1NJYA

Thymine-thymine mismatch at the polymerase active site
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 214
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njyA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njyA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njyA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njyA01
1TK8A 1RT1A 4KHQA 2G8VA 5KFZA 4Z4GA 3QIOA 2XGPA 5T7BA 9ICPA 1I39A 3MABA 1UA1A 1A77A 1HRHA 4NYNA 4RQ1A 5J0QA 1NKEA 1ZQBA 3K5LA 2AQ0A 4CJSA 4AHSA 3HT3A 1BQNA 3K4GA 3RR7A 4M9HA 4O4GA 1VSFA 4LZGA 2I9GA 2W42A 4I2HA 2B21A 4QZCA 4FJKA 5KFAA 2ZJ5A 2JGUA 4ED7A 4RQ6A 4DOCA 4Q8FA 4BGDA 3QEAZ 1Q8IA 5DB7A 2BGGA 4UQGA 3B0YA 3GIIA 3N4MB 4DL5A 1X9WA 2W9CA 2JEGA 5KG7A 3H4BA 1S5JA 3NFAA 3V4IA 3SV3A 1C1AA 4Y1DA 3SQ0A 4MFCA 4H8KA 1LW2A 4FJHA 2YV0X 2HHUA 3LAMA 4N47A 3AU6A 2DPIA 5DQHA 4LH5A 1RT7A 3KHLA 4GXIA 3NF7A 4JS4A 3V6KA 1KDHA 3LAKA 3OY9A 3NH0A 1G15A 1L3VA 2IGIA 1RYRA 1U49A 4JS5A 9ICQA 5D3GA 2V4RA 4Z6DA 2XY7A 4CF1A 1MU2A 5HBMA 3MECA 1NOMA 5DG8A 3HL8A 3SQ2A 5C5JA 2E6MA 2FBXA 4KLDA 2QXFA 4DTMA 2OA8A 9ICOA 3V6JA 3P1GA 1TK5A 4KLTA 1NKCA 1QHTA 3MDAA 4OLBA 4Z6CA 4P4OA 4Z4EA 2FPMA 4AHVA 2W9CB 5KRSA 4FJJA 2I5JA 5HLFA 4TUPA 4YVZA 5J2KA 2P5OA 5KFJA 3VQEA 1RBSA 2GUIA 7ICSA 7ICNA 5IIJA 2VANA 4CFDA 3EPIA 3AVBA 3OJSA 2Y1IA 3D45A 2BKEA 1IG9A 3RB0A 3EWAA 4ZTFA 3AO2A 4FLZA 2YNHA 4CJRA 5J29A 4DTOA 3ZDAA 4UAZA 3V1QA 1T4GA 4CHNA 4J9NA 1S1UA 4JLHA 3M8QA 4FLTA 4EEYA 3HX0A 3JPPA 3T5LA 4B9LA 1B9FA 4RPYA 4EYHB 3JSMA 4DO9A 3O4NA 4EP5A 4ZHRA 4OKEA 4J9RA 5DKWA 4R63A 3HP9A 3V9WA 5J2FA 1ZQSA 1VSLA 1FXXA 3MBYA 3AA5X 4I2IA 4M3TA 5IINA 1WSIA 1ZBLA 4YR0A 8ICSA 4FYDA 4OJRA 4HCBA 4RQ7A 1ZQHA 4HUFA 1ZBFA 3C6TA 3QNNA 3KLGA 1L3UA 3T5JA 3VQCA 1C6VA 1KEJA 4QZAA 2YKNA 4DFJA 1DTTA 4O9MA 8ICAA 3V1OA 4R64A 4IBNA 1CEZA 4I2FA 2O4IA 5J2MA 1RXWA 4ECQA 1JLBA 2LYHA 4CEBA 1J54A 1U04A 1KFDA 1ZQKA 1ASVA 4M0AA 3SUQA 4E3SA 1CXQA 4JRPA 3NH2A 3EY1A 5J2CA 3PW7A 4DTXA 5DLGA 4O3RA 1ZQTA 2ZTCA 3SI6A 3FDSA 3NGIA 5DDMA 3DLHA 3Q8LA 1WN7A 5L1IA 4CK1A 4CJWA 5I3UA 3E2EA 4NLGA 3OYDA 1RDBA 4CJLA 3L2UA 5BOMA 3QETA 2A1RA 1JLGA 4KITB 4PH5A 8ICNA 2NRZA 4FJIA 4KKOA 3HO1A 4CIEA 4R8UB 2QK9A 3HP6A 3ZDBA 3PVXA 1UAXA 1JLCA 3ZT0A 2F1JA 3ZDCA 4YP3A 1C0MA 3RAXA 3GQCA 4CGIA 1BCOA 1HNIA 4NM2A 3V7JA 1NJWA 4I2GA 4DFPA 3RRHA 3RJEA 2OZMA 3PY8A 4M04A 4ZTJA 4I9QA 4ECTA 4F91B 3HPGA 5J0UA 5CHGA 3NH1A 4QZDA 3AVLA 4DLGA 4DTNA 1WSJA 8ICEA 4I2DA 5KFDA 1ZYQA 4M6WB 4DSFA 2HNYA 4LSLA 1HJPA 3NBPA 3AA4A 3TAPA 4J9KA 8ICVA 4KLIA 1WSHA 1RT3A 2AGPA 5J2JA 3OS2A 3SQ4A 1DTQA 1C0TA 2MUTB 5FROA 4I9LA 3L2QA 1NOYA 4UAWA 1NK0A 4DQPA 4FXDA 2VA2A 2ZJAA 4Z6EA 3JPQA 4F3TA 3VA3A 4DTSA 5KGWA 3RJJA 3DOKA 3UXOA 3V72A 4MEYA 4BXOB 9ICKA 3TAMA 2FMSA 4CF8A 2ZTEA 3PV8A 3H7IA 4NXZA 4R8UA 3LP2A 3AVHA 4Z4CA 4PA1A 4BACA 4UB3A 3OJUA 1N56A 4E0DA 1T7PA 1C1BA 1RTHA 4RUAA 3LWMA 1YTUA 2BQ3A 3SV4A 3TABA 3KK2A 3NDKA 5HHIA 1Z00A 8ICGA 3KIOA 2I1QA 4EZ6A 1VSDA 4C8NA 2P6UA 4J9PA 1ZQAA 4DQSA 4BXOA 1FK9A 1UWBA 4CFCA 1QS4A 5DB9A 1R0AA 2FPLA 1Z25A 2RKIA 1X2IA 3SNNA 5DDYA 3LP1A 1RT4A 4FCYA 2PXIA 4I28A 4UB5A 3V7LA 4Z0UA 4GXKA 8ICFA 5HMMA 1TGOA 2MUTA 1YVUA 4KB0A 3HVTA 2J6TA 1RYSA 4DWIA 4FLVA 4DL2A 4M3YA 5KFWA 4EZ9A 3P5JA 3ISBA 3EPGA 4CF2A 3ZSWA 3VQ6A 2E4LA 5EWGA 3K5OA 3G6XA 3RRGA 3CG7A 4DTJA 3V9ZA 3WNFA 4TSXA 3QERA 2NRWA 8ICWA 3L3VA 1JL1A 1QTMA 4BDZA 2ASLA 2R8IA 3GILA 1BI4B 2KZMA 3SCXA 4PGQA 5J0WA 3B6PA 1KVCA 4KTWA 2XC9A 4L8RB 2HHQA 3M8SA 3NGZA 3GIKA 3HSTB 4ECWA 1ZQMA 5L1JA 1NJZA 1Q9XA 3C2MA 3KKRA 3BDPA 3QEPA 4F5PA 2HVHA 3LPUA 1JL2A 3V7KA 3K75D 3JPNA 3RMDA 4BE2A 1RXVA 4FJLA 2G8IA 5J2NA 2XCAA 2DFHA 3DLEA 3KTQA 1JLAA 3OYFA 2DY4A 3RJFA 4F2SA 1DLOA 2EHGA 1IKWA 1MC8A 4JRQA 1JXLA 8ICPA 4CF0A 1BL3A 4KHSA 2W9BA 1XU4A 4PQUA 3B6OA 4QZHA 1MQ3A 3AVIA 3QEWA 4ID1A 4RW7A 4J2BA 1PZNA 3MR3A 4DS4A 4FS1A 1F21A 3PX4A 5DK5A 3LPTA 3KK1A 4QWDA 5KT2A 2C2DA 3KHHA 1HQEA 2Y1JA 1T03A 1GOCA 2W8KA 3JPSA 2ALZA 1S77D 3GV7B 5KG1A 4TQRA 5HP1A 4M9LA 1KLNA 4FK0A 1S10A 4YXJA 4DL4A 4CJ3A 3V1RA 4KHWA 3OVNA 4QZ8A 3H8WA 4IFYA 3LWLA 3MXMA 1TKZA 4B8AB 1U45A 1T3NA 1Z26A 2HNDA 4QZEA 1NOZA 3I8DA 9ICLA 2BR0A 5JS2A 1ZQZA 1O1WA 5KFMA 5E41A 4EBDA 1LB2B 2Z1GA 1RCHA 1EXQA 3EZ5A 4J9OA 4O0JA 2DFFA 2BPFA 4F5OA 1BHLA 3C23A 3MR6A 4DEZA 1IKYA 1VK0A 3ZSVA 1K6YA 3OYGA 4KB1A 3AO3A 4C8KA 3QZ7A 3QO9A 3HPHA 3OHBA 4XIUA 1U9LA 1T8EA 3ISCA 4FBTA 2ZE2A 4M9GA 4CGDA 8ICZA 3VN5A 1VRUA 4YMOA 4M3RA 3RJHA 4F3OA 1C0UA 1UOCA 3H8SA 1KCFA 1MSWD 1IM4A 2DFEA 1UA0A 1BPEA 1RTIA 3VQ9A 3MR2A 2HW3A 1GOAA 3PMNA 1VRTA 3V6DA 5KG6A 4P4PA 1QSLA 4NM1A 3NE6A 3ULDA 3ZDEA 1BPZA 4CIGA 4I7FA 1N5YA 1KSPA 2VG6A 4KREA 4E7LA 5L1KA 2VWKA 4WE1A 4IQWA 8ICRA 4CK2A 3LDAA 4NLNA 4RW8A 3PUFA 3OYLA 5CZ1A 4J2AA 3OGUA 4O5KA 4OPJA 3SUPA 3OYHA 1NKBA 4CESA 2J6UA 2P1JA 3WNGA 2FLPA 4CJTA 2C2EA 4M6WA 2RPIA 4FK2A 4KN7A 3BJYA 3BQ2A 2V4QA 4NCGA 4KLSA 4DOAA 3OSNA 2FMPA 4E7KA 3KD1E 4CEQA 4RQ3A 1CUKA 3ZD8A 4ED2A 4AHRA 4YXMA 4TUSA 4F4WA 1J9AA 4QWEA 4N76A 9ICVA 1VSJA 2BQRA 4J9SA 4ED3A 5HRNA 4CJVA 4KI4A 3ZCMA 3LK9A 1VSEA 3ISNC 5D49A 3U3GA 1CLQA 2XRIA 3P83D 2QKKA 4HUGA 5KFGA 1FKPA 3AVJA 2BGWA 5EU7A 3ZT1A 1BPXA 1CZBA 4FLYA 5EWEA 2OPRA 3MFHA 3GV8B 5D4BA 3QESA 4LY7A 5J0XA 4W5QA 3MGIA 3TAGA 4DL3A 7ICLA 5KFHA 8ICYA 2BCSA 4LZDA 1ITGA 2OZSA 4YD2A 4CGHA 3K5NA 2B6AA 3T5KA 3NF8A 2BCUA 3T19A 4I2PA 4DU1A 3BQ0A 4KLMA 3SZ2A 5DQGA 4KFBA 3UXPA 4CJ5A 1GOBA 4YMNA 1COOA 1ZQWA 3C5FA 4ECVA 2VG7A 5KG3A 9ICSA 3KK3A 4ED8A 1VSMA 4OGCA 3NAEA 4NCAA 1S97A 7ICTA 2M9NA 1NK7A 8ICCA 4C8LA 1XO1A 3TAFA 5DBBA 4RQ8A 4F50A 2W9MA 4ED1A 3QEXA 4ID5A 2PYLA 1C1CA 4KHYA 9ICWA 4DTPA 1UT5A 4K4IA 4K8ZA 1QLNA 9ICBA 3ISDA 3QZ8A 2YHBA 1TKXA 8ICQA 3BGRA 4FZZA 4W5RA 1TAUA 3C95A 5CY4A 4CE9A 5I42A 2O4GA 4MFAA 1WCNA 9ICHA 7ICHA 4CHYA 2HVIA 4O55A 2JZBA 2X74A 2D5RA 3TR8A 1RPLA 2BCVA 3OYBA 3DLRA 3NHGA 4F5RA 5KT7A 2D0AA 5KFYA 2PZSA 1C7YA 4CJFA 5DGBA 3QEIA 4RT2A 3TAEA 4QZIA 4YNQA 3QIPA 7ICVA 4OPKA 4RW9A 3QEVA 5DGAA 4QZBA 5KG2A 5JS1A 9ICEA 2P6RA 1SL0A 2JEJA 3OYNA 3SI8A 3PR5B 1ZQYA 2W9BB 4F4KA 1XSPA 1J5OA 3RR8A 4FZXC 3C6UA 1TKDA 5DLFA 3RTVA 1RNHA 1SV5A 3EW9A 2G8KA 1RT2A 3M8PA 3MDCA 3RB3A 4Z4IA 4I2AA 1ZQUA 3U6FA 3IHQB 5KFRA 4JK1A 1BPYA 2FMQA 5HNKA 3G10A 3OHAA 1L3SA 3AUOA 4PGYA 2F8SA 2HHVA 4TUQA 4AHTA 4CEZA 3PO4A 4CJEA 4DFKA 2ZUCA 4YFUA 2E6LA 5JUMA 3RJIA 4OVLA 3MEGA 4PUOA 4I2JA 3PNCA 4MF8A 5KFCA 4PHDA 1S76D 5J0RA 3L2WA 2BDPA 7ICJA 4BDPA 2ZJ8A 4EYIB 4Z4FA 4I2EA 4DL7A 3Q8PB 3EYZA 3HXMA 3DOLA 1K1SA 1BISA 1D9DA 4HVJA 3OYMA 3RH6A 4PGXA 1JLFA 3AVKA 2BANA 4CHQA 4FM1A 1RBRA 5J2BA 5F9NA 9ICUA 3F73A 4BDYA 4KLGA 3KLIA 2G8FA 3QEBZ 4QOZB 4TQSA 3ZSRA 5J2HA 1KFSA 1YT3A 3CFRA 1WSEA 3PW4A 1TVAA 3TFRA 4PHPA 1NJYA 3OYAA 3ZSQA 4H4OA 4KLEA 4HUEA 1CXUA 3V6HA 2VA8A 3LP3A 4IQUA 3ORYA 4RQ5A 4O3PA 2XY8A 4FLUA 1D9FA 3RH5A 4N5SA 4EBCA 1IH7A 3BQ1A 2IHMA 3OS1A 4M9JA 4I27A 4FVMA 4NLKA 1S0OA 1WAJA 2PFOA 1HYVA 3RJKA 2MAXA 5TZVA 1SKSA 2FPKA 5CR0A 1QQCA 4KMUA 3MAQA 4KPYA 3HW8A 4DU3A 5KFKA 1TL1A 1ZQNA 3RWUA 3Q8SB 1VSHA 4KRFA 5J0OA 4MFBA 1BIZA 1BPBA 3VQ8A 2D0CA 1BI4A 1NK5A 8ICOA 4O3QA 5CP2A 3JYTA 9ICGA 9ICNA 2ETJA 1LW0A 1X9SA 2XHBA 1TV9A 3PW0A 4IG3A 4DU4A 4CECA 5BPCA 3DI6A 3H4DA 4CCHA 1Y88A 3LZJA 2ITGA 3ZSXA 4ICLA 5HMLA 2ATQA 1NK9A 2KN7A 5HRPA 3IS9A 3UIQA 3AV9A 3CQ8A 4M3UA 3G0ZA 4Y1CA 3LZIA 3DLKA 5CWRA 3WNEA 1NJXA 3RH4A 1IXRA 4ECSA 1QE1A 4CGFA 4DQIA 4AHUA 3RMAA 3VQDA 5IIMA 2B5JA 2UVWA 4DTRA 4KLQA 1NK4A 2PY5A 3RMCA 1N6QA 1SKRA 4KLUA 3I0SA 3T5HA 3SJJA 4JWMA 4LSNA 4Q5VA 4DOBA 1S6QA 2PI5A 3IAYA 4ED0A 4FJ7A 1ZBUA 3AVGA 3H8JA 1EETA 4XUSA 4RG8A 1EKEA 2YNFA 4B8CA 8ICXA 8ICKA 3AU2A 4O3OA 3OYJA 5HRRA 2OPSA 5DMRA 1RBUA 4RNOA 3ASMA 2Z1JA 4IRCA 3UQ0A 5EOZA 1A76A 3BQTA 3VQ7A 3ALYA 2DFLA 4KAZA 3QE9Y 4O44A 3S3NA 4R5PA 4O3NA 1LWEA 2NRTA 5D46A 5DB8A 1S0VA 4UB1A 1XSLA 3H08A 4P2HA 4DSJA 4LD0A 4W5TA 8ICLA 3L8BA 4Z6FA 2PI4A 4CEFA 3Q8KA 1B22A 4CJ4A 5IIIA 2AGQA 4EBEA 3LALA 2IOCA 2W8LA 3ZT4A 4LVSA 1XHXA 8ICBA 4CHZA 5J2PA 1BQMA 2Z1IA 2ZUBA 4QCLA 1HYSA 3MGHA 3ZT2A 1S9GA 4J9MA 1HQUA 1LWCA 2HHTA 4HCCA 7ICUA 3ZD9A 4FJNA 7ICKA 4B08A 4DMNA 5KFBA 2ASJA 3O3HA 4JV1A 5FRNA 4RW6A 5J0SA 4KTQA 3NF6A 2NRVA 4DSIA 2XGQA 4CJUA 4Q8EA 3IRXA 1XSNA 1IKVA 2DTUA 3RB6A 3RBEA 4YCXA 1WLJA 5DQIA 4XQ8A 3PW5A 1RDAA 2F1HA 2LSNA 2A1SA 2KW4A 3AA2A 2B4JA 4HYKA 5KFOA 4TURA 4E19A 4FJ5A 1LAWA 1L3TA 9ICTA 2IA6A 2NRXA 4FZYA 2PFPA 4DF4A 1KTQA 2HB5A 3TI0A 4R65A 5HHHA 1NK8A 4ECUA 4B9TA 3RMBA 3K58A 3DMJA 4MFFA 5C24A 4JUZA 5KTQA 4CIFA 3C94A 3TANA 1V9PA 3V9UA 4IDKA 2WONA 1S1XA 4M47A 2RF2A 3I0RA 4I2QA 3ETLA 1JX4A 3WNHA 3VA0A 4LH4A 4QZFA 4E1MA 8ICMA 5IIKA 3JPTA 2V9WA 4B9SA 1ASUA 4KLFA 3M9NB 2A1JA 5SWMA 4CJQA 4GMJB 4UBCA 5KT5A 1LV5A 4ELUA 1S0MA 2OWOA 3TAQA 3M8RA 5KI6A 1LAVA 4UB4A 3QINA 4B9UA 4KHUA 4RZRA 7ICEA 2G8UA 2ISOA 4J9LA 4KO0A 4YD1A 1B9DA 1DOQA 2UVUA 4ELTA 3IM1A 4J2DA 4AHCA 2IHNA 5K14A 1S1VA 1A5VA 3HJFA 1L5UA 1RT5A 3OYEA 5J2GA 4F4XA 1HMVA 1J53A 1LWFA 1SL2A 1ZETA 2A1JB 5KFVA 4J2EA 9ICXA 3HPOA 4H4MA 3QNOA 1RTDA 4K4GA 5J1EA 3OSPA 5BOLA 3C1ZA 4M45A 1KFTA 3B0XA 2GV9A 1H38A 7ICIA 3THVA 3LANA 4KV8A 8ICUA 4ED6A 4FBUA 4DSLA 1KVAA 3SPZA 2KFNA 2KQ2A 5IIOA 7ICRA 1U4BA 1KLMA 4IG0A 4HHTA 3F9KA 5L1LA 3GDXA 3C21A 2PFQA 1EXNA 3KHGA 4YMMA 4F4ZA 1T05A 1TFRA 4Q44A 1U47A 2D0BA 3SUNA 4G3IA 3C1YA 3V81A 1BVSA 4AILC 3KD5E 4RU9A 4EP4A 4QZGA 1Z3EB 1MQ2A 1IO2A 4CJPA 4FJGA 2XCPA 1HPZA 2EX3A 3HVRA 1W9HA 4PHEA 1ZQXA 3U3YA 1Q9YA 5KT4A 3HK2A 4UBBA 2BPCA 2JZBB 3CM5A 4QAGA 4FM0A 7ICGA 9ICRA 2GWSA 3A2FA 3FYHA 2WTFA 3S3MA 3JPRA 1SUQA 3PX0A 1JLQA 4NCBA 1ZQRA 2IS3A 2C22A 1EP4A 3OS0A 5KFLA 2KTQA 1JXBA 4C8MA 1ZQVA 4NY8A 2ZD1A 2IDOA 4KI6A 2BQUA 3L2VA 2XY6A 4MF2A 1TVRA 2XO7A 3IG1A 1EX4A 4M3XA 1K1QA 5J0PA 4HTUA 2OYQA 5HP4A 3AO4A 4DQRA 1HNVA 3AO1A 3NF9A 2YHAA 1D5AA 5KGXA 3TARA 1SZPA 5C25A 5KG4A 1S9EA 3FFIA 5FDLA 4DLEA 4RUCA 4PHAA 3HM9A 2HHSA 3OYKA 3TQ1A 3DYAA 4BE0A 4CEDA 5HRSA 1ZQOA 2FBVA 4CGJA 7ICPA 4KN4A 4XA5A 4P4MA 3RJGA 1TL3A 1ZQDA 2P51A 4PY5A 1X9MA 4KTZA 1RILA 3RBDA 1JXEA 4DS5A 2ZTDA 1WSGA 1XS9D 1JLEA 3AVAA 4Z4HA 5KFIA 4O5BA 4IRDA 2G8HA 5KG0A 2QKBA 4FJ9A 1S6PA 3Q8MA 5KFNA 3RB4A 1BGXT 3NCIA 4JWNA 1XHZA 4ECRA 5KFTA 1ZQEA 5KFSA 5J2AA 4E1NA 2RDIA 3RAQA 3ZT3A 4QW9A 4IKFA 2ATLA 3T3FA 3KLEA 4UAYA 4CGGA 2X6NA 3KLHA 4JV2A 2KZZA 4O3SA 4KLHA 1RT6A 4E7JA 2F96A 2FBTA 5DG9A 1SKWA 4GVMA 8ICHA 3DRSA 5KFEA 2RN2A 4YR2A 1VSIA 3HYFA 3T1AA 4AH9A 1ZJNA 5J0TA 4FJ8A 3UPQA 4FW2A 3D0PA 3UQ2A 3HWTA 4K8XA 4Q0BA 3QLHA 3VQ5A 1XWLA 5KFFA 4QWCA 1AROP 2AGOA 2JEIA 2DPJA 2W9AA 4N41A 1JMSA 1Z00B 3K5MA 1ZJMA 2HHWA 3NGYA 8ICIA 4F2RA 4IQTA 4B9MA 4O5CA 1QSYA 4CF9A 4GC7A 3KLFA 4M3WA 9ICMA 4DSKA 1XI1A 2NUBA 3V9SA 2Q3SA 5DB6A 1HUOA 2BCQA 4DQQA 3CYMA 1NK6A 3H40A 5CYMA 3CFPA 1ZBHA 1TAQA 2H5XA 4RQ4A 4I29A 3GIJA 4ELVA 4XRHA 3S3OA 3K57A 5KFPA 5KT6A 3DLBA 2IC3A 3MXIA 2FBYA 2G8WA 1RZTA 4CK3A 5F9LA 2AJQA 3MFIA 4BWMA 4PPXA 2HHXA 1X1PA 4QW8A 2WOMA 4M9NA 4IR1A 1ZQCA 2YKMA 5CA7A 3K2PA 1HUZA 4GLXA 5KFQA 1WNSA 5KFXA 5KFUA 1RBTA 3KKSA 4M3ZA 4YN4A 3V9XA 4QWAA 2VG5A 2C2RA 8ICJA 4RQ0A 1BIUA 2F1IA 1ZQPA 3DRPA 5J0YA 4I2CA 4FW1A 3O4QA 3NGDA 4M41A 4GC6A 3MR5A 1A5WA 1CZ9A 1RDCA 4F5QA 1WSFA 2R7YA 4CFAA 5SZTA 2RDJA 3ZDDA 2Z1HA 4FJXA 2C28A 4QWBA 4KLOA 1W0HA 1YTAA 4M42A 2IMWP 1N48A 3AVFA 4J9QA 3PW2A 4CHOA 7ICFA 4IFVA 3CM6A 1SL1A 1HYZA 1D8YA 3AVMA 1I3AA 3N97B 4F92B 5DG7A 1B92A 2R8JA 3S9HA 3G6YA 3AO5A 4FLXA 4YQWA 4CHPA 4OLAA 4NLZA 4B3OA 4ECXA 3CFOA 3M9MB 3PMLA 3GIMA 4RT3A 1VSKA 4ECYA 4CJKA 2HNZA 3JPOA 3VQ4A 8ICTA 2UVRA 1ZQIA 3KJVA 9ICCA 3AVCA 4IR9A 3SPYA 2JEFA 1U48A 5J2DA 4FO6A 2AU0A 7ICQA 1BCMA 4O0IA 4E7HA 5J2EA 2FLNA 2PYJA 4E89A 1KRPA 4N56A 2X6SA 1TK0A 3ZSOA 4GW6A 3SUOA 2YNGA 3L3UA 5DBCA 9ICIA 1S0NA 2OPPA 5CYQA 4DL6A 3OYIA 2ZQBA 4NYFA 3C2LA 3MEEA 4YG2A 2VA3A 2XY5A 4ECZA 3ZSYA 3C2KA 1UT8A 4RQ2A 3PX6A 3SQ1A 3L2RA 1S1WA 9ICAA 3VQAA 4RW4A 3M9OB 4FM2A 2P5GA 2R8KA 4DF8A 5CZ2A 3TWHA 2ISPA 1RTJA 4IRKA 3E01A 1ZQJA 3O3GA 2ZUDA 4CEOA 2KFZA 4PWDA 4KHNA 2IAJA 4OKKA 1S9FA 1JN3A 2P66A 4JV0A 2BHNA 2R8GA 3VQBA 2KZ3A 3PO5A 4R66A 4DTUA 3AVNA 1TKTA 1WAFA 1ZBIA 2FLLA 4RPXA 2ASDA 5KT3A 4RNNA 4O5EA 1RBVA 4Q45A 2YNIA 3VQPA 3GFKB 4F93B 3GV5B 3OYCA 4CFBA 4QZ9A 7ICMA 2AQ4A 3NTUA 4K4HA 5KRTA 4DSEA 1A5XA 4X5VA 3ITHA 4IQVA 2J6SA 9ICJA 3LP0A 4KLJA 2JLEA 1FKOA 4GXJA 1S1TA 4DFMA 2PFNA 4M2YA 4OKJA 3KHRA 5L9XA 3TFSA 4FS2A 2BPGA 4B9VA 2FC0A 4MEXA 5CB1A 2UVVA 4FJMA 4ZH4A 1KVBA 1D8LA 1ASWA 1JIHA 9ICFA 4FLWA 1ZQGA 2VWJA 4MQ3A 2Q0ZX 1JKHA 4CEAA 4RPZA 4UB2A 4F4YA 5DBAA 4CERA 3SYZA 3ZSZA 1ZQLA 2HMIA 3DM2A 1DGSA 5C42A 5J2IA 4CEEA 4OGEA 3O3FA 2F8TA 5KG5A 4G1QA 4W5OA 1HJRA 4Q43A 3AA3A 4KLLA 2BCRA 5EWFA 4BWJA 2R8HA 2X78A 4YFKA 4I2BA 3G6VA 3MEDA 3Q8QB 4B9NA 2OPQA 3PR4A 4W5NA 1REVA 3DLGA 5HROA 3Q8RB 3MXJA 4E7IA 5IILA 1TV6A 2BE2A 1RDDA 2IBKA 1XC9A 2GBZA 1B43A 3K59A 3VQQA 4RNMA 5J2QA 3LDSA 5CJ7A 3DRRA 5FRMA 1BPDA 1WCLA 3UXNA 4FK4A 1ZQQA 4YR3A 1IKXA 4F8RA 1ZQFA 4C8OA 4DG1A 3C5GA 4BE1A 1QSSA 7ICOA 4F5NA 1Y97A
chains in the Genus database with same CATH superfamily
1TK8A 5KFZA 1VQ4N 9ICPA 2QSWA 1I39A 5AK6A 3ZZPA 1A77A 4NYNA 4RQ1A 5J0QA 1JLGB 4JKFA 4DCPB 2DGUA 2KP7A 2CPZA 1ZQBA 1W25A 2JFDA 3F53A 2XYGB 3MM6B 1BQNA 3K4GA 3MMAB 3IM8A 4M9HA 1VSFA 2Q0RA 2I9GA 3IGNA 1HWLA 2W42A 5HR7A 5CYQB 4I2HA 2GCFA 4FJKA 2JGUA 1YVFA 2M70A 3ILIA 4Q8FA 2UUWA 2KKVA 4W98A 7FDRA 1Q8IA 4NL5A 2E9RX 2HHHF 3KK3B 2QA4N 3P5TL 1YDLA 2P9PA 3H4BA 1FFGB 1S5JA 3MWPA 3G9CA 2CIMA 1UWBB 5ALIA 3LUYA 3GBTA 4H8KA 3JTPA 5A76A 1FXRA 1M5OC 1HIWA 2HHUA 4N47A 4J90A 2DPIA 4LH5A 1HFEL 3GSIA 1RT7A 2RSQA 5LOQA 5C42B 4HT7A 3NF7A 2CG4A 5D3GB 3OY9A 3NH0A 2OTJS 1RYRA 1QAXA 4JS5A 9ICQA 1DBDA 3DDHA 4Z6DA 4B3SF 2NR0A 2F8KA 1AFIA 4CQ1A 2Q6BA 1MU2A 1FIQA 5HBMA 4XPCA 1EQ0A 3HL8A 3NOCA 2W2MP 3O9RA 2JC0A 4LF7K 4KLDA 1V5VA 4DTMA 3BGFA 3HZGA 2WVCA 1UEKA 4NXNK 4KLTA 3J7YP 4OLBA 2XLIA 4I68A 3A1YG 3WT0A 4AHVA 1QUVA 5A8KA 4NMXA 2W9CB 5KRSA 2KKPA 2LXFA 3CJBA 2IOHA 4TUPA 4YVZA 4EX7A 3S7RA 5JRTA 3ATVA 3RW6A 2GUIA 7ICNA 2EZYA 5IIJA 3I31A 2X1BA 3BYPA 2O8FB 3EPIA 4RTFD 2M88A 5HQMA 1VQNN 4K4SA 2W7AA 4QQBA 4KH6A 3CT9A 3D6MB 4PXEA 3DDNA 5J29A 4OD0A 5IT0A 3ZDAA 4DTOA 1N33F 1X4EA 1QZ6A 1FEZA 4FLTA 4F02A 3H5YA 1B9FA 3KG4A 1RWNB 2V2ZA 4DO9A 2BTFA 2W7OA 3RJMB 4ZHRA 2XMVA 1U0HA 4R63A 5IT9U 4NE9C 4K2JA 1ZQSA 2A3JA 3GOIA 1AB8A 4DR1J 1FXXA 3H5SA 3LYSA 2RRDA 2WB1F 3AA5X 2XMKA 2E8MA 4O8UA 1WSIA 1ZBLA 3VV2B 4IO8A 4OJRA 4WK1A 4HCBA 3CCZA 4DKWA 3VQSA 2L08A 1HQ2A 3MM5B 3KLGA 3T5JA 3GG1A 4QZAA 3C15A 2UUCF 2IYGA 5AQWA 4WF9L 3OTDA 4PUOB 2PN6A 3MGVA 4O9MA 4ILHA 3KJVB 3FKBA 1LNQA 2O4IA 2Q3PA 4ECQA 2QC3A 2O8FA 1JLBA 3NVWA 1UMJA 1J54A 1QD1A 4U8YA 1KFDA 2P9LA 4K8RA 3SUQA 1FFVA 3MAAA 1CXQA 2DY9A 4A46A 3MMJA 5J2CA 5LL6d 4I1TA 4CZFA 4RR5A 3OBYA 4O3RA 1Q82O 4Y2IA 1V85A 2QL9B 2VIXA 1GLAG 4ISEA 4CK1A 4CJWA 1VQ6N 1H74A 1RDUA 3M5RA 4CJLA 3L2UA 1GLCG 5ITHA 1S12A 2MQ8A 1KOOA 2CH6A 2GHVC 1OQ3A 3QETA 2QYCA 4KITB 4Z37A 1GLLO 4LF9J 2BUNA 3BGUA 5GMEA 1K8AO 5HR6A 1PYSB 4CT9A 3NGSA 4CIEA 4R8UB 4JI7K 4C4RA 3HP6A 2NPFA 3A5OC 1JLCA 4USJC 3ZDCA 2MMYA 4LRFA 1C0MA 5M1FA 1YJWS 5JLHA 2JNJA 2DTJA 3I76A 3F2KA 1UW4A 4DFPA 1Z2ZA 2F4VF 3D2NA 1F6TA 2KO1A 1CJTB 2B4PA 4DLGA 1SC4B 2XMWA 1CVJA 1NU0A 4PZOA 3U1LA 1N62A 1FW6A 2FF3B 3IP0A 2F65A 1F9FA 3MDFA 1ZTTA 3E1YA 2ZUAA 3NBPA 4BRQA 2VV5A 2Q66A 2ZOFA 8ICVA 5F1XA 4PWUA 5E3QA 1ECWA 1X4HA 3P4UB 4Y0FA 1OIAA 1DTQA 1C0TA 4O4RA 4FWRA 4H5RA 4AT1B 3D3BJ 5IWAF 4BUGA 5HMXA 2O8CB 2XHWA 4Z6EA 1WORA 5KGWA 3RJJA 3DOKA 4BXOB 2MYFA 4DUYF 4BQLA 1WYGA 2FMSA 1FHTA 3MCMA 2EWSA 3OFGA 4CT8A 3H7IA 4NXZA 4R8UA 3AVHA 4WJ3B 4B3SK 1GMUA 1F1BB 3OJUA 5GADU 1M5SA 1T7PA 1C1BA 1TKXB 2G06A 3NL0A 4C1NI 1NJIO 2CQGA 4P74A 4ZCMA 4ANEA 3M2RB 4X4VA 1O6XA 4NEYA 1OW5A 1VSDA 2J9DE 2VONA 1R27B 3G87A 3ZX2A 3CJCA 1Z25A 2BRKA 2F7VA 3LP1A 1QDUB 4FCYA 4I28A 4C7YA 4Z0UA 4HI1A 1YIJS 4X4NA 3I28A 3SQIA 1YVUA 2ILZA 2J6TA 2XG8A 2HMIB 2WZ1A 4LFCF 1UZHA 1HHTP 3FEYB 4DWIA 2DR6A 2MLZA 2CQHA 3AOCA 3IA0A 1MWYA 4G1QB 4EAHD 2OTJN 2GQQA 4CF2A 2ES6A 5EWGA 1CJUB 1WHWA 2DO4A 2XQCA 4DTJA 3UNYA 1REGX 1NBEB 4YOUA 1PVRA 2LQBA 2K7JA 4ED5A 3SCXA 2FZKB 5E33A 5J0WA 2BX6A 4RX6A 4QIWC 1SJ1A 1F0XA 3PRDA 4QU6A 1GTEA 3N6LA 4DV0J 3QEPA 4XDDA 3OD2A 2EZZA 2FJWA 4OHVA 4AXIA 4UATA 2HVHA 4WIQA 2M52A 3V7KA 3MGJA 2EAPA 3RMDA 2ZIUB 2OHDA 4RW7B 3E9OA 1OKJA 1K73T 2XCAA 4K2XA 2DFHA 3LDOA 2MQOA 3OYFA 2HBJA 4UTGA 2JFKA 3FRZA 4PL8A 2E8NA 1EP4B 1VOMA 3RJFA 4ZN3A 3LM2A 1SXDA 2H3FA 1MC8A 2FHJA 5GAEP 4JRQA 3JAMU 3K9KA 1BL3A 3QFUA 1Q82T 2IVYA 1XU4A 4QZHA 4ID1A 1VQMS 3MR3A 2Q2RA 2D6FC 2E7XA 2J9DA 5KOXA 1F21A 4H4MB 1YHQS 4DV4K 4OZ2A 2CQ2A 2FY8A 2FJBB 2AF6A 5G0RB 5AI5A 1UPPA 2F77X 3QSYB 5D4LA 4HAIA 1I5OB 3HJVA 1S77D 2ABYA 7AT1B 4TQRA 1KLNA 3Q0AA 2BZ2A 4CH7A 5M1KA 1VQ7N 1S10A 2HRTA 1ZC6A 3VAIA 3M6XA 4OJHA 4P10A 4CJ3A 5G4DA 3H8WA 4IDKB 4IFYA 3LWLA 4B8AB 1T3NA 1RAGB 3ZX0A 4EK2A 1NOZA 1J5OB 1DK3A 4OX9F 9ICLA 4C9DA 5JS2A 5KFMA 5E41A 2E1ZA 4QZVB 4BRFA 3N28A 3CC7S 2L41A 3K8WA 2DFFA 5AI9A 1BHLA 3C23A 3N0VA 5LSLA 1IKYA 5F3XB 4QS7A 4KB1A 1UVIA 4B3MF 1EO1A 4WYWA 4CO2A 4H5WA 2UUBJ 3QO9A 3A3OB 4X62K 3RSEB 3W0LA 1TKTB 2XI2A 3P39A 1HBOA 8ICZA 2GHPA 3IKMA 4WZMA 5M2UA 3NVZA 4ID8A 1MSWD 5AQVA 5FPDA 3KYLA 2HW3A 1GOAA 1VRTA 2E5LK 3NE6A 3AGRA 2WTUA 4FF3A 2HF3A 3UVJA 1KL9A 3TSQA 1N5YA 3BEGB 1KSPA 5DS7A 5TKWA 1W2BM 2MRLA 4OHZA 4KREA 1X66A 2IA0A 2ZNZA 2VHGA 2VQEF 4CK2A 1GFWB 3ZETB 1TAMA 1UVLA 1IIPA 3L7UA 3WUHA 3RGIA 4IKAA 1S9GB 3WC0A 2CFXA 2PDAA 2P1JA 1TFWA 3W62A 3B8HA 1Z4OA 3AXKA 2CZ4A 4M6WA 2IC3B 2RPIA 5AQFA 3CD6N 3HD2A 3CJ8A 4NCGA 3BQ2A 2Y0BB 3AODA 4W4MA 2H3VA 4RQ3A 3TA2A 4IYQA 3KLHB 2DIUA 3ZD8A 2E9TA 1OH7A 1J9AA 2CPJA 2BQRA 1TUWA 1W2BR 1Q7LB 1FF2A 3J8AA 1S72N 3U3GA 4BG9A 4OZJA 5KFGA 5ETTA 3DM2B 2BGWA 3ZT1A 1X4FA 1FA0A 4CO3A 3GE9A 5LJVA 3HI9A 3MFHA 4CWBA 4TN2A 1E6VA 3GV8B 4DR7F 4LY7A 5BPNA 3MD3A 2FXUA 2DVIA 3BBBA 1ZA2B 4OYIA 4W5QA 5CR4A 5M2PA 3SQGA 4JV5F 2BCSA 3UPFA 3VC8A 3Q89A 4LZDA 1Y5IB 5EE3A 1RKIA 3QJLA 2G5IB 2BCUA 1F0MA 4I2PA 4E8UA 1J5EJ 1GTHA 2U1AA 1CG2A 3AXMA 1BA0A 4CJ5A 4WK3A 5GADP 3AMZA 3I5CA 1O8BA 2DCUB 1ZQ1C 4ECVA 2VG7A 2HBZB 3KK3A 3OLBA 3HD1A 4OYMA 1OWXA 4QYZJ 1VQPS 2EPIA 5AI8A 1S97A 7ICTA 3NS6A 3CCLS 3MXHP 1C0TB 2M9NA 4JBCA 1NK7A 2GW8A 2E5LF 2XS7A 4W92B 3PIOL 2P9IB 5DBBA 2QZ8A 1WACA 3LF0A 4ID5A 4YOTA 1U1QA 4A8KA 2JLGA 4KHYA 5C25B 2YJEA 3GJTB 4DTPA 2K8CB 3MMAA 2C3UA 4K8ZA 1QLNA 4Y2XA 1FNOA 2YHBA 2CQ0A 1IJFB 3SXLA 3EVWA 4YDUA 1TAUA 3C95A 4IJAA 1WCNA 2VPWB 3R6GB 2GO7A 7ICHA 2UV8G 3ZLJA 5K9FA 1G99A 1L7NA 5AJ3F 2LDYA 2ACMA 3TR8A 3OYBA 3NHGA 4A48A 5GVQA 3DOKB 2PZSA 1C7YA 4CJFA 3MWTA 2LKZA 5I3QA 1GMWA 2P5VA 3HFZB 2NLWA 4QZIA 4YNQA 7ICVA 4QZBA 1QE1B 3DKDA 4FOEA 4X66F 1UJ4A 1RU1A 3DU6A 5DDPC 1KP6A 2XEXA 2MPUA 4KBIA 2W9BB 1XSPA 1EWQA 1PAEX 2IPOB 3TJ9A 2UXBJ 3F5TA 1FO4A 2G8KA 2HBKA 4ZS6A 1SBRA 4DMZA 4Y2YA 3J81U 4CLWA 1PBUA 4Z7YA 2NUHA 3O5BA 2QGFB 2FMQA 2DH8A 4OYPA 3SD7A 3OHAA 1F44A 1F9EB 2EC0A 3T1HJ 3VF0B 4G1IA 3GCWP 3J7ZO 2LBOA 2F8SA 2IM0A 4BROA 1R8CA 2DF4B 3PO4A 1N34J 4ILMA 4DFKA 4OV6A 3DDKA 3ETMA 5E7OB 4OVLA 2P9SA 2QI2A 2YNIB 4TLQA 3MEGA 4MF8A 3QJPA 5KFCA 3DOMB 4PHDA 5J0RA 4ZA1A 1CPZA 2ZJ8A 4Z4FA 4Y2AA 3G71S 4IQXA 3Q8PB 2OSQA 3DOLA 4Y28C 3DLLL 3D6TB 2E8OA 3RH6A 2D69A 2BANA 4CHQA 2KU7A 1DJ0A 9ICUA 1VHIA 3VEWA 1HR0F 1C20A 1K0TA 1T9WA 2YMLA 3KLIA 4QOZB 4TQSA 2CRXA 2XLJA 2W6KA 3ZSRA 4A47A 3OW2M 2GA7A 3PW4A 1QVFM 2L5YA 5EE0A 4A57A 4PHPA 5K5MA 3ZSQA 4H4OA 2YMPA 2MA1A 4KLEA 3ULHA 2KDOA 4X65F 2VA8A 3UDVA 4HWIA 3K8VA 5GAEU 3KK2B 4N5SA 1S49A 2K8GA 5AKEA 1AUSL 3R7NB 2P9NB 4FVMA 4HEA9 4O4GB 2PFOA 3B8AX 1HYVA 3I96A 2MAXA 2FPKA 5E2QA 1SIJA 3HW8A 3WQUA 4YDUC 5KFKA 3RWUA 4AL7A 1IR1A 4MFBA 1BIZA 1WUDA 2W25A 3T9ZA 4FZVA 1RQLA 1RGIA 4O3QA 2GZOA 1P6TA 5A8WA 4P0QA 3JYTA 5AQSA 2ETJA 3K7RA 2BBEA 4WZQA 1LW0A 1X9SA 2CQPA 1DQ9A 4A8QA 4CECA 5BPCA 4RNHA 2QTWA 2QW9A 2RQ5A 1NRKA 4MKAA 4CCHA 3ZSXA 3CJRA 1WKKA 4ID5B 3IS9A 4MKBA 3UIQA 3AV9A 3WXLA 2P8IA 1Q81O 4OMFG 2E5SA 4GRSA 4Y1CA 4CLYA 4IZ9A 3DLKA 5CHCB 5CWRA 4QYZK 5GTIU 1IXRA 1AUDA 1FWLA 1J2MA 1B7YB 2NYIA 4CGFA 1RT1B 1F5AA 1U8SA 4AHUA 5IIMA 3FCWA 2P2CB 2XHCA 2YB1A 4FE3A 4IUFA 1RWUA 4KLQA 2R3VA 1FRXA 1SKRA 4KLUA 3OL7A 3I0SA 4KIAA 4NXMF 5I9EB 2CJXB 2YXLA 4C8YA 1MROB 4OLOA 4FJ7A 1GEHA 2ILYA 3E9PA 2G0CA 1N34K 4QPXA 1EX8A 4RW6B 3JQJA 5H9FK 4AFFA 1J2NA 5I3UB 4RNOA 3ASMA 3PYFA 1M90O 3UQ0A 4Y2JA 2AA4A 5EOZA 2LM1A 1SXEA 3GB0A 3BQTA 4XDCA 3ALYA 1RBLA 4CTAB 3WXJA 1H1VA 4JI6J 2MJNA 1LWEA 2NRTA 4ZK7M 5D46A 5ELZA 4QYRA 2NO4A 4UB1A 1S0VA 2VH7A 5DDOC 3H08A 1N32J 4DSJA 3KWMA 8ICLA 3AY0A 4DR4F 1UJ5A 3S6JA 2JMGA 4CEFA 3Q8KA 4NA1A 3X3UA 3M6VA 5BYQA 5IIIA 5ALLA 2Z30B 1S57A 1ILYA 4FKXA 4A8MP 1NGHA 1XHXA 1VLBA 8ICBA 1HBUA 1Y11A 4QCLA 4KB7A 2R7WA 2LP4A 1LWCA 2HHTA 3F5AA 3ZD9A 4B08A 4DMNA 2ASJA 3O3HA 5IQ6A 4E98A 1XMBA 4CNQA 2W54A 5FRNA 2ZKUA 1EKRA 3NF6A 2XGQA 3E3XA 2RB7A 2ZE2B 3SQGB 1IKVA 2JGAA 3PSPA 1A7GE 3QT6A 5DQIA 4XQ8A 3PW5A 3H2UB 1ATNA 1VFJA 2B4JA 4HYKA 3BP8A 1X9JA 1T03B 4PRFA 4ETZA 2F3JA 1UVKA 1L3TA 3CD5A 4ZPWR 4DF4A 3KNGA 4EFAC 2ZJPL 3QUQA 3GJQB 1NK8A 2YJFA 2VQFK 1RM6C 3K58A 4MFFA 5C24A 4KH5A 1NGAA 2GX8A 2KVIA 4DV4J 4OYOA 2E8AA 4JI1J 2QIFA 1V9PA 3KG1A 4IDKA 4JI0F 2UXDK 2K4PA 2WONA 4ERDA 1WOQA 1YJTA 4CZMA 3ETLA 4NI2A 4X64J 2XZDB 4LH4A 3R5JB 4QZFA 5IIKA 3A0HU 4DUZF 2BE2B 3JPTA 3CWJA 2KIVA 4PG6A 1EKSA 1TKZB 4XO0A 2V9KA 2XBPA 1IBLJ 5SWMA 3I4PA 2IVMA 1LV5A 5KI6A 3M8RA 3FC4A 4KHUA 3EMTA 2XSJB 3IMQJ 4LBPA 3I56N 1HR0K 4KO0A 1IBMF 1TL1B 1JK9B 4J2DA 4ILJA 3LPEA 5B0AA 3HJFA 2Y0SF 1RT5A 2P9EA 3TTDA 3CCWA 2G1HA 4F4XA 1LWFA 2QL5B 2WK4A 2WRMA 1J53A 3F9MA 3OL9A 4C4WA 2HZCA 2A1JB 1N60A 3G8TA 5KFVA 3G4SN 9ICXA 3HPOA 1JLAB 3CD7A 2KNJA 5J1EA 4CBUA 2F3NA 3HHLC 2I2YA 1T6CA 3ULEA 3KKFA 8ICUA 3RUBL 3CMES 2UUAK 4RWWA 4YB5A 4OYZA 1IKYB 5KAKA 2ZH7A 1K9MO 3E58A 3QATA 4DSLA 1WJ9A 3R5BA 4JHDB 4C3LA 2LHTA 2KFNA 2W41A 5IIOA 5EHHA 2ZDPA 1Q18A 4FWQA 2VKRA 1RUSA 2PFQA 1FJCA 3UFCX 4DCCA 3KHGA 3FZFA 2CN1A 2O01C 3CCJN 1TFRA 3US5A 3E9LA 1Z1ZA 3K17A 1T44A 1C4CA 3SUNA 4G3IA 2YHWA 5JICA 3KVGA 2DHHA 4ATNA 2Y0SD 4AILC 4FNHA 1V3RA 2XCPA 2ZH5A 2ASMA 2UUBK 4ZVFA 1SWWA 3H46O 5EVZA 4PHEA 1ZQXA 3NMRA 4ZLLA 3VCDA 3HK2A 2RUGA 3DOMA 2JZBB 3CM5A 7ICGA 4DR5J 5D0RA 2R7TA 1X3NA 1SJ3P 2K60A 2GWSA 1YJ9S 3A2FA 2WTFA 1S1XB 3S3MA 3JPRA 3M8PB 1JLQA 1B0VA 4NCBA 2WONB 5ALGA 1WUUA 4U9RA 3O8MA 1OO0B 1R8HA 5KFLA 2ZITA 3VALA 4C8MA 2DNPA 4NY8A 2ZD1A 3MECB 2IDOA 2ZIXA 4KI6A 3B9JA 4WF9Q 2JDJA 1EX4A 2HOEA 3EO3A 4M3XA 5ALOA 5J0PA 3DRSB 3O9TA 1BD6A 2B7BB 5LMUK 1V38A 2A42A 3AO1A 3NF9A 2YHAA 3BZCA 3PKYA 4M63C 3M2RA 2IFXA 3R6LB 4NPOA 2PMZF 3NVYA 4NA3A 1LOTB 1S9EA 1JJ2R 4OJ5A 5FDLA 4H4OB 4US8A 4RUCA 4JYAF 4NXNF 3AJ1A 3TQ1A 2JH1A 3DGVA 3O80A 3DYAA 3H0MB 3C65A 1FT8A 3NXZA 3TZWA 5BR8K 2MGZB 1CC7A 4A4JA 3W9HA 3PSFA 4KN4A 1HWJA 3RJGA 1F60B 2ZZTA 4O44B 5CH7B 3OVBA 2V4JA 3A0BU 1RILA 1TUUA 1URNA 1QAIA 2J7WA 4DS5A 4OJLA 1FTCA 2ZF5O 2Q43A 4ZMMA 1WDDA 1OYEA 4LF6K 4K43A 1NGGA 4JKCA 3JXOA 2NPIA 2JL9A 1RYUA 2QKBA 2E1PA 1YBAA 1HKAA 3K5PA 4PHTX 1JNRB 4H0XB 3D6FB 3L3CA 1X6JA 3NCIA 3CJSA 5KFSA 1RWKB 1FVQA 1MMDA 1NWKA 5J2AA 2RDIA 3ATUA 4IKFA 1U26A 2UXCJ 3D1OA 4JV2A 2ZDOA 4BRPA 3WEEB 1RT6A 3MUMP 4E7JA 3IAS9 4HT5A 3DLKB 1NSAA 5ALEA 4GV6A 3DRSA 3M1YA 2RLTA 1VSIA 2CZ9A 1N63A 3O4WA 4FJ8A 3CMQA 3DXSX 2KG1A 1Z19A 2R2UA 3D0PA 4WWSA 3U1NA 3HWTA 1HLWA 4K8XA 4UB6U 3LL3A 1CULB 4QWCA 4F67A 1L3KA 1REVB 1QQ7A 3MM7B 1UCNA 2DPJA 3K5MA 5DO2A 1ZJMA 3OR2A 3NGYA 1QVFR 1QSYA 4GC7A 1JALA 3F41A 9ICMA 4CZLA 2NUUG 3E0FA 2OPQB 2NUBA 2W55A 3I55S 4CDGA 3ZC4A 5GAEI 3CC2N 3D6JA 1IM6A 4DQQA 3CYMA 2Q36A 2LU2A 2VQFJ 1WOOA 3L4BC 1NEEA 1TAQA 3N79A 4RQ4A 2V94A 4KX3A 3CMAS 1RHUB 3S3OA 3MN5A 1OPIA 3UCZP 4C8ZA 2YNGB 5KT6A 4ZVPB 3M8QB 5T7LA 5DM7L 1Q8KA 1KLMB 2FBYA 2YTCA 4K25A 3MFIA 5AXNA 4NYZA 1YJNS 3Q22A 1OH5A 4LSNB 1BWFO 2CJQA 3NY0A 4PAAA 5KFQA 2HS4A 2B4UA 1NPPA 1NLVA 3NRBA 5D0HA 3KKSA 1XTZA 2C2KB 4BR2A 1HI1A 2VG5A 1NHVA 1RTDB 1HW9A 3N4PA 1IVZA 2OSRA 1ZQPA 3NRWA 2Q31A 4I2CA 4FW1A 1VQ5N 2EW9A 4GKJJ 3L95X 2VPXB 3CEDA 4O0NA 1RDCA 2WVEA 2R7YA 4BREA 2GTDA 4FP9A 4DCHA 5ETSA 3CCSS 4Q2MA 2Z1HA 4QWBA 4KLOA 1IWAA 1YTAA 2WB1D 4V1Ak 1VQKS 3V2UC 3V81B 4J9QA 2KJ9A 4CHOA 4B1UB 2B9YA 3FBFA 2YQ3A 4K0KK 1U8WA 1C0GA 5CA5A 3CCUN 1SL1A 3CRXA 1COKA 5C10A 5DG7A 2RIJA 3W2VB 1B92A 2D3UA 1VR6A 5AQGA 3QFWA 4WTYA 4ZOSA 1IBKJ 2V8GA 4EGLA 5DM7Q 3M30A 4NLZA 4TU7A 3RFAA 5A2QU 4B17A 4LFCK 3IC1A 5A0YB 1BA1A 3QU7A 4CJKA 2ZJPQ 1S6OA 3UDLA 4NI2B 1D1UA 4JI4K 2FDRA 1QM9A 1ZQIA 1RAIB 1UPHA 3EUNA 1VQOS 3SPYA 4QNLA 5J2DA 4OYAA 4HVZA 2R2SA 3VF4A 4O0IA 2B8PA 2FLNA 1RQNA 2HQCA 3NMAA 2X6SA 2CWXA 3ZSOA 2Z2YB 3I5AA 1KD1T 4GW6A 2PT0A 3L3UA 5DBCA 3H20A 9ICIA 1FDBA 1S0NA 2ZQBA 2O8DB 4JI7F 2LQ5A 1NMDA 4ECZA 1HQEB 1UT8A 4RQ2A 4F3QA 4U7UD 3TADA 3MMCA 2ADBA 5K8MA 4JN4A 1NM2A 4YHHF 3HBTA 1X5TA 4FKYA 3BUZB 3ENBA 1XMOK 1HWUA 4RW4A 1JJHA 5A8KB 3EICA 3M9OB 3VPZA 3SK3A 5CZ2A 2ISPA 1H6KX 3D1QA 1FNXH 4IRKA 2HRYA 2Y9UA 1YZ7A 5L8RC 4CEOA 2HKEA 4OKKA 1PO6A 5ETLA 4WFAL 2N4CA 2MU2A 1VC6A 1RT7B 1ROFA 2P66A 5EN1A 4JV0A 3VTIA 2KZ3A 4KAIA 3QU4A 3DJCA 4IXCA 3GMGA 3H8MA 2EBGA 3IUCA 4MHVA 2ASDA 1ATRA 4Q0BB 4PXDA 2LYAA 4ZOHC 2GIQA 3C6AA 3QGHA 3VQPA 2AYBA 2WHOA 4LFBJ 3IGVA 1W26A 3GV5B 2P9UA 4KH0B 7ICMA 3G86A 4K4HA 3MPDA 2V8PA 5H9FJ 1EB0A 1A5XA 2RKIB 5BR8F 1D8BA 2J6SA 3LP0A 2EQYA 2JLEA 3WKBA 4GXJA 4TY9A 4DFMA 3JB9k 4UASA 5L9XA 5D0EA 1TP7A 3TFSA 4FS2A 4B9VA 2DQNB 1Q86T 5CB1A 3BN4A 4QOTA 1RAFB 1N32K 4ZH4A 1NCLA 2CADA 3VAJA 5ALYA 9ICFA 1YBUA 1YGYA 3O1WA 4FLWA 1LFWA 2K3KA 2GQCA 2AZ1A 2Q0ZX 2CPHA 4I4BA 4FPBA 1JKHA 4CEAA 4UB2A 1CBKA 4DX5A 1SB6A 2JH7A 5DBAA 2POKA 4EHUA 4MN4C 1Q86O 3ZSZA 3P3DA 5G0RA 4ZPVR 2V51B 1HYSB 5DJBA 3HZ6A 2RS2A 1CJVB 5KG5A 2OI2A 3CDAA 5KQDA 3PRBA 4QBUA 2GEMA 4YOVA 1HNZJ 1HJOA 4DX6A 4NLQA 5AJ3K 3M1VA 1MG7A 1RWVB 4B9NA 1SJRA 5IWAK 1T0TV 2QEXS 5HROA 4E7IA 5IILA 4HACB 1TV6A 4PG5A 1HNWJ 4XEIA 2FE9A 4PXCA 4RPFA 2QWLA 4NWIA 4FVUA 2G08A 4Y2RA 3PKMA 1NNLA 5E3PA 4MIAA 4NRUA 1D0EA 1FDDA 4NV0A 3WXIA 5FRMA 3PYGA 1E4GT 3UXNA 1ZQQA 1IKXA 2A0FB 1VS3A 3NCPA 3M2VB 4X4PA 4LQ9A 4ZDNA 2QB1A 1QSSA 3PG9A 3TUZC 2W3SA 3MM8A 3DNCA 3OVAA 1Y97A 5D0GA 2J0XA 3AAWB 1Y4ZB 4Z4GA 3QIOA 4CLFA 1N54B 1BWEA 2HHHK 4PYAA 4OL8A 5GIPA 1HRHA 2IDLA 3TOQA 1X4GA 1XMOJ 4QR0A 4KHPJ 3HT3A 1NH8A 2V0NA 1FE0A 3H25A 3M4XA 3WKDA 3B78A 2B21A 1WC5A 5KFAA 2HAIA 3VVTA 4ED7A 4JI4F 3WK4A 4RQ6A 1VBKA 2JHEA 2GO8A 2RH3A 3EE8A 2FY1A 2DIVA 2H3GX 3QGGA 2BGGA 1KVJA 4LREA 1TV6B 3N4MB 3PIOQ 1WF1A 4I0WA 1UL3A 3VAFA 2GWJA 2HNZB 2WBRA 5H9EK 1M6YA 3H6EA 5ETRA 1CZAN 4MFCA 4OHWA 1TVRB 4WKYA 3VGKA 3KFWX 3KHLA 2FHOB 1U1KA 1VJQA 1LWFB 3MAHA 1L3VA 1SJFA 5JLFA 1I6JA 2V4RA 3PSIA 3B6BA 1NSQA 4CF1A 3HSJA 1NOMA 5DG8A 5LSRA 5C5JA 1SB3C 5GAHU 2FBXA 2LQ9A 5B0DA 4Y2VA 3IG8A 3WC2A 2NREA 2QG9B 1TK5A 2RD5C 2G2OA 3ADAC 4NLYA 1NKCA 3M7VA 3MDAA 1S6QB 4DV5F 1ZH5A 2ZOGA 4A62A 1S1TB 2ADCA 3A5LC 4LIRA 3LP0B 3N5FA 5HLFA 1LWXA 2FYXA 5J2KA 2P5OA 1FRLA 1VMBA 3RZAA 4M5HA 7ICSA 1UJ6A 4XPEA 1RT3B 2VANA 4I64A 3SJHA 4CFDA 2QT7A 3GZFA 2W4DA 2QV6A 3UNGC 2BKEA 5U47A 3MPVA 3H7HB 2YNHA 5I4MA 3HFKA 4UAZA 1L7PA 1T4GA 2PEBA 3UMGA 6AT1B 2D1CA 1S1UA 2APOA 2YWEA 4RBTA 3FQKA 1XJWB 2HBMA 1IR2A 2BJ1A 1VLYA 1EWRA 5DKWA 3HP9A 3V9WA 5B0FA 4M5IA 4IH5A 5J2FA 2W24A 3DLLQ 4K59A 4URSA 5IC4B 3EXYA 2FD2A 2V8HA 4M3TA 5IINA 2RU9A 2X1FA 8ICSA 4X4RA 1JNZB 1YJ9N 4GFJA 4HUFA 1XBWA 2DXDA 1ZBFA 4ZJQA 2JX2A 5DZ7A 5B08A 3DRXA 3OFFA 1WHXA 3CJ4A 1HA1A 3C6TA 2VFTA 3SSSA 1L3UA 4WU3A 1PC4A 3LVWA 1WHVA 4R64A 2MSTA 2PA8D 5J2MA 5ALMA 1I94F 2AMCB 4CEBA 4XAKA 5BYRA 5IM0B 3TTCA 5MAOA 1ZQKA 1ASVA 1SJQA 3EEQA 4OX8A 1HI8A 3ZZ0A 2KV2A 2RQCA 1XNQJ 5DLGA 1ZQTA 4RW9B 1N5WA 3D2EA 3NGIA 3Q8LA 1RT2B 1WBDA 5L1IA 3WBZA 3N9UC 3E2EA 4OQJA 1SGGA 1VIOA 1WD6A 1JJ4A 3FZHA 1HKGA 3IBCB 4ISFA 2IVOA 2UU9F 4B1WB 2V63A 4BRGA 2DK2A 4KKOA 2NQPA 5AQLA 3UCGA 5CYMB 2AIRB 2OPRB 1ACMB 3PVXA 4LVNP 1UAXA 2F1JA 1FE4A 3OTOJ 4XH5A 1U6ZA 3RAXA 2H51B 5K14B 1EETB 3D54A 2WVBA 1TUYA 2DNYA 3RJEA 4MYUA 2OZMA 3O6WA 3W64A 4Y34A 4ISGA 4BRNA 3TEGA 2RRNA 1DTQB 4WFAQ 4JAXA 3W1YC 2MTLA 2YHXA 3O3LA 4B9QA 8ICEA 4JKGA 2ZIVB 4M6WB 2DHSA 5CHIA 1HJPA 4TU8A 4J9KA 2Y1LB 4LF4J 2GAHC 5K20B 1FFWB 1RT3A 3MM7A 5J2JA 3QPIA 2LU1A 3L2QA 1SZHA 3FAHA 4UAWA 1NK0A 3AQOA 5FPMA 3CCVN 2W2OP 1FRKA 3D28A 3PFOA 1VBZA 4ZPAA 4CYUA 3FGUA 4PEOA 2H1YA 4U7BA 1HNIB 1LK5A 3VA3A 1LWEB 3BKFA 1H2TZ 3O1LA 2QWQA 4KGVB 1G6BA 4MEYA 3SEIA 4YOXA 2D7SA 2YKAA 2FGCA 4CF8A 2ZTEA 4F0KA 3QFPA 3BS5B 2YMMA 5TKYA 4Z4CA 4URGA 4WYBA 4BACA 4E0DA 4M5MA 2IJRA 1RTHA 2MLXA 5AM4A 4R0EA 5AQIA 2VDIA 3TABA 3KK2A 1D09B 3W61A 3NDKA 1Y3KA 1AT1B 1J2VA 1Z00A 8ICGA 1E6VB 4OO1J 2HDOA 5GMDA 4V19X 4WTOB 4J9PA 2P6UA 3T41A 1ZQAA 3VGMA 1FESA 3BBCA 1UWBA 3JTOA 1B4SA 2K06A 4EX6A 4BR7A 2FVQA 2BW7A 2FPLA 2OEHA 3ICXA 1Y3JA 2RKIA 3SNNA 2FJEB 1BNOA 1NHUA 3W7BA 4GXKA 2KG5A 2X1AA 1TGOA 4OLPA 4CH1A 1U1MA 2RQ4A 3HVTA 4C0ZA 1Q95G 1RYSA 4HHHA 3CCRS 1KQFB 2RHKA 2DO0A 3CJTA 3M6UA 4GKKJ 4M3YA 4DR2K 3P5JA 1JB0C 3W5XA 2AX1A 2DL0A 2BZFA 4LMZA 1XMQF 3VQ6A 3RAMA 2E4LA 3K5OA 5EOYA 1V3SA 4O3MA 3G6XA 3RRGA 3WNFA 2A6OA 3QERA 1L7MA 8ICWA 4I6MB 1CJKA 3L3VA 1NSPA 1QTMA 2ASLA 3IS9B 3UE5A 1EZZB 1NJIT 1VQ9S 3CJ1A 1TQLA 1KVCA 3QXGA 5F0XA 2XC9A 1BOTO 1VJ5A 2G2ZA 2ZUGA 4AE5A 4AL6A 4ECWA 4Y2CA 4DV1J 3KKRA 3BDPA 4JNEA 3K2YA 1RWXB 2KG0A 2ALYB 4CRXA 2UUAF 2RE2A 3JPNA 3I0SB 3IAM9 4LR8A 2D0PA 2XMAA 1ZBSA 2G8IA 1PJ6A 3DLEA 3KUEA 3WK5A 2E44A 3J7ZT 5D4NA 2M2BA 4ICLB 2VOPA 3P31A 1U2VB 1YX2A 3A5MC 2NSBA 4F2SA 2UXDJ 3ZZUA 3EE3A 2OXOA 1SUQB 1NZ8A 3J81Y 4DV6K 1JXLA 4R25A 1RKJA 4KHSA 1S5LU 4PQUA 3B6OA 1ZOTA 2VFSA 3DMJB 4M5NA 2DNHA 1GLDG 4FS1A 2E7WA 2OMOA 2MY8A 4ACOA 1QTNB 3LPTA 3KWIA 1KN5A 3KK1A 4QWDA 4PWDB 5KT2A 2C2DA 3KHHA 3UDCA 3QRPA 1T03A 5HI7A 3ED5A 4BGAA 4YHHK 1FNMA 1SQKA 1RADB 3L0QA 2ALZA 2VYPA 1IJJA 5KG1A 2OPPB 4X4TA 1FD8A 2HOIA 4FK0A 3NAIA 1Q53A 1FWKA 3MN9A 2NXUA 3LGNA 3HHLD 2XLKA 3V1RA 4KHWA 5HLFB 3OVNA 5JXSA 1DLOB 5LMNJ 4JB8B 3MXMA 3KJFB 4DJBA 1U45A 4ZN1A 3QGIA 2H5EA 3DLEB 4OX6A 2BR0A 1ZQZA 1N5VA 2Q6CA 2Z1GA 1RCHA 4B3RJ 4CLKA 4J9OA 3LO3A 1ZZFA 4F5OA 3SDEA 3IBFB 2DH9A 2VPZB 1N36K 1RU2A 3OYGA 4ZVSB 3AO3A 3QWUA 1L8LA 2QTDA 2A19A 3OHBA 4DR6J 2W6LA 4XIUA 2KVSA 1U9LA 1T8EA 2A18A 2ZE2A 5AICA 3VN5A 1VRUA 1B0TA 3RJHA 5FP0A 4EFHA 1SC3B 1X5SA 3GE1A 3SMVA 4F3OA 1C0UA 1UOCA 3H8SA 5ALKA 3F2DA 1LW2B 3ZTSA 4X62F 4RU2A 1KCFA 2ZKTA 2V8VA 4KBOA 2DFEA 1BPEA 3PJXA 4TYAA 3VQ9A 1RDFA 3H1QA 4RKUC 3BSAA 3V6DA 3HSCA 4P4PA 4YUDA 4NM1A 3GR1A 1BPZA 2CG8A 3DLJA 1BQMB 4B3TF 1Y64A 2VG6A 4ILLA 1QQNA 3TSPA 4E7LA 4WE1A 2J4RA 1K5OA 3R1LA 3NGTA 1LKYA 1X3MA 3LDAA 2Q97A 1WC4A 3PUFA 5CZ1A 3OGUA 1FKAF 4OPJA 5JVHL 3SUPA 5FIIA 4Y65A 3VEZA 2J6UA 3T9NA 2MKKA 5BR9A 4QJFB 5AI6A 1H2VZ 2VFVA 5FD1A 4FK2A 4KN7A 4CNZA 3VAGA 1S4FA 2V4QA 4NLOA 2FMPA 3HHEA 4HHJA 4AYBF 2I0XA 4AHRA 1ZD5A 5HRNA 1XUPO 4CJVA 4KI4A 2C42A 5C2GA 2A1BA 2VUGA 2QKKA 2YB4A 3AVJA 2K4IA 5EU7A 2C3YA 4FLYA 4CF3A 2H4YB 2OPRA 5IT4A 2HMPA 3FLCO 4LF7F 1WI8A 4YORA 4U8VA 5J0XA 3EGNA 3PFEA 3L3FX 3CQXA 4DL3A 4FF2A 2B6AA 1P9YA 3VR1A 1DGKN 3T19A 2E3TA 1R8BA 2N3LA 4DU1A 3BKUA 4KLMA 1RJJA 4CBWA 2RP5A 1FKOB 5DQGA 3E66A 2AWZA 4CI0B 1QQMA 4YMNA 1COOA 3ICLA 1ZQWA 5LJWA 2DYAA 4ED8A 1HNXF 1VSMA 5BJRA 3ZNJ1 1F3FA 4DR5K 1OS5A 5LSOA 3ID6A 3H0PA 3KD3A 1PVQA 3MM9B 8ICCA 3PYEA 3TAFA 4QJVA 3R9LA 2W9MA 1A6LA 3H8YA 3TA1A 3QEXA 3KFUF 1PJ7A 4MFBB 2PYLA 1C1CA 5J2QB 1X4DA 4XH4A 9ICBA 3OXFA 2QX0A 1DTTB 2KT5A 8ICQA 3NKYA 3CJ9A 4W5RA 2KSOB 4MFAA 1RGVA 2QL7B 1HBNA 5GINA 3A5NC 2JZBA 5JTIA 3D2FA 2W11A 2P9CA 2HFSA 3A8EA 3DLRA 3GONA 3IDHA 3BZKA 2OD4A 5KT7A 1D4XA 1NO8A 3FCVA 2WMMA 1NDCA 4JI3F 1M90T 1TUGB 5DGBA 5FDLB 3EZOA 3M1FA 3KLFB 5HL7L 3TAEA 2J0SD 3QIPA 4OPKA 2BM0A 2NO5A 3S6EA 3AOBA 4Y6IA 3TZZA 3MOJB 2VG6B 4JK7A 9ICEA 2P6RA 1SL0A 2JEJA 2O8DA 3CJ5A 3PR5B 2IVFB 4ZVRB 5L1MA 1ZQYA 3SAGA 2DGOA 2AJFE 3DRRB 4A8OA 3EVOA 1J5OA 3RR8A 3EGWB 4Y2UA 1TMJA 5AKXA 4J37A 3EW9A 3JAMY 5F3TA 3A3NB 2MB0B 1RBAA 4I2AA 3U6FA 3KOAA 4OYXA 3U9DA 5KFRA 4JK1A 1H0HB 1K8KB 3MR7A 3G10A 3VAHA 3AUOA 4PGYA 1ZPVA 2KD1A 3BGLA 3LPYA 4LF8F 2ZUCA 4BBYA 3BO3A 4JKBA 2E6LA 3RJIA 3QAEA 4PUOA 1ZRNA 3PNCA 2OHFA 1RWPB 2DR5A 2HWHA 3CCEN 3M32B 4G9BA 4I2EA 4DL7A 1Q79A 2LLZA 3D0GE 3UD5A 3O9QA 4QIWF 4PGXA 4F7VA 3AVKA 2FJDB 4BDYA 1XN9A 2DB1A 2YKPA 2YHYA 4PKHA 2P9PB 2H5IB 4KHRA 3W65A 5ETVA 3KK7A 1DT9A 2HS0A 4B1VA 1YT3A 1WSEA 4OCZA 5IZHA 3FSXA 4JHDA 1RACB 3D2EB 3V6HA 3BSOA 3QAUA 2P35A 4O3PA 3FGVA 3CPEA 4FLUA 1D9FA 1T9YA 4AM7A 3LM9A 3SSRA 4EBCA 2BJDA 3L5KA 2IRXA 4BRLA 3UD4P 1RTZA 2LFVA 3W2WA 3MN7A 2IHMA 3UQSA 3DOLB 2KN4A 1FTRA 3OS1A 1WEXA 5B09A 1WAJA 2J8AA 2GOLA 3FBBA 4OPAA 1SIWB 5M1NA 2A3ZA 3PNIA 4KPYA 2BANB 5CR0A 3MAQA 3TX8A 3EDQB 4ZITA 2VJVA 2RRBA 4JK8A 3Q8SB 3TTFA 2DT9A 4KRFA 5J0OA 1SAZA 2HG4A 3M2VA 2ZVIA 2QLWA 1BI4A 8ICOA 4A8FA 3ENAA 1S59A 2BEFA 9ICNA 3KHYA 1QAJA 3PEJA 4IG3A 4DU4A 2XMJA 3L9ZA 2O8CA 2E2NA 4QS8A 3LZJA 4ICLA 5HMLA 1DEJA 2ATQA 2PA3A 1NGDA 2KN7A 3U7JA 3O6QA 3BDEA 2KE7A 4M3UA 4M95A 3CXCR 3T1YJ 3C8YA 3WNEA 1JCGA 1XR7A 3P96A 3E51A 4IDHA 1TFYA 3ZTOA 2GJFA 4FWOA 3VMFB 1SQEA 3DGPA 4JI8F 3D7EO 4GY2B 4OI6A 3SJJA 1T95A 1W2IA 5T41A 1N52B 4GV3A 3IAYA 2W43A 3H0RB 4Z94A 4WXWA 2OFHX 4H0YB 3H8JA 1EETA 4XUSA 4RG8A 4FFDA 1BLUA 1NNDA 8ICKA 4XTTA 3QIDA 2QXLA 1AXQA 3NOGA 4FXWA 4O3OA 4DCOB 3OYJA 4L6V3 2OPSA 5CQGA 1RBUA 2K4EA 2VF3A 3FBCA 4ZIWA 1JKHB 4LFAJ 4AQYJ 3HLUA 5HMYA 4KAZA 3QE9Y 3V4IB 1ZS6A 4R5PA 4TLRA 4P2HA 3EX7B 4GVBA 4LD0A 3BBFA 4IJNA 2HLTA 1MDUB 3OBWA 2PI4A 3TPQA 4AL5A 3DXKB 1YQHA 3MX2A 3U1MA 1B22A 1KEKA 4CJ4A 4A2AA 1RHJB 1S79A 3CCSN 3H59A 4ZLPA 5AQHA 2W8LA 2KJ5A 8AT1B 2EANA 2HFNA 4CHZA 1Z1BA 2XSFA 2Z1IA 3NGKA 3I8BA 1ZD2P 4J9MA 1HQUA 1B0PA 1NB2A 2E2OA 1SXLA 7ICUA 3CC4N 5JJBA 3BS5A 2JXJA 1C2PA 2KXNB 5BPMA 2ZM6F 2E1FA 4RW6A 3AL0B 5J0SA 4KTQA 2NRVA 1RHKB 1SKUB 4CJUA 4Q8EA 3IRUA 4G65A 1IJEB 4QPTA 2V7YA 3E8OA 3RBEA 3MPYA 2IBOA 4DR2J 1FXLA 4DR3J 2D41A 3BO2A 2F1HA 2LSNA 4IG3B 2VICA 5IS2A 2A1SA 2D9OA 4IOXA 4E19A 4BC9A 3QB0A 4FJ5A 4H5NA 1IBLK 2KOBA 9ICTA 2KT3A 3CJ3A 4M5GA 4OJPA 1KTQA 4AYBD 4B6JA 4NWBA 5LMNF 4R65A 3OV7A 1FRIA 1LCUA 2B4VA 5EDWA 4I7FB 3RMBA 1GMWD 2MZJA 4MJKA 3TANA 3FEZA 2EXUA 2PMZD 2OANA 2K2PA 3V9UA 4RWXA 3J80O 2MKCA 4K4TA 3K1ZA 2CAJA 4M47A 1XQSC 4I2QA 1K8AT 1HARA 3H0LB 2YN4A 4DHYA 2XWXA 1Q7YT 5LXYA 4EHTA 1AZSB 3M9NB 2A1JA 4DV7J 5J1PA 2E1CA 4ELUA 3CIMA 4GMJB 3TAQA 2LDIA 3TQEA 1LAVA 3QINA 1F3VA 4RZRA 4UT4A 4J9LA 2KMDA 3O5TB 4YD1A 4Y2SA 4ZPTR 1JLEB 2IHNA 5K14A 3K0SA 4CZGA 4TXSA 1L5UA 1T94A 1YITS 3OYEA 1JXVA 5J2GA 1HMVA 2QLTA 1YJRA 4KYZA 1EJ7L 4DPUA 3W63A 2P9GA 2VIHA 3QRQA 2QA2A 1YITN 2FHKA 4CM2A 1RTDA 3QNOA 4K4GA 5JVHQ 2CPRA 2EKYA 6FD1A 3C66A 3KZXA 4TYBA 3CCQS 5AK3A 1KFTA 2HRUA 3X1LB 1OMSA 2V69A 2W40A 1H38A 7ICIA 1RWWB 5AKIA 1L8OA 3THVA 2CQ3A 3NGUA 5IM0A 4LF8K 3ENVA 5AM1A 4FBUA 5FPNA 1XQIA 4OZ0A 4JK9A 4Y2QA 3CUNA 3C16B 3HKZF 4LFBK 4WU2A 1ED1A 4DV2J 2OEMA 3P45B 1ZM2A 1EXNA 3Q2TC 1MA7A 4F4ZA 4PPZA 2Y8WA 3FBEA 4Y0WA 3C1YA 3VCBA 2DHAA 2YBVA 5GAGU 3V81A 2YWWA 1Z3EB 1H3DA 1HPZA 2Z7JA 4US9A 3ONNA 3HVRA 1RQ0A 3U3YA 1VIXA 4JI3K 2XWYA 4L73A 1NGIA 4QAGA 4FM0A 9ICRA 1E6YA 3Q7CA 2E2PA 1CSJA 4HDGA 3PX0A 5HQ8A 1ZQRA 2VG5B 2IS3A 1EP4A 1JXBA 1ZQVA 4NLXA 1CI4A 2BQUA 5J2PB 4X4UA 2RVJA 1TVRA 2PMZC 2Z0GA 4HTUA 4LF6J 1WG8A 3EXCX 4OZ1A 4K0KF 2P9IA 2AXTU 5IC6B 1Q8BA 3PJWA 5KGXA 1RBOB 1AZSA 1RAEB 3WQPA 2FGOA 5C25A 4NXMK 5KG4A 3CVKA 4DLEA 3PXGa 1IUJA 1P8ZA 1R59O 3HM9A 3LVVA 2KRBA 4LF9K 1S4EA 4KMOB 4LF1A 2WVFA 2V2VA 2PFFB 3AARA 1FWPA 2D9PA 2PMHA 3R3TA 4I6AA 1ZQOA 1OSDA 4J5OA 4ZPDA 3AT1B 4ALZA 4XA5A 2QWMA 4P4MA 1ZQDA 5A0YA 2VG7B 3MTKA 3OFEA 3FEXB 5MLCV 3MCSA 1YJNN 5H2FU 1VYAA 4TY8A 2XB2D 2YTUA 4F25A 3CMAN 3AVAA 4DR3K 2BW2A 4O5BA 3ENQA 3MF5A 5ADXH 2KK0A 4IRDA 4TKTA 4I6MA 4A59A 4FJ9A 3OR1B 1X4AA 5KFNA 2HQFA 3TUPA 1BGXT 1KAZA 1ZQEA 3LA0A 3FFIB 3RAQA 1DRGA 3ZT3A 4QW9A 1T02A 4GVBB 3D1HA 3KLEA 3I9ZA 4UAYA 2LXIA 3KLHA 2X6NA 2KZZA 3ZI4A 4LF5F 4CO4A 8ICHA 5KFEA 3P49B 1HI0P 1N5XA 4YR2A 2YWGA 4JYAK 3T1AA 4AH9A 1ZJNA 5AZJA 5J2MB 5J0TA 1HHSA 3UPQA 3DI6B 4FW2A 3UQ2A 4C4TA 3R5CA 4B1XB 5HROB 3L4IA 1SJ4P 3VOVA 2EG1A 1YTYA 2JEIA 2J7KA 1JMSA 1IXKA 2HHWA 4TNOA 3TAMB 4P2MA 5B5EU 4F2RA 3IMXA 3CMEN 4IQTA 3PCOB 3CCUS 4O5CA 2DNQA 3NNCA 1X0FA 4M3WA 1S1WB 3AD8C 4C7QA 1U6FA 2XYPB 2C3MA 4G1PA 1NPRA 2HSZA 4CYUB 3OW2R 2DGVA 2LECA 2CNLB 5AE3A 4CO0A 3NEKA 2BCQA 2DGZA 1NK6A 2I7PA 3H40A 1U2RA 1ZBHA 2HIQA 4JMUA 5AM2A 2LM4A 9ATCB 3DLBA 2BMBA 2EH9A 4JD2B 1VQ4S 1X40A 3OPXA 3BF4A 2G8WA 1RZTA 2AJQA 4B02A 4DV3F 3L6QA 1JROA 3ETOA 1RSCA 4IR1A 2YKOA 2AJ1A 3K2PA 4U95A 4EO8A 2PSZA 1WNSA 4ZCIA 4YY3F 5KFUA 1RBTA 2CDRB 4P71A 2RILA 4M3ZA 4FYWB 3RW7A 4M5DA 3V9XA 5J1EB 2O8EA 1Z4NA 2C2RA 1VI7A 2HFVA 8ICJA 3T6JA 4RQ0A 5B0CA 1BIUA 4I69A 3O4QA 2ZNYA 2XZWA 4GC6A 3MR5A 1A5WA 2PEHA 4CZIA 4CFAA 1R0CB 5SZTA 2RDJA 4CZKA 1W0HA 4UOFA 4M42A 2IMWP 1NDKA 1QAYA 1Q46A 2K1RB 4IFVA 4C23A 3AVMA 5LJ5Y 3D2SA 3VF2A 4F92B 2ZZNA 1RISA 4DR7K 3DRPB 2EI5A 4NJ8A 4PQAA 4YQWA 4OLAA 4B3MK 2HK3A 3MAAB 2YMQA 3CERA 4DHVA 4ECYA 1WKJA 2EVZA 4E1JA 3J7Z5 3E01B 1BU6O 1Y9OA 2GMLA 4DX8H 1GQEA 1PBAA 4H54A 5HAOA 9ICCA 4B3TJ 3NS7B 1YRUA 1U48A 2AU0A 2KIWA 7ICQA 3MMCB 4HLBA 1BCMA 2OIHA 3AB2B 3UB5A 1FX4A 4DV7F 4E89A 1KRPA 1G7CB 1TK0A 1XNQK 5JVGL 2FVPA 4K4WA 3W3DA 2MHEA 1O0PA 5L46A 3GFZA 4UOHA 3TW0A 3DXBA 2WF8A 3ZTPA 3ZSYA 2HBLA 3PX6A 5KL1B 1YI2S 4H4KC 9ICAA 2AX0A 5CCMA 3VQAA 2B56A 5H1SQ 3CCRN 2P5GA 2R8KA 2J5AA 4DF8A 3TWHA 3LH2S 2KVCA 1ZQJA 2ZH3A 4K4ZA 2ZUDA 2KFZA 2WBNA 4PWDA 3EGZA 2ASPA 1S9FA 4ZP8A 2B7CB 1JN3A 1CRXA 3ZFVA 4PABA 1DQAA 2R8GA 4KHPF 4R66A 4DTUA 3KOOA 3TO8A 1JJ2M 1I51B 3IG5A 5IXUA 1ZBIA 1RHQB 4I2QB 2FLLA 1WI6A 4NOHA 4RPXA 5KT3A 3M8WA 1E4FT 4RNNA 1FJGF 4DR2F 3C7NB 1RBVA 3WEEA 2YNIA 4F93B 1JQGA 3NRZA 3T69A 1LXJA 4LSLB 1V6HA 4CFBA 2AQ4A 1RLCL 5JVGQ 5KRTA 4N77A 5IV3A 3PYDA 2R4FA 1FK9B 4U96A 1PCAA 3IRXB 1HKBA 2PFNA 4ZVTB 5AQQA 2O1PA 4IEEA 3SCKE 3QMQA 2XMUA 2YCHA 3QDKA 1RT4B 5HK4A 3G6EN 3MM8B 2MQPA 1ASWA 3MM6A 3CQYA 4HTJA 1JLFB 4DXLA 3LDNA 2CRLA 3UE2A 3POTB 4MH8A 5CRXA 1PSDA 3PTWA 2UXDF 4JI0K 4RPZA 3ENHA 1VHFA 3THXB 4KH4A 2KSOA 4HH1A 3JS6A 2OELA 3QLHB 2HMIA 3TKAA 3BGRB 4YY3J 2VL1A 5B7WA 2RJZA 4CEEA 1OVQA 3ZZYA 3FM9A 2ZBPA 4G1QA 2UUAJ 1C1CB 2W04A 4BWJA 3OTBA 4DV5K 4YFKA 4I2BA 3G6VA 2P9KB 4HTIA 4CIOA 2IRYA 3MEDA 1HLUA 2KKHA 1REVA 2ZJRQ 2CH5A 3Q8RB 4IOCQ 4WP9A 3DGPB 2IBKA 1ZTWA 2O5DA 1XC9A 1RDDA 1B43A 5MLCQ 5EE1A 5AM5A 4FYYB 3G82B 4KHPK 1FVSA 4RNMA 5J2QA 3QUTA 3LDSA 5CJ7A 1YG0A 1X8DA 3A3PB 2YKNB 4J9VA 1XMQJ 1WCLA 2HBYB 3BH7B 4DZ6A 5C12A 4F8RA 2W4PA 1UAWA 1ZQFA 5F8MA 1TUVA 2UZAA 3GWCA 4USMA 3MI7X 4BE1A 4CE6A 3VHQA 4LBHA 1AQ6A 1VQON 2RE1A 5KAFU 1BNPA 2CPIA 1RT1A 2W7PA 5LM7E 4KHQA 1Y5NB 1N0VC 4DPWA 3L4QA 2G8VA 3DXMA 2XGPA 5A6PA 2ACYA 1GX5A 4DV3J 3JSMB 1JCFA 1ZXIA 2VWBA 1UA1A 3RYLA 2Y1RI 2FSJA 5LMUF 3K5LA 1S9EB 4USWA 3RR7A 2B8QA 1Y0HA 3K9JA 2G1DA 4LZGA 4BLGA 2ZJRL 3CW2C 4QZCA 4IOCL 2WUSA 3NMUA 2ZJ5A 2HHPA 3I4HX 2A3VA 5LMNK 3MEDB 1XNRJ 4DOCA 4ZKAA 2P9LB 2DGQA 5A8RB 5DB7A 1KWMA 4X4OA 2WHEA 3GIIA 4DL5A 2KVQE 3BSNA 2QMUB 1NH7A 5B66U 5KG7A 3NFAA 1C1AA 3ZNUA 4Y1DA 3SQ0A 3N4WA 3MUTP 3QJJA 1LW2A 4I2PB 1GMVA 2YV0X 2KKZA 4LF8J 5DQHA 1M0SA 1TL5A 1DHMA 1T9TA 3J80Y 2LEBA 1UW9A 4JS4A 1KDHA 5IFMA 4LF5J 3OFHA 3A0IX 3FSYA 3LAKA 3CCVS 2IGIA 1U49A 2XY7A 3Q2SC 4Y2PA 4ZJLA 2K89A 1ZZNA 4LC9B 3SQ2A 4EI2A 4NL9A 2QXFA 5HL7Q 2DR9A 2ZIWB 2OA8A 2CQBA 3V6JA 3OQ2A 3U02A 3R7BB 1SH0A 2BKPA 3JQKA 2Y9HA 3JSBA 3N01A 4Z4EA 4UZBA 2FPMA 3MK6A 4JI5K 1YLXA 1CS4B 2V34A 5A8RA 5E26A 1RBSA 5LL6Z 1UEUA 4JI3J 2ZM6K 2GELA 5AKKA 4LRCA 1K9MT 3AVBA 3FNNA 3OJSA 5KOWA 2Y1IA 3D45A 1IG9A 3RB0A 3AO2A 5DM6L 3BH6B 2G13A 3ZETA 3V1QA 1YHQN 4J9NA 1BG3A 4WXOA 1S22A 4YS2A 4F26A 3JSMA 4ETXA 1XEZA 3TX0A 3AD7C 2ZH9A 3MHYA 3W5YA 4JI2K 2F4VK 3O4NA 3QUCA 4IC9A 2CNOB 4OKEA 1HPMA 4J9RA 1LVHA 1FCAA 3D2WA 3MMBB 2C2ZB 1F2HA 1YJ7A 3W8GA 2NZTA 2BACA 2QA1A 1I1GA 1K73O 4LF2A 5JMVA 3MCOA 5E3AA 4JOUA 4A8XA 4K5SA 1ZQHA 4TVAB 3KXDA 4LJXA 3MZIA 4I6YA 3QNNA 3QT8A 2LKYA 5LMUJ 3VQCA 1C6VA 1LWCB 1S5ZA 1DTTA 8ATCB 2VQFF 1RK8A 1B0XA 4A8YA 3H5UA 5D4OA 4IBNA 1CEZA 4I2FA 4YB7A 2O8EB 2LYHA 5J2NB 2OEJA 5KPTA 1NGCA 3CIPA 3F2CA 5DRKA 4M0AA 1K8KA 2GX9A 2HMXA 1OY6A 4E3SA 1N36F 2LYBA 1PYOB 2KB2A 4OI4A 4L3NA 3NH2A 2RU3A 3EZWA 2A5XA 3VQTA 2ZTCA 3M6GA 3FDSA 1HBMB 3DLHA 1WN7A 2GUPA 4IOAL 4NLGA 3OYDA 5GAHI 3LP1B 2F76X 2C3PA 1RT5B 2F9DA 3OLAA 4Q7AA 1G1XA 1M5HA 2A1RA 5C24B 2Z2LA 4PH5A 3I6PA 3HO1A 4BR0A 2QO3A 4DV0K 2XZTB 4FWNA 3ZDBA 3J7A1 5E5NA 3SFGA 3THPA 3TZXA 4YP3A 2IJNA 4JV5K 4DDFA 1KVKA 1A6SA 4TU9A 1ICEB 3ZYYX 4CGIA 3GZ7A 4NM2A 3V7JA 4I2GA 3EE9A 1U2FA 2B5JB 4DUZK 2AZ3A 4H03B 2IIHA 3NP5A 2FF6A 3HPGA 5J0UA 3NH1A 1H2UX 1CQMA 5AQJA 3H1VX 4QZDA 2CQ1A 4DQ8A 1OY9A 1RAHB 2LQ8A 5AQYA 2CVEA 1HKCA 2JOQA 2DNLA 4I2DA 5AQRA