5KNIA

Crystal structure of the wild-type sam domain of human tankyrase-1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
58
structure length
58
Chain Sequence
MNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tankyrase-1
publication title Tankyrase Sterile alpha Motif Domain Polymerization Is Required for Its Role in Wnt Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 58
sequence length 58
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5kniA00
1SV4A 2YTUA 2FE9A 1RG6A 2E8PA 1V85A 5F3XB 1SXEA 4IS7A 5L1MA 1SXDA 4NJ8A 3H8MA 1SV0C 2ES6A 1COKA 2F44A 2Y9UA 2B6GA 1UQVA 2D8CA 1X66A 4NL9A 1JI7A 1LKYB 4NL9C 2D3DA 3IDWA 2QB0B 2L5YA 3SENA 2EAPA 2KMDA 2DKXA 1PK3A 3BQ7A 3HILA 2EANA 5JTIA 1SV0A 5JRTA 1UCVA 2JV3A 2DL0A 1KW4A 1X9XA 2K60A 3K1RB 1LKYA 1B0XA 2Y9TA 4MHVA 1SGGA 2QB0A 1Z1VA 2ESEA 2QKQA 2KSOB 1OW5A 2E8OA 5J8YC 2LPEA 2K4PA 2DKZA 1WWVA 1F0MA 4RQNA 2LMRA 4PZOA 3SEIA 2F3NA 2QARB 2EAMA 2GLEA 2QB1A 5KNIA 1V38A 2QARA 1X40A 5JU5A 2KG5A 2KE7A 3TACB 2KSOA 2KIVA 2F8KA 4PZNA 5J8YA 3BS5B 2EAOA 1PK1B 1DXSA 2E8MA 1WWUA 3BS5A 3TADA 4RQMA 2E8NA 3TADC 3BS7A 1PK1A 3KKAA 1B4FA 3KKAC 1OXJA
chains in the Genus database with same CATH superfamily
2WF8A 3DV9A 1TK5A 1TE2A 2IOHA 5C5JA 3JPSA 3RAQA 3RAXA 5KG5A 4X5VA 2Y9UA 5KFTA 4M6WB 2KEYA 1IXRA 4OJLA 1ZQBA 1IV8A 2W43A 3H4DA 3G6VA 2L5YA 3QZ7A 2ATLA 2BQUA 3HPOA 4IQVA 4B9VA 1ZQYA 3MGHA 3BDPA 1QLNA 4RUAA 2JXJA 1JN3A 2VJ4A 5ALVA 5JTIA 3SR6A 5J2EA 8ICXA 3UMCA 4QZIA 5JRTA 5HP4A 2W04A 3AQEA 2KJ9A 4M0AA 4KLHA 2BPFA 4DF4A 4JB3A 9ICKA 3C29A 2HVIA 3H4BA 1UT8A 5IIJA 4P0PA 2QB0A 3T3FA 3V6HA 2WHEA 4QZEA 4EENA 4JV2A 2AQ4A 7ICQA 4XA5A 3UQ2A 4I2HA 3M6KA 4DSJA 4IQUA 3QU5A 2DKZA 3ZDDA 2FLLA 2MUTA 4RQNA 1Q3UA 4F91B 3JPOA 4PZOA 4AYBC 1KFSA 4UB8U 4QZCA 2ZIWA 2PXIA 4R8UB 2EAMA 2BCSA 4O5EA 4M47A 2OWOA 3JPTA 5EE3A 2IOFA 4NV0A 1N48A 2F76X 1RPLA 2YMLA 5J0RA 2FMQA 1Z00B 8ICLA 3HJEA 4Y2RA 3PW7A 2DWQA 4G9BA 2E5SA 3IG8A 4I29A 2WB1C 4F3OA 3RH4A 9ICEA 4RNMA 4ECQA 3KTQA 3WKCA 2ZIVA 1KQQA 4F4XA 2B6GA 3TI0A 2XY5A 2W9BB 2ZUBA 2BCVA 5AM3A 4KLLA 5ALDA 4RU9A 4OO1J 1N5XA 4KLUA 2AH5A 2LYAA 3ORYA 4J9SA 3C2LA 1N56A 2C28A 4YD1A 8ICBA 2EANA 1L7PA 2KK0A 5KL8B 1BPZA 1SZHA 4QZGA 4YR0A 2W9CA 1ZJMA 4Q44A 4O3RA 1RXVA 1JX4A 1ZQEA 2RDIA 2I1QA 3ICXA 5DQIA 1UPHA 3NVWA 4MFAA 3FYHA 3AUOA 3MGIA 2OYYA 2H3FA 4ECYA 1S8OA 3SI8A 3PO5A 1SZPA 3AM9A 4C8LA 1L7OA 2A1JB 4RQ6A 5IILA 1F0MA 1X9MA 2FPMA 1XU4A 4ELTA 5ALMA 3IV6A 3PMNA 3TAQA 2R8JA 2A19A 4DO9A 2KV2A 2ZJ8A 1XO1A 1X40A 3MGVA 4RQ8A 3E0FA 4FFDA 3LYSA 4ED7A 4IL6U 4DL6A 2F8KA 2KHQA 4US9A 3PW4A 3WKEA 1NJZA 4BX9C 4B9LA 5KFPA 4FBUA 3KKAA 5KT7A 1Y88A 3NS1A 1RG6A 4JMUA 2W7PA 1V85A 4F93B 1S0NA 2HI0A 3T5LA 3N28A 1KFDA 2JEFA 3PZPA 4YP3A 1L5UA 3TKAA 4Y2UA 2K4IA 2AGPA 1ZQSA 3RB4A 1XSLA 5F9LA 1XSPA 7ICNA 4DSIA 4KTQA 2K89A 4DWIA 1ZQOA 5KFNA 1L6NA 1FEZA 5ALTA 4UB3A 5EOZA 1X2IA 2XY6A 2NRVA 3GV8B 1UCVA 4F8RA 2JV3A 1RDFA 2E1FA 1L7MA 3AU6A 5DQHA 3S6JA 1ZQIA 3JPNA 3ETRA 5KFGA 5KFJA 4QWEA 4LZDA 3QUBA 5AI9A 4F4WA 2YY6A 3M9MB 2DFLA 2XCPA 2MU2A 2W03A 1HEKA 4PHPA 3TARA 2B0CA 4C80A 1WWVA 2ASLA 3UMBA 1NK6A 4KLSA 3TANA 2ZIUB 2KD1A 3C2KA 4FZNA 2UVVA 3RJJA 2B21A 5J0QA 3M9NB 4Y2XA 3RB6A 4KLGA 2NV3A 1K5OA 3BS7A 1NK8A 4J9QA 5L1LA 2FE9A 1Q3VA 1VJ5A 3IM1A 4BXOB 4UAVA 3EWAA 5DBCA 3OHBA 3U26A 4CDGA 1SB3C 4BJQA 3ZD8A 3JPQA 4M9JA 1QCKA 1SWVA 1WCNA 4F5OA 4TUSA 2DKXA 2DPIA 1AROP 1DK2A 2HOQA 9ICAA 2YB4A 8ICIA 2JMGA 2JZBA 1WYGA 5J2JA 4YR3A 3H40A 2IMWP 4EX6A 4ED0A 4UAWA 7ICMA 2DL0A 2G06A 4KLDA 2JR5A 2KKPA 4UASA 1N5WA 1SL2A 1J2MA 4YR2A 2ZIXA 2PI5A 4I2BA 3ZDBA 1S0MA 1L3SA 9ICSA 2KSOB 4M9GA 2K8CB 1QQ6A 9ICTA 4I2JA 9ICGA 3PSTA 4ICAA 2J6TA 2LPEA 4NLCA 7ICSA 2I5HA 1Q8KA 2MAXA 7ICRA 2K8AA 4M2YA 3BQTA 4Y2PA 3PW2A 2AU0A 1CEZA 2KP7A 4GFJA 2Y0SF 1RYUA 7ICVA 5ALHA 2HBLA 3C23A 5J2FA 2LKYA 4YMNA 1WUDA 2EAOA 4P0QA 1PK1B 1DXSA 3TADA 5J0SA 1B4FA 1F5SA 2E8PA 4US8A 5KFOA 4JUZA 2WF9A 1X6JA 3V72A 2HMXA 5AKGA 3L4PA 4LJXA 4NL9A 1F44A 1FFUA 4NLGA 1TAUA 1Q46A 2HHVA 1AQ6A 2HVHA 3QX7A 4CCHA 4FO6A 3B9JA 3M9OB 1HUOA 3BQ7A 2LM4A 4HAIA 2MSNA 3KFUF 8ICAA 1YZ6A 2JH1A 1RYSA 5ALPA 1OUQA 3PR4A 4EBCA 5J0TA 3IRUA 4OJ5A 4C7ZA 3D2QA 2ZJ5A 1D9DA 1RQNA 1X9WA 1TVAA 3ZDAA 4KLJA 2BPCA 4Z6CA 1ZQKA 5D46A 3AQFA 5CB1A 1S97A 2IA6A 5DBBA 3WK9A 1SIJA 3IN5A 1XS9D 3I28A 5KFMA 5KFZA 3H8SA 2P35A 4UBCA 4NM1A 1NKEA 3F2DA 1TV9A 2JGAA 5AKKA 2W3SA 3NRZA 1A77A 2W55A 1N2XA 4ECTA 4C8OA 5ALUA 2QARB 3GZFA 2IHMA 5ALNA 4F2SA 3KHHA 4R8UA 5AKLA 1V38A 1XSNA 3F2CA 1ZQGA 5AKJA 4DOBA 4KMUA 2DGZA 1Z00A 1FFVA 4FS1A 4M9LA 2HHQA 3V6JA 4F4YA 5J0OA 5CHGA 4I2GA 5L1IA 4MF2A 4O3PA 4YFKA 2KJ5A 3QYPA 5AI8A 3FM9A 4DOAA 2KHVA 5HR7A 2ZXIA 1ZRNA 4CE6A 3PW0A 4DLEA 4TQRA 3OJSA 5IINA 1L3VA 5HHIA 1X66A 4EEYA 2W9BA 3PX4A 3EPGA 3MR5A 2KMDA 3OSPA 3OPXA 4GC7A 5KFSA 7ICPA 5KFXA 3H0LB 2KKVA 5KFRA 1ZQCA 5T14A 3HP6A 1CUKA 3ISDA 3ISBA 4ED1A 8ICYA 1NK5A 2F1IA 2BCQA 2UVUA 1X9XA 5DB6A 1NK7A 3G6YA 2Y9TA 3RR8A 3C1YA 3KOOA 2HOFA 4KLIA 2OH2A 5KT4A 4GXKA 3RB3A 2XO7A 2AHOB 4PL1A 2G5IB 1MN8A 3TFSA 1OW5A 5AKHA 1EXNA 4NLZA 2K4PA 3PSFA 5DGBA 3C1ZA 9ICFA 4I2AA 4KN4A 4UATA 2OHFA 2OCEA 3MBYA 3QU4A 1IM4A 2VANA 1N63A 5DLFA 3GIIA 3G6XA 2BGWA 5AICA 5KNIA 5AI5A 4DS4A 1H38A 5ALRA 2KG5A 5DBAA 5KFAA 3SAGA 3AL0B 1ZQXA 2RLTA 9ICLA 4RQ0A 2WF6A 1DRGA 4B9NA 3BZCA 2KICA 3EPIA 5ALGA 2NYVA 3QU2A 2OEHA 2H3ZA 3T5KA 1TFRA 5EE1A 1VLBA 3AEVA 5ALKA 3H8MA 5KFCA 1ZD4A 2EH9A 3RFAA 4P4PA 4M04A 1KKXA 1ZQDA 4FS2A 3VC8A 5G5GA 1MA7A 3ALRA 4DFMA 3SENA 3KZXA 4NM2A 7ICOA 1PK3A 5AIBA 1Z19A 3HILA 9ICCA 2HW3A 4KLTA 4QW8A 5KTQA 4ZH4A 5KG1A 4YD2A 5J0PA 2BCUA 4EZ9A 4UQGA 3GV7B 4QIWC 3UPQA 3B0YA 4DSLA 3RR7A 5TZVA 1L8OA 4J03A 1B43A 4C7YA 5KT6A 3SZ2A 3CYMA 4YXMA 4EX7A 2QKQA 7ICIA 2YMQA 2AXTU 5E79U 5AKXA 4P2HA 5ALFA 1ZQFA 3LWLA 3KBBA 4CNQA 4BUGA 3L3FX 5KAIU 3AN1A 2XIDA 2WF5A 4PGYA 5DDMA 3Q8QB 4EZ6A 3F5EA 5J0YA 1RZTA 2EZXA 4O3MA 3PVXA 2KTQA 4RNOA 1IG6A 2M9NA 2CXYA 4O0IA 4C0ZA 3C28A 2W3RA 2A1AA 4TUPA 1ZQVA 2G0AA 1ZOLA 4HYKA 2Z7JA 3RBEA 2DQNB 2RQ5A 3NVVA 1NZBA 9ICOA 4DF8A 4ACOA 4DEZA 3WK7A 3SMVA 1CI4A 3J81j 1TK8A 4TUQA 3KKAC 1OXJA 3SV4A 4I2FA 4NY8A 1U4BA 4RUCA 3D6JA 3B0XA 2PI4A 1C7YA 2A3VA 2PFQA 5F3XB 3LK9A 1SXDA 4ECSA 1SV0C 4OCZA 3HT3A 4BXOA 3ZDEA 4Q43A 2W54A 4JWMA 7ICHA 5TISU 4PGQA 1QH9A 1T94A 1P7DA 3PR5B 4YMOA 2QB0B 2BR0A 8ICSA 2Y0SC 4CF5A 1RQLA 5KT5A 4RQ3A 3SAHA 1LVHA 3M8RA 5ALQA 1L8LA 2C2DA 1SV0A 2FLPA 4A8EA 1D9FA 3VCBA 2BCRA 1X6IA 4QZFA 2MUTB 1N62A 2JH7A 5ALWA 4IRCA 4PGXA 3HX0A 2MRLA 1B0XA 3FC4A 3DDHA 5HNKA 4DQRA 4IQTA 5KFUA 1NJXA 3A0BU 3AU2A 1M6YA 1COOA 4G3IA 3TQ1A 3NRWA 1BNPA 2KZZA 9ICWA 2WAQC 5HHHA 3R9KA 2P6UA 4XUSA 4ED8A 1IIPA 2KOBA 3GDXA 2IOFK 3ZI4A 8ICOA 2FPLA 1A6SA 1JALA 4Q45A 4LVSA 2LHTA 3F5AA 2VA2A 3NTUA 1NK4A 2W11A 3NVZA 1NK9A 2OXOA 4O3SA 4M9NA 2KIVA 3D2SA 3WK5A 2VA3A 3BS5B 2EZZA 3WK6A 2ZUDA 2ZXHA 5ALEA 1XWLA 1PK1A 5AM4A 5CR0A 3M8SA 3N7SC 2KNJA 2AGQA 1ZQPA 3WKDA 4RNNA 2Y1IA 2XI9A 8ICMA 1QSLA 2JRZA 2GO7A 4FBTA 1PUZA 4I27A 4Q8FA 3QUQA 4MFFA 3T5HA 5GTHU 2JHDA 1SKRA 4Z6DA 2V4RA 3E2EA 3PNCA 3QUCA 4B9UA 1ED1A 2EQYA 4UB6U 4QWAA 2VA8A 2EAPA 5D49A 1J2NA 3M1YA 3V7JA 4Y2SA 2WB1F 8ICUA 2F1JA 4J9OA 5EWEA 4FZMA 4KLEA 2KVCA 1URJA 3MABA 3OGUA 1O08A 2YX8A 2ZJAA 1ZRMA 1KSPA 1LKYA 2LI6A 4CF3A 8ICEA 4NLNA 2JEGA 5AK3A 4R63A 1ZQWA 2C2RA 4OJPA 2F77X 3HWTA 3MR6A 3GILA 1TKDA 2UVWA 4M9HA 5H2FU 4F50A 3ED5A 3PX0A 2ALZA 1ZD2P 5DKWA 2WFAA 3N4MB 2N1RA 1ZJNA 1N61A 4Y2TA 3MDAA 3RF9A 4QZDA 4DL4A 1C20A 1ZQLA 2LYHA 5KG6A 2QARA 3GFKB 1ZQZA 5JU5A 2AQ0A 5KAFU 1QSYA 1QTMA 3GU3A 1K1QA 2EDUA 4C4RA 2R8HA 9ICHA 5J0XA 4F72A 3BQ0A 2E8MA 1WWUA 5J29A 3TADC 1Z1BA 1ZYQA 4MF8A 4JK1A 4I2DA 3RH6A 2PFPA 3IG5A 3C21A 2HHXA 3MR2A 5ALYA 4F2RA 2KJ8A 1PVQA 5AKYA 3QE9Y 3QU7A 3I1YA 4CF4A 2K8BB 2ZTCA 5KG7A 4C8KA 4NL9C 4UW9A 3CW2C 4IRDA 4UAUA 3FAHA 3RBDA 4KMOB 3N7RC 2G09A 3JPRA 2BZFA 4U7CA 4DL7A 4RQ1A 4IC9A 3UM9A 8ICHA 3RJHA 1XC9A 1YZ7A 3RRGA 3C5GA 4BWJA 9ICRA 3HW8A 3GIMA 4M6WA 4OJOA 1T7PA 4DL3A 9ICIA 2K4EA 2W9AA 3K1RB 1L7NA 4XRHA 5G5HA 4J9PA 2H3QA 1UA0A 4JWNA 5KG3A 2H3VA 2ESEA 1S77D 4PHEA 2Q0ZX 1S5LU 1UHUA 1ZQHA 5K4LA 2NO4A 2G5HB 5KT3A 8ICFA 2XGQA 5AM0A 4QWCA 4C4TA 4J9MA 4R66A 1NOMA 4RT3A 1HIWA 4F71A 2HHUA 4Y2VA 1PZNA 2JEJA 4B9MA 1T3QA 2R8IA 2O6KA 4WJ3B 7ICJA 1RM6C 5CA7A 5KFKA 1ZQJA 4RQ7A 1S0OA 1SL0A 1MQ3A 4KX3A 4KLQA 1Z4OA 3H7IA 8ICQA 9ICMA 5KT2A 2Y1JA 2OM6A 4DFJA 3WK8A 8ICRA 4GIBA 2WF7A 3E58A 1L3UA 4UARA 4IS7A 2KIWA 8ICTA 4CRXA 2ES6A 1QQ5A 1ZQNA 5J2IA 2PFOA 5AKIA 1UQVA 2D8CA 8ICVA 3RRHA 5BOMA 5AM2A 4DQPA 1NNLA 2C22A 3QUTA 3MC1A 2YB1A 3BQ1A 4ECWA 1ZQMA 5DB8A 4ECUA 2HDOA 4JV1A 1BPYA 1ECWA 1GO3F 2W9MA 1NJWA 5CJ7A 2KVSA 4UB1A 1ZD3A 4ED6A 5ALSA 4YVZA 5DB9A 1TK0A 3ONNA 2VJ5A 4DLGA 3OSNA 5DGAA 5ALOA 3M7DA 4DOCA 2BHNA 3UMGA 3PY8A 2K60A 3UXPA 5AIAA 8ICWA 4C4SA 2BDPA 2K4HA 1ZQ1C 2EZYA 4FZLA 1Z4NA 9ICUA 2H5XA 2E3TA 3CRXA 4RT2A 4C8MA 3Q8KA 2YQEA 1SL1A 3LVWA 3EW9A 3ZDCA 1L3TA 2XC9A 1BPBA 2M0NA 5KFIA 4TURA 5HR6A 2IBKA 1X42A 4FE3A 2KZMA 3T79A 4JV0A 2IHNA 4B9SA 5AI6A 1NK0A 5J2AA 2PMZF 4QZHA 2KE7A 4ED2A 3RJIA 3N7PD 1VDVA 2XICA 4F5QA 3UXOA 2A1JA 4ECZA 5J2CA 4DSKA 1U48A 1KL9A 3EZ5A 1BNOA 5DB7A 4QZ8A 2CRXA 2F44A 2R8KA 5AK4A 4RPYA 4R65A 2D3DA 4R64A 5KFFA 3IDWA 9ICVA 3FDSA 1D8YA 4GLXA 2FI1A 1NJYA 1KRPA 3WKAA 4B9TA 1U47A 4NXZA 4KITB 2G07A 2BQRA 5KFDA 4J9NA 2J6UA 3WK4A 8ICCA 3BZKA 5J2KA 2JEIA 1V97A 4PHAA 8ICJA 1JUDA 3GIJA 4YMMA 1JMSA 4J9KA 4U6PA 3F53A 2RDJA 4F5PA 3KD3A 1NZPA 5DDYA 2NRZA 4GC6A 9ICPA 4RPZA 2ZTEA 2XVTA 3EYZA 3HKZF 1DOQA 4Y2YA 3UQ0A 1X9SA 2NRWA 2FJ6A 5J0UA 3OHAA 3IHQB 4O3OA 4C8NA 5DG7A 4F4KA 3HRDD 3Q8SB 2YN4A 4QW9A 3GIKA 2GLEA 1ZQUA 5KFWA 5EWGA 5HMMA 3NGDA 1DGSA 4QJFB 3D2NA 3WU2U 1A76A 3Q8MA 5J2HA 4RPXA 3BS5A 3L5KA 1ZXIA 3OTQA 4UB2A 2HSZA 2BQ3A 1T4GA 3RJEA 5KFBA 1SXEA 3C5FA 5D4BA 5KFQA 2R8GA 2ZIUA 1S0VA 3DEEA 3V7KA 1DGJA 9ICQA 9ICBA 1U49A 1QSSA 3ISCA 5DG8A 2HBMA 2F2AB 5CWRA 2DF4B 1JXLA 5FP0A 5IIMA 7ICGA 3KHRA 3MFHA 4CGZA 1K1SA 4MEYA 2D6FC 2ZG6A 1WCLA 2KFZA 2BPGA 4RQ4A 2QLTA 2V9WA 2I6XA 3Q8LA 5KG4A 2I9GA 1KW4A 4UBBA 4P0PB 5DQGA 5IIOA 3QNMA 4DQQA 3ETLA 1HJPA 4MHVA 1S9FA 4DCCA 4XQ8A 8ICNA 1BPXA 4DQIA 8ICKA 2Q4TA 2E1EA 3LDAA 3MDCA 3AMZA 1U9LA 4P4OA 4UB5A 3QXGA 2ZIWB 1YT3A 5AHXA 2C2EA 3TFRA 3PW5A 2HHTA 4I2CA 4ECVA 1SKSA 4UB4A 4EELA 2ISPA 3TACB 2KSOA 2F1HA 5ALLA 4PZNA 1PVRA 1BPEA 3NVYA 2BDUA 5L1JA 4B6JA 2ASJA 2BKEA 9ICJA 4EYHB 4O3QA 3QEAZ 5KFLA 3SYZA 1RYRA 4K4HA 4J9LA 1KFTA 2XCAA 3SQIA 4KLMA 2ZIVB 1N60A 1KBUA 4EBEA 1U45A 5AI0A 4Y2JA 3C2MA 4ED3A 3RB0A 4KLFA 4KX5A 4QWDA 3H0MB 1MQ2A 5AK5A 7ICLA 4QWBA 4MFCA 3WKBA 1O03A 4PJ0U 5BPCA 1NKCA 1T3NA 5AM1A 3PMLA 2FPKA 1MSWD 4ELVA 3T5JA 1D8LA 2G08A 4AYBF 3K1ZA 2W9CB 5F9NA 2P66A 2HBKA 3MFIA 2MA1A 1S76D 1T8EA 1SWWA 2HOIA 5KFVA 3N97B 5KFHA 4DS5A 5KL1B 2YMMA 2KN7A 4O9MA 3CNHA 3OJUA 5J0WA 8ICPA 7ICTA 2P6RA 4EYIB 1ZQRA 5GTIU 1D8BA 4BGDA 2UVRA 3QEBZ 4DL5A 2H3IA 3GV5B 1CRXA 2J6SA 5B5EU 2LMRA 2NRTA 4OD0A 1XO0A 4QIWF 5ALJA 1ZQTA 2QB1A 1ZETA 4Z6EA 5KG2A 3LVVA 1KEJA 2DBYA 1FIQA 2NRXA 3CP8A 4EEKA 4Y2QA 3RH5A 3PX6A 3K75D 5CRXA 4J9RA 2KZ3A 3KHLA 4RQ2A 2E8NA 1Z3EB 5C0YA 1UT5A 1KN5A 4QZAA 1SV4A 1JIHA 2ZTDA 1LB2B 3A0HU 2PFNA 5L1MA 3SD7A 4NJ8A 3Q8PB 3RJKA 1COKA 5CEHA 2FMSA 1WG8A 1JRPA 2HCFA 3RJFA 4GXIA 3LWMA 4NWIA 2PMZC 4YXJA 2FDRA 5L9XA 5KFYA 5EE0A 7ICEA 2WTFA 5HMLA 4I2IA 3PSPA 2PKEA 4O3NA 4NLBA 5CP2A 3PV8A 1JXEA 7ICUA 4PH5A 1V9PA 2CN1A 5BOLA 1UA1A 4OJ6A 1BPDA 3F2BA 4YQWA 4YCXA 4LZGA 3RJGA 1S10A 1ZQQA 2CPRA 3V6KA 2VIXA 2ASDA 5AKEA 2YMPA 3BJYA 1MC8A 2ZUCA 5IIIA 7ICKA 4F4ZA 1Z1VA 4K4IA 5DLGA 1NI3A 1XNSA 2DPJA 3QU9A 3K4GA 5A0LA 4QZ9A 3MR3A 3SV3A 5AI4A 3KHGA 2R18A 1ZQAA 4KLOA 5ALIA 4Z6FA 5B66U 9ICXA 5J2BA 3NASA 4IR1A 3RTVA 3JPPA 5ALZA 4ECXA 2AJQA 3TAPA 4QZBA 1QQ7A 2AGOA 4UAYA 5J2DA 4USAA 2LYBA 1J97A 3PSIA 1ZD5A 2WAQF 5KFEA 3HKZC 2RHFA 2YTUA 4DSFA 1NKBA 4IRKA 1TAQA 5AM5A 4GXJA 3ZD9A 4K4GA 3O0FA 2FLNA 2LBOA 3SAFA 1BVSA 1SKWA 3NUQA 4PPXA 4F92B 4I28A 4IQWA 3IP4B 1JI7A 1LKYB 1RXWA 1KLNA 5AK6A 5J2GA 2GOLA 4KN7A 3THVA 1JROA 4NLKA 2VKQA 4BDPA 8ICZA 2XGPA 5IIKA 2KFNA 4DFKA 4I2EA 4PHDA 2JZBB 2RP5A 5EE9A 1PVPA 7ICFA 4DFPA 9ICNA 2RRDA 1TAMA 3H8WA 4RZRA 4EBDA 3QZ8A 2GH1A 4O5KA 4O5CA 4ELUA 4DL2A 2LM1A 2W8KA 2F8LA 2ODGA 3Q8RB 4F5RA 4F5NA 5ALXA 1KDHA 3M6ZA 3PO4A 3EUB2 5JUMA 2ZIXB 3GQCA 2FMPA 1SGGA 4DSEA 3KZIU 5AKZA 5KG0A 4IR9A 4E0DA 1DK3A 4DQSA 4TQSA 2NO5A 4PL2A 4P4MA 1LV5A 2DUYA 3I76A 4RQ5A 2GWSA 5DG9A 3BQ2A 2E8OA 2XY7A 3H8JA 1KTQA 5J8YC 1FO4A 2W7OA 4AP9A 4ECRA 2V4QA 2HBJA 3H0RB 3SEIA 2F3NA 4BWMA 4ZOHC 3V7LA 3UXNA 4UAZA 2W8LA 1A0PA 1BGXT 4QNLA 4MEXA 4YG2A 4P0QB 2HHSA 4Q8EA 1B22A 4DFDA 5J8YA 1HUZA 2HHWA 8ICGA 4YN4A 4RQMA 5EWFA 2ISOA 5L1KA
chains in the Genus database with same CATH topology
1SV4A 2YTUA 2FE9A 1RG6A 2E8PA 1V85A 5F3XB 1SXEA 4IS7A 5L1MA 1SXDA 4NJ8A 3H8MA 1SV0C 2ES6A 1COKA 2F44A 2Y9UA 2B6GA 1UQVA 2D8CA 1X66A 4NL9A 1JI7A 1LKYB 4NL9C 2D3DA 3IDWA 2QB0B 2L5YA 3SENA 2EAPA 2KMDA 2DKXA 1PK3A 3BQ7A 3HILA 2EANA 5JTIA 1SV0A 5JRTA 1UCVA 2JV3A 2DL0A 1KW4A 1X9XA 2K60A 3K1RB 1LKYA 1B0XA 2Y9TA 4MHVA 1SGGA 2QB0A 1Z1VA 2ESEA 2QKQA 2KSOB 1OW5A 2E8OA 5J8YC 2LPEA 2K4PA 2DKZA 1WWVA 1F0MA 4RQNA 2LMRA 4PZOA 3SEIA 2F3NA 2QARB 2EAMA 2GLEA 2QB1A 5KNIA 1V38A 2QARA 1X40A 5JU5A 2KG5A 2KE7A 3TACB 2KSOA 2KIVA 2F8KA 4PZNA 5J8YA 3BS5B 2EAOA 1PK1B 1DXSA 2E8MA 1WWUA 3BS5A 3TADA 4RQMA 2E8NA 3TADC 3BS7A 1PK1A 3KKAA 1B4FA 3KKAC 1OXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV4 A;  2YTU A;  2FE9 A;  1RG6 A;  2E8P A;  1V85 A;  5F3X B;  1SXE A;  4IS7 A;  5L1M A;  1SXD A;  4NJ8 A;  3H8M A;  1SV0 C;  2ES6 A;  1COK A;  2F44 A;  2Y9U A;  2B6G A;  1UQV A;  2D8C A;  1X66 A;  4NL9 A;  1JI7 A;  1LKY B;  4NL9 C;  2D3D A;  3IDW A;  2QB0 B;  2L5Y A;  3SEN A;  2EAP A;  2KMD A;  2DKX A;  1PK3 A;  3BQ7 A;  3HIL A;  2EAN A;  5JTI A;  1SV0 A;  5JRT A;  1UCV A;  2JV3 A;  2DL0 A;  1KW4 A;  1X9X A;  2K60 A;  3K1R B;  1LKY A;  1B0X A;  2Y9T A;  4MHV A;  1SGG A;  2QB0 A;  1Z1V A;  2ESE A;  2QKQ A;  2KSO B;  1OW5 A;  2E8O A;  5J8Y C;  2LPE A;  2K4P A;  2DKZ A;  1WWV A;  1F0M A;  4RQN A;  2LMR A;  4PZO A;  3SEI A;  2F3N A;  2QAR B;  2EAM A;  2GLE A;  2QB1 A;  5KNI A;  1V38 A;  2QAR A;  1X40 A;  5JU5 A;  2KG5 A;  2KE7 A;  3TAC B;  2KSO A;  2KIV A;  2F8K A;  4PZN A;  5J8Y A;  3BS5 B;  2EAO A;  1PK1 B;  1DXS A;  2E8M A;  1WWU A;  3BS5 A;  3TAD A;  4RQM A;  2E8N A;  3TAD C;  3BS7 A;  1PK1 A;  3KKA A;  1B4F A;  3KKA C;  1OXJ A; 
#chains in the Genus database with same CATH topology
 2WF8 A;  3DV9 A;  1TK5 A;  1TE2 A;  2IOH A;  5C5J A;  3JPS A;  3RAQ A;  3RAX A;  5KG5 A;  4X5V A;  2Y9U A;  5KFT A;  4M6W B;  2KEY A;  1IXR A;  4OJL A;  1ZQB A;  1IV8 A;  2W43 A;  3H4D A;  3G6V A;  2L5Y A;  3QZ7 A;  2ATL A;  2BQU A;  3HPO A;  4IQV A;  4B9V A;  1ZQY A;  3MGH A;  3BDP A;  1QLN A;  4RUA A;  2JXJ A;  1JN3 A;  2VJ4 A;  5ALV A;  5JTI A;  3SR6 A;  5J2E A;  8ICX A;  3UMC A;  4QZI A;  5JRT A;  5HP4 A;  2W04 A;  3AQE A;  2KJ9 A;  4M0A A;  4KLH A;  2BPF A;  4DF4 A;  4JB3 A;  9ICK A;  3C29 A;  2HVI A;  3H4B A;  1UT8 A;  5IIJ A;  4P0P A;  2QB0 A;  3T3F A;  3V6H A;  2WHE A;  4QZE A;  4EEN A;  4JV2 A;  2AQ4 A;  7ICQ A;  4XA5 A;  3UQ2 A;  4I2H A;  3M6K A;  4DSJ A;  4IQU A;  3QU5 A;  2DKZ A;  3ZDD A;  2FLL A;  2MUT A;  4RQN A;  1Q3U A;  4F91 B;  3JPO A;  4PZO A;  4AYB C;  1KFS A;  4UB8 U;  4QZC A;  2ZIW A;  2PXI A;  4R8U B;  2EAM A;  2BCS A;  4O5E A;  4M47 A;  2OWO A;  3JPT A;  5EE3 A;  2IOF A;  4NV0 A;  1N48 A;  2F76 X;  1RPL A;  2YML A;  5J0R A;  2FMQ A;  1Z00 B;  8ICL A;  3HJE A;  4Y2R A;  3PW7 A;  2DWQ A;  4G9B A;  2E5S A;  3IG8 A;  4I29 A;  2WB1 C;  4F3O A;  3RH4 A;  9ICE A;  4RNM A;  4ECQ A;  3KTQ A;  3WKC A;  2ZIV A;  1KQQ A;  4F4X A;  2B6G A;  3TI0 A;  2XY5 A;  2W9B B;  2ZUB A;  2BCV A;  5AM3 A;  4KLL A;  5ALD A;  4RU9 A;  4OO1 J;  1N5X A;  4KLU A;  2AH5 A;  2LYA A;  3ORY A;  4J9S A;  3C2L A;  1N56 A;  2C28 A;  4YD1 A;  8ICB A;  2EAN A;  1L7P A;  2KK0 A;  5KL8 B;  1BPZ A;  1SZH A;  4QZG A;  4YR0 A;  2W9C A;  1ZJM A;  4Q44 A;  4O3R A;  1RXV A;  1JX4 A;  1ZQE A;  2RDI A;  2I1Q A;  3ICX A;  5DQI A;  1UPH A;  3NVW A;  4MFA A;  3FYH A;  3AUO A;  3MGI A;  2OYY A;  2H3F A;  4ECY A;  1S8O A;  3SI8 A;  3PO5 A;  1SZP A;  3AM9 A;  4C8L A;  1L7O A;  2A1J B;  4RQ6 A;  5IIL A;  1F0M A;  1X9M A;  2FPM A;  1XU4 A;  4ELT A;  5ALM A;  3IV6 A;  3PMN A;  3TAQ A;  2R8J A;  2A19 A;  4DO9 A;  2KV2 A;  2ZJ8 A;  1XO1 A;  1X40 A;  3MGV A;  4RQ8 A;  3E0F A;  4FFD A;  3LYS A;  4ED7 A;  4IL6 U;  4DL6 A;  2F8K A;  2KHQ A;  4US9 A;  3PW4 A;  3WKE A;  1NJZ A;  4BX9 C;  4B9L A;  5KFP A;  4FBU A;  3KKA A;  5KT7 A;  1Y88 A;  3NS1 A;  1RG6 A;  4JMU A;  2W7P A;  1V85 A;  4F93 B;  1S0N A;  2HI0 A;  3T5L A;  3N28 A;  1KFD A;  2JEF A;  3PZP A;  4YP3 A;  1L5U A;  3TKA A;  4Y2U A;  2K4I A;  2AGP A;  1ZQS A;  3RB4 A;  1XSL A;  5F9L A;  1XSP A;  7ICN A;  4DSI A;  4KTQ A;  2K89 A;  4DWI A;  1ZQO A;  5KFN A;  1L6N A;  1FEZ A;  5ALT A;  4UB3 A;  5EOZ A;  1X2I A;  2XY6 A;  2NRV A;  3GV8 B;  1UCV A;  4F8R A;  2JV3 A;  1RDF A;  2E1F A;  1L7M A;  3AU6 A;  5DQH A;  3S6J A;  1ZQI A;  3JPN A;  3ETR A;  5KFG A;  5KFJ A;  4QWE A;  4LZD A;  3QUB A;  5AI9 A;  4F4W A;  2YY6 A;  3M9M B;  2DFL A;  2XCP A;  2MU2 A;  2W03 A;  1HEK A;  4PHP A;  3TAR A;  2B0C A;  4C80 A;  1WWV A;  2ASL A;  3UMB A;  1NK6 A;  4KLS A;  3TAN A;  2ZIU B;  2KD1 A;  3C2K A;  4FZN A;  2UVV A;  3RJJ A;  2B21 A;  5J0Q A;  3M9N B;  4Y2X A;  3RB6 A;  4KLG A;  2NV3 A;  1K5O A;  3BS7 A;  1NK8 A;  4J9Q A;  5L1L A;  2FE9 A;  1Q3V A;  1VJ5 A;  3IM1 A;  4BXO B;  4UAV A;  3EWA A;  5DBC A;  3OHB A;  3U26 A;  4CDG A;  1SB3 C;  4BJQ A;  3ZD8 A;  3JPQ A;  4M9J A;  1QCK A;  1SWV A;  1WCN A;  4F5O A;  4TUS A;  2DKX A;  2DPI A;  1ARO P;  1DK2 A;  2HOQ A;  9ICA A;  2YB4 A;  8ICI A;  2JMG A;  2JZB A;  1WYG A;  5J2J A;  4YR3 A;  3H40 A;  2IMW P;  4EX6 A;  4ED0 A;  4UAW A;  7ICM A;  2DL0 A;  2G06 A;  4KLD A;  2JR5 A;  2KKP A;  4UAS A;  1N5W A;  1SL2 A;  1J2M A;  4YR2 A;  2ZIX A;  2PI5 A;  4I2B A;  3ZDB A;  1S0M A;  1L3S A;  9ICS A;  2KSO B;  4M9G A;  2K8C B;  1QQ6 A;  9ICT A;  4I2J A;  9ICG A;  3PST A;  4ICA A;  2J6T A;  2LPE A;  4NLC A;  7ICS A;  2I5H A;  1Q8K A;  2MAX A;  7ICR A;  2K8A A;  4M2Y A;  3BQT A;  4Y2P A;  3PW2 A;  2AU0 A;  1CEZ A;  2KP7 A;  4GFJ A;  2Y0S F;  1RYU A;  7ICV A;  5ALH A;  2HBL A;  3C23 A;  5J2F A;  2LKY A;  4YMN A;  1WUD A;  2EAO A;  4P0Q A;  1PK1 B;  1DXS A;  3TAD A;  5J0S A;  1B4F A;  1F5S A;  2E8P A;  4US8 A;  5KFO A;  4JUZ A;  2WF9 A;  1X6J A;  3V72 A;  2HMX A;  5AKG A;  3L4P A;  4LJX A;  4NL9 A;  1F44 A;  1FFU A;  4NLG A;  1TAU A;  1Q46 A;  2HHV A;  1AQ6 A;  2HVH A;  3QX7 A;  4CCH A;  4FO6 A;  3B9J A;  3M9O B;  1HUO A;  3BQ7 A;  2LM4 A;  4HAI A;  2MSN A;  3KFU F;  8ICA A;  1YZ6 A;  2JH1 A;  1RYS A;  5ALP A;  1OUQ A;  3PR4 A;  4EBC A;  5J0T A;  3IRU A;  4OJ5 A;  4C7Z A;  3D2Q A;  2ZJ5 A;  1D9D A;  1RQN A;  1X9W A;  1TVA A;  3ZDA A;  4KLJ A;  2BPC A;  4Z6C A;  1ZQK A;  5D46 A;  3AQF A;  5CB1 A;  1S97 A;  2IA6 A;  5DBB A;  3WK9 A;  1SIJ A;  3IN5 A;  1XS9 D;  3I28 A;  5KFM A;  5KFZ A;  3H8S A;  2P35 A;  4UBC A;  4NM1 A;  1NKE A;  3F2D A;  1TV9 A;  2JGA A;  5AKK A;  2W3S A;  3NRZ A;  1A77 A;  2W55 A;  1N2X A;  4ECT A;  4C8O A;  5ALU A;  2QAR B;  3GZF A;  2IHM A;  5ALN A;  4F2S A;  3KHH A;  4R8U A;  5AKL A;  1V38 A;  1XSN A;  3F2C A;  1ZQG A;  5AKJ A;  4DOB A;  4KMU A;  2DGZ A;  1Z00 A;  1FFV A;  4FS1 A;  4M9L A;  2HHQ A;  3V6J A;  4F4Y A;  5J0O A;  5CHG A;  4I2G A;  5L1I A;  4MF2 A;  4O3P A;  4YFK A;  2KJ5 A;  3QYP A;  5AI8 A;  3FM9 A;  4DOA A;  2KHV A;  5HR7 A;  2ZXI A;  1ZRN A;  4CE6 A;  3PW0 A;  4DLE A;  4TQR A;  3OJS A;  5IIN A;  1L3V A;  5HHI A;  1X66 A;  4EEY A;  2W9B A;  3PX4 A;  3EPG A;  3MR5 A;  2KMD A;  3OSP A;  3OPX A;  4GC7 A;  5KFS A;  7ICP A;  5KFX A;  3H0L B;  2KKV A;  5KFR A;  1ZQC A;  5T14 A;  3HP6 A;  1CUK A;  3ISD A;  3ISB A;  4ED1 A;  8ICY A;  1NK5 A;  2F1I A;  2BCQ A;  2UVU A;  1X9X A;  5DB6 A;  1NK7 A;  3G6Y A;  2Y9T A;  3RR8 A;  3C1Y A;  3KOO A;  2HOF A;  4KLI A;  2OH2 A;  5KT4 A;  4GXK A;  3RB3 A;  2XO7 A;  2AHO B;  4PL1 A;  2G5I B;  1MN8 A;  3TFS A;  1OW5 A;  5AKH A;  1EXN A;  4NLZ A;  2K4P A;  3PSF A;  5DGB A;  3C1Z A;  9ICF A;  4I2A A;  4KN4 A;  4UAT A;  2OHF A;  2OCE A;  3MBY A;  3QU4 A;  1IM4 A;  2VAN A;  1N63 A;  5DLF A;  3GII A;  3G6X A;  2BGW A;  5AIC A;  5KNI A;  5AI5 A;  4DS4 A;  1H38 A;  5ALR A;  2KG5 A;  5DBA A;  5KFA A;  3SAG A;  3AL0 B;  1ZQX A;  2RLT A;  9ICL A;  4RQ0 A;  2WF6 A;  1DRG A;  4B9N A;  3BZC A;  2KIC A;  3EPI A;  5ALG A;  2NYV A;  3QU2 A;  2OEH A;  2H3Z A;  3T5K A;  1TFR A;  5EE1 A;  1VLB A;  3AEV A;  5ALK A;  3H8M A;  5KFC A;  1ZD4 A;  2EH9 A;  3RFA A;  4P4P A;  4M04 A;  1KKX A;  1ZQD A;  4FS2 A;  3VC8 A;  5G5G A;  1MA7 A;  3ALR A;  4DFM A;  3SEN A;  3KZX A;  4NM2 A;  7ICO A;  1PK3 A;  5AIB A;  1Z19 A;  3HIL A;  9ICC A;  2HW3 A;  4KLT A;  4QW8 A;  5KTQ A;  4ZH4 A;  5KG1 A;  4YD2 A;  5J0P A;  2BCU A;  4EZ9 A;  4UQG A;  3GV7 B;  4QIW C;  3UPQ A;  3B0Y A;  4DSL A;  3RR7 A;  5TZV A;  1L8O A;  4J03 A;  1B43 A;  4C7Y A;  5KT6 A;  3SZ2 A;  3CYM A;  4YXM A;  4EX7 A;  2QKQ A;  7ICI A;  2YMQ A;  2AXT U;  5E79 U;  5AKX A;  4P2H A;  5ALF A;  1ZQF A;  3LWL A;  3KBB A;  4CNQ A;  4BUG A;  3L3F X;  5KAI U;  3AN1 A;  2XID A;  2WF5 A;  4PGY A;  5DDM A;  3Q8Q B;  4EZ6 A;  3F5E A;  5J0Y A;  1RZT A;  2EZX A;  4O3M A;  3PVX A;  2KTQ A;  4RNO A;  1IG6 A;  2M9N A;  2CXY A;  4O0I A;  4C0Z A;  3C28 A;  2W3R A;  2A1A A;  4TUP A;  1ZQV A;  2G0A A;  1ZOL A;  4HYK A;  2Z7J A;  3RBE A;  2DQN B;  2RQ5 A;  3NVV A;  1NZB A;  9ICO A;  4DF8 A;  4ACO A;  4DEZ A;  3WK7 A;  3SMV A;  1CI4 A;  3J81 j;  1TK8 A;  4TUQ A;  3KKA C;  1OXJ A;  3SV4 A;  4I2F A;  4NY8 A;  1U4B A;  4RUC A;  3D6J A;  3B0X A;  2PI4 A;  1C7Y A;  2A3V A;  2PFQ A;  5F3X B;  3LK9 A;  1SXD A;  4ECS A;  1SV0 C;  4OCZ A;  3HT3 A;  4BXO A;  3ZDE A;  4Q43 A;  2W54 A;  4JWM A;  7ICH A;  5TIS U;  4PGQ A;  1QH9 A;  1T94 A;  1P7D A;  3PR5 B;  4YMO A;  2QB0 B;  2BR0 A;  8ICS A;  2Y0S C;  4CF5 A;  1RQL A;  5KT5 A;  4RQ3 A;  3SAH A;  1LVH A;  3M8R A;  5ALQ A;  1L8L A;  2C2D A;  1SV0 A;  2FLP A;  4A8E A;  1D9F A;  3VCB A;  2BCR A;  1X6I A;  4QZF A;  2MUT B;  1N62 A;  2JH7 A;  5ALW A;  4IRC A;  4PGX A;  3HX0 A;  2MRL A;  1B0X A;  3FC4 A;  3DDH A;  5HNK A;  4DQR A;  4IQT A;  5KFU A;  1NJX A;  3A0B U;  3AU2 A;  1M6Y A;  1COO A;  4G3I A;  3TQ1 A;  3NRW A;  1BNP A;  2KZZ A;  9ICW A;  2WAQ C;  5HHH A;  3R9K A;  2P6U A;  4XUS A;  4ED8 A;  1IIP A;  2KOB A;  3GDX A;  2IOF K;  3ZI4 A;  8ICO A;  2FPL A;  1A6S A;  1JAL A;  4Q45 A;  4LVS A;  2LHT A;  3F5A A;  2VA2 A;  3NTU A;  1NK4 A;  2W11 A;  3NVZ A;  1NK9 A;  2OXO A;  4O3S A;  4M9N A;  2KIV A;  3D2S A;  3WK5 A;  2VA3 A;  3BS5 B;  2EZZ A;  3WK6 A;  2ZUD A;  2ZXH A;  5ALE A;  1XWL A;  1PK1 A;  5AM4 A;  5CR0 A;  3M8S A;  3N7S C;  2KNJ A;  2AGQ A;  1ZQP A;  3WKD A;  4RNN A;  2Y1I A;  2XI9 A;  8ICM A;  1QSL A;  2JRZ A;  2GO7 A;  4FBT A;  1PUZ A;  4I27 A;  4Q8F A;  3QUQ A;  4MFF A;  3T5H A;  5GTH U;  2JHD A;  1SKR A;  4Z6D A;  2V4R A;  3E2E A;  3PNC A;  3QUC A;  4B9U A;  1ED1 A;  2EQY A;  4UB6 U;  4QWA A;  2VA8 A;  2EAP A;  5D49 A;  1J2N A;  3M1Y A;  3V7J A;  4Y2S A;  2WB1 F;  8ICU A;  2F1J A;  4J9O A;  5EWE A;  4FZM A;  4KLE A;  2KVC A;  1URJ A;  3MAB A;  3OGU A;  1O08 A;  2YX8 A;  2ZJA A;  1ZRM A;  1KSP A;  1LKY A;  2LI6 A;  4CF3 A;  8ICE A;  4NLN A;  2JEG A;  5AK3 A;  4R63 A;  1ZQW A;  2C2R A;  4OJP A;  2F77 X;  3HWT A;  3MR6 A;  3GIL A;  1TKD A;  2UVW A;  4M9H A;  5H2F U;  4F50 A;  3ED5 A;  3PX0 A;  2ALZ A;  1ZD2 P;  5DKW A;  2WFA A;  3N4M B;  2N1R A;  1ZJN A;  1N61 A;  4Y2T A;  3MDA A;  3RF9 A;  4QZD A;  4DL4 A;  1C20 A;  1ZQL A;  2LYH A;  5KG6 A;  2QAR A;  3GFK B;  1ZQZ A;  5JU5 A;  2AQ0 A;  5KAF U;  1QSY A;  1QTM A;  3GU3 A;  1K1Q A;  2EDU A;  4C4R A;  2R8H A;  9ICH A;  5J0X A;  4F72 A;  3BQ0 A;  2E8M A;  1WWU A;  5J29 A;  3TAD C;  1Z1B A;  1ZYQ A;  4MF8 A;  4JK1 A;  4I2D A;  3RH6 A;  2PFP A;  3IG5 A;  3C21 A;  2HHX A;  3MR2 A;  5ALY A;  4F2R A;  2KJ8 A;  1PVQ A;  5AKY A;  3QE9 Y;  3QU7 A;  3I1Y A;  4CF4 A;  2K8B B;  2ZTC A;  5KG7 A;  4C8K A;  4NL9 C;  4UW9 A;  3CW2 C;  4IRD A;  4UAU A;  3FAH A;  3RBD A;  4KMO B;  3N7R C;  2G09 A;  3JPR A;  2BZF A;  4U7C A;  4DL7 A;  4RQ1 A;  4IC9 A;  3UM9 A;  8ICH A;  3RJH A;  1XC9 A;  1YZ7 A;  3RRG A;  3C5G A;  4BWJ A;  9ICR A;  3HW8 A;  3GIM A;  4M6W A;  4OJO A;  1T7P A;  4DL3 A;  9ICI A;  2K4E A;  2W9A A;  3K1R B;  1L7N A;  4XRH A;  5G5H A;  4J9P A;  2H3Q A;  1UA0 A;  4JWN A;  5KG3 A;  2H3V A;  2ESE A;  1S77 D;  4PHE A;  2Q0Z X;  1S5L U;  1UHU A;  1ZQH A;  5K4L A;  2NO4 A;  2G5H B;  5KT3 A;  8ICF A;  2XGQ A;  5AM0 A;  4QWC A;  4C4T A;  4J9M A;  4R66 A;  1NOM A;  4RT3 A;  1HIW A;  4F71 A;  2HHU A;  4Y2V A;  1PZN A;  2JEJ A;  4B9M A;  1T3Q A;  2R8I A;  2O6K A;  4WJ3 B;  7ICJ A;  1RM6 C;  5CA7 A;  5KFK A;  1ZQJ A;  4RQ7 A;  1S0O A;  1SL0 A;  1MQ3 A;  4KX3 A;  4KLQ A;  1Z4O A;  3H7I A;  8ICQ A;  9ICM A;  5KT2 A;  2Y1J A;  2OM6 A;  4DFJ A;  3WK8 A;  8ICR A;  4GIB A;  2WF7 A;  3E58 A;  1L3U A;  4UAR A;  4IS7 A;  2KIW A;  8ICT A;  4CRX A;  2ES6 A;  1QQ5 A;  1ZQN A;  5J2I A;  2PFO A;  5AKI A;  1UQV A;  2D8C A;  8ICV A;  3RRH A;  5BOM A;  5AM2 A;  4DQP A;  1NNL A;  2C22 A;  3QUT A;  3MC1 A;  2YB1 A;  3BQ1 A;  4ECW A;  1ZQM A;  5DB8 A;  4ECU A;  2HDO A;  4JV1 A;  1BPY A;  1ECW A;  1GO3 F;  2W9M A;  1NJW A;  5CJ7 A;  2KVS A;  4UB1 A;  1ZD3 A;  4ED6 A;  5ALS A;  4YVZ A;  5DB9 A;  1TK0 A;  3ONN A;  2VJ5 A;  4DLG A;  3OSN A;  5DGA A;  5ALO A;  3M7D A;  4DOC A;  2BHN A;  3UMG A;  3PY8 A;  2K60 A;  3UXP A;  5AIA A;  8ICW A;  4C4S A;  2BDP A;  2K4H A;  1ZQ1 C;  2EZY A;  4FZL A;  1Z4N A;  9ICU A;  2H5X A;  2E3T A;  3CRX A;  4RT2 A;  4C8M A;  3Q8K A;  2YQE A;  1SL1 A;  3LVW A;  3EW9 A;  3ZDC A;  1L3T A;  2XC9 A;  1BPB A;  2M0N A;  5KFI A;  4TUR A;  5HR6 A;  2IBK A;  1X42 A;  4FE3 A;  2KZM A;  3T79 A;  4JV0 A;  2IHN A;  4B9S A;  5AI6 A;  1NK0 A;  5J2A A;  2PMZ F;  4QZH A;  2KE7 A;  4ED2 A;  3RJI A;  3N7P D;  1VDV A;  2XIC A;  4F5Q A;  3UXO A;  2A1J A;  4ECZ A;  5J2C A;  4DSK A;  1U48 A;  1KL9 A;  3EZ5 A;  1BNO A;  5DB7 A;  4QZ8 A;  2CRX A;  2F44 A;  2R8K A;  5AK4 A;  4RPY A;  4R65 A;  2D3D A;  4R64 A;  5KFF A;  3IDW A;  9ICV A;  3FDS A;  1D8Y A;  4GLX A;  2FI1 A;  1NJY A;  1KRP A;  3WKA A;  4B9T A;  1U47 A;  4NXZ A;  4KIT B;  2G07 A;  2BQR A;  5KFD A;  4J9N A;  2J6U A;  3WK4 A;  8ICC A;  3BZK A;  5J2K A;  2JEI A;  1V97 A;  4PHA A;  8ICJ A;  1JUD A;  3GIJ A;  4YMM A;  1JMS A;  4J9K A;  4U6P A;  3F53 A;  2RDJ A;  4F5P A;  3KD3 A;  1NZP A;  5DDY A;  2NRZ A;  4GC6 A;  9ICP A;  4RPZ A;  2ZTE A;  2XVT A;  3EYZ A;  3HKZ F;  1DOQ A;  4Y2Y A;  3UQ0 A;  1X9S A;  2NRW A;  2FJ6 A;  5J0U A;  3OHA A;  3IHQ B;  4O3O A;  4C8N A;  5DG7 A;  4F4K A;  3HRD D;  3Q8S B;  2YN4 A;  4QW9 A;  3GIK A;  2GLE A;  1ZQU A;  5KFW A;  5EWG A;  5HMM A;  3NGD A;  1DGS A;  4QJF B;  3D2N A;  3WU2 U;  1A76 A;  3Q8M A;  5J2H A;  4RPX A;  3BS5 A;  3L5K A;  1ZXI A;  3OTQ A;  4UB2 A;  2HSZ A;  2BQ3 A;  1T4G A;  3RJE A;  5KFB A;  1SXE A;  3C5F A;  5D4B A;  5KFQ A;  2R8G A;  2ZIU A;  1S0V A;  3DEE A;  3V7K A;  1DGJ A;  9ICQ A;  9ICB A;  1U49 A;  1QSS A;  3ISC A;  5DG8 A;  2HBM A;  2F2A B;  5CWR A;  2DF4 B;  1JXL A;  5FP0 A;  5IIM A;  7ICG A;  3KHR A;  3MFH A;  4CGZ A;  1K1S A;  4MEY A;  2D6F C;  2ZG6 A;  1WCL A;  2KFZ A;  2BPG A;  4RQ4 A;  2QLT A;  2V9W A;  2I6X A;  3Q8L A;  5KG4 A;  2I9G A;  1KW4 A;  4UBB A;  4P0P B;  5DQG A;  5IIO A;  3QNM A;  4DQQ A;  3ETL A;  1HJP A;  4MHV A;  1S9F A;  4DCC A;  4XQ8 A;  8ICN A;  1BPX A;  4DQI A;  8ICK A;  2Q4T A;  2E1E A;  3LDA A;  3MDC A;  3AMZ A;  1U9L A;  4P4O A;  4UB5 A;  3QXG A;  2ZIW B;  1YT3 A;  5AHX A;  2C2E A;  3TFR A;  3PW5 A;  2HHT A;  4I2C A;  4ECV A;  1SKS A;  4UB4 A;  4EEL A;  2ISP A;  3TAC B;  2KSO A;  2F1H A;  5ALL A;  4PZN A;  1PVR A;  1BPE A;  3NVY A;  2BDU A;  5L1J A;  4B6J A;  2ASJ A;  2BKE A;  9ICJ A;  4EYH B;  4O3Q A;  3QEA Z;  5KFL A;  3SYZ A;  1RYR A;  4K4H A;  4J9L A;  1KFT A;  2XCA A;  3SQI A;  4KLM A;  2ZIV B;  1N60 A;  1KBU A;  4EBE A;  1U45 A;  5AI0 A;  4Y2J A;  3C2M A;  4ED3 A;  3RB0 A;  4KLF A;  4KX5 A;  4QWD A;  3H0M B;  1MQ2 A;  5AK5 A;  7ICL A;  4QWB A;  4MFC A;  3WKB A;  1O03 A;  4PJ0 U;  5BPC A;  1NKC A;  1T3N A;  5AM1 A;  3PML A;  2FPK A;  1MSW D;  4ELV A;  3T5J A;  1D8L A;  2G08 A;  4AYB F;  3K1Z A;  2W9C B;  5F9N A;  2P66 A;  2HBK A;  3MFI A;  2MA1 A;  1S76 D;  1T8E A;  1SWW A;  2HOI A;  5KFV A;  3N97 B;  5KFH A;  4DS5 A;  5KL1 B;  2YMM A;  2KN7 A;  4O9M A;  3CNH A;  3OJU A;  5J0W A;  8ICP A;  7ICT A;  2P6R A;  4EYI B;  1ZQR A;  5GTI U;  1D8B A;  4BGD A;  2UVR A;  3QEB Z;  4DL5 A;  2H3I A;  3GV5 B;  1CRX A;  2J6S A;  5B5E U;  2LMR A;  2NRT A;  4OD0 A;  1XO0 A;  4QIW F;  5ALJ A;  1ZQT A;  2QB1 A;  1ZET A;  4Z6E A;  5KG2 A;  3LVV A;  1KEJ A;  2DBY A;  1FIQ A;  2NRX A;  3CP8 A;  4EEK A;  4Y2Q A;  3RH5 A;  3PX6 A;  3K75 D;  5CRX A;  4J9R A;  2KZ3 A;  3KHL A;  4RQ2 A;  2E8N A;  1Z3E B;  5C0Y A;  1UT5 A;  1KN5 A;  4QZA A;  1SV4 A;  1JIH A;  2ZTD A;  1LB2 B;  3A0H U;  2PFN A;  5L1M A;  3SD7 A;  4NJ8 A;  3Q8P B;  3RJK A;  1COK A;  5CEH A;  2FMS A;  1WG8 A;  1JRP A;  2HCF A;  3RJF A;  4GXI A;  3LWM A;  4NWI A;  2PMZ C;  4YXJ A;  2FDR A;  5L9X A;  5KFY A;  5EE0 A;  7ICE A;  2WTF A;  5HML A;  4I2I A;  3PSP A;  2PKE A;  4O3N A;  4NLB A;  5CP2 A;  3PV8 A;  1JXE A;  7ICU A;  4PH5 A;  1V9P A;  2CN1 A;  5BOL A;  1UA1 A;  4OJ6 A;  1BPD A;  3F2B A;  4YQW A;  4YCX A;  4LZG A;  3RJG A;  1S10 A;  1ZQQ A;  2CPR A;  3V6K A;  2VIX A;  2ASD A;  5AKE A;  2YMP A;  3BJY A;  1MC8 A;  2ZUC A;  5III A;  7ICK A;  4F4Z A;  1Z1V A;  4K4I A;  5DLG A;  1NI3 A;  1XNS A;  2DPJ A;  3QU9 A;  3K4G A;  5A0L A;  4QZ9 A;  3MR3 A;  3SV3 A;  5AI4 A;  3KHG A;  2R18 A;  1ZQA A;  4KLO A;  5ALI A;  4Z6F A;  5B66 U;  9ICX A;  5J2B A;  3NAS A;  4IR1 A;  3RTV A;  3JPP A;  5ALZ A;  4ECX A;  2AJQ A;  3TAP A;  4QZB A;  1QQ7 A;  2AGO A;  4UAY A;  5J2D A;  4USA A;  2LYB A;  1J97 A;  3PSI A;  1ZD5 A;  2WAQ F;  5KFE A;  3HKZ C;  2RHF A;  2YTU A;  4DSF A;  1NKB A;  4IRK A;  1TAQ A;  5AM5 A;  4GXJ A;  3ZD9 A;  4K4G A;  3O0F A;  2FLN A;  2LBO A;  3SAF A;  1BVS A;  1SKW A;  3NUQ A;  4PPX A;  4F92 B;  4I28 A;  4IQW A;  3IP4 B;  1JI7 A;  1LKY B;  1RXW A;  1KLN A;  5AK6 A;  5J2G A;  2GOL A;  4KN7 A;  3THV A;  1JRO A;  4NLK A;  2VKQ A;  4BDP A;  8ICZ A;  2XGP A;  5IIK A;  2KFN A;  4DFK A;  4I2E A;  4PHD A;  2JZB B;  2RP5 A;  5EE9 A;  1PVP A;  7ICF A;  4DFP A;  9ICN A;  2RRD A;  1TAM A;  3H8W A;  4RZR A;  4EBD A;  3QZ8 A;  2GH1 A;  4O5K A;  4O5C A;  4ELU A;  4DL2 A;  2LM1 A;  2W8K A;  2F8L A;  2ODG A;  3Q8R B;  4F5R A;  4F5N A;  5ALX A;  1KDH A;  3M6Z A;  3PO4 A;  3EUB 2;  5JUM A;  2ZIX B;  3GQC A;  2FMP A;  1SGG A;  4DSE A;  3KZI U;  5AKZ A;  5KG0 A;  4IR9 A;  4E0D A;  1DK3 A;  4DQS A;  4TQS A;  2NO5 A;  4PL2 A;  4P4M A;  1LV5 A;  2DUY A;  3I76 A;  4RQ5 A;  2GWS A;  5DG9 A;  3BQ2 A;  2E8O A;  2XY7 A;  3H8J A;  1KTQ A;  5J8Y C;  1FO4 A;  2W7O A;  4AP9 A;  4ECR A;  2V4Q A;  2HBJ A;  3H0R B;  3SEI A;  2F3N A;  4BWM A;  4ZOH C;  3V7L A;  3UXN A;  4UAZ A;  2W8L A;  1A0P A;  1BGX T;  4QNL A;  4MEX A;  4YG2 A;  4P0Q B;  2HHS A;  4Q8E A;  1B22 A;  4DFD A;  5J8Y A;  1HUZ A;  2HHW A;  8ICG A;  4YN4 A;  4RQM A;  5EWF A;  2ISO A;  5L1K A; 
#chains in the Genus database with same CATH homology
 1SV4 A;  2YTU A;  2FE9 A;  1RG6 A;  2E8P A;  1V85 A;  5F3X B;  1SXE A;  4IS7 A;  5L1M A;  1SXD A;  4NJ8 A;  3H8M A;  1SV0 C;  2ES6 A;  1COK A;  2F44 A;  2Y9U A;  2B6G A;  1UQV A;  2D8C A;  1X66 A;  4NL9 A;  1JI7 A;  1LKY B;  4NL9 C;  2D3D A;  3IDW A;  2QB0 B;  2L5Y A;  3SEN A;  2EAP A;  2KMD A;  2DKX A;  1PK3 A;  3BQ7 A;  3HIL A;  2EAN A;  5JTI A;  1SV0 A;  5JRT A;  1UCV A;  2JV3 A;  2DL0 A;  1KW4 A;  1X9X A;  2K60 A;  3K1R B;  1LKY A;  1B0X A;  2Y9T A;  4MHV A;  1SGG A;  2QB0 A;  1Z1V A;  2ESE A;  2QKQ A;  2KSO B;  1OW5 A;  2E8O A;  5J8Y C;  2LPE A;  2K4P A;  2DKZ A;  1WWV A;  1F0M A;  4RQN A;  2LMR A;  4PZO A;  3SEI A;  2F3N A;  2QAR B;  2EAM A;  2GLE A;  2QB1 A;  5KNI A;  1V38 A;  2QAR A;  1X40 A;  5JU5 A;  2KG5 A;  2KE7 A;  3TAC B;  2KSO A;  2KIV A;  2F8K A;  4PZN A;  5J8Y A;  3BS5 B;  2EAO A;  1PK1 B;  1DXS A;  2E8M A;  1WWU A;  3BS5 A;  3TAD A;  4RQM A;  2E8N A;  3TAD C;  3BS7 A;  1PK1 A;  3KKA A;  1B4F A;  3KKA C;  1OXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...