3SEIA

Crystal structure of caskin1 tandem sams
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
TREGKSSEAVSQWLTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELRRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Caskin-1
publication title Tandem SAM domain structure of human Caskin1: a presynaptic, self-assembling scaffold for CASK.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3seiA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3seiA01
1LKYB 2LMRA 2ESEA 2F8KA 1Z1VA 1SXDA 1V38A 3TACB 5JRTA 1WWVA 5J8YA 1PK1B 2GLEA 5L1MA 1F0MA 2QARB 2LPEA 4RQMA 5J8YC 5JTIA 2E8PA 1PK3A 2EAOA 3SENA 3BQ7A 3IDWA 3BS7A 5KNIA 1LKYA 2EANA 2QB0B 4MHVA 2QB1A 3BS5B 3TADA 1JI7A 2YTUA 4PZOA 1PK1A 1B0XA 2KE7A 1DXSA 2JV3A 2QARA 2Y9UA 2KIVA 1UQVA 1X40A 3TADC 2E8NA 5F3XB 5JU5A 1X66A 2KSOB 2B6GA 2QB0A 2L5YA 2Y9TA 3KKAA 3BS5A 1B4FA 2DL0A 1OXJA 4IS7A 2E8MA 3H8MA 2ES6A 4NJ8A 3SEIA 3KKAC 2F3NA 2E8OA 1WWUA 2D8CA 1COKA 1OW5A 3HILA 4NL9A 2DKZA 2K60A 2F44A 1SV4A 2KMDA 1SV0C 1X9XA 2D3DA 2KSOA 1RG6A 2EAMA 1SGGA 4NL9C 1SXEA 2K4PA 3K1RB 2DKXA 2FE9A 1V85A 2QKQA 2KG5A 1KW4A 4PZNA 1SV0A 4RQNA 2EAPA 1UCVA
chains in the Genus database with same CATH superfamily
1A77A 2A1JA 4DSEA 1RXWA 3NASA 4UARA 4Y2TA 1ZQMA 4FO6A 3N7SC 1PVRA 3ZDEA 1NJXA 2OHFA 1T4GA 4DO9A 4TUPA 1KBUA 3MFHA 2HVIA 5KFVA 2EAOA 1UT5A 5KFXA 5J2JA 1TK0A 3KTQA 3PMNA 2BHNA 4NLCA 5TZVA 3KHLA 2KVCA 5KFQA 4DQRA 1TVAA 3CP8A 8ICWA 5AKZA 2ZIUB 1DGSA 1L7NA 5AHXA 5AIBA 1FFVA 7ICMA 1SL1A 3PR5B 2Y9UA 1U47A 1ZD5A 2W8LA 4F4YA 4BUGA 1ZD2P 3M9MB 2W8KA 4IL6U 3QE9Y 3RJGA 3ISBA 1ZQGA 3WU2U 2ZIUA 3T5JA 3IHQB 4P4OA 3IP4B 2DQNB 4DFPA 3UXNA 7ICGA 5DG7A 3ZD9A 1SKWA 3RJKA 4B9SA 5DG8A 1YZ6A 4Y2PA 4QWCA 3THVA 1IM4A 1NI3A 3BZCA 4IRCA 2YQEA 4O3RA 4M9GA 1TKDA 1DRGA 3H40A 4R66A 3QZ7A 2W9CB 3UM9A 2K4EA 5ALPA 5EWEA 9ICCA 1XU4A 3WK6A 3GV8B 4O3MA 2YMPA 2FPKA 3ISCA 2XY7A 4O3NA 4ECTA 2ASDA 4FZMA 4GXJA 8ICMA 2ESEA 3LYSA 1TAQA 1V38A 3RB4A 2G07A 5AI0A 2KHVA 2F2AB 3H8SA 1X9MA 3H8WA 4QZDA 4RNMA 3HWTA 5G5GA 2BZFA 1Z00B 3UXPA 5DLFA 2J6UA 2N1RA 2C2DA 5AKLA 4KLMA 2XC9A 1DGJA 5L1JA 4O5EA 5JUMA 3WKCA 4NLGA 4UQGA 3RR8A 4IQWA 5AKKA 4IC9A 5KFFA 1Z00A 1RQLA 5D49A 4EZ6A 1Z3EB 3GIMA 4TUSA 2KKPA 2BCUA 4I29A 1A0PA 3KD3A 4EBDA 3F2CA 4XRHA 4YCXA 1DK3A 3KKAA 4OJ5A 1ZOLA 3HKZC 5HNKA 4UAZA 3Q8QB 2ES6A 4IQVA 5KFJA 2HCFA 3SV3A 3F5EA 4DLGA 4DEZA 2JR5A 2W04A 4YP3A 2PFQA 5KFCA 1Z4OA 5KG0A 9ICOA 4CGZA 4YVZA 3KHRA 4F93B 3RAXA 2FE9A 1BPZA 2ZTEA 2QKQA 2YN4A 3AMZA 2XO7A 5DBAA 5KFWA 5AIAA 1ZQAA 2IA6A 4C0ZA 1SXDA 2W11A 4RQ3A 1RQNA 2NRVA 2NRZA 4YMNA 1ZQLA 1Z19A 1L8OA 3FYHA 2AGOA 5KG3A 1S10A 3H7IA 3QYPA 4JWNA 5AKEA 3OSPA 4RQ6A 4M2YA 4J03A 4Y2SA 2Y0SF 2A1AA 2MU2A 5KTQA 2QB1A 3TFSA 3BQ0A 4RQ4A 3Q8LA 3HRDD 1B0XA 4ECSA 3OJSA 3DEEA 2JV3A 1XNSA 1HIWA 2KHQA 4FZLA 2NO5A 3LDAA 3AUOA 5L1IA 5J0UA 4QZBA 1MC8A 2M9NA 3ZD8A 1U48A 3KFUF 5KFNA 2C28A 3E2EA 3M9OB 5KFRA 4QZFA 5ALVA 5J2KA 4NY8A 5C5JA 3SYZA 3ETLA 2HHVA 1QSYA 9ICQA 3WK9A 4ZOHC 8ICNA 4B6JA 2NV3A 5HR6A 5AI8A 3C29A 2ZTDA 5KFUA 1BVSA 4I2GA 3AU6A 2FJ6A 2K4IA 4C80A 2VIXA 2YB1A 4JUZA 2VKQA 1N62A 5ALMA 4PL1A 4F91B 4YG2A 4NWIA 8ICLA 4Q45A 2Q4TA 2OWOA 4UAVA 4QIWF 4TURA 2JZBA 9ICEA 2JEFA 2LMRA 3QXGA 4UB5A 2ZJ5A 5DLGA 3GU3A 5DB6A 5D4BA 2HOIA 2GLEA 5L1MA 1SL0A 4UB1A 5J8YC 1XSLA 2NYVA 3GILA 1IXRA 5AM2A 4UASA 1ZQQA 4NM1A 1SZPA 5DB8A 3PMLA 2P6RA 4O5KA 1ZQPA 3QEAZ 3ZDBA 4XA5A 3QUBA 4P4PA 3RAQA 3BS5B 2WAQF 3TADA 2F1HA 1NJZA 1N56A 2BQ3A 5DBBA 3L3FX 1BPXA 4AYBF 2P66A 4CCHA 2W7PA 1XO0A 3K4GA 3ZDAA 4QZ9A 3IG8A 5BOMA 1HJPA 2J6SA 3PSIA 3B0XA 7ICOA 2W9AA 1F5SA 4O9MA 4DFDA 4M9JA 1X2IA 4KITB 3MR6A 3BS5A 1KRPA 4GC6A 3QU4A 5J0XA 2ZUCA 5HHHA 3S6JA 3WK8A 5J0OA 1XSNA 2E8OA 4F71A 3JPTA 1TK8A 3M6ZA 4NLZA 9ICPA 4B9NA 4MF8A 7ICUA 1NKBA 5L1LA 2ODGA 2RDJA 4KLDA 2I5HA 2G5HB 1ZJMA 4PPXA 3H0LB 2KG5A 3H4DA 5ALZA 1RYSA 1YZ7A 4RNOA 5KG1A 4C4TA 2ZXIA 3T5LA 2ZTCA 2H3VA 2WF6A 4Y2XA 4R8UB 1TFRA 2BPCA 5CJ7A 4MEXA 5L9XA 4OO1J 1MN8A 2Y0SC 2FPMA 5IIKA 3NVYA 1XC9A 5ALKA 1BPYA 2Y1JA 1CUKA 2W7OA 5KG4A 3NVVA 4K4GA 5J0RA 4XUSA 5ALIA 4RUCA 1KTQA 3SMVA 5KL1B 4R8UA 2EANA 4ACOA 2WB1F 1RPLA 2D6FC 1JX4A 1NNLA 2EQYA 3BQ1A 4Y2JA 1WG8A 2IOFK 4BWJA 2VJ5A 2KFZA 1J2MA 1KDHA 5K4LA 8ICEA 4C4SA 1H38A 1ZQBA 1ZXIA 5JU5A 1AROP 2B6GA 3BQTA 2HHSA 2H3FA 3C1ZA 2HHUA 2YMLA 2J6TA 1B4FA 7ICEA 2VA8A 7ICIA 5AK3A 2JEIA 2K89A 2AJQA 4CNQA 1BNPA 1JXLA 3QEBZ 4J9OA 2LYAA 1SIJA 4UW9A 4QZGA 4DL4A 1LV5A 2KP7A 4KLSA 4QIWC 4WJ3B 4ZH4A 3PSPA 2B0CA 2BR0A 2VANA 5GTIU 3UMGA 4BWMA 3F2DA 4DS5A 1CI4A 2F76X 9ICAA 3WK7A 3L5KA 3RB6A 5DB9A 3EPIA 4G3IA 3NS1A 2DPJA 1X9SA 1OXJA 8ICFA 2EZYA 4O5CA 3HKZF 4CDGA 4KN7A 5ALFA 3TFRA 3G6XA 4M9HA 3SAGA 3CNHA 3TQ1A 4DL6A 3OHBA 3D2QA 2QARB 5IINA 1ZRMA 4F4ZA 2WAQC 9ICFA 1RM6C 3RB3A 2FMQA 2ALZA 4AYBC 1UHUA 1ZQEA 4Z6DA 2KJ9A 4DSJA 5J0YA 4KLHA 4QJFB 2KICA 1ZQRA 5KT4A 2QB0B 2VJ4A 4J9RA 4MHVA 3BQ2A 5J2EA 4I2JA 1LVHA 2KK0A 3TARA 3Q8PB 2QARA 3OTQA 1UQVA 1X40A 1RYUA 4KLIA 4PH5A 1BPDA 3UQ0A 1Q46A 1JMSA 1KFTA 3PX0A 2PKEA 4I2DA 1Q3UA 2QB0A 3IRUA 4RQ0A 5KFDA 3Q8SB 2HVHA 4M9NA 4GLXA 2R18A 5KFEA 2E8MA 3RJFA 3EYZA 8ICIA 4QZIA 5KT7A 3N28A 3MFIA 1UPHA 2FPLA 5KG5A 5FP0A 1HEKA 2DF4B 3PSTA 1X9XA 8ICKA 8ICUA 1Q3VA 2EAMA 9ICIA 4U6PA 5AICA 3GIKA 3SR6A 4NL9C 4FS2A 4F2RA 1VLBA 4PHPA 1KEJA 2HBLA 5KT5A 4RZRA 4GXIA 5ALNA 2HOFA 3RH5A 3D2NA 1NK0A 3F53A 2DPIA 1UCVA 1KLNA 3T5HA 2Q0ZX 3EZ5A 5KFOA 2I1QA 3Q8RB 5F9NA 2V4RA 4F5NA 3UPQA 3CYMA 8ICXA 1PK1B 2WF7A 2WB1C 2LYHA 4QZEA 4RQ2A 4K4IA 1CEZA 1PK3A 3BQ7A 4J9SA 2DBYA 2OXOA 5DB7A 9ICWA 1S9FA 2HMXA 1QSLA 2AXTU 1N2XA 2P6UA 4KLLA 3C5GA 1S0MA 1BGXT 1L3TA 1N63A 1PK1A 2W43A 8ICSA 4DOAA 5J2CA 3PW4A 3G6VA 4KLFA 3QU9A 4P2HA 3R9KA 3GIJA 4I2EA 3JPNA 4O3SA 2HOQA 4O0IA 2ZG6A 2KV2A 3OSNA 5ALUA 3H8MA 1Y88A 3IV6A 3V7JA 5KFKA 2NO4A 5ALHA 2F3NA 1VJ5A 1ZQVA 1QSSA 2BDUA 1SL2A 8ICTA 4DFMA 3CW2C 2JRZA 4YMMA 3ZDDA 4Q8FA 4OD0A 1RG6A 7ICSA 5AM1A 2R8JA 2ASLA 2EZXA 4QZAA 2H3IA 2K4PA 2DKXA 1N48A 1F44A 4F4WA 3ISDA 1V85A 4J9NA 1KW4A 4ECXA 1PVQA 2W3SA 4RQNA 1SV0A 1FEZA 4NV0A 2GWSA 3RRHA 3HT3A 2YB4A 3GDXA 4O3OA 4RT3A 4Q8EA 1B22A 5GTHU 1ED1A 2FLLA 2R8HA 2AH5A 5KFTA 4JB3A 2XVTA 2G5IB 3QU7A 3AN1A 3VC8A 1TAMA 2KVSA 3ALRA 4J9QA 9ICKA 4BX9C 5KG6A 4HAIA 4MFCA 4Y2RA 3AL0B 3SENA 2BCRA 5AK4A 1NK4A 1C20A 3BS7A 1D8LA 3V6HA 4BGDA 4F5PA 2LM1A 4CRXA 3N7PD 4FZNA 4KLEA 4ECYA 5KFBA 4RPYA 3HW8A 3C2KA 3V7LA 4XQ8A 4BDPA 3C21A 8ICVA 3MGHA 1JUDA 1FO4A 3FAHA 3PX4A 2IHMA 9ICXA 1PVPA 4PHDA 4DL3A 4EX7A 3LWLA 3QUTA 3L4PA 4LZDA 1RZTA 5ALTA 4R65A 1KSPA 1ZRNA 1QQ5A 5DGBA 4EEKA 4KMUA 1WYGA 2ZXHA 4ECVA 2IHNA 1NKEA 5CWRA 4QWEA 3AU2A 5AI6A 1SB3C 3RBEA 2W3RA 2H3QA 1NZPA 5KFAA 2D8CA 1JROA 3WKEA 4P4MA 3FM9A 4MFFA 1BPEA 3C1YA 4F2SA 3WKBA 2NRXA 1NK6A 2KJ5A 3D2SA 1S77D 4QWBA 2C2RA 3H8JA 4JV1A 5KFMA 7ICKA 5DQHA 5DQIA 2WTFA 3BDPA 3MABA 2I6XA 3WKAA 5AM3A 4RPZA 2C2EA 2ZIVB 2HBKA 2R8KA 2JZBB 3HPOA 2PMZF 3RH6A 2KD1A 4Z6FA 3A0HU 4RU9A 3H4BA 2VA3A 4QWDA 2LKYA 3GQCA 3LVVA 1ECWA 1A6SA 4EELA 7ICHA 3E0FA 4YQWA 1UT8A 4C8LA 1LB2B 5J0QA 2E8PA 3GV5B 1T8EA 4IR9A 1TV9A 7ICNA 1S8OA 3IDWA 4KX5A 8ICZA 1HUZA 2WF5A 2ZIVA 3LK9A 4UB3A 3PVXA 4EZ9A 3SAFA 1KL9A 4B9VA 1BPBA 2DWQA 5IIMA 5DKWA 3TAQA 4M04A 8ICBA 1J2NA 2R8GA 5AM5A 3PW7A 3RJJA 2ISPA 2YMQA 2IOHA 3TAPA 4FFDA 3RTVA 1KFDA 2F8LA 2O6KA 1XS9D 1S5LU 3RFAA 2ZUDA 4RNNA 1T7PA 4I2IA 5ALDA 3FC4A 4M6WB 5KG7A 1IIPA 4Z6EA 4RQ8A 4UBCA 2K4HA 2HBMA 2XI9A 2I9GA 1IV8A 3WKDA 1D8YA 5ALRA 4F5RA 5AKYA 1DOQA 3M9NB 3C5FA 4NJ8A 2KZMA 1WWUA 1WUDA 1ZETA 5B5EU 5CRXA 1NK8A 2F44A 2CXYA 2WFAA 1NKCA 4C8NA 4DL7A 4M6WA 8ICHA 4NLNA 5KFIA 5CB1A 4KLTA 3F2BA 5CEHA 4ED2A 3A0BU 4EX6A 2AGPA 4Y2UA 4LZGA 1QTMA 3MGIA 3SZ2A 3MC1A 3PX6A 3SQIA 5ALLA 5T14A 1NOMA 1ZQHA 3RBDA 5CHGA 1ZQFA 3NVZA 5EWFA 5J8YA 3HX0A 5AKHA 1CRXA 4QZHA 1ZYQA 3PW2A 5F9LA 4RQMA 4Y2VA 2KOBA 5KFHA 1NJWA 4YR2A 2NRTA 4ECQA 5J0SA 1RXVA 4DLEA 3V7KA 5KNIA 4GFJA 4QW9A 1JRPA 1L7MA 2ATLA 5J0WA 2UVRA 3MDCA 4EBEA 2OM6A 1S97A 4F50A 4YD2A 2KE7A 3KZIU 1X6JA 3K75D 2IOFA 2XY6A 4MFAA 1NK5A 3H0RB 4NLBA 2V9WA 2C22A 2A19A 4KX3A 1X66A 3AQEA 2AHOB 9ICLA 3O0FA 4OJPA 3PV8A 2DL0A 9ICMA 1YT3A 4IS7A 3TANA 2BDPA 1L3UA 5AKIA 2RQ5A 2XCPA 4OJ6A 2W9BB 1QQ6A 1D9DA 2WF9A 1UA1A 8ICAA 5ALJA 5AK5A 5KT6A 4ED8A 4P0PB 1ZQTA 3M8RA 4I28A 2EZZA 1SXEA 2P35A 2RLTA 2PFPA 4J9LA 2NRWA 2PMZC 7ICPA 4K4HA 1SKSA 4KN4A 3T3FA 1ZQZA 1ZJNA 9ICJA 2FLNA 1VDVA 3D6JA 4QNLA 7ICJA 4DSKA 2W9BA 4YD1A 5DG9A 4A8EA 3PR4A 2ISOA 1FFUA 3G6YA 4C7YA 2Z7JA 4ED0A 1NJYA 5KG2A 2W55A 3C2LA 3V72A 4P0PA 8ICPA 3PSFA 5AKGA 1XWLA 2M0NA 4RUAA 5J0TA 3IG5A 3QUCA 1U9LA 5E79U 2E1FA 1QQ7A 3QX7A 5AM0A 2RP5A 3QU5A 1ZQCA 9ICBA 3UXOA 1D9FA 4KMOB 4KLGA 2HHWA 4KLOA 2DFLA 2AQ4A 2FMSA 2XIDA 4KLUA 4Q43A 2JHDA 2AGQA 1TK5A 1JI7A 8ICCA 9ICNA 2FI1A 1MQ2A 2E8NA 4DOCA 3UQ2A 4JWMA 1SZHA 2B21A 3SD7A 5HMLA 5KFSA 5G5HA 3DDHA 5EOZA 5J2AA 4DCCA 3H0MB 4NXZA 3AM9A 4R63A 4JMUA 3I1YA 5DBCA 4NLKA 3HILA 3PNCA 4J9PA 1MA7A 3T79A 4PL2A 3JPOA 2DUYA 4RQ1A 1SV4A 2K60A 1ZQWA 4OCZA 4Z6CA 4QWAA 4G9BA 4O3QA 2HHXA 2K8CB 1T94A 4YN4A 2CPRA 3MR3A 4X5VA 5ALQA 4RQ7A 3RJIA 7ICTA 4TQRA 2WF8A 1V9PA 5D46A 1U49A 4ED7A 4QW8A 1LKYB 1Z4NA 2YMMA 2OH2A 4IRDA 3HJEA 1NK9A 7ICFA 5DDYA 2LI6A 5H2FU 4KLQA 2E5SA 2QLTA 3CRXA 4ECRA 9ICVA 5J29A 5CA7A 1U45A 2FDRA 5KFPA 2KKVA 8ICGA 2HW3A 1LKYA 3QNMA 4UB4A 1KQQA 4DF4A 4P0QB 1GO3F 4R64A 2H3ZA 4PZOA 1M6YA 2JGAA 2KZ3A 5KT3A 4F5QA 1T3NA 1ZQKA 5ALSA 5KFLA 1ZQNA 1XO1A 2LYBA 4IQTA 2V4QA 1Q8KA 4DQQA 3IM1A 3B9JA 4DFJA 4P0QA 3RJEA 3PW5A 3M1YA 4DF8A 9ICHA 2JMGA 2KN7A 1IG6A 4I2AA 5EWGA 5DDMA 4DSLA 3KKAC 4BXOB 3HP6A 5B66U 4MF2A 1OW5A 4F5OA 4NL9A 2BPGA 1ZQOA 9ICGA 4DQSA 5KT2A 4C4RA 1SV0C 4IRKA 2D3DA 9ICSA 2CN1A 1S0NA 2GO7A 1QLNA 4EBCA 5C0YA 2W9CA 3ETRA 1ZQ1C 1L3SA 4ELVA 1ZQSA 2RHFA 2G08A 2VA2A 4MEYA 7ICRA 4JV2A 4I2HA 4F3OA 3GFKB 4BXOA 4QZ8A 2W9MA 1QCKA 1O03A 1B43A 4ED1A 3AEVA 5KAIU 2KJ8A 1KKXA 1TAUA 2UVWA 4F92B 1MSWD 2Y1IA 1SWWA 1WWVA 5ALOA 4EENA 2HHQA 3NUQA 1KN5A 2K8BB 1TE2A 4UB6U 4YXMA 4CE6A 4YFKA 4M47A 5KFGA 2KTQA 3MR2A 1PZNA 3TKAA 4DWIA 3JPRA 4UAWA 4DL5A 4YMOA 4JK1A 2UVUA 3EUB2 2AU0A 5ALEA 4OJLA 5J0PA 3SV4A 2KIVA 1K5OA 2OCEA 5CR0A 4EEYA 4QZCA 1COOA 2E3TA 5ALXA 4F4XA 2KSOB 5EE3A 4RPXA 4B9MA 3M7DA 4USAA 4C8OA 2MAXA 7ICLA 3KOOA 3MDAA 2ZJAA 3SI8A 4C8MA 4FE3A 4UB2A 4PJ0U 5A0LA 3BZKA 9ICRA 4DFKA 2BCQA 3GV7B 3PO5A 5BOLA 5IIJA 5DQGA 4FBUA 2KSOA 1SGGA 2JEGA 2HI0A 4Y2YA 1ZQJA 2KEYA 1ZQXA 1ZQUA 2G06A 4RQ5A 4J9MA 3E58A 5KAFU 5J2BA 3OHAA 4ELTA 1S0OA 5ALYA 4PZNA 4DL2A 5IILA 3F5AA 5J2HA 4US9A 3V6KA 1Z1VA 2ZJ8A 4UAUA 2MRLA 5JRTA 7ICVA 5AKXA 3N4MB 5AM4A 3GZFA 3PO4A 2ZIXB 2LPEA 2JXJA 5JTIA 2HBJA 1OUQA 3MBYA 4PGXA 4M0AA 2FMPA 1T3QA 4F72A 3KBBA 5HHIA 5BPCA 1UA0A 4ICAA 2A3VA 2PFNA 4Q44A 1JALA 1XSPA 3C2MA 1JIHA 4DS4A 2XICA 4J9KA 4ED3A 4DQPA 5HR7A 3ED5A 1DXSA 2ZIXA 5L1KA 2F1JA 3T5KA 3TADC 2KZZA 4EYHB 2JH1A 4HYKA 1SWVA 3TI0A 3NRZA 4CF4A 4FS1A 1ZD4A 3LVWA 4KTQA 1K1SA 2FLPA 2RDIA 2DGZA 1WCNA 1PUZA 1N5WA 3FDSA 1EXNA 2KMDA 3RJHA 2K8AA 1NK7A 8ICOA 2W54A 3SAHA 4I2FA 2CRXA 2OYYA 5EE9A 3EWAA 2W03A 2G0AA 5AKJA 4YXJA 4I2BA 2ZUBA 5EE0A 3GIIA 2RRDA 2XY5A 1X42A 2BQRA 4TUQA 2KIWA 2YX8A 3U26A 2F8KA 4UBBA 2GOLA 1O08A 2H5XA 2KNJA 5IIOA 1Z1BA 2EH9A 2MA1A 2PI4A 2KFNA 2PXIA 1K1QA 3B0YA 3MGVA 1V97A 3KHGA 1L5UA 3OJUA 2PFOA 1WCLA 4IQUA 1L7OA 4B9LA 1RDFA 3AQFA 2BCSA 2BPFA 8ICRA 3PY8A 4ED6A 1L8LA 4FBTA 4B9UA 5J2GA 4DSIA 2JEJA 3UMCA 1S76D 4EYIB 3JPQA 4TQSA 3M6KA 3ORYA 4U7CA 1X9WA 2LHTA 5F3XB 3MR5A 1ZQIA 2BQUA 4GXKA 2EDUA 4B9TA 4ECWA 5KFZA 8ICJA 5TISU 3RH4A 5AI5A 5J2DA 3Q8KA 9ICUA 1NZBA 2IBKA 3SEIA 1P7DA 2MUTB 5AI4A 4CF3A 5HP4A 2HDOA 4IR1A 4I2CA 1COKA 2ASJA 2R8IA 2PI5A 5AI9A 2WHEA 3OPXA 3NGDA 2XGQA 3K1ZA 3I76A 3ZDCA 4LVSA 3KZXA 1ZD3A 1KFSA 2JH7A 3K1RB 4RT2A 4UAYA 4I27A 2YY6A 4O3PA 2BGWA 1QH9A 1C7YA 4UATA 1S0VA 3RR7A 4GC7A 2MUTA 2MSNA 3N97B 2EAPA 4US8A 1URJA 1X6IA 3NRWA 3QU2A 2BKEA 4OJOA 3ZI4A 1ZQYA 4CF5A 2ZIWB 1N5XA 3TACB 8ICQA 3ONNA 4DSFA 4Y2QA 4PGYA 3KHHA 3Q8MA 4KLJA 4BJQA 3V6JA 1F0MA 1JN3A 2UVVA 3C28A 3ICXA 4LJXA 3RRGA 1SKRA 4ECZA 3N7RC 3NVWA 1RYRA 5ALWA 4PGQA 2XGPA 3NTUA 3WK4A 2ZIWA 3I28A 1J97A 4NM2A 2YTUA 3C23A 1D8BA 1FIQA 4JV0A 3IN5A 4ECUA 2F1IA 3EPGA 1L6NA 2XCAA 2HHTA 8ICYA 4DOBA 3DV9A 3QZ8A 4AP9A 5KL8B 5J2IA 1MQ3A 4ELUA 5EE1A 5IIIA 3PW0A 3LWMA 2E1EA 5KFYA 2L5YA 2Y9TA 4M9LA 1N60A 3BJYA 4PHAA 3PZPA 3RB0A 1BNOA 1L3VA 5CP2A 4F8RA 2HSZA 2BCVA 3J81j 4C7ZA 3VCBA 4C8KA 3OGUA 3JPPA 1ZQDA 1L7PA 4PHEA 3UMBA 4E0DA 2DKZA 5J2FA 2A1JB 4DQIA 1U4BA 1A76A 5AK6A 2IMWP 1AQ6A 2G09A 3JPSA 1HUOA 4YR0A 1JXEA 5ALGA 3EW9A 1DK2A 2F77X 5DGAA 1N61A 3QUQA 2AQ0A 2LM4A 4UB8U 2OEHA 2LBOA 3WK5A 4GIBA 4F4KA 3M8SA 2GH1A 4YR3A 7ICQA 5HMMA 9ICTA 3RF9A
chains in the Genus database with same CATH topology
1LKYB 2LMRA 2ESEA 2F8KA 1Z1VA 1SXDA 1V38A 3TACB 5JRTA 1WWVA 5J8YA 1PK1B 2GLEA 5L1MA 1F0MA 2QARB 2LPEA 4RQMA 5J8YC 5JTIA 2E8PA 1PK3A 2EAOA 3SENA 3BQ7A 3IDWA 3BS7A 5KNIA 1LKYA 2EANA 2QB0B 4MHVA 2QB1A 3BS5B 3TADA 1JI7A 2YTUA 4PZOA 1PK1A 1B0XA 2KE7A 1DXSA 2JV3A 2QARA 2Y9UA 2KIVA 1UQVA 1X40A 3TADC 2E8NA 5F3XB 5JU5A 1X66A 2KSOB 2B6GA 2QB0A 2L5YA 2Y9TA 3KKAA 3BS5A 1B4FA 2DL0A 1OXJA 4IS7A 2E8MA 3H8MA 2ES6A 4NJ8A 3SEIA 3KKAC 2F3NA 2E8OA 1WWUA 2D8CA 1COKA 1OW5A 3HILA 4NL9A 2DKZA 2K60A 2F44A 1SV4A 2KMDA 1SV0C 1X9XA 2D3DA 2KSOA 1RG6A 2EAMA 1SGGA 4NL9C 1SXEA 2K4PA 3K1RB 2DKXA 2FE9A 1V85A 2QKQA 2KG5A 1KW4A 4PZNA 1SV0A 4RQNA 2EAPA 1UCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKY B;  2LMR A;  2ESE A;  2F8K A;  1Z1V A;  1SXD A;  1V38 A;  3TAC B;  5JRT A;  1WWV A;  5J8Y A;  1PK1 B;  2GLE A;  5L1M A;  1F0M A;  2QAR B;  2LPE A;  4RQM A;  5J8Y C;  5JTI A;  2E8P A;  1PK3 A;  2EAO A;  3SEN A;  3BQ7 A;  3IDW A;  3BS7 A;  5KNI A;  1LKY A;  2EAN A;  2QB0 B;  4MHV A;  2QB1 A;  3BS5 B;  3TAD A;  1JI7 A;  2YTU A;  4PZO A;  1PK1 A;  1B0X A;  2KE7 A;  1DXS A;  2JV3 A;  2QAR A;  2Y9U A;  2KIV A;  1UQV A;  1X40 A;  3TAD C;  2E8N A;  5F3X B;  5JU5 A;  1X66 A;  2KSO B;  2B6G A;  2QB0 A;  2L5Y A;  2Y9T A;  3KKA A;  3BS5 A;  1B4F A;  2DL0 A;  1OXJ A;  4IS7 A;  2E8M A;  3H8M A;  2ES6 A;  4NJ8 A;  3SEI A;  3KKA C;  2F3N A;  2E8O A;  1WWU A;  2D8C A;  1COK A;  1OW5 A;  3HIL A;  4NL9 A;  2DKZ A;  2K60 A;  2F44 A;  1SV4 A;  2KMD A;  1SV0 C;  1X9X A;  2D3D A;  2KSO A;  1RG6 A;  2EAM A;  1SGG A;  4NL9 C;  1SXE A;  2K4P A;  3K1R B;  2DKX A;  2FE9 A;  1V85 A;  2QKQ A;  2KG5 A;  1KW4 A;  4PZN A;  1SV0 A;  4RQN A;  2EAP A;  1UCV A; 
#chains in the Genus database with same CATH topology
 1A77 A;  2A1J A;  4DSE A;  1RXW A;  3NAS A;  4UAR A;  4Y2T A;  1ZQM A;  4FO6 A;  3N7S C;  1PVR A;  3ZDE A;  1NJX A;  2OHF A;  1T4G A;  4DO9 A;  4TUP A;  1KBU A;  3MFH A;  2HVI A;  5KFV A;  2EAO A;  1UT5 A;  5KFX A;  5J2J A;  1TK0 A;  3KTQ A;  3PMN A;  2BHN A;  4NLC A;  5TZV A;  3KHL A;  2KVC A;  5KFQ A;  4DQR A;  1TVA A;  3CP8 A;  8ICW A;  5AKZ A;  2ZIU B;  1DGS A;  1L7N A;  5AHX A;  5AIB A;  1FFV A;  7ICM A;  1SL1 A;  3PR5 B;  2Y9U A;  1U47 A;  1ZD5 A;  2W8L A;  4F4Y A;  4BUG A;  1ZD2 P;  3M9M B;  2W8K A;  4IL6 U;  3QE9 Y;  3RJG A;  3ISB A;  1ZQG A;  3WU2 U;  2ZIU A;  3T5J A;  3IHQ B;  4P4O A;  3IP4 B;  2DQN B;  4DFP A;  3UXN A;  7ICG A;  5DG7 A;  3ZD9 A;  1SKW A;  3RJK A;  4B9S A;  5DG8 A;  1YZ6 A;  4Y2P A;  4QWC A;  3THV A;  1IM4 A;  1NI3 A;  3BZC A;  4IRC A;  2YQE A;  4O3R A;  4M9G A;  1TKD A;  1DRG A;  3H40 A;  4R66 A;  3QZ7 A;  2W9C B;  3UM9 A;  2K4E A;  5ALP A;  5EWE A;  9ICC A;  1XU4 A;  3WK6 A;  3GV8 B;  4O3M A;  2YMP A;  2FPK A;  3ISC A;  2XY7 A;  4O3N A;  4ECT A;  2ASD A;  4FZM A;  4GXJ A;  8ICM A;  2ESE A;  3LYS A;  1TAQ A;  1V38 A;  3RB4 A;  2G07 A;  5AI0 A;  2KHV A;  2F2A B;  3H8S A;  1X9M A;  3H8W A;  4QZD A;  4RNM A;  3HWT A;  5G5G A;  2BZF A;  1Z00 B;  3UXP A;  5DLF A;  2J6U A;  2N1R A;  2C2D A;  5AKL A;  4KLM A;  2XC9 A;  1DGJ A;  5L1J A;  4O5E A;  5JUM A;  3WKC A;  4NLG A;  4UQG A;  3RR8 A;  4IQW A;  5AKK A;  4IC9 A;  5KFF A;  1Z00 A;  1RQL A;  5D49 A;  4EZ6 A;  1Z3E B;  3GIM A;  4TUS A;  2KKP A;  2BCU A;  4I29 A;  1A0P A;  3KD3 A;  4EBD A;  3F2C A;  4XRH A;  4YCX A;  1DK3 A;  3KKA A;  4OJ5 A;  1ZOL A;  3HKZ C;  5HNK A;  4UAZ A;  3Q8Q B;  2ES6 A;  4IQV A;  5KFJ A;  2HCF A;  3SV3 A;  3F5E A;  4DLG A;  4DEZ A;  2JR5 A;  2W04 A;  4YP3 A;  2PFQ A;  5KFC A;  1Z4O A;  5KG0 A;  9ICO A;  4CGZ A;  4YVZ A;  3KHR A;  4F93 B;  3RAX A;  2FE9 A;  1BPZ A;  2ZTE A;  2QKQ A;  2YN4 A;  3AMZ A;  2XO7 A;  5DBA A;  5KFW A;  5AIA A;  1ZQA A;  2IA6 A;  4C0Z A;  1SXD A;  2W11 A;  4RQ3 A;  1RQN A;  2NRV A;  2NRZ A;  4YMN A;  1ZQL A;  1Z19 A;  1L8O A;  3FYH A;  2AGO A;  5KG3 A;  1S10 A;  3H7I A;  3QYP A;  4JWN A;  5AKE A;  3OSP A;  4RQ6 A;  4M2Y A;  4J03 A;  4Y2S A;  2Y0S F;  2A1A A;  2MU2 A;  5KTQ A;  2QB1 A;  3TFS A;  3BQ0 A;  4RQ4 A;  3Q8L A;  3HRD D;  1B0X A;  4ECS A;  3OJS A;  3DEE A;  2JV3 A;  1XNS A;  1HIW A;  2KHQ A;  4FZL A;  2NO5 A;  3LDA A;  3AUO A;  5L1I A;  5J0U A;  4QZB A;  1MC8 A;  2M9N A;  3ZD8 A;  1U48 A;  3KFU F;  5KFN A;  2C28 A;  3E2E A;  3M9O B;  5KFR A;  4QZF A;  5ALV A;  5J2K A;  4NY8 A;  5C5J A;  3SYZ A;  3ETL A;  2HHV A;  1QSY A;  9ICQ A;  3WK9 A;  4ZOH C;  8ICN A;  4B6J A;  2NV3 A;  5HR6 A;  5AI8 A;  3C29 A;  2ZTD A;  5KFU A;  1BVS A;  4I2G A;  3AU6 A;  2FJ6 A;  2K4I A;  4C80 A;  2VIX A;  2YB1 A;  4JUZ A;  2VKQ A;  1N62 A;  5ALM A;  4PL1 A;  4F91 B;  4YG2 A;  4NWI A;  8ICL A;  4Q45 A;  2Q4T A;  2OWO A;  4UAV A;  4QIW F;  4TUR A;  2JZB A;  9ICE A;  2JEF A;  2LMR A;  3QXG A;  4UB5 A;  2ZJ5 A;  5DLG A;  3GU3 A;  5DB6 A;  5D4B A;  2HOI A;  2GLE A;  5L1M A;  1SL0 A;  4UB1 A;  5J8Y C;  1XSL A;  2NYV A;  3GIL A;  1IXR A;  5AM2 A;  4UAS A;  1ZQQ A;  4NM1 A;  1SZP A;  5DB8 A;  3PML A;  2P6R A;  4O5K A;  1ZQP A;  3QEA Z;  3ZDB A;  4XA5 A;  3QUB A;  4P4P A;  3RAQ A;  3BS5 B;  2WAQ F;  3TAD A;  2F1H A;  1NJZ A;  1N56 A;  2BQ3 A;  5DBB A;  3L3F X;  1BPX A;  4AYB F;  2P66 A;  4CCH A;  2W7P A;  1XO0 A;  3K4G A;  3ZDA A;  4QZ9 A;  3IG8 A;  5BOM A;  1HJP A;  2J6S A;  3PSI A;  3B0X A;  7ICO A;  2W9A A;  1F5S A;  4O9M A;  4DFD A;  4M9J A;  1X2I A;  4KIT B;  3MR6 A;  3BS5 A;  1KRP A;  4GC6 A;  3QU4 A;  5J0X A;  2ZUC A;  5HHH A;  3S6J A;  3WK8 A;  5J0O A;  1XSN A;  2E8O A;  4F71 A;  3JPT A;  1TK8 A;  3M6Z A;  4NLZ A;  9ICP A;  4B9N A;  4MF8 A;  7ICU A;  1NKB A;  5L1L A;  2ODG A;  2RDJ A;  4KLD A;  2I5H A;  2G5H B;  1ZJM A;  4PPX A;  3H0L B;  2KG5 A;  3H4D A;  5ALZ A;  1RYS A;  1YZ7 A;  4RNO A;  5KG1 A;  4C4T A;  2ZXI A;  3T5L A;  2ZTC A;  2H3V A;  2WF6 A;  4Y2X A;  4R8U B;  1TFR A;  2BPC A;  5CJ7 A;  4MEX A;  5L9X A;  4OO1 J;  1MN8 A;  2Y0S C;  2FPM A;  5IIK A;  3NVY A;  1XC9 A;  5ALK A;  1BPY A;  2Y1J A;  1CUK A;  2W7O A;  5KG4 A;  3NVV A;  4K4G A;  5J0R A;  4XUS A;  5ALI A;  4RUC A;  1KTQ A;  3SMV A;  5KL1 B;  4R8U A;  2EAN A;  4ACO A;  2WB1 F;  1RPL A;  2D6F C;  1JX4 A;  1NNL A;  2EQY A;  3BQ1 A;  4Y2J A;  1WG8 A;  2IOF K;  4BWJ A;  2VJ5 A;  2KFZ A;  1J2M A;  1KDH A;  5K4L A;  8ICE A;  4C4S A;  1H38 A;  1ZQB A;  1ZXI A;  5JU5 A;  1ARO P;  2B6G A;  3BQT A;  2HHS A;  2H3F A;  3C1Z A;  2HHU A;  2YML A;  2J6T A;  1B4F A;  7ICE A;  2VA8 A;  7ICI A;  5AK3 A;  2JEI A;  2K89 A;  2AJQ A;  4CNQ A;  1BNP A;  1JXL A;  3QEB Z;  4J9O A;  2LYA A;  1SIJ A;  4UW9 A;  4QZG A;  4DL4 A;  1LV5 A;  2KP7 A;  4KLS A;  4QIW C;  4WJ3 B;  4ZH4 A;  3PSP A;  2B0C A;  2BR0 A;  2VAN A;  5GTI U;  3UMG A;  4BWM A;  3F2D A;  4DS5 A;  1CI4 A;  2F76 X;  9ICA A;  3WK7 A;  3L5K A;  3RB6 A;  5DB9 A;  3EPI A;  4G3I A;  3NS1 A;  2DPJ A;  1X9S A;  1OXJ A;  8ICF A;  2EZY A;  4O5C A;  3HKZ F;  4CDG A;  4KN7 A;  5ALF A;  3TFR A;  3G6X A;  4M9H A;  3SAG A;  3CNH A;  3TQ1 A;  4DL6 A;  3OHB A;  3D2Q A;  2QAR B;  5IIN A;  1ZRM A;  4F4Z A;  2WAQ C;  9ICF A;  1RM6 C;  3RB3 A;  2FMQ A;  2ALZ A;  4AYB C;  1UHU A;  1ZQE A;  4Z6D A;  2KJ9 A;  4DSJ A;  5J0Y A;  4KLH A;  4QJF B;  2KIC A;  1ZQR A;  5KT4 A;  2QB0 B;  2VJ4 A;  4J9R A;  4MHV A;  3BQ2 A;  5J2E A;  4I2J A;  1LVH A;  2KK0 A;  3TAR A;  3Q8P B;  2QAR A;  3OTQ A;  1UQV A;  1X40 A;  1RYU A;  4KLI A;  4PH5 A;  1BPD A;  3UQ0 A;  1Q46 A;  1JMS A;  1KFT A;  3PX0 A;  2PKE A;  4I2D A;  1Q3U A;  2QB0 A;  3IRU A;  4RQ0 A;  5KFD A;  3Q8S B;  2HVH A;  4M9N A;  4GLX A;  2R18 A;  5KFE A;  2E8M A;  3RJF A;  3EYZ A;  8ICI A;  4QZI A;  5KT7 A;  3N28 A;  3MFI A;  1UPH A;  2FPL A;  5KG5 A;  5FP0 A;  1HEK A;  2DF4 B;  3PST A;  1X9X A;  8ICK A;  8ICU A;  1Q3V A;  2EAM A;  9ICI A;  4U6P A;  5AIC A;  3GIK A;  3SR6 A;  4NL9 C;  4FS2 A;  4F2R A;  1VLB A;  4PHP A;  1KEJ A;  2HBL A;  5KT5 A;  4RZR A;  4GXI A;  5ALN A;  2HOF A;  3RH5 A;  3D2N A;  1NK0 A;  3F53 A;  2DPI A;  1UCV A;  1KLN A;  3T5H A;  2Q0Z X;  3EZ5 A;  5KFO A;  2I1Q A;  3Q8R B;  5F9N A;  2V4R A;  4F5N A;  3UPQ A;  3CYM A;  8ICX A;  1PK1 B;  2WF7 A;  2WB1 C;  2LYH A;  4QZE A;  4RQ2 A;  4K4I A;  1CEZ A;  1PK3 A;  3BQ7 A;  4J9S A;  2DBY A;  2OXO A;  5DB7 A;  9ICW A;  1S9F A;  2HMX A;  1QSL A;  2AXT U;  1N2X A;  2P6U A;  4KLL A;  3C5G A;  1S0M A;  1BGX T;  1L3T A;  1N63 A;  1PK1 A;  2W43 A;  8ICS A;  4DOA A;  5J2C A;  3PW4 A;  3G6V A;  4KLF A;  3QU9 A;  4P2H A;  3R9K A;  3GIJ A;  4I2E A;  3JPN A;  4O3S A;  2HOQ A;  4O0I A;  2ZG6 A;  2KV2 A;  3OSN A;  5ALU A;  3H8M A;  1Y88 A;  3IV6 A;  3V7J A;  5KFK A;  2NO4 A;  5ALH A;  2F3N A;  1VJ5 A;  1ZQV A;  1QSS A;  2BDU A;  1SL2 A;  8ICT A;  4DFM A;  3CW2 C;  2JRZ A;  4YMM A;  3ZDD A;  4Q8F A;  4OD0 A;  1RG6 A;  7ICS A;  5AM1 A;  2R8J A;  2ASL A;  2EZX A;  4QZA A;  2H3I A;  2K4P A;  2DKX A;  1N48 A;  1F44 A;  4F4W A;  3ISD A;  1V85 A;  4J9N A;  1KW4 A;  4ECX A;  1PVQ A;  2W3S A;  4RQN A;  1SV0 A;  1FEZ A;  4NV0 A;  2GWS A;  3RRH A;  3HT3 A;  2YB4 A;  3GDX A;  4O3O A;  4RT3 A;  4Q8E A;  1B22 A;  5GTH U;  1ED1 A;  2FLL A;  2R8H A;  2AH5 A;  5KFT A;  4JB3 A;  2XVT A;  2G5I B;  3QU7 A;  3AN1 A;  3VC8 A;  1TAM A;  2KVS A;  3ALR A;  4J9Q A;  9ICK A;  4BX9 C;  5KG6 A;  4HAI A;  4MFC A;  4Y2R A;  3AL0 B;  3SEN A;  2BCR A;  5AK4 A;  1NK4 A;  1C20 A;  3BS7 A;  1D8L A;  3V6H A;  4BGD A;  4F5P A;  2LM1 A;  4CRX A;  3N7P D;  4FZN A;  4KLE A;  4ECY A;  5KFB A;  4RPY A;  3HW8 A;  3C2K A;  3V7L A;  4XQ8 A;  4BDP A;  3C21 A;  8ICV A;  3MGH A;  1JUD A;  1FO4 A;  3FAH A;  3PX4 A;  2IHM A;  9ICX A;  1PVP A;  4PHD A;  4DL3 A;  4EX7 A;  3LWL A;  3QUT A;  3L4P A;  4LZD A;  1RZT A;  5ALT A;  4R65 A;  1KSP A;  1ZRN A;  1QQ5 A;  5DGB A;  4EEK A;  4KMU A;  1WYG A;  2ZXH A;  4ECV A;  2IHN A;  1NKE A;  5CWR A;  4QWE A;  3AU2 A;  5AI6 A;  1SB3 C;  3RBE A;  2W3R A;  2H3Q A;  1NZP A;  5KFA A;  2D8C A;  1JRO A;  3WKE A;  4P4M A;  3FM9 A;  4MFF A;  1BPE A;  3C1Y A;  4F2S A;  3WKB A;  2NRX A;  1NK6 A;  2KJ5 A;  3D2S A;  1S77 D;  4QWB A;  2C2R A;  3H8J A;  4JV1 A;  5KFM A;  7ICK A;  5DQH A;  5DQI A;  2WTF A;  3BDP A;  3MAB A;  2I6X A;  3WKA A;  5AM3 A;  4RPZ A;  2C2E A;  2ZIV B;  2HBK A;  2R8K A;  2JZB B;  3HPO A;  2PMZ F;  3RH6 A;  2KD1 A;  4Z6F A;  3A0H U;  4RU9 A;  3H4B A;  2VA3 A;  4QWD A;  2LKY A;  3GQC A;  3LVV A;  1ECW A;  1A6S A;  4EEL A;  7ICH A;  3E0F A;  4YQW A;  1UT8 A;  4C8L A;  1LB2 B;  5J0Q A;  2E8P A;  3GV5 B;  1T8E A;  4IR9 A;  1TV9 A;  7ICN A;  1S8O A;  3IDW A;  4KX5 A;  8ICZ A;  1HUZ A;  2WF5 A;  2ZIV A;  3LK9 A;  4UB3 A;  3PVX A;  4EZ9 A;  3SAF A;  1KL9 A;  4B9V A;  1BPB A;  2DWQ A;  5IIM A;  5DKW A;  3TAQ A;  4M04 A;  8ICB A;  1J2N A;  2R8G A;  5AM5 A;  3PW7 A;  3RJJ A;  2ISP A;  2YMQ A;  2IOH A;  3TAP A;  4FFD A;  3RTV A;  1KFD A;  2F8L A;  2O6K A;  1XS9 D;  1S5L U;  3RFA A;  2ZUD A;  4RNN A;  1T7P A;  4I2I A;  5ALD A;  3FC4 A;  4M6W B;  5KG7 A;  1IIP A;  4Z6E A;  4RQ8 A;  4UBC A;  2K4H A;  2HBM A;  2XI9 A;  2I9G A;  1IV8 A;  3WKD A;  1D8Y A;  5ALR A;  4F5R A;  5AKY A;  1DOQ A;  3M9N B;  3C5F A;  4NJ8 A;  2KZM A;  1WWU A;  1WUD A;  1ZET A;  5B5E U;  5CRX A;  1NK8 A;  2F44 A;  2CXY A;  2WFA A;  1NKC A;  4C8N A;  4DL7 A;  4M6W A;  8ICH A;  4NLN A;  5KFI A;  5CB1 A;  4KLT A;  3F2B A;  5CEH A;  4ED2 A;  3A0B U;  4EX6 A;  2AGP A;  4Y2U A;  4LZG A;  1QTM A;  3MGI A;  3SZ2 A;  3MC1 A;  3PX6 A;  3SQI A;  5ALL A;  5T14 A;  1NOM A;  1ZQH A;  3RBD A;  5CHG A;  1ZQF A;  3NVZ A;  5EWF A;  5J8Y A;  3HX0 A;  5AKH A;  1CRX A;  4QZH A;  1ZYQ A;  3PW2 A;  5F9L A;  4RQM A;  4Y2V A;  2KOB A;  5KFH A;  1NJW A;  4YR2 A;  2NRT A;  4ECQ A;  5J0S A;  1RXV A;  4DLE A;  3V7K A;  5KNI A;  4GFJ A;  4QW9 A;  1JRP A;  1L7M A;  2ATL A;  5J0W A;  2UVR A;  3MDC A;  4EBE A;  2OM6 A;  1S97 A;  4F50 A;  4YD2 A;  2KE7 A;  3KZI U;  1X6J A;  3K75 D;  2IOF A;  2XY6 A;  4MFA A;  1NK5 A;  3H0R B;  4NLB A;  2V9W A;  2C22 A;  2A19 A;  4KX3 A;  1X66 A;  3AQE A;  2AHO B;  9ICL A;  3O0F A;  4OJP A;  3PV8 A;  2DL0 A;  9ICM A;  1YT3 A;  4IS7 A;  3TAN A;  2BDP A;  1L3U A;  5AKI A;  2RQ5 A;  2XCP A;  4OJ6 A;  2W9B B;  1QQ6 A;  1D9D A;  2WF9 A;  1UA1 A;  8ICA A;  5ALJ A;  5AK5 A;  5KT6 A;  4ED8 A;  4P0P B;  1ZQT A;  3M8R A;  4I28 A;  2EZZ A;  1SXE A;  2P35 A;  2RLT A;  2PFP A;  4J9L A;  2NRW A;  2PMZ C;  7ICP A;  4K4H A;  1SKS A;  4KN4 A;  3T3F A;  1ZQZ A;  1ZJN A;  9ICJ A;  2FLN A;  1VDV A;  3D6J A;  4QNL A;  7ICJ A;  4DSK A;  2W9B A;  4YD1 A;  5DG9 A;  4A8E A;  3PR4 A;  2ISO A;  1FFU A;  3G6Y A;  4C7Y A;  2Z7J A;  4ED0 A;  1NJY A;  5KG2 A;  2W55 A;  3C2L A;  3V72 A;  4P0P A;  8ICP A;  3PSF A;  5AKG A;  1XWL A;  2M0N A;  4RUA A;  5J0T A;  3IG5 A;  3QUC A;  1U9L A;  5E79 U;  2E1F A;  1QQ7 A;  3QX7 A;  5AM0 A;  2RP5 A;  3QU5 A;  1ZQC A;  9ICB A;  3UXO A;  1D9F A;  4KMO B;  4KLG A;  2HHW A;  4KLO A;  2DFL A;  2AQ4 A;  2FMS A;  2XID A;  4KLU A;  4Q43 A;  2JHD A;  2AGQ A;  1TK5 A;  1JI7 A;  8ICC A;  9ICN A;  2FI1 A;  1MQ2 A;  2E8N A;  4DOC A;  3UQ2 A;  4JWM A;  1SZH A;  2B21 A;  3SD7 A;  5HML A;  5KFS A;  5G5H A;  3DDH A;  5EOZ A;  5J2A A;  4DCC A;  3H0M B;  4NXZ A;  3AM9 A;  4R63 A;  4JMU A;  3I1Y A;  5DBC A;  4NLK A;  3HIL A;  3PNC A;  4J9P A;  1MA7 A;  3T79 A;  4PL2 A;  3JPO A;  2DUY A;  4RQ1 A;  1SV4 A;  2K60 A;  1ZQW A;  4OCZ A;  4Z6C A;  4QWA A;  4G9B A;  4O3Q A;  2HHX A;  2K8C B;  1T94 A;  4YN4 A;  2CPR A;  3MR3 A;  4X5V A;  5ALQ A;  4RQ7 A;  3RJI A;  7ICT A;  4TQR A;  2WF8 A;  1V9P A;  5D46 A;  1U49 A;  4ED7 A;  4QW8 A;  1LKY B;  1Z4N A;  2YMM A;  2OH2 A;  4IRD A;  3HJE A;  1NK9 A;  7ICF A;  5DDY A;  2LI6 A;  5H2F U;  4KLQ A;  2E5S A;  2QLT A;  3CRX A;  4ECR A;  9ICV A;  5J29 A;  5CA7 A;  1U45 A;  2FDR A;  5KFP A;  2KKV A;  8ICG A;  2HW3 A;  1LKY A;  3QNM A;  4UB4 A;  1KQQ A;  4DF4 A;  4P0Q B;  1GO3 F;  4R64 A;  2H3Z A;  4PZO A;  1M6Y A;  2JGA A;  2KZ3 A;  5KT3 A;  4F5Q A;  1T3N A;  1ZQK A;  5ALS A;  5KFL A;  1ZQN A;  1XO1 A;  2LYB A;  4IQT A;  2V4Q A;  1Q8K A;  4DQQ A;  3IM1 A;  3B9J A;  4DFJ A;  4P0Q A;  3RJE A;  3PW5 A;  3M1Y A;  4DF8 A;  9ICH A;  2JMG A;  2KN7 A;  1IG6 A;  4I2A A;  5EWG A;  5DDM A;  4DSL A;  3KKA C;  4BXO B;  3HP6 A;  5B66 U;  4MF2 A;  1OW5 A;  4F5O A;  4NL9 A;  2BPG A;  1ZQO A;  9ICG A;  4DQS A;  5KT2 A;  4C4R A;  1SV0 C;  4IRK A;  2D3D A;  9ICS A;  2CN1 A;  1S0N A;  2GO7 A;  1QLN A;  4EBC A;  5C0Y A;  2W9C A;  3ETR A;  1ZQ1 C;  1L3S A;  4ELV A;  1ZQS A;  2RHF A;  2G08 A;  2VA2 A;  4MEY A;  7ICR A;  4JV2 A;  4I2H A;  4F3O A;  3GFK B;  4BXO A;  4QZ8 A;  2W9M A;  1QCK A;  1O03 A;  1B43 A;  4ED1 A;  3AEV A;  5KAI U;  2KJ8 A;  1KKX A;  1TAU A;  2UVW A;  4F92 B;  1MSW D;  2Y1I A;  1SWW A;  1WWV A;  5ALO A;  4EEN A;  2HHQ A;  3NUQ A;  1KN5 A;  2K8B B;  1TE2 A;  4UB6 U;  4YXM A;  4CE6 A;  4YFK A;  4M47 A;  5KFG A;  2KTQ A;  3MR2 A;  1PZN A;  3TKA A;  4DWI A;  3JPR A;  4UAW A;  4DL5 A;  4YMO A;  4JK1 A;  2UVU A;  3EUB 2;  2AU0 A;  5ALE A;  4OJL A;  5J0P A;  3SV4 A;  2KIV A;  1K5O A;  2OCE A;  5CR0 A;  4EEY A;  4QZC A;  1COO A;  2E3T A;  5ALX A;  4F4X A;  2KSO B;  5EE3 A;  4RPX A;  4B9M A;  3M7D A;  4USA A;  4C8O A;  2MAX A;  7ICL A;  3KOO A;  3MDA A;  2ZJA A;  3SI8 A;  4C8M A;  4FE3 A;  4UB2 A;  4PJ0 U;  5A0L A;  3BZK A;  9ICR A;  4DFK A;  2BCQ A;  3GV7 B;  3PO5 A;  5BOL A;  5IIJ A;  5DQG A;  4FBU A;  2KSO A;  1SGG A;  2JEG A;  2HI0 A;  4Y2Y A;  1ZQJ A;  2KEY A;  1ZQX A;  1ZQU A;  2G06 A;  4RQ5 A;  4J9M A;  3E58 A;  5KAF U;  5J2B A;  3OHA A;  4ELT A;  1S0O A;  5ALY A;  4PZN A;  4DL2 A;  5IIL A;  3F5A A;  5J2H A;  4US9 A;  3V6K A;  1Z1V A;  2ZJ8 A;  4UAU A;  2MRL A;  5JRT A;  7ICV A;  5AKX A;  3N4M B;  5AM4 A;  3GZF A;  3PO4 A;  2ZIX B;  2LPE A;  2JXJ A;  5JTI A;  2HBJ A;  1OUQ A;  3MBY A;  4PGX A;  4M0A A;  2FMP A;  1T3Q A;  4F72 A;  3KBB A;  5HHI A;  5BPC A;  1UA0 A;  4ICA A;  2A3V A;  2PFN A;  4Q44 A;  1JAL A;  1XSP A;  3C2M A;  1JIH A;  4DS4 A;  2XIC A;  4J9K A;  4ED3 A;  4DQP A;  5HR7 A;  3ED5 A;  1DXS A;  2ZIX A;  5L1K A;  2F1J A;  3T5K A;  3TAD C;  2KZZ A;  4EYH B;  2JH1 A;  4HYK A;  1SWV A;  3TI0 A;  3NRZ A;  4CF4 A;  4FS1 A;  1ZD4 A;  3LVW A;  4KTQ A;  1K1S A;  2FLP A;  2RDI A;  2DGZ A;  1WCN A;  1PUZ A;  1N5W A;  3FDS A;  1EXN A;  2KMD A;  3RJH A;  2K8A A;  1NK7 A;  8ICO A;  2W54 A;  3SAH A;  4I2F A;  2CRX A;  2OYY A;  5EE9 A;  3EWA A;  2W03 A;  2G0A A;  5AKJ A;  4YXJ A;  4I2B A;  2ZUB A;  5EE0 A;  3GII A;  2RRD A;  2XY5 A;  1X42 A;  2BQR A;  4TUQ A;  2KIW A;  2YX8 A;  3U26 A;  2F8K A;  4UBB A;  2GOL A;  1O08 A;  2H5X A;  2KNJ A;  5IIO A;  1Z1B A;  2EH9 A;  2MA1 A;  2PI4 A;  2KFN A;  2PXI A;  1K1Q A;  3B0Y A;  3MGV A;  1V97 A;  3KHG A;  1L5U A;  3OJU A;  2PFO A;  1WCL A;  4IQU A;  1L7O A;  4B9L A;  1RDF A;  3AQF A;  2BCS A;  2BPF A;  8ICR A;  3PY8 A;  4ED6 A;  1L8L A;  4FBT A;  4B9U A;  5J2G A;  4DSI A;  2JEJ A;  3UMC A;  1S76 D;  4EYI B;  3JPQ A;  4TQS A;  3M6K A;  3ORY A;  4U7C A;  1X9W A;  2LHT A;  5F3X B;  3MR5 A;  1ZQI A;  2BQU A;  4GXK A;  2EDU A;  4B9T A;  4ECW A;  5KFZ A;  8ICJ A;  5TIS U;  3RH4 A;  5AI5 A;  5J2D A;  3Q8K A;  9ICU A;  1NZB A;  2IBK A;  3SEI A;  1P7D A;  2MUT B;  5AI4 A;  4CF3 A;  5HP4 A;  2HDO A;  4IR1 A;  4I2C A;  1COK A;  2ASJ A;  2R8I A;  2PI5 A;  5AI9 A;  2WHE A;  3OPX A;  3NGD A;  2XGQ A;  3K1Z A;  3I76 A;  3ZDC A;  4LVS A;  3KZX A;  1ZD3 A;  1KFS A;  2JH7 A;  3K1R B;  4RT2 A;  4UAY A;  4I27 A;  2YY6 A;  4O3P A;  2BGW A;  1QH9 A;  1C7Y A;  4UAT A;  1S0V A;  3RR7 A;  4GC7 A;  2MUT A;  2MSN A;  3N97 B;  2EAP A;  4US8 A;  1URJ A;  1X6I A;  3NRW A;  3QU2 A;  2BKE A;  4OJO A;  3ZI4 A;  1ZQY A;  4CF5 A;  2ZIW B;  1N5X A;  3TAC B;  8ICQ A;  3ONN A;  4DSF A;  4Y2Q A;  4PGY A;  3KHH A;  3Q8M A;  4KLJ A;  4BJQ A;  3V6J A;  1F0M A;  1JN3 A;  2UVV A;  3C28 A;  3ICX A;  4LJX A;  3RRG A;  1SKR A;  4ECZ A;  3N7R C;  3NVW A;  1RYR A;  5ALW A;  4PGQ A;  2XGP A;  3NTU A;  3WK4 A;  2ZIW A;  3I28 A;  1J97 A;  4NM2 A;  2YTU A;  3C23 A;  1D8B A;  1FIQ A;  4JV0 A;  3IN5 A;  4ECU A;  2F1I A;  3EPG A;  1L6N A;  2XCA A;  2HHT A;  8ICY A;  4DOB A;  3DV9 A;  3QZ8 A;  4AP9 A;  5KL8 B;  5J2I A;  1MQ3 A;  4ELU A;  5EE1 A;  5III A;  3PW0 A;  3LWM A;  2E1E A;  5KFY A;  2L5Y A;  2Y9T A;  4M9L A;  1N60 A;  3BJY A;  4PHA A;  3PZP A;  3RB0 A;  1BNO A;  1L3V A;  5CP2 A;  4F8R A;  2HSZ A;  2BCV A;  3J81 j;  4C7Z A;  3VCB A;  4C8K A;  3OGU A;  3JPP A;  1ZQD A;  1L7P A;  4PHE A;  3UMB A;  4E0D A;  2DKZ A;  5J2F A;  2A1J B;  4DQI A;  1U4B A;  1A76 A;  5AK6 A;  2IMW P;  1AQ6 A;  2G09 A;  3JPS A;  1HUO A;  4YR0 A;  1JXE A;  5ALG A;  3EW9 A;  1DK2 A;  2F77 X;  5DGA A;  1N61 A;  3QUQ A;  2AQ0 A;  2LM4 A;  4UB8 U;  2OEH A;  2LBO A;  3WK5 A;  4GIB A;  4F4K A;  3M8S A;  2GH1 A;  4YR3 A;  7ICQ A;  5HMM A;  9ICT A;  3RF9 A; 
#chains in the Genus database with same CATH homology
 1LKY B;  2LMR A;  2ESE A;  2F8K A;  1Z1V A;  1SXD A;  1V38 A;  3TAC B;  5JRT A;  1WWV A;  5J8Y A;  1PK1 B;  2GLE A;  5L1M A;  1F0M A;  2QAR B;  2LPE A;  4RQM A;  5J8Y C;  5JTI A;  2E8P A;  1PK3 A;  2EAO A;  3SEN A;  3BQ7 A;  3IDW A;  3BS7 A;  5KNI A;  1LKY A;  2EAN A;  2QB0 B;  4MHV A;  2QB1 A;  3BS5 B;  3TAD A;  1JI7 A;  2YTU A;  4PZO A;  1PK1 A;  1B0X A;  2KE7 A;  1DXS A;  2JV3 A;  2QAR A;  2Y9U A;  2KIV A;  1UQV A;  1X40 A;  3TAD C;  2E8N A;  5F3X B;  5JU5 A;  1X66 A;  2KSO B;  2B6G A;  2QB0 A;  2L5Y A;  2Y9T A;  3KKA A;  3BS5 A;  1B4F A;  2DL0 A;  1OXJ A;  4IS7 A;  2E8M A;  3H8M A;  2ES6 A;  4NJ8 A;  3SEI A;  3KKA C;  2F3N A;  2E8O A;  1WWU A;  2D8C A;  1COK A;  1OW5 A;  3HIL A;  4NL9 A;  2DKZ A;  2K60 A;  2F44 A;  1SV4 A;  2KMD A;  1SV0 C;  1X9X A;  2D3D A;  2KSO A;  1RG6 A;  2EAM A;  1SGG A;  4NL9 C;  1SXE A;  2K4P A;  3K1R B;  2DKX A;  2FE9 A;  1V85 A;  2QKQ A;  2KG5 A;  1KW4 A;  4PZN A;  1SV0 A;  4RQN A;  2EAP A;  1UCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...