3SEIA

Crystal structure of caskin1 tandem sams
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
TREGKSSEAVSQWLTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELRRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tandem SAM domain structure of human Caskin1: a presynaptic, self-assembling scaffold for CASK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Caskin-1
total genus 50
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3seiA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3seiA01
5F3XB 2YTUA 2EANA 4RQMA 2KIVA 5J8YA 5J8YC 2QKQA 1LKYB 1X66A 2E8NA 2L5YA 3SENA 1WWVA 1UQVA 2QB0A 1V38A 4PZOA 5JU5A 1X9XA 1WWUA 1PK1B 3TADA 3TADC 1F0MA 2KSOA 1SGGA 4PZNA 1SV0A 1SV0C 3K1RB 5L1MA 2Y9TA 5JRTA 1COKA 1OXJA 2F8KA 4NJ8A 1B0XA 2KSOB 2JV3A 1V85A 1KW4A 2DKZA 2FE9A 2EAOA 2ES6A 2QB1A 2E8OA 2QB0B 2D8CA 2D3DA 3TACB 4RQNA 1LKYA 2F44A 2Y9UA 4MHVA 1B4FA 1JI7A 2K60A 2DL0A 3HILA 2LMRA 2K4PA 5JTIA 1SV4A 3H8MA 3KKAC 1Z1VA 3KKAA 2DKXA 3BQ7A 1SXEA 1DXSA 2EAPA 1RG6A 2GLEA 1PK1A 2QARB 3BS5B 2E8MA 2KG5A 4NL9C 4NL9A 2KMDA 3BS5A 2QARA 2F3NA 2EAMA 2E8PA 1OW5A 2B6GA 1PK3A 5KNIA 1UCVA 3SEIA 1SXDA 2LPEA 2KE7A 3BS7A 2ESEA 1X40A 4IS7A 3IDWA
chains in the Genus database with same CATH superfamily
7ICKA 2M0NA 5J0UA 8ICLA 2AU0A 2EANA 3D6JA 1DK2A 1ZQOA 2P6UA 3G6VA 4IQUA 4ZH4A 1ZQVA 3C2LA 4I2DA 5AKGA 3UM9A 3MR2A 1U45A 5AKKA 9ICJA 1KEJA 2W3RA 4XUSA 4UAWA 4IR9A 4M0AA 4NY8A 2F1JA 4DQRA 4KTQA 8ICCA 3NVWA 2B0CA 4NLBA 3ZDDA 1S8OA 1SIJA 3C5FA 1N48A 5AI5A 4ECSA 4O3RA 2Y0SC 5HHHA 3QZ7A 4F5NA 5KFFA 2D3DA 4DOCA 3LDAA 4KLGA 2HHWA 4RQNA 4C7ZA 5L1KA 3WK5A 9ICOA 2Q0ZX 4F93B 2HVIA 2VJ4A 2BQUA 4M6WA 2CRXA 4F71A 4UB3A 2KTQA 5BOLA 3SV4A 4M9NA 2Z7JA 2RDIA 2H3ZA 1A0PA 4C0ZA 5IIOA 9ICPA 3PSIA 2JR5A 4IQTA 4RPZA 1PK1A 4FZNA 3IP4B 5FP0A 1BNOA 3AMZA 3MDAA 2JGAA 4C8NA 1BPBA 2KVCA 2GOLA 1S76D 2CXYA 4F2RA 4UAZA 3THVA 5ALSA 5KFHA 1TE2A 4DF4A 4Q8FA 3IG5A 1CUKA 3RJHA 1IV8A 4KLUA 2F1HA 5IINA 5EE3A 4IS7A 5AKXA 2ZIWB 3M7DA 5CEHA 2DPJA 1KFSA 4F5QA 3N97B 2BCSA 4G9BA 1KLNA 3FYHA 5AICA 4FBUA 2UVUA 3E2EA 1J2MA 1VJ5A 3BZCA 3N7SC 4I2FA 3QUTA 4J9SA 2BPCA 4PZOA 1ZQGA 2HHXA 3QX7A 1C20A 3NTUA 4Q44A 3QU5A 3QU4A 3K1RB 5L1MA 3GILA 1BPDA 3QEAZ 2XVTA 1N62A 2W9CA 3EUB2 4J9NA 4C8OA 2EZYA 4TUQA 2PI4A 2K8BB 1V97A 4F8RA 2W55A 4UBBA 3QNMA 4PH5A 5J2JA 3RH4A 2HW3A 3IM1A 4O3MA 4RPXA 4UAYA 1SKRA 1ZQAA 4R63A 9ICKA 2J6SA 1TK8A 3C2MA 2N1RA 2HBMA 1L3UA 4EX7A 4IL6U 5L1IA 4ED8A 2B21A 4Q8EA 5G5GA 4QZIA 1NK7A 8ICAA 1K1QA 3HRDD 1P7DA 2MUTA 2A3VA 4E0DA 1JMSA 2F3NA 2E8PA 4B9UA 4Y2UA 2BGWA 2HHSA 3PZPA 4NLKA 8ICTA 1TVAA 3A0BU 3BQ1A 3N7PD 1YZ6A 3BS7A 1QQ7A 4RQ0A 4ZOHC 3S6JA 5EWGA 5AM1A 2W9BB 2JZBB 3OHBA 4ED3A 2W03A 4YG2A 2IOFK 3RRHA 2HSZA 4M04A 2KIVA 3IG8A 3GU3A 3KZIU 4RQ5A 5ALUA 3RF9A 1X9WA 4DSJA 9ICFA 4Y2RA 3PMLA 1WUDA 7ICFA 4UW9A 5HHIA 4XRHA 2QB0A 3HKZC 1ZQWA 5HNKA 4F50A 4YQWA 4NM1A 1LV5A 4UARA 3M9NB 3HJEA 1WWUA 2KZMA 3FDSA 8ICJA 4BX9C 3QE9Y 3I1YA 1NJXA 4ICAA 4NJ8A 2G08A 5KFXA 3QU2A 2ES6A 5HMMA 4TURA 2W7OA 5KFNA 3NVYA 1DGSA 3WU2U 7ICPA 3TQ1A 5F9NA 4IR1A 1QSLA 1BGXT 2AXTU 4AYBF 8ICBA 4ED1A 5AKLA 3JPPA 2K4PA 7ICVA 3LVWA 1SV4A 1NK5A 7ICMA 5ALQA 1KQQA 2XY5A 2BPGA 5J0QA 4ED6A 8ICSA 1D8BA 4FS1A 3LWMA 4EYHB 4NL9A 3B9JA 4PGYA 4UATA 4OD0A 4YXMA 2W54A 4Y2QA 2W11A 2KFZA 3BS5A 5J2HA 4EENA 4DFKA 3IRUA 5L1JA 7ICIA 1XS9D 4CCHA 4I2EA 3QUQA 4C8LA 2W9AA 3GDXA 2BCUA 9ICEA 1SXDA 1D8LA 1T94A 4Y2TA 2HVHA 4F4KA 4ECXA 1KFTA 1XSPA 5KTQA 3KTQA 2JH1A 3K75D 3HT3A 3RR7A 3F5AA 1RDFA 2ZTCA 2W7PA 4DFJA 1HEKA 3MC1A 3SAFA 4I28A 1V38A 3C1ZA 7ICGA 4FS2A 3Q8SB 4RQ4A 1X9XA 2WF5A 2G0AA 4ECTA 1SL1A 4QZBA 3QYPA 3FC4A 2IOHA 1OXJA 1K1SA 2K8AA 3PSFA 5CWRA 4B9TA 4KX3A 1LVHA 3AM9A 4KMUA 3RFAA 2KJ9A 2HHVA 2FLNA 4RQ6A 1N61A 4NLGA 3KD3A 9ICGA 5AIBA 1WCLA 1ZQMA 1ZD5A 4DQQA 4YR3A 4DSEA 4QWCA 4K4HA 4Y2JA 1PZNA 4FE3A 3MGVA 2IHNA 4NLZA 3H4BA 4PHAA 2YX8A 1KRPA 5AM5A 1NK8A 2E8MA 3WKBA 2JRZA 2JEFA 1JX4A 5AI0A 5ALVA 2E1EA 1ZYQA 2LI6A 3AN1A 4AP9A 1BPXA 1RYRA 2KK0A 2ALZA 4ELVA 4I2AA 4O5KA 3BQTA 4B9SA 4YCXA 9ICCA 2DFLA 2ESEA 1ZD3A 2XI9A 2DUYA 1MN8A 3C23A 5F3XB 2PI5A 4RQMA 2DBYA 2MUTB 4RQ7A 3RH6A 1XO1A 3M9MB 3I28A 1FFUA 4YMNA 4NLNA 4O9MA 3AU6A 4QZEA 1RYUA 9ICMA 2PFOA 2GWSA 2KP7A 2Q4TA 3HX0A 3RB0A 1NJWA 3PR4A 3NUQA 2F76X 8ICNA 4KMOB 2RHFA 3B0YA 1JXEA 3MR5A 1X2IA 1V85A 1TK5A 1D9FA 4UB4A 1ZQTA 2GO7A 2NO5A 2NO4A 2W3SA 3ISCA 4F2SA 5AM4A 1KBUA 9ICQA 3SMVA 4ED7A 5ALEA 4QZAA 1RM6C 3NRWA 4HYKA 1AQ6A 1JRPA 1Z1BA 4DL5A 2DKXA 2WB1C 3KZXA 1NZBA 1TK0A 2EAPA 2VKQA 3RBDA 1URJA 3KHGA 4YVZA 3RJEA 2WF8A 9ICVA 3DEEA 3UPQA 3K4GA 3Q8KA 3SAHA 8ICZA 3H8SA 4JMUA 1S97A 4X5VA 2WHEA 9ICIA 4M9GA 2HMXA 2JH7A 4P4PA 2RDJA 5ALMA 3UXNA 5J2IA 1D8YA 1H38A 7ICJA 5J2FA 1HJPA 3Q8PB 1KDHA 1RQNA 5J2BA 1NOMA 1QTMA 8ICXA 5KT2A 2G5IB 5L1LA 3ZD8A 3C2KA 2A1JB 1A6SA 1UQVA 1D9DA 1S0MA 3RTVA 1L3TA 8ICWA 3MBYA 2ZIXB 1PK1B 3G6YA 4RU9A 4Z6CA 4CNQA 2KJ8A 5KFUA 1BPEA 1N5WA 4QZ8A 3KHRA 5KG5A 4P0QA 1KW4A 3TANA 2DKZA 2FE9A 2LYAA 2BR0A 2KKPA 2XO7A 2ZJ8A 3NVZA 5CP2A 5H2FU 2HHTA 2ZTDA 3H0MB 4YMOA 3EPGA 5DDYA 3E0FA 4Z6FA 2W9BA 3ZI4A 2BHNA 3KFUF 1N5XA 3QU7A 3HW8A 1QQ5A 5HR7A 8ICFA 4CDGA 5CJ7A 1L7OA 4DLGA 4PJ0U 4ECVA 3KKAA 2AHOB 3GQCA 1ZQJA 7ICLA 3ISDA 5J0PA 3MDCA 3OJSA 2KVSA 4YMMA 8ICKA 3QUBA 4YR2A 3ISBA 1KFDA 3F2DA 4B9MA 5DQGA 5J0SA 3PW0A 3PW7A 1TKDA 5DG7A 2V9WA 1FO4A 2QARA 2PFPA 2LM1A 2VJ5A 2ZIVA 4OO1J 1XNSA 2XC9A 5ALNA 4MEXA 4EZ6A 5J2EA 2C2RA 3PMNA 4ECUA 4Q43A 1NKBA 1O08A 1ZQHA 4QWEA 2ASLA 2P35A 2PMZF 4DEZA 4LZDA 2QKQA 1KTQA 1LB2B 2NYVA 1LKYB 2EDUA 2L5YA 3SENA 4UB5A 3MR3A 1WWVA 4CE6A 4KLSA 2R8JA 4IRCA 3BQ0A 1JN3A 4RZRA 4KLTA 2WB1F 3TADA 4YD2A 4NXZA 4P4MA 5EWEA 1SZHA 3GIMA 5ALKA 3HPOA 1DOQA 1BNPA 3BDPA 5DB6A 2HDOA 5DB7A 9ICNA 5J2CA 1T3NA 3MR6A 4GLXA 5ALPA 1HUOA 4FBTA 3H40A 4I2IA 1N56A 4JV0A 2JEJA 5KT5A 4J9RA 2BKEA 2ODGA 4M9JA 5T14A 1RPLA 2DL0A 5AKHA 1WYGA 2E3TA 3T3FA 4RT2A 2MU2A 1ZRMA 5KFCA 4JWNA 4I2JA 2ZXIA 4Y2PA 4F4YA 1L7MA 1ZQEA 1Q3VA 3WKDA 4UASA 1MQ3A 3CNHA 5AKZA 5BOMA 4C7YA 1XO0A 2FPKA 4F3OA 1ZQUA 5J0RA 2XY6A 5AK5A 4LJXA 1NK9A 4XQ8A 1PVPA 1QSSA 4KX5A 2ZG6A 5ALZA 5AI8A 5KFQA 1ZQZA 3C5GA 4ELUA 2NRXA 5CA7A 2XGPA 5B66U 5KFAA 3MFIA 3H7IA 2LPEA 4RUCA 4F72A 4F5RA 2UVRA 2W8KA 3RJJA 5DG8A 4MEYA 5J8YA 1CEZA 2KEYA 3TAPA 4IC9A 3MGIA 1X9SA 1RXWA 1X6IA 1CI4A 3TADC 4DF8A 3L5KA 2WF6A 4OJLA 1SV0A 2FJ6A 1PVQA 1JALA 5J29A 4ECYA 5KL8B 4DL6A 1IG6A 1PUZA 9ICSA 2HBJA 2OHFA 5DG9A 4M47A 3OHAA 2R8GA 2DF4B 1TAMA 5KT7A 4C4SA 4QZDA 5AI6A 4J9PA 3AEVA 5ALYA 4EEYA 1KL9A 2Y9UA 4JB3A 2EZZA 1U49A 5AM3A 4KITB 1S9FA 3TFRA 2CPRA 1T3QA 1NK0A 3HILA 2RLTA 3UMCA 5J2AA 5J0WA 3PO4A 5K4LA 5KG7A 4QJFB 4F4WA 4P0QB 2W8LA 2AQ4A 1A77A 3PX0A 3TARA 5A0LA 3V6KA 2NV3A 5KFPA 1S5LU 4I2CA 2F1IA 3PNCA 1UT5A 3D2QA 1N2XA 4DSKA 3PR5B 4RQ3A 4NV0A 2FDRA 2BCVA 3EWAA 5JUMA 1ZQBA 2LM4A 3UXOA 1MSWD 8ICOA 3KHLA 4QZ9A 2FMQA 1CRXA 2NRVA 2BQ3A 5AKYA 5AK3A 2WTFA 1ZQIA 1FEZA 4DL7A 1U47A 5ALLA 5KFMA 4BJQA 2EZXA 1ZQDA 3RJGA 4YP3A 2OCEA 3PW2A 5EE0A 3HP6A 4P4OA 3SZ2A 3AL0B 4TQRA 3JPOA 1XSNA 4B9NA 4Z6EA 1L3VA 5J8YC 5IILA 2ZJ5A 2PMZC 4IQWA 1UA0A 4OJPA 2XCAA 1L8OA 4KLMA 2E8NA 4AYBC 4BUGA 2KV2A 2FLPA 4ECRA 1BPYA 5GTIU 2F2AB 1WCNA 3IHQB 3GV5B 4UB2A 2BDPA 4U7CA 4KLLA 1C7YA 5JU5A 4QW9A 3IN5A 4F5PA 2EQYA 3HWTA 1O03A 2NRTA 3J81j 3WK9A 3ZDCA 2OH2A 3WK8A 4UB6U 3V72A 2FLLA 1F44A 4G3IA 3RR8A 1U4BA 2VA3A 4KN7A 4UAUA 4UB8U 4KLEA 2QB1A 2HHUA 3H8WA 2D8CA 1JUDA 1ED1A 3MABA 3V6HA 2W43A 1Z4OA 5J2DA 3Q8LA 1ZQNA 5KG0A 1UT8A 2AQ0A 8ICRA 2KKVA 7ICUA 2G5HB 4QIWC 3OTQA 5ALFA 5ALWA 3TKAA 4QWDA 4EBEA 2G09A 1RZTA 4EBCA 3BQ7A 1Z4NA 2ISPA 4O3OA 1T7PA 4KLDA 4CF4A 3ONNA 4C80A 2KG5A 3PX4A 5D49A 1FIQA 1DK3A 5EOZA 4EX6A 2YY6A 7ICHA 3ORYA 2BQRA 2EAMA 4TUPA 4NLCA 3ZDEA 2DGZA 1ZRNA 5KFJA 1OW5A 5AK6A 2ZIWA 1UHUA 2FPMA 1TAQA 5KFGA 8ICMA 3F2CA 5KFZA 2WAQC 3RAXA 2ZIVB 1A76A 4CGZA 1X66A 4BDPA 9ICBA 1L5UA 1S0OA 3T5LA 3BQ2A 2WF9A 5EE9A 2H3QA 4EBDA 1NK6A 4MFCA 7ICOA 2AJQA 3CW2C 1T8EA 3ZDBA 2LKYA 2ZUCA 1TAUA 3CP8A 4BXOA 2KSOA 1ZQQA 4RNOA 1JIHA 4PZNA 5CB1A 3Q8QB 2H3FA 2FMPA 2KJ5A 3JPTA 3C29A 2F8LA 2NRWA 1B43A 2H3IA 4CF3A 1UA1A 5CRXA 4U6PA 1XWLA 5CR0A 4C8KA 4IQVA 1XC9A 1EXNA 1L7PA 5KFLA 1DGJA 4F91B 1SKSA 1ZQCA 1LKYA 5KFTA 5DBCA 2F44A 3U26A 2MAXA 4DQIA 3H8JA 3N7RC 4GXIA 1TFRA 3NASA 1NJZA 2G07A 1S0VA 3F5EA 5ALGA 2HBLA 5GTHU 4J9KA 3LK9A 4DOAA 7ICRA 4FZLA 4EEKA 1Q3UA 4NWIA 3HKZF 5ALJA 3ETLA 3JPSA 2DQNB 4US8A 2XIDA 4OJOA 5J0TA 3M1YA 3Q8MA 5KFVA 1K5OA 5AM2A 1KSPA 3GV8B 2WF7A 4J9LA 1B22A 4ECWA 4QZCA 3QEBZ 2AGOA 4DS4A 3GZFA 2E5SA 3TAQA 5DBAA 5KFEA 3FAHA 5L9XA 3QUCA 2KN7A 4R66A 7ICQA 4DWIA 4UBCA 2O6KA 3N28A 4JK1A 5AIAA 3RAQA 5J2GA 4B9LA 2KFNA 2C2EA 2HCFA 1XU4A 5DGBA 3O0FA 4R8UB 4QW8A 1S77D 4RQ1A 2KHQA 4MFFA 1QLNA 4RQ8A 3WK4A 2Y9TA 5DBBA 3AQEA 3RJFA 2JV3A 5DB8A 4BXOB 3LVVA 1QH9A 3WK6A 3T5KA 1T4GA 2BPFA 4ED0A 4I29A 1UPHA 4QWAA 2QB0B 3EPIA 2IBKA 1M6YA 3QU9A 2C2DA 2UVWA 9ICXA 4J9MA 2ZTEA 3MGHA 2V4QA 3ED5A 4QWBA 4YN4A 4QIWF 3UMBA 9ICTA 2YQEA 2IMWP 2W04A 5KFRA 1Z1VA 2KD1A 3F2BA 1DXSA 1X42A 4C8MA 4P0PA 3Q8RB 1N60A 2XICA 4O5CA 2OXOA 4F92B 5KT3A 3UQ0A 2P66A 2Y1IA 5TZVA 3VCBA 3V7KA 5KAFU 1ZETA 1QCKA 3NVVA 3PO5A 5J0OA 1NK4A 1MA7A 4PGQA 2A19A 3A0HU 4RT3A 3PSPA 2JHDA 3M8RA 1UCVA 2ASDA 5ALIA 3SEIA 7ICEA 2KE7A 1U48A 1Z00A 4PGXA 4PL1A 2YMQA 3H0RB 2OM6A 4B9VA 3SR6A 5KL1B 2ISOA 2NRZA 4DSLA 3C21A 2OEHA 3V7LA 3SAGA 5KG1A 1JXLA 2BCRA 5DGAA 2IOFA 1Y88A 2LYBA 4MFAA 1VDVA 4KLHA 5ALTA 2MRLA 1QSYA 3ETRA 2RQ5A 2PKEA 1SL0A 2KOBA 1J97A 3NS1A 2JXJA 3PVXA 3MFHA 3GIJA 1S10A 4ACOA 4PHDA 8ICYA 1Q8KA 1NKEA 2M9NA 2EAOA 4M6WB 4PPXA 1ZOLA 3PX6A 4FFDA 2LHTA 4R65A 3TACB 2ATLA 2WFAA 3EYZA 3RRGA 2PFNA 4GC7A 1SKWA 3RJIA 3KHHA 3SYZA 1BPZA 5AHXA 2AH5A 1L6NA 4B6JA 3ALRA 1L3SA 1IXRA 4K4GA 5IIIA 3GIIA 4HAIA 4C4RA 2GH1A 4CRXA 1IM4A 5TISU 2W9CB 8ICPA 1YZ7A 4XA5A 1WG8A 3JPQA 4DLEA 4WJ3B 3LWLA 2QARB 1TV9A 2AGQA 5KT4A 4M9HA 2YB4A 4I2BA 5EWFA 4NL9C 3BJYA 3TI0A 2C28A 2IHMA 3D2NA 3PW4A 4DO9A 4PHPA 3LYSA 5IIKA 3KBBA 2JZBA 4US9A 4IRKA 2Y0SF 2KICA 3DV9A 1Z00B 4DOBA 1HUZA 1ZQFA 9ICHA 2RP5A 2BCQA 3ZDAA 5AI4A 4R64A 3IDWA 2YTUA 1ZQKA 2R8KA 4JV2A 3OSPA 4EELA 5DB9A 5EE1A 2R8IA 2ZUBA 3AU2A 2KHVA 4BWJA 5HP4A 5KFSA 3OPXA 1SB3C 4A8EA 1B0XA 3GV7B 2RRDA 2HOIA 3L4PA 2DWQA 1V9PA 3K1ZA 2WAQF 2VA8A 3PV8A 1RYSA 5G5HA 4DSFA 2E8OA 4RPYA 4J9OA 3SD7A 7ICTA 4UB1A 2K60A 1QQ6A 2K8CB 5KFYA 4FZMA 5D46A 3H4DA 4OJ6A 1NJYA 2J6TA 3RH5A 3VC8A 4KLJA 4RNNA 3RJKA 3D2SA 4EZ9A 3M6ZA 3KKAC 4ECZA 3M6KA 2FMSA 3EZ5A 1X6JA 2Y1JA 4KLQA 5DKWA 2KIWA 4UQGA 4FO6A 1N63A 2W9MA 1SL2A 5DDMA 5DLFA 2D6FC 5KT6A 1XSLA 5KG2A 3PSTA 5KG3A 2G06A 4DFDA 5C0YA 3DDHA 3NGDA 2KZZA 4DL2A 2ZIUA 4ECQA 1PK3A 4YXJA 5KNIA 3RB4A 2QLTA 3R9KA 5AK4A 4YFKA 2I5HA 2FI1A 5KG6A 2C22A 1X40A 9ICUA 9ICRA 3T79A 1PVRA 5AKJA 1ECWA 5E79U 4O3PA 3NRZA 2VA2A 9ICLA 3T5HA 3JPRA 3JPNA 4ELTA 1SGGA 1SWWA 4UAVA 5JRTA 2F8KA 5J2KA 2K4HA 4Z6DA 4O3SA 3WKCA 2FPLA 5KFDA 2V4RA 5ALRA 4Y2YA 4M2YA 2XGQA 3RBEA 8ICVA 3V7JA 5C5JA 1VLBA 4MHVA 1B4FA 2JEGA 1ZJMA 4O3QA 5DQIA 2I1QA 5IIJA 3M9OB 2EH9A 4QZHA 1NI3A 3SI8A 3IV6A 1F5SA 2JEIA 4LVSA 1YT3A 4GIBA 1SWVA 2XCPA 3OJUA 4BGDA 1ZQYA 3E58A 3WKEA 3BS5B 1ZQSA 4F4ZA 1NKCA 1L7NA 2HOFA 2HBKA 2VANA 3N4MB 1AROP 4ED2A 3KOOA 1ZD4A 2ZUDA 2OWOA 3UMGA 4DQSA 4C4TA 1HIWA 4RQ2A 3C28A 4TQSA 1COOA 4GXJA 4F4XA 5J0XA 3EW9A 4O3NA 3ICXA 4IRDA 3ZD9A 5CHGA 4RUAA 5KG4A 3FM9A 8ICEA 1NNLA 2ZJAA 1MC8A 3I76A 1BVSA 2I6XA 1FFVA 3PW5A 5ALXA 2YMPA 1S0NA 3AUOA 1SV0C 3UXPA 2A1AA 9ICWA 1ZQLA 1ZQPA 4DFMA 1ZD2P 4Y2SA 2KSOB 4DCCA 3GIKA 4MF2A 4CF5A 3C1YA 2PXIA 4USAA 4K4IA 3G6XA 5J0YA 1JI7A 2KZ3A 4DFPA 2LBOA 2ASJA 4DS5A 2J6UA 2E1FA 4GC6A 4JUZA 4PHEA 4Y2XA 3RB3A 5JTIA 4JWMA 3OSNA 1Q46A 1RXVA 1NZPA 5HR6A 1MQ2A 3AQFA 5HMLA 1ZQXA 4NM2A 3T5JA 2UVVA 1RG6A 4F5OA 5KAIU 2GLEA 2CN1A 4R8UA 9ICAA 2ZIXA 2R18A 1JROA 4DSIA 5DQHA 3WKAA 2PFQA 5BPCA 4I2HA 1ZQ1C 5AKEA 2R8HA 1GO3F 2OYYA 3BZKA 2AGPA 3OGUA 4Q45A 4P0PB 2VIXA 1SZPA 7ICNA 2MA1A 5AKIA 4YD1A 2H5XA 4O5EA 4Y2VA 2HOQA 7ICSA 5IIMA 5F9LA 4KN4A 4PL2A 2BZFA 3L3FX 3QXGA 5KFBA 3WK7A 2HHQA 4OCZA 2YN4A 5KFOA 1KN5A 2JMGA 2BDUA 2ZIUB 8ICIA 3CYMA 5AM0A 1DRGA 2ZXHA 2YMLA 4O0IA 2K4IA 4MF8A 2K89A 3UQ2A 1L8LA 5ALDA 1F0MA 4QZFA 1OUQA 2P6RA 5AI9A 2K4EA 1ZQRA 4GXKA 2IA6A 5KFKA 2YMMA 3B0XA 1COKA 3TFSA 4QNLA 3QZ8A 4QZGA 1Z3EB 4EYIB 4BWMA 1J2NA 4I27A 2XY7A 4DL4A 4KLFA 2H3VA 4OJ5A 4DL3A 8ICHA 2LMRA 4DQPA 1RQLA 2I9GA 2MSNA 5D4BA 4TUSA 5ALOA 3H8MA 4GFJA 4LZGA 1SXEA 3PY8A 4JV1A 1U9LA 1IIPA 1ZXIA 4RNMA 4M9LA 3GFKB 8ICGA 4J9QA 3M8SA 8ICUA 4KLIA 5KFWA 4P2HA 1Z19A 3SQIA 3F53A 5B5EU 3CRXA 2A1JA 8ICQA 2KMDA 2HI0A 3H0LB 2LYHA 2F77X 5KFIA 2KNJA 1KKXA 1ZJNA 5ALHA 2B6GA 2YB1A 3V6JA 3SV3A 4KLOA 1X9MA 3RB6A 2DPIA 4J03A 4I2GA 4YR0A 5DLGA
chains in the Genus database with same CATH topology
5F3XB 2YTUA 2EANA 4RQMA 2KIVA 5J8YA 5J8YC 2QKQA 1LKYB 1X66A 2E8NA 2L5YA 3SENA 1WWVA 1UQVA 2QB0A 1V38A 4PZOA 5JU5A 1X9XA 1WWUA 1PK1B 3TADA 3TADC 1F0MA 2KSOA 1SGGA 4PZNA 1SV0A 1SV0C 3K1RB 5L1MA 2Y9TA 5JRTA 1COKA 1OXJA 2F8KA 4NJ8A 1B0XA 2KSOB 2JV3A 1V85A 1KW4A 2DKZA 2FE9A 2EAOA 2ES6A 2QB1A 2E8OA 2QB0B 2D8CA 2D3DA 3TACB 4RQNA 1LKYA 2F44A 2Y9UA 4MHVA 1B4FA 1JI7A 2K60A 2DL0A 3HILA 2LMRA 2K4PA 5JTIA 1SV4A 3H8MA 3KKAC 1Z1VA 3KKAA 2DKXA 3BQ7A 1SXEA 1DXSA 2EAPA 1RG6A 2GLEA 1PK1A 2QARB 3BS5B 2E8MA 2KG5A 4NL9C 4NL9A 2KMDA 3BS5A 2QARA 2F3NA 2EAMA 2E8PA 1OW5A 2B6GA 1PK3A 5KNIA 1UCVA 3SEIA 1SXDA 2LPEA 2KE7A 3BS7A 2ESEA 1X40A 4IS7A 3IDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F3X B;  2YTU A;  2EAN A;  4RQM A;  2KIV A;  5J8Y A;  5J8Y C;  2QKQ A;  1LKY B;  1X66 A;  2E8N A;  2L5Y A;  3SEN A;  1WWV A;  1UQV A;  2QB0 A;  1V38 A;  4PZO A;  5JU5 A;  1X9X A;  1WWU A;  1PK1 B;  3TAD A;  3TAD C;  1F0M A;  2KSO A;  1SGG A;  4PZN A;  1SV0 A;  1SV0 C;  3K1R B;  5L1M A;  2Y9T A;  5JRT A;  1COK A;  1OXJ A;  2F8K A;  4NJ8 A;  1B0X A;  2KSO B;  2JV3 A;  1V85 A;  1KW4 A;  2DKZ A;  2FE9 A;  2EAO A;  2ES6 A;  2QB1 A;  2E8O A;  2QB0 B;  2D8C A;  2D3D A;  3TAC B;  4RQN A;  1LKY A;  2F44 A;  2Y9U A;  4MHV A;  1B4F A;  1JI7 A;  2K60 A;  2DL0 A;  3HIL A;  2LMR A;  2K4P A;  5JTI A;  1SV4 A;  3H8M A;  3KKA C;  1Z1V A;  3KKA A;  2DKX A;  3BQ7 A;  1SXE A;  1DXS A;  2EAP A;  1RG6 A;  2GLE A;  1PK1 A;  2QAR B;  3BS5 B;  2E8M A;  2KG5 A;  4NL9 C;  4NL9 A;  2KMD A;  3BS5 A;  2QAR A;  2F3N A;  2EAM A;  2E8P A;  1OW5 A;  2B6G A;  1PK3 A;  5KNI A;  1UCV A;  3SEI A;  1SXD A;  2LPE A;  2KE7 A;  3BS7 A;  2ESE A;  1X40 A;  4IS7 A;  3IDW A; 
#chains in the Genus database with same CATH topology
 7ICK A;  2M0N A;  5J0U A;  8ICL A;  2AU0 A;  2EAN A;  3D6J A;  1DK2 A;  1ZQO A;  2P6U A;  3G6V A;  4IQU A;  4ZH4 A;  1ZQV A;  3C2L A;  4I2D A;  5AKG A;  3UM9 A;  3MR2 A;  1U45 A;  5AKK A;  9ICJ A;  1KEJ A;  2W3R A;  4XUS A;  4UAW A;  4IR9 A;  4M0A A;  4NY8 A;  2F1J A;  4DQR A;  4KTQ A;  8ICC A;  3NVW A;  2B0C A;  4NLB A;  3ZDD A;  1S8O A;  1SIJ A;  3C5F A;  1N48 A;  5AI5 A;  4ECS A;  4O3R A;  2Y0S C;  5HHH A;  3QZ7 A;  4F5N A;  5KFF A;  2D3D A;  4DOC A;  3LDA A;  4KLG A;  2HHW A;  4RQN A;  4C7Z A;  5L1K A;  3WK5 A;  9ICO A;  2Q0Z X;  4F93 B;  2HVI A;  2VJ4 A;  2BQU A;  4M6W A;  2CRX A;  4F71 A;  4UB3 A;  2KTQ A;  5BOL A;  3SV4 A;  4M9N A;  2Z7J A;  2RDI A;  2H3Z A;  1A0P A;  4C0Z A;  5IIO A;  9ICP A;  3PSI A;  2JR5 A;  4IQT A;  4RPZ A;  1PK1 A;  4FZN A;  3IP4 B;  5FP0 A;  1BNO A;  3AMZ A;  3MDA A;  2JGA A;  4C8N A;  1BPB A;  2KVC A;  2GOL A;  1S76 D;  2CXY A;  4F2R A;  4UAZ A;  3THV A;  5ALS A;  5KFH A;  1TE2 A;  4DF4 A;  4Q8F A;  3IG5 A;  1CUK A;  3RJH A;  1IV8 A;  4KLU A;  2F1H A;  5IIN A;  5EE3 A;  4IS7 A;  5AKX A;  2ZIW B;  3M7D A;  5CEH A;  2DPJ A;  1KFS A;  4F5Q A;  3N97 B;  2BCS A;  4G9B A;  1KLN A;  3FYH A;  5AIC A;  4FBU A;  2UVU A;  3E2E A;  1J2M A;  1VJ5 A;  3BZC A;  3N7S C;  4I2F A;  3QUT A;  4J9S A;  2BPC A;  4PZO A;  1ZQG A;  2HHX A;  3QX7 A;  1C20 A;  3NTU A;  4Q44 A;  3QU5 A;  3QU4 A;  3K1R B;  5L1M A;  3GIL A;  1BPD A;  3QEA Z;  2XVT A;  1N62 A;  2W9C A;  3EUB 2;  4J9N A;  4C8O A;  2EZY A;  4TUQ A;  2PI4 A;  2K8B B;  1V97 A;  4F8R A;  2W55 A;  4UBB A;  3QNM A;  4PH5 A;  5J2J A;  3RH4 A;  2HW3 A;  3IM1 A;  4O3M A;  4RPX A;  4UAY A;  1SKR A;  1ZQA A;  4R63 A;  9ICK A;  2J6S A;  1TK8 A;  3C2M A;  2N1R A;  2HBM A;  1L3U A;  4EX7 A;  4IL6 U;  5L1I A;  4ED8 A;  2B21 A;  4Q8E A;  5G5G A;  4QZI A;  1NK7 A;  8ICA A;  1K1Q A;  3HRD D;  1P7D A;  2MUT A;  2A3V A;  4E0D A;  1JMS A;  2F3N A;  2E8P A;  4B9U A;  4Y2U A;  2BGW A;  2HHS A;  3PZP A;  4NLK A;  8ICT A;  1TVA A;  3A0B U;  3BQ1 A;  3N7P D;  1YZ6 A;  3BS7 A;  1QQ7 A;  4RQ0 A;  4ZOH C;  3S6J A;  5EWG A;  5AM1 A;  2W9B B;  2JZB B;  3OHB A;  4ED3 A;  2W03 A;  4YG2 A;  2IOF K;  3RRH A;  2HSZ A;  4M04 A;  2KIV A;  3IG8 A;  3GU3 A;  3KZI U;  4RQ5 A;  5ALU A;  3RF9 A;  1X9W A;  4DSJ A;  9ICF A;  4Y2R A;  3PML A;  1WUD A;  7ICF A;  4UW9 A;  5HHI A;  4XRH A;  2QB0 A;  3HKZ C;  1ZQW A;  5HNK A;  4F50 A;  4YQW A;  4NM1 A;  1LV5 A;  4UAR A;  3M9N B;  3HJE A;  1WWU A;  2KZM A;  3FDS A;  8ICJ A;  4BX9 C;  3QE9 Y;  3I1Y A;  1NJX A;  4ICA A;  4NJ8 A;  2G08 A;  5KFX A;  3QU2 A;  2ES6 A;  5HMM A;  4TUR A;  2W7O A;  5KFN A;  3NVY A;  1DGS A;  3WU2 U;  7ICP A;  3TQ1 A;  5F9N A;  4IR1 A;  1QSL A;  1BGX T;  2AXT U;  4AYB F;  8ICB A;  4ED1 A;  5AKL A;  3JPP A;  2K4P A;  7ICV A;  3LVW A;  1SV4 A;  1NK5 A;  7ICM A;  5ALQ A;  1KQQ A;  2XY5 A;  2BPG A;  5J0Q A;  4ED6 A;  8ICS A;  1D8B A;  4FS1 A;  3LWM A;  4EYH B;  4NL9 A;  3B9J A;  4PGY A;  4UAT A;  4OD0 A;  4YXM A;  2W54 A;  4Y2Q A;  2W11 A;  2KFZ A;  3BS5 A;  5J2H A;  4EEN A;  4DFK A;  3IRU A;  5L1J A;  7ICI A;  1XS9 D;  4CCH A;  4I2E A;  3QUQ A;  4C8L A;  2W9A A;  3GDX A;  2BCU A;  9ICE A;  1SXD A;  1D8L A;  1T94 A;  4Y2T A;  2HVH A;  4F4K A;  4ECX A;  1KFT A;  1XSP A;  5KTQ A;  3KTQ A;  2JH1 A;  3K75 D;  3HT3 A;  3RR7 A;  3F5A A;  1RDF A;  2ZTC A;  2W7P A;  4DFJ A;  1HEK A;  3MC1 A;  3SAF A;  4I28 A;  1V38 A;  3C1Z A;  7ICG A;  4FS2 A;  3Q8S B;  4RQ4 A;  1X9X A;  2WF5 A;  2G0A A;  4ECT A;  1SL1 A;  4QZB A;  3QYP A;  3FC4 A;  2IOH A;  1OXJ A;  1K1S A;  2K8A A;  3PSF A;  5CWR A;  4B9T A;  4KX3 A;  1LVH A;  3AM9 A;  4KMU A;  3RFA A;  2KJ9 A;  2HHV A;  2FLN A;  4RQ6 A;  1N61 A;  4NLG A;  3KD3 A;  9ICG A;  5AIB A;  1WCL A;  1ZQM A;  1ZD5 A;  4DQQ A;  4YR3 A;  4DSE A;  4QWC A;  4K4H A;  4Y2J A;  1PZN A;  4FE3 A;  3MGV A;  2IHN A;  4NLZ A;  3H4B A;  4PHA A;  2YX8 A;  1KRP A;  5AM5 A;  1NK8 A;  2E8M A;  3WKB A;  2JRZ A;  2JEF A;  1JX4 A;  5AI0 A;  5ALV A;  2E1E A;  1ZYQ A;  2LI6 A;  3AN1 A;  4AP9 A;  1BPX A;  1RYR A;  2KK0 A;  2ALZ A;  4ELV A;  4I2A A;  4O5K A;  3BQT A;  4B9S A;  4YCX A;  9ICC A;  2DFL A;  2ESE A;  1ZD3 A;  2XI9 A;  2DUY A;  1MN8 A;  3C23 A;  5F3X B;  2PI5 A;  4RQM A;  2DBY A;  2MUT B;  4RQ7 A;  3RH6 A;  1XO1 A;  3M9M B;  3I28 A;  1FFU A;  4YMN A;  4NLN A;  4O9M A;  3AU6 A;  4QZE A;  1RYU A;  9ICM A;  2PFO A;  2GWS A;  2KP7 A;  2Q4T A;  3HX0 A;  3RB0 A;  1NJW A;  3PR4 A;  3NUQ A;  2F76 X;  8ICN A;  4KMO B;  2RHF A;  3B0Y A;  1JXE A;  3MR5 A;  1X2I A;  1V85 A;  1TK5 A;  1D9F A;  4UB4 A;  1ZQT A;  2GO7 A;  2NO5 A;  2NO4 A;  2W3S A;  3ISC A;  4F2S A;  5AM4 A;  1KBU A;  9ICQ A;  3SMV A;  4ED7 A;  5ALE A;  4QZA A;  1RM6 C;  3NRW A;  4HYK A;  1AQ6 A;  1JRP A;  1Z1B A;  4DL5 A;  2DKX A;  2WB1 C;  3KZX A;  1NZB A;  1TK0 A;  2EAP A;  2VKQ A;  3RBD A;  1URJ A;  3KHG A;  4YVZ A;  3RJE A;  2WF8 A;  9ICV A;  3DEE A;  3UPQ A;  3K4G A;  3Q8K A;  3SAH A;  8ICZ A;  3H8S A;  4JMU A;  1S97 A;  4X5V A;  2WHE A;  9ICI A;  4M9G A;  2HMX A;  2JH7 A;  4P4P A;  2RDJ A;  5ALM A;  3UXN A;  5J2I A;  1D8Y A;  1H38 A;  7ICJ A;  5J2F A;  1HJP A;  3Q8P B;  1KDH A;  1RQN A;  5J2B A;  1NOM A;  1QTM A;  8ICX A;  5KT2 A;  2G5I B;  5L1L A;  3ZD8 A;  3C2K A;  2A1J B;  1A6S A;  1UQV A;  1D9D A;  1S0M A;  3RTV A;  1L3T A;  8ICW A;  3MBY A;  2ZIX B;  1PK1 B;  3G6Y A;  4RU9 A;  4Z6C A;  4CNQ A;  2KJ8 A;  5KFU A;  1BPE A;  1N5W A;  4QZ8 A;  3KHR A;  5KG5 A;  4P0Q A;  1KW4 A;  3TAN A;  2DKZ A;  2FE9 A;  2LYA A;  2BR0 A;  2KKP A;  2XO7 A;  2ZJ8 A;  3NVZ A;  5CP2 A;  5H2F U;  2HHT A;  2ZTD A;  3H0M B;  4YMO A;  3EPG A;  5DDY A;  3E0F A;  4Z6F A;  2W9B A;  3ZI4 A;  2BHN A;  3KFU F;  1N5X A;  3QU7 A;  3HW8 A;  1QQ5 A;  5HR7 A;  8ICF A;  4CDG A;  5CJ7 A;  1L7O A;  4DLG A;  4PJ0 U;  4ECV A;  3KKA A;  2AHO B;  3GQC A;  1ZQJ A;  7ICL A;  3ISD A;  5J0P A;  3MDC A;  3OJS A;  2KVS A;  4YMM A;  8ICK A;  3QUB A;  4YR2 A;  3ISB A;  1KFD A;  3F2D A;  4B9M A;  5DQG A;  5J0S A;  3PW0 A;  3PW7 A;  1TKD A;  5DG7 A;  2V9W A;  1FO4 A;  2QAR A;  2PFP A;  2LM1 A;  2VJ5 A;  2ZIV A;  4OO1 J;  1XNS A;  2XC9 A;  5ALN A;  4MEX A;  4EZ6 A;  5J2E A;  2C2R A;  3PMN A;  4ECU A;  4Q43 A;  1NKB A;  1O08 A;  1ZQH A;  4QWE A;  2ASL A;  2P35 A;  2PMZ F;  4DEZ A;  4LZD A;  2QKQ A;  1KTQ A;  1LB2 B;  2NYV A;  1LKY B;  2EDU A;  2L5Y A;  3SEN A;  4UB5 A;  3MR3 A;  1WWV A;  4CE6 A;  4KLS A;  2R8J A;  4IRC A;  3BQ0 A;  1JN3 A;  4RZR A;  4KLT A;  2WB1 F;  3TAD A;  4YD2 A;  4NXZ A;  4P4M A;  5EWE A;  1SZH A;  3GIM A;  5ALK A;  3HPO A;  1DOQ A;  1BNP A;  3BDP A;  5DB6 A;  2HDO A;  5DB7 A;  9ICN A;  5J2C A;  1T3N A;  3MR6 A;  4GLX A;  5ALP A;  1HUO A;  4FBT A;  3H40 A;  4I2I A;  1N56 A;  4JV0 A;  2JEJ A;  5KT5 A;  4J9R A;  2BKE A;  2ODG A;  4M9J A;  5T14 A;  1RPL A;  2DL0 A;  5AKH A;  1WYG A;  2E3T A;  3T3F A;  4RT2 A;  2MU2 A;  1ZRM A;  5KFC A;  4JWN A;  4I2J A;  2ZXI A;  4Y2P A;  4F4Y A;  1L7M A;  1ZQE A;  1Q3V A;  3WKD A;  4UAS A;  1MQ3 A;  3CNH A;  5AKZ A;  5BOM A;  4C7Y A;  1XO0 A;  2FPK A;  4F3O A;  1ZQU A;  5J0R A;  2XY6 A;  5AK5 A;  4LJX A;  1NK9 A;  4XQ8 A;  1PVP A;  1QSS A;  4KX5 A;  2ZG6 A;  5ALZ A;  5AI8 A;  5KFQ A;  1ZQZ A;  3C5G A;  4ELU A;  2NRX A;  5CA7 A;  2XGP A;  5B66 U;  5KFA A;  3MFI A;  3H7I A;  2LPE A;  4RUC A;  4F72 A;  4F5R A;  2UVR A;  2W8K A;  3RJJ A;  5DG8 A;  4MEY A;  5J8Y A;  1CEZ A;  2KEY A;  3TAP A;  4IC9 A;  3MGI A;  1X9S A;  1RXW A;  1X6I A;  1CI4 A;  3TAD C;  4DF8 A;  3L5K A;  2WF6 A;  4OJL A;  1SV0 A;  2FJ6 A;  1PVQ A;  1JAL A;  5J29 A;  4ECY A;  5KL8 B;  4DL6 A;  1IG6 A;  1PUZ A;  9ICS A;  2HBJ A;  2OHF A;  5DG9 A;  4M47 A;  3OHA A;  2R8G A;  2DF4 B;  1TAM A;  5KT7 A;  4C4S A;  4QZD A;  5AI6 A;  4J9P A;  3AEV A;  5ALY A;  4EEY A;  1KL9 A;  2Y9U A;  4JB3 A;  2EZZ A;  1U49 A;  5AM3 A;  4KIT B;  1S9F A;  3TFR A;  2CPR A;  1T3Q A;  1NK0 A;  3HIL A;  2RLT A;  3UMC A;  5J2A A;  5J0W A;  3PO4 A;  5K4L A;  5KG7 A;  4QJF B;  4F4W A;  4P0Q B;  2W8L A;  2AQ4 A;  1A77 A;  3PX0 A;  3TAR A;  5A0L A;  3V6K A;  2NV3 A;  5KFP A;  1S5L U;  4I2C A;  2F1I A;  3PNC A;  1UT5 A;  3D2Q A;  1N2X A;  4DSK A;  3PR5 B;  4RQ3 A;  4NV0 A;  2FDR A;  2BCV A;  3EWA A;  5JUM A;  1ZQB A;  2LM4 A;  3UXO A;  1MSW D;  8ICO A;  3KHL A;  4QZ9 A;  2FMQ A;  1CRX A;  2NRV A;  2BQ3 A;  5AKY A;  5AK3 A;  2WTF A;  1ZQI A;  1FEZ A;  4DL7 A;  1U47 A;  5ALL A;  5KFM A;  4BJQ A;  2EZX A;  1ZQD A;  3RJG A;  4YP3 A;  2OCE A;  3PW2 A;  5EE0 A;  3HP6 A;  4P4O A;  3SZ2 A;  3AL0 B;  4TQR A;  3JPO A;  1XSN A;  4B9N A;  4Z6E A;  1L3V A;  5J8Y C;  5IIL A;  2ZJ5 A;  2PMZ C;  4IQW A;  1UA0 A;  4OJP A;  2XCA A;  1L8O A;  4KLM A;  2E8N A;  4AYB C;  4BUG A;  2KV2 A;  2FLP A;  4ECR A;  1BPY A;  5GTI U;  2F2A B;  1WCN A;  3IHQ B;  3GV5 B;  4UB2 A;  2BDP A;  4U7C A;  4KLL A;  1C7Y A;  5JU5 A;  4QW9 A;  3IN5 A;  4F5P A;  2EQY A;  3HWT A;  1O03 A;  2NRT A;  3J81 j;  3WK9 A;  3ZDC A;  2OH2 A;  3WK8 A;  4UB6 U;  3V72 A;  2FLL A;  1F44 A;  4G3I A;  3RR8 A;  1U4B A;  2VA3 A;  4KN7 A;  4UAU A;  4UB8 U;  4KLE A;  2QB1 A;  2HHU A;  3H8W A;  2D8C A;  1JUD A;  1ED1 A;  3MAB A;  3V6H A;  2W43 A;  1Z4O A;  5J2D A;  3Q8L A;  1ZQN A;  5KG0 A;  1UT8 A;  2AQ0 A;  8ICR A;  2KKV A;  7ICU A;  2G5H B;  4QIW C;  3OTQ A;  5ALF A;  5ALW A;  3TKA A;  4QWD A;  4EBE A;  2G09 A;  1RZT A;  4EBC A;  3BQ7 A;  1Z4N A;  2ISP A;  4O3O A;  1T7P A;  4KLD A;  4CF4 A;  3ONN A;  4C80 A;  2KG5 A;  3PX4 A;  5D49 A;  1FIQ A;  1DK3 A;  5EOZ A;  4EX6 A;  2YY6 A;  7ICH A;  3ORY A;  2BQR A;  2EAM A;  4TUP A;  4NLC A;  3ZDE A;  2DGZ A;  1ZRN A;  5KFJ A;  1OW5 A;  5AK6 A;  2ZIW A;  1UHU A;  2FPM A;  1TAQ A;  5KFG A;  8ICM A;  3F2C A;  5KFZ A;  2WAQ C;  3RAX A;  2ZIV B;  1A76 A;  4CGZ A;  1X66 A;  4BDP A;  9ICB A;  1L5U A;  1S0O A;  3T5L A;  3BQ2 A;  2WF9 A;  5EE9 A;  2H3Q A;  4EBD A;  1NK6 A;  4MFC A;  7ICO A;  2AJQ A;  3CW2 C;  1T8E A;  3ZDB A;  2LKY A;  2ZUC A;  1TAU A;  3CP8 A;  4BXO A;  2KSO A;  1ZQQ A;  4RNO A;  1JIH A;  4PZN A;  5CB1 A;  3Q8Q B;  2H3F A;  2FMP A;  2KJ5 A;  3JPT A;  3C29 A;  2F8L A;  2NRW A;  1B43 A;  2H3I A;  4CF3 A;  1UA1 A;  5CRX A;  4U6P A;  1XWL A;  5CR0 A;  4C8K A;  4IQV A;  1XC9 A;  1EXN A;  1L7P A;  5KFL A;  1DGJ A;  4F91 B;  1SKS A;  1ZQC A;  1LKY A;  5KFT A;  5DBC A;  2F44 A;  3U26 A;  2MAX A;  4DQI A;  3H8J A;  3N7R C;  4GXI A;  1TFR A;  3NAS A;  1NJZ A;  2G07 A;  1S0V A;  3F5E A;  5ALG A;  2HBL A;  5GTH U;  4J9K A;  3LK9 A;  4DOA A;  7ICR A;  4FZL A;  4EEK A;  1Q3U A;  4NWI A;  3HKZ F;  5ALJ A;  3ETL A;  3JPS A;  2DQN B;  4US8 A;  2XID A;  4OJO A;  5J0T A;  3M1Y A;  3Q8M A;  5KFV A;  1K5O A;  5AM2 A;  1KSP A;  3GV8 B;  2WF7 A;  4J9L A;  1B22 A;  4ECW A;  4QZC A;  3QEB Z;  2AGO A;  4DS4 A;  3GZF A;  2E5S A;  3TAQ A;  5DBA A;  5KFE A;  3FAH A;  5L9X A;  3QUC A;  2KN7 A;  4R66 A;  7ICQ A;  4DWI A;  4UBC A;  2O6K A;  3N28 A;  4JK1 A;  5AIA A;  3RAQ A;  5J2G A;  4B9L A;  2KFN A;  2C2E A;  2HCF A;  1XU4 A;  5DGB A;  3O0F A;  4R8U B;  4QW8 A;  1S77 D;  4RQ1 A;  2KHQ A;  4MFF A;  1QLN A;  4RQ8 A;  3WK4 A;  2Y9T A;  5DBB A;  3AQE A;  3RJF A;  2JV3 A;  5DB8 A;  4BXO B;  3LVV A;  1QH9 A;  3WK6 A;  3T5K A;  1T4G A;  2BPF A;  4ED0 A;  4I29 A;  1UPH A;  4QWA A;  2QB0 B;  3EPI A;  2IBK A;  1M6Y A;  3QU9 A;  2C2D A;  2UVW A;  9ICX A;  4J9M A;  2ZTE A;  3MGH A;  2V4Q A;  3ED5 A;  4QWB A;  4YN4 A;  4QIW F;  3UMB A;  9ICT A;  2YQE A;  2IMW P;  2W04 A;  5KFR A;  1Z1V A;  2KD1 A;  3F2B A;  1DXS A;  1X42 A;  4C8M A;  4P0P A;  3Q8R B;  1N60 A;  2XIC A;  4O5C A;  2OXO A;  4F92 B;  5KT3 A;  3UQ0 A;  2P66 A;  2Y1I A;  5TZV A;  3VCB A;  3V7K A;  5KAF U;  1ZET A;  1QCK A;  3NVV A;  3PO5 A;  5J0O A;  1NK4 A;  1MA7 A;  4PGQ A;  2A19 A;  3A0H U;  4RT3 A;  3PSP A;  2JHD A;  3M8R A;  1UCV A;  2ASD A;  5ALI A;  3SEI A;  7ICE A;  2KE7 A;  1U48 A;  1Z00 A;  4PGX A;  4PL1 A;  2YMQ A;  3H0R B;  2OM6 A;  4B9V A;  3SR6 A;  5KL1 B;  2ISO A;  2NRZ A;  4DSL A;  3C21 A;  2OEH A;  3V7L A;  3SAG A;  5KG1 A;  1JXL A;  2BCR A;  5DGA A;  2IOF A;  1Y88 A;  2LYB A;  4MFA A;  1VDV A;  4KLH A;  5ALT A;  2MRL A;  1QSY A;  3ETR A;  2RQ5 A;  2PKE A;  1SL0 A;  2KOB A;  1J97 A;  3NS1 A;  2JXJ A;  3PVX A;  3MFH A;  3GIJ A;  1S10 A;  4ACO A;  4PHD A;  8ICY A;  1Q8K A;  1NKE A;  2M9N A;  2EAO A;  4M6W B;  4PPX A;  1ZOL A;  3PX6 A;  4FFD A;  2LHT A;  4R65 A;  3TAC B;  2ATL A;  2WFA A;  3EYZ A;  3RRG A;  2PFN A;  4GC7 A;  1SKW A;  3RJI A;  3KHH A;  3SYZ A;  1BPZ A;  5AHX A;  2AH5 A;  1L6N A;  4B6J A;  3ALR A;  1L3S A;  1IXR A;  4K4G A;  5III A;  3GII A;  4HAI A;  4C4R A;  2GH1 A;  4CRX A;  1IM4 A;  5TIS U;  2W9C B;  8ICP A;  1YZ7 A;  4XA5 A;  1WG8 A;  3JPQ A;  4DLE A;  4WJ3 B;  3LWL A;  2QAR B;  1TV9 A;  2AGQ A;  5KT4 A;  4M9H A;  2YB4 A;  4I2B A;  5EWF A;  4NL9 C;  3BJY A;  3TI0 A;  2C28 A;  2IHM A;  3D2N A;  3PW4 A;  4DO9 A;  4PHP A;  3LYS A;  5IIK A;  3KBB A;  2JZB A;  4US9 A;  4IRK A;  2Y0S F;  2KIC A;  3DV9 A;  1Z00 B;  4DOB A;  1HUZ A;  1ZQF A;  9ICH A;  2RP5 A;  2BCQ A;  3ZDA A;  5AI4 A;  4R64 A;  3IDW A;  2YTU A;  1ZQK A;  2R8K A;  4JV2 A;  3OSP A;  4EEL A;  5DB9 A;  5EE1 A;  2R8I A;  2ZUB A;  3AU2 A;  2KHV A;  4BWJ A;  5HP4 A;  5KFS A;  3OPX A;  1SB3 C;  4A8E A;  1B0X A;  3GV7 B;  2RRD A;  2HOI A;  3L4P A;  2DWQ A;  1V9P A;  3K1Z A;  2WAQ F;  2VA8 A;  3PV8 A;  1RYS A;  5G5H A;  4DSF A;  2E8O A;  4RPY A;  4J9O A;  3SD7 A;  7ICT A;  4UB1 A;  2K60 A;  1QQ6 A;  2K8C B;  5KFY A;  4FZM A;  5D46 A;  3H4D A;  4OJ6 A;  1NJY A;  2J6T A;  3RH5 A;  3VC8 A;  4KLJ A;  4RNN A;  3RJK A;  3D2S A;  4EZ9 A;  3M6Z A;  3KKA C;  4ECZ A;  3M6K A;  2FMS A;  3EZ5 A;  1X6J A;  2Y1J A;  4KLQ A;  5DKW A;  2KIW A;  4UQG A;  4FO6 A;  1N63 A;  2W9M A;  1SL2 A;  5DDM A;  5DLF A;  2D6F C;  5KT6 A;  1XSL A;  5KG2 A;  3PST A;  5KG3 A;  2G06 A;  4DFD A;  5C0Y A;  3DDH A;  3NGD A;  2KZZ A;  4DL2 A;  2ZIU A;  4ECQ A;  1PK3 A;  4YXJ A;  5KNI A;  3RB4 A;  2QLT A;  3R9K A;  5AK4 A;  4YFK A;  2I5H A;  2FI1 A;  5KG6 A;  2C22 A;  1X40 A;  9ICU A;  9ICR A;  3T79 A;  1PVR A;  5AKJ A;  1ECW A;  5E79 U;  4O3P A;  3NRZ A;  2VA2 A;  9ICL A;  3T5H A;  3JPR A;  3JPN A;  4ELT A;  1SGG A;  1SWW A;  4UAV A;  5JRT A;  2F8K A;  5J2K A;  2K4H A;  4Z6D A;  4O3S A;  3WKC A;  2FPL A;  5KFD A;  2V4R A;  5ALR A;  4Y2Y A;  4M2Y A;  2XGQ A;  3RBE A;  8ICV A;  3V7J A;  5C5J A;  1VLB A;  4MHV A;  1B4F A;  2JEG A;  1ZJM A;  4O3Q A;  5DQI A;  2I1Q A;  5IIJ A;  3M9O B;  2EH9 A;  4QZH A;  1NI3 A;  3SI8 A;  3IV6 A;  1F5S A;  2JEI A;  4LVS A;  1YT3 A;  4GIB A;  1SWV A;  2XCP A;  3OJU A;  4BGD A;  1ZQY A;  3E58 A;  3WKE A;  3BS5 B;  1ZQS A;  4F4Z A;  1NKC A;  1L7N A;  2HOF A;  2HBK A;  2VAN A;  3N4M B;  1ARO P;  4ED2 A;  3KOO A;  1ZD4 A;  2ZUD A;  2OWO A;  3UMG A;  4DQS A;  4C4T A;  1HIW A;  4RQ2 A;  3C28 A;  4TQS A;  1COO A;  4GXJ A;  4F4X A;  5J0X A;  3EW9 A;  4O3N A;  3ICX A;  4IRD A;  3ZD9 A;  5CHG A;  4RUA A;  5KG4 A;  3FM9 A;  8ICE A;  1NNL A;  2ZJA A;  1MC8 A;  3I76 A;  1BVS A;  2I6X A;  1FFV A;  3PW5 A;  5ALX A;  2YMP A;  1S0N A;  3AUO A;  1SV0 C;  3UXP A;  2A1A A;  9ICW A;  1ZQL A;  1ZQP A;  4DFM A;  1ZD2 P;  4Y2S A;  2KSO B;  4DCC A;  3GIK A;  4MF2 A;  4CF5 A;  3C1Y A;  2PXI A;  4USA A;  4K4I A;  3G6X A;  5J0Y A;  1JI7 A;  2KZ3 A;  4DFP A;  2LBO A;  2ASJ A;  4DS5 A;  2J6U A;  2E1F A;  4GC6 A;  4JUZ A;  4PHE A;  4Y2X A;  3RB3 A;  5JTI A;  4JWM A;  3OSN A;  1Q46 A;  1RXV A;  1NZP A;  5HR6 A;  1MQ2 A;  3AQF A;  5HML A;  1ZQX A;  4NM2 A;  3T5J A;  2UVV A;  1RG6 A;  4F5O A;  5KAI U;  2GLE A;  2CN1 A;  4R8U A;  9ICA A;  2ZIX A;  2R18 A;  1JRO A;  4DSI A;  5DQH A;  3WKA A;  2PFQ A;  5BPC A;  4I2H A;  1ZQ1 C;  5AKE A;  2R8H A;  1GO3 F;  2OYY A;  3BZK A;  2AGP A;  3OGU A;  4Q45 A;  4P0P B;  2VIX A;  1SZP A;  7ICN A;  2MA1 A;  5AKI A;  4YD1 A;  2H5X A;  4O5E A;  4Y2V A;  2HOQ A;  7ICS A;  5IIM A;  5F9L A;  4KN4 A;  4PL2 A;  2BZF A;  3L3F X;  3QXG A;  5KFB A;  3WK7 A;  2HHQ A;  4OCZ A;  2YN4 A;  5KFO A;  1KN5 A;  2JMG A;  2BDU A;  2ZIU B;  8ICI A;  3CYM A;  5AM0 A;  1DRG A;  2ZXH A;  2YML A;  4O0I A;  2K4I A;  4MF8 A;  2K89 A;  3UQ2 A;  1L8L A;  5ALD A;  1F0M A;  4QZF A;  1OUQ A;  2P6R A;  5AI9 A;  2K4E A;  1ZQR A;  4GXK A;  2IA6 A;  5KFK A;  2YMM A;  3B0X A;  1COK A;  3TFS A;  4QNL A;  3QZ8 A;  4QZG A;  1Z3E B;  4EYI B;  4BWM A;  1J2N A;  4I27 A;  2XY7 A;  4DL4 A;  4KLF A;  2H3V A;  4OJ5 A;  4DL3 A;  8ICH A;  2LMR A;  4DQP A;  1RQL A;  2I9G A;  2MSN A;  5D4B A;  4TUS A;  5ALO A;  3H8M A;  4GFJ A;  4LZG A;  1SXE A;  3PY8 A;  4JV1 A;  1U9L A;  1IIP A;  1ZXI A;  4RNM A;  4M9L A;  3GFK B;  8ICG A;  4J9Q A;  3M8S A;  8ICU A;  4KLI A;  5KFW A;  4P2H A;  1Z19 A;  3SQI A;  3F53 A;  5B5E U;  3CRX A;  2A1J A;  8ICQ A;  2KMD A;  2HI0 A;  3H0L B;  2LYH A;  2F77 X;  5KFI A;  2KNJ A;  1KKX A;  1ZJN A;  5ALH A;  2B6G A;  2YB1 A;  3V6J A;  3SV3 A;  4KLO A;  1X9M A;  3RB6 A;  2DPI A;  4J03 A;  4I2G A;  4YR0 A;  5DLG A; 
#chains in the Genus database with same CATH homology
 5F3X B;  2YTU A;  2EAN A;  4RQM A;  2KIV A;  5J8Y A;  5J8Y C;  2QKQ A;  1LKY B;  1X66 A;  2E8N A;  2L5Y A;  3SEN A;  1WWV A;  1UQV A;  2QB0 A;  1V38 A;  4PZO A;  5JU5 A;  1X9X A;  1WWU A;  1PK1 B;  3TAD A;  3TAD C;  1F0M A;  2KSO A;  1SGG A;  4PZN A;  1SV0 A;  1SV0 C;  3K1R B;  5L1M A;  2Y9T A;  5JRT A;  1COK A;  1OXJ A;  2F8K A;  4NJ8 A;  1B0X A;  2KSO B;  2JV3 A;  1V85 A;  1KW4 A;  2DKZ A;  2FE9 A;  2EAO A;  2ES6 A;  2QB1 A;  2E8O A;  2QB0 B;  2D8C A;  2D3D A;  3TAC B;  4RQN A;  1LKY A;  2F44 A;  2Y9U A;  4MHV A;  1B4F A;  1JI7 A;  2K60 A;  2DL0 A;  3HIL A;  2LMR A;  2K4P A;  5JTI A;  1SV4 A;  3H8M A;  3KKA C;  1Z1V A;  3KKA A;  2DKX A;  3BQ7 A;  1SXE A;  1DXS A;  2EAP A;  1RG6 A;  2GLE A;  1PK1 A;  2QAR B;  3BS5 B;  2E8M A;  2KG5 A;  4NL9 C;  4NL9 A;  2KMD A;  3BS5 A;  2QAR A;  2F3N A;  2EAM A;  2E8P A;  1OW5 A;  2B6G A;  1PK3 A;  5KNI A;  1UCV A;  3SEI A;  1SXD A;  2LPE A;  2KE7 A;  3BS7 A;  2ESE A;  1X40 A;  4IS7 A;  3IDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...