3SEIA

Crystal structure of caskin1 tandem sams
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
b'TREGKSSEAVSQWLTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELRRHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caskin-1
publication title Tandem SAM domain structure of human Caskin1: a presynaptic, self-assembling scaffold for CASK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 50
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3seiA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3seiA01
2QARB 2F3NA 1PK1B 2E8OA 5JRTA 2KSOB 1WWVA 1SV0C 2E8NA 1F0MA 2QB1A 3BQ7A 2QARA 1UCVA 1LKYB 2KSOA 1Z1VA 5JTIA 1V38A 3H8MA 1COKA 1X40A 1X9XA 3BS5A 3TADC 5KNIA 3BS7A 2KMDA 4NL9A 1LKYA 1JI7A 2B6GA 2Y9UA 4PZNA 3KKAC 4NJ8A 2EAPA 2L5YA 1RG6A 3KKAA 1WWUA 1SV0A 1UQVA 3BS5B 2Y9TA 3SEIA 1SXDA 2DKXA 2KG5A 2QKQA 2EAOA 2K60A 4RQMA 1SGGA 1OW5A 1DXSA 1PK3A 3TADA 1X66A 2JV3A 1KW4A 4MHVA 5JU5A 2ESEA 2LMRA 5F3XB 3HILA 3IDWA 2KE7A 3SENA 2QB0B 1OXJA 2E8MA 1V85A 2DKZA 2LPEA 4PZOA 2ES6A 2DL0A 1B0XA 2EAMA 4RQNA 1B4FA 2F44A 2E8PA 1SV4A 2QB0A 2GLEA 2K4PA 5L1MA 1SXEA 3K1RB 2F8KA 2D3DA 2EANA 1PK1A 5J8YC 5J8YA 2YTUA 2D8CA 3TACB 2KIVA 2FE9A 4IS7A 4NL9C
chains in the Genus database with same CATH superfamily
5AICA 1CUKA 2E8OA 4RQ7A 2G07A 4F5OA 2OM6A 3RRGA 4WJ3B 2F77X 1KL9A 3BQ1A 2MUTB 3RH5A 3IHQB 5J0PA 2M9NA 4FBUA 3SD7A 5CRXA 1Z1VA 2V4QA 5C0YA 1Z4NA 4QWCA 1BGXT 1NJZA 5ALVA 2OHFA 2BQ3A 5IIJA 3ZDCA 3UQ2A 5KNIA 4C4RA 3RR7A 3MR3A 2Y9UA 2HBJA 2JEIA 2ODGA 1UQVA 1T8EA 4BWMA 3FC4A 4YG2A 3EZ5A 3HT3A 3M6KA 3BQTA 2A3VA 1X9SA 3QUQA 4B9LA 3G6YA 3RH4A 4P4OA 3WKDA 3TADA 3SI8A 9ICUA 2IOFA 5ALMA 5AI5A 5J0YA 5IINA 9ICXA 1JXLA 8ICSA 3QUCA 2KE7A 2JEGA 4ELUA 1S76D 1TAMA 3C5GA 4F5QA 4F71A 4ECSA 4JV1A 3B0XA 3BDPA 1ZQKA 4O5EA 2ZTDA 3OSPA 2R8IA 1SIJA 4CF3A 4ECRA 5J0UA 2KV2A 3KTQA 2KEYA 9ICBA 3PSTA 1TK0A 1QLNA 1RQLA 2HBLA 3RJKA 5GTHU 4KITB 1ZRMA 5J2EA 2F1IA 2P66A 4Y2PA 5JRTA 3C2MA 5KFGA 3M9OB 4QIWC 4RUCA 4UB3A 4ECWA 3O0FA 9ICVA 2PMZC 3F5EA 1S0MA 4KLTA 3N97B 1KEJA 4OO1J 3RJFA 2XY7A 3H8MA 5J2IA 1YZ7A 3KHLA 9ICCA 4DWIA 2P6UA 2H3IA 1S97A 2MAXA 1PVRA 3TAQA 4Y2JA 1J97A 4UAYA 1X6IA 4ED2A 1UPHA 1XNSA 4I2DA 2MU2A 1MQ3A 1NK8A 4DLEA 4YR3A 8ICGA 2W55A 5J0TA 2W3RA 3SAHA 3PV8A 3GU3A 4ED7A 2ZIWA 1NJWA 3QXGA 5KG3A 5KFHA 2IOFK 2J6TA 1K5OA 1QSLA 1Z00A 3SAFA 2HOFA 5DG7A 2VA8A 3QZ7A 4PGYA 3QEBZ 3ED5A 3MDAA 4FZLA 1KFDA 2WAQF 4E0DA 1BVSA 2XGQA 2QB0B 4ECXA 3D2QA 1L3TA 5ALGA 2K8AA 2LYAA 8ICFA 2FPLA 2W7PA 1U48A 1S8OA 1N5XA 2KZMA 4OJ5A 2GLEA 2ALZA 4JWNA 4EZ6A 3V7LA 8ICAA 1JX4A 5CR0A 3H0LB 5ALRA 1DGJA 2EH9A 1Z3EB 2I6XA 1X9WA 1QSSA 1S10A 1V97A 4ECYA 2HW3A 4RQ4A 2NRXA 5AK5A 4OJLA 2XVTA 2B21A 4JUZA 3PMNA 2A19A 5KT2A 5KFQA 2OCEA 2BCSA 5KL8B 8ICOA 5DLGA 1JROA 1N63A 1KRPA 3QX7A 3M9MB 4J9SA 4UAWA 2YB4A 4KX3A 5J29A 2NO5A 5ALLA 3F2DA 2A1JB 4CE6A 1PVQA 3AU6A 4UBBA 2A1AA 3OHBA 4DL5A 3UQ0A 4CRXA 3V6HA 3PO4A 4QJFB 2KZZA 4GC6A 2W3SA 4ACOA 3G6VA 5KFNA 3RAQA 3MC1A 3RJEA 5ALWA 3H0RB 4Y2TA 2ZTEA 2XCAA 4DSLA 8ICWA 2BR0A 5HR7A 5CWRA 1TAUA 5F3XB 3M8SA 1QQ6A 4FZMA 1P7DA 1L7OA 5DG9A 5DB6A 3SYZA 3UPQA 4ELTA 4AYBC 3JPRA 1JALA 1KFSA 5J0SA 5KFIA 4A8EA 4YMMA 3EPGA 2KHQA 5HHHA 4TUQA 4P0QB 4M0AA 2AXTU 2MA1A 5HP4A 3TACB 2KIVA 2OYYA 5AKJA 1ZQLA 1L7MA 2H5XA 5KL1B 2QARB 1T3QA 5AKYA 4ECVA 3IP4B 3ZDBA 4MFCA 2W9BA 5DB8A 2C2EA 2WF9A 4J03A 1ZQGA 7ICJA 2ZXHA 1IIPA 1F0MA 1ZQ1C 1JXEA 1WG8A 1SKWA 4QWDA 2YY6A 3SV3A 1KQQA 4P0PB 4YFKA 3TI0A 3TARA 2W9BB 3TFSA 2UVVA 3BQ0A 2NRTA 1X40A 4I2JA 2G5HB 2ISPA 8ICJA 4O3PA 4YCXA 4NL9A 9ICIA 3HJEA 4RZRA 5ALIA 2K8BB 3JPSA 5KFKA 4YMOA 4XA5A 2ZTCA 1WWUA 5IIIA 1SV0A 4JK1A 4O3RA 4YQWA 2KG5A 2FLLA 1IM4A 1U9LA 3H4DA 2R8KA 1U45A 1L8OA 3KHHA 2Y0SF 1IXRA 1ZQAA 4J9OA 1Z4OA 8ICRA 4RNMA 4OD0A 4O5CA 4F4KA 2ZXIA 4FZNA 1J2NA 8ICMA 2IHMA 1ZQXA 9ICWA 5CA7A 1SL1A 1WUDA 4Y2RA 5J0WA 3NVWA 5IIOA 4BDPA 3WKBA 1JUDA 3KOOA 4RPZA 1ZQFA 4EBEA 3AU2A 1D9DA 1RPLA 1SV4A 4DSFA 2H3VA 5CHGA 8ICNA 3K1RB 1WYGA 2I9GA 1NK6A 1QQ5A 2YMMA 4F50A 1HUZA 3TKAA 4EZ9A 2FDRA 4M9NA 2F1JA 1A76A 2FPMA 2CXYA 2OEHA 1TKDA 3C21A 2NV3A 2HVHA 3ZD9A 4RT3A 2EZZA 2K4HA 3JPTA 3LVVA 2DFLA 3K4GA 9ICOA 3JPQA 1XSPA 2N1RA 1ZD5A 2IOHA 2WF8A 3B0YA 3MABA 1ZQDA 1ED1A 3QUBA 3E2EA 5DB7A 1QQ7A 3AQEA 4BXOA 2CPRA 1LKYA 2C2DA 7ICNA 4YN4A 4TUSA 1NNLA 1TK5A 4DQSA 1MC8A 2BCRA 5AKEA 4QZ9A 7ICRA 5DBAA 3KHRA 3ISDA 1NZBA 3H0MB 1SB3C 3WK8A 2PXIA 4C80A 2VJ4A 4BXOB 5KFSA 1A77A 1N62A 2BHNA 4DL4A 1ZOLA 2KIWA 1IG6A 3RTVA 4B9NA 3PX4A 5ALPA 4J9QA 1DXSA 4FFDA 2HOIA 2HBKA 4I2IA 5J2FA 3T5HA 3HPOA 3ETLA 1ZQMA 1F44A 3NTUA 1K1SA 2C22A 3NGDA 5HR6A 3GFKB 3H7IA 1M6YA 4UB6U 3PVXA 3ONNA 3JPNA 5AI8A 1D8YA 2HHWA 2LYBA 9ICGA 3QNMA 1L8LA 1Q8KA 2IHNA 1X42A 2R8JA 4QZGA 2EZXA 3ALRA 4I28A 7ICQA 2HOQA 8ICTA 5KFOA 4M9LA 4F4XA 4J9KA 3V7JA 7ICHA 1A0PA 1DOQA 4ECQA 1VLBA 2NRWA 2W04A 2KVSA 3C2LA 5KT3A 2KSOB 1ZQUA 4CNQA 2KJ8A 2Q0ZX 5H2FU 1LVHA 4DF4A 4QZFA 5B5EU 2I5HA 4KLGA 1V38A 2DGZA 4EELA 2YX8A 4DLGA 3PSIA 5B66U 5IIKA 5KFYA 1ZQIA 5AKHA 5KG7A 4PGXA 4NLNA 7ICIA 2L5YA 5KFRA 2FJ6A 2W8LA 1XSLA 1XSNA 5L1LA 9ICTA 9ICKA 1RXVA 4YXMA 2ZUDA 5DKWA 3RH6A 5KFPA 5KFAA 4I27A 3I1YA 2GWSA 4PL2A 4YMNA 5ALNA 4QIWF 2DBYA 4QZBA 4ICAA 2HHQA 5L9XA 4DQQA 2PMZF 2R8HA 4MF2A 5D49A 5DB9A 5KFVA 4DQIA 4UBCA 3HW8A 3EPIA 4DS4A 1PZNA 4KLDA 4KMUA 2OWOA 9ICJA 3LWMA 3H4BA 4RU9A 5A0LA 4EX7A 3GV7B 3VC8A 4J9PA 1NJXA 4UB4A 2DUYA 4XRHA 3DV9A 5EWFA 1ZD3A 3PMLA 1NK4A 2ZIXB 3NUQA 3PW0A 5AKKA 1PK1A 3AEVA 5KFWA 5ALEA 1Z1BA 1L3UA 4KLUA 3V6JA 1BPYA 4ECUA 3NRWA 1L7NA 1BPXA 5DQIA 1B43A 5KFEA 4UQGA 3GV5B 1PK1B 4C8NA 3RF9A 1KFTA 4Z6DA 2KHVA 4C8LA 5AI9A 5T14A 4BGDA 3ZDAA 2PFNA 4NV0A 3C5FA 1NI3A 5F9NA 2WB1F 5ALOA 1ZQRA 4M9HA 3OSNA 4UB5A 3KZXA 1PUZA 4PHPA 4YR2A 2FPKA 8ICEA 3BS7A 1ZD4A 2YN4A 3MBYA 8ICLA 2V4RA 2KD1A 3KKAC 5DDMA 5KG1A 3RBDA 4LZDA 1ZJNA 1FIQA 2AH5A 4YD2A 1SWVA 5C5JA 5JUMA 4O3SA 4DFDA 4CCHA 2QKQA 2XIDA 2FMSA 2BCQA 4PHEA 2PFOA 4M6WB 2XO7A 5AK4A 1NK7A 4EX6A 2F76X 3HX0A 4KLSA 3QUTA 5BOMA 1L3VA 4FBTA 2HHUA 4I2AA 4QNLA 2OXOA 5ALHA 2RLTA 3BZKA 7ICOA 1TFRA 1D8LA 3DDHA 1RYSA 3IDWA 5TISU 5KT7A 2KJ5A 4YVZA 2IMWP 1ZETA 4ECZA 4M04A 1X6JA 1RYRA 5J2AA 3UMCA 1AQ6A 5AM1A 4BX9C 5CJ7A 4OJPA 1B22A 3AL0B 2EZYA 3GILA 3THVA 2QB0A 1NK0A 1ZQQA 8ICKA 3BZCA 2F8KA 4JMUA 4US8A 4O0IA 5AHXA 4F2SA 3CNHA 3H40A 1ZQBA 2C2RA 3KD3A 5CB1A 4F91B 3C1ZA 2E1FA 5EOZA 1NK5A 5J0RA 4B9TA 4I2FA 1DK2A 3MR2A 4DS5A 1N48A 3LWLA 1TK8A 3BQ7A 1OUQA 5J2CA 4RQ0A 4RQ8A 3CW2C 4FS1A 5JTIA 2NRVA 1ZQVA 2JR5A 2G5IB 4AYBF 8ICBA 5HMLA 2ATLA 2ZJ5A 4FS2A 1NOMA 5AK3A 2NO4A 2BDPA 1RDFA 3KKAA 2BQRA 3PW2A 3GIMA 1SXDA 4UATA 4NXZA 1SKRA 4RNNA 2Z7JA 3N4MB 1UA1A 1BPEA 2A1JA 4KLMA 3LYSA 1OW5A 2R18A 2BDUA 2W03A 5ALFA 4EEKA 4GIBA 4C7ZA 2JEJA 1KW4A 3EYZA 3NS1A 3N28A 4LZGA 2LI6A 4YD1A 3ETRA 7ICMA 4Q45A 2DKZA 2G06A 1T7PA 5AM0A 2FLPA 2ASDA 2YB1A 4MEYA 5KFDA 3N7SC 3NVYA 9ICQA 2FMPA 1MQ2A 2VA2A 5AI4A 2K89A 4GC7A 1QH9A 2EDUA 3RB6A 1O08A 2JH1A 1S0VA 1IV8A 3R9KA 4B6JA 5HNKA 2FLNA 2WAQC 3TAPA 2HBMA 4RQ5A 2KN7A 3WKAA 3WKEA 2WF6A 4IL6U 3PW5A 3ORYA 4P0QA 3PW7A 4F2RA 4F4ZA 2VJ5A 4R8UB 9ICMA 1ZRNA 2HMXA 5HHIA 1C20A 4HYKA 1RXWA 4JB3A 2BGWA 4KX5A 2QARA 3OJSA 3V72A 4B9UA 2HVIA 4TURA 3I76A 5KT6A 2ZJAA 5L1JA 8ICXA 4XUSA 4CF5A 2F2AB 4P0PA 3ISBA 4OJ6A 2KVCA 3MR5A 1X9MA 3RR8A 5EE9A 3ICXA 3SEIA 3WK6A 1HIWA 2YMQA 5AK6A 5KFUA 4PJ0U 2BKEA 4US9A 2HI0A 2Y1IA 2HDOA 1N61A 1X66A 4Z6CA 4IRKA 3M9NB 5KFZA 7ICSA 3AMZA 7ICVA 1XO1A 4YR0A 1T94A 3PR4A 2E1EA 2YMPA 3SENA 5KAIU 1DGSA 4KLHA 4K4HA 2J6UA 1UA0A 3EUB2 5D4BA 4I2CA 1JMSA 3KHGA 1BPZA 5J2BA 5DLFA 5KG2A 2FI1A 4GLXA 1RYUA 2W54A 2JH7A 4MFFA 4GXKA 4MF8A 5G5HA 1PVPA 5KFXA 4CDGA 3OPXA 2GH1A 2UVWA 4M2YA 4U6PA 1NZPA 2G09A 3PY8A 2Y1JA 1Q3UA 4ED8A 8ICVA 5J0XA 3IV6A 4UB2A 5EE3A 3UMGA 2LKYA 4UAVA 4B9MA 3KBBA 2RDIA 1KSPA 4MEXA 2NYVA 1GO3F 3F2BA 4NLCA 2XGPA 3GIJA 1HUOA 5DQGA 5ALSA 5IILA 2DF4B 8ICQA 2RP5A 3PX0A 3ZDEA 4PHAA 4O5KA 3BQ2A 4B9VA 4DL3A 1TE2A 3FYHA 4NM2A 1UT8A 2Y9TA 5DBCA 2W8KA 3CYMA 1XC9A 9ICEA 3AUOA 2K60A 5J2HA 5EE1A 1YZ6A 4Y2YA 4JWMA 4Z6EA 1BPDA 2B0CA 1L6NA 4YXJA 2E5SA 4O3OA 1EXNA 2GOLA 4IQUA 3K1ZA 2LHTA 4QZEA 7ICLA 4QW8A 5JU5A 4M9JA 1D9FA 3Q8PB 5AI6A 3IG8A 3L5KA 1V85A 3HKZC 4LVSA 1CI4A 4OCZA 4DOBA 3RB4A 1NKEA 4F4YA 3NASA 2DL0A 5J0OA 1B0XA 2E8PA 1KKXA 4DOAA 5ALDA 2DPIA 3WKCA 2K4PA 1H38A 5L1MA 1D8BA 3V7KA 9ICLA 3EWAA 3MFHA 2HCFA 2ZG6A 4I2GA 2KFNA 2NRZA 3GIIA 5AM4A 4QWAA 5AKIA 1S0NA 3D2SA 3AN1A 4IR1A 3GZFA 5J0QA 5J2GA 5DBBA 2VIXA 4KLQA 2KJ9A 9ICNA 4QW9A 3K75D 2KOBA 2AHOB 3PX6A 2KSOA 3TANA 4UAZA 1COKA 4Z6FA 4C0ZA 4DCCA 1ZQCA 1LV5A 2ZIVB 3IG5A 4DOCA 3RB3A 4IRCA 2IA6A 4DFJA 3IRUA 3TADC 4EYHB 3QU4A 5KAFU 5CEHA 3RRHA 4EYIB 4BWJA 4NY8A 4NJ8A 3QZ8A 2EAPA 2YMLA 7ICPA 1X2IA 1RM6C 4FE3A 3SAGA 4IRDA 4ED0A 3C28A 1S9FA 5CP2A 2XY5A 3RJHA 2HSZA 1WCNA 3V6KA 1N56A 3ZI4A 1ZQSA 2KK0A 4I2HA 2YQEA 2VA3A 7ICTA 4QZDA 3FAHA 2W9MA 3RFAA 4XQ8A 3WK4A 4BUGA 9ICRA 1RZTA 4JV0A 8ICPA 2LMRA 3L4PA 9ICSA 2IBKA 7ICEA 2LM4A 1VDVA 3T5JA 1T3NA 2E3TA 5KTQA 4DFMA 1OXJA 5BPCA 3MFIA 4F8RA 4M47A 4CF4A 2AGOA 5DQHA 3A0HU 1N5WA 1B4FA 5KG4A 1DRGA 1S77D 2W9CA 1K1QA 5DG8A 4ED1A 2WF7A 2I1QA 4QWBA 3SQIA 1L3SA 3C23A 5AM2A 4O3NA 4PPXA 5AKGA 2W9CB 3UXPA 1BNPA 1CEZA 2ZIXA 4IS7A 4KLOA 3A0BU 3T79A 2LYHA 2RRDA 3LDAA 2PI4A 4KMOB 1WWVA 3VCBA 4DSJA 3IN5A 2AQ4A 4DL7A 1MN8A 5AM5A 5F9LA 2FMQA 1FO4A 3Q8QB 3RB0A 1X9XA 1VJ5A 2DQNB 4M9GA 3M7DA 3T3FA 3F2CA 3OHAA 1SZHA 2K4EA 2W11A 5KFJA 1RG6A 1CRXA 1TVAA 2AU0A 5AKLA 4I2BA 2JEFA 4KTQA 2W9AA 1DK3A 4R65A 4EEYA 1ZJMA 4TQRA 4F4WA 2BCVA 4YP3A 3SV4A 3E0FA 1AROP 1L7PA 4NLBA 1SGGA 4DL6A 4USAA 2LM1A 1SZPA 2KKPA 1Q46A 4M6WA 7ICKA 4Q8EA 3M1YA 5ALZA 4UARA 5ALTA 3BJYA 3UXOA 3G6XA 2HHVA 8ICIA 1FFUA 2EQYA 4QZIA 4I29A 2JHDA 1ZYQA 4KN4A 3PR5B 1KN5A 1NJYA 4DFKA 4DSKA 4HAIA 1ZQZA 1SXEA 5EWGA 3GV8B 2EANA 4TQSA 2PFPA 2RHFA 4C4SA 2K8CB 4UW9A 5AKZA 2D8CA 4PHDA 4Y2XA 5AIAA 4G3IA 2FE9A 5EE0A 3PW4A 3MGIA 1TV9A 3MDCA 3D6JA 2PFQA 1A6SA 3CRXA 3MGVA 3T5KA 4DSIA 4IQVA 4RPYA 3Q8RB 3QEAZ 2R8GA 5KFFA 4X5VA 2P6RA 4QZAA 1L5UA 1TAQA 4O3QA 5G5GA 5K4LA 3C1YA 3WU2U 3M8RA 1JI7A 2B6GA 3RJGA 8ICZA 4EBCA 3RAXA 2ZIWB 3QU5A 1ECWA 2F1HA 2JXJA 2EAOA 3H8WA 4RQMA 5KFBA 4DFPA 2UVUA 2WB1C 3NVZA 1Z00B 4MFAA 4DQPA 3QU9A 4NWIA 4Y2SA 4RQ2A 1UHUA 2QLTA 3AQFA 3OJUA 1Z19A 1S0OA 4F92B 2JZBA 2AGQA 4R63A 3QU7A 4MHVA 4Y2VA 4J9NA 4TUPA 4BJQA 5KFLA 4J9MA 4O3MA 2AJQA 5J2KA 5DGBA 1XO0A 4RNOA 3QYPA 3KZIU 2JZBB 3Q8MA 4AP9A 1ZQYA 4UB1A 4PZOA 4DF8A 2V9WA 4F3OA 4ZH4A 4P4PA 2D6FC 1MSWD 2WF5A 2ZIUA 5BOLA 4R64A 1HEKA 5J8YC 4CGZA 2MSNA 2BQUA 1F5SA 2BPFA 4ECTA 2XI9A 3PSPA 4RQ6A 7ICUA 4RUAA 2ZIUB 1KTQA 3NVVA 3MR6A 4NL9C 2F8LA 1ZQOA 3RJJA 4G9BA 4IC9A 9ICHA 5ALKA 1SV0C 8ICYA 4U7CA 1J2MA 4Q43A 5ALQA 2WFAA 2DWQA 3FDSA 2ASLA 1JN3A 2VKQA 2WTFA 4R8UA 4P2HA 3N7PD 4DEZA 2BZFA 7ICGA 5KG5A 2XCPA 3UXNA 3BS5A 2J6SA 5KG6A 2HHTA 1SL0A 4DL2A 2AQ0A 4EBDA 1MA7A 1ZXIA 1NK9A 3BS5B 3WK5A 2G0AA 4QWEA 1FFVA 2ZUBA 3MGHA 2Q4TA 2ZJ8A 2C28A 4DSEA 1ZQNA 1T4GA 4FO6A 4KLLA 4OJOA 4RQ3A 1KBUA 1SWWA 4DQRA 1ZQTA 1UT5A 3AM9A 2K4IA 7ICFA 4EENA 1N2XA 3LVWA 2PKEA 2E8MA 1XWLA 3SMVA 2ZUCA 2LPEA 3FM9A 4RPXA 2ES6A 4F72A 3IM1A 4DO9A 2W43A 5KFMA 3ZDDA 2F44A 3C29A 4Y2UA 4R66A 4IQWA 5GTIU 2W7OA 1HJPA 2KTQA 1O03A 2AGPA 4C8OA 3CP8A 4J9RA 4I2EA 2JRZA 5J8YA 2GO7A 5ALYA 1SL2A 2UVRA 5AKXA 2ASJA 4O9MA 8ICCA 4QZCA 4C4TA 4PGQA 3C2KA 3SZ2A 5ALXA 3T5LA 4NLZA 5L1IA 4IQTA 2QB1A 4ELVA 2KP7A 3N7RC 1UCVA 2VANA 3HKZF 3ISCA 1WCLA 9ICFA 1QTMA 2KKVA 4UASA 3TQ1A 4K4IA 2JGAA 5ALJA 2KMDA 2MRLA 1U47A 3M6ZA 4PZNA 2O6KA 9ICAA 5E79U 4ED6A 1ZQJA 2KFZA 2P35A 1N60A 2DKXA 3HWTA 5L1KA 3DEEA 5KG0A 3F53A 3PZPA 4NLKA 2KZ3A 1PK3A 3PNCA 4ED3A 2JV3A 4RQ1A 1V9PA 5KFCA 3GIKA 3S6JA 3GDXA 2ESEA 1ZQHA 2H3QA 3HILA 3OTQA 2HHXA 4B9SA 1NKCA 1U49A 2HHSA 5ALUA 1JRPA 4Y2QA 1NKBA 3UM9A 3HP6A 2EAMA 1KDHA 4RQNA 2JMGA 5HMMA 1U4BA 1S5LU 4C8MA 3JPOA 5TZVA 2RDJA 3WK7A 3Q8LA 8ICHA 9ICPA 3L3FX 3HRDD 3H8JA 4J9LA 2KNJA 2LBOA 4NM1A 2BCUA 4F5NA 4Q8FA 5AI0A 1YT3A 4LJXA 2BPCA 3KFUF 3J81j 4F5PA 2F3NA 2Y0SC 3WK9A 5J2JA 1XU4A 4QZ8A 1BPBA 1FEZA 4GXIA 2E8NA 4PL1A 4IR9A 3Q8SB 3H8SA 3GQCA 2PI5A 1KLNA 2ISOA 3D2NA 1LKYB 1BNOA 4QZHA 2DPJA 5EWEA 3TFRA 3QE9Y 3QU2A 2XICA 1JIHA 3PSFA 5KT5A 2BPGA 4JV2A 2CN1A 4K4GA 5DGAA 2H3ZA 2ZIVA 3NRZA 3PO5A 2WHEA 3F5AA 2MUTA 2H3FA 4KLEA 1RQNA 4KLIA 2OH2A 3LK9A 3ZD8A 3U26A 4UAUA 1ZQPA 3RBEA 3Q8KA 1Q3VA 1C7YA 1Y88A 5KFTA 1ZQEA 3RJIA 4ZOHC 3I28A 5AM3A 1SKSA 4GFJA 3UMBA 1ZQWA 4KLJA 1URJA 3SR6A 4NLGA 1COOA 3JPPA 1QCKA 5J2DA 2XC9A 2CRXA 4RT2A 4C7YA 3OGUA 5IIMA 5FP0A 5KT4A 1XS9D 2XY6A 4KLFA 4GXJA 4P4MA 4F93B 2G08A 2RQ5A 2M0NA 4Q44A 2D3DA 5D46A 8ICUA 3E58A 3B9JA 2YTUA 1ZD2P 4F5RA 4PH5A 2KICA 3EW9A 4KN7A 4C8KA 5AIBA 1LB2B 5DDYA 1QSYA 4UB8U
chains in the Genus database with same CATH topology
2QARB 2F3NA 1PK1B 2E8OA 5JRTA 2KSOB 1WWVA 1SV0C 2E8NA 1F0MA 2QB1A 3BQ7A 2QARA 1UCVA 1LKYB 2KSOA 1Z1VA 5JTIA 1V38A 3H8MA 1COKA 1X40A 1X9XA 3BS5A 3TADC 5KNIA 3BS7A 2KMDA 4NL9A 1LKYA 1JI7A 2B6GA 2Y9UA 4PZNA 3KKAC 4NJ8A 2EAPA 2L5YA 1RG6A 3KKAA 1WWUA 1SV0A 1UQVA 3BS5B 2Y9TA 3SEIA 1SXDA 2DKXA 2KG5A 2QKQA 2EAOA 2K60A 4RQMA 1SGGA 1OW5A 1DXSA 1PK3A 3TADA 1X66A 2JV3A 1KW4A 4MHVA 5JU5A 2ESEA 2LMRA 5F3XB 3HILA 3IDWA 2KE7A 3SENA 2QB0B 1OXJA 2E8MA 1V85A 2DKZA 2LPEA 4PZOA 2ES6A 2DL0A 1B0XA 2EAMA 4RQNA 1B4FA 2F44A 2E8PA 1SV4A 2QB0A 2GLEA 2K4PA 5L1MA 1SXEA 3K1RB 2F8KA 2D3DA 2EANA 1PK1A 5J8YC 5J8YA 2YTUA 2D8CA 3TACB 2KIVA 2FE9A 4IS7A 4NL9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAR B;  2F3N A;  1PK1 B;  2E8O A;  5JRT A;  2KSO B;  1WWV A;  1SV0 C;  2E8N A;  1F0M A;  2QB1 A;  3BQ7 A;  2QAR A;  1UCV A;  1LKY B;  2KSO A;  1Z1V A;  5JTI A;  1V38 A;  3H8M A;  1COK A;  1X40 A;  1X9X A;  3BS5 A;  3TAD C;  5KNI A;  3BS7 A;  2KMD A;  4NL9 A;  1LKY A;  1JI7 A;  2B6G A;  2Y9U A;  4PZN A;  3KKA C;  4NJ8 A;  2EAP A;  2L5Y A;  1RG6 A;  3KKA A;  1WWU A;  1SV0 A;  1UQV A;  3BS5 B;  2Y9T A;  3SEI A;  1SXD A;  2DKX A;  2KG5 A;  2QKQ A;  2EAO A;  2K60 A;  4RQM A;  1SGG A;  1OW5 A;  1DXS A;  1PK3 A;  3TAD A;  1X66 A;  2JV3 A;  1KW4 A;  4MHV A;  5JU5 A;  2ESE A;  2LMR A;  5F3X B;  3HIL A;  3IDW A;  2KE7 A;  3SEN A;  2QB0 B;  1OXJ A;  2E8M A;  1V85 A;  2DKZ A;  2LPE A;  4PZO A;  2ES6 A;  2DL0 A;  1B0X A;  2EAM A;  4RQN A;  1B4F A;  2F44 A;  2E8P A;  1SV4 A;  2QB0 A;  2GLE A;  2K4P A;  5L1M A;  1SXE A;  3K1R B;  2F8K A;  2D3D A;  2EAN A;  1PK1 A;  5J8Y C;  5J8Y A;  2YTU A;  2D8C A;  3TAC B;  2KIV A;  2FE9 A;  4IS7 A;  4NL9 C; 
#chains in the Genus database with same CATH topology
 5AIC A;  1CUK A;  2E8O A;  4RQ7 A;  2G07 A;  4F5O A;  2OM6 A;  3RRG A;  4WJ3 B;  2F77 X;  1KL9 A;  3BQ1 A;  2MUT B;  3RH5 A;  3IHQ B;  5J0P A;  2M9N A;  4FBU A;  3SD7 A;  5CRX A;  1Z1V A;  2V4Q A;  5C0Y A;  1Z4N A;  4QWC A;  1BGX T;  1NJZ A;  5ALV A;  2OHF A;  2BQ3 A;  5IIJ A;  3ZDC A;  3UQ2 A;  5KNI A;  4C4R A;  3RR7 A;  3MR3 A;  2Y9U A;  2HBJ A;  2JEI A;  2ODG A;  1UQV A;  1T8E A;  4BWM A;  3FC4 A;  4YG2 A;  3EZ5 A;  3HT3 A;  3M6K A;  3BQT A;  2A3V A;  1X9S A;  3QUQ A;  4B9L A;  3G6Y A;  3RH4 A;  4P4O A;  3WKD A;  3TAD A;  3SI8 A;  9ICU A;  2IOF A;  5ALM A;  5AI5 A;  5J0Y A;  5IIN A;  9ICX A;  1JXL A;  8ICS A;  3QUC A;  2KE7 A;  2JEG A;  4ELU A;  1S76 D;  1TAM A;  3C5G A;  4F5Q A;  4F71 A;  4ECS A;  4JV1 A;  3B0X A;  3BDP A;  1ZQK A;  4O5E A;  2ZTD A;  3OSP A;  2R8I A;  1SIJ A;  4CF3 A;  4ECR A;  5J0U A;  2KV2 A;  3KTQ A;  2KEY A;  9ICB A;  3PST A;  1TK0 A;  1QLN A;  1RQL A;  2HBL A;  3RJK A;  5GTH U;  4KIT B;  1ZRM A;  5J2E A;  2F1I A;  2P66 A;  4Y2P A;  5JRT A;  3C2M A;  5KFG A;  3M9O B;  4QIW C;  4RUC A;  4UB3 A;  4ECW A;  3O0F A;  9ICV A;  2PMZ C;  3F5E A;  1S0M A;  4KLT A;  3N97 B;  1KEJ A;  4OO1 J;  3RJF A;  2XY7 A;  3H8M A;  5J2I A;  1YZ7 A;  3KHL A;  9ICC A;  4DWI A;  2P6U A;  2H3I A;  1S97 A;  2MAX A;  1PVR A;  3TAQ A;  4Y2J A;  1J97 A;  4UAY A;  1X6I A;  4ED2 A;  1UPH A;  1XNS A;  4I2D A;  2MU2 A;  1MQ3 A;  1NK8 A;  4DLE A;  4YR3 A;  8ICG A;  2W55 A;  5J0T A;  2W3R A;  3SAH A;  3PV8 A;  3GU3 A;  4ED7 A;  2ZIW A;  1NJW A;  3QXG A;  5KG3 A;  5KFH A;  2IOF K;  2J6T A;  1K5O A;  1QSL A;  1Z00 A;  3SAF A;  2HOF A;  5DG7 A;  2VA8 A;  3QZ7 A;  4PGY A;  3QEB Z;  3ED5 A;  3MDA A;  4FZL A;  1KFD A;  2WAQ F;  4E0D A;  1BVS A;  2XGQ A;  2QB0 B;  4ECX A;  3D2Q A;  1L3T A;  5ALG A;  2K8A A;  2LYA A;  8ICF A;  2FPL A;  2W7P A;  1U48 A;  1S8O A;  1N5X A;  2KZM A;  4OJ5 A;  2GLE A;  2ALZ A;  4JWN A;  4EZ6 A;  3V7L A;  8ICA A;  1JX4 A;  5CR0 A;  3H0L B;  5ALR A;  1DGJ A;  2EH9 A;  1Z3E B;  2I6X A;  1X9W A;  1QSS A;  1S10 A;  1V97 A;  4ECY A;  2HW3 A;  4RQ4 A;  2NRX A;  5AK5 A;  4OJL A;  2XVT A;  2B21 A;  4JUZ A;  3PMN A;  2A19 A;  5KT2 A;  5KFQ A;  2OCE A;  2BCS A;  5KL8 B;  8ICO A;  5DLG A;  1JRO A;  1N63 A;  1KRP A;  3QX7 A;  3M9M B;  4J9S A;  4UAW A;  2YB4 A;  4KX3 A;  5J29 A;  2NO5 A;  5ALL A;  3F2D A;  2A1J B;  4CE6 A;  1PVQ A;  3AU6 A;  4UBB A;  2A1A A;  3OHB A;  4DL5 A;  3UQ0 A;  4CRX A;  3V6H A;  3PO4 A;  4QJF B;  2KZZ A;  4GC6 A;  2W3S A;  4ACO A;  3G6V A;  5KFN A;  3RAQ A;  3MC1 A;  3RJE A;  5ALW A;  3H0R B;  4Y2T A;  2ZTE A;  2XCA A;  4DSL A;  8ICW A;  2BR0 A;  5HR7 A;  5CWR A;  1TAU A;  5F3X B;  3M8S A;  1QQ6 A;  4FZM A;  1P7D A;  1L7O A;  5DG9 A;  5DB6 A;  3SYZ A;  3UPQ A;  4ELT A;  4AYB C;  3JPR A;  1JAL A;  1KFS A;  5J0S A;  5KFI A;  4A8E A;  4YMM A;  3EPG A;  2KHQ A;  5HHH A;  4TUQ A;  4P0Q B;  4M0A A;  2AXT U;  2MA1 A;  5HP4 A;  3TAC B;  2KIV A;  2OYY A;  5AKJ A;  1ZQL A;  1L7M A;  2H5X A;  5KL1 B;  2QAR B;  1T3Q A;  5AKY A;  4ECV A;  3IP4 B;  3ZDB A;  4MFC A;  2W9B A;  5DB8 A;  2C2E A;  2WF9 A;  4J03 A;  1ZQG A;  7ICJ A;  2ZXH A;  1IIP A;  1F0M A;  1ZQ1 C;  1JXE A;  1WG8 A;  1SKW A;  4QWD A;  2YY6 A;  3SV3 A;  1KQQ A;  4P0P B;  4YFK A;  3TI0 A;  3TAR A;  2W9B B;  3TFS A;  2UVV A;  3BQ0 A;  2NRT A;  1X40 A;  4I2J A;  2G5H B;  2ISP A;  8ICJ A;  4O3P A;  4YCX A;  4NL9 A;  9ICI A;  3HJE A;  4RZR A;  5ALI A;  2K8B B;  3JPS A;  5KFK A;  4YMO A;  4XA5 A;  2ZTC A;  1WWU A;  5III A;  1SV0 A;  4JK1 A;  4O3R A;  4YQW A;  2KG5 A;  2FLL A;  1IM4 A;  1U9L A;  3H4D A;  2R8K A;  1U45 A;  1L8O A;  3KHH A;  2Y0S F;  1IXR A;  1ZQA A;  4J9O A;  1Z4O A;  8ICR A;  4RNM A;  4OD0 A;  4O5C A;  4F4K A;  2ZXI A;  4FZN A;  1J2N A;  8ICM A;  2IHM A;  1ZQX A;  9ICW A;  5CA7 A;  1SL1 A;  1WUD A;  4Y2R A;  5J0W A;  3NVW A;  5IIO A;  4BDP A;  3WKB A;  1JUD A;  3KOO A;  4RPZ A;  1ZQF A;  4EBE A;  3AU2 A;  1D9D A;  1RPL A;  1SV4 A;  4DSF A;  2H3V A;  5CHG A;  8ICN A;  3K1R B;  1WYG A;  2I9G A;  1NK6 A;  1QQ5 A;  2YMM A;  4F50 A;  1HUZ A;  3TKA A;  4EZ9 A;  2FDR A;  4M9N A;  2F1J A;  1A76 A;  2FPM A;  2CXY A;  2OEH A;  1TKD A;  3C21 A;  2NV3 A;  2HVH A;  3ZD9 A;  4RT3 A;  2EZZ A;  2K4H A;  3JPT A;  3LVV A;  2DFL A;  3K4G A;  9ICO A;  3JPQ A;  1XSP A;  2N1R A;  1ZD5 A;  2IOH A;  2WF8 A;  3B0Y A;  3MAB A;  1ZQD A;  1ED1 A;  3QUB A;  3E2E A;  5DB7 A;  1QQ7 A;  3AQE A;  4BXO A;  2CPR A;  1LKY A;  2C2D A;  7ICN A;  4YN4 A;  4TUS A;  1NNL A;  1TK5 A;  4DQS A;  1MC8 A;  2BCR A;  5AKE A;  4QZ9 A;  7ICR A;  5DBA A;  3KHR A;  3ISD A;  1NZB A;  3H0M B;  1SB3 C;  3WK8 A;  2PXI A;  4C80 A;  2VJ4 A;  4BXO B;  5KFS A;  1A77 A;  1N62 A;  2BHN A;  4DL4 A;  1ZOL A;  2KIW A;  1IG6 A;  3RTV A;  4B9N A;  3PX4 A;  5ALP A;  4J9Q A;  1DXS A;  4FFD A;  2HOI A;  2HBK A;  4I2I A;  5J2F A;  3T5H A;  3HPO A;  3ETL A;  1ZQM A;  1F44 A;  3NTU A;  1K1S A;  2C22 A;  3NGD A;  5HR6 A;  3GFK B;  3H7I A;  1M6Y A;  4UB6 U;  3PVX A;  3ONN A;  3JPN A;  5AI8 A;  1D8Y A;  2HHW A;  2LYB A;  9ICG A;  3QNM A;  1L8L A;  1Q8K A;  2IHN A;  1X42 A;  2R8J A;  4QZG A;  2EZX A;  3ALR A;  4I28 A;  7ICQ A;  2HOQ A;  8ICT A;  5KFO A;  4M9L A;  4F4X A;  4J9K A;  3V7J A;  7ICH A;  1A0P A;  1DOQ A;  4ECQ A;  1VLB A;  2NRW A;  2W04 A;  2KVS A;  3C2L A;  5KT3 A;  2KSO B;  1ZQU A;  4CNQ A;  2KJ8 A;  2Q0Z X;  5H2F U;  1LVH A;  4DF4 A;  4QZF A;  5B5E U;  2I5H A;  4KLG A;  1V38 A;  2DGZ A;  4EEL A;  2YX8 A;  4DLG A;  3PSI A;  5B66 U;  5IIK A;  5KFY A;  1ZQI A;  5AKH A;  5KG7 A;  4PGX A;  4NLN A;  7ICI A;  2L5Y A;  5KFR A;  2FJ6 A;  2W8L A;  1XSL A;  1XSN A;  5L1L A;  9ICT A;  9ICK A;  1RXV A;  4YXM A;  2ZUD A;  5DKW A;  3RH6 A;  5KFP A;  5KFA A;  4I27 A;  3I1Y A;  2GWS A;  4PL2 A;  4YMN A;  5ALN A;  4QIW F;  2DBY A;  4QZB A;  4ICA A;  2HHQ A;  5L9X A;  4DQQ A;  2PMZ F;  2R8H A;  4MF2 A;  5D49 A;  5DB9 A;  5KFV A;  4DQI A;  4UBC A;  3HW8 A;  3EPI A;  4DS4 A;  1PZN A;  4KLD A;  4KMU A;  2OWO A;  9ICJ A;  3LWM A;  3H4B A;  4RU9 A;  5A0L A;  4EX7 A;  3GV7 B;  3VC8 A;  4J9P A;  1NJX A;  4UB4 A;  2DUY A;  4XRH A;  3DV9 A;  5EWF A;  1ZD3 A;  3PML A;  1NK4 A;  2ZIX B;  3NUQ A;  3PW0 A;  5AKK A;  1PK1 A;  3AEV A;  5KFW A;  5ALE A;  1Z1B A;  1L3U A;  4KLU A;  3V6J A;  1BPY A;  4ECU A;  3NRW A;  1L7N A;  1BPX A;  5DQI A;  1B43 A;  5KFE A;  4UQG A;  3GV5 B;  1PK1 B;  4C8N A;  3RF9 A;  1KFT A;  4Z6D A;  2KHV A;  4C8L A;  5AI9 A;  5T14 A;  4BGD A;  3ZDA A;  2PFN A;  4NV0 A;  3C5F A;  1NI3 A;  5F9N A;  2WB1 F;  5ALO A;  1ZQR A;  4M9H A;  3OSN A;  4UB5 A;  3KZX A;  1PUZ A;  4PHP A;  4YR2 A;  2FPK A;  8ICE A;  3BS7 A;  1ZD4 A;  2YN4 A;  3MBY A;  8ICL A;  2V4R A;  2KD1 A;  3KKA C;  5DDM A;  5KG1 A;  3RBD A;  4LZD A;  1ZJN A;  1FIQ A;  2AH5 A;  4YD2 A;  1SWV A;  5C5J A;  5JUM A;  4O3S A;  4DFD A;  4CCH A;  2QKQ A;  2XID A;  2FMS A;  2BCQ A;  4PHE A;  2PFO A;  4M6W B;  2XO7 A;  5AK4 A;  1NK7 A;  4EX6 A;  2F76 X;  3HX0 A;  4KLS A;  3QUT A;  5BOM A;  1L3V A;  4FBT A;  2HHU A;  4I2A A;  4QNL A;  2OXO A;  5ALH A;  2RLT A;  3BZK A;  7ICO A;  1TFR A;  1D8L A;  3DDH A;  1RYS A;  3IDW A;  5TIS U;  5KT7 A;  2KJ5 A;  4YVZ A;  2IMW P;  1ZET A;  4ECZ A;  4M04 A;  1X6J A;  1RYR A;  5J2A A;  3UMC A;  1AQ6 A;  5AM1 A;  4BX9 C;  5CJ7 A;  4OJP A;  1B22 A;  3AL0 B;  2EZY A;  3GIL A;  3THV A;  2QB0 A;  1NK0 A;  1ZQQ A;  8ICK A;  3BZC A;  2F8K A;  4JMU A;  4US8 A;  4O0I A;  5AHX A;  4F2S A;  3CNH A;  3H40 A;  1ZQB A;  2C2R A;  3KD3 A;  5CB1 A;  4F91 B;  3C1Z A;  2E1F A;  5EOZ A;  1NK5 A;  5J0R A;  4B9T A;  4I2F A;  1DK2 A;  3MR2 A;  4DS5 A;  1N48 A;  3LWL A;  1TK8 A;  3BQ7 A;  1OUQ A;  5J2C A;  4RQ0 A;  4RQ8 A;  3CW2 C;  4FS1 A;  5JTI A;  2NRV A;  1ZQV A;  2JR5 A;  2G5I B;  4AYB F;  8ICB A;  5HML A;  2ATL A;  2ZJ5 A;  4FS2 A;  1NOM A;  5AK3 A;  2NO4 A;  2BDP A;  1RDF A;  3KKA A;  2BQR A;  3PW2 A;  3GIM A;  1SXD A;  4UAT A;  4NXZ A;  1SKR A;  4RNN A;  2Z7J A;  3N4M B;  1UA1 A;  1BPE A;  2A1J A;  4KLM A;  3LYS A;  1OW5 A;  2R18 A;  2BDU A;  2W03 A;  5ALF A;  4EEK A;  4GIB A;  4C7Z A;  2JEJ A;  1KW4 A;  3EYZ A;  3NS1 A;  3N28 A;  4LZG A;  2LI6 A;  4YD1 A;  3ETR A;  7ICM A;  4Q45 A;  2DKZ A;  2G06 A;  1T7P A;  5AM0 A;  2FLP A;  2ASD A;  2YB1 A;  4MEY A;  5KFD A;  3N7S C;  3NVY A;  9ICQ A;  2FMP A;  1MQ2 A;  2VA2 A;  5AI4 A;  2K89 A;  4GC7 A;  1QH9 A;  2EDU A;  3RB6 A;  1O08 A;  2JH1 A;  1S0V A;  1IV8 A;  3R9K A;  4B6J A;  5HNK A;  2FLN A;  2WAQ C;  3TAP A;  2HBM A;  4RQ5 A;  2KN7 A;  3WKA A;  3WKE A;  2WF6 A;  4IL6 U;  3PW5 A;  3ORY A;  4P0Q A;  3PW7 A;  4F2R A;  4F4Z A;  2VJ5 A;  4R8U B;  9ICM A;  1ZRN A;  2HMX A;  5HHI A;  1C20 A;  4HYK A;  1RXW A;  4JB3 A;  2BGW A;  4KX5 A;  2QAR A;  3OJS A;  3V72 A;  4B9U A;  2HVI A;  4TUR A;  3I76 A;  5KT6 A;  2ZJA A;  5L1J A;  8ICX A;  4XUS A;  4CF5 A;  2F2A B;  4P0P A;  3ISB A;  4OJ6 A;  2KVC A;  3MR5 A;  1X9M A;  3RR8 A;  5EE9 A;  3ICX A;  3SEI A;  3WK6 A;  1HIW A;  2YMQ A;  5AK6 A;  5KFU A;  4PJ0 U;  2BKE A;  4US9 A;  2HI0 A;  2Y1I A;  2HDO A;  1N61 A;  1X66 A;  4Z6C A;  4IRK A;  3M9N B;  5KFZ A;  7ICS A;  3AMZ A;  7ICV A;  1XO1 A;  4YR0 A;  1T94 A;  3PR4 A;  2E1E A;  2YMP A;  3SEN A;  5KAI U;  1DGS A;  4KLH A;  4K4H A;  2J6U A;  1UA0 A;  3EUB 2;  5D4B A;  4I2C A;  1JMS A;  3KHG A;  1BPZ A;  5J2B A;  5DLF A;  5KG2 A;  2FI1 A;  4GLX A;  1RYU A;  2W54 A;  2JH7 A;  4MFF A;  4GXK A;  4MF8 A;  5G5H A;  1PVP A;  5KFX A;  4CDG A;  3OPX A;  2GH1 A;  2UVW A;  4M2Y A;  4U6P A;  1NZP A;  2G09 A;  3PY8 A;  2Y1J A;  1Q3U A;  4ED8 A;  8ICV A;  5J0X A;  3IV6 A;  4UB2 A;  5EE3 A;  3UMG A;  2LKY A;  4UAV A;  4B9M A;  3KBB A;  2RDI A;  1KSP A;  4MEX A;  2NYV A;  1GO3 F;  3F2B A;  4NLC A;  2XGP A;  3GIJ A;  1HUO A;  5DQG A;  5ALS A;  5IIL A;  2DF4 B;  8ICQ A;  2RP5 A;  3PX0 A;  3ZDE A;  4PHA A;  4O5K A;  3BQ2 A;  4B9V A;  4DL3 A;  1TE2 A;  3FYH A;  4NM2 A;  1UT8 A;  2Y9T A;  5DBC A;  2W8K A;  3CYM A;  1XC9 A;  9ICE A;  3AUO A;  2K60 A;  5J2H A;  5EE1 A;  1YZ6 A;  4Y2Y A;  4JWM A;  4Z6E A;  1BPD A;  2B0C A;  1L6N A;  4YXJ A;  2E5S A;  4O3O A;  1EXN A;  2GOL A;  4IQU A;  3K1Z A;  2LHT A;  4QZE A;  7ICL A;  4QW8 A;  5JU5 A;  4M9J A;  1D9F A;  3Q8P B;  5AI6 A;  3IG8 A;  3L5K A;  1V85 A;  3HKZ C;  4LVS A;  1CI4 A;  4OCZ A;  4DOB A;  3RB4 A;  1NKE A;  4F4Y A;  3NAS A;  2DL0 A;  5J0O A;  1B0X A;  2E8P A;  1KKX A;  4DOA A;  5ALD A;  2DPI A;  3WKC A;  2K4P A;  1H38 A;  5L1M A;  1D8B A;  3V7K A;  9ICL A;  3EWA A;  3MFH A;  2HCF A;  2ZG6 A;  4I2G A;  2KFN A;  2NRZ A;  3GII A;  5AM4 A;  4QWA A;  5AKI A;  1S0N A;  3D2S A;  3AN1 A;  4IR1 A;  3GZF A;  5J0Q A;  5J2G A;  5DBB A;  2VIX A;  4KLQ A;  2KJ9 A;  9ICN A;  4QW9 A;  3K75 D;  2KOB A;  2AHO B;  3PX6 A;  2KSO A;  3TAN A;  4UAZ A;  1COK A;  4Z6F A;  4C0Z A;  4DCC A;  1ZQC A;  1LV5 A;  2ZIV B;  3IG5 A;  4DOC A;  3RB3 A;  4IRC A;  2IA6 A;  4DFJ A;  3IRU A;  3TAD C;  4EYH B;  3QU4 A;  5KAF U;  5CEH A;  3RRH A;  4EYI B;  4BWJ A;  4NY8 A;  4NJ8 A;  3QZ8 A;  2EAP A;  2YML A;  7ICP A;  1X2I A;  1RM6 C;  4FE3 A;  3SAG A;  4IRD A;  4ED0 A;  3C28 A;  1S9F A;  5CP2 A;  2XY5 A;  3RJH A;  2HSZ A;  1WCN A;  3V6K A;  1N56 A;  3ZI4 A;  1ZQS A;  2KK0 A;  4I2H A;  2YQE A;  2VA3 A;  7ICT A;  4QZD A;  3FAH A;  2W9M A;  3RFA A;  4XQ8 A;  3WK4 A;  4BUG A;  9ICR A;  1RZT A;  4JV0 A;  8ICP A;  2LMR A;  3L4P A;  9ICS A;  2IBK A;  7ICE A;  2LM4 A;  1VDV A;  3T5J A;  1T3N A;  2E3T A;  5KTQ A;  4DFM A;  1OXJ A;  5BPC A;  3MFI A;  4F8R A;  4M47 A;  4CF4 A;  2AGO A;  5DQH A;  3A0H U;  1N5W A;  1B4F A;  5KG4 A;  1DRG A;  1S77 D;  2W9C A;  1K1Q A;  5DG8 A;  4ED1 A;  2WF7 A;  2I1Q A;  4QWB A;  3SQI A;  1L3S A;  3C23 A;  5AM2 A;  4O3N A;  4PPX A;  5AKG A;  2W9C B;  3UXP A;  1BNP A;  1CEZ A;  2ZIX A;  4IS7 A;  4KLO A;  3A0B U;  3T79 A;  2LYH A;  2RRD A;  3LDA A;  2PI4 A;  4KMO B;  1WWV A;  3VCB A;  4DSJ A;  3IN5 A;  2AQ4 A;  4DL7 A;  1MN8 A;  5AM5 A;  5F9L A;  2FMQ A;  1FO4 A;  3Q8Q B;  3RB0 A;  1X9X A;  1VJ5 A;  2DQN B;  4M9G A;  3M7D A;  3T3F A;  3F2C A;  3OHA A;  1SZH A;  2K4E A;  2W11 A;  5KFJ A;  1RG6 A;  1CRX A;  1TVA A;  2AU0 A;  5AKL A;  4I2B A;  2JEF A;  4KTQ A;  2W9A A;  1DK3 A;  4R65 A;  4EEY A;  1ZJM A;  4TQR A;  4F4W A;  2BCV A;  4YP3 A;  3SV4 A;  3E0F A;  1ARO P;  1L7P A;  4NLB A;  1SGG A;  4DL6 A;  4USA A;  2LM1 A;  1SZP A;  2KKP A;  1Q46 A;  4M6W A;  7ICK A;  4Q8E A;  3M1Y A;  5ALZ A;  4UAR A;  5ALT A;  3BJY A;  3UXO A;  3G6X A;  2HHV A;  8ICI A;  1FFU A;  2EQY A;  4QZI A;  4I29 A;  2JHD A;  1ZYQ A;  4KN4 A;  3PR5 B;  1KN5 A;  1NJY A;  4DFK A;  4DSK A;  4HAI A;  1ZQZ A;  1SXE A;  5EWG A;  3GV8 B;  2EAN A;  4TQS A;  2PFP A;  2RHF A;  4C4S A;  2K8C B;  4UW9 A;  5AKZ A;  2D8C A;  4PHD A;  4Y2X A;  5AIA A;  4G3I A;  2FE9 A;  5EE0 A;  3PW4 A;  3MGI A;  1TV9 A;  3MDC A;  3D6J A;  2PFQ A;  1A6S A;  3CRX A;  3MGV A;  3T5K A;  4DSI A;  4IQV A;  4RPY A;  3Q8R B;  3QEA Z;  2R8G A;  5KFF A;  4X5V A;  2P6R A;  4QZA A;  1L5U A;  1TAQ A;  4O3Q A;  5G5G A;  5K4L A;  3C1Y A;  3WU2 U;  3M8R A;  1JI7 A;  2B6G A;  3RJG A;  8ICZ A;  4EBC A;  3RAX A;  2ZIW B;  3QU5 A;  1ECW A;  2F1H A;  2JXJ A;  2EAO A;  3H8W A;  4RQM A;  5KFB A;  4DFP A;  2UVU A;  2WB1 C;  3NVZ A;  1Z00 B;  4MFA A;  4DQP A;  3QU9 A;  4NWI A;  4Y2S A;  4RQ2 A;  1UHU A;  2QLT A;  3AQF A;  3OJU A;  1Z19 A;  1S0O A;  4F92 B;  2JZB A;  2AGQ A;  4R63 A;  3QU7 A;  4MHV A;  4Y2V A;  4J9N A;  4TUP A;  4BJQ A;  5KFL A;  4J9M A;  4O3M A;  2AJQ A;  5J2K A;  5DGB A;  1XO0 A;  4RNO A;  3QYP A;  3KZI U;  2JZB B;  3Q8M A;  4AP9 A;  1ZQY A;  4UB1 A;  4PZO A;  4DF8 A;  2V9W A;  4F3O A;  4ZH4 A;  4P4P A;  2D6F C;  1MSW D;  2WF5 A;  2ZIU A;  5BOL A;  4R64 A;  1HEK A;  5J8Y C;  4CGZ A;  2MSN A;  2BQU A;  1F5S A;  2BPF A;  4ECT A;  2XI9 A;  3PSP A;  4RQ6 A;  7ICU A;  4RUA A;  2ZIU B;  1KTQ A;  3NVV A;  3MR6 A;  4NL9 C;  2F8L A;  1ZQO A;  3RJJ A;  4G9B A;  4IC9 A;  9ICH A;  5ALK A;  1SV0 C;  8ICY A;  4U7C A;  1J2M A;  4Q43 A;  5ALQ A;  2WFA A;  2DWQ A;  3FDS A;  2ASL A;  1JN3 A;  2VKQ A;  2WTF A;  4R8U A;  4P2H A;  3N7P D;  4DEZ A;  2BZF A;  7ICG A;  5KG5 A;  2XCP A;  3UXN A;  3BS5 A;  2J6S A;  5KG6 A;  2HHT A;  1SL0 A;  4DL2 A;  2AQ0 A;  4EBD A;  1MA7 A;  1ZXI A;  1NK9 A;  3BS5 B;  3WK5 A;  2G0A A;  4QWE A;  1FFV A;  2ZUB A;  3MGH A;  2Q4T A;  2ZJ8 A;  2C28 A;  4DSE A;  1ZQN A;  1T4G A;  4FO6 A;  4KLL A;  4OJO A;  4RQ3 A;  1KBU A;  1SWW A;  4DQR A;  1ZQT A;  1UT5 A;  3AM9 A;  2K4I A;  7ICF A;  4EEN A;  1N2X A;  3LVW A;  2PKE A;  2E8M A;  1XWL A;  3SMV A;  2ZUC A;  2LPE A;  3FM9 A;  4RPX A;  2ES6 A;  4F72 A;  3IM1 A;  4DO9 A;  2W43 A;  5KFM A;  3ZDD A;  2F44 A;  3C29 A;  4Y2U A;  4R66 A;  4IQW A;  5GTI U;  2W7O A;  1HJP A;  2KTQ A;  1O03 A;  2AGP A;  4C8O A;  3CP8 A;  4J9R A;  4I2E A;  2JRZ A;  5J8Y A;  2GO7 A;  5ALY A;  1SL2 A;  2UVR A;  5AKX A;  2ASJ A;  4O9M A;  8ICC A;  4QZC A;  4C4T A;  4PGQ A;  3C2K A;  3SZ2 A;  5ALX A;  3T5L A;  4NLZ A;  5L1I A;  4IQT A;  2QB1 A;  4ELV A;  2KP7 A;  3N7R C;  1UCV A;  2VAN A;  3HKZ F;  3ISC A;  1WCL A;  9ICF A;  1QTM A;  2KKV A;  4UAS A;  3TQ1 A;  4K4I A;  2JGA A;  5ALJ A;  2KMD A;  2MRL A;  1U47 A;  3M6Z A;  4PZN A;  2O6K A;  9ICA A;  5E79 U;  4ED6 A;  1ZQJ A;  2KFZ A;  2P35 A;  1N60 A;  2DKX A;  3HWT A;  5L1K A;  3DEE A;  5KG0 A;  3F53 A;  3PZP A;  4NLK A;  2KZ3 A;  1PK3 A;  3PNC A;  4ED3 A;  2JV3 A;  4RQ1 A;  1V9P A;  5KFC A;  3GIK A;  3S6J A;  3GDX A;  2ESE A;  1ZQH A;  2H3Q A;  3HIL A;  3OTQ A;  2HHX A;  4B9S A;  1NKC A;  1U49 A;  2HHS A;  5ALU A;  1JRP A;  4Y2Q A;  1NKB A;  3UM9 A;  3HP6 A;  2EAM A;  1KDH A;  4RQN A;  2JMG A;  5HMM A;  1U4B A;  1S5L U;  4C8M A;  3JPO A;  5TZV A;  2RDJ A;  3WK7 A;  3Q8L A;  8ICH A;  9ICP A;  3L3F X;  3HRD D;  3H8J A;  4J9L A;  2KNJ A;  2LBO A;  4NM1 A;  2BCU A;  4F5N A;  4Q8F A;  5AI0 A;  1YT3 A;  4LJX A;  2BPC A;  3KFU F;  3J81 j;  4F5P A;  2F3N A;  2Y0S C;  3WK9 A;  5J2J A;  1XU4 A;  4QZ8 A;  1BPB A;  1FEZ A;  4GXI A;  2E8N A;  4PL1 A;  4IR9 A;  3Q8S B;  3H8S A;  3GQC A;  2PI5 A;  1KLN A;  2ISO A;  3D2N A;  1LKY B;  1BNO A;  4QZH A;  2DPJ A;  5EWE A;  3TFR A;  3QE9 Y;  3QU2 A;  2XIC A;  1JIH A;  3PSF A;  5KT5 A;  2BPG A;  4JV2 A;  2CN1 A;  4K4G A;  5DGA A;  2H3Z A;  2ZIV A;  3NRZ A;  3PO5 A;  2WHE A;  3F5A A;  2MUT A;  2H3F A;  4KLE A;  1RQN A;  4KLI A;  2OH2 A;  3LK9 A;  3ZD8 A;  3U26 A;  4UAU A;  1ZQP A;  3RBE A;  3Q8K A;  1Q3V A;  1C7Y A;  1Y88 A;  5KFT A;  1ZQE A;  3RJI A;  4ZOH C;  3I28 A;  5AM3 A;  1SKS A;  4GFJ A;  3UMB A;  1ZQW A;  4KLJ A;  1URJ A;  3SR6 A;  4NLG A;  1COO A;  3JPP A;  1QCK A;  5J2D A;  2XC9 A;  2CRX A;  4RT2 A;  4C7Y A;  3OGU A;  5IIM A;  5FP0 A;  5KT4 A;  1XS9 D;  2XY6 A;  4KLF A;  4GXJ A;  4P4M A;  4F93 B;  2G08 A;  2RQ5 A;  2M0N A;  4Q44 A;  2D3D A;  5D46 A;  8ICU A;  3E58 A;  3B9J A;  2YTU A;  1ZD2 P;  4F5R A;  4PH5 A;  2KIC A;  3EW9 A;  4KN7 A;  4C8K A;  5AIB A;  1LB2 B;  5DDY A;  1QSY A;  4UB8 U; 
#chains in the Genus database with same CATH homology
 2QAR B;  2F3N A;  1PK1 B;  2E8O A;  5JRT A;  2KSO B;  1WWV A;  1SV0 C;  2E8N A;  1F0M A;  2QB1 A;  3BQ7 A;  2QAR A;  1UCV A;  1LKY B;  2KSO A;  1Z1V A;  5JTI A;  1V38 A;  3H8M A;  1COK A;  1X40 A;  1X9X A;  3BS5 A;  3TAD C;  5KNI A;  3BS7 A;  2KMD A;  4NL9 A;  1LKY A;  1JI7 A;  2B6G A;  2Y9U A;  4PZN A;  3KKA C;  4NJ8 A;  2EAP A;  2L5Y A;  1RG6 A;  3KKA A;  1WWU A;  1SV0 A;  1UQV A;  3BS5 B;  2Y9T A;  3SEI A;  1SXD A;  2DKX A;  2KG5 A;  2QKQ A;  2EAO A;  2K60 A;  4RQM A;  1SGG A;  1OW5 A;  1DXS A;  1PK3 A;  3TAD A;  1X66 A;  2JV3 A;  1KW4 A;  4MHV A;  5JU5 A;  2ESE A;  2LMR A;  5F3X B;  3HIL A;  3IDW A;  2KE7 A;  3SEN A;  2QB0 B;  1OXJ A;  2E8M A;  1V85 A;  2DKZ A;  2LPE A;  4PZO A;  2ES6 A;  2DL0 A;  1B0X A;  2EAM A;  4RQN A;  1B4F A;  2F44 A;  2E8P A;  1SV4 A;  2QB0 A;  2GLE A;  2K4P A;  5L1M A;  1SXE A;  3K1R B;  2F8K A;  2D3D A;  2EAN A;  1PK1 A;  5J8Y C;  5J8Y A;  2YTU A;  2D8C A;  3TAC B;  2KIV A;  2FE9 A;  4IS7 A;  4NL9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...