3B9JA

Structure of xanthine oxidase with 2-hydroxy-6-methylpurine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
b'ADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xanthine oxidase
publication title Substrate orientation in xanthine oxidase: crystal structure of enzyme in reaction with 2-hydroxy-6-methylpurine.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 162
sequence length 162
chains with identical sequence I
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2007-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3b9jA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b9jA01
1FFVA 3W5VB 3AE9B 3AB5A 3DWGC 3P4RB 1FMAD 1JWBD 2W3SA 1OQQA 1FRRA 3NVVA 1YQ4B 3FAHA 2H88B 1V97A 3AE4B 1JQ4A 1EWYC 4ITKA 1OFFA 4YTMB 2WDRB 1L6UA 2CJOA 1YQ3B 3ABVB 4LTUA 2Y5CA 5G5HA 3AECB 2W3RA 2E3TA 3B2GA 1SF0A 1N63A 1UWMA 2ACZB 1AWDA 2WDQB 2B76B 4ZHOA 2JX5A 1NYQA 1WXQA 1JRPA 2M56B 1QF6A 5EE3A 3AMZA 1VLBA 1E6EB 4YSZB 4YSXB 3ETRA 3LXFA 3AV8A 1ZP0B 1B9RA 1RWSA 1AYFA 2FBWB 1XLOA 4HROA 5C3JB 1F0ZA 3AEDB 4N58A 1KFYB 2LEKA 3RPFC 1WRIA 3VRBB 5MPOA 2DWQA 3AE2B 3AE1B 1N5WA 5EE1A 4C7YA 3VR9B 3BIID 2WU2B 2KMMA 1JALA 1N62A 2BS4B 1L6VA 1XLPA 1QOBA 1FFUA 1SIJA 1N60A 3VRAB 1J7AA 1FM0D 3P4SB 3KWLA 5EE9A 3HRDD 3W9CB 1E0ZA 1GPXA 3P4PB 3B9JA 1A70A 1TYGB 3AEAB 1ZUD2 2M19A 1T3QA 2WS3B 1FRDA 1FO4A 5G5GA 1WGKA 1E10A 2W54A 2PVOD 2WU5B 2JQRB 4ZOHC 1OQRA 3P63A 1XLNA 3EUB2 1RM6C 5AUIA 4YT0B 1IUEA 1VJKA 3NS1A 1KRHA 3AEBB 1J7CA 2BS3B 1XO3A 3SFEB 1NYRA 1DGJA 3AEFB 3P4QB 4JWSC 2AX5A 5H8YE 2BT6A 2WQYB 1NENB 3AE5B 1QOGA 1XLQA 2EKIA 2MH7A 5AUKA 1QOFA 1ZXIA 2Q5WD 3AE8B 5EE0A 4C7ZA 4JX1C 4WQMA 3SFDB 3VR8B 3HVZA 2WP9B 4ZHPA 3DWMA 3NVYA 1VDVA 3L4PA 1YJIA 1CZPA 4A9AA 3AH7A 4IDIA 1L0VB 3W5UB 5C2TB 3AE3B 4US8A 3AE6B 4KX6B 1PUTA 1J7BA 1CJEA 1E7PB 1FXAA 1NI3A 1L5PA 1NVID 2K9XA 1R7SA 2L83A 4YTPB 1WWTA 5GXGB 4HRSA 2N0SB 2MJDA 1E9MA 1ROEA 3P1MA 2PIAA 2L52A 4N59A 3NVWA 1KF6B 2MJEA 3LB8C 2DBYA 2KAJA 4FXCA 3AM9A 1DOIA 4YTNB 1DOXA 2W55A 1RYJA 4USAA 1V8CA 4YSYB 2G1EA 3CIRB 3AEEB 5H92C 3ZYYX 1WYGA 3NRZA 4C80A 1JW9D 4WWMA 1DOYA 1RFKA 3HUIA 4US9A 2K5PA 3AEGB 1N5XA 1GAQB 2H89B 1QOAA 2MJ3A 3WCQA 4P6VF 1ZOYB 2OHFA 3AN1A 1FXIA 4N6EB 2CU3A 3CWIA 3AE7B 1TKYA 3SR6A 2BS2B 1N61A 2HTME 3NVZA 2K22A 2WDVB 3B2FA 2CJNA 1FIQA 1JWAD 1QLBB 3FC4A 1TKGA 1YJJA 3PO0A 4JWUC 1TKEA 1TJEA 2QJLA 4YXDB 2PVGC 2PKOA 1PFDA 2QIEB 1I7HA 1QT9A 1SB3C 1PDXA 1NEKB 1JROA 2WLBA
chains in the Genus database with same CATH superfamily
5HHDG 4IS7A 2G45B 4XYCA 5J2AA 4FBTA 4A6QA 3A9KB 4J9QA 1E5WA 4QZAA 2QEJC 1OQQA 2LD9A 2WDTB 2B0CA 2E1EA 1GJZA 2GLEA 1U45A 1C9FA 1QZEA 3ABVB 3QARA 4A20A 1UCVA 4I2EA 3C23A 2KZMA 3WIMA 2ASLA 2QARB 2WXLA 1TS4A 5DPSA 1SKWA 5HG2A 4YSXB 2W7PA 3TL5A 1HIWA 2G09A 3ISCA 1ESFA 1YQBA 2A19A 3UMGA 4GIVA 2LWPA 1JX4A 4GMVA 5C23A 4ZRQA 4QNLA 3IAM1 3PV1A 2FCMA 3DDHA 3KYDD 4HAIA 2XCPA 3AUOA 3PSIA 4CGZA 2JZ3B 5AHXA 2PE6B 3C8YA 1N60A 4F72A 1UWXA 2VJ5A 4RM9A 3ZNZB 3MR3A 5LNK1 1C3TA 5J2RA 2BPSA 5J0PA 4LDTD 3C1ZA 5F3XB 4RH6A 4K4IA 1TTNA 1NBFC 1Q46A 5L1IA 1TY2A 1WX8A 2WXNA 3SAFA 4IWQA 1ED1A 3V3XA 2R2OA 1JROA 5KT2A 4Y2SA 2NO5A 1HUZA 5AM1A 1RRBA 7ICKA 2JT4B 5J0XA 5AICA 2DF4B 4HCNB 2PFNA 1YMHE 2ZEQA 2YVCA 2IOFA 4TQRA 4BKSD 2W7OA 1VDVA 1YJIA 9ICLA 1CZPA 3G6XA 3B0AA 3BQ2A 3ZLZA 4RQ8A 2XVTA 1E8YA 4IDIA 3R8BA 4R66A 3W5UB 3KHHA 4B9UA 1SE9A 1XD3B 4KIKB 2KFKA 2HHWA 4MEMA 4US8A 4KX6B 1V1PA 2HBKA 2JEIA 1L5PA 3FILA 4UB2A 4RU9A 3U7ZA 2XK5A 4DBGA 3HW8A 2N0SB 1ZQJA 3L08A 1Z5SB 5J18A 4ICVA 1L0YB 1P3QU 4UARA 3T5LA 2MBEA 3VH3B 4GFJA 3TARA 2D3GA 2NPTA 3VAWA 1XT9B 5AI9A 1D6EC 5DPTA 4WWMA 2RDIA 4NLBA 4W9KA 2D3BA 2KQSA 4HXDA 4HKQA 3AU6A 2K8CB 4DO9A 4MJSA 3LDAA 3L13A 2AGPA 5DB9A 3AU4A 5KG5A 4YD2A 4HWIB 2CU3A 2WXMA 5KFUA 2H5XA 3AE7B 4JE3B 2K22A 3NVZA 4DQSA 1K52A 2UU7A 1L7NA 4QZ8A 2FLNA 4LK0M 2JH7A 1ZDXA 5ALIA 3C2MA 2IOHA 4C0ZA 1TJEA 1GO3F 5DDMA 4X5VA 2DYMA 3RB0A 4BAXA 4JB3A 1SB3C 1PDXA 4W9DA 1XEEA 4K81A 3T8MA 1I4GA 2K8BB 1RFAA 4M02A 2L1AA 1NJZA 1FRRA 3IVFA 2L05A 1V97A 1X9XA 4DLEA 4Q45A 2AQ4A 2N7DA 4F4YA 1L6UA 2HDEA 3H4DA 2LJ5A 4NPNA 2HHQA 2K89A 8ICVA 4DWIA 5AZGA 4EEWA 3IM1A 1PVRA 2LI5A 4C4VB 1UZXB 3TMPB 2JX5A 4XDCA 1ZJMA 2BKRB 2K25A 2WGSA 1VR9A 4M2YA 2VANA 4GLSC 4FA6A 4BUGA 3TQ1A 2FBWB 2FNJB 1ZQKA 5MPOA 2E1FA 2DZMA 3EFCA 4TURA 2KICA 5EE1A 4B95A 9ICGA 4KLUA 3SENA 2KLGA 4PS8A 1ZQVA 3HKZF 1QOBA 2DHZA 2P66A 4JQWC 3K1ZA 4PHAA 2M9NA 2ICIA 2K1FA 1OQYA 2VH2A 5KT7A 1M4VA 4FJZA 2G3QB 1E0ZA 1Q0WB 1WX7A 9ICEA 5JHBA 2KN7A 3DVNV 1I42A 3PMLA 2YMPA 5D3IB 4WQOB 4ZOHC 2LVOA 5J0OA 5JTIA 2L7RA 3DBHB 4CF5A 2NTTA 4BXOA 1FCLA 4BX9C 4B9LA 3SFEB 1DGJA 3QU4A 3PSEB 1L4ZB 4WWNA 1UA1A 2MBQA 3VFKA 2JGAA 3ZD9A 3GIIA 3GV8B 1ZQNA 3QWZB 2KFKB 1IV8A 1FEZA 3QE9Y 3R2IA 3QAQA 1XNSA 5KFWA 3FILB 2N9PC 4FS2A 2XK5B 4KITB 1X9SA 4DFMA 1ZQMA 1TS2A 1FXAA 2KO3A 1ZQLA 1Z2MA 1H38A 3H8SA 4FJVB 1YN3A 4Z6CA 1XO1A 1C79A 3B1LX 2NPTB 2L52A 2D11A 1B9RA 4O3PA 4KGRA 3H0RB 1N48A 3ZDCA 2RDHA 3SU8X 5KFDA 4EEYA 4RQ7A 2C2EA 1IM4A 3IHQB 3EWAA 4MJSB 2PW9A 3OWEB 8ICSA 3HIZA 1UF0A 4RM8A 4IC9A 2KVZA 1S76D 3HT3A 1NJYA 3JPQA 3APFA 4P0PA 4AQ7A 3W1SC 2E8MA 1QTMA 3ED5A 5EWEA 3Q6BA 3PW4A 3TEYA 3H0LB 2X38A 1KM7A 2HTME 2ASJA 4GB9A 5IN7A 3NY5A 3X23A 3FC4A 1WI0A 5DCNA 3VDZA 4QIWC 3TJPA 2IHMA 4P4OA 5DGBA 4UB5A 2NS5A 2B3AA 3UIPB 2DFLA 1L3VA 2JWUA 2WHIA 1F2RC 5IO9A 4C4TA 2AGQA 3VUXA 5TR5A 3V6CB 4PS3A 3IV6A 4J9MA 5LXIB 4A3PA 1YQ3B 3H8MA 3E58A 5KG6A 5KFLA 2QB0A 5FK9C 4L23A 2AQ1B 1BMLC 3UMCA 2F1IA 4WJ3B 2DLBA 3SMVA 3ETRA 3SV4A 5AI5A 5AKLA 2RP5A 2YY6A 3LXFA 2EANA 3OSNA 2KX0A 3RNCC 4F91B 1ZGUB 3AU2A 4YXMA 2WXRA 3I9V1 2ALZA 3BIID 4F2RA 5IKCM 3MFIA 2XC9A 1NK6A 2XGQA 4LNNA 5AIAA 1FNVA 2B6GA 1JXEA 3PT2B 2KFJA 1OEYA 3NUHB 4J6IA 2JY6A 1L4DB 7ICHA 7ICVA 1TYGB 2KN4A 2RPVA 5JUMA 1BPDA 3ZJTA 1Z4NA 2WS3B 4YQWA 2CRXA 2J0KA 4EUTA 3LWLA 3TAQA 5BMGA 3ZW3A 4BXOB 1MQ2A 1WWUA 3PW2A 4MSMB 1ZQCA 3OLMD 4W9FA 2ZZPB 8ICFA 4KDLB 4P1BC 4U7CA 1VZ6A 2W8LA 3N7PD 3ZRCA 3JPPA 1A77A 1WJNA 4EKUA 1YZ6A 3T3OA 2WP9B 1D5MC 3M7DA 3C2LA 3Q69A 3JPSA 1NI2A 1WH3A 4JIOU 2ES6A 4Y2UA 5GTIU 4CYEA 2BF8B 3AE6B 3ZGZA 5AIBA 9ICCA 7ICTA 1R7SA 2INNE 5KFEA 1ENFA 3B08A 4HRSA 3MBYA 3I28A 1K1SA 4RQNA 4FBJB 2KEYA 3QZ8A 3QQ8B 3NVWA 2DYOA 1NZPA 2NBVB 8ICJA 1DOXA 2P6RA 4FS1A 1S8OA 1F77A 4USAA 4WWPA 2BTEA 5KG3A 2BCQA 8ICCA 5JXVA 1NZBA 3WK9A 4P0PB 2N1WA 2WXKA 2ASQA 8ICKA 3MR5A 2Y1IA 4DWFA 3UXOA 3VVWB 5L95C 1FXIA 1TGZB 5DBCA 1CRXA 4TUPA 1NK7A 1QH9A 5DPWA 3PO0A 4TKNA 3P42A 3EECA 3QK0A 5E6NA 1TKEA 4ZRPA 2LI6A 3QEBZ 4UAYA 3H0MB 4NM1A 5AKEA 5IP4D 8ICIA 4DHJD 4IQVA 4O1NA 2I6XA 5D94A 1N56A 4BGDA 4LJPB 2YB4A 2NTSA 3FAHA 2D3AA 4RFBA 2NVUI 3ONSA 3DVNU 2R8GA 4M47A 5JH5C 2QB0B 1T4GA 2KACA 2P35A 3RB6A 3B2GA 4BBNC 1SJHD 3M8RA 1UWMA 2V1YA 2KZ3A 1KRPA 3KD3A 1U4AA 4PPXA 5DPRA 3PR4A 1S10A 1ZQIA 3ZIMA 5JZEB 4NLZA 4EENA 1WJ6A 2BDUA 2GBKA 2ZJ5A 4XRHA 4KKIA 2FLPA 3BVZA 2BPFA 1RPLA 4PH5A 4DSFA 5E6JA 2ZIXB 3Q3JA 5AK4A 9ICPA 3HHMA 1FCCC 1N62A 3MGVA 3RB4A 1KJTA 3IXSA 3MTNB 3N1ZC 5DLGA 3RJIA 1SIJA 2KYWA 4TMAB 4WH4A 3PLVA 1ISNA 4KN7A 3MHZA 2YEPB 4NZLB 3SD5A 2LMRA 1T3QA 4KZ0A 2W54A 2PVOD 2HSZA 3BJYA 2IGHA 3EUB2 2LXAA 1WR6E 4NJ7A 3VQIA 3AEBB 2ZJAA 2D10A 1JN3A 1DXSA 1NENB 5E6OA 3KFUF 5HI1A 4AP4C 4C7ZA 1SXDA 7ICUA 4ZHPA 1JCKB 1H8CA 2L0FA 5BYRA 3OGUA 3GILA 2BYVE 4TQ1A 3Q8AA 3ALBA 2NBUA 3MABA 5KFIA 2NRZA 3HILA 1ZOLA 4LCDE 1NK4A 1F2RI 3RBDA 1ZE3D 1NI3A 3HVDA 3TFRA 1KTKA 5KAIU 3JSVA 2IA6A 3RFZB 2KQ4X 4NJ6A 1WMHB 3WK4A 4M01A 5AEKB 1SZPA 3ML8A 1KTQA 4FE3A 2PIAA 1QLNA 4N59A 5J0WA 1KF6B 3HP6A 1COOA 3H7PA 4N9F4 2LHTA 5KFMA 4ECWA 1RYJA 2VJ4A 3DCGA 3MC0B 1J0GA 2Q4TA 2LYAA 2EH9A 5KFVA 5AKGA 2K5PA 4QZBA 1C7YA 3HM6X 2J6SA 3QCAA 5FKAC 1V38A 2IPKD 4OZBA 5H2FU 5L1JA 2V4RA 1ZQYA 7ICEA 3APDA 3KW5B 4I2HA 1HTQA 1XU4A 2OOBB 3CWIA 3V6HA 1XQQA 4EE2A 4MGZE 2M8SA 3DDCB 5AM0A 3QEAZ 5TZVA 4JWNA 1H4RA 2P6UA 1I4HA 2BYFA 1TAQA 2G06A 4YR0A 2D2QA 2O6VD 3LK9A 3QYPA 4RT3A 4D2KA 2MQJA 2HVHA 3VC8A 2MWSB 3AB5A 4NQLB 4RUCA 2C60A 1P7FA 3N7RC 2NCNA 3EPGA 2HDOA 1YOVB 2V4LA 3DBSA 4F5NA 3W1SA 4EBEA 1TY0A 3IFWB 5CA7A 5HKHA 1EXNA 4PHDA 3LWMA 2KDFB 4ARCA 4OCZA 3M3JA 3IT4B 2XI9A 3AEVA 3RZWC 4RF1A 3OSPA 1ZP0B 4XQ8A 3ZTDA 4RQ1A 4C4VA 3M95A 4L2YA 3U2SC 1C20A 1VJ5A 5J2IA 4HEA1 2QMTA 1NKCA 3PHWB 3QUCA 2GMIC 4RMAA 4ICAA 3V61A 1GC7A 2O2VA 4RZRA 2J53A 4I2DA 4P4PA 3JW0X 3ICXA 3RH6A 2KDBA 5ALZA 5EE9A 3KWLA 2KWCA 2GBNA 5D3DA 1ACCA 4NY0A 4S17A 1E10A 3Q8PB 4FHKA 2VKQA 1ZQHA 4LLGM 1ECWA 1KFDA 5AUIA 5DG8A 2QARA 2RMMA 1S0NA 4EZ6A 1A6SA 1CK1A 1J8CA 2N9XA 1UH6A 3HX0A 3BQ1A 4ECUA 1SV4A 3GIMA 2ZIUA 3CW2C 4QZGA 3H4BA 1L6NA 3GQCA 1QOGA 4MGKE 4B9TA 5AKXA 1RYSA 3KKAC 2HE7A 2XGPA 1JWSD 4KTQA 1Y56A 4KX5A 5JU5A 1FPYA 3O65B 4O5KA 4DHZB 4EFOA 1TKDA 3R7QA 3JSVB 2E8NA 2G08A 1XCQL 4XC2A 4KLHA 5BMIA 5HFYA 2H3ZA 1XCTL 2FIFA 4A8EA 3QUQA 3I1YA 3H7PB 3A0HU 4F4WA 3GB1A 2KQ7A 5KT6A 2MJEA 2WF6A 1LGRA 4MT5A 5EWFA 3OJSA 3V7KA 1BT0A 1LQBA 4DSIA 4ECXA 5AM4A 3HWTA 2UVWA 2JSVX 2HHVA 5DG7A 1PK3A 3HUIA 3RNEC 2KOXA 2R8IA 4ECTA 3H7SA 3Q3MC 1TBEA 2UYZB 2XY7A 1RG6A 3RJEA 5ALLA 2INDC 1PUZA 3AN1A 3QUTA 2HI0A 2ZUCA 4CHKA 3NHEB 3Q2AC 2RRDA 2F1JA 3GE3C 2MCNB 5KFJA 5G2NA 2INPE 2L0TA 2BCVA 2NMQA 5KFSA 4REZA 4KLLA 2PVGC 3PX6A 3UPQA 1QT9A 3WKAA 2KC1A 3NJTA 3UINB 4F92B 4NL9C 4F93B 2ISPA 1JUDA 4KLOA 2ESEA 3O13A 1K8RB 3N28A 3VTWA 2H88B 2EAMA 5J2JA 1OFFA 1PVQA 4ED7A 3SQIA 1LB2B 4AYBC 3TFSA 3MDAA 4FZNA 4W9GA 5I4DA 1WGRA 2WDQB 3BVMA 3N30A 3SI8A 1EM7A 1WXQA 3I63C 3F53A 3Q8RB 1TFRA 1V5OA 2KJ6A 4K1RB 2KNJA 4XGAB 4ECYA 3FM9A 3WKEA 1SL2A 2GBJA 4ZRKA 4IQUA 4FZMA 4IR1A 1TS3A 2KHWB 2OXOA 3AV8A 1RWSA 8ICMA 2JWZA 4FJYA 1XLOA 2BB6A 1YIWA 1UGMA 2KD0A 2WXFA 4B0MA 1WRIA 4C4SA 2EQYA 3GP7A 2O2VB 2K4IA 3PHXB 1D3ZA 4J9RA 3ZDBA 1YT3A 7ICPA 3RYTA 3MFGA 3TEZA 3J9CA 4II2B 2K8BA 9ICAA 3MJWA 3WK7A 3A4RA 4AJWA 2KFNA 1FFUA 4I2FA 3T5JA 5DB6A 1T0QC 2RPQA 1TK5A 4UBCA 2LVPA 2JV3A 1QCKA 2BVCA 5IIJA 1NK5A 3TACB 5CEHA 2HBLA 3MC1A 1U48A 1OQRA 3P63A 4ED8A 1WF9A 2ZIUB 1F52A 2YLMA 4P16A 1BUIC 5CJ7A 2BR0A 4PZOA 2W04A 2BQ3A 3ZRFA 1ZD3A 3L3FX 5CHGA 4E3CA 3AE8B 1V1OA 4KLQA 1UELA 3ZDAA 2BQRA 2KD1A 3G6VA 2FUG1 5J2CA 5J2HA 1WE7A 2BQQA 1L3SA 3Q8LA 2RDJA 3BDPA 4QJFB 3ZUNA 4BZAA 5D2MB 2N1RA 2JXXA 3ECIA 2PKEA 4QW8A 4JV2A 5IOIA 5IIOA 4UATA 2K6QA 3H6NA 2CU1A 4OD0A 2FE8A 4I28A 3Q8SB 4KN4A 2PI4A 1WYWB 2DBYA 2KAJA 4CQNA 1J2NA 4NQKE 3VUWA 3ZJUA 3DHHC 3QU5A 2KVRA 2ZW1A 4MACA 3AEEB 1XXGA 4R3DA 5EWGA 5F9NA 1TV9A 4KLGA 1WGYA 2MU2A 5ALEA 2DYBA 2IBKA 2SEBD 4IOIE 4YG2A 3IT6B 3E2EA 4HYKA 2YTUA 1FEHA 5AKHA 3S6JA 1ZQDA 3DBLI 9ICJA 3R3MA 4A8XC 4I6NB 1VZ7A 2G07A 1ZQOA 2PFPA 2OM6A 3KHLA 1MI0A 5KFQA 1V5TA 3BQTA 2CJNA 1YX5B 4I6LB 1TKGA 2MP2B 2BDPA 2D5GA 3AI5A 4WWOA 2MHJA 3BYTB 3WANA 2HBMA 1FFVA 3LVWA 1JRUA 3AE9B 3QX7A 5B66U 4PJ0U 3MDCA 4MSQB 3NVVA 5DB8A 3KZIU 1BPYA 3PS6A 1X1MA 1D5ZC 4II3B 4YTMB 4ELUA 4XWTA 2OYYA 2W9AA 4RCOA 2I38A 4Y2QA 2BCUA 1XSNA 2BGFA 8ICNA 2MW5A 4GN1A 2E6XA 4GOCA 5KFFA 1XSPA 5HR7A 3H9DA 2B76B 4DCCA 1JRPA 5ALXA 4WAAA 3WKDA 2D3DA 2GBMA 1KLUD 2LUMA 4DFJA 2EMTA 4DDID 2ZTDA 2HOIA 3CSTA 1BPEA 4MGYE 1F9JA 2IOFK 8ICPA 2KTQA 9ICKA 1LXDA 2RD0A 5TISU 3OHBA 4C8KA 3GZNI 3AE2B 5T8IA 3ORYA 1EUVB 2VIXA 1C78A 5ALVA 3MHSD 1PVPA 3L16A 2VA2A 3NOBA 5AI8A 4EX7A 3RR8A 4RGMA 4RPYA 1RZTA 5D46A 1SE4A 3ALRA 3T79A 3B0YA 4UASA 2I1KA 3P4PB 1A5RA 2N7JA 4H2AA 4YN4A 4RQ3A 1WGDA 1PZNA 2XBBC 1KW4A 4GXBA 9ICSA 2K39A 4W9IA 3MP9A 4YT0B 1D8BA 1WCNA 1C4CA 1KKXA 1MQ3A 2IGGA 4BJQA 1PYWD 2KDMA 4PZNA 4YP3A 4WJPA 3UXNA 3MGIA 1V80A 1XLQA 4I6PA 3W9CB 1V85A 2YB1A 1LO5D 2LHDA 2Q5WD 4ACFA 4ASWC 4LZDA 4BDPA 4DS5A 2MX2A 2QSDA 1T94A 4A9AA 5FP0A 4JUZA 4O5CA 3DVGY 1S1QB 2VA8A 1Z4OA 1KDHA 5J2BA 3M1YA 3WK6A 2N7EA 2C7HA 2L83A 4RUAA 4YTPB 5G55A 1WCLA 3T3FA 2C2RA 2NYVA 2FCQA 1TVAA 4MEXA 5KL1B 8ICTA 2AL6A 1E9MA 1ROEA 4O0IA 2LGDA 5AI4A 3V6JA 2XY5A 1RXWA 5J2DA 1AW7A 3Q3NC 2FE9A 4DQIA 2L76A 4F5RA 4P1CC 1HQRD 1N2XA 2EDUA 5A0LA 3SDLC 2EAOA 2Y5PA 2HW3A 3KKAA 4DL6A 3U8ZA 3VH4B 1WRDB 3U30A 4BOSC 3V7JA 4OHJA 4A55A 4RNOA 3M6ZA 3J81j 1OXJA 2QB1A 1ZETA 5CHVC 4QZCA 4KGSA 2PFQA 3BQ7A 4JL9A 2I5HA 4B9VA 4C8LA 2NRWA 1Q10A 2BS2B 1DK2A 1TAMA 2IO0B 4R8UA 5DBAA 1IGDA 4LDTB 2Z8LA 4S0RA 1WXSA 5ALUA 2NRVA 2QJLA 3U26A 4CF3A 2N9KA 1PK1A 5AK3A 2IY0B 1D5XC 2AWTA 3RH5A 2D8CA 9ICNA 3ZXRA 2H3VA 3K9OB 1JWBD 7ICFA 1X40A 1ZD4A 2FJ6A 3ZD8A 2L32A 4M9GA 1EWYC 1MG4A 4QWCA 4ITKA 1ZQFA 2Z0DB 4LTUA 5IIKA 2Y5CA 2R8HA 1I4PA 4DFKA 1N63A 1AWDA 2R8KA 1MG8A 2A1AA 4TQ0A 4Y2TA 4YR2A 4CE6A 4DL2A 4AUQC 4I29A 2PE9A 2FPLA 3TKAA 1QQ7A 5BPCA 1WSPA 4NL9A 4CCHA 1KLNA 4ECSA 3V72A 2WF9A 4C7YA 3RNFC 2IMWP 4YWGG 3BWUD 2C7NB 2R8JA 1PGAA 5F9LA 4BFRA 1DK3A 4XE0A 3P4SB 1S77D 4TSSA 1ZQGA 2KVSA 3C5GA 3B9JA 2LGYA 2ISOA 3QIJA 1O03A 2LYHA 3DBLB 3N4MB 1FO4A 2WB1F 1ZQPA 4DF4A 4M6WA 4OJ6A 4HKZE 2JQRB 1ZDVA 2A5UA 1RM6C 4NV0A 1K53A 1KRHA 1J7CA 2OCEA 4MELA 4ZYSA 1G6JA 1XO3A 3Q14C 3L0WB 2EKIA 2MH7A 2KDIA 4WQMA 3B0XA 3M9MB 2ZIXA 1XF5L 4AWJA 2RLTA 2KTRA 3DWMA 2GBRA 3QU9A 2ZCBA 3TCAA 4E74A 2HJ8A 1P0RA 1X9MA 3JPOA 1J7BA 4G11A 1CJEA 3BZCA 2AXTU 3VTUA 3VXWA 5KFOA 1TT5B 2DPIA 1K51A 4AYBF 3MC9A 1TK0A 4HCPB 1K1QA 4K3CA 4NLCA 1COKA 4KMUA 4YSYB 2JRIB 3CIRB 1MSWD 4OVVA 1IPGA 3NRZA 3V05A 5T14A 3WALA 5D4BA 4CNQA 1WXAA 4ZH4A 1JXLA 2XIDA 3T3NA 3GZNB 2VZKD 3DHGC 4YMOA 1ZD5A 1ZOYB 2W03A 4N6EB 2FMSA 3CP8A 5BMHA 1GC6A 4R8UB 2ATLA 3M9NB 4J9PA 4DF8A 3C21A 4K3BA 1QLBB 1PK1B 4ZDVA 4KLDA 3WAMA 2AEHA 1WMHA 4OO1J 5J8YC 3SAHA 1NEKB 4HK2A 4N58A 4I2IA 5KFTA 2PEAA 3P4RB 3KWVA 2F76X 3GV5B 1WZ0A 4AS1A 5D49A 2PLPA 3BZDB 4J3OD 2H3FA 2JXTA 4AOFA 2WDRB 2YEPF 5CWRA 9ICHA 1OTRB 2V3SA 4F4KA 1ZW7A 2WXHA 4Z6EA 3VUYA 1SV0C 3N97B 4KVGB 2K8AA 1HE8A 5HR6A 3F2BA 2J7QB 1ZKHA 2MSNA 4YXJA 3HPOA 5C3JB 2V4QA 3TAPA 2MA9B 4F8CB 1AQ6A 1C4AA 1BNPA 3VCBA 2DWQA 1U4BA 3KUCB 2KMDA 1V2YA 5J17A 5TSSA 3CNHA 3RJKA 2JU6X 2WU2B 4IRKA 2A4ZA 2BS4B 3GOEA 8ICOA 2QHOA 2F44A 2ZG6A 3RF9A 3ZVVA 1RDFA 2I1QA 4I2BA 1X6JA 1GOZA 2VH1A 2AJQA 1IXRA 4OW0A 4MFAA 4M6WB 5AKKA 4C8NA 1P9DU 3K4GA 1HZ6A 2M19A 1M94A 1WGKA 4ED1A 1T0YA 4FLHA 2KIVA 1X66A 2IO2B 4RGOS 5JHAA 2CPRA 3GFKB 1VJKA 2EMSA 4R63A 2K8HA 2OEHA 4OZCA 3R7RA 4B6WA 5ALMA 1ZQAA 3QX1A 3RD2A 2JZZA 4OJOA 4GC6A 4K4GA 4MGIE 4YR3A 1ZQSA 4WJNA 1B22A 2KTRB 3RN9C 2AL3A 3SFDB 4IKGA 2LYBA 4EBCA 1YX6B 4TUQA 2WAQC 4EEKA 3RRGA 2KIWA 3TIXA 1IBXB 2KK8A 2IO3B 3E0FA 9ICXA 3AE3B 3N20C 1PUTA 2GB1A 1NVID 2JR5A 3NUQA 4DL3A 3U52E 4Y2VA 1Z1BA 2DPJA 3D6JA 5J0TA 1S97A 4XA5A 2BGWA 2CHXA 2K4EA 4X57B 2KKVA 4O3NA 1WR1A 4HPMB 2DL0A 1MN8A 3VTVA 1WXMA 1XO0A 1V8CA 1GG3A 1SGHA 3H7IA 1ZQUA 1DOYA 4DSLA 2KANA 3MC8A 4EZJA 4DSKA 4F50A 4YMMA 2ZIWA 2WXQA 2JH1A 3WCQA 1WE6A 1QQ6A 2EZYA 2V9WA 2DGZA 4RGNA 2WHEA 4Q2JA 3PV8A 1TKYA 1E8ZA 3OG5A 1NK8A 1IP9A 5ALOA 1TAUA 4F5OA 1U9LA 2UVRA 1E8XA 1VZ8A 1K5OA 8ICXA 2QIEB 2XY6A 4M04A 4WIPA 2UVVA 3Q8EA 2MBHA 1X42A 2JZPA 2L5YA 4DXGA 3G6YA 1NKBA 1E7UA 2HJ1A 3SYZA 2L00B 3UGBB 4CDGA 3PPAA 3I3TB 4ANVA 1JQ4A 2KZZA 2V9HA 3PW0A 5ALSA 1R4NI 4FULA 1RQLA 4C8OA 4PYZA 5KG4A 3E9SA 3ZTCA 1E7VA 7ICJA 2M56B 1ET9A 4EYIB 2ZNVC 4KMOB 5HP4A 2KJ9A 2LMCA 4BVUC 2YMQA 4UAUA 2E8OA 3IDWA 2XO7A 2R61A 1UT8A 2SAKA 3DQVA 4HROA 4W9HA 4WAFA 2LM4A 2INCC 3ZDTA 4UB1A 4IW0A 7ICMA 4UB6U 5DBBA 4B9NA 1T0RC 3PLUA 4F71A 1FD6A 4GU2A 4ARIA 4NY8A 1YJ1A 5AM2A 2LBOA 5KT5A 4QZIA 2LPEA 4M8MA 1ZQBA 1SGGA 4M0WA 4CO7A 3NZSA 4M9NA 8ICEA 3DOWA 3SZ2A 1CI4A 3N7SC 8ICUA 1K50A 1ZPSA 1ZYQA 2KXJA 2PPHA 1L3UA 5BYSA 2KJ8A 5GMVA 3NS1A 3RR7A 4OJ5A 2AX5A 4ECRA 1RXVA 2WQYB 4MDKE 3RBEA 3AE5B 4PGYA 3C2KA 4DHJB 5GTHU 2O6VA 5EE0A 2HOFA 8ICLA 5KFXA 4J9LA 1MJDA 3HVZA 4UBBA 1QSYA 1O08A 4J9KA 4F7ZA 1UNSA 2A1JA 4MEYA 3RFAA 3RAXA 3K1RB 5LLIA 4UDUC 2J52A 1JWUD 1YD8U 3E56A 2M17A 2LRWA 3A9JA 4KDIC 2XEWA 1GUAB 3UM9A 3C19A 3UQBA 3L5KA 1JI7A 2MJDA 2VRRB 3RRHA 9ICIA 1ZD2P 1P1AA 4YTNB 5DLFA 1D9DA 1T8EA 1HEKA 3AM9A 1L8OA 1KFSA 3NRWA 1BNOA 3MJ5A 1RLFA 1LVHA 1UA0A 4PYUA 3EC8A 3D2NA 2G1EA 2MSED 1L5UA 5E6PA 5H92C 1RFKA 2ZIWB 1X2IA 3JPNA 4UW9A 1BPBA 1S0VA 3M8SA 1N5XA 1TE2A 4MF8A 7ICIA 3IG8A 2JUOA 4KGTA 2GO7A 4QIWF 1TK8A 4M0AA 2OJWA 3RT3B 2Y1JA 2BW2A 3RJJA 3PZPA 1KOTA 1IG6A 4IG7B 2KHQA 8ICAA 4G0NB 4EYHB 2D6FC 2N9LA 3BINA 1I4RA 3S2AA 1J19A 3SR6A 3IN5A 2YQEA 4TUSA 4IR9A 3WA0A 5HHHA 2YN4A 4UQGA 2IZVB 2LGXA 1PFDA 1I7HA 3HM3A 2JRHA 3NG0A 3BS5A 1QKZA 4FZLA 3DVGX 2QLTA 3CRXA 4FBUA 2BYTA 4XDDA 1E8WA 1KSPA 3Q3FA 4I2CA 2DAFA 1YNTE 3AQFA 1MHXA 1UQVA 3AQEA 1DGSA 3KH0A 4BWMA 1DOQA 5G5HA 1S0MA 4Z6FA 4Y2JA 1WWVA 2WXOA 5CHFA 3ZDEA 1SF0A 3UQAA 3ZNHB 4GXJA 2ZJ8A 3RUIB 3PSPA 4ZHOA 2C9WB 1ZQZA 1S9FA 2I9GA 4OVZA 5DQHA 4JK1A 4KLTA 4EZLA 2ZUDA 4G3XB 2K4HA 2HHUA 3PMNA 5J8YA 4IRCA 4O3OA 3T5KA 3SHQA 3EYZA 1T0SC 4EELA 1PGXA 4ZRIA 3VRBB 2GOLA 5KFAA 4C8MA 2PMZC 1X9WA 2MP2A 9ICBA 2K0PA 2M4NA 4RQ4A 4YL8A 4B0EA 2R18A 2KWVB 1B1ZA 3PVLA 5CTRC 3BY4B 3OJUA 5ALKA 3PZDA 4KSKC 4HLEA 1LV5A 4R65A 1J7AA 1EF1A 4M0WB 2ZUBA 1SV0A 3ZO5B 4Q43A 7ICRA 3ZQ4A 2KJHB 1KN5A 2NBWB 2MRPA 5KG0A 3HK0A 2ZTCA 4NNJB 4QWEA 1STEA 1IIPA 3M6KA 2G4DB 1TS5A 2BS3B 1MPEA 1F0MA 4JWSC 5H8YE 2B21A 2O6VB 4ANWA 5KAFU 4F4XA 3BVGA 5AUKA 4RQ6A 1UT5A 4UB4A 5J0RA 3PVXA 2A3VA 2A1JB 4TV3A 4O3RA 3RJHA 3VR8B 1EF5A 2ZW0A 4ZRJA 2C5LC 3N3KB 1MC8A 1D8LA 4B9SA 4JWMA 2KN5A 4ECQA 2Y9TA 3A9JB 3V6KA 2WWZA 4GXKA 3QUBA 4ECVA 4EZKA 2BKFA 2W9MA 2BZFA 2UVUA 1QQ5A 2FCSA 2MEKA 3A1QA 5GXGB 1WWTA 4MF2A 3GZFA 2WTFA 2RDGA 3Q8BA 4PHEA 4RQ5A 4K7SA 4ANXA 3P1MA 1UHUA 5AM5A 4K4HA 3PSTA 2JEJA 3BQ0A 1DYQA 2FCNA 1T3NA 2REXA 1U47A 2WX1A 2Y5BB 1SZHA 3CYMA 3MGHA 3DV9A 1EWCA 5KHOA 4B6JA 3RNGC 3IRUA 4IM2A 2EAPA 1BGXT 3AEGB 1B4FA 3UQ2A 2F1HA 3D2QA 3KHRA 5E79U 1U49A 3PTFC 5J0QA 3LJ3A 1QOAA 4ED2A 5J2EA 8ICYA 2N1VA 3PRZA 2ZXHA 2ZIVA 3GDXA 1ZQ1C 2J6UA 2K6DB 1YN4A 4JV1A 4IQWA 4DK5A 2DAJA 1JWAD 1URJA 1NOMA 3OJ3A 3U7DA 3KBBA 5ALJA 4UAZA 1UUPA 3QXGA 3BS5B 3TI0A 1ZQEA 3SEIA 4BBNF 4DQQA 2KT7A 4NJCA 4UB3A 3TANA 3ZI4A 2JYEA 1KEJA 5AI0A 4KLEA 1XWLA 2KDEB 2ACZB 1SXEA 9ICOA 3V60A 1JMSA 2J6TA 1NJWA 3QU2A 1CEZA 2WAQF 1WXVA 1VLBA 2D07B 3H8WA 1SXTA 3N9YC 4GIBA 3TADC 2AU0A 5CP2A 3ISBA 3M62B 2H3IA 2IDYA 2OWOA 2G4SA 4JGHB 4PGXA 1MFWA 2AYOB 2GLSA 4P0QA 2AGOA 3PO5A 2LGSA 3SAGA 4OJLA 3L17A 3SD7A 2JPHA 3VR9B 4F1SA 4RQ0A 4OZAA 5B5EU 4P4MA 1ZQQA 1WGHA 2RR9A 3WAOA 2MUTA 4MM3B 4JLCA 4EZ9A 3ZXVA 4GDKA 2FUHB 5AK6A 4KLSA 1L7PA 2R2QA 4BKSA 1FRDA 4DOBA 5BO4B 2MAXA 3DBRI 3R2TA 3ZDDA 2ZJDA 1L7MA 1XLNA 2IJ0A 3U4EG 3WK8A 2M0AA 4BOZB 1YZ7A 2NV3A 1IUEA 5KG1A 3PZ8A 3QJZA 2CHZA 3AEFB 2K3UA 3P4QB 1F44A 4F4ZA 2O6KA 4LVSA 3KOOA 2BT6A 2KX3A 3IAS1 5FR3A 1SJED 2G9HD 3PRMB 5HNKA 5KNIA 4ANUA 1KLGD 1E90A 4IRDA 2FLLA 3NVYA 2KKCA 1L0VB 1I35A 1JIHA 1NK0A 9ICMA 4LJXA 2BWFA 3A1QB 4YVZA 4DQRA 3RB3A 2XNAC 4IM0A 1L0XB 1B43A 1ZQRA 2RQ5A 4Y2YA 5BOMA 1D4BA 3Q3OC 5ALGA 1WGGA 2AHOB 4RNMA 3IHPC 4QW9A 5IAAC 2AQ0A 4I2JA 2PTLA 2CHWA 1LFDA 4G50A 3C1YA 5CX3A 3EA6A 4IUMB 2NRXA 7ICQA 5HHIA 4QWAA 3KLSX 5AM3A 3I76A 1IYFA 4YMNA 4MH0E 4J03A 4IWOA 2ZTEA 1P7DA 2H89B 1ZQXA 2ZIVB 3EGRA 4PS7A 5ALHA 1SKSA 4KKJA 3BK2A 5KHQA 9ICUA 3ZNGC 3CF6E 3PW7A 2YX8A 4Y2XA 1IGCA 4KLFA 2KLCA 4C00A 3BK1A 3HJEA 1FIQA 5IIMA 1VCBA 3C28A 1SSNA 3Q8MA 2JHDA 3JVZX 4YXDB 2Q0ZX 2KOBA 3EFUA 3EHVA 1EO6A 1SE3A 3D32A 3ML9A 1XLPA 3C0RB 1QSSA 2WF5A 1HUOA 4J9OA 1R4MI 1OUQA 2KC2A 3ZJVA 3QA8A 2DQNB 1YQ4B 2F8KA 1GNUA 3F2CA 5C0YA 4DOCA 4E71A 2CS4A 4OVUA 2WF7A 1RYUA 2JEFA 1SWVA 2E3TA 3O0FA 1QQRA 5KG2A 2JF5A 2BBCA 3F5AA 1LKYA 4KLIA 3AMZA 3APCA 4O5EA 1E6EB 2QCZA 2Z0EB 3VHTC 4QZDA 1ZQWA 3EZ5A 2ONQA 4RNNA 3RMKC 3W2DA 3AULA 1F0ZA 3AEDB 2JMGA 1WZ3A 4P0QB 4EBDA 2W9CA 2ON8A 5KFNA 5DQIA 5L1MA 3OTQA 1S5LU 2F77X 4E0DA 2WXGA 3T9LA 2ZCCA 4EOYA 2NR2A 4P7IA 2MUTB 2KMMA 2BHNA 2HCFA 4HPLB 3UF8A 1TZOA 5KFKA 4GDKB 3M9OB 1V1PB 2FPMA 4C56C 3KTQA 5ALRA 2V0GA 4YCXA 4QZFA 4NLKA 1S0OA 2KKPA 2ZNVB 2RSUA 5KFHA 1KFTA 1KBUA 3WU2U 1A70A 3AEAB 3KUZA 4QAYA 5DQGA 1ZUD2 4EX6A 3BYYB 5KTQA 1MHHE 3GIKA 4L1BA 5G5GA 4F2SA 5KFBA 5KL8B 2N9EB 5IINA 1T7PA 3FDSA 1L7YA 5J2KA 5K4LA 3CMMB 5ALWA 3R66C 5D6JB 3RTVA 3AXCA 1KL9A 3KUDB 2DUYA 5DGAA 1SE2A 3D2SA 9ICFA 1NYRA 1TZ1A 2HD5B 2KMAA 4KSLC 4A90A 2HOQA 3UQ0A 1WFYA 2KZRA 1ZJNA 3TEWA 2EZZA 4HPPA 3RI7C 4JX1C 2KTFA 2DZJA 3QZ7A 2Y0SC 1SL1A 3GV7B 2WXJA 4DXFA 2KHVA 1SIFA 1A0PA 2MBBB 1NJXA 7ICSA 5J0UA 2K9XA 9ICWA 4DSEA 3QHTA 3Q8CA 4O9MA 4P2HA 4QZHA 2KFZA 2AQ2B 5AZHA 4KLJA 3RNBC 2E8PA 4ELVA 2M0NA 1KQQA 4FXCA 1DOIA 4XZ4A 2W55A 9ICTA 2BWES 4UAVA 3NASA 4ED6A 2KNBA 2JEGA 2QILA 4DL7A 2DZIA 4M8NA 3Q8FA 1Z19A 4J9NA 1HEZE 3PREA 2PMZF 1UBQA 2LHEA 1I4QA 3MR2A 1IBXA 2KMCA 2KJ5A 4HVBA 2EKEC 4BKGA 1N61A 2ZXIA 2QDFA 1YJJA 2OJRA 5L1LA 2KG5A 4LNKA 2Y3AA 4J9SA 2WYQA 2Z59B 1HZ5A 1OGWA 3JYUA 4JMUA 4NAWA 1CQVA 1Z3EB 1HJPA 4PL1A 4IQTA 3DBRB 2W3SA 4C4RA 1D9FA 1GB4A 2FDRA 5CHWA 4XX5A 1UD7A 2W8KA 3PR5B 4I2AA 2KJRA 4W9JA 1NKEA 2DKXA 1Y8RC 2LZ6A 1LKYB 5KFGA 3RJGA 3TEXA 3LVVA 1NYQA 4HJKA 3AU5A 5EE3A 4CRXA 4HJGE 2ZPNA 4UB8U 4RT2A 4YSZB 7ICGA 8ICWA 3K75D 2W9CB 3PW5A 1AROP 2BKEA 3UXPA 2G5IB 7ICOA 2LEKA 4HDQA 3N32A 4NLGA 4M00A 3NZUA 5AKJA 3FKYA 1FNWA 2LFIA 2JRZA 3SV3A 4GGQA 1Z00A 4RQ2A 4O3MA 2DNFA 1L6VA 2CKHB 2WXPA 2KSOA 4RPXA 2V3NA 3ISDA 1WM3A 2W11A 4NLNA 2W9BA 1FXTB 2UWQA 2WF8A 1SKRA 3OJ4B 4DEZA 3V62A 1EU4A 3TADA 8ICGA 1V49A 1V9PA 5KG7A 1NNLA 3PO4A 1Q3VA 1HA5A 3UMBA 1SL0A 4NJ8A 4Y2RA 3A4SC 2JYTA 4O3SA 5J29A 2GI9A 1P98A 2LGIA 1X6IA 5AKZA 8ICQA 1WIAA 1QOFA 1ZXIA 1L7OA 3PNCA 3T5HA 3IBEA 5EDSA 1R4MB 3TBLD 3EPIA 3AH7A 3SEBA 5IA7A 4DXAB 4FHJA 4K7UA 5ALTA 8ICRA 1Q3UA 3WKBA 4MFFA 3L54A 1HTOA 4U6PA 2J0JA 4NWIA 4MFCA 2MLBA 4WJQA 4BWJA 4RF0A 3LB8C 5KFYA 3WK5A 4ED3A 1S3SG 1WY8A 4RGTA 1KLVA 2MBOA 2DKZA 2IYDB 5HMMA 2AH5A 2L3ZA 2MA1A 5FR6A 4C80A 1JW9D 1C76A 4DQPA 4PT5A 2IO1B 1KH0A 4FN2A 5CB1A 2RGFA 2D3CA 1GAQB 3BZKA 3IG5A 3RJFA 3OAWA 4DFDA 2JZBA 2J0MA 1SBBB 3WAPA 4B9KA 4NXZA 2XN9C 5AI6A 5ALDA 4IM3A 2L8JA 4CF4A 4O3QA 1DRGA 1TIFA 2HHXA 2DENB 3N1YC 2WDVB 4ICUA 1GB1A 2LM1A 2PFOA 2GH1A 4JPSA 4NAWB 2EZXA 3ETLA 2IY1B 1GPXA 2WLBA 3R9KA 4Q44A 2ASDA 1SWWA 1J2MA 7ICNA 1XSLA 1V6EA 1M6YA 5L1KA 5IILA 3GU3A 5C5JA 3AE4B 2DZKA 1WJUA 3KQ4A 4F8RA 2CJOA 4UAWA 3N1XC 2W82A 5EOZA 2BPCA 4LNFA 3GS2A 2JXJA 3H1UA 3IP4B 4PK1A 4A3OA 4ECZA 2FMQA 2CXYA 1SEBD 1C4PA 5D7GA 3UI3A 1ZRNA 2QC8A 2WXIA 3DEEA 4W9CA 1PGBA 5KFRA 4PHPA 1BXTA 1Q1OA 2KWUB 3RULA 3PY8A 5ALPA 2XICA 4FO6A 3RH4A 1KFYB 2QKQA 2HHSA 2DX5B 2IHNA 2Z7JA 1Z00B 4Y2PA 1N5WA 2PXIA 4ZYNA 5HMLA 3IG3A 4DDGD 2N4FA 3RAQA 4QZ9A 1JALA 2H3QA 2KSOB 2RDBC 2YMMA 2KE7A 2W43A 2HMXA 3M63B 1Q8KA 2G5HB 2VA3A 3VRAB 1FM0D 1T6BX 4AJYB 2W9BB 2GWSA 1UGJA 2J4XA 2VZKB 3NS8A 3C5FA 2BYEA 2K4PA 5CRXA 4GLXA 5ALFA 1YN5A 1L3TA 7ICLA 4M9LA 1NDDA 5DG9A 4YD1A 2HTHA 4R64A 3ZKJC 3A0BU 2GOWA 4TUUA 2WX0A 2I2YA 3RCZA 5DB7A 3GE8C 2XCAA 2LRUA 8ICZA 1VRAB 9ICQA 2WNMA 3MR6A 4NAMA 2KP7A 3CSFA 3F5EA 1T5XD 2V4IB 3OHAA 3BS7A 4QWDA 1JWMD 2ODGA 2HVIA 3JPTA 2OEDA 3L4PA 1BPZA 4ACOA 4XUSA 3P2BA 5J0SA 3JPRA 4DL5A 1XS9D 1LM8B 3PX0A 3RZFA 1E7PB 4XWWA 5IIIA 4DS4A 4W9EA 1F5SA 2KK0A 3PSFA 3HKZC 5AK5A 3V7LA 4LNIA 4K7WA 2V3PA 3AL0B 1Y88A 3GIJA 2FI1A 4WJOA 2LKYA 3KVFB 5L9XA 2J42A 4PL2A 3ZYYX 2RHFA 2BQUA 5L83A 3H40A 2X8XX 2JZBB 4Q8EA 2LJIA 2BCRA 1L8LA 1WM2A 2KV2A 5KT4A 2FPKA 4G3IA 4GDLA 3Q8KA 2MJ3A 4YFKA 4GSWA 3OPXA 3FYHA 1OEYJ 3KYCD 2LVQA 4LNOA 3ZNID 1V9JA 1WG8A 4F5QA 3I57A 1C1YB 1RQNA 2IBIB 3I5JC 2BPGA 4AP9A 2LASA 2M1MA 5BYQA 2KWDA 5AZFA 3DHIC 5AKIA 3F2DA 4KZCA 4JV0A 3W5VB 1N6ZA 3DWGC 1FMAD 2C7MB 4I27A 2GRIA 2C22A 8ICBA 4B9MA 4Z6DA 2CR5A 3A9KA 5ALQA 4Q8FA 4PGQA 4TQSA 4KV2A 2CN1A 1Q5WB 1OW5A 5AKYA 2W3RA 3C29A 3AECB 4IC7B 4W9LA 4BKTA 3QNMA 3NGDA 4DOAA 2M0XA 1F1HA 3V6EB 3PGEA 4FADA 3KZXA 4RPZA 3L10B 4RNAA 4G9BA 2NRTA 3NTUA 2JVCA 1QF6A 5KFCA 2K60A 2Y0SF 4ED0A 4DL4A 2PJHA 1ZRMA 1L2NA 2F3NA 4F5PA 1V86A 3ONNA 2AQ3B 2PMVA 3TUOA 1NK9A 1AYFA 1B0XA 1A76A 4OJPA 1VD2A 1RYRA 3QC8B 3RPFC 4KLMA 1MVKA 2BCSA 3AE1B 2Y9UA 4I2GA 4MHVA 2I1JA 4RQMA 1UPHA 3H8JA 9ICVA 3KHGA 1BPXA 4DHZE 2FAZA 2HBJA 1XC9A 1J97A 3HRDD 2TSSA 2FIDA 4URKA 4MH8A 1MA7A 1AARA 4M9JA 3A33B 2YMLA 1D8YA 4QWBA 2ZVOA 3H8HA 3QU7A 1JMLA 2WU5B 1WX9A 5DKWA 2F2AB 3LDZE 1WJ4A 3ZDMC 2WFAA 1EU3A 2ZVNA 4GXIA 4DQOC 1HXYD 1P7EA 3DPDA 5ALNA 3X0WA 2MRLA 2LUEA 3RNAC 1CMXB 5KT3A 2WB1C 5J0YA 1FNUA 4QZEA 1WUDA 1AN8A 1PQSA 2BB5A 1Z1VA 2E5SA 3MFHA 4M9HA 3K9PB 5C2TB 5LXHA 3Q8QB 5DDYA 4IWPA 4MM3A 1QSLA 3WKCA 2HHTA 3UIOB 4LZGA 4NM2A 4KIKA 2C28A 4WURA 2PI5A 2W9NA 3LYYA 4LJOB 4IL6U 3LYSA 5KFZA 2EELA 4GC7A 1RAXA 4HDOA 1V81A 2G0AA 1UBIA 2IGDA 5J2GA 4DSJA 1ZQTA 1C77A 1I4XA 1WYGA 2C2DA 3NZ3A 3W1YA 4GDLB 3TSSA 4US9A 3ENEA 2FMPA 2F8LA 2NO4A 3EW9A 5KFPA 2K8CA 4P6VF 8ICHA 3THVA 2OHFA 9ICRA 4KX3A 4ELTA 2OH2A 1ET6A 3DBHI 1QILA 3URYA 3PX4A 4F3OA 5C1ZA 1CUKA 3B2FA 5ALYA 1ZXHA 3PRPB 5JRTA 2LXCA 1R4NB 2KVCA 5CR0A 4DLGA 2PKOA 4FFDA 1BVSA 3PZ7A 2ZPYA 5J2FA 4JWUC 4DFPA 5BOLA
chains in the Genus database with same CATH topology
5HHDG 3AB5A 4A6QA 3P4RB 2QEJC 3ZJVA 1OQQA 1P7FA 3KWVA 1YQ4B 4AS1A 4J3OD 2PLPA 3BZDB 2JXTA 2WDRB 2YEPF 1C9FA 3ABVB 3W1SA 1TY0A 2E3TA 1QQRA 2WXHA 2BBCA 2WXLA 4ARCA 1TS4A 3AMZA 3IT4B 5HG2A 1E6EB 4RF1A 4YSXB 1ZP0B 2ONQA 3W2DA 1F0ZA 5C3JB 3AEDB 4N58A 1ESFA 1C4AA 4L2YA 2DWQA 3U2SC 4HEA1 4ZRQA 2QMTA 2ON8A 2WXGA 5TSSA 3IAM1 2JU6X 2WU2B 2KMMA 2J53A 2BS4B 1TZOA 4GDKB 1V1PB 4C56C 3C8YA 1N60A 2V0GA 1UWXA 5LNK1 3KWLA 1GOZA 5EE9A 4OW0A 1A70A 3AEAB 5D3DA 1ACCA 1ZUD2 3BYYB 1HZ6A 1MHHE 2M19A 4RH6A 4L1BA 1WGKA 5G5GA 1E10A 2WXNA 1TY2A 5AUIA 4LLGM 4RGOS 3V3XA 2RMMA 1VJKA 1CK1A 4OZCA 1SE2A 4A90A 1NYRA 3TEWA 1QOGA 1YMHE 3SFDB 4IKGA 4JX1C 1JWSD 1VDVA 1YJIA 1CZPA 1Y56A 2WXJA 1IBXB 4IDIA 3R8BA 3W5UB 3AE3B 4DXFA 4US8A 1XCQL 4KX6B 1V1PA 1PUTA 2GB1A 1NVID 2K9XA 5BMIA 1XCTL 1L5PA 5HFYA 3FILA 3U52E 3Q8CA 3U7ZA 2N0SB 3GB1A 2AQ2B 2MJEA 1L0YB 4FXCA 1DOIA 4MT5A 2W55A 1D6EC 1V8CA 2JSVX 2QILA 4WWMA 1DOYA 3HUIA 4HKQA 2WXQA 3Q8FA 3WCQA 1HEZE 4RGNA 3AN1A 2LHEA 1I4QA 2CU3A 4Q2JA 2WXMA 4JE3B 1IBXA 3AE7B 1TKYA 2K22A 1N61A 3NVZA 2INPE 1YJJA 1K52A 4LK0M 2NMQA 1ZDXA 2Y3AA 4REZA 1TJEA 1VZ8A 1HZ5A 2PVGC 2QIEB 1QT9A 2DYMA 4WIPA 1SB3C 1PDXA 1CQVA 1XEEA 3Q8EA 1I4GA 2JZPA 4DXGA 2W3SA 2L1AA 3O13A 1FRRA 1GB4A 2H88B 1V97A 1JQ4A 1OFFA 1L6UA 2HDEA 5I4DA 2WDQB 3E9SA 3TEXA 3BVMA 2JX5A 1NYQA 1EM7A 1WXQA 4XDCA 2M56B 4GLSC 1VR9A 5EE3A 1ET9A 4HJGE 2LMCA 4YSZB 3AV8A 1TS3A 1B9RA 1RWSA 2R61A 2FBWB 4B0MA 1XLOA 2BB6A 2SAKA 4HROA 2WXFA 4WAFA 2LEKA 1WRIA 5MPOA 3GP7A 1FNWA 2LFIA 5EE1A 3MFGA 3TEZA 3J9CA 1L6VA 1QOBA 1FD6A 2WXPA 1FFUA 4ARIA 2ICIA 2V3NA 1M4VA 1E0ZA 4M0WA 1EU4A 1ZPSA 5D3IB 1K50A 4ZOHC 1OQRA 3P63A 5BYSA 1HA5A 3NS1A 4P16A 1BUIC 2JYTA 2NTTA 1FCLA 3SFEB 1DGJA 2GI9A 2AX5A 2LGIA 2WQYB 1L4ZB 3AE5B 1QOFA 1ZXIA 3AE8B 5EE0A 1V1OA 3HVZA 3R2IA 1UNSA 2FUG1 3AH7A 3SEBA 4UDUC 2J52A 1JWUD 3FILB 3E56A 1TS2A 1FXAA 2FE8A 1YN3A 2MJDA 1C79A 2L52A 4RF0A 3LB8C 4YTNB 2DBYA 2KAJA 3AM9A 4CQNA 4RGTA 4KGRA 3MJ5A 3ZJUA 2RDHA 2G1EA 2ZW1A 3AEEB 1XXGA 4MACA 4R3DA 5H92C 4C80A 1JW9D 1C76A 1RFKA 2PW9A 3OWEB 4PT5A 1KH0A 1N5XA 1GAQB 2SEBD 4IOIE 4KGTA 3IT6B 2BW2A 1FEHA 1SBBB 2XN9C 4A8XC 4AQ7A 1VZ7A 2N9LA 1I4RA 3TEYA 1MI0A 3SR6A 2X38A 2WDVB 2HTME 1GB1A 2CJNA 3FC4A 1TKGA 4NAWB 4JPSA 1PFDA 2D5GA 1I7HA 1GPXA 3BYTB 2WLBA 1QKZA 1FFVA 3AE9B 2JWUA 1F2RC 2BYTA 4XDDA 3NVVA 1YNTE 3AE4B 1D5ZC 1MHXA 4YTMB 3KQ4A 4XWTA 2CJOA 1YQ3B 2I38A 4RCOA 5G5HA 2W82A 3GS2A 2WXOA 2E6XA 1SF0A 5FK9C 2B76B 4ZHOA 4L23A 1SEBD 1C4PA 2AQ1B 4OVZA 1JRPA 5D7GA 3UI3A 1BMLC 2WXIA 1KLUD 2DLBA 2LUMA 3ETRA 1BXTA 1PGBA 3LXFA 1PGXA 1KFYB 3VRBB 5T8IA 3AE2B 2WXRA 1N5WA 2K0PA 3I9V1 1C78A 4B0EA 3BIID 1JALA 1B1ZA 4RGMA 1SE4A 1FNVA 3VRAB 1J7AA 1FM0D 1T6BX 1UGJA 3NUHB 2J4XA 2VZKB 3P4PB 2N7JA 1L4DB 4H2AA 3ZQ4A 1TYGB 2RPVA 2KN4A 1YN5A 3ZJTA 2WS3B 5BMGA 1STEA 3MP9A 4YT0B 2I2YA 1TS5A 1C4CA 2IGGA 1VRAB 2BS3B 1MPEA 1PYWD 2KDMA 2WNMA 4NAMA 5H8YE 1VZ6A 4JWSC 1T5XD 2V4IB 1XLQA 3W9CB 3BVGA 5AUKA 2Q5WD 1LO5D 2LHDA 1JWMD 3VR8B 3T3OA 2WP9B 1D5MC 2ZW0A 2OEDA 3L4PA 2QSDA 3Q69A 4A9AA 3AE6B 3ZGZA 1E7PB 2L83A 2MEKA 4XWWA 4YTPB 1R7SA 2INNE 5GXGB 1WWTA 1ENFA 4HRSA 2RDGA 3Q8BA 1E9MA 1ROEA 3P1MA 3NVWA 2DYOA 1AW7A 2V3PA 1DOXA 1DYQA 1HQRD 1F77A 4USAA 2J42A 2Y5PA 2BTEA 1EWCA 3ZYYX 5JXVA 2LJIA 3AEGB 4OHJA 4A55A 2WXKA 1QOAA 2MJ3A 4KGSA 1FXIA 1YN4A 1Q10A 2BS2B 3I57A 1JWAD 3PO0A 1IGDA 3P42A 2Z8LA 1UUPA 1TKEA 4ZRPA 2KWDA 2QJLA 5BYQA 2N9KA 1D5XC 3W5VB 4O1NA 3DWGC 1FMAD 1JWBD 2GRIA 2NTSA 3FAHA 2L32A 4NJCA 4RFBA 1EWYC 4ITKA 2JYEA 4LTUA 2KACA 2Y5CA 3AECB 2W3RA 3B2GA 1I4PA 1N63A 1SJHD 1UWMA 1AWDA 2ACZB 4TQ0A 4RNAA 1QF6A 1VLBA 1SXTA 3N9YC 2PMVA 1WSPA 2AQ3B 3TUOA 4KKIA 1AYFA 3BVZA 3RPFC 2IDYA 5E6JA 1MVKA 3AE1B 4C7YA 3VR9B 4YWGG 3BWUD 1FCCC 1N62A 3IXSA 4OZAA 1PGAA 4MM3B 1SIJA 4XE0A 4TMAB 4WH4A 3P4SB 2TSSA 3HRDD 4TSSA 4MH8A 3B9JA 3MHZA 2YEPB 4NZLB 1T3QA 3H8HA 1FRDA 1FO4A 2W54A 2PVOD 1JMLA 2JQRB 2WU5B 3R2TA 2IGHA 1ZDVA 1XLNA 3EUB2 1RM6C 2IJ0A 3U4EG 2M0AA 1IUEA 3VQIA 4DQOC 1EU3A 1K53A 1KRHA 3AEBB 1J7CA 4ZYSA 1HXYD 1XO3A 3PZ8A 1P7EA 3AEFB 2K3UA 3P4QB 3IAS1 2BT6A 1NENB 5FR3A 1SJED 2G9HD 2EKIA 2MH7A 5HI1A 4C7ZA 4WQMA 1KLGD 1FNUA 1XF5L 4ZHPA 1JCKB 3DWMA 3NVYA 5BYRA 1AN8A 2BB5A 4TQ1A 1L0VB 3Q8AA 5C2TB 1ZE3D 1F2RI 1J7BA 1CJEA 1NI3A 2XNAC 1L0XB 3HVDA 1KTKA 3RFZB 2KQ4X 4WURA 1K51A 3LYYA 1D4BA 2PIAA 4N59A 1KF6B 2EELA 2PTLA 3EA6A 2IGDA 1RYJA 1I4XA 1C77A 4YSYB 3CIRB 3KLSX 3MC0B 1WYGA 3NRZA 3NZ3A 3V05A 4GDLB 3TSSA 4US9A 2K5PA 3T3NA 5FKAC 2H89B 2VZKD 2IPKD 4OZBA 3EGRA 4P6VF 1ZOYB 2OHFA 4KKJA 3BK2A 4N6EB 5BMHA 3CWIA 3URYA 1ET6A 1QILA 4EE2A 4HKZE 1IGCA 3B2FA 1ZXHA 3BK1A 1FIQA 1QLBB 1SSNA 1I4HA 4YXDB 2PKOA 3PZ7A 1SE3A 4D2KA 4JWUC 1XLPA 1NEKB 1JROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFV A;  3W5V B;  3AE9 B;  3AB5 A;  3DWG C;  3P4R B;  1FMA D;  1JWB D;  2W3S A;  1OQQ A;  1FRR A;  3NVV A;  1YQ4 B;  3FAH A;  2H88 B;  1V97 A;  3AE4 B;  1JQ4 A;  1EWY C;  4ITK A;  1OFF A;  4YTM B;  2WDR B;  1L6U A;  2CJO A;  1YQ3 B;  3ABV B;  4LTU A;  2Y5C A;  5G5H A;  3AEC B;  2W3R A;  2E3T A;  3B2G A;  1SF0 A;  1N63 A;  1UWM A;  2ACZ B;  1AWD A;  2WDQ B;  2B76 B;  4ZHO A;  2JX5 A;  1NYQ A;  1WXQ A;  1JRP A;  2M56 B;  1QF6 A;  5EE3 A;  3AMZ A;  1VLB A;  1E6E B;  4YSZ B;  4YSX B;  3ETR A;  3LXF A;  3AV8 A;  1ZP0 B;  1B9R A;  1RWS A;  1AYF A;  2FBW B;  1XLO A;  4HRO A;  5C3J B;  1F0Z A;  3AED B;  4N58 A;  1KFY B;  2LEK A;  3RPF C;  1WRI A;  3VRB B;  5MPO A;  2DWQ A;  3AE2 B;  3AE1 B;  1N5W A;  5EE1 A;  4C7Y A;  3VR9 B;  3BII D;  2WU2 B;  2KMM A;  1JAL A;  1N62 A;  2BS4 B;  1L6V A;  1XLP A;  1QOB A;  1FFU A;  1SIJ A;  1N60 A;  3VRA B;  1J7A A;  1FM0 D;  3P4S B;  3KWL A;  5EE9 A;  3HRD D;  3W9C B;  1E0Z A;  1GPX A;  3P4P B;  3B9J A;  1A70 A;  1TYG B;  3AEA B;  1ZUD 2;  2M19 A;  1T3Q A;  2WS3 B;  1FRD A;  1FO4 A;  5G5G A;  1WGK A;  1E10 A;  2W54 A;  2PVO D;  2WU5 B;  2JQR B;  4ZOH C;  1OQR A;  3P63 A;  1XLN A;  3EUB 2;  1RM6 C;  5AUI A;  4YT0 B;  1IUE A;  1VJK A;  3NS1 A;  1KRH A;  3AEB B;  1J7C A;  2BS3 B;  1XO3 A;  3SFE B;  1NYR A;  1DGJ A;  3AEF B;  3P4Q B;  4JWS C;  2AX5 A;  5H8Y E;  2BT6 A;  2WQY B;  1NEN B;  3AE5 B;  1QOG A;  1XLQ A;  2EKI A;  2MH7 A;  5AUK A;  1QOF A;  1ZXI A;  2Q5W D;  3AE8 B;  5EE0 A;  4C7Z A;  4JX1 C;  4WQM A;  3SFD B;  3VR8 B;  3HVZ A;  2WP9 B;  4ZHP A;  3DWM A;  3NVY A;  1VDV A;  3L4P A;  1YJI A;  1CZP A;  4A9A A;  3AH7 A;  4IDI A;  1L0V B;  3W5U B;  5C2T B;  3AE3 B;  4US8 A;  3AE6 B;  4KX6 B;  1PUT A;  1J7B A;  1CJE A;  1E7P B;  1FXA A;  1NI3 A;  1L5P A;  1NVI D;  2K9X A;  1R7S A;  2L83 A;  4YTP B;  1WWT A;  5GXG B;  4HRS A;  2N0S B;  2MJD A;  1E9M A;  1ROE A;  3P1M A;  2PIA A;  2L52 A;  4N59 A;  3NVW A;  1KF6 B;  2MJE A;  3LB8 C;  2DBY A;  2KAJ A;  4FXC A;  3AM9 A;  1DOI A;  4YTN B;  1DOX A;  2W55 A;  1RYJ A;  4USA A;  1V8C A;  4YSY B;  2G1E A;  3CIR B;  3AEE B;  5H92 C;  3ZYY X;  1WYG A;  3NRZ A;  4C80 A;  1JW9 D;  4WWM A;  1DOY A;  1RFK A;  3HUI A;  4US9 A;  2K5P A;  3AEG B;  1N5X A;  1GAQ B;  2H89 B;  1QOA A;  2MJ3 A;  3WCQ A;  4P6V F;  1ZOY B;  2OHF A;  3AN1 A;  1FXI A;  4N6E B;  2CU3 A;  3CWI A;  3AE7 B;  1TKY A;  3SR6 A;  2BS2 B;  1N61 A;  2HTM E;  3NVZ A;  2K22 A;  2WDV B;  3B2F A;  2CJN A;  1FIQ A;  1JWA D;  1QLB B;  3FC4 A;  1TKG A;  1YJJ A;  3PO0 A;  4JWU C;  1TKE A;  1TJE A;  2QJL A;  4YXD B;  2PVG C;  2PKO A;  1PFD A;  2QIE B;  1I7H A;  1QT9 A;  1SB3 C;  1PDX A;  1NEK B;  1JRO A;  2WLB A; 
#chains in the Genus database with same CATH topology
 5HHD G;  4IS7 A;  2G45 B;  4XYC A;  5J2A A;  4FBT A;  4A6Q A;  3A9K B;  4J9Q A;  1E5W A;  4QZA A;  2QEJ C;  1OQQ A;  2LD9 A;  2WDT B;  2B0C A;  2E1E A;  1GJZ A;  2GLE A;  1U45 A;  1C9F A;  1QZE A;  3ABV B;  3QAR A;  4A20 A;  1UCV A;  4I2E A;  3C23 A;  2KZM A;  3WIM A;  2ASL A;  2QAR B;  2WXL A;  1TS4 A;  5DPS A;  1SKW A;  5HG2 A;  4YSX B;  2W7P A;  3TL5 A;  1HIW A;  2G09 A;  3ISC A;  1ESF A;  1YQB A;  2A19 A;  3UMG A;  4GIV A;  2LWP A;  1JX4 A;  4GMV A;  5C23 A;  4ZRQ A;  4QNL A;  3IAM 1;  3PV1 A;  2FCM A;  3DDH A;  3KYD D;  4HAI A;  2XCP A;  3AUO A;  3PSI A;  4CGZ A;  2JZ3 B;  5AHX A;  2PE6 B;  3C8Y A;  1N60 A;  4F72 A;  1UWX A;  2VJ5 A;  4RM9 A;  3ZNZ B;  3MR3 A;  5LNK 1;  1C3T A;  5J2R A;  2BPS A;  5J0P A;  4LDT D;  3C1Z A;  5F3X B;  4RH6 A;  4K4I A;  1TTN A;  1NBF C;  1Q46 A;  5L1I A;  1TY2 A;  1WX8 A;  2WXN A;  3SAF A;  4IWQ A;  1ED1 A;  3V3X A;  2R2O A;  1JRO A;  5KT2 A;  4Y2S A;  2NO5 A;  1HUZ A;  5AM1 A;  1RRB A;  7ICK A;  2JT4 B;  5J0X A;  5AIC A;  2DF4 B;  4HCN B;  2PFN A;  1YMH E;  2ZEQ A;  2YVC A;  2IOF A;  4TQR A;  4BKS D;  2W7O A;  1VDV A;  1YJI A;  9ICL A;  1CZP A;  3G6X A;  3B0A A;  3BQ2 A;  3ZLZ A;  4RQ8 A;  2XVT A;  1E8Y A;  4IDI A;  3R8B A;  4R66 A;  3W5U B;  3KHH A;  4B9U A;  1SE9 A;  1XD3 B;  4KIK B;  2KFK A;  2HHW A;  4MEM A;  4US8 A;  4KX6 B;  1V1P A;  2HBK A;  2JEI A;  1L5P A;  3FIL A;  4UB2 A;  4RU9 A;  3U7Z A;  2XK5 A;  4DBG A;  3HW8 A;  2N0S B;  1ZQJ A;  3L08 A;  1Z5S B;  5J18 A;  4ICV A;  1L0Y B;  1P3Q U;  4UAR A;  3T5L A;  2MBE A;  3VH3 B;  4GFJ A;  3TAR A;  2D3G A;  2NPT A;  3VAW A;  1XT9 B;  5AI9 A;  1D6E C;  5DPT A;  4WWM A;  2RDI A;  4NLB A;  4W9K A;  2D3B A;  2KQS A;  4HXD A;  4HKQ A;  3AU6 A;  2K8C B;  4DO9 A;  4MJS A;  3LDA A;  3L13 A;  2AGP A;  5DB9 A;  3AU4 A;  5KG5 A;  4YD2 A;  4HWI B;  2CU3 A;  2WXM A;  5KFU A;  2H5X A;  3AE7 B;  4JE3 B;  2K22 A;  3NVZ A;  4DQS A;  1K52 A;  2UU7 A;  1L7N A;  4QZ8 A;  2FLN A;  4LK0 M;  2JH7 A;  1ZDX A;  5ALI A;  3C2M A;  2IOH A;  4C0Z A;  1TJE A;  1GO3 F;  5DDM A;  4X5V A;  2DYM A;  3RB0 A;  4BAX A;  4JB3 A;  1SB3 C;  1PDX A;  4W9D A;  1XEE A;  4K81 A;  3T8M A;  1I4G A;  2K8B B;  1RFA A;  4M02 A;  2L1A A;  1NJZ A;  1FRR A;  3IVF A;  2L05 A;  1V97 A;  1X9X A;  4DLE A;  4Q45 A;  2AQ4 A;  2N7D A;  4F4Y A;  1L6U A;  2HDE A;  3H4D A;  2LJ5 A;  4NPN A;  2HHQ A;  2K89 A;  8ICV A;  4DWI A;  5AZG A;  4EEW A;  3IM1 A;  1PVR A;  2LI5 A;  4C4V B;  1UZX B;  3TMP B;  2JX5 A;  4XDC A;  1ZJM A;  2BKR B;  2K25 A;  2WGS A;  1VR9 A;  4M2Y A;  2VAN A;  4GLS C;  4FA6 A;  4BUG A;  3TQ1 A;  2FBW B;  2FNJ B;  1ZQK A;  5MPO A;  2E1F A;  2DZM A;  3EFC A;  4TUR A;  2KIC A;  5EE1 A;  4B95 A;  9ICG A;  4KLU A;  3SEN A;  2KLG A;  4PS8 A;  1ZQV A;  3HKZ F;  1QOB A;  2DHZ A;  2P66 A;  4JQW C;  3K1Z A;  4PHA A;  2M9N A;  2ICI A;  2K1F A;  1OQY A;  2VH2 A;  5KT7 A;  1M4V A;  4FJZ A;  2G3Q B;  1E0Z A;  1Q0W B;  1WX7 A;  9ICE A;  5JHB A;  2KN7 A;  3DVN V;  1I42 A;  3PML A;  2YMP A;  5D3I B;  4WQO B;  4ZOH C;  2LVO A;  5J0O A;  5JTI A;  2L7R A;  3DBH B;  4CF5 A;  2NTT A;  4BXO A;  1FCL A;  4BX9 C;  4B9L A;  3SFE B;  1DGJ A;  3QU4 A;  3PSE B;  1L4Z B;  4WWN A;  1UA1 A;  2MBQ A;  3VFK A;  2JGA A;  3ZD9 A;  3GII A;  3GV8 B;  1ZQN A;  3QWZ B;  2KFK B;  1IV8 A;  1FEZ A;  3QE9 Y;  3R2I A;  3QAQ A;  1XNS A;  5KFW A;  3FIL B;  2N9P C;  4FS2 A;  2XK5 B;  4KIT B;  1X9S A;  4DFM A;  1ZQM A;  1TS2 A;  1FXA A;  2KO3 A;  1ZQL A;  1Z2M A;  1H38 A;  3H8S A;  4FJV B;  1YN3 A;  4Z6C A;  1XO1 A;  1C79 A;  3B1L X;  2NPT B;  2L52 A;  2D11 A;  1B9R A;  4O3P A;  4KGR A;  3H0R B;  1N48 A;  3ZDC A;  2RDH A;  3SU8 X;  5KFD A;  4EEY A;  4RQ7 A;  2C2E A;  1IM4 A;  3IHQ B;  3EWA A;  4MJS B;  2PW9 A;  3OWE B;  8ICS A;  3HIZ A;  1UF0 A;  4RM8 A;  4IC9 A;  2KVZ A;  1S76 D;  3HT3 A;  1NJY A;  3JPQ A;  3APF A;  4P0P A;  4AQ7 A;  3W1S C;  2E8M A;  1QTM A;  3ED5 A;  5EWE A;  3Q6B A;  3PW4 A;  3TEY A;  3H0L B;  2X38 A;  1KM7 A;  2HTM E;  2ASJ A;  4GB9 A;  5IN7 A;  3NY5 A;  3X23 A;  3FC4 A;  1WI0 A;  5DCN A;  3VDZ A;  4QIW C;  3TJP A;  2IHM A;  4P4O A;  5DGB A;  4UB5 A;  2NS5 A;  2B3A A;  3UIP B;  2DFL A;  1L3V A;  2JWU A;  2WHI A;  1F2R C;  5IO9 A;  4C4T A;  2AGQ A;  3VUX A;  5TR5 A;  3V6C B;  4PS3 A;  3IV6 A;  4J9M A;  5LXI B;  4A3P A;  1YQ3 B;  3H8M A;  3E58 A;  5KG6 A;  5KFL A;  2QB0 A;  5FK9 C;  4L23 A;  2AQ1 B;  1BML C;  3UMC A;  2F1I A;  4WJ3 B;  2DLB A;  3SMV A;  3ETR A;  3SV4 A;  5AI5 A;  5AKL A;  2RP5 A;  2YY6 A;  3LXF A;  2EAN A;  3OSN A;  2KX0 A;  3RNC C;  4F91 B;  1ZGU B;  3AU2 A;  4YXM A;  2WXR A;  3I9V 1;  2ALZ A;  3BII D;  4F2R A;  5IKC M;  3MFI A;  2XC9 A;  1NK6 A;  2XGQ A;  4LNN A;  5AIA A;  1FNV A;  2B6G A;  1JXE A;  3PT2 B;  2KFJ A;  1OEY A;  3NUH B;  4J6I A;  2JY6 A;  1L4D B;  7ICH A;  7ICV A;  1TYG B;  2KN4 A;  2RPV A;  5JUM A;  1BPD A;  3ZJT A;  1Z4N A;  2WS3 B;  4YQW A;  2CRX A;  2J0K A;  4EUT A;  3LWL A;  3TAQ A;  5BMG A;  3ZW3 A;  4BXO B;  1MQ2 A;  1WWU A;  3PW2 A;  4MSM B;  1ZQC A;  3OLM D;  4W9F A;  2ZZP B;  8ICF A;  4KDL B;  4P1B C;  4U7C A;  1VZ6 A;  2W8L A;  3N7P D;  3ZRC A;  3JPP A;  1A77 A;  1WJN A;  4EKU A;  1YZ6 A;  3T3O A;  2WP9 B;  1D5M C;  3M7D A;  3C2L A;  3Q69 A;  3JPS A;  1NI2 A;  1WH3 A;  4JIO U;  2ES6 A;  4Y2U A;  5GTI U;  4CYE A;  2BF8 B;  3AE6 B;  3ZGZ A;  5AIB A;  9ICC A;  7ICT A;  1R7S A;  2INN E;  5KFE A;  1ENF A;  3B08 A;  4HRS A;  3MBY A;  3I28 A;  1K1S A;  4RQN A;  4FBJ B;  2KEY A;  3QZ8 A;  3QQ8 B;  3NVW A;  2DYO A;  1NZP A;  2NBV B;  8ICJ A;  1DOX A;  2P6R A;  4FS1 A;  1S8O A;  1F77 A;  4USA A;  4WWP A;  2BTE A;  5KG3 A;  2BCQ A;  8ICC A;  5JXV A;  1NZB A;  3WK9 A;  4P0P B;  2N1W A;  2WXK A;  2ASQ A;  8ICK A;  3MR5 A;  2Y1I A;  4DWF A;  3UXO A;  3VVW B;  5L95 C;  1FXI A;  1TGZ B;  5DBC A;  1CRX A;  4TUP A;  1NK7 A;  1QH9 A;  5DPW A;  3PO0 A;  4TKN A;  3P42 A;  3EEC A;  3QK0 A;  5E6N A;  1TKE A;  4ZRP A;  2LI6 A;  3QEB Z;  4UAY A;  3H0M B;  4NM1 A;  5AKE A;  5IP4 D;  8ICI A;  4DHJ D;  4IQV A;  4O1N A;  2I6X A;  5D94 A;  1N56 A;  4BGD A;  4LJP B;  2YB4 A;  2NTS A;  3FAH A;  2D3A A;  4RFB A;  2NVU I;  3ONS A;  3DVN U;  2R8G A;  4M47 A;  5JH5 C;  2QB0 B;  1T4G A;  2KAC A;  2P35 A;  3RB6 A;  3B2G A;  4BBN C;  1SJH D;  3M8R A;  1UWM A;  2V1Y A;  2KZ3 A;  1KRP A;  3KD3 A;  1U4A A;  4PPX A;  5DPR A;  3PR4 A;  1S10 A;  1ZQI A;  3ZIM A;  5JZE B;  4NLZ A;  4EEN A;  1WJ6 A;  2BDU A;  2GBK A;  2ZJ5 A;  4XRH A;  4KKI A;  2FLP A;  3BVZ A;  2BPF A;  1RPL A;  4PH5 A;  4DSF A;  5E6J A;  2ZIX B;  3Q3J A;  5AK4 A;  9ICP A;  3HHM A;  1FCC C;  1N62 A;  3MGV A;  3RB4 A;  1KJT A;  3IXS A;  3MTN B;  3N1Z C;  5DLG A;  3RJI A;  1SIJ A;  2KYW A;  4TMA B;  4WH4 A;  3PLV A;  1ISN A;  4KN7 A;  3MHZ A;  2YEP B;  4NZL B;  3SD5 A;  2LMR A;  1T3Q A;  4KZ0 A;  2W54 A;  2PVO D;  2HSZ A;  3BJY A;  2IGH A;  3EUB 2;  2LXA A;  1WR6 E;  4NJ7 A;  3VQI A;  3AEB B;  2ZJA A;  2D10 A;  1JN3 A;  1DXS A;  1NEN B;  5E6O A;  3KFU F;  5HI1 A;  4AP4 C;  4C7Z A;  1SXD A;  7ICU A;  4ZHP A;  1JCK B;  1H8C A;  2L0F A;  5BYR A;  3OGU A;  3GIL A;  2BYV E;  4TQ1 A;  3Q8A A;  3ALB A;  2NBU A;  3MAB A;  5KFI A;  2NRZ A;  3HIL A;  1ZOL A;  4LCD E;  1NK4 A;  1F2R I;  3RBD A;  1ZE3 D;  1NI3 A;  3HVD A;  3TFR A;  1KTK A;  5KAI U;  3JSV A;  2IA6 A;  3RFZ B;  2KQ4 X;  4NJ6 A;  1WMH B;  3WK4 A;  4M01 A;  5AEK B;  1SZP A;  3ML8 A;  1KTQ A;  4FE3 A;  2PIA A;  1QLN A;  4N59 A;  5J0W A;  1KF6 B;  3HP6 A;  1COO A;  3H7P A;  4N9F 4;  2LHT A;  5KFM A;  4ECW A;  1RYJ A;  2VJ4 A;  3DCG A;  3MC0 B;  1J0G A;  2Q4T A;  2LYA A;  2EH9 A;  5KFV A;  5AKG A;  2K5P A;  4QZB A;  1C7Y A;  3HM6 X;  2J6S A;  3QCA A;  5FKA C;  1V38 A;  2IPK D;  4OZB A;  5H2F U;  5L1J A;  2V4R A;  1ZQY A;  7ICE A;  3APD A;  3KW5 B;  4I2H A;  1HTQ A;  1XU4 A;  2OOB B;  3CWI A;  3V6H A;  1XQQ A;  4EE2 A;  4MGZ E;  2M8S A;  3DDC B;  5AM0 A;  3QEA Z;  5TZV A;  4JWN A;  1H4R A;  2P6U A;  1I4H A;  2BYF A;  1TAQ A;  2G06 A;  4YR0 A;  2D2Q A;  2O6V D;  3LK9 A;  3QYP A;  4RT3 A;  4D2K A;  2MQJ A;  2HVH A;  3VC8 A;  2MWS B;  3AB5 A;  4NQL B;  4RUC A;  2C60 A;  1P7F A;  3N7R C;  2NCN A;  3EPG A;  2HDO A;  1YOV B;  2V4L A;  3DBS A;  4F5N A;  3W1S A;  4EBE A;  1TY0 A;  3IFW B;  5CA7 A;  5HKH A;  1EXN A;  4PHD A;  3LWM A;  2KDF B;  4ARC A;  4OCZ A;  3M3J A;  3IT4 B;  2XI9 A;  3AEV A;  3RZW C;  4RF1 A;  3OSP A;  1ZP0 B;  4XQ8 A;  3ZTD A;  4RQ1 A;  4C4V A;  3M95 A;  4L2Y A;  3U2S C;  1C20 A;  1VJ5 A;  5J2I A;  4HEA 1;  2QMT A;  1NKC A;  3PHW B;  3QUC A;  2GMI C;  4RMA A;  4ICA A;  3V61 A;  1GC7 A;  2O2V A;  4RZR A;  2J53 A;  4I2D A;  4P4P A;  3JW0 X;  3ICX A;  3RH6 A;  2KDB A;  5ALZ A;  5EE9 A;  3KWL A;  2KWC A;  2GBN A;  5D3D A;  1ACC A;  4NY0 A;  4S17 A;  1E10 A;  3Q8P B;  4FHK A;  2VKQ A;  1ZQH A;  4LLG M;  1ECW A;  1KFD A;  5AUI A;  5DG8 A;  2QAR A;  2RMM A;  1S0N A;  4EZ6 A;  1A6S A;  1CK1 A;  1J8C A;  2N9X A;  1UH6 A;  3HX0 A;  3BQ1 A;  4ECU A;  1SV4 A;  3GIM A;  2ZIU A;  3CW2 C;  4QZG A;  3H4B A;  1L6N A;  3GQC A;  1QOG A;  4MGK E;  4B9T A;  5AKX A;  1RYS A;  3KKA C;  2HE7 A;  2XGP A;  1JWS D;  4KTQ A;  1Y56 A;  4KX5 A;  5JU5 A;  1FPY A;  3O65 B;  4O5K A;  4DHZ B;  4EFO A;  1TKD A;  3R7Q A;  3JSV B;  2E8N A;  2G08 A;  1XCQ L;  4XC2 A;  4KLH A;  5BMI A;  5HFY A;  2H3Z A;  1XCT L;  2FIF A;  4A8E A;  3QUQ A;  3I1Y A;  3H7P B;  3A0H U;  4F4W A;  3GB1 A;  2KQ7 A;  5KT6 A;  2MJE A;  2WF6 A;  1LGR A;  4MT5 A;  5EWF A;  3OJS A;  3V7K A;  1BT0 A;  1LQB A;  4DSI A;  4ECX A;  5AM4 A;  3HWT A;  2UVW A;  2JSV X;  2HHV A;  5DG7 A;  1PK3 A;  3HUI A;  3RNE C;  2KOX A;  2R8I A;  4ECT A;  3H7S A;  3Q3M C;  1TBE A;  2UYZ B;  2XY7 A;  1RG6 A;  3RJE A;  5ALL A;  2IND C;  1PUZ A;  3AN1 A;  3QUT A;  2HI0 A;  2ZUC A;  4CHK A;  3NHE B;  3Q2A C;  2RRD A;  2F1J A;  3GE3 C;  2MCN B;  5KFJ A;  5G2N A;  2INP E;  2L0T A;  2BCV A;  2NMQ A;  5KFS A;  4REZ A;  4KLL A;  2PVG C;  3PX6 A;  3UPQ A;  1QT9 A;  3WKA A;  2KC1 A;  3NJT A;  3UIN B;  4F92 B;  4NL9 C;  4F93 B;  2ISP A;  1JUD A;  4KLO A;  2ESE A;  3O13 A;  1K8R B;  3N28 A;  3VTW A;  2H88 B;  2EAM A;  5J2J A;  1OFF A;  1PVQ A;  4ED7 A;  3SQI A;  1LB2 B;  4AYB C;  3TFS A;  3MDA A;  4FZN A;  4W9G A;  5I4D A;  1WGR A;  2WDQ B;  3BVM A;  3N30 A;  3SI8 A;  1EM7 A;  1WXQ A;  3I63 C;  3F53 A;  3Q8R B;  1TFR A;  1V5O A;  2KJ6 A;  4K1R B;  2KNJ A;  4XGA B;  4ECY A;  3FM9 A;  3WKE A;  1SL2 A;  2GBJ A;  4ZRK A;  4IQU A;  4FZM A;  4IR1 A;  1TS3 A;  2KHW B;  2OXO A;  3AV8 A;  1RWS A;  8ICM A;  2JWZ A;  4FJY A;  1XLO A;  2BB6 A;  1YIW A;  1UGM A;  2KD0 A;  2WXF A;  4B0M A;  1WRI A;  4C4S A;  2EQY A;  3GP7 A;  2O2V B;  2K4I A;  3PHX B;  1D3Z A;  4J9R A;  3ZDB A;  1YT3 A;  7ICP A;  3RYT A;  3MFG A;  3TEZ A;  3J9C A;  4II2 B;  2K8B A;  9ICA A;  3MJW A;  3WK7 A;  3A4R A;  4AJW A;  2KFN A;  1FFU A;  4I2F A;  3T5J A;  5DB6 A;  1T0Q C;  2RPQ A;  1TK5 A;  4UBC A;  2LVP A;  2JV3 A;  1QCK A;  2BVC A;  5IIJ A;  1NK5 A;  3TAC B;  5CEH A;  2HBL A;  3MC1 A;  1U48 A;  1OQR A;  3P63 A;  4ED8 A;  1WF9 A;  2ZIU B;  1F52 A;  2YLM A;  4P16 A;  1BUI C;  5CJ7 A;  2BR0 A;  4PZO A;  2W04 A;  2BQ3 A;  3ZRF A;  1ZD3 A;  3L3F X;  5CHG A;  4E3C A;  3AE8 B;  1V1O A;  4KLQ A;  1UEL A;  3ZDA A;  2BQR A;  2KD1 A;  3G6V A;  2FUG 1;  5J2C A;  5J2H A;  1WE7 A;  2BQQ A;  1L3S A;  3Q8L A;  2RDJ A;  3BDP A;  4QJF B;  3ZUN A;  4BZA A;  5D2M B;  2N1R A;  2JXX A;  3ECI A;  2PKE A;  4QW8 A;  4JV2 A;  5IOI A;  5IIO A;  4UAT A;  2K6Q A;  3H6N A;  2CU1 A;  4OD0 A;  2FE8 A;  4I28 A;  3Q8S B;  4KN4 A;  2PI4 A;  1WYW B;  2DBY A;  2KAJ A;  4CQN A;  1J2N A;  4NQK E;  3VUW A;  3ZJU A;  3DHH C;  3QU5 A;  2KVR A;  2ZW1 A;  4MAC A;  3AEE B;  1XXG A;  4R3D A;  5EWG A;  5F9N A;  1TV9 A;  4KLG A;  1WGY A;  2MU2 A;  5ALE A;  2DYB A;  2IBK A;  2SEB D;  4IOI E;  4YG2 A;  3IT6 B;  3E2E A;  4HYK A;  2YTU A;  1FEH A;  5AKH A;  3S6J A;  1ZQD A;  3DBL I;  9ICJ A;  3R3M A;  4A8X C;  4I6N B;  1VZ7 A;  2G07 A;  1ZQO A;  2PFP A;  2OM6 A;  3KHL A;  1MI0 A;  5KFQ A;  1V5T A;  3BQT A;  2CJN A;  1YX5 B;  4I6L B;  1TKG A;  2MP2 B;  2BDP A;  2D5G A;  3AI5 A;  4WWO A;  2MHJ A;  3BYT B;  3WAN A;  2HBM A;  1FFV A;  3LVW A;  1JRU A;  3AE9 B;  3QX7 A;  5B66 U;  4PJ0 U;  3MDC A;  4MSQ B;  3NVV A;  5DB8 A;  3KZI U;  1BPY A;  3PS6 A;  1X1M A;  1D5Z C;  4II3 B;  4YTM B;  4ELU A;  4XWT A;  2OYY A;  2W9A A;  4RCO A;  2I38 A;  4Y2Q A;  2BCU A;  1XSN A;  2BGF A;  8ICN A;  2MW5 A;  4GN1 A;  2E6X A;  4GOC A;  5KFF A;  1XSP A;  5HR7 A;  3H9D A;  2B76 B;  4DCC A;  1JRP A;  5ALX A;  4WAA A;  3WKD A;  2D3D A;  2GBM A;  1KLU D;  2LUM A;  4DFJ A;  2EMT A;  4DDI D;  2ZTD A;  2HOI A;  3CST A;  1BPE A;  4MGY E;  1F9J A;  2IOF K;  8ICP A;  2KTQ A;  9ICK A;  1LXD A;  2RD0 A;  5TIS U;  3OHB A;  4C8K A;  3GZN I;  3AE2 B;  5T8I A;  3ORY A;  1EUV B;  2VIX A;  1C78 A;  5ALV A;  3MHS D;  1PVP A;  3L16 A;  2VA2 A;  3NOB A;  5AI8 A;  4EX7 A;  3RR8 A;  4RGM A;  4RPY A;  1RZT A;  5D46 A;  1SE4 A;  3ALR A;  3T79 A;  3B0Y A;  4UAS A;  2I1K A;  3P4P B;  1A5R A;  2N7J A;  4H2A A;  4YN4 A;  4RQ3 A;  1WGD A;  1PZN A;  2XBB C;  1KW4 A;  4GXB A;  9ICS A;  2K39 A;  4W9I A;  3MP9 A;  4YT0 B;  1D8B A;  1WCN A;  1C4C A;  1KKX A;  1MQ3 A;  2IGG A;  4BJQ A;  1PYW D;  2KDM A;  4PZN A;  4YP3 A;  4WJP A;  3UXN A;  3MGI A;  1V80 A;  1XLQ A;  4I6P A;  3W9C B;  1V85 A;  2YB1 A;  1LO5 D;  2LHD A;  2Q5W D;  4ACF A;  4ASW C;  4LZD A;  4BDP A;  4DS5 A;  2MX2 A;  2QSD A;  1T94 A;  4A9A A;  5FP0 A;  4JUZ A;  4O5C A;  3DVG Y;  1S1Q B;  2VA8 A;  1Z4O A;  1KDH A;  5J2B A;  3M1Y A;  3WK6 A;  2N7E A;  2C7H A;  2L83 A;  4RUA A;  4YTP B;  5G55 A;  1WCL A;  3T3F A;  2C2R A;  2NYV A;  2FCQ A;  1TVA A;  4MEX A;  5KL1 B;  8ICT A;  2AL6 A;  1E9M A;  1ROE A;  4O0I A;  2LGD A;  5AI4 A;  3V6J A;  2XY5 A;  1RXW A;  5J2D A;  1AW7 A;  3Q3N C;  2FE9 A;  4DQI A;  2L76 A;  4F5R A;  4P1C C;  1HQR D;  1N2X A;  2EDU A;  5A0L A;  3SDL C;  2EAO A;  2Y5P A;  2HW3 A;  3KKA A;  4DL6 A;  3U8Z A;  3VH4 B;  1WRD B;  3U30 A;  4BOS C;  3V7J A;  4OHJ A;  4A55 A;  4RNO A;  3M6Z A;  3J81 j;  1OXJ A;  2QB1 A;  1ZET A;  5CHV C;  4QZC A;  4KGS A;  2PFQ A;  3BQ7 A;  4JL9 A;  2I5H A;  4B9V A;  4C8L A;  2NRW A;  1Q10 A;  2BS2 B;  1DK2 A;  1TAM A;  2IO0 B;  4R8U A;  5DBA A;  1IGD A;  4LDT B;  2Z8L A;  4S0R A;  1WXS A;  5ALU A;  2NRV A;  2QJL A;  3U26 A;  4CF3 A;  2N9K A;  1PK1 A;  5AK3 A;  2IY0 B;  1D5X C;  2AWT A;  3RH5 A;  2D8C A;  9ICN A;  3ZXR A;  2H3V A;  3K9O B;  1JWB D;  7ICF A;  1X40 A;  1ZD4 A;  2FJ6 A;  3ZD8 A;  2L32 A;  4M9G A;  1EWY C;  1MG4 A;  4QWC A;  4ITK A;  1ZQF A;  2Z0D B;  4LTU A;  5IIK A;  2Y5C A;  2R8H A;  1I4P A;  4DFK A;  1N63 A;  1AWD A;  2R8K A;  1MG8 A;  2A1A A;  4TQ0 A;  4Y2T A;  4YR2 A;  4CE6 A;  4DL2 A;  4AUQ C;  4I29 A;  2PE9 A;  2FPL A;  3TKA A;  1QQ7 A;  5BPC A;  1WSP A;  4NL9 A;  4CCH A;  1KLN A;  4ECS A;  3V72 A;  2WF9 A;  4C7Y A;  3RNF C;  2IMW P;  4YWG G;  3BWU D;  2C7N B;  2R8J A;  1PGA A;  5F9L A;  4BFR A;  1DK3 A;  4XE0 A;  3P4S B;  1S77 D;  4TSS A;  1ZQG A;  2KVS A;  3C5G A;  3B9J A;  2LGY A;  2ISO A;  3QIJ A;  1O03 A;  2LYH A;  3DBL B;  3N4M B;  1FO4 A;  2WB1 F;  1ZQP A;  4DF4 A;  4M6W A;  4OJ6 A;  4HKZ E;  2JQR B;  1ZDV A;  2A5U A;  1RM6 C;  4NV0 A;  1K53 A;  1KRH A;  1J7C A;  2OCE A;  4MEL A;  4ZYS A;  1G6J A;  1XO3 A;  3Q14 C;  3L0W B;  2EKI A;  2MH7 A;  2KDI A;  4WQM A;  3B0X A;  3M9M B;  2ZIX A;  1XF5 L;  4AWJ A;  2RLT A;  2KTR A;  3DWM A;  2GBR A;  3QU9 A;  2ZCB A;  3TCA A;  4E74 A;  2HJ8 A;  1P0R A;  1X9M A;  3JPO A;  1J7B A;  4G11 A;  1CJE A;  3BZC A;  2AXT U;  3VTU A;  3VXW A;  5KFO A;  1TT5 B;  2DPI A;  1K51 A;  4AYB F;  3MC9 A;  1TK0 A;  4HCP B;  1K1Q A;  4K3C A;  4NLC A;  1COK A;  4KMU A;  4YSY B;  2JRI B;  3CIR B;  1MSW D;  4OVV A;  1IPG A;  3NRZ A;  3V05 A;  5T14 A;  3WAL A;  5D4B A;  4CNQ A;  1WXA A;  4ZH4 A;  1JXL A;  2XID A;  3T3N A;  3GZN B;  2VZK D;  3DHG C;  4YMO A;  1ZD5 A;  1ZOY B;  2W03 A;  4N6E B;  2FMS A;  3CP8 A;  5BMH A;  1GC6 A;  4R8U B;  2ATL A;  3M9N B;  4J9P A;  4DF8 A;  3C21 A;  4K3B A;  1QLB B;  1PK1 B;  4ZDV A;  4KLD A;  3WAM A;  2AEH A;  1WMH A;  4OO1 J;  5J8Y C;  3SAH A;  1NEK B;  4HK2 A;  4N58 A;  4I2I A;  5KFT A;  2PEA A;  3P4R B;  3KWV A;  2F76 X;  3GV5 B;  1WZ0 A;  4AS1 A;  5D49 A;  2PLP A;  3BZD B;  4J3O D;  2H3F A;  2JXT A;  4AOF A;  2WDR B;  2YEP F;  5CWR A;  9ICH A;  1OTR B;  2V3S A;  4F4K A;  1ZW7 A;  2WXH A;  4Z6E A;  3VUY A;  1SV0 C;  3N97 B;  4KVG B;  2K8A A;  1HE8 A;  5HR6 A;  3F2B A;  2J7Q B;  1ZKH A;  2MSN A;  4YXJ A;  3HPO A;  5C3J B;  2V4Q A;  3TAP A;  2MA9 B;  4F8C B;  1AQ6 A;  1C4A A;  1BNP A;  3VCB A;  2DWQ A;  1U4B A;  3KUC B;  2KMD A;  1V2Y A;  5J17 A;  5TSS A;  3CNH A;  3RJK A;  2JU6 X;  2WU2 B;  4IRK A;  2A4Z A;  2BS4 B;  3GOE A;  8ICO A;  2QHO A;  2F44 A;  2ZG6 A;  3RF9 A;  3ZVV A;  1RDF A;  2I1Q A;  4I2B A;  1X6J A;  1GOZ A;  2VH1 A;  2AJQ A;  1IXR A;  4OW0 A;  4MFA A;  4M6W B;  5AKK A;  4C8N A;  1P9D U;  3K4G A;  1HZ6 A;  2M19 A;  1M94 A;  1WGK A;  4ED1 A;  1T0Y A;  4FLH A;  2KIV A;  1X66 A;  2IO2 B;  4RGO S;  5JHA A;  2CPR A;  3GFK B;  1VJK A;  2EMS A;  4R63 A;  2K8H A;  2OEH A;  4OZC A;  3R7R A;  4B6W A;  5ALM A;  1ZQA A;  3QX1 A;  3RD2 A;  2JZZ A;  4OJO A;  4GC6 A;  4K4G A;  4MGI E;  4YR3 A;  1ZQS A;  4WJN A;  1B22 A;  2KTR B;  3RN9 C;  2AL3 A;  3SFD B;  4IKG A;  2LYB A;  4EBC A;  1YX6 B;  4TUQ A;  2WAQ C;  4EEK A;  3RRG A;  2KIW A;  3TIX A;  1IBX B;  2KK8 A;  2IO3 B;  3E0F A;  9ICX A;  3AE3 B;  3N20 C;  1PUT A;  2GB1 A;  1NVI D;  2JR5 A;  3NUQ A;  4DL3 A;  3U52 E;  4Y2V A;  1Z1B A;  2DPJ A;  3D6J A;  5J0T A;  1S97 A;  4XA5 A;  2BGW A;  2CHX A;  2K4E A;  4X57 B;  2KKV A;  4O3N A;  1WR1 A;  4HPM B;  2DL0 A;  1MN8 A;  3VTV A;  1WXM A;  1XO0 A;  1V8C A;  1GG3 A;  1SGH A;  3H7I A;  1ZQU A;  1DOY A;  4DSL A;  2KAN A;  3MC8 A;  4EZJ A;  4DSK A;  4F50 A;  4YMM A;  2ZIW A;  2WXQ A;  2JH1 A;  3WCQ A;  1WE6 A;  1QQ6 A;  2EZY A;  2V9W A;  2DGZ A;  4RGN A;  2WHE A;  4Q2J A;  3PV8 A;  1TKY A;  1E8Z A;  3OG5 A;  1NK8 A;  1IP9 A;  5ALO A;  1TAU A;  4F5O A;  1U9L A;  2UVR A;  1E8X A;  1VZ8 A;  1K5O A;  8ICX A;  2QIE B;  2XY6 A;  4M04 A;  4WIP A;  2UVV A;  3Q8E A;  2MBH A;  1X42 A;  2JZP A;  2L5Y A;  4DXG A;  3G6Y A;  1NKB A;  1E7U A;  2HJ1 A;  3SYZ A;  2L00 B;  3UGB B;  4CDG A;  3PPA A;  3I3T B;  4ANV A;  1JQ4 A;  2KZZ A;  2V9H A;  3PW0 A;  5ALS A;  1R4N I;  4FUL A;  1RQL A;  4C8O A;  4PYZ A;  5KG4 A;  3E9S A;  3ZTC A;  1E7V A;  7ICJ A;  2M56 B;  1ET9 A;  4EYI B;  2ZNV C;  4KMO B;  5HP4 A;  2KJ9 A;  2LMC A;  4BVU C;  2YMQ A;  4UAU A;  2E8O A;  3IDW A;  2XO7 A;  2R61 A;  1UT8 A;  2SAK A;  3DQV A;  4HRO A;  4W9H A;  4WAF A;  2LM4 A;  2INC C;  3ZDT A;  4UB1 A;  4IW0 A;  7ICM A;  4UB6 U;  5DBB A;  4B9N A;  1T0R C;  3PLU A;  4F71 A;  1FD6 A;  4GU2 A;  4ARI A;  4NY8 A;  1YJ1 A;  5AM2 A;  2LBO A;  5KT5 A;  4QZI A;  2LPE A;  4M8M A;  1ZQB A;  1SGG A;  4M0W A;  4CO7 A;  3NZS A;  4M9N A;  8ICE A;  3DOW A;  3SZ2 A;  1CI4 A;  3N7S C;  8ICU A;  1K50 A;  1ZPS A;  1ZYQ A;  2KXJ A;  2PPH A;  1L3U A;  5BYS A;  2KJ8 A;  5GMV A;  3NS1 A;  3RR7 A;  4OJ5 A;  2AX5 A;  4ECR A;  1RXV A;  2WQY B;  4MDK E;  3RBE A;  3AE5 B;  4PGY A;  3C2K A;  4DHJ B;  5GTH U;  2O6V A;  5EE0 A;  2HOF A;  8ICL A;  5KFX A;  4J9L A;  1MJD A;  3HVZ A;  4UBB A;  1QSY A;  1O08 A;  4J9K A;  4F7Z A;  1UNS A;  2A1J A;  4MEY A;  3RFA A;  3RAX A;  3K1R B;  5LLI A;  4UDU C;  2J52 A;  1JWU D;  1YD8 U;  3E56 A;  2M17 A;  2LRW A;  3A9J A;  4KDI C;  2XEW A;  1GUA B;  3UM9 A;  3C19 A;  3UQB A;  3L5K A;  1JI7 A;  2MJD A;  2VRR B;  3RRH A;  9ICI A;  1ZD2 P;  1P1A A;  4YTN B;  5DLF A;  1D9D A;  1T8E A;  1HEK A;  3AM9 A;  1L8O A;  1KFS A;  3NRW A;  1BNO A;  3MJ5 A;  1RLF A;  1LVH A;  1UA0 A;  4PYU A;  3EC8 A;  3D2N A;  2G1E A;  2MSE D;  1L5U A;  5E6P A;  5H92 C;  1RFK A;  2ZIW B;  1X2I A;  3JPN A;  4UW9 A;  1BPB A;  1S0V A;  3M8S A;  1N5X A;  1TE2 A;  4MF8 A;  7ICI A;  3IG8 A;  2JUO A;  4KGT A;  2GO7 A;  4QIW F;  1TK8 A;  4M0A A;  2OJW A;  3RT3 B;  2Y1J A;  2BW2 A;  3RJJ A;  3PZP A;  1KOT A;  1IG6 A;  4IG7 B;  2KHQ A;  8ICA A;  4G0N B;  4EYH B;  2D6F C;  2N9L A;  3BIN A;  1I4R A;  3S2A A;  1J19 A;  3SR6 A;  3IN5 A;  2YQE A;  4TUS A;  4IR9 A;  3WA0 A;  5HHH A;  2YN4 A;  4UQG A;  2IZV B;  2LGX A;  1PFD A;  1I7H A;  3HM3 A;  2JRH A;  3NG0 A;  3BS5 A;  1QKZ A;  4FZL A;  3DVG X;  2QLT A;  3CRX A;  4FBU A;  2BYT A;  4XDD A;  1E8W A;  1KSP A;  3Q3F A;  4I2C A;  2DAF A;  1YNT E;  3AQF A;  1MHX A;  1UQV A;  3AQE A;  1DGS A;  3KH0 A;  4BWM A;  1DOQ A;  5G5H A;  1S0M A;  4Z6F A;  4Y2J A;  1WWV A;  2WXO A;  5CHF A;  3ZDE A;  1SF0 A;  3UQA A;  3ZNH B;  4GXJ A;  2ZJ8 A;  3RUI B;  3PSP A;  4ZHO A;  2C9W B;  1ZQZ A;  1S9F A;  2I9G A;  4OVZ A;  5DQH A;  4JK1 A;  4KLT A;  4EZL A;  2ZUD A;  4G3X B;  2K4H A;  2HHU A;  3PMN A;  5J8Y A;  4IRC A;  4O3O A;  3T5K A;  3SHQ A;  3EYZ A;  1T0S C;  4EEL A;  1PGX A;  4ZRI A;  3VRB B;  2GOL A;  5KFA A;  4C8M A;  2PMZ C;  1X9W A;  2MP2 A;  9ICB A;  2K0P A;  2M4N A;  4RQ4 A;  4YL8 A;  4B0E A;  2R18 A;  2KWV B;  1B1Z A;  3PVL A;  5CTR C;  3BY4 B;  3OJU A;  5ALK A;  3PZD A;  4KSK C;  4HLE A;  1LV5 A;  4R65 A;  1J7A A;  1EF1 A;  4M0W B;  2ZUB A;  1SV0 A;  3ZO5 B;  4Q43 A;  7ICR A;  3ZQ4 A;  2KJH B;  1KN5 A;  2NBW B;  2MRP A;  5KG0 A;  3HK0 A;  2ZTC A;  4NNJ B;  4QWE A;  1STE A;  1IIP A;  3M6K A;  2G4D B;  1TS5 A;  2BS3 B;  1MPE A;  1F0M A;  4JWS C;  5H8Y E;  2B21 A;  2O6V B;  4ANW A;  5KAF U;  4F4X A;  3BVG A;  5AUK A;  4RQ6 A;  1UT5 A;  4UB4 A;  5J0R A;  3PVX A;  2A3V A;  2A1J B;  4TV3 A;  4O3R A;  3RJH A;  3VR8 B;  1EF5 A;  2ZW0 A;  4ZRJ A;  2C5L C;  3N3K B;  1MC8 A;  1D8L A;  4B9S A;  4JWM A;  2KN5 A;  4ECQ A;  2Y9T A;  3A9J B;  3V6K A;  2WWZ A;  4GXK A;  3QUB A;  4ECV A;  4EZK A;  2BKF A;  2W9M A;  2BZF A;  2UVU A;  1QQ5 A;  2FCS A;  2MEK A;  3A1Q A;  5GXG B;  1WWT A;  4MF2 A;  3GZF A;  2WTF A;  2RDG A;  3Q8B A;  4PHE A;  4RQ5 A;  4K7S A;  4ANX A;  3P1M A;  1UHU A;  5AM5 A;  4K4H A;  3PST A;  2JEJ A;  3BQ0 A;  1DYQ A;  2FCN A;  1T3N A;  2REX A;  1U47 A;  2WX1 A;  2Y5B B;  1SZH A;  3CYM A;  3MGH A;  3DV9 A;  1EWC A;  5KHO A;  4B6J A;  3RNG C;  3IRU A;  4IM2 A;  2EAP A;  1BGX T;  3AEG B;  1B4F A;  3UQ2 A;  2F1H A;  3D2Q A;  3KHR A;  5E79 U;  1U49 A;  3PTF C;  5J0Q A;  3LJ3 A;  1QOA A;  4ED2 A;  5J2E A;  8ICY A;  2N1V A;  3PRZ A;  2ZXH A;  2ZIV A;  3GDX A;  1ZQ1 C;  2J6U A;  2K6D B;  1YN4 A;  4JV1 A;  4IQW A;  4DK5 A;  2DAJ A;  1JWA D;  1URJ A;  1NOM A;  3OJ3 A;  3U7D A;  3KBB A;  5ALJ A;  4UAZ A;  1UUP A;  3QXG A;  3BS5 B;  3TI0 A;  1ZQE A;  3SEI A;  4BBN F;  4DQQ A;  2KT7 A;  4NJC A;  4UB3 A;  3TAN A;  3ZI4 A;  2JYE A;  1KEJ A;  5AI0 A;  4KLE A;  1XWL A;  2KDE B;  2ACZ B;  1SXE A;  9ICO A;  3V60 A;  1JMS A;  2J6T A;  1NJW A;  3QU2 A;  1CEZ A;  2WAQ F;  1WXV A;  1VLB A;  2D07 B;  3H8W A;  1SXT A;  3N9Y C;  4GIB A;  3TAD C;  2AU0 A;  5CP2 A;  3ISB A;  3M62 B;  2H3I A;  2IDY A;  2OWO A;  2G4S A;  4JGH B;  4PGX A;  1MFW A;  2AYO B;  2GLS A;  4P0Q A;  2AGO A;  3PO5 A;  2LGS A;  3SAG A;  4OJL A;  3L17 A;  3SD7 A;  2JPH A;  3VR9 B;  4F1S A;  4RQ0 A;  4OZA A;  5B5E U;  4P4M A;  1ZQQ A;  1WGH A;  2RR9 A;  3WAO A;  2MUT A;  4MM3 B;  4JLC A;  4EZ9 A;  3ZXV A;  4GDK A;  2FUH B;  5AK6 A;  4KLS A;  1L7P A;  2R2Q A;  4BKS A;  1FRD A;  4DOB A;  5BO4 B;  2MAX A;  3DBR I;  3R2T A;  3ZDD A;  2ZJD A;  1L7M A;  1XLN A;  2IJ0 A;  3U4E G;  3WK8 A;  2M0A A;  4BOZ B;  1YZ7 A;  2NV3 A;  1IUE A;  5KG1 A;  3PZ8 A;  3QJZ A;  2CHZ A;  3AEF B;  2K3U A;  3P4Q B;  1F44 A;  4F4Z A;  2O6K A;  4LVS A;  3KOO A;  2BT6 A;  2KX3 A;  3IAS 1;  5FR3 A;  1SJE D;  2G9H D;  3PRM B;  5HNK A;  5KNI A;  4ANU A;  1KLG D;  1E90 A;  4IRD A;  2FLL A;  3NVY A;  2KKC A;  1L0V B;  1I35 A;  1JIH A;  1NK0 A;  9ICM A;  4LJX A;  2BWF A;  3A1Q B;  4YVZ A;  4DQR A;  3RB3 A;  2XNA C;  4IM0 A;  1L0X B;  1B43 A;  1ZQR A;  2RQ5 A;  4Y2Y A;  5BOM A;  1D4B A;  3Q3O C;  5ALG A;  1WGG A;  2AHO B;  4RNM A;  3IHP C;  4QW9 A;  5IAA C;  2AQ0 A;  4I2J A;  2PTL A;  2CHW A;  1LFD A;  4G50 A;  3C1Y A;  5CX3 A;  3EA6 A;  4IUM B;  2NRX A;  7ICQ A;  5HHI A;  4QWA A;  3KLS X;  5AM3 A;  3I76 A;  1IYF A;  4YMN A;  4MH0 E;  4J03 A;  4IWO A;  2ZTE A;  1P7D A;  2H89 B;  1ZQX A;  2ZIV B;  3EGR A;  4PS7 A;  5ALH A;  1SKS A;  4KKJ A;  3BK2 A;  5KHQ A;  9ICU A;  3ZNG C;  3CF6 E;  3PW7 A;  2YX8 A;  4Y2X A;  1IGC A;  4KLF A;  2KLC A;  4C00 A;  3BK1 A;  3HJE A;  1FIQ A;  5IIM A;  1VCB A;  3C28 A;  1SSN A;  3Q8M A;  2JHD A;  3JVZ X;  4YXD B;  2Q0Z X;  2KOB A;  3EFU A;  3EHV A;  1EO6 A;  1SE3 A;  3D32 A;  3ML9 A;  1XLP A;  3C0R B;  1QSS A;  2WF5 A;  1HUO A;  4J9O A;  1R4M I;  1OUQ A;  2KC2 A;  3ZJV A;  3QA8 A;  2DQN B;  1YQ4 B;  2F8K A;  1GNU A;  3F2C A;  5C0Y A;  4DOC A;  4E71 A;  2CS4 A;  4OVU A;  2WF7 A;  1RYU A;  2JEF A;  1SWV A;  2E3T A;  3O0F A;  1QQR A;  5KG2 A;  2JF5 A;  2BBC A;  3F5A A;  1LKY A;  4KLI A;  3AMZ A;  3APC A;  4O5E A;  1E6E B;  2QCZ A;  2Z0E B;  3VHT C;  4QZD A;  1ZQW A;  3EZ5 A;  2ONQ A;  4RNN A;  3RMK C;  3W2D A;  3AUL A;  1F0Z A;  3AED B;  2JMG A;  1WZ3 A;  4P0Q B;  4EBD A;  2W9C A;  2ON8 A;  5KFN A;  5DQI A;  5L1M A;  3OTQ A;  1S5L U;  2F77 X;  4E0D A;  2WXG A;  3T9L A;  2ZCC A;  4EOY A;  2NR2 A;  4P7I A;  2MUT B;  2KMM A;  2BHN A;  2HCF A;  4HPL B;  3UF8 A;  1TZO A;  5KFK A;  4GDK B;  3M9O B;  1V1P B;  2FPM A;  4C56 C;  3KTQ A;  5ALR A;  2V0G A;  4YCX A;  4QZF A;  4NLK A;  1S0O A;  2KKP A;  2ZNV B;  2RSU A;  5KFH A;  1KFT A;  1KBU A;  3WU2 U;  1A70 A;  3AEA B;  3KUZ A;  4QAY A;  5DQG A;  1ZUD 2;  4EX6 A;  3BYY B;  5KTQ A;  1MHH E;  3GIK A;  4L1B A;  5G5G A;  4F2S A;  5KFB A;  5KL8 B;  2N9E B;  5IIN A;  1T7P A;  3FDS A;  1L7Y A;  5J2K A;  5K4L A;  3CMM B;  5ALW A;  3R66 C;  5D6J B;  3RTV A;  3AXC A;  1KL9 A;  3KUD B;  2DUY A;  5DGA A;  1SE2 A;  3D2S A;  9ICF A;  1NYR A;  1TZ1 A;  2HD5 B;  2KMA A;  4KSL C;  4A90 A;  2HOQ A;  3UQ0 A;  1WFY A;  2KZR A;  1ZJN A;  3TEW A;  2EZZ A;  4HPP A;  3RI7 C;  4JX1 C;  2KTF A;  2DZJ A;  3QZ7 A;  2Y0S C;  1SL1 A;  3GV7 B;  2WXJ A;  4DXF A;  2KHV A;  1SIF A;  1A0P A;  2MBB B;  1NJX A;  7ICS A;  5J0U A;  2K9X A;  9ICW A;  4DSE A;  3QHT A;  3Q8C A;  4O9M A;  4P2H A;  4QZH A;  2KFZ A;  2AQ2 B;  5AZH A;  4KLJ A;  3RNB C;  2E8P A;  4ELV A;  2M0N A;  1KQQ A;  4FXC A;  1DOI A;  4XZ4 A;  2W55 A;  9ICT A;  2BWE S;  4UAV A;  3NAS A;  4ED6 A;  2KNB A;  2JEG A;  2QIL A;  4DL7 A;  2DZI A;  4M8N A;  3Q8F A;  1Z19 A;  4J9N A;  1HEZ E;  3PRE A;  2PMZ F;  1UBQ A;  2LHE A;  1I4Q A;  3MR2 A;  1IBX A;  2KMC A;  2KJ5 A;  4HVB A;  2EKE C;  4BKG A;  1N61 A;  2ZXI A;  2QDF A;  1YJJ A;  2OJR A;  5L1L A;  2KG5 A;  4LNK A;  2Y3A A;  4J9S A;  2WYQ A;  2Z59 B;  1HZ5 A;  1OGW A;  3JYU A;  4JMU A;  4NAW A;  1CQV A;  1Z3E B;  1HJP A;  4PL1 A;  4IQT A;  3DBR B;  2W3S A;  4C4R A;  1D9F A;  1GB4 A;  2FDR A;  5CHW A;  4XX5 A;  1UD7 A;  2W8K A;  3PR5 B;  4I2A A;  2KJR A;  4W9J A;  1NKE A;  2DKX A;  1Y8R C;  2LZ6 A;  1LKY B;  5KFG A;  3RJG A;  3TEX A;  3LVV A;  1NYQ A;  4HJK A;  3AU5 A;  5EE3 A;  4CRX A;  4HJG E;  2ZPN A;  4UB8 U;  4RT2 A;  4YSZ B;  7ICG A;  8ICW A;  3K75 D;  2W9C B;  3PW5 A;  1ARO P;  2BKE A;  3UXP A;  2G5I B;  7ICO A;  2LEK A;  4HDQ A;  3N32 A;  4NLG A;  4M00 A;  3NZU A;  5AKJ A;  3FKY A;  1FNW A;  2LFI A;  2JRZ A;  3SV3 A;  4GGQ A;  1Z00 A;  4RQ2 A;  4O3M A;  2DNF A;  1L6V A;  2CKH B;  2WXP A;  2KSO A;  4RPX A;  2V3N A;  3ISD A;  1WM3 A;  2W11 A;  4NLN A;  2W9B A;  1FXT B;  2UWQ A;  2WF8 A;  1SKR A;  3OJ4 B;  4DEZ A;  3V62 A;  1EU4 A;  3TAD A;  8ICG A;  1V49 A;  1V9P A;  5KG7 A;  1NNL A;  3PO4 A;  1Q3V A;  1HA5 A;  3UMB A;  1SL0 A;  4NJ8 A;  4Y2R A;  3A4S C;  2JYT A;  4O3S A;  5J29 A;  2GI9 A;  1P98 A;  2LGI A;  1X6I A;  5AKZ A;  8ICQ A;  1WIA A;  1QOF A;  1ZXI A;  1L7O A;  3PNC A;  3T5H A;  3IBE A;  5EDS A;  1R4M B;  3TBL D;  3EPI A;  3AH7 A;  3SEB A;  5IA7 A;  4DXA B;  4FHJ A;  4K7U A;  5ALT A;  8ICR A;  1Q3U A;  3WKB A;  4MFF A;  3L54 A;  1HTO A;  4U6P A;  2J0J A;  4NWI A;  4MFC A;  2MLB A;  4WJQ A;  4BWJ A;  4RF0 A;  3LB8 C;  5KFY A;  3WK5 A;  4ED3 A;  1S3S G;  1WY8 A;  4RGT A;  1KLV A;  2MBO A;  2DKZ A;  2IYD B;  5HMM A;  2AH5 A;  2L3Z A;  2MA1 A;  5FR6 A;  4C80 A;  1JW9 D;  1C76 A;  4DQP A;  4PT5 A;  2IO1 B;  1KH0 A;  4FN2 A;  5CB1 A;  2RGF A;  2D3C A;  1GAQ B;  3BZK A;  3IG5 A;  3RJF A;  3OAW A;  4DFD A;  2JZB A;  2J0M A;  1SBB B;  3WAP A;  4B9K A;  4NXZ A;  2XN9 C;  5AI6 A;  5ALD A;  4IM3 A;  2L8J A;  4CF4 A;  4O3Q A;  1DRG A;  1TIF A;  2HHX A;  2DEN B;  3N1Y C;  2WDV B;  4ICU A;  1GB1 A;  2LM1 A;  2PFO A;  2GH1 A;  4JPS A;  4NAW B;  2EZX A;  3ETL A;  2IY1 B;  1GPX A;  2WLB A;  3R9K A;  4Q44 A;  2ASD A;  1SWW A;  1J2M A;  7ICN A;  1XSL A;  1V6E A;  1M6Y A;  5L1K A;  5IIL A;  3GU3 A;  5C5J A;  3AE4 B;  2DZK A;  1WJU A;  3KQ4 A;  4F8R A;  2CJO A;  4UAW A;  3N1X C;  2W82 A;  5EOZ A;  2BPC A;  4LNF A;  3GS2 A;  2JXJ A;  3H1U A;  3IP4 B;  4PK1 A;  4A3O A;  4ECZ A;  2FMQ A;  2CXY A;  1SEB D;  1C4P A;  5D7G A;  3UI3 A;  1ZRN A;  2QC8 A;  2WXI A;  3DEE A;  4W9C A;  1PGB A;  5KFR A;  4PHP A;  1BXT A;  1Q1O A;  2KWU B;  3RUL A;  3PY8 A;  5ALP A;  2XIC A;  4FO6 A;  3RH4 A;  1KFY B;  2QKQ A;  2HHS A;  2DX5 B;  2IHN A;  2Z7J A;  1Z00 B;  4Y2P A;  1N5W A;  2PXI A;  4ZYN A;  5HML A;  3IG3 A;  4DDG D;  2N4F A;  3RAQ A;  4QZ9 A;  1JAL A;  2H3Q A;  2KSO B;  2RDB C;  2YMM A;  2KE7 A;  2W43 A;  2HMX A;  3M63 B;  1Q8K A;  2G5H B;  2VA3 A;  3VRA B;  1FM0 D;  1T6B X;  4AJY B;  2W9B B;  2GWS A;  1UGJ A;  2J4X A;  2VZK B;  3NS8 A;  3C5F A;  2BYE A;  2K4P A;  5CRX A;  4GLX A;  5ALF A;  1YN5 A;  1L3T A;  7ICL A;  4M9L A;  1NDD A;  5DG9 A;  4YD1 A;  2HTH A;  4R64 A;  3ZKJ C;  3A0B U;  2GOW A;  4TUU A;  2WX0 A;  2I2Y A;  3RCZ A;  5DB7 A;  3GE8 C;  2XCA A;  2LRU A;  8ICZ A;  1VRA B;  9ICQ A;  2WNM A;  3MR6 A;  4NAM A;  2KP7 A;  3CSF A;  3F5E A;  1T5X D;  2V4I B;  3OHA A;  3BS7 A;  4QWD A;  1JWM D;  2ODG A;  2HVI A;  3JPT A;  2OED A;  3L4P A;  1BPZ A;  4ACO A;  4XUS A;  3P2B A;  5J0S A;  3JPR A;  4DL5 A;  1XS9 D;  1LM8 B;  3PX0 A;  3RZF A;  1E7P B;  4XWW A;  5III A;  4DS4 A;  4W9E A;  1F5S A;  2KK0 A;  3PSF A;  3HKZ C;  5AK5 A;  3V7L A;  4LNI A;  4K7W A;  2V3P A;  3AL0 B;  1Y88 A;  3GIJ A;  2FI1 A;  4WJO A;  2LKY A;  3KVF B;  5L9X A;  2J42 A;  4PL2 A;  3ZYY X;  2RHF A;  2BQU A;  5L83 A;  3H40 A;  2X8X X;  2JZB B;  4Q8E A;  2LJI A;  2BCR A;  1L8L A;  1WM2 A;  2KV2 A;  5KT4 A;  2FPK A;  4G3I A;  4GDL A;  3Q8K A;  2MJ3 A;  4YFK A;  4GSW A;  3OPX A;  3FYH A;  1OEY J;  3KYC D;  2LVQ A;  4LNO A;  3ZNI D;  1V9J A;  1WG8 A;  4F5Q A;  3I57 A;  1C1Y B;  1RQN A;  2IBI B;  3I5J C;  2BPG A;  4AP9 A;  2LAS A;  2M1M A;  5BYQ A;  2KWD A;  5AZF A;  3DHI C;  5AKI A;  3F2D A;  4KZC A;  4JV0 A;  3W5V B;  1N6Z A;  3DWG C;  1FMA D;  2C7M B;  4I27 A;  2GRI A;  2C22 A;  8ICB A;  4B9M A;  4Z6D A;  2CR5 A;  3A9K A;  5ALQ A;  4Q8F A;  4PGQ A;  4TQS A;  4KV2 A;  2CN1 A;  1Q5W B;  1OW5 A;  5AKY A;  2W3R A;  3C29 A;  3AEC B;  4IC7 B;  4W9L A;  4BKT A;  3QNM A;  3NGD A;  4DOA A;  2M0X A;  1F1H A;  3V6E B;  3PGE A;  4FAD A;  3KZX A;  4RPZ A;  3L10 B;  4RNA A;  4G9B A;  2NRT A;  3NTU A;  2JVC A;  1QF6 A;  5KFC A;  2K60 A;  2Y0S F;  4ED0 A;  4DL4 A;  2PJH A;  1ZRM A;  1L2N A;  2F3N A;  4F5P A;  1V86 A;  3ONN A;  2AQ3 B;  2PMV A;  3TUO A;  1NK9 A;  1AYF A;  1B0X A;  1A76 A;  4OJP A;  1VD2 A;  1RYR A;  3QC8 B;  3RPF C;  4KLM A;  1MVK A;  2BCS A;  3AE1 B;  2Y9U A;  4I2G A;  4MHV A;  2I1J A;  4RQM A;  1UPH A;  3H8J A;  9ICV A;  3KHG A;  1BPX A;  4DHZ E;  2FAZ A;  2HBJ A;  1XC9 A;  1J97 A;  3HRD D;  2TSS A;  2FID A;  4URK A;  4MH8 A;  1MA7 A;  1AAR A;  4M9J A;  3A33 B;  2YML A;  1D8Y A;  4QWB A;  2ZVO A;  3H8H A;  3QU7 A;  1JML A;  2WU5 B;  1WX9 A;  5DKW A;  2F2A B;  3LDZ E;  1WJ4 A;  3ZDM C;  2WFA A;  1EU3 A;  2ZVN A;  4GXI A;  4DQO C;  1HXY D;  1P7E A;  3DPD A;  5ALN A;  3X0W A;  2MRL A;  2LUE A;  3RNA C;  1CMX B;  5KT3 A;  2WB1 C;  5J0Y A;  1FNU A;  4QZE A;  1WUD A;  1AN8 A;  1PQS A;  2BB5 A;  1Z1V A;  2E5S A;  3MFH A;  4M9H A;  3K9P B;  5C2T B;  5LXH A;  3Q8Q B;  5DDY A;  4IWP A;  4MM3 A;  1QSL A;  3WKC A;  2HHT A;  3UIO B;  4LZG A;  4NM2 A;  4KIK A;  2C28 A;  4WUR A;  2PI5 A;  2W9N A;  3LYY A;  4LJO B;  4IL6 U;  3LYS A;  5KFZ A;  2EEL A;  4GC7 A;  1RAX A;  4HDO A;  1V81 A;  2G0A A;  1UBI A;  2IGD A;  5J2G A;  4DSJ A;  1ZQT A;  1C77 A;  1I4X A;  1WYG A;  2C2D A;  3NZ3 A;  3W1Y A;  4GDL B;  3TSS A;  4US9 A;  3ENE A;  2FMP A;  2F8L A;  2NO4 A;  3EW9 A;  5KFP A;  2K8C A;  4P6V F;  8ICH A;  3THV A;  2OHF A;  9ICR A;  4KX3 A;  4ELT A;  2OH2 A;  1ET6 A;  3DBH I;  1QIL A;  3URY A;  3PX4 A;  4F3O A;  5C1Z A;  1CUK A;  3B2F A;  5ALY A;  1ZXH A;  3PRP B;  5JRT A;  2LXC A;  1R4N B;  2KVC A;  5CR0 A;  4DLG A;  2PKO A;  4FFD A;  1BVS A;  3PZ7 A;  2ZPY A;  5J2F A;  4JWU C;  4DFP A;  5BOL A; 
#chains in the Genus database with same CATH homology
 5HHD G;  3AB5 A;  4A6Q A;  3P4R B;  2QEJ C;  3ZJV A;  1OQQ A;  1P7F A;  3KWV A;  1YQ4 B;  4AS1 A;  4J3O D;  2PLP A;  3BZD B;  2JXT A;  2WDR B;  2YEP F;  1C9F A;  3ABV B;  3W1S A;  1TY0 A;  2E3T A;  1QQR A;  2WXH A;  2BBC A;  2WXL A;  4ARC A;  1TS4 A;  3AMZ A;  3IT4 B;  5HG2 A;  1E6E B;  4RF1 A;  4YSX B;  1ZP0 B;  2ONQ A;  3W2D A;  1F0Z A;  5C3J B;  3AED B;  4N58 A;  1ESF A;  1C4A A;  4L2Y A;  2DWQ A;  3U2S C;  4HEA 1;  4ZRQ A;  2QMT A;  2ON8 A;  2WXG A;  5TSS A;  3IAM 1;  2JU6 X;  2WU2 B;  2KMM A;  2J53 A;  2BS4 B;  1TZO A;  4GDK B;  1V1P B;  4C56 C;  3C8Y A;  1N60 A;  2V0G A;  1UWX A;  5LNK 1;  3KWL A;  1GOZ A;  5EE9 A;  4OW0 A;  1A70 A;  3AEA B;  5D3D A;  1ACC A;  1ZUD 2;  3BYY B;  1HZ6 A;  1MHH E;  2M19 A;  4RH6 A;  4L1B A;  1WGK A;  5G5G A;  1E10 A;  2WXN A;  1TY2 A;  5AUI A;  4LLG M;  4RGO S;  3V3X A;  2RMM A;  1VJK A;  1CK1 A;  4OZC A;  1SE2 A;  4A90 A;  1NYR A;  3TEW A;  1QOG A;  1YMH E;  3SFD B;  4IKG A;  4JX1 C;  1JWS D;  1VDV A;  1YJI A;  1CZP A;  1Y56 A;  2WXJ A;  1IBX B;  4IDI A;  3R8B A;  3W5U B;  3AE3 B;  4DXF A;  4US8 A;  1XCQ L;  4KX6 B;  1V1P A;  1PUT A;  2GB1 A;  1NVI D;  2K9X A;  5BMI A;  1XCT L;  1L5P A;  5HFY A;  3FIL A;  3U52 E;  3Q8C A;  3U7Z A;  2N0S B;  3GB1 A;  2AQ2 B;  2MJE A;  1L0Y B;  4FXC A;  1DOI A;  4MT5 A;  2W55 A;  1D6E C;  1V8C A;  2JSV X;  2QIL A;  4WWM A;  1DOY A;  3HUI A;  4HKQ A;  2WXQ A;  3Q8F A;  3WCQ A;  1HEZ E;  4RGN A;  3AN1 A;  2LHE A;  1I4Q A;  2CU3 A;  4Q2J A;  2WXM A;  4JE3 B;  1IBX A;  3AE7 B;  1TKY A;  2K22 A;  1N61 A;  3NVZ A;  2INP E;  1YJJ A;  1K52 A;  4LK0 M;  2NMQ A;  1ZDX A;  2Y3A A;  4REZ A;  1TJE A;  1VZ8 A;  1HZ5 A;  2PVG C;  2QIE B;  1QT9 A;  2DYM A;  4WIP A;  1SB3 C;  1PDX A;  1CQV A;  1XEE A;  3Q8E A;  1I4G A;  2JZP A;  4DXG A;  2W3S A;  2L1A A;  3O13 A;  1FRR A;  1GB4 A;  2H88 B;  1V97 A;  1JQ4 A;  1OFF A;  1L6U A;  2HDE A;  5I4D A;  2WDQ B;  3E9S A;  3TEX A;  3BVM A;  2JX5 A;  1NYQ A;  1EM7 A;  1WXQ A;  4XDC A;  2M56 B;  4GLS C;  1VR9 A;  5EE3 A;  1ET9 A;  4HJG E;  2LMC A;  4YSZ B;  3AV8 A;  1TS3 A;  1B9R A;  1RWS A;  2R61 A;  2FBW B;  4B0M A;  1XLO A;  2BB6 A;  2SAK A;  4HRO A;  2WXF A;  4WAF A;  2LEK A;  1WRI A;  5MPO A;  3GP7 A;  1FNW A;  2LFI A;  5EE1 A;  3MFG A;  3TEZ A;  3J9C A;  1L6V A;  1QOB A;  1FD6 A;  2WXP A;  1FFU A;  4ARI A;  2ICI A;  2V3N A;  1M4V A;  1E0Z A;  4M0W A;  1EU4 A;  1ZPS A;  5D3I B;  1K50 A;  4ZOH C;  1OQR A;  3P63 A;  5BYS A;  1HA5 A;  3NS1 A;  4P16 A;  1BUI C;  2JYT A;  2NTT A;  1FCL A;  3SFE B;  1DGJ A;  2GI9 A;  2AX5 A;  2LGI A;  2WQY B;  1L4Z B;  3AE5 B;  1QOF A;  1ZXI A;  3AE8 B;  5EE0 A;  1V1O A;  3HVZ A;  3R2I A;  1UNS A;  2FUG 1;  3AH7 A;  3SEB A;  4UDU C;  2J52 A;  1JWU D;  3FIL B;  3E56 A;  1TS2 A;  1FXA A;  2FE8 A;  1YN3 A;  2MJD A;  1C79 A;  2L52 A;  4RF0 A;  3LB8 C;  4YTN B;  2DBY A;  2KAJ A;  3AM9 A;  4CQN A;  4RGT A;  4KGR A;  3MJ5 A;  3ZJU A;  2RDH A;  2G1E A;  2ZW1 A;  3AEE B;  1XXG A;  4MAC A;  4R3D A;  5H92 C;  4C80 A;  1JW9 D;  1C76 A;  1RFK A;  2PW9 A;  3OWE B;  4PT5 A;  1KH0 A;  1N5X A;  1GAQ B;  2SEB D;  4IOI E;  4KGT A;  3IT6 B;  2BW2 A;  1FEH A;  1SBB B;  2XN9 C;  4A8X C;  4AQ7 A;  1VZ7 A;  2N9L A;  1I4R A;  3TEY A;  1MI0 A;  3SR6 A;  2X38 A;  2WDV B;  2HTM E;  1GB1 A;  2CJN A;  3FC4 A;  1TKG A;  4NAW B;  4JPS A;  1PFD A;  2D5G A;  1I7H A;  1GPX A;  3BYT B;  2WLB A;  1QKZ A;  1FFV A;  3AE9 B;  2JWU A;  1F2R C;  2BYT A;  4XDD A;  3NVV A;  1YNT E;  3AE4 B;  1D5Z C;  1MHX A;  4YTM B;  3KQ4 A;  4XWT A;  2CJO A;  1YQ3 B;  2I38 A;  4RCO A;  5G5H A;  2W82 A;  3GS2 A;  2WXO A;  2E6X A;  1SF0 A;  5FK9 C;  2B76 B;  4ZHO A;  4L23 A;  1SEB D;  1C4P A;  2AQ1 B;  4OVZ A;  1JRP A;  5D7G A;  3UI3 A;  1BML C;  2WXI A;  1KLU D;  2DLB A;  2LUM A;  3ETR A;  1BXT A;  1PGB A;  3LXF A;  1PGX A;  1KFY B;  3VRB B;  5T8I A;  3AE2 B;  2WXR A;  1N5W A;  2K0P A;  3I9V 1;  1C78 A;  4B0E A;  3BII D;  1JAL A;  1B1Z A;  4RGM A;  1SE4 A;  1FNV A;  3VRA B;  1J7A A;  1FM0 D;  1T6B X;  1UGJ A;  3NUH B;  2J4X A;  2VZK B;  3P4P B;  2N7J A;  1L4D B;  4H2A A;  3ZQ4 A;  1TYG B;  2RPV A;  2KN4 A;  1YN5 A;  3ZJT A;  2WS3 B;  5BMG A;  1STE A;  3MP9 A;  4YT0 B;  2I2Y A;  1TS5 A;  1C4C A;  2IGG A;  1VRA B;  2BS3 B;  1MPE A;  1PYW D;  2KDM A;  2WNM A;  4NAM A;  5H8Y E;  1VZ6 A;  4JWS C;  1T5X D;  2V4I B;  1XLQ A;  3W9C B;  3BVG A;  5AUK A;  2Q5W D;  1LO5 D;  2LHD A;  1JWM D;  3VR8 B;  3T3O A;  2WP9 B;  1D5M C;  2ZW0 A;  2OED A;  3L4P A;  2QSD A;  3Q69 A;  4A9A A;  3AE6 B;  3ZGZ A;  1E7P B;  2L83 A;  2MEK A;  4XWW A;  4YTP B;  1R7S A;  2INN E;  5GXG B;  1WWT A;  1ENF A;  4HRS A;  2RDG A;  3Q8B A;  1E9M A;  1ROE A;  3P1M A;  3NVW A;  2DYO A;  1AW7 A;  2V3P A;  1DOX A;  1DYQ A;  1HQR D;  1F77 A;  4USA A;  2J42 A;  2Y5P A;  2BTE A;  1EWC A;  3ZYY X;  5JXV A;  2LJI A;  3AEG B;  4OHJ A;  4A55 A;  2WXK A;  1QOA A;  2MJ3 A;  4KGS A;  1FXI A;  1YN4 A;  1Q10 A;  2BS2 B;  3I57 A;  1JWA D;  3PO0 A;  1IGD A;  3P42 A;  2Z8L A;  1UUP A;  1TKE A;  4ZRP A;  2KWD A;  2QJL A;  5BYQ A;  2N9K A;  1D5X C;  3W5V B;  4O1N A;  3DWG C;  1FMA D;  1JWB D;  2GRI A;  2NTS A;  3FAH A;  2L32 A;  4NJC A;  4RFB A;  1EWY C;  4ITK A;  2JYE A;  4LTU A;  2KAC A;  2Y5C A;  3AEC B;  2W3R A;  3B2G A;  1I4P A;  1N63 A;  1SJH D;  1UWM A;  1AWD A;  2ACZ B;  4TQ0 A;  4RNA A;  1QF6 A;  1VLB A;  1SXT A;  3N9Y C;  2PMV A;  1WSP A;  2AQ3 B;  3TUO A;  4KKI A;  1AYF A;  3BVZ A;  3RPF C;  2IDY A;  5E6J A;  1MVK A;  3AE1 B;  4C7Y A;  3VR9 B;  4YWG G;  3BWU D;  1FCC C;  1N62 A;  3IXS A;  4OZA A;  1PGA A;  4MM3 B;  1SIJ A;  4XE0 A;  4TMA B;  4WH4 A;  3P4S B;  2TSS A;  3HRD D;  4TSS A;  4MH8 A;  3B9J A;  3MHZ A;  2YEP B;  4NZL B;  1T3Q A;  3H8H A;  1FRD A;  1FO4 A;  2W54 A;  2PVO D;  1JML A;  2JQR B;  2WU5 B;  3R2T A;  2IGH A;  1ZDV A;  1XLN A;  3EUB 2;  1RM6 C;  2IJ0 A;  3U4E G;  2M0A A;  1IUE A;  3VQI A;  4DQO C;  1EU3 A;  1K53 A;  1KRH A;  3AEB B;  1J7C A;  4ZYS A;  1HXY D;  1XO3 A;  3PZ8 A;  1P7E A;  3AEF B;  2K3U A;  3P4Q B;  3IAS 1;  2BT6 A;  1NEN B;  5FR3 A;  1SJE D;  2G9H D;  2EKI A;  2MH7 A;  5HI1 A;  4C7Z A;  4WQM A;  1KLG D;  1FNU A;  1XF5 L;  4ZHP A;  1JCK B;  3DWM A;  3NVY A;  5BYR A;  1AN8 A;  2BB5 A;  4TQ1 A;  1L0V B;  3Q8A A;  5C2T B;  1ZE3 D;  1F2R I;  1J7B A;  1CJE A;  1NI3 A;  2XNA C;  1L0X B;  3HVD A;  1KTK A;  3RFZ B;  2KQ4 X;  4WUR A;  1K51 A;  3LYY A;  1D4B A;  2PIA A;  4N59 A;  1KF6 B;  2EEL A;  2PTL A;  3EA6 A;  2IGD A;  1RYJ A;  1I4X A;  1C77 A;  4YSY B;  3CIR B;  3KLS X;  3MC0 B;  1WYG A;  3NRZ A;  3NZ3 A;  3V05 A;  4GDL B;  3TSS A;  4US9 A;  2K5P A;  3T3N A;  5FKA C;  2H89 B;  2VZK D;  2IPK D;  4OZB A;  3EGR A;  4P6V F;  1ZOY B;  2OHF A;  4KKJ A;  3BK2 A;  4N6E B;  5BMH A;  3CWI A;  3URY A;  1ET6 A;  1QIL A;  4EE2 A;  4HKZ E;  1IGC A;  3B2F A;  1ZXH A;  3BK1 A;  1FIQ A;  1QLB B;  1SSN A;  1I4H A;  4YXD B;  2PKO A;  3PZ7 A;  1SE3 A;  4D2K A;  4JWU C;  1XLP A;  1NEK B;  1JRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...