2YN4A

L-2-chlorobutryic acid bound complex l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
225
structure length
225
Chain Sequence
SGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 89
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2yn4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yn4A01
1QH9A 4CE6A 4QJBA 1YS9A 2JAOA 2P27A 3B9BA 3ZTYA 3M1YA 3L1VA 5AW9A 4F72A 4L6AA 4QQFA 3MN1A 4BKMA 3L0BA 2FPSA 1L7PA 4YIKA 2FI1A 4GIBA 3A3YA 1T5TA 2I7DA 1ZRMA 1ZD2P 2HCFA 1RLOA 2B1QA 1LVHA 5ALTA 1Z5GA 3OCYA 4NABA 4YCLA 3AR9A 4UAUA 3L8EA 1Q91A 2Q4TA 4IFTA 2X4DA 3N5KA 4Y2SA 3L1UA 2WF5A 5AM4A 4I9GA 5AW6A 1S2OA 3L7YA 3L8FA 3U7FB 2WF8A 3NALA 1TJ5A 1Z4PX 1CR6A 3KDPA 5AKYA 1Z4MA 4UM7A 3QYPA 4BYGA 2W11A 2PQ0A 1RRCA 4UARA 5AW1A 4NV0A 2WF9A 3E58A 4GXTA 1U7OA 3ESQA 3UMCA 4EX7A 3ZW7A 1O03A 2FPUA 3ZWDA 1Z4IA 3ZVMA 5AK3A 2JAWA 5AI9A 3WGVA 1QQ7A 4KX5A 2YMMA 2MSNA 4EEKA 4B6JA 4MUMA 2ZBFA 4ZEWA 4E88A 3U7GA 4PNHA 1TJ4A 2I33A 4JDPA 4UMVA 1U7PA 1Z4QA 4BBJA 2RBKA 3ET4A 1RMQA 2IOFK 2R8XA 3QUCA 3R9KA 3UMGA 3QX7A 4UMEA 2CFRA 4RETA 2NO4A 2YN4A 3I76A 1RMTA 1MH9A 2EATA 2Q5EA 3BWVA 3L8GA 1Z4LA 3N07A 5AM0A 5AW0A 1ZD4A 3WK5A 5AW2A 2BY4A 1XPJA 1TJ3A 2G0AA 1ZJJA 4XPZA 5ALXA 5ALRA 3EF1A 1SWVA 5AM5A 2B8EA 2HDOA 1EK2A 2PR7A 5AKEA 5AVQA 5AVYA 4J2TA 3ZVNA 1SU4A 4BX2A 2HEGA 4ZEXA 4Y2QA 4DCCA 5AHXA 1WZCA 2G80A 4JB3A 1TE2A 1L8OA 2G07A 2YFYA 2HO4A 3IB6A 4G63A 2FDRA 2YY6A 3I6BA 4XOUA 2MU2A 3D6JA 4YGYA 4DWOA 2JGAA 5AW5A 2I54A 3NUQA 1ZD5A 3I1YA 3QUBA 3CZ4A 1RMYA 2R8EA 4AS3A 2O9JA 3L8HA 3MPOA 4CF4A 2OA0A 5AIAA 3WKBA 3NASA 5ALZA 5E0OA 3FM9A 5AKHA 4OHFA 1TA0A 4AP9A 2G08A 1VFPA 3QUQA 1RLTA 2WHEA 4OFZA 1T5SA 4UMDA 5AM3A 3ZVLA 2FUEA 4BEVA 3PDWA 3QNMA 3IJ5A 5IT4A 3WKCA 3U7EB 3WKAA 3E81A 4XE5A 1XVIA 3W5CA 1ZRNA 5AK5A 4EZEA 2I34A 4DFDA 2GHQA 3P96A 3SKXA 3MMZA 4ZEVA 1X42A 2HF7A 5AKKA 4HAIA 5AICA 5AVUA 4Y2RA 1L7NA 4C4TA 1Z5UA 3ZU6A 3E84A 3QUTA 5ALFA 3FVVA 1N8NA 3RFUA 3QU2A 4UU1A 5ALSA 2ZXEA 5AIBA 3AR3A 3K1ZA 1NRWA 3ZX5A 3PCTA 4KNVA 3L5KA 3VAYA 2IA5A 4NAVA 2B1RA 3NAMA 1L8LA 3WK9A 2AGVA 5AKIA 3OCWA 4I9FA 4NFLA 1K1EA 4KNWA 3EPRA 2GHTA 4MWOA 5ALEA 2HSZA 4RESA 3S6JA 2QLTA 2ZBEA 1ZS9A 3R4CA 1J8DA 4Y2JA 3DNPA 3QU4A 2I6XA 3L0YA 2GMWA 3ZX4A 2JAUA 4BX3A 2OYCA 4Y2PA 3J7TA 4KYTA 2HF2A 3AR5A 4CF5A 5ALLA 1Q92A 1WVIA 1RKUA 3FPBA 4H1WA 3A1DA 3U19A 4HGOA 1VJ5A 3W5AA 2R8YA 3ONNA 1T9ZA 3QU9A 3U7HB 4FFDA 3B9RA 3OCZA 1Z88A 1RKVA 4HYTA 4BNDB 2CFTA 3KZXA 2BDEA 3N1UA 3I28A 3MC1A 1O08A 5AVVA 3W5BA 3M9LA 2AH5A 5AI6A 4G9BA 2NYVA 4UASA 3F9RA 1U2SA 4Y2YA 2MU1A 3AR7A 4C4SA 1KYTA 2R8ZA 3DDHA 3B8EA 4UAVA 4Y3UA 2YMPA 3E8MA 5A3RA 4UU0A 1ZOLA 4CNQA 2FPXA 3ET5A 3FZQA 1Z4NA 1VJRA 3SMVA 4HGPA 2WF6A 3CNHA 5ALOA 3SD7A 1QQ5A 5AESA 5AM2A 2HOQA 4KX3A 4KN8A 4UATA 2FUCA 1EK1A 3WKEA 2C8LA 3WGUA 2C8KA 2QYHA 5AVZA 5AK4A 1PW5A 3NIWA 3NANA 3IRUA 2W4MA 5ALNA 5AVTA 5AK6A 5AW3A 3HLTA 5AM1A 1NF2A 3WK6A 4HGRA 4UMFA 5AVXA 5JJBA 3ZTWA 2AUTA 4HGNA 2C4NA 2B82A 5IT0A 1WR8A 3N28A 4EENA 5ALPA 3OTQA 1L7MA 4L6CA 5ALYA 1N9KA 3SKYA 1RC8A 4L57A 4Y2TA 1AQ6A 2AMYA 2P11A 5ALIA 2OM6A 2IOHA 2RARA 1Z4OA 3BA6A 3AR4A 3WK8A 2ZBDA 3RF6A 3U13A 2ODAA 3OCXA 4YIHA 1JUDA 3ZI4A 2B0CA 3DV9A 4OCZA 2FPWA 3WKDA 3W5DA 4Y2UA 2JARA 2HX1A 2WM8A 4IG4A 2EAUA 3KOOA 4YCMA 3KD3A 5AKXA 3ZUPA 4UW9A 5AW8A 3SLRA 1YV9A 2YMLA 2ZG6A 1Z4JA 1ZD3A 3KC2A 4UM5A 4Y2VA 1YNSA 5ALDA 2D2VA 5AKJA 5AW7A 5ALVA 4EX6A 2G09A 5AKGA 5T41A 5FP0A 4FE3A 5AVRA 4BNDA 1RQLA 3DAOA 2C88A 2CN1A 5ALKA 1XP5A 5ALGA 2WF7A 2B30A 5ALWA 3ZWKA 2HHLA 1U02A 2EARA 3PGLA 3UM9A 1L6RA 2HI0A 3AR6A 3QU7A 3UMBA 1NNLA 3AR8A 1YJ5A 1FEZA 3WK7A 3QU5A 4Y2XA 2I55A 5IS2A 3U26A 1YMQA 5AI5A 3HYCA 5ALQA 5AKLA 2FPRA 2B8JA 2YJ6A 4FYPA 1RPZA 1QQ6A 3PGVA 5AI8A 4YH1A 2G06A 4OD0A 3EF0A 2ZBGA 3SF0A 2YJ3A 1RDFA 2WFAA 2C9MA 1Y8AA 2IYEA 5AKZA 3QLEA 3A1CA 1IWOA 5ALHA 4O8CA 1SWWA 4BX0A 2Q4RA 2GFHA 3GYGA 2DQSA 5AW4A 3OPXA 4F71A 2FEAA 2YBDA 2GO7A 2W43A 5AI4A 4CF3A 1YDFA 1QYIA 3ED5A 3QXGA 3SHQA 5AI0A 3QGMA 1RQNA 3FPSA 5ALMA 3TLMA 2YJ4A 2IOFA 2NO5A 5ALUA 2BDUA 3AR2A 3OCUA 2YJ5A 5A3SA 4YCNA 3R09A 1LTQA 2RB5A 2CFSA 4AS2A 4XQ0A 3FGOA 1F5SA 2G1AA 3OCVA 4HGQA 5A3QA 3A1EA 1U2TA 2RAVA 3ESRA 5ALJA 2YMQA 1Z4KA 3WK4A 2O2XA 2VKQA 2ZOSA 1J97A 4C4RA 3N8GA 4NWIA 1WPGA 1L7OA 3L0CA 4J03A 3EWIA 3KBBA 1RKQA 2P9JA 5AVSA 5AVWA 1S8OA 3NRJA 2P69A 4EELA 1RLMA 4BEWA 2OBBA 4DW8A 2PKEA 1CQZA
chains in the Genus database with same CATH superfamily
5IK2D 4IGFA 3ES9A 4LXQA 1MCZA 5TQ2A 5G4LA 4BQRA 4UOQA 6CHYA 4RMGA 5LJIA 2HN9A 3NNSA 4N9WA 4DUYB 4R7GA 3U1TA 1T8TA 3B1FA 3OZDA 3UAZA 3F8WA 1O95A 3QG5A 5I7WA 4M0KA 2CXSA 5AW1A 1U04A 4BBAA 3RSOA 3MFIA 1DDOA 4X20B 2QV0A 2VRCD 3MRXA 3STWA 2Z2JA 1RWPA 1G0NA 2YCBA 3KQWA 4LOKA 1TKDA 1Z34A 4DCGA 3RJMA 3PXCX 2W2MA 3TZHA 4QPCA 3LT4A 3TZKA 1U2PA 4QARA 4K3UA 5MN4A 1IH8A 3T9AA 2WTUA 1PLKA 1JPNA 3RJKA 1YT3A 2OP0A 4PL2A 3PXUA 3I4CA 5FRDA 3R23A 5HJ5A 3PLNA 4XLTA 2EBHX 2WP0A 1XMSA 3IVCA 3DBHA 5DQHA 1ZVJA 3HN7A 4MRVA 1EZZA 3K2EA 4RY0A 5L7TA 2NO0A 3OHAA 1XP8A 2R5FA 5KFOA 4EW1A 4WZAA 2PBRA 3PDWA 3WKCA 4I50F 4AS1A 1R9MA 3SJ7A 3DDWA 4EECA 1QLNA 2SBTA 4C01A 3V8EA 3AMVA 2MR6A 1ZQ1A 3ENWA 5EN4A 3PEEA 1TCBA 3ZI7A 3OMLA 4G85A 4UQPA 2EEPA 3NBAA 1JHMA 3PUJA 1SIUA 1SCUB 3B0XA 5C51B 3A4IA 1GZ3A 2GTIA 3O2QB 4A0GA 4Q45A 1JH9A 4Y18A 1RYBA 1Y4DE 1DRGA 1HYBA 3KZXA 2FP3A 3N2NA 1T4GA 1MG5A 4D98A 1P2GA 2NSDA 4HY3A 2O8BA 4H7IA 5JSHA 2ZJOA 4DA6A 4JLBA 4XQGA 2Q5IA 2PZAA 3TKAA 1VJRA 3W4JA 3UB3A 2YQZA 1BJRE 3U3XA 1EXDA 1U1DA 4GYWA 4MDFA 1RBQA 1UMKA 3TQ1A 4I1RA 1STOA 1T0UA 2P90A 4GAEA 3G0OA 1L3TA 4D3XA 1Q2UA 4YCDA 4MQ4A 4R7ZA 4FOSA 1EG7A 1Y8ZA 3EXFA 3ZH2A 4RWZA 4YXWA 1BSVA 5ILQA 1BPBA 1NXQA 2GTHA 1NVTA 3FDJA 1N2GA 3ACDA 1KI7A 2V6MA 3PCRB 1AXRA 3P97A 4P83A 3BXHA 4INAA 4XA5A 2VDRB 2CXQA 2ZG6A 4NNPA 1Q95A 3CCFA 2GK3A 4HN9A 1R9GA 2OXEA 2EKLA 1TZJA 5D3QA 2OAEA 3Q1LA 2Z09A 1SKMA 3A9WA 2CHEA 1U63A 3U4IA 4Q4AB 3N6VA 1I5EA 1GG2A 1Y7IA 1X3SA 3Q5GA 3TLBA 3VVLA 2RK6A 4FJ1A 3JARA 3OZEA 4OGLA 1ZIPA 2MHCA 3C2KA 1PK8A 2JIZD 3CE6A 1JEEA 1SBQA 3FR7A 2IZ7A 4WY5A 3KXKA 5EWEA 3TVYA 2XVYA 4HUQA 3TUJC 5ED4A 3D31A 1EQ2A 3ZDQA 4DYHA 3HR4A 4E21A 2Q4OA 3ADOA 2WTNA 4KSCA 3FF1A 1KC3A 2VZLA 4DHEA 3BE6A 3F7NA 1SGWA 2AZMA 2ZS7A 1SBHA 3BQ1A 4QUGA 1Z4KA 3WK4A 2XMGA 2FR8C 1UBNA 4JYZA 4PGFA 1RKQA 5E1BA 4BVFA 1YCGA 2HBMA 1QH8A 1TUEA 2ES4A 1G5RA 4PU0A 1Y6ZA 5DM0A 1L8AA 1NBMA 2QQFA 1CEYA 3P5BA 3GGGA 3DNFA 1U65A 5J0QA 2HK9A 1SKUA 1K0FA 1EAYA 4F5YA 4UB5A 3MSXA 3IAAA 3DMTC 2QX6A 5KWIA 3ZNNA 1ORDA 5G40A 1YTLA 2HLDD 4LHEA 5TRTA 4QSMA 3A1TA 1FQKA 4YBRA 3ANNA 3NTRA 3QYPA 4O2RA 3OEHD 5D1HA 1EWYA 2WE7A 1HSZA 4CFZA 5TMBA 3M6XA 2TMYA 1SC1A 4JDPA 4UVGA 3WV5A 5DBFA 2OD2A 6REQB 4L16A 2BY4A 1YB4A 4PRLA 2IXGA 4JQYA 2JLQA 3NCTA 4NNOA 4MV3A 3V4ZA 1R0KA 3V4VB 1IZZA 1E9SA 4FZ5A 4ZHQA 1P7YA 3AZOA 4JB3A 1BA3A 1YBMA 3S68A 3ESZA 3F8SA 3PXDA 3T5DA 3TR6A 2I5HA 1SV4A 2JD0A 5LIRA 1YCDA 2Z4SA 2PL1A 3R3JA 3ETCA 2JIMA 5BYAA 5FYQA 1DGJA 5KFAA 1CY8A 4X7BA 2PJUA 3WL8A 3W90A 2O5EA 3UJ9A 2B7BA 4O4JA 1BE8A 4JELA 4NY8A 3OP1A 4YRPA 2WKQA 4FE7A 5D5PA 5HK9A 3I09A 3VSAA 2RKWA 3ROZA 1GG8A 3U3JA 4UAZA 3IHLA 3SEQA 2PUBA 5E3IA 4L4YA 5H2FU 5BSFA 3M6VA 1J8MF 3EVDA 2R6ZA 5IK2A 2C78A 5CFMA 2I67A 1JEQB 4YRDA 5JYEA 4OREX 1JMVA 2ZCJA 4MICA 4R65A 3ANYB 3FSGD 4A3SA 5EZ6B 5BQ5A 1U9CA 4RENA 1SCAA 4DYDA 4M53A 5A3RA 1TCCA 1BU5A 3UH1A 3Q8KA 1DGQA 4CV1A 3SK0A 3M6WA 4BWVA 4YV7A 2GHRA 3PO4A 1F9AA 3IN5A 4XJSA 2HJRA 2PD4A 1V8PA 2VRCA 5B5EU 1M0TA 3G89A 1N5RA 2WQ7A 4AMVA 3L8YA 3OIDA 1NX6A 2VF5X 4EJ0A 5F77A 2V97A 2QAGA 3MUNA 1P6QA 2AMJA 2BEWA 1RZ3A 4IKEA 4C8LA 3RS8A 3A2KA 2AXNA 2DFKB 4WD3A 4CMEC 1D4OA 4GWLA 3JR7A 3OICA 4PQRA 1JXLA 3VR5D 4FI3C 3DO6A 4CMHA 3PFKA 4AJHA 1Y8CA 1B0ZA 3UIEA 3CX3A 2AI1A 4EHAA 2HMYB 4G23A 3N6RA 1RVV1 2K7ZA 4JT9A 4KLFA 3JZMA 2A5YB 2IE8A 3E23A 3HVUA 4EY3A 5IT5A 3CRNA 4DV5B 2JCBA 3CISA 4EKGA 4KTQA 1FRNA 1SOMA 4EB6A 4H6VA 3DAOA 3NWOA 3ZZ0A 3WB9A 5FLXA 5JCPA 3OLQA 3SEAA 3OT1A 1IHXA 1FEZA 2W5UA 3I01A 4EF6A 1FP6A 2PWPA 1RPZA 2D7DA 2J0UB 4PPQA 4J2HA 4YALA 4UM8B 1IG3A 2H11A 2P4SA 3VDNB 3QF7A 1PZXA 3E9MA 4YRZA 4LNHA 1XD2A 1NPDA 3RBVA 1POXA 2PV7A 3DV2A 2OZEA 4GXNA 3BGOS 1OMOA 1ITZA 2PSFA 1E1CA 5C81A 1VHJA 4J16A 4O3QA 5FPQA 3S2IA 2VSNA 2X2FA 5ADWA 5JI3E 3HY6A 4ND8B 4KXNA 2W8BA 2A5FA 4FINA 3N7UA 4NQZA 1E77A 2XTZA 1Q0HA 3AL0C 2E4XA 3HYSA 2WVHA 3VR0A 4KLLA 1DX9A 3HNPA 4R4JA 2ZULA 2RH4A 2E49A 4HUJA 4C7JA 1TMYA 2N47A 4JUCA 5K05A 4PO1A 3G7NA 2ACKA 1IPFA 4JP5A 3CEPB 4DB2A 3P0RA 1UWCA 4BLWA 4Q4HA 3ZD7A 2IS6A 4A0FA 4FB5A 3C48A 4I7EA 4UZEA 1LPAB 2COEA 4M60A 1KSHA 4W7HA 3Q8SB 5L3SB 1NYTA 3PS9A 5TSDA 3NALA 2WB1C 3G8BA 3HY4A 2RHWA 2EZ9A 4DL3A 3QHQA 3N7RC 1JA9A 4IDEA 3JD4A 4MH0R 1YIAA 3MXTA 3N2GA 3FFXA 4IIJB 1NW6A 5HWSA 5BQPA 5EG5A 1VJDA 5DTIA 4RVHA 1A8SA 1U7PA 2Q8NA 4LRTB 4H1TA 1GTL1 1PR4A 1HE8B 1L2TA 1USVA 3JQ8A 3OZUA 2DBZA 1CB0A 3T3IA 4ZYXA 3ZGLA 3G5MA 1U0JA 5AM5A 1ISPA 5J0YA 3FCSB 1P5JA 3BH7A 4Z0NA 4ZWNA 2NGRA 2HSEA 2O0HA 4FDAA 4B4VA 2MU2A 3E70C 3QKRB 4YJ2A 1QFMA 3DVLA 5J43A 1QYVA 2WPDD 3WKBA 4CWAA 4MW9A 4RT2A 2JIZA 4Z2YA 4KQMA 4CNBA 2ZT5A 3NORA 5B4VA 3JTEA 1EDBA 1Q16A 1V1RA 5NLLA 1VI2A 2ZYHA 1MZPA 2L5YA 3SP1A 1COOA 3AEUB 4TXJA 1WV0A 3FVVA 2QQ5A 2CF5A 2KI5A 1K92A 3PV0A 1C41A 4H31A 3SC6A 2X5OA 2DBRA 5CLQA 2Y1DA 3NAMA 3IDOA 1E1KA 5INTA 5B3AA 3V1LA 4EO7A 5L4NA 2NTJA 1ELOA 1R6BX 1CWUA 1NVUQ 3FAZA 5EPEA 1NONA 3AP3A 1FYEA 1WMAA 5BN3B 4KQWA 3DCYA 4OQFA 4LDNA 4L9SA 1XCJA 5JSZA 2GJKA 1T6YA 3K6SB 1DTEA 2NQTA 5ANRB 5KFEA 1HQYE 3CUKA 4RPLA 4L2IA 1F48A 5K0BA 5COQA 8ICSA 4NMLA 5B36A 2A7QA 4GQAA 1GGFA 1ZWKA 1NJFA 3CUUA 2VBFA 2HLDA 1E61A 1M2VA 4JROA 4RK1A 4UU0A 4X6XA 1VSUA 5DB7A 3SVZA 4U2BA 3OEHA 3RIYA 4ESVA 4Y67A 1N2OA 1IZYA 1NZBA 2NRWA 3SHFA 3IUSA 2VHUA 1BE6A 4PX2A 2IYFA 1WXDA 5TDHA 4KSYA 1WB6A 4ASUD 3NB0A 1RE0A 3BM5A 9ICUA 1GUFA 5FAXA 3CLTD 1PX0A 5JY1A 1GO2A 1ZCAA 1QX4A 3MUFA 4ZOHC 3A26A 4PCAA 2HXYA 2N3ZA 4ZCQA 2QHXA 3CRVA 4BKUA 1IQPA 3C8DA 1X1TA 2XAAA 3MS4A 3SZLA 5CFNA 4FC6A 1RHJA 3RF6A 1FLVA 3QZ8A 3GBSA 4C03A 4YEDA 3ZV6A 4GOMD 1QOPB 4I08A 3E15A 3PXAA 3UWKA 1SVOA 1P4GA 7REQA 2AQKA 4N39A 4XSHA 3QLUA 3ENQA 2H5LA 2PKRA 4O1MA 5CW2A 1ORRA 4ENSA 4DA7A 4MP6A 1U2EA 4PZYA 2OCGA 3TLZA 5ALWA 3EHEA 2R8JA 1PG2A 2I2WA 2ZYRA 5K9ZA 2AG0A 2EQ5A 4O2BB 4E0DA 1CPYA 2ONJA 1MLDA 1USKA 2KZZA 1IVYA 2OKGA 2XGPA 1NXPA 3PFHA 2WFAA 4XR4A 3KWFA 1GZVA 3H1TA 3B6IA 2PX4A 1GRNA 4KMMA 5KPJA 3H8JA 1WXFA 2OTCA 5KNIA 5KYXB 4B6RA 3V9AA 2R7AA 4C8KA 2SCUB 2PGDA 5C8VA 2JLUA 2EEZA 2B9VA 3UBTA 2IH4A 1XRNA 1CIPA 1T8SA 2XUAA 1QORA 5JNTA 2EJTA 3RLFA 3H2SA 3Q5EA 4F86A 4R1SA 3V3TA 1GPKA 2RAPA 2FRDC 5G3YA 3ZGZA 5ENVA 1DIRA 3C6BA 4OAOA 1OLSB 5J40A 4PZLA 1QH9A 1Z38A 4BMXA 3PQFA 2YOHA 2GCEA 2ZIVB 3X2EA 5JLAA 3JWIA 4F72A 3ZGNA 3BS7A 3E35A 3ZZ1A 3IH5A 4FVTA 4Z4IA 2AJDA 1IWPB 1VSQA 2GF2A 3Q12A 4U3JA 1OX5A 2REOA 4JI7B 5E8JA 1LFAA 1DQSA 3KRTA 3AUJB 4E5YA 1PJAA 4JJ6A 3BQTA 4JAVC 1BVUA 3R0QA 5FA5A 3DXZA 1DARA 4GKBA 4FDTA 1ZXIA 1BMFD 2AOWA 2XTAA 4YJ2F 3VR5A 2RBGA 2WU3A 3RO7A 3UTDA 4HP8A 2XE7A 1SC6A 5H5JA 4NJMA 1KVRA 4AECA 1XAIA 4C7BA 4I5FA 3MDCA 1E3IA 1KS2A 2IEBA 1K0UA 3SZMA 2J6IA 7ICSA 4E08A 2R8OA 3UAXA 2XF2A 3PXEA 1KNXA 2RHTA 4MV6A 4O29A 2V7VA 3SJZA 1NUSA 4RGYA 4Z6KA 3TRKA 4S04A 1XMIA 3BEOA 4GXRA 1JV2B 1SKYE 2ZUSA 2FWIA 1MB9A 3E7XA 3O8DA 4L85A 1ZFNA 4OV6B 1C14A 1A50B 2ZWPA 3E81A 3AETA 3BFXA 4BGUA 3H5AA 1MAWA 4YRIA 1ULBA 2XXAA 1GPAA 1ADFA 2G72A 4ZO4A 4I2CA 2XT6A 4TQAA 4DCSA 2V0GA 4KP7A 3LDHA 4TYWA 1TAQA 1AN9A 1NRWA 5EJEA 2SECE 2P75A 1FIUA 4IQWA 1PS8A 5AJZA 3R7AA 1HE5A 2XUGA 3OOWA 2YC4C 3T1VA 2ZBEA 3E2PA 2JH8A 2J9RA 4ZANA 2AI3A 2C61A 5BV2P 4GOLD 4FBUA 2LCFA 4KI7A 3V4LA 2OBFA 3STUA 1CNMA 3K6JA 1CIVA 5J2TF 3GEHA 2KSOB 1R6UA 3BCHA 3AUOA 1ID1A 3E3LA 1RXSA 4ZYZA 2DKNA 1T2NA 3U61B 4G37A 2O7QA 2KIVA 5LQDA 3IAS1 2QM3A 3DMPA 2JJYA 4PGMA 1M1ZA 4KJZA 3E8MA 1ZJWA 4OQDA 3RRFA 4BNVA 3PPIA 2XAUA 2ODPA 4ND2A 2A67A 1Y1KE 4MR8B 4PIMA 4DRXA 4G36A 3KTQA 1BGVA 3PHCA 2BGMA 3ZW8A 2CEKA 4PQEA 2OCYC 4NYMR 3EIFA 2IEDA 4E14A 3P9KA 1YUBA 1XDUA 1VKJA 4XASA 3V8QA 3I73A 4RU9A 1KYZA 3ABOB 4QEZA 3GT7A 4CF6A 1NYLA 1OXTA 4L6IA 3RS7A 2IE0A 4G8CA 7ICNA 4CKEA 3G6VA 2JEYA 3CJRA 2FUNB 1QH1A 3OQNA 2JRCA 2WPDA 1DKOA 3HH8A 1F2TA 2IYQA 1QOQB 1A9XB 3FOEC 3GGCA 1Z6XA 3JYOA 3WQBA 1K86A 4ESOA 2WYVA 1EXVA 2QG4A 1KH1A 4IXWA 3EQ2A 3NHJA 4N7MA 1RWWA 4EQ6B 1QH0A 4P34A 4ZOQI 2GLTA 2F48A 5TV2A 5IAEA 2F77X 3S8YA 1TPZA 5DYNA 5CXQA 1UP7A 5DSXA 3I2JA 4IR1A 2JLSA 1LPBB 2OGTA 1O0SA 1W2GA 2PI5A 1ULUA 3AJ8A 3M6IA 4MGIR 3H6HA 4TURA 1B76A 1YQUA 5CGQB 5EKSA 5EVJA 1Y6RA 1WCWA 3ELUA 1H3FA 4PLCA 1W5BA 4Z53A 1SOAA 1CRQA 3D2BA 3MJDA 1QQAA 2HKIA 3SYKA 2BD0A 4HZIA 1OC4A 1ZVMA 4AY4A 3AR2A 1WW3A 2PRJA 3ZGVA 4QX6A 1DKRA 1QIEA 1MN6A 2WZCA 1J20A 2AHRA 3NGMA 2IYYA 1M1XB 3COYA 3FB1A 2VKQA 1IJBA 3Q3GE 2ZTCA 1KR2A 4OJNA 4LHSA 3W4KA 5I5EA 2V4QA 3CB2A 3FPKA 3IEPA 4PR0A 4DFMA 4P3PA 1P2SA 1J99A 1JTVA 1VI6A 4MS1B 5TJ9A 1G8YA 5DCYA 1YZUA 1EHIA 1P9WA 4MEXA 1EG2A 1BHJA 9ICMA 3RV4A 1RXVA 1H2EA 3RH0A 2RGDA 1WXEA 2VK8A 1T29A 1KOGA 3SQWA 4ASUA 4KW7A 4ZA2A 3FAKA 3KSDO 3TDKA 3HR7A 3IO5A 5FI1B 1DRKA 1B0XA 3KZKA 1F6BA 4OHCA 1XB2A 4QATA 2HHHB 4U00A 1FDWA 3AIKA 1Z29A 2G9NA 1UM8A 4NLGA 4GX2A 1E1DA 1OLXA 1XNGA 1A9SA 4TXNA 1MC4A 3KQPA 5C5IA 2BZ0A 3QX7A 1ISJA 4YT2A 3BWXA 4HDCA 3NAZA 1VIVA 1I4TD 5JCZA 4OAQA 4ECUA 1GDDA 1LBHA 2WE8A 2R4UA 2G80A 4GQBA 4AI6A 1CSEE 2ADOA 2CE2X 4BN4A 4GDFA 1NJ1A 3FM9A 1GAEO 1RBMA 3S2YA 3MLBA 1PBTA 3AQEA 3R3HA 3BWEA 2FUEA 4K2HA 4EITA 3GROA 2FMQA 1ZJNA 3EQ7A 5IWCA 1VLBA 4NCNA 5IVKA 1NQTA 3BK1A 3GEIA 3TCNA 1MAAA 2W42A 2P41A 3ZWNA 2AD1A 3A11A 4I9FA 3UV6A 4EEXA 3B1XA 3KKEA 3H42B 1XJ0A 3BPSA 3CINA 4COKA 2O3SA 2H0QA 2D2FA 3NBXX 1V5FA 3B60A 4YX9A 1M0SA 5J4YA 2ZYSA 2BFCB 4FMCF 1GTJ1 3GLGB 1D2MA 1UCVA 5DQGA 4XYLA 4AUKA 3LGAA 3AKYA 4G1MB 1GQFA 1B6RA 3TSWA 1SUBA 2GZ1A 3UXMA 4AU1A 3DE0X 1T9KA 2WUVA 4I1IA 4Y0NA 1SVSA 4DS5A 4LEIA 2IU3A 2DECA 4UHBA 3ZK8A 4JJKA 1D4AA 1UDRA 2VXBA 4EW6A 5JZOA 3RRBA 4P58A 1WCIA 4K9MA 1BMFA 5KX5B 4LE0A 1KYYA 3EZ2A 4Q43A 2LM4A 4BNYA 4IQTA 1CUWA 2AMVA 3AYXB 2ZR9A 1MA3A 1NN1A 5FBHA 3GD5A 2PRIA 4ZO8A 3CBQA 3LA6A 5FUWA 4LOJA 2ISOA 1QWOA 4KVFA 1SVNA 4IILA 1KMNA 4KQIA 3NHAA 3U4QB 3EGDA 3VPSA 5ELMA 3U13A 5TS2A 5IXJA 5KJFA 2EFHB 2IY9A 3K0FB 2B94A 1I30A 2BTQB 3EE6A 2HIMA 2W0SA 4EARA 4QW9A 4OJOA 4KWTA 3GRUA 3NT4A 1C7RA 2CC2A 2DLNA 5T64A 1I2ZA 4MV8A 2X42A 4LZZA 5J47A 4C14A 3EYZA 1U98A 4OB7A 4KBYA 4YMMA 5EY5B 1MV8A 2W6ZA 4ITVA 3Q9NA 1YE3A 2GM5A 1ST2A 1QP8A 1G8KA 1K7CA 1YMQA 3CEHA 1AC5A 1AQIA 4P2HA 1MQ2A 3SZ3A 5G0TA 1U3DA 2FN8A 3BWCA 4MIYA 2MR5A 1DJPA 4N5MA 1HIWA 1ZRSA 2QL5A 3ACCA 1J4AA 1DFIA 1JDVA 2PRSA 2R84A 4FDMA 1OXJA 1ZQUA 5DGCA 4Y2HA 3AEQB 4Z6EA 4EY7A 3C5WP 1QYIA 5F51A 1CR4A 5DWDA 3FPSA 5C32A 1VKZA 1J23A 2YCLA 4YR3A 3C3JA 3VOSA 1K2VN 2IGBA 4B48A 1VJ0A 5JXWA 3VAZA 3T0IA 4CM6A 3ZE6A 3A6EA 3WRXA 3DCIA 4JJAA 3WYNA 1NK6A 5I7EA 2D8CA 5FLYA 3PGXA 5JRTA 1DDGA 5DNVA 5IAGA 2CMFA 3LT5A 4IDAA 4OO1J 3NYQA 4JX9A 2P27A 4MR7B 2JZCA 3CZPA 1XO1A 4C0SA 5JPCA 3ZDDA 3GRYA 3MGKA 3QMWA 1G4AE 3HCEA 3EPLA 3DWEX 5LL6P 4Q3DA 1ORTA 2XITA 1CRPA 1GPH1 3T0FA 4O59O 5KDLA 1OZAA 4HAWA 1X8JA 3LC2O 4EO4A 1RYMA 1VL6A 2QN7A 4C5AA 4BO1A 4YCCA 4CG3A 4YMSA 3K0CC 2LR0A 5C7IO 1KDYA 4MR9B 1M6HA 1IY1A 3BBLA 4BVKA 3HFSA 5GINE 3CH4B 1OH6A 2UV8A 2WAQF 3EGEA 3QUCA 3DS8A 1XWIA 5TX7A 3FDZA 1BVRA 2PX3A 8ATCA 2Q29A 4RD3A 3L43A 4Z3DA 1Y7PA 4LRQA 4X1IB 1WG8A 1RQ2A 4BQFA 4IRCA 3LQ2A 3GIIA 3DM9B 1ZU4A 1GQOA 4MZDA 1QSYA 3DZDA 4WEQA 5BSMA 4K1LA 4KI0A 4Y8VA 2DM6A 1UZAA 3AU8A 3FNIA 3LY9A 3INTA 8ICLA 3FJYA 2H4FA 1FDUA 3LPLA 3KWMA 2ZUDA 3X1KA 4LF5B 4D9JA 5JXGA 4M37A 4BAZA 1R5NA 2JATA 4MTLA 1KEEA 2IWRA 3ABRB 3TRFA 2V3VA 4RQ2A 4D4HA 5ARDA 1L5FA 3Q5DA 1ONPA 4UPVA 3EF3A 3A1NA 4CIBA 3GF4A 1J22A 1SZHA 1XCLA 2EJBA 2WYHA 2XLCA 1D6JA 3C43A 3FDFA 4PPFA 4IHJB 3F9IA 1JAIA 1L0BA 1XTPA 2KICA 1UBMS 1SUIA 4P3NA 5FX2A 3A0HU 1N7JA 3WMXA 1S77D 3B9RA 2W2TA 4JIGA 2FH5B 4ED6A 3RC7A 3CXUA 4IDNA 5MFZA 5HHTA 3A06A 1HH4A 4HEA1 4O4HB 3M3PA 1FX0B 1FFHA 3OCCA 1CQIB 4NFYA 1TV9A 2V4RA 1ECLA 3A4NA 5KQLA 3EZFA 3X1WA 2GA9A 1VL8A 2DULA 3URKA 1K5OA 4UM9D 3ZCVA 4CEHA 3R0XA 2EGHA 4N0PA 1QP0A 1L3CA 4MB6A 3C8HA 2I8AA 4A15A 4DJTA 1HQKA 3AIIA 1RWVA 4WBXC 2W8ZA 1GOTA 4XIFA 1PWHA 4C21A 1K4KA 1TC2A 4C05A 4N65A 4BNHA 3L02A 4L9WA 1ADBA 1E6MA 1WS6A 3M9XA 3ZNOA 2UVPB 3IOBA 2O2ZA 2ZYTX 1NLFA 5DI9A 2W48A 4MWBA 5B3KA 3SS8A 3P0IA 2Y93A 3M6MD 2R85A 1YI8A 2FPWA 4WKNA 4GL4A 4Z6DA 5IC6A 2F9MA 3OZ7A 2GD2A 2PZMA 2BFWA 3GVXA 2YIJA 3TARA 1FVFA 1DJNA 2ZRLA 1QTQA 3KX2A 1E5XA 4BNDA 3Q6NA 1D8BA 2VJ5A 5H9WA 3RIXA 4FNOA 2P30A 5JECA 2FLLA 1U80A 4UCXA 3ZD9A 4QKQA 1YFLA 1NJGA 3VOTA 3LM8A 5A03A 3CIOA 4UBIA 2GJ9A 1XKTA 4E30A 5E7MA 3ZQJA 4HAUA 2O23A 3U7RA 4RCVA 2ASEA 4PEVA 3HJBA 1Q0PA 3PKZA 3A04A 2QUJA 3EGXA 4QSHA 1LCIA 4U9IS 3RG2A 4GICA 5H02A 2OUKA 1FXSA 3DDNA 2BBOA 2P6PA 2Z4RA 4B73A 4YDSA 4FWIB 3REOA 5AXAA 2PKWA 3R0ZA 1NKSA 3OY7A 1JMKC 5F5LA 4RF5A 3HB1A 1PYOA 1O6GA 4M7RA 3MUEA 2O3UA 2Y27A 3NV7A 3G3EA 4H60A 3K71B 1P3DA 3GUHA 1LH0A 1W88B 5SYNA 1PZGA 1DAFA 2EP5A 2GUGA 2E89A 1W46A 3C7DB 5AJTA 3ZZTA 5HMMA 3PYMA 5DTJA 1OUMA 4DTIA 2BHNA 5DOZA 4EHFA 1QHYA 2JGRA 4Y7CA 5ESDA 5K8VA 5A6SA 1Q1ZA 4HB4A 4ECRA 1S2OA 1NSFA 1C9MA 2ZIWA 4JITA 1VIAA 2JLWA 2WFMA 3DYIA 1ECGA 4B6SA 4TZ0A 4WZBE 1LPNA 1GDTA 3BMCA 3ISDA 1SKWA 4Q47A 2WV9A 4OU5A 3AIOA 4GW3A 3PR2B 2R8BA 3GRAA 4OO3A 2ZU6A 1QGUA 1G8PA 1CUUA 4B82A 2VTBB 2XDYA 4PBTA 4AZ3B 2ZQ5A 2W58A 4IICA 1O7JA 2ODEA 4WXMA 5CIYA 2P6NA 2NSJA 2V45A 2EW2A 1WKCA 4WA7A 1BWRA 4H3KB 3TTTA 3KSZO 3EH1A 3JD0A 1K3TA 3ZDXB 3C1ZA 3ND9A 5JMTA 1L9XA 2RGNC 3IJ5A 2IYXA 3KLPX 5KQPA 4XTRA 4UAGA 1SKRA 1GU0A 3MWLA 5G4KB 3GRPA 2QV7A 5CCDA 2GILA 2G3YA 3A7EA 4JYBA 4R6XA 1AHHA 3QE3A 1R8QA 4PRKA 5J2EA 3AR3A 4YRBA 2VP4A 3ZLTA 3OA2A 5ADVA 1ECPA 2YIMA 3PNVA 1G5PA 4XQCA 3RUCA 5F5NA 1WE2A 3DZGA 3H11A 2ZRQA 1I4EB 5A2QA 3WWPA 3W5JA 2O7RA 5K2MA 5JNRA 1KKUA 5EMKA 3I2YX 5REQB 2HCBA 3LYLA 3U19A 4HGYA 1O6ZA 3V4SA 1ZPDA 2ZJ2A 2ZRMA 4IL5A 4UEQA 1RKVA 5DULA 5JD3A 3M4YA 3GFPA 1OJLA 2QLFA 3Q0IA 5JNLA 1Z00A 2IYAA 2XE6A 1F7UA 2UYGA 2I6GA 2JF0A 1TQ8A 5KNDH 4IUYA 4ERNA 1DJMA 4I2GA 2QG9A 2CL6X 3ZCQA 1LW7A 3F6SA 1QVWA 5BNWA 2BGKA 1WHTB 1UCFA 2LYAA 4NJEB 3OO1A 2FUCA 4QDZA 3GCZA 2Y1OA 3O4GA 2X2OA 2XZPA 5ALNA 1CJTC 3WL5A 2J5QA 1AN0A 4AO7A 3NXSA 3U7QA 4QUEA 4UMFA 2JK1A 1IE3A 1TYZA 2ZI7A 3VYSB 2RRDA 3M89A 3VC8A 9ICEA 3ZI0A 5EJ7A 3OUZA 5K3FA 5BMVF 3V2GA 1CY1A 3C70A 3G23A 3JQEA 5EUCA 1W0CA 5KSZA 1ADJA 3FRHA 1QHHA 1M7BA 3RNOA 3Q0TA 1GAWA 4EYHB 3EXEB 4R0VA 1EFKA 4YCMA 3FTPA 5D7NA 1Z5PA 2QDXA 3O75A 1QGAA 4QZCA 3NEYA 2FLPA 3HU3A 4FYJA 1ZK2A 1ZJ6A 4KKXB 3IUPA 5LFAA 4K4GA 2Y1FA 5MHTA 2EL7A 4LHYA 2XVTA 5BMOA 1ZKMA 5JARA 4DSTA 2AG1A 3PQEA 2G8NA 2OH2A 5HW0A 3E8XA 2YZ2A 2Z3VA 2TSYB 4NHOA 2V4ZA 3VHXA 4RAOA 4IDQA 5EXSA 1UDXA 4D0LB 3PJGA 2Z9CA 1AUXA 3ROEA 5IJ0B 3KSBC 4DIEA 4Y1FA 2QQGA 2QTVA 5EHNA 4IIBA 1PW7A 5FUBA 4V0LA 3R4VA 3ANSA 4KO1S 3FNBA 1YS1X 5JOQA 4QM7A 1ZH8A 3JALA 2ZJ6A 5BWCA 4E3WA 4KFRA 2IF0A 3TSOA 4TQRA 2TMGA 1O94D 1VXRA 1NC1A 4FFBB 4IY1A 2JVIA 3MGVA 1FMCA 1S0VA 4XUGB 3E8SA 2W71A 4UVEA 2WHPA 1YKGA 1MDFA 1CUCA 4XXHA 4RUAA 5BQOA 5BQFA 4URVR 4KPYA 4JMPA 2ORVA 3W1VA 1HQCA 1FDRA 1L4EA 3RRNA 3VR4D 1HZJA 3LTNC 2VI5A 1G3MA 4Q3LA 2FJ0A 4OB6A 4HGZA 1RRKA 1N92A 1VBKA 2J09A 1XZGA 3L40A 1KQNA 1DU4A 1TGYA 2ZCVA 4MJLA 3HUUA 4JYMA 2FUG6 4J9NA 3GDFA 4WJ3B 3UK6A 4J9OA 3RAXA 2QYTA 3PNMA 3PVZA 2R7LA 2PU5A 3LU1A 3CLUD 1ZNZA 4KFSA 3TLYA 2F1HA 4XYGA 4YJ3B 5KU1A 3IS3A 4HS9A 2W9CB 2IIQA 1B23P 1A98A 4DQ0A 3N7AA 4KQFA 3NO4A 2GO1A 5CA1A 1JHZA 3CVYA 2H1RA 4C7ZA 3CT4A 2NU6A 4E6EA 1RI4A 4MRMB 2A9VA 3BD7A 1BKDR 4Q02A 1XQ1A 2J3QA 5D5HA 4F9GA 3EMKA 3JQFC 1VJCA 4PW0A 1J2UA 4U2GA 3COWA 4JR2A 2ZXIA 3UJBA 1VDVA 3RTBA 2AE1A 3DH0A 1P77A 5EOZA 4M22A 3NX4A 2B2NA 1I13A 1X14A 3EG9B 3R0VA 2QZJA 2J9YB 3H9JA 2QXYA 5F7JA 4BFCA 1PU2A 2WP8J 5IIMA 5C1DA 1G2OA 1KJIA 4QWEA 1BXGB 3L8DA 4LNAA 1PUIA 4J1TC 4ECVA 4M6WA 4UNIA 4A4DA 2DBQA 1Y1TA 5KHOC 2QLJA 1V8BA 9ICKA 1JE1A 2FR0A 1YZFA 3VBEA 4DWIA 3AKCA 4BCDA 4DLLA 2BMVA 2J45A 1M76A 2RGXA 1ZZEA 1ODFA 1BC5A 4W1RA 2BGLA 1YULA 3W5AA 4L4XA 2EU8A 4KR0A 4DR2B 1AU9A 9ICBA 1WSBA 3H1EA 3F3KA 1YB1A 4Q34A 3MRVA 3FNQA 4ZT6A 3KB8A 3EYWA 1ZNYA 1YWGO 4F3RA 3J81A 4KRYA 1MABA 3SHWA 3GVIA 4D8TA 1LPPA 3C2QA 5D8DA 1AB6A 4FX5A 1M2KA 2ATIA 2DH6A 2FKNA 1I4DD 1G5TA 4ZGWA 4LV6A 2H2AA 1L5YA 2GPNA 1XD8A 3DZHA 4QIWC 4DFKA 4DQVA 4LJ6A 2F8SA 4AURA 3MJHA 1CE8B 4RPGA 2O8EB 3S1AB 3IAHA 1VL0A 2HXGA 1OFIA 1KTQA 3IKTA 3HT3A 4URWR 4AYBF 4NZNA 4X1OA 2WILA 1YNSA 5ITSA 3NVMB 3NDRA 2R44A 4ENPA 1LSSA 3G85A 1Z62A 2V65A 3FHOA 1BPXA 3AR6A 2Q50A 2XC9A 4FDLA 3EVTA 1NLMA 3D2CA 3PGMA 2H92A 4FBGA 2WZQA 2C9MA 2RI6A 1Y63A 2NZXA 4XGNA 3WG9A 2WTEA 4AQDA 2F55A 2JIDA 3PQ8A 1CBUA 3Q2IA 5IG2A 5B58C 1JECA 2BEUB 3H5IA 3TXYA 5BOLA 4PX3A 3EDYA 3UA4A 2Q28A 4JK3A 3HLYA 2J3HA 1NVMB 1FU8A 4Q7QA 2EZ4A 3B6EA 1JALA 5DV9A 4WN9B 2J8ZA 3IX7A 5CNMA 1SHLA 4QWMA 6AT1A 1X7YB 3LT0A 4M0FA 3BCUA 2ONYA 4RVGA 5JSQA 3OU6A 2ZETA 3S2FA 5BOMA 3H4BA 1O9HA 2DY1A 5FF9A 1N25A 1DL5A 4IV8A 5EZYB 3PFNA 4QZ8A 4O2AA 1XZBA 4U8HA 2GEUA 4TLEA 5ECWA 3BE8A 3E3AA 5D4BA 1ISMA 3RQSA 2XBLA 3TTXA 1RFGE 1VMKA 4EUSA 1QB8A 3M5WA 4FMPA 5SYMA 1XYGA 2RK3A 1G55A 1M5TA 1CR6A 4X3CA 2VZ8A 1XZMA 1YF3A 4MRRA 4HNTA 2A4MA 4MI3A 1JLHA 4EYIB 1JR3E 2XDQA 1DCMA 4X84A 4FZVA 13PKA 4ZYVA 4W9MC 1TJ4A 1JJAA 2ZAMA 3GDOA 4MW4A 1XZFA 2NO4A 3AL0B 4GU5A 1W93A 4OHVA 2W9XA 4RQTA 1OLUB 5BSEA 5LZ8A 3QFCA 4Y2QA 4ZDIA 2P6OA 1A9YA 3DVAA 2WA1A 2V0CA 4QG7A 1WPXA 5A9TA 3STYA 3R41A 5KJCA 2P9BA 2C96A 3I1FA 4RK6A 5J4HA 2QL9A 3T99A 4CKBA 3P5SA 2DC1A 1JWAB 4TSRA 4DSFA 2I4NA 2P9HA 3KL2A 5FPPA 5DMXA 1WSWA 2GVNA 2NW6A 1HYHA 4DABA 2XYQA 4M9XA 2IELA 4GT1A 1JTFA 2A1IA 2WIJA 3QHPA 3OEWA 2VA2A 2EXXA 1GCUA 1KFSA 3OIWA 4DDHA 1JQDA 3OOSA 2EWVA 4MQMA 1B0UA 1D7OA 4X85A 2WHQA 4BWMA 1O94A 1UT5A 3ROTA 1J7KA 2Q7XA 2QP3A 3KR2A 4J0EA 2JAUA 4MGKR 4A1FA 4YT5A 4X64B 1ZR4A 3WNBA 5K45A 1OW5A 2D8AA 1Z1BA 4YAWA 3PF8A 4B1FA 4P0TA 3DFZA 2Z3WA 3OX2A 2QRVA 5LCXA 2DQ4A 1GPYA 2B5VA 2Y2VA 5GJWC 1R12A 3T4XA 4V0SA 3L8ZA 4F4ZA 2PD6A 3VR4A 4D0GA 4A5OA 2WU0A 1S96A 5CU7A 4ZAWA 3D3KA 3PFCA 4IMRA 3PUKA 4RX1A 3WSTA 3IODA 1SCIA 2C9YA 4GC5A 1BS2A 2ZRPA 3FA2A 2VUHB 4DS3A 4OL9A 3K30A 2QI9C 2BPOA 1X1RA 2PRKA 3GY0A 3JATA 1KEPA 1ONSA 2ZTLA 3UOAB 1AA9A 2QJRA 4YA6A 2BMAA 4M9LA 3RRJA 4M1QA 4YO8A 5LR6A 3SSAA 3IBYA 5K8UA 4J0FA 3LC7O 3R6LA 5ICCA 3U31A 5D85A 4NFHA 5EPUA 1KDRA 1PNVA 4QE3A 2GH1A 3WKDA 4URFA 4NLNA 4LYYA 2I03A 3BJMA 4D02A 3JPQA 3HYLA 8ICTA 3PJEA 2CHGA 3M6AA 1L4LA 1G21A 2O2HA 3L01A 4NV3A 5JRZA 4N9QA 2PFSA 4C3VA 3RUFA 1NP7A 1X2EA 3S2EA 4CM4A 5KFJA 4ED3A 3N86A 4ZHQF 2HLNA 4I2AA 4JUBA 5FFFA 3QU7A 4P84A 1UA1A 3WDLA 4DLPA 4YMVA 1XHFA 2YJ6A 4MA0A 1GPBA 2BFDA 9ICRA 3ZU3A 1KXJA 3DBRB 1OY1A 3IMEA 4JX8A 1UKBA 5DTEA 4F7WA 4DSIA 3Q9LA 4QPPA 2ODTX 3BIOA 5HTKA 4BUCA 2ZI9A 2VQEB 2X8JB 2GO7A 4XLLA 3NCHA 2J41A 1QRAA 4HX5A 3AN1A 4O4JF 3UEOA 4G5SA 2FEKA 3ZDEA 1SRQA 2ZVQX 2JH9A 3MTBA 2GBCA 4HDMA 4F4UA 4RKWA 1TTHA 4BZWA 3RAGA 5CFLA 3JYQA 1WWUA 5JU6A 1RLMA 2HIHA 1N5WA 4ARAA 1ZM9A 5BUSA 2C92A 1M6YA 1ZQJA 1YS9A 4JV5B 2JBAA 1WEHA 7GPBA 1EFPA 1DKLA 3LGSA 5BWOA 4XW2A 1RWBA 2ASDA 4LZNA 5KBYA 2WAOA 3RM3A 5LXTA 1O0BA 3RFTA 2H2WA 2PWZA 4DJFC 4AF7A 3L92A 4Y2SA 3PSTA 1LDYA 1E6EA 1KFEB 2CVQA 4IEEA 4CCWA 1IEQA 2IYWA 3MNFA 2IKSA 3OTOB 4KZPA 4OP3A 1U7OA 2ZFUA 1KEZA 2PPVA 4RL6A 5IF9A 3KPUA 2GZSA 4B83A 4CEJB 1J2JA 4WUTA 2IU6A 4UBOA 4E5PA 4W6ZA 4US8A 2BFBB 3U3DA 821PA 4OHWA 5AHXA 3E9CA 2Z5LA 4G63A 3IL2A 4R8UB 4YVZA 3GFSA 5LOVA 3KEOA 1NF3A 1QWSA 5DIFA 1CNFA 4CV3A 3T9CA 1KU6A 4AZTA 2I91A 1KERA 1CUBA 2PS1A 5H1YA 2UZ0A 2FZLA 4B2YA 2W8KA 2FP4B 3SY8A 1Z19A 4WLUA 5AJWA 2GXQA 2WSBA 3DQPA 3C3WA 3SYZA 3K1ZA 3MCVA 3ZX5A 4URYR 2A1TR 1CG6A 2W83A 3FX2A 4CR7A 5B3LA 1LJUA 3KUXA 1KI1A 3ZKWA 4QECA 3F6EX 1PV2A 3KJZA 4B9UA 1RQGA 3AM9A 2LIPA 3ZX4A 4EFNA 4YUVA 2GM3A 4YXMA 3VU1A 1EB9A 4PHPA 4J91A 1A7KA 2XGSA 3Q3EA 1VJ5A 5U4XA 2YW2A 2QYOA 3PEVA 2HA2A 3BZUA 5JWHA 2NRVA 4IDGA 3V7WA 2VUSA 4RIGA 3TACB 3SE0A 4F11A 1YTUA 3MA0A 3RKSA 4POAA 2VK2A 5DKWA 1X9SA 5I9SA 2Y4OA 5GTHU 4MJ3A 3K0AB 2D3TA 4X66B 5F9LA 3BSYA 1WZIA 3CLVA 3DKIA 3QEAZ 5AOCA 3NDBB 3IERA 1LC3A 4BQPA 4E13A 5LNK6 1G20B 3ZYZA 1IBKB 1SBIA 3COJA 2KFZA 1TUGA 3SDBA 3O8CA 1I4OA 2QX8A 2H4JA 4MS4B 2GBPA 1QANA 4CMKA 4LSWA 3B2NA 3QJ5A 3DC2A 4DFJA 1P1IA 1NW8A 3KQSA 4NV1A 4EKYA 1OCEA 2A9KA 2AZTA 1TECE 4WCFA 3FSGA 1J0AA 4XGIA 1DDIA 1Z3EB 4RM2A 2FOXA 1NKVA 4TQSA 4PZ0A 2AMYA 1WAMA 3T7TA 2V3CC 3QEOA 4BP8A 5IKMA 3K2QA 2XQVA 2N1BA 4BGDA 1XVTA 1IUNA 2BCJQ 3BBPA 2O14A 3FKQA 1HDGO 2LDBA 5FWYB 2W03A 1O3YA 2GD0A 1QJCA 2FG5A 4NBSA 1SL0A 2BE7A 2WG2A 3B20A 2UZ4A 1MTZA 5K6RA 3OTGA 4M9CA 2ZLBA 3HBFA 1AO3A 4FYMA 3AYZB 1H2HA 2WKSA 3UT6A 3KKZA 1SU7A 3PQCA 3UMBA 3RUDA 4BZQA 4DIUA 4XX0A 4AJJA 1KMIY 3TLGA 4WZ6A 4YRNA 2H2FA 3ROGA 1S2GA 1ND5A 5H68A 1XX6A 1IZ0A 1H6CA 1A76A 3GPDG 4MQ6A 4QU0A 4AG5A 3G7SA 1UMBB 4RD4A 2PMWB 4TMWA 1HV8A 2VUTA 4CF3A 4P82A 5BW4A 3NFRA 5AI0A 4GBED 4L51A 3M1IA 3MBOA 4LVNA 2BFEA 1DFHA 3WDKA 1JI7A 5I8ZA 4C7MA 5FXMA 4YPVA 4TMKA 3MR3A 1F8GA 5LXTF 5KYWA 3K20A 4BMSA 3OPMA 1J0CA 1GN8A 4RDXA 2H3IA 5KTSA 3MCWA 1E4YA 5KC8A 4E07A 1RXEA 3OLZA 1CRLA 3ZTYA 3RRHA 2PUFA 2DLDA 4YJHA 4RPIA 3GLIA 1U5AA 4YMUA 4FQ5A 4L07A 3PFFA 5J2CA 3C15C 1DOQA 4MFFA 3T0GA 2EDAA 2DQZA 3RV3A 4BMVA 2O8FA 3SU8A 5LOVF 3D7MA 2PJRA 2QLBA 2B4YA 2KBFA 3HEMA 4P54A 4PCVA 1UKZA 3LCJA 2VTDA 1VB3A 1H9AA 4RS3A 4GR9A 3WGZA 2NSYA 2AD5A 1QG0A 2G0AA 4BJ6A 2PUGA 5DGTA 3EGWA 4KRGA 1QDLB 2FDRA 2YWBA 3WMRA 4AMYA 4HLUA 5HHIA 1G8JA 3C4VA 2RKBA 4TMYA 5IYZB 3ERCA 4MHOA 1NHGA 1SO8A 2I76A 1JH8A 2EWMA 3UGKA 4EUHA 3GV0A 4WKBA 4R8VA 5KYTA 1EUYA 4HL6A 1HNWB 5CM8B 3GLRA 2HSJA 1EFTA 4PIPA 1QAQA 2L18A 2EKBA 3F5FA 2KK0A 1FRFS 4HNSA 1HFKA 1ZOOA 3GD7A 4OYRA 1QONA 2ZTSA 4Q01A 2Q5JA 1AKRA 3QY0A 4BPRA 3DHNA 2VHYA 1J2YA 1M6VB 2W70A 2OYCA 2ZYUX 1SBYA 4PTYA 4DQQA 1O4WA 1JQJC 3R3XA 3OCJA 3PQ5A 4NG4A 4HGOA 5JD5A 3JPYA 3EMBA 3TKYA 3H9BA 2XF8A 2WWGA 4N0DA 5JS8A 1V96A 3L1JA 5E7QA 1GZHB 1LLDA 4GI1A 3ROKA 3H1FA 1DVRA 2BP7B 2IKQA 3TLAA 3NTXA 1NK7A 3ZXUB 1J8VA 9ICOA 3DEYX 3C97A 3A9UA 4MUAA 3ZWCA 4C88A 3ZHTA 2G4VA 3QF4B 3FTCA 3LO8A 1T3ZA 1X1DA 1F06A 3THXA 2D74A 4FFSA 1AF7A 4KX3A 3CVJA 1M6EX 4DKXA 2VCYA 3FMGA 1QFZA 4HB2A 1BGWA 4J4TA 5EP3A 5JT1A 1WM1A 4ANFA 3GFKB 1ZG3A 5EFZA 2AUTA 4E03A 4MPTA 5EVCA 3ZR4B 2I4MA 4B4KA 1TMGE 5G0SA 3ZY6A 4IIXA 1TZCA 3OSPA 3SYNA 4O3SA 3N76A 2NADA 4JWKA 5L1MA 3NAGA 3IE0A 1VB5A 4COOA 4Z8XA 1A8PA 3TZEA 3DCJA 1GA1A 3MWJA 4CU5A 2R3SA 3A2LA 2JCSA 3E9NA 2OO3A 2RC5A 5CCXA 1M9NA 4TUYB 3O26A 3JQCA 2IUTA 1E3MA 4JV0A 1MC5A 2GEFA 1M7HA 1Q6YA 2QRLA 1HDCA 2IBMA 3OQMA 4BO9A 4YR2A 4F3OA 1AS3A 3RT7A 1P74A 4R1LA 3W5IA 1X6VA 4URHA 5BR8B 1PKEA 4HUTA 4X7MA 4L8YA 2IZ1A 5DXJA 2EC5A 3A1CA 4BTEA 3NBUA 4OLHA 3R6GA 4CT4B 2EQYA 4L27A 2D2EA 1S8AA 3AESB 2J9FB 4YAOA 2H2GA 2XYRA 2GKOA 4UXJA 4P0QB 4WKGA 3ICPA 4AP5A 4HFMA 2J5XA 1W4CA 4I0WB 2QMHA 3D2SA 2BUBA 1H69A 4MUEA 1LJLA 4B7AA 5A4MS 3UJAA 1OGIA 5TPWA 1E6LA 1W9MA 3UQZA 5J2HA 4UNPA 3ZHSA 3FPCA 3R9XB 1RS0A 4L6AA 4LVCA 3NI2A 2VUIB 3MWDB 5CLFA 1UJ2A 2WKPA 1N57A 2HWXA 3RANA 4BP9A 5CYGA 1Z5GA 3HZZA 4DMGA 2HOIA 3LWZA 4BE4A 1HRDA 5JBIA 3JAWA 1A9QA 2OPBA 4PGAA 4M1ZA 2QY6A 4UQOA 3WGJA 1BHO1 1BG6A 4LDPA 2L0XA 2JR5A 1NWCA 4W5HA 4YUWA 4JUFA 2OY0A 4EPRA 1ODIA 4RUKA 2W2KA 1IOWA 1RMQA 3PNSA 2Y1GA 4RVNA 1KI6A 2EATA 2OO5C 5AM0A 2QN9A 2GCIA 1WCXA 1TIBA 4WIAA 1DI0A 2ZM6B 2EBFX 3IP7A 3KV1A 4DCCA 5KFFA 1XVVA 4TXLA 4R63A 3GHHA 4M1OA 1VE9A 1E2LA 1HE2A 5JMWA 3SG0A 1Q7RA 5F3XB 1F8YA 3UV3A 1N2HA 4FZNA 1VFPA 3G49A 4WKPA 3WRVA 2QLMA 3BCRA 3LCCA 4IFIA 1PGPA 1JPVA 4KREA 1VLQA 3W77A 5BNZA 1EE2A 5AOBA 4O0LA 3BL8A 3RIMA 1ARZA 2VP6A 3AU6A 1N8NA 2C7RA 2HC9A 2QARA 4DEXA 4F6RB 3GA5A 1CFJA 1U45A 2YUTA 3ZNQA 3BTSA 5E6SB 1JWLA 3OBBA 2HSZA 3FCUB 1WP4A 1GLVA 3JD3A 1Q3HA 3KZNA 2GMWA 3S5JA 3RYHA 2HK6A 1YASA 5H81A 3UNXA 1AUVA 4RK0A 3HRHA 3KU4A 3T8YA 4DG8A 1BOOA 5J5AA 1Z6PA 4FHEA 2PAAA 1GFIA 1WBJB 1VHWA 5ER6A 4A91A 3EXHC 4R9VA 4EPVA 4NFSA 2QMOA 3ZTTA 1OU0A 1KK0A 3U1VA 5LZ9A 1OX4A 1YRWA 1E4EB 3RUAA 1GT6A 4G9BA 2XT0A 4KWIA 2QUIA 4EEZA 1N0HA 1W5AA 1JAHA 3ICWA 4ZU6X 4CKWB 2A57A 2PSEA 5HQJA 3IC5A 2NSLA 1KS9A 1LNQA 2C57A 3E05A 5C52B 1VIDA 1Z56C 2GFQA 1PDVA 3I8SA 2XSZD 4LJLA 1JILA 2J5BA 4QZ9A 4IV5A 2I65A 2VLIA 4DSLA 1L5ZA 5KFBA 2WNIA 2HW3A 1B6TA 5BW8A 4X24A 3DHWC 3N75A 1FUIA 4AD8A 2OK8A 4KQ1A 4HRXA 3BA6A 3DOFA 4ZI7B 1F0PA 2AJTA 1BWQA 3VYRB 3ONVA 5KQRA 2B0CA 1R6TA 3AX6A 4OQNA 2V9WA 3SS9X 4ZYYA 1PR0A 3KKNA 3O4JA 4BVJA 1N3IA 2C7VA 3D4NA 1PNTA 3OJSA 4TXHA 1HE1C 2WAXA 3KTDA 4QFBA 4TWJA 3DBIA 3M82A 2AYXA 1CJBA 3S1LA 1NDUA 2P8SA 2VAPA 3UOWA 1DQPA 1A9ZA 4UE3S 2JEZA 2WIFA 1DOAA 3H0LB 3KQUA 4L4UA 1X9MA 4RA6A 1BCRB 2RJ3A 4ZOLB 4YAJA 1AS2A 2F1IA 2FEMA 2PGAA 4F4CA 5GIPE 5AW4A 2BCUA 2RLTA 3T5CA 1BX3A 3AERB 3Q41A 4NEQA 4BKPA 1ULZA 3BGIA 3BS5B 5TISU 3QVUA 5ALMA 3I30X 3JW8A 4F4HA 2LPEA 1IHYA 2NTVA 2NO5A 3IQWA 4EB0A 4O3RA 8ICBA 8ICPA 1MSWD 3TFQA 1B14A 4I4TA 1NJSA 1I2MA 3RVMA 2WAMA 4ECEA 3OWXA 1FFDA 1ESMA 5E6RA 1C29B 5JS6A 2Z9BA 5CYPA 5K6AA 521PA 4FOLA 4AMZA 3UH0A 3U3KA 1QDUA 1V8DA 1ADGA 4D3ZA 3OECA 3OEYA 4GVLA 1JDZA 4LI3X 3KYCA 2BKXA 3CLKA 4I9GA 3PUZA 2I78A 4K6CA 4OHYA 4LRXA 2QY9A 1KO7A 1B2LA 3L8CA 4G65A 3FYUC 1ST3A 4UM7A 2VA8A 4LXGA 3CWZA 2G9QA 3U4MA 2DETA 5AK3A 1L7BA 2CDNA 3UV7A 1F8UA 2XB6A 1AE1A 1U0GA 3R5TA 4RD1A 3I9NA 1PWYE 2D7CA 3I2FA 3F47A 5F12A 1XHEA 5AJVB 1JSLA 4X97A 5JXIA 1B3RA 4QGBA 3WLKX 3SICE 5AW0A 3WO0A 1IY8A 2C9BA 5DPMA 3DL4A 5KJEA 3RVJA 4Q05A 4NCXA 4HXEB 1PQYA 4S1NA 5BV1A 5DYWA 4GLLA 4JQCA 3OJEA 3DAHA 3RSSA 3ZKAA 3FAHA 2XIDA 1SZJG 3DVSX 3ZV7A 3TADC 2WDPA 5CX4A 5CK4A 5AKHA 1Z0IA 3OX3A 5HKKD 3F2VA 5KFRA 3WAKA 2Q27A 1C20A 1ORVA 2ERXA 2DCMA 3N0XA 1PT9A 4R2LA 3WO1A 1W48A 1Y3BE 4B4DA 3IP1A 2BI7A 1AGYA 1ZQTA 5BV8A 3GFGA 5K3EA 5DBBA 3UXEA 4IIVA 3K1AA 3H8VA 1JRLA 1YJBA 1F3LA 2HF2A 2ADFA 4KVAA 1YVPA 1PUXA 3MABA 10MHA 2C8JA 1O58A 4G0UA 3DSRA 2E6KA 4AUEA 1Z5NA 5AHWA 2ZPTX 3P2IA 4PGGA 2CL0X 2Y99A 2HMTA 2H85A 4L0MA 1JHDA 5K4GA 4KN6A 2ODGA 3LL7A 3HZHA 1F4VA 5L45A 5JSYA 3HJUA 4W5OA 1E62A 3LPNA 1P75A 5KTTA 2JAQA 1NJWA 1ATZA 5HQTA 1ZSNA 4K9SA 4OFWA 4N3BA 2UZ1B 2B8NA 2X6QA 5H8WA 5LMCA 2G4LA 2QD4A 2PEZA 5JAIA 3HVIA 2RGBA 2H5JA 3VNRA 1X7WA 3L82B 1BAPA 1L7MA 3M9MB 1U9IA 2ERCA 5CBPB 5FOQA 3TCKA 4MA4A 2WYIA 2K4IA 4FZLA 1QYCA 3PQ6A 3EQZA 4CGZA 4C4XA 4FZ3A 2D6FA 2XCSB 1BCSB 3E9ZA 3WHIA 4FS1A 1SCUA 2VNJA 3U7IA 2DJIA 5DCWA 5FNZA 3V7YA 4LDRA 3D2NA 3PKIA 2ZW9A 3P45A 2FZWA 4OG2A 5CP8A 1T2VA 3CA8A 1AKWA 3NBYC 4HADA 4FE3A 4MCIA 2HYIC 1XP5A 3LQYA 3FNEA 1JIIA 3CCBA 2PZEA 4ZPXA 3IEXA 2DWQA 3ND6A 4UU8A 2PNJA 4UD2A 1NYQA 1P61B 1VA4A 2YV2A 1O77A 4RUCA 1TVMA 2MJLA 3K6RA 3T9EA 3B3FA 2YHUA 1SWWA 3CO5A 3DHYA 3MWGA 3WMEA 4I8IA 5AVKA 9GPBA 3RB8A 1FFVA 3U48A 4TKUA 3B1JA 1NOKA 2I3ZA 2PH5A 3KKMA 3U60B 5A3SA 3R09A 1Z2DA 4I1VA 4RTNA 1JX6A 3G88A 2G1AA 2UVUA 3K1YA 3WBFA 2C2KA 1B4DA 2DKZA 3T9BA 2I7XA 3SBOA 4TQUS 4NWIA 4KG7A 4P4UA 4J8PA 1D9DA 1DLIA 4UHKA 3F3YA 3VH2A 3GDHA 4PHAA 1B8PA 1Z63A 4OB8A 1FXUA 4EG1A 4P80A 3FTQA 3HFGA 4GYJA 5DHAA 3EG5A 2XSZA 1QKIA 5F7OA 1NULA 1JJFA 5ALTA 3IIKA 3ABZA 4LZPA 4MGYR 2PFQA 2P3SA 3PE4A 3TSAA 4IRKA 2F59A 5EKUA 3AMZA 4DPKA 2TRSB 4BQEA 1T2FA 3TQOA 2ZE8A 1DOZA 2AOTB 3IMCA 3I5MA 5BN4B 1Q19A 2N42A 2Q7DA 1DQZA 1E1RD 4N0EA 3NP7A 4J6EA 1UMCA 1B3BA 1NVGA 4XTCS 1FE8A 4NP6A 2FPUA 2PUVA 1IXZA 1UC5B 1TRKA 1N6HA 4RQ4A 1T8EA 3G0DA 2XQGA 1E2QA 1O1YA 2PXCA 3BXZA 1Q0TA 2C54A 2Q5FA 3GT0A 4TYQA 3W8FA 3H2JA 5K3CA 2D5CA 2UXDB 1Z4LA 1N2CA 5FV7A 1ZXXA 2ZYDA 3ZU5A 2QT9A 2BF7A 2XUOA 4ZU3A 3EA0A 5E7IA 3DTNA 2XJ9A 1ZQKA 1W4AA 4H3HB 1C0LA 2RIRA 3I8XA 2ZE5A 1Q5PA 3M34A 3OFSA 4BO6A 3CZ4A 3HP4A 3TIFA 1SPBS 5EE5B 1GU1A 3DP7A 1OXUA 1PJLA 2XUZA 1QK3A 1FU4A 5J9FA 2QS9A 5F5XA 5BWLA 1KU0A 3JASB 4BRZA 4BFZA 1NKEA 1ISRA 2Q3MA 3E84A 4KB5A 2R8GA 3L8MA 3QYJA 1FOEB 1PVQA 1YB7A 2J3EA 1DMRA 4Q1EA 3D7RA 1K5HA 4ED2A 1CDEA 3LQQA 4CKYA 3PK0A 1W6RA 3H3FA 1T8UA 4Q1DA 1Y6JA 3RAFC 2GLEA 1Q20A 2WI8A 2AK2A 4CF5A 1T5DX 5LU8A 4FXOA 5TMPA 1LDMA 1VCIA 1V1MB 1COZA 3UCXA 2PZGA 4GC6A 4QEKA 2OMKA 1SXDA 1RD4A 4ZT4A 4Y2YA 1PQ4A 1K8RA 2QX4A 3IDAA 4UFPA 4Z99A 1D4ZA 2NX2A 1Z75A 4FKZA 2XWQA 1EJBA 2BBSA 3B51X 1QRTA 2ZQYA 3DKVA 2BE9A 4UNQA 2FPPB 1PFUA 1NVWQ 3PX6A 4EHJA 2ODWA 2Z1DA 3NHLA 2A30A 1GCOA 2WSYB 2VT6A 4DFPA 5EJ6A 4UAJA 3UATA 3ZBTA 3C8UA 1OZFA 4L5CA 3CPEA 5C4GB 2O3JA 3QKSA 2BZGA 4ZVLA 1CTQA 1UBGA 3GLFB 2CXUA 4DL2A 1L5QA 3AI2A 1C4XA 2H7XA 1PGOA 2RGYA 2DF8A 2NP6A 5KDDA 2HDWA 2X41A 5HKKA 1N6KA 5ALDA 4US1R 4QRDA 3R8XA 2HTEA 1G5FA 3WLFA 5K8CA 4RGVA 2JANA 2C88A 4WJZA 2HRRA 4EYOA 2EARA 3TEFA 2WICA 4FQ8A 4FIDA 2NTNA 1OFUA 1SQSA 5FTKA 1PFYA 3PZRA 2RFLA 2IYEA 3O31A 2KJ8A 4RJLA 4F5PA 2VPQA 1D2AA 1D9ZA 5DSTA 1XF1A 1YJXA 3DAPA 5KDOA 5BSWA 3ZCUA 2O1SA 3DT6A 3JWPA 3WLRA 1F14A 3IXQA 2ID7A 3VDRA 1XWFA 4NENA 2A0WA 5LD2C 1PX2A 4GC7A 1IM2A 2AJLI 2CNLA 3KQMA 1UM9A 1VZ2A 1DIHA 1U2TA 4H6PA 3H13A 2VHCA 2GWHA 1WUJS 3V6JA 1PEKE 4PLVA 3RASA 5HR5A 1RQRA 4J76A 1FS5A 2MYUA 4DR1B 5BW5A 2EFDB 3ZE7A 4D0RA 1I7QB 4QXMA 1CQXA 1TI7A 4ALMA 4I6EA 4EPTA 1E6WA 5FI5A 2X4DA 4ZAYA 3CNOA 2C20A 1AKVA 3RAPR 4BAUA 2GN2A 1NUUA 5CHGA 1WOYA 4LSGA 3I92A 5D49A 4GXJA 1MN8A 3U1BA 3V42A 2REQB 2J0UA 4LQ4A 1A5SB 3ESQA 1KOJA 4KXXA 3NHFA 4F5EA 1QHIA 4B9LA 3GJ6A 3O8OB 5D00A 3DO8A 5G0WA 3C74A 1BFDA 3AFNA 4HH0A 5K6TA 4TM7A 1Q3KA 1ZGJA 1WQ4A 3LQRA 4G0YA 3QFSA 1DG9A 4BL5A 3PW5A 3DDOA 2XMDA 1WZCA 3VXKA 4ND8A 3TB4A 4QZGA 5DRYA 5AMXA 2O9JA 2WTXA 3KS9A 5IRCD 4GLJA 1W85B 4A2QA 3PHJA 4YV0A 4MVWA 2GYYA 5A71A 4YMIA 4YBZA 4XRHA 2DFNA 2D4AA 3ELBA 4RPHA 5BPFA 3RC9A 4HVLA 3TAHA 2C97A 4IZHA 2A78A 1XF9A 4C3UA 1EE1A 4ND5A 1FUKA 3WWYA 1PT8A 1QLWA 2WWIA 2B7LA 5L3SA 3L4EA 4F9EA 3VMMA 2PBLA 2FPOA 1QRDA 3U4AA 3TRJA 4L0CA 2JZBB 4UHCA 4LKRA 2AI2A 1ND6A 3SM3A 4BDPA 4DLXA 4JR0A 4B87A 4LCBA 1S89A 1KRWA 3UK7A 1UDAA 3P9ZA 3ONNA 1N6PA 2J3JA 2ZUCA 1CNEA 4IVQA 3TVDA 2AKEA 3TFWA 1HDZA 3LTEA 3CEJA 3MINB 2HUPA 2MU1A 4ELUA 4H1HA 2KMLA 2GBLC 5I7UA 3KOZA 3MMPA 3WWEA 4B71A 421PA 3SKVA 2BEKA 3AF2A 2VJAA 1E1RA 2YS7A 5B30A 4JK1A 3A4LA 1V16B 2YV4A 1PS9A 4M9ZA 3IGFA 3VU8A 5EWFA 4FLMA 2IZ0A 1RWOA 3A0RB 3L7OA 5LJLA 3JWJA 5AVTA 2YRWA 1UANA 3CGWA 3B70A 3AEUA 1N33B 4Q7MB 3B6JA 2C0CA 4ZEMA 3AG5A 3ZIUA 4N54A 5I7OA 3SX0A 8ICVA 1TM4E 4QDKA 5C8ZA 4I2HA 2ZJYA 1GNPA 3JSXA 3I58A 2GA8A 3VYVA 4EY5A 4DV3B 3S8MA 2HFKA 3QX3A 4C6TA 5HMLA 2YZNA 5JASA 2QDKA 2FCAA 3L5OA 5CX1B 1UDCA 2BKAA 4ACBA 5I8WA 4M7OA 3LXXA 5DHUA 5GMOA 1Y5MA 4XIJA 3K6SA 1RCUA 3I45A 3CPJB 3KSUA 1JMSA 3ZZNA 1ULHA 2ID9A 4KDCA 5BV0A 4CQMB 2R6JA 1UUFA 3KD2A 3I53A 1SR8A 5CA1F 3TRIA 4RAQA 3DL2A 5KYNA 3PVCA 2KKVA 2VJ4A 4CMBA 1Y34E 2KTQA 1E96A 3K9BA 1UXOA 2X6RA 4NI5A 4F3YA 4JHLA 3SF0A 5U1PA 4LXIA 5T57A 3T1OA 5B1DA 1RHRA 3KELA 2ILVA 3WGLA 3DGFC 4QICA 5DRTA 1IIRA 3FWKA 3AH8A 1DJOA 5KWSA 1NBOA 4DSZA 3R5FA 4IF6A 2ZR0A 3IPRA 3IPXA 4RKQA 3NOXA 2NYRA 3HN6A 4YY3B 3X2SA 1CU1A 3INRA 5KTNA 2IEAA 1II8A 4ON9A 3WDSA 1TYBE 1WPGA 2E4YA 4H7KA 3BB3A 4RMIA 1XDZA 3T94A 1E32A 3JQ6A 1X7XB 3BIWA 3PRHA 1OE0A 3II6X 4C1NA 4ZZ0A 1UK6A 4XZ3A 3MQ4A 3IT1A 4BB5A 3B13B 3GJTA 2WB4A 3JYLA 1MIOA 1B74A 1BE1A 3DP9A 2G7MC 3PXBA 1BHQ1 1YOVB 4YCLA 5K3OA 1FDVA 5FUMA 2AGPA 1O87A 1UK8A 1TL7C 4JSRA 1YE5A 3KAKA 3L4BC 4DLYA 4W9RA 1IU9A 4LRSB 5EP1A 2JLRA 3NDIA 2WK1A 3M49A 1KMHA 1LI5A 1X92A 4ZP1A 4UBNA 2Q21A 3RRZA 4A36A 1A4XA 1V9PA 4DC0A 5EKXA 1HXHA 3O91A 3VOAA 1NBHA 2SCUA 2LV8A 2OCKA 4FZJA 2VHXA 5EEGA 4N47A 2V6BA 5H4GA 4P86A 3VU3A 1USWA 3QLJA 1S10A 1F51E 4BHTA 5ALZA 1GDHA 3OFJA 2NN3C 1CY4A 1T6XA 3R6DA 5HA5A 1LFDB 3N59A 2ZIVA 3L6RA 4IGAA 1VSTA 4EF5A 1ZRNA 4PHEA 3DV0B 1Y42X 5IH7A 4EGCB 3BFPA 3F2BA 4DQSA 3A3KA 3R0JA 4WK4B 4M8LA 3D2QA 3DJYA 2M32A 2I6SA 5LKAA 2Q3LA 5HKAA 2PKCA 4IQFA 2GBFA 3RFCA 4M0UA 3PICA 3BMQB 3VZRA 3CF6R 3UJ3X 1KDPA 3CMMA 2N0SA 4AJKA 5JTTA 4NVRA 2W6JD 3FH0A 3A05A 4PPGA 3PPWA 1GR1A 3RU9A 3T5PA 4BLTA 2WYWA 1UBUS 2BL4A 1ZCBA 1R6VA 3M9LA 4HLDA 1CCWA 4XD2A 3CR8A 1F44A 2W4IA 3GL9A 3WZMA 1NUTA 4OATA 3NG1A 2C84A 2BQUA 4DNFA 4H1VA 2IXDA 3RWBA 4JLPA 1NMSA 1E7RA 1M33A 4KN8A 1LC0A 4EJSC 5EJMA 7ICFA 2FG6C 4C8OA 1RYHA 4O2AF 2W6CX 3L7DA 5AJYA 4AYTA 3JZFA 4P1ZA 8ICNA 3H5LA 2VTVA 3WK6A 1ZL2A 3U39A 3QYFA 3UGJA 2DQNB 5CDUA 2DYKA 2Y6UA 1NVKA 3UMJA 2GB4A 4QOHA 4AIIA 5JCOC 1ZETA 3AVTA 2HX1A 4HSEA 4NE2A 2EAUA 2Y0BA 5CLIA 2AR7A 4FHGA 1XK6A 1WUIS 1VCHA 5ERYA 4OGGA 2AVDA 4LISA 5AKJA 3C7AA 5DGAA 2KSOA 1B6GA 1QKKA 1UDWA 1PEDA 4MZXA 5DG7A 3LVWA 3TO5A 4D92A 5LA6A 2HCJB 4H3SA 4TL7A 4CQNA 3AR8A 4B85A 1BEZA 3WK7A 1TM5E 1IWBB 4IAOA 3NRCA 2ZEJA 4O08A 1U0HC 1QQ6A 4KH0A 1HT3A 3AI3A 1DK3A 4CCYB 1AD2A 3ASUA 2PGLA 4ZGBA 3A6JA 4LZWA 4O8CA 1KJNA 3I83A 2VYVD 4U4AA 8ICEA 4Y1RB 4EHKA 3OI7A 2GPJA 2QJOA 2W2XA 4CUKA 5A06A 2KZ3A 4PFSA 3P9CA 2O2IA 2OFWA 4GLFA 1EGMB 4JU9A 3ETNA 1PVOA 4P4LA 1YQDA 2P4UA 4IJ5A 4BXOA 1VBFA 3HXLA 1RXCA 3R7LA 2GZRA 4JJ4A 1SQ5A 2HRQA 2W6MA 1H1TA 3PUVA 4JYAB 5M04A 4DHWA 5KKAA 4EHDA 2Q2WA 4IVRA 4JVLA 2A94A 1A9XA 2WMDA 3C3BA 3VTZA 3F98A 2E87A 1T9BA 3WIBA 1XQYA 2IIVA 1XA4A 4QOSA 3VV3A 5LVAA 4EQ6A 1U0RA 3IP5A 4LZGA 3ROQA 3HRDD 1SUEA 4L8LA 1IHPA 1GFSA 5ES3A 4AICA 4LGYA 4QIHA 3UQ0A 1GTMA 2XXJA 1NWHA 3MMSA 4CKXA 1JDSA 4QD3A 3FD8A 3AQFA 3I3OA 3LPAA 3CW9A 4UOEA 2GN8A 4B7ZA 1JXQA 3VVMA 2PGXA 3RRMA 1KSPA 1TE2A 4RZRA 3IB6A 1K1SA 2KFNA 3BICA 4F84A 1XSEA 4EA6A 5TEVA 4DIOA 2PVSA 2QB0A 4YDRA 4NAHA 3SIXA 5B4TA 3OOYA 2GASA 2GJAA 4R16A 4WXPA 4MS1A 4GGOA 2BGWA 1JZQA 2WY2D 2VS1A 4DLEA 3RVPA 5JLJA 4I5GA 5EWMB 5A4FS 4NE9A 2Y1CA 2IYVA 3GJXC 2O2DA 2WAYA 5ALSA 1CUXA 4KNVA 4C9BA 5E3HA 1WWKA 4EA7A 5J0WA 2NVUB 1VZ3A 3IALA 5IJ9A 2OKCA 2YHIB 1NIPA 3K2BA 5K8LA 3TZLA 3IUJA 3LWNA 2P4EA 5CDSA 2QTLA 2I6XA 1DEHA 1WXGA 1N61A 1DC4A 4FR5A 3GFQA 3ECSA 2N1RA 3L6EA 4ZJUA 3GNLA 4HWKA 3QEMB 2BCVA 4XM2A 2IDZA 1LA2A 2FVXA 5KVAA 1I6KA 2VXYA 3OSUA 3IP4B 3AHEA 4X3PA 3UB2A 4DC9A 5I4IA 4BCBA 5AI6A 1G38A 3C6KA 2YJZA 4C08A 4O3MA 1H2YA 3ZV4A 4BV8A 4D82A 1CB7A 4Y98A 1SURA 1DO8A 4NBUA 4MAMA 3CW2A 4GQIA 4GKKB 5EIOA 2XRMA 1KZ6A 3TKLA 2NXCA 4RPXA 1MAVA 1SVUA 3PQDA 3PXXA 1FYWA 3GRCA 3E9DA 2I7CA 2ZS9A 1FP7A 2ZVPX 4BGIA 1D0VA 1AK9A 5EE3A 1WO8A 2XCOA 2OZPA 4EI2A 1JEDA 3KE9A 2FHSA 2XYPA 4X5VA 3DOCA 5LA6F 4Y6PA 1SZDA 2DQKA 2IPAB 3HDVA 2H65A 4MPPA 5JZMA 5KFHA 1EP3B 5JC1A 5KAIU 2BMFA 1JUDA 1SQ0A 3BL6A 4RQ8A 5CNIA 2JVJA 4A2CA 1NI4A 1BN6A 5J2GA 4UW9A 2ZBPA 1NP3A 3CZCA 4KDEA 3KC2A 3RE1A 1N1MA 3GELA 2V54A 3KZIU 5AKGA 5TQVA 1CD5A 4L22A 1OFGA 2QTWB 2H5XA 1NRXA 3S4YA 2P2LA 4HB0A 2Y0CA 3JD2A 3C5EA 4R1NA 2Z8YM 3GA7A 1F9EA 3DLBA 3TVTA 3IAEA 4CL8A 1YBVA 4B2LA 3EWAA 3TGLA 1IJFA 4JYCA 3RFAA 2KM1A 2GYUA 1I1NA 1XALA 3Q9UA 4HBZA 5T3YA 1ZBQA 3LRXA 4EG4A 2L2QA 4KPFC 4MVCA 4C2AA 5EIAA 3UZUA 3ED5A 2IYOA 4RK5A 1QV9A 2HO5A 2EFCB 3SQIA 3CV3A 4IRUB 2WWYA 3G8AA 2WSSD 1WUTA 2IHTA 3WXMA 4AS2A 3ZZUA 1X13A 2NTEA 2ZOSA 1M34A 4UKDA 2EANA 1MPTA 3UHOA 2ZE7A 3T41A 1WUKS 4I81A 4TS1A 4BNLA 1U8EA 3STXA 2BTQA 3AVWA 1T8RA 1A1SA 4RA9B 4NZMA 1N9ZA 1RYSA 3VZSA 1GGMA 1PDWA 4X62B 1MXFA 2ECPA 1LUAA 4D99A 3FLEA 4UBLA 4PJ0U 1CX9B 2EJVA 1RLOA 3UWOA 4KBGA 1P60A 4OLFA 1F2DA 1QTNA 1KN5A 2K8CB 2ZIUA 4EUFA 4QWWA 4BUZA 4C2UA 1WXHA 4NNJA 3CMCO 4IHAA 3ILVA 5DX8A 1CZNA 1L5NA 4FXPA 3OZCA 4EAAA 1C9YA 3ETRA 2VWQA 5H0IA 3WBKA 1DZIA 3QELA 2HBZA 4V2UA 4D46A 1RAHA 1P62B 2PXHA 4QWBA 2YWRA 4PHGA 1VLZA 4MDHA 2B1JA 1PR6A 5AVQA 3FHLA 4KAFA 3A1FA 3HBJA 2YRFA 3ODPA 4RQNA 3DBLB 1JYEA 4NCJA 1RRMA 4TX1A 3U16A 4E11A 4MKFA 3VSCA 3RRYA 3B1WA 3LDGA 1X87A 5AIAA 1FTQA 4PSKA 4DM3A 5U4QA 2FXIA 3GWZA 2B78A 4QNMA 3M6FA 5I9LA 4D5EA 1WX1A 1JW9B 2VYVA 3T7CA 1NL3A 4KQHA 4QVGA 3JXEA 3HDYA 3JPSA 1S76D 3D6MA 2HBYA 5AIBA 1CF4A 2VIIA 3FETA 3LL4A 2PIAA 1THMA 3HKDA 4P36A 1GLNA 3LFTA 3LO5A 1S2MA 1EHYA 5GM2A 3DNPA 4ZVKA 3IDWA 3F3SA 1NPYA 2PMEA 4KMSA 4M9UA 2IDKA 2J3IA 5HGXA 3FNRA 4WZAE 3DO5A 5BOSB 2J4DA 3U2QA 3K09A 1AGRA 5F35A 4IQGA 3OU2A 4UHJA 4KAJA 2PUTA 4W9NC 1JIVA 3LC0A 3ST7A 2D00A 4X1IA 1SHTX 4ZCPA 2MYNA 3RYTC 4DMUB 1FTGA 1XAHA 4WFIA 3O90A 1JHVA 4ED0A 1JB9A 1IUKA 3WIDA 4B3TB 1LKYA 2O3QA 1NK5A 4JBYA 3HXTA 4IO0A 1N32B 1LQ2A 4QYSA 2R7KA 3T4PA 2H5EA 2J9ZB 3QWBA 2HR1A 3TTUA 3U49A 2C00A 2P2CA 4MHTA 1Z7YA 2OM6A 1OXMA 4EDFA 4DVJA 3EXHB 1YR1A 1I0LA 1SV0A 2P6MA 5CAEA 4D1YA 2ZKIA 1TAUA 3INGA 3Q3VA 1E2MA 2I1LA 5CNJA 2CXNA 3I61A 1S9HA 4TS3A 3FG9A 4N1AA 2CFCA 2C83A 1W30A 2UVVA 5CDGA 3WIUA 4LFCB 3QHAA 3CW8X 3MWEA 2VC2B 1YL5A 3OMXA 2YFKA 4O4HA 1FX0A 1J07A 3ETEA 4F91B 4PYKA 1V38A 4QBHA 1C3OB 4RTLA 2Q6LA 4B2PA 5K0TA 3PT5A 3WLHA 4J7AA 4IG9A 3PDCA 3VR6H 3P19A 4BPBA 4WADA 3R0IA 1UIRA 1JEYB 1WETA 4I27A 1OIVA 2R1TB 2QN2A 5AD1A 2BCSA 4PQGA 4L0DA 3COVA 3FWZA 5KSWB 4FKBA 2J7PD 3GPCA 9ICXA 4HDKB 3PUHA 2BR3A