1NJYA

Thymine-thymine mismatch at the polymerase active site
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 214
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njyA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njyA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njyA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njyA01
4M3XA 1BHLA 2PYLA 4QZ9A 3DLRA 3RBEA 3MEGA 3FDSA 4KLMA 4KLLA 4UB4A 4LZDA 1NK9A 3AVAA 8ICPA 3G6VA 1IKXA 2BE2A 1ZJMA 2LSNA 1KVCA 3QLHA 1I39A 2W9BB 7ICHA 1COOA 4W5NA 5D3GA 2C2DA 1V9PA 2DFHA 1RBVA 4CFCA 1ASVA 2KN7A 1UT8A 1CZBA 3TFRA 3CFPA 3F9KA 2Y1JA 4ELVA 3LAKA 1Y88A 4O9MA 4DSEA 2ZUCA 1EX4A 1WAJA 3D0PA 2OZMA 8ICBA 4CEAA 1RTHA 2PI4A 1GOAA 3S3NA 4J9LA 1S97A 1YT3A 1KLNA 4YFUA 4KN4A 2JZBB 9ICAA 2ETJA 4IG3A 1QSLA 3PW0A 3OYAA 4I2IA 3LWLA 2ZUDA 3CM6A 2XO7A 2MUTB 2DFEA 5CWRA 1S6QA 3ZT4A 1K1QA 3HPOA 4CEFA 1NOMA 1S5JA 3KLIA 2OWOA 3UQ0A 4BXOA 1Z25A 4FYDA 5HRPA 3EW9A 1S0OA 3TFSA 3OYJA 5J0QA 1ZQQA 1S9FA 4FJNA 4I9LA 3K59A 1HNVA 1ASWA 3GV7B 9ICKA 2LYHA 5DDYA 4DFJA 3HK2A 4JV0A 3CFRA 7ICNA 2JLEA 4OLAA 4KB0A 3PX6A 3T19A 3V6DA 3N97B 4CJFA 5KGXA 1TKZA 4CJUA 3M8PA 8ICGA 4PUOA 4YFKA 3MXMA 3Q8RB 2C28A 4F4XA 1LV5A 4DFKA 1K6YA 1T05A 1ZQDA 4KRFA 1XSLA 2Z1IA 3NAEA 1TKXA 3SNNA 1BPZA 5KT6A 3OYFA 1U47A 2IC3A 4IR1A 1SUQA 4NLZA 3NBPA 5KG5A 5DKWA 1D9FA 2BQ3A 1S76D 3FYHA 1XHXA 2W9MA 4DTPA 2D0BA 4GXKA 4BWMA 1WNSA 3C2LA 3EYZA 3UQ2A 4IFVA 4P2HA 3T5LA 2W8KA 9ICSA 1WN7A 9ICHA 5DG9A 5KG6A 3JPPA 4OPKA 1DTQA 4DTUA 4N41A 1ZBHA 3N4MB 2X6SA 2O4GA 4KLQA 1B9FA 1A77A 9ICTA 3L3VA 8ICMA 5J0OA 4IRDA 2HNDA 8ICTA 1SL0A 5JS1A 3RB3A 5J2JA 5SWMA 3ZDEA 3VA3A 4C8KA 4O5EA 3HSTB 4CEZA 4F3OA 2AGPA 1KVAA 3UXNA 5D4BA 3PW4A 1WSJA 1MSWD 3HVRA 4RQ3A 2G8HA 1JN3A 8ICFA 3RMDA 4CGDA 1QS4A 4IRKA 1S1UA 3ZCMA 2NRVA 1C0MA 3DI6A 4B9NA 4IRCA 2HVIA 5E41A 1TL3A 2FBYA 4RQ7A 4OVLA 2QK9A 4CFBA 1KTQA 3QE9Y 4RQ8A 4ECQA 4YXJA 4MFFA 3NDKA 3NF9A 1QSSA 4M9LA 3C1ZA 3K58A 3M8SA 2NUBA 5BPCA 1RBRA 4B8CA 3OYNA 4ED8A 1LAWA 5HMLA 3KD1E 4CEDA 3RH4A 2YNFA 1XC9A 1Q8IA 1IKWA 3JPOA 5L1JA 3UXPA 2HHSA 1B22A 4Q45A 2VG6A 3TAFA 4KLTA 3DMJA 3QEIA 4GXJA 4YR3A 2XY5A 3BGRA 1X9WA 4CHYA 3AO2A 3SQ1A 1RXVA 4NLKA 4Q8FA 4M3RA 3JPNA 7ICFA 5CHGA 1ZQKA 1TAUA 1EXQA 3AA4A 2OZSA 4M3UA 1VSKA 1ZQRA 4AH9A 5DGAA 1BCMA 4YNQA 3K2PA 1J9AA 4RPZA 3VQ4A 4FK2A 3PV8A 4CF1A 4ICLA 5J2GA 3GIKA 2VA2A 3K5OA 2IBKA 3NF8A 1SKRA 2XCAA 3C1YA 1BQNA 3B0XA 5IIIA 3LP2A 2FBVA 3L2VA 2HHXA 1BPEA 4CE9A 1JLCA 3QZ8A 3SUQA 4JRPA 1Z3EB 1C1AA 2Q0ZX 4J9PA 4IFYA 1NK8A 1ZQOA 4AILC 2FPLA 4XA5A 2D5RA 2DFLA 5CZ2A 4KHSA 3PVXA 1S10A 1JLBA 3LZIA 3P83D 3V9XA 4LD0A 1RYSA 4CIEA 4CJTA 3Q8QB 4F2RA 3NTUA 3H8JA 2XCPA 3VQ5A 4KLSA 3M8RA 1CXUA 1JMSA 3VA0A 2AGOA 2RDIA 1REVA 2VWJA 3GILA 5J2BA 3QESA 4FXDA 4I9QA 4KHUA 4PA1A 4UBCA 4IR9A 3ITHA 1VSJA 3BDPA 1X9SA 4ED6A 5DQHA 1BPYA 3WNEA 1RILA 1JLAA 4YD2A 4XRHA 4IQTA 2M9NA 1UA0A 4I2HA 4C8LA 3NH0A 4FM0A 3Q8LA 4I2JA 4CHNA 1SKSA 3HVTA 4RZRA 5EWEA 1WSGA 4HUGA 5EWGA 4F3TA 2OA8A 4F5RA 4RQ4A 4BWJA 2P6RA 3O3GA 1GOBA 2FPKA 1FKPA 3KKRA 1N5YA 3RRGA 2KFNA 4UAZA 5IIOA 2W8LA 3V7JA 1TK5A 2ZQBA 2BCVA 4KHWA 4JS5A 3EPIA 4OPJA 8ICVA 5HRNA 4LSNA 3S3MA 3HPHA 2BPCA 3SI6A 4CJSA 3D45A 4M9GA 1ZQUA 3K75D 8ICYA 4KV8A 4QZIA 2PFQA 2ASJA 4Z0UA 4ED7A 3FFIA 4K8XA 5L1IA 2AQ0A 4BE0A 4KN7A 2BPGA 4OKEA 3LP3A 4F5OA 2IDOA 5KG1A 1BVSA 2B21A 1ZQVA 7ICMA 1C6VA 1TFRA 1U04A 4I29A 2B4JA 3K5MA 1JX4A 9ICQA 2XHBA 3P5JA 4NLNA 5HP1A 3RJFA 4Y1DA 4NY8A 4DF4A 2Q3SA 5J0SA 1ZQNA 4MF2A 1NKCA 4O44A 1L5UA 1Y97A 3AVMA 3E01A 2G8FA 3QEVA 1JL2A 3AVGA 4YN4A 2BCSA 3VQAA 2Y1IA 4F92B 3V1RA 1VK0A 1ITGA 1T8EA 3MFIA 2FLNA 1H38A 2WTFA 3OHAA 4RW8A 2F8SA 3LALA 9ICOA 3RRHA 3NFAA 1CLQA 4ZH4A 5C5JA 1VSEA 3RJHA 3RAQA 2HB5A 5KRSA 5KFCA 4DWIA 5J0TA 1GOCA 3AVHA 1RTJA 4JS4A 4QZDA 3C94A 5CYMA 3L2WA 3KIOA 4Z4HA 4PY5A 4OGCA 3V9ZA 5J2PA 5DG7A 2WONA 4PQUA 4CGGA 2ASDA 4DOCA 4FO6A 5KFOA 2BQUA 3O3HA 3PNCA 3LWMA 1HYVA 4Z4GA 5HRRA 2HHWA 3DYAA 4KFBA 3Q8MA 9ICFA 4G3IA 3MEDA 3BQ2A 4ED3A 4DL2A 5KG2A 4BDPA 4FW1A 5KFBA 1ZBFA 2OYQA 1KFDA 2C22A 4DTSA 2KTQA 4PHDA 1CZ9A 1RT7A 4FLXA 4KI4A 1RDBA 1ZQPA 4F4ZA 4QZHA 2RF2A 3AVBA 4EEYA 1HQEA 2ZJ8A 4K4IA 5BOMA 5HBMA 4HYKA 1U4BA 4ED2A 5BOLA 4RW9A 3MEEA 1RTIA 5KFLA 3IM1A 3ZDAA 2OPPA 3RBDA 2F8TA 1T7PA 1ZQYA 4FS1A 3OYCA 3C2KA 1NKBA 1W0HA 5KFQA 4E19A 3U3YA 8ICOA 4N5SA 9ICPA 4UQGA 3LP1A 3ZD8A 3MDCA 3WNGA 1BPXA 3V72A 3BQTA 1UT5A 2VA3A 9ICMA 3O3FA 3VQCA 5KFEA 3AVCA 3GIMA 3IHQB 3KJVA 4R8UA 3SUOA 5KG4A 5DDMA 4ID5A 5DBBA 4ECSA 2UVVA 3I8DA 3OSPA 3DLGA 9ICJA 3AVKA 1D9DA 7ICQA 3O4QA 3ZSYA 1VSMA 4OGEA 2PFNA 3TABA 4QWAA 3T1AA 1WCNA 2XRIA 4EBEA 1X2IA 4DSKA 5KFYA 2FPMA 3LPTA 4Z4IA 1EP4A 1CXQA 4QWDA 9ICWA 2WOMA 2W9CB 5J2MA 4QZEA 3HWTA 1C1CA 4M9HA 1BI4A 5J1EA 7ICPA 1LWCA 4W5RA 1T3NA 4PH5A 3QEWA 4UAYA 3CM5A 8ICZA 5HMMA 4KLUA 1B92A 3NGIA 4FJJA 5C42A 7ICSA 2E4LA 3LZJA 2F1HA 3ULDA 4AHVA 1BISA 4RPYA 1WSFA 8ICQA 2P5GA 4O0JA 2JEIA 4OLBA 5D46A 1VSIA 4KB1A 3O4NA 3MXJA 4RUCA 3SV4A 4O3RA 2FLLA 1TK8A 4MFCA 1HJRA 3EY1A 2J6SA 4C8OA 4RQ0A 2YNGA 4L8RB 4DLEA 4BACA 5CR0A 4DFPA 3THVA 4RQ1A 3QZ7A 2R8GA 5EU7A 4CEOA 1NJXA 3QNOA 8ICNA 5KRTA 3RJKA 3SPYA 7ICKA 5DQGA 4I2CA 4H8KA 2W9BA 1N6QA 5J0UA 2A1JB 3H4BA 1NK5A 4CJ4A 1TAQA 2IHMA 1TL1A 1VRTA 3TQ1A 5DG8A 3NF7A 1QHTA 2ITGA 2QXFA 1KEJA 4F5NA 5L1KA 1B9DA 4DTJA 3C21A 2HNZA 2DPIA 5CZ1A 2BGWA 2DTUA 3PW2A 1J53A 3OYEA 1U9LA 3C2MA 3VQ8A 2JZBA 1VSDA 4P4PA 3GDXA 4ELTA 1YVUA 2IOCA 2VANA 5KFPA 4QAGA 3VQBA 4FZXC 4FJKA 4M9JA 1S6PA 4RQ6A 5IINA 5JS2A 4DTXA 2ISOA 2MUTA 1Q9XA 1K1SA 4JWNA 4W5OA 4B08A 3SV3A 4Y1CA 2F96A 4N56A 3OS2A 3LP0A 2KZZA 5J0PA 2YNHA 1AROP 1RT6A 1TV9A 4FJ8A 4X5VA 4DTOA 5KFUA 3HPGA 3RMBA 5J29A 3Q8PB 1HQUA 5HHHA 4B9TA 1S9GA 4EYIB 2GV9A 3QIOA 4CECA 4QCLA 3H8SA 4QZFA 2IMWP 1RCHA 4ZHRA 1HMVA 4I2EA 3QEBZ 4B8AB 4AHUA 4J9OA 4NYFA 1XHZA 4IQWA 4M47A 1IH7A 5KFZA 2X74A 3C5GA 4M6WB 4R65A 3TAMA 4AHTA 1BCOA 2PFOA 1ZQJA 3OYKA 4DQIA 4YMOA 1F21A 4CF8A 2AQ4A 1NK6A 4ECWA 3T5HA 4EYHB 3ZT1A 4ECUA 3AVLA 3TWHA 4DOBA 4DU4A 4BGDA 2XGPA 4ZTJA 3V6JA 2YKNA 4IDKA 2Z1GA 4C8NA 2PI5A 3QNNA 4IBNA 1QSYA 4FLVA 1RXWA 2YV0X 3DLBA 1RDCA 1NJZA 1KLMA 3OJSA 3M8QA 4J2BA 1ZQBA 4K8ZA 4Q44A 4O5BA 3G0ZA 1Z00B 2GWSA 1LWFA 3KLHA 4O3QA 4DSIA 4DL5A 1RBUA 4QZBA 5KFJA 4CJWA 1ZQAA 3MABA 1FK9A 1JLFA 4DG1A 3NHGA 5KFAA 8ICCA 1MQ2A 4W5QA 1ZQSA 1JXEA 4I2QA 4B3OA 4R66A 4CEEA 4CF0A 2V9WA 4QOZB 4DTNA 1IM4A 5J2AA 1B43A 7ICLA 4E7HA 4J9QA 3AUOA 4E7IA 3PO4A 2BKEA 3PY8A 3TAEA 4YP3A 4QZAA 1U45A 2F1IA 3AU6A 4IKFA 2UVWA 3L2RA 4R5PA 3SQ0A 2NRXA 4K4HA 4DSFA 7ICJA 3P1GA 4O5CA 1G15A 4HCCA 2UVUA 3H8WA 3OYIA 3AO1A 3SUNA 2HHTA 4F5QA 1RDDA 4LVSA 1J54A 4YG2A 5KT2A 2GBZA 4CK2A 4J9NA 4E1NA 4I2BA 3VQPA 3QINA 2FBXA 1NOYA 3DRSA 4I27A 4NYNA 3KK3A 3H08A 2YHBA 2NRWA 4PGYA 4F50A 4FJ7A 8ICKA 3V6HA 4DL6A 4GXIA 3ZSXA 4Z4CA 1X1PA 1FXXA 4W5TA 4FM1A 2V4QA 3K4GA 4FJIA 3MECA 2W42A 1YTUA 3AA2A 3HP9A 2HMIA 1SV5A 2VWKA 8ICAA 4DU3A 4DTMA 3ISNC 7ICIA 1ZQCA 2RN2A 2BGGA 2PYJA 3NE6A 1RDAA 3KLGA 1BL3A 1DOQA 4K4GA 1QQCA 3V9SA 3LDAA 1ZQHA 5DBCA 3G6XA 4DF8A 5DB8A 5IIMA 4XQ8A 3TAPA 4BDYA 4Z6FA 4DU1A 1EXNA 3HT3A 3LPUA 5DK5A 1TGOA 2P66A 4B9MA 7ICEA 4FJXA 3K5LA 5J2DA 1TKTA 2XY8A 1ZQXA 1XSNA 1JKHA 1WSEA 5KT4A 4MFAA 3V7LA 1HUZA 3HW8A 4H4MA 5HHIA 3M9MB 2OPSA 2AJQA 5KFXA 4YD1A 7ICVA 4HHTA 3DLKA 5C24A 2PY5A 2V4RA 4DL7A 8ICUA 4DS5A 5J2HA 4EZ9A 3EWAA 3K57A 3ISDA 9ICEA 3C6TA 5F9NA 1JLEA 3OVNA 2D0AA 3ZD9A 4CHPA 4GLXA 4FLTA 4FCYA 2QKBA 4B9LA 3DOLA 4BE1A 3VN5A 8ICLA 1KDHA 1NK4A 4CGFA 1HUOA 1VSFA 1WCLA 4FLYA 2A1RA 2P6UA 1RT3A 2P5OA 1ZQTA 1Q9YA 5KFFA 4C8MA 4YCXA 3CYMA 5C25A 1QLNA 1YTAA 3NGDA 3NF6A 5DMRA 4CJQA 5CB1A 2Z1HA 3SPZA 2EX3A 2BQRA 3RB6A 2BCRA 4FW2A 4E7KA 4B9UA 5HLFA 4I2FA 4QWCA 4QZCA 3C5FA 2O4IA 3H7IA 5FRNA 3V6KA 2JEGA 5J2NA 2B5JA 3SQ2A 4Z6DA 4FK0A 5FRMA 4ED1A 3KHRA 4CJKA 3NGYA 1D8YA 4JLHA 3GFKB 2IA6A 2ALZA 3BQ1A 1NK0A 4DMNA 4J2AA 4I2DA 3V1OA 3RR8A 4CHQA 2B6AA 1S0NA 4Z4FA 3ZDBA 4KTWA 4NXZA 4I2GA 1RT1A 3ASMA 3JSMA 2IGIA 2PXIA 2YNIA 1IO2A 4OJRA 3ZSVA 3NCIA 4DQSA 1NJYA 8ICJA 3TANA 1UWBA 4KAZA 9ICBA 3M9NB 4RW4A 4Q8EA 3U6FA 3AVIA 4BE2A 1LAVA 1DLOA 4F93B 4KLGA 4P4OA 3MR2A 4AHRA 3UPQA 3I0RA 1ZQLA 7ICUA 2JEFA 5KTQA 3PX0A 4HVJA 2VG7A 2AGQA 1TKDA 9ICGA 4KLIA 3MDAA 4KTQA 1KRPA 4FJHA 3AA5X 3RH5A 4QW8A 4FJMA 2UVRA 4NCGA 3GIIA 4I28A 3SCXA 2BDPA 4FS2A 3GV5B 4KHYA 4KHQA 3DOKA 4UB2A 3UXOA 2FC0A 8ICXA 3MR3A 4NCAA 4FJ5A 2DPJA 1XWLA 1BIZA 3OYBA 3A2FA 3M9OB 4DO9A 4DTRA 3MXIA 3RTVA 4CK3A 3KHGA 1RPLA 2JGUA 3VQ9A 2ZD1A 2G8IA 1U48A 1ZQWA 4CESA 3RB4A 4CIFA 2BPFA 3KHHA 4BXOB 1QE1A 4CERA 1ZQMA 3H4DA 5FROA 1SZPA 4CJRA 5KFTA 2YHAA 1CEZA 3QETA 3TR8A 1ZBIA 3QO9A 3BQ0A 4ECRA 5KFRA 4NLGA 4Q43A 4GC6A 5KT3A 1S1TA 3KD5E 5J2FA 5DB7A 3AVNA 4DQQA 1SKWA 3G10A 4M41A 5KT7A 2I9GA 3KK2A 2KQ2A 3LDSA 8ICRA 4HUFA 3V9UA 1D5AA 1HJPA 4M3TA 5J2IA 4PWDA 5KGWA 4ECYA 1BPDA 1ZQIA 2DFFA 5L1LA 4ECZA 3RJJA 2ZTCA 2HVHA 3EPGA 2R8IA 4J2DA 5HNKA 4O0IA 2ZTEA 4KPYA 3EZ5A 2I1QA 5KFKA 2FMQA 4FVMA 3ISCA 3HXMA 1NJWA 4TQSA 4KREA 5DQIA 4WE1A 4M42A 1HRHA 3KKSA 3F73A 3U3GA 3SQ4A 4HCBA 4LZGA 2G8WA 3PMNA 4TURA 4DL3A 1N48A 3CFOA 4PHPA 3IS9A 3TI0A 3L2QA 3V4IA 4NCBA 3VQ7A 3RR7A 4I2PA 4QWEA 4Z6EA 3RB0A 1JLGA 1RNHA 3JYTA 4J9MA 4FBTA 4J9SA 4B9SA 1DTTA 4MQ3A 1O1WA 1WSIA 2FMSA 4KHNA 3SJJA 4ELUA 3UIQA 1XO1A 4ZTFA 4QWBA 1MU2A 4MFBA 4KI6A 5J0WA 8ICHA 1SL1A 3TARA 4RT2A 4DS4A 3NH2A 4DL4A 3C23A 2C2EA 4FBUA 3PW7A 1ZQEA 3V9WA 2KFZA 2ATQA 4CJVA 1JL1A 4LH5A 1C1BA 1BGXT 3V81A 1CUKA 3T5KA 1N56A 4M3ZA 4PHEA 1A5XA 2YKMA 3I0SA 1RYRA 5EWFA 5KFSA 9ICUA 4QZGA 4CJPA 8ICWA 5J2QA 4KLOA 4M45A 4F2SA 1X9MA 1LB2B 5F9LA 2BCQA 3V1QA 2W9CA 4DQPA 5J0RA 3DLEA 4KTZA 4ECVA 1EKEA 2ISPA 1C7YA 4CJEA 1J5OA 8ICSA 5DLFA 3JPTA 3PO5A 3ZSZA 4CFAA 2FMPA 4E0DA 3L2UA 4KO0A 3KTQA 5KFMA 4QW9A 2XY6A 4YVZA 4R63A 3VQ6A 2BCUA 2RKIA 2ZTDA 3AO5A 4LY7A 5J0YA 4CGJA 9ICNA 1A5VA 4F4YA 3JPSA 4XUSA 3RAXA 1XU4A 1RT4A 5KG0A 5KG7A 1L3UA 9ICVA 1I3AA 4CEQA 4CIGA 2EHGA 5CYQA 3QERA 3IAYA 1WLJA 4RPXA 4ECTA 1S77D 2A1SA 2HW3A 4RU9A 4YMNA 4O5KA 2IS3A 3LAMA 4M0AA 3WNHA 4Q5VA 4RUAA 2J6TA 4N76A 1S9EA 1S1XA 4NM1A 9ICLA 1XS9D 4BDZA 3ISBA 4UB1A 3OS1A 3IG1A 2A1JA 2RDJA 1KFTA 1D8LA 2QKKA 4J9RA 2KZ3A 4R64A 5KFVA 4ID1A 2ATLA 4QZ8A 4KLFA 2G8UA 4FK4A 3PX4A 3ORYA 5T7BA 3ZDCA 1RZTA 3OYLA 5KFHA 3OHBA 3HP6A 2NRTA 4KITB 4M9NA 1SL2A 1KFSA 1NK7A 4CFDA 1FKOA 2NRZA 2R8HA 3TAGA 1EETA 9ICRA 1TV6A 5KFIA 5DBAA 4PHAA 3JPRA 1S1VA 2Z1JA 4FM2A 3MFHA 3PUFA 2W9AA 4CJ5A 4DOAA 3T3FA 4E7JA 3OYGA 1T03A 3KHLA 1RBSA 5KG3A 4E7LA 4M3WA 1VSLA 4F4KA 4UB5A 2KW4A 4DSLA 2PFPA 3HX0A 3GQCA 4OKKA 1UAXA 4MEXA 3RMAA 4E89A 3MAQA 4PGQA 4I2AA 3QEXA 1R0AA 4I7FA 3IRXA 7ICTA 3HM9A 3MR6A 4DQRA 2IHNA 4FLUA 1JLQA 1VSHA 1ZYQA 4UB3A 2BHNA 1Z26A 5HRSA 4Z4EA 3ZT0A 5J2CA 1RTDA 2RPIA 3AVJA 3OS0A 4EZ6A 3QIPA 5DLGA 3ZDDA 4Z6CA 4M6WA 2X6NA 4J2EA 2H5XA 1IKYA 3AU2A 4M04A 3CQ8A 4RG8A 5EOZA 5IIKA 5DGBA 3MGHA 3L3UA 3SZ2A 3OYHA 4RNMA 4TUPA 2G8VA 4MEYA 1TVAA 3MR5A 2JEJA 2BANA 5CJ7A 3AO3A 3B6OA 3H40A 3PMLA 4GC7A 3ZT2A 3TAQA 4O55A 4KLJA 4JWMA 4MF8A 1RBTA 4ECXA 3KLEA 4KLEA 3ETLA 5CY4A 3JPQA 2D0CA 1Z00A 2R7YA 4XIUA 4FLWA 1ZBLA 5J2EA 3SYZA 5KFDA 9ICXA 1UOCA 3DM2A 3ZSOA 2FLPA 1JIHA 5KFWA 1HNIA 3OYDA 3MGIA 3OJUA 1HPZA 3CG7A 4RQ2A 8ICIA 4M2YA 4ED0A 3K5NA 2ZE2A 3PR5B 4EP4A 4M3YA 3AV9A 3GIJA 5CP2A 3Q8KA 7ICRA 2ZJAA 5DB9A 3RWUA 4LH4A 4B9VA 1S0VA 4CHZA 5IIJA 4DEZA 1KSPA 1PZNA 3KK1A 2HHVA 3LK9A 3HO1A 2DY4A 1ZJNA 4EP5A 4CCHA 4P4MA 4IQVA 4PPXA 3OYMA 4O4GA 5KT5A 3OY9A 3ZSWA 5D49A 4TQRA 4UBBA 3E2EA 1L3TA 4F91B 4F4WA 2AU0A 3AO4A 3AA3A 4TSXA 4FJ9A 1HYZA 2MAXA 1U49A 4O3SA 9ICCA 4PGXA 5SZTA 3HJFA 3ALYA 1A76A 4FZYA 4DSJA 1S0MA 4G1QA 3OGUA 1LW2A 4O3NA 4KKOA 1TK0A 4OKJA 3QEPA 2P51A 4IQUA 1JXBA 1KCFA 2GUIA 4FLZA 2R8KA 3DRRA 4EBCA 3SUPA 2G8KA 1BIUA 2XC9A 4RNOA 4YR2A 4JUZA 4CF9A 1BQMA 3LANA 4F5PA 4YR0A 4RW6A 3OSNA 1DGSA 2ASLA 3VQQA 2X78A 4GMJB 3PW5A 3QEAZ 3DRPA 4FJGA 4GW6A 3B0YA 4KLDA 1ZQGA 9ICIA 4DFMA 5J0XA 5K14A 4RQ5A 2VG5A 3S3OA 4IG0A 3MBYA 1IG9A 3PR4A 4O3PA 1C0UA 3L8BA 2HHQA 4KMUA 1WSHA 4CGHA 2C2RA 3ZSQA 1ZQZA 5HP4A 3KLFA 1IXRA 1MC8A 4DLGA 5KI6A 4GVMA 2XY7A 3VQEA 3C95A 5IILA 3NGZA 4HUEA 5DB6A 2FBTA 4RW7A 4UAWA 3HYFA 5HROA 1RT5A 4RT3A 4AHCA 2R8JA 4LSLA 1KVBA 1HYSA 4AHSA 2HNYA 7ICOA 4N47A 3GV8B 2J6UA 3HL8A 1LWEA 7ICGA 1WAFA 2ZJ5A 4CJLA 4RNNA 1MQ3A 1ASUA 1RT2A 4O3OA 4R8UB 1ZQFA 1W9HA 4H4OA 1VRUA 2E6LA 5KFNA 1ZBUA 3AVFA 5CA7A 4EBDA 4J9KA 3RJIA 3RJGA 4YQWA 3ZT3A 4E1MA 4CEBA 1XSPA 4Q0BA 2ZUBA 4CHOA 4TUQA 1TVRA 4CJ3A 2PZSA 5FDLA 4CK1A 4FJLA 4JK1A 3SI8A 3V7KA 3NH1A 3VQDA 2OPQA 1QTMA 1XI1A 2VA8A 3S9HA 4TUSA 4YXMA 1C0TA 3Q8SB 1UA1A 1BPBA 1S1WA 3WNFA 4JV2A 5KFGA 5J2KA 4HTUA 1BI4B 1A5WA 3ZSRA 3RMCA 4JV1A 1IKVA 2OPRA 4NM2A 4JRQA 4CF2A 3DLHA 2E6MA 2I5JA 4FZZA 1L3VA 1NOZA 3RH6A 1L3SA 2F1JA 5L9XA 5I3UA 3C6UA 4E3SA 4KLHA 2IAJA 3BJYA 5TZVA 3RJEA 4F8RA 3B6PA 8ICEA 5I42A 2HHUA 2KZMA 5JUMA 3G6YA 1NKEA 2BR0A 2XGQA 1LW0A 2P1JA 1JXLA 3T5JA 4CGIA 4YMMA 1ZETA 1T4GA
chains in the Genus database with same CATH superfamily
4M3XA 1OY8A 2NXJA 4I0WA 3SQOP 4ACOA 4QZ9A 2YNGB 3B6BA 3EDRB 1IBMJ 1Y5NB 4CH1A 4XTTA 2H3EB 3MEGA 5E3RA 2ZG6A 3DGPA 4KLMA 3D0GE 3K5PA 4LZDA 2BYCA 5AKEA 3BH6B 1NK9A 2DK2A 3KWMA 4DR1F 3AVAA 3CJBA 1X0PA 2NYIA 1ZJMA 3MCMA 2LSNA 3SMSA 2CPYA 1GXLA 4C0OC 1HWKA 4W5NA 3T1YJ 4CFCA 3L3FX 4K25A 2X1BA 1CJUB 2N7CA 3SD7A 1LEOA 3JSBA 1HNXJ 3TFRA 3CFPA 5AQRA 2VIHA 5HQMA 2Y1LB 1FDDA 3FQKA 3AA8A 2ZUCA 2VBXA 3GJQB 2HNZB 1WAJA 8ICBA 3QGIA 4CEAA 1RTHA 1YT3A 1YVNA 4DKWA 1F60B 2KOBA 1YHQN 4KN4A 3PW0A 3OYAA 3LWLA 3GMGA 2K4HA 4YOTA 5CWRA 3ZT4A 2HFNA 3N28A 3R5AA 2DXDA 2B4OA 4NLDA 2V2ZA 2DHSA 2VOOA 4YDUC 3HOSA 3EW9A 2NPIA 3FM9A 3OYJA 1ZQQA 4FJNA 3LP0B 3KMQA 4LQ3A 1ZZNA 1HNVA 4TU9A 9ICKA 1AYEA 3BKUA 3UWTA 2Q36A 5DDYA 5AK4A 4ZJLA 4DUYJ 3EUB2 3CFRA 7ICNA 3TVYA 3PX6A 3V6DA 3RYLA 1URNA 2RHFA 2P9KB 5F8JA 1F0MA 1FRIA 3MXMA 1N34J 1LV5A 4WJBA 4FF4A 2H5JB 2Z1IA 4ZVHA 3KMSA 4QPXA 1TKXA 1X5PA 2I9SA 1U47A 2FC9A 1SUQA 5DKWA 1K8AT 3CE8A 4Z7CA 4JKDA 4H5RA 2HAIA 4DTPA 5ADXA 4KMOB 1SH2A 1RWNB 4QIWD 2HF4A 2QTDA 1WSVA 2YKNB 4HHJA 3EYZA 3UQ2A 2W8KA 1WN7A 2YB4A 1NMNA 1E4GT 2LA4A 1DTQA 4DTUA 1ZBHA 2BTFA 4OJOA 2AYEA 3BDEA 2HOQA 3MDQA 4P74A 3T41A 4KLQA 2QKQA 4JI0K 3RBXA 1LWFB 3KLHB 2HNDA 1SPBP 3ZDEA 4F72A 3D5MA 2QMWA 1WDDA 3PACA 2AGPA 1YIJS 5U47A 3ZX0A 4CT8A 3OPXA 5F8GA 1QZ6A 1HPMA 3B78A 4IRKA 4FDFA 4JI2K 3FE1A 3WKCA 2YPZA 3DI6A 1C0MA 4B9NA 1DK2A 3IGVA 1KTQA 3N4WA 3QE9Y 4ZVGA 4RQ8A 3H6EA 3TX8A 4LRBA 3NDKA 4DV4J 4Y2TA 3A3NB 1NLVA 2YY3A 1VGYA 3C1ZA 3FVYA 4DCJB 3LL3A 4DX6A 3N79A 2MZQA 1LKZA 2YCHA 5BPCA 1KKHA 1R8AA 4QBUA 2XYHB 3WC0A 4CEDA 5CE3A 3RH4A 2ITMA 4QPTA 1Q8IA 2XYPB 2WAQF 5LMUF 4CH7A 2QG9B 2ZJQQ 3H0MB 4FZMA 3DMJA 4Z7YA 4OX8A 2NO5A 1E6VB 5JVHL 4I6YA 2Z4PA 5ALDA 2OMOA 4CRJA 2D4WA 4Q8FA 3R5JB 2E5LK 7ICFA 1NUEA 1EXQA 3SXLA 3I6PA 3D2EA 2F65A 1ZQRA 5ITHA 3GP9A 2DGUA 4YNQA 1FKAF 3MGJA 1J9AA 4RPZA 5L46A 3VQ4A 3ZZZA 4NI2A 1SV5B 4NZ7A 1RAAB 1BHNA 2XBPA 4H0TB 2ZBQA 4GVBA 2XCAA 2MKYA 2ZH7A 1KQKA 2RT3A 3KLGB 4A46A 3L7OA 5BR8J 5HVFA 3O1LA 4B3TK 5LJWA 4BR5A 1Z3EB 5F3XB 4KGKA 1C1AA 2MQLA 1HW8A 1S7HA 3J7YI 4J9PA 4CBWA 2B4UA 2W7PA 2DITA 3L9ZA 4BGAA 3AN1A 3BGOP 2JGAA 2ODGA 3H45C 3ENQA 2H3GX 3V9XA 3SJHA 4KGMA 1L7PA 1RYSA 1W7AA 1KQSR 4NE9C 4L72B 4CJTA 3KUGA 4ZDNA 2PSZA 4CLLA 3M2VB 1NGAA 2XCPA 2IFXA 3H2VE 3BS5B 3IGNA 4RU2A 1WUUA 3MX2A 1VQ9N 4DZ6A 5ALXA 1YG0A 5IT9Y 3HVWA 4JBCA 1VQ4S 3H90A 4JI6F 4IR9A 3BDPA 2V52B 1V4TA 4NLYA 1RILA 2CWKA 4GRSA 1KW4A 4IQTA 1BWVA 4M63C 3M2RB 3QU2A 2KI2A 2E1YA 1DKGD 2N4DA 3SDEB 3E9PA 3H5UA 1GFWB 1NGDA 2LMRA 3NNCA 3R6LB 2GNKA 2GLEA 3D3BJ 4F3TA 1U26A 5I3PA 1AQ6A 3N0VA 1W2BM 1V3ZA 2VQFJ 1FKPA 3S6EA 2A1BA 1N5YA 3RRGA 2D1CA 3UN2A 3CCWA 4RWTA 1F3FA 3H0RB 3AODA 2X1FA 5KOWA 4TLQA 3EPIA 3ZX3A 4C2MA 5AE3A 3S3MA 2BPCA 2NZTA 4DV0K 1IR1A 5J2NB 2IA0A 4DPWA 2Z30B 4FZNA 4M9GA 3NG8A 4BRCA 1EKRA 4LF9F 4LF7F 4ED7A 3KWGA 3GL1A 5L1IA 4DFDA 1VQ7S 2B6AB 2W24A 4IXCA 4FPBA 3JSMB 3LP3A 2XO6A 1GTHA 2VFTA 2YNIB 1C6VA 2JHDA 4AP9A 1JX4A 2DNNA 4OYXA 1JMTA 4YOXA 3PJWA 1AA1B 4JB3A 2VU5A 2MLYA 2H3FA 4X4PA 4ETZA 4MF2A 4ETXA 1Y97A 3QBCA 4DV4K 3VF2A 3SCIE 3E01A 4KY3A 4YN4A 3QGPA 1KVIA 1NPRA 4F92B 3V1RA 2EZZA 3HTVA 4NCGB 4RTFD 4FPRA 2FLNA 4DV5K 1P8ZA 1H38A 3K17A 2WTFA 2YWFA 4DR7F 3RRHA 4QU6A 3VQTA 4ZH4A 5C5JA 5C15A 3CC7N 4JD2B 2HB5A 3FNNA 1TFYA 3IUCA 5J0TA 1GOCA 1CJVB 5EX0A 1VDVA 4A59A 4LT6A 4JS4A 1MWYA 1PC4A 3CCQN 3ISND 1M5HA 3KIOA 2ZEJA 4PY5A 3V9ZA 3IN5A 4OYWA 1QE1B 3PNCA 4X62F 1R89A 4PKGA 1GMVA 4Z4GA 1WELA 3DYAA 3CCUN 4M1KA 1FFUA 4G3IA 1S1TB 3M1YA 1CVJA 1N2XA 4DR4F 2DO4A 1E3MA 3AHPA 5KFBA 3Q22A 3QUTA 5JTIA 3AAQA 5LMUJ 2MY8A 1CZ9A 5HI7A 2MQMA 1RDBA 2B7CB 3AVBA 4K4IA 4PWWA 4DBQA 2LM1A 2AP6A 5HBMA 2QX0A 2AXTU 3HD2A 3QYYA 5LJ3Y 4JKHA 4I56A 4DR1K 1RTIA 5KFLA 1YVFA 2OPPA 3RBDA 5BJRA 4FS1A 2DGQA 2WB4A 3PSFA 1N88A 2LQ9A 3OYCA 3ET6A 4OYZA 3IS9B 4DL0C 2ZM6F 3U3YA 4JI4F 1XQSC 5B66U 3BYPA 1VFJA 3UI3A 3CDUA 1DTTB 1NM1A 2QWNA 4DN0A 2ZKTA 4K4VA 3V72A 2WB1C 2VA3A 2WVFA 4ZN3A 5KFEA 2YKAA 4LFAF 1HEKA 2IVMA 3KJVA 3IHQB 2UU9K 2FDNA 2FYXA 2V0NA 5KG4A 5AQSA 4ID5A 4USHA 5DBBA 4IJNA 3OUYA 3I8DA 3OSPA 3HF5A 2CJXB 3CD0A 3I4HX 1PJ5A 1F2GA 1C1BB 3ZSYA 1SIWB 2QARB 5ETRA 2PFNA 2F7TA 2WCXA 2AIRB 4HEA9 3OTBA 4J03A 1SXLA 5DDRC 1RBLA 2OEMA 2ZJQL 5J2QB 5KFYA 3LPTA 4Z4IA 1MDUB 2ZGYA 4ZOHC 4OZ2A 4A61A 5AZJB 9ICWA 4P0PA 5J2MA 4QZEA 1OYEA 2MPUA 2IYGA 2F8MA 4RL1A 1KXPA 2NYHA 3JXUA 1B99A 4C1NI 4HL9A 3CC2S 3DWLA 1DBDA 4JI6J 1P8GA 4AT1B 4DCHA 2IOFK 5B09A 1SWVA 3H59A 1L7NA 2HBRB 3HSDA 2BUNA 1BISA 2CPHA 1WSFA 5LL6d 2P5GA 2HYIB 3QRRA 1DT9A 3L5KA 3U26A 4DMZA 3A8YA 3H1QA 3O4NA 4O8UA 3W1YC 3OXLA 2HZCA 1F3VA 3K9JA 1YK9A 3HMJG 2CDRB 1SC3B 5CYQB 2YNGA 2UXBF 2PD1A 1X4FA 2HGNA 4EI2A 4BACA 1U1OA 2W40A 2LM4A 3QZ7A 2R8GA 2KO1A 5EU7A 4CEOA 2QB0B 5KRTA 2F4VF 1RWXB 3QMLA 1S9EB 2DR9A 4LR8A 4XPEA 1S1XB 1SI9A 2KKZA 3GFXA 4LF9J 3MF5A 2YTCA 2IHMA 4AYBC 3TQ1A 3L7PA 2Y8WA 1HWJA 4GKJF 1QHTA 2AT1B 4QR2A 2QXFA 1QAXA 2M52A 1UMJA 2OI2A 1VS3A 2HNZA 4WXWA 2BGWA 5CRXA 5M1OA 2DTUA 3CJ1A 1FKOB 4M8LA 1J53A 1U9LA 2FJVA 3VQ8A 4P4PA 4ELTA 1EETB 1YVUA 2IOCA 4QAGA 4FJKA 3GYXB 4FZXC 1SGGA 1RU2A 5ALVA 4YOVA 2AZ3A 2EFPA 3B8AX 5JS2A 4MDAA 1UETA 1OY6A 1WKLA 2EH9A 2AEMA 3HRGA 2H54B 2XLJA 4LVOP 4B08A 1EWRA 3IFRA 2VG6B 2FHJA 2ZVIA 3LP0A 5J0PA 3CDBA 3F0NA 4P2XA 2E29A 1Q18A 2KG1A 3ZXWA 3HPGA 4U7CA 2H3VA 5LMUK 3J80U 1TUWA 4B9TA 1TAMA 4QCLA 2IMWP 1RHMB 4V19J 2P9KA 2U2FA 3OLBA 3D9BA 4I2EA 1J5EJ 2C42A 2HGLA 4IOBA 4NLOA 1RTDB 2OHDA 4CTAB 4C1NK 3NGUA 1ZD2P 4M6WB 1BCOA 2QWLA 3OYKA 2AQ4A 3MM6B 3OBYA 4DDFA 4X62J 2FHJD 1ILYA 4JYAK 3VQSA 3TWHA 3IWNC 4M5KA 4RPFA 2R7XA 2XGPA 2YKNA 4YN3B 4DR4J 1Y3KA 4C8NA 2BANB 2PI5A 3QNNA 4IBNA 3RGIA 1T44A 2V67A 4J2BA 3CEDA 1YBAA 5BYSA 3AB4B 3G0ZA 4C98A 3QUQA 3CIZA 4X4RA 3ZNJ1 1LWFA 2NXUA 2MZSA 3KLHA 3AXKA 4F71A 5KFJA 1X4BA 3FBFA 1AZSB 1DGKN 2OH2A 3ZZPA 1HNIB 4EO8A 2BW2A 4KRWA 3GE1A 1V5IB 1A9NB 2ZE2B 1X5OA 1ZD5A 5KFAA 3BQ7A 1VQNN 1MQ2A 4X4SA 1ZQSA 3OPKA 2HBZB 1Z19A 1PC5A 4CEEA 3B9JA 2ZM6J 2VASA 4QOZB 2G13A 4DR3J 2CIMA 4DTNA 4USJC 1IV8A 2Z56B 1PAUB 5E7OB 5IV4A 4J9QA 4ID8A 1JI7A 1VQLS 4JI6K 3KNGA 3O44A 4DR5J 3BN7A 4TN2A 1FRMA 3AU6A 4IKFA 2DL0A 3L2RA 5B0CA 3OTQA 1WWUA 2MZRA 2B43A 4K4HA 7ICJA 4O5CA 2BOAA 3H8WA 1NJIT 2FB0A 1I6JA 3MM5B 3I96A 4F5QA 1RDDA 2G0JA 4H0XB 1UFLA 5KT2A 4G1QB 4CK2A 1S12A 5IWAJ 4E1NA 4KKOB 1E6VA 3OR2B 4M5IA 2FBXA 2MKCA 2DY1A 4I27A 4NYNA 1CC7A 3GPAA 2GC8A 3DRRB 1L7OA 1SV0C 1PIEA 4ZIWA 1Q7YT 2CH5A 1KN6A 8ICKA 2LA6A 4OX6A 1KKXA 1YITS 4FM1A 3VAKA 1MMNA 1KOHA 2QLFB 3AOAA 2CVIA 3QIDA 4FJIA 4LF9K 3K89A 2VOPA 5ETNA 4M7YA 4JI5J 3DDIA 5C0YA 1SV5A 2AV5A 2PAVA 4LF7K 8ICAA 4PL7A 2EXUA 2VG5B 4LF8J 1U6ZA 1XTZA 4ZVTB 2MTLA 2VGNA 4HHUA 3KLGA 2E1ZA 2B0GA 1PK3A 2IRUA 3S7RA 3QWUA 4A8QA 3THYB 5IIMA 3TAPA 2QB1A 4L76A 3KLFB 4BDYA 5GTHU 2VPXB 1SJ1A 2DNMA 2AX0A 1X31C 3MWPA 1EXNA 4OCZA 3HT3A 3LPUA 5DK5A 1D8ZA 2VICA 1TGOA 5L8RC 7ICEA 1VQ8N 5EVZA 3K5LA 1RT5B 1I5OB 3P4UB 3WX8A 3ZNUA 3NAIA 2K3IA 5KT4A 2FI1A 3MUVP 2IM2A 3EXYA 4PG6A 4BJQA 1HUZA 3M2VA 3GG1A 4X65F 4EFHA 4JHDB 4Y2KA 2VCPA 2KN4A 1LWEB 4DR7K 2K8BB 1RACB 4HHTA 3BS5A 1RHQB 5DM7Q 4KH0B 3K0SA 3FZLA 2XZDB 2KP7A 4P2SA 4K0KF 1LFWA 2O3DA 4OYOA 3ZZ0A 3OVNA 5BRDA 5AQXA 3ZD9A 4NL5A 5LMNJ 4JI3J 3MMBB 2QKBA 4B9LA 2C2MB 3VN5A 1KDHA 4MO4A 2KRRA 3MX5A 3U1MA 1NK4A 3DN9A 1WCLA 3M2RA 3C66A 3SDEA 3TZXA 3W8GA 4X62K 2C2KB 2ZZTA 4A2BA 2OPQB 4C8YA 2HVDA 3VVTA 5DMRA 1KQGB 3GE9A 2Z1HA 3U1LA 2N7YA 2YMLA 3HHLC 4DR4K 4U8YA 2A41A 4B9UA 4WYWA 4I2FA 4QWCA 4A5AA 2I5JB 3DFEA 4QZCA 2HOFA 3H7IA 3V6KA 5J2NA 5D6GA 3CMQA 3SQ2A 1YX2A 4PL2A 5FRMA 1P9YA 1VMBA 1M90O 1NB2A 2NXEA 3IM9A 5I42B 4IWVA 2Y9UA 5HVGA 4TVAB 3ZTQA 3D6JA 2B6AA 4K5SA 1LW0B 2MJNA 4YB7A 1RKJA 4Z4FA 4OHZA 3ZDBA 4KTWA 3G2XA 7AT1B 3JSMA 3ASMA 1UFKA 2YNIA 4OJRA 2KVQE 3NCIA 2UUAF 4FFDA 2HI0A 1UWBA 2ROEA 2ZM6K 3AVIA 4CT9A 4JI4K 2QA4G 2UXDF 1DLOA 4BC2A 1N5SA 3GFZA 5M2UA 3TZYA 4AHRA 5AQTA 1ZQLA 2JEFA 3PX0A 3F2KA 1BMQB 3V4MA 4LFAK 2BJEA 5IC4B 2WF7A 3MDAA 1FO4A 3AA5X 3SR6A 4FJMA 3R2CJ 3I1YA 4NCGA 2L5YA 2O66A 2XMMA 1M6YA 4K4YA 3UXOA 4EX7A 4UY85 1G3OA 2QA2A 2O8CB 2DPJA 1TUVA 4JD2A 3E51A 3M9OB 3D0IE 1TUYA 1RG6A 1CJVA 3NGSA 3RTVA 2APOA 4L73A 3VQ9A 1U48A 1ZQWA 4CESA 2ACMA 1JB0C 1XR7A 4U7BA 4ZS6A 3W3SA 1QE1A 4DPYA 3H4DA 2GV1A 5ETSA 2XTJP 4QIFA 3FZKA 2PA8D 3P31A 2E1FA 3N7SC 4NLGA 1GLEG 5HATA 4PHTX 4G1IA 1S1TA 5J2FA 4DQQA 3O08A 3QFPA 2CG8A 2QLWA 4CIOA 3LDSA 2ZUAA 1DZ5A 1HJPA 3MEKA 1JJ2R 5J2IA 1XQIA 1VQON 3J81U 2FGCA 1T05B 3RJJA 2UXBK 3A4TA 1U2RA 5EE9A 1Q46A 3QT6A 2IC3B 3EZ5A 3NL0A 4FF1A 3J7ZO 3F44A 3ISCA 3HXMA 3BYRA 5BRFA 2F4VK 4TQSA 3UCUP 4OJ5A 2P6TA 4NJ8A 3GFYA 2MQPA 3O9TA 4HCBA 4KSEB 3W8PA 1WC0A 4EAHD 3CFOA 5GAGU 3NRZA 3IS9A 5DDOC 2QV6A 3L2QA 4B6JA 1H74A 3THXB 3PHEA 1WHXA 4GKJK 3VQ7A 1L6NA 3RR7A 4OHXA 3HI0A 1VRQC 2W4DA 4QWEA 3QNWB 4Z6EA 4J9MA 4U7UD 4PXCA 3AQOA 1DTTA 2KEYA 2KKPA 5BYQA 1WSIA 2FMSA 2RRBA 2KH9A 3WKBA 4XEIA 1XO1A 1NBWA 4OI2A 4QWBA 3LF0A 4CLSA 1KBRA 5EX5A 5J0WA 4KI6A 1QQMA 3TARA 4ZKAA 3AD9C 3UR3C 2R2TA 3DDNA 1SQEA 3CPEA 5B0DA 1JL1A 1C1BA 1OO0B 3VGLA 2QARA 1CUKA 1N56A 1S1UB 2ESEA 2IVNA 3NWRA 1FDBA 5IM0A 5EWFA 8ICWA 5J2QA 1PBAA 2AA4A 2WVDA 5AZJA 1SJ3P 2EPIA 4DCOB 1GT8A 3VF0B 1WBDA 2GO7A 3O9UA 1DFDA 1C7YA 1VCTA 8ICSA 5IT4A 5DLFA 4IUFA 2IYIA 1H73A 1SJFA 5HR7A 3ZSZA 1NB7A 4G1PA 4CFAA 2FMPA 4E0DA 3BSCA 3R8YA 1VIOA 4YVZA 2MGZB 4R63A 3M8ZA 3HT0A 5J0YA 3BGRB 3CCEN 1X66A 3CDEA 1XU4A 2KB2A 3VAHA 5KG0A 4CIGA 1WHWA 2EHGA 3Q0AA 5CYQA 2R7TA 3QERA 2F1FA 4LBHA 2A1SA 2HW3A 5ALMA 2LEPA 4O5KA 4JI8J 3QFUA 2QB0A 4LBPA 5LSOA 3WNHA 4Q5VA 5BPMA 5D4NA 2EI5A 4CZLA 2KHQA 1S9EA 2VDIA 2H3QA 3UCZP 1S1XA 4Y2YA 1GMUA 1EB0A 3OS1A 5EN1A 2JXJA 3P4IA 2RDJA 4PAAA 2DBYA 2QKKA 1BQNB 3LP2B 4L3NA 4CD3A 4KLFA 2RHQB 5T7BA 3ZDCA 3OYLA 4D3GA 2QXLA 1OH8A 3P5BP 1D1UA 2QJ3A 4UY8T 1F44A 2HMPA 5DM7L 3WKAA 2BJ8A 1YJRA 4AL7A 5E2QA 4CFDA 1FKOA 1VK3A 5ALPA 2GMLA 2K06A 2ZDOA 3TAGA 1EETA 5E3QA 2UXDJ 1M1GA 4ILRA 1MW7A 1DRGA 3OVSA 1TR0A 3JPRA 2Z1JA 4FM2A 3HHKA 4Y28C 3TA0A 4DOAA 4OYIA 2DPNA 5KG3A 4M3WA 5ALGA 1NGIA 4F4KA 4UB5A 1T3VA 3EKSA 2AMCB 3HX0A 4OKKA 3OQ2A 4MEXA 3RMAA 2X51A 2G07A 4I2AA 2ALYB 2LU2A 3QEXA 4I7FA 3HKZF 1N52B 1T9WA 1SVDA 3HM9A 3PFEA 3O1WA 4DR2J 1OS5A 2IHNA 3ITHB 4FLUA 2RU9A 1VSHA 1X6IA 2E1RA 4ZPVR 4USVA 1NU0A 4NYZA 1RTDA 4CTAA 2VD3A 2P9UB 2OLWA 3G96A 4CZIA 3JAMY 2WF8A 1RBOB 3ZDDA 5CEHA 2N3LA 4M6WA 2RH3A 4ATNA 4J2EA 3MMAA 3O4WA 2DYAA 2DR6A 5IIKA 5DGBA 1B0TA 3MM6A 3R5DA 3L3UA 3SQGB 4RNMA 1KC8O 1HBUB 4CO4A 4ES3A 3Q89A 2LXUA 2OD4A 3ENAA 3FC4A 2MHNA 4U9RA 2BANA 5HQLA 3TPQA 4CO3A 4M5GA 2E1PA 4GC7A 4QR1A 1HNZF 4ZJQA 1YRUA 4K2JA 4KLJA 1B7YB 2JOQA 4JWMA 4KV8B 1WACA 3KG0A 1TFWA 4ECXA 1TKTB 3KLEA 4CNZA 3VF4A 2W54A 2LU1A 2O8BA 1ZPWX 1TZ0A 3AQFA 2R7YA 4FLWA 4B3SF 5AKHA 3F2CA 4CM0A 4H4MB 5GAHI 1UOCA 2BUPA 1PVPA 4QIEA 1AZSA 1WORA 5KFWA 1HNIA 3G6ES 5HO4A 1WBBA 2M4MA 3CNQP 4F3QA 3JXOA 1FNMA 3GR1A 3K5NA 2ZE2A 5D78A 1SJ4P 5EX3A 4X65K 3D1OA 2RRDA 1S0VA 1N32F 2HHVA 2ZH9A 1HI8A 3HO1A 2K3KA 3NKYA 1NHUA 4K0KK 3ZSWA 5D49A 4F91B 3U4LA 4F4WA 5F3TA 2AU0A 4TSXA 2A19A 1NGEA 1FA0A 1TELA 3IAM9 1W26A 1B0XA 2N82B 2EC2A 4RW8B 2DT9A 3CC2N 9ICCA 3PEJA 4OI6A 4PGXA 4GNIA 3MM5A 5GVQA 2BA9A 3ISZA 3IM8A 3NS5A 2L9NA 5L39A 4G1QA 4ISGA 2ZH4A 4CI6A 2DISA 5LJVA 2VBYA 4NPOA 4KKOA 1TK0A 1H2UX 3OR2A 2JH7A 2HLTA 1XNRJ 3NGRA 5J2PB 2YX1A 1JXBA 3M7VA 1KCFA 1TL7B 4FLZA 2WONB 5B5EU 4PQUB 1ZRMA 3DCAA 3DRRA 3R1HA 3KKAA 5AQIA 1W25A 4JUZA 2DXEA 2EBEA 3PIPQ 4F5PA 1NH8A 4RW6A 4J8FA 1RDRA 3ILIA 2ASLA 1YUWA 3IG5A 3QEAZ 4GIBA 2G2OA 1ZQGA 2FVCA 5H9EJ 5J0XA 3CCSN 1T9VA 2E1MC 2VG5A 1PKUA 3IBCB 1GQEA 4ZITA 3FZHA 5AKZA 1IJJA 3L0QA 4K4TA 1NHKL 4WQ5C 4UW9A 2XI3A 1M1KT 4KH5A 1S6OA 3TX0A 2HHQA 1FRLA 2L41A 2BM1A 2D7SA 2ASPA 2UUAK 4NXMF 4KMUA 3F53A 4LF5J 1N8RO 3LPEA 3M05A 3THYA 2YX8A 3ZSQA 5HMYA 3KLFA 2UXDK 5FJ4A 4R0JA 1U0SA 3HD1A 4DLGA 4B3MF 2XY7A 1XR5A 3CNHA 2UUTA 3ZZTA 2PBDA 4U95A 2OFGX 4HUEA 2NZ4A 2FBTA 4UAWA 3HYFA 2D41A 2PO4A 2FDRA 1RT5A 2G4BA 3FKBA 4PKHA 3ZO7A 5E84A 1HWIA 1Z6RA 2ZBCA 2MXYA 1KVBA 3EGVA 3UDCA 4AHSA 4CZEA 7ICOA 3PG9A 5ETLA 3GV8B 4HLBA 1LWEA 7ICGA 4CO0A 4LFCF 2VJ4A 2ZJ5A 2HHPA 5ETOA 3O80A 3CIPA 1CI4A 1TMMA 4USWA 1RB0A 1O6XA 2JVRA 1OVYA 4R8UB 8RUCA 3GJTB 5ALHA 2J76E 3MMBA 2ZH3A 1X9JA 2RLTA 4UOGA 4HDGA 4YQWA 4E1MA 4WCEQ 5HSPA 1Z2LA 1ZD4A 1XSPA 1O8BA 3W5XA 2DNHA 3Q86A 2FUG9 2ZUBA 4TUQA 1VQMS 2PZSA 3S8SA 4FJLA 3GTYX 3FC9A 2GO8A 2VF3A 3NH1A 2OPQA 2D3O1 3MM8B 4MIBA 1QTMA 1XI1A 3S9HA 2AYBA 2V8PA 4ZCIA 1GX6A 4NWIA 1UA1A 2HQCA 4YHHJ 3MUTP 1XEZA 2HSEB 3P38A 2RP5A 3AFGA 5J2KA 1B7FA 1LWCB 1EO1A 5IXUA 4JRQA 2I5JA 3WIUA 2E6MA 2ZITA 5L9XA 5DO2A 5ETPA 3BJYA 2G9OA 3B6PA 3I82A 8ICEA 5I42A 3ALRA 1IBLF 4QS9A 1NKEA 5D4PA 2BR0A 4DN9A 4USUA 1LW0A 1VQ5S 1JXLA 4N7TA 4WIIA 2XB2D 2QWOA 4Z4CA 3NVZA 3TACB 5T7LB 3RBEA 3CQYA 5AKXA 1V3SA 2B51A 4A8SA 2XI2A 2YPYA 4UB4A 2B0CA 2DGOA 1MN9A 1JALA 1Q8LA 3T9ZA 1NRKA 1RE1B 8ICPA 1EAYC 3G6VA 3IC1A 2HPUA 1HNZJ 2H4WB 1KVCA 1I39A 2DH7A 7ICHA 3SSRA 2J9DA 2C2DA 2KN7A 1UW4A 2PFFB 4LC9B 1LK7A 4JI1F 1LQ9A 1CZBA 1KL9A 2Y1JA 2NXCA 1Y88A 5AK5A 1EX4A 4ZP8A 3DRYA 2Q0RA 2Z57B 3KYLA 2OZMA 3JTOA 3W66A 2PI4A 1GOAA 4WYLA 4J9LA 4RBTA 4ZPTR 3KJFB 4YFUA 2O8CA 1IJEB 2JZBB 1QDUB 2DVIA 1S6PB 5IC6B 3Q23A 2ZUDA 2O5DA 2DQNB 2XO7A 2DFEA 5EE1A 4USKA 2L3MA 1N32J 4NLXA 4BG8A 1K1QA 1KAZA 2OWOA 4UASA 4KX3A 4FYDA 5HRPA 3TFSA 1S9FA 3O9SA 3IR7B 4I9LA 5KPZA 3CDWA 3I5AA 3GV7B 2LYHA 3RUBL 4WZMA 1VDHA 1MWZA 5H9EK 3HK2A 4JV0A 1VJWA 2JLEA 1F5AA 1EX8A 2V5HG 1S9GB 4CJFA 4P73A 2ZH2A 4CJUA 4ZHRB 3H0PA 4P2FA 2EG2A 3Q8RB 2W2OP 1RADB 2GTDA 3AXMA 1T05A 1N5QA 4LF6J 4AM6A 1ZQDA 4J91A 1TMJA 1Q8KA 1P1TA 4CD1A 3TAMB 3PYFA 1QVGR 1BPZA 2M7SA 3A3PB 2A3VA 2IC3A 4YY3F 4NLZA 3E66A 2BRKA 5KG5A 1D9FA 1XHXA 2MDAA 4K59A 1R59O 2W9MA 2NUHA 4MH8A 4GXKA 1W97L 4BWMA 3A12A 1IBCB 2H5EA 3C2LA 2C3PA 3NVMA 3T5LA 3K0JA 3QICA 1GXTA 3THXA 4OPKA 1VBXA 1KLMB 3IV6A 3KG1A 1FESA 2QA4S 2X6SA 2FF3B 1A77A 2MLXA 4JK8A 2GMJA 8ICTA 1KN5A 1SL0A 2CZ9A 2QA1A 4NXMJ 2LPEA 2K8CB 4B17A 5SWMA 3I55N 2NSBA 4C8KA 1VQPS 4B3MJ 3HSTB 4RWXA 1KVAA 1JLFB 2AWZA 3NOGA 1EKSA 1WSJA 3A0BU 4USTA 5AKGA 1U1MA 4RQ3A 1JN3A 4BRFA 4CGDA 2CRXA 1S1UA 4ZPAA 1YJWS 2D6FC 4IRCA 3CCLS 1LCUA 1U24A 4RQ7A 1MMDA 4OVLA 2QK9A 5ALIA 3NASA 1NSPA 1GLLO 4ECQA 4ZVOB 4YXJA 4LFCJ 1G1XA 2U1AA 4QOTA 3SEOA 1UHUA 2GGPB 3W5YA 1HHQA 1UVNA 2M5YA 1R43A 4FF3A 4B8CA 2PMZF 2QL9B 5IT0A 2PC6A 4ED8A 1ZPVA 3FMWA 1LAWA 1IUJA 2Q3PA 1NSKL 5HMLA 5GIPA 3PIPL 2OXOA 1R8HA 3WKDA 1XC9A 2K7JA 5L1JA 3UB5A 1FJCA 1VLYA 4QIVA 3BO3A 1KVJA 4Q45A 2E1AA 4GV6A 4KLTA 2MGZA 2BE9B 5M2RA 3UFCX 4GXJA 1BC6A 4YR3A 2XY5A 3BGRA 4CHYA 3KDOA 5AFUH 4NLKA 3KK3B 2NLWA 5AKIA 3JPNA 1ZQKA 4TY8B 2OZSA 2KM8C 2IOFA 2CJKA 4M3UA 1R0CB 1VSKA 2A2DA 4YORA 5DGAA 1HNZK 3WQPA 2ZIUB 1Y64A 2ZXHA 4RWWA 4KGXB 3P96A 2VQEF 2Y8YA 1LOTB 3VR1A 4P7TA 4B3SK 3D28A 3DHWC 3NF8A 3DEEA 1M1HA 4WBFA 2YQ3A 1BQNA 3L2VA 3LP2A 1H2VZ 3GU0A 2HHXA 4WJ3B 4CYUB 1JJ2M 4CE9A 5D15A 2J0WA 1OWXA 4KHPF 1UEKA 2J7WA 2H9ZA 4UQTA 2FPLA 3O2IA 4XA5A 2D5RA 1JWWA 4LREA 1VHXA 2YJFA 5MAOA 1N32K 4NLPA 2CWXA 3CUNA 4PXBA 4KHSA 3J81Y 1S10A 1V4SA 1PYTA 2BABA 4LD0A 2GIQA 3P5TL 4CIEA 4WCEL 2QLJB 3KVGA 3Q8QB 2IRXA 3BF4A 2FJBB 4YB5A 1I94F 3TJ9A 2DCUB 3CSKA 1KC8T 1X7VA 2O67A 4KLSA 3NMUA 2HBLA 4MJKA 1JMSA 2H48B 2ZIWB 3QU9A 3BPSP 1RUSA 2AGOA 4Y2QA 5A2QY 4BRHA 5CCMA 1SXEA 4AXIA 3C6TB 4FXDA 2J0SD 4PA1A 4DR6F 3ITHA 2R7RA 1VSJA 1Z1VA 4HVZA 1RSCA 4ANEA 4DZDA 3Q24A 3NVYA 3ILJA 1X9SA 4ED6A 5DQHA 1KWMA 1OH5A 2M9NA 1UA0A 2P9UA 4C8LA 1B0PA 5GAGP 1X0FA 4I2JA 4BRLA 4CLPA 1Q0NA 1NGCA 1WSGA 3J80O 4A62A 5EWGA 4RQ4A 1XBWA 2P6RA 3GCXP 1ZA2B 3SQGA 2WBNA 1Y9OA 2FPKA 4DU8A 5H9FK 5CXTA 5IS2A 2KFNA 2XZTB 1ATSA 2AJFE 5IIOA 5HLFB 1LXJA 3V7JA 1WKJA 3HJVA 3HSCA 4OPJA 2Z0GA 8ICVA 5JMNA 3CERA 5HRNA 2DIUA 2P9GA 3HM8A 2KICA 2B5JB 2KHVA 3K75D 4KV8A 3O5BA 1LKYB 2CJQA 4Z0UA 1WEZA 3FEZA 1IBKF 1SZ2A 2AQ0A 3G82B 4LSZB 3CXCM 1HKGA 4F5OA 2WAQD 3FZMA 4JV5F 2JC0A 2B21A 2V68A 4EK2A 7ICMA 1TFRA 4I29A 2XHBA 1E4FT 3W64A 4RW4B 5AJ3F 1GLFO 3I56N 2Q3SA 1RTZA 3VWSA 3ZC4A 4ZIVA 3ID6A 5A8KB 1AT1B 1ZQNA 3I0RB 2DNZA 4MHVA 4LFCK 3G8SA 1FWKA 2Q1NA 1RAGB 5BYRA 3M6UA 1JL2A 2JX2A 5C7PA 2WZ1A 3NOCA 2Y1IA 4FWOA 5AI6A 2OANA 4DV7F 5EY4A 3M32B 3OHAA 4RW8A 2F8SA 3CMAN 3I9V9 3EE3A 5GADI 3WC2A 1FWLA 3NFAA 2E9TA 1F6TA 2FSKA 4ED4A 3CCVN 4G9ZA 5CHIA 3AM9A 3WX4A 4DWIA 2DNGA 3AVHA 2E8NA 5ALWA 3AJ2A 3H2UB 3C94A 3EVOA 2GAGC 3L2WA 3LDQA 4LFBF 5J2PA 3KOOA 3FEYB 3LO3A 1TL7A 2WONA 5CR4A 2KT2A 4PQUA 2ZGZA 4DOCA 4FO6A 3EMTA 5KFOA 3O3HA 2YKQA 2E66A 3LWMA 2HHWA 4H54A 3BQ2A 4ED3A 1H72C 2YJEA 5KG2A 2EZXA 4NWBA 3MI7X 4BDPA 3SFUA 4EMDA 3MEGB 1BY9A 4FW1A 1IBLK 1KFDA 3DC2A 4K42A 4ZVEA 2C22A 2LXFA 2KTQA 2JRSA 2XSJB 2V50A 2MRLA 4PWDB 1FEEA 2Q66A 4WZQA 4US8A 4URGA 3ZTRA 1X4GA 1NCLA 1ZQPA 2KHCA 1REGX 3OW2M 4QZHA 3BKTA 5GTIU 1PSDA 5BOMA 1X4EA 4BREA 3SMVA 3M7DA 2RHSB 1K9MO 5BOLA 4LRAA 1N0VC 1Z05A 3KNAA 2EBGA 4WE1B 2Q6BA 2F8TA 1T7PA 1HX1A 3C2KA 2E8OA 1GLCG 1M5PC 5AKKA 2UUCF 4JI1K 3MPWA 3V4IB 3CD7A 2DBBA 3VAGA 2QN6B 2VYPA 2QL5B 9ICPA 4NYOA 4OX9J 3OD2A 4PCQA 3ZD8A 3P45B 4BR4A 1P7DA 4WPAA 1I3OB 4CZHA 3UD4P 4ZVSB 3AVCA 3AJDA 2KLAA 3GIMA 4QIWC 4R8UA 2DB1A 1IQTA 1HNVB 2VZ9A 5DDMA 3F2DA 4ECSA 1XUPO 1UJ5A 1SQGA 7ICQA 4CLUA 5CD4H 3LM9A 3O4QA 1K0VA 2JRZA 5LT5A 3V81B 5HJYA 3WDOA 1IV0A 1UCNA 1QCKA 4QWAA 5SUHA 2YKMB 5K9FA 1WCNA 4ZPCA 2EFNA 2WHEA 1N62A 1X2IA 4DSKA 3FJ2A 3HULA 3MM8A 1CXQA 5EOYA 2IIRA 4K41A 1JCEA 2DGWA 7ICPA 1LWCA 2JHEA 3GG4A 3VCDA 4UAYA 2X3DA 4KLUA 4DR6J 3CD6N 2EWSA 2F1HA 4Y2IA 2QE5A 4AHVA 2CRLA 2LMIA 2RVJA 4YY3K 1P9QC 1VR6A 1FWPA 5E26A 5AQHA 5D46A 5ALYA 3AB2B 3EGWB 4C4SA 2HGMA 1VSIA 4KB1A 2AHOB 3MXJA 3X3UA 1N54B 4A8XA 1RLCL 3SV4A 3DAWA 2Z2YB 2FLLA 1RT4B 1TK8A 4MFCA 2GAHC 3CETA 2J6SA 4C8OA 5T7LA 4RQ0A 4P10A 5D0EA 4OI1A 5I3QA 2ABYA 4USIA 4ZPDA 4L8RB 3LM2A 5CR0A 1QZ5A 1NJXA 3MAHA 2HSZA 8ICNA 2A3ZA 2HS0A 4PKIA 1K8AO 4M94A 1ZZFA 1T9UA 3QBWA 3ENHA 5DQGA 4I2CA 2MU2A 2H65B 4JP8A 5B8HA 1N0UA 3BZKA 2P9PB 2A1JB 1NK5A 1FFSB 5KL8B 2V63A 1IBKJ 3NF7A 4KE5A 2YY6A 2WBMA 5L1KA 3T6JA 1S72S 3C21A 3GG0A 4MLHA 3B54A 4JV5J 2DPIA 4ILLA 5CZ1A 2P35A 3VAJA 3VTHA 2COLA 4N8NA 3NMAA 3PIOQ 1KONA 5AJ3J 2Y0BB 2JZBA 2JFDA 1VSDA 3QX7A 2VANA 1TV6B 4B3RF 1N5WA 4FN5A 4FE3A 1S6PA 3QFHA 1XN9A 4DPOA 4RQ6A 2P9CA 5IINA 4LBIA 5DJBA 4LUBA 5ALJA 2NRHA 2V8HA 1YZ7A 2UXCJ 1T03B 4W5OA 1HD1A 3SV3A 3IO1A 4Y1CA 1SC6A 5GINA 2F96A 4F36A 4EEKA 4QS7A 2GQ2A 1AROP 4K2XA 4DV7J 1R0AB 1T6CA 4EENA 4FJ8A 1Y00A 4X5VA 4DTOA 2W55A 3N6MA 5HHHA 1S9GA 3QIOA 2GV9A 3H8SA 4ZHRA 3QEBZ 2EFGA 4P2MA 4WXOA 3OBWA 4J9OA 1VBZA 1B4SA 4BROA 4IQWA 5ETKA 4LFBJ 3C5GA 3N4PA 4R65A 2MKIA 2FGOA 1IWGA 1IKYB 2HS4A 3TAMA 2FVPA 4AHTA 2J7KA 4DQIA 2HZAA 1ZAWA 4QR0A 5AT1B 3T5HA 1HR0J 3QU4A 4EYHB 4ECUA 2VQEK 4DOBA 4F67A 3C65A 1S5ZA 5AXKA 4CDGA 3I9ZA 1XMQF 4BGDA 3MMVA 3V6JA 3OR1A 1NSQA 3V5RA 1QQ6A 2PKEA 2FZKB 3DOMB 3EO3A 3UKRB 4XAKA 2OCEA 1QSYA 4L74A 4FLVA 1RXWA 5AHXA 1KLMA 2DWQA 4KHPK 3OTCA 3QSIA 2GWSA 5CAAA 1X4CA 4FVUA 4DSIA 5AQLA 2VPYB 4DL5A 3TUPA 5A6WA 3DM2B 1HBMB 2VONA 2A6MA 2DHAA 2FTRA 1JLFA 5HMZA 2HZVA 1Z4UA 1UPMB 1F1BB 1QY7A 2DH9A 3DJCA 3NHGA 1YI2S 4KBIA 2FJXA 4A4JA 1I94K 2UUCJ 3M5RA 1AFIA 3SAGA 3EVMA 1SH0A 4JOUA 4O4GB 3AUOA 2BKEA 3PY8A 3MPUB 4YP3A 3BREA 3W0LA 2GGPA 3I5CA 1ULRA 2PDAA 3C15B 4JKFA 1AUDA 3GU3A 2VC1A 4F7VA 4P71A 2NRXA 2A5XA 2OFHX 2UZAA 2B4PA 4HCCA 3GB0A 3OYIA 1DXSA 4JI7F 4FPIA 4MO5A 3IA0A 3VAIA 1LW2B 3IRWP 4J9NA 3M6ZA 3IBPA 2GCFA 4FWNA 3QINA 4USAA 2PA3A 2NSCA 3KK3A 3WK5A 3F56A 4TY8A 4PGYA 4F50A 1ACMB 1Z4OA 2B3TB 4NX9A 4GXIA 2GJIA 2CQGA 1BQMB 4JEPA 1SKUB 1FXXA 4W5TA 4K7QA 1U02A 4K4ZA 3R1XA 1YJNS 2R7UA 3VGKA 2W42A 3DRPB 3AA2A 4B3TF 2CPJA 1SQKA 5K14B 3D54A 3ISNC 4OJLA 3M6GA 2K1RB 4IG0B 2HIYA 5K8MA 1GLDG 3HSGA 2PYJA 4K4GA 4JV5K 2GH1A 1C0UB 4CYUA 3G8TA 3U9DA 5LJ5Y 1ZQHA 5AM5A 3ICLA 1GLAG 4DF8A 5DB8A 4FOIA 1FT8A 5AJ3K 3CJ2A 3MCPA 2VFSA 3UNYA 4Z6FA 1UVMA 3BB5A 4BC7A 1FRJA 2MQQA 3FQLA 1QVGM 3W3DA 2NV3A 4WFZA 4WU2A 2P66A 4GO5X 2DHHA 2XY8A 1TU0B 5AM4A 2XLIA 4KIAA 5LXYA 2W7AA 4MFAA 5FLXU 3HW8A 3O8WA 1HWLA 1EQ0A 3AY0A 2KU7A 2YHXA 1U6BA 2W43A 7ICVA 3DLKA 5BN8A 5J2HA 1HA1A 2HK2A 1RT2B 1HBOB 4EZ9A 2ZWOA 4X64F 3EWAA 9ICEA 5T14A 3C6TA 5F9NA 2LI6A 4DX8H 3ZFVA 1ZOLA 3DYAB 4GLXA 3D6TB 8ICLA 4LFBK 2HS3A 4OZJA 1HUOA 3UR0A 4FLYA 2P6UA 5B0BA 4X4OA 1APSA 1XC3A 3HFZB 1Q9YA 4BRKA 2Y0SD 4BCAA 2HBQB 2LLZA 1QLNA 3FCVA 1RWMB 4J9VA 1YTAA 1FXDA 4DV0F 2W11A 2QIFA 1YZ6A 1R31A 2KG5A 3RB6A 4IFEA 2G2ZA 1CQNA 4FW2A 3MK6A 5HLFA 1CC8A 1M5SA 3J7YU 4PL8A 3JSRA 5FRNA 5I3UB 1Q3UA 2B5JA 1YSJA 3O6WA 4ED1A 2ZIVB 2WK4A 4X4QA 2IA6A 2ALZA 3BQ1A 1NK0A 4ZVRB 4J2AA 4CHQA 3PSPA 5ELZA 3G82A 3U1NA 1YJ9S 1UP1A 4NXZA 4I2GA 2DNYA 5AXMA 3AEVA 1VQKS 3ZSVA 3VEWA 1NJYA 4NLTA 4Y2CA 4PG5A 3PDNA 3CJAA 4RW4A 1XMQJ 3U6FA 1PUZA 2DD8S 1YWXA 4F93B 5A8KA 4KLGA 3PIOL 3UPQA 3I0RA 2BE2B 4AQYF 1RAHB 2ZBIA 5KTQA 4HVJA 2VG7A 3QLHB 2X1AA 3MWTA 2DRAA 4I64A 2BKNA 5D3GB 4QYZK 3PYGA 9ICGA 4KLIA 2Z58B 4KTQA 3OFEA 3RH5A 3AOCA 4QW8A 2E8PA 1LOUA 3NRBA 4OPHA 4URSA 4JI2J 3SCXA 2BDPA 4FS2A 1BNOA 3M32A 4KHYA 4P0PB 3D6HB 5AXLA 2G0AA 3HHEA 3EX7B 2KK0A 1BLUA 3LA0A 2BX6A 2JH3A 2R7WA 1X4DA 1X5SA 3OYBA 4IG3B 2WF9A 4URQU 1ZXIA 1K44A 2KXNB 2E8AA 1W2IA 4KGZB 3QT7A 2NPFA 3KHGA 2WBRA 1S6QB 1QAYA 2NZCA 2E9RX 2KVCA 1XMOF 4BXOB 5FROA 1G6BA 1CEZA 2KJ8A 3BQ0A 5EGYA 2P9SB 3EICA 2R7QA 5KFRA 2DNQA 3VGTA 1WG4A 2WC9A 2QRRA 4OYPA 4UATA 3KD5E 3AVNA 1SKWA 4M41A 5JLFA 3H2LA 1CS4B 2KQ2A 3W2WB 1RCXB 2E5LJ 3M8PB 4JI7J 3ULEB 2MQOA 4DUZF 4PUOB 4WFAQ 2XSJA 4PWDA 4KT0C 5C12A 1UTAA 2ZUGA 4ECYA 4MN4C 2RRAA 5F0XA 1NWKA 1RHJB 4ECZA 2NXNA 2ZTCA 4FWSA 2CA9A 3EPGA 2R8IA 2W2MP 3F5AA 4O0IA 1D4XA 4KPYA 3CJKB 2FMQA 3NBPB 2ZF5O 4RO0A 1ZRNA 2BRLA 3IAS9 2EK6A 1NJWA 4NL9A 5AIBA 1FERA 4OQJA 4WE1A 3TUIC 3KKSA 1SWWA 4ZVUB 2FZGB 3H98A 3U3GA 2QZ8A 1VAZA 2G8WA 3BS7A 3PMNA 3FRZA 3TO8A 1LVHA 3G71N 4IFVB 4B3TJ 3V4IA 2HBYB 4UZBA 5LXRA 4NCBA 1BUXA 5JMVA 2UU9F 2HHHF 1DQ8A 3MPYA 2Q31A 1RNHA 3JYTA 5F8MA 1QVFM 4B9SA 4MQ3A 1O1WA 3MPVA 2QSWA 1YJVA 4KHNA 3SJJA 4ELUA 2WMMA 3BGFA 1YTYA 4LRCA 3K1RB 4BRMA 2KNJA 3AGRA 3ZEUB 1SL1A 4B3RK 4RT2A 3FFKB 4DS4A 4DL4A 1JK9B 3C23A 3N5FA 2C2EA 1NPKA 3CMEN 4FBUA 4B1YB 3PW7A 2KFZA 1RGIA 1S99A 2MKJA 5HAOA 1HIWA 3V81A 3T5KA 3LDPA 2R2UA 3CCJS 4KB7A 1A5XA 2GX9A 3MWBA 2YKMA 3QMQA 3GFHA 1LK5A 1RYRA 5KFSA 9ICUA 4QZGA 1U1NA 3JB9k 2QWQA 2EAOA 1BA1A 2W1BA 2QEXN 4M45A 4F2SA 1X9MA 5F9LA 4OZ1A 3V1QA 2MLZA 2K8GA 2LYVA 4KTZA 4ECVA 2E8MA 4M5DB 2D3DA 4FKYA 1J5OA 3VGMA 5ETQA 4C4RA 3PO5A 5I4MA 4CW7B 3BSOA 4F02A 1V3RA 3A3OB 3H1VX 2MY7A 3G8QA 1RWOB 1FRKA 4QW9A 2D1KA 5KPTA 2XMWA 3MCNA 3VQ6A 2BCUA 1F9HA 3AO5A 3PNIA 9ICNA 1DEJA 2DUYA 4GV3A 1S49A 1RT4A 5KG7A 3AAPA 1ZTWA 4ILGB 4DV0J 1NXIA 1XMQK 1UAWA 1DURA 1BD6A 3ZLJA 2GWJA 1WLJA 4IQXA 4RPXA 4ECTA 2OELA 1Q82T 4RU9A 2GIFA 4I67A 3SMZA 2J6TA 1YJTA 3CD5A 4ICLB 2DNLA 2G5IB 3CGIA 3DLJA 2OAUA 1RZMA 2F44A 3VETA 2P9PA 2A1JA 2BKPA 3IG8A 1KFTA 4NV0A 2RHKA 4DCCA 4J9RA 3RVCA 2KZ3A 4R64A 4ID1A 3NVKA 2ATLA 4QZ8A 3OL6A 2WSCC 2G8UA 1ITPA 1VBKA 4K5RA 1RZTA 5KFHA 3HP6A 3KBBA 3LDLA 2HQIA 3GBTA 1KFSA 4IFYB 6AT1B 4RUHA 4FWMA 3VENA 9ICRA 1TV6A 3SK3A 5DBAA 2F7VA 3MN5A 3CF5Q 1JLBB 4RNFA 3E8OA 1S1VA 1UFWA 1BA0A 4DV5J 3PUFA 2W9AA 4CJ5A 2LFVA 3ZTOA 3T3FA 1T03A 4FP9A 3N7PD 5M1FA 1ZH5A 2LKZA 3MDFA 4DSLA 3ETRA 2PFPA 3GQCA 1R3NA 3G25A 3NGTA 3D2NA 1IWAA 2G06A 1R0AA 3D4JA 2VWBA 2ZWHA 3QGHA 1V38A 1RISA 1YXQA 4JI7K 1REVB 4HI1A 2OHFA 7ICTA 2WSEC 4H5NA 2F8EX 4DQRA 1FX2A 3DV9A 1ZYQA 4UB3A 3N5BA 4Y6IA 1U1LA 1Z26A 1JLAB 4ZCLA 4JYAF 1RQLA 3QIPA 1NJIO 1ZS6A 3U27A 1CG2A 2X6NA 5DZ6A 2H5XA 1IKYA 3AU2A 2D74B 4DPUA 4M04A 4RG8A 5EOZA 5A6PA 3SZ2A 4LIRA 3JSYA 3H8YA 5CHCB 3WK9A 1B4FA 3TW0A 4TUPA 2G8VA 1ZA1B 1YHQS 2JNJA 1TVAA 1WD6A 1WOSA 2N3OA 3OL7A 1HUXA 2F9JA 4YOWA 2JEJA 1EJ7L 1Q7YO 5CJ7A 3DOMA 4LSNB 3UKRA 3AO3A 3B6OA 3PMLA 1FFGB 3ZT2A 1NI3A 5MLCQ 2BXJA 3THTA 4DR1J 4AL5A 4UB6U 1FE0A 2YWEA 4DV2F 4EFAC 1N61A 2HURA 3Q2TC 5CY4A 2OTJN 1N36K 2J5AA 3SBTA 3FFIB 3R6GB 1Q4RA 4XIUA 3CJ5A 2DRDA 5K4LA 2Y9TA 2P8IA 3DM2A 1HBMA 1WDTA 2W01A 1JIHA 3OYDA 3MGIA 2GHPA 4RQ2A 1OH7A 3MGVA 4P72A 4K4SA 3AV9A 1D3WA 2QMUB 7ICRA 4IKAA 1OJ4A 3RWUA 1FEHA 1TYQB 3AY9A 4PZOA 4PYDA 5IIJA 2UU9J 2DY4A 3CULA 3LW5C 3U9ZA 4CM2A 3EZOA 4P4MA 4X64K 4O4GA 2HRUA 3QAUA 4Y3CA 3BS9A 3OBIA 3E2EA 3IBWA 1L3TA 4H03B 4YS2A 3CJRA 1PYOB 3C15A 1VYAA 3AO4A 3HCXA 4K4WA 4PYAA 3ONNA 4UOHA 4DHVA 3IDHA 1FJGF 1U49A 2YH1A 2E20A 5SZTA 5IZHA 1HKBA 3ALYA 4I68A 2IVYA 1S0MA 5LM7E 3T7ZA 2MYFA 1LW2A 3PCOB 2XSFA 4WFAL 4KBOA 4GFJA 3SCKE 2B8PA 2EC0A 4F4AA 2QI2A 1SIJA 3DXKB 2IVPA 1H1VA 2R8KA 3SUPA 2G8KA 4USMA 4CLZA 2XC9A 2OTLN 1HL6A 1BQMA 1D9AA 3LANA 3ETMA 5LL6Z 3H8MA 1DGSA 5E0OA 4NO7A 3HJEA 4KGVB 3VQQA 5GAEI 3DRPA 3L3CA 4KLDA 5H2FU 4BRPA 1UWBB 5K14A 4AXJA 4RQ5A 2GIRA 1ATNA 2K1RA 4IG0A 1NNLA 1DLOB 2MB0B 3MBYA 3HKZD 6FDRA 1RT7B 1XERA 1IG9A 1RDUA 4OZNA 3C46A 1IJFB 1C0UA 2PMWA 2HMXA 2YX4A 3QU7A 2C2RA 1ZQZA 5HP4A 1IXRA 3I8BA 3D3CJ 2KJWA 4MK8A 4K4XA 5KI6A 3MEEB 3KXDA 4NLBA 2E5IA 2QL7B 4AQYK 2I5HA 4YOYA 1MROB 1NPPA 4H4KA 4K8RA 2FJWA 2CPFA 2I8EA 4XH1A 2KT5A 3TOQA 4Z37A 1UW9A 5AQKA 3ETOA 4BC5A 1WC1A 2MHEA 1SJRA 4CGZA 1MQ3A 4Y2PA 8AT1B 1ASUA 3GLJA 3W9HA 2B6GA 1RT2A 1HBOA 1L7MA 4CNYA 4O3OA 2K89A 3W9JA 4TLRA 1W9HA 1VRUA 3UKUB 1GH8A 2JWNA 3ENOA 3RJGA 5J1NA 3CVKA 4CEBA 1XMOK 2WB1F 4K43A 2BM0A 4L75A 4NA1A 4CK1A 1UCVA 2LP4A 2GEMA 2JR5A 4Y0WA 4JK1A 3SI8A 2DY9A 2DKOB 1EP4B 2VA8A 2E5GA 2V6AA 1ZXOA 2VFUA 1IQZA 3BM7A 3C16B 1JNRB 5BPLA 4HTUA 3ZSRA 4JV1A 4DUZK 3D68A 2QO3A 4NM2A 2XEXA 4CF2A 1NDLA 4FZZA 2Q97A 5IFMA 5IQ6A 1L3VA 3RH6A 3NAHA 3K1ZA 5I3UA 2F1JA 5B0AA 2GZOA 4E3SA 5TZVA 3ENWA 4YDXA 5J8YA 4F8RA 2ZIVA 1EZZB 2ZDPA 2OMLA 4JYAJ 1QQ7A 1NGJA 2QC3A 2HHUA 4YB1P 2ASMA 4PXDA 4WQ4A 2P1JA 3L4IA 4CGIA 3QNMA 1VQ9S 2YMQA 1T4GA 2HOEA 4EU0A 2H3ZA 4UB8U 2FZCB 3Q8YA 5E3PA 2O01C 2YKPA 2R42A 3DGVA 4JAXA 3UE5A 3IKMA 2HHHK 2LEBA 3H25A 1XNQF 4FKXA 1SV4A 1IKXA 2BE2A 4P7VA 3ZI4A 5HQ8A 1RP5A 3QLHA 3CF5L 1COOA 1N6QB 2QLXA 5D3GA 3CJTA 2DFHA 1HIYA 3VAMA 1ASVA 1UT8A 2H3IA 1T9YA 4OI3A 4JKBA 5IM0B 4F0MA 1JXVA 1YJ7A 1SQFA 4MTPA 3BZCA 3F9KA 4ISEA 4ELVA 4NA2A 4O9MA 3R7SB 4DSEA 3A1YG 5C2DA 5IT9U 3D0PA 1QD1A 3CCRN 3OXGA 1H98A 4XO0A 1ZC6A 1S97A 1KLNA 2VB6A 3AMZA 9ICAA 4IG3A 4AYBF 3R3TA 5F3ZA 4BY9C 4A48A 2RS2A 1QSLA 4FSVA 3KJNB 3M30B 4C0BA 4AM7A 1S6QA 3HPOA 1UJ6A 1WTBA 1NOMA 2B9YA 4BXOA 1Z25A 1Y10A 3ZTSA 1DQ9A 5J0QA 2CQ2A 3K59A 2HF3A 1WF0A 2YNHB 2P9SA 3F41A 1RT6B 3R7NB 4OMFG 4DFJA 1KP6A 3D1HA 2RQCA 4E1JA 3H0LB 4OLAA 2CN1A 1FJGJ 4KB0A 3T19A 5KGXA 2RE2A 1CS4A 1ZAXA 3W2WA 5A76A 5LSRA 4GVEA 3M8PA 3ULEA 3ZX2A 8ICGA 4PUOA 4R25A 4YFKA 4F4XA 1FXRA 4WIQA 3RU0A 1NLKL 1K6YA 2LXIA 2P9IB 4KRFA 3FSIA 4JK7A 2VKQA 3GSIA 1UQVA 3SNNA 3BKFA 2R2SA 3RFAA 2DR7A 4IO8A 1KQQA 4IR1A 3CJKA 4C7QA 4LF7J 4XH4A 3NBPA 5AKJA 1S76D 3TP2A 3FYHA 2VFVA 2AJ1A 3CTRA 2D0BA 3CC7S 1WNSA 2YKOA 4IFVA 2WW4A 1R27B 1K73T 9ICSA 9ICHA 3CCQS 2R3VA 3JPPA 3MMJA 4PEOA 3I28A 3KLVA 3QUCA 4N41A 3N4MB 3A5MC 2HBKA 1B9FA 5GIOA 1C2PA 9ICTA 8ICMA 5AQUA 5J0OA 4IRDA 1B0VA 3WXIA 4BVPA 2J4RA 5JS1A 3A5NC 2IVOA 3ZEUA 3LOUA 1VC5A 2OIHA 4O5EA 4CEZA 4IC9A 3B4MA 4I7FB 1YJUA 1FTCA 2CPXA 3UXNA 1EWQA 1FJEB 3PW4A 1MSWD 2KVSA 2Z7JA 3HVRA 3CC4N 4DR7J 1WOOA 2H4YB 1D0EA 3ZTPA 3RMDA 3VMFB 4BRGA 1QS4A 4B3OB 4TKTA 4R79A 4UY8O 3J7YP 5J1PA 3ZCMA 2NRVA 5AFUA 4ALZA 1J2VA 2HVIA 1PAEX 2FBYA 1GLBG 2A6AA 1BOTO 2DGSA 4MFFA 4IL6U 3NF9A 1QSSA 3MMAB 2P2CB 3K58A 2UUBF 2F76X 3M8SA 1RBRA 3B8HA 4M5DA 3OYNA 2V7YA 3T79A 4DV1F 3U7JA 3KD1E 3JPOA 3UXPA 2HHSA 5AI4A 1NU4A 3TAFA 3WXKA 2NNWA 5HR6A 1X9WA 1WF2A 3SQ1A 3KLEB 3DRSB 2GMHA 2O8BB 3AA4A 3HDSA 3VEYA 3R5GA 5E79U 5JJBA 3K2PA 1SC4B 1WG8A 3PV8A 4CF1A 5G4DA