3K1ZA

Crystal structure of human haloacid dehalogenase-like hydrolase domain containing 3 (hdhd3)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
MRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
publication title Crystal Structure of Human Haloacid Dehalogenase-like Hydrolase Domain containing 3 (HDHD3)
rcsb
source organism Homo sapiens
total genus 87
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.720 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3k1zA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3k1zA01
3HLTA 5AIAA 4KNVA 3WK5A 2AMYA 3FVVA 4KYTA 3ZVLA 4AS3A 5ALGA 5ALXA 3A3YA 4C4TA 3KD3A 4BX0A 1RMQA 4BNDA 2YJ3A 3M9LA 2HO4A 4C4SA 2YJ5A 3E8MA 3F9RA 3OTQA 3ZWKA 4G9BA 2RARA 3L1UA 5AKKA 3TLMA 3DNPA 4Y3UA 2ZXEA 1EK1A 3WKCA 2CFRA 4Y2JA 3AR5A 5ALYA 3ZVNA 1TA0A 4BX3A 4GIBA 5ALVA 2MU1A 5AVUA 1RRCA 2W11A 2P69A 4B6JA 1O03A 1Z4NA 2IOFA 4L6AA 1RPZA 4EZEA 1Z5UA 2G06A 4BBJA 3WK4A 5IS2A 3RFUA 3SHQA 3WK8A 1TE2A 2HF2A 3BWVA 2I54A 2IOHA 3FZQA 3ONNA 5ALFA 4BKMA 4UW9A 5AKLA 4KX3A 5AVQA 3WK6A 1VJRA 4HAIA 2GFHA 4I9FA 3EF1A 1Q91A 2HDOA 1VFPA 3I1YA 3RF6A 1ZD5A 2QYHA 4FE3A 4NAVA 1ZD3A 1PW5A 2B8EA 5AHXA 4YGYA 4OD0A 1L7OA 2C4NA 2WFAA 3IB6A 3L1VA 4EELA 3L7YA 5AW8A 1T5TA 3U19A 3DDHA 1LTQA 2YFYA 2B82A 3SLRA 2AUTA 5AW6A 3OCVA 1RC8A 5AW4A 4PNHA 3NIWA 5AW2A 3FM9A 2YMLA 3AR3A 5ALTA 2RBKA 2HSZA 2YBDA 2NYVA 4CNQA 1JUDA 4KNWA 4KX5A 2VKQA 1RMTA 1L8OA 2B0CA 3NALA 5JJBA 2GHQA 3R9KA 3U7FB 1ZD4A 1IWOA 3A1DA 1QQ6A 3MPOA 3B8EA 4UMVA 2WF6A 3B9BA 4UARA 1Y8AA 4Y2QA 5AI5A 2I33A 2I6XA 4XQ0A 4UMDA 3SF0A 5AM1A 4J03A 2R8ZA 2GHTA 1YNSA 3QNMA 2HX1A 3OCUA 1SWVA 3WK9A 1VJ5A 5AVWA 4DW8A 4DFDA 5AKZA 3UM9A 3NRJA 4BEWA 3AR2A 4YCLA 4OCZA 3I6BA 1U7PA 1ZOLA 3AR7A 3HYCA 3N07A 5AM5A 2WHEA 5AVSA 5AESA 3U7EB 1Q92A 1L8LA 2B8JA 4RESA 5ALZA 1Z88A 3FPSA 5AK5A 2WF9A 3L8EA 5AI9A 3UMGA 4XE5A 3WGVA 4NWIA 5AI0A 1YJ5A 5AK4A 5ALWA 3FPBA 2IYEA 2BDEA 3IJ5A 2G0AA 1NF2A 3QU2A 3L0CA 5ALHA 5AK6A 1WVIA 2FPSA 4EX6A 2FPUA 2NO4A 5AKGA 3U7GA 2WF5A 2WM8A 4JB3A 1U7OA 2I34A 3QUQA 5AK3A 2NO5A 3R09A 4CF5A 3ZW7A 4BYGA 2YMMA 3R4CA 1LVHA 1RKVA 3L8HA 2R8EA 4E88A 2O9JA 3QUCA 3NAMA 4I9GA 2HEGA 2JAWA 2OA0A 3MMZA 1NRWA 1QQ7A 3L5KA 5ALQA 1SWWA 2EAUA 3CZ4A 4Y2YA 1WR8A 1S8OA 3QYPA 3WKEA 5A3RA 1Z4IA 5AW3A 4UMEA 4Y2XA 4Y2VA 2W43A 5ALDA 4OHFA 1QQ5A 2GO7A 3PCTA 2BDUA 2AGVA 3ET5A 3QLEA 3I28A 4H1WA 5AW0A 5ALLA 2R8YA 2HHLA 3AR4A 2FDRA 5AKIA 2C8KA 1NNLA 3ZTYA 5IT4A 4MUMA 5AVYA 3WGUA 3PGVA 1RKUA 3L8GA 5E0OA 4IFTA 5T41A 4RETA 4DWOA 2I7DA 4HGRA 3W5CA 4EEKA 2G09A 3L8FA 1RLMA 3QXGA 2PQ0A 3MN1A 4O8CA 5AI6A 2HI0A 3KBBA 2JAOA 2C8LA 4YCMA 5AIBA 4YIKA 3B9RA 5A3QA 4YIHA 2MSNA 3KDPA 2IOFK 4KN8A 3NUQA 4UAUA 1J8DA 3QU5A 4HGNA 1KYTA 2FUEA 4IG4A 2FPXA 2YMPA 3CNHA 2CFSA 4ZEWA 3N28A 4UAVA 3KOOA 5AM4A 4UM7A 2HCFA 2ODAA 1YV9A 3GYGA 1N8NA 4ZEVA 5AI8A 3ESQA 1XVIA 3W5BA 4YCNA 1Z5GA 4UMFA 4Y2SA 4XOUA 1EK2A 1Z4QA 3EWIA 1F5SA 4OFZA 1J97A 3NANA 2ZBEA 4UM5A 3QGMA 4L6CA 5ALEA 3ZI4A 1Z4MA 3SD7A 2WF7A 2HOQA 1L7NA 2FPRA 4QJBA 5ALSA 4F71A 1QYIA 2GMWA 2PR7A 2EATA 3E58A 4EX7A 3D6JA 1TJ4A 4BEVA 3OCYA 4CE6A 1RLOA 2YJ4A 1S2OA 2ZG6A 1WZCA 5AW5A 4GXTA 1FEZA 3PDWA 3K1ZA 1Z4PX 3W5AA 2I55A 5AKJA 5AM2A 5ALIA 1U2TA 3OCZA 1RDFA 2P9JA 3N1UA 3I76A 3N8GA 3M1YA 2CFTA 2FI1A 1L7MA 2OM6A 4EENA 5AKYA 3OCXA 5A3SA 3AR8A 2X4DA 3ET4A 3AR6A 3FGOA 5AVZA 1CR6A 5FP0A 1ZD2P 3EPRA 3E84A 1TJ3A 4FYPA 3L0YA 2RB5A 3SMVA 2P27A 3ESRA 2FUCA 2ZBDA 3WKDA 2G07A 3OCWA 4C4RA 2OYCA 3A1EA 3QUBA 4NV0A 5ALNA 4AS2A 5ALRA 3E81A 4HYTA 4NFLA 5AW1A 3BA6A 2ZBGA 1TJ5A 4DCCA 1U02A 3SKYA 4J2TA 4ZEXA 3PGLA 3KC2A 3P96A 1ZS9A 1QH9A 1Z4JA 1ZRNA 2YN4A 4F72A 5ALJA 2YJ6A 3U26A 2ZBFA 2B30A 3J7TA 1MH9A 4UATA 4JDPA 1L6RA 5IT0A 3SKXA 2WF8A 3N5KA 3VAYA 2OBBA 4HGQA 3WKAA 5ALMA 3ZWDA 3ZVMA 5AM3A 1AQ6A 2FPWA 1CQZA 4Y2PA 2Q5EA 3QUTA 3OPXA 3ZX4A 5AVRA 3QU4A 4MWOA 5AKEA 3QX7A 5AM0A 2JGAA 3AR9A 1RMYA 1WPGA 3W5DA 2QLTA 2RAVA 1L7PA 3KZXA 4HGOA 1Z4KA 5ALOA 5ALPA 1RLTA 2AH5A 3WK7A 2D2VA 2B1RA 3ZU6A 2IA5A 3S6JA 4XPZA 3U13A 3UMBA 1YMQA 2BY4A 5AICA 2G80A 4G63A 4HGPA 5ALKA 5AVXA 1RQLA 1RQNA 2HF7A 3A1CA 5AW9A 1XPJA 3EF0A 1O08A 1SU4A 1N9KA 2FEAA 1T5SA 2B1QA 4AP9A 2Q4TA 3ZTWA 1ZRMA 4FFDA 1YS9A 1XP5A 4L57A 5AKXA 2JARA 2EARA 1RKQA 3DAOA 3UMCA 3IRUA 1T9ZA 2Q4RA 4UASA 4NABA 1U2SA 1ZJJA 5AKHA 2DQSA 3ZX5A 4CF4A 2YY6A 2C9MA 3DV9A 2G08A 2JAUA 5AI4A 4Y2TA 2W4MA 3NASA 2O2XA 4UU1A 3ZUPA 3MC1A 4Y2UA 4YH1A 3U7HB 5ALUA 1YDFA 3WKBA 3QU7A 5AVVA 3L0BA 3ED5A 4UU0A 5AVTA 4Y2RA 2ZOSA 2C88A 2YMQA 1K1EA 2CN1A 5AW7A 2P11A 4BX2A 2R8XA 4BNDB 3QU9A 1X42A 4QQFA 4CF3A 1Z4OA 1Z4LA 2G1AA 2PKEA
chains in the Genus database with same CATH superfamily
5JWRA 2Q46A 5I7HA 3RGWS 3DR3A 4OA8A 1Q1QA 4PR0A 4C4SA 4PGAA 3OZFA 3TIXB 4O9MA 5B36A 4PC6A 4Y9DA 4JI0B 3SZUA 4WK4B 2KBEA 1QFMA 2IYPA 5I7RA 4ZTZB 1TA0A 4HWSA 3TNDA 4MUGA 1E1DA 1KKXA 2JLCA 4CG3A 4H0FA 3LWLA 2QLMA 1JT2A 3ZE7A 4HLUC 4LS3A 3SQMA 4CKEB 3SOPA 1YCGA 4KN5A 1UWLA 2NSYA 5K6AC 4HY3A 1I24A 4ZALA 3DKPA 3FI9A 2P2LA 5ES4B 4UPVA 2H2WA 4B45A 1R0ZA 1I4EB 4ZZ0A 1GTRA 1ADBA 5EJIA 1YTLA 2IU4A 3ZXXA 3DP7A 4CIWA 4YUZA 1NVVQ 1S2DA 3OGUA 3E3LA 3NPAA 9ICAA 2X0KA 3QNMA 2PANA 1P31A 2AI2A 1ZP6A 4GU5A 3RH0A 1YR6A 1WBJB 3GGJA 1RG6A 1INLA 3JZMA 3R3SA 3K2BA 4XDHA 4CETA 4L8WB 5K0ZA 1C9YA 4RZHA 4DXAA 2C7RA 1JEYB 3G0GA 4MP8A 3DBLA 4PAGA 1U0HC 3GH1A 2WLSA 5AI9A 2H5IA 2HUNA 4AY5A 3FPBA 3AN1A 2OSBA 2EDAA 3S1AA 2R6JA 1WPXA 2ZB8A 3MGKA 1G8KA 3O3OB 2BT4A 4LF8B 1P1HA 1E7YA 1LVHA 1TCAA 4AUNA 4DR4B 5A2GA 4EUFA 2O23A 2BE7A 1T2NA 3INGA 4Y18A 1DWOA 2FTKE 5BSRA 1UK7A 5DTMA 3QJ5A 1RI5A 3KB8A 3HXOA 4QJ3A 2UZ1A 4D9GA 2P9TA 5ALLA 3OTHA 2ZR8A 2F76X 1OWNA 4ZRDA 2CHVA 1R0SA 4KQGA 1O8CA 3UF0A 4WUTA 4NOJA 4YONB 2FUEA 2QUIA 2OBYA 1K7XB 4Z3KA 2VNKA 4FJ1A 3I0ZA 3EGIA 1PIWA 2V7EA 4FN4A 4WESA 5EE1A 3TQFA 3EJWA 1KHHA 2QNRA 3QVLA 1ZH6A 2G7MC 2XA2A 4KLJA 2XSZA 3QGMA 1E9DA 4MINA 2IZ0A 2CXOA 2FPRA 1V8ZA 3IQHX 1TM5E 2PA3A 2B2NA 3ZWMA 4NMWA 5EKTA 4KN9S 2VZLA 3RT1A 3AC0A 1WZCA 4JSYA 3NMUF 1C2TA 5LZ9A 4TUYA 3WSVA 4GXTA 2I6TA 3FHTA 5FOUA 3FX2A 1JDPA 4ZJUA 3RM3A 2GLUA 4ZI7F 3RAXA 3KPYA 3M33A 1FFXA 1JEOA 1J2YA 1JXOA 2F9FA 4ANFA 2RB5A 3FPCA 5U4XA 3IN5A 4GS5A 4RGYA 2I6FA 2XQVA 3OCWA 3VTAA 1V0JA 1U63A 3GLHE 1EFLA 1D4FA 2GDZA 3ER9A 2GYVA 2BM9A 1GGEA 4RHCA 3WYCA 3VDNB 2QR5A 4JDPA 1YZFA 1G20E 4WV3A 3OQNA 2WTNA 4R51A 3DMFA 3DDWA 4QDXA 5A5EA 4XYBA 4PCAA 1X19A 3O84A 5AOBA 1VXRA 1XOIA 4HRVA 3NQ41 4EB6B 4QXMA 2JLQA 2RGGA 5KJEA 2GAFA 5DMXA 1Q0RA 2P3QA 3PJRA 1A76A 3KAKA 1TAMA 3PNOA 1Q6YA 4P3PA 4C80A 1YU6A 1W96A 1T5SA 1ZK0A 3ZGZA 3UMCA 4UAZA 3PCRB 4JVLA 1F2UA 2RJOA 3C41J 2Q1YA 3PC8A 1JPVA 4M8NE 3KUKA 1K6EA 4ONEA 4W99A 3WQSB 2O2XA 4B73A 4KO1S 5G2OA 3OU2A 4LNHA 1N8KA 2GETA 3EFOA 1ZR4A 2WMNB 1JG7A 2R8XA 4E5VA 1RWPA 4PZZA 2CMHA 4BLSA 2HMWA 4MW4A 3V6JA 3GRKA 4J3FA 1IE3A 1EHIA 2GWSA 1RXYA 3ZKWA 5J2TF 2ZXEA 3FFTA 4I1UA 1YBMA 1LQUA 2WMOB 2OM2A 3WGMA 3AR5A 3HM2A 3I01A 3IAM6 4RTJA 1KMQA 1F7VA 1P2VA 4ZI3A 4JKYA 3QJYA 4DA8A 4KAXA 4DL2A 4FMCB 2GF2A 1Q91A 3VVCA 3NLLA 1GSIA 1E59A 3AM4A 4LEIA 3L1VA 1ZWLA 4V38A 5LUAA 3SLRA 4EGCB 4PANA 5JC1A 2EZYA 1LZKA 4WCFA 3TH5A 3F4LA 1G1MA 4NVRA 2HTFA 2EYUA 3RVNA 2PKXA 4NS1A 5JS6A 2F1JA 5BOMA 1G8GA 4P0QA 2QE7D 5HDQA 2GPTA 5HFJA 3L05A 1R6TA 4RQAA 3K15A 2QPLA 3QE0A 3ZGLA 1WXWA 2R8ZA 4WXRA 3Q3CA 4DW8A 3LD9A 3EPHA 3B6MA 3M4ZA 1UDWA 3EX7C 4ERXA 4AYXA 1RAIA 2C4UA 1S2GA 3NT2A 1GL3A 4WLOA 1JBKA 2YZGA 4UVEA 2DTXA 3E9MA 4NAHA 3SBXA 1BVUA 5A5VA 3ZHUA 1LRJA 1PZGA 1OX6A 2CL7X 4IXMA 3WIOA 4Q05A 2FRDA 2C3PA 3EY9A 1E0JA 3KQNA 4KQIA 2GJ8A 2ZBRA 2Q5QA 4YP0A 3RYIA 3H3XA 1EESA 4V0SA 1X40A 4B9LA 1TW3A 1KBUA 1EKXA 3V8VA 2DGZA 7MHTA 3VH4A 5AVYA 2G04A 5CA1A 4LJ6A 3GBSA 1WJGA 3FMPB 3T9AA 4JBXA 3TNYA 1JG4A 2PMBA 2HI0A 3BD8A 2IOFK 1PFYA 4HEJA 1T8TA 5CJ2A 4EEXA 2C2KA 2AJTA 3KSRA 4O3PA 1RZRA 4RSRA 5FRDA 2DBYA 4KWTA 5HOEA 4N7JA 1II8B 1QUEA 2PGNA 1RKXA 1M8KA 4BU1A 4LSMA 1C1YA 5A02A 3ZI4A 3AZOA 2WP0A 5DE3A 3EY4A 3O9ZA 1QYDA 5KTOA 5DB8A 5G1NA 1BXRA 3MMSA 4I2GA 5H4HA 5M7EA 1ZQXA 4LVUA 1E20A 3V7WA 5CBPA 4NBLA 1KYYA 3OT1B 3ROEA 3VUEA 3ABRB 3L4JA 5KYWA 3KQPA 3PNSA 2VSFA 5FKJA 4PINA 2XF8A 2X19A 2H7XA 4UBOA 4X85A 2Z2IA 2DFTA 3HJCA 4MNTA 3F7TA 4IOMA 5H83A 5JS1A 1VRWA 1KSGA 4HI0E 4RTMA 3KM0A 3PGLA 1I8TA 4KH0A 2JFYA 4TYQA 2BWJA 3TDNA 3WQBA 1MH9A 4RY9A 1P18A 2PRZA 2DECA 1YDHA 2FFJA 3Q72A 1VA4A 3ZNNA 4RTOA 4KQCA 3PXDA 7ADHA 1BS2A 3NU1A 4QDTA 2SKEA 4GI2A 4GM4A 2J0VA 4CG1A 4NLNA 1DHRA 1WY5A 1YKGA 1NOIA 1N9KA 3SYLA 3D3QA 4HLCA 4K3UA 2PSSA 4LZLA 5K3AA 4CL8A 1U3UA 3K0SA 2K8AA 1QE0A 1YU9A 3D5QA 4YJHB 4CL0A 3LDUA 4EJSA 2IT1A 3UC9A 2EHDA 4QWEA 2HSEA 3OFVA 2FX5A 5J0OA 3HPQA 5FBQB 4I4TB 4G5FA 4M9HA 1QVAA 4G5XA 3BYZA 1CJTC 4QQ8A 2I87A 1DQNA 4NULA 1VE1A 2GZ3A 3G0DA 1SEVA 2CPRA 4WHMA 4DEVA 1SVIA 2GXQA 4EW6A 4B6GA 3A4TA 4JQOA 2WAYA 3JW8A 2ATVA 4KLOA 4BEJA 3THVA 2I78A 4XUDA 1M8GA 1PJLA 1VDVA 3VOAA 3JARA 1LPMA 3NHJA 2EZXA 2WM2A 1SQFA 2KI5A 1GUBA 3EPJA 5FTMA 3K31A 1LBSA 3AXTA 3A6JA 2PQMA 1ZVQA 3KK0A 4GUAA 2R66A 1F2TA 4DV3B 3S29A 3UXHA 1I01A 4OGKA 3WFZA 2ONCA 2X2FA 4NZOA 2YUTA 4UFPA 3T0IA 2GLEA 4M9ZA 1QG4A 1PZXA 5J4YA 3EQ7A 4MH0R 4YRJA 3A26A 4OFBA 4NJOA 4G26A 3UV7A 4TMXA 3GFOA 3KQVA 4LOAA 4XIFA 1QRTA 5KG5A 1M34B 3W9YA 4F8RA 1TAHA 1T25A 1B8UA 1XLVA 5G0WA 2BCUA 3NC4A 4E4RA 3RE1A 4HAVA 3PA6A 1U98A 1BWPA 3R9WA 2QN9A 4OXNA 2J08A 3H0EA 3VU9A 4JJEA 4YRGA 1KP2A 4MLPA 5EP2A 3W7AA 4EGSA 3JZFA 2YX1A 3LT5A 3JAWB 5I4KA 3HM9A 3A6EA 1VLHA 1OGIA 1T9CA 1E2KA 5AM5A 5AESA 1AG9A 1T2UA 1C5KA 1TMYA 3HY4A 1Z88A 3JQ7A 4ZCRA 5KFIA 1M0EA 3P52A 5BUQA 4WWHA 2A4MA 1D4AA 2PO7A 5KQGA 5LQCA 1Z26A 3ECCA 3TOZA 3FNHA 5JCJA 3BTOA 5KFDA 2NZYA 4R2KA 4OHVA 5B3LA 4FMCF 4RH0A 8ICCA 5MDHA 1O1YA 3AVQA 2X13A 4MVCA 2OYYA 3L49A 4O8ZA 1UMKA 3LX4A 4TLBA 4HH0A 2YCBA 2BPCA 4G0WA 2HHLA 3Q8LA 1Q83A 3DTVA 2F8KA 1ODLA 1B22A 5JT1A 3A9VA 4CKZA 1UKAA 3R0JA 4X84A 1NZDA 3RVQA 4DV1B 1Z25A 1M2GA 4ZAWA 5AJXA 1DK2A 3CIFA 4ZHQA 2O7VA 2DP4E 1JH8A 2QT9A 1NLUA 2BE9A 2DPIA 3T1OA 3K0HA 4Y2SA 2Z8YM 2I71A 1DS6A 4FCWA 3ZK7A 1VL8A 5GV7A 2C7PA 1ZK2A 4L8FA 1X9SA 3JYQA 3FZYA 3PDIA 5K01A 2GSDA 1G5RA 1LI7A 3OCZA 3OC0A 2OK7A 1ML3A 2HJ9A 1P9RA 2EBHX 4PN7A 1QNLA 4P58A 1E60A 4G24A 2FUCA 4D8WA 5DBCA 4HPJB 3VHQA 2FY8A 2VJMB 4Z53A 1FRFS 3ABQB 3ZI0A 5BN1A 4YD1A 4YP7A 3BKWA 3B0YA 2CNBA 4MYUA 1YONA 3C97A 5I45A 2J6CA 5JRZA 4QZFA 3QIVA 2QTLA 4TYYA 4P53A 3PEUA 5CH3A 3JQ6A 4IH9A 4JV2A 2NPOA 4Z3OA 1F3LA 5JD6A 1Z13A 2JEFA 4ZT3A 1OX4B 1RHKA 1E9SA 2FVXA 2GEDA 3KDAA 4FTWA 4KYVA 4JGGA 1Q6ZA 1PSZA 3RWBA 1VHQA 2JVIA 2RGNC 1PR1A 1QP7A 4GWLA 3ZDFA 5J58A 4LJAA 2Z8YA 4BNHA 5L7WA 4DSKA 3W4KA 2F6RA 5JTTA 1W5SA 3KHTA 1YGPA 3O4GA 2RI1A 2HPAA 1MFPA 3TOSA 2ZEJA 2RKOA 3QVGB 3II6X 4UEQA 4X7MA 1NXTA 1IXRA 5AVVA 3SOZA 1WUHS 1RM5A 3RRXA 1O4WA 3TX2A 1CVRA 2FZWA 1XTPA 5B6PA 3U4MA 2R1VB 2ZBUA 4E6PA 3MWEB 3DP9A 3GRCA 5C5EA 1UT6A 3I73A 3C3XA 4OQQA 1PFWA 4F86A 1GZUA 2O3SA 2PJDA 5C3UA 3FHOA 2VQEB 2PFGA 3DVSX 4JK3A 4AZSA 1QIKA 5BY2A 4PLHA 1ZQ1A 1P4SA 2CJWB 3AJAA 5C18A 5KVCA 2VYNA 3ELWA 5JOQA 2FKNA 3ZH9B 2WV9A 3DZCA 4BLQA 4LHVA 3UENA 4JB2A 4PVCA 3W6ZA 4F5QA 2CY0A 3RR2A 4RQMA 5D01A 5JD3A 3HCCA 1M6WA 5L6MB 4IGIA 1RXUA 2OAGA 1VPLA 3GUHA 2R6AA 4YCCA 1ND5A 1Q3UA 3AB7A 4WK0B 2IGTA 5HM8A 1J9ZA 4RVOA 4BO6A 4AC9A 4EFDA 1MW9X 2GZRA 1KF0A 3WNVA 5CAEA 3AIIA 3W78A 1F8UA 1BMFD 4I4TF 1AZLA 2AMJA 4HLDA 5LZ5A 1UPCA 2AEMA 1F8XA 3HKDA 1T5OA 3NOQA 2ZCJA 4CI0B 1U8YA 1Z0FA 1WUDA 2VXYA 4MYCA 4LPSA 4AYBF 2CEKA 5KWVA 1Y37A 3GN2A 3LY7A 3ZV5A 4ECVA 3X44A 2VRNA 3MDCA 1G8JA 2X40A 3SGLA 3BE6A 3L0CA 1SUPA 3M1IA 3R75A 3RODA 3AMVA 4E22A 5TJHA 1X14A 3U3DA 2VJAA 2V3WA 4BYGA 1BSVA 2QM7A 3KHRA 3BQ2A 4I9GA 4YAJA 9ICVA 4U7DA 4HEA6 4RPXA 1NBEA 3BHJA 1CF9A 1DKMA 1J20A 1GA4A 3CJTA 3VPHA 3IPAA 1J90A 4PZDA 5L7YA 8OHMA 4QM7A 4TMFA 3JQCA 1E2IA 1TZBA 2PBLA 2G82A 3DV2A 2R18A 1GO2A 1S2IA 1SVNA 2RHLA 3D0QA 4X6LA 3BCRA 5DK6A 2OVFA 2H06A 2JLZA 5D51S 1V7CA 3RIMA 3LUAA 1BA3A 1M2VB 3KYCA 3M5WA 2ODAA 1TKAA 3GAZA 1S97A 1C14A 1AV6A 3ZCUA 3BSSA 2EZUA 5DYGA 2BQUA 1OHHA 4MKHA 4GKVA 3TUZC 5SYAA 3PQ4A 2AYZA 1KKUA 1JQJC 2R6ZA 2KPOA 4DG9A 4YCBA 1OXTA 1SQ5A 3JCZA 2DYKA 4DARA 5AM2A 4BO0A 4RCYA 3NT4A 1KGSA 3OKFA 3TBHA 3AR6A 5F2OA 3IKMB 3V6LA 4JT4A 3R23A 4ZVLA 1N7JA 5A5GA 4IDHA 3ZU3A 2ETXA 4LHYA 1VOTA 1YI0A 4BUGA 4ML3A 4HNHA 2GN6A 2EWWA 1T3GA 4WGGA 3OO1A 4MEXA 4LBWA 1NJ5A 1T1EA 1ULHA 1IBCA 1TVMA 5GVRA 3AY7A 1QFSA 3GIDA 5AVRA 2PSHA 3KU4A 3OIGA 2PVPA 1S0MA 4H6XA 4IR9A 1KZHA 1SQ0A 2WLTA 4DNFA 4G63A 4I2FA 1Y4SA 1JKFA 2Z6QA 1ZETA 1NUTA 2VJQA 5C8VA 4JI3B 5B37A 1FVFA 4C6TA 4G3XA 1KH3A 2UVDA 1B15A 2AI1A 4TLLB 1XHEA 4C04A 3QYJA 4P3OA 2Q1UA 1F0PA 2JA1A 2DTDA 1FTWA 2E2WA 1JLLA 1JF8A 2WVAA 8ICQA 4ZD6A 2W48A 1EB9A 4UHJA 3N97B 2W0SA 2FK7A 4BJ1A 3Q5GA 1XSEA 1JSZA 4LY3A 1QFXA 3TD6A 1X70A 4AVYA 1X42A 3FYHA 4BMPB 2OR3A 5HZMA 1XCJA 4F96A 4DIMA 5LVAA 2FU5C 3K9FC 2CLSA 2YICA 4A16A 1GNLA 1ORDA 4XA5A 4A8JA 4N0EA 5E7IA 3S68A 1H66A 2YYSA 3WGHA 2RARA 5C1OA 4Y3UA 1TYZA 2XCLA 1XXLA 4Q3AA 2SKDA 3MTGA 1N2HA 2BZ1A 3E4CA 4FBLA 4DBVO 5BOSB 3RFTA 3PI6A 1W0KD 3GUUA 1Q17A 1V3TA 2Q5FA 5B6JA 1PW7A 1DQZA 1R8SA 1IJBA 4PVDA 4UBBA 4GPEA 3DCYA 3P2MA 1ZD3A 3M7DA 4RPYA 2RAUA 5LR6A 1M6NA 2ZRNA 1P2GA 2DKZA 3B70A 4WZAE 4FGJA 2XNCA 2V5AA 1T8WA 2PYDA 1G7SA 1E4EB 4MYHA 4E03A 1NVWQ 1CUZA 4KOEC 3F7NA 5BV7A 1U2ZA 2PX4A 4NX2A 3T5AA 2PTGA 3RTBA 3H4BA 1JZSA 4BB0A 3ZGOA 1QF6A 2J9XB 3PK0A 1HE4A 3FOEC 3KXDA 3DHWC 4YXFA 2R4TA 4H6WA 3QTBA 2G4CA 5KFVA 5KFEA 4E7PA 1ST2A 1RBYA 1X9HA 3I6BA 1COKA 2OV1A 2R0QC 1LB2B 2VNHA 1IPFA 2RHDA 3K8OE 1Y3HA 2XUJA 1ECJA 4LZOA 4F1WA 3G88A 2PZAA 3O8DA 5DNEA 1V48A 1CQXA 4G65A 1FS5A 3RW9A 1CP3A 3QLTA 3KR9A 2XDAA 5L95A 1EEXB 2WEKA 2NVWA 3PQ2A 4WA8A 2GILA 4LE0A 1X7GA 3KVYA 5FLEX 1K7CA 4LF6B 2UKDA 3AU6A 1XWWA 3EHDA 2ORWA 3RG8A 2LTAA 4HTFA 1E96A 1LPPA 1WBDA 3PW0A 1P5HA 1YJQA 1IMJA 4MUMA 1H23A 4ALKA 2PGAA 4J2OA 2BGWA 4UQGA 1RYUA 4PLGA 5HZGA 4M37A 1JKMA 3AJRA 2JFGA 3ZWXA 3CH7A 2OAP1 3IQDB 3WIDA 4Q7QA 3ZGVA 4XEUA 5GQSA 1MB0A 1JFRA 2HHWA 1DOAA 3PW5A 3DW1X 1DC6A 1WULS 1HDZA 2D0DA 2I5PO 2BL4A 3O6VA 1PWHA 3F4BA 5KT4A 4MZXA 1ZD1A 2EBWA 2YHBA 5FA8A 2OQRA 3NVAA 1ZCBA 2FXIA 4AFNA 4BUCA 3DMRA 3O8CA 1AD2A 2YW9A 2NRVA 3R6TA 2IDJA 3F3YA 1J25A 1N2GA 1JHOA 4XD7D 2QMHA 2GBLC 4FX5A 1UJNA 4YR2A 5EFZA 4HD8A 5A1JA 2FPIB 1Z2AA 3UFXA 3FWNA 4TTTS 4RA9B 4A82A 3HU1A 4KAAA 4OQDA 1KEEB 2VP5A 3U49A 5FWYA 4Y6PA 3S2GA 3NIGB 1YIOA 1MD9A 4QOIA 4N3AA 1XLTC 1EA5A 5E1BA 1XTSA 1E1QA 4OHMA 3Q9SA 5A3JA 4UBLA 1OV4A 2F59A 4RDXA 5TSDA 4C2UA 3TFOA 1PI3A 3N5KA 1GPMA 4P98A 2OV6A 3UEOA 3F2CA 1ADFA 4BKUA 3TADC 3ZVMA 4L5BA 3MWDB 4R1OA 1RBMA 4OREX 3P8ZA 1KC3A 4U9IS 3BS5B 1YDMA 2B92A 3WLKX 2AZMA 1QHHA 1H2XA 1MN8A 3LMKA 3VPBA 1Y1LA 4BCCA 3GJ7A 2PS9A 4ZMRA 4EA8A 5H9VA 2EAPA 4O4HA 4UHHA 1P60A 3VPAA 1GPLA 4FS3A 2QM8A 2WD7A 4QG3A 1LTHR 1YR7A 2HBQA 4IGKA 3NH9A 3OU6A 3SXUB 3DLBA 1LDBA 3HRIA 1FQOA 4F5DA 2VDKB 2QHXA 2PLNA 3ZEIA 4TUSA 3VFDA 1LBEA 3TSWA 1XK6A 3DZGA 4ZI2A 5COQA 5FR2A 2GK7A 1TD1A 3HGMA 2KLHA 3UBTA 1Z7WA 3AUXA 4KN4A 4LF5B 3K0AB 1KK1A 1M8FA 3MXOA 1CPYA 5JNWA 1DBPA 1H9BA 3AUYA 3AVTA 3L43A 3D7MA 4C9BA 2VQDA 4YASA 1W5EA 1V9SA 4M46A 1XT6A 4YRPA 3EEIA 3H8SA 3UKOA 3C3EA 2WAAA 3MIZA 4GXIA 1US8B 2WBLC 2G28A 5D5QA 1ZU5A 3SDSA 2BFDA 1E89A 1W4BA 5CT4A 2X4GA 3ZE0B 1C4OA 4EIWA 5AW6A 1GWNA 5GMOA 2WTEA 5FFNA 2NTEA 2ZWAA 2VDNB 3DOIA 3HPRA 1XD2B 1KY5A 4WZZA 3K32A 1JQKA 4JA2A 1YTUA 4N0DA 2EL9A 3MTAA 4UMDA 1KSFX 4HDQB 3T5DA 1GGFA 1SXJB 4RHUA 2CHFA 5JJCA 4RK7A 4EI9A 2BGUA 1ECFA 2F1RA 2VSNA 1JXLA 1H93A 1SU7A 3OOYA 4NYJQ 4OXIA 5BNTA 5H8WA 3RFAA 3SYTA 5KDDA 4G1VA 2OGSA 1ODSA 4PFKA 2G1UA 1FDTA 2E5WA 5F1PA 1IIPA 3IPRA 4BJ3A 2CYBA 5I4CA 2ZPTX 5DYTA 3Q1LA 4PGHA 4E14A 1DJOA 3GV7B 1W46A 4R7ZA 2F90A 2R47A 2QDXA 3DYIA 4NPCA 3CW2C 5LMCA 3KTDA 4RJ2A 4MEYA 3SZLA 1GZ4A 1E6EA 4BE9A 4PL2A 3SZMA 3UZUA 5AHKA 3F6YA 2FDRA 4RQBA 1B8NA 2RHWA 5HOQA 5EHZA 4TLEA 3CEHA 5FTJA 2C22A 2WU8A 1NMXA 3JQAA 2DLDA 1N3IA 2GXAA 3ZIAA 3RS7A 3RJ9A 3OD1A 3L8FA 1ZRSA 3C2LA 2DQKA 3SN6A 2MYUA 3QU5A 3OJWA 3DKRA 1EXWA 2XQFA 3S1LA 3AOEA 4QWMA 1N8NA 4I66A 1XZGA 4QX6A 4B85A 1G0NA 4MVJH 1ZMRA 4EATA 1ABEA 1Y1RA 3AI2A 4R41A 1Z62A 5D3MB 4DLXA 2B4KA 1S9HA 1EVQA 1KFKB 4B3FX 4KSYA 2G5PA 2XOXA 4QJBA 3FOCA 4HXFB 3G5TA 3QWBA 3DO8A 2FHSA 1JAHA 3AYZB 2EIXA 1C4WA 1JW9B 3GI1A 2NTVA 4FYJA 2CWWA 3HBJA 3N8GA 1BU5A 3C7KA 2C2WA 3WMEA 2Z04A 2BH2A 1BOFA 4DQ0A 4AN0A 3JPSA 4KQMA 1CUDA 1GTL1 5K6TA 4J0FA 1E7SA 3NYQA 1FDRA 4OMCA 5A6VA 3O90A 3CUTA 2VXCA 3MLEA 2YWGA 4BV3A 2HT1A 1AXGA 4EY5A 4CEHA 4GE0A 3L79A 5ALJA 2GYUA 2X6QA 4MS4A 3HA3A 1G7RA 4TL9A 4ARZA 7ICJA 1EG7A 3K8QA 4O0IA 4EY6A 2A1AA 3FB4A 3I9V6 1PZEA 5L3QB 1KETA 2PVCA 3F2DA 1RQ2A 2JLBA 3K9NA 5FPTA 1ZRHA 2JEZA 4QIHA 3GIIA 1BX0A 1WUIS 1YXMA 5G0SA 2O2EA 3RKSA 2CJYA 3MABA 2FJUA 2IYOA 3RVOA 5EC8A 4GI3A 3ETJA 3FYTA 3G9XA 3CNBA 5EJMA 1J2TA 3TLAA 3KZVA 5KFQA 1JVBA 2HWXA 1OB2A 1XD9A 4OHCA 1N0HA 5DWQA 4ZMBA 2GRUA 5CYOA 1MXFA 3ADKA 3W1VA 3X43A 4R01A 2EARA 3FJYA 1BC5A 3LF1A 4DQUA 4FMPA 3WGYA 3RC3A 5HWSA 5JH7B 3G6YA 4EY7A 1BX1A 3QM1A 1YRQA 5E6UB 2AFHB 2JI9A 4UNPA 3Q7IA 2O06A 4Y2GA 1PVQA 5KQRA 3H9GA 3OKCA 2WTBA 3CNLA 3U4QB 2C9OA 2OEPA 4DSUA 3H5AA 2B6GA 2VP2A 5EE9A 3FSEA 1XMXA 4YRKA 2W8BB 2C84A 1V7QA 8ICAA 1XR3A 1GGJA 2IOYA 4AWXA 2CNNA 2OP1A 4DM3A 1UXOA 3P26A 1E79A 1KI1A 1BGXT 4I1SA 1MQAA 2RG7A 3L1UA 2BMFA 3QVUA 1PX2A 2ZYDA 3RUFA 3W6OA 1IQRA 3QVVA 1SGGA 1E0AA 4B6JA 1H1TA 4KXLA 1FTGA 1OH8A 3QJGA 2E89A 3OOSA 5AVQA 2WWIA 4RX1A 4GLXA 4GEKA 4G23A 3V1LA 4BV2A 5JHGB 2W6JA 4IQGA 3SK0A 1QWSA 2HY7A 3B2NA 3RYFA 3WI7A 1FJHA 2YHIB 1T4DA 3VI3B 4XM1A 4UTOA 2DLCX 1C8KA 3QV1A 2HQBA 1JHMA 1JDNA 3GGOA 4CEJA 4INJA 3LLCA 2VF4X 4MVJI 4BO9A 3DZJA 5CEHA 2PMZC 3TM4A 1EP9A 2NACA 3ZDYB 3FOBA 4TL6A 3HKEB 3BZBA 3Q11A 4FZLA 3WZ2A 3COZA 1UR5A 1NP7A 3C5EA 4KTVE 1H5NA 3ZQ4A 1UPTA 3DVRX 5BUCA 2HDNB 1H0SA 3WDSA 3TYXA 2VIXA 4DN6A 1TPYA 3QUQA 3VR4A 2Q9CA 2XA1A 5HIMA 4HEQA 2XGJA 3SYRA 3HVJA 1RKVA 3KLBA 1H2EA 2JAWA 1D1PA 5L1IA 4AICA 4QLBA 1Z0KA 5IJ9B 1N9GA 1J2UA 3ABOB 2GASA 2I2XB 3FR7A 1OR8A 4UOEA 1UQUA 1Y9JA 3IQWA 2EXXA 3C5GA 2WTXA 3PE4A 2SECE 3G5LA 4PZCA 1P80A 3W2FA 1TW2A 4JT2A 4LGVA 2JW5A 3QXGA 2ZYHA 4YG2A 5F9MA 5AI6A 3H7IA 3A1FA 3I23A 3O31A 4KAJA 1U0FA 4IDFA 4L08A 5KSOA 1Y6FA 4GOJA 3S2IA 4FSHA 5TC4A 1HLDA 1YHNA 4EP1A 2KKPA 3MJCA 4K6FA 4DV5B 3N2YA 3TRIA 4E13A 3CSSA 2R7MA 4NV1A 2P6UA 1A98A 4G0ZA 5LDGA 3RARA 3R44A 3DPUA 3RPEA 4C3UA 5K8TA 4TSFD 4HDMB 2VWQA 3ZY2A 1O9HA 3F8TA 3AF2A 5BSTA 5FCDA 1RC0A 2OM6A 3NFRA 4RZRA 2VJNA 4B34A 3RTDA 4ZQBA 4L2IA 4G1UC 1XAIA 4NPAA 4MCIA 3C6MA 5K0GA 3IHQB 2N42A 1NMEA 2J6TA 4RVGA 1HNNA 3PGMA 3WHLA 1KN5A 3B8HA 1HWYA 4JBHA 1SZDA 2ANBA 4JENA 2W2KB 5B2EA 4N3NA 4YLGA 2QN6A 3DT8A 3DXFA 2VK4A 4AS1A 4E33A 3VH3A 2TMGA 1UMBA 3RK1A 4AO7A 4OJ6A 3S2EA 1BDMA 3M8SA 4NJMA 4L95C 1FC0A 1XRLA 1DKQA 3PIIA 5A7HA 1K2VN 4X8MA 4LWZA 2LKDA 3PJGA 4MA5A 5ALPA 1UPBA 1TCVA 3M2TA 4NZZA 4ZU3A 2XYPA 4EYIB 3JZDA 4IH1A 2UUAB 1EGVB 2YHSA 3CH5A 3T5CA 3PC8C 4L7VA 3OOHA 3VU0A 2NRZA 4DFJA 3P7MA 1RE0A 2EQAA 1KPHA 1DLIA 3QHAA 5TMPA 3T34A 2WA1A 1UMDB 5FNVB 1YR9A 1JHAA 1JNXX 3Q98A 4MUHA 5L9AA 4KE6A 1L5WA 2P2YA 3I4FA 1DIHA 2CJFA 2PSEA 5KUTA 2JCGA 5GPBA 3LZCA 4DDKA 1T4GA 4HDSB 2ZQ5A 4PZOA 1DBQA 1Y89A 1Z3IX 3VZDA 1RMQA 2RG1A 2IBSA 1E2HA 3KRTA 1GZVA 3GGGA 1BFKA 4INAA 1QIGA 1RPJA 2GK4A 3TBFA 1AK2A 4RULA 2HA3A 3OOEA 4GIBA 2CVOA 4TS3A 1DRWA 3RR7A 3JRXA 1DL5A 2IDMA 2QTFA 1FUKA 1ZIOA 1Y9ZA 2PL9A 1ZQEA 3ONNA 1PJ2A 4WCFC 4KODA 3K4HA 1KMMA 3P4YA 2P79A 4TQGA 5DPMA 4EMSA 1IN6A 1QKJA 2W2LA 2WMDA 3Q9LA 2FW7A 2RC5A 4W5WA 3OD5A 3B48A 4PN3A 3V2GA 2Y9TA 5JH7F 3HP7A 4CMHA 4GNKA 2IP4A 2GVDC 1Q2XA 2GHQA 3MT0A 4B2YA 3F3MA 4Z54A 4CLEA 5HKBA 3AO0B 5KT2A 3GXBA 3OX4A 1AURA 3NVWA 4RF3A 1MA3A 4ZDKA 1ZEMA 5J4VA 2IIBA 3RF9A 1S1MA 5K8LA 1NF8A 5MN4A 5GP1A 2QZSA 2XADA 2GCNA 1WCIA 3IULA 3W2EA 2LKYA 3NW9A 3P71T 4D92A 1VE6A 4LJYA 2FRDC 1P0PA 4ZT2A 2A0XA 3E9YA 3EC7A 3E9EA 1G6Q1 3UT5A 2H3FA 1BD3A 3K2EA 1HNWB 2UZ4A 4JX8A 3GFQA 3W05A 1P17A 4NOLA 2ZDQA 4FCTA 4Q3DA 1EJ0A 2O6HA 2QR2A 2GTIA 2O6LA 1HI9A 5J5CA 4ZZ2A 3GD5A 1ORHA 5JSYA 2PZKA 3FCUB 4OHFA 4TLAA 2HB6A 2W93A 5KYKA 5KNCA 1ODCA 1KQPA 2WWGA 1MX9A 3I01M 3C3JA 1BKDR 1AQIA 2AT1A 4Q43A 1U3TA 2VPPA 1AGPA 2Z83A 3IE2A 3QI7A 4RBNA 1NG9A 4R1NA 1OPRA 2BZSA 1QANA 2EGGA 4U4AA 1YFKA 1MC1A 1PSDA 3E03A 4UDYX 3HI4A 3E2IA 4IM7A 3DL7A 4DLYA 4BFLA 1N57A 4YUXA 3MOSA 4J7UA 2YRXA 5C1DA 3G2MA 4R8RA 5JQGA 1JI3A 5HMLA 2IS1A 2H1HA 4GPD1 1EM8B 3DL0A 4Q1CA 2ZAGA 1GL6A 1L7RA 2FQ1A 3WGTA 3R7WA 2PU7A 3A4YA 2QL6A 3GQBB 3OCYA 4DA6A 2AOWA 3GARA 3S5JA 1OTYA 2KSQA 3NXSA 5ALIA 5J1TB 3RBAA 4UDNA 2W6CX 3D64A 5CHEA 3PUZA 2CZQA 3G5UA 1N2IA 4E12A 4DB4A 1TMKA 4GBJA 5DF1A 3U40A 3TD9A 4ZGGA 2FZGA 4KLRA 2PX5A 1RPTA 3K1AB 1T5DX 1XZQA 2WZCA 5EOVA 5BN4A 2IS2A 3IT3A 2DETA 4KN7A 2XWPA 3ZDZB 4P4PA 2VCHA 1W35A 2D1QA 1KFTA 4YRRA 2RDJA 4CIAA 2YXPX 1C7JA 1GN8A 2EFYA 1SXPA 5JXHA 4KMSA 4WLUA 3PC4A 4FNAA 4NMMA 1BE1A 1YGYA 1R8XA 1ESZA 3FOZA 1RYZA 4XKJA 2R00A 3MA0A 3B9JA 4R54A 2Y1DA 4EJSC 4IZIA 9ICPA 2KIWA 4C8MA 1RT9A 2V5UA 4CR6A 4HDAA 3KTQA 2J8ZA 4I1IA 1QSYA 1JDTA 2ZIVA 2WHPA 4MJLA 2WWWA 2MINB 3BTUA 1ZPDA 1CUUA 1H4TA 1WVGA 3NKVA 4MITA 3N8IA 4C88A 3ED5A 4CU5A 3JPRA 1N2BA 1BX3A 4KB5A 4MIOA 2C88A 4CCYA 3KZMA 4HDOB 3ZUGA 3QW4B 4YA6A 3MQ2A 1GR0A 1XQ6A 5DISB 2DY0A 1XTUA 4OYHA 2QMQA 3NWOA 1NQAO 1TGVA 2PLFA 2MDTA 1FYFA 4QXRA 4UD6A 3G9ZA 4G25A 3NTRA 2FW0A 2ZWMA 3KOXA 4YHBA 2XXAA 2UVUA 4BX3A 3UO8B 1U8FO 2GEJA 3X0DA 4F2RA 5E9JA 1D5WA 1V1RB 5THKA 1KEJA 3MCAA 4JL5A 5IM4A 3PQ8A 1E9CA 3ZIUA 5L6LB 1AV7A 1XYYA 3HVUA 4JLJA 4ROSA 4ZWNA 2QAIA 4HXGA 4M04A 4K4GA 7AT1A 4BGIA 3MD9A 3A0UA 2Q6OA 1DBIA 5LXTA 1A95A 1WOMA 5C1IA 1QDUA 5JJBA 1DT5A 1G2QA 5FNVF 1SOAA 4I2JA 3FIJA 4M49A 3CE9A 4GPTA 1DHTA 4YI3A 4TWZA 5EJ4A 3NCTA 2JJMA 1O95A 3EG9B 4KK3A 1CX9B 3OQVA 3TTYA 4BNGA 5LZ4A 3EGVA 1SVOA 4GI7A 1CZLA 1K8XB 1R7RA 2P65A 3K8ZA 4N5LA 2UYYA 2H4WA 3GVXA 3U7EB 1DX9A 1BXZA 3M3PA 2ICAA 3Q41A 4BQPA 2ACVA 4H3SA 1JIJA 3U4AA 1YRWA 3KHHA 1SCDA 1T2VA 3NVYA 4NQZA 5IX8A 2FPSA 5M3BA 2X77A 5JAZA 3JX9A 4OM7A 1ZAKA 3RQSA 5EJ6A 1LV5A 1SBNE 3RFFA 3CZRA 3QZUA 5JBQA 5HJEA 1NK8A 2AV6A 4F5EA 1YB6A 1HXHA 3KQHA 1S3IA 3DS8A 5AW3A 2GNOA 1JP7A 4YJ2B 1XCMA 2ASVA 4JB0A 5CFMA 2W9CA 4Q24A 1B93A 1NNLA 3QFHA 1U0SY 2XMDA 4NJ8A 2B0JA 3D2QA 3HE3A 1ENYA 8ICYA 3CUYA 4ED3A 3EQ6A 3KHSA 2W9XA 3EEOA 1UBEA 1ODJA 1PK8A 3NDRA 5IIMA 4YIKA 3LA6A 4QBGB 2J0UB 2R751 5KJFA 4AYWA 1ZNYA 3GOHA 4KPGA 3C3YA 1AKUA 4NY8A 2HW8A 2GTHA 2BMAA 2RH8A 4FMDF 1FBNA 1QWOA 4KREA 4UMFA 4D1YA 1FNSA 1XDBA 4M1OA 2XBLA 4XGQA 4ZV9A 4E08A 1WZEA 3O8QA 3BL8A 4IINA 3CLTD 4QECA 1EZZA 1C9NA 1WXQA 4LOIA 3MS7A 4C0QC 2ZXIA 3R6LA 4IJQA 2HBRA 3LTEA 1SA0B 5JWOA 3VZPA 1J0BA 4ZH4A 2ZFUA 4NOKA 3UHFA 4PPFA 2Q9UA 3T95A 4Q0MA 3E81A 1N9ZA 2QM0A 1OLOA 3I34X 3KCNA 2ZTMA 2CXSA 4JJIA 3NHZA 4YAKA 4ARCA 1QH9A 4PY2A 3P0IA 3RRYA 4C0XA 5D84A 5TARA 2ONZA 2WFLA 1ODFA 4FN5A 4FXPA 3HWWA 1N5WA 2R85A 3TLBA 4PQFA 3M6AA 3HYSA 5IBQA 3F7MA 2CNLA 5GIOE 1IY2A 3ZOZA 2XGPA 2W54A 1A97A 3BTVA 1I51A 5C7IO 1XZBA 5LNK6 3V1UA 1H2AS 3AIMA 4HGPA 1U1DA 1SUIA 1AXRA 2H08A 5LA6A 2B21A 1Q22A 1OFVA 3TLGA 3PQ6A 4NHEA 2QD1A 3LH5A 1IFXA 1IXRC 3C39A 4QDKA 3CNNA 5HKAA 3O3NB 4UASA 1AS3A 5AOCA 3Q7QA 4ZOCA 3OMLA 4RE6A 1D09A 1WPQA 3NCHA 4OX9Y 2WAOA 4OLFA 4XQ8A 3P9ZA 2PUWA 4R5HA 3KT8A 4NDAA 5FV7A 4TURA 2QZ4A 3NZEA 2NAPA 4PG8A 4LFBB 2VAXA 2IBTA 3WO1A 3FVVA 4BMDA 3HBFA 4BRZA 1ZQ1C 5ALXA 5DI3B 4DLKA 3JTEA 2XD9A 2K5UA 5I8ZA 3SX2A 4ZRNA 4FKMA 4ED6A 1EUQA 5KWJA 5AXCA 2PV7A 1RPZA 8ICIA 4PRYA 3AUTA 4N12A 5FFMA 3R7NA 2JCXA 5DGAA 3PHIA 3AF4A 2BUBA 1NNSA 2PT6A 5FO1A 1Z29A 5HP4A 5D3QA 1YNOA 2C31A 3VTKA 1LLFA 1L8OA 3NBQA 5I8PA 3MELA 5IVKA 1USGA 1A9OA 5DLDA 1KWGA 4WA7A 1XEFA 3VOSA 4LZNA 4LIPD 3OCUA 3ZZUA 1SXEA 1VJ5A 1OBFO 4CTOA 1P2SA 4D4GA 1PGPA 1OWPA 1I7PA 2H0QA 4RUCA 3QA9A 5FV4A 1I36A 3BMQB 4PQYA 2NO1A 1JR6A 4P9NA 1HLFA 4KLQA 1DQSA 1E58A 3M34A 2J1LA 4W5RA 1P0IA 1Q50A 1DB3A 3PWZA 1EK0A 2CXPA 4Y1RA 3U7GA 1J5PA 3HV2A 1XALA 3BA1A 4YRZA 3HB5X 4P4LA 3PA8A 2WHQA 4OLJA 4AX4A 3VDMA 4LXYA 3WGZA 5J2FA 2CJPA 1KBOA 4OUDB 4BKQA 3HN2A 3NC0C 3F5MA 2FFRA 3ZS9A 2FRXA 3NS1A 4Y2VA 4YP1A 2QG4A 1N2ZA 3E7FA 1NXQA 3ZNQA 2PUFA 5A7FA 1OZGA 4ENSA 1IUKA 4ER3A 4CKBA 1MAUA 1HURA 3JWEA 5HJ5A 4QGAA 4UB6U 2JAOA 4BFCA 1N7IA 3NHKA 3T3GA 5KG7A 4M76B 3V2HA 5DOZA 1WD5A 1Y7IA 1Z07A 2Q9AA 4O4IA 6REQB 1STOA 2GZ1A 3R5KA 5JNVA 5E9QA 1EQUA 3ZDEA 1SUWA 1P7WA 4E31A 2YJTD 3GT4A 2ZCUA 4LVCA 3RH4A 3C6YA 2RHBA 5BSWA 1VJ1A 3EZLA 3IUSA 4AKEA 3K6SB 3UUWA 2A59A 3HL4A 4BN4A 3C43A 1X9GA 4WDRA 2W6QA 4B32A 1JS1X 2EKQA 2Q28A 3WNQA 2FMPA 1NYQA 3FCXA 4XUCA 2QRPA 4YJ2F 4YCJA 2NZ2A 4C4RA 3MJFA 1OJ7A 1V1MA 5D1HA 1GZHB 1W4CA 3DMNA 4KMMA 4NR0A 4Q82A 5T4HA 5KVAA 5CXSA 1BWSA 1NV9A 1UQRA 4JN6B 3ZHXA 5BRJA 4BP1A 4AMUA 1QLJA 3UGTA 1YIDA 1HIWA 5IYZF 1HFJA 1U0GA 4GP6A 1PJBA 3ANMA 1J09A 3GVCA 3ICWA 3SIXA 3RJ5A 5C4GB 2WU3A 4MWOA 5F7ZA 3DHNA 4WVLA 2G8NA 4RY2A 3THXB 4A2CA 4CMIA 4BATA 3G3EA 2FXVA 8ICFA 2P4HX 1FDSA 3GMIA 1U48A 4O3NA 2ASJA 3QI2A 4P86A 3WC4A 2QLLA 2BPGA 4CM6A 1H8HA 2GZSA 1EXVA 1K68A 1BHO1 3QEJA 4G41A 3N4MB 4UEKA 3E6AA 4LISA 4RKQA 4OQPA 4RM2A 3NGLA 2E5LB 2YW2A 2HPHA 5E4YA 1NZPA 4LOKA 1NXSA 2DQSA 3A6KA 4B3HA 4DG8A 2KJ9A 1NF9A 2BCGY 3C0KA 3U7HB 5ALUA 3K9GA 3DMPA 4HQNA 2C2DA 1R4MB 1YCFA 4A8JC 4HZIA 4MROA 2JLSA 2PRYA 3ZWAA 4OJNA 3DD5A 2OHGA 3HK2A 1DG3A 4IIGA 3NG1A 4HFNA 3WK5A 2ACKA 4OQXA 1ZQCA 5EMLA 3D3KA 4BLOA 5AKKA 3CCFA 1UFOA 3DLAA 2IU0A 5E0KB 3W4IA 1TIBA 2HLDD 3ML1A 1EX1A 3RJJA 2GM3A 5EVCA 5ITZB 1QPGA 5IBPA 1ORIA 2KJQA 2ZB7A 2HK7A 1P4HA 1IAVA 2R65A 1HDEA 1T0BA 3GV8B 5EZQA 1QP0A 2XZPA 4JXJA 2HEIA 3KJIA 4CLOB 4QYIA 3KQSA 5M29A 4LRQA 1E4OA 3I6QA 3BJEA 1XEWX 1DKRA 4Q7MB 2Z9DA 1C4XA 1RRGA 4DWJA 5K0FA 2NV2B 4F84A 1FF9A 2PMFA 4DLSA 4YMSA 2WE7A 3KQOA 1S2MA 1PG2A 3Q3EA 4K2AA 4BWFB 4C4XA 3K6KA 1CIVA 1CY6A 3HXPA 1DI0A 5CM2Z 1O6ZA 4M4SA 4M86A 3DEIA 1NQTA 1WMSA 4GMDA 5IDYA 3HL0A 2IHNA 4W6QA 2OQIA 4R66A 4MAAA 4ENPA 2A9PA 5IKOA 2IYTA 2WF5A 3DB2A 3SMQA 1KI6B 3TMYA 3ZNPA 2BEWA 3ZD6A 4LHWA 3ND6A 3RRZA 4TQUS 2VSYA 2QSUA 4XDYA 3MFYA 2EJCA 3F2IA 3K5HA 4OYLA 4K81B 3CE6A 3BORA 5IC6A 1AT1A 3N3AC 2XE4A 4G37A 4XVUA 2G70A 3H84A 2HOIA 1AH2A 4KITB 1TA9A 3MMNA 3SCZA 1SCKA 4HYYA 2I4OA 1X0XA 2C1XA 3S4YA 2JHGA 4OLBA 3DLPX 4DZTA 4MUFA 4P22A 2WC1A 3QA3E 1UJ2A 3T4UA 1IHUA 2K2WA 1MX5A 5CB1A 3UUGA 2HXGA 3N0XA 3RH6A 3DUFB 1VIMA 5AM4A 2JJ1D 3OM9A 1IC6A 1VSVA 3LS2A 4CMBA 2B5OA 4B3CA 3QG1A 4LZJA 4Z49A 4KYUA 3E7WA 2AMLA 2E6UX 2Q6VA 1V35A 3PNKA 1Z6ZA 1I3KA 2OCKA 2O52A 1VMAA 3VXKA 5EWMA 5JY6A 1JSCA 5D87A 4FGSA 3B1FA 4DA9A 4Y98A 2QXYA 3UMVA 1NE2A 1NHGA 3SMVA 3R6DA 5DWVA 1JGTA 5KJ6A 2P9HA 4UU8A 3EIEA 2H8GA 4KBGA 5ADVA 1T4CB 4Q9DA 5BWOA 4G5QA 4JY7A 3K96A 1JQLB 3T0FA 1M83A 4J2TA 3FFAA 3PQCA 2IEAA 1A2KC 3TKLA 1ZXLA 3C4VA 3K4GA 1QBKC 3W34A 4R8UB 4HB4A 5J1SB 1EHYA 3U9SA 3G2IA 3EGDB 4PZUA 4EG0A 2WAQC 2XYGA 3D8NA 3Q12A 1PK1A 4KKVA 3E22B 3DPSA 4EW2A 5LDHA 4DHWA 2IZ1A 4YY3B 5IH3A 4R8KA 3V1TC 3AF1A 2YNMA 2HHHB 5C3MA 1YO6A 4UUQA 4YB8A 5FPPA 5H4GA 4Q12A 2QE6A 3VU1A 5JYCA 5JV5A 1SULA 1NXVA 5HGJA 2RI6A 1T3ZA 4A10A 2HCTA 3G59A 4KXVA 1QZUA 4PWZA 3UHPA 4BZWA 4GRAA 4XTRA 4H9GA 4YH1A 1L4LA 4I4LA 1CDDA 3GUVA 3WKBA 4JJ6A 2V0NA 1VRCA 3LUDA 1NUUA 1UWVA 2CXHA 1BQEA 3PI7A 4UZSA 1OD6A 4KLFA 3DNFA 1F8GA 1TK3A 4QUAA 1V5EA 4EBFA 5EPEA 2MJLA 1W59A 5NLLA 3L1IA 2XXJA 1T2AA 1Z5UA 3WK4A 4H1HA 4XARA 2BCSA 3LI2A 3FNQA 1OXMA 4BQRA 2BAGA 4KV9A 4F06A 1ZQYA 4ZYVA 3L7AA 1A0PA 4QWBA 4MVJD 4FE3A 1Y5RA 3KHLA 1VJGA 1N56A 1L3BA 3CH6A 3P9YA 4NQRA 2OG1A 1NF3A 2I1WA 1IOZA 2ZP1A 2F1OA 5I9NA 3QX3A 4G1MB 1ED1A 4YP3A 3DBOB 2A88A 3VO2A 4RPHA 2O2DA 4HYKA 2VQ3A 2D0PB 3U7FB 1GA6A 2IV3A 1ZD4A 4C0ZA 4AECA 4EBDA 3SWWA 8ADHA 4S1PA 1L6IA 3KIPA 4ZJYA 5FD8A 2J32A 1G42A 4XIJA 2X9QA 2QRNA 3KFLA 3B1WA 2VAMA 5FADA 2NU7B 3JWGA 2DKXA 1LPSA 4M21A 4M54A 3IG5A 2IU6A 3DUWA 2WJVA 3A36A 5WRFA 5JFGA 3C5FA 3UJ7A 4K87A 1K3FA 1OLXA 1MT0A 1NXWA 4M0EA 5TS2A 1JEQA 3L8YA 4ZVQA 2YS7A 1Q44A 3UK6A 5IIJA 2H3EA 1F6WA 2CMGA 3HA5A 2QY9A 1G0OA 3RRJA 1SHZA 2I3BA 1P4JA 2QQ0A 2YY5A 2EEPA 1LKYB 3GUYA 4EL5A 4NEHB 5DHFA 2WSSA 2GNPA 2EAUA 1FUIA 4TKUB 5BR4A 5E6SB 4UMEA 4C7JA 1W93A 4DFPA 1U2RA 4FFOA 3NEJA 1HQKA 2ADFA 4KR3A 1X2EA 3KQUA 5LU8A 1ECGA 4NFYA 3TIIA 1GNTA 3VVLA 4LOLA 1C0EA 4I7EA 4F1JA 3RAPR 3P2OA 4WOBA 2G71A 2NSHA 3AOEC 1KR5A 1J0DA 2H3HA 2EFCB 4K40A 7ICUA 3U44A 4S12A 4DWOA 4ZODA 3SHOA 3SC2A 4CKYA 4JYZA 2R8JA 4MW0A 2G8LA 3UOGA 3H17A 2I8CA 3HJBA 3IV9A 1H0RA 2IL1A 3WBKA 2VK2A 1JIVA 3QMPA 4JODA 3KOOA 3ZWQA 2I6QA 5EKSA 2XKJE 1ACLA 4Q3LA 5TE9A 2E8MA 1UDCA 2Y1CA 3HJRA 3DM9B 3D2AA 4U39A 1T0UA 3TZKA 3W2GA 4MQFA 3HN6A 1UIRA 2CSXA 4QWCA 4MQ6A 4FHEA 3HJAA 1PVPA 1MV8A 1X13A 2GO1A 1WSDA 4B46A 3OX3A 1K6MA 1LVUA 3QELA 1JHDA 3OEED 3KZOA 1Y5MA 1X1SA 2CFTA 3LUKA 2CNWD 1HYEA 3BIOA 3LOQA 4RA6B 1XJ0A 2A9QA 2WKRA 4DLNA 1CULC 3RVMA 1Y34E 1MU0A 3OPYI 2A92A 2A1UA 5AW1A 2FSSA 1M2WA 221PA 3DVAA 3E2MA 4NNPA 3KETA 4MWGA 1HTWA 3O83A 5IMBA 3OLYA 4YJGA 1WF3A 4FFBB 3ZQ6A 1C7IA 2VN8A 3QEMA 4NS4A 5CYGA 4A4DA 2QX8A 1MA0A 4YXJA 3LBYA 3I6ZA 2KSOA 4B6PA 2QX7A 3RSZA 1VGVA 3ZZ0A 2D2VA 2RH9B 3P9QA 2IF0A 3LSYA 3LDGA 2G80A 4IIJF 4QU9A 3AVYA 4JBIA 2H2DA 1CY7A 1PG5A 5AUPB 4LZAA 4YAFA 1Z0AA 3GT7A 1ZRMA 3H6GA 1YB4A 3VNSA 4UBNA 1R6XA 3BICA 4J0CA 3OZAA 4IIHA 1KMIY 2Q4BA 2VRBA 5AJVB 3BPSA 2C9MA 1QGUA 3QK7A 4BDPA 3V48A 1NGSA 3ZUPA 3TTXA 4Z5XA 3JZAA 3FFWA 4MVJG 3J80A 2YTUA 2NTJA 4B3GA 5D6OA 1XF1A 1HE3A 3WL6A 3AK4A 4PIMA 5GZ1A 5HQ3B 4O25A 1XZJA 4LNAA 4DCJA 2UVWA 3NYIA 1U99A 3H04A 2R8PA 3SXPA 4ECWA 4L8LA 1KXJA 1J06A 5EJ8A 1C7QA 1POWA 3PUIA 2VTBB 2PQ6A 2HV9A 3HBNA 1JLRA 4CR7A 8ICJA 2LRHA 3VO1A 1NDQA 2QL7A 5DNAA 1NQUA 3HCRA 4CKWA 2P75A 1QG6A 4FZ3A 2QN2A 3H8JA 2JGJA 3LO8A 5ECDA 1J5XA 3SHTA 1Z0JA 5ALFA 3MGIA 1KDOA 4R0VA 2YN2A 4F2HA 3KWLA 4OGGA 3H3FA 1GGKA 4D8TA 3R7AA 3A6HA 1JR3E 2NQ8A 4DMHA 4KXUA 5AT1A 3D6AA 5BN5B 5DM1A 1M2EA 2A5FA 1PQ4A 1X6JA 4N41A 4QOEA 2EH9A 2BI7A 2XDYA 4IXDA 3KKPA 4J16A 1R0LA 1WZUA 5SYNA 4HUQA 4AT1A 2FOXA 4LC9A 1RI4A 2YZ2A 2JIBA 4DIFA 1WZNA 2WP8J 1AQLA 5FPSA 3D5TA 4Q9LA 4FHCA 9GPBA 1U4NA 1GU1A 1IOWA 1VJDA 3U4GA 3MUFA 1M1YA 2V3CC 1ITZA 1OZAA 2KFNA 3PFIA 1AM4D 4PBSA 2HHQA 5EFOA 1YFZA 2W9AA 2FG5A 3DBIA 3ONFA 1BZYA 1QOZA 2O0HA 4TWAA 2V6IA 3IA2A 1Y8QA 3CZ4A 1W85A 4DRZA 3TUIC 1GDDA 2P9YA 3FDZA 5FI0B 1LF0A 3KE8A 1KP3A 1IXKA 1WE2A 1T1IA 1WWKA 4C7OB 2AI3A 2C95A 2ZS7A 4EY4A 4I9NA 4D74A 4US8A 1FRQA 4A0HA 3I61A 1BVSA 4EKNB 1VLZA 1R5BA 3OTOB 4ZOBA 3PF9A 3KR1A 2XY5A 2M32A 4HQ0A 5C1BA 3ZU5A 2MSNA 2OYRA 3V33A 1CK4A 2GK6A 4IHJA 2VHQA 3VKGA 5D46A 5ERGB 4MKFA 1DV2A 4HDRA 4WTOA 1VE3A 3R6GA 5TF0A 2WV7A 4HPWA 4CMKA 3TAUA 1B14A 4P8RA 3JD0A 5FUYA 1G18A 4LTDA 2OCDA 2XCSB 3C28A 2PKWA 4Q1EA 1P45A 1GU0A 4EARA 4Z4FA 6CHYA 5CXUA 3JASA 5C2JB 1B41A 3VCBA 2A3VA 3Q3VA 1FYVA 4M7RA 4ZO9A 5HG0A 3NHUA 4UHFA 2FN9A 3HV0A 5I6DA 1UCFA 2X2PA 1X39A 3PUHA 4U2KA 3X3HA 2VUSA 1ZQRA 2Q21A 1FA9A 2OB1A 5GJVC 4I55F 1FU4A 3E9ZA 1QDLB 3E9QA 1I1HA 3DDUA 2YRFA 1XEAA 2ZK7A 3VTFA 5BYJA 1VM6A 2VA8A 2W04A 1Y1QA 3OA2A 4U0KA 4O0MA 1NBOA 3PT5A 1RYNA 4O5CA 4AQ7A 2GN0A 5HYVA 4IQUA 1PWZA 4RYLA 1RACA 3G02A 1X7XB 3OZIA 3LY8A 2ZSIA 1T9AA 1IB6A 4XVHA 3EIWA 1A7AA 4CKCB 3T9CA 2UDPA 4DCUA 5ARDA 5FTLA 4L07A 4NLBA 2Z08A 4UBMA 3GRPA 1E4VA 1KDTA 4M53A 1RU3A 1CRZA 4BNXA 2A33A 4M7PA 1YVUA 4M9UA 1QOPB 1NXPA 2XCPA 2KNJA 1K4KA 2RGEA 3IBFA 3LHSA 4QA9A 3EUEA 1OIXA 4U7PB 2XDWA 3LTNC 1G3IA 2VDQB 4CM1A 3DQQA 5IAEA 4X3CA 1UWKA 3W06A 1V71A 4LRXA 3UH1A 1MIHA 4BDTA 4HKTA 1RBQA 2GQ0A 2ZJ6A 3WFIA 4OBWA 2QMYA 3VSEA 4EO9A 3P0EA 5DG7A 3SIPA 3MGVA 4LW8A 1BW9A 2J3QA 2BTOA 2X5JO 3QU9A 1EDBA 5DGHA 3BFVA 2P4SA 1L7QA 2Z3WA 4X65B 3AW8A 4NBRA 4QPDA 2A86A 3N0RA 3DKIA 3RVDA 3OUZA 1R00A 4YWHA 4LWOA 2VDRB 1SOMA 2WVGA 3RAFC 2JH3A 1C9EA 3WLEA 2IV7A 3F5AA 4WASA 1UZAA 3ZLUA 1EB8A 1KOGA 3CW9A 1NVGA 1LJ8A 5HCIA 2A1TS 4OAPA 1GG8A 3QZ7A 1RI1A 4MPTA 1ZOPA 3EC2A 3RRGA 1A8QA 2H4XA 4E5NA 2O8EA 3A6LA 5AW8A 1T10A 3BRWA 3BIXA 5DEIA 4MW5A 5CK4A 1SAYA 5HX7A 3EAFA 1Q1EA 2YC4C 3NHLA 1C3LA 1EI9A 1ZJMA 2XUAA 3V00A 2QJWA 3I6IA 2AK3A 4JLUA 4WECA 1VZ2A 2XCIA 1W34A 1J49A 1R5OA 3AVVA 4U8HA 3CZQA 1MJGM 4S1OA 1YULA 3RIXA 1TUGA 3R6WA 3V3KA 4MFFA 3WNCA 4I6JA 1AY0A 5ELLA 3WYBA 4KFCA 3VR5H 1PR4A 3WHIA 3C8UA 3C16C 1EIZA 4ND4A 2J3DA 1A2QA 2Q8NA 4N8EA 2V7WA 4OJOA 5EXEA 2HNBA 2PVSA 2ISQA 1LRKA 2OXRA 3RC2A 1QC5A 2G77B 1JKXA 1XVLA 5J2UA 2JAPA 3PXCX 2BONA 2X2OA 1T1RA 2VCEA 1RJ9B 4RS3A 3SC4A 2VLIA 4KR0A 4DE5A 1G21A 4AO6A 1Y98A 4E32A 4EUNA 1E1NA 1I2DA 2IMWP 2XOKA 5GJBA 1TJNA 4TV8A 8ICUA 4N0QA 2IHZA 1LBQA 1CR0A 3JV7A 5DMHA 1WDTA 3CF4G 1XTRA 1OFIA 5K3FA 4CDRA 5BV0A 2IBMA 2QXUA 3Q0TA 2OD2A 4YDRA 1E3SA 3ISTA 3M8RA 2M6SA 5DX0A 1JBQA 3T5TA 2VT7A 2I7DA 3ZWYA 3EFBA 1I3MA 3T7KA 4AF8A 4Q4AB 4IRUB 5JQWA 3QFTA 4DQVA 4KQ6A 5F33A 1T6NA 2N47A 1MJGA 2XRYA 2HOFA 1KZGB 3EPKA 2FWJA 3Q9NA 5AI8A 1R8QA 4DR3B 4YCNA 4YXWD 4IIVA 1V41E 5C35A 1HT0A 4MZDA 4M6WB 1BGWA 1CUCA 2AHOB 1F8YA 5L45A 1RRVA 1Z5OA 1ZUHA 3PY8A 4U7GA 2PZ8A 3TIVA 3EQ2A 1R0YA 4QVGA 5T57A 1Z82A 2NVUB 4MVXA 2I22A 3CLVA 9ICWA 3AR8A 4JH0A 1O97D 5F1OA 2CBZA 3FCEA 3RU9A 2HDWA 3MWYW 4AS2A 3HCBA 5BV1A 4N54A 1H8EA 4Z8YA 3A31A 3W2TA 4HNAA 1DWQA 4B5KA 5FWXB 1ZM7A 2HM7A 2IX3A 1FVXA 3JAKA 3GK3A 5KAFU 2LNDA 1WKBA 4YCSA 4RNOA 3LGXA 1ZXXA 4CM7A 2O1XA 4XPIA 4X64B 4KPFC 2R00C 4RFLA 2NU6A 3GDOA 4CODB 1IHPA 3QX7A 1UH5A 3ETGA 4XAQA 1L7PA 4HUJA 4RWEA 3JD4A 1U28A 2FPMA 2HJVA 1PE0A 3LYLA 7YASA 2RJ3A 5IAAA 1RRFA 5J0PA 4WOJA 4HZGA 5F64A 5EQTA 2CB9A 2JAQA 4LUCA 1Z22A 4CQLB 1Q8KA 4EHNA 2VJOA 5KFMA 4W1PA 1MAHA 1UWCA 4P32A 3QKSB 3ETDA 4EHJA 4TRNA 1CS0B 1NLYA 3NM4A 4Y2RA 5G3ZA 1X7WB 2ATLA 5TEVA 4FMDB 2PUGA 5JNRA 3PC7A 3ZJTA 4U2FA 2PMDA 1CUXA 4CIYA 3IAS1 2XWBF 3KD3A 5D3ZA 2OO3A 2VUHB 3Q3JB 1GKIA 4J9NA 3MPUA 3WGGA 4A5OA 5FJJA 1NW6A 3R7FA 3UV6A 2QN8A 2X9VA 4EKEA 1HZZA 2F44A 4AURA 3B60A 2GM4A 4I1OA 2H5JA 2I54A 3TFWA 4JLKA 2HRDA 2GCOB 2XB4A 3SLGA 1UC9A 5KAIU 4DY6A 1OLUA 4JJZA 4RK4A 3NDIA 16PKA 2I7CA 3A8TA 1HT2E 4QQRA 1ARZA 1Y3DE 4LKRA 3FM9A 1ORRA 2H6EA 3ITEA 4XJVA 1O95C 3PUJA 2FDXA 1K0UA 4HEHA 5CITA 4J43A 3NWPA 4W82A 2BTQB 4PIVA 3LDHA 1H4VB 2FMQA 2XF2A 3N53A 2Q0XA 3LL7A 5CFPA 3P27A 3E5NA 5K5EA 1NMZA 1CFJA 1Q0SA 2IY7A 3FNGA 3HP4A 1K63A 1X7YB 1H6CA 2YV4A 5E1OA 1YJCA 3P0JA 1NRJB 5F7JA 3BERA 3TLKA 1A2OA 3BT7A 2AXNA 3H0CA 4JDUA 5J4LA 1UJ4A 2QP9X 3L6DA 2C5FA 2IZ5A 3GUCA 2BM8A 3ENWA 5EIEA 4CGYA 3EZ9A 5JZOA 2H1SA 3CKKA 5IILA 2PUBA 2XUPA 3M9WA 3EXEB 2R2GA 1AGNA 1U8CB 3LJKA 3NAMA 1DIAA 1XF9A 2QMEA 5EZYA 1UP4A 3BBLA 4HH3C 2H9IA 1E9EA 4M8IA 1E1YA 3O9VA 2CMDA 1S8NA 5BR8B 1Q1GA 1MB2A 1I3OA 5BOLA 4TT3A 5DQIA 2A5LA 4CQMA 3O2QB 5T4EA 1MC5A 2UYCA 1SHLA 4YAOA 2FEKA 1CQPA 2YBEA 2ILTA 3QYFA 3W1EA 1CP2A 1RM6C 4ZK6A 2ZTDA 4MUNA 4TLDA 4H31A 4MCHA 2C42A 2ZYSA 1GZSA 3R7DA 3MBYA 1BCRB 5FLKA 1FOEB 5J0RA 3RUEA 1O96B 3IAEA 3OT5A 2AW3A 2JANA 1U1EA 3RFCA 2BFMA 4KFRA 2J9GA 4Q66C 2AKYA 4YV2A 3ESQA 1RSZA 3ETEA 3UWPA 3ALRA 1Z5GA 4B17A 3EOZA 5TLSA 4GF5A 3IMKA 1JLSA 2AOUA 3IR6A 3E3MA 5KX5A 3ANYB 1EA7A 4ILEA 2ZIWB 4Q3BA 4KK4A 2LPMA 3OBBA 4IFIA 2NUPB 2XWQA 2X41A 5DB7A 1A0OA 4ZU6X 4MI9A 1EFAA 3GP3A 4BO7A 2QL5A 1O0SA 1T8UA 3T0GA 1YQTA 1B2LA 2X4DA 4FWIB 2E0IA 3OQMA 4RIIA 2P3SA 4JU9A 3S55A 4V2IA 3GNQA 4FNOA 4BN5A 1Y6ZA 2DWOA 1C30A 5TVKA 1RM3A 3GBVA 5L3SB 4WT7A 1RZ3A 3O4HA 3TWOA 2M9NA 1J2MA 1SB9A 4UB4A 5K7SA 2Z8ZA 3WKAA 4OHXA 3CLUD 3EC1A 3L7NA 2NZUG 1VMEA 1W5AA 4M99A 1P9OA 3N70A 4B7UA 3FTDA 5KYXA 2IA6A 4XGKA 3W5DA 3TMKA 3GLTA 3OPNA 3U13A 4XWOA 1WB9A 2FJ0A 1ZMTA 1U7UA 3HB9A 2CDNA 4F38A 3N86A 1Z2NX 4N6GA 3IRUA 1PLLA 2PZBA 4Q4HB 3E9DA 3I8XA 4IS7A 4D56A 4XI9A 1U9CA 1YDFA 1L5QA 4G01B 1K27A 1L5YA 2YIDA 3QHPA 3VHXA 3FLBA 2I2DA 1WIWA 3I9LA 1WBBA 3PX2A 4ZVMA 4A0RA 2BZ0A 1TO2E 1VL0A 3W2HA 2SCUB 2CBXA 2VYVA 4PAWA 1VYHA 3F6BX 1E0KA 1VKOA 1YS2X 4AMVA 5ALYA 2OZLA 3VU8A 4OYYA 5J0XA 4WBNB 3FWPA 1KAQA 4PSDA 3EPIA 4PHPA 1MSWD 3CZPA 2IHKA 4EA6A 1H2YA 5CCEA 1T5LA 1J4AA 5JAMA 3UXOA 4I1YA 2BFCA 1DEHA 4DL5A 1CJKC 2CL0X 3BJRA 1B74A 2YYZA 4BMSA 3DA8A 1ZW6A 3NBYC 2KMLA 5IYZB 2V96A 3ADPA 3I5XA 2VHUA 3LPMA 1I10A 3RC1A 1ULZA 3FSGD 5L1LA 2L2QA 4FT2A 2R8HA 2GEFA 1W4AA 2QVBA 1NRIA 5AVSA 5F7XA 2EFGA 4PYKA 2WUGA 1FFBA 4FNMA 1CQJA 4LSZA 3R5HA 4N0MA 2P1DA 2YB4A 2EKZA 1RXIA 3KVVA 4G5YA 4DLRA 2HZBA 1XZAA 3NETA 4EUKA 2P2GA 2WTFA 3REGA 1NK7A 1E5VA 5IDWA 1YZ7A 4PC7A 1B23P 4DIUA 4Y30A 4REQB 4OUKX 3G2HA 2HK6A 3MMZA 1QQ7A 3R0XA 4HNQA 5FUMA 4OKSA 4KQXA 4Y2YA 4RELA 1LLQA 4IIYA 4QTZA 3T6KA 1C7RA 2RHFA 1IBLB 1L8XA 4YJFB 4WKGA 3HRDD 3SEIA 4G8BA 2HJRA 4FOLA 4UC0A 3LK9A 2FZLA 1XIVA 3HNOA 3RJGA 2V8BA 5IUKC 4MRMB 2QGNA 5EIHA 3RKUA 4GUDA 1IRXA 2AWOA 2OC4A 3BQ1A 1LWNA 3AHFA 3KBBA 1EE1A 5EWEA 4QW9A 4E2FA 2EJWA 5E9WA 1V6AA 4J07A 5IARA 3FNFA 4DBLC 5EIWA 1NXXA 2TMYA 1Z4QA 1HR0B 2XCTB 3IIMA 2GA9A 2AF3C 3CB4A 4O33A 1Z08A 3ZC3A 3Q6IA 4KACA 3TE7A 2WNHA 1DAEA 3GLGA 3IP1A 4G3IA 4G1BA 4IQFA 1JA0A 1BO6A 1VLVA 4RQ7A 3G0HA 1OWMA 1CZHA 3QP9A 4HDNB 5JEEA 3TZHA 3KKQA 2V97A 5KFCA 3LQQA 4CVNA 5HR6A 4PV7A 4TYWA 3LBIA 2YFKA 4TXMA 3PUYA 3WBFA 3WZLA 1T2EA 3UB4A 1E5QA 3SU8A 1OASA 3GCDA 1XNGA 3ENVA 1L7EA 3AEZA 5G40A 2ZBFA 2MTBA 1CYDA 3H4MA 3NOOA 4IVRA 1NJYA 2CC2A 4Q45A 3TXAA 1DJNA 3TECE 2QDKA 4MW9A 3U7RA 5HR7A 1PR6A 4WLEA 1X15A 5U4QA 1QHXA 5KG2A 3UMYA 2QY6A 9ICTA 4PGFA 3HCEA 2AOXA 1JRLA 2ZTSA 4NZMA 1ZC4A 4P93A 1N3YA 3ROGA 3G8BA 2O0KA 3TAPA 4X0EA 4BAZA 3QW2A 1N6KA 3BMNB 4LQ4A 1CIPA 3I05A 1LLUA 1OUMA 2BM0A 2ATEA 3LYHA 4MKXA 3FWKA 3OLXA 2QRLA 1UAYA 3GRYA 1P75A 3AF0A 3Q8PB 3F6EX 3N7UA 5AKXA 4WKCA 4CR8A 2GZAA 3UQZA 4PCLA 3EG5A 4O3SA 3DOJA 5CA0A 2VPQA 3AJEA 5KG4A 4DUGD 5DV9A 1YHYA 3R8CA 3MC1A 3AUKA 3EAGA 3DV0B 5AJWA 1PYDA 1QYCA 1KMHB 3TZBA 4WZBE 3FVRA 3PLNA 3UAOA 1RJDA 2KM1A 4ND8B 2PKEA 2QAGA 3T1QA 2JIZD 2VP3A 2DT8A 5GJCA 4MV8A 1TLLA 1MNQA 4BMCA 4BNDA 5DXJA 3JR3A 2QUAA 3BXPA 4YRNA 1NBHA 4M9JA 4EO4A 4Y2JA 2DFVA 5IC4A 2OWDA 4OXQA 4EZEA 3VPDA 2ZULA 2Q3BA 1KEZA 4CDNA 1QE5A 3WTCA 4NLZA 2IP1A 3B20A 3FZEA 4Q18A 4EHLA 3KQKA 2J48A 3HKZC 1UC8A 4FMBB 5FQOA 1FUYB 4V1CB 3SF8A 2PRIA 3V55A 2AQHA 4ZAVA 3PW2A 5AW2A 4TS1A 4M9RA 2IHJA 2EZZA 2PMEA 4I27A 1NR1A 2B8WA 3SJAA 1ISJA 4AP6A 1ECWA 1KHTA 4RZXA 2JFZA 1DPGA 3PPXA 4JYPA 5C81A 3H4TA 3G49A 1TRKA 2O4CA 3HRKA 3WJ1A 2ID4A 2QZZA 1UKEA 5CCDA 2HX1A 2H4HA 2I80A 4E7OA 5AVWA 3VR6H 3T7RA 4P2HA 2XMGA 1M2JA 4PFSA 3WX0A 1IAQA 1N4DA 2IPMA 3BL6A 4AX8A 1XCGB 5D5HA 1EEHA 2B4AA 3DMTA 1JYEA 5J5AA 3VR1A 5G0UA 5ALWA 3RFXA 3X1MA 4D3YA 2CFIA 3CT6A 4J29A 4F92B 1YE3A 4LGMA 5TB5A 7ICFA 4WBNF 3U0BA 1NN0A 5I9IA 3G7SA 1TEXA 1E0SA 3A58B 3ZCTA 1NURA 2WKWA 1N5MA 3D43A 3WP1B 1CD5A 2Y3IA 4D0LB 5JCOA 1K7SN 3AHEA 3V7NA 4YT5A 4K46A 3V4FA 1UMCA 3AFGA 2WWRA 3NHPA 1UAGA 3NAQA 9ICLA 4BV9A 1J1UA 4U1RA 2FLPA 1MV5A 3TAHA 1YMVA 3D5EA 3NB0A 4IX1A 3QWIA 3H2JA 1D2GA 2EX0A 1E1CA 4J7CA 1CRQA 3ESXA 1NBMA 4BJHB 4QODA 2H1IA 4FHZA 2C7BA 1NKTA 1HQDA 3CX8A 5FR1A 5LL6P 1CEZA 4UKDA 4FR0A 1BGVA 5KVSA 4HNRA 4OHWA 4JIGA 2HBZA 2XUGA 2WM3A 1F0KA 1YI1A 5ULLA 1X1QA 3MYYA 3X1WA 3RABA 4D8VA 2ROQA 4HXYA 4OB8A 1OXUA 2ZG6A 4ZC8A 4PLZA 4NLLA 2ZGVA 5AKJA 1S3FA 1VPWA 2BJWA 1A7KA 2OBLA 2W2MA 2P6NA 3RGGA 5JTUA 3C87A 5JI3E 2GBFA 4IJKA 1THZA 1S9DA 1DVRA 1KK0A 5LZ2A 3WXBA 4GL2A 2HSDA 1TKDA 3QMMA 1OFTA 3AP3A 7REQB 1V47A 4YT8A 2BEUB 3O4RA 1WSAA 2BF7A 2PX0A 5IK2A 4GQBA 5DH9A 2LM1A 4N5MA 5K1ZA 5HHTA 2FR1A 2ZTVA 4UAWA 1P7ZA 1XFDA 4KL8S 4YPOA 2VH1A 2A5DA 2QSJA 2V98A 3DE0X 1N5RA 1XMQB 4W5TA 1KRXA 2YNMC 3U7JA 1XSNA 3MOGA 1QV7A 4L4RA 2LIPA 1ZOOA 1VG9B 3RHTA 4LXHA 1RTKA 2W6PA 4MR8A 2PUTA 4PO1A 1MABA 2ZRDA 3GYBA 4LGCA 1U2PA 5B64A 3AERA 1DAIA 2AC7A 2RBGA 1WPRA 2QTVA 1KPGA 3M6MD 1ISPA 1NLZA 3LBFA 2PE5A 4PHEA 1HM5A 3V80A 1H0KA 1JWBB 1DJQA 1ODIA 5G4KA 2OY0A 1QM5A 1U3FA 2FN7A 2X4LA 2QUKA 1WMFA 3IHWA 4WZ6A 5I4BA 4LJSA 4QFMA 3L0DA 2LKCA 4IDPA 3GU3A 1DFIA 4E1AA 3VPCA 3BDPA 1BEEA 5KBYA 4DEYA 2D7CA 4JMLA 5AIAA 5EZ5A 1X7HA 1PJ8A 5DHAA 4GZMA 4S35A 4KMRA 1C9JA 5IVIA 4N6NA 3ZDAA 1XYGA 2IFTA 1VL5A 1EFKA 4YRDA 1P1CA 4XM0A 1EK1A 1N5DA 5BQ3A 4NDNE 2PXAA 3OJSA 2BQRA 4N47A 2ZE6A 3BWBA 4F8JA 3UG6A 2XW6A 4M98A 4DV2B 3EXIA 2NOAA 4H16A 1IULA 4ZOLF 2O8DB 1T0IA 1Y9EA 2R68A 2C97A 4QRDA 2CLDX 1QZXA 4TLCA 3UJPA 3CPHA 5M2QA 2AJDA 3U19A 2KE7A 2J7PD 1Z6QA 2ERYA 5F35A 2RIPA 3LUBA 4EB0A 3K4QA 4B3XA 1TMGE 4EPRA 2QD5A 1V2HE 2MSWA 2WWTA 2CXXA 3EA5A 2VAWA 5IAKA 3R7LA 3GP5A 2I33A 3PXBA 2VHCA 5JI2E 1M2OB 2QW8A 2IUEA 2ET6A 2OBNA 4QJFB 2F17A 3L0ZA 2BUAA 4IIJB 3HYCA 4YCDA 3ZWWA 3FKSA 1YL6A 2GUGA 3PX6A 3ZD7A 4QW8A 5K4LA 5G3YA 3RVKA 1SD5A 4W9RA 3A06A 2X8WA 5CR0A 1O6BA 3A04A 1DJLA 4ITVA 4D98A 2X6TA 4BO4A 2X9GA 1XTVA 4S3MA 3ISVA 4B4KA 1D6JA 4AL4A 5KFXA 4CQJA 3VI4B 4HH1A 4Y0VA 1MIOB 2ORYA 3LY5A 3DAYA 4H1TA 5A3RA 3QVTA 3T1TA 5KWSA 1QQ5A 3OE4A 4F4FA 1MO6A 2MMCA 4D2IA 1B1AA 4RENA 1YACA 4N7RA 1JWLA 4RL6A 4G2NA 4O3OA 2BFFB 5FBHA 4IS3A 1B0ZA 1U0BB 4YMGA 4MQUA 4MEBA 4YDHB 1W1IA 3L7KA 4BB6A 2ZYGA 3WMXA 1P2TA 1D8YA 1KBZA 4ZYWA 2DT5A 1KJNA 3EIUA 4IVPA 1TT7A 4LXUA 5FL7A 3BH6A 3VPXA 2D2XA 2FFBA 5I9TA 2D1TA 1YD7A 4C2BA 3IG8A 3VSAA 1YUM