3SEIA

Crystal structure of caskin1 tandem sams
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
TREGKSSEAVSQWLTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELRRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caskin-1
publication title Tandem SAM domain structure of human Caskin1: a presynaptic, self-assembling scaffold for CASK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 50
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3seiA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3seiA01
3BS5A 1Z1VA 1X9XA 5J8YC 5KNIA 1PK1B 2D3DA 2EANA 2QB0B 1PK1A 3K1RB 5JRTA 2LPEA 2KE7A 2QB0A 3IDWA 2L5YA 2QKQA 1X66A 3BS7A 4RQMA 2DKZA 2JV3A 4NJ8A 1KW4A 2YTUA 3TADA 1WWVA 2E8PA 2GLEA 5J8YA 1UQVA 1SXEA 2EAOA 2KG5A 1V85A 2E8OA 1OXJA 3SENA 2EAMA 1UCVA 2DKXA 2E8MA 1OW5A 2KSOB 4PZOA 1LKYB 2Y9UA 1JI7A 2KSOA 1SXDA 2LMRA 3KKAC 1LKYA 5JU5A 1SV0C 2F3NA 1SV4A 2QARB 1PK3A 2DL0A 1SGGA 3TACB 1B4FA 5L1MA 4MHVA 3HILA 2QARA 2E8NA 3H8MA 2K4PA 1V38A 5JTIA 4PZNA 3KKAA 4NL9C 4NL9A 5F3XB 2K60A 2QB1A 1SV0A 2ES6A 2F44A 2Y9TA 2D8CA 1COKA 2EAPA 4RQNA 1RG6A 2B6GA 2F8KA 1F0MA 2FE9A 3BQ7A 4IS7A 3SEIA 1DXSA 2KMDA 3BS5B 1WWUA 1B0XA 2KIVA 3TADC 2ESEA 1X40A
chains in the Genus database with same CATH superfamily
3T5LA 1OUQA 1ZD3A 5KFDA 2FLNA 5E79U 4DQRA 4O3NA 1XSNA 4KN4A 4DSIA 3QU4A 1PZNA 5J2AA 2IOHA 5JRTA 1RYRA 5DB8A 4TQRA 4PHAA 3F5EA 2XCPA 4BXOA 3GZFA 3AM9A 5IIOA 5AKEA 2J6TA 2NYVA 1DOQA 4BGDA 4PHEA 4DL5A 5AI6A 4F5PA 3RB4A 1FFUA 1ZQCA 5J2IA 3H8SA 1MN8A 4EX7A 1UCVA 3PSIA 1M6YA 5IIJA 4EBCA 3QU5A 1U48A 3GQCA 4DQQA 3H4DA 4IQTA 3QX7A 1ZQEA 3Q8RB 4ED1A 4UARA 2KJ9A 1SV0C 2ZTCA 4DL7A 2I1QA 1S5LU 4IRDA 3WKCA 8ICNA 1S0VA 5KFTA 4U7CA 3IN5A 9ICEA 2QARB 9ICFA 2E5SA 1ZQKA 3PY8A 3LWMA 3ETRA 3RJIA 4YFKA 4YXJA 3UPQA 1FEZA 1SWVA 5ALWA 3AEVA 8ICFA 3T3FA 3QUBA 4UAYA 2K4PA 4RUAA 4ED0A 2ZJAA 2PMZF 2RDIA 2QB1A 4QZEA 3SZ2A 4IR9A 3NVVA 3PO4A 2DQNB 5BPCA 1BPYA 1T4GA 3F53A 2HBLA 3M7DA 4Y2VA 3L4PA 4G9BA 5L1KA 3OJSA 3IP4B 1WCNA 3SQIA 2EDUA 5AKHA 8ICBA 3S6JA 3MGVA 1SL2A 2CXYA 4NLGA 2BQUA 2HHQA 5ALRA 4F4WA 2FMQA 2HMXA 3M9OB 3QYPA 7ICTA 1T3NA 2KKPA 2BDUA 2YMPA 2EZZA 4UW9A 4F4ZA 5CEHA 5ALGA 5ALSA 5KT7A 3V72A 1CUKA 9ICWA 2G07A 5KFKA 4QWAA 3RTVA 3HW8A 1SL1A 5EWGA 4P4PA 2XGQA 5AI0A 3UMGA 5J0SA 3N28A 2C28A 4X5VA 4ED8A 1T8EA 1S97A 1SXDA 4QZIA 1FFVA 2HBMA 3BQTA 4EYHB 2IOFA 3E0FA 2R8JA 4DFPA 2BKEA 2F2AB 3EPGA 4TUPA 8ICQA 2W43A 2KFZA 4DFDA 2EZXA 4QJFB 4KLUA 1VDVA 5ALYA 9ICOA 1Q8KA 4FE3A 5L1MA 3SV4A 4CE6A 3ETLA 3KD3A 3RFAA 5DLFA 1AQ6A 4DFJA 4O3MA 5ALPA 2WHEA 2BDPA 5ALXA 5EOZA 4EZ9A 5KFRA 2KZMA 2ZIWB 5KFVA 5ALIA 4DSLA 1RM6C 4J9LA 5KG4A 4R63A 4F92B 2B6GA 2F1IA 3Q8LA 5AKYA 3SEIA 4CF5A 3C1YA 1L7NA 2BPCA 4DS4A 4R65A 4F4KA 5DB9A 2Z7JA 3UXPA 4DL4A 1ZD5A 2G06A 1K5OA 2HSZA 4ELVA 1U9LA 4MFFA 4OO1J 4PL2A 2BCUA 3IDWA 3HWTA 4P0PA 2W7OA 2YTUA 2GOLA 5BOMA 3M6ZA 4KN7A 2E8PA 3HKZF 2A3VA 2V9WA 2FLPA 2XC9A 3AQEA 2DKXA 1T94A 2KNJA 1FIQA 1JI7A 2KSOA 4IL6U 5KG7A 4RT2A 4DSFA 3WK6A 4Q43A 1Z00A 3TFSA 2K4IA 1QCKA 5AIAA 3MFIA 7ICQA 3V7JA 4RT3A 2XCAA 4ECSA 2CN1A 3QEBZ 1ZYQA 1Y88A 3UM9A 3KZXA 4IC9A 4I2EA 3RJFA 1RQNA 5J0UA 2FI1A 7ICHA 4MEYA 4EBDA 7ICEA 2NV3A 3THVA 1S8OA 1NZBA 2AJQA 2Y9TA 3PSPA 2W3SA 2YX8A 2P66A 1XWLA 5C5JA 2PFOA 1ZQXA 4AYBF 2H3VA 3MR3A 1MC8A 7ICLA 3BQ7A 1Q3UA 3NASA 2VIXA 1SIJA 5KFCA 2RHFA 4JMUA 3KHLA 4YCXA 3AN1A 9ICIA 1HEKA 4NM2A 1ZRNA 3NVWA 2XY5A 5J2EA 4F2SA 2I9GA 4M47A 1TAQA 9ICLA 3EW9A 1L7PA 2RDJA 2ZIXB 3PR4A 3VC8A 2IHNA 3NVYA 2AQ0A 5ALQA 2UVUA 2WAQF 4RQMA 3HPOA 1L3TA 3RF9A 4C8OA 5AM4A 1A0PA 1D8YA 3QUTA 2R8IA 2AQ4A 4OJ6A 8ICJA 1NI3A 2E8MA 4RQ8A 4B9MA 4KTQA 1SKRA 4FZNA 4YG2A 3RJEA 2ASJA 3WU2U 4ECWA 3NS1A 3E58A 4EX6A 4IQWA 2W03A 5KFSA 1ZD4A 1ZQYA 9ICJA 1SZPA 3MR5A 3RJGA 4KLMA 2FPMA 7ICMA 2HCFA 4NLKA 1DK2A 5KFBA 3C2MA 1L3SA 4GFJA 4I2FA 3GIJA 5L1JA 3H8MA 4FS2A 5DDYA 3EWAA 5ALJA 1IXRA 1QH9A 2PMZC 1S10A 8ICSA 2JEGA 3TARA 2D8CA 1ZQLA 2MSNA 1ZQPA 4Z6DA 3QU7A 2FLLA 2ZG6A 2LI6A 5KT3A 4GLXA 3HX0A 3UMCA 3N7SC 4UASA 2YB4A 2ZIUB 3FM9A 4F8RA 5TISU 3KOOA 1HIWA 1ECWA 3RR7A 4K4HA 5GTIU 2QB0B 4MF8A 2W04A 3PSFA 3K1RB 3C5FA 3RBDA 4C4RA 2DF4B 4PJ0U 3PMLA 3J81j 2RRDA 3BS7A 4YR3A 3QE9Y 5CB1A 1NKEA 2VJ5A 1KN5A 3RB0A 4NY8A 2NRTA 5J0XA 2KVSA 2EAMA 1QSYA 3T5HA 1TAMA 3OPXA 5KT4A 2G08A 5CP2A 3QU2A 5KAFU 2V4RA 4J9KA 4UAZA 3FAHA 3ZI4A 2H3ZA 5CRXA 4ECYA 2Y9UA 4B9NA 1K1SA 3WK4A 1MSWD 3C29A 1KFSA 3MC1A 1UA0A 3IG5A 4JV0A 2VA2A 1H38A 1J2NA 3C1ZA 3WKAA 3Q8KA 3MGIA 3G6VA 2KKVA 5AK6A 4NWIA 5IINA 2QARA 3UMBA 1JMSA 4PGQA 3H0MB 5KL1B 1TKDA 2OYYA 2W3RA 3UXOA 1NK4A 4F72A 2KTQA 3KFUF 1XO1A 2V4QA 3ZDDA 5JTIA 3PNCA 3MABA 4F50A 1N56A 4LZGA 2K4HA 5AKIA 3SV3A 5D46A 1D9FA 1NNLA 1ZXIA 2FPLA 5AI5A 5KFMA 3SD7A 4Q44A 5DGBA 3PSTA 1C7YA 4O3QA 5AM3A 1S0NA 2UVRA 5KFJA 1KFTA 4B9SA 4F5NA 4DL3A 3JPRA 4CF3A 5KG5A 3MGHA 3FDSA 4DF8A 2LPEA 1KDHA 2EH9A 2KE7A 7ICRA 3BQ0A 8ICYA 8ICGA 2K8AA 3AL0B 2Y0SF 4F5OA 1HUZA 4NLZA 3D2QA 3LVWA 4O3RA 1BNPA 3N7PD 2W9CB 1COOA 4NJ8A 9ICBA 4F91B 1WWVA 3ISDA 4QZ8A 2W11A 3GFKB 3A0BU 4RPYA 3G6XA 2D6FC 3HKZC 1N60A 1PVPA 1MA7A 4PHPA 5J0YA 4ICAA 4TUQA 1LVHA 2LM4A 3L3FX 1ZQUA 2HHVA 4KMOB 5CWRA 3Q8PB 4P2HA 3V6HA 5KG2A 2HHXA 4NV0A 2G5HB 1UPHA 1KBUA 5DQHA 3ISCA 2GH1A 1NJZA 5J0OA 2E3TA 5DBBA 4FFDA 5J2JA 4PH5A 4YR0A 2IA6A 4NL9C 2W55A 4Q8FA 4UB3A 4KX3A 4I2JA 4I2BA 1QSLA 3AU2A 2ZIWA 7ICUA 2WF7A 1RG6A 2F8KA 3A0HU 2ALZA 2K8CB 3CYMA 2PI4A 2KV2A 2A1JB 3OHBA 4AYBC 4E0DA 2ZIVB 1FO4A 2KMDA 1BPZA 4GIBA 2MRLA 4YMMA 3QUQA 4EYIB 4Z6FA 4I27A 4EENA 4ECQA 3R9KA 3QXGA 4QZBA 4NXZA 3SAHA 4UAWA 4QZFA 2HOFA 4UBCA 2UVVA 5JUMA 4Z6CA 9ICMA 2KD1A 2QKQA 4R8UB 2XGPA 4QZAA 5DG7A 2E1EA 5J2CA 2O6KA 2GLEA 2EAOA 1L3UA 1NK9A 2ZUDA 2HVHA 1K1QA 1AROP 3MR6A 5AI4A 2C22A 1OW5A 5EWFA 8ICHA 2I6XA 4MFAA 4TUSA 1A77A 2BQRA 1UHUA 2AGOA 1X9SA 5ALMA 2H3QA 2JH7A 3PW5A 4I29A 4QWCA 3MDCA 3ICXA 4IR1A 1IG6A 4M9LA 2M9NA 5AIBA 5IIKA 3GIIA 2NRWA 3D6JA 4JV1A 2FPKA 4C7YA 2FDRA 4QNLA 3JPOA 1X9WA 1J2MA 2LBOA 3TAPA 8ICOA 2VA3A 5EWEA 3OHAA 2F1HA 1ZQGA 3RH4A 3F5AA 3M8RA 4DQPA 1NKBA 2PFQA 4Q45A 3RJJA 3I76A 4PL1A 3EZ5A 1QLNA 4YD1A 1XC9A 4FO6A 1ZQMA 1WCLA 1SKWA 3B0XA 3SR6A 4BUGA 1ZOLA 3AU6A 1Z4NA 4ECTA 2ZTEA 1WWUA 8ICLA 4YD2A 3RB6A 5AKGA 4XRHA 3B9JA 2HVIA 4NLNA 2A19A 4Y2UA 2BPGA 3QZ7A 3ORYA 3RH6A 4UQGA 2OXOA 2OWOA 5DBCA 4RUCA 4OCZA 1NK6A 2ZIXA 2DKZA 4EBEA 1S9FA 1T7PA 5KG3A 3LVVA 2XVTA 3K1ZA 3MR2A 2K89A 2F8LA 2KG5A 5HR7A 1V85A 1B43A 3PMNA 5AHXA 3JPPA 2W9BB 2NRVA 5IIMA 3OSPA 1ZQNA 2P6RA 4C80A 1VJ5A 4Y2RA 3K75D 5L9XA 1ZQIA 5KFWA 4C8MA 4YP3A 4DQSA 1XSPA 8ICVA 5AICA 1SV4A 1KSPA 1RDFA 3AUOA 1L5UA 2B21A 1PK3A 3ZDCA 5J2DA 1ZQHA 1A6SA 3SAFA 3RAXA 8ICCA 4FZMA 1NJYA 1SWWA 2WB1F 1NK8A 4Y2TA 4IQVA 4UB5A 4R66A 4QIWF 2J6UA 1U47A 3NRZA 4TURA 4M04A 2AXTU 4J9OA 1RZTA 4DSJA 2LM1A 4DOBA 3EPIA 5J29A 4PGXA 2W8LA 4NM1A 4C8NA 8ICXA 3D2NA 1Q3VA 2HHUA 1DXSA 1UA1A 2H3IA 1URJA 1IIPA 4UB8U 4QZHA 1S0MA 1PK1B 2ZIUA 5KFZA 4UAVA 3C2KA 3WKBA 2PI5A 3RJHA 2P6UA 2LYBA 2QB0A 5HR6A 4BWJA 2L5YA 1TK0A 1X6IA 5F9LA 5AI9A 4DSKA 1ZQOA 4NLCA 4IQUA 5EE1A 1RPLA 5J8YA 4LVSA 1ZQTA 3QEAZ 4XQ8A 3TQ1A 4IRCA 5ALDA 1L8OA 1Q46A 3EYZA 4F93B 4QW8A 4EEYA 3QNMA 3PW0A 1NJWA 1BPEA 4RQ7A 2XI9A 1BPXA 5CR0A 5L1IA 5DDMA 4CF4A 1O08A 1L8LA 4O3PA 2RLTA 9ICHA 5C0YA 5DB6A 5JU5A 5KG1A 2OH2A 2JZBB 2IOFK 5AM1A 3BQ1A 2KJ5A 4ACOA 5KFXA 2ZJ5A 2LHTA 2R18A 1NK0A 5K4LA 3F2DA 2DPJA 4B9UA 7ICKA 4PHDA 5AK4A 1B4FA 7ICFA 2MA1A 3TAQA 2R8HA 2IBKA 5ALOA 4UB4A 3F2CA 2BGWA 1XU4A 2PXIA 4CNQA 3AQFA 9ICUA 4KLQA 2KICA 4J9SA 1ZQJA 4I2GA 3ALRA 4KLEA 3JPSA 2LYAA 2ES6A 2KJ8A 4KLTA 3L5KA 1TK8A 5J2BA 2YQEA 3C2LA 4I2HA 2WFAA 3BS5B 3KTQA 2AHOB 2ZXIA 2Y1IA 1ZQVA 5J2FA 4YR2A 4QWDA 2XIDA 1RYSA 4KLOA 5J8YC 3RJKA 5DG9A 4C8KA 4KLDA 1L7MA 5CJ7A 4US9A 2HI0A 5T14A 7ICPA 3MFHA 3LYSA 3PW2A 4TQSA 1ZQDA 4I2DA 5ALFA 8ICMA 4QZ9A 2AU0A 4KITB 1ZJNA 1XNSA 2NRZA 5EE3A 9ICSA 2W9CA 1JROA 1UQVA 4CRXA 1BPDA 1ZQWA 2F76X 3IG8A 4KLIA 4GXJA 4DOCA 1WUDA 2JRZA 4ED3A 5KFNA 4EELA 1ZQQA 3DDHA 5DGAA 4KLLA 1LKYB 2BCVA 4C4TA 2JXJA 4B9LA 4DSEA 2ZXHA 3NGDA 4RPXA 1HUOA 3H8WA 3BQ2A 5KTQA 3WKDA 9ICNA 4F5QA 3SMVA 3UXNA 2KOBA 3GIMA 2MU2A 4CGZA 1RYUA 1UT5A 3T5JA 3T79A 3F2BA 4ZOHC 4YQWA 3M9MB 1A76A 1KQQA 8ICIA 4M6WB 1Z4OA 4KX5A 3E2EA 3TANA 2BCSA 3PX0A 2ISOA 2ISPA 1JXLA 3BZCA 2WTFA 3D2SA 4C8LA 4DCCA 4DF4A 4RQNA 5DB7A 5ALEA 2FE9A 1TVAA 4RQ3A 4M9NA 3CNHA 4ECXA 1LB2B 1S77D 4HYKA 1YT3A 2A1JA 2KVCA 2ZIVA 4P4OA 3OTQA 4J03A 3Q8SB 2G0AA 2D3DA 3KHRA 5HMMA 2KZ3A 4F4YA 5AKZA 2GO7A 5KFFA 2Q4TA 3O0FA 3V6JA 3PO5A 4ED2A 5KFLA 3RB3A 4RQ4A 4RNMA 2XO7A 5AI8A 3GDXA 9ICQA 2JV3A 2P35A 3RRHA 3GILA 4P4MA 3PX6A 5GTHU 4R8UA 1SXEA 1X9MA 9ICRA 2YMLA 3QU9A 2E8OA 3IV6A 1XS9D 3RR8A 1KTQA 4DL6A 1QSSA 4MFCA 4EEKA 5J2GA 1DGSA 3GU3A 1PVRA 5AKJA 1X2IA 5CHGA 3N7RC 1EXNA 4GXKA 5EE0A 2VANA 2Q0ZX 2DBYA 3I1YA 5AK3A 5H2FU 5ALNA 3FYHA 4GC7A 3H0LB 4YXMA 4I2CA 2MAXA 3KHGA 2WB1C 3ZD9A 4C7ZA 1BPBA 4QIWC 4Y2JA 2NRXA 2DWQA 2K60A 2QLTA 3C5GA 1NK5A 2M0NA 3SI8A 4B9VA 2YMMA 2VA8A 4O9MA 1N63A 3KHHA 3TFRA 5ALTA 3M6KA 1BVSA 4Q8EA 3AMZA 5CA7A 5AK5A 3BZKA 5D49A 3C28A 1TK5A 3QUCA 4F4XA 4LJXA 1ZQ1C 1X40A 5HMLA 2KK0A 5D4BA 4I2IA 5KFIA 5KFEA 1TV9A 5TZVA 9ICPA 1ZETA 4RQ6A 1Z3EB 3MDAA 3KBBA 8ICUA 4QZCA 4KLJA 7ICSA 4DWIA 8ICZA 3K4GA 4DEZA 2YN4A 3ED5A 2FJ6A 3CRXA 4ELUA 2ASLA 4ED7A 1UT8A 3ONNA 1BGXT 5J0WA 2H5XA 1GO3F 3SENA 5DKWA 5J2HA 3N4MB 9ICTA 3WKEA 1NJXA 4O3SA 2W9BA 4P0QB 3TI0A 2BCQA 5ALKA 4M9JA 3TKAA 1S76D 1D8BA 4GC6A 2WAQC 2IMWP 3RAQA 2BQ3A 3C21A 4B6JA 1BNOA 4Y2PA 8ICWA 2W9AA 1C20A 8ICEA 5G5GA 3TACB 2YY6A 2N1RA 1Z1BA 4KMUA 3WK8A 4O3OA 3G6YA 3M8SA 4GXIA 1V38A 1HJPA 4RPZA 3PW7A 1NOMA 3KKAA 4ECVA 2OEHA 2CPRA 4M2YA 1RQLA 4JB3A 1NZPA 1L6NA 1ZRMA 2WF5A 4DQIA 2MUTB 1SB3C 4RQ1A 3BJYA 2EQYA 2EAPA 2HHTA 5KL8B 4Z6EA 2RQ5A 4YN4A 2YB1A 2F1JA 9ICCA 3HRDD 2HBKA 1N62A 2JEIA 3B0YA 3ZDEA 4QWBA 2W8KA 2VKQA 5HP4A 3GV7B 1X9XA 1JN3A 4NLBA 5KT6A 2HOQA 4OJLA 3C23A 4BXOB 1PK1A 1KKXA 3JPTA 1L3VA 1RXVA 2WF9A 4LZDA 4JV2A 4QZDA 4DFMA 1X66A 1V9PA 2HW3A 2HDOA 1DK3A 1SZHA 3TADA 1D9DA 2UVWA 2KZZA 3CW2C 4QW9A 4JK1A 4DL2A 3DV9A 2DPIA 4M0AA 4US8A 2BCRA 1OXJA 5KFQA 5G5HA 1WYGA 4G3IA 1P7DA 3VCBA 5KFUA 4F3OA 5ALVA 5HHIA 5KFYA 1TAUA 5AKKA 1CEZA 2JMGA 1ZQSA 4UBBA 2DFLA 3KKAC 3SYZA 2XICA 2C2DA 4WJ3B 5AM2A 5L1LA 8ICTA 2F3NA 3NRWA 1YZ7A 1QQ6A 1ZQFA 3IHQB 3V7KA 2FMSA 4PPXA 2W9MA 3DEEA 3PR5B 2JZBA 4UATA 4Y2SA 3H7IA 1ZJMA 4K4IA 2ZJ8A 3HILA 1KL9A 3SAGA 3N97B 1QQ5A 3H0RB 4F5RA 2A1AA 8ICAA 4O5CA 2AH5A 4ZH4A 2F44A 1VLBA 1U49A 4RQ5A 5IILA 1F0MA 2JH1A 1NKCA 2EZYA 1SL0A 1QQ7A 3ZD8A 5DG8A 1ZQAA 4YMOA 2G09A 5DQGA 3HP6A 5ALLA 1B0XA 5IIIA 3TADC 5DBAA 3BS5A 5AKLA 7ICIA 5KNIA 4O5KA 4XA5A 4UB2A 2F77X 2PKEA 2EANA 9ICXA 9ICKA 4OD0A 2W54A 4B9TA 8ICRA 2GWSA 4FS1A 2OCEA 3IM1A 1T3QA 3GIKA 3QZ8A 3V6KA 3IRUA 1QTMA 1LV5A 4DS5A 1ED1A 1KW4A 5AKXA 5J0PA 3CP8A 2BPFA 3RRGA 3PVXA 2VJ4A 3WK5A 5KFHA 5ALUA 5ALHA 3H8JA 4BX9C 3PX4A 5HHHA 9ICVA 4AP9A 3HT3A 1XO0A 2KFNA 4QWEA 4R64A 3RH5A 2Y0SC 4CDGA 1LKYA 3EUB2 1PVQA 2C2RA 4M9GA 5DQIA 2OM6A 2AGPA 3BDPA 4RQ2A 4C0ZA 4ED6A 4FBTA 2KN7A 3T5KA 2HHWA 2LKYA 3RBEA 4UAUA 2E8NA 7ICJA 4OJPA 4BJQA 2R8GA 5F3XB 1CI4A 2BR0A 4O5EA 1F5SA 8ICKA 1J97A 5AM5A 1COKA 4M6WA 4ELTA 4J9PA 3MBYA 4USAA 4OJOA 5ALZA 2ODGA 1XSLA 5KFOA 7ICVA 1ZQRA 4MF2A 4ECUA 4BDPA 5J0TA 1MQ3A 1SKSA 4EZ6A 4A8EA 4HAIA 5A0LA 4XUSA 1S0OA 4U6PA 4QZGA 2R8KA 1DRGA 3LDAA 2XY6A 3ZDAA 5KT2A 9ICAA 4DO9A 4ECZA 4RQ0A 1ZQBA 4P0PB 1U4BA 3GV8B 3WK9A 4YMNA 4UB6U 1KEJA 2CRXA 3NUQA 2ATLA 4FBUA 4J9NA 4DFKA 5KFGA 3LK9A 1N48A 7ICNA 4M9HA 2IHMA 4K4GA 2ZUBA 2HHSA 1JXEA 2BZFA 8ICPA 3HJEA 4J9RA 2ZTDA 2KSOB 3WK7A 1ZQZA 3UQ0A 1Z00B 4PZOA 2NO5A 5KG0A 2DUYA 4PGYA 3M9NB 2JHDA 1IM4A 1WG8A 5J0QA 2WF6A 2C2EA 2LMRA 5AM0A 1TFRA 2KP7A 4KLGA 5FP0A 1JX4A 1X42A 5BOLA 4RU9A 2RP5A 1JIHA 3M1YA 5KAIU 3GV5B 2JEFA 1YZ6A 2G5IB 1D8LA 2KIWA 1KRPA 4JWNA 5KG6A 1DGJA 1N61A 4J9QA 4OJ5A 4YVZA 2JR5A 5KT5A 3I28A 4DLGA 4F71A 4DOAA 2KEYA 4KLSA 2E1FA 2OHFA 5F9NA 1B22A 2ASDA 7ICOA 3ISBA 1TE2A 4DLEA 3Q8QB 2KIVA 2ESEA 2HBJA 1Z1VA 1IV8A 3KZIU 1N5XA 4UB1A 4JUZA 2JEJA 2XY7A 1KLNA 2FMPA 4IRKA 1N2XA 9ICGA 5J2KA 3ZDBA 2I5HA 3PW4A 2YMQA 5B66U 5J0RA 5DLGA 1NK7A 4I2AA 4Y2QA 4C4SA 2PFPA 5HNKA 1X6JA 7ICGA 3NTUA 1ZD2P 3PV8A 2PFNA 4JWMA 2B0CA 1N5WA 4RZRA 4BWMA 3LWLA 2W7PA 1JRPA 5EE9A 2KHVA 3OGUA 2BHNA 3OSNA 1JALA 1Z19A 1O03A 2Y1JA 4P0QA 1RXWA 2NO4A 2H3FA 3JPQA 2WF8A 3PZPA 5KFAA 2K8BB 1CRXA 1F44A 1L7OA 2KHQA 2DGZA 2DL0A 3UQ2A 4RNNA 2HOIA 1SGGA 4O0IA 1MQ2A 4F2RA 4MHVA 3FC4A 4Y2XA 3V7LA 5B5EU 3H4BA 2AGQA 3Q8MA 3NVZA 4ECRA 2LYHA 3U26A 1JUDA 4PZNA 4RNOA 1U45A 4NL9A 3H40A 2K4EA 1SV0A 4MEXA 4KLFA 1PUZA 4KLHA 4CCHA 2ZUCA 4J9MA 3OJUA 2J6SA 3JPNA 2MUTA 2JGAA 4FZLA 4IS7A 1V97A 4I28A 4Y2YA 1KFDA 5KFPA
chains in the Genus database with same CATH topology
3BS5A 1Z1VA 1X9XA 5J8YC 5KNIA 1PK1B 2D3DA 2EANA 2QB0B 1PK1A 3K1RB 5JRTA 2LPEA 2KE7A 2QB0A 3IDWA 2L5YA 2QKQA 1X66A 3BS7A 4RQMA 2DKZA 2JV3A 4NJ8A 1KW4A 2YTUA 3TADA 1WWVA 2E8PA 2GLEA 5J8YA 1UQVA 1SXEA 2EAOA 2KG5A 1V85A 2E8OA 1OXJA 3SENA 2EAMA 1UCVA 2DKXA 2E8MA 1OW5A 2KSOB 4PZOA 1LKYB 2Y9UA 1JI7A 2KSOA 1SXDA 2LMRA 3KKAC 1LKYA 5JU5A 1SV0C 2F3NA 1SV4A 2QARB 1PK3A 2DL0A 1SGGA 3TACB 1B4FA 5L1MA 4MHVA 3HILA 2QARA 2E8NA 3H8MA 2K4PA 1V38A 5JTIA 4PZNA 3KKAA 4NL9C 4NL9A 5F3XB 2K60A 2QB1A 1SV0A 2ES6A 2F44A 2Y9TA 2D8CA 1COKA 2EAPA 4RQNA 1RG6A 2B6GA 2F8KA 1F0MA 2FE9A 3BQ7A 4IS7A 3SEIA 1DXSA 2KMDA 3BS5B 1WWUA 1B0XA 2KIVA 3TADC 2ESEA 1X40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS5 A;  1Z1V A;  1X9X A;  5J8Y C;  5KNI A;  1PK1 B;  2D3D A;  2EAN A;  2QB0 B;  1PK1 A;  3K1R B;  5JRT A;  2LPE A;  2KE7 A;  2QB0 A;  3IDW A;  2L5Y A;  2QKQ A;  1X66 A;  3BS7 A;  4RQM A;  2DKZ A;  2JV3 A;  4NJ8 A;  1KW4 A;  2YTU A;  3TAD A;  1WWV A;  2E8P A;  2GLE A;  5J8Y A;  1UQV A;  1SXE A;  2EAO A;  2KG5 A;  1V85 A;  2E8O A;  1OXJ A;  3SEN A;  2EAM A;  1UCV A;  2DKX A;  2E8M A;  1OW5 A;  2KSO B;  4PZO A;  1LKY B;  2Y9U A;  1JI7 A;  2KSO A;  1SXD A;  2LMR A;  3KKA C;  1LKY A;  5JU5 A;  1SV0 C;  2F3N A;  1SV4 A;  2QAR B;  1PK3 A;  2DL0 A;  1SGG A;  3TAC B;  1B4F A;  5L1M A;  4MHV A;  3HIL A;  2QAR A;  2E8N A;  3H8M A;  2K4P A;  1V38 A;  5JTI A;  4PZN A;  3KKA A;  4NL9 C;  4NL9 A;  5F3X B;  2K60 A;  2QB1 A;  1SV0 A;  2ES6 A;  2F44 A;  2Y9T A;  2D8C A;  1COK A;  2EAP A;  4RQN A;  1RG6 A;  2B6G A;  2F8K A;  1F0M A;  2FE9 A;  3BQ7 A;  4IS7 A;  3SEI A;  1DXS A;  2KMD A;  3BS5 B;  1WWU A;  1B0X A;  2KIV A;  3TAD C;  2ESE A;  1X40 A; 
#chains in the Genus database with same CATH topology
 3T5L A;  1OUQ A;  1ZD3 A;  5KFD A;  2FLN A;  5E79 U;  4DQR A;  4O3N A;  1XSN A;  4KN4 A;  4DSI A;  3QU4 A;  1PZN A;  5J2A A;  2IOH A;  5JRT A;  1RYR A;  5DB8 A;  4TQR A;  4PHA A;  3F5E A;  2XCP A;  4BXO A;  3GZF A;  3AM9 A;  5IIO A;  5AKE A;  2J6T A;  2NYV A;  1DOQ A;  4BGD A;  4PHE A;  4DL5 A;  5AI6 A;  4F5P A;  3RB4 A;  1FFU A;  1ZQC A;  5J2I A;  3H8S A;  1MN8 A;  4EX7 A;  1UCV A;  3PSI A;  1M6Y A;  5IIJ A;  4EBC A;  3QU5 A;  1U48 A;  3GQC A;  4DQQ A;  3H4D A;  4IQT A;  3QX7 A;  1ZQE A;  3Q8R B;  4ED1 A;  4UAR A;  2KJ9 A;  1SV0 C;  2ZTC A;  4DL7 A;  2I1Q A;  1S5L U;  4IRD A;  3WKC A;  8ICN A;  1S0V A;  5KFT A;  4U7C A;  3IN5 A;  9ICE A;  2QAR B;  9ICF A;  2E5S A;  1ZQK A;  3PY8 A;  3LWM A;  3ETR A;  3RJI A;  4YFK A;  4YXJ A;  3UPQ A;  1FEZ A;  1SWV A;  5ALW A;  3AEV A;  8ICF A;  3T3F A;  3QUB A;  4UAY A;  2K4P A;  4RUA A;  4ED0 A;  2ZJA A;  2PMZ F;  2RDI A;  2QB1 A;  4QZE A;  3SZ2 A;  4IR9 A;  3NVV A;  3PO4 A;  2DQN B;  5BPC A;  1BPY A;  1T4G A;  3F53 A;  2HBL A;  3M7D A;  4Y2V A;  3L4P A;  4G9B A;  5L1K A;  3OJS A;  3IP4 B;  1WCN A;  3SQI A;  2EDU A;  5AKH A;  8ICB A;  3S6J A;  3MGV A;  1SL2 A;  2CXY A;  4NLG A;  2BQU A;  2HHQ A;  5ALR A;  4F4W A;  2FMQ A;  2HMX A;  3M9O B;  3QYP A;  7ICT A;  1T3N A;  2KKP A;  2BDU A;  2YMP A;  2EZZ A;  4UW9 A;  4F4Z A;  5CEH A;  5ALG A;  5ALS A;  5KT7 A;  3V72 A;  1CUK A;  9ICW A;  2G07 A;  5KFK A;  4QWA A;  3RTV A;  3HW8 A;  1SL1 A;  5EWG A;  4P4P A;  2XGQ A;  5AI0 A;  3UMG A;  5J0S A;  3N28 A;  2C28 A;  4X5V A;  4ED8 A;  1T8E A;  1S97 A;  1SXD A;  4QZI A;  1FFV A;  2HBM A;  3BQT A;  4EYH B;  2IOF A;  3E0F A;  2R8J A;  4DFP A;  2BKE A;  2F2A B;  3EPG A;  4TUP A;  8ICQ A;  2W43 A;  2KFZ A;  4DFD A;  2EZX A;  4QJF B;  4KLU A;  1VDV A;  5ALY A;  9ICO A;  1Q8K A;  4FE3 A;  5L1M A;  3SV4 A;  4CE6 A;  3ETL A;  3KD3 A;  3RFA A;  5DLF A;  1AQ6 A;  4DFJ A;  4O3M A;  5ALP A;  2WHE A;  2BDP A;  5ALX A;  5EOZ A;  4EZ9 A;  5KFR A;  2KZM A;  2ZIW B;  5KFV A;  5ALI A;  4DSL A;  1RM6 C;  4J9L A;  5KG4 A;  4R63 A;  4F92 B;  2B6G A;  2F1I A;  3Q8L A;  5AKY A;  3SEI A;  4CF5 A;  3C1Y A;  1L7N A;  2BPC A;  4DS4 A;  4R65 A;  4F4K A;  5DB9 A;  2Z7J A;  3UXP A;  4DL4 A;  1ZD5 A;  2G06 A;  1K5O A;  2HSZ A;  4ELV A;  1U9L A;  4MFF A;  4OO1 J;  4PL2 A;  2BCU A;  3IDW A;  3HWT A;  4P0P A;  2W7O A;  2YTU A;  2GOL A;  5BOM A;  3M6Z A;  4KN7 A;  2E8P A;  3HKZ F;  2A3V A;  2V9W A;  2FLP A;  2XC9 A;  3AQE A;  2DKX A;  1T94 A;  2KNJ A;  1FIQ A;  1JI7 A;  2KSO A;  4IL6 U;  5KG7 A;  4RT2 A;  4DSF A;  3WK6 A;  4Q43 A;  1Z00 A;  3TFS A;  2K4I A;  1QCK A;  5AIA A;  3MFI A;  7ICQ A;  3V7J A;  4RT3 A;  2XCA A;  4ECS A;  2CN1 A;  3QEB Z;  1ZYQ A;  1Y88 A;  3UM9 A;  3KZX A;  4IC9 A;  4I2E A;  3RJF A;  1RQN A;  5J0U A;  2FI1 A;  7ICH A;  4MEY A;  4EBD A;  7ICE A;  2NV3 A;  3THV A;  1S8O A;  1NZB A;  2AJQ A;  2Y9T A;  3PSP A;  2W3S A;  2YX8 A;  2P66 A;  1XWL A;  5C5J A;  2PFO A;  1ZQX A;  4AYB F;  2H3V A;  3MR3 A;  1MC8 A;  7ICL A;  3BQ7 A;  1Q3U A;  3NAS A;  2VIX A;  1SIJ A;  5KFC A;  2RHF A;  4JMU A;  3KHL A;  4YCX A;  3AN1 A;  9ICI A;  1HEK A;  4NM2 A;  1ZRN A;  3NVW A;  2XY5 A;  5J2E A;  4F2S A;  2I9G A;  4M47 A;  1TAQ A;  9ICL A;  3EW9 A;  1L7P A;  2RDJ A;  2ZIX B;  3PR4 A;  3VC8 A;  2IHN A;  3NVY A;  2AQ0 A;  5ALQ A;  2UVU A;  2WAQ F;  4RQM A;  3HPO A;  1L3T A;  3RF9 A;  4C8O A;  5AM4 A;  1A0P A;  1D8Y A;  3QUT A;  2R8I A;  2AQ4 A;  4OJ6 A;  8ICJ A;  1NI3 A;  2E8M A;  4RQ8 A;  4B9M A;  4KTQ A;  1SKR A;  4FZN A;  4YG2 A;  3RJE A;  2ASJ A;  3WU2 U;  4ECW A;  3NS1 A;  3E58 A;  4EX6 A;  4IQW A;  2W03 A;  5KFS A;  1ZD4 A;  1ZQY A;  9ICJ A;  1SZP A;  3MR5 A;  3RJG A;  4KLM A;  2FPM A;  7ICM A;  2HCF A;  4NLK A;  1DK2 A;  5KFB A;  3C2M A;  1L3S A;  4GFJ A;  4I2F A;  3GIJ A;  5L1J A;  3H8M A;  4FS2 A;  5DDY A;  3EWA A;  5ALJ A;  1IXR A;  1QH9 A;  2PMZ C;  1S10 A;  8ICS A;  2JEG A;  3TAR A;  2D8C A;  1ZQL A;  2MSN A;  1ZQP A;  4Z6D A;  3QU7 A;  2FLL A;  2ZG6 A;  2LI6 A;  5KT3 A;  4GLX A;  3HX0 A;  3UMC A;  3N7S C;  4UAS A;  2YB4 A;  2ZIU B;  3FM9 A;  4F8R A;  5TIS U;  3KOO A;  1HIW A;  1ECW A;  3RR7 A;  4K4H A;  5GTI U;  2QB0 B;  4MF8 A;  2W04 A;  3PSF A;  3K1R B;  3C5F A;  3RBD A;  4C4R A;  2DF4 B;  4PJ0 U;  3PML A;  3J81 j;  2RRD A;  3BS7 A;  4YR3 A;  3QE9 Y;  5CB1 A;  1NKE A;  2VJ5 A;  1KN5 A;  3RB0 A;  4NY8 A;  2NRT A;  5J0X A;  2KVS A;  2EAM A;  1QSY A;  3T5H A;  1TAM A;  3OPX A;  5KT4 A;  2G08 A;  5CP2 A;  3QU2 A;  5KAF U;  2V4R A;  4J9K A;  4UAZ A;  3FAH A;  3ZI4 A;  2H3Z A;  5CRX A;  4ECY A;  2Y9U A;  4B9N A;  1K1S A;  3WK4 A;  1MSW D;  3C29 A;  1KFS A;  3MC1 A;  1UA0 A;  3IG5 A;  4JV0 A;  2VA2 A;  1H38 A;  1J2N A;  3C1Z A;  3WKA A;  3Q8K A;  3MGI A;  3G6V A;  2KKV A;  5AK6 A;  4NWI A;  5IIN A;  2QAR A;  3UMB A;  1JMS A;  4PGQ A;  3H0M B;  5KL1 B;  1TKD A;  2OYY A;  2W3R A;  3UXO A;  1NK4 A;  4F72 A;  2KTQ A;  3KFU F;  1XO1 A;  2V4Q A;  3ZDD A;  5JTI A;  3PNC A;  3MAB A;  4F50 A;  1N56 A;  4LZG A;  2K4H A;  5AKI A;  3SV3 A;  5D46 A;  1D9F A;  1NNL A;  1ZXI A;  2FPL A;  5AI5 A;  5KFM A;  3SD7 A;  4Q44 A;  5DGB A;  3PST A;  1C7Y A;  4O3Q A;  5AM3 A;  1S0N A;  2UVR A;  5KFJ A;  1KFT A;  4B9S A;  4F5N A;  4DL3 A;  3JPR A;  4CF3 A;  5KG5 A;  3MGH A;  3FDS A;  4DF8 A;  2LPE A;  1KDH A;  2EH9 A;  2KE7 A;  7ICR A;  3BQ0 A;  8ICY A;  8ICG A;  2K8A A;  3AL0 B;  2Y0S F;  4F5O A;  1HUZ A;  4NLZ A;  3D2Q A;  3LVW A;  4O3R A;  1BNP A;  3N7P D;  2W9C B;  1COO A;  4NJ8 A;  9ICB A;  4F91 B;  1WWV A;  3ISD A;  4QZ8 A;  2W11 A;  3GFK B;  3A0B U;  4RPY A;  3G6X A;  2D6F C;  3HKZ C;  1N60 A;  1PVP A;  1MA7 A;  4PHP A;  5J0Y A;  4ICA A;  4TUQ A;  1LVH A;  2LM4 A;  3L3F X;  1ZQU A;  2HHV A;  4KMO B;  5CWR A;  3Q8P B;  4P2H A;  3V6H A;  5KG2 A;  2HHX A;  4NV0 A;  2G5H B;  1UPH A;  1KBU A;  5DQH A;  3ISC A;  2GH1 A;  1NJZ A;  5J0O A;  2E3T A;  5DBB A;  4FFD A;  5J2J A;  4PH5 A;  4YR0 A;  2IA6 A;  4NL9 C;  2W55 A;  4Q8F A;  4UB3 A;  4KX3 A;  4I2J A;  4I2B A;  1QSL A;  3AU2 A;  2ZIW A;  7ICU A;  2WF7 A;  1RG6 A;  2F8K A;  3A0H U;  2ALZ A;  2K8C B;  3CYM A;  2PI4 A;  2KV2 A;  2A1J B;  3OHB A;  4AYB C;  4E0D A;  2ZIV B;  1FO4 A;  2KMD A;  1BPZ A;  4GIB A;  2MRL A;  4YMM A;  3QUQ A;  4EYI B;  4Z6F A;  4I27 A;  4EEN A;  4ECQ A;  3R9K A;  3QXG A;  4QZB A;  4NXZ A;  3SAH A;  4UAW A;  4QZF A;  2HOF A;  4UBC A;  2UVV A;  5JUM A;  4Z6C A;  9ICM A;  2KD1 A;  2QKQ A;  4R8U B;  2XGP A;  4QZA A;  5DG7 A;  2E1E A;  5J2C A;  2O6K A;  2GLE A;  2EAO A;  1L3U A;  1NK9 A;  2ZUD A;  2HVH A;  1K1Q A;  1ARO P;  3MR6 A;  5AI4 A;  2C22 A;  1OW5 A;  5EWF A;  8ICH A;  2I6X A;  4MFA A;  4TUS A;  1A77 A;  2BQR A;  1UHU A;  2AGO A;  1X9S A;  5ALM A;  2H3Q A;  2JH7 A;  3PW5 A;  4I29 A;  4QWC A;  3MDC A;  3ICX A;  4IR1 A;  1IG6 A;  4M9L A;  2M9N A;  5AIB A;  5IIK A;  3GII A;  2NRW A;  3D6J A;  4JV1 A;  2FPK A;  4C7Y A;  2FDR A;  4QNL A;  3JPO A;  1X9W A;  1J2M A;  2LBO A;  3TAP A;  8ICO A;  2VA3 A;  5EWE A;  3OHA A;  2F1H A;  1ZQG A;  3RH4 A;  3F5A A;  3M8R A;  4DQP A;  1NKB A;  2PFQ A;  4Q45 A;  3RJJ A;  3I76 A;  4PL1 A;  3EZ5 A;  1QLN A;  4YD1 A;  1XC9 A;  4FO6 A;  1ZQM A;  1WCL A;  1SKW A;  3B0X A;  3SR6 A;  4BUG A;  1ZOL A;  3AU6 A;  1Z4N A;  4ECT A;  2ZTE A;  1WWU A;  8ICL A;  4YD2 A;  3RB6 A;  5AKG A;  4XRH A;  3B9J A;  2HVI A;  4NLN A;  2A19 A;  4Y2U A;  2BPG A;  3QZ7 A;  3ORY A;  3RH6 A;  4UQG A;  2OXO A;  2OWO A;  5DBC A;  4RUC A;  4OCZ A;  1NK6 A;  2ZIX A;  2DKZ A;  4EBE A;  1S9F A;  1T7P A;  5KG3 A;  3LVV A;  2XVT A;  3K1Z A;  3MR2 A;  2K89 A;  2F8L A;  2KG5 A;  5HR7 A;  1V85 A;  1B43 A;  3PMN A;  5AHX A;  3JPP A;  2W9B B;  2NRV A;  5IIM A;  3OSP A;  1ZQN A;  2P6R A;  4C80 A;  1VJ5 A;  4Y2R A;  3K75 D;  5L9X A;  1ZQI A;  5KFW A;  4C8M A;  4YP3 A;  4DQS A;  1XSP A;  8ICV A;  5AIC A;  1SV4 A;  1KSP A;  1RDF A;  3AUO A;  1L5U A;  2B21 A;  1PK3 A;  3ZDC A;  5J2D A;  1ZQH A;  1A6S A;  3SAF A;  3RAX A;  8ICC A;  4FZM A;  1NJY A;  1SWW A;  2WB1 F;  1NK8 A;  4Y2T A;  4IQV A;  4UB5 A;  4R66 A;  4QIW F;  2J6U A;  1U47 A;  3NRZ A;  4TUR A;  4M04 A;  2AXT U;  4J9O A;  1RZT A;  4DSJ A;  2LM1 A;  4DOB A;  3EPI A;  5J29 A;  4PGX A;  2W8L A;  4NM1 A;  4C8N A;  8ICX A;  3D2N A;  1Q3V A;  2HHU A;  1DXS A;  1UA1 A;  2H3I A;  1URJ A;  1IIP A;  4UB8 U;  4QZH A;  1S0M A;  1PK1 B;  2ZIU A;  5KFZ A;  4UAV A;  3C2K A;  3WKB A;  2PI5 A;  3RJH A;  2P6U A;  2LYB A;  2QB0 A;  5HR6 A;  4BWJ A;  2L5Y A;  1TK0 A;  1X6I A;  5F9L A;  5AI9 A;  4DSK A;  1ZQO A;  4NLC A;  4IQU A;  5EE1 A;  1RPL A;  5J8Y A;  4LVS A;  1ZQT A;  3QEA Z;  4XQ8 A;  3TQ1 A;  4IRC A;  5ALD A;  1L8O A;  1Q46 A;  3EYZ A;  4F93 B;  4QW8 A;  4EEY A;  3QNM A;  3PW0 A;  1NJW A;  1BPE A;  4RQ7 A;  2XI9 A;  1BPX A;  5CR0 A;  5L1I A;  5DDM A;  4CF4 A;  1O08 A;  1L8L A;  4O3P A;  2RLT A;  9ICH A;  5C0Y A;  5DB6 A;  5JU5 A;  5KG1 A;  2OH2 A;  2JZB B;  2IOF K;  5AM1 A;  3BQ1 A;  2KJ5 A;  4ACO A;  5KFX A;  2ZJ5 A;  2LHT A;  2R18 A;  1NK0 A;  5K4L A;  3F2D A;  2DPJ A;  4B9U A;  7ICK A;  4PHD A;  5AK4 A;  1B4F A;  7ICF A;  2MA1 A;  3TAQ A;  2R8H A;  2IBK A;  5ALO A;  4UB4 A;  3F2C A;  2BGW A;  1XU4 A;  2PXI A;  4CNQ A;  3AQF A;  9ICU A;  4KLQ A;  2KIC A;  4J9S A;  1ZQJ A;  4I2G A;  3ALR A;  4KLE A;  3JPS A;  2LYA A;  2ES6 A;  2KJ8 A;  4KLT A;  3L5K A;  1TK8 A;  5J2B A;  2YQE A;  3C2L A;  4I2H A;  2WFA A;  3BS5 B;  3KTQ A;  2AHO B;  2ZXI A;  2Y1I A;  1ZQV A;  5J2F A;  4YR2 A;  4QWD A;  2XID A;  1RYS A;  4KLO A;  5J8Y C;  3RJK A;  5DG9 A;  4C8K A;  4KLD A;  1L7M A;  5CJ7 A;  4US9 A;  2HI0 A;  5T14 A;  7ICP A;  3MFH A;  3LYS A;  3PW2 A;  4TQS A;  1ZQD A;  4I2D A;  5ALF A;  8ICM A;  4QZ9 A;  2AU0 A;  4KIT B;  1ZJN A;  1XNS A;  2NRZ A;  5EE3 A;  9ICS A;  2W9C A;  1JRO A;  1UQV A;  4CRX A;  1BPD A;  1ZQW A;  2F76 X;  3IG8 A;  4KLI A;  4GXJ A;  4DOC A;  1WUD A;  2JRZ A;  4ED3 A;  5KFN A;  4EEL A;  1ZQQ A;  3DDH A;  5DGA A;  4KLL A;  1LKY B;  2BCV A;  4C4T A;  2JXJ A;  4B9L A;  4DSE A;  2ZXH A;  3NGD A;  4RPX A;  1HUO A;  3H8W A;  3BQ2 A;  5KTQ A;  3WKD A;  9ICN A;  4F5Q A;  3SMV A;  3UXN A;  2KOB A;  3GIM A;  2MU2 A;  4CGZ A;  1RYU A;  1UT5 A;  3T5J A;  3T79 A;  3F2B A;  4ZOH C;  4YQW A;  3M9M B;  1A76 A;  1KQQ A;  8ICI A;  4M6W B;  1Z4O A;  4KX5 A;  3E2E A;  3TAN A;  2BCS A;  3PX0 A;  2ISO A;  2ISP A;  1JXL A;  3BZC A;  2WTF A;  3D2S A;  4C8L A;  4DCC A;  4DF4 A;  4RQN A;  5DB7 A;  5ALE A;  2FE9 A;  1TVA A;  4RQ3 A;  4M9N A;  3CNH A;  4ECX A;  1LB2 B;  1S77 D;  4HYK A;  1YT3 A;  2A1J A;  2KVC A;  2ZIV A;  4P4O A;  3OTQ A;  4J03 A;  3Q8S B;  2G0A A;  2D3D A;  3KHR A;  5HMM A;  2KZ3 A;  4F4Y A;  5AKZ A;  2GO7 A;  5KFF A;  2Q4T A;  3O0F A;  3V6J A;  3PO5 A;  4ED2 A;  5KFL A;  3RB3 A;  4RQ4 A;  4RNM A;  2XO7 A;  5AI8 A;  3GDX A;  9ICQ A;  2JV3 A;  2P35 A;  3RRH A;  3GIL A;  4P4M A;  3PX6 A;  5GTH U;  4R8U A;  1SXE A;  1X9M A;  9ICR A;  2YML A;  3QU9 A;  2E8O A;  3IV6 A;  1XS9 D;  3RR8 A;  1KTQ A;  4DL6 A;  1QSS A;  4MFC A;  4EEK A;  5J2G A;  1DGS A;  3GU3 A;  1PVR A;  5AKJ A;  1X2I A;  5CHG A;  3N7R C;  1EXN A;  4GXK A;  5EE0 A;  2VAN A;  2Q0Z X;  2DBY A;  3I1Y A;  5AK3 A;  5H2F U;  5ALN A;  3FYH A;  4GC7 A;  3H0L B;  4YXM A;  4I2C A;  2MAX A;  3KHG A;  2WB1 C;  3ZD9 A;  4C7Z A;  1BPB A;  4QIW C;  4Y2J A;  2NRX A;  2DWQ A;  2K60 A;  2QLT A;  3C5G A;  1NK5 A;  2M0N A;  3SI8 A;  4B9V A;  2YMM A;  2VA8 A;  4O9M A;  1N63 A;  3KHH A;  3TFR A;  5ALT A;  3M6K A;  1BVS A;  4Q8E A;  3AMZ A;  5CA7 A;  5AK5 A;  3BZK A;  5D49 A;  3C28 A;  1TK5 A;  3QUC A;  4F4X A;  4LJX A;  1ZQ1 C;  1X40 A;  5HML A;  2KK0 A;  5D4B A;  4I2I A;  5KFI A;  5KFE A;  1TV9 A;  5TZV A;  9ICP A;  1ZET A;  4RQ6 A;  1Z3E B;  3MDA A;  3KBB A;  8ICU A;  4QZC A;  4KLJ A;  7ICS A;  4DWI A;  8ICZ A;  3K4G A;  4DEZ A;  2YN4 A;  3ED5 A;  2FJ6 A;  3CRX A;  4ELU A;  2ASL A;  4ED7 A;  1UT8 A;  3ONN A;  1BGX T;  5J0W A;  2H5X A;  1GO3 F;  3SEN A;  5DKW A;  5J2H A;  3N4M B;  9ICT A;  3WKE A;  1NJX A;  4O3S A;  2W9B A;  4P0Q B;  3TI0 A;  2BCQ A;  5ALK A;  4M9J A;  3TKA A;  1S76 D;  1D8B A;  4GC6 A;  2WAQ C;  2IMW P;  3RAQ A;  2BQ3 A;  3C21 A;  4B6J A;  1BNO A;  4Y2P A;  8ICW A;  2W9A A;  1C20 A;  8ICE A;  5G5G A;  3TAC B;  2YY6 A;  2N1R A;  1Z1B A;  4KMU A;  3WK8 A;  4O3O A;  3G6Y A;  3M8S A;  4GXI A;  1V38 A;  1HJP A;  4RPZ A;  3PW7 A;  1NOM A;  3KKA A;  4ECV A;  2OEH A;  2CPR A;  4M2Y A;  1RQL A;  4JB3 A;  1NZP A;  1L6N A;  1ZRM A;  2WF5 A;  4DQI A;  2MUT B;  1SB3 C;  4RQ1 A;  3BJY A;  2EQY A;  2EAP A;  2HHT A;  5KL8 B;  4Z6E A;  2RQ5 A;  4YN4 A;  2YB1 A;  2F1J A;  9ICC A;  3HRD D;  2HBK A;  1N62 A;  2JEI A;  3B0Y A;  3ZDE A;  4QWB A;  2W8K A;  2VKQ A;  5HP4 A;  3GV7 B;  1X9X A;  1JN3 A;  4NLB A;  5KT6 A;  2HOQ A;  4OJL A;  3C23 A;  4BXO B;  1PK1 A;  1KKX A;  3JPT A;  1L3V A;  1RXV A;  2WF9 A;  4LZD A;  4JV2 A;  4QZD A;  4DFM A;  1X66 A;  1V9P A;  2HW3 A;  2HDO A;  1DK3 A;  1SZH A;  3TAD A;  1D9D A;  2UVW A;  2KZZ A;  3CW2 C;  4QW9 A;  4JK1 A;  4DL2 A;  3DV9 A;  2DPI A;  4M0A A;  4US8 A;  2BCR A;  1OXJ A;  5KFQ A;  5G5H A;  1WYG A;  4G3I A;  1P7D A;  3VCB A;  5KFU A;  4F3O A;  5ALV A;  5HHI A;  5KFY A;  1TAU A;  5AKK A;  1CEZ A;  2JMG A;  1ZQS A;  4UBB A;  2DFL A;  3KKA C;  3SYZ A;  2XIC A;  2C2D A;  4WJ3 B;  5AM2 A;  5L1L A;  8ICT A;  2F3N A;  3NRW A;  1YZ7 A;  1QQ6 A;  1ZQF A;  3IHQ B;  3V7K A;  2FMS A;  4PPX A;  2W9M A;  3DEE A;  3PR5 B;  2JZB A;  4UAT A;  4Y2S A;  3H7I A;  1ZJM A;  4K4I A;  2ZJ8 A;  3HIL A;  1KL9 A;  3SAG A;  3N97 B;  1QQ5 A;  3H0R B;  4F5R A;  2A1A A;  8ICA A;  4O5C A;  2AH5 A;  4ZH4 A;  2F44 A;  1VLB A;  1U49 A;  4RQ5 A;  5IIL A;  1F0M A;  2JH1 A;  1NKC A;  2EZY A;  1SL0 A;  1QQ7 A;  3ZD8 A;  5DG8 A;  1ZQA A;  4YMO A;  2G09 A;  5DQG A;  3HP6 A;  5ALL A;  1B0X A;  5III A;  3TAD C;  5DBA A;  3BS5 A;  5AKL A;  7ICI A;  5KNI A;  4O5K A;  4XA5 A;  4UB2 A;  2F77 X;  2PKE A;  2EAN A;  9ICX A;  9ICK A;  4OD0 A;  2W54 A;  4B9T A;  8ICR A;  2GWS A;  4FS1 A;  2OCE A;  3IM1 A;  1T3Q A;  3GIK A;  3QZ8 A;  3V6K A;  3IRU A;  1QTM A;  1LV5 A;  4DS5 A;  1ED1 A;  1KW4 A;  5AKX A;  5J0P A;  3CP8 A;  2BPF A;  3RRG A;  3PVX A;  2VJ4 A;  3WK5 A;  5KFH A;  5ALU A;  5ALH A;  3H8J A;  4BX9 C;  3PX4 A;  5HHH A;  9ICV A;  4AP9 A;  3HT3 A;  1XO0 A;  2KFN A;  4QWE A;  4R64 A;  3RH5 A;  2Y0S C;  4CDG A;  1LKY A;  3EUB 2;  1PVQ A;  2C2R A;  4M9G A;  5DQI A;  2OM6 A;  2AGP A;  3BDP A;  4RQ2 A;  4C0Z A;  4ED6 A;  4FBT A;  2KN7 A;  3T5K A;  2HHW A;  2LKY A;  3RBE A;  4UAU A;  2E8N A;  7ICJ A;  4OJP A;  4BJQ A;  2R8G A;  5F3X B;  1CI4 A;  2BR0 A;  4O5E A;  1F5S A;  8ICK A;  1J97 A;  5AM5 A;  1COK A;  4M6W A;  4ELT A;  4J9P A;  3MBY A;  4USA A;  4OJO A;  5ALZ A;  2ODG A;  1XSL A;  5KFO A;  7ICV A;  1ZQR A;  4MF2 A;  4ECU A;  4BDP A;  5J0T A;  1MQ3 A;  1SKS A;  4EZ6 A;  4A8E A;  4HAI A;  5A0L A;  4XUS A;  1S0O A;  4U6P A;  4QZG A;  2R8K A;  1DRG A;  3LDA A;  2XY6 A;  3ZDA A;  5KT2 A;  9ICA A;  4DO9 A;  4ECZ A;  4RQ0 A;  1ZQB A;  4P0P B;  1U4B A;  3GV8 B;  3WK9 A;  4YMN A;  4UB6 U;  1KEJ A;  2CRX A;  3NUQ A;  2ATL A;  4FBU A;  4J9N A;  4DFK A;  5KFG A;  3LK9 A;  1N48 A;  7ICN A;  4M9H A;  2IHM A;  4K4G A;  2ZUB A;  2HHS A;  1JXE A;  2BZF A;  8ICP A;  3HJE A;  4J9R A;  2ZTD A;  2KSO B;  3WK7 A;  1ZQZ A;  3UQ0 A;  1Z00 B;  4PZO A;  2NO5 A;  5KG0 A;  2DUY A;  4PGY A;  3M9N B;  2JHD A;  1IM4 A;  1WG8 A;  5J0Q A;  2WF6 A;  2C2E A;  2LMR A;  5AM0 A;  1TFR A;  2KP7 A;  4KLG A;  5FP0 A;  1JX4 A;  1X42 A;  5BOL A;  4RU9 A;  2RP5 A;  1JIH A;  3M1Y A;  5KAI U;  3GV5 B;  2JEF A;  1YZ6 A;  2G5I B;  1D8L A;  2KIW A;  1KRP A;  4JWN A;  5KG6 A;  1DGJ A;  1N61 A;  4J9Q A;  4OJ5 A;  4YVZ A;  2JR5 A;  5KT5 A;  3I28 A;  4DLG A;  4F71 A;  4DOA A;  2KEY A;  4KLS A;  2E1F A;  2OHF A;  5F9N A;  1B22 A;  2ASD A;  7ICO A;  3ISB A;  1TE2 A;  4DLE A;  3Q8Q B;  2KIV A;  2ESE A;  2HBJ A;  1Z1V A;  1IV8 A;  3KZI U;  1N5X A;  4UB1 A;  4JUZ A;  2JEJ A;  2XY7 A;  1KLN A;  2FMP A;  4IRK A;  1N2X A;  9ICG A;  5J2K A;  3ZDB A;  2I5H A;  3PW4 A;  2YMQ A;  5B66 U;  5J0R A;  5DLG A;  1NK7 A;  4I2A A;  4Y2Q A;  4C4S A;  2PFP A;  5HNK A;  1X6J A;  7ICG A;  3NTU A;  1ZD2 P;  3PV8 A;  2PFN A;  4JWM A;  2B0C A;  1N5W A;  4RZR A;  4BWM A;  3LWL A;  2W7P A;  1JRP A;  5EE9 A;  2KHV A;  3OGU A;  2BHN A;  3OSN A;  1JAL A;  1Z19 A;  1O03 A;  2Y1J A;  4P0Q A;  1RXW A;  2NO4 A;  2H3F A;  3JPQ A;  2WF8 A;  3PZP A;  5KFA A;  2K8B B;  1CRX A;  1F44 A;  1L7O A;  2KHQ A;  2DGZ A;  2DL0 A;  3UQ2 A;  4RNN A;  2HOI A;  1SGG A;  4O0I A;  1MQ2 A;  4F2R A;  4MHV A;  3FC4 A;  4Y2X A;  3V7L A;  5B5E U;  3H4B A;  2AGQ A;  3Q8M A;  3NVZ A;  4ECR A;  2LYH A;  3U26 A;  1JUD A;  4PZN A;  4RNO A;  1U45 A;  4NL9 A;  3H40 A;  2K4E A;  1SV0 A;  4MEX A;  4KLF A;  1PUZ A;  4KLH A;  4CCH A;  2ZUC A;  4J9M A;  3OJU A;  2J6S A;  3JPN A;  2MUT A;  2JGA A;  4FZL A;  4IS7 A;  1V97 A;  4I28 A;  4Y2Y A;  1KFD A;  5KFP A; 
#chains in the Genus database with same CATH homology
 3BS5 A;  1Z1V A;  1X9X A;  5J8Y C;  5KNI A;  1PK1 B;  2D3D A;  2EAN A;  2QB0 B;  1PK1 A;  3K1R B;  5JRT A;  2LPE A;  2KE7 A;  2QB0 A;  3IDW A;  2L5Y A;  2QKQ A;  1X66 A;  3BS7 A;  4RQM A;  2DKZ A;  2JV3 A;  4NJ8 A;  1KW4 A;  2YTU A;  3TAD A;  1WWV A;  2E8P A;  2GLE A;  5J8Y A;  1UQV A;  1SXE A;  2EAO A;  2KG5 A;  1V85 A;  2E8O A;  1OXJ A;  3SEN A;  2EAM A;  1UCV A;  2DKX A;  2E8M A;  1OW5 A;  2KSO B;  4PZO A;  1LKY B;  2Y9U A;  1JI7 A;  2KSO A;  1SXD A;  2LMR A;  3KKA C;  1LKY A;  5JU5 A;  1SV0 C;  2F3N A;  1SV4 A;  2QAR B;  1PK3 A;  2DL0 A;  1SGG A;  3TAC B;  1B4F A;  5L1M A;  4MHV A;  3HIL A;  2QAR A;  2E8N A;  3H8M A;  2K4P A;  1V38 A;  5JTI A;  4PZN A;  3KKA A;  4NL9 C;  4NL9 A;  5F3X B;  2K60 A;  2QB1 A;  1SV0 A;  2ES6 A;  2F44 A;  2Y9T A;  2D8C A;  1COK A;  2EAP A;  4RQN A;  1RG6 A;  2B6G A;  2F8K A;  1F0M A;  2FE9 A;  3BQ7 A;  4IS7 A;  3SEI A;  1DXS A;  2KMD A;  3BS5 B;  1WWU A;  1B0X A;  2KIV A;  3TAD C;  2ESE A;  1X40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...