA 5ALHA 5IS2A 4YCNA 4Y2PA 2WF6A 5ALOA 2P9JA 3QU4A 3MMZA 5AI9A 3U7EB 5AVRA 3QYPA 4HGNA 2G0AA 3ZWKA 4DWOA 2ZBEA 4DW8A 4RETA 1Z4OA 3ZX4A 2FPSA 3L0CA 1RMQA 1L6RA 4YIHA 2PR7A 1T5SA 2HX1A 5AVYA 2P11A 3AR2A 5AKIA 4EX6A 3W5BA 5AVXA 3I1YA 4NABA 4HGRA 1L7OA 2G09A 3WK4A 1U2SA 3W5DA 3SHQA 5AW3A 2JAWA 3UMCA 2YY6A 4O8CA 4KN8A
chains in the Genus database with same CATH superfamily
1WF3A 3L7LA 2QN9A 4J7AA 3U6BA 3UGJA 5DCWA 5I7HA 3EGXB 1XVAA 4M7OA 2OPHA 3EX7C 1HUZA 1TMYA 3U5ZB 4AY2A 3NBKA 1TEXA 3QV1A 4ENRA 5BMVB 3STTA 4QRIA 3WAKA 5LFAA 5LP1A 4Y1EA 3NWBA 2H3EA 1YA8A 3DMFA 5TVGA 2HTEA 1TW3A 1IXZA 4DIBA 3QBDA 3VRHA 4QA9A 3L8DA 1Z0UA 5FTKA 3OCYA 3KAKA 3G0GA 1CDOA 4HK4A 4YQEA 3GVPA 1VI5A 4QPPA 4ECUA 4OQEA 3LX8A 5BN4A 4UE2A 1QIKA 1WU7A 1W1UA 1O89A 5KNCH 4EBFA 5IEBA 1OYVA 4M49A 2G6BA 1C2YA 2VBIA 1E94E 1U2EA 5ALDA 2ZAGA 4RU1A 5BQPA 2YW9A 1GRRA 2LZ0A 4YI3A 4QT4A 5JS8A 1HDGO 3G9TA 2XV1A 4NJMB 4XTRA 2R1TB 4KLHA 3Q87B 4QXAA 5EZYB 2PX0A 4AL4A 5ARBA 1Z2EA 2GN8A 3AR4A 3PQEA 3M0EA 3RC7A 4ZQFA 4CIXA 1U7OA 1NHGA 1OZ0A 4LY6A 4XWTA 5CMLA 3UKOA 1Z26A 2B98A 2QMUA 4CQNA 1UQUA 1NKCA 1M8FA 1WXWA 2VQFB 1E7MA 2P9YA 2HOIA 4TRJA 2NN3C 1DIAA 4FBTA 2XBUA 2XDQB 1TK0A 3QF4A 1DQYA 2DUNA 2HSGA 3EPGA 1YHYA 4PGYA 2B69A 2DWCA 2GYWA 4HFRA 4NJEB 4TVKA 4IIGA 3DMHA 3W2TA 2J5KA 2W2LA 4EAAA 8ICAA 2VDPB 4Y2XA 1VKJA 2Z3WA 3JCZA 3TAXA 1RNLA 5P21A 4YDQA 5FPHA 4PRZA 1IK6A 4WESA 4CCYB 2X1VA 3RR2A 4ZVOA 1SXJB 2V0GA 2ORWA 1PL7A 3WGMA 1NVTA 2Z2ZA 5EWLA 4HF7A 4EY5A 4F5QA 2YCLA 2PT5A 1ZD8A 1C2TA 4ACAA 1G3RA 4L3VA 2Y1JA 4U5QA 3VX4A 5BUCA 5ILOA 2JG3A 2FR0A 2EW2A 4HGOA 4I4TA 4GHWA 2W2TA 4XWWA 1ES9A 2K7FA 1HE3A 1LWNA 1EWTA 5HMMA 4QARA 2XYVA 4LVUA 1F48A 1K2VN 1T35A 2H06A 3SQDA 4G0UA 5IABA 1PK3A 1KYXA 3QPWA 4RQAA 2WYOA 2X9GA 2Q6IA 4UAWA 1W59A 1RBMA 4X84A 4ZREA 4DW8A 3CRMA 1RYHA 2XC9A 3EC2A 1LDNA 2O8BA 3NKLA 3IKJA 4BZPA 1W4BA 2DR3A 5DRTA 3VGPA 4JJ8A 2FQXA 2HMTA 1DX4A 5SY4A 2QHXA 4DSLA 2X6RA 2PZJA 3QW4B 3R6DA 3CLUD 2WTBA 1SBYA 3ZHUA 4EVSA 2XCPA 2VI5A 4LF9B 4BN0A 1E7QA 4M6WA 3JVEA 2IX9A 2Q6LA 4GC6A 1DIHA 4MUXA 4I5EA 1UJ2A 4FZLA 4JKOA 4ZAZA 1ZPDA 3RC3A 1YTLA 2YV3A 1WP4A 2A5JA 5TLSA 1NUUA 5FNZA 5CDSA 3GLFB 3NORA 1NBWB 3M8SA 3SV3A 4ENSA 1TV9A 4YAOA 2CMGA 2HWUA 1F3LA 7AT1A 2FJ6A 4L15A 4LVCA 1RMTA 2VDNB 3K9FC 1KZ9A 3UW3A 3W3ZB 4YLYA 1NY5A 1ZQZA 1X7XB 1YMQA 2EHJA 2SHKA 3A1NA 3EVGA 3WYBA 3U39A 3VOAA 4UXIA 4UFOA 4AUKA 4O5OA 1XJ0A 1RM5A 3OT1A 3GAZA 3UFBA 2XNSA 4CM6A 2JHAA 1TTQB 3KOMA 5F52A 3HFGA 3RSCA 4DSEA 3WLIA 1JFFB 2PXAA 1MX3A 2C2EA 3LLUA 4PLHA 1DDIA 3ETGA 1ZJWA 5I9NA 3L1UA 3N0XA 1TM1E 3RIGA 2JH7A 3EZXA 3WZ2A 1E7YA 4C05A 4MW2A 3DP7A 4I4NA 4IF4A 1R16A 4AWAA 5IJ9B 1SBQA 5IF3A 3RF9A 1YJQA 4PR0A 3A04A 4LCBA 3I1IA 4RDCA 1UXKA 3N8KA 3FDIA 2NTNA 1MTOA 2YXDA 4R8LA 3QQPA 5IT4A 3M3PA 1NBEA 2Z4TA 1FUEA 3DE1X 2P3QA 1K5HA 3TOVA 5DYTA 1WCWA 2WSMA 4X1IA 4FYVA 5H2FU 4YRGA 2RHLA 1ZK1A 1Q6ZA 2OM2A 1NKVA 4OF4A 4RZSA 1SK9A 1NR1A 2ZDGA 1YB2A 5AM3A 2E89A 3R3HA 2QAGB 1BNCA 1SH7A 1I4OA 4EHDA 1QVZA 1WBJB 1C4OA 3SZRA 4PX5A 4AP9A 3R9KA 4NXNB 3IKLA 1TCUA 4ND6A 4US9A 4B9LA 4YUVA 1U5BA 2HXYA 2EAPA 2GH1A 2D00A 4DJJA 1VA4A 2QR5A 4GPAA 3LYHA 4UU0A 1GQOA 2NRWA 4PZOA 5DYYA 2ZAMA 3PCRB 1QP4A 1NZPA 3OF2A 1PVOA 3HDJA 2KZMA 1NVMB 1QG2A 2H8GA 3DR5A 3MGAA 4Z9AA 5B55A 2Q5HA 2M32A 1L4EA 3AY6A 3PE4A 1J07A 3DDUA 3MVEA 4RVDA 2H9IA 2GEDA 2EIXA 3RUHA 1HL7A 2OG1A 1E1KA 3HJCA 4KUEA 5AM5A 4OXQA 1W4CA 5GIOE 1C80A 2NXNA 2AJBA 2M6RA 4HNAA 1Q7TA 4MUFA 1B8OA 3TLZA 1HY3A 4HDMA 1N5KA 1XCPA 4H4DA 3FMIA 1NSYA 5DCUA 3KQOA 1UM9A 4L4SA 4EW1A 3I5XA 4DB4A 4A82A 3SX4A 1JDNA 1S4MA 1XJWA 5KL8B 1U65A 2I87A 1NE7A 2AMVA 1JFRA 2VR1A 1Z7WA 2REBA 2XUPA 3E7WA 4OHWA 3WNBA 3IBFA 1MAWA 4X20A 2P79A 2QUAA 3WYAA 5EJ5A 3H2ZA 3AXSA 3WFJA 4GU5A 1ZGAA 1A9TA 3H6KA 1SUCA 2Q99A 4IIHA 3WL3A 1VL6A 2R4QA 1X40A 4P7GA 3KZVA 3S55A 5IIJA 1GYRA 4S0ZA 1NXXA 3AB8A 3D7MA 3R7NA 5J4VA 1N6NA 4B74A 5C7IO 1GTSA 4GICA 2DUYA 3G2HA 1DRGA 1E1RA 1PEDA 5BSHA 1XZJA 2CSXA 1PYOA 2FW7A 4IVRA 2ERXA 2OWOA 2ECKA 4W99A 3ND9A 4HGYA 4JJGA 1P72A 4N6GA 1M6NA 4F8RA 2HDOA 3LVVA 4Z6CA 3SJUA 3KD3A 1ISFA 3DEHA 5HUHA 4NFHA 3T54A 1K89A 1Q21A 3BX1A 3C5GA 4FT2A 4HTFB 4OAOA 1WV1A 4ZQBA 1C9MA 3HKDB 1PSWA 1R1DA 3OICA 5B1HA 3M8KA 3FAKA 3HB5X 4O3MA 4RF5A 2L0XA 3KWJA 4M0LA 1M75A 3SJZA 2EAMA 5KT2A 1MT3A 4NWIA 4EQZA 1CT9A 5JH7A 1YJ5A 2ATXA 4P84A 2R7MA 4QIWC 1R0RE 3OO1A 3PGLA 3DLBA 1TE2A 2EJWA 1P8JA 3RBVA 3D8NA 2RAUA 3H11A 2H57A 2GCEA 4G86A 4NBNA 4R64A 3PFIA 3T9DA 2NO5A 1DZ3A 4YUWA 3M6VA 5KNDH 1HLGA 2BE7A 4MYCA 2NQ2C 3L7KA 2VXBA 2EBFX 4UEKA 4K9SA 2X1LA 2YFYA 1T3ZA 4BQEA 4DKJA 3GA5A 1A2QA 3KK0A 3I04A 4M86A 4OM8A 4RELA 1QIHA 4F2GA 1GPH1 4IX9A 5LB2A 3T12A 9ICWA 3OTWA 4AZTA 2C5EA 4DZRA 2NXWA 4ZHQB 3FCEA 5JZBA 1NJFA 1G5IA 3AFHA 4OQNA 5GZ1A 3GG9A 4YRMA 4G6ZA 3AWDA 4CTKA 3NU1A 3THYB 4F5ZA 1AQIA 4WNYA 2VT2A 5ARCA 1Q3VA 5IUJC 3BOSA 4JUDX 2JZOA 2QTGA 2YMLA 4P7KA 2VRWA 4EA6A 1S2NA 3QU7A 3PR4A 4MR8A 5A6SA 5GOZA 4JDUA 1GUAA 3V7WA 4GMXA 5CH5A 2F2AB 3BWMA 1WMFA 4K9RA 5GOTA 3TW4A 4MX8A 2ZB3A 4JNCA 4A23A 1BNPA 4AKEA 2DETA 3TK1A 2ATEA 2EIHA 5JIBA 1T0BA 5DTMA 2NRVA 4Q34A 3N2YA 1FX1A 5DGXA 4FI3C 4BUJA 4FMDB 3PQ2A 2J6TA 1DOHA 3OKCA 2BUAA 4G23A 3BXZA 1SNYA 4ILKA 3GN2A 4YAWA 2GB4A 1UBTS 2WJVA 2AX3A 1E9CA 1Z3EB 1WB4A 4P6VF 2RE8A 1ONBA 5ALJA 2ZAOA 3KZXA 5JQGA 4U6PA 1TYEB 2EWWA 2X8AA 4FVTA 1SD2A 1S0VA 3IP3A 2P2YA 2WKWA 1PNRA 3FWHA 2MSDB 4WLVA 5I8PA 4UXHA 2VQSA 3K73O 3AHIA 2CL7X 4P98A 1EVEA 4WNCA 3L6CA 3TZKA 4DSUA 1ZQDA 4O59O 1E2KA 1N6PA 1PJ2A 3LOQA 3JVUA 2WAAA 1H4TA 1DTEA 2HFKA 5LBIA 4UASA 3FF1A 4ZCPA 1OT5A 2AFIA 2WSSA 2QRGA 4OFWA 3HYTA 4HCJA 4JQSA 1PT5A 2C9MA 3G9UA 5LU8A 1EESA 3R74A 1OHHD 4I5FA 1A98A 1JQLB 4D4MA 3JVVA 1W7AA 1XNQB 1Q1BA 4D9FA 3AQFA 3N6XA 1USIA 1DK2A 3HHPA 4E31A 4DQIA 3GV0A 4YRLA 5ICMA 3I5YA 2YX1A 4CFYA 1FFUA 5J5VA 3HKZF 5ITWA 1OMOA 4KXQA 5EP1A 3NVZA 4MKXA 5BW6B 1JJFA 2GYYA 3I6QA 1JFSA 2VKQA 3FGZA 1R18A 4I99A 4NPHA 1R3UA 3C6KA 5D1HA 3SLKA 3L1HA 1OXUA 3TI7A 2DERA 5TSDA 3AQ4A 2ZUBA 1M76A 3SS9X 5FA6A 3TDKA 3HXMA 1VM6A 3S8EA 1ECLA 1RTTA 2KZ3A 1K9VF 3ZNQA 3KL4A 2PWAA 2AGPA 1RXVA 3MTAA 4U00A 2RD2A 2YY7A 1D1PA 4HDQB 2YN0A 3BXHA 4G9EA 5B7GA 4LK2A 2ACVA 4ACOA 2HSZA 4Z4HA 1S2LA 4YLEA 4RHEA 4DG5A 2FJUA 4KKXB 5CYFA 5GJCA 2A14A 3TR5A 4XRRA 2G7ZA 1UKCA 1A4UA 1V0JA 2Q3JA 2WJ4A 4GXQA 2DBQA 4EZ6A 4E94A 2IZOA 5B2EA 5HXAA 3E8SA 4EF4A 5ICFA 4YX9A 3LD9A 4IJQA 1PD1A 2XCUA 1GGFA 2YJ4A 3ZHXA 2RGWA 4FQ5A 3GCDA 3CRVA 4GL2A 5C2JB 4QOHA 4DMLA 4KW7A 2VAVA 2YUIA 2IMWP 4NOKA 3C3BA 4S24A 3BFXA 2MJLA 4N5HX 5CWRA 1J25A 4MIKA 2HEGA 3I4LA 5B1EA 4NF2A 4BNYA 2BISA 1FNBA 3E7XA 3VVMA 5KO2A 1NOKA 1NVUQ 2JPDA 4WJZA 2X19A 3EPIA 4BS9A 4ZTZB 4BRUA 4L75A 1IK4A 2GSDA 2Y1IA 3ZTYA 1OYWA 4JROA 1MQ9A 1TYZA 3T1HB 3EEYA 3OE7D 4IWYA 1G7SA 3NRBA 2IZ6A 3IP4B 3PNKA 1XTVA 5IDVA 5JMTA 3S81A 1LPAB 2HXGA 2V0CA 3R3SA 5F2NA 3RSHA 4YP3A 2LM4A 1USUA 4XQ8A 4UBOA 1Z18A 1U0JA 1FLAA 2FPMA 4FCCA 3BZBA 4QXMA 1NXOA 4MW7A 2ZW9A 2P5UA 5HK9A 3CNNA 2ERYA 3OP4A 4LBZA 4CKWB 3S27A 4OFBA 4FYYA 2KSOB 1LDEA 3BHNA 1KI8A 2GBCA 3FSEA 4KVFA 4AJPA 5CBKA 5TT1A 4KPUA 4MWZA 1KO4A 3V4LA 1FIQA 4BRWA 4ZAGA 4ABYA 3PT5A 1NF3A 1U0LA 3BCRA 3EWAA 4HG2A 4BVEA 2IYUA 4ZO4A 4CV1A 1U8CB 3ZV5A 5BOVA 1HQKA 7ICHA 3A10A 4MPDA 1P6QA 1YV9A 2CLIB 2A0FA 1VJDA 3N6VA 4B6SA 5JD6A 4ZWNA 2WB2A 2GETA 3DEIA 2CK3D 1YJ8A 2D5BA 3HUDA 4IDFA 4HD8A 4RACA 2C8LA 4FEEA 4MWSA 3IAS6 4UB2A 4OXRA 5KFYA 1I0ZA 4WZAB 4YRFA 4EI2A 1ZHFA 2ODNA 2HF9A 1JEJA 3UW1A 3RJGA 1KNQA 1Y3HA 4IIBA 3ZV7A 4HNUA 4E46A 3SLRA 5KMGB 1C8BA 2GK6A 3A1VA 3FMGA 1L7AA 4DXAA 1T9AA 5KFUA 2EKPA 3TGPA 3GLHE 3KU4A 5E3IA 3UWKA 1L4FA 1Q5PA 1DV1A 2XD4A 2GZHA 4GUAA 3KB1A 4OU4A 4P2BA 3W05A 2WHQA 1CJKC 1FMLA 5T4HA 1Z38A 3AHEA 3MCTA 3BBLA 4AC9A 1IXYA 4ALKA 4U5XA 1RCFA 4NH4A 2WF6A 4NCHA 1K8QA 3MLBA 5TQ0B 4DEVA 4HNTA 1UMBA 4CU5A 3QLJA 2MR6A 3MTDA 3QYPA 3L1KA 4W5HA 5KFHA 1Q22A 1PZMA 3K1AA 5DW3A 3UB3A 3ZWVA 2R1VB 5B2FA 4YECA 2J4FA 5JQGB 4B7ZA 5A5DA 3ABSB 3T9BA 1C0EA 2QRLA 2CJFA 1ORIA 3L8CA 3ZWBA 2ZT6A 1TK2A 2CCKA 3I2GA 3DO8A 5G4KB 4DLNA 4UOEA 1U8EA 2RHJA 3ER6A 4M9JA 3R0ZA 2YZ7A 2VF7A 2J3DA 4YXFA 4U7WA 1R27A 1E1CA 2WHXA 3DVAA 3SDBA 5L3ZA 2R79A 4HGRA 3W9BA 5C1BA 3RJFA 4YMTA 3GGDA 3HRHA 5JCOC 3H9UA 3LW7A 3OFVA 4KN8A 3EPJA 1R7RA 4RWEA 1SUFA 3T3MB 3TRIA 3ZH9B 5FH9A 1DIRA 3GZTB 4JUIA 5J2BA 2CVZA 4EJ2A 4M9ZA 4ON9A 1WCNA 3UGKA 3W9SA 3AILA 3QWHA 4G3IA 1V7PC 1L7PA 1L3IA 2R9VA 4TPKA 1T8EA 4UE6A 4RQ3A 3F3KA 4C2AA 4CDNA 1SVOA 5JRTA 2VDWB 3MABA 3I9V6 2CF6A 4V39A 2KLHA 5DLFA 1V5FA 1UBRS 3PV8A 2IITA 3D8RA 4ZCSA 3X1DA 4ZIRA 1QCDA 5CA0F 5AVVA 2YZGA 1A97A 3WAGA 4JI2B 3OZEA 4OI0A 2YZKA 1S2MA 2E5WA 1WBBA 4EJSB 2Q0HA 2D5IA 3E18A 1VMEA 2ZUUA 3IR5A 4FKBA 4GBJA 5IPFA 4BV2A 5IT0A 2ZULA 2UYCA 3ZUGA 3E0XA 3ZTWA 3C41J 4C7JA 4BZQA 1PD0A 2H5XA 5EE5B 3RTGA 3R6LA 5J5AA 5BQOA 2OOSA 4ED1A 1DT3A 1OD6A 3BILA 1EEXB 3DONA 2YV5A 4AXBA 4C03A 3BS5A 3GGPA 1W29A 1X2BA 2AC2A 1HDYA 1ZK0A 2G1JA 4NBKA 3W6UA 4DA0A 2HHSA 3OU7A 1SG6A 2MA1A 1H5QA 3OZGA 3LY5A 4B43A 1YC2A 8ICYA 2Y05A 3I9LA 3W8DA 3WGZA 3RKSA 3LS2A 1VYTA 4NZZA 3EVBA 3IPRA 4UUOA 1YZTA 2CWWA 4UAJA 4XX0A 2F1IA 3IUYA 4IFIA 1PSZA 5KKNB 3BQ1A 3SAJA 4Z7NB 3CLSD 1YCFA 2OHVA 1LFAA 1DAGA 1J9GA 4MQMA 1EQ2A 2KIVA 1H2YA 1Z0JA 2OC9A 4RFLA 3H5WA 3H9EO 4KFSA 2DL0A 4XA8A 4CHTA 1M2KA 2JIZA 1BMQA 3JQ8B 2CHUA 3AP3A 1FFXA 1RQ7A 3HXPA 4TMFA 3EVEA 1MAUA 4EZ9A 1EKXA 1OC4A 4I46A 1L8LA 4KXYA 1T6XA 4OGKA 4WZAA 4D0SA 3KD2A 2Z6QA 2ZQ5A 1PF7E 2R65A 1D6NA 1KS2A 5EXDA 4RQTA 1OR8A 3VU0A 1UJBA 1AX9A 1P4AA 4HDCA 2CXRA 4LDJA 3ZGLA 5BV0A 3ZQJA 3WLAA 1GOTA 5C9ZA 1V9CA 1X1SA 3HYRA 1Z33A 5E1MA 4N7MA 4U7JA 2BM0A 5CD1A 4BO9A 1G9XA 2DU8A 3GNSA 1B93A 1G8HA 3FSJX 4A26A 1DRUA 1OC2A 4M1WA 5ECYA 2F8MA 3R8CA 2ZXUA 1X19A 2WVJA 2CFRA 3HNOA 5JO0A 2BGIA 2J9XB 4NPCA 5T3UA 2E85A 4U7DA 3TJZA 5PGMA 5IEJA 4NLLA 1JECA 3EXG1 1ZIPA 2O5RA 3VYRB 4PBRA 1CNEA 1Z7EA 3DT6A 5DISB 3DT8A 3WVNA 2QE6A 4HUTA 2EDUA 4YMHA 7ICIA 3G5LA 3ZWCA 3DTNA 3IEIA 4WOCA 8ICXA 4S35A 3GWGA 4G65A 1NU8A 2XGOA 2JVKA 2WAQC 3T38A 3WZMA 1FVFA 2GGSA 2VHEA 3Q8XB 2H1SA 1B2RA 3KYJB 4RL4A 4FS1A 5LZ9A 4HKTA 2B5WA 1P73A 5I9TA 3RYFB 5LL6P 3OFJA 1QR6A 1N0VC 3FRJA 3V7NA 4F6RB 4KR6A 4P5EA 2WYHA 1UK9A 3S7ZA 2E8PA 1FU7A 1KARA 1X8KA 1NW6A 2RGNA 1RI3A 3KTAA 2ZTCA 4GS5A 2G9QA 1EUCB 2ZBFA 1JR6A 1FRNA 1OWPA 1U98A 2JZCA 2R8BA 3HGTA 1GSHA 3CJTA 2VSOA 2BFBA 3A6GA 5EPOA 5F1PA 4RHYA 5T14A 4C21A 1T4DA 1K7FB 5COBA 3JPTA 1IM8A 1BQEA 1LJ8A 1WPGA 3EZYA 3NC0C 1AKMA 4NIMA 1X3SA 4RFSB 4UVEA 3QM1A 4B82A 4HP8A 4HYTA 1STOA 3C23A 3G3EA 3NAQA 4ND2A 4OV6B 5E3JA 4AS3A 2A35A 2O8EA 5KG7A 2AI2A 2XCIA 3GEDA 5EWJB 4BYGA 5IXJA 1YWGO 2IY8A 2JFUA 2Q4EA 4AJ1A 1N36B 3VU3A 4NV3A 4P32A 1IAVA 4JSYA 2BKVA 5D5PA 2ATIA 4XQ9A 1WY5A 3K2QA 5ARDA 2B1RA 3C1TA 5HDQA 4NE7A 1Q1QA 4P3OA 5TNXA 3X1WA 4CM3A 3R75A 3MFHA 3KPUA 1EM8A 3FFBA 5TPZA 1N77A 2QR2A 2F1OA 2R7AA 4MEJA 3WKAA 3OEYA 1WY7A 3UG6A 1P2FA 3VYWA 4CFZA 3THXA 3OH8A 2B4TO 5G3YA 2OE2A 3HBNA 1OFHA 1KPIA 4JLAA 4Y8VA 5FL7A 2I33A 4WAUA 2QM7A 2RHOA 5DBHX 2H2DA 3DEEA 3CGWA 3SZUA 2BGRA 1J1IA 5JVDB 1V6AA 1OV6A 1Z07A 3HP4A 1P61B 4MKZA 2J3QA 3LCRA 3B8HA 4L3WA 3MGVA 1JXEA 1EDEA 3ZPXA 4CV2A 4DLRA 2BM1A 1L1EA 3CNQS 2YMMA 3N2ZB 2OCKA 3CT6A 3JPYA 5EIBD 4EVRA 2IA5A 4JKYA 4K87A 4O2BA 2PJRA 2Q7XA 3FFXA 3ENVA 1O4WA 2CYBA 1A2OA 2ORED 2RC6A 1R64A 2VH2A 2IBMA 3B1VA 3EFHA 4BFWA 4OGLA 4IIFA 1L5MA 4LHYA 5T6MA 1Z68A 1YUMA 4OB8A 1FC0A 2C5LA 4DY4A 4BVGA 2VP3A 4TL6A 3TADC 4OJ5A 3OSNA 4YR9A 1YQXA 4CTNA 1HDRA 2JIBA 3EGIA 3L7DA 2FLNA 4TWBA 3TE7A 3DXZA 3L8ZA 5AJUA 2VRNA 2I54A 3K75D 3N86A 4F4KA 3N2IA 2QMYA 2JFQA 2YTUA 3DOCA 2JZBB 3I2FA 4OJPA 2YY5A 4Q16A 1ZYQA 4RX1A 3RV4A 3FH0A 3NIWA 2YWDA 4R2XA 2DQNB 2JIPA 1ZRHA 1VECA 1LF0A 3BBPA 4DMCA 3A9SA 4RVUA 1GT6A 4PNEA 5DBBA 2VZ8A 2YJ5A 2PRIA 1FP1D 4L5JA 2QY6A 1XAJA 2Y4NA 1JA0A 2XE7A 3EIXA 3OOHA 4IEEA 1BPEA 1EFUA 4C3ZA 4BNFA 3WE7A 5KREA 1BS2A 4RL6A 3JAWA 2YXEA 3GV7B 3MSCA 1UJNA 4RA6A 4J4BA 3U7JA 4M9UA 1BU5A 4ME6A 2FSUA 4IV8A 2ALJA 3GL9A 5AJHA 1RYMA 3H2BA 4UHCA 2X14A 1PX0A 4FNAA 4D99A 2QP3A 3M6XA 1B76A 2RH4A 4E4TA 4EA7A 4A92A 3PEVA 3OZAA 4NYMR 1QP7A 2PAAA 3GJ0A 3R3JA 1Q0PA 4YY3B 2UYOA 3BIFA 5J2GA 2JEZA 1HT2E 3OJLA 4TL9A 1ZUNA 2CNKA 2Y9UA 3JD4A 1EDOA 2RP5A 2VG8A 1JQ5A 2K87A 2H5IA 3P0EA 3EA0A 1EB9A 5KFXA 4YO8A 1RBYA 4WZAE 5EA2A 3V1YA 2VSQA 1YI1A 2WSLA 4KAFA 4DS4A 3PEUA 4TM8A 3PWSA 3NHMA 4NCXA 3UCEA 2C7QA 4KX3A 1KRWA 5BWCA 2I4MA 1ISIA 2JDIA 2Z95A 3KVYA 4DCNA 3K5PA 1RQRA 3JPWA 4Z0HO 1KQPA 2P4QA 4KCGA 1QFYA 2PMFA 4B0PA 4F4XA 4FJ2A 2H18A 4B5LA 1D8YA 2I34A 1DKLA 5DBGA 2J7PD 5C5IA 3M6UA 2O1WA 3MGCA 4BMVA 1TLFA 2VK8A 4XM2A 3SIWA 1UMDA 5EESA 5CM2Z 3SDZA 1ZMXA 3QJGA 3OEEA 4WCFA 4ERXA 1GPJA 4UMFA 5H3LA 1K2WA 4XVHA 3R4CA 4ZOLF 4MR8B 3NCTA 4E03A 4MUMA 1X38A 4QWEA 2PBRA 2FY8A 4MZDA 8ICUA 3TLAA 5BMVA 3U09A 5AJTA 4QUAA 2Y27A 1VG9B 5THQA 1YB1A 4KLAA 3IODA 1XKQA 2OKGA 4P0PA 1Y3AA 3V1NA 1P1KA 4Z0TA 1DPFA 3NVVA 2FR8A 2ZYWX 1P6XA 3CSDA 3CNLA 3HKEA 4NAUA 1EUDB 2EBWA 5DDMA 4MKHA 1HTTA 5FLEX 2WF7A 3S70A 3OP1A 4MH0R 4CKYA 4Q7QA 1T9BA 1OTYA 2NACA 3C16C 1NNUA 2WP0A 3LUHA 4BZXA 4EUFA 3O31A 4TYWA 1TQ2A 2GRAA 3JTEA 4IHAA 2FFHA 5DQIA 2RHWA 4GNKA 4H7FA 1T5TA 4I6GA 5F21A 2IYRA 2BLNA 1Z0ZA 1SKSA 2DWPA 2IU4A 2VP9A 2VPWA 4XI9A 1JALA 5G4KA 4WFQA 3AU2A 1JJIA 5SY9A 4BLTA 3IR6A 1SU7A 3PENA 4FSHA 4GUDA 4UMDA 2WD9A 3LHDA 3UENA 1YCDA 3O03A 1E2FA 4FGJA 3OU2A 1C1XB 1U2ZA 1C8LA 3K0HA 4KITB 3OG9A 1NSFA 4WCVA 1L5OA 2PZGA 5JZOA 2CE2X 1CUYA 3AT1A 4J16A 1M2EA 1AG9A 4KRXA 1HGXA 3RAPR 1P9RA 3BXOA 5C5EA 5CB8A 3CWZA 3DSRA 5DG8A 3I9V1 1HKUA 4NU8X 2IYYA 3AK4A 3BD6A 3JAKA 3KQWA 3NJ8A 3K1RB 3EMDA 4RF3A 4TUYA 5EMLA 2CMFA 3TAUA 3C8DA 2HHUA 5AXDA 2R6JA 3P2JA 1VSUA 4ENQA 2BR4A 2XMSA 3A37A 3RU7A 1Z5VA 1Z8NA 2YXNA 2VDOB 1Y5NA 2QTMA 2ZIWB 4LJ7A 2KZZA 2P5SA 3FDXA 4JC4A 1E4OA 4WLFA 1E1LA 1NC1A 3HXOA 1PW5A 1FMJA 2OWDA 3Q2IA 4G0VA 5G1NA 1TYAE 4ZJYA 1GHTA 3VM6A 1PG2A 3JYOA 1DJPA 4PBSA 1K3TA 1QDLB 5H4GA 1Z00B 2C9ZA 4XSVA 1FYFA 1DKPA 4BV9A 4YCMA 1R0ZA 4PSKA 1ANKA 4OI4A 2NU9A 3HXLA 2FAXA 2Q4RA 4FBLA 1F1BA 5LUBA 5HJ5A 4N41A 1U8YA 1SCBA 3QZ8A 3PUHA 3AEUB 1YCHA 5FHQA 4CLRB 4XGIA 4K88A 8MHTA 3RI3A 3TQOA 2N42A 3GH1A 4ETMA 1JW9B 3LY8A 4G4JA 2OHJA 4G0ZA 4OYYA 1MF7A 3HJRA 3ZZ1A 1Y1PA 1ZY2A 2HBYA 1VTKA 1MV8A 2ZJBA 3A9CA 3LP8A 1H38A 2AXNA 1K6XA 1ID1A 1X0VA 3ADPA 4HRAA 4L50A 3WB2A 3VTFA 1CRLA 4MUHA 4G5FA 4LHWA 4RO0A 4ZVUA 1CJSA 4DR5B 3N2KB 3OQ1A 2JH9A 5J8YC 3ZUPA 1ISPA 4UB4A 2GVDC 4HUQB 2HZBA 1XJQA 2TRSB 5CX1B 5LZ5A 4LOKA 3OOWA 3KLBA 4F4UA 1E3QA 2IKQA 1G5FA 1KBZA 3HCFA 4RADA 3S5JA 4KQHA 1DGJA 2AFHA 1XTKA 4D2IA 2BHLA 4U7PB 1X7ZB 2RGCA 1NURA 4JH0A 5JSFA 4R8UB 3WBFA 1CY6A 3EXHA 5KOHB 2R7NA 3PSHA 4ZXFA 2JEFA 3OE5A 4IV5A 4Q47A 4QYIB 4D9BA 4YT4A 4O1IA 1ESEA 3ISDA 1EVLA 4F11A 1CY0A 4GRIA 4KK3A 4G8DA 3D1VA 1QX4A 1QFSA 2A86A 1C7ZA 2QQ5A 2VEOA 3EZ7A 4ITVA 3N5CA 4FKZA 5EFZA 4YYEA 3FPFA 4ID9A 5HZKA 2QQFA 1I3LA 4GMGA 2NP6A 2PGXA 1Q8KA 2RKBA 3MBKA 4ZO9A 1C7JA 4FYWA 5EVCA 1WZUA 2YYYA 2CC2A 3U3KA 1NJXA 2ONYA 3FJOA 5IMSA 2IS2A 1SKWA 2ZAIA 2GRJA 1Z0DA 3AP2A 3NTXA 2KPOA 4MA4A 1LBEA 3R5TA 4OKNA 5LNK1 2VAWA 2B94A 1ZSNA 1THZA 1G2OA 3BFPA 3MSXA 1DFIA 2QXUA 2QVLA 5A5EA 4Q7JB 4JLUA 1G41A 1GA4A 2YYSA 4I9UA 1AXGA 1JQKA 3NBFA 3PVZA 4PQFA 4QU5A 5TY0A 4AD8A 1S7CA 3PD0A 1G66A 2X7JA 4RGYA 3DLCA 4IMRA 3OQNA 5GVRA 5KIAA 4E5SA 1GR1A 2GF2A 4JOBA 2JFWA 1ORTA 1X7XA 3TDNA 3QVGA 5CURA 4OXNA 5K0BA 1W4RA 1MJGM 2Y99A 1NI5A 2ZSHA 3UV7A 2G4CA 1XRNA 1L9XA 1P4JA 3PPVA 2F9FA 2ATVA 1F2DA 5KFGA 3HCNA 1W47A 1PO7A 4QL3A 1GZUA 4B8WA 1M34B 1MO2A 2NXEA 3K0EA 4JLSA 2X8BA 3UICA 3COPA 4Y6RA 2V7QD 3HXTA 1HIWA 3PV0A 3L0PA 5DGIA 3V9PA 2R18A 4L8LA 1T26A 2FHPA 2ZJ0A 2FK8A 4HNGA 4QXRA 1KTIA 2QD4A 4B6FA 2AXEA 1U6IA 2TMDA 1I1OA 2B6HA 4YCBA 3K0CC 4V0ME 4MVJD 2C3UA 1ZI9A 1X1DA 2K7ZA 2OLEA 9ICUA 2XNHA 3FPHA 3M6WA 3O1HB 4Y2PA 1R9MA 3BWEA 3IQEA 4QYMA 3G2OA 5CR0A 1JA9A 1RQPA 2ZJ8A 3DE3X 3U7IA 4DLYA 5JRJA 1JTVA 4G56A 3UPTA 2VBGA 3Q3IA 1O87A 1D6SA 2G0AA 4TV9F 2PSHA 2O6KA 3F9IA 1RXUA 1YULA 3AU6A 4TLMB 1UBGA 3K31A 5BORA 4UHJA 1FFSA 5DNYB 5KYYB 1PJQA 3DEAA 1WMBA 1QBKC 4TKUA 4AUEA 5HUQA 5BV8A 3HDQA 4HYQA 1BFUA 2LMRA 1A50B 1V9SA 4Z3OA 2B7LA 3EG9B 3B6MA 1P39A 4CUJA 3ZIDA 2JIRA 2OCPA 3HPRA 4EKYA 2A1JB 1PJTA 2QVYX 4PRYA 5I8WA 4DR1B 4E5KA 3CSUA 1SL2A 4P81A 2FWNA 3UMCA 1UBSB 2FU5C 4PCLA 2V7VA 2GOYA 1Z8DA 4RTNA 2X5XA 2O2ZA 1JZQA 2DT5A 4UHBA 5KYWA 4FHFA 4C3OB 1V11A 4QU8A 1YDWA 4JBYA 5CH8A 2G1UA 4GF5A 1M10A 3ONDA 4WN9A 4ZANA 4KXMA 4Q01A 5JRDS 1YKFA 1WULS 3O92A 5JSUA 1GPAA 2PK3A 2CXNA 3A06A 1SD1A 3OQVA 3P20A 4JU9A 1F8FA 4LVOA 4PYIA 4QD3A 5KAPA 2I6XA 4MPRA 2MCFA 2R97A 4N5LA 4N48A 1QU3A 1I01A 1C1DB 1LPNA 1VL5A 4IM7A 4ZGWA 4BNUA 5TZVA 2ZG6A 1J99A 2ZRCA 2ZXFA 3C6YA 3QBTA 4BNMA 4KQJA 2D1YA 3BE5A 5ESDA 4E11A 2DPXA 4YAJA 2PH3A 3CZQA 3S44A 2X2EA 2ZT7A 2FW0A 2M0NA 4XVUA 3AOGA 3K5IA 4EL5A 4TWZA 3WFIA 3WIVA 3UBTA 4IDOA 1XNRB 4YFKA 2ZTHA 5FBQB 3RG2A 3Q7SA 5JFOA 4QYTA 1RC8A 3IB3A 3PY8A 2WPDD 4KN4A 2GZMA 4DL4A 4FDUA 4G84A 2KN7A 4GYYA 4W8OA 3PW2A 2VXOA 3O8NA 4Y3UA 3KYDB 5KTPA 4M8IA 1WB6A 3ZJYA 2V55B 3TLGA 2QD1A 3C97A 3AW9A 3Q0IA 4B3FX 3THXB 3B5EA 2GWRA 3GLHB 3IIKA 4HRXA 3RJZA 1V16A 3UZUA 4D9KA 1K97A 3NATA 5CBPB 2Y1DA 2D4HA 2C42A 5HCIA 2Q5EA 2RGYA 2JK1A 1O6BA 1NV8A 3IUJA 4B4DA 2PZFA 3C8UA 5KFBA 4MQ5A 1VI6A 4PVDA 2X9VA 4OL0A 2O19A 1N8KA 3PKJA 2ENUA 5LJLA 1TIBA 1YMUA 1KO5A 4LZDA 3ZWPA 1VL2A 3ETHA 3JTMA 3SIPA 2AR9A 4GL4A 4ALIA 3D3JA 1KQQA 4H35A 9ICFA 3SZOA 1SGWA 2B7BA 2M6SA 3NTRA 3OAAA 9ABPA 1XNGA 3FDSA 3ZDXB 2TSYB 3I3SR 1GZSA 3L01A 3CRNA 3HUTA 1H1LA 3PF9A 3PNPA 5AHKA 5FI1B 2M9MA 3RB6A 2Z9BA 2ERCA 2VLIA 3O2NA 2CJYA 5LLSA 1D6JA 1C7EA 3GN1A 1BDJA 2A3RA 4LUCA 2QT9A 2P1DA 4P0PB 2VEDA 3HN6A 3Q3VA 5L1KA 4NYMQ 1DI0A 5E1DA 3I9MA 2RHDA 2E49A 1XDGA 2NQ8A 4KQMA 4WI1A 3V2GA 1CZOA 4KQ9A 5A1TA 1YZ7A 4CCWA 4PHPA 1M74A 2EJBA 1NLUA 3JQBA 3UHAA 4Y6SA 5PNTA 2O8BB 1AUVA 7REQA 1QYDA 3ELBA 2HCJB 4ZIRB 1HSZA 3K8QA 3OE4A 4LDZA 4LS3A 4AY6A 1P7WA 1R74A 1NM5A 3BA6A 2P2ZA 1NWHA 4RUKA 3KVNA 4UUMA 2B6NA 3MHTA 5L53A 1C8VB 1NW4A 1WMEA 5D6NA 1Y81A 2B2XA 5IJ0A 3NHSA 4PFQA 4CL8A 4QZAA 4BFTA 4YREA 3ROXA 4DV7B 1SOMA 2ON6A 4CEIA 3HKCB 1PLKA 4RPZA 4G85A 3C1YA 1YOBA 2P91A 3AETB 4HYEA 4M46A 3QG5A 4RMJA 4F2PA 3D2SA 3FVVA 1BJKA 2I03A 3CX7A 3IILA 2OYCA 3UMVA 4RQBA 1OUMA 1R8JA 4PTZA 1SXDA 4UHDA 2CMKA 2O2XA 5HW0A 4BV8A 1GDTA 5CLJA 2MSCB 1PZGA 4F4YA 1IUKA 3C2LA 2WLSA 3EZNA 3K9NA 1M34A 1QOPB 1T6YA 3CLTC 5L4NA 1MAVA 4DQLA 5J4HA 4O4JA 1U9CA 1ZK2A 5DULA 3B0YA 2FP3A 3O1IC 1X39A 4K86A 4L28A 4C06A 4EG1A 1P75A 4QSHA 1BPXA 3H87A 1F5NA 1FTWA 3MBYA 1BS1A 4KUHA 1VPTA 1X1QA 4QBGB 1X8XA 4BO2A 3VC7A 2BY4A 1XTUA 2BEJA 3S1AB 3C70A 5D85A 3LYUA 4OVKA 2ZZKA 1SCUB 4LYJA 1H42A 2H1FA 2Q41A 1FFXB 5ECWA 1ZQNA 1UMCA 3JQ8A 3WLFA 1U99A 3P4XA 3TWOA 1IQUA 1KK0A 1T29A 2B3TA 1P5FA 3HCRA 4X6XA 4QLAA 2AK3A 4DYHA 5FOQA 2Y0SC 3QPBA 3CGGA 1F60A 1PFKA 4A10A 3VPDA 5BYAA 4JP1A 1EDBA 3AEZA 5FX2A 4JEIA 1DKNA 4Z86A 2QD2A 3ZDAA 4JEUA 4XYGA 5FO1A 4O3FA 4OH7A 3KLMX 1R9JA 3BB4A 3OT1B 4PHHA 4R2MA 4U3JA 1PKXA 4Q9IA 3FI0A 5JTIA 1W88B 2WTXA 4HZGA 3AUYA 2KM1A 3DYIA 5AW5A 3PFKA 1CJTC 5E7MA 1ZKMA 1Z0AA 4RQ6A 4RGQA 4CI9A 1AQLA 1NXWA 4IIYA 4NPAA 1A8HA 2HMSA 4QGSA 1CJCA 2HADA 3BJYA 3UJ7A 1NK4A 4YJFA 3R1IA 2CFIA 4IH9A 2EEZA 2YC4C 3FPEA 1YJBA 1O95A 4NL4H 4IMPA 3T3GA 5CNIA 1OJ7A 1DPGA 2EFJA 3NHUA 3ICEA 1SV0C 4IY1A 3R8XA 2CDNA 3L0IB 4TL7A 3OCJA 2EL7A 1YQTA 4I4TF 4HQOA 4Q3BA 4RKEA 5AM2A 2G67A 1FRVA 2JFHA 1YIAA 4KIUA 4GFDA 4DFJA 1G8GA 1C7YA 1EK1A 3GT0A 5CYOA 3RG8A 4LOLA 2R48A 3ZOKA 5B12A 5A0LA 3QHPA 4H6WA 4G25A 1E1QD 1KQ3A 1OPXA 3CYMA 1HDIA 2MYPA 1QS0B 3NJ4A 3NT5A 1Y3IA 2J9YB 3QI7A 3SNKA 4V1CB 1WDLA 3H17A 1E0DA 4I19A 3RYHB 5CA0B 3TIGA 2CB0A 5DNCA 3BQ0A 4PYNA 2WZCA 4OHOA 2EL9A 3B6ZA 3RK4A 1I1NA 3H2JA 2VQEB 1A1VA 1FTNA 1YQQA 1E2UA 3GZ4A 4Q8FA 3OA2A 1ZISA 4ZCRA 5A3QA 1IH8A 1ILWA 4COKA 5DBFA 4Z0NA 2FWMX 1SC9A 3L4PA 2HJHA 4DCJA 4EYIB 1Q0UA 1RPZA 3DM9B 3MIZA 1MJ5A 1OAAA 2XMRA 2BTQB 4MHOA 4OFZA 3WHPA 5BO5A 4E2XA 2J31A 4HVCA 3T5CA 5EHIA 2DCMA 4GQAA 3P0IA 3RS4A 1QYCA 3E5RA 1CJMA 3HUEA 2W6JD 4B9TA 3AF5A 4KBGA 3T7DA 5E4JA 4HQFA 3VC1A 3K0AA 5BOLA 2P9BA 3WKBA 3OZIA 1J0DA 2XCRB 3Q9UA 3EIOA 3G2QA 3N2NA 3T4XA 1R6TA 4DLAA 4EYEA 1E2BA 1MABB 1Z12A 4G9BA 2YBDA 5DIZA 4JEHA 1C7RA 4BE4A 4N54A 4OQ4A 4K6MA 2BJWA 1NUHA 2ZS9A 5D3QA 5GY7A 1JG6A 1W30A 1TU4A 5KTTA 5GTIU 4C78A 2IL1A 1EK6A 1ZXXA 2GHTA 3U48A 2FE9A 1GO3F 1RYSA 2P62A 1KEEB 3LUBA 3UYLA 5K0SA 3AFNA 5BXQC 5C52B 4ZARA 4OX9B 2LR0A 4OIMA 4F6RA 4BVAA 4DLEA 3WLQA 1M7HA 3OF5A 1N5WA 1S5LU 2C5AA 4DS3A 3R6WA 1OZGA 1KHTA 4Z6DA 3ILYA 1TPZA 4MYTA 1VLQA 4KMMA 1LW6E 2GEUA 3M9WA 2W71A 1TAQA 2XEXA 3R3WA 1G6HA 1PJSA 4RSRA 4CKCA 2OZLB 3EHDA 3ZJ4A 3EDYA 4U2FA 1YOVA 5KFOA 1DK3A 1JAYA 2GI4A 3BGOS 3K1YA 4GZ5A 4NFLA 1Z8FA 3GGCA 4I1IA 1ZJMA 4C4TA 1P0QA 1NN1A 1ZLXA 5KFEA 1E5LA 1GFIA 1TQHA 1ZUD1 2PS1A 2VP2A 3NAGA 5DG9A 1S10A 3B2QA 3CF4A 4L0MA 4J94A 4HQ0A 2XZLA 2IHMA 3ELDA 3A70A 2K4EA 3PXGA 4X45A 2YVLA 2R6FA 3I32A 5KFJA 2V5UA 3NVDA 2IZ7A 2QGNA 4NC9A 1XTBA 1WDMA 5DB6A 4QYWA 4KLJA 3SXUB 3CZRA 3KT3A 4BX0A 2AOUB 5CB6A 3KPWA 4KSYA 3BRSA 5DIFA 5FA8A 4PCVA 1XTIA 3A7DA 1ACMA 3FMFA 3SVZA 1UANA 2V6IA 2C4WA 1L7XA 3GGJA 1FFBA 1Y1QA 5JCJA 2WT9A 3I9OA 1HMPA 3LRXA 3OLZA 1JXLA 4YAGA 4ZGGA 4ND7A 2XRMA 1TM3E 3DCNA 2ZROA 2WHYA 4J16C 2PPLA 3RRBA 3U3RA 4TKUB 1T4CB 5JC8A 3BD9A 2XVXA 1CDDA 5DE3A 1I3NA 2SKCA 2W48A 4RABA 4UKDA 2V1UA 1XWFA 2G70A 3K15A 1PT6A 3K70B 3TZLA 4YEDA 4RK0A 3TXYA 3FTDA 4X7RA 1IBMB 2WABA 1RXSA 3RVQA 3IO5A 4CR8A 3AMZA 3AI2A 2KTQA 3K0KA 1I1QB 3QXSA 3B1XA 5L45A 1OXBB 4RS3A 1XKXA 3GDOA 4E7OA 4V1CA 1JIHA 4YVZA 5HJ7A 3T94A 1NULA 4QNLA 1NYTA 1QTIA 5DQGA 2GUGA 3M5WA 4KIWA 2TMYA 4WT7A 4OLHA 4YP9A 4UARA 1LPSA 1L1FA 3MFIA 2ECFA 4TQRA 1AZLA 5KCMA 5T4EA 4OX9Y 4IXTA 2ZRJA 4EUHA 3MHPA 3I5MA 3OPXA 5TQ0A 5B4VA 5FV4A 1OGJA 2V7XA 3MUFA 5JZSA 1MCZA 2Y71A 2ZUTA 2G63A 1RYYA 3IUMA 4PZEA 4C29A 1C3OA 4Y1RB 3AUSA 1DIGA 3SYZA 2QRNA 3FGOA 3JRNA 3SXJA 3HJEA 1KJ9A 2DB3A 3RKUA 4DQKA 1Z16A 1WCYA 2CKDA 2WSSD 4X7PA 3GB9A 2W2LD 4H3VA 4YAKA 2BP7B 4JAVC 1JFVA 1JHXA 5L1MA 1G8MA 1NUSA 4I66A 3UH1A 1FTGA 1T8SA 3TXAA 3PX6A 4UUNA 1X9HA 3DZIA 3DAYA 3FTEA 5EMJA 3EVNA 1GILA 3D3NA 3WV4A 4LF8B 1ZJZA 4C2TA 3IUPA 3SYMA 1JH9A 4B80A 1E2JA 4DY6A 4BASA 2E1FA 3T3IA 1ZOIA 4GYKA 4JZKA 3UWMA 3DVQX 5EHXA 3AH8A 3IEVA 1TCVA 2HJSA 3X0DA 1WO8A 2OUIA 2BE9A 3X1MA 5EWEA 2FZ5A 5K4AA 3OIWA 1Q11A 5IKXA 1YVRA 2I2BA 2W2VA 1XEXA 3H5OA 4ETIA 5KFTA 1RAEA 1X1AA 2YHBA 1AIPA 2CVHA 3S8YA 3OLWA 3VC8A 4ICAA 3LCCA 3KEGA 4OHZA 2J3HA 4XDGA 2Q4DA 3O3OB 4KPEC 2YV4A 3FCXA 4Z0PA 4JV1A 1WB5A 2KMDA 1PSDA 2QUIA 3LRTA 1CRWG 5EVJA 3U4HA 1S2OA 3NRJA 4CXMA 3KSBC 1GPLA 2WFLA 2YQ4A 3UJBA 4MPTA 5A9RA 5KTMA 1L6IA 5LZ4A 4QWDA 1BHJA 4RZIA 2E4XA 4DADA 4CM8B 5F7ZA 3T06B 3QUQA 1P1HA 1SXHA 4E1AA 1J23A 1RVV1 2R11A 4MRPA 3A4YA 4CKWA 5EEGA 1P7PA 4TMVA 1UM9B 2ZQZA 2B1GA 4RPYA 4R5HA 3K72B 1OI3A 3M5PA 3S1LA 1XU7A 4ZYYA 1L3UA 4M83A 3VA7A 3ZD7A 2HCTA 4G5XA 1L5FA 3JR3A 3AF1A 3BS4A 4OD0A 2AQ4A 1E8DA 1ITZA 1D0VA 1N2SA 2DTXA 3HY4A 3KZMA 4G0XA 3ZQ6A 3OZCA 2HD4A 4CDRA 4UQLA 2Z1MA 3Q2OA 5CUQA 4BQFA 1LB1B 1QLHA 3EISA 4DDHA 1CDEA 1A2KC 4N47A 1TC2A 7ICEA 3A28A 3C5WP 3L8YA 3EZ6A 4QZGA 3IVRA 3WLJA 1Z6XA 4RY9A 3STYA 4GH5A 1I7NA 1B6TA 4MWTA 5HS6A 2DQSA 3RHTA 3RJHA 5BOSB 4CL2A 4B2PA 3Q8PB 2ONCA 2R1ZA 2OO5A 3PR5B 2C1ZA 2Q5JA 3PBKA 3VR2D 4B81A 1MB2A 5MN4A 4MUIA 1IB6A 3LPAA 4MYRA 1JZTA 3UXYA 2H4ZA 3EFBA 4UTVA 1CF9A 1XRPA 2JW5A 4Q7EA 1E0KA 1ACJA 1H65A 2B5OA 3CVUA 4YJKA 5J3JA 2Q1TA 1L7RA 1AQ6A 1ESNA 2J6HA 3O8RA 4YJDA 4BO5A 1GPNA 4TV8B 3HRDD 3RRNA 4UCXA 2E8MA 5FI3A 4OCZA 4G1BA 1T7PA 1BJTA 5JAZA 2HPVA 2IZ1A 4XARA 2JGKA 4TRRA 1AU9A 2QPOA 3G8AA 5CD9A 1N3IA 2VZEA 1J33A 4DAEA 3I6MA 3USCS 2NMVA 1YZUA 4CIAA 4GLLA 1UR5A 5DHAA 3UOAB 5E6SA 2C2KA 2GZDA 4JENA 3T7JA 3GYGA 2F76X 4EY7A 1Z5GA 4QLOA 3EHEA 1W2WB 3EPKA 4QOGA 3OMXA 1N2CE 2VYVD 2K4PA 4X1KB 4RY8A 3H9CA 4YV7A 1DUSA 1NK0A 5HKKD 2NPOA 5IBRA 2B1JA 1U2GC 4YS6A 4CPDA 3LHIA 3B20A 4P86A 3ENNA 3UWPA 5KSYA 1T1SA 3DH0A 5I51A 3A6PC 4HDNA 2H85A 2H48A 1IWPB 5IIOA 3M9NB 3LI2A 1LNSA 1FJ2A 4NOJA 4BFYA 1J0AA 1UAGA 3Q9LA 1P33A 3CR3C 3WLKX 3WWZA 1URPA 1MXFA 2O3QA 3S68A 4TXNA 2XWJI 3EH2A 4CMAA 3EVZA 1LC0A 4DSZA 3B6EA 2DGZA 1PK9A 3IBCA 2AT1A 1VIMA 1NJGA 4YHHB 4JJZA 1Q83A 3R0QA 3VHRA 1KRXA 4IHJF 1IZ7A 2XRYA 3ZVNA 3M6LA 1Z4OA 8ICRA 1G0OA 1XRRA 2GFIA 3HGQA 3L77A 1OBOA 4FFWA 4Y0NA 3ZYZA 5K45A 5LXTA 3L0CA 5BQXA 3QNWA 1U0BB 5HUJA 1T5SA 1YE5A 2PCJA 3HB7A 4C6HA 5ICCA 2Q2WA 2XB8A 1F6DA 5KOHA 5JXJA 2RGNC 2PFGA 4EY6A 4RTLA 1A5AB 2FH5B 3LX5A 4OBEA 4CN9A 1Z19A 1L7OA 1ZD9A 5DMHA 3BMOB 4K03A 4EMBA 2ZRHA 4ZCLA 2BT4A 3DHNA 1WD5A 3L46A 3WGJA 4I2JA 3NC1C 3PZPA 2IUUA 3O2JA 3KZNA 2OXCA 2W4QA 4NYJQ 1M73E 4NZPA 5GIPE 3EGWA 2C61A 2H08A 4FCWA 4GMKA 4KYTA 4EMUA 5B7PA 3GEHA 5KHOC 2ISPA 1RR6A 3PX4A 3X2EA 5HA5A 2Y68A 2REXB 4HRYA 3CZMA 2O54A 4JLJA 2VSFA 1EFPB 3QTTA 3L06A 3IQWA 5I45A 2O1SA 5F33A 3DEZA 4TKLA 5AESA 1XQVA 2W6IA 4WCFC 5INTA 5F77A 4U63A 3JPRA 3OIFA 1P3JA 2HRCA 3H5VA 4XX0B 1IWOA 2XNDA 4KTVE 4YASA 1UPAA 3IR7A 3SKXA 3H5AA 2ZJ4A 3VO9A 1MEEA 4J1TA 4BWYA 4KBFA 2AG6A 1N0IA 1A5BB 3TQHA 1I6MA 2FG5A 3A1CA 1R66A 4J3JA 4UM7A 5B3KA 2P65A 4C20A 3DOJA 3S99A 4LFBB 3KHKA 3RS9A 3U7RA 2X8WA 3RD5A 1WQ1R 1M6VA 5K9ZA 2PUDA 1AD2A 1Z4LA 2PT7A 1WXXA 1UCVA 4HNHA 1PK7A 4KLLA 1QHXA 4DT1B 5IX8A 2GLXA 2OV8A 3GV8B 3PHGA 3NUQA 3B0XA 4K40A 1MIOA 2C84A 2J59A 4REMA 5EZYA 3P9ZA 1GKUB 1L1RA 1MQ8B 4Y30A 3RBXA 1JDBC 5C8ZA 3D2CA 4CMIB 4QJ3A 2FDXA 3WL6A 5IAJA 2QUKA 1W5TA 3RABA 1VJTA 1WSBA 4L95C 3VPXA 3TQSA 5BURA 4F12A 5HR6A 1F8YA 3I92A 5FBWB 2ECPA 1LI7A 1KETA 2E4ZA 3UTCA 1FJXA 3L7MA 3T35A 1BVHA 3HM2A 1FUYB 3RJ5A 4M60A 3AMVA 5COQA 1Z73A 1U1GA 1XF1A 4RUCA 3B70A 3L4JA 1W0KD 3CUTA 3NM5A 2QARB 1GFWA 3H9BA 5AK4A 4R9NA 3SXPA 3A9VA 4CRXA 5F9LA 1NM5C 1V4BA 4F2WA 5JSHA 1F2UB 4EY4A 3AEYA 1XQYA 1KWKA 2VUUA 1MQ2A 3ESYA 5EJ9A 5EIFA 2FETA 4J9OA 1UWVA 2F17A 3BK2A 3LLCA 3QIVA 3WLRA 4N12A 1PS9A 1S8FA 4A6EA 1RWVA 1W8IA 3GIMA 1BXRA 1RYZA 2PRYA 1J42A 1Y7IA 4W63A 1WG8A 4USAA 1JXOA 3C6BA 3KBOA 5F35A 5LQUA 3X3HA 2O8DB 3RUFA 3LNTA 4K2HA 2FHSA 2E87A 2WMNB 2RHMA 1BMTA 1PLLA 1OU4A 2C4HA 3LKBA 4BFXA 2DTDA 3RIXA 2UUAB 1KFTA 4L0QA 2WIFA 2EOAA 2H3QA 5KFWA 4ZZ0A 1NLMA 2B99A 4HDMB 4O0LA 3E5HA 3UF0A 4BNGA 2OC4A 3OZSA 1NI3A 4UUQA 5GVSA 2PGOA 2QN3A 4HH0A 1UFKA 1KKLA 2WF8A 1NJZA 1YONA 3HI6A 1DG3A 2X76A 4QHSA 4YO7A 5AKLA 1Q46A 3VSAA 3WZLA 5AI8A 2YNMC 3T5MA 3N58A 1G3MA 2WFAA 1MFPA 1OLXA 3TRJA 1LDMA 2QB0B 1IE3A 2POQX 3O9VA 3UA3A 1KTQA 3QBEA 4JX8A 4HLDA 4OJNA 1V38A 3SGLA 4CEHB 2NAFA 5B2ZA 4QM6A 2RBGA 3U4DA 4D4HA 4M1QA 2PMBA 4EW2A 4XB1A 3SEZA 1PL0A 2ET6A 2GCIA 2NG1A 3PWZA 1UPCA 1YBAA 3M6AA 5U4XA 4C30A 4HDNB 1HR0B 1TO1E 3VMMA 2FDCA 2B4QA 4KACA 4OEHA 4P54A 4ZN6A 2H17A 1DIOB 2V5VA 5TF0A 4WWHA 5HMLA 1XYYA 1IPFA 3AHDA 2HMYB 2WU4A 4WXMA 5FUMA 1ECWA 1PGQA 2XTNA 3LBAA 4PFSA 1BXZA 4YCDA 1OH8A 1ZNYA 1CUUA 3RBEA 2JKVA 2GN1A 3H42B 3ACBA 2BGLA 1Q7GA 4JLBA 4I3HA 1KRHA 1V96A 3ENQA 3KU1A 3JSXA 1IN7A 4LDAA 4OL9A 4RVCA 5HDBB 2O2IA 4QHYA 2FCRA 3AUXA 2BTOA 2WNHA 4RJTA 5KQGA 2PY6A 4P2HA 2QN2A 4EEYA 2CPRA 4RA9B 4DM3A 4KRGA 1AN0A 4F3NA 1QTMA 1PW7A 5FP0A 2HA4A 3F49S 4N5MA 2RJNA 3ND8A 1EFAA 1Y8ZA 1YS7A 2WJZB 4LVNA 3IM1A 1CG6A 1YIOA 4Z3DA 2AJ8A 4BX9C 1N6LA 1JI3A 1N75A 2X2FA 2I1LA 2W3SA 3EEFA 4TQSA 1OJLA 3CR8A 3M6FA 3AVUA 3SKYA 4B9VA 1G8AA 2F1HA 3DKVA 4M9SA 3FTNA 3IVCA 3JAWB 1TQ8A 4Q8EA 4HDKA 2A88A 3SYRA 4HH4A 1ZQGA 4HMPA 4U7FA 4UEJA 2QVBA 1E58A 2R66A 4TSRA 3LWDA 2J48A 2CT8A 1SBZA 4MI3A 5EMNA 2I6GA 2IIBA 3U4IA 2W6PA 3MAAC 1T3QA 1FFAA 1I4TD 3JWIA 3P2YA 4AM8A 2ESEA 1M0TA 2VA9A 1OAOC 1JBKA 5GAJA 4H6XA 1SIBE 1SBHA 2NTJA 1XZBA 2E4UA 3MRSA 3WDMA 2YYZA 1D8AA 1ZZEA 3MPOA 4D5EA 5I7RA 2R6GA 2RB5A 4AUNA 2FWAA 1DJMA 4MQLA 1XL0A 1QNLA 4WRRA 2COEA 2I7CA 4R9UC 4JI6B 4CEJB 4RIGA 1A7AA 2OAGA 3ADOA 1WXEA 1YZFA 2EQAA 2C3YA 1PV2A 2WD7B 1XQ6A 4LBVA 3QYFA 3SJ7A 3QY9A 1LBHA 1U4OA 1ZGZA 1C14A 3GJ4A 4EHKA 5J2UF 4Q1EA 1PZNA 4L27A 2O5VA 4G01B 5BPHA 3PD1A 4CKZA 2EDAA 3RQIA 3HCCA 2C2XA 3AEUA 3GOHA 4YRJA 4IZIA 4UPDA 3ZCTA 4OLAA 1H2FA 2JVIA 1BDMA 2V74B 2WJAA 1PR6A 2FSVC 3PQ4A 3V33A 3MS2A 3VPSA 2BC9A 3G1WA 3TF5A 1I6WA 2UVPB 2JJ1D 1SC1A 5AW1A 2H07A 2VPXA 3D8BA 5E4FA 3A4IA 1QFMA 1PQYA 4P0QB 1U8FO 3K0CA 1PGPA 4GI1A 4WKOA 2OCDA 2D1QA 4LJYA 1IRXA 3NDJA 1EVYA 4J0EA 4RKWA 3KVOA 4IDQA 4OO1J 1XTTA 5BRAA 3U4GA 1QP0A 4GKVA 1JX4A 4KN6A 2HWXA 3GJ8A 4U8HA 4X8MA 3TVTA 2G8NA 1KMHA 1IFXA 4UUAA 2VNHA 2EAOA 2Q1SA 1UDXA 1G20A 1AO3A 2YWEA 1SGGA 3G88A 3NHRA 2W54A 1J6UA 1KFBB 1Y7HA 3D8TA 3FROA 4OOEA 4QULA 1MN8A 5AJVB 3AYZB 4EA9A 4U39A 1AF4A 1POWA 4BNDB 3O94A 4TOIA 5LOVF 2XYPA 5JWRA 3LUGA 5C0YA 1XSEA 4O2BF 2D6FA 4Q39A 1IATA 3P52A 1SXJC 1MA0A 3P9SA 4AG6A 4CMBA 3GIDA 4J1TC 2D1TA 3TAQA 3HYCA 5ES4B 3OEHA 4NJEA 3RH5A 1NVVQ 4L8FA 4P4GA 1P81A 2EJVA 1NU6A 3TAPA 3OLXA 5SZHB 3NV7A 3DZCA 2EFGA 5D7NA 4E21A 4ER6A 4EW3A 5KHLB 3DHVA 3GLFA 2NXCA 1GPKA 1ZQSA 4XIGS 3N7SC 5ICSA 4GRDA 2I91A 4H1WA 3ROEA 2CCGA 1NXVA 4YRCA 4EFNA 2Y1OA 5AK0A 5KDLA 3JYPA 1LSUA 1Q1AA 2R6DA 1OY1A 3F90A 3EZFA 5BQ3A 1JSZA 1JHAA 1SKQA 3QPUA 1H2AS 3MINA 4JXJA 5FBVB 5CB0A 9ICMA 1R6BX 2O8VA 1DINA 4MS3A 1MHPA 3A58B 4P4UA 5KUTA 4B31A 4M47A 1AGYA 3TLKA 2XBLA 1IUNA 4HV4A 4HWSA 4M76B 2BEUB 1FP6A 1Q44A 4OQFA 4FB4A 1E9AA 2JS7A 2DF4B 3MR2A 1R0BA 3W5IA 1FUKA 2K8AA 1WEKA 2DX7A 3AYXB 4AG5A 5AD1A 1EXWA 4HPWA 5HF6A 1Y4AE 4FFDA 1G3QA 2WAYA 4O5KA 4G1MB 4M99A 4E33A 3JQPA 3R7AA 3F67A 1YZVA 2DWUA 1RYNA 3ABRB 4YFYA 3G6YA 1BVSA 1Y3CE 4UJ3A 3ZK8A 5KU1A 3LGSA 4L5YA 4UMEA 1Q15A 1W73A 1Y1LA 4IQFA 3WBJA 1RP7A 2CVQA 2D2VA 3TI0A 3E9MA 3EF0A 4FW9A 4IIEA 3RAFC 4HWTA 2AOVA 3B6KA 2BAGA 3PFWO 5DN6A 1P1RA 2WJPA 1H22A 5G02A 4EG0A 2F43B 4GKBA 3QFRA 2CXPA 2A94A 2AS0A 4FBMA 3R5HA 1KSGA 2W8BB 1AUOA 3NX4A 3P26A 4CF6A 3N3BC 2ZTMA 2I4OA 4NRDA 4PQEA 2HF2A 5L95A 3RFUA 1RI4A 2GF9A 2GPAA 3Q10A 1GG5A 5L1LA 3R09A 3TW8B 5C4GB 1SUIA 4I14A 2BSXA 3LP5A 4IIUA 3LQYA 4I2VA 4CFSA 2OLKA 4CKBB 3MGKA 3LCVB 1HDCA 2LBOA 4Z6EA 3BAFA 3FY4A 3HSSA 2ZTEA 3SD7A 1ECGA 3GCXA 3A0RB 3MR3A 1U7ZA 3D4PA 4R6XA 5BSFA 8ADHA 3G49A 4E4RA 1Q3KA 2ZRIA 3CH6A 2Q2QA 3AJEA 4OGWA 4I1VA 1RYRA 1ECCA 3S8MA 2WWRA 1QV6A 3RR7A 1YOVB 2O7SA 2ZR0A 4RF2A 3UB4A 4C5BA 4XCXA 4G5OA 1YT5A 1KZYC 4D9EA 3F0TA 4O2BB 1TJ4A 3MBOA 1U9JA 3UOWA 1L2TA 1KAEA 3NETA 4JEMA 4TMTA 1ENZA 1JNXX 1C4XA 1D5CA 2C4UA 2QVZX 4C4OA 1ILEA 2QT1A 5F9HA 3PC3A 2VJ4A 1H9AA 5JEEA 2NO0A 2W0MA 3WIOA 1NZDA 4FUTA 2Y66A 2C9OA 1G20B 1I2ZA 1HNZB 4B6QA 4FIDA 3IBSA 1CB7A 1OGIA 4O3PA 4BCCA 2ADMA 2CNLA 3ZCPA 2W55A 4ED0A 1ETHA 2QTTA 2A9JA 4Y9TA 5A7GA 2QQ0A 4BVFA 1KWGA 1TVKB 1DCKA 2HDWA 3ROPA 1FW6A 3AIMA 1CUDA 2FN4A 2OEHA 3CUUA 1DE0A 3BH6A 4MHVA 4NLZA 1WABA 4P0QA 3N07A 1EFKA 3NWPA 2G4LA 2HMVA 3UCXA 3RVMA 3MR5A 4JDPA 1KI7A 3IAFA 1I4DD 2GPNA 1ADBA 3GRKA 3WBBA 3I8OA 3HP6A 3WP1B 2E21A 1UKYA 3K8YA 1GUZA 5H80A 8ICZA 2IP2A 4I2IA 1ZQTA 4WERA 2X0FA 5FOWA 5IDYA 4R63A 4DL7A 3TW6A 2CLDX 1VLBA 1LVHA 3TQ1A 4R2WA 1QP8A 1CUJA 2EATA 1J8FA 2XVTA 2QIOA 2RCYA 4OXYA 4Y6PA 2BI8A 1T36A 3STWA 3FZGA 3ZGYA 1O94D 4NEHB 1ZQRA 5EINA 3U44A 1OFTA 2AX4A 1XU4A 1DCFA 2PUFA 3TH5A 1KMCA 4EHHA 1EXVA 3ENWA 1TYBE 1MGOA 5KVVA 2HM7A 3FTQA 4X3CA 3G9QA 5EE3A 4OO3A 4BP3A 1R5NA 5AW2A 2J08A 4GOOD 2W70A 5CM8B 3KZIU 3TANA 1DMSA 3PUJA 1TT5A 4BRSA 1WBDA 2RLTA 1XELA 5LIRA 2GRUA 3EIHA 5LDDC 3KQUA 1GGJA 5DLPA 1SEVA 4BLUA 5IHXA 1LQUA 1V37A 4F5DA 1TJYA 1D2GA 1HZJA 4AJEA 1Q92A 4I8XA 2IKSA 2PGIA 3KB8A 4BE9A 1VG1A 5KNLA 3SOPA 1N3BA 3FZQA 1KFDA 1LRLA 2ROQA 3PITA 1DRWA 5CX1A 2ZXIA 1SK8A 2X8LA 1RM6C 5F5LA 4DABA 3WQRA 4ARAA 1GTL1 4B3IA 1EU1A 3ASVA 2XUHA 1UDCA 4Z3KA 3IH5A 4GX2A 3VVBA 3H4TA 5KSWB 4EHLA 1LBQA 4FGWA 3TZHA 1SG9A 3FNBA 3HZOA 4EG4A 3KPVA 1UP4A 1QG4A 1NTOA 4JB3A 1KYWA 1MB0A 1ZIXA 2WLTA 1GV0A 2GO1A 3A31A 3KKEA 4FXOA 4JR0A 5KFMA 1DKUA 4YV2A 5I7VA 3FBGA 1IQRA 1CJBA 3FD8A 4DNPA 3FPLA 5AKYA 2XXAB 2QZSA 2C5HA 3PQ3A 4ERNA 5JU6A 1E8NA 1A76A 3F4LA 3GRCA 4IGFA 5LQDA 4Q9KA 4A3SA 3LHSA 3KVVA 4WKPA 3V5NA 3UC5A 5CCBA 2I9KA 5ALXA 2VJMB 2X4LA 4TSKA 2GERA 5FPYA 5A7HA 4BEJA 4C6TB 2QKYA 5F23A 4QKQA 1T3TA 5GM1A 1ZM3A 1GPUA 3AOEC 3G2IA 3OE7A 5LA6B 2FOXA 4YP6A 3WK8A 3RU3A 4ES6A 1URJA 2RI6A 5KX5B 4JR2A 3TRDA 2XRFA 3LL7A 4LBYA 1N5DA 4MQEB 3H1FA 3UNXA 1WRBA 1H94A 2WVHA 1L7MA 4HZUA 5E8RA 5DNVA 3TIFA 4KIJA 4PHGA 4Z4CA 4Q7MB 4GLOA 2JKYA 4CG1A 3V1TC 3IG5A 4E0BA 3D0RA 2D74A 5A3RA 4BX8A 5CPFA 1WB9A 4BGDA 4JMLA 4QQKA 4X3PA 4YRBA 5M5BA 2HSWA 4KR0A 3JZFA 3ZCRA 3AHHA 5EP2A 1N8TA 1WKBA 3FCCA 4ZC8A 2DPYA 5KINB 1NW5A 4NKRA 2YIDA 1F9EA 3I0NA 3BK7A 4XGRA 1D04A 4J0FA 4MKIA 4EQ6A 1VYUA 1SKYB 3CEJA 4DOAA 5BXYA 9ICNA 1S2GA 3PC8C 4CLOA 1GFZA 5KG2A 3U7EB 3WQBA 2BGUA 4QPJC 2O7NA 4F7DA 3ETLA 1IZ8A 3H83A 1TKAA 2FYTA 1BWPA 5IK2A 3SAFA 2J1LA 1VSVA 2JV3A 2J3MA 3P4YA 3ZX4A 2ZSAA 3DTVD 2CL6X 2J09A 4XDYA 1ZQVA 1RHMA 3H99A 5TRTA 2OXIA 1VCHA 4DV2B 5HCNA 1VCOA 2E6KA 2PR7A 1ZVJA 1A3CA 3PW0A 3K6JA 2W2MA 1U7WA 3A6HA 3N0WA 4Y6QA 2VRCA 4ZVVA 3AUKA 4MS1A 2PGNA 1WNFA 2FFQA 2ZU6A 4RE6A 3O5AA 4D6PA 2BH9A 1XVUA 4R1OA 3SPXA 2O5CA 4O3OA 2JAWA 3QWIA 4K2AA 4DSIA 4E51A 4EAQA 2JZNA 2VPZA 3TVYA 3GUVA 2CFTA 3DQQA 4IGKA 5P8WA 1KDZA 4BWGA 2PWZA 4CDGA 5KFFA 2FEMA 3JYLA 3KSRA 3IRUA 4FX2A 1G5RA 5KVSA 3FUTA 1R0LA 5EWLB 2AEMA 4L72A 4DAOA 1SZDA 1YK1A 2MTBA 5D7BA 1GNRA 5H82A 4YXWA 3VZQA 4EHFA 2JGDB 4XYMA 4RNOA 4F04A 1QKIA 1JG3A 1EFLA 1H0HA 1RXEA 3K92A 1NVXQ 4X1YA 2OQVA 2XA1A 1Z06A 3IUEA 4KLSA 3O82A 4PZ0A 2D2EA 1XKTA 3OA0A 4X24A 2YWRA 3KIPA 4KZKA 5F3RA 2BFEB 5KNIA 3LKDA 4MICA 3UATA 1RHUA 3STVA 1NQUA 2CE7A 1QH8B 4JWNA 2UZAA 1FFWA 4X6YA 4XWGA 4R83A 1CUCA 3GJ3A 1NK6A 2Y9MB 2IBTA 4EBEA 1IC6A 1YNSA 4R66A 2E6UX 3D54D 3O1LA 2AQKA 1BVRA 2FFAA 2ZEJA 4ASUA 4P58A 3ELUA 1Z36A 3BKXA 3ZV6A 3X1ZA 5A4MS 4H7KA 4G1EB 1VKHA 2WUEA 4DSKA 1DRKA 1W44A 4YRSA 4LGYA 5G0VA 2XZOA 1FFEA 4HUJA 1LY1A 2X42A 1O8BA 2ZIXA 3EB9A 4NDZA 3RJMA 4QIHA 1Q12A 4OJKA 3HBFA 1LBSA 2WMYA 1I7QB 1RABA 1XDBA 1Z83A 1S97A 2BBOA 2HU2A 4UVIA 2BTEA 2CLOB 1ZDMA 3C5VA 4PZDA 4C3VA 3TADA 4QE3A 1YDEA 3TCKA 2CMHA 5U1PA 4NBLA 4K6OA 1FXUA 1OLSA 4P35A 1EEHA 3RFTA 4ZOQI 1RIFA 1QH1A 1A04A 1RQLA 3HMKA 2BD0A 1RWQA 3JU3A 3LZ6A 1T34A 4MA0A 2BW0A 2BMVA 2OCXA 2WNSA 4MNTA 3U0BA 3L9WA 3BIWA 5B30A 2QZZA 2DFKB 1FDWA 4WIAA 1DRVA 2ZSDA 4MCAA 4R84A 3UTDA 3WGKA 5AIAA 4JCOA 1N9GA 3OY7A 4JQCA 2GPYA 4MARA 5ITVA 3OZ7A 4QJFB 1DWOA 3D6HA 4GZLA 5ADHA 3S7TA 5CFOA 1E9DA 1M72A 4RD2A 1KOLA 4GDFA 5JSYA 3EYWA 1U3UA 3OHSX 3WSWA 3INGA 5EWMB 3R3ZA 4Z2YA 1QZZA 2GKOA 3FPGA 1CWUA 2BFEA 3GLQA 5D86A 1NKEA 1U49A 1M7GA 3E2IA 1S5PA 2GHIA 4C8LA 2ONZA 1JLHA 3GHHA 4JJEA 4MP3A 4NEQA 5FFNA 5FWXA 3L84A 1J5PA 2PGLA 3BE8A 4PAMA 3T1TA 4EY3A 1S8OA 2X0NA 4J76A 2ID8A 3T1VA 3A6KA 4NK4A 2IXTA 2HBMA 1JROA 3RJTA 4Z1MD 2VK1A 5JALA 2RK4A 5A3SA 2GD6A 5F12A 4FOTA 5E4YA 2FPKA 2FLLA 5M34A 2O8CA 3GHYA 5DXFA 1KU0A 1UWCA 3TE6A 5FTWA 4BQSA 3PTLA 2FWBA 4TTJA 4ZJUA 5IJ0B 4FINA 4F9GA 1M0WA 4GI5A 2P4SA 1ZMBA 1XC9A 4GPTA 2JAOA 2O4UX 2G06A 4BTEA 3UMGA 1P3Y1 3EF3A 4OATA 1O5OA 4LJ8A 4I5IA 4QBKA 5EOZA 4DCSA 4KXVA 1U3GA 4G41A 5HK8A 3PP8A 2C98A 4QVIA 5DRYA 3R20A 1B4FA 4LV5B 2NLOA 1BMDA 3I2JA 4DR2B 4BX2A 1E89A 4KWCA 3V9AA 3SSOA 3UGTA 4RENA 2HJVA 3E4DA 1QWOA 3HVJA 1Y4DE 3IGFA 3PNMA 3THVA 2G71A 4IOMA 3I52A 1D07A 1IQPA 1K66A 3CV3A 1NUQA 1Z37A 3FPKA 3QF7A 4KLZA 5BMVF 5JS7A 3P2KA 2YQEA 3U7QA 3PXXA 4MFFA 3INRA 5KYGA 2CNWD 2CV2A 1P29A 3JZMA 3KAPA 5KTRA 3E0FA 2F67A 2QTAA 3ASYA 1R0WA 1TT7A 2ZIEA 2R96A 3PUZA 2C7VA 4U4AA 1ZLYA 4DMMA 5BR4A 2G5HB 5HYVA 4PG6A 1K08A 4B76A 3JWHA 3ZW8A 2CKMA 4KMOB 2WJGA 2WKSA 3WLMA 1XVTA 3F78A 2CZCA 4JKIA 5C1DA 5KTYA 2KSQA 5BPFA 2FUKA 2H7VA 1FNMA 1UOQA 1WZNA 2GNOA 4D8VA 1QQ6A 3FB1A 5K1ZA 2J6IA 3QLTA 5JSZA 3NBMA 1G3IA 4LZNA 2P6UA 1FVXA 3I37X 4TN1A 5JTTA 3C3AA 1U8UA 3H0LB 1EVJA 2BQUA 1JEEA 1LTHR 3NIDB 5U4QA 3RHSA 1VCMA 4AYBF 3WYGA 3FUWA 1W0CA 4BQOA 3LTEA 5NLLA 1T3GA 4DCCA 5I4BA 2QZJA 2NRXA 3LXRA 1N5OX 3V7FA 1C29B 4I50F 1PUJA 3S3TA 4BZZA 4EI9A 4EPTA 2ZM5A 1OWOA 3GARA 3MYRA 4M0KA 2QF7A 3SOZA 3DLHA 4YMLA 3OC6A 1JDTA 5C4IA 3DJYA 4O4JB 1FUIA 1RPLA 3LE8A 1CRPA 3UMYA 3BULA 4YFVA 2FEKA 3DO5A 5HRUA 4FR0A 1BCSA 2M1XA 3FNGA 4FYKA 1NOIA 3BXPA 4LWZA 2REQB 2OXRA 3E9QA 1HJPA 2BEVA 2E55A 3ROFA 3RRYA 2I2AA 4Z9XA 2KNJA 2W9AA 1CPYA 2CLSA 3PI7A 1MH9A 1ZI8A 4WA8A 4XM1A 4DLBA 3L04A 5ESRA 3EAFA 1EAMA 1O08A 1SA0A 1XE3A 2J9FB 1W46A 2WD8A 2ZI9A 4Q1DA 5FHRA 5BN1A 1AKUA 3V1MA 3JPPA 5CXXA 5IJAA 5J9FA 2DULA 4XJTA 1JSLA 2DG2A 4YRPA 3ZU6A 2XOKD 1QTQA 4ARVA 1G4AE 1DAMA 2QE7D 2G7MC 4JUAA 3TEMA 3W5HA 4BP8A 3I12A 4BN4A 3T7EA 4ZVTA 1VPEA 4IF6A 2I1QA 1A7JA 1V43A 5DZSA 3CVWA 1EE9A 4YDRA 4QZBA 4IH4A 3I28A 4Q4JB 5K0LA 1EFCA 8ICKA 1WUJS 5DG7A 4F5WA 5IKMA 1JFTA 4IDEA 5K20A 1F7VA 5TS3A 2KJQA 3NC4A 5TR9A 1RVDA 3F3MA 5EXXA