3SEIA

Crystal structure of caskin1 tandem sams
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
TREGKSSEAVSQWLTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELRRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caskin-1
publication title Tandem SAM domain structure of human Caskin1: a presynaptic, self-assembling scaffold for CASK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 50
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3seiA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3seiA01
5JRTA 1RG6A 4NL9A 1SV0A 2D3DA 2EAMA 2K60A 5J8YC 2DKZA 3KKAA 2B6GA 3HILA 1COKA 1PK3A 5L1MA 1SGGA 1UQVA 2QB0B 1F0MA 1PK1B 4NL9C 2KG5A 1X40A 2GLEA 4MHVA 2QKQA 2DL0A 3BS5A 2E8OA 1LKYB 2QARB 2F3NA 2QB0A 2EAPA 1PK1A 1SXDA 2Y9TA 3IDWA 2Y9UA 2K4PA 2KSOB 1LKYA 4PZNA 1OW5A 5F3XB 1B4FA 3BS7A 2EAOA 2E8NA 1SV0C 2F8KA 3TADA 2LPEA 4NJ8A 1V38A 3K1RB 3H8MA 1WWVA 1V85A 5JTIA 2KSOA 1X66A 2JV3A 5J8YA 2F44A 3KKAC 2EANA 4RQMA 2FE9A 2KMDA 1B0XA 1WWUA 2D8CA 4RQNA 2KE7A 2ESEA 2QB1A 1X9XA 1OXJA 2LMRA 2KIVA 4PZOA 2QARA 2YTUA 1DXSA 2DKXA 1JI7A 2E8MA 3SENA 3TACB 1KW4A 2L5YA 1Z1VA 3BS5B 3BQ7A 2ES6A 2E8PA 5JU5A 5KNIA 4IS7A 1SXEA 3SEIA 1SV4A 3TADC 1UCVA
chains in the Genus database with same CATH superfamily
5CJ7A 8ICXA 2ODGA 3A0HU 1NKCA 1ZQUA 2XO7A 4US9A 2LBOA 2PFPA 1JROA 4OCZA 5FP0A 3DV9A 4MF8A 1BNOA 4P0QB 1HUZA 5HHHA 4KLHA 2VA3A 1RXWA 5ALLA 7ICSA 3N7RC 2W8LA 4NL9C 4QZHA 4DQRA 1WG8A 4NY8A 2GLEA 3H4DA 2ATLA 1N63A 4QZFA 3SI8A 1DK2A 1NJYA 8ICAA 4F3OA 4QZCA 3OTQA 1S0VA 3ICXA 4Z6CA 4C4RA 3HRDD 3N97B 4DOCA 4LVSA 9ICBA 1KSPA 5D4BA 3THVA 3DEEA 5AI6A 2JGAA 3QZ7A 4O3SA 2W7PA 2AGPA 5DQHA 4HYKA 3WK6A 1ZQHA 4I2IA 7ICEA 2KZZA 1NI3A 2FE9A 2W9CB 1KEJA 8ICHA 2W43A 1TE2A 3RFAA 3RF9A 3PW4A 1X9XA 1UA0A 3QYPA 4NV0A 2ZTEA 3UM9A 4M6WB 1DXSA 2BQRA 4ED7A 9ICAA 3IG8A 5KFIA 2CN1A 4ECYA 3MFHA 1YZ6A 1Z1BA 3JPTA 4F93B 1TK5A 5DG7A 4F50A 9ICLA 1T3QA 3UMBA 1SXEA 4KN4A 5AKYA 5KFZA 4B9MA 4DOBA 2UVWA 3KTQA 5CP2A 5J8YC 5J2AA 5J0PA 4ED0A 8ICSA 2KKVA 3V6KA 3CYMA 5KFBA 2KG5A 3GIIA 1N61A 5AK4A 5ALKA 4IRKA 5J0UA 4JV0A 5KFLA 5KFQA 9ICCA 3BS5A 4NLZA 5AHXA 9ICNA 4YN4A 4PPXA 2K4IA 1N2XA 1O03A 2FPMA 1DOQA 2IMWP 1Q3VA 1L7MA 1LKYA 4J9RA 2BZFA 2E8NA 1PUZA 2KJ8A 4J03A 4UBBA 3D6JA 4Q44A 3SV3A 2K4HA 1WWVA 3PR5B 3TFSA 3BZCA 4KLIA 3ZI4A 4F8RA 3ED5A 4O5CA 8ICMA 9ICOA 4ECWA 1QLNA 2VANA 4BXOA 4EENA 4EBEA 1BPBA 4HAIA 2W3SA 5KFSA 2FLNA 5KTQA 4DFDA 2ZJ5A 3T5KA 4ELVA 9ICWA 1V9PA 3E58A 2Y0SF 3KHHA 5J2CA 5ALTA 5EWEA 2EAOA 1ZD4A 3ISDA 2KFZA 4Y2SA 2V9WA 8ICUA 1URJA 2RP5A 4J9MA 2RDIA 5HMLA 3LDAA 3SD7A 4I2GA 3MFIA 3B0YA 2KKPA 4UATA 5KT3A 1CUKA 2RDJA 3TQ1A 4YCXA 1X9SA 3RBDA 4P2HA 4I2BA 5J2JA 2HVIA 1L8OA 1LVHA 1COKA 3VCBA 4GC7A 8ICRA 3SR6A 4ED6A 4QWBA 1U45A 5KFWA 4R8UB 4AP9A 3AN1A 1ZQWA 5KG0A 5DLGA 2GWSA 2LYBA 4P0QA 8ICWA 5L9XA 5AKHA 3TAQA 1K1SA 4MFAA 2BGWA 4F4KA 2F3NA 1ZQNA 3MR6A 1ZQSA 3H0LB 1WCNA 5DGBA 2AQ4A 5DBBA 5AM1A 7ICMA 5J2HA 4J9OA 5C5JA 4DQPA 4PZNA 3M6KA 1J2MA 1CRXA 5DBCA 4K4IA 3H40A 4NM2A 3V7LA 8ICFA 2MU2A 4CF3A 3EZ5A 2KOBA 3AL0B 4PGXA 4O0IA 1RPLA 4RPYA 1BVSA 3H8JA 5ALGA 3GV8B 1Y88A 1FIQA 2LMRA 3NVVA 1KFDA 4UAVA 3V7JA 3TANA 1T8EA 3C2KA 1L5UA 1IIPA 1ZQ1C 4TUPA 2W9CA 9ICXA 3SENA 5AI4A 3MDAA 1QSSA 2P35A 1ZQJA 2KHQA 4M6WA 2F1JA 3RRHA 3WKCA 4J9SA 1OUQA 8ICBA 5AICA 5DGAA 2G07A 2PFOA 3O0FA 4B9VA 2FMSA 3RJJA 1PVPA 2VKQA 5DB7A 2W04A 4RQ2A 1NJXA 3RR7A 2RQ5A 4RPXA 2KIWA 3SAFA 1MC8A 3IV6A 3OSNA 3QE9Y 2I5HA 5J0WA 2R8HA 3H4BA 2W3RA 1JXLA 4QZEA 2LM4A 1RM6C 3V7KA 2J6UA 2DBYA 2OXOA 3OPXA 1RZTA 2E3TA 4KLGA 3KOOA 4KLSA 8ICYA 4EZ6A 1X40A 5D46A 4XQ8A 1A77A 4O3RA 1U9LA 1Q46A 3LK9A 2ZXIA 4G9BA 4UAZA 4OJ5A 5CWRA 5J0TA 3BJYA 2YX8A 4DSIA 4F4XA 1M6YA 4R64A 4IQWA 2FMPA 5ALJA 5HMMA 3PW5A 4DS5A 4RQ1A 3OSPA 1TK8A 2KD1A 3SAHA 1X6JA 2Z7JA 4Y2TA 3FYHA 7ICHA 1S76D 5ALHA 4F2RA 5ALZA 3TFRA 1QQ5A 4KITB 5JTIA 4RNOA 2RRDA 3NRWA 4DQIA 5J8YA 5ALVA 3FM9A 3ZDBA 5KFOA 4P0PB 1JIHA 4KLEA 4Q8FA 4RQ6A 2ASJA 3C29A 1MN8A 2W9AA 4KLFA 1L7NA 1SL2A 2IBKA 5AKGA 1Z3EB 1UT5A 4BGDA 1NK5A 5KFJA 3LWMA 2ES6A 3TARA 2IOFK 3ZDDA 4RU9A 1NZBA 2HW3A 3WK5A 8ICZA 4I28A 8ICGA 4QWEA 5IIIA 4J9NA 4ECUA 2KHVA 3B9JA 4J9QA 1SB3C 2WB1C 4CF4A 4CF5A 4C8OA 2ZTDA 3T5JA 3AEVA 4ACOA 1N48A 3MR5A 1GO3F 4XA5A 1JRPA 2AHOB 7ICVA 2AQ0A 3C5FA 1NKBA 2W54A 5KFNA 1IV8A 4PL1A 1LV5A 2H5XA 4M9HA 2F77X 4ECXA 2AGQA 3QU4A 2JH1A 4B9LA 4RT2A 2KICA 7ICJA 2BCVA 1KLNA 2G0AA 1RYUA 3GIMA 4I2EA 4PH5A 4YXJA 4GC6A 5DBAA 1C20A 3CP8A 3SV4A 2LYHA 5KT2A 1X2IA 3ALRA 2R8KA 2JEGA 2YB1A 4O5KA 5HNKA 4AYBC 1T3NA 5DKWA 3PO4A 4E0DA 1S0MA 4RQNA 3EPGA 2DF4B 1ZQKA 2H3VA 4IRDA 3T5HA 2AGOA 5KFDA 1KW4A 3TAPA 9ICHA 5AM5A 1PVRA 3RH5A 1JN3A 5KFRA 5CA7A 2LYAA 3QU7A 2VJ4A 1HJPA 5AK5A 5J2IA 4JV2A 1KKXA 5GTIU 4GXKA 2EZXA 3QUQA 1SV4A 8ICLA 1UCVA 5E79U 1N5XA 4UB1A 5KFTA 4KMUA 2A3VA 4C4SA 2KEYA 3L3FX 9ICJA 2W9MA 1TAQA 3BQ0A 2PMZC 4JMUA 3RJEA 3NUQA 3IRUA 2F1HA 1S77D 3QUCA 4O3PA 1K5OA 4ED8A 7ICNA 3M6ZA 4YXMA 5KAFU 4DEZA 4O9MA 3EW9A 5ALDA 1L7PA 3HP6A 7ICFA 4O3MA 3PMNA 4U6PA 2WF8A 4EX7A 5AI8A 2OYYA 3GDXA 9ICKA 5J0QA 4DFMA 5F3XB 4I27A 2DPIA 2EH9A 3GIKA 2PFQA 2WF5A 3ONNA 5B66U 5L1IA 2JRZA 1QCKA 1NJWA 3NS1A 3MR3A 4GXJA 2CRXA 2H3ZA 1B0XA 1ZQOA 1A6SA 2FMQA 4NLBA 3PNCA 2WF9A 1OXJA 2RLTA 4CCHA 3MABA 1N56A 1L6NA 4P4OA 1YT3A 2JEJA 1ZQGA 5KFAA 4P0PA 4FO6A 2HHSA 2YMQA 5TZVA 4C8KA 5ALWA 4RZRA 4O3NA 1PZNA 5KFPA 3K75D 1Z1VA 3HJEA 2ISOA 4ECZA 2MRLA 1MA7A 3HKZC 5CRXA 3E2EA 7ICUA 5KFMA 1SZHA 1PVQA 5KG7A 2MAXA 3RB3A 4M04A 4QZ9A 3QX7A 5DQGA 2B6GA 2GO7A 1XU4A 1AQ6A 4KLJA 4QIWF 3HW8A 4M9JA 2IHMA 4C7ZA 2HCFA 3H7IA 2HDOA 4Q45A 1EXNA 3PX0A 1Q3UA 4QZGA 8ICEA 5GTHU 5KFKA 5KFVA 2QARB 3S6JA 2VIXA 2WFAA 1BPDA 2PKEA 2XICA 2EAPA 3M9NB 5J0SA 8ICVA 3F5EA 4O3QA 4QZDA 5KFFA 2BPGA 3RJFA 4Q8EA 1NK9A 2A1JB 5B5EU 4JK1A 2P66A 3LVWA 4RQ8A 4DLGA 4I29A 4O5EA 4F4WA 4ZH4A 4F71A 2KMDA 4ECSA 4J9LA 1WWUA 4ECRA 2ASDA 4PZOA 4C7YA 4PGQA 2XGPA 1MQ2A 2CXYA 5AIAA 1YZ7A 1KDHA 3J81j 2FI1A 1N62A 5AKIA 3NTUA 2DQNB 3D2SA 4C80A 2E1EA 3MGHA 1SWVA 2KV2A 5J0RA 2R8GA 3I28A 3RTVA 3NVWA 4Y2RA 5DB9A 3UMGA 3C23A 1RYRA 4CE6A 2PI5A 5EE9A 8ICOA 5TISU 3WKAA 1ZQPA 2ISPA 1TK0A 1FO4A 2W7OA 2EAMA 2HI0A 2AJQA 4ED3A 4C8LA 3PV8A 8ICIA 3KBBA 4Y2XA 2NO4A 1T4GA 4UB6U 4RQ0A 2VJ5A 3PY8A 4B9UA 4RQ3A 2XGQA 4FS2A 3MBYA 1WUDA 3AM9A 1L8LA 4UB3A 2XCAA 2W9BB 9ICRA 2XY6A 4TUSA 2FLPA 4R63A 4MHVA 5IILA 1H38A 4UW9A 4RNNA 2KN7A 1ZD3A 4YMOA 2ZIUB 4Y2JA 5KT7A 4DF8A 1BPEA 4QZBA 2KSOB 4I2JA 4JUZA 4QWDA 2KNJA 3MGVA 2ZJ8A 4O3OA 3GQCA 5ALFA 2QLTA 3EPIA 1V38A 3QUBA 4DSFA 1QH9A 5ALNA 3EYZA 4ZOHC 5G5GA 9ICEA 4QWCA 4C8NA 3HX0A 2C2DA 2IOHA 4JB3A 3K4GA 4CRXA 4DOAA 3N7PD 4KLLA 2E8MA 3KD3A 4NWIA 2JMGA 4QW8A 5CHGA 5ALIA 2I1QA 3Q8RB 1ZQCA 3UXNA 2KVSA 4UAYA 1D9FA 3HT3A 2ASLA 7ICQA 4EBDA 3JPRA 7ICRA 2BCUA 2R8IA 3TADC 2YMLA 1N60A 5JRTA 2HBJA 4DL4A 2BDPA 4NL9A 4F4ZA 5EWFA 4OD0A 3SAGA 4IQUA 4RQ4A 4UB5A 4BWJA 2AXTU 3HPOA 3LWLA 2EDUA 1VDVA 1IM4A 2ZUBA 5J0XA 3T79A 5L1MA 5L1JA 4UB4A 5EWGA 2QB0B 3I1YA 1ED1A 1K1QA 2WB1F 1S8OA 1SXDA 3BQ1A 3L5KA 3FDSA 5A0LA 1F5SA 7ICOA 4ELUA 3C1YA 2BPFA 2MSNA 4F92B 4EEKA 9ICMA 4DCCA 3UXOA 2F8KA 4NJ8A 3ZD8A 3RB4A 3WU2U 7ICLA 3JPNA 2Y1JA 3KZIU 2B21A 1BPYA 3F2DA 3AU6A 2KJ5A 4UAUA 4GIBA 4F5QA 1MQ3A 2BR0A 2ESEA 1VJ5A 3RB6A 2A1JA 4F2SA 2KIVA 1X9MA 1XSNA 4EX6A 3JPSA 4BUGA 1S10A 2DKXA 3IN5A 3GILA 4DLEA 5AM0A 3QU9A 3LYSA 4DO9A 2HBKA 4AYBF 3WKEA 5IIKA 5F9NA 3G6YA 3Q8KA 4I2CA 2XIDA 4M9LA 4MEXA 1ZQLA 1ZQYA 1ZRNA 3H8SA 5BPCA 2WAQC 5EE3A 4NXZA 4UASA 8ICTA 4LZGA 5J2FA 3SEIA 1JMSA 5D49A 1A0PA 5DG9A 4KX5A 5IIJA 5KFHA 4MF2A 2Q0ZX 5AI0A 4KLDA 5KFXA 5DG8A 3G6XA 3RJKA 7ICKA 5IINA 2Q4TA 3NASA 3OJUA 3SYZA 1ZJMA 4EELA 5J2DA 4DF4A 2KZ3A 3PW0A 5L1KA 3B0XA 5J0OA 1L3UA 9ICQA 2N1RA 2QKQA 2NRWA 5ALSA 2DL0A 4FFDA 5KG3A 2PMZF 1XS9D 3BZKA 5KG2A 1TKDA 2W9BA 2YMPA 3IHQB 3EWAA 4GXIA 4FE3A 4DL3A 2HMXA 2ZIUA 3TKAA 1XO1A 1U49A 1D8LA 2KSOA 4K4HA 3H8WA 1X66A 5ALOA 2AU0A 2LM1A 2JH7A 1ZJNA 5HHIA 1KN5A 4R8UA 2GH1A 2HVHA 2K8BB 5KFYA 1NK6A 2ZXHA 5KG1A 4EBCA 1Z4OA 1NK0A 4Y2PA 2KTQA 1SKWA 4M9NA 2DUYA 3JPQA 4DL2A 2C22A 4NLKA 1JX4A 3WK8A 2K8AA 3BS5B 1XC9A 3ZDCA 5AKXA 3PSFA 4IS7A 5AK3A 5G5HA 4I2FA 3R9KA 4EYIB 1NNLA 3RAXA 1NK4A 5KFEA 1B22A 4ED1A 3PMLA 1KTQA 4B9NA 3NGDA 1KRPA 3F2CA 4CGZA 3D2QA 4PHEA 5EOZA 4UAWA 2BKEA 2HHTA 4YVZA 3HILA 3HKZF 2XY7A 2ZIWB 4DWIA 1ZYQA 3C21A 5AM3A 2ZTCA 1ZQXA 4I2AA 4NLNA 4KN7A 1ECWA 5J0YA 1QSYA 1NOMA 1DGJA 1C7YA 8ICCA 3RJGA 2OH2A 4F91B 4M9GA 2B0CA 1F44A 5KG6A 1SIJA 2QB0A 2HBLA 4Y2QA 4QNLA 1D9DA 4FBUA 1DK3A 3GZFA 3BQ2A 2HHVA 3NRZA 1S0OA 3PR4A 2V4RA 4FZLA 2DPJA 5ALPA 2KJ9A 3ZD9A 3OGUA 2LHTA 5J2BA 2BQ3A 2NRZA 3GV5B 3TADA 2LPEA 2HHUA 2MA1A 1U47A 3TI0A 4OJOA 2OWOA 2F44A 4QZAA 3RH6A 3DDHA 8ICQA 3C2MA 1KQQA 4QWAA 8ICPA 9ICVA 5AK6A 5ALQA 3RH4A 2LI6A 2K8CB 2WHEA 4OJ6A 3RB0A 9ICPA 4FZNA 1ZQEA 1KFTA 5KFCA 3D2NA 1TV9A 3K1ZA 2PI4A 3GV7B 2C2EA 2BPCA 2KZMA 4DSKA 4DFPA 3ORYA 5AKJA 3QEBZ 4PL2A 1TVAA 4USAA 2W11A 4JWNA 2L5YA 2NO5A 3QNMA 4IC9A 4KLTA 3HWTA 2FPLA 2KP7A 2C2RA 4Z6DA 4PHDA 4K4GA 4G3IA 4M47A 7ICIA 4EZ9A 2MUTB 3RBEA 2V4QA 4WJ3B 3EUB2 8ICNA 1S9FA 4NLCA 4B9TA 4OO1J 5HR7A 1N5WA 5HP4A 4IQTA 2XY5A 2XVTA 4UB8U 5J2EA 4QW9A 4C8MA 3AU2A 1Q8KA 5L1LA 2ZJAA 3QU2A 2OM6A 3QXGA 2WF7A 2KVCA 3ISBA 1UPHA 2E8OA 2F1IA 2G5HB 5DDMA 4JWMA 2XC9A 1FEZA 4RNMA 1OW5A 4DFKA 2XCPA 1XNSA 4ECTA 1U4BA 4KLQA 3T5LA 1SV0C 2NYVA 2CPRA 1FFUA 5ALXA 2HHQA 3H8MA 4C4TA 3ZDAA 2W03A 3G6VA 2JV3A 3SZ2A 2K4EA 2H3QA 1DGSA 5KT5A 5KT6A 1XWLA 2YMMA 4YMMA 2QB1A 4Z6EA 4FBTA 3GU3A 2JZBB 5ALMA 2EZZA 4KLUA 1SKRA 1ZQZA 5AIBA 4MFFA 2EZYA 2A19A 4P4MA 3H0MB 3CRXA 1QQ6A 1UHUA 2FDRA 2NRVA 2YB4A 4F5NA 3NVZA 1O08A 1JALA 3F53A 1V97A 2VA2A 5J29A 4NM1A 5KT4A 1NK7A 5KNIA 3V72A 1HUOA 3WKBA 1L3TA 3AMZA 2UVRA 1BPZA 3M7DA 3RJIA 4DSLA 4TQSA 5H2FU 3UQ0A 1ZQMA 4BJQA 1ZRMA 1L7OA 4MFCA 5K4LA 2W55A 2ZG6A 1ZQRA 4IL6U 3WK9A 2G06A 1IXRA 1ZXIA 1ZETA 5AKEA 4F72A 1SGGA 1UA1A 5KL1B 4F5RA 3KFUF 1XSPA 2A1AA 3QUTA 3E0FA 5EE0A 3C1ZA 2ZIWA 5DB6A 5T14A 2HBMA 9ICUA 1ZQBA 4C0ZA 4UQGA 4EEYA 4F5PA 4I2DA 2F2AB 2H3IA 3KHRA 2ZUCA 1TAMA 2K4PA 5IIOA 4QZIA 3RRGA 4U7CA 5KG5A 3MC1A 2P6RA 2JR5A 2NRTA 4PHAA 4YR0A 4TUQA 3Q8QB 3A0BU 3K1RB 3RR8A 7ICTA 1V85A 1ZQFA 1HIWA 1X9WA 1QTMA 2OHFA 2BDUA 5AM4A 3U26A 4RQ5A 3QU5A 3KKAC 5AI9A 4RQMA 3FC4A 4DSEA 1RXVA 3Q8LA 4Y2VA 4EYHB 1TFRA 2BCQA 4YR2A 4QIWC 3MDCA 4YD1A 3OJSA 2R18A 4RT3A 3RJHA 3SMVA 1ZQDA 3M9MB 2JXJA 1S5LU 2J6TA 3GIJA 2DFLA 2G09A 3PW2A 9ICIA 3ISCA 4ED2A 3LVVA 1RYSA 4KLMA 2W8KA 2BCSA 2D6FC 3AQFA 3JPPA 4P4PA 3H0RB 3WK7A 1NKEA 4DL5A 1S97A 4QJFB 1QSLA 4ECQA 2F76X 2E5SA 3IM1A 3N7SC 2HHWA 3V6HA 2K60A 2IHNA 4UARA 1KBUA 5ALUA 1SL1A 2P6UA 2WAQF 1Z19A 3I76A 2PFNA 3PO5A 4DQQA 9ICTA 2MUTA 5KFGA 5AI5A 3ZDEA 1F0MA 1PK1B 1X6IA 3KHGA 1Z00B 2YQEA 4RUCA 2ZIXB 1KFSA 2VA8A 5KL8B 5BOMA 3C5GA 4GLXA 3WKDA 1RQLA 3BDPA 3L4PA 3IDWA 2FPKA 2Y9UA 3UMCA 4Z6FA 3C2LA 4IR9A 8ICKA 4MEYA 5C0YA 4NLGA 4CNQA 3Q8PB 1B4FA 2C28A 1L3VA 4DFJA 3Q8MA 4IR1A 2UVVA 1WYGA 4DL7A 2BCRA 1TAUA 1XO0A 1ZD5A 2G08A 4KMOB 1ZOLA 4QZ8A 1LB2B 1B43A 4IQVA 2QARA 2M0NA 4XUSA 8ICJA 2HHXA 2Y0SC 4YG2A 1CEZA 1JXEA 1KL9A 1DRGA 1UT8A 4R65A 5AKLA 4M2YA 3GFKB 4KX3A 4YR3A 2JZBA 4GFJA 2ZIVB 3NVYA 3F5AA 2HOIA 5AKKA 2E8PA 4Y2UA 3N4MB 4F5OA 4OJLA 5HR6A 1L3SA 4US8A 2HSZA 1SV0A 2D3DA 4IRCA 4Q43A 3Q8SB 4ELTA 5ALRA 5CR0A 1J97A 3JPOA 4YQWA 2OCEA 5JUMA 4JV1A 1SZPA 1RQNA 1AROP 4DL6A 1D8YA 4I2HA 2WF6A 5F9LA 2JEIA 2AH5A 1UQVA 2JHDA 7ICPA 3OHBA 5CB1A 3MGIA 1BGXT 2KK0A 5AM2A 3QEAZ 4DQSA 1IG6A 4LZDA 2OEHA 2M9NA 3UXPA 3C28A 2O6KA 2H3FA 5J2GA 3N28A 3SQIA 2HOQA 4TURA 1Z4NA 9ICSA 4BX9C 3T3FA 2XI9A 7ICGA 3CW2C 4OJPA 5ALYA 4PHPA 1T94A 1X42A 3BS7A 4LJXA 3M9OB 4KLOA 5EE1A 1FFVA 1ZQIA 2RHFA 5DLFA 2BHNA 2JEFA 3PZPA 2IA6A 2E1FA 1RDFA 3KHLA 4J9PA 3PSIA 3PX6A 2EANA 4TQRA 3MR2A 3UQ2A 4YFKA 2D8CA 3BQTA 4RPZA 2G5IB 1SKSA 2ZUDA 3PX4A 1ZQTA 2UVUA 9ICFA 1D8BA 2R8JA 5AKZA 4UB2A 2DGZA 2NRXA 3PSPA 4A8EA 2HOFA 3IP4B 1NK8A 3BQ7A 2NV3A 5JU5A 2YN4A 4M0AA 1S0NA 2FLLA 2IOFA 3FAHA 1J2NA 4B6JA 1CI4A 1RG6A 5KG4A 4ICAA 3VC8A 1COOA 4PJ0U 1U48A 3AUOA 2ALZA 2WTFA 2DKZA 1NZPA 2DWQA 9ICGA 4BWMA 3KKAA 2KFNA 5IIMA 2BQUA 2K89A 1PK3A 2Y1IA 1QQ7A 4ECVA 3M1YA 5DB8A 4R66A 1LKYB 4YD2A 1HEKA 3PVXA 1PK1A 2Y9TA 4KTQA 4FZMA 3ETLA 5ALEA 1A76A 1Z00A 2J6SA 5DDYA 4UBCA 1XSLA 2ZIXA 1ZQAA 2I9GA 2LKYA 3PSTA 4YP3A 5J2KA 3QZ8A 2I6XA 2EQYA 5CEHA 5BOLA 1WCLA 4DSJA 4PGYA 5KAIU 4Y2YA 1T7PA 3F2BA 3UPQA 3ETRA 1BPXA 4RQ7A 2PXIA 4BXOB 1MSWD 4DS4A 2KE7A 1ZQQA 1ZD2P 4YMNA 3IG5A 2FJ6A 1ZQVA 4BDPA 4CDGA 2YTUA 3KZXA 3OHAA 3AQEA 4RUAA 1SWWA 2F8LA 3CNHA 1BNPA 1JI7A 3M8SA 4X5VA 3TACB 5KFUA 1SL0A 4F4YA 3PW7A 2YY6A 3V6JA 3WK4A 1NJZA 1JUDA 4B9SA 2GOLA 4J9KA 3M8RA 3RAQA 4FS1A 1VLBA 4XRHA 1P7DA 5DQIA 2ZIVA
chains in the Genus database with same CATH topology
5JRTA 1RG6A 4NL9A 1SV0A 2D3DA 2EAMA 2K60A 5J8YC 2DKZA 3KKAA 2B6GA 3HILA 1COKA 1PK3A 5L1MA 1SGGA 1UQVA 2QB0B 1F0MA 1PK1B 4NL9C 2KG5A 1X40A 2GLEA 4MHVA 2QKQA 2DL0A 3BS5A 2E8OA 1LKYB 2QARB 2F3NA 2QB0A 2EAPA 1PK1A 1SXDA 2Y9TA 3IDWA 2Y9UA 2K4PA 2KSOB 1LKYA 4PZNA 1OW5A 5F3XB 1B4FA 3BS7A 2EAOA 2E8NA 1SV0C 2F8KA 3TADA 2LPEA 4NJ8A 1V38A 3K1RB 3H8MA 1WWVA 1V85A 5JTIA 2KSOA 1X66A 2JV3A 5J8YA 2F44A 3KKAC 2EANA 4RQMA 2FE9A 2KMDA 1B0XA 1WWUA 2D8CA 4RQNA 2KE7A 2ESEA 2QB1A 1X9XA 1OXJA 2LMRA 2KIVA 4PZOA 2QARA 2YTUA 1DXSA 2DKXA 1JI7A 2E8MA 3SENA 3TACB 1KW4A 2L5YA 1Z1VA 3BS5B 3BQ7A 2ES6A 2E8PA 5JU5A 5KNIA 4IS7A 1SXEA 3SEIA 1SV4A 3TADC 1UCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRT A;  1RG6 A;  4NL9 A;  1SV0 A;  2D3D A;  2EAM A;  2K60 A;  5J8Y C;  2DKZ A;  3KKA A;  2B6G A;  3HIL A;  1COK A;  1PK3 A;  5L1M A;  1SGG A;  1UQV A;  2QB0 B;  1F0M A;  1PK1 B;  4NL9 C;  2KG5 A;  1X40 A;  2GLE A;  4MHV A;  2QKQ A;  2DL0 A;  3BS5 A;  2E8O A;  1LKY B;  2QAR B;  2F3N A;  2QB0 A;  2EAP A;  1PK1 A;  1SXD A;  2Y9T A;  3IDW A;  2Y9U A;  2K4P A;  2KSO B;  1LKY A;  4PZN A;  1OW5 A;  5F3X B;  1B4F A;  3BS7 A;  2EAO A;  2E8N A;  1SV0 C;  2F8K A;  3TAD A;  2LPE A;  4NJ8 A;  1V38 A;  3K1R B;  3H8M A;  1WWV A;  1V85 A;  5JTI A;  2KSO A;  1X66 A;  2JV3 A;  5J8Y A;  2F44 A;  3KKA C;  2EAN A;  4RQM A;  2FE9 A;  2KMD A;  1B0X A;  1WWU A;  2D8C A;  4RQN A;  2KE7 A;  2ESE A;  2QB1 A;  1X9X A;  1OXJ A;  2LMR A;  2KIV A;  4PZO A;  2QAR A;  2YTU A;  1DXS A;  2DKX A;  1JI7 A;  2E8M A;  3SEN A;  3TAC B;  1KW4 A;  2L5Y A;  1Z1V A;  3BS5 B;  3BQ7 A;  2ES6 A;  2E8P A;  5JU5 A;  5KNI A;  4IS7 A;  1SXE A;  3SEI A;  1SV4 A;  3TAD C;  1UCV A; 
#chains in the Genus database with same CATH topology
 5CJ7 A;  8ICX A;  2ODG A;  3A0H U;  1NKC A;  1ZQU A;  2XO7 A;  4US9 A;  2LBO A;  2PFP A;  1JRO A;  4OCZ A;  5FP0 A;  3DV9 A;  4MF8 A;  1BNO A;  4P0Q B;  1HUZ A;  5HHH A;  4KLH A;  2VA3 A;  1RXW A;  5ALL A;  7ICS A;  3N7R C;  2W8L A;  4NL9 C;  4QZH A;  4DQR A;  1WG8 A;  4NY8 A;  2GLE A;  3H4D A;  2ATL A;  1N63 A;  4QZF A;  3SI8 A;  1DK2 A;  1NJY A;  8ICA A;  4F3O A;  4QZC A;  3OTQ A;  1S0V A;  3ICX A;  4Z6C A;  4C4R A;  3HRD D;  3N97 B;  4DOC A;  4LVS A;  9ICB A;  1KSP A;  5D4B A;  3THV A;  3DEE A;  5AI6 A;  2JGA A;  3QZ7 A;  4O3S A;  2W7P A;  2AGP A;  5DQH A;  4HYK A;  3WK6 A;  1ZQH A;  4I2I A;  7ICE A;  2KZZ A;  1NI3 A;  2FE9 A;  2W9C B;  1KEJ A;  8ICH A;  2W43 A;  1TE2 A;  3RFA A;  3RF9 A;  3PW4 A;  1X9X A;  1UA0 A;  3QYP A;  4NV0 A;  2ZTE A;  3UM9 A;  4M6W B;  1DXS A;  2BQR A;  4ED7 A;  9ICA A;  3IG8 A;  5KFI A;  2CN1 A;  4ECY A;  3MFH A;  1YZ6 A;  1Z1B A;  3JPT A;  4F93 B;  1TK5 A;  5DG7 A;  4F50 A;  9ICL A;  1T3Q A;  3UMB A;  1SXE A;  4KN4 A;  5AKY A;  5KFZ A;  4B9M A;  4DOB A;  2UVW A;  3KTQ A;  5CP2 A;  5J8Y C;  5J2A A;  5J0P A;  4ED0 A;  8ICS A;  2KKV A;  3V6K A;  3CYM A;  5KFB A;  2KG5 A;  3GII A;  1N61 A;  5AK4 A;  5ALK A;  4IRK A;  5J0U A;  4JV0 A;  5KFL A;  5KFQ A;  9ICC A;  3BS5 A;  4NLZ A;  5AHX A;  9ICN A;  4YN4 A;  4PPX A;  2K4I A;  1N2X A;  1O03 A;  2FPM A;  1DOQ A;  2IMW P;  1Q3V A;  1L7M A;  1LKY A;  4J9R A;  2BZF A;  2E8N A;  1PUZ A;  2KJ8 A;  4J03 A;  4UBB A;  3D6J A;  4Q44 A;  3SV3 A;  2K4H A;  1WWV A;  3PR5 B;  3TFS A;  3BZC A;  4KLI A;  3ZI4 A;  4F8R A;  3ED5 A;  4O5C A;  8ICM A;  9ICO A;  4ECW A;  1QLN A;  2VAN A;  4BXO A;  4EEN A;  4EBE A;  1BPB A;  4HAI A;  2W3S A;  5KFS A;  2FLN A;  5KTQ A;  4DFD A;  2ZJ5 A;  3T5K A;  4ELV A;  9ICW A;  1V9P A;  3E58 A;  2Y0S F;  3KHH A;  5J2C A;  5ALT A;  5EWE A;  2EAO A;  1ZD4 A;  3ISD A;  2KFZ A;  4Y2S A;  2V9W A;  8ICU A;  1URJ A;  2RP5 A;  4J9M A;  2RDI A;  5HML A;  3LDA A;  3SD7 A;  4I2G A;  3MFI A;  3B0Y A;  2KKP A;  4UAT A;  5KT3 A;  1CUK A;  2RDJ A;  3TQ1 A;  4YCX A;  1X9S A;  3RBD A;  4P2H A;  4I2B A;  5J2J A;  2HVI A;  1L8O A;  1LVH A;  1COK A;  3VCB A;  4GC7 A;  8ICR A;  3SR6 A;  4ED6 A;  4QWB A;  1U45 A;  5KFW A;  4R8U B;  4AP9 A;  3AN1 A;  1ZQW A;  5KG0 A;  5DLG A;  2GWS A;  2LYB A;  4P0Q A;  8ICW A;  5L9X A;  5AKH A;  3TAQ A;  1K1S A;  4MFA A;  2BGW A;  4F4K A;  2F3N A;  1ZQN A;  3MR6 A;  1ZQS A;  3H0L B;  1WCN A;  5DGB A;  2AQ4 A;  5DBB A;  5AM1 A;  7ICM A;  5J2H A;  4J9O A;  5C5J A;  4DQP A;  4PZN A;  3M6K A;  1J2M A;  1CRX A;  5DBC A;  4K4I A;  3H40 A;  4NM2 A;  3V7L A;  8ICF A;  2MU2 A;  4CF3 A;  3EZ5 A;  2KOB A;  3AL0 B;  4PGX A;  4O0I A;  1RPL A;  4RPY A;  1BVS A;  3H8J A;  5ALG A;  3GV8 B;  1Y88 A;  1FIQ A;  2LMR A;  3NVV A;  1KFD A;  4UAV A;  3V7J A;  3TAN A;  1T8E A;  3C2K A;  1L5U A;  1IIP A;  1ZQ1 C;  4TUP A;  2W9C A;  9ICX A;  3SEN A;  5AI4 A;  3MDA A;  1QSS A;  2P35 A;  1ZQJ A;  2KHQ A;  4M6W A;  2F1J A;  3RRH A;  3WKC A;  4J9S A;  1OUQ A;  8ICB A;  5AIC A;  5DGA A;  2G07 A;  2PFO A;  3O0F A;  4B9V A;  2FMS A;  3RJJ A;  1PVP A;  2VKQ A;  5DB7 A;  2W04 A;  4RQ2 A;  1NJX A;  3RR7 A;  2RQ5 A;  4RPX A;  2KIW A;  3SAF A;  1MC8 A;  3IV6 A;  3OSN A;  3QE9 Y;  2I5H A;  5J0W A;  2R8H A;  3H4B A;  2W3R A;  1JXL A;  4QZE A;  2LM4 A;  1RM6 C;  3V7K A;  2J6U A;  2DBY A;  2OXO A;  3OPX A;  1RZT A;  2E3T A;  4KLG A;  3KOO A;  4KLS A;  8ICY A;  4EZ6 A;  1X40 A;  5D46 A;  4XQ8 A;  1A77 A;  4O3R A;  1U9L A;  1Q46 A;  3LK9 A;  2ZXI A;  4G9B A;  4UAZ A;  4OJ5 A;  5CWR A;  5J0T A;  3BJY A;  2YX8 A;  4DSI A;  4F4X A;  1M6Y A;  4R64 A;  4IQW A;  2FMP A;  5ALJ A;  5HMM A;  3PW5 A;  4DS5 A;  4RQ1 A;  3OSP A;  1TK8 A;  2KD1 A;  3SAH A;  1X6J A;  2Z7J A;  4Y2T A;  3FYH A;  7ICH A;  1S76 D;  5ALH A;  4F2R A;  5ALZ A;  3TFR A;  1QQ5 A;  4KIT B;  5JTI A;  4RNO A;  2RRD A;  3NRW A;  4DQI A;  5J8Y A;  5ALV A;  3FM9 A;  3ZDB A;  5KFO A;  4P0P B;  1JIH A;  4KLE A;  4Q8F A;  4RQ6 A;  2ASJ A;  3C29 A;  1MN8 A;  2W9A A;  4KLF A;  1L7N A;  1SL2 A;  2IBK A;  5AKG A;  1Z3E B;  1UT5 A;  4BGD A;  1NK5 A;  5KFJ A;  3LWM A;  2ES6 A;  3TAR A;  2IOF K;  3ZDD A;  4RU9 A;  1NZB A;  2HW3 A;  3WK5 A;  8ICZ A;  4I28 A;  8ICG A;  4QWE A;  5III A;  4J9N A;  4ECU A;  2KHV A;  3B9J A;  4J9Q A;  1SB3 C;  2WB1 C;  4CF4 A;  4CF5 A;  4C8O A;  2ZTD A;  3T5J A;  3AEV A;  4ACO A;  1N48 A;  3MR5 A;  1GO3 F;  4XA5 A;  1JRP A;  2AHO B;  7ICV A;  2AQ0 A;  3C5F A;  1NKB A;  2W54 A;  5KFN A;  1IV8 A;  4PL1 A;  1LV5 A;  2H5X A;  4M9H A;  2F77 X;  4ECX A;  2AGQ A;  3QU4 A;  2JH1 A;  4B9L A;  4RT2 A;  2KIC A;  7ICJ A;  2BCV A;  1KLN A;  2G0A A;  1RYU A;  3GIM A;  4I2E A;  4PH5 A;  4YXJ A;  4GC6 A;  5DBA A;  1C20 A;  3CP8 A;  3SV4 A;  2LYH A;  5KT2 A;  1X2I A;  3ALR A;  2R8K A;  2JEG A;  2YB1 A;  4O5K A;  5HNK A;  4AYB C;  1T3N A;  5DKW A;  3PO4 A;  4E0D A;  1S0M A;  4RQN A;  3EPG A;  2DF4 B;  1ZQK A;  2H3V A;  4IRD A;  3T5H A;  2AGO A;  5KFD A;  1KW4 A;  3TAP A;  9ICH A;  5AM5 A;  1PVR A;  3RH5 A;  1JN3 A;  5KFR A;  5CA7 A;  2LYA A;  3QU7 A;  2VJ4 A;  1HJP A;  5AK5 A;  5J2I A;  4JV2 A;  1KKX A;  5GTI U;  4GXK A;  2EZX A;  3QUQ A;  1SV4 A;  8ICL A;  1UCV A;  5E79 U;  1N5X A;  4UB1 A;  5KFT A;  4KMU A;  2A3V A;  4C4S A;  2KEY A;  3L3F X;  9ICJ A;  2W9M A;  1TAQ A;  3BQ0 A;  2PMZ C;  4JMU A;  3RJE A;  3NUQ A;  3IRU A;  2F1H A;  1S77 D;  3QUC A;  4O3P A;  1K5O A;  4ED8 A;  7ICN A;  3M6Z A;  4YXM A;  5KAF U;  4DEZ A;  4O9M A;  3EW9 A;  5ALD A;  1L7P A;  3HP6 A;  7ICF A;  4O3M A;  3PMN A;  4U6P A;  2WF8 A;  4EX7 A;  5AI8 A;  2OYY A;  3GDX A;  9ICK A;  5J0Q A;  4DFM A;  5F3X B;  4I27 A;  2DPI A;  2EH9 A;  3GIK A;  2PFQ A;  2WF5 A;  3ONN A;  5B66 U;  5L1I A;  2JRZ A;  1QCK A;  1NJW A;  3NS1 A;  3MR3 A;  4GXJ A;  2CRX A;  2H3Z A;  1B0X A;  1ZQO A;  1A6S A;  2FMQ A;  4NLB A;  3PNC A;  2WF9 A;  1OXJ A;  2RLT A;  4CCH A;  3MAB A;  1N56 A;  1L6N A;  4P4O A;  1YT3 A;  2JEJ A;  1ZQG A;  5KFA A;  4P0P A;  4FO6 A;  2HHS A;  2YMQ A;  5TZV A;  4C8K A;  5ALW A;  4RZR A;  4O3N A;  1PZN A;  5KFP A;  3K75 D;  1Z1V A;  3HJE A;  2ISO A;  4ECZ A;  2MRL A;  1MA7 A;  3HKZ C;  5CRX A;  3E2E A;  7ICU A;  5KFM A;  1SZH A;  1PVQ A;  5KG7 A;  2MAX A;  3RB3 A;  4M04 A;  4QZ9 A;  3QX7 A;  5DQG A;  2B6G A;  2GO7 A;  1XU4 A;  1AQ6 A;  4KLJ A;  4QIW F;  3HW8 A;  4M9J A;  2IHM A;  4C7Z A;  2HCF A;  3H7I A;  2HDO A;  4Q45 A;  1EXN A;  3PX0 A;  1Q3U A;  4QZG A;  8ICE A;  5GTH U;  5KFK A;  5KFV A;  2QAR B;  3S6J A;  2VIX A;  2WFA A;  1BPD A;  2PKE A;  2XIC A;  2EAP A;  3M9N B;  5J0S A;  8ICV A;  3F5E A;  4O3Q A;  4QZD A;  5KFF A;  2BPG A;  3RJF A;  4Q8E A;  1NK9 A;  2A1J B;  5B5E U;  4JK1 A;  2P66 A;  3LVW A;  4RQ8 A;  4DLG A;  4I29 A;  4O5E A;  4F4W A;  4ZH4 A;  4F71 A;  2KMD A;  4ECS A;  4J9L A;  1WWU A;  4ECR A;  2ASD A;  4PZO A;  4C7Y A;  4PGQ A;  2XGP A;  1MQ2 A;  2CXY A;  5AIA A;  1YZ7 A;  1KDH A;  3J81 j;  2FI1 A;  1N62 A;  5AKI A;  3NTU A;  2DQN B;  3D2S A;  4C80 A;  2E1E A;  3MGH A;  1SWV A;  2KV2 A;  5J0R A;  2R8G A;  3I28 A;  3RTV A;  3NVW A;  4Y2R A;  5DB9 A;  3UMG A;  3C23 A;  1RYR A;  4CE6 A;  2PI5 A;  5EE9 A;  8ICO A;  5TIS U;  3WKA A;  1ZQP A;  2ISP A;  1TK0 A;  1FO4 A;  2W7O A;  2EAM A;  2HI0 A;  2AJQ A;  4ED3 A;  4C8L A;  3PV8 A;  8ICI A;  3KBB A;  4Y2X A;  2NO4 A;  1T4G A;  4UB6 U;  4RQ0 A;  2VJ5 A;  3PY8 A;  4B9U A;  4RQ3 A;  2XGQ A;  4FS2 A;  3MBY A;  1WUD A;  3AM9 A;  1L8L A;  4UB3 A;  2XCA A;  2W9B B;  9ICR A;  2XY6 A;  4TUS A;  2FLP A;  4R63 A;  4MHV A;  5IIL A;  1H38 A;  4UW9 A;  4RNN A;  2KN7 A;  1ZD3 A;  4YMO A;  2ZIU B;  4Y2J A;  5KT7 A;  4DF8 A;  1BPE A;  4QZB A;  2KSO B;  4I2J A;  4JUZ A;  4QWD A;  2KNJ A;  3MGV A;  2ZJ8 A;  4O3O A;  3GQC A;  5ALF A;  2QLT A;  3EPI A;  1V38 A;  3QUB A;  4DSF A;  1QH9 A;  5ALN A;  3EYZ A;  4ZOH C;  5G5G A;  9ICE A;  4QWC A;  4C8N A;  3HX0 A;  2C2D A;  2IOH A;  4JB3 A;  3K4G A;  4CRX A;  4DOA A;  3N7P D;  4KLL A;  2E8M A;  3KD3 A;  4NWI A;  2JMG A;  4QW8 A;  5CHG A;  5ALI A;  2I1Q A;  3Q8R B;  1ZQC A;  3UXN A;  2KVS A;  4UAY A;  1D9F A;  3HT3 A;  2ASL A;  7ICQ A;  4EBD A;  3JPR A;  7ICR A;  2BCU A;  2R8I A;  3TAD C;  2YML A;  1N60 A;  5JRT A;  2HBJ A;  4DL4 A;  2BDP A;  4NL9 A;  4F4Z A;  5EWF A;  4OD0 A;  3SAG A;  4IQU A;  4RQ4 A;  4UB5 A;  4BWJ A;  2AXT U;  3HPO A;  3LWL A;  2EDU A;  1VDV A;  1IM4 A;  2ZUB A;  5J0X A;  3T79 A;  5L1M A;  5L1J A;  4UB4 A;  5EWG A;  2QB0 B;  3I1Y A;  1ED1 A;  1K1Q A;  2WB1 F;  1S8O A;  1SXD A;  3BQ1 A;  3L5K A;  3FDS A;  5A0L A;  1F5S A;  7ICO A;  4ELU A;  3C1Y A;  2BPF A;  2MSN A;  4F92 B;  4EEK A;  9ICM A;  4DCC A;  3UXO A;  2F8K A;  4NJ8 A;  3ZD8 A;  3RB4 A;  3WU2 U;  7ICL A;  3JPN A;  2Y1J A;  3KZI U;  2B21 A;  1BPY A;  3F2D A;  3AU6 A;  2KJ5 A;  4UAU A;  4GIB A;  4F5Q A;  1MQ3 A;  2BR0 A;  2ESE A;  1VJ5 A;  3RB6 A;  2A1J A;  4F2S A;  2KIV A;  1X9M A;  1XSN A;  4EX6 A;  3JPS A;  4BUG A;  1S10 A;  2DKX A;  3IN5 A;  3GIL A;  4DLE A;  5AM0 A;  3QU9 A;  3LYS A;  4DO9 A;  2HBK A;  4AYB F;  3WKE A;  5IIK A;  5F9N A;  3G6Y A;  3Q8K A;  4I2C A;  2XID A;  4M9L A;  4MEX A;  1ZQL A;  1ZQY A;  1ZRN A;  3H8S A;  5BPC A;  2WAQ C;  5EE3 A;  4NXZ A;  4UAS A;  8ICT A;  4LZG A;  5J2F A;  3SEI A;  1JMS A;  5D49 A;  1A0P A;  5DG9 A;  4KX5 A;  5IIJ A;  5KFH A;  4MF2 A;  2Q0Z X;  5AI0 A;  4KLD A;  5KFX A;  5DG8 A;  3G6X A;  3RJK A;  7ICK A;  5IIN A;  2Q4T A;  3NAS A;  3OJU A;  3SYZ A;  1ZJM A;  4EEL A;  5J2D A;  4DF4 A;  2KZ3 A;  3PW0 A;  5L1K A;  3B0X A;  5J0O A;  1L3U A;  9ICQ A;  2N1R A;  2QKQ A;  2NRW A;  5ALS A;  2DL0 A;  4FFD A;  5KG3 A;  2PMZ F;  1XS9 D;  3BZK A;  5KG2 A;  1TKD A;  2W9B A;  2YMP A;  3IHQ B;  3EWA A;  4GXI A;  4FE3 A;  4DL3 A;  2HMX A;  2ZIU A;  3TKA A;  1XO1 A;  1U49 A;  1D8L A;  2KSO A;  4K4H A;  3H8W A;  1X66 A;  5ALO A;  2AU0 A;  2LM1 A;  2JH7 A;  1ZJN A;  5HHI A;  1KN5 A;  4R8U A;  2GH1 A;  2HVH A;  2K8B B;  5KFY A;  1NK6 A;  2ZXH A;  5KG1 A;  4EBC A;  1Z4O A;  1NK0 A;  4Y2P A;  2KTQ A;  1SKW A;  4M9N A;  2DUY A;  3JPQ A;  4DL2 A;  2C22 A;  4NLK A;  1JX4 A;  3WK8 A;  2K8A A;  3BS5 B;  1XC9 A;  3ZDC A;  5AKX A;  3PSF A;  4IS7 A;  5AK3 A;  5G5H A;  4I2F A;  3R9K A;  4EYI B;  1NNL A;  3RAX A;  1NK4 A;  5KFE A;  1B22 A;  4ED1 A;  3PML A;  1KTQ A;  4B9N A;  3NGD A;  1KRP A;  3F2C A;  4CGZ A;  3D2Q A;  4PHE A;  5EOZ A;  4UAW A;  2BKE A;  2HHT A;  4YVZ A;  3HIL A;  3HKZ F;  2XY7 A;  2ZIW B;  4DWI A;  1ZYQ A;  3C21 A;  5AM3 A;  2ZTC A;  1ZQX A;  4I2A A;  4NLN A;  4KN7 A;  1ECW A;  5J0Y A;  1QSY A;  1NOM A;  1DGJ A;  1C7Y A;  8ICC A;  3RJG A;  2OH2 A;  4F91 B;  4M9G A;  2B0C A;  1F44 A;  5KG6 A;  1SIJ A;  2QB0 A;  2HBL A;  4Y2Q A;  4QNL A;  1D9D A;  4FBU A;  1DK3 A;  3GZF A;  3BQ2 A;  2HHV A;  3NRZ A;  1S0O A;  3PR4 A;  2V4R A;  4FZL A;  2DPJ A;  5ALP A;  2KJ9 A;  3ZD9 A;  3OGU A;  2LHT A;  5J2B A;  2BQ3 A;  2NRZ A;  3GV5 B;  3TAD A;  2LPE A;  2HHU A;  2MA1 A;  1U47 A;  3TI0 A;  4OJO A;  2OWO A;  2F44 A;  4QZA A;  3RH6 A;  3DDH A;  8ICQ A;  3C2M A;  1KQQ A;  4QWA A;  8ICP A;  9ICV A;  5AK6 A;  5ALQ A;  3RH4 A;  2LI6 A;  2K8C B;  2WHE A;  4OJ6 A;  3RB0 A;  9ICP A;  4FZN A;  1ZQE A;  1KFT A;  5KFC A;  3D2N A;  1TV9 A;  3K1Z A;  2PI4 A;  3GV7 B;  2C2E A;  2BPC A;  2KZM A;  4DSK A;  4DFP A;  3ORY A;  5AKJ A;  3QEB Z;  4PL2 A;  1TVA A;  4USA A;  2W11 A;  4JWN A;  2L5Y A;  2NO5 A;  3QNM A;  4IC9 A;  4KLT A;  3HWT A;  2FPL A;  2KP7 A;  2C2R A;  4Z6D A;  4PHD A;  4K4G A;  4G3I A;  4M47 A;  7ICI A;  4EZ9 A;  2MUT B;  3RBE A;  2V4Q A;  4WJ3 B;  3EUB 2;  8ICN A;  1S9F A;  4NLC A;  4B9T A;  4OO1 J;  5HR7 A;  1N5W A;  5HP4 A;  4IQT A;  2XY5 A;  2XVT A;  4UB8 U;  5J2E A;  4QW9 A;  4C8M A;  3AU2 A;  1Q8K A;  5L1L A;  2ZJA A;  3QU2 A;  2OM6 A;  3QXG A;  2WF7 A;  2KVC A;  3ISB A;  1UPH A;  2E8O A;  2F1I A;  2G5H B;  5DDM A;  4JWM A;  2XC9 A;  1FEZ A;  4RNM A;  1OW5 A;  4DFK A;  2XCP A;  1XNS A;  4ECT A;  1U4B A;  4KLQ A;  3T5L A;  1SV0 C;  2NYV A;  2CPR A;  1FFU A;  5ALX A;  2HHQ A;  3H8M A;  4C4T A;  3ZDA A;  2W03 A;  3G6V A;  2JV3 A;  3SZ2 A;  2K4E A;  2H3Q A;  1DGS A;  5KT5 A;  5KT6 A;  1XWL A;  2YMM A;  4YMM A;  2QB1 A;  4Z6E A;  4FBT A;  3GU3 A;  2JZB B;  5ALM A;  2EZZ A;  4KLU A;  1SKR A;  1ZQZ A;  5AIB A;  4MFF A;  2EZY A;  2A19 A;  4P4M A;  3H0M B;  3CRX A;  1QQ6 A;  1UHU A;  2FDR A;  2NRV A;  2YB4 A;  4F5N A;  3NVZ A;  1O08 A;  1JAL A;  3F53 A;  1V97 A;  2VA2 A;  5J29 A;  4NM1 A;  5KT4 A;  1NK7 A;  5KNI A;  3V72 A;  1HUO A;  3WKB A;  1L3T A;  3AMZ A;  2UVR A;  1BPZ A;  3M7D A;  3RJI A;  4DSL A;  4TQS A;  5H2F U;  3UQ0 A;  1ZQM A;  4BJQ A;  1ZRM A;  1L7O A;  4MFC A;  5K4L A;  2W55 A;  2ZG6 A;  1ZQR A;  4IL6 U;  3WK9 A;  2G06 A;  1IXR A;  1ZXI A;  1ZET A;  5AKE A;  4F72 A;  1SGG A;  1UA1 A;  5KL1 B;  4F5R A;  3KFU F;  1XSP A;  2A1A A;  3QUT A;  3E0F A;  5EE0 A;  3C1Z A;  2ZIW A;  5DB6 A;  5T14 A;  2HBM A;  9ICU A;  1ZQB A;  4C0Z A;  4UQG A;  4EEY A;  4F5P A;  4I2D A;  2F2A B;  2H3I A;  3KHR A;  2ZUC A;  1TAM A;  2K4P A;  5IIO A;  4QZI A;  3RRG A;  4U7C A;  5KG5 A;  3MC1 A;  2P6R A;  2JR5 A;  2NRT A;  4PHA A;  4YR0 A;  4TUQ A;  3Q8Q B;  3A0B U;  3K1R B;  3RR8 A;  7ICT A;  1V85 A;  1ZQF A;  1HIW A;  1X9W A;  1QTM A;  2OHF A;  2BDU A;  5AM4 A;  3U26 A;  4RQ5 A;  3QU5 A;  3KKA C;  5AI9 A;  4RQM A;  3FC4 A;  4DSE A;  1RXV A;  3Q8L A;  4Y2V A;  4EYH B;  1TFR A;  2BCQ A;  4YR2 A;  4QIW C;  3MDC A;  4YD1 A;  3OJS A;  2R18 A;  4RT3 A;  3RJH A;  3SMV A;  1ZQD A;  3M9M B;  2JXJ A;  1S5L U;  2J6T A;  3GIJ A;  2DFL A;  2G09 A;  3PW2 A;  9ICI A;  3ISC A;  4ED2 A;  3LVV A;  1RYS A;  4KLM A;  2W8K A;  2BCS A;  2D6F C;  3AQF A;  3JPP A;  4P4P A;  3H0R B;  3WK7 A;  1NKE A;  4DL5 A;  1S97 A;  4QJF B;  1QSL A;  4ECQ A;  2F76 X;  2E5S A;  3IM1 A;  3N7S C;  2HHW A;  3V6H A;  2K60 A;  2IHN A;  4UAR A;  1KBU A;  5ALU A;  1SL1 A;  2P6U A;  2WAQ F;  1Z19 A;  3I76 A;  2PFN A;  3PO5 A;  4DQQ A;  9ICT A;  2MUT A;  5KFG A;  5AI5 A;  3ZDE A;  1F0M A;  1PK1 B;  1X6I A;  3KHG A;  1Z00 B;  2YQE A;  4RUC A;  2ZIX B;  1KFS A;  2VA8 A;  5KL8 B;  5BOM A;  3C5G A;  4GLX A;  3WKD A;  1RQL A;  3BDP A;  3L4P A;  3IDW A;  2FPK A;  2Y9U A;  3UMC A;  4Z6F A;  3C2L A;  4IR9 A;  8ICK A;  4MEY A;  5C0Y A;  4NLG A;  4CNQ A;  3Q8P B;  1B4F A;  2C28 A;  1L3V A;  4DFJ A;  3Q8M A;  4IR1 A;  2UVV A;  1WYG A;  4DL7 A;  2BCR A;  1TAU A;  1XO0 A;  1ZD5 A;  2G08 A;  4KMO B;  1ZOL A;  4QZ8 A;  1LB2 B;  1B43 A;  4IQV A;  2QAR A;  2M0N A;  4XUS A;  8ICJ A;  2HHX A;  2Y0S C;  4YG2 A;  1CEZ A;  1JXE A;  1KL9 A;  1DRG A;  1UT8 A;  4R65 A;  5AKL A;  4M2Y A;  3GFK B;  4KX3 A;  4YR3 A;  2JZB A;  4GFJ A;  2ZIV B;  3NVY A;  3F5A A;  2HOI A;  5AKK A;  2E8P A;  4Y2U A;  3N4M B;  4F5O A;  4OJL A;  5HR6 A;  1L3S A;  4US8 A;  2HSZ A;  1SV0 A;  2D3D A;  4IRC A;  4Q43 A;  3Q8S B;  4ELT A;  5ALR A;  5CR0 A;  1J97 A;  3JPO A;  4YQW A;  2OCE A;  5JUM A;  4JV1 A;  1SZP A;  1RQN A;  1ARO P;  4DL6 A;  1D8Y A;  4I2H A;  2WF6 A;  5F9L A;  2JEI A;  2AH5 A;  1UQV A;  2JHD A;  7ICP A;  3OHB A;  5CB1 A;  3MGI A;  1BGX T;  2KK0 A;  5AM2 A;  3QEA Z;  4DQS A;  1IG6 A;  4LZD A;  2OEH A;  2M9N A;  3UXP A;  3C28 A;  2O6K A;  2H3F A;  5J2G A;  3N28 A;  3SQI A;  2HOQ A;  4TUR A;  1Z4N A;  9ICS A;  4BX9 C;  3T3F A;  2XI9 A;  7ICG A;  3CW2 C;  4OJP A;  5ALY A;  4PHP A;  1T94 A;  1X42 A;  3BS7 A;  4LJX A;  3M9O B;  4KLO A;  5EE1 A;  1FFV A;  1ZQI A;  2RHF A;  5DLF A;  2BHN A;  2JEF A;  3PZP A;  2IA6 A;  2E1F A;  1RDF A;  3KHL A;  4J9P A;  3PSI A;  3PX6 A;  2EAN A;  4TQR A;  3MR2 A;  3UQ2 A;  4YFK A;  2D8C A;  3BQT A;  4RPZ A;  2G5I B;  1SKS A;  2ZUD A;  3PX4 A;  1ZQT A;  2UVU A;  9ICF A;  1D8B A;  2R8J A;  5AKZ A;  4UB2 A;  2DGZ A;  2NRX A;  3PSP A;  4A8E A;  2HOF A;  3IP4 B;  1NK8 A;  3BQ7 A;  2NV3 A;  5JU5 A;  2YN4 A;  4M0A A;  1S0N A;  2FLL A;  2IOF A;  3FAH A;  1J2N A;  4B6J A;  1CI4 A;  1RG6 A;  5KG4 A;  4ICA A;  3VC8 A;  1COO A;  4PJ0 U;  1U48 A;  3AUO A;  2ALZ A;  2WTF A;  2DKZ A;  1NZP A;  2DWQ A;  9ICG A;  4BWM A;  3KKA A;  2KFN A;  5IIM A;  2BQU A;  2K89 A;  1PK3 A;  2Y1I A;  1QQ7 A;  4ECV A;  3M1Y A;  5DB8 A;  4R66 A;  1LKY B;  4YD2 A;  1HEK A;  3PVX A;  1PK1 A;  2Y9T A;  4KTQ A;  4FZM A;  3ETL A;  5ALE A;  1A76 A;  1Z00 A;  2J6S A;  5DDY A;  4UBC A;  1XSL A;  2ZIX A;  1ZQA A;  2I9G A;  2LKY A;  3PST A;  4YP3 A;  5J2K A;  3QZ8 A;  2I6X A;  2EQY A;  5CEH A;  5BOL A;  1WCL A;  4DSJ A;  4PGY A;  5KAI U;  4Y2Y A;  1T7P A;  3F2B A;  3UPQ A;  3ETR A;  1BPX A;  4RQ7 A;  2PXI A;  4BXO B;  1MSW D;  4DS4 A;  2KE7 A;  1ZQQ A;  1ZD2 P;  4YMN A;  3IG5 A;  2FJ6 A;  1ZQV A;  4BDP A;  4CDG A;  2YTU A;  3KZX A;  3OHA A;  3AQE A;  4RUA A;  1SWW A;  2F8L A;  3CNH A;  1BNP A;  1JI7 A;  3M8S A;  4X5V A;  3TAC B;  5KFU A;  1SL0 A;  4F4Y A;  3PW7 A;  2YY6 A;  3V6J A;  3WK4 A;  1NJZ A;  1JUD A;  4B9S A;  2GOL A;  4J9K A;  3M8R A;  3RAQ A;  4FS1 A;  1VLB A;  4XRH A;  1P7D A;  5DQI A;  2ZIV A; 
#chains in the Genus database with same CATH homology
 5JRT A;  1RG6 A;  4NL9 A;  1SV0 A;  2D3D A;  2EAM A;  2K60 A;  5J8Y C;  2DKZ A;  3KKA A;  2B6G A;  3HIL A;  1COK A;  1PK3 A;  5L1M A;  1SGG A;  1UQV A;  2QB0 B;  1F0M A;  1PK1 B;  4NL9 C;  2KG5 A;  1X40 A;  2GLE A;  4MHV A;  2QKQ A;  2DL0 A;  3BS5 A;  2E8O A;  1LKY B;  2QAR B;  2F3N A;  2QB0 A;  2EAP A;  1PK1 A;  1SXD A;  2Y9T A;  3IDW A;  2Y9U A;  2K4P A;  2KSO B;  1LKY A;  4PZN A;  1OW5 A;  5F3X B;  1B4F A;  3BS7 A;  2EAO A;  2E8N A;  1SV0 C;  2F8K A;  3TAD A;  2LPE A;  4NJ8 A;  1V38 A;  3K1R B;  3H8M A;  1WWV A;  1V85 A;  5JTI A;  2KSO A;  1X66 A;  2JV3 A;  5J8Y A;  2F44 A;  3KKA C;  2EAN A;  4RQM A;  2FE9 A;  2KMD A;  1B0X A;  1WWU A;  2D8C A;  4RQN A;  2KE7 A;  2ESE A;  2QB1 A;  1X9X A;  1OXJ A;  2LMR A;  2KIV A;  4PZO A;  2QAR A;  2YTU A;  1DXS A;  2DKX A;  1JI7 A;  2E8M A;  3SEN A;  3TAC B;  1KW4 A;  2L5Y A;  1Z1V A;  3BS5 B;  3BQ7 A;  2ES6 A;  2E8P A;  5JU5 A;  5KNI A;  4IS7 A;  1SXE A;  3SEI A;  1SV4 A;  3TAD C;  1UCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...