2YN4A

L-2-chlorobutryic acid bound complex l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
225
structure length
225
Chain Sequence
SGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 89
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2yn4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yn4A01
2G1AA 4L6CA 3QUBA 5AVZA 3RFUA 2OBBA 2P11A 5ALRA 2PKEA 1Z88A 2FPXA 2HI0A 3N1UA 3FVVA 5AW9A 4QJBA 3AR9A 4Y2VA 2ZOSA 4JDPA 5AVSA 4EENA 4Y2PA 1NRWA 1ZJJA 2WFAA 5AKHA 5ALWA 1O08A 3NIWA 1FEZA 4IFTA 1U02A 4KX3A 2RB5A 1L7PA 2R8XA 3AR4A 1Y8AA 4F71A 2FPSA 2Q5EA 1WZCA 3ZVMA 2FPWA 1ZD4A 5AI0A 2C8KA 2YBDA 4UASA 5IT4A 4XOUA 2FPRA 2NO5A 1Q92A 2R8ZA 5AW2A 1Z4MA 5AM2A 1S2OA 1J8DA 3ZWDA 1QYIA 2CN1A 5AW1A 3N28A 2IOFA 2FDRA 3UMGA 3R4CA 3R9KA 4G63A 1T9ZA 3GYGA 1QQ7A 2HEGA 2YY6A 2YMMA 5AIBA 1WPGA 5AKIA 3L8EA 3M9LA 4HGQA 4J03A 1VJ5A 3S6JA 1TJ3A 2BDUA 2JGAA 3QGMA 4OFZA 4AS2A 4UMFA 4YCNA 3IJ5A 4ZEWA 2BY4A 5AM0A 2FI1A 3KBBA 3QUQA 1IWOA 2CFRA 4BX0A 4BYGA 4H1WA 2C8LA 2AH5A 4NABA 3AR3A 4NAVA 2B1RA 2YFYA 3ZW7A 1RLOA 1LTQA 3WK8A 2HCFA 2G09A 2I34A 2B8JA 3ED5A 5AKLA 3K1ZA 3OCYA 2OA0A 1NF2A 4KN8A 5IT0A 3FPSA 3QYPA 5AVXA 2B82A 5AW0A 3E84A 3NALA 3L1UA 2ZXEA 1Z4KA 4UMDA 4DW8A 4C4SA 3L5KA 2GHTA 4QQFA 4UMVA 4EEKA 4XPZA 4UW9A 3FM9A 4BKMA 4CNQA 3SMVA 1L7OA 3ZUPA 5IS2A 2YMPA 3U7HB 1N9KA 3FGOA 1RC8A 5AM4A 3NUQA 5AW8A 2D2VA 5AI9A 2FUEA 3PGLA 1Q91A 3BWVA 4HAIA 3EF1A 4EX6A 3AR2A 5AIAA 3ONNA 3QNMA 1U7PA 1RQNA 3SF0A 2C9MA 4HYTA 3A1DA 3NRJA 5ALQA 4PNHA 2EARA 2YJ6A 3QUCA 4C4RA 1WVIA 4Y2TA 3SKXA 2ZBDA 1U7OA 1Z4IA 3E8MA 4UU1A 3SKYA 1YMQA 3ESQA 3ZU6A 1RKUA 5AI4A 2HO4A 3J7TA 2AUTA 2JAUA 2Q4TA 1SWVA 1YJ5A 4UATA 1LVHA 3QUTA 3U7GA 3B9RA 4GIBA 5AVYA 2IOHA 3DV9A 2YJ5A 1XP5A 2HSZA 2YN4A 4Y2XA 5A3SA 4L6AA 4BX2A 5AM5A 4Y2UA 1RMQA 1Z5GA 3AR7A 5JJBA 4OHFA 1RPZA 5ALNA 3QLEA 5ALJA 1WR8A 4GXTA 1Z4QA 2W43A 3U26A 2G07A 2QYHA 1AQ6A 3L7YA 1T5SA 4EELA 1RLMA 5AK4A 3WKAA 3MN1A 4DWOA 3NAMA 5AVRA 2BDEA 1Z4JA 2YMQA 1SWWA 2EAUA 1TA0A 4UMEA 4EZEA 5ALUA 4FE3A 2HF2A 5ALZA 1Z4NA 1VJRA 4DCCA 2FPUA 3VAYA 4HGRA 2JAOA 3QX7A 2FUCA 3KDPA 4UU0A 5AW4A 5AVVA 3CNHA 3U7FB 1RDFA 5AKXA 2ZBGA 4BNDB 3AR6A 2B30A 3L1VA 4CF4A 5ALMA 3ZTYA 1EK1A 4HGNA 2YJ3A 5AK3A 3A3YA 2GHQA 5ALGA 3KC2A 1KYTA 3EPRA 2O2XA 2IOFK 3ZVNA 2AGVA 2QLTA 2MSNA 1ZD2P 1L7NA 5AI5A 3OCUA 5A3QA 5AESA 3QU5A 3ZX4A 2WF6A 3WK5A 2NO4A 1J97A 3ZTWA 1TJ5A 3N07A 4OD0A 1XPJA 3N5KA 3WK4A 1ZRMA 4YH1A 2B0CA 1XVIA 4UAUA 3W5AA 3AR8A 1O03A 4Y2JA 3FPBA 1RKVA 3WK9A 4AS3A 3P96A 1CR6A 4C4TA 1YS9A 3WGUA 1L6RA 1CQZA 3E58A 4XQ0A 2Q4RA 5AM3A 2DQSA 4Y2YA 1RLTA 2I54A 2ODAA 2ZBFA 3KD3A 5FP0A 2WHEA 1TJ4A 5AKJA 2OYCA 3HLTA 1RKQA 3M1YA 2G08A 2NYVA 1Z4PX 3HYCA 3I28A 2I7DA 1PW5A 2RARA 4FFDA 2GFHA 1VFPA 4HGOA 5ALYA 3L8FA 2GO7A 2I33A 3RF6A 3TLMA 3EF0A 4Y2RA 2ZBEA 2HDOA 3KOOA 2HOQA 2R8EA 1L8OA 4UM5A 4YIHA 3QXGA 5AW7A 3PGVA 1YV9A 5AKYA 2IA5A 3OPXA 2WF7A 1EK2A 3B9BA 4YCMA 3R09A 1YDFA 4UARA 2WF5A 3D6JA 5AHXA 3SD7A 4F72A 5AKKA 3DNPA 2G80A 1QQ5A 4XE5A 4B6JA 5AVTA 3ZI4A 4NWIA 3IRUA 3L0YA 4IG4A 1MH9A 4KNVA 3L8HA 5AVWA 3QU9A 3SLRA 4YIKA 1SU4A 3UMBA 1ZD5A 2W11A 4O8CA 2PQ0A 2O9JA 1F5SA 2W4MA 4CF3A 3NANA 2EATA 2P9JA 4KNWA 5ALEA 3W5DA 4L57A 2MU2A 1S8OA 5AKZA 1NNLA 2X4DA 2AMYA 2I6XA 5ALPA 3N8GA 2GMWA 4G9BA 3ZWKA 3L0BA 3OCZA 1Z4OA 4BBJA 5ALDA 3OTQA 5AM1A 1RMYA 2G0AA 3PCTA 1TE2A 3ZX5A 1U2SA 3ESRA 3WK7A 3AR5A 5AKGA 5A3RA 3NASA 3I6BA 4YCLA 5ALSA 3PDWA 4CE6A 5AW5A 2C88A 5T41A 3OCVA 5ALLA 4KX5A 3U13A 3I76A 1ZRNA 3MPOA 3OCXA 1Z5UA 2FEAA 2HF7A 3ET4A 4CF5A 2RBKA 2G06A 3W5CA 5AK5A 5ALHA 4OCZA 1JUDA 3U7EB 3SHQA 4AP9A 4BX3A 1QQ6A 3QU2A 2CFSA 4YGYA 2YJ4A 4Y2QA 2JARA 5AK6A 4E88A 5ALVA 1QH9A 4RETA 4KYTA 5ALIA 5AI8A 2B1QA 2WM8A 4RESA 4MWOA 3KZXA 3L0CA 4UM7A 3WKCA 1N8NA 5ALXA 2I55A 3MMZA 4EX7A 3ET5A 3I1YA 2OM6A 1L7MA 4DFDA 4NFLA 4HGPA 1YNSA 4J2TA 4BEVA 4JB3A 1RMTA 2CFTA 3ZVLA 3L8GA 5AI6A 3WKBA 1Z4LA 1K1EA 4BEWA 1X42A 3WK6A 2RAVA 4UAVA 3UM9A 3WKEA 3MC1A 4ZEVA 2WF8A 3QU7A 3A1CA 3F9RA 3DDHA 4FYPA 2MU1A 2HX1A 2B8EA 3U19A 3B8EA 5ALKA 3QU4A 2HHLA 4MUMA 4I9FA 1RQLA 5ALFA 2WF9A 3FZQA 4I9GA 3W5BA 5AVQA 5ALOA 5AICA 3BA6A 2P27A 3UMCA 3E81A 3WGVA 1T5TA 5E0OA 3EWIA 3WKDA 3DAOA 4Y3UA 1L8LA 4BNDA 4NV0A 5AW6A 3IB6A 1ZOLA 2R8YA 1U2TA 4ZEXA 2IYEA 1RRCA 5AW3A 5ALTA 2JAWA 2ZG6A 1ZS9A 1ZD3A 2YMLA 2P69A 2VKQA 3OCWA 5AVUA 3CZ4A 2C4NA 5AKEA 2PR7A 4Y2SA 3A1EA
chains in the Genus database with same CATH superfamily
1R6UA 3P26A 4P4GA 1L7DA 1Y1SA 2LNDA 3SNHA 3TB6A 1Q1EA 1C7FA 3IUEA 5EP2A 1WZ2A 5TEVA 1ESNA 3RYCB 5EKUA 1HGXA 4HF7A 1W87A 2FPXA 5BWNA 2WVGA 4RY0A 3DGFC 1PJRA 1Y33E 2WJ6A 5J5VA 1EFUA 4WK4B 4F9TA 4QTTB 3DOCA 1TB4A 1W5FA 1S7GA 2Q6KA 3L07A 1X1EA 3H83A 2IZ6A 3SF8B 1RXWA 4CRXA 7ICIA 1FFXB 3AZQA 4IUYA 4UTOA 4W1PA 1U80A 1TA9A 4Y30A 4CEJB 2HNAA 2JMGA 4AJIA 3NATA 5IZCA 1W85A 2E48A 2VHVA 3C3XA 3UWMA 5HG0A 1E2KA 4Y6QA 4WXHA 4BLQA 1R4MB 4CQJA 3OZXA 5CLHA 2C1ZA 4LRXA 4RHUA 5HRCA 3EXHA 4LCJA 1D7OA 3OEED 2P4SA 4M9CA 2OFOA 5KVVA 2H59A 5DB8A 1VFNA 2AXQA 3A6JA 3CB2A 4I55F 4QULA 1CS0B 3HBFA 1PYGA 3GQBB 4KCGA 1SKQA 1NY5A 5EHGA 5DN6D 3R5HA 5FTNA 3G2JA 1CUGA 3RHFA 3KZOA 3JWHA 4P5PA 4P7GA 3KZIU 2K4MA 3WAKA 3GIIA 4YUZA 4PHTA 1XZHA 3HJHA 4XWYA 1T43A 2XRFA 5EZ6B 2O2HA 2D7JA 1IJFA 1RFLA 2EJBA 3DNFA 2F9FA 3PR3A 1I2ZA 4I5EA 5TDHA 4AZTA 1GPKA 1UBSB 4CQMA 5BN3B 2DPMA 2G9VA 1JU4A 2WMOB 2VZEA 3AKDA 4Y8VA 3GNSA 2LCIA 3LC2O 2KIVA 3LWDA 4J94A 1P1JA 2MMGA 3JWEA 4X44A 4MYDA 4YN4A 5FHRA 4D25A 2PFKA 4U6SA 2QWXA 3M4ZA 2H5JA 1DBWA 4K6GA 3VR5D 4AS2A 3GLQA 1UFKA 4G81A 5KHLB 3EBOA 1DBSA 1BA3A 3FNGA 2OV6A 3C7DB 1HQDA 1UAYA 2DYKA 5CFMA 2AXTU 2PRYA 3N7AA 4MEBA 1POXA 2FQ1A 4PRYA 2OHFA 1EP9A 4MGZR 1QB7A 2XCQA 3GY0A 3KL4A 5FUQA 3UPQA 4A6PA 1E8NA 5KNLA 3RTGA 1H69A 1GV1A 4C7ZA 3IAHA 4UOQA 5IKEA 5A4AA 5K0EA 4PZPA 4OREX 3V8QA 4IDBA 1Q7EA 4RK0A 5J8YA 5DG8A 2B5OA 4AJHA 1LTQA 4FMDF 4UHCA 5KFYA 1JTFA 4YJ3A 2HU7A 4N5MA 3RJTA 1EFRA 3K0FA 1PJSA 1TYBE 4HHEA 4DZZA 5B7PA 3U44A 5KYVA 1D3AA 1FP2A 4NQZA 1O6GA 2BFNA 3T95A 2SNIE 1GN8A 3FF1A 3U6BA 1Y80A 1EK0A 2DCUA 3DVAB 1E64A 1V16B 1JSXA 1QCYA 4UB1A 1M0TA 1FXSA 1ONOA 2IQIA 4OU4A 2AU0A 4Q7KA 4UHFA 1N7GA 2QQFA 4YB8A 9ICWA 1TCBA 3U31A 3RG2A 1OXSC 4CKBB 4X1IB 1XS9D 3G68A 1Q1NA 2Z08A 1XEXB 1YDEA 4NZOA 1CEEA 3HE3A 5CXUA 1IHDA 1PT7A 1GKYA 2IY9A 2OAEA 4OIFA 5J2KA 4FKZA 4W9MC 5H8WA 2PUWA 3TRHA 4UW9A 2AMFA 1WO8A 2BHLA 4D9HA 3FROA 2J6SA 4AN0A 4AX8A 1D9DA 4YQFA 5KNIA 4F3TA 3MT7A 2G7ZA 1PUJA 1W35A 4ECXA 4A6DA 2WWTA 1NVTA 3GCZA 1B76A 3QEKA 3VR6D 4KI0A 4CL3A 4F5OA 3LYLA 2QZSA 5JD4A 3P9NA 1RQ2A 4TWZA 1I5EA 4QJ3A 2UVWA 1OWMA 5D1HA 3WGQA 4U4AA 1FRQA 2X76A 5GIPE 4Z7OB 5JXIA 3AM1A 4HDNA 4KFRA 2VSYA 2FSVC 2PFPA 2FOXA 2O4CA 3DMDA 4KSCA 3FBGA 1TAUA 1NW7A 4LJSA 1BEUB 1WRBA 4MWGA 4QOIA 5FL7D 3HBJA 3BXXA 3I04A 5FV7A 3OD1A 3B38A 3E8MA 3GNQA 2EL9A 3DWEX 3L43A 2Y77A 3O38A 3UK6A 4GUAA 1XNRB 2WAXA 3KQVA 1E4OA 3ZY2A 1X80A 2QUAA 3AX6A 3EAFA 5TEWA 3AF4A 3UN1A 3GR6A 4MV3A 3EYZA 2J6TA 1HO3A 1SWVA 3NHKA 4I6EA 4ZQEA 1P2VA 3ESYA 4DOAA 5ENDA 1E9DA 4QWCA 2JANA 4BQRA 3H5OA 2KLHA 2C92A 8ICRA 3HXLA 2A8YA 3PV8A 4A2QA 4WW0A 3QUTA 3COSA 5GQSA 3B9RA 3ZLTA 2B1GA 4AWBA 4HUJA 2NT4A 2PMEA 2PE5A 4O4LB 1UADA 1Q12A 3RFXA 5DF1A 3MNFA 4F06A 2WPDD 3CGGA 5HS6A 2FK8A 4R7ZA 3NEAA 2HSZA 2HA3A 3O6VA 1SIWA 3A9TA 4IIJB 4L95C 4TWIA 3P9ZA 3W5HA 2DHQA 2ATCA 4MQ6A 3G2LA 4QD3A 3O92A 2ZROA 5CTJA 1M2EA 4F4DA 4NZMA 5EPUA 2ERXA 1QU2A 4P93A 4MMXB 2AZDA 4IV8A 3HFRA 2XECA 2CMDA 1GADO 4HUTA 2QX4A 3JQ6A 3BGWA 2QYHA 1NKSA 1AQ6A 4NU0A 4O4JA 2JGLA 4RADA 4WK6A 1QO0D 1BQEA 1FYEA 1GG8A 1EM8A 9ICNA 2R48A 1N9ZA 2W6ID 4JK3A 2VZLA 3JX9A 4DADA 4JVLA 1E1KA 2IU6A 1JHRA 3NIGB 3BT7A 2FE1A 3IAS6 3NYWA 3BQ9A 4RUAA 3WKAA 5J0RA 4DLLA 3KLOA 5TMDA 4C1BA 1QLJA 3V6JA 2IITA 4F4CA 3AU2A 1YB6A 2W55A 5AJUA 3KJGA 2AA3A 4YRZA 1U8ZA 4PBTA 4YRCA 4M9GA 3K1JA 3QEMA 3MLEA 4RXUA 5GAJA 3ANYB 3OURA 3SIRA 3T61A 1AGRA 4E08A 4GPAA 1NULA 4DN6A 1E1QA 1KMNA 1M1ZA 1X15A 4FE3A 3AJEA 1Z4NA 4GT1A 4OQDA 5NLLA 3H0MB 4URVR 2WE8A 1L5OA 3HILA 5EGSA 3VAYA 2A1AA 2R9VA 2IHUA 3V3KA 3QNWA 1BPYA 2EBWA 4B0PA 3QX7A 5ETJA 4DMFA 1K7SN 2LKYA 1FSGA 8ICLA 1PVDA 4RPKA 3GCWA 4BUCA 2VCEA 3ZLJA 1LJ8A 2VHCA 5C35A 1I1OA 1SXJC 9ICRA 3L0OA 4XVHA 3ZIUA 3UJ7A 4TS9A 1U0HC 3NBKA 3FYHA 4LXXA 1CXZA 3TZQA 4MF8A 4PC3A 2CKDA 1XKTA 4P9NA 5JD5A 3FI0A 2ZUWA 3CWZA 4Y7DA 5K6RA 2V9PA 3KTQA 4MS1B 2Z1MA 4R66A 1QF7A 4EO7A 3AUFA 3IP1A 4DOBA 3OCUA 5A3QA 5MFPA 2I8AA 2F00A 1G1MA 3WYAA 1NX6A 4BOYA 3CLKA 4ZOLF 1J97A 2C54A 1H1LA 1M6HA 4JT2A 3N07A 2QUZA 3R0VA 4YJFA 3RT9A 2FOIA 1XPJA 2BLNA 3BTUA 3U9LA 4IYJA 4AAYA 4M8KA 1SQGA 5K8UA 4IDQA 4DTCA 4JXKA 1C1DB 2YIJA 3IR5A 1UMBB 1MQ2A 1TW3A 4D9NA 4ZYYA 2BFMA 4R9NA 4E3ZA 1ZQRA 3U39A 4KFUA 2PTHA 1DK2A 3F6SA 3D7RA 1E69A 3ZEIA 5L3ZA 1OH7A 2VHTA 1J1ZA 3ON5A 4LISA 5BSEA 3W4KA 3VKWA 1SUIA 1Q50A 4HVAA 4GBGA 4PPGA 4XIFA 1J2YA 1I6WA 4RO0A 3NT5A 4AICA 2IV2X 4TTQA 1WX1A 1MJHA 3GWZA 2QU8A 3TZKA 4J07A 4YFKA 1YASA 2R6DA 1H2XA 2W2KB 2CXNA 2VAWA 2Z6VA 3F4BA 4QOFA 5E2IA 1A98A 3GCDA 2DQSA 3PUHA 8ICPA 2I9GA 1GUFA 1U6IA 1WL8A 2OKCA 3AESA 2YXLA 3FMGA 1JKJA 2NSDA 5A7HA 3HCOA 1BHSA 1YQXA 4Q5IA 2A35A 3ZYZA 2IH2A 3RG8A 1OE0A 4XTCS 3F78A 4OGKA 5BOSB 4R2KA 3NGMA 1CY0A 1F6BA 5AUPB 3SJ7A 3C29A 1PS8A 1NPDA 3WE7A 5FBHA 1E4VA 3V1LA 4IV0A 1GAJA 2ODTX 1IB6A 1RXYA 5IHXA 4KMMA 5K8JB 2RJNA 2ZR7A 2HHJA 1PW5A 1NJWA 1LI5A 2J3JA 2XI9A 3LTNC 1E1LA 1KDOA 1TYDE 3QTTA 5E4FA 5B7NA 5CAEA 1UAGA 3Q5GA 4H35A 2WLSA 5DCLA 3SHOA 4P92A 4JVOA 2IF0A 1D03A 1T9HA 2XGGA 2HDOA 4MVJF 2ZS8A 4O4HF 2A1TR 4DR4B 1X1DA 1VHLA 2OXCA 5K4GA 4CEIA 1B1CA 2Q9UA 1XT6A 1N75A 5IXYA 2O3TA 1WUHS 5LVAA 1JDBB 1RYDA 2JA1A 4TN5A 1CD5A 2ID4A 4JMPA 4CM4A 1ZHOA 2LM1A 4YQEA 3EVBA 1H9CA 3RBDA 2B2CA 1GGFA 1N2HA 3GA0A 2VYNA 4WECA 1NJ1A 1W19A 4N6OA 2QRHA 5U9CA 1A9SA 3PQ5A 5J2TA 3TR0A 2BM9A 2IS1A 4B44A 1I3CA 3OAAD 2NUAA 4FXOA 5EE3A 1OI2A 3OSZA 4OGFA 1HE3A 1L5ZA 1R6DA 3RGWS 2IXEA 2O07A 3MDCA 4CT5A 2MYTA 3LU1A 1WMAA 3PW2A 4Z86A 3KKKA 1LTHR 3S0JA 3SJZA 3VYUB 3CO5A 4LQDA 3NS1A 2BEKA 3FBTA 4ZO4A 4TMXA 2RG1A 1S02A 3ZG6A 1KS9A 2XCUA 1T8PA 3B70A 2ZU0C 3BWMA 5AVKA 3TZ6A 1DTWA 4YACA 4E32A 3ZY4A 5K45A 4X1IA 2QQ0A 2UZ4A 3SDBA 2BM0A 4K87A 2KOBA 3GFPA 3PX3A 1QHFA 3LUAA 4X6YA 3MR5A 3THRA 2Z4SA 4FIZA 3GT7A 3FKQA 1UM8A 2EJVA 2FSUA 4N7MA 2XEDA 2A5JA 4ZOEA 2CDBA 5LUBA 3WIDA 5HW0A 2Y71A 5M2QA 2G9QA 1NM5C 2GM5A 4PRKA 5K2OA 1UJCA 4IXMA 5JTTA 3JQRA 4V3CA 3VDQA 1RPNA 1GN9A 1UT8A 1S77D 1ZQKA 4CVNA 5ALPA 1RAEA 3F74A 3GYBA 3OCZA 5KNDA 2A0KA 5HF5A 2ZQ5A 5CDUA 1EXMA 2TS1A 2ZT6A 4NCIA 4P3NA 4MV8A 5LUAA 1NT2A 4P34A 2XUZA 3V3TA 4NU8X 2VNHA 2VUSA 2XDQA 2JGNA 5K3AA 2KB0A 3QVTA 4GR5A 5JJKA 3O4VA 4HUQB 5B6JA 1HPLA 1CUYA 5REQB 1GQYA 3OOSA 3QJGA 1AIPA 4AECA 2X13A 4KX5A 5F5LA 4EG3A 5DX8A 1L3UA 2OECA 4ESHA 1QO9A 4IH1A 4DHWA 4RKRA 4HB3A 3OP4A 4CG3A 1WE2A 4IXDA 1ZVQA 4DQDA 5KAFU 5LP6C 1JUDA 4O1HA 4MYUA 4F9EA 5LM3A 2H2FA 2UZ1B 1GFSA 1LDEA 3WL5A 2W9XA 3Q8PB 2PU5A 2FPPA 2BGNA 2OCLA 1WMSA 1KEWA 1XTBA 2VAVA 4IIBA 2I03A 4HNRA 2OCDA 1E20A 2J08A 3RYCA 4YCSA 1FU4A 3PFBA 1CUZA 3K53A 1VKHA 3ZDBA 1G6HA 2L0XA 3E7FA 3O1JC 5M5BA 3NMUF 1T8EA 1XEWX 3EG9B 2C98A 4RE6A 4BV9A 3K6KA 1FDTA 1PK8A 3OPMA 3HGTA 1IZ9A 4CL2A 5HQ3A 4FM9A 3PDHA 1X39A 1SXDA 1RJGA 1ECPA 1VIYA 3PICA 1HURA 1EESA 3LT2A 1KMQA 4DLTA 4ZCIA 3BWYA 1Q3UA 1S7CA 3VH1A 5B1EA 1D0VA 1YVRA 3QA3E 4KZPA 5IM5A 1JYSA 1W36B 4JYBA 5JUWA 4HGPA 4RX1A 2XOKD 4UXJA 1CS4C 3HBNA 4ZOHC 3BIJA 4J2TA 5G1PA 3LL4A 3UWSA 3ZWMA 3UMMA 2GYWA 3LRXA 2WABA 2XITA 5DTIA 1QLNA 2VHZA 2W2PA 2JR5A 5FWXB 3GXOA 4NLLA 1R9JA 3UJ6A 4BL5A 3DE3X 3VGJA 1LDYA 4BEWA 5JNWA 2JA2A 1TEHA 4NONA 1XDUA 3ZGVA 4WCDA 1Y6QA 2BKLA 1E0JA 4JR0A 2RAVA 3DLIA 1NHWA 4OJPA 3LBNA 2IEGA 4L2IA 3I9MA 4ARZA 1XLTC 2PZGA 5JTUA 3G8DA 4OXRA 2RGWA 3JZFA 4V02A 1MQAA 3R6GA 3KHGA 2C4MA 2D2IA 1WB4A 4D44A 3OHBA 4F56A 2YS7A 1E3WA 4MUMA 3H8JA 1QM5A 1WD5A 4PXSA 4DLYA 2CMGA 3IDSA 1M0WA 5GGXA 3W1EA 2RHWA 3KYDA 4I9GA 2YWFA 2O6HA 2JAQA 3TVDA 2F76X 4J9QA 4LHZA 3KJFA 4K9QA 2O3QA 3X0DA 3E2MA 1MC8A 2DWCA 3MS7A 3A25A 4DQRA 1NOMA 4M46A 1RQRA 1N77A 1TO6A 1D6NA 2IU0A 3TG2A 3FWYA 3KELA 3DEJA 4Q03A 1NTRA 2NXWA 4DDUA 5KOIA 3M5PA 3KHTA 5IUKC 4BWGA 1DIGA 5CCXA 2JV3A 3AHJA 1YOBA 4J0QA 5G40A 3WJ2A 2EZYA 4HNHA 2WUVA 3JTMA 4JV1A 4X20A 1YZLA 2PJUA 1JFVA 1R0CA 2BQ3A 3BF7A 4CM6A 2CC2A 4JC5A 4EI7A 2OBNA 2VKQA 1XTRA 2AFVA 1NAHA 3JPOA 2EG5A 2P67A 4G1BA 4PFQA 2MYNA 4Z0PA 5BN5A 4DL7A 1T3GA 4QG3A 6ADHA 3NCTA 2HUNA 1XJ5A 3AI3A 1JHVA 4Y2SA 2ILTA 3K0KA 4F5QA 2CT8A 3CX8A 2DUJA 5KFUA 3RYIA 1OWNA 1RCFA 2NUPA 4JU8A 4F3NA 2GA9A 4KZKA 3MTDA 1U8EA 2PZEA 3OE4A 3LY8A 3L6EA 4AMYA 4IIDA 4PSKA 4ISBA 1B43A 3HDTA 3BDPA 1SBCA 3MQ4A 4Y2VA 4XWAA 1HUQA 3D6VA 5DZSA 1CR1A 1D0SA 2YJGA 4AS1A 2OAP1 5IJAA 2D3DA 3SHTA 4DJFC 2HT1A 4B3XA 3R7WA 4US9A 5JNVA 3I73A 2PZKA 1O08A 1NW6A 2QRNA 3SY8A 1QKJA 1I32A 3C6MA 3PUWA 2Q3JA 3VC1A 4WQMA 1ORIA 1PQUA 3GMTA 5DSTA 4ZDWA 3DCIA 3KTDA 3UK0A 3STTA 4IIXA 2BE9A 4CCHA 2FPSA 1V48A 2YXPX 1WZCA 2O5RA 3K9BA 3U7IA 4A27A 2OTCA 3GFRA 5LIRA 3E2PA 3S1SA 1P81A 4U7GA 4WBNF 2HPZA 3BG5A 4DJJA 2YBDA 4C01A 2ZJZA 3HI6A 3R7FA 5KOHB 4JXXA 1RTKA 2P1DA 4B46A 4BWVA 5SZHB 1PR9A 2PWPA 4FZ3A 4QSHA 1HDCA 1Q92A 3BMCB 2EIHA 2NP6A 3B6EA 1WXFA 1X6IA 3FA2A 1SD2A 3ORQA 5IAOA 4DC0A 4RGYA 2OM2A 4HDKA 1KMHB 9ICIA 3EIEA 4J9KA 1LWOA 3HVJA 1U2GA 3OF3A 3Q11A 2IOFA 4MR7A 4O0MA 3TX2A 1KC1A 3VKUA 1GL9B 3NYIA 1DJQA 4LF9B 2CF5A 4DSJA 3RODA 4DR1B 2KKPA 1MV8A 2CVPA 4ABTA 4K0KB 2VTVA 3CUTA 3DFKA 1Z0KA 3BHNA 3FJ1A 1E77A 3TUJC 2IZ0A 1N2XA 2EL7A 4Z2AA 1JLLB 1WPGA 3STYA 3AERA 2IP2A 3LZCA 1K1QA 4NQRA 3VC8A 1FXUA 1N2ZA 4IFEA 3LUFA 4RQ6A 1X7YB 1SBYA 4KIUA 3KJQA 4YUYA 3WFJA 4GFJA 3G2HA 1T36B 4OPMA 2Q6VA 3FSGA 4R3WA 5K4AA 2HXYA 3VVMA 4AMBA 4YAKA 4L8VA 4NBUA 4U7HA 5H3LA 3ONVA 4X45A 4ZJYA 5M34A 5DRYA 4UPEA 3AP2A 1LS1A 3SFZA 3Q7QA 3RSHA 5B5EU 1KJ9A 4FS8A 3KBBA 2IYUA 5TPZD 4Q8EA 1AKMA 4PC7A 1R6AA 3RNOA 2ZWIA 4CM4B 3H18A 1SU8A 3MJHA 1X19A 4Q15A 1F7UA 2FH5B 2AIRA 1AURA 1KJIA 4G5FA 1O89A 5HF8A 3ZW7A 2J9YB 2KFZA 2QK4A 2VP0A 1NJXA 2E37A 4KLZA 5F9LA 3NJRA 2HCFA 4M98A 2BVNA 4OIMA 5EHQA 5FEUA 4KO3S 4NS4A 1Q57A 4YP5A 3RIMA 1EFRD 2XPCA 4Z0NA 1XTKA 1DLJA 2C1EA 2Z1NA 2OCGA 4MLPA 4YRIA 2FJ0A 1BVHA 4WNAB 2W2LA 2VHUA 4TYNA 1AXRA 1YU6A 1UWCA 3BXZA 3GT4A 1K1SA 4HWSA 4NPCA 4PBSA 2ZJ3A 2WOOA 5G0VA 1TK3A 1G4UR 2VDPB 3NHBA 2X0NA 2JDIA 3QMPA 3NEPX 3I5XA 3CRRA 3LAWA 4FHEA 4KPFC 4A1FA 7ICUA 4FFSA 4LXTA 3CCFA 1UC9A 1C9NA 1VCIA 1G8JA 1KEZA 4X7RA 3WNDA 2LWIA 4QAQA 4QX6A 3UAWA 3IILA 3AWDA 2VJDA 1VL5A 4LIPD 4R2WA 4WDQA 3FGOA 1LBHA 4WXRA 2AUMA 1NNSA 1RC8A 2YS6A 2O7NA 3K20A 2ARKA 2FZGA 2VH2A 1Q91A 3I05A 4O29A 4CTNA 1DIBA 3N70A 1PK9A 1VLMA 2WA2A 3JW8A 3M7IA 3BD7A 3IMKA 4TSFA 1NVKA 3JV7A 3Q87B 1QG6A 4DQLA 5K8LA 3SF0A 1KORA 2CNNA 2GN8A 2G4VA 1VCHA 3LVQE 2VPWA 2W8ZA 4TZ6A 3DTVD 1FMCA 4FR2A 4NNOA 3B7PA 1HEUA 3E23A 5JZMA 2WAAA 2ZBDA 4EPTA 4JC8A 2VA3A 4JEUA 3TIVA 3TAHA 3M2PA 3ZV7A 1G64A 2HO4A 4RW0A 4AN4A 1ADFA 2O8NA 2V7TA 3MGCA 4Y98A 2RSLA 5KYYA 1BGWA 4Q1DA 4ZAZA 3V9PA 4RY8A 5HS4A 4L5CA 4EUHA 4DNOA 2EANA 1YZ7A 5BSKA 1LXCA 2XMDA 4K9DA 1XTSA 2UZ1A 2V0NA 4RIEA 4EF4A 5KVCA 1XA3A 4S35A 3UH1A 3D81A 3FKJA 5D2CA 4ZT6A 5JAOA 3CF2A 1JFRA 3KLBA 2VAPA 4K1LA 3VTKA 4K4GA 1M1UA 2HWKA 3MUFA 3QV1A 4JDUA 1EE2A 2HU8A 4JUFA 3GLFB 4RSMA 1K86A 3EC7A 2H9YA 3B6IA 4L5AA 4YFVA 3WLSA 3ABOB 1RKXA 4CG2A 5AESA 5C8DA 3I2IA 4P4OA 5SZIA 4C3VA 1XL0A 5TQVA 1ZCFA 2DJ5A 2EFHB 4Y2UA 4JT9A 4NU5A 1H65A 3R7SA 3IEPA 3VR3A 4RNMA 1K06A 1L4NA 2PKQO 4IZ6A 5DX1A 1OPXA 2DFTA 3ROEA 3UENA 1OZFA 1N36B 4PZCA 4MRAA 1CNFA 5T3YA 3V42A 2PO5A 5HJEA 4QDXA 1HLDA 1IC6A 3DCJA 4YR3A 1E1RA 3E22A 3TPFA 1DRUA 2K87A 3CJQA 3QBVA 4JUDX 5B3LA 4Z4FA 1L5HA 3JQBC 1SQFA 3F5EA 3NHPA 2OFFA 3IHQB 5IM4A 2B7BA 4V0MA 1ZUD1 4XCXA 2X0KA 3WV4A 1D7AA 3G2QA 4IDDA 4IH4A 5EP3A 4EJSC 4TMTA 4TRNA 1V5WA 5JSFA 4J9RA 2GNOA 2KIWA 1EWKA 2WR8A 1EEXB 3OT1A 1HORA 4H6XA 4MLZA 4LV6A 1OIWA 3M4XA 2PHZA 5J5CA 2YHIB 1GA1A 4NJMA 2YUTA 1K92A 3FDSA 1QTMA 1W36C 3ZZMA 3P4XA 2W83A 1MJGM 5L4SA 3IN5A 1W5SA 1VJRA 3FSEA 4M0PA 4RIGA 2XY4A 2ZRMA 4I2VA 1DG1G 1JQDA 4C05A 4C6TA 2BPOA 2WHYA 3WRYA 4Q7EA 1Z26A 2WU1A 4XVUA 3V4ZA 4PNPA 3O2NA 2COUA 3O03A 3PQCA 2WAQC 4MHSA 1CUHA 5HHIA 1DC6A 3BZUA 4JJEA 3W6NA 3HXQA 3KSAC 2B30A 4LE0A 5DBBA 1J8QA 3U17A 5KQMA 1I7DA 3PSFA 4RPLA 1H2HA 2P0YA 2XTJA 2V0CA 3EDQA 3G7UA 3B6KA 3MRTA 4QUDA 3V7UA 5ALGA 3ER9A 5IJXA 4CF7A 4DR6B 1G7TA 3AUYA 3DQPA 4HPWA 3ROZA 3WYEA 2Q5LA 2G70A 2RI6A 3ZHXA 1KSPA 1HT1E 1TCVA 5JZSA 3EWSA 2YICA 4HC4A 3FTNA 2AOXA 4HLCA 4LBWA 4IOKA 5GONB 3PLAE 4KLDA 3M6UA 1Q3VA 1QS0B 4W5RA 5CPBA 5L1IA 1X9IA 3P27A 2NO4A 3OA2A 4RZRA 3VZPA 2XWJI 1PUIA 3GGSA 3HU3A 2QP9X 1PSDA 1RYUA 2DBZA 3ISBA 1GNVA 1UMCA 1PCXA 2Z2ZA 1LSUA 2WQ7A 4HH0A 3G5TA 1GEGA 3PXBA 4IQ8A 1KQPA 2HT6A 4FLMA 4R5MA 2B0CA 2KTQA 1QH0A 3GLGA 3QZUA 1O03A 3CN9A 3K8QA 4CLRB 2ZYGA 3MSCA 2P65A 2W6QA 2J6BA 5COAA 4G37A 5AJHA 5T6BA 5DM0A 1Y5LA 5AHWA 5FOVA 1TRKA 5GPBA 3T5TA 5BVHB 3ER8A 4UUQA 2OGWA 3T3GA 1JEYB 4G8DA 3SSMA 4IKPA 1FFVA 2O3SA 4B6FA 1KQGA 2J7PD 1QP8A 1XDWA 4GZ6A 1BHO1 3DMNA 4L02A 2F43A 3H2ZA 4CV0A 1U47A 2FWIA 5I8PA 3MRSA 3PNVA 1G55A 2OFXA 7ICLA 1N2EA 1SAYA 4TRJA 2ZWVA 5CXXA 4ZQHA 3GOHA 5AMXA 10MHA 1II8A 1Q0HA 1XZNA 3ZQUA 2XTAA 4E6EA 4WLFA 2EGUA 3G2NA 1H4TA 1P7ZA 3K5WA 1N5WA 1WWUA 1E2EA 2IYXA 2ZBFA 5BPCA 3BMCA 4PQRA 1PQYA 1L1QA 2BGMA 4JROA 5EWJB 1OT5A 3V80A 5IK2A 3DTNA 4YPVA 3NHAA 5EYPA 2HBQA 1O0CA 1DEHA 2ZSBA 4K9KA 3FVRA 1DOQA 3AP3A 5J2UB 4I3GA 3TDMA 3W2FA 2WLTA 4F3RA 4ZI3A 1L5GB 1TF7A 2AC4A 3OZAA 2G08A 4WERA 4XVRA 2WUEA 5JRTA 1RRVA 3FUXA 2HHQA 4B9NA 5EXPA 3B1VA 2M6RA 3CSDA 1Q74A 4PG6A 4RAQA 1EJ2A 3RUDA 1MT3A 4J9PA 4RIHA 4TL9A 5CP8A 3R74A 5BR7A 4QHYA 1G7RA 4JS0A 4Q12A 2C0CA 2KKVA 5TF0A 4IVNA 2ZBEA 5JCOC 1L8OA 1ONPA 1ZZEA 1ZX1A 4WOPA 4NBRA 2E8NA 4MB0A 4XCQA 3TEJA 1AY0A 1DINA 1MKYA 2J41A 4J16A 3PGVA 3VVBA 1KYXA 2EYQA 2YHAA 4HLDA 4DLXA 1RWMA 3V4LA 3NDBB 3NHUA 2V98A 2IV3A 1KC3A 1KAMA 1FP1D 1SCDA 4D4IA 3L6CA 4MWDA 4B33A 1UC8A 4YMUA 4F72A 1YE3A 2JB9A 2YUIA 2FETA 3BQMB 5K3OA 4BWMA 4QLBA 3KQLA 3L06A 2WB2A 3ORYA 2G6TA 2XA1A 3DT6A 2XSZD 1BWRA 1CUWA 3VNAA 3KEOA 4ED3A 1W0KD 4HXGA 4O3PA 4AW9A 2JIRA 5FWDA 3LY7A 4A9AA 4KB5A 2J6HA 1NXTA 1V8FA 1ESDA 4GPIB 1YTLA 3L0YA 4H3SA 4JLSA 4M99A 1W48A 5DCUA 5ARDA 1MOZA 1L3SA 1PV2A 4BFUA 3UQ0A 3D4BA 1Z00B 3T5CA 5JAIA 2BI4A 2PQ0A 3NGLA 4KG7A 3K16A 1QQTA 2ZRBA 4MUIA 2GR9A 1KFJB 2C5BA 2O2DA 8ICCA 5HRAA 2HK8A 3U4GA 1HDEA 4OJ6A 1Y48E 4OX9B 1UK6A 1M8FA 4IG9A 2ID8A 1R5BA 4KODA 5JG7A 2MU2A 2VZ9A 3ICCA 4JUZA 2J5BA 3H1TA 1D2MA 4II7A 3EIQA 4M89A 4BZWA 2X4DA 2C7BA 3I6ZA 2R8JA 1YL7A 2OP0A 2R4UA 4WMLA 1SXGA 3NKLA 1WOYA 2YQ5A 2JIQA 2ZGVA 4LF8B 4DXDA 4WLEA 1ZK4A 4MUNA 1N1DA 1FTNA 3WICA 5JH7F 1GT91 3KT6A 3CM0A 2C2KA 3HO1A 4FO6A 1MIOA 3TAXA 4ABYA 1M8PA 4Z3KA 5I3CA 3ESRA 3L7LA 4KIGA 5G02A 5CEEA 3GJ5A 3TECE 3P9YA 3AR5A 1C14A 5G1NA 5I8ZA 2O19A 2QOEA 4PQEA 3DJYA 3D7MA 3DL4A 2OV1A 3GX1A 5IKMA 1C4KA 4CG1A 1EINA 1OWLA 2ZRFA 4FR0A 3NDJA 3VC3A 3B5JA 2PQ2A 4PE5B 5FJJA 5KHAA 1QYXA 1V1JA 2FEAA 3HKDA 5HRUA 4OFXA 3DJFA 4B35A 3KPJA 2NUTB 3I34X 1TV9A 2OHVA 4B6GA 1W6RA 2V5VA 5KNBA 1YR8A 1GM5A 2H65A 3B3GA 1T4CB 3PEWA 2HHAA 3MFHA 1AF4A 1NIJA 2BFFB 2MSDB 3R0JA 4PGHA 3RVDA 2C5GA 1SHJA 2GX6A 4TS4A 4YHHB 3ERCA 3WO0A 4BIMA 1V85A 1GNQA 2O1XA 3LXUX 4RV9A 4D4GA 4ZCRA 7ICHA 1RE1A 2IZ5A 5CCDA 2J3KA 2X9QA 3KKQA 4QLOA 4MVJG 5T6MA 1XYGA 2ZEJA 2XUFA 4GRIA 1PDOA 3MB8A 5BMVB 3H1GA 2VEOA 1A9RA 1P5ZB 3A2MA 4FYKA 4KMSA 3R6TA 2E5WA 1Z2EA 4I27A 2HOIA 3ZK8A 5JXHA 3C1OA 5DNEA 3W7VA 3OTHA 4DBLC 2OLEA 3EULA 4MUYA 5IJ0B 3K0SA 3MAAC 2BOVA 2I71A 2ZDGA 1IY9A 3A9SA 3CCBA 4PAGA 1C3LA 1CPYA 3ET5A 2FFAA 1KI8A 5CTAA 4BQQA 4FCTA 4DLBA 1GCOA 1CV2A 5JSYA 3RWOA 1FLDA 5KMGA 4RFLA 2X9GA 2ZDHA 3PC3A 2GK6A 4X6UA 4ZT4A 7MHTA 2JC3A 1L5HB 1NLUA 2O3UA 3HADA 3PHHA 5DWDA 1SEVA 4YYZA 1Y1PA 1JB1A 1MPXA 3GEBA 1WSWA 3K70B 5G0SA 4NLZA 1YB4A 3JSAA 4WFQA 4F2RA 1NP7A 2BC9A 1F06A 2GDJA 1MO6A 5G0UA 1Z6AA 5KFBA 2QN6A 3V5NA 4UDNA 1X42A 2DFNA 2ENWA 2C57A 2I6FA 1T8WA 1YS1X 2I67A 2IYAA 3HN6A 2WYOA 4OI4A 3EGCA 2YTUA 1V9SA 2YHIA 2PUTA 4BDTA 1DKQA 4XLZA 3X1XA 5C5DA 4JGGA 4AB1A 4M1WA 1E3JA 1K5OA 1NVAA 4OHUA 1FP6A 4DGSA 1HNWB 4H1TA 2NO1A 1J21A 1SNYA 3A3NA 3TACB 3BSYA 1L4GA 1OV6A 2BKXA 1PZEA 2EDCA 4B6OA 5KVAA 2C31A 4FOLA 3RJHA 2O6KA 4O3RA 5IT5A 1AGNA 5B4VA 5ALOA 1J0EA 1OXXK 4OHPA 2BSAA 4OJYA 4UREA 2HCJB 3WBBA 2NZUG 1PF7E 4HTAA 3JAWB 1U3FA 5JXWA 2I6SA 2Y2UA 4OK3A 4QSMA 1I36A 2V4UA 4ED7A 3LL7A 4NV0A 4Z9AA 5C80A 1HR0B 3ZOKA 4PG7A 3DVRX 2BT4A 4K9OA 1QIDA 2ZVQX 4UB6U 4B84A 4EWLA 1T34A 2G1UA 3OF5A 2WY2D 2WZCA 4PC1A 4D3DA 2IOQA 2H48A 4LXQA 5EJIA 3RJMA 2YMLA 1JH8A 2BN4A 4A8EA 2FEMA 3DEKA 5AKEA 2Q6IA 2Z4RA 2QRZA 3JAKA 2H18A 3CXRA 1ZLYA 4DDKA 3I0ZA 2W03A 4CM8A 2DR0A 2XUJA 2CXYA 2LM4A 5KFQA 2QIOA 1V1MB 2YZMA 3IUQA 3O4JA 1R37A 1ZWKA 3B1ZA 3BRSA 4I4TA 5IMBA 3ZCTA 1HUOA 3G6WA 4MKFA 1QGZA 2FLNA 2QLFA 3IKMB 2PKEA 3OIDA 1RABA 5H5JA 1XO1A 3FC4A 3OLXA 3N76A 3SJAA 3AB7A 3V7NA 3MYRA 1Q19A 3H7AA 1BX1A 3JQBA 2POCA 4TT3D 4DQPA 4HZUA 5AUOB 4YRFA 4DL9A 5BY2A 2MINA 3H4DA 5KFNA 4KO1S 3ZNQA 5CFOA 5IWAB 3GRKA 4MR8A 1QK5A 5ALWA 1CHNA 4BCCA 1E9VA 5FOXA 2COEA 3K5PA 3EPGA 3U7JA 4FOTA 4O59O 1XFDA 1NXPA 4XAQA 1ZQ1A 1FVOA 3K5IA 3M6FA 4IIYA 3OIYA 4ZO9A 4C07A 3EA5A 4IVRA 1BE6A 1LJUA 4DT1B 2HV9A 2OC9A 2DFDA 2LW7A 2O5CA 2L18A 3FGPA 5JBQA 3PE3A 3Q41A 3PW7A 2I4IA 3HUDA 2R2GA 4XGRA 1AA9A 1ZA2A 2R6AA 2XRMA 3QEOA 3I5UA 3P2KA 1IYZA 3R3ZA 4P4SB 3ZHRA 3VNVA 3W2TA 4RT2A 4ZCTA 3MGAA 4ANFA 1UBCA 1E6UA 3H97A 5BVGB 3FCUB 5BWMA 1ZI8A 1N62A 3QVGB 1SKRA 1A82A 5EWJA 4H1VA 4PZEA 2ZIFA 1NW3A 2C5FA 3VR0A 5C51B 1O94A 1B22A 3VYTB 4HH4A 5EYPB 3OTIA 3N28A 1PEAA 5TV2A 4RHCA 4TXJA 3E9ZA 4HN9A 1Q16A 1KI6B 3MCUA 3HYSA 1D2HA 1QTIA 1ZH4A 1G6Q1 1A1SA 4GBJA 2PS3A 4QRIA 5FBVB 2JFGA 1TF5A 1W29A 4ESOA 4R8LA 1HT2E 4Q02A 2VBGA 3QLTA 4MS3B 1KOGA 4M8NE 3G88A 1J6UA 2QD2A 3S2UA 3WTCA 3NR2A 3A6PC 4J0CA 3EA4A 5LZ5A 3PSPA 1I33A 1M1YE 4Y6GB 4EY8A 1VJ5A 2MTBA 3GMDA 5ICGA 2HRCA 2JCYA 4CV1A 1X70A 3S7ZA 1FO4A 1L4YA 1TPZA 1TCUA 1NVBA 2FSFA 2R8OA 1CDZA 4JQOA 4MVXA 2G1KA 3TLEA 2UZAA 4I2NA 4PN3A 3U1TA 1P9OA 2W7TA 3KZNA 5HZHA 3BJYA 3OPVA 2OD7A 4HMQA 2R8RA 2FN4A 2JHCA 3BXOA 3L8DA 2R4TA 3MERA 4PZZA 3KU4A 4PZNA 4L4UA 4EEYA 2AFRA 2VBFA 5A5GA 3K1YA 3F3KA 1XZIA 5DK6A 4LDAA 3LE8A 1L7EA 4HL6A 5C5EA 4ZVQA 1GUDA 1FUIA 3JPWA 2ZI3A 5AKLA 1BJKA 1AUVA 1J99A 3N2KA 4GI1A 1Z2NX 2AJTA 4IMJB 2HA5A 3NV7A 1GILA 3HWTA 3RV3A 4ZQBA 1QF9A 2XYHA 3P9IA 4C5CA 2GSWA 2RHHA 3D6NB 4GOMD 3TAQA 4HFMA 4ZT5A 4PL2A 3UFBA 4BGEA 5A4MS 2Z5VA 2VUUA 2Y1KA 4HSEA 2CXTA 3CT6A 4G4GA 2QRVA 2AG8A 4PF1A 2O2ZA 2DT8A 1QIKA 2QMOA 3CLUD 4A8HA 4BP1A 4DEYA 5KTMA 4LFAB 3M6ZA 1PZFA 5EA2A 3AINA 4KPEC 4EGFA 1ZJNA 4G5YA 2FDXA 3SZ2A 3P9QA 5F21A 1YJ8A 2EZTA 2P7HA 2WWIA 1L7OA 3OJFA 5JJLA 2KD1A 3SNKA 2Q41A 1PV4A 1U3CA 2HF8A 4UUNA 3DKVA 2QD4A 2GI4A 4PSVA 3PX7A 1GFZA 1KYQA 4ZI5A 3QKTA 3K9LA 3TIXB 4B8WA 3SFVA 1Z7EA 3CJRA 4XIJA 3T7AA 2CGEA 4FJ0A 3A2KA 4EX6A 4P22A 5KFGA 2Z43A 3I62A 1RWBA 2BAGA 5B1DA 5EOVA 3EVFA 3W8NA 3O84A 1VJTA 3T4UA 1EDBA 3JQFA 1VLVA 4CL8A 2XWSA 4PNHA 5YASA 3SC2B 5A2QA 3NV9A 5EMHA 3MGVA 4C4RA 3FCEA 3IKLA 3EEFA 4EW3A 2QYOA 1RE0A 4MRMA 5C7YA 3T38A 4O0LA 3BB3A 4UCWA 4D4JA 2RGUA 4BO1A 1U7OA 2FEPA 2A9JA 3G1TA 5AHOA 1EUQA 3ZU6A 2VSOA 1RKUA 3V7WA 3ZWOA 4YRMA 1C4XA 3VC2A 2PA3A 3VX3A 3P97A 1TU4A 4G0UA 1AV6A 4F3YA 4PHCA 2JAUA 2DKNA 5KSZA 3AEQB 2A1TS 3F2IA 1I2BA 3IX7A 5LXTF 1EGMB 1C3XA 1HC7A 2WZDA 3MJDA 1WHSB 1MR3F 5EJGA 4AP5A 2PWZA 2QTCA 1HLFA 2HD4A 2Z2KA 2DE0X 3WLRA 4E33A 4F5PA 2EFJA 3Q9NA 1Q84A 3K0CC 1W2WB 1VXOA 2JCGA 3QKUA 3ZE1B 4OHYA 1NI3A 3D7LA 3H2HA 1H38A 4BVFA 9ICXA 2FG7C 3MTGA 3DZBA 3RC9A 2KBEA 2GKGA 4FGLA 2POQX 1EHCA 3B85A 1NATA 2XD9A 4EHIA 2C4UA 1KAHA 3V46A 2G7MC 5EERA 1ZCZA 2YXDA 1XVAA 4DSKA 2CLMB 1Z4QA 4PSDA 4WEQA 5FOSA 4ZICA 2G07A 3LUKA 1P2UA 4IDGA 5DBGA 2QT9A 4X64B 4AZ3A 5KMGB 1BNCA 3UTDA 2XB8A 1TZKA 3H9UA 2N42A 1IOZA 2CXXA 4DR2B 2ZRPA 2NRVA 1YOVB 4CIBA 1VLHA 3N2EA 2WIAA 3ETLA 4L8GA 4MKIA 4W5QA 1PR1A 1V41E 1Z8FA 4J9MA 1E99A 5BNWA 1GO3F 3QLUA 4XIYA 3F8SA 5A04A 1BIFA 2G72A 4K86A 4U7CA 1AHHA 1Z4JA 1H2FA 2CSXA 4J91A 1KTQA 1SWWA 4MQEA 5KFIA 2KI5A 3NBFA 4QW9A 3R5KA 1B3BA 3VUEA 5D87A 1EVEA 4QTYA 5KFCA 1H0KA 4WDRA 1V47A 2BKUA 4JCOA 1MVOA 1E8MA 3LKDA 4D97A 4JKIA 4Z4EA 3KFUF 4MIYA 1DGJA 5ALZA 1D4OA 3C5CA 3HACA 2ORWA 3CX4A 1VRWA 2AE2A 3QH4A 1S3SA 3I8XA 3AFNA 4HGRA 1FQKA 1SCIA 3AVOA 3B52X 3DLPX 3IHWA 3LSTA 3D2QA 1O94C 2GAIA 3KDPA 4CIXA 2B4TO 1GKUB 2GPSA 3FAHA 4RWEA 3H4TA 4QOGA 4D79A 3RAQA 4KAFA 1VZ2A 4LDQA 5J2DA 4R2JA 4ZVRA 4KE6A 2WKSA 4YROA 3WSWA 3QPVA 2JLAA 3E8XA 4B8YA 5CCEA 3TI7A 5JE8A 3DCYA 3I01M 1YU9A 1EK1A 3NETA 1OAOC 1TKCA 2Q1WA 3CPJB 4PYQA 3A3YA 1X13A 3VDXA 3J81A 5LD2C 4XCVA 4ESEA 1CQWA 1KYTA 1V6AA 5CIQA 4E11A 1YB2A 1ZCBA 1CZNA 2UVPB 4QFCA 1S1MA 3IP8A 5BMVF 3KYCA 1KTVA 1XJQA 2RI1A 4X3PA 1DWOA 2FOLA 2JIMA 2MSKA 1EUDA 3GGPA 4NJOA 4RNCA 1ZK2A 3S1AB 3ZZ1A 5KWVA 4CM8B 1IHXA 2H51A 3KV3O 2HMUA 4GI2A 3KYJB 3GJ3A 4MQBA 2NP7A 4I4TB 1SUEA 5P21A 5FPPA 4L4SA 1RQGA 3V6MA 4XGNA 2GN6A 2G5CA 3GOQA 4OAQA 4RK6A 3COWA 1CIVA 4E21A 1SCJA 1DMRA 4DKJA 2FSGA 1DZ3A 2C4HA 2ZSEA 3D7SA 4HZUB 2ZE8A 4LDRA 4GE3A 3PQDA 4MA5A 2P2SA 4X1KA 1XZMA 4DIKA 3NHSA 5I5GA 4KDCA 1TTQB 3UWOA 1YJBA 3FRJA 4L08A 4DKXA 2K4HA 3TNFA 2FCRA 5DM70 3WG9A 2IYWA 1NK8A 1AS0A 3ETHA 4HTFA 1GGNA 1YVPA 1C0LA 3RYFB 2ZUBA 4DT1A 1XZCA 4OSOA 1PP4A 2H4JA 2Q7DA 2JEYA 3S4YA 1SM4A 4P1ZA 2WYHA 3WRXC 4OQLA 1V8DA 1NW4A 1JV2B 3PF9A 4B4DA 2JFPA 2ZJ2A 5AOBA 4K46A 4W7IA 1X86B 5LU9A 2Q4RA 4TL8A 2OAGA 5KFOA 3PO5A 4HEHA 4N9WA 1NLMA 2AW5A 3IHTA 1FS5A 1LF0A 1S10A 1ZOSA 3PRKE 4FJ1A 5FP0A 5C0OE 1ZBQA 3Q3CA 4XFKA 1W44A 2FP4A 2FEOA 4IIUA 1VECA 2WJYA 2Q29A 4YN3A 2ZTHA 3VM6A 3HLTA 1HYBA 3IT2A 1JBKA 2J4DA 2MR6A 3EZYA 1I4WA 3QQ5A 8ABPA 1H6CA 4V0QA 3THYB 2IHBA 5CFZA 1MVLA 4Z6FA 2M9NA 5F1PA 4BVGA 3ODGA 1RBYA 4R1OA 4RNNA 5BN4A 4QQRA 2FZKA 2JH7A 2JFVA 1TJNA 3IS3A 3R6WA 4F4WA 4N7JA 4AF8A 4HNTA 5DNCA 2PKQP 3DE2X 2PFQA 3JY6A 5GTHU 3ED1A 4IIHA 2J07A 3MEQA 1IBSA 4HAVA 1TADA 2RHRA 4YMTA 1SA0A 1Z0AA 2CBXA 2D5LA 5KFDA 2EP8A 4QAJA 5HKAA 3UV3A 5J2GA 5CRXA 2G9NA 3ZGYA 2IA5A 5K5EA 3CZ5A 1T25A 2WF7A 5IEJA 1LB1B 5DIFA 3R09A 3CB4A 3BHJA 2QX6A 3C85A 2O14A 2CNWA 1YK1A 3S2IA 3HBMA 1D9XA 1HXHA 3BJRA 3R0ZA 1T8SA 1HKHA 3VPXA 5G5HA 1G5HA 5LC1A 2B3DA 2RH8A 4ELUA 1PO7A 1QYWA 1YGPA 2R6HA 1JI3A 1LBTA 3K2BA 3W79A 5CA7A 1E9RA 2O5EA 2ZR8A 4RBNA 2PI4A 3O73A 2PXXA 3DDUA 4EIWA 3BEDA 1IOWA 1JSLA 5HUHA 3SLRA 1O6BA 1ZSNA 3O31A 3CZAA 1M10A 4UAJA 5C4IA 2XUAA 3WL4A 4WGFA 4JGIA 2C2OA 2VTEA 1L3VA 2CJFA 2O9JA 3DHEA 4AULA 3VPCA 4JLJA 3LNCA 1YR9A 1T2DA 3ZWWA 4F1WA 3GLFE 5F1KA 2KQUA 2OSBA 3R3XA 4MB6A 4RGQA 3U4DA 5CR0A 2DH6A 3K72B 3WGMA 2IE8A 1UBLS 1QX3A 4KLCA 3U5ZB 2NQTA 1UBMS 2WMDA 1WDLA 2V4RA 2AMYA 3VMFA 4UB4A 9ICHA 2BJHA 4ZXPA 1AH2A 4E15A 2FFHA 4LZPA 5FWYA 1DWUA 4IRDA 1SZJG 3N8GA 4FHGA 1ZISA 2YIDA 2O0JA 3A1FA 3C15C 4KE9A 1JIIA 1GG9A 4BBJA 5AM1A 3ACDA 2Q5IA 3ZHTA 4LRUA 5KTPA 2GEDA 3N6VA 3Q0EA 3KO8A 3ZX5A 3GIMA 4D3SA 1TK2A 1U2SA 3ADBA 3N2NA 4Z6CA 2BD0A 4YK7A 3CXUA 1JN3A 2RGCA 3DDZX 4JQZA 3V6HA 2VPZA 2ZKIA 4ND2A 2K89A 4PVDA 2V59A 1U9ZA 3L82B 4WY2A 4HS9A 4Q24A 1SC4A 4CG0A 1IUOA 5DTQA 1EFVA 1ID8A 3RFFA 1WW3A 3F6PA 3R3YA 2UYOA 5ES3A 5JQGB 2G06A 1ZJWA 2C9BA 4I14A 1G3RA 3AEQA 4FMCB 2Q5JA 4QKQA 2E1RA 3LHIA 1QB8A 4IFIA 2QAGA 1H8EA 1E96A 1U0FA 2DXIA 2HDHA 5IJZA 4PH5A 1LLCA 1PJLA 2F3SA 1P3Y1 4HXFB 3OQIA 4NNJA 1KRXA 1LPNA 2XYRA 4H4EA 3SC3A 1ISIA 3T06B 4IF4A 3ML1A 2QR3A 3AM3A 1ZH6A 3AF3A 3OJOA 4C7KA 1SV0C 1BFDA 1SIBE 3H13A 3EH1A 4PO1A 3WSTA 1QH9A 5CCBA 3JARA 4FDLA 2JJ8A 1U98A 3EMVA 3IUMA 3KK0A 4KYTA 4QGAA 3WDSA 2FPLA 721PA 2QTWB 4ZGBA 3IBFA 3WADA 3GJYA 3AUAA 2W2OA 4I4CA 4B4WA 2JLYA 1VHTA 3Q0TA 1O4WA 5C8YF 3P0JA 2GK7A 3PZRA 4GMXA 4DMHA 3HUEA 4TKUA 2E5FA 4AZVA 3IIMA 1TM4E 2AKAB 3LA8A 2WWXA 4DCSA 1NI4A 1L9KA 1YONA 2Z98A 2GK4A 3OHPA 1RT9A 4J49A 2HBKA 5EPOA 4W5TA 1PNOA 1C9YA 1RS0A 1Q1QA 2YCBA 1RMTA 1KKMA 3L6BA 2PGJA 3V7FA 1XELA 2A4KA 1H22A 1K1EA 1L5QA 3PLNA 4MYSA 4P86A 4B7UA 1WBBA 3V2GA 1UL1X 2E49A 3P2JA 5KJEA 2VIIA 3OWXA 1TQ8A 4N40A 3SXJA 4MQEB 2DULA 2A9VA 1EDOA 3HR4A 1ZU5A 4K26A 2XNDA 1E79D 4S1WA 1Y9AA 5JNSA 5JSKA 4HDMB 2FF5A 1HE5A 5DP2A 3OSNA 2OWOA 2LDXA 3IT0A 5CT8A 4PYKA 4UDXX 4ZO8A 5GGYA 1SHTX 4QELA 2EW1A 1QHIA 1F0PA 5DXAA 2HMAA 4YYEA 3ZHZA 2JH8A 4O4HA 3CW9A 1BVSA 5CLGA 3OQHA 3KWJA 4UEKA 3BRWA 4XX0A 4QBIA 5AICA 4KWHA 1M5RA 1T5LA 1JEEA 4BQPA 1C30A 4MMYB 1GRVA 2CL6X 3EWIA 5J5AA 2JHDA 4LHSA 1ZN8A 1GQOA 3NVYA 2LKCA 2Y1JA 1SVWA 3EZLA 2KG5A 3DF7A 2JFYA 4OXXA 3TG8A 4Q01A 2GJAA 4FN5A 4ZEXA 2AFIA 2IYEA 3ID6C 4H6PA 4TROA 3W6OA 1MJGA 3OOYA 4RVCA 2TMDA 5CLIA 2ZG6A 4E6PA 5KKNB 1SXJE 4G1FA 3P0EA 4QZBA 2Z6AA 4U7PB 4A36A 3KJIA 1M6WA 3D8NA 4P4NA 5MHTA 4RHTA 3ZHBA 1J2MA 3R9XB 3S1AA 1B8UA 1FVXA 1UBHS 2WIJA 4ZJPA 3JRXA 4G07A 3RAFC 2RIRA 1HH4A 4L6CA 5AVZA 3U3RA 4M0AA 2P5UA 4D9EA 3MB5A 1Z8DA 4A2PA 5CB4B 4IY1A 1WG8A 2RHJA 1Q14A 4IIFA 1XEFA 2GZ2A 4CPDA 5KNDH 4JI7B 2ZYSA 3C43A 2KJQA 3EXIA 1CUDA 3QJ5A 3I09A 1I80A 4JDPA 4QBTA 1DC3A 5JS2A 4X1KB 1XD9A 2GBFA 3AOGA 1SU7A 3LBIA 5JDCC 4LQCA 1FRFS 2IYPA 4HDSA 2CVFA 3D0RA 5BWBA 4V2IA 3HPOA 1YUBA 2LE0A 5B53A 4ENRA 3DXZA 4J6EA 1P4SA 2RB5A 2VXCA 3T99A 2R8XA 5C2JB 4B9LA 1RYSA 1B3RA 4PQFA 4TTRA 4Q9KA 3TR5A 2FMIA 4YWHA 3WGNA 5CEJA 4NV1A 3BMQA 4YJGB 4RYLA 1OYYA 2CNLA 1ZSYA 1W2GA 3OSPA 3HDQA 3LT1A 4IEIA 5FPYA 5KOJA 4AY4A 3A1SA 1NR1A 3ZV4A 1TUEA 2VJOA 3ITNA 4DTIA 4P0PA 5ES4B 5FEMA 2JHGA 2OO3A 1UJBA 5KS2A 3U1VA 3LWZA 3RVRA 1Z4MA 4C2AA 3PVSA 1VE9A 2QP3A 1NBHA 4JN6B 4YX9A 1U4SA 1ZI6A 4PO8A 3DLBA 3OM8A 3REFA 4CBVA 1GYPA 3HP7A 1NRXA 3VSBA 2NVUA 2RH5A 5J0YA 3H5IA 2ZE5A 2EFCB 3B1FA 3JQ9C 3R3SA 2C3UA 2IHKA 4S12A 1YVEI 4DGQA 1IJBA 2FPGB 5CNKA 4F5EA 2FTKE 4ESVA 4QU9A 3EGXB 4BJ3A 1R15A 1V9LA 2XO7A 3A4YA 3S6JA 4QWMA 5B30A 5JROA 1GCUA 4PLHA 1QV6A 1XA4A 3DWIA 3C39A 5TPWB 4PQGA 3GDXA 2B83A 1QRRA 2HDWA 5EWLA 2RK4A 2Y76A 1L4MA 1ABFA 4JR1A 3IURA 3MZ0A 3PEVA 5KSYA 5DHQA 3X1JA 2XDWA 2C22A 1M83A 5E6SA 4P58A 2EV9A 1ZN9A 2AT1A 1SUBA 1FIQA 4WZ6A 3VA7A 1B6TA 1KJZA 2Q0XA 4NPAA 4WXYB 3TOZA 4EHNA 2CB9A 1OBFO 3QEAZ 1R5JA 1C1XA 2V6IA 3ETDA 3RIYA 3KR2A 3ZGLA 4DIEA 2WINI 5DP1A 1D1SA 5JV5A 4UQGA 4EA8A 3K1ZA 1QCDA 4MRSA 2VRBA 3K7EA 3TX6A 1CUIA 3CBQA 3FPSA 1CJTC 2P2GA 4JP5A 1P19A 4MP6A 3ZU5A 3TLXA 5JU6A 3LLVA 4XYGA 1J0AA 3LWNA 2CHGA 2VANA 4IZHA 4IJ5A 5B4TA 4Q66C 4F4UA 2J32A 2R6ZA 2O54A 1QE3A 5L1MA 1N7IA 2PLAA 3PC2A 3T0IA 3WP1B 2Y9TA 2H1IA 1KU0A 2C7QA 3ZDZB 5KNDD 3L5KA 3BJIC 2SICE 4LBVA 2WTNA 4BMDA 1J1UA 1GGKA 2IOYA 1G9SA 2NAPA 4QDUA 5ED4A 1CK4A 4RTLA 5HF9A 1ICIA 2ZRGA 1Q3KA 3FZYA 1IMOA 1R5OA 1TVKA 3MRXA 4UNSA 5BQ5A 2QSUA 2Q3HA 3B5EA 1NXVA 3DV0B 3E4DA 4F4ZA 3VYWA 4DLNA 1BPEA 3ZWXA 3D2CA 4AP6A 3HDGA 4RA9B 3VNSA 4OEHA 5AI9A 4CWAA 4ED6A 5K7SA 3QVKA 3UVEA 4KAXA 1AVTA 2F44A 2AF4C 1R9GA 3EGDB 2ID7A 2O3JA 2EIXA 3Q3VA 4PLWA 2X6RA 4W1RA 3ZVKA 4UDOA 3BQNB 4OHBA 3SLKA 3WZLA 5HR5A 3TM5A 2JFOA 3S2GA 1WXWA 4ZKDA 4BUGA 3HPQA 3HSKA 1HFKA 4KQXA 4S1TA 1NQXA 1WVIA 1F2VA 5K05A 4W4TA 4BU1A 2BFPA 1W36D 5FNVF 2QD1A 4IFBA 2EBFX 1BPXA 1UXKA 1BQ4A 1R6XA 4RQ7A 5AK0A 3MIIA 1H6AA 3MGBA 1K3TA 3PUXA 3OZCA 1UQRA 3EMBA 2PU7A 3PE4A 4IHAA 5FUVA 1V97A 1PVVA 4RHXA 4DA9A 1TVAA 1T0PA 5L6MB 1R64A 1UOOA 2G17A 3RAPR 1NMSA 3QFFA 2X5XA 1NUPA 1QLWA 1T3SA 3DAYA 3Q40A 4KI7A 5IXJA 5KPJA 2KS6A 3W5UA 3B2NA 3IAM6 4XASA 5KFJA 2A30A 2WD8A 3DH0A 4K3UA 4GIBA 1GG5A 5AVYA 2P5SA 1HE8B 5HKKA 3G8BA 3ISTA 1SJ9A 4FZJA 2NTJA 5JT1A 1CJVC 3PFKA 3FVTA 2XB4A 5EKTA 3ZWYA 2CLIB 1XP5A 3SX0A 1JHQA 3TLBA 4ZZ1A 3JQAA 4Y6OA 1N48A 2BKVA 2REXB 3ETJA 4V1CA 5JJBA 3OUZA 8ICTA 1N3BA 1WIWA 4EMBA 3D43A 3EVCA 4OHFA 1E1CA 5A3JA 4L0QA 4HPJB 4WIAA 5D3KA 5IZCC 2EAPA 3K4PA 5ALJA 4GP7A 1LSSA 3O93A 1N5JA 1GAQA 4TKUB 1SUPA 3WU2U 1N8KA 2RFLA 1PR0A 2YQZA 1A04A 3K2EA 4GGPA 4IIEA 4WBXC 4ZT3A 3RFVA 4ZEMA 4M1MA 1NHGA 2AD1A 2IJGX 3NXKA 3V2UA 4D3YA 1A5AB 2I62A 2V7WA 1BS9A 3T9CA 4P4MA 2CV1A 5AK4A 2RQ5A 1P7WA 1CYDA 7ICEA 3BZCA 4NDAA 2WM2A 1PK3A 2Y4NA 5SZKB 4BC0A 4DWOA 1M72A 4ISCA 4LRSB 3B78A 2Q4OA 1OZHA 3AEXA 2YMQA 3R8CA 7ICMA 2EAUA 5AFSA 3PV0A 3QG5A 4RLQA 2PL5A 4F4JA 3N3AC 5LQMA 2CLHB 1VBFA 2Y6UA 4KQ6A 2QI9C 2XHEA 4ALMA 1GLGA 2V9WA 2FRXA 4PGYA 1E7MA 1CETA 2BGLA 5FLEX 5K0BA 1HEIA 4BNKA 2PFNA 5JZ9A 2FPUA 5KSWB 4WZBA 2WHQA 1Q0TA 1P2FA 1CJKC 2JAOA 3NTLA 1Z6YA 2DWOA 4ICIA 3M0EA 3ZW8A 4PSAA 2ATLA 1OI3A 3MTIA 3N39C 4GZ5A 4BNXA 2PBZA 3CFYA 1OASA 3RJFA 2R8IA 1D2CA 7ICTA 3FMFA 4KN4A 5HIAA 1AMUA 1VBKA 3PA8A 4FK8A 2E4AA 1N5OX 3TCNA 3LGSA 4DS4A 1ZL0A 2BLLA 4HGNA 4WA7A 3RS0A 3UGTA 4EECA 1NPYA 3FJYA 2AFIB 3V97A 2OCIA 4ELVA 4RD2A 2VK8A 5EXSA 4JV5B 3EPRA 4IJQA 5EHNA 5DNUA 1YI1A 4MRNA 4R9UC 3TBHA 3B6MA 1KEJA 3QKRA 4RABA 4AYTA 3ABRB 1QH1A 2HHUA 4MZDA 1PFYA 2XF2A 4HH1A 3FDZB 3U4MA 4DE5A 4XD2A 2J7KA 3EQZA 3TW6A 4B31A 5CFNA 4CV2A 1UK8A 2H31A 1B41A 3D9QX 1RSZA 1UDRA 3VC7A 4G85A 2O8DA 3FPCA 3JQ7B 3LYSA 4KQKA 5EINA 1LNSA 4EJSB 2QG6A 5CB4A 4WUVA 3FNIA 3N5KA 1UJ5A 1GUAA 5EMJA 3CVVA 1KA9H 2ROQA 3AB3A 1CZKA 5BYKA 3DMHA 1U8TA 2H7XA 3AWIA 4XQCA 1J0BA 1KFCB 3P8ZA 1UBJS 3PTLA 2WB1F 3LCJA 2O0KA 3R5JA 4YRNA 2QT1A 2Z2IA 1FFXA 1YCFA 2RONA 3ENKA 2Z2JA 1P0QA 4LYDA 3E0QA 4WPGA 3ZDRA 4YXJA 1XTVA 3EWNA 3TWOA 3GW8A 2O59A 5CPFA 4H16A 5DO9A 4BZZA 2YKGA 2QV0A 2HIHA 2O8CA 3ZLUA 2LP4Y 3RSFA 1SXJD 1GU1A 3Q72A 5LB2A 3PENA 1YA8A 5KI6A 3E9RA 3E1KA 4R5HA 2QG9A 1JJAA 1WSDA 3BMQB 1IQPA 1FTYA 1W73A 2YFQA 1SCAA 1HRDA 3LUGA 2WRZA 4MRRA 1GD1O 4LK2A 3WLQA 5A6VA 1F9AA 3RUAA 2KM1A 3P2MA 4AKSA 4EGCB 4D1YA 3WOHA 4LI0A 1RLTA 1MIHA 3QE9Y 3GQBA 1P7DA 4DFPA 3KQYA 4EYQA 3JQ9A 1GTL1 4S3MA 2DPXA 3QQPA 4QZDA 3HB0A 2X0DA 4B17A 4RTQA 2MR5A 3UFXB 2XCLA 1XEWY 1GSAA 4I4IA 1TFRA 1J2EA 5F33A 5CB8A 4MPJA 2ZS7A 2RAPA 3M1YA 2YQEA 1PJAA 2I78A 2OFPA 4B4OA 1WUDA 3PWSA 1XRQA 1LX7A 1RBZA 2ZI9A 3P9CA 3KALA 4H60A 4HXYA 2ZS9A 3PDIB 2HV8A 2ZJBA 3I12A 1QZXA 1VFPA 2VQSA 4X62B 1TF2A 1K7CA 4MULA 2PNJA 3EEOA 1DRGA 3UKOA 3ULKA 5LN1A 3BUSA 4LX0A 4O33A 1O0SA 3H8SA 3G2KA 1X9WA 2HOQA 5CP2A 1CRWG 3B3FA 2GJKA 4PLCA 4WD3A 1VIAA 5BT9A 4A4DA 3DZJA 3KHKA 1I7NA 4Q9NA 2WSSA 5H81A 1NJ8A 4DS5A 3CNOA 2FMPA 1CDEA 3U4AA 3L1KA 1XCPA 4C0JA 2C82A 2CJWA 1VG8A 5K0JA 3IPRA 4XKJA 1EK2A 1P74A 1Z6GA 1AUPA 4LQ4A 4UBJA 3VOTA 3VU3A 4YCMA 3K6SA 2LYAA 1N5XA 1J70A 2PUJA 3JXEA 3VSAA 3AF6A 3SFTA 4HNGA 2CNWD 1PLLA 3B9QA 3ZJVA 3L8ZA 2GZRA 4XFJA 5DHTA 4EB0A 4RJKA 1RM5A 5J2IA 2G04A 5C3UA 3N9IA 5F7OA 4QXAA 4KDRA 1M6NA 4RQ3A 3LIPA 4J4HA 2R79A 4XJVA 1GTJ1 5EEGA 2F77X 4EG1A 1WBDA 3PR5B 1ODLA 2IP4A 2PXCA 4UXIA 4BMXA 3JPPA 2XE6A 4QRHA 4ENPA 1H8HA 4NAUA 4GKAA 1XEXA 3VU8A 4JEIA 2JIBA 4EM6A 2RHTA 2Q46A 3BZWA 3GLHB 3SAJA 2PGAA 2C83A 4X93A 2JKZA 5KO2A 2GN2A 4G4IA 4RKYA 5T3UA 1T1GA 2F9MA 2NV0A 1JQ3A 4L27A 4M7OA 4D8TA 1W8DA 3OLVA 2ASVA 4H7EA 4DXHA 4UAWA 1YFKA 4UAZA 1OLUA 2XR1A 3CMMA 5EXXA 2WU0A 1UXGA 4CKYA 3O94A 5AKZA 2FMSA 1Y7PA 2QTBA 5DMXA 1WZNA 1ZQGA 2WDPA 2XAUA 3UBTA 2PK3A 1YUMA 3W2EA 3V72A 1NU8A 1QIHA 4EARA 4B87A 1O58A 4QUEA 4IXTA 3M1AA 1XNGA 5K03A 1QK4A 3FCOA 3HXTA 1P75A 4D3FA 5AR1A 3FWHA 1BD3A 4TMFA 3WGGA 3OTQA 1QTNA 4YLYA 1F2UB 2G0AA 4MKZA 2QVGA 3NGXA 4HDNB 1JDUA 2AOTB 3KLMX 2PEZA 3DR5A 4F8RA 4LY9A 4EW2A 2O8BB 4KSYA 1QIMA 1VE1A 3QPBA 2HGZA 5JAUA 1MABB 1EB9A 5J2UF 4R7GA 4KO4S 4BB6A 1TI7A 2H1WA 4FE4A 2V55B 5ALLA 4Q3DA 2P2LA 5IABA 3WAJA 4OX9Y 2OZVA 3EDYA 1ZRNA 4M60A 3DLHA 4PPQA 2XGPA 1CIPA 3EQ6A 1MAUA 4B9EA 3EXG1 4ZHQF 1X80B 1YFJA 3WMXA 3BDVA 4RTJA 4LEIA 2XVXA 3ADOA 2H1OA 5CM9C 4RVFA 3LY9A 4AZ3B 2W4IA 3GRVA 4J76A 1FSSA 4AP9A 4WY5A 4B85A 4R31A 3AO0B 3C0KA 5BXYA 4K2HA 5IYZF 1BKSB 5DBAA 1ABEA 3D4PA 3PQ4A 4P3XA 2ON6A 3TW0A 2C9YA 2ZRKA 5FBRB 5F4BA 4CMIB 1Y5MA 4HDCA 2LTAA 1E18A 1KEVA 3PFHA 4K6FA 4NBNA 3K32A 4F12A 4RMJA 3ADCA 1L4BA 4ITRC 3T1QA 4DRXB 3G0GA 2DETA 3V4FA 1BZYA 1YQQA 1EFAA 1U11A 4RKWA 2W70A 4CEHB 3P9KA 1E0SA 3I1FA 1T2NA 5HJ2A 2YW9A 3DBIA 1QIJA 4BXOA 5DWQA 2DFLA 1P5FA 4C6RA 3N4MB 1Z06A 5IBQA 4Z3DA 3BMOA 4YP0A 4IQWA 1CW2B 3R0XA 4LNHA 4LOJA 3IUJA 3DE5X 3SAHA 4UD2A 4ALJA 3AM9A 1T6NA 2NU7A 4RA6A 2AGPA 2NTEA 2QGFA 2A19A 1LQ2A 1T4BA 2WFZA 3EBLA 4HN2A 4F9FA 5BNTA 2J3LA 4YV0A 4UNIA 4B5LA 2YJNA 2JI8A 5AOAA 4M1TA 5ESWA 2IUTA 4DV6B 3RYHA 3O8NA 4FYHA 2Q0HA 5H16A 3KS9A 1JX6A 2QTNA 4B47A 5CM8B 1ZYQA 2GWSA 1P6XA 4MI6A 5HSGA 1RI5A 1KI9A 1WDTA 4C4ZA 1YSCA 1GZSA 3C41J 5EJ5A 1AHPA 3OPNA 5LKAA 2ZWAA 3BAFA 3ONDA 1B00A 2KMLA 3TQCA 2OHXA 2P9HA 2GUGA 1W47A 4DLGA 1B74A 3U19A 1MXHA 5KT6A 3TE6A 4RM3A 3GBVA 2RH4A 2LCQA 4LJ8A 4G0MA 4J1QA 3PXEA 4QU8A 4S1OA 1XK7A 2DR3A 4ARUA 3QU4A 1U0NA 8ICXA 1ZQWA 2JFWA 2NVBA 3DSRA 4GM1A 4CNBA 2WF9A 1QX4A 2R8GA 2JFHA 3ACCA 4BMVA 3W5BA 3AVYA 4P81A 4XM2A 4GYKA 2XRYA 5KQGA 3CSSA 2ZRLA 1JX4A 3EGWA 2YN0A 4BNFA 3T1VA 2UVUA 4CT0A 1RZRA 3AXSA 3LDFA 4HP8A 3RTDA 4HWGA 4LZJA 2JZBB 4HAZA 4DLWA 4Z0HO 4QEKA 4IJMA 4KUHA 4QIWF 3IQWA 5GOZA 4KLTA 1CVRA 3EOBI 4J1SA 1XBTA 1ZSVA 5G1OA 5LNK1 1GL6A 3N7TA 4KREA 1Z62A 1YRHA 2CL5A 3N7SC 2R97A 4TVBA 1W88A 1QWOA 4QUGA 5EXEA 2FVXA 4A10A 4BLOA 1OXMA 4BE4A 1EP1B 2VYCA 3DB1A 3I5YA 3G02A 4MS1A 4UC0A 1L7RA 3FDZA 2QM0A 3K75D 2EQYA 2O7SA 4KXNA 5KJ1A 1I13A 4R6XA 3I6YA 5FA5A 5DTJA 4YXMA 3GIJA 2BZSA 1ZM9A 3GAFA 1P9LA 1RCUA 3MFYA 4EUNA 2ZZNA 1MN8A 2A33A 1RM4A 2P11A 1H1LB 5DEIA 1YIDA 4D4HA 5IAKA 3HZOA 1NUTA 1Z88A 1E62A 2J0UB 4DO9A 5E1DA 2HI0A 2IYOA 3N1UA 2Q3BA 1GTRA 2I29A 2P9CA 3DV2A 3TK1A 2F8SA 1NF8A 4DAEA 5FPKA 1TZMA 1UMBA 4D42A 2MMCA 3A1NA 4Y6LA 3SBXA 1WDKA 1J9GA 3I0MA 3WGJA 4CDGA 3PRYA 2B9EA 2BRUA 4OHVA 3C1TA 4OJNA 4ND5A 2OXIA 4H3VA 5DM60 1KF0A 2GCOB 2F3UA 2HDNB 3ZDEA 2ESEA 1L7BA 2JLVA 3JVUA 3HKEA 1ZUWA 4PRLA 4KHPB 5BUCA 3B2EA 5I4BA 1NTOA 1OWOA 1EM6A 1YD7A 1U8XX 4NENA 5DB4A 1L6IA 1RAFA 5FJIA 1UIMA 5A7FA 4P0TA 5TY0A 5BV1A 2VO1A 4R9SA 4MKGA 4NS1A 5F9HA 1E9FA 4QVGA 2A5LA 4BJ1A 3A6LA 3FLAA 2AX4A 4O3QA 1FNCA 3ISCA 1TM5E 1TZJA 1S2OA 3SSNA 1FUEA 1AKVA 3ZWDA 2AOUB 1QDUA 1X1AA 3AF2A 3C8ZA 4F2SA 4IX9A 3TLKA 5CDGA 4JYAB 1VKOA 4GI5A 3H87A 1JDNA 4ZYLA 4JUAA 2VYFA 4BNZA 3ZY5A 4TM7A 3K9GA 2Q3CA 4ELTA 1UKBA 2FHSA 2V97A 4Q9JA 1BEZA 4R1PA 1KERA 1Y81A 5AIBA 4LMBA 2PSEA 3ZQJA 1EIWA 1IWPB 3EE6A 4HO1X 1R50A 4XIIA 2XMPA 3MWYW 1USGA 2FSSA 1BE1A 3H7IA 2P91A 3E5RA 2OV2A 4ZTUB 5DDYA 1QANA 3RIHA 2B7LA 4LRTB 4Q3CA 4ND4A 3VQTA 2ISCA 4QGHA 3RRMA 4YCNA 4EJ2A 3IJ5A 1GQFA 5CX1A 1ISJA 1XSEA 4O02B 5E9JA 1XVUA 1JA9A 2DFPA 4PZUA 4ARBA 4FFBA 4FMDB 4EJ0A 1T5HX 1AQUA 1ECFA 2HZ7A 1CERA 3K5HA 4LVCA 2O52A 4RL4A 5D85A 3WQSB 1EAMA 4BAGA 3I72A 1L5UA 2QD5A 5FNVA 1UFVA 4TZ0A 4TLMB 4ZQIA 2VBIA 3PC8C 3IPCA 1JNYA 4GPTA 1FMLA 1OROA 3ENWA 5E7MA 3T3EA 3U9TA 1I94B 1XD2B 4L22A 3ZXSA 4WLOA 4C3ZA 3GFTA 1NXWA 1QOZA 4X84A 2WKPA 3EJWA 2XDYA 5HCUA 3VJLA 2VKTA 2XVZA 5AHRA 4F8YA 2HLHA 3ED5A 5AXCA 2WVHA 3DKPA 3GK3A 8ICZA 5FR1A 4MEYA 5F9MA 1NF2A 2YB1A 3OJWA 1BROA 3DO5A 2XOKA 2NADA 4L8LA 3K8OE 4BUZA 3KZMA 4FFLA 4ND3A 4G09A 4WNIA 4ND8A 4D3XA 3NQ41 4EB6A 3ZZNA 3TQOA 1FE8A 2B37A 3QV2A 5A0LA 4HWKA 4BVKA 3HXOA 2UYHA 4DPLA 4RPGA 4NLCA 3U2QA 1GTZA 1ZJYA 3IT1A 2HW3A 3FRIA 1UA0A 2E3JA 4YCDA 4BCBA 3CZCA 4RAOA 3GLHA 3WQQA 1AQIA 3PNYA 3JZMA 1EIZA 2DX7A 3PD7A 5FUYA 4LGVA 1K88A 4MV0A 1DADA 4UNRA 1QIIA 4XYBA 5J2FA 3RPEA 1H2BA 1ESMA 2YWRA 1Z75A 1TC1A 3G2MA 3QLUC 4L4ZA 3RJZA 4X6XA 1OLUB 1YR1A 1O97C 1XKLA 2G1JA 2F3PA 3F9IA 4PX9A 2QUKA 3NH9A 1JG1A 4N03A 4U63A 5LQAA 4QOEA 2PR2A 1QIGA 1UPXA 2B0JA 1LK5A 2AEEA 2J85A 2VYQA 2YYAA 4B2IA 4AN1A 4ZMSA 3FHCB 2P41A 2AS0A 5LLSA 2DL0A 3C1ZA 2QN7A 1CY4A 4AJ1A 4CMEC 3O8CA 1IXYA 2FR0A 2OV8A 3NIFB 3PQ6A 2GJ4A 3I0NA 1TM7E 2UXDB 4RK4A 3LWBA 2AOTA 2EERA 3L7OA 1FY2A 3FPFA 5KNBH 2O8BA 3URMA 1RTTA 2WP8J 3UANA 1FDSA 1A7JA 1MABA 3HB9A 3A1TA 1WCYA 2IEZA 3IA2A 4NAHA 3TSAA 5LWHA 5HNKA 2G5IB 1E5XA 3P2OA 4NNPA 2VJAA 2EJUA 4I1YA 1O5OA 4TTTS 5EFOA 1FSZA 3PGKA 1FBNA 4U2DA 1KO5A 1YJCA 9ABPA 1MB4A 4J9LA 3HVHA 2PKCA 3JWGA 4BAZA 8ICGA 1U9CA 4CMJA 1VP3A 4PAQA 4WZZA 3GI1A 3TCXB 5LXTB 3K9CA 4UHBA 4UATA 3ZDQA 1ZMBA 4EFMA 3GBSA 2QPLA 4GLBA 4NU6A 1LRJA 3LS2A 2VXYA 4DS3A 3ZBUA 3KVVA 2G36A 1PQ4A 1XCGB 4RPHA 3X2EA 4F04A 4TQ9A 4LNUB 3E5HA 1D2NA 1CUJA 4ZOCA 4CKZA 2QARB 4IZIA 5HKKD 1VJ0A 1JU9A 4BN4A 4MVWA 4Z3OA 2P78A 3AL0C 4UTRA 1CEYA 5CH3A 2IUSA 5JH7A 3KM0A 3WLOA 3PC4A 3M8RA 3K4GA 5EJ7A 2H7VA 3RB6A 1JPNA 1N7JA 4RPJA 4YUAA 3SZGA 3JASA 1T8YA 3IVCA 2B1JA 3LF2A 4YUWA 3QFTA 1NUHA 4NLGA 1A72A 4IJVA 1QONA 4NK4A 4ZCMA 2BFOA 5BOVA 1U0OC 1TX4B 2XGOA 1FFWA 1T29A 3VDMA 4N41A 3IDWA 3E9EA 4DCGA 2GH1A 1JQJC 1RLMA 2C2GA 4BNYA 3RYHB 5JWOA 3MN1A 1JAHA 2I76A 1Y7LA 3RB3A 1B0AA 3S2ZA 4RTKA 5FOTA 2WUWE 4FTWA 4DRYA 4UOEA 3LKVA 1VG0B 1U04A 4L2IB 4DSTA 5A9SB 4IQFA 2JHFA 1ISSA 2XBLA 5D8DA 1KMMA 2NXCA 3JQPA 1P8JA 1ZESA 4RF5A 3BSSA 1YDWA 2RKBA 4UOZA 2BEVB 2C7RA 3D3JA 1Z68A 4MCHA 1JHZA 4CMCA 1BCRB 3AIOA 3EW7A 1JLHA 3T79A 2ZYDA 4MGEA 4PICA