1NJYA

Thymine-thymine mismatch at the polymerase active site
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 214
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njyA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njyA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njyA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njyA01
3VQCA 4M45A 3G10A 4LH4A 4ED2A 4KI4A 4F92B 8ICMA 1KEJA 4YP3A 4PHAA 1SL1A 1L3TA 3PY8A 1D8YA 3SUQA 4CFCA 4J9KA 3OYHA 4CIFA 2AQ0A 4B08A 1NK8A 1A77A 2ZUBA 1RYRA 3C95A 4Q5VA 4GVMA 4I2DA 5BOMA 4FLVA 1XC9A 4R66A 4KLUA 2W9AA 3OY9A 2ISOA 1LAVA 2ETJA 2BPCA 1RT1A 4QZCA 3F9KA 2AJQA 2NUBA 5KT3A 4B9SA 5C42A 4Y1DA 1HJPA 4RQ0A 4YFKA 2R8KA 4O3NA 4KO0A 2I1QA 3RWUA 3ITHA 4GC6A 4NCBA 5CP2A 2AGPA 4FJKA 5IIOA 1BIUA 5HMMA 1UA0A 4IR9A 4KB1A 1S77D 4KLDA 4RNMA 1ASVA 2ISPA 3OYDA 2RDJA 4CK1A 2UVWA 4KHNA 5KFWA 5EWGA 4CHYA 3V7KA 1XSPA 4FW2A 5KT2A 3MDAA 3AVFA 5J2GA 2V4QA 1A5WA 5D3GA 4I2BA 5KFKA 2R8GA 3AVIA 4JV0A 4R8UB 4CEAA 1EKEA 4RQ7A 4J9OA 3AVGA 3O3FA 2NRWA 1KSPA 4DOCA 4ED3A 2VG5A 9ICCA 4YD2A 3ZT3A 4EZ6A 5KFBA 1REVA 4DQQA 1C6VA 4NYFA 1VSLA 4I7FA 1ZQIA 1KVAA 3QNNA 4CJUA 4JV1A 2DFEA 4FK2A 2BCRA 5J2EA 5SZTA 5KFHA 3HW8A 3ZSYA 4RQ4A 9ICBA 4JV2A 2P6RA 4ELUA 4DOAA 2AGQA 2F96A 3NF6A 9ICFA 3A2FA 4KI6A 4KN4A 8ICIA 3ETLA 4UAZA 1XO1A 3S3MA 3RAQA 4RU9A 2C2EA 2OA8A 3T1AA 8ICXA 5J2NA 7ICFA 2HVHA 3C5FA 1TK0A 2BCVA 3ZSQA 1PZNA 1ZQGA 3EPGA 4F4YA 4RQ6A 4FS2A 1XU4A 1QSLA 3MR6A 5J2QA 3SV4A 3BDPA 3VQAA 4GMJB 3SQ0A 5J2MA 1S97A 2JEGA 4CJTA 1ZQKA 4KLQA 3CFOA 2BHNA 5HMLA 5DBBA 1TL3A 1YT3A 1K1SA 1ZQSA 3MXMA 4YN4A 1TGOA 5DG9A 4DFPA 3JPTA 1N56A 2UVUA 4E7IA 2KW4A 1HYSA 4QZDA 1RTHA 4JRQA 1VSMA 3L2QA 2JZBB 1RZTA 3AVAA 4Q43A 1UT5A 5KFAA 2VWJA 4F3TA 4NM1A 2YV0X 2HHTA 5F9NA 4BE2A 7ICEA 4JWMA 1S9GA 3K2PA 4AHCA 2VA8A 2KFZA 3ULDA 2PXIA 3GV8B 1TV9A 5KG0A 2F1JA 5J0WA 1BPXA 4Z6DA 4QW8A 3RMAA 4ED7A 2DPIA 1S5JA 3QO9A 4Q8FA 4G3IA 3C6UA 7ICGA 4DTPA 1KTQA 1QHTA 2OPSA 3K5NA 4BE0A 3MABA 4QZEA 1KVBA 1D5AA 4RT3A 4FLTA 2V4RA 2O4IA 3OYJA 1BPYA 3ASMA 4OVLA 1L3SA 4KLHA 3ZD9A 3C1ZA 3LP1A 3IM1A 1ZQRA 2VA3A 3LAMA 5KFTA 1RYSA 2YNHA 4BGDA 2YKMA 3RJJA 4FW1A 2EX3A 1BPDA 4EBCA 4XIUA 1X9SA 1WAFA 5JUMA 2ZTEA 5BOLA 1JXBA 1NK6A 4DQRA 1ASUA 4Z6CA 5DKWA 2A1JB 3F73A 4B9NA 4I2CA 4RW7A 4Y1CA 4CEEA 3NGYA 4O44A 1IG9A 4CEOA 3MECA 3I0SA 1TAQA 3V9SA 3TANA 1X9MA 4MFAA 2XC9A 4YNQA 4F5PA 4NXZA 1TAUA 1VSIA 2OPRA 4CF1A 4GW6A 4TUSA 2VANA 3G6VA 5KFYA 4E1NA 2RF2A 4DTRA 3L3VA 2ITGA 1W9HA 1RT5A 4O3SA 5J2FA 4KITB 1S1VA 3ORYA 4F91B 2IHNA 1N48A 3IRXA 4YMMA 1NK9A 3K58A 3PW7A 3HX0A 3QEXA 5DB6A 3RR7A 4RQ3A 2RN2A 2JZBA 3MR2A 3V9ZA 4YMNA 3MR5A 4W5TA 8ICZA 5J2BA 4PA1A 1Y97A 8ICBA 3PW2A 3LP0A 4CJ4A 4CCHA 4QWCA 2B21A 1W0HA 4TUPA 3JPSA 1S10A 9ICEA 4DTJA 1XS9D 3VN5A 7ICQA 4DSLA 4HVJA 2ZQBA 4CJSA 3DYAA 4F50A 1HMVA 2G8IA 4NLZA 2DY4A 3IHQB 4AHVA 2UVRA 3U6FA 3Q8RB 2Y1JA 1Q9XA 1S1UA 2FBYA 3AUOA 4AHRA 3CFPA 5DQIA 1U45A 1JLFA 3AU2A 4UBCA 1ZQPA 1SL2A 3S3OA 1B9FA 1UAXA 4HCBA 1FK9A 1HPZA 3M9OB 4QWDA 4IRKA 3QEIA 4DTUA 3TFSA 1NOZA 7ICJA 2DPJA 4TURA 1ZYQA 5L9XA 1BIZA 2A1JA 3AA2A 4KHYA 5KFLA 3NBPA 1U48A 4KLLA 4I2QA 7ICHA 1HQUA 4IG3A 5C24A 4PY5A 3HP6A 1JX4A 1ZQWA 1R0AA 2HB5A 4C8KA 8ICCA 5DLGA 5DG7A 1JLGA 3ZSXA 3KHHA 5DGAA 3RH5A 3ZSRA 3N4MB 3DI6A 4CGHA 3TAFA 4DL7A 3PO4A 1CXUA 1TVRA 3C6TA 4OKJA 4CJVA 3V72A 4DL5A 2W8KA 1X2IA 4F4XA 4CEZA 5D49A 1CZBA 3QZ7A 1NJWA 4M3UA 3JPPA 3LWMA 1QSSA 4O5EA 4M9NA 2PZSA 1QSYA 2HHWA 3K5OA 4FLWA 1RBUA 2NRVA 2Q3SA 3OYNA 3LALA 1S0MA 1VRUA 3NH0A 1ITGA 4OPKA 2HHXA 4DU1A 2OWOA 4X5VA 4FM1A 3HP9A 2P1JA 2IGIA 5DMRA 4CJ3A 1BCOA 9ICNA 1YVUA 2FMPA 3SPYA 3VQ4A 4R63A 1IM4A 3PMNA 4KTZA 4CEQA 2PFNA 4M41A 3AO3A 3NF7A 5C25A 5DBCA 8ICNA 2FBVA 2G8HA 2ASLA 4I2HA 3RJFA 2D5RA 2OPQA 9ICOA 3OJSA 1QLNA 3OGUA 4ZH4A 2FLLA 1TKZA 3DMJA 1KDHA 5KFOA 1JLAA 3RBEA 1IH7A 3H08A 4KKOA 4F3OA 3HPGA 4K4IA 5KFPA 8ICAA 3C5GA 4CF2A 4KRFA 4O0IA 1S76D 1DLOA 1G15A 3K5MA 2FPLA 4KHQA 5J29A 3LAKA 1WNSA 5KG5A 2ATQA 2Y1IA 3DLEA 3HPOA 4J2BA 3AO1A 1HUOA 1TK5A 3ZT1A 2F1IA 4JRPA 1V9PA 1YTUA 4DL2A 3NH2A 3GILA 3SI6A 3D0PA 8ICSA 4DMNA 3DLGA 7ICRA 1VSEA 3DRPA 4NLKA 1ZQNA 1NJYA 1VSJA 3OSNA 4DTNA 5DBAA 3H8SA 4Z6FA 2ZTDA 3K75D 4YR2A 5EU7A 4CGIA 2X78A 3VA0A 2X6SA 3TAGA 2B4JA 4FK4A 1C0UA 1TFRA 5KG6A 5CJ7A 8ICGA 3H4BA 4KB0A 3AA3A 4PQUA 2ZE2A 2FPKA 2R7YA 1T4GA 1QQCA 3PX0A 4ED8A 2ALZA 3AVNA 2XHBA 3PW5A 5CWRA 3L3UA 1ZQUA 3PMLA 1A5VA 4KV8A 4QZAA 4M47A 3QEVA 2B6AA 4OJRA 4E7KA 4CE9A 4E7LA 2BKEA 4FVMA 4JUZA 1J5OA 2ZD1A 3GV5B 1KFDA 5CYQA 1WSGA 3WNGA 5HP4A 2R8JA 1NK0A 2PFQA 3H4DA 2XY8A 3MFHA 3Q8MA 1LW2A 4KLJA 4RQ1A 1IXRA 1B22A 3HL8A 4FLYA 4LH5A 2PYJA 1MQ3A 1TKTA 3M9MB 4DQSA 2IA6A 5DQHA 5J1EA 5KG7A 4HYKA 5KT6A 3CFRA 3BJYA 9ICGA 1Q9YA 4Z0UA 4EP4A 3MXIA 3RB6A 4KLFA 1BCMA 4ED6A 4CJWA 2IC3A 1CEZA 2KZZA 5HRRA 3RJHA 8ICFA 3ISNC 2W42A 1TK8A 2BPFA 3AO5A 4H4MA 5HRNA 4BDZA 5D46A 2VWKA 1C0MA 2E4LA 2UVVA 5I3UA 5KFUA 9ICKA 4DL4A 4RT2A 3VQ9A 3SYZA 3G6XA 5HRSA 5HRPA 3LDSA 4IQWA 3VQ8A 2WTFA 4UQGA 3M8PA 1LWFA 4CHNA 5SWMA 3KD5E 4XRHA 1NJZA 1KRPA 8ICHA 5IIKA 3N97B 1C1CA 3V6KA 3EW9A 3P5JA 1IO2A 3GIMA 2HNYA 1UA1A 2ZJ8A 4QZ8A 4J9SA 1XWLA 4E19A 3MR3A 4E1MA 3Q8LA 1RT3A 3RH6A 4OKEA 5D4BA 4F93B 3ZDDA 1JLBA 2KZ3A 5J0RA 1VSFA 5L1JA 1C7YA 3UQ0A 4J2AA 1Z3EB 9ICPA 1NOMA 4MFBA 5DB8A 4I2FA 2YNFA 3K4GA 4MF8A 2P6UA 3O4NA 5KFJA 2RDIA 4KFBA 4H8KA 2F1HA 1DTTA 1LAWA 3RBDA 3AVJA 1IKYA 3RRHA 4LD0A 4I2EA 2BCSA 2F8SA 4W5NA 3I0RA 3NH1A 1SZPA 4M3RA 3DLBA 4CF9A 4HUFA 3KLFA 2ZUCA 1LW0A 3NAEA 1KLNA 4DL6A 4N56A 2W9CB 2WONA 1JL2A 1ZQOA 5EWEA 4FCYA 4Q44A 1FKOA 4O5KA 4F5NA 4O0JA 1ZJMA 4I2IA 3GFKB 3RTVA 3C23A 5KT4A 3L2VA 4QWAA 1CUKA 4AHUA 2QXFA 2RPIA 5CA7A 1HQEA 4CIEA 2ZJAA 1KCFA 3T3FA 4N76A 4B9TA 2ASDA 3SCXA 4PHDA 3GV7B 2JGUA 1VSHA 1KFTA 3BQ0A 5J0PA 1S1TA 3FFIA 3OYLA 4HUEA 5J0UA 3BQTA 4FJGA 1RT2A 4PHEA 2KFNA 3AO4A 4K4GA 3KHGA 3V9UA 1JL1A 3AVBA 4CHZA 4FK0A 1AROP 1VK0A 4IBNA 1WCNA 3E01A 1J53A 1BGXT 1F21A 5BPCA 4IQTA 4KMUA 4FJXA 3HVTA 4R8UA 3CG7A 3SPZA 3OHAA 4CIGA 1BQMA 3EPIA 4QZBA 5HLFA 3WNFA 5KG1A 4HCCA 4YXJA 8ICOA 4F4ZA 3RMBA 4CJQA 4DO9A 4IFVA 3V81A 2FC0A 2VG7A 4M9HA 1RBSA 4I9QA 3PNCA 3ZCMA 3TQ1A 5J0OA 4B8CA 1JKHA 2BGWA 1UWBA 4UBBA 2BCUA 4CJEA 5FRNA 3C2KA 3TI0A 1U04A 1BPZA 4F5RA 4QZFA 4AILC 1U4BA 9ICUA 5J0SA 3NE6A 3ZDCA 2PY5A 3PV8A 4CF8A 4C8LA 4YR3A 4MEYA 2IMWP 2BR0A 1BISA 3G0ZA 4CJLA 1RXWA 4CJPA 4BACA 3C2LA 4FXDA 1EX4A 3ZT4A 2AU0A 3KLHA 1WSFA 1WSHA 4CHOA 2YNGA 2LYHA 7ICUA 4M9GA 5DB9A 1S1WA 1H38A 1GOCA 1HYVA 5TZVA 1T03A 4RPZA 8ICRA 2ZJ5A 4RG8A 2W9MA 3TAPA 4Z4CA 3OJUA 1U47A 4O3OA 4I29A 5DK5A 4F8RA 4BXOB 4P2HA 3HPHA 5J0TA 5CZ2A 4DG1A 3L2UA 4DSFA 3QETA 3H8WA 4ECXA 3ZT2A 2NRTA 1RDAA 4E0DA 2XRIA 2GBZA 4QWEA 4QOZB 1D8LA 4I2AA 4E89A 4FJIA 4EYIB 4CEDA 1VSDA 4UAWA 4F5OA 3GIKA 5J0XA 1U9LA 4I2PA 3AVKA 4CK3A 3LZJA 7ICLA 1BPBA 4IR1A 4E7JA 1YTAA 3SQ2A 3BGRA 5J0QA 3OS1A 1T05A 4QW9A 4RQ8A 4KLGA 4XQ8A 4CFDA 2FBTA 2G8WA 3V1RA 3TAQA 2M9NA 4F2SA 4JLHA 2YKNA 4KLOA 1N6QA 3QIPA 3U3YA 1LWCA 3ISBA 2HHUA 1A5XA 1RT6A 3KK3A 2YHAA 5JS1A 5E41A 1NKBA 4DLGA 4ED0A 4CJRA 4DTSA 3IS9A 1C0TA 4I2JA 3V6HA 3BQ2A 1CXQA 4DFMA 1RILA 2VA2A 3VQ7A 4PWDA 4R64A 3NGZA 1RBVA 3V1OA 3SUNA 1IKXA 2HNZA 3MAQA 3AA5X 2FMQA 2DFLA 4EBDA 4AHSA 5L1LA 4CECA 1HJRA 2RKIA 4YR0A 4AH9A 4DF4A 3V1QA 2QKBA 1RCHA 2E6MA 3MFIA 1CZ9A 1XI1A 3HVRA 4LZGA 5IINA 3AVMA 4MQ3A 2AQ4A 1S9FA 1LV5A 3O4QA 3KHLA 3QESA 5KG4A 3MGIA 3AO2A 3LPUA 3MXJA 1COOA 4J9NA 2ASJA 4CGJA 3NCIA 5L1IA 1S1XA 5DGBA 4M3YA 3SUOA 4BXOA 3HO1A 3HSTB 3DOKA 1O1WA 5KFVA 3C2MA 4PHPA 3PVXA 9ICSA 5CY4A 3GIIA 4KHUA 3ZT0A 1N5YA 3GQCA 1WCLA 1JLEA 5KFSA 2KZMA 2MAXA 4C8MA 4K4HA 4M3WA 4DOBA 1BVSA 3K57A 3RR8A 5HNKA 2BGGA 4OLBA 4TQSA 2H5XA 1I3AA 3AA4A 4QZ9A 2HHVA 5KG3A 1JIHA 8ICPA 1MC8A 5KFNA 3AVHA 3SV3A 3UIQA 4B8AB 3MBYA 2Z1IA 4RNOA 3ZSVA 5KGWA 4FJJA 1Y88A 2J6UA 4B9VA 4DTOA 2P5OA 3CQ8A 4P4PA 1HUZA 3QE9Y 3ZD8A 3T5JA 1SKWA 1RT4A 2AGOA 4GLXA 3L2RA 3PUFA 8ICLA 1FKPA 3SNNA 4CGFA 4IRDA 4TSXA 3KLGA 4MF2A 5EWFA 1SV5A 1RXVA 1B43A 4W5RA 1WSEA 2B5JA 4Q8EA 3QZ8A 4J9RA 4B3OA 3AU6A 3M8RA 3SQ1A 4B9LA 4F2RA 4KLEA 4YFUA 3RJKA 3NDKA 3S9HA 3IAYA 4CJKA 4DTMA 1UT8A 3HM9A 4IRCA 5IIMA 1RT7A 4CJFA 2XGQA 3CM5A 1ZQDA 1S0VA 5IIIA 4B9MA 1K1QA 3NGIA 3EY1A 3V6DA 8ICTA 4W5QA 4DSJA 4DU3A 1KVCA 4I27A 3LZIA 2DFFA 4Z4IA 4O5CA 1NK5A 1C1BA 1FXXA 4UB5A 3WNHA 3NF9A 2C2RA 3JPQA 3VQDA 4K8ZA 3V7LA 4J9PA 4OGEA 7ICNA 1K6YA 3K5LA 4O4GA 1IKVA 1WLJA 3WNEA 4FJ7A 1S6QA 2HVIA 2IHMA 4NM2A 5KT5A 2JEFA 3HWTA 3GIJA 4CERA 3DRRA 1RNHA 4IKFA 1X1PA 1SKRA 4BWMA 4DFKA 1BHLA 2J6SA 4YXMA 3OVNA 3V6JA 2R8IA 4YCXA 2Q0ZX 4FJ8A 1HYZA 2G8VA 3P1GA 3JSMA 3I8DA 3U3GA 4RPXA 4ID1A 4DQPA 1S0OA 3KK1A 2XY6A 1RPLA 4MEXA 5I42A 3RJIA 3UQ2A 1ZBUA 3SUPA 5KFXA 1QE1A 3S3NA 1NKEA 4DL3A 2HHQA 5CHGA 3H40A 5CYMA 3QINA 3OYEA 2EHGA 5J2CA 4O55A 1JLCA 3DM2A 3UXNA 4CK2A 9ICWA 3NHGA 7ICOA 1DGSA 4LSLA 3QEWA 1JXLA 1ZETA 3EZ5A 4GXKA 7ICPA 4E7HA 4CGDA 4FJNA 5FDLA 4ECYA 2ZTCA 3TR8A 1ZQYA 1ZQMA 4C8OA 3DRSA 4FO6A 2W9BB 4Q45A 1ZQCA 3PO5A 7ICMA 4CEBA 3VQ5A 3HK2A 3KJVA 3NFAA 4MFFA 9ICAA 3VQEA 5J2AA 2BQ3A 4DEZA 2HNDA 4DU4A 5KFFA 4LZDA 4GXIA 4LSNA 1RTDA 4PGYA 4CFBA 2Z1GA 4MFCA 4KN7A 4O5BA 5DDMA 4ICLA 3SJJA 2BANA 3VQ6A 1ZQZA 9ICIA 1ZQLA 1GOBA 3KKSA 3HXMA 5KI6A 2IBKA 1U49A 4ECTA 4CHQA 2QK9A 4EZ9A 1MQ2A 5FROA 2C2DA 4DF8A 3ALYA 1T8EA 4LVSA 3KK2A 1JMSA 1L3VA 4CF0A 4I2GA 4M04A 2PI4A 8ICJA 3QERA 1SKSA 4EBEA 3OSPA 3KLEA 3ZDBA 4UB4A 4IQVA 1BL3A 4KTQA 4OKKA 3TAMA 3ZSOA 5KFZA 2BE2A 4RUAA 5C5JA 4ECRA 4ECUA 3TWHA 3JYTA 4NY8A 2BQRA 4YVZA 4GC7A 4OLAA 4P4OA 4ECWA 5IIJA 3RAXA 1JLQA 3RH4A 3C94A 8ICKA 3D45A 1XSNA 1T7PA 3QNOA 2FLNA 7ICTA 4P4MA 5J0YA 5KFIA 4FM0A 5J2JA 4DLEA 1XHXA 4WE1A 5HP1A 2J6TA 4ELTA 5K14A 3RMCA 4M3TA 1Z25A 4ZTFA 2MUTB 1B92A 9ICTA 2BDPA 3LP2A 4N47A 1IKWA 3KIOA 3RB0A 1CLQA 4QAGA 4HTUA 3LDAA 4IFYA 1ZJNA 4Z4GA 1NJXA 3DLHA 2W9BA 1TL1A 4F4WA 4FLXA 4KAZA 1GOAA 1Z00B 3ZSWA 2OZSA 1ZQQA 4O3PA 1WSJA 1ZQVA 3VQBA 3RB3A 4EEYA 1J54A 2G8KA 9ICVA 4KLMA 3ZSZA 3OYFA 3HJFA 1B9DA 4C8NA 3CYMA 1C1AA 3LK9A 5EOZA 3EYZA 3Q8PB 3OYAA 5FRMA 7ICKA 2FLPA 5KG2A 4EP5A 4F4KA 2PYLA 2D0BA 4RW4A 8ICQA 4I9LA 4N41A 1A76A 3C21A 2JEJA 7ICIA 2W8LA 4HHTA 5J2HA 3Q8SB 1T3NA 3M8SA 1EP4A 3C1YA 1L5UA 1HRHA 4M9JA 4CHPA 4FLZA 4J2DA 1ZBHA 4DFJA 5KFQA 4M3ZA 4QZIA 2Z1JA 2LSNA 4KHWA 4JK1A 3LWLA 3KD1E 1NK4A 4J2EA 4NYNA 4OPJA 4KLIA 3OS2A 3HT3A 3ZDAA 1JN3A 4YQWA 3H8JA 3M9NB 3KKRA 3IG1A 3MDCA 4N5SA 4O3QA 5KFMA 4RW8A 2DTUA 1L3UA 3CM6A 4RUCA 1D9DA 4QWBA 2HMIA 4EYHB 4ELVA 2X74A 3PR4A 4J9QA 2W9CA 4CESA 5KTQA 2XCPA 4Z4EA 4ECZA 3M8QA 2GV9A 3QEPA 4UB3A 5KRSA 4Z4HA 4J9MA 3B6OA 3VQPA 2FMSA 4DQIA 1ZQBA 4M9LA 2JLEA 2MUTA 9ICHA 1WN7A 3VQQA 4AHTA 1ZBFA 2QKKA 3E2EA 1RBTA 4KPYA 2I9GA 4PH5A 1XHZA 4KLTA 9ICRA 1Z00A 5CR0A 4JS5A 2D0AA 4RQ2A 3PW0A 1NKCA 5HROA 4R65A 4CEFA 3DLRA 4UB2A 4RNNA 3OYBA 5J2DA 7ICSA 2GWSA 1ZQHA 4O3RA 3T5LA 1BQNA 3T19A 4HUGA 4M42A 4IG0A 4PPXA 9ICMA 4FJHA 4K8XA 3V9XA 4Z4FA 1S9EA 4BWJA 1EXNA 2WOMA 1RDBA 1ZQEA 1TVAA 2BPGA 5DDYA 2ZUDA 2C22A 3RJEA 1Z26A 9ICLA 3V9WA 5HBMA 1ZQJA 4ZTJA 3LANA 4FZYA 4M6WB 2A1RA 5IILA 3QEBZ 1HNVA 1NK7A 2A1SA 1ZQFA 5F9LA 2XO7A 1S6PA 4BE1A 3H7IA 4RPYA 4L8RB 4DTXA 2NRXA 3P83D 8ICEA 8ICUA 5CB1A 4XUSA 3O3HA 3GDXA 1EXQA 2YNIA 4CJ5A 4GXJA 5KFDA 4DS5A 3OYCA 1EETA 5L1KA 4NLNA 4M3XA 1TKDA 4NLGA 4QCLA 1ASWA 4YG2A 4B9UA 1RTIA 3LP3A 3ISCA 3RJGA 2P5GA 1I39A 3KLIA 3SQ4A 4ZHRA 4UB1A 4W5OA 3TABA 1LB2B 4ECVA 3RRGA 3SI8A 4G1QA 3FYHA 4JWNA 4XA5A 1BI4B 3DOLA 2BCQA 3QEAZ 2D0CA 2OZMA 3B0XA 2PFOA 3OYKA 5KFRA 3ISDA 1J9AA 2KN7A 4ECQA 4FLUA 3KTQA 7ICVA 2ATLA 3JPRA 2R8HA 5HHHA 2P51A 3PX6A 9ICQA 4RZRA 2XCAA 2IDOA 5J2PA 4BDPA 2V9WA 4KREA 3T5HA 3MGHA 5KFGA 1KFSA 2KQ2A 3MEGA 2FBXA 4F5QA 5HHIA 3K59A 1WAJA 4DSEA 1JXEA 4J9LA 3V7JA 4DWIA 3OYGA 3JPNA 4LY7A 4JS4A 3T5KA 1LWEA 4RW6A 3BQ1A 3THVA 3DLKA 5T7BA 2KTQA 1RTJA 4FJ5A 1SL0A 4I28A 1KLMA 3OYMA 3L8BA 5DG8A 1XSLA 3L2WA 1HNIA 3QLHA 3O3GA 3AV9A 2HHSA 4QZHA 4M6WA 4RQ5A 2P66A 5KGXA 5DLFA 1RDCA 3RB4A 1DOQA 4FBTA 3TFRA 2C28A 4KLSA 4FBUA 3NF8A 2XGPA 3QIOA 3FDSA 4FZXC 3Q8KA 5JS2A 2OPPA 1NOYA 1QTMA 2BQUA 3HYFA 1UOCA 2Z1HA 1WSIA 3RMDA 2G8FA 1X9WA 1MSWD 1ZQXA 9ICXA 3B6PA 2X6NA 2YHBA 3VA3A 4CFAA 4YMOA 2G8UA 4DSIA 2O4GA 2IOCA 3TAEA 4ED1A 1ZQAA 5DB7A 4FJLA 4FS1A 1D9FA 5KRTA 4KTWA 4FYDA 2JEIA 4RW9A 1RBRA 5KT7A 2PI5A 4M0AA 8ICVA 8ICYA 4PGXA 1RDDA 4ID5A 3TARA 1BI4A 4FM2A 2E6LA 4UAYA 3PR5B 4DSKA 3UPQA 4ECSA 2XY7A 3OHBA 3LPTA 3PW4A 5DQGA 2FPMA 4TUQA 3Q8QB 3OS0A 8ICWA 4NCGA 4KHSA 1MU2A 2IAJA 3EWAA 3UXPA 3JPOA 5KFCA 3NGDA 2NRZA 4FJ9A 2F8TA 4BDYA 4PGQA 3MEEA 4TQRA 2VG6A 5CZ1A 3ZDEA 4QZGA 5J2IA 3PX4A 4DS4A 1ZQTA 4FJMA 4NCAA 4H4OA 1ZBLA 3SZ2A 2HW3A 9ICJA 2DFHA 3B0YA 2IS3A 4YD1A 1DTQA 4IDKA 1QS4A 4OGCA 4PUOA 3G6YA 4CGGA 4M2YA 3UXOA 2OYQA 5KFEA 2XY5A 1Q8IA 4Q0BA 4R5PA 5J2KA 1ZBIA 4O9MA 3MEDA 2GUIA 4FZZA 3V4IA 2PFPA 1VSKA 3AVLA 4Z6EA 1S0NA 3KHRA 3AVCA 3OYIA 2I5JA 1BPEA 1TV6A 1SUQA 1VRTA 3NTUA 1TKXA 4E3SA 4IQUA
chains in the Genus database with same CATH superfamily
5LMUF 1YXQA 3G10A 3SMVA 3ENVA 2P9LA 3IBFB 4K4ZA 3MCPA 1SL1A 1L3TA 4EX6A 3CJ3A 1PC5A 3G4SS 1WUDA 4V19X 4NXMF 3A8IA 1RYRA 4PG8A 2R7SA 3C95A 1FEZA 2FJBB 4O4RA 5BOMA 2ZZTA 3M6UA 3D3CJ 2DNZA 4FPRA 4K59A 3E9LA 3NRZA 4YDXA 2ISOA 2EPIA 3VALA 4OJ3A 1URRA 5J2QB 1VQ7S 2UXBF 3F9KA 2AJQA 1T9TA 2NUBA 3QUCA 1NHKL 2DNGA 1GLEG 3TYTA 1IR2A 4Y1DA 4FWPA 4GRSA 2R8KA 1SBRA 3LVVA 1YF5L 4AXJA 3H5UA 5LJ3Y 4H0YB 3RVCA 3DCAA 4IOAL 2CG4A 4KLDA 4RNMA 2ISPA 2PFFB 3GE1A 2RDJA 3SJHA 1RTHB 3BSOA 4KHNA 5KFWA 1EIYB 4CHYA 1XSPA 4CO1A 4FW2A 1QM9A 3MDAA 2KLAA 5CA5A 3AVFA 2DRDA 3T1HJ 4I2BA 5M1QA 3AVIA 4JV0A 1S9GB 4R8UB 4LIWA 5CE3A 2I9SA 2MXYA 1IWAA 2E1YA 4ED3A 2IJNA 4LR9A 2BOAA 2SXLA 5HQ8A 3VF2A 4OD0A 3ZT3A 4LF8K 3L4PA 2JMGA 1G4CA 1U0HA 1W26A 4NLDA 4NYFA 1ZD2P 4B3SF 3KXDA 3QNNA 4JV1A 2HQCA 5GAHU 1NSKL 4X64F 3G2XA 3G87A 1EJ7L 5J2EA 4AL6A 2NPIA 2G13A 4ZVSB 3BS7A 2YKMB 3L3CA 2G0AA 2HBYB 1VQMS 5AXKA 4UQTA 4JV2A 3CC7N 2HBZB 2G9OA 2IPOB 3AH6A 5C2DA 4KN4A 2OTJN 3ETLA 2GWJA 2XVTA 1FDDA 3EUB2 3KWGA 3RAQA 3I56N 3T1AA 2ZM6F 1BD6A 5J8YA 2DRAA 3LA0A 4GY2B 1TK0A 1V5VA 4FP9A 1HWIA 1T03B 3EM1A 3CDBA 3EPGA 3LTOA 3SV4A 2OEHA 3BDPA 3VQAA 2O8DB 2HKEA 4WFXA 3J7YU 3DU5A 4KLQA 2BHNA 5HMLA 3W3SA 4G9ZA 1TL3A 1ZQSA 3D2SA 4OZ5A 2NR0A 1VQPN 4DFPA 1UTAA 3NUQA 1NGGA 4MKBA 4LVOP 4FF4A 3L3FX 1W97L 2JZBB 4FNIA 2VPWB 4F3TA 3SAGA 5F9NA 4QBUA 2M7SA 3LVWA 2HF4A 1JROA 3IRWP 2B51A 3W60A 2VA8A 2KFZA 2JLFA 2LXFA 3SDEB 4U67L 1TV9A 2G1DA 2Z8QA 1BPXA 4EU0A 1RWNB 5A8RB 4KIAA 7ICGA 1LWCB 4QZEA 4X2BA 4PWUA 1D5AA 1PG5B 1VDVA 3RRKA 2VQEK 3H0PA 3OYJA 3R5CA 1J2MA 3HVAA 3CMAN 4BRGA 1L3SA 1JLFB 4BJQA 3LP1A 1K0TA 3IM1A 5KFTA 4HH1A 3NNHA 2XMKA 3RJJA 2CJBA 4DR5K 4FW1A 2ADBA 2EX3A 2LDIA 1MG7A 5AXNA 4X65F 2UUWA 1YI2S 2GJIA 1AB8A 3VGUA 3IMXA 5E3RA 2I2YA 2KHCA 3NL0A 1JXBA 3TU5A 1ASUA 1VISA 2CH5A 3C14B 2HHPA 4NI2A 2BDUA 1UVNA 4O44A 5C24B 3CMES 1IWGA 2V2QA 3T69A 1TAQA 1A6SA 4KH1B 4NXZA 2KXFA 2H4YB 3PCOB 5ALQA 1LKZA 4HACB 2W24A 5AM3A 3GJRB 3FM9A 2HMPA 3QB0A 3WT0A 4BRIA 3TADC 3UCGA 2IHNA 1N48A 2E1EA 3IRXA 3OA9A 1NK9A 3P5TL 3FKBA 1OY6A 2RN2A 3V9ZA 5E79U 1R8PA 3MR5A 2KXHA 4JI4F 1D0EA 4PA1A 3IWNC 2QWPA 8ICBA 3PHTA 1FKAF 4OYIA 1RDUA 1MWKA 3VENA 4G1PA 4QWCA 2CJYB 1W0HA 1HKAA 4TUPA 3JPSA 1XS9D 3CCJN 5DJBA 1J5EK 3GBTA 4K4UA 4DSLA 4HVJA 2ZQBA 4FYXB 4F50A 1XMQF 4USTA 2QWNA 2G8IA 2DY4A 1K73O 4K2JA 1NNLA 4TYBA 3MN9A 4OX6A 3U6FA 4PCQA 1LK7A 2OELA 3US5A 2IOFK 4WQ5A 2FBYA 1FHTA 5ETSA 1YZ7A 2GO9A 3CFPA 5GMDA 2AEJA 2ZDOA 2DKXA 3ET6B 2BYCA 4UBCA 4NYOA 2HFUA 1B9FA 2OPQB 4HCBA 1FK9A 2H1YA 2RQ4A 2D4WA 2GLEA 2DXEA 3O1BA 3X1LB 4DTUA 1NOZA 1R8CA 4TURA 4ZP6A 3MWTA 2OUGA 3MCAB 1HNXK 3OTCA 3DXKA 1ZYQA 1NPRA 2VBZA 1BIZA 3TTCA 2A1JA 5KFLA 4CP5A 4JBCA 3A0IX 1U48A 4KLLA 2PA8D 3DLEB 1N32J 1SJQA 5CEHA 4A47A 2YWKA 4C8KA 4JV5F 4M5LA 4DR1K 1SC1B 2JHDA 4ZLNA 2DR5A 3ZSXA 3KHHA 4NPOA 3ZSRA 2RRNA 2MSSA 3QICA 4DL7A 3N01A 3H0MB 3C6TA 3W63A 2QL9B 2YKOA 2W8KA 4QIWF 2F1FA 3QWPA 4XEIA 2W2MP 2VQFK 1U2FA 2MLYA 1U6ZA 4MHVA 4M3UA 2ZE2B 2RQKA 1QSSA 4ZJLA 3D1OA 3K5OA 2B0GA 3BEGB 2NRVA 2Q3SA 2LM1A 5D0GA 1RCXB 3HSDA 1C0GA 1ITGA 4ZLLA 2DXDA 2HQFA 4X5VA 1GT8A 2PFUA 2P1JA 5JRTA 2E5SA 4CJ3A 4BRAA 3UMCA 3ILJA 2LKZA 2FMPA 1LW2B 1N61A 3A3NB 2MQLA 4CEQA 1UEKA 1OS5A 5L38A 2ASLA 2I38A 3RJFA 3DGPB 1Y5NB 1AQ6A 1SJ1A 1T9WA 1UJ5A 3OGUA 2FLLA 1TKZA 3DMJA 2FVPA 3RBEA 4U7UK 5JVGQ 4WXWA 3CIZA 4KKOA 3H08A 4XH1A 3FMBA 4DUYK 1QVGM 3HPGA 3C5GA 2ZITA 1TUUA 5IQQA 4DV6F 1S76D 1RQ0A 3HSGA 2ZH7A 3NGKA 1DLOA 1YJNN 5BN8A 4YN3B 3KKFA 3R5BA 4NX9A 3ZZPA 5FDLB 2DNMA 3AO1A 2HFOA 1TK5A 1XEZA 3ZT1A 2OD4A 4HT5A 1EKRA 4C80A 1RLCL 3PXGa 1X5PA 8ICSA 4O23A 3DRYA 4MT1A 4NZ6A 2BW7A 2FD2A 3C46A 2A2CA 4DR6K 4NLKA 2ILYA 1ZQNA 4L3QA 2IHR1 4Z6FA 1BDGA 2VOOA 1S4EA 4YR2A 1FDAA 4PG4A 1BXNA 1T44A 2JJ4D 2X6SA 1TZ0A 1OO0B 5KG6A 2BM1A 2APOA 4FPIA 4PQUA 2PD1A 2XNQA 4XO0A 3CCLS 3BS5A 3EUNA 1WKJA 5A0YB 2ZIVA 1OIAA 3T79A 3K5PA 2ALZA 3AVNA 3PW5A 4MYUA 3NS7B 4EIAA 3AAQA 2K8BB 3PMLA 2G2OA 3BH6B 4UF4A 3MD1A 3E0FA 1S5ZA 1HNWJ 1JNRB 3A12A 2B6AA 4WQ5C 2CNNB 3KLEB 4OJRA 2H5IB 4CE9A 1DRGA 4FVMA 4JUZA 2PMZC 2K8AA 4WK3A 3GV5B 3NNCA 4TU8A 5CYQA 2XLKA 1N34K 2ESEA 5HP4A 1KAXA 2R8JA 2PFQA 4JI1F 4JI5J 3JYTB 4OI2A 3ZTOA 3Q8MA 3W61A 1XO0A 2RH3A 4LH5A 2R7UA 4FWSA 2QYCA 2GO8A 1T11A 1ULRA 4BRNA 5J1EA 2KL8A 2NCKL 4CYUA 2D3OR 3R3TA 3BJYA 3JQJA 4Z0UA 3OFHA 4EP4A 3MXIA 3ZC4A 5MLCV 3OTQA 2BW2A 5AQWA 4CJWA 2IC3A 2Q1NA 2LU1A 2VFRA 8ICFA 3IO1A 2RVJA 2MMYA 2W42A 2Q31A 3ZYYX 3C16B 2BPFA 1R27B 4FZVA 1HQEB 2PSZA 1U7LA 4YUDA 4BDZA 5D46A 3AJ2A 1EQYA 3EXCX 2E4LA 1Q8BA 4M7XA 2B3TB 2UVVA 2ZIXB 2J7UA 4WFNQ 3W0LA 5KFUA 1FJGF 4BBYA 1RYUA 2WF8A 1ZXIA 1KR4A 1RT2B 4OI0A 5BN9A 4DR2J 5LL6Z 1Z2ZA 6AT1B 5M2UA 5HRSA 3LDSA 4CNZA 2BJDA 2P9PA 3CJ2A 1FD2A 2HK2A 4P2MA 1LWFA 5SWMA 4LF7K 3KD5E 2RHSB 1ZAVA 5HO4A 3N97B 1YBTA 3PYEA 2MGZB 2UU9J 3GIMA 4MKAA 4JI7F 4JI2J 1T6DA 1CJTA 3GYGA 1S48A 1N5TA 1C4AA 4QZ8A 2AJ4A 4J9SA 2VYPA 1X9JA 4E19A 2Y9HA 3Q8LA 4YOYA 1RT3A 2FTRA 3OVSA 5D4BA 3T6BA 4EO6A 1YJVA 1JLBA 2DYAA 2KZ3A 5J0RA 4IFVB 4IC9A 3M4XA 1VSFA 5L1JA 1X0PA 4A62A 4J2AA 1Z3EB 4MFBA 4I2FA 1F0MA 1XC3A 2YNFA 1JKHB 5K8PA 5KFJA 4JKGB 2VFUA 2C2NA 3CWJA 4ZN1A 4WFBL 1LAWA 1JCGA 3TSQA 4OYAA 2Z2YB 4OHXA 2HVDA 2MY8A 3VCDA 4LD0A 3J80U 2F8SA 2ZXHA 3LQVA 3HZGA 3KLFA 1YRTA 1LW0A 4TYAA 1KLNA 3P6YC 1Q1KA 2WONA 2OTJS 1ZQOA 5EWEA 1RABB 4P7TA 1SC6A 4W4MA 2ZJRL 4JMUA 4I2IA 3KLHB 3RTVA 3C23A 3HHLC 5FLXU 5KT4A 2ZC3A 1VQNN 4UW9A 5ETQA 2RPIA 4DR4K 2G0IA 3HFKA 2CXYA 2XYHB 3T3FA 4USMA 1MN7A 2JGUA 3J7A1 1SS6A 1HFEL 2KIVA 5J0PA 1S1TA 3FFIA 3PDNA 4DUZF 1BO5O 4DG1B 4HUEA 2LU2A 3BQTA 3GSIA 3PRDA 4E1JA 5HROB 3KHGA 1RACB 3V9UA 5IOLA 4ACOA 5L46A 4BS2A 1UVKA 4I2PB 2RE2A 4C1NK 1BGXT 4KMUA 2F4VK 3DN9A 1N5WA 1EO1A 4PJ0U 1T05B 1PGZA 4Y2UA 4LFAF 2WOMB 4IOAQ 3EL2A 4QZBA 5HLFA 3WNFA 5KAFU 8ICOA 3QT7A 3IDHA 2U2FA 3D6TB 4CJQA 3V81A 4F0MA 2VG7A 2AJ1A 2YKNB 2FC0A 3M30A 2NRHA 1V3RA 1N6QB 2FJWA 3Q8VA 3D2EB 3ZCMA 5J0OA 2V69A 3TJ8A 4ZCIA 1SZHA 1NNEA 2BGWA 3MAAB 2BMBA 2BCUA 3HD2A 5FRNA 3C2KA 3CMAS 3IWLA 3MAHA 4PRFA 1WHXA 1DK2A 4N7TA 3JSBA 3SIPB 5IT9O 2QC3A 1RWKB 3ZDCA 4M5JA 3M2RB 3PV8A 1HBNB 1IBKF 3A13A 4JKDA 4ILHA 4YB5A 1QVFM 2P9GA 2CGKA 5ELZA 1E6YB 5ALYA 4DCJB 3JAMU 2GMLA 4Q2LA 2HSTA 1WSHA 1IBLK 3L95X 4CHOA 1YITN 2DGOA 1N36K 1TUGB 4C0HA 3UE5A 2FXUA 1XNRJ 4GVLA 2E9RX 1LVHA 4F02A 4JD2B 3CCVN 3VTIA 1UZDA 4DV5K 1WF0A 2GHPA 4QYZK 3OJUA 2RMLA 3LM2A 1S1XB 2LMRA 1U47A 3Q2TC 3TP2A 4BROA 5DK5A 2ZWOA 4ECXA 3CJ5A 4YHHJ 2XSJA 4BC5A 1JRPA 3G82A 3U1NA 4NL5A 1IV0A 1D8LA 1N5YB 4I2AA 4FJIA 3G96A 1CULA 4RBVA 4BR7A 1JLEB 3SD7A 4NV0A 5T7LB 5AQSA 4UAWA 4C3KA 2YX8A 4K7QA 3T1YJ 2IM1A 7FDRA 3GJQB 4CO4A 1BPBA 1RM6C 2DNQA 3MCOA 2KD1A 4LBIA 3QJJA 3VGTA 1VBXA 1PVQA 2HIQA 5AJ3F 1U1NA 4CFDA 1NLKL 2M9NA 4F2SA 3K1ZA 2VJ5A 2E88A 2KHVA 3U3YA 5D0RA 4QNLA 1WSVA 2IBOA 3FZFA 3M7DA 4U67Q 3IGVA 4CJRA 1K9MO 4OI6A 4OYPA 3HJEA 3CXCR 3VQ7A 1RBVA 3LDLA 2K06A 4KHPJ 2GVZA 3SUNA 3A0HU 1IKXA 2HNZA 2FMQA 1NHVA 1SV5B 1VBYA 2B5JB 2XLIA 2YJFA 3G8QA 2RKIA 1FWKA 4K8RA 1VS3A 4DF4A 3V1QA 2E6MA 5ALJA 4C4SA 3UD3P 2P9IB 4DV2F 3J7ZO 3MGIA 4P72A 2VBYA 3AO2A 4M5GA 2FHJD 3LPUA 2UXCF 4J9NA 2ASJA 2XMWA 3GU0A 2ZEJA 1RT7B 2LYVA 3SUOA 2MQNA 2YBVA 4OJGA 3MXHP 1WTBA 1O1WA 2F8LA 4AYBD 3FZMA 2HS4A 2VF3A 3FQLA 5CY4A 3LL3A 4DV4K 4KHUA 1TYQB 1MMLA 3ZT0A 4C4TA 1WCLA 3IA0A 5KFSA 5G5HA 3KWIA 5C2GA 4C8MA 4K4HA 2VFSA 1BVSA 3K57A 5GAHP 4EEKA 5HNKA 4OLBA 1CJVA 1PKUA 4JP8A 1KAYA 3ZTRA 1T9VA 4MK9A 4QZ9A 2E66A 5G4DA 4USAA 5KFNA 4DV3K 3AVHA 5HATA 2YQ3A 4UAUA 1HHSA 3DOMA 2CWKA 5KGWA 1DTQB 2QFJA 4ZITA 3JSMB 2QM1A 4B9VA 4I6MA 4DR3F 1DKGD 3Q86A 1VR6A 5E3CA 3GFZA 2HURA 4P4PA 2DGTA 2UUBF 1T6CA 1Y5LB 1KBRA 1SKWA 4GLXA 2JWNA 1Y00A 3SNNA 4RCHA 1RHRB 4QJFB 3C19A 2V94A 2AYGA 4LF5J 2KI2A 3J7YP 3H1VX 4CGFA 2QLTA 4U7CA 4C23A 5AK3A 3D0HE 1IR1A 1JLCB 2H5EA 1WSEA 4PXEA 4Q8EA 2G4BA 5ETRA 2XMUA 1IQTA 1YJNS 2H3FA 1N5XA 3M8RA 4LFBF 3SQ1A 4LSLB 4F2RA 1ZD3A 2ZKTA 2OTLS 4KLEA 1FRHA 2DKOB 1GQEA 1H72C 1KBUA 1PYTA 1Z05A 3NDKA 1A0OB 1HNZJ 4CJKA 5CHIA 3QRPA 1UT8A 3HM9A 1MMDA 3OUYB 2XGQA 4IJAA 1FXDA 5D4NA 5IIIA 1K1QA 5CCLA 3NGIA 3V6DA 2RHKA 1ZAWA 2HYIB 4ZVGA 4YY3J 2F3JA 4W5QA 3TWZA 5B0FA 4DU3A 4RTFD 2V67A 2XO6A 3AQFA 1TP7A 5EOYA 4O5CA 1NK5A 4YDDB 4UB5A 3NF9A 2ZH2A 4K8ZA 4UOHA 7ICNA 4U9RA 3K5LA 1K6YA 4O4GA 2JSXA 3WNEA 4NM2A 1FFWB 3DRRA 4IKFA 4OJ1A 1PJ5A 4DFKA 4O3MA 1BHLA 5A2QO 3CCQN 3CD7A 5AZIA 5AQMA 6FD1A 4URGA 3TVYA 2P2CB 2QTDA 1P90A 3ELHA 2FJ6A 4FJ8A 1WWUA 3M2UB 4MLEA 4IXCA 3I8DA 3T1HK 3I9V9 4BRLA 4RPXA 3DDHA 3KK1A 2W3RA 1NJIT 4MEXA 4CZFA 3VZIA 5I42A 3RJIA 1KAZA 3QUBA 5F1XA 3OV7A 2HHQA 3MUVP 1BLUA 2BRKA 1F0XA 2NO4A 2IFXA 2QA1A 3UXNA 4YMEA 5K14B 3C28A 5AE1A 3OR1B 5HMXA 3SFGA 9ICWA 3EN9A 3OTOF 1GLFO 3DWLA 4HR2A 4J37A 3MGVA 7FD1A 3QFPA 2H65B 1X9XA 3QFUA 4NE9C 3EZ5A 4P0PB 7ICPA 2A6MA 5CZXA 4FJNA 4ECYA 2ZTCA 3TR8A 1V85A 4C8OA 3DRSA 4P7VA 2HZCA 4FO6A 4Q45A 1ZQCA 2IIHA 1QQMA 2A5XA 4CEBA 3KJVA 5LT5A 4I64A 4CZHA 3FZHA 5DO2A 1MA7A 2YX1A 5D15A 2X1AA 2HNDA 2GC8A 2R7OA 3FUYA 2Z1GA 1G7CB 1NB2A 1VDHA 5DDMA 2L9DA 3SJJA 2BANA 2VBXA 4F36A 1ZQZA 1EP4B 4KX5A 4LF1A 4EZ9A 3A8KA 5B0DA 2GV1A 3R8EA 1YX2A 1MQ2A 1T8EA 4HEA9 4CF0A 2AX0A 3I32A 3QERA 2VKRA 1SKSA 2VDIA 4EBEA 3OSPA 3H8MA 3ZDBA 4Y2YA 1BL3A 3J7AN 4WCEQ 5ALVA 2DHSA 5T41A 3ZSOA 2XMMA 5KFZA 2I0XA 4PZVA 2VC1A 1KWMA 4ECRA 3BYRA 4F71A 5EE1A 4OZ0A 3TWHA 1PC4A 4NY8A 2QN6B 3FEZA 3V2UC 3RUBL 3AXKA 4P4OA 1COKA 3C94A 1Q86T 1CRXA 3R6GB 2DH7A 2KKZA 1VQNS 5AM2A 2FLNA 1LXJA 7ICTA 5KFIA 4WE1A 4OFZA 3W2VA 2ZH6A 1Q4RA 4ELTA 2RD5C 1Y7PA 2EBGA 4K4YA 2W4DA 2VKZG 2BDPA 5E33A 2W55A 4PWWA 3KIOA 1VJ5A 1BUXA 3KZIU 3RB0A 2BACA 3GOIA 2B7CB 1ZJNA 3ONQA 1HEKA 1NJXA 3DLHA 4PPZA 3WDOA 1TL1A 4F4WA 1GOAA 5KL8B 3N6LA 3VWSA 4ZCLA 4O3PA 2DH9A 4DI6A 1ZQVA 3RB3A 3UVJB 9ICVA 2MZQA 4LIRA 3HJFA 2GCFA 1B9DA 3CYMA 3D5MA 4WYLA 3MMCA 2OPRB 3EKUA 5FRMA 7ICKA 1BQNB 4GO5X 5A2QY 2PYLA 3W62A 3IG5A 2Z56B 4IG0B 4X62J 8ICQA 5AM5A 4N41A 2FHMA 7ICIA 1K47A 5J2HA 4WBFA 2F9DA 1CC8A 4H0PA 3K8WA 4P52A 2O8EB 1L5UA 2D9OA 1U2VB 1NZAA 2QI2A 4J2DA 4CI0B 5KFQA 2OIHA 1SGGA 3HHDA 2GVDB 4H0VB 3TA1A 1T9XA 1GX5A 2M88A 4KHWA 5DDRC 4JK1A 5A76A 2ZIWB 5BR8J 5HBMB 3KD1E 2V8HA 4Z7CA 3LP0B 4NYNA 4KLIA 3OS2A 3MCMA 3AL0B 2IA0A 5HN0A 3M9NB 3KKRA 2HRUA 4UATA 3MM7B 3DC2A 1L3UA 3AD9C 4NZ7A 2HMIA 4LFCJ 4EYHB 4PL7A 2YNIB 2PO4A 2A41A 3VGLA 4J9QA 5GIPA 4FWQA 5HL7L 3MZIA 3CIMA 4HTJA 3M8QA 2GV9A 2JVRA 3QEPA 4WFBQ 4EX7A 1FDNA 3OLBA 2VJ4A 2L41A 1QTNB 2NXNA 1NMDA 1V3SA 5B0AA 4DCPB 3B6OA 2AEFA 2FMSA 1RTIB 3D6RA 3QBXA 1F44A 2BE9B 3OR2A 2F7VA 5ADXH 4M9LA 2J9DE 3HT0A 3WU2U 4UOFA 3SSSA 1ZBFA 3AD8C 2UV8A 3BR9A 2ZJRQ 4G1QB 3HSZA 1WC1A 2LCWA 1HBMA 2QARA 2X51A 4EUVA 9ICRA 4I2QB 1HQUB 4IG3B 1Z00A 4JS5A 4I6YA 3PW0A 2CPZA 2LA6A 3B82A 4BVOA 5J2DA 4F0HA 4ZA1A 3A8YA 2JFKA 1Q3UA 2M3DA 2LMIA 4O3RA 1PJ6A 3ZEUA 3MEGB 2Q97A 3HZEA 5AIAA 2DTJA 2Z0GA 4HUGA 1N32K 1U2RA 4K8XA 4IYQA 3H59A 3S01A 1SJFA 1LWEB 3THXB 1EXNA 2UYTA 4C8YA 1UVMA 4HL9A 4J9VA 1QY7A 2MU2A 2BPGA 2ZFHA 2AEMA 3OXFA 4PZNA 5AK4A 4FXVA 3V9WA 2F9JA 3LANA 4DR1F 4M6WB 2A1RA 4CNYA 4K4VA 4K4XA 3GDQA 4MIBA 2K4IA 2O01C 1S6PA 2WAQF 4FF3A 2M2BA 3N7SC 2M9KA 3P83D 1GFWB 5CB1A 3O3HA 1EXQA 2MZJA 4GXJA 1MWMA 4DZ6A 3EVOA 3O0FA 1WHVA 1EETA 3KHYA 1FD8A 3SQGA 3NVWA 1PAEX 1K44A 2DNPA 8ATCB 1AA1B 3ZETB 2HQDA 4LMZA 4QCLA 1B4FA 4B9UA 1N5QA 3VEWA 1FNOA 1MROA 5HMYA 5AQUA 4UB1A 2V4JA 3N5BA 2I1RA 4XA5A 1YZ6A 3DOLA 1BI4B 3QEAZ 3AEVA 3M6VA 3HBTA 2PFOA 2HFVA 4A4JA 3OW2M 3ISDA 1J9AA 2KYZA 1UW9A 1X3MA 2KN7A 3UKUA 3ISND 4FLUA 3KTQA 1Z1VA 2R8HA 3MMJA 3KOAA 3CCRN 4ICAA 4NCGB 1U1OA 2BA9A 9ICQA 4LC9B 3MGHA 1NU4A 3I5CA 2IAJB 1S99A 1G2EA 4H03B 1MWQA 5F2RA 4DSEA 5H9EJ 4J9LA 2KT3A 4DUYF 3CJ7A 1PAUB 3JPNA 4JS4A 1KQKA 1OY8A 3CDEA 3TW0A 3C7NA 2UXDF 3DLKA 4CZLA 4ZPBA 4DPUA 1YBAA 4FJ5A 1Y11A 1KQSR 3LF0A 2CNKB 3OYMA 2MSNA 1XSLA 3Q22A 4IDKB 4LSZB 3C6HA 1RDCA 3U7JA 2C28A 4IQMA 1CG2A 3QIOA 4R5PB 1W2BM 3FDSA 3Q8KA 3GFYA 1UPMB 1XIQA 2LKYA 3SAFA 1FWPA 2OPPA 1NOYA 1CZAN 2VONA 4WQ4A 4MKVA 3AY0A 1WSIA 3P4IA 3RMDA 2G8FA 3AT1B 3CD5A 1HNWK 1VRTB 1SWWA 1X4FA 3M32A 2W40A 3ZZ0A 3C0BA 9ICXA 3ZTPA 2DY1A 3MWBA 4YMOA 4P0QA 5F0UA 4U96A 2G8UA 4GV9A 2O8FA 1FVQA 1H1VA 1ZQAA 4JI5K 3W9JA 4NEYA 3OL8A 2JH3A 1OW5A 1SJ4P 3B78A 5BYSA 5AKLA 4NO7A 3VQTA 1X66A 1RBRA 3PIPL 2PI5A 4M0AA 8ICYA 1RA7A 4H4MB 1N34F 4RKUC 2V34A 3BGLA 2DVIA 3SBMA 5LSOA 1T9YA 4FM2A 2K8CB 3K2YA 4C1NI 3O9QA 4DSKA 4DV1J 2XY7A 2IVFB 1FERA 3PW4A 4C0BA 4TUQA 4KHSA 2GMHA 3GYNA 1H98A 1EB0A 3Q23A 2CWXA 3EWAA 4Y00A 3WKEA 4E2FB 4YDUA 3UXPA 3JPOA 2NRZA 1V6HA 4BDYA 2XBPA 4DR2K 1C1CB 3H8YA 3CCQS 4CBXA 4CRXA 4CW7B 1P6TA 2M5YA 4FVCA 4Z2XA 3CCEN 3ZDEA 4QZGA 3PX4A 1ZQTA 3NGUA 1RBAA 3CDWA 2AJFE 4G9BA 4FJMA 2RUGA 4H4OA 1E6VB 1VQ8N 2IS3A 4F0KA 2F7TA 2UU9K 1GNKA 5ALPA 4JI2K 4YS2A 1R8BA 2KH9A 1HKCA 3O4WA 4PUOA 2AW0A 1L7MA 4CGGA 2ZBQA 1JI7A 3UXOA 3O9SA 2OYQA 4ZJQA 5GADU 1EHWA 4BRDA 1U0HB 4XDDA 3NMAA 3ULEA 3C29A 3MEDA 4OMFG 4AE5A 3O2IA 3AVLA 1DTTB 1NO8A 2I5JA 2OFGX 2OI2A 2UUTA 1TV6A 5HAOA 2RRAA 2J8SA 2F5GA 4CTAA 4M45A 4NLRA 4UY8T 4ED2A 3HILA 2VJUA 1HBUA 8ICMA 1YJRA 1KEJA 5E0OA 4CH1A 3UN5A 1FKOB 3PY8A 3SUQA 4AYBC 4CIFA 3R1HA 2AQ0A 3JSRA 2YX7A 2ZUBA 2Z30B 2B4OA 4DV7F 4LF9F 1DGKN 3NOGA 4GVMA 5AI6A 2VFTA 2GGPB 4K4TA 3OFGA 2CZVC 4KLUA 3BSAA 5LY3A 4NYPA 2BPCA 1RT1A 2VC0A 3ZFVA 3CSKA 1D3WA 1NNDA 2D69A 1V3ZA 2EAPA 1BOTO 2BTFA 1X8DA 2J8AA 2QLWA 4PKIA 2I1QA 1TL3B 3ITHA 3ICLA 4LR8A 4GC6A 2VIHA 1KXPA 1L6NA 2NNWA 2AGPA 5GAEU 1Q81T 1UVJA 4KB1A 1S77D 2CJ9A 1ASVA 2C3YA 2KJWA 3OYDA 3E01B 4CK1A 4ZN3A 2EANA 5EWGA 1CI4A 5HR6A 1KHVA 4UARA 4I6AA 5J2GA 3H0RB 2DKZA 5ETLA 3FSIA 5KFKA 1K0VA 2R8GA 1L3KA 3AVGA 3PYFA 5AICA 2R18A 3ENAA 4WU3A 2VG5A 9ICCA 1GAOA 2DHHA 2HAFA 1OUQA 5EDWA 3H1QA 5KFBA 1U09A 1B99A 1UWBB 1DBDA 3CJ0A 4DQQA 1RAJA 1C6VA 1W7AA 2HMXA 4YB7A 1GO3F 1XNQJ 2EAMA 2ZHBA 3DNCA 4CJUA 1XQIA 2F4VF 5EN1A 2DFEA 5LM7E 4FK2A 3DDKA 2Y0SF 2KOBA 3CCMS 2BCRA 1NMEB 3MPDA 3ZSYA 4RQ4A 4OZ3A 2A1AA 4JB8B 3T41A 3OL9A 2MLXA 1VOMA 4HH0A 1NU0A 4ELUA 1VLBA 4DOAA 4CLTA 2MRLA 4A59A 5EE3A 3RU0A 3NF6A 3A2FA 8ICIA 4ED4A 2WHEA 4UAZA 3S3MA 4NI2B 3PFOA 4BG9A 2OA8A 8ICXA 5J2NA 7ICFA 5ALUA 4O44B 3LUYA 3C5FA 5B7WA 2BCVA 3RZAA 1ZM3A 2CYYA 2HF3A 1WTFA 5CD4A 1ZQGA 2ZBCA 4F4YA 4FS2A 1XU4A 4OLOA 1QSLA 3AN1A 2KNJA 3ZI4A 2NZCA 2VL1A 1I51B 4YDUC 1Q8KA 5J2MA 2EFNA 2JEGA 1H74A 3FJ2A 5LMUJ 4IJNA 2ZH4A 2F2AB 4OHYA 1XBWA 1XNRK 4UB8U 4G1IA 1HKGA 1GTEA 1YT3A 3KG4A 1TGOA 4DPOA 5AZJA 3C66A 5BPMA 4OX9F 3NCPA 1Q95G 1OWXA 4NXMJ 4E7IA 3NCRA 4YHHK 4QZDA 3ETRA 1HIWA 3L2QA 1RZTA 5KFAA 4NM1A 1NDLA 3CNHA 4BE2A 7ICEA 1NGIA 1MDUB 1KQFB 5HANA 2UXBJ 1M5HA 2PXIA 3T1YK 4QIWD 1FI4A 3RMAA 1MN9A 4KHMA 3C6AA 2K8GA 2JL9A 4QIVA 4Q8FA 2IYIA 2N82B 4DTPA 4BE0A 4FLTA 5AM1A 2V4RA 3GONA 2CPDA 1C0TB 1AZSA 3UW1A 3K0JA 4KLHA 2IRYA 3C1ZA 3R6LB 3IWXA 2WK4A 1RYSA 1FK9B 3F2DA 4BGDA 3PFEA 2CQCA 4ZVFA 1W25A 4EBCA 1WAFA 5AE3A 2ZTEA 2WRMA 4X4UA 2ZH1A 4KHPK 3DXKB 4DQRA 4Z6CA 2A1JB 2CJXB 4I2CA 5HR7A 4L76A 4RW7A 3DJCA 1YJ9N 1DT9A 2AZ1A 1U8WA 1IG9A 3RSEB 3MECA 4FNHA 2F77X 3BBCA 1RWVB 3I0SA 3JS9A 3MM8A 2XM3A 3TANA 3RYLA 1X9MA 4GVBA 4X64J 4MFAA 4YNQA 3ILOA 5JVHQ 2C2OB 2VHGA 1R0CB 1P8ZA 1L7NA 4U8YA 3UR0A 1ESVA 1TU0B 4GW6A 2AD9A 5KFYA 2DNHA 4E1NA 3WK4A 2RF2A 1W9HA 1RT5A 3C6TB 3P45B 3ED5A 3ORYA 1F5BA 3WXMB 2EI5A 2EQYA 4F91B 2QZ8A 1M5KC 2DB1A 4FF1A 2HFZA 3PW7A 1HJOA 2HAIA 5DB6A 2W3SA 5A8WB 5D0HA 4W5TA 1QQ6A 4LF6F 4C8ZA 1OJ4A 1DY3A 2ZH9A 4CCHA 5K4LA 1Q53A 1VI7A 2DIVA 2CZ4A 9ICEA 3CQYA 2D3ZA 2YWGA 2KVIA 3L09A 3VN5A 2D3UA 4B6JA 1SQEA 4DX7A 3N28A 5H2FU 1PILA 3IHQB 4C4WA 3MPWA 4Y2MA 3UE2A 1Y5IB 3Q8RB 4GVEA 1S1UA 2YPZA 1SIWB 3QRRA 2E2OA 1ZZNA 1D8BA 4QR1A 3KG1A 2KHDA 1UPPA 2Q6BA 3AU2A 2E7XA 3R7SB 1ZQPA 4OJHA 1SL2A 2RDDA 3TSUA 4CBWA 4YOEA 1HPZA 3M9OB 1FRKA 3DMJB 5HL7Q 3QEIA 1RE1B 4KGMA 4KKOB 3HOTA 1SWVA 4DKWA 2BXJA 3CD0A 4CDIA 4LF5K 4B3OB 5L9XA 1DLOB 2B9YA 3NBPA 2R3VA 1OSDA 3CCRS 1DRZA 3DXBA 1R0AA 3IBPA 1DZ5A 3D68A 2HB5A 5F0XA 1YLXA 5BPLA 5DG7A 2A2DA 4CLKA 3B8AX 3IGNA 2DUYA 1JLGA 1M6YA 5F0WA 3RH5A 5DGAA 3TSPA 5BXIA 3DAWA 3BQ7A 3TTFA 4NLCA 1TVRA 1CXUA 3F5AA 4DPXA 4OKJA 4CJVA 4X65J 2F44A 4BCAA 3L0QA 3GB0A 2KN4A 1NGBA 2JOQA 3CMQA 5BYRA 1CZBA 3VERA 3QZ7A 4YY3K 3BS5B 5IM0A 3O08A 2Y1LB 2G07A 1VQLS 1W7WA 2PZSA 2ZIVB 2IOHA 4QJVA 1QSYA 4B3MJ 5DM6L 4M63A 1WOPA 1LKYA 4FLWA 2RRDA 1RBUA 3TUJC 1UKUA 3OYNA 3MCSA 1OVQA 2B6AB 5ALIA 3PIOQ 3FZKA 2DGWA 4A2AA 2HHXA 1NSPA 3AHPA 5CQGA 4DU1A 5CYQB 3WX4A 2QA4G 2HGLA 2CPFA 9ICNA 1YVUA 2DNYA 2BJ8A 3SPYA 3ILIA 2KO1A 1SQFA 4R63A 1HQ2A 5DDOC 1RBLA 2XQCA 4PG6A 3Q2SC 3OBYA 3I87A 1X42A 5J1EB 3IR6B 5C25A 4CYUB 1JMTA 5BRHA 4KH0B 2W2PP 2DHXA 2IC3B 2E5LF 1RHMB 1BC6A 5KFOA 1S22A 3SCLE 5FPEA 1JLAA 5EX3A 3GZFA 3GCWP 1UVIA 4F3OA 4U8VA 3BKTA 4K4IA 3MUTP 1XMQJ 8ICAA 3VTHA 5FPDA 1G15A 4J8FA 2FPLA 4KHQA 5AI5A 5J29A 2IM0A 3PJXA 3HPOA 4J2BA 1X6IA 2HS3A 3K17A 1ZAXA 1SJRA 1YTUA 2E7VA 3D0PA 2P9PB 4DMNA 1CSJA 1LWFB 2KVCA 2YKQA 5D0EA 3HHKA 2QWRA 3H8SA 2ZTDA 3FAHA 3I4PA 4P2FA 1WC0A 3K75D 5EU7A 1X4EA 1CJTB 3WXKA 3AA8A 4FK4A 1C0UA 1VQ8S 1ZOTA 1C2PA 1RT3B 1QQCA 4UTGA 2DGZA 4RL1A 2XHBA 5CWRA 3L3UA 1ZQUA 4JV5J 4KV8A 4BG8A 3GL1A 3OPKA 1VQ4N 1U24A 2YNFB 1VFJA 3RW7A 3R1XA 1J5OA 1SH3A 1P1LA 3NWRA 4AXIA 1BY9A 1UWAA 3TAMB 4S0MA 2CUYA 3WNGA 2I6XA 3VEVA 4GO7X 1NK0A 3H5SA 1IQZA 3UKRA 4ZP9A 3EVWA 2R7VA 3MFHA 3O5TB 1IXRA 1ZH5A 1QD1A 4FLYA 1TKTA 3KLFB 1LW0B 2Y3YA 2NREA 3CD6S 1GLAG 2WONB 3PZPA 1CC7A 9ICGA 3GTYX 1BCMA 3LH2S 3FBFA 4MDBA 4DR7F 3M1FA 5HRRA 2A10A 1FFUA 3ISNC 5HP1B 3NCQA 3MWPA 1B70B 1Y0HA 1RP5A 5HI7A 4PG7A 4NEZA 3GP9A 1OSCA 1XR5A 3QFHA 3M6GA 2H4WB 4TLRA 4X4OA 5LL6d 4ZVHA 1VC6A 2E9TA 5F8LA 1S1TB 2HIYA 3FFIB 2XS5A 5J1PA 1I94K 3PIPQ 1KVJA 3G6XA 1KOHA 2FJDB 1NCLA 4B1XB 3M8PA 4IOCL 4KGVB 3SR6A 1NJZA 3THWA 2W7OA 3HCXA 8ICHA 3GZ7A 2HNYA 4X66F 1H7WA 2FB0A 1C20A 3RGIA 1UA1A 2EDUA 3MM6A 2I6WA 2VFVA 1XWLA 1RCOB 4H0TB 3MR3A 3B4MA 5HLFB 4B1VA 4X62K 3CERA 3Q0AA 2VG7B 3M30B 5DB8A 2XNRA 4KYZA 3K4GA 4MF8A 3O4NA 2QEXN 1P1TA 2F1HA 3EGWB 3VAJA 3CJ8A 4A8OA 2UZAA 5BR8K 1IKYA 1YAGA 3RRHA 1VQ5S 2WW4A 4A8KA 1F6TA 1Q3VA 4I2EA 5B0CA 4W5NA 1BWFO 4M3RA 3DLBA 4JAXA 2ZUCA 3VGSA 3NAEA 2HQ3A 4B3TJ 4N56A 2W9CB 3NMRA 4Q44A 4F5NA 3OTBA 1H2VZ 5E84A 3UD5A 4LFCK 3U26A 1ZJMA 3TZYA 3TUPA 2O8BA 3FBEA 4WF9L 3L2VA 1R59O 3IFEA 4KX3A 2HRYA 3R97A 3UD4P 5AI9A 2YQ1A 5CA7A 2E8MA 4CIEA 3HDSA 3E3XA 4TLQA 2L5YA 3SAHA 2CQPA 4NWBA 4NLVA 4B9TA 2ASDA 3SCXA 3KWMA 2QA4N 1VSHA 5D8HB 2YWEA 2Y0BB 3N0VA 5J0UA 2H54B 2VICA 2XSJB 2V7YA 3ID6A 2CQ3A 3JQKA 3S1TA 2PA3A 3QU7A 4PHEA 2F8KA 3G82B 3UWTA 3AO4A 4K4GA 1WOQA 1QQ7A 1NJIO 1JL1A 1YHQN 1CULB 4FK0A 2Z2LA 5GAHI 3G86A 1WCNA 3E8OA 2ZG6A 5BPCA 2V50A 2FVRA 2IDLA 5M2RA 1HLWA 4R8UA 3H3NO 1BQMA 2K1RA 1FJGJ 2RSQA 5KG1A 2WBNA 4YXJA 4CLFA 5LJVA 4M9HA 2EC2A 2G2YA 3A5NC 2DR6A 4B8CA 1IJEB 1G6BA 2GIQA 3TI0A 4F5RA 2EC0A 4AILC 3J7YI 9ICUA 3CNQP 2G5HB 2R9LA 3NE6A 5DM7Q 1TE2A 2PY5A 2GVZB 1IKXB 2HNZB 2EEYA 1TUVA 4YR3A 4MEYA 2IMWP 4OYMA 1BISA 1PJ7A 4CJPA 2RKIB 1Q7YT 1YJ9S 3ZT4A 2AU0A 1WSFA 2ZVSA 3A3OB 2YNGA 4LRCA 2LYHA 4NL9A 7ICUA 4M9GA 2OH2A 3KLIB 2ZVIA 1S1WA 2OCEA 3IMQJ 3LPYA 3LW5C 1HWKA 5TZVA 1UZHA 3AB4B 1T03A 1HIYA 3VOVA 4HI1A 8ICRA 3AY9A 2FGOA 4Z4CA 3D1QA 2BV3A 4O3OA 4P2HA 4FKXA 5J0TA 3HPHA 1DK3A 2EWHA 3THPA 3L2UA 2OFHX 4O8KA 5FLXO 1WKKA 3KBBA 2NRTA 1RDAA 4E0DA 5GADP 2C3UA 2GBZA 4QOZB 1N8RT 4E89A 4EYIB 2Q66A 4CEDA 1VSDA 1LWXA 1Q86O 4KAIA 4M94A 3GIKA 1C4CA 1U9LA 4DX5A 2AYBA 2HG4A 4CK3A 3LZJA 4JI3K 2KHOA 1Q82T 2C2ZB 1CJVB 2RAQA 5AT1B 3TOQA 3BPDA 2AWZA 1J27A 5GIOA 5J0QA 2P9CA 3OS1A 4QW9A 4DCHA 2FBTA 3TVKA 4DUZJ 5H9EK 4L74A 5EVZA 1SCJB 1GX6A 3DLJA 3V5RA 1TQLA 2KRBA 1VQON 1Q78A 3DOMB 4KLOA 1NSAA 2VH7A 3AGKA 1LWCA 4Y2IA 1K8KB 1A5XA 2MKYA 4I6MB 1RT6A 2YHAA 5JS1A 1T3VA 5E41A 1WG4A 1NKBA 1ZA2B 2OM6A 4DLGA 5CRXA 2ZJQL 3BQ2A 4H5WA 4DFMA 3D2FB 3HX9A 3UMBA 2QG9B 4PWDA 3OXLA 1RU1A 5D4PA 3V1OA 1Z2LA 1EX8A 2FHOB 4LFAJ 3PRVA 5JVGL 1DAXA 1FIQA 4PQAA 2YJEA 1HJRA 1IBMF 3VC8A 3MTKA 2V51B 4YR0A 4KH5A 2QKBA 1RCHA 5GAEP 1CZ9A 1XI1A 3CDUA 5IINA 1PIEA 2NQPA 2QSWA 2AQ4A 4MAKA 3FRZA 1S9FA 5DETA 2YPYA 3KHLA 3Q7CA 4CZMA 1NGAA 4TY8A 1TUYA 2QL7B 2YWWA 3I31A 2ZJPL 2J0QD 1N33F 3NCIA 2EK6A 2JH7A 5L1IA 2XZWA 3R3LA 5DGBA 2E1ZA 3HO1A 4HWIA 3R2DJ 3JAMO 3ULHA 4A8MP 1H2TZ 3TUZC 3DOKA 1HR0J 1HI0P 2ZOFA 3V6DB 3C2MA 9ICSA 2G2ZA 1XMOJ 1RHQB 1AW0A 3GQCA 2K7KA 1RWWB 2ZXIA 4QIWC 3KZXA 1MU2B 4H5RA 5AQJA 4DV1K 2CJAA 3MC1A 2B7BB 1KP6A 2CGLA 4M3WA 4DOBA 4L73A 1LK5A 3RR8A 4ED5A 1KQGB 3UCUP 3MOJB 4O4GB 1M5OC 4U6PA 2CDQA 3D4JA 2WB1F 3I4HX 1RQLA 5IWAK 4OL8A 3BBBA 1JIHA 2EZYA 8ICPA 5AZIB 3P5BP 1MC8A 2W6KA 3SV3A 2PT0A 1FFVA 1NHUA 4PHTX 3FSYA 1WF2A 2JXJA 3UPFA 1N52B 1Y88A 2J6UA 5HMZA 3L6QA 1RGVA 2J76E 3SMSA 4DTOA 2QGFB 5L1MA 2P5OA 2DNKA 1ZPWX 1M5SA 3KK1B 1A6LA 3EE8A 1HUZA 4PKHA 5HVFA 1Z19A 5I42B 2RU9A 3T5JA 4DR2F 1RT4A 2AGOA 1KN5A 3J80Y 4JI0F 3PUFA 3TX8A 1FKPA 1RDWX 1ATNA 3FBBA 4IWVA 3WKBA 2KSOA 5IC4B 2FF6A 3S7RA 5RUBA 5AJ3J 2HGNA 3VEZA 5ALKA 2BJ7A 2DO0A 5FLXY 1SH0A 3O5BA 1X4HA 4RWXA 4YFUA 1R3NA 4GKJF 1Z4OA 1IVZA 1L7PA 2Z57B 3IAYA 3JTPA 1TL5A 2CAJA 2GAHC 3SCKE 3KJVB 4YOVA 3CJQA 4IRCA 5IIMA 1R6VA 1SC3B 4F04B 3CJBA 3U9DA 4M5HA 2XG8A 3KZBA 1YIJN 2HNDB 5BRDA 3KNAA 3UFCX 2NLXA 3NEKA 4ZS6A 2OEKA 4IKAA 2VWBA 1Z1ZA 3GSDA 4DSJA 5C42B 3ENOA 4F4AA 2BANB 2Z7JA 3VGVA 2LBOA 1XQSC 3LZIA 2B4PA 1T3QA 2YX6A 4P9SA 1C1BA 1GMUA 1URJA 3JPQA 5KOWA 1UFKA 1OMSA 1FESA 4JK8A 4DV2J 1ZM9A 1WLJA 5LMNF 1VQ4S 2IHMA 5KT5A 4CLSA 3DLLL 4PEOA 2D41A 4K50A 1X1PA 4BWMA 5T14A 2GHWA 4ANDA 2GFFA 4YXMA 5A6PA 3V6JA 2KVQE 4LVNP 2MZRA 2QLBB 2Q0ZX 3RFAA 2OO4A 5G5GA 3AXMA 3ZZTA 5IFMA 3P1GA 5AFUH 3L4BC 4ID1A 2GQQA 1IR0A 3F2KA 3BZKA 5KFXA 1YK9A 3S3NA 1NKEA 2OHFA 1HKBA 1WC5A 3QINA 1NDPA 1I1GA 2EHGA 3F56A 4WE1B 3DM2A 4CK2A 2DL0A 3CW2C 4EO8A 1XNQK 1X5TA 3VEXA 3NHGA 3U8XA 1J2VA 2MKCA 4BVPA 5ALTA 2PN6A 4CF4A 1QHAA 3BF4A 2K4HA 2EH9A 4C3MA 4E7HA 2XICA 4DR3J 5FDLA 4DV0J 1ZQMA 1NZPA 1RB0A 3TJAA 1TL1B 3FEXB 2UUBJ 4GIBA 3BZQA 2MQ8A 2A0FB 3NVYA 3O80A 2DNNA 4ZOSA 4MJKA 4DMZA 2H3QA 2E8NA 5AI8A 1VHFA 2CGJA 1P8GA 3FK4A 4LSNA 4CFBA 3VAKA 2FVCA 3MMCB 3TR5A 1VLYA 4ICLA 3VCBA 2GQCA 3M3ZA 1ZQLA 1GOBA 3IM9A 4B3RK 2KFYA 4LFBJ 5K9FA 4PAAA 4ECTA 1LCUA 3O1WA 4TXSA 3CPWR 1HUXA 3QSIA 5LMUK 3D28A 4RQMA 1VBZA 4DF8A 2ASPA 4LVSA 4I2GA 3WHIA 4M04A 2PI4A 2HVZA 2QEXS 3TADA 2LYAA 4P2SA 5LSRA 3KLEA 4NXMK 1HLUA 1TUWA 4CD1A 2O67A 4NMLA 3OBWA 3BUZB 4DCOB 2MKSA 2XMTA 3W2WA 1XNRF 3QJLA 2YH0A 1UP1A 2PDAA 4ILJA 5HK4A 4PYDA 3JYTA 3HF5A 4CT9A 4YORA 2HMIB 4MK8A 2OPSB 2UXBK 4OLAA 1JALA 1ZA1B 3DU6A 4USIA 1JLQA 1BNOA 3RH4A 3M8QB 2CPEA 3F9MA 2P6SA 3WXIA 3TJ9A 2WAQD 4DLEA 2NYHA 1XHXA 2L08A 4AQYF 3BPSP 3OR2B 4Y28C 3RMCA 2G09A 4M3TA 1Z25A 4ZTFA 1B92A 9ICTA 3LP2A 2W11A 2GZOA 1IKWA 1YG0A 4EFHA 2Q3PA 3LYSA 4IFYA 4C97A 3FR0A 4AM6A 3CJRA 4CLYA 1RSCA 1HBMB 2V68A 2QARB 5M1FA 1O8BA 2W25A 1F1BB 1GMWA 4FLXA 1Z00B 1CJKA 4WK1A 3QU4A 4A8SA 1YHQS 4XH5A 1VQKN 5HJYA 3KFUF 1WSJA 3CCUS 4PABA 3ZSZA 2LI6A 1D8ZA 4LBHA 1OXJA 1HWJA 3M6KA 3LK9A 4N77A 5EOZA 3ZEUB 2FC9A 2DBYA 4I1TA 2MQQA 5FD1A 2QKQA 4F4KA 3WQTA 4EP5A 2D0BA 2J9CA 3OTOJ 1A76A 4X64K 4HHTA 4DBQA 5B0BA 5AK5A 1T3NA 3M8SA 4UY8O 1JK9B 1FRMA 3WIUA 2J0SD 2LEAA 4IOCQ 4QZIA 2R7RA 3MR7A 3M2VB 3M05A 3PYGA 1Y9OA 3O6WA 1AXQA 3HT3A 4BGAA 3GJSB 3P38A 1S6PB 5ETOA 2E5HA 4LF4F 3LDPA 3MDCA 4N5SA 4O3QA 4KGZB 2FF3B 3NGRA 3CM6A 3RBZA 4RUCA 4J91A 5B66U 3D3BJ 5F8HA 5AKHA 2QYGA 4ANEA 4CZIA 4JHDA 4CESA 5KTQA 2XCPA 1EETB 4ECZA 3BKFA 4TY9A 1GH8A 3SQGB 3H3OB 4KBOA 2PAVA 1JJ4A 3KOOA 2R7WA 3WEEA 1DFDA 1Q81O 3VQPA 3FEYB 4JKBA 4WXOA 4FZLA 1MROB 1V97A 1G1XA 9ICHA 1R89A 1WN7A 3VQQA 4AHTA 3SEIA 4OZ2A 1SZ2A 2QKKA 3QSYB 3S41A 3E2EA 4C11A 2WF7A 4CZGA 1AFIA 4RNHA 4KPYA 2MZ1A 4ILLA 2VD3A 3DOLB 2J9DA 4WF9Q 4PH5A 3CETA 3J8AA 1XHZA 2VGMA 3OBIA 2XYPB 4C9DA 5HROA 4WZQA 4ILMA 3UKUB 3VETA 3OYBA 2E2NA 3L9ZA 2JDJA 2GWSA 3D1HA 3T5LA 2EKYA 2E1RA 4ZK7M 1NXIA 5A8KA 4QU7A 3BO4A 3DHWC 2J0WA 4RQNA 4Z4FA 2XHCA 3C7NB 2XI3A 3DLKB 4BWJA 2WOMA 1VQOS 4KH6A 3Q89A 4CZEA 5AHXA 1RDBA 3FNNA 2CQ0A 4W98A 3O3LA 1ZQEA 3B8HA 1NUEA 3RJEA 4X65K 1YWXA 1O51A 2ALYB 1Z26A 9ICLA 3D2EA 5BYQA 3BN4A 3KJNB 1ZQJA 1XN9A 2FI1A 3MD3A 4FZYA 4QS7A 3I55N 3MAAA 4UASA 5F9LA 1RQNA 4ERDA 3EZWA 2VOPA 4NJ8A 2J7KA 3A5OC 3IG8A 2OPPB 1YJTA 4B3MK 1U6FA 2D3DA 2O66A 3NMUA 5KFDA 4X4SA 4YY3F 4W92B 3D2QA 4ANCA 1TKDA 4NLGA 3QYYA 4Z37A 4YG2A 2O8FB 2HHHK 2PIIA 2COLA 1VHXA 4F25A 3SQ4A 2BEFA 4X4NA 2OMOA 1EZZB 3NRWA 1IJJA 3WK8A 3FYHA 2QWQA 3BSNA 1SB3C 2OZMA 3MMAB 2YHYA 3KMSA 2KJ8A 3EWGA 2HGMA 4CDGA 2D0OA 2BJ3A 4ECQA 4BC7A 2ATLA 1XMQK 4KGKA 1RFQA 2GEMA 1WC3A 2BUNA 4IUFA 3DEEA 1KFSA 2KVSA 3K59A 3O6QA 1JXEA 2DGXA 2A6AA 4DWIA 1Y3JA 2CNOB 5AXMA 5ETNA 2OANA 2I7NA 4RW6A 2FYXA 3THVA 1Q8LA 3BN7A 2BUPA 4H4OB 2NUHA 1KLMA 2V0NA 2QWMA 1WUUA 2GJ2A 3R1LA 3FGVA 3ZTQA 3L2WA 1HNIA 3ISZA 4F3MA 2JVOA 2HHSA 4PUOB 2XULA 5G0RA 2ZBPA 3NF8A 2GMJA 1N88A 3KVGA 2AXTU 3ULEB 4FZXC 3MOZA 1IM6A 3KUGA 5JS2A 5C10A 3NVKA 2Z1HA 3UB5A 3ZNJ1 2I5JB 4JV5K 1X9WA 1TV6B 1ZQXA 2F9WA 3QAEA 4K0KF 1X4DA 2RLTA 3VA3A 4CFAA 5AKKA 4ZCKA 2ZJQQ 2B9XA 2O4GA 1OVYA 1Z1BA 1HHQA 2IOCA 4NMXA 1I3OB 3HOSA 2NO5A 1HBUB 1NPKA 4DR1J 1ZPVA 4KTWA 4WZMA 1V38A 2WF9A 3WKAA 2JEIA 1S6OA 2DEIA 2Y0SD 5KT7A 2W54A 4OJ6A 1EAYC 1RDDA 2CIMA 3I9ZA 3UNYA 4ZCMA 1YBUA 3UPQA 3HHLA 4ECSA 1RT1B 3J81U 1BNPA 2ZH8A 3NS1A 3Q8QB 2ZJPQ 1WHWA 1QCKA 3IXQA 5AQYA 3ITHB 2HVEA 2FC8A 4C48A 4ZP7A 2DR9A 3V4MA 3B9JA 1F2GA 4FJ9A 4OX7A 3MEEA 2VG6A 4CIOA 3CUNA 1S72N 1TL7A 1I94F 4WCEL 2HW3A 2ES6A 3J7Z5 4YD1A 1DTQA 1QS4A 1RJJA 4M2YA 4ZDNA 4Q0BA 4R25A 3R9KA 1N4LA 3KKAC 5J2KA 1ZBIA 4ZPVR 2VU5A 2PFPA 1VSKA 4Z6EA 4UT4A 1B7FA 1SUQA 4OPHA 3NTUA 3CDAA 2UXDJ 1TKXA 5IXUA 2O3DA 5I3QA 3CXCM 3VQCA 2DCUB 2E1CA 4LH4A 5LSLA 1AT1B 3D2WA 3BGFA 4F92B 2Z4PA 2KHQA 4YP3A 5GAGU 4PHAA 1KHWA 1D8YA 4CFCA 4J9KA 3N6MA 3OYHA 2LQJA 3EDRB 4FL9A 2FY1A 3GR1A 4ZPWR 2V2VA 1NK8A 3THYA 5DZ6A 4GKKF 3EX7B 4B3TK 3G4SN 5J2NB 2F9TA 2UUAF 4FLVA 1XC9A 1UQVA 3OUYA 2O6KA 2QX0A 2W9AA 2JFDA 1K8AT 3OY9A 2MTLA 3H20A 3LGHA 3NY0A 2FDNA 1E4FT 4H5VA 1QQNA 1X40A 5J2MB 5KT3A 1GXTA 4IO9L 1HJPA 2NYVA 4RQ0A 1WORA 2OGUA 3IFRA 4NLYA 4KO0A 3K9JA 5AQHA 2UP1A 4NCBA 5CP2A 5AZJB 1KOOA 4FJKA 4OJLA 5HMMA 1UA0A 5HOOA 3QNMA 2Y8WA 2UVWA 1WELA 1N34J 2BKOA 1NGEA 3HVTB 3HFVA 3DXMA 4CEAA 4J9OA 2BKNA 4IOXA 2PEBA 5KPRA 1SV0C 1KSPA 1CBKA 3RF9A 4DOCA 1U1MA 1SXEA 3DLLQ 3N4WA 4PPDA 3KJFB 4N8NA 4BRPA 3BF3A 4DB3A 4ZPDA 4JK7A 2HBJA 2KKPA 1FJGK 2HPUA 2J0XA 4I7FA 1VSLA 4FWKA 2FUG9 2K2PA 2HBMA 1KVAA 1AZSB 3CVKA 1GLCG 1FJ7A 3KJQB 3MPVA 2F8MA 2RQ5A 2XIDA 2B56A 4RX6A 1FNMA 5SZTA 1RWXB 2C3PA 5KFHA 3HW8A 3S6JA 3SK3A 3HZ6A 3OR1A 3CC7S 1DHMA 4ZP8A 1DXSA 2P6RA 3WKCA 2AGQA 9ICFA 3I56S 2GJFA 2QLFB 3A8EA 4X4RA 1VQKS 4ATNA 4CM2A 2XYGB 4UAVA 2C2EA 4TVAB 2HVHA 3N5FA 1I5OB 3MECB 1S49A 5AQOA 1PZNA 3I0SB 3MM8B 2E8AA 4RQ6A 4GVBB 8AT1B 4WTYA 2OHDA 3SQ0A 3NASA 1R43A 1S97A 3QU9A 4CJTA 3CFOA 3D6HB 2RF2B 1VQPS 1RT5B 1K1SA 3MXMA 1NPPA 4YN4A 5DG9A 4C0OC 3JPTA 3JXUA 2ZUAA 2L3MA 2KW4A 4QIEA 1HYSA 4DV7J 4LF9J 3JXOA 4OI1A 4JRQA 3AVAA 1UT5A 2YV0X 5CYJA 1V5IB 3CCZA 2FLOA 5CAAA 4AHCA 3GJTB 1RAHB 2BE7D 2XMAA 2F4FA 1RBOB 3GV8B 3ZZYA 5KG0A 2PC6A 4Z6DA 5AKIA 4PXBA 2AA4A 5D78A 2DPIA 3QO9A 1S5JA 3MM5B 3C6UA 1ZTWA 1F3VA 4NYZA 2FVQA 1QHTA 1KVBA 1S1UB 4B02A 3KK3B 1RU2A 3OVAA 4AL7A 2R42A 2DISA 1R8HA 4JI8F 4AM7A 4JI3F 2RHFA 3IS9B 2HFNA 3BH7B 1BPYA 1U6BA 5M1PA 2E5GA 3ASMA 1S79A 3ZD9A 4JI6K 2HK3A 2VA3A 3LAMA 1FX4A 4OZ1A 3BM7A 2YNHA 1HPZB 3AQOA 2K3IA 3ZTSA 1LQ9A 4KR0B 1BPDA 5AK6A 2DXFA 3F5TA 5JUMA 1S6UA 1IJFB 4PKGA 1MNEA 3RG6A 2YY6A 1NK6A 4FDFA 3M8YA 3F73A 1NH7A 1UJ6A 4LFAK 3NBPB 1B64A 3NGYA 3SMZA 4CEOA 2ROGA 2X7IA 2OSQA 4XDCA 1CJUA 1R0AB 5A6WA 4EAHD 1QAXA