1NJYA

Thymine-thymine mismatch at the polymerase active site
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 214
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njyA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njyA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njyA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njyA01
4GXKA 4YCXA 1RBUA 1YT3A 2Y1IA 3CYMA 2FBVA 3DLEA 3LK9A 3NCIA 4CHZA 4E7JA 4KHNA 4P4PA 3C94A 5KT4A 3NGYA 1RTIA 3AUOA 3V9WA 3PW7A 3TARA 1NK7A 4RW8A 3PUFA 1ZQZA 3IS9A 3OYIA 1S0MA 2P5GA 4ID5A 1IG9A 1IKXA 4ED2A 2PY5A 5J0UA 3O3FA 1U45A 1KVBA 3LWMA 1C1AA 2PFPA 3MGIA 1RTHA 4R63A 3UPQA 4B9SA 4C8OA 4M45A 5KI6A 2NRXA 3HX0A 2OWOA 1B9FA 1ZQNA 4ED8A 4I2HA 1S6PA 1XHZA 3SYZA 1HUOA 3ZSZA 4EP4A 1TGOA 2LSNA 4CF1A 4ZTJA 1S9FA 1TFRA 8ICIA 4E1NA 5DMRA 3WNFA 1COOA 3ZT4A 3LDAA 5CA7A 3OHAA 3M8PA 3VQ7A 2XY8A 3WNHA 3V6DA 2JEGA 1YTAA 2QKBA 1XWLA 3ZDEA 5DB8A 4YFUA 3SJJA 1A5XA 1ZQLA 1XI1A 3G0ZA 2LYHA 5T7BA 3B6OA 1CXQA 4GVMA 1QLNA 4Z4EA 4QZAA 4FM2A 1YTUA 5C5JA 4DG1A 3RBDA 3QEWA 8ICSA 4FJXA 1NKEA 4I2BA 4BGDA 5EU7A 4JS5A 2F8TA 2AGOA 3PO5A 2BPCA 3C2KA 3BQ0A 4ECXA 1XC9A 4CJTA 3T19A 2XC9A 2BCUA 3E01A 2EX3A 1C0TA 4CJEA 4KLGA 2DFEA 4K4HA 1J53A 3MXIA 1XSLA 4BWJA 2ASJA 2BCSA 3RB4A 3RB3A 5J2NA 5CZ1A 9ICCA 1TL1A 1NOMA 3MAQA 2FPMA 5L9XA 3Q8SB 4DL4A 2KTQA 4FLYA 2R8IA 2WOMA 3C5FA 2Z1JA 2PI4A 2OZMA 3B6PA 5KT3A 3OJUA 3ISDA 1ZQAA 3M9MB 3RBEA 7ICMA 4H4OA 1SL1A 3GILA 5DLFA 4ECQA 4CFBA 3ZCMA 4HCCA 4OJRA 3I0RA 3V4IA 1SKRA 4QWEA 8ICEA 4RZRA 2NRVA 4KLLA 4KTQA 1BQNA 4QZ8A 4KLMA 4IKFA 2OPPA 1T3NA 3NE6A 4FLZA 2O4GA 5HP4A 4AILC 1DOQA 1X9WA 4ECRA 4QW9A 4HVJA 1VSFA 1B43A 3OYMA 5J2PA 4DLGA 4CGHA 8ICKA 4QWCA 3UIQA 1JLFA 4F92B 3RTVA 4BE0A 3AVBA 5KFPA 4Q45A 4Q8FA 2HW3A 3NH0A 7ICFA 1S1UA 1KTQA 1JX4A 2FC0A 1RTDA 1HMVA 3K58A 5J29A 1ZQUA 1ZQXA 5C25A 4XUSA 1BPDA 1RBSA 1ZBLA 3RH4A 4BE2A 1RBRA 5JS1A 5KFMA 5DB7A 5KFEA 1NK9A 3QE9Y 4DTSA 1C1CA 3P5JA 3OSNA 5KTQA 1LW0A 3SZ2A 1TKXA 2Q0ZX 3JPRA 4EYIB 1ZETA 3QNNA 5J0SA 1ZQJA 2OPRA 4PWDA 3MFHA 3ZD8A 2IC3A 2UVUA 5FRMA 4J9QA 2VA3A 5F9LA 2RKIA 4Z4HA 2JEJA 1IKWA 1TK8A 1BPZA 5KFJA 2JEFA 1EXQA 3ZSVA 2RPIA 3TAQA 4Q8EA 4E3SA 2HHVA 4I2IA 3KK1A 5KFFA 4IDKA 1RT6A 1TKZA 4CGDA 2FLLA 4DQQA 1BPYA 1A76A 2AQ0A 3QZ7A 3TABA 1A77A 1A5WA 4O4GA 4YD1A 1WCNA 9ICAA 1ZBFA 3MBYA 4CCHA 4NM2A 1W9HA 2W8LA 1D9DA 2BKEA 1MQ2A 3K5LA 4RQ1A 5KFTA 1BISA 3C1YA 3RJEA 4GXIA 1QSYA 1UT8A 4CGJA 4F2SA 3M8SA 2R8JA 9ICBA 2KN7A 1QS4A 2XRIA 9ICQA 2MUTA 4P2HA 1JXEA 4DF8A 3OYNA 3OVNA 5D49A 4RUCA 2FMQA 1JIHA 5J2FA 5KT2A 4M6WA 4KV8A 4RQ6A 1JKHA 2FMPA 2XGQA 1IKVA 4C8KA 4FJIA 4CEDA 5C24A 1WNSA 3DMJA 4JWNA 4CJUA 2ZJ5A 1JMSA 3K5NA 5J0XA 5CZ2A 4CEFA 4KLEA 1SKWA 2E6LA 3OYKA 2J6SA 4ED3A 7ICOA 3OSPA 4R8UA 4YXJA 4KHSA 4EBDA 1ZYQA 2UVRA 7ICIA 1ASWA 1VSHA 3WNEA 4K8XA 4M9LA 2IHMA 4DF4A 1LWCA 4DOAA 3CFPA 3M9OB 3M9NB 2YNFA 4UB1A 1U47A 2HMIA 5KFRA 2GV9A 4RQ2A 4PUOA 9ICLA 4CJPA 1KLNA 3NF8A 4QZEA 3JPOA 4M41A 3ZSXA 7ICVA 3VQ9A 5KFDA 3LAKA 2DPJA 3QIPA 2ZUDA 4M3YA 4FM1A 4PA1A 3KKSA 4UQGA 4AHVA 5D46A 3ZT3A 4NCGA 1FKOA 2PZSA 1Q8IA 5DBBA 1T4GA 2X6NA 3ZDAA 3C95A 3WNGA 4QZBA 1CXUA 3OS2A 4RW9A 4QAGA 4M9NA 1NJZA 2G8HA 2D0AA 9ICHA 2BR0A 2JZBA 4Q43A 3LP3A 5KFGA 2FLPA 4NXZA 3D45A 5DKWA 5L1KA 4M04A 1X9MA 1VSIA 4DL7A 4CIEA 4E19A 3T5JA 2C2DA 3RMCA 3MR3A 1S0OA 4FJHA 4M3WA 5J0PA 4IRKA 2DY4A 4TUPA 3V9UA 4CF0A 2BCVA 2QKKA 3JPNA 2OA8A 3RWUA 4RNMA 4DWIA 4CGFA 1RXVA 2J6TA 3DRRA 4KLHA 4FCYA 4M3ZA 3S3NA 1BL3A 4R64A 4XIUA 2F1HA 9ICMA 8ICGA 3UXOA 3NDKA 2VG7A 4DU1A 4IRCA 3SQ2A 1RPLA 1B22A 3KLHA 1B9DA 4F91B 4OVLA 4I2EA 4MEXA 3RB0A 4DTRA 2WONA 2B21A 5HBMA 3AO1A 3V1OA 1TL3A 4FJJA 4RNNA 4Z4IA 1ZQDA 4Z6DA 4LH5A 4KLSA 1KCFA 4JRQA 1ZQMA 3H40A 1SL0A 1NK0A 3TI0A 5KG1A 1KLMA 3KHGA 1BQMA 2V9WA 3V6HA 3NGDA 4KKOA 4MFBA 1U4BA 4FBUA 3H8JA 3B0XA 4F50A 5E41A 2IS3A 4H4MA 3DLBA 1DTTA 4B9NA 2KZMA 8ICBA 1A5VA 4KLIA 1ZQFA 1LW2A 3OYHA 2VWJA 4CEQA 4FZYA 4DLEA 4DOCA 8ICQA 1RTJA 4HUEA 3SQ0A 4PHEA 2BQRA 4DQRA 2XGPA 2J6UA 3V72A 3CG7A 3C6UA 2FLNA 4RW4A 4ECSA 2V4QA 4KFBA 2A1SA 3HL8A 4FLTA 1EXNA 3JPPA 1HQEA 3GIMA 2V4RA 3BJYA 1KDHA 4O5KA 4FS2A 4R5PA 1DGSA 4PPXA 4NCAA 2ZUCA 3Q8RB 3TAFA 4ELVA 4E7KA 3QEPA 1ITGA 3TR8A 1B92A 1D9FA 4DTNA 2XHBA 4YR3A 4DL5A 3V1QA 2IAJA 3ZSOA 5J2MA 1HYVA 2GWSA 2IMWP 3CQ8A 4O5BA 3DRSA 1ZJNA 1N56A 3K2PA 3S3MA 5J2KA 3K59A 3TFRA 1KFSA 1JN3A 1GOBA 4CJVA 3OYAA 2VA8A 2FBXA 5KG4A 4CHQA 4XQ8A 4DFMA 4DL6A 3QESA 5IIIA 9ICGA 9ICNA 4R65A 4I9LA 2RF2A 1UWBA 4DTPA 1T7PA 5TZVA 3HVTA 1LB2B 4M47A 1VK0A 1TKDA 2W9CB 4DFJA 4F5NA 8ICHA 3NF7A 5KG5A 4J9SA 1VSDA 4UB2A 3Q8LA 4LY7A 4KHUA 3C23A 4O3SA 2HVIA 1N5YA 4G1QA 3L2QA 2FBTA 1CZBA 4UAZA 4F4KA 5DB6A 4BACA 3AVKA 3RJKA 3LP0A 3QEIA 4B8AB 5L1IA 4EP5A 1RNHA 3ZT1A 4M0AA 1BVSA 3TAPA 2YNGA 3RAXA 1WSIA 1Z00B 2IBKA 3MDCA 2ZJ8A 1S76D 4FJ5A 3N97B 3RJHA 3QLHA 4DL2A 3AVFA 1T05A 3OS1A 2VG6A 4KHYA 1VSEA 3GV7B 4CF9A 1RT1A 8ICFA 3RMBA 5HNKA 3LZIA 2OPQA 2PXIA 1KEJA 2F96A 4Y1CA 4DL3A 1KFTA 2A1RA 1C0MA 5HMMA 1N48A 1RZTA 3PMNA 3BDPA 4J2AA 3H4DA 1ZQEA 4I2CA 3NH1A 4KI6A 3ISNC 4RW7A 3VQAA 4JV1A 3OYGA 1HPZA 5KT7A 1S6QA 1ZBUA 3PNCA 4B8CA 1MQ3A 3SPYA 2AQ4A 4FYDA 2HHWA 2XY7A 1RT5A 1S97A 9ICIA 2UVWA 3LPUA 9ICVA 3DI6A 4W5QA 3RRGA 3QETA 5IINA 1SZPA 1ZQSA 2C2EA 3AA3A 4LZDA 2Z1IA 5J0WA 3OYDA 1N6QA 2DPIA 2X6SA 4CJLA 4KPYA 8ICNA 4KREA 1CLQA 3O4QA 2G8WA 4QCLA 4CF8A 3HP9A 1NOYA 1UT5A 5BOLA 1NKBA 3OGUA 3VN5A 4EBEA 3UQ2A 8ICYA 8ICRA 4ID1A 4CE9A 5KFBA 3MEGA 4R66A 2BQUA 3V7KA 4ZTFA 3K5MA 1IKYA 4KI4A 1RILA 4B9MA 4L8RB 1EX4A 8ICJA 3H7IA 4FXDA 1TAUA 5DK5A 2E4LA 2XY6A 4O3OA 4N56A 1BIZA 2F8SA 4JS4A 4RU9A 5DQIA 3ASMA 4FO6A 2BCQA 8ICPA 4OKEA 4FK2A 2PI5A 5KRTA 4JK1A 4QOZB 4PHPA 4P4OA 1QE1A 5KFHA 4OLAA 2BQ3A 3VA0A 3RJFA 4RPXA 5J0OA 4FW1A 1D8YA 3RJIA 3GIKA 3Q8QB 4GC6A 3EZ5A 1RBTA 1I39A 2RDJA 2MAXA 4P4MA 3K75D 4ECTA 3EW9A 4J2BA 4DSJA 4FJLA 3L2RA 4F3OA 2ALZA 4Z4FA 4DSKA 2YV0X 4ECWA 4J9PA 2HHXA 4ED1A 4B9VA 5J0TA 3DM2A 5FRNA 3P1GA 4DTOA 5KFOA 5J0RA 1C7YA 2ATQA 4Z6CA 3CM5A 4CK3A 3SUNA 4J9KA 4GMJB 2YNIA 5CHGA 4YQWA 3O4NA 4JV2A 4E1MA 2JEIA 3MEDA 4C8LA 5KFSA 5DBAA 5KG0A 3SCXA 2BGWA 3OYCA 4DQSA 4HTUA 2PFOA 2ZQBA 1C1BA 1JLAA 2ZUBA 1NK5A 1ZQBA 2RDIA 4CEBA 4B3OA 4NCBA 1S9EA 4YMNA 3Q8KA 1BI4A 3VQ5A 2B4JA 3VQ4A 2G8UA 3HWTA 3VA3A 3C5GA 1LAVA 4KB1A 1RDBA 1JL1A 7ICGA 3GIJA 2YNHA 9ICTA 1T03A 5IIMA 4MFAA 4N47A 1RDAA 4RQ5A 1HJPA 1PZNA 2G8VA 4F4ZA 3OYJA 4FJ7A 2W9MA 3NGIA 3RJJA 9ICJA 4YNQA 4Y1DA 4IQTA 2IDOA 1X2IA 1WSJA 4PGYA 3G6YA 1HYZA 5KT6A 4DQPA 3G6XA 1R0AA 5HHHA 1FKPA 5IILA 2OPSA 3MDAA 3RJGA 4OKJA 4DEZA 1LWFA 1XSPA 5J2JA 4RW6A 3RMDA 4CHNA 1BI4B 1JL2A 4FJGA 3BQ1A 3HJFA 4PY5A 5I42A 4CIFA 2Y1JA 3RRHA 5DG8A 3HW8A 3SUOA 4UB4A 2DFHA 4PHDA 3KHRA 2IGIA 4AHTA 4F4WA 3PX6A 2AU0A 4PQUA 3C2MA 3DOLA 1CUKA 1Q9XA 3PVXA 4IQUA 1XS9D 3VQEA 4LSNA 4YXMA 4M2YA 4DSEA 2X74A 3TANA 1I3AA 4ELUA 2HHTA 4CHOA 4W5NA 2IHNA 2VANA 2FPLA 4O5EA 3ORYA 5DQHA 1UA1A 1IXRA 5HHIA 1S0NA 4QZHA 4DS4A 4CFCA 3U3GA 5KRSA 3PX0A 3D0PA 5EWFA 1C0UA 5CP2A 2YHAA 4DTUA 4F4XA 3HP6A 3O3GA 5CYQA 1VSKA 5DG9A 4O9MA 3SV3A 4QZGA 8ICVA 1D5AA 4FK0A 4FJ8A 4FBTA 4TUQA 1QQCA 4DS5A 2PYJA 5HRRA 3V9SA 3KHLA 1RBVA 4FJ9A 1ASVA 5L1LA 4W5TA 2O4IA 1HJRA 3NTUA 7ICNA 4E89A 1ZQQA 4ECVA 5J2HA 4UBCA 4AHSA 3ZDBA 3QO9A 2D5RA 1TVAA 3BQ2A 4DFKA 4RG8A 7ICEA 4CEEA 3DRPA 3MXJA 4O0IA 4F5RA 7ICTA 2KQ2A 1XHXA 1NK4A 1CZ9A 1K1SA 4DMNA 2ETJA 1ZQYA 3OYBA 3PY8A 1WCLA 4QZDA 7ICSA 3K4GA 5HRSA 5DDYA 4RQ4A 1WAFA 1WSEA 3NF9A 5KG3A 8ICXA 1HNVA 3KJVA 4TQRA 4I2AA 3U6FA 3EYZA 3ZSYA 7ICPA 3AO3A 3JPQA 3T1AA 5EWEA 4YN4A 4EZ9A 3TQ1A 5KFZA 2GBZA 1U48A 3AO4A 4O3RA 5IIJA 4RUAA 4I29A 1ASUA 4CGGA 4K8ZA 4E0DA 4OGCA 2P1JA 3V9ZA 4RQ8A 1S1XA 1RT3A 4KLQA 4ICLA 4YG2A 4KHWA 1RDCA 1X9SA 4HUFA 3GIIA 2AGPA 3UXPA 1QTMA 2P66A 1V9PA 2ZJAA 2OZSA 3AV9A 5CJ7A 4W5RA 4NLZA 1L3VA 5J2CA 5CWRA 3MABA 2ASDA 4EBCA 2A1JB 4YMOA 3SUPA 3Q8PB 4F8RA 1JLEA 2VG5A 1X1PA 1SUQA 3PW0A 1FXXA 3H8SA 3DLGA 4F4YA 4QWBA 4UB3A 2R8KA 1RT2A 5CY4A 1XO1A 4O5CA 3NH2A 4I7FA 3HVRA 9ICUA 3B0YA 1RT4A 1KFDA 4CJKA 1GOAA 2ZTCA 4YVZA 4M3TA 3DOKA 1Y88A 3IM1A 5J2AA 2ITGA 4MFFA 4OKKA 4DSFA 3MECA 2XY5A 1S1VA 2X78A 2KZ3A 3SI8A 4E7HA 3BQTA 4BE1A 5KFIA 2QK9A 4DOBA 1RCHA 1MC8A 1K1QA 2Q3SA 4I28A 5IIOA 1RYRA 1LV5A 3OJSA 3HSTB 3M8RA 4QWDA 5KFCA 3OY9A 4EZ6A 3OYLA 2W9CA 5KFWA 4CJQA 4FW2A 1WSGA 3QEXA 4J9LA 3F73A 4ED6A 3RH6A 4IR9A 1C6VA 4RPYA 2KZZA 3LANA 4X5VA 4GLXA 4J9MA 4F5QA 4IQWA 3NAEA 2W8KA 4DTXA 1NK6A 4BDYA 3TAMA 4OGEA 3PV8A 4CJWA 2NRTA 5J2QA 1Z00A 3OS0A 4KLUA 1WSHA 2Z1HA 2EHGA 2AJQA 2G8FA 3L2VA 1TK0A 1BGXT 1ZQVA 3C2LA 3S3OA 1L3UA 1ZQGA 4CGIA 4DTJA 3LZJA 3DYAA 4IG0A 4B08A 1S0VA 4TURA 1K6YA 3NGZA 4CHYA 4LZGA 5J2GA 1WSFA 3VQQA 2BHNA 4FJNA 4F2RA 5HLFA 4W5OA 4C8MA 3FDSA 3AVCA 4NLNA 2BANA 3OYFA 3NF6A 9ICOA 3V6JA 4FLUA 1LWEA 3K57A 4KRFA 2PYLA 3HK2A 1BPXA 4O44A 1WAJA 2ASLA 1U9LA 4UAWA 4HUGA 3QEVA 5DQGA 2BE2A 2H5XA 7ICQA 3PW4A 4O0JA 1ZQOA 1XU4A 5KFVA 2XCAA 4RQ0A 1Z25A 1NJWA 4NY8A 5KFAA 5DG7A 4NLKA 3PO4A 2BCRA 1MU2A 4JUZA 2G8KA 4YD2A 2W9BB 5KFQA 4BXOA 3QERA 2VA2A 3ALYA 3RR8A 2WTFA 3LALA 3EY1A 3DLRA 4RNOA 3ITHA 2P6RA 4J9RA 1ZQKA 2HNDA 3ZSWA 3UQ0A 3SPZA 2BGGA 3AVAA 1O1WA 2I1QA 1ZBIA 2HB5A 1BPEA 2F1JA 3AU2A 3HPHA 1ZQPA 1Z3EB 3MXMA 5CR0A 4IG3A 4FLWA 2NUBA 2P51A 3K5OA 3UXNA 1ZJMA 1G15A 3MR5A 4I2FA 5KGWA 9ICRA 2HNZA 7ICJA 1D8LA 3DLKA 3MR6A 3THVA 3LWLA 4BXOB 3LAMA 3QIOA 5HP1A 1L3SA 4CK2A 4CF2A 5KFYA 1KVAA 1UOCA 4KLDA 5KG7A 4DSLA 1F21A 3AVGA 4LH4A 3LDSA 3GDXA 4C8NA 3E2EA 1ZBHA 3V7LA 3HPOA 3QZ8A 2C28A 3AVJA 3DLHA 4Z4GA 1H38A 4Z0UA 8ICZA 2FPKA 4DTMA 4NLGA 3C1ZA 4IFYA 3KK2A 1YVUA 3SI6A 3TAGA 2DFFA 4LVSA 2C22A 4KAZA 4DU4A 4J2EA 2R7YA 3JPTA 1UAXA 2FBYA 4UAYA 2KFZA 3G10A 3SQ4A 1S10A 3ZD9A 3GV5B 3ULDA 4E7LA 3QEAZ 1UA0A 3LP1A 3IG1A 4QZIA 1EKEA 4N41A 4OPJA 4KLFA 3I8DA 3P83D 5JUMA 1TKTA 4IRDA 2BDPA 3JYTA 3CFRA 5DGBA 4MF8A 3PW5A 2P5OA 1KRPA 4KLTA 3GFKB 1HRHA 7ICUA 3ZT0A 3SNNA 3KD5E 3C6TA 9ICWA 8ICCA 2YHBA 3KLEA 4DU3A 4M3RA 4I2PA 2AGQA 4CFAA 3L3UA 3V1RA 2ZE2A 5DBCA 2B5JA 3JSMA 5D4BA 2NRZA 1RXWA 3VQ8A 1EETA 4CJFA 1HYSA 1L3TA 7ICKA 2JLEA 5DDMA 2ISOA 2PFNA 3TAEA 3U3YA 4ECUA 3LPTA 4IBNA 1JXBA 3GQCA 1IH7A 1QSSA 4CJ5A 3S9HA 2PFQA 2YKNA 1SL2A 4CHPA 4I27A 4CECA 2Z1GA 1VRTA 3O3HA 4MEYA 4I2QA 4O55A 2IOCA 1Z26A 3KD1E 2YKMA 3Q8MA 3ISCA 1TK5A 4RT3A 4DO9A 1U49A 2QXFA 4B9UA 3TWHA 3M8QA 3N4MB 2BPFA 3EPIA 9ICXA 9ICPA 3KKRA 4RQ7A 3KIOA 1WN7A 5KFXA 4AHRA 4Q44A 4G3IA 3QINA 3SV4A 5DLGA 4FK4A 3C21A 3AA4A 3RR7A 4BDPA 1J5OA 4I9QA 2R8GA 3L8BA 4XRHA 1VSJA 3MR2A 1ZQRA 4EEYA 4FJKA 5L1JA 3HPGA 4CEZA 4FZXC 3ZSRA 3V6KA 4M3XA 4QZCA 3AVLA 4WE1A 4ZHRA 3HM9A 1HUZA 3AA2A 4M9JA 5JS2A 1QHTA 3KLGA 1NJXA 5EOZA 4IR1A 1J54A 5DGAA 3VQDA 1RYSA 3PX4A 1EP4A 3MEEA 4KLOA 4BDZA 3NHGA 3T5KA 1TVRA 4DFPA 8ICUA 4UB5A 8ICTA 5KGXA 1S1WA 4M9GA 3L3VA 4LD0A 2ZD1A 1TV9A 1GOCA 4UBBA 4B9LA 2W42A 4ZH4A 8ICOA 4RQ3A 4KMUA 4CEOA 3BGRA 1VSMA 4F93B 5FROA 1RDDA 3OYEA 1BCMA 4CJ4A 4FZZA 3NFAA 2M9NA 5KG2A 3H4BA 2IA6A 3V9XA 3LP2A 1JLCA 3AVMA 4MFCA 4MF2A 4AH9A 4O3PA 2B6AA 4OPKA 4YMMA 3ZDCA 2D0BA 3CM6A 4KTZA 1BHLA 1JLGA 4F3TA 5J0YA 3KK3A 1LAWA 3H8WA 4YR0A 3G6VA 4AHUA 5KFNA 4TSXA 4HYKA 3PR4A 5HRNA 4M9HA 8ICMA 1VSLA 4CJ3A 2FMSA 3T3FA 3SQ1A 4PH5A 5KFUA 3PMLA 4YP3A 5SZTA 4M3UA 3AVIA 4E7IA 3V81A 4KB0A 2ISPA 4JLHA 1L5UA 4QZ9A 4F5OA 4ED0A 2HHUA 5J0QA 4KTWA 4KHQA 3RH5A 9ICKA 4M42A 4QZFA 3QNOA 2MUTB 5HROA 4AHCA 8ICAA 3KTQA 2C2RA 3VQPA 3IRXA 5KFLA 4M6WB 4I2GA 2XCPA 2KW4A 1Y97A 2W9AA 5KFKA 5FDLA 9ICSA 3ETLA 1KVCA 4EYHB 4FLXA 4FVMA 3VQ6A 4XA5A 3F9KA 3OHBA 4GW6A 2F1IA 2D0CA 4CJSA 4JWMA 2OYQA 4RT2A 1ZQWA 3RAQA 1J9AA 3QEBZ 2HHSA 4J9OA 3ZSQA 2GUIA 4FLVA 4I2DA 3MGHA 3RMAA 3AO2A 3AVHA 4R8UB 3FYHA 3ZDDA 4H8KA 1HQUA 2A1JA 7ICRA 2DFLA 4N5SA 5BPCA 2ZTDA 3EPGA 3L2WA 2I9GA 1TAQA 4YR2A 3L2UA 4NYNA 5DB9A 4HHTA 4TUSA 1RT7A 3T5LA 3PR5B 1DTQA 4QW8A 3HYFA 2HVHA 3VQCA 5D3GA 4ECZA 4KN7A 2RN2A 4KO0A 3HT3A 1NKCA 1JXLA 5HMLA 3GV8B 3TFSA 4FS1A 1XSNA 4O3QA 4HCBA 2NRWA 5C42A 4ED7A 4NYFA 1BPBA 4GC7A 4J2DA 4ECYA 4BWMA 3FFIA 3KLIA 3CFOA 1IM4A 4RPZA 9ICFA 1BCOA 4DQIA 4Z4CA 5I3UA 5J2EA 4KLJA 1ZQTA 1T8EA 2HHQA 1CEZA 5HRPA 1JLBA 5J2IA 4CK1A 4Q0BA 4B9TA 3IHQB 4CJRA 2ZTEA 3AO5A 2JZBB 4CIGA 3ISBA 2R8HA 2E6MA 3MFIA 4GXJA 4OLBA 2UVVA 1ZQIA 7ICLA 3ZT2A 4PHAA 4N76A 4FJMA 1WLJA 7ICHA 5KG6A 3VQBA 4KITB 2DTUA 1FK9A 3KLFA 3NBPA 8ICWA 1ZQHA 4NM1A 1IO2A 4CEAA 4JRPA 4PGXA 3PW2A 1S77D 5CYMA 3JPSA 4IFVA 4J9NA 4CESA 1TV6A 1S9GA 4ELTA 3AVNA 5K14A 2ATLA 1S1TA 1BIUA 2I5JA 4KN4A 3HO1A 4PGQA 1MSWD 4Q5VA 3IAYA 4F5PA 3RB6A 1KSPA 5CB1A 5SWMA 5EWGA 2KFNA 3EWAA 1DLOA 3H08A 3HXMA 2BPGA 1Q9YA 3T5HA 3AA5X 4K4GA 4Z6EA 3A2FA 1ZQCA 4MQ3A 4O3NA 2G8IA 5BOMA 1HNIA 1SV5A 5J1EA 2JGUA 1NOZA 2HNYA 4FM0A 4K4IA 4TQSA 2P6UA 1S5JA 4JV0A 1QSLA 1U04A 4CFDA 3KHHA 4DSIA 8ICLA 1AROP 5J2BA 1NJYA 4QWAA 3V7JA 4IQVA 1REVA 4LSLA 5IIKA 5J2DA 3SUQA 4I2JA 9ICEA 1NK8A 4YFKA 1SKSA 4CERA 4Z6FA 2VWKA 5F9NA 2XO7A 2W9BA 1JLQA 1W0HA 5KT5A 1VRUA 3I0SA 3AU6A
chains in the Genus database with same CATH superfamily
1RBUA 4R5PB 1MN9A 1YT3A 4PKDB 3DV9A 2Y1IA 3CYMA 2DNZA 4JI1J 3DLEA 3LK9A 4Q2MA 4CHZA 4E7JA 1LK7A 5KT4A 1RTIA 4MDAA 1WTBA 3AUOA 3V9WA 1U1LA 3DRSB 3RYLA 3CCZA 3IS9A 3KOAA 3GYNA 2GAHC 4B3RF 2QLFB 2Z7JA 4LRBA 2QWOA 5J0UA 3NUQA 3NCPA 2VBZA 2QL9B 4KH6A 3R97A 3FBEA 4C8OA 4M45A 2V94A 1B9FA 3HVTB 3CJKB 2B7CB 4ED8A 2NRRA 4I2HA 3SYZA 2XS2A 4AQYJ 3WT0A 1TGOA 1K8AO 1Z4UA 3DLJA 3T1HJ 1TFRA 1MROA 2E5SA 3VR1A 5MLCQ 3RF9A 4G1QB 3OHAA 4U6PA 5AIAA 2MSSA 1XN9A 1XR7A 2XY8A 3CMAN 4L3QA 3AY0A 2JEGA 1KQSR 5BYRA 1VR6A 3BSOA 5ADXA 5M1OA 3MCNA 2YNGB 2QKBA 2CGKA 1XWLA 3ZDEA 2O67A 4YFUA 1RTHB 4YS2A 4L72B 1XI1A 1PIEA 2IVYA 1MWZA 4JKGA 1FD2A 4JI5F 4B3RK 2M8HA 3B6OA 1VFJA 2VG6B 1RAOA 4EEKA 4GVMA 1QLNA 4QYZJ 3C29A 5ALLA 4IWVA 4A8XA 2YQ3A 3VGTA 4JS5A 1XTZA 2F8TA 2AGOA 1YHQS 4JYAJ 3L4PA 2YWEA 2LP4A 3BQ0A 2YHWA 2KSOB 2QL5B 3QFHA 1X5OA 2EX3A 2H5IB 2KT3A 2YJEA 4ZMMA 1OH7A 1IQZA 4KLGA 3CJ0A 4DFDA 3MXIA 1XSLA 5AKYA 3ULEA 2ASJA 3RB4A 1LXJA 5J2NA 5AI9A 4U96A 1GK8A 3PRBA 4TU9A 1TL1A 3HT0A 3MMAA 4OX7A 4DV0F 4ILJA 2V51B 4WKYA 3NVVA 2YTCA 4BRKA 4JI5K 2A0FB 1WHYA 4CFBA 4HCCA 5GAHP 1Q86O 4UQTA 3M2UB 5K4LA 3I5AA 1NU0A 4HI2A 2HURA 2E2PA 3VETA 3PNIA 2CPIA 2R7XA 2Z4PA 4UUWA 3MPYA 1BQNA 4BX9C 2VHGA 1R43A 3MEGB 4JI3J 5CRXA 4KLMA 2EZXA 3T7ZA 2FF6A 2ZBQA 3A8EA 3WK6A 5TISU 2E7XA 1MN7A 1SZHA 1GFWB 2OPPA 4WTYA 4USVA 1PK1A 3N4PA 5ETTA 1WACA 5B0BA 1X9WA 1RISA 4Q7AA 2AD9A 2HAFA 3BKTA 3JTNA 3UN3A 1TYQA 1SC4B 4FF3A 4DLGA 2W24A 2QB1A 4WJ3B 1URRA 2B4UA 4FNHA 3UIQA 3SLCA 1N5VA 2DGOA 4DV0K 1JMTA 5A8RA 1RWOB 2F8EX 5GMKa 3KKFA 1KTQA 4I6MA 2QWMA 5HR6A 2D6FC 4FVUA 4IS7A 1ZRMA 1YHQN 1R8CA 2IM2A 3RBXA 5KFEA 1YTYA 1WUAA 1NK9A 2ZGYA 1FDBA 3PHEA 3QE9Y 4NLXA 5I3QA 5E0OA 4DTSA 3P5JA 4PKGA 3OBWA 3OSNA 5KTQA 1MW7A 1D8ZA 3SZ2A 4C2MA 1TKXA 3P4UB 2Q0ZX 2E44A 1VQ6S 1MMDA 4TY8B 1WWHA 4AE5A 2LCWA 3HI9A 3OHRA 2VA3A 5A6PA 4NI2A 1W97L 4FFDA 1QDUB 2DKXA 1IBCB 4DV5F 3BKFA 4CLPA 1RTDB 1BNPA 1VIOA 2F77X 4A2BA 4CTAB 3TAQA 4Q8EA 1IR0A 1C1BB 2HHVA 3KK1A 1FO1A 1TKZA 4DQQA 2HIYA 4ITSA 4ZVQB 5KL1B 1N5QA 4WF9L 2ASOA 1A76A 4YOVA 3QRRA 2P9NA 3TABA 4PJ0U 3NGSA 3ZFVA 2B56A 3MCAB 1LW0B 2ZJRL 3WBZA 3MCPA 1W9HA 2W8LA 5IM0B 3K5LA 4X66F 4BRAA 4RQ1A 1BISA 1RHMB 3BSNA 4O8UA 3RJEA 4EHUA 3CDWA 2XYPB 4CGJA 4LQ3A 1U26A 2DH8A 4LF9F 2MUTA 2HRTA 2ZUGA 1JXEA 4DF8A 4OJ1A 5FJ4A 3QGGA 1S49A 4PRFA 5J2FA 3Q8UA 1LOUA 4RQ6A 2FMPA 2XGQA 4NA1A 4WFZA 1IKVA 2OPSB 4C8KA 1RZMA 2QWLA 4C7YA 5AJ3J 4FJIA 2XZDB 4M63C 2YWFA 4Y6IA 3UI3A 4DV5K 2O6KA 2ZJ5A 1VBZA 2UXBJ 1Y5NB 2H54B 5J0XA 4QNLA 1GMVA 4RTFD 2M2BA 4OO1J 4M5JA 1HHTP 2Y0SC 1Q78A 4YHHF 1YJ9S 3WIUA 2DHAA 2J6SA 2JWKA 2MLXA 2CWKA 5HVHA 4MK8A 1WHXA 2CPFA 3KDNA 1MWQA 4YXJA 3FCHA 3HVWA 1ZYQA 1ASWA 2F9JA 3POTA 1JJCB 3ENAA 4X66K 1QHAA 2B4PA 1XMOF 1DURA 1NHUA 4DF4A 3FE1A 5AI4A 4ZIVA 3Q23A 3CFPA 4LF9K 1VQ6N 2QYCA 3D68A 2QMUB 4HHUA 1U47A 3ZZTA 3IR5B 4RQ2A 5K8PA 9ICLA 3DHXA 1N8RO 2GQQA 4QZEA 3B8HA 2CJAA 7ICVA 1GLCG 5KFDA 3UB5A 2DPJA 5LJ3Y 5CYQB 4CWBA 5IQ6A 4PA1A 5D0GA 3KKSA 2OEMA 1PC5A 3BB5A 3GTYX 3CTRA 2R7QA 1XJWB 3L7OA 4M5GA 1CSJA 1U09A 1T4GA 4YHHK 2OP5A 2DPNA 3C95A 3OS2A 2YN4A 2E5JA 2M70A 2ZWOA 4M95A 4BRFA 4ZA1A 2BR0A 3GJTB 1V5IB 2YY3A 4DR3F 4Q43A 2CA9A 2OMLA 2FLPA 4NXZA 3D45A 3TEGA 1RM6C 1EAYC 4PYDA 1XMOK 3KG4A 5ITHA 3MR3A 4FJHA 5J0PA 2MKHA 2HI0A 2DY4A 3EM1A 4HACB 2JV3A 2VJVA 3V9UA 2BCVA 1KEKA 4RNMA 4DWIA 1SV0A 4OJHA 4CGFA 3DRRA 3BS7A 4FCYA 3K9KA 4M3ZA 4AM6A 4WFBL 1GTEA 3H0MB 3KJVB 2GQ2A 2F1HA 1HBOB 1HQ2A 5ALZA 3H1VX 1VIXA 2PMZC 3IUCA 1YJ9N 3SQ2A 2WF7A 4ZITA 4ISEA 4ZJLA 4MEXA 1RWNB 1C0GA 3G96A 2B21A 2EVZA 1TMMA 4CRJA 2QARA 2XWYA 2ES6A 2D3ZA 2C2ZB 1RT3B 4DR3K 3W5ZA 4NLTA 4ICLB 5HL7L 5KG1A 3KHGA 3O5TB 4DXLA 3NGDA 4C4WA 1YJVA 1CJTA 1HWKA 4FBUA 3QBCA 5KQDA 2IS3A 1YKWA 4ISGA 3PEJA 1DTTA 1XC3A 2XMUA 1LW2A 2AJ0A 1NEEA 2F9DA 3W8PA 3WC2A 3J7A1 4DPXA 4CEQA 5KQ8A 1D0EA 3BO4A 4WJBA 3SQ0A 2EZZA 2OXOA 1JLEB 3MMCB 2VD3A 4DQRA 2XGPA 4ECSA 3KMSA 1J2MA 1EXNA 1VQ8S 1TL3B 2UP1A 3O08A 3VC8A 3J81O 5AKZA 3GIMA 2HQDA 3OTDA 4FYVB 4FS2A 2VZ9A 4R5PA 1DGSA 3BSCA 2Q0RA 1CRXA 1RT4B 3BS5B 3N6NA 4JB3A 2ZUCA 1Y5IB 4NCAA 1X66A 1VLYA 3TAFA 4DTNA 1B0XA 4DL5A 1BQXA 2IMWP 3DRSA 1Q18A 1ZJNA 4C6AA 1BU6O 3K59A 2AXTU 1GOBA 1X42A 3OYAA 2VA8A 4Y2JA 4YY3J 2XHCA 4DL6A 4BRCA 5IIIA 3C6UB 4RL1A 2YPZA 3FRYA 3VHQA 4R65A 4CT8A 1SKUB 4DV2F 1VBXA 2H5JB 4B3SJ 4GV3A 2CQGA 2AF6A 4X4SA 1OSDA 3HVTA 2YXLA 2W9CB 2NXUA 2IOFA 1FRLA 3K2YA 4LR9A 2LXIA 1RWPB 4DR6F 4KHUA 2HVIA 1Q82O 4G1QA 1XNRF 1O0PA 4P73A 4BACA 3MN6A 4C0OC 1EKSA 3NAIA 4ZP9A 1TFYA 4B8AB 2SXLA 4EP5A 4M0AA 1BVSA 4JI4J 2VQEF 2IBOA 4QU7A 2YNGA 2O01C 2IBKA 2BRLA 3MDCA 4JI6J 4FJ5A 3MWPA 3D2QA 2PEBA 2VU5A 1Q3UA 3G71S 2QSFA 1RAHB 3OS1A 2VG6A 1ZM2A 1VSEA 3F41A 4EMDA 4CF9A 2EK1A 8ICFA 2VF3A 3RMBA 3SMZA 4KB7A 2DBBA 4DV2K 2AYGA 1KFTA 1DK3A 1M1HA 1N48A 3FBFA 3GJRB 1KQKA 4H4KA 4YOEA 5DM7L 4F36A 2BH1A 3IWNC 2XNQA 1UVNA 5E79U 4I2CA 4V1Ak 4YDXA 3ISNC 3FZMA 4JI0F 2DGTA 3R1XA 4MN4C 2B43A 2YQ0A 2IHR1 3HFVA 4KYZA 3PFEA 4W4MA 1S6QA 1XNRK 3BEXA 5B09A 5DZ7A 5CHIA 1MQ3A 4BR0A 3SPYA 2HHWA 3LPUA 2DY1A 4W5QA 3EZWA 1ZQSA 2VQEK 2AZ3A 2ESEA 3AA3A 4USKA 3W2VB 3C66A 2Z1IA 2ZH9A 4B1VA 1AA1B 3VVUA 2DPIA 3PJWA 3GG4A 4CJLA 2CFXA 8ICNA 1I3OB 1YJWS 2JMGA 4DR2K 4QCLA 4CF8A 1NOYA 1FJCA 1OIAA 1UT5A 1NKBA 1FRMA 2BJ3A 2EFPA 5SUHA 5AQHA 1RDWX 1VJWA 5BRDA 3JSBA 8ICRA 5AZJB 4IYQA 4Z7CA 3MEGA 3CCRS 2CNKB 2JFDA 2GWKA 4F71A 4BR2A 3N6MA 3O6QA 3ENBA 3K5MA 4KI4A 1NMEB 4M7XA 1DHMA 4JI0K 2DUYA 4L8RB 1U25A 1UEVA 1TAUA 1UJ6A 2VBYA 5DK5A 2ZH8A 4C98A 4O3OA 4N56A 1EARA 4RU9A 3MTKA 4FWOA 4UB6U 2YX6A 2KYXA 4DUZF 1KXPA 1ZC6A 4LVOP 4C48A 5A2QU 4PHPA 4QOZB 1XO0A 2CJXB 4J5OA 4P4OA 1OSCA 1EQ0A 4RPXA 5J0OA 1M5HA 4E2FB 3A8JA 2C3MA 2H4YB 3Q8QB 4GC6A 2IIHA 1SCJB 2RDJA 3EZ5A 4OJOA 1HI8A 3CCJS 1X6IA 4FJLA 4F3OA 2Q1LA 4DSKA 2YV0X 2YVSA 1UEUA 2K1RB 2JWNA 1TKTB 2E9TA 2E5LJ 4TY8A 2Q4TA 4Z6CA 3CM5A 3SUNA 3H45C 2QA4G 4DCCA 3MEKA 2R3VA 4JV5F 2DRBA 2JDJA 4ZJQA 5AQVA 3OYCA 3KLEB 4HTUA 3ZTSA 2HOQA 2PFOA 3HF5A 4CTAA 2ZQBA 3C6AA 3SBMA 1C1BA 2KJ8A 4H5VA 2PMZF 1RKIA 1ZQBA 2X1BA 2RDIA 4GVBA 4CEBA 1UPHA 2AWZA 3NXZA 1EETB 3OL7A 2E1ZA 4DUZK 4YMNA 2MZQA 2W3RA 1SIWB 2I8EA 1YJWN 3C5GA 3C7NB 4KB1A 3SQGB 4P2XA 5ALWA 4OV6A 1EKRA 2NYIA 5IIMA 4FPAA 4MFAA 5IM0A 2DQNB 2G8VA 4F4ZA 3L4QA 1QD1A 3CCRN 3H5SA 2W9MA 4NX9A 9ICJA 4YNQA 1HARA 2KT2A 3UDCA 1OYDA 5AI8A 3P3DA 4GKJJ 1X2IA 3AAPA 5KT6A 2BE9B 1LEOA 4U8VA 3TA1A 1WI6A 2O3DA 4AD6A 3NS1A 1FA0A 4WK1A 2OPSA 5CE3A 1XSPA 4JV5K 2FJDB 1BI4B 5HANA 3HJFA 5LXRA 4CIFA 4K4ZA 3HW8A 4IJNA 5AZIB 3I32A 1RHRB 2LYBA 5ALDA 2N4CA 2FY1A 1Z1BA 3IWLA 4K2JA 1JJ2M 2ZM6K 3GJQB 1CUKA 2YMMA 3OW2M 2PC6A 1Y7PA 4K4YA 3CDBA 1PK3A 4I64A 5AKXA 4YXMA 3I9V9 4M2YA 2NPIA 2CH6A 3CCJN 2HS3A 2F4VK 5GAHU 1E6YB 3CE8A 5ALXA 2IHNA 2UUCJ 4WQ4A 5DQHA 1PCAA 5HHIA 2WBRA 1NGGA 4CFCA 3GSDA 3PX0A 1TVRB 2MKKA 2KVQE 4KHPJ 4DB3A 1C0UA 1S1WB 5EX0A 3MMVA 1JCGA 1U02A 5CYQA 1VSKA 5DG9A 2LDIA 3SV3A 4CYUB 4FWQA 3GMGA 1GH8A 2BJ1A 3BGRB 1QQCA 4NLBA 3J7Z5 3CCES 3D9BA 3PYEA 2BV3A 2MU2A 4WYBA 4WU2A 5L9NA 2KKHA 3KHLA 4FJ9A 3EMTA 5L1LA 1W7AA 4ZOHC 1JLCB 1V85A 2DYAA 2B6AB 2J7WA 2YX1A 5D0EA 2E5HA 1M5SA 2D3O1 1TVAA 1G2EA 4ILMA 4NYOA 4FXWA 7ICEA 3MXJA 4O0IA 4F5RA 4DQ8A 1NGEA 4ILRA 1XHXA 1GX5A 1CZ9A 3PYGA 3US5A 1K1SA 1YRUA 2ZZMA 4HACA 4RWXA 4EFHA 2EC0A 5EX5A 2JVRA 1PO6A 5ALUA 1TTHB 2PT0A 3V81B 4QZDA 3K4GA 2J8AA 5IT9O 3CCSS 4OJLA 1WSEA 4ZP7A 3DEEA 2CQ0A 3KJVA 4LT6A 1HBOA 2XI2A 2IRYA 3ZSYA 3AXKA 3GZFA 2JOQA 3T1AA 2EBGA 3SMVA 1AB8A 4ZLPA 5MAOA 1K8AT 3O0FA 3LM2A 4DX6A 1IBKJ 5IIJA 2C3UA 2W4PA 3DRPB 9RUBA 4UARA 1YG0A 2LI6A 3IV6A 1HL6A 2HBRB 3HHEA 4K8ZA 1UW4A 3SDEB 1RP5A 4OGCA 2CQBA 4DCPB 3GIRA 3PCOB 2CQ2A 5CXTA 1RT3A 2BABA 4ICLA 3HHLB 3D6JA 1X9SA 2NUHA 2E7WA 3BF3A 4HUFA 3GIIA 2W11A 3UXPA 1QTMA 4LREA 2ZJAA 2UXCJ 3AV9A 5CJ7A 2QMWA 5CWRA 1SJ1A 2DBYA 2ASYA 3KZBA 1OPZA 2ASDA 4QR1A 1IV0A 4YMOA 1JLEA 3MMCA 3CF5L 2FC9A 1S4EA 5FPNA 4CZLA 3IC1A 3PW0A 1XQIA 3TZXA 4HH0A 3CCEN 4CH0S 3HLUA 3DC2A 2VQFF 5JU5A 1CPZA 3DLGA 4UB3A 1FJGF 1SC1B 2P9CA 3HVRA 5D3GB 3B0YA 1SWWA 1RT4A 5F8JA 4CJKA 1GOAA 3BS5A 5ETMA 1W2BR 3R8YA 1N34J 4M3TA 4DV4J 3IM1A 4PWWA 2E8NA 3HTVA 4ETXA 4B1WB 1NNLA 4TYAA 4A62A 2KZ3A 2FJBB 4NXNJ 5D6GA 4BE1A 3BGLA 2RRBA 1SUQB 4LF1A 4UOGA 3KLVA 4ZLJA 4PWUA 1MC8A 3K1ZA 4Q0BB 3OJSA 4DJBA 1Q86T 3CCSN 3QRQA 3HI0A 4QWDA 2W9CA 4B3TF 2VKZG 3ZZ0A 4FW2A 3NLCA 4F4AA 3DOKB 2HSEB 1WSGA 3QEXA 3A1YG 2KHDA 3DDKA 1F3VA 3RH6A 4QQBA 5AKKA 5CABA 2VQFK 4L6V3 2CZVC 2KL8A 2KZZA 3EXCX 3TSQA 1FJGK 1R8BA 4BR7A 5F8GA 4J03A 3ZTOA 4J9MA 3VF6A 1YZ7A 3NAEA 4JKDA 4BDYA 2M5YA 1YJRA 5T14A 3C65A 2LQBA 4DPWA 1PG5B 4OGEA 3PV8A 1IJEB 5J2QA 4CJWA 5CYMB 1QY7A 1WSHA 2Z1HA 1ZZFA 2AJQA 2G4BA 2ILZA 1K73T 2NV3A 4CDIA 1L3UA 2ZJQL 3QT5A 1VC6A 2RQMA 3NMUA 1K6YA 2A40A 2MB0B 4LZGA 4B17A 2CIMA 2FZCB 2CPDA 1BWEA 5HLFA 1PC4A 3KHYA 4W5OA 2W2NP 4C8MA 2XMAA 3FDSA 3OL9A 9ICOA 2ZNYA 1ICEB 1MA7A 1FDDA 1UWAA 1F0XA 3V6JA 4Y2XA 4B3TK 4P75A 2LMIA 3NVMA 3E0FA 4F0MA 2Q31A 3M7VA 4UAWA 4B1ZA 1YBAA 2XHWA 2XYHB 3UNYA 2YBVA 3Q22A 2A6MA 4U67Q 1V4TA 2NS1B 5AQTA 4O0JA 1ZQOA 4LF7J 5KFVA 4DV3J 1SQKA 1H7XA 3R9PA 2CPXA 4RQ0A 3VZIA 1SXEA 3BBBA 4JK7A 1REVB 5C2FA 1NJWA 2FIUA 4NLKA 3PO4A 3O1LA 2BCRA 3W2VA 4BXOA 2VIHA 3QGHA 2VA2A 1SJ3P 2WTFA 3LALA 3EY1A 1JRPA 1RHKB 1PYOB 2P6RA 2JHDA 1FCAA 4JI1F 1ESVA 2HB5A 1BPEA 4MIBA 3AU2A 4HAIA 2KXFA 3LOUA 1Z3EB 3MXMA 5AZJA 3EJMA 5LM7E 1WC5A 3TQEA 3W5XA 3K5OA 4N8OA 2NZ4A 4JI2J 3LDOA 9ICRA 3NOGA 1KAZA 3MUTP 7ICJA 3MN5A 3PIPL 3MR6A 3THVA 3FSYA 3GR1A 4CK2A 4X64J 3W3DA 2PA8D 1UOCA 4KLDA 4RCHA 1F21A 4F3QA 3GDXA 2MZ1A 3VZHA 2J7KA 2HNDB 3DLHA 3UDVA 1H38A 5AQGA 4FXVA 8ICZA 2BW7A 2FSKA 1FKAF 4M5IA 3C1ZA 3KK2A 1H2TZ 4IG3B 3W9JA 5LSLA 2DFFA 3HOTA 2ZH5A 1S5LU 4EWTA 1LFPA 2ZF5O 1M5VC 3TUPA 1NSPA 2W40A 2EKYA 4JI1K 2LM1A 3TTCA 3PEHA 1IUJA 4OYIA 1VQ5S 4P0PB 3SQ4A 1ZXOA 4E7LA 1K5OA 1UA0A 1TUUA 4QZIA 5B7WA 4URSA 4KLFA 3I8DA 2K1RA 5AM2A 2MKYA 5JUMA 4ZVRB 1TKTA 4IRDA 2BDPA 3I55S 1YITS 3TZWA 3CFRA 3AHPA 3TTDA 5FLXO 2QC3A 4DG1B 3L3FX 4LQ9A 5L8RC 2KVSA 3JQMA 9ICWA 1N8RT 2PMWA 2F7TA 2YHBA 3H90A 2OFGX 5A0YB 3KLEA 2AGQA 2VKRA 2F8KA 3NGUA 4RJVA 4JYAF 4P7VA 3Q8VA 2F8HA 2F4FA 4AUKA 1RXWA 3VQ8A 1VYAA 4FPRA 5H1SV 1EETA 2OTJS 4DR4J 1L8LA 4AQYK 1C2PA 3KG0A 3TAEA 5K9FA 4YDUC 4ECUA 3SQGA 3MOJB 4LC9B 3QBWA 3VPZA 3CXCR 1JXBA 2VIXA 3B4DA 1WD6A 4M5DB 2PFQA 2VFRA 4MEYA 3BF1A 2HOEA 1HD0A 1WOSA 3Q8MA 1TK5A 1VQ7S 4DO9A 2ZXHA 1R0BG 5ETKA 1WEXA 4H4OB 2YKQA 5AI5A 4D3GA 3TWHA 2NLWA 3MM7B 2B5JB 3EPIA 3HKZC 9ICXA 2ALYB 2ZBCA 3I0RB 4EFAC 3C0BA 1WN7A 1T9WA 4QYZK 1N52B 3ATUA 2ZBIA 3Q83A 2W4DA 1ATNA 2DGUA 1J5OA 4UZBA 1SH0A 4JYAK 5AZIA 4JI3F 3UCGA 4I9QA 2R8GA 4A8EA 1UETA 1W26A 4XRHA 1VSJA 1L6NA 1VRTB 1VQPS 2QV6A 3HJVA 1EQMA 1NGCA 1H98A 2VPXB 3D2WA 5BRHA 1L8OA 2MYFA 4MAKA 2OFHX 3WK5A 2MKJA 2YKPA 4M3XA 2QA2A 1X4DA 1WG1A 3AVLA 1NU4A 2NXNA 3OXLA 3HM9A 1Y3KA 1VQ5N 3AMZA 4C0HA 5IT0A 2K3KA 1DRZA 1E6YA 2W04A 1BLUA 1NJXA 1SQGA 2DCUB 4FZMA 5D4NA 3I55N 1YITN 2Y0SD 3MM5B 4PEOA 4ANCA 2X1AA 3MGVA 5DGAA 3PX4A 3IDWA 4YUDA 4JK8A 3T5KA 1TVRA 1RHQB 2D0PA 1K0TA 8ICTA 1S1WA 4M9GA 2ZD1A 1SXDA 1X4AA 5C25B 5ALKA 4CYUA 4CP5A 3HULA 3UMCA 4KMUA 2Q43A 4R25A 4LFBJ 4FWRA 3BGRA 3W7BA 5BPMA 3CJTA 3CIZA 2VWBA 1VSMA 4OX8A 3MAHA 3OYEA 1Y5LB 4ZHRB 1PSDA 1BCMA 4CJ4A 4MT1A 2M9NA 4JI3K 1I94J 4PWDB 2OI2A 2IA6A 3ZXWA 2O8CB 2P9IB 1JLCA 4MFCA 4MF2A 4AH9A 4JMUA 3KLGB 1U6BA 2RKIB 4O3PA 2B6AA 3IP4B 1ZAXA 2QTDA 2PDAA 3U1MA 4C11B 3MHYA 4JAXA 3TW0A 1NNEA 3NNCA 4KTZA 4Y2TA 4BGAA 1F44A 1RAIB 4F3TA 1GT8A 3KK3A 3Q24A 1VQ7N 3D67A 2MRLA 3CIMA 4CLYA 4PABA 5AQYA 4M9HA 3A5NC 2PN6A 4CLTA 4A8OA 2E5IA 4PH5A 5KFUA 2VCPA 5SZTA 4FN5A 3AVIA 1IR2A 3V81A 4KB0A 3DRYA 2ISPA 4JLHA 2HHUA 4ED0A 2HGMA 1Z2LA 1FX2A 5A6WA 4F9OA 5LMUF 4M42A 2F8MA 3CCMS 1OY6A 4ED5A 4AHCA 8ICAA 4I6WA 2C2RA 1VQPN 4OJ3A 4G9ZA 3S6EA 2R2UA 4EHTA 5M2RA 4A5AA 1NHKL 3R6MA 3MF5A 3LDPA 2G13A 1Q82T 2XCPA 2YWGA 5LOQA 5BPLA 3HBTA 2DEIA 5AXKA 4LVNP 8AT1B 4XAKA 3SDEA 3JAMU 2OEJA 3DMJB 1OVQA 5AJ3F 2E1YA 3VWSA 5E3PA 4GW6A 1RYUA 3THTA 2VBXA 3KWGA 4RT2A 3ZTQA 5BN8A 2G2ZA 2PMZD 2HK2A 2BKPA 1VQYA 4ERDA 2AEFA 2KI2A 4Y2PA 2VYPA 4WBFA 2HRUA 3EE9A 5THWA 4JI8J 4H8KA 3N9UC 7ICRA 4N5SA 4DDFA 5BPCA 4OYZA 2B9WA 3EPGA 2JH3A 4NYPA 2I1RA 1TAQA 4IO8A 1N33J 2DNOA 1VQNS 4LF4J 3BO3A 3VAMA 3T5LA 3GPAA 3FMBA 3UKRB 4QW8A 2YNFB 3HYFA 1UVJA 1WOQA 1Z4OA 5D3GA 4ECZA 2RN2A 3OLAA 1GNKA 1F9FA 4O3QA 4NYFA 4OHVA 4J2DA 2MJUA 3DDIA 4ECYA 3BDEA 1G4CA 4C7ZA 4BWMA 3WIVA 1NWKA 5AJ3K 4HR2A 4FZNA 4OIXA 4PL1A 2HFZA 3AJDA 3N7PD 1O03A 1G3OA 1T8EA 2HHQA 2KDOA 3Q2SC 1UJ5A 1UAWA 4CK1A 4Q0BA 4OHYA 3C6HA 1DTQB 4DCOB 3VGLA 4CIGA 4G9BA 4DMZA 3ISBA 3P31A 4YB1P 3MFIA 4GXJA 4DR5J 1ZQIA 4KIAA 2K7JA 3CCMN 1S22A 2GJIA 2VL1A 3VQBA 4KITB 2DTUA 3EL2A 3OFFA 4L76A 1A0PA 2KVIA 2VFSA 3DJCA 2AJ2A 3MXHP 1ZQHA 2W2OP 4B1YB 3U27A 5HQLA 3CCWA 2DNPA 2MY7A 5CYMA 3AB4B 4UY8O 3JPSA 4AM7A 4J9NA 1JLBB 1C20A 4CESA 1TV6A 1TAMA 1CULA 4ELTA 5K14A 3CPEA 2LEPA 3HO1A 2RD5C 2HCFA 4NLRA 4F5PA 3D3CJ 4K0KJ 4OYPA 5EWGA 3H08A 1Q9YA 2BPGA 3EDRB 3IM8A 1BUPA 4U9RA 1TL7B 1FDAA 5HO4A 1VQNN 4P0QB 2Q0UA 5FIIA 4YMEA 3IR6B 2G8IA 1KLMB 1RBOB 2JGUA 1NOZA 3GFYA 2HQIA 4KKOB 4K4IA 3MAAB 1O51A 1D1UA 3O5BA 1AROP 5J2BA 3HKZF 1S1TB 4K25A 4ZN3A 3BPSP 3MM9B 5IC4B 4IQVA 1REVA 1W7WA 4I2JA 3LO3A 3QICA 3FM9A 4YFKA 4KFBB 4QU6A 3SSSA 2D1CA 4QIWC 1EX8A 1R59O 5HI7A 4C0BA 3E51A 2V9KA 4GXKA 2DNRA 3O1BA 3VGMA 2EFVA 3NMAA 4X4OA 2V8PA 2KJ5A 2FBVA 4BRDA 5M1QA 3NCIA 3O44A 2E1AA 5CA5A 2HNYB 1S99A 1ZH5A 4UASA 1EHWA 3CJSA 4PG6A 2XS5A 4J9UE 4CT9A 1NK7A 3R5GA 2IIRA 1Z2ZA 2ADBA 1NDKA 3OYIA 1T95A 2K2PA 3FSXA 2QLJB 4LSLB 2RJZA 1Q8KA 1IG9A 4O3MA 2PY5A 1U45A 4M5MA 1KVBA 2EBEA 4O0NA 3OTEA 1C1AA 3CDEA 1R6VA 4YY3F 4WCEQ 1KP6A 3MGIA 4R63A 1UWBB 1H7WA 1AT1B 2MHEA 4DPOA 5KI6A 3HX0A 3HRGA 2OWOA 2KB2A 2PO4A 3BEGB 4TXSA 4H0OA 2AKWB 2KM8C 3OFHA 1T11A 4ZTJA 2UV8G 3UKUB 2GUPA 3M8YA 3QGPA 3OPKA 2KHVA 2FJVA 3AAQA 2GOLA 4ID5B 3OTOJ 5GAHI 3TX8A 4X4PA 3HSJA 1NZBA 3WKBA 1X0PA 5E84A 1WG4A 3U9ZA 5DB8A 4YB5A 5DM6Q 3DLLQ 4JI4F 1U2RA 1ZQLA 2YQEA 1VBKA 3WXIA 2C3PA 2LYHA 4G65A 3D54A 5T7BA 2FJ6A 2J0WA 2ZKUA 5BN9A 1CXQA 2JL9A 2Z2ZA 2WCXA 3CCTA 3D0IE 1WYGA 3FKBA 3UN5A 2DXFA 4Z4EA 1PAEX 4FM2A 1YTUA 3KFUF 4DG1A 4YY3K 3QEWA 1FNXH 8ICSA 2K7KA 4FJXA 3TWZA 4EO8A 1NKEA 1ZBSA 4I2BA 1P7DA 2Y9HA 5EU7A 5L1MA 3UWTA 4ATNA 1NPKA 5A0YA 4CJTA 2Z56B 2XC9A 2BCUA 4KHRA 4MHVA 3C19A 1LKYB 4KSEB 3IMXA 4RW7B 2F3JA 4URGA 4CJEA 4ILHA 4UT4A 2DFEA 4BWJA 4WF9Q 1RT5B 1Q81O 4WKRA 4M5DA 1NOMA 2FPMA 4OZ2A 2AP1A 1YBUA 3HMJG 4DL4A 2KTQA 4FL9A 4R0JA 2FYXA 3TR5A 4JI4K 4IEIA 2BDUA 5KT3A 4DHVA 3ISDA 3SAFA 1D9AA 4ZPVR 7ICMA 3QAUA 3GSIA 3FEZA 4JI6K 4H4OA 3PIOQ 2ABYA 2P9SB 4ECQA 1NH7A 1TE2A 3HZEA 3MM7A 5K8OA 1X4GA 4P72A 2Q3PA 1WORA 1FXRA 3I0RA 4OJRA 1C0TB 2GHPA 3HD2A 2NRVA 2HF4A 1HI1A 1XR6A 4NLPA 1U2FA 3I76A 3UE2A 2RHKA 4B9QA 4IKFA 1KQSM 4Y28C 3SEOA 4NRTA 1RB0A 2FUG9 3NE6A 1JJ2R 4FLZA 3O9SA 3SIPB 5KPZA 2EAOA 3R3TA 3OW2R 1VSFA 2N3OA 2OUGA 4NZ0A 2E5GA 2YH0A 4CGHA 3KMQA 5EN1A 3EE3A 4CZKA 2DR7A 2E7VA 3AVBA 1VLOA 3CJCA 5KFPA 2W54A 5F2RA 2MQNA 1IR1A 3MM5A 4MKBA 1VMBA 1JX4A 1BXNA 1NUEA 1QE1B 4K50A 1WI8A 2GA7A 1S7HA 3K58A 3QB0A 3KUGA 2PSZA 1M5KC 2WFBA 3FGVA 1XNSA 5EUHA 5IV4A 5C25A 4XUSA 1BPDA 4NXMJ 5JS1A 1F5AA 4BRLA 4CD3A 5EVZA 7FD1A 4DV1J 3EEQA 2KK0A 4IOBA 5IXUA 4CM2A 4EYIB 1ZETA 3QNNA 5J0SA 4PWDA 1X60A 2YMPA 4BVPA 2O8CA 4CZFA 5ELZA 2YNIB 2E5LF 2RKIA 2JEJA 3VGVA 3MEDB 1OVYA 1TK8A 1XK8A 3ILOA 4C11A 2R7VA 2KT5A 2IVPA 1NGFA 2JEFA 4NZ7A 2KKVA 2VJ4A 1BDGA 4UOHA 2A10A 1JNZB 3ZX2A 5K8MA 4E3SA 3CJBA 5KFFA 2LYVA 1RSCA 1QQ6A 3EGWB 1KD1O 2OO4A 2Z57B 1H2VZ 2GQCA 2YJFA 3CDUA 4EENA 2EW9A 3W61A 2VPWB 3U1NA 1HUXA 1WCNA 1UTAA 2DXDA 9ICAA 2BRKA 4ZVOB 2VODA 3LL3A 2YNHB 3PRVA 2YX8A 1D9DA 5AQSA 5KFTA 1RE1B 2ZITA 3AAWB 4CH1A 2P8IA 3GE1A 1WWVA 1QUVA 2YY6A 2HBYB 4F2SA 2I0XA 9ICBA 5K20B 3J7AN 2KN7A 2W1BA 3D0HE 3OYNA 3OVNA 1T9UA 4QPXA 3UDEA 1PJ7A 3ETRA 2G1DA 4RUCA 3ENWA 1T6CA 2LBOA 1TUGB 3HFKA 2KYZA 4UW2A 4LF8J 1QQ7A 2ZIXB 1LWFB 2E5LK 1X6JA 4Y2QA 4QIGA 1WNSA 4O4GB 2LDYA 3DMJA 2M0GB 2J9DA 4MKYA 5I42B 1FTCA 4CJUA 1HBNA 1C0FA 4QIWF 3K5NA 3SBTA 5CZ2A 4HL9A 3QWPA 2DWQA 2E6LA 4X4QA 1WF2A 5ALJA 1Y10A 1B4SA 4ED3A 3GDQA 7ICOA 3OSPA 4ZS6A 4LSNB 4EBDA 4IQXA 2UVRA 4NLWA 1VSHA 4F02A 4K8XA 1XNQJ 4PL7A 4XPCA 1X9JA 4Y2CA 4DV7J 2HLUA 4BQLA 2UUCF 4CQ1A 2YNFA 3UKRA 5KFRA 2GV9A 3H6EA 4GKJK 4CJPA 3Q2TC 3EN9A 5F41A 3VQ9A 3LAKA 3OVBA 4GRSA 4KHPF 4JKEA 3BGUA 5JVGL 2D9PA 4UQGA 5AQOA 1DK2A 4K4WA 2V63A 5DBBA 1QVGR 2X6NA 4H0TB 3OVSA 1LWCB 4DR1J 4M9NA 3GB0A 4IEEA 4JKFA 6FD1A 3U7JA 3I56S 3RW7A 5KFGA 1TUYA 2WF5A 3ZX0A 4QBUA 4A8MP 4M04A 1X9MA 1LXNA 2XULA 4PKIA 1DARA 3J81Y 3N7RC 4Z94A 3RMCA 1S0OA 4M3WA 1PJ5A 4OI0A 2YPYA 2OSRA 3J80U 2UUCK 4TUPA 2ACYA 2EI5A 1FRHA 2FD2A 2W3SA 2V5HG 5CZXA 4CF0A 3JPNA 2L9WA 1RXVA 3DGPA 2ZOFA 3CI5A 4KLHA 3TZYA 3D7EO 4XH1A 3WKEA 3S3NA 3O8MA 4MMOA 2HYIB 4KHPK 1WEZA 4XIUA 1F3FA 5HMXA 5DO2A 4WZQA 8ICGA 4B1UB 1S6OA 3M30B 2K8AA 4E8UA 1E3MA 4DU1A 1RPLA 1NO8A 2AX0A 3UE5A 1B22A 1B9DA 3F53A 4F91B 4FP9A 3RB0A 4DTRA 1CJKB 4I6YA 4KGVB 3IBWA 2L41A 3V1OA 1IBKF 4RNNA 4FJJA 3FZFA 4JN4A 1TL7A 4KLSA 2FY8A 2H1YA 2B0CA 2YI1A 1KLMA 1BQMA 2XQCA 2GMLA 4KKOA 3CUNA 4Y00A 1U4BA 3B0XA 5E41A 3MAAA 1B0PA 2NZTA 3C28A 1IWGA 2GLEA 8ICBA 1ZQFA 2UXCF 1ZAVA 2GMHA 3OYHA 3MM9A 2VWJA 2VGMA 2FF3B 4HUEA 1GMUA 2DIVA 4PHEA 2BQRA 1RWKB 5E3QA 2J6UA 3HJEA 2MKIA 4Y0WA 4KFBA 2K8GA 1KKXA 2WONB 3O1WA 2OEKA 4RWTA 1HQEA 4RNFA 2V4RA 1KDHA 2DNKA 1TUVA 4PXEA 4BRNA 2IRUA 1CI4A 1AQ6A 3UMGA 4GIBA 3C14B 1Q46A 2HS4A 3NGTA 4ELVA 3TR8A 2GX9A 2GO7A 2FJWA 3I56N 5J2MA 1SH3A 1N34F 2P9LB 1IBKK 4DV4F 1N56A 3S3MA 5J2KA 1JN3A 2FBXA 1S1VB 5BPNA 4XQ8A 4DFMA 1UKUA 1YWXA 3DU5A 3QESA 2ITMA 3QQCD 1TR0A 9ICNA 2B8PA 4NYZA 2RF2A 1UWBA 3NCQA 4LRFA 4DTPA 2UXCK 1ROFA 1KDNA 1LB2B 1VHXA 4K42A 2VV5A 4DFJA 4F5NA 1RADB 3CWJA 4CLFA 3NF7A 3G8TA 3NOCA 4Z37A 4UB2A 3UKUA 2DGQA 2QYGA 1HX1A 3L2QA 5EE9A 1CZBA 4F4KA 3AVKA 4BBYA 3LP0A 1NM1A 1AFIA 2WMMA 1RDFA 1RNHA 4DHYA 3BPDA 4PXBA 3TAPA 2DO4A 3RAXA 1Z00B 1N34K 4AL7A 2ZJ8A 4DV4K 4MLHA 4IXCA 3GG0A 2QFJA 3RUBL 3U1LA 3GV7B 1RI7A 2PFUA 5AT1B 1PKUA 5AK3A 1FNOA 3LZIA 2PBDA 4PZOA 2CXEA 2G08A 3VV2B 5HMMA 1WSRA 4CBUA 4OYMA 2VUGA 1NBWA 3GR0A 5A2QO 2GJ2A 4QR0A 5DDQC 2Y1RI 2N1RA 1LKYA 4OZNA 4NJ8A 2H51B 5A8WB 4RW7A 5C12A 3IGVA 3VQAA 4BR4A 5IZHA 2ZHAA 1FTRA 4B8CA 4WIIA 1U6FA 2AQ4A 1KQQA 1RT5A 5AQXA 2UVWA 4LF7F 4DV3F 3QETA 3E3XA 4K8RA 2LXFA 1MU2B 1TL5A 1UZHA 4JBCA 3NP5A 4MK9A 1HNWJ 1F0MA 4KPYA 5F0WA 2HG4A 3WKCA 3ITHB 1NGHA 2QKQA 1R3NA 2E8OA 3UPFA 3HP9A 2VASA 3HVAA 4I1TA 5BOLA 5D4PA 3VN5A 2PIIA 4CBWA 5M1FA 3UQ2A 8ICYA 1L7NA 4ID1A 4IH6A 2QM1A 3CD6S 3UD3P 3SMSA 3QPIA 1R8PA 1NJIO 2RUSA 1HWUA 2L9NA 1HR0J 2HNZB 1IKYA 3QJJA 4BQZA 2KVCA 2FVSA 4EU0A 4FXDA 1T3VA 1COKA 2BA9A 4ZIWA 1AUSL 4A47A 2XY6A 4LF7K 4DV3K 2VBWA 2ILYA 1RLCL 2D9OA 2DISA 1M1KT 2XMMA 4P6QA 2W25A 3OTBA 4I67A 4FO6A 4OPHA 1Q0NA 3JS9A 8ICPA 4DPUA 5KRTA 4JK1A 4JB8B 3CETA 4IFYB 3CJ4A 4ZPCA 3SK3A 1QE1A 4LBIA 4K4UA 1VQ9S 4RU2A 4F0KA 2BQ3A 3VA0A 3RJFA 3PJ9A 4U67L 5AQZA 1GLAG 3GIKA 3WZ0A 4YEAA 1B99A 5ADZA 2KFYA 5GTHU 4P4MA 3EW9A 4DSJA 2CJYB 2FE9A 3L2RA 4Z4FA 4HT5A 4ECWA 3SENA 2Q97A 3LP1B 3IG1B 2HHXA 4B9VA 5J0TA 4OV1A 2EZYA 1X5SA 2GO9A 2E9RX 2YNIA 5CHGA 4JI2K 2VFUA 4E1MA 5GMDA 2HZVA 5HMYA 3MEDA 4FZVA 5DBAA 2FI1A 1SI9A 2ZIWB 2BE7D 1VQLS 1CC7A 1Y11A 2H9ZA 2BUNA 2O1PA 2GVDB 3JSMB 3W3SA 1FT8A 4YB6A 2KG5A 1CZAN 3VQ4A 1B3TA 2G8UA 4PZVA 1LAVA 4NWBA 1XQSC 4LFCJ 2YNHA 2KJVA 2HVDA 4RQ5A 3TPQA 2YKNB 1Q95G 1KW4A 3CULA 3NKYA 2C2NA 4I2QB 4FJ7A 1RLDA 3TJ9A 4Y1DA 3ZC4A 4IQTA 2GV1A 3OTQA 2IDOA 3N4WA 1WSJA 4KY3A 3G6YA 1ZM9A 1LVHA 3NL0A 3QUQA 2GWJA 5AE1A 5LMNJ 3OV7A 3B9JA 2X7IA 2ZIXA 1OYEA 1FRXA 4OKJA 1LWFA 4CZGA 2XBPA 5J2JA 4CHNA 4DU8A 3BQ1A 4PY5A 1KAYA 5I42A 2JFKA 2Y1JA 2HBZB 3RRHA 2ZNZA 4OX6A 4UY8T 3OA9A 2CPYA 3KHRA 2IGIA 1H73A 3C2MA 3PYFA 1VQ9N 1SJFA 2DD8S 4HWIA 3ISZA 3P49B 4LRCA 3PVXA 4LSNA 5IT9Y 3S7RA 4WE1B 3BR9A 2ODGA 3BN4A 2X74A 3TANA 1I3AA 6FDRA 3OUYA 4ELUA 1ECWA 3D0GE 4W5NA 3BO2A 4XTTA 3C8YA 4O5EA 3CF5Q 4PL8A 1UA1A 3CHWA 4DS4A 4AYBD 1EP4B 2J0SD 2CN1A 1WSVA 4ZDNA 3OVAA 2YHAA 5AM5A 2HQGA 4F4XA 2IOFK 1X7VA 4UATA 4O9MA 4KR0B 8ICVA 4ZPTR 1VQLN 1UVLA 4FBTA 5DJBA 1VBYA 1FO4A 5D8HB 2WSEC 2PYJA 4OQJA 2ZIVB 1HNZJ 4LFBF 1YLXA 2C3OA 1WTFA 5JICA 2H48B 2YMLA 4CJ7A 2E88A 2CJBA 4FE3A 4MIWA 2GAGC 4W5TA 3EKUA 3NTUA 2U2FA 1I94F 2Z2YB 1NSKL 3NAHA 4ECVA 4UBCA 4P7TA 2PKEA 4AHSA 3ZDBA 2KKZA 4NL9C 3AQPA 3BQ2A 2ZZNA 2GIQA 3R5DA 2AEMA 5GINA 2ZVIA 2EKNA 3QRPA 4LR8A 3BBCA 4OZ1A 3L9ZA 2DNNA 3O6WA 2UYTA 4M63A 1VC5A 1ZQYA 2I2YA 1WCLA 7ICSA 1SS6A 2X3GA 2CQPA 4RQ4A 1WAFA 3NF9A 4NLQA 1KOOA 3OPXA 2V69A 4QJVA 3JSRA 3KVGA 3U6FA 3EYZA 1ZA1B 3M30A 4MK7A 3GLJA 1VDHA 4YN4A 3TU5A 4LFBK 2GBZA 3TQ1A 3KOOA 4LMZA 1GO3F 1Z1VA 3AO4A 1S5ZA 1WHVA 3UMBA 4PAAA 4RUAA 1U2VB 3QX7A 1CJKA 1U8WA 5FDLB 1I94K 2CRLA 4CGGA 1RWVB 2CZ9A 1SXLA 2P1JA 3DOMA 3J8AA 1HEKA 3GYGA 3AD7C 3THYA 4Y0FA 1RDCA 3S01A 2K06A 2V50A 1V9PA 1KHWA 4NLZA 3R7BB 1X4EA 1FEHA 3PKMA 2DO0A 1WDTA 2IA0A 2DGSA 2A1JB 2DHHA 3WEEB 3GP9A 3N5FA 3WK9A 3MDQA 3L7UA 3DKDA 1N36J 1W25A 1NNDA 1KVIA 3VCBA 3S41A 1N33F 2HKEA 1NMNA 1RT7B 3D4JA 5LSRA 2R8KA 4QWBA 4O5CA 4NLSA 3PRDA 4KX5A 1DQAA 2KD1A 3ED5A 4AXJA 3C14A 9ICUA 1KFDA 2WAQF 2ZTCA 3NNHA 5C42B 2OHDA 3MX5A 3V2UC 3SJHA 2ITGA 2OMOA 4TYBA 1X4BA 2P9LA 4OKKA 5ALMA 3FFIB 3HSDA 2XY5A 1Q81T 3CMQA 1NLVA 1S1VA 3T1YJ 1OQ3A 3WU2U 2CPRA 4E7HA 1YI2S 1ZS6A 5I3UB 4AT1B 2Q66A 1F9HA 4DOBA 1V4SA 4FYWB 2YCHA 4RWWA 1K1QA 2LQJA 3DXKB 4P2SA 1LV5A 1GAOA 2CGJA 3DXSX 3N01A 2HHHJ 5KFCA 2UUAJ 2N3LA 4MTPA 1U8SA 2MKCA 4JI8K 4BHQA 4DR5F 3FEXB 2ZWHA 1FK9B 5IC6B 1N33K 1Z4NA 2DXEA 4RPYA 1IXKA 3NBPB 3R1HA 4DR7F 1RBAA 4BC5A 1DBDA 1Q79A 1A7GE 2ZHBA 4HH1A 3ZEUB 4F5QA 4IQWA 2V2VA 2W8KA 1NK6A 4P71A 2PGCA 3IRWP 3SSRA 2AW0A 2NRTA 1Z00A 4KLUA 1C4AA 1U0HB 4IFVB 3SXLA 3FUYA 2EHGA 3MGJA 4U95A 1S9GB 2WB1C 5EXWA 1ZQVA 4LBHA 2I5JB 4CGIA 1S12A 4B08A 1BC6A 4TURA 3NGZA 2Y1LB 4FNIA 5J2GA 3VQQA 3VGSA 4C8ZA 4F2RA 4UB8U 2GCFA 2G9OA 3AGKA 3VF4A 4K0KF 3TUIC 2MY8A 2E3TA 4NLNA 3NF6A 4G1IA 2R9LA 4FLUA 4OPAA 3OXFA 5ALHA 5AR0A 5J1EB 1S6UA 4O8KA 2LA6A 1W2BM 4O44A 4CE6A 1WAJA 3QMLA 3NVKA 1KOHA 5A8WA 4DR5K 4HUGA 2H3FA 4J37A 7ICQA 2P5VA 5HQ8A 1BG3A 4DR7K 1XU4A 3Q0AA 1RTZA 5KNIA 2K4EA 1U24A 1SH2A 3ADAC 3VAJA 5KAIU 4TNOA 5AXNA 3N28A 4NY8A 5KFAA 3T9NA 4C7QA 3EGVA 1MU2A 4JUZA 2C3YA 5F8MA 2G8KA 4YD2A 5KFQA 3B82A 1YI2N 2MMYA 5E3CA 1VRUB 4OHZA 3RR8A 3ATVA 3DLRA 4RNOA 3BKUA 5FLXY 3ITHA 1KD1T 1PVQA 1KTVA 3ZSWA 5TKWA 3SPZA 2BGGA 2EAMA 4IUFA 2F1JA 5CEHA 2DHSA 2HAIA 1U1OA 2ZDPA 3KJNB 1ZQPA 3HPHA 4K0KK 5CR0A 3A8IA 1KQGB 4B3MJ 3UVJB 1IKXB 3TADC 2V8HA 2DITA 2HNZA 3KJQB 2HFNA 2P9EA 3A5MC 5D77A 5EE3A 2MQMA 3DLKA 4J8FA 3LAMA 3SQIA 1T3QA 3G86A 3FRZA 2WW8A 3J7YI 1S6PB 4ILGB 2DL0A 4C8NA 3E2EA 1HA1A 2RRDA 1N5XA 2C28A 4EO6A 4Z4GA 5AM3A 2LQ8A 4NLGA 4IFYA 3VAHA 4NO7A 2DEJA 3V6DB 3P6YC 1TP7A 5AHXA 3OTOF 1UAXA 1RJJA 2HZCA 1WNEA 2GC8A 2KFZA 3G10A 3NNAA 1S10A 5ETOA 1S3XA 3LP1A 2H3VA 3IG1A 1SWVA 1QZ5A 5AQFA 2FVPA 3ZZZA 3JYTA 2A2CA 4CDGA 2P9PB 3EICA 5DGBA 1FWLA 2GS8A 2GIFA 2P5OA 3FK4A 3ZT0A 7ICUA 3SNNA 2H4WB 1FFWB 4FWPA 2Y0BB 3RVCA 2ZIWA 2N82B 2HOFA 4CFAA 2JVOA 4BR9A 2G0IA 2GVDA 3JSMA 5D4BA 3E01B 5KAKA 2NRZA 4KBOA 2HVZA 4Q2LA 1X0FA 1L3TA 1SAZA 1HIYA 3D2FB 1Y64A 1WC4A 1NHVA 3I33A 1NDLA 2AH5A 2CNLB 2MZJA 1IH7A 4WCEL 1Z1ZA 2EG2A 2DKOB 1K44A 4IFEA 2YKNA 3T6BA 3OTOK 1FJEB 4CECA 2IRXA 2PFDA 4U8YA 4I2QA 4KX3A 1Z26A 4TKTA 5ETPA 1VGYA 2WVCA 1UEKA 4RX6A 1Q7YO 4HI1A 1VJ5A 5CR4A 3JB9k 5JJBA 2AMCB 4I2PB 4X84A 3N4MB 2KXHA 2WK4A 4EX7A 1OWXA 2YMQA 3BY5A 9ICPA 2MQ8A 1HYSB 1BO5O 3KIOA 4AHRA 3QINA 4A8YA 2PD1A 4FK4A 2UUTA 5DM6L 3RR7A 3DLLL 4X2BA 3MC1A 2D3UA 2RH3A 1RABB 2RNEA 1ILYA 3VEYA 4FJKA 1F6TA 1U1QA 1U1MA 2LPEA 3OTCA 3V6KA 4WE1A 3HHLD 1FF2A 4H54A 1JLFB 3CJ9A 4M9JA 5JS2A 1QHTA 5EX3A 5H2FU 1Y3JA 5GIPA 1S72S 1RACB 3MEEA 1EP4A 2YWKA 3AQEA 1S1UB 2GFFA 5AKJA 3JAMO 3R8EA 2MLZA 5CHCB 2VB6A 3E1YA 3BGOP 1X9XA 3L3VA 4LD0A 5C7PA 2RDDA 3ENOA 4P2FA 2W42A 5B0EA 3A4TA 2JHEA 4XDDA 1IG8A 4RQ3A 1PYTA 1MWKA 3QAEA 4NXMF 4F93B 4TLRA 5BRFA 2ZIVA 4YOTA 3CXCM 5AQMA 4FZZA 3ICLA 1HW9A 2OPRB 3H4BA 3O8WA 3DNCA 4X4RA 3AVMA 3PIOL 4OD0A 5J1PA 3ZZUA 2XS7A 3L6QA 4CO2A 4OPKA 4YMMA 3ZDCA 4U7UD 1D09B 2W01A 1BHLA 1YXQA 2F40A 2WB1F 4YR0A 2GH1A 3NEKA 4TSXA 4HYKA 3PR4A 5HRNA 1VSLA 1N88A 1EJ7L 2ZWPA 3T3FA 3SQ1A 3R2CJ 4BGBA 3WKAA 1SV4A 2JRSA 2CPZA 4WFYA 3FC4A 4E7IA 5G0RB 3CJ2A 3GZ7A 2M8DB 4F5OA 5J0QA 3MPWA 1T0TV 4KTWA 3RH5A 2YX4A 1RXOB 2HQ3A 3QNOA 3IO1A 4NXMK 2M0NA 4Y34A 4KGKA 1I6JA 3QDKA 4M6WB 3QXGA 4DV1K 4XPEA 2E8AA 3KUHA 3QU2A 5AM0A 1U2VA 4FPIA 1Z6RA 5FDLA 1PAUB 4LF8F 1B7FA 4A8SA 4LUBA 3M3ZA 5CYJA 1K0VA 2JH1A 3LDNA 3F9KA 4XDCA 2F1IA 4CJSA 3DHWC 2RLTA 1OUQA 3RAQA 1J9AA 1OQ6A 3DDNA 2MLYA 1S72N 3ZSQA 3F2BA 3EVWA 5AM1A 4TY9A 3GL1A 2U1AA 4W98A 5ALVA 3VQSA 3MGHA 2F1FA 3AVHA 4A46A 4R8UB 3FYHA 2AV5A 2A1JA 3IRXB 3WEEA 2KKPA 2A41A 2CH5A 4CNQA 2I9GA 4ZCMA 1YIJS 2VDIA 5DB9A 4HHTA 1WBDA 3F2CA 4ICAA 1XNQF 4TUSA 1RT7A 3BYPA 3PSPA 2A1BA 3NRBA 2HMIB 4PUOB 4DV7F 1FEEA 1U1RA 2EWSA 1JXLA 3M6XA 3GV8B 1A0OB 3QIPB 5C42A 2P6SA 3AA8A 1DRGA 3OT9A 1A6LA 3CNQP 3PLAA 4LF8K 4USTA 4KJIA 2FXUA 3FFIA 2WVBA 1YVNA 1IM4A 4JI7J 4RBUA 4DQIA 5HJXA 5JXSA 5G5GA 4NCGB 1UZDA 5I3UA 1ACMB 3D1QA 5GMEA 4RW9B 1ZQTA 3LUYA 5J2IA 1UVKA 1YX2A 2QO3A 4B9TA 4MYUA 3MOZA 2CYYA 4DR1F 2BBEA 4UF4A 2JZBB 2E6MA 1ITPA 2KIVA 3KK7A 2UVVA 4PHAA 1N5TA 1OPIA 2QLBB 2MQQA 1WLJA 4BC7A 3WXLA 5LJ5Y 1XNQK 1FK9A 2CPJA 3NBPA 1X5PA 1NJIT 1JB0C 3ONNA 3ZEUA 1IO2A 4DV7K 1WHWA 4ZPAA 4PGXA 3PW2A 1WKLA 2ZH3A 4ZLLA 1NB7A 4WQ5A 1U0HA 4IFVA 4J9VA 3CJQA 2OELA 2HWTA 3HOSA 3LGHA 1S9GA 1ZPVA 2Z2MA 5F1XA 2ATLA 2R2RA 2VG7B 1UW9A 3VESA 1FNMA 2I5JA 4H03B 3N6LA 3KLHB 4DR6J 4Q5VA 1RWMB 1JCFA 2N7CA 2GHVC 2KICA 3NS7B 5DETA 3RB6A 4M7YA 2E2QA 4PHTX 5CB1A 1DT9A 5L38A 5RUBA 3UR0A 5SWMA 3EWAA 4N7TA 5B5EU 1RCXB 4NLDA 4P52A 3AA5X 2E1FA 3KFWX 3M32B 1IV8A 4DR1K 2RQCA 5JLFA 1YIJN 2M3DA 1NLKL 3A2FA 1N0UA 4DN9A 5J1EA 2GZOA 5ETNA 2P6UA 1OMSA 4RBVA 1IM6A 3QUCA 2VFVA 2QB0B 4H4MB 4CFDA 3KHHA 4DSIA 2WW4A 4CW7B 5CQGA 1F9EB 2XICA 4QWAA 2KIWA 3FZHA 5AQRA 5J2DA 1RTJB 3OQ2A 3SUQA 2F65A 1P8GA 4WFAQ 3R5BA 4CERA 1FRKA 3SR6A 1U1KA 4Z6FA 4CO5A 2VWKA 2WB4A 2LQ5A 2XO7A 4NLYA 3W66A 1VRUA 4CLWA 3GYXB 4OCZA 3AU6A 2AYEA 4YCXA 3CJKA 2R7SA 4IQMA 3RSEB 1I51B 4KHNA 1J27A 2P9UB 4XH5A 3C94A 2W7AA 2IAJB 3TARA 1XERA 4GKKF 4GNIA 3PUFA 1ZQZA 4H5NA 2FHMA 2V4JB 4RNHA 2P5GA 4OYAA 3UVJA 5H9FJ 2C42A 1IKXA 5AQNA 2IJRA 3O3FA 3LWMA 2PFPA 3S8SA 1RTHA 4C3LA 4B9SA 2NRXA 3L0QA 1ZQNA 3KYLA 1S6PA 1XHZA 4C4RA 3O9UA 2GJFA 4DR2F 4CGZA 1FFUA 1HNXJ 4CF1A 1NGDA 8ICIA 5DMRA 2M7SA 3WNFA 1N5YB 3LDAA 1OO0B 2K4HA 3VQ7A 1PBAA 2XEXA 1EIYB 1ZD4A 1KNZA 3WNHA 1V9OA 3V6DA 2KSOA 1KVJA 2FSJA 4GKKK 1A5XA 1VOMA 3SEIA 3G0ZA 3QLHB 5KPRA 1T05B 5IOLA 3MCOA 2P9PA 5CH7B 2FJEB 1CVJA 1NSQA 4MO5A 3H2VE 2V8GA 5ALRA 4QZAA 2OPQB 4CZHA 3PO5A 3NGKA 1GLBG 4HLBA 2BPCA 4UTGA 3FCVA 4ECXA 3T19A 3M2UA 3E01A 5FD1A 3QGIA 1R27B 1D8BA 4RUHA 1FDNA 4K4HA 1HPZB 2MQOA 2BCSA 5CZ1A 2CXYA 9ICCA 1RA7A 3MAQA 1FX4A 3Q8SB 4FLYA 4Z2XA 5HR7A 2R8IA 3C5FA 2KJWA 2PI4A 2NUUG 4QPTA 3BZKA 5F8NA 3W8GA 3OJUA 1ZQAA 3I87A 4MYTA 3RBEA 1N6QB 1SL1A 3GILA 3H25A 3K8WA 5DLFA 1FESA 2R2SA 3ZCMA 4X4NA 2A18A 1HNWF 4N77A 3FMWA 3ZZRA 2KM8B 4Y2AA 1SKRA 4QWEA 1WC0A 4RZRA 2QA1A 3IGNA 4KLLA 2HBJA 4HTIA 1S4FA 2NXEA 4QZ8A 1P9YA 1T3NA 3K9JA 3M6ZA 4J7CA 2JH7A 2HWHA 4ZCLA 3FZLA 1HR0F 5B08A 4AILC 2OM6A 1WC1A 4ECRA 4QW9A 1FERA 4HVJA 1HBMB 3OYMA 4FF4A 3PDNA 2GGPB 2DNGA 4QWCA 2D3DA 4FPBA 1JLFA 3PYDA 2K3IA 3RTVA 2HSTA 4Q8FA 4AFFA 3NH0A 1BQNB 7ICFA 1S1UA 4HTLA 1RTDA 2D69A 1HNWK 1PGZA 1ZQXA