3B9JA

Structure of xanthine oxidase with 2-hydroxy-6-methylpurine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
ADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate orientation in xanthine oxidase: crystal structure of enzyme in reaction with 2-hydroxy-6-methylpurine.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords xanthine oxidase
total genus 40
structure length 162
sequence length 162
chains with identical sequence I
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2007-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3b9jA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b9jA01
2MJ3A 1TKEA 1E0ZA 1YJIA 1DOIA 1N5XA 5EE9A 2E3TA 1AWDA 2WU5B 2FBWB 1FIQA 3FC4A 3NRZA 3PO0A 2LEKA 3AN1A 1F0ZA 3P4QB 4LTUA 3AEBB 1IUEA 1QOBA 2BS4B 3AE7B 3AE3B 4YSZB 1R7SA 2W3SA 1RM6C 2W55A 1FRRA 2H88B 1QOFA 1ZXIA 1RWSA 3DWMA 2Y5CA 4N6EB 1CJEA 2MJEA 3HRDD 1T3QA 1JWAD 4P6VF 1N5WA 5MPOA 1SIJA 2M19A 1SB3C 1QOGA 2BT6A 4US9A 2M56B 3AEGB 4YXDB 2QJLA 2B76B 1QF6A 5EE1A 2OHFA 3KWLA 3LB8C 4IDIA 3AB5A 2JX5A 3L4PA 2PVOD 1TJEA 2JQRB 2Q5WD 1FO4A 3FAHA 3NVVA 1XO3A 2KMMA 2PIAA 4YTPB 3P1MA 2PVGC 3AE6B 1WGKA 4YSXB 5AUKA 5G5HA 1JWBD 1ROEA 2BS3B 3AE1B 5GXGB 1NVID 2W3RA 2CJOA 1FXAA 3CIRB 4WQMA 3RPFC 4HROA 1TYGB 1CZPA 1ZUD2 4US8A 1GPXA 1N60A 1KFYB 2MH7A 1UWMA 2WS3B 3ZYYX 1I7HA 1PDXA 1AYFA 3HUIA 2G1EA 3WCQA 2WQYB 2HTME 5H92C 4A9AA 2MJDA 2ACZB 1GAQB 3AEEB 1WYGA 1J7BA 1XLOA 1E10A 1JALA 5EE3A 1JQ4A 1J7AA 4YTMB 1ZOYB 4JX1C 3AMZA 1JROA 3W9CB 3AE9B 1FFVA 1TKYA 2L83A 2DBYA 2EKIA 2WDRB 4FXCA 4YTNB 3SFDB 4ZHOA 1B9RA 4C7YA 3EUB2 3VRBB 1KF6B 4C80A 1E7PB 1EWYC 1L6UA 4N59A 4YSYB 3W5VB 3NVWA 1NEKB 1NI3A 1WWTA 1FM0D 1PFDA 1QOAA 3NVYA 3AEFB 4HRSA 1KRHA 3NS1A 1PUTA 1XLQA 1E9MA 5C3JB 2WDQB 1OQQA 4N58A 5EE0A 1N62A 5G5GA 1VJKA 2WDVB 3B2FA 5C2TB 3VR9B 4USAA 2AX5A 4ZHPA 1WXQA 1NENB 1N63A 5H8YE 1XLPA 1JW9D 1N61A 1L0VB 1OQRA 2CJNA 5AUIA 1NYQA 1V97A 3DWGC 2W54A 1XLNA 4ITKA 1VDVA 1JRPA 3BIID 1DOXA 4JWUC 1FXIA 3ABVB 2K9XA 3AEDB 2WP9B 1L6VA 1RYJA 1YQ4B 2L52A 1V8CA 4YT0B 3ETRA 3SR6A 2DWQA 3P4RB 3VRAB 1VLBA 4C7ZA 3P63A 2WLBA 4ZOHC 1QLBB 2CU3A 1RFKA 1QT9A 3P4PB 3LXFA 1DGJA 3VR8B 1TKGA 1WRIA 3SFEB 1A70A 4JWSC 1FMAD 3AM9A 1FFUA 2H89B 3AE8B 3NVZA 2N0SB 2QIEB 3AV8A 2K22A 2WU2B 1SF0A 3HVZA 2K5PA 1E6EB 1YJJA 3AE2B 3W5UB 1L5PA 1YQ3B 1OFFA 1J7CA 3CWIA 3AE4B 2BS2B 3AEAB 4KX6B 2PKOA 3AE5B 3B2GA 3AECB 1FRDA 3B9JA 1ZP0B 1NYRA 1DOYA 2KAJA 3AH7A 3P4SB 4WWMA
chains in the Genus database with same CATH superfamily
4NV0A 2YB1A 3IT4B 4RFBA 2AXTU 2G45B 2Y5PA 2DZKA 1F2RC 2E6XA 4HYKA 2Y1IA 3IRUA 4GXIA 1ZQMA 4P4PA 3PR5B 3GIJA 1S3SG 1U49A 2QSDA 5J2BA 1XCQL 2BDPA 1FRRA 1ZXIA 2R8IA 2W8KA 2ZIXB 2D10A 1T3QA 3A0BU 4A20A 3PPAA 2ALZA 2ZCCA 1ZYQA 4KITB 5AKZA 2LGXA 2BQQA 3QNMA 2G06A 4QZGA 1D8BA 2ZJ8A 4P4MA 2N7JA 1KBUA 3ZRFA 1QF6A 5IAAC 1TV9A 2DGZA 1C77A 1K53A 3U7DA 1TJEA 1L2NA 2L8JA 4YXMA 3MDCA 5KT6A 2V3NA 1FEZA 1QLNA 2VA3A 5IIIA 4WQMA 3RPFC 3HILA 3GILA 2ZNVC 4MT5A 1JMLA 2WS3B 3Q8RB 1PGAA 4ASWC 4YG2A 2Y9UA 2BBCA 3HUIA 4JK1A 5H92C 3T79A 4UB8U 4O3PA 4F5RA 4NJ8A 5ALNA 1SE4A 5FR3A 2CR5A 1NNLA 1FCLA 2D3CA 4YFKA 3SAHA 2R18A 1VCBA 4GIVA 4ECRA 1WXAA 9ICCA 2DPJA 4RGTA 5DB8A 2JU6X 2WXFA 2EH9A 3O0FA 4LJOB 5CHWA 4DOAA 2FE8A 3RF9A 3JPSA 2FCNA 1PFDA 4DS4A 1L4ZB 2FCSA 2EDUA 3QCAA 1U9LA 4KSLC 4NPNA 2HI0A 5KFTA 2WDQB 3M63B 5D46A 3DVNU 4IG7B 3AU6A 3PLVA 1VJKA 2WDVB 2KZZA 2AX5A 5DGBA 2JYEA 3U26A 1PK3A 4GOCA 7ICQA 4G3IA 4DOCA 5C5JA 1Q3VA 5ALQA 5CHGA 1TFRA 2F8LA 3RTVA 3R7RA 1FXIA 1P7DA 2KKVA 2J0KA 2MCNB 4MELA 4IL6U 2VH1A 3FKYA 3ZKJC 3K4GA 5KFGA 3PZ7A 2DWQA 2MUTA 1CI4A 1NZPA 1CMXB 2FNJB 2BPCA 4ZOHC 2VA8A 4BWMA 2ICIA 5D3DA 3MC0B 2R2OA 4A55A 4ANVA 2XY6A 2FMPA 4PS7A 1K5OA 4MGIE 1GUAB 1KL9A 1FFUA 2HBLA 4DS5A 3PW2A 8ICNA 3N4MB 2YQEA 3IN5A 1UWXA 2KMDA 4J9OA 3APCA 1N56A 1NJYA 2ZVOA 3IAM1 2Z7JA 2B6GA 2HVIA 4M47A 2AL3A 5EE9A 2E5SA 1F0MA 2QMTA 4DBGA 2KX0A 2KE7A 2JYTA 1SKWA 5HHHA 7ICTA 2F44A 1RYUA 4M01A 1MHXA 1C7YA 3HT3A 2KJ6A 3PY8A 1QOFA 5DCNA 3K1RB 4P4OA 2NMQA 5FR6A 3H0MB 2IY0B 3DVGX 3QX7A 2N9PC 2CN1A 3BINA 3EC8A 3A9KA 3UI3A 1MC8A 1C9FA 2MEKA 1V49A 4P1CC 4DCCA 4JWMA 4IDIA 2KN5A 2JX5A 2LZ6A 3CNHA 3RRGA 3UM9A 4G3XB 4MF8A 3ORYA 3QU4A 3MR5A 2IBKA 1OEYJ 1WXMA 2QDFA 2I2YA 5AZGA 2MU2A 4ECVA 2INDC 1RXWA 3AE1B 3KKAC 2J6SA 5C0YA 4KV2A 4EUTA 5BMHA 4US8A 1NK8A 5AKHA 1SXDA 2ZUDA 2KQ4X 1NJWA 4O3OA 1WIAA 2P6RA 1BGXT 4UAWA 3VCBA 1JMSA 2K6DB 1B43A 1PGXA 5DG9A 2W9BB 1PUZA 3EHVA 4NLNA 1J7AA 2EAOA 5DGAA 4DFJA 3OJSA 1QQ7A 4IQUA 5HNKA 5KFIA 4DF4A 3NY5A 5L1MA 1NOMA 3NUQA 5J0YA 3Q8SB 1MG8A 1ZQXA 4RPYA 4KZ0A 1RQNA 1P7EA 1V81A 1WWTA 3SU8X 5J2HA 3NVYA 3AEFB 2ZTEA 4RT2A 3DBRI 1XLQA 3L17A 3BK1A 4BAXA 2KFZA 1D5ZC 4R64A 2LMRA 2IOFA 3B2FA 3O13A 2IPKD 3ECIA 3O65B 2IO0B 3Q3JA 4GSWA 2CJNA 2VZKB 1CQVA 2IDYA 5KFWA 4OJOA 1COKA 3HJEA 2KTFA 4FULA 3DBLB 3PZ8A 3UQBA 2N9EB 2JSVX 4J03A 2FPKA 1HE8A 3WK8A 1ED1A 3PVLA 3ETLA 1V38A 5JRTA 1C4AA 2WLBA 2NV3A 5AZFA 1S0VA 2IOFK 1Z19A 4FO6A 1ESFA 3DDHA 4MJSA 1U4BA 1XEEA 1YOVB 3N28A 2K8CB 4RUAA 3BDPA 1L5PA 4PHEA 2M0XA 3UXOA 3AE4B 3RMKC 5IO9A 1WI0A 3QC8B 2HHWA 4B95A 3ZJUA 3EPGA 3RJFA 4NY0A 4UB4A 1KLUD 2NYVA 2G3QB 4Y2TA 4I2HA 4WWMA 3Q2AC 2DQNB 5AI6A 1NKEA 2IGGA 3EPIA 2EMTA 1TE2A 2G5HB 2XICA 3ZNID 2BGFA 1RYSA 4B9SA 1RFAA 1HXYD 1DK3A 4CNQA 2ESEA 4F4YA 4RQ3A 4M9GA 2DNFA 3W1SA 2W3SA 1ZQCA 4O5CA 2H88B 3C1ZA 3WKEA 3PV1A 4KLTA 1K50A 4OCZA 3WKAA 4M9HA 1XD3B 1SWVA 2IGDA 5ALYA 3TAQA 4K3BA 4GFJA 1SJED 4KDLB 2M4NA 2LJ5A 1WR6E 2MA9B 2ZIWA 2IZVB 4A90A 3T3OA 2JQRB 2M8SA 3KVFB 1PZNA 4C4TA 2DZJA 3OJ4B 3TFSA 1S5LU 3H7PB 2KX3A 4PL2A 3CIRB 3N7RC 1Z5SB 2K4PA 5HHIA 2K8BA 1KEJA 2MH7A 2LYHA 1V1PB 3A1QA 4IC7B 1UPHA 3WCQA 3CP8A 1TK8A 2JZ3B 4MSMB 2RMMA 3U8ZA 4P1BC 3VTUA 4JMUA 4ZRJA 3SD5A 4DHZB 3V7LA 4XA5A 1UELA 2YVCA 4UDUC 1FFVA 1JI7A 4JB3A 2WDRB 3ZLZA 3TANA 4O3QA 2MWSB 4AJYB 2JMGA 1DRGA 1Q0WB 3GV7B 5CWRA 3QQ8B 4J6IA 1HUOA 2BQRA 3ZGZA 2FUHB 1NK9A 4CF4A 2KVZA 3L13A 4XGAB 1NDDA 2LGDA 4GLXA 4EZJA 3T5KA 4PZNA 1BUIC 3AI5A 1TZOA 2NBWB 3NUHB 2HOIA 5EE0A 1EF1A 2EKEC 5KFCA 2WXGA 5KL8B 4F4KA 1NENB 2HHQA 5AM2A 4KIKA 1STEA 2K60A 2KJRA 1L5UA 3F2BA 1SIFA 4OVUA 2WXLA 5BYQA 2KQ7A 2L52A 2ISOA 2Z59B 3A33B 3ZRCA 4O1NA 1QLBB 4II3B 1ZQPA 2K4EA 2WXKA 2JRZA 2NR2A 4MEXA 1H38A 2FI1A 1PQSA 4ZYNA 4I29A 5D94A 4PS3A 3DHHC 3H1UA 2NPTA 3MR3A 3HHMA 2DF4B 2WX1A 2H5XA 2W9AA 3C2MA 3SEIA 4RQ1A 4ED6A 2PKOA 2KLCA 3CF6E 1ZP0B 2QARB 5AHXA 2HHSA 2LM4A 3OLMD 4DDID 3H7SA 3UPQA 1WF9A 1L4DB 2KMAA 4HPPA 2E3TA 4HWIB 4QZ8A 3NRZA 2XC9A 3VHTC 1X6JA 2GOWA 2GBNA 2HW3A 2BYEA 3LWLA 3GB1A 2DKZA 4LTUA 4DL3A 4KLSA 2K1FA 1T4GA 2ZIXA 3MP9A 2GH1A 4EYHB 1L3UA 1ISNA 2ZIUA 2N7DA 5AKKA 3DWMA 4RQNA 1JXEA 4F92B 1SEBD 2TSSA 1WJ4A 4DSIA 1T6BX 3G6XA 3AEVA 1E8XA 4ED0A 2D2QA 2M19A 2WWZA 1WY8A 5ALMA 1BNPA 5CJ7A 3MGVA 1HA5A 4RQ6A 4P16A 4HKQA 2PKEA 2LGYA 5F9LA 5J8YC 5L9XA 2PIAA 5IIOA 2Q5WD 4ECQA 2MBQA 2ZJ5A 3P1MA 3Q6BA 4A6QA 4LJPB 4EFOA 5FK9C 2XY7A 2LGSA 2KHVA 2MAXA 4NZLB 3ZO5B 8ICEA 4DQOC 1HTQA 2OH2A 5ALWA 2IOHA 3H8WA 1E7UA 2K3UA 4CE6A 2C2DA 1CZPA 1N6ZA 2WF6A 2HOQA 2XI9A 4GU2A 1Q8KA 4KLHA 4JPSA 3PMNA 5J0UA 2J6TA 4Y2YA 2GBKA 5JHAA 4KGRA 4J9QA 1AYFA 1K1SA 1JUDA 4KLUA 2RLTA 1Z00A 2AGPA 4CCHA 2K25A 4Y2QA 1L8LA 4M0WA 3R8BA 4DQQA 2OOBB 5AI8A 3PSFA 5CP2A 3RI7C 2I5HA 5LXIB 1T8EA 4UB6U 2KLGA 9ICLA 4U7CA 1B9RA 4C7YA 2KDFB 4C4RA 2GWSA 1WR1A 9ICRA 2LWPA 3EZ5A 5EOZA 3L3FX 2PFOA 2KZMA 1P1AA 3BQ7A 4RU9A 4BVUC 5G5GA 2KHWB 3RH4A 1T0RC 4KGTA 3DOWA 2LRUA 3RCZA 2L76A 1N63A 1Q46A 4EZLA 1DXSA 1LO5D 1LXDA 1ZDXA 5J2CA 2GI9A 2J0MA 4FN2A 2OEDA 2HOFA 3H7IA 3U30A 3UF8A 2XCPA 2NTTA 1WWUA 5AIBA 4ANWA 3QUTA 5CEHA 2JXTA 2X38A 1ZE3D 2CHWA 4GXKA 3C0RB 2WDTB 1IIPA 4K4GA 1YQ4B 4NWIA 4NAMA 4KKJA 2IJ0A 4FADA 5AEKB 3T3NA 3QZ8A 4J9PA 1HJPA 2M9NA 1LKYB 1RFKA 5ALHA 1BPZA 2LRWA 4ED2A 2BKEA 3G6VA 4ZYSA 1ZJNA 4RQMA 4AYBC 2K22A 1RQLA 1TY0A 2K5PA 2J42A 3BY4B 3QYPA 2RDIA 1I4GA 3S2AA 3R9KA 2BS2B 3VTWA 3AE5B 4KZCA 4OJPA 3VH4B 3P4SB 2KC1A 4RNAA 2MJ3A 1D8LA 1YJIA 4UATA 4O9MA 4B9LA 2KFKA 9ICIA 3AN1A 5HFYA 2IA6A 3ZQ4A 3N32A 4I28A 2W7OA 4P2HA 4I6LB 5J2AA 1RM6C 4PHDA 1Q10A 3WK9A 4X57B 3ZIMA 1D3ZA 3FYHA 4M9JA 4OZBA 4A3OA 2MRLA 9ICBA 2UVVA 4JQWC 1N5WA 4DLEA 1OW5A 5FP0A 4DEZA 4US9A 5T14A 2ZCBA 2B76B 4MH0E 4ZRKA 2ISPA 3IHQB 1B4FA 3KKAA 1PYWD 3KZXA 8ICKA 3R7QA 2ASLA 4UBCA 4ED7A 4K81A 4MSQB 2KDEB 1KFSA 4YTPB 1WGYA 1ZQAA 2K39A 2UU7A 2M0NA 1X1MA 3AE6B 1QSSA 2KEYA 1HQRD 2RPVA 5E79U 3H40A 1RDFA 1ROEA 5KG7A 3IBEA 2FLLA 4BGDA 5TSSA 2IMWP 1TS2A 1L0YB 3LWMA 1NK7A 2AQ3B 1N60A 4C4VB 1KN5A 5J29A 2DYMA 2KDMA 2V1YA 2WAQF 3V3XA 4WAAA 2PFNA 5TISU 2LD9A 3PRMB 3OJUA 1JX4A 4YTMB 1WCNA 2KJ9A 4LZDA 3H8SA 2XY5A 1FCCC 3UXPA 2V4QA 1E8ZA 1J19A 2KQSA 2R8HA 2HJ8A 1NEKB 5J2RA 3UINB 9ICXA 4EZ6A 3ZD8A 5ALEA 3UMGA 2B3AA 4DL5A 1TIFA 1KRHA 3APFA 2F2AB 3IFWB 4I2GA 3KFUF 3ZW3A 1XLPA 1JW9D 1N61A 1R4NI 4ECTA 3RB4A 1ZQUA 2NVUI 5A0LA 3RR7A 4XE0A 5HR7A 1NK6A 2DAJA 2PMZF 3ABVB 1DGSA 2QB1A 2MX2A 3T9LA 4B9NA 4AOFA 4F1SA 3IDWA 1L3TA 2W7PA 3D32A 5AKIA 4ECUA 2CU3A 4AS1A 3HKZC 3NG0A 3C2LA 4QAYA 4KLIA 2O6KA 4RNNA 1RYRA 1ET9A 5AI9A 2QIEB 3AXCA 2WU2B 2FMQA 4FHKA 4P7IA 4DSEA 4OJ6A 2W9BA 4F4WA 3Q8CA 1ZQBA 2E8NA 4YQWA 4KX6B 2N9LA 3MTNB 3RB3A 1YT3A 4YD1A 4M6WB 4NJCA 1PK1A 2CHXA 4C8KA 3I63C 1A5RA 2YMPA 1WGDA 4UBBA 4FBTA 5DLFA 2RDGA 4S17A 4XUSA 7ICPA 1NBFC 1UBIA 3DVGY 4NJ7A 3OJ3A 3KH0A 1SGGA 4KMUA 1RLFA 3DBRB 3VQIA 2KG5A 2G07A 3PGEA 2Q4TA 4J3OD 4OVVA 3KTQA 1HUZA 3VFKA 3MDAA 4HDQA 4LDTB 4WJNA 3MHZA 5AM1A 4FFDA 5J2DA 1Z3EB 1NJZA 2OWOA 1ECWA 5AKGA 1K8RB 5CHVC 3PT2B 2V4LA 4J9RA 1FO4A 2I1QA 4AWJA 3EFUA 1TS3A 2JPHA 2D8CA 4M8NA 9ICAA 3D2QA 3NS8A 4W9CA 2ZTCA 5D2MB 2KSOA 1IP9A 4HJKA 4H2AA 5KHQA 4LJXA 4F3OA 3GS2A 3N1YC 4RUCA 2KNBA 1XWLA 2HDOA 4M9NA 3P2BA 2HHXA 4IWQA 2RPQA 1V5TA 4NLGA 4ELVA 1WYGA 3Q8LA 4KX3A 2V9WA 3GIKA 2O2VA 5EE3A 2NRWA 3C19A 2BDUA 1JQ4A 4DF8A 2ZZPB 1U45A 2WF9A 4QW9A 2FUG1 1ZQYA 2L0FA 1IPGA 2AWTA 2WXOA 4OZCA 2J6UA 4C8NA 2WB1F 3EUB2 3L5KA 1ZQJA 1HZ6A 4M2YA 2X8XX 4MGKE 3SQIA 1SXTA 2BKRB 2IHNA 1OQQA 2F77X 3WA0A 4FBJB 4MFAA 3QHTA 5DDMA 1V9JA 3VR9B 1XC9A 4MEMA 1WXQA 4MM3B 3F2DA 2HHUA 5J2IA 2BWFA 1KFDA 3Q8QB 5AI4A 2WTFA 1E7VA 3D2SA 1WX7A 2KTRA 4WQOB 1A76A 2J7QB 3KUDB 3OGUA 2KWCA 2WX0A 2YY6A 2WHIA 5KT3A 5KFRA 2AGQA 3UXNA 3TKAA 4IKGA 2H3VA 2JZBB 5G2NA 2K89A 4QWEA 5IINA 3Q8MA 5ALGA 3C5GA 3LXFA 4YMMA 1TKGA 4HK2A 2L5YA 8ICJA 1GJZA 5J0QA 1ZQNA 2LMCA 3AV8A 4E74A 3BJYA 1NK4A 4B6JA 3OAWA 1E8WA 2NPTB 1SV0C 1OFFA 3V6JA 3U52E 4RQ4A 4P0PA 3SMVA 1TAQA 3WALA 3K1ZA 1RXVA 2F3NA 2MBBB 4I6PA 1T7PA 4MH8A 4W9EA 1WRDB 2KWVB 3THVA 1YMHE 2KOBA 3RZFA 3ZD9A 3NZSA 4FJVB 2EZXA 4EENA 2HE7A 2BB5A 1SL1A 4RCOA 2AYOB 3IVFA 4ICVA 1GC7A 2YTUA 5ALPA 5DG8A 4DL4A 2BS4B 4M8MA 5D7GA 3R66C 2UVUA 3TAPA 4QZAA 4NLKA 2B0CA 2WXNA 2IY1B 4PHAA 3KUCB 5J2KA 8ICYA 1ZQWA 2BQ3A 3PR4A 2LI6A 2JY6A 4KIKB 5KFFA 3RNAC 4ANXA 4EYIB 4B9UA 2CXYA 4TQSA 4FLHA 2DENB 5EWFA 1YIWA 2PVOD 2KV2A 1V9PA 5JTIA 1KSPA 7ICGA 3U7ZA 2KMMA 1N2XA 1X40A 1QZEA 3PO5A 4PGXA 1C78A 1HEZE 3R2TA 4A8EA 5KAIU 2W3RA 5DBCA 3BS5A 4CDGA 1IGCA 1YJ1A 5L1LA 1R4NB 4HROA 2M17A 2H3ZA 4TQ1A 1BMLC 1L3VA 1Y8RC 3VDZA 3UMBA 2Y0SC 2QKQA 2HTME 1L3SA 1D9DA 4KKIA 2R8GA 1F77A 3V61A 4FJYA 2K8AA 4XDCA 4HEA1 1SV4A 2BCVA 3VC8A 3JPOA 2FE9A 2AQ1B 2KDBA 5ALXA 1SL0A 5J8YA 1KF6B 5DQIA 1XF5L 4LK0M 4GDLB 1D9FA 4F5OA 1M4VA 3TJPA 4KLGA 4KLDA 3ZVVA 4DFDA 4W9FA 2WAQC 5J0RA 4Y2RA 3BQ1A 2FPLA 2I1KA 1HTOA 2R2QA 3DWGC 3RJJA 3V6EB 1H4RA 2D07B 2BPSA 4QZIA 4F8RA 1DOXA 3GE8C 1C4CA 5L1JA 1EXNA 1SV0A 2JEFA 1V8CA 1YX6B 1UBQA 4PYZA 1TVAA 5CA7A 3DDCB 5JH5C 4UB3A 1PGBA 1U4AA 5AM5A 4MGZE 2W04A 4XQ8A 3QIJA 4RPXA 4C4VA 3TUOA 3AE2B 1PVPA 2E1FA 1XSNA 4WJ3B 4WH4A 1X9XA 1MQ3A 3SV4A 3LYSA 3HM3A 3KYCD 3AECB 4PH5A 5KFKA 8ICFA 1O08A 2KJHB 4MF2A 4YR3A 2NBUA 1AWDA 5ALUA 2BW2A 2DL0A 3Q3OC 2ZVNA 3NJTA 4JL9A 3QAQA 1ZQTA 2G08A 1IUEA 3CSTA 4NAWA 2REXA 2BZFA 3HW8A 2Y5CA 1DOQA 2VKQA 1KKXA 2PLPA 3HRDD 3SENA 3URYA 2GBRA 3AUOA 3PW7A 3ONSA 3G6YA 9ICOA 2M56B 3RT3B 4EBEA 2CRXA 2PE6B 5KG2A 4YXJA 1F5SA 1UD7A 4XYCA 2XBBC 2JRIB 3QU5A 1L8OA 3M1YA 4Q8FA 1WXSA 3FAHA 1T0QC 1GC6A 9ICGA 4G9BA 4XRHA 4U6PA 1RAXA 3I3TB 1C79A 1LVHA 3SAFA 2SEBD 4MM3A 8ICGA 1K52A 3MFHA 4JIOU 1QQ5A 3DBLI 4PT5A 5TZVA 3RNBC 3IG3A 3TEXA 1KFYB 4QWAA 3TCAA 1SSNA 1KW4A 2HMXA 3ISCA 2BYVE 4RH6A 4AUQC 2ACZB 1XLOA 4B0EA 2N1WA 3TSSA 3QX1A 2KFJA 2RD0A 1QH9A 2ZJAA 1FXTB 2KDIA 3AULA 4KN7A 4TURA 2DZMA 4G11A 2L83A 5AM3A 3SFDB 4FXCA 2QB0B 9ICHA 2K4HA 3V6KA 1E90A 3VRBB 1HZ5A 3H4DA 1SL2A 2J52A 2JUOA 4ECSA 2FIDA 2NCNA 4DWFA 2OXOA 4F2SA 1FPYA 4CYEA 1PUTA 9ICWA 4K3CA 3QJZA 4OD0A 2YEPB 1MSWD 3IG5A 5C2TB 8ICIA 2EQYA 2JEIA 4IS7A 4D2KA 3EYZA 4RNMA 5KT4A 5ALTA 5B66U 3ZNHB 2VRRB 3OWEB 5AI5A 1C1YB 4GIBA 3RJGA 9ICMA 7ICNA 4R66A 2Y3AA 2K9XA 4FHJA 4XX5A 5KG1A 5C23A 3QUQA 4BDPA 1J2NA 3SR6A 5KNIA 4KVGB 4MGYE 4JUZA 3MR6A 1UT5A 3KZIU 3F2CA 3C28A 2IHMA 4PZOA 4XWTA 5KFPA 2J4XA 1KQQA 2WXHA 2BQUA 3R3MA 1FEHA 2VJ4A 3M9OB 4TV3A 3D6JA 2ZW0A 2YMQA 3TMPB 2NRTA 3V60A 1B1ZA 2MQJA 4XWWA 2P66A 1CK1A 1WFYA 1MHHE 2ONQA 3MC9A 3BS5B 1X42A 3PZPA 2XK5B 5KG4A 5J0TA 8ICWA 8ICCA 1PK1B 3RUIB 5J0XA 4IRCA 1N5XA 5KFEA 1X2IA 5AKJA 4EBDA 2KJ5A 1JN3A 3PZDA 4MDKE 2E8PA 4QW8A 2P6UA 2PXIA 4OVZA 2DKXA 3PMLA 3T5HA 1GB4A 1OQYA 4BXOA 4AP9A 1UT8A 4QIWC 2KWDA 2MW5A 3N9YC 4OW0A 3VVWB 1JWAD 1ZQSA 3KW5B 2ZIUB 4I27A 4LNFA 1LQBA 2C9WB 1QOGA 4GLSC 5EE1A 5KTQA 4Z6CA 5KL1B 4RF1A 4ANUA 2W8LA 2GRIA 2KVSA 4IM0A 3ZDCA 8ICUA 2HDEA 2PVGC 5AK5A 3HP6A 3KHLA 1FNVA 5E6PA 2KICA 2LI5A 3PHXB 4BKGA 5AM0A 4HPLB 2LUMA 2GMIC 1RG6A 1JWBD 2N1VA 2E8MA 2WF7A 4UB2A 1UNSA 1YN3A 2CJOA 3WANA 1S97A 1UZXB 2RP5A 1GPXA 3TEZA 1MJDA 2AEHA 1GNUA 4W9GA 1OUQA 1WGRA 1A6SA 1B0XA 1K1QA 1I7HA 2LVPA 9ICNA 4IUMB 3APDA 1UF0A 2ZXHA 2JRHA 4B9TA 3AEEB 1SXEA 3WAPA 2KNJA 4RPZA 4DSFA 2FDRA 2F1HA 3HWTA 1NKCA 5HHDG 3ALRA 2KC2A 2R61A 3JPRA 4DXGA 3LVVA 3GIMA 4QZDA 2WB1C 3X0WA 1P9DU 4W9HA 5FKAC 2N1RA 1ZD3A 1TKDA 3IP4B 3RAXA 2D3AA 2G4DB 4NAWB 4C00A 4JV0A 3VXWA 1FM0D 1QOAA 2JVCA 3HX0A 1TK0A 5KHOA 4CF3A 2WFAA 2BF8B 2RHFA 2JWZA 1WX8A 3VH3B 9ICPA 7ICJA 1X66A 4ZHPA 5ALLA 3ENEA 2H3FA 4IOIE 4LVSA 4W9JA 5KFXA 1LGRA 5KFVA 4QWCA 4LNKA 3M8RA 1XLNA 1TAUA 5ALFA 1WGGA 4EELA 2LJIA 2I9GA 4RNOA 2RQ5A 3I5JC 1ZQZA 2ZIVA 1L6VA 2K8CA 4ED1A 2LHEA 3KD3A 3ETRA 4PYUA 5LXHA 1XT9B 2KZRA 1ZQEA 1V6EA 1P3QU 4NM1A 5DQGA 1SZPA 1LKYA 2L1AA 2ZNVB 7ICVA 5BYRA 3QZ7A 4J9KA 5DB6A 4HDOA 3X23A 2G0AA 4RQ5A 2PPHA 4R3DA 3PRZA 3ZXRA 2OJWA 4F72A 2HBJA 3DBHB 5D3IB 1NZBA 2Y5BB 3TIXA 5I4DA 2KFNA 3DHIC 4DQPA 2LHTA 4QIWF 5AKYA 3BZCA 4NQKE 4Y2SA 4DHJD 2QILA 1EU3A 4IR1A 1DK2A 3JSVA 4KLFA 5IILA 1XXGA 5E6JA 1WMHA 3ML9A 2WF8A 4F5QA 4M02A 3NZ3A 1ENFA 2FBWB 4WWOA 3N7SC 3MJ5A 4S0RA 3PO0A 2E8OA 4HCPB 3TQ1A 3PX6A 3AE3B 4DSKA 4Q8EA 4YSZB 2W9NA 5JHBA 1C3TA 3I57A 1BPBA 1ZQQA 4N6EB 3PX4A 2YB4A 5D4BA 1S0NA 1SZHA 2MJEA 2C28A 3B08A 1L6NA 2WXJA 2PMZC 4DL6A 3VAWA 2N9XA 2ZPYA 5CRXA 3M6KA 3BQ0A 5EDSA 1DYQA 2ZJDA 3LB8C 4KMOB 5JXVA 1QKZA 4DFMA 5J2FA 1VD2A 4RGMA 4ECWA 3NVVA 2ASQA 4KLMA 2V4IB 3E58A 1L7NA 4DXFA 4DSLA 3H4BA 2KTQA 4GN1A 5DKWA 4O5KA 4JV1A 1EUVB 5G5HA 3TEYA 1XO1A 2JR5A 4ARCA 3Q8KA 3BYYB 4GB9A 2PTLA 3SI8A 3S6JA 3AU2A 4R8UA 4C0ZA 3K9PB 1UWMA 8ICOA 4ECYA 2G1EA 4UARA 4A9AA 3F5EA 1J7BA 2OEHA 2CU1A 3ED5A 1WZ0A 1KLVA 4UASA 3ISBA 1VRAB 2GBJA 3RB6A 2SAKA 1MN8A 5J2GA 3A4SC 4BBNF 4ARIA 3GZNB 3QEAZ 3IT6B 5JU5A 3OPXA 4K4IA 4J9MA 7ICFA 4ED3A 3E2EA 1WJUA 2EZYA 3ZUNA 2BCUA 3KBBA 2DBYA 2XEWA 4PS8A 4YTNB 1JWMD 4EEWA 4JLCA 5KAFU 4N59A 3W5VB 3NVWA 2L32A 3JYUA 1LV5A 2EELA 2D3BA 2WXQA 2D3DA 4ELTA 1VZ6A 1I42A 3NS1A 4GDKA 2PE9A 1D4BA 3WAMA 1ACCA 2UYZB 5KG5A 1I4PA 1GG3A 4TUPA 2AL6A 2V3PA 4YMOA 3ZDAA 5T8IA 3GIIA 3RJHA 5AUIA 4O0IA 1MPEA 1HEKA 3RNGC 3T5LA 4QWBA 8ICHA 3V6CB 3U2SC 2A1AA 4DXAB 2AH5A 2LM1A 4GC6A 9ICSA 2C5LC 2HBMA 3OHBA 3AU5A 3BIID 2IO2B 9ICTA 1ZXHA 3DBHI 5DQHA 1SKSA 3AEDB 2PFQA 3EGRA 3QU7A 1TS4A 2BGWA 3P4RB 1XSPA 3B0AA 2KO3A 2WXRA 1I4XA 2LBOA 5KG6A 3M95A 5AICA 7ICEA 3SFEB 1YX5B 3C1YA 2BKFA 2I1JA 1O03A 1FNWA 3V6HA 1AARA 2N0SB 5KFQA 1WXVA 2BPGA 1SKRA 5KFBA 2JZPA 1ZQDA 3GV8B 9ICFA 3N1ZC 1J7CA 1KFTA 3PVXA 1KTQA 4MACA 1Z4NA 1OEYA 3IAS1 2V0GA 1NYRA 3AH7A 2DPIA 4UAUA 4K4HA 5ALKA 4F4ZA 1TKEA 4F7ZA 1ZQKA 3WAOA 3N3KB 5IIMA 1K51A 4IM2A 2Y0SF 3RAQA 4I2BA 2QB0A 2INPE 4ED8A 2LVQA 2MBEA 1HIWA 1TK5A 3AEBB 3ZTDA 5AK6A 4P0QB 4FS2A 4QZBA 4ECXA 1URJA 4UAZA 1Q5WB 3TI0A 2ZPNA 3QARA 3PW0A 1SJHD 3MC8A 2RSUA 2W43A 8ICZA 1SB3C 4OJLA 4I2CA 3QWZB 4QZCA 4KTQA 1NJXA 1GB1A 2C2EA 7ICLA 1S1QB 3ML8A 3DQVA 2WHEA 3F53A 3KHGA 4YR0A 1BNOA 2XN9C 4O3MA 3JPQA 2FMSA 1NVID 3M9NB 3I9V1 3DVNV 2HBKA 4DFPA 2F1JA 1L7MA 3Q69A 4MFFA 4DL2A 2L0TA 4M0AA 5E6OA 4EE2A 4TQRA 4DQRA 1VZ8A 3AU4A 2KHQA 1PDXA 4ACOA 3T8MA 1EWCA 1V1OA 3WU2U 1QILA 1ZETA 8ICAA 4Z6DA 3L0WB 4DO9A 2A19A 3RNCC 4R63A 2K4IA 3I28A 1EU4A 3KLSX 1KDHA 4FZMA 4BXOB 2PJHA 1WUDA 4W9IA 2YLMA 3RULA 1QSLA 4I2EA 3W9CB 4GMVA 2D5GA 2KD1A 4E0DA 2KOXA 3SV3A 4KGSA 1TZ1A 2V9HA 5AI0A 1F52A 2PEAA 4K7SA 2LKYA 3QU9A 3BVZA 1KTKA 9ICUA 3C5FA 4YSYB 4TUSA 1S8OA 1J8CA 5KG0A 2YMMA 3KHHA 4HLEA 2DLBA 1F9JA 2OM6A 4M6WA 2JT4B 3M9MB 1N62A 2KJ8A 1D5MC 4PHPA 2N4FA 3OTQA 3RBDA 3W2DA 3RH5A 2RR9A 5BOLA 2BYFA 4G50A 1TAMA 3SAGA 4YP3A 2Y9TA 1NYQA 1TY2A 2JEJA 4UB1A 2VH2A 5IKCM 5JUMA 5DBAA 4Y2VA 2KACA 4RGNA 3PSEB 2WGSA 2Z8LA 4YT0B 4ZRQA 2L3ZA 1UA0A 1BVSA 4IWOA 4QZEA 4QNLA 4ZRPA 1Y56A 3UQAA 1BPXA 4C56C 4FE3A 2BYTA 4YWGG 1BT0A 4QJFB 2EAPA 1DGJA 3ISDA 3F5AA 1WRIA 4N9F4 1A70A 2WF5A 4NL9C 3C29A 1MA7A 3NVZA 5KFYA 4Q43A 1QCKA 5KFNA 4DFKA 2F8KA 2HHVA 3KWVA 2JHDA 3D2NA 1D5XC 3Q8AA 1IBXB 4WWNA 2LYBA 1U48A 4P0QA 1XCTL 1RRBA 2KK0A 1YQBA 1OGWA 3B2GA 4HPMB 1FRDA 4YL8A 5LNK1 2JEGA 2KAJA 5CR0A 1MFWA 4URKA 4YSXB 3WK5A 1E0ZA 4IM3A 3Q8PB 2A5UA 2JXJA 1RZTA 3DEEA 3FC4A 2W9MA 4L2YA 4BOZB 2ES6A 2KFKB 2WXPA 3NOBA 4B6WA 1P98A 5C1ZA 5DG7A 2K8HA 4UQGA 5HG2A 2YN4A 4J9NA 1S77D 3PX0A 4CRXA 4FA6A 1PVRA 3PW4A 1Y88A 3C2KA 4QWDA 4P6VF 4Z6FA 4B9MA 2RGFA 5MPOA 4C8MA 5J0PA 4TUUA 4J9SA 4RQ8A 4EEYA 3J81j 3E56A 1RPLA 2BCSA 4BOSC 1ET6A 1TBEA 3L4PA 2DHZA 4TUQA 4KLOA 3QE9Y 1WG8A 3ZJVA 3JPNA 8ICSA 4EX7A 3WKDA 2ODGA 1L7PA 3PSTA 1IXRA 5AZHA 2LVOA 1WE7A 3NRWA 2K8BB 4XC2A 3HPOA 2M1MA 3FILB 1TYGB 3FM9A 7ICMA 2PI4A 1EF5A 5HI1A 3LDAA 1OTRB 2DUYA 1WX9A 2A1JA 1V1PA 2VZKD 4UAYA 2MJDA 3A1QB 1GAQB 4GXBA 4XDDA 1V2YA 3KOOA 2PMVA 1ZOYB 3ICXA 5AKLA 4ECZA 2Q0ZX 3T3FA 3TARA 5H2FU 2FPMA 2I38A 1TKYA 4PK1A 2G09A 5HMMA 4CQNA 1JWUD 1P0RA 3WK4A 7ICKA 2KVRA 8ICVA 5DPRA 4GDLA 1G6JA 3HIZA 8ICBA 1WMHB 2YMLA 3EW9A 4C80A 2BR0A 1E7PB 2CHZA 2UWQA 4TSSA 1QQRA 2FIFA 4F71A 4LDTD 5BOMA 2F1IA 2MSED 3RNEC 1E9MA 3E0FA 2DX5B 3ZDTA 2AQ4A 2KD0A 2MUTB 3EFCA 5KG3A 5DPTA 2INCC 3PHWB 5H8YE 3I76A 1D6EC 3FILA 1ZQRA 1VDVA 3WK6A 4IRKA 2XGQA 1WZ3A 1JRPA 3Q8FA 3MBYA 4DWIA 3FDSA 1XU4A 3M62B 1TGZB 3ONNA 1RYJA 4A8XC 2BTEA 4WJQA 2ASJA 4L23A 1ZDVA 4NM2A 4GXJA 4BFRA 3P63A 4NXZA 2LPEA 3PSPA 4OJ5A 2KYWA 4ZRIA 3UIPB 3WIMA 4DHZE 1JIHA 1QT9A 3P4PB 2BWES 2LXCA 2HCFA 4NQLB 1FMAD 1UCVA 3AE8B 4BKTA 4Z6EA 1WWVA 1T5XD 1CUKA 2WXIA 2E1EA 4E3CA 5L1IA 2KWUB 1YQ3B 4RZRA 1BPYA 2L00B 5AIAA 3WKBA 3N7PD 1AW7A 1XO0A 2JF5A 3IV6A 4KLQA 3B9JA 5KFMA 8ICMA 2QHOA 3KUZA 2NO4A 1IBXA 2OJRA 7ICIA 1NK0A 4F5NA 1WJ6A 2QLTA 3M6ZA 4IQVA 3V7KA 2VIXA 2Z0DB 1VJ5A 4RM9A 1YNTE 2LEKA 1F0ZA 3QU2A 3Q14C 5J0OA 3N97B 1C4PA 3SHQA 1QOBA 5JZEB 2A3VA 5J17A 3RYTA 5KFAA 1RWSA 3MHSD 3B1LX 2G9HD 1FD6A 2QARA 2D6FC 2ATLA 2HVHA 5LLIA 1UH6A 2Y1JA 2GLEA 3C8YA 3L08A 4K7UA 4NLBA 3LK9A 4B9VA 2KANA 4C8LA 1WE6A 2RDBC 2C60A 1ZQGA 3ZNGC 2ZEQA 5CX3A 4RF0A 5ALRA 4F4XA 1XO3A 4HKZE 4WIPA 3GP7A 4M00A 5ALIA 3RRHA 1SE2A 4DK5A 2BS3B 3QEBZ 2C7HA 3GQCA 3BZDB 1TS5A 2JZBA 5GTIU 4ZH4A 4FS1A 5HKHA 3QXGA 2NS5A 2VJ5A 3UQ2A 4IQTA 1ZQIA 2NTSA 1WM3A 2W9CB 3GZFA 4YCXA 2EAMA 1X9MA 4K7WA 3BQTA 4EEKA 1UQVA 3VUXA 3HKZF 3IG8A 2W82A 1XNSA 3M8SA 4REZA 3TFRA 1JALA 1QSYA 2R8JA 3H9DA 4JWNA 2DFLA 5IIJA 2F76X 3I1YA 2GOLA 5J18A 1MQ2A 4ZHOA 2C22A 2FLNA 4BUGA 8ICRA 1M6YA 4R8UB 2A4ZA 3K9OB 4IW0A 1L6UA 2MLBA 1SBBB 4W9LA 1NI3A 2D11A 3BVGA 5KT5A 5EWEA 4TKNA 2O2VB 1LM8B 5ALZA 1ZGUB 1V85A 1ZD5A 3H7PA 1S76D 4DDGD 1WM2A 5TR5A 4JE3B 7ICHA 4KSKC 4F8CB 3GFKB 3H8MA 1XSLA 9ICJA 1I4RA 5AKEA 5J0WA 3Q3NC 1I4QA 5KT7A 3H0LB 4E71A 2XO7A 3C21A 5DBBA 1SGHA 3B0YA 4L1BA 5DLGA 5KT2A 1ZQ1C 5AK3A 1F1HA 2DAFA 2BHNA 3P42A 9ICQA 2NBVB 7ICUA 4BKSA 5IN7A 2O6VB 4LNIA 1ZKHA 1SWWA 2LFIA 4HXDA 4DL7A 1WSPA 3LDZE 3VR8B 4JWSC 3RH6A 3AM9A 2H89B 3B0XA 1KLNA 3PTFC 5BMIA 2K6QA 1YN5A 4I2IA 3VTVA 3RNFC 3TL5A 4YVZA 2BCQA 2N7EA 2ASDA 1YJJA 3A4RA 1YZ6A 4KN4A 3R2IA 5KFUA 4F2RA 4LNOA 4NNJB 2RDJA 1KRPA 4Y2UA 9ICKA 1DOIA 8ICQA 4FBUA 2FJ6A 3NHEB 2WU5B 1KM7A 3TEWA 3DHGC 4W9KA 1Q3UA 1B22A 3PW5A 3PRPB 2ZW1A 2N9KA 3BK2A 1LB2B 3RBEA 3MGIA 1R7SA 2M0AA 1U47A 8ICXA 4DHJB 1BPEA 2YX8A 5F3XB 4FJZA 3ZJTA 4DQSA 2BT6A 2PI5A 4AYBF 3GOEA 2V3SA 1KLGD 2C2RA 3SZ2A 1E8YA 1EM7A 3TADC 2QCZA 2HHTA 3A9JB 3QK0A 7ICRA 2Z0EB 4EZKA 3PREA 3DPDA 2KIWA 2RDHA 1FNUA 1LFDA 3MABA 4KLLA 5L95C 4RGOS 1S9FA 1QQ6A 4YMNA 5ALVA 1NKBA 2HJ1A 2IO3B 1V5OA 4DQIA 2O6VD 4I6NB 4HAIA 1FXAA 1ZJMA 1ZUD2 3H6NA 1X9WA 5DPSA 4TQ0A 2V4RA 2LXAA 3L10B 2R8KA 4RQ7A 3IHPC 4OZAA 1WYWB 2KIVA 4I2AA 2JXXA 1VR9A 2KVCA 2FAZA 4RQ0A 1IGDA 4JX1C 5GTHU 5EWGA 4LLGM 3V05A 2KKCA 4HJGE 5DB7A 2LYAA 4QZFA 4Q2JA 5ALJA 3ZNZB 3RD2A 2EZZA 4DLGA 5G55A 1IYFA 2FLPA 1ZQHA 3ZXVA 4EOYA 1X6IA 5D6JB 1EWYC 3GZNI 4QZHA 1ZQLA 2IGHA 4O3RA 5HP4A 5D49A 1SE3A 1D8YA 5C3JB 4O3NA 4WURA 3PO4A 1WGHA 3RJKA 2DYBA 3ZI4A 4HCNB 5KFOA 8ICPA 2W03A 1GOZA 3DBSA 1ZQVA 3GU3A 5GMVA 5IP4D 1J0GA 7ICSA 2BB6A 2GB1A 1NK5A 1Z4OA 4CGZA 4ITKA 2GLSA 3LYYA 3A9KB 3J9CA 4IWPA 4JWUC 1AN8A 1VZ7A 1ZPSA 3UQ0A 1JRUA 8ICTA 4X5VA 2INNE 3TACB 2ZTDA 4DSJA 2VANA 4UB5A 4JGHB 4A3PA 4C4SA 3VRAB 3HVDA 2G4SA 1J97A 3Q3FA 4EBCA 3BVMA 5KFJA 2ZG6A 2LASA 5F9NA 1ZRNA 2J53A 4WJPA 3NZUA 2XCAA 4FZNA 3RB0A 3N30A 4MEYA 1SF0A 1Q1OA 3Q8EA 3IXSA 3H8HA 5ALOA 3W5UB 5KFDA 4CO7A 2A1JB 2NRVA 4BKSD 5L1KA 4JV2A 2IO1B 1L7OA 1T3NA 4BBNC 2NRZA 1EO6A 1IM4A 1V86A 4W9DA 2AQ2B 2L05A 5L83A 4NJ6A 2LHDA 1L7YA 1S10A 1TT5B 1F44A 4KLEA 2KTRB 3P4QB 4WJOA 1MI0A 2AHOB 2W55A 2MP2A 2HD5B 2AGOA 4PL1A 4II2B 3UIOB 1CJEA 2DYOA 3DCGA 4F93B 4Y2JA 1SIJA 2JH7A 4O5EA 3NTUA 4YXDB 4AJWA 2QJLA 4NL9A 3BZKA 3EWAA 3AB5A 4PJ0U 4OHJA 3GDXA 2MA1A 4UW9A 3H8JA 4CF5A 1Z1BA 2JH1A 1UGJA 2D3GA 4WWPA 2J0JA 5IA7A 4KX5A 2ZUCA 1KOTA 4LCDE 2VA2A 2H3IA 2L7RA 4R65A 2BCRA 3VUWA 3ZYYX 4NY8A 1ZOLA 2XGPA 3L54A 4B9KA 2WQYB 2QC8A 4Q44A 5KFHA 2C7MB 2NO5A 4MJSB 5IOIA 2DZIA 1E10A 3UGBB 1A0PA 3QUCA 2P35A 2O6VA 2CPRA 2BVCA 3KHRA 3JW0X 3U4EG 1JROA 5AM4A 2LGIA 1MG4A 1X9SA 1ZW7A 5CTRC 3K75D 4TMAB 3QUBA 2RRDA 1WH3A 2ZXIA 1SE9A 5BYSA 2G5IB 4BX9C 3M7DA 3NASA 3EA6A 1Z2MA 5HMLA 4HRSA 4G0NB 4OO1J 5DPWA 1P7FA 3MFIA 3M3JA 1PVQA 4N58A 4RT3A 1XQQA 5KFLA 2EMSA 1ZQFA 2GBMA 4RM8A 4EKUA 5BPCA 2MRPA 1L0VB 3KQ4A 1V97A 2UVWA 2W54A 4I2FA 3PV8A 1ZQOA 4ICAA 1I4HA 4IQWA 1YZ7A 3RZWC 3OSPA 3Q8BA 3MR2A 5CHFA 1IV8A 4I2DA 2YEPF 2WP9B 1UHUA 4XZ4A 1UGMA 2JWUA 2KZ3A 3V72A 2MBOA 1ZD4A 3MC1A 1BXTA 1UUPA 2KMCA 5ALSA 1COOA 4IRDA 2XVTA 4KLJA 2MBHA 2KT7A 4NLCA 4Y2XA 3HK0A 2PW9A 3JVZX 5BMGA 3E9SA 4KDIC 5DDYA 4PGYA 2OCEA 3H0RB 3SYZA 2MHJA 1S0MA 3WK7A 1M94A 5AK4A 2W9CA 4CHKA 2KXJA 4EX6A 4F50A 1R4MB 1KJTA 4C8OA 3CWIA 3PLUA 3RR8A 1F2RI 3PSIA 2KN4A 4HVBA 2GO7A 3ZDMC 1NI2A 1JCKB 3HM6X 1H8CA 4F91B 4PPXA 2KN7A 4RQ2A 2AU0A 3L16A 1AQ6A 1OXJA 2B21A 3W1YA 2XK5A 1FIQA 3ZDDA 5J2JA 3ZTCA 1JWSD 2QEJC 3MJWA 4ICUA 1E5WA 4GDKB 4WAFA 2FCMA 3JPTA 3AE7B 4YD2A 1T0YA 2IBIB 4P0PB 3DV9A 5IIKA 1S0OA 1A77A 4M0WB 1XS9D 3SEBA 3N1XC 3RFZB 3CMMB 5K4LA 1GO3F 1Z1VA 3MFGA 3CYMA 5KFSA 4O3SA 3LJ3A 2AQ0A 3AEGB 2KKPA 2ZIWB 3NGDA 2OHFA 1CEZA 3KWLA 4Q45A 9ICEA 3N20C 4PGQA 4YR2A 1V80A 2XNAC 1JXLA 4J9LA 2MSNA 3JPPA 3RJEA 4B0MA 4BZAA 1WGKA 5AUKA 2OYYA 4AP4C 5GXGB 2IYDB 1BPDA 1I35A 5ALDA 3BYTB 5DB9A 1ZRMA 2WYQA 3JSVB 4BWJA 5B5EU 4M04A 2NRXA 7ICOA 4LZGA 1L0XB 2C7NB 1YD8U 4ELUA 4IC9A 3GV5B 1IG6A 3RN9C 3EECA 3V7JA 3UMCA 4EZ9A 4MHVA 5CB1A 3PS6A 4LNNA 4DOBA 1ZD2P 2WXMA 3AMZA 3KYDD 3BS7A 3RFAA 3AE9B 3C23A 3TADA 2PFPA 4RMAA 2K0PA 2EKIA 4F5PA 1C76A 1T0SC 4FZLA 3GE3C 1UA1A 1CRXA 5E6NA 2MP2B 2XIDA 3VUYA 2LUEA 3SD7A 4UAVA 5HR6A 1YN4A 1AROP 2UVRA 4GGQA 3OHAA 3ZDEA 4AQ7A 5J2EA 1QTMA 4USAA 2KP7A 1T94A 2JV3A 5J0SA 3ZDBA 3AQEA 4NLZA 2JGAA 3OSNA 4BJQA 4M9LA 2HSZA 4Y2PA 4IR9A 1OQRA 3LVWA 2KK8A 2ON8A 3ALBA 3SDLC 3W1SC 3BWUD 1R4MI 3QA8A 4ZDVA 4QZ9A 8ICLA 2ZUBA 3CSFA 3A0HU 3CW2C 4I2JA 5AKXA 3A9JA 1KH0A 3RJIA 5BO4B 3CRXA 1WCLA 2W11A 2I6XA 1Z00B 1N48A 3IM1A 3T5JA 1VLBA 4C7ZA 1WJNA 2H3QA 1MVKA 3AQFA 3PNCA 2AJQA 3TBLD 4ACFA 3AL0B 2EANA 2HTHA 4YN4A 3Q3MC 4K1RB 3V62A 2KSOB 3MGHA 9ICVA 3HVZA 2ZIVB 5KFZA 2BPFA 3WKCA 1E6EB 3OG5A 1TTNA 1C20A 2WNMA 2JZZA 3AEAB 1J2MA 3BQ2A 2CKHB 4MFCA 2FCQA 1DOYA 4GC7A 2CS4A
chains in the Genus database with same CATH topology
2MJ3A 1YJIA 3IT4B 4RFBA 1N5XA 2Y5PA 1F2RC 1YNTE 2E6XA 3AN1A 2LEKA 5HFYA 1F0ZA 3ZQ4A 4OVZA 1C4PA 1QOBA 2QSDA 1RM6C 1FRRA 1Q10A 1XCQL 1RWSA 1ZXIA 2KWDA 3N9YC 2G9HD 4OZBA 4OW0A 1FD6A 1GB4A 1T3QA 1JWAD 3C8YA 1N5WA 1QOGA 4US9A 2N7JA 2B76B 4GLSC 1QF6A 5EE1A 1PYWD 1C77A 1K53A 4RF1A 2GRIA 1TJEA 4RF0A 1XO3A 4HKZE 2HDEA 4WIPA 2PVGC 3GP7A 4YTPB 1FNVA 3AE6B 1SE2A 1HQRD 2LUMA 2RPVA 2V3NA 1ROEA 1JWBD 2BS3B 3BZDB 1TS5A 1UNSA 1YN3A 2CJOA 4WQMA 3RPFC 5TSSA 1TS2A 1L0YB 2AQ3B 2NTSA 1N60A 1GPXA 3TEZA 4MT5A 1JMLA 2DYMA 2KDMA 2WS3B 1I7HA 1PGAA 2BBCA 3HUIA 5H92C 3V3XA 3AEEB 2W82A 4REZA 1JALA 1SE4A 4YTMB 5FR3A 1FCLA 5HHDG 2R61A 1FCCC 4ZHOA 4DXGA 4RGTA 2JU6X 2WXFA 5FKAC 1L6UA 4NAWB 1SBBB 2FE8A 1NEKB 1NI3A 1FM0D 3BVGA 1PFDA 1QOAA 1L4ZB 1KRHA 2WDQB 1VJKA 2WDVB 4ZHPA 2AX5A 2JYEA 4IOIE 1XLPA 1JW9D 1N61A 4JE3B 1I4RA 1XLNA 4XE0A 1I4QA 2LJIA 1FXIA 3ABVB 4L1BA 1L6VA 2LHEA 3ETRA 3PZ7A 2DWQA 3P42A 4ZOHC 2CU3A 2ICIA 4AS1A 5D3DA 3MC0B 2LFIA 4A55A 2L1AA 1WSPA 3VR8B 5BYRA 1ET9A 4JWSC 3AM9A 1FFUA 2H89B 2QIEB 5BMIA 2WU2B 4R3DA 1YN5A 1UWXA 1YJJA 3Q8CA 5D3IB 5I4DA 3R2IA 2N9LA 4KX6B 4NJCA 3IAM1 2QILA 1EU3A 1XXGA 5E6JA 2RDGA 1DOIA 5EE9A 3NZ3A 2QMTA 2WU5B 1ENFA 2FBWB 3MJ5A 3PO0A 3VQIA 3TEWA 2JYTA 2ZW1A 4J3OD 3AE3B 2N9KA 3BK2A 4YSZB 1MHXA 3I57A 1R7SA 2M0AA 4N6EB 1QOFA 2NMQA 2MJEA 2WXJA 3MHZA 3ZJTA 2BT6A 3UI3A 1KLGD 1DYQA 1C9FA 2MEKA 1EM7A 3LB8C 5JXVA 4IDIA 1QKZA 2JX5A 4RGMA 1FO4A 2RDHA 3NVVA 1FNUA 2I2YA 2V4IB 4DXFA 1TS3A 4RGOS 3TEYA 5G5HA 3AE1B 4ARCA 1FXAA 3BYYB 4H2AA 1ZUD2 2PTLA 4US8A 5BMHA 3GS2A 1UWMA 4TQ0A 2KQ4X 2G1EA 4A9AA 1WYGA 1J7BA 4OZAA 1VRAB 4ARIA 2SAKA 1PGXA 1VR9A 5EE3A 1JQ4A 1J7AA 1IGDA 3IT6B 4JX1C 4LLGM 3V05A 4HJGE 2FUG1 2DBYA 4Q2JA 4YTNB 2WXOA 4OZCA 1JWMD 1HZ6A 3EUB2 1P7EA 1EWYC 4N59A 3W5VB 3NVWA 2L32A 1WWTA 2EELA 2IGHA 2WXQA 3NVYA 3AEFB 1VZ6A 3NS1A 1SE3A 1XLQA 1SXTA 1D4BA 5C3JB 1OQQA 3BK1A 1ACCA 1I4PA 1D5ZC 4WURA 3B2FA 3VR9B 3O13A 1WXQA 2IPKD 2V3PA 5T8IA 4MM3B 1GOZA 2CJNA 5AUIA 2VZKB 2IDYA 1CQVA 2BB6A 2GB1A 1MPEA 4ITKA 3LYYA 3U2SC 3J9CA 3BIID 4JWUC 1AN8A 1VZ7A 1ZPSA 1ZXHA 3PZ8A 3AEDB 2INNE 2JSVX 3EGRA 1TS4A 4IKGA 3P4RB 3VRAB 3HVDA 2WLBA 1C4AA 2WXRA 1I4XA 3BVMA 3LXFA 1TKGA 3SFEB 2J53A 1ESFA 1FNWA 2LMCA 2N0SB 3AV8A 1XEEA 1SF0A 3Q8EA 2JZPA 3IXSA 3H8HA 3W5UB 1L5PA 1OFFA 1J7CA 3AE4B 3U52E 4MACA 4MH8A 3ZJUA 3IAS1 2V0GA 1NYRA 1YMHE 3AH7A 1KLUD 4WWMA 1TKEA 2AQ2B 2IGGA 1K51A 2LHDA 2INPE 2BB5A 1HXYD 3P4QB 4RCOA 1MI0A 3AEBB 2BS4B 5D7GA 3W1SA 2W3SA 2W55A 2H88B 2WXNA 1CJEA 1K50A 1SJHD 2DYOA 1SIJA 2IGDA 1SB3C 4YXDB 1SJED 2QJLA 1GB1A 3AB5A 4A90A 2PVOD 4OHJA 2JQRB 3U7ZA 2KMMA 3T3OA 1UGJA 2XN9C 1C78A 1HEZE 3R2TA 1NVID 2W3RA 1IGCA 3CIRB 3I9V1 4HROA 3Q69A 4TQ1A 1BMLC 4EE2A 2MH7A 1V1PB 1VZ8A 3ZYYX 1PDXA 1EWCA 1V1OA 2WQYB 2HTME 3WCQA 1QILA 1E10A 2RMMA 4KKIA 1F77A 1EU4A 3KLSX 3U4EG 1JROA 3W9CB 2LGIA 4UDUC 4XDCA 2D5GA 1FFVA 4HEA1 4KGSA 2WDRB 4TMAB 2AQ1B 5BYSA 3BVZA 1KTKA 1KF6B 1XF5L 4LK0M 4YSYB 3EA6A 4GDLB 3ZGZA 4HRSA 2DLBA 1P7FA 1BUIC 1M4VA 1TZOA 3NUHB 4N58A 5EE0A 1N62A 1D5MC 2WXGA 1NENB 3W2DA 1L0VB 1STEA 3KQ4A 1NYQA 1V97A 1TY2A 2W54A 3DWGC 1I4HA 1DOXA 3Q8BA 1C4CA 2YEPF 2WP9B 2WXLA 2KACA 5BYQA 4RGNA 2JWUA 2L52A 1V8CA 2Z8LA 4YT0B 4ZRQA 1BXTA 1UUPA 4ZRPA 4O1NA 1Y56A 1QLBB 4C56C 2BYTA 4YWGG 2WXKA 5BMGA 1DGJA 1PGBA 2PW9A 1WRIA 3E9SA 1A70A 3NVZA 3TUOA 3AE2B 3KWVA 1D5XC 3Q8AA 4WH4A 1IBXB 3CWIA 1XCTL 2PKOA 1F2RI 2KN4A 3AECB 3B2GA 5LNK1 1FRDA 1ZP0B 1JCKB 2KAJA 4YSXB 1E0ZA 1L4DB 2E3TA 1AWDA 1FIQA 3FC4A 3NRZA 2BW2A 3GB1A 4L2YA 1JWSD 2QEJC 4GDKB 4LTUA 4WAFA 2WXPA 1IUEA 3AE7B 3MP9A 5HG2A 3DWMA 3URYA 2Y5CA 3SEBA 3RFZB 2PLPA 3HRDD 1SEBD 2TSSA 3MFGA 4P6VF 1T6BX 5MPOA 2M19A 2M56B 3AEGB 1HA5A 2OHFA 3E56A 3KWLA 4P16A 4HKQA 1ET6A 3L4PA 3ZJVA 2Q5WD 3FAHA 2PIAA 2XNAC 3P1MA 4A6QA 4B0MA 5FK9C 1WGKA 1C79A 4NZLB 5AUKA 4DQOC 2SEBD 5GXGB 1K52A 3BYTB 3FILB 1TYGB 1CZPA 2K3UA 4PT5A 3TEXA 5HI1A 1L0XB 1KFYB 4JPSA 1SSNA 4KGRA 1AYFA 4RH6A 1V1PA 2VZKD 2MJDA 2ACZB 1GAQB 1XLOA 4B0EA 3TSSA 4XDDA 2PMVA 2WXMA 1ZOYB 4M0WA 3R8BA 3AMZA 3AE9B 2I38A 1TKYA 2L83A 2K0PA 2EKIA 3SFDB 1C76A 4FXCA 4CQNA 1JWUD 1B9RA 4C7YA 3VRBB 1HZ5A 4C80A 1E7PB 2J52A 4TSSA 1QQRA 1PUTA 1E9MA 1YN4A 2YEPB 5G5GA 5C2TB 4AQ7A 4USAA 4KGTA 4D2KA 1N63A 5H8YE 1LO5D 1ZDXA 2GI9A 1D6EC 1OQRA 3FILA 3OWEB 2ON8A 2OEDA 1VDVA 3BWUD 1JRPA 3Q8FA 2NTTA 2JXTA 2K9XA 2X38A 2Y3AA 1ZE3D 1RYJA 1YQ4B 1KH0A 4A8XC 2BTEA 4NAMA 3SR6A 2IJ0A 1ZDVA 4KKJA 4L23A 3T3NA 1VLBA 4C7ZA 3P63A 1RFKA 1MVKA 1QT9A 3P4PB 4XWTA 2J4XA 1FMAD 2WXHA 3AE8B 4ZYSA 1FEHA 1T5XD 2K22A 2WXIA 1TY0A 3HVZA 2K5PA 2ZW0A 1E6EB 2J42A 1YQ3B 2WNMA 1I4GA 1B1ZA 2BS2B 3AEAB 1AW7A 3AE5B 4XWWA 1CK1A 3B9JA 2ONQA 1MHHE 1DOYA 1IBXA 3P4SB 4RNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ3 A;  1TKE A;  1E0Z A;  1YJI A;  1DOI A;  1N5X A;  5EE9 A;  2E3T A;  1AWD A;  2WU5 B;  2FBW B;  1FIQ A;  3FC4 A;  3NRZ A;  3PO0 A;  2LEK A;  3AN1 A;  1F0Z A;  3P4Q B;  4LTU A;  3AEB B;  1IUE A;  1QOB A;  2BS4 B;  3AE7 B;  3AE3 B;  4YSZ B;  1R7S A;  2W3S A;  1RM6 C;  2W55 A;  1FRR A;  2H88 B;  1QOF A;  1ZXI A;  1RWS A;  3DWM A;  2Y5C A;  4N6E B;  1CJE A;  2MJE A;  3HRD D;  1T3Q A;  1JWA D;  4P6V F;  1N5W A;  5MPO A;  1SIJ A;  2M19 A;  1SB3 C;  1QOG A;  2BT6 A;  4US9 A;  2M56 B;  3AEG B;  4YXD B;  2QJL A;  2B76 B;  1QF6 A;  5EE1 A;  2OHF A;  3KWL A;  3LB8 C;  4IDI A;  3AB5 A;  2JX5 A;  3L4P A;  2PVO D;  1TJE A;  2JQR B;  2Q5W D;  1FO4 A;  3FAH A;  3NVV A;  1XO3 A;  2KMM A;  2PIA A;  4YTP B;  3P1M A;  2PVG C;  3AE6 B;  1WGK A;  4YSX B;  5AUK A;  5G5H A;  1JWB D;  1ROE A;  2BS3 B;  3AE1 B;  5GXG B;  1NVI D;  2W3R A;  2CJO A;  1FXA A;  3CIR B;  4WQM A;  3RPF C;  4HRO A;  1TYG B;  1CZP A;  1ZUD 2;  4US8 A;  1GPX A;  1N60 A;  1KFY B;  2MH7 A;  1UWM A;  2WS3 B;  3ZYY X;  1I7H A;  1PDX A;  1AYF A;  3HUI A;  2G1E A;  3WCQ A;  2WQY B;  2HTM E;  5H92 C;  4A9A A;  2MJD A;  2ACZ B;  1GAQ B;  3AEE B;  1WYG A;  1J7B A;  1XLO A;  1E10 A;  1JAL A;  5EE3 A;  1JQ4 A;  1J7A A;  4YTM B;  1ZOY B;  4JX1 C;  3AMZ A;  1JRO A;  3W9C B;  3AE9 B;  1FFV A;  1TKY A;  2L83 A;  2DBY A;  2EKI A;  2WDR B;  4FXC A;  4YTN B;  3SFD B;  4ZHO A;  1B9R A;  4C7Y A;  3EUB 2;  3VRB B;  1KF6 B;  4C80 A;  1E7P B;  1EWY C;  1L6U A;  4N59 A;  4YSY B;  3W5V B;  3NVW A;  1NEK B;  1NI3 A;  1WWT A;  1FM0 D;  1PFD A;  1QOA A;  3NVY A;  3AEF B;  4HRS A;  1KRH A;  3NS1 A;  1PUT A;  1XLQ A;  1E9M A;  5C3J B;  2WDQ B;  1OQQ A;  4N58 A;  5EE0 A;  1N62 A;  5G5G A;  1VJK A;  2WDV B;  3B2F A;  5C2T B;  3VR9 B;  4USA A;  2AX5 A;  4ZHP A;  1WXQ A;  1NEN B;  1N63 A;  5H8Y E;  1XLP A;  1JW9 D;  1N61 A;  1L0V B;  1OQR A;  2CJN A;  5AUI A;  1NYQ A;  1V97 A;  3DWG C;  2W54 A;  1XLN A;  4ITK A;  1VDV A;  1JRP A;  3BII D;  1DOX A;  4JWU C;  1FXI A;  3ABV B;  2K9X A;  3AED B;  2WP9 B;  1L6V A;  1RYJ A;  1YQ4 B;  2L52 A;  1V8C A;  4YT0 B;  3ETR A;  3SR6 A;  2DWQ A;  3P4R B;  3VRA B;  1VLB A;  4C7Z A;  3P63 A;  2WLB A;  4ZOH C;  1QLB B;  2CU3 A;  1RFK A;  1QT9 A;  3P4P B;  3LXF A;  1DGJ A;  3VR8 B;  1TKG A;  1WRI A;  3SFE B;  1A70 A;  4JWS C;  1FMA D;  3AM9 A;  1FFU A;  2H89 B;  3AE8 B;  3NVZ A;  2N0S B;  2QIE B;  3AV8 A;  2K22 A;  2WU2 B;  1SF0 A;  3HVZ A;  2K5P A;  1E6E B;  1YJJ A;  3AE2 B;  3W5U B;  1L5P A;  1YQ3 B;  1OFF A;  1J7C A;  3CWI A;  3AE4 B;  2BS2 B;  3AEA B;  4KX6 B;  2PKO A;  3AE5 B;  3B2G A;  3AEC B;  1FRD A;  3B9J A;  1ZP0 B;  1NYR A;  1DOY A;  2KAJ A;  3AH7 A;  3P4S B;  4WWM A; 
#chains in the Genus database with same CATH topology
 4NV0 A;  2YB1 A;  3IT4 B;  4RFB A;  2AXT U;  2G45 B;  2Y5P A;  2DZK A;  1F2R C;  2E6X A;  4HYK A;  2Y1I A;  3IRU A;  4GXI A;  1ZQM A;  4P4P A;  3PR5 B;  3GIJ A;  1S3S G;  1U49 A;  2QSD A;  5J2B A;  1XCQ L;  2BDP A;  1FRR A;  1ZXI A;  2R8I A;  2W8K A;  2ZIX B;  2D10 A;  1T3Q A;  3A0B U;  4A20 A;  3PPA A;  2ALZ A;  2ZCC A;  1ZYQ A;  4KIT B;  5AKZ A;  2LGX A;  2BQQ A;  3QNM A;  2G06 A;  4QZG A;  1D8B A;  2ZJ8 A;  4P4M A;  2N7J A;  1KBU A;  3ZRF A;  1QF6 A;  5IAA C;  1TV9 A;  2DGZ A;  1C77 A;  1K53 A;  3U7D A;  1TJE A;  1L2N A;  2L8J A;  4YXM A;  3MDC A;  5KT6 A;  2V3N A;  1FEZ A;  1QLN A;  2VA3 A;  5III A;  4WQM A;  3RPF C;  3HIL A;  3GIL A;  2ZNV C;  4MT5 A;  1JML A;  2WS3 B;  3Q8R B;  1PGA A;  4ASW C;  4YG2 A;  2Y9U A;  2BBC A;  3HUI A;  4JK1 A;  5H92 C;  3T79 A;  4UB8 U;  4O3P A;  4F5R A;  4NJ8 A;  5ALN A;  1SE4 A;  5FR3 A;  2CR5 A;  1NNL A;  1FCL A;  2D3C A;  4YFK A;  3SAH A;  2R18 A;  1VCB A;  4GIV A;  4ECR A;  1WXA A;  9ICC A;  2DPJ A;  4RGT A;  5DB8 A;  2JU6 X;  2WXF A;  2EH9 A;  3O0F A;  4LJO B;  5CHW A;  4DOA A;  2FE8 A;  3RF9 A;  3JPS A;  2FCN A;  1PFD A;  4DS4 A;  1L4Z B;  2FCS A;  2EDU A;  3QCA A;  1U9L A;  4KSL C;  4NPN A;  2HI0 A;  5KFT A;  2WDQ B;  3M63 B;  5D46 A;  3DVN U;  4IG7 B;  3AU6 A;  3PLV A;  1VJK A;  2WDV B;  2KZZ A;  2AX5 A;  5DGB A;  2JYE A;  3U26 A;  1PK3 A;  4GOC A;  7ICQ A;  4G3I A;  4DOC A;  5C5J A;  1Q3V A;  5ALQ A;  5CHG A;  1TFR A;  2F8L A;  3RTV A;  3R7R A;  1FXI A;  1P7D A;  2KKV A;  2J0K A;  2MCN B;  4MEL A;  4IL6 U;  2VH1 A;  3FKY A;  3ZKJ C;  3K4G A;  5KFG A;  3PZ7 A;  2DWQ A;  2MUT A;  1CI4 A;  1NZP A;  1CMX B;  2FNJ B;  2BPC A;  4ZOH C;  2VA8 A;  4BWM A;  2ICI A;  5D3D A;  3MC0 B;  2R2O A;  4A55 A;  4ANV A;  2XY6 A;  2FMP A;  4PS7 A;  1K5O A;  4MGI E;  1GUA B;  1KL9 A;  1FFU A;  2HBL A;  4DS5 A;  3PW2 A;  8ICN A;  3N4M B;  2YQE A;  3IN5 A;  1UWX A;  2KMD A;  4J9O A;  3APC A;  1N56 A;  1NJY A;  2ZVO A;  3IAM 1;  2Z7J A;  2B6G A;  2HVI A;  4M47 A;  2AL3 A;  5EE9 A;  2E5S A;  1F0M A;  2QMT A;  4DBG A;  2KX0 A;  2KE7 A;  2JYT A;  1SKW A;  5HHH A;  7ICT A;  2F44 A;  1RYU A;  4M01 A;  1MHX A;  1C7Y A;  3HT3 A;  2KJ6 A;  3PY8 A;  1QOF A;  5DCN A;  3K1R B;  4P4O A;  2NMQ A;  5FR6 A;  3H0M B;  2IY0 B;  3DVG X;  3QX7 A;  2N9P C;  2CN1 A;  3BIN A;  3EC8 A;  3A9K A;  3UI3 A;  1MC8 A;  1C9F A;  2MEK A;  1V49 A;  4P1C C;  4DCC A;  4JWM A;  4IDI A;  2KN5 A;  2JX5 A;  2LZ6 A;  3CNH A;  3RRG A;  3UM9 A;  4G3X B;  4MF8 A;  3ORY A;  3QU4 A;  3MR5 A;  2IBK A;  1OEY J;  1WXM A;  2QDF A;  2I2Y A;  5AZG A;  2MU2 A;  4ECV A;  2IND C;  1RXW A;  3AE1 B;  3KKA C;  2J6S A;  5C0Y A;  4KV2 A;  4EUT A;  5BMH A;  4US8 A;  1NK8 A;  5AKH A;  1SXD A;  2ZUD A;  2KQ4 X;  1NJW A;  4O3O A;  1WIA A;  2P6R A;  1BGX T;  4UAW A;  3VCB A;  1JMS A;  2K6D B;  1B43 A;  1PGX A;  5DG9 A;  2W9B B;  1PUZ A;  3EHV A;  4NLN A;  1J7A A;  2EAO A;  5DGA A;  4DFJ A;  3OJS A;  1QQ7 A;  4IQU A;  5HNK A;  5KFI A;  4DF4 A;  3NY5 A;  5L1M A;  1NOM A;  3NUQ A;  5J0Y A;  3Q8S B;  1MG8 A;  1ZQX A;  4RPY A;  4KZ0 A;  1RQN A;  1P7E A;  1V81 A;  1WWT A;  3SU8 X;  5J2H A;  3NVY A;  3AEF B;  2ZTE A;  4RT2 A;  3DBR I;  1XLQ A;  3L17 A;  3BK1 A;  4BAX A;  2KFZ A;  1D5Z C;  4R64 A;  2LMR A;  2IOF A;  3B2F A;  3O13 A;  2IPK D;  3ECI A;  3O65 B;  2IO0 B;  3Q3J A;  4GSW A;  2CJN A;  2VZK B;  1CQV A;  2IDY A;  5KFW A;  4OJO A;  1COK A;  3HJE A;  2KTF A;  4FUL A;  3DBL B;  3PZ8 A;  3UQB A;  2N9E B;  2JSV X;  4J03 A;  2FPK A;  1HE8 A;  3WK8 A;  1ED1 A;  3PVL A;  3ETL A;  1V38 A;  5JRT A;  1C4A A;  2WLB A;  2NV3 A;  5AZF A;  1S0V A;  2IOF K;  1Z19 A;  4FO6 A;  1ESF A;  3DDH A;  4MJS A;  1U4B A;  1XEE A;  1YOV B;  3N28 A;  2K8C B;  4RUA A;  3BDP A;  1L5P A;  4PHE A;  2M0X A;  3UXO A;  3AE4 B;  3RMK C;  5IO9 A;  1WI0 A;  3QC8 B;  2HHW A;  4B95 A;  3ZJU A;  3EPG A;  3RJF A;  4NY0 A;  4UB4 A;  1KLU D;  2NYV A;  2G3Q B;  4Y2T A;  4I2H A;  4WWM A;  3Q2A C;  2DQN B;  5AI6 A;  1NKE A;  2IGG A;  3EPI A;  2EMT A;  1TE2 A;  2G5H B;  2XIC A;  3ZNI D;  2BGF A;  1RYS A;  4B9S A;  1RFA A;  1HXY D;  1DK3 A;  4CNQ A;  2ESE A;  4F4Y A;  4RQ3 A;  4M9G A;  2DNF A;  3W1S A;  2W3S A;  1ZQC A;  4O5C A;  2H88 B;  3C1Z A;  3WKE A;  3PV1 A;  4KLT A;  1K50 A;  4OCZ A;  3WKA A;  4M9H A;  1XD3 B;  1SWV A;  2IGD A;  5ALY A;  3TAQ A;  4K3B A;  4GFJ A;  1SJE D;  4KDL B;  2M4N A;  2LJ5 A;  1WR6 E;  2MA9 B;  2ZIW A;  2IZV B;  4A90 A;  3T3O A;  2JQR B;  2M8S A;  3KVF B;  1PZN A;  4C4T A;  2DZJ A;  3OJ4 B;  3TFS A;  1S5L U;  3H7P B;  2KX3 A;  4PL2 A;  3CIR B;  3N7R C;  1Z5S B;  2K4P A;  5HHI A;  2K8B A;  1KEJ A;  2MH7 A;  2LYH A;  1V1P B;  3A1Q A;  4IC7 B;  1UPH A;  3WCQ A;  3CP8 A;  1TK8 A;  2JZ3 B;  4MSM B;  2RMM A;  3U8Z A;  4P1B C;  3VTU A;  4JMU A;  4ZRJ A;  3SD5 A;  4DHZ B;  3V7L A;  4XA5 A;  1UEL A;  2YVC A;  4UDU C;  1FFV A;  1JI7 A;  4JB3 A;  2WDR B;  3ZLZ A;  3TAN A;  4O3Q A;  2MWS B;  4AJY B;  2JMG A;  1DRG A;  1Q0W B;  3GV7 B;  5CWR A;  3QQ8 B;  4J6I A;  1HUO A;  2BQR A;  3ZGZ A;  2FUH B;  1NK9 A;  4CF4 A;  2KVZ A;  3L13 A;  4XGA B;  1NDD A;  2LGD A;  4GLX A;  4EZJ A;  3T5K A;  4PZN A;  1BUI C;  3AI5 A;  1TZO A;  2NBW B;  3NUH B;  2HOI A;  5EE0 A;  1EF1 A;  2EKE C;  5KFC A;  2WXG A;  5KL8 B;  4F4K A;  1NEN B;  2HHQ A;  5AM2 A;  4KIK A;  1STE A;  2K60 A;  2KJR A;  1L5U A;  3F2B A;  1SIF A;  4OVU A;  2WXL A;  5BYQ A;  2KQ7 A;  2L52 A;  2ISO A;  2Z59 B;  3A33 B;  3ZRC A;  4O1N A;  1QLB B;  4II3 B;  1ZQP A;  2K4E A;  2WXK A;  2JRZ A;  2NR2 A;  4MEX A;  1H38 A;  2FI1 A;  1PQS A;  4ZYN A;  4I29 A;  5D94 A;  4PS3 A;  3DHH C;  3H1U A;  2NPT A;  3MR3 A;  3HHM A;  2DF4 B;  2WX1 A;  2H5X A;  2W9A A;  3C2M A;  3SEI A;  4RQ1 A;  4ED6 A;  2PKO A;  2KLC A;  3CF6 E;  1ZP0 B;  2QAR B;  5AHX A;  2HHS A;  2LM4 A;  3OLM D;  4DDI D;  3H7S A;  3UPQ A;  1WF9 A;  1L4D B;  2KMA A;  4HPP A;  2E3T A;  4HWI B;  4QZ8 A;  3NRZ A;  2XC9 A;  3VHT C;  1X6J A;  2GOW A;  2GBN A;  2HW3 A;  2BYE A;  3LWL A;  3GB1 A;  2DKZ A;  4LTU A;  4DL3 A;  4KLS A;  2K1F A;  1T4G A;  2ZIX A;  3MP9 A;  2GH1 A;  4EYH B;  1L3U A;  1ISN A;  2ZIU A;  2N7D A;  5AKK A;  3DWM A;  4RQN A;  1JXE A;  4F92 B;  1SEB D;  2TSS A;  1WJ4 A;  4DSI A;  1T6B X;  3G6X A;  3AEV A;  1E8X A;  4ED0 A;  2D2Q A;  2M19 A;  2WWZ A;  1WY8 A;  5ALM A;  1BNP A;  5CJ7 A;  3MGV A;  1HA5 A;  4RQ6 A;  4P16 A;  4HKQ A;  2PKE A;  2LGY A;  5F9L A;  5J8Y C;  5L9X A;  2PIA A;  5IIO A;  2Q5W D;  4ECQ A;  2MBQ A;  2ZJ5 A;  3P1M A;  3Q6B A;  4A6Q A;  4LJP B;  4EFO A;  5FK9 C;  2XY7 A;  2LGS A;  2KHV A;  2MAX A;  4NZL B;  3ZO5 B;  8ICE A;  4DQO C;  1HTQ A;  2OH2 A;  5ALW A;  2IOH A;  3H8W A;  1E7U A;  2K3U A;  4CE6 A;  2C2D A;  1CZP A;  1N6Z A;  2WF6 A;  2HOQ A;  2XI9 A;  4GU2 A;  1Q8K A;  4KLH A;  4JPS A;  3PMN A;  5J0U A;  2J6T A;  4Y2Y A;  2GBK A;  5JHA A;  4KGR A;  4J9Q A;  1AYF A;  1K1S A;  1JUD A;  4KLU A;  2RLT A;  1Z00 A;  2AGP A;  4CCH A;  2K25 A;  4Y2Q A;  1L8L A;  4M0W A;  3R8B A;  4DQQ A;  2OOB B;  5AI8 A;  3PSF A;  5CP2 A;  3RI7 C;  2I5H A;  5LXI B;  1T8E A;  4UB6 U;  2KLG A;  9ICL A;  4U7C A;  1B9R A;  4C7Y A;  2KDF B;  4C4R A;  2GWS A;  1WR1 A;  9ICR A;  2LWP A;  3EZ5 A;  5EOZ A;  3L3F X;  2PFO A;  2KZM A;  1P1A A;  3BQ7 A;  4RU9 A;  4BVU C;  5G5G A;  2KHW B;  3RH4 A;  1T0R C;  4KGT A;  3DOW A;  2LRU A;  3RCZ A;  2L76 A;  1N63 A;  1Q46 A;  4EZL A;  1DXS A;  1LO5 D;  1LXD A;  1ZDX A;  5J2C A;  2GI9 A;  2J0M A;  4FN2 A;  2OED A;  2HOF A;  3H7I A;  3U30 A;  3UF8 A;  2XCP A;  2NTT A;  1WWU A;  5AIB A;  4ANW A;  3QUT A;  5CEH A;  2JXT A;  2X38 A;  1ZE3 D;  2CHW A;  4GXK A;  3C0R B;  2WDT B;  1IIP A;  4K4G A;  1YQ4 B;  4NWI A;  4NAM A;  4KKJ A;  2IJ0 A;  4FAD A;  5AEK B;  3T3N A;  3QZ8 A;  4J9P A;  1HJP A;  2M9N A;  1LKY B;  1RFK A;  5ALH A;  1BPZ A;  2LRW A;  4ED2 A;  2BKE A;  3G6V A;  4ZYS A;  1ZJN A;  4RQM A;  4AYB C;  2K22 A;  1RQL A;  1TY0 A;  2K5P A;  2J42 A;  3BY4 B;  3QYP A;  2RDI A;  1I4G A;  3S2A A;  3R9K A;  2BS2 B;  3VTW A;  3AE5 B;  4KZC A;  4OJP A;  3VH4 B;  3P4S B;  2KC1 A;  4RNA A;  2MJ3 A;  1D8L A;  1YJI A;  4UAT A;  4O9M A;  4B9L A;  2KFK A;  9ICI A;  3AN1 A;  5HFY A;  2IA6 A;  3ZQ4 A;  3N32 A;  4I28 A;  2W7O A;  4P2H A;  4I6L B;  5J2A A;  1RM6 C;  4PHD A;  1Q10 A;  3WK9 A;  4X57 B;  3ZIM A;  1D3Z A;  3FYH A;  4M9J A;  4OZB A;  4A3O A;  2MRL A;  9ICB A;  2UVV A;  4JQW C;  1N5W A;  4DLE A;  1OW5 A;  5FP0 A;  4DEZ A;  4US9 A;  5T14 A;  2ZCB A;  2B76 B;  4MH0 E;  4ZRK A;  2ISP A;  3IHQ B;  1B4F A;  3KKA A;  1PYW D;  3KZX A;  8ICK A;  3R7Q A;  2ASL A;  4UBC A;  4ED7 A;  4K81 A;  4MSQ B;  2KDE B;  1KFS A;  4YTP B;  1WGY A;  1ZQA A;  2K39 A;  2UU7 A;  2M0N A;  1X1M A;  3AE6 B;  1QSS A;  2KEY A;  1HQR D;  2RPV A;  5E79 U;  3H40 A;  1RDF A;  1ROE A;  5KG7 A;  3IBE A;  2FLL A;  4BGD A;  5TSS A;  2IMW P;  1TS2 A;  1L0Y B;  3LWM A;  1NK7 A;  2AQ3 B;  1N60 A;  4C4V B;  1KN5 A;  5J29 A;  2DYM A;  2KDM A;  2V1Y A;  2WAQ F;  3V3X A;  4WAA A;  2PFN A;  5TIS U;  2LD9 A;  3PRM B;  3OJU A;  1JX4 A;  4YTM B;  1WCN A;  2KJ9 A;  4LZD A;  3H8S A;  2XY5 A;  1FCC C;  3UXP A;  2V4Q A;  1E8Z A;  1J19 A;  2KQS A;  2R8H A;  2HJ8 A;  1NEK B;  5J2R A;  3UIN B;  9ICX A;  4EZ6 A;  3ZD8 A;  5ALE A;  3UMG A;  2B3A A;  4DL5 A;  1TIF A;  1KRH A;  3APF A;  2F2A B;  3IFW B;  4I2G A;  3KFU F;  3ZW3 A;  1XLP A;  1JW9 D;  1N61 A;  1R4N I;  4ECT A;  3RB4 A;  1ZQU A;  2NVU I;  5A0L A;  3RR7 A;  4XE0 A;  5HR7 A;  1NK6 A;  2DAJ A;  2PMZ F;  3ABV B;  1DGS A;  2QB1 A;  2MX2 A;  3T9L A;  4B9N A;  4AOF A;  4F1S A;  3IDW A;  1L3T A;  2W7P A;  3D32 A;  5AKI A;  4ECU A;  2CU3 A;  4AS1 A;  3HKZ C;  3NG0 A;  3C2L A;  4QAY A;  4KLI A;  2O6K A;  4RNN A;  1RYR A;  1ET9 A;  5AI9 A;  2QIE B;  3AXC A;  2WU2 B;  2FMQ A;  4FHK A;  4P7I A;  4DSE A;  4OJ6 A;  2W9B A;  4F4W A;  3Q8C A;  1ZQB A;  2E8N A;  4YQW A;  4KX6 B;  2N9L A;  3MTN B;  3RB3 A;  1YT3 A;  4YD1 A;  4M6W B;  4NJC A;  1PK1 A;  2CHX A;  4C8K A;  3I63 C;  1A5R A;  2YMP A;  1WGD A;  4UBB A;  4FBT A;  5DLF A;  2RDG A;  4S17 A;  4XUS A;  7ICP A;  1NBF C;  1UBI A;  3DVG Y;  4NJ7 A;  3OJ3 A;  3KH0 A;  1SGG A;  4KMU A;  1RLF A;  3DBR B;  3VQI A;  2KG5 A;  2G07 A;  3PGE A;  2Q4T A;  4J3O D;  4OVV A;  3KTQ A;  1HUZ A;  3VFK A;  3MDA A;  4HDQ A;  4LDT B;  4WJN A;  3MHZ A;  5AM1 A;  4FFD A;  5J2D A;  1Z3E B;  1NJZ A;  2OWO A;  1ECW A;  5AKG A;  1K8R B;  5CHV C;  3PT2 B;  2V4L A;  4J9R A;  1FO4 A;  2I1Q A;  4AWJ A;  3EFU A;  1TS3 A;  2JPH A;  2D8C A;  4M8N A;  9ICA A;  3D2Q A;  3NS8 A;  4W9C A;  2ZTC A;  5D2M B;  2KSO A;  1IP9 A;  4HJK A;  4H2A A;  5KHQ A;  4LJX A;  4F3O A;  3GS2 A;  3N1Y C;  4RUC A;  2KNB A;  1XWL A;  2HDO A;  4M9N A;  3P2B A;  2HHX A;  4IWQ A;  2RPQ A;  1V5T A;  4NLG A;  4ELV A;  1WYG A;  3Q8L A;  4KX3 A;  2V9W A;  3GIK A;  2O2V A;  5EE3 A;  2NRW A;  3C19 A;  2BDU A;  1JQ4 A;  4DF8 A;  2ZZP B;  1U45 A;  2WF9 A;  4QW9 A;  2FUG 1;  1ZQY A;  2L0F A;  1IPG A;  2AWT A;  2WXO A;  4OZC A;  2J6U A;  4C8N A;  2WB1 F;  3EUB 2;  3L5K A;  1ZQJ A;  1HZ6 A;  4M2Y A;  2X8X X;  4MGK E;  3SQI A;  1SXT A;  2BKR B;  2IHN A;  1OQQ A;  2F77 X;  3WA0 A;  4FBJ B;  4MFA A;  3QHT A;  5DDM A;  1V9J A;  3VR9 B;  1XC9 A;  4MEM A;  1WXQ A;  4MM3 B;  3F2D A;  2HHU A;  5J2I A;  2BWF A;  1KFD A;  3Q8Q B;  5AI4 A;  2WTF A;  1E7V A;  3D2S A;  1WX7 A;  2KTR A;  4WQO B;  1A76 A;  2J7Q B;  3KUD B;  3OGU A;  2KWC A;  2WX0 A;  2YY6 A;  2WHI A;  5KT3 A;  5KFR A;  2AGQ A;  3UXN A;  3TKA A;  4IKG A;  2H3V A;  2JZB B;  5G2N A;  2K89 A;  4QWE A;  5IIN A;  3Q8M A;  5ALG A;  3C5G A;  3LXF A;  4YMM A;  1TKG A;  4HK2 A;  2L5Y A;  8ICJ A;  1GJZ A;  5J0Q A;  1ZQN A;  2LMC A;  3AV8 A;  4E74 A;  3BJY A;  1NK4 A;  4B6J A;  3OAW A;  1E8W A;  2NPT B;  1SV0 C;  1OFF A;  3V6J A;  3U52 E;  4RQ4 A;  4P0P A;  3SMV A;  1TAQ A;  3WAL A;  3K1Z A;  1RXV A;  2F3N A;  2MBB B;  4I6P A;  1T7P A;  4MH8 A;  4W9E A;  1WRD B;  2KWV B;  3THV A;  1YMH E;  2KOB A;  3RZF A;  3ZD9 A;  3NZS A;  4FJV B;  2EZX A;  4EEN A;  2HE7 A;  2BB5 A;  1SL1 A;  4RCO A;  2AYO B;  3IVF A;  4ICV A;  1GC7 A;  2YTU A;  5ALP A;  5DG8 A;  4DL4 A;  2BS4 B;  4M8M A;  5D7G A;  3R66 C;  2UVU A;  3TAP A;  4QZA A;  4NLK A;  2B0C A;  2WXN A;  2IY1 B;  4PHA A;  3KUC B;  5J2K A;  8ICY A;  1ZQW A;  2BQ3 A;  3PR4 A;  2LI6 A;  2JY6 A;  4KIK B;  5KFF A;  3RNA C;  4ANX A;  4EYI B;  4B9U A;  2CXY A;  4TQS A;  4FLH A;  2DEN B;  5EWF A;  1YIW A;  2PVO D;  2KV2 A;  1V9P A;  5JTI A;  1KSP A;  7ICG A;  3U7Z A;  2KMM A;  1N2X A;  1X40 A;  1QZE A;  3PO5 A;  4PGX A;  1C78 A;  1HEZ E;  3R2T A;  4A8E A;  5KAI U;  2W3R A;  5DBC A;  3BS5 A;  4CDG A;  1IGC A;  1YJ1 A;  5L1L A;  1R4N B;  4HRO A;  2M17 A;  2H3Z A;  4TQ1 A;  1BML C;  1L3V A;  1Y8R C;  3VDZ A;  3UMB A;  2Y0S C;  2QKQ A;  2HTM E;  1L3S A;  1D9D A;  4KKI A;  2R8G A;  1F77 A;  3V61 A;  4FJY A;  2K8A A;  4XDC A;  4HEA 1;  1SV4 A;  2BCV A;  3VC8 A;  3JPO A;  2FE9 A;  2AQ1 B;  2KDB A;  5ALX A;  1SL0 A;  5J8Y A;  1KF6 B;  5DQI A;  1XF5 L;  4LK0 M;  4GDL B;  1D9F A;  4F5O A;  1M4V A;  3TJP A;  4KLG A;  4KLD A;  3ZVV A;  4DFD A;  4W9F A;  2WAQ C;  5J0R A;  4Y2R A;  3BQ1 A;  2FPL A;  2I1K A;  1HTO A;  2R2Q A;  3DWG C;  3RJJ A;  3V6E B;  1H4R A;  2D07 B;  2BPS A;  4QZI A;  4F8R A;  1DOX A;  3GE8 C;  1C4C A;  5L1J A;  1EXN A;  1SV0 A;  2JEF A;  1V8C A;  1YX6 B;  1UBQ A;  4PYZ A;  1TVA A;  5CA7 A;  3DDC B;  5JH5 C;  4UB3 A;  1PGB A;  1U4A A;  5AM5 A;  4MGZ E;  2W04 A;  4XQ8 A;  3QIJ A;  4RPX A;  4C4V A;  3TUO A;  3AE2 B;  1PVP A;  2E1F A;  1XSN A;  4WJ3 B;  4WH4 A;  1X9X A;  1MQ3 A;  3SV4 A;  3LYS A;  3HM3 A;  3KYC D;  3AEC B;  4PH5 A;  5KFK A;  8ICF A;  1O08 A;  2KJH B;  4MF2 A;  4YR3 A;  2NBU A;  1AWD A;  5ALU A;  2BW2 A;  2DL0 A;  3Q3O C;  2ZVN A;  3NJT A;  4JL9 A;  3QAQ A;  1ZQT A;  2G08 A;  1IUE A;  3CST A;  4NAW A;  2REX A;  2BZF A;  3HW8 A;  2Y5C A;  1DOQ A;  2VKQ A;  1KKX A;  2PLP A;  3HRD D;  3SEN A;  3URY A;  2GBR A;  3AUO A;  3PW7 A;  3ONS A;  3G6Y A;  9ICO A;  2M56 B;  3RT3 B;  4EBE A;  2CRX A;  2PE6 B;  5KG2 A;  4YXJ A;  1F5S A;  1UD7 A;  4XYC A;  2XBB C;  2JRI B;  3QU5 A;  1L8O A;  3M1Y A;  4Q8F A;  1WXS A;  3FAH A;  1T0Q C;  1GC6 A;  9ICG A;  4G9B A;  4XRH A;  4U6P A;  1RAX A;  3I3T B;  1C79 A;  1LVH A;  3SAF A;  2SEB D;  4MM3 A;  8ICG A;  1K52 A;  3MFH A;  4JIO U;  1QQ5 A;  3DBL I;  4PT5 A;  5TZV A;  3RNB C;  3IG3 A;  3TEX A;  1KFY B;  4QWA A;  3TCA A;  1SSN A;  1KW4 A;  2HMX A;  3ISC A;  2BYV E;  4RH6 A;  4AUQ C;  2ACZ B;  1XLO A;  4B0E A;  2N1W A;  3TSS A;  3QX1 A;  2KFJ A;  2RD0 A;  1QH9 A;  2ZJA A;  1FXT B;  2KDI A;  3AUL A;  4KN7 A;  4TUR A;  2DZM A;  4G11 A;  2L83 A;  5AM3 A;  3SFD B;  4FXC A;  2QB0 B;  9ICH A;  2K4H A;  3V6K A;  1E90 A;  3VRB B;  1HZ5 A;  3H4D A;  1SL2 A;  2J52 A;  2JUO A;  4ECS A;  2FID A;  2NCN A;  4DWF A;  2OXO A;  4F2S A;  1FPY A;  4CYE A;  1PUT A;  9ICW A;  4K3C A;  3QJZ A;  4OD0 A;  2YEP B;  1MSW D;  3IG5 A;  5C2T B;  8ICI A;  2EQY A;  2JEI A;  4IS7 A;  4D2K A;  3EYZ A;  4RNM A;  5KT4 A;  5ALT A;  5B66 U;  3ZNH B;  2VRR B;  3OWE B;  5AI5 A;  1C1Y B;  4GIB A;  3RJG A;  9ICM A;  7ICN A;  4R66 A;  2Y3A A;  2K9X A;  4FHJ A;  4XX5 A;  5KG1 A;  5C23 A;  3QUQ A;  4BDP A;  1J2N A;  3SR6 A;  5KNI A;  4KVG B;  4MGY E;  4JUZ A;  3MR6 A;  1UT5 A;  3KZI U;  3F2C A;  3C28 A;  2IHM A;  4PZO A;  4XWT A;  5KFP A;  2J4X A;  1KQQ A;  2WXH A;  2BQU A;  3R3M A;  1FEH A;  2VJ4 A;  3M9O B;  4TV3 A;  3D6J A;  2ZW0 A;  2YMQ A;  3TMP B;  2NRT A;  3V60 A;  1B1Z A;  2MQJ A;  4XWW A;  2P66 A;  1CK1 A;  1WFY A;  1MHH E;  2ONQ A;  3MC9 A;  3BS5 B;  1X42 A;  3PZP A;  2XK5 B;  5KG4 A;  5J0T A;  8ICW A;  8ICC A;  1PK1 B;  3RUI B;  5J0X A;  4IRC A;  1N5X A;  5KFE A;  1X2I A;  5AKJ A;  4EBD A;  2KJ5 A;  1JN3 A;  3PZD A;  4MDK E;  2E8P A;  4QW8 A;  2P6U A;  2PXI A;  4OVZ A;  2DKX A;  3PML A;  3T5H A;  1GB4 A;  1OQY A;  4BXO A;  4AP9 A;  1UT8 A;  4QIW C;  2KWD A;  2MW5 A;  3N9Y C;  4OW0 A;  3VVW B;  1JWA D;  1ZQS A;  3KW5 B;  2ZIU B;  4I27 A;  4LNF A;  1LQB A;  2C9W B;  1QOG A;  4GLS C;  5EE1 A;  5KTQ A;  4Z6C A;  5KL1 B;  4RF1 A;  4ANU A;  2W8L A;  2GRI A;  2KVS A;  4IM0 A;  3ZDC A;  8ICU A;  2HDE A;  2PVG C;  5AK5 A;  3HP6 A;  3KHL A;  1FNV A;  5E6P A;  2KIC A;  2LI5 A;  3PHX B;  4BKG A;  5AM0 A;  4HPL B;  2LUM A;  2GMI C;  1RG6 A;  1JWB D;  2N1V A;  2E8M A;  2WF7 A;  4UB2 A;  1UNS A;  1YN3 A;  2CJO A;  3WAN A;  1S97 A;  1UZX B;  2RP5 A;  1GPX A;  3TEZ A;  1MJD A;  2AEH A;  1GNU A;  4W9G A;  1OUQ A;  1WGR A;  1A6S A;  1B0X A;  1K1Q A;  1I7H A;  2LVP A;  9ICN A;  4IUM B;  3APD A;  1UF0 A;  2ZXH A;  2JRH A;  4B9T A;  3AEE B;  1SXE A;  3WAP A;  2KNJ A;  4RPZ A;  4DSF A;  2FDR A;  2F1H A;  3HWT A;  1NKC A;  5HHD G;  3ALR A;  2KC2 A;  2R61 A;  3JPR A;  4DXG A;  3LVV A;  3GIM A;  4QZD A;  2WB1 C;  3X0W A;  1P9D U;  4W9H A;  5FKA C;  2N1R A;  1ZD3 A;  1TKD A;  3IP4 B;  3RAX A;  2D3A A;  2G4D B;  4NAW B;  4C00 A;  4JV0 A;  3VXW A;  1FM0 D;  1QOA A;  2JVC A;  3HX0 A;  1TK0 A;  5KHO A;  4CF3 A;  2WFA A;  2BF8 B;  2RHF A;  2JWZ A;  1WX8 A;  3VH3 B;  9ICP A;  7ICJ A;  1X66 A;  4ZHP A;  5ALL A;  3ENE A;  2H3F A;  4IOI E;  4LVS A;  4W9J A;  5KFX A;  1LGR A;  5KFV A;  4QWC A;  4LNK A;  3M8R A;  1XLN A;  1TAU A;  5ALF A;  1WGG A;  4EEL A;  2LJI A;  2I9G A;  4RNO A;  2RQ5 A;  3I5J C;  1ZQZ A;  2ZIV A;  1L6V A;  2K8C A;  4ED1 A;  2LHE A;  3KD3 A;  3ETR A;  4PYU A;  5LXH A;  1XT9 B;  2KZR A;  1ZQE A;  1V6E A;  1P3Q U;  4NM1 A;  5DQG A;  1SZP A;  1LKY A;  2L1A A;  2ZNV B;  7ICV A;  5BYR A;  3QZ7 A;  4J9K A;  5DB6 A;  4HDO A;  3X23 A;  2G0A A;  4RQ5 A;  2PPH A;  4R3D A;  3PRZ A;  3ZXR A;  2OJW A;  4F72 A;  2HBJ A;  3DBH B;  5D3I B;  1NZB A;  2Y5B B;  3TIX A;  5I4D A;  2KFN A;  3DHI C;  4DQP A;  2LHT A;  4QIW F;  5AKY A;  3BZC A;  4NQK E;  4Y2S A;  4DHJ D;  2QIL A;  1EU3 A;  4IR1 A;  1DK2 A;  3JSV A;  4KLF A;  5IIL A;  1XXG A;  5E6J A;  1WMH A;  3ML9 A;  2WF8 A;  4F5Q A;  4M02 A;  3NZ3 A;  1ENF A;  2FBW B;  4WWO A;  3N7S C;  3MJ5 A;  4S0R A;  3PO0 A;  2E8O A;  4HCP B;  3TQ1 A;  3PX6 A;  3AE3 B;  4DSK A;  4Q8E A;  4YSZ B;  2W9N A;  5JHB A;  1C3T A;  3I57 A;  1BPB A;  1ZQQ A;  4N6E B;  3PX4 A;  2YB4 A;  5D4B A;  1S0N A;  1SZH A;  2MJE A;  2C28 A;  3B08 A;  1L6N A;  2WXJ A;  2PMZ C;  4DL6 A;  3VAW A;  2N9X A;  2ZPY A;  5CRX A;  3M6K A;  3BQ0 A;  5EDS A;  1DYQ A;  2ZJD A;  3LB8 C;  4KMO B;  5JXV A;  1QKZ A;  4DFM A;  5J2F A;  1VD2 A;  4RGM A;  4ECW A;  3NVV A;  2ASQ A;  4KLM A;  2V4I B;  3E58 A;  1L7N A;  4DXF A;  4DSL A;  3H4B A;  2KTQ A;  4GN1 A;  5DKW A;  4O5K A;  4JV1 A;  1EUV B;  5G5H A;  3TEY A;  1XO1 A;  2JR5 A;  4ARC A;  3Q8K A;  3BYY B;  4GB9 A;  2PTL A;  3SI8 A;  3S6J A;  3AU2 A;  4R8U A;  4C0Z A;  3K9P B;  1UWM A;  8ICO A;  4ECY A;  2G1E A;  4UAR A;  4A9A A;  3F5E A;  1J7B A;  2OEH A;  2CU1 A;  3ED5 A;  1WZ0 A;  1KLV A;  4UAS A;  3ISB A;  1VRA B;  2GBJ A;  3RB6 A;  2SAK A;  1MN8 A;  5J2G A;  3A4S C;  4BBN F;  4ARI A;  3GZN B;  3QEA Z;  3IT6 B;  5JU5 A;  3OPX A;  4K4I A;  4J9M A;  7ICF A;  4ED3 A;  3E2E A;  1WJU A;  2EZY A;  3ZUN A;  2BCU A;  3KBB A;  2DBY A;  2XEW A;  4PS8 A;  4YTN B;  1JWM D;  4EEW A;  4JLC A;  5KAF U;  4N59 A;  3W5V B;  3NVW A;  2L32 A;  3JYU A;  1LV5 A;  2EEL A;  2D3B A;  2WXQ A;  2D3D A;  4ELT A;  1VZ6 A;  1I42 A;  3NS1 A;  4GDK A;  2PE9 A;  1D4B A;  3WAM A;  1ACC A;  2UYZ B;  5KG5 A;  1I4P A;  1GG3 A;  4TUP A;  2AL6 A;  2V3P A;  4YMO A;  3ZDA A;  5T8I A;  3GII A;  3RJH A;  5AUI A;  4O0I A;  1MPE A;  1HEK A;  3RNG C;  3T5L A;  4QWB A;  8ICH A;  3V6C B;  3U2S C;  2A1A A;  4DXA B;  2AH5 A;  2LM1 A;  4GC6 A;  9ICS A;  2C5L C;  2HBM A;  3OHB A;  3AU5 A;  3BII D;  2IO2 B;  9ICT A;  1ZXH A;  3DBH I;  5DQH A;  1SKS A;  3AED B;  2PFQ A;  3EGR A;  3QU7 A;  1TS4 A;  2BGW A;  3P4R B;  1XSP A;  3B0A A;  2KO3 A;  2WXR A;  1I4X A;  2LBO A;  5KG6 A;  3M95 A;  5AIC A;  7ICE A;  3SFE B;  1YX5 B;  3C1Y A;  2BKF A;  2I1J A;  1O03 A;  1FNW A;  3V6H A;  1AAR A;  2N0S B;  5KFQ A;  1WXV A;  2BPG A;  1SKR A;  5KFB A;  2JZP A;  1ZQD A;  3GV8 B;  9ICF A;  3N1Z C;  1J7C A;  1KFT A;  3PVX A;  1KTQ A;  4MAC A;  1Z4N A;  1OEY A;  3IAS 1;  2V0G A;  1NYR A;  3AH7 A;  2DPI A;  4UAU A;  4K4H A;  5ALK A;  4F4Z A;  1TKE A;  4F7Z A;  1ZQK A;  3WAO A;  3N3K B;  5IIM A;  1K51 A;  4IM2 A;  2Y0S F;  3RAQ A;  4I2B A;  2QB0 A;  2INP E;  4ED8 A;  2LVQ A;  2MBE A;  1HIW A;  1TK5 A;  3AEB B;  3ZTD A;  5AK6 A;  4P0Q B;  4FS2 A;  4QZB A;  4ECX A;  1URJ A;  4UAZ A;  1Q5W B;  3TI0 A;  2ZPN A;  3QAR A;  3PW0 A;  1SJH D;  3MC8 A;  2RSU A;  2W43 A;  8ICZ A;  1SB3 C;  4OJL A;  4I2C A;  3QWZ B;  4QZC A;  4KTQ A;  1NJX A;  1GB1 A;  2C2E A;  7ICL A;  1S1Q B;  3ML8 A;  3DQV A;  2WHE A;  3F53 A;  3KHG A;  4YR0 A;  1BNO A;  2XN9 C;  4O3M A;  3JPQ A;  2FMS A;  1NVI D;  3M9N B;  3I9V 1;  3DVN V;  2HBK A;  4DFP A;  2F1J A;  1L7M A;  3Q69 A;  4MFF A;  4DL2 A;  2L0T A;  4M0A A;  5E6O A;  4EE2 A;  4TQR A;  4DQR A;  1VZ8 A;  3AU4 A;  2KHQ A;  1PDX A;  4ACO A;  3T8M A;  1EWC A;  1V1O A;  3WU2 U;  1QIL A;  1ZET A;  8ICA A;  4Z6D A;  3L0W B;  4DO9 A;  2A19 A;  3RNC C;  4R63 A;  2K4I A;  3I28 A;  1EU4 A;  3KLS X;  1KDH A;  4FZM A;  4BXO B;  2PJH A;  1WUD A;  4W9I A;  2YLM A;  3RUL A;  1QSL A;  4I2E A;  3W9C B;  4GMV A;  2D5G A;  2KD1 A;  4E0D A;  2KOX A;  3SV3 A;  4KGS A;  1TZ1 A;  2V9H A;  5AI0 A;  1F52 A;  2PEA A;  4K7S A;  2LKY A;  3QU9 A;  3BVZ A;  1KTK A;  9ICU A;  3C5F A;  4YSY B;  4TUS A;  1S8O A;  1J8C A;  5KG0 A;  2YMM A;  3KHH A;  4HLE A;  2DLB A;  1F9J A;  2OM6 A;  4M6W A;  2JT4 B;  3M9M B;  1N62 A;  2KJ8 A;  1D5M C;  4PHP A;  2N4F A;  3OTQ A;  3RBD A;  3W2D A;  3RH5 A;  2RR9 A;  5BOL A;  2BYF A;  4G50 A;  1TAM A;  3SAG A;  4YP3 A;  2Y9T A;  1NYQ A;  1TY2 A;  2JEJ A;  4UB1 A;  2VH2 A;  5IKC M;  5JUM A;  5DBA A;  4Y2V A;  2KAC A;  4RGN A;  3PSE B;  2WGS A;  2Z8L A;  4YT0 B;  4ZRQ A;  2L3Z A;  1UA0 A;  1BVS A;  4IWO A;  4QZE A;  4QNL A;  4ZRP A;  1Y56 A;  3UQA A;  1BPX A;  4C56 C;  4FE3 A;  2BYT A;  4YWG G;  1BT0 A;  4QJF B;  2EAP A;  1DGJ A;  3ISD A;  3F5A A;  1WRI A;  4N9F 4;  1A70 A;  2WF5 A;  4NL9 C;  3C29 A;  1MA7 A;  3NVZ A;  5KFY A;  4Q43 A;  1QCK A;  5KFN A;  4DFK A;  2F8K A;  2HHV A;  3KWV A;  2JHD A;  3D2N A;  1D5X C;  3Q8A A;  1IBX B;  4WWN A;  2LYB A;  1U48 A;  4P0Q A;  1XCT L;  1RRB A;  2KK0 A;  1YQB A;  1OGW A;  3B2G A;  4HPM B;  1FRD A;  4YL8 A;  5LNK 1;  2JEG A;  2KAJ A;  5CR0 A;  1MFW A;  4URK A;  4YSX B;  3WK5 A;  1E0Z A;  4IM3 A;  3Q8P B;  2A5U A;  2JXJ A;  1RZT A;  3DEE A;  3FC4 A;  2W9M A;  4L2Y A;  4BOZ B;  2ES6 A;  2KFK B;  2WXP A;  3NOB A;  4B6W A;  1P98 A;  5C1Z A;  5DG7 A;  2K8H A;  4UQG A;  5HG2 A;  2YN4 A;  4J9N A;  1S77 D;  3PX0 A;  4CRX A;  4FA6 A;  1PVR A;  3PW4 A;  1Y88 A;  3C2K A;  4QWD A;  4P6V F;  4Z6F A;  4B9M A;  2RGF A;  5MPO A;  4C8M A;  5J0P A;  4TUU A;  4J9S A;  4RQ8 A;  4EEY A;  3J81 j;  3E56 A;  1RPL A;  2BCS A;  4BOS C;  1ET6 A;  1TBE A;  3L4P A;  2DHZ A;  4TUQ A;  4KLO A;  3QE9 Y;  1WG8 A;  3ZJV A;  3JPN A;  8ICS A;  4EX7 A;  3WKD A;  2ODG A;  1L7P A;  3PST A;  1IXR A;  5AZH A;  2LVO A;  1WE7 A;  3NRW A;  2K8B B;  4XC2 A;  3HPO A;  2M1M A;  3FIL B;  1TYG B;  3FM9 A;  7ICM A;  2PI4 A;  1EF5 A;  5HI1 A;  3LDA A;  1OTR B;  2DUY A;  1WX9 A;  2A1J A;  1V1P A;  2VZK D;  4UAY A;  2MJD A;  3A1Q B;  1GAQ B;  4GXB A;  4XDD A;  1V2Y A;  3KOO A;  2PMV A;  1ZOY B;  3ICX A;  5AKL A;  4ECZ A;  2Q0Z X;  3T3F A;  3TAR A;  5H2F U;  2FPM A;  2I38 A;  1TKY A;  4PK1 A;  2G09 A;  5HMM A;  4CQN A;  1JWU D;  1P0R A;  3WK4 A;  7ICK A;  2KVR A;  8ICV A;  5DPR A;  4GDL A;  1G6J A;  3HIZ A;  8ICB A;  1WMH B;  2YML A;  3EW9 A;  4C80 A;  2BR0 A;  1E7P B;  2CHZ A;  2UWQ A;  4TSS A;  1QQR A;  2FIF A;  4F71 A;  4LDT D;  5BOM A;  2F1I A;  2MSE D;  3RNE C;  1E9M A;  3E0F A;  2DX5 B;  3ZDT A;  2AQ4 A;  2KD0 A;  2MUT B;  3EFC A;  5KG3 A;  5DPT A;  2INC C;  3PHW B;  5H8Y E;  3I76 A;  1D6E C;  3FIL A;  1ZQR A;  1VDV A;  3WK6 A;  4IRK A;  2XGQ A;  1WZ3 A;  1JRP A;  3Q8F A;  3MBY A;  4DWI A;  3FDS A;  1XU4 A;  3M62 B;  1TGZ B;  3ONN A;  1RYJ A;  4A8X C;  2BTE A;  4WJQ A;  2ASJ A;  4L23 A;  1ZDV A;  4NM2 A;  4GXJ A;  4BFR A;  3P63 A;  4NXZ A;  2LPE A;  3PSP A;  4OJ5 A;  2KYW A;  4ZRI A;  3UIP B;  3WIM A;  4DHZ E;  1JIH A;  1QT9 A;  3P4P B;  2BWE S;  2LXC A;  2HCF A;  4NQL B;  1FMA D;  1UCV A;  3AE8 B;  4BKT A;  4Z6E A;  1WWV A;  1T5X D;  1CUK A;  2WXI A;  2E1E A;  4E3C A;  5L1I A;  2KWU B;  1YQ3 B;  4RZR A;  1BPY A;  2L00 B;  5AIA A;  3WKB A;  3N7P D;  1AW7 A;  1XO0 A;  2JF5 A;  3IV6 A;  4KLQ A;  3B9J A;  5KFM A;  8ICM A;  2QHO A;  3KUZ A;  2NO4 A;  1IBX A;  2OJR A;  7ICI A;  1NK0 A;  4F5N A;  1WJ6 A;  2QLT A;  3M6Z A;  4IQV A;  3V7K A;  2VIX A;  2Z0D B;  1VJ5 A;  4RM9 A;  1YNT E;  2LEK A;  1F0Z A;  3QU2 A;  3Q14 C;  5J0O A;  3N97 B;  1C4P A;  3SHQ A;  1QOB A;  5JZE B;  2A3V A;  5J17 A;  3RYT A;  5KFA A;  1RWS A;  3MHS D;  3B1L X;  2G9H D;  1FD6 A;  2QAR A;  2D6F C;  2ATL A;  2HVH A;  5LLI A;  1UH6 A;  2Y1J A;  2GLE A;  3C8Y A;  3L08 A;  4K7U A;  4NLB A;  3LK9 A;  4B9V A;  2KAN A;  4C8L A;  1WE6 A;  2RDB C;  2C60 A;  1ZQG A;  3ZNG C;  2ZEQ A;  5CX3 A;  4RF0 A;  5ALR A;  4F4X A;  1XO3 A;  4HKZ E;  4WIP A;  3GP7 A;  4M00 A;  5ALI A;  3RRH A;  1SE2 A;  4DK5 A;  2BS3 B;  3QEB Z;  2C7H A;  3GQC A;  3BZD B;  1TS5 A;  2JZB A;  5GTI U;  4ZH4 A;  4FS1 A;  5HKH A;  3QXG A;  2NS5 A;  2VJ5 A;  3UQ2 A;  4IQT A;  1ZQI A;  2NTS A;  1WM3 A;  2W9C B;  3GZF A;  4YCX A;  2EAM A;  1X9M A;  4K7W A;  3BQT A;  4EEK A;  1UQV A;  3VUX A;  3HKZ F;  3IG8 A;  2W82 A;  1XNS A;  3M8S A;  4REZ A;  3TFR A;  1JAL A;  1QSY A;  2R8J A;  3H9D A;  4JWN A;  2DFL A;  5IIJ A;  2F76 X;  3I1Y A;  2GOL A;  5J18 A;  1MQ2 A;  4ZHO A;  2C22 A;  2FLN A;  4BUG A;  8ICR A;  1M6Y A;  4R8U B;  2A4Z A;  3K9O B;  4IW0 A;  1L6U A;  2MLB A;  1SBB B;  4W9L A;  1NI3 A;  2D11 A;  3BVG A;  5KT5 A;  5EWE A;  4TKN A;  2O2V B;  1LM8 B;  5ALZ A;  1ZGU B;  1V85 A;  1ZD5 A;  3H7P A;  1S76 D;  4DDG D;  1WM2 A;  5TR5 A;  4JE3 B;  7ICH A;  4KSK C;  4F8C B;  3GFK B;  3H8M A;  1XSL A;  9ICJ A;  1I4R A;  5AKE A;  5J0W A;  3Q3N C;  1I4Q A;  5KT7 A;  3H0L B;  4E71 A;  2XO7 A;  3C21 A;  5DBB A;  1SGH A;  3B0Y A;  4L1B A;  5DLG A;  5KT2 A;  1ZQ1 C;  5AK3 A;  1F1H A;  2DAF A;  2BHN A;  3P42 A;  9ICQ A;  2NBV B;  7ICU A;  4BKS A;  5IN7 A;  2O6V B;  4LNI A;  1ZKH A;  1SWW A;  2LFI A;  4HXD A;  4DL7 A;  1WSP A;  3LDZ E;  3VR8 B;  4JWS C;  3RH6 A;  3AM9 A;  2H89 B;  3B0X A;  1KLN A;  3PTF C;  5BMI A;  2K6Q A;  1YN5 A;  4I2I A;  3VTV A;  3RNF C;  3TL5 A;  4YVZ A;  2BCQ A;  2N7E A;  2ASD A;  1YJJ A;  3A4R A;  1YZ6 A;  4KN4 A;  3R2I A;  5KFU A;  4F2R A;  4LNO A;  4NNJ B;  2RDJ A;  1KRP A;  4Y2U A;  9ICK A;  1DOI A;  8ICQ A;  4FBU A;  2FJ6 A;  3NHE B;  2WU5 B;  1KM7 A;  3TEW A;  3DHG C;  4W9K A;  1Q3U A;  1B22 A;  3PW5 A;  3PRP B;  2ZW1 A;  2N9K A;  3BK2 A;  1LB2 B;  3RBE A;  3MGI A;  1R7S A;  2M0A A;  1U47 A;  8ICX A;  4DHJ B;  1BPE A;  2YX8 A;  5F3X B;  4FJZ A;  3ZJT A;  4DQS A;  2BT6 A;  2PI5 A;  4AYB F;  3GOE A;  2V3S A;  1KLG D;  2C2R A;  3SZ2 A;  1E8Y A;  1EM7 A;  3TAD C;  2QCZ A;  2HHT A;  3A9J B;  3QK0 A;  7ICR A;  2Z0E B;  4EZK A;  3PRE A;  3DPD A;  2KIW A;  2RDH A;  1FNU A;  1LFD A;  3MAB A;  4KLL A;  5L95 C;  4RGO S;  1S9F A;  1QQ6 A;  4YMN A;  5ALV A;  1NKB A;  2HJ1 A;  2IO3 B;  1V5O A;  4DQI A;  2O6V D;  4I6N B;  4HAI A;  1FXA A;  1ZJM A;  1ZUD 2;  3H6N A;  1X9W A;  5DPS A;  4TQ0 A;  2V4R A;  2LXA A;  3L10 B;  2R8K A;  4RQ7 A;  3IHP C;  4OZA A;  1WYW B;  2KIV A;  4I2A A;  2JXX A;  1VR9 A;  2KVC A;  2FAZ A;  4RQ0 A;  1IGD A;  4JX1 C;  5GTH U;  5EWG A;  4LLG M;  3V05 A;  2KKC A;  4HJG E;  5DB7 A;  2LYA A;  4QZF A;  4Q2J A;  5ALJ A;  3ZNZ B;  3RD2 A;  2EZZ A;  4DLG A;  5G55 A;  1IYF A;  2FLP A;  1ZQH A;  3ZXV A;  4EOY A;  1X6I A;  5D6J B;  1EWY C;  3GZN I;  4QZH A;  1ZQL A;  2IGH A;  4O3R A;  5HP4 A;  5D49 A;  1SE3 A;  1D8Y A;  5C3J B;  4O3N A;  4WUR A;  3PO4 A;  1WGH A;  3RJK A;  2DYB A;  3ZI4 A;  4HCN B;  5KFO A;  8ICP A;  2W03 A;  1GOZ A;  3DBS A;  1ZQV A;  3GU3 A;  5GMV A;  5IP4 D;  1J0G A;  7ICS A;  2BB6 A;  2GB1 A;  1NK5 A;  1Z4O A;  4CGZ A;  4ITK A;  2GLS A;  3LYY A;  3A9K B;  3J9C A;  4IWP A;  4JWU C;  1AN8 A;  1VZ7 A;  1ZPS A;  3UQ0 A;  1JRU A;  8ICT A;  4X5V A;  2INN E;  3TAC B;  2ZTD A;  4DSJ A;  2VAN A;  4UB5 A;  4JGH B;  4A3P A;  4C4S A;  3VRA B;  3HVD A;  2G4S A;  1J97 A;  3Q3F A;  4EBC A;  3BVM A;  5KFJ A;  2ZG6 A;  2LAS A;  5F9N A;  1ZRN A;  2J53 A;  4WJP A;  3NZU A;  2XCA A;  4FZN A;  3RB0 A;  3N30 A;  4MEY A;  1SF0 A;  1Q1O A;  3Q8E A;  3IXS A;  3H8H A;  5ALO A;  3W5U B;  5KFD A;  4CO7 A;  2A1J B;  2NRV A;  4BKS D;  5L1K A;  4JV2 A;  2IO1 B;  1L7O A;  1T3N A;  4BBN C;  2NRZ A;  1EO6 A;  1IM4 A;  1V86 A;  4W9D A;  2AQ2 B;  2L05 A;  5L83 A;  4NJ6 A;  2LHD A;  1L7Y A;  1S10 A;  1TT5 B;  1F44 A;  4KLE A;  2KTR B;  3P4Q B;  4WJO A;  1MI0 A;  2AHO B;  2W55 A;  2MP2 A;  2HD5 B;  2AGO A;  4PL1 A;  4II2 B;  3UIO B;  1CJE A;  2DYO A;  3DCG A;  4F93 B;  4Y2J A;  1SIJ A;  2JH7 A;  4O5E A;  3NTU A;  4YXD B;  4AJW A;  2QJL A;  4NL9 A;  3BZK A;  3EWA A;  3AB5 A;  4PJ0 U;  4OHJ A;  3GDX A;  2MA1 A;  4UW9 A;  3H8J A;  4CF5 A;  1Z1B A;  2JH1 A;  1UGJ A;  2D3G A;  4WWP A;  2J0J A;  5IA7 A;  4KX5 A;  2ZUC A;  1KOT A;  4LCD E;  2VA2 A;  2H3I A;  2L7R A;  4R65 A;  2BCR A;  3VUW A;  3ZYY X;  4NY8 A;  1ZOL A;  2XGP A;  3L54 A;  4B9K A;  2WQY B;  2QC8 A;  4Q44 A;  5KFH A;  2C7M B;  2NO5 A;  4MJS B;  5IOI A;  2DZI A;  1E10 A;  3UGB B;  1A0P A;  3QUC A;  2P35 A;  2O6V A;  2CPR A;  2BVC A;  3KHR A;  3JW0 X;  3U4E G;  1JRO A;  5AM4 A;  2LGI A;  1MG4 A;  1X9S A;  1ZW7 A;  5CTR C;  3K75 D;  4TMA B;  3QUB A;  2RRD A;  1WH3 A;  2ZXI A;  1SE9 A;  5BYS A;  2G5I B;  4BX9 C;  3M7D A;  3NAS A;  3EA6 A;  1Z2M A;  5HML A;  4HRS A;  4G0N B;  4OO1 J;  5DPW A;  1P7F A;  3MFI A;  3M3J A;  1PVQ A;  4N58 A;  4RT3 A;  1XQQ A;  5KFL A;  2EMS A;  1ZQF A;  2GBM A;  4RM8 A;  4EKU A;  5BPC A;  2MRP A;  1L0V B;  3KQ4 A;  1V97 A;  2UVW A;  2W54 A;  4I2F A;  3PV8 A;  1ZQO A;  4ICA A;  1I4H A;  4IQW A;  1YZ7 A;  3RZW C;  3OSP A;  3Q8B A;  3MR2 A;  5CHF A;  1IV8 A;  4I2D A;  2YEP F;  2WP9 B;  1UHU A;  4XZ4 A;  1UGM A;  2JWU A;  2KZ3 A;  3V72 A;  2MBO A;  1ZD4 A;  3MC1 A;  1BXT A;  1UUP A;  2KMC A;  5ALS A;  1COO A;  4IRD A;  2XVT A;  4KLJ A;  2MBH A;  2KT7 A;  4NLC A;  4Y2X A;  3HK0 A;  2PW9 A;  3JVZ X;  5BMG A;  3E9S A;  4KDI C;  5DDY A;  4PGY A;  2OCE A;  3H0R B;  3SYZ A;  2MHJ A;  1S0M A;  3WK7 A;  1M94 A;  5AK4 A;  2W9C A;  4CHK A;  2KXJ A;  4EX6 A;  4F50 A;  1R4M B;  1KJT A;  4C8O A;  3CWI A;  3PLU A;  3RR8 A;  1F2R I;  3PSI A;  2KN4 A;  4HVB A;  2GO7 A;  3ZDM C;  1NI2 A;  1JCK B;  3HM6 X;  1H8C A;  4F91 B;  4PPX A;  2KN7 A;  4RQ2 A;  2AU0 A;  3L16 A;  1AQ6 A;  1OXJ A;  2B21 A;  3W1Y A;  2XK5 A;  1FIQ A;  3ZDD A;  5J2J A;  3ZTC A;  1JWS D;  2QEJ C;  3MJW A;  4ICU A;  1E5W A;  4GDK B;  4WAF A;  2FCM A;  3JPT A;  3AE7 B;  4YD2 A;  1T0Y A;  2IBI B;  4P0P B;  3DV9 A;  5IIK A;  1S0O A;  1A77 A;  4M0W B;  1XS9 D;  3SEB A;  3N1X C;  3RFZ B;  3CMM B;  5K4L A;  1GO3 F;  1Z1V A;  3MFG A;  3CYM A;  5KFS A;  4O3S A;  3LJ3 A;  2AQ0 A;  3AEG B;  2KKP A;  2ZIW B;  3NGD A;  2OHF A;  1CEZ A;  3KWL A;  4Q45 A;  9ICE A;  3N20 C;  4PGQ A;  4YR2 A;  1V80 A;  2XNA C;  1JXL A;  4J9L A;  2MSN A;  3JPP A;  3RJE A;  4B0M A;  4BZA A;  1WGK A;  5AUK A;  2OYY A;  4AP4 C;  5GXG B;  2IYD B;  1BPD A;  1I35 A;  5ALD A;  3BYT B;  5DB9 A;  1ZRM A;  2WYQ A;  3JSV B;  4BWJ A;  5B5E U;  4M04 A;  2NRX A;  7ICO A;  4LZG A;  1L0X B;  2C7N B;  1YD8 U;  4ELU A;  4IC9 A;  3GV5 B;  1IG6 A;  3RN9 C;  3EEC A;  3V7J A;  3UMC A;  4EZ9 A;  4MHV A;  5CB1 A;  3PS6 A;  4LNN A;  4DOB A;  1ZD2 P;  2WXM A;  3AMZ A;  3KYD D;  3BS7 A;  3RFA A;  3AE9 B;  3C23 A;  3TAD A;  2PFP A;  4RMA A;  2K0P A;  2EKI A;  4F5P A;  1C76 A;  1T0S C;  4FZL A;  3GE3 C;  1UA1 A;  1CRX A;  5E6N A;  2MP2 B;  2XID A;  3VUY A;  2LUE A;  3SD7 A;  4UAV A;  5HR6 A;  1YN4 A;  1ARO P;  2UVR A;  4GGQ A;  3OHA A;  3ZDE A;  4AQ7 A;  5J2E A;  1QTM A;  4USA A;  2KP7 A;  1T94 A;  2JV3 A;  5J0S A;  3ZDB A;  3AQE A;  4NLZ A;  2JGA A;  3OSN A;  4BJQ A;  4M9L A;  2HSZ A;  4Y2P A;  4IR9 A;  1OQR A;  3LVW A;  2KK8 A;  2ON8 A;  3ALB A;  3SDL C;  3W1S C;  3BWU D;  1R4M I;  3QA8 A;  4ZDV A;  4QZ9 A;  8ICL A;  2ZUB A;  3CSF A;  3A0H U;  3CW2 C;  4I2J A;  5AKX A;  3A9J A;  1KH0 A;  3RJI A;  5BO4 B;  3CRX A;  1WCL A;  2W11 A;  2I6X A;  1Z00 B;  1N48 A;  3IM1 A;  3T5J A;  1VLB A;  4C7Z A;  1WJN A;  2H3Q A;  1MVK A;  3AQF A;  3PNC A;  2AJQ A;  3TBL D;  4ACF A;  3AL0 B;  2EAN A;  2HTH A;  4YN4 A;  3Q3M C;  4K1R B;  3V62 A;  2KSO B;  3MGH A;  9ICV A;  3HVZ A;  2ZIV B;  5KFZ A;  2BPF A;  3WKC A;  1E6E B;  3OG5 A;  1TTN A;  1C20 A;  2WNM A;  2JZZ A;  3AEA B;  1J2M A;  3BQ2 A;  2CKH B;  4MFC A;  2FCQ A;  1DOY A;  4GC7 A;  2CS4 A; 
#chains in the Genus database with same CATH homology
 2MJ3 A;  1YJI A;  3IT4 B;  4RFB A;  1N5X A;  2Y5P A;  1F2R C;  1YNT E;  2E6X A;  3AN1 A;  2LEK A;  5HFY A;  1F0Z A;  3ZQ4 A;  4OVZ A;  1C4P A;  1QOB A;  2QSD A;  1RM6 C;  1FRR A;  1Q10 A;  1XCQ L;  1RWS A;  1ZXI A;  2KWD A;  3N9Y C;  2G9H D;  4OZB A;  4OW0 A;  1FD6 A;  1GB4 A;  1T3Q A;  1JWA D;  3C8Y A;  1N5W A;  1QOG A;  4US9 A;  2N7J A;  2B76 B;  4GLS C;  1QF6 A;  5EE1 A;  1PYW D;  1C77 A;  1K53 A;  4RF1 A;  2GRI A;  1TJE A;  4RF0 A;  1XO3 A;  4HKZ E;  2HDE A;  4WIP A;  2PVG C;  3GP7 A;  4YTP B;  1FNV A;  3AE6 B;  1SE2 A;  1HQR D;  2LUM A;  2RPV A;  2V3N A;  1ROE A;  1JWB D;  2BS3 B;  3BZD B;  1TS5 A;  1UNS A;  1YN3 A;  2CJO A;  4WQM A;  3RPF C;  5TSS A;  1TS2 A;  1L0Y B;  2AQ3 B;  2NTS A;  1N60 A;  1GPX A;  3TEZ A;  4MT5 A;  1JML A;  2DYM A;  2KDM A;  2WS3 B;  1I7H A;  1PGA A;  2BBC A;  3HUI A;  5H92 C;  3V3X A;  3AEE B;  2W82 A;  4REZ A;  1JAL A;  1SE4 A;  4YTM B;  5FR3 A;  1FCL A;  5HHD G;  2R61 A;  1FCC C;  4ZHO A;  4DXG A;  4RGT A;  2JU6 X;  2WXF A;  5FKA C;  1L6U A;  4NAW B;  1SBB B;  2FE8 A;  1NEK B;  1NI3 A;  1FM0 D;  3BVG A;  1PFD A;  1QOA A;  1L4Z B;  1KRH A;  2WDQ B;  1VJK A;  2WDV B;  4ZHP A;  2AX5 A;  2JYE A;  4IOI E;  1XLP A;  1JW9 D;  1N61 A;  4JE3 B;  1I4R A;  1XLN A;  4XE0 A;  1I4Q A;  2LJI A;  1FXI A;  3ABV B;  4L1B A;  1L6V A;  2LHE A;  3ETR A;  3PZ7 A;  2DWQ A;  3P42 A;  4ZOH C;  2CU3 A;  2ICI A;  4AS1 A;  5D3D A;  3MC0 B;  2LFI A;  4A55 A;  2L1A A;  1WSP A;  3VR8 B;  5BYR A;  1ET9 A;  4JWS C;  3AM9 A;  1FFU A;  2H89 B;  2QIE B;  5BMI A;  2WU2 B;  4R3D A;  1YN5 A;  1UWX A;  1YJJ A;  3Q8C A;  5D3I B;  5I4D A;  3R2I A;  2N9L A;  4KX6 B;  4NJC A;  3IAM 1;  2QIL A;  1EU3 A;  1XXG A;  5E6J A;  2RDG A;  1DOI A;  5EE9 A;  3NZ3 A;  2QMT A;  2WU5 B;  1ENF A;  2FBW B;  3MJ5 A;  3PO0 A;  3VQI A;  3TEW A;  2JYT A;  2ZW1 A;  4J3O D;  3AE3 B;  2N9K A;  3BK2 A;  4YSZ B;  1MHX A;  3I57 A;  1R7S A;  2M0A A;  4N6E B;  1QOF A;  2NMQ A;  2MJE A;  2WXJ A;  3MHZ A;  3ZJT A;  2BT6 A;  3UI3 A;  1KLG D;  1DYQ A;  1C9F A;  2MEK A;  1EM7 A;  3LB8 C;  5JXV A;  4IDI A;  1QKZ A;  2JX5 A;  4RGM A;  1FO4 A;  2RDH A;  3NVV A;  1FNU A;  2I2Y A;  2V4I B;  4DXF A;  1TS3 A;  4RGO S;  3TEY A;  5G5H A;  3AE1 B;  4ARC A;  1FXA A;  3BYY B;  4H2A A;  1ZUD 2;  2PTL A;  4US8 A;  5BMH A;  3GS2 A;  1UWM A;  4TQ0 A;  2KQ4 X;  2G1E A;  4A9A A;  1WYG A;  1J7B A;  4OZA A;  1VRA B;  4ARI A;  2SAK A;  1PGX A;  1VR9 A;  5EE3 A;  1JQ4 A;  1J7A A;  1IGD A;  3IT6 B;  4JX1 C;  4LLG M;  3V05 A;  4HJG E;  2FUG 1;  2DBY A;  4Q2J A;  4YTN B;  2WXO A;  4OZC A;  1JWM D;  1HZ6 A;  3EUB 2;  1P7E A;  1EWY C;  4N59 A;  3W5V B;  3NVW A;  2L32 A;  1WWT A;  2EEL A;  2IGH A;  2WXQ A;  3NVY A;  3AEF B;  1VZ6 A;  3NS1 A;  1SE3 A;  1XLQ A;  1SXT A;  1D4B A;  5C3J B;  1OQQ A;  3BK1 A;  1ACC A;  1I4P A;  1D5Z C;  4WUR A;  3B2F A;  3VR9 B;  3O13 A;  1WXQ A;  2IPK D;  2V3P A;  5T8I A;  4MM3 B;  1GOZ A;  2CJN A;  5AUI A;  2VZK B;  2IDY A;  1CQV A;  2BB6 A;  2GB1 A;  1MPE A;  4ITK A;  3LYY A;  3U2S C;  3J9C A;  3BII D;  4JWU C;  1AN8 A;  1VZ7 A;  1ZPS A;  1ZXH A;  3PZ8 A;  3AED B;  2INN E;  2JSV X;  3EGR A;  1TS4 A;  4IKG A;  3P4R B;  3VRA B;  3HVD A;  2WLB A;  1C4A A;  2WXR A;  1I4X A;  3BVM A;  3LXF A;  1TKG A;  3SFE B;  2J53 A;  1ESF A;  1FNW A;  2LMC A;  2N0S B;  3AV8 A;  1XEE A;  1SF0 A;  3Q8E A;  2JZP A;  3IXS A;  3H8H A;  3W5U B;  1L5P A;  1OFF A;  1J7C A;  3AE4 B;  3U52 E;  4MAC A;  4MH8 A;  3ZJU A;  3IAS 1;  2V0G A;  1NYR A;  1YMH E;  3AH7 A;  1KLU D;  4WWM A;  1TKE A;  2AQ2 B;  2IGG A;  1K51 A;  2LHD A;  2INP E;  2BB5 A;  1HXY D;  3P4Q B;  4RCO A;  1MI0 A;  3AEB B;  2BS4 B;  5D7G A;  3W1S A;  2W3S A;  2W55 A;  2H88 B;  2WXN A;  1CJE A;  1K50 A;  1SJH D;  2DYO A;  1SIJ A;  2IGD A;  1SB3 C;  4YXD B;  1SJE D;  2QJL A;  1GB1 A;  3AB5 A;  4A90 A;  2PVO D;  4OHJ A;  2JQR B;  3U7Z A;  2KMM A;  3T3O A;  1UGJ A;  2XN9 C;  1C78 A;  1HEZ E;  3R2T A;  1NVI D;  2W3R A;  1IGC A;  3CIR B;  3I9V 1;  4HRO A;  3Q69 A;  4TQ1 A;  1BML C;  4EE2 A;  2MH7 A;  1V1P B;  1VZ8 A;  3ZYY X;  1PDX A;  1EWC A;  1V1O A;  2WQY B;  2HTM E;  3WCQ A;  1QIL A;  1E10 A;  2RMM A;  4KKI A;  1F77 A;  1EU4 A;  3KLS X;  3U4E G;  1JRO A;  3W9C B;  2LGI A;  4UDU C;  4XDC A;  2D5G A;  1FFV A;  4HEA 1;  4KGS A;  2WDR B;  4TMA B;  2AQ1 B;  5BYS A;  3BVZ A;  1KTK A;  1KF6 B;  1XF5 L;  4LK0 M;  4YSY B;  3EA6 A;  4GDL B;  3ZGZ A;  4HRS A;  2DLB A;  1P7F A;  1BUI C;  1M4V A;  1TZO A;  3NUH B;  4N58 A;  5EE0 A;  1N62 A;  1D5M C;  2WXG A;  1NEN B;  3W2D A;  1L0V B;  1STE A;  3KQ4 A;  1NYQ A;  1V97 A;  1TY2 A;  2W54 A;  3DWG C;  1I4H A;  1DOX A;  3Q8B A;  1C4C A;  2YEP F;  2WP9 B;  2WXL A;  2KAC A;  5BYQ A;  4RGN A;  2JWU A;  2L52 A;  1V8C A;  2Z8L A;  4YT0 B;  4ZRQ A;  1BXT A;  1UUP A;  4ZRP A;  4O1N A;  1Y56 A;  1QLB B;  4C56 C;  2BYT A;  4YWG G;  2WXK A;  5BMG A;  1DGJ A;  1PGB A;  2PW9 A;  1WRI A;  3E9S A;  1A70 A;  3NVZ A;  3TUO A;  3AE2 B;  3KWV A;  1D5X C;  3Q8A A;  4WH4 A;  1IBX B;  3CWI A;  1XCT L;  2PKO A;  1F2R I;  2KN4 A;  3AEC B;  3B2G A;  5LNK 1;  1FRD A;  1ZP0 B;  1JCK B;  2KAJ A;  4YSX B;  1E0Z A;  1L4D B;  2E3T A;  1AWD A;  1FIQ A;  3FC4 A;  3NRZ A;  2BW2 A;  3GB1 A;  4L2Y A;  1JWS D;  2QEJ C;  4GDK B;  4LTU A;  4WAF A;  2WXP A;  1IUE A;  3AE7 B;  3MP9 A;  5HG2 A;  3DWM A;  3URY A;  2Y5C A;  3SEB A;  3RFZ B;  2PLP A;  3HRD D;  1SEB D;  2TSS A;  3MFG A;  4P6V F;  1T6B X;  5MPO A;  2M19 A;  2M56 B;  3AEG B;  1HA5 A;  2OHF A;  3E56 A;  3KWL A;  4P16 A;  4HKQ A;  1ET6 A;  3L4P A;  3ZJV A;  2Q5W D;  3FAH A;  2PIA A;  2XNA C;  3P1M A;  4A6Q A;  4B0M A;  5FK9 C;  1WGK A;  1C79 A;  4NZL B;  5AUK A;  4DQO C;  2SEB D;  5GXG B;  1K52 A;  3BYT B;  3FIL B;  1TYG B;  1CZP A;  2K3U A;  4PT5 A;  3TEX A;  5HI1 A;  1L0X B;  1KFY B;  4JPS A;  1SSN A;  4KGR A;  1AYF A;  4RH6 A;  1V1P A;  2VZK D;  2MJD A;  2ACZ B;  1GAQ B;  1XLO A;  4B0E A;  3TSS A;  4XDD A;  2PMV A;  2WXM A;  1ZOY B;  4M0W A;  3R8B A;  3AMZ A;  3AE9 B;  2I38 A;  1TKY A;  2L83 A;  2K0P A;  2EKI A;  3SFD B;  1C76 A;  4FXC A;  4CQN A;  1JWU D;  1B9R A;  4C7Y A;  3VRB B;  1HZ5 A;  4C80 A;  1E7P B;  2J52 A;  4TSS A;  1QQR A;  1PUT A;  1E9M A;  1YN4 A;  2YEP B;  5G5G A;  5C2T B;  4AQ7 A;  4USA A;  4KGT A;  4D2K A;  1N63 A;  5H8Y E;  1LO5 D;  1ZDX A;  2GI9 A;  1D6E C;  1OQR A;  3FIL A;  3OWE B;  2ON8 A;  2OED A;  1VDV A;  3BWU D;  1JRP A;  3Q8F A;  2NTT A;  2JXT A;  2K9X A;  2X38 A;  2Y3A A;  1ZE3 D;  1RYJ A;  1YQ4 B;  1KH0 A;  4A8X C;  2BTE A;  4NAM A;  3SR6 A;  2IJ0 A;  1ZDV A;  4KKJ A;  4L23 A;  3T3N A;  1VLB A;  4C7Z A;  3P63 A;  1RFK A;  1MVK A;  1QT9 A;  3P4P B;  4XWT A;  2J4X A;  1FMA D;  2WXH A;  3AE8 B;  4ZYS A;  1FEH A;  1T5X D;  2K22 A;  2WXI A;  1TY0 A;  3HVZ A;  2K5P A;  2ZW0 A;  1E6E B;  2J42 A;  1YQ3 B;  2WNM A;  1I4G A;  1B1Z A;  2BS2 B;  3AEA B;  1AW7 A;  3AE5 B;  4XWW A;  1CK1 A;  3B9J A;  2ONQ A;  1MHH E;  1DOY A;  1IBX A;  3P4S B;  4RNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...