3A0BU

Crystal structure of br-substituted photosystem ii complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
total genus 19
structure length 98
sequence length 98
chains with identical sequence u
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 3a0bU01
4UB8U 3A0HU 1S5LU 5B66U 5KAFU 3A0BU 3KZIU 5H2FU 5KAIU 5GTHU 4PJ0U 2DUYA 3WU2U 5B5EU 4IL6U 2AXTU 5GTIU 4UB6U 5E79U 5TISU
chains in the Genus database with same CATH superfamily
1ZQTA 5AK6A 5AIAA 1RYSA 4EELA 2C2EA 4NJ8A 5AI5A 2ASJA 5ALFA 2WB1F 4RQ4A 4UAUA 1ZQMA 2WF9A 1XU4A 2ZJ5A 4F5OA 2W7PA 3PX4A 3UMGA 5KAFU 5DG7A 3QUTA 3KHRA 2ZXHA 8ICSA 4RT3A 5AKHA 5J2HA 4J9PA 4IS7A 3ZDAA 4K4IA 4KLFA 2FLNA 2KIWA 2UVRA 2C2DA 3HT3A 4RPXA 5IINA 1Z1VA 3TKAA 4CE6A 1K5OA 3N7SC 3THVA 3PO5A 1L7NA 1DK2A 5KFKA 1IM4A 4M47A 5AI9A 4EBCA 5J2BA 4Y2QA 4I2DA 1K1QA 2GH1A 2YY6A 3SI8A 1L8LA 5B5EU 4RQ1A 3RB3A 4KN7A 5ALGA 1N5XA 3NTUA 5AK4A 5J2FA 3FAHA 3BDPA 2NO4A 3RBEA 1KRPA 3PX6A 5J2JA 1FFVA 4XUSA 3OJUA 4DFJA 4E0DA 4F92B 3SAHA 4FBTA 3T5JA 1QQ6A 3K1ZA 4G9BA 3EWAA 4I2IA 3IV6A 4JWMA 2H3IA 2A19A 4TUQA 4P0PB 1SZPA 2NRTA 3E58A 1ZQUA 3PMNA 2MU2A 1T3NA 1QH9A 4NLNA 4B9MA 2LBOA 1RPLA 2AJQA 3LVWA 1S0MA 1XNSA 1O08A 3G6XA 3SEIA 4OJPA 4RQ6A 2Y9TA 4YR3A 4M0AA 9ICPA 9ICRA 3K4GA 1MQ2A 4EZ9A 2KV2A 4MEYA 2DPIA 4KX5A 2AGOA 1DGSA 3H0LB 5J0QA 4I2FA 5IIOA 3E0FA 3UXPA 4F4XA 4I2AA 2RDJA 5ALTA 1J97A 4O3QA 4J03A 2BZFA 3OJSA 3H8WA 4CDGA 1ZD4A 3SAGA 3GIKA 3ZD9A 1V85A 1WWUA 1O03A 2W54A 4Z6CA 1WCLA 2EQYA 3C2LA 3H8MA 3KZXA 1ZQAA 1Q3VA 3H4BA 4QIWF 3GIIA 1Z19A 5J2CA 4ECYA 2IOFA 2BDUA 3JPNA 2BCUA 4C4SA 1IIPA 3QE9Y 5L1JA 3AUOA 3BQ0A 2RQ5A 2PI4A 4M6WB 1N48A 2CRXA 1MC8A 7ICPA 1Q8KA 3UPQA 5AM4A 5BOLA 3RF9A 4DLGA 2EZYA 4FZLA 2KJ5A 2YMMA 2H5XA 3PNCA 4Z6FA 4KX3A 5ALYA 4X5VA 1RG6A 2CXYA 4KMOB 3QXGA 5DQHA 3PW7A 1RXWA 3OHBA 2W55A 2KN7A 4B9UA 2BCSA 3A0BU 5EE3A 5KFEA 1WWVA 4M2YA 1UHUA 2Y0SF 1B4FA 4P4PA 2HHQA 3GV5B 7ICJA 8ICOA 4Q8FA 3QU2A 1TV9A 5AI4A 2PFNA 1ZJMA 2JEGA 3AMZA 4J9RA 4EX7A 5IIMA 3OHAA 4OD0A 2W8LA 5K4LA 4JK1A 3IP4B 5DG9A 3KKAC 5AI0A 5DQGA 1NK0A 5DLGA 3RJKA 4DEZA 1NK6A 3S6JA 2M0NA 3PW2A 5L1LA 4FE3A 1B22A 2GOLA 8ICXA 2J6UA 4DSJA 2NRWA 1ZYQA 5AKXA 8ICBA 4DS5A 3SZ2A 3SR6A 4Y2PA 3NUQA 5CR0A 1T3QA 4RQMA 8ICVA 1Z4OA 1N60A 1SGGA 5KL8B 4GFJA 2QLTA 1KKXA 2W9BA 3MGIA 3O0FA 2P6UA 2NV3A 3R9KA 4GXJA 5KFWA 4YXJA 4UASA 4ACOA 2QB0B 1NK4A 5KG0A 4IC9A 2FLLA 2XY7A 4PHPA 3DV9A 5AHXA 4ED8A 2PFPA 4JUZA 2MA1A 9ICUA 2WTFA 2ZIVA 2AHOB 5KG7A 4J9SA 2BKEA 1Z3EB 4PL1A 2C28A 2JH7A 1RYUA 3WKCA 2HHSA 1ZQNA 1ZQ1C 1QSYA 4Y2SA 3G6VA 2EAPA 1XSLA 4I28A 2LKYA 4RNMA 1BNOA 2ESEA 2VANA 3L3FX 4Y2TA 1S0NA 2LMRA 4C7ZA 4DSLA 3ZDBA 2YMPA 1NJYA 1U9LA 1A0PA 4QZHA 1X9MA 2VJ5A 1MQ3A 1NNLA 8ICGA 2LYBA 3C28A 3BS7A 3C5GA 3TANA 1BPXA 4NLGA 2KKVA 1SL1A 3M9OB 5KFJA 4YFKA 4ED2A 1EXNA 3ISBA 1KBUA 2ZTEA 1ZQHA 3PW0A 3NVVA 4KLTA 4Y2UA 4C8NA 3JPPA 3EYZA 3KBBA 3ZDCA 2WAQC 5AKEA 1VDVA 4Y2XA 4O5CA 1KFTA 3HJEA 3GFKB 3TADC 4DSFA 5ALJA 4DFDA 2A1JB 3J81j 9ICFA 2KFZA 3WK4A 2Y1JA 2OCEA 2W04A 5AM3A 3EPIA 3PSPA 4UQGA 4F72A 3TAPA 4B6JA 4DF8A 1KN5A 4F5RA 5ALUA 3IHQB 4DSEA 4UARA 1U47A 2QB0A 2DF4B 3RB4A 2MUTB 1UT8A 2P35A 5J0WA 3F5EA 2ZIUB 4IRCA 3H0RB 1ZJNA 3PVXA 3F53A 3B0XA 5D49A 3NVWA 2VJ4A 2K4PA 1NK9A 3UQ2A 4QW8A 4M9HA 2RHFA 3OSNA 4F2SA 4CNQA 3QUCA 1ZETA 3BZCA 1PK1B 2ZIXA 2F1IA 2KVSA 4UB4A 1Z4NA 1A76A 1UA1A 1SL0A 3WK8A 2JRZA 2C2RA 4DL5A 1DK3A 2ZJAA 1TE2A 2QARA 4ED1A 2XY5A 3RR7A 2F1JA 4KLJA 5TZVA 1SKSA 3MR6A 3V6HA 1CRXA 8ICPA 5H2FU 4R63A 1PVQA 4JV1A 4YN4A 2K4EA 4XRHA 3IM1A 2KD1A 1ZQCA 2JGAA 5IIJA 3AEVA 4I2GA 4PZOA 4ECRA 7ICTA 3H40A 1H38A 2FMQA 1T8EA 1JIHA 5J8YA 4NLZA 1V97A 7ICLA 4O3MA 5AI6A 4PZNA 1LKYA 1HIWA 2HHWA 1FFUA 3ISCA 4F4YA 2OH2A 5HMLA 2A1AA 4TQRA 5TISU 2H3VA 4O3OA 4C8MA 5J2DA 2G5IB 1QSLA 2YB4A 5CA7A 3NRWA 4QW9A 1CEZA 5JRTA 4DL3A 4NWIA 4XQ8A 4MF8A 5F9LA 4P2HA 8ICCA 4F5NA 2ATLA 2MSNA 1ZQBA 3LDAA 1S77D 3M1YA 3MFIA 2BQUA 5CJ7A 1UPHA 2ZIUA 2JHDA 2BCQA 3ETLA 3G6YA 3CW2C 5ALLA 4QZ8A 7ICUA 1IV8A 4UAZA 5D4BA 3D2NA 3RRGA 4DCCA 1WCNA 3QEAZ 5KFSA 2W03A 5JU5A 2HBKA 5J0RA 5IIIA 4F2RA 4M9LA 2F76X 5KL1B 4O3PA 4DFKA 4O5EA 5J0OA 2K8CB 2XCAA 3WKBA 4RZRA 3Q8PB 2R8KA 7ICMA 5HHHA 2ZUCA 4F5QA 4Y2JA 1S5LU 4DL6A 3KHLA 1ZQRA 5J29A 1K1SA 1V9PA 4DFMA 4DF4A 3KD3A 2CPRA 4F4ZA 2PFOA 5L9XA 4C0ZA 1TK5A 2LM1A 2BQRA 5ALRA 5CRXA 4KLEA 4GIBA 3KFUF 1X6IA 3PZPA 4KITB 1ZD3A 4BUGA 4PHAA 5IIKA 2MRLA 2YMQA 1UCVA 2F44A 4PGXA 2AGPA 4PGYA 2UVUA 4DOAA 2BDPA 4NL9C 3UM9A 3RBDA 2BCVA 2G07A 1OUQA 3WU2U 4ELTA 8ICAA 3TFSA 3OTQA 5IILA 2FI1A 4DSKA 3N7RC 2WB1C 2QB1A 2HVHA 9ICBA 2QKQA 2R18A 2LI6A 2N1RA 5ALKA 4MFAA 3Q8SB 1ZQXA 4Y2YA 1QLNA 1TVAA 1NOMA 3ONNA 2K8BB 8ICFA 2JXJA 1J2MA 3H4DA 4Z6EA 5AIBA 4DQRA 1KL9A 4FZMA 1U48A 1B43A 3NGDA 4CF4A 1QTMA 2OXOA 1X9WA 2KZMA 2DQNB 1S0OA 2W9CA 9ICGA 3MBYA 2YX8A 1ED1A 4YMNA 4BXOB 4QZBA 4R64A 4I2HA 1SV0A 3GIJA 2M9NA 2EANA 2WHEA 1L8OA 2F8KA 9ICKA 2IOHA 5GTIU 5CEHA 8ICKA 4RQ2A 2E1FA 3WKDA 4OCZA 3HWTA 3F2BA 2XY6A 5J0UA 1TAUA 3VC8A 3FDSA 4C80A 4QJFB 4OJOA 3GIMA 3EUB2 1VJ5A 4K4HA 1JRPA 1N62A 1BNPA 1PZNA 1S76D 2ALZA 4J9NA 4KLLA 2VKQA 2IHMA 3QEBZ 4M04A 4AYBF 7ICKA 5C5JA 4QZEA 1KSPA 2G06A 1L3UA 3NVYA 4RQ3A 4C8KA 5J2IA 1T7PA 1F0MA 7ICSA 3QUQA 3WK6A 3SQIA 4NLCA 4YCXA 4M9NA 1DRGA 3HKZF 3PV8A 2J6TA 1N5WA 2HBLA 2G5HB 4BWJA 9ICOA 3C5FA 3ZDDA 2EH9A 1ECWA 5AM1A 4GLXA 3JPTA 1ZQSA 4KLSA 3CP8A 3Q8LA 5ALPA 5DB6A 5AK3A 1NKCA 3VCBA 2PMZF 4XA5A 2VA3A 2OWOA 2VA8A 4I27A 3HKZC 4UBBA 3SV3A 3QU5A 4B9TA 4QZIA 2GLEA 4RNNA 1VLBA 4G3IA 3RH5A 4BJQA 1Y88A 4KTQA 1XO0A 5DB7A 3BQ2A 1ZQEA 5E79U 4QIWC 5C0YA 7ICGA 2R8GA 5J0TA 3ZD8A 5KFVA 3QUBA 4Q43A 4RT2A 3HILA 4OJ6A 3V7LA 4P0PA 3RJHA 1KQQA 2E5SA 3RRHA 3QYPA 3SMVA 5ALWA 5J2EA 2HBMA 2HHTA 2I5HA 5HMMA 2KHVA 5AKYA 2L5YA 5AK5A 4P4OA 1LB2B 1T4GA 1M6YA 1XS9D 5DDYA 9ICQA 3ZI4A 2ZJ8A 1SXDA 5KT2A 3OGUA 2CN1A 5KAIU 4ICAA 2PXIA 5KFYA 8ICHA 2WF5A 5ALOA 9ICVA 2IA6A 4YQWA 4CGZA 2KZZA 1A6SA 1ZQVA 5DGAA 4DQQA 4BGDA 2Y0SC 5AKGA 1ZRMA 2C22A 1L7OA 1S8OA 4YMMA 3ISDA 2UVVA 3LVVA 4RU9A 2YQEA 5J0YA 8ICTA 4CF5A 4P4MA 1JALA 1JXLA 4RQ8A 1PVRA 4PPXA 4Z6DA 1ZD5A 5KTQA 4NM1A 1BVSA 5ALEA 2HCFA 3C23A 4F3OA 2K8AA 2DPJA 3M9MB 5CP2A 4C8LA 2RLTA 2IBKA 2R8IA 3SV4A 5T14A 2VIXA 4J9OA 2ZTCA 2AH5A 4TUPA 5AICA 3NVZA 4M6WA 4I2BA 4ECZA 5KFAA 4NV0A 1X42A 1CI4A 2W43A 3RFAA 4Y2VA 1XC9A 2ASDA 1TK8A 5G5HA 3GQCA 2J6SA 4IRKA 4QZDA 4EBEA 1RZTA 2DWQA 8ICMA 2ODGA 1ZQIA 3I28A 3PW5A 5ALSA 2KICA 5GTHU 1X40A 3E2EA 2FPKA 4PGQA 5KFNA 4QWBA 2AXTU 4I2JA 4K4GA 3RB0A 1YZ6A 5DBAA 3B9JA 3NRZA 4R8UB 5L1IA 4RQNA 5BPCA 4IRDA 2W9AA 1XO1A 1SWVA 2E8PA 4NXZA 4FS1A 2XICA 3TACB 1COOA 3RJGA 4PL2A 5A0LA 4F93B 5J2AA 2XO7A 4OJLA 5KFCA 3UXNA 2RRDA 2VA2A 2A3VA 3LK9A 1QCKA 4LJXA 2BPFA 1KW4A 5DGBA 2WFAA 1KLNA 4KLOA 1UT5A 1RQNA 5EOZA 1UQVA 1XSPA 5KFDA 2BCRA 9ICIA 7ICHA 2K60A 4UB5A 2LHTA 2OEHA 4C4RA 2KG5A 2HHUA 5AKLA 4B9LA 1BPDA 4KN4A 2KFNA 5J0PA 2FJ6A 2FPMA 2O6KA 5KT3A 2H3ZA 4ELVA 1U49A 3RAXA 1AQ6A 2EZZA 4ELUA 2NRXA 2JEFA 1WUDA 2OHFA 4YP3A 1KFDA 4AP9A 5CWRA 2P6RA 3CYMA 4ECTA 2KJ8A 4O5KA 4R66A 2PI5A 4UB6U 1RDFA 3TARA 1LV5A 2NYVA 2W11A 5EE9A 3UMCA 3FYHA 1DOQA 3D6JA 1F44A 2BQ3A 4YD2A 4C8OA 3T5HA 1KFSA 4CF3A 2K4HA 5ALXA 2PKEA 1SKWA 3K75D 4LZDA 2WF8A 2KK0A 4EEKA 1ZXIA 5KFZA 1N61A 5EWFA 4MFCA 2FMPA 3V7KA 4F91B 4BWMA 4UB1A 1WYGA 4CCHA 2WF6A 3PO4A 2DGZA 3H8JA 2KP7A 4IR9A 2ES6A 7ICVA 1TAMA 3QZ8A 3B0YA 5G5GA 1X66A 3C2MA 4M9JA 5KFBA 3F2CA 4UBCA 2ISPA 5HP4A 4NLKA 4HYKA 2YMLA 4PJ0U 4UB2A 1SB3C 4GXKA 2LYAA 2K89A 4YXMA 3Q8KA 2A1JA 3KTQA 2MAXA 3EW9A 3H7IA 4JV0A 2Y1IA 8ICEA 3JPSA 3M8RA 1D8YA 4RUAA 1JMSA 4PHEA 1C20A 2E8NA 5DDMA 3C1YA 3F2DA 1Z00B 2NRZA 1RXVA 1AROP 1NJWA 3ED5A 8ICIA 3I76A 2MUTA 4RPZA 2EAMA 1COKA 1T94A 4JMUA 3GV7B 4UATA 4FBUA 2V4RA 4O3SA 4MFFA 2W8KA 1D9FA 9ICJA 1X2IA 3PY8A 1FIQA 5F3XB 4RQ7A 1HUZA 5KFMA 4ECSA 5KFGA 5HR7A 3SAFA 5HNKA 3T5LA 5DKWA 1ZQZA 1PK1A 2R8HA 4KMUA 4A8EA 8ICRA 5EWEA 1GO3F 2HBJA 2JZBB 2XGPA 1JROA 2LPEA 3KHHA 2KIVA 4DL4A 5DB8A 3M6KA 5ALIA 3TAQA 4OO1J 4F50A 5D46A 5ALVA 3PX0A 3PW4A 1PK3A 4C7YA 3KKAA 3MDCA 3V7JA 2JEJA 4EX6A 1OW5A 2ISOA 1V38A 2F77X 5DLFA 4KLIA 4J9MA 2RP5A 3JPRA 4KLHA 2KMDA 2KOBA 2LM4A 1KEJA 3ORYA 3LWMA 2Y9UA 2K4IA 1TKDA 1HUOA 5DG8A 3FC4A 1NZBA 3AU2A 3RAQA 3M6ZA 1OXJA 3PR4A 2G09A 4IQVA 3JPQA 4YG2A 2YTUA 3FM9A 3SENA 3C29A 4GXIA 3N7PD 4RPYA 5ALDA 1Z00A 4B9SA 3RJJA 2HMXA 4NLBA 4O0IA 2F8LA 2JEIA 2YB1A 8ICNA 1L3VA 3ICXA 9ICHA 4UB8U 3U26A 3SYZA 3A0HU 4HAIA 1ZQOA 3M7DA 2ZXIA 4MEXA 2HOIA 4TQSA 2W3RA 2KZ3A 1RM6C 2DUYA 2IMWP 3GV8B 9ICLA 2JV3A 7ICEA 4GC6A 2JH1A 3OSPA 5JUMA 2BGWA 5KFFA 1N56A 3BS5B 2DKXA 5AKJA 4Q44A 4FO6A 2AQ4A 2R8JA 2HOQA 2KKPA 3CNHA 2IOFK 3ZDEA 5ALMA 4DLEA 7ICRA 2JZBA 1JX4A 1X9SA 1NK7A 8ICLA 2FPLA 4EENA 4US9A 3UMBA 3GU3A 3IDWA 4KLQA 2KEYA 2AQ0A 4PH5A 5AM0A 2JR5A 5JTIA 5KG1A 3MFHA 5KNIA 5EWGA 2XIDA 4ECXA 3AM9A 1TAQA 1U4BA 3Q8QB 2FMSA 3EZ5A 2KJ9A 3BQTA 4ZOHC 1MSWD 2XI9A 4PHDA 5AM2A 1DXSA 1IG6A 3MR2A 1ZQDA 3TADA 2AGQA 3RB6A 3T5KA 5KG2A 1UA0A 1NI3A 2DBYA 1NZPA 1X9XA 2HHVA 1L7PA 3IG8A 4ED7A 1NJZA 9ICNA 3RJFA 1N63A 5KFIA 4AYBC 2W3SA 1Z1BA 3N4MB 1F5SA 5KT4A 4KLDA 3BQ7A 3DDHA 5HHIA 5AI8A 5J8YC 4F4WA 2GWSA 2B21A 1L5UA 1KTQA 2KE7A 1L7MA 4QZGA 3IG5A 4JB3A 3PR5B 1NJXA 1BPZA 4U7CA 9ICMA 5AKIA 4UAYA 4LZGA 1SXEA 2W9BB 4DOCA 2PFQA 3L5KA 1ZQYA 8ICJA 2D8CA 4DOBA 2V4QA 8ICQA 4DQIA 4QWDA 5KFOA 3K1RB 2OYYA 3AQFA 3UXOA 5DQIA 5KT5A 4ECQA 2DL0A 3AL0B 4BXOA 4F8RA 3OPXA 3BS5A 1YZ7A 1ZD2P 2PMZC 2P66A 4J9LA 2JMGA 1P7DA 1QQ5A 1RQLA 2BPCA 4J9QA 5KG5A 1MN8A 9ICWA 5ALQA 2ZIVB 4QNLA 4I2CA 3PSFA 4B9VA 5ALZA 4ECUA 5L1MA 4USAA 1CUKA 4EZ6A 2I1QA 4TUSA 3AQEA 4JWNA 1ZQKA 1D8LA 1ZOLA 4RQ5A 3PMLA 3RH6A 1SIJA 3F5AA 4EBDA 1Q3UA 2V9WA 5B66U 2B6GA 4QWAA 3IRUA 1RYRA 2BPGA 3N28A 2UVWA 4TURA 1ZRNA 5L1KA 1NKEA 3IN5A 1HEKA 4DL7A 3MR3A 2H3QA 3MGHA 4IR1A 1ZQLA 3AN1A 5EE0A 3KZIU 4OJ5A 2I9GA 2BR0A 1SZHA 2G0AA 1SWWA 2HDOA 5KFQA 3TI0A 4DSIA 3RJEA 2LYHA 3H8SA 5KFXA 3KHGA 1S97A 4O9MA 4DO9A 3QU4A 1X6JA 1JXEA 2F2AB 4MHVA 4EEYA 7ICFA 2KHQA 4UB3A 1L3TA 3MABA 4KLMA 1A77A 4DQPA 3HRDD 2ASLA 2Z7JA 2XGQA 3HP6A 4QZ9A 3V6JA 2F3NA 4ZH4A 9ICCA 1BPBA 3JPOA 1ZQPA 1PUZA 3TFRA 2HHXA 3C1ZA 3WKAA 3LWLA 4F4KA 5KT7A 4O3RA 4EYHB 1KDHA 2E1EA 8ICWA 5KT6A 5FP0A 2Q0ZX 1JUDA 2ZUDA 4UAVA 3NASA 3V72A 1L6NA 2EZXA 3Q8RB 5KFUA 5DB9A 1D9DA 5HR6A 4YVZA 1JN3A 3HPOA 1S9FA 1BGXT 1S0VA 2D6FC 1S10A 5ALHA 1DGJA 3HX0A 1SV0C 4RNOA 5AKKA 2E8MA 2ZIXB 3T3FA 5AM5A 2B0CA 4MF2A 2W9MA 1QSSA 2KVCA 1SV4A 3WK7A 2XC9A 2KNJA 3NS1A 5EE1A 4QWCA 2WAQF 1TK0A 2Q4TA 4US8A 4R65A 8ICUA 1URJA 1LVHA 1XWLA 2QARB 4NL9A 3BQ1A 1FEZA 5BOMA 1NK5A 4DFPA 1FO4A 1SL2A 4DL2A 3DEEA 3RJIA 5DBCA 1U45A 2EAOA 2ZTDA 4Y2RA 2HOFA 4BX9C 5F9NA 2DFLA 2FDRA 7ICIA 4Q8EA 4ED3A 1ZQGA 5KFTA 4YR0A 4M9GA 3MGVA 3GILA 1BPEA 3Q8MA 1J2NA 3M8SA 1LKYB 2ZIWB 4WJ3B 3KOOA 2AU0A 1MA7A 3D2QA 9ICSA 4QZFA 8ICZA 4ECVA 5CHGA 4FFDA 3M9NB 4IQUA 4I2EA 2E8OA 3QU7A 3QZ7A 3BZKA 1PVPA 3RTVA 4LVSA 2KSOB 9ICTA 5ALNA 4DQSA 3WK5A 3MDAA 4KLGA 2HI0A 2I6XA 3PSIA 5KG4A 4RUCA 1ZQQA 1BPYA 2ZG6A 1NKBA 3EPGA 2FLPA 1IXRA 4B9NA 4IL6U 3AU6A 3GZFA 2HW3A 4U6PA 5KG6A 3C2KA 2D3DA 2DKZA 3HW8A 4IQWA 4R8UA 3H0MB 4P0QB 8ICYA 4Q45A 5J2KA 2G08A 9ICAA 1WG8A 2HSZA 4ED6A 5KG3A 4GC7A 4FZNA 2KTQA 3GDXA 1C7YA 2BHNA 1JI7A 2W7OA 2FE9A 3RR8A 1L3SA 3QU9A 3C21A 4QZCA 4FS2A 4JV2A 4IQTA 1QQ7A 4F5PA 4YR2A 1N2XA 4F71A 3TQ1A 4UAWA 2RDIA 3UQ0A 3D2SA 7ICNA 5J0XA 4DS4A 2EDUA 4RQ0A 3L4PA 4QWEA 2GO7A 5KFPA 3I1YA 3SD7A 1SKRA 1ZQWA 4ECWA 5KFRA 2ZIWA 4NY8A 1ZQFA 4YMOA 2OM6A 2ZUBA 1YT3A 3ALRA 5DBBA 1Q46A 4KLUA 3QNMA 4EYIB 2WF7A 1NK8A 5CB1A 3LYSA 4J9KA 1TFRA 2YN4A 4BDPA 5AKZA 2KSOA 2E3TA 4NM2A 4I29A 4O3NA 3MR5A 1D8BA 9ICXA 4YD1A 4QZAA 7ICQA 1HJPA 9ICEA 2F1HA 2H3FA 3WK9A 3CRXA 2HVIA 3PSTA 3V6KA 3ETRA 3QX7A 4CRXA 4ED0A 2XVTA 3WKEA 1XSNA 4UW9A 5KFHA 3T79A 4DWIA 5KFLA 7ICOA 2W9CB 5J2GA 2NO5A 4C4TA 2XCPA 4P0QA 5J0SA 3BJYA 3RH4A 1ZQJA 1B0XA 3MC1A 2IHNA 3N97B 2NRVA
chains in the Genus database with same CATH topology
4UB8U 3A0HU 1S5LU 5B66U 5KAFU 3A0BU 3KZIU 5H2FU 5KAIU 5GTHU 4PJ0U 2DUYA 3WU2U 5B5EU 4IL6U 2AXTU 5GTIU 4UB6U 5E79U 5TISU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 U;  3A0H U;  1S5L U;  5B66 U;  5KAF U;  3A0B U;  3KZI U;  5H2F U;  5KAI U;  5GTH U;  4PJ0 U;  2DUY A;  3WU2 U;  5B5E U;  4IL6 U;  2AXT U;  5GTI U;  4UB6 U;  5E79 U;  5TIS U; 
#chains in the Genus database with same CATH topology
 1ZQT A;  5AK6 A;  5AIA A;  1RYS A;  4EEL A;  2C2E A;  4NJ8 A;  5AI5 A;  2ASJ A;  5ALF A;  2WB1 F;  4RQ4 A;  4UAU A;  1ZQM A;  2WF9 A;  1XU4 A;  2ZJ5 A;  4F5O A;  2W7P A;  3PX4 A;  3UMG A;  5KAF U;  5DG7 A;  3QUT A;  3KHR A;  2ZXH A;  8ICS A;  4RT3 A;  5AKH A;  5J2H A;  4J9P A;  4IS7 A;  3ZDA A;  4K4I A;  4KLF A;  2FLN A;  2KIW A;  2UVR A;  2C2D A;  3HT3 A;  4RPX A;  5IIN A;  1Z1V A;  3TKA A;  4CE6 A;  1K5O A;  3N7S C;  3THV A;  3PO5 A;  1L7N A;  1DK2 A;  5KFK A;  1IM4 A;  4M47 A;  5AI9 A;  4EBC A;  5J2B A;  4Y2Q A;  4I2D A;  1K1Q A;  2GH1 A;  2YY6 A;  3SI8 A;  1L8L A;  5B5E U;  4RQ1 A;  3RB3 A;  4KN7 A;  5ALG A;  1N5X A;  3NTU A;  5AK4 A;  5J2F A;  3FAH A;  3BDP A;  2NO4 A;  3RBE A;  1KRP A;  3PX6 A;  5J2J A;  1FFV A;  4XUS A;  3OJU A;  4DFJ A;  4E0D A;  4F92 B;  3SAH A;  4FBT A;  3T5J A;  1QQ6 A;  3K1Z A;  4G9B A;  3EWA A;  4I2I A;  3IV6 A;  4JWM A;  2H3I A;  2A19 A;  4TUQ A;  4P0P B;  1SZP A;  2NRT A;  3E58 A;  1ZQU A;  3PMN A;  2MU2 A;  1T3N A;  1QH9 A;  4NLN A;  4B9M A;  2LBO A;  1RPL A;  2AJQ A;  3LVW A;  1S0M A;  1XNS A;  1O08 A;  3G6X A;  3SEI A;  4OJP A;  4RQ6 A;  2Y9T A;  4YR3 A;  4M0A A;  9ICP A;  9ICR A;  3K4G A;  1MQ2 A;  4EZ9 A;  2KV2 A;  4MEY A;  2DPI A;  4KX5 A;  2AGO A;  1DGS A;  3H0L B;  5J0Q A;  4I2F A;  5IIO A;  3E0F A;  3UXP A;  4F4X A;  4I2A A;  2RDJ A;  5ALT A;  1J97 A;  4O3Q A;  4J03 A;  2BZF A;  3OJS A;  3H8W A;  4CDG A;  1ZD4 A;  3SAG A;  3GIK A;  3ZD9 A;  1V85 A;  1WWU A;  1O03 A;  2W54 A;  4Z6C A;  1WCL A;  2EQY A;  3C2L A;  3H8M A;  3KZX A;  1ZQA A;  1Q3V A;  3H4B A;  4QIW F;  3GII A;  1Z19 A;  5J2C A;  4ECY A;  2IOF A;  2BDU A;  3JPN A;  2BCU A;  4C4S A;  1IIP A;  3QE9 Y;  5L1J A;  3AUO A;  3BQ0 A;  2RQ5 A;  2PI4 A;  4M6W B;  1N48 A;  2CRX A;  1MC8 A;  7ICP A;  1Q8K A;  3UPQ A;  5AM4 A;  5BOL A;  3RF9 A;  4DLG A;  2EZY A;  4FZL A;  2KJ5 A;  2YMM A;  2H5X A;  3PNC A;  4Z6F A;  4KX3 A;  5ALY A;  4X5V A;  1RG6 A;  2CXY A;  4KMO B;  3QXG A;  5DQH A;  3PW7 A;  1RXW A;  3OHB A;  2W55 A;  2KN7 A;  4B9U A;  2BCS A;  3A0B U;  5EE3 A;  5KFE A;  1WWV A;  4M2Y A;  1UHU A;  2Y0S F;  1B4F A;  4P4P A;  2HHQ A;  3GV5 B;  7ICJ A;  8ICO A;  4Q8F A;  3QU2 A;  1TV9 A;  5AI4 A;  2PFN A;  1ZJM A;  2JEG A;  3AMZ A;  4J9R A;  4EX7 A;  5IIM A;  3OHA A;  4OD0 A;  2W8L A;  5K4L A;  4JK1 A;  3IP4 B;  5DG9 A;  3KKA C;  5AI0 A;  5DQG A;  1NK0 A;  5DLG A;  3RJK A;  4DEZ A;  1NK6 A;  3S6J A;  2M0N A;  3PW2 A;  5L1L A;  4FE3 A;  1B22 A;  2GOL A;  8ICX A;  2J6U A;  4DSJ A;  2NRW A;  1ZYQ A;  5AKX A;  8ICB A;  4DS5 A;  3SZ2 A;  3SR6 A;  4Y2P A;  3NUQ A;  5CR0 A;  1T3Q A;  4RQM A;  8ICV A;  1Z4O A;  1N60 A;  1SGG A;  5KL8 B;  4GFJ A;  2QLT A;  1KKX A;  2W9B A;  3MGI A;  3O0F A;  2P6U A;  2NV3 A;  3R9K A;  4GXJ A;  5KFW A;  4YXJ A;  4UAS A;  4ACO A;  2QB0 B;  1NK4 A;  5KG0 A;  4IC9 A;  2FLL A;  2XY7 A;  4PHP A;  3DV9 A;  5AHX A;  4ED8 A;  2PFP A;  4JUZ A;  2MA1 A;  9ICU A;  2WTF A;  2ZIV A;  2AHO B;  5KG7 A;  4J9S A;  2BKE A;  1Z3E B;  4PL1 A;  2C28 A;  2JH7 A;  1RYU A;  3WKC A;  2HHS A;  1ZQN A;  1ZQ1 C;  1QSY A;  4Y2S A;  3G6V A;  2EAP A;  1XSL A;  4I28 A;  2LKY A;  4RNM A;  1BNO A;  2ESE A;  2VAN A;  3L3F X;  4Y2T A;  1S0N A;  2LMR A;  4C7Z A;  4DSL A;  3ZDB A;  2YMP A;  1NJY A;  1U9L A;  1A0P A;  4QZH A;  1X9M A;  2VJ5 A;  1MQ3 A;  1NNL A;  8ICG A;  2LYB A;  3C28 A;  3BS7 A;  3C5G A;  3TAN A;  1BPX A;  4NLG A;  2KKV A;  1SL1 A;  3M9O B;  5KFJ A;  4YFK A;  4ED2 A;  1EXN A;  3ISB A;  1KBU A;  2ZTE A;  1ZQH A;  3PW0 A;  3NVV A;  4KLT A;  4Y2U A;  4C8N A;  3JPP A;  3EYZ A;  3KBB A;  3ZDC A;  2WAQ C;  5AKE A;  1VDV A;  4Y2X A;  4O5C A;  1KFT A;  3HJE A;  3GFK B;  3TAD C;  4DSF A;  5ALJ A;  4DFD A;  2A1J B;  3J81 j;  9ICF A;  2KFZ A;  3WK4 A;  2Y1J A;  2OCE A;  2W04 A;  5AM3 A;  3EPI A;  3PSP A;  4UQG A;  4F72 A;  3TAP A;  4B6J A;  4DF8 A;  1KN5 A;  4F5R A;  5ALU A;  3IHQ B;  4DSE A;  4UAR A;  1U47 A;  2QB0 A;  2DF4 B;  3RB4 A;  2MUT B;  1UT8 A;  2P35 A;  5J0W A;  3F5E A;  2ZIU B;  4IRC A;  3H0R B;  1ZJN A;  3PVX A;  3F53 A;  3B0X A;  5D49 A;  3NVW A;  2VJ4 A;  2K4P A;  1NK9 A;  3UQ2 A;  4QW8 A;  4M9H A;  2RHF A;  3OSN A;  4F2S A;  4CNQ A;  3QUC A;  1ZET A;  3BZC A;  1PK1 B;  2ZIX A;  2F1I A;  2KVS A;  4UB4 A;  1Z4N A;  1A76 A;  1UA1 A;  1SL0 A;  3WK8 A;  2JRZ A;  2C2R A;  4DL5 A;  1DK3 A;  2ZJA A;  1TE2 A;  2QAR A;  4ED1 A;  2XY5 A;  3RR7 A;  2F1J A;  4KLJ A;  5TZV A;  1SKS A;  3MR6 A;  3V6H A;  1CRX A;  8ICP A;  5H2F U;  4R63 A;  1PVQ A;  4JV1 A;  4YN4 A;  2K4E A;  4XRH A;  3IM1 A;  2KD1 A;  1ZQC A;  2JGA A;  5IIJ A;  3AEV A;  4I2G A;  4PZO A;  4ECR A;  7ICT A;  3H40 A;  1H38 A;  2FMQ A;  1T8E A;  1JIH A;  5J8Y A;  4NLZ A;  1V97 A;  7ICL A;  4O3M A;  5AI6 A;  4PZN A;  1LKY A;  1HIW A;  2HHW A;  1FFU A;  3ISC A;  4F4Y A;  2OH2 A;  5HML A;  2A1A A;  4TQR A;  5TIS U;  2H3V A;  4O3O A;  4C8M A;  5J2D A;  2G5I B;  1QSL A;  2YB4 A;  5CA7 A;  3NRW A;  4QW9 A;  1CEZ A;  5JRT A;  4DL3 A;  4NWI A;  4XQ8 A;  4MF8 A;  5F9L A;  4P2H A;  8ICC A;  4F5N A;  2ATL A;  2MSN A;  1ZQB A;  3LDA A;  1S77 D;  3M1Y A;  3MFI A;  2BQU A;  5CJ7 A;  1UPH A;  2ZIU A;  2JHD A;  2BCQ A;  3ETL A;  3G6Y A;  3CW2 C;  5ALL A;  4QZ8 A;  7ICU A;  1IV8 A;  4UAZ A;  5D4B A;  3D2N A;  3RRG A;  4DCC A;  1WCN A;  3QEA Z;  5KFS A;  2W03 A;  5JU5 A;  2HBK A;  5J0R A;  5III A;  4F2R A;  4M9L A;  2F76 X;  5KL1 B;  4O3P A;  4DFK A;  4O5E A;  5J0O A;  2K8C B;  2XCA A;  3WKB A;  4RZR A;  3Q8P B;  2R8K A;  7ICM A;  5HHH A;  2ZUC A;  4F5Q A;  4Y2J A;  1S5L U;  4DL6 A;  3KHL A;  1ZQR A;  5J29 A;  1K1S A;  1V9P A;  4DFM A;  4DF4 A;  3KD3 A;  2CPR A;  4F4Z A;  2PFO A;  5L9X A;  4C0Z A;  1TK5 A;  2LM1 A;  2BQR A;  5ALR A;  5CRX A;  4KLE A;  4GIB A;  3KFU F;  1X6I A;  3PZP A;  4KIT B;  1ZD3 A;  4BUG A;  4PHA A;  5IIK A;  2MRL A;  2YMQ A;  1UCV A;  2F44 A;  4PGX A;  2AGP A;  4PGY A;  2UVU A;  4DOA A;  2BDP A;  4NL9 C;  3UM9 A;  3RBD A;  2BCV A;  2G07 A;  1OUQ A;  3WU2 U;  4ELT A;  8ICA A;  3TFS A;  3OTQ A;  5IIL A;  2FI1 A;  4DSK A;  3N7R C;  2WB1 C;  2QB1 A;  2HVH A;  9ICB A;  2QKQ A;  2R18 A;  2LI6 A;  2N1R A;  5ALK A;  4MFA A;  3Q8S B;  1ZQX A;  4Y2Y A;  1QLN A;  1TVA A;  1NOM A;  3ONN A;  2K8B B;  8ICF A;  2JXJ A;  1J2M A;  3H4D A;  4Z6E A;  5AIB A;  4DQR A;  1KL9 A;  4FZM A;  1U48 A;  1B43 A;  3NGD A;  4CF4 A;  1QTM A;  2OXO A;  1X9W A;  2KZM A;  2DQN B;  1S0O A;  2W9C A;  9ICG A;  3MBY A;  2YX8 A;  1ED1 A;  4YMN A;  4BXO B;  4QZB A;  4R64 A;  4I2H A;  1SV0 A;  3GIJ A;  2M9N A;  2EAN A;  2WHE A;  1L8O A;  2F8K A;  9ICK A;  2IOH A;  5GTI U;  5CEH A;  8ICK A;  4RQ2 A;  2E1F A;  3WKD A;  4OCZ A;  3HWT A;  3F2B A;  2XY6 A;  5J0U A;  1TAU A;  3VC8 A;  3FDS A;  4C80 A;  4QJF B;  4OJO A;  3GIM A;  3EUB 2;  1VJ5 A;  4K4H A;  1JRP A;  1N62 A;  1BNP A;  1PZN A;  1S76 D;  2ALZ A;  4J9N A;  4KLL A;  2VKQ A;  2IHM A;  3QEB Z;  4M04 A;  4AYB F;  7ICK A;  5C5J A;  4QZE A;  1KSP A;  2G06 A;  1L3U A;  3NVY A;  4RQ3 A;  4C8K A;  5J2I A;  1T7P A;  1F0M A;  7ICS A;  3QUQ A;  3WK6 A;  3SQI A;  4NLC A;  4YCX A;  4M9N A;  1DRG A;  3HKZ F;  3PV8 A;  2J6T A;  1N5W A;  2HBL A;  2G5H B;  4BWJ A;  9ICO A;  3C5F A;  3ZDD A;  2EH9 A;  1ECW A;  5AM1 A;  4GLX A;  3JPT A;  1ZQS A;  4KLS A;  3CP8 A;  3Q8L A;  5ALP A;  5DB6 A;  5AK3 A;  1NKC A;  3VCB A;  2PMZ F;  4XA5 A;  2VA3 A;  2OWO A;  2VA8 A;  4I27 A;  3HKZ C;  4UBB A;  3SV3 A;  3QU5 A;  4B9T A;  4QZI A;  2GLE A;  4RNN A;  1VLB A;  4G3I A;  3RH5 A;  4BJQ A;  1Y88 A;  4KTQ A;  1XO0 A;  5DB7 A;  3BQ2 A;  1ZQE A;  5E79 U;  4QIW C;  5C0Y A;  7ICG A;  2R8G A;  5J0T A;  3ZD8 A;  5KFV A;  3QUB A;  4Q43 A;  4RT2 A;  3HIL A;  4OJ6 A;  3V7L A;  4P0P A;  3RJH A;  1KQQ A;  2E5S A;  3RRH A;  3QYP A;  3SMV A;  5ALW A;  5J2E A;  2HBM A;  2HHT A;  2I5H A;  5HMM A;  2KHV A;  5AKY A;  2L5Y A;  5AK5 A;  4P4O A;  1LB2 B;  1T4G A;  1M6Y A;  1XS9 D;  5DDY A;  9ICQ A;  3ZI4 A;  2ZJ8 A;  1SXD A;  5KT2 A;  3OGU A;  2CN1 A;  5KAI U;  4ICA A;  2PXI A;  5KFY A;  8ICH A;  2WF5 A;  5ALO A;  9ICV A;  2IA6 A;  4YQW A;  4CGZ A;  2KZZ A;  1A6S A;  1ZQV A;  5DGA A;  4DQQ A;  4BGD A;  2Y0S C;  5AKG A;  1ZRM A;  2C22 A;  1L7O A;  1S8O A;  4YMM A;  3ISD A;  2UVV A;  3LVV A;  4RU9 A;  2YQE A;  5J0Y A;  8ICT A;  4CF5 A;  4P4M A;  1JAL A;  1JXL A;  4RQ8 A;  1PVR A;  4PPX A;  4Z6D A;  1ZD5 A;  5KTQ A;  4NM1 A;  1BVS A;  5ALE A;  2HCF A;  3C23 A;  4F3O A;  2K8A A;  2DPJ A;  3M9M B;  5CP2 A;  4C8L A;  2RLT A;  2IBK A;  2R8I A;  3SV4 A;  5T14 A;  2VIX A;  4J9O A;  2ZTC A;  2AH5 A;  4TUP A;  5AIC A;  3NVZ A;  4M6W A;  4I2B A;  4ECZ A;  5KFA A;  4NV0 A;  1X42 A;  1CI4 A;  2W43 A;  3RFA A;  4Y2V A;  1XC9 A;  2ASD A;  1TK8 A;  5G5H A;  3GQC A;  2J6S A;  4IRK A;  4QZD A;  4EBE A;  1RZT A;  2DWQ A;  8ICM A;  2ODG A;  1ZQI A;  3I28 A;  3PW5 A;  5ALS A;  2KIC A;  5GTH U;  1X40 A;  3E2E A;  2FPK A;  4PGQ A;  5KFN A;  4QWB A;  2AXT U;  4I2J A;  4K4G A;  3RB0 A;  1YZ6 A;  5DBA A;  3B9J A;  3NRZ A;  4R8U B;  5L1I A;  4RQN A;  5BPC A;  4IRD A;  2W9A A;  1XO1 A;  1SWV A;  2E8P A;  4NXZ A;  4FS1 A;  2XIC A;  3TAC B;  1COO A;  3RJG A;  4PL2 A;  5A0L A;  4F93 B;  5J2A A;  2XO7 A;  4OJL A;  5KFC A;  3UXN A;  2RRD A;  2VA2 A;  2A3V A;  3LK9 A;  1QCK A;  4LJX A;  2BPF A;  1KW4 A;  5DGB A;  2WFA A;  1KLN A;  4KLO A;  1UT5 A;  1RQN A;  5EOZ A;  1UQV A;  1XSP A;  5KFD A;  2BCR A;  9ICI A;  7ICH A;  2K60 A;  4UB5 A;  2LHT A;  2OEH A;  4C4R A;  2KG5 A;  2HHU A;  5AKL A;  4B9L A;  1BPD A;  4KN4 A;  2KFN A;  5J0P A;  2FJ6 A;  2FPM A;  2O6K A;  5KT3 A;  2H3Z A;  4ELV A;  1U49 A;  3RAX A;  1AQ6 A;  2EZZ A;  4ELU A;  2NRX A;  2JEF A;  1WUD A;  2OHF A;  4YP3 A;  1KFD A;  4AP9 A;  5CWR A;  2P6R A;  3CYM A;  4ECT A;  2KJ8 A;  4O5K A;  4R66 A;  2PI5 A;  4UB6 U;  1RDF A;  3TAR A;  1LV5 A;  2NYV A;  2W11 A;  5EE9 A;  3UMC A;  3FYH A;  1DOQ A;  3D6J A;  1F44 A;  2BQ3 A;  4YD2 A;  4C8O A;  3T5H A;  1KFS A;  4CF3 A;  2K4H A;  5ALX A;  2PKE A;  1SKW A;  3K75 D;  4LZD A;  2WF8 A;  2KK0 A;  4EEK A;  1ZXI A;  5KFZ A;  1N61 A;  5EWF A;  4MFC A;  2FMP A;  3V7K A;  4F91 B;  4BWM A;  4UB1 A;  1WYG A;  4CCH A;  2WF6 A;  3PO4 A;  2DGZ A;  3H8J A;  2KP7 A;  4IR9 A;  2ES6 A;  7ICV A;  1TAM A;  3QZ8 A;  3B0Y A;  5G5G A;  1X66 A;  3C2M A;  4M9J A;  5KFB A;  3F2C A;  4UBC A;  2ISP A;  5HP4 A;  4NLK A;  4HYK A;  2YML A;  4PJ0 U;  4UB2 A;  1SB3 C;  4GXK A;  2LYA A;  2K89 A;  4YXM A;  3Q8K A;  2A1J A;  3KTQ A;  2MAX A;  3EW9 A;  3H7I A;  4JV0 A;  2Y1I A;  8ICE A;  3JPS A;  3M8R A;  1D8Y A;  4RUA A;  1JMS A;  4PHE A;  1C20 A;  2E8N A;  5DDM A;  3C1Y A;  3F2D A;  1Z00 B;  2NRZ A;  1RXV A;  1ARO P;  1NJW A;  3ED5 A;  8ICI A;  3I76 A;  2MUT A;  4RPZ A;  2EAM A;  1COK A;  1T94 A;  4JMU A;  3GV7 B;  4UAT A;  4FBU A;  2V4R A;  4O3S A;  4MFF A;  2W8K A;  1D9F A;  9ICJ A;  1X2I A;  3PY8 A;  1FIQ A;  5F3X B;  4RQ7 A;  1HUZ A;  5KFM A;  4ECS A;  5KFG A;  5HR7 A;  3SAF A;  5HNK A;  3T5L A;  5DKW A;  1ZQZ A;  1PK1 A;  2R8H A;  4KMU A;  4A8E A;  8ICR A;  5EWE A;  1GO3 F;  2HBJ A;  2JZB B;  2XGP A;  1JRO A;  2LPE A;  3KHH A;  2KIV A;  4DL4 A;  5DB8 A;  3M6K A;  5ALI A;  3TAQ A;  4OO1 J;  4F50 A;  5D46 A;  5ALV A;  3PX0 A;  3PW4 A;  1PK3 A;  4C7Y A;  3KKA A;  3MDC A;  3V7J A;  2JEJ A;  4EX6 A;  1OW5 A;  2ISO A;  1V38 A;  2F77 X;  5DLF A;  4KLI A;  4J9M A;  2RP5 A;  3JPR A;  4KLH A;  2KMD A;  2KOB A;  2LM4 A;  1KEJ A;  3ORY A;  3LWM A;  2Y9U A;  2K4I A;  1TKD A;  1HUO A;  5DG8 A;  3FC4 A;  1NZB A;  3AU2 A;  3RAQ A;  3M6Z A;  1OXJ A;  3PR4 A;  2G09 A;  4IQV A;  3JPQ A;  4YG2 A;  2YTU A;  3FM9 A;  3SEN A;  3C29 A;  4GXI A;  3N7P D;  4RPY A;  5ALD A;  1Z00 A;  4B9S A;  3RJJ A;  2HMX A;  4NLB A;  4O0I A;  2F8L A;  2JEI A;  2YB1 A;  8ICN A;  1L3V A;  3ICX A;  9ICH A;  4UB8 U;  3U26 A;  3SYZ A;  3A0H U;  4HAI A;  1ZQO A;  3M7D A;  2ZXI A;  4MEX A;  2HOI A;  4TQS A;  2W3R A;  2KZ3 A;  1RM6 C;  2DUY A;  2IMW P;  3GV8 B;  9ICL A;  2JV3 A;  7ICE A;  4GC6 A;  2JH1 A;  3OSP A;  5JUM A;  2BGW A;  5KFF A;  1N56 A;  3BS5 B;  2DKX A;  5AKJ A;  4Q44 A;  4FO6 A;  2AQ4 A;  2R8J A;  2HOQ A;  2KKP A;  3CNH A;  2IOF K;  3ZDE A;  5ALM A;  4DLE A;  7ICR A;  2JZB A;  1JX4 A;  1X9S A;  1NK7 A;  8ICL A;  2FPL A;  4EEN A;  4US9 A;  3UMB A;  3GU3 A;  3IDW A;  4KLQ A;  2KEY A;  2AQ0 A;  4PH5 A;  5AM0 A;  2JR5 A;  5JTI A;  5KG1 A;  3MFH A;  5KNI A;  5EWG A;  2XID A;  4ECX A;  3AM9 A;  1TAQ A;  1U4B A;  3Q8Q B;  2FMS A;  3EZ5 A;  2KJ9 A;  3BQT A;  4ZOH C;  1MSW D;  2XI9 A;  4PHD A;  5AM2 A;  1DXS A;  1IG6 A;  3MR2 A;  1ZQD A;  3TAD A;  2AGQ A;  3RB6 A;  3T5K A;  5KG2 A;  1UA0 A;  1NI3 A;  2DBY A;  1NZP A;  1X9X A;  2HHV A;  1L7P A;  3IG8 A;  4ED7 A;  1NJZ A;  9ICN A;  3RJF A;  1N63 A;  5KFI A;  4AYB C;  2W3S A;  1Z1B A;  3N4M B;  1F5S A;  5KT4 A;  4KLD A;  3BQ7 A;  3DDH A;  5HHI A;  5AI8 A;  5J8Y C;  4F4W A;  2GWS A;  2B21 A;  1L5U A;  1KTQ A;  2KE7 A;  1L7M A;  4QZG A;  3IG5 A;  4JB3 A;  3PR5 B;  1NJX A;  1BPZ A;  4U7C A;  9ICM A;  5AKI A;  4UAY A;  4LZG A;  1SXE A;  2W9B B;  4DOC A;  2PFQ A;  3L5K A;  1ZQY A;  8ICJ A;  2D8C A;  4DOB A;  2V4Q A;  8ICQ A;  4DQI A;  4QWD A;  5KFO A;  3K1R B;  2OYY A;  3AQF A;  3UXO A;  5DQI A;  5KT5 A;  4ECQ A;  2DL0 A;  3AL0 B;  4BXO A;  4F8R A;  3OPX A;  3BS5 A;  1YZ7 A;  1ZD2 P;  2PMZ C;  2P66 A;  4J9L A;  2JMG A;  1P7D A;  1QQ5 A;  1RQL A;  2BPC A;  4J9Q A;  5KG5 A;  1MN8 A;  9ICW A;  5ALQ A;  2ZIV B;  4QNL A;  4I2C A;  3PSF A;  4B9V A;  5ALZ A;  4ECU A;  5L1M A;  4USA A;  1CUK A;  4EZ6 A;  2I1Q A;  4TUS A;  3AQE A;  4JWN A;  1ZQK A;  1D8L A;  1ZOL A;  4RQ5 A;  3PML A;  3RH6 A;  1SIJ A;  3F5A A;  4EBD A;  1Q3U A;  2V9W A;  5B66 U;  2B6G A;  4QWA A;  3IRU A;  1RYR A;  2BPG A;  3N28 A;  2UVW A;  4TUR A;  1ZRN A;  5L1K A;  1NKE A;  3IN5 A;  1HEK A;  4DL7 A;  3MR3 A;  2H3Q A;  3MGH A;  4IR1 A;  1ZQL A;  3AN1 A;  5EE0 A;  3KZI U;  4OJ5 A;  2I9G A;  2BR0 A;  1SZH A;  2G0A A;  1SWW A;  2HDO A;  5KFQ A;  3TI0 A;  4DSI A;  3RJE A;  2LYH A;  3H8S A;  5KFX A;  3KHG A;  1S97 A;  4O9M A;  4DO9 A;  3QU4 A;  1X6J A;  1JXE A;  2F2A B;  4MHV A;  4EEY A;  7ICF A;  2KHQ A;  4UB3 A;  1L3T A;  3MAB A;  4KLM A;  1A77 A;  4DQP A;  3HRD D;  2ASL A;  2Z7J A;  2XGQ A;  3HP6 A;  4QZ9 A;  3V6J A;  2F3N A;  4ZH4 A;  9ICC A;  1BPB A;  3JPO A;  1ZQP A;  1PUZ A;  3TFR A;  2HHX A;  3C1Z A;  3WKA A;  3LWL A;  4F4K A;  5KT7 A;  4O3R A;  4EYH B;  1KDH A;  2E1E A;  8ICW A;  5KT6 A;  5FP0 A;  2Q0Z X;  1JUD A;  2ZUD A;  4UAV A;  3NAS A;  3V72 A;  1L6N A;  2EZX A;  3Q8R B;  5KFU A;  5DB9 A;  1D9D A;  5HR6 A;  4YVZ A;  1JN3 A;  3HPO A;  1S9F A;  1BGX T;  1S0V A;  2D6F C;  1S10 A;  5ALH A;  1DGJ A;  3HX0 A;  1SV0 C;  4RNO A;  5AKK A;  2E8M A;  2ZIX B;  3T3F A;  5AM5 A;  2B0C A;  4MF2 A;  2W9M A;  1QSS A;  2KVC A;  1SV4 A;  3WK7 A;  2XC9 A;  2KNJ A;  3NS1 A;  5EE1 A;  4QWC A;  2WAQ F;  1TK0 A;  2Q4T A;  4US8 A;  4R65 A;  8ICU A;  1URJ A;  1LVH A;  1XWL A;  2QAR B;  4NL9 A;  3BQ1 A;  1FEZ A;  5BOM A;  1NK5 A;  4DFP A;  1FO4 A;  1SL2 A;  4DL2 A;  3DEE A;  3RJI A;  5DBC A;  1U45 A;  2EAO A;  2ZTD A;  4Y2R A;  2HOF A;  4BX9 C;  5F9N A;  2DFL A;  2FDR A;  7ICI A;  4Q8E A;  4ED3 A;  1ZQG A;  5KFT A;  4YR0 A;  4M9G A;  3MGV A;  3GIL A;  1BPE A;  3Q8M A;  1J2N A;  3M8S A;  1LKY B;  2ZIW B;  4WJ3 B;  3KOO A;  2AU0 A;  1MA7 A;  3D2Q A;  9ICS A;  4QZF A;  8ICZ A;  4ECV A;  5CHG A;  4FFD A;  3M9N B;  4IQU A;  4I2E A;  2E8O A;  3QU7 A;  3QZ7 A;  3BZK A;  1PVP A;  3RTV A;  4LVS A;  2KSO B;  9ICT A;  5ALN A;  4DQS A;  3WK5 A;  3MDA A;  4KLG A;  2HI0 A;  2I6X A;  3PSI A;  5KG4 A;  4RUC A;  1ZQQ A;  1BPY A;  2ZG6 A;  1NKB A;  3EPG A;  2FLP A;  1IXR A;  4B9N A;  4IL6 U;  3AU6 A;  3GZF A;  2HW3 A;  4U6P A;  5KG6 A;  3C2K A;  2D3D A;  2DKZ A;  3HW8 A;  4IQW A;  4R8U A;  3H0M B;  4P0Q B;  8ICY A;  4Q45 A;  5J2K A;  2G08 A;  9ICA A;  1WG8 A;  2HSZ A;  4ED6 A;  5KG3 A;  4GC7 A;  4FZN A;  2KTQ A;  3GDX A;  1C7Y A;  2BHN A;  1JI7 A;  2W7O A;  2FE9 A;  3RR8 A;  1L3S A;  3QU9 A;  3C21 A;  4QZC A;  4FS2 A;  4JV2 A;  4IQT A;  1QQ7 A;  4F5P A;  4YR2 A;  1N2X A;  4F71 A;  3TQ1 A;  4UAW A;  2RDI A;  3UQ0 A;  3D2S A;  7ICN A;  5J0X A;  4DS4 A;  2EDU A;  4RQ0 A;  3L4P A;  4QWE A;  2GO7 A;  5KFP A;  3I1Y A;  3SD7 A;  1SKR A;  1ZQW A;  4ECW A;  5KFR A;  2ZIW A;  4NY8 A;  1ZQF A;  4YMO A;  2OM6 A;  2ZUB A;  1YT3 A;  3ALR A;  5DBB A;  1Q46 A;  4KLU A;  3QNM A;  4EYI B;  2WF7 A;  1NK8 A;  5CB1 A;  3LYS A;  4J9K A;  1TFR A;  2YN4 A;  4BDP A;  5AKZ A;  2KSO A;  2E3T A;  4NM2 A;  4I29 A;  4O3N A;  3MR5 A;  1D8B A;  9ICX A;  4YD1 A;  4QZA A;  7ICQ A;  1HJP A;  9ICE A;  2F1H A;  2H3F A;  3WK9 A;  3CRX A;  2HVI A;  3PST A;  3V6K A;  3ETR A;  3QX7 A;  4CRX A;  4ED0 A;  2XVT A;  3WKE A;  1XSN A;  4UW9 A;  5KFH A;  3T79 A;  4DWI A;  5KFL A;  7ICO A;  2W9C B;  5J2G A;  2NO5 A;  4C4T A;  2XCP A;  4P0Q A;  5J0S A;  3BJY A;  3RH4 A;  1ZQJ A;  1B0X A;  3MC1 A;  2IHN A;  3N97 B;  2NRV A; 
#chains in the Genus database with same CATH homology
 4UB8 U;  3A0H U;  1S5L U;  5B66 U;  5KAF U;  3A0B U;  3KZI U;  5H2F U;  5KAI U;  5GTH U;  4PJ0 U;  2DUY A;  3WU2 U;  5B5E U;  4IL6 U;  2AXT U;  5GTI U;  4UB6 U;  5E79 U;  5TIS U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...