5KNIA

Crystal structure of the wild-type sam domain of human tankyrase-1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
58
structure length
58
Chain Sequence
MNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-1
publication title Tankyrase Sterile alpha Motif Domain Polymerization Is Required for Its Role in Wnt Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 17
structure length 58
sequence length 58
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5kniA00
1B4FA 1X40A 2F8KA 1UQVA 2ESEA 1F0MA 2FE9A 2QB0B 4IS7A 3BS5A 2Y9UA 1COKA 2KE7A 2JV3A 2ES6A 2QARB 5L1MA 2D8CA 5J8YA 1LKYB 2KSOA 2QARA 3H8MA 2F3NA 2F44A 3BQ7A 2E8NA 2DL0A 2E8MA 1B0XA 2EAMA 3SENA 4MHVA 5JRTA 2K60A 5JTIA 2LPEA 3TADC 5F3XB 1WWVA 2QB0A 1SXDA 1V85A 2YTUA 3BS7A 1OW5A 1UCVA 1KW4A 2EANA 1V38A 2B6GA 1LKYA 4PZNA 2L5YA 3HILA 2EAPA 2Y9TA 5J8YC 1SV4A 3IDWA 2D3DA 3KKAA 2KIVA 1X9XA 1SV0A 2DKZA 4NJ8A 1PK1B 1PK3A 1RG6A 2K4PA 3K1RB 1SXEA 4NL9A 3TACB 1PK1A 3SEIA 2QB1A 4RQMA 4RQNA 2KG5A 1X66A 5KNIA 3BS5B 1JI7A 1Z1VA 2EAOA 2QKQA 2E8OA 1OXJA 1SGGA 2GLEA 4PZOA 2KMDA 2E8PA 2LMRA 2KSOB 1DXSA 3KKAC 5JU5A 1SV0C 1WWUA 2DKXA 4NL9C 3TADA
chains in the Genus database with same CATH superfamily
5FP0A 1X40A 1N56A 3BQ0A 1X6JA 9ICJA 4GXJA 1ZQMA 2OM6A 3SV4A 5ALYA 1ZQSA 2RDIA 4KLMA 5J0PA 2FPKA 3F5AA 3MR3A 1NKBA 4M9HA 1JX4A 2XY5A 1TVAA 5AK4A 2KVCA 3QX7A 3BQ1A 3GIKA 3M1YA 2VA2A 4R66A 2PFNA 7ICOA 8ICAA 2A1JA 4EZ9A 4Y2UA 2LPEA 2YMLA 4O3QA 5F3XB 1WUDA 3AQFA 3JPPA 4FS2A 5J0YA 4C4SA 2M0NA 4UAYA 2KHQA 3H8SA 2B6GA 4Z6CA 4J9OA 1BPYA 1V9PA 3LDAA 5KAIU 5AM5A 3KD3A 1S5LU 2ZTCA 2HHSA 5KG1A 5HR7A 8ICTA 2F8LA 2DKZA 3HPOA 4YG2A 3QU5A 3K1RB 1PK1A 4Z6EA 4QZ9A 1NJWA 5KFWA 3L3FX 5D49A 1L6NA 4PL1A 4NLCA 2MA1A 5KFHA 4F93B 4ECTA 4B9NA 1X9WA 3AM9A 1TK0A 1QSSA 1Z4OA 3KBBA 4OCZA 5IIKA 5G5HA 4WJ3B 2KMDA 2IOFK 5KFAA 5KL8B 4BWJA 2FLNA 4C7YA 3NASA 2PFPA 4M6WB 3EYZA 5ALOA 5DBCA 2R8JA 4EENA 2ZXIA 2F1IA 2JZBA 4Y2QA 2GH1A 4UAVA 2F8KA 4YFKA 1ZYQA 1UQVA 4DS5A 1T8EA 1QSYA 2GWSA 1SKRA 3E0FA 3B0YA 3Q8QB 2WF6A 1COKA 3RF9A 4CRXA 3HT3A 2W43A 4LZDA 1TAUA 2NO5A 3AU2A 8ICZA 9ICHA 4RQ8A 4KLLA 4EBDA 2A1JB 2EAMA 5AM1A 3B9JA 1L3VA 3IG8A 2GOLA 2CXYA 3GU3A 2IOHA 5IIMA 5B5EU 5GTHU 4J9KA 2W8LA 3Q8MA 1XSLA 3RFAA 4B9UA 4F3OA 2BKEA 1WG8A 1YZ7A 3IDWA 3AEVA 3T79A 2ASJA 1QCKA 4K4IA 4QWEA 4P4MA 1PK1B 4NL9A 4QIWC 1U4BA 4F8RA 5AK5A 1ZOLA 3TFRA 2BQUA 2HBJA 3CP8A 4ED8A 3T5JA 3LK9A 1KRPA 1JI7A 5KFOA 5DBBA 2E8OA 2E1FA 1COOA 3T5KA 2WFAA 4ED2A 8ICEA 3SI8A 4NM1A 3PV8A 1S0NA 3IV6A 1DXSA 2JZBB 2PI4A 3MGHA 4UARA 4KLHA 5B66U 5EE3A 4P0QB 3QYPA 5KFRA 4KX5A 2C28A 4KLOA 4M9JA 4O3RA 3C1ZA 3OHAA 1RXVA 3C1YA 3MFIA 3C28A 4F4ZA 3R9KA 4ECXA 1CUKA 2EDUA 3WKEA 3N7SC 2BZFA 2HHTA 2F44A 4KMOB 5J0SA 1F5SA 2Q0ZX 4GXKA 5T14A 1UA1A 1L8LA 2BPCA 4FS1A 1U49A 5KFJA 5KFBA 4CCHA 1TV9A 1BVSA 3ZI4A 3C5FA 1OW5A 4OJPA 5KFUA 3PX6A 5AKYA 5J2HA 1T4GA 4MFAA 4PHPA 2HW3A 2J6TA 1VLBA 7ICRA 2J6UA 1QLNA 5IINA 3UM9A 4KLIA 5KFGA 1XSNA 1ZQEA 2G09A 1XNSA 2ZG6A 1ZQBA 2YY6A 5CP2A 4US9A 2G07A 5ALFA 2KK0A 2ZJ5A 2ZJAA 4BX9C 1FFVA 4LJXA 4B9SA 4Y2SA 3GDXA 3V7JA 1ZQVA 5DQGA 4F5RA 2XY6A 3WK5A 3H8WA 3JPTA 4FZNA 2KJ9A 4RNNA 2RRDA 4DL7A 3QEBZ 2A1AA 2J6SA 1UHUA 2EZZA 2KHVA 2BCQA 4YR3A 1NK5A 1HUZA 2KFZA 7ICJA 3M9NB 4PGYA 2JMGA 3ZD8A 4CNQA 1KBUA 3RAXA 4EBEA 2FE9A 3SAGA 1Z00B 3RJEA 4YR2A 4DSEA 4O5CA 8ICBA 1NK4A 1SKWA 1FIQA 4KMUA 4USAA 2JXJA 1NK9A 4P4PA 3NUQA 5IIOA 2H3QA 5TISU 4QZCA 3UQ0A 2NV3A 2W03A 1BGXT 2LBOA 2F2AB 3MDCA 3MFHA 4EELA 3TADC 3C21A 3ETRA 3MBYA 4DFMA 3UPQA 2AGPA 3BS7A 8ICQA 3ZD9A 3BQ2A 3FC4A 2BCVA 1TE2A 4OJOA 2BHNA 3F53A 2PMZF 2ZIWB 4BXOA 5HMLA 3ICXA 1JRPA 2P66A 1SL1A 3RR8A 4P4OA 1U9LA 4B6JA 5KG3A 1PVRA 1NJZA 2K4PA 2C22A 5DB6A 4EYHB 2K4EA 3D6JA 3EWAA 4C4RA 1ZQPA 5ALMA 1KLNA 3GZFA 1Z1VA 2ZIUA 3PMNA 2KOBA 5DG8A 5TZVA 4J9SA 1Q3VA 4DF4A 8ICVA 2E8PA 2XO7A 3RJIA 2G5IB 1S0MA 4KLUA 2A3VA 4DL4A 3LWLA 4IR9A 1MQ2A 4UB8U 2EQYA 4ECUA 3AL0B 4IRCA 2Q4TA 4QWAA 2ESEA 1MA7A 3SV3A 4NLZA 3NVWA 4CF5A 1IM4A 4GC6A 2W9MA 3HJEA 4F92B 5IIIA 3NRZA 1SL0A 1C20A 5J8YA 3H4BA 2BPGA 1VJ5A 2IHMA 5J0XA 2OYYA 3BQ7A 2WHEA 5DG7A 2HHQA 4TUPA 3V6KA 2R18A 3T3FA 3G6YA 2AQ4A 1L3TA 4YMOA 5ALHA 8ICSA 4G3IA 5CHGA 1LV5A 5IIJA 3GIIA 3ZDAA 4ED3A 5L1KA 2EANA 3KHLA 4F91B 3TARA 2W7OA 4BXOB 3FDSA 3HX0A 3PX4A 1KSPA 2HHUA 4I2JA 3N7RC 1ZQHA 2W54A 4IQTA 2KFNA 1SIJA 4GFJA 2KZ3A 4I2DA 4NWIA 1RM6C 4YD2A 4QNLA 4J9LA 5ALXA 2K4HA 4RQNA 5J0QA 4DL5A 4M04A 2W9CB 2ZIUB 5AI4A 4I2BA 2QLTA 1DK3A 4Z6FA 2BPFA 1YZ6A 1UPHA 4JB3A 4QWBA 3H0MB 3HWTA 4RPYA 2JRZA 5HHHA 4QIWF 3MGIA 5J0OA 5AKJA 1T94A 3M9MB 4MF8A 1ZQKA 3OGUA 4B9VA 5AHXA 4O0IA 2FPMA 4DQPA 4YN4A 4RUAA 8ICUA 5DG9A 2B0CA 1FEZA 5D46A 4QWDA 4GXIA 4PGXA 3MABA 4JV1A 1TKDA 4KX3A 1JXLA 3PY8A 3MR6A 4YXJA 2Y9UA 2NRTA 4ECVA 5ALLA 3HKZF 5KFZA 4F4YA 2XCAA 5JUMA 4M6WA 4JWMA 4UASA 2MAXA 4UB5A 3G6XA 3H8MA 4O3OA 5DB7A 1WCLA 2LKYA 2LYAA 2E8NA 4I2AA 1B0XA 9ICUA 1N5XA 3H0LB 3KOOA 4CF3A 3IM1A 1X9MA 2DUYA 2MSNA 1UT8A 4I2HA 9ICKA 4U6PA 1YT3A 4TUSA 4YVZA 1O03A 4DWIA 1PUZA 2ATLA 5AIAA 2VA8A 4DFDA 1JIHA 4QZHA 3KKAA 1NK6A 1X2IA 5EE0A 9ICRA 1Z3EB 3C2MA 4KLGA 4RQ6A 5DB9A 4Y2XA 2PMZC 4NV0A 1A0PA 3IRUA 4MFCA 3BDPA 3PX0A 3IG5A 2XGPA 1D8LA 4Y2JA 4J9MA 8ICHA 2G5HB 2JEJA 2IOFA 2DBYA 1X66A 2E3TA 4UBBA 4QZBA 3EZ5A 2FLLA 5J2BA 1N62A 5AI5A 5ALJA 5ALKA 4PGQA 1SGGA 1Y88A 1X9SA 5BOLA 4Z6DA 3EPGA 8ICIA 4DQRA 3WKAA 4DFPA 2HBLA 4M9NA 3ONNA 4RNOA 2HDOA 4DQQA 4DEZA 4DQIA 8ICOA 5ALWA 3RB4A 4IS7A 2DF4B 5ALZA 2PFOA 1ZQGA 3IHQB 3AU6A 3Q8RB 4I27A 5AK6A 4ED7A 2WF7A 2ZUCA 3A0HU 3PO4A 3J81j 3V7LA 2AQ0A 4RPXA 2KP7A 1ZXIA 1U48A 2JR5A 2KKPA 3LVWA 1AQ6A 3WKDA 2YB1A 3M7DA 3OTQA 3BZKA 4MHVA 4P0QA 5KG0A 2K60A 5KFVA 5J2GA 4TQRA 1MSWD 1O08A 3NVVA 2KZZA 3ORYA 2WAQF 1N63A 5ALSA 2C2DA 7ICTA 4I28A 5AM3A 4IC9A 4KTQA 4EEKA 4MF2A 3T5LA 3C23A 4PZNA 2BQ3A 4F4WA 3KTQA 5G5GA 2M9NA 2G06A 2EZYA 1ZQUA 4XRHA 4KLEA 1X9XA 1N61A 1SKSA 4PHEA 1Q8KA 1PK3A 3WU2U 1RG6A 3SD7A 3S6JA 3QNMA 4M9GA 4UB6U 2LM4A 4OJ5A 2FLPA 3RR7A 3ZDCA 2OH2A 5AKKA 1Q46A 3PW7A 1RYSA 5KAFU 1ZQAA 4OD0A 1PVPA 4KLQA 4DLEA 3N28A 4TURA 2C2EA 4RZRA 2V9WA 5HHIA 3N4MB 1NKEA 4Q45A 5J2CA 1NJXA 4JK1A 1ZQFA 4UATA 1SZPA 1SV0C 1NK7A 3I28A 2CN1A 1S97A 2R8HA 1FO4A 1IXRA 5KT4A 1URJA 4EX7A 2ODGA 2DWQA 4ZH4A 4UB4A 5H2FU 1ZRMA 3LWMA 4QZ8A 1U45A 2H3ZA 4PHDA 1ZQDA 4DSKA 1DGJA 1FFUA 2HOIA 4IRDA 5ALDA 1ED1A 4KLJA 1T3NA 4C8NA 5AI9A 1J97A 2V4QA 5AI8A 4O9MA 3NRWA 2F3NA 4TUQA 1HIWA 2UVRA 4Q43A 3HKZC 4IL6U 4QZGA 3NGDA 1ECWA 1BPDA 3KHRA 3QU2A 2MU2A 1Z4NA 1V97A 5CRXA 5HR6A 3MR5A 2JEGA 4DFKA 1QTMA 1Z00A 9ICXA 4JWNA 4X5VA 1UCVA 1LVHA 2K4IA 3M9OB 4GC7A 5KG6A 3PZPA 3QZ7A 5AM0A 9ICVA 4B9TA 2VJ4A 3OSNA 8ICYA 3RTVA 5AM4A 1P7DA 3TANA 4FZLA 3PR5B 4R64A 2RP5A 4C0ZA 9ICPA 3UQ2A 4KLTA 1KFTA 3IP4B 1S76D 3H0RB 1B43A 1NJYA 3BS5B 2JH1A 3M8SA 1NNLA 4DQSA 3SR6A 1ZQXA 1ZQ1C 1SZHA 4QWCA 2ZIWA 4DSFA 1S9FA 2KSOB 2OCEA 1HUOA 3GIJA 3QE9Y 4R8UB 2B21A 4YR0A 2PXIA 2KVSA 1ZETA 3ZDEA 4QZFA 3PNCA 5CA7A 2H3IA 4RT3A 1F0MA 3V6HA 2NRZA 2ZUBA 2ASDA 5HMMA 2YQEA 1UT5A 2H5XA 9ICIA 4FZMA 3HW8A 3RH4A 4IQWA 1ZQWA 2ZTEA 2LHTA 5ALTA 1U47A 2FMPA 1XC9A 1X6IA 2YMPA 2YN4A 9ICNA 2KD1A 7ICUA 2BCUA 3ISCA 4B9MA 3L5KA 1L8OA 2W9BB 5KL1B 2FJ6A 4JV2A 4M9LA 3RB6A 3JPRA 1ZQNA 5D4BA 4Y2PA 4F2SA 4OJLA 9ICTA 2W04A 3F2DA 2UVVA 2WAQC 3OJSA 1DGSA 8ICKA 3KZIU 4RUCA 3A0BU 2BGWA 1QQ5A 5KT5A 5KFLA 9ICGA 2AGQA 9ICOA 3FAHA 2HCFA 4C4TA 3C5GA 2Y1IA 3UXNA 2QB1A 5EE9A 1JUDA 2VIXA 2F76X 2IHNA 5C0YA 1A77A 3Q8LA 5L1LA 4P0PB 5IILA 2KG5A 3THVA 3RRGA 4F4XA 1RYUA 2ZIXA 3KZXA 1QQ7A 1X42A 1IG6A 3FYHA 3Q8KA 4UB3A 2ISOA 4ECYA 4PZOA 5J2AA 1NK8A 2XC9A 2IMWP 4CE6A 4NY8A 2LMRA 8ICLA 3Q8PB 9ICFA 3OHBA 1NZPA 3ALRA 3NVZA 1RYRA 2KZMA 2VJ5A 4NL9C 1TK5A 1B4FA 5DGBA 4YP3A 1KTQA 3I1YA 2W9CA 1MC8A 5KFNA 3RJFA 3Q8SB 2ZXHA 5KT2A 8ICPA 3PW5A 4BWMA 2Y0SF 4F4KA 4C7ZA 1ZRNA 4DL6A 1BPEA 4BUGA 3M8RA 4FBUA 4YD1A 4U7CA 4K4GA 2YMMA 4IQVA 3TI0A 1RPLA 5DQHA 5DGAA 4RQ5A 4M2YA 2G08A 2LM1A 4IQUA 2DPIA 3RJHA 1DK2A 5DDYA 2I5HA 3AQEA 5KFSA 4M47A 1SXDA 4RPZA 3WK8A 4I2EA 9ICAA 3CW2C 3PSIA 1WCNA 2DQNB 3QUTA 3QUQA 4FFDA 4ECZA 2K89A 5J2KA 4Q8FA 2L5YA 3HILA 2EAPA 2Z7JA 2ASLA 3L4PA 9ICQA 3RBEA 1ZQYA 8ICWA 4OJ6A 4BGDA 4KLDA 3QXGA 1AROP 3H7IA 4JUZA 2MRLA 3C2KA 5ALPA 4DS4A 2HBKA 1PVQA 4RQMA 2ZIXB 4DFJA 2KIWA 4P2HA 3RB3A 5J0RA 5ALQA 3GV7B 4C8MA 3V6JA 3RBDA 2HOFA 1JN3A 2EAOA 5J0UA 3NVYA 4IR1A 4J9RA 2VANA 5KT6A 2UVUA 4DL3A 2XCPA 2DGZA 5KFTA 5AKZA 4EZ6A 4RQ7A 5JU5A 1DOQA 1ZD2P 5C5JA 3TQ1A 4Q8EA 3RH6A 4O3NA 5ALEA 2FMSA 1TK8A 2P6UA 2YMQA 4QZIA 2KICA 1JALA 2QB0B 3ISDA 3RB0A 4Y2YA 2P6RA 3EUB2 4QZAA 3QU7A 1K1QA 2HBMA 3RJKA 2ZTDA 2W3RA 4LVSA 5AKLA 2ZJ8A 7ICLA 2AHOB 2AXTU 4NLGA 2FPLA 1LKYB 5KFIA 1EXNA 4PHAA 5L1IA 1OUQA 1RZTA 4UB2A 9ICWA 2W3SA 1JMSA 7ICEA 3V7KA 4PL2A 3K4GA 5AI6A 5AIBA 4I2FA 5KFPA 5J29A 5KFFA 1UA0A 3CYMA 3T5HA 5ALNA 3TFSA 5J2IA 3F2CA 1MN8A 3KHGA 2R8KA 2IBKA 1JROA 4IRKA 4C8OA 5L1JA 7ICMA 3PSFA 4XUSA 1BPZA 2FI1A 3PW4A 3JPNA 1ZQRA 1ZJMA 1RXWA 3BZCA 1XO1A 7ICPA 3AUOA 4UBCA 1ZQQA 3HRDD 5J2FA 3SEIA 3GV5B 4I29A 2A19A 4ELUA 1S0VA 2PKEA 7ICSA 2HI0A 5AK3A 1NZBA 4YCXA 2OWOA 2R8GA 2RDJA 2I1QA 5J2EA 3TKAA 1L3SA 4G9BA 5DDMA 4NLKA 3QUBA 2KTQA 4RT2A 2UVWA 3FM9A 2RQ5A 3UXPA 5KG4A 4EEYA 4QZEA 2ALZA 2E1EA 4RQ2A 2NRWA 4DOBA 3CNHA 2BCSA 2CPRA 1S0OA 4I2GA 5EWGA 3GV8B 2JEFA 7ICFA 4PH5A 2KN7A 4ECQA 1RQLA 2NYVA 1WYGA 3N97B 3D2NA 5L1MA 2R8IA 3D2QA 4F5NA 4RNMA 5DLGA 2Y0SC 1J2NA 4M0AA 3PW0A 3D2SA 1L7OA 3F2BA 4UAZA 4DLGA 4YMMA 1ZD5A 5JRTA 3ZDBA 4DO9A 2AH5A 1BPBA 4RU9A 5F9LA 2BQRA 1ZQIA 2LYHA 4F5PA 4AP9A 4UQGA 2Y1JA 9ICBA 1V38A 3QU9A 3DEEA 8ICGA 1A76A 5J8YC 1SV4A 5BOMA 4RQ1A 8ICCA 1XSPA 4UAWA 1L3UA 3K75D 3MDAA 2C2RA 5ALUA 3M6KA 5GTIU 3SAHA 2WB1C 3O0FA 2W7PA 2EZXA 2XICA 3SMVA 9ICSA 2W9AA 4EYIB 7ICIA 4MFFA 4O3PA 4UAUA 4O5EA 4J03A 1A6SA 3QUCA 3PR4A 2K8CB 2HHVA 3GQCA 3JPOA 2LYBA 3ETLA 1N2XA 5BPCA 1KFDA 5ALIA 2G0AA 4KLSA 1ZD3A 1GO3F 1TAMA 5L9XA 1S8OA 2PFQA 2AU0A 1D9DA 1L7NA 3TADA 3AN1A 4J9NA 2BCRA 3OSPA 4YMNA 1Q3UA 1S77D 1KDHA 1HEKA 8ICJA 3BS5A 4E0DA 1T3QA 4JMUA 1RDFA 4ICAA 4UB1A 2KSOA 7ICKA 4R8UA 3ED5A 1RQNA 4C80A 2KJ5A 3MC1A 2E8MA 3MR2A 4DL2A 3SENA 3RJGA 1SL2A 4DSLA 3SQIA 3WKCA 3B0XA 1KL9A 4J9PA 4TQSA 5J2DA 2FMQA 4CDGA 3JPQA 1V85A 2IA6A 7ICQA 5KTQA 1KKXA 4NLBA 1XWLA 4Q44A 3EW9A 4XQ8A 9ICLA 1NKCA 3QU4A 4QW9A 1N60A 3C2LA 3PW2A 3UMCA 1KEJA 5DBAA 3H8JA 3VCBA 2BDPA 4PPXA 3PVXA 1BNPA 5CR0A 5DLFA 5E79U 5KFDA 3I76A 3DDHA 2NO4A 1SXEA 4AYBF 4ED0A 3UMBA 4NXZA 1QH9A 4UW9A 2W9BA 1DRGA 5A0LA 1D8YA 3U26A 4JV0A 4R63A 7ICNA 5KFMA 2I6XA 1NK0A 5KFYA 2OHFA 4F5QA 4DCCA 2XY7A 3PSPA 3C29A 5AKHA 3KKAC 3BJYA 4RQ0A 2AJQA 2JH7A 2MUTA 2DKXA 4R65A 1Z19A 3NS1A 3F5EA 1PZNA 3BQTA 5KFCA 1ZQTA 1N48A 4I2IA 2AGOA 1ZJNA 4PJ0U 4P0PA 8ICNA 2K8AA 2DPJA 5KFXA 5AKXA 5KT7A 2JV3A 4BJQA 2D8CA 1TFRA 2QARA 5AKGA 2P35A 4FO6A 2E5SA 2O6KA 2RLTA 1J2MA 2WF5A 2KNJA 2YX8A 1K1SA 4I2CA 1QQ6A 1XO0A 2EH9A 5JTIA 3VC8A 5ALGA 1QSLA 3JPSA 2CRXA 5CJ7A 2V4RA 2HHXA 4B9LA 3E2EA 7ICHA 2WTFA 4Y2RA 5EOZA 2BDUA 1C7YA 4O3MA 3GFKB 2K8BB 2XIDA 2N1RA 2OXOA 3EPIA 3K1ZA 4BDPA 2WF8A 5EE1A 2RHFA 1L7MA 3SZ2A 8ICRA 3TAPA 5HP4A 2JHDA 3LVVA 4US8A 5KNIA 2F1HA 4O3SA 2W11A 4OO1J 2WF9A 4HAIA 2KKVA 1ZQLA 1ZQCA 2GLEA 5ALVA 1Z1BA 1L5UA 2MUTB 1TAQA 4FBTA 4CGZA 3LYSA 1WWUA 2PI5A 2XGQA 5AICA 2H3VA 4Y2VA 4F71A 3AMZA 2JGAA 5KFEA 1KQQA 1BNOA 4DF8A 4ECRA 2NRVA 1ZQJA 4FE3A 4NLNA 4RQ3A 4F5OA 4DSIA 2HVIA 1H38A 5J0WA 2YB4A 3PO5A 2HMXA 2QARB 1XU4A 5J0TA 5K4LA 3PMLA 4HYKA 4EBCA 5KG7A 4J9QA 3QZ8A 4DOCA 3ZDDA 2DL0A 2HSZA 4LZGA 4F50A 1ZQZA 2H3FA 3ISBA 3E58A 4RQ4A 2KEYA 1K5OA 3SAFA 1BPXA 5AKEA 3N7PD 4XA5A 2QB0A 1CEZA 1D9FA 5KT3A 2F77X 1M6YA 3G6VA 1LB2B 3RRHA 4ELVA 8ICFA 3HP6A 1KFSA 1T7PA 1LKYA 1JXEA 3V72A 2XI9A 2Y9TA 4C8KA 2HVHA 1D8BA 2D3DA 3H4DA 2KIVA 2W55A 1CRXA 3TACB 4KLFA 3KFUF 3QEAZ 5HNKA 2BR0A 7ICGA 4O5KA 2F1JA 4ELTA 5CEHA 5AM2A 5KFQA 4AYBC 1IIPA 5EWEA 1S10A 4KITB 2QKQA 3RJJA 3OJUA 1OXJA 3RH5A 2VA3A 2WB1F 3RAQA 4QZDA 1SWVA 1B22A 4DOAA 3WK9A 1NI3A 2ZIVA 1SWWA 4KN7A 5CB1A 5J2JA 1N5WA 4K4HA 4NM2A 2D6FC 4ACOA 9ICMA 5KG5A 4MEXA 4QJFB 2ZUDA 4ED1A 2KE7A 9ICEA 2ES6A 4ECSA 4ED6A 3WK4A 4F2RA 4C8LA 2XVTA 4YXMA 5AKIA 3PSTA 4A8EA 4EX6A 3UMGA 3GILA 3WK6A 3KHHA 1F44A 2HHWA 1KN5A 5KFKA 9ICCA 1ZD4A 5CWRA 4GIBA 1HJPA 3IN5A 1WWVA 5DQIA 1ZQOA 2YTUA 3NTUA 5AI0A 2FDRA 5DKWA 3H40A 1CI4A 2KJ8A 1KW4A 3MGVA 2VKQA 1SB3C 1L7PA 1IV8A 4GLXA 3WKBA 4F72A 3WK7A 3GIMA 5EWFA 8ICMA 2W8KA 1SV0A 1VDVA 4NJ8A 4Y2TA 4MEYA 5KG2A 3CRXA 3DV9A 2I9GA 2JEIA 3TAQA 2LI6A 3UXOA 4QW8A 2ISPA 1NOMA 7ICVA 1XS9D 3OPXA 8ICXA 2KV2A 3M6ZA 4ZOHC 1MQ3A 2NRXA 2ZIVB 2GO7A 4CF4A 5ALRA 2OEHA 3SYZA 5F9NA 5DB8A 4YQWA 2DFLA 4ECWA 2HOQA 4DSJA 4KN4A
chains in the Genus database with same CATH topology
1B4FA 1X40A 2F8KA 1UQVA 2ESEA 1F0MA 2FE9A 2QB0B 4IS7A 3BS5A 2Y9UA 1COKA 2KE7A 2JV3A 2ES6A 2QARB 5L1MA 2D8CA 5J8YA 1LKYB 2KSOA 2QARA 3H8MA 2F3NA 2F44A 3BQ7A 2E8NA 2DL0A 2E8MA 1B0XA 2EAMA 3SENA 4MHVA 5JRTA 2K60A 5JTIA 2LPEA 3TADC 5F3XB 1WWVA 2QB0A 1SXDA 1V85A 2YTUA 3BS7A 1OW5A 1UCVA 1KW4A 2EANA 1V38A 2B6GA 1LKYA 4PZNA 2L5YA 3HILA 2EAPA 2Y9TA 5J8YC 1SV4A 3IDWA 2D3DA 3KKAA 2KIVA 1X9XA 1SV0A 2DKZA 4NJ8A 1PK1B 1PK3A 1RG6A 2K4PA 3K1RB 1SXEA 4NL9A 3TACB 1PK1A 3SEIA 2QB1A 4RQMA 4RQNA 2KG5A 1X66A 5KNIA 3BS5B 1JI7A 1Z1VA 2EAOA 2QKQA 2E8OA 1OXJA 1SGGA 2GLEA 4PZOA 2KMDA 2E8PA 2LMRA 2KSOB 1DXSA 3KKAC 5JU5A 1SV0C 1WWUA 2DKXA 4NL9C 3TADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4F A;  1X40 A;  2F8K A;  1UQV A;  2ESE A;  1F0M A;  2FE9 A;  2QB0 B;  4IS7 A;  3BS5 A;  2Y9U A;  1COK A;  2KE7 A;  2JV3 A;  2ES6 A;  2QAR B;  5L1M A;  2D8C A;  5J8Y A;  1LKY B;  2KSO A;  2QAR A;  3H8M A;  2F3N A;  2F44 A;  3BQ7 A;  2E8N A;  2DL0 A;  2E8M A;  1B0X A;  2EAM A;  3SEN A;  4MHV A;  5JRT A;  2K60 A;  5JTI A;  2LPE A;  3TAD C;  5F3X B;  1WWV A;  2QB0 A;  1SXD A;  1V85 A;  2YTU A;  3BS7 A;  1OW5 A;  1UCV A;  1KW4 A;  2EAN A;  1V38 A;  2B6G A;  1LKY A;  4PZN A;  2L5Y A;  3HIL A;  2EAP A;  2Y9T A;  5J8Y C;  1SV4 A;  3IDW A;  2D3D A;  3KKA A;  2KIV A;  1X9X A;  1SV0 A;  2DKZ A;  4NJ8 A;  1PK1 B;  1PK3 A;  1RG6 A;  2K4P A;  3K1R B;  1SXE A;  4NL9 A;  3TAC B;  1PK1 A;  3SEI A;  2QB1 A;  4RQM A;  4RQN A;  2KG5 A;  1X66 A;  5KNI A;  3BS5 B;  1JI7 A;  1Z1V A;  2EAO A;  2QKQ A;  2E8O A;  1OXJ A;  1SGG A;  2GLE A;  4PZO A;  2KMD A;  2E8P A;  2LMR A;  2KSO B;  1DXS A;  3KKA C;  5JU5 A;  1SV0 C;  1WWU A;  2DKX A;  4NL9 C;  3TAD A; 
#chains in the Genus database with same CATH topology
 5FP0 A;  1X40 A;  1N56 A;  3BQ0 A;  1X6J A;  9ICJ A;  4GXJ A;  1ZQM A;  2OM6 A;  3SV4 A;  5ALY A;  1ZQS A;  2RDI A;  4KLM A;  5J0P A;  2FPK A;  3F5A A;  3MR3 A;  1NKB A;  4M9H A;  1JX4 A;  2XY5 A;  1TVA A;  5AK4 A;  2KVC A;  3QX7 A;  3BQ1 A;  3GIK A;  3M1Y A;  2VA2 A;  4R66 A;  2PFN A;  7ICO A;  8ICA A;  2A1J A;  4EZ9 A;  4Y2U A;  2LPE A;  2YML A;  4O3Q A;  5F3X B;  1WUD A;  3AQF A;  3JPP A;  4FS2 A;  5J0Y A;  4C4S A;  2M0N A;  4UAY A;  2KHQ A;  3H8S A;  2B6G A;  4Z6C A;  4J9O A;  1BPY A;  1V9P A;  3LDA A;  5KAI U;  5AM5 A;  3KD3 A;  1S5L U;  2ZTC A;  2HHS A;  5KG1 A;  5HR7 A;  8ICT A;  2F8L A;  2DKZ A;  3HPO A;  4YG2 A;  3QU5 A;  3K1R B;  1PK1 A;  4Z6E A;  4QZ9 A;  1NJW A;  5KFW A;  3L3F X;  5D49 A;  1L6N A;  4PL1 A;  4NLC A;  2MA1 A;  5KFH A;  4F93 B;  4ECT A;  4B9N A;  1X9W A;  3AM9 A;  1TK0 A;  1QSS A;  1Z4O A;  3KBB A;  4OCZ A;  5IIK A;  5G5H A;  4WJ3 B;  2KMD A;  2IOF K;  5KFA A;  5KL8 B;  4BWJ A;  2FLN A;  4C7Y A;  3NAS A;  2PFP A;  4M6W B;  3EYZ A;  5ALO A;  5DBC A;  2R8J A;  4EEN A;  2ZXI A;  2F1I A;  2JZB A;  4Y2Q A;  2GH1 A;  4UAV A;  2F8K A;  4YFK A;  1ZYQ A;  1UQV A;  4DS5 A;  1T8E A;  1QSY A;  2GWS A;  1SKR A;  3E0F A;  3B0Y A;  3Q8Q B;  2WF6 A;  1COK A;  3RF9 A;  4CRX A;  3HT3 A;  2W43 A;  4LZD A;  1TAU A;  2NO5 A;  3AU2 A;  8ICZ A;  9ICH A;  4RQ8 A;  4KLL A;  4EBD A;  2A1J B;  2EAM A;  5AM1 A;  3B9J A;  1L3V A;  3IG8 A;  2GOL A;  2CXY A;  3GU3 A;  2IOH A;  5IIM A;  5B5E U;  5GTH U;  4J9K A;  2W8L A;  3Q8M A;  1XSL A;  3RFA A;  4B9U A;  4F3O A;  2BKE A;  1WG8 A;  1YZ7 A;  3IDW A;  3AEV A;  3T79 A;  2ASJ A;  1QCK A;  4K4I A;  4QWE A;  4P4M A;  1PK1 B;  4NL9 A;  4QIW C;  1U4B A;  4F8R A;  5AK5 A;  1ZOL A;  3TFR A;  2BQU A;  2HBJ A;  3CP8 A;  4ED8 A;  3T5J A;  3LK9 A;  1KRP A;  1JI7 A;  5KFO A;  5DBB A;  2E8O A;  2E1F A;  1COO A;  3T5K A;  2WFA A;  4ED2 A;  8ICE A;  3SI8 A;  4NM1 A;  3PV8 A;  1S0N A;  3IV6 A;  1DXS A;  2JZB B;  2PI4 A;  3MGH A;  4UAR A;  4KLH A;  5B66 U;  5EE3 A;  4P0Q B;  3QYP A;  5KFR A;  4KX5 A;  2C28 A;  4KLO A;  4M9J A;  4O3R A;  3C1Z A;  3OHA A;  1RXV A;  3C1Y A;  3MFI A;  3C28 A;  4F4Z A;  3R9K A;  4ECX A;  1CUK A;  2EDU A;  3WKE A;  3N7S C;  2BZF A;  2HHT A;  2F44 A;  4KMO B;  5J0S A;  1F5S A;  2Q0Z X;  4GXK A;  5T14 A;  1UA1 A;  1L8L A;  2BPC A;  4FS1 A;  1U49 A;  5KFJ A;  5KFB A;  4CCH A;  1TV9 A;  1BVS A;  3ZI4 A;  3C5F A;  1OW5 A;  4OJP A;  5KFU A;  3PX6 A;  5AKY A;  5J2H A;  1T4G A;  4MFA A;  4PHP A;  2HW3 A;  2J6T A;  1VLB A;  7ICR A;  2J6U A;  1QLN A;  5IIN A;  3UM9 A;  4KLI A;  5KFG A;  1XSN A;  1ZQE A;  2G09 A;  1XNS A;  2ZG6 A;  1ZQB A;  2YY6 A;  5CP2 A;  4US9 A;  2G07 A;  5ALF A;  2KK0 A;  2ZJ5 A;  2ZJA A;  4BX9 C;  1FFV A;  4LJX A;  4B9S A;  4Y2S A;  3GDX A;  3V7J A;  1ZQV A;  5DQG A;  4F5R A;  2XY6 A;  3WK5 A;  3H8W A;  3JPT A;  4FZN A;  2KJ9 A;  4RNN A;  2RRD A;  4DL7 A;  3QEB Z;  2A1A A;  2J6S A;  1UHU A;  2EZZ A;  2KHV A;  2BCQ A;  4YR3 A;  1NK5 A;  1HUZ A;  2KFZ A;  7ICJ A;  3M9N B;  4PGY A;  2JMG A;  3ZD8 A;  4CNQ A;  1KBU A;  3RAX A;  4EBE A;  2FE9 A;  3SAG A;  1Z00 B;  3RJE A;  4YR2 A;  4DSE A;  4O5C A;  8ICB A;  1NK4 A;  1SKW A;  1FIQ A;  4KMU A;  4USA A;  2JXJ A;  1NK9 A;  4P4P A;  3NUQ A;  5IIO A;  2H3Q A;  5TIS U;  4QZC A;  3UQ0 A;  2NV3 A;  2W03 A;  1BGX T;  2LBO A;  2F2A B;  3MDC A;  3MFH A;  4EEL A;  3TAD C;  3C21 A;  3ETR A;  3MBY A;  4DFM A;  3UPQ A;  2AGP A;  3BS7 A;  8ICQ A;  3ZD9 A;  3BQ2 A;  3FC4 A;  2BCV A;  1TE2 A;  4OJO A;  2BHN A;  3F53 A;  2PMZ F;  2ZIW B;  4BXO A;  5HML A;  3ICX A;  1JRP A;  2P66 A;  1SL1 A;  3RR8 A;  4P4O A;  1U9L A;  4B6J A;  5KG3 A;  1PVR A;  1NJZ A;  2K4P A;  2C22 A;  5DB6 A;  4EYH B;  2K4E A;  3D6J A;  3EWA A;  4C4R A;  1ZQP A;  5ALM A;  1KLN A;  3GZF A;  1Z1V A;  2ZIU A;  3PMN A;  2KOB A;  5DG8 A;  5TZV A;  4J9S A;  1Q3V A;  4DF4 A;  8ICV A;  2E8P A;  2XO7 A;  3RJI A;  2G5I B;  1S0M A;  4KLU A;  2A3V A;  4DL4 A;  3LWL A;  4IR9 A;  1MQ2 A;  4UB8 U;  2EQY A;  4ECU A;  3AL0 B;  4IRC A;  2Q4T A;  4QWA A;  2ESE A;  1MA7 A;  3SV3 A;  4NLZ A;  3NVW A;  4CF5 A;  1IM4 A;  4GC6 A;  2W9M A;  3HJE A;  4F92 B;  5III A;  3NRZ A;  1SL0 A;  1C20 A;  5J8Y A;  3H4B A;  2BPG A;  1VJ5 A;  2IHM A;  5J0X A;  2OYY A;  3BQ7 A;  2WHE A;  5DG7 A;  2HHQ A;  4TUP A;  3V6K A;  2R18 A;  3T3F A;  3G6Y A;  2AQ4 A;  1L3T A;  4YMO A;  5ALH A;  8ICS A;  4G3I A;  5CHG A;  1LV5 A;  5IIJ A;  3GII A;  3ZDA A;  4ED3 A;  5L1K A;  2EAN A;  3KHL A;  4F91 B;  3TAR A;  2W7O A;  4BXO B;  3FDS A;  3HX0 A;  3PX4 A;  1KSP A;  2HHU A;  4I2J A;  3N7R C;  1ZQH A;  2W54 A;  4IQT A;  2KFN A;  1SIJ A;  4GFJ A;  2KZ3 A;  4I2D A;  4NWI A;  1RM6 C;  4YD2 A;  4QNL A;  4J9L A;  5ALX A;  2K4H A;  4RQN A;  5J0Q A;  4DL5 A;  4M04 A;  2W9C B;  2ZIU B;  5AI4 A;  4I2B A;  2QLT A;  1DK3 A;  4Z6F A;  2BPF A;  1YZ6 A;  1UPH A;  4JB3 A;  4QWB A;  3H0M B;  3HWT A;  4RPY A;  2JRZ A;  5HHH A;  4QIW F;  3MGI A;  5J0O A;  5AKJ A;  1T94 A;  3M9M B;  4MF8 A;  1ZQK A;  3OGU A;  4B9V A;  5AHX A;  4O0I A;  2FPM A;  4DQP A;  4YN4 A;  4RUA A;  8ICU A;  5DG9 A;  2B0C A;  1FEZ A;  5D46 A;  4QWD A;  4GXI A;  4PGX A;  3MAB A;  4JV1 A;  1TKD A;  4KX3 A;  1JXL A;  3PY8 A;  3MR6 A;  4YXJ A;  2Y9U A;  2NRT A;  4ECV A;  5ALL A;  3HKZ F;  5KFZ A;  4F4Y A;  2XCA A;  5JUM A;  4M6W A;  4JWM A;  4UAS A;  2MAX A;  4UB5 A;  3G6X A;  3H8M A;  4O3O A;  5DB7 A;  1WCL A;  2LKY A;  2LYA A;  2E8N A;  4I2A A;  1B0X A;  9ICU A;  1N5X A;  3H0L B;  3KOO A;  4CF3 A;  3IM1 A;  1X9M A;  2DUY A;  2MSN A;  1UT8 A;  4I2H A;  9ICK A;  4U6P A;  1YT3 A;  4TUS A;  4YVZ A;  1O03 A;  4DWI A;  1PUZ A;  2ATL A;  5AIA A;  2VA8 A;  4DFD A;  1JIH A;  4QZH A;  3KKA A;  1NK6 A;  1X2I A;  5EE0 A;  9ICR A;  1Z3E B;  3C2M A;  4KLG A;  4RQ6 A;  5DB9 A;  4Y2X A;  2PMZ C;  4NV0 A;  1A0P A;  3IRU A;  4MFC A;  3BDP A;  3PX0 A;  3IG5 A;  2XGP A;  1D8L A;  4Y2J A;  4J9M A;  8ICH A;  2G5H B;  2JEJ A;  2IOF A;  2DBY A;  1X66 A;  2E3T A;  4UBB A;  4QZB A;  3EZ5 A;  2FLL A;  5J2B A;  1N62 A;  5AI5 A;  5ALJ A;  5ALK A;  4PGQ A;  1SGG A;  1Y88 A;  1X9S A;  5BOL A;  4Z6D A;  3EPG A;  8ICI A;  4DQR A;  3WKA A;  4DFP A;  2HBL A;  4M9N A;  3ONN A;  4RNO A;  2HDO A;  4DQQ A;  4DEZ A;  4DQI A;  8ICO A;  5ALW A;  3RB4 A;  4IS7 A;  2DF4 B;  5ALZ A;  2PFO A;  1ZQG A;  3IHQ B;  3AU6 A;  3Q8R B;  4I27 A;  5AK6 A;  4ED7 A;  2WF7 A;  2ZUC A;  3A0H U;  3PO4 A;  3J81 j;  3V7L A;  2AQ0 A;  4RPX A;  2KP7 A;  1ZXI A;  1U48 A;  2JR5 A;  2KKP A;  3LVW A;  1AQ6 A;  3WKD A;  2YB1 A;  3M7D A;  3OTQ A;  3BZK A;  4MHV A;  4P0Q A;  5KG0 A;  2K60 A;  5KFV A;  5J2G A;  4TQR A;  1MSW D;  1O08 A;  3NVV A;  2KZZ A;  3ORY A;  2WAQ F;  1N63 A;  5ALS A;  2C2D A;  7ICT A;  4I28 A;  5AM3 A;  4IC9 A;  4KTQ A;  4EEK A;  4MF2 A;  3T5L A;  3C23 A;  4PZN A;  2BQ3 A;  4F4W A;  3KTQ A;  5G5G A;  2M9N A;  2G06 A;  2EZY A;  1ZQU A;  4XRH A;  4KLE A;  1X9X A;  1N61 A;  1SKS A;  4PHE A;  1Q8K A;  1PK3 A;  3WU2 U;  1RG6 A;  3SD7 A;  3S6J A;  3QNM A;  4M9G A;  4UB6 U;  2LM4 A;  4OJ5 A;  2FLP A;  3RR7 A;  3ZDC A;  2OH2 A;  5AKK A;  1Q46 A;  3PW7 A;  1RYS A;  5KAF U;  1ZQA A;  4OD0 A;  1PVP A;  4KLQ A;  4DLE A;  3N28 A;  4TUR A;  2C2E A;  4RZR A;  2V9W A;  5HHI A;  3N4M B;  1NKE A;  4Q45 A;  5J2C A;  1NJX A;  4JK1 A;  1ZQF A;  4UAT A;  1SZP A;  1SV0 C;  1NK7 A;  3I28 A;  2CN1 A;  1S97 A;  2R8H A;  1FO4 A;  1IXR A;  5KT4 A;  1URJ A;  4EX7 A;  2ODG A;  2DWQ A;  4ZH4 A;  4UB4 A;  5H2F U;  1ZRM A;  3LWM A;  4QZ8 A;  1U45 A;  2H3Z A;  4PHD A;  1ZQD A;  4DSK A;  1DGJ A;  1FFU A;  2HOI A;  4IRD A;  5ALD A;  1ED1 A;  4KLJ A;  1T3N A;  4C8N A;  5AI9 A;  1J97 A;  2V4Q A;  5AI8 A;  4O9M A;  3NRW A;  2F3N A;  4TUQ A;  1HIW A;  2UVR A;  4Q43 A;  3HKZ C;  4IL6 U;  4QZG A;  3NGD A;  1ECW A;  1BPD A;  3KHR A;  3QU2 A;  2MU2 A;  1Z4N A;  1V97 A;  5CRX A;  5HR6 A;  3MR5 A;  2JEG A;  4DFK A;  1QTM A;  1Z00 A;  9ICX A;  4JWN A;  4X5V A;  1UCV A;  1LVH A;  2K4I A;  3M9O B;  4GC7 A;  5KG6 A;  3PZP A;  3QZ7 A;  5AM0 A;  9ICV A;  4B9T A;  2VJ4 A;  3OSN A;  8ICY A;  3RTV A;  5AM4 A;  1P7D A;  3TAN A;  4FZL A;  3PR5 B;  4R64 A;  2RP5 A;  4C0Z A;  9ICP A;  3UQ2 A;  4KLT A;  1KFT A;  3IP4 B;  1S76 D;  3H0R B;  1B43 A;  1NJY A;  3BS5 B;  2JH1 A;  3M8S A;  1NNL A;  4DQS A;  3SR6 A;  1ZQX A;  1ZQ1 C;  1SZH A;  4QWC A;  2ZIW A;  4DSF A;  1S9F A;  2KSO B;  2OCE A;  1HUO A;  3GIJ A;  3QE9 Y;  4R8U B;  2B21 A;  4YR0 A;  2PXI A;  2KVS A;  1ZET A;  3ZDE A;  4QZF A;  3PNC A;  5CA7 A;  2H3I A;  4RT3 A;  1F0M A;  3V6H A;  2NRZ A;  2ZUB A;  2ASD A;  5HMM A;  2YQE A;  1UT5 A;  2H5X A;  9ICI A;  4FZM A;  3HW8 A;  3RH4 A;  4IQW A;  1ZQW A;  2ZTE A;  2LHT A;  5ALT A;  1U47 A;  2FMP A;  1XC9 A;  1X6I A;  2YMP A;  2YN4 A;  9ICN A;  2KD1 A;  7ICU A;  2BCU A;  3ISC A;  4B9M A;  3L5K A;  1L8O A;  2W9B B;  5KL1 B;  2FJ6 A;  4JV2 A;  4M9L A;  3RB6 A;  3JPR A;  1ZQN A;  5D4B A;  4Y2P A;  4F2S A;  4OJL A;  9ICT A;  2W04 A;  3F2D A;  2UVV A;  2WAQ C;  3OJS A;  1DGS A;  8ICK A;  3KZI U;  4RUC A;  3A0B U;  2BGW A;  1QQ5 A;  5KT5 A;  5KFL A;  9ICG A;  2AGQ A;  9ICO A;  3FAH A;  2HCF A;  4C4T A;  3C5G A;  2Y1I A;  3UXN A;  2QB1 A;  5EE9 A;  1JUD A;  2VIX A;  2F76 X;  2IHN A;  5C0Y A;  1A77 A;  3Q8L A;  5L1L A;  4P0P B;  5IIL A;  2KG5 A;  3THV A;  3RRG A;  4F4X A;  1RYU A;  2ZIX A;  3KZX A;  1QQ7 A;  1X42 A;  1IG6 A;  3FYH A;  3Q8K A;  4UB3 A;  2ISO A;  4ECY A;  4PZO A;  5J2A A;  1NK8 A;  2XC9 A;  2IMW P;  4CE6 A;  4NY8 A;  2LMR A;  8ICL A;  3Q8P B;  9ICF A;  3OHB A;  1NZP A;  3ALR A;  3NVZ A;  1RYR A;  2KZM A;  2VJ5 A;  4NL9 C;  1TK5 A;  1B4F A;  5DGB A;  4YP3 A;  1KTQ A;  3I1Y A;  2W9C A;  1MC8 A;  5KFN A;  3RJF A;  3Q8S B;  2ZXH A;  5KT2 A;  8ICP A;  3PW5 A;  4BWM A;  2Y0S F;  4F4K A;  4C7Z A;  1ZRN A;  4DL6 A;  1BPE A;  4BUG A;  3M8R A;  4FBU A;  4YD1 A;  4U7C A;  4K4G A;  2YMM A;  4IQV A;  3TI0 A;  1RPL A;  5DQH A;  5DGA A;  4RQ5 A;  4M2Y A;  2G08 A;  2LM1 A;  4IQU A;  2DPI A;  3RJH A;  1DK2 A;  5DDY A;  2I5H A;  3AQE A;  5KFS A;  4M47 A;  1SXD A;  4RPZ A;  3WK8 A;  4I2E A;  9ICA A;  3CW2 C;  3PSI A;  1WCN A;  2DQN B;  3QUT A;  3QUQ A;  4FFD A;  4ECZ A;  2K89 A;  5J2K A;  4Q8F A;  2L5Y A;  3HIL A;  2EAP A;  2Z7J A;  2ASL A;  3L4P A;  9ICQ A;  3RBE A;  1ZQY A;  8ICW A;  4OJ6 A;  4BGD A;  4KLD A;  3QXG A;  1ARO P;  3H7I A;  4JUZ A;  2MRL A;  3C2K A;  5ALP A;  4DS4 A;  2HBK A;  1PVQ A;  4RQM A;  2ZIX B;  4DFJ A;  2KIW A;  4P2H A;  3RB3 A;  5J0R A;  5ALQ A;  3GV7 B;  4C8M A;  3V6J A;  3RBD A;  2HOF A;  1JN3 A;  2EAO A;  5J0U A;  3NVY A;  4IR1 A;  4J9R A;  2VAN A;  5KT6 A;  2UVU A;  4DL3 A;  2XCP A;  2DGZ A;  5KFT A;  5AKZ A;  4EZ6 A;  4RQ7 A;  5JU5 A;  1DOQ A;  1ZD2 P;  5C5J A;  3TQ1 A;  4Q8E A;  3RH6 A;  4O3N A;  5ALE A;  2FMS A;  1TK8 A;  2P6U A;  2YMQ A;  4QZI A;  2KIC A;  1JAL A;  2QB0 B;  3ISD A;  3RB0 A;  4Y2Y A;  2P6R A;  3EUB 2;  4QZA A;  3QU7 A;  1K1Q A;  2HBM A;  3RJK A;  2ZTD A;  2W3R A;  4LVS A;  5AKL A;  2ZJ8 A;  7ICL A;  2AHO B;  2AXT U;  4NLG A;  2FPL A;  1LKY B;  5KFI A;  1EXN A;  4PHA A;  5L1I A;  1OUQ A;  1RZT A;  4UB2 A;  9ICW A;  2W3S A;  1JMS A;  7ICE A;  3V7K A;  4PL2 A;  3K4G A;  5AI6 A;  5AIB A;  4I2F A;  5KFP A;  5J29 A;  5KFF A;  1UA0 A;  3CYM A;  3T5H A;  5ALN A;  3TFS A;  5J2I A;  3F2C A;  1MN8 A;  3KHG A;  2R8K A;  2IBK A;  1JRO A;  4IRK A;  4C8O A;  5L1J A;  7ICM A;  3PSF A;  4XUS A;  1BPZ A;  2FI1 A;  3PW4 A;  3JPN A;  1ZQR A;  1ZJM A;  1RXW A;  3BZC A;  1XO1 A;  7ICP A;  3AUO A;  4UBC A;  1ZQQ A;  3HRD D;  5J2F A;  3SEI A;  3GV5 B;  4I29 A;  2A19 A;  4ELU A;  1S0V A;  2PKE A;  7ICS A;  2HI0 A;  5AK3 A;  1NZB A;  4YCX A;  2OWO A;  2R8G A;  2RDJ A;  2I1Q A;  5J2E A;  3TKA A;  1L3S A;  4G9B A;  5DDM A;  4NLK A;  3QUB A;  2KTQ A;  4RT2 A;  2UVW A;  3FM9 A;  2RQ5 A;  3UXP A;  5KG4 A;  4EEY A;  4QZE A;  2ALZ A;  2E1E A;  4RQ2 A;  2NRW A;  4DOB A;  3CNH A;  2BCS A;  2CPR A;  1S0O A;  4I2G A;  5EWG A;  3GV8 B;  2JEF A;  7ICF A;  4PH5 A;  2KN7 A;  4ECQ A;  1RQL A;  2NYV A;  1WYG A;  3N97 B;  3D2N A;  5L1M A;  2R8I A;  3D2Q A;  4F5N A;  4RNM A;  5DLG A;  2Y0S C;  1J2N A;  4M0A A;  3PW0 A;  3D2S A;  1L7O A;  3F2B A;  4UAZ A;  4DLG A;  4YMM A;  1ZD5 A;  5JRT A;  3ZDB A;  4DO9 A;  2AH5 A;  1BPB A;  4RU9 A;  5F9L A;  2BQR A;  1ZQI A;  2LYH A;  4F5P A;  4AP9 A;  4UQG A;  2Y1J A;  9ICB A;  1V38 A;  3QU9 A;  3DEE A;  8ICG A;  1A76 A;  5J8Y C;  1SV4 A;  5BOM A;  4RQ1 A;  8ICC A;  1XSP A;  4UAW A;  1L3U A;  3K75 D;  3MDA A;  2C2R A;  5ALU A;  3M6K A;  5GTI U;  3SAH A;  2WB1 C;  3O0F A;  2W7P A;  2EZX A;  2XIC A;  3SMV A;  9ICS A;  2W9A A;  4EYI B;  7ICI A;  4MFF A;  4O3P A;  4UAU A;  4O5E A;  4J03 A;  1A6S A;  3QUC A;  3PR4 A;  2K8C B;  2HHV A;  3GQC A;  3JPO A;  2LYB A;  3ETL A;  1N2X A;  5BPC A;  1KFD A;  5ALI A;  2G0A A;  4KLS A;  1ZD3 A;  1GO3 F;  1TAM A;  5L9X A;  1S8O A;  2PFQ A;  2AU0 A;  1D9D A;  1L7N A;  3TAD A;  3AN1 A;  4J9N A;  2BCR A;  3OSP A;  4YMN A;  1Q3U A;  1S77 D;  1KDH A;  1HEK A;  8ICJ A;  3BS5 A;  4E0D A;  1T3Q A;  4JMU A;  1RDF A;  4ICA A;  4UB1 A;  2KSO A;  7ICK A;  4R8U A;  3ED5 A;  1RQN A;  4C80 A;  2KJ5 A;  3MC1 A;  2E8M A;  3MR2 A;  4DL2 A;  3SEN A;  3RJG A;  1SL2 A;  4DSL A;  3SQI A;  3WKC A;  3B0X A;  1KL9 A;  4J9P A;  4TQS A;  5J2D A;  2FMQ A;  4CDG A;  3JPQ A;  1V85 A;  2IA6 A;  7ICQ A;  5KTQ A;  1KKX A;  4NLB A;  1XWL A;  4Q44 A;  3EW9 A;  4XQ8 A;  9ICL A;  1NKC A;  3QU4 A;  4QW9 A;  1N60 A;  3C2L A;  3PW2 A;  3UMC A;  1KEJ A;  5DBA A;  3H8J A;  3VCB A;  2BDP A;  4PPX A;  3PVX A;  1BNP A;  5CR0 A;  5DLF A;  5E79 U;  5KFD A;  3I76 A;  3DDH A;  2NO4 A;  1SXE A;  4AYB F;  4ED0 A;  3UMB A;  4NXZ A;  1QH9 A;  4UW9 A;  2W9B A;  1DRG A;  5A0L A;  1D8Y A;  3U26 A;  4JV0 A;  4R63 A;  7ICN A;  5KFM A;  2I6X A;  1NK0 A;  5KFY A;  2OHF A;  4F5Q A;  4DCC A;  2XY7 A;  3PSP A;  3C29 A;  5AKH A;  3KKA C;  3BJY A;  4RQ0 A;  2AJQ A;  2JH7 A;  2MUT A;  2DKX A;  4R65 A;  1Z19 A;  3NS1 A;  3F5E A;  1PZN A;  3BQT A;  5KFC A;  1ZQT A;  1N48 A;  4I2I A;  2AGO A;  1ZJN A;  4PJ0 U;  4P0P A;  8ICN A;  2K8A A;  2DPJ A;  5KFX A;  5AKX A;  5KT7 A;  2JV3 A;  4BJQ A;  2D8C A;  1TFR A;  2QAR A;  5AKG A;  2P35 A;  4FO6 A;  2E5S A;  2O6K A;  2RLT A;  1J2M A;  2WF5 A;  2KNJ A;  2YX8 A;  1K1S A;  4I2C A;  1QQ6 A;  1XO0 A;  2EH9 A;  5JTI A;  3VC8 A;  5ALG A;  1QSL A;  3JPS A;  2CRX A;  5CJ7 A;  2V4R A;  2HHX A;  4B9L A;  3E2E A;  7ICH A;  2WTF A;  4Y2R A;  5EOZ A;  2BDU A;  1C7Y A;  4O3M A;  3GFK B;  2K8B B;  2XID A;  2N1R A;  2OXO A;  3EPI A;  3K1Z A;  4BDP A;  2WF8 A;  5EE1 A;  2RHF A;  1L7M A;  3SZ2 A;  8ICR A;  3TAP A;  5HP4 A;  2JHD A;  3LVV A;  4US8 A;  5KNI A;  2F1H A;  4O3S A;  2W11 A;  4OO1 J;  2WF9 A;  4HAI A;  2KKV A;  1ZQL A;  1ZQC A;  2GLE A;  5ALV A;  1Z1B A;  1L5U A;  2MUT B;  1TAQ A;  4FBT A;  4CGZ A;  3LYS A;  1WWU A;  2PI5 A;  2XGQ A;  5AIC A;  2H3V A;  4Y2V A;  4F71 A;  3AMZ A;  2JGA A;  5KFE A;  1KQQ A;  1BNO A;  4DF8 A;  4ECR A;  2NRV A;  1ZQJ A;  4FE3 A;  4NLN A;  4RQ3 A;  4F5O A;  4DSI A;  2HVI A;  1H38 A;  5J0W A;  2YB4 A;  3PO5 A;  2HMX A;  2QAR B;  1XU4 A;  5J0T A;  5K4L A;  3PML A;  4HYK A;  4EBC A;  5KG7 A;  4J9Q A;  3QZ8 A;  4DOC A;  3ZDD A;  2DL0 A;  2HSZ A;  4LZG A;  4F50 A;  1ZQZ A;  2H3F A;  3ISB A;  3E58 A;  4RQ4 A;  2KEY A;  1K5O A;  3SAF A;  1BPX A;  5AKE A;  3N7P D;  4XA5 A;  2QB0 A;  1CEZ A;  1D9F A;  5KT3 A;  2F77 X;  1M6Y A;  3G6V A;  1LB2 B;  3RRH A;  4ELV A;  8ICF A;  3HP6 A;  1KFS A;  1T7P A;  1LKY A;  1JXE A;  3V72 A;  2XI9 A;  2Y9T A;  4C8K A;  2HVH A;  1D8B A;  2D3D A;  3H4D A;  2KIV A;  2W55 A;  1CRX A;  3TAC B;  4KLF A;  3KFU F;  3QEA Z;  5HNK A;  2BR0 A;  7ICG A;  4O5K A;  2F1J A;  4ELT A;  5CEH A;  5AM2 A;  5KFQ A;  4AYB C;  1IIP A;  5EWE A;  1S10 A;  4KIT B;  2QKQ A;  3RJJ A;  3OJU A;  1OXJ A;  3RH5 A;  2VA3 A;  2WB1 F;  3RAQ A;  4QZD A;  1SWV A;  1B22 A;  4DOA A;  3WK9 A;  1NI3 A;  2ZIV A;  1SWW A;  4KN7 A;  5CB1 A;  5J2J A;  1N5W A;  4K4H A;  4NM2 A;  2D6F C;  4ACO A;  9ICM A;  5KG5 A;  4MEX A;  4QJF B;  2ZUD A;  4ED1 A;  2KE7 A;  9ICE A;  2ES6 A;  4ECS A;  4ED6 A;  3WK4 A;  4F2R A;  4C8L A;  2XVT A;  4YXM A;  5AKI A;  3PST A;  4A8E A;  4EX6 A;  3UMG A;  3GIL A;  3WK6 A;  3KHH A;  1F44 A;  2HHW A;  1KN5 A;  5KFK A;  9ICC A;  1ZD4 A;  5CWR A;  4GIB A;  1HJP A;  3IN5 A;  1WWV A;  5DQI A;  1ZQO A;  2YTU A;  3NTU A;  5AI0 A;  2FDR A;  5DKW A;  3H40 A;  1CI4 A;  2KJ8 A;  1KW4 A;  3MGV A;  2VKQ A;  1SB3 C;  1L7P A;  1IV8 A;  4GLX A;  3WKB A;  4F72 A;  3WK7 A;  3GIM A;  5EWF A;  8ICM A;  2W8K A;  1SV0 A;  1VDV A;  4NJ8 A;  4Y2T A;  4MEY A;  5KG2 A;  3CRX A;  3DV9 A;  2I9G A;  2JEI A;  3TAQ A;  2LI6 A;  3UXO A;  4QW8 A;  2ISP A;  1NOM A;  7ICV A;  1XS9 D;  3OPX A;  8ICX A;  2KV2 A;  3M6Z A;  4ZOH C;  1MQ3 A;  2NRX A;  2ZIV B;  2GO7 A;  4CF4 A;  5ALR A;  2OEH A;  3SYZ A;  5F9N A;  5DB8 A;  4YQW A;  2DFL A;  4ECW A;  2HOQ A;  4DSJ A;  4KN4 A; 
#chains in the Genus database with same CATH homology
 1B4F A;  1X40 A;  2F8K A;  1UQV A;  2ESE A;  1F0M A;  2FE9 A;  2QB0 B;  4IS7 A;  3BS5 A;  2Y9U A;  1COK A;  2KE7 A;  2JV3 A;  2ES6 A;  2QAR B;  5L1M A;  2D8C A;  5J8Y A;  1LKY B;  2KSO A;  2QAR A;  3H8M A;  2F3N A;  2F44 A;  3BQ7 A;  2E8N A;  2DL0 A;  2E8M A;  1B0X A;  2EAM A;  3SEN A;  4MHV A;  5JRT A;  2K60 A;  5JTI A;  2LPE A;  3TAD C;  5F3X B;  1WWV A;  2QB0 A;  1SXD A;  1V85 A;  2YTU A;  3BS7 A;  1OW5 A;  1UCV A;  1KW4 A;  2EAN A;  1V38 A;  2B6G A;  1LKY A;  4PZN A;  2L5Y A;  3HIL A;  2EAP A;  2Y9T A;  5J8Y C;  1SV4 A;  3IDW A;  2D3D A;  3KKA A;  2KIV A;  1X9X A;  1SV0 A;  2DKZ A;  4NJ8 A;  1PK1 B;  1PK3 A;  1RG6 A;  2K4P A;  3K1R B;  1SXE A;  4NL9 A;  3TAC B;  1PK1 A;  3SEI A;  2QB1 A;  4RQM A;  4RQN A;  2KG5 A;  1X66 A;  5KNI A;  3BS5 B;  1JI7 A;  1Z1V A;  2EAO A;  2QKQ A;  2E8O A;  1OXJ A;  1SGG A;  2GLE A;  4PZO A;  2KMD A;  2E8P A;  2LMR A;  2KSO B;  1DXS A;  3KKA C;  5JU5 A;  1SV0 C;  1WWU A;  2DKX A;  4NL9 C;  3TAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...