1B22A

Rad51 (n-terminal domain)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
EEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-terminal domain of the human Rad51 protein binds DNA: structure and a DNA binding surface as revealed by NMR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA REPAIR PROTEIN RAD51
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1998-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1b22A00
2M9NA 5EOZA 4QWEA 5D46A 3PW0A 9ICAA 3RH5A 2BR0A 1Z3EB 1QSYA 1ZQUA 4TUPA 3OGUA 1S10A 1BVSA 1SKRA 5KG3A 5DBCA 5KFQA 4DL2A 3OSPA 4KMUA 4UB5A 3NGDA 2J6UA 4YD2A 1UA1A 3MDCA 4ECYA 3GIKA 2BDPA 7ICVA 1K1SA 9ICCA 4YMOA 1ZQHA 5DG8A 5KFIA 1ZETA 4CCHA 4ECWA 4RUAA 8ICPA 3M9NB 4QZBA 3T5HA 4RQ0A 4Q8EA 1SL1A 2P6RA 1XO1A 4YR2A 5KFYA 2XGPA 4R64A 5DB8A 4YXMA 1ZQOA 4DLGA 3AU6A 2A1JB 1BPDA 8ICKA 5HMLA 3B0XA 4P4MA 1TVAA 1A76A 5TZVA 5L1JA 4M04A 1L3UA 3JPRA 3SI8A 1NKBA 1S76D 3OHBA 3V7KA 4IRKA 3Q8QB 7ICLA 2LYHA 2AQ0A 2NRXA 3RR8A 4KLFA 2BCRA 7ICMA 4QZAA 3MFHA 3UQ0A 3MR2A 2AU0A 3V6JA 3G6YA 4ECVA 4GC6A 1SKWA 4R8UA 4Q43A 4IR9A 1S0VA 4MFCA 2HHWA 3PMNA 4Z6DA 3UQ2A 8ICMA 9ICLA 3IM1A 1ZQFA 8ICTA 1SKSA 5KG5A 4MF2A 3T5JA 4RQ2A 1Y88A 5C5JA 1L3SA 3BQ1A 4O9MA 3BQTA 1TFRA 3RB0A 8ICFA 4YR0A 4IRDA 5DKWA 4O3QA 1ZQDA 4QWBA 3PVXA 4O3OA 2W8KA 3PX6A 5D49A 2PI5A 4O3SA 4M6WB 3FDSA 4BXOA 5KFWA 1MC8A 3N4MB 2BPGA 5KG7A 4F4XA 4FO6A 4EBCA 4IQWA 4EBEA 4DQQA 4M9JA 5CHGA 1WCNA 1XU4A 3RJKA 4UBBA 3EW9A 5KFFA 4DFKA 4RNOA 5J0QA 3C5GA 2R8KA 3V7LA 4Q45A 2ISPA 4BWMA 4RQ5A 1TK8A 3EYZA 4YFKA 4DSLA 4ED7A 2W9MA 2C22A 1T8EA 1JX4A 5J2IA 3H7IA 1RZTA 4BGDA 1HUOA 7ICPA 4RU9A 3ISCA 2B21A 3C1ZA 3C2MA 1KSPA 2KTQA 2FLPA 2JZBB 4BWJA 7ICTA 1DOQA 2Y1IA 5KFNA 3G6VA 8ICEA 2F1JA 1QSLA 4DOAA 2C2EA 7ICIA 2W9BA 2BPFA 3AUOA 5DQHA 5DBBA 4QZ9A 5L1IA 4M0AA 8ICSA 4I2JA 5EWGA 1NKEA 2H5XA 4DL3A 4NM2A 2DPIA 5KG4A 4JUZA 4DF8A 4F50A 4RUCA 1N56A 3RR7A 3RH6A 4P4PA 4F2SA 4ECUA 5HP4A 3MDAA 5DDYA 3MGIA 4YN4A 2BCUA 8ICOA 4J9QA 3PX4A 4XRHA 4JV2A 7ICHA 9ICGA 4ZH4A 3V72A 3ZDEA 4UQGA 4Z6EA 3H8JA 2V4RA 2PFNA 1MSWD 4O3RA 4RNNA 1Z00B 2BCQA 3GFKB 3H4BA 3ISBA 1MQ2A 4G3IA 3RBDA 7ICFA 4KN7A 4RPXA 2JEFA 3OSNA 3MR3A 4DFPA 3C1YA 3C23A 4ECSA 2HHVA 2BGWA 4KLGA 4RQ1A 4BXOB 4KTQA 1S97A 4QZCA 5IINA 1A77A 2FMQA 3RTVA 4ED3A 5J0SA 3H4DA 4IRCA 4MF8A 2C28A 4QWAA 3FYHA 3ISDA 3ZDCA 4QWDA 1BPZA 3ORYA 3V6KA 3EPIA 1L5UA 1ZQCA 2ZUBA 4F5RA 3RRGA 2AGPA 4F8RA 3RJJA 2HVIA 1KFTA 3HPOA 1UT8A 4TQSA 2W9CB 5J0YA 4DL7A 2GWSA 1ZYQA 8ICQA 5KT4A 2PXIA 1S77D 1ZQVA 4RZRA 7ICQA 1NK6A 5J2HA 5CB1A 4ECXA 4I27A 3RRHA 1C7YA 3H8SA 5KFZA 3T5KA 4I2IA 4P4OA 4FS2A 4PHPA 3RJFA 4PGYA 4LVSA 2AGQA 4B9UA 5J0RA 3GV5B 3PW2A 5KFCA 4M9HA 4TQRA 4DS5A 5KFBA 2AGOA 1RYSA 3MABA 8ICYA 1XC9A 3JPQA 3ZDBA 2PFOA 1XSLA 9ICSA 5DG7A 1KFDA 3ETLA 4R66A 1X9MA 1D9DA 9ICWA 2FMSA 4LZGA 2F1IA 4RQ7A 5DQIA 2W9AA 4F5QA 5DB7A 1ZQJA 4YCXA 1JIHA 3UPQA 9ICMA 8ICCA 4I28A 8ICRA 3Q8KA 2XCPA 3GIMA 4O3PA 2W9BB 9ICQA 4XA5A 4EEYA 2IBKA 5CR0A 2ZTEA 5DGBA 5DLGA 5J2GA 3C5FA 1ZQZA 3TFRA 5CJ7A 3RJHA 1U49A 3RJEA 4E0DA 1PZNA 3H8WA 4IQUA 3QZ8A 3OJUA 4TURA 9ICPA 2JZBA 3UXOA 4ED6A 1TK5A 3N97B 4UB2A 3EPGA 5HMMA 1ZQBA 1ZQSA 1BPXA 4M9GA 4J9KA 4KLLA 4ECZA 1B22A 4DF4A 1ZQQA 3M9MB 8ICVA 2BQRA 4YR3A 4DL4A 1K1QA 3UXNA 1BGXT 3LK9A 2XY5A 4DO9A 2HVHA 4J9MA 1COOA 1ZQMA 4GXJA 4DFJA 2ASLA 1KEJA 3QZ7A 1DGSA 5DQGA 4F4WA 3ZDAA 1UT5A 3THVA 2OWOA 2MUTA 8ICGA 4DSKA 1XWLA 2Y1JA 4FBTA 1RYRA 3QEAZ 4DL6A 4KLJA 1KLNA 1L3VA 4B9SA 3ZDDA 1LB2B 2P6UA 3AU2A 5KFVA 4ED0A 4QW9A 1U48A 1ZQEA 4M9LA 5KFSA 2F1HA 5KFKA 4FS1A 4J9LA 2MAXA 9ICIA 1ZQNA 1X9SA 1D9FA 4BDPA 4F4YA 1NJZA 4ELTA 3JPNA 4ED1A 3HX0A 2IHNA 1NK8A 3H40A 3BDPA 3PW5A 1EXNA 4IQTA 5D4BA 3PX0A 3GIJA 3TARA 4YVZA 3C2LA 2NRVA 4EYIB 1TK0A 1RXWA 4Z6FA 4B9MA 3RJGA 2J6TA 4I2EA 3NTUA 4RNMA 3OHAA 4ECRA 1XSPA 4ELVA 1T7PA 4M9NA 1XS9D 5KT2A 2XCAA 4I2BA 9ICNA 2W9CA 4PHDA 4O0IA 2FLNA 4KLSA 4HYKA 1HJPA 4B9NA 3GILA 5KT3A 4ELUA 4IQVA 5IIMA 4QZDA 4DSFA 5KFTA 4DQIA 2UVRA 4QZGA 2JEIA 4DSJA 2KFZA 1N48A 3MGHA 3PW4A 1QLNA 3JPSA 2UVVA 9ICFA 3GQCA 9ICTA 8ICZA 1JMSA 4R8UB 2IMWP 2ZUCA 3T5LA 9ICUA 1NJXA 1KTQA 9ICOA 4PPXA 1QTMA 4KLUA 2XY7A 2BQ3A 4KLQA 1S0MA 2V9WA 3RB4A 2ZTDA 5KFPA 1NK5A 5KFRA 3RH4A 1KDHA 1NKCA 4DSIA 4B9TA 4ECTA 5L1LA 3UXPA 4EZ6A 1T3NA 5BOMA 4KLHA 2V4QA 5KT7A 5J0TA 3GIIA 7ICKA 8ICIA 4DOCA 4F5NA 1KFSA 3SV3A 9ICKA 9ICXA 2ZJ5A 2BCSA 3JPOA 4DWIA 3JPPA 4KLTA 4F93B 3SV4A 4KLEA 5J2BA 4K4IA 3MR5A 4JV0A 2HHTA 4M47A 2FPMA 1BPBA 3KHHA 4J9SA 3PV8A 2XY6A 4C8NA 1D8YA 2VANA 5IILA 1ZQRA 4C8OA 4KITB 4DQRA 1V9PA 1LV5A 2BCVA 4ED8A 3RAXA 2JEJA 2VA8A 1AROP 9ICBA 8ICJA 4DQSA 9ICJA 4NXZA 2R8IA 7ICGA 5L9XA 3MFIA 1L3TA 3T3FA 2C2DA 4GXIA 4EBDA 2J6SA 4I29A 7ICRA 5J2AA 4UBCA 3KHRA 4PGQA 2HHXA 2ZTCA 2XGQA 3Q8RB 2I1QA 4QZ8A 4UAZA 3V7JA 2UVUA 5HNKA 7ICNA 4DLEA 1ZQWA 4UB4A 3C2KA 3TANA 4YXJA 2ZJAA 4F3OA 4F5PA 2PFPA 2KZZA 5EWEA 5J2DA 5CWRA 4KLIA 3C21A 5KG0A 1BPEA 3HWTA 4B9VA 1RPLA 1U4BA 1S0NA 2Q0ZX 5IIOA 2ASJA 4I2GA 4YD1A 4RT2A 4RQ4A 1TAQA 2PI4A 2FPKA 4M6WA 4PH5A 1RXVA 4F2RA 4KLDA 8ICHA 3MBYA 2R8HA 7ICJA 5EWFA 3G6XA 4KN4A 3Q8MA 1JXEA 4PGXA 2BQUA 1U9LA 1NOMA 5KG6A 4RQ3A 4C8KA 4MEXA 2VA3A 7ICSA 3EWAA 4JK1A 4UB1A 5CA7A 5J29A 4ED2A 3TFSA 4DS4A 9ICEA 4LZDA 4RQ6A 5DB9A 4RPZA 4TUQA 4YG2A 3PW7A 4PHAA 1S9FA 1ZQTA 4XUSA 4F92B 3Q8SB 4KLMA 2FPLA 4UAYA 4NLGA 1T4GA 3PR4A 3RJIA 4GC7A 4XQ8A 3BQ2A 2DPJA 4J9RA 4Q8FA 8ICXA 1NK4A 1KRPA 2IA6A 3PO4A 1WCLA 4R65A 4JWMA 4FBUA 4RPYA 2KZ3A 5KT6A 3EZ5A 4QZHA 3JPTA 2BKEA 3KHGA 3KHLA 5DGAA 1U45A 2PFQA 2VA2A 4NM1A 4NLKA 2I9GA 7ICEA 1JN3A 3RB6A 3LWLA 2R8GA 2KZMA 4R63A 2BPCA 5KFOA 5KT5A 4F4KA 3IHQB 1ZQKA 5KFXA 5L1KA 1ZQPA 5DDMA 3M9OB 4RQ8A 4TUSA 1Z00A 4DL5A 5IIKA 5J2CA 2UVWA 2NRZA 4I2FA 1U47A 1MQ3A 1NK9A 1ZQGA 5J0XA 2AQ4A 5F9NA 2P66A 5J0OA 4RT3A 1NJYA 4QWCA 1SZPA 3M8RA 4I2CA 2ATLA 3KTQA 5IIIA 1NK0A 1B43A 3GDXA 3K4GA 9ICVA 5KG1A 2NRTA 5KFAA 5KFDA 1ZQXA 4YMMA 3PNCA 5BPCA 4DOBA 3MR6A 4MFAA 8ICUA 1NK7A 5KG2A 3GV7B 4MEYA 1ZQYA 5J2KA 4J9NA 4K4HA 1SL0A 1NJWA 1HUZA 1CEZA 4X5VA 4F91B 1IM4A 5JUMA 4JWNA 1ZQIA 8ICLA 1S0OA 1H38A 2JEGA 3PO5A 3PY8A 4QZFA 4YQWA 1IXRA 4I2DA 5F9LA 1ZJMA 1TAUA 4NY8A 1TKDA 4P2HA 4ECQA 3E2EA 3RAQA 2HW3A 5J2FA 5KFGA 2C2RA 5HHIA 4F4ZA 8ICAA 5DG9A 5J2EA 1CUKA 4PHEA 5J0UA 9ICRA 3HT3A 4O5CA 2FLLA 2KN7A 3M8SA 1ZQAA 2HHUA 5J0WA 2ISOA 2HHSA 1D8LA 3OJSA 4MFFA 2AJQA 3RB3A 3TAPA 4YMNA 4JV1A 2KFNA 5KFHA 2R8JA 2XC9A 4GLXA 4IR1A 2ASDA 1X2IA 4YP3A 4O5EA 4EZ9A 4I2AA 2DFLA 4B9LA 3TI0A 2RDIA 3SZ2A 3BJYA 4GXKA 3LDAA 3ZD9A 5DBAA 3QEBZ 4DFMA 2W8LA 4NLNA 4F5OA 2ZJ8A 2WTFA 4UB3A 2ALZA 1JXLA 4I2HA 4M2YA 1X9WA 4C8LA 3LWMA 4DSEA 1UA0A 2ZUDA 4Q44A 3B0YA 8ICWA 2MUTB 4NLZA 3TAQA 4K4GA 3PR5B 2FMPA 3BQ0A 3HW8A 3RBEA 3K75D 4J9PA 3ZD8A 5KTQA 2BHNA 3Q8LA 2IHMA 4QW8A 2RDJA 5KFUA 1TV9A 5HHHA 9ICHA 4DQPA 1ZJNA 1QSSA 4QZIA 4O3NA 5KFLA 5CP2A 3SYZA 7ICUA 1ZQLA 5J2JA 4QZEA 5KFMA 2XO7A 4O5KA 5KFJA 3TQ1A 2NRWA 4C8MA 5DLFA 8ICNA 5IIJA 5J0PA 4EYHB 3V6HA 5BOLA 4UAWA 4J9OA 3QE9Y 1XSNA 3Q8PB 3GV8B 3HP6A 1SL2A 1BPYA 8ICBA 4KLOA 2HHQA 2A1JA 5KFEA 3PMLA 4Z6CA 4DEZA 7ICOA 5DB6A
chains in the Genus database with same CATH superfamily
5AKJA 2K4HA 2AHOB 1QSYA 1ZQUA 4TUPA 1BVSA 2J6UA 2BDPA 9ICCA 3HKZC 4RUAA 8ICPA 4RQ0A 2P6RA 5KFYA 4R64A 3KBBA 5HMLA 2OH2A 3WKAA 3Q8QB 2AQ0A 1Z4NA 2BCRA 5AI8A 5L1MA 3UQ0A 2AU0A 1S76D 2XICA 3F2DA 4GC6A 4ECVA 2KIVA 9ICLA 5KG5A 4O9MA 5DKWA 4O3QA 4QWBA 2KE7A 4O3OA 3PVXA 3PX6A 2PI5A 4M6WB 3FDSA 4BXOA 4FO6A 4EBCA 2HMXA 4M9JA 5AK3A 4UBBA 2ISPA 5E79U 4ED7A 1JX4A 5AKGA 1C20A 4RU9A 3ISCA 2B21A 3C1ZA 3C2MA 1KSPA 4BWJA 7ICTA 4CNQA 2Y1IA 1JI7A 3QU4A 5KFNA 3G6VA 7ICIA 5DBBA 1NKEA 2W03A 4F50A 1N56A 5ALSA 4ECUA 5DDYA 4O3MA 8ICOA 4XRHA 1J2NA 3ZDEA 1X6IA 3H8MA 2P35A 2PFNA 5JU5A 1N5XA 3HILA 4G3IA 1KW4A 4DFPA 5G5GA 2HHVA 2BGWA 5J8YC 4KTQA 4QZCA 5AM1A 4ED3A 5AM2A 2WAQC 3ZDCA 3ORYA 1ZQCA 4F5RA 2Y9UA 2HBLA 3I28A 4TQSA 4DL7A 2GWSA 1ZQVA 1C7YA 3H8SA 5KFZA 4I2IA 3RJFA 4QJFB 2LM4A 4C4RA 4PGYA 5ALKA 5J0RA 1RYSA 5EE1A 2PFOA 5AKYA 3WK8A 1F0MA 3WK9A 1X9MA 3F2CA 4RQ7A 4F5QA 5DB7A 4YCXA 8ICCA 2HI0A 4UW9A 4XA5A 2IBKA 3FAHA 2LPEA 3TFRA 1ZQZA 5CJ7A 9ICVA 3RJEA 3OJUA 3H8WA 5KNIA 4TURA 5AK5A 4ED6A 4A8EA 4UB2A 4M9GA 4AYBC 4ECZA 3M9MB 3F5AA 2XVTA 3UMGA 2BQRA 3NUQA 2XY5A 4J9MA 1NI3A 4DFJA 4IC9A 1PK3A 2ESEA 1UT5A 1XWLA 4FBTA 4DL6A 4OJLA 4EELA 3AU2A 1U48A 3L4PA 5KFKA 2OXOA 5ALGA 4ELTA 3GU3A 3HX0A 4YVZA 2YB4A 1L6NA 1XSPA 2ZIVB 2H3QA 3ZI4A 1Q3VA 4PHDA 2WF8A 4O0IA 1HJPA 4IQVA 4DSFA 2JGAA 2A19A 3MGHA 3JPSA 2UVVA 4Y2YA 2YX8A 4Y2UA 2Q4TA 1S0MA 2V9WA 3QNMA 3RB4A 2KJ5A 1NKCA 4DSIA 3M7DA 1L7PA 3GIIA 2A3VA 8ICIA 1M6YA 1KFSA 9ICXA 2ZJ5A 3JPOA 4DWIA 4KLTA 2K8CB 4KMOB 2K8AA 3SQIA 4KLEA 5J2BA 3MR5A 1SGGA 2DUYA 4M47A 2FPMA 2KP7A 4HAIA 3DV9A 5IILA 2F2AB 4ED8A 4OJ5A 2VA8A 1X42A 8ICJA 2E1EA 4RQMA 2N1RA 2J6SA 2ZTCA 3D6JA 2XGQA 4GIBA 4UAZA 3V7JA 2UVUA 4FZLA 2D6FC 1CI4A 2KZZA 5CWRA 3C21A 5KG0A 3KKAA 1GO3F 4RT2A 2PI4A 1ZRMA 2FPKA 4PH5A 1RXVA 2E5SA 1L7NA 4F2RA 4KLDA 3G6XA 4KX5A 2BQUA 2VA3A 4UB1A 2KHVA 4CRXA 3WK5A 4DS4A 4RQ6A 3PW7A 1S9FA 2KK0A 4CF5A 2HSZA 4UAYA 4NLGA 3PR4A 2LI6A 4XQ8A 5ALRA 2KICA 3PO4A 1YT3A 3EZ5A 2XI9A 3KHLA 4NLKA 2JEIA 2XIDA 1NNLA 2VA2A 4PJ0U 2WFAA 3QU9A 1UQVA 3M9OB 4DL5A 2UVWA 5J2CA 2NRZA 2AQ4A 1NJYA 2ZG6A 1NK0A 1B43A 3GDXA 5AI5A 3WK6A 3PNCA 2E8OA 2ZIXB 5CRXA 4F91B 5JUMA 3PY8A 3PO5A 1IG6A 2KKVA 4QZFA 5F9LA 2W3SA 4P2HA 2HW3A 1KQQA 4C0ZA 4EENA 5DG9A 5J0UA 3HT3A 1ZD3A 2FLLA 2KN7A 2HHUA 5AICA 1D8LA 2KV2A 3RFAA 5KFHA 3MGVA 4O5EA 5ALVA 4I2AA 3BJYA 3ZD9A 4NLNA 2ALZA 4I2HA 2YMMA 1B4FA 1PVPA 4Q44A 3NASA 1KKXA 3TAQA 3PR5B 1TE2A 3HW8A 4J9PA 2W04A 3Q8LA 5KTQA 3NS1A 5HHHA 4DQPA 1QQ5A 5KFLA 5CP2A 1JRPA 3SYZA 1ZQLA 4RQNA 5KFMA 2WF6A 4O5KA 5KFJA 1HEKA 4C8MA 5J0PA 4EYHB 4UAWA 4WJ3B 3ICXA 3Q8PB 3HP6A 8ICBA 4U7CA 2EAMA 2NO4A 1RYUA 4Z6CA 7ICOA 3PSTA 2KMDA 4QWEA 5KAFU 3RH5A 1Z3EB 2NYVA 3OGUA 3MC1A 5KG3A 3OSPA 5AM0A 1LKYA 4NL9A 3SENA 4UB5A 3RF9A 4U6PA 1X66A 2ZIWA 3GIKA 1ZQHA 2RQ5A 4CCHA 3QUBA 3PSPA 4QZBA 4Q8EA 3ED5A 1UHUA 2QARA 1BPDA 8ICKA 3B0XA 1ZD2P 1NKBA 3OHBA 3KZXA 4IRKA 1YZ6A 2NRXA 3RR8A 2ZXIA 3MFHA 4IR9A 8ICFA 4Q43A 5JTIA 5HR7A 3PMNA 3UQ2A 8ICTA 4RQ2A 3IG8A 2W8KA 4UB6U 1MC8A 3N4MB 5KG7A 2A1AA 4IQWA 2JHDA 1SXDA 5AKIA 4BWMA 3IP4B 2C22A 5J2IA 2KJ8A 2KTQA 2K4IA 1DOQA 5ALOA 4DOAA 1FO4A 4I2JA 1N63A 5EWGA 3CW2C 3PSFA 3QUTA 4NM2A 3GZFA 4JUZA 1TAMA 3RH6A 3MDAA 7ICHA 3AM9A 2QKQA 2QARB 1F5SA 4O3RA 1Z00B 1QCKA 3IRUA 3H4BA 3ISBA 1MQ2A 1UCVA 3N7RC 3QX7A 7ICFA 1Z19A 2JEFA 3OSNA 5AKXA 3C23A 4UAVA 2JXJA 5FP0A 3U26A 2G08A 3UMCA 1S97A 4LJXA 5J0SA 5KL8B 3H4DA 4MF8A 2C28A 3M6ZA 3ISDA 4P0PA 4QWDA 1BPZA 3V6KA 1L5UA 5ALPA 4PL1A 3RRGA 2AGPA 3RJJA 2HVIA 1YZ7A 1UT8A 2W9CB 1ZYQA 4OJOA 5KT4A 4Y2JA 2JH1A 4Y2SA 4OCZA 3SAHA 7ICQA 1N62A 3R9KA 1NK6A 4FE3A 5CB1A 4FS2A 2LKYA 2D8CA 3GV5B 3N7PD 4M9HA 5KFBA 1XC9A 3JPQA 5DG7A 1KFDA 1SIJA 9ICWA 2FMSA 4LZGA 2F1IA 1RG6A 1JIHA 3Q8KA 3GIMA 5DLGA 4KLJA 1SV0A 1U49A 1PZNA 3QZ8A 9ICPA 2AH5A 5HMMA 1BPXA 4KLLA 4DF4A 1BGXT 2M0NA 4GXJA 1KEJA 1DGSA 1SWWA 3D2NA 3HKZF 4UATA 3ZDAA 5ALQA 3THVA 2MUTA 1LVHA 2Y1JA 3NRZA 2DF4B 4B9SA 3H0MB 3ZDDA 1LB2B 2P6UA 5KFVA 1ZQEA 4J9LA 9ICIA 1ZQNA 4JMUA 3NVYA 1N61A 1D9FA 3KZIU 1NJZA 3K1ZA 1WUDA 1EXNA 4IQTA 5JRTA 5D4BA 3PX0A 1RXWA 2NRVA 4Z6FA 2J6TA 4I2EA 3NTUA 2H3VA 3QUQA 4PZNA 5ALNA 1XS9D 2VKQA 1T3QA 4HYKA 4B9NA 1JALA 5AK6A 4QZDA 4DQIA 4Y2VA 9ICTA 8ICZA 2ZUCA 9ICUA 1KTQA 9ICOA 2W55A 2XY7A 2BQ3A 4BX9C 2ZTDA 5KFPA 2YMLA 1NK5A 2IOFA 2D3DA 4J03A 4B9TA 4ECTA 2F76X 3UXPA 5BOMA 5KT7A 7ICKA 4DOCA 4US8A 3SV3A 3F5EA 9ICKA 3IDWA 4F93B 2YQEA 1PUZA 1PVQA 1P7DA 4K4IA 5TISU 2KIWA 3KHHA 2ZIWB 3LVWA 1D8YA 1ZQRA 5AKEA 1V9PA 4IL6U 1LV5A 1XO0A 2JEJA 1IIPA 3OTQA 2JMGA 4UAUA 2RLTA 3VC8A 2LBOA 2C2DA 7ICRA 2HHXA 4PGQA 2Y9TA 7ICNA 5AIAA 1ZQWA 1N60A 4YXJA 1L8OA 3A0HU 5J2DA 4KLIA 1BPEA 1S0NA 4YD1A 1AQ6A 1T94A 2KSOB 2R8HA 7ICJA 5EWFA 4PGXA 3O0FA 1NOMA 5KG6A 4MEXA 7ICSA 3EWAA 4OD0A 3TFSA 4RPZA 2KNJA 3BQ7A 4GC7A 2DPJA 1O03A 2K4EA 2LYBA 5DGAA 2BKEA 3KHGA 7ICEA 2I9GA 1JN3A 3LWLA 2BPCA 5KT5A 3IHQB 1ZQKA 1K5OA 2EZXA 5IIKA 1WG8A 4FZMA 4RT3A 4QWCA 1SZPA 3M8RA 2ATLA 2FI1A 5ALTA 5KFAA 5BPCA 3BS7A 1NK7A 4MEYA 1ZOLA 1XNSA 2LM1A 4JWNA 5GTHU 1ZQIA 4YQWA 1ZJMA 2I6XA 4ECQA 3RAQA 3DEEA 8ICAA 5J2EA 1CUKA 3WU2U 1ZQAA 2G5HB 3S6JA 2ISOA 3WKBA 2F77X 4Y2QA 2R8JA 1X2IA 4EZ9A 1OXJA 4BUGA 4C80A 3TI0A 2RDIA 4AYBF 4B9LA 4NV0A 4GXKA 3QEBZ 2W8LA 4F5OA 4UB3A 4C8LA 1Q8KA 3LWMA 2ZUDA 2AXTU 2MUTB 4NLZA 1Z1BA 4K4GA 2BHNA 2KD1A 3FC4A 1QSSA 4O3NA 7ICUA 2EAOA 4QZEA 5IIJA 2QLTA 4US9A 1XSNA 1SL2A 3GV8B 1BPYA 3LVVA 4C7YA 2A1JA 5KFEA 3TADA 5EOZA 2K4PA 2BR0A 2Y0SF 4KMUA 3NGDA 4YD2A 4ECYA 1K1SA 4YMOA 3SEIA 4ECWA 5CEHA 3T5HA 2MA1A 5DB8A 2JV3A 4DLGA 1ZQOA 2A1JB 4B6JA 5ALMA 1TVAA 1A76A 4M04A 3JPRA 3SI8A 3V7KA 3CRXA 2LYHA 5KL1B 7ICMA 3G6YA 2W7OA 2HHWA 1QH9A 2EH9A 4NWIA 1ZQFA 4MF2A 3T5JA 1L3SA 5ALFA 3BQTA 2DGZA 1L7MA 1TFRA 3RB0A 4YR0A 4IRDA 4AP9A 1ZQDA 4QIWF 2GLEA 2W43A 5KFWA 4F4XA 2HBMA 4CF4A 4EBEA 5CHGA 1WCNA 3H0RB 3EW9A 5AKZA 5J0QA 3C5GA 1F44A 3V7LA 2R8KA 2GOLA 4Q45A 4RQ5A 3EYZA 4YFKA 2F3NA 2W9MA 2BZFA 3PZPA 3H7IA 1RZTA 4BGDA 7ICPA 5EE9A 2FLPA 2JZBB 2HDOA 2VJ4A 8ICEA 2K60A 3NRWA 2W9BA 2BPFA 5DQHA 3I76A 1ZXIA 5L1IA 3AQEA 2H5XA 4DL3A 1ZRNA 5KG4A 3RR7A 4F2SA 4P4PA 5HP4A 1DK2A 2OYYA 2E3TA 4J9QA 4ZH4A 3V72A 4UQGA 3H8JA 2EZYA 2V4RA 3SR6A 1VDVA 4RNNA 2BCQA 3GFKB 4C4SA 1N5WA 3C1YA 2KOBA 3T79A 4KLGA 5EE0A 4RQ1A 1Q46A 5IINA 1A77A 2FMQA 4ICAA 2GH1A 1WYGA 2MU2A 4IRCA 2RHFA 3FYHA 2CN1A 2EZZA 3EPIA 2ZUBA 1DXSA 4F8RA 1V38A 1KFTA 1VLBA 5J0YA 3BZCA 3QU2A 3WKDA 2FE9A 8ICQA 2PXIA 4RZRA 5J2HA 4P4OA 4IS7A 4LVSA 5AI4A 2IOFK 4DS5A 8ICYA 3MABA 5AIBA 2IOHA 2E8MA 3PSIA 1XSLA 9ICSA 1J2MA 3ETLA 4R66A 2CPRA 5DQIA 2W9AA 3UPQA 4O3PA 4EX6A 5DGBA 5J2GA 3C5FA 3RJHA 4E0DA 2JZBA 1ZQBA 2F44A 3H0LB 1B22A 1ZQQA 4DL4A 3LK9A 4P0PB 2W3RA 1COOA 3F53A 2CXYA 2PMZF 2ASLA 5C0YA 1PK1B 3HJEA 8ICGA 1KLNA 1L3VA 2KEYA 4ED0A 4FS1A 2MAXA 3UMBA 1X9SA 2YY6A 2KSOA 3JPNA 2IHNA 1DK3A 1PVRA 3BDPA 3TARA 8ICRA 3GIJA 3C2LA 2B0CA 3RJGA 1L7OA 3EUB2 4C4TA 3OHAA 4ECRA 1T7PA 4M9NA 4I2BA 2XCAA 1HIWA 9ICNA 2O6KA 2W9CA 2JRZA 3GILA 4DCCA 4ELUA 2ZIUB 4QZGA 3AMZA 5B5EU 1QLNA 3GQCA 2IMWP 1ZD5A 3T5LA 4JB3A 2JR5A 2VJ5A 1QTMA 4KLUA 1D8BA 2KVCA 2PKEA 1KDHA 4EZ6A 2DWQA 4KLHA 2V4QA 4F5NA 4NLCA 2BCSA 3BS5A 1WWUA 2HHTA 1UPHA 5ALHA 4J9SA 3PV8A 2XY6A 4C8NA 2DL0A 2VANA 1DRGA 2B6GA 2Y0SC 4C8OA 2BCVA 3RAXA 1MN8A 4BJQA 2OCEA 4DQSA 4NXZA 2G09A 3B9JA 2OHFA 5L9XA 4UASA 3SAFA 1L3TA 4GXIA 4EBDA 4I29A 5J2AA 3KHRA 4P0QA 4QZ8A 5A0LA 1SV4A 1RM6C 3C2KA 2LYAA 3TANA 5F3XB 2PFPA 5ALYA 3AN1A 3HWTA 1DGJA 1U4BA 4I2GA 2ASJA 3UM9A 4RQ4A 1TAQA 2WB1F 1BNOA 8ICHA 1FFVA 1JXEA 1OW5A 4CF3A 4C8KA 4JK1A 2WF7A 3E58A 5CA7A 5J29A 3F2BA 5DB9A 1ZQTA 4PHAA 2KHQA 2G5IB 4XUSA 4F92B 5AK4A 2E8PA 3Q8SB 4KLMA 1T4GA 1PK1A 3BQ2A 2LMRA 4Y2PA 4Q8FA 4PL2A 1KRPA 4R65A 2HOFA 2KZ3A 4QZHA 3JPTA 1U45A 2PFQA 3D2QA 4QIWC 4R63A 2KZMA 3FM9A 5KFXA 3QU7A 4TUSA 1Z00A 2DQNB 1U47A 1ZQGA 1NK9A 3CNHA 5F9NA 1X9XA 2W54A 5J0OA 2OEHA 1WWVA 3KTQA 5IIIA 2G06A 3K4GA 1QQ6A 2WHEA 5KG1A 2NRTA 5KFDA 1ZQXA 4YMMA 5G5HA 3MR6A 4MFAA 3GV7B 5J2KA 4K4HA 3J81j 1SL0A 1NJWA 1HUZA 1IM4A 1S8OA 2OM6A 5AM3A 1H38A 2JEGA 4I2DA 2FJ6A 2EANA 1TAUA 4NY8A 1TKDA 5J2FA 5KFGA 2C2RA 5HHIA 5KAIU 2QB1A 4O5CA 5ALWA 3L3FX 3OJSA 4MFFA 4YMNA 4JV1A 4GLXA 4IR1A 2ASDA 4YP3A 2DFLA 4KX3A 2ODGA 2ZJ8A 3M6KA 1X40A 4DSEA 3ONNA 2L5YA 3B0YA 2HOQA 8ICWA 2FMPA 3BQ0A 3RBEA 3K75D 2HOIA 3BZKA 3KFUF 1V85A 5KFUA 4C7ZA 4F71A 1TV9A 9ICHA 1QQ7A 5J2JA 2W7PA 2F8KA 2XO7A 2NRWA 3V6HA 3QYPA 2QB0A 4J9OA 3QE9Y 3BS5B 1SZHA 2G07A 2HHQA 3PMLA 5AM4A 4Y2RA 3V6JA 2M9NA 2HCFA 5D46A 3PW0A 9ICAA 2ZIXA 3C28A 2Z7JA 2WAQF 3E0FA 1S10A 2KJ9A 1SKRA 3SMVA 5DBCA 5KFQA 4DL2A 5ALJA 3N7SC 1S5LU 1UA1A 3MDCA 1L8LA 7ICVA 1Z1VA 1JUDA 5AM5A 5DG8A 4UARA 3WKEA 5KFIA 4OO1J 1ZETA 1FFUA 3M9NB 3VCBA 1SL1A 1XO1A 2E1FA 4YR2A 2BDUA 2XGPA 3KOOA 4YXMA 3AU6A 3TACB 4P4MA 5TZVA 5L1JA 1L3UA 7ICLA 1URJA 3WK4A 4EEKA 4KLFA 3AQFA 4QZAA 3MR2A 1SKWA 4R8UA 1S0VA 4MFCA 3IG5A 4Z6DA 8ICMA 1RQNA 1A0PA 3IM1A 1SKSA 3M1YA 3IN5A 1Y88A 5C5JA 3BQ1A 3KD3A 4PZOA 5D49A 4O3SA 2H3IA 1OUQA 2BPGA 4DQQA 3RJKA 1XU4A 4DFKA 5KFFA 2W11A 4QNLA 4RNOA 1TK8A 4DSLA 1T8EA 1A6SA 5AI0A 2PMZC 2WF5A 1HUOA 2EQYA 3WK7A 3ALRA 5ALIA 2F1JA 2R18A 1QSLA 2C2EA 3AUOA 1LKYB 4QZ9A 4M0AA 8ICSA 1RQLA 2DPIA 3NVWA 3SAGA 4DF8A 1ZQ1C 4RUCA 3MGIA 4YN4A 2BCUA 3PX4A 4JV2A 9ICGA 4Z6EA 1MSWD 1NZBA 3RBDA 4KN7A 4RPXA 3MR3A 3LYSA 4ECSA 3TKAA 2YB1A 4MHVA 4BXOB 3RTVA 1ZD4A 4QWAA 1BNPA 4CE6A 2JH7A 3HPOA 5T14A 2ZIVA 1JROA 1S77D 5AI9A 4ECXA 3ETRA 4OJ6A 4I27A 3RRHA 1KBUA 2WF9A 3T5KA 4PHPA 2ZXHA 2AGQA 3SD7A 3PW2A 3NVVA 5KFCA 4TQRA 2H3FA 2AGOA 3ZDBA 4CDGA 1D9DA 1ZQJA 2KVSA 9ICMA 2YMQA 4I28A 2XCPA 2W9BB 2WB1C 9ICQA 4EEYA 4FZNA 5CR0A 2ZTEA 5ALLA 2F8LA 4IQUA 3UXOA 1SV0C 1TK5A 3N97B 3EPGA 5ALUA 2QB0B 1ZQSA 2I5HA 4USAA 4J9KA 2MRLA 8ICVA 5B66U 4YR3A 1K1QA 3UXNA 4DO9A 2HVHA 2YN4A 1ZQMA 3L5KA 3QZ7A 5DQGA 3NVZA 4F4WA 1V97A 3CP8A 2OWOA 4DSKA 1RYRA 3QEAZ 5AKLA 4GFJA 5AKHA 4M9LA 4QW9A 5KFSA 2F1HA 4OJPA 4FFDA 2RRDA 4BDPA 3C29A 4F4YA 4ED1A 1NK8A 3H40A 3QXGA 3PW5A 1ECWA 1TK0A 4EYIB 1RDFA 4B9MA 5GTIU 4RNMA 4ELVA 2K89A 5KT2A 2K8BB 5K4LA 1NZPA 1FEZA 2ES6A 4KLSA 2FLNA 1SWVA 5KT3A 5IIMA 5KFTA 2UVRA 2E8NA 4DSJA 2KFZA 1N48A 3PW4A 3QU5A 9ICFA 2VIXA 1VJ5A 5ALEA 1JMSA 4R8UB 1CRXA 4ACOA 2DKZA 5AHXA 1NJXA 3CYMA 4PPXA 4KLQA 1MA7A 5KFRA 3RH4A 2RP5A 4UB8U 1SB3C 5L1LA 4ZOHC 1T3NA 5J0TA 1Q3UA 5ALDA 3AEVA 3JPPA 4CGZA 3SV4A 1IV8A 3OPXA 4JV0A 2YMPA 1BPBA 3K1RB 2MSNA 5ALXA 4KITB 4DQRA 5AI6A 1AROP 9ICBA 9ICJA 1COKA 2R8IA 2KG5A 7ICGA 3MFIA 3T3FA 4UBCA 3Q8RB 2I1QA 2EAPA 5HNKA 4DLEA 4UB4A 2ZJAA 4F3OA 4F5PA 2LHTA 3A0BU 5EWEA 1KL9A 1Z4OA 4B9VA 1RPLA 2Q0ZX 5IIOA 2HBKA 4M6WA 5J8YA 2KKPA 3MBYA 1N2XA 3Q8MA 4KN4A 3IV6A 1U9LA 2G0AA 4RQ3A 2H3ZA 3HRDD 2DKXA 3D2SA 4ED2A 3DDHA 4LZDA 4B9UA 9ICEA 8ICNA 4TUQA 4YG2A 2ZIUA 4Y2XA 2FPLA 3RJIA 4J9RA 8ICXA 1NK4A 3AL0B 2IA6A 1WCLA 4JWMA 4FBUA 4RPYA 2DBYA 5KT6A 4NM1A 3RB6A 2R8GA 5KFOA 4F4KA 3N28A 5L1KA 1ZQPA 5DDMA 4RQ8A 4I2FA 1MQ3A 2GO7A 5J0XA 4NL9C 2P66A 4I2CA 3TADC 4NLBA 4DOBA 5H2FU 8ICUA 5KG2A 4Y2TA 1ZQYA 4J9NA 1SXEA 1CEZA 4X5VA 8ICLA 1S0OA 2NV3A 1IXRA 1ED1A 1X6JA 1FIQA 1KN5A 3E2EA 2CRXA 4F4ZA 4G9BA 4PHEA 9ICRA 3M8SA 5J0WA 3WKCA 2HHSA 5AKKA 2AJQA 3RB3A 3TAPA 5ALZA 2KFNA 5HR6A 2XC9A 4NJ8A 4EX7A 3SZ2A 3LDAA 3KKAC 5DBAA 4DFMA 2WTFA 1JXLA 4M2YA 2EDUA 1X9WA 1J97A 1UA0A 2YTUA 4F72A 3ZD8A 2IHMA 2HBJA 4QW8A 2RDJA 1O08A 1ZJNA 4QZIA 5EE3A 3TQ1A 4P0QB 4DFDA 5DLFA 3I1YA 5BOLA 2NO5A 1B0XA 4KLOA 4DEZA 2FDRA 3QUCA 5DB6A
chains in the Genus database with same CATH topology
2M9NA 5EOZA 4QWEA 5D46A 3PW0A 9ICAA 3RH5A 2BR0A 1Z3EB 1QSYA 1ZQUA 4TUPA 3OGUA 1S10A 1BVSA 1SKRA 5KG3A 5DBCA 5KFQA 4DL2A 3OSPA 4KMUA 4UB5A 3NGDA 2J6UA 4YD2A 1UA1A 3MDCA 4ECYA 3GIKA 2BDPA 7ICVA 1K1SA 9ICCA 4YMOA 1ZQHA 5DG8A 5KFIA 1ZETA 4CCHA 4ECWA 4RUAA 8ICPA 3M9NB 4QZBA 3T5HA 4RQ0A 4Q8EA 1SL1A 2P6RA 1XO1A 4YR2A 5KFYA 2XGPA 4R64A 5DB8A 4YXMA 1ZQOA 4DLGA 3AU6A 2A1JB 1BPDA 8ICKA 5HMLA 3B0XA 4P4MA 1TVAA 1A76A 5TZVA 5L1JA 4M04A 1L3UA 3JPRA 3SI8A 1NKBA 1S76D 3OHBA 3V7KA 4IRKA 3Q8QB 7ICLA 2LYHA 2AQ0A 2NRXA 3RR8A 4KLFA 2BCRA 7ICMA 4QZAA 3MFHA 3UQ0A 3MR2A 2AU0A 3V6JA 3G6YA 4ECVA 4GC6A 1SKWA 4R8UA 4Q43A 4IR9A 1S0VA 4MFCA 2HHWA 3PMNA 4Z6DA 3UQ2A 8ICMA 9ICLA 3IM1A 1ZQFA 8ICTA 1SKSA 5KG5A 4MF2A 3T5JA 4RQ2A 1Y88A 5C5JA 1L3SA 3BQ1A 4O9MA 3BQTA 1TFRA 3RB0A 8ICFA 4YR0A 4IRDA 5DKWA 4O3QA 1ZQDA 4QWBA 3PVXA 4O3OA 2W8KA 3PX6A 5D49A 2PI5A 4O3SA 4M6WB 3FDSA 4BXOA 5KFWA 1MC8A 3N4MB 2BPGA 5KG7A 4F4XA 4FO6A 4EBCA 4IQWA 4EBEA 4DQQA 4M9JA 5CHGA 1WCNA 1XU4A 3RJKA 4UBBA 3EW9A 5KFFA 4DFKA 4RNOA 5J0QA 3C5GA 2R8KA 3V7LA 4Q45A 2ISPA 4BWMA 4RQ5A 1TK8A 3EYZA 4YFKA 4DSLA 4ED7A 2W9MA 2C22A 1T8EA 1JX4A 5J2IA 3H7IA 1RZTA 4BGDA 1HUOA 7ICPA 4RU9A 3ISCA 2B21A 3C1ZA 3C2MA 1KSPA 2KTQA 2FLPA 2JZBB 4BWJA 7ICTA 1DOQA 2Y1IA 5KFNA 3G6VA 8ICEA 2F1JA 1QSLA 4DOAA 2C2EA 7ICIA 2W9BA 2BPFA 3AUOA 5DQHA 5DBBA 4QZ9A 5L1IA 4M0AA 8ICSA 4I2JA 5EWGA 1NKEA 2H5XA 4DL3A 4NM2A 2DPIA 5KG4A 4JUZA 4DF8A 4F50A 4RUCA 1N56A 3RR7A 3RH6A 4P4PA 4F2SA 4ECUA 5HP4A 3MDAA 5DDYA 3MGIA 4YN4A 2BCUA 8ICOA 4J9QA 3PX4A 4XRHA 4JV2A 7ICHA 9ICGA 4ZH4A 3V72A 3ZDEA 4UQGA 4Z6EA 3H8JA 2V4RA 2PFNA 1MSWD 4O3RA 4RNNA 1Z00B 2BCQA 3GFKB 3H4BA 3ISBA 1MQ2A 4G3IA 3RBDA 7ICFA 4KN7A 4RPXA 2JEFA 3OSNA 3MR3A 4DFPA 3C1YA 3C23A 4ECSA 2HHVA 2BGWA 4KLGA 4RQ1A 4BXOB 4KTQA 1S97A 4QZCA 5IINA 1A77A 2FMQA 3RTVA 4ED3A 5J0SA 3H4DA 4IRCA 4MF8A 2C28A 4QWAA 3FYHA 3ISDA 3ZDCA 4QWDA 1BPZA 3ORYA 3V6KA 3EPIA 1L5UA 1ZQCA 2ZUBA 4F5RA 3RRGA 2AGPA 4F8RA 3RJJA 2HVIA 1KFTA 3HPOA 1UT8A 4TQSA 2W9CB 5J0YA 4DL7A 2GWSA 1ZYQA 8ICQA 5KT4A 2PXIA 1S77D 1ZQVA 4RZRA 7ICQA 1NK6A 5J2HA 5CB1A 4ECXA 4I27A 3RRHA 1C7YA 3H8SA 5KFZA 3T5KA 4I2IA 4P4OA 4FS2A 4PHPA 3RJFA 4PGYA 4LVSA 2AGQA 4B9UA 5J0RA 3GV5B 3PW2A 5KFCA 4M9HA 4TQRA 4DS5A 5KFBA 2AGOA 1RYSA 3MABA 8ICYA 1XC9A 3JPQA 3ZDBA 2PFOA 1XSLA 9ICSA 5DG7A 1KFDA 3ETLA 4R66A 1X9MA 1D9DA 9ICWA 2FMSA 4LZGA 2F1IA 4RQ7A 5DQIA 2W9AA 4F5QA 5DB7A 1ZQJA 4YCXA 1JIHA 3UPQA 9ICMA 8ICCA 4I28A 8ICRA 3Q8KA 2XCPA 3GIMA 4O3PA 2W9BB 9ICQA 4XA5A 4EEYA 2IBKA 5CR0A 2ZTEA 5DGBA 5DLGA 5J2GA 3C5FA 1ZQZA 3TFRA 5CJ7A 3RJHA 1U49A 3RJEA 4E0DA 1PZNA 3H8WA 4IQUA 3QZ8A 3OJUA 4TURA 9ICPA 2JZBA 3UXOA 4ED6A 1TK5A 3N97B 4UB2A 3EPGA 5HMMA 1ZQBA 1ZQSA 1BPXA 4M9GA 4J9KA 4KLLA 4ECZA 1B22A 4DF4A 1ZQQA 3M9MB 8ICVA 2BQRA 4YR3A 4DL4A 1K1QA 3UXNA 1BGXT 3LK9A 2XY5A 4DO9A 2HVHA 4J9MA 1COOA 1ZQMA 4GXJA 4DFJA 2ASLA 1KEJA 3QZ7A 1DGSA 5DQGA 4F4WA 3ZDAA 1UT5A 3THVA 2OWOA 2MUTA 8ICGA 4DSKA 1XWLA 2Y1JA 4FBTA 1RYRA 3QEAZ 4DL6A 4KLJA 1KLNA 1L3VA 4B9SA 3ZDDA 1LB2B 2P6UA 3AU2A 5KFVA 4ED0A 4QW9A 1U48A 1ZQEA 4M9LA 5KFSA 2F1HA 5KFKA 4FS1A 4J9LA 2MAXA 9ICIA 1ZQNA 1X9SA 1D9FA 4BDPA 4F4YA 1NJZA 4ELTA 3JPNA 4ED1A 3HX0A 2IHNA 1NK8A 3H40A 3BDPA 3PW5A 1EXNA 4IQTA 5D4BA 3PX0A 3GIJA 3TARA 4YVZA 3C2LA 2NRVA 4EYIB 1TK0A 1RXWA 4Z6FA 4B9MA 3RJGA 2J6TA 4I2EA 3NTUA 4RNMA 3OHAA 4ECRA 1XSPA 4ELVA 1T7PA 4M9NA 1XS9D 5KT2A 2XCAA 4I2BA 9ICNA 2W9CA 4PHDA 4O0IA 2FLNA 4KLSA 4HYKA 1HJPA 4B9NA 3GILA 5KT3A 4ELUA 4IQVA 5IIMA 4QZDA 4DSFA 5KFTA 4DQIA 2UVRA 4QZGA 2JEIA 4DSJA 2KFZA 1N48A 3MGHA 3PW4A 1QLNA 3JPSA 2UVVA 9ICFA 3GQCA 9ICTA 8ICZA 1JMSA 4R8UB 2IMWP 2ZUCA 3T5LA 9ICUA 1NJXA 1KTQA 9ICOA 4PPXA 1QTMA 4KLUA 2XY7A 2BQ3A 4KLQA 1S0MA 2V9WA 3RB4A 2ZTDA 5KFPA 1NK5A 5KFRA 3RH4A 1KDHA 1NKCA 4DSIA 4B9TA 4ECTA 5L1LA 3UXPA 4EZ6A 1T3NA 5BOMA 4KLHA 2V4QA 5KT7A 5J0TA 3GIIA 7ICKA 8ICIA 4DOCA 4F5NA 1KFSA 3SV3A 9ICKA 9ICXA 2ZJ5A 2BCSA 3JPOA 4DWIA 3JPPA 4KLTA 4F93B 3SV4A 4KLEA 5J2BA 4K4IA 3MR5A 4JV0A 2HHTA 4M47A 2FPMA 1BPBA 3KHHA 4J9SA 3PV8A 2XY6A 4C8NA 1D8YA 2VANA 5IILA 1ZQRA 4C8OA 4KITB 4DQRA 1V9PA 1LV5A 2BCVA 4ED8A 3RAXA 2JEJA 2VA8A 1AROP 9ICBA 8ICJA 4DQSA 9ICJA 4NXZA 2R8IA 7ICGA 5L9XA 3MFIA 1L3TA 3T3FA 2C2DA 4GXIA 4EBDA 2J6SA 4I29A 7ICRA 5J2AA 4UBCA 3KHRA 4PGQA 2HHXA 2ZTCA 2XGQA 3Q8RB 2I1QA 4QZ8A 4UAZA 3V7JA 2UVUA 5HNKA 7ICNA 4DLEA 1ZQWA 4UB4A 3C2KA 3TANA 4YXJA 2ZJAA 4F3OA 4F5PA 2PFPA 2KZZA 5EWEA 5J2DA 5CWRA 4KLIA 3C21A 5KG0A 1BPEA 3HWTA 4B9VA 1RPLA 1U4BA 1S0NA 2Q0ZX 5IIOA 2ASJA 4I2GA 4YD1A 4RT2A 4RQ4A 1TAQA 2PI4A 2FPKA 4M6WA 4PH5A 1RXVA 4F2RA 4KLDA 8ICHA 3MBYA 2R8HA 7ICJA 5EWFA 3G6XA 4KN4A 3Q8MA 1JXEA 4PGXA 2BQUA 1U9LA 1NOMA 5KG6A 4RQ3A 4C8KA 4MEXA 2VA3A 7ICSA 3EWAA 4JK1A 4UB1A 5CA7A 5J29A 4ED2A 3TFSA 4DS4A 9ICEA 4LZDA 4RQ6A 5DB9A 4RPZA 4TUQA 4YG2A 3PW7A 4PHAA 1S9FA 1ZQTA 4XUSA 4F92B 3Q8SB 4KLMA 2FPLA 4UAYA 4NLGA 1T4GA 3PR4A 3RJIA 4GC7A 4XQ8A 3BQ2A 2DPJA 4J9RA 4Q8FA 8ICXA 1NK4A 1KRPA 2IA6A 3PO4A 1WCLA 4R65A 4JWMA 4FBUA 4RPYA 2KZ3A 5KT6A 3EZ5A 4QZHA 3JPTA 2BKEA 3KHGA 3KHLA 5DGAA 1U45A 2PFQA 2VA2A 4NM1A 4NLKA 2I9GA 7ICEA 1JN3A 3RB6A 3LWLA 2R8GA 2KZMA 4R63A 2BPCA 5KFOA 5KT5A 4F4KA 3IHQB 1ZQKA 5KFXA 5L1KA 1ZQPA 5DDMA 3M9OB 4RQ8A 4TUSA 1Z00A 4DL5A 5IIKA 5J2CA 2UVWA 2NRZA 4I2FA 1U47A 1MQ3A 1NK9A 1ZQGA 5J0XA 2AQ4A 5F9NA 2P66A 5J0OA 4RT3A 1NJYA 4QWCA 1SZPA 3M8RA 4I2CA 2ATLA 3KTQA 5IIIA 1NK0A 1B43A 3GDXA 3K4GA 9ICVA 5KG1A 2NRTA 5KFAA 5KFDA 1ZQXA 4YMMA 3PNCA 5BPCA 4DOBA 3MR6A 4MFAA 8ICUA 1NK7A 5KG2A 3GV7B 4MEYA 1ZQYA 5J2KA 4J9NA 4K4HA 1SL0A 1NJWA 1HUZA 1CEZA 4X5VA 4F91B 1IM4A 5JUMA 4JWNA 1ZQIA 8ICLA 1S0OA 1H38A 2JEGA 3PO5A 3PY8A 4QZFA 4YQWA 1IXRA 4I2DA 5F9LA 1ZJMA 1TAUA 4NY8A 1TKDA 4P2HA 4ECQA 3E2EA 3RAQA 2HW3A 5J2FA 5KFGA 2C2RA 5HHIA 4F4ZA 8ICAA 5DG9A 5J2EA 1CUKA 4PHEA 5J0UA 9ICRA 3HT3A 4O5CA 2FLLA 2KN7A 3M8SA 1ZQAA 2HHUA 5J0WA 2ISOA 2HHSA 1D8LA 3OJSA 4MFFA 2AJQA 3RB3A 3TAPA 4YMNA 4JV1A 2KFNA 5KFHA 2R8JA 2XC9A 4GLXA 4IR1A 2ASDA 1X2IA 4YP3A 4O5EA 4EZ9A 4I2AA 2DFLA 4B9LA 3TI0A 2RDIA 3SZ2A 3BJYA 4GXKA 3LDAA 3ZD9A 5DBAA 3QEBZ 4DFMA 2W8LA 4NLNA 4F5OA 2ZJ8A 2WTFA 4UB3A 2ALZA 1JXLA 4I2HA 4M2YA 1X9WA 4C8LA 3LWMA 4DSEA 1UA0A 2ZUDA 4Q44A 3B0YA 8ICWA 2MUTB 4NLZA 3TAQA 4K4GA 3PR5B 2FMPA 3BQ0A 3HW8A 3RBEA 3K75D 4J9PA 3ZD8A 5KTQA 2BHNA 3Q8LA 2IHMA 4QW8A 2RDJA 5KFUA 1TV9A 5HHHA 9ICHA 4DQPA 1ZJNA 1QSSA 4QZIA 4O3NA 5KFLA 5CP2A 3SYZA 7ICUA 1ZQLA 5J2JA 4QZEA 5KFMA 2XO7A 4O5KA 5KFJA 3TQ1A 2NRWA 4C8MA 5DLFA 8ICNA 5IIJA 5J0PA 4EYHB 3V6HA 5BOLA 4UAWA 4J9OA 3QE9Y 1XSNA 3Q8PB 3GV8B 3HP6A 1SL2A 1BPYA 8ICBA 4KLOA 2HHQA 2A1JA 5KFEA 3PMLA 4Z6CA 4DEZA 7ICOA 5DB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9N A;  5EOZ A;  4QWE A;  5D46 A;  3PW0 A;  9ICA A;  3RH5 A;  2BR0 A;  1Z3E B;  1QSY A;  1ZQU A;  4TUP A;  3OGU A;  1S10 A;  1BVS A;  1SKR A;  5KG3 A;  5DBC A;  5KFQ A;  4DL2 A;  3OSP A;  4KMU A;  4UB5 A;  3NGD A;  2J6U A;  4YD2 A;  1UA1 A;  3MDC A;  4ECY A;  3GIK A;  2BDP A;  7ICV A;  1K1S A;  9ICC A;  4YMO A;  1ZQH A;  5DG8 A;  5KFI A;  1ZET A;  4CCH A;  4ECW A;  4RUA A;  8ICP A;  3M9N B;  4QZB A;  3T5H A;  4RQ0 A;  4Q8E A;  1SL1 A;  2P6R A;  1XO1 A;  4YR2 A;  5KFY A;  2XGP A;  4R64 A;  5DB8 A;  4YXM A;  1ZQO A;  4DLG A;  3AU6 A;  2A1J B;  1BPD A;  8ICK A;  5HML A;  3B0X A;  4P4M A;  1TVA A;  1A76 A;  5TZV A;  5L1J A;  4M04 A;  1L3U A;  3JPR A;  3SI8 A;  1NKB A;  1S76 D;  3OHB A;  3V7K A;  4IRK A;  3Q8Q B;  7ICL A;  2LYH A;  2AQ0 A;  2NRX A;  3RR8 A;  4KLF A;  2BCR A;  7ICM A;  4QZA A;  3MFH A;  3UQ0 A;  3MR2 A;  2AU0 A;  3V6J A;  3G6Y A;  4ECV A;  4GC6 A;  1SKW A;  4R8U A;  4Q43 A;  4IR9 A;  1S0V A;  4MFC A;  2HHW A;  3PMN A;  4Z6D A;  3UQ2 A;  8ICM A;  9ICL A;  3IM1 A;  1ZQF A;  8ICT A;  1SKS A;  5KG5 A;  4MF2 A;  3T5J A;  4RQ2 A;  1Y88 A;  5C5J A;  1L3S A;  3BQ1 A;  4O9M A;  3BQT A;  1TFR A;  3RB0 A;  8ICF A;  4YR0 A;  4IRD A;  5DKW A;  4O3Q A;  1ZQD A;  4QWB A;  3PVX A;  4O3O A;  2W8K A;  3PX6 A;  5D49 A;  2PI5 A;  4O3S A;  4M6W B;  3FDS A;  4BXO A;  5KFW A;  1MC8 A;  3N4M B;  2BPG A;  5KG7 A;  4F4X A;  4FO6 A;  4EBC A;  4IQW A;  4EBE A;  4DQQ A;  4M9J A;  5CHG A;  1WCN A;  1XU4 A;  3RJK A;  4UBB A;  3EW9 A;  5KFF A;  4DFK A;  4RNO A;  5J0Q A;  3C5G A;  2R8K A;  3V7L A;  4Q45 A;  2ISP A;  4BWM A;  4RQ5 A;  1TK8 A;  3EYZ A;  4YFK A;  4DSL A;  4ED7 A;  2W9M A;  2C22 A;  1T8E A;  1JX4 A;  5J2I A;  3H7I A;  1RZT A;  4BGD A;  1HUO A;  7ICP A;  4RU9 A;  3ISC A;  2B21 A;  3C1Z A;  3C2M A;  1KSP A;  2KTQ A;  2FLP A;  2JZB B;  4BWJ A;  7ICT A;  1DOQ A;  2Y1I A;  5KFN A;  3G6V A;  8ICE A;  2F1J A;  1QSL A;  4DOA A;  2C2E A;  7ICI A;  2W9B A;  2BPF A;  3AUO A;  5DQH A;  5DBB A;  4QZ9 A;  5L1I A;  4M0A A;  8ICS A;  4I2J A;  5EWG A;  1NKE A;  2H5X A;  4DL3 A;  4NM2 A;  2DPI A;  5KG4 A;  4JUZ A;  4DF8 A;  4F50 A;  4RUC A;  1N56 A;  3RR7 A;  3RH6 A;  4P4P A;  4F2S A;  4ECU A;  5HP4 A;  3MDA A;  5DDY A;  3MGI A;  4YN4 A;  2BCU A;  8ICO A;  4J9Q A;  3PX4 A;  4XRH A;  4JV2 A;  7ICH A;  9ICG A;  4ZH4 A;  3V72 A;  3ZDE A;  4UQG A;  4Z6E A;  3H8J A;  2V4R A;  2PFN A;  1MSW D;  4O3R A;  4RNN A;  1Z00 B;  2BCQ A;  3GFK B;  3H4B A;  3ISB A;  1MQ2 A;  4G3I A;  3RBD A;  7ICF A;  4KN7 A;  4RPX A;  2JEF A;  3OSN A;  3MR3 A;  4DFP A;  3C1Y A;  3C23 A;  4ECS A;  2HHV A;  2BGW A;  4KLG A;  4RQ1 A;  4BXO B;  4KTQ A;  1S97 A;  4QZC A;  5IIN A;  1A77 A;  2FMQ A;  3RTV A;  4ED3 A;  5J0S A;  3H4D A;  4IRC A;  4MF8 A;  2C28 A;  4QWA A;  3FYH A;  3ISD A;  3ZDC A;  4QWD A;  1BPZ A;  3ORY A;  3V6K A;  3EPI A;  1L5U A;  1ZQC A;  2ZUB A;  4F5R A;  3RRG A;  2AGP A;  4F8R A;  3RJJ A;  2HVI A;  1KFT A;  3HPO A;  1UT8 A;  4TQS A;  2W9C B;  5J0Y A;  4DL7 A;  2GWS A;  1ZYQ A;  8ICQ A;  5KT4 A;  2PXI A;  1S77 D;  1ZQV A;  4RZR A;  7ICQ A;  1NK6 A;  5J2H A;  5CB1 A;  4ECX A;  4I27 A;  3RRH A;  1C7Y A;  3H8S A;  5KFZ A;  3T5K A;  4I2I A;  4P4O A;  4FS2 A;  4PHP A;  3RJF A;  4PGY A;  4LVS A;  2AGQ A;  4B9U A;  5J0R A;  3GV5 B;  3PW2 A;  5KFC A;  4M9H A;  4TQR A;  4DS5 A;  5KFB A;  2AGO A;  1RYS A;  3MAB A;  8ICY A;  1XC9 A;  3JPQ A;  3ZDB A;  2PFO A;  1XSL A;  9ICS A;  5DG7 A;  1KFD A;  3ETL A;  4R66 A;  1X9M A;  1D9D A;  9ICW A;  2FMS A;  4LZG A;  2F1I A;  4RQ7 A;  5DQI A;  2W9A A;  4F5Q A;  5DB7 A;  1ZQJ A;  4YCX A;  1JIH A;  3UPQ A;  9ICM A;  8ICC A;  4I28 A;  8ICR A;  3Q8K A;  2XCP A;  3GIM A;  4O3P A;  2W9B B;  9ICQ A;  4XA5 A;  4EEY A;  2IBK A;  5CR0 A;  2ZTE A;  5DGB A;  5DLG A;  5J2G A;  3C5F A;  1ZQZ A;  3TFR A;  5CJ7 A;  3RJH A;  1U49 A;  3RJE A;  4E0D A;  1PZN A;  3H8W A;  4IQU A;  3QZ8 A;  3OJU A;  4TUR A;  9ICP A;  2JZB A;  3UXO A;  4ED6 A;  1TK5 A;  3N97 B;  4UB2 A;  3EPG A;  5HMM A;  1ZQB A;  1ZQS A;  1BPX A;  4M9G A;  4J9K A;  4KLL A;  4ECZ A;  1B22 A;  4DF4 A;  1ZQQ A;  3M9M B;  8ICV A;  2BQR A;  4YR3 A;  4DL4 A;  1K1Q A;  3UXN A;  1BGX T;  3LK9 A;  2XY5 A;  4DO9 A;  2HVH A;  4J9M A;  1COO A;  1ZQM A;  4GXJ A;  4DFJ A;  2ASL A;  1KEJ A;  3QZ7 A;  1DGS A;  5DQG A;  4F4W A;  3ZDA A;  1UT5 A;  3THV A;  2OWO A;  2MUT A;  8ICG A;  4DSK A;  1XWL A;  2Y1J A;  4FBT A;  1RYR A;  3QEA Z;  4DL6 A;  4KLJ A;  1KLN A;  1L3V A;  4B9S A;  3ZDD A;  1LB2 B;  2P6U A;  3AU2 A;  5KFV A;  4ED0 A;  4QW9 A;  1U48 A;  1ZQE A;  4M9L A;  5KFS A;  2F1H A;  5KFK A;  4FS1 A;  4J9L A;  2MAX A;  9ICI A;  1ZQN A;  1X9S A;  1D9F A;  4BDP A;  4F4Y A;  1NJZ A;  4ELT A;  3JPN A;  4ED1 A;  3HX0 A;  2IHN A;  1NK8 A;  3H40 A;  3BDP A;  3PW5 A;  1EXN A;  4IQT A;  5D4B A;  3PX0 A;  3GIJ A;  3TAR A;  4YVZ A;  3C2L A;  2NRV A;  4EYI B;  1TK0 A;  1RXW A;  4Z6F A;  4B9M A;  3RJG A;  2J6T A;  4I2E A;  3NTU A;  4RNM A;  3OHA A;  4ECR A;  1XSP A;  4ELV A;  1T7P A;  4M9N A;  1XS9 D;  5KT2 A;  2XCA A;  4I2B A;  9ICN A;  2W9C A;  4PHD A;  4O0I A;  2FLN A;  4KLS A;  4HYK A;  1HJP A;  4B9N A;  3GIL A;  5KT3 A;  4ELU A;  4IQV A;  5IIM A;  4QZD A;  4DSF A;  5KFT A;  4DQI A;  2UVR A;  4QZG A;  2JEI A;  4DSJ A;  2KFZ A;  1N48 A;  3MGH A;  3PW4 A;  1QLN A;  3JPS A;  2UVV A;  9ICF A;  3GQC A;  9ICT A;  8ICZ A;  1JMS A;  4R8U B;  2IMW P;  2ZUC A;  3T5L A;  9ICU A;  1NJX A;  1KTQ A;  9ICO A;  4PPX A;  1QTM A;  4KLU A;  2XY7 A;  2BQ3 A;  4KLQ A;  1S0M A;  2V9W A;  3RB4 A;  2ZTD A;  5KFP A;  1NK5 A;  5KFR A;  3RH4 A;  1KDH A;  1NKC A;  4DSI A;  4B9T A;  4ECT A;  5L1L A;  3UXP A;  4EZ6 A;  1T3N A;  5BOM A;  4KLH A;  2V4Q A;  5KT7 A;  5J0T A;  3GII A;  7ICK A;  8ICI A;  4DOC A;  4F5N A;  1KFS A;  3SV3 A;  9ICK A;  9ICX A;  2ZJ5 A;  2BCS A;  3JPO A;  4DWI A;  3JPP A;  4KLT A;  4F93 B;  3SV4 A;  4KLE A;  5J2B A;  4K4I A;  3MR5 A;  4JV0 A;  2HHT A;  4M47 A;  2FPM A;  1BPB A;  3KHH A;  4J9S A;  3PV8 A;  2XY6 A;  4C8N A;  1D8Y A;  2VAN A;  5IIL A;  1ZQR A;  4C8O A;  4KIT B;  4DQR A;  1V9P A;  1LV5 A;  2BCV A;  4ED8 A;  3RAX A;  2JEJ A;  2VA8 A;  1ARO P;  9ICB A;  8ICJ A;  4DQS A;  9ICJ A;  4NXZ A;  2R8I A;  7ICG A;  5L9X A;  3MFI A;  1L3T A;  3T3F A;  2C2D A;  4GXI A;  4EBD A;  2J6S A;  4I29 A;  7ICR A;  5J2A A;  4UBC A;  3KHR A;  4PGQ A;  2HHX A;  2ZTC A;  2XGQ A;  3Q8R B;  2I1Q A;  4QZ8 A;  4UAZ A;  3V7J A;  2UVU A;  5HNK A;  7ICN A;  4DLE A;  1ZQW A;  4UB4 A;  3C2K A;  3TAN A;  4YXJ A;  2ZJA A;  4F3O A;  4F5P A;  2PFP A;  2KZZ A;  5EWE A;  5J2D A;  5CWR A;  4KLI A;  3C21 A;  5KG0 A;  1BPE A;  3HWT A;  4B9V A;  1RPL A;  1U4B A;  1S0N A;  2Q0Z X;  5IIO A;  2ASJ A;  4I2G A;  4YD1 A;  4RT2 A;  4RQ4 A;  1TAQ A;  2PI4 A;  2FPK A;  4M6W A;  4PH5 A;  1RXV A;  4F2R A;  4KLD A;  8ICH A;  3MBY A;  2R8H A;  7ICJ A;  5EWF A;  3G6X A;  4KN4 A;  3Q8M A;  1JXE A;  4PGX A;  2BQU A;  1U9L A;  1NOM A;  5KG6 A;  4RQ3 A;  4C8K A;  4MEX A;  2VA3 A;  7ICS A;  3EWA A;  4JK1 A;  4UB1 A;  5CA7 A;  5J29 A;  4ED2 A;  3TFS A;  4DS4 A;  9ICE A;  4LZD A;  4RQ6 A;  5DB9 A;  4RPZ A;  4TUQ A;  4YG2 A;  3PW7 A;  4PHA A;  1S9F A;  1ZQT A;  4XUS A;  4F92 B;  3Q8S B;  4KLM A;  2FPL A;  4UAY A;  4NLG A;  1T4G A;  3PR4 A;  3RJI A;  4GC7 A;  4XQ8 A;  3BQ2 A;  2DPJ A;  4J9R A;  4Q8F A;  8ICX A;  1NK4 A;  1KRP A;  2IA6 A;  3PO4 A;  1WCL A;  4R65 A;  4JWM A;  4FBU A;  4RPY A;  2KZ3 A;  5KT6 A;  3EZ5 A;  4QZH A;  3JPT A;  2BKE A;  3KHG A;  3KHL A;  5DGA A;  1U45 A;  2PFQ A;  2VA2 A;  4NM1 A;  4NLK A;  2I9G A;  7ICE A;  1JN3 A;  3RB6 A;  3LWL A;  2R8G A;  2KZM A;  4R63 A;  2BPC A;  5KFO A;  5KT5 A;  4F4K A;  3IHQ B;  1ZQK A;  5KFX A;  5L1K A;  1ZQP A;  5DDM A;  3M9O B;  4RQ8 A;  4TUS A;  1Z00 A;  4DL5 A;  5IIK A;  5J2C A;  2UVW A;  2NRZ A;  4I2F A;  1U47 A;  1MQ3 A;  1NK9 A;  1ZQG A;  5J0X A;  2AQ4 A;  5F9N A;  2P66 A;  5J0O A;  4RT3 A;  1NJY A;  4QWC A;  1SZP A;  3M8R A;  4I2C A;  2ATL A;  3KTQ A;  5III A;  1NK0 A;  1B43 A;  3GDX A;  3K4G A;  9ICV A;  5KG1 A;  2NRT A;  5KFA A;  5KFD A;  1ZQX A;  4YMM A;  3PNC A;  5BPC A;  4DOB A;  3MR6 A;  4MFA A;  8ICU A;  1NK7 A;  5KG2 A;  3GV7 B;  4MEY A;  1ZQY A;  5J2K A;  4J9N A;  4K4H A;  1SL0 A;  1NJW A;  1HUZ A;  1CEZ A;  4X5V A;  4F91 B;  1IM4 A;  5JUM A;  4JWN A;  1ZQI A;  8ICL A;  1S0O A;  1H38 A;  2JEG A;  3PO5 A;  3PY8 A;  4QZF A;  4YQW A;  1IXR A;  4I2D A;  5F9L A;  1ZJM A;  1TAU A;  4NY8 A;  1TKD A;  4P2H A;  4ECQ A;  3E2E A;  3RAQ A;  2HW3 A;  5J2F A;  5KFG A;  2C2R A;  5HHI A;  4F4Z A;  8ICA A;  5DG9 A;  5J2E A;  1CUK A;  4PHE A;  5J0U A;  9ICR A;  3HT3 A;  4O5C A;  2FLL A;  2KN7 A;  3M8S A;  1ZQA A;  2HHU A;  5J0W A;  2ISO A;  2HHS A;  1D8L A;  3OJS A;  4MFF A;  2AJQ A;  3RB3 A;  3TAP A;  4YMN A;  4JV1 A;  2KFN A;  5KFH A;  2R8J A;  2XC9 A;  4GLX A;  4IR1 A;  2ASD A;  1X2I A;  4YP3 A;  4O5E A;  4EZ9 A;  4I2A A;  2DFL A;  4B9L A;  3TI0 A;  2RDI A;  3SZ2 A;  3BJY A;  4GXK A;  3LDA A;  3ZD9 A;  5DBA A;  3QEB Z;  4DFM A;  2W8L A;  4NLN A;  4F5O A;  2ZJ8 A;  2WTF A;  4UB3 A;  2ALZ A;  1JXL A;  4I2H A;  4M2Y A;  1X9W A;  4C8L A;  3LWM A;  4DSE A;  1UA0 A;  2ZUD A;  4Q44 A;  3B0Y A;  8ICW A;  2MUT B;  4NLZ A;  3TAQ A;  4K4G A;  3PR5 B;  2FMP A;  3BQ0 A;  3HW8 A;  3RBE A;  3K75 D;  4J9P A;  3ZD8 A;  5KTQ A;  2BHN A;  3Q8L A;  2IHM A;  4QW8 A;  2RDJ A;  5KFU A;  1TV9 A;  5HHH A;  9ICH A;  4DQP A;  1ZJN A;  1QSS A;  4QZI A;  4O3N A;  5KFL A;  5CP2 A;  3SYZ A;  7ICU A;  1ZQL A;  5J2J A;  4QZE A;  5KFM A;  2XO7 A;  4O5K A;  5KFJ A;  3TQ1 A;  2NRW A;  4C8M A;  5DLF A;  8ICN A;  5IIJ A;  5J0P A;  4EYH B;  3V6H A;  5BOL A;  4UAW A;  4J9O A;  3QE9 Y;  1XSN A;  3Q8P B;  3GV8 B;  3HP6 A;  1SL2 A;  1BPY A;  8ICB A;  4KLO A;  2HHQ A;  2A1J A;  5KFE A;  3PML A;  4Z6C A;  4DEZ A;  7ICO A;  5DB6 A; 
#chains in the Genus database with same CATH topology
 5AKJ A;  2K4H A;  2AHO B;  1QSY A;  1ZQU A;  4TUP A;  1BVS A;  2J6U A;  2BDP A;  9ICC A;  3HKZ C;  4RUA A;  8ICP A;  4RQ0 A;  2P6R A;  5KFY A;  4R64 A;  3KBB A;  5HML A;  2OH2 A;  3WKA A;  3Q8Q B;  2AQ0 A;  1Z4N A;  2BCR A;  5AI8 A;  5L1M A;  3UQ0 A;  2AU0 A;  1S76 D;  2XIC A;  3F2D A;  4GC6 A;  4ECV A;  2KIV A;  9ICL A;  5KG5 A;  4O9M A;  5DKW A;  4O3Q A;  4QWB A;  2KE7 A;  4O3O A;  3PVX A;  3PX6 A;  2PI5 A;  4M6W B;  3FDS A;  4BXO A;  4FO6 A;  4EBC A;  2HMX A;  4M9J A;  5AK3 A;  4UBB A;  2ISP A;  5E79 U;  4ED7 A;  1JX4 A;  5AKG A;  1C20 A;  4RU9 A;  3ISC A;  2B21 A;  3C1Z A;  3C2M A;  1KSP A;  4BWJ A;  7ICT A;  4CNQ A;  2Y1I A;  1JI7 A;  3QU4 A;  5KFN A;  3G6V A;  7ICI A;  5DBB A;  1NKE A;  2W03 A;  4F50 A;  1N56 A;  5ALS A;  4ECU A;  5DDY A;  4O3M A;  8ICO A;  4XRH A;  1J2N A;  3ZDE A;  1X6I A;  3H8M A;  2P35 A;  2PFN A;  5JU5 A;  1N5X A;  3HIL A;  4G3I A;  1KW4 A;  4DFP A;  5G5G A;  2HHV A;  2BGW A;  5J8Y C;  4KTQ A;  4QZC A;  5AM1 A;  4ED3 A;  5AM2 A;  2WAQ C;  3ZDC A;  3ORY A;  1ZQC A;  4F5R A;  2Y9U A;  2HBL A;  3I28 A;  4TQS A;  4DL7 A;  2GWS A;  1ZQV A;  1C7Y A;  3H8S A;  5KFZ A;  4I2I A;  3RJF A;  4QJF B;  2LM4 A;  4C4R A;  4PGY A;  5ALK A;  5J0R A;  1RYS A;  5EE1 A;  2PFO A;  5AKY A;  3WK8 A;  1F0M A;  3WK9 A;  1X9M A;  3F2C A;  4RQ7 A;  4F5Q A;  5DB7 A;  4YCX A;  8ICC A;  2HI0 A;  4UW9 A;  4XA5 A;  2IBK A;  3FAH A;  2LPE A;  3TFR A;  1ZQZ A;  5CJ7 A;  9ICV A;  3RJE A;  3OJU A;  3H8W A;  5KNI A;  4TUR A;  5AK5 A;  4ED6 A;  4A8E A;  4UB2 A;  4M9G A;  4AYB C;  4ECZ A;  3M9M B;  3F5A A;  2XVT A;  3UMG A;  2BQR A;  3NUQ A;  2XY5 A;  4J9M A;  1NI3 A;  4DFJ A;  4IC9 A;  1PK3 A;  2ESE A;  1UT5 A;  1XWL A;  4FBT A;  4DL6 A;  4OJL A;  4EEL A;  3AU2 A;  1U48 A;  3L4P A;  5KFK A;  2OXO A;  5ALG A;  4ELT A;  3GU3 A;  3HX0 A;  4YVZ A;  2YB4 A;  1L6N A;  1XSP A;  2ZIV B;  2H3Q A;  3ZI4 A;  1Q3V A;  4PHD A;  2WF8 A;  4O0I A;  1HJP A;  4IQV A;  4DSF A;  2JGA A;  2A19 A;  3MGH A;  3JPS A;  2UVV A;  4Y2Y A;  2YX8 A;  4Y2U A;  2Q4T A;  1S0M A;  2V9W A;  3QNM A;  3RB4 A;  2KJ5 A;  1NKC A;  4DSI A;  3M7D A;  1L7P A;  3GII A;  2A3V A;  8ICI A;  1M6Y A;  1KFS A;  9ICX A;  2ZJ5 A;  3JPO A;  4DWI A;  4KLT A;  2K8C B;  4KMO B;  2K8A A;  3SQI A;  4KLE A;  5J2B A;  3MR5 A;  1SGG A;  2DUY A;  4M47 A;  2FPM A;  2KP7 A;  4HAI A;  3DV9 A;  5IIL A;  2F2A B;  4ED8 A;  4OJ5 A;  2VA8 A;  1X42 A;  8ICJ A;  2E1E A;  4RQM A;  2N1R A;  2J6S A;  2ZTC A;  3D6J A;  2XGQ A;  4GIB A;  4UAZ A;  3V7J A;  2UVU A;  4FZL A;  2D6F C;  1CI4 A;  2KZZ A;  5CWR A;  3C21 A;  5KG0 A;  3KKA A;  1GO3 F;  4RT2 A;  2PI4 A;  1ZRM A;  2FPK A;  4PH5 A;  1RXV A;  2E5S A;  1L7N A;  4F2R A;  4KLD A;  3G6X A;  4KX5 A;  2BQU A;  2VA3 A;  4UB1 A;  2KHV A;  4CRX A;  3WK5 A;  4DS4 A;  4RQ6 A;  3PW7 A;  1S9F A;  2KK0 A;  4CF5 A;  2HSZ A;  4UAY A;  4NLG A;  3PR4 A;  2LI6 A;  4XQ8 A;  5ALR A;  2KIC A;  3PO4 A;  1YT3 A;  3EZ5 A;  2XI9 A;  3KHL A;  4NLK A;  2JEI A;  2XID A;  1NNL A;  2VA2 A;  4PJ0 U;  2WFA A;  3QU9 A;  1UQV A;  3M9O B;  4DL5 A;  2UVW A;  5J2C A;  2NRZ A;  2AQ4 A;  1NJY A;  2ZG6 A;  1NK0 A;  1B43 A;  3GDX A;  5AI5 A;  3WK6 A;  3PNC A;  2E8O A;  2ZIX B;  5CRX A;  4F91 B;  5JUM A;  3PY8 A;  3PO5 A;  1IG6 A;  2KKV A;  4QZF A;  5F9L A;  2W3S A;  4P2H A;  2HW3 A;  1KQQ A;  4C0Z A;  4EEN A;  5DG9 A;  5J0U A;  3HT3 A;  1ZD3 A;  2FLL A;  2KN7 A;  2HHU A;  5AIC A;  1D8L A;  2KV2 A;  3RFA A;  5KFH A;  3MGV A;  4O5E A;  5ALV A;  4I2A A;  3BJY A;  3ZD9 A;  4NLN A;  2ALZ A;  4I2H A;  2YMM A;  1B4F A;  1PVP A;  4Q44 A;  3NAS A;  1KKX A;  3TAQ A;  3PR5 B;  1TE2 A;  3HW8 A;  4J9P A;  2W04 A;  3Q8L A;  5KTQ A;  3NS1 A;  5HHH A;  4DQP A;  1QQ5 A;  5KFL A;  5CP2 A;  1JRP A;  3SYZ A;  1ZQL A;  4RQN A;  5KFM A;  2WF6 A;  4O5K A;  5KFJ A;  1HEK A;  4C8M A;  5J0P A;  4EYH B;  4UAW A;  4WJ3 B;  3ICX A;  3Q8P B;  3HP6 A;  8ICB A;  4U7C A;  2EAM A;  2NO4 A;  1RYU A;  4Z6C A;  7ICO A;  3PST A;  2KMD A;  4QWE A;  5KAF U;  3RH5 A;  1Z3E B;  2NYV A;  3OGU A;  3MC1 A;  5KG3 A;  3OSP A;  5AM0 A;  1LKY A;  4NL9 A;  3SEN A;  4UB5 A;  3RF9 A;  4U6P A;  1X66 A;  2ZIW A;  3GIK A;  1ZQH A;  2RQ5 A;  4CCH A;  3QUB A;  3PSP A;  4QZB A;  4Q8E A;  3ED5 A;  1UHU A;  2QAR A;  1BPD A;  8ICK A;  3B0X A;  1ZD2 P;  1NKB A;  3OHB A;  3KZX A;  4IRK A;  1YZ6 A;  2NRX A;  3RR8 A;  2ZXI A;  3MFH A;  4IR9 A;  8ICF A;  4Q43 A;  5JTI A;  5HR7 A;  3PMN A;  3UQ2 A;  8ICT A;  4RQ2 A;  3IG8 A;  2W8K A;  4UB6 U;  1MC8 A;  3N4M B;  5KG7 A;  2A1A A;  4IQW A;  2JHD A;  1SXD A;  5AKI A;  4BWM A;  3IP4 B;  2C22 A;  5J2I A;  2KJ8 A;  2KTQ A;  2K4I A;  1DOQ A;  5ALO A;  4DOA A;  1FO4 A;  4I2J A;  1N63 A;  5EWG A;  3CW2 C;  3PSF A;  3QUT A;  4NM2 A;  3GZF A;  4JUZ A;  1TAM A;  3RH6 A;  3MDA A;  7ICH A;  3AM9 A;  2QKQ A;  2QAR B;  1F5S A;  4O3R A;  1Z00 B;  1QCK A;  3IRU A;  3H4B A;  3ISB A;  1MQ2 A;  1UCV A;  3N7R C;  3QX7 A;  7ICF A;  1Z19 A;  2JEF A;  3OSN A;  5AKX A;  3C23 A;  4UAV A;  2JXJ A;  5FP0 A;  3U26 A;  2G08 A;  3UMC A;  1S97 A;  4LJX A;  5J0S A;  5KL8 B;  3H4D A;  4MF8 A;  2C28 A;  3M6Z A;  3ISD A;  4P0P A;  4QWD A;  1BPZ A;  3V6K A;  1L5U A;  5ALP A;  4PL1 A;  3RRG A;  2AGP A;  3RJJ A;  2HVI A;  1YZ7 A;  1UT8 A;  2W9C B;  1ZYQ A;  4OJO A;  5KT4 A;  4Y2J A;  2JH1 A;  4Y2S A;  4OCZ A;  3SAH A;  7ICQ A;  1N62 A;  3R9K A;  1NK6 A;  4FE3 A;  5CB1 A;  4FS2 A;  2LKY A;  2D8C A;  3GV5 B;  3N7P D;  4M9H A;  5KFB A;  1XC9 A;  3JPQ A;  5DG7 A;  1KFD A;  1SIJ A;  9ICW A;  2FMS A;  4LZG A;  2F1I A;  1RG6 A;  1JIH A;  3Q8K A;  3GIM A;  5DLG A;  4KLJ A;  1SV0 A;  1U49 A;  1PZN A;  3QZ8 A;  9ICP A;  2AH5 A;  5HMM A;  1BPX A;  4KLL A;  4DF4 A;  1BGX T;  2M0N A;  4GXJ A;  1KEJ A;  1DGS A;  1SWW A;  3D2N A;  3HKZ F;  4UAT A;  3ZDA A;  5ALQ A;  3THV A;  2MUT A;  1LVH A;  2Y1J A;  3NRZ A;  2DF4 B;  4B9S A;  3H0M B;  3ZDD A;  1LB2 B;  2P6U A;  5KFV A;  1ZQE A;  4J9L A;  9ICI A;  1ZQN A;  4JMU A;  3NVY A;  1N61 A;  1D9F A;  3KZI U;  1NJZ A;  3K1Z A;  1WUD A;  1EXN A;  4IQT A;  5JRT A;  5D4B A;  3PX0 A;  1RXW A;  2NRV A;  4Z6F A;  2J6T A;  4I2E A;  3NTU A;  2H3V A;  3QUQ A;  4PZN A;  5ALN A;  1XS9 D;  2VKQ A;  1T3Q A;  4HYK A;  4B9N A;  1JAL A;  5AK6 A;  4QZD A;  4DQI A;  4Y2V A;  9ICT A;  8ICZ A;  2ZUC A;  9ICU A;  1KTQ A;  9ICO A;  2W55 A;  2XY7 A;  2BQ3 A;  4BX9 C;  2ZTD A;  5KFP A;  2YML A;  1NK5 A;  2IOF A;  2D3D A;  4J03 A;  4B9T A;  4ECT A;  2F76 X;  3UXP A;  5BOM A;  5KT7 A;  7ICK A;  4DOC A;  4US8 A;  3SV3 A;  3F5E A;  9ICK A;  3IDW A;  4F93 B;  2YQE A;  1PUZ A;  1PVQ A;  1P7D A;  4K4I A;  5TIS U;  2KIW A;  3KHH A;  2ZIW B;  3LVW A;  1D8Y A;  1ZQR A;  5AKE A;  1V9P A;  4IL6 U;  1LV5 A;  1XO0 A;  2JEJ A;  1IIP A;  3OTQ A;  2JMG A;  4UAU A;  2RLT A;  3VC8 A;  2LBO A;  2C2D A;  7ICR A;  2HHX A;  4PGQ A;  2Y9T A;  7ICN A;  5AIA A;  1ZQW A;  1N60 A;  4YXJ A;  1L8O A;  3A0H U;  5J2D A;  4KLI A;  1BPE A;  1S0N A;  4YD1 A;  1AQ6 A;  1T94 A;  2KSO B;  2R8H A;  7ICJ A;  5EWF A;  4PGX A;  3O0F A;  1NOM A;  5KG6 A;  4MEX A;  7ICS A;  3EWA A;  4OD0 A;  3TFS A;  4RPZ A;  2KNJ A;  3BQ7 A;  4GC7 A;  2DPJ A;  1O03 A;  2K4E A;  2LYB A;  5DGA A;  2BKE A;  3KHG A;  7ICE A;  2I9G A;  1JN3 A;  3LWL A;  2BPC A;  5KT5 A;  3IHQ B;  1ZQK A;  1K5O A;  2EZX A;  5IIK A;  1WG8 A;  4FZM A;  4RT3 A;  4QWC A;  1SZP A;  3M8R A;  2ATL A;  2FI1 A;  5ALT A;  5KFA A;  5BPC A;  3BS7 A;  1NK7 A;  4MEY A;  1ZOL A;  1XNS A;  2LM1 A;  4JWN A;  5GTH U;  1ZQI A;  4YQW A;  1ZJM A;  2I6X A;  4ECQ A;  3RAQ A;  3DEE A;  8ICA A;  5J2E A;  1CUK A;  3WU2 U;  1ZQA A;  2G5H B;  3S6J A;  2ISO A;  3WKB A;  2F77 X;  4Y2Q A;  2R8J A;  1X2I A;  4EZ9 A;  1OXJ A;  4BUG A;  4C80 A;  3TI0 A;  2RDI A;  4AYB F;  4B9L A;  4NV0 A;  4GXK A;  3QEB Z;  2W8L A;  4F5O A;  4UB3 A;  4C8L A;  1Q8K A;  3LWM A;  2ZUD A;  2AXT U;  2MUT B;  4NLZ A;  1Z1B A;  4K4G A;  2BHN A;  2KD1 A;  3FC4 A;  1QSS A;  4O3N A;  7ICU A;  2EAO A;  4QZE A;  5IIJ A;  2QLT A;  4US9 A;  1XSN A;  1SL2 A;  3GV8 B;  1BPY A;  3LVV A;  4C7Y A;  2A1J A;  5KFE A;  3TAD A;  5EOZ A;  2K4P A;  2BR0 A;  2Y0S F;  4KMU A;  3NGD A;  4YD2 A;  4ECY A;  1K1S A;  4YMO A;  3SEI A;  4ECW A;  5CEH A;  3T5H A;  2MA1 A;  5DB8 A;  2JV3 A;  4DLG A;  1ZQO A;  2A1J B;  4B6J A;  5ALM A;  1TVA A;  1A76 A;  4M04 A;  3JPR A;  3SI8 A;  3V7K A;  3CRX A;  2LYH A;  5KL1 B;  7ICM A;  3G6Y A;  2W7O A;  2HHW A;  1QH9 A;  2EH9 A;  4NWI A;  1ZQF A;  4MF2 A;  3T5J A;  1L3S A;  5ALF A;  3BQT A;  2DGZ A;  1L7M A;  1TFR A;  3RB0 A;  4YR0 A;  4IRD A;  4AP9 A;  1ZQD A;  4QIW F;  2GLE A;  2W43 A;  5KFW A;  4F4X A;  2HBM A;  4CF4 A;  4EBE A;  5CHG A;  1WCN A;  3H0R B;  3EW9 A;  5AKZ A;  5J0Q A;  3C5G A;  1F44 A;  3V7L A;  2R8K A;  2GOL A;  4Q45 A;  4RQ5 A;  3EYZ A;  4YFK A;  2F3N A;  2W9M A;  2BZF A;  3PZP A;  3H7I A;  1RZT A;  4BGD A;  7ICP A;  5EE9 A;  2FLP A;  2JZB B;  2HDO A;  2VJ4 A;  8ICE A;  2K60 A;  3NRW A;  2W9B A;  2BPF A;  5DQH A;  3I76 A;  1ZXI A;  5L1I A;  3AQE A;  2H5X A;  4DL3 A;  1ZRN A;  5KG4 A;  3RR7 A;  4F2S A;  4P4P A;  5HP4 A;  1DK2 A;  2OYY A;  2E3T A;  4J9Q A;  4ZH4 A;  3V72 A;  4UQG A;  3H8J A;  2EZY A;  2V4R A;  3SR6 A;  1VDV A;  4RNN A;  2BCQ A;  3GFK B;  4C4S A;  1N5W A;  3C1Y A;  2KOB A;  3T79 A;  4KLG A;  5EE0 A;  4RQ1 A;  1Q46 A;  5IIN A;  1A77 A;  2FMQ A;  4ICA A;  2GH1 A;  1WYG A;  2MU2 A;  4IRC A;  2RHF A;  3FYH A;  2CN1 A;  2EZZ A;  3EPI A;  2ZUB A;  1DXS A;  4F8R A;  1V38 A;  1KFT A;  1VLB A;  5J0Y A;  3BZC A;  3QU2 A;  3WKD A;  2FE9 A;  8ICQ A;  2PXI A;  4RZR A;  5J2H A;  4P4O A;  4IS7 A;  4LVS A;  5AI4 A;  2IOF K;  4DS5 A;  8ICY A;  3MAB A;  5AIB A;  2IOH A;  2E8M A;  3PSI A;  1XSL A;  9ICS A;  1J2M A;  3ETL A;  4R66 A;  2CPR A;  5DQI A;  2W9A A;  3UPQ A;  4O3P A;  4EX6 A;  5DGB A;  5J2G A;  3C5F A;  3RJH A;  4E0D A;  2JZB A;  1ZQB A;  2F44 A;  3H0L B;  1B22 A;  1ZQQ A;  4DL4 A;  3LK9 A;  4P0P B;  2W3R A;  1COO A;  3F53 A;  2CXY A;  2PMZ F;  2ASL A;  5C0Y A;  1PK1 B;  3HJE A;  8ICG A;  1KLN A;  1L3V A;  2KEY A;  4ED0 A;  4FS1 A;  2MAX A;  3UMB A;  1X9S A;  2YY6 A;  2KSO A;  3JPN A;  2IHN A;  1DK3 A;  1PVR A;  3BDP A;  3TAR A;  8ICR A;  3GIJ A;  3C2L A;  2B0C A;  3RJG A;  1L7O A;  3EUB 2;  4C4T A;  3OHA A;  4ECR A;  1T7P A;  4M9N A;  4I2B A;  2XCA A;  1HIW A;  9ICN A;  2O6K A;  2W9C A;  2JRZ A;  3GIL A;  4DCC A;  4ELU A;  2ZIU B;  4QZG A;  3AMZ A;  5B5E U;  1QLN A;  3GQC A;  2IMW P;  1ZD5 A;  3T5L A;  4JB3 A;  2JR5 A;  2VJ5 A;  1QTM A;  4KLU A;  1D8B A;  2KVC A;  2PKE A;  1KDH A;  4EZ6 A;  2DWQ A;  4KLH A;  2V4Q A;  4F5N A;  4NLC A;  2BCS A;  3BS5 A;  1WWU A;  2HHT A;  1UPH A;  5ALH A;  4J9S A;  3PV8 A;  2XY6 A;  4C8N A;  2DL0 A;  2VAN A;  1DRG A;  2B6G A;  2Y0S C;  4C8O A;  2BCV A;  3RAX A;  1MN8 A;  4BJQ A;  2OCE A;  4DQS A;  4NXZ A;  2G09 A;  3B9J A;  2OHF A;  5L9X A;  4UAS A;  3SAF A;  1L3T A;  4GXI A;  4EBD A;  4I29 A;  5J2A A;  3KHR A;  4P0Q A;  4QZ8 A;  5A0L A;  1SV4 A;  1RM6 C;  3C2K A;  2LYA A;  3TAN A;  5F3X B;  2PFP A;  5ALY A;  3AN1 A;  3HWT A;  1DGJ A;  1U4B A;  4I2G A;  2ASJ A;  3UM9 A;  4RQ4 A;  1TAQ A;  2WB1 F;  1BNO A;  8ICH A;  1FFV A;  1JXE A;  1OW5 A;  4CF3 A;  4C8K A;  4JK1 A;  2WF7 A;  3E58 A;  5CA7 A;  5J29 A;  3F2B A;  5DB9 A;  1ZQT A;  4PHA A;  2KHQ A;  2G5I B;  4XUS A;  4F92 B;  5AK4 A;  2E8P A;  3Q8S B;  4KLM A;  1T4G A;  1PK1 A;  3BQ2 A;  2LMR A;  4Y2P A;  4Q8F A;  4PL2 A;  1KRP A;  4R65 A;  2HOF A;  2KZ3 A;  4QZH A;  3JPT A;  1U45 A;  2PFQ A;  3D2Q A;  4QIW C;  4R63 A;  2KZM A;  3FM9 A;  5KFX A;  3QU7 A;  4TUS A;  1Z00 A;  2DQN B;  1U47 A;  1ZQG A;  1NK9 A;  3CNH A;  5F9N A;  1X9X A;  2W54 A;  5J0O A;  2OEH A;  1WWV A;  3KTQ A;  5III A;  2G06 A;  3K4G A;  1QQ6 A;  2WHE A;  5KG1 A;  2NRT A;  5KFD A;  1ZQX A;  4YMM A;  5G5H A;  3MR6 A;  4MFA A;  3GV7 B;  5J2K A;  4K4H A;  3J81 j;  1SL0 A;  1NJW A;  1HUZ A;  1IM4 A;  1S8O A;  2OM6 A;  5AM3 A;  1H38 A;  2JEG A;  4I2D A;  2FJ6 A;  2EAN A;  1TAU A;  4NY8 A;  1TKD A;  5J2F A;  5KFG A;  2C2R A;  5HHI A;  5KAI U;  2QB1 A;  4O5C A;  5ALW A;  3L3F X;  3OJS A;  4MFF A;  4YMN A;  4JV1 A;  4GLX A;  4IR1 A;  2ASD A;  4YP3 A;  2DFL A;  4KX3 A;  2ODG A;  2ZJ8 A;  3M6K A;  1X40 A;  4DSE A;  3ONN A;  2L5Y A;  3B0Y A;  2HOQ A;  8ICW A;  2FMP A;  3BQ0 A;  3RBE A;  3K75 D;  2HOI A;  3BZK A;  3KFU F;  1V85 A;  5KFU A;  4C7Z A;  4F71 A;  1TV9 A;  9ICH A;  1QQ7 A;  5J2J A;  2W7P A;  2F8K A;  2XO7 A;  2NRW A;  3V6H A;  3QYP A;  2QB0 A;  4J9O A;  3QE9 Y;  3BS5 B;  1SZH A;  2G07 A;  2HHQ A;  3PML A;  5AM4 A;  4Y2R A;  3V6J A;  2M9N A;  2HCF A;  5D46 A;  3PW0 A;  9ICA A;  2ZIX A;  3C28 A;  2Z7J A;  2WAQ F;  3E0F A;  1S10 A;  2KJ9 A;  1SKR A;  3SMV A;  5DBC A;  5KFQ A;  4DL2 A;  5ALJ A;  3N7S C;  1S5L U;  1UA1 A;  3MDC A;  1L8L A;  7ICV A;  1Z1V A;  1JUD A;  5AM5 A;  5DG8 A;  4UAR A;  3WKE A;  5KFI A;  4OO1 J;  1ZET A;  1FFU A;  3M9N B;  3VCB A;  1SL1 A;  1XO1 A;  2E1F A;  4YR2 A;  2BDU A;  2XGP A;  3KOO A;  4YXM A;  3AU6 A;  3TAC B;  4P4M A;  5TZV A;  5L1J A;  1L3U A;  7ICL A;  1URJ A;  3WK4 A;  4EEK A;  4KLF A;  3AQF A;  4QZA A;  3MR2 A;  1SKW A;  4R8U A;  1S0V A;  4MFC A;  3IG5 A;  4Z6D A;  8ICM A;  1RQN A;  1A0P A;  3IM1 A;  1SKS A;  3M1Y A;  3IN5 A;  1Y88 A;  5C5J A;  3BQ1 A;  3KD3 A;  4PZO A;  5D49 A;  4O3S A;  2H3I A;  1OUQ A;  2BPG A;  4DQQ A;  3RJK A;  1XU4 A;  4DFK A;  5KFF A;  2W11 A;  4QNL A;  4RNO A;  1TK8 A;  4DSL A;  1T8E A;  1A6S A;  5AI0 A;  2PMZ C;  2WF5 A;  1HUO A;  2EQY A;  3WK7 A;  3ALR A;  5ALI A;  2F1J A;  2R18 A;  1QSL A;  2C2E A;  3AUO A;  1LKY B;  4QZ9 A;  4M0A A;  8ICS A;  1RQL A;  2DPI A;  3NVW A;  3SAG A;  4DF8 A;  1ZQ1 C;  4RUC A;  3MGI A;  4YN4 A;  2BCU A;  3PX4 A;  4JV2 A;  9ICG A;  4Z6E A;  1MSW D;  1NZB A;  3RBD A;  4KN7 A;  4RPX A;  3MR3 A;  3LYS A;  4ECS A;  3TKA A;  2YB1 A;  4MHV A;  4BXO B;  3RTV A;  1ZD4 A;  4QWA A;  1BNP A;  4CE6 A;  2JH7 A;  3HPO A;  5T14 A;  2ZIV A;  1JRO A;  1S77 D;  5AI9 A;  4ECX A;  3ETR A;  4OJ6 A;  4I27 A;  3RRH A;  1KBU A;  2WF9 A;  3T5K A;  4PHP A;  2ZXH A;  2AGQ A;  3SD7 A;  3PW2 A;  3NVV A;  5KFC A;  4TQR A;  2H3F A;  2AGO A;  3ZDB A;  4CDG A;  1D9D A;  1ZQJ A;  2KVS A;  9ICM A;  2YMQ A;  4I28 A;  2XCP A;  2W9B B;  2WB1 C;  9ICQ A;  4EEY A;  4FZN A;  5CR0 A;  2ZTE A;  5ALL A;  2F8L A;  4IQU A;  3UXO A;  1SV0 C;  1TK5 A;  3N97 B;  3EPG A;  5ALU A;  2QB0 B;  1ZQS A;  2I5H A;  4USA A;  4J9K A;  2MRL A;  8ICV A;  5B66 U;  4YR3 A;  1K1Q A;  3UXN A;  4DO9 A;  2HVH A;  2YN4 A;  1ZQM A;  3L5K A;  3QZ7 A;  5DQG A;  3NVZ A;  4F4W A;  1V97 A;  3CP8 A;  2OWO A;  4DSK A;  1RYR A;  3QEA Z;  5AKL A;  4GFJ A;  5AKH A;  4M9L A;  4QW9 A;  5KFS A;  2F1H A;  4OJP A;  4FFD A;  2RRD A;  4BDP A;  3C29 A;  4F4Y A;  4ED1 A;  1NK8 A;  3H40 A;  3QXG A;  3PW5 A;  1ECW A;  1TK0 A;  4EYI B;  1RDF A;  4B9M A;  5GTI U;  4RNM A;  4ELV A;  2K89 A;  5KT2 A;  2K8B B;  5K4L A;  1NZP A;  1FEZ A;  2ES6 A;  4KLS A;  2FLN A;  1SWV A;  5KT3 A;  5IIM A;  5KFT A;  2UVR A;  2E8N A;  4DSJ A;  2KFZ A;  1N48 A;  3PW4 A;  3QU5 A;  9ICF A;  2VIX A;  1VJ5 A;  5ALE A;  1JMS A;  4R8U B;  1CRX A;  4ACO A;  2DKZ A;  5AHX A;  1NJX A;  3CYM A;  4PPX A;  4KLQ A;  1MA7 A;  5KFR A;  3RH4 A;  2RP5 A;  4UB8 U;  1SB3 C;  5L1L A;  4ZOH C;  1T3N A;  5J0T A;  1Q3U A;  5ALD A;  3AEV A;  3JPP A;  4CGZ A;  3SV4 A;  1IV8 A;  3OPX A;  4JV0 A;  2YMP A;  1BPB A;  3K1R B;  2MSN A;  5ALX A;  4KIT B;  4DQR A;  5AI6 A;  1ARO P;  9ICB A;  9ICJ A;  1COK A;  2R8I A;  2KG5 A;  7ICG A;  3MFI A;  3T3F A;  4UBC A;  3Q8R B;  2I1Q A;  2EAP A;  5HNK A;  4DLE A;  4UB4 A;  2ZJA A;  4F3O A;  4F5P A;  2LHT A;  3A0B U;  5EWE A;  1KL9 A;  1Z4O A;  4B9V A;  1RPL A;  2Q0Z X;  5IIO A;  2HBK A;  4M6W A;  5J8Y A;  2KKP A;  3MBY A;  1N2X A;  3Q8M A;  4KN4 A;  3IV6 A;  1U9L A;  2G0A A;  4RQ3 A;  2H3Z A;  3HRD D;  2DKX A;  3D2S A;  4ED2 A;  3DDH A;  4LZD A;  4B9U A;  9ICE A;  8ICN A;  4TUQ A;  4YG2 A;  2ZIU A;  4Y2X A;  2FPL A;  3RJI A;  4J9R A;  8ICX A;  1NK4 A;  3AL0 B;  2IA6 A;  1WCL A;  4JWM A;  4FBU A;  4RPY A;  2DBY A;  5KT6 A;  4NM1 A;  3RB6 A;  2R8G A;  5KFO A;  4F4K A;  3N28 A;  5L1K A;  1ZQP A;  5DDM A;  4RQ8 A;  4I2F A;  1MQ3 A;  2GO7 A;  5J0X A;  4NL9 C;  2P66 A;  4I2C A;  3TAD C;  4NLB A;  4DOB A;  5H2F U;  8ICU A;  5KG2 A;  4Y2T A;  1ZQY A;  4J9N A;  1SXE A;  1CEZ A;  4X5V A;  8ICL A;  1S0O A;  2NV3 A;  1IXR A;  1ED1 A;  1X6J A;  1FIQ A;  1KN5 A;  3E2E A;  2CRX A;  4F4Z A;  4G9B A;  4PHE A;  9ICR A;  3M8S A;  5J0W A;  3WKC A;  2HHS A;  5AKK A;  2AJQ A;  3RB3 A;  3TAP A;  5ALZ A;  2KFN A;  5HR6 A;  2XC9 A;  4NJ8 A;  4EX7 A;  3SZ2 A;  3LDA A;  3KKA C;  5DBA A;  4DFM A;  2WTF A;  1JXL A;  4M2Y A;  2EDU A;  1X9W A;  1J97 A;  1UA0 A;  2YTU A;  4F72 A;  3ZD8 A;  2IHM A;  2HBJ A;  4QW8 A;  2RDJ A;  1O08 A;  1ZJN A;  4QZI A;  5EE3 A;  3TQ1 A;  4P0Q B;  4DFD A;  5DLF A;  3I1Y A;  5BOL A;  2NO5 A;  1B0X A;  4KLO A;  4DEZ A;  2FDR A;  3QUC A;  5DB6 A; 
#chains in the Genus database with same CATH homology
 2M9N A;  5EOZ A;  4QWE A;  5D46 A;  3PW0 A;  9ICA A;  3RH5 A;  2BR0 A;  1Z3E B;  1QSY A;  1ZQU A;  4TUP A;  3OGU A;  1S10 A;  1BVS A;  1SKR A;  5KG3 A;  5DBC A;  5KFQ A;  4DL2 A;  3OSP A;  4KMU A;  4UB5 A;  3NGD A;  2J6U A;  4YD2 A;  1UA1 A;  3MDC A;  4ECY A;  3GIK A;  2BDP A;  7ICV A;  1K1S A;  9ICC A;  4YMO A;  1ZQH A;  5DG8 A;  5KFI A;  1ZET A;  4CCH A;  4ECW A;  4RUA A;  8ICP A;  3M9N B;  4QZB A;  3T5H A;  4RQ0 A;  4Q8E A;  1SL1 A;  2P6R A;  1XO1 A;  4YR2 A;  5KFY A;  2XGP A;  4R64 A;  5DB8 A;  4YXM A;  1ZQO A;  4DLG A;  3AU6 A;  2A1J B;  1BPD A;  8ICK A;  5HML A;  3B0X A;  4P4M A;  1TVA A;  1A76 A;  5TZV A;  5L1J A;  4M04 A;  1L3U A;  3JPR A;  3SI8 A;  1NKB A;  1S76 D;  3OHB A;  3V7K A;  4IRK A;  3Q8Q B;  7ICL A;  2LYH A;  2AQ0 A;  2NRX A;  3RR8 A;  4KLF A;  2BCR A;  7ICM A;  4QZA A;  3MFH A;  3UQ0 A;  3MR2 A;  2AU0 A;  3V6J A;  3G6Y A;  4ECV A;  4GC6 A;  1SKW A;  4R8U A;  4Q43 A;  4IR9 A;  1S0V A;  4MFC A;  2HHW A;  3PMN A;  4Z6D A;  3UQ2 A;  8ICM A;  9ICL A;  3IM1 A;  1ZQF A;  8ICT A;  1SKS A;  5KG5 A;  4MF2 A;  3T5J A;  4RQ2 A;  1Y88 A;  5C5J A;  1L3S A;  3BQ1 A;  4O9M A;  3BQT A;  1TFR A;  3RB0 A;  8ICF A;  4YR0 A;  4IRD A;  5DKW A;  4O3Q A;  1ZQD A;  4QWB A;  3PVX A;  4O3O A;  2W8K A;  3PX6 A;  5D49 A;  2PI5 A;  4O3S A;  4M6W B;  3FDS A;  4BXO A;  5KFW A;  1MC8 A;  3N4M B;  2BPG A;  5KG7 A;  4F4X A;  4FO6 A;  4EBC A;  4IQW A;  4EBE A;  4DQQ A;  4M9J A;  5CHG A;  1WCN A;  1XU4 A;  3RJK A;  4UBB A;  3EW9 A;  5KFF A;  4DFK A;  4RNO A;  5J0Q A;  3C5G A;  2R8K A;  3V7L A;  4Q45 A;  2ISP A;  4BWM A;  4RQ5 A;  1TK8 A;  3EYZ A;  4YFK A;  4DSL A;  4ED7 A;  2W9M A;  2C22 A;  1T8E A;  1JX4 A;  5J2I A;  3H7I A;  1RZT A;  4BGD A;  1HUO A;  7ICP A;  4RU9 A;  3ISC A;  2B21 A;  3C1Z A;  3C2M A;  1KSP A;  2KTQ A;  2FLP A;  2JZB B;  4BWJ A;  7ICT A;  1DOQ A;  2Y1I A;  5KFN A;  3G6V A;  8ICE A;  2F1J A;  1QSL A;  4DOA A;  2C2E A;  7ICI A;  2W9B A;  2BPF A;  3AUO A;  5DQH A;  5DBB A;  4QZ9 A;  5L1I A;  4M0A A;  8ICS A;  4I2J A;  5EWG A;  1NKE A;  2H5X A;  4DL3 A;  4NM2 A;  2DPI A;  5KG4 A;  4JUZ A;  4DF8 A;  4F50 A;  4RUC A;  1N56 A;  3RR7 A;  3RH6 A;  4P4P A;  4F2S A;  4ECU A;  5HP4 A;  3MDA A;  5DDY A;  3MGI A;  4YN4 A;  2BCU A;  8ICO A;  4J9Q A;  3PX4 A;  4XRH A;  4JV2 A;  7ICH A;  9ICG A;  4ZH4 A;  3V72 A;  3ZDE A;  4UQG A;  4Z6E A;  3H8J A;  2V4R A;  2PFN A;  1MSW D;  4O3R A;  4RNN A;  1Z00 B;  2BCQ A;  3GFK B;  3H4B A;  3ISB A;  1MQ2 A;  4G3I A;  3RBD A;  7ICF A;  4KN7 A;  4RPX A;  2JEF A;  3OSN A;  3MR3 A;  4DFP A;  3C1Y A;  3C23 A;  4ECS A;  2HHV A;  2BGW A;  4KLG A;  4RQ1 A;  4BXO B;  4KTQ A;  1S97 A;  4QZC A;  5IIN A;  1A77 A;  2FMQ A;  3RTV A;  4ED3 A;  5J0S A;  3H4D A;  4IRC A;  4MF8 A;  2C28 A;  4QWA A;  3FYH A;  3ISD A;  3ZDC A;  4QWD A;  1BPZ A;  3ORY A;  3V6K A;  3EPI A;  1L5U A;  1ZQC A;  2ZUB A;  4F5R A;  3RRG A;  2AGP A;  4F8R A;  3RJJ A;  2HVI A;  1KFT A;  3HPO A;  1UT8 A;  4TQS A;  2W9C B;  5J0Y A;  4DL7 A;  2GWS A;  1ZYQ A;  8ICQ A;  5KT4 A;  2PXI A;  1S77 D;  1ZQV A;  4RZR A;  7ICQ A;  1NK6 A;  5J2H A;  5CB1 A;  4ECX A;  4I27 A;  3RRH A;  1C7Y A;  3H8S A;  5KFZ A;  3T5K A;  4I2I A;  4P4O A;  4FS2 A;  4PHP A;  3RJF A;  4PGY A;  4LVS A;  2AGQ A;  4B9U A;  5J0R A;  3GV5 B;  3PW2 A;  5KFC A;  4M9H A;  4TQR A;  4DS5 A;  5KFB A;  2AGO A;  1RYS A;  3MAB A;  8ICY A;  1XC9 A;  3JPQ A;  3ZDB A;  2PFO A;  1XSL A;  9ICS A;  5DG7 A;  1KFD A;  3ETL A;  4R66 A;  1X9M A;  1D9D A;  9ICW A;  2FMS A;  4LZG A;  2F1I A;  4RQ7 A;  5DQI A;  2W9A A;  4F5Q A;  5DB7 A;  1ZQJ A;  4YCX A;  1JIH A;  3UPQ A;  9ICM A;  8ICC A;  4I28 A;  8ICR A;  3Q8K A;  2XCP A;  3GIM A;  4O3P A;  2W9B B;  9ICQ A;  4XA5 A;  4EEY A;  2IBK A;  5CR0 A;  2ZTE A;  5DGB A;  5DLG A;  5J2G A;  3C5F A;  1ZQZ A;  3TFR A;  5CJ7 A;  3RJH A;  1U49 A;  3RJE A;  4E0D A;  1PZN A;  3H8W A;  4IQU A;  3QZ8 A;  3OJU A;  4TUR A;  9ICP A;  2JZB A;  3UXO A;  4ED6 A;  1TK5 A;  3N97 B;  4UB2 A;  3EPG A;  5HMM A;  1ZQB A;  1ZQS A;  1BPX A;  4M9G A;  4J9K A;  4KLL A;  4ECZ A;  1B22 A;  4DF4 A;  1ZQQ A;  3M9M B;  8ICV A;  2BQR A;  4YR3 A;  4DL4 A;  1K1Q A;  3UXN A;  1BGX T;  3LK9 A;  2XY5 A;  4DO9 A;  2HVH A;  4J9M A;  1COO A;  1ZQM A;  4GXJ A;  4DFJ A;  2ASL A;  1KEJ A;  3QZ7 A;  1DGS A;  5DQG A;  4F4W A;  3ZDA A;  1UT5 A;  3THV A;  2OWO A;  2MUT A;  8ICG A;  4DSK A;  1XWL A;  2Y1J A;  4FBT A;  1RYR A;  3QEA Z;  4DL6 A;  4KLJ A;  1KLN A;  1L3V A;  4B9S A;  3ZDD A;  1LB2 B;  2P6U A;  3AU2 A;  5KFV A;  4ED0 A;  4QW9 A;  1U48 A;  1ZQE A;  4M9L A;  5KFS A;  2F1H A;  5KFK A;  4FS1 A;  4J9L A;  2MAX A;  9ICI A;  1ZQN A;  1X9S A;  1D9F A;  4BDP A;  4F4Y A;  1NJZ A;  4ELT A;  3JPN A;  4ED1 A;  3HX0 A;  2IHN A;  1NK8 A;  3H40 A;  3BDP A;  3PW5 A;  1EXN A;  4IQT A;  5D4B A;  3PX0 A;  3GIJ A;  3TAR A;  4YVZ A;  3C2L A;  2NRV A;  4EYI B;  1TK0 A;  1RXW A;  4Z6F A;  4B9M A;  3RJG A;  2J6T A;  4I2E A;  3NTU A;  4RNM A;  3OHA A;  4ECR A;  1XSP A;  4ELV A;  1T7P A;  4M9N A;  1XS9 D;  5KT2 A;  2XCA A;  4I2B A;  9ICN A;  2W9C A;  4PHD A;  4O0I A;  2FLN A;  4KLS A;  4HYK A;  1HJP A;  4B9N A;  3GIL A;  5KT3 A;  4ELU A;  4IQV A;  5IIM A;  4QZD A;  4DSF A;  5KFT A;  4DQI A;  2UVR A;  4QZG A;  2JEI A;  4DSJ A;  2KFZ A;  1N48 A;  3MGH A;  3PW4 A;  1QLN A;  3JPS A;  2UVV A;  9ICF A;  3GQC A;  9ICT A;  8ICZ A;  1JMS A;  4R8U B;  2IMW P;  2ZUC A;  3T5L A;  9ICU A;  1NJX A;  1KTQ A;  9ICO A;  4PPX A;  1QTM A;  4KLU A;  2XY7 A;  2BQ3 A;  4KLQ A;  1S0M A;  2V9W A;  3RB4 A;  2ZTD A;  5KFP A;  1NK5 A;  5KFR A;  3RH4 A;  1KDH A;  1NKC A;  4DSI A;  4B9T A;  4ECT A;  5L1L A;  3UXP A;  4EZ6 A;  1T3N A;  5BOM A;  4KLH A;  2V4Q A;  5KT7 A;  5J0T A;  3GII A;  7ICK A;  8ICI A;  4DOC A;  4F5N A;  1KFS A;  3SV3 A;  9ICK A;  9ICX A;  2ZJ5 A;  2BCS A;  3JPO A;  4DWI A;  3JPP A;  4KLT A;  4F93 B;  3SV4 A;  4KLE A;  5J2B A;  4K4I A;  3MR5 A;  4JV0 A;  2HHT A;  4M47 A;  2FPM A;  1BPB A;  3KHH A;  4J9S A;  3PV8 A;  2XY6 A;  4C8N A;  1D8Y A;  2VAN A;  5IIL A;  1ZQR A;  4C8O A;  4KIT B;  4DQR A;  1V9P A;  1LV5 A;  2BCV A;  4ED8 A;  3RAX A;  2JEJ A;  2VA8 A;  1ARO P;  9ICB A;  8ICJ A;  4DQS A;  9ICJ A;  4NXZ A;  2R8I A;  7ICG A;  5L9X A;  3MFI A;  1L3T A;  3T3F A;  2C2D A;  4GXI A;  4EBD A;  2J6S A;  4I29 A;  7ICR A;  5J2A A;  4UBC A;  3KHR A;  4PGQ A;  2HHX A;  2ZTC A;  2XGQ A;  3Q8R B;  2I1Q A;  4QZ8 A;  4UAZ A;  3V7J A;  2UVU A;  5HNK A;  7ICN A;  4DLE A;  1ZQW A;  4UB4 A;  3C2K A;  3TAN A;  4YXJ A;  2ZJA A;  4F3O A;  4F5P A;  2PFP A;  2KZZ A;  5EWE A;  5J2D A;  5CWR A;  4KLI A;  3C21 A;  5KG0 A;  1BPE A;  3HWT A;  4B9V A;  1RPL A;  1U4B A;  1S0N A;  2Q0Z X;  5IIO A;  2ASJ A;  4I2G A;  4YD1 A;  4RT2 A;  4RQ4 A;  1TAQ A;  2PI4 A;  2FPK A;  4M6W A;  4PH5 A;  1RXV A;  4F2R A;  4KLD A;  8ICH A;  3MBY A;  2R8H A;  7ICJ A;  5EWF A;  3G6X A;  4KN4 A;  3Q8M A;  1JXE A;  4PGX A;  2BQU A;  1U9L A;  1NOM A;  5KG6 A;  4RQ3 A;  4C8K A;  4MEX A;  2VA3 A;  7ICS A;  3EWA A;  4JK1 A;  4UB1 A;  5CA7 A;  5J29 A;  4ED2 A;  3TFS A;  4DS4 A;  9ICE A;  4LZD A;  4RQ6 A;  5DB9 A;  4RPZ A;  4TUQ A;  4YG2 A;  3PW7 A;  4PHA A;  1S9F A;  1ZQT A;  4XUS A;  4F92 B;  3Q8S B;  4KLM A;  2FPL A;  4UAY A;  4NLG A;  1T4G A;  3PR4 A;  3RJI A;  4GC7 A;  4XQ8 A;  3BQ2 A;  2DPJ A;  4J9R A;  4Q8F A;  8ICX A;  1NK4 A;  1KRP A;  2IA6 A;  3PO4 A;  1WCL A;  4R65 A;  4JWM A;  4FBU A;  4RPY A;  2KZ3 A;  5KT6 A;  3EZ5 A;  4QZH A;  3JPT A;  2BKE A;  3KHG A;  3KHL A;  5DGA A;  1U45 A;  2PFQ A;  2VA2 A;  4NM1 A;  4NLK A;  2I9G A;  7ICE A;  1JN3 A;  3RB6 A;  3LWL A;  2R8G A;  2KZM A;  4R63 A;  2BPC A;  5KFO A;  5KT5 A;  4F4K A;  3IHQ B;  1ZQK A;  5KFX A;  5L1K A;  1ZQP A;  5DDM A;  3M9O B;  4RQ8 A;  4TUS A;  1Z00 A;  4DL5 A;  5IIK A;  5J2C A;  2UVW A;  2NRZ A;  4I2F A;  1U47 A;  1MQ3 A;  1NK9 A;  1ZQG A;  5J0X A;  2AQ4 A;  5F9N A;  2P66 A;  5J0O A;  4RT3 A;  1NJY A;  4QWC A;  1SZP A;  3M8R A;  4I2C A;  2ATL A;  3KTQ A;  5III A;  1NK0 A;  1B43 A;  3GDX A;  3K4G A;  9ICV A;  5KG1 A;  2NRT A;  5KFA A;  5KFD A;  1ZQX A;  4YMM A;  3PNC A;  5BPC A;  4DOB A;  3MR6 A;  4MFA A;  8ICU A;  1NK7 A;  5KG2 A;  3GV7 B;  4MEY A;  1ZQY A;  5J2K A;  4J9N A;  4K4H A;  1SL0 A;  1NJW A;  1HUZ A;  1CEZ A;  4X5V A;  4F91 B;  1IM4 A;  5JUM A;  4JWN A;  1ZQI A;  8ICL A;  1S0O A;  1H38 A;  2JEG A;  3PO5 A;  3PY8 A;  4QZF A;  4YQW A;  1IXR A;  4I2D A;  5F9L A;  1ZJM A;  1TAU A;  4NY8 A;  1TKD A;  4P2H A;  4ECQ A;  3E2E A;  3RAQ A;  2HW3 A;  5J2F A;  5KFG A;  2C2R A;  5HHI A;  4F4Z A;  8ICA A;  5DG9 A;  5J2E A;  1CUK A;  4PHE A;  5J0U A;  9ICR A;  3HT3 A;  4O5C A;  2FLL A;  2KN7 A;  3M8S A;  1ZQA A;  2HHU A;  5J0W A;  2ISO A;  2HHS A;  1D8L A;  3OJS A;  4MFF A;  2AJQ A;  3RB3 A;  3TAP A;  4YMN A;  4JV1 A;  2KFN A;  5KFH A;  2R8J A;  2XC9 A;  4GLX A;  4IR1 A;  2ASD A;  1X2I A;  4YP3 A;  4O5E A;  4EZ9 A;  4I2A A;  2DFL A;  4B9L A;  3TI0 A;  2RDI A;  3SZ2 A;  3BJY A;  4GXK A;  3LDA A;  3ZD9 A;  5DBA A;  3QEB Z;  4DFM A;  2W8L A;  4NLN A;  4F5O A;  2ZJ8 A;  2WTF A;  4UB3 A;  2ALZ A;  1JXL A;  4I2H A;  4M2Y A;  1X9W A;  4C8L A;  3LWM A;  4DSE A;  1UA0 A;  2ZUD A;  4Q44 A;  3B0Y A;  8ICW A;  2MUT B;  4NLZ A;  3TAQ A;  4K4G A;  3PR5 B;  2FMP A;  3BQ0 A;  3HW8 A;  3RBE A;  3K75 D;  4J9P A;  3ZD8 A;  5KTQ A;  2BHN A;  3Q8L A;  2IHM A;  4QW8 A;  2RDJ A;  5KFU A;  1TV9 A;  5HHH A;  9ICH A;  4DQP A;  1ZJN A;  1QSS A;  4QZI A;  4O3N A;  5KFL A;  5CP2 A;  3SYZ A;  7ICU A;  1ZQL A;  5J2J A;  4QZE A;  5KFM A;  2XO7 A;  4O5K A;  5KFJ A;  3TQ1 A;  2NRW A;  4C8M A;  5DLF A;  8ICN A;  5IIJ A;  5J0P A;  4EYH B;  3V6H A;  5BOL A;  4UAW A;  4J9O A;  3QE9 Y;  1XSN A;  3Q8P B;  3GV8 B;  3HP6 A;  1SL2 A;  1BPY A;  8ICB A;  4KLO A;  2HHQ A;  2A1J A;  5KFE A;  3PML A;  4Z6C A;  4DEZ A;  7ICO A;  5DB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...