1B22A

Rad51 (n-terminal domain)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
b'EEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA REPAIR PROTEIN RAD51
publication title The N-terminal domain of the human Rad51 protein binds DNA: structure and a DNA binding surface as revealed by NMR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1998-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1b22A00
3B0XA 1ZQKA 5J2CA 4I2AA 1U9LA 2IHMA 1ZJMA 3JPTA 3PW7A 4M9GA 5C5JA 3RH4A 3QEAZ 3HPOA 1KSPA 5KG2A 4Z6FA 5J2DA 3GIJA 7ICNA 4TURA 2HHXA 3SYZA 2MAXA 4KLOA 3OJUA 1RYSA 3V7JA 4DQRA 8ICBA 4B9MA 1PZNA 5J2GA 2BCRA 4NLGA 4F2SA 3RJGA 3GV7B 3QEBZ 3C5FA 2VA2A 4B9TA 4GXJA 4TQSA 5DB8A 1ZQTA 9ICSA 5KT3A 5F9NA 4JV0A 1RXWA 5J2HA 1NK7A 2J6TA 3Q8SB 3V7KA 1L3UA 4F4KA 3ZDEA 4ED0A 4KTQA 4M0AA 5CWRA 2JEFA 5J0OA 4BDPA 5L1JA 4J9MA 7ICIA 3T5LA 5KFVA 8ICSA 4R65A 1ZJNA 4KITB 3PX6A 1ZQCA 1JXLA 5IIJA 3MFIA 3G6VA 3SI8A 4YMMA 4DWIA 4QZGA 2PXIA 1HJPA 1KLNA 1ZQEA 2KZ3A 8ICVA 2HHVA 8ICOA 7ICHA 4DFMA 1N56A 4KLQA 2XGQA 1NK9A 2VA8A 5KFTA 2HW3A 5HHIA 4ECSA 4XQ8A 1BPYA 8ICAA 3G6YA 5J0SA 2Y1JA 4C8OA 4ECVA 2ZUCA 4MEXA 4EBDA 5D4BA 3PVXA 3MDCA 4K4HA 2BGWA 5CP2A 1Z3EB 3RJIA 4QZCA 4DOCA 4UB2A 2AQ0A 1XSPA 3GDXA 4QZEA 3BQ1A 4FBTA 5J0RA 5KFOA 4J9KA 4DO9A 1T3NA 4O3QA 3PMNA 1S97A 4F4ZA 2Q0ZX 3NTUA 1NK6A 4KLFA 1XO1A 4QZ9A 2NRWA 1NK4A 3KHLA 3H8WA 1KFSA 4GC6A 4EBEA 3QZ8A 2UVRA 4UB4A 5KFIA 5HHHA 3ISDA 1AROP 5KG7A 4KLDA 8ICPA 5DGBA 3OHAA 5J2EA 4QZDA 5KG3A 1DGSA 1S0VA 3V6HA 9ICHA 1ZQGA 2XGPA 2KFNA 1ZQXA 8ICZA 2BKEA 5KFZA 3ZDAA 4F4WA 2FPKA 3M9OB 1NJWA 1EXNA 4KLIA 4PHAA 3ISBA 4IQUA 1XSNA 1QSLA 2BDPA 4PHPA 4ED2A 5J2FA 4YD2A 3B0YA 4RPYA 1WCNA 4Q43A 2F1HA 5CJ7A 1C7YA 4ELUA 1X2IA 4KN4A 5J29A 4UB3A 5KFPA 3H8SA 4NM2A 5KFKA 2BCQA 4YP3A 4DLGA 1N48A 1UT8A 1D9DA 4LZDA 4RPXA 2JEJA 2DPJA 2ALZA 7ICMA 8ICEA 3PV8A 3PMLA 8ICNA 1ZQNA 3RR8A 2HHUA 4DF8A 2J6SA 1LV5A 3HT3A 4RQ7A 3OSPA 4J9NA 1NJXA 4QWEA 1T7PA 4YVZA 4BWJA 1S0OA 4J9SA 2I1QA 1ZQSA 2UVWA 4YMNA 1ZYQA 3T5KA 3UPQA 2C22A 3G6XA 2JEIA 2BQ3A 3AU2A 4DOAA 1BGXT 5KFGA 3FDSA 4KLGA 4M04A 2JZBA 4RQ8A 4GLXA 2BPCA 4UB1A 1S10A 3GFKB 3N97B 3MABA 5L9XA 2F1JA 3RAQA 1ZQIA 7ICKA 1Z00A 5EOZA 5KFAA 1ZQYA 4X5VA 3SZ2A 3GV5B 2PFPA 5J0QA 2AJQA 4F93B 4QWBA 4RZRA 4MEYA 4KMUA 1H38A 1QTMA 5KT4A 2FMQA 4TUPA 4YXMA 4JUZA 5DBCA 5L1IA 2HHWA 4DLEA 5KFFA 3IHQB 2NRTA 4I2DA 5DQHA 3HP6A 2W9CB 4DSIA 5DQIA 2ASJA 1KRPA 3JPPA 3SV4A 4O3NA 3SV3A 5HNKA 9ICMA 7ICRA 2V4RA 1D9FA 1A76A 4Q44A 1HUOA 3V6JA 2HHTA 4DEZA 2ZUDA 3RH6A 3GV8B 1XC9A 1L3VA 2JEGA 2HHSA 3NGDA 4GXIA 4I28A 4NM1A 3H40A 2R8HA 3PO4A 1JN3A 3MR5A 1NJZA 2VA3A 1ZQAA 7ICUA 2MUTA 1BPDA 4DSEA 1SL0A 4F5QA 3KHRA 5IILA 3BQ2A 3Q8KA 7ICQA 4P4PA 4PHDA 3RTVA 4C8KA 4PGYA 5DGAA 5L1KA 4UAWA 4DFPA 4ELTA 4K4GA 4C8LA 4I29A 3H7IA 3GIKA 3KHHA 4DL5A 3THVA 2PFOA 2DFLA 4RQ0A 3C2LA 1ZQUA 4PGQA 3RJJA 2XCAA 3ETLA 3RB6A 5J0YA 2BCVA 1L3SA 3AU6A 1HUZA 5DDMA 1NK8A 4M9NA 4MFAA 3OJSA 2H5XA 3RBDA 4MF2A 5J2IA 3FYHA 1TV9A 2A1JB 3RAXA 3ZDBA 1MSWD 4ED1A 2JZBB 3Q8MA 4RQ1A 2W9MA 4DS4A 3QE9Y 4ECTA 3EWAA 1UA1A 4RNMA 4UAZA 9ICFA 4ED7A 3LWLA 4BGDA 4JK1A 1XWLA 1Z00B 4F92B 4DL7A 9ICGA 3ZDDA 1T4GA 2I9GA 3PNCA 4XA5A 9ICJA 2J6UA 3Q8LA 3C1ZA 9ICPA 5J2BA 4ED6A 3T5JA 1SL2A 2BCSA 1S0NA 4LVSA 2XY6A 2BR0A 4PGXA 5KFWA 3Q8PB 1TK5A 3PR5B 2ATLA 9ICTA 3MR6A 4DFJA 4EEYA 3UXPA 9ICLA 5KT6A 4NLZA 2AGPA 4YXJA 3HW8A 5KFEA 4I2CA 5J0WA 2DPIA 1BPEA 3HWTA 4UAYA 4ECUA 1K1SA 5DG9A 4UBBA 4QWDA 4GC7A 3RBEA 1ZQQA 4M9LA 4KLJA 5KFMA 4JV1A 8ICIA 1CUKA 2R8GA 3AUOA 5KFCA 4O5CA 2W9CA 3H4DA 2FMSA 1ZQOA 2MUTB 3EW9A 2ZTEA 5HMLA 5CB1A 5L1LA 2IMWP 4DOBA 2WTFA 4IQTA 4RNOA 3RJHA 4IR1A 4LZGA 8ICQA 1JIHA 9ICKA 4JWNA 3M9MB 3TANA 1TK0A 4B9NA 1JMSA 2PFQA 9ICAA 3K4GA 1IM4A 3PX0A 1KDHA 2GWSA 2C28A 3RB3A 4M9JA 1B43A 3C23A 2Y1IA 4F4YA 4EZ9A 3JPOA 1LB2B 5DBBA 2NRVA 3PY8A 5KFJA 4QZBA 4R63A 4F5RA 3BQTA 3H8JA 4Z6DA 5KT7A 3Q8RB 3MR3A 3UQ0A 1NJYA 4F5NA 4MF8A 2KTQA 8ICCA 1ZQVA 2FLPA 8ICTA 4QW9A 1MC8A 7ICJA 5DB9A 3ORYA 3JPNA 2IBKA 4I2GA 1MQ3A 7ICOA 4O3SA 3TARA 3PW4A 3RH5A 2M9NA 3LK9A 4G3IA 1NOMA 4F2RA 4TUQA 4R66A 1RZTA 4O3RA 1WCLA 1TKDA 4I2FA 5HMMA 3UQ2A 7ICVA 4F91B 4EBCA 3C21A 4ZH4A 1ZQJA 1NKCA 3V7LA 2R8KA 2A1JA 1TAUA 5J0UA 2C2RA 4XUSA 5IIKA 9ICIA 4O5EA 5KFHA 1UA0A 4QZ8A 2AGQA 7ICPA 7ICSA 3ZD8A 3MBYA 1D8YA 5EWGA 3LWMA 2ZJ5A 5BOMA 4TQRA 4ED3A 2C2DA 2XO7A 1K1QA 2F1IA 5KT2A 4TUSA 4DFKA 1NKEA 1NK0A 1NK5A 3V6KA 8ICHA 9ICEA 8ICUA 9ICUA 8ICWA 3RRHA 1QSSA 1U49A 2OWOA 1COOA 1RYRA 1ZQHA 3BDPA 4IQWA 5KFUA 5DB6A 4KLSA 3JPSA 1XS9D 3C2MA 3MFHA 2ZJAA 5J0XA 5JUMA 4O5KA 4KLTA 1CEZA 5IINA 2PI4A 2KZZA 3TI0A 4B9SA 4B9VA 3MGHA 4IRDA 4ELVA 4RUAA 1X9SA 1Y88A 4Q45A 2R8JA 4RU9A 3RB0A 8ICXA 4C8NA 5DG8A 1QSYA 5J2JA 3C2KA 4YD1A 2KFZA 1IXRA 1V9PA 5DB7A 3T3FA 4MFCA 2HVHA 3M9NB 3T5HA 4IR9A 4KLMA 3BQ0A 4NXZA 2KZMA 4PHEA 4DL6A 1X9WA 5EWFA 2AU0A 5D49A 2P6UA 3HX0A 1ZQPA 7ICFA 1XSLA 4BXOB 4RQ4A 3RJKA 1RXVA 4RPZA 4F50A 4B9UA 4ECZA 2W8KA 8ICFA 9ICOA 4HYKA 1ZETA 4EYHB 4F5OA 9ICNA 4M47A 2P66A 4DSJA 3RRGA 4QWAA 3EZ5A 4DQIA 4P4OA 3TAPA 1SL1A 8ICLA 1NKBA 1BPZA 4BWMA 4ECRA 3PW5A 9ICQA 3PX4A 5F9LA 3MGIA 1X9MA 1MQ2A 7ICLA 3LDAA 9ICXA 4ECXA 1KTQA 4J9PA 4YQWA 4QZFA 4QWCA 5DG7A 4O9MA 3EPGA 4GXKA 5KFLA 3GIMA 5J0TA 2UVVA 3PW2A 3N4MB 3OHBA 3ZD9A 1TAQA 3KHGA 1XU4A 4Z6EA 1L3TA 4EZ6A 2FLLA 3TAQA 2FPMA 3RJFA 1ZQZA 2BQRA 2IA6A 3ISCA 4DSLA 4M6WB 1U47A 4DL2A 3ZDCA 4YR3A 2FPLA 4RT2A 4RQ5A 1ZQMA 1L5UA 2V9WA 4O0IA 3OGUA 8ICRA 3C5GA 4I2BA 4YR0A 4ECYA 2PI5A 5DLGA 4Z6CA 3RR7A 5CR0A 2XCPA 4QW8A 1DOQA 4F5PA 1ZQRA 5KFDA 4DL3A 4F3OA 2BQUA 4UQGA 4IQVA 4IRKA 2R8IA 4MFFA 2BCUA 4PH5A 1TVAA 2LYHA 1BVSA 2ZTCA 5IIOA 3M8RA 4ED8A 5KFYA 1SZPA 8ICMA 4J9RA 5KG0A 5DKWA 3GQCA 2IHNA 4I2HA 5DQGA 9ICCA 1TK8A 5EWEA 4QZHA 3RB4A 4FBUA 4QZAA 5KFNA 4J9LA 4Q8EA 5J2KA 2KN7A 4JWMA 1KFDA 4M9HA 4QZIA 4UB5A 4DS5A 1ZQWA 5KG1A 2AQ4A 9ICBA 1U45A 1U4BA 4R64A 2ISOA 5KG6A 3TFSA 9ICWA 7ICEA 2VANA 3TQ1A 1KFTA 5IIIA 4BXOA 9ICVA 3PO5A 4NLNA 1JXEA 4XRHA 1ZQDA 4YG2A 1S76D 4KLUA 1BPXA 1S9FA 2RDJA 1SKSA 2ASDA 3PR4A 4R8UA 1KEJA 4RUCA 2XY5A 2W9BA 7ICGA 5CHGA 1D8LA 5CA7A 3GIIA 5BOLA 4F4XA 4DSKA 4Q8FA 8ICKA 5KG4A 3V72A 4KLHA 4KLLA 5J2AA 4I2EA 2HVIA 1T8EA 1SKRA 2NRZA 2W8LA 1BPBA 1UT5A 3JPQA 4YN4A 2C2EA 3PW0A 4DSFA 4B9LA 8ICJA 2NRXA 4FS1A 4FO6A 2XY7A 1S77D 2BHNA 4O3PA 1ZQBA 1QLNA 4RQ6A 3H4BA 4PPXA 4RT3A 5HP4A 8ICGA 3EYZA 1B22A 4KN7A 4K4IA 7ICTA 3C1YA 3IM1A 4ECWA 4I2IA 1ZQLA 4CCHA 3M8SA 3GILA 2ZUBA 2B21A 2XC9A 3BJYA 2ASLA 2HHQA 4M6WA 2UVUA 1TFRA 4NLKA 4RQ2A 4P4MA 5KFQA 4RNNA 2ZTDA 3RJEA 4YCXA 4J9QA 4UBCA 2ZJ8A 4I2JA 1U48A 2PFNA 4P2HA 3QZ7A 5KFXA 2FMPA 2FLNA 4EYIB 4JV2A 4IRCA 4J9OA 5IIMA 3Q8QB 5DDYA 4ECQA 4O3OA 3UXOA 1RPLA 3OSNA 5KG5A 2BPGA 4I27A 2V4QA 4DF4A 5KT5A 5D46A 1JX4A 3MR2A 2P6RA 3UXNA 5KTQA 4F8RA 5TZVA 4DL4A 2BPFA 8ICYA 2W9AA 5KFSA 5BPCA 4M2YA 4FS2A 2RDIA 2ISPA 1A77A 4DQQA 5J0PA 3EPIA 1SKWA 4NY8A 3E2EA 3JPRA 5DLFA 3TFRA 1ZQFA 3KTQA 5KFRA 4RQ3A 9ICRA 4DQSA 2AGOA 1S0MA 4DQPA 4R8UB 4YR2A 4KLEA 5KFBA 3MDAA 2W9BB 4E0DA 4YMOA 3K75D 4YFKA 4C8MA 5DBAA
chains in the Genus database with same CATH superfamily
1PVRA 1ZQKA 5J2CA 2WF6A 2IHMA 1ZJMA 3RH4A 3QEAZ 3WKAA 5KG2A 2OXOA 2HHXA 8ICBA 3VC8A 3GV7B 2VA2A 5DB8A 5KT3A 4ICAA 5F9NA 5J2HA 2J6TA 3TACB 4KTQA 4B6JA 2JEFA 4KITB 1ZQCA 3MFIA 3MC1A 4OJOA 4MHVA 3QU9A 3CRXA 4KLQA 4Y2TA 4AYBC 2ZIWB 2VA8A 1FFVA 5KFTA 1BPYA 5AKIA 5J0SA 4C8OA 4EBDA 5D4BA 3PVXA 4K4HA 2BGWA 4QZCA 1PVPA 1XSPA 4BJQA 3AQEA 2JH7A 5EE9A 3L3FX 4FBTA 1NK6A 4QZ9A 2NRWA 1O08A 1NK4A 1A0PA 2UVRA 5KFIA 1AROP 5KG7A 2RP5A 3OHAA 1DGSA 3NVVA 2WB1F 4RQMA 4EELA 2FPKA 1NJWA 3CNHA 4ED2A 5J2FA 3KBBA 1WCNA 4Q43A 3SQIA 3CP8A 2AHOB 4KN4A 1BNPA 3H8SA 1UT8A 1D9DA 2DPJA 3PV8A 1NZBA 3PMLA 8ICNA 1ZQNA 5ALRA 2A1AA 4UARA 1LV5A 3SR6A 4QWEA 2I1QA 3T5KA 1RYUA 2E1EA 3KFUF 4KLGA 5ALIA 2JZBA 2Y9TA 2K8BB 2BPCA 2EDUA 4UB1A 3QU2A 3N97B 3MABA 1ZQIA 2F1JA 3D2QA 2JHDA 5EOZA 1ZOLA 1URJA 5KAIU 2AJQA 2GO7A 4F93B 4MEYA 4KMUA 2FMQA 5DBCA 5L1IA 2KG5A 2NRTA 4Y2VA 4NWIA 4DSIA 2HBKA 2Y0SF 1J2MA 3SV3A 1WUDA 3RH6A 1WWVA 3NGDA 1C20A 2F8KA 3H40A 3MR5A 4DSEA 1SL0A 3KHRA 3BQ2A 4PHDA 5T14A 4PGYA 2B6GA 3QNMA 4DL5A 3RB6A 1FEZA 1L3SA 3AU6A 5DDMA 3OJSA 1N2XA 3RBDA 1MSWD 2A1JB 4ED1A 2I5HA 4DS4A 3QE9Y 4ECTA 3RFAA 4UAZA 4BGDA 1XWLA 4F92B 4NV0A 3ZDDA 1RDFA 3Q8LA 5B5EU 5AM5A 2XICA 2KSOA 2ZIUB 4LVSA 2W7PA 3Q8PB 1N62A 4DFJA 1SGGA 4EEYA 3UXPA 4NLCA 5KFEA 4I2CA 1BPEA 4GC7A 4NL9A 3RBEA 8ICIA 2K4HA 1F5SA 4JV1A 2W9CA 1ZRNA 1ZQOA 2MUTB 2M0NA 1X66A 5HMLA 5L1LA 4LZGA 4IR1A 1PK1B 2JR5A 1F44A 4PL1A 5ALZA 3PSIA 1JMSA 3K4GA 1IM4A 2YX8A 5KL1B 2C28A 1B43A 2OM6A 2Y1IA 4QZBA 4R63A 2K4IA 4Z6DA 3UQ0A 3MR3A 3Q8RB 5ALDA 1ZD4A 4QW9A 3I1YA 3ORYA 3JPNA 4I2GA 4Y2QA 4F71A 2QKQA 2M9NA 2E8NA 4O3RA 2JXJA 1ZQJA 3V7LA 4O5EA 2E8OA 1UA0A 3ZD8A 3MBYA 4P0QA 3LWMA 2ZJ5A 5BOMA 4ED3A 2IOFK 4KX3A 3RRHA 2OWOA 1U49A 5EE1A 3BDPA 3JPSA 2EAMA 2ZJAA 5J0XA 4O5KA 1CEZA 4PJ0U 2PI4A 4IRDA 1Y88A 4Q45A 3C2KA 4YD1A 3T3FA 3M9NB 3T5HA 2EQYA 3BQ0A 4DL6A 1X9WA 2KHVA 3KKAC 3QU5A 1XSLA 5ALPA 5AKJA 1ZETA 1WWUA 1SL1A 1MN8A 2DBYA 2HOIA 1NKBA 4ACOA 4BWMA 9ICQA 1N5WA 1PUZA 3D2SA 5AM2A 2GOLA 3WK5A 4J9PA 2EZYA 4YQWA 4O9MA 4GXKA 1Z4NA 3WKCA 1V38A 2LYBA 2FPMA 4OJLA 2ZXIA 3RJFA 1ZQZA 5AKHA 2BQRA 1ED1A 1Z19A 3U26A 1ZQMA 2FPLA 3KZXA 2V9WA 2XCPA 1Q46A 3I76A 4F3OA 4IQVA 2R8IA 2KE7A 5AKYA 8ICMA 3IV6A 1ZD3A 1OW5A 1V85A 1AQ6A 4OCZA 5EWEA 2ZIVA 1UPHA 4QZIA 4DS5A 4OJ5A 2DKZA 1X40A 2YY6A 3FM9A 4P0PA 3PSTA 2VANA 1KFTA 9ICVA 3PO5A 1KKXA 1ZQDA 3CW2C 3WU2U 4CE6A 3HRDD 3N7PD 2HDOA 2A19A 2YB1A 4F4XA 2LM4A 8ICKA 5KG4A 5J2AA 4I2EA 2HVIA 2HHQA 2W8LA 1UT5A 3JPQA 5ALUA 4YN4A 4FS1A 4FO6A 2QB0B 1QLNA 4RQ6A 3UMCA 4PPXA 8ICGA 3EYZA 4KN7A 5AKXA 4ECWA 1YZ7A 1ZQLA 1UQVA 1S8OA 4CCHA 4LJXA 3BJYA 2ASLA 2OYYA 1KQQA 4RQ2A 3RJEA 4YCXA 4J9QA 2Q4TA 4UBCA 2ZJ8A 4I2JA 3RF9A 4P2HA 3J81j 2FLNA 4JV2A 4J9OA 3Q8QB 5AIAA 4ECQA 3UXOA 1RPLA 3AN1A 4Y2XA 4KX5A 2HCFA 2N1RA 1JX4A 3UXNA 2BPFA 5ALXA 2YQEA 4NLBA 1KL9A 3E2EA 1ZQFA 3KTQA 5KFRA 4RQ3A 4UB6U 4DQPA 4KLEA 1L7NA 4YMOA 3K75D 2F8LA 5J2GA 2R8GA 4I2AA 1U9LA 3PW7A 2EAPA 4QIWF 3HPOA 7ICNA 3WKDA 4TURA 3OJUA 2CXYA 2PMZC 4DQRA 1PZNA 3C5FA 3F2DA 2MU2A 1L7MA 1L6NA 2EH9A 1NK7A 4Y2JA 3Q8SB 1XO0A 3V7KA 1L3UA 4KMOB 4M0AA 4BDPA 7ICIA 5KFVA 2E1FA 1ZJNA 5IIJA 2GH1A 3SI8A 1KLNA 1HJPA 5AI4A 1ZQEA 2KZ3A 4USAA 2HHVA 8ICOA 4DFMA 3ETRA 5HHIA 5AM1A 2DF4B 1P7DA 2ZG6A 1Z3EB 5AM4A 5AK4A 3GDXA 3WK9A 2JMGA 5ALHA 2W11A 1JI7A 1YZ6A 4O3QA 4KLFA 2Q0ZX 2RRDA 4JMUA 3H8WA 1KFSA 4GC6A 4KLDA 3M1YA 4UB8U 1RQLA 5DGBA 1T94A 1S0VA 4NL9C 2XGPA 2KFNA 2D6FC 8ICZA 2BKEA 3ZDAA 3M9OB 1EXNA 4PHAA 1SWVA 4FZNA 4YD2A 4RPYA 1C7YA 1N63A 1A6SA 5J29A 4UB3A 5ALSA 5KFKA 2BCQA 4YP3A 1N48A 4LZDA 2DL0A 2ALZA 4WJ3B 5AM3A 2G07A 3HT3A 1T7PA 4BWJA 4YMNA 1ZYQA 3UPQA 2C22A 3G6XA 4DOAA 1T3QA 4C0ZA 4M04A 2WF8A 1KN5A 3NVWA 2DQNB 2YMLA 3KOOA 1S10A 2LYAA 5L9XA 1NZPA 2ZIXB 2G06A 5KFAA 4JB3A 2PFPA 5J0QA 4QWBA 1H38A 1QTMA 5KT4A 4TUPA 4YXMA 2HHWA 2ZIUA 4DLEA 1RG6A 5DQIA 2ESEA 2ASJA 2H3FA 1SIJA 2RQ5A 3BS5B 9ICMA 7ICRA 5ALKA 2HHTA 1HUOA 3V6JA 3GV8B 2W7OA 1XC9A 2OEHA 2LI6A 2HHSA 4I28A 4NM1A 2P35A 2VA3A 1NJZA 2MUTA 1BPDA 5IILA 1PK1A 4IS7A 4P4PA 2E5SA 3RTVA 4UAWA 5TISU 4PGQA 4O3MA 3ETLA 2BCVA 4MF2A 5J2IA 2K4EA 2FE9A 2PKEA 3Q8MA 4RQ1A 2B0CA 2WF9A 2K60A 1Z00B 3M6ZA 4DL7A 2G08A 2K8CB 4OO1J 2I9GA 3C1ZA 3T5JA 1SL2A 1DK3A 4UAVA 1X42A 4PGXA 5KFWA 5KT6A 4NLZA 2KNJA 5J0WA 4CDGA 4UAYA 3QU4A 3OTQA 5DG9A 1ZQQA 3UMBA 2KMDA 2FMSA 5CB1A 4DOBA 4C80A 2WTFA 2JH1A 5AK3A 2DUYA 2H3IA 3TANA 2IOFA 2KKVA 3KD3A 4B9NA 3UMGA 9ICAA 1KDHA 1X6JA 2GWSA 3C23A 1JROA 2BDUA 5DBBA 3PY8A 4I2FA 2KTQA 5ALMA 1QQ5A 1VDVA 2XI9A 5DB9A 2IBKA 3TARA 3PW4A 2HOFA 1NOMA 4TUQA 4R66A 3D6JA 1RZTA 1WCLA 1LKYB 3UQ2A 1GO3F 4EX7A 2R8KA 1TAUA 3QXGA 5J0UA 1DRGA 3VCBA 2NO5A 5IIKA 1X9XA 4QZ8A 2AGQA 7ICPA 7ICSA 1D8YA 2C2DA 5KT2A 4TUSA 9ICUA 4DFKA 8ICHA 3V6KA 8ICWA 2HBJA 4KLTA 2KZZA 4B9VA 3HKZC 1ZQ1C 4RU9A 3RB0A 4C8NA 4U7CA 1WYGA 1V9PA 3M6KA 2KZMA 1IV8A 5AKLA 4PHEA 2P6UA 4A8EA 3RJKA 1RXVA 1B4FA 4PL2A 5JU5A 1L7OA 4EYHB 4DSJA 3RRGA 4P4OA 8ICLA 1BPZA 3PW5A 5F9LA 2W3RA 1KTQA 1ECWA 4QZFA 3BZCA 4QWCA 5KFLA 3NRZA 3ZD9A 3KHGA 4EZ6A 3TAQA 2OHFA 3C29A 3LVVA 3QUQA 3ISCA 4DL2A 5CRXA 2H3ZA 3AQFA 3MGVA 4RQ5A 3D2NA 3QX7A 2QB0A 2HBLA 4Z6CA 2O6KA 3EUB2 5J8YA 1N5XA 5B66U 4F5PA 3AMZA 3SD7A 4DL3A 2F76X 4MFFA 3H0LB 1TAMA 2YTUA 1QQ7A 4U6PA 2LBOA 4Y2YA 4UW9A 2ZTCA 3M8RA 5KFYA 1SZPA 4J9RA 5DKWA 3LVWA 9ICCA 3RB4A 2KKPA 4Q8EA 2HSZA 1KFDA 1ZQWA 3TKAA 1U45A 1K5OA 9ICWA 7ICEA 4BXOA 1S76D 4KLUA 2NYVA 5ALQA 3ZI4A 3ALRA 2XY5A 2WAQF 5AI9A 1RQNA 5BOLA 1JUDA 8ICJA 3PW0A 4B9LA 1S77D 2BHNA 4BX9C 5HP4A 2E3TA 4I2IA 3M8SA 2WB1C 3F2BA 3WKEA 4M6WA 2FI1A 1JALA 2ZTDA 5KAFU 1XNSA 2LM1A 3QZ7A 5KFXA 4IRCA 5ALVA 4DF4A 5KT5A 4UASA 7ICQA 2P6RA 4F8RA 5ALWA 2W9AA 5KFSA 5BPCA 2ISPA 1N60A 4CF5A 3HILA 2LKYA 4IL6U 3TFRA 3N28A 2W55A 1QCKA 9ICRA 4DQSA 2AGOA 4R8UB 4E0DA 1FIQA 4YFKA 4M9GA 5C5JA 3K1RB 1UCVA 5J2DA 4NJ8A 4KLOA 2BCRA 4NLGA 4F2SA 3QEBZ 2Y0SC 4GXJA 4TQSA 1ZQTA 9ICSA 1S5LU 4JV0A 1F0MA 2E8MA 3ZDEA 3PSPA 5CWRA 4IC9A 1J2NA 5L1JA 4J9MA 3QYPA 2E8PA 3PX6A 4Y2RA 2QLTA 3KZIU 1JXLA 4DWIA 2BZFA 1N56A 4GFJA 2KV2A 2K89A 1TE2A 3H0MB 2HW3A 4XQ8A 3N7RC 4AP9A 3G6YA 2Y1JA 1QQ6A 3PSFA 3MDCA 5CP2A 3IP4B 4DOCA 4UB2A 5AI5A 2AQ0A 1KW4A 5J0RA 4DO9A 4J9KA 1S97A 4F4ZA 1L8LA 3NVZA 1XO1A 2KK0A 5HHHA 2QARB 1SXDA 5ALJA 5J2EA 3BS5A 2LPEA 3V6HA 1L7PA 1ZQGA 1ZQXA 2JRZA 5KFZA 1O03A 3ISBA 1XSNA 2BDPA 2VIXA 4ELUA 5CJ7A 2KD1A 5KFPA 4NM2A 2YMPA 4DLGA 4RPXA 2JEJA 3CYMA 4BUGA 5ALYA 3RR8A 2J6SA 3IDWA 4US8A 1NJXA 4YVZA 1Q3UA 4J9SA 1ZQSA 4FE3A 2UVWA 2BQ3A 2KSOB 3AU2A 1BGXT 2ES6A 4GLXA 3WK6A 3GFKB 2MSNA 7ICKA 2HOQA 1Z00A 2ZIWA 1ZQYA 3QUTA 3GV5B 2W9CB 1SZHA 5HNKA 1A76A 3A0BU 4DEZA 2ZUDA 3WK4A 2EAOA 1JN3A 2KHQA 4F5QA 2G09A 4FZMA 4K4GA 4ELTA 5L1KA 1N61A 4I29A 1VLBA 2PFOA 2KEYA 1PK3A 5J0YA 1V97A 1HUZA 5AIBA 2YB4A 1TV9A 2JGAA 3ZDBA 3RAXA 4CF4A 2W9MA 3FAHA 4OJPA 1UA1A 4RNMA 4ED7A 1UHUA 2W3SA 2XIDA 4JK1A 2WFAA 1T4GA 2KJ5A 3TADA 3PNCA 1LKYA 2Z7JA 2J6UA 1MA7A 5J2BA 3SENA 2RHFA 2BR0A 1Q3VA 5EE0A 2ATLA 9ICTA 3QUBA 3MR6A 2AGPA 4YXJA 1HIWA 2DPIA 3HWTA 4ECUA 4KLJA 4UBBA 5J8YC 1CI4A 4HAIA 1IG6A 5KFCA 5A0LA 3H4DA 3EW9A 2IMWP 4IQTA 1JIHA 9ICKA 4JWNA 5AI6A 2PFQA 3PX0A 3RB3A 3L4PA 4QJFB 1L8OA 4F4YA 4EZ9A 5CEHA 2NRVA 5KFJA 9ICNA 5KT7A 4ZOHC 1ZQVA 2FLPA 4G9BA 1MQ3A 7ICOA 4O3SA 2F3NA 4G3IA 4F2RA 4GIBA 5HMMA 5C0YA 7ICVA 2A1JA 3R9KA 2C2RA 1SXEA 5EWGA 3RJGA 4TQRA 1NKEA 1NK0A 2F1IA 2Y9UA 8ICUA 4UATA 1NK5A 1QSSA 1COOA 1RYRA 1ZQHA 4KLSA 5KFUA 2EZXA 1XS9D 1KBUA 5JUMA 3TI0A 2CRXA 2EANA 4RUAA 1FFUA 2KP7A 5J2JA 3NASA 2K8AA 1IXRA 4MFCA 5DB7A 2HVHA 4IR9A 4NXZA 3B9JA 2OH2A 5EWFA 5D49A 1ZQPA 7ICFA 4RQ4A 4F50A 5F3XB 3M7DA 4ECZA 8ICFA 9ICOA 4F5OA 4DQIA 3TAPA 5ALTA 5AHXA 3PX4A 3MGIA 1X9MA 1MQ2A 7ICLA 9ICXA 3IN5A 3EPGA 3GIMA 5J0TA 2UVVA 3SMVA 3N4MB 1TAQA 4Z6EA 2W04A 4C4TA 1L3TA 2FLLA 4EX6A 5ALEA 2G5IB 5ALLA 1DXSA 4CRXA 4QIWC 4RT2A 1M6YA 1CRXA 3OGUA 5AI8A 5AKZA 3C5GA 4YR0A 4I2BA 2PI5A 2VJ5A 2DKXA 2K4PA 1DOQA 5KFDA 4QNLA 2BQUA 5HR6A 2QB1A 2BCUA 2CN1A 2F77X 5IIOA 4CNQA 3AEVA 2IHNA 4I2HA 5DQGA 3E0FA 3I28A 1TK8A 4QZHA 4FBUA 3GU3A 4QZAA 4J9LA 4JWMA 2KN7A 4M9HA 2AQ4A 9ICBA 2AH5A 5KG6A 2FDRA 3TQ1A 5IIIA 2DGZA 4C4SA 1JXEA 3BZKA 1S9FA 2RDJA 2ASDA 5ALFA 4R8UA 4RUCA 2CPRA 7ICGA 3GIIA 5CA7A 4DSKA 3C28A 4KLLA 1X6IA 1T8EA 2NRZA 2C2EA 1BPBA 1Z1BA 4DSFA 2VJ4A 2XY7A 1ZQBA 4F72A 2L5YA 3QUCA 2WHEA 3LYSA 5ALNA 2ZUBA 2F2AB 2UVUA 1TFRA 4NLKA 5JTIA 4P4MA 5KFQA 4RNNA 1SB3C 2PFNA 3BS7A 3A0HU 1SV0A 1B0XA 3OSNA 5KG5A 2BPGA 4I27A 1ZD5A 2V4QA 5TZVA 1SV4A 5J0PA 5E79U 4CGZA 5ALGA 1S0MA 4YR2A 2NV3A 3MDAA 2W9BB 5FP0A 2MA1A 5DBAA 3B0XA 1Z1VA 2HI0A 3HJEA 3JPTA 1KSPA 4Z6FA 3GIJA 3SYZA 1Q8KA 2MAXA 2G0AA 1RYSA 3H8MA 2QARA 3V7JA 4B9MA 2AXTU 1ZD2P 4CF3A 4B9TA 1NI3A 2G5HB 1RXWA 2KIVA 4F4KA 4ED0A 5J0OA 4J03A 3T5LA 8ICSA 4R65A 2NO4A 3G6VA 4YMMA 4QZGA 2PXIA 8ICVA 4OJ6A 7ICHA 2XGQA 1NK9A 2EZZA 1VJ5A 2IOHA 5L1MA 4ECSA 5G5HA 2W54A 8ICAA 4ECVA 2ZUCA 4MEXA 3RJIA 3TADC 5HR7A 2YN4A 4QZEA 3BQ1A 5KFOA 1T3NA 3PMNA 3NTUA 2ODGA 3KHLA 4EBEA 3QZ8A 4UB4A 3ISDA 8ICPA 4QZDA 5KG3A 3ED5A 9ICHA 3GZFA 3NVYA 4F4WA 4KLIA 4IQUA 1QSLA 3NS1A 3O0FA 4PHPA 3N7SC 3B0YA 2F1HA 1X2IA 1PVQA 3DV9A 1FO4A 1QH9A 4OD0A 7ICMA 8ICEA 1NNLA 4DF8A 4RQ7A 3OSPA 4J9NA 1S0OA 5AKKA 3SEIA 2WF7A 2JEIA 2KJ8A 5KFGA 3FDSA 4RQ8A 3RAQA 4C4RA 1OUQA 4X5VA 3SZ2A 1ZRMA 4RZRA 4JUZA 5KFFA 3IHQB 2PMZF 3HP6A 4I2DA 5DQHA 1JRPA 3AL0B 5GTHU 4FZLA 1KRPA 4Y2PA 5AICA 3JPPA 3SV4A 4O3NA 2VKQA 2V4RA 1D9FA 3IRUA 4Q44A 1L3VA 2JEGA 5K4LA 4GXIA 3PO4A 2R8HA 3SAGA 1ZQAA 7ICUA 2KJ9A 3Q8KA 2KVCA 4C8KA 5DGAA 4DFPA 1DGJA 4C8LA 3H7IA 3KHHA 3THVA 2DFLA 4RQ0A 3C2LA 1HEKA 1ZQUA 2XCAA 2YMQA 2HBMA 1BNOA 1NK8A 2MRLA 4MFAA 4M9NA 2H5XA 3FYHA 5JRTA 2JZBB 3EWAA 3SAHA 9ICFA 5H2FU 3DEEA 3LWLA 1SWWA 3WK7A 9ICGA 9ICJA 2KOBA 4XA5A 1DK2A 2A3VA 9ICPA 4ED6A 3ICXA 3ONNA 2BCSA 1S0NA 2XY6A 3AM9A 1YT3A 1TK5A 3PR5B 3L5KA 9ICLA 2ZIXA 3S6JA 3HW8A 2I6XA 1K1SA 4QWDA 4M9LA 5KFMA 1CUKA 3AUOA 4O5CA 1WG8A 2ZTEA 1Z4OA 4IRKA 3RJHA 4EENA 4RNOA 8ICQA 3E58A 5AK5A 3M9MB 1TK0A 4M9JA 1J97A 3JPOA 1LB2B 3RJJA 3DDHA 4F5RA 3BQTA 3H8JA 1NJYA 4F5NA 4MF8A 8ICCA 8ICTA 4Y2SA 1MC8A 2R18A 7ICJA 2GLEA 3BQ7A 1RM6C 3RH5A 1COKA 3LK9A 1TKDA 4F91B 4EBCA 3C21A 4ZH4A 1NKCA 3FC4A 2W43A 2WF5A 4XUSA 9ICIA 2RLTA 4PZOA 5G5GA 5KFHA 2WAQC 2XO7A 1K1QA 9ICEA 4IQWA 5DB6A 3C2MA 5KL8B 3MFHA 3F2CA 2LHTA 5IINA 2DWQA 3H0RB 2ZXHA 4B9SA 3MGHA 4ELVA 1X9SA 5ALOA 2R8JA 8ICXA 5DG8A 1QSYA 2JV3A 2XVTA 2KFZA 4KLMA 2KICA 2AU0A 3HX0A 4BXOB 1SV0C 2D3DA 4RPZA 4B9UA 2W8KA 2F44A 4C7YA 4HYKA 4M47A 4EEKA 2P66A 4QWAA 3EZ5A 4DFDA 4ECRA 4AYBF 3LDAA 4ECXA 1ZXIA 5DG7A 1D8BA 4PZNA 3PW2A 3OHBA 1XU4A 2FJ6A 3K1ZA 1IIPA 2KVSA 4P0QB 2IA6A 4DSLA 4M6WB 1U47A 3ZDCA 4YR3A 1L5UA 4O0IA 8ICRA 3PZPA 4ECYA 5DLGA 3RR7A 5CR0A 4QW8A 2KIWA 3IG8A 3NRWA 1ZQRA 5AM0A 4UQGA 5AKEA 4PH5A 1TVAA 2LYHA 1BVSA 4Y2UA 4ED8A 2W03A 3IG5A 2H3QA 5KG0A 3GQCA 5KFNA 5J2KA 4UB5A 5KG1A 3OPXA 1U4BA 4R64A 2ISOA 3TFSA 3QU7A 1OXJA 4UAUA 4NLNA 4DCCA 4XRHA 4YG2A 5EE3A 1BPXA 1SKSA 3PR4A 3F53A 1KEJA 2W9BA 5CHGA 1D8LA 4Q8FA 3UM9A 3V72A 4KLHA 1SKRA 2NRXA 2D8CA 2LMRA 4O3PA 3HKZF 3H4BA 4C7ZA 4RT3A 1B22A 4K4IA 7ICTA 3C1YA 3IM1A 3GILA 2B21A 2XC9A 2HMXA 2OCEA 4FFDA 3T79A 4RQNA 3WK8A 1U48A 3WKBA 2FMPA 5AI0A 5GTIU 4EYIB 3F5EA 2H3VA 5IIMA 3KKAA 5DDYA 4O3OA 2ZIVB 3F5AA 5D46A 3MR2A 5KTQA 4DL4A 8ICYA 5AKGA 4US9A 4M2YA 4P0PB 4FS2A 2RDIA 1A77A 4DQQA 5AK6A 5KNIA 2YMMA 3EPIA 1SKWA 4NY8A 3SAFA 3JPRA 5DLFA 1LVHA 3NUQA 5KFBA 2HHUA 3GIKA 4C8MA
chains in the Genus database with same CATH topology
3B0XA 1ZQKA 5J2CA 4I2AA 1U9LA 2IHMA 1ZJMA 3JPTA 3PW7A 4M9GA 5C5JA 3RH4A 3QEAZ 3HPOA 1KSPA 5KG2A 4Z6FA 5J2DA 3GIJA 7ICNA 4TURA 2HHXA 3SYZA 2MAXA 4KLOA 3OJUA 1RYSA 3V7JA 4DQRA 8ICBA 4B9MA 1PZNA 5J2GA 2BCRA 4NLGA 4F2SA 3RJGA 3GV7B 3QEBZ 3C5FA 2VA2A 4B9TA 4GXJA 4TQSA 5DB8A 1ZQTA 9ICSA 5KT3A 5F9NA 4JV0A 1RXWA 5J2HA 1NK7A 2J6TA 3Q8SB 3V7KA 1L3UA 4F4KA 3ZDEA 4ED0A 4KTQA 4M0AA 5CWRA 2JEFA 5J0OA 4BDPA 5L1JA 4J9MA 7ICIA 3T5LA 5KFVA 8ICSA 4R65A 1ZJNA 4KITB 3PX6A 1ZQCA 1JXLA 5IIJA 3MFIA 3G6VA 3SI8A 4YMMA 4DWIA 4QZGA 2PXIA 1HJPA 1KLNA 1ZQEA 2KZ3A 8ICVA 2HHVA 8ICOA 7ICHA 4DFMA 1N56A 4KLQA 2XGQA 1NK9A 2VA8A 5KFTA 2HW3A 5HHIA 4ECSA 4XQ8A 1BPYA 8ICAA 3G6YA 5J0SA 2Y1JA 4C8OA 4ECVA 2ZUCA 4MEXA 4EBDA 5D4BA 3PVXA 3MDCA 4K4HA 2BGWA 5CP2A 1Z3EB 3RJIA 4QZCA 4DOCA 4UB2A 2AQ0A 1XSPA 3GDXA 4QZEA 3BQ1A 4FBTA 5J0RA 5KFOA 4J9KA 4DO9A 1T3NA 4O3QA 3PMNA 1S97A 4F4ZA 2Q0ZX 3NTUA 1NK6A 4KLFA 1XO1A 4QZ9A 2NRWA 1NK4A 3KHLA 3H8WA 1KFSA 4GC6A 4EBEA 3QZ8A 2UVRA 4UB4A 5KFIA 5HHHA 3ISDA 1AROP 5KG7A 4KLDA 8ICPA 5DGBA 3OHAA 5J2EA 4QZDA 5KG3A 1DGSA 1S0VA 3V6HA 9ICHA 1ZQGA 2XGPA 2KFNA 1ZQXA 8ICZA 2BKEA 5KFZA 3ZDAA 4F4WA 2FPKA 3M9OB 1NJWA 1EXNA 4KLIA 4PHAA 3ISBA 4IQUA 1XSNA 1QSLA 2BDPA 4PHPA 4ED2A 5J2FA 4YD2A 3B0YA 4RPYA 1WCNA 4Q43A 2F1HA 5CJ7A 1C7YA 4ELUA 1X2IA 4KN4A 5J29A 4UB3A 5KFPA 3H8SA 4NM2A 5KFKA 2BCQA 4YP3A 4DLGA 1N48A 1UT8A 1D9DA 4LZDA 4RPXA 2JEJA 2DPJA 2ALZA 7ICMA 8ICEA 3PV8A 3PMLA 8ICNA 1ZQNA 3RR8A 2HHUA 4DF8A 2J6SA 1LV5A 3HT3A 4RQ7A 3OSPA 4J9NA 1NJXA 4QWEA 1T7PA 4YVZA 4BWJA 1S0OA 4J9SA 2I1QA 1ZQSA 2UVWA 4YMNA 1ZYQA 3T5KA 3UPQA 2C22A 3G6XA 2JEIA 2BQ3A 3AU2A 4DOAA 1BGXT 5KFGA 3FDSA 4KLGA 4M04A 2JZBA 4RQ8A 4GLXA 2BPCA 4UB1A 1S10A 3GFKB 3N97B 3MABA 5L9XA 2F1JA 3RAQA 1ZQIA 7ICKA 1Z00A 5EOZA 5KFAA 1ZQYA 4X5VA 3SZ2A 3GV5B 2PFPA 5J0QA 2AJQA 4F93B 4QWBA 4RZRA 4MEYA 4KMUA 1H38A 1QTMA 5KT4A 2FMQA 4TUPA 4YXMA 4JUZA 5DBCA 5L1IA 2HHWA 4DLEA 5KFFA 3IHQB 2NRTA 4I2DA 5DQHA 3HP6A 2W9CB 4DSIA 5DQIA 2ASJA 1KRPA 3JPPA 3SV4A 4O3NA 3SV3A 5HNKA 9ICMA 7ICRA 2V4RA 1D9FA 1A76A 4Q44A 1HUOA 3V6JA 2HHTA 4DEZA 2ZUDA 3RH6A 3GV8B 1XC9A 1L3VA 2JEGA 2HHSA 3NGDA 4GXIA 4I28A 4NM1A 3H40A 2R8HA 3PO4A 1JN3A 3MR5A 1NJZA 2VA3A 1ZQAA 7ICUA 2MUTA 1BPDA 4DSEA 1SL0A 4F5QA 3KHRA 5IILA 3BQ2A 3Q8KA 7ICQA 4P4PA 4PHDA 3RTVA 4C8KA 4PGYA 5DGAA 5L1KA 4UAWA 4DFPA 4ELTA 4K4GA 4C8LA 4I29A 3H7IA 3GIKA 3KHHA 4DL5A 3THVA 2PFOA 2DFLA 4RQ0A 3C2LA 1ZQUA 4PGQA 3RJJA 2XCAA 3ETLA 3RB6A 5J0YA 2BCVA 1L3SA 3AU6A 1HUZA 5DDMA 1NK8A 4M9NA 4MFAA 3OJSA 2H5XA 3RBDA 4MF2A 5J2IA 3FYHA 1TV9A 2A1JB 3RAXA 3ZDBA 1MSWD 4ED1A 2JZBB 3Q8MA 4RQ1A 2W9MA 4DS4A 3QE9Y 4ECTA 3EWAA 1UA1A 4RNMA 4UAZA 9ICFA 4ED7A 3LWLA 4BGDA 4JK1A 1XWLA 1Z00B 4F92B 4DL7A 9ICGA 3ZDDA 1T4GA 2I9GA 3PNCA 4XA5A 9ICJA 2J6UA 3Q8LA 3C1ZA 9ICPA 5J2BA 4ED6A 3T5JA 1SL2A 2BCSA 1S0NA 4LVSA 2XY6A 2BR0A 4PGXA 5KFWA 3Q8PB 1TK5A 3PR5B 2ATLA 9ICTA 3MR6A 4DFJA 4EEYA 3UXPA 9ICLA 5KT6A 4NLZA 2AGPA 4YXJA 3HW8A 5KFEA 4I2CA 5J0WA 2DPIA 1BPEA 3HWTA 4UAYA 4ECUA 1K1SA 5DG9A 4UBBA 4QWDA 4GC7A 3RBEA 1ZQQA 4M9LA 4KLJA 5KFMA 4JV1A 8ICIA 1CUKA 2R8GA 3AUOA 5KFCA 4O5CA 2W9CA 3H4DA 2FMSA 1ZQOA 2MUTB 3EW9A 2ZTEA 5HMLA 5CB1A 5L1LA 2IMWP 4DOBA 2WTFA 4IQTA 4RNOA 3RJHA 4IR1A 4LZGA 8ICQA 1JIHA 9ICKA 4JWNA 3M9MB 3TANA 1TK0A 4B9NA 1JMSA 2PFQA 9ICAA 3K4GA 1IM4A 3PX0A 1KDHA 2GWSA 2C28A 3RB3A 4M9JA 1B43A 3C23A 2Y1IA 4F4YA 4EZ9A 3JPOA 1LB2B 5DBBA 2NRVA 3PY8A 5KFJA 4QZBA 4R63A 4F5RA 3BQTA 3H8JA 4Z6DA 5KT7A 3Q8RB 3MR3A 3UQ0A 1NJYA 4F5NA 4MF8A 2KTQA 8ICCA 1ZQVA 2FLPA 8ICTA 4QW9A 1MC8A 7ICJA 5DB9A 3ORYA 3JPNA 2IBKA 4I2GA 1MQ3A 7ICOA 4O3SA 3TARA 3PW4A 3RH5A 2M9NA 3LK9A 4G3IA 1NOMA 4F2RA 4TUQA 4R66A 1RZTA 4O3RA 1WCLA 1TKDA 4I2FA 5HMMA 3UQ2A 7ICVA 4F91B 4EBCA 3C21A 4ZH4A 1ZQJA 1NKCA 3V7LA 2R8KA 2A1JA 1TAUA 5J0UA 2C2RA 4XUSA 5IIKA 9ICIA 4O5EA 5KFHA 1UA0A 4QZ8A 2AGQA 7ICPA 7ICSA 3ZD8A 3MBYA 1D8YA 5EWGA 3LWMA 2ZJ5A 5BOMA 4TQRA 4ED3A 2C2DA 2XO7A 1K1QA 2F1IA 5KT2A 4TUSA 4DFKA 1NKEA 1NK0A 1NK5A 3V6KA 8ICHA 9ICEA 8ICUA 9ICUA 8ICWA 3RRHA 1QSSA 1U49A 2OWOA 1COOA 1RYRA 1ZQHA 3BDPA 4IQWA 5KFUA 5DB6A 4KLSA 3JPSA 1XS9D 3C2MA 3MFHA 2ZJAA 5J0XA 5JUMA 4O5KA 4KLTA 1CEZA 5IINA 2PI4A 2KZZA 3TI0A 4B9SA 4B9VA 3MGHA 4IRDA 4ELVA 4RUAA 1X9SA 1Y88A 4Q45A 2R8JA 4RU9A 3RB0A 8ICXA 4C8NA 5DG8A 1QSYA 5J2JA 3C2KA 4YD1A 2KFZA 1IXRA 1V9PA 5DB7A 3T3FA 4MFCA 2HVHA 3M9NB 3T5HA 4IR9A 4KLMA 3BQ0A 4NXZA 2KZMA 4PHEA 4DL6A 1X9WA 5EWFA 2AU0A 5D49A 2P6UA 3HX0A 1ZQPA 7ICFA 1XSLA 4BXOB 4RQ4A 3RJKA 1RXVA 4RPZA 4F50A 4B9UA 4ECZA 2W8KA 8ICFA 9ICOA 4HYKA 1ZETA 4EYHB 4F5OA 9ICNA 4M47A 2P66A 4DSJA 3RRGA 4QWAA 3EZ5A 4DQIA 4P4OA 3TAPA 1SL1A 8ICLA 1NKBA 1BPZA 4BWMA 4ECRA 3PW5A 9ICQA 3PX4A 5F9LA 3MGIA 1X9MA 1MQ2A 7ICLA 3LDAA 9ICXA 4ECXA 1KTQA 4J9PA 4YQWA 4QZFA 4QWCA 5DG7A 4O9MA 3EPGA 4GXKA 5KFLA 3GIMA 5J0TA 2UVVA 3PW2A 3N4MB 3OHBA 3ZD9A 1TAQA 3KHGA 1XU4A 4Z6EA 1L3TA 4EZ6A 2FLLA 3TAQA 2FPMA 3RJFA 1ZQZA 2BQRA 2IA6A 3ISCA 4DSLA 4M6WB 1U47A 4DL2A 3ZDCA 4YR3A 2FPLA 4RT2A 4RQ5A 1ZQMA 1L5UA 2V9WA 4O0IA 3OGUA 8ICRA 3C5GA 4I2BA 4YR0A 4ECYA 2PI5A 5DLGA 4Z6CA 3RR7A 5CR0A 2XCPA 4QW8A 1DOQA 4F5PA 1ZQRA 5KFDA 4DL3A 4F3OA 2BQUA 4UQGA 4IQVA 4IRKA 2R8IA 4MFFA 2BCUA 4PH5A 1TVAA 2LYHA 1BVSA 2ZTCA 5IIOA 3M8RA 4ED8A 5KFYA 1SZPA 8ICMA 4J9RA 5KG0A 5DKWA 3GQCA 2IHNA 4I2HA 5DQGA 9ICCA 1TK8A 5EWEA 4QZHA 3RB4A 4FBUA 4QZAA 5KFNA 4J9LA 4Q8EA 5J2KA 2KN7A 4JWMA 1KFDA 4M9HA 4QZIA 4UB5A 4DS5A 1ZQWA 5KG1A 2AQ4A 9ICBA 1U45A 1U4BA 4R64A 2ISOA 5KG6A 3TFSA 9ICWA 7ICEA 2VANA 3TQ1A 1KFTA 5IIIA 4BXOA 9ICVA 3PO5A 4NLNA 1JXEA 4XRHA 1ZQDA 4YG2A 1S76D 4KLUA 1BPXA 1S9FA 2RDJA 1SKSA 2ASDA 3PR4A 4R8UA 1KEJA 4RUCA 2XY5A 2W9BA 7ICGA 5CHGA 1D8LA 5CA7A 3GIIA 5BOLA 4F4XA 4DSKA 4Q8FA 8ICKA 5KG4A 3V72A 4KLHA 4KLLA 5J2AA 4I2EA 2HVIA 1T8EA 1SKRA 2NRZA 2W8LA 1BPBA 1UT5A 3JPQA 4YN4A 2C2EA 3PW0A 4DSFA 4B9LA 8ICJA 2NRXA 4FS1A 4FO6A 2XY7A 1S77D 2BHNA 4O3PA 1ZQBA 1QLNA 4RQ6A 3H4BA 4PPXA 4RT3A 5HP4A 8ICGA 3EYZA 1B22A 4KN7A 4K4IA 7ICTA 3C1YA 3IM1A 4ECWA 4I2IA 1ZQLA 4CCHA 3M8SA 3GILA 2ZUBA 2B21A 2XC9A 3BJYA 2ASLA 2HHQA 4M6WA 2UVUA 1TFRA 4NLKA 4RQ2A 4P4MA 5KFQA 4RNNA 2ZTDA 3RJEA 4YCXA 4J9QA 4UBCA 2ZJ8A 4I2JA 1U48A 2PFNA 4P2HA 3QZ7A 5KFXA 2FMPA 2FLNA 4EYIB 4JV2A 4IRCA 4J9OA 5IIMA 3Q8QB 5DDYA 4ECQA 4O3OA 3UXOA 1RPLA 3OSNA 5KG5A 2BPGA 4I27A 2V4QA 4DF4A 5KT5A 5D46A 1JX4A 3MR2A 2P6RA 3UXNA 5KTQA 4F8RA 5TZVA 4DL4A 2BPFA 8ICYA 2W9AA 5KFSA 5BPCA 4M2YA 4FS2A 2RDIA 2ISPA 1A77A 4DQQA 5J0PA 3EPIA 1SKWA 4NY8A 3E2EA 3JPRA 5DLFA 3TFRA 1ZQFA 3KTQA 5KFRA 4RQ3A 9ICRA 4DQSA 2AGOA 1S0MA 4DQPA 4R8UB 4YR2A 4KLEA 5KFBA 3MDAA 2W9BB 4E0DA 4YMOA 3K75D 4YFKA 4C8MA 5DBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0X A;  1ZQK A;  5J2C A;  4I2A A;  1U9L A;  2IHM A;  1ZJM A;  3JPT A;  3PW7 A;  4M9G A;  5C5J A;  3RH4 A;  3QEA Z;  3HPO A;  1KSP A;  5KG2 A;  4Z6F A;  5J2D A;  3GIJ A;  7ICN A;  4TUR A;  2HHX A;  3SYZ A;  2MAX A;  4KLO A;  3OJU A;  1RYS A;  3V7J A;  4DQR A;  8ICB A;  4B9M A;  1PZN A;  5J2G A;  2BCR A;  4NLG A;  4F2S A;  3RJG A;  3GV7 B;  3QEB Z;  3C5F A;  2VA2 A;  4B9T A;  4GXJ A;  4TQS A;  5DB8 A;  1ZQT A;  9ICS A;  5KT3 A;  5F9N A;  4JV0 A;  1RXW A;  5J2H A;  1NK7 A;  2J6T A;  3Q8S B;  3V7K A;  1L3U A;  4F4K A;  3ZDE A;  4ED0 A;  4KTQ A;  4M0A A;  5CWR A;  2JEF A;  5J0O A;  4BDP A;  5L1J A;  4J9M A;  7ICI A;  3T5L A;  5KFV A;  8ICS A;  4R65 A;  1ZJN A;  4KIT B;  3PX6 A;  1ZQC A;  1JXL A;  5IIJ A;  3MFI A;  3G6V A;  3SI8 A;  4YMM A;  4DWI A;  4QZG A;  2PXI A;  1HJP A;  1KLN A;  1ZQE A;  2KZ3 A;  8ICV A;  2HHV A;  8ICO A;  7ICH A;  4DFM A;  1N56 A;  4KLQ A;  2XGQ A;  1NK9 A;  2VA8 A;  5KFT A;  2HW3 A;  5HHI A;  4ECS A;  4XQ8 A;  1BPY A;  8ICA A;  3G6Y A;  5J0S A;  2Y1J A;  4C8O A;  4ECV A;  2ZUC A;  4MEX A;  4EBD A;  5D4B A;  3PVX A;  3MDC A;  4K4H A;  2BGW A;  5CP2 A;  1Z3E B;  3RJI A;  4QZC A;  4DOC A;  4UB2 A;  2AQ0 A;  1XSP A;  3GDX A;  4QZE A;  3BQ1 A;  4FBT A;  5J0R A;  5KFO A;  4J9K A;  4DO9 A;  1T3N A;  4O3Q A;  3PMN A;  1S97 A;  4F4Z A;  2Q0Z X;  3NTU A;  1NK6 A;  4KLF A;  1XO1 A;  4QZ9 A;  2NRW A;  1NK4 A;  3KHL A;  3H8W A;  1KFS A;  4GC6 A;  4EBE A;  3QZ8 A;  2UVR A;  4UB4 A;  5KFI A;  5HHH A;  3ISD A;  1ARO P;  5KG7 A;  4KLD A;  8ICP A;  5DGB A;  3OHA A;  5J2E A;  4QZD A;  5KG3 A;  1DGS A;  1S0V A;  3V6H A;  9ICH A;  1ZQG A;  2XGP A;  2KFN A;  1ZQX A;  8ICZ A;  2BKE A;  5KFZ A;  3ZDA A;  4F4W A;  2FPK A;  3M9O B;  1NJW A;  1EXN A;  4KLI A;  4PHA A;  3ISB A;  4IQU A;  1XSN A;  1QSL A;  2BDP A;  4PHP A;  4ED2 A;  5J2F A;  4YD2 A;  3B0Y A;  4RPY A;  1WCN A;  4Q43 A;  2F1H A;  5CJ7 A;  1C7Y A;  4ELU A;  1X2I A;  4KN4 A;  5J29 A;  4UB3 A;  5KFP A;  3H8S A;  4NM2 A;  5KFK A;  2BCQ A;  4YP3 A;  4DLG A;  1N48 A;  1UT8 A;  1D9D A;  4LZD A;  4RPX A;  2JEJ A;  2DPJ A;  2ALZ A;  7ICM A;  8ICE A;  3PV8 A;  3PML A;  8ICN A;  1ZQN A;  3RR8 A;  2HHU A;  4DF8 A;  2J6S A;  1LV5 A;  3HT3 A;  4RQ7 A;  3OSP A;  4J9N A;  1NJX A;  4QWE A;  1T7P A;  4YVZ A;  4BWJ A;  1S0O A;  4J9S A;  2I1Q A;  1ZQS A;  2UVW A;  4YMN A;  1ZYQ A;  3T5K A;  3UPQ A;  2C22 A;  3G6X A;  2JEI A;  2BQ3 A;  3AU2 A;  4DOA A;  1BGX T;  5KFG A;  3FDS A;  4KLG A;  4M04 A;  2JZB A;  4RQ8 A;  4GLX A;  2BPC A;  4UB1 A;  1S10 A;  3GFK B;  3N97 B;  3MAB A;  5L9X A;  2F1J A;  3RAQ A;  1ZQI A;  7ICK A;  1Z00 A;  5EOZ A;  5KFA A;  1ZQY A;  4X5V A;  3SZ2 A;  3GV5 B;  2PFP A;  5J0Q A;  2AJQ A;  4F93 B;  4QWB A;  4RZR A;  4MEY A;  4KMU A;  1H38 A;  1QTM A;  5KT4 A;  2FMQ A;  4TUP A;  4YXM A;  4JUZ A;  5DBC A;  5L1I A;  2HHW A;  4DLE A;  5KFF A;  3IHQ B;  2NRT A;  4I2D A;  5DQH A;  3HP6 A;  2W9C B;  4DSI A;  5DQI A;  2ASJ A;  1KRP A;  3JPP A;  3SV4 A;  4O3N A;  3SV3 A;  5HNK A;  9ICM A;  7ICR A;  2V4R A;  1D9F A;  1A76 A;  4Q44 A;  1HUO A;  3V6J A;  2HHT A;  4DEZ A;  2ZUD A;  3RH6 A;  3GV8 B;  1XC9 A;  1L3V A;  2JEG A;  2HHS A;  3NGD A;  4GXI A;  4I28 A;  4NM1 A;  3H40 A;  2R8H A;  3PO4 A;  1JN3 A;  3MR5 A;  1NJZ A;  2VA3 A;  1ZQA A;  7ICU A;  2MUT A;  1BPD A;  4DSE A;  1SL0 A;  4F5Q A;  3KHR A;  5IIL A;  3BQ2 A;  3Q8K A;  7ICQ A;  4P4P A;  4PHD A;  3RTV A;  4C8K A;  4PGY A;  5DGA A;  5L1K A;  4UAW A;  4DFP A;  4ELT A;  4K4G A;  4C8L A;  4I29 A;  3H7I A;  3GIK A;  3KHH A;  4DL5 A;  3THV A;  2PFO A;  2DFL A;  4RQ0 A;  3C2L A;  1ZQU A;  4PGQ A;  3RJJ A;  2XCA A;  3ETL A;  3RB6 A;  5J0Y A;  2BCV A;  1L3S A;  3AU6 A;  1HUZ A;  5DDM A;  1NK8 A;  4M9N A;  4MFA A;  3OJS A;  2H5X A;  3RBD A;  4MF2 A;  5J2I A;  3FYH A;  1TV9 A;  2A1J B;  3RAX A;  3ZDB A;  1MSW D;  4ED1 A;  2JZB B;  3Q8M A;  4RQ1 A;  2W9M A;  4DS4 A;  3QE9 Y;  4ECT A;  3EWA A;  1UA1 A;  4RNM A;  4UAZ A;  9ICF A;  4ED7 A;  3LWL A;  4BGD A;  4JK1 A;  1XWL A;  1Z00 B;  4F92 B;  4DL7 A;  9ICG A;  3ZDD A;  1T4G A;  2I9G A;  3PNC A;  4XA5 A;  9ICJ A;  2J6U A;  3Q8L A;  3C1Z A;  9ICP A;  5J2B A;  4ED6 A;  3T5J A;  1SL2 A;  2BCS A;  1S0N A;  4LVS A;  2XY6 A;  2BR0 A;  4PGX A;  5KFW A;  3Q8P B;  1TK5 A;  3PR5 B;  2ATL A;  9ICT A;  3MR6 A;  4DFJ A;  4EEY A;  3UXP A;  9ICL A;  5KT6 A;  4NLZ A;  2AGP A;  4YXJ A;  3HW8 A;  5KFE A;  4I2C A;  5J0W A;  2DPI A;  1BPE A;  3HWT A;  4UAY A;  4ECU A;  1K1S A;  5DG9 A;  4UBB A;  4QWD A;  4GC7 A;  3RBE A;  1ZQQ A;  4M9L A;  4KLJ A;  5KFM A;  4JV1 A;  8ICI A;  1CUK A;  2R8G A;  3AUO A;  5KFC A;  4O5C A;  2W9C A;  3H4D A;  2FMS A;  1ZQO A;  2MUT B;  3EW9 A;  2ZTE A;  5HML A;  5CB1 A;  5L1L A;  2IMW P;  4DOB A;  2WTF A;  4IQT A;  4RNO A;  3RJH A;  4IR1 A;  4LZG A;  8ICQ A;  1JIH A;  9ICK A;  4JWN A;  3M9M B;  3TAN A;  1TK0 A;  4B9N A;  1JMS A;  2PFQ A;  9ICA A;  3K4G A;  1IM4 A;  3PX0 A;  1KDH A;  2GWS A;  2C28 A;  3RB3 A;  4M9J A;  1B43 A;  3C23 A;  2Y1I A;  4F4Y A;  4EZ9 A;  3JPO A;  1LB2 B;  5DBB A;  2NRV A;  3PY8 A;  5KFJ A;  4QZB A;  4R63 A;  4F5R A;  3BQT A;  3H8J A;  4Z6D A;  5KT7 A;  3Q8R B;  3MR3 A;  3UQ0 A;  1NJY A;  4F5N A;  4MF8 A;  2KTQ A;  8ICC A;  1ZQV A;  2FLP A;  8ICT A;  4QW9 A;  1MC8 A;  7ICJ A;  5DB9 A;  3ORY A;  3JPN A;  2IBK A;  4I2G A;  1MQ3 A;  7ICO A;  4O3S A;  3TAR A;  3PW4 A;  3RH5 A;  2M9N A;  3LK9 A;  4G3I A;  1NOM A;  4F2R A;  4TUQ A;  4R66 A;  1RZT A;  4O3R A;  1WCL A;  1TKD A;  4I2F A;  5HMM A;  3UQ2 A;  7ICV A;  4F91 B;  4EBC A;  3C21 A;  4ZH4 A;  1ZQJ A;  1NKC A;  3V7L A;  2R8K A;  2A1J A;  1TAU A;  5J0U A;  2C2R A;  4XUS A;  5IIK A;  9ICI A;  4O5E A;  5KFH A;  1UA0 A;  4QZ8 A;  2AGQ A;  7ICP A;  7ICS A;  3ZD8 A;  3MBY A;  1D8Y A;  5EWG A;  3LWM A;  2ZJ5 A;  5BOM A;  4TQR A;  4ED3 A;  2C2D A;  2XO7 A;  1K1Q A;  2F1I A;  5KT2 A;  4TUS A;  4DFK A;  1NKE A;  1NK0 A;  1NK5 A;  3V6K A;  8ICH A;  9ICE A;  8ICU A;  9ICU A;  8ICW A;  3RRH A;  1QSS A;  1U49 A;  2OWO A;  1COO A;  1RYR A;  1ZQH A;  3BDP A;  4IQW A;  5KFU A;  5DB6 A;  4KLS A;  3JPS A;  1XS9 D;  3C2M A;  3MFH A;  2ZJA A;  5J0X A;  5JUM A;  4O5K A;  4KLT A;  1CEZ A;  5IIN A;  2PI4 A;  2KZZ A;  3TI0 A;  4B9S A;  4B9V A;  3MGH A;  4IRD A;  4ELV A;  4RUA A;  1X9S A;  1Y88 A;  4Q45 A;  2R8J A;  4RU9 A;  3RB0 A;  8ICX A;  4C8N A;  5DG8 A;  1QSY A;  5J2J A;  3C2K A;  4YD1 A;  2KFZ A;  1IXR A;  1V9P A;  5DB7 A;  3T3F A;  4MFC A;  2HVH A;  3M9N B;  3T5H A;  4IR9 A;  4KLM A;  3BQ0 A;  4NXZ A;  2KZM A;  4PHE A;  4DL6 A;  1X9W A;  5EWF A;  2AU0 A;  5D49 A;  2P6U A;  3HX0 A;  1ZQP A;  7ICF A;  1XSL A;  4BXO B;  4RQ4 A;  3RJK A;  1RXV A;  4RPZ A;  4F50 A;  4B9U A;  4ECZ A;  2W8K A;  8ICF A;  9ICO A;  4HYK A;  1ZET A;  4EYH B;  4F5O A;  9ICN A;  4M47 A;  2P66 A;  4DSJ A;  3RRG A;  4QWA A;  3EZ5 A;  4DQI A;  4P4O A;  3TAP A;  1SL1 A;  8ICL A;  1NKB A;  1BPZ A;  4BWM A;  4ECR A;  3PW5 A;  9ICQ A;  3PX4 A;  5F9L A;  3MGI A;  1X9M A;  1MQ2 A;  7ICL A;  3LDA A;  9ICX A;  4ECX A;  1KTQ A;  4J9P A;  4YQW A;  4QZF A;  4QWC A;  5DG7 A;  4O9M A;  3EPG A;  4GXK A;  5KFL A;  3GIM A;  5J0T A;  2UVV A;  3PW2 A;  3N4M B;  3OHB A;  3ZD9 A;  1TAQ A;  3KHG A;  1XU4 A;  4Z6E A;  1L3T A;  4EZ6 A;  2FLL A;  3TAQ A;  2FPM A;  3RJF A;  1ZQZ A;  2BQR A;  2IA6 A;  3ISC A;  4DSL A;  4M6W B;  1U47 A;  4DL2 A;  3ZDC A;  4YR3 A;  2FPL A;  4RT2 A;  4RQ5 A;  1ZQM A;  1L5U A;  2V9W A;  4O0I A;  3OGU A;  8ICR A;  3C5G A;  4I2B A;  4YR0 A;  4ECY A;  2PI5 A;  5DLG A;  4Z6C A;  3RR7 A;  5CR0 A;  2XCP A;  4QW8 A;  1DOQ A;  4F5P A;  1ZQR A;  5KFD A;  4DL3 A;  4F3O A;  2BQU A;  4UQG A;  4IQV A;  4IRK A;  2R8I A;  4MFF A;  2BCU A;  4PH5 A;  1TVA A;  2LYH A;  1BVS A;  2ZTC A;  5IIO A;  3M8R A;  4ED8 A;  5KFY A;  1SZP A;  8ICM A;  4J9R A;  5KG0 A;  5DKW A;  3GQC A;  2IHN A;  4I2H A;  5DQG A;  9ICC A;  1TK8 A;  5EWE A;  4QZH A;  3RB4 A;  4FBU A;  4QZA A;  5KFN A;  4J9L A;  4Q8E A;  5J2K A;  2KN7 A;  4JWM A;  1KFD A;  4M9H A;  4QZI A;  4UB5 A;  4DS5 A;  1ZQW A;  5KG1 A;  2AQ4 A;  9ICB A;  1U45 A;  1U4B A;  4R64 A;  2ISO A;  5KG6 A;  3TFS A;  9ICW A;  7ICE A;  2VAN A;  3TQ1 A;  1KFT A;  5III A;  4BXO A;  9ICV A;  3PO5 A;  4NLN A;  1JXE A;  4XRH A;  1ZQD A;  4YG2 A;  1S76 D;  4KLU A;  1BPX A;  1S9F A;  2RDJ A;  1SKS A;  2ASD A;  3PR4 A;  4R8U A;  1KEJ A;  4RUC A;  2XY5 A;  2W9B A;  7ICG A;  5CHG A;  1D8L A;  5CA7 A;  3GII A;  5BOL A;  4F4X A;  4DSK A;  4Q8F A;  8ICK A;  5KG4 A;  3V72 A;  4KLH A;  4KLL A;  5J2A A;  4I2E A;  2HVI A;  1T8E A;  1SKR A;  2NRZ A;  2W8L A;  1BPB A;  1UT5 A;  3JPQ A;  4YN4 A;  2C2E A;  3PW0 A;  4DSF A;  4B9L A;  8ICJ A;  2NRX A;  4FS1 A;  4FO6 A;  2XY7 A;  1S77 D;  2BHN A;  4O3P A;  1ZQB A;  1QLN A;  4RQ6 A;  3H4B A;  4PPX A;  4RT3 A;  5HP4 A;  8ICG A;  3EYZ A;  1B22 A;  4KN7 A;  4K4I A;  7ICT A;  3C1Y A;  3IM1 A;  4ECW A;  4I2I A;  1ZQL A;  4CCH A;  3M8S A;  3GIL A;  2ZUB A;  2B21 A;  2XC9 A;  3BJY A;  2ASL A;  2HHQ A;  4M6W A;  2UVU A;  1TFR A;  4NLK A;  4RQ2 A;  4P4M A;  5KFQ A;  4RNN A;  2ZTD A;  3RJE A;  4YCX A;  4J9Q A;  4UBC A;  2ZJ8 A;  4I2J A;  1U48 A;  2PFN A;  4P2H A;  3QZ7 A;  5KFX A;  2FMP A;  2FLN A;  4EYI B;  4JV2 A;  4IRC A;  4J9O A;  5IIM A;  3Q8Q B;  5DDY A;  4ECQ A;  4O3O A;  3UXO A;  1RPL A;  3OSN A;  5KG5 A;  2BPG A;  4I27 A;  2V4Q A;  4DF4 A;  5KT5 A;  5D46 A;  1JX4 A;  3MR2 A;  2P6R A;  3UXN A;  5KTQ A;  4F8R A;  5TZV A;  4DL4 A;  2BPF A;  8ICY A;  2W9A A;  5KFS A;  5BPC A;  4M2Y A;  4FS2 A;  2RDI A;  2ISP A;  1A77 A;  4DQQ A;  5J0P A;  3EPI A;  1SKW A;  4NY8 A;  3E2E A;  3JPR A;  5DLF A;  3TFR A;  1ZQF A;  3KTQ A;  5KFR A;  4RQ3 A;  9ICR A;  4DQS A;  2AGO A;  1S0M A;  4DQP A;  4R8U B;  4YR2 A;  4KLE A;  5KFB A;  3MDA A;  2W9B B;  4E0D A;  4YMO A;  3K75 D;  4YFK A;  4C8M A;  5DBA A; 
#chains in the Genus database with same CATH topology
 1PVR A;  1ZQK A;  5J2C A;  2WF6 A;  2IHM A;  1ZJM A;  3RH4 A;  3QEA Z;  3WKA A;  5KG2 A;  2OXO A;  2HHX A;  8ICB A;  3VC8 A;  3GV7 B;  2VA2 A;  5DB8 A;  5KT3 A;  4ICA A;  5F9N A;  5J2H A;  2J6T A;  3TAC B;  4KTQ A;  4B6J A;  2JEF A;  4KIT B;  1ZQC A;  3MFI A;  3MC1 A;  4OJO A;  4MHV A;  3QU9 A;  3CRX A;  4KLQ A;  4Y2T A;  4AYB C;  2ZIW B;  2VA8 A;  1FFV A;  5KFT A;  1BPY A;  5AKI A;  5J0S A;  4C8O A;  4EBD A;  5D4B A;  3PVX A;  4K4H A;  2BGW A;  4QZC A;  1PVP A;  1XSP A;  4BJQ A;  3AQE A;  2JH7 A;  5EE9 A;  3L3F X;  4FBT A;  1NK6 A;  4QZ9 A;  2NRW A;  1O08 A;  1NK4 A;  1A0P A;  2UVR A;  5KFI A;  1ARO P;  5KG7 A;  2RP5 A;  3OHA A;  1DGS A;  3NVV A;  2WB1 F;  4RQM A;  4EEL A;  2FPK A;  1NJW A;  3CNH A;  4ED2 A;  5J2F A;  3KBB A;  1WCN A;  4Q43 A;  3SQI A;  3CP8 A;  2AHO B;  4KN4 A;  1BNP A;  3H8S A;  1UT8 A;  1D9D A;  2DPJ A;  3PV8 A;  1NZB A;  3PML A;  8ICN A;  1ZQN A;  5ALR A;  2A1A A;  4UAR A;  1LV5 A;  3SR6 A;  4QWE A;  2I1Q A;  3T5K A;  1RYU A;  2E1E A;  3KFU F;  4KLG A;  5ALI A;  2JZB A;  2Y9T A;  2K8B B;  2BPC A;  2EDU A;  4UB1 A;  3QU2 A;  3N97 B;  3MAB A;  1ZQI A;  2F1J A;  3D2Q A;  2JHD A;  5EOZ A;  1ZOL A;  1URJ A;  5KAI U;  2AJQ A;  2GO7 A;  4F93 B;  4MEY A;  4KMU A;  2FMQ A;  5DBC A;  5L1I A;  2KG5 A;  2NRT A;  4Y2V A;  4NWI A;  4DSI A;  2HBK A;  2Y0S F;  1J2M A;  3SV3 A;  1WUD A;  3RH6 A;  1WWV A;  3NGD A;  1C20 A;  2F8K A;  3H40 A;  3MR5 A;  4DSE A;  1SL0 A;  3KHR A;  3BQ2 A;  4PHD A;  5T14 A;  4PGY A;  2B6G A;  3QNM A;  4DL5 A;  3RB6 A;  1FEZ A;  1L3S A;  3AU6 A;  5DDM A;  3OJS A;  1N2X A;  3RBD A;  1MSW D;  2A1J B;  4ED1 A;  2I5H A;  4DS4 A;  3QE9 Y;  4ECT A;  3RFA A;  4UAZ A;  4BGD A;  1XWL A;  4F92 B;  4NV0 A;  3ZDD A;  1RDF A;  3Q8L A;  5B5E U;  5AM5 A;  2XIC A;  2KSO A;  2ZIU B;  4LVS A;  2W7P A;  3Q8P B;  1N62 A;  4DFJ A;  1SGG A;  4EEY A;  3UXP A;  4NLC A;  5KFE A;  4I2C A;  1BPE A;  4GC7 A;  4NL9 A;  3RBE A;  8ICI A;  2K4H A;  1F5S A;  4JV1 A;  2W9C A;  1ZRN A;  1ZQO A;  2MUT B;  2M0N A;  1X66 A;  5HML A;  5L1L A;  4LZG A;  4IR1 A;  1PK1 B;  2JR5 A;  1F44 A;  4PL1 A;  5ALZ A;  3PSI A;  1JMS A;  3K4G A;  1IM4 A;  2YX8 A;  5KL1 B;  2C28 A;  1B43 A;  2OM6 A;  2Y1I A;  4QZB A;  4R63 A;  2K4I A;  4Z6D A;  3UQ0 A;  3MR3 A;  3Q8R B;  5ALD A;  1ZD4 A;  4QW9 A;  3I1Y A;  3ORY A;  3JPN A;  4I2G A;  4Y2Q A;  4F71 A;  2QKQ A;  2M9N A;  2E8N A;  4O3R A;  2JXJ A;  1ZQJ A;  3V7L A;  4O5E A;  2E8O A;  1UA0 A;  3ZD8 A;  3MBY A;  4P0Q A;  3LWM A;  2ZJ5 A;  5BOM A;  4ED3 A;  2IOF K;  4KX3 A;  3RRH A;  2OWO A;  1U49 A;  5EE1 A;  3BDP A;  3JPS A;  2EAM A;  2ZJA A;  5J0X A;  4O5K A;  1CEZ A;  4PJ0 U;  2PI4 A;  4IRD A;  1Y88 A;  4Q45 A;  3C2K A;  4YD1 A;  3T3F A;  3M9N B;  3T5H A;  2EQY A;  3BQ0 A;  4DL6 A;  1X9W A;  2KHV A;  3KKA C;  3QU5 A;  1XSL A;  5ALP A;  5AKJ A;  1ZET A;  1WWU A;  1SL1 A;  1MN8 A;  2DBY A;  2HOI A;  1NKB A;  4ACO A;  4BWM A;  9ICQ A;  1N5W A;  1PUZ A;  3D2S A;  5AM2 A;  2GOL A;  3WK5 A;  4J9P A;  2EZY A;  4YQW A;  4O9M A;  4GXK A;  1Z4N A;  3WKC A;  1V38 A;  2LYB A;  2FPM A;  4OJL A;  2ZXI A;  3RJF A;  1ZQZ A;  5AKH A;  2BQR A;  1ED1 A;  1Z19 A;  3U26 A;  1ZQM A;  2FPL A;  3KZX A;  2V9W A;  2XCP A;  1Q46 A;  3I76 A;  4F3O A;  4IQV A;  2R8I A;  2KE7 A;  5AKY A;  8ICM A;  3IV6 A;  1ZD3 A;  1OW5 A;  1V85 A;  1AQ6 A;  4OCZ A;  5EWE A;  2ZIV A;  1UPH A;  4QZI A;  4DS5 A;  4OJ5 A;  2DKZ A;  1X40 A;  2YY6 A;  3FM9 A;  4P0P A;  3PST A;  2VAN A;  1KFT A;  9ICV A;  3PO5 A;  1KKX A;  1ZQD A;  3CW2 C;  3WU2 U;  4CE6 A;  3HRD D;  3N7P D;  2HDO A;  2A19 A;  2YB1 A;  4F4X A;  2LM4 A;  8ICK A;  5KG4 A;  5J2A A;  4I2E A;  2HVI A;  2HHQ A;  2W8L A;  1UT5 A;  3JPQ A;  5ALU A;  4YN4 A;  4FS1 A;  4FO6 A;  2QB0 B;  1QLN A;  4RQ6 A;  3UMC A;  4PPX A;  8ICG A;  3EYZ A;  4KN7 A;  5AKX A;  4ECW A;  1YZ7 A;  1ZQL A;  1UQV A;  1S8O A;  4CCH A;  4LJX A;  3BJY A;  2ASL A;  2OYY A;  1KQQ A;  4RQ2 A;  3RJE A;  4YCX A;  4J9Q A;  2Q4T A;  4UBC A;  2ZJ8 A;  4I2J A;  3RF9 A;  4P2H A;  3J81 j;  2FLN A;  4JV2 A;  4J9O A;  3Q8Q B;  5AIA A;  4ECQ A;  3UXO A;  1RPL A;  3AN1 A;  4Y2X A;  4KX5 A;  2HCF A;  2N1R A;  1JX4 A;  3UXN A;  2BPF A;  5ALX A;  2YQE A;  4NLB A;  1KL9 A;  3E2E A;  1ZQF A;  3KTQ A;  5KFR A;  4RQ3 A;  4UB6 U;  4DQP A;  4KLE A;  1L7N A;  4YMO A;  3K75 D;  2F8L A;  5J2G A;  2R8G A;  4I2A A;  1U9L A;  3PW7 A;  2EAP A;  4QIW F;  3HPO A;  7ICN A;  3WKD A;  4TUR A;  3OJU A;  2CXY A;  2PMZ C;  4DQR A;  1PZN A;  3C5F A;  3F2D A;  2MU2 A;  1L7M A;  1L6N A;  2EH9 A;  1NK7 A;  4Y2J A;  3Q8S B;  1XO0 A;  3V7K A;  1L3U A;  4KMO B;  4M0A A;  4BDP A;  7ICI A;  5KFV A;  2E1F A;  1ZJN A;  5IIJ A;  2GH1 A;  3SI8 A;  1KLN A;  1HJP A;  5AI4 A;  1ZQE A;  2KZ3 A;  4USA A;  2HHV A;  8ICO A;  4DFM A;  3ETR A;  5HHI A;  5AM1 A;  2DF4 B;  1P7D A;  2ZG6 A;  1Z3E B;  5AM4 A;  5AK4 A;  3GDX A;  3WK9 A;  2JMG A;  5ALH A;  2W11 A;  1JI7 A;  1YZ6 A;  4O3Q A;  4KLF A;  2Q0Z X;  2RRD A;  4JMU A;  3H8W A;  1KFS A;  4GC6 A;  4KLD A;  3M1Y A;  4UB8 U;  1RQL A;  5DGB A;  1T94 A;  1S0V A;  4NL9 C;  2XGP A;  2KFN A;  2D6F C;  8ICZ A;  2BKE A;  3ZDA A;  3M9O B;  1EXN A;  4PHA A;  1SWV A;  4FZN A;  4YD2 A;  4RPY A;  1C7Y A;  1N63 A;  1A6S A;  5J29 A;  4UB3 A;  5ALS A;  5KFK A;  2BCQ A;  4YP3 A;  1N48 A;  4LZD A;  2DL0 A;  2ALZ A;  4WJ3 B;  5AM3 A;  2G07 A;  3HT3 A;  1T7P A;  4BWJ A;  4YMN A;  1ZYQ A;  3UPQ A;  2C22 A;  3G6X A;  4DOA A;  1T3Q A;  4C0Z A;  4M04 A;  2WF8 A;  1KN5 A;  3NVW A;  2DQN B;  2YML A;  3KOO A;  1S10 A;  2LYA A;  5L9X A;  1NZP A;  2ZIX B;  2G06 A;  5KFA A;  4JB3 A;  2PFP A;  5J0Q A;  4QWB A;  1H38 A;  1QTM A;  5KT4 A;  4TUP A;  4YXM A;  2HHW A;  2ZIU A;  4DLE A;  1RG6 A;  5DQI A;  2ESE A;  2ASJ A;  2H3F A;  1SIJ A;  2RQ5 A;  3BS5 B;  9ICM A;  7ICR A;  5ALK A;  2HHT A;  1HUO A;  3V6J A;  3GV8 B;  2W7O A;  1XC9 A;  2OEH A;  2LI6 A;  2HHS A;  4I28 A;  4NM1 A;  2P35 A;  2VA3 A;  1NJZ A;  2MUT A;  1BPD A;  5IIL A;  1PK1 A;  4IS7 A;  4P4P A;  2E5S A;  3RTV A;  4UAW A;  5TIS U;  4PGQ A;  4O3M A;  3ETL A;  2BCV A;  4MF2 A;  5J2I A;  2K4E A;  2FE9 A;  2PKE A;  3Q8M A;  4RQ1 A;  2B0C A;  2WF9 A;  2K60 A;  1Z00 B;  3M6Z A;  4DL7 A;  2G08 A;  2K8C B;  4OO1 J;  2I9G A;  3C1Z A;  3T5J A;  1SL2 A;  1DK3 A;  4UAV A;  1X42 A;  4PGX A;  5KFW A;  5KT6 A;  4NLZ A;  2KNJ A;  5J0W A;  4CDG A;  4UAY A;  3QU4 A;  3OTQ A;  5DG9 A;  1ZQQ A;  3UMB A;  2KMD A;  2FMS A;  5CB1 A;  4DOB A;  4C80 A;  2WTF A;  2JH1 A;  5AK3 A;  2DUY A;  2H3I A;  3TAN A;  2IOF A;  2KKV A;  3KD3 A;  4B9N A;  3UMG A;  9ICA A;  1KDH A;  1X6J A;  2GWS A;  3C23 A;  1JRO A;  2BDU A;  5DBB A;  3PY8 A;  4I2F A;  2KTQ A;  5ALM A;  1QQ5 A;  1VDV A;  2XI9 A;  5DB9 A;  2IBK A;  3TAR A;  3PW4 A;  2HOF A;  1NOM A;  4TUQ A;  4R66 A;  3D6J A;  1RZT A;  1WCL A;  1LKY B;  3UQ2 A;  1GO3 F;  4EX7 A;  2R8K A;  1TAU A;  3QXG A;  5J0U A;  1DRG A;  3VCB A;  2NO5 A;  5IIK A;  1X9X A;  4QZ8 A;  2AGQ A;  7ICP A;  7ICS A;  1D8Y A;  2C2D A;  5KT2 A;  4TUS A;  9ICU A;  4DFK A;  8ICH A;  3V6K A;  8ICW A;  2HBJ A;  4KLT A;  2KZZ A;  4B9V A;  3HKZ C;  1ZQ1 C;  4RU9 A;  3RB0 A;  4C8N A;  4U7C A;  1WYG A;  1V9P A;  3M6K A;  2KZM A;  1IV8 A;  5AKL A;  4PHE A;  2P6U A;  4A8E A;  3RJK A;  1RXV A;  1B4F A;  4PL2 A;  5JU5 A;  1L7O A;  4EYH B;  4DSJ A;  3RRG A;  4P4O A;  8ICL A;  1BPZ A;  3PW5 A;  5F9L A;  2W3R A;  1KTQ A;  1ECW A;  4QZF A;  3BZC A;  4QWC A;  5KFL A;  3NRZ A;  3ZD9 A;  3KHG A;  4EZ6 A;  3TAQ A;  2OHF A;  3C29 A;  3LVV A;  3QUQ A;  3ISC A;  4DL2 A;  5CRX A;  2H3Z A;  3AQF A;  3MGV A;  4RQ5 A;  3D2N A;  3QX7 A;  2QB0 A;  2HBL A;  4Z6C A;  2O6K A;  3EUB 2;  5J8Y A;  1N5X A;  5B66 U;  4F5P A;  3AMZ A;  3SD7 A;  4DL3 A;  2F76 X;  4MFF A;  3H0L B;  1TAM A;  2YTU A;  1QQ7 A;  4U6P A;  2LBO A;  4Y2Y A;  4UW9 A;  2ZTC A;  3M8R A;  5KFY A;  1SZP A;  4J9R A;  5DKW A;  3LVW A;  9ICC A;  3RB4 A;  2KKP A;  4Q8E A;  2HSZ A;  1KFD A;  1ZQW A;  3TKA A;  1U45 A;  1K5O A;  9ICW A;  7ICE A;  4BXO A;  1S76 D;  4KLU A;  2NYV A;  5ALQ A;  3ZI4 A;  3ALR A;  2XY5 A;  2WAQ F;  5AI9 A;  1RQN A;  5BOL A;  1JUD A;  8ICJ A;  3PW0 A;  4B9L A;  1S77 D;  2BHN A;  4BX9 C;  5HP4 A;  2E3T A;  4I2I A;  3M8S A;  2WB1 C;  3F2B A;  3WKE A;  4M6W A;  2FI1 A;  1JAL A;  2ZTD A;  5KAF U;  1XNS A;  2LM1 A;  3QZ7 A;  5KFX A;  4IRC A;  5ALV A;  4DF4 A;  5KT5 A;  4UAS A;  7ICQ A;  2P6R A;  4F8R A;  5ALW A;  2W9A A;  5KFS A;  5BPC A;  2ISP A;  1N60 A;  4CF5 A;  3HIL A;  2LKY A;  4IL6 U;  3TFR A;  3N28 A;  2W55 A;  1QCK A;  9ICR A;  4DQS A;  2AGO A;  4R8U B;  4E0D A;  1FIQ A;  4YFK A;  4M9G A;  5C5J A;  3K1R B;  1UCV A;  5J2D A;  4NJ8 A;  4KLO A;  2BCR A;  4NLG A;  4F2S A;  3QEB Z;  2Y0S C;  4GXJ A;  4TQS A;  1ZQT A;  9ICS A;  1S5L U;  4JV0 A;  1F0M A;  2E8M A;  3ZDE A;  3PSP A;  5CWR A;  4IC9 A;  1J2N A;  5L1J A;  4J9M A;  3QYP A;  2E8P A;  3PX6 A;  4Y2R A;  2QLT A;  3KZI U;  1JXL A;  4DWI A;  2BZF A;  1N56 A;  4GFJ A;  2KV2 A;  2K89 A;  1TE2 A;  3H0M B;  2HW3 A;  4XQ8 A;  3N7R C;  4AP9 A;  3G6Y A;  2Y1J A;  1QQ6 A;  3PSF A;  3MDC A;  5CP2 A;  3IP4 B;  4DOC A;  4UB2 A;  5AI5 A;  2AQ0 A;  1KW4 A;  5J0R A;  4DO9 A;  4J9K A;  1S97 A;  4F4Z A;  1L8L A;  3NVZ A;  1XO1 A;  2KK0 A;  5HHH A;  2QAR B;  1SXD A;  5ALJ A;  5J2E A;  3BS5 A;  2LPE A;  3V6H A;  1L7P A;  1ZQG A;  1ZQX A;  2JRZ A;  5KFZ A;  1O03 A;  3ISB A;  1XSN A;  2BDP A;  2VIX A;  4ELU A;  5CJ7 A;  2KD1 A;  5KFP A;  4NM2 A;  2YMP A;  4DLG A;  4RPX A;  2JEJ A;  3CYM A;  4BUG A;  5ALY A;  3RR8 A;  2J6S A;  3IDW A;  4US8 A;  1NJX A;  4YVZ A;  1Q3U A;  4J9S A;  1ZQS A;  4FE3 A;  2UVW A;  2BQ3 A;  2KSO B;  3AU2 A;  1BGX T;  2ES6 A;  4GLX A;  3WK6 A;  3GFK B;  2MSN A;  7ICK A;  2HOQ A;  1Z00 A;  2ZIW A;  1ZQY A;  3QUT A;  3GV5 B;  2W9C B;  1SZH A;  5HNK A;  1A76 A;  3A0B U;  4DEZ A;  2ZUD A;  3WK4 A;  2EAO A;  1JN3 A;  2KHQ A;  4F5Q A;  2G09 A;  4FZM A;  4K4G A;  4ELT A;  5L1K A;  1N61 A;  4I29 A;  1VLB A;  2PFO A;  2KEY A;  1PK3 A;  5J0Y A;  1V97 A;  1HUZ A;  5AIB A;  2YB4 A;  1TV9 A;  2JGA A;  3ZDB A;  3RAX A;  4CF4 A;  2W9M A;  3FAH A;  4OJP A;  1UA1 A;  4RNM A;  4ED7 A;  1UHU A;  2W3S A;  2XID A;  4JK1 A;  2WFA A;  1T4G A;  2KJ5 A;  3TAD A;  3PNC A;  1LKY A;  2Z7J A;  2J6U A;  1MA7 A;  5J2B A;  3SEN A;  2RHF A;  2BR0 A;  1Q3V A;  5EE0 A;  2ATL A;  9ICT A;  3QUB A;  3MR6 A;  2AGP A;  4YXJ A;  1HIW A;  2DPI A;  3HWT A;  4ECU A;  4KLJ A;  4UBB A;  5J8Y C;  1CI4 A;  4HAI A;  1IG6 A;  5KFC A;  5A0L A;  3H4D A;  3EW9 A;  2IMW P;  4IQT A;  1JIH A;  9ICK A;  4JWN A;  5AI6 A;  2PFQ A;  3PX0 A;  3RB3 A;  3L4P A;  4QJF B;  1L8O A;  4F4Y A;  4EZ9 A;  5CEH A;  2NRV A;  5KFJ A;  9ICN A;  5KT7 A;  4ZOH C;  1ZQV A;  2FLP A;  4G9B A;  1MQ3 A;  7ICO A;  4O3S A;  2F3N A;  4G3I A;  4F2R A;  4GIB A;  5HMM A;  5C0Y A;  7ICV A;  2A1J A;  3R9K A;  2C2R A;  1SXE A;  5EWG A;  3RJG A;  4TQR A;  1NKE A;  1NK0 A;  2F1I A;  2Y9U A;  8ICU A;  4UAT A;  1NK5 A;  1QSS A;  1COO A;  1RYR A;  1ZQH A;  4KLS A;  5KFU A;  2EZX A;  1XS9 D;  1KBU A;  5JUM A;  3TI0 A;  2CRX A;  2EAN A;  4RUA A;  1FFU A;  2KP7 A;  5J2J A;  3NAS A;  2K8A A;  1IXR A;  4MFC A;  5DB7 A;  2HVH A;  4IR9 A;  4NXZ A;  3B9J A;  2OH2 A;  5EWF A;  5D49 A;  1ZQP A;  7ICF A;  4RQ4 A;  4F50 A;  5F3X B;  3M7D A;  4ECZ A;  8ICF A;  9ICO A;  4F5O A;  4DQI A;  3TAP A;  5ALT A;  5AHX A;  3PX4 A;  3MGI A;  1X9M A;  1MQ2 A;  7ICL A;  9ICX A;  3IN5 A;  3EPG A;  3GIM A;  5J0T A;  2UVV A;  3SMV A;  3N4M B;  1TAQ A;  4Z6E A;  2W04 A;  4C4T A;  1L3T A;  2FLL A;  4EX6 A;  5ALE A;  2G5I B;  5ALL A;  1DXS A;  4CRX A;  4QIW C;  4RT2 A;  1M6Y A;  1CRX A;  3OGU A;  5AI8 A;  5AKZ A;  3C5G A;  4YR0 A;  4I2B A;  2PI5 A;  2VJ5 A;  2DKX A;  2K4P A;  1DOQ A;  5KFD A;  4QNL A;  2BQU A;  5HR6 A;  2QB1 A;  2BCU A;  2CN1 A;  2F77 X;  5IIO A;  4CNQ A;  3AEV A;  2IHN A;  4I2H A;  5DQG A;  3E0F A;  3I28 A;  1TK8 A;  4QZH A;  4FBU A;  3GU3 A;  4QZA A;  4J9L A;  4JWM A;  2KN7 A;  4M9H A;  2AQ4 A;  9ICB A;  2AH5 A;  5KG6 A;  2FDR A;  3TQ1 A;  5III A;  2DGZ A;  4C4S A;  1JXE A;  3BZK A;  1S9F A;  2RDJ A;  2ASD A;  5ALF A;  4R8U A;  4RUC A;  2CPR A;  7ICG A;  3GII A;  5CA7 A;  4DSK A;  3C28 A;  4KLL A;  1X6I A;  1T8E A;  2NRZ A;  2C2E A;  1BPB A;  1Z1B A;  4DSF A;  2VJ4 A;  2XY7 A;  1ZQB A;  4F72 A;  2L5Y A;  3QUC A;  2WHE A;  3LYS A;  5ALN A;  2ZUB A;  2F2A B;  2UVU A;  1TFR A;  4NLK A;  5JTI A;  4P4M A;  5KFQ A;  4RNN A;  1SB3 C;  2PFN A;  3BS7 A;  3A0H U;  1SV0 A;  1B0X A;  3OSN A;  5KG5 A;  2BPG A;  4I27 A;  1ZD5 A;  2V4Q A;  5TZV A;  1SV4 A;  5J0P A;  5E79 U;  4CGZ A;  5ALG A;  1S0M A;  4YR2 A;  2NV3 A;  3MDA A;  2W9B B;  5FP0 A;  2MA1 A;  5DBA A;  3B0X A;  1Z1V A;  2HI0 A;  3HJE A;  3JPT A;  1KSP A;  4Z6F A;  3GIJ A;  3SYZ A;  1Q8K A;  2MAX A;  2G0A A;  1RYS A;  3H8M A;  2QAR A;  3V7J A;  4B9M A;  2AXT U;  1ZD2 P;  4CF3 A;  4B9T A;  1NI3 A;  2G5H B;  1RXW A;  2KIV A;  4F4K A;  4ED0 A;  5J0O A;  4J03 A;  3T5L A;  8ICS A;  4R65 A;  2NO4 A;  3G6V A;  4YMM A;  4QZG A;  2PXI A;  8ICV A;  4OJ6 A;  7ICH A;  2XGQ A;  1NK9 A;  2EZZ A;  1VJ5 A;  2IOH A;  5L1M A;  4ECS A;  5G5H A;  2W54 A;  8ICA A;  4ECV A;  2ZUC A;  4MEX A;  3RJI A;  3TAD C;  5HR7 A;  2YN4 A;  4QZE A;  3BQ1 A;  5KFO A;  1T3N A;  3PMN A;  3NTU A;  2ODG A;  3KHL A;  4EBE A;  3QZ8 A;  4UB4 A;  3ISD A;  8ICP A;  4QZD A;  5KG3 A;  3ED5 A;  9ICH A;  3GZF A;  3NVY A;  4F4W A;  4KLI A;  4IQU A;  1QSL A;  3NS1 A;  3O0F A;  4PHP A;  3N7S C;  3B0Y A;  2F1H A;  1X2I A;  1PVQ A;  3DV9 A;  1FO4 A;  1QH9 A;  4OD0 A;  7ICM A;  8ICE A;  1NNL A;  4DF8 A;  4RQ7 A;  3OSP A;  4J9N A;  1S0O A;  5AKK A;  3SEI A;  2WF7 A;  2JEI A;  2KJ8 A;  5KFG A;  3FDS A;  4RQ8 A;  3RAQ A;  4C4R A;  1OUQ A;  4X5V A;  3SZ2 A;  1ZRM A;  4RZR A;  4JUZ A;  5KFF A;  3IHQ B;  2PMZ F;  3HP6 A;  4I2D A;  5DQH A;  1JRP A;  3AL0 B;  5GTH U;  4FZL A;  1KRP A;  4Y2P A;  5AIC A;  3JPP A;  3SV4 A;  4O3N A;  2VKQ A;  2V4R A;  1D9F A;  3IRU A;  4Q44 A;  1L3V A;  2JEG A;  5K4L A;  4GXI A;  3PO4 A;  2R8H A;  3SAG A;  1ZQA A;  7ICU A;  2KJ9 A;  3Q8K A;  2KVC A;  4C8K A;  5DGA A;  4DFP A;  1DGJ A;  4C8L A;  3H7I A;  3KHH A;  3THV A;  2DFL A;  4RQ0 A;  3C2L A;  1HEK A;  1ZQU A;  2XCA A;  2YMQ A;  2HBM A;  1BNO A;  1NK8 A;  2MRL A;  4MFA A;  4M9N A;  2H5X A;  3FYH A;  5JRT A;  2JZB B;  3EWA A;  3SAH A;  9ICF A;  5H2F U;  3DEE A;  3LWL A;  1SWW A;  3WK7 A;  9ICG A;  9ICJ A;  2KOB A;  4XA5 A;  1DK2 A;  2A3V A;  9ICP A;  4ED6 A;  3ICX A;  3ONN A;  2BCS A;  1S0N A;  2XY6 A;  3AM9 A;  1YT3 A;  1TK5 A;  3PR5 B;  3L5K A;  9ICL A;  2ZIX A;  3S6J A;  3HW8 A;  2I6X A;  1K1S A;  4QWD A;  4M9L A;  5KFM A;  1CUK A;  3AUO A;  4O5C A;  1WG8 A;  2ZTE A;  1Z4O A;  4IRK A;  3RJH A;  4EEN A;  4RNO A;  8ICQ A;  3E58 A;  5AK5 A;  3M9M B;  1TK0 A;  4M9J A;  1J97 A;  3JPO A;  1LB2 B;  3RJJ A;  3DDH A;  4F5R A;  3BQT A;  3H8J A;  1NJY A;  4F5N A;  4MF8 A;  8ICC A;  8ICT A;  4Y2S A;  1MC8 A;  2R18 A;  7ICJ A;  2GLE A;  3BQ7 A;  1RM6 C;  3RH5 A;  1COK A;  3LK9 A;  1TKD A;  4F91 B;  4EBC A;  3C21 A;  4ZH4 A;  1NKC A;  3FC4 A;  2W43 A;  2WF5 A;  4XUS A;  9ICI A;  2RLT A;  4PZO A;  5G5G A;  5KFH A;  2WAQ C;  2XO7 A;  1K1Q A;  9ICE A;  4IQW A;  5DB6 A;  3C2M A;  5KL8 B;  3MFH A;  3F2C A;  2LHT A;  5IIN A;  2DWQ A;  3H0R B;  2ZXH A;  4B9S A;  3MGH A;  4ELV A;  1X9S A;  5ALO A;  2R8J A;  8ICX A;  5DG8 A;  1QSY A;  2JV3 A;  2XVT A;  2KFZ A;  4KLM A;  2KIC A;  2AU0 A;  3HX0 A;  4BXO B;  1SV0 C;  2D3D A;  4RPZ A;  4B9U A;  2W8K A;  2F44 A;  4C7Y A;  4HYK A;  4M47 A;  4EEK A;  2P66 A;  4QWA A;  3EZ5 A;  4DFD A;  4ECR A;  4AYB F;  3LDA A;  4ECX A;  1ZXI A;  5DG7 A;  1D8B A;  4PZN A;  3PW2 A;  3OHB A;  1XU4 A;  2FJ6 A;  3K1Z A;  1IIP A;  2KVS A;  4P0Q B;  2IA6 A;  4DSL A;  4M6W B;  1U47 A;  3ZDC A;  4YR3 A;  1L5U A;  4O0I A;  8ICR A;  3PZP A;  4ECY A;  5DLG A;  3RR7 A;  5CR0 A;  4QW8 A;  2KIW A;  3IG8 A;  3NRW A;  1ZQR A;  5AM0 A;  4UQG A;  5AKE A;  4PH5 A;  1TVA A;  2LYH A;  1BVS A;  4Y2U A;  4ED8 A;  2W03 A;  3IG5 A;  2H3Q A;  5KG0 A;  3GQC A;  5KFN A;  5J2K A;  4UB5 A;  5KG1 A;  3OPX A;  1U4B A;  4R64 A;  2ISO A;  3TFS A;  3QU7 A;  1OXJ A;  4UAU A;  4NLN A;  4DCC A;  4XRH A;  4YG2 A;  5EE3 A;  1BPX A;  1SKS A;  3PR4 A;  3F53 A;  1KEJ A;  2W9B A;  5CHG A;  1D8L A;  4Q8F A;  3UM9 A;  3V72 A;  4KLH A;  1SKR A;  2NRX A;  2D8C A;  2LMR A;  4O3P A;  3HKZ F;  3H4B A;  4C7Z A;  4RT3 A;  1B22 A;  4K4I A;  7ICT A;  3C1Y A;  3IM1 A;  3GIL A;  2B21 A;  2XC9 A;  2HMX A;  2OCE A;  4FFD A;  3T79 A;  4RQN A;  3WK8 A;  1U48 A;  3WKB A;  2FMP A;  5AI0 A;  5GTI U;  4EYI B;  3F5E A;  2H3V A;  5IIM A;  3KKA A;  5DDY A;  4O3O A;  2ZIV B;  3F5A A;  5D46 A;  3MR2 A;  5KTQ A;  4DL4 A;  8ICY A;  5AKG A;  4US9 A;  4M2Y A;  4P0P B;  4FS2 A;  2RDI A;  1A77 A;  4DQQ A;  5AK6 A;  5KNI A;  2YMM A;  3EPI A;  1SKW A;  4NY8 A;  3SAF A;  3JPR A;  5DLF A;  1LVH A;  3NUQ A;  5KFB A;  2HHU A;  3GIK A;  4C8M A; 
#chains in the Genus database with same CATH homology
 3B0X A;  1ZQK A;  5J2C A;  4I2A A;  1U9L A;  2IHM A;  1ZJM A;  3JPT A;  3PW7 A;  4M9G A;  5C5J A;  3RH4 A;  3QEA Z;  3HPO A;  1KSP A;  5KG2 A;  4Z6F A;  5J2D A;  3GIJ A;  7ICN A;  4TUR A;  2HHX A;  3SYZ A;  2MAX A;  4KLO A;  3OJU A;  1RYS A;  3V7J A;  4DQR A;  8ICB A;  4B9M A;  1PZN A;  5J2G A;  2BCR A;  4NLG A;  4F2S A;  3RJG A;  3GV7 B;  3QEB Z;  3C5F A;  2VA2 A;  4B9T A;  4GXJ A;  4TQS A;  5DB8 A;  1ZQT A;  9ICS A;  5KT3 A;  5F9N A;  4JV0 A;  1RXW A;  5J2H A;  1NK7 A;  2J6T A;  3Q8S B;  3V7K A;  1L3U A;  4F4K A;  3ZDE A;  4ED0 A;  4KTQ A;  4M0A A;  5CWR A;  2JEF A;  5J0O A;  4BDP A;  5L1J A;  4J9M A;  7ICI A;  3T5L A;  5KFV A;  8ICS A;  4R65 A;  1ZJN A;  4KIT B;  3PX6 A;  1ZQC A;  1JXL A;  5IIJ A;  3MFI A;  3G6V A;  3SI8 A;  4YMM A;  4DWI A;  4QZG A;  2PXI A;  1HJP A;  1KLN A;  1ZQE A;  2KZ3 A;  8ICV A;  2HHV A;  8ICO A;  7ICH A;  4DFM A;  1N56 A;  4KLQ A;  2XGQ A;  1NK9 A;  2VA8 A;  5KFT A;  2HW3 A;  5HHI A;  4ECS A;  4XQ8 A;  1BPY A;  8ICA A;  3G6Y A;  5J0S A;  2Y1J A;  4C8O A;  4ECV A;  2ZUC A;  4MEX A;  4EBD A;  5D4B A;  3PVX A;  3MDC A;  4K4H A;  2BGW A;  5CP2 A;  1Z3E B;  3RJI A;  4QZC A;  4DOC A;  4UB2 A;  2AQ0 A;  1XSP A;  3GDX A;  4QZE A;  3BQ1 A;  4FBT A;  5J0R A;  5KFO A;  4J9K A;  4DO9 A;  1T3N A;  4O3Q A;  3PMN A;  1S97 A;  4F4Z A;  2Q0Z X;  3NTU A;  1NK6 A;  4KLF A;  1XO1 A;  4QZ9 A;  2NRW A;  1NK4 A;  3KHL A;  3H8W A;  1KFS A;  4GC6 A;  4EBE A;  3QZ8 A;  2UVR A;  4UB4 A;  5KFI A;  5HHH A;  3ISD A;  1ARO P;  5KG7 A;  4KLD A;  8ICP A;  5DGB A;  3OHA A;  5J2E A;  4QZD A;  5KG3 A;  1DGS A;  1S0V A;  3V6H A;  9ICH A;  1ZQG A;  2XGP A;  2KFN A;  1ZQX A;  8ICZ A;  2BKE A;  5KFZ A;  3ZDA A;  4F4W A;  2FPK A;  3M9O B;  1NJW A;  1EXN A;  4KLI A;  4PHA A;  3ISB A;  4IQU A;  1XSN A;  1QSL A;  2BDP A;  4PHP A;  4ED2 A;  5J2F A;  4YD2 A;  3B0Y A;  4RPY A;  1WCN A;  4Q43 A;  2F1H A;  5CJ7 A;  1C7Y A;  4ELU A;  1X2I A;  4KN4 A;  5J29 A;  4UB3 A;  5KFP A;  3H8S A;  4NM2 A;  5KFK A;  2BCQ A;  4YP3 A;  4DLG A;  1N48 A;  1UT8 A;  1D9D A;  4LZD A;  4RPX A;  2JEJ A;  2DPJ A;  2ALZ A;  7ICM A;  8ICE A;  3PV8 A;  3PML A;  8ICN A;  1ZQN A;  3RR8 A;  2HHU A;  4DF8 A;  2J6S A;  1LV5 A;  3HT3 A;  4RQ7 A;  3OSP A;  4J9N A;  1NJX A;  4QWE A;  1T7P A;  4YVZ A;  4BWJ A;  1S0O A;  4J9S A;  2I1Q A;  1ZQS A;  2UVW A;  4YMN A;  1ZYQ A;  3T5K A;  3UPQ A;  2C22 A;  3G6X A;  2JEI A;  2BQ3 A;  3AU2 A;  4DOA A;  1BGX T;  5KFG A;  3FDS A;  4KLG A;  4M04 A;  2JZB A;  4RQ8 A;  4GLX A;  2BPC A;  4UB1 A;  1S10 A;  3GFK B;  3N97 B;  3MAB A;  5L9X A;  2F1J A;  3RAQ A;  1ZQI A;  7ICK A;  1Z00 A;  5EOZ A;  5KFA A;  1ZQY A;  4X5V A;  3SZ2 A;  3GV5 B;  2PFP A;  5J0Q A;  2AJQ A;  4F93 B;  4QWB A;  4RZR A;  4MEY A;  4KMU A;  1H38 A;  1QTM A;  5KT4 A;  2FMQ A;  4TUP A;  4YXM A;  4JUZ A;  5DBC A;  5L1I A;  2HHW A;  4DLE A;  5KFF A;  3IHQ B;  2NRT A;  4I2D A;  5DQH A;  3HP6 A;  2W9C B;  4DSI A;  5DQI A;  2ASJ A;  1KRP A;  3JPP A;  3SV4 A;  4O3N A;  3SV3 A;  5HNK A;  9ICM A;  7ICR A;  2V4R A;  1D9F A;  1A76 A;  4Q44 A;  1HUO A;  3V6J A;  2HHT A;  4DEZ A;  2ZUD A;  3RH6 A;  3GV8 B;  1XC9 A;  1L3V A;  2JEG A;  2HHS A;  3NGD A;  4GXI A;  4I28 A;  4NM1 A;  3H40 A;  2R8H A;  3PO4 A;  1JN3 A;  3MR5 A;  1NJZ A;  2VA3 A;  1ZQA A;  7ICU A;  2MUT A;  1BPD A;  4DSE A;  1SL0 A;  4F5Q A;  3KHR A;  5IIL A;  3BQ2 A;  3Q8K A;  7ICQ A;  4P4P A;  4PHD A;  3RTV A;  4C8K A;  4PGY A;  5DGA A;  5L1K A;  4UAW A;  4DFP A;  4ELT A;  4K4G A;  4C8L A;  4I29 A;  3H7I A;  3GIK A;  3KHH A;  4DL5 A;  3THV A;  2PFO A;  2DFL A;  4RQ0 A;  3C2L A;  1ZQU A;  4PGQ A;  3RJJ A;  2XCA A;  3ETL A;  3RB6 A;  5J0Y A;  2BCV A;  1L3S A;  3AU6 A;  1HUZ A;  5DDM A;  1NK8 A;  4M9N A;  4MFA A;  3OJS A;  2H5X A;  3RBD A;  4MF2 A;  5J2I A;  3FYH A;  1TV9 A;  2A1J B;  3RAX A;  3ZDB A;  1MSW D;  4ED1 A;  2JZB B;  3Q8M A;  4RQ1 A;  2W9M A;  4DS4 A;  3QE9 Y;  4ECT A;  3EWA A;  1UA1 A;  4RNM A;  4UAZ A;  9ICF A;  4ED7 A;  3LWL A;  4BGD A;  4JK1 A;  1XWL A;  1Z00 B;  4F92 B;  4DL7 A;  9ICG A;  3ZDD A;  1T4G A;  2I9G A;  3PNC A;  4XA5 A;  9ICJ A;  2J6U A;  3Q8L A;  3C1Z A;  9ICP A;  5J2B A;  4ED6 A;  3T5J A;  1SL2 A;  2BCS A;  1S0N A;  4LVS A;  2XY6 A;  2BR0 A;  4PGX A;  5KFW A;  3Q8P B;  1TK5 A;  3PR5 B;  2ATL A;  9ICT A;  3MR6 A;  4DFJ A;  4EEY A;  3UXP A;  9ICL A;  5KT6 A;  4NLZ A;  2AGP A;  4YXJ A;  3HW8 A;  5KFE A;  4I2C A;  5J0W A;  2DPI A;  1BPE A;  3HWT A;  4UAY A;  4ECU A;  1K1S A;  5DG9 A;  4UBB A;  4QWD A;  4GC7 A;  3RBE A;  1ZQQ A;  4M9L A;  4KLJ A;  5KFM A;  4JV1 A;  8ICI A;  1CUK A;  2R8G A;  3AUO A;  5KFC A;  4O5C A;  2W9C A;  3H4D A;  2FMS A;  1ZQO A;  2MUT B;  3EW9 A;  2ZTE A;  5HML A;  5CB1 A;  5L1L A;  2IMW P;  4DOB A;  2WTF A;  4IQT A;  4RNO A;  3RJH A;  4IR1 A;  4LZG A;  8ICQ A;  1JIH A;  9ICK A;  4JWN A;  3M9M B;  3TAN A;  1TK0 A;  4B9N A;  1JMS A;  2PFQ A;  9ICA A;  3K4G A;  1IM4 A;  3PX0 A;  1KDH A;  2GWS A;  2C28 A;  3RB3 A;  4M9J A;  1B43 A;  3C23 A;  2Y1I A;  4F4Y A;  4EZ9 A;  3JPO A;  1LB2 B;  5DBB A;  2NRV A;  3PY8 A;  5KFJ A;  4QZB A;  4R63 A;  4F5R A;  3BQT A;  3H8J A;  4Z6D A;  5KT7 A;  3Q8R B;  3MR3 A;  3UQ0 A;  1NJY A;  4F5N A;  4MF8 A;  2KTQ A;  8ICC A;  1ZQV A;  2FLP A;  8ICT A;  4QW9 A;  1MC8 A;  7ICJ A;  5DB9 A;  3ORY A;  3JPN A;  2IBK A;  4I2G A;  1MQ3 A;  7ICO A;  4O3S A;  3TAR A;  3PW4 A;  3RH5 A;  2M9N A;  3LK9 A;  4G3I A;  1NOM A;  4F2R A;  4TUQ A;  4R66 A;  1RZT A;  4O3R A;  1WCL A;  1TKD A;  4I2F A;  5HMM A;  3UQ2 A;  7ICV A;  4F91 B;  4EBC A;  3C21 A;  4ZH4 A;  1ZQJ A;  1NKC A;  3V7L A;  2R8K A;  2A1J A;  1TAU A;  5J0U A;  2C2R A;  4XUS A;  5IIK A;  9ICI A;  4O5E A;  5KFH A;  1UA0 A;  4QZ8 A;  2AGQ A;  7ICP A;  7ICS A;  3ZD8 A;  3MBY A;  1D8Y A;  5EWG A;  3LWM A;  2ZJ5 A;  5BOM A;  4TQR A;  4ED3 A;  2C2D A;  2XO7 A;  1K1Q A;  2F1I A;  5KT2 A;  4TUS A;  4DFK A;  1NKE A;  1NK0 A;  1NK5 A;  3V6K A;  8ICH A;  9ICE A;  8ICU A;  9ICU A;  8ICW A;  3RRH A;  1QSS A;  1U49 A;  2OWO A;  1COO A;  1RYR A;  1ZQH A;  3BDP A;  4IQW A;  5KFU A;  5DB6 A;  4KLS A;  3JPS A;  1XS9 D;  3C2M A;  3MFH A;  2ZJA A;  5J0X A;  5JUM A;  4O5K A;  4KLT A;  1CEZ A;  5IIN A;  2PI4 A;  2KZZ A;  3TI0 A;  4B9S A;  4B9V A;  3MGH A;  4IRD A;  4ELV A;  4RUA A;  1X9S A;  1Y88 A;  4Q45 A;  2R8J A;  4RU9 A;  3RB0 A;  8ICX A;  4C8N A;  5DG8 A;  1QSY A;  5J2J A;  3C2K A;  4YD1 A;  2KFZ A;  1IXR A;  1V9P A;  5DB7 A;  3T3F A;  4MFC A;  2HVH A;  3M9N B;  3T5H A;  4IR9 A;  4KLM A;  3BQ0 A;  4NXZ A;  2KZM A;  4PHE A;  4DL6 A;  1X9W A;  5EWF A;  2AU0 A;  5D49 A;  2P6U A;  3HX0 A;  1ZQP A;  7ICF A;  1XSL A;  4BXO B;  4RQ4 A;  3RJK A;  1RXV A;  4RPZ A;  4F50 A;  4B9U A;  4ECZ A;  2W8K A;  8ICF A;  9ICO A;  4HYK A;  1ZET A;  4EYH B;  4F5O A;  9ICN A;  4M47 A;  2P66 A;  4DSJ A;  3RRG A;  4QWA A;  3EZ5 A;  4DQI A;  4P4O A;  3TAP A;  1SL1 A;  8ICL A;  1NKB A;  1BPZ A;  4BWM A;  4ECR A;  3PW5 A;  9ICQ A;  3PX4 A;  5F9L A;  3MGI A;  1X9M A;  1MQ2 A;  7ICL A;  3LDA A;  9ICX A;  4ECX A;  1KTQ A;  4J9P A;  4YQW A;  4QZF A;  4QWC A;  5DG7 A;  4O9M A;  3EPG A;  4GXK A;  5KFL A;  3GIM A;  5J0T A;  2UVV A;  3PW2 A;  3N4M B;  3OHB A;  3ZD9 A;  1TAQ A;  3KHG A;  1XU4 A;  4Z6E A;  1L3T A;  4EZ6 A;  2FLL A;  3TAQ A;  2FPM A;  3RJF A;  1ZQZ A;  2BQR A;  2IA6 A;  3ISC A;  4DSL A;  4M6W B;  1U47 A;  4DL2 A;  3ZDC A;  4YR3 A;  2FPL A;  4RT2 A;  4RQ5 A;  1ZQM A;  1L5U A;  2V9W A;  4O0I A;  3OGU A;  8ICR A;  3C5G A;  4I2B A;  4YR0 A;  4ECY A;  2PI5 A;  5DLG A;  4Z6C A;  3RR7 A;  5CR0 A;  2XCP A;  4QW8 A;  1DOQ A;  4F5P A;  1ZQR A;  5KFD A;  4DL3 A;  4F3O A;  2BQU A;  4UQG A;  4IQV A;  4IRK A;  2R8I A;  4MFF A;  2BCU A;  4PH5 A;  1TVA A;  2LYH A;  1BVS A;  2ZTC A;  5IIO A;  3M8R A;  4ED8 A;  5KFY A;  1SZP A;  8ICM A;  4J9R A;  5KG0 A;  5DKW A;  3GQC A;  2IHN A;  4I2H A;  5DQG A;  9ICC A;  1TK8 A;  5EWE A;  4QZH A;  3RB4 A;  4FBU A;  4QZA A;  5KFN A;  4J9L A;  4Q8E A;  5J2K A;  2KN7 A;  4JWM A;  1KFD A;  4M9H A;  4QZI A;  4UB5 A;  4DS5 A;  1ZQW A;  5KG1 A;  2AQ4 A;  9ICB A;  1U45 A;  1U4B A;  4R64 A;  2ISO A;  5KG6 A;  3TFS A;  9ICW A;  7ICE A;  2VAN A;  3TQ1 A;  1KFT A;  5III A;  4BXO A;  9ICV A;  3PO5 A;  4NLN A;  1JXE A;  4XRH A;  1ZQD A;  4YG2 A;  1S76 D;  4KLU A;  1BPX A;  1S9F A;  2RDJ A;  1SKS A;  2ASD A;  3PR4 A;  4R8U A;  1KEJ A;  4RUC A;  2XY5 A;  2W9B A;  7ICG A;  5CHG A;  1D8L A;  5CA7 A;  3GII A;  5BOL A;  4F4X A;  4DSK A;  4Q8F A;  8ICK A;  5KG4 A;  3V72 A;  4KLH A;  4KLL A;  5J2A A;  4I2E A;  2HVI A;  1T8E A;  1SKR A;  2NRZ A;  2W8L A;  1BPB A;  1UT5 A;  3JPQ A;  4YN4 A;  2C2E A;  3PW0 A;  4DSF A;  4B9L A;  8ICJ A;  2NRX A;  4FS1 A;  4FO6 A;  2XY7 A;  1S77 D;  2BHN A;  4O3P A;  1ZQB A;  1QLN A;  4RQ6 A;  3H4B A;  4PPX A;  4RT3 A;  5HP4 A;  8ICG A;  3EYZ A;  1B22 A;  4KN7 A;  4K4I A;  7ICT A;  3C1Y A;  3IM1 A;  4ECW A;  4I2I A;  1ZQL A;  4CCH A;  3M8S A;  3GIL A;  2ZUB A;  2B21 A;  2XC9 A;  3BJY A;  2ASL A;  2HHQ A;  4M6W A;  2UVU A;  1TFR A;  4NLK A;  4RQ2 A;  4P4M A;  5KFQ A;  4RNN A;  2ZTD A;  3RJE A;  4YCX A;  4J9Q A;  4UBC A;  2ZJ8 A;  4I2J A;  1U48 A;  2PFN A;  4P2H A;  3QZ7 A;  5KFX A;  2FMP A;  2FLN A;  4EYI B;  4JV2 A;  4IRC A;  4J9O A;  5IIM A;  3Q8Q B;  5DDY A;  4ECQ A;  4O3O A;  3UXO A;  1RPL A;  3OSN A;  5KG5 A;  2BPG A;  4I27 A;  2V4Q A;  4DF4 A;  5KT5 A;  5D46 A;  1JX4 A;  3MR2 A;  2P6R A;  3UXN A;  5KTQ A;  4F8R A;  5TZV A;  4DL4 A;  2BPF A;  8ICY A;  2W9A A;  5KFS A;  5BPC A;  4M2Y A;  4FS2 A;  2RDI A;  2ISP A;  1A77 A;  4DQQ A;  5J0P A;  3EPI A;  1SKW A;  4NY8 A;  3E2E A;  3JPR A;  5DLF A;  3TFR A;  1ZQF A;  3KTQ A;  5KFR A;  4RQ3 A;  9ICR A;  4DQS A;  2AGO A;  1S0M A;  4DQP A;  4R8U B;  4YR2 A;  4KLE A;  5KFB A;  3MDA A;  2W9B B;  4E0D A;  4YMO A;  3K75 D;  4YFK A;  4C8M A;  5DBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...