1NJYA

Thymine-thymine mismatch at the polymerase active site
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 214
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njyA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njyA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njyA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njyA01
8ICOA 1S76D 4FS1A 1ZQBA 4J9KA 4PUOA 3G10A 2BPGA 3PO4A 4HCCA 1NK8A 4J9LA 1JLFA 1ZYQA 1ZQMA 4CHZA 4DL3A 4F2SA 4Z4IA 1ZQEA 4FJKA 3JYTA 3AU2A 1YTUA 4NCAA 3NDKA 1ASWA 2RPIA 2HNDA 4OJRA 9ICOA 3UPQA 5KFRA 4NLGA 4RQ2A 3UQ0A 2PI5A 2XC9A 4CEEA 3KHLA 4QWAA 4KLIA 3ULDA 4C8KA 4I2DA 3HP6A 4XUSA 3NF8A 3RJGA 4QWBA 3CYMA 4E7HA 4CJTA 1XC9A 4GC6A 2YKNA 5I42A 4IFYA 4Q8FA 5K14A 1BPEA 1Q9XA 1VSIA 4CFCA 2W9CA 2YNHA 4CF9A 4K4HA 1S77D 1S1TA 2FLLA 2H5XA 3RB0A 3HX0A 4FLWA 3B6OA 3PUFA 8ICFA 2HHSA 3F73A 1T8EA 1NJWA 3RH5A 1ZBLA 4IQTA 4I28A 3V72A 4B8CA 1VSHA 2XGPA 4CERA 2ZQBA 3LDAA 3MR6A 3RBEA 8ICJA 4KHNA 5KT5A 4F5PA 4I9LA 4KTZA 1ZBFA 3LP1A 1L5UA 3MGIA 4F4YA 4FJ5A 4PGQA 3AVIA 3RJHA 2BGGA 3K2PA 4B9NA 4Z4FA 4DOAA 2PFPA 4J2AA 4KLEA 3H8SA 5KFWA 5KFJA 3C21A 3NF7A 8ICGA 4R8UB 1JXLA 1KVAA 4CJ5A 4GW6A 4UB3A 3ZSZA 3SQ0A 2VA8A 4DFKA 1U49A 5KT6A 8ICHA 3Q8QB 3H08A 9ICEA 4QZ8A 2C22A 3ZCMA 3ISBA 3V1RA 1S0NA 1CXQA 4I2IA 4O44A 4M9GA 4JWNA 1W0HA 2AGOA 1RT1A 4CJVA 4O5EA 3H8WA 4DQRA 3AO3A 5CA7A 3O4QA 2WTFA 1R0AA 4CJSA 3AV9A 4NCBA 3K4GA 3E2EA 4F4ZA 3ZDEA 3HP9A 3QINA 5DBAA 2DPJA 1CZ9A 3AVFA 5J2DA 3C1ZA 4CHOA 5KFKA 2D0BA 2G8IA 4BE1A 3H8JA 3RR8A 8ICYA 3V9ZA 2V4RA 4M9NA 4DEZA 3DLEA 4OGEA 4J9QA 5KG1A 1RT6A 4KFBA 4LD0A 1C6VA 3MAQA 1ZQTA 3M9NB 1RDAA 8ICRA 2WONA 4E7KA 9ICPA 7ICGA 1A5WA 3P5JA 5CY4A 2RKIA 3K59A 5KFGA 1LAWA 4DO9A 3S3OA 3NCIA 3RTVA 4O55A 4YMOA 4I2HA 7ICQA 4HUGA 4QCLA 4I27A 3SQ1A 2P5OA 4R5PA 4KO0A 2HNYA 4B9LA 1NK5A 4DLEA 3D45A 3PMNA 1TK0A 1L3UA 4M9JA 3MEEA 4FJXA 3O3HA 4ED2A 3OYMA 1ZQFA 1RTDA 4FLUA 2F1HA 4CGHA 3M8RA 5FDLA 2X6NA 1I3AA 2HW3A 4R65A 5J0QA 3ZSXA 3VQ6A 1SV5A 1NK0A 9ICJA 5BPCA 5HLFA 1SUQA 2MUTB 1QE1A 3K5NA 4M6WA 5L1KA 4OLAA 2WOMA 2OPPA 3ZT2A 4FLTA 3G0ZA 3VQBA 1N48A 4FZZA 7ICFA 3RRHA 5IIOA 4KAZA 3NH1A 3PX4A 4WE1A 4BE0A 2BQRA 5FRMA 2FC0A 3B6PA 1RT3A 3VA0A 3KLHA 1IH7A 4RQ6A 4QOZB 1B9FA 3SJJA 2BQUA 1BCOA 2P6RA 4FBTA 4ID1A 4FK2A 2KTQA 5DDMA 4F5QA 1ZQRA 5J2AA 4FJMA 4JRPA 4DOCA 3H7IA 3A2FA 2OPQA 3HJFA 4FM0A 4UB1A 4MFAA 5J0XA 4ECSA 1XSPA 1ZQSA 4HCBA 3DOLA 3KK2A 5C25A 3Q8SB 3MR3A 3GIMA 1GOCA 3H4BA 4HVJA 2F96A 1RILA 2PZSA 5KG7A 3RBDA 3OJUA 4UB5A 2AQ0A 3HL8A 3P1GA 3KKRA 4RQ3A 3AVCA 5EOZA 3O3FA 1VSMA 1KSPA 4O0JA 1LAVA 1HNIA 3GV7B 4DSIA 2A1RA 3GIJA 4QZDA 1MQ2A 4HYKA 3SUQA 1DOQA 5DQHA 1HYSA 4QZBA 3LDSA 4KTWA 3SNNA 2HMIA 2PYJA 4Z6FA 3V7LA 1EETA 2XO7A 3AVMA 3L2QA 3HPOA 4KLOA 2HVHA 3RMCA 3AA5X 3KD1E 1S9EA 1XSNA 3ZD9A 1TV6A 4KLMA 5KG3A 4IR1A 3S3MA 4EBEA 4FJJA 3V1QA 2Y1JA 5J2FA 4CF8A 1ZQPA 2G8FA 5KI6A 5EWGA 3L2VA 2ZUBA 4F2RA 1S9FA 4KI4A 4KPYA 3M8SA 3T3FA 4NM1A 4BDZA 4DTJA 9ICXA 1X9WA 2R8GA 5C42A 3QNOA 3HWTA 4W5TA 4GXKA 3ZD8A 9ICMA 4FJGA 4RT3A 3VQDA 4YCXA 4FLZA 3TABA 2W8KA 1WCLA 7ICOA 3C23A 4Z4CA 3ZSVA 1O1WA 3V9XA 4RNOA 5C5JA 3LALA 1UT8A 4P2HA 4J2BA 1AROP 4JWMA 1SKWA 4MQ3A 2JEJA 4EZ6A 3K57A 1VSKA 4AHSA 4CJWA 1ZQLA 3IAYA 3ZSQA 4CJLA 1WCNA 4TURA 5KT7A 1C0TA 1ZJMA 5DMRA 4KLJA 4F4KA 2ASDA 1K1QA 2YKMA 1LW2A 3T19A 2XY8A 5J0YA 3VQ8A 4RPZA 1PZNA 4FW2A 4DQSA 2BGWA 2FBVA 3UQ2A 4RU9A 3VQPA 3JPTA 3QEBZ 7ICLA 4BE2A 4EP5A 4IQWA 4B9SA 3AVHA 3C2MA 4XRHA 2BDPA 4CE9A 4F3OA 2XGQA 7ICIA 1BPXA 4N76A 1RDBA 5HP1A 1J54A 2Z1JA 2OWOA 4DSFA 2W9BA 4DS4A 4EZ9A 4MFBA 1X9SA 4M3XA 4DOBA 1Z00A 5D3GA 1UT5A 4RQ4A 1JL1A 2O4IA 5KFEA 3C2KA 5J2BA 2QK9A 5DG8A 4IKFA 3AVGA 9ICUA 4KTQA 4O3OA 4NXZA 1HQUA 1T3NA 3EYZA 2UVVA 3S9HA 1BCMA 3B0YA 3DLGA 1NK7A 1RT7A 4UBCA 9ICVA 2EHGA 4OGCA 2IBKA 1XO1A 4DL7A 4NLNA 4KLHA 4CFBA 2RDJA 3OYFA 2B6AA 1CZBA 4YD1A 4BGDA 1RTJA 1T03A 3OYCA 4E0DA 5L1LA 3AUOA 1ZQZA 5KFNA 5KFQA 4AHUA 4B08A 4Q0BA 2RDIA 3IM1A 3U3GA 4Q44A 1WN7A 3OS2A 1EX4A 2ITGA 3JPSA 1C1CA 1QLNA 5KFVA 4DTXA 2BANA 4LSLA 1BPDA 4KLFA 3AA4A 1Q8IA 5HBMA 5KG0A 3BQ2A 1FKPA 2P1JA 2IOCA 2C2EA 4DTNA 2XRIA 5KRTA 2W9CB 1U45A 2IS3A 5KFUA 2XY6A 1RNHA 5J2MA 3OYKA 3SI8A 3ZT1A 7ICJA 3SUPA 2B5JA 3OSNA 3EZ5A 4O5KA 4QZ9A 2IDOA 4IG3A 3FYHA 2IHMA 3VQQA 1IKVA 3OGUA 1KFDA 1RCHA 2ZTCA 1N56A 5SWMA 5J2CA 4IR9A 4PHAA 4O9MA 4H4OA 1Q9YA 4P4PA 2VG7A 4FVMA 3MDCA 4CESA 1TV9A 1ASVA 4ED6A 4DWIA 3VA3A 4HTUA 4Q5VA 1LW0A 4PQUA 8ICUA 3ZSOA 4YG2A 4ELVA 3I0SA 3OS0A 3CFRA 1JLGA 1A77A 3RMAA 4CJFA 4F5NA 5T7BA 2Z1GA 3I0RA 2JZBA 4KHYA 5KT4A 2YHBA 4OVLA 1BIUA 4I2BA 1J5OA 4R64A 4F93B 1ZBUA 3KLFA 2M9NA 4ED0A 4FK0A 3EWAA 4QZFA 3KTQA 2A1SA 1TAQA 3V1OA 3AU6A 2ZD1A 3RRGA 4C8OA 2E6MA 2NRVA 5D46A 3U6FA 1N6QA 4F50A 2FMSA 4DTSA 4AHCA 2QXFA 2KZZA 4ECQA 1KEJA 3RWUA 2D0CA 1DGSA 4DSEA 3QO9A 5DDYA 1KCFA 3ISNC 1ZQWA 4ECUA 3PO5A 1LWCA 3TWHA 3JPQA 3V6KA 2NRZA 3RR7A 4KLQA 1VSJA 4CK2A 3PW2A 4FJ7A 1NJZA 2YHAA 3TQ1A 1WSIA 4RQ7A 4UQGA 4ECRA 3AO1A 3TANA 4DQIA 5J2NA 4OKJA 3L8BA 4LH5A 4KITB 5DB7A 4MEXA 1YT3A 4FJIA 1TK5A 3T5JA 4UAYA 1Z3EB 2YNGA 1RZTA 3OYEA 2G8UA 3DLHA 3L2UA 4AILC 1SZPA 3GV5B 4FM2A 1VSDA 4O3RA 2P51A 3HYFA 2BHNA 1WSGA 4E3SA 2ZUCA 1BHLA 4MFCA 4YQWA 4N5SA 4Q43A 2JGUA 4H4MA 5IIJA 2BCSA 2BCRA 2PFNA 4KLLA 3MXMA 7ICVA 7ICRA 3OSPA 5IIMA 4DSLA 2HHVA 3IHQB 4UBBA 4I7FA 4CEZA 1FKOA 3QERA 4F8RA 4PH5A 2HHUA 2G8HA 3ZSWA 2E4LA 1HUOA 1KDHA 1S6PA 3NAEA 4CFAA 4FLVA 2W8LA 4CHYA 8ICMA 3CFOA 4FYDA 1K6YA 4I2CA 5KG4A 2ATLA 5KRSA 3QNNA 4JUZA 4JLHA 2J6SA 3DRPA 4F4WA 4B9TA 1HMVA 5CJ7A 8ICEA 3ZDAA 5J0PA 4CECA 4CHNA 3KLGA 5DLFA 1EKEA 3MEGA 4FCYA 1ZQJA 2G8KA 2JEGA 1SL1A 1MU2A 3Q8LA 1KFSA 5KFBA 2V4QA 1I39A 3KKSA 3HT3A 4F92B 4FJ8A 1WSHA 4IRCA 4LZGA 2JLEA 3DRSA 1XS9D 9ICFA 3S3NA 4AHTA 3VQ5A 3PMLA 1D9FA 5DQIA 2MUTA 4IG0A 2DY4A 5KT2A 1S97A 1HNVA 9ICIA 3UXPA 1TGOA 9ICTA 1RDCA 3AVNA 3N97B 3QIOA 3T5KA 1BL3A 2AU0A 3M8QA 2Q3SA 2I5JA 1D8YA 1IKYA 4TQSA 5CYQA 2B4JA 3AO4A 1ASUA 2ZJ5A 2OZSA 4Z4GA 5KFYA 5KFZA 1TKDA 3PY8A 1RT4A 3PW5A 3C1YA 4DFPA 2OYQA 5DKWA 3RH6A 1HUZA 4B9MA 3MECA 9ICGA 4K4IA 1HYZA 1XHXA 1S0MA 2F1IA 4KMUA 4HUFA 3MFIA 3LAMA 1ZQUA 3K5LA 3NGYA 1JLQA 2ZUDA 4KLDA 5KG5A 2GBZA 3HPGA 4YFUA 3V6JA 1N5YA 4QZGA 3PX6A 1Z00B 5IILA 3E01A 4YXJA 2BR0A 1DTTA 4RUCA 1FXXA 4YMNA 3ZT4A 3C94A 1TKZA 3GDXA 3VQAA 5KFPA 3BQTA 2DTUA 3Q8RB 1U48A 1U04A 1QTMA 1S9GA 4O3SA 4J9RA 4M41A 3MR5A 2C2RA 4I29A 3OHBA 4ECTA 4LH4A 3SUOA 4GMJB 2B21A 4QZIA 2G8VA 3BQ1A 1B92A 3ISDA 4QWEA 4RNMA 2F8SA 4CJUA 4O3NA 1RYSA 2I1QA 1BPZA 3ETLA 4YVZA 4FZXC 1RBVA 3BGRA 7ICNA 4MEYA 4EYIB 9ICHA 1HJRA 4M3YA 5CHGA 3DOKA 1LV5A 3O3GA 1S1UA 2AJQA 1YVUA 3G6VA 4UB2A 1J9AA 3V9SA 4UB4A 4J2EA 1BGXT 4UAZA 3AVJA 4RW9A 2FPMA 4I2QA 4RPYA 4PPXA 1VK0A 4K4GA 4CHPA 4O4GA 1UAXA 1BVSA 5KG6A 5BOLA 8ICIA 3RJKA 1C0MA 3TARA 3K58A 4O5CA 5CB1A 1TK8A 2IAJA 4HHTA 1GOBA 5KFMA 2UVWA 9ICKA 2VWKA 2D5RA 4CJKA 3DLBA 1RXVA 1RBSA 2FLPA 2ISOA 4YMMA 1XWLA 3SV3A 3ORYA 4M47A 4YN4A 4Z6EA 3RB6A 1WLJA 4BWMA 4RUAA 3HXMA 5SZTA 2QKKA 3LWMA 4PGXA 8ICTA 3GQCA 1MQ3A 1T7PA 5I3UA 4K8ZA 5L1IA 3AVLA 2BCUA 3OHAA 1NK4A 4RW7A 1IM4A 3JPRA 4P4MA 3WNFA 1F21A 4PHDA 3OYBA 2NRXA 1S5JA 4N56A 4M3ZA 2EX3A 1JXBA 3DM2A 3V7KA 4YNQA 8ICXA 3AVAA 5KFIA 1ZQAA 3OYLA 4KHQA 1NKEA 2KFZA 3QEVA 3QEXA 2R8JA 3QEAZ 2AGPA 7ICKA 4DTRA 4J9NA 3AVKA 2BPFA 4RPXA 2GWSA 3MFHA 3PV8A 2ZJAA 3H4DA 3GV8B 4JV0A 5TZVA 1S6QA 1TKXA 1XHZA 5IIIA 1ZJNA 1LWEA 3KHGA 3SPYA 8ICAA 5KFHA 4NY8A 4ZTJA 2XY7A 4JK1A 2PI4A 2FPKA 3SI6A 4JRQA 5J2EA 5KGWA 2OZMA 3SQ4A 4QZCA 2W9AA 9ICSA 1JIHA 1UWBA 1Z25A 4CJQA 2YV0X 1B9DA 4QZHA 1CXUA 4XQ8A 4H8KA 1MC8A 5J29A 4ECXA 3VQ4A 3D0PA 1ZQYA 2I9GA 1GOAA 3GFKB 1ZQDA 2UVRA 1XI1A 3G6XA 4J9SA 4B8AB 4CEQA 4CEFA 4NYNA 4P4OA 4QW9A 5J0OA 3LAKA 1BISA 2O4GA 4KV8A 2OA8A 5J2IA 3CQ8A 5D49A 2OPRA 1XSLA 1J53A 3NH0A 3WNGA 1CUKA 3ZSRA 1MSWD 1S1XA 5J1EA 5HHHA 3V81A 4QW8A 3KHHA 2HHXA 4FO6A 4O3QA 4W5QA 2FMQA 1X1PA 3OYDA 4NYFA 4K8XA 1RYRA 3WNHA 2YNFA 8ICNA 1WSEA 3UXNA 5CYMA 5C24A 4I2PA 4M2YA 4CHQA 2FPLA 4R8UA 2ASJA 8ICQA 2W9MA 5KFTA 2R8HA 1L3TA 4FLXA 2X6SA 2Q0ZX 7ICUA 1EXNA 2DPIA 5F9LA 5DGAA 4JS4A 4O5BA 1SKSA 3N4MB 2HVIA 5HMMA 2DFLA 2D0AA 3TI0A 3MGHA 4OPKA 3VQEA 3UIQA 1ZQVA 1K1SA 8ICBA 3T5HA 1HQEA 3KLEA 1T4GA 2P66A 1BPYA 1KLNA 3IRXA 1ZQGA 2G8WA 4CK3A 4GXIA 4QZEA 4CJ4A 5DLGA 1WNSA 5J0UA 3M9OB 3Q8PB 2XCAA 4AH9A 2PYLA 9ICLA 3VQ7A 3NF6A 1NKCA 4DU1A 5KFCA 5L9XA 4ECVA 2VA3A 4I9QA 2MAXA 4CEDA 1JL2A 4F91B 1IKWA 5KFLA 3TAPA 4RW8A 1ZETA 3PR4A 5JS1A 1JMSA 3IS9A 5CZ1A 3V4IA 4KB0A 4DTOA 4F4XA 1JXEA 1SL0A 4DFMA 4CCHA 4DQPA 4B9UA 4QWCA 1IO2A 4DTMA 2UVUA 3PR5B 2FBYA 4RNNA 4W5NA 3JSMA 3KK1A 2VWJA 3MXJA 4O3PA 3GIIA 3C95A 1BI4A 1KLMA 3LK9A 4M3RA 3LANA 4Z6CA 3TFSA 3AVBA 1U47A 3KLIA 3VQCA 4FJNA 4MF8A 7ICTA 1QSYA 4C8NA 3GIKA 4GXJA 3MEDA 4E19A 3L2WA 4QWDA 2C2DA 4PGYA 1JLAA 2R7YA 1WSFA 3SCXA 1RTIA 4I2FA 4KLSA 2JEIA 3IG1A 5IIKA 4BXOB 4OKKA 4E1NA 5DB6A 3M8PA 7ICSA 5F9NA 4GC7A 1ZBIA 3OVNA 3OJSA 3PNCA 1A5XA 2IHNA 1NK6A 2XCPA 1QSLA 3OYGA 4C8MA 4CGJA 1NK9A 1FK9A 7ICHA 4YD2A 1B22A 4RT2A 4FK4A 3OYAA 3RB4A 1RBRA 5DK5A 5DBBA 2P5GA 4CEOA 4M9HA 2ASLA 4CEBA 2AQ4A 8ICSA 5EU7A 1XU4A 3V7JA 1S0OA 3NGZA 5DB9A 3U3YA 2GV9A 4IQVA 5CZ2A 2VG5A 1T05A 4TUQA 1ZBHA 3NBPA 4KLUA 5HNKA 1RT5A 5HMLA 4J9PA 2IA6A 3NH2A 4FLYA 4C8LA 4F5RA 4DSJA 2A1JA 3RJFA 3ZDDA 1KTQA 2P6UA 4IQUA 4M3WA 8ICWA 4DTUA 2BCQA 3NGIA 3MABA 4XIUA 3RAQA 3HPHA 1D8LA 4IFVA 5DBCA 4DQQA 3ALYA 2PFOA 2BPCA 4OPJA 4JS5A 5HP4A 2GUIA 5HRSA 2XHBA 4XA5A 5HROA 2AGQA 3JPPA 1KVCA 3ZSYA 3TAQA 3NTUA 5HRRA 4CIFA 3QZ7A 4W5RA 4YR0A 1EXQA 2HHWA 3GILA 3OS1A 1COOA 2BCVA 5DG9A 3ITHA 5D4BA 4J9OA 1JN3A 3L2RA 2RF2A 3PX0A 3ZDCA 2KZMA 4NM2A 1U4BA 2NRTA 1VRUA 3FFIA 2IC3A 1H38A 4CGGA 4Z4EA 5JS2A 5J2QA 1JKHA 2W42A 1S1VA 4KB1A 3TAEA 1ZQNA 5KFOA 3C2LA 4NLZA 3QE9Y 4EBCA 1LWFA 3NF9A 1S10A 3HSTB 4OLBA 4X5VA 9ICAA 3LP2A 3OY9A 3AO2A 8ICKA 3EPGA 4KKOA 2DFHA 4I2EA 3K5OA 2Z1IA 3NGDA 3KJVA 5KFAA 5L1JA 2C28A 2BQ3A 4CF2A 2KZ3A 3TFRA 3THVA 1JLCA 1DLOA 3L3UA 3K75D 3EPIA 1REVA 2JEFA 2X74A 4CEAA 1NKBA 4ED8A 4FJLA 4CIEA 4FBUA 4Z6DA 8ICPA 3SQ2A 3LWLA 4OKEA 1TFRA 4EBDA 3DI6A 4CJEA 5CP2A 4ICLA 2PY5A 2QKBA 4QZAA 3SV4A 4ECZA 1D5AA 4KN7A 1IG9A 3DRRA 4PA1A 4CJPA 1C1BA 4FW1A 4PHEA 1VSEA 3LP3A 3MXIA 1U9LA 3FDSA 4GLXA 3V6HA 7ICEA 2HB5A 1QSSA 9ICNA 1SL2A 4BDYA 4N41A 1C0UA 3HM9A 4DSKA 3V9WA 4YR3A 4RQ1A 4ID5A 2VANA 3HVRA 5J0TA 4CJ3A 4CK1A 8ICLA 2BE2A 3LP0A 1C1AA 1D9DA 3RJJA 3DYAA 4G1QA 5KFFA 5KTQA 3JPNA 4MFFA 3DLKA 4FM1A 2LSNA 4M9LA 5J2GA 5KFDA 4I2AA 9ICQA 3C5FA 4DU3A 2ZJ8A 1BPBA 2W9BB 4EP4A 2VA2A 1L3VA 1SKRA 4NLKA 1NJYA 1QQCA 3BQ0A 4KHWA 1RBUA 1W9HA 4KLTA 1EP4A 3KHRA 4TSXA 4AHVA 1ZQKA 2F8TA 3HK2A 3QZ8A 4J9MA 3LPUA 3MBYA 3OYHA 5J0WA 4ECWA 3G6YA 4Y1CA 1NOYA 3QIPA 4B9VA 4ZH4A 1QHTA 4Z0UA 1ZQXA 2J6TA 4TUSA 7ICPA 4CJRA 5J2KA 1C7YA 4W5OA 5DG7A 3RH4A 4M6WB 2JZBB 1UA1A 4UAWA 9ICCA 3OYJA 2ZTDA 2FBTA 4F3TA 4KRFA 4RZRA 1KVBA 4HUEA 5EWEA 1YTAA 3ZT3A 1RBTA 5J2PA 4R66A 4RQ0A 1HYVA 2HNZA 2R8KA 2ZTEA 4EEYA 5IINA 2FBXA 4DU4A 8ICZA 2NRWA 2VG6A 5CWRA 4RW4A 4DF4A 3PW7A 2KW4A 4J2DA 3AA3A 4E7IA 4NCGA 4DL6A 4IRDA 4RQ5A 4Y1DA 3NE6A 3EY1A 3SUNA 4ZHRA 4CF1A 4CFDA 5E41A 3O4NA 4M45A 3TR8A 4E7LA 9ICRA 3QEWA 3B0XA 2KFNA 3V6DA 2V9WA 3RJEA 1CEZA 4RG8A 4FJ9A 3DLRA 5JUMA 2FLNA 4IBNA 3MDAA 5HRNA 4I2GA 3RAXA 3K5MA 2Y1IA 5J0SA 3SZ2A 4RQ8A 4M0AA 1IKXA 4DS5A 1WSJA 2DFFA 3BJYA 4EYHB 1BQNA 4KHSA 3ZDBA 1NJXA 3NHGA 1HJPA 2YNIA 3SYZA 1RT2A 3TAFA 1HPZA 2XY5A 4ED1A 1IXRA 1A5VA 4Z4HA 2PFQA 4DL5A 3CG7A 3T1AA 9ICWA 3H40A 3KD5E 1ITGA 4DMNA 2ALZA 4DG1A 4YR2A 1BI4B 4E7JA 1NOZA 1RTHA 3ISCA 4CIGA 4KHUA 1KFTA 3VN5A 4M3TA 2IMWP 1UOCA 1KRPA 1VSFA 1JX4A 1G15A 4IRKA 3PVXA 4R63A 4B3OA 4PY5A 3RMDA 5FRNA 3LZIA 5DQGA 4DLGA 1RDDA 3L3VA 5HRPA 4YXMA 2X78A 1DTQA 4DFJA 5DB8A 4LSNA 1S1WA 4ED3A 3T5LA 1WAFA 3C6UA 2BKEA 3ASMA 5EWFA 1TKTA 3JPOA 2HHTA 1ZQCA 1B43A 1TL1A 3QLHA 1CLQA 3VQ9A 3AO5A 3HO1A 1ZQOA 5DGBA 3P83D 1Y97A 3ZT0A 3Q8MA 3QEPA 3OYNA 4ED7A 4E89A 5J2JA 5FROA 4M42A 3QEIA 1ZQQA 3AA2A 2NUBA 4CGIA 3NFAA 3RJIA 4BACA 4YP3A 4ECYA 2F1JA 3TAGA 1RXWA 4M3UA 4DF8A 1Y88A 5CR0A 4QAGA 2J6UA 4CGFA 4E1MA 3I8DA 4ELTA 3V9UA 4ZTFA 5J2HA 4TUPA 3CM6A 4MF2A 7ICMA 3F9KA 3PW0A 4JV1A 3HW8A 8ICCA 3C6TA 3M9MB 4TQRA 4AHRA 2KN7A 4M04A 4FS2A 5KFXA 4GVMA 1UA0A 4KREA 2ISPA 1TL3A 2OPSA 4FJHA 2DFEA 5KGXA 1BIZA 3KIOA 3HVTA 1A76A 3RMBA 1NOMA 4Q45A 4FXDA 3EW9A 3OYIA 1VRTA 2HHQA 4YFKA 3UXOA 3QETA 5BOMA 4DTPA 1Z26A 3SPZA 1ZQHA 4ELUA 2IGIA 4DL2A 3Q8KA 3RB3A 1V9PA 3TAMA 5HHIA 2R8IA 4N47A 4PWDA 3C5GA 3CFPA 1JLEA 2E6LA 3PW4A 3BDPA 3MR2A 2RN2A 1WAJA 4LZDA 4JV2A 1VSLA 4RW6A 3LPTA 2FMPA 5KFSA 3WNEA 4G3IA 4F5OA 1TAUA 4KI6A 5J0RA 1ZQIA 2ZE2A 1X9MA 4BDPA 3KK3A 3DMJA 1BQMA 2A1JB 4KN4A 1TVRA 2PXIA 1JLBA 2KQ2A 5KT3A 1HRHA 2Z1HA 4CGDA 4PHPA 4IDKA 4FZYA 4BWJA 4O0IA 3QESA 3CM5A 5KG2A 1LB2B 1RPLA 4KLGA 4Q8EA 1S0VA 1L3SA 8ICVA 4DL4A 4LVSA 4I2JA 2LYHA 4BXOA 9ICBA 1QS4A 3LZJA 2ETJA 4L8RB 1TVAA 4CF0A 4LY7A 1X2IA 2ATQA
chains in the Genus database with same CATH superfamily
1HNIB 4FS1A 1YI2S 4H5TA 4J9KA 1KN5A 2IMOA 2BPGA 1NK8A 2XI3A 5K8OA 1YXQA 1ZYQA 4I56A 1DZ5A 1S5LU 1ZQEA 4ILLA 3JYTA 4I6MA 4FOIA 3AU2A 4PWDB 4WTYA 4RQ2A 4UOHA 3NVZA 3RW7A 4CEEA 3PG9A 1S72S 4KLIA 3HFZB 3NF8A 1A0OB 1RQLA 3IG8A 3CYMA 2GVZB 1L7OA 2ZHBA 2AHOB 2ATCB 4FZLA 4Q8FA 5K14A 1BPEA 1ZPWX 2YNHA 2VKQA 4CF9A 1S77D 2C3MA 4BUGA 1MMNA 2NPIA 2BTFA 3HD1A 2OAUA 2JDJA 3PUFA 3BO2A 1S79A 5IQQA 3F73A 5GADI 5FLXY 2CJAA 5AK3A 2ZM6J 3RH5A 1NB2A 3BSNA 4B8CA 2JV3A 4FF1A 4B3MJ 1VSHA 1NGGA 1FT8A 3RBEA 4NA1A 4KHNA 2V68A 1ZBFA 3CGIA 3ZZ0A 5CABA 2JHEA 2DGSA 5BXIA 2V94A 3AVIA 2IC3B 2BGGA 2VODA 3Q86A 1BWFO 2CQHA 4MT1A 1D4XA 1R0CB 1Q1KA 4C0BA 5AM1A 3JSBA 3UN5A 1HUXA 2PFPA 1DRGA 4EHUA 3H8SA 3GJRB 2XS7A 5KFWA 3D5MA 4F3MA 1T9YA 4JV5K 3NF7A 8ICGA 1S72N 4R8UB 3F44A 2ZBIA 1SI9A 3EZUA 2LMIA 2LXUA 3DDKA 2BMBA 4CJ5A 2KXHA 3FC9A 4BHQA 4IFYB 2VHGA 3EE3A 1DAXA 2VA8A 4P52A 4YY3K 4RW7B 1GLFO 2DRAA 3CJTA 2QWLA 4UATA 2G06A 3H08A 3F2CA 2C22A 2NREA 4K0KJ 4OZ0A 3ICLA 4JI6F 4CZFA 2WVCA 4CP5A 1S0NA 2JLFA 4BG8A 4XH4A 2ZIWB 4FWKA 4Y28C 5AQRA 4Y2AA 3D7SB 3A5OC 1RWNB 1RT1A 4FSVA 1IV8A 2FHOB 2HWHA 3CDEA 4BR5A 5HATA 1ZM9A 2A2DA 4DQRA 5I3PA 1YKWA 3AO3A 4IOAQ 3NVVA 2DR8A 3O4QA 1XR5A 5C2GA 1WWUA 4CJSA 5DDRC 4EUVA 4NCBA 3NGSA 2AJ1A 1UEVA 4P2MA 3CHWA 3E2EA 4JNEA 5CYMB 5F8JA 3JQMA 1CZ9A 5J2DA 3C1ZA 4CHOA 2ILZA 1F0MA 3KG0A 4WYWA 1DHMA 3H8JA 2LXFA 3V9ZA 4NXNF 3OR2A 4IH5A 3U9DA 4EAHD 4FWMA 3DLEB 4WYLA 1C6VA 1QHAA 1RDAA 7ICGA 1A5WA 3G71N 2MU2A 3T1HF 1GEHA 1GMVA 3K59A 5KFGA 1FEEA 4DO9A 2WCXA 2HNYB 4M5JA 3NCIA 3RTVA 4O55A 7ICQA 2U2FA 1UFLA 4R5PA 2BE7D 4B9LA 5AZJB 3WEEB 4DLEA 3PMNA 3G2XA 4M9JA 1VQPN 1YHQN 1HNZK 1LK7A 4JI0K 3HFVA 2DL0A 1NPRA 2XICA 3OYMA 2O8EA 1C2PA 1EP4B 3LF0A 4A8SA 1ZQFA 5FIIA 4ER8A 5HJXA 4QJFB 1G6BA 3W64A 1IG6A 2IVFB 4R65A 1Z1BA 3M8PB 4X64J 4Y65A 2OTJS 2HBYB 1SV5A 2ZJQQ 5BPCA 3IS9B 5HLFA 3TW0A 2ODGA 3VGKA 5L1KA 4MJKA 2CH6A 3ZNJ1 2LQ8A 1M0SA 3HI9A 2E9ZA 4V19X 4WE1A 3OTOK 3MURP 1RT3A 4URGA 4MHVA 1IH7A 2YX7A 5DM6Q 4EHTA 2P6RA 3O08A 2AV5A 4FK2A 2KTQA 2KYZA 2FGOA 4FJMA 3CC7S 1NUEA 4JRPA 3M2RB 5AKGA 3KNGA 4OJ5A 4K4SA 4FM0A 4UB1A 3NBPB 2J5AA 1HEKA 3BO3A 4ECSA 1XSPA 5AQNA 2HOQA 2CQDA 3F2BA 4J90A 3HVWA 2QB0A 2MZJA 2RU3A 5AQIA 5CAAA 1RILA 5LJWA 2Q0UA 5KG7A 1H3DA 2VBWA 3BYPA 4UB5A 4TKTA 2MQPA 2AQ0A 1YITS 2IOFK 2KVSA 2WF6A 3CDAA 4YY3J 1SJQA 1VHFA 3KKAC 2HZAA 3DGPB 4IG0B 2P9LA 1LAVA 4PKIA 1HNIA 2J9DE 1KWMA 4QZDA 2UUCJ 3MR7A 1JRPA 5IZHA 1A6SA 3H0PA 4R0EA 2VQFK 5AKXA 5HQMA 3SNNA 4Y2MA 4Z6FA 4NLDA 4UY85 1T9WA 2KJ9A 2P8IA 3MF5A 1FKAF 3L2QA 3VZHA 1GLBG 1C0TB 2WBMA 1RAGB 3BGLA 2NNWA 1A0PA 2M0GB 2HWIA 1U1PA 4A57A 4KLMA 2UXDK 5EE0A 1XEZA 4J5OA 3J7AN 2GVZA 2MQLA 4FJJA 3NNHA 8ATCB 1X60A 1C0GA 5J2FA 3DRPB 5AZIA 4DX7A 4YHHK 1KOHA 3BGRB 4IZ9A 3DMJB 1Q7YO 1C4AA 4KR0B 4JV5F 3IRUA 2GJ2A 2ZUBA 4F2RA 4KI4A 2CJ9A 2DWQA 3SDEA 2A41A 4X64K 1S6UA 1CPZA 3VEOA 1HNWJ 1ZM4A 4BY9C 4DV7K 4FJGA 4RT3A 4YCXA 3AGKA 2R7QA 7ICOA 3C23A 5KOWA 2VGMA 3W5XA 3DXMB 3V9XA 2RLTA 3NS1A 5HQ8A 3LALA 3QFWA 3IFRA 1UT8A 2ZH3A 2LBOA 1SKWA 2QEXS 2JEJA 4Z2XA 4A8FA 4PXCA 1FDDA 1HD0A 2AYGA 3J7YU 4CJWA 1ZQLA 2ZJRQ 4TURA 2P9KB 1ZJMA 2RHSB 1HBUA 5FLXU 5DMRA 4KLJA 5LL6d 3O80A 2ASDA 2W6LA 3F5EA 3MM5A 1IBMJ 3EJMA 2XY8A 2Z0GA 4NX9A 2E5JA 2YWFA 4DI6A 3QWPA 4MK8A 4PXBA 3G9CA 3DHXA 3KVGA 3JPTA 2VFRA 4IQWA 4OV6A 2NSCA 4YHHJ 3FSXA 3UR3C 3QRPA 5ETSA 4XRHA 3T9NA 4F3OA 1RWMB 5ALWA 2XGQA 7ICIA 4JI8J 2M5YA 2CJQA 4N76A 1RDBA 2PT0A 1BC6A 1J54A 3L7OA 2Z1JA 5AKYA 3VF2A 1OY6A 3HHLC 4RO0A 4MFBA 1N61A 4ZVRB 3M6GA 4WJBA 1Z00A 5ALMA 3MD1A 5KFEA 1EARA 4OZ3A 5J2BA 5AM5A 3JSRA 4HACA 2KV2A 1IR2A 3EXCX 1Q0NA 1N62A 1KD1O 1WORA 4ZOSA 1LKYB 2ADCA 5TISU 2COLA 1F3FA 1BCMA 1SV0A 4B9QA 4OGCA 2FZKB 4US8A 4NLNA 3OYFA 3GJQB 3M32B 4K25A 3OFGA 2LI6A 1RDFA 3FZMA 3HSZA 4RBTA 3WX8A 5KFNA 1E6VB 1JUDA 3WXLA 4AHUA 3A3PB 5HVFA 2X51A 1WN7A 2LQ5A 1EX4A 3OS2A 1QLNA 4U96A 3MPVA 4KGXB 3M2UB 2YWWA 5HBMA 4WQ4A 2CZ9A 3BQ2A 3QT6A 2P1JA 5EHHA 1NGHA 3D6TB 3MMCB 5KRTA 1FKPB 2W9CB 2IS3A 3N7SC 5KFUA 3UNGC 5J2MA 2RT3A 1SIJA 3SI8A 7ICJA 4GKJJ 3SUPA 3OSNA 4O5KA 4IG3A 4OHWA 1LWCB 1HNXF 4NCGB 1DLOB 3AA9A 1KFDA 3FAHA 4IR9A 3DDHA 2OMOA 4A46A 2VG7A 4Y3CA 2WVEA 2HFUA 4MH8A 4O23A 1XMOF 4CO1A 4PQUA 3QRQA 3DWLA 1BDGA 2DVIA 5AI5A 2FUG9 3W0LA 3OS0A 3CFRA 3NVMA 1JLGA 4GY2B 2E1CA 1T9XA 3PKYA 3GG1A 4F5NA 3I0RA 4KHYA 2QFIA 2X1AA 1BIUA 1WC1A 3CCEN 3CJKB 1G7CB 2MQOA 3T1YF 2M9NA 4C11A 1B99A 4QZFA 3KTQA 2CQPA 2P35A 2CKWA 3BF4A 4NLRA 3K8VA 2NRVA 3U6FA 4K4UA 1NU0A 4DR3K 5EGYA 4AHCA 4LFBJ 1FRLA 2LQJA 3PSFA 5JVGQ 2KZZA 4OHXA 2M0NA 3CMQA 3RWUA 1X5OA 7FDRA 1S6OA 3OTDA 5DDYA 1KCFA 2GHWA 2KJVA 3CJAA 2QWQA 3UFCX 3PO5A 3EVMA 3V6KA 2NRZA 1WWHA 4KLQA 5F0WA 4FJ7A 2F3NA 1NJZA 3C15A 4DV4F 4ZP8A 2RS8A 3R8EA 2DH9A 4UQGA 4JKEA 2H5EA 1HBNB 4JI0F 2PFFB 3J81U 3KLGB 1RP5A 2E1AA 3CUNA 3D2SA 3SIPB 2X1FA 3VEZA 4DQ8A 4OYPA 1N0UA 1CSJA 4ZVHA 4UAYA 4HH1A 4NZ6A 2PMWA 3QT7A 2YNGA 2OD4A 3C6UB 4JI2F 1IR1A 1BE4A 2N1RA 3L2UA 3BGUA 3GV5B 1WWVA 1W25A 2G4BA 3O5TB 2DBYA 2AP1A 1NLVA 2GO9A 4LRDA 4OHVA 4ILGB 3K9JA 1FRHA 1FWPA 4LFBF 2XEXA 2BCSA 1DURA 3ONNA 2KT5A 2ZGZA 2JH7A 2PFNA 2KKVA 3TADC 5IIMA 1TL7A 5IQ6A 4KFBB 4CEZA 3O44A 1FKOA 1H7XA 1FE4A 4Y2QA 3ZSWA 4YB5A 1HUOA 1FJEB 2E8AA 4FLVA 2GVDA 4FYDA 2VH7A 5JMNA 5GTHU 1D3WA 3RYLA 3N0VA 3DRPA 3AB4B 2DGOA 1KNZA 3ZDAA 4CLYA 1YUWA 2RILA 4CHNA 3O6WA 3CP8A 3KK2B 1VQYA 4BC7A 3S7RA 1GMWD 2CPRA 3HT3A 4LR7A 4M5KA 4FJ8A 3C16B 1WSHA 4IRCA 1XC3A 4LZGA 1TKTB 3GFXA 4NMXA 3FZFA 3H20A 3S3NA 1H2VZ 1QUVA 4QR2A 1YITN 3ZZPA 3PMLA 1F5AA 3HVTB 4CLFA 3UB5A 2KNJA 2YY6A 2H65B 1SUQB 2DY4A 5IWAJ 1S97A 5FD1A 2QIFA 1W2BM 4YB6A 2H1YA 4K4XA 9ICTA 1RDCA 4I4BA 5D0GA 3QIOA 2B8QA 3T5KA 1BL3A 1BQXA 2I5JA 1UJ4A 3OTQA 1IKYA 4MTPA 2P9PA 5CYQA 2B4JA 4TU7A 2ZJ5A 4Z4GA 1YVFA 3LVVA 3PW5A 2AF6A 5DKWA 2K3KA 1HUZA 2E5GA 2F4FA 4GVLA 9ICGA 3US5A 3CI5A 1Y3JA 4FVUA 4CW7B 3FCVA 2MZTA 1GLCG 3MCOA 3CJ7A 1JLQA 4M5HA 4DUYK 4NLYA 2WB1C 5ADXH 2HWTA 3EM1A 1Z00B 4UOGA 4NOHA 4KE5A 1SC4B 4HACB 3JTOA 2K8GA 1ULRA 4QIEA 2ROEA 1VBXA 2HDOA 1ZTWA 3ZX2A 2O8DA 3DCAA 2QLXA 3Q8RB 3OHRA 4PL1A 4LF4F 3OHBA 3ELHA 2ZH2A 1QAXA 2Z2LA 4IO9Q 1O03A 4I6AA 1BWEA 2P6TA 1K73O 1JB0C 4UY8T 3WKDA 3J80U 1KKHA 2F8SA 1SJ4P 1KTVA 2RJZA 1WHXA 1HNZF 2R7TA 1RBVA 3MMCA 3ETMA 2QE5A 4HHJA 3RJMB 5F41A 4P9SA 2CVIA 1HJRA 1JLAB 1HWJA 2CJBA 2AJQA 1LVHA 3OTBA 2MMYA 1HBMA 4UB2A 5D4NA 3V9SA 4DR5J 4J2EA 4KH0B 3AEVA 2KH9A 2QWRA 3ET6B 1LFPA 5BYRA 2HS4A 1PK3A 4PPXA 3FBEA 5ALZA 2X3GA 3JTPA 2CUYA 2PMZC 1VRTB 5BOLA 4FE3A 3HZGA 1DBDA 3VAIA 1COKA 3TARA 2YKQA 3I0RB 4HHTA 3JAMY 2PIIA 1HIWA 5ALDA 3FGUA 2QL5B 1VR6A 3E9OA 4PKDB 4U6PA 2VWKA 3MGJA 5AKLA 1UW4A 5EDWA 4FVCA 3QRRA 1RXVA 2V34A 3CJRA 4DV1F 3ORYA 4YN4A 2DEIA 4Z6EA 2LFVA 4OMFG 4LF6F 5I4MA 1I94K 3ID8A 2QKKA 3DDIA 2G9OA 2XMWA 3TVYA 4UASA 5I3UA 1UHUA 3DLKB 4K8ZA 4GO5X 3AVLA 1QQ5A 3R5JB 4RW7A 2LKYA 1CQMA 2MKSA 3CJCA 1IM4A 3JPRA 3NOCA 2HQCA 3OYBA 2V51B 1XNSA 3NCRA 4N56A 1X4DA 4M3ZA 2EX3A 1JXBA 2HAFA 3V7KA 3CCQS 3R5BA 4O4GB 3ZTRA 5AQVA 1Y10A 1XMQJ 3AVAA 2EI5A 2M7SA 5EOYA 4BS2A 2IM2A 3QEAZ 1RT1B 2HSTA 4GKKK 1ROFA 4FWOA 3TX8A 3HHNB 4DTRA 2BPFA 2KDOA 1GO3F 5LMNJ 1ZRNA 2O6KA 1WKKA 2DKZA 2CNKB 3ENWA 3Q2SC 2K7JA 1S6QA 2ERRA 2E88A 5IIIA 1ZJNA 1FCAA 4DV2F 3QFPA 3N4QA 2ILYA 1Q3UA 2YXLA 4Y2PA 1R6YA 1LW2B 3EKUA 4F71A 5JXSA 5ALTA 3BB5A 2LHTA 1QAJA 2MZRA 1YDLA 2AKWB 3SI6A 3D28A 2ACMA 5AQOA 4BC2A 2QLTA 2RB7A 1BUPA 1JIHA 1UWBA 1Z25A 2FVQA 3QAEA 4QZHA 3J81j 2NCKL 3ULHA 1VQNS 4ECXA 3VQ4A 2YY3A 4A8YA 4AM7A 2K8CB 3F5TA 1X4FA 4ETZA 4ZVQB 4P75A 2AEJA 4B8AB 3MMBA 2W2PP 4CEFA 4NYNA 2OXOA 1V9OA 3H8MA 5AI6A 3LW5C 5F2RA 5J2IA 5D49A 2Y0SD 1XMOJ 3QGIA 1J53A 3WNGA 3MM6B 1WF2A 2RNEA 4U9RA 2DUYA 3HDSA 3ZZZA 2O66A 5J8YA 2JSXA 1TL1B 2JJ4D 2LYBA 1YK9A 4IJAA 2G07A 2YH0A 4K0KF 5T7LA 4DZDA 2WB1F 4EFAC 4X2BA 2EBGA 4ZVFA 2LQ9A 3UXNA 5CYMA 1HI1A 1HHSA 2BANB 2W01A 4I2PA 1IBKJ 4TY8A 2LA4A 4BC4A 2ASJA 4YB7A 2W9MA 3MCAB 2DEJA 2BE2B 3BP8A 1L3TA 4KX5A 1EXNA 3DLLQ 2ACYA 1JCEA 4O5BA 1M5SA 2B8PA 2P9GA 4USWA 2IDEA 2D0AA 3TVKA 2FY8A 3TI0A 5JRTA 3NGRA 1ZQVA 1R7IA 1K1SA 8ICBA 3IMXA 4LF5J 1F0XA 1R8HA 4AE5A 4R5PB 1IBKF 2ZNZA 3PFEA 4HT5A 4F02A 2QB0B 4CK3A 2QYGA 2XWXA 2GX9A 1U8WA 1KD1T 4JI7F 3JAMO 2YMMA 2CJXB 2PYLA 3UDLA 4DR6K 3VAFA 2DHHA 3GPAA 3NF6A 4DPYA 1RLCL 1NKCA 1RJJA 3ED5A 2Y0SC 5KFCA 1M5OC 5L9XA 3NWRA 4CEDA 2WFBA 4BJQA 2AJ0A 2VYPA 5JS1A 3NG8A 2HRUA 3IS9A 4OX9K 1SL0A 1JXEA 3MCMA 4QPTA 1VRQC 1UAWA 3VTIA 3OVSA 1RU1A 4DQPA 4B9UA 4KY3A 4DR7K 3D6HB 4DTMA 2FBYA 1JJ2M 4A61A 1RABB 3JSMA 2F4VF 3KK1A 3C95A 4RWTA 3SQGA 4M3RA 3LANA 4Z6CA 3TFSA 2UXBJ 3GSIA 3BZQA 3KLIA 1VBKA 3VQCA 1HJOA 4MF8A 1NMDA 4JI7J 4ILRA 3GIKA 2BJ8A 4FF3A 4AQYJ 5F0XA 1XMOK 2DCUB 3CJ0A 2C2DA 4B3SK 2RUSA 4PGYA 2F8KA 2AW0A 1JLAA 1R27B 2LLZA 2BUPA 4Z94A 1NJIO 1SV0C 4DR1F 3SCXA 1ECWA 2EAPA 1HLWA 1VS3A 2XMUA 5ALHA 4DHVA 3MD3A 1U1QA 3ET6A 4ZPCA 2ZH4A 4AP9A 3D66A 3KZXA 3OTEA 1PVRA 4AYBD 2HKEA 2DF4B 1JALA 2VOOA 3CW2C 1A5XA 3DXMA 5M1PA 4B3MK 2DNYA 4OZLA 1S9GB 1BQNB 1FK9A 3W2VB 4YD2A 1GTEA 3VGTA 3KUHA 2DGTA 3RB4A 5DK5A 5CYJA 3KFUF 2P5GA 3S8SA 3A8IA 1NWKA 5DM7L 4DX6A 4PRFA 2AQ4A 4X4OA 1HKBA 5EU7A 3R5DA 1A7GE 1LOUA 2H3IA 2D3O1 3V7JA 4C4TA 5DB9A 3U3YA 4JOUA 1YQHA 4CO2A 4TUQA 4NPOA 2W7AA 2OH2A 3CDBA 3CD6S 5HNKA 1UEUA 4O0NA 4CF4A 4U7UK 3NH2A 2VL1A 4FLYA 4PZOA 4F5RA 3HM8A 4DSJA 2A1JA 2W11A 2CPXA 2UXCF 2P6UA 4M5IA 3NRWA 2B0CA 3MABA 2W40A 2G08A 2EFPA 2C2NA 3RAQA 4IFVA 6FDRA 4DQQA 3ALYA 4G1PA 4ZPVR 4OPJA 5HP4A 2KB2A 4C0HA 2R7OA 1DFDA 4XA5A 5HROA 3K1RB 1V5VA 2DH8A 4C97A 1TQLA 2DNNA 2IIHA 3NY0A 1B3TA 4RCHA 4W5RA 1EXQA 1RUSA 3LOUA 3OS1A 2E29A 4NLQA 2BCVA 1HNXK 3ITHA 2EFNA 3W9IA 2RE1A 4OJ6A 4PL2A 3PX0A 3P45B 2KZMA 3BBCA 5E79U 1U6BA 2LEAA 1N32J 5J2QA 4NEYA 1JKHA 4WU2A 1L7MA 3ZFVA 4KB1A 1WEXA 4OI3A 1ZQNA 1RQ0A 3A5LC 4NLZA 4NLTA 1SJ1A 4EBCA 3M6UA 4M8LA 2X3DA 4LR9A 1S10A 3PIPL 2NXEA 3DYAB 1RT5B 5GAGI 3BBBA 4KKOA 4DR1J 2OMLA 4KMOB 5GMKa 1NM1A 1P8ZA 5J2MB 2CZVC 5KFAA 2DITA 1J2NA 3NLCA 5HMWA 2DJWA 2OSQA 3WK4A 2KZ3A 3TFRA 4CF2A 1DLOA 3L3UA 4LREA 2ZZTA 2JEFA 3W63A 1Y00A 1BNPA 1X4AA 4CIEA 3DXKA 3D6RA 2IBOA 3HILA 3MMBB 4JD2B 4CZMA 2ZH7A 3SQ2A 2AZ1A 2W1BA 1FNMA 5C0YA 5AKHA 3CCSN 2VASA 3M1YA 4TYAA 1VQLS 4OJPA 1NDKA 1ILYA 3E1YA 2CNOB 1T6CA 2DGZA 5B0AA 1VSEA 4WWSA 2XM3A 4USJC 3WC2A 2CDQA 1QSSA 3NP5A 4OJOA 3WQUA 5HOOA 1SL2A 2JHDA 2L3MA 3GG0A 3OUYA 3W2WB 2FXUA 3HVRA 5J0TA 3ICXA 4IO8A 5F3TA 4CJ3A 8ICLA 2FC9A 2BE2A 2IM3A 5HK4A 2W54A 3M8ZA 4K4VA 2H3EB 1H0HB 5B0DA 2E44A 1HNXJ 2LSNA 3FQLA 4M9LA 5J2GA 4G1QB 4NRTA 1APSA 1KQKA 3DOKB 2ZJ8A 3CVKA 4GO7X 2DR5A 3CJ1A 3HOSA 3AD8C 7AT1B 3MK6A 4EP4A 2VA2A 2QGFB 3R3LA 3UCUP 4KHWA 3TA0A 4ZHRB 4IO1A 5AM0A 2OD6A 1RBUA 3TJAA 3C46A 4ACOA 4EK2A 4TSXA 2VG7B 4BGAA 3QZ8A 1N33J 3LPUA 4LFCK 1R8BA 3MBYA 3G6YA 3GLJA 4OHZA 2A3JA 1RXOB 1QHTA 1EAYC 3UMBA 5F8NA 2GMLA 3NUQA 5F8HA 7ICPA 2KICA 3DFEA 4ZITA 1LWEB 3C19A 4R25A 1UA1A 4DJBA 1HWKA 1XQIA 3CC7N 4BRNA 2FBTA 4KRFA 4DV2J 2Z2YB 4HUEA 1MROA 2ZHOA 2YNFB 3F56A 4LF8F 1XN9A 1YRTA 2FZGB 3TP2A 4BRDA 4WU3A 4LRFA 4C3MA 4EEYA 1ZPVA 2P9NA 4CZEA 2E5SA 1RFQA 2NRWA 2VG6A 4RW4A 2VWBA 5L39A 3PW7A 3CCLN 1SXEA 1XO0A 4YS2A 4ITSA 2UUWA 2DRBA 5AI8A 4CF1A 4CFDA 4LQ9A 3O9RA 2ZIWA 2EXUA 3TR8A 2JRZA 1HBNA 2VF3A 5J1NA 3ETOA 2PSZA 3IUCA 2KG5A 4X65F 3IBPA 3DN9A 2J0SD 4P71A 5LXYA 2KD1A 1NAQA 5J1EB 2RVJA 5HRNA 3QU2A 3D0IE 2R9LA 1X5TA 2Y1IA 5J0SA 3AD9C 3N6MA 4M0AA 3VAMA 2DFFA 3BJYA 2KRBA 1BQNA 3ZDBA 1P8GA 3CE8A 3E9LA 3NHGA 2JH3A 2BKPA 2YNIA 3DKDA 3SYZA 2ESEA 1BWVA 2XY5A 4ED1A 1A5VA 3W8PA 3LO3A 3CO9A 3ISND 9ICWA 2EVZA 1ITGA 4BROA 4ATNA 2ALZA 3ENOA 3DC2A 1U6ZA 3LDPA 4BRFA 4XH5A 1N2XA 1NOZA 1XMQF 5MLCQ 3CCTA 4CIGA 4I68A 2DHGA 3PJ9A 2FIUA 2ZIXB 5KL8B 2F2AB 1KRPA 2M52A 1BG3A 1G15A 3QNWB 4M5MA 3R9LA 4ANCA 2BM0A 4QIWD 2QARB 2IJRA 3NGUA 2LPEA 1SS6A 3KZIU 5F3XB 4LSNA 4EI2A 2VPXB 1RTIB 4DUZJ 4Z7CA 5JVHQ 3T5LA 1L3KA 4FPAA 5ALNA 5KNIA 4OI0A 4A8EA 2I6XA 4PJ0U 2OSRA 4OLPA 1RHUB 1TKTA 3JPOA 3R8YA 1ZQCA 4KH1B 1KC8O 1CLQA 4OJLA 3OR1A 3HO1A 3P83D 4G6VB 3PCOB 3VAKA 5M1OA 3I96A 3WZ0A 2W6KA 4H4MB 4ED7A 3IN5A 4WQ5A 2VC0A 1C4CA 3RW6A 3QEIA 2VDHA 3R6GB 3UDCA 1RT4B 3O2IA 2IM0A 3WQPA 3NFAA 4BACA 4EO6A 4HL9A 3QU5A 1R43A 3TAGA 2HFZA 1RXWA 3SCKE 5CR0A 3A8YA 3SR6A 4CGFA 2H3GX 3I8DA 4ELTA 1SB3C 1IQTA 3VTHA 5J2HA 1YJNS 2HHHF 7ICMA 3ADAC 3TZXA 3BEXA 1NSAA 9RUBA 5K20B 4TQRA 3CJ4A 4AHRA 5B5EU 4G1IA 3DOMB 5AIBA 1EJ7L 5G0RB 1I94F 1R89A 1TE2A 1KBRA 2OPSA 4FJHA 2GC8A 3RRKA 5K9FA 2ZOGA 3KIOA 4NASA 2CYYA 4MIBA 4LVNP 4Y2TA 1VRTA 2DHXA 3UXOA 5IFMA 1H7WA 4ELUA 4DUYJ 2IGIA 4O8UA 3FK4A 1SXDA 3TVZA 2BE9B 3BSOA 5I3QA 3TAMA 5HHIA 4N47A 3C5GA 3VAGA 3BDPA 1NGEA 3MR2A 3W2WA 1WAJA 1VSLA 4ILHA 5AXLA 2DD8S 5KFSA 2J8AA 3WNEA 2JWKA 4KI6A 4Y34A 1ZQIA 2QB1A 2ZE2A 1X9MA 4BDPA 3KK3A 4F72A 1RWVB 1K0VA 3PEJA 3DMJA 5B0EA 2PXIA 3FJ2A 5AKKA 2CQGA 3QWUA 4PHPA 4U7CA 4IDKA 4DR6F 3QESA 1WDDA 3CM5A 3GWCA 5KG2A 2O1PA 2FY1A 3AAPA 4M63A 1RPLA 4Q8EA 4WQ5C 5HO4A 5ALEA 2PEHA 1S0VA 2VQEJ 8ICVA 1EQYA 4DL4A 2LYHA 4BXOA 3BS9A 5D3GB 3LZJA 2H3FA 3H6EA 4LY7A 3HF5A 4P0PA 2C3OA 2F4VJ 1S76D 4CF3A 1QQNA 4PUOA 4Y2SA 3IWLA 2ZHAA 4J9LA 1DY3A 3QXGA 4NLBA 4CHZA 1Q16B 4FJKA 4OYMA 4UOCA 5GTIU 3CMEN 4NCAA 3NDKA 2RPIA 1U1KA 2HNDA 2HG4A 3TR5A 4OJRA 1PBUA 3LDQA 1T6DA 4A59A 1AQ6A 1ZD5A 3GDQA 2I9SA 3TU5A 3KD3A 2QO3A 4OCZA 2HVEA 2E5LK 3PM9A 3QU9A 1E6YB 4I2DA 3HP6A 1T3OA 1V3SA 4RU2A 4JI1J 3A5NC 3RJGA 5I42B 4E7HA 4B6JA 4B3RF 5GAEI 5ADXA 4DU7A 2K1RB 2YKNA 4CZKA 4BC5A 1Q9XA 2YB4A 4PWUA 4OJ1A 4X4TA 1F44A 4K4HA 1S1TA 5E2QA 1QDUB 2MPUA 1JNRB 2FLLA 4CT9A 2H5XA 3MC1A 3RB0A 1REVB 4ZK7M 4OHYA 1E3MA 3HKWA 3B6OA 3FBFA 4JI8F 4CO3A 1TFWA 4QPXA 3PHTA 1VQ6S 4DR7J 2W4PA 4NE9C 2ZUGA 4A8WA 2ZVIA 2HQ3A 2IFXA 2D7SA 4HT7A 4IJNA 4CERA 1NDPA 3MR6A 3MXHP 5CH7B 5KT5A 3OW2R 2XSJB 1IBMF 4F5PA 4AQYF 4KTZA 1L5UA 3ENQA 4F4YA 1RCXB 2BOAA 2OKQA 2FVPA 1I6JA 3MMAB 3I87A 4IUFA 3TSUA 3K2PA 2I7PA 4DOAA 3I31A 4J2AA 4KLEA 2CG8A 5HBMB 2CRXA 5KFJA 3HJVA 3C21A 1Q82O 1B64A 3VETA 2V0NA 3AAQA 3QPIA 2E2QA 2W2NP 4CBUA 1KVAA 4GW6A 4UB3A 3ZSZA 3R9KA 3SQ0A 5IS2A 1M1KT 1NZPA 1GLEG 2YPZA 3Q8QB 3R7BB 4DV4K 4WF9Q 1VLBA 1UWBB 2OEKA 2MLZA 2HQDA 5E84A 3ISBA 1RG6A 2D0PA 3FE1A 4PQUB 4I2IA 3VPZA 2V67A 4M9GA 2V8HA 1S1XB 3TWZA 4WKRA 4IOCQ 4O5EA 4NLPA 2RE2A 3H8WA 3UM9A 2V69A 3MOJB 5CA7A 5BRHA 2WTFA 2CQIA 2RU9A 4L75A 3CJKA 6FD1A 2ZKTA 4DCOB 1QZ6A 3AV9A 2W3RA 3BEGB 3BS7A 4L74A 4ES1A 5GADP 4DR1K 4F4ZA 3SCLE 3U1LA 5DBAA 2CQBA 4L3KA 4XEIA 1UVIA 4M9NA 3WK5A 4OGEA 3DV9A 2XB2D 1AFIA 1EB0A 3P4UB 3MAQA 3GYNA 3D54A 3JSYA 4MLEA 5CY4A 3J7A1 3M8WA 5D4OA 1UCVA 5C2DA 1LAWA 2WTUA 4L3NA 1K9MO 3S3OA 4ZVOB 1MWMA 4I2HA 4I27A 3SQ1A 2P5OA 4OPHA 3D2FB 1ZZFA 4W4MA 2Y9HA 1NK5A 5EN1A 4JYAF 1HNWK 1GLAG 2NYVA 4FJXA 4ED2A 3VEVA 5AQJA 3A0IX 4GKJK 4FNHA 2F1HA 4TXSA 4IOXA 2R4FA 3WKCA 4CGHA 3C65A 5FDLA 3OXFA 5L1MA 3KNAA 2X6NA 1K47A 1SJ3P 3HHLA 4XTTA 1V5IB 1YF5L 5J0QA 4WFNL 3Q22A 4UUWA 1TMMA 2QWOA 3EKSA 1WJ9A 3QUBA 2CPHA 2B56A 5AM2A 5B0CA 1NK0A 9ICJA 2XZDB 2R7RA 1Q81T 1CLFA 1QE1A 4OLAA 3G4SS 5F8LA 3ZT2A 2D9PA 4DCJB 3OA9A 4J7CA 3DLLL 4KRWA 2JWLA 3RRHA 5IIOA 3L0QA 3NH1A 4BE0A 3FC4A 5FRMA 3BY5A 3OR2B 1EHWA 1NI3A 3QUQA 1KAYA 3UCZP 3NNCA 1URNA 4RQ6A 4Y00A 2BQUA 1YZ7A 4ILMA 1BCOA 4FPRA 5M2UA 1BU6O 4FBTA 4ZVEA 1U24A 1KVKA 2XMKA 3GR0A 4LT6A 3NCQA 2CPZA 5SUHA 3GTYX 4CLLA 2EQYA 2LEPA 3J7AP 4DOCA 2HBMA 3FKBA 2ASOA 5D0HA 1AYEA 3MECB 3UD5A 3UVJB 5J0XA 1ZQSA 4PG7A 4LFCF 1WACA 2BYCA 3KK2A 4ZIWA 2GW8A 1OPIA 3GIMA 4HVJA 1NMEB 3FVYA 1IWGA 1VQ9N 3E51A 1UVMA 4C3LA 2H51B 3T7ZA 2ZH6A 4QIWC 1J2VA 3KKRA 4KT0C 4DN0A 1VSMA 1KSPA 2CPDA 2Z2ZA 3M1VA 4GMKA 4K2JA 4DSIA 1RTZA 2CPJA 4HYKA 1XK8A 3BO4A 1FJGF 4QZBA 3O8MA 4FWQA 1FRKA 2F44A 3KMQA 1YJWS 1EX8A 4MYTA 4P72A 4UAVA 4NZ0A 3AVMA 3RMCA 4WZMA 2HVHA 3KDOA 2P9CA 5KAKA 4BC9A 1J97A 1S9EA 4B3SJ 3FNNA 2HLUA 3CCSS 4GIBA 4K50A 4IR1A 3PIOL 5HSPA 4G9ZA 1F9HA 3UD4P 2DO4A 3M30B 2HVZA 4FYYB 1ZQPA 2VUGA 3OT9A 2AA4A 3S41A 2Y9TA 3CD5A 4B1XB 4KPYA 3M8SA 1VBYA 2W03A 3L4PA 2X1GA 4BDZA 4LF9F 3K8WA 5AI4A 3O9SA 2BJDA 2EKNA 1DTQB 2WAQD 1X9WA 5C42A 4GXKA 2ZBCA 3G25A 4LSZB 2UUBF 3TABA 4CH1A 1RDRA 3SAFA 1XNQJ 2DY1A 5B08A 1VC5A 3FBCA 2CAJA 4RNOA 3EZWA 3CDWA 2K4EA 1WG8A 4P2HA 4JWMA 3O1LA 4MQ3A 1R6VA 3K57A 3ZETA 2K4HA 1VSKA 2E2OA 4AHSA 1K0TA 2WB1D 1Q18A 3O8WA 1WCNA 4ENOA 5KT7A 1C0TA 1NPKA 2GHVC 1IUJA 4F4KA 4O3MA 1OPZA 2V2QA 4C1NK 3T19A 2N4DA 5J2QB 3VQ8A 1SGGA 3L5KA 1PZNA 2YKMB 2XMMA 1QTNB 4K8RA 4AT1B 2ABYA 3QEBZ 2K06A 2Q2RA 4BE2A 2V2VA 4A5BA 3D68A 1OQ3A 3POTB 3R9PA 1BPXA 3QGPA 4HTLA 3M7VA 1P9YA 4AUKA 3ZZOA 3SENA 3KJQB 4DS4A 2XZTB 3PACA 1X9SA 4M3XA 4H5WA 4CBWA 4RQ4A 1JL1A 2BJ9A 2NR0A 4PPZA 4DV4J 3PYEA 3R2DJ 3OLBA 2XLIA 1SV4A 4NXZA 3AXKA 1T3NA 3A5MC 1R8PA 3FEZA 4L6V3 4CT8A 1FXLA 2Y8WA 4ZJQA 4JKGA 3B0YA 2B6AB 5HR6A 3H1QA 4UBCA 3QJJA 1YJTA 1WI6A 4JHDA 4CFBA 2RF2B 2XQCA 2RQ4A 1CZBA 4YD1A 3LP1B 3OYCA 4KC5A 4WFBL 5L1LA 2E5LJ 3EGZA 5H9FK 5KFQA 2HZCA 4Q0BA 3IM1A 3U3GA 1OH6A 4Q44A 1U1RA 2XTJP 1NMNA 3JPSA 2R2TA 4DTXA 3GB0A 5LXRA 4X64F 1ZXIA 4KLFA 3MOZA 3AA4A 1Q8IA 1BNOA 5KG0A 2IOCA 1NRKA 1YJ9S 1N5QA 2CH5A 2R7UA 2B5JA 3L4QA 3EZ5A 4QZ9A 2HVDA 4ZMMA 2YHXA 3FYHA 3FCWA 2G5IB 2QMXA 3VQQA 3JAMU 5HJYA 1ZH5A 2FJXA 4O4RA 2ZTCA 1N56A 5J2CA 1QAYA 1Z4UA 4H0OA 1Q9YA 4P4PA 3THWB 3TADA 4Y0WA 4CESA 1ASVA 1YAGA 3T1HK 3H45C 4ED6A 4DWIA 3G82A 3VA3A 4TU9A 4Q5VA 1KP6A 1LW0A 4ZCLA 1N5WA 1SC1B 2KT2A 2GHPA 1A77A 4ZVGA 2V4JB 2UV8A 5T7BA 2Z1GA 1IBKK 5KT4A 2PC6A 4KH4A 3MTKA 1Z2ZA 4F93B 4JKBA 1XBWA 4C8YA 1IBLJ 4FK0A 4DV0K 5EX5A 3MMJA 5J2PB 2A1SA 1ZS6A 3V1OA 2E6MA 1N6QA 1FXDA 3KG4A 2AH5A 4DTSA 2V6AA 3LTOA 1R0BG 2UU9F 5THWA 4ECQA 4BRIA 5FPMA 2XWYA 1KEJA 4DR6J 2WONB 3U8XA 1EIYB 2PE8A 3ISNC 1ZQWA 1LWCA 3T9ZA 3QO9B 4GKKF 1VSJA 4CK2A 2JFDA 2YHAA 2A0FB 4RQ7A 3I55N 3C6HA 4DV5F 3VF0B 2QM1A 3RZAA 5AJ3K 3L8BA 4KITB 3DDNA 5DB7A 2N7YA 5CXTA 3T5JA 4Q2MA 1S49A 2J7KA 2VICA 2VB6A 2KVCA 5E7OB 3OYEA 2R18A 4PG4A 2DB1A 4ZVSB 3M2VA 2MKCA 4LF9K 2XHCA 1EKRA 5KOXA 4FM2A 2WBNA 5E3CA 1WUDA 4IL6U 2P51A 3N28A 2HPUA 1WSGA 1Z4NA 4E3SA 5BR8K 4YQWA 2FF6A 4N5SA 1FDBA 4Q43A 4H4MA 5IIJA 1GAOA 1VHXA 2FJEB 2BCRA 2MZ1A 3OSPA 2BH1A 4DOZA 2A19A 4I7FA 3HI0A 2YNIB 1WOQA 2DHSA 3QERA 1YI2N 2G8HA 2HHUA 2FQQB 1NGDA 1KQSR 1S6PA 4CFAA 1V6HA 1KR4A 4I2CA 2J8SA 3CIZA 2KYXA 5KRSA 2YKPA 1HR0J 2OCEA 3IO1A 4RWXA 3RBZA 3AN1A 2J6SA 2G13A 4YEAA 4B9TA 3GYGA 4K43A 2WW8A 3P38A 3FMBA 3SXLA 3SCJE 1SAZA 4MN4C 3KLGA 4CECA 1A6LA 1ZQJA 1YBAA 5D8HB 1MU2A 3Q8LA 3DRSB 2XMAA 1YGYA 4RUBA 2KIVA 2ZBRA 4DN9A 4K41A 1VQLN 2HQIA 4LVOP 1M5PC 1XS9D 4CI6A 3BN7A 1DTTB 1D9FA 2QA4N 1HNVB 3OLAA 2MUTA 2ZBPA 1URRA 2OANA 7FD1A 3UXPA 5AQZA 3OR1B 3GFZA 5IOLA 5JVGL 2DIVA 1N36J 3CB4A 2AU0A 5ALYA 3M8QA 3QFUA 3BR9A 3EDRB 3AO4A 1ASUA 2DR7A 2JRSA 4FDFA 3OFHA 2OZSA 4NZ7A 2GJIA 5KFZA 1F9EB 1T9TA 1RT4A 2OYQA 4DFPA 1MNEA 3MN6A 3RH6A 1XQSC 1HYZA 1NG9A 2G0CA 5U47A 1QQMA 2E8NA 2F1IA 3MM9B 3CCUN 4KMUA 4CDGA 3WC0A 2ZIUB 1YJRA 5A0YB 3K5LA 1EKSA 4PL8A 4BRQA 3BREA 2ZUDA 2AXTU 5KG5A 2GBZA 4FWLA 3V6JA 1DGKN 1N5YA 4GV3A 2EK6A 2KOBA 3PX6A 2QC3A 3G8SA 5IILA 4DUTA 3QJPA 2H4YB 3EVOA 4I64A 4RUCA 3QB0A 5AI0A 9ATCB 3ZT4A 3C94A 1TKZA 3GDXA 3VQAA 4LF8J 3BQTA 5K5MA 2L9WA 2WF8A 4OFZA 1S9GA 4J9RA 3K0JA 3MR5A 1NJIT 3WXIA 5KPZA 3ATVA 2DNZA 2VQFF 1R3NA 4FF2A 4ECTA 4LH4A 4JV5J 5KQ8A 2RSQA 4IKAA 1EWQA 4QZIA 5HVGA 1VQPS 2M3DA 3CCMS 3ISDA 4QWEA 4CRJA 3N6NA 2K60A 2ZH9A 3I9ZA 3DRXA 2NLWA 4DX8H 5GIOA 1ITPA 4O3NA 1RYSA 1N8RT 4IWVA 3I5AA 4WFBQ 4DR5K 1E6YA 2OPQB 4YVZA 4FZXC 1VLOA 2UXDF 3AOCA 5ALJA 3BN4A 4ZOHC 4EYIB 4I67A 1WOPA 2XNRA 2B5JB 4KGKA 2HBZB 4WKYA 1AFJA 1S1UA 2HBLA 2MEWA 3OFEA 4P2FA 4UAZA 1IIPA 4RW9A 5HROB 3RVCA 1RWUA 4K4GA 1UAXA 1BVSA 1GX6A 5CHIA 4OYAA 2NO4A 8ICIA 1RB0A 2J4RA 2RIJA 4IYQA 1DARA 2XSJA 4C98A 3P4IA 2I2YA 3EUNA 3Q8VA 2J0QD 3A0BU 5LL6Z 2UVWA 1Y5LB 2GMJA 4CJKA 2EG1A 3MPWA 4H4KA 2FVSA 4A8QA 2QEXN 2FLPA 2W4CA 3WHIA 3SV3A 1S57A 4ZLLA 5M1KA 4YOUA 3TZWA 1YLXA 2FHJA 4RUAA 3HXMA 3CCVS 5GADU 1T11A 1F5CA 2X7IA 5GMDA 2CQ0A 5BYQA 5HR7A 8ICTA 3WXMB 1MQ3A 4YUDA 2LYVA 3M6VA 4LUBA 1O8BA 2YPYA 3SFGA 4M5LA 2FYXA 3WNFA 1JJHA 1F21A 1CJTA 2NRXA 4J9UE 2PDAA 1S5JA 2ZC3A 4MKYA 3GU3A 4CH7A 3DXKB 3V4MA 1MA9B 3TYTA 5D4LA 4YNQA 8ICXA 3QBWA 4CO4A 4KHQA 4KHMA 1NKEA 2KK0A 3QEVA 1SJRA 2VONA 2QSFA 4LR8A 2EWSA 1S3XA 2VFVA 1FEZA 2AGPA 1XJWB 5LSOA 3AVKA 1GMWA 3H2LA 4RPXA 1JLFB 5AXMA 1FNXH 1I51B 2Z58B 1CULB 3CCWA 3MFHA 4NL5A 1PC5A 1T44A 4JV0A 1OVYA 2MY7A 5K4LA 2PFDA 3G96A 3SPYA 2CFXA 8ICAA 4WFAQ 1RT2B 1Q3VA 2PI4A 4OJ3A 5J2EA 4MDBA 1TMJA 1TYQA 3N7RC 2N82B 2MZSA 5A8KB 4FWPA 2UXBF 1OIAA 2YV0X 2PA8D 5HP1B 2QJ3A 2AJ2A 2ZM6F 1GOAA 4DR7F 1HQEB 2UVRA 3SCIE 3TPQA 3OTCA 4H0XB 4PR6A 5C7PA 1XI1A 1MDUB 2U1AA 3PFOA 3CCQN 3AA8A 4JK8A 1PYOB 4QW9A 1NM2A 1S1WB 3LAKA 4KV8A 5CA5A 3UE5A 2OA8A 1GLDG 4K5SA 2OPRA 4U67Q 1SWVA 3ZSRA 1S1XA 1YIJS 5KPTA 1Y3KA 1KHVA 2HHXA 4OX9J 3OW2M 1N5TA 3UR0A 4CIOA 1VHIA 3OYDA 2QTDA 4NYFA 5BR8F 2QMUB 3CC2S 4PABA 2HFVA 1RYRA 3WNHA 5BREA 1X40A 2YNFA 4BCAA 1DQ9A 1Q46A 1WSEA 2HOEA 1NNEA 2XYHB 4CHQA 4PYAA 5HMZA 8ICQA 2EC2A 4UTGA 2FF3B 2E7VA 3MN5A 1HPZB 4DR3F 2KT3A 3KWIA 2E1EA 2P9NB 5DGAA 2DNMA 5JTIA 2EH9A 2C3PA 2LMRA 3N4MB 1DXSA 3BH7B 2XNQA 4OZ5A 4DR3J 3UIQA 5IV4A 2Q4TA 3HOTA 1T4GA 4CLTA 1RTDB 1JNZB 1ZD4A 3VQSA 5M1FA 3BS5B 4QZEA 3N4WA 5DLGA 3M5RA 3M9OB 1NGBA 2GQQA 3VQ7A 3SLCA 1IV0A 1VK3A 4I9QA 2UYTA 4OZNA 4A8KA 4RW8A 3KJNB 2VJVA 3OD2A 3PSTA 1XMBA 1O0PA 1DEJA 4MAKA 2QA1A 3GU0A 2RRDA 2DGQA 1RWXB 2RRBA 3V4IB 2C3YA 4JBCA 1M90O 4CCHA 1Q86O 4M5GA 2UUBK 1IO2A 4RNNA 3A1YG 4W5NA 3GIIA 1EO1A 3AVBA 4LF4K 3J7ZT 3I56S 3ENVA 3L09A 2E20A 1RHMB 1NH7A 3JXOA 5C25B 3AD7C 1Q8BA 1OS5A 3MEDA 3DU5A 4BGBA 2KXFA 4QWDA 3MTJA 1VAZA 2CQ1A 4PPDA 2R7YA 1DK2A 2CNLB 2B43A 2L9DA 4LSNB 4KSEB 1RTIA 2HGNA 4I2FA 5B0FA 3P5TL 4KLSA 5IIKA 4OKKA 2XI9A 2CJYB 4CNZA 2HGLA 1HBOA 2C1EB 2JWNA 4C48A 1RWOB 4GC7A 4HI1A 4CZJA 1WBBA 4FZMA 1DJ0A 4GVEA 1VQSA 2IHNA 4JI4K 1JWWA 3TSPA 2MKKA 3PYFA 1YTYA 3MWPA 1H6KX 3KUGA 4XPCA 4KYZA 3OYGA 1WBDA 1MA7A 4CGJA 2A6AA 5AKZA 4BRMA 3C29A 4B3RJ 4J91A 3D7EO 1B22A 4RT2A 4FK4A 3OYAA 2KI2A 4ZCKA 4CEBA 4NI2B 4P0QA 2K4IA 2IY5B 1XU4A 3NGZA 1MN8A 3I28A 2UV8G 2GV9A 5D4PA 4IQVA 5CZ2A 1FFUA 1U6FA 5AK5A 2A3ZA 1NDCA 3VVTA 2QRRA 1U0HB 2KHCA 2IA6A 2JX2A 3RJFA 3G4SN 1KTQA 2H5JB 3POTA 2E66A 2BCQA 3SMZA 2LECA 1CJKA 4MLHA 2UUBJ 1RGVA 3G8TA 1TTHB 2PFOA 2GAHC 2OPSB 1PJ5A 5FPDA 3Q83A 4ZJLA 5A8WB 4CWBA 2GUIA 2XHBA 3H1VX 3KFWX 2AGQA 3JPPA 3ZSYA 1YJWN 3QUCA 4DL0C 3NTUA 1Y7PA 2DNPA 3QZ7A 3AODA 4YR0A 3GILA 3ZTOA 1T9UA 1COOA 2MSTA 1HYSB 3QDKA 1N60A 5D4BA 1RHRB 3WKEA 3CJ5A 1JN3A 2RF2A 4L3QA 1X5SA 4NM2A 2NRTA 4USTA 1VRUA 3FFIA 2IC3A 3HHKA 4LF2A 3BYRA 4CGGA 2P9EA 4Z4EA 1VQMN 1H73A 3NAIA 3H5YA 4E98A 5KFOA 3BR8A 1IBMK 1TV6B 1U26A 2PN6A 3HTVA 1PBAA 3HSTB 4OLBA 1W2IA 2KG1A 2A3VA 2VFSA 5M1QA 2YTCA 3QT5A 3LP2A 3PZPA 3OY9A 4WK3A 5CD4A 5A8KA 4XH1A 4I2EA 3K5OA 3MAAA 2Z1IA 3NGDA 2VZ9A 2NQPA 1HFEL 3QUTA 2C28A 1ESVA 5ALSA 3VMFB 4JI8K 4IFVB 3HX9A 5ALOA 2LEBA 1JLCA 3A8EA 2APOA 3R6LB 3K75D 4FNIA 4OI2A 4ED8A 1K44A 1RWKB 3PIOQ 2BBEA 2PGCA 1RDUA 8ICPA 3TZZA 1ZA1B 1TFRA 1Y4ZB 3VQTA 3FZKA 3RF9A 1WEZA 5GIPA 2CGJA 5CP2A 2PY5A 4EX6A 3NCPA 1D5AA 5DM7Q 5AHXA 4W92B 1N34K 4NLOA 2DQNB 3QSIA 1C1BA 4NL9C 3W9JA 4FW1A 3LP3A 3MXIA 1U9LA 3FDSA 4PZVA 4GLXA 3V6HA 7ICEA 4WP3A 1KVIA 3UMGA 9ICNA 2DNKA 4NJ8A 1G99A 4BDYA 3H0MB 1SH3A 2HBQB 1Q78A 2UXCK 1P27B 4BRKA 1JJ2R 3TQEA 4RQ1A 2ZIVB 4RW6B 2LQBA 1T3VA 2J7UA 2QLBB 4FZVA 5B8HA 3H5UA 1FFVA 4N77A 1C1AA 1D9DA 3RJJA 3OBWA 3DYAA 1X6IA 3NL0A 4TNOA 1QUPA 2FPHX 4MFFA 3CCES 4FM1A 4ISFA 2E1YA 5KFDA 5E26A 4I2AA 9ICQA 1KS2A 3C5FA 2K3IA 3C3LA 1BPBA 3PNIA 4CZIA 1UVJA 3R7SB 2F1FA 3U1MA 4DR2J 1SKRA 4NLKA 1WKLA 3MN9A 3JTNA 5T14A 2Q43A 1W9HA 2LU2A 4KLTA 4I2QB 1EP4A 4WTOB 2W25A 4QU7A 5ADZA 5G5GA 1FWLA 5AKEA 3HK2A 4J9MA 5IWAK 1CG2A 4ECWA 1UL3A 4Y1CA 2J0WA 4Z0UA 4ZVPB 1ZQXA 2J6TA 4TUSA 2XMTA 3WQTA 2ASYA 5J2KA 3AY9A 3MMAA 1C7YA 5DG7A 3FSYA 4LJXA 4UAWA 1UP1A 1N52B 2XYGB 1C0FA 2Z8QA 2KM8C 5EWEA 1H2UX 2EWHA 4DR4K 5C24B 5J2PA 2KM8B 4R66A 2V50A 2VPZB 1KAZA 4DBQA 4RQ0A 3J7ZO 2HURA 1TAMA 1CVJA 4M95A 3GE9A 4HLBA 4B1UB 1O51A 2FBXA 3D0HE 3HFKA 3I32A 1I5OB 2B4VA 2NZ4A 4IRDA 2KVQE 3LPYA 4Y1DA 2Q1NA 3EY1A 2F77X 4OQJA 4H4OB 4ZHRA 2L5YA 2WW4A 1UPMB 3O4NA 3IV6A 3WEEA 3DM2B 3JS9A 2EPIA 2LVWA 9ICRA 1NNDA 2ZG6A 4NRUA 1FJ7A 3SQIA 1CEZA 1T94A 3HKZC 1RWWB 2Z30B 2FLNA 4IBNA 1Q86T 3MDAA 2P9LB 5AXNA 5C10A 3RAXA 4U8VA 1ZQ1C 2IVNA 4RQ8A 2GEMA 3FBBA 5E3QA 3DHWC 4OI6A 4KHSA 3D4JA 3R27A 5AQPA 3PYDA 2D69A 3ZTQA 1OH8A 1MROB 3I5BA 4CNYA 2VJ4A 3TAFA 2HI0A 2B0GA 4DL5A 3CG7A 3H40A 1UFKA 2POKA 2MXYA 2DNRA 1KL9A 2UUAF 1BI4B 1V4TA 4LF9J 2W2OP 5E3PA 1G2EA 4RW4B 3BM7A 2EKYA 3ISCA 3VN5A 4M3TA 2IMWP 1HWUA 2UU9J 1JX4A 2H48B 3VAHA 1S8OA 1X4BA 2KKHA 4CYUA 3PVXA 5A0YA 4NWBA 4LF5F 2I5HA 4B3OA 1IJFB 3ILLA 2WF5A 3RMDA 4YMEA 1UVNA 3LZIA 3IM8A 3L3VA 1N5YB 1Q8KA 2X78A 1FRMA 1MU2B 3THTA 5M1NA 1WAFA 4USKA 2VCPA 4D3HA 3GSDA 4PHTX 2BKEA 3R7NB 3ASMA 2MQNA 2HHTA 4WFYA 3F0NA 1R0AB 4NO7A 3FM9A 4H4KC 4LBPA 4KB7A 2E1FA 1ZQOA 2HAIA 3FRYA 4OJGA 1P1LA 1MMDA 2B4OA 3BF1A 5FROA 4M42A 1FX4A 1ZQQA 3VEYA 2NUBA 3SJHA 2VBZA 4UARA 3VOVA 1NNLA 1NZAA 2CN1A 4GKJF 2XSFA 4OX6A 4YP3A 2A1AA 2UZAA 2ZIXA 2F1JA 3IWNC 5DDQC 4M3UA 2LYAA 3LP2B 4GV6A 2J6UA 4E1MA 4B3TK 4MF2A 3F2KA 1S22A 5AM3A 1JLCB 1X4GA 5KFXA 4GVMA 2ZF5O 3Q23A 3THYA 3ATUA 4RW9B 2N3OA 2ISPA 5L8RC 4NWIA 3D2WA 5KGXA 4E1JA 4DV6J 1F5SA 2ES6A 1MW7A 1K73T 3OYIA 3CETA 2XIDA 1HKCA 4YFKA 3VGMA 2KEYA 2BVZA 3M6WA 3QETA 1UETA 4FF4A 1Z26A 2IPOB 4WK1A 4ZPTR 3V5RA 3DXSX 4AYBF 1BMQB 3RB3A 1CI4A 2R8IA 4KX3A 2DKXA 1JLEA 2E6LA 4LZDA 4JV2A 2I8EA 4RW6A 4EWTA 4WCEQ 2FMPA 3EVWA 3MM5B 2ZVSA 1SXLA 1TAUA 4C7QA 1JCFA 1F2HA 2WC9A 3ZX0A 1UVLA 1O6XA 1D8BA 1JLBB 3J8AA 5FJ4A 4YORA 4KN4A 1FE0A 1TVRA 5ITHA 1IG8A 3TKAA 1OQ6A 1VQMS 1YBUA 4BWJA 4KLGA 2DKOB 5T41A 3CD6N 2BJ7A 4LVSA 2DNOA 1VQON 2DGUA 2ADBA 4CZGA 1N88A 3HVAA 1VC0A 4L8RB 3CNHA 1TVAA 1TUGB 3J80O 4C80A 8ICOA 1WSVA 4NB4A 5LOQA 4ILJA 1ZQBA 3IGVA 4OL8A 4U95A 5D6GA 2KIWA 4HCCA 4I6MB 1JLFA 4KH6A 4Z4IA 2OELA 2WAQC 2IA0A 2RQ5A 4QNLA 3TAMB 1QH9A 3NMAA 2KFYA 1YTUA 2B9YA 1ASWA 2BKOA 1UW9A 3IFEA 3UPQA 3QBXA 3IGNA 3QIDA 2B3TB 2EK1A 4C11B 5HAOA 3V2UC 2PI5A 5LJVA 4KHRA 1VDVA 3KHLA 1Z4OA 1NXIA 3ULDA 1WF1A 3ID6A 4C8KA 4RWWA 4CJTA 1KQFB 1NHVA 1OY8A 2QYCA 5BPNA 1TYQB 1NB7A 4Y2CA 1QVGR 1VSIA 2W9CA 2OEJA 5K14B 4M5DA 4JAXA 2V8PA 2GIFA 3SD7A 4OX8A 3AAWB 1KEKA 2QWPA 4FL9A 2PMZF 1BUXA 4DDFA 3QYYA 4DR2K 1OW5A 4USMA 1FX2A 2KRRA 3I33A 4ISEA 5AM4A 2FC8A 4IOAL 4IQTA 4I28A 3V72A 2DIUA 4RTFD 1LEOA 3LDAA 4JHDB 5KL1B 1P1TA 1ZAXA 3GYXB 4PAAA 3LP1A 1CJVB 3L7UA 2F9DA 1Q81O 1R31A 1U1OA 4ID8A 5AQMA 2IYIA 4FJ5A 1VDHA 1KW4A 3RJHA 4DPXA 2DNHA 1OO0B 4Y2RA 4F67A 4X66F 4JB8B 4JI4J 2OHFA 2YWGA 2OI2A 2MB0B 3GZ7A 1F6TA 3VF4A 2OFGX 3UO0A 4QR1A 1JXLA 3TTCA 3AQEA 1RT6B 1EQMA 1RA6A 2K1RA 3EO3A 3HSCA 2YWHA 1AUSL 2MKYA 4NXMK 2A10A 2O01C 2PEBA 1WI8A 3N5FA 4DUZK 3IDHA 5IM0A 2R3VA 5KT6A 8ICHA 1PSDA 4QZ8A 3Q0AA 3ZCMA 1F5BA 1FRXA 1GXTA 1RK8A 4NA3A 2W04A 2EG2A 2CPEA 3JB9k 1HLUA 1TELA 4MIWA 3C16A 3ILIA 4JWNA 1W0HA 3NKYA 1RAHB 1TL5A 1WG4A 1VQ6N 3GFHA 5GAHU 3QYPA 4NYZA 4UZCA 1R0AA 3FRZA 4QIWF 2M9KA 1VBZA 1IBLF 1CC8A 1WHYA 3WXKA 3ZDEA 3HP9A 2Q3PA 2PFUA 3AVFA 2G8IA 5KFKA 2D0BA 1VI7A 4BE1A 8ICYA 3JQKA 3OTOJ 2OUGA 3I4PA 2V4RA 3DLEA 2CPFA 4NYOA 4J9QA 5KG1A 2JMGA 3VGSA 4KFBA 3R5CA 2BXJA 4TYBA 2AJ4A 4JKAA 4LD0A 2L48A 3FUYA 3M9NB 2WONA 3AQOA 3CSKA 4K4TA 9ICPA 1CS4B 3M3ZA 3P5JA 5JMVA 2RKIA 2CIMA 3QGHA 3MPDA 1U7LA 3X1LB 3ZZTA 2ZUAA 4YMOA 4HUGA 4QCLA 4K4YA 1IN0A 1PK1A 2C2ZB 2HNYA 2IVOA 4M7YA 5AE2A 4WFNQ 3BGOP 5AQYA 1JLQB 3D45A 4M5NA 5FP0A 4OYXA 5LMNF 4FWNA 4P10A 4QOTA 1RTDA 4FLUA 4YN3B 3E3XA 2OFHX 4PCQA 3M8RA 2FD2A 4LQ3A 1L7PA