3B9JA

Structure of xanthine oxidase with 2-hydroxy-6-methylpurine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
ADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xanthine oxidase
publication title Substrate orientation in xanthine oxidase: crystal structure of enzyme in reaction with 2-hydroxy-6-methylpurine.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 162
sequence length 162
chains with identical sequence I
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2007-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3b9jA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b9jA01
4YTMB 1N62A 2QIEB 1J7AA 1L6UA 5EE3A 3AN1A 1VJKA 3LB8C 2CU3A 2WLBA 1OQQA 3AEAB 5H8YE 2BS4B 3NVWA 1FFVA 1FIQA 2KMMA 1E0ZA 1QOGA 3AEGB 4US9A 1SB3C 1I7HA 3W9CB 1AYFA 4KX6B 2KAJA 1JROA 2WDQB 1NVID 2W55A 3AE4B 3AMZA 3AE3B 4C80A 2L52A 3P4SB 1L0VB 2EKIA 2K22A 1E7PB 1FXAA 2H88B 2K9XA 3AE6B 1ROEA 2JQRB 2WU2B 3AE5B 3FAHA 3AEEB 3BIID 3CIRB 3P4RB 5GXGB 3VR8B 1WXQA 3L4PA 2JX5A 2PVGC 1QOFA 1NI3A 5AUKA 1SIJA 4N58A 1AWDA 1JW9D 3AE9B 2BT6A 1QF6A 1ZP0B 3AH7A 3FC4A 3VRAB 1RM6C 1J7CA 5G5HA 3B2GA 2K5PA 5EE9A 1N5XA 1ZOYB 1XLOA 2DBYA 3VRBB 1YQ3B 3EUB2 2OHFA 3HRDD 2PIAA 4JX1C 4YT0B 4C7ZA 2LEKA 2M56B 3AE7B 3NVZA 1FFUA 1OQRA 3CWIA 1PDXA 1WGKA 2WDVB 3AB5A 1N5WA 1WRIA 2BS3B 2PVOD 3WCQA 2WDRB 1OFFA 1ZXIA 4YSXB 1QOAA 1N60A 1FMAD 2W3RA 1KFYB 4IDIA 1NYQA 4JWUC 1A70A 3P4QB 4HRSA 3AEFB 2FBWB 2MJ3A 1B9RA 1DOXA 1N61A 2B76B 2MJDA 3B2FA 3HVZA 3P63A 1KF6B 4YTNB 1EWYC 2WP9B 2PKOA 4YXDB 1NYRA 3P1MA 1XLPA 2WQYB 2E3TA 2MJEA 1V8CA 5C2TB 1GPXA 1KRHA 1SF0A 1TKYA 3AECB 1FXIA 2H89B 5MPOA 1QOBA 2M19A 3AEBB 1TYGB 3DWMA 2CJOA 4JWSC 3W5VB 1FM0D 1L6VA 2N0SB 3AE8B 3SFDB 1JWBD 1IUEA 3NS1A 1RWSA 1ZUD2 1WWTA 1TKGA 3LXFA 5AUIA 2L83A 1VLBA 1NENB 3ABVB 2Y5CA 1R7SA 4LTUA 3SFEB 2WU5B 4N59A 4ZOHC 3SR6A 1V97A 1VDVA 4WQMA 4ZHPA 4FXCA 1XLQA 1DOIA 5H92C 2W3SA 2HTME 1FRDA 2BS2B 2MH7A 1XLNA 2CJNA 3P4PB 1JRPA 5EE0A 1TKEA 3W5UB 3B9JA 1GAQB 1JWAD 1QT9A 4HROA 3VR9B 4A9AA 1F0ZA 2DWQA 5C3JB 1DGJA 3AE2B 1WYGA 1UWMA 3AV8A 4C7YA 5G5GA 4ITKA 4P6VF 3NVVA 1PUTA 1XO3A 2G1EA 2AX5A 1JALA 1RFKA 3RPFC 3NVYA 1E6EB 1N63A 2W54A 2ACZB 2QJLA 4N6EB 2WS3B 1L5PA 1YJIA 3ETRA 1CZPA 1E9MA 3ZYYX 4US8A 3AEDB 4ZHOA 1DOYA 3NRZA 4USAA 1PFDA 4YSZB 3AE1B 5EE1A 3HUIA 1NEKB 1J7BA 1RYJA 4WWMA 1YQ4B 3DWGC 1FO4A 1YJJA 1FRRA 3KWLA 1E10A 4YSYB 2Q5WD 3AM9A 1CJEA 3PO0A 1T3QA 1TJEA 4YTPB 1JQ4A 1QLBB
chains in the Genus database with same CATH superfamily
2PMVA 3RJIA 2GLSA 4DF4A 1I4GA 4UAWA 3LB8C 2PFOA 1RFAA 4KLUA 4KVGB 1E8YA 3SMVA 4R65A 2J0MA 4A8XC 2PJHA 4F1SA 4EBCA 3PR5B 2C7NB 4PPXA 2PFNA 3R66C 3PNCA 1A6SA 2MU2A 5BOLA 1E7PB 2RD0A 3MC1A 4B0MA 4P0PA 3RB3A 2DAFA 2A1JB 2WXHA 3MGIA 3BIID 3C8YA 2LHDA 1NI3A 5AM1A 3RJFA 4O1NA 4Y2TA 1JW9D 3NASA 2R8HA 4MGIE 4Y2YA 1GB1A 4YMMA 3EFCA 1MJDA 3GZFA 5KG5A 3UINB 3KZXA 5J2CA 2XGQA 2DBYA 5KT2A 2VA2A 1XLOA 2QSDA 4A55A 1SWWA 4OJ6A 3HRDD 1GNUA 2NV3A 5BYRA 3LDAA 3QE9Y 3N9YC 1RXVA 1XCTL 8ICEA 2M56B 3RB6A 4F7ZA 3NVZA 1S1QB 4ZYSA 3I9V1 4QZDA 2WTFA 4GMVA 2W7OA 4KGSA 1SL1A 1R4NI 2K8BB 3R7QA 1A70A 1TZOA 2MRPA 2WF8A 3HILA 1UBIA 1ZPSA 2LBOA 1QZEA 4XYCA 5AK6A 1E5WA 1C4AA 5KFRA 1D8LA 4GDKB 5MPOA 1QOBA 2KJRA 4RQ6A 2KKVA 2NYVA 4BOZB 2YMQA 3BS7A 4HKQA 2PPHA 2R18A 3HPOA 3OHAA 1VZ8A 2Y1JA 1GB4A 2OYYA 5AKHA 4OZBA 3U7DA 2D3GA 9ICQA 5AZFA 4PHEA 1B4FA 3GILA 1JMLA 3LK9A 3DHGC 1PZNA 1TTNA 3QC8B 3AQFA 3B08A 1WMHB 3SV4A 5KFWA 1T8EA 4DWFA 3AE2B 1I42A 1EWCA 3PO4A 2HTHA 4XGAB 1QQ6A 4QZAA 3DVNV 4I6LB 2Z59B 3H7IA 4GIBA 2DZIA 7ICJA 3HWTA 2VKQA 1HTQA 2K8HA 5KG1A 4R8UA 4TUSA 1BXTA 1YJIA 2KANA 3ZYYX 1DOYA 3N1XC 2IOFK 4XWTA 3C23A 3HUIA 4BZAA 3SENA 3MGHA 1YQ4B 3AU4A 2L0FA 1RRBA 5DDMA 1J97A 5IIMA 2FI1A 1TVAA 4M8MA 1JQ4A 2ZIVA 1JX4A 2GOWA 3TBLD 5EE3A 1D9DA 2KVSA 1D5ZC 3AEAB 4K4HA 3IV6A 4C8LA 4M9NA 5AKLA 2BS4B 3RNCC 7ICEA 1UH6A 4FFDA 3L16A 5IIIA 4BBNC 2FCQA 4KX6B 4OHJA 2PMZF 2OJWA 3NTUA 2QKQA 2MWSB 1NKCA 1E8ZA 4NPNA 4XA5A 3RUIB 1ZQRA 4Q8FA 3ISBA 2WU2B 4JQWC 2K25A 5GXGB 4C4VA 4C4RA 3GV8B 2PVGC 1QOFA 3ICXA 4JV2A 3AUOA 5FKAC 4F8RA 3OWEB 3DBSA 3JPOA 4F5QA 3FILA 2KSOA 3PW0A 4AUQC 2I6XA 1U48A 2WAQF 4QW8A 1YQ3B 3EZ5A 1SKWA 3HHMA 1WG8A 1SL2A 4BFRA 2G3QB 3SYZA 2NRTA 3CWIA 3QK0A 1CK1A 3N7PD 1VD2A 3V6HA 4MH8A 3GE3C 3BQ0A 1ENFA 2RDBC 3AEFB 3U8ZA 5KFEA 4GLSC 5KFYA 1C76A 2V1YA 3KW5B 4YXDB 4E74A 4HCPB 1NYRA 4PHPA 4DSFA 1DK2A 3RMKC 5JTIA 4RQ1A 3MGVA 9ICMA 3DEEA 2W9CB 4QWCA 1TKYA 3BY4B 4EOYA 2JRZA 1B0XA 3S6JA 2ZCCA 5D3IB 2WWZA 2Y0SC 1V5TA 1D3ZA 4ED2A 2FLLA 3CMMB 4A3OA 4WWPA 2KLCA 1IP9A 2JU6X 1P0RA 2KDIA 3GV7B 2KJHB 2I9GA 3UQBA 1DRGA 1SE4A 2EZYA 5ALFA 3J81j 2O6VB 2H3ZA 1ZQSA 1D9FA 7ICFA 3EC8A 3V72A 3QX1A 1NJZA 2CXYA 3BJYA 2NPTA 2J4XA 3MDAA 3H8HA 3VR9B 2JMGA 3L54A 2HE7A 5KAIU 4DCCA 3TAQA 1PGAA 2K3UA 4K1RB 3RN9C 1UWXA 2A1JA 1BPZA 3PRMB 3HX0A 2AGOA 1ZD4A 1V1PB 4DQQA 2HMXA 1STEA 2YLMA 1E7VA 4X5VA 1L5PA 1KN5A 4ED3A 4QW9A 3C5GA 1UUPA 2LHTA 3M8SA 4P2HA 1C7YA 4GOCA 1RYJA 3HW8A 2G9HD 1E7UA 4YSYB 4XDCA 4E0DA 1ZQZA 2ZG6A 4TQSA 5CB1A 1WGDA 2IHNA 4QNLA 5J17A 2E8MA 2XY7A 2O6KA 3PR4A 1V49A 4I2DA 2K8BA 2KDEB 5AI4A 5C1ZA 2W8KA 3GZNB 2JXJA 3TKAA 3ML8A 1NKBA 4IQVA 3RH5A 4BVUC 5J2KA 4RQ8A 2Y3AA 3P4SB 3HP6A 5BPCA 3QU2A 3T9LA 3U4EG 1KQQA 2K22A 4CF5A 5L83A 1L2NA 4UASA 2JQRB 2RPQA 4GDKA 4DXGA 2IY0B 3EW9A 4MACA 4IOIE 1ZQHA 5DB8A 2GB1A 1SIJA 2WXKA 3O13A 4WURA 2CHWA 3ZJVA 4DHZB 5DBCA 4DXAB 3RI7C 3ZDMC 1ZOLA 3VRBB 5L1LA 4UB2A 5CWRA 3M9NB 1XXGA 1AW7A 4JLCA 4TURA 4J3OD 4YT0B 3UF8A 2RLTA 3MHZA 3KLSX 4UB6U 4GU2A 4Y2UA 1I35A 5HP4A 3N28A 3V7JA 3C19A 2LRUA 7ICLA 2PVOD 3ZIMA 1WMHA 4KLFA 2GRIA 4JL9A 1P9DU 4KGTA 5KFOA 4F2RA 3QZ7A 3BVMA 1J8CA 8ICWA 3PW5A 3B2FA 1TE2A 2IO3B 1L7PA 2F3NA 4YTNB 3Q8CA 2KX3A 4QZ8A 3P1MA 3R2TA 1SXDA 5C2TB 3AECB 3RJHA 3SEBA 4DS5A 3U30A 2JRIB 4HVBA 1V86A 1O03A 1ZQUA 3HM6X 4PL2A 3DWMA 2DYMA 7ICRA 2I5HA 1RLFA 2N1WA 4TV3A 5JHAA 4W9GA 3NY5A 4C4SA 4IC7B 4QZ9A 5J2RA 2AXTU 3UM9A 5J0WA 3SFEB 2LJ5A 4DOAA 4M9LA 4XWWA 1SV4A 2Y5BB 2KNJA 2W9BB 3M9MB 3GFKB 2RR9A 4HJKA 1XLQA 3Q14C 2W9MA 5KNIA 1GG3A 3MABA 2CJNA 5KT3A 4K3CA 3W5UB 1TFRA 4RPXA 3T5KA 2OEDA 4PJ0U 7ICKA 3QA8A 2PFQA 2WHIA 1ZRMA 2GH1A 4DS4A 4R63A 4PS7A 3RB4A 4JPSA 1X6IA 3QUBA 5D3DA 2HI0A 3NVVA 4QWBA 2BQQA 5E6PA 2LI5A 2KDFB 3IVFA 3H9DA 1WXSA 4F71A 2GMIC 2ESEA 2JHDA 3Q3FA 3V05A 3TFSA 4FJZA 4JB3A 2IO1B 3KFUF 2LZ6A 2W11A 2KVRA 3GIIA 4NNJB 3V61A 3T79A 2DYBA 1JXLA 4MFCA 1S8OA 2J0JA 1YT3A 3K75D 3GOEA 2W82A 4DHJD 4XE0A 2C5LC 2MP2B 3G6YA 9ICFA 1S5LU 4MT5A 3G6VA 5H8YE 1M4VA 5BO4B 1KOTA 1YMHE 3QU4A 2HOFA 1OEYJ 3H8SA 2OEHA 1SB3C 3NRWA 3ZDCA 2QB0A 5L1MA 2KAJA 3PSPA 4KLOA 2MAXA 2KFKA 2ODGA 2LGIA 5E6OA 5LNK1 5DPRA 3RNEC 2IBKA 3PX6A 1SE3A 3JPNA 4EFOA 2OH2A 3QU9A 4M0AA 5KG2A 2IGDA 2BT6A 4OCZA 1Z1BA 1PGBA 5J0UA 1ZQXA 3LYSA 4RGMA 2DUYA 2W7PA 2ASJA 3DV9A 1GC6A 2INPE 1K1QA 1NNLA 3BS5A 3MJ5A 2O6VA 1LKYB 2WXPA 4BDPA 1TS2A 3ZRFA 1OQYA 4BUGA 2BZFA 4RNNA 2E8NA 5KFKA 4TUUA 4PH5A 4C8NA 4J9LA 2MCNB 1N5WA 4RQ5A 4F3OA 1WF9A 3MFIA 3BQ1A 1TK8A 1K5OA 4O5KA 1YN4A 3WKCA 4Q8EA 1QKZA 5TZVA 1PYWD 3M95A 4LDTD 3UPQA 5IINA 1PVPA 3BZCA 4O0IA 8ICZA 1IGDA 1KTKA 1XEEA 3RJKA 3OAWA 4YP3A 3MR3A 3N30A 1V1PA 2M8SA 2F77X 3UMBA 3V7LA 2G45B 2ZEQA 4CHKA 1JXEA 5AI0A 9ICGA 3ZW3A 1TY2A 3I3TB 2VJ5A 3RNGC 3WAPA 1SBBB 3QUTA 1MPEA 2FCNA 4IM3A 2KV2A 1G6JA 5B5EU 1WXVA 1LV5A 5DQIA 2E8PA 3WKEA 3PVLA 5J0XA 5HR7A 2F2AB 3UXNA 2BQRA 4ICUA 2XY6A 3H40A 4MGZE 1QLNA 3SR6A 4ECRA 4FULA 4BXOB 3TEZA 3NHEB 4RQ3A 2FE8A 2ZCBA 5J0QA 2ALZA 2LVPA 3KVFB 4O3PA 9ICRA 1FEHA 2Y9UA 2F76X 4KLEA 4GSWA 1WYGA 4J9KA 2Y1IA 4LJOB 3UGBB 2AQ3B 8ICIA 1IYFA 4YD2A 4RT3A 1C1YB 4N6EB 4A90A 2Z7JA 3T5LA 1WM2A 2LKYA 1XSPA 5EE1A 3WAOA 8ICNA 2KVZA 2N1VA 1NEKB 2HHTA 2XVTA 5I4DA 1MHXA 2K6DB 1M6YA 1TKDA 4LNIA 4DSIA 2DNFA 2Z8LA 1T6BX 4NY8A 1RYUA 1D5MC 1FNUA 9ICNA 2LPEA 1XSLA 3D32A 2JR5A 2ZUBA 5HHDG 3JPTA 4GDLB 2DKZA 4NLBA 1L6UA 3C2KA 3EGRA 5LLIA 1VJKA 1Q0WB 2W9AA 5KFUA 3NG0A 1GJZA 1NBFC 1KLUD 4X57B 1AROP 3IDWA 5J0PA 2G0AA 3W1SA 4FJYA 4HPLB 1S0VA 1SJHD 1E0ZA 4F5NA 4YL8A 2Y9TA 1XSNA 3OG5A 3H8WA 2HOQA 2DFLA 3PW4A 3ALBA 5IIJA 4DO9A 4RUAA 2M0NA 2HHQA 1KLGD 2M17A 3ZKJC 3MR6A 2AU0A 1UA0A 1FXAA 4G0NB 1ZQFA 4KLLA 5KG4A 5KFFA 3L4PA 3NUHB 2QHOA 2G06A 4J9QA 2LWPA 2OCEA 2ZVNA 4N58A 4MEXA 2A1AA 3ZDDA 3FC4A 4AYBF 3A1QB 3MC9A 3PRPB 3PMNA 4RM8A 4Z6EA 5EWFA 2OHFA 1E90A 2YMPA 1BNOA 3OJ4B 4WJQA 2P66A 8ICJA 1XS9D 3AU5A 3EHVA 2PW9A 2W9BA 4RMAA 4P16A 5DKWA 3ZDBA 1L3UA 4YSXB 3UXPA 1OFFA 1ZXIA 4W9DA 2W04A 3P4QB 4MF2A 3M1YA 3RJGA 4QZBA 1V38A 4OD0A 1WGRA 2ICIA 4PS3A 2KHVA 4DFMA 2KX0A 4WAFA 3DCGA 8ICYA 3JSVB 1V8CA 5AKJA 1ZQKA 5E6NA 3JPRA 8ICHA 1MHHE 1SF0A 1LB2B 1S0NA 4RGNA 3ZO5B 2D10A 2HBLA 2WHEA 5HMMA 5C23A 4F4XA 5HHHA 1UD7A 4ZH4A 4TQRA 2JGAA 7ICTA 3TANA 3Q8AA 3BZDB 4K7UA 3CP8A 4FS2A 1O08A 2FUHB 2WXGA 2WB1F 1JWBD 1L3VA 4HXDA 1YD8U 5CHFA 1LGRA 5DB7A 3GIKA 5AKIA 2L83A 1TV9A 3FKYA 3OLMD 1VLBA 3QCAA 2P6RA 1ZQTA 4EZ9A 4XC2A 2WU5B 4N59A 5CHVC 4QWAA 1SKRA 2EMTA 3KBBA 2D8CA 2ZJ5A 3U26A 1YQBA 2CR5A 1JWAD 5E79U 3KHHA 1JWSD 1R4MI 4CO7A 1TGZB 2LASA 5ALEA 4LCDE 3MR5A 2HDOA 3Q2AC 4DWIA 1U4AA 1PUTA 5AKKA 4WWOA 4JE3B 1RG6A 3X23A 2BPFA 2KKCA 3E0FA 4RF1A 4NL9A 4ECUA 3BVGA 1Z5SB 3GB1A 1XF5L 2F1HA 4Y2PA 2BTEA 1LKYA 1ZRNA 3EECA 2E5SA 1YJJA 4C0ZA 3A33B 1WWVA 2MA9B 3OSNA 4DQIA 2L1AA 4YTPB 1S0MA 1SE9A 1J7AA 4TUQA 1H8CA 4OW0A 5IIOA 3RZWC 4DL2A 3Q8BA 4KLGA 3V6CB 2DHZA 2ZIUB 1OXJA 4DOCA 4DEZA 2IMWP 3MP9A 3AXCA 1KM7A 2W55A 1UA1A 3AE4B 4K7SA 2L7RA 3M7DA 4ECVA 1SJED 4OJLA 4YFKA 3ISDA 2IHMA 2KIWA 1SEBD 4YVZA 2L0TA 2H5XA 3OGUA 2K1FA 2YMMA 3SEIA 3VRAB 3LVVA 2ZW0A 2KTFA 3QJZA 2KKPA 1ECWA 5HR6A 3E9SA 3N7RC 2LYHA 3DDHA 5JRTA 4YR2A 4M04A 3IHQB 5JU5A 4DSLA 3JYUA 2PIAA 3PSFA 4PHAA 4REZA 4FN2A 2YVCA 2AQ0A 4PT5A 2KK8A 1ZQCA 5J2IA 4BXOA 4OJOA 4LNOA 1WRIA 2BS3B 5KFMA 3WCQA 4EEYA 1ZJNA 2BQ3A 5J0RA 1PVRA 3DHIC 5FR6A 4EKUA 2HHVA 2YY6A 1QILA 2B76B 4AJYB 4KLMA 2KWVB 5LXIB 2WQYB 3DBRI 4FS1A 1KW4A 5AIAA 5J2BA 2GBKA 5D7GA 4LK0M 5DGBA 3IG5A 2KE7A 1FXIA 1Q3VA 5BMGA 2PE6B 4KMOB 2BCSA 3GIJA 2BW2A 2WX0A 2ZZPB 2O2VB 2BYTA 1JCKB 3N1ZC 2IYDB 4FHJA 8ICVA 4ANWA 3TSSA 4G3XB 2MBOA 5BOMA 3WIMA 1BPXA 3NJTA 4B9TA 4GDLA 1WYWB 4HPMB 4RQNA 4Z6DA 2KHQA 1ZJMA 1HEZE 2ASLA 1A5RA 2BR0A 3ZVVA 2BPGA 4NY0A 3V62A 5IILA 4J6IA 2WX1A 4HCNB 4ZHPA 5GTIU 3PLVA 2Q4TA 5ALPA 5EE0A 2KZMA 4GB9A 7ICUA 4M9HA 3DBHB 3ZUNA 2KJ5A 5CJ7A 3RH4A 3KQ4A 3B9JA 3DBRB 4RNAA 1RDFA 1I4QA 4HROA 5AZGA 1N2XA 1IIPA 5ALKA 3WKAA 3RRHA 3SQIA 1WJ4A 2HD5B 2ZIXB 2R8IA 5AM5A 4EBEA 1JALA 1TK0A 5AEKB 3WK6A 4O3NA 1L4ZB 4P7IA 4Q2JA 4EEWA 1MC8A 2ACZB 3VAWA 2JVCA 3A1QA 4FHKA 1E9MA 5L1IA 4HYKA 4US8A 1NJWA 4PS8A 1ZQMA 4ZHOA 1NOMA 2KWUB 2L5YA 5J29A 5KFSA 4WWMA 4ECWA 3A0BU 1FRRA 1NKEA 4ECYA 1X9WA 2OM6A 2FMQA 1Q1OA 9ICAA 1V80A 5D6JB 1UF0A 2LMCA 2KT7A 2FNJB 2XBBC 4CF3A 4K7WA 2WDTB 3DQVA 1SZHA 1FFVA 2PLPA 3T3NA 2KXJA 1SXEA 4C4TA 3JSVA 3RT3B 2M0XA 2KQSA 2V3PA 5CHWA 2EKEC 4BKTA 3ZI4A 4J9MA 1ZQQA 1IV8A 1X42A 3FAHA 4CE6A 5DGAA 2NCNA 1WXQA 2KVCA 1SWVA 1X6JA 5EOZA 2ISPA 2SEBD 3AE9B 3MJWA 4KZ0A 4B6WA 3TEWA 1ZQEA 4I6NB 2FMSA 4IRCA 3APCA 3PREA 4ASWC 2RDIA 1P7DA 2VA3A 5ALQA 2VA8A 4JX1C 3D6JA 5ALVA 3B0YA 3OJUA 1FFUA 1WGKA 3MTNB 3ECIA 2BYFA 3V60A 3ZD9A 5ALOA 1MVKA 4ARIA 4H2AA 3ENEA 1TAUA 4JWUC 1B9RA 5AKGA 3E58A 1DOXA 4NJ7A 1B22A 4DBGA 2KN5A 3VDZA 1JN3A 3MC8A 2EZXA 1OUQA 2G4SA 2WXRA 4JV0A 1Z3EB 5ALYA 2J52A 4IR1A 3L17A 2QEJC 4OZAA 1I4PA 5JZEB 3CRXA 4M9JA 2JUOA 1F0MA 3VH4B 2F44A 5AKXA 4KLSA 3SAFA 1RXWA 4ZRJA 5BMHA 2J0KA 4YCXA 4EX7A 2IDYA 3ZJUA 4HWIB 3RRGA 7ICIA 1ZQAA 3T5HA 1XNSA 4UB5A 2N7EA 2ZTCA 2JV3A 3KYDD 1BPEA 1RQNA 4KLDA 4F4ZA 4A8EA 4F72A 4PHDA 2GBNA 3C0RB 3AQEA 2JRHA 2NBVB 4B9KA 2RQ5A 2JEFA 9ICXA 3UIOB 2HHSA 3EWAA 3BK1A 1TT5B 1WWUA 1L3SA 3SI8A 2LYAA 2ZPYA 1P3QU 5CR0A 2XIDA 3MFHA 4IQUA 5KT4A 2KTRB 3VC8A 3PSEB 4C8OA 2D3BA 8ICLA 1ZGUB 2YB4A 3CW2C 2LJIA 2IY1B 3PMLA 3IT6B 4NLCA 4QZIA 3URYA 1NK9A 3BQ7A 4F5PA 1DXSA 7ICQA 2I1QA 4MDKE 1WR6E 3VVWB 2MSED 2L8JA 1CJEA 3MHSD 3PO0A 2PI5A 5J0SA 1QLBB 5KG0A 2NVUI 3C1YA 3HK0A 3HKZF 5DQGA 2LXCA 3H4DA 2WXJA 1OQQA 2JYTA 4FJVB 3GZNI 3NVWA 4RU9A 1UPHA 2IOFA 4I2IA 1IBXB 5EDSA 1WX9A 2BCUA 2M0AA 3KUCB 2RRDA 4F93B 3Q8KA 3WK4A 2J6UA 3Q3NC 3KKAA 2WXLA 3FDSA 4J9PA 3DVGY 1L0VB 2Z0DB 3QU7A 3VR8B 3AE5B 1IG6A 4TUPA 2VIXA 4EELA 2LM1A 4YQWA 2W43A 1X9MA 1E8XA 1SL0A 2V9HA 5AI5A 2M1MA 1AWDA 2DPIA 4RQ2A 2REXA 3M3JA 3AH7A 2NO4A 1RM6C 4M6WB 2QLTA 1GOZA 5ALZA 2DF4B 2FLNA 2MW5A 4KGRA 4EZJA 4C7ZA 2QILA 2I38A 4IR9A 1F2RI 5BYSA 3UQAA 1NZBA 2LRWA 3BINA 1XCQL 3BK2A 1QOAA 3ZNID 4KDIC 4NV0A 2NRWA 1UQVA 2OXOA 2L05A 3QQ8B 2ZIXA 2IPKD 1SZPA 3BYTB 1BGXT 1ZW7A 1YNTE 3L3FX 1KFSA 5KFCA 1FD6A 4IQWA 3L0WB 1KRHA 3TCAA 4I2FA 2KQ7A 1EM7A 2PTLA 2K4EA 1L7YA 2LD9A 3H6NA 1Q5WB 1BT0A 4BKSA 1N48A 3IAS1 2ZNVB 2ZPNA 2FJ6A 1A0PA 5AK3A 1COOA 1MQ3A 2MBHA 2ES6A 4K3BA 3R8BA 3PX4A 4LNKA 1D8YA 3GV5B 2HJ1A 8ICUA 3PSIA 3V6EB 1QSYA 1WZ0A 2DL0A 3NS1A 5KHOA 1KFDA 3UMCA 4I6PA 2KZZA 2D11A 1NENB 3ABVB 5F9NA 5DCNA 3BYYB 1Z00B 8ICBA 3APDA 4LJPB 2V3SA 2WXQA 3GDXA 1VDVA 4F4KA 2J6SA 5AM4A 1DOIA 2HBKA 1HQRD 2BS2B 2MH7A 3UI3A 5F3XB 5L9XA 3WK5A 1QT9A 3QXGA 1L4DB 1U47A 4GXIA 3DVGX 3AV8A 2KG5A 2NBUA 1NK7A 4IG7B 1T0YA 1ZXHA 2AX5A 1WE6A 3RAQA 1N63A 4RUCA 4I27A 3T3OA 1U9LA 3ED5A 4KSKC 1L8OA 1HIWA 2HBMA 7ICMA 4JGHB 3VTUA 4YSZB 3AE1B 4Q45A 2JF5A 2NRXA 2YN4A 2ZJAA 5ALDA 2LGSA 4OVUA 5IA7A 2FCSA 2JXTA 1UELA 1DOQA 2ON8A 3JVZX 3MR2A 2PMZC 1SV0A 3BWUD 4EENA 3K4GA 3HVDA 2G4DB 4N9F4 1NI2A 1UT8A 3FYHA 4IRKA 1RAXA 3RJJA 4QZFA 1V1OA 1WRDB 2K8AA 2XI9A 1NJXA 3RBEA 1A77A 5CEHA 1S77D 4B9NA 2KTQA 3AL0B 1UCVA 1V6EA 4JWNA 2BVCA 2WDQB 3AMZA 3PLUA 2ASQA 4B0EA 4FZMA 5J2DA 3L10B 2WAQC 1ROEA 1WI0A 5JH5C 2XICA 3BQ2A 2JZ3B 5KFDA 5KFNA 3M9OB 9ICIA 4R66A 5D2MB 3PSTA 2WXIA 3ONSA 8ICAA 3RCZA 2KMCA 4KITB 4ECSA 1WJNA 2O6VD 3B2GA 1F5SA 4KX3A 5KG7A 4EEKA 2C2RA 1ZQGA 1C78A 2R8GA 4BX9C 2KYWA 1TS3A 3QUCA 5KFXA 2EDUA 1KL9A 1V9PA 4M9GA 1YN5A 2HHWA 1WXMA 1N60A 1JMSA 3KHLA 2W3RA 1KFYB 3OSPA 2W9CA 2VH2A 5FR3A 2WXMA 2MJ3A 2MJDA 3MC0B 3RTVA 2PKOA 1ZQ1C 1HJPA 4WAAA 2XC9A 4KZCA 3THVA 4QIWF 1J2NA 4Z6FA 2LHEA 1WGYA 1ZDVA 4Y2JA 5AI6A 4JK1A 4F91B 1L6VA 2EAMA 4J03A 2KJ9A 3WALA 2V4QA 2L3ZA 1RYRA 1L6NA 4U7CA 1C77A 5DBBA 1MN8A 2EZZA 1MQ2A 2YB1A 5A0LA 1SIFA 5AI9A 4OO1J 2NRVA 1MFWA 3MFGA 4YD1A 1IBXA 4WJNA 4HJGE 4UB8U 4EYHB 1YJ1A 4FLHA 1QQ7A 5J0TA 4NLKA 2MSNA 4DL3A 1ZETA 2WF7A 4ITKA 2INDC 3PZPA 4JWMA 3PV1A 3SDLC 7ICPA 9ICVA 4IS7A 4I2CA 1V9JA 4XZ4A 2AL3A 2QMTA 1ACCA 5KFJA 2KACA 4MFAA 3RZFA 4YR0A 4M6WA 2V4RA 2AHOB 2EQYA 3EYZA 1URJA 4GFJA 4ELTA 2CPRA 4XRHA 1NZPA 4O3MA 2G09A 1EF1A 1WGHA 4WJPA 4YN4A 1S3SG 5KFPA 1OEYA 4DDID 2R8JA 3SD7A 4M00A 3AULA 1K53A 3L5KA 3OJSA 4B9LA 1FIQA 2KMMA 1L7NA 1QOGA 4US9A 2A5UA 2I1KA 4LZDA 1D6EC 1AYFA 4RCOA 2AWTA 2BWFA 1C4PA 8ICFA 1Z19A 4DHZE 4UAUA 4I2AA 3QHTA 3NZSA 1F2RC 1J2MA 3Q3MC 3PPAA 1Z1VA 4XQ8A 3P2BA 4NWIA 5ALJA 4MJSB 4QZEA 3UXOA 4UAZA 1QF6A 3W1SC 5AZHA 2E8OA 3ZQ4A 4DSKA 4OJ5A 2BKEA 2AL6A 1WH3A 3W2DA 3WK9A 4L23A 2N9PC 2VRRB 2HOIA 4ED7A 3R3MA 3JPSA 5AICA 1JIHA 3ZXVA 1BPYA 1Z4NA 1Z00A 3HIZA 2LEKA 2FPKA 1ESFA 1HA5A 3H1UA 9ICCA 4F4YA 1L7OA 3A0HU 2UVRA 1L8LA 4I29A 2RP5A 2IBIB 5BMIA 1JWMD 2DQNB 5IP4D 1RYSA 5FP0A 5KFZA 3H7PB 1ET6A 1BPBA 3P63A 1ISNA 1KF6B 1WX8A 1EWYC 3OPXA 1D8BA 3M63B 3ZJTA 5GTHU 4IRDA 4HDOA 2WFAA 2OOBB 3RR8A 4W9IA 3QX7A 1KSPA 1NK8A 2M19A 3F2BA 2KC1A 4PGYA 5CHGA 3QIJA 2NRZA 1BPDA 3DHHC 2DKXA 3AE8B 2VZKB 2XEWA 3A9JB 4NQLB 3KUDB 2BCVA 4HPPA 4ZDVA 4DFJA 2BYEA 2ZXIA 1U45A 4OZCA 3DVNU 4UAVA 3RULA 2M9NA 2KFZA 4RZRA 2N4FA 1T4GA 4WQMA 2W3SA 9ICTA 1CRXA 1GPXA 1PQSA 2K0PA 1FEZA 4W9LA 1GAQB 4NLGA 2D5GA 2WYQA 5ALSA 7ICSA 3ZNHB 3ZRCA 1B43A 4C7YA 3F2CA 1ZQLA 2CS4A 3APFA 4ECXA 5KG3A 5AM3A 4UB3A 3PHXB 7ICOA 1HUZA 2G08A 2GBJA 1XO0A 3Q8LA 1C4CA 5AKEA 1E6EB 3IBEA 4O5CA 1YX5B 3IP4B 4UAYA 1HUOA 4KSLC 3RAXA 1PUZA 3AEDB 3BDPA 4RPZA 5ALNA 5KFVA 4I2EA 2MP2A 1ZD3A 4L2YA 2XO7A 2FMPA 1J7BA 3KWLA 3JPQA 2BCRA 2LMRA 2KWDA 3RBDA 1C9FA 3AM9A 1IXRA 1MA7A 4R8UB 3TAPA 1TJEA 3D2QA 4YTMB 2VJ4A 1N62A 3PZDA 5BYQA 1L5UA 3HM3A 2L76A 2BQUA 1ZD5A 2AQ4A 3PO5A 5TISU 2CU3A 4NL9C 3IN5A 9ICLA 1TZ1A 2INNE 1K8RB 1JRUA 2LXAA 2AH5A 3DBLB 5AK5A 2ZIVB 4XDDA 3RNFC 3WK8A 3RR7A 3LWLA 3AU2A 1TBEA 1NVID 4R3DA 3AE3B 5DPTA 1SGHA 1X2IA 2DZMA 4FBJB 5JHBA 2H88B 2XCPA 3OHBA 4DQSA 4CRXA 3SFDB 3CIRB 1WUDA 4MH0E 2GO7A 3KHRA 2BDUA 2JX5A 3Q8PB 1IPGA 2J42A 4B9VA 2WXNA 1AN8A 3TADA 1FNWA 4BBNF 3C29A 2G07A 2M4NA 2H3IA 1GUAB 1ZP0B 5DPWA 3L08A 2JZBB 1WZ3A 1J7CA 5CP2A 3MBYA 5KFTA 4ARCA 3TL5A 1HXYD 2GBRA 4UATA 2MX2A 4F5OA 2JWZA 5DG9A 4IW0A 2CU1A 3SU8X 1KEJA 1CQVA 4ZRPA 2MBEA 3ZDEA 4F8CB 1PDXA 1JI7A 2KSOB 2H3VA 2CN1A 3ZGZA 2WDRB 3DPDA 3VXWA 4ZYNA 2AJQA 1FMAD 4G50A 2P6UA 1VZ6A 1T7PA 4R64A 8ICKA 3HVZA 4GIVA 1OGWA 4NZLB 4DSEA 5T8IA 2N7DA 2K6QA 4AS1A 4QZCA 3UIPB 4M8NA 2QDFA 2WNMA 3R9KA 4GXKA 1PK1B 5TSSA 5J2AA 2BDPA 2UYZB 2XK5B 4EZKA 4QZHA 5HHIA 1Q8KA 1OTRB 4AP9A 3Q8QB 5FK9C 2LYBA 4WH4A 4ED1A 3W5VB 4KV2A 2C7MB 4EX6A 2VANA 2FDRA 3TEXA 1Y8RC 4KTQA 2WXOA 4P4MA 3LWMA 2KC2A 2BPCA 3RH6A 5G2NA 2NR2A 3R2IA 8ICGA 4YR3A 3LXFA 2CHZA 4KLTA 2F8LA 3C2MA 5J8YA 3I28A 2Y0SF 1QSSA 2GOLA 1N56A 1HEKA 2QB1A 3TARA 7ICGA 2BHNA 3CNHA 9ICUA 4B9UA 4JUZA 4JIOU 4PL1A 4KLIA 2XGPA 3DBHI 4RF0A 4M47A 1JRPA 3GU3A 4O3OA 5HFYA 5IIKA 3N4MB 2NTSA 2B3AA 2IOHA 1BNPA 4EZ6A 3DOWA 1VJ5A 3M62B 2NPTB 4W9JA 2KOBA 4MJSA 4P4PA 2HDEA 3GQCA 4S0RA 1KFTA 3KOOA 4RT2A 3B0AA 1ZQDA 1PFDA 4RQ7A 2EELA 5HMLA 1F52A 5CA7A 1XC9A 1WIAA 3QU5A 2KWCA 4IM0A 4TQ0A 2V4IB 2VZKD 4ICVA 1RQLA 2ZIWB 2F8KA 2XNAC 3IXSA 8ICXA 3NZ3A 1F77A 2MBQA 4EE2A 7ICVA 4CF4A 1QH9A 3PS6A 2WF6A 2B21A 1E8WA 3IFWB 1XT9B 3VH3B 3H7PA 4YMNA 2BWES 4YMOA 3NZUA 5KFIA 1ZE3D 3AU6A 2D6FC 2JZZA 3AEGB 4C56C 3ZNZB 4UQGA 3CSFA 1JROA 4AYBC 1C20A 2HBJA 4IWPA 4NAMA 2UVWA 2BKFA 4Y2RA 3F53A 3SAHA 2K9XA 2ZJDA 4WWNA 2V4LA 2R8KA 1KRPA 2PXIA 3KYCD 1K1SA 3RNAC 1Q3UA 5AUKA 1YZ7A 4DLGA 2LGYA 2AQ1B 2RPVA 2G5IB 1IM4A 1GC7A 4IQTA 3A9JA 2RHFA 2C2EA 8ICMA 1WSPA 2L32A 2EAOA 5C5JA 5DG7A 5CTRC 3ZNGC 2IJ0A 3WK7A 1PVQA 1QQRA 1UZXB 2MQJA 1ZQYA 4O3QA 4J9SA 3I63C 4GGQA 3BQTA 1UNSA 1OQRA 2KJ8A 3A9KB 2K4IA 1JWUD 1MSWD 3M6ZA 2ISOA 4B9SA 2MHJA 3PT2B 2HHXA 1X40A 1R4NB 2DZJA 5J2HA 2E1EA 2FBWB 5KAFU 3KWVA 4FE3A 4IUMB 1N61A 2EH9A 1CMXB 3ETLA 3ZTDA 1LQBA 3BVZA 3F2DA 1H4RA 3EA6A 4PK1A 1EU3A 2E3TA 4DQRA 3RB0A 4M0WB 4NAWB 4PZOA 3PW2A 3J9CA 2WB1C 5IO9A 1M94A 1TAQA 5KL8B 1Y56A 2ZJ8A 3AEBB 4OJPA 2LM4A 1VCBA 2RDGA 1PK3A 2W8LA 4RQ4A 2JWUA 5AM2A 1QTMA 3PHWB 2JYEA 3QEAZ 1ZQNA 4D2KA 4EUTA 5DLGA 3V6KA 2LUMA 2MBBB 2TSSA 5ALGA 1HZ5A 2X8XX 3KUZA 1X9SA 3I1YA 5TR5A 2W03A 2ZW1A 1UGMA 1SGGA 1K51A 2AGQA 1V97A 4O3RA 4HAIA 4W9KA 2HTME 3P4PB 1XLNA 4ANUA 1WJUA 4C8KA 3K1RB 1A76A 2LI6A 4URKA 1WXAA 3P42A 1V81A 2DWQA 2N9XA 3L13A 2RDJA 2ZUDA 2ONQA 1SE2A 1T3NA 5ALTA 5K4LA 3M6KA 2I1JA 2K4HA 1EU4A 1TS5A 4NLNA 1TS4A 4IL6U 2K8CB 2JZBA 2N9KA 1Q46A 5AI8A 2UU7A 1ZQVA 3QARA 5H2FU 2NBWB 2P35A 2KEYA 1FO4A 4I2GA 2LUEA 3DDCB 9ICBA 2NS5A 2Q5WD 4UB4A 2L00B 2ZIUA 3RNBC 2OWOA 4UBCA 3KH0A 4KKJA 2PFPA 3AN1A 1H38A 5ALRA 2HVHA 3LYYA 2J6TA 1EUVB 4CQNA 3ZDTA 4PZNA 4QZGA 2KN7A 3JPPA 3SZ2A 4IM2A 1UT5A 4Y2VA 3WKBA 4MSMB 2KP7A 3F5EA 4DLEA 1ZYQA 3UMGA 1WGGA 3GS2A 2KQ4X 1TAMA 2QC8A 3V7KA 3C28A 2GLEA 3C1ZA 3RJEA 1PK1A 4EBDA 2IO0B 3W1YA 2BKRB 2XK5A 2BGFA 1V5OA 2ZTEA 5D94A 3U7ZA 4DL6A 2QB0B 2K60A 3G6XA 3SAGA 5KT5A 4DFKA 2Q0ZX 2KFKB 3WANA 3ZTCA 1NK5A 4FBUA 4YG2A 2JH7A 4Y2XA 1COKA 3IG8A 3N7SC 3KD3A 3KKAC 4RQMA 1ZOYB 4J9OA 2V3NA 3HT3A 4G9BA 4KX5A 2W9NA 4CDGA 2C60A 5J2FA 4W9EA 4ACOA 4BGDA 4RM9A 3NUQA 1LO5D 2RSUA 2MUTB 5AKYA 1RPLA 4NJ8A 2LGDA 3BS5B 5J2GA 4DHJB 5ALWA 1NK0A 3TI0A 3WAMA 2FAZA 4HRSA 4K81A 4DOBA 1YN3A 1FXTB 3QNMA 1C79A 1K52A 2AEHA 4F50A 3EPIA 1P98A 4C8MA 5KTQA 2ASDA 2N9LA 1XLPA 3K9OB 2J7QB 1ED1A 2KO3A 2MJEA 1KLVA 2O2VA 1BVSA 5E6JA 2HHUA 3SD5A 5DDYA 1YOVB 7ICNA 2BB5A 2LVQA 2YEPF 2FPMA 3N20C 4UDUC 4BKSD 3RFZB 4IKGA 3EFUA 4BWMA 3ALRA 2CJOA 4ECZA 3SV3A 2E1FA 3CYMA 3I5JC 5ALIA 2ZIWA 2AQ2B 2YEPB 4BKGA 4UB1A 8ICCA 3GE8C 3ZLZA 3Q8EA 3QUQA 2B0CA 3PZ8A 1WWTA 1TKGA 3D2SA 3H4BA 4RH6A 5AUIA 4E71A 2IGHA 4LTUA 4G3IA 9ICPA 2N1RA 1R7SA 4NM2A 4KDLB 2Z0EB 1CEZA 2BYVE 1FPYA 4UARA 4KLQA 2A3VA 1F1HA 1SKSA 3AEVA 2K4PA 4KIKB 3QAQA 4ZRKA 5C3JB 1XU4A 2YMLA 5IKCM 2YQEA 5G5GA 2HVIA 4LDTB 4LNNA 2PE9A 1LVHA 2KZ3A 2DZKA 3NVYA 4P1CC 4WJOA 4HEA1 2HW3A 2QJLA 1F44A 5LXHA 1DGSA 3UQ2A 1T94A 2CHXA 2CKHB 4MFFA 1V2YA 4USAA 1X1MA 4QAYA 2D07B 2UVVA 2KIVA 4KN4A 2N9EB 4G11A 4TQ1A 3T3FA 2KMAA 5AIBA 2BPSA 1RZTA 2LGXA 2R61A 4PGXA 1P1AA 1ZKHA 1WJ6A 3JW0X 4W9CA 4XX5A 3ZXRA 2KJ6A 3LVWA 3A9KA 4MM3B 4A3PA 5ALHA 2QIEB 5IOIA 2SAKA 5KFHA 2DGZA 1SSNA 3AI5A 4MEMA 2V9WA 3I76A 2NMQA 5KFGA 3W9CB 1XWLA 1HTOA 3K1ZA 2ZUCA 3B0XA 4M0WA 3VTWA 5L95C 4NAWA 4P0QB 5D49A 1SV0C 3P4RB 5IN7A 3AEEB 2XCAA 2JY6A 3AE6B 2MRLA 3V6JA 5B66U 4AJWA 4LZGA 4OVVA 4ICAA 4J9RA 4GLXA 4MELA 5D4BA 2MA1A 4DFPA 2RDHA 5KG6A 4O3SA 1MI0A 5CX3A 5ALXA 1P7FA 3ZDAA 3IAM1 4XUSA 7ICHA 3ISCA 5EE9A 1WCLA 3Q8MA 4ELUA 4F4WA 3E2EA 3TFRA 1D5XC 5AM0A 4YWGG 2D2QA 4KN7A 1WM3A 2CRXA 3VUYA 4BAXA 4Q43A 5ALMA 3B1LX 5L1JA 4DL5A 2I2YA 1VZ7A 4CYEA 2WDVB 3AB5A 4FBTA 2ATLA 3WA0A 2KZRA 3QZ8A 4TMAB 1KKXA 1WY8A 4HKZE 3TQ1A 3QEBZ 1J19A 3Q8FA 4HK2A 2WXFA 3OJ3A 1T0QC 2KDMA 4RQ0A 4DL4A 2DAJA 2KNBA 1S10A 3H7SA 5KFQA 2WF9A 1N6ZA 2K8CA 4DQPA 2EMSA 3Q8SB 3TACB 5JUMA 3PX0A 4YXJA 2BBCA 2VH1A 3GP7A 2XN9C 1KBUA 1X66A 4MGKE 1MG8A 2N0SB 4ZRIA 1X9XA 2JXXA 3VQIA 2K89A 4J9NA 2IZVB 4KLJA 1NJYA 4TKNA 3IM1A 3KHGA 1RWSA 1ZUD2 3PZ7A 3MDCA 1KJTA 1ZDXA 4ANVA 5DB9A 2QARB 1UBQA 4QWDA 5EWGA 3Q8RB 1WR1A 4DK5A 4ED0A 3CSTA 4ANXA 4LLGM 2KTRA 4FXCA 2D3DA 1L7MA 1FRDA 2IGGA 4YXMA 4LJXA 4L1BA 1TKEA 3H0LB 3NS8A 4EZLA 5AKZA 2HCFA 2EANA 4BWJA 4DSJA 3PTFC 4K4IA 1WE7A 1ZQWA 2JZPA 4WQOB 1QQ5A 4P6VF 4MSQB 2DPJA 5C0YA 1EF5A 1RFKA 2KDBA 1U4BA 4TSSA 2DYOA 5DBAA 3KZIU 4ED6A 1YIWA 1S76D 2R2QA 1KDHA 1NK4A 2NTTA 2FCMA 5DG8A 4JMUA 4P4OA 1NK6A 1XD3B 1SXTA 4RPYA 3HKZC 2HSZA 4W9HA 3RF9A 2C9WB 1Z4OA 3NOBA 3VHTC 2G5HB 2YTUA 3D2NA 3GIMA 2HJ8A 3DWGC 3Q6BA 2V0GA 1E10A 3O0FA 1OW5A 1T3QA 3RFAA 3ML9A 1WCNA 2YX8A 1S97A 2MUTA 2BCQA 3U52E 2H3FA 4ELVA 4A6QA 3TJPA 4AP4C 4GXBA 4FA6A 5KT7A 5HG2A 2GWSA 5J2JA 1S0OA 3VTVA 1VRAB 2PKEA 4QWEA 3IRUA 4JV1A 5JXVA 4C80A 4ECQA 4DF8A 8ICRA 2EKIA 2L52A 8ICTA 1I4RA 3ZD8A 2E6XA 3H0MB 2F1IA 9ICSA 4GN1A 3HJEA 4CCHA 1T0SC 4F5RA 2C2DA 9ICOA 1YZ6A 2KFNA 8ICSA 4B6JA 1CUKA 1L0XB 2D3CA 1U49A 1N5XA 3BZKA 3IHPC 1ZD2P 8ICOA 4U6PA 1L3TA 4DQOC 4B9MA 3V3XA 1I4HA 4B95A 4I28A 4M01A 4K4GA 3AE7B 4AQ7A 1ET9A 3UQ0A 2BGWA 2ZNVC 2ZVOA 4LNFA 1VR9A 2GBMA 9ICWA 2H3QA 3EPGA 4KIKA 3N3KB 4IDIA 4RNMA 1XO1A 1NYQA 2Y5PA 3A4SC 3M8RA 5DB6A 2N7JA 2KLGA 3SHQA 2FE9A 4NM1A 2KOXA 2RMMA 2INCC 4O9MA 4GC6A 1LFDA 2KN4A 1DYQA 2H89B 4P0PB 1YX6B 5KL1B 2IO2B 3N32A 4BOSC 1K50A 4JWSC 1C3TA 1FM0D 2WF5A 4NQKE 4GC7A 4C00A 4RGOS 1IUEA 2ZXHA 4MM3A 1J0GA 1LXDA 1Z2MA 1TY0A 2JH1A 1HZ6A 1B1ZA 2KD0A 4KKIA 2JEIA 5CRXA 9ICHA 2JSVX 2C22A 3R7RA 5ALLA 2UVUA 1WX7A 4MHVA 1QCKA 2JEJA 3C21A 2FIFA 4A9AA 4P0QA 3N97B 2R2OA 2A4ZA 2LVOA 4ED8A 1XO3A 4CNQA 2PI4A 3RPFC 2A19A 5AHXA 3WKDA 4Z6CA 2C7HA 1T5XD 5KFAA 2FLPA 5HKHA 4KLHA 5HI1A 2WS3B 4NLZA 1DK3A 3ETRA 4RNOA 1CZPA 1PGXA 4I2HA 2NO5A 5J2EA 2RGFA 1V85A 4IWQA 3KTQA 8ICQA 3TUOA 4Y2QA 3C5FA 1AQ6A 2DLBA 3U2SC 3K9PB 9ICEA 4KMUA 2XY5A 5J0YA 1BUIC 1GO3F 4HDQA 4F2SA 4MGYE 2WLBA 3WU2U 1ZQPA 5KT6A 3DBLI 3VCBA 1Q10A 2DX5B 5GMVA 5G55A 3H0RB 1KLNA 3VUWA 1I7HA 4UW9A 1ZQBA 4MF8A 3LDZE 3A4RA 4MEYA 4M2YA 4CGZA 1D4BA 2ZTDA 5T14A 4Y2SA 1XQQA 1ZQOA 4W9FA 5F9LA 1S9FA 4IC9A 2J53A 5AK4A 3S2AA 4PGQA 5J0OA 1JUDA 1ZQJA 3IG3A 2FIDA 2OJRA 3VFKA 3C2LA 4O5EA 1TK5A 2JEGA 1AARA 4IWOA 5G5HA 5EWEA 2K5PA 3TIXA 9ICKA 1EO6A 1L0YB 2LFIA 5HNKA 3EUB2 5J18A 1BMLC 1EXNA 4RFBA 2QARA 2AGPA 4RGTA 1FCLA 4DXFA 2QCZA 2WGSA 3PGEA 3TADC 3IT4B 3LJ3A 2EAPA 4BJQA 4EYIB 3QYPA 4PYUA 3E56A 4QIWC 4ECTA 3Q3JA 3RYTA 5DLFA 3PW7A 4QJFB 3F5AA 4Q44A 2PEAA 3O65B 4NJ6A 2WP9B 2IA6A 3I57A 1KH0A 5ALUA 2JPHA 3ONNA 4DFDA 5L1KA 2GI9A 3OTQA 5KFBA 2C28A 1I4XA 2F1JA 4C4VB 2BF8B 4ZRQA 3NGDA 4I2BA 1TYGB 1FCCC 2JT4B 1FNVA 4WIPA 3VUXA 5KHQA 4OVZA 4DDGD 3T5JA 4ACFA 2K39A 4P1BC 3N1YC 3X0WA 3TEYA 3FILB 2KFJA 2KICA 1ZQIA 4E3CA 4M02A 3QWZB 4NXZA 2MEKA 2Y5CA 4AWJA 1P7EA 1KTQA 2BB6A 1Y88A 4ZOHC 1HE8A 3TMPB 2KD1A 2UWQA 3PVXA 3Q69A 4FZLA 2D3AA 2DENB 3H8JA 2KHWB 4LVSA 1MG4A 5H92C 1UGJA 2FUG1 3PRZA 2FPLA 2X38A 1IGCA 2AYOB 1LM8B 1F0ZA 4AOFA 2B6GA 1R4MB 1UHUA 1DGJA 1NDDA 2KK0A 4F92B 5IAAC 1T0RC 1UWMA 1CI4A 4UBBA 4I2JA 3FM9A 5J8YC 1QSLA 4WJ3B 9ICJA 1F9JA 2G1EA 3ORYA 3Q3OC 4NJCA 5DPSA 5KFLA 3RD2A 2W54A 4FZNA 4II3B 2MLBA 4II2B 3NRZA 1TIFA 4HLEA 2KMDA 5D46A 4DL7A 4PYZA 3PV8A 4S17A 4A20A 5DQHA 4GXJA 3T8MA 1WFYA 3CF6E 4FO6A 3PY8A 3H8MA 8ICPA 4FADA
chains in the Genus database with same CATH topology
2PMVA 3HVDA 4GDLB 4KKJA 1I4GA 1L6UA 3EGRA 3AN1A 1VJKA 3LB8C 3LYYA 1KLUD 1V1OA 4CQNA 3W1SA 4A8XC 1SJHD 1E0ZA 2WDQB 3GS2A 2KQ4X 4B0EA 3AMZA 1KLGD 1E7PB 1FXAA 1ROEA 4B0MA 2WXHA 3BIID 3U7ZA 3L4PA 3C8YA 3NUHB 2LHDA 1NI3A 4N58A 4O1NA 1JW9D 2WXIA 3FC4A 1GB1A 3B2GA 2QSDA 1ZOYB 1XLOA 2DBYA 2V3NA 4A55A 2OHFA 3HRDD 5BYRA 1C78A 3N9YC 1XCTL 2M56B 2PW9A 3NVZA 1TS3A 1LO5D 4ZYSA 1YN5A 3I9V1 4P16A 4KGSA 4YSXB 1OFFA 1ZXIA 1N60A 2W3RA 1KFYB 5FR3A 1A70A 3P4QB 1TZOA 2WXMA 2MJ3A 4HRSA 1YN3A 2MJDA 1FCLA 1C79A 1K52A 2ICIA 3MC0B 2PKOA 4WAFA 2N9LA 1ZPSA 1XLPA 2MJEA 1V8CA 5E6JA 1MHHE 1SF0A 1C4AA 4RGNA 2LHEA 2YEPF 4UDUC 2BB5A 3RFZB 4GDKB 5MPOA 1QOBA 1ZDVA 4IKGA 2CJOA 1L6VA 3Q8AA 2AQ2B 3BZDB 2YEPB 4HKQA 1VZ8A 2WXGA 1JWBD 3Q8EA 1GB4A 1C77A 3PZ8A 4OZBA 1WWTA 1TKGA 4RH6A 5AUIA 2L83A 1VLBA 2IGHA 4LTUA 1R7SA 2WU5B 4N59A 1JMLA 3MFGA 1IBXA 4HJGE 1JWAD 1JWSD 5C3JB 3AE2B 1EWCA 5G5GA 4ITKA 1PUTA 3NVYA 4JE3B 4HEA1 2QMTA 2QJLA 1ACCA 3ZYYX 1BXTA 1YJIA 2KACA 4RF1A 1DOYA 4USAA 3BVGA 4XWTA 3GB1A 3HUIA 1XF5L 2BTEA 4TQ1A 1YQ4B 1YJJA 2R61A 2L1AA 4YTPB 1JQ4A 4MM3B 2QIEB 5EE3A 1J7AA 1D5ZC 3AEAB 2SAKA 1SSNA 1K53A 2BS4B 4OW0A 3Q8BA 1FIQA 2KMMA 1QOGA 4US9A 2NMQA 1D6EC 3W9CB 1AYFA 4KX6B 3MP9A 4OHJA 4RCOA 1C4PA 3AE4B 2W55A 4M0WA 1SJED 1SEBD 1F2RC 3P4RB 3AEEB 3AE6B 2WU2B 5GXGB 2PVGC 1QOFA 2RDHA 5FKAC 1MI0A 1QF6A 3OWEB 3VRAB 1P7FA 3ZQ4A 2ZW0A 3IAM1 3FILA 5EE9A 3E9SA 3W2DA 4L23A 1YQ3B 1D5XC 4YWGG 2PIAA 4REZA 2LEKA 3CWIA 1ESFA 1HA5A 4PT5A 2I2YA 1VZ7A 1CK1A 2WDVB 3AB5A 4MH8A 1WRIA 2BS3B 3WCQA 4TMAB 5BMIA 1JWMD 4HKZE 1ENFA 3AEFB 4GLSC 3Q8FA 1QILA 1ET6A 2B76B 2WXFA 1C76A 3P63A 1KF6B 1EWYC 2KDMA 4YXDB 1NYRA 3ZJTA 2WQYB 5D7GA 4LK0M 1TKYA 1FXIA 2M19A 5D3IB 5BMGA 2BBCA 3GP7A 2BW2A 2XN9C 3VQIA 2N0SB 2BYTA 1JCKB 2JU6X 2VZKB 3AE8B 3TSSA 1SE4A 1RWSA 1ZUD2 3PZ7A 4OZCA 1HEZE 1ZDXA 4WQMA 4LLGM 4ZHPA 4FXCA 2W3SA 5EE0A 1FRDA 2IGGA 2J4XA 1GPXA 2K0PA 4L1BA 1TKEA 3KQ4A 3B9JA 1GAQB 3H8HA 1I4QA 4HROA 2D5GA 4RNAA 3VR9B 1PGAA 2K3UA 2JZPA 4P6VF 4C7YA 1UWXA 1JALA 1RFKA 1C4CA 1E6EB 1V1PB 1L4ZB 2DYOA 4Q2JA 4TSSA 1STEA 2ACZB 1L5PA 2NTTA 1E9MA 4US8A 1UUPA 3AEDB 4ZHOA 1SXTA 4L2YA 1J7BA 1RYJA 4WWMA 3DWGC 3KWLA 1FRRA 1E10A 2V0GA 2KWDA 2G9HD 1C9FA 4YSYB 4XDCA 3AM9A 1T3QA 1TJEA 2LMCA 3U52E 4YTMB 5BYQA 1N62A 4A6QA 2CU3A 2INNE 1FFVA 2PLPA 5HG2A 3T3NA 1VRAB 4XDDA 2V3PA 2Y3AA 1NVID 3P4SB 4R3DA 3AE3B 3U4EG 4C80A 2L52A 5JXVA 2EKIA 2K22A 1I4RA 2E6XA 2H88B 3SFDB 2JQRB 3FAHA 3CIRB 4DXGA 1WXQA 2JX5A 4IOIE 4MACA 2J42A 2GB1A 2WXNA 1AN8A 1SIJA 1FNWA 2SEBD 2WXKA 3AE9B 3O13A 4WURA 3TEWA 1ZP0B 1L0XB 3ZJVA 1J7CA 4ARCA 1N5XA 1HXYD 3VRBB 1XXGA 1AW7A 4J3OD 1CQVA 4JX1C 4YT0B 3V3XA 4ZRPA 1I4HA 4DQOC 3AE7B 3MHZA 1FFUA 3KLSX 1PDXA 1ET9A 4AQ7A 1WGKA 1VR9A 2PVOD 4ARIA 1MVKA 2WDRB 3ZGZA 4H2AA 2GRIA 1FMAD 4IDIA 2Y5PA 1NYQA 4JWUC 4KGTA 1B9RA 1VZ6A 3BVMA 1DOXA 3B2FA 2N7JA 3HVZA 4NZLB 4YTNB 3Q8CA 5T8IA 2RMMA 3P1MA 4AS1A 3R2TA 2WXRA 2WNMA 5C2TB 2KN4A 5TSSA 2J52A 3AECB 3SEBA 1DYQA 2H89B 2QEJC 1K50A 4OZAA 5FK9C 4WH4A 1I4PA 3DWMA 4JWSC 2DYMA 3W5VB 1FM0D 3TEXA 5BMHA 2WXOA 4RGOS 3R2IA 1IUEA 2IDYA 3ZJUA 3LXFA 1TY0A 1HZ6A 1B1ZA 4KKIA 3SFEB 4XWWA 2JSVX 1XLQA 4RF0A 3BK1A 2CJNA 1JRPA 3W5UB 5HFYA 4A9AA 2OEDA 2NTSA 4JPSA 5D3DA 3NVVA 1XO3A 3RPFC 1T5XD 2LJIA 3IT6B 2HDEA 2WS3B 5HI1A 3ETRA 1CZPA 1PGXA 3URYA 3V05A 1PFDA 2EELA 3TUOA 3U2SC 2DLBA 2V4IB 4TQ0A 2VZKD 2XNAC 1CJEA 3IXSA 3PO0A 3NZ3A 1F77A 4EE2A 2W82A 1BUIC 1QLBB 4XE0A 4MT5A 2WXJA 2WLBA 1M4VA 1OQQA 5H8YE 2JYTA 1YMHE 3NVWA 1IBXB 1Q10A 1ZE3D 2M0AA 3AEGB 1SB3C 1I7HA 4C56C 2KAJA 1JROA 2WXLA 2LGIA 4NAMA 1D4BA 1L0VB 5LNK1 2K9XA 3VR8B 3AE5B 1SE3A 2J53A 5AUKA 2IGDA 1AWDA 2RPVA 2AQ1B 2BT6A 1PGBA 3AH7A 1RM6C 4RGMA 1WSPA 5G5HA 2L32A 2K5PA 1L0YB 2INPE 3MJ5A 1GOZA 2LFIA 2IJ0A 3EUB2 1QQRA 2WXPA 1BMLC 1TS2A 4KGRA 4RFBA 4C7ZA 1UNSA 2QILA 2I38A 1OQRA 1F2RI 4RGTA 5BYSA 4DXFA 1N5WA 3IT4B 1JWUD 1XCQL 3BK2A 1QOAA 1YN4A 3E56A 1QKZA 2FBWB 3KWVA 1PYWD 1N61A 2IPKD 1IGDA 2WP9B 1KTKA 1XEEA 3BVZA 1YNTE 3BYTB 3EA6A 3I57A 1EU3A 1KH0A 2E3TA 1V1PA 4NAWB 2GI9A 1FD6A 1KRHA 3J9CA 1Y56A 1EM7A 1I4XA 2PTLA 4ZRQA 3AEBB 4WIPA 1TYGB 1FCCC 3IAS1 1FNVA 1TY2A 2RDGA 4OVZA 2JWUA 3TEYA 3R8BA 1SBBB 2JYEA 1MPEA 4D2KA 3FILB 2LUMA 2TSSA 1HZ5A 3NS1A 1NENB 2MEKA 3ABVB 2Y5CA 1P7EA 3BYYB 2BB6A 2ZW1A 4ZOHC 1K51A 2WXQA 3SR6A 3Q69A 1V97A 1VDVA 3TEZA 1DOIA 5H92C 2HTME 1HQRD 1UGJA 2BS2B 1XLNA 2FE8A 2FUG1 2MH7A 2X38A 3P4PB 1IGCA 3UI3A 1QT9A 3P42A 1F0ZA 2DWQA 1L4DB 1FEHA 1DGJA 3AV8A 1WYGA 1UWMA 2ONQA 1SE2A 4NJCA 2G1EA 1ZXHA 2AX5A 1EU4A 1TS5A 2AQ3B 1TS4A 1N63A 2W54A 3T3OA 4N6EB 4A90A 2N9KA 3NRZA 4YSZB 3AE1B 5EE1A 5I4DA 1NEKB 1MHXA 1FO4A 2Z8LA 2Q5WD 1T6BX 2JXTA 2ON8A 1D5MC 1FNUA 5HHDG 3BWUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTM B;  1N62 A;  2QIE B;  1J7A A;  1L6U A;  5EE3 A;  3AN1 A;  1VJK A;  3LB8 C;  2CU3 A;  2WLB A;  1OQQ A;  3AEA B;  5H8Y E;  2BS4 B;  3NVW A;  1FFV A;  1FIQ A;  2KMM A;  1E0Z A;  1QOG A;  3AEG B;  4US9 A;  1SB3 C;  1I7H A;  3W9C B;  1AYF A;  4KX6 B;  2KAJ A;  1JRO A;  2WDQ B;  1NVI D;  2W55 A;  3AE4 B;  3AMZ A;  3AE3 B;  4C80 A;  2L52 A;  3P4S B;  1L0V B;  2EKI A;  2K22 A;  1E7P B;  1FXA A;  2H88 B;  2K9X A;  3AE6 B;  1ROE A;  2JQR B;  2WU2 B;  3AE5 B;  3FAH A;  3AEE B;  3BII D;  3CIR B;  3P4R B;  5GXG B;  3VR8 B;  1WXQ A;  3L4P A;  2JX5 A;  2PVG C;  1QOF A;  1NI3 A;  5AUK A;  1SIJ A;  4N58 A;  1AWD A;  1JW9 D;  3AE9 B;  2BT6 A;  1QF6 A;  1ZP0 B;  3AH7 A;  3FC4 A;  3VRA B;  1RM6 C;  1J7C A;  5G5H A;  3B2G A;  2K5P A;  5EE9 A;  1N5X A;  1ZOY B;  1XLO A;  2DBY A;  3VRB B;  1YQ3 B;  3EUB 2;  2OHF A;  3HRD D;  2PIA A;  4JX1 C;  4YT0 B;  4C7Z A;  2LEK A;  2M56 B;  3AE7 B;  3NVZ A;  1FFU A;  1OQR A;  3CWI A;  1PDX A;  1WGK A;  2WDV B;  3AB5 A;  1N5W A;  1WRI A;  2BS3 B;  2PVO D;  3WCQ A;  2WDR B;  1OFF A;  1ZXI A;  4YSX B;  1QOA A;  1N60 A;  1FMA D;  2W3R A;  1KFY B;  4IDI A;  1NYQ A;  4JWU C;  1A70 A;  3P4Q B;  4HRS A;  3AEF B;  2FBW B;  2MJ3 A;  1B9R A;  1DOX A;  1N61 A;  2B76 B;  2MJD A;  3B2F A;  3HVZ A;  3P63 A;  1KF6 B;  4YTN B;  1EWY C;  2WP9 B;  2PKO A;  4YXD B;  1NYR A;  3P1M A;  1XLP A;  2WQY B;  2E3T A;  2MJE A;  1V8C A;  5C2T B;  1GPX A;  1KRH A;  1SF0 A;  1TKY A;  3AEC B;  1FXI A;  2H89 B;  5MPO A;  1QOB A;  2M19 A;  3AEB B;  1TYG B;  3DWM A;  2CJO A;  4JWS C;  3W5V B;  1FM0 D;  1L6V A;  2N0S B;  3AE8 B;  3SFD B;  1JWB D;  1IUE A;  3NS1 A;  1RWS A;  1ZUD 2;  1WWT A;  1TKG A;  3LXF A;  5AUI A;  2L83 A;  1VLB A;  1NEN B;  3ABV B;  2Y5C A;  1R7S A;  4LTU A;  3SFE B;  2WU5 B;  4N59 A;  4ZOH C;  3SR6 A;  1V97 A;  1VDV A;  4WQM A;  4ZHP A;  4FXC A;  1XLQ A;  1DOI A;  5H92 C;  2W3S A;  2HTM E;  1FRD A;  2BS2 B;  2MH7 A;  1XLN A;  2CJN A;  3P4P B;  1JRP A;  5EE0 A;  1TKE A;  3W5U B;  3B9J A;  1GAQ B;  1JWA D;  1QT9 A;  4HRO A;  3VR9 B;  4A9A A;  1F0Z A;  2DWQ A;  5C3J B;  1DGJ A;  3AE2 B;  1WYG A;  1UWM A;  3AV8 A;  4C7Y A;  5G5G A;  4ITK A;  4P6V F;  3NVV A;  1PUT A;  1XO3 A;  2G1E A;  2AX5 A;  1JAL A;  1RFK A;  3RPF C;  3NVY A;  1E6E B;  1N63 A;  2W54 A;  2ACZ B;  2QJL A;  4N6E B;  2WS3 B;  1L5P A;  1YJI A;  3ETR A;  1CZP A;  1E9M A;  3ZYY X;  4US8 A;  3AED B;  4ZHO A;  1DOY A;  3NRZ A;  4USA A;  1PFD A;  4YSZ B;  3AE1 B;  5EE1 A;  3HUI A;  1NEK B;  1J7B A;  1RYJ A;  4WWM A;  1YQ4 B;  3DWG C;  1FO4 A;  1YJJ A;  1FRR A;  3KWL A;  1E10 A;  4YSY B;  2Q5W D;  3AM9 A;  1CJE A;  3PO0 A;  1T3Q A;  1TJE A;  4YTP B;  1JQ4 A;  1QLB B; 
#chains in the Genus database with same CATH topology
 2PMV A;  3RJI A;  2GLS A;  4DF4 A;  1I4G A;  4UAW A;  3LB8 C;  2PFO A;  1RFA A;  4KLU A;  4KVG B;  1E8Y A;  3SMV A;  4R65 A;  2J0M A;  4A8X C;  2PJH A;  4F1S A;  4EBC A;  3PR5 B;  2C7N B;  4PPX A;  2PFN A;  3R66 C;  3PNC A;  1A6S A;  2MU2 A;  5BOL A;  1E7P B;  2RD0 A;  3MC1 A;  4B0M A;  4P0P A;  3RB3 A;  2DAF A;  2A1J B;  2WXH A;  3MGI A;  3BII D;  3C8Y A;  2LHD A;  1NI3 A;  5AM1 A;  3RJF A;  4O1N A;  4Y2T A;  1JW9 D;  3NAS A;  2R8H A;  4MGI E;  4Y2Y A;  1GB1 A;  4YMM A;  3EFC A;  1MJD A;  3GZF A;  5KG5 A;  3UIN B;  3KZX A;  5J2C A;  2XGQ A;  2DBY A;  5KT2 A;  2VA2 A;  1XLO A;  2QSD A;  4A55 A;  1SWW A;  4OJ6 A;  3HRD D;  1GNU A;  2NV3 A;  5BYR A;  3LDA A;  3QE9 Y;  3N9Y C;  1RXV A;  1XCT L;  8ICE A;  2M56 B;  3RB6 A;  4F7Z A;  3NVZ A;  1S1Q B;  4ZYS A;  3I9V 1;  4QZD A;  2WTF A;  4GMV A;  2W7O A;  4KGS A;  1SL1 A;  1R4N I;  2K8B B;  3R7Q A;  1A70 A;  1TZO A;  2MRP A;  2WF8 A;  3HIL A;  1UBI A;  1ZPS A;  2LBO A;  1QZE A;  4XYC A;  5AK6 A;  1E5W A;  1C4A A;  5KFR A;  1D8L A;  4GDK B;  5MPO A;  1QOB A;  2KJR A;  4RQ6 A;  2KKV A;  2NYV A;  4BOZ B;  2YMQ A;  3BS7 A;  4HKQ A;  2PPH A;  2R18 A;  3HPO A;  3OHA A;  1VZ8 A;  2Y1J A;  1GB4 A;  2OYY A;  5AKH A;  4OZB A;  3U7D A;  2D3G A;  9ICQ A;  5AZF A;  4PHE A;  1B4F A;  3GIL A;  1JML A;  3LK9 A;  3DHG C;  1PZN A;  1TTN A;  3QC8 B;  3AQF A;  3B08 A;  1WMH B;  3SV4 A;  5KFW A;  1T8E A;  4DWF A;  3AE2 B;  1I42 A;  1EWC A;  3PO4 A;  2HTH A;  4XGA B;  1QQ6 A;  4QZA A;  3DVN V;  4I6L B;  2Z59 B;  3H7I A;  4GIB A;  2DZI A;  7ICJ A;  3HWT A;  2VKQ A;  1HTQ A;  2K8H A;  5KG1 A;  4R8U A;  4TUS A;  1BXT A;  1YJI A;  2KAN A;  3ZYY X;  1DOY A;  3N1X C;  2IOF K;  4XWT A;  3C23 A;  3HUI A;  4BZA A;  3SEN A;  3MGH A;  1YQ4 B;  3AU4 A;  2L0F A;  1RRB A;  5DDM A;  1J97 A;  5IIM A;  2FI1 A;  1TVA A;  4M8M A;  1JQ4 A;  2ZIV A;  1JX4 A;  2GOW A;  3TBL D;  5EE3 A;  1D9D A;  2KVS A;  1D5Z C;  3AEA B;  4K4H A;  3IV6 A;  4C8L A;  4M9N A;  5AKL A;  2BS4 B;  3RNC C;  7ICE A;  1UH6 A;  4FFD A;  3L16 A;  5III A;  4BBN C;  2FCQ A;  4KX6 B;  4OHJ A;  2PMZ F;  2OJW A;  3NTU A;  2QKQ A;  2MWS B;  1NKC A;  1E8Z A;  4NPN A;  4XA5 A;  3RUI B;  1ZQR A;  4Q8F A;  3ISB A;  2WU2 B;  4JQW C;  2K25 A;  5GXG B;  4C4V A;  4C4R A;  3GV8 B;  2PVG C;  1QOF A;  3ICX A;  4JV2 A;  3AUO A;  5FKA C;  4F8R A;  3OWE B;  3DBS A;  3JPO A;  4F5Q A;  3FIL A;  2KSO A;  3PW0 A;  4AUQ C;  2I6X A;  1U48 A;  2WAQ F;  4QW8 A;  1YQ3 B;  3EZ5 A;  1SKW A;  3HHM A;  1WG8 A;  1SL2 A;  4BFR A;  2G3Q B;  3SYZ A;  2NRT A;  3CWI A;  3QK0 A;  1CK1 A;  3N7P D;  1VD2 A;  3V6H A;  4MH8 A;  3GE3 C;  3BQ0 A;  1ENF A;  2RDB C;  3AEF B;  3U8Z A;  5KFE A;  4GLS C;  5KFY A;  1C76 A;  2V1Y A;  3KW5 B;  4YXD B;  4E74 A;  4HCP B;  1NYR A;  4PHP A;  4DSF A;  1DK2 A;  3RMK C;  5JTI A;  4RQ1 A;  3MGV A;  9ICM A;  3DEE A;  2W9C B;  4QWC A;  1TKY A;  3BY4 B;  4EOY A;  2JRZ A;  1B0X A;  3S6J A;  2ZCC A;  5D3I B;  2WWZ A;  2Y0S C;  1V5T A;  1D3Z A;  4ED2 A;  2FLL A;  3CMM B;  4A3O A;  4WWP A;  2KLC A;  1IP9 A;  2JU6 X;  1P0R A;  2KDI A;  3GV7 B;  2KJH B;  2I9G A;  3UQB A;  1DRG A;  1SE4 A;  2EZY A;  5ALF A;  3J81 j;  2O6V B;  2H3Z A;  1ZQS A;  1D9F A;  7ICF A;  3EC8 A;  3V72 A;  3QX1 A;  1NJZ A;  2CXY A;  3BJY A;  2NPT A;  2J4X A;  3MDA A;  3H8H A;  3VR9 B;  2JMG A;  3L54 A;  2HE7 A;  5KAI U;  4DCC A;  3TAQ A;  1PGA A;  2K3U A;  4K1R B;  3RN9 C;  1UWX A;  2A1J A;  1BPZ A;  3PRM B;  3HX0 A;  2AGO A;  1ZD4 A;  1V1P B;  4DQQ A;  2HMX A;  1STE A;  2YLM A;  1E7V A;  4X5V A;  1L5P A;  1KN5 A;  4ED3 A;  4QW9 A;  3C5G A;  1UUP A;  2LHT A;  3M8S A;  4P2H A;  1C7Y A;  4GOC A;  1RYJ A;  3HW8 A;  2G9H D;  1E7U A;  4YSY B;  4XDC A;  4E0D A;  1ZQZ A;  2ZG6 A;  4TQS A;  5CB1 A;  1WGD A;  2IHN A;  4QNL A;  5J17 A;  2E8M A;  2XY7 A;  2O6K A;  3PR4 A;  1V49 A;  4I2D A;  2K8B A;  2KDE B;  5AI4 A;  5C1Z A;  2W8K A;  3GZN B;  2JXJ A;  3TKA A;  3ML8 A;  1NKB A;  4IQV A;  3RH5 A;  4BVU C;  5J2K A;  4RQ8 A;  2Y3A A;  3P4S B;  3HP6 A;  5BPC A;  3QU2 A;  3T9L A;  3U4E G;  1KQQ A;  2K22 A;  4CF5 A;  5L83 A;  1L2N A;  4UAS A;  2JQR B;  2RPQ A;  4GDK A;  4DXG A;  2IY0 B;  3EW9 A;  4MAC A;  4IOI E;  1ZQH A;  5DB8 A;  2GB1 A;  1SIJ A;  2WXK A;  3O13 A;  4WUR A;  2CHW A;  3ZJV A;  4DHZ B;  5DBC A;  4DXA B;  3RI7 C;  3ZDM C;  1ZOL A;  3VRB B;  5L1L A;  4UB2 A;  5CWR A;  3M9N B;  1XXG A;  1AW7 A;  4JLC A;  4TUR A;  4J3O D;  4YT0 B;  3UF8 A;  2RLT A;  3MHZ A;  3KLS X;  4UB6 U;  4GU2 A;  4Y2U A;  1I35 A;  5HP4 A;  3N28 A;  3V7J A;  3C19 A;  2LRU A;  7ICL A;  2PVO D;  3ZIM A;  1WMH A;  4KLF A;  2GRI A;  4JL9 A;  1P9D U;  4KGT A;  5KFO A;  4F2R A;  3QZ7 A;  3BVM A;  1J8C A;  8ICW A;  3PW5 A;  3B2F A;  1TE2 A;  2IO3 B;  1L7P A;  2F3N A;  4YTN B;  3Q8C A;  2KX3 A;  4QZ8 A;  3P1M A;  3R2T A;  1SXD A;  5C2T B;  3AEC B;  3RJH A;  3SEB A;  4DS5 A;  3U30 A;  2JRI B;  4HVB A;  1V86 A;  1O03 A;  1ZQU A;  3HM6 X;  4PL2 A;  3DWM A;  2DYM A;  7ICR A;  2I5H A;  1RLF A;  2N1W A;  4TV3 A;  5JHA A;  4W9G A;  3NY5 A;  4C4S A;  4IC7 B;  4QZ9 A;  5J2R A;  2AXT U;  3UM9 A;  5J0W A;  3SFE B;  2LJ5 A;  4DOA A;  4M9L A;  4XWW A;  1SV4 A;  2Y5B B;  2KNJ A;  2W9B B;  3M9M B;  3GFK B;  2RR9 A;  4HJK A;  1XLQ A;  3Q14 C;  2W9M A;  5KNI A;  1GG3 A;  3MAB A;  2CJN A;  5KT3 A;  4K3C A;  3W5U B;  1TFR A;  4RPX A;  3T5K A;  2OED A;  4PJ0 U;  7ICK A;  3QA8 A;  2PFQ A;  2WHI A;  1ZRM A;  2GH1 A;  4DS4 A;  4R63 A;  4PS7 A;  3RB4 A;  4JPS A;  1X6I A;  3QUB A;  5D3D A;  2HI0 A;  3NVV A;  4QWB A;  2BQQ A;  5E6P A;  2LI5 A;  2KDF B;  3IVF A;  3H9D A;  1WXS A;  4F71 A;  2GMI C;  2ESE A;  2JHD A;  3Q3F A;  3V05 A;  3TFS A;  4FJZ A;  4JB3 A;  2IO1 B;  3KFU F;  2LZ6 A;  2W11 A;  2KVR A;  3GII A;  4NNJ B;  3V61 A;  3T79 A;  2DYB A;  1JXL A;  4MFC A;  1S8O A;  2J0J A;  1YT3 A;  3K75 D;  3GOE A;  2W82 A;  4DHJ D;  4XE0 A;  2C5L C;  2MP2 B;  3G6Y A;  9ICF A;  1S5L U;  4MT5 A;  3G6V A;  5H8Y E;  1M4V A;  5BO4 B;  1KOT A;  1YMH E;  3QU4 A;  2HOF A;  1OEY J;  3H8S A;  2OEH A;  1SB3 C;  3NRW A;  3ZDC A;  2QB0 A;  5L1M A;  2KAJ A;  3PSP A;  4KLO A;  2MAX A;  2KFK A;  2ODG A;  2LGI A;  5E6O A;  5LNK 1;  5DPR A;  3RNE C;  2IBK A;  3PX6 A;  1SE3 A;  3JPN A;  4EFO A;  2OH2 A;  3QU9 A;  4M0A A;  5KG2 A;  2IGD A;  2BT6 A;  4OCZ A;  1Z1B A;  1PGB A;  5J0U A;  1ZQX A;  3LYS A;  4RGM A;  2DUY A;  2W7P A;  2ASJ A;  3DV9 A;  1GC6 A;  2INP E;  1K1Q A;  1NNL A;  3BS5 A;  3MJ5 A;  2O6V A;  1LKY B;  2WXP A;  4BDP A;  1TS2 A;  3ZRF A;  1OQY A;  4BUG A;  2BZF A;  4RNN A;  2E8N A;  5KFK A;  4TUU A;  4PH5 A;  4C8N A;  4J9L A;  2MCN B;  1N5W A;  4RQ5 A;  4F3O A;  1WF9 A;  3MFI A;  3BQ1 A;  1TK8 A;  1K5O A;  4O5K A;  1YN4 A;  3WKC A;  4Q8E A;  1QKZ A;  5TZV A;  1PYW D;  3M95 A;  4LDT D;  3UPQ A;  5IIN A;  1PVP A;  3BZC A;  4O0I A;  8ICZ A;  1IGD A;  1KTK A;  1XEE A;  3RJK A;  3OAW A;  4YP3 A;  3MR3 A;  3N30 A;  1V1P A;  2M8S A;  2F77 X;  3UMB A;  3V7L A;  2G45 B;  2ZEQ A;  4CHK A;  1JXE A;  5AI0 A;  9ICG A;  3ZW3 A;  1TY2 A;  3I3T B;  2VJ5 A;  3RNG C;  3WAP A;  1SBB B;  3QUT A;  1MPE A;  2FCN A;  4IM3 A;  2KV2 A;  1G6J A;  5B5E U;  1WXV A;  1LV5 A;  5DQI A;  2E8P A;  3WKE A;  3PVL A;  5J0X A;  5HR7 A;  2F2A B;  3UXN A;  2BQR A;  4ICU A;  2XY6 A;  3H40 A;  4MGZ E;  1QLN A;  3SR6 A;  4ECR A;  4FUL A;  4BXO B;  3TEZ A;  3NHE B;  4RQ3 A;  2FE8 A;  2ZCB A;  5J0Q A;  2ALZ A;  2LVP A;  3KVF B;  4O3P A;  9ICR A;  1FEH A;  2Y9U A;  2F76 X;  4KLE A;  4GSW A;  1WYG A;  4J9K A;  2Y1I A;  4LJO B;  3UGB B;  2AQ3 B;  8ICI A;  1IYF A;  4YD2 A;  4RT3 A;  1C1Y B;  4N6E B;  4A90 A;  2Z7J A;  3T5L A;  1WM2 A;  2LKY A;  1XSP A;  5EE1 A;  3WAO A;  8ICN A;  2KVZ A;  2N1V A;  1NEK B;  2HHT A;  2XVT A;  5I4D A;  1MHX A;  2K6D B;  1M6Y A;  1TKD A;  4LNI A;  4DSI A;  2DNF A;  2Z8L A;  1T6B X;  4NY8 A;  1RYU A;  1D5M C;  1FNU A;  9ICN A;  2LPE A;  1XSL A;  3D32 A;  2JR5 A;  2ZUB A;  5HHD G;  3JPT A;  4GDL B;  2DKZ A;  4NLB A;  1L6U A;  3C2K A;  3EGR A;  5LLI A;  1VJK A;  1Q0W B;  2W9A A;  5KFU A;  3NG0 A;  1GJZ A;  1NBF C;  1KLU D;  4X57 B;  1ARO P;  3IDW A;  5J0P A;  2G0A A;  3W1S A;  4FJY A;  4HPL B;  1S0V A;  1SJH D;  1E0Z A;  4F5N A;  4YL8 A;  2Y9T A;  1XSN A;  3OG5 A;  3H8W A;  2HOQ A;  2DFL A;  3PW4 A;  3ALB A;  5IIJ A;  4DO9 A;  4RUA A;  2M0N A;  2HHQ A;  1KLG D;  2M17 A;  3ZKJ C;  3MR6 A;  2AU0 A;  1UA0 A;  1FXA A;  4G0N B;  1ZQF A;  4KLL A;  5KG4 A;  5KFF A;  3L4P A;  3NUH B;  2QHO A;  2G06 A;  4J9Q A;  2LWP A;  2OCE A;  2ZVN A;  4N58 A;  4MEX A;  2A1A A;  3ZDD A;  3FC4 A;  4AYB F;  3A1Q B;  3MC9 A;  3PRP B;  3PMN A;  4RM8 A;  4Z6E A;  5EWF A;  2OHF A;  1E90 A;  2YMP A;  1BNO A;  3OJ4 B;  4WJQ A;  2P66 A;  8ICJ A;  1XS9 D;  3AU5 A;  3EHV A;  2PW9 A;  2W9B A;  4RMA A;  4P16 A;  5DKW A;  3ZDB A;  1L3U A;  4YSX B;  3UXP A;  1OFF A;  1ZXI A;  4W9D A;  2W04 A;  3P4Q B;  4MF2 A;  3M1Y A;  3RJG A;  4QZB A;  1V38 A;  4OD0 A;  1WGR A;  2ICI A;  4PS3 A;  2KHV A;  4DFM A;  2KX0 A;  4WAF A;  3DCG A;  8ICY A;  3JSV B;  1V8C A;  5AKJ A;  1ZQK A;  5E6N A;  3JPR A;  8ICH A;  1MHH E;  1SF0 A;  1LB2 B;  1S0N A;  4RGN A;  3ZO5 B;  2D10 A;  2HBL A;  2WHE A;  5HMM A;  5C23 A;  4F4X A;  5HHH A;  1UD7 A;  4ZH4 A;  4TQR A;  2JGA A;  7ICT A;  3TAN A;  3Q8A A;  3BZD B;  4K7U A;  3CP8 A;  4FS2 A;  1O08 A;  2FUH B;  2WXG A;  2WB1 F;  1JWB D;  1L3V A;  4HXD A;  1YD8 U;  5CHF A;  1LGR A;  5DB7 A;  3GIK A;  5AKI A;  2L83 A;  1TV9 A;  3FKY A;  3OLM D;  1VLB A;  3QCA A;  2P6R A;  1ZQT A;  4EZ9 A;  4XC2 A;  2WU5 B;  4N59 A;  5CHV C;  4QWA A;  1SKR A;  2EMT A;  3KBB A;  2D8C A;  2ZJ5 A;  3U26 A;  1YQB A;  2CR5 A;  1JWA D;  5E79 U;  3KHH A;  1JWS D;  1R4M I;  4CO7 A;  1TGZ B;  2LAS A;  5ALE A;  4LCD E;  3MR5 A;  2HDO A;  3Q2A C;  4DWI A;  1U4A A;  1PUT A;  5AKK A;  4WWO A;  4JE3 B;  1RG6 A;  3X23 A;  2BPF A;  2KKC A;  3E0F A;  4RF1 A;  4NL9 A;  4ECU A;  3BVG A;  1Z5S B;  3GB1 A;  1XF5 L;  2F1H A;  4Y2P A;  2BTE A;  1LKY A;  1ZRN A;  3EEC A;  2E5S A;  1YJJ A;  4C0Z A;  3A33 B;  1WWV A;  2MA9 B;  3OSN A;  4DQI A;  2L1A A;  4YTP B;  1S0M A;  1SE9 A;  1J7A A;  4TUQ A;  1H8C A;  4OW0 A;  5IIO A;  3RZW C;  4DL2 A;  3Q8B A;  4KLG A;  3V6C B;  2DHZ A;  2ZIU B;  1OXJ A;  4DOC A;  4DEZ A;  2IMW P;  3MP9 A;  3AXC A;  1KM7 A;  2W55 A;  1UA1 A;  3AE4 B;  4K7S A;  2L7R A;  3M7D A;  4ECV A;  1SJE D;  4OJL A;  4YFK A;  3ISD A;  2IHM A;  2KIW A;  1SEB D;  4YVZ A;  2L0T A;  2H5X A;  3OGU A;  2K1F A;  2YMM A;  3SEI A;  3VRA B;  3LVV A;  2ZW0 A;  2KTF A;  3QJZ A;  2KKP A;  1ECW A;  5HR6 A;  3E9S A;  3N7R C;  2LYH A;  3DDH A;  5JRT A;  4YR2 A;  4M04 A;  3IHQ B;  5JU5 A;  4DSL A;  3JYU A;  2PIA A;  3PSF A;  4PHA A;  4REZ A;  4FN2 A;  2YVC A;  2AQ0 A;  4PT5 A;  2KK8 A;  1ZQC A;  5J2I A;  4BXO A;  4OJO A;  4LNO A;  1WRI A;  2BS3 B;  5KFM A;  3WCQ A;  4EEY A;  1ZJN A;  2BQ3 A;  5J0R A;  1PVR A;  3DHI C;  5FR6 A;  4EKU A;  2HHV A;  2YY6 A;  1QIL A;  2B76 B;  4AJY B;  4KLM A;  2KWV B;  5LXI B;  2WQY B;  3DBR I;  4FS1 A;  1KW4 A;  5AIA A;  5J2B A;  2GBK A;  5D7G A;  4LK0 M;  5DGB A;  3IG5 A;  2KE7 A;  1FXI A;  1Q3V A;  5BMG A;  2PE6 B;  4KMO B;  2BCS A;  3GIJ A;  2BW2 A;  2WX0 A;  2ZZP B;  2O2V B;  2BYT A;  1JCK B;  3N1Z C;  2IYD B;  4FHJ A;  8ICV A;  4ANW A;  3TSS A;  4G3X B;  2MBO A;  5BOM A;  3WIM A;  1BPX A;  3NJT A;  4B9T A;  4GDL A;  1WYW B;  4HPM B;  4RQN A;  4Z6D A;  2KHQ A;  1ZJM A;  1HEZ E;  2ASL A;  1A5R A;  2BR0 A;  3ZVV A;  2BPG A;  4NY0 A;  3V62 A;  5IIL A;  4J6I A;  2WX1 A;  4HCN B;  4ZHP A;  5GTI U;  3PLV A;  2Q4T A;  5ALP A;  5EE0 A;  2KZM A;  4GB9 A;  7ICU A;  4M9H A;  3DBH B;  3ZUN A;  2KJ5 A;  5CJ7 A;  3RH4 A;  3KQ4 A;  3B9J A;  3DBR B;  4RNA A;  1RDF A;  1I4Q A;  4HRO A;  5AZG A;  1N2X A;  1IIP A;  5ALK A;  3WKA A;  3RRH A;  3SQI A;  1WJ4 A;  2HD5 B;  2ZIX B;  2R8I A;  5AM5 A;  4EBE A;  1JAL A;  1TK0 A;  5AEK B;  3WK6 A;  4O3N A;  1L4Z B;  4P7I A;  4Q2J A;  4EEW A;  1MC8 A;  2ACZ B;  3VAW A;  2JVC A;  3A1Q A;  4FHK A;  1E9M A;  5L1I A;  4HYK A;  4US8 A;  1NJW A;  4PS8 A;  1ZQM A;  4ZHO A;  1NOM A;  2KWU B;  2L5Y A;  5J29 A;  5KFS A;  4WWM A;  4ECW A;  3A0B U;  1FRR A;  1NKE A;  4ECY A;  1X9W A;  2OM6 A;  2FMQ A;  1Q1O A;  9ICA A;  1V80 A;  5D6J B;  1UF0 A;  2LMC A;  2KT7 A;  2FNJ B;  2XBB C;  4CF3 A;  4K7W A;  2WDT B;  3DQV A;  1SZH A;  1FFV A;  2PLP A;  3T3N A;  2KXJ A;  1SXE A;  4C4T A;  3JSV A;  3RT3 B;  2M0X A;  2KQS A;  2V3P A;  5CHW A;  2EKE C;  4BKT A;  3ZI4 A;  4J9M A;  1ZQQ A;  1IV8 A;  1X42 A;  3FAH A;  4CE6 A;  5DGA A;  2NCN A;  1WXQ A;  2KVC A;  1SWV A;  1X6J A;  5EOZ A;  2ISP A;  2SEB D;  3AE9 B;  3MJW A;  4KZ0 A;  4B6W A;  3TEW A;  1ZQE A;  4I6N B;  2FMS A;  4IRC A;  3APC A;  3PRE A;  4ASW C;  2RDI A;  1P7D A;  2VA3 A;  5ALQ A;  2VA8 A;  4JX1 C;  3D6J A;  5ALV A;  3B0Y A;  3OJU A;  1FFU A;  1WGK A;  3MTN B;  3ECI A;  2BYF A;  3V60 A;  3ZD9 A;  5ALO A;  1MVK A;  4ARI A;  4H2A A;  3ENE A;  1TAU A;  4JWU C;  1B9R A;  5AKG A;  3E58 A;  1DOX A;  4NJ7 A;  1B22 A;  4DBG A;  2KN5 A;  3VDZ A;  1JN3 A;  3MC8 A;  2EZX A;  1OUQ A;  2G4S A;  2WXR A;  4JV0 A;  1Z3E B;  5ALY A;  2J52 A;  4IR1 A;  3L17 A;  2QEJ C;  4OZA A;  1I4P A;  5JZE B;  3CRX A;  4M9J A;  2JUO A;  1F0M A;  3VH4 B;  2F44 A;  5AKX A;  4KLS A;  3SAF A;  1RXW A;  4ZRJ A;  5BMH A;  2J0K A;  4YCX A;  4EX7 A;  2IDY A;  3ZJU A;  4HWI B;  3RRG A;  7ICI A;  1ZQA A;  3T5H A;  1XNS A;  4UB5 A;  2N7E A;  2ZTC A;  2JV3 A;  3KYD D;  1BPE A;  1RQN A;  4KLD A;  4F4Z A;  4A8E A;  4F72 A;  4PHD A;  2GBN A;  3C0R B;  3AQE A;  2JRH A;  2NBV B;  4B9K A;  2RQ5 A;  2JEF A;  9ICX A;  3UIO B;  2HHS A;  3EWA A;  3BK1 A;  1TT5 B;  1WWU A;  1L3S A;  3SI8 A;  2LYA A;  2ZPY A;  1P3Q U;  5CR0 A;  2XID A;  3MFH A;  4IQU A;  5KT4 A;  2KTR B;  3VC8 A;  3PSE B;  4C8O A;  2D3B A;  8ICL A;  1ZGU B;  2YB4 A;  3CW2 C;  2LJI A;  2IY1 B;  3PML A;  3IT6 B;  4NLC A;  4QZI A;  3URY A;  1NK9 A;  3BQ7 A;  4F5P A;  1DXS A;  7ICQ A;  2I1Q A;  4MDK E;  1WR6 E;  3VVW B;  2MSE D;  2L8J A;  1CJE A;  3MHS D;  3PO0 A;  2PI5 A;  5J0S A;  1QLB B;  5KG0 A;  2NVU I;  3C1Y A;  3HK0 A;  3HKZ F;  5DQG A;  2LXC A;  3H4D A;  2WXJ A;  1OQQ A;  2JYT A;  4FJV B;  3GZN I;  3NVW A;  4RU9 A;  1UPH A;  2IOF A;  4I2I A;  1IBX B;  5EDS A;  1WX9 A;  2BCU A;  2M0A A;  3KUC B;  2RRD A;  4F93 B;  3Q8K A;  3WK4 A;  2J6U A;  3Q3N C;  3KKA A;  2WXL A;  3FDS A;  4J9P A;  3DVG Y;  1L0V B;  2Z0D B;  3QU7 A;  3VR8 B;  3AE5 B;  1IG6 A;  4TUP A;  2VIX A;  4EEL A;  2LM1 A;  4YQW A;  2W43 A;  1X9M A;  1E8X A;  1SL0 A;  2V9H A;  5AI5 A;  2M1M A;  1AWD A;  2DPI A;  4RQ2 A;  2REX A;  3M3J A;  3AH7 A;  2NO4 A;  1RM6 C;  4M6W B;  2QLT A;  1GOZ A;  5ALZ A;  2DF4 B;  2FLN A;  2MW5 A;  4KGR A;  4EZJ A;  4C7Z A;  2QIL A;  2I38 A;  4IR9 A;  1F2R I;  5BYS A;  3UQA A;  1NZB A;  2LRW A;  3BIN A;  1XCQ L;  3BK2 A;  1QOA A;  3ZNI D;  4KDI C;  4NV0 A;  2NRW A;  1UQV A;  2OXO A;  2L05 A;  3QQ8 B;  2ZIX A;  2IPK D;  1SZP A;  3BYT B;  1BGX T;  1ZW7 A;  1YNT E;  3L3F X;  1KFS A;  5KFC A;  1FD6 A;  4IQW A;  3L0W B;  1KRH A;  3TCA A;  4I2F A;  2KQ7 A;  1EM7 A;  2PTL A;  2K4E A;  1L7Y A;  2LD9 A;  3H6N A;  1Q5W B;  1BT0 A;  4BKS A;  1N48 A;  3IAS 1;  2ZNV B;  2ZPN A;  2FJ6 A;  1A0P A;  5AK3 A;  1COO A;  1MQ3 A;  2MBH A;  2ES6 A;  4K3B A;  3R8B A;  3PX4 A;  4LNK A;  1D8Y A;  3GV5 B;  2HJ1 A;  8ICU A;  3PSI A;  3V6E B;  1QSY A;  1WZ0 A;  2DL0 A;  3NS1 A;  5KHO A;  1KFD A;  3UMC A;  4I6P A;  2KZZ A;  2D11 A;  1NEN B;  3ABV B;  5F9N A;  5DCN A;  3BYY B;  1Z00 B;  8ICB A;  3APD A;  4LJP B;  2V3S A;  2WXQ A;  3GDX A;  1VDV A;  4F4K A;  2J6S A;  5AM4 A;  1DOI A;  2HBK A;  1HQR D;  2BS2 B;  2MH7 A;  3UI3 A;  5F3X B;  5L9X A;  3WK5 A;  1QT9 A;  3QXG A;  1L4D B;  1U47 A;  4GXI A;  3DVG X;  3AV8 A;  2KG5 A;  2NBU A;  1NK7 A;  4IG7 B;  1T0Y A;  1ZXH A;  2AX5 A;  1WE6 A;  3RAQ A;  1N63 A;  4RUC A;  4I27 A;  3T3O A;  1U9L A;  3ED5 A;  4KSK C;  1L8O A;  1HIW A;  2HBM A;  7ICM A;  4JGH B;  3VTU A;  4YSZ B;  3AE1 B;  4Q45 A;  2JF5 A;  2NRX A;  2YN4 A;  2ZJA A;  5ALD A;  2LGS A;  4OVU A;  5IA7 A;  2FCS A;  2JXT A;  1UEL A;  1DOQ A;  2ON8 A;  3JVZ X;  3MR2 A;  2PMZ C;  1SV0 A;  3BWU D;  4EEN A;  3K4G A;  3HVD A;  2G4D B;  4N9F 4;  1NI2 A;  1UT8 A;  3FYH A;  4IRK A;  1RAX A;  3RJJ A;  4QZF A;  1V1O A;  1WRD B;  2K8A A;  2XI9 A;  1NJX A;  3RBE A;  1A77 A;  5CEH A;  1S77 D;  4B9N A;  2KTQ A;  3AL0 B;  1UCV A;  1V6E A;  4JWN A;  2BVC A;  2WDQ B;  3AMZ A;  3PLU A;  2ASQ A;  4B0E A;  4FZM A;  5J2D A;  3L10 B;  2WAQ C;  1ROE A;  1WI0 A;  5JH5 C;  2XIC A;  3BQ2 A;  2JZ3 B;  5KFD A;  5KFN A;  3M9O B;  9ICI A;  4R66 A;  5D2M B;  3PST A;  2WXI A;  3ONS A;  8ICA A;  3RCZ A;  2KMC A;  4KIT B;  4ECS A;  1WJN A;  2O6V D;  3B2G A;  1F5S A;  4KX3 A;  5KG7 A;  4EEK A;  2C2R A;  1ZQG A;  1C78 A;  2R8G A;  4BX9 C;  2KYW A;  1TS3 A;  3QUC A;  5KFX A;  2EDU A;  1KL9 A;  1V9P A;  4M9G A;  1YN5 A;  2HHW A;  1WXM A;  1N60 A;  1JMS A;  3KHL A;  2W3R A;  1KFY B;  3OSP A;  2W9C A;  2VH2 A;  5FR3 A;  2WXM A;  2MJ3 A;  2MJD A;  3MC0 B;  3RTV A;  2PKO A;  1ZQ1 C;  1HJP A;  4WAA A;  2XC9 A;  4KZC A;  3THV A;  4QIW F;  1J2N A;  4Z6F A;  2LHE A;  1WGY A;  1ZDV A;  4Y2J A;  5AI6 A;  4JK1 A;  4F91 B;  1L6V A;  2EAM A;  4J03 A;  2KJ9 A;  3WAL A;  2V4Q A;  2L3Z A;  1RYR A;  1L6N A;  4U7C A;  1C77 A;  5DBB A;  1MN8 A;  2EZZ A;  1MQ2 A;  2YB1 A;  5A0L A;  1SIF A;  5AI9 A;  4OO1 J;  2NRV A;  1MFW A;  3MFG A;  4YD1 A;  1IBX A;  4WJN A;  4HJG E;  4UB8 U;  4EYH B;  1YJ1 A;  4FLH A;  1QQ7 A;  5J0T A;  4NLK A;  2MSN A;  4DL3 A;  1ZET A;  2WF7 A;  4ITK A;  2IND C;  3PZP A;  4JWM A;  3PV1 A;  3SDL C;  7ICP A;  9ICV A;  4IS7 A;  4I2C A;  1V9J A;  4XZ4 A;  2AL3 A;  2QMT A;  1ACC A;  5KFJ A;  2KAC A;  4MFA A;  3RZF A;  4YR0 A;  4M6W A;  2V4R A;  2AHO B;  2EQY A;  3EYZ A;  1URJ A;  4GFJ A;  4ELT A;  2CPR A;  4XRH A;  1NZP A;  4O3M A;  2G09 A;  1EF1 A;  1WGH A;  4WJP A;  4YN4 A;  1S3S G;  5KFP A;  1OEY A;  4DDI D;  2R8J A;  3SD7 A;  4M00 A;  3AUL A;  1K53 A;  3L5K A;  3OJS A;  4B9L A;  1FIQ A;  2KMM A;  1L7N A;  1QOG A;  4US9 A;  2A5U A;  2I1K A;  4LZD A;  1D6E C;  1AYF A;  4RCO A;  2AWT A;  2BWF A;  1C4P A;  8ICF A;  1Z19 A;  4DHZ E;  4UAU A;  4I2A A;  3QHT A;  3NZS A;  1F2R C;  1J2M A;  3Q3M C;  3PPA A;  1Z1V A;  4XQ8 A;  3P2B A;  4NWI A;  5ALJ A;  4MJS B;  4QZE A;  3UXO A;  4UAZ A;  1QF6 A;  3W1S C;  5AZH A;  2E8O A;  3ZQ4 A;  4DSK A;  4OJ5 A;  2BKE A;  2AL6 A;  1WH3 A;  3W2D A;  3WK9 A;  4L23 A;  2N9P C;  2VRR B;  2HOI A;  4ED7 A;  3R3M A;  3JPS A;  5AIC A;  1JIH A;  3ZXV A;  1BPY A;  1Z4N A;  1Z00 A;  3HIZ A;  2LEK A;  2FPK A;  1ESF A;  1HA5 A;  3H1U A;  9ICC A;  4F4Y A;  1L7O A;  3A0H U;  2UVR A;  1L8L A;  4I29 A;  2RP5 A;  2IBI B;  5BMI A;  1JWM D;  2DQN B;  5IP4 D;  1RYS A;  5FP0 A;  5KFZ A;  3H7P B;  1ET6 A;  1BPB A;  3P63 A;  1ISN A;  1KF6 B;  1WX8 A;  1EWY C;  3OPX A;  1D8B A;  3M63 B;  3ZJT A;  5GTH U;  4IRD A;  4HDO A;  2WFA A;  2OOB B;  3RR8 A;  4W9I A;  3QX7 A;  1KSP A;  1NK8 A;  2M19 A;  3F2B A;  2KC1 A;  4PGY A;  5CHG A;  3QIJ A;  2NRZ A;  1BPD A;  3DHH C;  2DKX A;  3AE8 B;  2VZK B;  2XEW A;  3A9J B;  4NQL B;  3KUD B;  2BCV A;  4HPP A;  4ZDV A;  4DFJ A;  2BYE A;  2ZXI A;  1U45 A;  4OZC A;  3DVN U;  4UAV A;  3RUL A;  2M9N A;  2KFZ A;  4RZR A;  2N4F A;  1T4G A;  4WQM A;  2W3S A;  9ICT A;  1CRX A;  1GPX A;  1PQS A;  2K0P A;  1FEZ A;  4W9L A;  1GAQ B;  4NLG A;  2D5G A;  2WYQ A;  5ALS A;  7ICS A;  3ZNH B;  3ZRC A;  1B43 A;  4C7Y A;  3F2C A;  1ZQL A;  2CS4 A;  3APF A;  4ECX A;  5KG3 A;  5AM3 A;  4UB3 A;  3PHX B;  7ICO A;  1HUZ A;  2G08 A;  2GBJ A;  1XO0 A;  3Q8L A;  1C4C A;  5AKE A;  1E6E B;  3IBE A;  4O5C A;  1YX5 B;  3IP4 B;  4UAY A;  1HUO A;  4KSL C;  3RAX A;  1PUZ A;  3AED B;  3BDP A;  4RPZ A;  5ALN A;  5KFV A;  4I2E A;  2MP2 A;  1ZD3 A;  4L2Y A;  2XO7 A;  2FMP A;  1J7B A;  3KWL A;  3JPQ A;  2BCR A;  2LMR A;  2KWD A;  3RBD A;  1C9F A;  3AM9 A;  1IXR A;  1MA7 A;  4R8U B;  3TAP A;  1TJE A;  3D2Q A;  4YTM B;  2VJ4 A;  1N62 A;  3PZD A;  5BYQ A;  1L5U A;  3HM3 A;  2L76 A;  2BQU A;  1ZD5 A;  2AQ4 A;  3PO5 A;  5TIS U;  2CU3 A;  4NL9 C;  3IN5 A;  9ICL A;  1TZ1 A;  2INN E;  1K8R B;  1JRU A;  2LXA A;  2AH5 A;  3DBL B;  5AK5 A;  2ZIV B;  4XDD A;  3RNF C;  3WK8 A;  3RR7 A;  3LWL A;  3AU2 A;  1TBE A;  1NVI D;  4R3D A;  3AE3 B;  5DPT A;  1SGH A;  1X2I A;  2DZM A;  4FBJ B;  5JHB A;  2H88 B;  2XCP A;  3OHB A;  4DQS A;  4CRX A;  3SFD B;  3CIR B;  1WUD A;  4MH0 E;  2GO7 A;  3KHR A;  2BDU A;  2JX5 A;  3Q8P B;  1IPG A;  2J42 A;  4B9V A;  2WXN A;  1AN8 A;  3TAD A;  1FNW A;  4BBN F;  3C29 A;  2G07 A;  2M4N A;  2H3I A;  1GUA B;  1ZP0 B;  5DPW A;  3L08 A;  2JZB B;  1WZ3 A;  1J7C A;  5CP2 A;  3MBY A;  5KFT A;  4ARC A;  3TL5 A;  1HXY D;  2GBR A;  4UAT A;  2MX2 A;  4F5O A;  2JWZ A;  5DG9 A;  4IW0 A;  2CU1 A;  3SU8 X;  1KEJ A;  1CQV A;  4ZRP A;  2MBE A;  3ZDE A;  4F8C B;  1PDX A;  1JI7 A;  2KSO B;  2H3V A;  2CN1 A;  3ZGZ A;  2WDR B;  3DPD A;  3VXW A;  4ZYN A;  2AJQ A;  1FMA D;  4G50 A;  2P6U A;  1VZ6 A;  1T7P A;  4R64 A;  8ICK A;  3HVZ A;  4GIV A;  1OGW A;  4NZL B;  4DSE A;  5T8I A;  2N7D A;  2K6Q A;  4AS1 A;  4QZC A;  3UIP B;  4M8N A;  2QDF A;  2WNM A;  3R9K A;  4GXK A;  1PK1 B;  5TSS A;  5J2A A;  2BDP A;  2UYZ B;  2XK5 B;  4EZK A;  4QZH A;  5HHI A;  1Q8K A;  1OTR B;  4AP9 A;  3Q8Q B;  5FK9 C;  2LYB A;  4WH4 A;  4ED1 A;  3W5V B;  4KV2 A;  2C7M B;  4EX6 A;  2VAN A;  2FDR A;  3TEX A;  1Y8R C;  4KTQ A;  2WXO A;  4P4M A;  3LWM A;  2KC2 A;  2BPC A;  3RH6 A;  5G2N A;  2NR2 A;  3R2I A;  8ICG A;  4YR3 A;  3LXF A;  2CHZ A;  4KLT A;  2F8L A;  3C2M A;  5J8Y A;  3I28 A;  2Y0S F;  1QSS A;  2GOL A;  1N56 A;  1HEK A;  2QB1 A;  3TAR A;  7ICG A;  2BHN A;  3CNH A;  9ICU A;  4B9U A;  4JUZ A;  4JIO U;  4PL1 A;  4KLI A;  2XGP A;  3DBH I;  4RF0 A;  4M47 A;  1JRP A;  3GU3 A;  4O3O A;  5HFY A;  5IIK A;  3N4M B;  2NTS A;  2B3A A;  2IOH A;  1BNP A;  4EZ6 A;  3DOW A;  1VJ5 A;  3M62 B;  2NPT B;  4W9J A;  2KOB A;  4MJS A;  4P4P A;  2HDE A;  3GQC A;  4S0R A;  1KFT A;  3KOO A;  4RT2 A;  3B0A A;  1ZQD A;  1PFD A;  4RQ7 A;  2EEL A;  5HML A;  1F52 A;  5CA7 A;  1XC9 A;  1WIA A;  3QU5 A;  2KWC A;  4IM0 A;  4TQ0 A;  2V4I B;  2VZK D;  4ICV A;  1RQL A;  2ZIW B;  2F8K A;  2XNA C;  3IXS A;  8ICX A;  3NZ3 A;  1F77 A;  2MBQ A;  4EE2 A;  7ICV A;  4CF4 A;  1QH9 A;  3PS6 A;  2WF6 A;  2B21 A;  1E8W A;  3IFW B;  1XT9 B;  3VH3 B;  3H7P A;  4YMN A;  2BWE S;  4YMO A;  3NZU A;  5KFI A;  1ZE3 D;  3AU6 A;  2D6F C;  2JZZ A;  3AEG B;  4C56 C;  3ZNZ B;  4UQG A;  3CSF A;  1JRO A;  4AYB C;  1C20 A;  2HBJ A;  4IWP A;  4NAM A;  2UVW A;  2BKF A;  4Y2R A;  3F53 A;  3SAH A;  2K9X A;  2ZJD A;  4WWN A;  2V4L A;  2R8K A;  1KRP A;  2PXI A;  3KYC D;  1K1S A;  3RNA C;  1Q3U A;  5AUK A;  1YZ7 A;  4DLG A;  2LGY A;  2AQ1 B;  2RPV A;  2G5I B;  1IM4 A;  1GC7 A;  4IQT A;  3A9J A;  2RHF A;  2C2E A;  8ICM A;  1WSP A;  2L32 A;  2EAO A;  5C5J A;  5DG7 A;  5CTR C;  3ZNG C;  2IJ0 A;  3WK7 A;  1PVQ A;  1QQR A;  1UZX B;  2MQJ A;  1ZQY A;  4O3Q A;  4J9S A;  3I63 C;  4GGQ A;  3BQT A;  1UNS A;  1OQR A;  2KJ8 A;  3A9K B;  2K4I A;  1JWU D;  1MSW D;  3M6Z A;  2ISO A;  4B9S A;  2MHJ A;  3PT2 B;  2HHX A;  1X40 A;  1R4N B;  2DZJ A;  5J2H A;  2E1E A;  2FBW B;  5KAF U;  3KWV A;  4FE3 A;  4IUM B;  1N61 A;  2EH9 A;  1CMX B;  3ETL A;  3ZTD A;  1LQB A;  3BVZ A;  3F2D A;  1H4R A;  3EA6 A;  4PK1 A;  1EU3 A;  2E3T A;  4DQR A;  3RB0 A;  4M0W B;  4NAW B;  4PZO A;  3PW2 A;  3J9C A;  2WB1 C;  5IO9 A;  1M94 A;  1TAQ A;  5KL8 B;  1Y56 A;  2ZJ8 A;  3AEB B;  4OJP A;  2LM4 A;  1VCB A;  2RDG A;  1PK3 A;  2W8L A;  4RQ4 A;  2JWU A;  5AM2 A;  1QTM A;  3PHW B;  2JYE A;  3QEA Z;  1ZQN A;  4D2K A;  4EUT A;  5DLG A;  3V6K A;  2LUM A;  2MBB B;  2TSS A;  5ALG A;  1HZ5 A;  2X8X X;  3KUZ A;  1X9S A;  3I1Y A;  5TR5 A;  2W03 A;  2ZW1 A;  1UGM A;  1SGG A;  1K51 A;  2AGQ A;  1V97 A;  4O3R A;  4HAI A;  4W9K A;  2HTM E;  3P4P B;  1XLN A;  4ANU A;  1WJU A;  4C8K A;  3K1R B;  1A76 A;  2LI6 A;  4URK A;  1WXA A;  3P42 A;  1V81 A;  2DWQ A;  2N9X A;  3L13 A;  2RDJ A;  2ZUD A;  2ONQ A;  1SE2 A;  1T3N A;  5ALT A;  5K4L A;  3M6K A;  2I1J A;  2K4H A;  1EU4 A;  1TS5 A;  4NLN A;  1TS4 A;  4IL6 U;  2K8C B;  2JZB A;  2N9K A;  1Q46 A;  5AI8 A;  2UU7 A;  1ZQV A;  3QAR A;  5H2F U;  2NBW B;  2P35 A;  2KEY A;  1FO4 A;  4I2G A;  2LUE A;  3DDC B;  9ICB A;  2NS5 A;  2Q5W D;  4UB4 A;  2L00 B;  2ZIU A;  3RNB C;  2OWO A;  4UBC A;  3KH0 A;  4KKJ A;  2PFP A;  3AN1 A;  1H38 A;  5ALR A;  2HVH A;  3LYY A;  2J6T A;  1EUV B;  4CQN A;  3ZDT A;  4PZN A;  4QZG A;  2KN7 A;  3JPP A;  3SZ2 A;  4IM2 A;  1UT5 A;  4Y2V A;  3WKB A;  4MSM B;  2KP7 A;  3F5E A;  4DLE A;  1ZYQ A;  3UMG A;  1WGG A;  3GS2 A;  2KQ4 X;  1TAM A;  2QC8 A;  3V7K A;  3C28 A;  2GLE A;  3C1Z A;  3RJE A;  1PK1 A;  4EBD A;  2IO0 B;  3W1Y A;  2BKR B;  2XK5 A;  2BGF A;  1V5O A;  2ZTE A;  5D94 A;  3U7Z A;  4DL6 A;  2QB0 B;  2K60 A;  3G6X A;  3SAG A;  5KT5 A;  4DFK A;  2Q0Z X;  2KFK B;  3WAN A;  3ZTC A;  1NK5 A;  4FBU A;  4YG2 A;  2JH7 A;  4Y2X A;  1COK A;  3IG8 A;  3N7S C;  3KD3 A;  3KKA C;  4RQM A;  1ZOY B;  4J9O A;  2V3N A;  3HT3 A;  4G9B A;  4KX5 A;  2W9N A;  4CDG A;  2C60 A;  5J2F A;  4W9E A;  4ACO A;  4BGD A;  4RM9 A;  3NUQ A;  1LO5 D;  2RSU A;  2MUT B;  5AKY A;  1RPL A;  4NJ8 A;  2LGD A;  3BS5 B;  5J2G A;  4DHJ B;  5ALW A;  1NK0 A;  3TI0 A;  3WAM A;  2FAZ A;  4HRS A;  4K81 A;  4DOB A;  1YN3 A;  1FXT B;  3QNM A;  1C79 A;  1K52 A;  2AEH A;  4F50 A;  3EPI A;  1P98 A;  4C8M A;  5KTQ A;  2ASD A;  2N9L A;  1XLP A;  3K9O B;  2J7Q B;  1ED1 A;  2KO3 A;  2MJE A;  1KLV A;  2O2V A;  1BVS A;  5E6J A;  2HHU A;  3SD5 A;  5DDY A;  1YOV B;  7ICN A;  2BB5 A;  2LVQ A;  2YEP F;  2FPM A;  3N20 C;  4UDU C;  4BKS D;  3RFZ B;  4IKG A;  3EFU A;  4BWM A;  3ALR A;  2CJO A;  4ECZ A;  3SV3 A;  2E1F A;  3CYM A;  3I5J C;  5ALI A;  2ZIW A;  2AQ2 B;  2YEP B;  4BKG A;  4UB1 A;  8ICC A;  3GE8 C;  3ZLZ A;  3Q8E A;  3QUQ A;  2B0C A;  3PZ8 A;  1WWT A;  1TKG A;  3D2S A;  3H4B A;  4RH6 A;  5AUI A;  4E71 A;  2IGH A;  4LTU A;  4G3I A;  9ICP A;  2N1R A;  1R7S A;  4NM2 A;  4KDL B;  2Z0E B;  1CEZ A;  2BYV E;  1FPY A;  4UAR A;  4KLQ A;  2A3V A;  1F1H A;  1SKS A;  3AEV A;  2K4P A;  4KIK B;  3QAQ A;  4ZRK A;  5C3J B;  1XU4 A;  2YML A;  5IKC M;  2YQE A;  5G5G A;  2HVI A;  4LDT B;  4LNN A;  2PE9 A;  1LVH A;  2KZ3 A;  2DZK A;  3NVY A;  4P1C C;  4WJO A;  4HEA 1;  2HW3 A;  2QJL A;  1F44 A;  5LXH A;  1DGS A;  3UQ2 A;  1T94 A;  2CHX A;  2CKH B;  4MFF A;  1V2Y A;  4USA A;  1X1M A;  4QAY A;  2D07 B;  2UVV A;  2KIV A;  4KN4 A;  2N9E B;  4G11 A;  4TQ1 A;  3T3F A;  2KMA A;  5AIB A;  2BPS A;  1RZT A;  2LGX A;  2R61 A;  4PGX A;  1P1A A;  1ZKH A;  1WJ6 A;  3JW0 X;  4W9C A;  4XX5 A;  3ZXR A;  2KJ6 A;  3LVW A;  3A9K A;  4MM3 B;  4A3P A;  5ALH A;  2QIE B;  5IOI A;  2SAK A;  5KFH A;  2DGZ A;  1SSN A;  3AI5 A;  4MEM A;  2V9W A;  3I76 A;  2NMQ A;  5KFG A;  3W9C B;  1XWL A;  1HTO A;  3K1Z A;  2ZUC A;  3B0X A;  4M0W A;  3VTW A;  5L95 C;  4NAW A;  4P0Q B;  5D49 A;  1SV0 C;  3P4R B;  5IN7 A;  3AEE B;  2XCA A;  2JY6 A;  3AE6 B;  2MRL A;  3V6J A;  5B66 U;  4AJW A;  4LZG A;  4OVV A;  4ICA A;  4J9R A;  4GLX A;  4MEL A;  5D4B A;  2MA1 A;  4DFP A;  2RDH A;  5KG6 A;  4O3S A;  1MI0 A;  5CX3 A;  5ALX A;  1P7F A;  3ZDA A;  3IAM 1;  4XUS A;  7ICH A;  3ISC A;  5EE9 A;  1WCL A;  3Q8M A;  4ELU A;  4F4W A;  3E2E A;  3TFR A;  1D5X C;  5AM0 A;  4YWG G;  2D2Q A;  4KN7 A;  1WM3 A;  2CRX A;  3VUY A;  4BAX A;  4Q43 A;  5ALM A;  3B1L X;  5L1J A;  4DL5 A;  2I2Y A;  1VZ7 A;  4CYE A;  2WDV B;  3AB5 A;  4FBT A;  2ATL A;  3WA0 A;  2KZR A;  3QZ8 A;  4TMA B;  1KKX A;  1WY8 A;  4HKZ E;  3TQ1 A;  3QEB Z;  1J19 A;  3Q8F A;  4HK2 A;  2WXF A;  3OJ3 A;  1T0Q C;  2KDM A;  4RQ0 A;  4DL4 A;  2DAJ A;  2KNB A;  1S10 A;  3H7S A;  5KFQ A;  2WF9 A;  1N6Z A;  2K8C A;  4DQP A;  2EMS A;  3Q8S B;  3TAC B;  5JUM A;  3PX0 A;  4YXJ A;  2BBC A;  2VH1 A;  3GP7 A;  2XN9 C;  1KBU A;  1X66 A;  4MGK E;  1MG8 A;  2N0S B;  4ZRI A;  1X9X A;  2JXX A;  3VQI A;  2K89 A;  4J9N A;  2IZV B;  4KLJ A;  1NJY A;  4TKN A;  3IM1 A;  3KHG A;  1RWS A;  1ZUD 2;  3PZ7 A;  3MDC A;  1KJT A;  1ZDX A;  4ANV A;  5DB9 A;  2QAR B;  1UBQ A;  4QWD A;  5EWG A;  3Q8R B;  1WR1 A;  4DK5 A;  4ED0 A;  3CST A;  4ANX A;  4LLG M;  2KTR A;  4FXC A;  2D3D A;  1L7M A;  1FRD A;  2IGG A;  4YXM A;  4LJX A;  4L1B A;  1TKE A;  3H0L B;  3NS8 A;  4EZL A;  5AKZ A;  2HCF A;  2EAN A;  4BWJ A;  4DSJ A;  3PTF C;  4K4I A;  1WE7 A;  1ZQW A;  2JZP A;  4WQO B;  1QQ5 A;  4P6V F;  4MSQ B;  2DPJ A;  5C0Y A;  1EF5 A;  1RFK A;  2KDB A;  1U4B A;  4TSS A;  2DYO A;  5DBA A;  3KZI U;  4ED6 A;  1YIW A;  1S76 D;  2R2Q A;  1KDH A;  1NK4 A;  2NTT A;  2FCM A;  5DG8 A;  4JMU A;  4P4O A;  1NK6 A;  1XD3 B;  1SXT A;  4RPY A;  3HKZ C;  2HSZ A;  4W9H A;  3RF9 A;  2C9W B;  1Z4O A;  3NOB A;  3VHT C;  2G5H B;  2YTU A;  3D2N A;  3GIM A;  2HJ8 A;  3DWG C;  3Q6B A;  2V0G A;  1E10 A;  3O0F A;  1OW5 A;  1T3Q A;  3RFA A;  3ML9 A;  1WCN A;  2YX8 A;  1S97 A;  2MUT A;  2BCQ A;  3U52 E;  2H3F A;  4ELV A;  4A6Q A;  3TJP A;  4AP4 C;  4GXB A;  4FA6 A;  5KT7 A;  5HG2 A;  2GWS A;  5J2J A;  1S0O A;  3VTV A;  1VRA B;  2PKE A;  4QWE A;  3IRU A;  4JV1 A;  5JXV A;  4C80 A;  4ECQ A;  4DF8 A;  8ICR A;  2EKI A;  2L52 A;  8ICT A;  1I4R A;  3ZD8 A;  2E6X A;  3H0M B;  2F1I A;  9ICS A;  4GN1 A;  3HJE A;  4CCH A;  1T0S C;  4F5R A;  2C2D A;  9ICO A;  1YZ6 A;  2KFN A;  8ICS A;  4B6J A;  1CUK A;  1L0X B;  2D3C A;  1U49 A;  1N5X A;  3BZK A;  3IHP C;  1ZD2 P;  8ICO A;  4U6P A;  1L3T A;  4DQO C;  4B9M A;  3V3X A;  1I4H A;  4B95 A;  4I28 A;  4M01 A;  4K4G A;  3AE7 B;  4AQ7 A;  1ET9 A;  3UQ0 A;  2BGW A;  2ZNV C;  2ZVO A;  4LNF A;  1VR9 A;  2GBM A;  9ICW A;  2H3Q A;  3EPG A;  4KIK A;  3N3K B;  4IDI A;  4RNM A;  1XO1 A;  1NYQ A;  2Y5P A;  3A4S C;  3M8R A;  5DB6 A;  2N7J A;  2KLG A;  3SHQ A;  2FE9 A;  4NM1 A;  2KOX A;  2RMM A;  2INC C;  4O9M A;  4GC6 A;  1LFD A;  2KN4 A;  1DYQ A;  2H89 B;  4P0P B;  1YX6 B;  5KL1 B;  2IO2 B;  3N32 A;  4BOS C;  1K50 A;  4JWS C;  1C3T A;  1FM0 D;  2WF5 A;  4NQK E;  4GC7 A;  4C00 A;  4RGO S;  1IUE A;  2ZXH A;  4MM3 A;  1J0G A;  1LXD A;  1Z2M A;  1TY0 A;  2JH1 A;  1HZ6 A;  1B1Z A;  2KD0 A;  4KKI A;  2JEI A;  5CRX A;  9ICH A;  2JSV X;  2C22 A;  3R7R A;  5ALL A;  2UVU A;  1WX7 A;  4MHV A;  1QCK A;  2JEJ A;  3C21 A;  2FIF A;  4A9A A;  4P0Q A;  3N97 B;  2R2O A;  2A4Z A;  2LVO A;  4ED8 A;  1XO3 A;  4CNQ A;  2PI4 A;  3RPF C;  2A19 A;  5AHX A;  3WKD A;  4Z6C A;  2C7H A;  1T5X D;  5KFA A;  2FLP A;  5HKH A;  4KLH A;  5HI1 A;  2WS3 B;  4NLZ A;  1DK3 A;  3ETR A;  4RNO A;  1CZP A;  1PGX A;  4I2H A;  2NO5 A;  5J2E A;  2RGF A;  1V85 A;  4IWQ A;  3KTQ A;  8ICQ A;  3TUO A;  4Y2Q A;  3C5F A;  1AQ6 A;  2DLB A;  3U2S C;  3K9P B;  9ICE A;  4KMU A;  2XY5 A;  5J0Y A;  1BUI C;  1GO3 F;  4HDQ A;  4F2S A;  4MGY E;  2WLB A;  3WU2 U;  1ZQP A;  5KT6 A;  3DBL I;  3VCB A;  1Q10 A;  2DX5 B;  5GMV A;  5G55 A;  3H0R B;  1KLN A;  3VUW A;  1I7H A;  4UW9 A;  1ZQB A;  4MF8 A;  3LDZ E;  3A4R A;  4MEY A;  4M2Y A;  4CGZ A;  1D4B A;  2ZTD A;  5T14 A;  4Y2S A;  1XQQ A;  1ZQO A;  4W9F A;  5F9L A;  1S9F A;  4IC9 A;  2J53 A;  5AK4 A;  3S2A A;  4PGQ A;  5J0O A;  1JUD A;  1ZQJ A;  3IG3 A;  2FID A;  2OJR A;  3VFK A;  3C2L A;  4O5E A;  1TK5 A;  2JEG A;  1AAR A;  4IWO A;  5G5H A;  5EWE A;  2K5P A;  3TIX A;  9ICK A;  1EO6 A;  1L0Y B;  2LFI A;  5HNK A;  3EUB 2;  5J18 A;  1BML C;  1EXN A;  4RFB A;  2QAR A;  2AGP A;  4RGT A;  1FCL A;  4DXF A;  2QCZ A;  2WGS A;  3PGE A;  3TAD C;  3IT4 B;  3LJ3 A;  2EAP A;  4BJQ A;  4EYI B;  3QYP A;  4PYU A;  3E56 A;  4QIW C;  4ECT A;  3Q3J A;  3RYT A;  5DLF A;  3PW7 A;  4QJF B;  3F5A A;  4Q44 A;  2PEA A;  3O65 B;  4NJ6 A;  2WP9 B;  2IA6 A;  3I57 A;  1KH0 A;  5ALU A;  2JPH A;  3ONN A;  4DFD A;  5L1K A;  2GI9 A;  3OTQ A;  5KFB A;  2C28 A;  1I4X A;  2F1J A;  4C4V B;  2BF8 B;  4ZRQ A;  3NGD A;  4I2B A;  1TYG B;  1FCC C;  2JT4 B;  1FNV A;  4WIP A;  3VUX A;  5KHQ A;  4OVZ A;  4DDG D;  3T5J A;  4ACF A;  2K39 A;  4P1B C;  3N1Y C;  3X0W A;  3TEY A;  3FIL B;  2KFJ A;  2KIC A;  1ZQI A;  4E3C A;  4M02 A;  3QWZ B;  4NXZ A;  2MEK A;  2Y5C A;  4AWJ A;  1P7E A;  1KTQ A;  2BB6 A;  1Y88 A;  4ZOH C;  1HE8 A;  3TMP B;  2KD1 A;  2UWQ A;  3PVX A;  3Q69 A;  4FZL A;  2D3A A;  2DEN B;  3H8J A;  2KHW B;  4LVS A;  1MG4 A;  5H92 C;  1UGJ A;  2FUG 1;  3PRZ A;  2FPL A;  2X38 A;  1IGC A;  2AYO B;  1LM8 B;  1F0Z A;  4AOF A;  2B6G A;  1R4M B;  1UHU A;  1DGJ A;  1NDD A;  2KK0 A;  4F92 B;  5IAA C;  1T0R C;  1UWM A;  1CI4 A;  4UBB A;  4I2J A;  3FM9 A;  5J8Y C;  1QSL A;  4WJ3 B;  9ICJ A;  1F9J A;  2G1E A;  3ORY A;  3Q3O C;  4NJC A;  5DPS A;  5KFL A;  3RD2 A;  2W54 A;  4FZN A;  4II3 B;  2MLB A;  4II2 B;  3NRZ A;  1TIF A;  4HLE A;  2KMD A;  5D46 A;  4DL7 A;  4PYZ A;  3PV8 A;  4S17 A;  4A20 A;  5DQH A;  4GXJ A;  3T8M A;  1WFY A;  3CF6 E;  4FO6 A;  3PY8 A;  3H8M A;  8ICP A;  4FAD A; 
#chains in the Genus database with same CATH homology
 2PMV A;  3HVD A;  4GDL B;  4KKJ A;  1I4G A;  1L6U A;  3EGR A;  3AN1 A;  1VJK A;  3LB8 C;  3LYY A;  1KLU D;  1V1O A;  4CQN A;  3W1S A;  4A8X C;  1SJH D;  1E0Z A;  2WDQ B;  3GS2 A;  2KQ4 X;  4B0E A;  3AMZ A;  1KLG D;  1E7P B;  1FXA A;  1ROE A;  4B0M A;  2WXH A;  3BII D;  3U7Z A;  3L4P A;  3C8Y A;  3NUH B;  2LHD A;  1NI3 A;  4N58 A;  4O1N A;  1JW9 D;  2WXI A;  3FC4 A;  1GB1 A;  3B2G A;  2QSD A;  1ZOY B;  1XLO A;  2DBY A;  2V3N A;  4A55 A;  2OHF A;  3HRD D;  5BYR A;  1C78 A;  3N9Y C;  1XCT L;  2M56 B;  2PW9 A;  3NVZ A;  1TS3 A;  1LO5 D;  4ZYS A;  1YN5 A;  3I9V 1;  4P16 A;  4KGS A;  4YSX B;  1OFF A;  1ZXI A;  1N60 A;  2W3R A;  1KFY B;  5FR3 A;  1A70 A;  3P4Q B;  1TZO A;  2WXM A;  2MJ3 A;  4HRS A;  1YN3 A;  2MJD A;  1FCL A;  1C79 A;  1K52 A;  2ICI A;  3MC0 B;  2PKO A;  4WAF A;  2N9L A;  1ZPS A;  1XLP A;  2MJE A;  1V8C A;  5E6J A;  1MHH E;  1SF0 A;  1C4A A;  4RGN A;  2LHE A;  2YEP F;  4UDU C;  2BB5 A;  3RFZ B;  4GDK B;  5MPO A;  1QOB A;  1ZDV A;  4IKG A;  2CJO A;  1L6V A;  3Q8A A;  2AQ2 B;  3BZD B;  2YEP B;  4HKQ A;  1VZ8 A;  2WXG A;  1JWB D;  3Q8E A;  1GB4 A;  1C77 A;  3PZ8 A;  4OZB A;  1WWT A;  1TKG A;  4RH6 A;  5AUI A;  2L83 A;  1VLB A;  2IGH A;  4LTU A;  1R7S A;  2WU5 B;  4N59 A;  1JML A;  3MFG A;  1IBX A;  4HJG E;  1JWA D;  1JWS D;  5C3J B;  3AE2 B;  1EWC A;  5G5G A;  4ITK A;  1PUT A;  3NVY A;  4JE3 B;  4HEA 1;  2QMT A;  2QJL A;  1ACC A;  3ZYY X;  1BXT A;  1YJI A;  2KAC A;  4RF1 A;  1DOY A;  4USA A;  3BVG A;  4XWT A;  3GB1 A;  3HUI A;  1XF5 L;  2BTE A;  4TQ1 A;  1YQ4 B;  1YJJ A;  2R61 A;  2L1A A;  4YTP B;  1JQ4 A;  4MM3 B;  2QIE B;  5EE3 A;  1J7A A;  1D5Z C;  3AEA B;  2SAK A;  1SSN A;  1K53 A;  2BS4 B;  4OW0 A;  3Q8B A;  1FIQ A;  2KMM A;  1QOG A;  4US9 A;  2NMQ A;  1D6E C;  3W9C B;  1AYF A;  4KX6 B;  3MP9 A;  4OHJ A;  4RCO A;  1C4P A;  3AE4 B;  2W55 A;  4M0W A;  1SJE D;  1SEB D;  1F2R C;  3P4R B;  3AEE B;  3AE6 B;  2WU2 B;  5GXG B;  2PVG C;  1QOF A;  2RDH A;  5FKA C;  1MI0 A;  1QF6 A;  3OWE B;  3VRA B;  1P7F A;  3ZQ4 A;  2ZW0 A;  3IAM 1;  3FIL A;  5EE9 A;  3E9S A;  3W2D A;  4L23 A;  1YQ3 B;  1D5X C;  4YWG G;  2PIA A;  4REZ A;  2LEK A;  3CWI A;  1ESF A;  1HA5 A;  4PT5 A;  2I2Y A;  1VZ7 A;  1CK1 A;  2WDV B;  3AB5 A;  4MH8 A;  1WRI A;  2BS3 B;  3WCQ A;  4TMA B;  5BMI A;  1JWM D;  4HKZ E;  1ENF A;  3AEF B;  4GLS C;  3Q8F A;  1QIL A;  1ET6 A;  2B76 B;  2WXF A;  1C76 A;  3P63 A;  1KF6 B;  1EWY C;  2KDM A;  4YXD B;  1NYR A;  3ZJT A;  2WQY B;  5D7G A;  4LK0 M;  1TKY A;  1FXI A;  2M19 A;  5D3I B;  5BMG A;  2BBC A;  3GP7 A;  2BW2 A;  2XN9 C;  3VQI A;  2N0S B;  2BYT A;  1JCK B;  2JU6 X;  2VZK B;  3AE8 B;  3TSS A;  1SE4 A;  1RWS A;  1ZUD 2;  3PZ7 A;  4OZC A;  1HEZ E;  1ZDX A;  4WQM A;  4LLG M;  4ZHP A;  4FXC A;  2W3S A;  5EE0 A;  1FRD A;  2IGG A;  2J4X A;  1GPX A;  2K0P A;  4L1B A;  1TKE A;  3KQ4 A;  3B9J A;  1GAQ B;  3H8H A;  1I4Q A;  4HRO A;  2D5G A;  4RNA A;  3VR9 B;  1PGA A;  2K3U A;  2JZP A;  4P6V F;  4C7Y A;  1UWX A;  1JAL A;  1RFK A;  1C4C A;  1E6E B;  1V1P B;  1L4Z B;  2DYO A;  4Q2J A;  4TSS A;  1STE A;  2ACZ B;  1L5P A;  2NTT A;  1E9M A;  4US8 A;  1UUP A;  3AED B;  4ZHO A;  1SXT A;  4L2Y A;  1J7B A;  1RYJ A;  4WWM A;  3DWG C;  3KWL A;  1FRR A;  1E10 A;  2V0G A;  2KWD A;  2G9H D;  1C9F A;  4YSY B;  4XDC A;  3AM9 A;  1T3Q A;  1TJE A;  2LMC A;  3U52 E;  4YTM B;  5BYQ A;  1N62 A;  4A6Q A;  2CU3 A;  2INN E;  1FFV A;  2PLP A;  5HG2 A;  3T3N A;  1VRA B;  4XDD A;  2V3P A;  2Y3A A;  1NVI D;  3P4S B;  4R3D A;  3AE3 B;  3U4E G;  4C80 A;  2L52 A;  5JXV A;  2EKI A;  2K22 A;  1I4R A;  2E6X A;  2H88 B;  3SFD B;  2JQR B;  3FAH A;  3CIR B;  4DXG A;  1WXQ A;  2JX5 A;  4IOI E;  4MAC A;  2J42 A;  2GB1 A;  2WXN A;  1AN8 A;  1SIJ A;  1FNW A;  2SEB D;  2WXK A;  3AE9 B;  3O13 A;  4WUR A;  3TEW A;  1ZP0 B;  1L0X B;  3ZJV A;  1J7C A;  4ARC A;  1N5X A;  1HXY D;  3VRB B;  1XXG A;  1AW7 A;  4J3O D;  1CQV A;  4JX1 C;  4YT0 B;  3V3X A;  4ZRP A;  1I4H A;  4DQO C;  3AE7 B;  3MHZ A;  1FFU A;  3KLS X;  1PDX A;  1ET9 A;  4AQ7 A;  1WGK A;  1VR9 A;  2PVO D;  4ARI A;  1MVK A;  2WDR B;  3ZGZ A;  4H2A A;  2GRI A;  1FMA D;  4IDI A;  2Y5P A;  1NYQ A;  4JWU C;  4KGT A;  1B9R A;  1VZ6 A;  3BVM A;  1DOX A;  3B2F A;  2N7J A;  3HVZ A;  4NZL B;  4YTN B;  3Q8C A;  5T8I A;  2RMM A;  3P1M A;  4AS1 A;  3R2T A;  2WXR A;  2WNM A;  5C2T B;  2KN4 A;  5TSS A;  2J52 A;  3AEC B;  3SEB A;  1DYQ A;  2H89 B;  2QEJ C;  1K50 A;  4OZA A;  5FK9 C;  4WH4 A;  1I4P A;  3DWM A;  4JWS C;  2DYM A;  3W5V B;  1FM0 D;  3TEX A;  5BMH A;  2WXO A;  4RGO S;  3R2I A;  1IUE A;  2IDY A;  3ZJU A;  3LXF A;  1TY0 A;  1HZ6 A;  1B1Z A;  4KKI A;  3SFE B;  4XWW A;  2JSV X;  1XLQ A;  4RF0 A;  3BK1 A;  2CJN A;  1JRP A;  3W5U B;  5HFY A;  4A9A A;  2OED A;  2NTS A;  4JPS A;  5D3D A;  3NVV A;  1XO3 A;  3RPF C;  1T5X D;  2LJI A;  3IT6 B;  2HDE A;  2WS3 B;  5HI1 A;  3ETR A;  1CZP A;  1PGX A;  3URY A;  3V05 A;  1PFD A;  2EEL A;  3TUO A;  3U2S C;  2DLB A;  2V4I B;  4TQ0 A;  2VZK D;  2XNA C;  1CJE A;  3IXS A;  3PO0 A;  3NZ3 A;  1F77 A;  4EE2 A;  2W82 A;  1BUI C;  1QLB B;  4XE0 A;  4MT5 A;  2WXJ A;  2WLB A;  1M4V A;  1OQQ A;  5H8Y E;  2JYT A;  1YMH E;  3NVW A;  1IBX B;  1Q10 A;  1ZE3 D;  2M0A A;  3AEG B;  1SB3 C;  1I7H A;  4C56 C;  2KAJ A;  1JRO A;  2WXL A;  2LGI A;  4NAM A;  1D4B A;  1L0V B;  5LNK 1;  2K9X A;  3VR8 B;  3AE5 B;  1SE3 A;  2J53 A;  5AUK A;  2IGD A;  1AWD A;  2RPV A;  2AQ1 B;  2BT6 A;  1PGB A;  3AH7 A;  1RM6 C;  4RGM A;  1WSP A;  5G5H A;  2L32 A;  2K5P A;  1L0Y B;  2INP E;  3MJ5 A;  1GOZ A;  2LFI A;  2IJ0 A;  3EUB 2;  1QQR A;  2WXP A;  1BML C;  1TS2 A;  4KGR A;  4RFB A;  4C7Z A;  1UNS A;  2QIL A;  2I38 A;  1OQR A;  1F2R I;  4RGT A;  5BYS A;  4DXF A;  1N5W A;  3IT4 B;  1JWU D;  1XCQ L;  3BK2 A;  1QOA A;  1YN4 A;  3E56 A;  1QKZ A;  2FBW B;  3KWV A;  1PYW D;  1N61 A;  2IPK D;  1IGD A;  2WP9 B;  1KTK A;  1XEE A;  3BVZ A;  1YNT E;  3BYT B;  3EA6 A;  3I57 A;  1EU3 A;  1KH0 A;  2E3T A;  1V1P A;  4NAW B;  2GI9 A;  1FD6 A;  1KRH A;  3J9C A;  1Y56 A;  1EM7 A;  1I4X A;  2PTL A;  4ZRQ A;  3AEB B;  4WIP A;  1TYG B;  1FCC C;  3IAS 1;  1FNV A;  1TY2 A;  2RDG A;  4OVZ A;  2JWU A;  3TEY A;  3R8B A;  1SBB B;  2JYE A;  1MPE A;  4D2K A;  3FIL B;  2LUM A;  2TSS A;  1HZ5 A;  3NS1 A;  1NEN B;  2MEK A;  3ABV B;  2Y5C A;  1P7E A;  3BYY B;  2BB6 A;  2ZW1 A;  4ZOH C;  1K51 A;  2WXQ A;  3SR6 A;  3Q69 A;  1V97 A;  1VDV A;  3TEZ A;  1DOI A;  5H92 C;  2HTM E;  1HQR D;  1UGJ A;  2BS2 B;  1XLN A;  2FE8 A;  2FUG 1;  2MH7 A;  2X38 A;  3P4P B;  1IGC A;  3UI3 A;  1QT9 A;  3P42 A;  1F0Z A;  2DWQ A;  1L4D B;  1FEH A;  1DGJ A;  3AV8 A;  1WYG A;  1UWM A;  2ONQ A;  1SE2 A;  4NJC A;  2G1E A;  1ZXH A;  2AX5 A;  1EU4 A;  1TS5 A;  2AQ3 B;  1TS4 A;  1N63 A;  2W54 A;  3T3O A;  4N6E B;  4A90 A;  2N9K A;  3NRZ A;  4YSZ B;  3AE1 B;  5EE1 A;  5I4D A;  1NEK B;  1MHX A;  1FO4 A;  2Z8L A;  2Q5W D;  1T6B X;  2JXT A;  2ON8 A;  1D5M C;  1FNU A;  5HHD G;  3BWU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...