3B9JA

Structure of xanthine oxidase with 2-hydroxy-6-methylpurine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
ADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate orientation in xanthine oxidase: crystal structure of enzyme in reaction with 2-hydroxy-6-methylpurine.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords xanthine oxidase
total genus 40
structure length 162
sequence length 162
chains with identical sequence I
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2007-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3b9jA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b9jA01
3WCQA 3B2FA 1TKGA 2ACZB 4FXCA 1NI3A 2WLBA 1V97A 5G5HA 5MPOA 3W9CB 2CJNA 2W54A 4ZHPA 1WWTA 2H89B 1J7CA 1A70A 2K22A 2DBYA 3AE9B 2WP9B 4US8A 2JQRB 1E7PB 3CIRB 2BT6A 1WGKA 1AYFA 1DOIA 1OQQA 3AH7A 1TKEA 1SIJA 3NVVA 2KAJA 4HRSA 1T3QA 3SFDB 2WDQB 1IUEA 1XO3A 3DWMA 3L4PA 1RM6C 3NRZA 3AE4B 3PO0A 3BIID 2Q5WD 4N6EB 1N60A 1OFFA 2E3TA 1YJJA 2L52A 1N5XA 2WDVB 3AECB 5EE3A 1FFUA 3AMZA 1FIQA 2CU3A 1VLBA 1JWAD 3P4PB 3AEAB 1FFVA 1ZUD2 1JALA 2K9XA 2PIAA 4US9A 1I7HA 2BS2B 1WXQA 2KMMA 1VJKA 2DWQA 2PVGC 1DOXA 2L83A 3AEBB 3AEGB 1QOGA 1CZPA 3HRDD 4ZOHC 1NYQA 1DOYA 2WDRB 2H88B 3NS1A 1R7SA 1RYJA 5GXGB 2M56B 1N61A 4LTUA 1L5PA 3VRAB 3AEEB 1JQ4A 3FC4A 3AE3B 3ZYYX 1NYRA 2M19A 3AEDB 3KWLA 1DGJA 1E10A 4A9AA 4WQMA 2HTME 3NVZA 3W5VB 4YSZB 1XLQA 1AWDA 1NVID 2W3SA 4ZHOA 3CWIA 4JWUC 2QJLA 1E6EB 2EKIA 4C7ZA 3HUIA 3NVYA 2LEKA 3P4RB 4KX6B 2N0SB 1J7AA 1FRDA 4YTNB 1FXIA 1XLPA 3AN1A 5EE0A 5C2TB 1WYGA 1TJEA 1YQ4B 3AE5B 1FO4A 2WU5B 3VR9B 1NENB 3AE1B 1GPXA 3FAHA 5EE9A 1SB3C 2WS3B 4ITKA 1L6UA 1ZP0B 3LB8C 3P63A 2AX5A 5H8YE 2QIEB 1ZOYB 3AE2B 1ZXIA 3AB5A 5C3JB 1QOBA 1V8CA 1KF6B 2CJOA 5G5GA 2MJEA 1L0VB 3B2GA 1QF6A 4IDIA 2G1EA 3VRBB 1RWSA 1CJEA 1GAQB 2BS4B 1N63A 4N58A 1XLNA 1KRHA 3SR6A 1FRRA 1KFYB 2PVOD 1JW9D 4WWMA 5EE1A 1VDVA 1JRPA 4C80A 4C7YA 3AE7B 3P1MA 3AEFB 1RFKA 1FM0D 1TYGB 2W3RA 4YXDB 1XLOA 1QOFA 2PKOA 2BS3B 3P4QB 2W55A 2K5PA 3AM9A 1N5WA 1PUTA 1TKYA 2B76B 2WU2B 4HROA 1EWYC 3AV8A 5AUKA 3VR8B 2JX5A 4JWSC 3SFEB 2OHFA 1QT9A 2WQYB 1E0ZA 1PDXA 3LXFA 3RPFC 1PFDA 1ROEA 1L6VA 3B9JA 3ETRA 1QOAA 2MJDA 1FMAD 1J7BA 3AE8B 2MH7A 1NEKB 1JROA 1SF0A 1WRIA 1YQ3B 4YTPB 1YJIA 3EUB2 2Y5CA 4YT0B 4YTMB 4JX1C 3NVWA 4N59A 4P6VF 1B9RA 3HVZA 1N62A 1UWMA 1JWBD 4USAA 1FXAA 1QLBB 5H92C 3P4SB 1OQRA 4YSYB 5AUIA 1E9MA 1F0ZA 3DWGC 4YSXB 2MJ3A 2FBWB 3AE6B 3ABVB 3W5UB
chains in the Genus database with same CATH superfamily
4M0WB 2LMRA 1RQLA 1K1SA 3SU8X 4I2HA 4DEZA 2INPE 2JMGA 2MRLA 3CP8A 2M1MA 5KTQA 4RQ5A 4C4VA 4F50A 4F5PA 3AI5A 2I6XA 4F8CB 3NUQA 2FE9A 2QB0B 2WXIA 2XCPA 5KT6A 1D9DA 1RRBA 3V6CB 1D5ZC 2RLTA 1K8RB 2I1JA 1N5XA 1VRAB 2L76A 3JYUA 1RYUA 1ZDVA 4MJSA 3O0FA 1K5OA 4S0RA 4K3CA 1I7HA 5ALYA 2KMMA 1KJTA 2ZNVC 5DG7A 5KFTA 3U4EG 3IM1A 2BDPA 2JYEA 1LKYB 4ECUA 5KFAA 4KLTA 3RRHA 1IG6A 2JRHA 4CGZA 3H0MB 1ZQBA 3K4GA 1VZ6A 2IPKD 1NYRA 1U45A 4EZ6A 3PZ8A 2KN4A 4YSZB 4JV1A 1WFYA 8ICAA 2KLGA 3PT2B 3PMNA 4LNOA 3NY5A 3G6YA 4PHPA 2VKQA 3GB1A 3C1ZA 4GGQA 4WJNA 1FXIA 5HMLA 1FXTB 3PVLA 5HHIA 1GO3F 3AE5B 4O5CA 2KO3A 1NJWA 4XQ8A 4Y2PA 3IG5A 1GJZA 2O2VA 7ICMA 3Q3NC 3UGBB 4Y2XA 5DBCA 1DOQA 4J9SA 1YD8U 2HBKA 4RH6A 3PRMB 4OJ5A 4K4IA 3NJTA 5KFYA 4RNAA 3F2BA 1CMXB 2KOBA 1PGAA 2BWFA 4KX5A 2KJRA 5DPSA 3KUZA 5EWFA 2JEGA 4DQOC 2WF7A 5J0RA 4KLHA 2MHJA 4DQQA 3BQ1A 1TYGB 4QWCA 1SL1A 1A0PA 1NK5A 1L8OA 2L0FA 3RBDA 9ICMA 3A9JB 3WKBA 2A5UA 2WU2B 1WXVA 3I3TB 7ICLA 5DCNA 1LV5A 3R66C 2JR5A 2G5IB 2WXFA 3RAQA 2KKVA 2WFAA 2QKQA 3RAXA 1S97A 1TK5A 1ROEA 2DENB 1E7UA 5J17A 5J0WA 1WMHB 1WRIA 1TS4A 2W9CA 3L3FX 4NLCA 1HEZE 2VH1A 4IWPA 3ZQ4A 7ICPA 4N59A 5KFZA 4WJOA 3Q8EA 5KT2A 5CA7A 4RCOA 3GIKA 4GXJA 4FN2A 3TADA 2PTLA 2N4FA 3JW0X 4C56C 2MJ3A 5FP0A 3RNCC 4OO1J 3KWVA 3WCQA 1YT3A 4O3OA 1WMHA 4LJOB 1LFDA 4LNKA 3BQTA 1TIFA 1F52A 4EENA 3C0RB 2H89B 4KLIA 3F53A 9ICRA 3TFRA 1ZQFA 2J0KA 4UAWA 2KC1A 1IV8A 1WJUA 3DPDA 3HM3A 1A77A 3KZXA 2IA6A 3PSEB 1RXWA 3DVNU 2KTFA 3IDWA 4K4GA 2KHWB 1YX6B 4Y2SA 4F91B 1WRDB 4QIWF 4DDGD 1ZQAA 1FCCC 5AZHA 4E74A 9ICSA 2ZW0A 3E0FA 4XWTA 5KG0A 3QE9Y 2EZYA 3RRGA 4Y2TA 3K1ZA 5AKJA 2IBIB 7ICJA 1NI2A 4NLBA 2ASLA 2RDHA 3V62A 5BMIA 8ICGA 2JY6A 8ICIA 4ZOHC 3JPSA 2F1HA 1OEYA 2A1JB 4OVVA 1WZ3A 3IT6B 3TARA 2O2VB 1ZPSA 4LDTD 5HNKA 1BUIC 5L83A 1S10A 4AP9A 8ICOA 4NAWA 4ECRA 3QZ7A 2C28A 1JXEA 4I28A 1ET9A 4WQMA 5ALQA 2AQ4A 3TEYA 1TTNA 2WF8A 4K81A 4B9UA 3GZNI 4E71A 5IINA 3MR3A 5JTIA 3L5KA 2INCC 4F71A 3ML9A 1RFAA 1Z3EB 1L3SA 1BNPA 3KTQA 1NKCA 4BWJA 2A3VA 4RQNA 3FAHA 3DVGX 4MH0E 4ANWA 7ICGA 1ZD2P 3P63A 5LLIA 5IIIA 1P7FA 4MEMA 4I2DA 4M47A 2QIEB 2K8BA 4B9TA 1V8CA 4RQ6A 1YNTE 2BPCA 1T6BX 5BYSA 3QCAA 2ZJAA 4B9LA 2BB5A 3T79A 4GC7A 1PGBA 2J0JA 2MLBA 2V4LA 1NNLA 1KLNA 4DL4A 3RJJA 2K8CB 2HHQA 3NTUA 3UI3A 2CXYA 2NO4A 3WAPA 1I4QA 5ALIA 4MGIE 1ZQZA 3HW8A 4K4HA 7ICRA 4JWSC 3SFEB 1QT9A 3MFIA 3A1QB 2J53A 3PZPA 2KKPA 4KGRA 1WX7A 3PLUA 2UU7A 2OJWA 1SKRA 5KFPA 4TUPA 3X0WA 4UAZA 4GB9A 2DUYA 1JROA 1YQ3B 3HHMA 4EZJA 3DEEA 3ZDMC 2JVCA 2MEKA 4AYBF 2FCQA 2A4ZA 5AKYA 3ZGZA 3U30A 3ZNZB 2K39A 1WR1A 2LI6A 4OJLA 1VJ5A 4M9HA 3TFSA 3MHSD 1ZQUA 5AUIA 3QK0A 3WA0A 3IAS1 3SV3A 3BK1A 4NAMA 1EU3A 4KLUA 2K8AA 3ZDAA 2BKRB 2NRVA 4GLSC 3ZTCA 2ZXHA 5KAIU 3BYYB 4W9HA 5EWGA 3K75D 2JEIA 3CIRB 4BKSD 2BCVA 1PQSA 1QLNA 1STEA 1P1AA 2WX0A 2G08A 3AULA 4PS3A 2FMPA 4RNMA 2BHNA 5ALOA 1KKXA 2KLCA 2LWPA 1C20A 2W8LA 1ZQNA 2Q5WD 1RQNA 2CHZA 1U47A 2ZIVB 5ALHA 4FJYA 1WGDA 4DSKA 2WYQA 3ISDA 3AU4A 4ZYNA 2DL0A 4OZBA 2BZFA 3ZW3A 4C4TA 4YMNA 2K9XA 3FILB 1UHUA 2KN5A 4LCDE 1SL2A 3AEGB 3ETLA 1WCLA 4TUSA 4GOCA 3PW7A 4FBJB 4P0PA 1DOYA 3L10B 2H3ZA 2OCEA 2D2QA 4OZCA 1ZQXA 2M19A 2FCNA 1ZQRA 3KWLA 2ZW1A 1B43A 5ALJA 3W5VB 3SD5A 4KLLA 3PNCA 4MJSB 4PYUA 2K4IA 2HSZA 3ZRCA 4UB4A 3KZIU 3BZDB 5IIKA 4YMOA 3KKAA 3M9MB 1ZE3D 4GDKA 4MEXA 1WWVA 7ICIA 3DHGC 2PI5A 2KXJA 1PK1B 3MDCA 3B0AA 4QWAA 2J6SA 4Y2QA 2AQ2B 4FS2A 2CKHB 4B9SA 2LM4A 4IC7B 3OAWA 3JVZX 1T4GA 4MEYA 2MJEA 2V9HA 2P6UA 2JUOA 4OW0A 1K52A 3KHRA 5IA7A 2HJ8A 2FUHB 5G55A 1NKBA 1FEZA 4NM2A 4ZYSA 5KFFA 2W9BB 3OTQA 4XE0A 3OJUA 1RXVA 3TEWA 3EFCA 3AQEA 3QU5A 3H6NA 1L7PA 1FM0D 3UXPA 1ZDXA 3P4QB 5KAFU 1S1QB 2W55A 1WJ6A 4GXIA 4HROA 2MUTA 5HMMA 2ZIUB 2E1FA 4JPSA 5HR6A 1HQRD 2DNFA 3M7DA 4D2KA 3D2NA 4F72A 1ZQLA 5AI4A 5J29A 1PGXA 4KLJA 4NJ7A 4XDDA 2EAOA 1DRGA 2F77X 4IC9A 2M0NA 3QA8A 4K7WA 3O13A 3MGIA 1Q0WB 2KK0A 4O3MA 1AN8A 3L08A 1DK2A 4DOBA 3OWEB 5KFKA 2AL6A 1ET6A 4DQIA 1N62A 4PK1A 1MC8A 5DB9A 2OH2A 4NY0A 5DQHA 2GO7A 3A0BU 2BGFA 2YEPF 8ICVA 2YVCA 3SZ2A 3PV8A 1BPBA 3RJHA 2RDGA 1HTQA 3HK0A 2BKFA 3V72A 2JZ3B 2DBYA 3M9NB 4MH8A 5KFEA 4XX5A 4ELUA 2MCNB 1V80A 3RBEA 3UIOB 1V86A 3PW5A 1RG6A 4A20A 4UAYA 4DK5A 1T3QA 2WB1F 2YY6A 2LHTA 4UAVA 1WX8A 5JXVA 4ANXA 4E3CA 2TSSA 2KE7A 3Q8CA 2E3TA 4JGHB 4OZAA 3SEBA 2GWSA 3ZVVA 2CU3A 1VLBA 2NVUI 5AM4A 2M8SA 1T94A 3AEAB 1D4BA 2XI9A 3AXCA 3UQBA 4GU2A 3ALRA 4ICAA 3TBLD 3RFZB 4XRHA 4BJQA 2ESEA 5AKGA 3ZDBA 2YB4A 1EM7A 1ZQJA 1L5PA 2KANA 3AEEB 1HJPA 5ALWA 2R2QA 2G4DB 3GV7B 2FLLA 1Z19A 2DPJA 1H4RA 2LKYA 2HTME 2LUMA 1DXSA 3ZRFA 3QX1A 2O6VB 4YFKA 2VANA 3AU6A 4F4WA 2BQ3A 2JGAA 4KX6B 2CHWA 4J9KA 4YTNB 3PX0A 1D9FA 1MHXA 4O1NA 1Y8RC 4I2GA 4YR3A 1KM7A 5JU5A 5J2RA 4J6IA 4UBCA 4JLCA 1TZ1A 3VTUA 4G3XB 1ZOYB 2NPTB 4UW9A 2ZPYA 3DCGA 1ZW7A 3QUQA 5G5GA 4LDTB 1ZQMA 1Y56A 3VUYA 2AQ0A 4F4ZA 2KG5A 4MF8A 2KV2A 1Z1BA 3SQIA 4O5EA 3Q8QB 2JXXA 2AXTU 4PHEA 2AGOA 1L3VA 3A4SC 3IV6A 3L54A 3MJ5A 4G0NB 3JPQA 3U7ZA 3RB3A 1JW9D 3R7RA 4C4SA 3GU3A 4FFDA 3DBSA 4YXDB 3VDZA 3V7LA 1YQBA 4R66A 4HPPA 3AM9A 4EX6A 3VR8B 5B66U 5ALXA 1EWCA 3Q3JA 2ZIWA 2N9LA 1E0ZA 3V6HA 4AJWA 3RJFA 5BYRA 1L6VA 4DL2A 1JUDA 1X6IA 3ISBA 1NZBA 2JU6X 4ICUA 4JE3B 2NR2A 5IOIA 2L5YA 5CHGA 4DFPA 2JEFA 4RZRA 3H1UA 2LVOA 5KL1B 1ENFA 4HKQA 2KQ4X 2LVQA 3W1YA 2JXTA 3QU9A 3RUIB 1UWMA 1MHHE 2JRZA 2I5HA 5J2JA 3ZUNA 3DWGC 9ICWA 2V1YA 3JPNA 2FNJB 3KD3A 4MFAA 2BW2A 5CB1A 3FYHA 4FBTA 1T0QC 2KDBA 4QWEA 3A33B 1L6NA 3UMCA 2BR0A 4JB3A 4NQKE 4YR2A 1J7CA 3BZCA 4PS7A 3PSFA 1JI7A 1TGZB 3A1QA 1D5MC 2NMQA 4HKZE 4DHJB 4KMUA 4A3PA 5F9LA 2IOFA 1AYFA 3DHIC 3ZJUA 2KJHB 4ZRIA 3ZDEA 5D3DA 4QZEA 2W7PA 3GV8B 1IUEA 1XT9B 2V0GA 1SWWA 1TS3A 1UCVA 4QZ8A 3BDPA 5ALDA 1XO1A 4MF2A 4I27A 5ALNA 9ICBA 1FIQA 9ICNA 2O6VA 1X40A 2QB1A 1WJ4A 2XBBC 4ARIA 1D8BA 4YL8A 5D46A 3ZD9A 1OUQA 3V3XA 4TUUA 2ZG6A 4C8MA 1N61A 3E2EA 3AE3B 2AL3A 1SIFA 5KFJA 1UGMA 1SKWA 1UPHA 3VUWA 2HHSA 2J4XA 8ICCA 4LZGA 5KFSA 1WGYA 2EKIA 3M6KA 3ZTDA 4IQVA 5AHXA 5I4DA 3AN1A 3A0HU 4X57B 2WXOA 1VD2A 4IS7A 2BKEA 1TAMA 3AE1B 4PGYA 5ALPA 2Y5BB 4YD1A 5J2DA 7ICKA 5KFBA 4FADA 2FPLA 1L4DB 1XF5L 1V81A 3RFAA 4GMVA 3PW2A 4O3RA 1RYRA 1WX9A 4OCZA 2WX1A 3HJEA 1BPYA 1C3TA 1L7NA 1X42A 2N1RA 3U8ZA 1TKDA 2CR5A 4KLMA 1ZRNA 4NNJB 4I2CA 4TURA 4B9KA 4MACA 3UM9A 5EOZA 5AZGA 8ICLA 1CRXA 3F2CA 3NRWA 4BX9C 4RNOA 3P42A 1E8ZA 3NG0A 4ELTA 4TSSA 3M8RA 2YMPA 5BMGA 3T3OA 1YZ7A 2B0CA 2EKEC 5HKHA 4M2YA 2GLEA 3ETRA 5J0SA 4KGSA 4Q45A 2MJDA 2ASJA 2CRXA 1FMAD 1IGDA 4RMAA 2W9BA 1UZXB 5KG7A 3AE8B 4W9JA 4QWDA 3N7SC 4B9VA 1L2NA 4YTPB 4G3IA 2BGWA 4CQNA 3CYMA 1COOA 3VCBA 3JSVA 4CYEA 4QNLA 5L95C 4L1BA 2K3UA 3PSTA 2OJRA 2ZIUA 2OYYA 1OQRA 2KOXA 3B1LX 3I5JC 2ZUCA 4MELA 1QQ7A 2ZEQA 2AHOB 3ABVB 3PRPB 1NK7A 3IBEA 4XYCA 3UMBA 1TKGA 4WH4A 3MGVA 4O9MA 1AQ6A 1V97A 1YIWA 3WALA 1ECWA 2BF8B 3AE9B 3ML8A 9ICJA 2ISPA 1KDHA 2AQ3B 3N1XC 2QC8A 1AW7A 5AKXA 5BOMA 5BOLA 3PW4A 3A9KB 5D7GA 4Y2RA 3AH7A 5DPRA 2EZZA 2DAFA 5AK5A 4Z6FA 3H9DA 1SV4A 2KDIA 4ANUA 3C5FA 3L13A 2EDUA 2P66A 3AE4B 3DVNV 4PS8A 2DYOA 5EE3A 3PY8A 3T5KA 2QHOA 1PUZA 3AMZA 4OHJA 5KG2A 1MA7A 2LUEA 4US9A 2Q0ZX 3B0YA 4K3BA 3IP4B 4UB8U 5T8IA 4A3OA 1ZXHA 2LMCA 1QOGA 2N9XA 2GH1A 2LJ5A 4HAIA 1P3QU 2KZ3A 7ICFA 1ZOLA 2H88B 2ON8A 2L1AA 4F1SA 2MUTB 4LTUA 1LKYA 2INNE 4RGMA 2F1IA 3AEDB 4O3SA 2DKXA 5AI0A 5KT4A 3RNEC 4A9AA 2KQ7A 2L3ZA 4DFJA 1TY2A 1OQYA 4QIWC 1TZOA 3I63C 3Q8RB 2CPRA 4KLQA 3BINA 4A8XC 3UQAA 1QQ5A 5ALSA 4KX3A 2H3QA 5EE0A 2NO5A 2ASDA 1XLPA 1OTRB 3PZ7A 2LXAA 5DDMA 1N56A 2DZJA 1ACCA 5DBBA 1J2MA 2QEJC 2WS3B 4MHVA 2LGYA 5H8YE 2B3AA 4BVUC 4BDPA 3AE2B 4ECSA 8ICNA 4KN7A 1KF6B 1L0XB 4GDLB 3R7QA 2O6KA 2UWQA 3SV4A 2G1EA 9ICKA 2IJ0A 3OLMD 1GAQB 4N58A 4C80A 2KFZA 3M8SA 4KVGB 5KFGA 3V61A 4R63A 3QUCA 3OJSA 1XS9D 4DQSA 1ZQCA 1SXEA 2FMQA 2JEJA 8ICSA 3GS2A 3IHPC 1SE3A 2PKOA 2BTEA 2KSOB 2K5PA 2B76B 1X6JA 5CWRA 2UVWA 4RPXA 2XO7A 4ED2A 1MN8A 2OHFA 2XY7A 4UARA 5AK3A 9ICPA 1S3SG 3APFA 2KD0A 7ICVA 2IOHA 3N9YC 3RR8A 4TQRA 2ZJDA 4QZHA 1AARA 1ZQVA 2KDMA 2GOLA 1YJIA 5KFNA 1T0YA 1F2RC 2C2DA 2ZTDA 4NJ6A 4IM0A 2WAQF 2YMQA 2KYWA 4XGAB 3Q69A 2ZUBA 1UH6A 4K1RB 3SHQA 5KFRA 3HKZF 1JWSD 3IHQB 4YSXB 4MM3B 2FBWB 4EBDA 3KUCB 3MR6A 5KL8B 4HJGE 3HWTA 2F8LA 4IRKA 1Z4NA 2KWUB 2WLBA 2BQRA 4ZH4A 1N48A 4AP4C 4IQWA 1L3UA 2H3FA 4DL5A 2JQRB 4HDQA 3RD2A 4B6JA 1NZPA 5HHHA 1CUKA 4II3B 1F5SA 5HP4A 2KAJA 3F5AA 3C2KA 1C77A 3M3JA 1XNSA 1U9LA 3GFKB 2KVSA 5EWEA 1TS2A 3NZSA 3R2TA 4M00A 2JHDA 2CN1A 4I2JA 1KLVA 3Q3FA 5ALRA 2XNAC 4IL6U 1FCLA 4WIPA 2PVGC 2BS2B 1BPEA 1JWMD 1V9PA 2DGZA 4DLGA 2XC9A 3ZDTA 4GDLA 1NK6A 4QZIA 4BOSC 1ZQQA 2EMTA 9ICLA 3IRUA 4NL9C 5DDYA 3I76A 2VA3A 4F4KA 2V4QA 1S9FA 5AI9A 5C23A 2YN4A 1L7YA 2I1KA 2KX0A 3KHLA 2BPGA 4DS4A 1CI4A 2KMDA 3AEVA 2X38A 2IO1B 1P7DA 3S2AA 2ALZA 1I35A 1G6JA 5L1MA 4O5KA 1LO5D 5DB7A 4HPLB 1V49A 1NVID 1GC7A 4OVUA 4I2AA 1WCNA 4KN4A 4CDGA 2WXLA 2D6FC 1E6EB 1ZD3A 2E8MA 2RR9A 2LHDA 2HHWA 4F3OA 1X66A 9ICTA 2AJQA 5A0LA 3DDHA 1S0OA 2KTRA 2KWDA 5LNK1 4RQMA 2ZCBA 2AX5A 1ZETA 2JZZA 4QZBA 4RQ2A 5J2AA 2KMAA 2RP5A 1FPYA 1UUPA 4FHJA 3RH5A 4XC2A 2NYVA 2N9KA 1MSWD 2W8KA 2OWOA 7ICTA 1OW5A 1Z00A 8ICMA 3KHGA 5AKZA 1VZ8A 5J2GA 5ALLA 5AM3A 1KOTA 4QZGA 3GIJA 2N7DA 2QB0A 8ICWA 3LJ3A 4YWGG 1D3ZA 1PUTA 5AUKA 3ZXVA 3A9KA 2AYOB 3Q8LA 4NPNA 2OOBB 2PLPA 4HK2A 1D6EC 4PH5A 8ICRA 7ICOA 1Z00B 4NQLB 3VQIA 2Y0SC 1SV0A 3Q14C 1A76A 4LNFA 4M01A 4RQ3A 3JPRA 2RQ5A 4ECXA 2MU2A 4PHDA 8ICEA 3RYTA 2W9NA 2YB1A 1GNUA 3HX0A 1NJXA 5CHWA 1BNOA 4F4YA 1OGWA 3P4SB 1QZEA 2KHQA 1Q8KA 5J2FA 3URYA 2E8PA 4YD2A 3S6JA 4B6WA 3EWAA 1SKSA 1RYSA 1JCKB 2KMCA 1ZQDA 4PJ0U 1XWLA 4P4PA 4GIBA 4M6WB 4BBNC 4P4OA 5J0YA 4RUCA 4DO9A 1A70A 4EUTA 1YN3A 4KLFA 3PX6A 2WB1C 4PPXA 4P7IA 1WZ0A 2IY0B 2JH7A 1X9WA 5GTIU 2J52A 4NJCA 4I29A 3IT4B 2EAPA 1TKEA 4RM9A 5KFXA 2Z8LA 1ZQYA 3T8MA 3L4PA 5AKHA 5J0XA 5CHFA 4N6EB 2XGPA 1I4GA 1OFFA 2ZTCA 3JSVB 1ZQKA 3QUTA 3H7SA 1S8OA 3RT3B 4M9LA 2LASA 3KFUF 5DG8A 2DFLA 2ZIVA 5L1JA 1C4PA 1RPLA 3KW5B 3A9JA 1SWVA 3QXGA 1JMSA 2KN7A 3ZXRA 3WK9A 4ZRJA 3NOBA 1ZQEA 2PMZC 2W9AA 5FR6A 3ISCA 4HPMB 3RH4A 4EX7A 3ZYYX 2GB1A 2OXOA 3LWMA 4CO7A 3T9LA 3N3KB 1KLGD 4O0IA 1AWDA 2NTTA 3UQ0A 5CP2A 3HKZC 3CWIA 3GIIA 4ECQA 3QEAZ 5E6NA 5IILA 2GBRA 3R8BA 4C7ZA 4UASA 1ZQPA 2JRIB 1J7AA 4QJFB 4R64A 2P6RA 3D2QA 3JPTA 1YOVB 2WWZA 4RF1A 3BS5B 2ZVOA 1QTMA 2D07B 2NBVB 5L1IA 1V38A 2VA2A 4BXOB 1JRUA 2L7RA 2K6QA 2OEDA 3NZUA 3H8SA 3PO4A 1S0MA 1IM4A 2ONQA 2M0AA 5D49A 1QOBA 2VZKB 7ICSA 4IWOA 4MSMB 2LGIA 3HVDA 4IDIA 2BVCA 1PYWD 2HI0A 8ICKA 3QQ8B 5J18A 5E6PA 1ZJMA 1UT5A 3AUOA 2GLSA 2L05A 1OXJA 3LK9A 3PRZA 3P1MA 3WK4A 1NDDA 3IXSA 4G50A 2IHNA 2HVIA 4AUQC 5AI6A 2PXIA 4C00A 2LYHA 3R9KA 5JHBA 4RQ0A 3OSPA 5KFQA 9ICHA 1UBQA 2KDEB 4TKNA 2NS5A 3U7DA 1PFDA 1YX5B 1V5OA 1QOAA 4DL7A 3PHXB 5AZFA 3L0WB 4GIVA 5ALGA 4W9IA 1J7BA 2Q4TA 1QILA 3RJIA 1IYFA 2JV3A 1SGGA 4UAUA 4DFDA 2BQQA 5AM1A 4J03A 2FIFA 4YT0B 4JX1C 4FS1A 2JT4B 1J2NA 4EEKA 4BGDA 1XO0A 2WAQC 2YMLA 2RDBC 1UELA 3GE3C 3RMKC 4A6QA 1EF1A 2KC2A 2LBOA 4AWJA 3GILA 4PGQA 3B2FA 5ALUA 1TAQA 1ZQSA 4HCNB 4XWWA 2WF9A 4Y2JA 2EMSA 4C8KA 3W1SC 4JUZA 1Y88A 1U48A 1E8YA 3RI7C 3KOOA 4US8A 4IRDA 1WYWB 4W9KA 1S0VA 2F3NA 4Z6DA 2WXPA 2YLMA 4NLKA 5AIBA 5CHVC 3UXOA 3UMGA 3CSTA 3SFDB 1PK1A 1YMHE 2KNJA 1IXRA 1MG4A 3AEFB 4RGTA 3WKEA 5KFVA 5IP4D 4GSWA 3AL0B 2ZNVB 2BYVE 5J8YA 4KIKB 1SV0C 5T14A 3UPQA 3N4MB 1JWAD 3ZLZA 1B4FA 2HD5B 2KJ9A 1OEYJ 3ALBA 2V3SA 3DBRI 3BQ0A 4BOZB 4DHZE 3C5GA 3PV1A 2E8NA 5L9XA 4DF8A 2MBHA 1ZKHA 8ICJA 2ZXIA 3I9V1 3VRAB 3C23A 5ALTA 3KYCD 1WI0A 9ICUA 1YJ1A 3HILA 2LGXA 5CR0A 2XIDA 1XLQA 2BCQA 4FJZA 5IAAC 2ZVNA 4R8UA 1Q5WB 4X5VA 5KFHA 2G09A 1TV9A 9ICFA 4UDUC 4ECVA 3QUBA 3C2LA 1FRDA 4FBUA 3Q3MC 1CK1A 5C2TB 1Z4OA 4KDIC 2WU5B 1NENB 2C7NB 4EZ9A 1SB3C 9ICGA 3L17A 1B22A 4KLOA 4FLHA 3DBLI 4IW0A 2X8XX 5AKIA 3QYPA 3THVA 3ZDDA 3GV5B 4DQPA 3B2GA 2D3GA 1N6ZA 2N9PC 3SDLC 3VRBB 4QW9A 4HYKA 4IR9A 3PR4A 4ECWA 3Q8PB 2ASQA 2NTSA 1JRPA 3MC9A 7ICHA 2MBBB 3C29A 5ALVA 3LVWA 4GC6A 1EF5A 2WXHA 5L1LA 2GRIA 1GOZA 3VH4B 3OHBA 5AM5A 1C1YB 4P0PB 1F1HA 4CNQA 2BPFA 4TQ0A 2DX5B 3RNAC 4KGTA 2AU0A 2N1VA 3ONNA 3OHAA 2FLPA 2N9EB 3PS6A 2MP2B 2HCFA 3WKCA 4RM8A 4M9GA 3VVWB 2G3QB 5D4BA 5DGAA 5DBAA 1ZD4A 2BWES 4UBBA 2KK8A 2V9WA 8ICQA 2MRPA 4BUGA 2VJ5A 3WAOA 4AS1A 3QU2A 5F9NA 3SD7A 4A55A 5BO4B 4I6PA 5J2HA 2ZUDA 2EZXA 4YSYB 1F0ZA 4XDCA 5KFOA 4B9MA 3Q8MA 9ICOA 3H0RB 2WHIA 2WXMA 3IVFA 3V6EB 2D10A 1NOMA 1QSLA 2V4IB 4HVBA 5J2BA 2E8OA 4EKUA 4PGXA 2KX3A 5MPOA 4J9NA 2CJNA 1FNVA 4UATA 3EYZA 2PKEA 1WIAA 2HDOA 2KEYA 3H8WA 5KG1A 2N7JA 4TQ1A 1WH3A 1WSPA 4M9NA 2PI4A 1V1PA 3MR5A 1X9XA 3G6VA 1SIJA 2Z7JA 3LDZE 4RUAA 3PSIA 4JWNA 2IDYA 1UWXA 3RJEA 4RGNA 2BYTA 2L52A 5J2CA 2N1WA 1TVAA 4L2YA 2G45B 4R8UB 2NCNA 4FA6A 1Z2MA 5DLGA 4C8LA 4HJKA 1ZUD2 2NBUA 4U7CA 2Y9TA 4Y2UA 2DWQA 3RNGC 3DQVA 5CTRC 3TANA 3RNFC 3WKDA 3AU5A 3LYSA 1XXGA 2KICA 3N1YC 1J8CA 1KTQA 2KZMA 1NYQA 1RYJA 1A5RA 5GXGB 1UGJA 2AWTA 3GE8C 1TK0A 3I57A 3CRXA 2WXNA 2J0MA 4HXDA 3VUXA 3RTVA 4AOFA 2GBJA 4NXZA 2IZVB 4LZDA 3ZNGC 1BPZA 2W43A 3P4RB 5CX3A 2N0SB 1GB1A 3QU7A 1YN4A 1TJEA 4RT3A 2DQNB 2FI1A 2NRTA 3KYDD 4P1BC 3ICXA 2F76X 4EOYA 2VRRB 1B1ZA 4CF5A 2RPVA 3TADC 1ED1A 4DFKA 2RD0A 3AB5A 1TK8A 4Q2JA 5J8YC 4F4XA 1L0VB 4C0ZA 2QILA 4WURA 5HR7A 2G9HD 1RWSA 3N32A 4NM1A 2PMZF 3Q8FA 2FE8A 5KFCA 3MC8A 3D32A 1L0YB 2V4RA 1K51A 3RB4A 3N7PD 5J0UA 4QZFA 2PPHA 2LVPA 2EAMA 2UYZB 2DKZA 2KIWA 3VC8A 1D8YA 4WWNA 2WDTB 3U2SC 4YXMA 3M1YA 3PX4A 1PZNA 1IPGA 2DHZA 1ZJNA 3B9JA 3BS5A 3SAFA 4DXGA 4B0MA 2DF4B 3H8MA 4I6NB 3RJKA 2SAKA 1SF0A 2MSED 4EE2A 4I2EA 4DDID 3KKAC 2IYDB 4YTMB 4DF4A 4GXBA 3BZKA 2JYTA 3BYTB 4USAA 1K53A 2WXJA 1QLBB 4W9GA 2IO3B 3PW0A 4PZOA 1HIWA 1ZQOA 2UVVA 4KLSA 4P16A 4EZKA 4PZNA 2D3CA 2ZJ5A 3VH3B 3PZDA 4EEWA 4EYIB 2WP9B 3SAHA 4BKGA 5IO9A 4J9MA 1I4HA 1RLFA 3C21A 2NPTA 3BJYA 2CHXA 2QDFA 3T5JA 4P1CC 2BYFA 2JZPA 4C8OA 2RSUA 5IIMA 1O08A 1H8CA 2PFNA 3J81j 4DOCA 4DCCA 1I4PA 2XK5A 1T0RC 5EDSA 1GB4A 3PMLA 2YX8A 1KH0A 4OJOA 2HJ1A 5J0OA 7ICUA 3BQ2A 4RU9A 3Q3OC 5JH5C 4RQ4A 4UB2A 2KP7A 4F2RA 5DPWA 5ALFA 5KHOA 4LNIA 5AK4A 3QWZB 2WGSA 1MG8A 3WU2U 2K25A 5HFYA 3V7KA 3CNHA 3T3FA 3F2DA 1O03A 4B95A 2LHEA 1DGJA 4GN1A 1UD7A 5AM2A 3M9OB 1QSYA 2JZBA 1T8EA 1M94A 3RH6A 3FDSA 2W9CB 3HM6X 1NKEA 2K4HA 3HUIA 1J19A 5D94A 2JWZA 2MP2A 3Q8BA 1QKZA 5D3IB 1YQ4B 1FO4A 2HW3A 1WE6A 4P2HA 1F44A 4MFCA 5KT3A 2LYAA 4FE3A 5C5JA 4EYHB 2P35A 1XU4A 4GDKB 2A1AA 9ICQA 1SBBB 2RMMA 2XCAA 2K0PA 3LYYA 8ICFA 2LXCA 5TISU 4AJYB 4IKGA 2W7OA 2AQ1B 4MGZE 2K89A 2I38A 3BK2A 3EC8A 2DZMA 3MHZA 3V60A 5JHAA 3M6ZA 3SR6A 5KFLA 5DGBA 1SXTA 2IGHA 4ICVA 2ZIXA 1VDVA 1KLUD 1UQVA 7ICNA 1P7EA 4RPYA 1SE4A 1I4XA 1XCQL 4EFOA 5ALMA 1XLOA 3T3NA 4J9LA 3ENEA 4JV0A 1V1PB 2XN9C 1EWYC 2KWCA 4RQ1A 4PL2A 2IO2B 2JX5A 4JIOU 4HDOA 3ZNID 2G07A 2YMMA 4Q8EA 1HTOA 1PDXA 2XVTA 2MWSB 4O3NA 5FR3A 4A90A 1MQ2A 4O3QA 4DOAA 5KT7A 1BMLC 4LNNA 4NV0A 3QZ8A 3T5HA 1YZ6A 2C9WB 3APDA 4IQTA 1QH9A 3TEXA 1M6YA 1SZPA 3W2DA 3RNBC 3TUOA 1JWBD 3H8JA 1F9JA 1FNWA 1FXAA 5IKCM 1PVRA 4PHAA 3R3MA 1E9MA 4WWPA 2NRWA 1Q3VA 2F44A 3AE6B 4AQ7A 2Z59B 1NK0A 2MA1A 5GMVA 5G5HA 4NLNA 1E5WA 2AH5A 2XK5B 3EGRA 4PYZA 1SZHA 3W9CB 4ZHPA 1MQ3A 3IFWB 2MA9B 1KQQA 2KD1A 5BPCA 2C7HA 2J6UA 1J0GA 4DHZB 2F1JA 4YG2A 4RQ7A 1OQQA 2NBWB 1EXNA 3VTVA 3TCAA 4WJ3B 3GDXA 4GLXA 5DQIA 2OEHA 4DL6A 2GBKA 1AROP 1KRPA 2WDQB 4ED0A 3PO0A 4ECYA 3BIID 4I6LB 4YR0A 1XEEA 1ZYQA 3V7JA 3IAM1 5JRTA 1QQ6A 1L3TA 3SEIA 1EU4A 3ZDCA 4S17A 4P4MA 4TQSA 1FFVA 1JALA 1J97A 3OGUA 3GQCA 5KG3A 1SSNA 2V3NA 1WXQA 3M95A 1ZQ1C 2Y9UA 3VHTC 2JPHA 2SEBD 1DOXA 5IIJA 2KJ8A 2C7MB 3DHHC 4IR1A 2GMIC 2KSOA 5CEHA 3O65B 2QARB 3FC4A 4NLZA 3QIJA 5KHQA 1R4MB 1XQQA 2M0XA 2IOFK 4U6PA 4DWIA 2RRDA 3NVZA 1ZGUB 1L4ZB 3EFUA 3UXNA 2BCUA 1S0NA 1WY8A 2KNBA 3NVYA 2M4NA 3TMPB 1UT8A 5AICA 4DFMA 2PFOA 3PLVA 3RULA 1QCKA 1ZQIA 4KLGA 1T3NA 4KLEA 3WIMA 2WHEA 1KEJA 1KL9A 1D5XC 4ITKA 1A6SA 3K9PB 1C9FA 4ED7A 3P2BA 2W04A 9ICIA 1WGRA 2KTRB 4FJVB 4YXJA 4WAFA 2BYEA 5C3JB 1WXSA 3RN9C 3NHEB 1UBIA 4CCHA 4G11A 2MQJA 2LGSA 2BPSA 2PJHA 3LWLA 5JUMA 4WJQA 4DBGA 4RNNA 1N63A 2FJ6A 1KRHA 5FKAC 4F92B 1SJHD 3DBRB 3D6JA 1V85A 4UB6U 4JK1A 4LK0M 2BB6A 1D8LA 2MBQA 1T7PA 2FCMA 4H2AA 2E1EA 2MSNA 2ZIWB 4PL1A 2FUG1 2LPEA 7ICQA 4ELVA 2KACA 3Q6BA 3JPOA 1IBXA 2MAXA 4TV3A 2E5SA 5D2MB 4JQWC 2KTQA 3LXFA 3RPFC 3KUDB 1SE9A 3WK6A 1HUZA 2NV3A 2HOFA 5KT5A 2JSVX 3TL5A 1U4BA 3E56A 4FZLA 5D6JB 1S77D 1JXLA 1LGRA 5E6JA 2PFQA 5KG5A 2Y5CA 4IQUA 1WR6E 4TUQA 3NVWA 1ESFA 1IBXB 3HT3A 1B9RA 8ICPA 1LXDA 5H92C 4WQOB 1KBUA 3N97B 1L7MA 4I2BA 4JWMA 3IG3A 1BPDA 4DSFA 3KVFB 3GIMA 4YCXA 1KTKA 4KKJA 4C4VB 3ZI4A 3PO5A 4ASWC 2LI5A 2L8JA 1XD3B 1JIHA 2MBOA 2BCSA 3WANA 1E7PB 3OJ4B 4EBCA 3LDAA 1NBFC 1EUVB 1TFRA 2DPIA 1RDFA 8ICTA 3TSSA 5DLFA 1XSLA 3IN5A 2RDJA 2IHMA 2IBKA 3H7PA 4WWOA 1KFSA 4J9QA 3UQ2A 7ICEA 2MBEA 3G6XA 3NGDA 1IGCA 5KFMA 1WM2A 5H2FU 1N60A 3AECB 3MTNB 3NUHB 3GP7A 1PVPA 1FFUA 1KSPA 1C4CA 1RAXA 2G4SA 1UA1A 4UB1A 1RZTA 4ACOA 3AEBB 2FMSA 3H7PB 4URKA 5F3XB 1C4AA 2DYBA 4JV2A 5K4LA 4Z6CA 3H0LB 2BDUA 4JMUA 4NZLB 2HHTA 2FLNA 1TBEA 1JQ4A 5ALEA 4FHKA 4R65A 1E10A 3QARA 3WAMA 4CF4A 2EQYA 1QSSA 3CMMB 4F5RA 2UVRA 2QSDA 4HCPB 4QW8A 4DSLA 1LVHA 5C0YA 1Z1VA 4BAXA 2XY6A 3EPGA 4R3DA 3H40A 2W03A 3EZ5A 4Z6EA 5L1KA 3VR9B 3T5LA 5EE9A 4DWFA 1BPXA 3MC1A 4F5QA 2H5XA 5J0TA 3LB8C 4HWIB 2KIVA 1CEZA 3DVGY 3Q8KA 8ICZA 1TT5B 2KVZA 2D5GA 3R2IA 4IWQA 2LGDA 3EECA 5J0QA 2K4EA 2BCRA 5E79U 2FPKA 4M6WA 3DOWA 3ZD8A 1JMLA 4IM2A 4W9CA 2BS4B 4QWBA 9ICXA 1FEHA 2Z0EB 1KFYB 3QU4A 2K60A 2WF6A 4Q8FA 3BVMA 2RHFA 4C7YA 3CSFA 3NS8A 4MGKE 1RFKA 2INDC 3BWUD 2W3RA 3TJPA 2BS3B 1V5TA 1N5WA 2RDIA 2KHVA 3C19A 1P0RA 1XSNA 9ICEA 4KTQA 3C1YA 1SGHA 1K1QA 4WAAA 1X1MA 3VXWA 4ANVA 4W9DA 5KFUA 4QZ9A 2LZ6A 4LJPB 4CE6A 5KNIA 2FCSA 4NLGA 2I9GA 3CF6E 2AGQA 3UF8A 2MH7A 4AYBC 3BVGA 1MVKA 3VFKA 3F5EA 3HVZA 3ED5A 2MX2A 5BMHA 3MABA 2BQUA 2YEPB 3PR5B 2C22A 5LXHA 4ZRPA 1UNSA 1UF0A 2JH1A 4F5NA 8ICHA 1WM3A 2ZIXB 8ICYA 3W5UB 3PREA 3MR2A 2KFJA 2ACZB 4FXCA 1KFDA 2W54A 4GXKA 1PVQA 4DLEA 2K22A 2R2OA 2R61A 2D8CA 1BT0A 3EW9A 3MDAA 2HDEA 1C79A 4CHKA 3QHTA 4ED3A 4W9EA 2BT6A 1LM8B 2KVCA 4BKTA 2HVHA 2QLTA 3B0XA 3UINB 4J9PA 3PHWB 2KQSA 1NK9A 5LXIB 1XO3A 2IO0B 1ISNA 1R4MI 1Q3UA 1YJJA 1JWUD 4HEA1 3DBHB 3P4PB 1MJDA 4GFJA 1IIPA 2R8GA 2KKCA 2IGDA 1T5XD 1GG3A 2L83A 2HOQA 2GBMA 4W9LA 1CZPA 2PW9A 3HRDD 2E6XA 2WDRB 3NS1A 1U4AA 2WXKA 2HBMA 4F2SA 1V1OA 4BWMA 5AKLA 8ICBA 2ZCCA 2H3VA 4J9RA 5DB6A 4EZLA 3DBLB 4RPZA 1X9MA 2W3SA 5E6OA 5HG2A 3VAWA 1S76D 3K9OB 2DLBA 2QJLA 2WTFA 4M8NA 1WXMA 1VZ7A 4FULA 1WYGA 3RB6A 2O6VD 4RT2A 1TY0A 4K7SA 2B6GA 1GC6A 3ZJTA 5TZVA 2RGFA 2AGPA 3DBHI 2J42A 3KQ4A 1ZXIA 2KFKB 3H8HA 1UA0A 3OJ3A 3FILA 3H4DA 4KSLC 4W9FA 1LQBA 3TAPA 3C2MA 1FNUA 4YP3A 1EO6A 3TACB 1BXTA 3ZO5B 1XLNA 1PK3A 1DK3A 4DXFA 5AEKB 2BBCA 4N9F4 1VR9A 4REZA 2CU1A 1SE2A 2EH9A 2YTUA 3SENA 4NL9A 1V6EA 5DG9A 1U49A 1QOFA 2JWUA 2D11A 1HEKA 1R4NI 3BY4B 5AIAA 4NY8A 5IN7A 1URJA 1DYQA 5J0PA 2L32A 3J9CA 3RR7A 4IG7B 2Y0SF 4EEYA 1TS5A 2F2AB 4KIKA 2G06A 1ZRMA 2ISOA 3N1ZC 4E0DA 2ZTEA 1NEKB 3TAQA 1KN5A 2W9MA 1XCTL 1C78A 3EPIA 4ECZA 5DB8A 4Y2YA 2FPMA 4RGOS 2FIDA 3X23A 4MM3A 3SAGA 4I2FA 2R8JA 9ICVA 3QX7A 1NJZA 4M8MA 3N20C 1XSPA 2HHVA 1P98A 2KT7A 2XY5A 2QARA 3OPXA 4EBEA 4BXOA 3QNMA 1WJNA 5FK9C 4IRCA 1Q46A 4DSEA 2HE7A 2IGGA 1NI3A 4P0QA 4ARCA 2UVUA 2JXJA 3MGHA 1V9JA 3QAQA 5TR5A 2ES6A 3TEZA 1JN3A 2QMTA 2HTHA 1TE2A 4BZAA 2XICA 5JZEB 2JF5A 2M17A 3C8YA 3GOEA 3PGEA 2DZIA 2HMXA 4DXAB 2Y1JA 3ZNHB 2V3PA 4ED6A 1Q1OA 2K1FA 1RM6C 3VTWA 3HP6A 1COKA 2A19A 4MSQB 2QCZA 2DAJA 2EELA 1E8WA 4UB5A 4F5OA 1E7VA 2HBJA 1L5UA 1GUAB 1K50A 3SMVA 5BYQA 4OJPA 2PMVA 1F2RI 2N7EA 4RQ8A 2GBNA 1VJKA 2KFKA 2MW5A 1C76A 9ICAA 4KDLB 4M02A 2ODGA 2K6DB 4YQWA 4OVZA 2C5LC 2WXQA 1KFTA 2B21A 3PTFC 3MJWA 1I42A 3TIXA 1VCBA 2D3AA 1BVSA 1DGSA 1L8LA 4LJXA 3TI0A 2R8KA 3I1YA 5J2IA 3WKAA 3B08A 3ORYA 3NZ3A 4IM3A 1WG8A 3RB0A 4JWUC 4F93B 1T0SC 1I4RA 2EANA 4J9OA 1F77A 4II2B 4QZDA 4Q43A 3ZKJC 4KMOB 3FM9A 2WF5A 3QEBZ 5ALZA 2J6TA 1GPXA 3RZWC 1Q10A 1ZP0B 4RFBA 5DQGA 1HZ6A 4KLDA 3NASA 1BGXT 1ZQWA 1QF6A 2C2EA 2GI9A 2W82A 2LD9A 2VZKD 1CJEA 1NJYA 2R8IA 4XA5A 1JX4A 1LB2B 4A8EA 5KG4A 1FRRA 3BVZA 4WWMA 5EE1A 4J3OD 5GTHU 3AE7B 4LLGM 4M0AA 1QQRA 4HLEA 1ZQHA 5AKEA 5DPTA 4K7UA 3QJZA 4KSKC 5J2EA 3FKYA 1ZQGA 5ALKA 1TKYA 1WE7A 2LFIA 3KLSX 5AI5A 5AM0A 4M04A 2PEAA 3EA6A 4KKIA 3EHVA 2J7QB 4M9JA 2AEHA 2WQYB 4YMMA 1YN5A 3WK7A 1NK4A 5KG6A 4WJPA 3UIPB 4QAYA 3TQ1A 4BBNF 2KVRA 2KDFB 4F7ZA 4NJ8A 2XEWA 2REXA 3GZFA 3BS7A 1WWUA 2VH2A 1CQVA 4CRXA 1HZ5A 2Z0DB 3EUB2 4DS5A 2PE9A 2K4PA 1HE8A 2KJ5A 4TMAB 4YN4A 4P6VF 1B0XA 2VA8A 2WXGA 3MC0B 3MFGA 3U52E 4XUSA 4FZNA 3ECIA 1ZQTA 1WGGA 4Q44A 1MPEA 1R4NB 2XGQA 4QZCA 5DKWA 5KFIA 5G2NA 4KZ0A 2IMWP 2GOWA 4ZRQA 3L16A 4RF0A 3DDCB 1WF9A 4UB3A 2LJIA 1P9DU 1WWTA 2NRZA 1V2YA 1SXDA 3V6JA 3E9SA 4NAWB 4XZ4A 1E90A 1IP9A 3H4BA 1XC9A 8ICXA 1F0MA 4ED1A 1WGKA 1DOIA 1WUDA 3OSNA 3NVVA 2PFPA 1KW4A 2A1JA 3ONSA 4HRSA 5AK6A 3KBBA 2F8KA 5TSSA 4OD0A 1WGHA 2L0TA 2WXRA 3DWMA 3LVVA 3RF9A 3NRZA 2KWVB 1ZD5A 3D2SA 2C2RA 2I2YA 3H7IA 2HOIA 4C8NA 3PPAA 3JPPA 2WDVB 1HUOA 3APCA 3V6KA 2RPQA 2PIAA 5IIOA 4ZRKA 4I2IA 3PVXA 3ZJVA 4UQGA 2ATLA 4DL3A 1L7OA 4YVZA 4O3PA 3WK5A 2L00B 3DV9A 2FDRA 2M9NA 1H38A 3U26A 2ZJ8A 4B9NA 5KFDA 1WXAA 2WNMA 4IOIE 1S5LU 5HI1A 2LRUA 2KJ6A 4MDKE 1R7SA 2G5HB 4OJ6A 2DYMA 2Y1IA 3RJGA 2M56B 1HXYD 3Q8AA 2W11A 4B0EA 2ZPNA 2NRXA 4G9BA 2K8CA 4CF3A 3PSPA 2LRWA 3V05A 4NWIA 3W1SA 4BFRA 3MBYA 1MFWA 4ZHOA 4IUMB 3M63B 2H3IA 4KITB 5B5EU 3KH0A 4ED8A 2KFNA 2LEKA 2JZBB 2DZKA 3AQFA 1NK8A 2D3BA 3A4RA 3N28A 3OG5A 1HA5A 1M4VA 5AI8A 2Y5PA 2KZZA 4EELA 1L6UA 2K8HA 4KV2A 3I28A 3TKAA 5HHDG 3N30A 4FZMA 1SEBD 2YQEA 1Z5SB 1TAUA 2CJOA 1C7YA 2ICIA 1MI0A 3GZNB 2VJ4A 2KZRA 4MT5A 2I1QA 5C1ZA 4BKSA 3E58A 4KZCA 5J2KA 2R18A 4FO6A 4P0QB 2PVOD 3HIZA 4DHJD 8ICUA 2HHXA 3Q8SB 1FD6A 3C28A 2D3DA 5CRXA 1X9SA 9ICCA 5AKKA 4ZDVA 4PT5A 2VIXA 3AV8A 1SL0A 2HBLA 2CS4A 3MP9A 2FAZA 3K1RB 3AU2A 2G0AA 4JL9A 2LM1A 4Y2VA 1X2IA 2ZZPB 4MGYE 2LYBA 4ACFA 4DSJA 2Y3AA 3IG8A 2OM6A 3RCZA 2IY1B 3CW2C 4F8RA 4M0WA 3WK8A 3MFHA 3RZFA 2C60A 2PE6B 4L23A 3Q2AC 5KFWA 1E8XA 1SJED 4DSIA 3SYZA 2K8BB 3N7RC 4MFFA 3KHHA 3BQ7A 1N2XA 2R8HA 4LVSA 3QC8B 5CJ7A 3SI8A 3ZIMA 3HPOA 2HHUA 4DQRA 4C4RA 3M62B 4ECTA 4QZAA
chains in the Genus database with same CATH topology
3B2FA 4XWWA 1J7CA 2INPE 4US8A 1D5MC 1E7PB 2NMQA 4HKZE 2WXPA 1AYFA 3TSSA 3ZJUA 3SFDB 5D3DA 1IUEA 1YMHE 2V0GA 2WXIA 1TS3A 4RGTA 1IGCA 1D5ZC 1N60A 3AECB 1N5XA 1VRAB 3NUHB 3GP7A 1FFUA 1FIQA 1C4CA 1ZDVA 1JWAD 1I7HA 2KMMA 4ARIA 3U4EG 3AEBB 2JYEA 1C4AA 3V3XA 3I9V1 1N61A 4NZLB 3VRAB 1JQ4A 3AE3B 1VZ6A 2IPKD 1NYRA 3PZ8A 1E10A 2KN4A 4YSZB 1XLQA 2J4XA 2QSDA 2EKIA 3GB1A 4UDUC 1FRDA 5I4DA 1FXIA 3AN1A 1CK1A 5C2TB 2WXOA 4R3DA 3AE5B 2WU5B 3VR9B 1NENB 3AE1B 5EE9A 1SB3C 1L4DB 3LB8C 1XF5L 4RH6A 3B2GA 2D5GA 4RNAA 3R2IA 3VRBB 1PGAA 1JMLA 2BS4B 1FEHA 1KFYB 4DQOC 2NTSA 1JRPA 4MACA 3BVMA 4C7YA 1RFKA 1TYGB 2WXHA 3P42A 3BWUD 2W3RA 4TSSA 2GRIA 1GOZA 2BS3B 1N5WA 5BMGA 2WU2B 3T3OA 4TQ0A 2WXFA 4KGTA 1ROEA 3ETRA 4KGSA 2MJDA 1IGDA 1FMAD 3AE8B 2MH7A 4YTPB 1WRIA 3BVGA 1MVKA 1TS4A 4CQNA 1HEZE 3ZQ4A 4N59A 4AS1A 3HVZA 3Q8EA 5BMHA 4A55A 4RCOA 2YEPB 4L1BA 2K3UA 1OQRA 2PTLA 4YSYB 1UNSA 1F0ZA 4XDCA 4C56C 2MJ3A 2WXMA 3ABVB 3W5UB 2V4IB 3WCQA 3KWVA 4WH4A 1TKGA 2ACZB 4FXCA 1V97A 5MPOA 2CJNA 2W54A 1FNVA 2H89B 3AE9B 2K22A 2R61A 2AQ3B 2HDEA 1C79A 2N7JA 4TQ1A 1AW7A 1WSPA 1V1PA 2BT6A 5D7GA 3AH7A 1SIJA 1XO3A 2IDYA 1UWXA 3AE4B 4RGNA 2BYTA 1YJJA 2L52A 1FCCC 2DYOA 1JWUD 5EE3A 4L2YA 3AMZA 2ZW0A 4HEA1 4OHJA 3P4PB 4XWTA 1ZUD2 4US9A 1T5XD 2IGDA 2DWQA 5T8IA 1ZXHA 2L83A 2LMCA 1QOGA 2RDHA 5BMIA 1CZPA 2PW9A 1XXGA 3HRDD 4ZOHC 1NYQA 2E6XA 2H88B 2WDRB 3NS1A 2ON8A 1RYJA 2L1AA 3IT6B 5GXGB 1ZPSA 2WXKA 1BUIC 4LTUA 1UGJA 2INNE 4RGMA 1V1OA 3AEDB 3I57A 2WXNA 4A9AA 1ET9A 3TEYA 4WQMA 1TY2A 1TZOA 2W3SA 5HG2A 2DLBA 2QJLA 4A8XC 3P4RB 1VZ7A 2N0SB 1GB1A 1XLPA 3PZ7A 1YN4A 5EE0A 1WYGA 1TJEA 1TY0A 3FAHA 1ACCA 3ZJTA 1B1ZA 2QEJC 2WS3B 3P63A 5H8YE 1P7FA 2RPVA 2J42A 2QIEB 3AE2B 3KQ4A 1ZXIA 3AB5A 4Q2JA 3H8HA 1V8CA 1KF6B 1L0XB 1YNTE 4GDLB 1L0VB 3FILA 1T6BX 5BYSA 2QILA 2G1EA 2IJ0A 4WURA 2G9HD 1RWSA 2BB5A 1GAQB 1PGBA 1FNUA 1BXTA 4N58A 1XLNA 4DXFA 2BBCA 2FE8A 1VR9A 3Q8FA 4REZA 1L0YB 4C80A 1SE2A 3AEFB 1K51A 3GS2A 1QOFA 1SE3A 2JWUA 2PKOA 3UI3A 1I4QA 2BTEA 2K5PA 2B76B 3U2SC 1DYQA 2L32A 4JWSC 3SFEB 3J9CA 2OHFA 1QT9A 2J53A 1TS5A 4KGRA 3B9JA 4DXGA 3N9YC 4B0MA 2SAKA 1NEKB 1YQ3B 1JROA 1SF0A 2KDMA 4EE2A 1XCTL 1YJIA 1C78A 2MEKA 4YTMB 1F2RC 4RGOS 3ZGZA 2JYTA 3Q69A 3BYTB 4USAA 1K53A 1QLBB 1JWSD 5AUIA 4YSXB 3IAS1 4MM3B 2FBWB 3BK1A 4NAMA 1EU3A 5FK9C 4HJGE 2IGGA 4P16A 1NI3A 4ARCA 2WLBA 4GLSC 3TEZA 2QMTA 3BYYB 2WP9B 2JQRB 3CIRB 3C8YA 1I4HA 1STEA 2KAJA 1C77A 2V3PA 2JZPA 1RM6C 1TS2A 3R2TA 2Q5WD 2WXJA 2EELA 4ZRPA 1K50A 5BYQA 1I4PA 2PMVA 1F2RI 2XNAC 4OZBA 3FILB 2K9XA 1FCLA 4WIPA 1GB4A 1KH0A 2BS2B 2PVGC 1JWMD 1VJKA 1C76A 3AEGB 4OVZA 1DOYA 2WXQA 4OZCA 5HFYA 2M19A 3KWLA 2LHEA 2X38A 2ZW1A 1DGJA 1LO5D 3W5VB 3NZ3A 1NVID 4JWUC 2WXLA 1E6EB 3HUIA 1I4RA 2LHDA 1F77A 3BZDB 3Q8BA 1QKZA 5D3IB 1YQ4B 1FO4A 1ZE3D 1GPXA 2KWDA 5LNK1 1Q10A 1ZP0B 4RFBA 2AX5A 2AQ2B 4GDKB 1HZ6A 1SBBB 2RMMA 2K0PA 3LYYA 2MJEA 1QF6A 4OW0A 1K52A 2GI9A 2W82A 4IKGA 2AQ1B 1UUPA 2VZKD 2I38A 3BK2A 1CJEA 3MHZA 4ZYSA 4XE0A 2N9KA 3SR6A 1FRRA 3BVZA 3TEWA 1SXTA 4WWMA 2IGHA 5EE1A 1KLUD 1VDVA 4J3OD 1VZ8A 3AE7B 4LLGM 1QQRA 1P7EA 1SE4A 1I4XA 1FM0D 1XCQL 1ZDXA 1XLOA 3P4QB 3T3NA 2W55A 4YWGG 4HROA 1PUTA 1TKYA 5AUKA 1V1PB 2XN9C 2LFIA 1EWYC 4JPSA 1HQRD 3KLSX 2JX5A 4D2KA 3EA6A 4KKIA 2WQYB 1PDXA 1YN5A 2PLPA 1D6EC 1PGXA 5FR3A 4XDDA 4A90A 3VQIA 3O13A 1BMLC 1AN8A 1CQVA 1HZ5A 3EUB2 3OWEB 3TEXA 1ET6A 3W2DA 4TMAB 4P6VF 1N62A 3TUOA 1JWBD 1FNWA 1FXAA 2WXGA 3MC0B 3MFGA 3U52E 3P4SB 1E9MA 1MPEA 2YEPF 3AE6B 3URYA 4AQ7A 4ZRQA 1JCKB 2RDGA 4RF0A 5G5HA 3EGRA 2LJIA 3W9CB 4ZHPA 1WWTA 1A70A 2DBYA 1YN3A 4MH8A 4NAWB 3E9SA 2J52A 4NJCA 1WGKA 3IT4B 1DOIA 1OQQA 1TKEA 3NVVA 4HRSA 1T3QA 5TSSA 2Z8LA 2WDQB 2WXRA 5JXVA 3DWMA 3L4PA 3PO0A 3NRZA 2I2YA 2TSSA 3BIID 4N6EB 1I4GA 1OFFA 2E3TA 1XEEA 3Q8CA 2WDVB 3IAM1 4OZAA 3SEBA 2CU3A 1VLBA 3ZJVA 1EU4A 3AEAB 1FFVA 2PIAA 1JALA 1SSNA 2V3NA 1D4BA 1WXQA 1C4PA 4IOIE 2SEBD 2WNMA 3RFZB 1DOXA 5HI1A 1EM7A 1R7SA 2DYMA 2M56B 1L5PA 1HXYD 3AEEB 3Q8AA 3FC4A 3ZYYX 2GB1A 4B0EA 1KLGD 2HTME 3NVZA 3V05A 2NTTA 1AWDA 1L4ZB 2LUMA 3W1SA 4ZHOA 3CWIA 3R8BA 4C7ZA 3NVYA 2LEKA 4KX6B 1J7AA 4YTNB 1MHXA 4O1NA 4RF1A 1HA5A 1M4VA 1D5XC 2OEDA 2Y5PA 4ITKA 1L6UA 1C9FA 1ZOYB 4WAFA 5HHDG 2ONQA 1SEBD 2M0AA 5C3JB 1QOBA 2VZKB 2CJOA 2ICIA 5G5GA 2LGIA 1MI0A 1Y56A 3HVDA 4IDIA 1PYWD 4MT5A 3MJ5A 1N63A 1KRHA 5FKAC 3U7ZA 2PVOD 1JW9D 1SJHD 4LK0M 3P1MA 1FD6A 2BB6A 4YXDB 3IXSA 4H2AA 2FUG1 3AM9A 2KACA 3VR8B 4PT5A 3AV8A 3MP9A 1IBXA 1EWCA 2N9LA 1E0ZA 3LXFA 3RPFC 1PFDA 5BYRA 1L6VA 1QOAA 2JU6X 4JE3B 2JSVX 1J7BA 2Y3AA 3E56A 1QILA 4M0WA 4HKQA 1ENFA 5E6JA 2KQ4X 2Y5CA 4YT0B 4JX1C 2JXTA 4L23A 3NVWA 1ESFA 1IBXB 1B9RA 1SJED 1MHHE 1UWMA 5H92C 3DWGC 4A6QA 2BW2A 1KTKA 4KKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WCQ A;  3B2F A;  1TKG A;  2ACZ B;  4FXC A;  1NI3 A;  2WLB A;  1V97 A;  5G5H A;  5MPO A;  3W9C B;  2CJN A;  2W54 A;  4ZHP A;  1WWT A;  2H89 B;  1J7C A;  1A70 A;  2K22 A;  2DBY A;  3AE9 B;  2WP9 B;  4US8 A;  2JQR B;  1E7P B;  3CIR B;  2BT6 A;  1WGK A;  1AYF A;  1DOI A;  1OQQ A;  3AH7 A;  1TKE A;  1SIJ A;  3NVV A;  2KAJ A;  4HRS A;  1T3Q A;  3SFD B;  2WDQ B;  1IUE A;  1XO3 A;  3DWM A;  3L4P A;  1RM6 C;  3NRZ A;  3AE4 B;  3PO0 A;  3BII D;  2Q5W D;  4N6E B;  1N60 A;  1OFF A;  2E3T A;  1YJJ A;  2L52 A;  1N5X A;  2WDV B;  3AEC B;  5EE3 A;  1FFU A;  3AMZ A;  1FIQ A;  2CU3 A;  1VLB A;  1JWA D;  3P4P B;  3AEA B;  1FFV A;  1ZUD 2;  1JAL A;  2K9X A;  2PIA A;  4US9 A;  1I7H A;  2BS2 B;  1WXQ A;  2KMM A;  1VJK A;  2DWQ A;  2PVG C;  1DOX A;  2L83 A;  3AEB B;  3AEG B;  1QOG A;  1CZP A;  3HRD D;  4ZOH C;  1NYQ A;  1DOY A;  2WDR B;  2H88 B;  3NS1 A;  1R7S A;  1RYJ A;  5GXG B;  2M56 B;  1N61 A;  4LTU A;  1L5P A;  3VRA B;  3AEE B;  1JQ4 A;  3FC4 A;  3AE3 B;  3ZYY X;  1NYR A;  2M19 A;  3AED B;  3KWL A;  1DGJ A;  1E10 A;  4A9A A;  4WQM A;  2HTM E;  3NVZ A;  3W5V B;  4YSZ B;  1XLQ A;  1AWD A;  1NVI D;  2W3S A;  4ZHO A;  3CWI A;  4JWU C;  2QJL A;  1E6E B;  2EKI A;  4C7Z A;  3HUI A;  3NVY A;  2LEK A;  3P4R B;  4KX6 B;  2N0S B;  1J7A A;  1FRD A;  4YTN B;  1FXI A;  1XLP A;  3AN1 A;  5EE0 A;  5C2T B;  1WYG A;  1TJE A;  1YQ4 B;  3AE5 B;  1FO4 A;  2WU5 B;  3VR9 B;  1NEN B;  3AE1 B;  1GPX A;  3FAH A;  5EE9 A;  1SB3 C;  2WS3 B;  4ITK A;  1L6U A;  1ZP0 B;  3LB8 C;  3P63 A;  2AX5 A;  5H8Y E;  2QIE B;  1ZOY B;  3AE2 B;  1ZXI A;  3AB5 A;  5C3J B;  1QOB A;  1V8C A;  1KF6 B;  2CJO A;  5G5G A;  2MJE A;  1L0V B;  3B2G A;  1QF6 A;  4IDI A;  2G1E A;  3VRB B;  1RWS A;  1CJE A;  1GAQ B;  2BS4 B;  1N63 A;  4N58 A;  1XLN A;  1KRH A;  3SR6 A;  1FRR A;  1KFY B;  2PVO D;  1JW9 D;  4WWM A;  5EE1 A;  1VDV A;  1JRP A;  4C80 A;  4C7Y A;  3AE7 B;  3P1M A;  3AEF B;  1RFK A;  1FM0 D;  1TYG B;  2W3R A;  4YXD B;  1XLO A;  1QOF A;  2PKO A;  2BS3 B;  3P4Q B;  2W55 A;  2K5P A;  3AM9 A;  1N5W A;  1PUT A;  1TKY A;  2B76 B;  2WU2 B;  4HRO A;  1EWY C;  3AV8 A;  5AUK A;  3VR8 B;  2JX5 A;  4JWS C;  3SFE B;  2OHF A;  1QT9 A;  2WQY B;  1E0Z A;  1PDX A;  3LXF A;  3RPF C;  1PFD A;  1ROE A;  1L6V A;  3B9J A;  3ETR A;  1QOA A;  2MJD A;  1FMA D;  1J7B A;  3AE8 B;  2MH7 A;  1NEK B;  1JRO A;  1SF0 A;  1WRI A;  1YQ3 B;  4YTP B;  1YJI A;  3EUB 2;  2Y5C A;  4YT0 B;  4YTM B;  4JX1 C;  3NVW A;  4N59 A;  4P6V F;  1B9R A;  3HVZ A;  1N62 A;  1UWM A;  1JWB D;  4USA A;  1FXA A;  1QLB B;  5H92 C;  3P4S B;  1OQR A;  4YSY B;  5AUI A;  1E9M A;  1F0Z A;  3DWG C;  4YSX B;  2MJ3 A;  2FBW B;  3AE6 B;  3ABV B;  3W5U B; 
#chains in the Genus database with same CATH topology
 4M0W B;  2LMR A;  1RQL A;  1K1S A;  3SU8 X;  4I2H A;  4DEZ A;  2INP E;  2JMG A;  2MRL A;  3CP8 A;  2M1M A;  5KTQ A;  4RQ5 A;  4C4V A;  4F50 A;  4F5P A;  3AI5 A;  2I6X A;  4F8C B;  3NUQ A;  2FE9 A;  2QB0 B;  2WXI A;  2XCP A;  5KT6 A;  1D9D A;  1RRB A;  3V6C B;  1D5Z C;  2RLT A;  1K8R B;  2I1J A;  1N5X A;  1VRA B;  2L76 A;  3JYU A;  1RYU A;  1ZDV A;  4MJS A;  3O0F A;  1K5O A;  4S0R A;  4K3C A;  1I7H A;  5ALY A;  2KMM A;  1KJT A;  2ZNV C;  5DG7 A;  5KFT A;  3U4E G;  3IM1 A;  2BDP A;  2JYE A;  1LKY B;  4ECU A;  5KFA A;  4KLT A;  3RRH A;  1IG6 A;  2JRH A;  4CGZ A;  3H0M B;  1ZQB A;  3K4G A;  1VZ6 A;  2IPK D;  1NYR A;  1U45 A;  4EZ6 A;  3PZ8 A;  2KN4 A;  4YSZ B;  4JV1 A;  1WFY A;  8ICA A;  2KLG A;  3PT2 B;  3PMN A;  4LNO A;  3NY5 A;  3G6Y A;  4PHP A;  2VKQ A;  3GB1 A;  3C1Z A;  4GGQ A;  4WJN A;  1FXI A;  5HML A;  1FXT B;  3PVL A;  5HHI A;  1GO3 F;  3AE5 B;  4O5C A;  2KO3 A;  1NJW A;  4XQ8 A;  4Y2P A;  3IG5 A;  1GJZ A;  2O2V A;  7ICM A;  3Q3N C;  3UGB B;  4Y2X A;  5DBC A;  1DOQ A;  4J9S A;  1YD8 U;  2HBK A;  4RH6 A;  3PRM B;  4OJ5 A;  4K4I A;  3NJT A;  5KFY A;  4RNA A;  3F2B A;  1CMX B;  2KOB A;  1PGA A;  2BWF A;  4KX5 A;  2KJR A;  5DPS A;  3KUZ A;  5EWF A;  2JEG A;  4DQO C;  2WF7 A;  5J0R A;  4KLH A;  2MHJ A;  4DQQ A;  3BQ1 A;  1TYG B;  4QWC A;  1SL1 A;  1A0P A;  1NK5 A;  1L8O A;  2L0F A;  3RBD A;  9ICM A;  3A9J B;  3WKB A;  2A5U A;  2WU2 B;  1WXV A;  3I3T B;  7ICL A;  5DCN A;  1LV5 A;  3R66 C;  2JR5 A;  2G5I B;  2WXF A;  3RAQ A;  2KKV A;  2WFA A;  2QKQ A;  3RAX A;  1S97 A;  1TK5 A;  1ROE A;  2DEN B;  1E7U A;  5J17 A;  5J0W A;  1WMH B;  1WRI A;  1TS4 A;  2W9C A;  3L3F X;  4NLC A;  1HEZ E;  2VH1 A;  4IWP A;  3ZQ4 A;  7ICP A;  4N59 A;  5KFZ A;  4WJO A;  3Q8E A;  5KT2 A;  5CA7 A;  4RCO A;  3GIK A;  4GXJ A;  4FN2 A;  3TAD A;  2PTL A;  2N4F A;  3JW0 X;  4C56 C;  2MJ3 A;  5FP0 A;  3RNC C;  4OO1 J;  3KWV A;  3WCQ A;  1YT3 A;  4O3O A;  1WMH A;  4LJO B;  1LFD A;  4LNK A;  3BQT A;  1TIF A;  1F52 A;  4EEN A;  3C0R B;  2H89 B;  4KLI A;  3F53 A;  9ICR A;  3TFR A;  1ZQF A;  2J0K A;  4UAW A;  2KC1 A;  1IV8 A;  1WJU A;  3DPD A;  3HM3 A;  1A77 A;  3KZX A;  2IA6 A;  3PSE B;  1RXW A;  3DVN U;  2KTF A;  3IDW A;  4K4G A;  2KHW B;  1YX6 B;  4Y2S A;  4F91 B;  1WRD B;  4QIW F;  4DDG D;  1ZQA A;  1FCC C;  5AZH A;  4E74 A;  9ICS A;  2ZW0 A;  3E0F A;  4XWT A;  5KG0 A;  3QE9 Y;  2EZY A;  3RRG A;  4Y2T A;  3K1Z A;  5AKJ A;  2IBI B;  7ICJ A;  1NI2 A;  4NLB A;  2ASL A;  2RDH A;  3V62 A;  5BMI A;  8ICG A;  2JY6 A;  8ICI A;  4ZOH C;  3JPS A;  2F1H A;  1OEY A;  2A1J B;  4OVV A;  1WZ3 A;  3IT6 B;  3TAR A;  2O2V B;  1ZPS A;  4LDT D;  5HNK A;  1BUI C;  5L83 A;  1S10 A;  4AP9 A;  8ICO A;  4NAW A;  4ECR A;  3QZ7 A;  2C28 A;  1JXE A;  4I28 A;  1ET9 A;  4WQM A;  5ALQ A;  2AQ4 A;  3TEY A;  1TTN A;  2WF8 A;  4K81 A;  4B9U A;  3GZN I;  4E71 A;  5IIN A;  3MR3 A;  5JTI A;  3L5K A;  2INC C;  4F71 A;  3ML9 A;  1RFA A;  1Z3E B;  1L3S A;  1BNP A;  3KTQ A;  1NKC A;  4BWJ A;  2A3V A;  4RQN A;  3FAH A;  3DVG X;  4MH0 E;  4ANW A;  7ICG A;  1ZD2 P;  3P63 A;  5LLI A;  5III A;  1P7F A;  4MEM A;  4I2D A;  4M47 A;  2QIE B;  2K8B A;  4B9T A;  1V8C A;  4RQ6 A;  1YNT E;  2BPC A;  1T6B X;  5BYS A;  3QCA A;  2ZJA A;  4B9L A;  2BB5 A;  3T79 A;  4GC7 A;  1PGB A;  2J0J A;  2MLB A;  2V4L A;  1NNL A;  1KLN A;  4DL4 A;  3RJJ A;  2K8C B;  2HHQ A;  3NTU A;  3UI3 A;  2CXY A;  2NO4 A;  3WAP A;  1I4Q A;  5ALI A;  4MGI E;  1ZQZ A;  3HW8 A;  4K4H A;  7ICR A;  4JWS C;  3SFE B;  1QT9 A;  3MFI A;  3A1Q B;  2J53 A;  3PZP A;  2KKP A;  4KGR A;  1WX7 A;  3PLU A;  2UU7 A;  2OJW A;  1SKR A;  5KFP A;  4TUP A;  3X0W A;  4UAZ A;  4GB9 A;  2DUY A;  1JRO A;  1YQ3 B;  3HHM A;  4EZJ A;  3DEE A;  3ZDM C;  2JVC A;  2MEK A;  4AYB F;  2FCQ A;  2A4Z A;  5AKY A;  3ZGZ A;  3U30 A;  3ZNZ B;  2K39 A;  1WR1 A;  2LI6 A;  4OJL A;  1VJ5 A;  4M9H A;  3TFS A;  3MHS D;  1ZQU A;  5AUI A;  3QK0 A;  3WA0 A;  3IAS 1;  3SV3 A;  3BK1 A;  4NAM A;  1EU3 A;  4KLU A;  2K8A A;  3ZDA A;  2BKR B;  2NRV A;  4GLS C;  3ZTC A;  2ZXH A;  5KAI U;  3BYY B;  4W9H A;  5EWG A;  3K75 D;  2JEI A;  3CIR B;  4BKS D;  2BCV A;  1PQS A;  1QLN A;  1STE A;  1P1A A;  2WX0 A;  2G08 A;  3AUL A;  4PS3 A;  2FMP A;  4RNM A;  2BHN A;  5ALO A;  1KKX A;  2KLC A;  2LWP A;  1C20 A;  2W8L A;  1ZQN A;  2Q5W D;  1RQN A;  2CHZ A;  1U47 A;  2ZIV B;  5ALH A;  4FJY A;  1WGD A;  4DSK A;  2WYQ A;  3ISD A;  3AU4 A;  4ZYN A;  2DL0 A;  4OZB A;  2BZF A;  3ZW3 A;  4C4T A;  4YMN A;  2K9X A;  3FIL B;  1UHU A;  2KN5 A;  4LCD E;  1SL2 A;  3AEG B;  3ETL A;  1WCL A;  4TUS A;  4GOC A;  3PW7 A;  4FBJ B;  4P0P A;  1DOY A;  3L10 B;  2H3Z A;  2OCE A;  2D2Q A;  4OZC A;  1ZQX A;  2M19 A;  2FCN A;  1ZQR A;  3KWL A;  2ZW1 A;  1B43 A;  5ALJ A;  3W5V B;  3SD5 A;  4KLL A;  3PNC A;  4MJS B;  4PYU A;  2K4I A;  2HSZ A;  3ZRC A;  4UB4 A;  3KZI U;  3BZD B;  5IIK A;  4YMO A;  3KKA A;  3M9M B;  1ZE3 D;  4GDK A;  4MEX A;  1WWV A;  7ICI A;  3DHG C;  2PI5 A;  2KXJ A;  1PK1 B;  3MDC A;  3B0A A;  4QWA A;  2J6S A;  4Y2Q A;  2AQ2 B;  4FS2 A;  2CKH B;  4B9S A;  2LM4 A;  4IC7 B;  3OAW A;  3JVZ X;  1T4G A;  4MEY A;  2MJE A;  2V9H A;  2P6U A;  2JUO A;  4OW0 A;  1K52 A;  3KHR A;  5IA7 A;  2HJ8 A;  2FUH B;  5G55 A;  1NKB A;  1FEZ A;  4NM2 A;  4ZYS A;  5KFF A;  2W9B B;  3OTQ A;  4XE0 A;  3OJU A;  1RXV A;  3TEW A;  3EFC A;  3AQE A;  3QU5 A;  3H6N A;  1L7P A;  1FM0 D;  3UXP A;  1ZDX A;  3P4Q B;  5KAF U;  1S1Q B;  2W55 A;  1WJ6 A;  4GXI A;  4HRO A;  2MUT A;  5HMM A;  2ZIU B;  2E1F A;  4JPS A;  5HR6 A;  1HQR D;  2DNF A;  3M7D A;  4D2K A;  3D2N A;  4F72 A;  1ZQL A;  5AI4 A;  5J29 A;  1PGX A;  4KLJ A;  4NJ7 A;  4XDD A;  2EAO A;  1DRG A;  2F77 X;  4IC9 A;  2M0N A;  3QA8 A;  4K7W A;  3O13 A;  3MGI A;  1Q0W B;  2KK0 A;  4O3M A;  1AN8 A;  3L08 A;  1DK2 A;  4DOB A;  3OWE B;  5KFK A;  2AL6 A;  1ET6 A;  4DQI A;  1N62 A;  4PK1 A;  1MC8 A;  5DB9 A;  2OH2 A;  4NY0 A;  5DQH A;  2GO7 A;  3A0B U;  2BGF A;  2YEP F;  8ICV A;  2YVC A;  3SZ2 A;  3PV8 A;  1BPB A;  3RJH A;  2RDG A;  1HTQ A;  3HK0 A;  2BKF A;  3V72 A;  2JZ3 B;  2DBY A;  3M9N B;  4MH8 A;  5KFE A;  4XX5 A;  4ELU A;  2MCN B;  1V80 A;  3RBE A;  3UIO B;  1V86 A;  3PW5 A;  1RG6 A;  4A20 A;  4UAY A;  4DK5 A;  1T3Q A;  2WB1 F;  2YY6 A;  2LHT A;  4UAV A;  1WX8 A;  5JXV A;  4ANX A;  4E3C A;  2TSS A;  2KE7 A;  3Q8C A;  2E3T A;  4JGH B;  4OZA A;  3SEB A;  2GWS A;  3ZVV A;  2CU3 A;  1VLB A;  2NVU I;  5AM4 A;  2M8S A;  1T94 A;  3AEA B;  1D4B A;  2XI9 A;  3AXC A;  3UQB A;  4GU2 A;  3ALR A;  4ICA A;  3TBL D;  3RFZ B;  4XRH A;  4BJQ A;  2ESE A;  5AKG A;  3ZDB A;  2YB4 A;  1EM7 A;  1ZQJ A;  1L5P A;  2KAN A;  3AEE B;  1HJP A;  5ALW A;  2R2Q A;  2G4D B;  3GV7 B;  2FLL A;  1Z19 A;  2DPJ A;  1H4R A;  2LKY A;  2HTM E;  2LUM A;  1DXS A;  3ZRF A;  3QX1 A;  2O6V B;  4YFK A;  2VAN A;  3AU6 A;  4F4W A;  2BQ3 A;  2JGA A;  4KX6 B;  2CHW A;  4J9K A;  4YTN B;  3PX0 A;  1D9F A;  1MHX A;  4O1N A;  1Y8R C;  4I2G A;  4YR3 A;  1KM7 A;  5JU5 A;  5J2R A;  4J6I A;  4UBC A;  4JLC A;  1TZ1 A;  3VTU A;  4G3X B;  1ZOY B;  2NPT B;  4UW9 A;  2ZPY A;  3DCG A;  1ZW7 A;  3QUQ A;  5G5G A;  4LDT B;  1ZQM A;  1Y56 A;  3VUY A;  2AQ0 A;  4F4Z A;  2KG5 A;  4MF8 A;  2KV2 A;  1Z1B A;  3SQI A;  4O5E A;  3Q8Q B;  2JXX A;  2AXT U;  4PHE A;  2AGO A;  1L3V A;  3A4S C;  3IV6 A;  3L54 A;  3MJ5 A;  4G0N B;  3JPQ A;  3U7Z A;  3RB3 A;  1JW9 D;  3R7R A;  4C4S A;  3GU3 A;  4FFD A;  3DBS A;  4YXD B;  3VDZ A;  3V7L A;  1YQB A;  4R66 A;  4HPP A;  3AM9 A;  4EX6 A;  3VR8 B;  5B66 U;  5ALX A;  1EWC A;  3Q3J A;  2ZIW A;  2N9L A;  1E0Z A;  3V6H A;  4AJW A;  3RJF A;  5BYR A;  1L6V A;  4DL2 A;  1JUD A;  1X6I A;  3ISB A;  1NZB A;  2JU6 X;  4ICU A;  4JE3 B;  2NR2 A;  5IOI A;  2L5Y A;  5CHG A;  4DFP A;  2JEF A;  4RZR A;  3H1U A;  2LVO A;  5KL1 B;  1ENF A;  4HKQ A;  2KQ4 X;  2LVQ A;  3W1Y A;  2JXT A;  3QU9 A;  3RUI B;  1UWM A;  1MHH E;  2JRZ A;  2I5H A;  5J2J A;  3ZUN A;  3DWG C;  9ICW A;  2V1Y A;  3JPN A;  2FNJ B;  3KD3 A;  4MFA A;  2BW2 A;  5CB1 A;  3FYH A;  4FBT A;  1T0Q C;  2KDB A;  4QWE A;  3A33 B;  1L6N A;  3UMC A;  2BR0 A;  4JB3 A;  4NQK E;  4YR2 A;  1J7C A;  3BZC A;  4PS7 A;  3PSF A;  1JI7 A;  1TGZ B;  3A1Q A;  1D5M C;  2NMQ A;  4HKZ E;  4DHJ B;  4KMU A;  4A3P A;  5F9L A;  2IOF A;  1AYF A;  3DHI C;  3ZJU A;  2KJH B;  4ZRI A;  3ZDE A;  5D3D A;  4QZE A;  2W7P A;  3GV8 B;  1IUE A;  1XT9 B;  2V0G A;  1SWW A;  1TS3 A;  1UCV A;  4QZ8 A;  3BDP A;  5ALD A;  1XO1 A;  4MF2 A;  4I27 A;  5ALN A;  9ICB A;  1FIQ A;  9ICN A;  2O6V A;  1X40 A;  2QB1 A;  1WJ4 A;  2XBB C;  4ARI A;  1D8B A;  4YL8 A;  5D46 A;  3ZD9 A;  1OUQ A;  3V3X A;  4TUU A;  2ZG6 A;  4C8M A;  1N61 A;  3E2E A;  3AE3 B;  2AL3 A;  1SIF A;  5KFJ A;  1UGM A;  1SKW A;  1UPH A;  3VUW A;  2HHS A;  2J4X A;  8ICC A;  4LZG A;  5KFS A;  1WGY A;  2EKI A;  3M6K A;  3ZTD A;  4IQV A;  5AHX A;  5I4D A;  3AN1 A;  3A0H U;  4X57 B;  2WXO A;  1VD2 A;  4IS7 A;  2BKE A;  1TAM A;  3AE1 B;  4PGY A;  5ALP A;  2Y5B B;  4YD1 A;  5J2D A;  7ICK A;  5KFB A;  4FAD A;  2FPL A;  1L4D B;  1XF5 L;  1V81 A;  3RFA A;  4GMV A;  3PW2 A;  4O3R A;  1RYR A;  1WX9 A;  4OCZ A;  2WX1 A;  3HJE A;  1BPY A;  1C3T A;  1L7N A;  1X42 A;  2N1R A;  3U8Z A;  1TKD A;  2CR5 A;  4KLM A;  1ZRN A;  4NNJ B;  4I2C A;  4TUR A;  4B9K A;  4MAC A;  3UM9 A;  5EOZ A;  5AZG A;  8ICL A;  1CRX A;  3F2C A;  3NRW A;  4BX9 C;  4RNO A;  3P42 A;  1E8Z A;  3NG0 A;  4ELT A;  4TSS A;  3M8R A;  2YMP A;  5BMG A;  3T3O A;  1YZ7 A;  2B0C A;  2EKE C;  5HKH A;  4M2Y A;  2GLE A;  3ETR A;  5J0S A;  4KGS A;  4Q45 A;  2MJD A;  2ASJ A;  2CRX A;  1FMA D;  1IGD A;  4RMA A;  2W9B A;  1UZX B;  5KG7 A;  3AE8 B;  4W9J A;  4QWD A;  3N7S C;  4B9V A;  1L2N A;  4YTP B;  4G3I A;  2BGW A;  4CQN A;  3CYM A;  1COO A;  3VCB A;  3JSV A;  4CYE A;  4QNL A;  5L95 C;  4L1B A;  2K3U A;  3PST A;  2OJR A;  2ZIU A;  2OYY A;  1OQR A;  2KOX A;  3B1L X;  3I5J C;  2ZUC A;  4MEL A;  1QQ7 A;  2ZEQ A;  2AHO B;  3ABV B;  3PRP B;  1NK7 A;  3IBE A;  4XYC A;  3UMB A;  1TKG A;  4WH4 A;  3MGV A;  4O9M A;  1AQ6 A;  1V97 A;  1YIW A;  3WAL A;  1ECW A;  2BF8 B;  3AE9 B;  3ML8 A;  9ICJ A;  2ISP A;  1KDH A;  2AQ3 B;  3N1X C;  2QC8 A;  1AW7 A;  5AKX A;  5BOM A;  5BOL A;  3PW4 A;  3A9K B;  5D7G A;  4Y2R A;  3AH7 A;  5DPR A;  2EZZ A;  2DAF A;  5AK5 A;  4Z6F A;  3H9D A;  1SV4 A;  2KDI A;  4ANU A;  3C5F A;  3L13 A;  2EDU A;  2P66 A;  3AE4 B;  3DVN V;  4PS8 A;  2DYO A;  5EE3 A;  3PY8 A;  3T5K A;  2QHO A;  1PUZ A;  3AMZ A;  4OHJ A;  5KG2 A;  1MA7 A;  2LUE A;  4US9 A;  2Q0Z X;  3B0Y A;  4K3B A;  3IP4 B;  4UB8 U;  5T8I A;  4A3O A;  1ZXH A;  2LMC A;  1QOG A;  2N9X A;  2GH1 A;  2LJ5 A;  4HAI A;  1P3Q U;  2KZ3 A;  7ICF A;  1ZOL A;  2H88 B;  2ON8 A;  2L1A A;  4F1S A;  2MUT B;  4LTU A;  1LKY A;  2INN E;  4RGM A;  2F1I A;  3AED B;  4O3S A;  2DKX A;  5AI0 A;  5KT4 A;  3RNE C;  4A9A A;  2KQ7 A;  2L3Z A;  4DFJ A;  1TY2 A;  1OQY A;  4QIW C;  1TZO A;  3I63 C;  3Q8R B;  2CPR A;  4KLQ A;  3BIN A;  4A8X C;  3UQA A;  1QQ5 A;  5ALS A;  4KX3 A;  2H3Q A;  5EE0 A;  2NO5 A;  2ASD A;  1XLP A;  1OTR B;  3PZ7 A;  2LXA A;  5DDM A;  1N56 A;  2DZJ A;  1ACC A;  5DBB A;  1J2M A;  2QEJ C;  2WS3 B;  4MHV A;  2LGY A;  5H8Y E;  2B3A A;  4BVU C;  4BDP A;  3AE2 B;  4ECS A;  8ICN A;  4KN7 A;  1KF6 B;  1L0X B;  4GDL B;  3R7Q A;  2O6K A;  2UWQ A;  3SV4 A;  2G1E A;  9ICK A;  2IJ0 A;  3OLM D;  1GAQ B;  4N58 A;  4C80 A;  2KFZ A;  3M8S A;  4KVG B;  5KFG A;  3V61 A;  4R63 A;  3QUC A;  3OJS A;  1XS9 D;  4DQS A;  1ZQC A;  1SXE A;  2FMQ A;  2JEJ A;  8ICS A;  3GS2 A;  3IHP C;  1SE3 A;  2PKO A;  2BTE A;  2KSO B;  2K5P A;  2B76 B;  1X6J A;  5CWR A;  2UVW A;  4RPX A;  2XO7 A;  4ED2 A;  1MN8 A;  2OHF A;  2XY7 A;  4UAR A;  5AK3 A;  9ICP A;  1S3S G;  3APF A;  2KD0 A;  7ICV A;  2IOH A;  3N9Y C;  3RR8 A;  4TQR A;  2ZJD A;  4QZH A;  1AAR A;  1ZQV A;  2KDM A;  2GOL A;  1YJI A;  5KFN A;  1T0Y A;  1F2R C;  2C2D A;  2ZTD A;  4NJ6 A;  4IM0 A;  2WAQ F;  2YMQ A;  2KYW A;  4XGA B;  3Q69 A;  2ZUB A;  1UH6 A;  4K1R B;  3SHQ A;  5KFR A;  3HKZ F;  1JWS D;  3IHQ B;  4YSX B;  4MM3 B;  2FBW B;  4EBD A;  3KUC B;  3MR6 A;  5KL8 B;  4HJG E;  3HWT A;  2F8L A;  4IRK A;  1Z4N A;  2KWU B;  2WLB A;  2BQR A;  4ZH4 A;  1N48 A;  4AP4 C;  4IQW A;  1L3U A;  2H3F A;  4DL5 A;  2JQR B;  4HDQ A;  3RD2 A;  4B6J A;  1NZP A;  5HHH A;  1CUK A;  4II3 B;  1F5S A;  5HP4 A;  2KAJ A;  3F5A A;  3C2K A;  1C77 A;  3M3J A;  1XNS A;  1U9L A;  3GFK B;  2KVS A;  5EWE A;  1TS2 A;  3NZS A;  3R2T A;  4M00 A;  2JHD A;  2CN1 A;  4I2J A;  1KLV A;  3Q3F A;  5ALR A;  2XNA C;  4IL6 U;  1FCL A;  4WIP A;  2PVG C;  2BS2 B;  1BPE A;  1JWM D;  1V9P A;  2DGZ A;  4DLG A;  2XC9 A;  3ZDT A;  4GDL A;  1NK6 A;  4QZI A;  4BOS C;  1ZQQ A;  2EMT A;  9ICL A;  3IRU A;  4NL9 C;  5DDY A;  3I76 A;  2VA3 A;  4F4K A;  2V4Q A;  1S9F A;  5AI9 A;  5C23 A;  2YN4 A;  1L7Y A;  2I1K A;  2KX0 A;  3KHL A;  2BPG A;  4DS4 A;  1CI4 A;  2KMD A;  3AEV A;  2X38 A;  2IO1 B;  1P7D A;  3S2A A;  2ALZ A;  1I35 A;  1G6J A;  5L1M A;  4O5K A;  1LO5 D;  5DB7 A;  4HPL B;  1V49 A;  1NVI D;  1GC7 A;  4OVU A;  4I2A A;  1WCN A;  4KN4 A;  4CDG A;  2WXL A;  2D6F C;  1E6E B;  1ZD3 A;  2E8M A;  2RR9 A;  2LHD A;  2HHW A;  4F3O A;  1X66 A;  9ICT A;  2AJQ A;  5A0L A;  3DDH A;  1S0O A;  2KTR A;  2KWD A;  5LNK 1;  4RQM A;  2ZCB A;  2AX5 A;  1ZET A;  2JZZ A;  4QZB A;  4RQ2 A;  5J2A A;  2KMA A;  2RP5 A;  1FPY A;  1UUP A;  4FHJ A;  3RH5 A;  4XC2 A;  2NYV A;  2N9K A;  1MSW D;  2W8K A;  2OWO A;  7ICT A;  1OW5 A;  1Z00 A;  8ICM A;  3KHG A;  5AKZ A;  1VZ8 A;  5J2G A;  5ALL A;  5AM3 A;  1KOT A;  4QZG A;  3GIJ A;  2N7D A;  2QB0 A;  8ICW A;  3LJ3 A;  4YWG G;  1D3Z A;  1PUT A;  5AUK A;  3ZXV A;  3A9K A;  2AYO B;  3Q8L A;  4NPN A;  2OOB B;  2PLP A;  4HK2 A;  1D6E C;  4PH5 A;  8ICR A;  7ICO A;  1Z00 B;  4NQL B;  3VQI A;  2Y0S C;  1SV0 A;  3Q14 C;  1A76 A;  4LNF A;  4M01 A;  4RQ3 A;  3JPR A;  2RQ5 A;  4ECX A;  2MU2 A;  4PHD A;  8ICE A;  3RYT A;  2W9N A;  2YB1 A;  1GNU A;  3HX0 A;  1NJX A;  5CHW A;  1BNO A;  4F4Y A;  1OGW A;  3P4S B;  1QZE A;  2KHQ A;  1Q8K A;  5J2F A;  3URY A;  2E8P A;  4YD2 A;  3S6J A;  4B6W A;  3EWA A;  1SKS A;  1RYS A;  1JCK B;  2KMC A;  1ZQD A;  4PJ0 U;  1XWL A;  4P4P A;  4GIB A;  4M6W B;  4BBN C;  4P4O A;  5J0Y A;  4RUC A;  4DO9 A;  1A70 A;  4EUT A;  1YN3 A;  4KLF A;  3PX6 A;  2WB1 C;  4PPX A;  4P7I A;  1WZ0 A;  2IY0 B;  2JH7 A;  1X9W A;  5GTI U;  2J52 A;  4NJC A;  4I29 A;  3IT4 B;  2EAP A;  1TKE A;  4RM9 A;  5KFX A;  2Z8L A;  1ZQY A;  3T8M A;  3L4P A;  5AKH A;  5J0X A;  5CHF A;  4N6E B;  2XGP A;  1I4G A;  1OFF A;  2ZTC A;  3JSV B;  1ZQK A;  3QUT A;  3H7S A;  1S8O A;  3RT3 B;  4M9L A;  2LAS A;  3KFU F;  5DG8 A;  2DFL A;  2ZIV A;  5L1J A;  1C4P A;  1RPL A;  3KW5 B;  3A9J A;  1SWV A;  3QXG A;  1JMS A;  2KN7 A;  3ZXR A;  3WK9 A;  4ZRJ A;  3NOB A;  1ZQE A;  2PMZ C;  2W9A A;  5FR6 A;  3ISC A;  4HPM B;  3RH4 A;  4EX7 A;  3ZYY X;  2GB1 A;  2OXO A;  3LWM A;  4CO7 A;  3T9L A;  3N3K B;  1KLG D;  4O0I A;  1AWD A;  2NTT A;  3UQ0 A;  5CP2 A;  3HKZ C;  3CWI A;  3GII A;  4ECQ A;  3QEA Z;  5E6N A;  5IIL A;  2GBR A;  3R8B A;  4C7Z A;  4UAS A;  1ZQP A;  2JRI B;  1J7A A;  4QJF B;  4R64 A;  2P6R A;  3D2Q A;  3JPT A;  1YOV B;  2WWZ A;  4RF1 A;  3BS5 B;  2ZVO A;  1QTM A;  2D07 B;  2NBV B;  5L1I A;  1V38 A;  2VA2 A;  4BXO B;  1JRU A;  2L7R A;  2K6Q A;  2OED A;  3NZU A;  3H8S A;  3PO4 A;  1S0M A;  1IM4 A;  2ONQ A;  2M0A A;  5D49 A;  1QOB A;  2VZK B;  7ICS A;  4IWO A;  4MSM B;  2LGI A;  3HVD A;  4IDI A;  2BVC A;  1PYW D;  2HI0 A;  8ICK A;  3QQ8 B;  5J18 A;  5E6P A;  1ZJM A;  1UT5 A;  3AUO A;  2GLS A;  2L05 A;  1OXJ A;  3LK9 A;  3PRZ A;  3P1M A;  3WK4 A;  1NDD A;  3IXS A;  4G50 A;  2IHN A;  2HVI A;  4AUQ C;  5AI6 A;  2PXI A;  4C00 A;  2LYH A;  3R9K A;  5JHB A;  4RQ0 A;  3OSP A;  5KFQ A;  9ICH A;  1UBQ A;  2KDE B;  4TKN A;  2NS5 A;  3U7D A;  1PFD A;  1YX5 B;  1V5O A;  1QOA A;  4DL7 A;  3PHX B;  5AZF A;  3L0W B;  4GIV A;  5ALG A;  4W9I A;  1J7B A;  2Q4T A;  1QIL A;  3RJI A;  1IYF A;  2JV3 A;  1SGG A;  4UAU A;  4DFD A;  2BQQ A;  5AM1 A;  4J03 A;  2FIF A;  4YT0 B;  4JX1 C;  4FS1 A;  2JT4 B;  1J2N A;  4EEK A;  4BGD A;  1XO0 A;  2WAQ C;  2YML A;  2RDB C;  1UEL A;  3GE3 C;  3RMK C;  4A6Q A;  1EF1 A;  2KC2 A;  2LBO A;  4AWJ A;  3GIL A;  4PGQ A;  3B2F A;  5ALU A;  1TAQ A;  1ZQS A;  4HCN B;  4XWW A;  2WF9 A;  4Y2J A;  2EMS A;  4C8K A;  3W1S C;  4JUZ A;  1Y88 A;  1U48 A;  1E8Y A;  3RI7 C;  3KOO A;  4US8 A;  4IRD A;  1WYW B;  4W9K A;  1S0V A;  2F3N A;  4Z6D A;  2WXP A;  2YLM A;  4NLK A;  5AIB A;  5CHV C;  3UXO A;  3UMG A;  3CST A;  3SFD B;  1PK1 A;  1YMH E;  2KNJ A;  1IXR A;  1MG4 A;  3AEF B;  4RGT A;  3WKE A;  5KFV A;  5IP4 D;  4GSW A;  3AL0 B;  2ZNV B;  2BYV E;  5J8Y A;  4KIK B;  1SV0 C;  5T14 A;  3UPQ A;  3N4M B;  1JWA D;  3ZLZ A;  1B4F A;  2HD5 B;  2KJ9 A;  1OEY J;  3ALB A;  2V3S A;  3DBR I;  3BQ0 A;  4BOZ B;  4DHZ E;  3C5G A;  3PV1 A;  2E8N A;  5L9X A;  4DF8 A;  2MBH A;  1ZKH A;  8ICJ A;  2ZXI A;  3I9V 1;  3VRA B;  3C23 A;  5ALT A;  3KYC D;  1WI0 A;  9ICU A;  1YJ1 A;  3HIL A;  2LGX A;  5CR0 A;  2XID A;  1XLQ A;  2BCQ A;  4FJZ A;  5IAA C;  2ZVN A;  4R8U A;  1Q5W B;  4X5V A;  5KFH A;  2G09 A;  1TV9 A;  9ICF A;  4UDU C;  4ECV A;  3QUB A;  3C2L A;  1FRD A;  4FBU A;  3Q3M C;  1CK1 A;  5C2T B;  1Z4O A;  4KDI C;  2WU5 B;  1NEN B;  2C7N B;  4EZ9 A;  1SB3 C;  9ICG A;  3L17 A;  1B22 A;  4KLO A;  4FLH A;  3DBL I;  4IW0 A;  2X8X X;  5AKI A;  3QYP A;  3THV A;  3ZDD A;  3GV5 B;  4DQP A;  3B2G A;  2D3G A;  1N6Z A;  2N9P C;  3SDL C;  3VRB B;  4QW9 A;  4HYK A;  4IR9 A;  3PR4 A;  4ECW A;  3Q8P B;  2ASQ A;  2NTS A;  1JRP A;  3MC9 A;  7ICH A;  2MBB B;  3C29 A;  5ALV A;  3LVW A;  4GC6 A;  1EF5 A;  2WXH A;  5L1L A;  2GRI A;  1GOZ A;  3VH4 B;  3OHB A;  5AM5 A;  1C1Y B;  4P0P B;  1F1H A;  4CNQ A;  2BPF A;  4TQ0 A;  2DX5 B;  3RNA C;  4KGT A;  2AU0 A;  2N1V A;  3ONN A;  3OHA A;  2FLP A;  2N9E B;  3PS6 A;  2MP2 B;  2HCF A;  3WKC A;  4RM8 A;  4M9G A;  3VVW B;  2G3Q B;  5D4B A;  5DGA A;  5DBA A;  1ZD4 A;  2BWE S;  4UBB A;  2KK8 A;  2V9W A;  8ICQ A;  2MRP A;  4BUG A;  2VJ5 A;  3WAO A;  4AS1 A;  3QU2 A;  5F9N A;  3SD7 A;  4A55 A;  5BO4 B;  4I6P A;  5J2H A;  2ZUD A;  2EZX A;  4YSY B;  1F0Z A;  4XDC A;  5KFO A;  4B9M A;  3Q8M A;  9ICO A;  3H0R B;  2WHI A;  2WXM A;  3IVF A;  3V6E B;  2D10 A;  1NOM A;  1QSL A;  2V4I B;  4HVB A;  5J2B A;  2E8O A;  4EKU A;  4PGX A;  2KX3 A;  5MPO A;  4J9N A;  2CJN A;  1FNV A;  4UAT A;  3EYZ A;  2PKE A;  1WIA A;  2HDO A;  2KEY A;  3H8W A;  5KG1 A;  2N7J A;  4TQ1 A;  1WH3 A;  1WSP A;  4M9N A;  2PI4 A;  1V1P A;  3MR5 A;  1X9X A;  3G6V A;  1SIJ A;  2Z7J A;  3LDZ E;  4RUA A;  3PSI A;  4JWN A;  2IDY A;  1UWX A;  3RJE A;  4RGN A;  2BYT A;  2L52 A;  5J2C A;  2N1W A;  1TVA A;  4L2Y A;  2G45 B;  4R8U B;  2NCN A;  4FA6 A;  1Z2M A;  5DLG A;  4C8L A;  4HJK A;  1ZUD 2;  2NBU A;  4U7C A;  2Y9T A;  4Y2U A;  2DWQ A;  3RNG C;  3DQV A;  5CTR C;  3TAN A;  3RNF C;  3WKD A;  3AU5 A;  3LYS A;  1XXG A;  2KIC A;  3N1Y C;  1J8C A;  1KTQ A;  2KZM A;  1NYQ A;  1RYJ A;  1A5R A;  5GXG B;  1UGJ A;  2AWT A;  3GE8 C;  1TK0 A;  3I57 A;  3CRX A;  2WXN A;  2J0M A;  4HXD A;  3VUX A;  3RTV A;  4AOF A;  2GBJ A;  4NXZ A;  2IZV B;  4LZD A;  3ZNG C;  1BPZ A;  2W43 A;  3P4R B;  5CX3 A;  2N0S B;  1GB1 A;  3QU7 A;  1YN4 A;  1TJE A;  4RT3 A;  2DQN B;  2FI1 A;  2NRT A;  3KYD D;  4P1B C;  3ICX A;  2F76 X;  4EOY A;  2VRR B;  1B1Z A;  4CF5 A;  2RPV A;  3TAD C;  1ED1 A;  4DFK A;  2RD0 A;  3AB5 A;  1TK8 A;  4Q2J A;  5J8Y C;  4F4X A;  1L0V B;  4C0Z A;  2QIL A;  4WUR A;  5HR7 A;  2G9H D;  1RWS A;  3N32 A;  4NM1 A;  2PMZ F;  3Q8F A;  2FE8 A;  5KFC A;  3MC8 A;  3D32 A;  1L0Y B;  2V4R A;  1K51 A;  3RB4 A;  3N7P D;  5J0U A;  4QZF A;  2PPH A;  2LVP A;  2EAM A;  2UYZ B;  2DKZ A;  2KIW A;  3VC8 A;  1D8Y A;  4WWN A;  2WDT B;  3U2S C;  4YXM A;  3M1Y A;  3PX4 A;  1PZN A;  1IPG A;  2DHZ A;  1ZJN A;  3B9J A;  3BS5 A;  3SAF A;  4DXG A;  4B0M A;  2DF4 B;  3H8M A;  4I6N B;  3RJK A;  2SAK A;  1SF0 A;  2MSE D;  4EE2 A;  4I2E A;  4DDI D;  3KKA C;  2IYD B;  4YTM B;  4DF4 A;  4GXB A;  3BZK A;  2JYT A;  3BYT B;  4USA A;  1K53 A;  2WXJ A;  1QLB B;  4W9G A;  2IO3 B;  3PW0 A;  4PZO A;  1HIW A;  1ZQO A;  2UVV A;  4KLS A;  4P16 A;  4EZK A;  4PZN A;  2D3C A;  2ZJ5 A;  3VH3 B;  3PZD A;  4EEW A;  4EYI B;  2WP9 B;  3SAH A;  4BKG A;  5IO9 A;  4J9M A;  1I4H A;  1RLF A;  3C21 A;  2NPT A;  3BJY A;  2CHX A;  2QDF A;  3T5J A;  4P1C C;  2BYF A;  2JZP A;  4C8O A;  2RSU A;  5IIM A;  1O08 A;  1H8C A;  2PFN A;  3J81 j;  4DOC A;  4DCC A;  1I4P A;  2XK5 A;  1T0R C;  5EDS A;  1GB4 A;  3PML A;  2YX8 A;  1KH0 A;  4OJO A;  2HJ1 A;  5J0O A;  7ICU A;  3BQ2 A;  4RU9 A;  3Q3O C;  5JH5 C;  4RQ4 A;  4UB2 A;  2KP7 A;  4F2R A;  5DPW A;  5ALF A;  5KHO A;  4LNI A;  5AK4 A;  3QWZ B;  2WGS A;  1MG8 A;  3WU2 U;  2K25 A;  5HFY A;  3V7K A;  3CNH A;  3T3F A;  3F2D A;  1O03 A;  4B95 A;  2LHE A;  1DGJ A;  4GN1 A;  1UD7 A;  5AM2 A;  3M9O B;  1QSY A;  2JZB A;  1T8E A;  1M94 A;  3RH6 A;  3FDS A;  2W9C B;  3HM6 X;  1NKE A;  2K4H A;  3HUI A;  1J19 A;  5D94 A;  2JWZ A;  2MP2 A;  3Q8B A;  1QKZ A;  5D3I B;  1YQ4 B;  1FO4 A;  2HW3 A;  1WE6 A;  4P2H A;  1F44 A;  4MFC A;  5KT3 A;  2LYA A;  4FE3 A;  5C5J A;  4EYH B;  2P35 A;  1XU4 A;  4GDK B;  2A1A A;  9ICQ A;  1SBB B;  2RMM A;  2XCA A;  2K0P A;  3LYY A;  8ICF A;  2LXC A;  5TIS U;  4AJY B;  4IKG A;  2W7O A;  2AQ1 B;  4MGZ E;  2K89 A;  2I38 A;  3BK2 A;  3EC8 A;  2DZM A;  3MHZ A;  3V60 A;  5JHA A;  3M6Z A;  3SR6 A;  5KFL A;  5DGB A;  1SXT A;  2IGH A;  4ICV A;  2ZIX A;  1VDV A;  1KLU D;  1UQV A;  7ICN A;  1P7E A;  4RPY A;  1SE4 A;  1I4X A;  1XCQ L;  4EFO A;  5ALM A;  1XLO A;  3T3N A;  4J9L A;  3ENE A;  4JV0 A;  1V1P B;  2XN9 C;  1EWY C;  2KWC A;  4RQ1 A;  4PL2 A;  2IO2 B;  2JX5 A;  4JIO U;  4HDO A;  3ZNI D;  2G07 A;  2YMM A;  4Q8E A;  1HTO A;  1PDX A;  2XVT A;  2MWS B;  4O3N A;  5FR3 A;  4A90 A;  1MQ2 A;  4O3Q A;  4DOA A;  5KT7 A;  1BML C;  4LNN A;  4NV0 A;  3QZ8 A;  3T5H A;  1YZ6 A;  2C9W B;  3APD A;  4IQT A;  1QH9 A;  3TEX A;  1M6Y A;  1SZP A;  3W2D A;  3RNB C;  3TUO A;  1JWB D;  3H8J A;  1F9J A;  1FNW A;  1FXA A;  5IKC M;  1PVR A;  4PHA A;  3R3M A;  1E9M A;  4WWP A;  2NRW A;  1Q3V A;  2F44 A;  3AE6 B;  4AQ7 A;  2Z59 B;  1NK0 A;  2MA1 A;  5GMV A;  5G5H A;  4NLN A;  1E5W A;  2AH5 A;  2XK5 B;  3EGR A;  4PYZ A;  1SZH A;  3W9C B;  4ZHP A;  1MQ3 A;  3IFW B;  2MA9 B;  1KQQ A;  2KD1 A;  5BPC A;  2C7H A;  2J6U A;  1J0G A;  4DHZ B;  2F1J A;  4YG2 A;  4RQ7 A;  1OQQ A;  2NBW B;  1EXN A;  3VTV A;  3TCA A;  4WJ3 B;  3GDX A;  4GLX A;  5DQI A;  2OEH A;  4DL6 A;  2GBK A;  1ARO P;  1KRP A;  2WDQ B;  4ED0 A;  3PO0 A;  4ECY A;  3BII D;  4I6L B;  4YR0 A;  1XEE A;  1ZYQ A;  3V7J A;  3IAM 1;  5JRT A;  1QQ6 A;  1L3T A;  3SEI A;  1EU4 A;  3ZDC A;  4S17 A;  4P4M A;  4TQS A;  1FFV A;  1JAL A;  1J97 A;  3OGU A;  3GQC A;  5KG3 A;  1SSN A;  2V3N A;  1WXQ A;  3M95 A;  1ZQ1 C;  2Y9U A;  3VHT C;  2JPH A;  2SEB D;  1DOX A;  5IIJ A;  2KJ8 A;  2C7M B;  3DHH C;  4IR1 A;  2GMI C;  2KSO A;  5CEH A;  3O65 B;  2QAR B;  3FC4 A;  4NLZ A;  3QIJ A;  5KHQ A;  1R4M B;  1XQQ A;  2M0X A;  2IOF K;  4U6P A;  4DWI A;  2RRD A;  3NVZ A;  1ZGU B;  1L4Z B;  3EFU A;  3UXN A;  2BCU A;  1S0N A;  1WY8 A;  2KNB A;  3NVY A;  2M4N A;  3TMP B;  1UT8 A;  5AIC A;  4DFM A;  2PFO A;  3PLV A;  3RUL A;  1QCK A;  1ZQI A;  4KLG A;  1T3N A;  4KLE A;  3WIM A;  2WHE A;  1KEJ A;  1KL9 A;  1D5X C;  4ITK A;  1A6S A;  3K9P B;  1C9F A;  4ED7 A;  3P2B A;  2W04 A;  9ICI A;  1WGR A;  2KTR B;  4FJV B;  4YXJ A;  4WAF A;  2BYE A;  5C3J B;  1WXS A;  3RN9 C;  3NHE B;  1UBI A;  4CCH A;  4G11 A;  2MQJ A;  2LGS A;  2BPS A;  2PJH A;  3LWL A;  5JUM A;  4WJQ A;  4DBG A;  4RNN A;  1N63 A;  2FJ6 A;  1KRH A;  5FKA C;  4F92 B;  1SJH D;  3DBR B;  3D6J A;  1V85 A;  4UB6 U;  4JK1 A;  4LK0 M;  2BB6 A;  1D8L A;  2MBQ A;  1T7P A;  2FCM A;  4H2A A;  2E1E A;  2MSN A;  2ZIW B;  4PL1 A;  2FUG 1;  2LPE A;  7ICQ A;  4ELV A;  2KAC A;  3Q6B A;  3JPO A;  1IBX A;  2MAX A;  4TV3 A;  2E5S A;  5D2M B;  4JQW C;  2KTQ A;  3LXF A;  3RPF C;  3KUD B;  1SE9 A;  3WK6 A;  1HUZ A;  2NV3 A;  2HOF A;  5KT5 A;  2JSV X;  3TL5 A;  1U4B A;  3E56 A;  4FZL A;  5D6J B;  1S77 D;  1JXL A;  1LGR A;  5E6J A;  2PFQ A;  5KG5 A;  2Y5C A;  4IQU A;  1WR6 E;  4TUQ A;  3NVW A;  1ESF A;  1IBX B;  3HT3 A;  1B9R A;  8ICP A;  1LXD A;  5H92 C;  4WQO B;  1KBU A;  3N97 B;  1L7M A;  4I2B A;  4JWM A;  3IG3 A;  1BPD A;  4DSF A;  3KVF B;  3GIM A;  4YCX A;  1KTK A;  4KKJ A;  4C4V B;  3ZI4 A;  3PO5 A;  4ASW C;  2LI5 A;  2L8J A;  1XD3 B;  1JIH A;  2MBO A;  2BCS A;  3WAN A;  1E7P B;  3OJ4 B;  4EBC A;  3LDA A;  1NBF C;  1EUV B;  1TFR A;  2DPI A;  1RDF A;  8ICT A;  3TSS A;  5DLF A;  1XSL A;  3IN5 A;  2RDJ A;  2IHM A;  2IBK A;  3H7P A;  4WWO A;  1KFS A;  4J9Q A;  3UQ2 A;  7ICE A;  2MBE A;  3G6X A;  3NGD A;  1IGC A;  5KFM A;  1WM2 A;  5H2F U;  1N60 A;  3AEC B;  3MTN B;  3NUH B;  3GP7 A;  1PVP A;  1FFU A;  1KSP A;  1C4C A;  1RAX A;  2G4S A;  1UA1 A;  4UB1 A;  1RZT A;  4ACO A;  3AEB B;  2FMS A;  3H7P B;  4URK A;  5F3X B;  1C4A A;  2DYB A;  4JV2 A;  5K4L A;  4Z6C A;  3H0L B;  2BDU A;  4JMU A;  4NZL B;  2HHT A;  2FLN A;  1TBE A;  1JQ4 A;  5ALE A;  4FHK A;  4R65 A;  1E10 A;  3QAR A;  3WAM A;  4CF4 A;  2EQY A;  1QSS A;  3CMM B;  4F5R A;  2UVR A;  2QSD A;  4HCP B;  4QW8 A;  4DSL A;  1LVH A;  5C0Y A;  1Z1V A;  4BAX A;  2XY6 A;  3EPG A;  4R3D A;  3H40 A;  2W03 A;  3EZ5 A;  4Z6E A;  5L1K A;  3VR9 B;  3T5L A;  5EE9 A;  4DWF A;  1BPX A;  3MC1 A;  4F5Q A;  2H5X A;  5J0T A;  3LB8 C;  4HWI B;  2KIV A;  1CEZ A;  3DVG Y;  3Q8K A;  8ICZ A;  1TT5 B;  2KVZ A;  2D5G A;  3R2I A;  4IWQ A;  2LGD A;  3EEC A;  5J0Q A;  2K4E A;  2BCR A;  5E79 U;  2FPK A;  4M6W A;  3DOW A;  3ZD8 A;  1JML A;  4IM2 A;  4W9C A;  2BS4 B;  4QWB A;  9ICX A;  1FEH A;  2Z0E B;  1KFY B;  3QU4 A;  2K60 A;  2WF6 A;  4Q8F A;  3BVM A;  2RHF A;  4C7Y A;  3CSF A;  3NS8 A;  4MGK E;  1RFK A;  2IND C;  3BWU D;  2W3R A;  3TJP A;  2BS3 B;  1V5T A;  1N5W A;  2RDI A;  2KHV A;  3C19 A;  1P0R A;  1XSN A;  9ICE A;  4KTQ A;  3C1Y A;  1SGH A;  1K1Q A;  4WAA A;  1X1M A;  3VXW A;  4ANV A;  4W9D A;  5KFU A;  4QZ9 A;  2LZ6 A;  4LJP B;  4CE6 A;  5KNI A;  2FCS A;  4NLG A;  2I9G A;  3CF6 E;  2AGQ A;  3UF8 A;  2MH7 A;  4AYB C;  3BVG A;  1MVK A;  3VFK A;  3F5E A;  3HVZ A;  3ED5 A;  2MX2 A;  5BMH A;  3MAB A;  2BQU A;  2YEP B;  3PR5 B;  2C22 A;  5LXH A;  4ZRP A;  1UNS A;  1UF0 A;  2JH1 A;  4F5N A;  8ICH A;  1WM3 A;  2ZIX B;  8ICY A;  3W5U B;  3PRE A;  3MR2 A;  2KFJ A;  2ACZ B;  4FXC A;  1KFD A;  2W54 A;  4GXK A;  1PVQ A;  4DLE A;  2K22 A;  2R2O A;  2R61 A;  2D8C A;  1BT0 A;  3EW9 A;  3MDA A;  2HDE A;  1C79 A;  4CHK A;  3QHT A;  4ED3 A;  4W9E A;  2BT6 A;  1LM8 B;  2KVC A;  4BKT A;  2HVH A;  2QLT A;  3B0X A;  3UIN B;  4J9P A;  3PHW B;  2KQS A;  1NK9 A;  5LXI B;  1XO3 A;  2IO0 B;  1ISN A;  1R4M I;  1Q3U A;  1YJJ A;  1JWU D;  4HEA 1;  3DBH B;  3P4P B;  1MJD A;  4GFJ A;  1IIP A;  2R8G A;  2KKC A;  2IGD A;  1T5X D;  1GG3 A;  2L83 A;  2HOQ A;  2GBM A;  4W9L A;  1CZP A;  2PW9 A;  3HRD D;  2E6X A;  2WDR B;  3NS1 A;  1U4A A;  2WXK A;  2HBM A;  4F2S A;  1V1O A;  4BWM A;  5AKL A;  8ICB A;  2ZCC A;  2H3V A;  4J9R A;  5DB6 A;  4EZL A;  3DBL B;  4RPZ A;  1X9M A;  2W3S A;  5E6O A;  5HG2 A;  3VAW A;  1S76 D;  3K9O B;  2DLB A;  2QJL A;  2WTF A;  4M8N A;  1WXM A;  1VZ7 A;  4FUL A;  1WYG A;  3RB6 A;  2O6V D;  4RT2 A;  1TY0 A;  4K7S A;  2B6G A;  1GC6 A;  3ZJT A;  5TZV A;  2RGF A;  2AGP A;  3DBH I;  2J42 A;  3KQ4 A;  1ZXI A;  2KFK B;  3H8H A;  1UA0 A;  3OJ3 A;  3FIL A;  3H4D A;  4KSL C;  4W9F A;  1LQB A;  3TAP A;  3C2M A;  1FNU A;  4YP3 A;  1EO6 A;  3TAC B;  1BXT A;  3ZO5 B;  1XLN A;  1PK3 A;  1DK3 A;  4DXF A;  5AEK B;  2BBC A;  4N9F 4;  1VR9 A;  4REZ A;  2CU1 A;  1SE2 A;  2EH9 A;  2YTU A;  3SEN A;  4NL9 A;  1V6E A;  5DG9 A;  1U49 A;  1QOF A;  2JWU A;  2D11 A;  1HEK A;  1R4N I;  3BY4 B;  5AIA A;  4NY8 A;  5IN7 A;  1URJ A;  1DYQ A;  5J0P A;  2L32 A;  3J9C A;  3RR7 A;  4IG7 B;  2Y0S F;  4EEY A;  1TS5 A;  2F2A B;  4KIK A;  2G06 A;  1ZRM A;  2ISO A;  3N1Z C;  4E0D A;  2ZTE A;  1NEK B;  3TAQ A;  1KN5 A;  2W9M A;  1XCT L;  1C78 A;  3EPI A;  4ECZ A;  5DB8 A;  4Y2Y A;  2FPM A;  4RGO S;  2FID A;  3X23 A;  4MM3 A;  3SAG A;  4I2F A;  2R8J A;  9ICV A;  3QX7 A;  1NJZ A;  4M8M A;  3N20 C;  1XSP A;  2HHV A;  1P98 A;  2KT7 A;  2XY5 A;  2QAR A;  3OPX A;  4EBE A;  4BXO A;  3QNM A;  1WJN A;  5FK9 C;  4IRC A;  1Q46 A;  4DSE A;  2HE7 A;  2IGG A;  1NI3 A;  4P0Q A;  4ARC A;  2UVU A;  2JXJ A;  3MGH A;  1V9J A;  3QAQ A;  5TR5 A;  2ES6 A;  3TEZ A;  1JN3 A;  2QMT A;  2HTH A;  1TE2 A;  4BZA A;  2XIC A;  5JZE B;  2JF5 A;  2M17 A;  3C8Y A;  3GOE A;  3PGE A;  2DZI A;  2HMX A;  4DXA B;  2Y1J A;  3ZNH B;  2V3P A;  4ED6 A;  1Q1O A;  2K1F A;  1RM6 C;  3VTW A;  3HP6 A;  1COK A;  2A19 A;  4MSQ B;  2QCZ A;  2DAJ A;  2EEL A;  1E8W A;  4UB5 A;  4F5O A;  1E7V A;  2HBJ A;  1L5U A;  1GUA B;  1K50 A;  3SMV A;  5BYQ A;  4OJP A;  2PMV A;  1F2R I;  2N7E A;  4RQ8 A;  2GBN A;  1VJK A;  2KFK A;  2MW5 A;  1C76 A;  9ICA A;  4KDL B;  4M02 A;  2ODG A;  2K6D B;  4YQW A;  4OVZ A;  2C5L C;  2WXQ A;  1KFT A;  2B21 A;  3PTF C;  3MJW A;  1I42 A;  3TIX A;  1VCB A;  2D3A A;  1BVS A;  1DGS A;  1L8L A;  4LJX A;  3TI0 A;  2R8K A;  3I1Y A;  5J2I A;  3WKA A;  3B08 A;  3ORY A;  3NZ3 A;  4IM3 A;  1WG8 A;  3RB0 A;  4JWU C;  4F93 B;  1T0S C;  1I4R A;  2EAN A;  4J9O A;  1F77 A;  4II2 B;  4QZD A;  4Q43 A;  3ZKJ C;  4KMO B;  3FM9 A;  2WF5 A;  3QEB Z;  5ALZ A;  2J6T A;  1GPX A;  3RZW C;  1Q10 A;  1ZP0 B;  4RFB A;  5DQG A;  1HZ6 A;  4KLD A;  3NAS A;  1BGX T;  1ZQW A;  1QF6 A;  2C2E A;  2GI9 A;  2W82 A;  2LD9 A;  2VZK D;  1CJE A;  1NJY A;  2R8I A;  4XA5 A;  1JX4 A;  1LB2 B;  4A8E A;  5KG4 A;  1FRR A;  3BVZ A;  4WWM A;  5EE1 A;  4J3O D;  5GTH U;  3AE7 B;  4LLG M;  4M0A A;  1QQR A;  4HLE A;  1ZQH A;  5AKE A;  5DPT A;  4K7U A;  3QJZ A;  4KSK C;  5J2E A;  3FKY A;  1ZQG A;  5ALK A;  1TKY A;  1WE7 A;  2LFI A;  3KLS X;  5AI5 A;  5AM0 A;  4M04 A;  2PEA A;  3EA6 A;  4KKI A;  3EHV A;  2J7Q B;  4M9J A;  2AEH A;  2WQY B;  4YMM A;  1YN5 A;  3WK7 A;  1NK4 A;  5KG6 A;  4WJP A;  3UIP B;  4QAY A;  3TQ1 A;  4BBN F;  2KVR A;  2KDF B;  4F7Z A;  4NJ8 A;  2XEW A;  2REX A;  3GZF A;  3BS7 A;  1WWU A;  2VH2 A;  1CQV A;  4CRX A;  1HZ5 A;  2Z0D B;  3EUB 2;  4DS5 A;  2PE9 A;  2K4P A;  1HE8 A;  2KJ5 A;  4TMA B;  4YN4 A;  4P6V F;  1B0X A;  2VA8 A;  2WXG A;  3MC0 B;  3MFG A;  3U52 E;  4XUS A;  4FZN A;  3ECI A;  1ZQT A;  1WGG A;  4Q44 A;  1MPE A;  1R4N B;  2XGQ A;  4QZC A;  5DKW A;  5KFI A;  5G2N A;  4KZ0 A;  2IMW P;  2GOW A;  4ZRQ A;  3L16 A;  4RF0 A;  3DDC B;  1WF9 A;  4UB3 A;  2LJI A;  1P9D U;  1WWT A;  2NRZ A;  1V2Y A;  1SXD A;  3V6J A;  3E9S A;  4NAW B;  4XZ4 A;  1E90 A;  1IP9 A;  3H4B A;  1XC9 A;  8ICX A;  1F0M A;  4ED1 A;  1WGK A;  1DOI A;  1WUD A;  3OSN A;  3NVV A;  2PFP A;  1KW4 A;  2A1J A;  3ONS A;  4HRS A;  5AK6 A;  3KBB A;  2F8K A;  5TSS A;  4OD0 A;  1WGH A;  2L0T A;  2WXR A;  3DWM A;  3LVV A;  3RF9 A;  3NRZ A;  2KWV B;  1ZD5 A;  3D2S A;  2C2R A;  2I2Y A;  3H7I A;  2HOI A;  4C8N A;  3PPA A;  3JPP A;  2WDV B;  1HUO A;  3APC A;  3V6K A;  2RPQ A;  2PIA A;  5IIO A;  4ZRK A;  4I2I A;  3PVX A;  3ZJV A;  4UQG A;  2ATL A;  4DL3 A;  1L7O A;  4YVZ A;  4O3P A;  3WK5 A;  2L00 B;  3DV9 A;  2FDR A;  2M9N A;  1H38 A;  3U26 A;  2ZJ8 A;  4B9N A;  5KFD A;  1WXA A;  2WNM A;  4IOI E;  1S5L U;  5HI1 A;  2LRU A;  2KJ6 A;  4MDK E;  1R7S A;  2G5H B;  4OJ6 A;  2DYM A;  2Y1I A;  3RJG A;  2M56 B;  1HXY D;  3Q8A A;  2W11 A;  4B0E A;  2ZPN A;  2NRX A;  4G9B A;  2K8C A;  4CF3 A;  3PSP A;  2LRW A;  3V05 A;  4NWI A;  3W1S A;  4BFR A;  3MBY A;  1MFW A;  4ZHO A;  4IUM B;  3M63 B;  2H3I A;  4KIT B;  5B5E U;  3KH0 A;  4ED8 A;  2KFN A;  2LEK A;  2JZB B;  2DZK A;  3AQF A;  1NK8 A;  2D3B A;  3A4R A;  3N28 A;  3OG5 A;  1HA5 A;  1M4V A;  5AI8 A;  2Y5P A;  2KZZ A;  4EEL A;  1L6U A;  2K8H A;  4KV2 A;  3I28 A;  3TKA A;  5HHD G;  3N30 A;  4FZM A;  1SEB D;  2YQE A;  1Z5S B;  1TAU A;  2CJO A;  1C7Y A;  2ICI A;  1MI0 A;  3GZN B;  2VJ4 A;  2KZR A;  4MT5 A;  2I1Q A;  5C1Z A;  4BKS A;  3E58 A;  4KZC A;  5J2K A;  2R18 A;  4FO6 A;  4P0Q B;  2PVO D;  3HIZ A;  4DHJ D;  8ICU A;  2HHX A;  3Q8S B;  1FD6 A;  3C28 A;  2D3D A;  5CRX A;  1X9S A;  9ICC A;  5AKK A;  4ZDV A;  4PT5 A;  2VIX A;  3AV8 A;  1SL0 A;  2HBL A;  2CS4 A;  3MP9 A;  2FAZ A;  3K1R B;  3AU2 A;  2G0A A;  4JL9 A;  2LM1 A;  4Y2V A;  1X2I A;  2ZZP B;  4MGY E;  2LYB A;  4ACF A;  4DSJ A;  2Y3A A;  3IG8 A;  2OM6 A;  3RCZ A;  2IY1 B;  3CW2 C;  4F8R A;  4M0W A;  3WK8 A;  3MFH A;  3RZF A;  2C60 A;  2PE6 B;  4L23 A;  3Q2A C;  5KFW A;  1E8X A;  1SJE D;  4DSI A;  3SYZ A;  2K8B B;  3N7R C;  4MFF A;  3KHH A;  3BQ7 A;  1N2X A;  2R8H A;  4LVS A;  3QC8 B;  5CJ7 A;  3SI8 A;  3ZIM A;  3HPO A;  2HHU A;  4DQR A;  4C4R A;  3M62 B;  4ECT A;  4QZA A; 
#chains in the Genus database with same CATH homology
 3B2F A;  4XWW A;  1J7C A;  2INP E;  4US8 A;  1D5M C;  1E7P B;  2NMQ A;  4HKZ E;  2WXP A;  1AYF A;  3TSS A;  3ZJU A;  3SFD B;  5D3D A;  1IUE A;  1YMH E;  2V0G A;  2WXI A;  1TS3 A;  4RGT A;  1IGC A;  1D5Z C;  1N60 A;  3AEC B;  1N5X A;  1VRA B;  3NUH B;  3GP7 A;  1FFU A;  1FIQ A;  1C4C A;  1ZDV A;  1JWA D;  1I7H A;  2KMM A;  4ARI A;  3U4E G;  3AEB B;  2JYE A;  1C4A A;  3V3X A;  3I9V 1;  1N61 A;  4NZL B;  3VRA B;  1JQ4 A;  3AE3 B;  1VZ6 A;  2IPK D;  1NYR A;  3PZ8 A;  1E10 A;  2KN4 A;  4YSZ B;  1XLQ A;  2J4X A;  2QSD A;  2EKI A;  3GB1 A;  4UDU C;  1FRD A;  5I4D A;  1FXI A;  3AN1 A;  1CK1 A;  5C2T B;  2WXO A;  4R3D A;  3AE5 B;  2WU5 B;  3VR9 B;  1NEN B;  3AE1 B;  5EE9 A;  1SB3 C;  1L4D B;  3LB8 C;  1XF5 L;  4RH6 A;  3B2G A;  2D5G A;  4RNA A;  3R2I A;  3VRB B;  1PGA A;  1JML A;  2BS4 B;  1FEH A;  1KFY B;  4DQO C;  2NTS A;  1JRP A;  4MAC A;  3BVM A;  4C7Y A;  1RFK A;  1TYG B;  2WXH A;  3P42 A;  3BWU D;  2W3R A;  4TSS A;  2GRI A;  1GOZ A;  2BS3 B;  1N5W A;  5BMG A;  2WU2 B;  3T3O A;  4TQ0 A;  2WXF A;  4KGT A;  1ROE A;  3ETR A;  4KGS A;  2MJD A;  1IGD A;  1FMA D;  3AE8 B;  2MH7 A;  4YTP B;  1WRI A;  3BVG A;  1MVK A;  1TS4 A;  4CQN A;  1HEZ E;  3ZQ4 A;  4N59 A;  4AS1 A;  3HVZ A;  3Q8E A;  5BMH A;  4A55 A;  4RCO A;  2YEP B;  4L1B A;  2K3U A;  1OQR A;  2PTL A;  4YSY B;  1UNS A;  1F0Z A;  4XDC A;  4C56 C;  2MJ3 A;  2WXM A;  3ABV B;  3W5U B;  2V4I B;  3WCQ A;  3KWV A;  4WH4 A;  1TKG A;  2ACZ B;  4FXC A;  1V97 A;  5MPO A;  2CJN A;  2W54 A;  1FNV A;  2H89 B;  3AE9 B;  2K22 A;  2R61 A;  2AQ3 B;  2HDE A;  1C79 A;  2N7J A;  4TQ1 A;  1AW7 A;  1WSP A;  1V1P A;  2BT6 A;  5D7G A;  3AH7 A;  1SIJ A;  1XO3 A;  2IDY A;  1UWX A;  3AE4 B;  4RGN A;  2BYT A;  1YJJ A;  2L52 A;  1FCC C;  2DYO A;  1JWU D;  5EE3 A;  4L2Y A;  3AMZ A;  2ZW0 A;  4HEA 1;  4OHJ A;  3P4P B;  4XWT A;  1ZUD 2;  4US9 A;  1T5X D;  2IGD A;  2DWQ A;  5T8I A;  1ZXH A;  2L83 A;  2LMC A;  1QOG A;  2RDH A;  5BMI A;  1CZP A;  2PW9 A;  1XXG A;  3HRD D;  4ZOH C;  1NYQ A;  2E6X A;  2H88 B;  2WDR B;  3NS1 A;  2ON8 A;  1RYJ A;  2L1A A;  3IT6 B;  5GXG B;  1ZPS A;  2WXK A;  1BUI C;  4LTU A;  1UGJ A;  2INN E;  4RGM A;  1V1O A;  3AED B;  3I57 A;  2WXN A;  4A9A A;  1ET9 A;  3TEY A;  4WQM A;  1TY2 A;  1TZO A;  2W3S A;  5HG2 A;  2DLB A;  2QJL A;  4A8X C;  3P4R B;  1VZ7 A;  2N0S B;  1GB1 A;  1XLP A;  3PZ7 A;  1YN4 A;  5EE0 A;  1WYG A;  1TJE A;  1TY0 A;  3FAH A;  1ACC A;  3ZJT A;  1B1Z A;  2QEJ C;  2WS3 B;  3P63 A;  5H8Y E;  1P7F A;  2RPV A;  2J42 A;  2QIE B;  3AE2 B;  3KQ4 A;  1ZXI A;  3AB5 A;  4Q2J A;  3H8H A;  1V8C A;  1KF6 B;  1L0X B;  1YNT E;  4GDL B;  1L0V B;  3FIL A;  1T6B X;  5BYS A;  2QIL A;  2G1E A;  2IJ0 A;  4WUR A;  2G9H D;  1RWS A;  2BB5 A;  1GAQ B;  1PGB A;  1FNU A;  1BXT A;  4N58 A;  1XLN A;  4DXF A;  2BBC A;  2FE8 A;  1VR9 A;  3Q8F A;  4REZ A;  1L0Y B;  4C80 A;  1SE2 A;  3AEF B;  1K51 A;  3GS2 A;  1QOF A;  1SE3 A;  2JWU A;  2PKO A;  3UI3 A;  1I4Q A;  2BTE A;  2K5P A;  2B76 B;  3U2S C;  1DYQ A;  2L32 A;  4JWS C;  3SFE B;  3J9C A;  2OHF A;  1QT9 A;  2J53 A;  1TS5 A;  4KGR A;  3B9J A;  4DXG A;  3N9Y C;  4B0M A;  2SAK A;  1NEK B;  1YQ3 B;  1JRO A;  1SF0 A;  2KDM A;  4EE2 A;  1XCT L;  1YJI A;  1C78 A;  2MEK A;  4YTM B;  1F2R C;  4RGO S;  3ZGZ A;  2JYT A;  3Q69 A;  3BYT B;  4USA A;  1K53 A;  1QLB B;  1JWS D;  5AUI A;  4YSX B;  3IAS 1;  4MM3 B;  2FBW B;  3BK1 A;  4NAM A;  1EU3 A;  5FK9 C;  4HJG E;  2IGG A;  4P16 A;  1NI3 A;  4ARC A;  2WLB A;  4GLS C;  3TEZ A;  2QMT A;  3BYY B;  2WP9 B;  2JQR B;  3CIR B;  3C8Y A;  1I4H A;  1STE A;  2KAJ A;  1C77 A;  2V3P A;  2JZP A;  1RM6 C;  1TS2 A;  3R2T A;  2Q5W D;  2WXJ A;  2EEL A;  4ZRP A;  1K50 A;  5BYQ A;  1I4P A;  2PMV A;  1F2R I;  2XNA C;  4OZB A;  3FIL B;  2K9X A;  1FCL A;  4WIP A;  1GB4 A;  1KH0 A;  2BS2 B;  2PVG C;  1JWM D;  1VJK A;  1C76 A;  3AEG B;  4OVZ A;  1DOY A;  2WXQ A;  4OZC A;  5HFY A;  2M19 A;  3KWL A;  2LHE A;  2X38 A;  2ZW1 A;  1DGJ A;  1LO5 D;  3W5V B;  3NZ3 A;  1NVI D;  4JWU C;  2WXL A;  1E6E B;  3HUI A;  1I4R A;  2LHD A;  1F77 A;  3BZD B;  3Q8B A;  1QKZ A;  5D3I B;  1YQ4 B;  1FO4 A;  1ZE3 D;  1GPX A;  2KWD A;  5LNK 1;  1Q10 A;  1ZP0 B;  4RFB A;  2AX5 A;  2AQ2 B;  4GDK B;  1HZ6 A;  1SBB B;  2RMM A;  2K0P A;  3LYY A;  2MJE A;  1QF6 A;  4OW0 A;  1K52 A;  2GI9 A;  2W82 A;  4IKG A;  2AQ1 B;  1UUP A;  2VZK D;  2I38 A;  3BK2 A;  1CJE A;  3MHZ A;  4ZYS A;  4XE0 A;  2N9K A;  3SR6 A;  1FRR A;  3BVZ A;  3TEW A;  1SXT A;  4WWM A;  2IGH A;  5EE1 A;  1KLU D;  1VDV A;  4J3O D;  1VZ8 A;  3AE7 B;  4LLG M;  1QQR A;  1P7E A;  1SE4 A;  1I4X A;  1FM0 D;  1XCQ L;  1ZDX A;  1XLO A;  3P4Q B;  3T3N A;  2W55 A;  4YWG G;  4HRO A;  1PUT A;  1TKY A;  5AUK A;  1V1P B;  2XN9 C;  2LFI A;  1EWY C;  4JPS A;  1HQR D;  3KLS X;  2JX5 A;  4D2K A;  3EA6 A;  4KKI A;  2WQY B;  1PDX A;  1YN5 A;  2PLP A;  1D6E C;  1PGX A;  5FR3 A;  4XDD A;  4A90 A;  3VQI A;  3O13 A;  1BML C;  1AN8 A;  1CQV A;  1HZ5 A;  3EUB 2;  3OWE B;  3TEX A;  1ET6 A;  3W2D A;  4TMA B;  4P6V F;  1N62 A;  3TUO A;  1JWB D;  1FNW A;  1FXA A;  2WXG A;  3MC0 B;  3MFG A;  3U52 E;  3P4S B;  1E9M A;  1MPE A;  2YEP F;  3AE6 B;  3URY A;  4AQ7 A;  4ZRQ A;  1JCK B;  2RDG A;  4RF0 A;  5G5H A;  3EGR A;  2LJI A;  3W9C B;  4ZHP A;  1WWT A;  1A70 A;  2DBY A;  1YN3 A;  4MH8 A;  4NAW B;  3E9S A;  2J52 A;  4NJC A;  1WGK A;  3IT4 B;  1DOI A;  1OQQ A;  1TKE A;  3NVV A;  4HRS A;  1T3Q A;  5TSS A;  2Z8L A;  2WDQ B;  2WXR A;  5JXV A;  3DWM A;  3L4P A;  3PO0 A;  3NRZ A;  2I2Y A;  2TSS A;  3BII D;  4N6E B;  1I4G A;  1OFF A;  2E3T A;  1XEE A;  3Q8C A;  2WDV B;  3IAM 1;  4OZA A;  3SEB A;  2CU3 A;  1VLB A;  3ZJV A;  1EU4 A;  3AEA B;  1FFV A;  2PIA A;  1JAL A;  1SSN A;  2V3N A;  1D4B A;  1WXQ A;  1C4P A;  4IOI E;  2SEB D;  2WNM A;  3RFZ B;  1DOX A;  5HI1 A;  1EM7 A;  1R7S A;  2DYM A;  2M56 B;  1L5P A;  1HXY D;  3AEE B;  3Q8A A;  3FC4 A;  3ZYY X;  2GB1 A;  4B0E A;  1KLG D;  2HTM E;  3NVZ A;  3V05 A;  2NTT A;  1AWD A;  1L4Z B;  2LUM A;  3W1S A;  4ZHO A;  3CWI A;  3R8B A;  4C7Z A;  3NVY A;  2LEK A;  4KX6 B;  1J7A A;  4YTN B;  1MHX A;  4O1N A;  4RF1 A;  1HA5 A;  1M4V A;  1D5X C;  2OED A;  2Y5P A;  4ITK A;  1L6U A;  1C9F A;  1ZOY B;  4WAF A;  5HHD G;  2ONQ A;  1SEB D;  2M0A A;  5C3J B;  1QOB A;  2VZK B;  2CJO A;  2ICI A;  5G5G A;  2LGI A;  1MI0 A;  1Y56 A;  3HVD A;  4IDI A;  1PYW D;  4MT5 A;  3MJ5 A;  1N63 A;  1KRH A;  5FKA C;  3U7Z A;  2PVO D;  1JW9 D;  1SJH D;  4LK0 M;  3P1M A;  1FD6 A;  2BB6 A;  4YXD B;  3IXS A;  4H2A A;  2FUG 1;  3AM9 A;  2KAC A;  3VR8 B;  4PT5 A;  3AV8 A;  3MP9 A;  1IBX A;  1EWC A;  2N9L A;  1E0Z A;  3LXF A;  3RPF C;  1PFD A;  5BYR A;  1L6V A;  1QOA A;  2JU6 X;  4JE3 B;  2JSV X;  1J7B A;  2Y3A A;  3E56 A;  1QIL A;  4M0W A;  4HKQ A;  1ENF A;  5E6J A;  2KQ4 X;  2Y5C A;  4YT0 B;  4JX1 C;  2JXT A;  4L23 A;  3NVW A;  1ESF A;  1IBX B;  1B9R A;  1SJE D;  1MHH E;  1UWM A;  5H92 C;  3DWG C;  4A6Q A;  2BW2 A;  1KTK A;  4KKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...