1B22A

Rad51 (n-terminal domain)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
EEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-terminal domain of the human Rad51 protein binds DNA: structure and a DNA binding surface as revealed by NMR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA REPAIR PROTEIN RAD51
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1998-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1b22A00
4I27A 3H4DA 4EEYA 4DSKA 4KLIA 3AU2A 2FLPA 4F2RA 4KLFA 3H8WA 1JXLA 4DLGA 1ZQYA 1TK8A 4J9SA 3Q8PB 5KG1A 5KFXA 5KFSA 5KG7A 5KFBA 1HUZA 1TFRA 1Y88A 2BQRA 4J9LA 4DF8A 5KT4A 4UB2A 5KG6A 3C23A 4DL5A 2BCQA 4QZ9A 1D9DA 4GXKA 4RQ0A 4DFMA 8ICGA 2PFNA 3PR5B 3PX6A 4BXOB 4KLSA 5KT6A 4F5NA 3LDAA 3OHAA 4ECRA 3TQ1A 1BPDA 2P66A 2KZZA 4YD1A 4I2IA 3HWTA 4LVSA 4Z6CA 8ICVA 3ORYA 3SI8A 7ICEA 5BPCA 4UQGA 2ATLA 8ICZA 9ICTA 1KFTA 5DBAA 2PXIA 3PV8A 3Q8KA 3PNCA 5DGBA 4M9HA 3H7IA 1NJXA 1K1SA 3RJFA 2A1JB 2AGQA 5DDMA 2ZTDA 1UT5A 3FDSA 5BOLA 2ISOA 4KLTA 1Z00B 4DOBA 8ICXA 5DGAA 3C1YA 1SL1A 1ZQHA 1ZQIA 3GIIA 4J9QA 5IIKA 4DQRA 1ZQBA 4GC6A 2BPFA 1TV9A 4MF2A 3QZ8A 3BQ1A 2XY6A 3G6VA 3C5FA 3PO4A 4F92B 4QZ8A 3BJYA 2MAXA 4ECVA 3PX4A 1ZQKA 2KZMA 2XGQA 4J9OA 2HHVA 3HPOA 4KLOA 7ICIA 1TAQA 2VA3A 4O0IA 1ZQWA 4RQ3A 4R66A 2C2RA 3PW2A 2KZ3A 5CR0A 5DQGA 3NGDA 4QZFA 9ICXA 4GXJA 5KT7A 2IBKA 2HHSA 4M9NA 3M8RA 3LWLA 5DLFA 3QEBZ 4I2GA 4JV1A 1WCLA 1JX4A 3BDPA 5CWRA 3QEAZ 3JPPA 4UAWA 4I2AA 4GLXA 3PVXA 4JV2A 3PW7A 4YR2A 2FPLA 5F9NA 5TZVA 4M47A 3KHGA 4PHPA 5KT3A 4I2EA 4ED3A 4QWEA 3ISDA 1JN3A 3HT3A 2A1JA 3ZD9A 4QZEA 1ZETA 1D9FA 4FBUA 8ICBA 2M9NA 5CJ7A 4DSEA 4KMUA 5DQHA 3GILA 2C22A 1JMSA 1SKWA 8ICIA 4Z6EA 3TARA 4X5VA 4RQ2A 4NLGA 2I1QA 1RPLA 3NTUA 3V7KA 2XY7A 4MEYA 3ZDCA 4KN7A 4IQVA 5J2AA 3PO5A 2BDPA 1KTQA 2JZBB 4YXMA 9ICCA 5EOZA 1SL2A 2XY5A 1Z3EB 5HHHA 4ED7A 1T7PA 3GIJA 3PR4A 5J0OA 4EBCA 2R8GA 4O3PA 1QLNA 8ICJA 9ICMA 1NK9A 1L3TA 2R8IA 3KHRA 4ZH4A 4NY8A 2ISPA 3SYZA 3ETLA 2HHWA 4Q8EA 2V9WA 3B0YA 4F4WA 1QSYA 2AGPA 3M8SA 3AU6A 2W8LA 4KLGA 1ZQPA 4YMOA 3UXNA 5HMLA 7ICVA 4DWIA 7ICPA 2KTQA 3UXPA 4ECZA 1BGXT 1RXWA 1BPZA 3LWMA 4NM2A 3V7LA 5F9LA 4KLLA 9ICKA 4M6WB 3OSNA 8ICMA 1U48A 2IMWP 4ECYA 4QWBA 4ED1A 4KLUA 5EWGA 1NK4A 2VA2A 4KTQA 9ICVA 4ELTA 4UB3A 2UVRA 2MUTA 3HW8A 4JWNA 2ZUCA 1BPXA 5D46A 3ZDDA 4IQTA 4F8RA 7ICLA 2H5XA 9ICPA 4B9MA 4F3OA 4Q44A 4DL7A 1SKRA 4KLJA 4DSJA 4ECWA 2W9BB 3PW0A 1MSWD 2HVIA 5CA7A 4UB1A 4C8NA 4RZRA 3T5KA 4DL4A 2BGWA 1PZNA 4M2YA 4R8UA 1ZQLA 1L5UA 4C8KA 9ICFA 5L9XA 4RUAA 1QSLA 2J6SA 3RB6A 5JUMA 3V72A 1ZQOA 2ASLA 4MFAA 8ICUA 2FPKA 5D49A 3OHBA 4YQWA 1SKSA 3GDXA 3RH5A 8ICRA 4B9VA 4TUSA 1U4BA 3IM1A 5J2FA 4F93B 4GC7A 1XO1A 2BPGA 2UVWA 5J2HA 5IINA 5IIIA 1S0OA 3AUOA 4C8MA 1N48A 1DGSA 1KLNA 5KFEA 1C7YA 4KLMA 4I2DA 4UB4A 5DQIA 3MBYA 1ZJMA 3T5JA 4UAYA 2HW3A 5DDYA 4F5RA 4K4HA 4J9KA 7ICMA 3IHQB 4YVZA 4DQSA 5J0QA 1TVAA 1ZQFA 5DB8A 3MFIA 1ZQEA 3TFRA 2NRZA 1ZQZA 8ICYA 3C2LA 4M6WA 7ICNA 4DFJA 2J6UA 1XU4A 4LZDA 7ICOA 1QSSA 4MEXA 7ICTA 4J9PA 4NLNA 4MF8A 4ELVA 1KDHA 4JWMA 4UB5A 2BPCA 2HHXA 5DG8A 5EWEA 4F4YA 3GIKA 1KRPA 1COOA 1S77D 1DOQA 2DFLA 3JPNA 5J2JA 8ICEA 3ISBA 2ZUDA 1S0MA 3TANA 1X9WA 3RH6A 2PI4A 4IR9A 2JEGA 1NKBA 5IILA 3RR7A 4BGDA 4B9SA 4M0AA 4YN4A 1RXVA 4QZGA 3RAQA 3K75D 5C5JA 3FYHA 4PGYA 3PW4A 2R8KA 7ICGA 5KFFA 3MR5A 1HUOA 4DL2A 4P4PA 4XRHA 4DSIA 1TK0A 3EPGA 1RYRA 3C2KA 2B21A 4YFKA 5KFPA 4PHEA 1ZQSA 5J2GA 2BCUA 3V7JA 5DLGA 5KG4A 1L3SA 2PI5A 4I2BA 5KFKA 2NRXA 3RH4A 2KFNA 4EYIB 1ZQTA 2OWOA 4EBDA 3RJEA 4DFKA 4ELUA 5J2DA 3PMLA 3GV5B 7ICJA 4PPXA 5IIJA 2F1JA 4RQ4A 1S10A 1LB2B 8ICHA 7ICUA 7ICKA 4F4KA 4QZIA 1ZQDA 4XQ8A 3RAXA 3Q8RB 1BPEA 5J0XA 5DB9A 4QZHA 4KN4A 2DPIA 1S76D 3M9NB 4J9NA 1S0VA 8ICTA 5KTQA 4F5PA 4IR1A 3RBDA 9ICUA 4DOAA 3RR8A 3MGIA 4DS5A 4RPXA 1LV5A 3H8JA 3GQCA 8ICSA 2F1HA 4YCXA 5IIMA 1RZTA 4QZCA 7ICSA 3N97B 4Q45A 5BOMA 2NRVA 3TAQA 4QZDA 3Q8SB 4FBTA 2XCAA 3PW5A 4NM1A 8ICOA 4XA5A 1UA0A 2AU0A 2FMQA 1U47A 2UVVA 4TUQA 4O5KA 2W9CA 1NK6A 4Q43A 4C8LA 1T8EA 5J0TA 3Q8QB 4MFFA 4CCHA 2W9CB 4FS1A 3EZ5A 2JEJA 2NRWA 1XSPA 3BQ2A 2FMPA 4JK1A 1QTMA 5KFMA 3RJKA 1EXNA 5CHGA 4BWJA 2R8HA 4R64A 1S0NA 4BXOA 4QWDA 3JPRA 4NLKA 4QW9A 4P4OA 5J0UA 2W9MA 4YR0A 4F5OA 1NKCA 1ZQCA 3SZ2A 4ED8A 2FPMA 4P2HA 4TQSA 9ICIA 5KFZA 3V6HA 3QE9Y 5DBBA 4EYHB 3ZDAA 3RJJA 2AJQA 1IXRA 3GFKB 4DF4A 7ICRA 3PMNA 4DOCA 4YD2A 3RBEA 2AQ0A 4ECXA 4F2SA 5EWFA 3EPIA 8ICKA 4IRCA 4DO9A 1ZQVA 2P6UA 2AGOA 4KLHA 9ICRA 2VA8A 4PGXA 3OJUA 5KFRA 4GXIA 4DSFA 5HMMA 1MQ2A 4ECSA 5KFVA 4KITB 2DPJA 4RQ7A 1JIHA 5KFHA 2J6TA 2KN7A 2RDJA 4Z6FA 1D8LA 2C2DA 1AROP 4NXZA 1ZQXA 3N4MB 3EYZA 4FO6A 3UXOA 4DLEA 3RRGA 3C21A 2BR0A 1NOMA 5D4BA 1X2IA 3MR2A 1S97A 1ZQMA 1BVSA 4RPZA 4F4ZA 2FLLA 2ZTCA 3OJSA 5KFQA 5KG5A 4QWCA 5J0SA 5J29A 3ISCA 9ICJA 3C1ZA 2BQ3A 3RJHA 5J2EA 1U49A 2JEIA 4YMNA 4F50A 3UQ0A 2BCSA 4PGQA 4I2HA 3ZDBA 3RB3A 4KLQA 2KFZA 1T3NA 4UAZA 4J9MA 3GV7B 3SV4A 1B22A 2W9AA 3G6YA 4E0DA 3MGHA 3MR6A 5KFYA 1ZJNA 3M9OB 4ED6A 3TI0A 4P4MA 5J2CA 9ICWA 1N56A 3MR3A 2ZJ8A 3KHLA 5DBCA 3Q8MA 4NLZA 5KFJA 4RQ5A 2XGPA 2ZTEA 1NK5A 2FLNA 1RYSA 2I9GA 2IA6A 3KTQA 1XSLA 4TQRA 4TUPA 4KLDA 5KG0A 2HHQA 3H40A 3PX0A 3EWAA 8ICNA 1Z00A 3MFHA 3MABA 1JXEA 1H38A 3V6KA 4B9TA 4C8OA 4I29A 4M9LA 3BQTA 2R8JA 5KT2A 4RT3A 3UPQA 4M04A 2LYHA 5DKWA 3OGUA 4QW8A 4F5QA 4XUSA 4B9UA 4G3IA 3BQ0A 9ICHA 1ZQUA 4RQ8A 5L1KA 1XWLA 5KFWA 3MDAA 3B0XA 3TFSA 4YG2A 2BCVA 4ECQA 1CEZA 3T5LA 1S9FA 5CP2A 1XS9D 4YMMA 2F1IA 1XC9A 1MQ3A 4BWMA 4DSLA 5HP4A 4O3RA 4QZAA 2HHTA 1B43A 1U9LA 2PFPA 3ZD8A 3RB0A 5CB1A 1X9MA 1TKDA 4PH5A 4UBBA 4B9NA 1KFDA 2AQ4A 4K4IA 3E2EA 2HVHA 5DB6A 1NJWA 5KFCA 3K4GA 3ZDEA 2XC9A 1SZPA 5HNKA 4R63A 4FS2A 1XSNA 5KFTA 5KFAA 3RRHA 3T5HA 2JZBA 9ICEA 5IIOA 8ICPA 1A77A 1CUKA 8ICQA 1TAUA 5L1LA 4ECTA 2VANA 4DEZA 4HYKA 5KFNA 4TURA 3C2MA 1KSPA 4MFCA 9ICAA 4F4XA 2W8KA 4O5EA 5KG2A 4YR3A 2IHMA 5KFOA 2Y1IA 2P6RA 4IQUA 4RNOA 4RU9A 1ZQAA 4O3NA 3Q8LA 3HX0A 3H8SA 9ICGA 9ICQA 4LZGA 4RUCA 4ED2A 4I28A 2C2EA 1BPYA 4Q8FA 5KFGA 8ICWA 2ASDA 1V9PA 4O3SA 4EZ9A 5L1IA 2HHUA 5KG3A 5J2BA 1BPBA 1NKEA 8ICLA 1NJYA 4I2CA 3JPTA 5J0PA 3RTVA 5KFDA 4O5CA 4O3OA 1NK7A 2RDIA 1WCNA 4F91B 1D8YA 1A76A 2Q0ZX 3JPOA 4K4GA 4B9LA 7ICFA 2ZUBA 3KHHA 1L3VA 4ECUA 4RNNA 2W9BA 2V4QA 3HP6A 3TAPA 8ICAA 1U45A 4I2JA 2PFOA 3UQ2A 5J0YA 2NRTA 9ICLA 9ICSA 5HHIA 2MUTB 1ZQJA 2ZJAA 5L1JA 4DS4A 2Y1JA 2PFQA 4IRDA 4YP3A 2C28A 9ICOA 1ZQGA 1HJPA 2UVUA 3QZ7A 8ICFA 1KEJA 3SV3A 7ICHA 1UT8A 3EW9A 5DG9A 3C5GA 4KLEA 4R65A 2GWSA 5J2IA 4EZ6A 1IM4A 4QWAA 3H4BA 3THVA 4DFPA 4EBEA 3JPSA 4IRKA 3RJGA 1ZQRA 4BDPA 4PHAA 2FMSA 4RNMA 5J2KA 1ZQNA 4I2FA 3PY8A 9ICBA 5J0WA 2JEFA 5KFUA 4Z6DA 5KT5A 2BCRA 4M9JA 2BHNA 4PHDA 4DL3A 1K1QA 1T4GA 4JV0A 2BKEA 1ZYQA 1NK8A 1SL0A 3LK9A 2V4RA 2BQUA 4JUZA 1X9SA 4M9GA 7ICQA 4RQ6A 2IHNA 3MDCA 4ED0A 3JPQA 1UA1A 2ZJ5A 4YXJA 4R8UB 3V6JA 3M9MB 4RPYA 3GV8B 5J0RA 4RT2A 5DG7A 1L3UA 1ZQQA 1MC8A 3RJIA 3OSPA 4QZBA 4UBCA 1KFSA 4DQQA 2XO7A 1NJZA 3T3FA 5KFIA 3RB4A 3G6XA 1TK5A 5KFLA 9ICNA 4RQ1A 4J9RA 8ICCA 5DB7A 4DQIA 2WTFA 4IQWA 4O9MA 2ASJA 4O3QA 1NK0A 2XCPA 4DQPA 3GIMA 2ALZA 4DL6A
chains in the Genus database with same CATH superfamily
4DSKA 1RM6C 4C0ZA 5L1MA 4DLGA 1ZQYA 5KG1A 2F8KA 5KFSA 5KG7A 1TFRA 1Y88A 2BQRA 4J9LA 2KNJA 2GH1A 4DF8A 4UB2A 1CI4A 1D9DA 3KZIU 1MN8A 2G06A 3PR5B 3PX6A 1B4FA 1SWWA 2NO5A 3F2CA 2KZZA 4YD1A 3HWTA 7ICEA 2AXTU 5BPCA 2ATLA 9ICTA 3Q8KA 3PNCA 5DGBA 1NJXA 3H0RB 2A1JB 2AGQA 2ZTDA 2AH5A 4KLTA 2ISOA 1DRGA 2F3NA 2RHFA 1SL1A 1ZQHA 4DQRA 4J9QA 3QU5A 4GC6A 2BPFA 4MF2A 4FFDA 3G6VA 1OXJA 1X9XA 3C5FA 4QZ8A 2MAXA 2A3VA 2HMXA 3QX7A 2HHVA 3HPOA 1TAQA 3GZFA 2KZ3A 4NLCA 1V85A 2IBKA 5KT7A 4M9NA 3QEBZ 1Z4NA 3DDHA 4I2GA 1JX4A 5CWRA 3QEAZ 5KAFU 3PW7A 5AM2A 1SV0C 4M47A 3VCBA 4PHPA 1LVHA 5KT3A 2HBMA 1O08A 3SQIA 4ED3A 1SV0A 3ISDA 1JN3A 1ZETA 5EE3A 3L5KA 4UARA 1JMSA 1SKWA 4F71A 1RPLA 3NTUA 3ZDCA 4KN7A 4IQVA 4CF5A 4YXMA 1Z3EB 5HHHA 3GU3A 3GIJA 4O3PA 8ICJA 5ALJA 1IG6A 2KV2A 2K4EA 3KHRA 4EELA 4ZH4A 2EZYA 3ETLA 4JB3A 2KSOA 5AM5A 4KLGA 4NLBA 2JHDA 5HMLA 4DWIA 7ICVA 1RG6A 3UXPA 4ECZA 5F9LA 1X6JA 4OJOA 2LMRA 3C28A 4PZOA 1NK4A 2ZIUA 3AN1A 4KTQA 4ELTA 2UVRA 1BPXA 4F8RA 4IQTA 4B9MA 4Q44A 4DL7A 4KLJA 4DSJA 4OJPA 2Q4TA 1ZOLA 2JH7A 3UMCA 4CF3A 4M2YA 4R8UA 1ZQLA 1L5UA 2BDUA 3QNMA 5L9XA 2LYAA 1Q3VA 3K1RB 8ICUA 5D49A 3OHBA 1SKSA 5AKZA 3DEEA 4B9VA 2ZIVA 1U4BA 3IM1A 5AKEA 5J2FA 4F93B 2KIVA 1OUQA 5IIIA 3AUOA 5AI5A 4UB4A 2CXYA 4UAYA 2HW3A 5DDYA 4K4HA 1TVAA 2JGAA 1ZQEA 3ALRA 3TFRA 1ZQZA 3ED5A 4DFJA 2KMDA 3QUCA 5AK4A 5EWEA 4F4YA 3GIKA 1VLBA 4EX7A 2DFLA 1V97A 1S0MA 3RH6A 5FP0A 3RR7A 1O03A 2FI1A 2R8KA 4DSIA 3EPGA 5ALLA 1RYRA 1WWVA 4EBDA 4DFKA 5AKKA 5IIJA 2E8MA 2YB4A 1ZQDA 2G0AA 4QZHA 1RQLA 4UASA 2KJ9A 9ICUA 2EAPA 3HJEA 4RPXA 3H8JA 7ICSA 3N97B 3TAQA 3IN5A 1QQ6A 3PW5A 8ICOA 2E1FA 3QYPA 1U47A 4TUQA 2K60A 4EEKA 4C8LA 1T8EA 2H3ZA 4UAVA 2FMPA 2DKZA 5KFMA 4EENA 1VDVA 2W04A 4OJLA 3H8MA 4QWDA 3JPRA 3CYMA 4P4OA 5J0UA 2W9MA 4F5OA 4P0QA 4TQSA 5KFZA 3V6HA 2YMMA 3SR6A 3ZDAA 4DF4A 4DOCA 4ECXA 3RF9A 8ICKA 4KLHA 2A19A 4PGXA 5KFRA 4ECSA 2JH1A 5KFVA 4BX9C 2RDJA 2C2DA 4OCZA 1AROP 3N4MB 3A0HU 3UXOA 4DLEA 3SAFA 3C21A 2HI0A 4RPZA 3D6JA 3OJSA 4QWCA 1QH9A 4US9A 5KL8B 3C1ZA 3NVVA 3RJHA 5ALGA 1SZHA 3UQ0A 4PGQA 4I2HA 2KFZA 4J9MA 1L8LA 4P0PB 3BS5B 4E0DA 4OD0A 4ED6A 1A0PA 3TI0A 3MR3A 4RQ5A 1XSLA 3H40A 3MGVA 3PX0A 8ICNA 4G9BA 1H38A 3MABA 3H0LB 4I29A 4M9LA 4NL9C 5KT2A 3UPQA 4M04A 5DKWA 4B9UA 3NUQA 3B0XA 2EANA 1S9FA 2LI6A 5CP2A 2B6GA 2F1IA 3N7SC 1MQ3A 4DSLA 3TKAA 5ALIA 4AYBF 5ALOA 3ZD8A 3RB0A 1TKDA 4UBBA 3E2EA 2Y0SC 4K4IA 3BZKA 3K4GA 2XC9A 5HNKA 4FS2A 1XSNA 2ZXHA 1A77A 1KN5A 1KSPA 2RRDA 5KFNA 3WK5A 3ZI4A 2W8KA 4O5EA 2P6RA 5CRXA 2Y1IA 4RU9A 4O3NA 3HX0A 3H8SA 9ICGA 4LZGA 4ED2A 1BPYA 2ASDA 1Z19A 5K4LA 5L1IA 8ICLA 3C29A 3L3FX 4CDGA 5KFDA 4FZMA 4O3OA 2RDIA 1A76A 2Q0ZX 4B9LA 7ICFA 3KHHA 4ECUA 2W9BA 2V4QA 3HP6A 3TAPA 3BZCA 9ICSA 4IRDA 2ZJAA 4Y2TA 1KEJA 1UT8A 3THVA 2HOQA 2EH9A 5KFUA 5KT5A 2BHNA 4JV0A 1NK8A 3LK9A 2V4RA 2BQUA 3WKEA 3JPQA 3V6JA 4CF4A 4CGZA 4DQQA 1NJZA 2KE7A 2E8PA 5AIAA 3G6XA 3AL0B 4RQ1A 4J9RA 8ICCA 4O9MA 4DQIA 2G09A 3HKZF 1J97A 4DL6A 2QLTA 3QU7A 1WUDA 5E79U 1YT3A 1KW4A 1TK8A 4P0PA 3QU9A 5EE1A 5KT4A 2BCQA 1PVRA 4BXOB 4F5NA 4ECRA 1N60A 3A0BU 1MA7A 5ALMA 3ORYA 1JALA 1KFTA 2QARA 2PXIA 3PV8A 4M9HA 3RJFA 1ZD3A 3FDSA 4DOBA 3C1YA 5IIKA 3N28A 4ICAA 3BQ1A 3BJYA 5AKHA 3UMBA 3PX4A 2HSZA 4QIWF 4KLOA 7ICIA 2VA3A 2IOFA 4O0IA 1ZQWA 4RQ3A 2XI9A 5CR0A 3SD7A 2KHVA 4QZFA 4Y2QA 3QXGA 3LWLA 4Y2VA 3BDPA 4JV2A 4YR2A 1YZ6A 1N2XA 4I2EA 2Y0SF 3HT3A 5JTIA 4QZEA 4FBUA 5AM0A 5CJ7A 4DSEA 4KMUA 1J2NA 3GILA 2G5HB 4NLGA 2I1QA 3V7KA 4Y2RA 3PO5A 1JROA 1KTQA 2BDPA 9ICCA 2VKQA 1SL2A 2MU2A 2XY5A 3SENA 4EBCA 1NK9A 1N62A 2KVSA 5J8YC 2ISPA 3SYZA 2E1EA 4IC9A 3LYSA 1QSYA 2AGPA 3UXNA 1HIWA 2KTQA 1RXWA 1BPZA 3LWMA 9ICKA 4KLLA 4M6WB 3OSNA 4C7YA 4KLUA 3NASA 3HW8A 5ALZA 5D46A 4QNLA 4C7ZA 9ICPA 4F3OA 1NZBA 1SKRA 2H3IA 3KFUF 1D8BA 4C8NA 2BGWA 1QSLA 3V72A 5AKJA 3GDXA 5ALWA 4GC7A 1XO1A 5J2HA 1VJ5A 2EZZA 3IRUA 1DGSA 1KLNA 4KLMA 3MBYA 1ZJMA 5DQIA 2VIXA 4F5RA 7ICMA 2PMZF 4J9KA 4YVZA 3E58A 2YQEA 5J0QA 5DB8A 3F5EA 2NRZA 1BNPA 4M6WA 1XU4A 2K4PA 3L4PA 4J9PA 4NLNA 2BPCA 2CPRA 3SAHA 1KRPA 1COOA 1JRPA 2ZUDA 3O0FA 1ZRMA 4IR9A 1JI7A 2ZG6A 4M0AA 4YN4A 1RXVA 3TADC 2ES6A 4PGYA 3PW4A 4DL2A 1T3QA 1UHUA 4RQMA 1TK0A 1Q46A 4BJQA 1ZQSA 2FE9A 3V7JA 5KG4A 5KFKA 3RH4A 2KFNA 1HEKA 1ZQTA 4ELUA 2IOHA 3GV5B 1X42A 1SXDA 3K1ZA 2PKEA 2F1JA 2WAQF 4RQ4A 5AKXA 2YMQA 2DGZA 4XQ8A 5J0XA 1S76D 4KN4A 4NJ8A 4KX5A 3WK8A 3BS5A 1FEZA 2KVCA 2DPIA 4IR1A 3RBDA 2W55A 4DS5A 2WF8A 3KOOA 2ZIWB 5ALFA 2NRVA 4PJ0U 3Q8SB 4FBTA 2XCAA 4NM1A 4XA5A 2YMLA 3RFAA 2AU0A 1UA0A 2FMQA 4MHVA 3VC8A 1NK6A 4Q43A 3DV9A 4CCHA 4FS1A 2KP7A 5KAIU 3BQ2A 3ETRA 1M6YA 2E8OA 2R18A 1EXNA 5CHGA 4BWJA 4R64A 1NKCA 2K4HA 1K5OA 3SZ2A 9ICIA 2M0NA 3QE9Y 2KEYA 7ICRA 1IXRA 3GFKB 3PMNA 2AQ0A 5TISU 5ALYA 1ZQVA 2P6UA 4BUGA 2VA8A 4DSFA 5HMMA 1MQ2A 2E8NA 2DQNB 5B5EU 4RQ7A 3TACB 3I1YA 1D8LA 1ZQXA 4DFDA 2BR0A 1NOMA 2JRZA 2FLLA 1L6NA 2ZTCA 5KG5A 5J29A 3ISCA 9ICJA 2BQ3A 5ALXA 2KKVA 1DGJA 5AK3A 2K8BB 5JRTA 3M6ZA 3GV7B 3G6YA 3MR6A 1ZJNA 5J2CA 2OEHA 1L8OA 2ZJ8A 5KFJA 2FLNA 1RYSA 3F2DA 5KG0A 1WWUA 3MFHA 1JXEA 5KNIA 2KHQA 5AM4A 2R8JA 3ICXA 3LVVA 5G5HA 5AK6A 2OH2A 2LYHA 4F5QA 3BQ0A 3BQ7A 3WK9A 5L1KA 3N7RC 4Y2YA 5KFWA 3MDAA 2BCVA 1CEZA 3T5LA 1XC9A 4P0QB 2K8AA 4U7CA 2PFPA 1X6IA 5CB1A 5DB6A 4RQNA 5KFAA 2JZBA 9ICEA 2F8LA 5IIOA 5AI4A 1CUKA 2VANA 4HYKA 3C2MA 9ICAA 4JMUA 4F4XA 1FFVA 4YR3A 3BS7A 2IHMA 4RNOA 1ZQAA 3Q8LA 9ICQA 4RUCA 8ICWA 4DCCA 1V9PA 4OO1J 5J2BA 1BPBA 1NKEA 1Q8KA 1NJYA 4I2CA 3S6JA 4O5CA 1PK3A 2DUYA 4F91B 1D8YA 3M6KA 3SMVA 3JPOA 4K4GA 3FM9A 2PFOA 3UQ2A 5J0YA 3B9JA 2WF6A 5HHIA 2MUTB 4CNQA 1RQNA 2PFQA 1ZQGA 4US8A 1QCKA 2UVUA 8ICFA 7ICHA 4KLEA 5AM1A 5G5GA 4DFPA 4EBEA 2WAQC 2ZIXB 4F72A 1L7MA 2FMSA 1ZQNA 4M9JA 4C4SA 1K1QA 1X9SA 4RQ6A 1UA1A 2XIDA 3M9MB 4RPYA 1L3UA 4QZBA 1KFSA 2LHTA 4WJ3B 2WF5A 2NV3A 2ASJA 1ZRNA 4I27A 3H4DA 4EEYA 4KLIA 2FLPA 4KLFA 3H8WA 2HBKA 5KFBA 1HUZA 1ZD2P 2W7OA 4DL5A 3C23A 2MSNA 4QZ9A 5H2FU 3OTQA 5KT6A 4C4TA 3OHAA 3TQ1A 2OXOA 8ICVA 4LVSA 4Z6CA 1ECWA 3SI8A 5DBAA 3H7IA 1K1SA 5DDMA 3WK6A 5BOLA 1Z00B 8ICXA 4PL2A 5DGAA 1N63A 1UCVA 1ZQBA 2A1AA 3QZ8A 2OCEA 2XY6A 1AQ6A 3PO4A 4F92B 4ECVA 2MA1A 3QU2A 5AICA 2AHOB 5DQGA 2WHEA 1IIPA 3M8RA 5DLFA 4JV1A 1WCLA 5AHXA 3UMGA 2RP5A 4UAWA 4I2AA 3PVXA 2FPLA 5F9NA 5TZVA 5EE9A 2W3SA 4QWEA 3IDWA 1D9FA 2VJ5A 2M9NA 2C22A 4Z6EA 3IG5A 2XY7A 1NNLA 1ZD4A 4MEYA 2JZBB 5ALKA 2VJ4A 1QLNA 9ICMA 3M1YA 1X66A 4NY8A 3WKBA 2HHWA 4Q8EA 2V9WA 5AI8A 4F4WA 5GTHU 4YMOA 3KZXA 2O6KA 1BGXT 3V7LA 3FC4A 8ICMA 4OJ6A 1U48A 4ECYA 4QWBA 4ED1A 9ICVA 2HCFA 4UB3A 2MUTA 3U26A 2ZUCA 3ZDDA 2P35A 1UPHA 2OM6A 2W9BB 3PW0A 2FDRA 2HVIA 4RZRA 3T5KA 1PZNA 2DF4B 2WB1F 2J6SA 2W7PA 3RB6A 4MFAA 2FPKA 3AMZA 3WK7A 3CP8A 3RH5A 8ICRA 4TUSA 2BPGA 4U6PA 1B0XA 3F5AA 1S0OA 4C8MA 1N48A 5KFEA 1C7YA 4I2DA 2W54A 3T5JA 1Q3UA 5AKGA 1DK2A 1ZQFA 1J2MA 1FO4A 8ICYA 7ICNA 3AQEA 2J6UA 4LZDA 7ICOA 1QSSA 4MEXA 7ICTA 4ELVA 2L5YA 5DG8A 1S77D 8ICEA 3TANA 2PI4A 2JEGA 3CW2C 2DL0A 4QZGA 3IG8A 3RAQA 2HBJA 3K75D 3FYHA 1QQ5A 3MR5A 1HUOA 3C2KA 3AEVA 2B21A 4A8EA 5DLGA 2KD1A 1PVPA 1L3SA 5ALUA 2NRXA 4EYIB 2OWOA 1PUZA 3RJEA 1FIQA 1L7NA 1S10A 7ICUA 4F4KA 3RAXA 1BPEA 5DB9A 2HOFA 3M9NB 4J9NA 8ICTA 4F5PA 3MGIA 3GQCA 4YCXA 5IIMA 4Q45A 1UQVA 4QZDA 3OPXA 1LKYA 3CRXA 2E3TA 1C20A 2QB0B 1KQQA 5J0TA 3Q8QB 2W9CB 2JEJA 2NRWA 1XSPA 3NVYA 4JK1A 3RJKA 5ALNA 3UM9A 4BXOA 4YR0A 3WK4A 4P2HA 2LBOA 5ALQA 3QUQA 5DBBA 4YD2A 3RBEA 5AKLA 5EWFA 3EPIA 2G08A 3NVZA 2AGOA 9ICRA 3HRDD 3OJUA 4GXIA 2JV3A 3NS1A 1KBUA 1ZQ1C 3WKAA 3LVWA 1PK1B 5AKYA 1JIHA 2KN7A 4Z6FA 5EE0A 2YX8A 4UB6U 3MC1A 4NXZA 2DKXA 3EYZA 4CRXA 1DXSA 1ZQMA 1BVSA 4F4ZA 2D6FC 1F5SA 5J2EA 4QJFB 5AI6A 4ZOHC 1TAMA 1WYGA 2BCSA 3ZDBA 4FE3A 2WFAA 4KLQA 2D8CA 4UB8U 1T3NA 3SV4A 2JR5A 3MGHA 3EUB2 5KFYA 2KJ8A 2YB1A 4P4MA 3F2BA 1S8OA 1N56A 5DBCA 3Q8MA 4NLZA 1TE2A 1NK5A 5AI9A 2HHQA 2JMGA 3EWAA 4B9TA 3V6KA 4C8OA 4AYBC 3T79A 4QW8A 4RQ8A 1XWLA 3KBBA 4YG2A 2GOLA 4ECQA 1ZXIA 1XS9D 4YMMA 1WG8A 2K89A 4QZAA 1B43A 2ZIVB 3KKAA 3PZPA 1Z1BA 2K8CB 1X9MA 4PH5A 2HVHA 4B9NA 3M7DA 2ODGA 1NJWA 3ZDEA 1F0MA 1SZPA 2RQ5A 4CE6A 4R63A 5KFTA 3T5HA 8ICQA 4MFCA 5KG2A 5ALTA 2LKYA 4Q8FA 2DBYA 5ALRA 1X40A 2HHUA 5KG3A 3JPTA 5J0PA 3RTVA 1NK7A 1WCNA 1L3VA 4RNNA 8ICAA 1U45A 2G5IB 4I2JA 4UATA 2ZIXA 5L1JA 4YP3A 2C28A 3KD3A 1HJPA 2HDOA 3QZ7A 5DG9A 5J2IA 1IM4A 5ALPA 4QWAA 2F44A 2KG5A 4BDPA 4PHAA 4RNMA 2MRLA 4I2FA 5J0WA 2BCRA 4DL3A 1T4GA 2BKEA 1SL0A 4JUZA 4M9GA 1YZ7A 3MDCA 2YTUA 2ZJ5A 2EDUA 2F2AB 4YXJA 4R8UB 3GV8B 1RYUA 5J0RA 1ED1A 4UBCA 3T3FA 5KFIA 1TK5A 5KFLA 9ICNA 2NO4A 5DB7A 4IQWA 2PMZC 4O3QA 1NK0A 2XCPA 3GIMA 5B66U 5GTIU 3QUBA 5ALVA 2F77X 3AU2A 4GFJA 4F2RA 1JXLA 4J9SA 2KSOB 2Y9UA 3Q8PB 4USAA 2EAMA 5KFXA 3WU2U 2Y9TA 3FAHA 1Z1VA 4B6JA 5KG6A 4GXKA 4RQ0A 3CNHA 4DFMA 8ICGA 2PFNA 5ALSA 2XICA 2W3RA 4Y2XA 4KLSA 3LDAA 1BPDA 2P66A 4I2IA 8ICZA 4UQGA 2KOBA 2YN4A 3H0MB 1UT5A 1SIJA 1ZQIA 3GIIA 3E0FA 1DK3A 1TV9A 1JUDA 2EQYA 4PZNA 1ZQKA 2KZMA 3NVWA 2XGQA 5ALHA 4J9OA 2BZFA 2C2RA 4R66A 3PW2A 4Y2UA 3NGDA 2G07A 2YY6A 9ICXA 4GXJA 2HHSA 3JPPA 4GLXA 3KHGA 3QUTA 4C80A 2A1JA 1URJA 3ZD9A 1SGGA 8ICBA 4LJXA 5DQHA 8ICIA 3TARA 3TADA 2QKQA 2Z7JA 4X5VA 4RQ2A 4ACOA 5J2AA 2ZXIA 2RLTA 2YMPA 5EOZA 3D2SA 4ED7A 1T7PA 3PR4A 5J0OA 2R8GA 1L3TA 2R8IA 3J81j 2D3DA 1V38A 3B0YA 3M8SA 2E5SA 2W8LA 3AU6A 1ZQPA 7ICPA 2FJ6A 4NM2A 4C4RA 2IMWP 4FZNA 5AK5A 5EWGA 2VA2A 7ICLA 4JWNA 4AP9A 4NV0A 2H5XA 4ECWA 1MSWD 1LKYB 3I76A 5CA7A 4UB1A 4FZLA 4DL4A 4OJ5A 3IV6A 4C8KA 9ICFA 3R9KA 5AI0A 5AKIA 3D2QA 1FFUA 4RUAA 4Y2PA 2CRXA 5JUMA 1ZQOA 3HILA 2ASLA 1Z4OA 4YQWA 5AM3A 2UVWA 2NYVA 3QU4A 5IINA 3SAGA 3PSTA 1A6SA 3PSFA 5A0LA 3IP4B 3IHQB 4DQSA 2WF7A 3MFIA 3C2LA 2GO7A 2WF9A 5JU5A 1ZD5A 2W11A 2KKPA 4MF8A 1KDHA 4UAUA 3WKCA 4UB5A 4JWMA 2HHXA 1DOQA 5J8YA 4O3MA 3WKDA 5J2JA 3JPNA 3ISBA 1X9WA 4IL6U 1NKBA 5IILA 4BGDA 4B9SA 5C5JA 7ICGA 1QQ7A 1NI3A 5KFFA 3ONNA 2ESEA 4P4PA 4XRHA 5T14A 4YFKA 5KFPA 4PHEA 5J2GA 2BCUA 2HOIA 1BNOA 2PI5A 4I2BA 5CEHA 2QARB 5J2DA 1SV4A 4GIBA 3PMLA 7ICJA 1GO3F 4PPXA 1PVQA 1LB2B 3NRZA 8ICHA 7ICKA 1IV8A 4QZIA 3Q8RB 1S0VA 5KTQA 2EAOA 4DOAA 3RR8A 8ICSA 1LV5A 2OHFA 2F1HA 1RZTA 4QZCA 5BOMA 1S5LU 1SWVA 2KICA 2I5HA 1CRXA 2UVVA 4O5KA 2W9CA 2QB1A 2EZXA 4MFFA 2H3QA 3EZ5A 1P7DA 1QTMA 1COKA 2R8HA 1OW5A 1S0NA 4NLKA 4QW9A 1ZQCA 1KKXA 4ED8A 2FPMA 5AIBA 4NL9A 2LPEA 2KIWA 4QIWC 4EYHB 3RJJA 2AJQA 2KK0A 4F2SA 1PK1A 4IRCA 4DO9A 3AQFA 3HKZC 4KITB 2DPJA 5KFHA 2J6TA 1RDFA 4KX3A 2WB1C 4FO6A 3RRGA 4Y2JA 5D4BA 1X2IA 3MR2A 1S97A 2I6XA 5KFQA 5J0SA 2GLEA 2LYBA 2JEIA 1U49A 4YMNA 1XO0A 4F50A 2ZIWA 1N61A 3RB3A 1T94A 4UAZA 1F44A 1L7OA 3I28A 1B22A 2W9AA 1N5WA 2K4IA 3PSIA 3M9OB 2W43A 9ICWA 2QB0A 3KHLA 2I9GA 2XGPA 2ZTEA 2DWQA 3KTQA 2IA6A 4KLDA 4TQRA 4TUPA 1Z00A 2XVTA 3BQTA 2OYYA 2W03A 2IOFK 4RT3A 3SEIA 3OGUA 2ZIUB 4XUSA 4HAIA 4G3IA 9ICHA 1NZPA 3NRWA 1ZQUA 3TFSA 4BWMA 4J03A 5HP4A 4O3RA 2HHTA 5ALDA 1U9LA 2LM1A 1KFDA 4PL1A 2AQ4A 5KFCA 3KKAC 3RRHA 1L7PA 8ICPA 5F3XB 1TAUA 2LM4A 1SB3C 5L1LA 4ECTA 4DEZA 4TURA 1XNSA 3D2NA 5KFOA 2B0CA 2JXJA 4IQUA 2HBLA 4I28A 2C2EA 5KFGA 4O3SA 4EZ9A 4Y2SA 3PSPA 2KJ5A 4NWIA 5HR6A 2F76X 2ZUBA 9ICLA 2NRTA 1ZQJA 2H3FA 2Y1JA 2H3VA 4DS4A 9ICOA 3SV3A 3F53A 3EW9A 3C5GA 4IS7A 4KMOB 4R65A 2GWSA 3AM9A 4EZ6A 3H4BA 3N7PD 3JPSA 4IRKA 3RJGA 1ZQRA 1N5XA 5HR7A 5J2KA 4UW9A 3PY8A 9ICBA 2JEFA 4Z6DA 1KL9A 4PHDA 1ZYQA 5C0YA 7ICQA 2IHNA 2N1RA 4ED0A 4RT2A 5DG7A 4EX6A 1ZQQA 1MC8A 3RJIA 3OSPA 2XO7A 2CN1A 5KL1B 3RB4A 5ALEA 1SXEA 2WTFA 4DQPA 2ALZA
chains in the Genus database with same CATH topology
4I27A 3H4DA 4EEYA 4DSKA 4KLIA 3AU2A 2FLPA 4F2RA 4KLFA 3H8WA 1JXLA 4DLGA 1ZQYA 1TK8A 4J9SA 3Q8PB 5KG1A 5KFXA 5KFSA 5KG7A 5KFBA 1HUZA 1TFRA 1Y88A 2BQRA 4J9LA 4DF8A 5KT4A 4UB2A 5KG6A 3C23A 4DL5A 2BCQA 4QZ9A 1D9DA 4GXKA 4RQ0A 4DFMA 8ICGA 2PFNA 3PR5B 3PX6A 4BXOB 4KLSA 5KT6A 4F5NA 3LDAA 3OHAA 4ECRA 3TQ1A 1BPDA 2P66A 2KZZA 4YD1A 4I2IA 3HWTA 4LVSA 4Z6CA 8ICVA 3ORYA 3SI8A 7ICEA 5BPCA 4UQGA 2ATLA 8ICZA 9ICTA 1KFTA 5DBAA 2PXIA 3PV8A 3Q8KA 3PNCA 5DGBA 4M9HA 3H7IA 1NJXA 1K1SA 3RJFA 2A1JB 2AGQA 5DDMA 2ZTDA 1UT5A 3FDSA 5BOLA 2ISOA 4KLTA 1Z00B 4DOBA 8ICXA 5DGAA 3C1YA 1SL1A 1ZQHA 1ZQIA 3GIIA 4J9QA 5IIKA 4DQRA 1ZQBA 4GC6A 2BPFA 1TV9A 4MF2A 3QZ8A 3BQ1A 2XY6A 3G6VA 3C5FA 3PO4A 4F92B 4QZ8A 3BJYA 2MAXA 4ECVA 3PX4A 1ZQKA 2KZMA 2XGQA 4J9OA 2HHVA 3HPOA 4KLOA 7ICIA 1TAQA 2VA3A 4O0IA 1ZQWA 4RQ3A 4R66A 2C2RA 3PW2A 2KZ3A 5CR0A 5DQGA 3NGDA 4QZFA 9ICXA 4GXJA 5KT7A 2IBKA 2HHSA 4M9NA 3M8RA 3LWLA 5DLFA 3QEBZ 4I2GA 4JV1A 1WCLA 1JX4A 3BDPA 5CWRA 3QEAZ 3JPPA 4UAWA 4I2AA 4GLXA 3PVXA 4JV2A 3PW7A 4YR2A 2FPLA 5F9NA 5TZVA 4M47A 3KHGA 4PHPA 5KT3A 4I2EA 4ED3A 4QWEA 3ISDA 1JN3A 3HT3A 2A1JA 3ZD9A 4QZEA 1ZETA 1D9FA 4FBUA 8ICBA 2M9NA 5CJ7A 4DSEA 4KMUA 5DQHA 3GILA 2C22A 1JMSA 1SKWA 8ICIA 4Z6EA 3TARA 4X5VA 4RQ2A 4NLGA 2I1QA 1RPLA 3NTUA 3V7KA 2XY7A 4MEYA 3ZDCA 4KN7A 4IQVA 5J2AA 3PO5A 2BDPA 1KTQA 2JZBB 4YXMA 9ICCA 5EOZA 1SL2A 2XY5A 1Z3EB 5HHHA 4ED7A 1T7PA 3GIJA 3PR4A 5J0OA 4EBCA 2R8GA 4O3PA 1QLNA 8ICJA 9ICMA 1NK9A 1L3TA 2R8IA 3KHRA 4ZH4A 4NY8A 2ISPA 3SYZA 3ETLA 2HHWA 4Q8EA 2V9WA 3B0YA 4F4WA 1QSYA 2AGPA 3M8SA 3AU6A 2W8LA 4KLGA 1ZQPA 4YMOA 3UXNA 5HMLA 7ICVA 4DWIA 7ICPA 2KTQA 3UXPA 4ECZA 1BGXT 1RXWA 1BPZA 3LWMA 4NM2A 3V7LA 5F9LA 4KLLA 9ICKA 4M6WB 3OSNA 8ICMA 1U48A 2IMWP 4ECYA 4QWBA 4ED1A 4KLUA 5EWGA 1NK4A 2VA2A 4KTQA 9ICVA 4ELTA 4UB3A 2UVRA 2MUTA 3HW8A 4JWNA 2ZUCA 1BPXA 5D46A 3ZDDA 4IQTA 4F8RA 7ICLA 2H5XA 9ICPA 4B9MA 4F3OA 4Q44A 4DL7A 1SKRA 4KLJA 4DSJA 4ECWA 2W9BB 3PW0A 1MSWD 2HVIA 5CA7A 4UB1A 4C8NA 4RZRA 3T5KA 4DL4A 2BGWA 1PZNA 4M2YA 4R8UA 1ZQLA 1L5UA 4C8KA 9ICFA 5L9XA 4RUAA 1QSLA 2J6SA 3RB6A 5JUMA 3V72A 1ZQOA 2ASLA 4MFAA 8ICUA 2FPKA 5D49A 3OHBA 4YQWA 1SKSA 3GDXA 3RH5A 8ICRA 4B9VA 4TUSA 1U4BA 3IM1A 5J2FA 4F93B 4GC7A 1XO1A 2BPGA 2UVWA 5J2HA 5IINA 5IIIA 1S0OA 3AUOA 4C8MA 1N48A 1DGSA 1KLNA 5KFEA 1C7YA 4KLMA 4I2DA 4UB4A 5DQIA 3MBYA 1ZJMA 3T5JA 4UAYA 2HW3A 5DDYA 4F5RA 4K4HA 4J9KA 7ICMA 3IHQB 4YVZA 4DQSA 5J0QA 1TVAA 1ZQFA 5DB8A 3MFIA 1ZQEA 3TFRA 2NRZA 1ZQZA 8ICYA 3C2LA 4M6WA 7ICNA 4DFJA 2J6UA 1XU4A 4LZDA 7ICOA 1QSSA 4MEXA 7ICTA 4J9PA 4NLNA 4MF8A 4ELVA 1KDHA 4JWMA 4UB5A 2BPCA 2HHXA 5DG8A 5EWEA 4F4YA 3GIKA 1KRPA 1COOA 1S77D 1DOQA 2DFLA 3JPNA 5J2JA 8ICEA 3ISBA 2ZUDA 1S0MA 3TANA 1X9WA 3RH6A 2PI4A 4IR9A 2JEGA 1NKBA 5IILA 3RR7A 4BGDA 4B9SA 4M0AA 4YN4A 1RXVA 4QZGA 3RAQA 3K75D 5C5JA 3FYHA 4PGYA 3PW4A 2R8KA 7ICGA 5KFFA 3MR5A 1HUOA 4DL2A 4P4PA 4XRHA 4DSIA 1TK0A 3EPGA 1RYRA 3C2KA 2B21A 4YFKA 5KFPA 4PHEA 1ZQSA 5J2GA 2BCUA 3V7JA 5DLGA 5KG4A 1L3SA 2PI5A 4I2BA 5KFKA 2NRXA 3RH4A 2KFNA 4EYIB 1ZQTA 2OWOA 4EBDA 3RJEA 4DFKA 4ELUA 5J2DA 3PMLA 3GV5B 7ICJA 4PPXA 5IIJA 2F1JA 4RQ4A 1S10A 1LB2B 8ICHA 7ICUA 7ICKA 4F4KA 4QZIA 1ZQDA 4XQ8A 3RAXA 3Q8RB 1BPEA 5J0XA 5DB9A 4QZHA 4KN4A 2DPIA 1S76D 3M9NB 4J9NA 1S0VA 8ICTA 5KTQA 4F5PA 4IR1A 3RBDA 9ICUA 4DOAA 3RR8A 3MGIA 4DS5A 4RPXA 1LV5A 3H8JA 3GQCA 8ICSA 2F1HA 4YCXA 5IIMA 1RZTA 4QZCA 7ICSA 3N97B 4Q45A 5BOMA 2NRVA 3TAQA 4QZDA 3Q8SB 4FBTA 2XCAA 3PW5A 4NM1A 8ICOA 4XA5A 1UA0A 2AU0A 2FMQA 1U47A 2UVVA 4TUQA 4O5KA 2W9CA 1NK6A 4Q43A 4C8LA 1T8EA 5J0TA 3Q8QB 4MFFA 4CCHA 2W9CB 4FS1A 3EZ5A 2JEJA 2NRWA 1XSPA 3BQ2A 2FMPA 4JK1A 1QTMA 5KFMA 3RJKA 1EXNA 5CHGA 4BWJA 2R8HA 4R64A 1S0NA 4BXOA 4QWDA 3JPRA 4NLKA 4QW9A 4P4OA 5J0UA 2W9MA 4YR0A 4F5OA 1NKCA 1ZQCA 3SZ2A 4ED8A 2FPMA 4P2HA 4TQSA 9ICIA 5KFZA 3V6HA 3QE9Y 5DBBA 4EYHB 3ZDAA 3RJJA 2AJQA 1IXRA 3GFKB 4DF4A 7ICRA 3PMNA 4DOCA 4YD2A 3RBEA 2AQ0A 4ECXA 4F2SA 5EWFA 3EPIA 8ICKA 4IRCA 4DO9A 1ZQVA 2P6UA 2AGOA 4KLHA 9ICRA 2VA8A 4PGXA 3OJUA 5KFRA 4GXIA 4DSFA 5HMMA 1MQ2A 4ECSA 5KFVA 4KITB 2DPJA 4RQ7A 1JIHA 5KFHA 2J6TA 2KN7A 2RDJA 4Z6FA 1D8LA 2C2DA 1AROP 4NXZA 1ZQXA 3N4MB 3EYZA 4FO6A 3UXOA 4DLEA 3RRGA 3C21A 2BR0A 1NOMA 5D4BA 1X2IA 3MR2A 1S97A 1ZQMA 1BVSA 4RPZA 4F4ZA 2FLLA 2ZTCA 3OJSA 5KFQA 5KG5A 4QWCA 5J0SA 5J29A 3ISCA 9ICJA 3C1ZA 2BQ3A 3RJHA 5J2EA 1U49A 2JEIA 4YMNA 4F50A 3UQ0A 2BCSA 4PGQA 4I2HA 3ZDBA 3RB3A 4KLQA 2KFZA 1T3NA 4UAZA 4J9MA 3GV7B 3SV4A 1B22A 2W9AA 3G6YA 4E0DA 3MGHA 3MR6A 5KFYA 1ZJNA 3M9OB 4ED6A 3TI0A 4P4MA 5J2CA 9ICWA 1N56A 3MR3A 2ZJ8A 3KHLA 5DBCA 3Q8MA 4NLZA 5KFJA 4RQ5A 2XGPA 2ZTEA 1NK5A 2FLNA 1RYSA 2I9GA 2IA6A 3KTQA 1XSLA 4TQRA 4TUPA 4KLDA 5KG0A 2HHQA 3H40A 3PX0A 3EWAA 8ICNA 1Z00A 3MFHA 3MABA 1JXEA 1H38A 3V6KA 4B9TA 4C8OA 4I29A 4M9LA 3BQTA 2R8JA 5KT2A 4RT3A 3UPQA 4M04A 2LYHA 5DKWA 3OGUA 4QW8A 4F5QA 4XUSA 4B9UA 4G3IA 3BQ0A 9ICHA 1ZQUA 4RQ8A 5L1KA 1XWLA 5KFWA 3MDAA 3B0XA 3TFSA 4YG2A 2BCVA 4ECQA 1CEZA 3T5LA 1S9FA 5CP2A 1XS9D 4YMMA 2F1IA 1XC9A 1MQ3A 4BWMA 4DSLA 5HP4A 4O3RA 4QZAA 2HHTA 1B43A 1U9LA 2PFPA 3ZD8A 3RB0A 5CB1A 1X9MA 1TKDA 4PH5A 4UBBA 4B9NA 1KFDA 2AQ4A 4K4IA 3E2EA 2HVHA 5DB6A 1NJWA 5KFCA 3K4GA 3ZDEA 2XC9A 1SZPA 5HNKA 4R63A 4FS2A 1XSNA 5KFTA 5KFAA 3RRHA 3T5HA 2JZBA 9ICEA 5IIOA 8ICPA 1A77A 1CUKA 8ICQA 1TAUA 5L1LA 4ECTA 2VANA 4DEZA 4HYKA 5KFNA 4TURA 3C2MA 1KSPA 4MFCA 9ICAA 4F4XA 2W8KA 4O5EA 5KG2A 4YR3A 2IHMA 5KFOA 2Y1IA 2P6RA 4IQUA 4RNOA 4RU9A 1ZQAA 4O3NA 3Q8LA 3HX0A 3H8SA 9ICGA 9ICQA 4LZGA 4RUCA 4ED2A 4I28A 2C2EA 1BPYA 4Q8FA 5KFGA 8ICWA 2ASDA 1V9PA 4O3SA 4EZ9A 5L1IA 2HHUA 5KG3A 5J2BA 1BPBA 1NKEA 8ICLA 1NJYA 4I2CA 3JPTA 5J0PA 3RTVA 5KFDA 4O5CA 4O3OA 1NK7A 2RDIA 1WCNA 4F91B 1D8YA 1A76A 2Q0ZX 3JPOA 4K4GA 4B9LA 7ICFA 2ZUBA 3KHHA 1L3VA 4ECUA 4RNNA 2W9BA 2V4QA 3HP6A 3TAPA 8ICAA 1U45A 4I2JA 2PFOA 3UQ2A 5J0YA 2NRTA 9ICLA 9ICSA 5HHIA 2MUTB 1ZQJA 2ZJAA 5L1JA 4DS4A 2Y1JA 2PFQA 4IRDA 4YP3A 2C28A 9ICOA 1ZQGA 1HJPA 2UVUA 3QZ7A 8ICFA 1KEJA 3SV3A 7ICHA 1UT8A 3EW9A 5DG9A 3C5GA 4KLEA 4R65A 2GWSA 5J2IA 4EZ6A 1IM4A 4QWAA 3H4BA 3THVA 4DFPA 4EBEA 3JPSA 4IRKA 3RJGA 1ZQRA 4BDPA 4PHAA 2FMSA 4RNMA 5J2KA 1ZQNA 4I2FA 3PY8A 9ICBA 5J0WA 2JEFA 5KFUA 4Z6DA 5KT5A 2BCRA 4M9JA 2BHNA 4PHDA 4DL3A 1K1QA 1T4GA 4JV0A 2BKEA 1ZYQA 1NK8A 1SL0A 3LK9A 2V4RA 2BQUA 4JUZA 1X9SA 4M9GA 7ICQA 4RQ6A 2IHNA 3MDCA 4ED0A 3JPQA 1UA1A 2ZJ5A 4YXJA 4R8UB 3V6JA 3M9MB 4RPYA 3GV8B 5J0RA 4RT2A 5DG7A 1L3UA 1ZQQA 1MC8A 3RJIA 3OSPA 4QZBA 4UBCA 1KFSA 4DQQA 2XO7A 1NJZA 3T3FA 5KFIA 3RB4A 3G6XA 1TK5A 5KFLA 9ICNA 4RQ1A 4J9RA 8ICCA 5DB7A 4DQIA 2WTFA 4IQWA 4O9MA 2ASJA 4O3QA 1NK0A 2XCPA 4DQPA 3GIMA 2ALZA 4DL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I27 A;  3H4D A;  4EEY A;  4DSK A;  4KLI A;  3AU2 A;  2FLP A;  4F2R A;  4KLF A;  3H8W A;  1JXL A;  4DLG A;  1ZQY A;  1TK8 A;  4J9S A;  3Q8P B;  5KG1 A;  5KFX A;  5KFS A;  5KG7 A;  5KFB A;  1HUZ A;  1TFR A;  1Y88 A;  2BQR A;  4J9L A;  4DF8 A;  5KT4 A;  4UB2 A;  5KG6 A;  3C23 A;  4DL5 A;  2BCQ A;  4QZ9 A;  1D9D A;  4GXK A;  4RQ0 A;  4DFM A;  8ICG A;  2PFN A;  3PR5 B;  3PX6 A;  4BXO B;  4KLS A;  5KT6 A;  4F5N A;  3LDA A;  3OHA A;  4ECR A;  3TQ1 A;  1BPD A;  2P66 A;  2KZZ A;  4YD1 A;  4I2I A;  3HWT A;  4LVS A;  4Z6C A;  8ICV A;  3ORY A;  3SI8 A;  7ICE A;  5BPC A;  4UQG A;  2ATL A;  8ICZ A;  9ICT A;  1KFT A;  5DBA A;  2PXI A;  3PV8 A;  3Q8K A;  3PNC A;  5DGB A;  4M9H A;  3H7I A;  1NJX A;  1K1S A;  3RJF A;  2A1J B;  2AGQ A;  5DDM A;  2ZTD A;  1UT5 A;  3FDS A;  5BOL A;  2ISO A;  4KLT A;  1Z00 B;  4DOB A;  8ICX A;  5DGA A;  3C1Y A;  1SL1 A;  1ZQH A;  1ZQI A;  3GII A;  4J9Q A;  5IIK A;  4DQR A;  1ZQB A;  4GC6 A;  2BPF A;  1TV9 A;  4MF2 A;  3QZ8 A;  3BQ1 A;  2XY6 A;  3G6V A;  3C5F A;  3PO4 A;  4F92 B;  4QZ8 A;  3BJY A;  2MAX A;  4ECV A;  3PX4 A;  1ZQK A;  2KZM A;  2XGQ A;  4J9O A;  2HHV A;  3HPO A;  4KLO A;  7ICI A;  1TAQ A;  2VA3 A;  4O0I A;  1ZQW A;  4RQ3 A;  4R66 A;  2C2R A;  3PW2 A;  2KZ3 A;  5CR0 A;  5DQG A;  3NGD A;  4QZF A;  9ICX A;  4GXJ A;  5KT7 A;  2IBK A;  2HHS A;  4M9N A;  3M8R A;  3LWL A;  5DLF A;  3QEB Z;  4I2G A;  4JV1 A;  1WCL A;  1JX4 A;  3BDP A;  5CWR A;  3QEA Z;  3JPP A;  4UAW A;  4I2A A;  4GLX A;  3PVX A;  4JV2 A;  3PW7 A;  4YR2 A;  2FPL A;  5F9N A;  5TZV A;  4M47 A;  3KHG A;  4PHP A;  5KT3 A;  4I2E A;  4ED3 A;  4QWE A;  3ISD A;  1JN3 A;  3HT3 A;  2A1J A;  3ZD9 A;  4QZE A;  1ZET A;  1D9F A;  4FBU A;  8ICB A;  2M9N A;  5CJ7 A;  4DSE A;  4KMU A;  5DQH A;  3GIL A;  2C22 A;  1JMS A;  1SKW A;  8ICI A;  4Z6E A;  3TAR A;  4X5V A;  4RQ2 A;  4NLG A;  2I1Q A;  1RPL A;  3NTU A;  3V7K A;  2XY7 A;  4MEY A;  3ZDC A;  4KN7 A;  4IQV A;  5J2A A;  3PO5 A;  2BDP A;  1KTQ A;  2JZB B;  4YXM A;  9ICC A;  5EOZ A;  1SL2 A;  2XY5 A;  1Z3E B;  5HHH A;  4ED7 A;  1T7P A;  3GIJ A;  3PR4 A;  5J0O A;  4EBC A;  2R8G A;  4O3P A;  1QLN A;  8ICJ A;  9ICM A;  1NK9 A;  1L3T A;  2R8I A;  3KHR A;  4ZH4 A;  4NY8 A;  2ISP A;  3SYZ A;  3ETL A;  2HHW A;  4Q8E A;  2V9W A;  3B0Y A;  4F4W A;  1QSY A;  2AGP A;  3M8S A;  3AU6 A;  2W8L A;  4KLG A;  1ZQP A;  4YMO A;  3UXN A;  5HML A;  7ICV A;  4DWI A;  7ICP A;  2KTQ A;  3UXP A;  4ECZ A;  1BGX T;  1RXW A;  1BPZ A;  3LWM A;  4NM2 A;  3V7L A;  5F9L A;  4KLL A;  9ICK A;  4M6W B;  3OSN A;  8ICM A;  1U48 A;  2IMW P;  4ECY A;  4QWB A;  4ED1 A;  4KLU A;  5EWG A;  1NK4 A;  2VA2 A;  4KTQ A;  9ICV A;  4ELT A;  4UB3 A;  2UVR A;  2MUT A;  3HW8 A;  4JWN A;  2ZUC A;  1BPX A;  5D46 A;  3ZDD A;  4IQT A;  4F8R A;  7ICL A;  2H5X A;  9ICP A;  4B9M A;  4F3O A;  4Q44 A;  4DL7 A;  1SKR A;  4KLJ A;  4DSJ A;  4ECW A;  2W9B B;  3PW0 A;  1MSW D;  2HVI A;  5CA7 A;  4UB1 A;  4C8N A;  4RZR A;  3T5K A;  4DL4 A;  2BGW A;  1PZN A;  4M2Y A;  4R8U A;  1ZQL A;  1L5U A;  4C8K A;  9ICF A;  5L9X A;  4RUA A;  1QSL A;  2J6S A;  3RB6 A;  5JUM A;  3V72 A;  1ZQO A;  2ASL A;  4MFA A;  8ICU A;  2FPK A;  5D49 A;  3OHB A;  4YQW A;  1SKS A;  3GDX A;  3RH5 A;  8ICR A;  4B9V A;  4TUS A;  1U4B A;  3IM1 A;  5J2F A;  4F93 B;  4GC7 A;  1XO1 A;  2BPG A;  2UVW A;  5J2H A;  5IIN A;  5III A;  1S0O A;  3AUO A;  4C8M A;  1N48 A;  1DGS A;  1KLN A;  5KFE A;  1C7Y A;  4KLM A;  4I2D A;  4UB4 A;  5DQI A;  3MBY A;  1ZJM A;  3T5J A;  4UAY A;  2HW3 A;  5DDY A;  4F5R A;  4K4H A;  4J9K A;  7ICM A;  3IHQ B;  4YVZ A;  4DQS A;  5J0Q A;  1TVA A;  1ZQF A;  5DB8 A;  3MFI A;  1ZQE A;  3TFR A;  2NRZ A;  1ZQZ A;  8ICY A;  3C2L A;  4M6W A;  7ICN A;  4DFJ A;  2J6U A;  1XU4 A;  4LZD A;  7ICO A;  1QSS A;  4MEX A;  7ICT A;  4J9P A;  4NLN A;  4MF8 A;  4ELV A;  1KDH A;  4JWM A;  4UB5 A;  2BPC A;  2HHX A;  5DG8 A;  5EWE A;  4F4Y A;  3GIK A;  1KRP A;  1COO A;  1S77 D;  1DOQ A;  2DFL A;  3JPN A;  5J2J A;  8ICE A;  3ISB A;  2ZUD A;  1S0M A;  3TAN A;  1X9W A;  3RH6 A;  2PI4 A;  4IR9 A;  2JEG A;  1NKB A;  5IIL A;  3RR7 A;  4BGD A;  4B9S A;  4M0A A;  4YN4 A;  1RXV A;  4QZG A;  3RAQ A;  3K75 D;  5C5J A;  3FYH A;  4PGY A;  3PW4 A;  2R8K A;  7ICG A;  5KFF A;  3MR5 A;  1HUO A;  4DL2 A;  4P4P A;  4XRH A;  4DSI A;  1TK0 A;  3EPG A;  1RYR A;  3C2K A;  2B21 A;  4YFK A;  5KFP A;  4PHE A;  1ZQS A;  5J2G A;  2BCU A;  3V7J A;  5DLG A;  5KG4 A;  1L3S A;  2PI5 A;  4I2B A;  5KFK A;  2NRX A;  3RH4 A;  2KFN A;  4EYI B;  1ZQT A;  2OWO A;  4EBD A;  3RJE A;  4DFK A;  4ELU A;  5J2D A;  3PML A;  3GV5 B;  7ICJ A;  4PPX A;  5IIJ A;  2F1J A;  4RQ4 A;  1S10 A;  1LB2 B;  8ICH A;  7ICU A;  7ICK A;  4F4K A;  4QZI A;  1ZQD A;  4XQ8 A;  3RAX A;  3Q8R B;  1BPE A;  5J0X A;  5DB9 A;  4QZH A;  4KN4 A;  2DPI A;  1S76 D;  3M9N B;  4J9N A;  1S0V A;  8ICT A;  5KTQ A;  4F5P A;  4IR1 A;  3RBD A;  9ICU A;  4DOA A;  3RR8 A;  3MGI A;  4DS5 A;  4RPX A;  1LV5 A;  3H8J A;  3GQC A;  8ICS A;  2F1H A;  4YCX A;  5IIM A;  1RZT A;  4QZC A;  7ICS A;  3N97 B;  4Q45 A;  5BOM A;  2NRV A;  3TAQ A;  4QZD A;  3Q8S B;  4FBT A;  2XCA A;  3PW5 A;  4NM1 A;  8ICO A;  4XA5 A;  1UA0 A;  2AU0 A;  2FMQ A;  1U47 A;  2UVV A;  4TUQ A;  4O5K A;  2W9C A;  1NK6 A;  4Q43 A;  4C8L A;  1T8E A;  5J0T A;  3Q8Q B;  4MFF A;  4CCH A;  2W9C B;  4FS1 A;  3EZ5 A;  2JEJ A;  2NRW A;  1XSP A;  3BQ2 A;  2FMP A;  4JK1 A;  1QTM A;  5KFM A;  3RJK A;  1EXN A;  5CHG A;  4BWJ A;  2R8H A;  4R64 A;  1S0N A;  4BXO A;  4QWD A;  3JPR A;  4NLK A;  4QW9 A;  4P4O A;  5J0U A;  2W9M A;  4YR0 A;  4F5O A;  1NKC A;  1ZQC A;  3SZ2 A;  4ED8 A;  2FPM A;  4P2H A;  4TQS A;  9ICI A;  5KFZ A;  3V6H A;  3QE9 Y;  5DBB A;  4EYH B;  3ZDA A;  3RJJ A;  2AJQ A;  1IXR A;  3GFK B;  4DF4 A;  7ICR A;  3PMN A;  4DOC A;  4YD2 A;  3RBE A;  2AQ0 A;  4ECX A;  4F2S A;  5EWF A;  3EPI A;  8ICK A;  4IRC A;  4DO9 A;  1ZQV A;  2P6U A;  2AGO A;  4KLH A;  9ICR A;  2VA8 A;  4PGX A;  3OJU A;  5KFR A;  4GXI A;  4DSF A;  5HMM A;  1MQ2 A;  4ECS A;  5KFV A;  4KIT B;  2DPJ A;  4RQ7 A;  1JIH A;  5KFH A;  2J6T A;  2KN7 A;  2RDJ A;  4Z6F A;  1D8L A;  2C2D A;  1ARO P;  4NXZ A;  1ZQX A;  3N4M B;  3EYZ A;  4FO6 A;  3UXO A;  4DLE A;  3RRG A;  3C21 A;  2BR0 A;  1NOM A;  5D4B A;  1X2I A;  3MR2 A;  1S97 A;  1ZQM A;  1BVS A;  4RPZ A;  4F4Z A;  2FLL A;  2ZTC A;  3OJS A;  5KFQ A;  5KG5 A;  4QWC A;  5J0S A;  5J29 A;  3ISC A;  9ICJ A;  3C1Z A;  2BQ3 A;  3RJH A;  5J2E A;  1U49 A;  2JEI A;  4YMN A;  4F50 A;  3UQ0 A;  2BCS A;  4PGQ A;  4I2H A;  3ZDB A;  3RB3 A;  4KLQ A;  2KFZ A;  1T3N A;  4UAZ A;  4J9M A;  3GV7 B;  3SV4 A;  1B22 A;  2W9A A;  3G6Y A;  4E0D A;  3MGH A;  3MR6 A;  5KFY A;  1ZJN A;  3M9O B;  4ED6 A;  3TI0 A;  4P4M A;  5J2C A;  9ICW A;  1N56 A;  3MR3 A;  2ZJ8 A;  3KHL A;  5DBC A;  3Q8M A;  4NLZ A;  5KFJ A;  4RQ5 A;  2XGP A;  2ZTE A;  1NK5 A;  2FLN A;  1RYS A;  2I9G A;  2IA6 A;  3KTQ A;  1XSL A;  4TQR A;  4TUP A;  4KLD A;  5KG0 A;  2HHQ A;  3H40 A;  3PX0 A;  3EWA A;  8ICN A;  1Z00 A;  3MFH A;  3MAB A;  1JXE A;  1H38 A;  3V6K A;  4B9T A;  4C8O A;  4I29 A;  4M9L A;  3BQT A;  2R8J A;  5KT2 A;  4RT3 A;  3UPQ A;  4M04 A;  2LYH A;  5DKW A;  3OGU A;  4QW8 A;  4F5Q A;  4XUS A;  4B9U A;  4G3I A;  3BQ0 A;  9ICH A;  1ZQU A;  4RQ8 A;  5L1K A;  1XWL A;  5KFW A;  3MDA A;  3B0X A;  3TFS A;  4YG2 A;  2BCV A;  4ECQ A;  1CEZ A;  3T5L A;  1S9F A;  5CP2 A;  1XS9 D;  4YMM A;  2F1I A;  1XC9 A;  1MQ3 A;  4BWM A;  4DSL A;  5HP4 A;  4O3R A;  4QZA A;  2HHT A;  1B43 A;  1U9L A;  2PFP A;  3ZD8 A;  3RB0 A;  5CB1 A;  1X9M A;  1TKD A;  4PH5 A;  4UBB A;  4B9N A;  1KFD A;  2AQ4 A;  4K4I A;  3E2E A;  2HVH A;  5DB6 A;  1NJW A;  5KFC A;  3K4G A;  3ZDE A;  2XC9 A;  1SZP A;  5HNK A;  4R63 A;  4FS2 A;  1XSN A;  5KFT A;  5KFA A;  3RRH A;  3T5H A;  2JZB A;  9ICE A;  5IIO A;  8ICP A;  1A77 A;  1CUK A;  8ICQ A;  1TAU A;  5L1L A;  4ECT A;  2VAN A;  4DEZ A;  4HYK A;  5KFN A;  4TUR A;  3C2M A;  1KSP A;  4MFC A;  9ICA A;  4F4X A;  2W8K A;  4O5E A;  5KG2 A;  4YR3 A;  2IHM A;  5KFO A;  2Y1I A;  2P6R A;  4IQU A;  4RNO A;  4RU9 A;  1ZQA A;  4O3N A;  3Q8L A;  3HX0 A;  3H8S A;  9ICG A;  9ICQ A;  4LZG A;  4RUC A;  4ED2 A;  4I28 A;  2C2E A;  1BPY A;  4Q8F A;  5KFG A;  8ICW A;  2ASD A;  1V9P A;  4O3S A;  4EZ9 A;  5L1I A;  2HHU A;  5KG3 A;  5J2B A;  1BPB A;  1NKE A;  8ICL A;  1NJY A;  4I2C A;  3JPT A;  5J0P A;  3RTV A;  5KFD A;  4O5C A;  4O3O A;  1NK7 A;  2RDI A;  1WCN A;  4F91 B;  1D8Y A;  1A76 A;  2Q0Z X;  3JPO A;  4K4G A;  4B9L A;  7ICF A;  2ZUB A;  3KHH A;  1L3V A;  4ECU A;  4RNN A;  2W9B A;  2V4Q A;  3HP6 A;  3TAP A;  8ICA A;  1U45 A;  4I2J A;  2PFO A;  3UQ2 A;  5J0Y A;  2NRT A;  9ICL A;  9ICS A;  5HHI A;  2MUT B;  1ZQJ A;  2ZJA A;  5L1J A;  4DS4 A;  2Y1J A;  2PFQ A;  4IRD A;  4YP3 A;  2C28 A;  9ICO A;  1ZQG A;  1HJP A;  2UVU A;  3QZ7 A;  8ICF A;  1KEJ A;  3SV3 A;  7ICH A;  1UT8 A;  3EW9 A;  5DG9 A;  3C5G A;  4KLE A;  4R65 A;  2GWS A;  5J2I A;  4EZ6 A;  1IM4 A;  4QWA A;  3H4B A;  3THV A;  4DFP A;  4EBE A;  3JPS A;  4IRK A;  3RJG A;  1ZQR A;  4BDP A;  4PHA A;  2FMS A;  4RNM A;  5J2K A;  1ZQN A;  4I2F A;  3PY8 A;  9ICB A;  5J0W A;  2JEF A;  5KFU A;  4Z6D A;  5KT5 A;  2BCR A;  4M9J A;  2BHN A;  4PHD A;  4DL3 A;  1K1Q A;  1T4G A;  4JV0 A;  2BKE A;  1ZYQ A;  1NK8 A;  1SL0 A;  3LK9 A;  2V4R A;  2BQU A;  4JUZ A;  1X9S A;  4M9G A;  7ICQ A;  4RQ6 A;  2IHN A;  3MDC A;  4ED0 A;  3JPQ A;  1UA1 A;  2ZJ5 A;  4YXJ A;  4R8U B;  3V6J A;  3M9M B;  4RPY A;  3GV8 B;  5J0R A;  4RT2 A;  5DG7 A;  1L3U A;  1ZQQ A;  1MC8 A;  3RJI A;  3OSP A;  4QZB A;  4UBC A;  1KFS A;  4DQQ A;  2XO7 A;  1NJZ A;  3T3F A;  5KFI A;  3RB4 A;  3G6X A;  1TK5 A;  5KFL A;  9ICN A;  4RQ1 A;  4J9R A;  8ICC A;  5DB7 A;  4DQI A;  2WTF A;  4IQW A;  4O9M A;  2ASJ A;  4O3Q A;  1NK0 A;  2XCP A;  4DQP A;  3GIM A;  2ALZ A;  4DL6 A; 
#chains in the Genus database with same CATH topology
 4DSK A;  1RM6 C;  4C0Z A;  5L1M A;  4DLG A;  1ZQY A;  5KG1 A;  2F8K A;  5KFS A;  5KG7 A;  1TFR A;  1Y88 A;  2BQR A;  4J9L A;  2KNJ A;  2GH1 A;  4DF8 A;  4UB2 A;  1CI4 A;  1D9D A;  3KZI U;  1MN8 A;  2G06 A;  3PR5 B;  3PX6 A;  1B4F A;  1SWW A;  2NO5 A;  3F2C A;  2KZZ A;  4YD1 A;  3HWT A;  7ICE A;  2AXT U;  5BPC A;  2ATL A;  9ICT A;  3Q8K A;  3PNC A;  5DGB A;  1NJX A;  3H0R B;  2A1J B;  2AGQ A;  2ZTD A;  2AH5 A;  4KLT A;  2ISO A;  1DRG A;  2F3N A;  2RHF A;  1SL1 A;  1ZQH A;  4DQR A;  4J9Q A;  3QU5 A;  4GC6 A;  2BPF A;  4MF2 A;  4FFD A;  3G6V A;  1OXJ A;  1X9X A;  3C5F A;  4QZ8 A;  2MAX A;  2A3V A;  2HMX A;  3QX7 A;  2HHV A;  3HPO A;  1TAQ A;  3GZF A;  2KZ3 A;  4NLC A;  1V85 A;  2IBK A;  5KT7 A;  4M9N A;  3QEB Z;  1Z4N A;  3DDH A;  4I2G A;  1JX4 A;  5CWR A;  3QEA Z;  5KAF U;  3PW7 A;  5AM2 A;  1SV0 C;  4M47 A;  3VCB A;  4PHP A;  1LVH A;  5KT3 A;  2HBM A;  1O08 A;  3SQI A;  4ED3 A;  1SV0 A;  3ISD A;  1JN3 A;  1ZET A;  5EE3 A;  3L5K A;  4UAR A;  1JMS A;  1SKW A;  4F71 A;  1RPL A;  3NTU A;  3ZDC A;  4KN7 A;  4IQV A;  4CF5 A;  4YXM A;  1Z3E B;  5HHH A;  3GU3 A;  3GIJ A;  4O3P A;  8ICJ A;  5ALJ A;  1IG6 A;  2KV2 A;  2K4E A;  3KHR A;  4EEL A;  4ZH4 A;  2EZY A;  3ETL A;  4JB3 A;  2KSO A;  5AM5 A;  4KLG A;  4NLB A;  2JHD A;  5HML A;  4DWI A;  7ICV A;  1RG6 A;  3UXP A;  4ECZ A;  5F9L A;  1X6J A;  4OJO A;  2LMR A;  3C28 A;  4PZO A;  1NK4 A;  2ZIU A;  3AN1 A;  4KTQ A;  4ELT A;  2UVR A;  1BPX A;  4F8R A;  4IQT A;  4B9M A;  4Q44 A;  4DL7 A;  4KLJ A;  4DSJ A;  4OJP A;  2Q4T A;  1ZOL A;  2JH7 A;  3UMC A;  4CF3 A;  4M2Y A;  4R8U A;  1ZQL A;  1L5U A;  2BDU A;  3QNM A;  5L9X A;  2LYA A;  1Q3V A;  3K1R B;  8ICU A;  5D49 A;  3OHB A;  1SKS A;  5AKZ A;  3DEE A;  4B9V A;  2ZIV A;  1U4B A;  3IM1 A;  5AKE A;  5J2F A;  4F93 B;  2KIV A;  1OUQ A;  5III A;  3AUO A;  5AI5 A;  4UB4 A;  2CXY A;  4UAY A;  2HW3 A;  5DDY A;  4K4H A;  1TVA A;  2JGA A;  1ZQE A;  3ALR A;  3TFR A;  1ZQZ A;  3ED5 A;  4DFJ A;  2KMD A;  3QUC A;  5AK4 A;  5EWE A;  4F4Y A;  3GIK A;  1VLB A;  4EX7 A;  2DFL A;  1V97 A;  1S0M A;  3RH6 A;  5FP0 A;  3RR7 A;  1O03 A;  2FI1 A;  2R8K A;  4DSI A;  3EPG A;  5ALL A;  1RYR A;  1WWV A;  4EBD A;  4DFK A;  5AKK A;  5IIJ A;  2E8M A;  2YB4 A;  1ZQD A;  2G0A A;  4QZH A;  1RQL A;  4UAS A;  2KJ9 A;  9ICU A;  2EAP A;  3HJE A;  4RPX A;  3H8J A;  7ICS A;  3N97 B;  3TAQ A;  3IN5 A;  1QQ6 A;  3PW5 A;  8ICO A;  2E1F A;  3QYP A;  1U47 A;  4TUQ A;  2K60 A;  4EEK A;  4C8L A;  1T8E A;  2H3Z A;  4UAV A;  2FMP A;  2DKZ A;  5KFM A;  4EEN A;  1VDV A;  2W04 A;  4OJL A;  3H8M A;  4QWD A;  3JPR A;  3CYM A;  4P4O A;  5J0U A;  2W9M A;  4F5O A;  4P0Q A;  4TQS A;  5KFZ A;  3V6H A;  2YMM A;  3SR6 A;  3ZDA A;  4DF4 A;  4DOC A;  4ECX A;  3RF9 A;  8ICK A;  4KLH A;  2A19 A;  4PGX A;  5KFR A;  4ECS A;  2JH1 A;  5KFV A;  4BX9 C;  2RDJ A;  2C2D A;  4OCZ A;  1ARO P;  3N4M B;  3A0H U;  3UXO A;  4DLE A;  3SAF A;  3C21 A;  2HI0 A;  4RPZ A;  3D6J A;  3OJS A;  4QWC A;  1QH9 A;  4US9 A;  5KL8 B;  3C1Z A;  3NVV A;  3RJH A;  5ALG A;  1SZH A;  3UQ0 A;  4PGQ A;  4I2H A;  2KFZ A;  4J9M A;  1L8L A;  4P0P B;  3BS5 B;  4E0D A;  4OD0 A;  4ED6 A;  1A0P A;  3TI0 A;  3MR3 A;  4RQ5 A;  1XSL A;  3H40 A;  3MGV A;  3PX0 A;  8ICN A;  4G9B A;  1H38 A;  3MAB A;  3H0L B;  4I29 A;  4M9L A;  4NL9 C;  5KT2 A;  3UPQ A;  4M04 A;  5DKW A;  4B9U A;  3NUQ A;  3B0X A;  2EAN A;  1S9F A;  2LI6 A;  5CP2 A;  2B6G A;  2F1I A;  3N7S C;  1MQ3 A;  4DSL A;  3TKA A;  5ALI A;  4AYB F;  5ALO A;  3ZD8 A;  3RB0 A;  1TKD A;  4UBB A;  3E2E A;  2Y0S C;  4K4I A;  3BZK A;  3K4G A;  2XC9 A;  5HNK A;  4FS2 A;  1XSN A;  2ZXH A;  1A77 A;  1KN5 A;  1KSP A;  2RRD A;  5KFN A;  3WK5 A;  3ZI4 A;  2W8K A;  4O5E A;  2P6R A;  5CRX A;  2Y1I A;  4RU9 A;  4O3N A;  3HX0 A;  3H8S A;  9ICG A;  4LZG A;  4ED2 A;  1BPY A;  2ASD A;  1Z19 A;  5K4L A;  5L1I A;  8ICL A;  3C29 A;  3L3F X;  4CDG A;  5KFD A;  4FZM A;  4O3O A;  2RDI A;  1A76 A;  2Q0Z X;  4B9L A;  7ICF A;  3KHH A;  4ECU A;  2W9B A;  2V4Q A;  3HP6 A;  3TAP A;  3BZC A;  9ICS A;  4IRD A;  2ZJA A;  4Y2T A;  1KEJ A;  1UT8 A;  3THV A;  2HOQ A;  2EH9 A;  5KFU A;  5KT5 A;  2BHN A;  4JV0 A;  1NK8 A;  3LK9 A;  2V4R A;  2BQU A;  3WKE A;  3JPQ A;  3V6J A;  4CF4 A;  4CGZ A;  4DQQ A;  1NJZ A;  2KE7 A;  2E8P A;  5AIA A;  3G6X A;  3AL0 B;  4RQ1 A;  4J9R A;  8ICC A;  4O9M A;  4DQI A;  2G09 A;  3HKZ F;  1J97 A;  4DL6 A;  2QLT A;  3QU7 A;  1WUD A;  5E79 U;  1YT3 A;  1KW4 A;  1TK8 A;  4P0P A;  3QU9 A;  5EE1 A;  5KT4 A;  2BCQ A;  1PVR A;  4BXO B;  4F5N A;  4ECR A;  1N60 A;  3A0B U;  1MA7 A;  5ALM A;  3ORY A;  1JAL A;  1KFT A;  2QAR A;  2PXI A;  3PV8 A;  4M9H A;  3RJF A;  1ZD3 A;  3FDS A;  4DOB A;  3C1Y A;  5IIK A;  3N28 A;  4ICA A;  3BQ1 A;  3BJY A;  5AKH A;  3UMB A;  3PX4 A;  2HSZ A;  4QIW F;  4KLO A;  7ICI A;  2VA3 A;  2IOF A;  4O0I A;  1ZQW A;  4RQ3 A;  2XI9 A;  5CR0 A;  3SD7 A;  2KHV A;  4QZF A;  4Y2Q A;  3QXG A;  3LWL A;  4Y2V A;  3BDP A;  4JV2 A;  4YR2 A;  1YZ6 A;  1N2X A;  4I2E A;  2Y0S F;  3HT3 A;  5JTI A;  4QZE A;  4FBU A;  5AM0 A;  5CJ7 A;  4DSE A;  4KMU A;  1J2N A;  3GIL A;  2G5H B;  4NLG A;  2I1Q A;  3V7K A;  4Y2R A;  3PO5 A;  1JRO A;  1KTQ A;  2BDP A;  9ICC A;  2VKQ A;  1SL2 A;  2MU2 A;  2XY5 A;  3SEN A;  4EBC A;  1NK9 A;  1N62 A;  2KVS A;  5J8Y C;  2ISP A;  3SYZ A;  2E1E A;  4IC9 A;  3LYS A;  1QSY A;  2AGP A;  3UXN A;  1HIW A;  2KTQ A;  1RXW A;  1BPZ A;  3LWM A;  9ICK A;  4KLL A;  4M6W B;  3OSN A;  4C7Y A;  4KLU A;  3NAS A;  3HW8 A;  5ALZ A;  5D46 A;  4QNL A;  4C7Z A;  9ICP A;  4F3O A;  1NZB A;  1SKR A;  2H3I A;  3KFU F;  1D8B A;  4C8N A;  2BGW A;  1QSL A;  3V72 A;  5AKJ A;  3GDX A;  5ALW A;  4GC7 A;  1XO1 A;  5J2H A;  1VJ5 A;  2EZZ A;  3IRU A;  1DGS A;  1KLN A;  4KLM A;  3MBY A;  1ZJM A;  5DQI A;  2VIX A;  4F5R A;  7ICM A;  2PMZ F;  4J9K A;  4YVZ A;  3E58 A;  2YQE A;  5J0Q A;  5DB8 A;  3F5E A;  2NRZ A;  1BNP A;  4M6W A;  1XU4 A;  2K4P A;  3L4P A;  4J9P A;  4NLN A;  2BPC A;  2CPR A;  3SAH A;  1KRP A;  1COO A;  1JRP A;  2ZUD A;  3O0F A;  1ZRM A;  4IR9 A;  1JI7 A;  2ZG6 A;  4M0A A;  4YN4 A;  1RXV A;  3TAD C;  2ES6 A;  4PGY A;  3PW4 A;  4DL2 A;  1T3Q A;  1UHU A;  4RQM A;  1TK0 A;  1Q46 A;  4BJQ A;  1ZQS A;  2FE9 A;  3V7J A;  5KG4 A;  5KFK A;  3RH4 A;  2KFN A;  1HEK A;  1ZQT A;  4ELU A;  2IOH A;  3GV5 B;  1X42 A;  1SXD A;  3K1Z A;  2PKE A;  2F1J A;  2WAQ F;  4RQ4 A;  5AKX A;  2YMQ A;  2DGZ A;  4XQ8 A;  5J0X A;  1S76 D;  4KN4 A;  4NJ8 A;  4KX5 A;  3WK8 A;  3BS5 A;  1FEZ A;  2KVC A;  2DPI A;  4IR1 A;  3RBD A;  2W55 A;  4DS5 A;  2WF8 A;  3KOO A;  2ZIW B;  5ALF A;  2NRV A;  4PJ0 U;  3Q8S B;  4FBT A;  2XCA A;  4NM1 A;  4XA5 A;  2YML A;  3RFA A;  2AU0 A;  1UA0 A;  2FMQ A;  4MHV A;  3VC8 A;  1NK6 A;  4Q43 A;  3DV9 A;  4CCH A;  4FS1 A;  2KP7 A;  5KAI U;  3BQ2 A;  3ETR A;  1M6Y A;  2E8O A;  2R18 A;  1EXN A;  5CHG A;  4BWJ A;  4R64 A;  1NKC A;  2K4H A;  1K5O A;  3SZ2 A;  9ICI A;  2M0N A;  3QE9 Y;  2KEY A;  7ICR A;  1IXR A;  3GFK B;  3PMN A;  2AQ0 A;  5TIS U;  5ALY A;  1ZQV A;  2P6U A;  4BUG A;  2VA8 A;  4DSF A;  5HMM A;  1MQ2 A;  2E8N A;  2DQN B;  5B5E U;  4RQ7 A;  3TAC B;  3I1Y A;  1D8L A;  1ZQX A;  4DFD A;  2BR0 A;  1NOM A;  2JRZ A;  2FLL A;  1L6N A;  2ZTC A;  5KG5 A;  5J29 A;  3ISC A;  9ICJ A;  2BQ3 A;  5ALX A;  2KKV A;  1DGJ A;  5AK3 A;  2K8B B;  5JRT A;  3M6Z A;  3GV7 B;  3G6Y A;  3MR6 A;  1ZJN A;  5J2C A;  2OEH A;  1L8O A;  2ZJ8 A;  5KFJ A;  2FLN A;  1RYS A;  3F2D A;  5KG0 A;  1WWU A;  3MFH A;  1JXE A;  5KNI A;  2KHQ A;  5AM4 A;  2R8J A;  3ICX A;  3LVV A;  5G5H A;  5AK6 A;  2OH2 A;  2LYH A;  4F5Q A;  3BQ0 A;  3BQ7 A;  3WK9 A;  5L1K A;  3N7R C;  4Y2Y A;  5KFW A;  3MDA A;  2BCV A;  1CEZ A;  3T5L A;  1XC9 A;  4P0Q B;  2K8A A;  4U7C A;  2PFP A;  1X6I A;  5CB1 A;  5DB6 A;  4RQN A;  5KFA A;  2JZB A;  9ICE A;  2F8L A;  5IIO A;  5AI4 A;  1CUK A;  2VAN A;  4HYK A;  3C2M A;  9ICA A;  4JMU A;  4F4X A;  1FFV A;  4YR3 A;  3BS7 A;  2IHM A;  4RNO A;  1ZQA A;  3Q8L A;  9ICQ A;  4RUC A;  8ICW A;  4DCC A;  1V9P A;  4OO1 J;  5J2B A;  1BPB A;  1NKE A;  1Q8K A;  1NJY A;  4I2C A;  3S6J A;  4O5C A;  1PK3 A;  2DUY A;  4F91 B;  1D8Y A;  3M6K A;  3SMV A;  3JPO A;  4K4G A;  3FM9 A;  2PFO A;  3UQ2 A;  5J0Y A;  3B9J A;  2WF6 A;  5HHI A;  2MUT B;  4CNQ A;  1RQN A;  2PFQ A;  1ZQG A;  4US8 A;  1QCK A;  2UVU A;  8ICF A;  7ICH A;  4KLE A;  5AM1 A;  5G5G A;  4DFP A;  4EBE A;  2WAQ C;  2ZIX B;  4F72 A;  1L7M A;  2FMS A;  1ZQN A;  4M9J A;  4C4S A;  1K1Q A;  1X9S A;  4RQ6 A;  1UA1 A;  2XID A;  3M9M B;  4RPY A;  1L3U A;  4QZB A;  1KFS A;  2LHT A;  4WJ3 B;  2WF5 A;  2NV3 A;  2ASJ A;  1ZRN A;  4I27 A;  3H4D A;  4EEY A;  4KLI A;  2FLP A;  4KLF A;  3H8W A;  2HBK A;  5KFB A;  1HUZ A;  1ZD2 P;  2W7O A;  4DL5 A;  3C23 A;  2MSN A;  4QZ9 A;  5H2F U;  3OTQ A;  5KT6 A;  4C4T A;  3OHA A;  3TQ1 A;  2OXO A;  8ICV A;  4LVS A;  4Z6C A;  1ECW A;  3SI8 A;  5DBA A;  3H7I A;  1K1S A;  5DDM A;  3WK6 A;  5BOL A;  1Z00 B;  8ICX A;  4PL2 A;  5DGA A;  1N63 A;  1UCV A;  1ZQB A;  2A1A A;  3QZ8 A;  2OCE A;  2XY6 A;  1AQ6 A;  3PO4 A;  4F92 B;  4ECV A;  2MA1 A;  3QU2 A;  5AIC A;  2AHO B;  5DQG A;  2WHE A;  1IIP A;  3M8R A;  5DLF A;  4JV1 A;  1WCL A;  5AHX A;  3UMG A;  2RP5 A;  4UAW A;  4I2A A;  3PVX A;  2FPL A;  5F9N A;  5TZV A;  5EE9 A;  2W3S A;  4QWE A;  3IDW A;  1D9F A;  2VJ5 A;  2M9N A;  2C22 A;  4Z6E A;  3IG5 A;  2XY7 A;  1NNL A;  1ZD4 A;  4MEY A;  2JZB B;  5ALK A;  2VJ4 A;  1QLN A;  9ICM A;  3M1Y A;  1X66 A;  4NY8 A;  3WKB A;  2HHW A;  4Q8E A;  2V9W A;  5AI8 A;  4F4W A;  5GTH U;  4YMO A;  3KZX A;  2O6K A;  1BGX T;  3V7L A;  3FC4 A;  8ICM A;  4OJ6 A;  1U48 A;  4ECY A;  4QWB A;  4ED1 A;  9ICV A;  2HCF A;  4UB3 A;  2MUT A;  3U26 A;  2ZUC A;  3ZDD A;  2P35 A;  1UPH A;  2OM6 A;  2W9B B;  3PW0 A;  2FDR A;  2HVI A;  4RZR A;  3T5K A;  1PZN A;  2DF4 B;  2WB1 F;  2J6S A;  2W7P A;  3RB6 A;  4MFA A;  2FPK A;  3AMZ A;  3WK7 A;  3CP8 A;  3RH5 A;  8ICR A;  4TUS A;  2BPG A;  4U6P A;  1B0X A;  3F5A A;  1S0O A;  4C8M A;  1N48 A;  5KFE A;  1C7Y A;  4I2D A;  2W54 A;  3T5J A;  1Q3U A;  5AKG A;  1DK2 A;  1ZQF A;  1J2M A;  1FO4 A;  8ICY A;  7ICN A;  3AQE A;  2J6U A;  4LZD A;  7ICO A;  1QSS A;  4MEX A;  7ICT A;  4ELV A;  2L5Y A;  5DG8 A;  1S77 D;  8ICE A;  3TAN A;  2PI4 A;  2JEG A;  3CW2 C;  2DL0 A;  4QZG A;  3IG8 A;  3RAQ A;  2HBJ A;  3K75 D;  3FYH A;  1QQ5 A;  3MR5 A;  1HUO A;  3C2K A;  3AEV A;  2B21 A;  4A8E A;  5DLG A;  2KD1 A;  1PVP A;  1L3S A;  5ALU A;  2NRX A;  4EYI B;  2OWO A;  1PUZ A;  3RJE A;  1FIQ A;  1L7N A;  1S10 A;  7ICU A;  4F4K A;  3RAX A;  1BPE A;  5DB9 A;  2HOF A;  3M9N B;  4J9N A;  8ICT A;  4F5P A;  3MGI A;  3GQC A;  4YCX A;  5IIM A;  4Q45 A;  1UQV A;  4QZD A;  3OPX A;  1LKY A;  3CRX A;  2E3T A;  1C20 A;  2QB0 B;  1KQQ A;  5J0T A;  3Q8Q B;  2W9C B;  2JEJ A;  2NRW A;  1XSP A;  3NVY A;  4JK1 A;  3RJK A;  5ALN A;  3UM9 A;  4BXO A;  4YR0 A;  3WK4 A;  4P2H A;  2LBO A;  5ALQ A;  3QUQ A;  5DBB A;  4YD2 A;  3RBE A;  5AKL A;  5EWF A;  3EPI A;  2G08 A;  3NVZ A;  2AGO A;  9ICR A;  3HRD D;  3OJU A;  4GXI A;  2JV3 A;  3NS1 A;  1KBU A;  1ZQ1 C;  3WKA A;  3LVW A;  1PK1 B;  5AKY A;  1JIH A;  2KN7 A;  4Z6F A;  5EE0 A;  2YX8 A;  4UB6 U;  3MC1 A;  4NXZ A;  2DKX A;  3EYZ A;  4CRX A;  1DXS A;  1ZQM A;  1BVS A;  4F4Z A;  2D6F C;  1F5S A;  5J2E A;  4QJF B;  5AI6 A;  4ZOH C;  1TAM A;  1WYG A;  2BCS A;  3ZDB A;  4FE3 A;  2WFA A;  4KLQ A;  2D8C A;  4UB8 U;  1T3N A;  3SV4 A;  2JR5 A;  3MGH A;  3EUB 2;  5KFY A;  2KJ8 A;  2YB1 A;  4P4M A;  3F2B A;  1S8O A;  1N56 A;  5DBC A;  3Q8M A;  4NLZ A;  1TE2 A;  1NK5 A;  5AI9 A;  2HHQ A;  2JMG A;  3EWA A;  4B9T A;  3V6K A;  4C8O A;  4AYB C;  3T79 A;  4QW8 A;  4RQ8 A;  1XWL A;  3KBB A;  4YG2 A;  2GOL A;  4ECQ A;  1ZXI A;  1XS9 D;  4YMM A;  1WG8 A;  2K89 A;  4QZA A;  1B43 A;  2ZIV B;  3KKA A;  3PZP A;  1Z1B A;  2K8C B;  1X9M A;  4PH5 A;  2HVH A;  4B9N A;  3M7D A;  2ODG A;  1NJW A;  3ZDE A;  1F0M A;  1SZP A;  2RQ5 A;  4CE6 A;  4R63 A;  5KFT A;  3T5H A;  8ICQ A;  4MFC A;  5KG2 A;  5ALT A;  2LKY A;  4Q8F A;  2DBY A;  5ALR A;  1X40 A;  2HHU A;  5KG3 A;  3JPT A;  5J0P A;  3RTV A;  1NK7 A;  1WCN A;  1L3V A;  4RNN A;  8ICA A;  1U45 A;  2G5I B;  4I2J A;  4UAT A;  2ZIX A;  5L1J A;  4YP3 A;  2C28 A;  3KD3 A;  1HJP A;  2HDO A;  3QZ7 A;  5DG9 A;  5J2I A;  1IM4 A;  5ALP A;  4QWA A;  2F44 A;  2KG5 A;  4BDP A;  4PHA A;  4RNM A;  2MRL A;  4I2F A;  5J0W A;  2BCR A;  4DL3 A;  1T4G A;  2BKE A;  1SL0 A;  4JUZ A;  4M9G A;  1YZ7 A;  3MDC A;  2YTU A;  2ZJ5 A;  2EDU A;  2F2A B;  4YXJ A;  4R8U B;  3GV8 B;  1RYU A;  5J0R A;  1ED1 A;  4UBC A;  3T3F A;  5KFI A;  1TK5 A;  5KFL A;  9ICN A;  2NO4 A;  5DB7 A;  4IQW A;  2PMZ C;  4O3Q A;  1NK0 A;  2XCP A;  3GIM A;  5B66 U;  5GTI U;  3QUB A;  5ALV A;  2F77 X;  3AU2 A;  4GFJ A;  4F2R A;  1JXL A;  4J9S A;  2KSO B;  2Y9U A;  3Q8P B;  4USA A;  2EAM A;  5KFX A;  3WU2 U;  2Y9T A;  3FAH A;  1Z1V A;  4B6J A;  5KG6 A;  4GXK A;  4RQ0 A;  3CNH A;  4DFM A;  8ICG A;  2PFN A;  5ALS A;  2XIC A;  2W3R A;  4Y2X A;  4KLS A;  3LDA A;  1BPD A;  2P66 A;  4I2I A;  8ICZ A;  4UQG A;  2KOB A;  2YN4 A;  3H0M B;  1UT5 A;  1SIJ A;  1ZQI A;  3GII A;  3E0F A;  1DK3 A;  1TV9 A;  1JUD A;  2EQY A;  4PZN A;  1ZQK A;  2KZM A;  3NVW A;  2XGQ A;  5ALH A;  4J9O A;  2BZF A;  2C2R A;  4R66 A;  3PW2 A;  4Y2U A;  3NGD A;  2G07 A;  2YY6 A;  9ICX A;  4GXJ A;  2HHS A;  3JPP A;  4GLX A;  3KHG A;  3QUT A;  4C80 A;  2A1J A;  1URJ A;  3ZD9 A;  1SGG A;  8ICB A;  4LJX A;  5DQH A;  8ICI A;  3TAR A;  3TAD A;  2QKQ A;  2Z7J A;  4X5V A;  4RQ2 A;  4ACO A;  5J2A A;  2ZXI A;  2RLT A;  2YMP A;  5EOZ A;  3D2S A;  4ED7 A;  1T7P A;  3PR4 A;  5J0O A;  2R8G A;  1L3T A;  2R8I A;  3J81 j;  2D3D A;  1V38 A;  3B0Y A;  3M8S A;  2E5S A;  2W8L A;  3AU6 A;  1ZQP A;  7ICP A;  2FJ6 A;  4NM2 A;  4C4R A;  2IMW P;  4FZN A;  5AK5 A;  5EWG A;  2VA2 A;  7ICL A;  4JWN A;  4AP9 A;  4NV0 A;  2H5X A;  4ECW A;  1MSW D;  1LKY B;  3I76 A;  5CA7 A;  4UB1 A;  4FZL A;  4DL4 A;  4OJ5 A;  3IV6 A;  4C8K A;  9ICF A;  3R9K A;  5AI0 A;  5AKI A;  3D2Q A;  1FFU A;  4RUA A;  4Y2P A;  2CRX A;  5JUM A;  1ZQO A;  3HIL A;  2ASL A;  1Z4O A;  4YQW A;  5AM3 A;  2UVW A;  2NYV A;  3QU4 A;  5IIN A;  3SAG A;  3PST A;  1A6S A;  3PSF A;  5A0L A;  3IP4 B;  3IHQ B;  4DQS A;  2WF7 A;  3MFI A;  3C2L A;  2GO7 A;  2WF9 A;  5JU5 A;  1ZD5 A;  2W11 A;  2KKP A;  4MF8 A;  1KDH A;  4UAU A;  3WKC A;  4UB5 A;  4JWM A;  2HHX A;  1DOQ A;  5J8Y A;  4O3M A;  3WKD A;  5J2J A;  3JPN A;  3ISB A;  1X9W A;  4IL6 U;  1NKB A;  5IIL A;  4BGD A;  4B9S A;  5C5J A;  7ICG A;  1QQ7 A;  1NI3 A;  5KFF A;  3ONN A;  2ESE A;  4P4P A;  4XRH A;  5T14 A;  4YFK A;  5KFP A;  4PHE A;  5J2G A;  2BCU A;  2HOI A;  1BNO A;  2PI5 A;  4I2B A;  5CEH A;  2QAR B;  5J2D A;  1SV4 A;  4GIB A;  3PML A;  7ICJ A;  1GO3 F;  4PPX A;  1PVQ A;  1LB2 B;  3NRZ A;  8ICH A;  7ICK A;  1IV8 A;  4QZI A;  3Q8R B;  1S0V A;  5KTQ A;  2EAO A;  4DOA A;  3RR8 A;  8ICS A;  1LV5 A;  2OHF A;  2F1H A;  1RZT A;  4QZC A;  5BOM A;  1S5L U;  1SWV A;  2KIC A;  2I5H A;  1CRX A;  2UVV A;  4O5K A;  2W9C A;  2QB1 A;  2EZX A;  4MFF A;  2H3Q A;  3EZ5 A;  1P7D A;  1QTM A;  1COK A;  2R8H A;  1OW5 A;  1S0N A;  4NLK A;  4QW9 A;  1ZQC A;  1KKX A;  4ED8 A;  2FPM A;  5AIB A;  4NL9 A;  2LPE A;  2KIW A;  4QIW C;  4EYH B;  3RJJ A;  2AJQ A;  2KK0 A;  4F2S A;  1PK1 A;  4IRC A;  4DO9 A;  3AQF A;  3HKZ C;  4KIT B;  2DPJ A;  5KFH A;  2J6T A;  1RDF A;  4KX3 A;  2WB1 C;  4FO6 A;  3RRG A;  4Y2J A;  5D4B A;  1X2I A;  3MR2 A;  1S97 A;  2I6X A;  5KFQ A;  5J0S A;  2GLE A;  2LYB A;  2JEI A;  1U49 A;  4YMN A;  1XO0 A;  4F50 A;  2ZIW A;  1N61 A;  3RB3 A;  1T94 A;  4UAZ A;  1F44 A;  1L7O A;  3I28 A;  1B22 A;  2W9A A;  1N5W A;  2K4I A;  3PSI A;  3M9O B;  2W43 A;  9ICW A;  2QB0 A;  3KHL A;  2I9G A;  2XGP A;  2ZTE A;  2DWQ A;  3KTQ A;  2IA6 A;  4KLD A;  4TQR A;  4TUP A;  1Z00 A;  2XVT A;  3BQT A;  2OYY A;  2W03 A;  2IOF K;  4RT3 A;  3SEI A;  3OGU A;  2ZIU B;  4XUS A;  4HAI A;  4G3I A;  9ICH A;  1NZP A;  3NRW A;  1ZQU A;  3TFS A;  4BWM A;  4J03 A;  5HP4 A;  4O3R A;  2HHT A;  5ALD A;  1U9L A;  2LM1 A;  1KFD A;  4PL1 A;  2AQ4 A;  5KFC A;  3KKA C;  3RRH A;  1L7P A;  8ICP A;  5F3X B;  1TAU A;  2LM4 A;  1SB3 C;  5L1L A;  4ECT A;  4DEZ A;  4TUR A;  1XNS A;  3D2N A;  5KFO A;  2B0C A;  2JXJ A;  4IQU A;  2HBL A;  4I28 A;  2C2E A;  5KFG A;  4O3S A;  4EZ9 A;  4Y2S A;  3PSP A;  2KJ5 A;  4NWI A;  5HR6 A;  2F76 X;  2ZUB A;  9ICL A;  2NRT A;  1ZQJ A;  2H3F A;  2Y1J A;  2H3V A;  4DS4 A;  9ICO A;  3SV3 A;  3F53 A;  3EW9 A;  3C5G A;  4IS7 A;  4KMO B;  4R65 A;  2GWS A;  3AM9 A;  4EZ6 A;  3H4B A;  3N7P D;  3JPS A;  4IRK A;  3RJG A;  1ZQR A;  1N5X A;  5HR7 A;  5J2K A;  4UW9 A;  3PY8 A;  9ICB A;  2JEF A;  4Z6D A;  1KL9 A;  4PHD A;  1ZYQ A;  5C0Y A;  7ICQ A;  2IHN A;  2N1R A;  4ED0 A;  4RT2 A;  5DG7 A;  4EX6 A;  1ZQQ A;  1MC8 A;  3RJI A;  3OSP A;  2XO7 A;  2CN1 A;  5KL1 B;  3RB4 A;  5ALE A;  1SXE A;  2WTF A;  4DQP A;  2ALZ A; 
#chains in the Genus database with same CATH homology
 4I27 A;  3H4D A;  4EEY A;  4DSK A;  4KLI A;  3AU2 A;  2FLP A;  4F2R A;  4KLF A;  3H8W A;  1JXL A;  4DLG A;  1ZQY A;  1TK8 A;  4J9S A;  3Q8P B;  5KG1 A;  5KFX A;  5KFS A;  5KG7 A;  5KFB A;  1HUZ A;  1TFR A;  1Y88 A;  2BQR A;  4J9L A;  4DF8 A;  5KT4 A;  4UB2 A;  5KG6 A;  3C23 A;  4DL5 A;  2BCQ A;  4QZ9 A;  1D9D A;  4GXK A;  4RQ0 A;  4DFM A;  8ICG A;  2PFN A;  3PR5 B;  3PX6 A;  4BXO B;  4KLS A;  5KT6 A;  4F5N A;  3LDA A;  3OHA A;  4ECR A;  3TQ1 A;  1BPD A;  2P66 A;  2KZZ A;  4YD1 A;  4I2I A;  3HWT A;  4LVS A;  4Z6C A;  8ICV A;  3ORY A;  3SI8 A;  7ICE A;  5BPC A;  4UQG A;  2ATL A;  8ICZ A;  9ICT A;  1KFT A;  5DBA A;  2PXI A;  3PV8 A;  3Q8K A;  3PNC A;  5DGB A;  4M9H A;  3H7I A;  1NJX A;  1K1S A;  3RJF A;  2A1J B;  2AGQ A;  5DDM A;  2ZTD A;  1UT5 A;  3FDS A;  5BOL A;  2ISO A;  4KLT A;  1Z00 B;  4DOB A;  8ICX A;  5DGA A;  3C1Y A;  1SL1 A;  1ZQH A;  1ZQI A;  3GII A;  4J9Q A;  5IIK A;  4DQR A;  1ZQB A;  4GC6 A;  2BPF A;  1TV9 A;  4MF2 A;  3QZ8 A;  3BQ1 A;  2XY6 A;  3G6V A;  3C5F A;  3PO4 A;  4F92 B;  4QZ8 A;  3BJY A;  2MAX A;  4ECV A;  3PX4 A;  1ZQK A;  2KZM A;  2XGQ A;  4J9O A;  2HHV A;  3HPO A;  4KLO A;  7ICI A;  1TAQ A;  2VA3 A;  4O0I A;  1ZQW A;  4RQ3 A;  4R66 A;  2C2R A;  3PW2 A;  2KZ3 A;  5CR0 A;  5DQG A;  3NGD A;  4QZF A;  9ICX A;  4GXJ A;  5KT7 A;  2IBK A;  2HHS A;  4M9N A;  3M8R A;  3LWL A;  5DLF A;  3QEB Z;  4I2G A;  4JV1 A;  1WCL A;  1JX4 A;  3BDP A;  5CWR A;  3QEA Z;  3JPP A;  4UAW A;  4I2A A;  4GLX A;  3PVX A;  4JV2 A;  3PW7 A;  4YR2 A;  2FPL A;  5F9N A;  5TZV A;  4M47 A;  3KHG A;  4PHP A;  5KT3 A;  4I2E A;  4ED3 A;  4QWE A;  3ISD A;  1JN3 A;  3HT3 A;  2A1J A;  3ZD9 A;  4QZE A;  1ZET A;  1D9F A;  4FBU A;  8ICB A;  2M9N A;  5CJ7 A;  4DSE A;  4KMU A;  5DQH A;  3GIL A;  2C22 A;  1JMS A;  1SKW A;  8ICI A;  4Z6E A;  3TAR A;  4X5V A;  4RQ2 A;  4NLG A;  2I1Q A;  1RPL A;  3NTU A;  3V7K A;  2XY7 A;  4MEY A;  3ZDC A;  4KN7 A;  4IQV A;  5J2A A;  3PO5 A;  2BDP A;  1KTQ A;  2JZB B;  4YXM A;  9ICC A;  5EOZ A;  1SL2 A;  2XY5 A;  1Z3E B;  5HHH A;  4ED7 A;  1T7P A;  3GIJ A;  3PR4 A;  5J0O A;  4EBC A;  2R8G A;  4O3P A;  1QLN A;  8ICJ A;  9ICM A;  1NK9 A;  1L3T A;  2R8I A;  3KHR A;  4ZH4 A;  4NY8 A;  2ISP A;  3SYZ A;  3ETL A;  2HHW A;  4Q8E A;  2V9W A;  3B0Y A;  4F4W A;  1QSY A;  2AGP A;  3M8S A;  3AU6 A;  2W8L A;  4KLG A;  1ZQP A;  4YMO A;  3UXN A;  5HML A;  7ICV A;  4DWI A;  7ICP A;  2KTQ A;  3UXP A;  4ECZ A;  1BGX T;  1RXW A;  1BPZ A;  3LWM A;  4NM2 A;  3V7L A;  5F9L A;  4KLL A;  9ICK A;  4M6W B;  3OSN A;  8ICM A;  1U48 A;  2IMW P;  4ECY A;  4QWB A;  4ED1 A;  4KLU A;  5EWG A;  1NK4 A;  2VA2 A;  4KTQ A;  9ICV A;  4ELT A;  4UB3 A;  2UVR A;  2MUT A;  3HW8 A;  4JWN A;  2ZUC A;  1BPX A;  5D46 A;  3ZDD A;  4IQT A;  4F8R A;  7ICL A;  2H5X A;  9ICP A;  4B9M A;  4F3O A;  4Q44 A;  4DL7 A;  1SKR A;  4KLJ A;  4DSJ A;  4ECW A;  2W9B B;  3PW0 A;  1MSW D;  2HVI A;  5CA7 A;  4UB1 A;  4C8N A;  4RZR A;  3T5K A;  4DL4 A;  2BGW A;  1PZN A;  4M2Y A;  4R8U A;  1ZQL A;  1L5U A;  4C8K A;  9ICF A;  5L9X A;  4RUA A;  1QSL A;  2J6S A;  3RB6 A;  5JUM A;  3V72 A;  1ZQO A;  2ASL A;  4MFA A;  8ICU A;  2FPK A;  5D49 A;  3OHB A;  4YQW A;  1SKS A;  3GDX A;  3RH5 A;  8ICR A;  4B9V A;  4TUS A;  1U4B A;  3IM1 A;  5J2F A;  4F93 B;  4GC7 A;  1XO1 A;  2BPG A;  2UVW A;  5J2H A;  5IIN A;  5III A;  1S0O A;  3AUO A;  4C8M A;  1N48 A;  1DGS A;  1KLN A;  5KFE A;  1C7Y A;  4KLM A;  4I2D A;  4UB4 A;  5DQI A;  3MBY A;  1ZJM A;  3T5J A;  4UAY A;  2HW3 A;  5DDY A;  4F5R A;  4K4H A;  4J9K A;  7ICM A;  3IHQ B;  4YVZ A;  4DQS A;  5J0Q A;  1TVA A;  1ZQF A;  5DB8 A;  3MFI A;  1ZQE A;  3TFR A;  2NRZ A;  1ZQZ A;  8ICY A;  3C2L A;  4M6W A;  7ICN A;  4DFJ A;  2J6U A;  1XU4 A;  4LZD A;  7ICO A;  1QSS A;  4MEX A;  7ICT A;  4J9P A;  4NLN A;  4MF8 A;  4ELV A;  1KDH A;  4JWM A;  4UB5 A;  2BPC A;  2HHX A;  5DG8 A;  5EWE A;  4F4Y A;  3GIK A;  1KRP A;  1COO A;  1S77 D;  1DOQ A;  2DFL A;  3JPN A;  5J2J A;  8ICE A;  3ISB A;  2ZUD A;  1S0M A;  3TAN A;  1X9W A;  3RH6 A;  2PI4 A;  4IR9 A;  2JEG A;  1NKB A;  5IIL A;  3RR7 A;  4BGD A;  4B9S A;  4M0A A;  4YN4 A;  1RXV A;  4QZG A;  3RAQ A;  3K75 D;  5C5J A;  3FYH A;  4PGY A;  3PW4 A;  2R8K A;  7ICG A;  5KFF A;  3MR5 A;  1HUO A;  4DL2 A;  4P4P A;  4XRH A;  4DSI A;  1TK0 A;  3EPG A;  1RYR A;  3C2K A;  2B21 A;  4YFK A;  5KFP A;  4PHE A;  1ZQS A;  5J2G A;  2BCU A;  3V7J A;  5DLG A;  5KG4 A;  1L3S A;  2PI5 A;  4I2B A;  5KFK A;  2NRX A;  3RH4 A;  2KFN A;  4EYI B;  1ZQT A;  2OWO A;  4EBD A;  3RJE A;  4DFK A;  4ELU A;  5J2D A;  3PML A;  3GV5 B;  7ICJ A;  4PPX A;  5IIJ A;  2F1J A;  4RQ4 A;  1S10 A;  1LB2 B;  8ICH A;  7ICU A;  7ICK A;  4F4K A;  4QZI A;  1ZQD A;  4XQ8 A;  3RAX A;  3Q8R B;  1BPE A;  5J0X A;  5DB9 A;  4QZH A;  4KN4 A;  2DPI A;  1S76 D;  3M9N B;  4J9N A;  1S0V A;  8ICT A;  5KTQ A;  4F5P A;  4IR1 A;  3RBD A;  9ICU A;  4DOA A;  3RR8 A;  3MGI A;  4DS5 A;  4RPX A;  1LV5 A;  3H8J A;  3GQC A;  8ICS A;  2F1H A;  4YCX A;  5IIM A;  1RZT A;  4QZC A;  7ICS A;  3N97 B;  4Q45 A;  5BOM A;  2NRV A;  3TAQ A;  4QZD A;  3Q8S B;  4FBT A;  2XCA A;  3PW5 A;  4NM1 A;  8ICO A;  4XA5 A;  1UA0 A;  2AU0 A;  2FMQ A;  1U47 A;  2UVV A;  4TUQ A;  4O5K A;  2W9C A;  1NK6 A;  4Q43 A;  4C8L A;  1T8E A;  5J0T A;  3Q8Q B;  4MFF A;  4CCH A;  2W9C B;  4FS1 A;  3EZ5 A;  2JEJ A;  2NRW A;  1XSP A;  3BQ2 A;  2FMP A;  4JK1 A;  1QTM A;  5KFM A;  3RJK A;  1EXN A;  5CHG A;  4BWJ A;  2R8H A;  4R64 A;  1S0N A;  4BXO A;  4QWD A;  3JPR A;  4NLK A;  4QW9 A;  4P4O A;  5J0U A;  2W9M A;  4YR0 A;  4F5O A;  1NKC A;  1ZQC A;  3SZ2 A;  4ED8 A;  2FPM A;  4P2H A;  4TQS A;  9ICI A;  5KFZ A;  3V6H A;  3QE9 Y;  5DBB A;  4EYH B;  3ZDA A;  3RJJ A;  2AJQ A;  1IXR A;  3GFK B;  4DF4 A;  7ICR A;  3PMN A;  4DOC A;  4YD2 A;  3RBE A;  2AQ0 A;  4ECX A;  4F2S A;  5EWF A;  3EPI A;  8ICK A;  4IRC A;  4DO9 A;  1ZQV A;  2P6U A;  2AGO A;  4KLH A;  9ICR A;  2VA8 A;  4PGX A;  3OJU A;  5KFR A;  4GXI A;  4DSF A;  5HMM A;  1MQ2 A;  4ECS A;  5KFV A;  4KIT B;  2DPJ A;  4RQ7 A;  1JIH A;  5KFH A;  2J6T A;  2KN7 A;  2RDJ A;  4Z6F A;  1D8L A;  2C2D A;  1ARO P;  4NXZ A;  1ZQX A;  3N4M B;  3EYZ A;  4FO6 A;  3UXO A;  4DLE A;  3RRG A;  3C21 A;  2BR0 A;  1NOM A;  5D4B A;  1X2I A;  3MR2 A;  1S97 A;  1ZQM A;  1BVS A;  4RPZ A;  4F4Z A;  2FLL A;  2ZTC A;  3OJS A;  5KFQ A;  5KG5 A;  4QWC A;  5J0S A;  5J29 A;  3ISC A;  9ICJ A;  3C1Z A;  2BQ3 A;  3RJH A;  5J2E A;  1U49 A;  2JEI A;  4YMN A;  4F50 A;  3UQ0 A;  2BCS A;  4PGQ A;  4I2H A;  3ZDB A;  3RB3 A;  4KLQ A;  2KFZ A;  1T3N A;  4UAZ A;  4J9M A;  3GV7 B;  3SV4 A;  1B22 A;  2W9A A;  3G6Y A;  4E0D A;  3MGH A;  3MR6 A;  5KFY A;  1ZJN A;  3M9O B;  4ED6 A;  3TI0 A;  4P4M A;  5J2C A;  9ICW A;  1N56 A;  3MR3 A;  2ZJ8 A;  3KHL A;  5DBC A;  3Q8M A;  4NLZ A;  5KFJ A;  4RQ5 A;  2XGP A;  2ZTE A;  1NK5 A;  2FLN A;  1RYS A;  2I9G A;  2IA6 A;  3KTQ A;  1XSL A;  4TQR A;  4TUP A;  4KLD A;  5KG0 A;  2HHQ A;  3H40 A;  3PX0 A;  3EWA A;  8ICN A;  1Z00 A;  3MFH A;  3MAB A;  1JXE A;  1H38 A;  3V6K A;  4B9T A;  4C8O A;  4I29 A;  4M9L A;  3BQT A;  2R8J A;  5KT2 A;  4RT3 A;  3UPQ A;  4M04 A;  2LYH A;  5DKW A;  3OGU A;  4QW8 A;  4F5Q A;  4XUS A;  4B9U A;  4G3I A;  3BQ0 A;  9ICH A;  1ZQU A;  4RQ8 A;  5L1K A;  1XWL A;  5KFW A;  3MDA A;  3B0X A;  3TFS A;  4YG2 A;  2BCV A;  4ECQ A;  1CEZ A;  3T5L A;  1S9F A;  5CP2 A;  1XS9 D;  4YMM A;  2F1I A;  1XC9 A;  1MQ3 A;  4BWM A;  4DSL A;  5HP4 A;  4O3R A;  4QZA A;  2HHT A;  1B43 A;  1U9L A;  2PFP A;  3ZD8 A;  3RB0 A;  5CB1 A;  1X9M A;  1TKD A;  4PH5 A;  4UBB A;  4B9N A;  1KFD A;  2AQ4 A;  4K4I A;  3E2E A;  2HVH A;  5DB6 A;  1NJW A;  5KFC A;  3K4G A;  3ZDE A;  2XC9 A;  1SZP A;  5HNK A;  4R63 A;  4FS2 A;  1XSN A;  5KFT A;  5KFA A;  3RRH A;  3T5H A;  2JZB A;  9ICE A;  5IIO A;  8ICP A;  1A77 A;  1CUK A;  8ICQ A;  1TAU A;  5L1L A;  4ECT A;  2VAN A;  4DEZ A;  4HYK A;  5KFN A;  4TUR A;  3C2M A;  1KSP A;  4MFC A;  9ICA A;  4F4X A;  2W8K A;  4O5E A;  5KG2 A;  4YR3 A;  2IHM A;  5KFO A;  2Y1I A;  2P6R A;  4IQU A;  4RNO A;  4RU9 A;  1ZQA A;  4O3N A;  3Q8L A;  3HX0 A;  3H8S A;  9ICG A;  9ICQ A;  4LZG A;  4RUC A;  4ED2 A;  4I28 A;  2C2E A;  1BPY A;  4Q8F A;  5KFG A;  8ICW A;  2ASD A;  1V9P A;  4O3S A;  4EZ9 A;  5L1I A;  2HHU A;  5KG3 A;  5J2B A;  1BPB A;  1NKE A;  8ICL A;  1NJY A;  4I2C A;  3JPT A;  5J0P A;  3RTV A;  5KFD A;  4O5C A;  4O3O A;  1NK7 A;  2RDI A;  1WCN A;  4F91 B;  1D8Y A;  1A76 A;  2Q0Z X;  3JPO A;  4K4G A;  4B9L A;  7ICF A;  2ZUB A;  3KHH A;  1L3V A;  4ECU A;  4RNN A;  2W9B A;  2V4Q A;  3HP6 A;  3TAP A;  8ICA A;  1U45 A;  4I2J A;  2PFO A;  3UQ2 A;  5J0Y A;  2NRT A;  9ICL A;  9ICS A;  5HHI A;  2MUT B;  1ZQJ A;  2ZJA A;  5L1J A;  4DS4 A;  2Y1J A;  2PFQ A;  4IRD A;  4YP3 A;  2C28 A;  9ICO A;  1ZQG A;  1HJP A;  2UVU A;  3QZ7 A;  8ICF A;  1KEJ A;  3SV3 A;  7ICH A;  1UT8 A;  3EW9 A;  5DG9 A;  3C5G A;  4KLE A;  4R65 A;  2GWS A;  5J2I A;  4EZ6 A;  1IM4 A;  4QWA A;  3H4B A;  3THV A;  4DFP A;  4EBE A;  3JPS A;  4IRK A;  3RJG A;  1ZQR A;  4BDP A;  4PHA A;  2FMS A;  4RNM A;  5J2K A;  1ZQN A;  4I2F A;  3PY8 A;  9ICB A;  5J0W A;  2JEF A;  5KFU A;  4Z6D A;  5KT5 A;  2BCR A;  4M9J A;  2BHN A;  4PHD A;  4DL3 A;  1K1Q A;  1T4G A;  4JV0 A;  2BKE A;  1ZYQ A;  1NK8 A;  1SL0 A;  3LK9 A;  2V4R A;  2BQU A;  4JUZ A;  1X9S A;  4M9G A;  7ICQ A;  4RQ6 A;  2IHN A;  3MDC A;  4ED0 A;  3JPQ A;  1UA1 A;  2ZJ5 A;  4YXJ A;  4R8U B;  3V6J A;  3M9M B;  4RPY A;  3GV8 B;  5J0R A;  4RT2 A;  5DG7 A;  1L3U A;  1ZQQ A;  1MC8 A;  3RJI A;  3OSP A;  4QZB A;  4UBC A;  1KFS A;  4DQQ A;  2XO7 A;  1NJZ A;  3T3F A;  5KFI A;  3RB4 A;  3G6X A;  1TK5 A;  5KFL A;  9ICN A;  4RQ1 A;  4J9R A;  8ICC A;  5DB7 A;  4DQI A;  2WTF A;  4IQW A;  4O9M A;  2ASJ A;  4O3Q A;  1NK0 A;  2XCP A;  4DQP A;  3GIM A;  2ALZ A;  4DL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...