2YN4A

L-2-chlorobutryic acid bound complex l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
225
structure length
225
Chain Sequence
b'SGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 89
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2yn4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yn4A01
3UMGA 4UM7A 5AKIA 4EELA 3E58A 3N28A 1VJ5A 1Q91A 5IS2A 4OCZA 4I9GA 5AICA 4XOUA 3ED5A 2YBDA 5ALNA 1TJ5A 2C88A 2QYHA 4B6JA 5AHXA 5AVUA 4CE6A 1Z4LA 2ZG6A 3QUTA 4QJBA 2MU1A 3OCUA 4CF5A 3UMCA 5ALUA 5AVXA 5AM4A 1T9ZA 1L6RA 1U7OA 3U19A 5AW1A 4OD0A 2G08A 1MH9A 3WKDA 1AQ6A 3ZX4A 4OHFA 2IOFK 2HOQA 3NALA 4BBJA 3I1YA 3FPSA 4HGOA 5AVSA 5AVWA 2W11A 4UMVA 1Q92A 3ET5A 3OTQA 3B9BA 5IT4A 3MMZA 1O03A 2G09A 3AR3A 2GMWA 4UATA 2JAWA 2WM8A 5A3QA 1K1EA 2WF7A 4HAIA 2PQ0A 3AR9A 3FPBA 1U2SA 4YCMA 2WFAA 3N8GA 2MU2A 3ZU6A 3L8GA 3SD7A 5AW3A 3A3YA 1N8NA 1ZD3A 2R8YA 4YIHA 2ZXEA 4HGQA 4UU0A 3W5CA 4XQ0A 2P69A 4Y2RA 3EPRA 2RARA 5ALLA 3QUQA 5AW7A 1L7MA 5ALGA 1WPGA 4KNWA 5ALJA 1QH9A 1RKUA 2NYVA 1U02A 3NUQA 2D2VA 1XVIA 1L7NA 1RMTA 3WK7A 2I55A 2WF8A 5ALRA 5AW2A 4Y2XA 3U7HB 4EX7A 2OM6A 3PCTA 5ALQA 1Z4OA 4FFDA 3UM9A 2YJ4A 3B8EA 3SLRA 5IT0A 4CF4A 4Y2JA 5AM5A 4ZEWA 2I54A 2AGVA 1RQNA 3ZTWA 2CFRA 1Z5UA 4RESA 4UMDA 2I7DA 1Y8AA 2P11A 2HHLA 3L5KA 5ALVA 2CFTA 5AI0A 4DCCA 2HEGA 4Y3UA 2Q5EA 1L7OA 3W5AA 2I34A 2GHQA 2YN4A 4BNDA 4Y2VA 5AW6A 1TJ3A 1YNSA 2GHTA 2I33A 1RRCA 3GYGA 3WKAA 1J8DA 2RBKA 2HI0A 2G80A 3NAMA 2EATA 3AR7A 2R8XA 3SF0A 2BDEA 2YMQA 1Z4PX 3N1UA 1ZS9A 3DAOA 3L0YA 1ZRMA 3WGUA 5ALWA 5AI6A 2FPSA 3J7TA 2FUCA 1NRWA 3ZVNA 1Z4KA 1RQLA 3ONNA 2YJ5A 3ESRA 4UAVA 2C4NA 1ZOLA 4DWOA 5JJBA 2P27A 2HO4A 4YCLA 3OCYA 5FP0A 4MWOA 4AS2A 1Z4JA 4KNVA 4UU1A 4IG4A 4Y2PA 2B30A 5AKGA 1CR6A 2Q4RA 1NNLA 3ZTYA 2B1QA 3MPOA 4BKMA 1RKQA 2BY4A 4EX6A 2ZOSA 1ZJJA 3EWIA 4ZEXA 3WKBA 2HF7A 2B1RA 4UM5A 3CNHA 1Z5GA 1SU4A 4CF3A 3HYCA 3MC1A 5ALDA 2PKEA 1RMYA 3W5BA 4CNQA 5ALMA 5AW5A 3U7EB 3K1ZA 3SHQA 3L1VA 2W43A 3U26A 1YMQA 3OCWA 2G07A 4KYTA 3BA6A 2G0AA 5ALKA 4Y2QA 1F5SA 4YGYA 5ALXA 3KC2A 3S6JA 3QU4A 2FPXA 2RAVA 5ALPA 4J03A 4EEKA 4BNDB 3L7YA 4L6AA 3IB6A 2C8LA 4YIKA 3N07A 2EARA 3RFUA 1SWVA 3FZQA 4GXTA 4HYTA 4FYPA 3L0BA 1YJ5A 1S2OA 2HDOA 2YMPA 3QNMA 4UASA 3WKCA 3QLEA 4DFDA 3QGMA 5AI4A 1EK1A 2B8JA 4O8CA 4KX5A 2OYCA 3F9RA 1X42A 3M1YA 5AIBA 4XPZA 2IA5A 4EENA 3PDWA 3EF0A 3DNPA 2AH5A 3R9KA 2B0CA 2I6XA 1YV9A 3QXGA 5ALFA 3WK5A 2O9JA 2OBBA 2ZBDA 3AR5A 3U7GA 2ZBFA 2NO4A 5AESA 3AR4A 2QLTA 4RETA 1CQZA 4KX3A 4E88A 2FEAA 2WF9A 1Z4IA 5ALEA 5AVZA 3ET4A 2OA0A 3QX7A 1QQ5A 3NASA 1JUDA 3SKXA 1QYIA 5AI9A 3FGOA 3OPXA 3R09A 3QU5A 3L8EA 3QU2A 1Z4MA 2IOHA 5AM2A 5AKYA 3BWVA 4FE3A 4AS3A 4I9FA 2FDRA 2FI1A 1RLMA 2JAUA 3AR6A 3KD3A 4DW8A 5AVQA 2FUEA 4UMFA 3UMBA 3NANA 3QU7A 5AKHA 5A3SA 2DQSA 2Q4TA 4KN8A 5E0OA 4YCNA 1QQ7A 1RC8A 2ZBGA 3WK4A 4AP9A 3AR2A 3OCVA 5ALZA 1QQ6A 3QYPA 1WVIA 1RKVA 1XP5A 2C9MA 3ESQA 3AR8A 2C8KA 3P96A 3ZX5A 2G1AA 3L8FA 3TLMA 2JARA 4BEVA 4HGRA 3KBBA 4G63A 1Z88A 3I6BA 2GO7A 3OCXA 3E8MA 5AW9A 3ZVMA 5AIAA 2WHEA 2PR7A 2YJ6A 1L8LA 4JDPA 4PNHA 3QU9A 4UAUA 2R8ZA 1YS9A 5ALSA 3NIWA 2IYEA 4BYGA 2YMMA 4NFLA 4UMEA 4NABA 4Y2SA 3KZXA 1RMQA 4MUMA 5AKKA 2X4DA 1TE2A 4EZEA 3DV9A 3A1DA 3L0CA 3W5DA 2MSNA 4H1WA 2FPWA 3ZWKA 2AUTA 2YY6A 2G06A 2O2XA 5AK5A 3WKEA 1L7PA 2HF2A 4J2TA 5AK3A 3A1CA 2B82A 5AKXA 4NAVA 5AI5A 5T41A 3WK8A 5AK6A 1VJRA 4JB3A 4Y2UA 1L8OA 4G9BA 4NV0A 3KOOA 3A1EA 4L57A 4L6CA 4UARA 3IJ5A 5ALYA 1ZD4A 2EAUA 3I76A 4IFTA 3WK9A 3WGVA 2WF5A 2NO5A 4C4TA 3DDHA 2YFYA 1XPJA 5AVTA 1IWOA 5AKZA 4F71A 3L8HA 1J97A 2IOFA 1VFPA 1NF2A 4HGPA 3U13A 1PW5A 1WZCA 1ZD2P 2HX1A 3CZ4A 3KDPA 5AK4A 5AM3A 2R8EA 4HGNA 3ZUPA 3L1UA 5AI8A 2VKQA 3ZW7A 3SKYA 1RDFA 4C4SA 3VAYA 1LTQA 1EK2A 1T5SA 2JGAA 2JAOA 2ODAA 3FVVA 3U7FB 3PGLA 4Y2TA 2HSZA 2ZBEA 3QUBA 5ALIA 3FM9A 4UW9A 1U7PA 5ALTA 2W4MA 1ZD5A 1RLTA 3PGVA 1U2TA 3E84A 4BX0A 1S8OA 2AMYA 2YJ3A 3ZVLA 1WR8A 5AVRA 1LVHA 4BX2A 5AVYA 1SWWA 3ZWDA 3HLTA 2YMLA 3I28A 2HCFA 3QUCA 5AW8A 4YH1A 3D6JA 3EF1A 5AKLA 1FEZA 4C4RA 1RLOA 1T5TA 3B9RA 3RF6A 1ZRNA 2CFSA 2BDUA 2FPUA 4XE5A 4QQFA 4BEWA 4BX3A 4F72A 1TJ4A 2P9JA 3IRUA 3E81A 5AW0A 3MN1A 4ZEVA 1O08A 5AM0A 3R4CA 1YDFA 4OFZA 5AM1A 1TA0A 2GFHA 5AVVA 5ALOA 5A3RA 2RB5A 1Z4NA 5AKJA 3ZI4A 2WF6A 2CN1A 3M9LA 3WK6A 1Z4QA 4Y2YA 2B8EA 2FPRA 3NRJA 5AW4A 5AKEA 1RPZA 1KYTA 3SMVA 1N9KA 3N5KA 3OCZA 4NWIA 4GIBA 5ALHA
chains in the Genus database with same CATH superfamily
4UM7A 1N60A 2HCBA 4M0AA 2IIQA 5CXQA 3ELDA 2C88A 4B6JA 1AO3A 4OUDA 5CIYA 1SK9A 3AEQA 4UBJA 1WXIA 3CXRA 4EY3A 1BXZA 2PX5A 2FR8A 3JRNA 3NHBA 1L7BA 2XCUA 4MV8A 1IE3A 1NUQA 1U4NA 2FPGB 3BQMB 3ZEAA 2WAQC 3QELA 4HH0A 1U3TA 1HLPA 3QA9A 4BEJA 3N4MB 2XZDA 3ZDXB 4DLSA 1R37A 1NRXA 2P41A 1NC3A 4OJYA 2M2IA 2OO3A 4GT1A 4MW2A 1XRQA 3CN7A 1HQDA 3W2TA 4FYJA 5DKWA 3G8YA 1VKHA 2WF8A 3ZE0B 2V98A 1YRYE 1B00A 1XDZA 1I01A 3KEOA 1N25A 3HDTA 4E15A 5JAMA 4CTNA 2O8NA 4C9BA 3GAAA 4HVLA 4CL8A 4WXEA 1H93A 3CZAA 2MOKA 1ECJA 5LZ8A 4NLCA 2J6CA 1LLFA 4AKSA 2BPGA 4FNMA 5IJ0B 1OV4A 2XE4A 1IN4A 1GKLA 2GSDA 3QLJA 3NJ8A 2AXEA 2C2OA 1GO2A 2AJLI 4NAHA 3UV6A 4G0ZA 4IMPA 5HF6A 3PC4A 3B6MA 3EMBA 4Q18A 1BGXT 2GEKA 3EEFA 1JAIA 4I5DA 2I78A 4FSDA 4IXNA 4RPIA 3ETNA 5MFPA 1CQIA 4M55A 4Q0MA 2YZ7A 2HF7A 1R8XA 3F67A 3MLAA 4YJFA 3ECSA 5L40A 1IY0A 1ESEA 4ENRA 3MBOA 4FFNA 5C0OE 2ZTDA 1UA1A 4HOYA 2X8JA 1JH9A 3BJYA 3LCJA 2Y2VA 1LDNA 3OLVA 1HDIA 4OHMA 3RVNA 4QPPA 1JEQA 3U9LA 5A06A 4WW0A 1V47A 2F59A 3PEUA 2C8LA 3GLFA 4HWSA 4DADA 5HIIA 2PMEA 1FX0B 1RI4A 3QEJA 2I7XA 3DQZA 3WKCA 5KREA 1O4WA 4KGXA 5E1MA 2HCRA 2A78A 4RIFA 4DOCA 1ZRHA 1IDOA 5MFZA 2QRZA 7ICVA 2XX3A 3QY9A 2SKCA 5EUBA 5BSEA 2G3YA 3TFRA 4IILA 5CRIA 3QYJA 2PV0A 4JY7A 1QJ4A 1MHTA 2Y0SC 3V8NA 3C5HA 1Q12A 3N8NA 3CX4A 4RV5A 2B1JA 1MNAA 1XP5A 4LX8A 1ZU5A 3C7TA 4FMBB 3EQ8A 2JI9A 1DEAA 3HKBA 2R8ZA 3ZHSA 8LDHA 3ZZ0A 1WSBA 2IVZA 4K4IA 4HJRA 4KGDA 4KLQA 1INLA 5TEVA 1IHUA 9ICOA 4LC9A 5EP2A 2D0DA 3FE2A 4OXIA 3D7RA 1UODA 2Z9DA 1S2IA 3CR3C 4I36A 4J91A 2ID9A 3HM9A 1OB5A 2BCVA 1WEHA 5AD1A 5T6MA 4BJ3A 4KL8S 1OXVA 2G67A 3MLBA 5BSMA 5KX5B 3RVMA 1KOGA 3TM4A 5K3EA 3IALA 1HQYE 3HCNA 4C5BA 5HK8A 2EDAA 3PNQA 2LRHA 2I3AA 4A7PA 2X3YA 5IBQA 1J0DA 1COOA 3H0RB 3CSUA 2QYOA 2BTEA 1C7YA 3A0HU 2E9SA 5AOVA 5EESA 4TYMA 2PKXA 2QSYA 4Q4LA 3P0HA 4B7AA 5D01A 2H3FA 4QM7A 4AXBA 2JJ2D 3E9ZA 4ARSA 2CFSA 2XDWA 3FG9A 2WUGA 1CIVA 4ED8A 4D8WA 1FB5A 4FHFA 4DDWA 2PT9A 1P6UA 1UBEA 3CGGA 2CV2A 3LLSA 5DRTA 2YVKA 3SEQA 2VEOA 4ZI5A 3ED1A 1G20E 2VA9A 4QZDA 2BMEA 1EVEA 3RGWS 3ONVA 1CRQA 2GVNA 1PT7A 2F8KA 2EEZA 2GK4A 3TOCA 1KSJA 2H3VA 4TMWA 1Z16A 4E1BA 4YMGA 3V6JA 2BL4A 2QL9A 1GTVA 4O2BB 1FJ2A 3HJAA 3DDNA 1DC5A 3RRYA 3A3YA 3WYAA 2BEWB 3LVVA 3EPRA 4IRKA 1LDYA 2W98A 1DIRA 2R96A 4XIYA 4KYVA 4C8OA 2P7IA 1TAQA 3FYUC 3TIGA 3K6JA 1L7NA 4IDFA 1KAQA 3ZHRA 3QTBA 3BN3A 4J0KA 4CF4A 2LP4Y 3G1UA 5A5GA 2ZTVA 2R6GA 1B4FA 1RLIA 1AKMA 5CT4A 4D1YA 1RCUA 4RSGA 4KJZA 2IWRA 1L4HA 1X94A 3TIIA 2AKAB 2HXSA 4AICA 3NWPA 1E2BA 1PX0A 2B6GA 2ZWIA 1P1KA 3TFWA 4DLKA 4ECEA 2IHNA 3O0DA 5JS8A 4UHFA 2JVKA 5DF1A 1PUXA 3OPQA 3F4KA 4K9NA 2BTQA 1L7EA 3CF4A 3ONFA 3SJCA 2AVDA 3RH6A 1ST3A 1IJBA 1YQ9A 3D7NA 5BN4B 1K1SA 4M0EA 3WGTA 4NXMB 5KFQA 1TOAA 1IN1A 4JV2A 3H5WA 1A8SA 2AD1A 3C7CB 3HI6A 1ZBDA 1JL3A 2AEFA 2X9NA 1IB6A 3FLEA 4XB6B 2KW5A 3DHNA 1FLAA 3LBYA 4H4CA 3SE0A 2WWXA 1SC1A 2PL9A 2ZJ1A 2PX3A 3SX0A 3AJDA 4PZUA 3WLKX 1MFZA 4NE9A 1ACLA 3O0TA 2CPRA 1GZ6A 2V4QA 3KALA 4R01A 2OXTA 3KQHA 3STYA 4DFDA 4K4HA 5BN5A 3NBFA 3QA3E 5AIBA 5KQGA 3R3SA 5DH9A 2J5KA 1YBAA 3ZI0A 4ZN6A 1COWA 4D8UA 4YMUA 3Q9NA 3H5IA 3C16C 1UMCB 2C9YA 4PS1A 1V4BA 3DP7A 4C76A 1T9CA 5EIBD 4KCGA 2W93A 4OSEA 4XQ9A 2VSNA 4HZUB 3SYMA 4MW5A 5CFRA 1NMXA 1Z4MA 3NCTA 4FQ5A 5C7IO 1GPNA 4XJXA 4K28A 4J9NA 1M2WA 1FTSA 2QORA 2YCLA 3KJQA 4D3SA 2YZGA 5J0UA 1RE0A 2ZIAA 3MR5A 1U2GA 1FBNA 4XEHA 3VBEA 4CI9A 1CV2A 1AKTA 3MCTA 4RVNA 2K87A 4F0JA 2EFEB 2H0QA 2N3ZA 4CMGA 1CUVA 4PZ0A 2K4EA 4I5IA 3N2ZB 4R8UA 1Q19A 3DFMA 1QIKA 1QIGA 5DLQC 1QXSA 4JB3A 2PCJA 3NX4A 1H2EA 4OX9B 1EWKA 2C2ZA 1VSVA 3QP9A 4EYEA 3G5AA 2IZ7A 3AG5A 1UKBA 1N5OX 4CCYA 2PT6A 3LZDA 4ODIA 3A37A 3F2IA 4EGJA 4CQLB 3OIDA 3G82C 4DQDA 3FDFA 1B73A 2VYVA 3Q7RA 4B6EA 2ZRAA 3I2IA 2A9FA 1WDTA 3TD6A 1E0KA 1BWSA 4HRXA 4XR4A 4HZIA 4FD2A 1KHHA 1H9CA 2W9BB 1XCLA 2J5XA 1YZ7A 4MVJP 3IUYA 1H23A 4DLBA 4QWMA 2OTCA 3VJRA 2H1FA 3ESBA 5D5QA 3KXIA 1GPBA 4R9VA 2X0EA 7ABPA 4KWIA 1XIVA 5KDLA 3CB4A 4ND7A 1ZITA 2QMUA 1JSLA 2ORWA 3HBLA 1G21E 2I6GA 3W8DA 4JL5A 5AW4A 1YHZA 2PD4A 1JVBA 3HPOA 4BDSA 3DF9A 1VJ5A 2R9VA 1Z8NA 2OFOA 2PGDA 2ZPAA 2DYKA 1U5BB 3T8YA 5ELLA 2P4HX 1SVSA 4IIEA 2PWPA 1OU0A 1RXCA 3ZX4A 1ZVKA 1B1AA 1W36C 4KR2A 1DOZA 4XIGS 5B6PA 4Q24A 5JHGB 3IFSA 5EIHA 3IELA 5GJVC 5SYAA 2PYDA 2WFAA 2RAUA 3V8MA 2ZU0C 2HN9A 1KQPA 3DG9A 1L5WA 1QIIA 1U7XA 2GX6A 2X3FA 1X66A 3RJHA 5G3ZA 4E5KA 5M34A 1FQKA 4ZU6X 1QGAA 5CIWA 2XYVA 3JX9A 3A6LA 4UFPA 1QTRA 3CLKA 3W6ZA 5CB4A 4ELTA 4P4NA 1LI7A 5DIFA 3E9RA 1AS3A 3WXBA 3NTOA 4DDTA 4BMCA 1Q5PA 3R5FA 1J0EA 4ICAA 2IXAA 3ZVRA 4PH5A 2FR8C 4EO9A 2BDEA 2BMVA 2FP3A 3BXHA 4LY0A 1TQ2A 5DCYA 5HZMA 4MRAA 1VECA 3W04A 5AXAA 4K2AA 2CL0X 3V48A 3R5KA 1T6YA 4KO1S 5I7EA 1HWYA 1RFLA 4E07A 1M6NA 2ODNA 3CLTD 3CLSD 2XC9A 1YFKA 5A0VA 3UKJA 3Q12A 1H3NA 4G0PA 2B8WA 2JH1A 1BQ4A 4C0WA 3MD9A 3NB0A 4RHCA 4W8OA 2JD1A 2ZTHA 3N87A 4N47A 2G07A 2Y67A 2QDKA 4PYRA 1RZTA 3KR0A 3HJEA 5JCJA 4Z4HA 1F51E 2MCFA 5HFAA 3ZJYA 3FPHA 2G4LA 4YIKA 3AM4A 3MIIA 3L0BA 3PLRA 3ADBA 1Q1QA 3KKQA 4CJXA 2PT7A 1TW3A 5EE3A 3A4LA 4H35A 1V5FA 3KAQA 3M1YA 3UT5A 4RVGA 3F3SA 1BRTA 3IHTA 3CF2A 3WK5A 2C95A 3VR3A 5KG4A 4YRNA 1ZQFA 1N6HA 2QU7A 4DJAA 4ETNA 1NMSA 4RW0A 4AL4A 1QS0A 1NMQA 2ANCA 1KFKB 5CHEA 2PZFA 4DWWA 4KLCA 1V45E 2JDID 4CN9A 3KTDA 1N78A 4N9WA 2K8AA 4P2GA 3ZDZB 4QDOA 1XTPA 3AERA 4CGZA 1MO4A 4R3NA 1WS6A 2XT9A 3AFMA 1Q21A 5JECA 4DL3A 5JH7B 2NV6A 4QPZA 4R16A 9ICPA 1XSEA 3HKEA 3GFQA 2E89A 1LY1A 2YS6A 3D8NA 2BFEB 1YJ8A 4BN0A 2BFFA 2CK3A 5CDYA 1RHMA 2JRCA 3PL5A 4DCOA 2VPPA 3ZYZA 1VJGA 1Y4AE 1LLUA 4P4TA 1HBJA 4RZQA 4BUCA 5UKDA 3L2OB 2L69A 3PVSA 1II8A 4KMUA 1P44A 5IJ9B 3II6X 1WCWA 5CLLA 1X7XB 4UCFA 1IZZA 3DMDA 1P8JA 4HX5A 1OASA 4RDHA 3ZQ6A 4HJXA 3A2NA 1BDJA 3FIUA 3LUJA 1G8KA 2P79A 5F3WB 4JGGA 1YWGO 2C8JA 2R6DA 4AY3A 2BIFA 1SL0A 2VQSA 1ULTA 3VISA 4BO2A 1N2CE 2FZCA 2PLWA 4LA4A 1NJ8A 2JGFA 1KO8A 3QKWA 2F48A 1FMLA 1YTLA 2BFCA 3OJEA 2CXRA 3IHWA 2LM1A 3FYDA 2FWIA 4C4PA 1TPYA 3E84A 1RJ9B 3D3JA 1ABFA 1LVHA 2EP8A 3H4IA 4RA6B 2VNKA 3JVIA 1CB0A 4TTPA 3QE9Y 1IY1A 3C6XA 4CM3A 2ZSIA 2VT2A 4NDAA 4PRKA 4M9CA 3BGIA 1TVAA 4D46A 5FD8A 2X5JO 2HSEA 2O8FB 4YLGA 4FMDF 1GQYA 4S3MA 5KSWB 1CK4A 4IFIA 3D1VA 5HR5A 3IBSA 4IINA 3WGYA 2RHWA 4JWNA 4G67A 4UDNA 3LBAA 4IDCA 4J3JA 1J33A 1E2LA 4M2YA 4KLTA 2E82A 4FOSA 3UA3A 4CF5A 2JEIA 1P5FA 4Q19A 2C4MA 3SXPA 1P4GA 3IQDB 3U4AA 4OHFA 4QJ5A 2CLHB 3VSCA 4IS3A 4CIYA 5IDVA 3FPSA 2J87A 5KQRA 2NXCA 3G0OA 2HTEA 1O03A 4K26A 3LT4A 4MDYA 1FDWA 1B23P 1GKKA 1JNXX 2FCRA 3H9JA 5IXSA 2FQWA 2ZCJA 3ZHQA 4FFRA 5BRJA 2OWDA 3FHJA 1I9CA 4JGIA 4DIEA 2VFAA 5C8YB 2P9YA 4O59O 4RVFA 3U3JA 4HPJB 4MO9A 1MRZA 1XBTA 3GMTA 2NPIA 2XA2A 2HT1A 4B3XA 2JEOA 5DBGA 1XHFA 4XD2A 4WD3A 2GZ1A 2VR1A 2AQIA 5FADA 3DHEA 4A6DA 2HV8A 3AGPA 1EH5A 3Q3JB 4CDGA 3H9EO 2ZI4A 4U2EA 4MUBA 4JI4B 1CC1S 2YASA 1NBIA 5CFQA 3IBFA 2IS1A 3FX2A 3D6FA 1BX3A 1WZNA 4KVZA 4NJOA 2C9OA 2XBUA 4OX9Y 2VHXA 2R68A 1Z0SA 1M75A 4DA9A 2JK0A 4YRMA 3ZDQA 1ENYA 5TARA 5F76A 4MVJD 4H6VA 2IMWP 2FXVA 3BFKA 3GVPA 4NYJR 3W5VA 2QN1A 1BVSA 3LPLA 2J8ZA 1NVVQ 2BY4A 4CTMA 3G0GA 4EJ2A 221PA 3ZW8A 3SHWA 1TM3E 4NESA 4LIPD 4LRUA 4RV4A 3VO1A 4XDZA 4JODA 2ZIVA 1WCIB 1V5GA 4UVHA 1F5SA 2N47A 1TKCA 1E1NA 2A35A 3PXCX 3TQIA 2R11A 1BYIA 1PR1A 2J9ZB 4KN5A 5E6UB 4N0EA 5DN6D 1IK4A 1TRKA 1KO1A 1LLQA 3T94A 4E30A 1XQVA 3F0TA 1LBIA 1EP1B 2Q7OE 3HBMA 2L82A 8ICMA 5EZSA 3LF1A 5E7QA 2X14A 3MILA 3GROA 3VH4A 5FV7A 1NFFA 2HF8A 1NYTA 3LWMA 3PTAA 3HRDD 3NT5A 3E82A 2BCRA 1TKDA 4XQEA 3M34A 3SKXA 2R00A 4WX2B 2KSOB 1F44A 3G0HA 4L75A 3O2QB 3BSYA 2EL9A 4YJKA 3AF3A 4EUKA 2J3HA 2GCGA 1ECFA 5C7OO 1PV2A 3KZKA 2M6LA 3P9CA 2C7OA 4X3PA 2VHTA 5JU6A 2DSTA 4S2EA 3TECE 3TDMA 3U49A 4G1MB 1RIIA 1VC2A 1EMDA 2IPNA 1DFHA 2HRDA 4LE0A 5K8JB 4RNNA 2RC6A 1E2IA 2FPWA 3MBYA 1VGRA 5BV7A 1C9YA 5P8WA 3MSCA 2GHIA 2RHLA 4ESOA 1YD7A 4PN3A 4RZSA 2VJQA 3A0UA 1JAHA 3G68A 1UFOA 4C4TA 3TYXA 1T8UA 4NY1A 3GGOA 3Q0IA 3RF7A 4LE1A 4NCBA 5DX8A 1YZTA 4AT1A 5CB4F 1Y3IA 1T5DX 3G2HA 1N1MA 2QLJA 2YX8A 4EM6A 3H84A 5B4VA 5A9RA 1E1LA 1HEIA 4NMHA 4YX9A 3HWTA 4GLFA 2WJGA 3E0QA 3R0ZA 2C2MA 1U2GC 1SAYA 1YT5A 1Z06A 1KKMA 2B69A 4H1UA 1UM9B 3AINA 1ZJNA 1ZQLA 4NLKA 1AB5A 3VHQA 3AW9A 2BEKA 2QP4A 2QRVB 1DEXA 3NM4A 3IVCA 1A0OA 1CP2A 3MFIA 3I37X 1WHTB 1AT1A 4ESHA 2JGLA 3EDOA 3TN7A 4YJGB 4OREX 1XQ9A 5FL7A 4LTNA 3HRIA 4WASA 1E1QD 2IYXA 3WDMA 2BMAA 5ALHA 1U7DA 5HNKA 5CFZA 3THXA 3VU8A 3Q7PA 2D0PB 4JL6A 7ICTA 3BHNA 1CX9B 5JEDA 1R9JA 1T36A 1SZJG 2CHVA 5EZYF 5KT3A 2VHEA 3F90A 3UBMA 3UK0A 4D4IA 1QGDA 4JUFA 2GZ2A 1JR4A 4TQUS 4PGXA 4PSKA 4BRWA 5KI6A 1JQBA 1VRVA 1C1HA 4NCKA 1D8TA 4QOHA 5BOVA 4CDMA 2QD2A 1EVZA 2PS0A 8ICNA 4O4HA 1VCNA 2VDWB 4BO8A 2F76X 4GBJA 1P6QA 2HRQA 1QIMA 1W4LA 1JAZA 1GM5A 1HNWB 1IJEA 3BCSA 3IHQB 5B37A 5EJAA 1DLIA 4XWYA 4Q7QA 2C2HA 4TT3A 2ZRBA 4KQ6A 2ZSEA 1NI5A 3OLXA 2QD3A 4C0LA 2XUQA 2AKYA 4HUJA 3DBRB 2ZUEA 4UTNA 3BFJA 1AG9A 1ZICA 4KBFA 4UNNA 5IUNC 4B34A 2FWRA 3UC5A 1PTJA 1NKVA 1YS6A 3IMGA 3MINA 4MS4B 1KI3A 5EJ9A 1N75A 2H5XA 5DM4A 2FR0A 3RAQA 4RMHA 1T1RA 5A4KA 2P30A 2JVJA 1G2IA 4GD3Q 1X7YB 4GGMX 5HCNA 3WDLA 5JBQA 4M9XA 4Z6FA 3O21A 1W52X 1TV9A 3EMDA 4WZBA 5E4TA 3FI0A 1FYXA 1T8WA 5IKXA 4L4ZA 3NWBA 2DHEA 3W5BA 8OHMA 2W43A 5LUBA 3OCWA 1JW9B 3BRWA 1PT8A 2CXSA 3DYIA 2PNFA 2R8JA 4YCAA 4CBVA 1JHPA 1ZJYA 4UM9B 2A1TS 1NW9B 3HNPA 2AJDA 1NQOA 5F51A 4HAWA 1C1DA 1Z62A 5EPOA 1Z37A 1E2PA 1Q3KA 4MRSA 4CLHA 2P6NA 4F8RA 4RULA 1VXOA 5JRTA 1R0BA 3KZMA 2I87A 4DLNA 5KYVA 4MIKA 2P2SA 4E09A 3OHAA 3DGFC 4QHSA 4J94A 4X6YA 4CLOB 3DE2X 3D4PA 4RETA 1TDJA 1VDVA 1NP6A 3TSYA 3AKCA 2AS0A 2ZBRA 3IQFA 4UFNA 5IAAA 4QIWC 2QTGA 2O48X 3VR5D 3SGLA 1JR3E 3H1PA 4XSHA 2HMUA 3SLKA 3DZJA 3NVVA 2QTBA 5IDQA 1GADO 3C43A 3CR8A 4E1AA 3ZVMA 4E5PA 3KE9A 2HBKA 4AW9A 4KXFB 2PANA 3IB3A 5A6SB 1GPUA 4IJ5A 1U0EA 3GEEA 2DWUA 3CEAA 1IM4A 3PEEA 3M9OB 5JI3E 3Q8SB 3RS0A 5C1IA 4OI2A 3T5HA 1J8VA 3E3AA 1NUSA 4MZXA 7ICGA 4XKJA 2WF5A 2BELA 3RS3A 4XRRA 2ZI6A 3K9FC 5JAZA 3GX1A 5IBPA 3RRFA 3LO8A 4US0R 4G0UA 2PU7A 3TLGB 3U56A 1DP4A 5ALTA 4CG1A 4TWJA 3NHAA 2PUHA 5LQKA 1GTG1 4ZYWA 4W7IA 4UTVA 4DCJA 3MZ0A 2KVSA 3SQOA 3TZBA 1ZH8A 1OYOA 3L6BA 3LK7A 1JEEA 1REQB 4MQFA 3G7SA 4OFZA 4JJ6A 3FF4A 5GM2A 3F6RA 1LV8A 4QJFB 2HWYA 2ZSJA 3M4XA 4UOQA 1UZLA 2EKBA 5B53A 3TSAA 3EY9A 3EVCA 1UKAA 4EKIA 1UT5A 2RAFA 3M1IA 2AJ8A 5G4KA 2Z6QA 4ZVSA 2LTAA 3UG7A 1W75A 1VI2A 1ICIA 1KMQA 5BVGB 3OSZA 4EHKA 2CLKB 3CF0A 1E61A 1XXHB 2VK1A 3PNSA 2EBUA 1MMFB 3PMNA 3DEIA 1V3UA 1H1LB 1RHKA 4PIMA 3QFSA 5I8PA 1CUSA 4POOA 2GWRA 3IMEA 1HURA 1E9SA 4KR6A 1RKUA 1VMAA 3KUXA 3FMPB 1FSSA 1GNRA 1YFJA 4G1UC 1Y3BE 4WAUA 5KYNA 2AWOA 4JEHA 4KO8A 8ICFA 5JEEA 4ON9A 2C61A 1SKWA 3RU2A 1X9GA 2IQIA 1V71A 4RM3A 1WDWB 4TMKA 4A6XA 4Z4QA 2AG1A 2DL0A 1KI9A 3GVIA 1K8QA 4ZYUA 5AVOA 1ADBA 4IXMA 3G9UA 5IAOA 1IBRA 1MC1A 4U2GA 2BQUA 2EOAA 2B7BA 2EATA 2HA5A 4HFJA 3K6RA 4DM3A 4J0IA 3P2EA 1SA0A 2FPSA 3MYYA 3GLRA 4F4HA 3WYEA 4UAVA 3LLCA 5FTWA 5FB3A 3AP1A 4WKGA 5B1SA 1KEJA 1S8FA 3PG5A 1SQ5A 4L5BA 3SC3A 3OP4A 3NTRA 3CZMA 4RO0A 2EJCA 1GHTA 4DMFA 2FWJA 4LYYA 4CKBA 3NAQA 4CNQA 2H2FA 5HFNA 4NONA 1QTNA 1IEXA 4H7EA 4MHOA 5K2OA 2J45A 2WYHA 3FMIA 4URHA 2IHJA 4XB1A 1KTQA 3DOHA 4XCQA 4J9PA 2AOWA 4LOIA 2DFPA 1EWYA 3L7KA 3GAFA 3BQ2A 1OH8A 3WWEA 2R60A 3PP8A 3PITA 5J1TB 1DQRA 2XMCA 1HE4A 2Q21A 2YFHA 3FUWA 1T6NA 4K87A 2EJTA 1Z2OX 1IHYA 4JA2A 3C5WP 1RQXA 1VHTA 3PE6A 4TRJA 4TSRA 1Q7BA 1VKZA 1U0TA 3UXPA 2XWPA 3LSTA 4HGZA 1TIPA 2JJ1A 2Y9TA 2HY7A 3FOWA 3GEGA 4I14A 3AMZA 2CUZA 5AJUA 2DQSA 1B6SA 2FF7A 3JYPA 3U4QB 1QH0A 1ZCFA 4JI1B 1U2RA 4HI0E 4IXDA 4Z1OA 3H6HA 4CMCA 2YWEA 2A0FA 1A8QA 3TKAA 4ZP1A 2GCIA 1GFWA 4JT8A 1NPTO 4QRDA 4O4HF 4EJ0A 1QVVA 2VCEA 2VSFA 4C05A 5C53B 2P3QA 2LGJA 1T9BA 2B8TA 5L51A 3VTAA 5BWLA 4L6CA 5KYTA 4IQVA 3PXAA 2UUBB 2JJMA 4UAWA 1E62A 2QTRA 3QZ7A 4G1EB 3A04A 2JLQA 4W82A 5CA7A 5DULA 1CQXA 2BBWA 4KPUB 2ZIXA 3O3CA 1AY0A 3A9RA 3K72B 1GG5A 3BQNB 2ZW9A 2B3TA 4RKEA 3TRHA 3L7NA 4O0MA 3D8RA 3BWXA 4U9UA 4YJ2B 3VHLB 1OFTA 4RTSA 3V6LA 2PZGA 1YJXA 3LBNA 1S0VA 2IS6A 1U0LA 3ZWWA 4UHDA 4O63O 4LMRA 3NWEA 2XWBF 4KLZA 3JZFA 3B9PA 3EHEA 2V7WA 2EGHA 2QMEA 3L4EA 1GQ2A 3PD0A 3CX7A 1WXWA 3ECCA 5L1IA 1WETA 5HQ3A 1VFNA 5THKA 3DA8A 1RWKA 2WG2A 5EOVA 4TVOA 4N3GA 9ICNA 4B4WA 4LF6B 4KQMA 2GD0A 1MO6A 3QRWA 2PUEA 4DZZA 1Z6YA 5DK6A 4YRRA 3WADA 2QTVA 3PHBE 3H6KA 2VOJA 1NK5A 2NNWB 3UGQA 2D8AA 2COKA 2Y1JA 5K0LA 3WKDA 3NNDA 1TUBB 4TSFD 3M8RA 2WNIA 3L0IB 1YQTA 2AZTA 3UB3A 5L3RA 1X77A 3ROXA 3CLUD 3P9XA 3VAAA 3RT7A 2IYSA 5DBFA 5IILA 4GOOD 1XC7A 4HB3A 1R10A 4WOPA 4WEOA 3AV0B 3TIFA 5KSZA 5C31A 3LC0A 2VJPA 2QT9A 3HBAA 3DBVO 3S81A 3DHWC 3KSUA 4O5KA 3T7SA 2IS4A 2F90A 5ALRA 1QVZA 4Y1RA 3RJEA 4QWDA 1QIFA 4QUDA 4DRXB 3W2HA 2IU0A 2XMPA 5KG6A 1YK1A 5K3CA 2K7ZA 1JLRA 4BMXA 3ISDA 2K4HA 3UOWA 2WD8A 4B45A 1PR0A 8ICJA 3FRHA 4OL0A 3I6QA 4D2IA 4KK3A 4KHPB 2ZUSA 1HOTA 4P0PB 3OZ7A 4WBNB 4UU8A 3AVOA 1G60A 4ZHQA 4JLMA 2FUCA 1SHTX 3B3AA 2DFDA 3HCRA 2H3HA 1KOFA 5EXPA 2OGUA 4OEHA 3F8TA 3C1ZA 4GWLA 2F8LA 3PSAA 3L7MA 3B0XA 4ALLA 2ALZA 3NHUA 4LZGA 4LDNA 2QRGA 3QSGA 2P3LA 1ULAA 4R1QA 3PI6A 2Y76A 1M76A 1UMKA 4P32A 1CZNA 5ANRB 5JZSA 4J0FA 1Q22A 4ARCA 3BJRA 5CVVA 1R64A 4UM9D 5FOUA 1UDAA 4NR0A 2P66A 2QMZA 2PBFA 5F9LA 4LQLA 3PDHA 2H85A 1DAPA 1YL7A 3FBGA 3WFIA 1NN1A 2FE4A 2WINI 3QU4A 3U4GA 3IM1A 2GK7A 4KTTE 5KL1B 4BO6A 3UMJA 1PFKA 4AG6A 3F1KA 5FTLA 1DAOA 2XJ4A 1F6DA 1PTJC 1T2CA 3IOBA 4PZDA 4QFMA 2DLCX 3OKPA 1ZYQA 2HJ9A 3F9RA 3LBIA 4WEQA 2ZJ6A 4RFVA 2JGKA 4P86A 4K9DA 1N3YA 4LJKA 3K20A 2AN5A 3VO8A 3F6BX 3IAM6 1UOPA 2PZAA 4TLCA 3I9V6 4ITRC 4RQAA 4NS4A 2BKLA 3IP5A 3C1AA 3BBLA 3L4JA 3VNSA 1FUIA 1IUPA 3L4SO 4EGQA 1OX4A 2DBRA 4ECYA 4Q3NA 2A0UA 3AM5A 4HQRA 3V7NA 4B79A 1VJ0A 2VJ5A 5AXDA 4ER0A 3WIDA 3AF4A 4EMSA 4GKKB 1RYFA 3H5VA 1UPAA 4IICA 2XPCA 3QYPA 1GYPA 2XXBA 3VHXA 3IA2A 3Q8XB 5JZOA 3GUVA 1IU9A 1K7XB 5KT2A 1P9NA 1BTOA 4NYIQ 1THTA 5HTOA 4EF4A 4N49A 2IH2A 4GOKA 3WHKA 1ZIXA 2ZYRA 2ZAYA 4G1BA 5IASA 4EUNA 3CGWA 3RTDA 2P6RA 5DXAA 2B4YA 2KI5A 3W2IA 1DG3A 1P2UA 2Z2IA 4W5JA 2QKYA 3KFXA 1JIIA 1SV4A 3OEHD 2H0AA 3KTQA 4NXNB 2EZYA 2VQDA 2ZI9A 1VPLA 3NBZC 2P68A 2E1PA 1XVUA 4NG5A 2IX3A 4QO7A 3E0XA 2HX1A 2F3QA 3OZXA 3GRYA 2W9CA 1K5PA 4FTWA 1GFIA 1VSUA 2XMDA 4BQQA 1B22A 1MV8A 4R0VA 4TZTA 4A15A 3TBHA 3ZGLA 2BPOA 1QHGA 1L9KA 5BR1A 2BBSA 4MJ7A 2J09A 4QDJA 4D41A 4BIIA 1M6YA 4R64A 1WU8A 1A69A 2QAIA 1XJQA 3L6DA 5ESXA 5IBCA 1J8FA 1SWWA 2H0RA 3OJXA 3KYDA 4IIJA 4YMHA 3ZBTA 4MYTA 4FHEA 2Z8ZA 1NOMA 5A7GA 3IE1A 5KVVA 2ZJ0A 3KFLA 1YDEA 3E81A 4GP7A 3LXRA 1PVPA 3IILA 4EB0A 4BVJA 1RQ7A 2C1XA 3L6CA 4AUKA 1G6Q1 4DJFC 2PH7A 2ZUVA 3OX3A 1E96A 1Q11A 1AC5A 2Q8QA 1O94A 1TK8A 4MITA 1NBMA 1OAOA 1P1JA 3V7YA 1JIJA 1QIDA 1PL8A 3M7IA 4QE3A 1E1RD 1NXTA 4E5DA 4CKCA 4LDQA 2PUJA 3RWOA 5BN1A 4CMEA 1U0RA 3QTLA 4R0NA 2NUTB 3N8IA 1GTL1 1YA8A 2FZEA 2YW2A 4RJ2A 5ALLA 4FEYA 5EWJA 3LIPA 3GLHB 8ICQA 1Y7TA 1P77A 5I7WA 5JCXA 2H08A 2J08A 2ZRFA 1DPFA 4QYTA 3OZDA 4DMGA 3KKNA 4ISBA 4PM4A 4BVLA 2WTAA 3PCTA 1DKQA 2KVCA 4BTEA 4JMPA 2H3ZA 4NYMQ 3WLPA 3WHLA 1IG6A 1QHNA 4LJRA 2WAOA 1FBTA 4B31A 5CLFA 3SXJA 4D9NA 1CETA 4P0QA 2F55A 4B3MB 4PC6A 1TW2A 3EGXA 2C4TA 1KR5A 2NSYA 4IIYA 4ZARA 4LNUA 4OJPA 3MRVA 4C0KA 4FS8A 3DLAA 2GVZC 1I2BA 3PD7A 3I2FA 2YJ5A 2HO4A 5FYQA 1P5HA 4GL4A 3Q8KA 1O5IA 4GXRA 4PZZA 4RT2A 5IIMA 3UJHA 1I3OA 5DK4A 2V5UA 4RHYA 3T9FA 2C22A 4FKZA 3K9QO 4D9JA 3ECAA 3RYFA 3LYHA 4C7KA 5BYJA 1E3MA 8ICBA 1IXKA 5EERA 3TG8A 2JI7A 1CRLA 3PWTA 3B3JA 4QNLA 2PH3A 1PHRA 3DGEC 5EKXA 4G1CA 4CDNA 2FPXA 2O23A 1YMVA 2ZFUA 1BA2A 4A0QA 1RQGA 4Q3EA 4ER3A 4R83A 5TVKA 4FYPA 4B85A 4MEJA 2XZOA 3MWEA 2E0IA 4OJOA 2SKDA 2MAXA 4HLNA 1ODLA 2VWHA 5CJ7A 3PEVA 3BHJA 3EXG1 3T4EA 3RS9A 1R9MA 5JSZA 1SQSA 3USZA 4K8RB 3R4VA 4CEJA 2NTJA 3F4BA 1YB5A 3ER9A 1Z4IA 5FOVA 4E22A 3P4UA 5F73A 4G2NA 3VOBA 1T9GS 3TPFA 2I3GA 4KXNA 5B1HA 1N6OA 2DT5A 1OWMA 2I1LA 5IFLA 1E5LA 4GSYA 2FI1A 1BZYA 4PGYA 1CIPA 1K0UA 4NE7A 5WRFA 2H51A 1Z5OA 2W8KA 2NZXA 5HYVA 5KFJA 4MDFA 2FK7A 3GPBA 2GH1A 3KZ1E 1M8JA 4FO6A 3DVAA 3QI7A 2P8JA 4E46A 3NYRA 2ZWVA 2IEAA 3B7WA 2V6FA 3TTTA 4UCQA 2C07A 4DCMA 2HJRA 2IWHA 3QFHA 3T12A 1ZRSA 2OKGA 2HF2A 3MS4A 2D2FA 5EE1A 1X70A 2VDMB 3PNOA 2ECQA 5FAKA 4CIVA 4EHAA 2F1KA 1YACA 1J56A 2J48A 3P0FA 5TVGA 4YCXA 2YNMA 1YHNA 3OIVA 5AR1A 4Q00A 9ICWA 4H27A 3ANMA 1IQRA 3NKLA 4C0QC 4RDXA 3L0OA 1T5SA 3O9MA 2C2DA 1Y3CE 3CNBA 2Z08A 1UBFA 4PLYA 4J6EA 4YR7A 5CVJA 8ICWA 2OG1A 5EFOA 3DAHA 4N54A 4BX9C 1V9CA 2EKLA 1VIVA 3TTVA 2I7TA 4J1QA 4I2JA 4ZHQF 4X1KA 3VNQA 2B2CA 3GRAA 1DXOA 3FAKA 4I6JA 2O6KA 2Q46A 4ZCIA 5KNBA 1JVNA 4BNXA 3A7EA 5G0UA 4AECA 4MQMA 1RRKA 3SENA 3QWAA 3R76A 4J49A 2EYQA 2FUNB 1FFHA 3PF9A 4LY6A 2F44A 2W6JD 3PGXA 4EW1A 3VRHA 3NHLA 3OZTA 3THSA 4OSOA 1J4AA 3E48A 2W11A 4X90A 1BHJA 2DY1A 3K0SA 1W0KA 3MMZA 3D64A 3RIXA 1V9LA 2G09A 1WXQA 2GLTA 4Q3KA 4IDEA 2VUHB 4OB8A 3SDSA 3WJ1A 3SD7A 2ZE7A 2XICA 1P3JA 1NYRA 4OYHA 1DGQA 1A9OA 2VAMA 3ALRA 2ACVA 1UXGA 1CZOA 1V7CA 3C1TA 2KG5A 4MKXA 2YJTD 4WA7A 2J3EA 2W8LA 1MABB 4QXRA 2X13A 2VA8A 1XNQB 4EPVA 1WWVA 2B78A 2OAP1 3C2QA 5G0VA 4GEGA 3OHBA 1IN6A 3WLNA 3P0IA 1CF4A 3O2SB 2DU8A 3ETEA 1ZQZA 2GXAA 2JBAA 2A4MA 1SOVA 1UFKA 3JQBC 5FTNA 4IF6A 4MP6A 2ZRIA 3UATA 3N53A 1JKFA 1X15A 1QVAA 3CBQA 3GFVA 2C8VA 5DSXA 2H16A 3DDSA 3JAWB 4PYIA 4LS3A 5I5EA 4Y18A 3MTQA 4DWOA 2QW1A 2Z3ZA 4DO9A 2CXYA 1CR6A 3M6WA 3ZDRA 1MZVA 2LKYA 4WNAB 1E4YA 3MAJA 2W90A 3FJOA 2QAGB 1MP0A 1X38A 1PV4A 4HQLA 4DZRA 3RB6A 3H0MB 3EQ6A 5H1YA 3VDXA 2W6ZA 5J2CA 2J0VA 3EYAA 3GEHA 4ALNA 2Y1DA 2QIOA 1N6IA 5HKLA 3I2GA 3HP4A 2ZIZA 4UOEA 2H1CA 1E58A 2TSYB 3P2YA 1DU4A 2XZTA 1OB2A 4H7HA 4I3HA 1U48A 1E2EA 1YZHA 3WLEA 4IIJF 2Y0EA 5CA1A 2XCOA 2MUTA 3DBLA 1MX9A 1YNOA 1C9MA 1YV9A 4INZA 2JJYA 5BUZA 5JMOA 4W6QA 2G25A 1PT5A 3G3EA 5JPCA 2FJPA 1QO9A 4FBMA 4IQWA 4F21A 4RF5A 1XZ8A 4DLZA 3KQVA 3U1TA 4MX8A 1CJUC 2GOYA 2AOXA 4RSRA 1VG1A 4CVNA 1XB2A 3RS4A 4DA0A 4RDCA 1D3AA 5DM2A 1DT3A 2FA9A 2E49A 4NLBA 1QKKA 2A9QA 2QVYX 3DAFA 3AR8A 1H1TA 4ND2A 3BE8A 1E98A 2QGNA 2QVBA 3KBBA 1RACA 1WNFA 4DZTA 2QE6A 2BHLA 3C1YA 3SYNA 1KTVA 2D7CA 1AKEA 4D4GA 3GF4A 3Q10A 3C2MA 2OHOA 1F5NA 2Q5FA 1IM5A 2XUFA 2CXHA 3VOSA 5H83A 1A3CA 3T5BA 5EWEA 3W79A 4JBNA 3WGVA 4FM9A 2QRHA 1ZNXA 2YQ4A 3QV2A 4M37A 3OZIA 4MI1A 3DE1X 2DHRA 2WYIA 2JXJA 1MB3A 1ZQ9A 4M2LA 3OOWA 3FAZA 1CEZA 1KJQA 2IUYA 5C5JA 1AH2A 1C0PA 4OKNA 1MW8X 3UJNA 1KWKA 4AZVA 5IMSA 2HSZA 3FM9A 4UW9A 4XH9B 5G0TA 1SHKA 4UVIA 1ZD5A 4EOGA 1LXCA 3JPRA 3BB4A 1U3UA 4ZEMA 4GMGA 1QOPB 3ZWPA 3UMFA 4M9NA 1LTHR 5HIKA 4JP2A 5J2IA 3P97A 1ZL0A 1KRWA 2BDUA 1VYVA 5EIEA 4C88A 3COYA 4QOGA 2FAXA 3RJ9A 5FQNA 5CLGA 5EMNA 3MTAA 5DG7A 4ZREA 1SKRA 4DPLA 1ZQOA 4MYDA 4ML3A 4TT8A 1O9HA 4LXUA 4QDXA 3DOOA 4KXMA 3LD9A 1AB6A 3R7NA 1X7WA 4JLOA 3LDHA 2ZYGA 4S2UA 3OFSA 1P2TA 2QUAA 2BZ1A 3EXFA 4UMVA 4K9LA 3R5SA 4HZGA 2H52A 2DKFA 4TL6A 2CZQA 4UBNA 2ZJBA 1UANA 4YP5A 2JCVA 2V7QD 2HBRA 5EZYA 3YASA 3LCCA 4WXRA 4P9NA 5LDDC 1C7RA 1M8PA 2HYIC 3HDQA 3PC3A 2GPYA 4G6ZA 3G2KA 4PSUA 3FB4A 3GRZA 3TVDA 1TKRA 3S2SA 1NZJA 3CN9A 3IQXA 1YB1A 4X8MA 1RVDA 1JQJC 2EWWA 4TLEA 1QGUA 3OIUA 4XVQA 4HQ6A 3TVYA 3N2KA 3JQCA 1O94C 2GHQA 1H6DA 4QWCA 3QJYA 1BH2A 1ONPA 3NAZA 2HIAA 4DQ0A 4GMXA 3PW4A 3P9SA 3GIKA 4REQA 1ZOOA 2GD2A 1ZRMA 3BCRA 2FE1A 5LA6A 3ROZA 4CMEC 3RUIA 1JMYA 3OLWA 5KG0A 2B1QA 5J2JA 2HLDA 3E22A 4C6TB 5B3LA 1T6BY 3EWIA 3FGPA 4UJ5A 4ERXA 1K1QA 1FVOA 4DR3B 2GAJA 2ZYHA 4PS0A 3B1WA 2QVCA 4B47A 4GI1A 3VPCA 2AZXA 3VO2A 1Y9DA 2EFJA 5TQ2B 5COBA 5I47A 2YIDA 1NJ1A 3SSNA 1P0PA 1BW9B 2WUDA 3AETA 4YPFA 3WWYA 1R00A 4JR2A 2QTCA 3IB6A 4BQRA 4KUHA 4RNDB 4QBIA 3HB0A 1SWVA 2P9BA 1BSVA 2VHYA 4RUKA 2QTZA 3WYGA 4I3FA 5CD1A 3AJRA 4RPLA 4W5TA 1UMDA 1EK1A 2OCAA 2WAMA 4JQZA 1A4RA 1ZJZA 3DFFA 4JJKA 4UAYA 4R4JA 3WZ2A 3OBIA 1YQWA 2F1RA 2XWQA 3AR4A 5TS3A 2CL7X 3T15A 1LNQA 3PFHA 2YVAA 1KI6A 5FJIA 4WDQA 2E5SA 4DLYA 4WZAE 3FTDA 4X8OA 2RJOA 1QP0A 4YNBA 2AZMA 1DQYA 4H0NA 4O2AB 4AI6A 1K7SN 4DQXA 2BGLA 3K1RB 1CEYA 4YC7A 4ZRNA 4J90A 1XEAA 1KEPA 2VNIA 2ZBGA 5FWXA 4FR2A 2O0LA 5BNFA 4TS3A 1U45A 5F7ZA 1DOQA 1QB8A 4XDYA 4I2HA 1YB7A 4DSKA 5JXGA 4L28A 4QLAA 2YMMA 4CLEA 4DV2B 3PUVA 4D5EA 2WYOA 3AHGA 2IT1A 3C4JA 1Q15A 1G8JA 2AHOB 2V4RA 1PSWA 1SM4A 3L7DA 1PL7A 4EITA 1H3EA 4EPWA 2IXFA 3AVPA 2CLLB 1VSQA 1E9BA 2YWHA 3AVQA 4HATA 1QWOA 4JT4A 1P5JA 3IG5A 3ZW9A 3UHPA 3KTAA 4DV5B 4RH3A 4JT9A 4MMZB 2O05A 4I3GA 1QFZA 1DCFA 6PFKA 4TLDA 4Z5XA 3R77A 1F60A 1RHUA 5DDMA 4C3VA 4JASB 1M1YB 1WQ3A 5BXQC 3MB5A 4G4SO 4COOA 4AF7A 3MGBA 2HCFA 4EA9A 1QIHA 4RK1A 4DPMA 1LPMA 2AW5A 2EG9A 3H5LA 1P4HA 2O0KA 3L41A 4JWTA 3OTHA 3RF6A 2GM3A 1ODFA 5EKSA 2NZ8A 4E14A 2IY7A 2X6TA 3GLIE 1KP3A 2ZAOA 1DPGA 1FFXA 3DJFA 5JARA 4KQEA 2HK7A 3HZRA 1RM3A 1RPZA 4GXJA 2EGGA 4MROA 3F3KA 1F2UB 5C51B 2PJUA 1P5RA 2YNMC 4G8BA 3EODA 1IZ9A 3S1AB 5I3CA 3NW9A 2KSQA 2R6FA 3B6ZA 5JNRA 5DT9A 3G8AA 4KDEA 1Q92A 1DS6A 1ZC3A 1UBSB 1TF5A 2I4MA 5IINA 4DIKA 1A7UA 2H29A 5LD2B 4UHCA 4B3BA 2OHXA 4EY7A 5J4YA 3KLPX 4WXHA 4D0SA 3GJ8A 1BRMA 1G8YA 2TMKA 5CYOA 1EE1A 5CA1F 3JD2A 4JD5A 4JSTA 1G55A 2L2QA 2ZATA 3RANA 4OLAA 4KQFA 1RXWA 3K96A 4TXJA 3A27A 1GQSA 4ETWA 2NV0A 1M6HA 2FSUA 1HJPA 3GARA 3V1LA 1E2KA 3H5AA 3ZK7A 1TPZA 1A50B 5IT0A 2IH4A 3V4VB 2X5XA 3WMWA 4KQXA 2FFQA 3RUEA 2IBSA 1PZXA 4FBTA 4QYIA 3N2EA 2V4MA 3R20A 3FKSD 1Z8DA 2B20A 1CJBA 1W73A 4A4DA 5FIUA 1OYYA 2FPOA 3FRIA 3VYTB 4TMTA 2GEVA 3UGJA 1QOQB 3ZQKA 4PLZA 3KZVA 3EA5A 4E33A 3C5GA 3H0CA 4ZYTA 1C81A 5K0FA 3DKPA 2AEJA 4DRYA 4EB6A 2ZBUA 2FU5C 2FPLA 2WKQA 1QX3A 1UOEA 1YDHA 2LIVA 1D2HA 2KX7A 3UHFA 1U0HC 4HDCA 1I32A 4ZT7A 1DEHA 1RMYA 3K0CA 3EDYA 1ACJA 2RCNA 3USCS 3DF7A 4NCNA 5ALKA 4EL5A 4JOSA 2QT1A 2QN9A 2C94A 4XUSA 1Y5RA 5ETJA 5EQFA 1GNVA 4XX1A 4F8YA 4L7VA 2XUOA 4R9UC 3MQ2A 3JWHA 4AKIA 5FEMA 3GT3A 5J2KA 4U2KA 1IZYA 1U7TA 4MARA 4ALJA 2V0NA 3QXSA 2BE7A 4JYZA 4FB4A 1KEZA 3UK7A 3W06A 5A2QA 2BPCA 1K6MA 3IC5A 2AB0A 5KDOA 1NJGA 1AQJA 3UB2A 1F0KA 5MN6A 3Q8PB 5E9AA 4C0SA 4U5XA 3B78A 1M9NA 3TZ6A 3VV3A 2HHVA 3L02A 3SIPA 4ACOA 1S0NA 4ZALA 4BVFA 3R6GA 4MHVA 1ZP6A 1DQNA 3W34A 4HX2A 4CODB 3D3NA 5KFUA 1QO0A 1OWOA 4UTRA 3QXCA 2HGZA 3ZNOA 1DCTA 4J0QA 3QX8A 2O8CA 3VR4D 3OWHA 3RIMA 3HCAA 3KZXA 1N9ZA 2GYYA 4AN4A 1NXQA 2PX2A 4OIFA 1XMJA 4I2NA 5DPMA 2QD4A 2P5TB 3I53A 2A9PA 1NF8A 3JAKB 1UP7A 7ICSA 4F5RA 3VU9A 3AY6A 1KK2A 3SK0A 3T7TA 3JQEA 2YHBA 4Z0PA 1N3BA 3BEOA 3CZ4A 2UZIR 4K0RA 1JXLA 3PZPA 3IDAA 2ODTX 4IDDA 1UC4B 4LXGA 1N0IA 2HJVA 5DZSA 1NURA 3NFYA 2PLFA 3LFHA 3FWNA 3DQQA 5JG7A 1HT1E 5LMCA 5DHTA 1T4GA 5LA6F 3KOXA 3H1GA 4HQ0A 4U6PA 4XGIA 2W2MA 4RIGA 5GONB 3DB1A 3MGAA 5CP2A 1SOAA 3U62A 3JSXA 2G1UA 1SXJA 4TMYA 4ZKDA 4N3BA 3CISA 1V8BA 7ICMA 2H4YA 1ZX1A 4YRFA 3UH1A 4X20B 3NKVA 3WAKA 1K8XB 3DFKA 5IUJC 3CUYA 2JV3A 4QBKA 1KOJA 1UXKA 2EHDA 3IODA 4IH9A 3H7AA 2CFOA 2FZGA 5G53C 4LTDA 3RVKA 1AS0A 4ZVOA 1YRHA 2ZIWA 4BVGA 1K98A 1O6GA 2W8BB 1G2PA 3EDQA 4I4CA 4PYMA 1YAJA 3PUWA 1TRHA 4BL5A 3JTEA 5CH3A 3EPHA 3EIUA 2O2EA 1ZEJA 3ABOB 4Q66C 1S5LU 2O5EA 3TW4A 5A3QA 3S7ZA 4YCMA 4TL9A 4V0SA 4TV8A 6NULA 2Q2WA 1OI2A 4V1CA 1V1MB 4B2YA 5FOWA 3TOZA 1IDN1 3L7AA 1YQEA 3NGLA 4OQFA 1EFDN 1UADA 2GN9A 1P75A 3VGPA 4FFDA 1T9KA 5G1PA 5LP6A 5L1JA 2FLNA 1C29B 3H3FA 1DAHA 1ZOSA 1VDZA 1L5NA 3GDOA 3MJRA 5TQ0B 4DIBA 2HEGA 3NGMA 1UAGA 3U31A 3P0RA 1DKNA 4A8JA 4A8EA 1AX9A 1AHNA 4Q12A 4V0ME 5DMHA 1E3TA 2HUNA 1Q57A 4W4TA 3L6EA 5G41A 2HI0A 1I51A 1Z83A 3OUZA 4DSUA 1YOVA 4KRYA 1X8KA 3C6KA 1SU7A 2PTGA 4DJJA 2OBXA 4IIDA 2JHGA 3NCHA 2FMIA 3B1YA 3PKZA 3L7LA 4EG3A 2JRLA 3RTVA 5HR6A 1VBKA 5KTMA 1JIVA 1UBGA 3MPOA 3TLYA 4FD3A 2Y1IA 5B57C 1JLLB 4XB2A 5I9BA 1M2OB 2F3SA 3O90A 4DABA 2DOKA 4O0IA 4QT4A 2VAXA 2NYRA 1YDGA 1UFRA 3K05A 3QXJA 5G5HA 4Z7NB 3BA6A 4QQRA 1SKYB 5IYZB 4JI7B 2YFQA 1S3SA 2G36A 2CSXA 4E3ZA 1GGHA 4BGUA 2ASJA 3IT2A 4IZHA 5E38A 1XNHA 1CJVC 1W85B 1ANKA 1BDIA 1X7ZA 4NU0A 1HIWA 3SIRA 4JIMA 4LJ4A 2D7JA 2JGDB 2LMRA 3BXEA 2YICA 3OMLA 2WSLA 3HN6A 5M7EA 4LDZA 2OV2A 4H3KB 1E1MA 3PD1A 2Z1MA 2AI3A 4WNIA 1ESDA 1JHXA 3QH4A 1EG2A 1ICEA 4DCTA 5LIPA 1NVFA 3IT1A 1GU7A 1DRUA 4IPTA 4P34A 1RU3A 3Q9UA 2YJNA 4DDKA 4CLRB 3BWVA 3EHDA 1I0IA 2I65A 2Z3WA 3CVOA 2IJGX 4OI1A 2X1HA 4GSLA 5MF6A 4IQTA 5DGHA 3STHA 3UTCA 4MNTA 4LSZA 1EEXB 4BVEA 3ORSA 4U8GA 2YWFA 2C04A 5ALSA 3ZE9A 4NABA 1QH1A 4R1SA 2X3UA 5I7OA 4P1ZA 3D6UA 2IIPA 2IXTA 4NJEA 3ZE6A 3WB0A 4AP6A 1T0PA 2AFHE 3VC8A 3QENA 2FMSA 3DE0X 5DTRA 5G4LA 4ZAYA 1TK5A 3WLFA 1GO3F 4QBHA 3QVWA 3THVA 3EAGA 3V7FA 1L3BA 3FZNA 4U5QA 1GR1A 1PX2A 1PD1A 3OQ1A 3KXLA 3D8BA 1LPAB 2CD9A 2H2IA 4A5SA 3PHCA 1GRNA 4EJFA 5AI8A 4KFRA 1D1PA 5JXWA 2NNLD 1P2SA 1JHQA 4WLOA 5JO9A 4UUBA 5F7OA 1FFGA 3HA7A 4GZLA 3SVTA 2C54A 5KFEA 2JK1A 3Q1KA 3H4DA 4J1TA 1QSGA 2XAUA 1DBVO 4L0CA 3CG0A 1CZLA 2OOSA 1NKEA 2QXUA 3AZPA 2EKDA 2FP4B 4U0KA 3RB3A 3RKUA 1ZRNA 4JELA 4NQRA 4FCTA 1K4KA 1B8PA 2NUAA 5HX7A 3COJA 4O1HA 1EUCA 3GGSA 1O95A 3TB4A 4P80A 3W7AA 1PG2A 5CNMA 4KJXA 4WN9A 3IIKA 3SQXA 1V6CA 4I81A 2DCUA 3IPRA 3EIHA 2JFZA 1OLUA 3L3FX 2O4CA 2IZ1A 3C14C 1OU4A 1HSZA 2ZSAA 1B14A 3ROPA 2AMLA 1LJUA 4BV9A 1B2LA 5KFCA 1CP3A 3AN1A 1UWCA 5CVUA 2JAXA 2HHAA 3UQ2A 2OL4A 3ZDAA 1TFUA 4RBNA 2WM2A 2ZIEA 4X45A 3NS1A 2AFIB 4F2GA 4DMKA 5JVDA 1Z6GA 1W9MA 3O1HB 3KT0A 1K5DA 3LQ2A 5JMTA 2W4IA 1T3LA 1H9BA 2D1SA 2H7XA 3WQQA 1R66A 4M7PA 4R8MA 1ONSA 2R6CA 3LS2A 4DCSA 1F1JA 4GR5A 2AT1A 3D4LA 4YAWA 3SFZA 2PNJA 2W2TA 1OSNA 4LYFA 3LHSA 4XSVA 2W2VA 3W5JA 2C59A 2QJWA 4JJ8A 1J8DA 3NDJA 3BH0A 2G1KA 5HMMA 4QUAA 1C7ZA 4E7PA 1NONA 7ADHA 4M8SA 2RGWA 3RTCA 4KLDA 3IV6A 3RAPR 4OTZA 4E31A 3WWDA 1H4VB 5J2AA 3EIWA 5LBTA 4BECA 2NXEA 4NZNA 4P5DA 3NZEA 3RODA 4B83A 5DASA 1E2MA 2X9GA 4IDQA 1CB7A 1TD1A 5BWMA 2Z8YA 5E1DA 4OHWA 4QASA 2JS7A 8ICCA 2WJVA 1KL7A 3RRMA 3A4VA 3KHHA 5IK2A 4LE2A 2QL7A 1FK8A 1KBOA 3OZAA 4HV4A 4B7ZA 4L6AA 1PNQA 1EFPB 4RD3A 4L7QA 2PGJA 1DBPA 2ZJ8A 3T6KA 4IQ4A 5BW6B 1VL5A 1KKLA 2R00C 4Q21A 2JFQA 4HSGA 1TQ6A 1UAAA 1DXYA 2QDXA 4P4SA 3V34A 2ZXIA 2A33A 2YFKA 3D7SA 3HSKA 3W7BA 2H1IA 2GCPA 1SUSA 4FS1A 1GSIA 3GZJA 1R8SA 1Y3FE 5G0SA 5HSGA 2XF2A 2X1MA 2Q50A 2IPOA 2C84A 2XXAA 2RMKA 7ICUA 4MYSA 3M0EA 3LK6A 4CL0A 3NU1A 1FSGA 1NUUA 4XLZA 4UBIA 4C4XA 5IP5A 4UEOA 4KN8A 2FOIA 4DCVA 1WZIA 1KFBB 2G83A 3IAM1 3PFNA 2JIOA 3TLMA 2CHUA 3I9V1 2CNDA 4YUXA 1MA0A 4GPBA 2OQIA 1XCOA 2A88A 1EINA 4C1BA 4MRMB 4DQKA 5K0GA 3KAPA 1AHPA 3D2SA 3V32A 1SQFA 4TV8F 2G06A 4PZOA 5AK5A 1DL5A 9ICBA 3S55A 4BZXA 1CY6A 5CYGA 2NVWA 5EJ8A 2ZJFA 4YV1A 1XZFA 4QJ4A 2SICE 3DTTA 1UP6A 2ZYSA 4B84A 3F3MA 4B44A 2MSDB 4CM8B 5LP6F 1L8QA 6Q21A 2BBTA 1SPXA 4Y7CA 3C6ZA 1NXPA 3GG2A 4F4JA 1B8NA 2K2QB 4FUQA 1ZM7A 1SC3A 1EK2A 4HNAB 4F38A 3RYCA 1F0MA 3VVLA 4YHBA 1ZUWA 4JX8A 2W4MA 1GYQA 4JN6B 3MT7A 4PBSA 3ASYA 2B9VA 3GJ0A 4FOOA 5T67A 2MYPA 2ZT6A 4M9UA 4UB5A 4YD2A 4B6RA 1PQYA 1PGJA 4HLDA 3JPYA 5KT5A 3K0BA 3I4CA 1MZPA 2E5FA 5KAPA 4BO5A 2UYGA 4R5HA 1ZM9A 2ODEA 3DE7X 2IUFA 1EXWA 3B3GA 3GY0A 3NRJA 3ACCA 1RYHA 5REQA 1I2CA 2YYSA 1OH7A 3OMXA 4DNXA 1EXDA 2C2YA 3MUFA 3CLVA 3GAZA 1NVDA 5A5FA 1HE3A 4FJ0A 4MQEA 1YB4A 1H0RA 4F6CA 1PR2A 4DIUA 2K4PA 1KFEB 3I6YA 5GTIU 2V0GA 5HF9A 1RBZA 4GC5A 1G8AA 3NBUA 3JS5A 2VK2A 3H83A 3FPLA 3L8CA 3F98A 4OPMA 4MGKR 5EXDA 2VJCA 5KQLA 3OD5A 4CXMA 2YHIB 1ZH2A 4LHWA 1O96B 3FW1A 1SXJC 4QNNA 3SDZA 4MWCA 5EJ4A 4URZR 4MEBA 1RPJA 2BF7A 3L6RA 2V03A 1JGTA 4D3FA 1CS0B 1JTFA 2EANA 3U81A 1M67A 4Z6CA 1GNPA 4WCDA 2O0HA 1WB6A 1WKCA 1A95A 2X9LA 2OQRA 1OV6A 2KN7A 4OP2A 3M3DA 5AI0A 2EF0A 3ES9A 1ZLXA 2QOEA 3T7RA 1QG0A 2VPZA 4BVHA 1FYEA 4GYWA 4D3ZA 2D3DA 1Y37A 3UWMA 4YFVA 4M1QA 2RHBA 2KE5A 2VDUE 3JYOA 1RP1A 2P65A 2P9TA 3ND5A 1HH4A 3RIEA 3MFYA 2XECA 1NN0A 2PUVA 1EX7A 2W2KA 1V6AA 1B76A 1M72A 2QM8A 4WVLA 1N2IA 3U7JA 1U9ZA 4NK5A 1C80A 1TVKB 4FOLA 3K9LA 9LDBA 2HQSA 1WABA 3FY4A 1JEYA 4GGOA 7ICFA 3W1WA 4BFUA 3R7WB 1HNXB 5F1YA 2MMGA 1H85A 3ZDDA 4Z4CA 1VSBA 4NOJA 2OC4A 4LC0A 4DFJA 3C41J 2J4FA 4NJMB 4UVDA 4K5QA 4EH1A 3FPJA 3UGKA 4A8JC 3FGZA 4CKWA 3PNMA 3FZQA 3DOEA 3JVVA 2FPPA 4CYMA 3SS7X 2B8JA 2XSZD 3HNRA 2EX0A 4DA6A 2WT4A 2X4IA 2DFLA 4F4XA 3EF0A 4QPJC 4GF5A 3WLMA 2WIKA 2IYZA 2VQ6A 2AQ0A 3ETDA 3AWIA 5H16A 3MRXA 3WZMA 1RFGE 2VHUA 1DTSA 1GPJA 4C8NA 3KOUA 3KM0A 3R5JA 1KK0A 5EL0A 3Q9SA 2BFBA 5DBCA 1QK5A 3EXIA 3QEKA 2OZEA 4X5VA 3ESZA 3X2SA 4WT7A 5E4FA 2X76A 2VPXA 5AKHA 4P3XA 4E51A 5J2EA 3D2AA 1F2DA 5J5CA 1Z26A 4YCSA 4FCWA 2QE7A 4JOBA 4BN5A 1XKXA 3UAZA 3KJZA 1CW2B 1N4AA 1L8LA 1ZFNA 3D5TA 1FDOA 2Y3IA 1MKYA 2Q5CA 5IVKA 1RSZA 1A4UA 5EHIA 3GGCA 3AG6A 1T4CA 2GEUA 2A6PA 1KERA 3ZBPA 4UPVA 2AOUA 3E4DA 4CEHA 4JV5B 3IAS6 4C01A 5JVDF 4LJYA 1QK3A 5JAIA 3V4SA 2FHSA 3FI9A 5KFIA 4MTLA 3N05A 5KFLA 4G25A 4D9MA 3SOZA 1WSAA 3M8KA 2RIRA 2VRCA 4P2HA 2RGUA 3DEAA 3H2GA 3AF0A 3GP8A 3ANNA 1Z47A 3OU6A 3LUPA 3I2JA 1SH7A 2V7PA 3I01A 2X9VA 1E89A 3HB1A 4BKUA 3QNWA 1GNQA 4PHDA 3B8HA 1ZW6A 4US2R 1IXRA 2I6UA 1R0YA 1O8CA 1Z7WA 2X86A 1ZK0A 4NBVA 2ATIA 3A0BU 4JLPA 4DA7A 4ZAWA 2ECFA 1OHHD 4KHZA 4GE3A 1OOEA 2R79A 3QPDA 2AZ4A 4N7BA 5TC4A 2KMLA 3TI0A 5DHAA 5J2UB 2WV9A 4Z4EA 1SOUA 3C5EA 3VMFA 1J7JA 1TU0A 4DY6A 4X7RA 5D3QA 2OGSA 2WIAA 4NFHA 9ICCA 1BJTA 3T3PB 5KNBH 2KHVA 5F7JA 1R0WA 5A1TA 4IJVA 3AEUA 2GYWA 1KVSA 4I1RA 3PV8A 2ZYAA 5A4MS 4HMPA 4V0LA 3M89A 4JUDX 3SI8A 1ZONA 3EDRA 5HR7A 1IOVA 1G5TA 3CF4G 2V6IA 4A91A 4ARZB 3TSZA 2XY6A 4B3DA 4BVBA 2GJ8A 1GV0A 1NVUQ 4J1TC 3GVXA 5HJEA 2OMKA 3RKRA 3HZHA 4I1IA 2VPQA 4EF6A 1HT0A 3A7DA 2RARA 1IOWA 4OAQA 5J0SA 3TF5A 3EGDB 1XV5A 1XFDA 3I64A 4AJHA 3L04A 4OHPA 5DEIA 2LIPA 3GZNB 3P2OA 3QLVA 5KEIA 2D54A 2RH5A 2OV8A 1DRKA 5A6VA 2CEKA 5DM1A 2RC5A 3RCBA 1GUBA 3SQWA 1L5OA 4B80A 3ND6A 5I6DA 4GOMD 2PXCA 3NAMA 1GA1A 1MX3A 3HI4A 3ZDEA 4NMWA 3H5RA 4LHYA 1IBLB 3E8SA 4QZIA 3OH8A 4BB9A 3EC7A 4O6VA 1JLKA 3GDXA 4JK1A 2X8LA 5EUMA 3MGIA 4XWTA 1PIWA 1CPYA 1XEXA 2UZ0A 1J2JA 3NH6A 3JYLA 3MC1A 4JLVA 1AVTA 3CP8A 4D9IA 2QUKA 3BS4A 5ALMA 2I1QA 3AU9A 3F2DA 1Z00A 4Q8FA 1CR1A 4WK4B 1A9SA 2XQFA 4FDLA 5TEWA 1HG0A 3PK0A 4MCIA 3F5SA 4YN4A 1CUWA 2ISCA 4JLWA 2RHCA 4FBGA 4FZ5A 4AZWA 2FKNA 4JNCA 1R2QA 4EK9A 4GX0A 2IA5A 2WD7B 4URWR 5TE9A 3IKMB 1MJ5A 3AQFA 3LQRA 4NOKA 4U2CA 1R5JA 2I2BA 4CT0A 1FVFA 3KJXA 1JAXA 3I9LA 1JP7A 3FR8A 1EIZA 3V8QA 1NATA 5LM3A 4MVCA 4UJ3A 3S68A 5CFOA 5HW0A 2H65A 5KNCD 1MX1A 1SEPA 4PAQA 5DEOA 4EZ9A 2ZUBA 2JLZA 2QVLA 2WSMA 2FFRA 3K6KA 4U1RA 4KAXA 2FEMA 2NVOA 2Q4TA 3OCVA 5LOVB 5GY7A 2C97A 3ZX5A 5B3JA 2Y1CA 4GM4A 1XVAA 2R8RA 3FNQA 4BO3A 4NMLA 4GNRA 2P40A 1XVTA 2WFLB 3AU6A 3NVAA 1XLWA 1NLUA 1D8AA 3X44A 3U0VA 2ODBA 2DG2A 4RZUA 1VTKA 2AUTA 2DUMA 4J9LA 1MJNA 1JBKA 3T0FA 4AWAA 1AHIA 5JQWA 1C20A 4BCBA 4FFVA 3PSPA 3WK9A 3V4PB 1QAMA 1B16A 3KL4A 9MHTA 2H2WA 3BEDA 2OP1A 2XB9A 2REQB 2Y0DA 3AM9A 4S1WA 1XK6A 3QVKA 3RB8A 4H7PA 2PWAA 2FN8A 1E6UA 3PMLA 1KF0A 1WB4A 3NJ4A 2JZBB 3OU7A 3IPXA 3LC7O 3M6KA 3NGXA 2D0IA 4KRFA 1RLTA 1SB9A 2YIVX 1U2TA 4JVOA 2YJ3A 3OD1A 2Y9MB 4R1TA 1HQCA 2ZU6A 1VHLA 1JEJA 3E5HA 3CQ9A 3IIEA 3G9ZA 3DL4A 4J9OA 2WIDA 1NRIA 3S2GA 4FQ7A 2X8BA 1DBQA 1FNBA 5BV2P 1YDFA 3P9QA 1ZQUA 3CW9A 4FU0A 3D81A 5I8ZA 1TAUA 1Q0HA 1VI5A 3T7AA 4AFNA 3U4CA 3CC8A 1R4AA 3GCXA 4GBMA 4LY9A 2BEUA 1U8UA 4M6WB 3VVMA 1V3VA 1M6VA 3G6YA 3AM1A 3UVEA 3TKLA 3EZ9A 4OMUA 2DPYA 1TK0A 3PB3A 4GKVA 1B15A 1JI7A 2ECKA 2JJ2A 3VZQA 5FL3A 1IOZA 1U49A 1GT91 1P1BA 4MRVA 3BH6A 4XR9A 2GBCA 2IODA 4B48A 2IXDA 3QBJA 5EXTA 1LV7A 3L1HA 1V11A 1GAJA 4EY6A 1OJLA 2G5GX 2PSJA 1OMOA 2IOYA 4H17A 4CRXA 4I4TB 1M73E 2OV3A 2JATA 4KMMA 2C7GA 5HQTA 4OBXA 3JASA 4NATA 4M8NE 3UA4A 2CFTA 2CWWA 5AQEA 3BRSA 1GG2A 1KC1A 3MFHA 1NRJB 5F5LA 4MHSA 3LPMA 4B6FA 3BIJA 4YJ3F 2AR0A 4P6VF 1TXGA 4F11A 1TGYA 4BWJA 4B82A 2JHFA 1VP3A 3LDGA 4KOAA 1EESA 2X22A 4DBLC 2RE8A 2VVTA 3T35A 4Z1MD 4HX9A 4FKBA 3CKKA 3DPUA 4M7RA 5CBPB 3FCSB 5FFMA 4B73A 3DWEX 2RHJA 2XTAA 1EUDA 1YZLA 1KSFX 2Q07A 4CV0A 1V96A 3SI7A 4L8WB 3DZGA 1BMDA 5AW5A 2YIJA 1ZQTA 4HT3B 3E9DA 3VYVA 4R68A 1J2RA 3KEFA 3GK3A 3HO8A 3EXEA 2Q3LA 1O1YA 3EUFA 2QV7A 3BD9A 5C18A 2ID8A 5SICE 2HDOA 3FHLA 1JEAA 1JN3A 1S7CA 4QPCA 1PQUA 1TMGE 4V0NA 3VTKA 3I2HA 3GBSA 1XJWA 4J0EA 3DAYA 3KFVA 3TWOA 2QTAA 2D06A 2CLOB 3NEYA 1G4HA 4BNWA 3I0NA 5B5SA 2VNAA 4DL4A 3Q8RB 3RUPA 3HXTA 4PLTA 4US8A 1XNGA 1H2FA 2I62A 5EZ5A 3ROTA 3UHAA 4O3RA 5TIIA 4EHJA 3EFOB 3GGJA 1Z39A 4TYWA 3VUEA 3BERA 1EVJA 4D9FA 1NX9A 4BUZA 4Q3AA 1GCUA 4BP8A 4GLJA 1ND6A 4Y6OA 1XNJA 1CUUA 4JDPA 4NCXA 1GY8A 1A5BB 2ZREA 4BU0A 1EJ0A 3DXYA 1ITZA 4Q3BA 3T5JA 2Q2QA 1YS2X 4RQ0A 2IZ5A 1T3NA 1ENOA 3VNRA 2HMWA 3OJOA 6ADHA 3L4BA 3OE1A 3K5HA 1TIKA 5GQSA 2BHTA 4KLHA 1DLJA 3I76A 2AXNA 4HQKA 4TYYA 2VYQA 3I9FA 3WRWA 4H6PA 1ZD9A 1W1IA 4EHDA 3LLMA 3QPWA 2WABA 3ACBA 4RANA 1UJ5A 1NW6A 4BMOB 2ODAA 3N7UA 2GYVA 4S1OA 3G49A 5FBZA 4RYDA 3GFKB 5ALIA 2YRWA 2QVXX 4HUQA 4DMMA 3OPYI 3E23A 1L5UA 4OQPA 4U3JA 3T7DA 1DOAA 4YCCA 1DMSA 2O3RA 5FLYA 4MLDA 4EHFA 4R2LA 2GETA 3ZUGA 2NRTA 2FUG1 3WIOA 4DDMA 4HNTA 1W8DA 1OAOC 3EBLA 1Q7RA 2Z3VA 3J81j 3HLKA 4V03A 3NIBA 3IXMA 1P1CA 2VIIA 4M0DA 4AZ3B 3GN1A 4PFQA 3UPUA 1LB2B 1MF7A 4Q7JB 1E2GA 2FPRA 4EUEA 1CIJA 3SBXA 3KWJA 1JLMA 1QBKC 1PWZA 1J09A 1JPNA 3T06B 4BU1A 1Z63A 1TC2A 2W6NA 2KMDA 1ZAKA 3N2GB 5CMLA 4QBGB 2JAPA 1WKVA 2QQFA 3NALA 3OOYA 3KVOA 2ONCA 3BQTA 3HJCA 1Y1PA 2HJHA 3REQB 2Q0QA 1IXRC 1XKLA 1D07A 4MRNA 2RI0A 4LGYA 4XQ0A 1NMZA 4E1VA 3IP3A 5BR7A 3KQLA 2J9FB 4R8KA 3WBFA 1PYDA 5G1NA 4ADSG 2YV1A 3I5XA 1YJCA 4JBIA 5C7YA 5EWMB 5CLQA 4GHWA 5DNEA 3G8CA 1SIOA 3VR6H 1J42A 2FX3A 1MHPA 5J0OA 2FPGA 3QOYA 2B99A 4RJKA 4HTFB 5DLFA 3CU5A 4A0HA 3PNYA 4BFCA 3SSOA 1ZHHA 5L1MA 4HAYA 2VTKA 5AOBA 2B8NA 1XJ5A 3LO5A 4IYRA 1LSSA 1W35A 2OCLA 4YUZA 2CJFA 2YMQA 5JJCA 5LQNA 3RTBA 4LHZA 3IUJA 1SBZA 4AULA 3WS7A 3DMNA 3CR7A 1KKUA 4NOMA 3K71B 2V55B 1ZXBA 4QU8A 3AT1A 2CE7A 1SQ6A 1LBSA 3AF5A 3MGKA 1J1IA 1V35A 1PVRA 5HP4A 1FFDA 4MRRA 4J16A 3KJIA 4EYIB 3HXMA 4YYEA 1VHWA 3ZVKA 4ZOAA 4Z3OA 3OJSA 4Y6QA 3GNQA 3E3OA 1FY2A 5CXUA 2FSPA 3RSSA 1YRBA 1QLHA 1E1KA 1MOZA 4WJLA 5C52B 2ZTMA 2Q9CA 5DQHA 1Y1SA 1JLSA 2P75A 1KIAA 2XA9A 1IH8A 2FUG6 1Z6QA 1JJBA 3CTPA 4YMWA 3H1FA 3ANXA 3NYIA 1UT8A 2X58A 3R9KA 4ND4A 5JJLA 4LVUA 4FFMA 2PX0A 2YOHA 3RAEC 3I09A 2FFAA 3IMFA 2R65A 1P1IA 2ZK7A 2DWCA 1GTJ1 5CD9A 1EM6A 2OXIA 4C0HA 3FCUB 3EEBA 5DSTA 4RPCA 1FX0A 1JYEA 1YULA 4DEYA 4JUIA 5AM2A 4LVSA 4LRSB 4MYUA 3SJZA 3SV4A 1OZGA 2QR2A 5JNVA 1IK6A 1QANA 4MK4A 1VCOA 3ISBA 5KUTA 3VJKA 2GUGA 1CUCA 3U9TA 4I28A 2Q1WA 1W88B 1YS9A 1G4AE 4PRLA 2H1SA 4JJ7A 2XUDA 5KFMA 3NDBB 3OE5A 4Y8VA 3JRWA 4FFSA 2JDIA 2CDNA 2WQ6A 2BQRA 1LBHA 4NKRA 1W30A 2NU6B 4P98A 3G6WA 2RONA 1J5EB 4QA9A 4JLDA 4JJIA 2D7DA 5EKTA 1IWOA 2EP5A 2IL1A 1KQOA 2VJNA 3GA5A 4WY8A 5EKDA 1S8NA 3VR6A 3HP7A 1ULHA 3EN0A 2PKRA 1Y1LA 4YUAA 3PGLA 4CUZA 5CGZA 2W6ID 5B3JC 3IDFA 3A1WA 1YZFA 2ZRLA 4KR3A 2AMJA 5I9IA 1P74A 3TJZA 5FOQA 2A5YB 5IU6A 1E9RA 3TE6A 2IHZA 3W6OA 4G2TA 1JHAA 1AZTA 5KX5A 2PH5A 1B2RA 1KA9H 5C34B 4R05A 5AW0A 4FEGA 3OT1B 1TA0A 4IFEA 2I8AA 5A0LA 4ED1A 3ROQA 2OT3B 3P52A 1PAUA 3U37A 1Q1EA 4CF7A 4UM8B 3RRXA 2E6KA 5AICA 4PZNA 1TI7A 1RCTE 3CPJB 2UXDB 1GRRA 5BNTA 4A9AA 4P82A 4R40A 2DY0A 3GLGB 1TT5B 3R7SA 3X2EA 2QGFA 3OEWA 1QWSA 3JYHA 3DMRA 4YDRA 1F0PA 3V6MA 2G5CA 3K4QA 4DWJA 2FPIA 1AKYA 5CPBA 4DCGA 4JXZA 5GIPE 5JSKA 1H94A 2WU1A 3PX2A 4DGQA 2CB0A 2OPHA 1FIQA 4KOEC 3NATA 2XRZA 4RK6A 1HNNA 4QYMA 4BLWA 2FLPA 3B9JA 2XBMA 5E0KB 2FN9A 1U65A 2PKQP 2V1XA 4O2BA 4JV0A 4DFPA 2V3VA 4BNVA 3IVAA 3PI7A 5DTQA 3J81k 4DARA 5LIRA 2EZTA 4INJA 2BEWA 4I46A 5HZGA 4GYYA 2ATXA 2ALJA 5BSTA 1RAIA 3TLKA 1L8XA 3WLJA 8ICKA 1VLZA 4UUAA 2R6R1 3RARA 2DC1A 2JCYA 3T9BA 4KE6A 4ZU1X 3ITNA 3L4PA 4N8DA 2OD7A 5J2FA 3VNAA 3EIOA 4Z0TA 2G0NA 4BKMA 3CV3A 4UBLA 5A71A 3FBWA 4F96A 1C7QA 3QPUA 1GJRA 2XDYA 2BZSA 1XF1A 3DKVA 1S4MA 3N6RA 1RYNA 3CJQA 3CMCO 3R6DA 1HORA 3HV0A 3I9MA 9ICGA 5KG3A 1YC5A 1AXGA 2HH9A 1JKXA 2IBTA 4FW9A 3QBDA 3PX3A 1WXHA 3EPIA 4GGPA 1FRQA 1VMDA 3AUTA 5BN4A 5AVKA 4MVJA 3TIVA 2P6OA 13PKA 3WJAA 1ID1A 1S0MA 2WG0A 1FTWA 2GI4A 1HI9A 3CVXA 3E9EA 4DUGD 2BR0A 3AR5A 3ZH9B 1PZFA 2V97A 3SHFA 1A9YA 1NVKA 4QX6A 3C24A 2AR9A 5LNK6 3MR2A 5CX1B 3T7KA 4DG8A 1E9DA 3MAAC 2DLNA 3WLAA 1YZGA 5F1OA 1B0UA 1WF6A 3OFKA 5TDHA 4ES6A 2JHPA 1CEEA 2XKJE 2G17A 4KXLA 3F49S 3GIIA 2GA9A 1TUIA 1AKRA 3WE7A 3ZIDA 7ICOA 4J9UE 3DEEA 5DN6A 4MB2A 1TMKA 3KYBA 2XGQA 1UMCA 4TKUB 4NBSA 4F5DA 2YOGA 3PPWA 1NG1A 4HZUA 3KSDO 4OH1A 4QJ3A 4C87A 1E3DA 3EW7A 3HW8A 5EIXA 2G5IB 4XFKA 4P7FA 4M38A 3MD0A 5CTJA 4YAFA 4KLLA 4DR2B 5KFDA 1DG9A 4Y2UA 1WVMA 3L0PA 1FW6A 4PVDA 3OQMA 2VRNA 1VE5A 3MJTA 4OFXA