1B22A

Rad51 (n-terminal domain)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
EEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA REPAIR PROTEIN RAD51
publication title The N-terminal domain of the human Rad51 protein binds DNA: structure and a DNA binding surface as revealed by NMR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1998-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1b22A00
2KZ3A 1QSSA 5KT7A 1S0MA 5CJ7A 2P6RA 2XY7A 7ICOA 2V4QA 4MFAA 4F91B 4DL5A 4I2FA 1ZQEA 8ICUA 7ICSA 4ECXA 5D49A 4YXMA 4B9UA 2ISOA 5KFHA 3UXPA 3PW0A 1QTMA 1ZQIA 4FS1A 1CUKA 3RJJA 8ICBA 1L3VA 4I2AA 3JPQA 1CEZA 9ICOA 2V4RA 4YN4A 1D9FA 4QZAA 4QWDA 3TI0A 2GWSA 2BDPA 1NK0A 1TAQA 2C28A 3MDAA 8ICMA 5DB9A 1ZQCA 3C1ZA 4O0IA 4MEYA 4MFCA 8ICEA 1S0NA 2OWOA 1ZQYA 3RH5A 3OHBA 4DQQA 2ATLA 1TKDA 1S76D 4TUQA 2RDJA 2DFLA 4BDPA 1TAUA 2BQ3A 4NLKA 3OGUA 3RB6A 3GIJA 1KSPA 3RJGA 5KFJA 5EWEA 4QWBA 1ZQAA 2BPFA 1KEJA 2PI5A 9ICLA 1ZJNA 1XC9A 4ECYA 1T8EA 5L1IA 2NRXA 3SV4A 2IHMA 3Q8RB 4B9NA 2MUTB 3UPQA 3RB4A 4NM2A 3MBYA 4GXJA 3EPGA 2F1JA 4O5KA 8ICWA 2ZJ8A 1Y88A 2ZTDA 1SL0A 4RZRA 1B22A 5DLGA 4KLHA 4F93B 5HP4A 4J9MA 1MSWD 3SYZA 1S9FA 3EZ5A 3H40A 4UB2A 3EWAA 9ICVA 5KFPA 4DL4A 3ISDA 1IXRA 1SKSA 9ICPA 4DFJA 4YVZA 4DFKA 1BPXA 5KFBA 1KFSA 2HHTA 1SZPA 3M8RA 5IIKA 4GLXA 4RT2A 4B9VA 4K4HA 8ICJA 2KFZA 1UA1A 3QEAZ 1S0OA 2IHNA 4DQPA 5J2AA 3UQ0A 7ICQA 3EW9A 5BPCA 8ICAA 4EYIB 2NRZA 3QE9Y 3EYZA 7ICMA 5J0SA 3BQ2A 3QZ7A 1L3TA 2BCQA 8ICQA 2XY5A 2NRVA 5KFRA 4QZFA 2I9GA 1JN3A 3RJHA 5J2BA 3MFHA 3TAPA 1NKEA 3V6JA 4J9KA 4MF8A 4KLQA 4DOBA 3PX4A 1ZQPA 5KG2A 4J9RA 4BXOB 4M9NA 3V6HA 9ICBA 2V9WA 5CHGA 4B9MA 1WCLA 1L3UA 4DSLA 3M9MB 4C8KA 2ZJ5A 3RJEA 1SKWA 3PW4A 1SL1A 4R63A 4LZGA 1WCNA 4XQ8A 1X9SA 1ZQJA 5F9NA 5EWGA 5J0WA 3ZDBA 4BXOA 3GV8B 1S77D 2I1QA 9ICSA 3ISBA 5JUMA 9ICFA 5KFFA 5KFVA 5IILA 4EBEA 4K4IA 4UB4A 5DQIA 4P2HA 1NOMA 3KHLA 3ZD9A 4DSKA 4F5OA 3H7IA 1TK5A 2A1JB 4JV0A 4QZ8A 4I29A 3V7KA 1MQ3A 2KZZA 4FBTA 4UB1A 4Z6FA 3V72A 3H8JA 4UBCA 1ZQOA 4JV1A 2ASDA 3SV3A 1NK4A 9ICWA 5J2KA 2BHNA 4RU9A 5IIMA 9ICEA 2BPCA 1N56A 4JK1A 9ICUA 2IBKA 7ICHA 8ICIA 9ICJA 2A1JA 4F4WA 3QZ8A 1U49A 3ORYA 8ICCA 5KT3A 4Q8FA 3RJFA 4B9LA 1KDHA 1KFDA 2JEFA 4JUZA 4ELTA 7ICRA 1S97A 4J9NA 2BQRA 1SKRA 1ZQFA 3HPOA 4GC7A 4GXKA 4C8MA 2ZTCA 4XA5A 4KLDA 4DL3A 1X2IA 3C1YA 4KLOA 5J2JA 4ED7A 3HW8A 1A76A 1AROP 4RQ0A 1D8LA 4JWMA 4MF2A 4F92B 8ICSA 5J2IA 5D46A 4UAZA 4X5VA 3JPSA 3ZD8A 4ECUA 4DQRA 1BPBA 3M9NB 3T5HA 4QZHA 3MR2A 4UQGA 3C5GA 3Q8SB 2W8KA 4EEYA 4ECVA 5KFYA 1BVSA 5KFCA 5KFNA 3C21A 4R65A 3UXOA 4ED1A 1ZQGA 2BGWA 1QSYA 1T3NA 3ZDAA 7ICNA 3AU6A 4PHPA 1NKBA 4HYKA 4F5NA 3V7LA 5KFQA 4RQ6A 4KTQA 4XUSA 2FLNA 4M47A 3GDXA 1X9MA 2F1HA 5DBAA 3RTVA 3OJSA 3H4DA 2ZUBA 9ICQA 5KFEA 3AU2A 2J6UA 3MR6A 1KRPA 4PGYA 3JPTA 5DB6A 2VA2A 8ICGA 4YCXA 4O3RA 1L3SA 4KN7A 5KG0A 2W9CB 4ZH4A 3E2EA 3RH4A 1XWLA 4QZBA 3OSNA 4F5QA 2BCRA 4RQ1A 1NK6A 2FLPA 2FMSA 2KZMA 2HHVA 8ICOA 5J0OA 4I2HA 4F4ZA 4JWNA 2HHUA 4Z6DA 4ECSA 4ED0A 4YMNA 3RJKA 2BCVA 4TQRA 2AGPA 2NRWA 3NTUA 1UT5A 5DBBA 2HVHA 4DLEA 2AJQA 8ICLA 4RPYA 5BOMA 3PR5B 3HP6A 1UT8A 4KLIA 3UXNA 5CR0A 4DO9A 2ASJA 5DQHA 3MR3A 2BPGA 5KG7A 2BCSA 1TK0A 3K75D 2HHXA 4Q43A 4R8UB 3MABA 5KT4A 3Q8PB 4RQ2A 1U45A 5C5JA 4Q44A 2ZUCA 2XO7A 3GILA 4ECZA 4FO6A 4MFFA 1XSPA 5KTQA 2MUTA 5KFDA 2C2DA 2ZUDA 4RNNA 1XSLA 2HHWA 1ZETA 2FMQA 3TFSA 1ZQNA 1XO1A 2BR0A 1L5UA 2MAXA 4YP3A 3PX6A 4KN4A 3QEBZ 4O5CA 1V9PA 3Q8QB 3PX0A 2AGOA 5CB1A 1RYRA 2ISPA 5J29A 4DSEA 1MQ2A 4GC6A 4IRKA 2VA8A 2FLLA 4DQIA 5J0YA 4GXIA 4RNMA 3RR7A 9ICNA 4KLSA 3GIKA 1D8YA 5KFZA 3PO4A 4PGXA 5KG5A 2Y1IA 2ZTEA 2ALZA 2P66A 5KFWA 4O3QA 4IRCA 5DGAA 3H4BA 1UA0A 4I2EA 2XY6A 3RBEA 1B43A 3M8SA 4NXZA 4DLGA 1ZQWA 4DL6A 1H38A 4PH5A 7ICKA 4YFKA 4C8NA 5L1JA 4ECWA 3THVA 4O5EA 9ICHA 1BGXT 4KLJA 1PZNA 4TUSA 5IIJA 1BPZA 4KLMA 3T5LA 4O3SA 2Y1JA 4F4KA 5D4BA 4F50A 3TAQA 3T5KA 5DBCA 5DB8A 4KLFA 1TK8A 5HHIA 4I2IA 4QZCA 4LZDA 2JZBB 3N4MB 1T7PA 4JV2A 3ZDCA 5DQGA 4RQ8A 1QSLA 2W9AA 3FDSA 5DG8A 2JEJA 9ICCA 4IQVA 4E0DA 5KG4A 8ICHA 5KFAA 3KHRA 4LVSA 4I2GA 4DFPA 3TARA 2PFPA 3MGIA 2BCUA 2UVWA 9ICRA 1ZJMA 2J6TA 5DG7A 2JZBA 3MFIA 4DOAA 1TVAA 4O3OA 2HVIA 5IIOA 3GQCA 2AQ4A 4EBDA 1RXWA 4TQSA 4I2BA 4NLZA 4CCHA 2KFNA 8ICNA 5KG3A 3RBDA 4M9LA 4BGDA 9ICIA 1NK9A 5F9LA 3PW5A 5KT5A 2KN7A 4QWEA 4M2YA 3KHHA 1U9LA 4PHAA 4FS2A 4F8RA 3PV8A 4DSJA 4YMMA 1JIHA 2XCPA 3HT3A 3TQ1A 2FPMA 2FMPA 2W8LA 1U47A 2XGQA 3H8WA 4YQWA 3LWLA 2VANA 3BJYA 4DSFA 5KG1A 1IM4A 3C23A 8ICYA 3G6YA 4M9JA 1S0VA 9ICAA 1C7YA 1XSNA 8ICXA 7ICTA 3PY8A 1EXNA 4DSIA 4IQTA 1ZQZA 4YMOA 3BQ0A 5DKWA 3PNCA 1Z00B 3M9OB 3KTQA 3B0XA 3IM1A 2IMWP 3GFKB 3JPOA 1XU4A 2BQUA 5TZVA 3EPIA 3GIIA 1ZQHA 2JEIA 3OJUA 2C2RA 2PFOA 2R8GA 4F3OA 5IIIA 4Z6EA 3KHGA 3V7JA 3ZDDA 1N48A 3B0YA 4IRDA 2R8JA 1Z00A 7ICIA 9ICKA 4DOCA 1NJWA 4TUPA 2UVRA 2F1IA 3LK9A 5KT2A 3Q8MA 1NK7A 1ZQXA 4O3NA 5J2CA 3RRHA 1ZQLA 4F4XA 2HHQA 8ICZA 3PO5A 4IQUA 4KLEA 2XC9A 2R8KA 3PMLA 3ZDEA 3G6XA 5KFLA 4UAYA 4PPXA 3RB3A 1BPEA 3C2KA 2HW3A 4KITB 4F2RA 4ECQA 4ECRA 1NK8A 3Q8KA 4M9HA 5J2EA 4QZ9A 1JXLA 4DS4A 3N97B 1U48A 5EWFA 4ED8A 8ICVA 4C8LA 2H5XA 4DEZA 5KFOA 1ZQTA 3HX0A 2R8HA 5DDYA 8ICRA 2W9CA 4PGQA 3TFRA 1U4BA 4PHDA 1K1QA 2J6SA 1KLNA 4UBBA 4KLUA 1S10A 5KFGA 3V6KA 1RXVA 4P4OA 3SZ2A 4EZ9A 3MR5A 4KLGA 3HWTA 3UQ2A 4YD1A 4DWIA 1JXEA 4RQ3A 4P4MA 4DF4A 5KFTA 2RDIA 4O3PA 2FPLA 4QZGA 4M9GA 9ICMA 3MGHA 3K4GA 3JPNA 2BKEA 4ED3A 1COOA 4DL7A 2P6UA 5KFXA 1ZQRA 5CP2A 3T3FA 4K4GA 3GIMA 1TFRA 1KFTA 2FPKA 1JX4A 1NJZA 5J0RA 4RPZA 3RAQA 4UB3A 4EBCA 4M04A 4R8UA 2DPIA 5DGBA 2PFNA 4IQWA 3JPRA 4ECTA 1DGSA 4RQ5A 4NY8A 2UVUA 8ICFA 7ICUA 4J9QA 4BWJA 4DS5A 7ICJA 4RQ4A 3G6VA 2HHSA 4RQ7A 9ICTA 4Q45A 5J2HA 4DFMA 5J0XA 3RB0A 1ZQSA 4RUAA 7ICGA 3C2LA 4FBUA 4QZIA 4F5PA 1T4GA 5HNKA 2M9NA 4KMUA 3RAXA 4NLNA 3SI8A 4DQSA 7ICFA 4DF8A 1A77A 5KFSA 5KFIA 4XRHA 4IR1A 1NJXA 1K1SA 4ELUA 4M0AA 4QWCA 3GV7B 4YR2A 1NJYA 4I2JA 4M6WB 1ZYQA 5J2DA 1HUOA 5HMLA 2W9BB 2ASLA 2WTFA 3PVXA 4ED2A 3C5FA 3C2MA 2NRTA 5EOZA 3ISCA 1BPYA 1X9WA 1ZQKA 1ZQDA 5J0TA 4BWMA 1QLNA 4M6WA 4G3IA 2PXIA 4P4PA 1RYSA 1DOQA 2W9BA 4QW9A 5L9XA 3MDCA 4J9LA 3RH6A 5DB7A 4YXJA 3T5JA 5J0UA 2C22A 1NKCA 3RRGA 2VA3A 4NM1A 4DL2A 5J0QA 4J9SA 4QW8A 9ICGA 1TV9A 3H8SA 1KTQA 3AUOA 5HMMA 1BPDA 5J2GA 5BOLA 3PW2A 1ZQUA 4UAWA 7ICVA 4QZEA 4J9OA 4QZDA 2PI4A 5KFMA 1LB2B 3OSPA 7ICLA 4TURA 4KLTA 3OHAA 1D9DA 2C2EA 3PW7A 3LWMA 5KFKA 1ZQBA 4IR9A 4UB5A 3PR4A 4B9SA 4I2CA 2UVVA 2DPJA 4YR3A 9ICXA 1ZQVA 4ED6A 1HUZA 5KT6A 2ZJAA 5CA7A 5DG9A 1SL2A 4I28A 8ICPA 2IA6A 5L1LA 1HJPA 4YG2A 1RZTA 1MC8A 2XGPA 3BDPA 5KG6A 3BQTA 3FYHA 3LDAA 1ZQMA 4ELVA 1LV5A 4RPXA 8ICTA 4F4YA 2W9MA 4Q8EA 1JMSA 4I2DA 4Z6CA 2JEGA 4RUCA 5CWRA 4YR0A 4J9PA 3PMNA 3Q8LA 1NK5A 3GV5B 2PFQA 4EZ6A 4KLLA 3NGDA 4F2SA 4I27A 3BQ1A 4MEXA 4EYHB 2AU0A 4B9TA 7ICPA 4PHEA 3RJIA 5HHHA 4O9MA 4QWAA 5DLFA 3IHQB 2R8IA 7ICEA 4YD2A 5KFUA 5L1KA 4RNOA 4R66A 3JPPA 4RT3A 1XS9D 1ZQQA 4C8OA 5J2FA 2AQ0A 2B21A 5IINA 3TANA 1Z3EB 4R64A 2LYHA 3ETLA 2KTQA 4F5RA 2XCAA 4NLGA 1RPLA 8ICKA 5DDMA 2Q0ZX 3RR8A 5J0PA 2AGQA
chains in the Genus database with same CATH superfamily
2AHOB 2YQEA 2LM1A 1S0MA 2P6RA 2ESEA 4F91B 1ZQEA 4C0ZA 5D49A 4EEKA 2E8NA 4NWIA 3GU3A 1CUKA 3IV6A 1K5OA 4I2AA 9ICOA 5GTHU 2V4RA 2H3ZA 1QH9A 4IL6U 2GWSA 3TI0A 3OTQA 2C28A 5DB9A 4MEYA 8ICEA 3OHBA 3I28A 2RDJA 1O08A 4OJOA 2BQ3A 4NLKA 3OGUA 5KFJA 4QWBA 1DXSA 3NUQA 1SGGA 4B9NA 3U26A 3L3FX 2MUTB 5ALUA 2F1JA 4O5KA 2ZJ8A 5DLGA 5HP4A 3SYZA 3EZ5A 3H40A 2RP5A 3ISDA 4Y2TA 4Y2VA 3CRXA 9ICPA 4DFKA 4IS7A 3M8RA 4GLXA 4K4HA 2I5HA 5AM1A 1QQ6A 5J2AA 3UQ0A 3T79A 3EW9A 4NL9C 2FI1A 8ICAA 3EYZA 2KVCA 3BQ2A 2XY5A 3DEEA 2NRVA 2I9GA 3MFHA 3TAPA 3V6JA 3ICXA 2DUYA 4J9KA 1X6JA 3PX4A 5KG2A 2DQNB 4BXOB 2V9WA 2EZXA 4DSLA 1Z19A 4C8KA 3HJEA 1SL1A 5F9NA 5J0WA 9ICSA 5ALQA 1S77D 2KMDA 3KFUF 4P2HA 3KHLA 2A1JB 2O6KA 3HRDD 3RF9A 4Z6FA 3V72A 3H8JA 4UBCA 1ZQOA 2BHNA 9ICEA 1VJ5A 1N56A 1SV4A 5CRXA 5ALXA 7ICHA 2DF4B 3QZ8A 5KT3A 3RJFA 2JEFA 4NLCA 4ELTA 4NLBA 1LVHA 2B0CA 1S97A 4J9NA 1JUDA 2YB4A 1ZD4A 5JRTA 2BQRA 3HPOA 3BS5A 5ALIA 4CDGA 5TISU 4ED7A 2JRZA 1CRXA 2OEHA 1AROP 3KKAC 4RQ0A 4Y2YA 3QX7A 5J2IA 5AKYA 5EE9A 1BPBA 3T5HA 4EELA 4QZHA 3MR2A 2PKEA 1SWVA 2KV2A 2KIVA 3CW2C 5ALNA 5AM2A 4ED1A 3ZDAA 2BGWA 1T3NA 3AU6A 4PHPA 5KFQA 3GDXA 4ACOA 3OJSA 5ALOA 1J2NA 2KNJA 2W03A 3JPTA 2Z7JA 2VA2A 2WAQF 4YCXA 1L3SA 5KG0A 2HMXA 2KOBA 1NK6A 2FMSA 2HHVA 3WKEA 2AXTU 3TKAA 4F4ZA 4JWNA 5B5EU 4ED0A 2EZZA 2WF5A 2BCVA 3ZI4A 4TQRA 5AKZA 2NRWA 5DBBA 4DLEA 8ICLA 4RPYA 3C29A 2ZXIA 1UCVA 4DO9A 3MR3A 2BCSA 1SXDA 1X9XA 4RQ2A 1U45A 5KTQA 3PSPA 2JGAA 4YP3A 3F2BA 1OXJA 4UASA 5KNIA 3IDWA 5CB1A 3CP8A 1RYRA 4GC6A 2VA8A 5J0YA 4GXIA 3RR7A 3GIKA 5KFZA 4PGXA 2P66A 4O3QA 3H4BA 5ALGA 3RBEA 4NXZA 1ZQWA 4P0QA 4DL6A 2E3TA 3KD3A 1H38A 2XIDA 4PH5A 4C8NA 5L1JA 3THVA 4O5EA 4TUSA 2WF9A 5IIJA 5AI8A 3T5LA 4O3SA 4F4KA 3T5KA 4KLFA 4LZDA 2JZBB 1T7PA 2QB0A 3I76A 4RQ8A 5AICA 3FDSA 2JEJA 4IQVA 5KG4A 8ICHA 2E1FA 2G07A 4I2GA 2HVIA 4NLZA 9ICIA 2KFNA 4BGDA 1M6YA 3PW5A 5KT5A 1IIPA 3KHHA 4FS2A 4OD0A 3PV8A 4DSJA 1JIHA 3TQ1A 1U47A 2JMGA 4DSFA 3H0RB 5G5HA 3G6YA 1XSNA 8ICXA 1EXNA 5AIAA 4IQTA 1ZQZA 4YMOA 3B0XA 3ETRA 2IMWP 5TZVA 3GIIA 1L7MA 3OJUA 2C2RA 1L6NA 5IIIA 3KHGA 4KX5A 2F8LA 3ZDDA 2UVRA 1NJWA 4KX3A 1ZQXA 4O3NA 3N7PD 4F4XA 1ZQLA 3PO5A 4IQUA 2R8KA 3ZDEA 2KSOB 5KFLA 4UAYA 1AQ6A 2HW3A 4KITB 1ED1A 4JB3A 4ECRA 3NS1A 5EE3A 4PZOA 2ZIXA 5J2EA 1JXLA 4CF5A 1S8OA 4ZOHC 1KQQA 5EWFA 3MGVA 8ICVA 3IG5A 4C8LA 2H5XA 5AKIA 4DEZA 2W55A 2R8HA 8ICRA 3SAHA 5HR7A 2W9CA 3F2CA 1U4BA 2J6SA 4KLUA 4P4OA 3SZ2A 3UQ2A 4DWIA 4RQ3A 2YN4A 2KVSA 5KFTA 3MGHA 1ZQRA 5CP2A 3GIMA 1TFRA 2W7PA 2LPEA 4M04A 2PFNA 2KJ8A 4Y2PA 1KN5A 4RQ5A 2UVUA 4DFDA 1RDFA 4J9QA 1D8BA 4RQ4A 3L5KA 2HHSA 9ICTA 3J81j 4Q45A 5ALKA 5ALRA 3C2LA 4QZIA 4F5PA 4KMUA 4NLNA 4DQSA 7ICFA 4C7YA 4M0AA 1K1SA 5F3XB 5AKEA 1ZYQA 3C5FA 2D8CA 1ZQDA 4BWMA 4M6WA 4P4PA 1RYSA 5DB7A 2F44A 2HI0A 3RRGA 1XO0A 9ICGA 4J9SA 1TV9A 1SXEA 5HMMA 2QARA 2FDRA 1S5LU 4F71A 4QZDA 1WWVA 3OHAA 1D9DA 3AL0B 5AI6A 2WB1C 3QU2A 3LWMA 5KFKA 5AM4A 3PW7A 4UB5A 2C2EA 1F0MA 4I2CA 2K4PA 2DPJA 4YR3A 1JI7A 4FZMA 5DG9A 1SL2A 8ICPA 2IA6A 5L1LA 1RZTA 1MC8A 1Z1BA 1ZQMA 1UHUA 4OO1J 4YR0A 3PMNA 4F2SA 4PHEA 3IHQB 4YD2A 4IC9A 1XS9D 5KL8B 2AQ0A 2NO4A 2B21A 5IINA 4R64A 3ETLA 2KP7A 8ICKA 2LKYA 5AI4A 4MFAA 2WF8A 3DV9A 1O03A 7ICSA 4C80A 4YXMA 4B9UA 2ISOA 1FFVA 2KK0A 5ALYA 1ZQIA 4FS1A 4LJXA 5AM0A 1L3VA 3PSFA 1CEZA 5AK5A 4YN4A 3SQIA 8ICMA 1N61A 5G5GA 3C1ZA 1RQLA 1RQNA 1ZQYA 2EDUA 3RH5A 2ATLA 4TUQA 4BDPA 2GH1A 2YMMA 2VJ4A 1KSPA 1ZQAA 2BDUA 2EAPA 1XC9A 5L1IA 2NRXA 3F53A 4GXJA 3EPGA 1TAMA 8ICWA 4RZRA 3LYSA 1MSWD 1S9FA 9ICVA 2EAMA 4DFJA 5KFBA 5IIKA 4B9VA 4RT2A 8ICJA 3QEAZ 3H0MB 2IOHA 4EYIB 3QE9Y 7ICMA 3QZ7A 4P0QB 8ICQA 3BZCA 5KFRA 4QZFA 1JN3A 5J2BA 1NKEA 1Z4NA 2H3IA 4MF8A 4DOBA 3KOOA 1ZQPA 4M9NA 9ICBA 5EE0A 4O3MA 3RJEA 1PVRA 1SV0A 4R63A 4LZGA 1ZQJA 1X9SA 5EWGA 3QUQA 2I1QA 5IILA 4EBEA 2L5YA 4G9BA 2KZZA 3WKCA 4C4RA 3V7KA 1MQ3A 9ICWA 4JK1A 2IBKA 2OM6A 4EX6A 4F4WA 2NV3A 3TADA 3H8MA 2F2AB 4JUZA 1X42A 3KBBA 4KLDA 5J2JA 2XI9A 3HW8A 2E8PA 5D46A 4UAZA 1COKA 2XICA 5EE1A 3JPSA 4ECUA 5J8YA 5ALEA 4UQGA 3SAFA 3UMGA 1BVSA 5KFCA 2KEYA 5KFNA 1PK3A 8ICZA 1F44A 4M47A 4RQ6A 4XUSA 2FLNA 5DBAA 9ICQA 5KFEA 3AU2A 3MR6A 1KRPA 3AN1A 4KN7A 2W9CB 3E2EA 3RH4A 9ICNA 3OSNA 2KZMA 8ICOA 4I2HA 4ECSA 4YMNA 2AGPA 1LKYB 3UXNA 5DQHA 2HHXA 4Q43A 2ZIWA 4Q44A 4ECZA 3GILA 2C2DA 4RNNA 3UMCA 3TFSA 1ZQNA 3M7DA 3A0HU 2BR0A 2MAXA 1PK1B 3PX6A 4KN4A 4O5CA 5HR6A 1V9PA 2K8BB 3PX0A 4DSEA 1MQ2A 2OHFA 4KLSA 5KG5A 2ALZA 4IRCA 5AK4A 1V38A 5DGAA 1FEZA 4I2EA 4OCZA 1B43A 3M8SA 4DLGA 3QNMA 3BZKA 1ZD3A 1BGXT 1SWWA 4KLJA 1PZNA 5D4BA 4NV0A 4CF4A 5DB8A 2W54A 1TK8A 4JV2A 2W9AA 3TARA 2PFPA 2BCUA 1ZJMA 5DG7A 4O3OA 5IIOA 1SZHA 4EBDA 1RXWA 4C4SA 5L1MA 3RBDA 1YT3A 4M9LA 1NK9A 5F9LA 2W3RA 4F8RA 2KJ9A 3H8WA 3BJYA 1IM4A 2LYAA 3C23A 3ALRA 1KL9A 1OUQA 1S0VA 9ICAA 3PSTA 4KMOB 7ICTA 3PNCA 1XU4A 3EPIA 2PFOA 4F3OA 4Z6EA 3B0YA 1WYGA 1PVQA 4IRDA 2R8JA 1Z00A 7ICIA 9ICKA 5KT2A 1NK7A 1WWUA 5ALZA 3EUB2 3C2KA 4P0PA 4F2RA 4ECQA 4FZLA 1U48A 4ED8A 2QKQA 5DDYA 4FZNA 3TFRA 2LHTA 3WK5A 1KLNA 1S10A 3BQ7A 3MR5A 1Q3VA 1JXEA 4UW9A 4M9GA 3SR6A 3CNHA 2BKEA 1COOA 4DL7A 5KFXA 1SIJA 5AKKA 3T3FA 2W04A 2EANA 4RPZA 4EBCA 1Z4OA 2DPIA 4IQWA 3JPRA 3VCBA 4Y2SA 4ECTA 5FP0A 1DGSA 4QIWC 2QLTA 7ICUA 2DKZA 5J2HA 3RB0A 2YMQA 7ICGA 2K8AA 2M9NA 2ZIUA 3C28A 3D6JA 3SI8A 2DKXA 4AYBC 2GO7A 4DF8A 2BZFA 4XRHA 4ELUA 5ALTA 2RHFA 2W9BB 1JRPA 1FIQA 4ED2A 3I1YA 1L7NA 3LVVA 2PXIA 1F5SA 2OXOA 3M1YA 2JR5A 2VA3A 5AKJA 2K60A 1KTQA 4Y2XA 2DWQA 1BPDA 3PW2A 7ICVA 4J9OA 5KFMA 1QCKA 4CNQA 1LB2B 4TURA 2K4IA 1ZQBA 2UVVA 1ZQVA 5CA7A 2K8CB 1HJPA 1YZ7A 2JV3A 5ALDA 1NZPA 3BDPA 3LDAA 4ELVA 4OJ5A 4Y2JA 4Q8EA 4I2DA 4Z6CA 2JEGA 5CWRA 1NK5A 4J9PA 3B9JA 4EZ6A 3K1ZA 1GO3F 3WKBA 3WK9A 3E58A 5HHHA 3RJIA 2RQ5A 2R8IA 3HILA 5L1KA 1C20A 4RT3A 1V97A 2HDOA 2K4HA 2VKQA 2LYHA 2KTQA 1YZ6A 2MRLA 3SMVA 2XCAA 4RQNA 3S6JA 2Q0ZX 2KZ3A 1QSSA 5CJ7A 7ICOA 2V4QA 4DL5A 4I2FA 4ECXA 2E5SA 1QTMA 3AQFA 5AK3A 3RJJA 1ZD5A 1D9FA 2G08A 1J2MA 4QZAA 4QWDA 3MDAA 3NASA 3VC8A 1ZQCA 4O0IA 2OWOA 5AI9A 3NRWA 4OJ6A 3GIJA 2BPFA 1KEJA 9ICLA 1ZJNA 2F77X 4ECYA 3SV4A 3Q8RB 2K4EA 2P35A 3UPQA 2W7OA 4MHVA 4US9A 1TE2A 1UQVA 1Y88A 1B22A 5AIBA 4U6PA 4KLHA 4F93B 3AM9A 2LYBA 3EWAA 2MU2A 4DL4A 1IXRA 1KFSA 1BPXA 2HHTA 3H0LB 5ALSA 2KFZA 3PZPA 7ICQA 2YTUA 1Q3UA 5AM3A 2BCQA 2WF6A 2HBJA 2I6XA 1VLBA 3V6HA 2EAOA 5CHGA 2KKVA 1L3UA 1DK3A 3PW4A 5KAIU 1WCNA 5ALPA 4BXOA 3GV8B 3ISBA 5KFVA 4K4IA 5DQIA 1X66A 1NOMA 3IG8A 3ZD9A 4F5OA 3DDHA 4JV0A 3WU2U 4JV1A 1ZRNA 4EX7A 1KKXA 2ODGA 1WG8A 9ICUA 1N60A 2A1JA 4WJ3B 3BS5B 1U49A 3ORYA 5AK6A 4B9LA 2PMZF 1ZQFA 1SKRA 2Y9UA 5AM5A 4GXKA 4C8MA 4XA5A 2KKPA 4DL3A 1X2IA 3C1YA 1A76A 2G0AA 8ICSA 4F92B 4X5VA 1L8LA 3F5EA 4DQRA 3M9NB 4NJ8A 3C5GA 3SENA 2W8KA 4ECVA 5KFYA 1KW4A 3C21A 3UXOA 1NKBA 3V7LA 2F1HA 3H4DA 2ZUBA 2Y0SC 2J6UA 4PGYA 5DB6A 8ICGA 4GFJA 4ZH4A 4QZBA 3D2SA 2BCRA 5J0OA 2MSNA 1BNPA 2KICA 3RJKA 1ZQ1C 2HVHA 3ONNA 5BOMA 3PR5B 4KLIA 1X40A 3SD7A 3WK6A 1B4FA 2BPGA 5KG7A 1TK0A 4ICAA 1DK2A 3HKZF 3Q8PB 1XSPA 5KFDA 2ZUDA 2FMQA 1PUZA 1L5UA 2W43A 3Q8QB 2ISPA 2FLLA 2EZYA 4RNMA 3AQEA 2DGZA 5ALLA 1D8YA 2Y1IA 2ZTEA 3AEVA 2W11A 3M6KA 3ED5A 5AKGA 7ICKA 2QB0B 2K89A 2W3SA 3N28A 1BPZA 5HHIA 2MA1A 4QZCA 3N4MB 2F76X 3ZDCA 5DQGA 1QSLA 5ALJA 2KG5A 4E0DA 2HCFA 5KFAA 4LVSA 2UVWA 2J6TA 4UAUA 2JZBA 1TVAA 5AI5A 2D3DA 4UB8U 1X6IA 4YMMA 5AHXA 3HT3A 1SV0C 2GLEA 2FPMA 3IRUA 1RYUA 4GIBA 2W8LA 2FMPA 3N7RC 4QNLA 4YQWA 2VANA 8ICYA 2ZXHA 3PY8A 4DSIA 3BQ0A 3M9OB 3KTQA 3IM1A 1OW5A 3GFKB 3JPOA 2F8KA 2BQUA 2JEIA 2OYYA 2R8GA 3TADC 3V7JA 4TUPA 2F1IA 3LK9A 3Q8MA 2ZIXB 5J2CA 4PZNA 4UB6U 1JROA 4KLEA 3PMLA 1URJA 3G6XA 3UM9A 4PPXA 1L8OA 3RB3A 3N7SC 2H3QA 3Q8KA 4QZ9A 4DS4A 3N97B 2ZG6A 2KSOA 5KFOA 2H3FA 1ZQTA 5J8YC 3HX0A 2CXYA 4PGQA 1CI4A 1K1QA 3V6KA 1RXVA 4EZ9A 4DF4A 4QZGA 2RDIA 2FPLA 4O3PA 3JPNA 4ED3A 2JH7A 3OPXA 1KFTA 2FPKA 1JX4A 4Y2UA 1NJZA 1N5WA 4NL9A 4UB3A 5KL1B 4R8UA 5DGBA 1FO4A 2N1RA 1A0PA 4NY8A 2WAQC 4BWJA 4DS5A 5ALWA 4RQ7A 2WHEA 3NVZA 4DFMA 5J0XA 1ZQSA 2YX8A 1T4GA 1HIWA 5KFIA 2HSZA 4IR1A 1NJXA 4QWCA 3GV7B 4YR2A 1NJYA 1RG6A 2OH2A 4M6WB 1HUOA 5J2DA 2ASLA 2G06A 1FFUA 2NRTA 5EOZA 3K1RB 1KBUA 4CGZA 1BPYA 2QARB 1DOQA 4QW9A 5L9XA 3MDCA 4J9LA 3RH6A 3CYMA 2HOIA 4YXJA 3T5JA 2C22A 1NKCA 4NM1A 1MN8A 2Q4TA 3SAGA 3H8SA 3AUOA 1SB3C 5J2GA 5BOLA 4QZEA 3QU4A 2CN1A 5T14A 7ICLA 4KLTA 2KD1A 4IR9A 3PR4A 2F3NA 1NI3A 4ED6A 1HUZA 3KKAA 3QU9A 2XGPA 5KG6A 3BQTA 2OCEA 4PL2A 8ICTA 4F4YA 2W9MA 5ALFA 3UMBA 3WK7A 4OJPA 3GV5B 4KLLA 3NGDA 2NYVA 4I27A 3BQ1A 5B66U 3QUTA 1P7DA 4MEXA 4B9TA 5C0YA 7ICPA 4QWAA 4USAA 2A3VA 7ICEA 5KFUA 5H2FU 4RNOA 1J97A 1A6SA 1ZQQA 4CE6A 5K4LA 1Z3EB 3AMZA 4F5RA 2A1AA 1B0XA 4NLGA 1T3QA 5J0PA 1HEKA 1N2XA 5KT7A 2XY7A 1ZRMA 2LBOA 8ICUA 4F72A 5CEHA 4C7ZA 5KFHA 3UXPA 3PW0A 3QU5A 2G09A 3RFAA 1N63A 8ICBA 4HAIA 3NVVA 3JPQA 2HBKA 3NVYA 3KZIU 2KIWA 2BDPA 1NK0A 1TAQA 1ZD2P 4MFCA 1S0NA 4DQQA 1TKDA 1S76D 2DFLA 4OJLA 1TAUA 3PSIA 3RB6A 3RJGA 5EWEA 2PI5A 1T8EA 2IHMA 5AKHA 3BS7A 3RB4A 4NM2A 3MBYA 4U7CA 4EENA 2AH5A 5A0LA 1L7OA 2ZTDA 1SL0A 4Y2QA 4J9MA 4UB2A 5KFPA 1SKSA 4YVZA 1MA7A 2FE9A 1SZPA 1JALA 2WFAA 1UA1A 1S0OA 3FM9A 2IHNA 2VJ5A 4DQPA 2JH1A 5BPCA 3L4PA 2NRZA 5J0SA 3D2NA 2A19A 2B6GA 1L3TA 3RJHA 5AKXA 4KLQA 4RQMA 4JMUA 4J9RA 2RLTA 4B9MA 1DGJA 1WCLA 3M9MB 2ZJ5A 1SKWA 2ZIVA 4XQ8A 3MC1A 4Y2RA 2HOFA 3ZDBA 5JUMA 4FE3A 9ICFA 5KFFA 2NO5A 4UB4A 4DSKA 4I29A 3H7IA 1TK5A 4QZ8A 4FBTA 4UB1A 1N62A 3SV3A 2ASDA 1NK4A 5J2KA 4RU9A 5IIMA 2BPCA 2RRDA 2KJ5A 1Z1VA 8ICIA 9ICJA 8ICCA 4Q8FA 1KDHA 1KFDA 4AP9A 2G5IB 7ICRA 1DRGA 4GC7A 2ZTCA 3WKDA 5GTIU 4KLOA 3O0FA 1D8LA 4JWMA 3WK8A 1ZOLA 4MF2A 2YB1A 3ZD8A 2XVTA 3Q8SB 4EEYA 1ZQGA 4R65A 1QSYA 7ICNA 4KTQA 4HYKA 4F5NA 3E0FA 4UATA 1X9MA 3RTVA 3QXGA 4PL1A 3FAHA 2JHDA 4QIWF 4O3RA 2PMZC 3LVWA 1XWLA 2FLPA 4F5QA 4RQ1A 3NVWA 2D6FC 2HHUA 4Z6DA 2ZIWB 4AYBF 3NTUA 1UT5A 3QUBA 2AJQA 3HP6A 1UT8A 5CR0A 1L7PA 2ASJA 3K75D 4R8UB 3MABA 5KT4A 5C5JA 2DL0A 2ZUCA 2XO7A 4FO6A 4MFFA 2MUTA 1LKYA 4BUGA 1XSLA 2HHWA 1ZETA 1XO1A 5JTIA 3QEBZ 3FC4A 1RM6C 2YY6A 2AGOA 1V85A 2CPRA 5J29A 4IRKA 4DQIA 1PK1A 3PO4A 5KFWA 3SEIA 1UA0A 2CRXA 2XY6A 5KAFU 2JXJA 1QQ7A 4YFKA 1XNSA 4ECWA 9ICHA 3HKZC 2WF7A 4KLMA 2Y1JA 3QYPA 4F50A 3TAQA 5DBCA 2QB1A 4I2IA 1NNLA 2ES6A 9ICCA 5DG8A 4DCCA 3KHRA 2YMPA 4DFPA 2H3VA 3MGIA 9ICRA 3MFIA 4DOAA 2VIXA 2LI6A 3GQCA 2AQ4A 4I2BA 4TQSA 8ICNA 4CCHA 5KG3A 4B6JA 3KZXA 1PVPA 3QUCA 2KN7A 4QWEA 4M2YA 1U9LA 4PHAA 3NRZA 3R9KA 2XCPA 3IP4B 1NZBA 5E79U 2XGQA 3LWLA 5KG1A 2E8MA 4M9JA 1C7YA 1QQ5A 4J03A 1ECWA 5DKWA 1Z00B 1ZQHA 1N5XA 1N48A 2HBMA 4P0PB 4DOCA 1UPHA 2E1EA 2HHQA 3RRHA 2XC9A 1BPEA 1NK8A 2GOLA 4M9HA 5ALHA 2HOQA 4FFDA 1WUDA 2IOFK 4PHDA 1BNOA 4UBBA 5KFGA 3WK4A 4KLGA 3D2QA 3HWTA 4YD1A 4CRXA 4P4MA 9ICMA 3K4GA 2P6UA 2M0NA 5JU5A 4K4GA 4A8EA 5AKLA 5J0RA 3RAQA 2EQYA 1ZXIA 3A0BU 2ZIUB 2E8OA 8ICFA 2LM4A 3WKAA 7ICJA 3G6VA 2R18A 5ALMA 3F5AA 4RUAA 2Y9TA 4PJ0U 1Q46A 2KHQA 2WB1F 4FBUA 5HNKA 3RAXA 4UAVA 1A77A 5KFSA 4I2JA 3GZFA 5HMLA 4BJQA 2KE7A 2WTFA 3PVXA 2FJ6A 3C2MA 3ISCA 1X9WA 1ZQKA 5J0TA 3F2DA 1QLNA 4G3IA 2G5HB 2W9BA 5J0UA 5ALVA 2ZIVB 4DL2A 5J0QA 4QW8A 2DBYA 3TACB 1ZQUA 4UAWA 2PI4A 3QU7A 4BX9C 3OSPA 4US8A 4B9SA 2KHVA 9ICXA 4C4TA 4QJFB 2EH9A 5KT6A 2ZJAA 4I28A 1Q8KA 4YG2A 4UARA 2YMLA 3FYHA 1LV5A 4RPXA 2IOFA 4CF3A 1VDVA 1JMSA 4RUCA 3Q8LA 2PFQA 2Y0SF 1T94A 1IG6A 1IV8A 4EYHB 2AU0A 4O9MA 5DLFA 2LMRA 4R66A 3JPPA 4C8OA 5J2FA 3IN5A 3M6ZA 5AI0A 3TANA 2HBLA 1RPLA 5DDMA 3RR8A 2AGQA
chains in the Genus database with same CATH topology
2KZ3A 1QSSA 5KT7A 1S0MA 5CJ7A 2P6RA 2XY7A 7ICOA 2V4QA 4MFAA 4F91B 4DL5A 4I2FA 1ZQEA 8ICUA 7ICSA 4ECXA 5D49A 4YXMA 4B9UA 2ISOA 5KFHA 3UXPA 3PW0A 1QTMA 1ZQIA 4FS1A 1CUKA 3RJJA 8ICBA 1L3VA 4I2AA 3JPQA 1CEZA 9ICOA 2V4RA 4YN4A 1D9FA 4QZAA 4QWDA 3TI0A 2GWSA 2BDPA 1NK0A 1TAQA 2C28A 3MDAA 8ICMA 5DB9A 1ZQCA 3C1ZA 4O0IA 4MEYA 4MFCA 8ICEA 1S0NA 2OWOA 1ZQYA 3RH5A 3OHBA 4DQQA 2ATLA 1TKDA 1S76D 4TUQA 2RDJA 2DFLA 4BDPA 1TAUA 2BQ3A 4NLKA 3OGUA 3RB6A 3GIJA 1KSPA 3RJGA 5KFJA 5EWEA 4QWBA 1ZQAA 2BPFA 1KEJA 2PI5A 9ICLA 1ZJNA 1XC9A 4ECYA 1T8EA 5L1IA 2NRXA 3SV4A 2IHMA 3Q8RB 4B9NA 2MUTB 3UPQA 3RB4A 4NM2A 3MBYA 4GXJA 3EPGA 2F1JA 4O5KA 8ICWA 2ZJ8A 1Y88A 2ZTDA 1SL0A 4RZRA 1B22A 5DLGA 4KLHA 4F93B 5HP4A 4J9MA 1MSWD 3SYZA 1S9FA 3EZ5A 3H40A 4UB2A 3EWAA 9ICVA 5KFPA 4DL4A 3ISDA 1IXRA 1SKSA 9ICPA 4DFJA 4YVZA 4DFKA 1BPXA 5KFBA 1KFSA 2HHTA 1SZPA 3M8RA 5IIKA 4GLXA 4RT2A 4B9VA 4K4HA 8ICJA 2KFZA 1UA1A 3QEAZ 1S0OA 2IHNA 4DQPA 5J2AA 3UQ0A 7ICQA 3EW9A 5BPCA 8ICAA 4EYIB 2NRZA 3QE9Y 3EYZA 7ICMA 5J0SA 3BQ2A 3QZ7A 1L3TA 2BCQA 8ICQA 2XY5A 2NRVA 5KFRA 4QZFA 2I9GA 1JN3A 3RJHA 5J2BA 3MFHA 3TAPA 1NKEA 3V6JA 4J9KA 4MF8A 4KLQA 4DOBA 3PX4A 1ZQPA 5KG2A 4J9RA 4BXOB 4M9NA 3V6HA 9ICBA 2V9WA 5CHGA 4B9MA 1WCLA 1L3UA 4DSLA 3M9MB 4C8KA 2ZJ5A 3RJEA 1SKWA 3PW4A 1SL1A 4R63A 4LZGA 1WCNA 4XQ8A 1X9SA 1ZQJA 5F9NA 5EWGA 5J0WA 3ZDBA 4BXOA 3GV8B 1S77D 2I1QA 9ICSA 3ISBA 5JUMA 9ICFA 5KFFA 5KFVA 5IILA 4EBEA 4K4IA 4UB4A 5DQIA 4P2HA 1NOMA 3KHLA 3ZD9A 4DSKA 4F5OA 3H7IA 1TK5A 2A1JB 4JV0A 4QZ8A 4I29A 3V7KA 1MQ3A 2KZZA 4FBTA 4UB1A 4Z6FA 3V72A 3H8JA 4UBCA 1ZQOA 4JV1A 2ASDA 3SV3A 1NK4A 9ICWA 5J2KA 2BHNA 4RU9A 5IIMA 9ICEA 2BPCA 1N56A 4JK1A 9ICUA 2IBKA 7ICHA 8ICIA 9ICJA 2A1JA 4F4WA 3QZ8A 1U49A 3ORYA 8ICCA 5KT3A 4Q8FA 3RJFA 4B9LA 1KDHA 1KFDA 2JEFA 4JUZA 4ELTA 7ICRA 1S97A 4J9NA 2BQRA 1SKRA 1ZQFA 3HPOA 4GC7A 4GXKA 4C8MA 2ZTCA 4XA5A 4KLDA 4DL3A 1X2IA 3C1YA 4KLOA 5J2JA 4ED7A 3HW8A 1A76A 1AROP 4RQ0A 1D8LA 4JWMA 4MF2A 4F92B 8ICSA 5J2IA 5D46A 4UAZA 4X5VA 3JPSA 3ZD8A 4ECUA 4DQRA 1BPBA 3M9NB 3T5HA 4QZHA 3MR2A 4UQGA 3C5GA 3Q8SB 2W8KA 4EEYA 4ECVA 5KFYA 1BVSA 5KFCA 5KFNA 3C21A 4R65A 3UXOA 4ED1A 1ZQGA 2BGWA 1QSYA 1T3NA 3ZDAA 7ICNA 3AU6A 4PHPA 1NKBA 4HYKA 4F5NA 3V7LA 5KFQA 4RQ6A 4KTQA 4XUSA 2FLNA 4M47A 3GDXA 1X9MA 2F1HA 5DBAA 3RTVA 3OJSA 3H4DA 2ZUBA 9ICQA 5KFEA 3AU2A 2J6UA 3MR6A 1KRPA 4PGYA 3JPTA 5DB6A 2VA2A 8ICGA 4YCXA 4O3RA 1L3SA 4KN7A 5KG0A 2W9CB 4ZH4A 3E2EA 3RH4A 1XWLA 4QZBA 3OSNA 4F5QA 2BCRA 4RQ1A 1NK6A 2FLPA 2FMSA 2KZMA 2HHVA 8ICOA 5J0OA 4I2HA 4F4ZA 4JWNA 2HHUA 4Z6DA 4ECSA 4ED0A 4YMNA 3RJKA 2BCVA 4TQRA 2AGPA 2NRWA 3NTUA 1UT5A 5DBBA 2HVHA 4DLEA 2AJQA 8ICLA 4RPYA 5BOMA 3PR5B 3HP6A 1UT8A 4KLIA 3UXNA 5CR0A 4DO9A 2ASJA 5DQHA 3MR3A 2BPGA 5KG7A 2BCSA 1TK0A 3K75D 2HHXA 4Q43A 4R8UB 3MABA 5KT4A 3Q8PB 4RQ2A 1U45A 5C5JA 4Q44A 2ZUCA 2XO7A 3GILA 4ECZA 4FO6A 4MFFA 1XSPA 5KTQA 2MUTA 5KFDA 2C2DA 2ZUDA 4RNNA 1XSLA 2HHWA 1ZETA 2FMQA 3TFSA 1ZQNA 1XO1A 2BR0A 1L5UA 2MAXA 4YP3A 3PX6A 4KN4A 3QEBZ 4O5CA 1V9PA 3Q8QB 3PX0A 2AGOA 5CB1A 1RYRA 2ISPA 5J29A 4DSEA 1MQ2A 4GC6A 4IRKA 2VA8A 2FLLA 4DQIA 5J0YA 4GXIA 4RNMA 3RR7A 9ICNA 4KLSA 3GIKA 1D8YA 5KFZA 3PO4A 4PGXA 5KG5A 2Y1IA 2ZTEA 2ALZA 2P66A 5KFWA 4O3QA 4IRCA 5DGAA 3H4BA 1UA0A 4I2EA 2XY6A 3RBEA 1B43A 3M8SA 4NXZA 4DLGA 1ZQWA 4DL6A 1H38A 4PH5A 7ICKA 4YFKA 4C8NA 5L1JA 4ECWA 3THVA 4O5EA 9ICHA 1BGXT 4KLJA 1PZNA 4TUSA 5IIJA 1BPZA 4KLMA 3T5LA 4O3SA 2Y1JA 4F4KA 5D4BA 4F50A 3TAQA 3T5KA 5DBCA 5DB8A 4KLFA 1TK8A 5HHIA 4I2IA 4QZCA 4LZDA 2JZBB 3N4MB 1T7PA 4JV2A 3ZDCA 5DQGA 4RQ8A 1QSLA 2W9AA 3FDSA 5DG8A 2JEJA 9ICCA 4IQVA 4E0DA 5KG4A 8ICHA 5KFAA 3KHRA 4LVSA 4I2GA 4DFPA 3TARA 2PFPA 3MGIA 2BCUA 2UVWA 9ICRA 1ZJMA 2J6TA 5DG7A 2JZBA 3MFIA 4DOAA 1TVAA 4O3OA 2HVIA 5IIOA 3GQCA 2AQ4A 4EBDA 1RXWA 4TQSA 4I2BA 4NLZA 4CCHA 2KFNA 8ICNA 5KG3A 3RBDA 4M9LA 4BGDA 9ICIA 1NK9A 5F9LA 3PW5A 5KT5A 2KN7A 4QWEA 4M2YA 3KHHA 1U9LA 4PHAA 4FS2A 4F8RA 3PV8A 4DSJA 4YMMA 1JIHA 2XCPA 3HT3A 3TQ1A 2FPMA 2FMPA 2W8LA 1U47A 2XGQA 3H8WA 4YQWA 3LWLA 2VANA 3BJYA 4DSFA 5KG1A 1IM4A 3C23A 8ICYA 3G6YA 4M9JA 1S0VA 9ICAA 1C7YA 1XSNA 8ICXA 7ICTA 3PY8A 1EXNA 4DSIA 4IQTA 1ZQZA 4YMOA 3BQ0A 5DKWA 3PNCA 1Z00B 3M9OB 3KTQA 3B0XA 3IM1A 2IMWP 3GFKB 3JPOA 1XU4A 2BQUA 5TZVA 3EPIA 3GIIA 1ZQHA 2JEIA 3OJUA 2C2RA 2PFOA 2R8GA 4F3OA 5IIIA 4Z6EA 3KHGA 3V7JA 3ZDDA 1N48A 3B0YA 4IRDA 2R8JA 1Z00A 7ICIA 9ICKA 4DOCA 1NJWA 4TUPA 2UVRA 2F1IA 3LK9A 5KT2A 3Q8MA 1NK7A 1ZQXA 4O3NA 5J2CA 3RRHA 1ZQLA 4F4XA 2HHQA 8ICZA 3PO5A 4IQUA 4KLEA 2XC9A 2R8KA 3PMLA 3ZDEA 3G6XA 5KFLA 4UAYA 4PPXA 3RB3A 1BPEA 3C2KA 2HW3A 4KITB 4F2RA 4ECQA 4ECRA 1NK8A 3Q8KA 4M9HA 5J2EA 4QZ9A 1JXLA 4DS4A 3N97B 1U48A 5EWFA 4ED8A 8ICVA 4C8LA 2H5XA 4DEZA 5KFOA 1ZQTA 3HX0A 2R8HA 5DDYA 8ICRA 2W9CA 4PGQA 3TFRA 1U4BA 4PHDA 1K1QA 2J6SA 1KLNA 4UBBA 4KLUA 1S10A 5KFGA 3V6KA 1RXVA 4P4OA 3SZ2A 4EZ9A 3MR5A 4KLGA 3HWTA 3UQ2A 4YD1A 4DWIA 1JXEA 4RQ3A 4P4MA 4DF4A 5KFTA 2RDIA 4O3PA 2FPLA 4QZGA 4M9GA 9ICMA 3MGHA 3K4GA 3JPNA 2BKEA 4ED3A 1COOA 4DL7A 2P6UA 5KFXA 1ZQRA 5CP2A 3T3FA 4K4GA 3GIMA 1TFRA 1KFTA 2FPKA 1JX4A 1NJZA 5J0RA 4RPZA 3RAQA 4UB3A 4EBCA 4M04A 4R8UA 2DPIA 5DGBA 2PFNA 4IQWA 3JPRA 4ECTA 1DGSA 4RQ5A 4NY8A 2UVUA 8ICFA 7ICUA 4J9QA 4BWJA 4DS5A 7ICJA 4RQ4A 3G6VA 2HHSA 4RQ7A 9ICTA 4Q45A 5J2HA 4DFMA 5J0XA 3RB0A 1ZQSA 4RUAA 7ICGA 3C2LA 4FBUA 4QZIA 4F5PA 1T4GA 5HNKA 2M9NA 4KMUA 3RAXA 4NLNA 3SI8A 4DQSA 7ICFA 4DF8A 1A77A 5KFSA 5KFIA 4XRHA 4IR1A 1NJXA 1K1SA 4ELUA 4M0AA 4QWCA 3GV7B 4YR2A 1NJYA 4I2JA 4M6WB 1ZYQA 5J2DA 1HUOA 5HMLA 2W9BB 2ASLA 2WTFA 3PVXA 4ED2A 3C5FA 3C2MA 2NRTA 5EOZA 3ISCA 1BPYA 1X9WA 1ZQKA 1ZQDA 5J0TA 4BWMA 1QLNA 4M6WA 4G3IA 2PXIA 4P4PA 1RYSA 1DOQA 2W9BA 4QW9A 5L9XA 3MDCA 4J9LA 3RH6A 5DB7A 4YXJA 3T5JA 5J0UA 2C22A 1NKCA 3RRGA 2VA3A 4NM1A 4DL2A 5J0QA 4J9SA 4QW8A 9ICGA 1TV9A 3H8SA 1KTQA 3AUOA 5HMMA 1BPDA 5J2GA 5BOLA 3PW2A 1ZQUA 4UAWA 7ICVA 4QZEA 4J9OA 4QZDA 2PI4A 5KFMA 1LB2B 3OSPA 7ICLA 4TURA 4KLTA 3OHAA 1D9DA 2C2EA 3PW7A 3LWMA 5KFKA 1ZQBA 4IR9A 4UB5A 3PR4A 4B9SA 4I2CA 2UVVA 2DPJA 4YR3A 9ICXA 1ZQVA 4ED6A 1HUZA 5KT6A 2ZJAA 5CA7A 5DG9A 1SL2A 4I28A 8ICPA 2IA6A 5L1LA 1HJPA 4YG2A 1RZTA 1MC8A 2XGPA 3BDPA 5KG6A 3BQTA 3FYHA 3LDAA 1ZQMA 4ELVA 1LV5A 4RPXA 8ICTA 4F4YA 2W9MA 4Q8EA 1JMSA 4I2DA 4Z6CA 2JEGA 4RUCA 5CWRA 4YR0A 4J9PA 3PMNA 3Q8LA 1NK5A 3GV5B 2PFQA 4EZ6A 4KLLA 3NGDA 4F2SA 4I27A 3BQ1A 4MEXA 4EYHB 2AU0A 4B9TA 7ICPA 4PHEA 3RJIA 5HHHA 4O9MA 4QWAA 5DLFA 3IHQB 2R8IA 7ICEA 4YD2A 5KFUA 5L1KA 4RNOA 4R66A 3JPPA 4RT3A 1XS9D 1ZQQA 4C8OA 5J2FA 2AQ0A 2B21A 5IINA 3TANA 1Z3EB 4R64A 2LYHA 3ETLA 2KTQA 4F5RA 2XCAA 4NLGA 1RPLA 8ICKA 5DDMA 2Q0ZX 3RR8A 5J0PA 2AGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZ3 A;  1QSS A;  5KT7 A;  1S0M A;  5CJ7 A;  2P6R A;  2XY7 A;  7ICO A;  2V4Q A;  4MFA A;  4F91 B;  4DL5 A;  4I2F A;  1ZQE A;  8ICU A;  7ICS A;  4ECX A;  5D49 A;  4YXM A;  4B9U A;  2ISO A;  5KFH A;  3UXP A;  3PW0 A;  1QTM A;  1ZQI A;  4FS1 A;  1CUK A;  3RJJ A;  8ICB A;  1L3V A;  4I2A A;  3JPQ A;  1CEZ A;  9ICO A;  2V4R A;  4YN4 A;  1D9F A;  4QZA A;  4QWD A;  3TI0 A;  2GWS A;  2BDP A;  1NK0 A;  1TAQ A;  2C28 A;  3MDA A;  8ICM A;  5DB9 A;  1ZQC A;  3C1Z A;  4O0I A;  4MEY A;  4MFC A;  8ICE A;  1S0N A;  2OWO A;  1ZQY A;  3RH5 A;  3OHB A;  4DQQ A;  2ATL A;  1TKD A;  1S76 D;  4TUQ A;  2RDJ A;  2DFL A;  4BDP A;  1TAU A;  2BQ3 A;  4NLK A;  3OGU A;  3RB6 A;  3GIJ A;  1KSP A;  3RJG A;  5KFJ A;  5EWE A;  4QWB A;  1ZQA A;  2BPF A;  1KEJ A;  2PI5 A;  9ICL A;  1ZJN A;  1XC9 A;  4ECY A;  1T8E A;  5L1I A;  2NRX A;  3SV4 A;  2IHM A;  3Q8R B;  4B9N A;  2MUT B;  3UPQ A;  3RB4 A;  4NM2 A;  3MBY A;  4GXJ A;  3EPG A;  2F1J A;  4O5K A;  8ICW A;  2ZJ8 A;  1Y88 A;  2ZTD A;  1SL0 A;  4RZR A;  1B22 A;  5DLG A;  4KLH A;  4F93 B;  5HP4 A;  4J9M A;  1MSW D;  3SYZ A;  1S9F A;  3EZ5 A;  3H40 A;  4UB2 A;  3EWA A;  9ICV A;  5KFP A;  4DL4 A;  3ISD A;  1IXR A;  1SKS A;  9ICP A;  4DFJ A;  4YVZ A;  4DFK A;  1BPX A;  5KFB A;  1KFS A;  2HHT A;  1SZP A;  3M8R A;  5IIK A;  4GLX A;  4RT2 A;  4B9V A;  4K4H A;  8ICJ A;  2KFZ A;  1UA1 A;  3QEA Z;  1S0O A;  2IHN A;  4DQP A;  5J2A A;  3UQ0 A;  7ICQ A;  3EW9 A;  5BPC A;  8ICA A;  4EYI B;  2NRZ A;  3QE9 Y;  3EYZ A;  7ICM A;  5J0S A;  3BQ2 A;  3QZ7 A;  1L3T A;  2BCQ A;  8ICQ A;  2XY5 A;  2NRV A;  5KFR A;  4QZF A;  2I9G A;  1JN3 A;  3RJH A;  5J2B A;  3MFH A;  3TAP A;  1NKE A;  3V6J A;  4J9K A;  4MF8 A;  4KLQ A;  4DOB A;  3PX4 A;  1ZQP A;  5KG2 A;  4J9R A;  4BXO B;  4M9N A;  3V6H A;  9ICB A;  2V9W A;  5CHG A;  4B9M A;  1WCL A;  1L3U A;  4DSL A;  3M9M B;  4C8K A;  2ZJ5 A;  3RJE A;  1SKW A;  3PW4 A;  1SL1 A;  4R63 A;  4LZG A;  1WCN A;  4XQ8 A;  1X9S A;  1ZQJ A;  5F9N A;  5EWG A;  5J0W A;  3ZDB A;  4BXO A;  3GV8 B;  1S77 D;  2I1Q A;  9ICS A;  3ISB A;  5JUM A;  9ICF A;  5KFF A;  5KFV A;  5IIL A;  4EBE A;  4K4I A;  4UB4 A;  5DQI A;  4P2H A;  1NOM A;  3KHL A;  3ZD9 A;  4DSK A;  4F5O A;  3H7I A;  1TK5 A;  2A1J B;  4JV0 A;  4QZ8 A;  4I29 A;  3V7K A;  1MQ3 A;  2KZZ A;  4FBT A;  4UB1 A;  4Z6F A;  3V72 A;  3H8J A;  4UBC A;  1ZQO A;  4JV1 A;  2ASD A;  3SV3 A;  1NK4 A;  9ICW A;  5J2K A;  2BHN A;  4RU9 A;  5IIM A;  9ICE A;  2BPC A;  1N56 A;  4JK1 A;  9ICU A;  2IBK A;  7ICH A;  8ICI A;  9ICJ A;  2A1J A;  4F4W A;  3QZ8 A;  1U49 A;  3ORY A;  8ICC A;  5KT3 A;  4Q8F A;  3RJF A;  4B9L A;  1KDH A;  1KFD A;  2JEF A;  4JUZ A;  4ELT A;  7ICR A;  1S97 A;  4J9N A;  2BQR A;  1SKR A;  1ZQF A;  3HPO A;  4GC7 A;  4GXK A;  4C8M A;  2ZTC A;  4XA5 A;  4KLD A;  4DL3 A;  1X2I A;  3C1Y A;  4KLO A;  5J2J A;  4ED7 A;  3HW8 A;  1A76 A;  1ARO P;  4RQ0 A;  1D8L A;  4JWM A;  4MF2 A;  4F92 B;  8ICS A;  5J2I A;  5D46 A;  4UAZ A;  4X5V A;  3JPS A;  3ZD8 A;  4ECU A;  4DQR A;  1BPB A;  3M9N B;  3T5H A;  4QZH A;  3MR2 A;  4UQG A;  3C5G A;  3Q8S B;  2W8K A;  4EEY A;  4ECV A;  5KFY A;  1BVS A;  5KFC A;  5KFN A;  3C21 A;  4R65 A;  3UXO A;  4ED1 A;  1ZQG A;  2BGW A;  1QSY A;  1T3N A;  3ZDA A;  7ICN A;  3AU6 A;  4PHP A;  1NKB A;  4HYK A;  4F5N A;  3V7L A;  5KFQ A;  4RQ6 A;  4KTQ A;  4XUS A;  2FLN A;  4M47 A;  3GDX A;  1X9M A;  2F1H A;  5DBA A;  3RTV A;  3OJS A;  3H4D A;  2ZUB A;  9ICQ A;  5KFE A;  3AU2 A;  2J6U A;  3MR6 A;  1KRP A;  4PGY A;  3JPT A;  5DB6 A;  2VA2 A;  8ICG A;  4YCX A;  4O3R A;  1L3S A;  4KN7 A;  5KG0 A;  2W9C B;  4ZH4 A;  3E2E A;  3RH4 A;  1XWL A;  4QZB A;  3OSN A;  4F5Q A;  2BCR A;  4RQ1 A;  1NK6 A;  2FLP A;  2FMS A;  2KZM A;  2HHV A;  8ICO A;  5J0O A;  4I2H A;  4F4Z A;  4JWN A;  2HHU A;  4Z6D A;  4ECS A;  4ED0 A;  4YMN A;  3RJK A;  2BCV A;  4TQR A;  2AGP A;  2NRW A;  3NTU A;  1UT5 A;  5DBB A;  2HVH A;  4DLE A;  2AJQ A;  8ICL A;  4RPY A;  5BOM A;  3PR5 B;  3HP6 A;  1UT8 A;  4KLI A;  3UXN A;  5CR0 A;  4DO9 A;  2ASJ A;  5DQH A;  3MR3 A;  2BPG A;  5KG7 A;  2BCS A;  1TK0 A;  3K75 D;  2HHX A;  4Q43 A;  4R8U B;  3MAB A;  5KT4 A;  3Q8P B;  4RQ2 A;  1U45 A;  5C5J A;  4Q44 A;  2ZUC A;  2XO7 A;  3GIL A;  4ECZ A;  4FO6 A;  4MFF A;  1XSP A;  5KTQ A;  2MUT A;  5KFD A;  2C2D A;  2ZUD A;  4RNN A;  1XSL A;  2HHW A;  1ZET A;  2FMQ A;  3TFS A;  1ZQN A;  1XO1 A;  2BR0 A;  1L5U A;  2MAX A;  4YP3 A;  3PX6 A;  4KN4 A;  3QEB Z;  4O5C A;  1V9P A;  3Q8Q B;  3PX0 A;  2AGO A;  5CB1 A;  1RYR A;  2ISP A;  5J29 A;  4DSE A;  1MQ2 A;  4GC6 A;  4IRK A;  2VA8 A;  2FLL A;  4DQI A;  5J0Y A;  4GXI A;  4RNM A;  3RR7 A;  9ICN A;  4KLS A;  3GIK A;  1D8Y A;  5KFZ A;  3PO4 A;  4PGX A;  5KG5 A;  2Y1I A;  2ZTE A;  2ALZ A;  2P66 A;  5KFW A;  4O3Q A;  4IRC A;  5DGA A;  3H4B A;  1UA0 A;  4I2E A;  2XY6 A;  3RBE A;  1B43 A;  3M8S A;  4NXZ A;  4DLG A;  1ZQW A;  4DL6 A;  1H38 A;  4PH5 A;  7ICK A;  4YFK A;  4C8N A;  5L1J A;  4ECW A;  3THV A;  4O5E A;  9ICH A;  1BGX T;  4KLJ A;  1PZN A;  4TUS A;  5IIJ A;  1BPZ A;  4KLM A;  3T5L A;  4O3S A;  2Y1J A;  4F4K A;  5D4B A;  4F50 A;  3TAQ A;  3T5K A;  5DBC A;  5DB8 A;  4KLF A;  1TK8 A;  5HHI A;  4I2I A;  4QZC A;  4LZD A;  2JZB B;  3N4M B;  1T7P A;  4JV2 A;  3ZDC A;  5DQG A;  4RQ8 A;  1QSL A;  2W9A A;  3FDS A;  5DG8 A;  2JEJ A;  9ICC A;  4IQV A;  4E0D A;  5KG4 A;  8ICH A;  5KFA A;  3KHR A;  4LVS A;  4I2G A;  4DFP A;  3TAR A;  2PFP A;  3MGI A;  2BCU A;  2UVW A;  9ICR A;  1ZJM A;  2J6T A;  5DG7 A;  2JZB A;  3MFI A;  4DOA A;  1TVA A;  4O3O A;  2HVI A;  5IIO A;  3GQC A;  2AQ4 A;  4EBD A;  1RXW A;  4TQS A;  4I2B A;  4NLZ A;  4CCH A;  2KFN A;  8ICN A;  5KG3 A;  3RBD A;  4M9L A;  4BGD A;  9ICI A;  1NK9 A;  5F9L A;  3PW5 A;  5KT5 A;  2KN7 A;  4QWE A;  4M2Y A;  3KHH A;  1U9L A;  4PHA A;  4FS2 A;  4F8R A;  3PV8 A;  4DSJ A;  4YMM A;  1JIH A;  2XCP A;  3HT3 A;  3TQ1 A;  2FPM A;  2FMP A;  2W8L A;  1U47 A;  2XGQ A;  3H8W A;  4YQW A;  3LWL A;  2VAN A;  3BJY A;  4DSF A;  5KG1 A;  1IM4 A;  3C23 A;  8ICY A;  3G6Y A;  4M9J A;  1S0V A;  9ICA A;  1C7Y A;  1XSN A;  8ICX A;  7ICT A;  3PY8 A;  1EXN A;  4DSI A;  4IQT A;  1ZQZ A;  4YMO A;  3BQ0 A;  5DKW A;  3PNC A;  1Z00 B;  3M9O B;  3KTQ A;  3B0X A;  3IM1 A;  2IMW P;  3GFK B;  3JPO A;  1XU4 A;  2BQU A;  5TZV A;  3EPI A;  3GII A;  1ZQH A;  2JEI A;  3OJU A;  2C2R A;  2PFO A;  2R8G A;  4F3O A;  5III A;  4Z6E A;  3KHG A;  3V7J A;  3ZDD A;  1N48 A;  3B0Y A;  4IRD A;  2R8J A;  1Z00 A;  7ICI A;  9ICK A;  4DOC A;  1NJW A;  4TUP A;  2UVR A;  2F1I A;  3LK9 A;  5KT2 A;  3Q8M A;  1NK7 A;  1ZQX A;  4O3N A;  5J2C A;  3RRH A;  1ZQL A;  4F4X A;  2HHQ A;  8ICZ A;  3PO5 A;  4IQU A;  4KLE A;  2XC9 A;  2R8K A;  3PML A;  3ZDE A;  3G6X A;  5KFL A;  4UAY A;  4PPX A;  3RB3 A;  1BPE A;  3C2K A;  2HW3 A;  4KIT B;  4F2R A;  4ECQ A;  4ECR A;  1NK8 A;  3Q8K A;  4M9H A;  5J2E A;  4QZ9 A;  1JXL A;  4DS4 A;  3N97 B;  1U48 A;  5EWF A;  4ED8 A;  8ICV A;  4C8L A;  2H5X A;  4DEZ A;  5KFO A;  1ZQT A;  3HX0 A;  2R8H A;  5DDY A;  8ICR A;  2W9C A;  4PGQ A;  3TFR A;  1U4B A;  4PHD A;  1K1Q A;  2J6S A;  1KLN A;  4UBB A;  4KLU A;  1S10 A;  5KFG A;  3V6K A;  1RXV A;  4P4O A;  3SZ2 A;  4EZ9 A;  3MR5 A;  4KLG A;  3HWT A;  3UQ2 A;  4YD1 A;  4DWI A;  1JXE A;  4RQ3 A;  4P4M A;  4DF4 A;  5KFT A;  2RDI A;  4O3P A;  2FPL A;  4QZG A;  4M9G A;  9ICM A;  3MGH A;  3K4G A;  3JPN A;  2BKE A;  4ED3 A;  1COO A;  4DL7 A;  2P6U A;  5KFX A;  1ZQR A;  5CP2 A;  3T3F A;  4K4G A;  3GIM A;  1TFR A;  1KFT A;  2FPK A;  1JX4 A;  1NJZ A;  5J0R A;  4RPZ A;  3RAQ A;  4UB3 A;  4EBC A;  4M04 A;  4R8U A;  2DPI A;  5DGB A;  2PFN A;  4IQW A;  3JPR A;  4ECT A;  1DGS A;  4RQ5 A;  4NY8 A;  2UVU A;  8ICF A;  7ICU A;  4J9Q A;  4BWJ A;  4DS5 A;  7ICJ A;  4RQ4 A;  3G6V A;  2HHS A;  4RQ7 A;  9ICT A;  4Q45 A;  5J2H A;  4DFM A;  5J0X A;  3RB0 A;  1ZQS A;  4RUA A;  7ICG A;  3C2L A;  4FBU A;  4QZI A;  4F5P A;  1T4G A;  5HNK A;  2M9N A;  4KMU A;  3RAX A;  4NLN A;  3SI8 A;  4DQS A;  7ICF A;  4DF8 A;  1A77 A;  5KFS A;  5KFI A;  4XRH A;  4IR1 A;  1NJX A;  1K1S A;  4ELU A;  4M0A A;  4QWC A;  3GV7 B;  4YR2 A;  1NJY A;  4I2J A;  4M6W B;  1ZYQ A;  5J2D A;  1HUO A;  5HML A;  2W9B B;  2ASL A;  2WTF A;  3PVX A;  4ED2 A;  3C5F A;  3C2M A;  2NRT A;  5EOZ A;  3ISC A;  1BPY A;  1X9W A;  1ZQK A;  1ZQD A;  5J0T A;  4BWM A;  1QLN A;  4M6W A;  4G3I A;  2PXI A;  4P4P A;  1RYS A;  1DOQ A;  2W9B A;  4QW9 A;  5L9X A;  3MDC A;  4J9L A;  3RH6 A;  5DB7 A;  4YXJ A;  3T5J A;  5J0U A;  2C22 A;  1NKC A;  3RRG A;  2VA3 A;  4NM1 A;  4DL2 A;  5J0Q A;  4J9S A;  4QW8 A;  9ICG A;  1TV9 A;  3H8S A;  1KTQ A;  3AUO A;  5HMM A;  1BPD A;  5J2G A;  5BOL A;  3PW2 A;  1ZQU A;  4UAW A;  7ICV A;  4QZE A;  4J9O A;  4QZD A;  2PI4 A;  5KFM A;  1LB2 B;  3OSP A;  7ICL A;  4TUR A;  4KLT A;  3OHA A;  1D9D A;  2C2E A;  3PW7 A;  3LWM A;  5KFK A;  1ZQB A;  4IR9 A;  4UB5 A;  3PR4 A;  4B9S A;  4I2C A;  2UVV A;  2DPJ A;  4YR3 A;  9ICX A;  1ZQV A;  4ED6 A;  1HUZ A;  5KT6 A;  2ZJA A;  5CA7 A;  5DG9 A;  1SL2 A;  4I28 A;  8ICP A;  2IA6 A;  5L1L A;  1HJP A;  4YG2 A;  1RZT A;  1MC8 A;  2XGP A;  3BDP A;  5KG6 A;  3BQT A;  3FYH A;  3LDA A;  1ZQM A;  4ELV A;  1LV5 A;  4RPX A;  8ICT A;  4F4Y A;  2W9M A;  4Q8E A;  1JMS A;  4I2D A;  4Z6C A;  2JEG A;  4RUC A;  5CWR A;  4YR0 A;  4J9P A;  3PMN A;  3Q8L A;  1NK5 A;  3GV5 B;  2PFQ A;  4EZ6 A;  4KLL A;  3NGD A;  4F2S A;  4I27 A;  3BQ1 A;  4MEX A;  4EYH B;  2AU0 A;  4B9T A;  7ICP A;  4PHE A;  3RJI A;  5HHH A;  4O9M A;  4QWA A;  5DLF A;  3IHQ B;  2R8I A;  7ICE A;  4YD2 A;  5KFU A;  5L1K A;  4RNO A;  4R66 A;  3JPP A;  4RT3 A;  1XS9 D;  1ZQQ A;  4C8O A;  5J2F A;  2AQ0 A;  2B21 A;  5IIN A;  3TAN A;  1Z3E B;  4R64 A;  2LYH A;  3ETL A;  2KTQ A;  4F5R A;  2XCA A;  4NLG A;  1RPL A;  8ICK A;  5DDM A;  2Q0Z X;  3RR8 A;  5J0P A;  2AGQ A; 
#chains in the Genus database with same CATH topology
 2AHO B;  2YQE A;  2LM1 A;  1S0M A;  2P6R A;  2ESE A;  4F91 B;  1ZQE A;  4C0Z A;  5D49 A;  4EEK A;  2E8N A;  4NWI A;  3GU3 A;  1CUK A;  3IV6 A;  1K5O A;  4I2A A;  9ICO A;  5GTH U;  2V4R A;  2H3Z A;  1QH9 A;  4IL6 U;  2GWS A;  3TI0 A;  3OTQ A;  2C28 A;  5DB9 A;  4MEY A;  8ICE A;  3OHB A;  3I28 A;  2RDJ A;  1O08 A;  4OJO A;  2BQ3 A;  4NLK A;  3OGU A;  5KFJ A;  4QWB A;  1DXS A;  3NUQ A;  1SGG A;  4B9N A;  3U26 A;  3L3F X;  2MUT B;  5ALU A;  2F1J A;  4O5K A;  2ZJ8 A;  5DLG A;  5HP4 A;  3SYZ A;  3EZ5 A;  3H40 A;  2RP5 A;  3ISD A;  4Y2T A;  4Y2V A;  3CRX A;  9ICP A;  4DFK A;  4IS7 A;  3M8R A;  4GLX A;  4K4H A;  2I5H A;  5AM1 A;  1QQ6 A;  5J2A A;  3UQ0 A;  3T79 A;  3EW9 A;  4NL9 C;  2FI1 A;  8ICA A;  3EYZ A;  2KVC A;  3BQ2 A;  2XY5 A;  3DEE A;  2NRV A;  2I9G A;  3MFH A;  3TAP A;  3V6J A;  3ICX A;  2DUY A;  4J9K A;  1X6J A;  3PX4 A;  5KG2 A;  2DQN B;  4BXO B;  2V9W A;  2EZX A;  4DSL A;  1Z19 A;  4C8K A;  3HJE A;  1SL1 A;  5F9N A;  5J0W A;  9ICS A;  5ALQ A;  1S77 D;  2KMD A;  3KFU F;  4P2H A;  3KHL A;  2A1J B;  2O6K A;  3HRD D;  3RF9 A;  4Z6F A;  3V72 A;  3H8J A;  4UBC A;  1ZQO A;  2BHN A;  9ICE A;  1VJ5 A;  1N56 A;  1SV4 A;  5CRX A;  5ALX A;  7ICH A;  2DF4 B;  3QZ8 A;  5KT3 A;  3RJF A;  2JEF A;  4NLC A;  4ELT A;  4NLB A;  1LVH A;  2B0C A;  1S97 A;  4J9N A;  1JUD A;  2YB4 A;  1ZD4 A;  5JRT A;  2BQR A;  3HPO A;  3BS5 A;  5ALI A;  4CDG A;  5TIS U;  4ED7 A;  2JRZ A;  1CRX A;  2OEH A;  1ARO P;  3KKA C;  4RQ0 A;  4Y2Y A;  3QX7 A;  5J2I A;  5AKY A;  5EE9 A;  1BPB A;  3T5H A;  4EEL A;  4QZH A;  3MR2 A;  2PKE A;  1SWV A;  2KV2 A;  2KIV A;  3CW2 C;  5ALN A;  5AM2 A;  4ED1 A;  3ZDA A;  2BGW A;  1T3N A;  3AU6 A;  4PHP A;  5KFQ A;  3GDX A;  4ACO A;  3OJS A;  5ALO A;  1J2N A;  2KNJ A;  2W03 A;  3JPT A;  2Z7J A;  2VA2 A;  2WAQ F;  4YCX A;  1L3S A;  5KG0 A;  2HMX A;  2KOB A;  1NK6 A;  2FMS A;  2HHV A;  3WKE A;  2AXT U;  3TKA A;  4F4Z A;  4JWN A;  5B5E U;  4ED0 A;  2EZZ A;  2WF5 A;  2BCV A;  3ZI4 A;  4TQR A;  5AKZ A;  2NRW A;  5DBB A;  4DLE A;  8ICL A;  4RPY A;  3C29 A;  2ZXI A;  1UCV A;  4DO9 A;  3MR3 A;  2BCS A;  1SXD A;  1X9X A;  4RQ2 A;  1U45 A;  5KTQ A;  3PSP A;  2JGA A;  4YP3 A;  3F2B A;  1OXJ A;  4UAS A;  5KNI A;  3IDW A;  5CB1 A;  3CP8 A;  1RYR A;  4GC6 A;  2VA8 A;  5J0Y A;  4GXI A;  3RR7 A;  3GIK A;  5KFZ A;  4PGX A;  2P66 A;  4O3Q A;  3H4B A;  5ALG A;  3RBE A;  4NXZ A;  1ZQW A;  4P0Q A;  4DL6 A;  2E3T A;  3KD3 A;  1H38 A;  2XID A;  4PH5 A;  4C8N A;  5L1J A;  3THV A;  4O5E A;  4TUS A;  2WF9 A;  5IIJ A;  5AI8 A;  3T5L A;  4O3S A;  4F4K A;  3T5K A;  4KLF A;  4LZD A;  2JZB B;  1T7P A;  2QB0 A;  3I76 A;  4RQ8 A;  5AIC A;  3FDS A;  2JEJ A;  4IQV A;  5KG4 A;  8ICH A;  2E1F A;  2G07 A;  4I2G A;  2HVI A;  4NLZ A;  9ICI A;  2KFN A;  4BGD A;  1M6Y A;  3PW5 A;  5KT5 A;  1IIP A;  3KHH A;  4FS2 A;  4OD0 A;  3PV8 A;  4DSJ A;  1JIH A;  3TQ1 A;  1U47 A;  2JMG A;  4DSF A;  3H0R B;  5G5H A;  3G6Y A;  1XSN A;  8ICX A;  1EXN A;  5AIA A;  4IQT A;  1ZQZ A;  4YMO A;  3B0X A;  3ETR A;  2IMW P;  5TZV A;  3GII A;  1L7M A;  3OJU A;  2C2R A;  1L6N A;  5III A;  3KHG A;  4KX5 A;  2F8L A;  3ZDD A;  2UVR A;  1NJW A;  4KX3 A;  1ZQX A;  4O3N A;  3N7P D;  4F4X A;  1ZQL A;  3PO5 A;  4IQU A;  2R8K A;  3ZDE A;  2KSO B;  5KFL A;  4UAY A;  1AQ6 A;  2HW3 A;  4KIT B;  1ED1 A;  4JB3 A;  4ECR A;  3NS1 A;  5EE3 A;  4PZO A;  2ZIX A;  5J2E A;  1JXL A;  4CF5 A;  1S8O A;  4ZOH C;  1KQQ A;  5EWF A;  3MGV A;  8ICV A;  3IG5 A;  4C8L A;  2H5X A;  5AKI A;  4DEZ A;  2W55 A;  2R8H A;  8ICR A;  3SAH A;  5HR7 A;  2W9C A;  3F2C A;  1U4B A;  2J6S A;  4KLU A;  4P4O A;  3SZ2 A;  3UQ2 A;  4DWI A;  4RQ3 A;  2YN4 A;  2KVS A;  5KFT A;  3MGH A;  1ZQR A;  5CP2 A;  3GIM A;  1TFR A;  2W7P A;  2LPE A;  4M04 A;  2PFN A;  2KJ8 A;  4Y2P A;  1KN5 A;  4RQ5 A;  2UVU A;  4DFD A;  1RDF A;  4J9Q A;  1D8B A;  4RQ4 A;  3L5K A;  2HHS A;  9ICT A;  3J81 j;  4Q45 A;  5ALK A;  5ALR A;  3C2L A;  4QZI A;  4F5P A;  4KMU A;  4NLN A;  4DQS A;  7ICF A;  4C7Y A;  4M0A A;  1K1S A;  5F3X B;  5AKE A;  1ZYQ A;  3C5F A;  2D8C A;  1ZQD A;  4BWM A;  4M6W A;  4P4P A;  1RYS A;  5DB7 A;  2F44 A;  2HI0 A;  3RRG A;  1XO0 A;  9ICG A;  4J9S A;  1TV9 A;  1SXE A;  5HMM A;  2QAR A;  2FDR A;  1S5L U;  4F71 A;  4QZD A;  1WWV A;  3OHA A;  1D9D A;  3AL0 B;  5AI6 A;  2WB1 C;  3QU2 A;  3LWM A;  5KFK A;  5AM4 A;  3PW7 A;  4UB5 A;  2C2E A;  1F0M A;  4I2C A;  2K4P A;  2DPJ A;  4YR3 A;  1JI7 A;  4FZM A;  5DG9 A;  1SL2 A;  8ICP A;  2IA6 A;  5L1L A;  1RZT A;  1MC8 A;  1Z1B A;  1ZQM A;  1UHU A;  4OO1 J;  4YR0 A;  3PMN A;  4F2S A;  4PHE A;  3IHQ B;  4YD2 A;  4IC9 A;  1XS9 D;  5KL8 B;  2AQ0 A;  2NO4 A;  2B21 A;  5IIN A;  4R64 A;  3ETL A;  2KP7 A;  8ICK A;  2LKY A;  5AI4 A;  4MFA A;  2WF8 A;  3DV9 A;  1O03 A;  7ICS A;  4C80 A;  4YXM A;  4B9U A;  2ISO A;  1FFV A;  2KK0 A;  5ALY A;  1ZQI A;  4FS1 A;  4LJX A;  5AM0 A;  1L3V A;  3PSF A;  1CEZ A;  5AK5 A;  4YN4 A;  3SQI A;  8ICM A;  1N61 A;  5G5G A;  3C1Z A;  1RQL A;  1RQN A;  1ZQY A;  2EDU A;  3RH5 A;  2ATL A;  4TUQ A;  4BDP A;  2GH1 A;  2YMM A;  2VJ4 A;  1KSP A;  1ZQA A;  2BDU A;  2EAP A;  1XC9 A;  5L1I A;  2NRX A;  3F53 A;  4GXJ A;  3EPG A;  1TAM A;  8ICW A;  4RZR A;  3LYS A;  1MSW D;  1S9F A;  9ICV A;  2EAM A;  4DFJ A;  5KFB A;  5IIK A;  4B9V A;  4RT2 A;  8ICJ A;  3QEA Z;  3H0M B;  2IOH A;  4EYI B;  3QE9 Y;  7ICM A;  3QZ7 A;  4P0Q B;  8ICQ A;  3BZC A;  5KFR A;  4QZF A;  1JN3 A;  5J2B A;  1NKE A;  1Z4N A;  2H3I A;  4MF8 A;  4DOB A;  3KOO A;  1ZQP A;  4M9N A;  9ICB A;  5EE0 A;  4O3M A;  3RJE A;  1PVR A;  1SV0 A;  4R63 A;  4LZG A;  1ZQJ A;  1X9S A;  5EWG A;  3QUQ A;  2I1Q A;  5IIL A;  4EBE A;  2L5Y A;  4G9B A;  2KZZ A;  3WKC A;  4C4R A;  3V7K A;  1MQ3 A;  9ICW A;  4JK1 A;  2IBK A;  2OM6 A;  4EX6 A;  4F4W A;  2NV3 A;  3TAD A;  3H8M A;  2F2A B;  4JUZ A;  1X42 A;  3KBB A;  4KLD A;  5J2J A;  2XI9 A;  3HW8 A;  2E8P A;  5D46 A;  4UAZ A;  1COK A;  2XIC A;  5EE1 A;  3JPS A;  4ECU A;  5J8Y A;  5ALE A;  4UQG A;  3SAF A;  3UMG A;  1BVS A;  5KFC A;  2KEY A;  5KFN A;  1PK3 A;  8ICZ A;  1F44 A;  4M47 A;  4RQ6 A;  4XUS A;  2FLN A;  5DBA A;  9ICQ A;  5KFE A;  3AU2 A;  3MR6 A;  1KRP A;  3AN1 A;  4KN7 A;  2W9C B;  3E2E A;  3RH4 A;  9ICN A;  3OSN A;  2KZM A;  8ICO A;  4I2H A;  4ECS A;  4YMN A;  2AGP A;  1LKY B;  3UXN A;  5DQH A;  2HHX A;  4Q43 A;  2ZIW A;  4Q44 A;  4ECZ A;  3GIL A;  2C2D A;  4RNN A;  3UMC A;  3TFS A;  1ZQN A;  3M7D A;  3A0H U;  2BR0 A;  2MAX A;  1PK1 B;  3PX6 A;  4KN4 A;  4O5C A;  5HR6 A;  1V9P A;  2K8B B;  3PX0 A;  4DSE A;  1MQ2 A;  2OHF A;  4KLS A;  5KG5 A;  2ALZ A;  4IRC A;  5AK4 A;  1V38 A;  5DGA A;  1FEZ A;  4I2E A;  4OCZ A;  1B43 A;  3M8S A;  4DLG A;  3QNM A;  3BZK A;  1ZD3 A;  1BGX T;  1SWW A;  4KLJ A;  1PZN A;  5D4B A;  4NV0 A;  4CF4 A;  5DB8 A;  2W54 A;  1TK8 A;  4JV2 A;  2W9A A;  3TAR A;  2PFP A;  2BCU A;  1ZJM A;  5DG7 A;  4O3O A;  5IIO A;  1SZH A;  4EBD A;  1RXW A;  4C4S A;  5L1M A;  3RBD A;  1YT3 A;  4M9L A;  1NK9 A;  5F9L A;  2W3R A;  4F8R A;  2KJ9 A;  3H8W A;  3BJY A;  1IM4 A;  2LYA A;  3C23 A;  3ALR A;  1KL9 A;  1OUQ A;  1S0V A;  9ICA A;  3PST A;  4KMO B;  7ICT A;  3PNC A;  1XU4 A;  3EPI A;  2PFO A;  4F3O A;  4Z6E A;  3B0Y A;  1WYG A;  1PVQ A;  4IRD A;  2R8J A;  1Z00 A;  7ICI A;  9ICK A;  5KT2 A;  1NK7 A;  1WWU A;  5ALZ A;  3EUB 2;  3C2K A;  4P0P A;  4F2R A;  4ECQ A;  4FZL A;  1U48 A;  4ED8 A;  2QKQ A;  5DDY A;  4FZN A;  3TFR A;  2LHT A;  3WK5 A;  1KLN A;  1S10 A;  3BQ7 A;  3MR5 A;  1Q3V A;  1JXE A;  4UW9 A;  4M9G A;  3SR6 A;  3CNH A;  2BKE A;  1COO A;  4DL7 A;  5KFX A;  1SIJ A;  5AKK A;  3T3F A;  2W04 A;  2EAN A;  4RPZ A;  4EBC A;  1Z4O A;  2DPI A;  4IQW A;  3JPR A;  3VCB A;  4Y2S A;  4ECT A;  5FP0 A;  1DGS A;  4QIW C;  2QLT A;  7ICU A;  2DKZ A;  5J2H A;  3RB0 A;  2YMQ A;  7ICG A;  2K8A A;  2M9N A;  2ZIU A;  3C28 A;  3D6J A;  3SI8 A;  2DKX A;  4AYB C;  2GO7 A;  4DF8 A;  2BZF A;  4XRH A;  4ELU A;  5ALT A;  2RHF A;  2W9B B;  1JRP A;  1FIQ A;  4ED2 A;  3I1Y A;  1L7N A;  3LVV A;  2PXI A;  1F5S A;  2OXO A;  3M1Y A;  2JR5 A;  2VA3 A;  5AKJ A;  2K60 A;  1KTQ A;  4Y2X A;  2DWQ A;  1BPD A;  3PW2 A;  7ICV A;  4J9O A;  5KFM A;  1QCK A;  4CNQ A;  1LB2 B;  4TUR A;  2K4I A;  1ZQB A;  2UVV A;  1ZQV A;  5CA7 A;  2K8C B;  1HJP A;  1YZ7 A;  2JV3 A;  5ALD A;  1NZP A;  3BDP A;  3LDA A;  4ELV A;  4OJ5 A;  4Y2J A;  4Q8E A;  4I2D A;  4Z6C A;  2JEG A;  5CWR A;  1NK5 A;  4J9P A;  3B9J A;  4EZ6 A;  3K1Z A;  1GO3 F;  3WKB A;  3WK9 A;  3E58 A;  5HHH A;  3RJI A;  2RQ5 A;  2R8I A;  3HIL A;  5L1K A;  1C20 A;  4RT3 A;  1V97 A;  2HDO A;  2K4H A;  2VKQ A;  2LYH A;  2KTQ A;  1YZ6 A;  2MRL A;  3SMV A;  2XCA A;  4RQN A;  3S6J A;  2Q0Z X;  2KZ3 A;  1QSS A;  5CJ7 A;  7ICO A;  2V4Q A;  4DL5 A;  4I2F A;  4ECX A;  2E5S A;  1QTM A;  3AQF A;  5AK3 A;  3RJJ A;  1ZD5 A;  1D9F A;  2G08 A;  1J2M A;  4QZA A;  4QWD A;  3MDA A;  3NAS A;  3VC8 A;  1ZQC A;  4O0I A;  2OWO A;  5AI9 A;  3NRW A;  4OJ6 A;  3GIJ A;  2BPF A;  1KEJ A;  9ICL A;  1ZJN A;  2F77 X;  4ECY A;  3SV4 A;  3Q8R B;  2K4E A;  2P35 A;  3UPQ A;  2W7O A;  4MHV A;  4US9 A;  1TE2 A;  1UQV A;  1Y88 A;  1B22 A;  5AIB A;  4U6P A;  4KLH A;  4F93 B;  3AM9 A;  2LYB A;  3EWA A;  2MU2 A;  4DL4 A;  1IXR A;  1KFS A;  1BPX A;  2HHT A;  3H0L B;  5ALS A;  2KFZ A;  3PZP A;  7ICQ A;  2YTU A;  1Q3U A;  5AM3 A;  2BCQ A;  2WF6 A;  2HBJ A;  2I6X A;  1VLB A;  3V6H A;  2EAO A;  5CHG A;  2KKV A;  1L3U A;  1DK3 A;  3PW4 A;  5KAI U;  1WCN A;  5ALP A;  4BXO A;  3GV8 B;  3ISB A;  5KFV A;  4K4I A;  5DQI A;  1X66 A;  1NOM A;  3IG8 A;  3ZD9 A;  4F5O A;  3DDH A;  4JV0 A;  3WU2 U;  4JV1 A;  1ZRN A;  4EX7 A;  1KKX A;  2ODG A;  1WG8 A;  9ICU A;  1N60 A;  2A1J A;  4WJ3 B;  3BS5 B;  1U49 A;  3ORY A;  5AK6 A;  4B9L A;  2PMZ F;  1ZQF A;  1SKR A;  2Y9U A;  5AM5 A;  4GXK A;  4C8M A;  4XA5 A;  2KKP A;  4DL3 A;  1X2I A;  3C1Y A;  1A76 A;  2G0A A;  8ICS A;  4F92 B;  4X5V A;  1L8L A;  3F5E A;  4DQR A;  3M9N B;  4NJ8 A;  3C5G A;  3SEN A;  2W8K A;  4ECV A;  5KFY A;  1KW4 A;  3C21 A;  3UXO A;  1NKB A;  3V7L A;  2F1H A;  3H4D A;  2ZUB A;  2Y0S C;  2J6U A;  4PGY A;  5DB6 A;  8ICG A;  4GFJ A;  4ZH4 A;  4QZB A;  3D2S A;  2BCR A;  5J0O A;  2MSN A;  1BNP A;  2KIC A;  3RJK A;  1ZQ1 C;  2HVH A;  3ONN A;  5BOM A;  3PR5 B;  4KLI A;  1X40 A;  3SD7 A;  3WK6 A;  1B4F A;  2BPG A;  5KG7 A;  1TK0 A;  4ICA A;  1DK2 A;  3HKZ F;  3Q8P B;  1XSP A;  5KFD A;  2ZUD A;  2FMQ A;  1PUZ A;  1L5U A;  2W43 A;  3Q8Q B;  2ISP A;  2FLL A;  2EZY A;  4RNM A;  3AQE A;  2DGZ A;  5ALL A;  1D8Y A;  2Y1I A;  2ZTE A;  3AEV A;  2W11 A;  3M6K A;  3ED5 A;  5AKG A;  7ICK A;  2QB0 B;  2K89 A;  2W3S A;  3N28 A;  1BPZ A;  5HHI A;  2MA1 A;  4QZC A;  3N4M B;  2F76 X;  3ZDC A;  5DQG A;  1QSL A;  5ALJ A;  2KG5 A;  4E0D A;  2HCF A;  5KFA A;  4LVS A;  2UVW A;  2J6T A;  4UAU A;  2JZB A;  1TVA A;  5AI5 A;  2D3D A;  4UB8 U;  1X6I A;  4YMM A;  5AHX A;  3HT3 A;  1SV0 C;  2GLE A;  2FPM A;  3IRU A;  1RYU A;  4GIB A;  2W8L A;  2FMP A;  3N7R C;  4QNL A;  4YQW A;  2VAN A;  8ICY A;  2ZXH A;  3PY8 A;  4DSI A;  3BQ0 A;  3M9O B;  3KTQ A;  3IM1 A;  1OW5 A;  3GFK B;  3JPO A;  2F8K A;  2BQU A;  2JEI A;  2OYY A;  2R8G A;  3TAD C;  3V7J A;  4TUP A;  2F1I A;  3LK9 A;  3Q8M A;  2ZIX B;  5J2C A;  4PZN A;  4UB6 U;  1JRO A;  4KLE A;  3PML A;  1URJ A;  3G6X A;  3UM9 A;  4PPX A;  1L8O A;  3RB3 A;  3N7S C;  2H3Q A;  3Q8K A;  4QZ9 A;  4DS4 A;  3N97 B;  2ZG6 A;  2KSO A;  5KFO A;  2H3F A;  1ZQT A;  5J8Y C;  3HX0 A;  2CXY A;  4PGQ A;  1CI4 A;  1K1Q A;  3V6K A;  1RXV A;  4EZ9 A;  4DF4 A;  4QZG A;  2RDI A;  2FPL A;  4O3P A;  3JPN A;  4ED3 A;  2JH7 A;  3OPX A;  1KFT A;  2FPK A;  1JX4 A;  4Y2U A;  1NJZ A;  1N5W A;  4NL9 A;  4UB3 A;  5KL1 B;  4R8U A;  5DGB A;  1FO4 A;  2N1R A;  1A0P A;  4NY8 A;  2WAQ C;  4BWJ A;  4DS5 A;  5ALW A;  4RQ7 A;  2WHE A;  3NVZ A;  4DFM A;  5J0X A;  1ZQS A;  2YX8 A;  1T4G A;  1HIW A;  5KFI A;  2HSZ A;  4IR1 A;  1NJX A;  4QWC A;  3GV7 B;  4YR2 A;  1NJY A;  1RG6 A;  2OH2 A;  4M6W B;  1HUO A;  5J2D A;  2ASL A;  2G06 A;  1FFU A;  2NRT A;  5EOZ A;  3K1R B;  1KBU A;  4CGZ A;  1BPY A;  2QAR B;  1DOQ A;  4QW9 A;  5L9X A;  3MDC A;  4J9L A;  3RH6 A;  3CYM A;  2HOI A;  4YXJ A;  3T5J A;  2C22 A;  1NKC A;  4NM1 A;  1MN8 A;  2Q4T A;  3SAG A;  3H8S A;  3AUO A;  1SB3 C;  5J2G A;  5BOL A;  4QZE A;  3QU4 A;  2CN1 A;  5T14 A;  7ICL A;  4KLT A;  2KD1 A;  4IR9 A;  3PR4 A;  2F3N A;  1NI3 A;  4ED6 A;  1HUZ A;  3KKA A;  3QU9 A;  2XGP A;  5KG6 A;  3BQT A;  2OCE A;  4PL2 A;  8ICT A;  4F4Y A;  2W9M A;  5ALF A;  3UMB A;  3WK7 A;  4OJP A;  3GV5 B;  4KLL A;  3NGD A;  2NYV A;  4I27 A;  3BQ1 A;  5B66 U;  3QUT A;  1P7D A;  4MEX A;  4B9T A;  5C0Y A;  7ICP A;  4QWA A;  4USA A;  2A3V A;  7ICE A;  5KFU A;  5H2F U;  4RNO A;  1J97 A;  1A6S A;  1ZQQ A;  4CE6 A;  5K4L A;  1Z3E B;  3AMZ A;  4F5R A;  2A1A A;  1B0X A;  4NLG A;  1T3Q A;  5J0P A;  1HEK A;  1N2X A;  5KT7 A;  2XY7 A;  1ZRM A;  2LBO A;  8ICU A;  4F72 A;  5CEH A;  4C7Z A;  5KFH A;  3UXP A;  3PW0 A;  3QU5 A;  2G09 A;  3RFA A;  1N63 A;  8ICB A;  4HAI A;  3NVV A;  3JPQ A;  2HBK A;  3NVY A;  3KZI U;  2KIW A;  2BDP A;  1NK0 A;  1TAQ A;  1ZD2 P;  4MFC A;  1S0N A;  4DQQ A;  1TKD A;  1S76 D;  2DFL A;  4OJL A;  1TAU A;  3PSI A;  3RB6 A;  3RJG A;  5EWE A;  2PI5 A;  1T8E A;  2IHM A;  5AKH A;  3BS7 A;  3RB4 A;  4NM2 A;  3MBY A;  4U7C A;  4EEN A;  2AH5 A;  5A0L A;  1L7O A;  2ZTD A;  1SL0 A;  4Y2Q A;  4J9M A;  4UB2 A;  5KFP A;  1SKS A;  4YVZ A;  1MA7 A;  2FE9 A;  1SZP A;  1JAL A;  2WFA A;  1UA1 A;  1S0O A;  3FM9 A;  2IHN A;  2VJ5 A;  4DQP A;  2JH1 A;  5BPC A;  3L4P A;  2NRZ A;  5J0S A;  3D2N A;  2A19 A;  2B6G A;  1L3T A;  3RJH A;  5AKX A;  4KLQ A;  4RQM A;  4JMU A;  4J9R A;  2RLT A;  4B9M A;  1DGJ A;  1WCL A;  3M9M B;  2ZJ5 A;  1SKW A;  2ZIV A;  4XQ8 A;  3MC1 A;  4Y2R A;  2HOF A;  3ZDB A;  5JUM A;  4FE3 A;  9ICF A;  5KFF A;  2NO5 A;  4UB4 A;  4DSK A;  4I29 A;  3H7I A;  1TK5 A;  4QZ8 A;  4FBT A;  4UB1 A;  1N62 A;  3SV3 A;  2ASD A;  1NK4 A;  5J2K A;  4RU9 A;  5IIM A;  2BPC A;  2RRD A;  2KJ5 A;  1Z1V A;  8ICI A;  9ICJ A;  8ICC A;  4Q8F A;  1KDH A;  1KFD A;  4AP9 A;  2G5I B;  7ICR A;  1DRG A;  4GC7 A;  2ZTC A;  3WKD A;  5GTI U;  4KLO A;  3O0F A;  1D8L A;  4JWM A;  3WK8 A;  1ZOL A;  4MF2 A;  2YB1 A;  3ZD8 A;  2XVT A;  3Q8S B;  4EEY A;  1ZQG A;  4R65 A;  1QSY A;  7ICN A;  4KTQ A;  4HYK A;  4F5N A;  3E0F A;  4UAT A;  1X9M A;  3RTV A;  3QXG A;  4PL1 A;  3FAH A;  2JHD A;  4QIW F;  4O3R A;  2PMZ C;  3LVW A;  1XWL A;  2FLP A;  4F5Q A;  4RQ1 A;  3NVW A;  2D6F C;  2HHU A;  4Z6D A;  2ZIW B;  4AYB F;  3NTU A;  1UT5 A;  3QUB A;  2AJQ A;  3HP6 A;  1UT8 A;  5CR0 A;  1L7P A;  2ASJ A;  3K75 D;  4R8U B;  3MAB A;  5KT4 A;  5C5J A;  2DL0 A;  2ZUC A;  2XO7 A;  4FO6 A;  4MFF A;  2MUT A;  1LKY A;  4BUG A;  1XSL A;  2HHW A;  1ZET A;  1XO1 A;  5JTI A;  3QEB Z;  3FC4 A;  1RM6 C;  2YY6 A;  2AGO A;  1V85 A;  2CPR A;  5J29 A;  4IRK A;  4DQI A;  1PK1 A;  3PO4 A;  5KFW A;  3SEI A;  1UA0 A;  2CRX A;  2XY6 A;  5KAF U;  2JXJ A;  1QQ7 A;  4YFK A;  1XNS A;  4ECW A;  9ICH A;  3HKZ C;  2WF7 A;  4KLM A;  2Y1J A;  3QYP A;  4F50 A;  3TAQ A;  5DBC A;  2QB1 A;  4I2I A;  1NNL A;  2ES6 A;  9ICC A;  5DG8 A;  4DCC A;  3KHR A;  2YMP A;  4DFP A;  2H3V A;  3MGI A;  9ICR A;  3MFI A;  4DOA A;  2VIX A;  2LI6 A;  3GQC A;  2AQ4 A;  4I2B A;  4TQS A;  8ICN A;  4CCH A;  5KG3 A;  4B6J A;  3KZX A;  1PVP A;  3QUC A;  2KN7 A;  4QWE A;  4M2Y A;  1U9L A;  4PHA A;  3NRZ A;  3R9K A;  2XCP A;  3IP4 B;  1NZB A;  5E79 U;  2XGQ A;  3LWL A;  5KG1 A;  2E8M A;  4M9J A;  1C7Y A;  1QQ5 A;  4J03 A;  1ECW A;  5DKW A;  1Z00 B;  1ZQH A;  1N5X A;  1N48 A;  2HBM A;  4P0P B;  4DOC A;  1UPH A;  2E1E A;  2HHQ A;  3RRH A;  2XC9 A;  1BPE A;  1NK8 A;  2GOL A;  4M9H A;  5ALH A;  2HOQ A;  4FFD A;  1WUD A;  2IOF K;  4PHD A;  1BNO A;  4UBB A;  5KFG A;  3WK4 A;  4KLG A;  3D2Q A;  3HWT A;  4YD1 A;  4CRX A;  4P4M A;  9ICM A;  3K4G A;  2P6U A;  2M0N A;  5JU5 A;  4K4G A;  4A8E A;  5AKL A;  5J0R A;  3RAQ A;  2EQY A;  1ZXI A;  3A0B U;  2ZIU B;  2E8O A;  8ICF A;  2LM4 A;  3WKA A;  7ICJ A;  3G6V A;  2R18 A;  5ALM A;  3F5A A;  4RUA A;  2Y9T A;  4PJ0 U;  1Q46 A;  2KHQ A;  2WB1 F;  4FBU A;  5HNK A;  3RAX A;  4UAV A;  1A77 A;  5KFS A;  4I2J A;  3GZF A;  5HML A;  4BJQ A;  2KE7 A;  2WTF A;  3PVX A;  2FJ6 A;  3C2M A;  3ISC A;  1X9W A;  1ZQK A;  5J0T A;  3F2D A;  1QLN A;  4G3I A;  2G5H B;  2W9B A;  5J0U A;  5ALV A;  2ZIV B;  4DL2 A;  5J0Q A;  4QW8 A;  2DBY A;  3TAC B;  1ZQU A;  4UAW A;  2PI4 A;  3QU7 A;  4BX9 C;  3OSP A;  4US8 A;  4B9S A;  2KHV A;  9ICX A;  4C4T A;  4QJF B;  2EH9 A;  5KT6 A;  2ZJA A;  4I28 A;  1Q8K A;  4YG2 A;  4UAR A;  2YML A;  3FYH A;  1LV5 A;  4RPX A;  2IOF A;  4CF3 A;  1VDV A;  1JMS A;  4RUC A;  3Q8L A;  2PFQ A;  2Y0S F;  1T94 A;  1IG6 A;  1IV8 A;  4EYH B;  2AU0 A;  4O9M A;  5DLF A;  2LMR A;  4R66 A;  3JPP A;  4C8O A;  5J2F A;  3IN5 A;  3M6Z A;  5AI0 A;  3TAN A;  2HBL A;  1RPL A;  5DDM A;  3RR8 A;  2AGQ A; 
#chains in the Genus database with same CATH homology
 2KZ3 A;  1QSS A;  5KT7 A;  1S0M A;  5CJ7 A;  2P6R A;  2XY7 A;  7ICO A;  2V4Q A;  4MFA A;  4F91 B;  4DL5 A;  4I2F A;  1ZQE A;  8ICU A;  7ICS A;  4ECX A;  5D49 A;  4YXM A;  4B9U A;  2ISO A;  5KFH A;  3UXP A;  3PW0 A;  1QTM A;  1ZQI A;  4FS1 A;  1CUK A;  3RJJ A;  8ICB A;  1L3V A;  4I2A A;  3JPQ A;  1CEZ A;  9ICO A;  2V4R A;  4YN4 A;  1D9F A;  4QZA A;  4QWD A;  3TI0 A;  2GWS A;  2BDP A;  1NK0 A;  1TAQ A;  2C28 A;  3MDA A;  8ICM A;  5DB9 A;  1ZQC A;  3C1Z A;  4O0I A;  4MEY A;  4MFC A;  8ICE A;  1S0N A;  2OWO A;  1ZQY A;  3RH5 A;  3OHB A;  4DQQ A;  2ATL A;  1TKD A;  1S76 D;  4TUQ A;  2RDJ A;  2DFL A;  4BDP A;  1TAU A;  2BQ3 A;  4NLK A;  3OGU A;  3RB6 A;  3GIJ A;  1KSP A;  3RJG A;  5KFJ A;  5EWE A;  4QWB A;  1ZQA A;  2BPF A;  1KEJ A;  2PI5 A;  9ICL A;  1ZJN A;  1XC9 A;  4ECY A;  1T8E A;  5L1I A;  2NRX A;  3SV4 A;  2IHM A;  3Q8R B;  4B9N A;  2MUT B;  3UPQ A;  3RB4 A;  4NM2 A;  3MBY A;  4GXJ A;  3EPG A;  2F1J A;  4O5K A;  8ICW A;  2ZJ8 A;  1Y88 A;  2ZTD A;  1SL0 A;  4RZR A;  1B22 A;  5DLG A;  4KLH A;  4F93 B;  5HP4 A;  4J9M A;  1MSW D;  3SYZ A;  1S9F A;  3EZ5 A;  3H40 A;  4UB2 A;  3EWA A;  9ICV A;  5KFP A;  4DL4 A;  3ISD A;  1IXR A;  1SKS A;  9ICP A;  4DFJ A;  4YVZ A;  4DFK A;  1BPX A;  5KFB A;  1KFS A;  2HHT A;  1SZP A;  3M8R A;  5IIK A;  4GLX A;  4RT2 A;  4B9V A;  4K4H A;  8ICJ A;  2KFZ A;  1UA1 A;  3QEA Z;  1S0O A;  2IHN A;  4DQP A;  5J2A A;  3UQ0 A;  7ICQ A;  3EW9 A;  5BPC A;  8ICA A;  4EYI B;  2NRZ A;  3QE9 Y;  3EYZ A;  7ICM A;  5J0S A;  3BQ2 A;  3QZ7 A;  1L3T A;  2BCQ A;  8ICQ A;  2XY5 A;  2NRV A;  5KFR A;  4QZF A;  2I9G A;  1JN3 A;  3RJH A;  5J2B A;  3MFH A;  3TAP A;  1NKE A;  3V6J A;  4J9K A;  4MF8 A;  4KLQ A;  4DOB A;  3PX4 A;  1ZQP A;  5KG2 A;  4J9R A;  4BXO B;  4M9N A;  3V6H A;  9ICB A;  2V9W A;  5CHG A;  4B9M A;  1WCL A;  1L3U A;  4DSL A;  3M9M B;  4C8K A;  2ZJ5 A;  3RJE A;  1SKW A;  3PW4 A;  1SL1 A;  4R63 A;  4LZG A;  1WCN A;  4XQ8 A;  1X9S A;  1ZQJ A;  5F9N A;  5EWG A;  5J0W A;  3ZDB A;  4BXO A;  3GV8 B;  1S77 D;  2I1Q A;  9ICS A;  3ISB A;  5JUM A;  9ICF A;  5KFF A;  5KFV A;  5IIL A;  4EBE A;  4K4I A;  4UB4 A;  5DQI A;  4P2H A;  1NOM A;  3KHL A;  3ZD9 A;  4DSK A;  4F5O A;  3H7I A;  1TK5 A;  2A1J B;  4JV0 A;  4QZ8 A;  4I29 A;  3V7K A;  1MQ3 A;  2KZZ A;  4FBT A;  4UB1 A;  4Z6F A;  3V72 A;  3H8J A;  4UBC A;  1ZQO A;  4JV1 A;  2ASD A;  3SV3 A;  1NK4 A;  9ICW A;  5J2K A;  2BHN A;  4RU9 A;  5IIM A;  9ICE A;  2BPC A;  1N56 A;  4JK1 A;  9ICU A;  2IBK A;  7ICH A;  8ICI A;  9ICJ A;  2A1J A;  4F4W A;  3QZ8 A;  1U49 A;  3ORY A;  8ICC A;  5KT3 A;  4Q8F A;  3RJF A;  4B9L A;  1KDH A;  1KFD A;  2JEF A;  4JUZ A;  4ELT A;  7ICR A;  1S97 A;  4J9N A;  2BQR A;  1SKR A;  1ZQF A;  3HPO A;  4GC7 A;  4GXK A;  4C8M A;  2ZTC A;  4XA5 A;  4KLD A;  4DL3 A;  1X2I A;  3C1Y A;  4KLO A;  5J2J A;  4ED7 A;  3HW8 A;  1A76 A;  1ARO P;  4RQ0 A;  1D8L A;  4JWM A;  4MF2 A;  4F92 B;  8ICS A;  5J2I A;  5D46 A;  4UAZ A;  4X5V A;  3JPS A;  3ZD8 A;  4ECU A;  4DQR A;  1BPB A;  3M9N B;  3T5H A;  4QZH A;  3MR2 A;  4UQG A;  3C5G A;  3Q8S B;  2W8K A;  4EEY A;  4ECV A;  5KFY A;  1BVS A;  5KFC A;  5KFN A;  3C21 A;  4R65 A;  3UXO A;  4ED1 A;  1ZQG A;  2BGW A;  1QSY A;  1T3N A;  3ZDA A;  7ICN A;  3AU6 A;  4PHP A;  1NKB A;  4HYK A;  4F5N A;  3V7L A;  5KFQ A;  4RQ6 A;  4KTQ A;  4XUS A;  2FLN A;  4M47 A;  3GDX A;  1X9M A;  2F1H A;  5DBA A;  3RTV A;  3OJS A;  3H4D A;  2ZUB A;  9ICQ A;  5KFE A;  3AU2 A;  2J6U A;  3MR6 A;  1KRP A;  4PGY A;  3JPT A;  5DB6 A;  2VA2 A;  8ICG A;  4YCX A;  4O3R A;  1L3S A;  4KN7 A;  5KG0 A;  2W9C B;  4ZH4 A;  3E2E A;  3RH4 A;  1XWL A;  4QZB A;  3OSN A;  4F5Q A;  2BCR A;  4RQ1 A;  1NK6 A;  2FLP A;  2FMS A;  2KZM A;  2HHV A;  8ICO A;  5J0O A;  4I2H A;  4F4Z A;  4JWN A;  2HHU A;  4Z6D A;  4ECS A;  4ED0 A;  4YMN A;  3RJK A;  2BCV A;  4TQR A;  2AGP A;  2NRW A;  3NTU A;  1UT5 A;  5DBB A;  2HVH A;  4DLE A;  2AJQ A;  8ICL A;  4RPY A;  5BOM A;  3PR5 B;  3HP6 A;  1UT8 A;  4KLI A;  3UXN A;  5CR0 A;  4DO9 A;  2ASJ A;  5DQH A;  3MR3 A;  2BPG A;  5KG7 A;  2BCS A;  1TK0 A;  3K75 D;  2HHX A;  4Q43 A;  4R8U B;  3MAB A;  5KT4 A;  3Q8P B;  4RQ2 A;  1U45 A;  5C5J A;  4Q44 A;  2ZUC A;  2XO7 A;  3GIL A;  4ECZ A;  4FO6 A;  4MFF A;  1XSP A;  5KTQ A;  2MUT A;  5KFD A;  2C2D A;  2ZUD A;  4RNN A;  1XSL A;  2HHW A;  1ZET A;  2FMQ A;  3TFS A;  1ZQN A;  1XO1 A;  2BR0 A;  1L5U A;  2MAX A;  4YP3 A;  3PX6 A;  4KN4 A;  3QEB Z;  4O5C A;  1V9P A;  3Q8Q B;  3PX0 A;  2AGO A;  5CB1 A;  1RYR A;  2ISP A;  5J29 A;  4DSE A;  1MQ2 A;  4GC6 A;  4IRK A;  2VA8 A;  2FLL A;  4DQI A;  5J0Y A;  4GXI A;  4RNM A;  3RR7 A;  9ICN A;  4KLS A;  3GIK A;  1D8Y A;  5KFZ A;  3PO4 A;  4PGX A;  5KG5 A;  2Y1I A;  2ZTE A;  2ALZ A;  2P66 A;  5KFW A;  4O3Q A;  4IRC A;  5DGA A;  3H4B A;  1UA0 A;  4I2E A;  2XY6 A;  3RBE A;  1B43 A;  3M8S A;  4NXZ A;  4DLG A;  1ZQW A;  4DL6 A;  1H38 A;  4PH5 A;  7ICK A;  4YFK A;  4C8N A;  5L1J A;  4ECW A;  3THV A;  4O5E A;  9ICH A;  1BGX T;  4KLJ A;  1PZN A;  4TUS A;  5IIJ A;  1BPZ A;  4KLM A;  3T5L A;  4O3S A;  2Y1J A;  4F4K A;  5D4B A;  4F50 A;  3TAQ A;  3T5K A;  5DBC A;  5DB8 A;  4KLF A;  1TK8 A;  5HHI A;  4I2I A;  4QZC A;  4LZD A;  2JZB B;  3N4M B;  1T7P A;  4JV2 A;  3ZDC A;  5DQG A;  4RQ8 A;  1QSL A;  2W9A A;  3FDS A;  5DG8 A;  2JEJ A;  9ICC A;  4IQV A;  4E0D A;  5KG4 A;  8ICH A;  5KFA A;  3KHR A;  4LVS A;  4I2G A;  4DFP A;  3TAR A;  2PFP A;  3MGI A;  2BCU A;  2UVW A;  9ICR A;  1ZJM A;  2J6T A;  5DG7 A;  2JZB A;  3MFI A;  4DOA A;  1TVA A;  4O3O A;  2HVI A;  5IIO A;  3GQC A;  2AQ4 A;  4EBD A;  1RXW A;  4TQS A;  4I2B A;  4NLZ A;  4CCH A;  2KFN A;  8ICN A;  5KG3 A;  3RBD A;  4M9L A;  4BGD A;  9ICI A;  1NK9 A;  5F9L A;  3PW5 A;  5KT5 A;  2KN7 A;  4QWE A;  4M2Y A;  3KHH A;  1U9L A;  4PHA A;  4FS2 A;  4F8R A;  3PV8 A;  4DSJ A;  4YMM A;  1JIH A;  2XCP A;  3HT3 A;  3TQ1 A;  2FPM A;  2FMP A;  2W8L A;  1U47 A;  2XGQ A;  3H8W A;  4YQW A;  3LWL A;  2VAN A;  3BJY A;  4DSF A;  5KG1 A;  1IM4 A;  3C23 A;  8ICY A;  3G6Y A;  4M9J A;  1S0V A;  9ICA A;  1C7Y A;  1XSN A;  8ICX A;  7ICT A;  3PY8 A;  1EXN A;  4DSI A;  4IQT A;  1ZQZ A;  4YMO A;  3BQ0 A;  5DKW A;  3PNC A;  1Z00 B;  3M9O B;  3KTQ A;  3B0X A;  3IM1 A;  2IMW P;  3GFK B;  3JPO A;  1XU4 A;  2BQU A;  5TZV A;  3EPI A;  3GII A;  1ZQH A;  2JEI A;  3OJU A;  2C2R A;  2PFO A;  2R8G A;  4F3O A;  5III A;  4Z6E A;  3KHG A;  3V7J A;  3ZDD A;  1N48 A;  3B0Y A;  4IRD A;  2R8J A;  1Z00 A;  7ICI A;  9ICK A;  4DOC A;  1NJW A;  4TUP A;  2UVR A;  2F1I A;  3LK9 A;  5KT2 A;  3Q8M A;  1NK7 A;  1ZQX A;  4O3N A;  5J2C A;  3RRH A;  1ZQL A;  4F4X A;  2HHQ A;  8ICZ A;  3PO5 A;  4IQU A;  4KLE A;  2XC9 A;  2R8K A;  3PML A;  3ZDE A;  3G6X A;  5KFL A;  4UAY A;  4PPX A;  3RB3 A;  1BPE A;  3C2K A;  2HW3 A;  4KIT B;  4F2R A;  4ECQ A;  4ECR A;  1NK8 A;  3Q8K A;  4M9H A;  5J2E A;  4QZ9 A;  1JXL A;  4DS4 A;  3N97 B;  1U48 A;  5EWF A;  4ED8 A;  8ICV A;  4C8L A;  2H5X A;  4DEZ A;  5KFO A;  1ZQT A;  3HX0 A;  2R8H A;  5DDY A;  8ICR A;  2W9C A;  4PGQ A;  3TFR A;  1U4B A;  4PHD A;  1K1Q A;  2J6S A;  1KLN A;  4UBB A;  4KLU A;  1S10 A;  5KFG A;  3V6K A;  1RXV A;  4P4O A;  3SZ2 A;  4EZ9 A;  3MR5 A;  4KLG A;  3HWT A;  3UQ2 A;  4YD1 A;  4DWI A;  1JXE A;  4RQ3 A;  4P4M A;  4DF4 A;  5KFT A;  2RDI A;  4O3P A;  2FPL A;  4QZG A;  4M9G A;  9ICM A;  3MGH A;  3K4G A;  3JPN A;  2BKE A;  4ED3 A;  1COO A;  4DL7 A;  2P6U A;  5KFX A;  1ZQR A;  5CP2 A;  3T3F A;  4K4G A;  3GIM A;  1TFR A;  1KFT A;  2FPK A;  1JX4 A;  1NJZ A;  5J0R A;  4RPZ A;  3RAQ A;  4UB3 A;  4EBC A;  4M04 A;  4R8U A;  2DPI A;  5DGB A;  2PFN A;  4IQW A;  3JPR A;  4ECT A;  1DGS A;  4RQ5 A;  4NY8 A;  2UVU A;  8ICF A;  7ICU A;  4J9Q A;  4BWJ A;  4DS5 A;  7ICJ A;  4RQ4 A;  3G6V A;  2HHS A;  4RQ7 A;  9ICT A;  4Q45 A;  5J2H A;  4DFM A;  5J0X A;  3RB0 A;  1ZQS A;  4RUA A;  7ICG A;  3C2L A;  4FBU A;  4QZI A;  4F5P A;  1T4G A;  5HNK A;  2M9N A;  4KMU A;  3RAX A;  4NLN A;  3SI8 A;  4DQS A;  7ICF A;  4DF8 A;  1A77 A;  5KFS A;  5KFI A;  4XRH A;  4IR1 A;  1NJX A;  1K1S A;  4ELU A;  4M0A A;  4QWC A;  3GV7 B;  4YR2 A;  1NJY A;  4I2J A;  4M6W B;  1ZYQ A;  5J2D A;  1HUO A;  5HML A;  2W9B B;  2ASL A;  2WTF A;  3PVX A;  4ED2 A;  3C5F A;  3C2M A;  2NRT A;  5EOZ A;  3ISC A;  1BPY A;  1X9W A;  1ZQK A;  1ZQD A;  5J0T A;  4BWM A;  1QLN A;  4M6W A;  4G3I A;  2PXI A;  4P4P A;  1RYS A;  1DOQ A;  2W9B A;  4QW9 A;  5L9X A;  3MDC A;  4J9L A;  3RH6 A;  5DB7 A;  4YXJ A;  3T5J A;  5J0U A;  2C22 A;  1NKC A;  3RRG A;  2VA3 A;  4NM1 A;  4DL2 A;  5J0Q A;  4J9S A;  4QW8 A;  9ICG A;  1TV9 A;  3H8S A;  1KTQ A;  3AUO A;  5HMM A;  1BPD A;  5J2G A;  5BOL A;  3PW2 A;  1ZQU A;  4UAW A;  7ICV A;  4QZE A;  4J9O A;  4QZD A;  2PI4 A;  5KFM A;  1LB2 B;  3OSP A;  7ICL A;  4TUR A;  4KLT A;  3OHA A;  1D9D A;  2C2E A;  3PW7 A;  3LWM A;  5KFK A;  1ZQB A;  4IR9 A;  4UB5 A;  3PR4 A;  4B9S A;  4I2C A;  2UVV A;  2DPJ A;  4YR3 A;  9ICX A;  1ZQV A;  4ED6 A;  1HUZ A;  5KT6 A;  2ZJA A;  5CA7 A;  5DG9 A;  1SL2 A;  4I28 A;  8ICP A;  2IA6 A;  5L1L A;  1HJP A;  4YG2 A;  1RZT A;  1MC8 A;  2XGP A;  3BDP A;  5KG6 A;  3BQT A;  3FYH A;  3LDA A;  1ZQM A;  4ELV A;  1LV5 A;  4RPX A;  8ICT A;  4F4Y A;  2W9M A;  4Q8E A;  1JMS A;  4I2D A;  4Z6C A;  2JEG A;  4RUC A;  5CWR A;  4YR0 A;  4J9P A;  3PMN A;  3Q8L A;  1NK5 A;  3GV5 B;  2PFQ A;  4EZ6 A;  4KLL A;  3NGD A;  4F2S A;  4I27 A;  3BQ1 A;  4MEX A;  4EYH B;  2AU0 A;  4B9T A;  7ICP A;  4PHE A;  3RJI A;  5HHH A;  4O9M A;  4QWA A;  5DLF A;  3IHQ B;  2R8I A;  7ICE A;  4YD2 A;  5KFU A;  5L1K A;  4RNO A;  4R66 A;  3JPP A;  4RT3 A;  1XS9 D;  1ZQQ A;  4C8O A;  5J2F A;  2AQ0 A;  2B21 A;  5IIN A;  3TAN A;  1Z3E B;  4R64 A;  2LYH A;  3ETL A;  2KTQ A;  4F5R A;  2XCA A;  4NLG A;  1RPL A;  8ICK A;  5DDM A;  2Q0Z X;  3RR8 A;  5J0P A;  2AGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...