1NJYA

Thymine-thymine mismatch at the polymerase active site
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 214
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njyA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njyA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njyA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njyA01
5J0QA 4CGGA 4P4OA 4FLUA 2PFPA 1TGOA 4ECZA 4F2SA 1RBUA 4IBNA 2E6MA 2HHUA 4KTZA 3H4DA 5FDLA 4IQUA 4O3PA 1D9DA 4O44A 1SKWA 3SYZA 3C1ZA 1YTUA 4ED7A 1S0NA 4C8KA 3V7LA 5DLGA 1Z25A 1BPDA 3RJHA 1K1QA 3AA2A 3MEEA 4R63A 3CM5A 2J6SA 4FLWA 1W9HA 4LH4A 5J0UA 3RB3A 1BCMA 4IRKA 3S3NA 4RQ1A 4ICLA 3IS9A 3AV9A 1QS4A 5HRRA 3NDKA 4BDYA 1ZBLA 3DLEA 2AGOA 2NRXA 1QSYA 3AVIA 4DMNA 3RRGA 3OYHA 4FM2A 7ICJA 4KMUA 3C2LA 4CJ3A 4M3ZA 4UAWA 5DB9A 3HX0A 4JRPA 4CHQA 1LAWA 1NOMA 1ZQTA 1J9AA 1LV5A 1LWCA 5J0TA 5D4BA 1VSMA 4OJRA 3UXOA 3VQ5A 4CERA 4DSEA 4MF2A 5HROA 4M6WB 5KFDA 4IKFA 1IKVA 3ZT2A 3PO4A 4ELTA 4HUEA 3V6JA 4O0IA 3SQ0A 5KFVA 5HNKA 3A2FA 4PHDA 4HVJA 4ECTA 3VQ9A 4F5NA 2ZUDA 4I2JA 4FJ9A 5CA7A 4FJGA 7ICPA 3LWLA 1ZQFA 3PY8A 1S1TA 1XHZA 3QLHA 3OYGA 3MABA 1RT7A 3NGYA 1XHXA 5HHHA 3HW8A 4DTMA 4UQGA 1WSEA 1SL2A 3AVBA 4Z6DA 5J0OA 1TK5A 4YFUA 3LAMA 3AVKA 3M8RA 3T1AA 4CGFA 1TAUA 2X6NA 5SZTA 1DOQA 3TAEA 5J2NA 1BQMA 2ETJA 3AVLA 2FPLA 1ZQZA 4QZ9A 3ZDBA 1RTHA 3JPNA 4TUPA 4F2RA 3HVTA 7ICKA 4FS1A 1IXRA 4M9JA 3OYMA 4OGEA 4E1NA 5JS2A 3P5JA 4AHSA 4F8RA 4FLYA 4DTNA 4F4WA 3AO3A 2KTQA 4TSXA 3QETA 4PHPA 3KK1A 2RPIA 5HBMA 4PWDA 2OPRA 5KFMA 4I7FA 8ICIA 3QEVA 2BGWA 1RXWA 4GXIA 4CHPA 1ZQHA 3Q8KA 4YG2A 5KFGA 4QOZB 4CF1A 1I39A 4I2GA 3RRHA 4FM1A 2XHBA 5KT5A 1LB2B 4IG0A 1N56A 1A5WA 1RTDA 5KFKA 3VQQA 1VSEA 3AA5X 3IAYA 5J2IA 3QIOA 1QTMA 3EW9A 2W9BA 1ZBHA 3TAFA 1B43A 1UWBA 5L1JA 2HNZA 2P6UA 3VQ4A 3V4IA 4J2DA 1RTIA 1U45A 1XSPA 8ICPA 4FLXA 3LDAA 1TVRA 3SUQA 2PFQA 2GUIA 1RYRA 1KVBA 8ICGA 5J2BA 1JX4A 4FJHA 3MR6A 4DU1A 4F5QA 4DU4A 4FJ5A 4NCGA 2AGQA 3GIJA 1HMVA 1FXXA 4O9MA 4EBCA 1C1BA 4G3IA 1VSKA 4O5BA 2A1JA 4NCBA 4LY7A 8ICQA 3ZSVA 4FK4A 5J2EA 4JUZA 3JPRA 3CG7A 2OYQA 8ICWA 3OHAA 3AVMA 1COOA 4XRHA 3RH6A 4J9OA 4I2QA 1RPLA 1JXLA 2FLNA 3M9MB 5KFIA 3DI6A 9ICKA 3QNOA 2ASJA 1HUZA 3M8QA 3HP6A 1NOYA 3SV4A 4FJLA 4GMJB 4KN7A 3MDAA 3K57A 2FBXA 3MFHA 4CJKA 2PI4A 4CECA 3OYNA 4FCYA 8ICXA 2LSNA 5DBCA 4CJ5A 4O3OA 4KLOA 1FKOA 4XQ8A 2Z1GA 1J53A 4B08A 1XS9D 2KQ2A 3H8WA 1TKZA 1WSJA 4ED8A 2YNHA 4N5SA 4OPJA 2ATLA 2W42A 1CLQA 5KFPA 1S10A 2M9NA 4F3TA 2FPMA 3FFIA 2XY7A 4J9LA 3V9SA 2X74A 4IQWA 4E7IA 3MXIA 2R7YA 1U48A 1NOZA 3KLHA 3VA3A 2Q3SA 3T5LA 1S1XA 4O55A 5JS1A 2JEGA 3JPPA 5J2DA 3VQCA 7ICFA 4ELVA 1KCFA 3QE9Y 1WAFA 2F8TA 4M04A 2V9WA 5DQGA 3MFIA 3N97B 5T7BA 3JPQA 3WNHA 1EXQA 3RBDA 4IR9A 4DEZA 5HRSA 4PY5A 1BI4A 4KLFA 4FZXC 5J1EA 4KLJA 4CHNA 1I3AA 3HSTB 1TV9A 4CEFA 1FK9A 2R8KA 4HHTA 1TFRA 2BKEA 3G0ZA 2MAXA 4DQPA 1WSFA 4KITB 3C5FA 3TABA 2BQUA 1YTAA 8ICUA 3TFSA 5J0YA 3G6YA 1ZBFA 4ECXA 2C2RA 3B0XA 3H4BA 5KFRA 4GC7A 3AO2A 3QESA 7ICOA 1L3SA 1LW2A 3AVCA 4RUAA 4W5TA 2GWSA 4JS5A 3H40A 3DRRA 4M3UA 1ZQPA 4B9NA 4E89A 4KKOA 3DM2A 3BQTA 1Y88A 4EYHB 4M3RA 1A5VA 1S9FA 5DB6A 3HO1A 4I2AA 5KGXA 4F50A 4M2YA 3KK3A 2X6SA 3RMBA 3KK2A 2AU0A 4DTJA 5CY4A 2XY8A 1L3UA 3DLKA 2G8UA 2WONA 4CEAA 2HHQA 5L1KA 1KVAA 4ECSA 3SPZA 1X2IA 4EBDA 8ICNA 1UAXA 3VQPA 1D5AA 1N48A 5DG9A 3OGUA 1S1VA 2JGUA 4QZEA 1DLOA 1S6QA 1A5XA 1CXUA 1HJRA 2BCQA 5D46A 2FLPA 4F91B 1KTQA 1MQ3A 9ICRA 3T5JA 3O3GA 5BOLA 3ZDAA 4TURA 2JEFA 4Q5VA 1JLBA 3OVNA 2PYLA 1BI4B 3CFOA 3V1QA 3L3VA 1N5YA 8ICLA 5KFJA 4O5EA 3ALYA 4AH9A 4H4OA 4XA5A 2F8SA 1ZQSA 5KFZA 7ICSA 2R8JA 5KFNA 3ISBA 2IDOA 3BQ1A 1PZNA 4RQ3A 1L5UA 2HHWA 2HHSA 3UQ2A 5L1LA 4IFVA 9ICJA 1S77D 3ZD8A 2QKBA 2W9CA 3OYKA 4PQUA 2FPKA 4R65A 3V6DA 4KREA 4JWNA 1RT5A 2XO7A 4C8MA 2I1QA 4OLAA 2ITGA 1S0OA 1Q9XA 3PO5A 2ZQBA 2MUTA 5DLFA 4BDPA 2Z1HA 4BGDA 1TKXA 4RQ2A 4FK2A 2R8HA 2BCRA 4F4YA 3RR8A 3VQ8A 3MXJA 1S9GA 2W8KA 1ZQVA 5KFOA 1C0TA 3GIMA 2P1JA 1Y97A 4FW1A 4NYFA 3ASMA 4KI4A 5HLFA 1VSLA 4I2PA 4AILC 2ATQA 2X78A 3K5MA 1T05A 4ED6A 5CZ2A 3ZSOA 8ICEA 1XC9A 3LP3A 4KLUA 3SI6A 2EX3A 1SUQA 1WCLA 4O0JA 1H38A 4Z0UA 4NCAA 7ICVA 4Z4GA 2HNYA 5KFFA 3ZT3A 3OYDA 4UB3A 5DG8A 1NK8A 2HHTA 2YKNA 3NAEA 4RT2A 4KLDA 3AU6A 2IS3A 1EP4A 5CHGA 2UVRA 2PFOA 4QZBA 4CE9A 2KW4A 2D0CA 2W9CB 7ICQA 1N6QA 4CK3A 3K5NA 4OGCA 4KHWA 1L3VA 4R5PA 3OYJA 1K1SA 2G8KA 3LZJA 2RKIA 2AJQA 1RT3A 3KTQA 5KFSA 4FJNA 2XGPA 3NBPA 4OKEA 4DL5A 1S6PA 3OYLA 1QHTA 5E41A 3OYCA 3S3OA 4RT3A 4YMNA 4YCXA 3RBEA 4QZFA 1HNIA 2DFEA 3HPGA 1NJXA 4M9NA 4KLEA 2Z1JA 4CJUA 5D49A 3SUPA 4DQRA 3ZDDA 2XCPA 8ICYA 3U3GA 4G1QA 4N47A 3ZDCA 4CJVA 2ZUCA 3L2VA 1VK0A 3I0SA 3RMCA 4Z4IA 1ZQUA 1RDCA 5HHIA 1BIUA 4FVMA 4CEEA 3CQ8A 3C95A 2PFNA 2HW3A 8ICFA 4NM1A 4QW9A 3GIIA 2DPJA 2R8GA 1XO1A 4B3OA 2XGQA 4CF2A 3P1GA 7ICGA 1C1CA 4CEQA 3E2EA 4CHZA 4BDZA 4Q43A 1WSHA 4J9SA 1ZQKA 1Q8IA 1LWFA 4M42A 2Q0ZX 4DL7A 1SKSA 7ICTA 2NRWA 4QZIA 1XSNA 2E4LA 5EWFA 4R8UB 3AUOA 4MQ3A 4DSFA 3QERA 2C2DA 4M0AA 4JV2A 4CJEA 3TFRA 1J5OA 5KFEA 9ICMA 3K5OA 4YN4A 3IHQB 3GIKA 1JL1A 2G8FA 3LWMA 1RT1A 4BXOA 1D8YA 3QINA 9ICEA 3T3FA 4K4GA 5C25A 1S97A 3UXNA 3MR3A 2RDJA 4I9LA 4H4MA 1TAQA 3HYFA 3NHGA 3DMJA 4CHYA 1ZBIA 2QK9A 1KRPA 4AHUA 4P4MA 4AHTA 3RMAA 1S9EA 1HPZA 4YR3A 4CFDA 4ED3A 4I2CA 4YMMA 4MFBA 3GFKB 3H8SA 4ED2A 4FO6A 3ZSZA 3T19A 2EHGA 1VSJA 5KT7A 1RZTA 1RT4A 4J9MA 1TL1A 1T8EA 4YFKA 4LZDA 3OS2A 4CK1A 1MC8A 3ZCMA 5J2MA 3V72A 4XUSA 4O3SA 3AA4A 3ITHA 2BPFA 3QEAZ 2KN7A 1JMSA 3CM6A 3HK2A 3TQ1A 3OYFA 4I2IA 1IO2A 1X9SA 1ITGA 4M45A 3BJYA 3RB0A 3TWHA 1KLNA 3NH1A 1ZQDA 3OSPA 4AHVA 4CEZA 4CK2A 1EX4A 4CESA 1F21A 3PW2A 1HYVA 4LH5A 1RBTA 3DLGA 4M41A 4FJJA 4KTWA 1U04A 5EWEA 1ZYQA 4C8OA 4GVMA 4KFBA 4BXOB 5DK5A 3V9XA 4B9UA 3V9WA 8ICRA 1NKEA 2FBTA 3RJGA 1NJZA 4Q0BA 4RG8A 3TANA 1S76D 2D5RA 5KGWA 2BPCA 4GW6A 3U3YA 4FBUA 4CJQA 3HT3A 4KB0A 3GDXA 1KSPA 4FJ8A 1VRUA 4ID5A 3UIQA 4KLTA 4GLXA 4DF4A 5KRTA 4CEOA 4F5RA 2BCUA 4X5VA 4MFFA 3LP1A 2DPIA 4DS5A 1RT6A 3V1OA 3I0RA 8ICVA 3C23A 4Y1CA 1ZQBA 4Q8FA 3ISNC 1IKWA 4DLEA 9ICNA 3E01A 4B8AB 3C6UA 3UXPA 5I3UA 9ICGA 3TAGA 3OJSA 5KFXA 2FLLA 1JXBA 4QZDA 3UQ0A 2FBYA 2V4RA 5CB1A 4ECRA 4FJXA 4CJRA 3HP9A 3SUNA 5J2HA 1TK0A 4OLBA 2OA8A 1BGXT 1R0AA 4DTPA 4B9TA 4RW9A 4J2EA 3T5HA 1IH7A 2VG7A 3ZD9A 1T03A 5C24A 1C0MA 3C21A 4KRFA 5CJ7A 1Z00A 3S3MA 3ULDA 7ICIA 3LP0A 1S1WA 4DF8A 2P66A 1RDAA 3OSNA 4W5NA 4AHCA 3HPHA 3DOLA 5IIOA 4DTSA 1CUKA 9ICXA 3BQ2A 1A76A 2HMIA 4YXMA 2VWKA 3RAQA 5EWGA 1XI1A 2P5OA 1SZPA 2XCAA 1IG9A 4RNMA 4CGHA 4PPXA 1ASWA 1LAVA 5KFWA 5C42A 5KG2A 4LZGA 4IFYA 4RUCA 1WLJA 2BANA 7ICNA 1VSHA 1S0VA 5DDYA 3KLEA 1Z26A 2YHBA 4CHOA 4QZCA 4CGDA 4N56A 5KTQA 1LWEA 1RNHA 2IA6A 3QO9A 3RH4A 3O3FA 1G15A 2J6UA 2W9BB 5J0RA 4O4GA 5SWMA 3PX4A 2KZMA 2IGIA 2NRZA 5I42A 4K4IA 4O3QA 1ZETA 4DTXA 4YQWA 1GOAA 1BCOA 1HRHA 1Z3EB 3KKSA 4FJKA 4F4XA 1QE1A 2KFNA 4RW8A 4FXDA 1UOCA 3NGZA 4F4KA 4JS4A 4M3XA 1Z00B 3B6OA 4JLHA 4J2BA 4DO9A 1QSLA 4F5OA 3K5LA 4DL2A 4I29A 3SQ2A 2ASLA 4Q44A 2ASDA 2A1JB 3LPUA 5HRNA 3WNEA 1BISA 4MEXA 2ISPA 3GILA 3LK9A 4KHSA 4PA1A 1DGSA 4Z4EA 3RWUA 8ICJA 4CJPA 2VG6A 3VA0A 1BVSA 4UAYA 3DLBA 4M9GA 5DQHA 5HMLA 3V6HA 3QIPA 4UBBA 4I2EA 4EBEA 2ZUBA 4GXKA 3F9KA 4DSJA 2BDPA 8ICMA 1MSWD 1WAJA 4IQVA 1CXQA 3NF9A 3OS1A 1NK0A 2AGPA 3AO5A 4O5CA 3Q8PB 1KFDA 7ICMA 4XIUA 1ZQCA 5KT3A 4RQ6A 7ICRA 4CFAA 4O3RA 4OPKA 3M9OB 1NKCA 4NXZA 1B22A 2RF2A 4NLGA 3QZ8A 4KHUA 4ELUA 4O3NA 1JN3A 4QWCA 4YVZA 2PZSA 1FKPA 2V4QA 2IBKA 3GV8B 3EPGA 2JZBA 4QZGA 3N4MB 4BACA 4FM0A 2I5JA 9ICIA 4DTRA 3OHBA 4DOCA 3MXMA 3K59A 1DTQA 2VA8A 9ICAA 3JPOA 4JK1A 4I2FA 9ICUA 3PX0A 4KI6A 3AVGA 4NM2A 2ALZA 3VQDA 4EZ9A 4ZHRA 5K14A 1WSGA 4JV1A 5KFBA 5JUMA 2P51A 3O4NA 5J2PA 4Z6EA 2ZE2A 5FROA 1B92A 4W5RA 3L2QA 5J2JA 4LSNA 5KFHA 3CFPA 3RJJA 2DFLA 4Z6CA 8ICKA 4FW2A 4HCBA 4QAGA 3B0YA 3ZSXA 5DG7A 2DFFA 1X1PA 5BOMA 1SL1A 3PW4A 5KI6A 3PR4A 1TV6A 2P5GA 4E7KA 3M8PA 8ICOA 1HYZA 5CZ1A 1C6VA 4RW7A 2O4GA 4F92B 1NK7A 2AQ0A 3ZSYA 3QZ7A 3V6KA 3LAKA 3HXMA 4H8KA 9ICCA 4KO0A 4RNNA 4Z4CA 1HJPA 1NJWA 1RXVA 2BR0A 1DTTA 5IILA 2W9MA 3EZ5A 9ICFA 2BHNA 3K75D 5KG0A 4DFPA 3RH5A 2BCSA 4CIEA 3D0PA 2HVIA 1BQNA 5KT2A 1BPBA 3ZT1A 1NK4A 1HNVA 3PW5A 4M47A 4M3TA 4HTUA 5HP4A 3C2KA 5J0XA 4RW4A 2C22A 2KFZA 4UBCA 1C7YA 4B9VA 1TVAA 4CJ4A 1QSSA 8ICTA 4RPZA 9ICLA 4GC6A 4KLGA 2KZ3A 3QEBZ 2PXIA 4JRQA 3KHGA 1AROP 4CFBA 2F96A 4R66A 3KHLA 3ZSQA 4HCCA 4CJWA 1ASVA 3H08A 4BE1A 3JPTA 3PW7A 4GXJA 4Q8EA 4FLVA 5CP2A 2IMWP 4KLMA 5DGAA 4CGIA 1ZBUA 4ED1A 1NKBA 3JSMA 3B6PA 4KLQA 4FK0A 4RQ4A 3P83D 2MUTB 4FLTA 2J6TA 1JLAA 4M3WA 8ICHA 3LP2A 1ZQOA 4OVLA 4CGJA 4W5QA 4ECQA 1CEZA 2YNIA 3F73A 4W5OA 3C2MA 2WOMA 4PGYA 4YD1A 4KLLA 9ICPA 5BPCA 4ECWA 3IG1A 2C2EA 5CWRA 2G8HA 3SQ1A 1UA0A 1ZQXA 3G10A 2HVHA 5KFYA 2ISOA 4PHEA 4EZ6A 4CJSA 4KPYA 2OZMA 3ORYA 2DTUA 2B5JA 1RDBA 5F9NA 1HQEA 3EYZA 3LANA 4N76A 1L3TA 3KD1E 3L3UA 2XC9A 4E0DA 4O5KA 4PUOA 5DDMA 4UB1A 1TK8A 1SKRA 4DQSA 4CCHA 3HJFA 4RW6A 4CJFA 3L2UA 3EPIA 2IHMA 3KKRA 3MGHA 1VSDA 1QLNA 4MF8A 4TUQA 5KG6A 4YR0A 1MU2A 3FYHA 3M9NB 1IKXA 3SQ4A 5EOZA 4J9KA 4R64A 1BPXA 5KFAA 3SPYA 5DQIA 2D0AA 3O3HA 3ISDA 1ZQNA 4NY8A 2PYJA 1JLGA 2W9AA 4RNOA 3AVHA 1WCNA 1YVUA 3ZSWA 1BL3A 4C8NA 2JEJA 3MR2A 4ZH4A 4RQ5A 3GV7B 1RCHA 2KZZA 2ZTDA 1SV5A 2GBZA 3TARA 2UVWA 1RDDA 1EETA 4KLSA 1VRTA 1O1WA 3LPTA 4I2BA 3KLFA 5DB7A 5J0PA 1ZQQA 3BGRA 4QZAA 3PR5B 4N41A 1KDHA 4F3OA 5DGBA 1BPEA 1BPZA 3MAQA 5IIMA 4QWBA 2FMSA 4NYNA 4EP5A 5KFTA 3JYTA 3L8BA 3U6FA 1XWLA 2ZTEA 3ISCA 4YNQA 1U47A 4WE1A 4HYKA 1KVCA 2F1IA 2FBVA 9ICHA 1T4GA 1ZQLA 2QXFA 1T7PA 4RPXA 3LDSA 3FDSA 2WTFA 4E1MA 5DB8A 1ZQWA 4KHQA 5J2AA 2RDIA 3LALA 1ZQRA 4MFAA 3OYIA 4DFKA 5L9XA 1REVA 2O4IA 1ZQYA 4E19A 1JLEA 1ZQMA 4B9SA 4KTQA 4DFJA 4CF0A 3NH2A 9ICVA 3Q8SB 4M9HA 3NGDA 3G6VA 4QWEA 9ICTA 4CIFA 4EEYA 5EU7A 2FC0A 4Q45A 3AVJA 4BE0A 2HHXA 2W8LA 5FRNA 2D0BA 3H7IA 3NF6A 4KLHA 4IRCA 4MFCA 4FBTA 4RQ7A 1VSIA 2XY5A 3GV5B 4CJTA 3O4QA 4B9LA 4KHNA 1RYSA 3OYAA 3ZT0A 5L1IA 4FLZA 4FJIA 2IC3A 3C94A 3KIOA 4DG1A 1JKHA 3OJUA 2BCVA 4UB5A 5C5JA 9ICSA 4QW8A 3MBYA 5HMMA 4JV0A 2H5XA 3EWAA 1C1AA 1GOBA 3KLIA 3SJJA 1QQCA 2OPPA 2VANA 3OY9A 2G8IA 3TR8A 4RPYA 2ZJAA 3RAXA 4OKKA 4DWIA 2ZJ8A 2ZD1A 4DSKA 4ED0A 2OZSA 3RTVA 1C0UA 3ZT4A 4TQSA 1D8LA 3TAMA 1Q9YA 4LSLA 3EY1A 4HUGA 2A1RA 3AVAA 1HYSA 1X9MA 3L2RA 5J2CA 1NK5A 4DL6A 1JIHA 9ICOA 5KFUA 2IOCA 5KRSA 3NCIA 3QEXA 1B9DA 5CYQA 4CIGA 3DLRA 1TKTA 1IKYA 5HRPA 1XU4A 3QEWA 4FZZA 4DSIA 3DOKA 4P4PA 1SL0A 4I27A 4EYIB 4RQ0A 1UA1A 3TAPA 2NRVA 3M8SA 2FMPA 1J54A 3NTUA 4F93B 4E7LA 3KD5E 2GV9A 4DTUA 3PNCA 4TUSA 4PH5A 4CFCA 4DLGA 3NH0A 3K2PA 3OYEA 1NJYA 5DKWA 3D45A 4NLNA 1JXEA 3DRSA 5IIIA 3NF7A 4IR1A 1ZQGA 2LYHA 4QWDA 1JLFA 3ZDEA 1BHLA 2VA2A 3OYBA 1EKEA 4KLIA 4C8LA 2BQ3A 5F9LA 1KFSA 8ICCA 1S0MA 3SZ2A 2I9GA 4RU9A 3L2WA 4BE2A 5DMRA 1GOCA 1WSIA 3QEIA 1ZQEA 3K58A 2XY6A 3HL8A 1U4BA 2NRTA 4F5PA 1V9PA 5J0WA 3RB6A 2Z1IA 4QZ8A 1CZ9A 3NE6A 3PX6A 2F1JA 5J29A 3AA3A 1ZQJA 5J2FA 3PUFA 1W0HA 4OKJA 5HP1A 3V9ZA 5KG1A 1NK9A 4QZHA 1B9FA 1UT5A 2BGGA 4YR2A 3C1YA 1TL3A 4K4HA 4DU3A 3QNNA 4ECYA 9ICWA 5KG5A 3VQBA 2VA3A 3ETLA 3VQAA 1KFTA 3C6TA 4B8CA 4I2HA 5J2GA 2Y1IA 4J9QA 1LW0A 8ICBA 3SNNA 4CF9A 3C5GA 4MEYA 4DOAA 1CZBA 3RJKA 4FYDA 3NGIA 4CJLA 4J2AA 5J2QA 2JLEA 1S1UA 3HWTA 2OPQA 3AO4A 2RN2A 4L8RB 1U9LA 4RZRA 2YNGA 1U49A 3CYMA 4DL4A 3T5KA 5CYMA 4YXJA 4UB4A 4DTOA 4Z6FA 3GQCA 3VQ6A 2ZTCA 3TAQA 4M9LA 4CF8A 3K4GA 2DY4A 2BQRA 3PMNA 1ZJNA 4DL3A 1S5JA 2E6LA 1ZQIA 3AU2A 3SV3A 3Q8QB 3QEPA 4PHAA 4YMOA 3Q8RB 3HPOA 2Y1JA 9ICQA 3KLGA 1KEJA 3S9HA 4JWMA 2YV0X 1RBVA 8ICAA 4K8XA 5IINA 8ICZA 2UVUA 5TZVA 4QWAA 7ICHA 5IIKA 3KHRA 3PW0A 1RILA 3V1RA 2FMQA 5D3GA 3NF8A 3PV8A 4IRDA 4QCLA 4B9MA 1UT8A 2F1HA 1HUOA 4E3SA 4UB2A 3NFAA 4KV8A 3RB4A 3OS0A 1XSLA 1MQ2A 4I9QA 3KHHA 3MGIA 3CFRA 1BIZA 5J0SA 2OPSA 4FS2A 4DQQA 3THVA 1ASUA 2B21A 4LVSA 9ICBA 2XRIA 1VSFA 3VN5A 2JEIA 4DS4A 4J9PA 5FRMA 2VG5A 2G8WA 4KHYA 1RTJA 4KB1A 4NLZA 3HM9A 3SUOA 7ICLA 4PGQA 2A1SA 3BQ0A 1ZJMA 4HUFA 2JZBB 5KT4A 2BPGA 5KT6A 2HB5A 3DLHA 2QKKA 1JLCA 4IG3A 4UAZA 3MR5A 3MEDA 4Y1DA 3MECA 5KFLA 2PI5A 3V9UA 1BPYA 4LD0A 3ZSRA 3TI0A 2BE2A 4K8ZA 2C28A 5KFCA 4TQRA 2PY5A 4IQTA 2HHVA 1IM4A 3RJEA 1RT2A 4ZTFA 3DRPA 2OWOA 3WNFA 2HNDA 3I8DA 2IAJA 4FZYA 4PGXA 3RJIA 5DBBA 4I2DA 3RR7A 1A77A 1WNSA 3VQEA 3PVXA 1D9FA 5IIJA 4KN4A 3G6XA 3Q8LA 3VQ7A 3PMLA 3SCXA 4IDKA 5DBAA 2NUBA 5KFQA 3AO1A 4BWMA 4ID1A 4J9NA 4E7JA 4CEBA 3KJVA 3V7JA 1X9WA 3BDPA 4ECVA 4FJMA 2DFHA 1YT3A 3SI8A 4BWJA 2UVVA 3AVFA 1JL2A 2VWJA 5KG3A 7ICEA 3MEGA 1HQUA 3UPQA 4KAZA 3RJFA 4EP4A 4NLKA 2R8IA 4CEDA 2YHAA 2P6RA 3IM1A 2YKMA 2B4JA 4I28A 3JPSA 3V7KA 1T3NA 3LZIA 4J9RA 4AHRA 3Q8MA 1EXNA 2YNFA 2G8VA 4DQIA 4RQ8A 2AQ4A 3HVRA 1K6YA 4YD2A 2ZJ5A 4R8UA 1TKDA 4P2HA 4Z4HA 3RMDA 5KG4A 1JLQA 4FJ7A 3MDCA 7ICUA 4E7HA 2IHNA 4DSLA 3AVNA 1RBRA 1ZQAA 5KG7A 1WN7A 4ZTJA 5CR0A 3IRXA 3DYAA 4YP3A 2B6AA 1RBSA 5J2KA 3V81A 4ECUA 4M6WA 1NK6A 4M3YA 4DFMA 3H8JA 8ICSA 4DOBA 3WNGA 1KLMA 4Z4FA 4F4ZA
chains in the Genus database with same CATH superfamily
4P4OA 4FLUA 1OW5A 1WI8A 4IBNA 2RU9A 3FMWA 2E6MA 2PEBA 2Q2RA 3H4DA 4QPTA 4NLBA 4IQUA 3KJVB 4GVLA 1UL3A 3O8MA 1WSRA 2VQEF 4C8KA 3MF5A 1BPDA 2KVQE 3MEGB 1HQUB 4C8ZA 2AP1A 5KPRA 2KD1A 4C3KA 3CM5A 2BW2A 4FLWA 1T0TV 3UR3C 4XDDA 2VFRA 1YAGA 3S3NA 4WQ4C 4ICLA 2LI6A 5HRRA 3IG1B 4JP8A 3NDKA 1S49A 2LU2A 1ZBLA 3DLEA 3CMES 3IBWA 5ELZA 4FM2A 4WFNL 4AXJA 4JI8J 3C2LA 4CJ3A 2B5JB 2QL7B 3W9IA 1NSQA 1UTAA 3RRKA 5CE3A 2CQGA 3R5JB 2HAFA 1J9AA 3EX7B 4QYZK 3HT0A 5ETMA 1H2UX 4LF5F 3R8EA 5J0TA 3NS5A 1QQNA 3NCQA 3AAPA 1VBXA 2LMRA 5KOXA 4PG5A 4M5LA 4DSEA 3J80O 1W7AA 3IV6A 1RWVB 1SC4B 3KVGA 2VFUA 3ZT2A 4FFDA 5ALMA 3V6JA 4RQNA 3SQ0A 4Y2MA 1T9UA 4K8RA 2U2FA 4ECTA 2BJEA 2AEMA 3O9TA 5CA7A 5THWA 4I6MB 5IFMA 2XNQA 1S1TA 1XHZA 3MABA 2GLEA 4KHMA 1SJQA 4TVAB 2DYAA 1WSEA 2AT1B 3CMAS 4NX9A 1N4LA 1TK5A 3BO4A 1JCFA 3LAMA 2BZ2A 1NGFA 1TAUA 2X6NA 5AQQA 1SV4A 3QGGA 3D1OA 2J9CA 3TAEA 5EX0A 3QIDA 4JOUA 4F0MA 2FPLA 3MWBA 4QZ9A 4USUA 4TUPA 4F2RA 4C6AA 3P4IA 1VQ6N 3ZX0A 4LBHA 1IXRA 4C4RA 2IA0A 1RM6C 4AHSA 2ACMA 4MTPA 3VENA 4WCEQ 1J2NA 2ZJPL 2V68A 4F4WA 1LWCB 3KK1A 1IJJA 4DR7F 3TQEA 1WOSA 3VOVA 5BR8F 2GZOA 1OIAA 1N52B 2AHOB 3KJFB 8ICIA 1IBMF 1RLCL 4WE1B 3M6GA 3Q8KA 3H1VX 1VBKA 2MYFA 3OR1B 2V8PA 5AKHA 2ZIXB 2DXEA 2ZZMA 5LXYA 1RTDA 2HZVA 4DUYK 1X0PA 3ENWA 5KFKA 4C1NK 4HH0A 2GNKA 3VQQA 1VSEA 3AA5X 1ECWA 5J2IA 4IYQA 1REVB 1MWQA 2W9BA 1YBTA 1ZBHA 1FJGK 4ZJLA 4MK8A 4QS7A 2JWKA 3B4DA 4M5NA 3F9MA 2B43A 2W41A 4DV3J 1RTIA 4ZP6A 1BQMB 2MJNA 2GIQA 1XNQJ 3LDAA 1SQFA 4FPRA 2GJ2A 1RYRA 5J2BA 3PZPA 1JX4A 4FJ5A 5FLXY 5EE3A 4L6V3 3BS5A 2CA9A 4EBCA 5HN0A 4CF3A 4G3IA 2MQ8A 3CE8A 4YB5A 4FNHA 3AM9A 2MQOA 1WG1A 3MDFA 3A4TA 4JUZA 3JPRA 2E1RA 2GMJA 2OYQA 1KKXA 4EO8A 1GAOA 5BYRA 2WUSA 1JXLA 1RA7A 4IO8A 2FLNA 4R25A 9ICKA 4CLKA 1HUZA 2NREA 4DX8H 3LOUA 3E1YA 1WTBA 2CH6A 3CCMN 3NMRA 3HP6A 3EO3A 4ISEA 3I76A 3R8YA 3AOAA 4F0HA 3K57A 2P9PB 3QRRA 3MFHA 4CJKA 2H3EB 8ICXA 2MZSA 2FF6A 4X62J 2F3NA 1V38A 2H3IA 1YJNN 1C20A 1KD1T 3D2SA 1J53A 4B08A 5JICA 1ZTTA 3UWTA 1B0VA 2YNHA 4PG6A 2F4VK 2VBXA 4IOXA 3M2UA 5LMNK 4IOAL 4F3TA 2FPMA 2HOFA 2X74A 5HL7L 2VOOA 4IO1A 4IQWA 1PYOB 3V4MA 2VKZG 2ZWHA 3BDEA 1IM6A 3VA3A 2Q3SA 3T5LA 1NMNA 1YJWN 2G1HA 3TOQA 5J2DA 3VQCA 1LK7A 3OTCA 3P96A 2F8TA 2V9WA 3MAAB 3CJKA 3N97B 1EXQA 2CJKA 1BI4A 5J1EA 4KLJA 2GHWA 3HHLA 2A3JA 5LL6Z 3DHXA 1FK9A 2R8KA 3PNIA 1GQEA 2AJ4A 1WSFA 3OTOF 2YWKA 1JLFB 3QGHA 1VCTA 3TFSA 3G6YA 4ECXA 4ERDA 3MHYA 3H4BA 4GC7A 5KFRA 3IA0A 2VPWB 4LQ9A 4CZCA 3R2CJ 3J7A1 1LW2A 1UJ4A 4JS5A 1O51A 1YJ9N 5KAIU 2CPFA 4M5JA 3C2PA 3H3NO 1TP7A 3HFZB 1ZPWX 2L9DA 2IFXA 1P27B 2XIDA 4B9NA 2WB4A 3BQTA 1TKZB 5K5MA 4JKFA 1Y88A 2QLFB 4LF7J 4MLHA 1SIWB 4M3RA 2LKZA 2O6KA 4I2AA 5KGXA 4F50A 3DLJA 2YKAA 2IOFK 3R5BA 3N4PA 2XY8A 2Q3PA 2ZWOA 3DLKA 3SPZA 2BE9B 3ENBA 3MAHA 1N48A 3OGUA 1BD6A 4QZEA 1S6QA 2QGFB 2QFJA 4UY85 4AL7A 1A5XA 3MR7A 1HJRA 2BCQA 5D46A 3KKAA 2UXBF 4F91B 5AXKA 3FAHA 1RE1B 2ZBQA 2VKQA 3EGZA 1YRXA 2QN6B 3CFOA 4JI0J 1R8PA 1N5YA 1UW9A 4O5EA 3ALYA 3GCXP 2QWOA 1PK1B 2F8SA 1S1UB 5KFZA 1VC5A 5KFNA 4PL8A 2LQBA 4CI0B 1RWWB 3UQ2A 5M1KA 2HSEB 5HQ8A 4HI2A 2PFDA 3ZD8A 2HBZB 3TX8A 3O2IA 3DOMA 4PQUA 5HOOA 4B1YB 2DGWA 4R65A 2YQ0A 4JWNA 1RT5A 2I1QA 3Q23A 2G2OA 1CS4B 4USAA 3F5TA 3WQPA 2KK0A 2WC9A 4OI1A 1OUQA 3TSQA 1Q1KA 3R7SB 1N8RO 1YK9A 2D3UA 3G4SN 2R8HA 5HO4A 4F4YA 3SMZA 3RR8A 2JLGA 1KNZA 2F77X 3NOCA 3MXJA 2F4VF 2W8KA 5GVQA 2YCHA 5LMNF 1N8RT 4FOEA 4NYFA 4KI4A 1S59A 3FR0A 2VL1A 1ESVA 4I2PA 3WT0A 3ZFVA 2DVIA 3ZSOA 8ICEA 4DV5J 4DX7A 3T1YK 3SI6A 5IWAK 4ETXA 2EX3A 4ZVOB 1SUQA 1M1GA 4LFCF 4Z0UA 1MW7A 3MMVA 2IDLA 4Z4GA 5DG8A 1NK8A 4RT2A 3AU6A 4JK8A 3WEEB 2ROPA 1EP4A 2H5JB 1XTZA 4Y2QA 4AL6A 2W25A 2K4EA 5AKXA 1DRZA 3FBBA 3OQ2A 1N6QA 2D0CA 1FIQA 2B9WA 4CK3A 3QRPA 4NZ7A 3V6DB 3J7AP 3MECB 2DR6A 2JHEA 1L3VA 1K5OA 1FTCA 4B1ZA 2G8KA 2WVBA 3LDOA 1VQNS 4YOYA 1RT3A 4DPXA 2ZH1A 1CQNA 2XGPA 3EEQA 4DL5A 4OI4A 2FZGB 2DY1A 3UN3A 2HDOA 4C4TA 3BPDA 1BXNA 1S9GB 2YBVA 4AP9A 1C0TB 1BWVA 3QUCA 3H2UB 3FSYA 3THXA 1IQZA 2YPYA 3RBEA 2O66A 1HNIA 3HBTA 2JL9A 2NZ4A 4DFDA 1KN5A 1NJXA 1X9JA 2ADCA 1FNOA 4N47A 3KJNB 1VK0A 1SZHA 1ZOTA 5G4DA 4Z4IA 3M7DA 4CH0S 3HD2A 5HMYA 4FVMA 1BIUA 2HNYB 1ZA2B 2LP4A 3CQ8A 1W2BR 5ALQA 3GFZA 3C95A 3O9RA 2PFNA 3JTPA 4XTTA 2QXLA 4QW9A 1XO1A 2VICA 3P1GA 2DWQA 3MOZA 3R1XA 4GNIA 2Z7JA 4CEQA 3ZC4A 3Q0AA 4K4YA 3MPDA 4P73A 3ZZTA 2UXDK 4G9BA 4Y2JA 1LWFA 4DL7A 3D0IE 1SKSA 4LFAJ 1VQ7N 5AI4A 1UMJA 3QERA 3M30B 2MQLA 4JV2A 4CJEA 1J5OA 9ICMA 3PKMA 2JVOA 2ZBIA 2V5HG 4P2XA 1I1GA 1QAYA 4DN9A 5M2RA 3VALA 3VGTA 4IJNA 3EJMA 2PMZD 5B08A 4WK3A 5HMXA 4K4GA 3H5XA 4L3NA 3OVAA 3OVBA 1HD0A 1S97A 3TP2A 3QSYB 2KKZA 3NHGA 4CHYA 3QXGA 2VZ9A 5M1NA 1KLMB 1U2VB 2X1GA 2LKYA 4AYBC 4ZS6A 5AQMA 5GADU 4ED2A 3UMBA 4FO6A 4U67L 2Y1RI 2EHGA 4LSZB 2E8NA 3ILLA 5JU5A 3P49B 1TL1A 3T1YF 1YX2A 5IWAF 4I6AA 1KQGB 2IM2A 4CK1A 1MC8A 5J2MA 1TL7A 3D28A 3PSFA 4ZP8A 2VCPA 3H20A 1S5ZA 4TYAA 4DUZK 5AHXA 2O1PA 2FVQA 3LDQA 1JMSA 3CM6A 3OYFA 3TZYA 4KHPK 2OHDA 2M88A 3BJYA 5LSRA 5DM6Q 1AFIA 2BJ9A 3Q89A 4BLGA 4IKAA 3THPA 1JJ2M 2Y8WA 3OSPA 1VK3A 3VVUA 2EFQA 4CEZA 4AL5A 1KWMA 3W5XA 4CESA 1HYVA 4ILMA 4FZNA 2HEKA 1DQ9A 3GG0A 1OQ6A 5EWEA 1ZYQA 3V9XA 4PG7A 3E66A 5HQLA 3V9WA 2QW9A 8ICRA 1NKEA 3MN7A 3MI7X 2NO4A 5F0UA 3C19A 3DDKA 4WFAL 5JXSA 4Q0BA 1VYAA 2XYPB 4X65K 1S76D 1RHKB 4GW6A 2G08A 2GWKA 4FJ8A 1S9EB 3BEGB 3QMQA 1U1QA 2GW8A 4IWVA 4CEOA 4DS5A 4OZ5A 2LVWA 2P6SA 3QLHB 1IKWA 3CPWR 2Y3YA 3UXPA 1MROB 2XSJB 2D0PA 2YMMA 4FP9A 3UQ0A 3NVVA 1F3FA 4OYWA 2XBPA 2FBYA 1RGVA 2V4RA 1Y10A 4M63C 5CB1A 4FJXA 2IM1A 4KGZB 3T6JA 1SZ2A 5J2HA 3ID8A 2IDEA 4K0KF 4WPAA 4PKHA 2OA8A 1FVSA 5L46A 2MLYA 4L73A 5F8HA 4RW9A 4J2EA 2VG7A 1IH7A 5AQJA 2NS1B 1C0MA 2H65B 1RTHB 1Z00A 1NCLA 5M1FA 5A8WA 4HDGA 3DDIA 3BQ7A 3LP0A 1S1WA 5HVFA 2CPHA 1VGYA 4AHCA 1HI8A 3HPHA 2ZG6A 2POKA 3C7NA 2CH5A 2K06A 2E1YA 3TVZA 1CUKA 1WC5A 4OJ1A 3BQ2A 4NI2B 2HMIA 4KH5A 2DGXA 4XPCA 3RAQA 2P5OA 1SZPA 1IG9A 2E8OA 1K9MO 2W2MP 4C9DA 3H25A 4BRFA 4NLCA 3NGKA 1Q81T 1NGAA 3LP1B 4EK2A 2BANA 5F8IA 2Z4PA 1K9MT 4ICAA 3MMBA 1X6JA 2QB1A 1RWOB 2DIUA 2NXJA 1WC0A 3KLEA 1FRXA 1Z26A 2YHBA 3R5GA 2P9KB 4YOWA 5I3UB 4N56A 2A3ZA 3QU9A 3UMCA 3JQJA 4NXNK 4NA3A 3O3FA 2J6UA 1AZSA 2QL9B 1NBWA 1UWBB 2KZMA 3G8SA 1ZA1B 4ED5A 2JOQA 1XMOJ 2HNZB 4DUZF 2Z58B 4K4IA 3BSCA 4O3QA 1ZETA 3G71S 4YQWA 2EFPA 3V4IB 4KHPF 5FPNA 2KHDA 2KFNA 4RW8A 5AT1B 4KAIA 4A47A 4K5SA 4WKYA 3NCRA 3CCLS 5DETA 1K0VA 4JS4A 4M3XA 2FF3B 1LEOA 3AEVA 1VIOA 4CQ1A 5HR6A 3G82A 4EIAA 5CCLA 4KH6A 1HMVB 3PSTA 4F5OA 4DL2A 2IYGA 2ASLA 2QLTA 3NG8A 2HK2A 2CPRA 2VASA 1R6VA 4P0QB 5KL1B 2A1JB 4V19S 1TL4A 3LK9A 4KHSA 3D66A 4ZVRB 4CJPA 2VG6A 4UAYA 5GAGI 3IMXA 5HMLA 2RP5A 3V6HA 3HVWA 4M5KA 1FESA 3DI6B 4EBEA 2KFYA 3F9KA 1I94J 2EK6A 3JTOA 3LW5C 3EVWA 2QKQA 3KNAA 1CXQA 1AFJA 4JD2B 1NK0A 2H3VA 3AO5A 3AAWB 4AUKA 4OZ2A 4XIUA 1ZQCA 4BRMA 2CPXA 3BSAA 3OPXA 1Z1ZA 3W9HA 4NXZA 3QYPA 1EX8A 3LUYA 1B64A 3QZ8A 1R8AA 2ZEJA 3WKAA 2FJWA 1XQIA 4QWCA 5J8YA 2PZSA 1OS5A 3M6WA 1FKPA 2V4QA 4MKBA 1GO3F 4I69A 2YQ1A 2J76E 4BACA 2FHMA 9ICIA 3E3XA 3OHBA 3C16B 3FCWA 4OI6A 4ZLPA 9ICAA 3D2NA 9ICUA 1S1XB 2RQCA 3AHPA 3CJ7A 1ZQ1C 3VQDA 1VOMA 3QPIA 4JV1A 4P2MA 5IM0B 4Z6EA 4H5WA 1ZRMA 2ZE2A 3IC1A 3A3NB 3P5TL 1W7WA 5FIIA 1VQ4N 5J2JA 3CQYA 3OTDA 3RJJA 2F76X 4DR6K 3NVMA 4HCBA 3EM1A 3B0YA 5DG7A 2OI2A 3FEZA 5BOMA 3OUYB 4YB7A 5GMEA 2B8QA 5KI6A 1N36J 2VC0A 3DHWC 2O4GA 2UYTA 2RF2B 3A8JA 4CM2A 3WXLA 5AFUA 2XEXA 2LDYA 4KO0A 1FF2A 3FSIA 1HJPA 1UPHA 1JB0C 1EHWA 2LXIA 2YQ3A 1RXVA 3R5CA 7AT1B 2P9IB 4QIWD 2ZIVA 1DK3A 4B3TK 2BHNA 2DQNB 2WONB 2PDAA 3W62A 4CVNE 2BCSA 3PTWA 4CIEA 4HACB 3N7SC 5AKIA 4CLUA 5FLXO 1S1VB 3TU5A 4CDIA 1BPBA 4A8MP 1DARA 1QJHA 2WF8A 3GMGA 1S99A 4HTUA 3IRUA 5HP4A 4OI3A 2X7IA 4NEZA 3U1LA 4GFJA 5J0XA 2KJWA 2C22A 5LJWA 1C7YA 1N2XA 4NV0A 4PAAA 1QSSA 2DGQA 2UUCK 5ETQA 2OTJN 8ICTA 1SV0A 2FVSA 4CH7A 9ICLA 4KLGA 2KZ3A 4CT9A 3QEBZ 2BA9A 5ALJA 1RBOB 3KHGA 1AROP 2V2QA 3M1VB 4KH0B 5F8MA 2L9WA 3QU5A 3ZSQA 3H08A 1TV6B 3K1ZA 4CP5A 4GXJA 3QUBA 4Q8EA 4FLVA 3TRGA 4CO5A 3JAMO 2IMWP 5GAHP 5DGAA 3KHYA 5EX3A 1ZBUA 4B3RK 2JLFA 2FQQB 3AD8C 4RQ4A 2P6TA 2MUTB 4K4XA 2KHVA 4JKAA 1TKXB 3M2VA 4OVLA 4ECQA 5IT4A 2XMKA 3KUGA 2PIIA 3MMCA 3F73A 1DTTB 4OZ3A 5D0HA 1IG8A 4PGYA 2QARB 3IG1A 1RWMB 2C2EA 3D67A 2G8HA 3SQ1A 5HQMA 3D54A 1UA0A 3G10A 1HWIA 1SQGA 2ISOA 1YDLA 4L74A 1RP5A 3H5SA 2G0JA 5CRXA 3TVYA 2B5JA 1HQEA 4FWSA 3HZEA 1RHRB 3H5YA 1TELA 2W3RA 2KE7A 3KD1E 2FGCA 4UB1A 4RPFA 3W3DA 2Q6BA 3HHEA 4CCHA 1M1KO 2K3IA 5AKKA 3MGHA 1GMUA 3MPVA 1Y3JA 3GR0A 1E4GT 4UUXA 1MU2A 3J7YP 3M9NB 4DR6F 4JI1F 3NKYA 4CZMA 2WF9A 4TU8A 2KYZA 4ANEA 1QVFM 5EE0A 2DO0A 1BPXA 3SPYA 4JI5J 2KIVA 1WC1A 3ISDA 1RYUA 2W9AA 2W01A 4DU8A 3LP2B 2BTFA 5A6WA 1YVUA 3QGPA 2MKKA 2JEJA 2UUBK 2DBYA 3D1HA 2KZZA 2GBZA 5EDWA 3TARA 2HQ3A 2UVWA 4TKTA 2MZTA 1T3OA 4DPTA 4KLSA 3LPTA 1O1WA 4I2BA 4GV9A 4WFBL 5KNIA 3LDNA 5J0PA 2FLOA 2AIRB 5AI5A 4N41A 2ZM6J 4LFBJ 1KDHA 4F71A 2KKPA 2GQCA 2NV3A 3ED5A 1ZPVA 3D6HB 3CW2C 2OTLN 3GLJA 2FMSA 4YDXA 2B0GA 1HD1A 2UUCF 2QL5B 4WE1A 4HYKA 4WF9Q 9ICHA 3OR1A 4RW6B 4CO3A 3W1YC 3GFXA 2GVZB 1T7PA 3CO9A 3FDSA 3WK7A 2WTFA 2ZIXA 2QYGA 4HAIA 4E1MA 1ZQWA 5J2AA 3CD5A 4KX5A 3MMAA 2W04A 3QGIA 4DFKA 3BZKA 3BS7A 3ZEUA 1REVA 1ZQYA 1JLEA 1ZQMA 2J8SA 4B3RF 2DNRA 4KTQA 1RTZA 1J5EF 4YOTA 1KQQA 2VUGA 2UXCF 9ICVA 5M1QA 1PJ7A 3OL9A 3O6QA 5JLFA 3NGDA 5F8JA 1HA1A 3UDCA 9ICTA 4CIFA 4MO4A 2A3VA 4LF1A 4DN0A 3BGRB 3DMJB 4PXEA 4NLQA 1X40A 2W8LA 5FRNA 5L1MA 4OPHA 1A0OB 3I4HX 2WB1F 3NF6A 2ZKUA 1HNZJ 2W7AA 5I3PA 4IRCA 2ZXIA 2BH1A 4FBTA 1VISA 3JS9A 4RQ7A 1VSIA 2XY5A 3O4QA 2FY1A 4B9LA 1OMSA 3F44A 1IBLK 4ZMMA 4HHUA 1SXLA 3NMUA 4U6PA 4FJIA 5HK4A 2R2RA 2M4MA 3P39A 4ZVQB 1P8GA 3HSDA 3UB5A 4H4KA 3IWLA 3OJUA 4UB5A 5C5JA 4DPYA 2DUYA 1AB8A 4ILHA 1VRQC 2JH1A 4Y2XA 4QS8A 5G0RB 1QQCA 2VANA 2ZGZA 3L4PA 4OKKA 1D09B 2ZJ8A 2ZD1A 2RHFA 4Y6IA 4ED0A 1RAJA 1CJKA 2WF5A 4TQSA 5E0OA 2I9SA 1ACMB 2CJAA 3CERA 1BHNA 3TAMA 2E66A 1S72S 4LSLA 1RDFA 3O80A 4HUGA 4KFBB 5AQKA 2IVFB 1UPMB 1Y3KA 5J2CA 2H3ZA 3O8WA 5KFUA 2IOCA 1YBAA 4OZJA 4ZITA 3QBWA 5KRSA 3T41A 2JWLA 1RWXB 2EBEA 1JQGA 5DDPC 2F8HA 2J0QD 2WW4A 2XS2A 3QEWA 4FZZA 2N4DA 3ZNUA 1F5CA 2WMMA 5JVHL 1RT6B 4Z7YA 1UA1A 3I0RB 3M8SA 4UB8U 4UW2A 3NTUA 4BRDA 4E7LA 1ULRA 3L3CA 3GWCA 4LIWA 2DPNA 3KFUF 3AXMA 3NH0A 3K2PA 1WOPA 3I9ZA 4ES1A 3SSSA 2IVOA 4OJ6A 1JXEA 1X7VA 4ATNA 3MN9A 5AIBA 2ZC4A 4X4QA 3CC2S 1JLFA 1HUXA 1SI9A 4KLIA 1R0AB 1PSDA 4CZIA 4BGBA 2OP5A 2F8EX 1KFSA 2D1KA 1S0MA 3SZ2A 2F1FA 2F9JA 2QLXA 1JJ4A 5TKWA 2FJXA 4QYZJ 4BE2A 2JRZA 5DMRA 1GOCA 1UETA 1ZQEA 3H0MB 3O44A 1WG4A 3RU0A 3K58A 2XY6A 3J8AA 1VQ9N 3HL8A 2EH9A 2NRTA 2W55A 4DV6K 1FI4A 1CZ9A 1QAXA 4DV0K 1N33K 5J29A 3AA3A 2M3DA 3PUFA 1W0HA 4J8FA 4WK1A 1GLAG 5T7LA 4Z94A 3V9ZA 2IJRA 4QZHA 1FD8A 2H4YB 4YR2A 4DU3A 5ITHA 4IFYB 5KG5A 1ZD3A 5E7OB 5E79U 1U24A 3HI9A 2B7CB 2LQJA 3TVKA 3C6TA 2ZH2A 4GKJK 5J2GA 2V9KA 3F5EA 5LJ5Y 2OCEA 3BN7A 1IBLF 4CF9A 4NLXA 2PO4A 3VGLA 4MEYA 4RWWA 1CZBA 4FYDA 3NGIA 4J2AA 2JLEA 1S1UA 2A1AA 2FXUA 3I4PA 2YNGA 4LF9F 4BR9A 2O8CA 5K8MA 5AM0A 2OFGX 4OHWA 1U1LA 1RBLA 2HFZA 2B4OA 5B0AA 2KHOA 4URQU 1UEKA 3QICA 4CF8A 1H2TZ 3K4GA 2PA8D 2MXYA 3US5A 5C7PA 2CZ9A 2E6LA 3AU2A 5K8NA 4LF4F 3ICXA 4PHAA 3Q8RB 9ICQA 1Q95G 3AQOA 3MMJA 3W61A 4MJKA 4LBPA 1KEJA 4JWMA 4K4SA 1RBVA 1VQPN 1F9HA 2H5IB 3Q7CA 1UZDA 5IINA 3CNQP 1KHVA 1QQ7A 4DUYJ 3MK6A 3AB2B 1X4EA 3QT8A 3QIPB 4C11B 1Z19A 3TADA 4LF6J 4QCLA 1FNXH 1N5WA 2DGTA 1FJGJ 4KV8A 3NFAA 3RB4A 5CD4H 2LQ8A 1MQ2A 2Y8YA 1DFDA 2AWZA 2B3TB 3VC8A 2OPSA 2YPZA 4FS2A 5E5NA 5LMUF 1ASUA 1GTHA 2QJ3A 2XRIA 1VSFA 2HGNA 4DS4A 3MTKA 1KP6A 2VG5A 2WSCC 1CJTA 3WEEA 2G8WA 4KHYA 1TUVA 1YBUA 2G1DA 3J7ZO 4Y34A 3SUOA 2E1EA 7ICLA 1TUGB 2D3O1 3CTRA 1IBKK 3U7JA 5I4MA 2O67A 2HBMA 1NEEA 2HBYB 4X4RA 3SFGA 3MECA 5B5EU 1DTQB 3UN5A 3WKBA 1HBNB 1BPYA 3VAFA 3V9UA 2DHHA 3LPEA 1XR6A 2HHHK 1ZXOA 2C28A 2EC0A 4WYWA 4URSA 2HHVA 4DV6F 1WC6A 3RJEA 3DGVA 3R7NB 3LDLA 1N33F 3I8DA 4OD0A 2NXNA 4I2DA 1A77A 1WNSA 3IXQA 2GAHC 1FHTA 3F2DA 2KG5A 2UU9J 3VF4A 2CXYA 3VQ7A 2EZYA 2NUBA 4IQMA 2HS3A 4BWMA 1ZZFA 1X5OA 1PUZA 4ID1A 4F25A 5AJ3K 3EGNA 4ZLNA 2BZFA 4FZVA 4IH7A 2Q79A 1X9WA 3HSJA 4QBUA 3M8PB 1YGYA 3N28A 3QBCA 4FWNA 4QQBA 3IG8A 2F4VJ 2LA4A 5CQGA 4FYYB 2R8IA 4JKGB 2CRXA 1VDVA 2YHAA 3OXGA 2JV3A 4MDAA 3MM9B 3B54A 3NS7B 5E3QA 5ALNA 2CJBA 1T3NA 3UE5A 2MZRA 1EXNA 1HBOA 4IG3B 1C4AA 1ICEB 1QUVA 4J9VA 2AQ4A 4XH4A 3M30A 2R42A 4Z4HA 3RMDA 5KG4A 2P9NB 4FJ7A 2BM0A 7ICUA 3QMLA 1BQNB 5AZIB 4TN2A 3K8VA 2XMJA 4URGA 1PKUA 1ZQAA 2YKOA 1VQMS 5KG7A 3AY0A 3UFCX 1RDUA 4ZTJA 5CR0A 3CMQA 2OKQA 4YP3A 2HNDB 2YY3A 1TUUA 1MMDA 3GE9A 1GH8A 1PK3A 2XLIA 5LSLA 3D3BJ 4DFMA 3QDKA 2HI0A 1GXUA 3WNGA 4HKQA 1X0FA 1KLMA 4KJIA 4JI4J 1SH0A 1L7PA 3ID6A 2ZUGA 2ASMA 1SKWA 1YTUA 5AM5A 4IL6U 1ZZNA 3J80U 1S0NA 4CE6A 3TJAA 2W6KA 3TSPA 1Z25A 3H90A 3RJHA 4GVEA 1YI2N 2MA1A 2J6SA 4TY9A 1VC0A 3ENHA 1NZAA 4LH4A 1JLAB 2CG8A 1UVKA 1LXJA 3BR9A 3S6JA 2YKMB 2YNIB 4RQ1A 2YNFB 2FHOB 1QS4A 1GK8A 1IBKF 4P7VA 4DCOB 1TTHB 3IR6B 2J9EA 2NRXA 1SH3A 3OYHA 2JDJA 2F3JA 4LIRA 2F7TA 5KQ8A 2IIHA 1VQON 2ZH9A 2A6MA 2G2ZA 3TTFA 5F8NA 2CWKA 4M3ZA 1HL6A 2C2MB 3HMJG 4QU6A 5DB9A 2IRYA 3HX0A 2O8FB 4CHQA 1LAWA 1DT9A 1NOMA 2V8VA 2Q36A 3K89A 1ZQTA 3DYAB 3F5AA 5D4BA 2CWXA 2YX8A 2XMAA 4H5NA 1RGIA 2KU7A 2GO9A 4MF2A 1CBKA 4PUOB 1HHTP 5KFDA 4ES2A 1U1OA 3QU7A 3PO4A 4XDCA 4HUEA 5BPLA 4O0IA 2DKZA 5KFVA 1KOOA 3A2FA 4PHDA 3P31A 2KI2A 3VQ9A 4F5NA 3POTA 2ZUDA 4I2JA 1U8SA 4JKDA 4FJGA 5AJ3F 3IG5A 3QLHA 5AM2A 1XHXA 1MROA 3HW8A 1GNKA 1NMDA 2GJIA 1YQHA 1IR0A 2XSJA 1SL2A 5J0OA 2E1CA 3VQTA 2W40A 3A0HU 1FEHA 4EUVA 3M8RA 3T1AA 1T95A 5SZTA 4M7YA 3WXJA 4DR1J 2EXUA 4I56A 4OX9K 3TWZA 4ID8A 1EETB 1VRTB 5L8RC 3I5AA 3D9BA 1RTHA 1B4SA 2MSTA 5C2DA 2YY6A 2XLKA 3OR2A 1H7XA 1HNXF 1EQYA 4BRAA 2CRLA 3ZLJA 5C2GA 3B6BA 4DTNA 4PR6A 5HVGA 3AO3A 2KTQA 4TSXA 3QETA 2RPIA 3I82A 4NI2A 4QIEA 1L6NA 1G1XA 4I7FA 2ZGYA 2BGWA 4WJ3B 4CHPA 4BY9C 4H0YB 2I38A 3VGKA 5KFGA 4PABA 2PBDA 4QOZB 4CF1A 3I33A 1WF1A 4DB3A 4J5OA 3CCJS 1HR0F 3TEGA 3VF2A 3UKRA 2MTLA 3U26A 3IR7B 3SIPB 2P9KA 2MY8A 1Y64A 2ESEA 1A9NB 3QIOA 1QTMA 3O4WA 3WKEA 1UWBA 4OYAA 2VJ5A 2HNZA 3VQ4A 3V4IA 2Z57B 1N5VA 3WQUA 5SUHA 8ICPA 4FLXA 4ER8A 1Z4OA 4OFZA 4DV1K 1TVRA 2HSTA 3PRBA 3GSDA 2KM8B 2PFQA 3IO1A 3I6PA 1BUPA 1KVBA 2E8PA 4JYAF 1RWUA 5JTIA 4CLWA 2FJVA 3GIJA 1HMVA 4X66K 4OL8A 1VSKA 4KX3A 3L7UA 2A1JA 4ISGA 3KK1B 4LY7A 8ICQA 4FK4A 3CMEN 1FXLA 5DM7Q 2ERRA 5D4PA 3AVMA 2GV1A 1R8CA 1V5VA 4I2QA 2UXDJ 4M8LA 5AE3A 1FRKA 1N54B 3OFGA 3BEXA 3WIVA 4A8WA 3DI6A 3QNOA 2ASJA 3CDEA 3V5RA 2JSXA 3NRBA 3OPKA 5LL6d 4B1WB 5FP0A 1NOYA 1RTDB 4GMJB 4FJLA 4KN7A 3MDAA 1X31C 1FWPA 3MX5A 4CLTA 2AEJA 2JRSA 1F5SA 3UDVA 4CECA 2Q0UA 3EGWB 2LSNA 2IRXA 4CJ5A 4O3OA 4KLOA 3EKUA 4XQ8A 2JWNA 1U09A 2HBKA 2W3SA 4HI1A 2XVTA 1XS9D 2KQ2A 3F2CA 2DEIA 1HYSB 3DRXA 1RTIB 2ALYB 1WSJA 3DXKA 4OPJA 4OX9F 3CMAN 3EZUA 1CLQA 2GQQA 2E5LK 3HRGA 2CPJA 2XY7A 4E7IA 1N60A 2UUAF 3BS5B 2NRHA 2R7YA 4QIGA 1U48A 1NOZA 4LF8K 1ZS6A 1S1XA 5KPZA 5JS1A 3NS6A 7ICFA 4BC9A 1KCFA 1WAFA 3A1YG 5T7BA 3MFIA 5AZJB 3WNHA 4DEZA 4KLFA 2H9ZA 3FGUA 4CHNA 3HSTB 1Q3VA 3HD1A 2MHNA 3BGOP 4HTJA 2XYHB 5ALPA 4UOFA 2BX6A 2NSCA 3AGRA 3DRSB 3OBYA 2BQUA 2EQYA 4NL5A 3RW6A 1YTAA 3HOTA 1G2EA 1P9YA 1NHVA 2XWXA 4C4WA 2Y0SF 1AUSL 1NU4A 2YH1A 3AO2A 3M6VA 2RVJA 5ADXH 1KQSR 1PBAA 1L3SA 1P6TA 4RUAA 2V2KA 1D8BA 3AT1B 3GIRA 3H40A 4X65J 3C28A 2DF4B 2KKHA 3DM2A 3HZ6A 2YNHB 4HH1A 1S9FA 5DB6A 4M2YA 2AU0A 4DTJA 5CY4A 3CHWA 4Y2SA 2CADA 2G8UA 4CI6A 2WONA 2HHQA 5L1KA 2QLBB 3RUBL 4ECSA 1Q8BA 4EBDA 2F9TA 1UAXA 3I1YA 1S1VA 2JGUA 4Q2MA 5AR0A 1NHUA 2W4DA 3H7HB 2RDDA 1Z1BA 9ICRA 2BACA 3OTEA 4TURA 3KOOA 4LR7A 2GHVC 2PYLA 1BI4B 3V1QA 1VAZA 2DXDA 3J80Y 3L3VA 3VCBA 2L41A 1IV8A 1LW0B 3HHLB 5KFJA 1FK9B 4RCHA 4CZKA 4OJ5A 5J2QB 1NB2A 5ETSA 2R8JA 3M1VA 2HOQA 2AA4A 3SJHA 3N5BA 4KRWA 4ZJQA 2R2TA 4J7CA 1JXVA 2H1YA 3HULA 2FJEB 3AXKA 4UY8O 3QX7A 3DXSX 4USKA 1YXQA 1HBMB 4C8MA 4OLAA 2XULA 2ZQBA 2MUTA 4BDPA 3OXFA 3GG1A 3EICA 1MWKA 4BGDA 1TKXA 3M3ZA 3C6AA 1UHUA 2UV8G 2YJEA 4IDHA 4DR4K 2B4PA 3OL6A 3P3DA 1FEZA 2QARA 1Y5LB 2F2AB 1F3VA 1EQ0A 4Y2YA 1ZQVA 3GIMA 4HWIA 1ED1A 2P1JA 1Y97A 4DR2K 1FTRA 1UVIA 2V2VA 2U1AA 3J7YU 1HHQA 3U27A 1YIJS 1TL5A 1DRGA 1S6QB 2IMOA 4AILC 4NXNJ 3BF3A 1GMVA 3WC2A 3K5MA 3T9NA 4ED6A 4A8KA 4CLPA 2EG1A 3LP3A 4KLUA 5G5GA 2CQ2A 1N5YB 1RUSA 2EBGA 2MQQA 2CPDA 1OJ4A 2D69A 4NCAA 3UVJA 3C14B 1YZ7A 2VODA 2HHTA 1OO0B 2ZDOA 3QB0A 5ETOA 5CHGA 5AKJA 3DXMB 2PFOA 4QZBA 4OX7A 3DOMB 3D6FB 3ENAA 5JMVA 4PQUB 3CGIA 2WSFC 2RT3A 4HTLA 3JXOA 2F9WA 1RT5B 3CDUA 3OYJA 4XPEA 3LZJA 2RKIA 1WHYA 3KTQA 2HLUA 1RZMA 3SCLE 4K41A 4Y2UA 1Y0HA 5ALTA 4TXSA 4GVBA 1RT2B 2FYXA 1H0HB 3CJCA 5E41A 3OYCA 2AYGA 1Y11A 3CDWA 4IOCQ 4NXMJ 2YB4A 1P8ZA 4QZFA 4USHA 4BRHA 2DFEA 2XO6A 5C10A 1NGJA 2WRMA 2Z1JA 4CJUA 4I2PB 3MWPA 2RIJA 3IRWP 2CZVC 4DCHA 3HKWA 4CJVA 2C3PA 1XBWA 3L2VA 3RMCA 3LF0A 1SUQB 4CZFA 5HHIA 5TISU 2Q31A 1GLLO 3BGUA 3LPYA 1Q82O 2HW3A 2FIUA 5KL8B 2R8GA 2VJUA 2H3GX 4CF2A 5ALDA 1IWGA 4U8VA 3SXLA 5EY4A 1N6QB 3AY9A 4P75A 3WK8A 4RLEA 2BDUA 1OH6A 4QZIA 1XSNA 1L7OA 4R8UB 4MQ3A 2XS7A 1RT3B 3K5OA 4N7TA 3W2VA 3QUQA 3I56S 4YY3J 3GIKA 2LQ9A 2E9RX 4QOTA 2G8FA 5AI9A 1HX1A 3M8WA 4O8KA 3F2BA 1RT1A 4BXOA 4I68A 9ICEA 4DR4F 3T3FA 5IC4B 4BGAA 3THXB 3MC1A 3UXNA 2RDJA 3V81B 4H4MA 3O5TB 5GTIU 5BRDA 3HYFA 4CO2A 5C12A 1ZBIA 3DMJA 3MZIA 4DR2F 1KRPA 4F26A 4AHUA 4KE5A 4AHTA 5GAGP 1FJEB 4YR3A 4CFDA 2E2QA 4DV7K 4MFBA 2WAQC 1YJNS 5IT0A 4ZN1A 3NAIA 1HW9A 5KT7A 2DB1A 3EMTA 1T8EA 3QT6A 3OS2A 1M90T 2VD3A 2EFOA 3RVCA 3MEEB 4JKBA 1QY7A 4Y28C 4B3TJ 3NMAA 1JCEA 2KN7A 1NI3A 2DK2A 1EKRA 3A3OB 2KVCA 4KC5A 1WBDA 2O01C 5G0RA 4ACOA 3MCOA 1GTEA 3TWHA 5K4LA 1LWFB 3HHLD 2EANA 1NHKL 3EL2A 4AHVA 1NAQA 4CK2A 3VAJA 5J1NA 1J5OB 2QA4N 4OJ3A 1F21A 4BRCA 3PW2A 1U26A 1RBTA 3R6GB 3DLGA 4QYRA 3X1LB 4M41A 4BRNA 4FJJA 1TFYA 3UD5A 1U04A 4C8OA 4DV2K 4KFBA 4IC9A 2BV3A 1GX6A 2LCWA 4JI7K 3WQTA 1PJ6A 3K2YA 3IGVA 4DU7A 4RQMA 1ZM9A 4B9QA 4HEA9 1K8KA 1VQNN 2BPCA 3EDRB 3R9LA 2ZJRL 2O8EB 3LH2S 4JAXA 4KB0A 2NLWA 4USIA 4J03A 4F67A 4ID5A 2EW9A 4JI2F 5B09A 1H74A 4F5RA 2BCUA 4CLYA 5BREA 1SWWA 2DPIA 1RT6A 4HLBA 2QEXS 3I0RA 3QYYA 3C23A 2KYXA 3ISNC 1TL1B 2IVMA 1VHXA 4UW9A 5KAFU 4DLEA 4B8AB 2GTDA 2IVPA 3HHNB 2QT7A 3TAGA 5J2MB 4OV1A 1VS3A 4JI6K 1U6BA 1FDDA 4CNYA 2FZCB 3K0JA 3HP9A 3W2WA 2W1BA 3SENA 1TK0A 3GFYA 3PHTA 1BGXT 1R0AA 4DTPA 4B9TA 5J2NB 1N0VC 5GAHI 5C24A 1NLKL 2HK3A 3IP0A 4J91A 3QATA 1C0GA 2P66A 3U8XA 1U8WA 3ETOA 4W5NA 3BY5A 4DV4K 2DNGA 2Z2YB 2NXEA 9ICXA 5CZXA 3OTQA 1RBAA 5GMKa 4Q0BB 1NM1A 2DNOA 2A40A 2VWKA 1Q86T 2G07A 2QO3A 5EWGA 1Q8KA 2FPHX 4RNMA 3KDNA 1FRIA 4RBVA 4MIAA 3VEWA 5KFWA 5C42A 2DCLA 4LZGA 4IFYA 1MN7A 4CYUB 1WLJA 7ICNA 2MLXA 3DXBA 3CD7A 2Z2ZA 4K7QA 4ILLA 5MLCV 2ZH3A 4CHOA 2F7VA 4H5RA 1K47A 1LWEA 2UUBJ 2QA2A 2ZZTA 3VEOA 5J0RA 5SWMA 2C2NA 4ILGB 2V8DA 1FO4A 2FC9A 2OM6A 2MKIA 3TKAA 4GKKK 4B02A 1T6CA 4XEIA 4F4KA 3KD3A 4YORA 1SC1B 1EQMA 1Z00B 2WK4A 4OHVA 1YF5L 3LP0B 4NCGB 4DO9A 1S1WB 1H98A 4I29A 4B3SJ 3B4MA 1TFWA 3SQ2A 1OH5A 3MWTA 4KQZA 2EEYA 3C7NB 2Z56B 2D9PA 1PIEA 3VVTA 4DV2F 3AD9C 1PC5A 5LJ3Y 4MEXA 1YJVA 4JI7F 2L48A 3K9KA 4V19X 3FE1A 1DGSA 1GEHA 2P35A 1XR7A 1MWYA 1BVSA 1S4EA 3DLBA 4B3MK 5DQHA 3QIPA 4C11A 2QLWA 4UBBA 4I2EA 1KAZA 5F2RA 3PRVA 2ZUBA 2WB1D 2BANB 1B0XA 2GX9A 3SR6A 8ICMA 1X4FA 2W03A 3MMBB 4WZMA 1ATNA 1WAJA 4TU7A 1MA7A 4D3GA 4O5CA 1V4TA 3K8WA 4RQ6A 3SQIA 4O3RA 2GO8A 4OPKA 3J7AN 3M9OB 4K42A 1HNWF 1D0EA 1B22A 4YUDA 4JI6F 4NLGA 1WEZA 1FCAA 1OYEA 1CLFA 1SQKA 2UUWA 4O3NA 1JN3A 5DDOC 3Q8VA 4KPCA 5ALUA 3RBXA 5ETLA 3N4MB 1YJUA 4YOEA 4RJVA 4JI3K 4DOCA 3MXMA 3G82B 1OXJA 1IIPA 1IBLJ 1DTQA 2VA8A 1M5KC 1P1LA 3PJXA 3MN6A 3AQEA 1P7DA 3AVGA 1VQKS 4NM2A 2QRRA 4A5BA 2Q1NA 2M7SA 4C0OC 4DV4F 3IBCB 2GWJA 4ZHRA 5K14A 5KFBA 4CT8A 4ZPDA 3E51A 4DR5F 2VG6B 3CIMA 5J2PA 2R2UA 4K4UA 3Q2SC 3CQXA 1R89A 2HKEA 5FLXU 5D0EA 3OW2R 5KFHA 2AF6A 1ILYA 3A0BU 1DEJA 3C46A 8ICKA 2GIFA 2K7JA 3ZSXA 2DFFA 2LHTA 4X4NA 1X1PA 4KIAA 1SL1A 3PW4A 1N5QA 2NPIA 5M1PA 1I6JA 3PR4A 5IT9O 4YB1P 3AODA 4E7KA 1NM2A 3M8PA 1YUWA 2I6XA 4XH5A 3DEEA 3JQKA 3HM8A 1N32J 5CZ1A 1C6VA 5GAEI 3ZSYA 4W4MA 1OH8A 4JKGA 9ICCA 4RNNA 1FKPB 4Z4CA 3CT9A 1OY6A 1Y4ZB 4USTA 2BR0A 2Q97A 3KK2B 4GKKF 2R7QA 3GBTA 4FKXA 3JAMU 2E2PA 3ATVA 3I28A 3K75D 5KG0A 4DFPA 1N5SA 5I9EB 3O9UA 2QMUB 3D0PA 2P9NA 3G71N 1BQNA 4JKHA 3LVVA 1BWFO 2HBQB 1WBBA 1NK4A 2HLTA 3C2KA 1W2BM 4CBXA 3KG4A 3CCLN 1JLBB 2G5HB 2KFZA 4UBCA 1NDCA 1TVAA 3IDWA 3ZTPA 4RPZA 2YKQA 1NGCA 4H4OB 2W6LA 4B3MF 4JRQA 4G9ZA 4B6JA 3VZHA 4LC9B 2L3MA 4CFBA 1OVQA 2F96A 3AOCA 4DHYA 1ASVA 4X64F 4BE1A 1RAGB 3JPTA 4Q7AA 3PW7A 1BE4A 4PCQA 4PZOA 5AXNA 4DV6J 2CQ1A 3S1TA 5CP2A 4KLMA 2B7BB 4DV0J 2KVIA 3UW1A 1F0MA 1NKBA 4ANDA 3JSMA 4BJQA 4FK0A 4FLTA 3DKDA 2LM4A 2J6TA 1DBDA 1JLAA 4KO0B 3ENQA 4W5QA 4CGJA 2CJ9A 2N3LA 2ZIUB 2ZUAA 3TA0A 2YNIA 3C2MA 1S7HA 2WOMA 2QWNA 4YD1A 2ES6A 1EAYC 2ZIVB 1SH2A 1F2GA 1GMWD 1NRKA 5AQYA 1ZQXA 2HVHA 5KFYA 4GKJJ 2OD6A 4EZ6A 5B0CA 4CJSA 3AOBA 4WP8A 4AM6A 5LJVA 5AQNA 5HLFB 1Q0NA 1X4GA 4OI0A 1MWMA 3UMGA 3UO0A 1T05B 3I87A 5BR8K 1RDWX 1U1MA 2YKPA 4BVOA 2PFFB 1HBUB 3RJMB 1X3MA 3IAS9 5B8HA 5IQQA 1IBMK 4MN4C 3TJ9A 4PUOA 1B4FA 4JI8F 2G09A 2D3OR 1SKRA 3HJFA 2HOEA 4FPBA 4CJFA 1RKIA 1VSDA 1WG8A 1X4DA 1D3WA 1UVMA 4CNZA 5CH7B 4BRQA 5D4LA 4R64A 1XK8A 5KFAA 4QU7A 2E1ZA 3IM8A 5DQIA 4O8UA 4FWRA 3O3HA 2HWIA 5ALSA 1HLWA 2PYJA 4RNOA 2M9KA 3M2VB 3ZSWA 1RDRA 3MMCB 3UQSA 1BL3A 4C8NA 2EFGA 1S6PB 3SAHA 3U1NA 6AT1B 5L39A 3RYLA 2DD8S 4X62K 1EETA 3MGJA 1VRTA 2BKPA 4A61A 1HEKA 4MKVA 5T41A 3KKAC 5L9NA 3PCOB 3BKUA 3CPWM 1SCJB 3G6ES 3OD2A 1KBRA 5DM7L 3FBFA 1HQEB 2WVCA 2G9OA 2Y9TA 1JNZB 4QWBA 1SC3B 2P9SA 3OA9A 5KFTA 3I0SB 3L8BA 2QWQA 1XWLA 2ZTEA 3I5BA 2IYIA 5F0WA 2F1IA 2LDIA 1IBKJ 5K8PA 3PIOQ 2FBVA 2H4WB 4WP9A 1WKKA 4B3OB 3LDSA 5E3RA 1MU2B 3O9QA 3QT5A 2YXLA 5AE1A 3AJ1A 3C29A 3LALA 2HHHJ 3NNAA 2FE9A 3CSKA 5AXMA 5L9XA 1CC7A 2MPUA 1WYGA 4Y2KA 3PIPL 2GVDB 3VMFB 2E7XA 1TZ0A 4DR3J 5DJBA 2HQIA 4CBWA 4C7YA 3ZI4A 5AM4A 4EEYA 5EU7A 2RS8A 1X4CA 4Q45A 3AVJA 1WUAA 4M1KA 4LF7K 2AH5A 4KLHA 4DV3F 1N62A 3CJ4A 1U2CA 1XNQF 4KHNA 1FEEA 2EVZA 1SB6A 2VQFK 1RG6A 3SLCA 4FLZA 2IC3A 2MKHA 3HSGA 3OTOK 3C94A 5U47A 1FRHA 4DUTA 5EE1A 1OSCA 3CD0A 3WK6A 3CCES 1KVJA 2BCVA 5HR7A 1FA0A 2QSFA 9ICSA 4QW8A 1F9FA 2D8CA 4EWTA 3MBYA 5HMMA 2YVSA 2H5XA 3EWAA 3AJDA 1GOBA 1VMBA 1L7NA 1V3RA 3MMAB 1HQ2A 4PWUA 3OY9A 3GONA 2G8IA 3AD7C 3ZEUB 4DWIA 1I51B 2WZ1A 3UCUP 1JLEB 4C8YA 1F44A 2OMOA 2ZH7A 3ZT4A 1D8LA 3FNNA 5HSPA 2W4CA 2RQ4A 2BE7D 2C42A 1Q9YA 3EY1A 3AVAA 1HYSA 3EE3A 4WQ5A 3L2RA 3NVKA 1NK5A 5ALLA 4AD6A 3CI5A 3IFEA 2DL0A 3PYGA 5ALXA 2B4VA 4X62F 2KJVA 4NLUA 3CC4S 1LKZA 2AZ3A 3SCIE 3R27A 1SJFA 1UZHA 1DGKN 4CZLA 3GU0A 2UXBK 1VRUB 1XU4A 5ETKA 3DOKA 4Y2CA 4P4PA 3OLBA 4TLRA 3LM9A 4RQ0A 3TUJC 2FMPA 5AZJA 2HMPA 2ADBA 5FD1A 3PNCA 5IXUA 3C6UB 1DQ8A 4DLGA 2NYHA 4CWBA 2XB2D 3ISZA 2EG2A 4FNIA 3DRSA 4IR1A 2EZXA 3FLCO 5ALWA 3ZDEA 1UVLA 2LPEA 2HRYA 4W90B 3FBCA 4C8LA 4B1VA 3L5KA 2VJVA 8ICCA 3JAMY 5L38A 3M6UA 3NCPA 1TQLA 2ZD1B 3VEXA 4JEPA 1CJKB 4OV6A 1XN9A 2LEAA 3ETRA 3TAMB 3L4IA 2J0SD 3RGIA 4LSLB 2KT2A 1B99A 1T94A 2MB0B 3CJ5A 3W5YA 1WOQA 4LUBA 1LOUA 4BRPA 4QZ8A 2YWGA 3NE6A 4ZIWA 2F1JA 1NG9A 5G5HA 3U1MA 5HP1A 6FDRA 5KG1A 3R9KA 4V1Ak 3ZZOA 4NB4A 3C1YA 4U96A 4K4HA 2HQDA 3AQPA 4ECYA 1VHIA 2WW8A 4LF7F 2BEFA 5A8RB 3ETLA 3VQAA 4Y2VA 3I8BA 4Y2IA 4LFCK 1EO1A 2OFHX 3ZETB 1LW0A 1XR5A 3CUNA 4CTAB 4M5HA 2MSSA 2VQFF 5CZVA 3OL7A 4CJLA 5J2QA 1DGJA 2XMTA 4L8RB 3CYMA 4YXJA 4JI0F 3P8BB 3GQCA 3VQ6A 2HBJA 2ZTCA 5AK3A 3LDPA 2YX4A 2DY4A 2BQRA 3QT7A 3PDNA 3VTHA 3G96A 3PMNA 5B0BA 1HBMA 3LL3A 4BR7A 2RQ5A 4R79A 3GG4A 2R7VA 2YMPA 1S5JA 1ZQIA 2ZH8A 2YI1A 4X4SA 2G0AA 4IOCL 4KH4A 3S9HA 5T7LB 1QHAA 4K8XA 1KR4A 8ICZA 2CYYA 4B1XB 4QWAA 1X42A 1S72N 7ICHA 3KHRA 3PW0A 3FZLA 2QA1A 5F8GA 3NF8A 1JNRB 1UT8A 2F1HA 4NA2A 3C6TB 4UB2A 2B8PA 3QJJA 5BYQA 3UR0A 2ZZNA 1RFQA 2OMLA 2EFNA 3CFRA 1BIZA 4WXOA 3R3LA 1N5XA 5J0SA 4DQQA 4C2MA 4DV1J 2ZKTA 3C14A 9ICBA 3AGKA 3VN5A 2JEIA 3D3CJ 2DR7A 2YNGB 4FWQA 1W2IA 4C80A 2O8CB 4NLZA 4DV5F 2G0CA 4PGQA 2N4CA 1SS6A 3DXMA 2A1SA 4CRXA 2KH9A 4HUFA 2JZBB 5KT4A 4X66J 3RSEA 2HB5A 5JVGQ 2N1RA 3HKZC 2E5SA 3MR5A 4I67A 3EGVA 5KFLA 3R6MA 3CC2N 4X4UA 3AQFA 4IOAQ 3ZSRA 2DRDA 4CBUA 3BF4A 4TQRA 1O08A 3CDAA 4F3MA 3J81O 1ZC6A 4OLOA 1IM4A 1RT2A 1RWKB 2AD9A 4FZYA 5AQRA 4IH6A 4WP3A 4KGXB 5DBBA 3VQEA 3MURP 3CCSS 1D9FA 1Q18A 5IIJA 3Q8LA 3TZXA 4PHTX 4QNLA 1JJCB 3AO1A 4KV8B 3VERA 1M6YA 3B82A 4H0TB 2APOA 4EO6A 3UD4P 1QAIA 3H98A 2OPSB 2DFHA 3KDOA 2CJYB 3AVFA 4BWJA 1LKYA 3KWGA 4RW7B 3UPQA 1J6ZA 2VG5B 1CJTB 2E5LJ 2G13A 5D4NA 1HW8A 4NLKA 4NRTA 1S57A 1OSDA 2ZHAA 4LF8J 3JPSA 3V7KA 3LZIA 2Y0SD 4J9RA 2ITMA 4OJPA 2G8VA 4DQIA 5GAGU 4EHTA 3KZBA 4RQ8A 3HVRA 2YJFA 2QA4G 2CPZA 3AARA 4YD2A 4R8UA 4P2HA 1HIYA 3EDQB 4OYXA 4E7HA 2QWPA 2FVCA 3AVNA 4RUHA 1QZ5A 1RBRA 3D4JA 2ZBRA 3QJLA 1NZBA 3P45B 4RW4B 3VETA 3SBGA 3KUEA 5GTHU 2YX6A 3BKTA 3V81A 2L08A 3QU4A 3JXUA 4M6WA 4HDHA 2MRLA 1KW4A 3H8JA 3FGVA 2V8GA 3RAMA 2HWHA 5J0QA 4O3MA 4CGGA 1SIZA 4JMUA 1TGOA 4NZ0A 1RBUA 1HKBA 2HHUA 4KTZA 2W2PP 2FTRA 4ENOA 4H5TA 3SYZA 3C1ZA 3N6MA 1WACA 4LREA 5HMWA 5DLGA 1K1QA 4W98A 3AA2A 3U02A 3CULA 2BJ1A 3TYTA 3MEEA 2BABA 4R63A 2K8GA 3H1QA 5J8YC 2CGKA 4K0KK 5J0UA 3CCQS 4MO5A 3CIPA 2E7WA 3WX4A 2H54B 4BC4A 3OVSA 3PFEA 3IS9A 1HBOB 2XWYA 1KL9A 3GJQB 3HZGA 2XMUA 5EHHA 4DJBA 2AGOA 3FK4A 2DKXA 3AVIA 4DMNA 3UKUB 1MNEA 3EVOA 3M5RA 1Y00A 2XZTB 1CULA 4UAWA 4NLVA 4JRPA 1C4CA 2B0CA 2PC6A 3BZCA 4HTIA 3VR1A 2DCUB 4DPUA 4OJRA 3UXOA 4JKEA 1NXIA 3VQ5A 4CERA 1AW0A 2O8EA 1R27B 1C0FA 3DDHA 4IKFA 2EFVA 4NPOA 5HNKA 4DZ6A 2WVFA 2KSOA 2E9ZA 2E29A 4U7CA 1U2FA 3BGLA 4FJ9A 7ICPA 5MLCQ 4CD3A 1ZQFA 3PY8A 3OYGA 2OELA 2PT0A 1RT7A 1IKXB 2V2ZA 5HHHA 2HGMA 3E58A 4UQGA 3I31A 4O23A 7FD1A 3AVBA 1I94K 4Z6DA 1K44A 4RO0A 5J1PA 1U6ZA 2C3UA 2DIVA 2Y1LB 2XMMA 1JLGB 3AVKA 2AJ2A 4CGFA 5LY3A 1TU0B 3VPZA 5AKLA 3PM9A 2HFOA 3ET6A 4DOZA 3BM7A 1VQ5S 5J2NA 4CZEA 1AA1B 3D7EO 3ZDBA 1WB9A 3KLFB 3GP9A 3E9PA 2C3MA 7ICKA 1W26A 2BMBA 3K7RA 5HATA 5AKGA 4M9JA 2J0XA 1YITS 4OGEA 2HFUA 4E1NA 3P5JA 4F8RA 2Q1LA 4FLYA 2JFKA 1D8ZA 4DX6A 4PHPA 2ROEA 1WEXA 2A2CA 3JYTB 3MCPA 2OPRA 5KFMA 4PWWA 3SQGB 4DZDA 5HVHA 3QEVA 5BR9A 3IUCA 4GXIA 4AQYK 2V8HA 2CQ4A 4M5MA 5KOWA 1VQMN 2QZ8A 4LBIA 4I2GA 3RRHA 2XG8A 4FM1A 2KB2A 4CYUA 3POTB 5KT5A 2PD1A 3IN5A 2V69A 1LB2B 1ZM4A 4FYXB 2ZFHA 2CIMA 5ALYA 1FRJA 3UNYA 2M2BA 3H0LB 2WTUA 5AXLA 2NO5A 1GMWA 3T9ZA 5CABA 3BBCA 1S7IA 1Z2LA 3MX2A 4TY8A 2VBZA 5L1JA 3TUPA 1VHFA 2P6UA 3CCZA 1N36K 1XQSC 3TNVA 4J2DA 2LXUA 2GA7A 4PJ0U 2V63A 1U45A 1A7GE 3SBMA 2P9UA 3SUQA 1NNDA 1FXRA 4OYOA 4NE9C 2CGLA 3CCVN 4P6QA 8ICGA 3BBBA 4IFEA 3MR6A 4DU1A 4F5QA 5AI8A 3R2DJ 4NCGA 1XMOF 1CC8A 1Q3UA 3OR2B 1FXXA 4O9MA 1FT8A 2YHXA 2XS5A 1TR0A 3CJSA 3THWB 3KWIA 2XM3A 2WHOA 3GOIA 1NZPA 4NCBA 2RJZA 2Z2MA 3ZSVA 2YWWA 5J2EA 2EI5A 3CG7A 1SBRA 1W97L 4I7FB 1COOA 5AFUH 2G4BA 4I6YA 4BR0A 4XRHA 4U67Q 1RPLA 2AXTU 3WK5A 3S6EA 1JWWA 4E1JA 3M9MB 4DG1B 5B66U 2MKCA 3VEYA 1VR6A 1BNOA 4A48A 3UKRB 3SV4A 4LRAA 5AQIA 8AT1B 3BSOA 4H5VA 1ZM2A 3EUNA 2VDIA 2PI4A 3MM8A 3CC7S 3KG0A 1N0UA 1NO8A 2VB6A 4FF4A 2D3ZA 1I94F 1C0UB 2MKYA 2Z1GA 1V85A 1CJUB 2F5GA 1RQ0A 2HZAA 2K4PA 2C1EB 2RMLA 4N5SA 1TVRB 3M8YA 4LF2A 4DV7J 2ATLA 3ZTQA 2W42A 4U8YA 3WXMB 2D41A 2M9NA 5AK5A 1UKUA 4WFAQ 1TKTB 1IKYB 1M5PC 1Q78A 3MXIA 4NMLA 5AQLA 3JPPA 4QIVA 1HKCA 3QE9Y 4N8NA 3RBDA 4UAVA 4A8OA 1QM9A 1I3AA 1R0CB 3MPUB 4I2QB 1TV9A 2F8MA 2E1AA 3KBBA 2IRUA 4CEFA 1OPIA 3FSXA 4AQYF 1TFRA 4RR5A 1IV0A 2BKEA 3DCAA 4X84A 2MAXA 4DQPA 3P6YC 5DZ6A 3C5FA 3M1FA 1GT8A 2ZJQL 4BVPA 1E6VB 2CNOB 3UDEA 5J0YA 3AN1A 2F40A 5BXIA 3GYGA 2WF6A 3B0XA 2Z2LA 4DV2J 1K8AO 1FFVA 1H7WA 2GWSA