3SEIA

Crystal structure of caskin1 tandem sams
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
TREGKSSEAVSQWLTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELRRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tandem SAM domain structure of human Caskin1: a presynaptic, self-assembling scaffold for CASK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Caskin-1
total genus 50
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3seiA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3seiA01
2F8KA 1KW4A 2GLEA 2E8MA 5JRTA 2QB1A 4NJ8A 2E8OA 2DL0A 2LPEA 1SXEA 3BS7A 1B4FA 1V85A 2KE7A 5JTIA 1SV0A 3TADA 1WWVA 1X66A 1F0MA 2D3DA 1PK1B 3TADC 2EAOA 1LKYB 5JU5A 1DXSA 1SXDA 1SGGA 2EANA 1SV4A 2KG5A 2D8CA 2KMDA 4RQNA 1V38A 2YTUA 1SV0C 2F3NA 2EAMA 3BQ7A 3BS5B 2FE9A 2E8PA 3IDWA 4PZNA 3SENA 1LKYA 2ES6A 3SEIA 2KIVA 1PK1A 2KSOB 2F44A 1B0XA 2DKZA 2LMRA 2DKXA 3K1RB 1UCVA 1JI7A 3BS5A 2QB0B 2Y9UA 2QKQA 3KKAC 1COKA 1Z1VA 2B6GA 4NL9C 2E8NA 1X40A 2JV3A 1PK3A 2QARB 5L1MA 1UQVA 1RG6A 1WWUA 4RQMA 3H8MA 5F3XB 1OW5A 2EAPA 4IS7A 2QB0A 2KSOA 5J8YA 2Y9TA 4MHVA 1X9XA 2K4PA 5KNIA 2QARA 3TACB 3HILA 2L5YA 3KKAA 4PZOA 2K60A 1OXJA 5J8YC 2ESEA 4NL9A
chains in the Genus database with same CATH superfamily
4M2YA 4I2IA 2JMGA 2Y1IA 1CEZA 1ZQTA 3T5HA 2HHWA 1B4FA 1V85A 3WKBA 5J2AA 2ZIWB 9ICAA 1D8YA 4Z6CA 4F4WA 1K5OA 1PUZA 3K4GA 2XICA 4I2AA 1VJ5A 2UVVA 2NO4A 4BDPA 3NASA 2KG5A 2D8CA 2H3QA 5CRXA 1ZRNA 4ECUA 1SV0C 2EAMA 1ZQLA 2YN4A 2OCEA 2ZJ5A 3QEAZ 2EQYA 3N28A 4EX6A 4ED1A 3QU9A 4DQRA 9ICPA 3S6JA 4LJXA 3L5KA 4AYBC 3OPXA 4IRCA 4O3NA 3PO5A 4B6JA 4CDGA 3AU6A 2GWSA 2HW3A 3KKAC 4F2SA 4NL9C 4DOBA 2A1AA 4QIWC 4IR9A 1O03A 1D8LA 4Y2VA 9ICUA 1NJZA 3JPNA 2K4PA 2DQNB 1DRGA 2ZIUA 2W8LA 5KT2A 3HILA 4MEXA 4HYKA 2XY7A 2L5YA 9ICJA 2F8LA 3ETLA 2AQ0A 1L5UA 4AYBF 4P4OA 1KKXA 3SV3A 2PMZF 3EPGA 2LYAA 1KW4A 3OGUA 5AKXA 9ICRA 1D9FA 4I2EA 4Y2UA 3FYHA 3M6KA 8ICXA 5DQIA 3UMBA 2PXIA 4F93B 3MFHA 2OHFA 4ECQA 4B9LA 5ALQA 1ZQJA 3PO4A 4US8A 2ZUBA 1SGGA 3BQ2A 1S0VA 2HBJA 4QZ8A 5KL1B 4I2CA 3K75D 4R63A 4GC7A 4U6PA 1TK0A 2BDPA 4MFFA 3QYPA 3GIIA 2CXYA 3FDSA 4ECWA 2E8PA 2WB1C 4J9RA 2GH1A 3PSPA 2V4RA 4M47A 8ICTA 1Z3EB 5KFUA 3SAHA 4F92B 4B9MA 1KFTA 3EWAA 2AU0A 2OH2A 5KFFA 1L3VA 1PZNA 4JWMA 1Y88A 1SL0A 2V9WA 4NLBA 2B6GA 2JGAA 5J0YA 2EAPA 4IS7A 3OJSA 3C23A 5J8YA 2YMPA 2B21A 2MU2A 3ZD9A 3C1YA 2OM6A 5KNIA 1X42A 4I29A 5AI5A 2HI0A 1L7NA 4IQUA 1S0NA 1ZD3A 4QZDA 2R8KA 4C8MA 4QZIA 3PSTA 2AJQA 2HHXA 4FZMA 8ICSA 4P4MA 2KN7A 4ECVA 3IP4B 2DGZA 1SXEA 2K89A 3BS7A 3U26A 3ZDAA 2DWQA 2KHQA 5ALGA 4RNNA 4P0QB 5J0WA 4CF4A 3VCBA 1L7MA 4O5EA 4OCZA 2NRWA 4QZBA 4O5KA 3V72A 5AM1A 3MR3A 3KHRA 3ALRA 2BCVA 4IQTA 5G5HA 4EEKA 4RQNA 5AI8A 2F77X 3HW8A 1NZPA 4YQWA 3BQ7A 4C7YA 4M9LA 1NJYA 4RU9A 5ALTA 3UMGA 2W55A 2XI9A 1F5SA 5D4BA 4J9KA 3H40A 1B43A 4MFCA 8ICRA 4ELVA 1ZQQA 3KZIU 4F4KA 5TISU 2HHUA 4U7CA 2KTQA 1IG6A 1JN3A 1DGJA 3KOOA 3GIJA 3DEEA 1UCVA 3NGDA 2MSNA 5KFJA 1XU4A 2ZXIA 4Z6EA 3NTUA 2KZMA 3OSPA 1Z1VA 4BWJA 4ED3A 4ACOA 4G3IA 3RFAA 2ZTCA 2FI1A 2AGOA 2VIXA 8ICLA 5EWEA 3G6XA 2A3VA 5ALPA 5KFLA 3AL0B 5KFWA 2NO5A 3HPOA 2E1FA 2VJ5A 2KFNA 2HHSA 5IIIA 1OXJA 2XVTA 2PFPA 5CA7A 1RQNA 4EYHB 3HRDD 3QU7A 1COOA 1N5WA 2J6SA 5BOMA 3PV8A 3BQTA 4ZOHC 2H3ZA 9ICXA 3ICXA 2BCSA 4FE3A 2W9CA 7ICLA 4DQPA 1PVQA 1C20A 3V7JA 2ALZA 3SR6A 2EAOA 4Z6FA 1QTMA 8ICHA 3RJIA 4DSEA 2RHFA 4BUGA 3K1ZA 2JEFA 4JK1A 4O3SA 2EANA 3F53A 2M0NA 4O3QA 3OSNA 4QWAA 2GO7A 4I2GA 4EZ6A 5BOLA 1S10A 2P6RA 2KKPA 4GIBA 5KFZA 4YP3A 2KK0A 1HEKA 3MGHA 3QUBA 7ICKA 5CJ7A 4MF2A 5AKEA 8ICPA 3PR4A 2AGQA 4YMMA 2BQUA 3RJGA 2JH7A 4UB2A 5EWGA 2LMRA 5KFQA 3C1ZA 4UQGA 2BDUA 1YZ7A 1N63A 2RDIA 2XY5A 5AM3A 1ZRMA 1CRXA 3BQ0A 1WG8A 9ICCA 3T5JA 4RQMA 4ED8A 1RPLA 3ZDEA 3SMVA 2RRDA 2AHOB 1BGXT 2XIDA 2ISPA 3QNMA 4C4RA 2W03A 4RT3A 3UPQA 4MFAA 2G07A 2CRXA 3V6JA 1A77A 4KLOA 5J0PA 7ICIA 1UHUA 1NKBA 5J2HA 2UVWA 5AKKA 4KLJA 3IG5A 2HHTA 5HR7A 4PPXA 2WTFA 2R8IA 1D9DA 2F8KA 4F5QA 1L7PA 1T8EA 1QCKA 1HIWA 1ZD5A 3L4PA 3PX4A 2N1RA 5AK3A 1ZQCA 3UXNA 4CE6A 5KFOA 2ISOA 3LDAA 2ZIXA 2ZTEA 4DS4A 7ICSA 3WKAA 1Q46A 3MC1A 4Q8FA 3UXOA 1NOMA 4JV0A 1TVAA 1PVRA 1FO4A 4WJ3B 4Y2RA 4UB3A 1ZD4A 5ALJA 5CEHA 3V6KA 2F3NA 1LB2B 3RB3A 1XS9D 4OO1J 2QLTA 9ICIA 1XO0A 1ZQSA 3C2MA 3PY8A 3MDCA 1S0MA 3H0LB 4QWCA 2YY6A 2JXJA 4QWDA 1BPZA 3RH4A 1PK1A 4R8UB 3SYZA 1VLBA 1S5LU 4I2JA 4QZFA 1RXVA 1RYSA 3WK5A 5AK4A 4RQ5A 2RQ5A 1ECWA 2LM4A 2FDRA 4XQ8A 3BS5A 5KG0A 4FFDA 7ICUA 2F1HA 2DBYA 4DOCA 1PK3A 3MBYA 5IIKA 2KIWA 3B9JA 3H4BA 3N4MB 1L8LA 4JUZA 1V9PA 4RPZA 2M9NA 2Y9TA 5DB6A 4KN4A 2JZBB 1X9XA 4PGXA 3DDHA 4KX5A 1JXLA 1BNOA 4P0PB 2I9GA 3KHHA 1JMSA 2DKXA 1NK0A 2AQ4A 7ICMA 2R8JA 2JRZA 3TI0A 4EBCA 4EYIB 1RXWA 2NV3A 1IXRA 5A0LA 2LI6A 3WK7A 1ZJMA 3CW2C 1IV8A 5KFGA 4G9BA 3MR6A 2PI4A 1JALA 3PX6A 1KDHA 1WWVA 1K1QA 2Z7JA 4DO9A 2JH1A 4JMUA 4Y2YA 1RYUA 2PKEA 1NNLA 1BVSA 1URJA 4R8UA 1DK3A 2F1JA 5KFEA 1FIQA 5EE1A 4RQ6A 1N2XA 2HOIA 3BZCA 1UA1A 3FC4A 9ICKA 9ICVA 2UVRA 3CNHA 4DFPA 5ALYA 4PZNA 2XGPA 4KMUA 3OTQA 3I1YA 4YN4A 1KSPA 1GO3F 1ZQIA 2YMLA 4OJPA 3HKZF 3Q8LA 8ICEA 7ICJA 2JEJA 1U4BA 3T3FA 5AKGA 3NVZA 2HBLA 4FBTA 4DFJA 4J9SA 3H0RB 3GV8B 5KFVA 1COKA 7ICVA 4QIWF 2E8NA 5J0UA 2G5HB 5DDMA 4QNLA 2QB0A 4MHVA 3NVYA 2MA1A 2C2EA 3I76A 4DOAA 4EZ9A 4M9JA 4O3OA 3QZ7A 2H3VA 1UT8A 4OJ6A 1TAQA 1K1SA 3KKAA 3ORYA 2NRZA 1J2NA 3TAQA 1YT3A 4NL9A 1N61A 3JPPA 2P6UA 5CB1A 4I2BA 1P7DA 4TUPA 5HR6A 3AN1A 4Y2JA 4RPYA 8ICQA 3PW2A 3G6YA 5KTQA 2E8OA 5KG1A 4ELUA 4R65A 3HKZC 3ISCA 3C21A 5KFSA 5KFAA 3MDAA 8ICVA 4KTQA 1HJPA 1SXDA 5KFXA 3D6JA 5KT7A 1VDVA 2HVIA 1TK8A 8ICWA 2FPLA 3IM1A 1ZQUA 3RF9A 5D49A 1ZQWA 1A6SA 4O3MA 1BPBA 3Q8PB 2KMDA 3N7SC 2OWOA 4I2FA 4P2HA 2K4HA 1QQ6A 3RJKA 1XSNA 5J0OA 2BKEA 5ALMA 3PX0A 2FE9A 2Q0ZX 2NYVA 5C5JA 3KTQA 9ICOA 4NWIA 1LVHA 5GTHU 3JPOA 3OHBA 2KZ3A 4EBDA 1MA7A 4M0AA 3Q8SB 2VA8A 3THVA 5DQGA 2H5XA 1DOQA 1HUOA 4IC9A 3M9NB 4LZDA 5AKIA 4C8OA 1BPXA 3AEVA 2W43A 2K4EA 1Q8KA 3QUTA 3WU2U 1UT5A 1YZ6A 5GTIU 2LM1A 1KEJA 2ZTDA 3BJYA 4DLEA 2JR5A 4PGYA 5AIBA 5B5EU 4EENA 3QEBZ 3EW9A 2ZJ8A 4XRHA 4X5VA 3QX7A 1FFVA 5AM2A 3VC8A 1NJXA 2BCRA 2I1QA 8ICJA 4DEZA 4Y2QA 2WAQF 2FJ6A 4PHDA 2E8MA 1NI3A 4B9VA 5ALVA 5HMLA 3GIKA 3E58A 1NK6A 1Z00B 3WKEA 5J2DA 1NKCA 1L3TA 4TUSA 3IRUA 4TUQA 5KFRA 3NRWA 5DDYA 4QJFB 1IIPA 5JU5A 4ECYA 2JHDA 4IQVA 3H7IA 2FMSA 2JEIA 5DBBA 2W8KA 2BCQA 3M7DA 1SV4A 5ALUA 1BNPA 2BCUA 5KFCA 1H38A 2R8GA 3PMNA 4J9PA 7ICHA 1M6YA 5IIOA 3I28A 5C0YA 1J2MA 2W9AA 3C2KA 2ASJA 5KFIA 3HJEA 5AKYA 5AM0A 1TFRA 3Q8MA 2PFNA 1RYRA 4F5OA 5L1JA 4GC6A 3M6ZA 9ICBA 2CN1A 5AICA 5DLFA 2WB1F 4DFDA 4RZRA 5ALKA 4KN7A 1JI7A 2BQRA 3SI8A 2YB4A 2QB0B 3FAHA 4EEYA 4NXZA 5J0SA 5KG3A 4J9MA 4Q8EA 5ALOA 2UVUA 4NLKA 4PHAA 3SQIA 3EZ5A 3C28A 3ONNA 1X2IA 2ATLA 4DSLA 2IHNA 3RB4A 2YQEA 3KFUF 1KLNA 2Y0SC 3RR7A 1Z00A 8ICIA 2XY6A 3QU5A 1XC9A 2IBKA 5KG6A 4Y2PA 1ZQFA 3M8RA 3QUCA 4FS1A 3RRGA 1ZQNA 2GLEA 1ZOLA 4QW8A 1Z1BA 5KG7A 1SWVA 3V7KA 4A8EA 1N60A 1NK4A 3T5LA 4HAIA 1FEZA 4GXJA 5L1KA 1B22A 5J2CA 4C0ZA 4B9NA 1DK2A 2G06A 5KAFU 4M04A 1U47A 3AMZA 1SWWA 1T94A 5IIJA 3B0XA 4UB4A 4KLLA 3F5AA 5HHHA 1KBUA 1ZQ1C 4QWBA 3J81j 2AGPA 4J9NA 5DQHA 1CI4A 7ICEA 1MQ3A 4AP9A 3SEIA 4KLEA 4NV0A 1JUDA 7ICGA 2KJ8A 3MFIA 5DB8A 2MUTB 2F44A 4I28A 1L6NA 2OYYA 4NM2A 3NVWA 9ICTA 4GFJA 4DSIA 5L9XA 4DSFA 3D2SA 1U45A 2JZBA 2Y1JA 1T3QA 1X40A 2ZIUB 3GV7B 3H8MA 5EOZA 1OW5A 3AUOA 2RP5A 2G09A 1WCNA 3E0FA 3M9OB 2HCFA 2QARA 2DPJA 4OJOA 3NS1A 3H8JA 4NLCA 5AKJA 1S76D 4PHEA 2ZIVA 2OEHA 4DFMA 1O08A 1Z4NA 5KFKA 2J6TA 2DF4B 3LWMA 2W9BB 2DFLA 5DBCA 1ZQRA 3Q8QB 2PFOA 4B9UA 5KL8B 9ICMA 4CCHA 1DXSA 4NM1A 2HMXA 4PGQA 4NY8A 3PW4A 4UBBA 1XNSA 5J0XA 2LYHA 1JXEA 4P0PA 1QLNA 4DL6A 3EUB2 2R8HA 1QSYA 3PR5B 3MR5A 7ICQA 3NRZA 1U9LA 3IDWA 3E2EA 3SENA 2FLNA 2VA3A 3KZXA 4YXMA 3V6HA 2HOFA 9ICNA 2KP7A 2BGWA 1ED1A 1BPEA 3UXPA 3RH5A 5HP4A 1UA0A 4XA5A 2HHQA 2KKVA 4YR2A 2O6KA 3RJHA 3RB6A 3GDXA 4JV1A 2HVHA 9ICQA 3K1RB 4UBCA 3A0HU 1CUKA 5EE3A 5KG2A 4Y2SA 4Q45A 7ICFA 3WKCA 4YD1A 3RBDA 5IINA 7ICTA 4YG2A 2RLTA 4TQRA 4RUCA 1ZQBA 3MGIA 3KHGA 4FO6A 2YX8A 4KLQA 3LYSA 4DFKA 4DL2A 5H2FU 2BPFA 3AQFA 5CR0A 5IIMA 3SV4A 5J29A 3UM9A 4JV2A 2ZXHA 5AK6A 5KFYA 3SD7A 5DGBA 4UARA 1KN5A 4F4XA 5KFPA 2LBOA 3TQ1A 4UB6U 2C22A 3N7PD 2FMQA 3ZDBA 4M6WB 4JWNA 4DL3A 2I5HA 4R64A 2KJ9A 5ALWA 1WUDA 3L3FX 5J2EA 4Z6DA 5AIAA 1PK1B 3GIMA 4IRKA 3UQ2A 1S0OA 4KX3A 1XSLA 4NLNA 3HWTA 3JPQA 4UAVA 4E0DA 3H4DA 1EXNA 1SL1A 1T7PA 4ECRA 3QUQA 5DLGA 4F5PA 1L7OA 4RQ3A 3BS5B 4KLFA 4YXJA 5KAIU 4M9GA 2NRTA 5ALRA 2R18A 4UW9A 1NK5A 5J0QA 1RZTA 2KIVA 4UB1A 4RQ1A 1A76A 2DUYA 5EE9A 4KLUA 1Q3VA 4B9TA 1TK5A 3TARA 4FZLA 5BPCA 4RT2A 5HHIA 2P66A 4J03A 4YFKA 1DGSA 1D8BA 5ALLA 2HDOA 2A1JA 2KV2A 3IG8A 2QKQA 4P4PA 2F1IA 1RM6C 2QARB 1UQVA 9ICFA 1XSPA 4UB5A 4NLGA 3RJEA 3JPSA 2XCPA 4DLGA 4M9NA 2AH5A 4QZCA 3ED5A 2WF9A 1ZQKA 2NRVA 2WF7A 3TACB 3WK4A 8ICKA 4QWEA 5E79U 4IRDA 3RAXA 1RDFA 3N7RC 2HOQA 4PZOA 5ALSA 5KFMA 3GV5B 4ED0A 1ZQEA 1U49A 1N62A 4KLMA 2VJ4A 1S8OA 1RQLA 3R9KA 8ICZA 2KHVA 5KFTA 4KLIA 2HHVA 1NZBA 8ICFA 4RQ0A 4C8NA 4KLSA 2WFAA 5AI9A 4OD0A 3ZDCA 3QU2A 1ZQDA 2FPKA 7ICRA 2WF5A 4ICAA 4XUSA 1JROA 5ALXA 8ICOA 2VANA 3T79A 4C8KA 3T5KA 4Y2XA 2YTUA 2B0CA 2W3SA 3JPTA 3PSIA 4RQ4A 9ICHA 2GOLA 1C7YA 3RAQA 5F9LA 3OJUA 3GQCA 1UPHA 5TZVA 4F72A 1NK9A 1F44A 4DSJA 1TAUA 4DF8A 2ES6A 1N48A 2PMZC 5DBAA 3RJJA 1WYGA 2FLPA 4QZGA 2KOBA 1N5XA 2YMQA 2DKZA 3LWLA 1T3NA 8ICNA 4K4GA 4ZH4A 1L3UA 4OJLA 4PH5A 3M9MB 2ASDA 2E5SA 5DG8A 2Y9UA 1TV9A 2WHEA 3NUQA 4UAZA 2ZIVB 4QZHA 2JV3A 1RG6A 2YMMA 3D2QA 1ZQYA 3HX0A 5KG4A 2VKQA 3M8SA 3PVXA 1QQ5A 2WF8A 5HNKA 3LVWA 1L8OA 1HUZA 4GLXA 2NRXA 3WK6A 5J8YC 4M6WA 2ESEA 3GU3A 1X9WA 4C4SA 1KL9A 3B0YA 3ISDA 1SZPA 4NJ8A 4Q44A 3PW0A 2PI5A 1SKRA 4UASA 4RNOA 3WKDA 5JTIA 4FZNA 4KMOB 1KRPA 5AKHA 4BX9C 3TANA 4UATA 2IMWP 2G0AA 1X9MA 4F5NA 4ECTA 1Q3UA 4C4TA 8ICGA 2JEGA 8ICBA 4JB3A 4C7ZA 5JUMA 3AM9A 8ICUA 1X9SA 4EELA 1V38A 3Q8RB 5K4LA 2W9CB 3ZI4A 1XWLA 2MRLA 4CNQA 2A1JB 3CRXA 5KFBA 3PNCA 4PL2A 1OUQA 2KSOB 4BJQA 1IM4A 2IOFA 1SZHA 4YD2A 2IHMA 5KFHA 4Q43A 5HMMA 4B9SA 4I2DA 3HT3A 4R66A 3RBEA 4PL1A 5KG5A 3C5GA 3AQEA 3SAGA 5J2KA 3TAPA 2LKYA 4KLHA 3Q8KA 3RRHA 3QE9Y 1ZETA 1ZYQA 2KSOA 4DS5A 5EWFA 2ZJAA 2KICA 4O5CA 1ZQGA 4DQQA 8ICCA 3BZKA 4I27A 4F50A 5IILA 2P35A 1ZQAA 2PFQA 5KT6A 1TKDA 2WAQC 4US9A 3FM9A 3F2CA 1S9FA 5F9NA 3H8WA 4C80A 3EPIA 4F71A 2FLLA 4C8LA 3MR2A 4ED7A 1NKEA 5CHGA 5JRTA 5DG9A 2QB1A 4Y2TA 1U48A 3IN5A 4TQSA 4KLDA 1KTQA 1SB3C 3OHAA 2LPEA 1S97A 2ZUCA 9ICGA 4BGDA 3F2BA 3TADA 4YMOA 4YR3A 1N56A 1SKSA 3TFSA 5AI4A 3TADC 4DSKA 3CP8A 4UAUA 5J2JA 4YR0A 9ICSA 4PJ0U 2BR0A 2F2AB 4J9OA 3GFKB 3BQ1A 4M9HA 3M1YA 8ICYA 4F5RA 1JRPA 3H0MB 1SIJA 4MF8A 2KFZA 5ALFA 4IL6U 2YB1A 2BZFA 5ALIA 2KEYA 4QZEA 5AI0A 4BXOB 4USAA 3O0FA 1X6JA 5AM4A 2G5IB 2ZIXB 2EZZA 4RQ7A 2Q4TA 2H3FA 4KITB 1BPYA 4RPXA 1MQ2A 4F2RA 1B0XA 1A0PA 4BWMA 7ICNA 4DL5A 5EE0A 1L3SA 4ECZA 5L1IA 4RNMA 4F91B 5AKZA 5L1LA 1J97A 2D6FC 5J2BA 3ZD8A 5L1MA 5J2GA 1ZJNA 1SKWA 5J2IA 1ZQPA 2IOHA 2K8BB 4BXOA 2C2DA 4QW9A 3PZPA 2W04A 1JIHA 5D46A 2KVSA 4I2HA 2HSZA 4FS2A 4CF5A 4P0QA 3KHLA 4OJ5A 7ICPA 3TKAA 4TURA 2W11A 3C5FA 2W3RA 1S77D 2Y0SF 5DG7A 3QU4A 2AXTU 3BDPA 4O0IA 2BPGA 3LVVA 3ISBA 5ALDA 3WK9A 4DCCA 3PW5A 3N97B 8ICMA 1AQ6A 2J6UA 1NJWA 4MEYA 2MAXA 1X66A 4O3RA 1MSWD 2EZXA 1ZD2P 2ZIWA 5DB7A 4CRXA 5AM5A 4K4HA 1Z19A 1ZQXA 4CF3A 1SL2A 3DV9A 1ZQOA 2FPMA 5AHXA 2KJ5A 3RH6A 3F2DA 1KQQA 4DF4A 1MN8A 1KFDA 2G08A 4ELTA 3UMCA 2EZYA 5J0RA 3AU2A 5ALEA 1LV5A 4IQWA 3CYMA 2H3IA 2OXOA 5CP2A 1ZQZA 5DGAA 1Z4OA 2V4QA 3V7LA 1ZQVA 3PW7A 2KNJA 2F76X 5AKLA 1QSLA 1AROP 1BPDA 2RDJA 4LZGA 4KLGA 4CGZA 1ZQHA 2LHTA 5KT5A 3RTVA 2IOFK 1PVPA 4J9QA 4DQSA 4O9MA 2EDUA 1TE2A 3JPRA 4IR1A 2EH9A 5KFDA 9ICLA 3KD3A 5DB9A 2VA2A 3UQ0A 2K4IA 2W7OA 1FFUA 2E1EA 2K8AA 1TAMA 4UAWA 5KT4A 3G6VA 3C2LA 4J9LA 7ICOA 5J2FA 1QSSA 2W54A 1ZQMA 3ETRA 5B66U 3KBBA 4YVZA 2KD1A 4F8RA 5AK5A 3SAFA 4DWIA 3QZ8A 4ED2A 3GZFA 3ZDDA 2XCAA 2DL0A 2KE7A 2XGQA 4FBUA 2CPRA 1SV0A 3PMLA 2ODGA 2IA6A 3TFRA 2KVCA 5DKWA 2ZG6A 1F0MA 2D3DA 2BPCA 1X6IA 2C28A 5KT3A 2ZUDA 4RQ2A 1LKYB 1QH9A 2ASLA 5ALZA 2BHNA 3IHQB 1WCLA 3IV6A 2MUTA 4F4YA 2BQ3A 1NK7A 4YMNA 4DL7A 4LVSA 1XO1A 2W9MA 4O3PA 4ECXA 4DQIA 3F5EA 2WF6A 3MGVA 3H8SA 2A19A 4EX7A 3WK8A 4UAYA 3NVVA 2C2RA 3LK9A 4PHPA 4EBEA 1JX4A 1KFSA 5ALHA 2W9BA 4KLTA 1T4GA 1LKYA 2DPIA 5T14A 4ED6A 3MABA 5AI6A 9ICWA 4ECSA 4QZAA 1V97A 2XC9A 2HBMA 1NK8A 4GXKA 2E3TA 4YCXA 3PSFA 2HBKA 4F3OA 1MC8A 8ICAA 4RUAA 4RQ8A 3RJFA 3A0BU 2W7PA 5FP0A 5J0TA 5CWRA 1WWUA 5F3XB 3C29A 4F4ZA 3QXGA 3HP6A 2I6XA 5ALNA 5KFNA 5G5GA 4K4IA 2LYBA 9ICEA 2FMPA 3RB0A 3RR8A 3D2NA 2XO7A 3EYZA 3GILA 4GXIA 1QQ7A 2K8CB 2K60A 2KZZA 1ZXIA 4UB8U 4QZ9A 4DL4A 4NLZA 3SZ2A
chains in the Genus database with same CATH topology
2F8KA 1KW4A 2GLEA 2E8MA 5JRTA 2QB1A 4NJ8A 2E8OA 2DL0A 2LPEA 1SXEA 3BS7A 1B4FA 1V85A 2KE7A 5JTIA 1SV0A 3TADA 1WWVA 1X66A 1F0MA 2D3DA 1PK1B 3TADC 2EAOA 1LKYB 5JU5A 1DXSA 1SXDA 1SGGA 2EANA 1SV4A 2KG5A 2D8CA 2KMDA 4RQNA 1V38A 2YTUA 1SV0C 2F3NA 2EAMA 3BQ7A 3BS5B 2FE9A 2E8PA 3IDWA 4PZNA 3SENA 1LKYA 2ES6A 3SEIA 2KIVA 1PK1A 2KSOB 2F44A 1B0XA 2DKZA 2LMRA 2DKXA 3K1RB 1UCVA 1JI7A 3BS5A 2QB0B 2Y9UA 2QKQA 3KKAC 1COKA 1Z1VA 2B6GA 4NL9C 2E8NA 1X40A 2JV3A 1PK3A 2QARB 5L1MA 1UQVA 1RG6A 1WWUA 4RQMA 3H8MA 5F3XB 1OW5A 2EAPA 4IS7A 2QB0A 2KSOA 5J8YA 2Y9TA 4MHVA 1X9XA 2K4PA 5KNIA 2QARA 3TACB 3HILA 2L5YA 3KKAA 4PZOA 2K60A 1OXJA 5J8YC 2ESEA 4NL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8K A;  1KW4 A;  2GLE A;  2E8M A;  5JRT A;  2QB1 A;  4NJ8 A;  2E8O A;  2DL0 A;  2LPE A;  1SXE A;  3BS7 A;  1B4F A;  1V85 A;  2KE7 A;  5JTI A;  1SV0 A;  3TAD A;  1WWV A;  1X66 A;  1F0M A;  2D3D A;  1PK1 B;  3TAD C;  2EAO A;  1LKY B;  5JU5 A;  1DXS A;  1SXD A;  1SGG A;  2EAN A;  1SV4 A;  2KG5 A;  2D8C A;  2KMD A;  4RQN A;  1V38 A;  2YTU A;  1SV0 C;  2F3N A;  2EAM A;  3BQ7 A;  3BS5 B;  2FE9 A;  2E8P A;  3IDW A;  4PZN A;  3SEN A;  1LKY A;  2ES6 A;  3SEI A;  2KIV A;  1PK1 A;  2KSO B;  2F44 A;  1B0X A;  2DKZ A;  2LMR A;  2DKX A;  3K1R B;  1UCV A;  1JI7 A;  3BS5 A;  2QB0 B;  2Y9U A;  2QKQ A;  3KKA C;  1COK A;  1Z1V A;  2B6G A;  4NL9 C;  2E8N A;  1X40 A;  2JV3 A;  1PK3 A;  2QAR B;  5L1M A;  1UQV A;  1RG6 A;  1WWU A;  4RQM A;  3H8M A;  5F3X B;  1OW5 A;  2EAP A;  4IS7 A;  2QB0 A;  2KSO A;  5J8Y A;  2Y9T A;  4MHV A;  1X9X A;  2K4P A;  5KNI A;  2QAR A;  3TAC B;  3HIL A;  2L5Y A;  3KKA A;  4PZO A;  2K60 A;  1OXJ A;  5J8Y C;  2ESE A;  4NL9 A; 
#chains in the Genus database with same CATH topology
 4M2Y A;  4I2I A;  2JMG A;  2Y1I A;  1CEZ A;  1ZQT A;  3T5H A;  2HHW A;  1B4F A;  1V85 A;  3WKB A;  5J2A A;  2ZIW B;  9ICA A;  1D8Y A;  4Z6C A;  4F4W A;  1K5O A;  1PUZ A;  3K4G A;  2XIC A;  4I2A A;  1VJ5 A;  2UVV A;  2NO4 A;  4BDP A;  3NAS A;  2KG5 A;  2D8C A;  2H3Q A;  5CRX A;  1ZRN A;  4ECU A;  1SV0 C;  2EAM A;  1ZQL A;  2YN4 A;  2OCE A;  2ZJ5 A;  3QEA Z;  2EQY A;  3N28 A;  4EX6 A;  4ED1 A;  3QU9 A;  4DQR A;  9ICP A;  3S6J A;  4LJX A;  3L5K A;  4AYB C;  3OPX A;  4IRC A;  4O3N A;  3PO5 A;  4B6J A;  4CDG A;  3AU6 A;  2GWS A;  2HW3 A;  3KKA C;  4F2S A;  4NL9 C;  4DOB A;  2A1A A;  4QIW C;  4IR9 A;  1O03 A;  1D8L A;  4Y2V A;  9ICU A;  1NJZ A;  3JPN A;  2K4P A;  2DQN B;  1DRG A;  2ZIU A;  2W8L A;  5KT2 A;  3HIL A;  4MEX A;  4HYK A;  2XY7 A;  2L5Y A;  9ICJ A;  2F8L A;  3ETL A;  2AQ0 A;  1L5U A;  4AYB F;  4P4O A;  1KKX A;  3SV3 A;  2PMZ F;  3EPG A;  2LYA A;  1KW4 A;  3OGU A;  5AKX A;  9ICR A;  1D9F A;  4I2E A;  4Y2U A;  3FYH A;  3M6K A;  8ICX A;  5DQI A;  3UMB A;  2PXI A;  4F93 B;  3MFH A;  2OHF A;  4ECQ A;  4B9L A;  5ALQ A;  1ZQJ A;  3PO4 A;  4US8 A;  2ZUB A;  1SGG A;  3BQ2 A;  1S0V A;  2HBJ A;  4QZ8 A;  5KL1 B;  4I2C A;  3K75 D;  4R63 A;  4GC7 A;  4U6P A;  1TK0 A;  2BDP A;  4MFF A;  3QYP A;  3GII A;  2CXY A;  3FDS A;  4ECW A;  2E8P A;  2WB1 C;  4J9R A;  2GH1 A;  3PSP A;  2V4R A;  4M47 A;  8ICT A;  1Z3E B;  5KFU A;  3SAH A;  4F92 B;  4B9M A;  1KFT A;  3EWA A;  2AU0 A;  2OH2 A;  5KFF A;  1L3V A;  1PZN A;  4JWM A;  1Y88 A;  1SL0 A;  2V9W A;  4NLB A;  2B6G A;  2JGA A;  5J0Y A;  2EAP A;  4IS7 A;  3OJS A;  3C23 A;  5J8Y A;  2YMP A;  2B21 A;  2MU2 A;  3ZD9 A;  3C1Y A;  2OM6 A;  5KNI A;  1X42 A;  4I29 A;  5AI5 A;  2HI0 A;  1L7N A;  4IQU A;  1S0N A;  1ZD3 A;  4QZD A;  2R8K A;  4C8M A;  4QZI A;  3PST A;  2AJQ A;  2HHX A;  4FZM A;  8ICS A;  4P4M A;  2KN7 A;  4ECV A;  3IP4 B;  2DGZ A;  1SXE A;  2K89 A;  3BS7 A;  3U26 A;  3ZDA A;  2DWQ A;  2KHQ A;  5ALG A;  4RNN A;  4P0Q B;  5J0W A;  4CF4 A;  3VCB A;  1L7M A;  4O5E A;  4OCZ A;  2NRW A;  4QZB A;  4O5K A;  3V72 A;  5AM1 A;  3MR3 A;  3KHR A;  3ALR A;  2BCV A;  4IQT A;  5G5H A;  4EEK A;  4RQN A;  5AI8 A;  2F77 X;  3HW8 A;  1NZP A;  4YQW A;  3BQ7 A;  4C7Y A;  4M9L A;  1NJY A;  4RU9 A;  5ALT A;  3UMG A;  2W55 A;  2XI9 A;  1F5S A;  5D4B A;  4J9K A;  3H40 A;  1B43 A;  4MFC A;  8ICR A;  4ELV A;  1ZQQ A;  3KZI U;  4F4K A;  5TIS U;  2HHU A;  4U7C A;  2KTQ A;  1IG6 A;  1JN3 A;  1DGJ A;  3KOO A;  3GIJ A;  3DEE A;  1UCV A;  3NGD A;  2MSN A;  5KFJ A;  1XU4 A;  2ZXI A;  4Z6E A;  3NTU A;  2KZM A;  3OSP A;  1Z1V A;  4BWJ A;  4ED3 A;  4ACO A;  4G3I A;  3RFA A;  2ZTC A;  2FI1 A;  2AGO A;  2VIX A;  8ICL A;  5EWE A;  3G6X A;  2A3V A;  5ALP A;  5KFL A;  3AL0 B;  5KFW A;  2NO5 A;  3HPO A;  2E1F A;  2VJ5 A;  2KFN A;  2HHS A;  5III A;  1OXJ A;  2XVT A;  2PFP A;  5CA7 A;  1RQN A;  4EYH B;  3HRD D;  3QU7 A;  1COO A;  1N5W A;  2J6S A;  5BOM A;  3PV8 A;  3BQT A;  4ZOH C;  2H3Z A;  9ICX A;  3ICX A;  2BCS A;  4FE3 A;  2W9C A;  7ICL A;  4DQP A;  1PVQ A;  1C20 A;  3V7J A;  2ALZ A;  3SR6 A;  2EAO A;  4Z6F A;  1QTM A;  8ICH A;  3RJI A;  4DSE A;  2RHF A;  4BUG A;  3K1Z A;  2JEF A;  4JK1 A;  4O3S A;  2EAN A;  3F53 A;  2M0N A;  4O3Q A;  3OSN A;  4QWA A;  2GO7 A;  4I2G A;  4EZ6 A;  5BOL A;  1S10 A;  2P6R A;  2KKP A;  4GIB A;  5KFZ A;  4YP3 A;  2KK0 A;  1HEK A;  3MGH A;  3QUB A;  7ICK A;  5CJ7 A;  4MF2 A;  5AKE A;  8ICP A;  3PR4 A;  2AGQ A;  4YMM A;  2BQU A;  3RJG A;  2JH7 A;  4UB2 A;  5EWG A;  2LMR A;  5KFQ A;  3C1Z A;  4UQG A;  2BDU A;  1YZ7 A;  1N63 A;  2RDI A;  2XY5 A;  5AM3 A;  1ZRM A;  1CRX A;  3BQ0 A;  1WG8 A;  9ICC A;  3T5J A;  4RQM A;  4ED8 A;  1RPL A;  3ZDE A;  3SMV A;  2RRD A;  2AHO B;  1BGX T;  2XID A;  2ISP A;  3QNM A;  4C4R A;  2W03 A;  4RT3 A;  3UPQ A;  4MFA A;  2G07 A;  2CRX A;  3V6J A;  1A77 A;  4KLO A;  5J0P A;  7ICI A;  1UHU A;  1NKB A;  5J2H A;  2UVW A;  5AKK A;  4KLJ A;  3IG5 A;  2HHT A;  5HR7 A;  4PPX A;  2WTF A;  2R8I A;  1D9D A;  2F8K A;  4F5Q A;  1L7P A;  1T8E A;  1QCK A;  1HIW A;  1ZD5 A;  3L4P A;  3PX4 A;  2N1R A;  5AK3 A;  1ZQC A;  3UXN A;  4CE6 A;  5KFO A;  2ISO A;  3LDA A;  2ZIX A;  2ZTE A;  4DS4 A;  7ICS A;  3WKA A;  1Q46 A;  3MC1 A;  4Q8F A;  3UXO A;  1NOM A;  4JV0 A;  1TVA A;  1PVR A;  1FO4 A;  4WJ3 B;  4Y2R A;  4UB3 A;  1ZD4 A;  5ALJ A;  5CEH A;  3V6K A;  2F3N A;  1LB2 B;  3RB3 A;  1XS9 D;  4OO1 J;  2QLT A;  9ICI A;  1XO0 A;  1ZQS A;  3C2M A;  3PY8 A;  3MDC A;  1S0M A;  3H0L B;  4QWC A;  2YY6 A;  2JXJ A;  4QWD A;  1BPZ A;  3RH4 A;  1PK1 A;  4R8U B;  3SYZ A;  1VLB A;  1S5L U;  4I2J A;  4QZF A;  1RXV A;  1RYS A;  3WK5 A;  5AK4 A;  4RQ5 A;  2RQ5 A;  1ECW A;  2LM4 A;  2FDR A;  4XQ8 A;  3BS5 A;  5KG0 A;  4FFD A;  7ICU A;  2F1H A;  2DBY A;  4DOC A;  1PK3 A;  3MBY A;  5IIK A;  2KIW A;  3B9J A;  3H4B A;  3N4M B;  1L8L A;  4JUZ A;  1V9P A;  4RPZ A;  2M9N A;  2Y9T A;  5DB6 A;  4KN4 A;  2JZB B;  1X9X A;  4PGX A;  3DDH A;  4KX5 A;  1JXL A;  1BNO A;  4P0P B;  2I9G A;  3KHH A;  1JMS A;  2DKX A;  1NK0 A;  2AQ4 A;  7ICM A;  2R8J A;  2JRZ A;  3TI0 A;  4EBC A;  4EYI B;  1RXW A;  2NV3 A;  1IXR A;  5A0L A;  2LI6 A;  3WK7 A;  1ZJM A;  3CW2 C;  1IV8 A;  5KFG A;  4G9B A;  3MR6 A;  2PI4 A;  1JAL A;  3PX6 A;  1KDH A;  1WWV A;  1K1Q A;  2Z7J A;  4DO9 A;  2JH1 A;  4JMU A;  4Y2Y A;  1RYU A;  2PKE A;  1NNL A;  1BVS A;  1URJ A;  4R8U A;  1DK3 A;  2F1J A;  5KFE A;  1FIQ A;  5EE1 A;  4RQ6 A;  1N2X A;  2HOI A;  3BZC A;  1UA1 A;  3FC4 A;  9ICK A;  9ICV A;  2UVR A;  3CNH A;  4DFP A;  5ALY A;  4PZN A;  2XGP A;  4KMU A;  3OTQ A;  3I1Y A;  4YN4 A;  1KSP A;  1GO3 F;  1ZQI A;  2YML A;  4OJP A;  3HKZ F;  3Q8L A;  8ICE A;  7ICJ A;  2JEJ A;  1U4B A;  3T3F A;  5AKG A;  3NVZ A;  2HBL A;  4FBT A;  4DFJ A;  4J9S A;  3H0R B;  3GV8 B;  5KFV A;  1COK A;  7ICV A;  4QIW F;  2E8N A;  5J0U A;  2G5H B;  5DDM A;  4QNL A;  2QB0 A;  4MHV A;  3NVY A;  2MA1 A;  2C2E A;  3I76 A;  4DOA A;  4EZ9 A;  4M9J A;  4O3O A;  3QZ7 A;  2H3V A;  1UT8 A;  4OJ6 A;  1TAQ A;  1K1S A;  3KKA A;  3ORY A;  2NRZ A;  1J2N A;  3TAQ A;  1YT3 A;  4NL9 A;  1N61 A;  3JPP A;  2P6U A;  5CB1 A;  4I2B A;  1P7D A;  4TUP A;  5HR6 A;  3AN1 A;  4Y2J A;  4RPY A;  8ICQ A;  3PW2 A;  3G6Y A;  5KTQ A;  2E8O A;  5KG1 A;  4ELU A;  4R65 A;  3HKZ C;  3ISC A;  3C21 A;  5KFS A;  5KFA A;  3MDA A;  8ICV A;  4KTQ A;  1HJP A;  1SXD A;  5KFX A;  3D6J A;  5KT7 A;  1VDV A;  2HVI A;  1TK8 A;  8ICW A;  2FPL A;  3IM1 A;  1ZQU A;  3RF9 A;  5D49 A;  1ZQW A;  1A6S A;  4O3M A;  1BPB A;  3Q8P B;  2KMD A;  3N7S C;  2OWO A;  4I2F A;  4P2H A;  2K4H A;  1QQ6 A;  3RJK A;  1XSN A;  5J0O A;  2BKE A;  5ALM A;  3PX0 A;  2FE9 A;  2Q0Z X;  2NYV A;  5C5J A;  3KTQ A;  9ICO A;  4NWI A;  1LVH A;  5GTH U;  3JPO A;  3OHB A;  2KZ3 A;  4EBD A;  1MA7 A;  4M0A A;  3Q8S B;  2VA8 A;  3THV A;  5DQG A;  2H5X A;  1DOQ A;  1HUO A;  4IC9 A;  3M9N B;  4LZD A;  5AKI A;  4C8O A;  1BPX A;  3AEV A;  2W43 A;  2K4E A;  1Q8K A;  3QUT A;  3WU2 U;  1UT5 A;  1YZ6 A;  5GTI U;  2LM1 A;  1KEJ A;  2ZTD A;  3BJY A;  4DLE A;  2JR5 A;  4PGY A;  5AIB A;  5B5E U;  4EEN A;  3QEB Z;  3EW9 A;  2ZJ8 A;  4XRH A;  4X5V A;  3QX7 A;  1FFV A;  5AM2 A;  3VC8 A;  1NJX A;  2BCR A;  2I1Q A;  8ICJ A;  4DEZ A;  4Y2Q A;  2WAQ F;  2FJ6 A;  4PHD A;  2E8M A;  1NI3 A;  4B9V A;  5ALV A;  5HML A;  3GIK A;  3E58 A;  1NK6 A;  1Z00 B;  3WKE A;  5J2D A;  1NKC A;  1L3T A;  4TUS A;  3IRU A;  4TUQ A;  5KFR A;  3NRW A;  5DDY A;  4QJF B;  1IIP A;  5JU5 A;  4ECY A;  2JHD A;  4IQV A;  3H7I A;  2FMS A;  2JEI A;  5DBB A;  2W8K A;  2BCQ A;  3M7D A;  1SV4 A;  5ALU A;  1BNP A;  2BCU A;  5KFC A;  1H38 A;  2R8G A;  3PMN A;  4J9P A;  7ICH A;  1M6Y A;  5IIO A;  3I28 A;  5C0Y A;  1J2M A;  2W9A A;  3C2K A;  2ASJ A;  5KFI A;  3HJE A;  5AKY A;  5AM0 A;  1TFR A;  3Q8M A;  2PFN A;  1RYR A;  4F5O A;  5L1J A;  4GC6 A;  3M6Z A;  9ICB A;  2CN1 A;  5AIC A;  5DLF A;  2WB1 F;  4DFD A;  4RZR A;  5ALK A;  4KN7 A;  1JI7 A;  2BQR A;  3SI8 A;  2YB4 A;  2QB0 B;  3FAH A;  4EEY A;  4NXZ A;  5J0S A;  5KG3 A;  4J9M A;  4Q8E A;  5ALO A;  2UVU A;  4NLK A;  4PHA A;  3SQI A;  3EZ5 A;  3C28 A;  3ONN A;  1X2I A;  2ATL A;  4DSL A;  2IHN A;  3RB4 A;  2YQE A;  3KFU F;  1KLN A;  2Y0S C;  3RR7 A;  1Z00 A;  8ICI A;  2XY6 A;  3QU5 A;  1XC9 A;  2IBK A;  5KG6 A;  4Y2P A;  1ZQF A;  3M8R A;  3QUC A;  4FS1 A;  3RRG A;  1ZQN A;  2GLE A;  1ZOL A;  4QW8 A;  1Z1B A;  5KG7 A;  1SWV A;  3V7K A;  4A8E A;  1N60 A;  1NK4 A;  3T5L A;  4HAI A;  1FEZ A;  4GXJ A;  5L1K A;  1B22 A;  5J2C A;  4C0Z A;  4B9N A;  1DK2 A;  2G06 A;  5KAF U;  4M04 A;  1U47 A;  3AMZ A;  1SWW A;  1T94 A;  5IIJ A;  3B0X A;  4UB4 A;  4KLL A;  3F5A A;  5HHH A;  1KBU A;  1ZQ1 C;  4QWB A;  3J81 j;  2AGP A;  4J9N A;  5DQH A;  1CI4 A;  7ICE A;  1MQ3 A;  4AP9 A;  3SEI A;  4KLE A;  4NV0 A;  1JUD A;  7ICG A;  2KJ8 A;  3MFI A;  5DB8 A;  2MUT B;  2F44 A;  4I28 A;  1L6N A;  2OYY A;  4NM2 A;  3NVW A;  9ICT A;  4GFJ A;  4DSI A;  5L9X A;  4DSF A;  3D2S A;  1U45 A;  2JZB A;  2Y1J A;  1T3Q A;  1X40 A;  2ZIU B;  3GV7 B;  3H8M A;  5EOZ A;  1OW5 A;  3AUO A;  2RP5 A;  2G09 A;  1WCN A;  3E0F A;  3M9O B;  2HCF A;  2QAR A;  2DPJ A;  4OJO A;  3NS1 A;  3H8J A;  4NLC A;  5AKJ A;  1S76 D;  4PHE A;  2ZIV A;  2OEH A;  4DFM A;  1O08 A;  1Z4N A;  5KFK A;  2J6T A;  2DF4 B;  3LWM A;  2W9B B;  2DFL A;  5DBC A;  1ZQR A;  3Q8Q B;  2PFO A;  4B9U A;  5KL8 B;  9ICM A;  4CCH A;  1DXS A;  4NM1 A;  2HMX A;  4PGQ A;  4NY8 A;  3PW4 A;  4UBB A;  1XNS A;  5J0X A;  2LYH A;  1JXE A;  4P0P A;  1QLN A;  4DL6 A;  3EUB 2;  2R8H A;  1QSY A;  3PR5 B;  3MR5 A;  7ICQ A;  3NRZ A;  1U9L A;  3IDW A;  3E2E A;  3SEN A;  2FLN A;  2VA3 A;  3KZX A;  4YXM A;  3V6H A;  2HOF A;  9ICN A;  2KP7 A;  2BGW A;  1ED1 A;  1BPE A;  3UXP A;  3RH5 A;  5HP4 A;  1UA0 A;  4XA5 A;  2HHQ A;  2KKV A;  4YR2 A;  2O6K A;  3RJH A;  3RB6 A;  3GDX A;  4JV1 A;  2HVH A;  9ICQ A;  3K1R B;  4UBC A;  3A0H U;  1CUK A;  5EE3 A;  5KG2 A;  4Y2S A;  4Q45 A;  7ICF A;  3WKC A;  4YD1 A;  3RBD A;  5IIN A;  7ICT A;  4YG2 A;  2RLT A;  4TQR A;  4RUC A;  1ZQB A;  3MGI A;  3KHG A;  4FO6 A;  2YX8 A;  4KLQ A;  3LYS A;  4DFK A;  4DL2 A;  5H2F U;  2BPF A;  3AQF A;  5CR0 A;  5IIM A;  3SV4 A;  5J29 A;  3UM9 A;  4JV2 A;  2ZXH A;  5AK6 A;  5KFY A;  3SD7 A;  5DGB A;  4UAR A;  1KN5 A;  4F4X A;  5KFP A;  2LBO A;  3TQ1 A;  4UB6 U;  2C22 A;  3N7P D;  2FMQ A;  3ZDB A;  4M6W B;  4JWN A;  4DL3 A;  2I5H A;  4R64 A;  2KJ9 A;  5ALW A;  1WUD A;  3L3F X;  5J2E A;  4Z6D A;  5AIA A;  1PK1 B;  3GIM A;  4IRK A;  3UQ2 A;  1S0O A;  4KX3 A;  1XSL A;  4NLN A;  3HWT A;  3JPQ A;  4UAV A;  4E0D A;  3H4D A;  1EXN A;  1SL1 A;  1T7P A;  4ECR A;  3QUQ A;  5DLG A;  4F5P A;  1L7O A;  4RQ3 A;  3BS5 B;  4KLF A;  4YXJ A;  5KAI U;  4M9G A;  2NRT A;  5ALR A;  2R18 A;  4UW9 A;  1NK5 A;  5J0Q A;  1RZT A;  2KIV A;  4UB1 A;  4RQ1 A;  1A76 A;  2DUY A;  5EE9 A;  4KLU A;  1Q3V A;  4B9T A;  1TK5 A;  3TAR A;  4FZL A;  5BPC A;  4RT2 A;  5HHI A;  2P66 A;  4J03 A;  4YFK A;  1DGS A;  1D8B A;  5ALL A;  2HDO A;  2A1J A;  2KV2 A;  3IG8 A;  2QKQ A;  4P4P A;  2F1I A;  1RM6 C;  2QAR B;  1UQV A;  9ICF A;  1XSP A;  4UB5 A;  4NLG A;  3RJE A;  3JPS A;  2XCP A;  4DLG A;  4M9N A;  2AH5 A;  4QZC A;  3ED5 A;  2WF9 A;  1ZQK A;  2NRV A;  2WF7 A;  3TAC B;  3WK4 A;  8ICK A;  4QWE A;  5E79 U;  4IRD A;  3RAX A;  1RDF A;  3N7R C;  2HOQ A;  4PZO A;  5ALS A;  5KFM A;  3GV5 B;  4ED0 A;  1ZQE A;  1U49 A;  1N62 A;  4KLM A;  2VJ4 A;  1S8O A;  1RQL A;  3R9K A;  8ICZ A;  2KHV A;  5KFT A;  4KLI A;  2HHV A;  1NZB A;  8ICF A;  4RQ0 A;  4C8N A;  4KLS A;  2WFA A;  5AI9 A;  4OD0 A;  3ZDC A;  3QU2 A;  1ZQD A;  2FPK A;  7ICR A;  2WF5 A;  4ICA A;  4XUS A;  1JRO A;  5ALX A;  8ICO A;  2VAN A;  3T79 A;  4C8K A;  3T5K A;  4Y2X A;  2YTU A;  2B0C A;  2W3S A;  3JPT A;  3PSI A;  4RQ4 A;  9ICH A;  2GOL A;  1C7Y A;  3RAQ A;  5F9L A;  3OJU A;  3GQC A;  1UPH A;  5TZV A;  4F72 A;  1NK9 A;  1F44 A;  4DSJ A;  1TAU A;  4DF8 A;  2ES6 A;  1N48 A;  2PMZ C;  5DBA A;  3RJJ A;  1WYG A;  2FLP A;  4QZG A;  2KOB A;  1N5X A;  2YMQ A;  2DKZ A;  3LWL A;  1T3N A;  8ICN A;  4K4G A;  4ZH4 A;  1L3U A;  4OJL A;  4PH5 A;  3M9M B;  2ASD A;  2E5S A;  5DG8 A;  2Y9U A;  1TV9 A;  2WHE A;  3NUQ A;  4UAZ A;  2ZIV B;  4QZH A;  2JV3 A;  1RG6 A;  2YMM A;  3D2Q A;  1ZQY A;  3HX0 A;  5KG4 A;  2VKQ A;  3M8S A;  3PVX A;  1QQ5 A;  2WF8 A;  5HNK A;  3LVW A;  1L8O A;  1HUZ A;  4GLX A;  2NRX A;  3WK6 A;  5J8Y C;  4M6W A;  2ESE A;  3GU3 A;  1X9W A;  4C4S A;  1KL9 A;  3B0Y A;  3ISD A;  1SZP A;  4NJ8 A;  4Q44 A;  3PW0 A;  2PI5 A;  1SKR A;  4UAS A;  4RNO A;  3WKD A;  5JTI A;  4FZN A;  4KMO B;  1KRP A;  5AKH A;  4BX9 C;  3TAN A;  4UAT A;  2IMW P;  2G0A A;  1X9M A;  4F5N A;  4ECT A;  1Q3U A;  4C4T A;  8ICG A;  2JEG A;  8ICB A;  4JB3 A;  4C7Z A;  5JUM A;  3AM9 A;  8ICU A;  1X9S A;  4EEL A;  1V38 A;  3Q8R B;  5K4L A;  2W9C B;  3ZI4 A;  1XWL A;  2MRL A;  4CNQ A;  2A1J B;  3CRX A;  5KFB A;  3PNC A;  4PL2 A;  1OUQ A;  2KSO B;  4BJQ A;  1IM4 A;  2IOF A;  1SZH A;  4YD2 A;  2IHM A;  5KFH A;  4Q43 A;  5HMM A;  4B9S A;  4I2D A;  3HT3 A;  4R66 A;  3RBE A;  4PL1 A;  5KG5 A;  3C5G A;  3AQE A;  3SAG A;  5J2K A;  3TAP A;  2LKY A;  4KLH A;  3Q8K A;  3RRH A;  3QE9 Y;  1ZET A;  1ZYQ A;  2KSO A;  4DS5 A;  5EWF A;  2ZJA A;  2KIC A;  4O5C A;  1ZQG A;  4DQQ A;  8ICC A;  3BZK A;  4I27 A;  4F50 A;  5IIL A;  2P35 A;  1ZQA A;  2PFQ A;  5KT6 A;  1TKD A;  2WAQ C;  4US9 A;  3FM9 A;  3F2C A;  1S9F A;  5F9N A;  3H8W A;  4C80 A;  3EPI A;  4F71 A;  2FLL A;  4C8L A;  3MR2 A;  4ED7 A;  1NKE A;  5CHG A;  5JRT A;  5DG9 A;  2QB1 A;  4Y2T A;  1U48 A;  3IN5 A;  4TQS A;  4KLD A;  1KTQ A;  1SB3 C;  3OHA A;  2LPE A;  1S97 A;  2ZUC A;  9ICG A;  4BGD A;  3F2B A;  3TAD A;  4YMO A;  4YR3 A;  1N56 A;  1SKS A;  3TFS A;  5AI4 A;  3TAD C;  4DSK A;  3CP8 A;  4UAU A;  5J2J A;  4YR0 A;  9ICS A;  4PJ0 U;  2BR0 A;  2F2A B;  4J9O A;  3GFK B;  3BQ1 A;  4M9H A;  3M1Y A;  8ICY A;  4F5R A;  1JRP A;  3H0M B;  1SIJ A;  4MF8 A;  2KFZ A;  5ALF A;  4IL6 U;  2YB1 A;  2BZF A;  5ALI A;  2KEY A;  4QZE A;  5AI0 A;  4BXO B;  4USA A;  3O0F A;  1X6J A;  5AM4 A;  2G5I B;  2ZIX B;  2EZZ A;  4RQ7 A;  2Q4T A;  2H3F A;  4KIT B;  1BPY A;  4RPX A;  1MQ2 A;  4F2R A;  1B0X A;  1A0P A;  4BWM A;  7ICN A;  4DL5 A;  5EE0 A;  1L3S A;  4ECZ A;  5L1I A;  4RNM A;  4F91 B;  5AKZ A;  5L1L A;  1J97 A;  2D6F C;  5J2B A;  3ZD8 A;  5L1M A;  5J2G A;  1ZJN A;  1SKW A;  5J2I A;  1ZQP A;  2IOH A;  2K8B B;  4BXO A;  2C2D A;  4QW9 A;  3PZP A;  2W04 A;  1JIH A;  5D46 A;  2KVS A;  4I2H A;  2HSZ A;  4FS2 A;  4CF5 A;  4P0Q A;  3KHL A;  4OJ5 A;  7ICP A;  3TKA A;  4TUR A;  2W11 A;  3C5F A;  2W3R A;  1S77 D;  2Y0S F;  5DG7 A;  3QU4 A;  2AXT U;  3BDP A;  4O0I A;  2BPG A;  3LVV A;  3ISB A;  5ALD A;  3WK9 A;  4DCC A;  3PW5 A;  3N97 B;  8ICM A;  1AQ6 A;  2J6U A;  1NJW A;  4MEY A;  2MAX A;  1X66 A;  4O3R A;  1MSW D;  2EZX A;  1ZD2 P;  2ZIW A;  5DB7 A;  4CRX A;  5AM5 A;  4K4H A;  1Z19 A;  1ZQX A;  4CF3 A;  1SL2 A;  3DV9 A;  1ZQO A;  2FPM A;  5AHX A;  2KJ5 A;  3RH6 A;  3F2D A;  1KQQ A;  4DF4 A;  1MN8 A;  1KFD A;  2G08 A;  4ELT A;  3UMC A;  2EZY A;  5J0R A;  3AU2 A;  5ALE A;  1LV5 A;  4IQW A;  3CYM A;  2H3I A;  2OXO A;  5CP2 A;  1ZQZ A;  5DGA A;  1Z4O A;  2V4Q A;  3V7L A;  1ZQV A;  3PW7 A;  2KNJ A;  2F76 X;  5AKL A;  1QSL A;  1ARO P;  1BPD A;  2RDJ A;  4LZG A;  4KLG A;  4CGZ A;  1ZQH A;  2LHT A;  5KT5 A;  3RTV A;  2IOF K;  1PVP A;  4J9Q A;  4DQS A;  4O9M A;  2EDU A;  1TE2 A;  3JPR A;  4IR1 A;  2EH9 A;  5KFD A;  9ICL A;  3KD3 A;  5DB9 A;  2VA2 A;  3UQ0 A;  2K4I A;  2W7O A;  1FFU A;  2E1E A;  2K8A A;  1TAM A;  4UAW A;  5KT4 A;  3G6V A;  3C2L A;  4J9L A;  7ICO A;  5J2F A;  1QSS A;  2W54 A;  1ZQM A;  3ETR A;  5B66 U;  3KBB A;  4YVZ A;  2KD1 A;  4F8R A;  5AK5 A;  3SAF A;  4DWI A;  3QZ8 A;  4ED2 A;  3GZF A;  3ZDD A;  2XCA A;  2DL0 A;  2KE7 A;  2XGQ A;  4FBU A;  2CPR A;  1SV0 A;  3PML A;  2ODG A;  2IA6 A;  3TFR A;  2KVC A;  5DKW A;  2ZG6 A;  1F0M A;  2D3D A;  2BPC A;  1X6I A;  2C28 A;  5KT3 A;  2ZUD A;  4RQ2 A;  1LKY B;  1QH9 A;  2ASL A;  5ALZ A;  2BHN A;  3IHQ B;  1WCL A;  3IV6 A;  2MUT A;  4F4Y A;  2BQ3 A;  1NK7 A;  4YMN A;  4DL7 A;  4LVS A;  1XO1 A;  2W9M A;  4O3P A;  4ECX A;  4DQI A;  3F5E A;  2WF6 A;  3MGV A;  3H8S A;  2A19 A;  4EX7 A;  3WK8 A;  4UAY A;  3NVV A;  2C2R A;  3LK9 A;  4PHP A;  4EBE A;  1JX4 A;  1KFS A;  5ALH A;  2W9B A;  4KLT A;  1T4G A;  1LKY A;  2DPI A;  5T14 A;  4ED6 A;  3MAB A;  5AI6 A;  9ICW A;  4ECS A;  4QZA A;  1V97 A;  2XC9 A;  2HBM A;  1NK8 A;  4GXK A;  2E3T A;  4YCX A;  3PSF A;  2HBK A;  4F3O A;  1MC8 A;  8ICA A;  4RUA A;  4RQ8 A;  3RJF A;  3A0B U;  2W7P A;  5FP0 A;  5J0T A;  5CWR A;  1WWU A;  5F3X B;  3C29 A;  4F4Z A;  3QXG A;  3HP6 A;  2I6X A;  5ALN A;  5KFN A;  5G5G A;  4K4I A;  2LYB A;  9ICE A;  2FMP A;  3RB0 A;  3RR8 A;  3D2N A;  2XO7 A;  3EYZ A;  3GIL A;  4GXI A;  1QQ7 A;  2K8C B;  2K60 A;  2KZZ A;  1ZXI A;  4UB8 U;  4QZ9 A;  4DL4 A;  4NLZ A;  3SZ2 A; 
#chains in the Genus database with same CATH homology
 2F8K A;  1KW4 A;  2GLE A;  2E8M A;  5JRT A;  2QB1 A;  4NJ8 A;  2E8O A;  2DL0 A;  2LPE A;  1SXE A;  3BS7 A;  1B4F A;  1V85 A;  2KE7 A;  5JTI A;  1SV0 A;  3TAD A;  1WWV A;  1X66 A;  1F0M A;  2D3D A;  1PK1 B;  3TAD C;  2EAO A;  1LKY B;  5JU5 A;  1DXS A;  1SXD A;  1SGG A;  2EAN A;  1SV4 A;  2KG5 A;  2D8C A;  2KMD A;  4RQN A;  1V38 A;  2YTU A;  1SV0 C;  2F3N A;  2EAM A;  3BQ7 A;  3BS5 B;  2FE9 A;  2E8P A;  3IDW A;  4PZN A;  3SEN A;  1LKY A;  2ES6 A;  3SEI A;  2KIV A;  1PK1 A;  2KSO B;  2F44 A;  1B0X A;  2DKZ A;  2LMR A;  2DKX A;  3K1R B;  1UCV A;  1JI7 A;  3BS5 A;  2QB0 B;  2Y9U A;  2QKQ A;  3KKA C;  1COK A;  1Z1V A;  2B6G A;  4NL9 C;  2E8N A;  1X40 A;  2JV3 A;  1PK3 A;  2QAR B;  5L1M A;  1UQV A;  1RG6 A;  1WWU A;  4RQM A;  3H8M A;  5F3X B;  1OW5 A;  2EAP A;  4IS7 A;  2QB0 A;  2KSO A;  5J8Y A;  2Y9T A;  4MHV A;  1X9X A;  2K4P A;  5KNI A;  2QAR A;  3TAC B;  3HIL A;  2L5Y A;  3KKA A;  4PZO A;  2K60 A;  1OXJ A;  5J8Y C;  2ESE A;  4NL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...