3B9JA

Structure of xanthine oxidase with 2-hydroxy-6-methylpurine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
ADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords xanthine oxidase
publication title Substrate orientation in xanthine oxidase: crystal structure of enzyme in reaction with 2-hydroxy-6-methylpurine.
pubmed doi rcsb
total genus 40
structure length 162
sequence length 162
chains with identical sequence I
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2007-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3b9jA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b9jA01
4ZHOA 1UWMA 4KX6B 2H89B 2MJDA 1V8CA 4LTUA 1NENB 3FC4A 4US9A 2L83A 3PO0A 3L4PA 3NVVA 4P6VF 5AUKA 3VRAB 1N63A 1CZPA 1E6EB 3AE9B 2W3SA 3BIID 3DWMA 4USAA 5EE3A 4ZOHC 3ABVB 3AEGB 1VLBA 2AX5A 1OQQA 3AE5B 3NS1A 2WP9B 1QLBB 4N6EB 3W5UB 2EKIA 3AEFB 3NVZA 4HROA 1JALA 2FBWB 3VR8B 2BS3B 3HUIA 1FXAA 1GAQB 3SFEB 1KRHA 2JX5A 1T3QA 2ACZB 1F0ZA 4C7YA 4YTMB 1YJIA 3AE7B 2CU3A 2LEKA 3NVYA 1NYRA 1ZUD2 5G5HA 1E9MA 5C3JB 1I7HA 3CWIA 2CJOA 5EE9A 1XLPA 1XO3A 3P4RB 1YQ4B 4WQMA 2W54A 4US8A 3AMZA 3P4SB 5G5GA 3B9JA 1N61A 1XLQA 3AE8B 4FXCA 5H92C 1RWSA 1L5PA 4ZHPA 3KWLA 3ETRA 2BS4B 3NRZA 1R7SA 1JWAD 2L52A 3AE1B 1N5XA 1SIJA 1N5WA 2PVOD 2WDQB 4A9AA 1TKEA 1XLNA 3LB8C 2E3TA 5EE1A 3AM9A 1PUTA 3LXFA 5AUIA 4YSXB 1J7CA 1SF0A 1WYGA 1VJKA 3CIRB 1TKGA 1OFFA 1N60A 1ZP0B 1PDXA 3AEAB 3B2GA 1QF6A 1A70A 1VDVA 2WDRB 2WU2B 2WDVB 4ITKA 4JWSC 3AE2B 1YQ3B 3HRDD 1E7PB 1CJEA 1WWTA 2WU5B 3P4QB 1DOIA 1NYQA 3AEEB 1QT9A 1JQ4A 2KMMA 1FIQA 3EUB2 1OQRA 2B76B 3P1MA 2M56B 4YXDB 2H88B 2OHFA 1KFYB 3AB5A 4YT0B 1NI3A 1NVID 2K5PA 4HRSA 4N58A 1J7BA 1WRIA 1J7AA 4C7ZA 1JRPA 1AYFA 4YSYB 5C2TB 1ZXIA 1PFDA 2Q5WD 1TJEA 1QOBA 3AN1A 1V97A 1FRDA 4YTNB 2N0SB 1FRRA 3RPFC 3W5VB 1E10A 2PKOA 2W55A 2W3RA 2WQYB 2K9XA 4C80A 2KAJA 1DOXA 1JWBD 1NEKB 2HTME 1QOAA 3HVZA 3FAHA 2MJEA 3SR6A 1FMAD 3P4PB 2BT6A 2DBYA 1QOFA 3AE6B 3AV8A 2PIAA 1E0ZA 2MH7A 1SB3C 2QJLA 1FO4A 2G1EA 1TYGB 2DWQA 3AH7A 2WS3B 1RFKA 4WWMA 1AWDA 3ZYYX 1ROEA 3NVWA 1JROA 1FXIA 1DGJA 3VR9B 3AECB 1DOYA 1WXQA 4YTPB 4JX1C 2PVGC 4IDIA 5GXGB 1FM0D 2BS2B 2WLBA 1B9RA 3AEDB 3VRBB 5EE0A 3W9CB 2M19A 1FFVA 1RM6C 2QIEB 3SFDB 1IUEA 4YSZB 2CJNA 3AE4B 3AEBB 1L6VA 1L0VB 1FFUA 1KF6B 1N62A 2Y5CA 2K22A 3P63A 5MPOA 3AE3B 1L6UA 5H8YE 2JQRB 3WCQA 1QOGA 1JW9D 4N59A 1WGKA 3B2FA 1GPXA 1EWYC 4JWUC 1ZOYB 2MJ3A 1XLOA 1TKYA 3DWGC 1RYJA 1YJJA
chains in the Genus database with same CATH superfamily
4NNJB 5KTQA 2B0CA 1UUPA 1WR6E 4L1BA 4QZGA 2JEIA 3H4DA 2UVVA 5EE3A 1E6EB 1F1HA 2CXYA 2C7HA 3V61A 5J0WA 2FPKA 3L17A 2YVCA 2WP9B 3TBLD 3M9MB 1K50A 3DHGC 3W2DA 2LBOA 2KD1A 2JX5A 1WWVA 5KT2A 8ICNA 3L0WB 3OLMD 4A20A 4YTMB 4NJ7A 4EFOA 4DOCA 1ZUD2 2FUG1 2LRWA 2C7MB 1T94A 2VIXA 4J03A 2WTFA 3QC8B 2MSNA 1EO6A 2KV2A 3NG0A 4WQMA 3CYMA 7ICLA 4FJYA 4US8A 5BYQA 5IAAC 4M04A 1RDFA 2PFPA 1L7MA 3N7SC 4K7UA 4RNNA 2LXCA 3GIIA 4HPPA 3VH3B 4F92B 4WJPA 4M9GA 1JWAD 1SE2A 4PS3A 3L13A 4F5PA 3Q8PB 1BUIC 5L1LA 4M9NA 3C21A 5J29A 1J7CA 1J19A 1YT3A 2JT4B 1TT5B 2RPVA 3SU8X 2WDRB 3C1YA 1SL1A 1CJEA 1WWTA 4ZRPA 3R7RA 2KMMA 1KFDA 3EUB2 4O3MA 2N9PC 4BXOA 1XD3B 5IO9A 1ZQFA 4KGSA 2C22A 3A1QB 2RHFA 4BZAA 5KG0A 5DBCA 1QOBA 1U4BA 2D3BA 2KO3A 2GRIA 2W3RA 9ICGA 2LFIA 1VZ6A 4ZRJA 4BOZB 1XNSA 2WAQF 3PMNA 2NCNA 2V4IB 4ANXA 5DBBA 4RQMA 5JRTA 4I2EA 4KN7A 2WF6A 2PIAA 1C77A 4ELUA 4P0PB 3M9OB 1FO4A 2KMDA 1MJDA 4UASA 2FMSA 3AQFA 1HA5A 1RFKA 4ED8A 3PVXA 4F4KA 4MELA 5IILA 2ZJ8A 5EWEA 3EPIA 1PGAA 1WX9A 2KN7A 4J9RA 1SJHD 4A8XC 3E2EA 3ALBA 2KC2A 3CMMB 5K4LA 3VC8A 4WJ3B 3ONNA 1QQ7A 4O3RA 4O0IA 2LVQA 1WJ4A 2BPGA 4PZOA 3W9CB 1YQBA 5BYSA 1WRDB 2AXTU 3PSIA 1CQVA 2W8LA 2LM1A 2YMQA 2A5UA 1Z4OA 2KFNA 5C1ZA 2IO0B 2EAPA 1SXEA 4QZFA 4YG2A 3RR7A 1CMXB 4PYZA 3Q3FA 3RFZB 7ICRA 4AJWA 4Q43A 2F2AB 4RQ6A 3BY4B 2W9AA 2LVOA 4ED1A 1X42A 2JQRB 1Z5SB 1S10A 1XU4A 4JB3A 4DF8A 5DB6A 5J0XA 4NLCA 3B0YA 2KDEB 1C9FA 2IYDB 4W9CA 2L8JA 3PLVA 2HMXA 2K4HA 5IA7A 3QXGA 4I2HA 3L4PA 1OW5A 2O2VB 1U45A 1YJ1A 2A19A 3RB0A 4YMNA 9ICHA 2HBMA 4Y2YA 1HQRD 2XICA 1WF9A 3H8WA 4LZDA 2BVCA 4B95A 2KT7A 4DDID 5KFFA 3Q3OC 5KT4A 2KLCA 3SEIA 4KLHA 4NWIA 3V7LA 4REZA 1YJIA 2EKEC 2LEKA 4DL7A 2EANA 1HUZA 1X9MA 2NBUA 1ZRNA 2C2EA 1SKWA 1RLFA 2D2QA 5AIAA 4LDTB 1L5PA 3RNCC 1FPYA 2KMCA 1L8OA 2G4DB 1N5XA 4IM2A 4NQLB 2Y0SF 4IQUA 4O5CA 4DFPA 5JH5C 3QAQA 4I27A 1TAUA 5KG4A 1LGRA 1NK9A 4KLFA 4K3BA 1TY0A 5HHDG 3EFCA 5KFUA 1L7YA 2L76A 3WK7A 8ICMA 4R66A 2KDIA 2XY5A 2JZBB 3BQ2A 4RT2A 4UW9A 2BZFA 2K5PA 2KTQA 2DKXA 3HJEA 2K25A 3RNGC 2KIVA 1PUZA 2KDBA 1ZQZA 2RP5A 3N28A 5ALGA 4NJ6A 3F5EA 4NLBA 2PKOA 4W9GA 3U26A 5KT5A 2N9XA 3NZSA 1EF1A 1TS3A 5H2FU 4TURA 2R61A 5AZHA 1KW4A 3C2KA 1PYWD 1LXDA 3QUCA 2FNJB 4XGAB 3U52E 2KHWB 4LJOB 1TYGB 5IIMA 1MVKA 4F5RA 1JUDA 5AK6A 2NR2A 2IY0B 1KEJA 1UZXB 5F9NA 1MC8A 2VA3A 2BCUA 1F9JA 1D8YA 7ICTA 2KNJA 3V6HA 2QILA 3VAWA 3KWVA 1X9XA 3PX4A 1E7UA 3KVFB 4YN4A 3C5FA 3A1QA 4GGQA 4I2DA 2B21A 1WCNA 4OJ6A 1FEHA 3N9YC 3RMKC 2HCFA 1RG6A 3MR2A 2FPMA 1XC9A 1LKYB 3RT3B 3WKBA 3RULA 2Z7JA 4NL9C 1C4PA 4KKJA 2LYHA 3JVZX 4C8LA 4MH8A 1F2RI 3V72A 1V85A 4XQ8A 1EWCA 1KDHA 5CP2A 4B0MA 1K1SA 2JHDA 2K8BB 2LJ5A 4DBGA 1T0SC 2ZJDA 4FO6A 3H7PB 4P0PA 2KD0A 2XO7A 8ICEA 1XO1A 9ICQA 1KLNA 3I1YA 2DYBA 1NZPA 1ZDVA 2KKVA 1NK7A 1X9WA 4ELVA 1ZKHA 1EU4A 1BNOA 3PO0A 5IN7A 3K9PB 4OJ5A 3T5LA 1Y8RC 2BCSA 1XF5L 4UDUC 4W9EA 1TAQA 4RF0A 4UARA 4OVUA 9ICVA 3N7PD 4YR0A 1EU3A 2Y9UA 4EYHB 4JIOU 1I4PA 2GMIC 1ZQAA 2JPHA 1SGHA 4J9SA 4FHKA 4MGIE 4ACFA 1DK2A 1IBXB 3NUHB 4MGKE 7ICPA 3R8BA 3GS2A 2JXJA 1DOQA 2GLSA 2RDHA 4ECRA 1QILA 3GP7A 4F5OA 2MWSB 1E8XA 4DOBA 2C28A 2NRTA 4JK1A 3GQCA 3QUBA 1C4CA 3AE1B 3R2IA 4F5QA 2WDQB 5AUIA 3RJJA 2CU1A 4GC6A 4JL9A 2O2VA 3U30A 1E8ZA 4C8OA 5C5JA 4GIVA 1CK1A 3K4GA 3PRMB 4JWSC 1AQ6A 3DBLI 2M9NA 4RQ4A 3EZ5A 2N1WA 5AKJA 2WX0A 4DS5A 3IBEA 2X38A 4DFDA 5CTRC 2NRZA 2K89A 4GDLB 5DQIA 2L00B 2CHZA 3ZIMA 1QCKA 1ZXIA 4LDTD 2WWZA 4BAXA 1ZOLA 1V97A 1Q5WB 2HOQA 2E8PA 2KN4A 2DLBA 2KFZA 1CUKA 2BQ3A 4J6IA 3V7KA 4JQWC 4RGMA 1D9DA 1WI0A 4OW0A 5KFAA 4RQ2A 3PREA 1H38A 4PS8A 1NJZA 5C23A 2O6KA 1OQYA 4UB1A 3WKAA 1F52A 2WXOA 2RMMA 4I2BA 2MBQA 4MACA 4URKA 1QZEA 3OGUA 3V7JA 2KMAA 5BMGA 4P0QB 2HSZA 1ZQTA 2V0GA 2KX0A 3FKYA 3VH4B 1DOYA 7ICOA 4KX3A 2C9WB 2PVGC 2G5HB 5ALJA 9ICXA 3JPOA 4JWMA 3F2BA 1E8YA 3MJ5A 4YVZA 5IIIA 5DKWA 3PNCA 4OZBA 4DL3A 1ENFA 1RM6C 2L0FA 3OHBA 2IA6A 8ICUA 2LM4A 3HT3A 2G0AA 5ALXA 4ED7A 3RJHA 3EGRA 4XC2A 2ZUCA 1JWSD 1TV9A 3JYUA 4PT5A 4DFJA 3IVFA 4F8RA 1MQ2A 4R64A 1KRPA 1PK1B 3OJ4B 4N59A 1NJWA 4P4PA 4DF4A 4YQWA 4NY8A 5KL1B 1UNSA 4TKNA 3C28A 3DVGX 1YJJA 4KX6B 3KUDB 4D2KA 3V05A 4ICVA 5AUKA 3PO5A 2Z59B 3V3XA 1I4RA 4RQ5A 2Q4TA 4CF5A 1D5ZC 1I4GA 1LKYA 5AI0A 3RD2A 4EEYA 2FPLA 4A8EA 1H4RA 3ZJVA 4XX5A 2LYAA 2XIDA 2ZJ5A 2WXKA 5KFQA 4GMVA 2IBKA 1ZQKA 2KG5A 1D3ZA 8ICAA 9ICRA 8ICKA 1JI7A 1R4NI 4O3NA 3Q69A 3WALA 4HJGE 2PI5A 3H7PA 3NJTA 1XLQA 3AE8B 1MSWD 4ZDVA 2FMQA 1SIFA 2GBMA 3SAFA 2BCQA 1FNVA 1Q1OA 3M3JA 1WG8A 1IXRA 3A33B 1OTRB 4TV3A 2DHZA 1X6IA 1F77A 3SV3A 1L3SA 3AEAB 4CYEA 3SYZA 2YMLA 3RYTA 3AE2B 2I1JA 5DPSA 1U47A 3Q3JA 3P4QB 3K1RB 3BDPA 4NL9A 2HHSA 3TSSA 2J6SA 1M94A 1OQRA 4HK2A 4AYBC 3H0LB 1V80A 2LGYA 1TZOA 1RQNA 4ZRIA 1I35A 3OHAA 1BPEA 3TJPA 1IBXA 1K52A 2L7RA 9ICUA 1JMLA 2KDMA 1XWLA 1WGGA 5J0OA 1NKEA 2PEAA 1UA1A 4YP3A 2WQYB 5KAIU 2ZVNA 4HXDA 4AYBF 2VZKB 2AWTA 1QQ6A 3M63B 5DCNA 2GBRA 3N32A 3SAHA 5J2IA 3N30A 3NUQA 3HWTA 1VCBA 3RRHA 4XYCA 1ED1A 1L7PA 4MEYA 5DG8A 1ACCA 2GI9A 4TUPA 3DBHI 2KSOB 3MHZA 5CWRA 2Y9TA 3ZTDA 2AQ4A 4JV2A 1JWMD 4MGZE 5JUMA 2AEHA 3VTUA 3AUOA 3AU2A 4ZRKA 1COKA 2A1JB 5E6PA 1WXQA 5AM2A 2BQRA 4GDLA 3NZUA 1MFWA 2OEHA 4I2FA 2NMQA 4MSMB 4KVGB 2MSED 4YR2A 3G6VA 4FBJB 4WWOA 4KN4A 1S97A 5HHHA 2ALZA 4PHAA 3NTUA 4EZKA 3HK0A 2CJNA 3RF9A 5EWGA 1RXVA 1Q8KA 2KP7A 1ZQQA 4MT5A 3KBBA 2NBWB 1ESFA 1GC6A 2KJ6A 3L10B 2LXAA 4YWGG 5AM1A 5H8YE 3ZRFA 4PL1A 4UAWA 2JH7A 4PGYA 5BOMA 2E1EA 5KFSA 1WGKA 1WX7A 2DZMA 2HHTA 3VUXA 5ALSA 4JUZA 2PE9A 4AWJA 4P0QA 4W9JA 4LJXA 9ICIA 4ZHOA 1C1YB 1UWMA 3I63C 1WWUA 4H2AA 1WE7A 5AK4A 2B6GA 5CHWA 2L83A 4MF2A 3ZDAA 1P7EA 3PS6A 4MFCA 5AM0A 3P2BA 1KLUD 1WGYA 2GWSA 2AX5A 2L1AA 2RDBC 1S8OA 3AE5B 3W5UB 1F2RC 4N6EB 2H5XA 1YD8U 5IIJA 2BS3B 4DSKA 2KJ9A 2JYTA 3PW5A 2NYVA 4EENA 1FEZA 3UXPA 3PW7A 3ZGZA 4C7YA 4QWDA 1NK5A 2KQ7A 3RNEC 4Q45A 5J0QA 2MA1A 3VXWA 2PFQA 1AARA 2KFJA 2WF9A 1YZ6A 3D2QA 1PK1A 3P4RB 1L6NA 4IQVA 4PHEA 2YTUA 1NKCA 3LJ3A 3BQTA 3U4EG 2FI1A 5ALKA 4TSSA 4GLXA 4UAUA 5DQGA 2Z8LA 2F44A 4J9QA 1ZQNA 4W9FA 4TQ0A 5HNKA 3M8SA 5ALOA 2W9NA 4KIKB 2MP2B 2RSUA 4DEZA 2DAFA 4QAYA 1X1MA 3IHPC 1WYGA 4IKGA 3RFAA 5KG7A 1HJPA 2M0NA 1VDVA 2MEKA 3A9JB 2OWOA 1H8CA 3R3MA 3TFRA 4TQRA 2GO7A 1FIQA 1S77D 2M56B 4YXDB 2H88B 2PMVA 3I76A 2W04A 4LCDE 1NOMA 4HJKA 4XDDA 2PE6B 5C2TB 1HE8A 5IOIA 1PFDA 2G45B 1KJTA 2FE8A 1UF0A 3H0RB 4GFJA 2YX8A 4AJYB 2MAXA 1WJNA 3T5KA 1QQRA 4GXJA 1WM2A 2BYTA 2BT6A 2GBNA 4WQOB 4GOCA 3GV7B 2MRPA 2MH7A 1PK3A 8ICBA 2AL6A 2V3SA 3QYPA 4ECQA 2QJLA 3PSTA 1QTMA 1XQQA 2I9GA 1VJ5A 3KYCD 2XCPA 4HDOA 3MC0B 1MPEA 3Q8QB 4IOIE 4QWCA 9ICWA 3CW2C 1MG4A 3Q8KA 2F77X 3MABA 2WX1A 4IW0A 4K81A 5E6OA 4W9IA 2WXMA 2WHEA 5KFMA 3EA6A 4RH6A 2VZKD 5KFIA 5ALRA 4WURA 4DCCA 3IT4B 2GB1A 8ICIA 3DBLB 2IMWP 3PO4A 1KF6B 1TGZB 2V9HA 4WWPA 4LNKA 5MPOA 2KHVA 5IIKA 4L23A 4XDCA 4I6PA 1KFTA 1JW9D 2OH2A 5KT7A 1BT0A 4ECWA 3B2FA 2KSOA 4PL2A 1ZOYB 2MJ3A 3DWMA 3PGEA 1MHXA 2C2DA 2WXQA 2EZYA 5FKAC 3UQBA 2A1JA 1FXTB 4M0AA 1ZQUA 3VRAB 3MR3A 3OTQA 1E0ZA 2RPQA 2K8CB 5AKKA 3B0AA 3QEBZ 4UB4A 4F7ZA 2EMSA 3AEFB 4BDPA 2PMZF 5KG1A 2JGAA 4CF3A 3FYHA 3HUIA 1GAQB 2H3QA 2ACZB 3MR5A 4PS7A 4KMUA 4I2AA 3VUWA 2CU3A 5BOLA 1PGBA 2MQJA 1HEKA 5EOZA 1RRBA 2WB1F 4FXCA 1UHUA 5J0RA 2NRWA 1K5OA 2I5HA 2HOIA 1WFYA 4F5NA 2GOWA 3RJIA 2KZZA 7ICUA 5CJ7A 3APCA 3M8RA 1SIJA 2PVOD 2IGHA 4WAFA 5EE1A 4C0ZA 2VRRB 1GC7A 4QZIA 4BUGA 3TMPB 2J42A 3IV6A 2WU2B 4ZYNA 3EFUA 1KQQA 3VUYA 3L08A 3HRDD 3H7IA 3NS8A 4G50A 4NLKA 3AEEB 4RNOA 3N4MB 3P1MA 3H8HA 5DQHA 3BZDB 3M62B 1NI3A 2GH1A 3H8SA 3UMCA 1NVID 4Z6FA 3MDCA 3QQ8B 1J7BA 2KOXA 2KJRA 3PSEB 4DL6A 3C29A 1L5UA 1AYFA 1ET9A 1X6JA 2WXFA 1ZQHA 2FLNA 2TSSA 4ECVA 3BZKA 3ISBA 1E10A 3GV8B 2W55A 3ZQ4A 4DK5A 3LVVA 1RQLA 2QLTA 2KAJA 1ZQJA 1SEBD 2KYWA 3RCZA 1SE4A 5KFOA 2I2YA 1JXEA 2HI0A 3SR6A 2K1FA 2MP2A 5CX3A 3LWMA 5J2RA 2Z0DB 3CP8A 2Y1JA 1Z1VA 2HJ1A 4MM3B 1EXNA 3GU3A 1IGDA 4CGZA 2HVIA 3AI5A 1XS9D 3A9JA 3HKZC 3H40A 4GB9A 1BMLC 2WF7A 1R4NB 9ICAA 2MBHA 2BGWA 4B9MA 5KFBA 1UBIA 4JX1C 3M1YA 5ALLA 1O03A 2L5YA 4MDKE 4ICAA 4OHJA 4CE6A 5EE0A 1B4FA 4OD0A 4B9TA 3DOWA 4EBDA 3BJYA 2ZNVC 4HCNB 4R8UB 1F0MA 2NBVB 3W1SA 2KKPA 1L0VB 2G4SA 2QDFA 2PKEA 2XVTA 3MR6A 2SEBD 1C3TA 5AKXA 2D11A 4B9SA 4O3QA 4DSIA 3APDA 1J2NA 2RDIA 1VZ7A 3AU6A 2L32A 1KL9A 4UAYA 4KLLA 2MLBA 3N1XC 1XLOA 2ZTCA 7ICVA 2BR0A 1LFDA 1TK0A 4AP9A 1V8CA 4LTUA 5AKHA 3EWAA 3GILA 3T9LA 3QK0A 3UPQA 2XY6A 5DB7A 1U49A 2QB1A 4F72A 4XRHA 2WXRA 2ZNVB 2XBBC 3V6EB 1AN8A 1T3QA 7ICIA 3JSVB 4Y2PA 3RTVA 5AM4A 1T6BX 3DBHB 3ML9A 4YMMA 3AU5A 2KJ8A 4XA5A 5L1IA 4RPYA 1IP9A 1WXMA 5KFPA 1QLNA 1N61A 3V62A 4UAVA 1WR1A 2EZXA 2VKQA 5AM5A 3JPQA 7ICMA 3DCGA 5D3DA 2FE9A 2DKZA 4K3CA 3H4BA 3PW2A 2ESEA 4EUTA 5J2BA 4KLGA 3RJEA 3FDSA 1OFFA 2ICIA 2K8CA 2LASA 5CB1A 3QA8A 4NLGA 2EELA 2KJ5A 3TKAA 7ICSA 1D6EC 2MBBB 3KH0A 5ALPA 5BPCA 4ACOA 5AK3A 5KG3A 2ATLA 1SBBB 2ZEQA 3E56A 2WF8A 1K1QA 1MQ3A 3TIXA 5AKZA 1BPZA 2BKRB 3BS5B 2WXGA 3DEEA 2QB0B 4HKZE 4NAWB 2AYOB 2WNMA 2DNFA 2I38A 5AKLA 3OWEB 4ZYSA 4NLNA 3F5AA 4K1RB 1P3QU 2JSVX 4F93B 5AKEA 2K4IA 2HBJA 2KK0A 2J6TA 3EECA 2BB6A 3U8ZA 4YD2A 4MEXA 3A0BU 2KACA 3NY5A 4P7IA 5LXIB 1L4DB 1QOAA 2CR5A 2XN9C 5ALFA 2M8SA 2MU2A 2NO5A 1IG6A 1R4MI 2N9KA 4PZNA 3AV8A 4JWNA 3QEAZ 1PQSA 3C2MA 1VD2A 2BGFA 2RLTA 2L3ZA 1N48A 3QIJA 1D5XC 5KFZA 3K1ZA 4B9UA 3TAQA 2CKHB 3C5GA 1ROEA 1DGJA 2BPSA 4MGYE 4XE0A 1DXSA 3HX0A 1RYSA 3CNHA 1SKRA 2OCEA 4Y2XA 5D94A 1ZXHA 3P42A 4EEKA 1FM0D 5HG2A 3RH4A 4F50A 1YN5A 5J2CA 2YMPA 3KFUF 2DPJA 2EAMA 2M19A 1NBFC 1T7PA 4IRCA 3L54A 2BHNA 1A77A 4C8NA 4M8MA 4ECYA 4B9VA 1C76A 3AE3B 5BO4B 1L2NA 5AI4A 1QOGA 1YZ7A 1T5XD 2MHJA 4MM3A 5J2DA 1XXGA 1EWYC 4JWUC 4M47A 2NO4A 8ICXA 2NVUI 4DHJB 2DUYA 3AE6B 3BQ0A 3FILB 2K8HA 2OM6A 2YMMA 4Y2VA 1NK0A 5KFYA 1ET6A 2MJDA 2KDFB 4HEA1 1JX4A 3RN9C 1CZPA 3EHVA 4CCHA 4GSWA 5KFCA 1ZQDA 4PPXA 3QZ7A 1SSNA 2G07A 3VTVA 5F3XB 3DHHC 1FXAA 4XWWA 5J0YA 4R8UA 2H3IA 3KW5B 2AHOB 4QIWC 4QZ8A 4II3B 1Z2MA 1TS2A 2YQEA 5ALYA 5DDMA 3IHQB 4K4HA 7ICJA 1ZQYA 4R63A 1YNTE 4ANWA 2DZJA 4ELTA 1X9SA 1MN8A 1YQ4B 4LNFA 4DSEA 4YCXA 4I6LB 2WHIA 3E0FA 2KZ3A 2QMTA 5H92C 1ZETA 3O13A 2AQ0A 4P4MA 5JXVA 1SV0A 3RNFC 2N9LA 4GXBA 2OYYA 4Q2JA 4DL4A 2UWQA 1L8LA 1GJZA 3DHIC 3LB8C 4R3DA 2I1QA 1PUTA 2LUEA 4C00A 1ZD2P 1FCLA 1TKGA 2JEJA 2KTRB 4M9JA 3R2TA 3PZDA 2KWDA 2UVRA 2WDVB 9ICOA 2R18A 3RI7C 3TADC 2QEJC 1QT9A 4KLJA 2HBLA 1VR9A 3JSVA 2BBCA 2QCZA 1ISNA 2OHFA 3DBRI 4GLSC 3IG8A 1A6SA 4HRSA 4EZLA 4FJZA 1F44A 2ZUBA 1M6YA 4F2SA 3RH6A 2FIFA 1JWUD 3L3FX 3G6YA 3OSNA 1GOZA 1LO5D 2W8KA 1E90A 4DSLA 2IZVB 1DOXA 3CF6E 3R9KA 4EX7A 4I2CA 2FDRA 3TACB 2BKFA 4J9NA 3LDZE 4P4OA 3WAOA 2KOBA 1XCQL 3ENEA 5AKYA 4LK0M 1A5RA 1ZQIA 3CSTA 2IO3B 5D3IB 2XGPA 4NXZA 1QSLA 3QX1A 5HMMA 2ASQA 3GDXA 1J97A 2W7PA 4K4GA 4QZDA 1DYQA 2PW9A 5L83A 3ED5A 3BS5A 2BS2B 4NAWA 2Q0ZX 2QB0A 3GIJA 5DLFA 4KLSA 3ZO5B 3RRGA 3SV4A 2DGZA 1QH9A 2FCQA 2J6UA 1WGHA 2KHQA 9ICKA 1WE6A 4TQ1A 9ICFA 2KZRA 3N3KB 4A55A 1Y56A 2ZCBA 2R8IA 3DQVA 2IOFK 3ZTCA 1SXDA 2JRHA 4Z6DA 1NK6A 3U7DA 2JXTA 4KSKC 1L0YB 2FCNA 2JZBA 5J8YA 2E5SA 4G3IA 1RPLA 4C8KA 2H89B 5DGAA 1V9JA 4US9A 2LVPA 4P6VF 4GXKA 5HI1A 4UB2A 1QKZA 3DVNV 2XI9A 3RH5A 2JY6A 4Q8FA 4CO7A 3ONSA 5D2MB 3OPXA 5ALZA 2EKIA 1ZQ1C 3NVZA 3IXSA 1ZD5A 2RGFA 2DQNB 2EAOA 1UPHA 2JH1A 3UIOB 4NQKE 1L3VA 2W03A 2BKEA 2JEGA 2KK8A 3QCAA 4DHJD 2KE7A 4I6NB 4NJCA 4OZCA 1FD6A 3X23A 4QW9A 1ZDXA 3DV9A 3FILA 5KFVA 2MUTB 3NRZA 4OJPA 2ISPA 1ZD4A 1C20A 2BS4B 1Z00B 2F1JA 4NV0A 2V4QA 4YSXB 3LVWA 5CHFA 1JCKB 3ZNHB 4RQ8A 1ZPSA 4X57B 3PV8A 3Q6BA 1URJA 1WYWB 3HW8A 3HP6A 4ICUA 1TFRA 1PVQA 1YOVB 5L1JA 2BPCA 2NRXA 1GB1A 2HDEA 4FFDA 1LV5A 2K8BA 1JRPA 2LGIA 4KDLB 5ALWA 3KLSX 4II2B 1ECWA 4EX6A 1XO0A 1IV8A 2LZ6A 4PYUA 8ICPA 4LNOA 3QZ8A 2MA9B 1S0OA 4ARCA 5KFRA 1Q0WB 3TEYA 3N7RC 2DBYA 2G9HD 2LPEA 1Q10A 3PZ7A 4QZCA 4B0EA 4AQ7A 2AGOA 1TK5A 4KLQA 4DQSA 2KTRA 5LNK1 3EC8A 3MHSD 3SHQA 8ICYA 4M0WB 2E8MA 1TVAA 8ICOA 3MC8A 2J52A 1ZW7A 2YN4A 1ZQWA 3IFWB 2AQ3B 3JPRA 3OG5A 4HCPB 4XZ4A 3AEDB 2IOHA 4F4WA 2AGQA 1WH3A 5KFWA 3A4RA 4BBNC 4RQ0A 2ZTEA 2K39A 5C0YA 4P1CC 3SFDB 1V9PA 4UBBA 1NDDA 1S5LU 3R7QA 2KXJA 4EZ6A 3AE4B 1LM8B 1L6VA 3KKAA 3H1UA 4EKUA 3HM6X 1TY2A 4QWAA 4IL6U 3ZD9A 1HUOA 2BCVA 2EMTA 3IT6B 2WDTB 2HOFA 1C78A 5AIBA 2FAZA 4I2JA 3TADA 3NZ3A 1A0PA 1HZ5A 3UF8A 1UGMA 1F5SA 4TQSA 3N20C 5D7GA 2IDYA 1WXSA 3NOBA 1OGWA 4HDQA 4IWPA 3PT2B 1I4XA 2ZW0A 2JMGA 3SFEB 3BQ1A 4Y2RA 4FADA 4RUAA 3ABVB 2KFKB 3NS1A 1QLBB 3DBSA 4J3OD 4HROA 1SZHA 2RRDA 3KYDD 1QSSA 1WGRA 3RJGA 1R4MB 2LWPA 4RGTA 5DB8A 3I9V1 5ALHA 5T14A 1HZ6A 2DYMA 3I3TB 5GMVA 4JGHB 8ICRA 3ALRA 4FLHA 2YEPB 5G5HA 4KLIA 2VA8A 2FIDA 3KD3A 3DDCB 1P98A 2H3VA 1XO3A 3NGDA 2LHTA 2O6VB 5KFKA 2KEYA 2M0AA 5A0LA 1Q3UA 4C4RA 3KWLA 3ETRA 5BYRA 4ECTA 3KZIU 3PW4A 4RUCA 3AU4A 4B9KA 4G9BA 4UBCA 2N9EB 3PRZA 1A70A 2W11A 1EUVB 2NS5A 2BB5A 1YQ3B 2K8AA 5KG5A 1K8RB 1CEZA 1CRXA 1P7DA 5FR3A 2DZKA 2LUMA 3RJKA 2ZIUB 4HYKA 4AOFA 2ZUDA 4OJLA 3N97B 4N58A 4F91B 2V4LA 5CR0A 3VVWB 4YSYB 3Q8CA 1SV4A 3ZNGC 4WWNA 3PZPA 3BK2A 1ZRMA 1NK4A 1P0RA 8ICLA 5J2HA 1FRDA 2BWFA 1V6EA 3H7SA 1EF5A 3ETLA 3W1SC 9ICJA 4NJ8A 1GG3A 1HEZE 2MUTA 3VCBA 1YMHE 7ICQA 2IO2B 2HJ8A 2JZ3B 1Z00A 3FAHA 3A4SC 3H9DA 4KZ0A 2ZIVB 7ICKA 1YX6B 5G2NA 2YLMA 4YR3A 1KLVA 4C4SA 4RQ3A 1AWDA 1O08A 2E1FA 3SEBA 3NVWA 4I28A 2ZXHA 2ZJAA 4DLGA 4NY0A 4HLEA 1T3NA 2INCC 1SZPA 3D6JA 5GXGB 3UI3A 8ICZA 3C2LA 2RD0A 4JE3B 4AUQC 3C19A 2DX5B 2LGXA 4GDKB 4UAZA 4ED3A 1XSPA 1IIPA 2PI4A 2K4EA 1FFUA 1M4VA 2F1IA 5L1KA 3WU2U 3ICXA 3ZJTA 3I28A 3ISCA 3V6KA 2AJQA 3DBRB 4ZRQA 3JPTA 4C4VB 3DWGC 1TKYA 3Q8RB 4R65A 4I2GA 4YXMA 4M0WA 4HPMB 1WSPA 5ALMA 1GUAB 2LGSA 8ICTA 3GIMA 4RFBA 3V60A 4E74A 1NENB 3RB3A 3NVVA 2CRXA 3ZRCA 3ZDCA 4KDIC 4PGXA 1MG8A 3AE9B 4HAIA 4MHVA 4KLUA 1TS4A 3BIID 4ZOHC 4IRKA 5HP4A 3NHEB 2G08A 3Q2AC 4HWIB 4E3CA 4YFKA 3PMLA 4IS7A 3ML8A 4DOAA 3WKEA 1TE2A 3Q8FA 3UMGA 2ASLA 2G09A 2GOLA 3PY8A 3GZNI 4F1SA 2PPHA 3UXOA 1Z1BA 1F0ZA 4FS2A 3RUIB 4S17A 2JV3A 3AE7B 2PFOA 2OXOA 1NK8A 4FBUA 5J0PA 2Y3AA 2XY7A 1HIWA 4GC7A 4QWEA 4GN1A 4IC9A 1I42A 2IHNA 3ZDBA 2BDUA 5GTHU 1SJED 4W9HA 1RWSA 4P16A 3LYYA 5AK5A 2K60A 3Q8BA 2QARB 3GZFA 2HHUA 5IP4D 1RFAA 5FK9C 2HHWA 2E3TA 1YX5B 4GIBA 2MCNB 1SF0A 2BYEA 3PVLA 2KFKA 3QARA 2LJIA 3IDWA 2KKCA 1E7PB 2WU5B 4QW8A 4IWOA 4LNIA 3ZNID 3UXNA 2N1RA 3KTQA 3MTNB 4YT0B 4RQ7A 1RYRA 2O6VD 5AI6A 4C7ZA 5KFJA 3V6JA 5KHOA 3QU2A 3TAPA 1S1QB 2BW2A 4MJSB 2W43A 5KFGA 3ISDA 3EPGA 5HHIA 5I4DA 4IR1A 2W9BB 3PLUA 4W9DA 1WZ0A 4QWBA 2RR9A 3K9OB 1NEKB 1NI2A 3TCAA 5KFXA 4GXIA 5BMIA 3RNBC 1GB4A 4Z6CA 2YY6A 1C4AA 3NASA 1SB3C 1WIAA 2WS3B 5EDSA 1BXTA 2AGPA 2P6UA 2J0KA 2NV3A 2KLGA 5T8IA 2KVZA 4F8CB 4RMAA 3N1YC 5ALTA 1N6ZA 2ZIUA 3KHHA 2H3ZA 4O3OA 2LMRA 2CS4A 1RZTA 2MX2A 3RB6A 2P35A 3KOOA 3BVZA 3URYA 4QJFB 4EELA 3TANA 4P2HA 5CHVC 4G0NB 2JU6X 3TUOA 4EZJA 3O0FA 4DS4A 4JLCA 3MGHA 3T3FA 4EOYA 5AKGA 1HTQA 2KANA 1IYFA 1V38A 4DWFA 4KGTA 4KIKA 4RQNA 2FCMA 2IBIB 4IM3A 2YB4A 3O65B 2ZIVA 2JWUA 4DL5A 2PJHA 3MC9A 4KZCA 4NAMA 4HVBA 1SWWA 4UB6U 2F8KA 2QKQA 1UT8A 2FLLA 1TK8A 3IG3A 3J9CA 1SV0C 8ICCA 2KVSA 3SENA 4X5VA 4KLEA 5J17A 4EYIB 3D32A 1FNWA 3OJUA 4RPZA 4KLTA 3D2SA 4N9F4 3RB4A 4ED6A 5GTIU 4FZMA 2V3NA 1T4GA 5J0UA 9ICSA 2PTLA 3C23A 4Y2UA 3AEGB 3HKZF 1BPDA 3AQEA 5HR7A 1I4QA 1V2YA 1JALA 2FBWB 2WXIA 2FLPA 3ZI4A 1D8LA 2K0PA 4UB8U 3JPPA 5CA7A 4GDKA 3F2CA 5TSSA 2B3AA 2G06A 4QZAA 5AI9A 2WAQC 4K7SA 1ZQSA 1KFSA 2JZPA 3FM9A 4B6JA 1NYRA 3MP9A 5C3JB 4NM2A 3IRUA 3Q3MC 5EE9A 4ANUA 3RZFA 4FZLA 3EYZA 3ZJUA 4ED0A 5G5GA 2FMPA 4C4VA 3ZUNA 2KTFA 5IINA 1R7SA 2JZZA 2ASJA 4KITB 1AROP 1ZE3D 1SE9A 4IUMB 1B0XA 3L16A 2ZPYA 1VJKA 4J9OA 3QUQA 4PH5A 1ZQRA 2UVUA 3UM9A 1E5WA 2JVCA 1ZJMA 3BVGA 7ICGA 4HKQA 4W9LA 1KTQA 4CDGA 1NYQA 1C79A 1JQ4A 1RXWA 3ZD8A 1HXYD 2F1HA 4KMOB 2XEWA 3WKDA 3TI0A 3IG5A 4EBCA 2N4FA 1Q46A 4MFFA 2ES6A 1MA7A 3QWZB 3AN1A 1S9FA 1ZQXA 3SZ2A 4KTQA 3RPFC 2V1YA 5DBAA 1JIHA 2WXLA 4GU2A 4WJNA 4KGRA 3SD7A 2K9XA 4G3XB 2JR5A 4C80A 4PK1A 2QARA 1T0YA 3WAPA 4QZBA 3C8YA 3H6NA 4BWMA 4QNLA 1A76A 2WF5A 3MDAA 1QOFA 3RZWC 3J81j 3BWUD 2VANA 4KLMA 1TAMA 4KKIA 2BCRA 1S0NA 1FNUA 1Z19A 4K7WA 5J8YC 4DFKA 3NRWA 4YD1A 1BGXT 2EDUA 3AECB 3LK9A 4DXFA 4NPNA 4PGQA 3VRBB 1BNPA 3PTFC 3ZDMC 4MJSA 4BKTA 4M8NA 1NJYA 5KFLA 3WK8A 4QZHA 2W9BA 2ASDA 2L0TA 2EQYA 4CNQA 1D9FA 2UVWA 1IUEA 1V86A 5ALIA 1XSLA 2KQ4X 4YSZB 3MFIA 2NTSA 4DSJA 4RGNA 9ICEA 2Y5CA 4U7CA 4RQ1A 5J2AA 2WXJA 2Y0SC 2C5LC 4PHDA 3T5JA 2LI6A 2ON8A 3EW9A 2N7DA 1TS5A 2V4RA 3MFHA 3QUTA 5EWFA 1E8WA 1OEYA 1XCTL 4DXGA 1XSNA 1RYJA 1SKSA 2KX3A 1T0RC 4IM0A 5ALUA 3QU9A 2XNAC 4KSLC 5AZGA 4FULA 4ARIA 2CPRA 2DF4B 3QNMA 3AXCA 2W9CB 1D4BA 4KX5A 1J2MA 4ASWC 1CI4A 1N63A 5J2JA 2C7NB 1ZQPA 5AI5A 3GE3C 1C7YA 3UMBA 5KT6A 3I57A 9ICPA 3VDZA 1UT5A 2DYOA 4TMAB 5KHQA 1WJ6A 1WM3A 2MW5A 3PW0A 4M6WB 3N1ZC 3SD5A 3NVYA 1S0VA 3ZDDA 4WAAA 3QU5A 3DPDA 2LHDA 9ICTA 3P4SB 5JU5A 4ECUA 1ZQMA 1X66A 2BDPA 4ZHPA 5BMHA 4ECXA 2HDOA 3BINA 3U7ZA 3C1ZA 4I29A 4M9LA 3PRPB 2R8GA 1N5WA 5AICA 1DK3A 2OEDA 3B08A 1BPXA 1TKEA 1X40A 2WXPA 3SMVA 4DWIA 4RPXA 4J9MA 4QZEA 4JMUA 1GO3F 1N60A 4RGOS 5D6JB 4Y2TA 1QF6A 9ICCA 4OZAA 2IO1B 5E6NA 3HVDA 5KG6A 3X0WA 1ZQEA 2BYVE 2Y5BB 3IAS1 3U2SC 2HTHA 3ZDEA 2KJHB 3AL0B 2FJ6A 2M1MA 1PVPA 2B76B 1WGDA 2J0MA 2E8NA 4IG7B 1WRIA 2IY1B 2D3AA 2J53A 2JWZA 2Q5WD 5JTIA 2M17A 1D5MC 3ZXVA 1JRUA 4CQNA 1U48A 5AM3A 2F8LA 2LYBA 2D10A 2GLEA 1L7NA 3TFSA 3W5VB 4RNAA 3WA0A 1UBQA 4P1BC 4AP4C 5HKHA 4QIWF 1Q3VA 3KKAC 3F2DA 1VZ8A 5J0SA 1PGXA 2LGDA 2LI5A 5HMLA 5KAFU 1WXAA 3OJ3A 3P4PB 4OVZA 2VH1A 2V3PA 3L5KA 3JPSA 3TEZA 3G6XA 3M6KA 2RDGA 4RU9A 3GV5B 3KHRA 3E9SA 4FE3A 2Z0EB 3GZNB 3KQ4A 3UIPB 3GB1A 4IC7B 3AULA 4DQPA 3JW0X 2A3VA 1FXIA 1UCVA 3GE8C 3TEWA 3RBEA 3VR9B 3MJWA 3GOEA 3UQ0A 2WLBA 5G55A 3S2AA 1IPGA 4J9PA 3RAXA 1UQVA 4ECZA 4JV1A 1V81A 9ICMA 1ZYQA 2N1VA 4JPSA 4XWTA 3PSFA 1IM4A 1WXVA 1I4HA 2JRZA 5TISU 1TKDA 4EBEA 2V9WA 1B1ZA 2R8JA 2W82A 3ZYYX 4F4YA 3DVNU 2QSDA 3QU4A 2AL3A 4UB3A 2ZTDA 3TL5A 4AS1A 4O5EA 3T5HA 2BYFA 2LKYA 2HBKA 1S76D 2NPTB 4KLOA 2KWVB 1OXJA 2ONQA 4IRDA 2K6DB 4RZRA 4EZ9A 3VFKA 4LVSA 4BKSD 1BVSA 1L3TA 3FC4A 2IHMA 8ICQA 1JMSA 4MEMA 2W3SA 4BKSA 2AQ2B 4CRXA 1VLBA 3UGBB 3PR4A 3QE9Y 4Q44A 1E7VA 5L9XA 3MGIA 4I2IA 3PZ8A 3RJFA 1VRAB 4RT3A 4LZGA 3SDLC 1L7OA 2INDC 3BYYB 2OJRA 5FP0A 2REXA 1E9MA 8ICHA 3BZCA 3WK5A 1I7HA 1P7FA 5D46A 2CJOA 3HIZA 3B9JA 1JN3A 4DHZE 1KKXA 2MRLA 3ZVVA 4BVUC 4IQWA 4DQQA 4IR9A 3IP4B 3BK1A 3Q8AA 2ZIWB 4S0RA 3RR8A 1XLNA 5KL8B 4TUQA 4CF4A 1FCCC 1OUQA 2W9CA 1BPYA 4NZLB 4B9NA 3DVGY 5CEHA 3ZNZB 4Y2SA 4M9HA 2R2QA 2ZW1A 1PDXA 3VTWA 4BJQA 3PHXB 5B5EU 1ZQOA 2INNE 1PVRA 4M00A 2F76X 3KUZA 2XK5B 2ZVOA 5AZFA 1KFYB 3AB5A 4M6WA 4WJQA 4PHPA 2I1KA 2KICA 4PJ0U 2UYZB 5DPWA 4LLGM 2AH5A 2C2RA 2R8KA 4NLZA 3BVMA 3RBDA 3IAM1 4YTNB 3LWLA 2ZZPB 3I5JC 5DLGA 2XC9A 1SL0A 2J0JA 1JWBD 2HTME 4G11A 1ZQCA 1V1OA 5DPTA 8ICVA 1WJUA 2MJEA 4O1NA 1J8CA 2AQ1B 2UU7A 2AU0A 3IM1A 1TZ1A 1TTNA 2E8OA 8ICWA 5J2FA 2DAJA 2DWQA 2D5GA 1LQBA 5D4BA 1LVHA 2WXHA 1S3SG 4HPLB 1KN5A 4M2YA 8ICSA 5DGBA 2D3GA 3F53A 2CHXA 9ICNA 2L05A 5FR6A 1Y88A 3RAQA 5CHGA 1T0QC 4DSFA 3GFKB 3PX6A 5J0TA 3A0HU 1V1PB 4C8MA 5AHXA 3ECIA 4YTPB 2ZIXB 4A3OA 4YXJA 5IKCM 4ED2A 2WGSA 5KFHA 4MSQB 4DHZB 1T8EA 5LXHA 4WH4A 5JHBA 4M01A 4BGDA 5J2GA 3WK9A 2IGDA 2Y1IA 2W9MA 4J9KA 3QX7A 3WIMA 1S0MA 4DXAB 5J2KA 2D07B 1K51A 1N62A 3HPOA 3OAWA 4L2YA 4F3OA 1MI0A 2KC1A 1L6UA 1SE3A 4W9KA 1X2IA 3MGVA 2D3DA 1D8BA 1WUDA 4MF8A 3C0RB 4WJOA 2DL0A 1GPXA 1P1AA 1ZGUB 1NJXA 5JHAA 2XCAA 3A9KB 5TZVA 3H8JA 5TR5A 4C56C 1KLGD 4QZ9A 2K4PA 3H0MB 1UD7A 4O3SA 2KVCA 5ALEA 2F3NA 2I6XA 3PX0A 2BTEA 1NZBA 2D6FC 2YB1A 1B9RA 3PSPA 2M4NA 3CIRB 2IOFA 4MFAA 1OQQA 3PR5B 4RF1A 2CN1A 4FA6A 1K53A 3T79A 1UGJA 2VJ5A 4KLDA 4Y2JA 4O9MA 1WZ3A 3VR8B 1NNLA 3Q8SB 4F2RA 2KNBA 3HM3A 3HHMA 4RM8A 3ZW3A 3T3NA 1ZQVA 8ICJA 3PV1A 5ALVA 4F4XA 5ALNA 2CHWA 3T3OA 2SAKA 2EZZA 2A1AA 4FHJA 5JZEB 1ZD3A 5E6JA 1MHHE 3CWIA 4K4IA 3GIKA 5DB9A 4DLEA 1XLPA 1YN4A 2QC8A 3BYTB 9ICLA 3AMZA 4BBNF 4ANVA 3JPNA 4FN2A 3W1YA 3B0XA 4DQOC 5D49A 2NPTA 3BQ7A 2BPFA 2OOBB 1RAXA 4B6WA 3ORYA 3ZLZA 2L52A 3QJZA 2BQQA 4DQIA 2HHVA 2YEPF 1UWXA 3LXFA 5HR6A 2P66A 3VQIA 1UH6A 3R66C 3WAMA 2C60A 4O5KA 2HD5B 2LHEA 1N2XA 2KIWA 4DO9A 1N56A 2X8XX 5KT3A 3WKCA 3K75D 2NTTA 4MH0E 1SXTA 2HE7A 4A3PA 4NM1A 1SL2A 1RYUA 9ICBA 4A90A 1J7AA 3LYSA 4BFRA 1AW7A 2LMCA 2GBJA 1TJEA 5B66U 1WMHB 1FRRA 1XT9B 4RM9A 4FBTA 4F71A 4E71A 2J7QB 4J9LA 1QSYA 3ZDTA 4EEWA 3QHTA 2DENB 3MFGA 2WYQA 3CSFA 5E79U 2ZIWA 1Z4NA 3H8MA 1FMAD 4FZNA 1V49A 4XUSA 1BPBA 4Z6EA 2G5IB 4UB5A 2ISOA 2G1EA 3SQIA 2D8CA 2PXIA 3AH7A 1U4AA 3RNAC 2G3QB 2KN5A 2R8HA 1JROA 2PFNA 5F9LA 2BWES 2HHQA 2INPE 2XK5A 4IDIA 4OVVA 2N7EA 4BX9C 4DQRA 1TIFA 4UQGA 3OSPA 1PZNA 1SWVA 3MBYA 2K6QA 4TUUA 1QQ5A 3QU7A 2HW3A 1UELA 1FFVA 5ALQA 3WK4A 2KZMA 4YL8A 2VA2A 2FUHB 3AEBB 5DG7A 1V5TA 2VH2A 3V6CB 3APFA 2M0XA 8ICGA 3ZXRA 2K22A 5J18A 3D2NA 3WCQA 2R2OA 2JF5A 5KG2A 4UATA 7ICHA 2RQ5A 1LB2B 2ODGA 1L3UA 4LJPB 1JXLA 2JEFA 2KWUB 1P9DU 4CHKA 1KOTA 1ZJNA 1V5OA 3Q8EA 2ZG6A 4Y2QA 4B9LA 4WIPA 5L95C 2IGGA 3DDHA 3KHLA 1V1PA 2MBOA 4M02A 3PHWB 2ZIXA 4OO1J 4USAA 3OJSA 4ITKA 1B43A 3TARA 2JRIB 2P6RA 7ICEA 1DRGA 1KRHA 3TQ1A 3S6JA 3B1LX 5DG9A 4U6PA 4BXOB 1U9LA 3M9NB 3PPAA 4TUSA 4LNNA 1WCLA 1XEEA 1J0GA 5CRXA 4ECSA 1OEYJ 3Q8MA 3E58A 2D3CA 1NKBA 2W54A 4IWQA 2ZPNA 4C4TA 2DPIA 1L4ZB 3A9KA 4JV0A 4DFMA 3VHTC 2NRVA 3MC1A 4A9AA 4BKGA 2N7JA 3AM9A 3CRXA 4EE2A 3KZXA 3UQAA 2JXXA 2W7OA 4RCOA 1ZP0B 5DDYA 2E6XA 3B2GA 2BQUA 4OJOA 1IGCA 4FJVB 2DFLA 1B22A 1ZQLA 5KFTA 2A4ZA 4KV2A 2EH9A 1WX8A 8ICFA 1DOIA 3BS7A 2PLPA 5AKIA 1YIWA 2XGQA 1DGSA 3IN5A 3SI8A 5KFDA 3UQ2A 1KSPA 4BOSC 4YMOA 1L0XB 2OJWA 1STEA 2IPKD 2WXNA 3M7DA 4ZH4A 5AI8A 2N0SB 4A6QA 3KUCB 2HVHA 3THVA 1YN3A 3M95A 5KNIA 3Q3NC 3LDAA 2ZXIA 4DL2A 2Y5PA 3HVZA 7ICNA 2KVRA 2VJ4A 1G6JA 3Q14C 2RDJA 1HTOA 3AEVA 4Q8EA 4OCZA 2KWCA 3SAGA 3Q8LA 1COOA 3HILA 4BWJA 1KM7A 1Z3EB 2J4XA 2LRUA 3ZKJC 4WWMA 2PMZC 1EM7A 1TBEA 5IIOA 3TEXA 5HFYA 2KQSA 2LD9A 4DDGD 5AEKB 5J2EA 1ZQBA 1ZQGA 4E0DA 2DZIA 2GBKA 1GNUA 5KFNA 2JYEA 2O6VA 1WMHA 1KBUA 2WB1C 2MBEA 2QIEB 2ZCCA 3T8MA 2FCSA 3M6ZA 4IQTA 2JUOA 3WK6A 3WANA 5LLIA 4RNMA 3P63A 5KFEA 1SGGA 7ICFA 2WFAA 2H3FA 4O3PA 4FS1A 2BF8B 1KH0A 3UINB 5L1MA 2HHXA 1WY8A 5DPRA 3KHGA 2IJ0A 5ALDA 4F4ZA 1UA0A 1KTKA 2QHOA 2K3UA
chains in the Genus database with same CATH topology
4ZHOA 2XNAC 1UWMA 4ARIA 4H2AA 2H89B 1UUPA 4US9A 2L83A 4P6VF 1D4BA 4L1BA 1P7EA 1QKZA 5HI1A 1N63A 1E6EB 5EE3A 1KLUD 2AX5A 2L1AA 3AE5B 3W5UB 2WP9B 3I57A 1F2RC 4N6EB 2EKIA 3NVZA 3IXSA 2BS3B 1K50A 2DYOA 4TMAB 3W2DA 2JYTA 2JX5A 3ZGZA 4C7YA 4YTMB 3NVYA 1ZUD2 2FUG1 3P4RB 4WQMA 5BYQA 4US8A 2LHDA 3P4SB 4NJCA 4OZCA 3U4EG 1FD6A 4ZHPA 5BMHA 1ZDXA 3FILA 2BS4B 3NRZA 2Z8LA 4TSSA 1JWAD 3U7ZA 1SE2A 4TQ0A 1N5WA 2OEDA 1TKEA 1BUIC 2WXPA 4YSXB 1J7CA 1WYGA 1JCKB 4IKGA 1N60A 2RPVA 4RGOS 1QF6A 1ZPSA 4OZAA 1VDVA 2MEKA 2WDRB 3HVDA 3IAS1 1CJEA 1WWTA 3U2SC 4ZRPA 2KMMA 1FIQA 3EUB2 2B76B 2M56B 4YXDB 2H88B 2PMVA 1GB1A 2HDEA 1WRIA 1JRPA 4XDDA 2LGIA 5C2TB 2J53A 2Q5WD 1PFDA 3KLSX 4CQNA 1D5MC 1QOBA 2FE8A 3W5VB 4RNAA 2GRIA 2W3RA 2LFIA 1VZ6A 1VZ8A 1PGXA 1QQRA 4ARCA 2V4IB 3TEYA 3P4PB 4OVZA 2BYTA 2BT6A 2V3PA 2DBYA 2G9HD 1E0ZA 1Q10A 2PIAA 2RDGA 3PZ7A 2MH7A 3E9SA 4B0EA 1C77A 3TEZA 3KQ4A 5LNK1 4AQ7A 2QJLA 1FO4A 3GB1A 1HA5A 1RFKA 1PGAA 1FXIA 3TEWA 3MC0B 1SJHD 2J52A 3VR9B 1MPEA 4A8XC 4IOIE 2AQ3B 2WLBA 3AEDB 3W9CB 5BYSA 2WXMA 1CQVA 3EA6A 4RH6A 2VZKD 4JPSA 4XWTA 3SFDB 4WURA 3IT4B 2GB1A 3AE4B 1I4HA 1L6VA 2W82A 1B1ZA 3RFZB 1KF6B 1TY2A 2QSDA 5MPOA 4L23A 2JQRB 4XDCA 1JW9D 4AS1A 3IT6B 3B2FA 1C78A 3NZ3A 1C9FA 1ZOYB 2MJ3A 3DWMA 1HZ5A 1MHXA 2ONQA 2WXQA 5FKAC 5D7GA 2IDYA 3FC4A 3L4PA 3VRAB 1I4XA 2ZW0A 3SFEB 2W3SA 2AQ2B 3ABVB 1VLBA 3NS1A 1HQRD 1QLBB 4J3OD 3AEFB 4HROA 4RGTA 3HUIA 1GAQB 3PZ8A 3I9V1 2ACZB 1VRAB 1HZ6A 2DYMA 4REZA 1YJIA 2CU3A 3BYYB 2LEKA 1PGBA 2YEPB 5G5HA 1E9MA 1I7HA 1P7FA 2CJOA 1XO3A 4FXCA 3B9JA 2M0AA 1L5PA 3KWLA 3ETRA 5BYRA 3BK1A 3Q8AA 1N5XA 1SIJA 2PVOD 2IGHA 1XLNA 1FCCC 4WAFA 5EE1A 4NZLB 2ZW1A 1PDXA 1A70A 2J42A 2WU2B 2BB5A 1YQ3B 5HHDG 3HRDD 1TY0A 2INNE 5FR3A 2LUMA 3AEEB 3P1MA 3H8HA 1KFYB 3AB5A 3BZDB 1NI3A 1NVID 2K5PA 4N58A 1J7BA 1AYFA 1ET9A 3Q8CA 2WXFA 4YSYB 3BK2A 4LLGM 2TSSA 3BVMA 1FRDA 4YTNB 3IAM1 1E10A 2PKOA 2W55A 3ZQ4A 2KAJA 1SEBD 1JWBD 1YMHE 1HEZE 2HTME 1TS3A 1SE4A 3FAHA 1V1OA 2I2YA 2R61A 2MJEA 3SR6A 4O1NA 1PYWD 2AQ1B 4MM3B 1IGDA 3U52E 1TYGB 2DWQA 1MVKA 2D5GA 2WXHA 3ZYYX 1AWDA 1BMLC 3SEBA 3NVWA 2QILA 4YTPB 1V1PB 3KWVA 4JX1C 5GXGB 3UI3A 1FEHA 3N9YC 4OHJA 5EE0A 4JE3B 4WH4A 2IGDA 1C4PA 4GDKB 4KKJA 4MH8A 3W1SA 1F2RI 1L0VB 1FFUA 1M4VA 1K51A 1N62A 1EWCA 4L2YA 2SEBD 1MI0A 1L6UA 1SE3A 4B0MA 3ZJTA 1VZ7A 4ZRQA 2L32A 1GPXA 3DWGC 1XLOA 1TKYA 4M0WA 1WSPA 1ZDVA 4C56C 1KLGD 4RFBA 1V8CA 1EU4A 4LTUA 1NENB 3PO0A 3NVVA 1XF5L 4UDUC 3AE9B 3BIID 2BTEA 4RF0A 1TS4A 1B9RA 4ZOHC 3CIRB 1OQQA 4RF1A 1K53A 1UGJA 2WXRA 3VR8B 3Q8FA 3T3NA 1EU3A 1AN8A 1T3QA 1F0ZA 1I4PA 1T6BX 3AE7B 3T3OA 2SAKA 2Y3AA 5E6JA 1MHHE 1IBXB 3CWIA 1YN4A 3NUHB 1XLPA 3R8BA 3BYTB 3GS2A 3AMZA 1N61A 1SJED 2RDHA 1RWSA 4DQOC 1QILA 4P16A 3LYYA 3GP7A 3Q8BA 5D3DA 1C4CA 2L52A 3AE1B 3R2IA 2WDQB 5FK9C 5AUIA 2E3TA 2YEPF 1UWXA 3LXFA 3VQIA 1SF0A 1CK1A 1OFFA 2ICIA 4JWSC 2LJIA 2EELA 1E7PB 1D6EC 2LHEA 2WU5B 1SBBB 3E56A 2X38A 2NTTA 1SXTA 4YT0B 2WXGA 4HKZE 4GDLB 4NAWB 4A90A 1J7AA 4C7ZA 2WNMA 2I38A 1AW7A 1ZXIA 3OWEB 2LMCA 4ZYSA 1TJEA 1V97A 2BW2A 1FRRA 2JSVX 5I4DA 2KN4A 2DLBA 2BB6A 2KACA 1NEKB 3MFGA 1L4DB 4RGMA 1QOAA 2XN9C 4OW0A 5BMIA 1FMAD 1GB4A 2N9KA 3AV8A 1C4AA 4KGSA 2WXOA 1SB3C 2RMMA 2G1EA 4MACA 1D5XC 5BMGA 3AH7A 2WS3B 2V0GA 1BXTA 1ROEA 1JROA 5T8IA 1DGJA 4XE0A 2INPE 1DOYA 1ZXHA 2PVGC 3P42A 4IDIA 1FM0D 3MJ5A 5HG2A 1YN5A 3BVZA 3URYA 3TUOA 2JU6X 2M19A 4OZBA 1FFVA 1ENFA 1RM6C 3AEBB 3EGRA 4KGTA 1JWSD 4PT5A 1C76A 2K22A 2JWUA 3AE3B 4NAMA 3WCQA 1QOGA 1T5XD 4N59A 1XXGA 1UNSA 3J9CA 1EWYC 4JWUC 3AE6B 3FILB 1YJJA 1FNWA 1ET6A 4KX6B 3Q8EA 4WIPA 2MJDA 2IGGA 4D2KA 1V1PA 2V3NA 4HEA1 5AUKA 3V05A 1CZPA 2PTLA 3V3XA 1I4RA 4USAA 3AEGB 4ITKA 1SSNA 1D5ZC 1I4QA 1I4GA 1JALA 2FBWB 2WXIA 1FXAA 3ZJVA 1KRHA 2K0PA 4XWWA 5TSSA 2WXKA 1TS2A 2JZPA 1XEEA 1NYRA 3MP9A 5C3JB 1YNTE 3Q69A 4HJGE 5EE9A 1YQ4B 2W54A 3ZJUA 5G5GA 1XLQA 2QMTA 3AE8B 3O13A 5H92C 1L4ZB 5JXVA 2N9LA 1R7SA 4Q2JA 1FNVA 4A9AA 3LB8C 2N7JA 1ZE3D 4R3DA 3AM9A 1PUTA 4EE2A 1VJKA 4RCOA 1FCLA 1TKGA 1F77A 1ZP0B 2E6XA 3AEAB 3B2GA 3R2TA 1IGCA 2KWDA 2WDVB 3AE2B 3BVGA 4HKQA 2QEJC 3P4QB 1DOIA 1C79A 1NYQA 1QT9A 1JQ4A 3TSSA 2PLPA 1OQRA 1VR9A 1HXYD 2BBCA 4GLSC 2OHFA 1TZOA 4HRSA 1L0XB 1IBXA 1K52A 1STEA 2IPKD 1JMLA 2KDMA 2WXNA 3AN1A 1JWUD 1GOZA 2N0SB 3RPFC 2WXLA 1LO5D 4A6QA 1YN3A 2WQYB 4KGRA 2K9XA 4C80A 1DOXA 2Y5PA 2VZKB 3HVZA 3C8YA 1QOFA 3BWUD 4KKIA 1ACCA 2GI9A 1XCQL 2J4XA 3MHZA 1FNUA 4LK0M 4WWMA 1JWMD 1EM7A 5D3IB 3AECB 3TEXA 2PW9A 1WXQA 5HFYA 1DYQA 4DXFA 2BS2B 2NMQA 2JYEA 3VRBB 2QIEB 4TQ1A 1IUEA 4YSZB 2CJNA 2KQ4X 4A55A 1Y56A 2NTSA 4MT5A 4RGNA 1ESFA 2Y5CA 3P63A 2WXJA 4YWGG 5H8YE 2ON8A 1KH0A 2JXTA 1WGKA 1TS5A 2IJ0A 1L0YB 1XCTL 4DXGA 1KTKA 1RYJA 2K3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHO A;  1UWM A;  4KX6 B;  2H89 B;  2MJD A;  1V8C A;  4LTU A;  1NEN B;  3FC4 A;  4US9 A;  2L83 A;  3PO0 A;  3L4P A;  3NVV A;  4P6V F;  5AUK A;  3VRA B;  1N63 A;  1CZP A;  1E6E B;  3AE9 B;  2W3S A;  3BII D;  3DWM A;  4USA A;  5EE3 A;  4ZOH C;  3ABV B;  3AEG B;  1VLB A;  2AX5 A;  1OQQ A;  3AE5 B;  3NS1 A;  2WP9 B;  1QLB B;  4N6E B;  3W5U B;  2EKI A;  3AEF B;  3NVZ A;  4HRO A;  1JAL A;  2FBW B;  3VR8 B;  2BS3 B;  3HUI A;  1FXA A;  1GAQ B;  3SFE B;  1KRH A;  2JX5 A;  1T3Q A;  2ACZ B;  1F0Z A;  4C7Y A;  4YTM B;  1YJI A;  3AE7 B;  2CU3 A;  2LEK A;  3NVY A;  1NYR A;  1ZUD 2;  5G5H A;  1E9M A;  5C3J B;  1I7H A;  3CWI A;  2CJO A;  5EE9 A;  1XLP A;  1XO3 A;  3P4R B;  1YQ4 B;  4WQM A;  2W54 A;  4US8 A;  3AMZ A;  3P4S B;  5G5G A;  3B9J A;  1N61 A;  1XLQ A;  3AE8 B;  4FXC A;  5H92 C;  1RWS A;  1L5P A;  4ZHP A;  3KWL A;  3ETR A;  2BS4 B;  3NRZ A;  1R7S A;  1JWA D;  2L52 A;  3AE1 B;  1N5X A;  1SIJ A;  1N5W A;  2PVO D;  2WDQ B;  4A9A A;  1TKE A;  1XLN A;  3LB8 C;  2E3T A;  5EE1 A;  3AM9 A;  1PUT A;  3LXF A;  5AUI A;  4YSX B;  1J7C A;  1SF0 A;  1WYG A;  1VJK A;  3CIR B;  1TKG A;  1OFF A;  1N60 A;  1ZP0 B;  1PDX A;  3AEA B;  3B2G A;  1QF6 A;  1A70 A;  1VDV A;  2WDR B;  2WU2 B;  2WDV B;  4ITK A;  4JWS C;  3AE2 B;  1YQ3 B;  3HRD D;  1E7P B;  1CJE A;  1WWT A;  2WU5 B;  3P4Q B;  1DOI A;  1NYQ A;  3AEE B;  1QT9 A;  1JQ4 A;  2KMM A;  1FIQ A;  3EUB 2;  1OQR A;  2B76 B;  3P1M A;  2M56 B;  4YXD B;  2H88 B;  2OHF A;  1KFY B;  3AB5 A;  4YT0 B;  1NI3 A;  1NVI D;  2K5P A;  4HRS A;  4N58 A;  1J7B A;  1WRI A;  1J7A A;  4C7Z A;  1JRP A;  1AYF A;  4YSY B;  5C2T B;  1ZXI A;  1PFD A;  2Q5W D;  1TJE A;  1QOB A;  3AN1 A;  1V97 A;  1FRD A;  4YTN B;  2N0S B;  1FRR A;  3RPF C;  3W5V B;  1E10 A;  2PKO A;  2W55 A;  2W3R A;  2WQY B;  2K9X A;  4C80 A;  2KAJ A;  1DOX A;  1JWB D;  1NEK B;  2HTM E;  1QOA A;  3HVZ A;  3FAH A;  2MJE A;  3SR6 A;  1FMA D;  3P4P B;  2BT6 A;  2DBY A;  1QOF A;  3AE6 B;  3AV8 A;  2PIA A;  1E0Z A;  2MH7 A;  1SB3 C;  2QJL A;  1FO4 A;  2G1E A;  1TYG B;  2DWQ A;  3AH7 A;  2WS3 B;  1RFK A;  4WWM A;  1AWD A;  3ZYY X;  1ROE A;  3NVW A;  1JRO A;  1FXI A;  1DGJ A;  3VR9 B;  3AEC B;  1DOY A;  1WXQ A;  4YTP B;  4JX1 C;  2PVG C;  4IDI A;  5GXG B;  1FM0 D;  2BS2 B;  2WLB A;  1B9R A;  3AED B;  3VRB B;  5EE0 A;  3W9C B;  2M19 A;  1FFV A;  1RM6 C;  2QIE B;  3SFD B;  1IUE A;  4YSZ B;  2CJN A;  3AE4 B;  3AEB B;  1L6V A;  1L0V B;  1FFU A;  1KF6 B;  1N62 A;  2Y5C A;  2K22 A;  3P63 A;  5MPO A;  3AE3 B;  1L6U A;  5H8Y E;  2JQR B;  3WCQ A;  1QOG A;  1JW9 D;  4N59 A;  1WGK A;  3B2F A;  1GPX A;  1EWY C;  4JWU C;  1ZOY B;  2MJ3 A;  1XLO A;  1TKY A;  3DWG C;  1RYJ A;  1YJJ A; 
#chains in the Genus database with same CATH topology
 4NNJ B;  5KTQ A;  2B0C A;  1UUP A;  1WR6 E;  4L1B A;  4QZG A;  2JEI A;  3H4D A;  2UVV A;  5EE3 A;  1E6E B;  1F1H A;  2CXY A;  2C7H A;  3V61 A;  5J0W A;  2FPK A;  3L17 A;  2YVC A;  2WP9 B;  3TBL D;  3M9M B;  1K50 A;  3DHG C;  3W2D A;  2LBO A;  2KD1 A;  2JX5 A;  1WWV A;  5KT2 A;  8ICN A;  3L0W B;  3OLM D;  4A20 A;  4YTM B;  4NJ7 A;  4EFO A;  4DOC A;  1ZUD 2;  2FUG 1;  2LRW A;  2C7M B;  1T94 A;  2VIX A;  4J03 A;  2WTF A;  3QC8 B;  2MSN A;  1EO6 A;  2KV2 A;  3NG0 A;  4WQM A;  3CYM A;  7ICL A;  4FJY A;  4US8 A;  5BYQ A;  5IAA C;  4M04 A;  1RDF A;  2PFP A;  1L7M A;  3N7S C;  4K7U A;  4RNN A;  2LXC A;  3GII A;  4HPP A;  3VH3 B;  4F92 B;  4WJP A;  4M9G A;  1JWA D;  1SE2 A;  4PS3 A;  3L13 A;  4F5P A;  3Q8P B;  1BUI C;  5L1L A;  4M9N A;  3C21 A;  5J29 A;  1J7C A;  1J19 A;  1YT3 A;  2JT4 B;  1TT5 B;  2RPV A;  3SU8 X;  2WDR B;  3C1Y A;  1SL1 A;  1CJE A;  1WWT A;  4ZRP A;  3R7R A;  2KMM A;  1KFD A;  3EUB 2;  4O3M A;  2N9P C;  4BXO A;  1XD3 B;  5IO9 A;  1ZQF A;  4KGS A;  2C22 A;  3A1Q B;  2RHF A;  4BZA A;  5KG0 A;  5DBC A;  1QOB A;  1U4B A;  2D3B A;  2KO3 A;  2GRI A;  2W3R A;  9ICG A;  2LFI A;  1VZ6 A;  4ZRJ A;  4BOZ B;  1XNS A;  2WAQ F;  3PMN A;  2NCN A;  2V4I B;  4ANX A;  5DBB A;  4RQM A;  5JRT A;  4I2E A;  4KN7 A;  2WF6 A;  2PIA A;  1C77 A;  4ELU A;  4P0P B;  3M9O B;  1FO4 A;  2KMD A;  1MJD A;  4UAS A;  2FMS A;  3AQF A;  1HA5 A;  1RFK A;  4ED8 A;  3PVX A;  4F4K A;  4MEL A;  5IIL A;  2ZJ8 A;  5EWE A;  3EPI A;  1PGA A;  1WX9 A;  2KN7 A;  4J9R A;  1SJH D;  4A8X C;  3E2E A;  3ALB A;  2KC2 A;  3CMM B;  5K4L A;  3VC8 A;  4WJ3 B;  3ONN A;  1QQ7 A;  4O3R A;  4O0I A;  2LVQ A;  1WJ4 A;  2BPG A;  4PZO A;  3W9C B;  1YQB A;  5BYS A;  1WRD B;  2AXT U;  3PSI A;  1CQV A;  2W8L A;  2LM1 A;  2YMQ A;  2A5U A;  1Z4O A;  2KFN A;  5C1Z A;  2IO0 B;  2EAP A;  1SXE A;  4QZF A;  4YG2 A;  3RR7 A;  1CMX B;  4PYZ A;  3Q3F A;  3RFZ B;  7ICR A;  4AJW A;  4Q43 A;  2F2A B;  4RQ6 A;  3BY4 B;  2W9A A;  2LVO A;  4ED1 A;  1X42 A;  2JQR B;  1Z5S B;  1S10 A;  1XU4 A;  4JB3 A;  4DF8 A;  5DB6 A;  5J0X A;  4NLC A;  3B0Y A;  2KDE B;  1C9F A;  2IYD B;  4W9C A;  2L8J A;  3PLV A;  2HMX A;  2K4H A;  5IA7 A;  3QXG A;  4I2H A;  3L4P A;  1OW5 A;  2O2V B;  1U45 A;  1YJ1 A;  2A19 A;  3RB0 A;  4YMN A;  9ICH A;  2HBM A;  4Y2Y A;  1HQR D;  2XIC A;  1WF9 A;  3H8W A;  4LZD A;  2BVC A;  4B95 A;  2KT7 A;  4DDI D;  5KFF A;  3Q3O C;  5KT4 A;  2KLC A;  3SEI A;  4KLH A;  4NWI A;  3V7L A;  4REZ A;  1YJI A;  2EKE C;  2LEK A;  4DL7 A;  2EAN A;  1HUZ A;  1X9M A;  2NBU A;  1ZRN A;  2C2E A;  1SKW A;  1RLF A;  2D2Q A;  5AIA A;  4LDT B;  1L5P A;  3RNC C;  1FPY A;  2KMC A;  1L8O A;  2G4D B;  1N5X A;  4IM2 A;  4NQL B;  2Y0S F;  4IQU A;  4O5C A;  4DFP A;  5JH5 C;  3QAQ A;  4I27 A;  1TAU A;  5KG4 A;  1LGR A;  1NK9 A;  4KLF A;  4K3B A;  1TY0 A;  5HHD G;  3EFC A;  5KFU A;  1L7Y A;  2L76 A;  3WK7 A;  8ICM A;  4R66 A;  2KDI A;  2XY5 A;  2JZB B;  3BQ2 A;  4RT2 A;  4UW9 A;  2BZF A;  2K5P A;  2KTQ A;  2DKX A;  3HJE A;  2K25 A;  3RNG C;  2KIV A;  1PUZ A;  2KDB A;  1ZQZ A;  2RP5 A;  3N28 A;  5ALG A;  4NJ6 A;  3F5E A;  4NLB A;  2PKO A;  4W9G A;  3U26 A;  5KT5 A;  2N9X A;  3NZS A;  1EF1 A;  1TS3 A;  5H2F U;  4TUR A;  2R61 A;  5AZH A;  1KW4 A;  3C2K A;  1PYW D;  1LXD A;  3QUC A;  2FNJ B;  4XGA B;  3U52 E;  2KHW B;  4LJO B;  1TYG B;  5IIM A;  1MVK A;  4F5R A;  1JUD A;  5AK6 A;  2NR2 A;  2IY0 B;  1KEJ A;  1UZX B;  5F9N A;  1MC8 A;  2VA3 A;  2BCU A;  1F9J A;  1D8Y A;  7ICT A;  2KNJ A;  3V6H A;  2QIL A;  3VAW A;  3KWV A;  1X9X A;  3PX4 A;  1E7U A;  3KVF B;  4YN4 A;  3C5F A;  3A1Q A;  4GGQ A;  4I2D A;  2B21 A;  1WCN A;  4OJ6 A;  1FEH A;  3N9Y C;  3RMK C;  2HCF A;  1RG6 A;  3MR2 A;  2FPM A;  1XC9 A;  1LKY B;  3RT3 B;  3WKB A;  3RUL A;  2Z7J A;  4NL9 C;  1C4P A;  4KKJ A;  2LYH A;  3JVZ X;  4C8L A;  4MH8 A;  1F2R I;  3V72 A;  1V85 A;  4XQ8 A;  1EWC A;  1KDH A;  5CP2 A;  4B0M A;  1K1S A;  2JHD A;  2K8B B;  2LJ5 A;  4DBG A;  1T0S C;  2ZJD A;  4FO6 A;  3H7P B;  4P0P A;  2KD0 A;  2XO7 A;  8ICE A;  1XO1 A;  9ICQ A;  1KLN A;  3I1Y A;  2DYB A;  1NZP A;  1ZDV A;  2KKV A;  1NK7 A;  1X9W A;  4ELV A;  1ZKH A;  1EU4 A;  1BNO A;  3PO0 A;  5IN7 A;  3K9P B;  4OJ5 A;  3T5L A;  1Y8R C;  2BCS A;  1XF5 L;  4UDU C;  4W9E A;  1TAQ A;  4RF0 A;  4UAR A;  4OVU A;  9ICV A;  3N7P D;  4YR0 A;  1EU3 A;  2Y9U A;  4EYH B;  4JIO U;  1I4P A;  2GMI C;  1ZQA A;  2JPH A;  1SGH A;  4J9S A;  4FHK A;  4MGI E;  4ACF A;  1DK2 A;  1IBX B;  3NUH B;  4MGK E;  7ICP A;  3R8B A;  3GS2 A;  2JXJ A;  1DOQ A;  2GLS A;  2RDH A;  4ECR A;  1QIL A;  3GP7 A;  4F5O A;  2MWS B;  1E8X A;  4DOB A;  2C28 A;  2NRT A;  4JK1 A;  3GQC A;  3QUB A;  1C4C A;  3AE1 B;  3R2I A;  4F5Q A;  2WDQ B;  5AUI A;  3RJJ A;  2CU1 A;  4GC6 A;  4JL9 A;  2O2V A;  3U30 A;  1E8Z A;  4C8O A;  5C5J A;  4GIV A;  1CK1 A;  3K4G A;  3PRM B;  4JWS C;  1AQ6 A;  3DBL I;  2M9N A;  4RQ4 A;  3EZ5 A;  2N1W A;  5AKJ A;  2WX0 A;  4DS5 A;  3IBE A;  2X38 A;  4DFD A;  5CTR C;  2NRZ A;  2K89 A;  4GDL B;  5DQI A;  2L00 B;  2CHZ A;  3ZIM A;  1QCK A;  1ZXI A;  4LDT D;  2WWZ A;  4BAX A;  1ZOL A;  1V97 A;  1Q5W B;  2HOQ A;  2E8P A;  2KN4 A;  2DLB A;  2KFZ A;  1CUK A;  2BQ3 A;  4J6I A;  3V7K A;  4JQW C;  4RGM A;  1D9D A;  1WI0 A;  4OW0 A;  5KFA A;  4RQ2 A;  3PRE A;  1H38 A;  4PS8 A;  1NJZ A;  5C23 A;  2O6K A;  1OQY A;  4UB1 A;  3WKA A;  1F52 A;  2WXO A;  2RMM A;  4I2B A;  2MBQ A;  4MAC A;  4URK A;  1QZE A;  3OGU A;  3V7J A;  2KMA A;  5BMG A;  4P0Q B;  2HSZ A;  1ZQT A;  2V0G A;  2KX0 A;  3FKY A;  3VH4 B;  1DOY A;  7ICO A;  4KX3 A;  2C9W B;  2PVG C;  2G5H B;  5ALJ A;  9ICX A;  3JPO A;  4JWM A;  3F2B A;  1E8Y A;  3MJ5 A;  4YVZ A;  5III A;  5DKW A;  3PNC A;  4OZB A;  4DL3 A;  1ENF A;  1RM6 C;  2L0F A;  3OHB A;  2IA6 A;  8ICU A;  2LM4 A;  3HT3 A;  2G0A A;  5ALX A;  4ED7 A;  3RJH A;  3EGR A;  4XC2 A;  2ZUC A;  1JWS D;  1TV9 A;  3JYU A;  4PT5 A;  4DFJ A;  3IVF A;  4F8R A;  1MQ2 A;  4R64 A;  1KRP A;  1PK1 B;  3OJ4 B;  4N59 A;  1NJW A;  4P4P A;  4DF4 A;  4YQW A;  4NY8 A;  5KL1 B;  1UNS A;  4TKN A;  3C28 A;  3DVG X;  1YJJ A;  4KX6 B;  3KUD B;  4D2K A;  3V05 A;  4ICV A;  5AUK A;  3PO5 A;  2Z59 B;  3V3X A;  1I4R A;  4RQ5 A;  2Q4T A;  4CF5 A;  1D5Z C;  1I4G A;  1LKY A;  5AI0 A;  3RD2 A;  4EEY A;  2FPL A;  4A8E A;  1H4R A;  3ZJV A;  4XX5 A;  2LYA A;  2XID A;  2ZJ5 A;  2WXK A;  5KFQ A;  4GMV A;  2IBK A;  1ZQK A;  2KG5 A;  1D3Z A;  8ICA A;  9ICR A;  8ICK A;  1JI7 A;  1R4N I;  4O3N A;  3Q69 A;  3WAL A;  4HJG E;  2PI5 A;  3H7P A;  3NJT A;  1XLQ A;  3AE8 B;  1MSW D;  4ZDV A;  2FMQ A;  1SIF A;  2GBM A;  3SAF A;  2BCQ A;  1FNV A;  1Q1O A;  3M3J A;  1WG8 A;  1IXR A;  3A33 B;  1OTR B;  4TV3 A;  2DHZ A;  1X6I A;  1F77 A;  3SV3 A;  1L3S A;  3AEA B;  4CYE A;  3SYZ A;  2YML A;  3RYT A;  3AE2 B;  2I1J A;  5DPS A;  1U47 A;  3Q3J A;  3P4Q B;  3K1R B;  3BDP A;  4NL9 A;  2HHS A;  3TSS A;  2J6S A;  1M94 A;  1OQR A;  4HK2 A;  4AYB C;  3H0L B;  1V80 A;  2LGY A;  1TZO A;  1RQN A;  4ZRI A;  1I35 A;  3OHA A;  1BPE A;  3TJP A;  1IBX A;  1K52 A;  2L7R A;  9ICU A;  1JML A;  2KDM A;  1XWL A;  1WGG A;  5J0O A;  1NKE A;  2PEA A;  1UA1 A;  4YP3 A;  2WQY B;  5KAI U;  2ZVN A;  4HXD A;  4AYB F;  2VZK B;  2AWT A;  1QQ6 A;  3M63 B;  5DCN A;  2GBR A;  3N32 A;  3SAH A;  5J2I A;  3N30 A;  3NUQ A;  3HWT A;  1VCB A;  3RRH A;  4XYC A;  1ED1 A;  1L7P A;  4MEY A;  5DG8 A;  1ACC A;  2GI9 A;  4TUP A;  3DBH I;  2KSO B;  3MHZ A;  5CWR A;  2Y9T A;  3ZTD A;  2AQ4 A;  4JV2 A;  1JWM D;  4MGZ E;  5JUM A;  2AEH A;  3VTU A;  3AUO A;  3AU2 A;  4ZRK A;  1COK A;  2A1J B;  5E6P A;  1WXQ A;  5AM2 A;  2BQR A;  4GDL A;  3NZU A;  1MFW A;  2OEH A;  4I2F A;  2NMQ A;  4MSM B;  4KVG B;  2MSE D;  4YR2 A;  3G6V A;  4FBJ B;  4WWO A;  4KN4 A;  1S97 A;  5HHH A;  2ALZ A;  4PHA A;  3NTU A;  4EZK A;  3HK0 A;  2CJN A;  3RF9 A;  5EWG A;  1RXV A;  1Q8K A;  2KP7 A;  1ZQQ A;  4MT5 A;  3KBB A;  2NBW B;  1ESF A;  1GC6 A;  2KJ6 A;  3L10 B;  2LXA A;  4YWG G;  5AM1 A;  5H8Y E;  3ZRF A;  4PL1 A;  4UAW A;  2JH7 A;  4PGY A;  5BOM A;  2E1E A;  5KFS A;  1WGK A;  1WX7 A;  2DZM A;  2HHT A;  3VUX A;  5ALS A;  4JUZ A;  2PE9 A;  4AWJ A;  4P0Q A;  4W9J A;  4LJX A;  9ICI A;  4ZHO A;  1C1Y B;  1UWM A;  3I63 C;  1WWU A;  4H2A A;  1WE7 A;  5AK4 A;  2B6G A;  5CHW A;  2L83 A;  4MF2 A;  3ZDA A;  1P7E A;  3PS6 A;  4MFC A;  5AM0 A;  3P2B A;  1KLU D;  1WGY A;  2GWS A;  2AX5 A;  2L1A A;  2RDB C;  1S8O A;  3AE5 B;  3W5U B;  1F2R C;  4N6E B;  2H5X A;  1YD8 U;  5IIJ A;  2BS3 B;  4DSK A;  2KJ9 A;  2JYT A;  3PW5 A;  2NYV A;  4EEN A;  1FEZ A;  3UXP A;  3PW7 A;  3ZGZ A;  4C7Y A;  4QWD A;  1NK5 A;  2KQ7 A;  3RNE C;  4Q45 A;  5J0Q A;  2MA1 A;  3VXW A;  2PFQ A;  1AAR A;  2KFJ A;  2WF9 A;  1YZ6 A;  3D2Q A;  1PK1 A;  3P4R B;  1L6N A;  4IQV A;  4PHE A;  2YTU A;  1NKC A;  3LJ3 A;  3BQT A;  3U4E G;  2FI1 A;  5ALK A;  4TSS A;  4GLX A;  4UAU A;  5DQG A;  2Z8L A;  2F44 A;  4J9Q A;  1ZQN A;  4W9F A;  4TQ0 A;  5HNK A;  3M8S A;  5ALO A;  2W9N A;  4KIK B;  2MP2 B;  2RSU A;  4DEZ A;  2DAF A;  4QAY A;  1X1M A;  3IHP C;  1WYG A;  4IKG A;  3RFA A;  5KG7 A;  1HJP A;  2M0N A;  1VDV A;  2MEK A;  3A9J B;  2OWO A;  1H8C A;  3R3M A;  3TFR A;  4TQR A;  2GO7 A;  1FIQ A;  1S77 D;  2M56 B;  4YXD B;  2H88 B;  2PMV A;  3I76 A;  2W04 A;  4LCD E;  1NOM A;  4HJK A;  4XDD A;  2PE6 B;  5C2T B;  1HE8 A;  5IOI A;  1PFD A;  2G45 B;  1KJT A;  2FE8 A;  1UF0 A;  3H0R B;  4GFJ A;  2YX8 A;  4AJY B;  2MAX A;  1WJN A;  3T5K A;  1QQR A;  4GXJ A;  1WM2 A;  2BYT A;  2BT6 A;  2GBN A;  4WQO B;  4GOC A;  3GV7 B;  2MRP A;  2MH7 A;  1PK3 A;  8ICB A;  2AL6 A;  2V3S A;  3QYP A;  4ECQ A;  2QJL A;  3PST A;  1QTM A;  1XQQ A;  2I9G A;  1VJ5 A;  3KYC D;  2XCP A;  4HDO A;  3MC0 B;  1MPE A;  3Q8Q B;  4IOI E;  4QWC A;  9ICW A;  3CW2 C;  1MG4 A;  3Q8K A;  2F77 X;  3MAB A;  2WX1 A;  4IW0 A;  4K81 A;  5E6O A;  4W9I A;  2WXM A;  2WHE A;  5KFM A;  3EA6 A;  4RH6 A;  2VZK D;  5KFI A;  5ALR A;  4WUR A;  4DCC A;  3IT4 B;  2GB1 A;  8ICI A;  3DBL B;  2IMW P;  3PO4 A;  1KF6 B;  1TGZ B;  2V9H A;  4WWP A;  4LNK A;  5MPO A;  2KHV A;  5IIK A;  4L23 A;  4XDC A;  4I6P A;  1KFT A;  1JW9 D;  2OH2 A;  5KT7 A;  1BT0 A;  4ECW A;  3B2F A;  2KSO A;  4PL2 A;  1ZOY B;  2MJ3 A;  3DWM A;  3PGE A;  1MHX A;  2C2D A;  2WXQ A;  2EZY A;  5FKA C;  3UQB A;  2A1J A;  1FXT B;  4M0A A;  1ZQU A;  3VRA B;  3MR3 A;  3OTQ A;  1E0Z A;  2RPQ A;  2K8C B;  5AKK A;  3B0A A;  3QEB Z;  4UB4 A;  4F7Z A;  2EMS A;  3AEF B;  4BDP A;  2PMZ F;  5KG1 A;  2JGA A;  4CF3 A;  3FYH A;  3HUI A;  1GAQ B;  2H3Q A;  2ACZ B;  3MR5 A;  4PS7 A;  4KMU A;  4I2A A;  3VUW A;  2CU3 A;  5BOL A;  1PGB A;  2MQJ A;  1HEK A;  5EOZ A;  1RRB A;  2WB1 F;  4FXC A;  1UHU A;  5J0R A;  2NRW A;  1K5O A;  2I5H A;  2HOI A;  1WFY A;  4F5N A;  2GOW A;  3RJI A;  2KZZ A;  7ICU A;  5CJ7 A;  3APC A;  3M8R A;  1SIJ A;  2PVO D;  2IGH A;  4WAF A;  5EE1 A;  4C0Z A;  2VRR B;  1GC7 A;  4QZI A;  4BUG A;  3TMP B;  2J42 A;  3IV6 A;  2WU2 B;  4ZYN A;  3EFU A;  1KQQ A;  3VUY A;  3L08 A;  3HRD D;  3H7I A;  3NS8 A;  4G50 A;  4NLK A;  3AEE B;  4RNO A;  3N4M B;  3P1M A;  3H8H A;  5DQH A;  3BZD B;  3M62 B;  1NI3 A;  2GH1 A;  3H8S A;  3UMC A;  1NVI D;  4Z6F A;  3MDC A;  3QQ8 B;  1J7B A;  2KOX A;  2KJR A;  3PSE B;  4DL6 A;  3C29 A;  1L5U A;  1AYF A;  1ET9 A;  1X6J A;  2WXF A;  1ZQH A;  2FLN A;  2TSS A;  4ECV A;  3BZK A;  3ISB A;  1E10 A;  3GV8 B;  2W55 A;  3ZQ4 A;  4DK5 A;  3LVV A;  1RQL A;  2QLT A;  2KAJ A;  1ZQJ A;  1SEB D;  2KYW A;  3RCZ A;  1SE4 A;  5KFO A;  2I2Y A;  1JXE A;  2HI0 A;  3SR6 A;  2K1F A;  2MP2 A;  5CX3 A;  3LWM A;  5J2R A;  2Z0D B;  3CP8 A;  2Y1J A;  1Z1V A;  2HJ1 A;  4MM3 B;  1EXN A;  3GU3 A;  1IGD A;  4CGZ A;  2HVI A;  3AI5 A;  1XS9 D;  3A9J A;  3HKZ C;  3H40 A;  4GB9 A;  1BML C;  2WF7 A;  1R4N B;  9ICA A;  2MBH A;  2BGW A;  4B9M A;  5KFB A;  1UBI A;  4JX1 C;  3M1Y A;  5ALL A;  1O03 A;  2L5Y A;  4MDK E;  4ICA A;  4OHJ A;  4CE6 A;  5EE0 A;  1B4F A;  4OD0 A;  4B9T A;  3DOW A;  4EBD A;  3BJY A;  2ZNV C;  4HCN B;  4R8U B;  1F0M A;  2NBV B;  3W1S A;  2KKP A;  1L0V B;  2G4S A;  2QDF A;  2PKE A;  2XVT A;  3MR6 A;  2SEB D;  1C3T A;  5AKX A;  2D11 A;  4B9S A;  4O3Q A;  4DSI A;  3APD A;  1J2N A;  2RDI A;  1VZ7 A;  3AU6 A;  2L32 A;  1KL9 A;  4UAY A;  4KLL A;  2MLB A;  3N1X C;  1XLO A;  2ZTC A;  7ICV A;  2BR0 A;  1LFD A;  1TK0 A;  4AP9 A;  1V8C A;  4LTU A;  5AKH A;  3EWA A;  3GIL A;  3T9L A;  3QK0 A;  3UPQ A;  2XY6 A;  5DB7 A;  1U49 A;  2QB1 A;  4F72 A;  4XRH A;  2WXR A;  2ZNV B;  2XBB C;  3V6E B;  1AN8 A;  1T3Q A;  7ICI A;  3JSV B;  4Y2P A;  3RTV A;  5AM4 A;  1T6B X;  3DBH B;  3ML9 A;  4YMM A;  3AU5 A;  2KJ8 A;  4XA5 A;  5L1I A;  4RPY A;  1IP9 A;  1WXM A;  5KFP A;  1QLN A;  1N61 A;  3V62 A;  4UAV A;  1WR1 A;  2EZX A;  2VKQ A;  5AM5 A;  3JPQ A;  7ICM A;  3DCG A;  5D3D A;  2FE9 A;  2DKZ A;  4K3C A;  3H4B A;  3PW2 A;  2ESE A;  4EUT A;  5J2B A;  4KLG A;  3RJE A;  3FDS A;  1OFF A;  2ICI A;  2K8C A;  2LAS A;  5CB1 A;  3QA8 A;  4NLG A;  2EEL A;  2KJ5 A;  3TKA A;  7ICS A;  1D6E C;  2MBB B;  3KH0 A;  5ALP A;  5BPC A;  4ACO A;  5AK3 A;  5KG3 A;  2ATL A;  1SBB B;  2ZEQ A;  3E56 A;  2WF8 A;  1K1Q A;  1MQ3 A;  3TIX A;  5AKZ A;  1BPZ A;  2BKR B;  3BS5 B;  2WXG A;  3DEE A;  2QB0 B;  4HKZ E;  4NAW B;  2AYO B;  2WNM A;  2DNF A;  2I38 A;  5AKL A;  3OWE B;  4ZYS A;  4NLN A;  3F5A A;  4K1R B;  1P3Q U;  2JSV X;  4F93 B;  5AKE A;  2K4I A;  2HBJ A;  2KK0 A;  2J6T A;  3EEC A;  2BB6 A;  3U8Z A;  4YD2 A;  4MEX A;  3A0B U;  2KAC A;  3NY5 A;  4P7I A;  5LXI B;  1L4D B;  1QOA A;  2CR5 A;  2XN9 C;  5ALF A;  2M8S A;  2MU2 A;  2NO5 A;  1IG6 A;  1R4M I;  2N9K A;  4PZN A;  3AV8 A;  4JWN A;  3QEA Z;  1PQS A;  3C2M A;  1VD2 A;  2BGF A;  2RLT A;  2L3Z A;  1N48 A;  3QIJ A;  1D5X C;  5KFZ A;  3K1Z A;  4B9U A;  3TAQ A;  2CKH B;  3C5G A;  1ROE A;  1DGJ A;  2BPS A;  4MGY E;  4XE0 A;  1DXS A;  3HX0 A;  1RYS A;  3CNH A;  1SKR A;  2OCE A;  4Y2X A;  5D94 A;  1ZXH A;  3P42 A;  4EEK A;  1FM0 D;  5HG2 A;  3RH4 A;  4F50 A;  1YN5 A;  5J2C A;  2YMP A;  3KFU F;  2DPJ A;  2EAM A;  2M19 A;  1NBF C;  1T7P A;  4IRC A;  3L54 A;  2BHN A;  1A77 A;  4C8N A;  4M8M A;  4ECY A;  4B9V A;  1C76 A;  3AE3 B;  5BO4 B;  1L2N A;  5AI4 A;  1QOG A;  1YZ7 A;  1T5X D;  2MHJ A;  4MM3 A;  5J2D A;  1XXG A;  1EWY C;  4JWU C;  4M47 A;  2NO4 A;  8ICX A;  2NVU I;  4DHJ B;  2DUY A;  3AE6 B;  3BQ0 A;  3FIL B;  2K8H A;  2OM6 A;  2YMM A;  4Y2V A;  1NK0 A;  5KFY A;  1ET6 A;  2MJD A;  2KDF B;  4HEA 1;  1JX4 A;  3RN9 C;  1CZP A;  3EHV A;  4CCH A;  4GSW A;  5KFC A;  1ZQD A;  4PPX A;  3QZ7 A;  1SSN A;  2G07 A;  3VTV A;  5F3X B;  3DHH C;  1FXA A;  4XWW A;  5J0Y A;  4R8U A;  2H3I A;  3KW5 B;  2AHO B;  4QIW C;  4QZ8 A;  4II3 B;  1Z2M A;  1TS2 A;  2YQE A;  5ALY A;  5DDM A;  3IHQ B;  4K4H A;  7ICJ A;  1ZQY A;  4R63 A;  1YNT E;  4ANW A;  2DZJ A;  4ELT A;  1X9S A;  1MN8 A;  1YQ4 B;  4LNF A;  4DSE A;  4YCX A;  4I6L B;  2WHI A;  3E0F A;  2KZ3 A;  2QMT A;  5H92 C;  1ZET A;  3O13 A;  2AQ0 A;  4P4M A;  5JXV A;  1SV0 A;  3RNF C;  2N9L A;  4GXB A;  2OYY A;  4Q2J A;  4DL4 A;  2UWQ A;  1L8L A;  1GJZ A;  3DHI C;  3LB8 C;  4R3D A;  2I1Q A;  1PUT A;  2LUE A;  4C00 A;  1ZD2 P;  1FCL A;  1TKG A;  2JEJ A;  2KTR B;  4M9J A;  3R2T A;  3PZD A;  2KWD A;  2UVR A;  2WDV B;  9ICO A;  2R18 A;  3RI7 C;  3TAD C;  2QEJ C;  1QT9 A;  4KLJ A;  2HBL A;  1VR9 A;  3JSV A;  2BBC A;  2QCZ A;  1ISN A;  2OHF A;  3DBR I;  4GLS C;  3IG8 A;  1A6S A;  4HRS A;  4EZL A;  4FJZ A;  1F44 A;  2ZUB A;  1M6Y A;  4F2S A;  3RH6 A;  2FIF A;  1JWU D;  3L3F X;  3G6Y A;  3OSN A;  1GOZ A;  1LO5 D;  2W8K A;  1E90 A;  4DSL A;  2IZV B;  1DOX A;  3CF6 E;  3R9K A;  4EX7 A;  4I2C A;  2FDR A;  3TAC B;  2BKF A;  4J9N A;  3LDZ E;  4P4O A;  3WAO A;  2KOB A;  1XCQ L;  3ENE A;  5AKY A;  4LK0 M;  1A5R A;  1ZQI A;  3CST A;  2IO3 B;  5D3I B;  2XGP A;  4NXZ A;  1QSL A;  3QX1 A;  5HMM A;  2ASQ A;  3GDX A;  1J97 A;  2W7P A;  4K4G A;  4QZD A;  1DYQ A;  2PW9 A;  5L83 A;  3ED5 A;  3BS5 A;  2BS2 B;  4NAW A;  2Q0Z X;  2QB0 A;  3GIJ A;  5DLF A;  4KLS A;  3ZO5 B;  3RRG A;  3SV4 A;  2DGZ A;  1QH9 A;  2FCQ A;  2J6U A;  1WGH A;  2KHQ A;  9ICK A;  1WE6 A;  4TQ1 A;  9ICF A;  2KZR A;  3N3K B;  4A55 A;  1Y56 A;  2ZCB A;  2R8I A;  3DQV A;  2IOF K;  3ZTC A;  1SXD A;  2JRH A;  4Z6D A;  1NK6 A;  3U7D A;  2JXT A;  4KSK C;  1L0Y B;  2FCN A;  2JZB A;  5J8Y A;  2E5S A;  4G3I A;  1RPL A;  4C8K A;  2H89 B;  5DGA A;  1V9J A;  4US9 A;  2LVP A;  4P6V F;  4GXK A;  5HI1 A;  4UB2 A;  1QKZ A;  3DVN V;  2XI9 A;  3RH5 A;  2JY6 A;  4Q8F A;  4CO7 A;  3ONS A;  5D2M B;  3OPX A;  5ALZ A;  2EKI A;  1ZQ1 C;  3NVZ A;  3IXS A;  1ZD5 A;  2RGF A;  2DQN B;  2EAO A;  1UPH A;  2JH1 A;  3UIO B;  4NQK E;  1L3V A;  2W03 A;  2BKE A;  2JEG A;  2KK8 A;  3QCA A;  4DHJ D;  2KE7 A;  4I6N B;  4NJC A;  4OZC A;  1FD6 A;  3X23 A;  4QW9 A;  1ZDX A;  3DV9 A;  3FIL A;  5KFV A;  2MUT B;  3NRZ A;  4OJP A;  2ISP A;  1ZD4 A;  1C20 A;  2BS4 B;  1Z00 B;  2F1J A;  4NV0 A;  2V4Q A;  4YSX B;  3LVW A;  5CHF A;  1JCK B;  3ZNH B;  4RQ8 A;  1ZPS A;  4X57 B;  3PV8 A;  3Q6B A;  1URJ A;  1WYW B;  3HW8 A;  3HP6 A;  4ICU A;  1TFR A;  1PVQ A;  1YOV B;  5L1J A;  2BPC A;  2NRX A;  1GB1 A;  2HDE A;  4FFD A;  1LV5 A;  2K8B A;  1JRP A;  2LGI A;  4KDL B;  5ALW A;  3KLS X;  4II2 B;  1ECW A;  4EX6 A;  1XO0 A;  1IV8 A;  2LZ6 A;  4PYU A;  8ICP A;  4LNO A;  3QZ8 A;  2MA9 B;  1S0O A;  4ARC A;  5KFR A;  1Q0W B;  3TEY A;  3N7R C;  2DBY A;  2G9H D;  2LPE A;  1Q10 A;  3PZ7 A;  4QZC A;  4B0E A;  4AQ7 A;  2AGO A;  1TK5 A;  4KLQ A;  4DQS A;  2KTR A;  5LNK 1;  3EC8 A;  3MHS D;  3SHQ A;  8ICY A;  4M0W B;  2E8M A;  1TVA A;  8ICO A;  3MC8 A;  2J52 A;  1ZW7 A;  2YN4 A;  1ZQW A;  3IFW B;  2AQ3 B;  3JPR A;  3OG5 A;  4HCP B;  4XZ4 A;  3AED B;  2IOH A;  4F4W A;  2AGQ A;  1WH3 A;  5KFW A;  3A4R A;  4BBN C;  4RQ0 A;  2ZTE A;  2K39 A;  5C0Y A;  4P1C C;  3SFD B;  1V9P A;  4UBB A;  1NDD A;  1S5L U;  3R7Q A;  2KXJ A;  4EZ6 A;  3AE4 B;  1LM8 B;  1L6V A;  3KKA A;  3H1U A;  4EKU A;  3HM6 X;  1TY2 A;  4QWA A;  4IL6 U;  3ZD9 A;  1HUO A;  2BCV A;  2EMT A;  3IT6 B;  2WDT B;  2HOF A;  1C78 A;  5AIB A;  2FAZ A;  4I2J A;  3TAD A;  3NZ3 A;  1A0P A;  1HZ5 A;  3UF8 A;  1UGM A;  1F5S A;  4TQS A;  3N20 C;  5D7G A;  2IDY A;  1WXS A;  3NOB A;  1OGW A;  4HDQ A;  4IWP A;  3PT2 B;  1I4X A;  2ZW0 A;  2JMG A;  3SFE B;  3BQ1 A;  4Y2R A;  4FAD A;  4RUA A;  3ABV B;  2KFK B;  3NS1 A;  1QLB B;  3DBS A;  4J3O D;  4HRO A;  1SZH A;  2RRD A;  3KYD D;  1QSS A;  1WGR A;  3RJG A;  1R4M B;  2LWP A;  4RGT A;  5DB8 A;  3I9V 1;  5ALH A;  5T14 A;  1HZ6 A;  2DYM A;  3I3T B;  5GMV A;  4JGH B;  8ICR A;  3ALR A;  4FLH A;  2YEP B;  5G5H A;  4KLI A;  2VA8 A;  2FID A;  3KD3 A;  3DDC B;  1P98 A;  2H3V A;  1XO3 A;  3NGD A;  2LHT A;  2O6V B;  5KFK A;  2KEY A;  2M0A A;  5A0L A;  1Q3U A;  4C4R A;  3KWL A;  3ETR A;  5BYR A;  4ECT A;  3KZI U;  3PW4 A;  4RUC A;  3AU4 A;  4B9K A;  4G9B A;  4UBC A;  2N9E B;  3PRZ A;  1A70 A;  2W11 A;  1EUV B;  2NS5 A;  2BB5 A;  1YQ3 B;  2K8A A;  5KG5 A;  1K8R B;  1CEZ A;  1CRX A;  1P7D A;  5FR3 A;  2DZK A;  2LUM A;  3RJK A;  2ZIU B;  4HYK A;  4AOF A;  2ZUD A;  4OJL A;  3N97 B;  4N58 A;  4F91 B;  2V4L A;  5CR0 A;  3VVW B;  4YSY B;  3Q8C A;  1SV4 A;  3ZNG C;  4WWN A;  3PZP A;  3BK2 A;  1ZRM A;  1NK4 A;  1P0R A;  8ICL A;  5J2H A;  1FRD A;  2BWF A;  1V6E A;  3H7S A;  1EF5 A;  3ETL A;  3W1S C;  9ICJ A;  4NJ8 A;  1GG3 A;  1HEZ E;  2MUT A;  3VCB A;  1YMH E;  7ICQ A;  2IO2 B;  2HJ8 A;  2JZ3 B;  1Z00 A;  3FAH A;  3A4S C;  3H9D A;  4KZ0 A;  2ZIV B;  7ICK A;  1YX6 B;  5G2N A;  2YLM A;  4YR3 A;  1KLV A;  4C4S A;  4RQ3 A;  1AWD A;  1O08 A;  2E1F A;  3SEB A;  3NVW A;  4I28 A;  2ZXH A;  2ZJA A;  4DLG A;  4NY0 A;  4HLE A;  1T3N A;  2INC C;  1SZP A;  3D6J A;  5GXG B;  3UI3 A;  8ICZ A;  3C2L A;  2RD0 A;  4JE3 B;  4AUQ C;  3C19 A;  2DX5 B;  2LGX A;  4GDK B;  4UAZ A;  4ED3 A;  1XSP A;  1IIP A;  2PI4 A;  2K4E A;  1FFU A;  1M4V A;  2F1I A;  5L1K A;  3WU2 U;  3ICX A;  3ZJT A;  3I28 A;  3ISC A;  3V6K A;  2AJQ A;  3DBR B;  4ZRQ A;  3JPT A;  4C4V B;  3DWG C;  1TKY A;  3Q8R B;  4R65 A;  4I2G A;  4YXM A;  4M0W A;  4HPM B;  1WSP A;  5ALM A;  1GUA B;  2LGS A;  8ICT A;  3GIM A;  4RFB A;  3V60 A;  4E74 A;  1NEN B;  3RB3 A;  3NVV A;  2CRX A;  3ZRC A;  3ZDC A;  4KDI C;  4PGX A;  1MG8 A;  3AE9 B;  4HAI A;  4MHV A;  4KLU A;  1TS4 A;  3BII D;  4ZOH C;  4IRK A;  5HP4 A;  3NHE B;  2G08 A;  3Q2A C;  4HWI B;  4E3C A;  4YFK A;  3PML A;  4IS7 A;  3ML8 A;  4DOA A;  3WKE A;  1TE2 A;  3Q8F A;  3UMG A;  2ASL A;  2G09 A;  2GOL A;  3PY8 A;  3GZN I;  4F1S A;  2PPH A;  3UXO A;  1Z1B A;  1F0Z A;  4FS2 A;  3RUI B;  4S17 A;  2JV3 A;  3AE7 B;  2PFO A;  2OXO A;  1NK8 A;  4FBU A;  5J0P A;  2Y3A A;  2XY7 A;  1HIW A;  4GC7 A;  4QWE A;  4GN1 A;  4IC9 A;  1I42 A;  2IHN A;  3ZDB A;  2BDU A;  5GTH U;  1SJE D;  4W9H A;  1RWS A;  4P16 A;  3LYY A;  5AK5 A;  2K60 A;  3Q8B A;  2QAR B;  3GZF A;  2HHU A;  5IP4 D;  1RFA A;  5FK9 C;  2HHW A;  2E3T A;  1YX5 B;  4GIB A;  2MCN B;  1SF0 A;  2BYE A;  3PVL A;  2KFK A;  3QAR A;  2LJI A;  3IDW A;  2KKC A;  1E7P B;  2WU5 B;  4QW8 A;  4IWO A;  4LNI A;  3ZNI D;  3UXN A;  2N1R A;  3KTQ A;  3MTN B;  4YT0 B;  4RQ7 A;  1RYR A;  2O6V D;  5AI6 A;  4C7Z A;  5KFJ A;  3V6J A;  5KHO A;  3QU2 A;  3TAP A;  1S1Q B;  2BW2 A;  4MJS B;  2W43 A;  5KFG A;  3ISD A;  3EPG A;  5HHI A;  5I4D A;  4IR1 A;  2W9B B;  3PLU A;  4W9D A;  1WZ0 A;  4QWB A;  2RR9 A;  3K9O B;  1NEK B;  1NI2 A;  3TCA A;  5KFX A;  4GXI A;  5BMI A;  3RNB C;  1GB4 A;  4Z6C A;  2YY6 A;  1C4A A;  3NAS A;  1SB3 C;  1WIA A;  2WS3 B;  5EDS A;  1BXT A;  2AGP A;  2P6U A;  2J0K A;  2NV3 A;  2KLG A;  5T8I A;  2KVZ A;  4F8C B;  4RMA A;  3N1Y C;  5ALT A;  1N6Z A;  2ZIU A;  3KHH A;  2H3Z A;  4O3O A;  2LMR A;  2CS4 A;  1RZT A;  2MX2 A;  3RB6 A;  2P35 A;  3KOO A;  3BVZ A;  3URY A;  4QJF B;  4EEL A;  3TAN A;  4P2H A;  5CHV C;  4G0N B;  2JU6 X;  3TUO A;  4EZJ A;  3O0F A;  4DS4 A;  4JLC A;  3MGH A;  3T3F A;  4EOY A;  5AKG A;  1HTQ A;  2KAN A;  1IYF A;  1V38 A;  4DWF A;  4KGT A;  4KIK A;  4RQN A;  2FCM A;  2IBI B;  4IM3 A;  2YB4 A;  3O65 B;  2ZIV A;  2JWU A;  4DL5 A;  2PJH A;  3MC9 A;  4KZC A;  4NAM A;  4HVB A;  1SWW A;  4UB6 U;  2F8K A;  2QKQ A;  1UT8 A;  2FLL A;  1TK8 A;  3IG3 A;  3J9C A;  1SV0 C;  8ICC A;  2KVS A;  3SEN A;  4X5V A;  4KLE A;  5J17 A;  4EYI B;  3D32 A;  1FNW A;  3OJU A;  4RPZ A;  4KLT A;  3D2S A;  4N9F 4;  3RB4 A;  4ED6 A;  5GTI U;  4FZM A;  2V3N A;  1T4G A;  5J0U A;  9ICS A;  2PTL A;  3C23 A;  4Y2U A;  3AEG B;  3HKZ F;  1BPD A;  3AQE A;  5HR7 A;  1I4Q A;  1V2Y A;  1JAL A;  2FBW B;  2WXI A;  2FLP A;  3ZI4 A;  1D8L A;  2K0P A;  4UB8 U;  3JPP A;  5CA7 A;  4GDK A;  3F2C A;  5TSS A;  2B3A A;  2G06 A;  4QZA A;  5AI9 A;  2WAQ C;  4K7S A;  1ZQS A;  1KFS A;  2JZP A;  3FM9 A;  4B6J A;  1NYR A;  3MP9 A;  5C3J B;  4NM2 A;  3IRU A;  3Q3M C;  5EE9 A;  4ANU A;  3RZF A;  4FZL A;  3EYZ A;  3ZJU A;  4ED0 A;  5G5G A;  2FMP A;  4C4V A;  3ZUN A;  2KTF A;  5IIN A;  1R7S A;  2JZZ A;  2ASJ A;  4KIT B;  1ARO P;  1ZE3 D;  1SE9 A;  4IUM B;  1B0X A;  3L16 A;  2ZPY A;  1VJK A;  4J9O A;  3QUQ A;  4PH5 A;  1ZQR A;  2UVU A;  3UM9 A;  1E5W A;  2JVC A;  1ZJM A;  3BVG A;  7ICG A;  4HKQ A;  4W9L A;  1KTQ A;  4CDG A;  1NYQ A;  1C79 A;  1JQ4 A;  1RXW A;  3ZD8 A;  1HXY D;  2F1H A;  4KMO B;  2XEW A;  3WKD A;  3TI0 A;  3IG5 A;  4EBC A;  2N4F A;  1Q46 A;  4MFF A;  2ES6 A;  1MA7 A;  3QWZ B;  3AN1 A;  1S9F A;  1ZQX A;  3SZ2 A;  4KTQ A;  3RPF C;  2V1Y A;  5DBA A;  1JIH A;  2WXL A;  4GU2 A;  4WJN A;  4KGR A;  3SD7 A;  2K9X A;  4G3X B;  2JR5 A;  4C80 A;  4PK1 A;  2QAR A;  1T0Y A;  3WAP A;  4QZB A;  3C8Y A;  3H6N A;  4BWM A;  4QNL A;  1A76 A;  2WF5 A;  3MDA A;  1QOF A;  3RZW C;  3J81 j;  3BWU D;  2VAN A;  4KLM A;  1TAM A;  4KKI A;  2BCR A;  1S0N A;  1FNU A;  1Z19 A;  4K7W A;  5J8Y C;  4DFK A;  3NRW A;  4YD1 A;  1BGX T;  2EDU A;  3AEC B;  3LK9 A;  4DXF A;  4NPN A;  4PGQ A;  3VRB B;  1BNP A;  3PTF C;  3ZDM C;  4MJS A;  4BKT A;  4M8N A;  1NJY A;  5KFL A;  3WK8 A;  4QZH A;  2W9B A;  2ASD A;  2L0T A;  2EQY A;  4CNQ A;  1D9F A;  2UVW A;  1IUE A;  1V86 A;  5ALI A;  1XSL A;  2KQ4 X;  4YSZ B;  3MFI A;  2NTS A;  4DSJ A;  4RGN A;  9ICE A;  2Y5C A;  4U7C A;  4RQ1 A;  5J2A A;  2WXJ A;  2Y0S C;  2C5L C;  4PHD A;  3T5J A;  2LI6 A;  2ON8 A;  3EW9 A;  2N7D A;  1TS5 A;  2V4R A;  3MFH A;  3QUT A;  5EWF A;  1E8W A;  1OEY A;  1XCT L;  4DXG A;  1XSN A;  1RYJ A;  1SKS A;  2KX3 A;  1T0R C;  4IM0 A;  5ALU A;  3QU9 A;  2XNA C;  4KSL C;  5AZG A;  4FUL A;  4ARI A;  2CPR A;  2DF4 B;  3QNM A;  3AXC A;  2W9C B;  1D4B A;  4KX5 A;  1J2M A;  4ASW C;  1CI4 A;  1N63 A;  5J2J A;  2C7N B;  1ZQP A;  5AI5 A;  3GE3 C;  1C7Y A;  3UMB A;  5KT6 A;  3I57 A;  9ICP A;  3VDZ A;  1UT5 A;  2DYO A;  4TMA B;  5KHQ A;  1WJ6 A;  1WM3 A;  2MW5 A;  3PW0 A;  4M6W B;  3N1Z C;  3SD5 A;  3NVY A;  1S0V A;  3ZDD A;  4WAA A;  3QU5 A;  3DPD A;  2LHD A;  9ICT A;  3P4S B;  5JU5 A;  4ECU A;  1ZQM A;  1X66 A;  2BDP A;  4ZHP A;  5BMH A;  4ECX A;  2HDO A;  3BIN A;  3U7Z A;  3C1Z A;  4I29 A;  4M9L A;  3PRP B;  2R8G A;  1N5W A;  5AIC A;  1DK3 A;  2OED A;  3B08 A;  1BPX A;  1TKE A;  1X40 A;  2WXP A;  3SMV A;  4DWI A;  4RPX A;  4J9M A;  4QZE A;  4JMU A;  1GO3 F;  1N60 A;  4RGO S;  5D6J B;  4Y2T A;  1QF6 A;  9ICC A;  4OZA A;  2IO1 B;  5E6N A;  3HVD A;  5KG6 A;  3X0W A;  1ZQE A;  2BYV E;  2Y5B B;  3IAS 1;  3U2S C;  2HTH A;  3ZDE A;  2KJH B;  3AL0 B;  2FJ6 A;  2M1M A;  1PVP A;  2B76 B;  1WGD A;  2J0M A;  2E8N A;  4IG7 B;  1WRI A;  2IY1 B;  2D3A A;  2J53 A;  2JWZ A;  2Q5W D;  5JTI A;  2M17 A;  1D5M C;  3ZXV A;  1JRU A;  4CQN A;  1U48 A;  5AM3 A;  2F8L A;  2LYB A;  2D10 A;  2GLE A;  1L7N A;  3TFS A;  3W5V B;  4RNA A;  3WA0 A;  1UBQ A;  4P1B C;  4AP4 C;  5HKH A;  4QIW F;  1Q3V A;  3KKA C;  3F2D A;  1VZ8 A;  5J0S A;  1PGX A;  2LGD A;  2LI5 A;  5HML A;  5KAF U;  1WXA A;  3OJ3 A;  3P4P B;  4OVZ A;  2VH1 A;  2V3P A;  3L5K A;  3JPS A;  3TEZ A;  3G6X A;  3M6K A;  2RDG A;  4RU9 A;  3GV5 B;  3KHR A;  3E9S A;  4FE3 A;  2Z0E B;  3GZN B;  3KQ4 A;  3UIP B;  3GB1 A;  4IC7 B;  3AUL A;  4DQP A;  3JW0 X;  2A3V A;  1FXI A;  1UCV A;  3GE8 C;  3TEW A;  3RBE A;  3VR9 B;  3MJW A;  3GOE A;  3UQ0 A;  2WLB A;  5G55 A;  3S2A A;  1IPG A;  4J9P A;  3RAX A;  1UQV A;  4ECZ A;  4JV1 A;  1V81 A;  9ICM A;  1ZYQ A;  2N1V A;  4JPS A;  4XWT A;  3PSF A;  1IM4 A;  1WXV A;  1I4H A;  2JRZ A;  5TIS U;  1TKD A;  4EBE A;  2V9W A;  1B1Z A;  2R8J A;  2W82 A;  3ZYY X;  4F4Y A;  3DVN U;  2QSD A;  3QU4 A;  2AL3 A;  4UB3 A;  2ZTD A;  3TL5 A;  4AS1 A;  4O5E A;  3T5H A;  2BYF A;  2LKY A;  2HBK A;  1S76 D;  2NPT B;  4KLO A;  2KWV B;  1OXJ A;  2ONQ A;  4IRD A;  2K6D B;  4RZR A;  4EZ9 A;  3VFK A;  4LVS A;  4BKS D;  1BVS A;  1L3T A;  3FC4 A;  2IHM A;  8ICQ A;  1JMS A;  4MEM A;  2W3S A;  4BKS A;  2AQ2 B;  4CRX A;  1VLB A;  3UGB B;  3PR4 A;  3QE9 Y;  4Q44 A;  1E7V A;  5L9X A;  3MGI A;  4I2I A;  3PZ8 A;  3RJF A;  1VRA B;  4RT3 A;  4LZG A;  3SDL C;  1L7O A;  2IND C;  3BYY B;  2OJR A;  5FP0 A;  2REX A;  1E9M A;  8ICH A;  3BZC A;  3WK5 A;  1I7H A;  1P7F A;  5D46 A;  2CJO A;  3HIZ A;  3B9J A;  1JN3 A;  4DHZ E;  1KKX A;  2MRL A;  3ZVV A;  4BVU C;  4IQW A;  4DQQ A;  4IR9 A;  3IP4 B;  3BK1 A;  3Q8A A;  2ZIW B;  4S0R A;  3RR8 A;  1XLN A;  5KL8 B;  4TUQ A;  4CF4 A;  1FCC C;  1OUQ A;  2W9C A;  1BPY A;  4NZL B;  4B9N A;  3DVG Y;  5CEH A;  3ZNZ B;  4Y2S A;  4M9H A;  2R2Q A;  2ZW1 A;  1PDX A;  3VTW A;  4BJQ A;  3PHX B;  5B5E U;  1ZQO A;  2INN E;  1PVR A;  4M00 A;  2F76 X;  3KUZ A;  2XK5 B;  2ZVO A;  5AZF A;  1KFY B;  3AB5 A;  4M6W A;  4WJQ A;  4PHP A;  2I1K A;  2KIC A;  4PJ0 U;  2UYZ B;  5DPW A;  4LLG M;  2AH5 A;  2C2R A;  2R8K A;  4NLZ A;  3BVM A;  3RBD A;  3IAM 1;  4YTN B;  3LWL A;  2ZZP B;  3I5J C;  5DLG A;  2XC9 A;  1SL0 A;  2J0J A;  1JWB D;  2HTM E;  4G11 A;  1ZQC A;  1V1O A;  5DPT A;  8ICV A;  1WJU A;  2MJE A;  4O1N A;  1J8C A;  2AQ1 B;  2UU7 A;  2AU0 A;  3IM1 A;  1TZ1 A;  1TTN A;  2E8O A;  8ICW A;  5J2F A;  2DAJ A;  2DWQ A;  2D5G A;  1LQB A;  5D4B A;  1LVH A;  2WXH A;  1S3S G;  4HPL B;  1KN5 A;  4M2Y A;  8ICS A;  5DGB A;  2D3G A;  3F53 A;  2CHX A;  9ICN A;  2L05 A;  5FR6 A;  1Y88 A;  3RAQ A;  5CHG A;  1T0Q C;  4DSF A;  3GFK B;  3PX6 A;  5J0T A;  3A0H U;  1V1P B;  4C8M A;  5AHX A;  3ECI A;  4YTP B;  2ZIX B;  4A3O A;  4YXJ A;  5IKC M;  4ED2 A;  2WGS A;  5KFH A;  4MSQ B;  4DHZ B;  1T8E A;  5LXH A;  4WH4 A;  5JHB A;  4M01 A;  4BGD A;  5J2G A;  3WK9 A;  2IGD A;  2Y1I A;  2W9M A;  4J9K A;  3QX7 A;  3WIM A;  1S0M A;  4DXA B;  5J2K A;  2D07 B;  1K51 A;  1N62 A;  3HPO A;  3OAW A;  4L2Y A;  4F3O A;  1MI0 A;  2KC1 A;  1L6U A;  1SE3 A;  4W9K A;  1X2I A;  3MGV A;  2D3D A;  1D8B A;  1WUD A;  4MF8 A;  3C0R B;  4WJO A;  2DL0 A;  1GPX A;  1P1A A;  1ZGU B;  1NJX A;  5JHA A;  2XCA A;  3A9K B;  5TZV A;  3H8J A;  5TR5 A;  4C56 C;  1KLG D;  4QZ9 A;  2K4P A;  3H0M B;  1UD7 A;  4O3S A;  2KVC A;  5ALE A;  2F3N A;  2I6X A;  3PX0 A;  2BTE A;  1NZB A;  2D6F C;  2YB1 A;  1B9R A;  3PSP A;  2M4N A;  3CIR B;  2IOF A;  4MFA A;  1OQQ A;  3PR5 B;  4RF1 A;  2CN1 A;  4FA6 A;  1K53 A;  3T79 A;  1UGJ A;  2VJ5 A;  4KLD A;  4Y2J A;  4O9M A;  1WZ3 A;  3VR8 B;  1NNL A;  3Q8S B;  4F2R A;  2KNB A;  3HM3 A;  3HHM A;  4RM8 A;  3ZW3 A;  3T3N A;  1ZQV A;  8ICJ A;  3PV1 A;  5ALV A;  4F4X A;  5ALN A;  2CHW A;  3T3O A;  2SAK A;  2EZZ A;  2A1A A;  4FHJ A;  5JZE B;  1ZD3 A;  5E6J A;  1MHH E;  3CWI A;  4K4I A;  3GIK A;  5DB9 A;  4DLE A;  1XLP A;  1YN4 A;  2QC8 A;  3BYT B;  9ICL A;  3AMZ A;  4BBN F;  4ANV A;  3JPN A;  4FN2 A;  3W1Y A;  3B0X A;  4DQO C;  5D49 A;  2NPT A;  3BQ7 A;  2BPF A;  2OOB B;  1RAX A;  4B6W A;  3ORY A;  3ZLZ A;  2L52 A;  3QJZ A;  2BQQ A;  4DQI A;  2HHV A;  2YEP F;  1UWX A;  3LXF A;  5HR6 A;  2P66 A;  3VQI A;  1UH6 A;  3R66 C;  3WAM A;  2C60 A;  4O5K A;  2HD5 B;  2LHE A;  1N2X A;  2KIW A;  4DO9 A;  1N56 A;  2X8X X;  5KT3 A;  3WKC A;  3K75 D;  2NTT A;  4MH0 E;  1SXT A;  2HE7 A;  4A3P A;  4NM1 A;  1SL2 A;  1RYU A;  9ICB A;  4A90 A;  1J7A A;  3LYS A;  4BFR A;  1AW7 A;  2LMC A;  2GBJ A;  1TJE A;  5B66 U;  1WMH B;  1FRR A;  1XT9 B;  4RM9 A;  4FBT A;  4F71 A;  4E71 A;  2J7Q B;  4J9L A;  1QSY A;  3ZDT A;  4EEW A;  3QHT A;  2DEN B;  3MFG A;  2WYQ A;  3CSF A;  5E79 U;  2ZIW A;  1Z4N A;  3H8M A;  1FMA D;  4FZN A;  1V49 A;  4XUS A;  1BPB A;  4Z6E A;  2G5I B;  4UB5 A;  2ISO A;  2G1E A;  3SQI A;  2D8C A;  2PXI A;  3AH7 A;  1U4A A;  3RNA C;  2G3Q B;  2KN5 A;  2R8H A;  1JRO A;  2PFN A;  5F9L A;  2BWE S;  2HHQ A;  2INP E;  2XK5 A;  4IDI A;  4OVV A;  2N7E A;  4BX9 C;  4DQR A;  1TIF A;  4UQG A;  3OSP A;  1PZN A;  1SWV A;  3MBY A;  2K6Q A;  4TUU A;  1QQ5 A;  3QU7 A;  2HW3 A;  1UEL A;  1FFV A;  5ALQ A;  3WK4 A;  2KZM A;  4YL8 A;  2VA2 A;  2FUH B;  3AEB B;  5DG7 A;  1V5T A;  2VH2 A;  3V6C B;  3APF A;  2M0X A;  8ICG A;  3ZXR A;  2K22 A;  5J18 A;  3D2N A;  3WCQ A;  2R2O A;  2JF5 A;  5KG2 A;  4UAT A;  7ICH A;  2RQ5 A;  1LB2 B;  2ODG A;  1L3U A;  4LJP B;  1JXL A;  2JEF A;  2KWU B;  1P9D U;  4CHK A;  1KOT A;  1ZJN A;  1V5O A;  3Q8E A;  2ZG6 A;  4Y2Q A;  4B9L A;  4WIP A;  5L95 C;  2IGG A;  3DDH A;  3KHL A;  1V1P A;  2MBO A;  4M02 A;  3PHW B;  2ZIX A;  4OO1 J;  4USA A;  3OJS A;  4ITK A;  1B43 A;  3TAR A;  2JRI B;  2P6R A;  7ICE A;  1DRG A;  1KRH A;  3TQ1 A;  3S6J A;  3B1L X;  5DG9 A;  4U6P A;  4BXO B;  1U9L A;  3M9N B;  3PPA A;  4TUS A;  4LNN A;  1WCL A;  1XEE A;  1J0G A;  5CRX A;  4ECS A;  1OEY J;  3Q8M A;  3E58 A;  2D3C A;  1NKB A;  2W54 A;  4IWQ A;  2ZPN A;  4C4T A;  2DPI A;  1L4Z B;  3A9K A;  4JV0 A;  4DFM A;  3VHT C;  2NRV A;  3MC1 A;  4A9A A;  4BKG A;  2N7J A;  3AM9 A;  3CRX A;  4EE2 A;  3KZX A;  3UQA A;  2JXX A;  2W7O A;  4RCO A;  1ZP0 B;  5DDY A;  2E6X A;  3B2G A;  2BQU A;  4OJO A;  1IGC A;  4FJV B;  2DFL A;  1B22 A;  1ZQL A;  5KFT A;  2A4Z A;  4KV2 A;  2EH9 A;  1WX8 A;  8ICF A;  1DOI A;  3BS7 A;  2PLP A;  5AKI A;  1YIW A;  2XGQ A;  1DGS A;  3IN5 A;  3SI8 A;  5KFD A;  3UQ2 A;  1KSP A;  4BOS C;  4YMO A;  1L0X B;  2OJW A;  1STE A;  2IPK D;  2WXN A;  3M7D A;  4ZH4 A;  5AI8 A;  2N0S B;  4A6Q A;  3KUC B;  2HVH A;  3THV A;  1YN3 A;  3M95 A;  5KNI A;  3Q3N C;  3LDA A;  2ZXI A;  4DL2 A;  2Y5P A;  3HVZ A;  7ICN A;  2KVR A;  2VJ4 A;  1G6J A;  3Q14 C;  2RDJ A;  1HTO A;  3AEV A;  4Q8E A;  4OCZ A;  2KWC A;  3SAG A;  3Q8L A;  1COO A;  3HIL A;  4BWJ A;  1KM7 A;  1Z3E B;  2J4X A;  2LRU A;  3ZKJ C;  4WWM A;  2PMZ C;  1EM7 A;  1TBE A;  5IIO A;  3TEX A;  5HFY A;  2KQS A;  2LD9 A;  4DDG D;  5AEK B;  5J2E A;  1ZQB A;  1ZQG A;  4E0D A;  2DZI A;  2GBK A;  1GNU A;  5KFN A;  2JYE A;  2O6V A;  1WMH A;  1KBU A;  2WB1 C;  2MBE A;  2QIE B;  2ZCC A;  3T8M A;  2FCS A;  3M6Z A;  4IQT A;  2JUO A;  3WK6 A;  3WAN A;  5LLI A;  4RNM A;  3P63 A;  5KFE A;  1SGG A;  7ICF A;  2WFA A;  2H3F A;  4O3P A;  4FS1 A;  2BF8 B;  1KH0 A;  3UIN B;  5L1M A;  2HHX A;  1WY8 A;  5DPR A;  3KHG A;  2IJ0 A;  5ALD A;  4F4Z A;  1UA0 A;  1KTK A;  2QHO A;  2K3U A; 
#chains in the Genus database with same CATH homology
 4ZHO A;  2XNA C;  1UWM A;  4ARI A;  4H2A A;  2H89 B;  1UUP A;  4US9 A;  2L83 A;  4P6V F;  1D4B A;  4L1B A;  1P7E A;  1QKZ A;  5HI1 A;  1N63 A;  1E6E B;  5EE3 A;  1KLU D;  2AX5 A;  2L1A A;  3AE5 B;  3W5U B;  2WP9 B;  3I57 A;  1F2R C;  4N6E B;  2EKI A;  3NVZ A;  3IXS A;  2BS3 B;  1K50 A;  2DYO A;  4TMA B;  3W2D A;  2JYT A;  2JX5 A;  3ZGZ A;  4C7Y A;  4YTM B;  3NVY A;  1ZUD 2;  2FUG 1;  3P4R B;  4WQM A;  5BYQ A;  4US8 A;  2LHD A;  3P4S B;  4NJC A;  4OZC A;  3U4E G;  1FD6 A;  4ZHP A;  5BMH A;  1ZDX A;  3FIL A;  2BS4 B;  3NRZ A;  2Z8L A;  4TSS A;  1JWA D;  3U7Z A;  1SE2 A;  4TQ0 A;  1N5W A;  2OED A;  1TKE A;  1BUI C;  2WXP A;  4YSX B;  1J7C A;  1WYG A;  1JCK B;  4IKG A;  1N60 A;  2RPV A;  4RGO S;  1QF6 A;  1ZPS A;  4OZA A;  1VDV A;  2MEK A;  2WDR B;  3HVD A;  3IAS 1;  1CJE A;  1WWT A;  3U2S C;  4ZRP A;  2KMM A;  1FIQ A;  3EUB 2;  2B76 B;  2M56 B;  4YXD B;  2H88 B;  2PMV A;  1GB1 A;  2HDE A;  1WRI A;  1JRP A;  4XDD A;  2LGI A;  5C2T B;  2J53 A;  2Q5W D;  1PFD A;  3KLS X;  4CQN A;  1D5M C;  1QOB A;  2FE8 A;  3W5V B;  4RNA A;  2GRI A;  2W3R A;  2LFI A;  1VZ6 A;  1VZ8 A;  1PGX A;  1QQR A;  4ARC A;  2V4I B;  3TEY A;  3P4P B;  4OVZ A;  2BYT A;  2BT6 A;  2V3P A;  2DBY A;  2G9H D;  1E0Z A;  1Q10 A;  2PIA A;  2RDG A;  3PZ7 A;  2MH7 A;  3E9S A;  4B0E A;  1C77 A;  3TEZ A;  3KQ4 A;  5LNK 1;  4AQ7 A;  2QJL A;  1FO4 A;  3GB1 A;  1HA5 A;  1RFK A;  1PGA A;  1FXI A;  3TEW A;  3MC0 B;  1SJH D;  2J52 A;  3VR9 B;  1MPE A;  4A8X C;  4IOI E;  2AQ3 B;  2WLB A;  3AED B;  3W9C B;  5BYS A;  2WXM A;  1CQV A;  3EA6 A;  4RH6 A;  2VZK D;  4JPS A;  4XWT A;  3SFD B;  4WUR A;  3IT4 B;  2GB1 A;  3AE4 B;  1I4H A;  1L6V A;  2W82 A;  1B1Z A;  3RFZ B;  1KF6 B;  1TY2 A;  2QSD A;  5MPO A;  4L23 A;  2JQR B;  4XDC A;  1JW9 D;  4AS1 A;  3IT6 B;  3B2F A;  1C78 A;  3NZ3 A;  1C9F A;  1ZOY B;  2MJ3 A;  3DWM A;  1HZ5 A;  1MHX A;  2ONQ A;  2WXQ A;  5FKA C;  5D7G A;  2IDY A;  3FC4 A;  3L4P A;  3VRA B;  1I4X A;  2ZW0 A;  3SFE B;  2W3S A;  2AQ2 B;  3ABV B;  1VLB A;  3NS1 A;  1HQR D;  1QLB B;  4J3O D;  3AEF B;  4HRO A;  4RGT A;  3HUI A;  1GAQ B;  3PZ8 A;  3I9V 1;  2ACZ B;  1VRA B;  1HZ6 A;  2DYM A;  4REZ A;  1YJI A;  2CU3 A;  3BYY B;  2LEK A;  1PGB A;  2YEP B;  5G5H A;  1E9M A;  1I7H A;  1P7F A;  2CJO A;  1XO3 A;  4FXC A;  3B9J A;  2M0A A;  1L5P A;  3KWL A;  3ETR A;  5BYR A;  3BK1 A;  3Q8A A;  1N5X A;  1SIJ A;  2PVO D;  2IGH A;  1XLN A;  1FCC C;  4WAF A;  5EE1 A;  4NZL B;  2ZW1 A;  1PDX A;  1A70 A;  2J42 A;  2WU2 B;  2BB5 A;  1YQ3 B;  5HHD G;  3HRD D;  1TY0 A;  2INN E;  5FR3 A;  2LUM A;  3AEE B;  3P1M A;  3H8H A;  1KFY B;  3AB5 A;  3BZD B;  1NI3 A;  1NVI D;  2K5P A;  4N58 A;  1J7B A;  1AYF A;  1ET9 A;  3Q8C A;  2WXF A;  4YSY B;  3BK2 A;  4LLG M;  2TSS A;  3BVM A;  1FRD A;  4YTN B;  3IAM 1;  1E10 A;  2PKO A;  2W55 A;  3ZQ4 A;  2KAJ A;  1SEB D;  1JWB D;  1YMH E;  1HEZ E;  2HTM E;  1TS3 A;  1SE4 A;  3FAH A;  1V1O A;  2I2Y A;  2R61 A;  2MJE A;  3SR6 A;  4O1N A;  1PYW D;  2AQ1 B;  4MM3 B;  1IGD A;  3U52 E;  1TYG B;  2DWQ A;  1MVK A;  2D5G A;  2WXH A;  3ZYY X;  1AWD A;  1BML C;  3SEB A;  3NVW A;  2QIL A;  4YTP B;  1V1P B;  3KWV A;  4JX1 C;  5GXG B;  3UI3 A;  1FEH A;  3N9Y C;  4OHJ A;  5EE0 A;  4JE3 B;  4WH4 A;  2IGD A;  1C4P A;  4GDK B;  4KKJ A;  4MH8 A;  3W1S A;  1F2R I;  1L0V B;  1FFU A;  1M4V A;  1K51 A;  1N62 A;  1EWC A;  4L2Y A;  2SEB D;  1MI0 A;  1L6U A;  1SE3 A;  4B0M A;  3ZJT A;  1VZ7 A;  4ZRQ A;  2L32 A;  1GPX A;  3DWG C;  1XLO A;  1TKY A;  4M0W A;  1WSP A;  1ZDV A;  4C56 C;  1KLG D;  4RFB A;  1V8C A;  1EU4 A;  4LTU A;  1NEN B;  3PO0 A;  3NVV A;  1XF5 L;  4UDU C;  3AE9 B;  3BII D;  2BTE A;  4RF0 A;  1TS4 A;  1B9R A;  4ZOH C;  3CIR B;  1OQQ A;  4RF1 A;  1K53 A;  1UGJ A;  2WXR A;  3VR8 B;  3Q8F A;  3T3N A;  1EU3 A;  1AN8 A;  1T3Q A;  1F0Z A;  1I4P A;  1T6B X;  3AE7 B;  3T3O A;  2SAK A;  2Y3A A;  5E6J A;  1MHH E;  1IBX B;  3CWI A;  1YN4 A;  3NUH B;  1XLP A;  3R8B A;  3BYT B;  3GS2 A;  3AMZ A;  1N61 A;  1SJE D;  2RDH A;  1RWS A;  4DQO C;  1QIL A;  4P16 A;  3LYY A;  3GP7 A;  3Q8B A;  5D3D A;  1C4C A;  2L52 A;  3AE1 B;  3R2I A;  2WDQ B;  5FK9 C;  5AUI A;  2E3T A;  2YEP F;  1UWX A;  3LXF A;  3VQI A;  1SF0 A;  1CK1 A;  1OFF A;  2ICI A;  4JWS C;  2LJI A;  2EEL A;  1E7P B;  1D6E C;  2LHE A;  2WU5 B;  1SBB B;  3E56 A;  2X38 A;  2NTT A;  1SXT A;  4YT0 B;  2WXG A;  4HKZ E;  4GDL B;  4NAW B;  4A90 A;  1J7A A;  4C7Z A;  2WNM A;  2I38 A;  1AW7 A;  1ZXI A;  3OWE B;  2LMC A;  4ZYS A;  1TJE A;  1V97 A;  2BW2 A;  1FRR A;  2JSV X;  5I4D A;  2KN4 A;  2DLB A;  2BB6 A;  2KAC A;  1NEK B;  3MFG A;  1L4D B;  4RGM A;  1QOA A;  2XN9 C;  4OW0 A;  5BMI A;  1FMA D;  1GB4 A;  2N9K A;  3AV8 A;  1C4A A;  4KGS A;  2WXO A;  1SB3 C;  2RMM A;  2G1E A;  4MAC A;  1D5X C;  5BMG A;  3AH7 A;  2WS3 B;  2V0G A;  1BXT A;  1ROE A;  1JRO A;  5T8I A;  1DGJ A;  4XE0 A;  2INP E;  1DOY A;  1ZXH A;  2PVG C;  3P42 A;  4IDI A;  1FM0 D;  3MJ5 A;  5HG2 A;  1YN5 A;  3BVZ A;  3URY A;  3TUO A;  2JU6 X;  2M19 A;  4OZB A;  1FFV A;  1ENF A;  1RM6 C;  3AEB B;  3EGR A;  4KGT A;  1JWS D;  4PT5 A;  1C76 A;  2K22 A;  2JWU A;  3AE3 B;  4NAM A;  3WCQ A;  1QOG A;  1T5X D;  4N59 A;  1XXG A;  1UNS A;  3J9C A;  1EWY C;  4JWU C;  3AE6 B;  3FIL B;  1YJJ A;  1FNW A;  1ET6 A;  4KX6 B;  3Q8E A;  4WIP A;  2MJD A;  2IGG A;  4D2K A;  1V1P A;  2V3N A;  4HEA 1;  5AUK A;  3V05 A;  1CZP A;  2PTL A;  3V3X A;  1I4R A;  4USA A;  3AEG B;  4ITK A;  1SSN A;  1D5Z C;  1I4Q A;  1I4G A;  1JAL A;  2FBW B;  2WXI A;  1FXA A;  3ZJV A;  1KRH A;  2K0P A;  4XWW A;  5TSS A;  2WXK A;  1TS2 A;  2JZP A;  1XEE A;  1NYR A;  3MP9 A;  5C3J B;  1YNT E;  3Q69 A;  4HJG E;  5EE9 A;  1YQ4 B;  2W54 A;  3ZJU A;  5G5G A;  1XLQ A;  2QMT A;  3AE8 B;  3O13 A;  5H92 C;  1L4Z B;  5JXV A;  2N9L A;  1R7S A;  4Q2J A;  1FNV A;  4A9A A;  3LB8 C;  2N7J A;  1ZE3 D;  4R3D A;  3AM9 A;  1PUT A;  4EE2 A;  1VJK A;  4RCO A;  1FCL A;  1TKG A;  1F77 A;  1ZP0 B;  2E6X A;  3AEA B;  3B2G A;  3R2T A;  1IGC A;  2KWD A;  2WDV B;  3AE2 B;  3BVG A;  4HKQ A;  2QEJ C;  3P4Q B;  1DOI A;  1C79 A;  1NYQ A;  1QT9 A;  1JQ4 A;  3TSS A;  2PLP A;  1OQR A;  1VR9 A;  1HXY D;  2BBC A;  4GLS C;  2OHF A;  1TZO A;  4HRS A;  1L0X B;  1IBX A;  1K52 A;  1STE A;  2IPK D;  1JML A;  2KDM A;  2WXN A;  3AN1 A;  1JWU D;  1GOZ A;  2N0S B;  3RPF C;  2WXL A;  1LO5 D;  4A6Q A;  1YN3 A;  2WQY B;  4KGR A;  2K9X A;  4C80 A;  1DOX A;  2Y5P A;  2VZK B;  3HVZ A;  3C8Y A;  1QOF A;  3BWU D;  4KKI A;  1ACC A;  2GI9 A;  1XCQ L;  2J4X A;  3MHZ A;  1FNU A;  4LK0 M;  4WWM A;  1JWM D;  1EM7 A;  5D3I B;  3AEC B;  3TEX A;  2PW9 A;  1WXQ A;  5HFY A;  1DYQ A;  4DXF A;  2BS2 B;  2NMQ A;  2JYE A;  3VRB B;  2QIE B;  4TQ1 A;  1IUE A;  4YSZ B;  2CJN A;  2KQ4 X;  4A55 A;  1Y56 A;  2NTS A;  4MT5 A;  4RGN A;  1ESF A;  2Y5C A;  3P63 A;  2WXJ A;  4YWG G;  5H8Y E;  2ON8 A;  1KH0 A;  2JXT A;  1WGK A;  1TS5 A;  2IJ0 A;  1L0Y B;  1XCT L;  4DXG A;  1KTK A;  1RYJ A;  2K3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...