3B9JA

Structure of xanthine oxidase with 2-hydroxy-6-methylpurine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
ADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xanthine oxidase
publication title Substrate orientation in xanthine oxidase: crystal structure of enzyme in reaction with 2-hydroxy-6-methylpurine.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 162
sequence length 162
chains with identical sequence I
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2007-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3b9jA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b9jA01
1NEKB 2M19A 2Y5CA 1JALA 2Q5WD 2AX5A 1EWYC 1NVID 3AE6B 3NVWA 1QOGA 1WGKA 2MJ3A 3ETRA 2PIAA 4N6EB 3AE4B 3AECB 1JWAD 3NVYA 4IDIA 1NYQA 2WU5B 3AEBB 1RFKA 3AE3B 2PVGC 4N59A 1A70A 1XLNA 3CWIA 2K9XA 4ZHPA 1YQ3B 3LXFA 1KF6B 2ACZB 2KMMA 2MJDA 2KAJA 1QLBB 1SF0A 1YJIA 3AE1B 5G5GA 1J7CA 4USAA 2WDQB 4HRSA 3ZYYX 1TKGA 2MJEA 1FM0D 1OQRA 1OQQA 1L6UA 4C7ZA 2CU3A 1VJKA 3AE7B 1J7BA 1FXAA 1L0VB 1NI3A 2CJNA 2M56B 3AE5B 4YSZB 3P4SB 5MPOA 1RM6C 3P1MA 3AE9B 1SIJA 1PFDA 1N62A 3AN1A 1WXQA 1JQ4A 2JQRB 5AUIA 4JX1C 1WYGA 1DOXA 4ZOHC 1GAQB 3NVVA 1DOIA 1XLOA 3ABVB 3AE2B 1J7AA 3HVZA 5EE0A 5C3JB 4YXDB 4YSXB 3VR9B 2B76B 5H92C 1VLBA 1NYRA 2K5PA 1XLQA 3VRAB 1ZP0B 2MH7A 1JW9D 4HROA 4YT0B 5GXGB 1VDVA 1JROA 2W3RA 3AH7A 3AEFB 4C7YA 1N5WA 2CJOA 3AEEB 1R7SA 1FFVA 1N60A 1FRDA 3P4PB 5EE1A 5G5HA 4C80A 2WS3B 3BIID 3NS1A 3L4PA 3CIRB 1YJJA 1QOAA 2BT6A 1QOBA 2DBYA 2QIEB 2WDVB 2LEKA 1QF6A 2OHFA 1ZXIA 2E3TA 1CZPA 1E7PB 1E9MA 4YTPB 5EE3A 2W3SA 1YQ4B 3DWGC 1T3QA 1E6EB 1ZOYB 1N63A 2QJLA 5H8YE 1FFUA 2H88B 3P63A 2L83A 2H89B 4YSYB 3W5UB 1TKEA 1IUEA 4FXCA 1SB3C 3W9CB 1NENB 1GPXA 1E10A 1JWBD 1QOFA 1E0ZA 2JX5A 2BS4B 3W5VB 4KX6B 1RWSA 3LB8C 2WLBA 3AEDB 3DWMA 4ITKA 2HTME 3P4RB 2L52A 3KWLA 2PVOD 1V97A 4US9A 3P4QB 1RYJA 3FAHA 2FBWB 4A9AA 1KRHA 3RPFC 3HRDD 4YTNB 4P6VF 2W54A 5AUKA 1FMAD 3SR6A 1I7HA 2BS3B 3WCQA 1PUTA 3AMZA 3VR8B 1JRPA 1N61A 1CJEA 2BS2B 3AEAB 1AYFA 1L5PA 1TKYA 1V8CA 1QT9A 1WRIA 3AE8B 3HUIA 3SFDB 3PO0A 3NRZA 3B2FA 1FXIA 3FC4A 3VRBB 1B9RA 2PKOA 4N58A 5EE9A 3B9JA 1L6VA 1WWTA 1XO3A 4JWSC 4LTUA 1TJEA 3AEGB 2DWQA 1OFFA 2N0SB 1AWDA 1DOYA 1PDXA 1FRRA 3NVZA 1F0ZA 2WQYB 1KFYB 2EKIA 1XLPA 5C2TB 4ZHOA 4WQMA 1TYGB 1FO4A 2WDRB 2K22A 3SFEB 3AV8A 1ROEA 1ZUD2 3EUB2 2G1EA 4YTMB 3AM9A 3AB5A 4JWUC 1UWMA 3B2GA 1N5XA 4US8A 1DGJA 4WWMA 2WP9B 1FIQA 2W55A 2WU2B
chains in the Genus database with same CATH superfamily
1BNOA 1NEKB 2B21A 2W9MA 4S17A 3UIOB 1SE3A 1PK1B 2JF5A 3ETRA 1L4ZB 4ECSA 2D3DA 5CTRC 2MBBB 4DL3A 3MR2A 3TAPA 1BUIC 2D07B 4GFJA 2YEPF 2W03A 2IOHA 5HHHA 2XK5B 3RNGC 2KD1A 3IG3A 1MI0A 2LYAA 3AU4A 3AE7B 3RD2A 4UASA 4F5NA 4J9KA 1Q0WB 3ZQ4A 5J2DA 2WHEA 4ECWA 2F2AB 2JRIB 2HHTA 2GMIC 4UB3A 2JQRB 3V60A 2BPGA 2FCQA 3QXGA 3GB1A 2PLPA 4JX1C 3PNCA 3PS6A 4DHZE 1SJHD 3O0FA 1H38A 3AE2B 3PSTA 1SGHA 2IY1B 5EWEA 5DCNA 5KFZA 2WAQF 3VRAB 1C4CA 4DSEA 8ICVA 2P35A 3J81j 3L0WB 3PRZA 3C1ZA 4J9LA 2HJ1A 5D3IB 2G5HB 2CJOA 4WURA 1VZ6A 4MFCA 4MEMA 1U9LA 2PMVA 2D3BA 1WYWB 1RPLA 1LQBA 4O9MA 1ZKHA 3B0XA 4WWOA 3PX4A 1E8ZA 1T4GA 5HMMA 1HUOA 2O2VA 1T3QA 4PHDA 2QJLA 3OPXA 5KFKA 2KJ6A 2H88B 4YSYB 5CHVC 1SXDA 3FDSA 1TKEA 1N56A 2VH1A 3KUZA 4TKNA 3H6NA 1SKWA 3NHEB 4KLFA 8ICAA 3NUHB 3RULA 3JPOA 3WK4A 8ICFA 2ZCCA 4W9EA 9ICRA 2NBWB 1X40A 4LDTB 4DEZA 4BFRA 5J0TA 1V6EA 2RDJA 3F2BA 2IPKD 2UVRA 2JT4B 3HRDD 4IOIE 4FBUA 4OW0A 4F71A 4ACOA 2W9CA 1YZ6A 2UYZB 4R8UB 1XS9D 3KHGA 1FXTB 4Z6CA 4DFKA 3GP7A 4KDIC 5LXIB 1ZDXA 4PK1A 1HEZE 1SZPA 4QAYA 2E8OA 8ICPA 4EELA 2HCFA 2KTRA 3A0BU 4ANXA 4RQ0A 1PDXA 4Z6EA 7ICLA 3MR5A 3GV8B 4W9HA 2N4FA 4E71A 2JEFA 2K22A 4PYUA 3UQBA 4I6LB 1PGBA 4OHJA 3BWUD 3OAWA 2LYBA 1FNWA 2FLNA 2R8JA 2WP9B 2JV3A 2ISOA 5E6NA 3I28A 1JWMD 1JALA 4DOBA 2Z0EB 3FYHA 9ICUA 3ONNA 1L8LA 3PZ7A 1YN4A 5IILA 2GI9A 4KMUA 3BJYA 1KSPA 1KRPA 2NO5A 4RQ6A 2MJDA 3N1XC 2LHDA 3B1LX 3SYZA 1SF0A 3IT4B 3QU4A 3W1YA 4CE6A 1WRDB 8ICQA 4W9LA 1CK1A 3RTVA 1RQNA 3NY5A 2R18A 2ZG6A 3ZO5B 2BCVA 4KLIA 2QB1A 2ASDA 1PQSA 3E9SA 4W9CA 5C0YA 3SI8A 4ED8A 2KJRA 3UQ0A 5J8YC 4DOAA 2G07A 3BQ1A 4CYEA 1FNUA 1WYGA 4HPPA 4ANWA 1ET9A 4F4XA 2I1QA 4I2GA 1NI2A 3M9NB 2DZIA 1XXGA 4G50A 1C78A 3M7DA 1X9WA 3NOBA 4RU9A 2FMPA 3ZD9A 1P7FA 1ZP0B 2HHWA 4JV0A 4M2YA 3VQIA 4UW9A 2PPHA 4XA5A 1JROA 4A3PA 4C7YA 2WXMA 1SBBB 3RNCC 4BVUC 4KTQA 2ZIWA 4CF3A 3Q69A 2DAFA 2KZ3A 4MEYA 4DFPA 3R9KA 3L4PA 3OWEB 2DENB 2LUMA 2KFKB 2D5GA 2VJ5A 5T8IA 5HHIA 2HDOA 3GDXA 3N28A 3H9DA 1DK3A 4UBBA 4O3MA 4XGAB 1GC7A 5J2GA 3QCAA 1YQ4B 4WJQA 3ZDDA 3P63A 2OH2A 1D8BA 3JPRA 3AU2A 2KVRA 4F4ZA 2DX5B 2W9NA 3MBYA 1NJZA 2JXXA 4C56C 1UCVA 5KHQA 4UB8U 4P4MA 2DPIA 3IBEA 2JX5A 4F72A 2JUOA 1IXRA 1B22A 3P4RB 2BGFA 4K4IA 4BOZB 4TQRA 4I2DA 5HHDG 1V97A 4DF4A 4I2IA 1Z1BA 4F4WA 3FAHA 2I9GA 5IP4D 2OWOA 1HXYD 1VZ8A 1Z4NA 4A6QA 4WAAA 2HDEA 2XO7A 2AH5A 4RQ8A 1WZ3A 5E6JA 5AKEA 2IO1B 5HFYA 1DYQA 3RI7C 4NLBA 1L5PA 1P98A 3SMVA 4TV3A 4A55A 2GBJA 2VA2A 3QU7A 2MEKA 4K7SA 4OZCA 2NPTA 2WNMA 4KIKB 5KG1A 3V72A 3GIMA 2KZZA 1KEJA 1TJEA 2N0SB 2WF6A 4MSQB 3MFIA 2KTQA 4NL9A 1WF9A 3BS7A 1HZ5A 3T3FA 3ALRA 4NLCA 5D4BA 1C4AA 2QLTA 4O3NA 4C8NA 5ALLA 2UU7A 4IM2A 3I5JC 2KC1A 1S0VA 2DKXA 5KG4A 1EWYC 1WGKA 2AU0A 2YY6A 4LJOB 2LVOA 4RNOA 2GRIA 2IBKA 1SZHA 5L1IA 4JB3A 4GU2A 2LYHA 4MJSA 2P66A 3TUOA 4DLGA 3RNAC 1BPBA 1FCCC 1ZRNA 2WB1F 3DBHB 4MELA 4DHJB 2G0AA 3RCZA 4C7ZA 5TR5A 1FXAA 1K51A 5AM5A 5BOMA 4RNNA 2HVIA 1D5XC 2G09A 1S0OA 4M0AA 4WWNA 2YN4A 1EU3A 5CWRA 1EO6A 5J2CA 2UVUA 3ABVB 3V6HA 1J7AA 4FHKA 5C3JB 5ALZA 4L23A 3K4GA 3KZXA 3RYTA 3V62A 4ANVA 2WXQA 4ASWC 9ICKA 2YLMA 4R64A 1P7EA 1Q46A 3PW2A 2G5IB 1E7UA 2KD0A 3MJ5A 4II3B 2GOWA 3AEEB 4NJ6A 1EWCA 4RCOA 2GO7A 4J9QA 3TANA 8ICLA 4CQNA 4ED7A 4FJYA 3TQ1A 3ONSA 4DO9A 1NZPA 1COKA 2KZRA 1D5MC 4RGMA 2YB4A 3UGBB 1B4FA 1QOAA 4QZEA 3JYUA 3TADA 3M63B 1CZPA 2ZNVB 2W3SA 1M94A 4LJXA 4UB1A 2AGPA 1ZQRA 2NYVA 1K52A 5KFEA 3N9YC 2XICA 5C1ZA 1FD6A 1ZQZA 4NQLB 1L2NA 3Q2AC 1COOA 1P1AA 3WANA 1RDFA 1WJNA 1NENB 5HMLA 5AI6A 2XC9A 2BCSA 3ZLZA 3W5VB 3EPGA 5KFGA 2OEHA 2NTTA 1X6JA 4QIWC 2JEJA 2Q4TA 2LGIA 3DPDA 4F4KA 2DPJA 2FBWB 2ISPA 5JHAA 4B9KA 1KRHA 1WMHB 4P6VF 2H5XA 2KIWA 1MFWA 1WM2A 3M3JA 2PFQA 3GZFA 1Z00A 3Q8BA 1V9PA 5ALSA 4KLTA 1M4VA 1KQQA 1MPEA 3ZTCA 3I63C 2WXJA 2KVZA 2SAKA 1C79A 3T5KA 3VCBA 5DBBA 4Y2YA 2ASLA 1SV4A 1C1YB 3NRZA 2DFLA 8ICYA 4O5CA 2FPMA 4YD2A 3I3TB 2Q0ZX 2ICIA 1WZ0A 3JSVB 2BF8B 2GB1A 2SEBD 3URYA 4MFAA 4XE0A 1XLPA 1S0MA 4PYZA 4Q2JA 1HJPA 2JY6A 3DBHI 1S76D 1ZQWA 3EUB2 1J2NA 4YTMB 5J0OA 2N7DA 5KFMA 4WWMA 3TSSA 2JPHA 5AK6A 4YQWA 2REXA 2IO3B 1RXVA 3IHPC 3UQAA 3GIIA 4Q44A 1FEZA 2AX5A 1RZTA 2ZUBA 3NVWA 2ASQA 2MBOA 4W9IA 2F8LA 4BKSA 4CHKA 4M01A 1QTMA 4GIBA 5J2KA 1MN8A 3NJTA 4P0PB 4HEA1 2KYWA 4FZLA 2G9HD 3Q8RB 5BYRA 3PGEA 4KN7A 2HHUA 4HRSA 3SD5A 4MF2A 1L7MA 2R8IA 1PVPA 4O5EA 4NLNA 2CU3A 4Q8EA 5T14A 4NZLB 5G55A 2ZJDA 2K1FA 2VZKB 1ZE3D 1RM6C 1BPEA 2BGWA 1F2RI 5AHXA 3QUTA 4PS3A 3RB6A 1NK5A 5TZVA 3KYDD 4DBGA 4DSFA 2DF4B 3W1SA 1UQVA 3M6KA 4BKTA 3HJEA 5AM4A 3Q8EA 2MUTB 2YMLA 2ZZPB 1Z4OA 1F1HA 2KV2A 2JR5A 2PE6B 4C8KA 4F5PA 1N2XA 2RDIA 2RDHA 3Q8KA 1TY0A 3H7PA 4YXDB 4YXMA 2LVPA 4ECXA 8ICMA 3CW2C 3EW9A 4F92B 4BUGA 4C0ZA 1EF1A 1K8RB 2HHSA 3SHQA 2AQ3B 1JMSA 2WF5A 2FE8A 2Y9TA 2N7EA 4A20A 4IR9A 2RDGA 3TARA 4WJOA 3PREA 1C4PA 4KLUA 2GH1A 9ICLA 2O6VB 3CIRB 2P6UA 3H8WA 2DBYA 2VJ4A 2DLBA 4C4TA 2WDVB 4I2EA 1ZQLA 4P2HA 3DHGC 4M0WA 1ZXIA 3B08A 2OCEA 3FM9A 4YTPB 1TE2A 4II2B 3JPPA 1LGRA 5H8YE 2WFAA 1MQ3A 2KJ5A 1TIFA 2C60A 4FXCA 3Q8QB 1F77A 3Q8AA 1SB3C 3Q3OC 4AP9A 4UB2A 1XNSA 2LM4A 3K75D 4NM2A 2D11A 4JK1A 4YWGG 4RF1A 2KP7A 2A19A 3KUDB 5FR6A 4I27A 3P4QB 2BKFA 5KAFU 4YMOA 4FHJA 4GDLA 2W54A 3H40A 4BBNF 2LJ5A 5E6OA 3A1QB 3WCQA 5DB9A 4RGTA 3PV8A 4TUQA 1S9FA 5JTIA 4KSKC 1SJED 3SZ2A 1URJA 2W82A 1OXJA 4EX6A 2WXNA 1KFDA 4RGNA 2PKOA 2JU6X 5FP0A 2L76A 5KFNA 2VH2A 1IPGA 3PMNA 3QX7A 1P0RA 1WGHA 3AI5A 1AWDA 1BPDA 5AKYA 1F0ZA 4JWNA 2D3AA 4HDQA 4AJWA 2AEHA 4NAWA 4DL4A 1KLGD 9ICJA 3RFAA 4ELTA 2JZ3B 1T0YA 3LYYA 4QIWF 1WSPA 2H3QA 2V9HA 2Y0SC 4DQIA 2JXTA 2M0NA 4UB5A 5GXGB 1IBXA 3PW5A 3RZFA 4IG7B 4LCDE 3RT3B 4GMVA 3I1YA 4C8LA 2JVCA 3AE4B 4EEWA 1WMHA 1SL0A 5KT7A 4U7CA 1L3VA 2K39A 4GLSC 3VUWA 3SQIA 3HIZA 1KF6B 3PV1A 2P6RA 5ALOA 1QLBB 3WU2U 2FAZA 3L08A 1OQQA 1WUDA 1WR1A 4YSZB 4HCPB 1UGJA 2QKQA 4RQ2A 2LFIA 2JHDA 3AE9B 1NOMA 1S1QB 1JXEA 1YT3A 1RG6A 3WAOA 3M6ZA 2GLEA 2R8KA 4ZRIA 4URKA 2WHIA 3RB0A 2MP2B 1WGGA 2KFJA 3ZNGC 4MGZE 3Q3NC 1NYRA 2KG5A 1FPYA 4M9NA 1X66A 4Y2TA 5HI1A 4MT5A 5KFIA 3R2TA 4HROA 2BB5A 2M4NA 2HHXA 2K6DB 4XRHA 2BKRB 4D2KA 2O2VB 3N7PD 3GV5B 5FR3A 2HMXA 3ZIMA 2MW5A 2YQEA 3BIID 3U30A 5D2MB 1QOBA 3AU6A 5D46A 3C2KA 1QF6A 4XUSA 5J2AA 2NBUA 1T6BX 2RR9A 5J29A 2N9KA 5ALXA 2DYBA 2KMCA 2KDBA 3DWGC 1QILA 2DKZA 4F3OA 1WGDA 2L83A 1E8YA 2CN1A 4KZ0A 3IG8A 4TUUA 1WFYA 1B43A 5ALIA 3WIMA 5IIOA 3GV7B 5CEHA 2W9CB 1QOFA 1JWUD 4KX6B 3Q14C 4KN4A 4LNKA 1ZD2P 1WXAA 2WX0A 7ICKA 4HLEA 5B66U 3WK5A 5GMVA 8ICJA 4I2JA 1WWVA 4ELVA 5D94A 3TIXA 2KTRB 3TMPB 1B0XA 3KKAA 1X6IA 2G4DB 4KLLA 1ENFA 1KOTA 2CR5A 2IDYA 4NV0A 1N6ZA 1N61A 1X2IA 5KFAA 2RPVA 2RMMA 5J0WA 3H1UA 3HUIA 1GB1A 1QT9A 1Q3UA 5L1LA 2EMTA 4ACFA 2KNBA 4N58A 1XEEA 3WK7A 3DQVA 1V2YA 3DOWA 1V1OA 3KYCD 3VTWA 3KLSX 4CRXA 1PUZA 2G06A 3QEAZ 4FJVB 3PW7A 1EU4A 1MC8A 2CRXA 1L0YB 3C0RB 3EFCA 1TK5A 3EC8A 1SKRA 1CEZA 4F5OA 2G1EA 3SEIA 2ZIXA 2IJ0A 3GILA 2ZW1A 1MG4A 4RQ4A 2ONQA 3V7KA 5J8YA 5IO9A 2KK8A 2G45B 4RM9A 1Z1VA 1CQVA 2C28A 1NVID 4J9RA 1KDHA 1QOGA 2MRPA 5KFBA 4AWJA 1ZQHA 3KD3A 4KLHA 4OZBA 1NYQA 2K60A 2KT7A 3H8SA 4E3CA 2PVGC 4WJPA 3SU8X 3LVVA 3ML8A 2GBNA 4AS1A 2ZXHA 2C22A 3PHWB 3QYPA 2A3VA 1J7BA 3H0LB 3H8MA 2BQRA 2LHTA 4UAVA 2KKPA 2FI1A 3HKZC 4FE3A 3RAQA 1GOZA 3PSFA 3PVXA 2WXFA 5AI0A 4M02A 2LXAA 3EZ5A 1ZQNA 3V7JA 3PVLA 3QWZB 5AI5A 3LJ3A 4Q45A 4WIPA 4ZOHC 5J2EA 3MDCA 3J9CA 3TEXA 2ZIWB 3VFKA 4C4VA 4Z6DA 5BMHA 2LHEA 2XNAC 2B76B 4OZAA 3ISDA 4M9GA 2ZCBA 7ICVA 2WDTB 4RZRA 1TVAA 1NK6A 3SENA 3QU9A 4IQVA 4TQSA 3C28A 1E7VA 3SV4A 1IGDA 1U48A 5DPSA 5AZHA 1R7SA 4P1BC 3V6JA 3JVZX 3TBLD 1LVHA 3PT2B 1X9MA 8ICNA 2VA8A 9ICTA 2JSVX 1WJ4A 5ALGA 1OUQA 1DXSA 2E6XA 2KX0A 1BGXT 4O5KA 1D4BA 2K25A 2EANA 4AUQC 2J0MA 2VIXA 2INDC 2A4ZA 3RH4A 3DBLB 1L3TA 1E8XA 2JH1A 1QSSA 2AQ4A 5L1JA 1GPXA 1E10A 4M9HA 2QHOA 4PGYA 3ZDTA 2L05A 1L4DB 2BS4B 1AROP 3AQEA 4AYBF 2M9NA 1FNVA 2JWUA 2L52A 3ZXVA 2K3UA 2MP2A 2BYFA 4H2AA 3A4SC 5DPRA 3BINA 4TQ0A 2N1VA 3F5AA 2NPTB 3ZD8A 4S0RA 5AUKA 1KFTA 1UELA 1UT8A 1OTRB 5ALPA 1L3SA 2DNFA 2VZKD 1D8LA 5AI9A 1SEBD 1NJWA 3TI0A 1L7OA 4I2HA 1JMLA 1Q3VA 2ZPNA 1Q1OA 2H3FA 4ECUA 2WX1A 4GDKA 2K8HA 5JH5C 2BR0A 1XO3A 4DLEA 3N32A 1KBUA 4B9TA 4LTUA 4HKQA 1DOYA 1XWLA 1U4AA 1J2MA 1MG8A 1QH9A 4R63A 1CRXA 4BAXA 4AQ7A 1ZJMA 2M1MA 3LK9A 4IRDA 1UD7A 4J9NA 4EYIB 3TEYA 1ROEA 2J0JA 2L1AA 1ZQXA 1D8YA 4JWUC 3PSEB 2RPQA 1S5LU 3VUXA 1L7NA 4MJSB 2Y5CA 2KN7A 1UGMA 1FCLA 1NZBA 2KNJA 1L8OA 2MSNA 4IDIA 4QZBA 3D2QA 1V5OA 4C8OA 2HOQA 3BYYB 3SAFA 3AE3B 2QDFA 3RMKC 4HVBA 1SXEA 1KL9A 1MVKA 4PPXA 2K9XA 4RMAA 3RJJA 5ALJA 9ICAA 1NK0A 1I4RA 1YMHE 5J0UA 4IQWA 3TEWA 4BDPA 5DG8A 1YJ1A 4F93B 2BZFA 4IQUA 1S10A 2PW9A 3V3XA 8ICSA 2EKEC 5MPOA 3P1MA 1D3ZA 4PZNA 4NY0A 9ICHA 3RJHA 5JUMA 3AN1A 2CKHB 2KIVA 4QJFB 5AUIA 2KICA 4KLSA 4ARIA 1GAQB 2FLPA 5KG0A 2IGGA 4CF5A 1NJYA 2F8KA 2KHVA 3KFUF 1ZJNA 2I6XA 2BCQA 7ICOA 4WWPA 4ZRPA 2K5PA 2W7OA 3KVFB 2BVCA 4ZRKA 1AQ6A 2MH7A 3DBLI 4NWIA 3BK2A 3IHQB 3IDWA 2GBMA 4M00A 2V4QA 2ZUDA 3QU2A 1T8EA 3APCA 4IC9A 4I28A 3AH7A 4I29A 2W04A 1ZETA 2D10A 4BXOA 3DDCB 4JV1A 3AEVA 4A3OA 1PGXA 1WJ6A 3P4PB 4QNLA 4HAIA 2FE9A 5J0YA 9ICVA 2R2QA 2YEPB 2ZJAA 3MFGA 5D7GA 2YMMA 2LEKA 2IOFK 2ON8A 3APDA 2W8LA 4RH6A 2OHFA 5FK9C 1ZD3A 4LNIA 1UHUA 2JMGA 3BDPA 1NJXA 5KL8B 5J0SA 3DVNV 1ZQMA 4PGXA 4KVGB 1UT5A 4KLQA 5KFPA 3JW0X 4LNNA 2IZVB 2V4IB 4FN2A 3BZKA 5KFQA 4UAZA 1YX6B 2NBVB 2ZVOA 4P1CC 7ICPA 4RFBA 2J6SA 1Z00B 1EXNA 4M6WA 3LWMA 3D32A 5CX3A 4UAYA 5HR7A 2K8BA 4KDLB 1G6JA 2KACA 3PZPA 3N1YC 1ZQIA 1I42A 4GC6A 1D5ZC 3R66C 7ICQA 1FMAD 3NZSA 2BTEA 4DSJA 2LASA 2EZYA 1PUTA 4XWWA 5KFFA 2MAXA 4JV2A 1DGSA 1ED1A 3AEAB 3H8HA 1OGWA 4I2BA 3AE8B 3IT6B 9ICOA 1UBQA 2BDUA 2HVHA 4F1SA 5KT2A 4JGHB 3T5JA 1WWTA 2MSED 5C23A 4Z6FA 4PJ0U 5KFHA 4IM0A 2FNJB 1WXSA 4M8NA 5KT3A 5BPCA 1Z5SB 2V3SA 2WQYB 2MHJA 3RUIB 4F4YA 4I2FA 1ZUD2 5AI4A 3T5HA 4J9SA 1PVQA 1GJZA 1ZQFA 1N5XA 2IMWP 4QZFA 3OJ4B 3PMLA 4O3SA 4DF8A 1WGYA 2NRWA 2PJHA 4RNAA 2M19A 3HT3A 9ICWA 5K4LA 3KTQA 1YN5A 2UVVA 1L6NA 1TKDA 3QHTA 3Q8CA 1K53A 2PIAA 2XN9C 1QLNA 2FCMA 2R2OA 4BWMA 2KFZA 3F2CA 5DQIA 1V1PA 1QQ5A 3RNFC 4B9SA 2NTSA 4C8MA 3AEBB 3RAXA 3U4EG 3EYZA 2JEIA 2KFNA 8ICRA 4N9F4 2ZTEA 4O3PA 2XGPA 2C2EA 1XO0A 1KKXA 3K9PB 3RRGA 4LK0M 2KMMA 1E90A 1ZOLA 2KOXA 2A1AA 4EYHB 3F5EA 1U45A 2C5LC 2RD0A 3Q6BA 3MC0B 3UMCA 1VJ5A 1KLNA 1LM8B 2NRTA 1JI7A 3MGHA 2Y1IA 1Y56A 1L0VB 3IFWB 4PL2A 3H7PB 5ALQA 1H8CA 4BKGA 1HQRD 9ICMA 3C5GA 1BPZA 2DYOA 4HDOA 2UWQA 3WKDA 2I38A 2JYTA 2B3AA 1D6EC 3PZ8A 3H4DA 2ZIUA 4J3OD 3NVVA 3UMBA 1HA5A 2EAOA 4ZH4A 2KVCA 1V5TA 1NDDA 4HCNB 3DEEA 2RQ5A 5KG5A 1V38A 4XDDA 2WXHA 2WYQA 1SWVA 3N7RC 4ELUA 1JW9D 3VVWB 3OTQA 2BYTA 2W3RA 4M0WB 2QSDA 5BMGA 3AEFB 2HW3A 1FFVA 2KWCA 4K4GA 2FJ6A 3IV6A 3MP9A 3QC8B 4G0NB 2KLCA 4KLEA 2MWSB 2J6UA 3ED5A 1R4MB 1WY8A 2RGFA 4NY8A 4KLOA 4GXBA 2WGSA 4C00A 1DOQA 4B9LA 4B9UA 5EWFA 1E6EB 3RH5A 2BB6A 2YTUA 2HSZA 2H89B 4KX3A 2Z59B 2KLGA 1V85A 1NKCA 4IRCA 3IVFA 2FMQA 3RJGA 4I2AA 1PK3A 4CDGA 4GDLB 4B9NA 1EM7A 4Y2RA 4KLGA 2QCZA 5G2NA 2KN4A 2C9WB 2WLBA 3THVA 4Y2XA 2AJQA 1R4NB 5BYQA 3KBBA 4WJNA 1TAMA 2PMZC 5KFXA 2DQNB 1L5UA 3MR6A 3C1YA 2FPKA 3A9JA 1P7DA 4NAWB 1TKYA 4A90A 3DDHA 4XYCA 3QU5A 4FBTA 3X23A 1V81A 2KWUB 1XF5L 3IRUA 1VZ7A 2V9WA 1UNSA 2KWVB 2OEDA 2DWQA 3NRWA 1LKYA 4F8RA 1FRRA 1F52A 1UH6A 2HE7A 4TMAB 1IBXB 4A8EA 4B9MA 8ICUA 3ISBA 1TAQA 2M17A 3CNHA 1L7YA 5D6JB 9ICEA 4TUPA 1L0XB 4CF4A 4US8A 3APFA 1ZW7A 3AL0B 2KWDA 4NJCA 4CCHA 2LJIA 4PHEA 1VRAB 4DQPA 5KTQA 4O0IA 1IIPA 2HTHA 1SV0C 4PGQA 2KJHB 3LVWA 2W9BA 3AECB 3M1YA 4FZMA 5DQHA 4G11A 3QA8A 2JRZA 4NM1A 1T0QC 1ZRMA 1NKBA 1GNUA 4DCCA 2EQYA 4DL6A 2KAJA 5C5JA 3IN5A 3H8JA 1B1ZA 5J0PA 2AYOB 3PX0A 2F77X 4HJGE 3Q3MC 5KFCA 1Z3EB 3E58A 3E56A 2IO0B 1SIJA 2NV3A 4IW0A 3MHZA 1RQLA 1V49A 3V05A 4DL7A 3AUOA 1R4MI 3OJUA 5KAIU 5CR0A 3C8YA 3TJPA 2NRXA 4RM8A 3RR7A 8ICGA 4J9PA 2KXJA 2ZIVB 1AARA 2ESEA 2N7JA 4B9VA 2HBJA 4F5RA 3RB4A 3D6JA 3PO4A 1XLQA 5BO4B 8ICHA 3HX0A 4EENA 3R7RA 3ENEA 4ED3A 3NASA 4KKJA 3MHSD 2D2QA 4KLJA 2WF9A 1DRGA 1GUAB 4NJ7A 3T5LA 2BCUA 4EUTA 2AL3A 5EE1A 3Q8LA 2K8CA 4W9DA 2WS3B 4G3XB 4K7WA 4DL2A 4R66A 2WXPA 3CMMB 2ES6A 3PR4A 1R4NI 1A5RA 5AI8A 1WX9A 4B6JA 1F9JA 3MC9A 3LDAA 4LDTD 3L54A 4YCXA 1KJTA 3QUCA 4J6IA 3R8BA 5KT6A 4DFDA 4UARA 3SEBA 5KFUA 2WXLA 4IRKA 3PLUA 3M8RA 3BQ0A 4O3QA 3MGVA 4NAMA 3O13A 2JXJA 3BVMA 1TAUA 3LB8C 1CI4A 2K4EA 1JXLA 1ZQEA 1ZQTA 2EZXA 1TS4A 5AKXA 5HR6A 3GU3A 1WE6A 2HTME 3PPAA 1STEA 2D3CA 1I35A 4TURA 3ALBA 1J19A 4OJOA 3V7LA 2H3IA 2KKCA 4DS5A 2KMAA 5L95C 1F44A 2W11A 5AKHA 3ZDCA 1K50A 4DDGD 3OSPA 8ICEA 3RH6A 4UBCA 3CSTA 3AXCA 3DVNU 1SL1A 3Q8SB 1NNLA 1QQ7A 2E5SA 2PFPA 1YNTE 1NK9A 2WWZA 5EWGA 4KGTA 2ZIXB 4EZJA 2A1JA 2WXGA 4K7UA 1WM3A 2EAMA 3PHXB 4YVZA 3UXNA 4R65A 4IR1A 4HYKA 5ALYA 2WDRB 4QZCA 3FILA 4ZHOA 2BQ3A 1U4BA 1YD8U 4HXDA 3C2MA 5ALFA 3UINB 2VRRB 1ZQQA 3AQFA 1C7YA 4QZGA 2XY5A 1TZOA 3EA6A 3MC8A 2RRDA 1TY2A 3V6KA 2C2DA 1SIFA 2I1KA 3ZKJC 2BPCA 2IYDB 3NVYA 3GOEA 4LLGM 4ECRA 1AW7A 2QARA 1MA7A 1RFKA 2PE9A 2KDIA 1A70A 3TFSA 1XLNA 2EDUA 4DSIA 4YP3A 4ED0A 1TK0A 2KANA 1VR9A 9ICSA 4YN4A 4FADA 3DCGA 1S0NA 3NGDA 3GIKA 5KL1B 2FIDA 2Y5BB 2LGDA 4IM3A 4C4VB 1VJKA 5D49A 4MH8A 3A4RA 2MRLA 4OJPA 2RP5A 2K89A 2IGHA 5J2FA 3C5FA 3Q3FA 3UXPA 3CYMA 5ALTA 5DB8A 3DV9A 4B6WA 2FUHB 5CHFA 4I2CA 5AKIA 4JL9A 1IM4A 2MU2A 4QWCA 3EECA 1GC6A 3ZI4A 3A0HU 3VR9B 2L0TA 2VANA 1JCKB 3D2NA 3QARA 2R8GA 4J03A 5J2BA 5DLFA 4FJZA 3KWVA 1UPHA 1N60A 1XQQA 4MM3A 4FFDA 3ZJVA 3NS1A 4PS8A 2EAPA 4K3BA 1T94A 2ZTDA 2K0PA 4ZRJA 3DVGX 3QAQA 4E0DA 2L00B 2BHNA 5IIMA 3U7DA 1ZQPA 1T7PA 4BKSD 2FPLA 1PGAA 1QCKA 2JZPA 5BYSA 1WR6E 2RSUA 4EOYA 4TSSA 1PZNA 3IAS1 5AM0A 4MEXA 2C7HA 2HJ8A 4YMMA 3A9KA 3DVGY 4O3RA 5L1KA 2ZTCA 4NLKA 1SL2A 3C29A 3UIPB 4EBEA 3KHRA 1C76A 2MA1A 1TS5A 2DL0A 4ITKA 3RJIA 1T3NA 4UDUC 4B0MA 2ZIVA 3IM1A 5ALRA 8ICXA 1RYJA 3T3OA 2HBMA 2MA9B 4GDKB 4E74A 4W9JA 2I2YA 3QIJA 4F8CB 2F44A 2WAQC 2KZMA 2XEWA 3OSNA 3QNMA 4OVZA 4HPLB 1C77A 2KDEB 4C4SA 1AYFA 1TZ1A 2WF8A 1V8CA 3TKAA 4K1RB 3ZDMC 3SFDB 4O3OA 5GTHU 3B2FA 2ODGA 5EDSA 3B9JA 7ICFA 1L6VA 5JU5A 1AN8A 1SE4A 3NZUA 4EFOA 3DBSA 1ZDVA 2JGAA 5C2TB 4NNJB 2Z7JA 3SV3A 1FO4A 2FUG1 2KQSA 2N1WA 3AB5A 4MGYE 2BW2A 2ZEQA 3VDZA 1QSLA 4DHJD 4WQOB 2J42A 1RYSA 1Z19A 4M9JA 3PSPA 1SE9A 3NZ3A 4XZ4A 5KFYA 3L5KA 4QZHA 2K4IA 2LBOA 3LWLA 3GFKB 2KOBA 3N1ZC 3TAQA 1T0SC 3QUBA 3RNEC 3RBDA 5AKJA 4J9OA 3OJ3A 4LVSA 2N1RA 1ZGUB 1QKZA 1KH0A 1SKSA 1XSPA 1L6UA 4UAWA 5HKHA 1NI3A 3QX1A 1HIWA 3W1SC 2DUYA 8ICOA 2KHWB 3P4SB 3VXWA 3K1ZA 2OJWA 3I76A 3HVDA 3JPSA 9ICPA 1JQ4A 4NLGA 2QB0B 4Y2JA 5KT4A 2X8XX 3ZTDA 1SWWA 4QZDA 2MBQA 4BXOB 2YMPA 4OO1J 5KFTA 3MTNB 4LZGA 1LB2B 3HWTA 1UF0A 4P16A 4DHZB 2N9LA 1T0RC 3S6JA 5H2FU 5B5EU 1WH3A 1LFDA 2EMSA 1UBIA 5CHGA 1J8CA 3KHHA 7ICEA 2W8KA 2QMTA 4KITB 4QW9A 3KH0A 2F1HA 4EBCA 4MFFA 3IAM1 3HPOA 2AQ0A 3KW5B 4DS4A 1P9DU 4QWDA 1KLVA 2K6QA 3L16A 2D8CA 5CJ7A 4UQGA 5DB7A 4LJPB 2DGZA 4M6WB 4XQ8A 2KSOA 3VHTC 2K8BB 1TS2A 5CHWA 2LMRA 3W5UB 1YQBA 1I4XA 5ALWA 2CHWA 2Y0SF 2AGQA 2F3NA 1WX7A 3W9CB 4OVVA 4K81A 4UB6U 4QZAA 4TUSA 4EE2A 2KO3A 4B95A 2YVCA 4KLMA 3RNBC 2NO4A 3C23A 5KFRA 2GBKA 4FULA 2L3ZA 2XGQA 5ALKA 2MBEA 3UF8A 1ZD5A 1SXTA 1IV8A 4JE3B 5ALNA 2LKYA 3SR6A 2QC8A 2BS3B 2BKEA 5AIBA 4RPXA 7ICGA 5DDYA 9ICCA 3PO5A 1F2RC 3MC1A 3SAHA 1CJEA 1S97A 5J2JA 2BCRA 4GXKA 1NBFC 3Q8FA 4YR0A 1SGGA 4K4HA 2WXOA 8ICZA 1ACCA 1QSYA 2I1JA 2ZNVC 3AEGB 1ZQBA 1UWXA 5KFWA 1XO1A 2B0CA 4I6NB 3EHVA 1WIAA 4IWPA 2EKIA 5TISU 4X5VA 1U49A 1V1PB 4KMOB 4HKZE 4P0QA 1I4PA 3B2GA 2KDFB 2BPFA 2CS4A 2ASJA 1WGRA 3VH3B 2BPSA 4XC2A 5CRXA 4KGRA 4L2YA 3GE8C 4F5QA 9ICNA 2HOFA 4N6EB 2HOIA 5DGBA 3BQ7A 4R3DA 4NJ8A 2IHMA 2V4LA 2R61A 4JWMA 5AKZA 2KK0A 3PSIA 3CWIA 2AQ2B 4ZHPA 4F2RA 1YOVB 4CNQA 4K3CA 3ZYYX 1MJDA 3HK0A 2ZIUB 4XDCA 4DSKA 1OQRA 5KG2A 1KTQA 3BS5A 4GB9A 1E8WA 2M56B 3BZCA 3RJFA 2IO2B 4IKGA 2NCNA 4RQNA 3E0FA 2ZJ8A 2CXYA 5GTIU 1N62A 3QK0A 3TL5A 2L0FA 4IWQA 3MR3A 2O6VD 1IGCA 2XI9A 2MX2A 1X9XA 3MABA 2G4SA 2MLBA 2VKQA 5HNKA 2HD5B 3BZDB 2W9AA 5J18A 4QW8A 1Q8KA 1S8OA 3EFUA 2WXRA 4QWAA 3IXSA 5ALDA 1N5WA 2OM6A 4DQQA 2MQJA 4AJYB 5F9LA 3BQ2A 3QE9Y 3DBRB 1CUKA 5A0LA 4C80A 5KG3A 3PLVA 3B0YA 3WKAA 4NLZA 1WG8A 4QZ8A 7ICJA 5J2IA 4IUMB 2WF7A 4U6PA 4ECYA 2WXIA 3S2AA 1RXWA 5J0XA 5EOZA 1ZQOA 3PR5B 8ICBA 3GZNB 2ZVNA 2WB1C 3N20C 1J0GA 3GIJA 3HM3A 3QJZA 2IBIB 2BDPA 2FCNA 1D9DA 2KC2A 5AZFA 4BOSC 5JZEB 1ZQUA 2KJ8A 4Y2VA 3D2SA 4FS2A 2QB0A 3ZDEA 5IOIA 4DWFA 5IN7A 5AK3A 1UUPA 3A9JB 2KJ9A 3VC8A 2QEJC 4EKUA 2KQ4X 2BBCA 4ANUA 2F76X 3KKAC 3MDAA 2TSSA 4YTNB 1FEHA 5J0RA 4CGZA 2DAJA 5J2RA 1Q10A 2LM1A 1I7HA 2VA3A 4EBDA 1ESFA 1LKYB 2E1EA 3VR8B 4J9MA 3R3MA 2LI5A 4RPYA 1L7PA 3RFZB 3VUYA 2L8JA 1WRIA 3HKZF 3IP4B 1SV0A 2PXIA 5HP4A 1TTNA 2GOLA 2NRVA 4AP4C 2JRHA 1B9RA 3LYSA 4AOFA 2EZZA 2ZUCA 2XY7A 3RBEA 3ZW3A 5E79U 2ALZA 8ICKA 4DL5A 3NVZA 2E8PA 4YFKA 3JPTA 9ICQA 1MHHE 3OJSA 4M04A 5KFSA 4DQOC 4Y2UA 1RAXA 3CP8A 2W9BB 3AV8A 3I57A 4PHPA 1KTKA 3V6CB 3ZNID 1YX5B 1ZQSA 3AM9A 1XC9A 5KT5A 1OQYA 4YXJA 3CRXA 5I4DA 2DZKA 5IKCM 4FS1A 1JUDA 1XSLA 2KMDA 3N7SC 2J6TA 3ZRCA 1K1QA 2Q5WD 4F91B 5AKGA 2IY0B 4M8MA 2EH9A 2RDBC 3SD7A 1JWAD 1DK2A 4ECVA 1RFAA 4MGIE 1MHXA 3H7IA 2NR2A 1TGZB 1MQ2A 3M9OB 5DB6A 2ACZB 2C2RA 2NRZA 5G5GA 3N4MB 1J7CA 1PK1A 2WDQB 5LNK1 2MJEA 2INPE 4GXIA 3NTUA 2KX3A 3MFHA 3RRHA 5HG2A 4OJ5A 1WX8A 3DBRI 1J97A 2RLTA 3SAGA 4OJLA 5IIIA 4M47A 5AM3A 2ATLA 2XK5A 1V86A 5J17A 5L83A 4BJQA 2DZMA 3ORYA 4EEYA 2K8CB 1C3TA 3LDZE 5AZGA 3ETLA 1JN3A 4O1NA 3GZNI 2E8MA 4HPMB 5IAAC 3Q3JA 2CHZA 1LV5A 1ZD4A 1VDVA 2Y9UA 2CHXA 2KVSA 5DG9A 3RB3A 2BQUA 2FMSA 1EF5A 1IP9A 2XIDA 8ICWA 1IG6A 3C19A 4WAFA 7ICMA 5G5HA 4FZNA 3OHAA 1RLFA 2K4HA 1WE7A 2PEAA 1VCBA 4FBJB 3ISCA 1YIWA 4LNOA 3WALA 4M9LA 2H3VA 2IGDA 2FDRA 1X42A 2E3TA 4CO7A 4GXJA 3F2DA 1VD2A 3L13A 1QQRA 4PT5A 1FFUA 3QUQA 4BWJA 3K9OB 3UM9A 5KG7A 4RNMA 2GLSA 3OHBA 3RR8A 1UA0A 2FCSA 1JWBD 4ZYNA 3ZUNA 3UQ2A 2LGYA 3GE3C 4EX7A 4GN1A 4A8XC 4QZ9A 1A77A 3GQCA 4OVUA 3ZJUA 2IA6A 1HTOA 3KWLA 4Y2PA 4US9A 3AULA 2XVTA 2JZBB 1MSWD 4Y2SA 2EELA 7ICIA 5CB1A 1V80A 2LUEA 4BGDA 1C20A 1JWSD 2A1JB 4YR3A 4ZDVA 5KFVA 5L1MA 1ECWA 5CP2A 4HWIB 4QWBA 3RN9C 4GOCA 1XT9B 4W9GA 1ZQDA 3U52E 4IQTA 3FILB 2LPEA 1ZQJA 4RT3A 1BNPA 1XD3B 3UMGA 2HHQA 4UATA 3H0RB 5F3XB 3PZDA 5ALVA 1F5SA 1KN5A 2D6FC 2LXCA 4JWSC 4ICUA 4ZYSA 3TACB 3EGRA 4TQ1A 3BQTA 4MH0E 4JQWC 1YN3A 1KFYB 4R8UA 2V1YA 4BZAA 4WQMA 1TYGB 2AL6A 4GIVA 4RPZA 4RQ7A 3A33B 5F9NA 1S77D 4P7IA 3SFEB 2BQQA 3ZGZA 3JPQA 2QARB 3G6YA 1DGJA 3WKBA 1OEYJ 2A5UA 4DXGA 4DXFA 4EEKA 5AEKB 4XWTA 5LXHA 1A76A 2LWPA 4YR2A 2XCAA 2K8AA 3MGIA 3N30A 2JH7A 3VTUA 1EUVB 3WAPA 3MJWA 1A0PA 2KHQA 4N59A 2W43A 4RQ5A 3ZVVA 4RQ1A 7ICUA 3CSFA 3BK1A 3HW8A 1U47A 4G3IA 2KE7A 3H4BA 4USAA 5AIAA 1ZQVA 3Q8PB 1KFSA 1JX4A 4DSLA 1TKGA 4BBNC 5KFJA 2OXOA 5DG7A 8ICTA 2LGXA 3RJEA 2PFNA 3HP6A 2OJRA 4RGOS 1RRBA 3CF6E 1M6YA 1WI0A 4FA6A 2MBHA 2M8SA 2V3NA 3T9LA 5AICA 1DOXA 4OCZA 1CMXB 4LNFA 3T8MA 5DLGA 1XLOA 4QWEA 1UZXB 4ARCA 4YSXB 2XY6A 3QEBZ 3PRMB 4MM3B 5H92C 4YD1A 3O65B 5DDMA 2J7QB 4ICAA 3WK9A 2PTLA 3DHHC 4YT0B 2F1JA 2BWFA 2INCC 4FLHA 3V6EB 1K5OA 4IWOA 1TK8A 1WXMA 4Y2QA 4IC7B 2MCNB 1TFRA 2Y1JA 2BWES 3Q8MA 1A6SA 1YJJA 2BT6A 3N97B 1WCLA 3A9KB 5AKLA 5DBCA 2CPRA 1E7PB 3OLMD 1GB4A 5EE3A 4YG2A 2YMQA 2HHVA 4RUCA 3N3KB 2Y5PA 2LZ6A 1ZQYA 1N63A 1OW5A 5ALUA 3WKCA 1QQ6A 9ICGA 2KFKA 4JIOU 4KSLC 1XCTL 3L17A 1RWSA 2J52A 2QILA 1BMLC 1H4RA 3AEDB 3V61A 2KEYA 1PVRA 3BYTB 2M0AA 1X1MA 8ICCA 4KGSA 1HEKA 4KZCA 2PI4A 3WAMA 5AK4A 1TT5B 2KQ7A 7ICNA 2KTFA 2DYMA 3H0MB 4GLXA 1JRPA 1BPYA 3IG5A 9ICBA 9ICFA 2BS2B 5KFOA 2GBRA 2KKVA 3VRBB 3ZXRA 5DGAA 5AK5A 4ECTA 2ZPYA 2LRWA 4PS7A 3EWAA 1LO5D 1UA1A 1SE2A 1HZ6A 3E2EA 3QQ8B 3WA0A 2AQ1B 4ED6A 2LI6A 4P4OA 3PRPB 5DQGA 1ZQ1C 4EZ9A 2V4RA 3T79A 1V9JA 3GS2A 2AXTU 4KIKA 2K4PA 5AKKA 2BYEA 2X38A 4GGQA 4GSWA 3RJKA 1TS3A 1RYUA 3I9V1 1ZYQA 4JLCA 2MJ3A 4F2SA 4EZKA 4HK2A 3RF9A 4EZLA 2WU5B 1NKEA 2JZBA 1KW4A 2LGSA 3K1RB 4DQSA 2WTFA 1YQ3B 3LXFA 1HE8A 4NL9C 1Y88A 1YJIA 4RF0A 4MF8A 5JRTA 3U2SC 2W7PA 3M8SA 2E8NA 3JPNA 3RZWC 2B6GA 1FM0D 1ZXHA 3R2IA 1ZQGA 3U7ZA 3AE5B 2G08A 2CJNA 3UXOA 1ZPSA 5DPWA 9ICXA 2RHFA 4PH5A 1PFDA 4LZDA 2XBBC 2YX8A 5KNIA 1WXQA 4PZOA 5ALEA 8ICIA 2V0GA 1I4HA 3TFRA 9ICIA 1DOIA 2PMZF 4DDID 1HUZA 2LRUA 3HVZA 3BVZA 4YMNA 2NMQA 4ED1A 3AU5A 3KUCB 5ALMA 2JYEA 1KM7A 1D9FA 4BX9C 4IS7A 3UI3A 4WJ3B 5TSSA 1GO3F 4P4PA 2O6KA 7ICTA 1WXVA 3M62B 2KSOB 3OG5A 4PHAA 4L1BA 3OGUA 3NS8A 4GC7A 1XU4A 2WXKA 4DK5A 1BXTA 5DPTA 3C21A 5FKAC 3C2LA 1E9MA 1N48A 2KN5A 2AGOA 3W2DA 3H7SA 3DHIC 1ZOYB 3TEZA 2N9PC 4KLDA 4W9FA 3ZJTA 7ICRA 4PL1A 1WCNA 2E1FA 5DKWA 1IUEA 3X0WA 4Q43A 2C7NB 4B0EA 3G6XA 2M0XA 1NK4A 3ZRFA 3U8ZA 1NK8A 2J0KA 3VAWA 4KV2A 3PX6A 3UPQA 3QZ7A 5E6PA 4OJ6A 3G6VA 3HILA 5KFDA 2PVOD 1I4GA 4UAUA 1PYWD 3P2BA 2HBLA 3RPFC 4XX5A 5KFLA 3TADC 4FO6A 1TV9A 1NK7A 5J0QA 5BMIA 1O08A 1JRUA 4F50A 4DQRA 2AHOB 3B0AA 1Y8RC 5ALHA 1FXIA 1XSNA 7ICSA 5CA7A 5D3DA 4I6PA 4P0QB 3WK8A 2Y3AA 4ZRQA 2G3QB 1OFFA 3L10B 1ISNA 2Z0DB 5KHOA 4ICVA 4MDKE 2JZZA 4DFMA 2YB1A 5BOLA 4DXAB 3U26A 2JWZA 2N9XA 5LLIA 3HHMA 4G9BA 1WWUA 1E5WA 2CU1A 3T3NA 2FIFA 1Z2MA 1IYFA 3PTFC 3JSVA 2WU2B 4YL8A 4RQMA 4MSMB 5IA7A 2IOFA 1X9SA 4KKIA 3PY8A 2DZJA 3WKEA 4DFJA 3AE6B 3NG0A 2NVUI 2PKEA 4F7ZA 2J53A 4AYBC 5L9XA 3BS5B 4JUZA 2XCPA 5J2HA 1SSNA 3M95A 1QZEA 1O03A 3PW4A 2L7RA 2OOBB 3F53A 1ZQAA 4Q8FA 4REZA 5IIJA 4RUAA 3AE1B 4ECQA 2I5HA 4RT2A 4WH4A 3WK6A 1YZ7A 1JIHA 1ZQCA 2L32A 4C4RA 3ZDAA 3TCAA 1T5XD 4P0PA 4NPNA 1Q5WB 2OYYA 5JHBA 2GWSA 3KZIU 1BVSA 5IINA 1XCQL 2D3GA 5EE0A 4DWIA 4MHVA 1VLBA 4OD0A 4ED2A 2JEGA 5AM2A 4RQ3A 2BYVE 2V3PA 2MUTA 5KG6A 1WJUA 1HTQA 3HM6X 4QZIA 1FRDA 2UVWA 2HBKA 4UB4A 2QIEB 4MGKE 3SDLC 5IIKA 1ET6A 1P3QU 4W9KA 3P42A 2NS5A 3NUQA 4X57B 1OEYA 1F0MA 2ZXIA 3R7QA 3QZ8A 2DHZA 2O6VA 3BVGA 2PI5A 3ICXA 2J4XA 3EPIA 2L5YA 2IHNA 3ZNHB 1E0ZA 5DBAA 2F1IA 4JMUA 3DWMA 2Z8LA 1BT0A 5JXVA 2LMCA 4ECZA 1L3UA 4A9AA 4EZ6A 4MACA 1RYRA 1BPXA 3BY4B 2ZJ5A 2KDMA 2LD9A 3KQ4A 3KOOA 2AWTA 3AMZA 3L3FX 1ZQKA 4DOCA 3ML9A 1TBEA 3PO0A 2PFOA 1K1SA 3FC4A 2LVQA 2R8HA 3VH4B 2H3ZA 5EE9A 7ICHA 1S3SG 2N9EB 3FKYA 4NQKE 3KHLA 3A1QA 1I4QA 3ECIA 4JPSA 4HJKA 3PW0A 2C7MB 4KX5A 1KLUD 1C9FA 3ZDBA 2FLLA 3ZNZB 2ZW0A 4IL6U 5AM1A 1LXDA 3VTVA 2HI0A 2INNE 1UWMA 1FIQA 1GG3A 4NXZA 2W55A 3M9MB
chains in the Genus database with same CATH topology
1NEKB 1VRAB 2JXTA 2Q5WD 1IBXA 1SE3A 3ETRA 1L4ZB 3AE4B 3AECB 1JWAD 1MHXA 4GLSC 2YEPF 1BUIC 1KF6B 2ACZB 2KAJA 1QLBB 5G5GA 1J7CA 2WDQB 5LNK1 1B1ZA 2MJEA 2INPE 1MI0A 1OQQA 4HJGE 3AE7B 5HG2A 4YSZB 1UGJA 3E56A 3ZQ4A 2LFIA 3AE9B 1SIJA 3MHZA 2JQRB 3V05A 3GB1A 4JX1C 2PLPA 3C8YA 1SJHD 3AE2B 2N7JA 1NYRA 4O1NA 1XLQA 3VRAB 1C4CA 5HI1A 4MT5A 3R2TA 4HROA 2BB5A 1VDVA 4KKJA 5D3IB 2CJOA 4D2KA 4WURA 1VZ6A 5FR3A 4WAFA 5EE1A 5G5HA 2WS3B 2PMVA 3BIID 2WXPA 1QOBA 1QF6A 2IGDA 1T6BX 2E3TA 2N9KA 1QQRA 3DWGC 1QILA 1T3QA 2QJLA 4PT5A 1FFUA 2H88B 3R8BA 2L83A 4YSYB 1TKEA 3SEBA 2WXLA 1JWBD 3NUHB 4NAMA 1QOFA 3O13A 4A8XC 1JWUD 3BVMA 4KX6B 3LB8C 1TS4A 2HTME 3ZJUA 3KWLA 4US9A 1STEA 2IPKD 2EELA 4OW0A 3HRDD 4IOIE 1JWSD 1ENFA 1K50A 2IDYA 1N61A 2RPVA 2RMMA 3HUIA 3U52E 1GB1A 1QT9A 3FILB 3GP7A 1ZDXA 1HEZE 4N58A 1YNTE 1XEEA 4KGTA 4JWSC 4ZYSA 2WXGA 1V1OA 1PDXA 3KLSX 3EGRA 4TQ1A 1YN3A 1KFYB 1EU4A 4ZHOA 4WQMA 1TYGB 2WDRB 1L0YB 3FILA 2K22A 3ZGZA 3SFEB 1PGBA 4OHJA 2G1EA 3BWUD 1FNWA 2IJ0A 1DGJA 3EA6A 1TZOA 2WP9B 2ZW1A 2ONQA 1TY2A 1JWMD 1JALA 4DXGA 1CQVA 1NVID 1QOGA 4DXFA 4XWTA 3NVYA 4OZBA 4LLGM 1AW7A 1NYQA 3PZ7A 1RFKA 2PVGC 1YN4A 4N59A 1A70A 1XLNA 2GI9A 3BK1A 2MJDA 2LHDA 3IT4B 1SF0A 4AS1A 1VR9A 4USAA 1TKGA 1CK1A 1VJKA 1J7BA 3E9SA 4MH8A 4RGOS 2IGHA 2WXFA 1GOZA 1FNUA 2V3NA 4WIPA 1WYGA 1DOXA 4ZOHC 1ET9A 3J9CA 3TEXA 1XLOA 4ARCA 1XXGA 1C78A 5BMHA 4YSXB 2LHEA 2XNAC 2B76B 4MM3B 5H92C 4OZAA 3VR9B 1P7FA 1JCKB 1ZP0B 2PTLA 4YT0B 3VQIA 1JROA 1IGDA 4C7YA 2WXMA 1SBBB 1R7SA 3KWVA 3Q69A 1N60A 3ZJVA 3NS1A 3L4PA 1YJJA 3OWEB 2BT6A 2K0PA 2LUMA 2JSVX 2D5GA 5T8IA 2E6XA 1E7PB 1GB4A 1D4BA 5EE3A 1YQ4B 2Y5PA 5BYSA 1PGAA 2JZPA 1N63A 3P63A 4TSSA 3IAS1 4C56C 1GPXA 1E10A 1L4DB 1XCTL 2BS4B 2JX5A 1RWSA 1C76A 1FNVA 2J52A 1BMLC 1TS5A 2JWUA 2QILA 3AEDB 3P4RB 2L52A 4ITKA 4UDUC 3BYTB 2M0AA 2K3UA 5HHDG 1V97A 4H2AA 4B0MA 1RYJA 3FAHA 4KGSA 4TQ0A 3T3OA 1HXYD 4GDKB 1VZ8A 5AUKA 2I2YA 4A6QA 2DYMA 2HDEA 2VZKD 5E6JA 5HFYA 1JRPA 1DYQA 4OVZA 1C77A 2BS2B 1AYFA 1L5PA 1SEBD 1V8CA 4A55A 3SFDB 1JMLA 2MEKA 3B2FA 4OZCA 3VRBB 2WNMA 3B9JA 1L6VA 1SE4A 1AN8A 1XO3A 4LTUA 1TJEA 1DOYA 4HKQA 1LO5D 2N0SB 1SE2A 4AQ7A 1HZ6A 1ZDVA 2AQ1B 5C2TB 1FO4A 2FUG1 3TEYA 1ROEA 2L1AA 3GS2A 1HZ5A 3AB5A 4JWUC 2BW2A 2X38A 1C4AA 2J42A 2Y5CA 1TS3A 1FCLA 3NZ3A 3I9V1 1EWYC 1WGKA 2MJ3A 4IDIA 2GRIA 2WU5B 3BYYB 3AE3B 1MVKA 2K9XA 1YQ3B 3LXFA 3TUOA 1QKZA 1I4RA 4RF0A 1YJIA 1FCCC 1YMHE 3U2SC 1KH0A 3TEWA 1FM0D 4NJCA 1L6UA 4C7ZA 1ZXHA 2PW9A 3R2IA 3V3XA 1FXAA 3U7ZA 1NI3A 2CJNA 3AE5B 1K51A 1ZPSA 3P4SB 5MPOA 3P1MA 1D5XC 1PFDA 3HVDA 3AN1A 1WXQA 1JQ4A 1EU3A 5AUIA 4ARIA 1GAQB 2V0GA 1I4HA 2IGGA 1DOIA 3ABVB 1J7AA 3HVZA 5C3JB 4L23A 3BVZA 2NMQA 4P16A 2K5PA 4ZRPA 2JYEA 2N9LA 2MH7A 3BK2A 2WXQA 5GXGB 1P7EA 3MJ5A 3UI3A 5TSSA 3AH7A 4RCOA 3AEEB 4CQNA 2QMTA 1EWCA 1PGXA 3IAM1 3P4PB 4L1BA 1D5MC 2YEPB 3MFGA 4RGMA 1QOAA 5D7GA 2WXKA 2LEKA 2ON8A 1BXTA 4RH6A 2OHFA 5FK9C 1CZPA 1E9MA 5FKAC 2W3SA 3W2DA 3TEZA 1ZOYB 1TS2A 3ZJTA 3N9YC 1K52A 3W5UB 1FD6A 1I4XA 1IUEA 2V4IB 4B0EA 3W9CB 1NENB 4RFBA 4EE2A 3W5VB 2NTTA 2LGIA 2PVOD 1I4GA 1SXTA 2KACA 4JE3B 2FBWB 1PYWD 1KRHA 3RPFC 4P6VF 1D5ZC 1FMAD 3SR6A 2BTEA 2BS3B 3Q8BA 5BMIA 1M4VA 1MPEA 1PUTA 1F2RC 4XWWA 2WXJA 2SAKA 1C79A 1CJEA 3AEAB 3H8HA 3AE8B 3IT6B 3Q8FA 3NRZA 1FXIA 2WXOA 1ACCA 2ICIA 5D3DA 4ZRQA 1WWTA 2Y3AA 3AEGB 1OFFA 1UWXA 2GB1A 2SEBD 3URYA 2WQYB 2EKIA 4XE0A 1XLPA 4Q2JA 1ZUD2 3EUB2 1V1PB 4HKZE 4YTMB 3B2GA 1N5XA 1I4PA 3T3NA 4WWMA 3TSSA 2WU2B 4RNAA 2M19A 4KKIA 3Q8CA 2AX5A 1YN5A 3AE6B 3NVWA 4KGRA 1K53A 2PIAA 2XN9C 4L2YA 4N6EB 1V1PA 2J53A 4R3DA 2NTSA 1SSNA 2R61A 3AEBB 3U4EG 3CWIA 2AQ2B 4HEA1 4REZA 4LK0M 4ZHPA 2G9HD 2KMMA 5BYRA 3AE1B 4HRSA 3ZYYX 3MC0B 4XDCA 4NZLB 1OQRA 2CU3A 1Y56A 1L0VB 4WH4A 2VZKB 2M56B 1ZE3D 2L32A 1RM6C 1F2RI 4IKGA 1HQRD 1T5XD 2DYOA 1N62A 3W1SA 2I38A 2JYTA 3Q8EA 1D6EC 3PZ8A 4J3OD 3NVVA 1IGCA 1HA5A 1XCQL 2RDHA 1TY0A 5EE0A 4YXDB 1VLBA 4XDDA 3BZDB 2WXHA 1JW9D 2AQ3B 2V3PA 2BYTA 2W3RA 2WXRA 2QSDA 3IXSA 5BMGA 3AEFB 2FE8A 1N5WA 2RDGA 1FFVA 1FRDA 4C80A 3MP9A 1C4PA 3CIRB 2DLBA 2WDVB 2DBYA 2QIEB 1ET6A 2WXIA 4M0WA 1ZXIA 4YTPB 3P42A 5H8YE 1E6EB 2BB6A 2H89B 3BVGA 4FXCA 1F77A 3Q8AA 2J4XA 1SB3C 4GDLB 4YWGG 1EM7A 4RF1A 1E0ZA 2KN4A 2WLBA 3DWMA 1UUPA 2Z8LA 2QEJC 5JXVA 2KQ4X 2BBCA 2LMCA 5BYQA 3P4QB 4A9AA 4MACA 2TSSA 4YTNB 1FEHA 2W54A 1Q10A 1I7HA 2KDMA 3KQ4A 1ESFA 3WCQA 4RGTA 3VR8B 3AMZA 1SJED 2W82A 3RFZB 4NAWB 1TKYA 1WRIA 4A90A 2WXNA 3PO0A 3FC4A 4RGNA 1B9RA 1XF5L 2JU6X 2PKOA 5EE9A 1VZ7A 1UNSA 2OEDA 2DWQA 1AWDA 1I4QA 4JPSA 1FRRA 3NVZA 1F0ZA 1MHHE 4TMAB 1IBXB 1KLUD 1C9FA 4DQOC 1KLGD 3AV8A 3I57A 1KTKA 2ZW0A 3AM9A 2INNE 1L0XB 1UWMA 3LYYA 4US8A 1FIQA 2KWDA 1WSPA 5I4DA 2W55A 2LJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEK B;  2M19 A;  2Y5C A;  1JAL A;  2Q5W D;  2AX5 A;  1EWY C;  1NVI D;  3AE6 B;  3NVW A;  1QOG A;  1WGK A;  2MJ3 A;  3ETR A;  2PIA A;  4N6E B;  3AE4 B;  3AEC B;  1JWA D;  3NVY A;  4IDI A;  1NYQ A;  2WU5 B;  3AEB B;  1RFK A;  3AE3 B;  2PVG C;  4N59 A;  1A70 A;  1XLN A;  3CWI A;  2K9X A;  4ZHP A;  1YQ3 B;  3LXF A;  1KF6 B;  2ACZ B;  2KMM A;  2MJD A;  2KAJ A;  1QLB B;  1SF0 A;  1YJI A;  3AE1 B;  5G5G A;  1J7C A;  4USA A;  2WDQ B;  4HRS A;  3ZYY X;  1TKG A;  2MJE A;  1FM0 D;  1OQR A;  1OQQ A;  1L6U A;  4C7Z A;  2CU3 A;  1VJK A;  3AE7 B;  1J7B A;  1FXA A;  1L0V B;  1NI3 A;  2CJN A;  2M56 B;  3AE5 B;  4YSZ B;  3P4S B;  5MPO A;  1RM6 C;  3P1M A;  3AE9 B;  1SIJ A;  1PFD A;  1N62 A;  3AN1 A;  1WXQ A;  1JQ4 A;  2JQR B;  5AUI A;  4JX1 C;  1WYG A;  1DOX A;  4ZOH C;  1GAQ B;  3NVV A;  1DOI A;  1XLO A;  3ABV B;  3AE2 B;  1J7A A;  3HVZ A;  5EE0 A;  5C3J B;  4YXD B;  4YSX B;  3VR9 B;  2B76 B;  5H92 C;  1VLB A;  1NYR A;  2K5P A;  1XLQ A;  3VRA B;  1ZP0 B;  2MH7 A;  1JW9 D;  4HRO A;  4YT0 B;  5GXG B;  1VDV A;  1JRO A;  2W3R A;  3AH7 A;  3AEF B;  4C7Y A;  1N5W A;  2CJO A;  3AEE B;  1R7S A;  1FFV A;  1N60 A;  1FRD A;  3P4P B;  5EE1 A;  5G5H A;  4C80 A;  2WS3 B;  3BII D;  3NS1 A;  3L4P A;  3CIR B;  1YJJ A;  1QOA A;  2BT6 A;  1QOB A;  2DBY A;  2QIE B;  2WDV B;  2LEK A;  1QF6 A;  2OHF A;  1ZXI A;  2E3T A;  1CZP A;  1E7P B;  1E9M A;  4YTP B;  5EE3 A;  2W3S A;  1YQ4 B;  3DWG C;  1T3Q A;  1E6E B;  1ZOY B;  1N63 A;  2QJL A;  5H8Y E;  1FFU A;  2H88 B;  3P63 A;  2L83 A;  2H89 B;  4YSY B;  3W5U B;  1TKE A;  1IUE A;  4FXC A;  1SB3 C;  3W9C B;  1NEN B;  1GPX A;  1E10 A;  1JWB D;  1QOF A;  1E0Z A;  2JX5 A;  2BS4 B;  3W5V B;  4KX6 B;  1RWS A;  3LB8 C;  2WLB A;  3AED B;  3DWM A;  4ITK A;  2HTM E;  3P4R B;  2L52 A;  3KWL A;  2PVO D;  1V97 A;  4US9 A;  3P4Q B;  1RYJ A;  3FAH A;  2FBW B;  4A9A A;  1KRH A;  3RPF C;  3HRD D;  4YTN B;  4P6V F;  2W54 A;  5AUK A;  1FMA D;  3SR6 A;  1I7H A;  2BS3 B;  3WCQ A;  1PUT A;  3AMZ A;  3VR8 B;  1JRP A;  1N61 A;  1CJE A;  2BS2 B;  3AEA B;  1AYF A;  1L5P A;  1TKY A;  1V8C A;  1QT9 A;  1WRI A;  3AE8 B;  3HUI A;  3SFD B;  3PO0 A;  3NRZ A;  3B2F A;  1FXI A;  3FC4 A;  3VRB B;  1B9R A;  2PKO A;  4N58 A;  5EE9 A;  3B9J A;  1L6V A;  1WWT A;  1XO3 A;  4JWS C;  4LTU A;  1TJE A;  3AEG B;  2DWQ A;  1OFF A;  2N0S B;  1AWD A;  1DOY A;  1PDX A;  1FRR A;  3NVZ A;  1F0Z A;  2WQY B;  1KFY B;  2EKI A;  1XLP A;  5C2T B;  4ZHO A;  4WQM A;  1TYG B;  1FO4 A;  2WDR B;  2K22 A;  3SFE B;  3AV8 A;  1ROE A;  1ZUD 2;  3EUB 2;  2G1E A;  4YTM B;  3AM9 A;  3AB5 A;  4JWU C;  1UWM A;  3B2G A;  1N5X A;  4US8 A;  1DGJ A;  4WWM A;  2WP9 B;  1FIQ A;  2W55 A;  2WU2 B; 
#chains in the Genus database with same CATH topology
 1BNO A;  1NEK B;  2B21 A;  2W9M A;  4S17 A;  3UIO B;  1SE3 A;  1PK1 B;  2JF5 A;  3ETR A;  1L4Z B;  4ECS A;  2D3D A;  5CTR C;  2MBB B;  4DL3 A;  3MR2 A;  3TAP A;  1BUI C;  2D07 B;  4GFJ A;  2YEP F;  2W03 A;  2IOH A;  5HHH A;  2XK5 B;  3RNG C;  2KD1 A;  3IG3 A;  1MI0 A;  2LYA A;  3AU4 A;  3AE7 B;  3RD2 A;  4UAS A;  4F5N A;  4J9K A;  1Q0W B;  3ZQ4 A;  5J2D A;  2WHE A;  4ECW A;  2F2A B;  2JRI B;  2HHT A;  2GMI C;  4UB3 A;  2JQR B;  3V60 A;  2BPG A;  2FCQ A;  3QXG A;  3GB1 A;  2PLP A;  4JX1 C;  3PNC A;  3PS6 A;  4DHZ E;  1SJH D;  3O0F A;  1H38 A;  3AE2 B;  3PST A;  1SGH A;  2IY1 B;  5EWE A;  5DCN A;  5KFZ A;  2WAQ F;  3VRA B;  1C4C A;  4DSE A;  8ICV A;  2P35 A;  3J81 j;  3L0W B;  3PRZ A;  3C1Z A;  4J9L A;  2HJ1 A;  5D3I B;  2G5H B;  2CJO A;  4WUR A;  1VZ6 A;  4MFC A;  4MEM A;  1U9L A;  2PMV A;  2D3B A;  1WYW B;  1RPL A;  1LQB A;  4O9M A;  1ZKH A;  3B0X A;  4WWO A;  3PX4 A;  1E8Z A;  1T4G A;  5HMM A;  1HUO A;  2O2V A;  1T3Q A;  4PHD A;  2QJL A;  3OPX A;  5KFK A;  2KJ6 A;  2H88 B;  4YSY B;  5CHV C;  1SXD A;  3FDS A;  1TKE A;  1N56 A;  2VH1 A;  3KUZ A;  4TKN A;  3H6N A;  1SKW A;  3NHE B;  4KLF A;  8ICA A;  3NUH B;  3RUL A;  3JPO A;  3WK4 A;  8ICF A;  2ZCC A;  4W9E A;  9ICR A;  2NBW B;  1X40 A;  4LDT B;  4DEZ A;  4BFR A;  5J0T A;  1V6E A;  2RDJ A;  3F2B A;  2IPK D;  2UVR A;  2JT4 B;  3HRD D;  4IOI E;  4FBU A;  4OW0 A;  4F71 A;  4ACO A;  2W9C A;  1YZ6 A;  2UYZ B;  4R8U B;  1XS9 D;  3KHG A;  1FXT B;  4Z6C A;  4DFK A;  3GP7 A;  4KDI C;  5LXI B;  1ZDX A;  4PK1 A;  1HEZ E;  1SZP A;  4QAY A;  2E8O A;  8ICP A;  4EEL A;  2HCF A;  2KTR A;  3A0B U;  4ANX A;  4RQ0 A;  1PDX A;  4Z6E A;  7ICL A;  3MR5 A;  3GV8 B;  4W9H A;  2N4F A;  4E71 A;  2JEF A;  2K22 A;  4PYU A;  3UQB A;  4I6L B;  1PGB A;  4OHJ A;  3BWU D;  3OAW A;  2LYB A;  1FNW A;  2FLN A;  2R8J A;  2WP9 B;  2JV3 A;  2ISO A;  5E6N A;  3I28 A;  1JWM D;  1JAL A;  4DOB A;  2Z0E B;  3FYH A;  9ICU A;  3ONN A;  1L8L A;  3PZ7 A;  1YN4 A;  5IIL A;  2GI9 A;  4KMU A;  3BJY A;  1KSP A;  1KRP A;  2NO5 A;  4RQ6 A;  2MJD A;  3N1X C;  2LHD A;  3B1L X;  3SYZ A;  1SF0 A;  3IT4 B;  3QU4 A;  3W1Y A;  4CE6 A;  1WRD B;  8ICQ A;  4W9L A;  1CK1 A;  3RTV A;  1RQN A;  3NY5 A;  2R18 A;  2ZG6 A;  3ZO5 B;  2BCV A;  4KLI A;  2QB1 A;  2ASD A;  1PQS A;  3E9S A;  4W9C A;  5C0Y A;  3SI8 A;  4ED8 A;  2KJR A;  3UQ0 A;  5J8Y C;  4DOA A;  2G07 A;  3BQ1 A;  4CYE A;  1FNU A;  1WYG A;  4HPP A;  4ANW A;  1ET9 A;  4F4X A;  2I1Q A;  4I2G A;  1NI2 A;  3M9N B;  2DZI A;  1XXG A;  4G50 A;  1C78 A;  3M7D A;  1X9W A;  3NOB A;  4RU9 A;  2FMP A;  3ZD9 A;  1P7F A;  1ZP0 B;  2HHW A;  4JV0 A;  4M2Y A;  3VQI A;  4UW9 A;  2PPH A;  4XA5 A;  1JRO A;  4A3P A;  4C7Y A;  2WXM A;  1SBB B;  3RNC C;  4BVU C;  4KTQ A;  2ZIW A;  4CF3 A;  3Q69 A;  2DAF A;  2KZ3 A;  4MEY A;  4DFP A;  3R9K A;  3L4P A;  3OWE B;  2DEN B;  2LUM A;  2KFK B;  2D5G A;  2VJ5 A;  5T8I A;  5HHI A;  2HDO A;  3GDX A;  3N28 A;  3H9D A;  1DK3 A;  4UBB A;  4O3M A;  4XGA B;  1GC7 A;  5J2G A;  3QCA A;  1YQ4 B;  4WJQ A;  3ZDD A;  3P63 A;  2OH2 A;  1D8B A;  3JPR A;  3AU2 A;  2KVR A;  4F4Z A;  2DX5 B;  2W9N A;  3MBY A;  1NJZ A;  2JXX A;  4C56 C;  1UCV A;  5KHQ A;  4UB8 U;  4P4M A;  2DPI A;  3IBE A;  2JX5 A;  4F72 A;  2JUO A;  1IXR A;  1B22 A;  3P4R B;  2BGF A;  4K4I A;  4BOZ B;  4TQR A;  4I2D A;  5HHD G;  1V97 A;  4DF4 A;  4I2I A;  1Z1B A;  4F4W A;  3FAH A;  2I9G A;  5IP4 D;  2OWO A;  1HXY D;  1VZ8 A;  1Z4N A;  4A6Q A;  4WAA A;  2HDE A;  2XO7 A;  2AH5 A;  4RQ8 A;  1WZ3 A;  5E6J A;  5AKE A;  2IO1 B;  5HFY A;  1DYQ A;  3RI7 C;  4NLB A;  1L5P A;  1P98 A;  3SMV A;  4TV3 A;  4A55 A;  2GBJ A;  2VA2 A;  3QU7 A;  2MEK A;  4K7S A;  4OZC A;  2NPT A;  2WNM A;  4KIK B;  5KG1 A;  3V72 A;  3GIM A;  2KZZ A;  1KEJ A;  1TJE A;  2N0S B;  2WF6 A;  4MSQ B;  3MFI A;  2KTQ A;  4NL9 A;  1WF9 A;  3BS7 A;  1HZ5 A;  3T3F A;  3ALR A;  4NLC A;  5D4B A;  1C4A A;  2QLT A;  4O3N A;  4C8N A;  5ALL A;  2UU7 A;  4IM2 A;  3I5J C;  2KC1 A;  1S0V A;  2DKX A;  5KG4 A;  1EWY C;  1WGK A;  2AU0 A;  2YY6 A;  4LJO B;  2LVO A;  4RNO A;  2GRI A;  2IBK A;  1SZH A;  5L1I A;  4JB3 A;  4GU2 A;  2LYH A;  4MJS A;  2P66 A;  3TUO A;  4DLG A;  3RNA C;  1BPB A;  1FCC C;  1ZRN A;  2WB1 F;  3DBH B;  4MEL A;  4DHJ B;  2G0A A;  3RCZ A;  4C7Z A;  5TR5 A;  1FXA A;  1K51 A;  5AM5 A;  5BOM A;  4RNN A;  2HVI A;  1D5X C;  2G09 A;  1S0O A;  4M0A A;  4WWN A;  2YN4 A;  1EU3 A;  5CWR A;  1EO6 A;  5J2C A;  2UVU A;  3ABV B;  3V6H A;  1J7A A;  4FHK A;  5C3J B;  5ALZ A;  4L23 A;  3K4G A;  3KZX A;  3RYT A;  3V62 A;  4ANV A;  2WXQ A;  4ASW C;  9ICK A;  2YLM A;  4R64 A;  1P7E A;  1Q46 A;  3PW2 A;  2G5I B;  1E7U A;  2KD0 A;  3MJ5 A;  4II3 B;  2GOW A;  3AEE B;  4NJ6 A;  1EWC A;  4RCO A;  2GO7 A;  4J9Q A;  3TAN A;  8ICL A;  4CQN A;  4ED7 A;  4FJY A;  3TQ1 A;  3ONS A;  4DO9 A;  1NZP A;  1COK A;  2KZR A;  1D5M C;  4RGM A;  2YB4 A;  3UGB B;  1B4F A;  1QOA A;  4QZE A;  3JYU A;  3TAD A;  3M63 B;  1CZP A;  2ZNV B;  2W3S A;  1M94 A;  4LJX A;  4UB1 A;  2AGP A;  1ZQR A;  2NYV A;  1K52 A;  5KFE A;  3N9Y C;  2XIC A;  5C1Z A;  1FD6 A;  1ZQZ A;  4NQL B;  1L2N A;  3Q2A C;  1COO A;  1P1A A;  3WAN A;  1RDF A;  1WJN A;  1NEN B;  5HML A;  5AI6 A;  2XC9 A;  2BCS A;  3ZLZ A;  3W5V B;  3EPG A;  5KFG A;  2OEH A;  2NTT A;  1X6J A;  4QIW C;  2JEJ A;  2Q4T A;  2LGI A;  3DPD A;  4F4K A;  2DPJ A;  2FBW B;  2ISP A;  5JHA A;  4B9K A;  1KRH A;  1WMH B;  4P6V F;  2H5X A;  2KIW A;  1MFW A;  1WM2 A;  3M3J A;  2PFQ A;  3GZF A;  1Z00 A;  3Q8B A;  1V9P A;  5ALS A;  4KLT A;  1M4V A;  1KQQ A;  1MPE A;  3ZTC A;  3I63 C;  2WXJ A;  2KVZ A;  2SAK A;  1C79 A;  3T5K A;  3VCB A;  5DBB A;  4Y2Y A;  2ASL A;  1SV4 A;  1C1Y B;  3NRZ A;  2DFL A;  8ICY A;  4O5C A;  2FPM A;  4YD2 A;  3I3T B;  2Q0Z X;  2ICI A;  1WZ0 A;  3JSV B;  2BF8 B;  2GB1 A;  2SEB D;  3URY A;  4MFA A;  4XE0 A;  1XLP A;  1S0M A;  4PYZ A;  4Q2J A;  1HJP A;  2JY6 A;  3DBH I;  1S76 D;  1ZQW A;  3EUB 2;  1J2N A;  4YTM B;  5J0O A;  2N7D A;  5KFM A;  4WWM A;  3TSS A;  2JPH A;  5AK6 A;  4YQW A;  2REX A;  2IO3 B;  1RXV A;  3IHP C;  3UQA A;  3GII A;  4Q44 A;  1FEZ A;  2AX5 A;  1RZT A;  2ZUB A;  3NVW A;  2ASQ A;  2MBO A;  4W9I A;  2F8L A;  4BKS A;  4CHK A;  4M01 A;  1QTM A;  4GIB A;  5J2K A;  1MN8 A;  3NJT A;  4P0P B;  4HEA 1;  2KYW A;  4FZL A;  2G9H D;  3Q8R B;  5BYR A;  3PGE A;  4KN7 A;  2HHU A;  4HRS A;  3SD5 A;  4MF2 A;  1L7M A;  2R8I A;  1PVP A;  4O5E A;  4NLN A;  2CU3 A;  4Q8E A;  5T14 A;  4NZL B;  5G55 A;  2ZJD A;  2K1F A;  2VZK B;  1ZE3 D;  1RM6 C;  1BPE A;  2BGW A;  1F2R I;  5AHX A;  3QUT A;  4PS3 A;  3RB6 A;  1NK5 A;  5TZV A;  3KYD D;  4DBG A;  4DSF A;  2DF4 B;  3W1S A;  1UQV A;  3M6K A;  4BKT A;  3HJE A;  5AM4 A;  3Q8E A;  2MUT B;  2YML A;  2ZZP B;  1Z4O A;  1F1H A;  2KV2 A;  2JR5 A;  2PE6 B;  4C8K A;  4F5P A;  1N2X A;  2RDI A;  2RDH A;  3Q8K A;  1TY0 A;  3H7P A;  4YXD B;  4YXM A;  2LVP A;  4ECX A;  8ICM A;  3CW2 C;  3EW9 A;  4F92 B;  4BUG A;  4C0Z A;  1EF1 A;  1K8R B;  2HHS A;  3SHQ A;  2AQ3 B;  1JMS A;  2WF5 A;  2FE8 A;  2Y9T A;  2N7E A;  4A20 A;  4IR9 A;  2RDG A;  3TAR A;  4WJO A;  3PRE A;  1C4P A;  4KLU A;  2GH1 A;  9ICL A;  2O6V B;  3CIR B;  2P6U A;  3H8W A;  2DBY A;  2VJ4 A;  2DLB A;  4C4T A;  2WDV B;  4I2E A;  1ZQL A;  4P2H A;  3DHG C;  4M0W A;  1ZXI A;  3B08 A;  2OCE A;  3FM9 A;  4YTP B;  1TE2 A;  4II2 B;  3JPP A;  1LGR A;  5H8Y E;  2WFA A;  1MQ3 A;  2KJ5 A;  1TIF A;  2C60 A;  4FXC A;  3Q8Q B;  1F77 A;  3Q8A A;  1SB3 C;  3Q3O C;  4AP9 A;  4UB2 A;  1XNS A;  2LM4 A;  3K75 D;  4NM2 A;  2D11 A;  4JK1 A;  4YWG G;  4RF1 A;  2KP7 A;  2A19 A;  3KUD B;  5FR6 A;  4I27 A;  3P4Q B;  2BKF A;  5KAF U;  4YMO A;  4FHJ A;  4GDL A;  2W54 A;  3H40 A;  4BBN F;  2LJ5 A;  5E6O A;  3A1Q B;  3WCQ A;  5DB9 A;  4RGT A;  3PV8 A;  4TUQ A;  1S9F A;  5JTI A;  4KSK C;  1SJE D;  3SZ2 A;  1URJ A;  2W82 A;  1OXJ A;  4EX6 A;  2WXN A;  1KFD A;  4RGN A;  2PKO A;  2JU6 X;  5FP0 A;  2L76 A;  5KFN A;  2VH2 A;  1IPG A;  3PMN A;  3QX7 A;  1P0R A;  1WGH A;  3AI5 A;  1AWD A;  1BPD A;  5AKY A;  1F0Z A;  4JWN A;  2D3A A;  4HDQ A;  4AJW A;  2AEH A;  4NAW A;  4DL4 A;  1KLG D;  9ICJ A;  3RFA A;  4ELT A;  2JZ3 B;  1T0Y A;  3LYY A;  4QIW F;  1WSP A;  2H3Q A;  2V9H A;  2Y0S C;  4DQI A;  2JXT A;  2M0N A;  4UB5 A;  5GXG B;  1IBX A;  3PW5 A;  3RZF A;  4IG7 B;  4LCD E;  3RT3 B;  4GMV A;  3I1Y A;  4C8L A;  2JVC A;  3AE4 B;  4EEW A;  1WMH A;  1SL0 A;  5KT7 A;  4U7C A;  1L3V A;  2K39 A;  4GLS C;  3VUW A;  3SQI A;  3HIZ A;  1KF6 B;  3PV1 A;  2P6R A;  5ALO A;  1QLB B;  3WU2 U;  2FAZ A;  3L08 A;  1OQQ A;  1WUD A;  1WR1 A;  4YSZ B;  4HCP B;  1UGJ A;  2QKQ A;  4RQ2 A;  2LFI A;  2JHD A;  3AE9 B;  1NOM A;  1S1Q B;  1JXE A;  1YT3 A;  1RG6 A;  3WAO A;  3M6Z A;  2GLE A;  2R8K A;  4ZRI A;  4URK A;  2WHI A;  3RB0 A;  2MP2 B;  1WGG A;  2KFJ A;  3ZNG C;  4MGZ E;  3Q3N C;  1NYR A;  2KG5 A;  1FPY A;  4M9N A;  1X66 A;  4Y2T A;  5HI1 A;  4MT5 A;  5KFI A;  3R2T A;  4HRO A;  2BB5 A;  2M4N A;  2HHX A;  2K6D B;  4XRH A;  2BKR B;  4D2K A;  2O2V B;  3N7P D;  3GV5 B;  5FR3 A;  2HMX A;  3ZIM A;  2MW5 A;  2YQE A;  3BII D;  3U30 A;  5D2M B;  1QOB A;  3AU6 A;  5D46 A;  3C2K A;  1QF6 A;  4XUS A;  5J2A A;  2NBU A;  1T6B X;  2RR9 A;  5J29 A;  2N9K A;  5ALX A;  2DYB A;  2KMC A;  2KDB A;  3DWG C;  1QIL A;  2DKZ A;  4F3O A;  1WGD A;  2L83 A;  1E8Y A;  2CN1 A;  4KZ0 A;  3IG8 A;  4TUU A;  1WFY A;  1B43 A;  5ALI A;  3WIM A;  5IIO A;  3GV7 B;  5CEH A;  2W9C B;  1QOF A;  1JWU D;  4KX6 B;  3Q14 C;  4KN4 A;  4LNK A;  1ZD2 P;  1WXA A;  2WX0 A;  7ICK A;  4HLE A;  5B66 U;  3WK5 A;  5GMV A;  8ICJ A;  4I2J A;  1WWV A;  4ELV A;  5D94 A;  3TIX A;  2KTR B;  3TMP B;  1B0X A;  3KKA A;  1X6I A;  2G4D B;  4KLL A;  1ENF A;  1KOT A;  2CR5 A;  2IDY A;  4NV0 A;  1N6Z A;  1N61 A;  1X2I A;  5KFA A;  2RPV A;  2RMM A;  5J0W A;  3H1U A;  3HUI A;  1GB1 A;  1QT9 A;  1Q3U A;  5L1L A;  2EMT A;  4ACF A;  2KNB A;  4N58 A;  1XEE A;  3WK7 A;  3DQV A;  1V2Y A;  3DOW A;  1V1O A;  3KYC D;  3VTW A;  3KLS X;  4CRX A;  1PUZ A;  2G06 A;  3QEA Z;  4FJV B;  3PW7 A;  1EU4 A;  1MC8 A;  2CRX A;  1L0Y B;  3C0R B;  3EFC A;  1TK5 A;  3EC8 A;  1SKR A;  1CEZ A;  4F5O A;  2G1E A;  3SEI A;  2ZIX A;  2IJ0 A;  3GIL A;  2ZW1 A;  1MG4 A;  4RQ4 A;  2ONQ A;  3V7K A;  5J8Y A;  5IO9 A;  2KK8 A;  2G45 B;  4RM9 A;  1Z1V A;  1CQV A;  2C28 A;  1NVI D;  4J9R A;  1KDH A;  1QOG A;  2MRP A;  5KFB A;  4AWJ A;  1ZQH A;  3KD3 A;  4KLH A;  4OZB A;  1NYQ A;  2K60 A;  2KT7 A;  3H8S A;  4E3C A;  2PVG C;  4WJP A;  3SU8 X;  3LVV A;  3ML8 A;  2GBN A;  4AS1 A;  2ZXH A;  2C22 A;  3PHW B;  3QYP A;  2A3V A;  1J7B A;  3H0L B;  3H8M A;  2BQR A;  2LHT A;  4UAV A;  2KKP A;  2FI1 A;  3HKZ C;  4FE3 A;  3RAQ A;  1GOZ A;  3PSF A;  3PVX A;  2WXF A;  5AI0 A;  4M02 A;  2LXA A;  3EZ5 A;  1ZQN A;  3V7J A;  3PVL A;  3QWZ B;  5AI5 A;  3LJ3 A;  4Q45 A;  4WIP A;  4ZOH C;  5J2E A;  3MDC A;  3J9C A;  3TEX A;  2ZIW B;  3VFK A;  4C4V A;  4Z6D A;  5BMH A;  2LHE A;  2XNA C;  2B76 B;  4OZA A;  3ISD A;  4M9G A;  2ZCB A;  7ICV A;  2WDT B;  4RZR A;  1TVA A;  1NK6 A;  3SEN A;  3QU9 A;  4IQV A;  4TQS A;  3C28 A;  1E7V A;  3SV4 A;  1IGD A;  1U48 A;  5DPS A;  5AZH A;  1R7S A;  4P1B C;  3V6J A;  3JVZ X;  3TBL D;  1LVH A;  3PT2 B;  1X9M A;  8ICN A;  2VA8 A;  9ICT A;  2JSV X;  1WJ4 A;  5ALG A;  1OUQ A;  1DXS A;  2E6X A;  2KX0 A;  1BGX T;  4O5K A;  1D4B A;  2K25 A;  2EAN A;  4AUQ C;  2J0M A;  2VIX A;  2IND C;  2A4Z A;  3RH4 A;  3DBL B;  1L3T A;  1E8X A;  2JH1 A;  1QSS A;  2AQ4 A;  5L1J A;  1GPX A;  1E10 A;  4M9H A;  2QHO A;  4PGY A;  3ZDT A;  2L05 A;  1L4D B;  2BS4 B;  1ARO P;  3AQE A;  4AYB F;  2M9N A;  1FNV A;  2JWU A;  2L52 A;  3ZXV A;  2K3U A;  2MP2 A;  2BYF A;  4H2A A;  3A4S C;  5DPR A;  3BIN A;  4TQ0 A;  2N1V A;  3F5A A;  2NPT B;  3ZD8 A;  4S0R A;  5AUK A;  1KFT A;  1UEL A;  1UT8 A;  1OTR B;  5ALP A;  1L3S A;  2DNF A;  2VZK D;  1D8L A;  5AI9 A;  1SEB D;  1NJW A;  3TI0 A;  1L7O A;  4I2H A;  1JML A;  1Q3V A;  2ZPN A;  1Q1O A;  2H3F A;  4ECU A;  2WX1 A;  4GDK A;  2K8H A;  5JH5 C;  2BR0 A;  1XO3 A;  4DLE A;  3N32 A;  1KBU A;  4B9T A;  4LTU A;  4HKQ A;  1DOY A;  1XWL A;  1U4A A;  1J2M A;  1MG8 A;  1QH9 A;  4R63 A;  1CRX A;  4BAX A;  4AQ7 A;  1ZJM A;  2M1M A;  3LK9 A;  4IRD A;  1UD7 A;  4J9N A;  4EYI B;  3TEY A;  1ROE A;  2J0J A;  2L1A A;  1ZQX A;  1D8Y A;  4JWU C;  3PSE B;  2RPQ A;  1S5L U;  3VUX A;  1L7N A;  4MJS B;  2Y5C A;  2KN7 A;  1UGM A;  1FCL A;  1NZB A;  2KNJ A;  1L8O A;  2MSN A;  4IDI A;  4QZB A;  3D2Q A;  1V5O A;  4C8O A;  2HOQ A;  3BYY B;  3SAF A;  3AE3 B;  2QDF A;  3RMK C;  4HVB A;  1SXE A;  1KL9 A;  1MVK A;  4PPX A;  2K9X A;  4RMA A;  3RJJ A;  5ALJ A;  9ICA A;  1NK0 A;  1I4R A;  1YMH E;  5J0U A;  4IQW A;  3TEW A;  4BDP A;  5DG8 A;  1YJ1 A;  4F93 B;  2BZF A;  4IQU A;  1S10 A;  2PW9 A;  3V3X A;  8ICS A;  2EKE C;  5MPO A;  3P1M A;  1D3Z A;  4PZN A;  4NY0 A;  9ICH A;  3RJH A;  5JUM A;  3AN1 A;  2CKH B;  2KIV A;  4QJF B;  5AUI A;  2KIC A;  4KLS A;  4ARI A;  1GAQ B;  2FLP A;  5KG0 A;  2IGG A;  4CF5 A;  1NJY A;  2F8K A;  2KHV A;  3KFU F;  1ZJN A;  2I6X A;  2BCQ A;  7ICO A;  4WWP A;  4ZRP A;  2K5P A;  2W7O A;  3KVF B;  2BVC A;  4ZRK A;  1AQ6 A;  2MH7 A;  3DBL I;  4NWI A;  3BK2 A;  3IHQ B;  3IDW A;  2GBM A;  4M00 A;  2V4Q A;  2ZUD A;  3QU2 A;  1T8E A;  3APC A;  4IC9 A;  4I28 A;  3AH7 A;  4I29 A;  2W04 A;  1ZET A;  2D10 A;  4BXO A;  3DDC B;  4JV1 A;  3AEV A;  4A3O A;  1PGX A;  1WJ6 A;  3P4P B;  4QNL A;  4HAI A;  2FE9 A;  5J0Y A;  9ICV A;  2R2Q A;  2YEP B;  2ZJA A;  3MFG A;  5D7G A;  2YMM A;  2LEK A;  2IOF K;  2ON8 A;  3APD A;  2W8L A;  4RH6 A;  2OHF A;  5FK9 C;  1ZD3 A;  4LNI A;  1UHU A;  2JMG A;  3BDP A;  1NJX A;  5KL8 B;  5J0S A;  3DVN V;  1ZQM A;  4PGX A;  4KVG B;  1UT5 A;  4KLQ A;  5KFP A;  3JW0 X;  4LNN A;  2IZV B;  2V4I B;  4FN2 A;  3BZK A;  5KFQ A;  4UAZ A;  1YX6 B;  2NBV B;  2ZVO A;  4P1C C;  7ICP A;  4RFB A;  2J6S A;  1Z00 B;  1EXN A;  4M6W A;  3LWM A;  3D32 A;  5CX3 A;  4UAY A;  5HR7 A;  2K8B A;  4KDL B;  1G6J A;  2KAC A;  3PZP A;  3N1Y C;  1ZQI A;  1I42 A;  4GC6 A;  1D5Z C;  3R66 C;  7ICQ A;  1FMA D;  3NZS A;  2BTE A;  4DSJ A;  2LAS A;  2EZY A;  1PUT A;  4XWW A;  5KFF A;  2MAX A;  4JV2 A;  1DGS A;  1ED1 A;  3AEA B;  3H8H A;  1OGW A;  4I2B A;  3AE8 B;  3IT6 B;  9ICO A;  1UBQ A;  2BDU A;  2HVH A;  4F1S A;  5KT2 A;  4JGH B;  3T5J A;  1WWT A;  2MSE D;  5C23 A;  4Z6F A;  4PJ0 U;  5KFH A;  4IM0 A;  2FNJ B;  1WXS A;  4M8N A;  5KT3 A;  5BPC A;  1Z5S B;  2V3S A;  2WQY B;  2MHJ A;  3RUI B;  4F4Y A;  4I2F A;  1ZUD 2;  5AI4 A;  3T5H A;  4J9S A;  1PVQ A;  1GJZ A;  1ZQF A;  1N5X A;  2IMW P;  4QZF A;  3OJ4 B;  3PML A;  4O3S A;  4DF8 A;  1WGY A;  2NRW A;  2PJH A;  4RNA A;  2M19 A;  3HT3 A;  9ICW A;  5K4L A;  3KTQ A;  1YN5 A;  2UVV A;  1L6N A;  1TKD A;  3QHT A;  3Q8C A;  1K53 A;  2PIA A;  2XN9 C;  1QLN A;  2FCM A;  2R2O A;  4BWM A;  2KFZ A;  3F2C A;  5DQI A;  1V1P A;  1QQ5 A;  3RNF C;  4B9S A;  2NTS A;  4C8M A;  3AEB B;  3RAX A;  3U4E G;  3EYZ A;  2JEI A;  2KFN A;  8ICR A;  4N9F 4;  2ZTE A;  4O3P A;  2XGP A;  2C2E A;  1XO0 A;  1KKX A;  3K9P B;  3RRG A;  4LK0 M;  2KMM A;  1E90 A;  1ZOL A;  2KOX A;  2A1A A;  4EYH B;  3F5E A;  1U45 A;  2C5L C;  2RD0 A;  3Q6B A;  3MC0 B;  3UMC A;  1VJ5 A;  1KLN A;  1LM8 B;  2NRT A;  1JI7 A;  3MGH A;  2Y1I A;  1Y56 A;  1L0V B;  3IFW B;  4PL2 A;  3H7P B;  5ALQ A;  1H8C A;  4BKG A;  1HQR D;  9ICM A;  3C5G A;  1BPZ A;  2DYO A;  4HDO A;  2UWQ A;  3WKD A;  2I38 A;  2JYT A;  2B3A A;  1D6E C;  3PZ8 A;  3H4D A;  2ZIU A;  4J3O D;  3NVV A;  3UMB A;  1HA5 A;  2EAO A;  4ZH4 A;  2KVC A;  1V5T A;  1NDD A;  4HCN B;  3DEE A;  2RQ5 A;  5KG5 A;  1V38 A;  4XDD A;  2WXH A;  2WYQ A;  1SWV A;  3N7R C;  4ELU A;  1JW9 D;  3VVW B;  3OTQ A;  2BYT A;  2W3R A;  4M0W B;  2QSD A;  5BMG A;  3AEF B;  2HW3 A;  1FFV A;  2KWC A;  4K4G A;  2FJ6 A;  3IV6 A;  3MP9 A;  3QC8 B;  4G0N B;  2KLC A;  4KLE A;  2MWS B;  2J6U A;  3ED5 A;  1R4M B;  1WY8 A;  2RGF A;  4NY8 A;  4KLO A;  4GXB A;  2WGS A;  4C00 A;  1DOQ A;  4B9L A;  4B9U A;  5EWF A;  1E6E B;  3RH5 A;  2BB6 A;  2YTU A;  2HSZ A;  2H89 B;  4KX3 A;  2Z59 B;  2KLG A;  1V85 A;  1NKC A;  4IRC A;  3IVF A;  2FMQ A;  3RJG A;  4I2A A;  1PK3 A;  4CDG A;  4GDL B;  4B9N A;  1EM7 A;  4Y2R A;  4KLG A;  2QCZ A;  5G2N A;  2KN4 A;  2C9W B;  2WLB A;  3THV A;  4Y2X A;  2AJQ A;  1R4N B;  5BYQ A;  3KBB A;  4WJN A;  1TAM A;  2PMZ C;  5KFX A;  2DQN B;  1L5U A;  3MR6 A;  3C1Y A;  2FPK A;  3A9J A;  1P7D A;  4NAW B;  1TKY A;  4A90 A;  3DDH A;  4XYC A;  3QU5 A;  4FBT A;  3X23 A;  1V81 A;  2KWU B;  1XF5 L;  3IRU A;  1VZ7 A;  2V9W A;  1UNS A;  2KWV B;  2OED A;  2DWQ A;  3NRW A;  1LKY A;  4F8R A;  1FRR A;  1F52 A;  1UH6 A;  2HE7 A;  4TMA B;  1IBX B;  4A8E A;  4B9M A;  8ICU A;  3ISB A;  1TAQ A;  2M17 A;  3CNH A;  1L7Y A;  5D6J B;  9ICE A;  4TUP A;  1L0X B;  4CF4 A;  4US8 A;  3APF A;  1ZW7 A;  3AL0 B;  2KWD A;  4NJC A;  4CCH A;  2LJI A;  4PHE A;  1VRA B;  4DQP A;  5KTQ A;  4O0I A;  1IIP A;  2HTH A;  1SV0 C;  4PGQ A;  2KJH B;  3LVW A;  2W9B A;  3AEC B;  3M1Y A;  4FZM A;  5DQH A;  4G11 A;  3QA8 A;  2JRZ A;  4NM1 A;  1T0Q C;  1ZRM A;  1NKB A;  1GNU A;  4DCC A;  2EQY A;  4DL6 A;  2KAJ A;  5C5J A;  3IN5 A;  3H8J A;  1B1Z A;  5J0P A;  2AYO B;  3PX0 A;  2F77 X;  4HJG E;  3Q3M C;  5KFC A;  1Z3E B;  3E58 A;  3E56 A;  2IO0 B;  1SIJ A;  2NV3 A;  4IW0 A;  3MHZ A;  1RQL A;  1V49 A;  3V05 A;  4DL7 A;  3AUO A;  1R4M I;  3OJU A;  5KAI U;  5CR0 A;  3C8Y A;  3TJP A;  2NRX A;  4RM8 A;  3RR7 A;  8ICG A;  4J9P A;  2KXJ A;  2ZIV B;  1AAR A;  2ESE A;  2N7J A;  4B9V A;  2HBJ A;  4F5R A;  3RB4 A;  3D6J A;  3PO4 A;  1XLQ A;  5BO4 B;  8ICH A;  3HX0 A;  4EEN A;  3R7R A;  3ENE A;  4ED3 A;  3NAS A;  4KKJ A;  3MHS D;  2D2Q A;  4KLJ A;  2WF9 A;  1DRG A;  1GUA B;  4NJ7 A;  3T5L A;  2BCU A;  4EUT A;  2AL3 A;  5EE1 A;  3Q8L A;  2K8C A;  4W9D A;  2WS3 B;  4G3X B;  4K7W A;  4DL2 A;  4R66 A;  2WXP A;  3CMM B;  2ES6 A;  3PR4 A;  1R4N I;  1A5R A;  5AI8 A;  1WX9 A;  4B6J A;  1F9J A;  3MC9 A;  3LDA A;  4LDT D;  3L54 A;  4YCX A;  1KJT A;  3QUC A;  4J6I A;  3R8B A;  5KT6 A;  4DFD A;  4UAR A;  3SEB A;  5KFU A;  2WXL A;  4IRK A;  3PLU A;  3M8R A;  3BQ0 A;  4O3Q A;  3MGV A;  4NAM A;  3O13 A;  2JXJ A;  3BVM A;  1TAU A;  3LB8 C;  1CI4 A;  2K4E A;  1JXL A;  1ZQE A;  1ZQT A;  2EZX A;  1TS4 A;  5AKX A;  5HR6 A;  3GU3 A;  1WE6 A;  2HTM E;  3PPA A;  1STE A;  2D3C A;  1I35 A;  4TUR A;  3ALB A;  1J19 A;  4OJO A;  3V7L A;  2H3I A;  2KKC A;  4DS5 A;  2KMA A;  5L95 C;  1F44 A;  2W11 A;  5AKH A;  3ZDC A;  1K50 A;  4DDG D;  3OSP A;  8ICE A;  3RH6 A;  4UBC A;  3CST A;  3AXC A;  3DVN U;  1SL1 A;  3Q8S B;  1NNL A;  1QQ7 A;  2E5S A;  2PFP A;  1YNT E;  1NK9 A;  2WWZ A;  5EWG A;  4KGT A;  2ZIX B;  4EZJ A;  2A1J A;  2WXG A;  4K7U A;  1WM3 A;  2EAM A;  3PHX B;  4YVZ A;  3UXN A;  4R65 A;  4IR1 A;  4HYK A;  5ALY A;  2WDR B;  4QZC A;  3FIL A;  4ZHO A;  2BQ3 A;  1U4B A;  1YD8 U;  4HXD A;  3C2M A;  5ALF A;  3UIN B;  2VRR B;  1ZQQ A;  3AQF A;  1C7Y A;  4QZG A;  2XY5 A;  1TZO A;  3EA6 A;  3MC8 A;  2RRD A;  1TY2 A;  3V6K A;  2C2D A;  1SIF A;  2I1K A;  3ZKJ C;  2BPC A;  2IYD B;  3NVY A;  3GOE A;  4LLG M;  4ECR A;  1AW7 A;  2QAR A;  1MA7 A;  1RFK A;  2PE9 A;  2KDI A;  1A70 A;  3TFS A;  1XLN A;  2EDU A;  4DSI A;  4YP3 A;  4ED0 A;  1TK0 A;  2KAN A;  1VR9 A;  9ICS A;  4YN4 A;  4FAD A;  3DCG A;  1S0N A;  3NGD A;  3GIK A;  5KL1 B;  2FID A;  2Y5B B;  2LGD A;  4IM3 A;  4C4V B;  1VJK A;  5D49 A;  4MH8 A;  3A4R A;  2MRL A;  4OJP A;  2RP5 A;  2K89 A;  2IGH A;  5J2F A;  3C5F A;  3Q3F A;  3UXP A;  3CYM A;  5ALT A;  5DB8 A;  3DV9 A;  4B6W A;  2FUH B;  5CHF A;  4I2C A;  5AKI A;  4JL9 A;  1IM4 A;  2MU2 A;  4QWC A;  3EEC A;  1GC6 A;  3ZI4 A;  3A0H U;  3VR9 B;  2L0T A;  2VAN A;  1JCK B;  3D2N A;  3QAR A;  2R8G A;  4J03 A;  5J2B A;  5DLF A;  4FJZ A;  3KWV A;  1UPH A;  1N60 A;  1XQQ A;  4MM3 A;  4FFD A;  3ZJV A;  3NS1 A;  4PS8 A;  2EAP A;  4K3B A;  1T94 A;  2ZTD A;  2K0P A;  4ZRJ A;  3DVG X;  3QAQ A;  4E0D A;  2L00 B;  2BHN A;  5IIM A;  3U7D A;  1ZQP A;  1T7P A;  4BKS D;  2FPL A;  1PGA A;  1QCK A;  2JZP A;  5BYS A;  1WR6 E;  2RSU A;  4EOY A;  4TSS A;  1PZN A;  3IAS 1;  5AM0 A;  4MEX A;  2C7H A;  2HJ8 A;  4YMM A;  3A9K A;  3DVG Y;  4O3R A;  5L1K A;  2ZTC A;  4NLK A;  1SL2 A;  3C29 A;  3UIP B;  4EBE A;  3KHR A;  1C76 A;  2MA1 A;  1TS5 A;  2DL0 A;  4ITK A;  3RJI A;  1T3N A;  4UDU C;  4B0M A;  2ZIV A;  3IM1 A;  5ALR A;  8ICX A;  1RYJ A;  3T3O A;  2HBM A;  2MA9 B;  4GDK B;  4E74 A;  4W9J A;  2I2Y A;  3QIJ A;  4F8C B;  2F44 A;  2WAQ C;  2KZM A;  2XEW A;  3OSN A;  3QNM A;  4OVZ A;  4HPL B;  1C77 A;  2KDE B;  4C4S A;  1AYF A;  1TZ1 A;  2WF8 A;  1V8C A;  3TKA A;  4K1R B;  3ZDM C;  3SFD B;  4O3O A;  5GTH U;  3B2F A;  2ODG A;  5EDS A;  3B9J A;  7ICF A;  1L6V A;  5JU5 A;  1AN8 A;  1SE4 A;  3NZU A;  4EFO A;  3DBS A;  1ZDV A;  2JGA A;  5C2T B;  4NNJ B;  2Z7J A;  3SV3 A;  1FO4 A;  2FUG 1;  2KQS A;  2N1W A;  3AB5 A;  4MGY E;  2BW2 A;  2ZEQ A;  3VDZ A;  1QSL A;  4DHJ D;  4WQO B;  2J42 A;  1RYS A;  1Z19 A;  4M9J A;  3PSP A;  1SE9 A;  3NZ3 A;  4XZ4 A;  5KFY A;  3L5K A;  4QZH A;  2K4I A;  2LBO A;  3LWL A;  3GFK B;  2KOB A;  3N1Z C;  3TAQ A;  1T0S C;  3QUB A;  3RNE C;  3RBD A;  5AKJ A;  4J9O A;  3OJ3 A;  4LVS A;  2N1R A;  1ZGU B;  1QKZ A;  1KH0 A;  1SKS A;  1XSP A;  1L6U A;  4UAW A;  5HKH A;  1NI3 A;  3QX1 A;  1HIW A;  3W1S C;  2DUY A;  8ICO A;  2KHW B;  3P4S B;  3VXW A;  3K1Z A;  2OJW A;  3I76 A;  3HVD A;  3JPS A;  9ICP A;  1JQ4 A;  4NLG A;  2QB0 B;  4Y2J A;  5KT4 A;  2X8X X;  3ZTD A;  1SWW A;  4QZD A;  2MBQ A;  4BXO B;  2YMP A;  4OO1 J;  5KFT A;  3MTN B;  4LZG A;  1LB2 B;  3HWT A;  1UF0 A;  4P16 A;  4DHZ B;  2N9L A;  1T0R C;  3S6J A;  5H2F U;  5B5E U;  1WH3 A;  1LFD A;  2EMS A;  1UBI A;  5CHG A;  1J8C A;  3KHH A;  7ICE A;  2W8K A;  2QMT A;  4KIT B;  4QW9 A;  3KH0 A;  2F1H A;  4EBC A;  4MFF A;  3IAM 1;  3HPO A;  2AQ0 A;  3KW5 B;  4DS4 A;  1P9D U;  4QWD A;  1KLV A;  2K6Q A;  3L16 A;  2D8C A;  5CJ7 A;  4UQG A;  5DB7 A;  4LJP B;  2DGZ A;  4M6W B;  4XQ8 A;  2KSO A;  3VHT C;  2K8B B;  1TS2 A;  5CHW A;  2LMR A;  3W5U B;  1YQB A;  1I4X A;  5ALW A;  2CHW A;  2Y0S F;  2AGQ A;  2F3N A;  1WX7 A;  3W9C B;  4OVV A;  4K81 A;  4UB6 U;  4QZA A;  4TUS A;  4EE2 A;  2KO3 A;  4B95 A;  2YVC A;  4KLM A;  3RNB C;  2NO4 A;  3C23 A;  5KFR A;  2GBK A;  4FUL A;  2L3Z A;  2XGQ A;  5ALK A;  2MBE A;  3UF8 A;  1ZD5 A;  1SXT A;  1IV8 A;  4JE3 B;  5ALN A;  2LKY A;  3SR6 A;  2QC8 A;  2BS3 B;  2BKE A;  5AIB A;  4RPX A;  7ICG A;  5DDY A;  9ICC A;  3PO5 A;  1F2R C;  3MC1 A;  3SAH A;  1CJE A;  1S97 A;  5J2J A;  2BCR A;  4GXK A;  1NBF C;  3Q8F A;  4YR0 A;  1SGG A;  4K4H A;  2WXO A;  8ICZ A;  1ACC A;  1QSY A;  2I1J A;  2ZNV C;  3AEG B;  1ZQB A;  1UWX A;  5KFW A;  1XO1 A;  2B0C A;  4I6N B;  3EHV A;  1WIA A;  4IWP A;  2EKI A;  5TIS U;  4X5V A;  1U49 A;  1V1P B;  4KMO B;  4HKZ E;  4P0Q A;  1I4P A;  3B2G A;  2KDF B;  2BPF A;  2CS4 A;  2ASJ A;  1WGR A;  3VH3 B;  2BPS A;  4XC2 A;  5CRX A;  4KGR A;  4L2Y A;  3GE8 C;  4F5Q A;  9ICN A;  2HOF A;  4N6E B;  2HOI A;  5DGB A;  3BQ7 A;  4R3D A;  4NJ8 A;  2IHM A;  2V4L A;  2R61 A;  4JWM A;  5AKZ A;  2KK0 A;  3PSI A;  3CWI A;  2AQ2 B;  4ZHP A;  4F2R A;  1YOV B;  4CNQ A;  4K3C A;  3ZYY X;  1MJD A;  3HK0 A;  2ZIU B;  4XDC A;  4DSK A;  1OQR A;  5KG2 A;  1KTQ A;  3BS5 A;  4GB9 A;  1E8W A;  2M56 B;  3BZC A;  3RJF A;  2IO2 B;  4IKG A;  2NCN A;  4RQN A;  3E0F A;  2ZJ8 A;  2CXY A;  5GTI U;  1N62 A;  3QK0 A;  3TL5 A;  2L0F A;  4IWQ A;  3MR3 A;  2O6V D;  1IGC A;  2XI9 A;  2MX2 A;  1X9X A;  3MAB A;  2G4S A;  2MLB A;  2VKQ A;  5HNK A;  2HD5 B;  3BZD B;  2W9A A;  5J18 A;  4QW8 A;  1Q8K A;  1S8O A;  3EFU A;  2WXR A;  4QWA A;  3IXS A;  5ALD A;  1N5W A;  2OM6 A;  4DQQ A;  2MQJ A;  4AJY B;  5F9L A;  3BQ2 A;  3QE9 Y;  3DBR B;  1CUK A;  5A0L A;  4C80 A;  5KG3 A;  3PLV A;  3B0Y A;  3WKA A;  4NLZ A;  1WG8 A;  4QZ8 A;  7ICJ A;  5J2I A;  4IUM B;  2WF7 A;  4U6P A;  4ECY A;  2WXI A;  3S2A A;  1RXW A;  5J0X A;  5EOZ A;  1ZQO A;  3PR5 B;  8ICB A;  3GZN B;  2ZVN A;  2WB1 C;  3N20 C;  1J0G A;  3GIJ A;  3HM3 A;  3QJZ A;  2IBI B;  2BDP A;  2FCN A;  1D9D A;  2KC2 A;  5AZF A;  4BOS C;  5JZE B;  1ZQU A;  2KJ8 A;  4Y2V A;  3D2S A;  4FS2 A;  2QB0 A;  3ZDE A;  5IOI A;  4DWF A;  5IN7 A;  5AK3 A;  1UUP A;  3A9J B;  2KJ9 A;  3VC8 A;  2QEJ C;  4EKU A;  2KQ4 X;  2BBC A;  4ANU A;  2F76 X;  3KKA C;  3MDA A;  2TSS A;  4YTN B;  1FEH A;  5J0R A;  4CGZ A;  2DAJ A;  5J2R A;  1Q10 A;  2LM1 A;  1I7H A;  2VA3 A;  4EBD A;  1ESF A;  1LKY B;  2E1E A;  3VR8 B;  4J9M A;  3R3M A;  2LI5 A;  4RPY A;  1L7P A;  3RFZ B;  3VUY A;  2L8J A;  1WRI A;  3HKZ F;  3IP4 B;  1SV0 A;  2PXI A;  5HP4 A;  1TTN A;  2GOL A;  2NRV A;  4AP4 C;  2JRH A;  1B9R A;  3LYS A;  4AOF A;  2EZZ A;  2ZUC A;  2XY7 A;  3RBE A;  3ZW3 A;  5E79 U;  2ALZ A;  8ICK A;  4DL5 A;  3NVZ A;  2E8P A;  4YFK A;  3JPT A;  9ICQ A;  1MHH E;  3OJS A;  4M04 A;  5KFS A;  4DQO C;  4Y2U A;  1RAX A;  3CP8 A;  2W9B B;  3AV8 A;  3I57 A;  4PHP A;  1KTK A;  3V6C B;  3ZNI D;  1YX5 B;  1ZQS A;  3AM9 A;  1XC9 A;  5KT5 A;  1OQY A;  4YXJ A;  3CRX A;  5I4D A;  2DZK A;  5IKC M;  4FS1 A;  1JUD A;  1XSL A;  2KMD A;  3N7S C;  2J6T A;  3ZRC A;  1K1Q A;  2Q5W D;  4F91 B;  5AKG A;  2IY0 B;  4M8M A;  2EH9 A;  2RDB C;  3SD7 A;  1JWA D;  1DK2 A;  4ECV A;  1RFA A;  4MGI E;  1MHX A;  3H7I A;  2NR2 A;  1TGZ B;  1MQ2 A;  3M9O B;  5DB6 A;  2ACZ B;  2C2R A;  2NRZ A;  5G5G A;  3N4M B;  1J7C A;  1PK1 A;  2WDQ B;  5LNK 1;  2MJE A;  2INP E;  4GXI A;  3NTU A;  2KX3 A;  3MFH A;  3RRH A;  5HG2 A;  4OJ5 A;  1WX8 A;  3DBR I;  1J97 A;  2RLT A;  3SAG A;  4OJL A;  5III A;  4M47 A;  5AM3 A;  2ATL A;  2XK5 A;  1V86 A;  5J17 A;  5L83 A;  4BJQ A;  2DZM A;  3ORY A;  4EEY A;  2K8C B;  1C3T A;  3LDZ E;  5AZG A;  3ETL A;  1JN3 A;  4O1N A;  3GZN I;  2E8M A;  4HPM B;  5IAA C;  3Q3J A;  2CHZ A;  1LV5 A;  1ZD4 A;  1VDV A;  2Y9U A;  2CHX A;  2KVS A;  5DG9 A;  3RB3 A;  2BQU A;  2FMS A;  1EF5 A;  1IP9 A;  2XID A;  8ICW A;  1IG6 A;  3C19 A;  4WAF A;  7ICM A;  5G5H A;  4FZN A;  3OHA A;  1RLF A;  2K4H A;  1WE7 A;  2PEA A;  1VCB A;  4FBJ B;  3ISC A;  1YIW A;  4LNO A;  3WAL A;  4M9L A;  2H3V A;  2IGD A;  2FDR A;  1X42 A;  2E3T A;  4CO7 A;  4GXJ A;  3F2D A;  1VD2 A;  3L13 A;  1QQR A;  4PT5 A;  1FFU A;  3QUQ A;  4BWJ A;  3K9O B;  3UM9 A;  5KG7 A;  4RNM A;  2GLS A;  3OHB A;  3RR8 A;  1UA0 A;  2FCS A;  1JWB D;  4ZYN A;  3ZUN A;  3UQ2 A;  2LGY A;  3GE3 C;  4EX7 A;  4GN1 A;  4A8X C;  4QZ9 A;  1A77 A;  3GQC A;  4OVU A;  3ZJU A;  2IA6 A;  1HTO A;  3KWL A;  4Y2P A;  4US9 A;  3AUL A;  2XVT A;  2JZB B;  1MSW D;  4Y2S A;  2EEL A;  7ICI A;  5CB1 A;  1V80 A;  2LUE A;  4BGD A;  1C20 A;  1JWS D;  2A1J B;  4YR3 A;  4ZDV A;  5KFV A;  5L1M A;  1ECW A;  5CP2 A;  4HWI B;  4QWB A;  3RN9 C;  4GOC A;  1XT9 B;  4W9G A;  1ZQD A;  3U52 E;  4IQT A;  3FIL B;  2LPE A;  1ZQJ A;  4RT3 A;  1BNP A;  1XD3 B;  3UMG A;  2HHQ A;  4UAT A;  3H0R B;  5F3X B;  3PZD A;  5ALV A;  1F5S A;  1KN5 A;  2D6F C;  2LXC A;  4JWS C;  4ICU A;  4ZYS A;  3TAC B;  3EGR A;  4TQ1 A;  3BQT A;  4MH0 E;  4JQW C;  1YN3 A;  1KFY B;  4R8U A;  2V1Y A;  4BZA A;  4WQM A;  1TYG B;  2AL6 A;  4GIV A;  4RPZ A;  4RQ7 A;  3A33 B;  5F9N A;  1S77 D;  4P7I A;  3SFE B;  2BQQ A;  3ZGZ A;  3JPQ A;  2QAR B;  3G6Y A;  1DGJ A;  3WKB A;  1OEY J;  2A5U A;  4DXG A;  4DXF A;  4EEK A;  5AEK B;  4XWT A;  5LXH A;  1A76 A;  2LWP A;  4YR2 A;  2XCA A;  2K8A A;  3MGI A;  3N30 A;  2JH7 A;  3VTU A;  1EUV B;  3WAP A;  3MJW A;  1A0P A;  2KHQ A;  4N59 A;  2W43 A;  4RQ5 A;  3ZVV A;  4RQ1 A;  7ICU A;  3CSF A;  3BK1 A;  3HW8 A;  1U47 A;  4G3I A;  2KE7 A;  3H4B A;  4USA A;  5AIA A;  1ZQV A;  3Q8P B;  1KFS A;  1JX4 A;  4DSL A;  1TKG A;  4BBN C;  5KFJ A;  2OXO A;  5DG7 A;  8ICT A;  2LGX A;  3RJE A;  2PFN A;  3HP6 A;  2OJR A;  4RGO S;  1RRB A;  3CF6 E;  1M6Y A;  1WI0 A;  4FA6 A;  2MBH A;  2M8S A;  2V3N A;  3T9L A;  5AIC A;  1DOX A;  4OCZ A;  1CMX B;  4LNF A;  3T8M A;  5DLG A;  1XLO A;  4QWE A;  1UZX B;  4ARC A;  4YSX B;  2XY6 A;  3QEB Z;  3PRM B;  4MM3 B;  5H92 C;  4YD1 A;  3O65 B;  5DDM A;  2J7Q B;  4ICA A;  3WK9 A;  2PTL A;  3DHH C;  4YT0 B;  2F1J A;  2BWF A;  2INC C;  4FLH A;  3V6E B;  1K5O A;  4IWO A;  1TK8 A;  1WXM A;  4Y2Q A;  4IC7 B;  2MCN B;  1TFR A;  2Y1J A;  2BWE S;  3Q8M A;  1A6S A;  1YJJ A;  2BT6 A;  3N97 B;  1WCL A;  3A9K B;  5AKL A;  5DBC A;  2CPR A;  1E7P B;  3OLM D;  1GB4 A;  5EE3 A;  4YG2 A;  2YMQ A;  2HHV A;  4RUC A;  3N3K B;  2Y5P A;  2LZ6 A;  1ZQY A;  1N63 A;  1OW5 A;  5ALU A;  3WKC A;  1QQ6 A;  9ICG A;  2KFK A;  4JIO U;  4KSL C;  1XCT L;  3L17 A;  1RWS A;  2J52 A;  2QIL A;  1BML C;  1H4R A;  3AED B;  3V61 A;  2KEY A;  1PVR A;  3BYT B;  2M0A A;  1X1M A;  8ICC A;  4KGS A;  1HEK A;  4KZC A;  2PI4 A;  3WAM A;  5AK4 A;  1TT5 B;  2KQ7 A;  7ICN A;  2KTF A;  2DYM A;  3H0M B;  4GLX A;  1JRP A;  1BPY A;  3IG5 A;  9ICB A;  9ICF A;  2BS2 B;  5KFO A;  2GBR A;  2KKV A;  3VRB B;  3ZXR A;  5DGA A;  5AK5 A;  4ECT A;  2ZPY A;  2LRW A;  4PS7 A;  3EWA A;  1LO5 D;  1UA1 A;  1SE2 A;  1HZ6 A;  3E2E A;  3QQ8 B;  3WA0 A;  2AQ1 B;  4ED6 A;  2LI6 A;  4P4O A;  3PRP B;  5DQG A;  1ZQ1 C;  4EZ9 A;  2V4R A;  3T79 A;  1V9J A;  3GS2 A;  2AXT U;  4KIK A;  2K4P A;  5AKK A;  2BYE A;  2X38 A;  4GGQ A;  4GSW A;  3RJK A;  1TS3 A;  1RYU A;  3I9V 1;  1ZYQ A;  4JLC A;  2MJ3 A;  4F2S A;  4EZK A;  4HK2 A;  3RF9 A;  4EZL A;  2WU5 B;  1NKE A;  2JZB A;  1KW4 A;  2LGS A;  3K1R B;  4DQS A;  2WTF A;  1YQ3 B;  3LXF A;  1HE8 A;  4NL9 C;  1Y88 A;  1YJI A;  4RF0 A;  4MF8 A;  5JRT A;  3U2S C;  2W7P A;  3M8S A;  2E8N A;  3JPN A;  3RZW C;  2B6G A;  1FM0 D;  1ZXH A;  3R2I A;  1ZQG A;  3U7Z A;  3AE5 B;  2G08 A;  2CJN A;  3UXO A;  1ZPS A;  5DPW A;  9ICX A;  2RHF A;  4PH5 A;  1PFD A;  4LZD A;  2XBB C;  2YX8 A;  5KNI A;  1WXQ A;  4PZO A;  5ALE A;  8ICI A;  2V0G A;  1I4H A;  3TFR A;  9ICI A;  1DOI A;  2PMZ F;  4DDI D;  1HUZ A;  2LRU A;  3HVZ A;  3BVZ A;  4YMN A;  2NMQ A;  4ED1 A;  3AU5 A;  3KUC B;  5ALM A;  2JYE A;  1KM7 A;  1D9F A;  4BX9 C;  4IS7 A;  3UI3 A;  4WJ3 B;  5TSS A;  1GO3 F;  4P4P A;  2O6K A;  7ICT A;  1WXV A;  3M62 B;  2KSO B;  3OG5 A;  4PHA A;  4L1B A;  3OGU A;  3NS8 A;  4GC7 A;  1XU4 A;  2WXK A;  4DK5 A;  1BXT A;  5DPT A;  3C21 A;  5FKA C;  3C2L A;  1E9M A;  1N48 A;  2KN5 A;  2AGO A;  3W2D A;  3H7S A;  3DHI C;  1ZOY B;  3TEZ A;  2N9P C;  4KLD A;  4W9F A;  3ZJT A;  7ICR A;  4PL1 A;  1WCN A;  2E1F A;  5DKW A;  1IUE A;  3X0W A;  4Q43 A;  2C7N B;  4B0E A;  3G6X A;  2M0X A;  1NK4 A;  3ZRF A;  3U8Z A;  1NK8 A;  2J0K A;  3VAW A;  4KV2 A;  3PX6 A;  3UPQ A;  3QZ7 A;  5E6P A;  4OJ6 A;  3G6V A;  3HIL A;  5KFD A;  2PVO D;  1I4G A;  4UAU A;  1PYW D;  3P2B A;  2HBL A;  3RPF C;  4XX5 A;  5KFL A;  3TAD C;  4FO6 A;  1TV9 A;  1NK7 A;  5J0Q A;  5BMI A;  1O08 A;  1JRU A;  4F50 A;  4DQR A;  2AHO B;  3B0A A;  1Y8R C;  5ALH A;  1FXI A;  1XSN A;  7ICS A;  5CA7 A;  5D3D A;  4I6P A;  4P0Q B;  3WK8 A;  2Y3A A;  4ZRQ A;  2G3Q B;  1OFF A;  3L10 B;  1ISN A;  2Z0D B;  5KHO A;  4ICV A;  4MDK E;  2JZZ A;  4DFM A;  2YB1 A;  5BOL A;  4DXA B;  3U26 A;  2JWZ A;  2N9X A;  5LLI A;  3HHM A;  4G9B A;  1WWU A;  1E5W A;  2CU1 A;  3T3N A;  2FIF A;  1Z2M A;  1IYF A;  3PTF C;  3JSV A;  2WU2 B;  4YL8 A;  4RQM A;  4MSM B;  5IA7 A;  2IOF A;  1X9S A;  4KKI A;  3PY8 A;  2DZJ A;  3WKE A;  4DFJ A;  3AE6 B;  3NG0 A;  2NVU I;  2PKE A;  4F7Z A;  2J53 A;  4AYB C;  5L9X A;  3BS5 B;  4JUZ A;  2XCP A;  5J2H A;  1SSN A;  3M95 A;  1QZE A;  1O03 A;  3PW4 A;  2L7R A;  2OOB B;  3F53 A;  1ZQA A;  4Q8F A;  4REZ A;  5IIJ A;  4RUA A;  3AE1 B;  4ECQ A;  2I5H A;  4RT2 A;  4WH4 A;  3WK6 A;  1YZ7 A;  1JIH A;  1ZQC A;  2L32 A;  4C4R A;  3ZDA A;  3TCA A;  1T5X D;  4P0P A;  4NPN A;  1Q5W B;  2OYY A;  5JHB A;  2GWS A;  3KZI U;  1BVS A;  5IIN A;  1XCQ L;  2D3G A;  5EE0 A;  4DWI A;  4MHV A;  1VLB A;  4OD0 A;  4ED2 A;  2JEG A;  5AM2 A;  4RQ3 A;  2BYV E;  2V3P A;  2MUT A;  5KG6 A;  1WJU A;  1HTQ A;  3HM6 X;  4QZI A;  1FRD A;  2UVW A;  2HBK A;  4UB4 A;  2QIE B;  4MGK E;  3SDL C;  5IIK A;  1ET6 A;  1P3Q U;  4W9K A;  3P42 A;  2NS5 A;  3NUQ A;  4X57 B;  1OEY A;  1F0M A;  2ZXI A;  3R7Q A;  3QZ8 A;  2DHZ A;  2O6V A;  3BVG A;  2PI5 A;  3ICX A;  2J4X A;  3EPI A;  2L5Y A;  2IHN A;  3ZNH B;  1E0Z A;  5DBA A;  2F1I A;  4JMU A;  3DWM A;  2Z8L A;  1BT0 A;  5JXV A;  2LMC A;  4ECZ A;  1L3U A;  4A9A A;  4EZ6 A;  4MAC A;  1RYR A;  1BPX A;  3BY4 B;  2ZJ5 A;  2KDM A;  2LD9 A;  3KQ4 A;  3KOO A;  2AWT A;  3AMZ A;  3L3F X;  1ZQK A;  4DOC A;  3ML9 A;  1TBE A;  3PO0 A;  2PFO A;  1K1S A;  3FC4 A;  2LVQ A;  2R8H A;  3VH4 B;  2H3Z A;  5EE9 A;  7ICH A;  1S3S G;  2N9E B;  3FKY A;  4NQK E;  3KHL A;  3A1Q A;  1I4Q A;  3ECI A;  4JPS A;  4HJK A;  3PW0 A;  2C7M B;  4KX5 A;  1KLU D;  1C9F A;  3ZDB A;  2FLL A;  3ZNZ B;  2ZW0 A;  4IL6 U;  5AM1 A;  1LXD A;  3VTV A;  2HI0 A;  2INN E;  1UWM A;  1FIQ A;  1GG3 A;  4NXZ A;  2W55 A;  3M9M B; 
#chains in the Genus database with same CATH homology
 1NEK B;  1VRA B;  2JXT A;  2Q5W D;  1IBX A;  1SE3 A;  3ETR A;  1L4Z B;  3AE4 B;  3AEC B;  1JWA D;  1MHX A;  4GLS C;  2YEP F;  1BUI C;  1KF6 B;  2ACZ B;  2KAJ A;  1QLB B;  5G5G A;  1J7C A;  2WDQ B;  5LNK 1;  1B1Z A;  2MJE A;  2INP E;  1MI0 A;  1OQQ A;  4HJG E;  3AE7 B;  5HG2 A;  4YSZ B;  1UGJ A;  3E56 A;  3ZQ4 A;  2LFI A;  3AE9 B;  1SIJ A;  3MHZ A;  2JQR B;  3V05 A;  3GB1 A;  4JX1 C;  2PLP A;  3C8Y A;  1SJH D;  3AE2 B;  2N7J A;  1NYR A;  4O1N A;  1XLQ A;  3VRA B;  1C4C A;  5HI1 A;  4MT5 A;  3R2T A;  4HRO A;  2BB5 A;  1VDV A;  4KKJ A;  5D3I B;  2CJO A;  4D2K A;  4WUR A;  1VZ6 A;  5FR3 A;  4WAF A;  5EE1 A;  5G5H A;  2WS3 B;  2PMV A;  3BII D;  2WXP A;  1QOB A;  1QF6 A;  2IGD A;  1T6B X;  2E3T A;  2N9K A;  1QQR A;  3DWG C;  1QIL A;  1T3Q A;  2QJL A;  4PT5 A;  1FFU A;  2H88 B;  3R8B A;  2L83 A;  4YSY B;  1TKE A;  3SEB A;  2WXL A;  1JWB D;  3NUH B;  4NAM A;  1QOF A;  3O13 A;  4A8X C;  1JWU D;  3BVM A;  4KX6 B;  3LB8 C;  1TS4 A;  2HTM E;  3ZJU A;  3KWL A;  4US9 A;  1STE A;  2IPK D;  2EEL A;  4OW0 A;  3HRD D;  4IOI E;  1JWS D;  1ENF A;  1K50 A;  2IDY A;  1N61 A;  2RPV A;  2RMM A;  3HUI A;  3U52 E;  1GB1 A;  1QT9 A;  3FIL B;  3GP7 A;  1ZDX A;  1HEZ E;  4N58 A;  1YNT E;  1XEE A;  4KGT A;  4JWS C;  4ZYS A;  2WXG A;  1V1O A;  1PDX A;  3KLS X;  3EGR A;  4TQ1 A;  1YN3 A;  1KFY B;  1EU4 A;  4ZHO A;  4WQM A;  1TYG B;  2WDR B;  1L0Y B;  3FIL A;  2K22 A;  3ZGZ A;  3SFE B;  1PGB A;  4OHJ A;  2G1E A;  3BWU D;  1FNW A;  2IJ0 A;  1DGJ A;  3EA6 A;  1TZO A;  2WP9 B;  2ZW1 A;  2ONQ A;  1TY2 A;  1JWM D;  1JAL A;  4DXG A;  1CQV A;  1NVI D;  1QOG A;  4DXF A;  4XWT A;  3NVY A;  4OZB A;  4LLG M;  1AW7 A;  1NYQ A;  3PZ7 A;  1RFK A;  2PVG C;  1YN4 A;  4N59 A;  1A70 A;  1XLN A;  2GI9 A;  3BK1 A;  2MJD A;  2LHD A;  3IT4 B;  1SF0 A;  4AS1 A;  1VR9 A;  4USA A;  1TKG A;  1CK1 A;  1VJK A;  1J7B A;  3E9S A;  4MH8 A;  4RGO S;  2IGH A;  2WXF A;  1GOZ A;  1FNU A;  2V3N A;  4WIP A;  1WYG A;  1DOX A;  4ZOH C;  1ET9 A;  3J9C A;  3TEX A;  1XLO A;  4ARC A;  1XXG A;  1C78 A;  5BMH A;  4YSX B;  2LHE A;  2XNA C;  2B76 B;  4MM3 B;  5H92 C;  4OZA A;  3VR9 B;  1P7F A;  1JCK B;  1ZP0 B;  2PTL A;  4YT0 B;  3VQI A;  1JRO A;  1IGD A;  4C7Y A;  2WXM A;  1SBB B;  1R7S A;  3KWV A;  3Q69 A;  1N60 A;  3ZJV A;  3NS1 A;  3L4P A;  1YJJ A;  3OWE B;  2BT6 A;  2K0P A;  2LUM A;  2JSV X;  2D5G A;  5T8I A;  2E6X A;  1E7P B;  1GB4 A;  1D4B A;  5EE3 A;  1YQ4 B;  2Y5P A;  5BYS A;  1PGA A;  2JZP A;  1N63 A;  3P63 A;  4TSS A;  3IAS 1;  4C56 C;  1GPX A;  1E10 A;  1L4D B;  1XCT L;  2BS4 B;  2JX5 A;  1RWS A;  1C76 A;  1FNV A;  2J52 A;  1BML C;  1TS5 A;  2JWU A;  2QIL A;  3AED B;  3P4R B;  2L52 A;  4ITK A;  4UDU C;  3BYT B;  2M0A A;  2K3U A;  5HHD G;  1V97 A;  4H2A A;  4B0M A;  1RYJ A;  3FAH A;  4KGS A;  4TQ0 A;  3T3O A;  1HXY D;  4GDK B;  1VZ8 A;  5AUK A;  2I2Y A;  4A6Q A;  2DYM A;  2HDE A;  2VZK D;  5E6J A;  5HFY A;  1JRP A;  1DYQ A;  4OVZ A;  1C77 A;  2BS2 B;  1AYF A;  1L5P A;  1SEB D;  1V8C A;  4A55 A;  3SFD B;  1JML A;  2MEK A;  3B2F A;  4OZC A;  3VRB B;  2WNM A;  3B9J A;  1L6V A;  1SE4 A;  1AN8 A;  1XO3 A;  4LTU A;  1TJE A;  1DOY A;  4HKQ A;  1LO5 D;  2N0S B;  1SE2 A;  4AQ7 A;  1HZ6 A;  1ZDV A;  2AQ1 B;  5C2T B;  1FO4 A;  2FUG 1;  3TEY A;  1ROE A;  2L1A A;  3GS2 A;  1HZ5 A;  3AB5 A;  4JWU C;  2BW2 A;  2X38 A;  1C4A A;  2J42 A;  2Y5C A;  1TS3 A;  1FCL A;  3NZ3 A;  3I9V 1;  1EWY C;  1WGK A;  2MJ3 A;  4IDI A;  2GRI A;  2WU5 B;  3BYY B;  3AE3 B;  1MVK A;  2K9X A;  1YQ3 B;  3LXF A;  3TUO A;  1QKZ A;  1I4R A;  4RF0 A;  1YJI A;  1FCC C;  1YMH E;  3U2S C;  1KH0 A;  3TEW A;  1FM0 D;  4NJC A;  1L6U A;  4C7Z A;  1ZXH A;  2PW9 A;  3R2I A;  3V3X A;  1FXA A;  3U7Z A;  1NI3 A;  2CJN A;  3AE5 B;  1K51 A;  1ZPS A;  3P4S B;  5MPO A;  3P1M A;  1D5X C;  1PFD A;  3HVD A;  3AN1 A;  1WXQ A;  1JQ4 A;  1EU3 A;  5AUI A;  4ARI A;  1GAQ B;  2V0G A;  1I4H A;  2IGG A;  1DOI A;  3ABV B;  1J7A A;  3HVZ A;  5C3J B;  4L23 A;  3BVZ A;  2NMQ A;  4P16 A;  2K5P A;  4ZRP A;  2JYE A;  2N9L A;  2MH7 A;  3BK2 A;  2WXQ A;  5GXG B;  1P7E A;  3MJ5 A;  3UI3 A;  5TSS A;  3AH7 A;  4RCO A;  3AEE B;  4CQN A;  2QMT A;  1EWC A;  1PGX A;  3IAM 1;  3P4P B;  4L1B A;  1D5M C;  2YEP B;  3MFG A;  4RGM A;  1QOA A;  5D7G A;  2WXK A;  2LEK A;  2ON8 A;  1BXT A;  4RH6 A;  2OHF A;  5FK9 C;  1CZP A;  1E9M A;  5FKA C;  2W3S A;  3W2D A;  3TEZ A;  1ZOY B;  1TS2 A;  3ZJT A;  3N9Y C;  1K52 A;  3W5U B;  1FD6 A;  1I4X A;  1IUE A;  2V4I B;  4B0E A;  3W9C B;  1NEN B;  4RFB A;  4EE2 A;  3W5V B;  2NTT A;  2LGI A;  2PVO D;  1I4G A;  1SXT A;  2KAC A;  4JE3 B;  2FBW B;  1PYW D;  1KRH A;  3RPF C;  4P6V F;  1D5Z C;  1FMA D;  3SR6 A;  2BTE A;  2BS3 B;  3Q8B A;  5BMI A;  1M4V A;  1MPE A;  1PUT A;  1F2R C;  4XWW A;  2WXJ A;  2SAK A;  1C79 A;  1CJE A;  3AEA B;  3H8H A;  3AE8 B;  3IT6 B;  3Q8F A;  3NRZ A;  1FXI A;  2WXO A;  1ACC A;  2ICI A;  5D3D A;  4ZRQ A;  1WWT A;  2Y3A A;  3AEG B;  1OFF A;  1UWX A;  2GB1 A;  2SEB D;  3URY A;  2WQY B;  2EKI A;  4XE0 A;  1XLP A;  4Q2J A;  1ZUD 2;  3EUB 2;  1V1P B;  4HKZ E;  4YTM B;  3B2G A;  1N5X A;  1I4P A;  3T3N A;  4WWM A;  3TSS A;  2WU2 B;  4RNA A;  2M19 A;  4KKI A;  3Q8C A;  2AX5 A;  1YN5 A;  3AE6 B;  3NVW A;  4KGR A;  1K53 A;  2PIA A;  2XN9 C;  4L2Y A;  4N6E B;  1V1P A;  2J53 A;  4R3D A;  2NTS A;  1SSN A;  2R61 A;  3AEB B;  3U4E G;  3CWI A;  2AQ2 B;  4HEA 1;  4REZ A;  4LK0 M;  4ZHP A;  2G9H D;  2KMM A;  5BYR A;  3AE1 B;  4HRS A;  3ZYY X;  3MC0 B;  4XDC A;  4NZL B;  1OQR A;  2CU3 A;  1Y56 A;  1L0V B;  4WH4 A;  2VZK B;  2M56 B;  1ZE3 D;  2L32 A;  1RM6 C;  1F2R I;  4IKG A;  1HQR D;  1T5X D;  2DYO A;  1N62 A;  3W1S A;  2I38 A;  2JYT A;  3Q8E A;  1D6E C;  3PZ8 A;  4J3O D;  3NVV A;  1IGC A;  1HA5 A;  1XCQ L;  2RDH A;  1TY0 A;  5EE0 A;  4YXD B;  1VLB A;  4XDD A;  3BZD B;  2WXH A;  1JW9 D;  2AQ3 B;  2V3P A;  2BYT A;  2W3R A;  2WXR A;  2QSD A;  3IXS A;  5BMG A;  3AEF B;  2FE8 A;  1N5W A;  2RDG A;  1FFV A;  1FRD A;  4C80 A;  3MP9 A;  1C4P A;  3CIR B;  2DLB A;  2WDV B;  2DBY A;  2QIE B;  1ET6 A;  2WXI A;  4M0W A;  1ZXI A;  4YTP B;  3P42 A;  5H8Y E;  1E6E B;  2BB6 A;  2H89 B;  3BVG A;  4FXC A;  1F77 A;  3Q8A A;  2J4X A;  1SB3 C;  4GDL B;  4YWG G;  1EM7 A;  4RF1 A;  1E0Z A;  2KN4 A;  2WLB A;  3DWM A;  1UUP A;  2Z8L A;  2QEJ C;  5JXV A;  2KQ4 X;  2BBC A;  2LMC A;  5BYQ A;  3P4Q B;  4A9A A;  4MAC A;  2TSS A;  4YTN B;  1FEH A;  2W54 A;  1Q10 A;  1I7H A;  2KDM A;  3KQ4 A;  1ESF A;  3WCQ A;  4RGT A;  3VR8 B;  3AMZ A;  1SJE D;  2W82 A;  3RFZ B;  4NAW B;  1TKY A;  1WRI A;  4A90 A;  2WXN A;  3PO0 A;  3FC4 A;  4RGN A;  1B9R A;  1XF5 L;  2JU6 X;  2PKO A;  5EE9 A;  1VZ7 A;  1UNS A;  2OED A;  2DWQ A;  1AWD A;  1I4Q A;  4JPS A;  1FRR A;  3NVZ A;  1F0Z A;  1MHH E;  4TMA B;  1IBX B;  1KLU D;  1C9F A;  4DQO C;  1KLG D;  3AV8 A;  3I57 A;  1KTK A;  2ZW0 A;  3AM9 A;  2INN E;  1L0X B;  1UWM A;  3LYY A;  4US8 A;  1FIQ A;  2KWD A;  1WSP A;  5I4D A;  2W55 A;  2LJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...