3K1ZA

Crystal structure of human haloacid dehalogenase-like hydrolase domain containing 3 (hdhd3)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
MRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
publication title Crystal Structure of Human Haloacid Dehalogenase-like Hydrolase Domain containing 3 (HDHD3)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 87
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.720 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3k1zA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3k1zA01
3OCUA 1TJ5A 2B1QA 4IG4A 3ZTYA 2WM8A 3I76A 3KC2A 4UMFA 3L0BA 3L8FA 4KX3A 5ALYA 3ZVLA 2B8JA 2B0CA 3U13A 5ALUA 5AKHA 2I34A 3N5KA 3RFUA 2JGAA 2GHQA 2I7DA 3NAMA 3ET4A 2WF7A 3P96A 2G08A 5AM4A 5AVZA 4YCNA 3W5AA 3W5CA 2OYCA 1QQ5A 3U7GA 5AKIA 5ALJA 2YMLA 4HGOA 3F9RA 4BBJA 1LVHA 3KBBA 3B8EA 1XVIA 3OCXA 5ALSA 4AS2A 3J7TA 3WK8A 3QUTA 4UARA 2W43A 1T5SA 3QU5A 1WPGA 4BEVA 3WK7A 1ZOLA 3DAOA 2BDEA 3QGMA 2X4DA 3AR9A 3B9BA 3SLRA 2IOFA 3OCYA 1EK1A 3D6JA 1L7MA 3DV9A 1TJ4A 2JAWA 1Z4LA 2IOFK 3AR3A 3FPBA 2G1AA 4BX2A 3U19A 2AUTA 2BY4A 2EATA 5AW5A 4HGPA 3FVVA 2B8EA 2R8YA 4YH1A 3ZX4A 4DCCA 4ZEVA 2MSNA 3ED5A 2WF8A 4EZEA 3N1UA 1IWOA 3WK5A 1U2TA 2BDUA 1L7NA 4Y2XA 2B1RA 3E81A 5ALNA 4NV0A 2ZOSA 4AS3A 3AR4A 1YMQA 4EX7A 4UW9A 2FUCA 5AI0A 2YMPA 4KN8A 3HYCA 4EEKA 3AR5A 3UMBA 4FE3A 3QYPA 3L0CA 2ZBFA 5AVUA 1RKQA 3ZX5A 2FPUA 1TA0A 1RKVA 2FEAA 3QU2A 2VKQA 3ZVMA 3SF0A 5IS2A 3ZWDA 5AK4A 4QJBA 5ALEA 3A1CA 3S6JA 3SMVA 4QQFA 4BKMA 1XP5A 1RLOA 1Z5GA 4B6JA 2IYEA 2C88A 4UASA 2JARA 3W5BA 5T41A 1Z4MA 3QLEA 4OHFA 4XE5A 1NF2A 4C4SA 1S8OA 5ALHA 3KOOA 1RPZA 3AR6A 4G63A 4Y2QA 1J8DA 4I9GA 3AR7A 1RMQA 3WGUA 2Q4TA 5AI4A 3WGVA 2HF7A 3M1YA 2W11A 5A3SA 4DWOA 2R8EA 1U2SA 3IJ5A 1SWVA 2YJ3A 2WFAA 3KZXA 4JB3A 3I1YA 3N8GA 4ZEXA 2RAVA 1XPJA 3NRJA 2C9MA 5AKJA 4H1WA 2P9JA 2PR7A 2R8ZA 4L57A 4J03A 2ZBGA 4PNHA 3QUBA 2P69A 5AIBA 3A3YA 5AESA 5AKYA 4L6CA 2HOQA 5AVYA 2I55A 3ZWKA 3NIWA 2G06A 4Y2JA 3WKCA 5ALGA 1RMTA 1WVIA 3R9KA 1O03A 2D2VA 1RC8A 3ZW7A 4CNQA 3W5DA 1Z4NA 3EWIA 4JDPA 2AH5A 2PKEA 3N28A 1ZD4A 1NNLA 4C4TA 3PGLA 5ALFA 2WHEA 2YJ4A 2CFTA 1YNSA 5ALTA 2P27A 2Q4RA 2YY6A 4NAVA 2IOHA 5AK3A 2NO5A 4Y3UA 4Y2RA 2I33A 2NO4A 1YJ5A 4FFDA 1RLMA 4G9BA 4Y2UA 2WF5A 3U7HB 2CN1A 4HGQA 5AIAA 1YS9A 4UMVA 5AKLA 2ZBEA 3HLTA 1QQ7A 1QYIA 3M9LA 2QLTA 4XOUA 3OCZA 3B9RA 1EK2A 1X42A 4BEWA 5AI8A 2C4NA 3IRUA 1ZD3A 1RMYA 4Y2SA 3L5KA 2CFRA 4XPZA 3RF6A 4YCMA 3OTQA 1VFPA 5AVTA 4C4RA 2FUEA 2OA0A 1Z88A 4HYTA 3CNHA 5AVVA 4CE6A 2ZBDA 2RARA 3PGVA 4YCLA 3BWVA 3BA6A 4BX3A 4CF3A 4I9FA 2FPWA 1RKUA 3OCVA 1ZD5A 3ESRA 1VJRA 4OD0A 1J97A 1SWWA 2AMYA 2AGVA 3SD7A 5IT4A 3EF0A 4UATA 2C8KA 4UAUA 2B82A 2PQ0A 4FYPA 1YDFA 4BNDB 2WF6A 3FZQA 1F5SA 4Y2TA 3R4CA 3E58A 5AKXA 4DW8A 3QX7A 3EF1A 3I28A 4AP9A 5ALPA 1ZD2P 2DQSA 2FPXA 2O9JA 1U7OA 3DNPA 4MUMA 5AW6A 2OM6A 2I6XA 1TE2A 3NANA 4CF4A 3UM9A 3L1UA 3MN1A 2I54A 1Z4OA 1QH9A 2HHLA 1K1EA 3AR8A 3NALA 3OPXA 3FPSA 5FP0A 4RETA 3ET5A 1YV9A 2HCFA 4HAIA 5A3RA 4F71A 5AVRA 1Z4QA 4UMDA 4NABA 3PCTA 5ALQA 3N07A 5AW9A 2GHTA 1RLTA 4UU0A 1L8OA 4XQ0A 5AK5A 1ZRNA 4RESA 3FM9A 3R09A 4ZEWA 4OCZA 5ALMA 3UMCA 2HX1A 4KNVA 4KNWA 2G07A 4YGYA 3ZVNA 3AR2A 1FEZA 2FPRA 4BYGA 1RDFA 5ALVA 2QYHA 2YN4A 5AW7A 5AM5A 2ZXEA 4O8CA 5AI5A 1L6RA 3U26A 2HO4A 5AM2A 4NFLA 3QU4A 1QQ6A 2IA5A 2HSZA 1CQZA 4KX5A 5ALZA 1S2OA 2W4MA 5ALXA 2HF2A 3QXGA 5AI9A 2NYVA 4EELA 3FGOA 5AW3A 3L8GA 4Y2YA 3L1VA 2WF9A 3CZ4A 2JAOA 4UMEA 1CR6A 2RBKA 5AI6A 1Q92A 1Y8AA 3KDPA 5AM0A 4UM7A 1U7PA 3EPRA 3MMZA 2EARA 2YJ5A 1O08A 2B30A 3KD3A 1JUDA 3VAYA 5AHXA 1L8LA 4IFTA 3I6BA 3ONNA 3L8HA 3SKYA 4UM5A 1AQ6A 5AM3A 1Z4PX 5ALOA 5A3QA 2OBBA 5AW2A 5ALDA 1T9ZA 4YIKA 3GYGA 4BNDA 1RQNA 5AKEA 3E8MA 2HEGA 1TJ3A 1U02A 4E88A 2P11A 2FDRA 3WKEA 3ZU6A 5AVQA 3PDWA 3ZTWA 3ESQA 3NUQA 2GO7A 5AICA 3U7EB 3WKDA 4UU1A 3ZUPA 5AKZA 2FPSA 5AW1A 4EX6A 4CF5A 4KYTA 1L7PA 1WR8A 2YMQA 5AVSA 3MC1A 3WK6A 3U7FB 3K1ZA 3SKXA 2ODAA 4GXTA 4UAVA 2CFSA 1RRCA 2G80A 2GMWA 1SU4A 2ZG6A 4EENA 4DFDA 1KYTA 1LTQA 5AVXA 5E0OA 1N9KA 4J2TA 3UMGA 4MWOA 4HGNA 3L0YA 4GIBA 5ALWA 3WK4A 3MPOA 1Z4JA 1NRWA 5ALRA 3E84A 3A1EA 2G09A 4YIHA 1VJ5A 3TLMA 1Z4IA 3QUCA 5ALLA 3WKAA 4NWIA 5ALKA 1WZCA 3QU7A 2RB5A 2YFYA 3ZI4A 4BX0A 3L7YA 3L8EA 2FI1A 2JAUA 5AW0A 4OFZA 2O2XA 2Q5EA 2YMMA 3NASA 1Z5UA 3A1DA 3DDHA 1Q91A 3WK9A 1PW5A 5AW4A 2R8XA 1L7OA 5AVWA 5JJBA 2YBDA 3QNMA 4Y2VA 2GFHA 5AK6A 2EAUA 4F72A 5AM1A 2MU1A 5IT0A 3QUQA 1RQLA 3SHQA 2G0AA 1Z4KA 2YJ6A 3WKBA 3QU9A 2C8LA 2HI0A 4HGRA 1ZJJA 5AKGA 1N8NA 1ZS9A 3IB6A 4Y2PA 5AW8A 1ZRMA 2HDOA 1MH9A 1T5TA 4L6AA 5AKKA 3OCWA 5ALIA
chains in the Genus database with same CATH superfamily
5DBHX 1FP6A 2BCSA 3U13A 4G1VA 5DTIA 4HFNA 4EO7A 4S05A 3NAMA 1G0OA 4WD3A 1RS0A 4NMHA 1DKUA 2WT9A 3DONA 1FVHA 5JJKA 3Q8QB 3N0VA 3IV9A 1YA4A 3D3WB 1S76D 4TMTA 3HI6A 1GZ7A 1LSUA 3MINA 3PHGA 3A6DA 2J30A 3A8TA 4HYYA 1L8AA 2G9ZA 1AQYA 3UXMA 5AI0A 4NONA 3TNYA 1EUZA 2B2NA 4XWYA 3IDAA 3QQPA 1PYGA 3K0SA 1EINA 4F4JA 4YFKA 2HMVA 4XTRA 3VC2A 3GV7B 2JFUA 3ANXA 4RK6A 4AG5A 3W5BA 2F43A 5FPTA 5T4BA 3RYFA 2PYZA 3V5NA 4LJ7A 1Y5MA 1UKBA 3PDUA 2ODNA 4OXRA 2XVXA 2WILA 4JC0A 4J0DA 3CWCA 1HFKA 4DMHA 3KT8A 5I8WA 1OXBB 5IIKA 4OQDA 4MVJE 2J85A 3I1YA 2P1ZA 5TMPA 5DN6D 5DBCA 3MGVA 1ZGCA 3VZDA 1MN8A 3R74A 3OFNA 3OMWA 3AUAA 1H2YA 5JTUA 1U7XA 2Y71A 2JI6A 5FKJA 3F0TA 2AZXA 4ZALA 3STTA 2XVYA 5CLIA 4YRQA 3FFTA 1VLJA 5CYOA 2AOUA 2BFMA 4LKOA 5TPZA 4I99A 5TS3A 5LLDA 2OY0A 1NONA 2ZBEA 2B20A 3CBGA 3QWFA 2RKBA 1G2IA 3GB9A 4XUGB 3GCZA 1C9JA 4KKVA 3PPXA 4R51A 4QU0A 3OTQA 3QOXA 3PK0A 3WBFA 3ZCRA 1N7IA 2ZBDA 3PGVA 2ZTLA 2I1QA 1F5NA 3BTSA 1K08A 1KO1A 2HQSA 1Y81A 4OD0A 4I3FA 2A9QA 4UATA 3VH1A 1P2TA 1PSDA 3B51X 1X40A 5MGNA 3WLJA 3SEAA 3FZQA 3PJRA 1KEJA 4F4HA 3RUCA 3F74A 3I5MA 2ODQA 4JZKA 4COOA 1L4BA 1BC5A 3YASA 4KK3A 1RWNA 2JHCA 3BFJA 5IAKA 2A33A 2J7PD 2GD1O 3LF2A 4P3KA 4PIVA 1LWOA 1IL0A 2QORA 3ZHQA 5FI0B 3O2JA 4RE5A 4UHFA 1B6TA 5JIBA 4P0TA 2HF8A 2ZLBA 1JIIA 2Z43A 3OECA 5C7IO 3RVKA 1PNQA 5KDDA 2VQ3A 4W9NA 3IVXA 1E3EA 2ZTHA 4QG7A 3ZWOA 2PDAA 4D3YA 5ALVA 1YB5A 4D9IA 5DEOA 4GRAA 1ZINA 4IUBS 5B53A 3I32A 2YJNA 1IOLA 1P6UA 2WICA 1DOHA 1UOEA 1K7YA 4ZVSA 3WL7A 1CXZA 2DPIA 2XRMA 4M89A 4UM7A 1QHSA 2EBFX 4CV2A 2F9MA 4J07A 2V74B 3JZDA 2ZYGA 1V11A 2X76A 1JXEA 4TZKA 1RLIA 1VJ0A 2WSMA 3NM5A 1WKBA 2OXIA 4OGLA 2D7CA 3WKEA 1K0UA 4R8KA 2RGWA 1G7RA 2FHSA 2PS3A 3VU9A 4RYDA 1AMUA 1ULZA 3IJEB 4O59O 1GUDA 3LNTA 5GY7A 2HOFA 5GJWC 3U3OA 1HE3A 3N2NA 4G5XA 4YYEA 1XRPA 2AXEA 2RIPA 4ZCRA 3WMEA 5CGQB 3N7AA 2BQ3A 3GPCA 3O73A 1Q14A 2PZJA 4OTZA 2PX4A 4M1ZA 1JR4A 5ADUS 1SC6A 3Q2IA 2FPIA 3P2JA 5JISA 4QGGA 4RPLA 4QVIA 2AMFA 4D99A 1C1DB 3KL2A 3CF0A 4X7MA 2CPRA 1AQUA 2F1RA 3OQBA 2IOQA 2CUNA 5JT1A 1G7SA 2ISPA 3DTNA 3IOMA 3G8DA 3CZMA 3HY6A 2VXOA 1SVLA 4HWKA 1KO8A 2ZS8A 3ZIDA 3RIGA 1PFKA 1N6IA 4QXPA 1LVHA 1B3BA 1J2JA 5BSFA 3BXHA 5B3JC 3CRQA 1Y34E 4JLPA 3N8KA 3QPAA 2BKVA 1EFKA 5H9WA 1DJLA 4YCDA 4W6ZA 3EC2A 5GONA 1R0LA 5TF4A 4LVSA 3FB1A 2QIPA 4ZEVA 4N6GA 3A2NA 4IIYA 2R8GA 3F46A 3CA8A 4NZNA 4GP7A 2X15A 4FBUA 3IEKA 4D6XA 2ZKIA 2MA1A 3T34A 2OG1A 2VQDA 3DAYA 5CLQA 3JQAA 2CKDA 1PK1A 2Z6VA 2IODA 4MQBA 3EZ6A 1XZJA 5AJXA 6ADHA 4KI7A 4RQUA 3ITDA 2W2LA 3D4OA 3OJCA 4ZHQF 5T41A 3Q7EA 5C8YB 4OHFA 1NQUA 1AKYA 3OZDA 2J1LA 2IYOA 4HQKA 3JVUA 4UCQA 2QUKA 1D9XA 4XYLA 2FW6A 1E20A 3KUKA 2RI0A 3BBLA 5CX1A 3GFQA 2HPHA 4HEHA 1QX4A 4DXAA 1EK0A 5D01A 3RSGA 4XFKA 4E51A 5IKOA 3COSA 1E62A 5AKYA 5C1OA 3RB4A 3SSNA 1FS6A 1GPH1 1YZYA 5KDOA 1H1LA 3ZWNA 3T1QA 2G6TA 1ECBA 2YVLA 2B6NA 4FPXA 2WE8A 4BQFA 4GZ6A 4NAVA 2FHPA 4K4IA 3MOSA 1TEZA 3CEPB 4OFBA 2YWBA 2EBHX 4Z0NA 2WV9A 3W5JA 1KSPA 3C3EA 4I46A 2P9GA 3FOBA 3MR2A 4KXXA 4G3XA 1AK1A 2UKDA 5C51B 3LG2A 3LCMA 2FW7A 1CYDA 3ESZA 3RHSA 1OCEA 2MMGA 4AQDA 1HG1A 4DABA 4EARA 1DP4A 5FF9A 1NHWA 3QEMB 1GRQA 1W7AA 4Y2TA 4QGHA 5KREA 1KE1A 1I3MA 4Z99A 1YS1X 1R8QA 2XUKA 4LDPA 3ANNA 4AP6A 2OV2A 3QMVA 4TUYB 5FP0A 4B6EA 5ADHA 1PKXA 4FQ5A 1U0EA 1OTXA 1WB9A 3ZWYA 2DKFA 4ARAA 2OV3A 5CAEB 1CT9A 1S1CA 4IVRA 1FB5A 4ZHQA 3MOGA 2YS7A 1J8VA 4FDTA 4CEJA 3NWBA 1TZ2A 5ULLA 1YB2A 1Q19A 4H7PA 2X0DA 4JASB 3PKIA 1I30A 4IJ6A 4EB6A 3G88A 2G5TA 1E98A 1NVUQ 1MQAA 4OU4A 1FC0A 1X8XA 5DT9A 2JW5A 3GGDA 4ZOLB 3MR6A 3BM5A 1RC1A 3AGPA 5BMVA 5BRAA 4BL5A 4R01A 3JYOA 2CMFA 1QXSA 4FNGA 1B76A 1KERA 1L8LA 4I2DA 3UA4A 4JKOA 2HTEA 1YWGO 3U9SA 3DDOA 5TQ2A 3DZCA 2GVZC 5CH8A 2P66A 1Z15A 2J0UA 3RHFA 1FLDA 2DFKB 1HUOA 2I87A 4DWVA 3FE2A 1UWLA 2AN1A 4KIFA 3FCEA 2OILA 5GMOA 3C6YA 1DJNA 2NVUB 2GN4A 2K6GA 5JD6A 4OJKA 3MR5A 4OJPA 3DDSA 2WPDA 3EPPA 4M1WA 5F1PA 4A1OA 2PEYA 1Z3CA 2RK3A 4Q18A 4NTZA 4FO6A 2X1MA 4FHZA 1QYCA 4WASA 4UZEA 1WCIA 2FE9A 4G0XA 3SQLA 4YQEA 5FHQA 4D43A 5DFAA 4M8LA 2BGWA 1YJAA 4TWJA 3IP5A 2W8LA 1DG3A 3HCWA 3CYFA 5BYBA 4ES6A 2Q3EA 4XUCA 3ICCA 1YS6A 3P2MA 3AX6A 1Q3VA 3TRDA 1Z2NX 2XMZA 1T0PA 1H93A 1QE3A 1XVAA 3KC2A 4XSGA 1UCVA 1E6MA 1WAMA 2GZRA 4CN8A 1AGPA 4I1YA 3FD8A 2PLAA 2QDKA 5MF6A 5A2QA 4CLRB 2VYCA 1JXQA 1HTTA 3T94A 3N0WA 4QFCA 5DOZA 3HHPA 4JDUA 2ZJ0A 2GF2A 3QEOA 3T4PA 1W8DA 4AULA 5JCJD 4GP6A 4K6GA 2QTVB 2GKOA 2B1RA 4QXMA 3PC8C 3WQHA 4R63A 4BQNA 1OWNA 4K1XA 2KHQA 3ELDA 4LF6B 4B2PA 2Y1FA 4ZAVA 3JD3A 1N5DA 4D79A 5HIMA 1RJEA 4DJAA 1KFTA 1MF7A 3IVCA 2AN4A 1JI3A 5EZQA 3NHRA 5BOSA 1BDJA 1J5PA 4ZYXA 4NCNA 1L9KA 1OIVA 1QORA 2VJKA 4ZANA 4X85A 13PKA 4PCLA 2ZIFA 3U9LA 2O0MA 5SY4A 5GINE 3WGOA 4KP7A 1KSHA 2ZANA 5H68A 1N5KA 4KVAA 4BWYA 4A15A 1NJXA 3AL0B 1SU6A 2WFAA 5GJBA 4KIUA 2JCGA 1L3CA 4D3ZA 2Y1XA 3K6RA 1SV0C 1YE3A 3EISA 2HOQA 5JAQA 1YDWA 1S9DA 4UC0A 3N3AC 1NKSA 1DXOA 2KW5A 3D3WA 2OO3A 2FWRA 4LXXA 1F06A 3KPWA 4JLMA 1AKEA 4JV1A 4BO0A 3CIOA 4MUIA 1ZQJA 3ZWAA 1UZMA 1DJOA 3WL5A 1WXGA 4DWJA 2ONYA 2PS9A 1AHPA 3C3BA 4K9QA 2FN7A 2P65A 4JJAA 2C1XA 3D7KA 3AK4A 4PXYA 4M87A 4Q6WA 1KI3A 2VH5R 4XZ3A 5AVJA 2QIOA 2B82A 2A78A 2WWRA 3ZCXA 4FHCA 5KWSA 2KJ5A 2EFCB 1YNOA 3L0SA 4W5QA 4KN7A 4UTZA 1T5OA 4KLMA 2QLJA 2YXEA 4QW9A 1TYDE 5JJCA 4DSNA 4PRLA 2PUTA 3T3MB 2D1QA 2AFHE 4M83A 4C4YA 4H15A 3ZV4A 1J7KA 2TMYA 2BM8A 4NCBA 4C14A 1IONA 4E2ZA 3DB2A 5E7IA 1ULBA 2EWMA 5ADWA 3VSDA 1AROP 4YMUA 5ICEA 1WXDA 5DF1A 2OYRA 1IM5A 4AJ2A 2V03A 4YDSA 2A86A 3PVCA 3L7LA 1CJTC 2PSDA 4IRXA 5CIQA 5D5PA 2Q5QA 2H11A 5DNAA 5TJHA 3DWIA 8OHMA 5K3EA 2FEMA 3O84A 3HPOA 1PUXA 4IJVA 2A2ZA 3WWZA 3KCNA 1IIBA 3L0IB 4OQLA 4KFCA 3IAFA 5JZVA 1P0QA 4DUGA 4RNMA 3IMKA 4PPNA 4JVOA 1W0KA 3A36A 3IVGA 2IH2A 2FPGA 2RHHA 5ANRB 1JSCA 5LD2B 1I2AA 1R2QA 2IX9A 4BFTA 4PIMA 5KYXB 3RTVA 5A71A 4EUEA 2KV2A 4WLVA 1KJYA 1ZYQA 1NHGA 4UBMA 4LDRA 2D5CA 3R4VA 1BOFA 4KIJA 2GD0A 1Z0JA 4IMPA 2MU2A 1JG6A 4GI1A 2A30A 1YQTA 1IHPA 3AM5A 4U7WA 3LO5A 1C30A 5LJIA 2Q28A 2AVDA 5CT4A 3Q9NA 5EIBC 1ZQZA 2QTZA 1QDLB 4AN1A 1L3UA 4GPZA 2VZ9A 3EVEA 2E4XA 5F2KA 4DWWA 4TT8A 2A1UA 5BSRA 4EGQA 1IUNA 3D2SA 4N12A 2CXQA 5CJ7A 2QZZA 3OF2A 4B3JA 2XUJA 5JXJA 3ZEAA 5E6RB 2OCEA 1C0KA 4COKA 3INNA 3JARB 5KTNA 4GI3A 4URZR 4PLPA 3ZTYA 3GEDA 5KFBA 3MT8A 1Z00B 4K8OA 5CLFA 3NHPA 5ALJA 2XE8A 3E61A 2OTCA 4AJLA 2X7JA 4IRCA 2OE2A 4BUJA 4KQJA 4MW5A 3WRYA 4FW9A 1NULA 3E22B 5G4KA 2C3YA 1Q3HA 3E5RA 3LNCA 4HL6A 3VNRA 5C8YF 3D02A 1VI2A 4PLZA 4IOLA 3GN1A 4L3VA 1PGJA 4QWWA 5IG2A 1F2UB 2OCDA 3JU3A 1P0MA 4BTLA 3QNWA 1GL6A 1V7CA 1D9FA 1A96A 3FZGA 4HUJA 3FPFA 1FQWA 1LI5A 5CLGA 5I8PA 1RAAA 4BZPA 4W4TA 3QWBA 3NNNA 3MTEA 2QEQA 4L16A 1R6VA 2OHFA 1C1DA 2WZBA 2YL2A 3C2KA 5EMHA 1ZJNA 3JZAA 4GI2A 3D7LA 4EYEA 3NGDA 1MXFA 5BN4B 2W11A 1UBNA 2G36A 3U31A 2B25A 4HBGA 1VXOA 4B4KA 3KLOA 3TXAA 3NTQA 3MSCA 2RAPA 3UMSA 2ZQ5A 4QM7A 4AN4A 4RMNA 5DNYB 5H2FU 1DK2A 3EYWA 3OFND 1U6JA 3CLUD 3VPXA 2BYTA 5JO9A 3V00A 3O2NA 3ACCA 4ZIRB 1Z08A 4EPXA 1PK3A 1VL6A 2QTNA 2W03A 1IPEA 5TJ9A 4OBWA 2G6BA 1XNRB 3KHHA 2CFRA 1BH2A 1SY7A 3VR5H 5TPZD 4TUYF 1J1IA 3DVRX 5SYAA 1SKRA 2ECPA 4BX3A 4IXWA 3RB3A 1GD1O 2X1VA 1FTWA 1AE1A 4I50B 4IEIA 4Y6PA 1AH2A 1KRXA 1U48A 2A0FA 4Z54A 1R12A 5C3UA 5C5EA 4EO9A 1ABBA 2F1HA 4CQLA 1S02A 3L1UA 5EQTA 2H9YA 3UJ6A 5JXIA 5TQ0A 5DYIA 2BPCA 4ZOLF 2SHKA 4AN0A 4XM1A 1XMPA 4BU0A 2FPKA 1VKNA 1S7CA 1E5XA 2PH5A 4RFVA 3VR4D 1WZNA 3WIOA 1FTYA 2DL0A 1N5LA 4BNUA 1I7PA 1OB5A 4XGNA 1QCYA 2Z4RA 3G2IA 1V4NA 2QM0A 4ED0A 2PGAA 4XRRA 3EC1A 3VYVA 5A1JA 3GAFA 4CVNA 5JCOC 4RZ2A 1QZXA 1PS8A 3GX1A 1OZAA 2BM9A 1E6UA 4TQ9A 3MQ4A 4LWPA 2X9GA 3HJTA 1OXXK 5K3FB 1GKYA 2BEWA 3D0OA 3MWYW 1U8EA 5B36A 1EDOA 3I6MA 1RYDA 2G7MC 3IIIA 4GI5A 2XXAA 4MSUA 3ETLA 1XQWA 3HVKA 1CJCA 3L93A 5AHKA 5EJIA 5I47A 2JLBA 1PVQA 2IYYA 2VK1A 4B6OA 4OQEA 3UKJA 4XQ8A 1OU4A 3R7LA 4EHKA 1PRYA 2ZZKA 1SRRA 2V6GA 2CZQA 3AOGA 1ACMA 3KYIB 2DR2A 3ETJA 3F6CA 1XKQA 2BC9A 4CM6A 2FQYA 4AK9A 1T3ZA 4LRUA 3KT3A 3MUNA 1FU4A 3QOFA 2QTGA 4YBRA 1BDBA 1E2EA 3UK6A 2OCBA 1H94A 5CAEA 4G37A 4OH7A 5KO2A 3RNLA 1WO8A 1S01A 1CRWG 4KQ2A 5DJ5A 3L82B 3M9WA 4B9EA 5CTJA 1TKBA 2R7KA 2VA9A 4ZT2A 4JLDA 5AM1A 5K6AC 1X7ZB 3K0BA 4ZOLA 2YV5A 1RQXA 1A8PA 4G85A 5G5HA 3V9PA 3WGMA 4RSMA 4Y2PA 3GBVA 1K9VF 3FB4A 2PTGA 3N74A 1M1UA 3E2IA 4NZYA 4MWDA 3LRTA 4EDFA 1I4TD 4B2YA 1HG0A 1K7FB 1S2IA 2Z08A 5LWQA 1D4AA 5FUVA 3O8CA 1DXYA 4OB6A 3RRXA 3GGCA 4L0CA 3OX4A 2AQHA 1UJMA 5DK4A 4NZ9A 2D1FA 4GLOA 1Y48E 5EAIA 1KFSA 1ZBQA 5CR0A 1M1XB 1J2NA 2RGAA 2R7MA 2C99A 2P6PA 3ELBA 3ZY2A 2WA1A 5K0LA 3TQOA 1DO2A 4OHCA 2XZTA 2O4CA 1DCMA 2XITA 3U4MA 3R0JA 2ASEA 1OPRA 2AMLA 2Q29A 2M6SA 3JQAD 3CMCO 3PC4A 2HRDA 1X94A 3Q8WA 5DHQA 3ORQA 3OIUA 1QMGA 2W2LD 2YZKA 3KXPA 3PQCA 2KKVA 4DNXA 3LP5A 3CLUC 2B4AA 3TQIA 3ZDXB 1MOQA 3DBLB 3G7NA 3OT4A 3KM0A 4D9KA 3IAUA 4P8RA 4BBPA 4GPTA 4M3NA 2FPMA 3SJAA 1YKSA 2Z4TA 4UQLA 4IW3B 2LCFA 8AT1A 5KVCA 4F84A 4G07A 4JX9A 2WIGA 3OFJA 2MCFA 1PV2A 4YPOA 4JT4A 2QTVA 4LZGA 2G28A 4L1KA 4NZPA 2X7XA 4LZWA 1ZQNA 2K8CB 3FDJA 1OC4A 1RXEA 1X3LA 1FRNA 2ZJFA 3SF8A 1R8XA 1XZBA 1HDIA 1O4VA 4R2HA 1H8HA 4DZZA 4I4LA 3UYKA 2FG7C 5C1IA 4ND7A 1Z22A 1FCJA 1B43A 4DQXA 2CVHA 4GUAA 1E6KA 2Q3BA 1DC6A 2PZEA 3ASZA 5L3RA 1BHJA 3AF5A 1H4QA 1Y7PA 2RGBA 1LKZA 3D6VA 4IJUA 2A1IA 1UDXA 3TAPA 2P9QA 4RV4A 5IBQA 1ECFA 3GIWA 1Z3EB 3E2MA 1JX6A 4RH3A 3W3AD 5TS2A 4GGPA 4N82A 1OT5A 3ZE1B 1KZ6A 4NK5A 3WIEA 2W8ZA 2JD2A 3TVDA 1XGKA 3BE6A 4NABA 3N07A 1U0OC 4W9NC 3PS9A 1CZNA 2W54A 4FBLA 3C48A 4ENWA 3AFIA 4JMPA 3MGKA 2OCXA 2I8AA 2PU5A 4EG1A 3L84A 1TA4A 2WIKA 4KQHA 4O4HB 3ZZNA 1T0BA 4ZEOA 1DL5A 4D25A 1O5OA 3O0FA 4KTQA 3IB3A 5B3AA 3OUTA 4E5KA 3FPAA 5CJPA 1N5JA 2OBBA 3LXMA 2AXNA 2GYYA 3MWDB 4FWTA 5BQXA 2V7XA 3IAAA 4CU2A 3HL0A 3K1AB 3T38A 4DCSA 1DAHA 4KQWA 4DDKA 1XZEA 4YJHA 4JUIA 3Q3GE 4WL0A 4OKSA 3U49A 4NXNB 1XELA 1AN9A 5EWJB 3D6TB 3RW9A 3ZD9A 5JYCA 3MC1A 3WK6A 1NNUA 3RRBA 1YJQA 3USZA 3VOBA 5J29A 1YUMA 2Q0QA 4RTSA 4EENA 4L73A 2MSLA 3N7SC 4QIWC 1N2XA 1XZMA 3EDRA 2VHTA 2WWWA 3B85A 3NKVA 1V16B 2Y4NA 1CE8B 1FVFA 1GZSA 4WZAB 5IVPA 1U5AA 2B4YA 2PH1A 4BDPA 2CB0A 1X8JA 2WPDD 3IPLA 2P1RA 1PFUA 1ZNWA 4YR9A 2W9CB 3GLHA 3UV6A 1TC2A 4C4ZA 4F4IA 3D5QA 4PL1A 4P0PB 1KYIA 3O1HB 3ZLBA 2X13A 5HGJA 3MS7A 3TPZA 4PZZA 3OZCA 3VX3A 1M5RA 1TLLA 5DGAA 3C4VA 4ECRA 1NI5A 1GGEA 3HFSA 4CMAA 1X1CA 1KIMA 5FTWA 3GRVA 2VQSA 1JE0A 2JMGA 2KVCA 1WL8A 8ICSA 2OM2A 2VYQA 4AS2A 2R8BA 4HI0E 5LQKA 3R0XA 3I5YA 5BQPA 3VU3A 1PUZA 1N5RA 2O3RA 2LIPA 1H5UA 3MTIA 4RH1A 1QRAA 5J8YA 2ZBVA 9ICQA 5J58A 3CR3C 4U7PB 2IF2A 2BZ0A 4B45A 2DTDA 4PXAA 1XCBA 4WJ3B 2BFFB 3NEYA 5AVUA 2VZ0A 4DREA 2I8CA 4OJLA 1VL8A 1KQOA 1PD1A 2XGOA 1FYWA 3C6XA 3RJKA 4C0WA 5DEIA 4N5NA 4EEYA 3BL6A 1CY2A 4M2LA 5D3ZA 2GZSA 1ZQPA 3PNPA 2PZMA 1JMVA 3BB1A 2ZSHA 3GNQA 5E6RA 1GR0A 2A9VA 1R4MB 3EXG1 1Y63A 3WSVA 1YZTA 5DULA 4RPZA 4QZ9A 3N5CA 1Y8ZA 2RAVA 3HQ4O 2V3CC 2QKYA 2O2DA 2OXRA 4MVJP 4XFDA 4P81A 1JHRA 2VAPA 1KBQA 4NBSA 3BSYA 4N6OA 4WRRA 1PTJA 2IHZA 1Y3IA 4RKEA 1UMCA 1XIVA 3U80A 3FIUA 4GX0A 1B6GA 4MUNA 1GSIA 4I50F 2K89A 1TOAA 4DDUA 4BLQA 4Y2UA 4D41A 2IVZA 4Q1DA 3IDFA 4IH1A 3ISJA 4RD4A 2ODWA 1F3OA 1X9MA 7AT1A 4Q9DA 1RRPA 4BO7A 5JMPA 1MH1A 4BASA 1H2EA 1OTYA 1GPUA 2C3OA 5F78A 2NTNA 2GCEA 5BSTA 3GIMA 1Z2OX 1LF5A 5FJJA 2YVAA 3K2QA 4C43A 5KJFA 4NHOA 1TMYA 3RS2A 1L2TA 3E18A 4CQJA 1H6CA 5KOHA 2PY6A 5BN4A 1HNWB 1DAFA 1NJSA 4KLOA 3QUSA 3HDJA 2FMKA 4GX2A 2NYAA 3GPLA 1RXIA 3RUIA 1Z6YA 3C45A 4IF6A 4HTFB 1UQRA 2QKQA 2L69A 2DBRA 2E4ZA 3H0CA 4FZJA 1NGSA 4M4SA 1VYVA 5CBPB 1KP3A 2NYUA 4ZIRA 5AW7A 5JNUA 2J5RA 3T6KA 3DULA 1KBOA 3WOVA 2Z83A 4OJTA 4JFRA 3FF1A 1KAQA 4M99A 2WZCA 3UT0A 1C9KA 5F35A 2J8ZA 1K86A 3D1VA 3GEEA 3LCRA 3FZEA 5AM0A 1RKXA 4GEGA 2C2ZA 4YRKA 3HNRA 3Q85A 4MIYA 4PE5B 4DCGA 1IB0A 1WF6A 1JNYA 4P33A 2AN3A 2IT1A 4I50A 4RCYA 1Y42X 4BVFA 5DW3A 4CG3A 3N8IA 4KJXA 1VGVA 3AFHA 3O31A 4Q1CA 5F9NA 1I2MA 4DUGD 4GX5A 3NBUA 1FYVA 1WHTA 1E9FA 5TIIA 4Q34A 5AYVA 3FPGA 2EGHA 1ECGA 3ENNA 4B76A 7GPBA 5K0BA 4EBEA 4HG2A 2N3ZA 1J25A 4PAMA 2GASA 5TV2A 3RJMA 4RTNA 3KB8A 2ZCJA 4OBEA 2NSDA 3SZGA 4US8A 2V6JA 5JDIA 1EGHA 4Q3AA 4GWKA 4B47A 1KS9A 1YB6A 1MQ3A 1L5HB 3M6KA 2C2OA 3KKAA 4P4PA 3DMNA 1E9VA 2GBPA 2OUIA 3B2QA 5I3CA 3OF3A 3D31A 1JVSA 3SJCA 3OZTA 2C2HA 1UMDA 3SHFA 1O9BA 3E7FA 2A1TR 4UAJA 4BO1A 5JH7F 4QBKA 2C8LA 1SG9A 4BQQA 1VIVA 3FJOA 5K8VA 3CJQA 4BN5A 4F04A 3NM4A 1MH9A 5AKKA 3L4JA 4J7AA 2AJCA 4RPXA 4RD2A 4KV9A 3G0CA 4HLQB 2ZI4A 3C3PA 2FX3A 1YS4A 2Q2NA 4C76A 4FX5A 2C2BA 1RKBA 3TZEA 3DVLA 4NCHA 1VPVA 1CP3A 4DHWA 4YMVA 3AI1A 1R4AA 4M9QA 4WEOA 1V35A 5DB7A 2C20A 4IFEA 4QZIA 2WIBA 4A6PA 4Q0MA 3T9CA 4DSKA 1KH1A 2R6FA 4LXHA 5L1KA 4DBLE 4S2UA 1OFGA 1KETA 4LI0A 2BZFA 4ZT4A 5FPQA 4R54A 2E4WA 1XMQB 4D4IA 4LV8B 3JQEA 3S44A 4PJ0U 4P86A 3QUAA 1L4FA 1YF3A 4E0DA 4GAEA 4BP3A 2NZ2A 1FQOA 1JDVA 3Q6NA 3TJMA 1TK5A 2VCHA 4QQFA 4TKMA 4B6JA 2OCIA 1JLHA 1US8B 4BB6A 2EQ5A 3LFHA 1WOYA 2JI7A 3AR6A 4EVRA 4OAQA 1PR6A 2J5QA 4EL0A 2BFWA 3KB6A 5DB9A 5A5DA 2WWYA 3PL1A 2QB0A 4WN3A 4ETWA 4R1NA 2O50A 3HJEA 3F98A 4KLGA 1RXVA 3AF6A 1KWGA 4GX1A 4EJFA 4A8JA 3I4CA 3FYHA 3ZDRA 2CMDA 4XSHA 2YHBA 3ZCUA 3OLQA 1SB8A 4NU5A 3GAAA 4C4TA 2G70A 3KPUA 1GU0A 1Z0KA 4AB1A 4RVOA 4JJ7A 3I62A 2ABWA 2FR8A 2R6JA 4UVEA 5J1TB 3BGVA 4FZ5A 4X45A 1V41E 3WO0A 1Z26A 2ECOA 4CR8A 4RA9B 2ONCA 4GO1A 5H7XA 1U7UA 4P58A 2P6OA 4XOUA 1KR5A 4Y6SA 4ERNA 3KXDA 4L9RA 4YCMA 2DVMA 3T4XA 1SCDA 1PWHA 3CWQA 5AVVA 1WPXA 3CJTA 2OHHA 4NU8X 3PR2B 4DLPA 2JGKA 4IBOA 3H0EA 1IZ0A 3FYDA 3AHFA 1TEXA 1R1DA 3TFQA 3VH3A 3RSOA 1IY0A 1PR5A 2Z8XA 4EB3A 3GWGA 2FB9A 3LYHA 5ADVA 2PH3A 4XUEA 1RI5A 5JARA 2NZWA 2R0QC 3KALA 1IVYA 3RJJA 4O4HF 3B3GA 3AHEA 1KSJA 3DBLA 1JIXA 4RETA 2PQ2A 5FEUA 4ZD6A 3DBHB 2P68A 3G8BA 1CQWA 3QVJA 3LL4A 3ML1A 3ONDA 3ZYZA 2OYYA 3G9ZA 3FWNA 4BFSA 4M1OA 3N6VA 1F0NA 4YGYA 3UTDA 4YV1A 2C57A 1ZQOA 9ICPA 4Z7JA 3PXEA 3U4QB 2V54A 3GFKB 1NWHA 2BBOA 2W8BB 2NYVA 3ZIUA 3C3JA 1Q1ZA 1YQQA 4HATA 4A2WA 2FZCA 4W5JA 1M67A 4NCJA 3OEWA 4TMVA 3K96A 4FNOA 4PGYA 1FL9A 2R7NA 1LW7A 5MFZA 4R2WA 3OJOA 3RH6A 2C2EA 2Q3LA 3FPKA 3OQMA 4E6EA 2W0SA 2VP6A 1ZCAA 4QZHA 1VG1A 1Q1QA 1NBHA 1ZD8A 2C5FA 3D7SA 3QKUA 1Y8QB 1CUHA 1M83A 2C2WA 3PDIB 5TMDA 1NPTO 4XB6B 1XTIA 1XPUA 3O9MA 1LTQA 4MVYA 3UMGA 4J2TA 1OBOA 4QM6A 5PNTA 4ECYA 3R77A 5NULA 1L5RA 3GROA 4UBLA 4C80A 5IYZA 5KFDA 5U4QA 3NT5A 4LJYA 2JF0A 4YA6A 1WMSA 5C8VA 2JGDA 1WYGA 1J23A 1JJBA 4Z9BA 4NFYA 4O4HA 5TSDA 1MJGM 5DX0A 3A10A 3W5HA 3THXA 2WG1A 3HADA 3TI0A 1E96A 2H0RA 2J67A 2W7TA 4G0PA 2ID8A 1O6GA 3O1JC 1T4BA 1TJ5A 4Y9TA 2XE7A 4PHFA 3PHCA 2I7XA 3GJTA 1FFUA 3UN1A 2WLTA 1XO1A 3T5PA 1C8KA 3O21A 1R4ZA 3A25A 1WCWA 2P8JA 3WRYC 1LKYB 1E1NA 3SIXA 4DYVA 3HVUA 4Z0TA 3BDIA 4UREA 3RC8A 3RYHA 2YRXA 1L5KA 1CDOA 2X9QA 3PPYA 1JKFA 5F3WB 2OHGA 3I0ZA 4UFNA 5AJYA 1FU7A 4N7MA 3HCAA 2C0CA 2E3TA 2HT6A 3TOCA 1X38A 2MSDB 1MUUA 4DSJA 1DZ3A 2H0AA 4Q24A 4Q9AA 4QECA 4UB3A 4IXNA 3AHDA 1CE8A 1MT3A 2PJUA 4ARCA 1Y9AA 3UCXA 4YCJA 1ZH8A 3CCBA 1QG4A 3OOEA 3SXJA 1ZWKA 4M1TA 3IQIX 2AC2A 3A1CA 3GDHA 5CYPA 1IWBB 4LRWA 3OWXA 5FV7A 4DMGA 2KZ3A 1JW9B 4PWZA 3A6GA 4B73A 2LGJA 4P0PA 3OIDA 2G25A 3VR4A 2PZLA 1W85A 1J8DA 1X1SA 5DBOA 1PG0A 4F97A 4I2HA 3IVAA 3RIYA 4QZGA 2NO1A 3A3NA 1VL0A 4C2TA 3N8GA 3DFUA 5ILOA 4XASA 3IUYA 1W5FA 3EUWA 2ORED 5JNSA 3U16A 4QPNA 1DV1A 5L4SA 1VJDA 2X4LA 3JQGA 2P4SA 1PK8A 1YA8A 3T12A 2I4IA 4E1AA 4KXVA 2CFTA 2GN2A 3PQDA 3N6RA 2E4VA 2NO4A 3TW8B 3LY8A 1TYZA 3A1SA 4Z5XA 3EA0A 4YRMA 1I3KA 2ZI9A 4Z8YA 2E49A 3C1ZA 2XC9A 1ZD3A 3KJNA 2ZRJA 3G0GA 2JFWA 4P31A 3RLIA 1NPYA 4C3ZA 2C7BA 3HGTA 4ZYZA 3ST7A 2DLCX 3U44B 3NVAA 3HO6A 2HLHA 4QRIA 2JKVA 2AXTU 1G9SA 4R8LA 3BYZA 1H8HD 2QN8A 2E8OA 3OZ7A 4LN1A 4C7YA 4DF8A 1AOXA 4JEHA 5CFRA 1N6LA 1NVVQ 3T7EA 1ESCA 3NANA 3UM9A 2AOXA 5L7YA 1II9A 2X77A 4WEQA 2F8LA 2PM8A 1ZCBA 3C29A 3LVBA 4KVGA 4R2MA 2M0NA 3TRHA 2VHEA 5K0FA 3I42A 3DFIA 1CJUC 4PG7A 4HNVA 1Z8NA 1FZTA 2UVPB 4GC5A 1VG0B 4R2LA 4RZRA 2XHZA 5KG1A 3CINA 3CS3A 3UMCA 4FBTA 2EFHB 3ISDA 1ZK0A 2JH3A 2CEAA 4BVAA 1DARA 2HKIA 2ZZNA 3ESYA 2OBMA 4DADA 4RX1A 1SXPA 5J4LA 1OBFO 3EZGA 3VQTA 3P7MA 3IDWA 3GDGA 2Z95A 3MZ0A 5DHRA 4RKYA 4DLVA 2PFSA 1TKCA 1Q92A 1P1HA 2ZE5A 2E21A 2KQUA 4RXTA 2VCEA 2RH5A 1O08A 2YDXA 2VHZA 1VJCA 2AF4C 3SHTA 4BFUA 3WIDA 5ITZB 2AJBA 3AEVA 7ICPA 2ZRCA 1LC3A 5IAEA 3EGXA 1TJ3A 3RC3A 3K9HA 1DIRA 4UTPA 4C8MA 3ROQA 3VDQA 1K4KA 4HDNB 2FRXA 3UWSA 1DPFA 1FX1A 1U0HC 2RH8A 1PLLA 1Y4AE 3F1KA 3TBFA 4DS4A 2E48A 3FSEA 4KN9S 1U63A 2NO7A 1ELOA 2O5CA 1SHZA 3L0DA 4DMMA 1COZA 5C1PA 2BP7B 2JA2A 3FPJA 1QKIA 4CODB 3KJZA 4KLNA 2YJTD 4PC3A 4EABA 2PRJA 1GSOA 5CHGA 1NZDA 2YFKA 1ZXBA 3VISA 3C0KA 1NXXA 5A06A 2Y1LA 5CBPA 4NE7A 4LE1A 2VNHA 3QHAA 4RXUA 2WWXA 2JV3A 2GARA 4Y2VA 4TRMA 1O3YA 3GUUA 1JA9A 4Q9HA 2W6ID 2I4TA 2XIQA 2P0AA 3FKSA 4OQZA 2H57A 3DD5A 3NWOA 1PGPA 1UK9A 3OE7A 1OXKB 3JV7A 3D1LA 3V7WA 1C8BA 3CF4A 4BE4A 3EE6A 1VBKA 2REQA 4JLJA 3B0YA 4U2FA 4F9EA 3GZJA 3ZDZB 1EZ4A 5FAXA 2JA1A 3ZC3A 1Z3IX 1MVNA 3ND6A 4RQBA 2NUAA 3AR9A 3CG4A 3BRQA 3HKZC 3GLUA 5REQB 1I4LD 2K4PA 4YLEA 1OJ7A 5DG9A 7ICHA 3QKRA 5F3XB 4P3OA 4YN4A 3N1UA 3ZZ0A 4UVGA 3DLBA 4G81A 2TMDA 4K3UA 4TM8A 2FG5A 3WICA 2VHYA 2PKQO 3K92A 3L0CA 1L5HA 3W3AA 3NVWA 4I2EA 3ZUGA 2VT3A 5L4LA 1PFQA 4Y67A 4M9GA 4LC1A 5CA0B 2CMGA 4ON9A 2W7OA 2HXGA 2AB0A 3B20A 3RVOA 2YCLA 1MZPA 2FPLA 4F4FA 2AA3A 1NF2A 2PBLA 4DGSA 1MQ8B 2WR8A 3PCRB 1SXJB 1T4MA 3WNCA 3GFGA 4EUSA 4E2XA 3BPSA 2F3PA 7MDHA 3I1FA 4QJIA 1T9DA 3CX7A 4J03A 2IH5A 3EC7A 2EEZA 4QO8A 4C7OB 3DG9A 2QRPA 2Y4OA 5DMHA 5G02A 1GPLA 4ZCQA 2DFTA 2JLAA 5KFKA 4RHUA 4FM9A 2BIFA 2PKEA 1NNLA 2ASLA 1O1YA 3S2UA 2POCA 2ZTUA 5K2OA 5AOVA 1GN9A 1SCUB 5DB4A 2M9NA 4R9RA 1YZQA 3M9LA 2YZ2A 1ZQWA 2JFYA 4D98A 3JD0A 2DFPA 1TYEB 4R1TA 3GY0A 3RG8A 4QKQA 4WFJA 5E6UB 3ZE7A 4ARZA 4NV3A 5LB2A 2VSOA 2J3HA 4P4UA 4LJ6A 1US8A 2ZROA 3HDVA 3WL8A 1K97A 3AUOA 4JJ8A 1UEJA 1AQIA 3KAPA 3ZQ6A 2J0EA 2A1JA 3V2GA 1L1QA 1RWMA 1MMFB 3KKOA 3B6IA 3C5EA 1AS3A 5FV4A 3AL0C 2VIXA 4LMAA 5BYAA 1CRPA 1FQJA 3RYCA 3G5UA 3FCAA 3A4NA 2P40A 4IGKA 2E4AA 5COBA 2D4AA 2JGRA 4MPJA 4HWRA 1CS0A 2VDOB 1KQQA 5EOZA 1NRXA 4M0DA 5J23A 1WTCA 2JEZA 5EL0A 2R8PA 2ZYSA 4DT1B 2C8JA 4CEIA 4L5CA 2EL7A 4RVCA 4F3TA 1DGJA 5ALMA 1NW8A 3EUFA 3ZCPA 5AD1A 3PUWA 4NE2A 3OEHA 2F9LA 4KREA 1E32A 3T3OA 2EH9A 1E2JA 3WAKA 1WEKA 4HLUA 3T9EA 4TZTA 1J42A 2G9NA 1JMKC 3O9VA 5AJTA 1VMDA 3Q3VA 5HIIA 1CRQA 2F59A 2R4TA 3T8YA 3BQMB 2AU0A 3QZ8A 3H86A 2INGX 4BZQA 3JTEA 4Q3LA 4KQMA 4IQUA 4DSLA 1SVUA 3NRZA 2DUMA 3PW7A 1JR3E 1SOUA 2PX2A 1YTLA 1CUAA 3BRWA 2QQFA 3CKKA 2NO0A 3PU6A 4UBBA 4DIDA 4JKIA 4TYPA 3HNOA 3R24A 1FP2A 4AJHA 2XO7A 1X0VA 5DB6A 1Q0SA 3STHA 3E9QA 4E5PA 4C0KA 1L7DA 1TD1A 2XRFA 3OTWA 1DDIA 4H16A 3VOSA 5IWCA 1SN7A 1I0LA 3BAZA 2Q5EA 4HMQA 1CJVC 2QBYA 1GAQA 4LJXA 3CEJA 4XIFA 5HQTA 2ICAA 2JCYA 1RPAA 3DBVO 3G0BA 3U4QA 2P6NA 2W8BA 4HNQA 3SHQA 3GRCA 1E58A 4HQ0A 1ESZA 1WB5A 2PMWB 4OJNA 1QV6A 1PFGA 3P9ZA 4XYMA 5F2NA 3CP8A 1JSZA 4UBIA 4DA6A 5ER9A 2DXIA 3CVJA 3UXPA 1CEQA 3PO5A 2IV7A 3W5AA 1VQ1A 2I9KA 3FHJA 2R8OA 3KEOA 4G36A 5IJWA 1V6AA 2QRMA 2JIRA 1WPGA 2M6RA 3N0XA 3QGMA 3PDIA 5FI3A 3FI0A 2A84A 2DLDA 3PXDA 4OOFA 1M7HA 2VO1A 1ETHA 4AUNA 2OOKA 1X8KA 5J8YC 2R3SA 2EKBA 4OK5A 3ZLJA 1PHPA 3JYNA 4B0OA 3A9VA 4MVJH 3DGEC 2UUBB 1EFLA 1RXSA 4QZCA 1KC1A 1M8GA 3WDLA 2EJBA 8ICRA 4EA8A 3PHBE 1S2NA 1JVNA 2OV4A 2H7CA 2JGNA 4EZBA 4F3YA 4E70A 3GD5A 3S81A 5JE8A 3IR6A 3I04A 2WB1F 1KAGA 1SHLA 2EG5A 2Z30A 4ZGWA 1UBRS 4JBWA 4HXEB 2D2FA 4AO8A 2VRBA 1CIPA 2PSFA 1F48A 3QVKA 1QGDA 4XGRA 4WX2B 3IUJA 2LRHA 3BQ7A 2JFVA 3HBMA 2AR7A 1LKYA 4L6CA 1NXSA 4NPAA 1PTJC 3LF1A 2YXNA 4CPDA 4CNQA 1HL7A 3SLGA 2CXXA 1JXLA 5IDQA 4ZKEA 4BFVA 4DLLA 4L3WA 3NU1A 3EZ2A 2OB1A 4QJ4A 1JDPA 4LOLA 5JZ9A 5EPEA 1RPJA 5I7RA 2HZBA 1PYOA 2YOHA 2AF3C 1X87A 2X58A 1C20A 4UTRA 2QL9A 2ZUTA 5C7LO 1QRTA 2JD1A 2WYIA 4RAQA 2VDMB 1TU4A 3S99A 1L6NA 1GGKA 4KMMA 2BHLA 4HQRA 3WJ2A 1PL0A 2NGRA 3E58A 1H38A 3O9ZA 3OY2A 1TVEA 1EFAA 1GDHA 1S97A 3LWLA 3D2CA 4B3IA 4FGZA 1RM5A 2XB9A 5DYNA 5TEWA 4DV2B 4KUEA 2DECA 1LBSA 3W77A 1OZ0A 3KKMA 4H1UA 4MYSA 4UNPA 4E7PA 1EFHA 2FFQA 3TTXA 2Q6LA 2VOEA 5BVGB 3MXTA 2UUPA 4QJFB 2BJVA 2C28A 4OXIA 2AQ8A 4I9HA 4TWRA 2BR4A 3OX2A 1W6RA 2FEKA 1EDEA 1AV6A 1Z2AA 2GESA 3TAQA 1IBMB 1UDRA 1Q2XA 1SULA 2BH9A 5JHGB 3TW8A 2CV1A 2OC9A 1YXMA 4QUGA 1R6DA 3WSWA 4HUTA 4JODA 1FBNA 2PRYA 1AGNA 2LCIA 3L4EA 4Z3OA 3RJZA 2XUHA 4Z4FA 9ICOA 3EQ6A 3WYCA 1E7QA 5M34A 4KFUA 1X14A 3AG5A 3EVDA 4YRNA 2GWRA 3U44A 4JHLA 2D62A 3ZWXA 3GRYA 2GXQA 3KQTA 5BW6B 4EO4A 1AA9A 1R5BA 3KLPX 5C32A 2YJGA 3Q0IA 2VK4A 5CT8A 4H4CA 1RQNA 4NKRA 4EM6A 1I7DA 1E9DA 4XA8A 1NBWB 4YAUA 3VZQA 4GC6A 4FN4A 1BYUA 4MULA 2YYZA 5KSPA 2WIJA 4NL4H 5KPJA 4K81B 4RDXA 2OQIA 1JFLA 8ICJA 2GCNA 3HBNA 3TIGA 4RPYA 2PVCA 7ICIA 2JFNA 4PN7A 4RHXA 4OQYA 4OJOA 1E94E 4C6SA 5JDIC 4JYBA 3VR6H 4BV3A 3N2ZB 4KIGA 1P7VA 1IHUA 3SZ2A 3RANA 3SG0A 2OBYA 3GN2A 4PLFA 3KKAC 4OFZA 1ZQAA 4RJTA 5ES4B 5JYEA 4NM2A 4KN6A 1E61A 3V46A 2JZCA 3PW5A 1PN3A 1M74A 3DE6X 1BNCA 3I9LA 4A0RA 3I2GA 4Z4QA 3MJCA 1XZAA 1E1LA 1KEWA 4IDBA 3SFZA 3CV3A 4LXYA 2GPAA 3KZCA 5K01A 1Q1EA 4HGOA 2GD2A 3AZOA 5TGDA 1NMSA 2JJ1A 4EA7A 5GM1A 4HYEA 5CA0F 3EZ5A 5GV8A 2O19A 2ZWPA 5I9NA 4FZLA 3OT1B 3U19A 2IE0A 2P2YA 2AQKA 1VXRA 3T79A 3EYAA 4XUDA 4TUPA 2EHJA 1R66A 2PYDA 3RC2A 4X20B 3EPKA 3J81j 4MV8A 3S3TA 3HU2A 4D8VA 4RSRA 3EVGA 3RHTA 3GL9A 5LZ9A 4GOKA 2NU7B 5IC6A 3IMEA 3NDRA 5C8YA 2BMWA 1KU6A 2BPGA 3ESCA 3EOAI 2P90A 3KWMA 3WXMA 5L3ZA 3RASA 4GSKA 3MGGA 2GRAA 5CCXA 2LPMA 1PHRA 3K8QA 3AR7A 3HRDD 3IAM6 2G5HB 4YT2A 3L07A 4QDUA 1PTKA 1N75A 1CC1S 3WQQA 1NSFA 1VSUA 4A8JC 2W2OA 4NCIA 1C7QA 1TAQA 1XLTA 1JIHA 4X24A 1J1UA 4MQLA 2TRSB 5INTA 3VV3A 5KVSA 1HJPA 4NXMB 5ESDA 1H22A 4IQTA 2JATA 3PQ2A 4U7TB 2FR8C 5JTIA 3RSQA 2Q4RA 2J4DA 3GT3A 2CVQA 4B71A 4LX8A 1X9IA 3LX8A 1RQ7A 1DO8A 2QM3A 2RHBA 2CVPA 4R2IA 4R8SA 2D59A 2IRWA 3RVBA 3QEMA 2CWDA 6GPBA 3T35A 2AJQA 3FNQA 1GAJA 2QX7A 4P4NA 1GV0A 3GLFB 1QZZA 1NN3A 3KJQA 2C5SA 5LXTB 1RAHA 5JDCA 4F50A 5IBRA 5HE8A 1XB2A 4I6GA 1HZZA 3QX7A 4TUYA 2VT7A 4U7DA 1SXJA 1GNPA 1D8BA 4YRIA 4RTLA 1W2HA 1TZJA 2WIAA 1E0SA 3N4MB 1GV1A 3DYIA 3MD9A 2FFBA 3K0EA 5A4FS 5AJWA 1J9ZA 1BE6A 3PWTA 2FZVA 2HWKA 4PPXA 1RHJA 4PYIA 4C7OA 1T6ZA 1Z5ZA 3PCTA 1PJZA 2X6QA 4YX9A 4GYWA 3F3YA 2D2XA 3H9BA 1PJCA 3L4KA 4ZV7A 4OGGA 4MV3A 1C3JA 2NO9A 3AP1A 2EFEB 2OV6A 3B0XA 1ZU4A 1RAEA 1F44A 4QUIA 5A4KA 1YR3A 3ZIAA 2B94A 4HAOA 3IP7A 5G0WA 1BDHA 5BWCA 1ESMA 3NVVA 4C05A 4MCHA 3KOWA 2XQVA 1IAVA 4IQ8A 1GTG1 1P3JA 2NNLD 1IU9A 3IUBA 1MIHA 3MCZA 5BRJA 2NVUA 4Y8VA 4CUZA 4DA8A 5JH7B 4J76A 3HPQA 4KDRA 2R66A 3ESQA 4BWVA 4RK5A 1MJFA 3AVXA 2R8RA 2I66A 2CDAA 3Q10A 5KG0A 2FZ4A 3M6UA 1BSVA 4L4RA 1JSXA 2ASDA 1G5IA 1K7EB 2G1JA 4KI0A 3VFDA 1GUFA 3WB0A 2Z2ZA 2ZJ2A 1K8QA 2ZS7A 4CFYA 1GG8A 2E37A 4PNPA 4UB2A 2V6BA 1VYUA 3U3JA 1WPQA 3ZD8A 3AZPA 3V8PA 3U1VA 2MU1A 4ETNA 3P4XA 3M2PA 3HM9A 2NSLA 3IKVA 3PDCA 3QVVA 2EBWA 4HXYA 2WYUA 5FTJA 2NXCA 3SHWA 3RIXA 3IB6A 1BU8A 3RUFA 2HNBA 1DOQA 3O4RA 4DSAA 4IIVA 4CLRA 5HMLA 5CT9A 3D5EA 3TQSA 3FKSD 4BBJA 5FO1A 2H07A 3F53A 3GMIA 2W9MA 1N6RA 4M0AA 3OE7D 2CXUA 2I6GA 2UYYA 3F4LA 3NEPX 2C94A 4OQMA 1CY8A 4KQ6A 1O77A 1SXIA 2IA6A 1YCGA 3FCCA 2EGUA 4FD3A 4LK3A 2MUTB 4ZYWA 5DP2A 1IWOA 2HW8A 2QNBA 5EWEA 3GGGA 4PS0A 2IHNA 4JUDX 1FRVA 3BJZA 3MIZA 1HM5A 4BFCA 1N3YA 1FJXA 5ITSA 5K4AA 1FDSA 2AMJA 2R6R1 1IY1A 1E3DA 5DU2A 3I5XA 5HNKA 3SF0A 1LPSA 4V0ME 1ZITA 2UZ4A 4GPD1 1BMFA 1EWTA 4N5LA 3F7TA 3TQTA 4BKUA 5SZJA 4RUAA 2V6MA 5JZSA 3KOOA 3I9JA 5AOBA 4NV1A 4AAYA 3QX3A 1P2UA 5JYBA 1C2YA 3C43A 4YG2A 4DJ5X 7ICMA 2CBZA 4XDHA 4YAFA 3DHEA 1KK3A 3CX8A 3DKVA 2KFNA 2D1RA 2ID9A 5HG0A 2XY4A 3ZNPA 1QGAA 4XLLA 4B3CA 4HEA1 3K5WA 3QFCA 2RG1A 3GGJA 3D54D 4WZBB 1EHYA 1HH4A 3ZDFA 3KAKA 1CEXA 1S8FA 4L5YA 1SG6A 2FW1A 1K5PA 4MDFA 1K5OA 3KETA 3KTDA 4AMVA 2H4ZA 3LIIA 5E9WA 1X42A 3RAQA 3H4IA 1F8GA 2ZJAA 2A5JA 4GKJB 4L8YA 3X3HA 2AUNA 5JSQA 2HIMA 3EVCA 4XDYA 1NK8A 2P3SA 3PQ8A 4AWBA 3MWLA 3T7KA 2I7VA 4E5DA 3O90A 3IE2A 3B7PA 2RHRA 1I0IA 1SUSA 1RXUA 4OO1J 1L5SA 4L78A 2GJSA 3BL8A 2JLQA 5HKLA 3OY7A 2GXAA 1Y6QA 1Q0PA 4CN9A 3ZDBA 3WFIA 3DQPA 3T3GA 4FHFA 3C70A 5A3RA 4QNRA 4BGDA 4NL9A 2W6IA 5J1SB 4Z6DA 3OZIA 4IHJB 4FI3F 1A4IA 5KFUA 1KDZA 1F0MA 1I13A 2AGQA 1XEXB 1X70A 1R3UA 1PLJA 1KTIA 2ARKA 2IXBA 1JFVA 4X6YA 1FP1D 1OBCA 5DLGA 3SYKA 3R40A 1XRSB 1P4RA 3RSCA 2X0FA 2ZJZA 1R3DA 4NZOA 3G1TA 3PW2A 4PLCA 3E9RA 3N2EA 2EDAA 3OEHD 4TL8A 3F73A 1K0FA 1U9JA 1KJNA 4LNUB 1CK4A 1WCV1 9MHTA 1GNTA 5G53C 3WLTA 3PLNA 5KYXA 3SS8A 4G1EB 3IAXA 1OQAA 3OVMA 3BFXA 1JILA 3PA8A 2O2IA 1MB0A 3NJ4A 4EEXA 3UUFA 4PSDA 3ESAA 2HVHA 4LSGA 4N5MA 5IH7A 1F38A 3BTOA 3D8HA 3ZCSA 1NL3A 3WLIA 2BMEA 4HKTA 2ZI5A 2C00A 4DCOA 4MZDA 3I9NA 3ME5A 1CY6A 4EKGA 3BRWD 3I1JA 3L6OO 5FBZA 1LLUA 3AQFA 3AEQB 1QB8A 4JWNA 4EYKA 3F6SA 3KBOA 3PFKA 4WGFA 1XQXA 4L28A 2HQBA 4BPBA 4PM4A 5KMGB 4WKCA 3JARA 2GFHA 4JV5B 1GUAA 1XF1A 1L1FA 1F12A 1KHHA 5H3LA 3PKZA 1Z00A 2O52A 2DUNA 2OVBA 2FMSA 3R9WA 1PJ8A 5EC8A 3QX8A 3VDRA 3T61A 1AUQA 2V1XA 4KOEC 1FDUA 1P8AA 3E22A 1BGXT 3P2YA 2I7DA 4NZZA 2FEXA 3TSWA 4ALKA 1SZDA 1NW4A 1N1DA 4M0PA 2Y9MB 1MW9X 4BVHA 2I6UA 2N1RA 5L95A 4NULA 3P9NA 3VH2A 2ZRFA 1PJTA 4L4ZA 1V97A 1F2UA 2H5EA 2Q3CA 3OCYA 5DTEA 3H7IA 5AJZA 2GN9A 3DVAB 4KVZA 1SVMA 4TURA 5IUJC 2C0QA 2DE0X 4AS3A 1G6Q1 3COWA 1SC1A 1WZUA 5KOYA 3PZPA 2CXNA 2C7OA 4DDMA 3Q12A 2AN5A 2CNBA 5I45A 3QSYA 1IOZA 4MUJA 2RK6A 4PANA 2C29D 1WXFA 3T1VA 1SGGA 1NQ5A 2BDTA 1SMKA 5DISB 4FDUA 3SM9A 3V1UA 1N2SA 4RACA 1H2RS 2ACKA 3QH4A 3D8SA 4RANA 1J20A 4O3FA 2C95A 4DWOA 4OKIA 1F9AA 4N3CA 3ZK8A 2ZQZA 3FUVA 1KPIA 3F7OA 4WSOA 3ZHCA 1CZHA 3E3LA 3KHSA 3BIOA 3PNOA 3WIBA 2YY7A 2W6PA 4ID3A 3N3BC 4L27A 1ZJWA 2O3JA 4KR2A 1AHHA 3OT1A 3K9BA 3K09A 2REOA 3QLVA 4WE3A 5LXTF 4F45A 4F5DA 2WF5A 3NWEA 4WK4B 4FEGA 1NE2A 1Q77A 3BBPA 4F11A 1M1YB 4R64A 3FRIA 2IEAA 3AY7A 1EJ2A 3QZUA 5AJHA 1M1ZA 4YP3A 2NU7A 4DVGA 4GR9A 4F5QA 1OFVA 2JIOA 3KQVA 2HCBA 2VL7A 3BA6A 1R0RE 5E9QA 2ZM5A 5AJUA 1SELA 4CETA 1TC1A 4QU9A 1MAAA 4FONA 3KFLA 5J2IA 3WU2U 3R6GA 5KOJB 1EU1A 4DEYA 1HTBA 4PLYA 2RGNA 2MWMA 4KLFA 1HT0A 2RI6A 1XEFA 4LF4B 3DC7A 3T3EA 4EH1A 1XPRA 3EEYA 1SKQA 2IUSA 2GFQA 721PA 3P0FA 1EP2B 3PIDA 2IS4A 1PJAA 4MIOA 2R9VA 4X92A 4U7CA 2V98A 1W0JA 2ZRPA 1CEEA 3I2FA 5B58C 4C4OA 2FPRA 5DWVA 4R3WA 4P83A 2Z09A 4HLUC 2DPGA 3AT1A 5K3FA 4WK6A 3SVLA 5G40A 3GJ4A 3LZCA 2Z8ZA 1KFEB 5T4EA 1IULA 2YRWA 2DERA 3WBKA 3AY6A 5DKWA 2V3VA 5G4LA 3AM1A 2OMKA 1LPNA 3KYCB 3OTHA 1T9HA 3HC7A 4PAQA 5KNDH 2FH5B 2PMKA 1KI4A 3DF7A 4FZNA 1CZUA 3PLAE 1QS0B 3C87A 2DBYA 3CB2A 4AICA 2YQ5A 1FE8A 3X2FA 2XYQA 1ZQYA 2G4LA 5IFLA 3ZE9A 2Y1KA 3TD2A 3DM5A 5FR2A 2B83A 1ZJMA 4B87A 3FMGA 1BJKA 2RDJA 1XT6A 3TQQA 2GMWA 5KL8B 3COVA 2PUAA 4GR5A 2ADOA 4CM7A 4DNFA 4AWXA 1FMTA 1P2DA 2B92A 3P8ZA 5FBWB 2FSIA 3OJFA 2HBMA 4BNHA 1YD7A 1G20B 1X7ZA 1ESDA 1OFIA 1CLEA 3QNUA 2BFNA 5CPBA 5HQJA 1SHTX 3GMTA 3OOJA 2NQ2C 3DTYA 5AVWA 1X3SA 2GOLA 2NN3C 4F72A 1R4NB 3T5JA 3E4CA 5IAJA 2I4RA 1Y1TA 2BGKA 1LDBA 2WWFA 5A4JA 5KT7A 4KMUA 1T8RA 2C4WA 2JFQA 3IOYA 1J33A 1ZSNA 1OFUX 5FAKA 3FHTA 2OBFA 3NNSA 4ZAFA 2JFFA 3DEAA 1LV7A 4AJOA 5EJAA 5LSAA 3N7RC 3ND7A 1KYQA 4UDXX 1AQJA 4IZOA 5LFAA 5JH7A 3HR7A 3RAGA 3TADA 1SFRA 2ATIA 3L04A 3N05A 2IOFA 1GSHA 2JJ1D 1NU6A 4WUTA 4MRVA 4O0LA 4RD1A 3TKLA 1NT4A 3AF4A 4MHTA 1TK0A 4NV0A 1J0BA 4O25A 5CFLA 3LMKA 1HE4A 3FHCB 4BMXA 1L7RA 3S27A 1HZJA 3OQNA 1JI7A 5J63A 1QX3A 2D5LA 4Y1GA 2FOIA 4P08A 1K92A 5AT1A 1XDZA 2HJ9A 2GPSA 1EGVB 1VE3A 3BZBA 3A6PC 2ZIVB 1ZQ9A 4YR2A 2A88A 4PX3A 3KS9A 1NFQA 1E4EB 4DB4A 3AC0A 5I7HA 4I81A 4I5EA 3PJFA 2I55A 4OJYA 5DSXA 1HLPA 5CH5A 1HEKA 2O8VA 3NGLA 2SKEA 4ICIA 1TT5B 3NM6B 3AI2A 3EGDB 2AD5A 5CFNA 1A2QA 2I67A 5KEIA 2O4UX 2QD1A 2LTAA 1QHFA 2NO5A 4D7AA 2X14A 1PQ4A 3LA6A 4YAIA 1YS9A 2J3QA 4NEHB 1MC4A 3E3OA 4QYXA 3NORA 4BEWA 1ML4A 2ZUCA 2PZGA 4NXZA 3B78A 3R3JA 3PIIA 4IHJF 5ITVA 2E1PA 2KS6A 2AGVA 2HU2A 1Y6ZA 2CVZA 2IH4A 2IXEA 3BN3A 1SCAA 3K94A 5DM70 4G5YA 3STVA 2AWOA 1SQ6A 3EGWA 1USIA 1ZC4A 4GQAA 2DFVA 3QOYA 1D07A 1S10A 2H5JA 4H0NA 4PR0A 1ISRA 2DWCA 3HTXA 5LDGA 9ICGA 3G5LA 3FPSA 1SXJD 4R31A 2XIJA 5AVRA 5EGNA 8ADHA 4OFWA 4M1MA 4MXDA 2IXDA 5I9MA 3WMRA 1SC3A 2IYAA 2H5LA 4NOKA 2CNDA 3O1IC 4E2YA 2BUAA 5U1PA 5EXPA 3U3RA 1N92A 2Q1SA 4YTEA 4H7KA 3I64A 3VPFA 5B5SA 3LT5A 621PA 1VMEA 1FMFA 1BJTA 4KO2S 1TD9A 3MWDA 2FJPA 2X22A 3ROZA 4Q16A 3K1AA 3ZIAD 4FMPA 3V8VA 2LIVA 1IPHA 2XBUA 1N9ZA 3EVBA 5DM60 4Y6QA 1GCOA 3O4GA 4FFMA 5EWJA 9ICUA 4UAWA 4YRAA 4J0QA 3KVYA 1E6EA 5T7BA 4KXUA 5FO0A 4PG4A 2ZR8A 2PVSA 4I19A 5AW1A 1NAIA 3IESA 1P9WA 1V16A 1A5BB 5KFRA 2CJYA 4WZAA 4HRAA 4BNVA 7ICLA 1KYZA 5T4FA 4BUCA 2PRSA 4B83A 4XWAA 2W9CA 2AOVA 1HLDA 4TGLA 3NBFA 2JLYA 1UK7A 5BSKA 1XI2A 3K4HA 4V3BA 2Y3IA 1NW5A 3GO4A 2PZFA 2RFLA 1RFGE 2V45A 2AW3A 1KMNA 1X7YB 2WTMA 2B8NA 4HMOA 5F7XA 4MUGA 1GFIA 3IILA 2NPIA 1ZO8A 2BMDA 4LNUA 3TOZA 8GPBA 4FMBB 2Y1JA 4KLEA 3SS7X 1ZRSA 4DSZA 1RYNA 4I4NA 2J08A 3D3KA 1QQAA 1GL3A 3ECSA 4ZJUA 4X93A 3UCEA 2JGAA 1P1JA 3L1IA 4MP6A 5AQEA 5LMNB 2QLBA 1IQ0A 2FUKA 1GTJ1 3ZE2B 3EFHA 2J9FB 4F3RA 2AJLI 4QXOA 1AB5A 2G1PA 1QTRA 1H0HA 2B5VA 4B4UA 2WM9B 4Z7NB 1X13A 3FOFC 2YY5A 1MPTA 4N76A 5FFMA 4DCCA 2BFFA 3BDVA 4HH4A 5HJEA 3TH5A 4PGQA 1G7CA 1GCUA 3UVEA 1F7UA 1N0WA 5ALNA 3BSFA 2MHCA 4ASUA 2BGRA 3UAZA 2L2QA 3FBGA 5IJXA 4R3NA 3BMCB 3RBXA 1HRDA 1YO6A 1G7TA 4PHAA 1J6UA 4TSFA 1CCWA 4KR7A 4QZ8A 2QL6A 1Z37A 1R4MA 4DL3A 4QT0A 1NP7A 2FOXA 3EAQA 5B1SA 4G4GA 4K7JA 3B5IA 3RIMA 3OX1A 4HYQA 2FJ0A 1NKCA 5H70A 4N49A 1BMFD 1C3LA 5CDTA 5C52B 3OE5A 4KFTA 1ZR4A 1XLTC 3INTA 2ESEA 3PW0A 4LGMA 3IDQA 1F20A 4HP8A 4M04A 3A3YA 1H69A 3DNMA 4C30A 1RIFA 4OYLA 4HFJA 2IZ6A 2BONA 3UT6A 3Q15C 3W5DA 3MJEA 4OYHA 2LYAA 1SIOA 3ANSA 2Z6UA 2N1BA 1LSJA 1T5HX 1MNAA 3IH5A 4OX9B 3NATA 3P0EA 5G0TA 4EITA 3IR7A 1ZUHA 5K3DA 2CFIA 3KEMA 2ACEA 2EU8A 2G77B 4LQLA 3ISVA 4R0NA 4RY9A 5A02A 4QPDA 4BNWA 5EIAA 1COKA 3EX7C 2XKJE 3AFOA 4XPZA 4U7FA 2BCVA 2YWFA 1Z88A 3KTAB 3VKFA 2H0QA 3WL4A 3B1JA 4RFLA 3TCXB 3FTEA 3GNSA 1HE8B 1VJRA 1HZZC 1P61B 5FHRA 4PLGA 3DW3X 1HX7A 1SXJC 1CR1A 1FUEA 3V2HA 4B5KA 4E5UA 4DLUA 3MXOA 3GEMA 1ST3A 4JP8A 2VA2A 5FTMA 2EKZA 5GVRA 4HTFA 4RXMA 4DIBA 4KLSA 1YHZA 4TLCA 4J4HA 2Z9CA 3FTCA 3JVDA 5ALQA 4EG0A 4YMWA 2XYRA 4P2GA 2KN7A 2E9SA 2CL0X 3GFRA 4ESOA 7ABPA 3BMQB 3T4UA 1IBLB 3SI7A 5DNUA 4AY3A 1E59A 1Z0FA 2VRCA 2EZXA 1BKYA 1G38A 3NCTA 7REQB 5BUCA 3NHMA 1N57A 3DOOA 2HRCA 1D0IA 1O5TA 1M1YA 4IDOA 1GUZA 3RTDA 5A0VA 4IKPA 4CR7A 3WGYA 3CR7A 3V34A 2WJJA 4GICA 4NNPA 5KQSA 1S96A 1KDVA 2J31A 5K2MA 4H35A 3MMZA 4FDVA 2EARA 1T8YA 5AHXA 4D96A 2IBTA 1AY0A 4UM5A 4UM8B 1GU7A 5L3QB 4R1SA 1VRWA 4L07A 4LE0A 1QP7A 4GMFA 3FN4A 3HN2A 2VRWA 3IG5A 3BD7A 5L9AA 3N9IA 1WNTA 1GG2A 3KFXA 4DL9A 4GXTA 1Z7GA 3U3ZA 3LWDA 1X1BA 1RQ2A 1X9HA 2C54A 1J1ZA 4LOKA 3WHPA 2BSQA 4ZOAA 3SQNA 1JI0A 2FKAA 2IHTA 1I1OA 2RB5A 2VF7A 5F73A 3HMKA 5EZYB 4OXXA 3UNXA 3M6AA 4TLBA 4PHGA 1YR8A 2QP3A 2CHUA 1QYRA 4HB0A 2ZSBA 4ER3A 3DFKA 5F2OA 3HYTA 4K9OA 3KR9A 3LOQA 2B37A 2FRVA 2ZT5A 3HZOA 3R0ZA 3DHWC 3ORYA 4H3HB 2BGMA 4GH5A 4OH1A 5EZ6B 3Q3JB 5A04A 3C21A 3HH8A 2YHIB 2O59A 1CW2B 2PRKA 3KYCA 1NVAA 4HDAA 3L8FA 1F6WA 4KLUA 1TM3E 1NBMD 4KHPB 4TKVB 5EIHA 1QS0A 3EWSA 3TFWA 1U9IA 3PR5B 3RS0A 3WK8A 4Y98A 3NTUA 4UJ3A 4TTRA 4DJTA 4KH1A 5ESXA 4CT5A 1BHQ1 3VZBA 2ORVA 5T6BA 3V7UA 2WQ7A 1CG6A 1LS6A 2L0XA 5ARBA 2J6HA 4LF9B 4LYDA 5B1DA 3R8CA 1WWKA 4F5WA 3VSCA 2JCVA 4FR5A 1AZWA 5DTRA 1TYAE 1UOOA 3HYCA 2NP7A 2MR6A 4X9XA 3QPVA 5B2ZA 1JJFA 3CTPA 2B5OA 2HXYA 3LIPA 3PLRA 5GOTA 3H84A 2YV3A 2EKDA 1M0EA 3LDAA 4AROA 4KV7A 4N9WA 4EGSA 3D2BA 2QG6A 4LMRA 4N0PA 4IQFA 4UNQA 4YRLA 1YQEA 2YXBA 4UQPA 4HVAA 4UTNA 3ZXXA 3TYXA 4DQDA 5DHTA 1YDGA 3LBNA 3ZV5A 1O6CA 2O2CA 3C3AA 5ICSA 1ATZA 2VUHB 4MWTA 4AF7A 1T2UA 1IMOA 4D4LA 3C1UA 4RA9A 8ICOA 3FTPA 4QHTA 1MAWA 1RRMA 3F5SA 1Z5OA 2P9ZA 1XCJA 4WMLA 4BRUA 5AK3A 2QUBA 3CRXA 1ZISA 3R7WB 4D9FA 4DUPA 3JVEA 2Y9PB 1CUCA 5D1HA 1L0BA 5DGIA 1UODA 1EK2A 3LLMA 5HF5A 3CZPA 3HCCA 2R6ZA 3SYTA 1K8RA 2ZATA 2Y0CA 5I01A 1ZU5A 1DXQA 2Z6QA 4D4HA 3C1AA 2Y27A 4MV6A 2XT0A 2XADA 3OO0A 1JDJA 3WLNA 4QE3A 1Q57A 4DMCA 5EYPB 5JI3E 1F5SA 2QJOA 1QFZA 1QLHA 1PR2A 1OWMA 3ANYB 3EMBA 2AC4A 4PV7A 4TLLB 4RY2A 5DHAA 1I2BA 4EA6A 1ZQFA 2OM6A 3DBHA 4EUNA 2P62A 1ADJA 1LB1B 2I54A 3FCXA 1OAAA 5IJZA 4EHDA 2OBXA 1BEZA 3C5CA 4NL9C 4JBLA 2HBZA 5IEBA 4DLGA 1B73A 1O8BA 5T64A 4ZTZB 1OYYA 4Y1FA 1JPJA 2CLCX 2R6DA 2QPLA 4B84A 5IIJA 4Y6OA 2FWPA 2PT5A 5LDDC 1XSPA 3TD6A 1B4FA 5AOAA 3L77A 2A7XA 1S77D 1W0JD 1KHTA 3CEMA 4WOCA 3H1PA 1Z56C 1LJLA 3MMXA 5LD2C 1KC3A 1L4KA 1RJGA 2IBMA 4D2IA 1Q0TA 5GAJA 2LNDA 4KQGA 1JQJC 4YRBA 3V6LA 5CNIA 1Y1PA 4ALIA 3SSOA 2IZ0A 1ODLA 4G2TA 1Y8QA 4YI3A 3HLYA 4J7XA 3R5SA 1WB6A 1SJ9A 2PRIA 4FT4A 2C9ZA 4V2UA 2HZ7A 3DPSA 4MK4A 3VI3B 3UQYS 3WC4A 1PEDA 1JIJA 2PD3A 2WAYA 1M2WA 1N2OA 2C77A 1HDXA 3TAUA 1W5BA 5DM2A 1UXOA 4FYHA 2RCYA 5A4MS 2GWSA 2FLNA 1P9OA 1G41A 3GHYA 4KQFA 4F4CA 4IM7A 1ECPA 1VCHA 3BXOA 4AW9A 2YWRA 4I36A 4AO7A 3H8WA 5LQCA 2IMWP 1WULS 2FW0A 1ES9A 4B48A 4DLTA 1JG1A 3HWTA 2J6SA 2WC1A 4HSGA 1KP2A 1ZM3A 1G19A 1AXRA 3CRNA 5LYYA 2GNAA 2KOBA 1XRJA 1XSLA 3F5DA 1T8UA 4QOEA 2P9BA 1GN8A 5B6JA 5ALIA 4J91A 4LTDA 5ALUA 4NATA 3IPXA 4L0MA 4TTJA 3REOA 3ZV3A 3P96A 3THWB 3IBCA 2VHWA 4CFZA 1XF9A 3LCUA 2Q27A 3AHGA 3R7DA 4DSEA 2PS1A 1EFPB 3GIIA 2BT4A 2ZYVX 1TJ4A 2XOKA 2A9PA 2XLBA 3VR2A 2CXPA 3IUPA 3R5HA 4RUKA 5TVGA 4IVNA 4RADA 5CCEA 1U47A 1XTSA 1CR0A 3ERCA 1FSSA 4NBTA 2K4HA 3B12A 3DO8A 3AU9A 1AKQA 4ZQEA 1XV5A 1GGJA 1HNXB 1MC8A 2V4MA 4MGKR 1U3UA 5JBNA 4DBZA 1R9JA 4L7VA 1YUBA 2OP0A 2X5NA 2QN1A 1XEWX 4RVUA 2I1WA 1URPA 3W3ZB 4G5QA 4K46A 2ZDHA 2Q4BA 1O97D 1TQHA 4DCJA 4JC4A 1SO8A 2JJQA 2XNDA 3SJBA 4ZV4A 2ZJ4A 3OEEA 4J94A 5JHHB 4F21A 2QTLA 4F5ZA 3FVWA 1EGQA 2QTRA 2I6FA 1C3OB 5J0PA 3CW9A 3OHPA 1ONBA 2QLFA 3OOWA 3TZHA 1IBCA 2XUPA 4DV7B 2HV9A 3VYWA 3GCWA 4DCNA 5L8VA 1P2BA 3K09C 4R1LA 3QLVC 4RTMA 1ZH2A 2QX8A 1OFTA 1DC7A 1KRHA 3SQWA 1E1YA 4YASA 4Y2RA 1TX4B 1SXQA 4HRVA 3B6EA 4S12A 2ZI7A 3WHIA 5A2GA 3H4VA 2VZEA 1XTBA 1TIKA 3B7WA 4C04A 3D3NA 3TQHA 2ZULA 4DV6B 3RK4A 2HDHA 2FQWA 2XVAA 5J0RA 1RKUA 2WA2A 4YFYA 3UPTA 2HREA 3VA7A 2GM5A 2RGNC 4PN3A 1A5TA 1G8JA 4RLSA 3EPIA 3HG7A 5GADl 2PV7A 3T9BA 4Z1MA 821PA 5IU6A 1JZSA 2HA0A 3U2QA 3NFYA 2CLIB 4QSHA 2JXJA 4LQDA 4L0QA 4NPHA 1ORIA 3ZBQA 3WV4A 1VPLA 2RRDA 3O8QB 2Q8NA 4WXEA 4S1PA 4IO1A 2UVPA 1AXGA 1TPYA 2RP5A 1PVOA 5IMSA 1Q7BA 3LUFA 4B4VA 1XN4A 3OBBA 3JALB 2O8NA 4OA5A 1MN6A 4I1OA 2I2CA 1SOWA 2YN4A 1II8B 1GYRA 1KXZA 4LJ4A 3DOIA 2Z98A 1E1KA 2P79A 4JLKA 4CKZA 1UC8A 4NCXA 4BNJA 2PX3A 4M0EA 4NBLA 4O02B 4EGCB 3UB4A 1VLVA 5ITZA 3SEFA 1YZNA 1Y8AA 2H9IA 3AVQA 5EE0A 2JVJA 4HDNA 4G5FA 4E07A 3MWGA 5ALOA 1CQIB 5CVTA 1UFOA 4G1BA 5H4GA 4E08A 2Z1NA 5EZYF 4DDVA 2EEPA 1CVRA 1M2FA 1QV9A 3W2TA 4A2CA 3UFXB 4N54A 4N4AA 2BP7A 5EHQA 2EF0A 1K8YB 3KT0A 3EN0A 4NFHA 3DCJA 2XA9A 4Q4JB 1BFUA 3OF5A 5KYKA 1M2KA 4PO8A 1CSEE 3P2IA 3BOSA 4FD2A 1PLKA 1MAUA 1S0VA 4M0LA 3C6QA 5JXGA 3CPJB 1C8LA 2R86A 1XZPA 1X74A 7REQA 2FZLA 3OICA 4UDNA 1XOIA 4AJ4A 3NR2A 2PZBA 2FFHA 4A5SA 1RE0A 1Y7TA 5TY0A 5AK6A 2QUJA 3QY0A 5B66U 4PL2A 1GDDA 3A3PA 1VCOA 4TMWA 1JAZA 5DX1A 4LGYA 3LC0A 3WP0A 1SBTA 3RFVA 3ABSB 1INLA 1J2RA 3I9FA 4GKKB 5JS7A 1EFDN 3QI2A 1YR2A 3PRJA 2I71A 1XCMA 4LOAA 3UTCA 3EDCA 3FFBA 3M9OB 3ZZUA 2VOJA 2V1UA 2KJ9A 4DQKA 5DI9A 5H5JA 5D51S 1N2CB 3TADC 5CJJA 5REQA 5CCDA 1WZEA 4RF2A 1G21B 4L8FA 2I62A 1NVVR 4B2LA 2C83A 3TPFA 5JAIA 5TX7A 2JGMA 3TSOA 4BLPA 3LSYA 1M8FA 3PEYA 1WSBA 4ER0A 3WYGA 3DHYA 2MSNA 3L7AA 2AKEA 1DFIA 3A6JA 3ZLUA 1UJ2A 5CA0A 3WL6A 3F5AA 4EFDA 4WLNA 4JGBA 1SUAA 3IVMA 4MV4A 4M0MA 2Q1YA 5EZYA 1O97C 3H9QA 1XBTA 3TR6A 2BEUB 1RKVA 1TYBE 3UT5B 2KWIA 4YB8A 5HBRA 4QWBA 4EAAA 4ASUD 3WLHA 4F85A 2PI4A 4INAA 4XE5A 1RP1A 1RWXA 4TSFD 1NNSA 4ZDWA 1WV1A 2YHIA 4NBNA 1V8OA 1G5HA 2QSUA 1XCOA 3ETCA 1UKEA 2GZ1A 2FRDA 3BEDA 1YA6A 4PSUA 1EPUA 4RPJA 2PANA 1WQ4A 1W6UA 3PYMA 2UYCA 1LBHA 4DKJA 4I2FA 4B40A 4AL4A 4CMJA 1YZVA 3RU7A 1UJNA 3W4IA 1SCUA 1RC8A 2R7LA 1T2EA 5DGDA 3N58A 2G71A 1ZW1A 2Z58A 4L8GA 2P3QA 2EDCA 4I1RA 5E6UA 4D1YA 4BLWA 1IHDA 3TTUA 5KQGA 4MS3B 3DZBA 3OCZA 3AF3A 3U6KA 4O2RA 3JPYA 4QT4A 1EE1A 3WYNA 1VPEA 3BWVA 4KC0A 5L1LA 3FC4A 3EQZA 4PONA 2W2PA 3VR3A 4X8LA 2UUOA 2VHXA 3L6EA 3VZCA 4GLFA 5ICCA 1Q7GA 4BIMA 5AKXA 2GK3A 2WMYA 1YQ9A 5D6OA 4ODIA 3EQ2A 1YHYA 4YY3B 4LVNA 2GFIA 3ZXIA 4DT1A 2QUIA 3OHAA 1GT91 1R0XA 4ABYA 3X1YA 1TTHA 4AMYA 4MJ3A