2YN4A

L-2-chlorobutryic acid bound complex l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
225
structure length
225
Chain Sequence
SGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
total genus 89
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2yn4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yn4A01
4L57A 5AHXA 1VFPA 2B82A 3WK7A 3QUCA 3WK5A 3CZ4A 1QH9A 3QUTA 2CFTA 4YCMA 3U7GA 3HYCA 1CR6A 3FPBA 4HAIA 4UMEA 3NALA 3WKCA 4J03A 2HF7A 1RKUA 2FUEA 2ZBDA 2I6XA 3I28A 5AW1A 5AM4A 5AIBA 4XE5A 1QQ5A 2GFHA 2FDRA 1Z4LA 1Z4KA 2EATA 2RBKA 1RMTA 4G63A 1TA0A 3QU9A 2PQ0A 2ZBFA 3WKBA 5AVQA 2ZBGA 3B9BA 2BDEA 2RB5A 2HDOA 2R8XA 3QLEA 3UM9A 2JARA 1X42A 3L0BA 3MPOA 2HSZA 3ZX5A 4F71A 3EWIA 5AK4A 4B6JA 4BX3A 1XVIA 4AS3A 3M1YA 1VJ5A 3NAMA 5ALHA 1RQNA 1NRWA 3AR3A 1KYTA 4XOUA 2I34A 4UARA 4Y2VA 5ALTA 5AW8A 3L7YA 1RKVA 3WK8A 4C4RA 5AM2A 2RARA 2YJ6A 3AR6A 5ALWA 1Z4OA 4CF5A 3OCVA 3ZVLA 2JAOA 3W5BA 3OPXA 4UM5A 2G08A 5IT4A 1O08A 2I7DA 5AK3A 5AVZA 2IA5A 2FUCA 2OM6A 1WPGA 4HGQA 3IRUA 5AVVA 5AW5A 1S8OA 3L8GA 2B1QA 2YY6A 1L8LA 1ZRMA 4RETA 5ALYA 4MUMA 3R4CA 3F9RA 4HGRA 4H1WA 3E84A 4GIBA 1RMYA 2AUTA 4ZEXA 3N28A 3PGVA 3ED5A 2GHTA 3N5KA 1N9KA 4EELA 3PGLA 4NWIA 3UMBA 1Z4IA 3SHQA 3FGOA 1YJ5A 3DAOA 4C4TA 3L5KA 2YMQA 3ET5A 2EAUA 4Y2RA 3ONNA 4YCNA 4UAVA 3SKXA 2G80A 1Z4JA 5AVXA 3OCZA 1XPJA 5JJBA 1TE2A 2DQSA 2YMLA 4BEWA 1O03A 1L7PA 3L0YA 4CF3A 1WVIA 3E81A 2HF2A 2YMPA 3J7TA 2FPXA 3ET4A 5AKKA 1U2TA 4Y2UA 4UMFA 3AR5A 4OCZA 3ZX4A 2FPSA 5T41A 3OTQA 4QJBA 5AKJA 3EPRA 2R8ZA 2GHQA 5AVWA 3AR2A 1TJ3A 3A1CA 5ALNA 1LTQA 4E88A 3D6JA 1L7NA 4DWOA 3A3YA 2FEAA 3FVVA 4ZEVA 2P69A 2C88A 1XP5A 2PKEA 3WGUA 5AI4A 4JB3A 1ZOLA 4I9GA 1ZRNA 5E0OA 2VKQA 5AKEA 2YFYA 3U7EB 2D2VA 4UAUA 5ALPA 3ZTWA 3WK6A 3ZUPA 1YS9A 5A3RA 2GMWA 3U7HB 5AM5A 4HGNA 4YH1A 1Z4NA 3DDHA 1RDFA 3IJ5A 1PW5A 3L1UA 2I54A 4UASA 5AVRA 2WF6A 2YN4A 4EENA 4OFZA 4RESA 5IS2A 1QYIA 4EZEA 3QUBA 2CN1A 3AR4A 4XPZA 3ESQA 4XQ0A 4EEKA 2AGVA 2PR7A 4FYPA 3L0CA 3FPSA 2GO7A 1WR8A 4L6CA 1J8DA 4UMVA 5ALEA 5ALFA 5AVUA 2FPWA 5AW6A 1QQ6A 3BWVA 2ZXEA 3P96A 4OHFA 2WF8A 2G0AA 3QNMA 3W5CA 5ALDA 1NNLA 4KNWA 4Y2JA 4DCCA 3RF6A 3B9RA 3OCXA 1Z5UA 5AK6A 4Y3UA 4JDPA 2WF9A 5ALGA 1Z4PX 3ZWKA 1YV9A 2FPRA 4BNDA 3KD3A 3MC1A 4MWOA 3L8HA 3OCWA 3ZVMA 3VAYA 4Y2TA 4BBJA 4HYTA 4HGPA 2IYEA 1RQLA 2WM8A 4HGOA 1LVHA 3WKAA 2I55A 1Y8AA 3NIWA 3WK4A 3R09A 1RLMA 1U7OA 2HX1A 3E8MA 1VJRA 3L8FA 4YIKA 4Y2PA 2W11A 2IOFK 4BKMA 2WFAA 1WZCA 3GYGA 3U26A 2AMYA 3M9LA 4UM7A 5AK5A 2YJ5A 2QLTA 3SMVA 2EARA 3BA6A 3UMCA 5AI6A 2G1AA 1ZD2P 3FM9A 1T5TA 4F72A 1QQ7A 5AIAA 3ZI4A 5AM3A 2OA0A 5ALSA 1T5SA 3AR9A 2BDUA 5A3QA 5ALVA 2ODAA 2RAVA 2C8LA 4IFTA 1S2OA 3QU2A 1U7PA 4Y2QA 1N8NA 3WGVA 2R8YA 3U13A 3ZTYA 3PCTA 5AW9A 4OD0A 2YJ3A 4DFDA 2B0CA 1Q92A 2C8KA 3KBBA 2MU2A 3QXGA 5AVTA 4NV0A 1L7OA 3EF0A 3NASA 2FPUA 3I6BA 5A3SA 1TJ4A 2OYCA 3NANA 3DV9A 4NAVA 3W5AA 1ZD4A 1Z4MA 2JAWA 2ZG6A 3SD7A 5FP0A 3K1ZA 5AKYA 4Y2XA 3FZQA 2HHLA 4KX3A 4YCLA 2OBBA 5ALLA 5AKXA 4UATA 1CQZA 1RRCA 2JAUA 5AKGA 2B30A 4BNDB 3ZVNA 3EF1A 4KX5A 3AR7A 2YBDA 5AESA 4YIHA 5AW3A 2FI1A 3HLTA 1Z88A 2X4DA 5AW2A 1L7MA 3KDPA 4EX6A 3QU4A 1SWVA 5ALZA 1MH9A 5ALMA 1Q91A 5ALQA 1SWWA 5AW4A 4O8CA 4L6AA 4IG4A 2HOQA 4Y2YA 2HI0A 3QUQA 3WKEA 2NO4A 3U7FB 1TJ5A 3I1YA 3N1UA 1U2SA 3U19A 1JUDA 3AR8A 1RLOA 4I9FA 2JGAA 5AW7A 3N8GA 4CF4A 2ZBEA 5IT0A 1NF2A 5AW0A 1RKQA 3I76A 3ESRA 1AQ6A 3KZXA 4UMDA 1ZD5A 4KNVA 3IB6A 2G06A 2B1RA 3WKDA 4C4SA 3L1VA 4NFLA 5AVYA 3ZW7A 4EX7A 1ZS9A 2WF5A 5AM1A 1L6RA 3R9KA 2HO4A 2NO5A 3MMZA 4J2TA 2R8EA 4FFDA 3L8EA 5AKLA 3NUQA 1Z5GA 2HEGA 4NABA 3A1DA 4YGYA 3SLRA 5AM0A 2W4MA 3QGMA 3E58A 1L8OA 4Y2SA 1Z4QA 1F5SA 4DW8A 2Q4RA 1SU4A 4PNHA 1YDFA 4CNQA 5AVSA 4AS2A 2HCFA 5AI9A 4G9BA 2WHEA 3OCYA 1J97A 2BY4A 5AI8A 2AH5A 5ALKA 1IWOA 4BEVA 2B8EA 1RC8A 2IOFA 2P27A 3N07A 1U02A 3W5DA 3RFUA 3UMGA 1RLTA 4AP9A 2YMMA 5ALRA 5ALUA 1T9ZA 2NYVA 5AKIA 2Q5EA 4UW9A 3DNPA 2B8JA 1YNSA 4BX0A 2CFRA 3KOOA 1RMQA 4ZEWA 5AI0A 2G07A 5ALIA 5AKZA 2Q4TA 2IOHA 2QYHA 3WK9A 2WF7A 4UU1A 3CNHA 5AI5A 2ZOSA 3NRJA 3SKYA 2W43A 2C4NA 5ALJA 2G09A 3S6JA 2P9JA 3QU7A 2MU1A 4FE3A 4BYGA 4GXTA 1ZD3A 3QYPA 4KYTA 3ZU6A 2C9MA 1YMQA 3SF0A 5AKHA 3QU5A 1ZJJA 4BX2A 3PDWA 1RPZA 2P11A 3MN1A 3QX7A 2YJ4A 1EK2A 2CFSA 3A1EA 2MSNA 1EK1A 2O9JA 5ALOA 3OCUA 2I33A 1K1EA 3KC2A 3B8EA 3ZWDA 4QQFA 3TLMA 4UU0A 5AICA 4KN8A 4CE6A 2O2XA 1FEZA 5ALXA
chains in the Genus database with same CATH superfamily
3PC8A 3WB2A 1QHGA 1OV4A 3QUCA 2NUPA 4JENA 4D0RA 4EBCA 5GP1A 5CWRA 1KO7A 3FPEA 4H18A 1BX1A 2V7PA 3AHGA 3KEQA 3H1PA 4QWMA 4Y6QA 5KMGA 3LLCA 4RQUA 3TI9A 1PR6A 5KYWB 3U3DA 5LZ7A 2WYIA 4ICIA 2X9GA 3RVRA 1K8XB 3QF4B 1NXSA 4EVIA 1FF9A 4H9GA 3HV2A 4RU1A 3LH5A 1TA9A 2CMHA 2XCOA 5JXHA 5CEJA 5CFNA 1D1PA 3TOCA 3HPQA 3IJRA 3ZWBA 1O87A 1VG9B 4YCBA 1N8TA 1HG1A 2QXUA 4D74A 4WBNB 1BH2A 7ICLA 3WHLA 2FZ5A 1EFUA 3WLSA 2QZJA 2A6PA 2BMFA 1P2VA 2ZRNA 1DL5A 1TZBA 4YCNA 2FRXA 4X8MA 3GJQA 3I9KA 4EMUA 5E7MA 2DQSA 1NXXA 2RHLA 1RYUA 4KW7A 2ZRCA 4DDMA 1WMFA 3PVZA 3OZCA 3RTAA 3TD2A 3OSNA 2H17A 2ZQYA 3C6XA 4UMFA 2AE2A 1X9GA 5T41A 3CN9A 3DZDA 1Q0HA 2WU8A 4EG4A 2GVDC 3SF8B 2QE6A 4LJ5A 4ZK6A 2CHVA 5KCZA 1GCIA 3UHAA 1AA6A 3DLPX 4PHAA 3N7AA 1W59A 2QTHA 2Y1DA 1ZCFA 1VE7A 3PPVA 4K9DA 1Z2AA 3DLBA 4C7JA 4JI3B 4QWWA 4NYJQ 3FY4A 4GYJA 3DEJA 4OQMA 4MB0A 2KP7A 3AJ8A 1Z12A 1MIOA 1FYVA 5DE3A 4EB6A 4RD6A 4GEKA 3NX4A 3NHBA 4NC9A 1IATA 1PVVA 3RF6A 2V6FA 4DT1A 2COEA 3NUGA 3FDJA 3A4YA 2OT3B 3VPFA 5FNVA 1IZ0A 2BT4A 5U9CA 9ICMA 1NYTA 2X4LA 2VBFA 2Y3IA 4I4TF 2IU6A 1A9PA 1HEUA 1I2CA 1P91A 5IUJC 4RIIA 2I4NA 4KLQA 3EDOA 1J8MF 3D7NA 3STHA 4NFSA 4RWEA 4OYRA 5JXIA 2XY5A 4FR2A 3HXLA 2A5JA 1P2UA 3FVWA 1C9KA 3IBFA 4EKGA 3BCUA 3T3NA 5EIFA 5L3ZA 4BNWA 1KY5A 4GKJB 4BVGA 5JSKA 3OE1A 4MHSA 3NTVA 3EVTA 3MJDA 2GAIA 1QIHA 4PZ9A 3AJ9A 2NT4A 3CX4A 4ZI7F 2VDRB 4CR6A 4KLHA 4D1YA 5IFLA 3E9NA 3HZZA 3P0FA 1IMOA 4N6GA 5CIQA 1U8AA 2IL1A 2VOJA 4WCFA 2ZU6A 3LX4A 3FDFA 2PXHA 3GILA 4XRRA 3A2MA 4CI0B 5J0PA 1E6CA 3SLRA 3ITKA 1RIFA 4QU9A 1NQXA 3KQOA 4NTZA 4KP7A 2NNWB 1TLTA 3OCYA 2J33A 3ZCQA 4PZDA 1ZQKA 4MW2A 5DM70 3WQBA 1PP4A 3EFEA 1FL9A 2VEOA 4KN6A 4BUCA 3OOEA 3O8RA 1LBEA 4LDNA 4P36A 2BUBA 1AZWA 4HR7A 4Q12A 2P4QA 4I3GA 4U7PB 2D13A 3M6XA 4KUGA 2CXXA 1YDGA 4P4MA 4RQ1A 2O2SA 2EP7A 1VP9A 3P32A 3NT4A 1O9BA 1Z6AA 3B5JA 4TX1A 1JI0A 2AX3A 3ZE8A 3W9BA 1HLFA 2YBEA 2YNMD 3W3AA 1OT5A 3BXHA 2VI5A 2P9FA 2AOXA 2Q0SA 1BMQA 3GAAA 5CVTA 2IC5A 5EGNA 1TAHA 1EWYA 4JYAB 4G5HA 1NXVA 1E5XA 3DFKA 3EWIA 3GZJA 1DC4A 3WGMA 1T2NA 1ZKDA 1E1NA 4B47A 1GDDA 3VSAA 4BP1A 1YD7A 4PY2A 1Z5NA 2X14A 5KFUA 1OXJA 4LGCA 2ZIVA 3IHQB 5A7FA 2P5TB 3AEQB 1SNYA 4NU8X 2B1QA 1EJ2A 1X87A 3MG9A 2I2WA 3UA4A 2WTUA 3N7PD 5JQWA 1YRHA 1DO0A 3DDWA 5CXXA 1KDZA 1YGPA 3BREA 2Z6QA 4IDBA 4XI9A 5EHQA 3G79A 5J0WA 2NV6A 5KYVA 2GDZA 1JW9B 4UCWA 1Z7BA 3SYZA 3MJRA 2Q1YA 1JX6A 1A5SB 5KQSA 3ZPXA 3UPDA 1FSSA 1F2DA 3HDJA 3PLRA 5CCDA 1BDIA 3THXA 3Q3GE 4URVR 7REQA 3TXAA 1J0EA 3G68A 1YC2A 3WWEA 2K60A 2XGMA 4BWGA 1T6YA 4FE7A 1KO4A 3UYLA 5KFWA 1BN6A 4EG0A 3AXTA 3UOGA 2GZ2A 3KT0A 3PW4A 3SBDA 1XPOA 3USZA 5FNVB 3SDSA 3D2AA 3B1WA 2EDAA 3PSAA 4ECWA 1KKUA 1R4NA 5LIRA 4QQNA 2C4UA 2K7ZA 2WTEA 5KO2A 2F17A 1QZXA 2GEJA 4QBGB 2YWCA 1RHKA 2DTXA 4W5HA 2W2KA 2P9ZA 3FPGA 3LLMA 4H77A 5FPYA 4MZXA 2ILTA 1S8NA 5KJ6A 4U7TB 5GJVC 2P9EA 4EG5A 3BTVA 1WB6A 3LBIA 5JS6A 3RUFA 5KYKA 1TEXA 1KJIA 1G19A 3AU8A 3AU2A 1DCMA 3UB3A 4Z0PA 5CNKA 4N3AA 3D1VA 3E8MA 5JC1A 3HYLA 3TDNA 1B2RA 3V4ZA 5DNCA 2P68A 2J3QA 2BFPA 5F1KA 2JHCA 2YJGA 3LIIA 4P84A 3ESCA 4RZ2A 3HUTA 2I6QA 3BPSA 5WRFA 3AVYA 3GI1A 1SURA 3T7CA 4K88A 3QQPA 3KHSA 3K70C 8ICXA 3CISA 5H2FU 3F47A 3DLTA 2JIMA 5CHYA 4LZGA 1CQIA 4ADSG 2JGNA 2R8GA 2CV0A 5BV0A 5AKYA 2FR0A 3RF9A 2OZKA 3TAPA 2I29A 1R8YA 3IDFA 4NARA 5ILGA 5LNK6 3ODPA 2OGTA 1XK7A 2C2GA 3WWCA 4MR7A 4CFZA 1A4UA 1KYQA 1SCAA 1X13A 3OTOB 3U4DA 4QUGA 2IHVA 2P6RA 1TCUA 5HEKA 3FZEA 2F3TA 1YCHA 4INPA 2SHKA 1LPMA 4JL5A 1WW8A 3VAAA 4TQAA 4DLVA 2OY0A 3T9DA 1U0SY 1KEPA 4KXLA 1F2TB 5EWJA 5CUQA 4RZIA 4XWTA 4D4GA 2VYVA 4QIHA 1F9EA 3HYNA 4FW8A 2LHTA 1UBTS 4UAZA 4IWYA 4RDCA 1KDPA 1Y1QA 3M6IA 3NQ41 4YVZA 1M2NA 3WP1B 4DDHA 1FTNA 1KAHA 3BB3A 3FVQA 2D8MA 5KU7A 4ACOA 5AI0A 3LDHA 3CR3C 2FQYA 3FCAA 5KPDA 2CMFA 4DIDA 1JAYA 4DWVA 4Y30A 4AMBA 1OGYA 5K3EA 5KZMB 3W8DA 4QOHA 4HWRA 1WSAA 1G8PA 4PYJA 4JEIA 2IU0A 3ZU5A 2HPVA 2BPGA 1NBWB 4O2AA 3SE0A 3WLOA 2JFZA 3N6RA 4XQCA 2O2XA 4GRDA 2RGDA 3S2SA 2AUNA 5JPDA 4XB6B 4ME6A 4XWGA 4J9QA 2WR8A 2GAOA 5J2KA 2E5FA 1G8HA 4B4OA 4QDJA 1W4RA 1ZNZA 1NV9A 4YAWA 4W5OA 1XV5A 3RKSA 1XLWA 3X3HA 1NJYA 4QJFB 2V9ZA 1VKOA 3BB4A 1FVFA 5IC4A 3GQBB 2QUAA 3LX8A 4GECA 2ZSJA 2ASEA 2FG7C 2G5TA 2CXPA 5C9ZA 2WFZA 3JRWA 3PU6A 2H00A 1JROA 1GFWA 5EINA 1OD6A 1MO4A 2KN7A 2FLPA 4B9VA 1YZHA 3UOWA 2NYRA 3FUVA 2NSJA 3KDAA 3FLBA 3AZOA 7REQB 4DMUB 4DUGD 2IUYA 3PPXA 1TZMA 1DBWA 1ZESA 2AEMA 4GEGA 3DB2A 3QFTA 4YCSA 3M6VA 4PG6A 2AN4A 1CY7A 2GPNA 4G97A 2KHQA 2POQX 3WRYA 1F14A 3QVGB 4DEXA 2JGEA 3IC5A 4ZP1A 1JIXA 2Z2KA 4KITB 4F3KA 5TC4A 4UNRA 4JUFA 1B2LA 4LNUA 1O03A 5F9LA 1I6WA 2DUNA 2ENWA 3OMLA 2VIIA 4KWCA 4AQYB 3MTBA 3BCSA 1FW8A 2GHQA 4B9LA 3GT3A 1P1CA 4TWBA 4KMSA 3CEJA 4RJKA 3P9ZA 2XVAA 1NZDA 1DKMA 2JGLA 4NYMQ 2C3YA 5LZ5A 2D8CA 1Y5NA 1UBFA 1ORHA 2G8NA 5JNVA 1QYRA 3JSXA 2WMYA 4E2YA 3NIBA 4X97A 4ZANA 3OZIA 3KSUA 2GKOA 2IYYA 2MJLA 4AUKA 1JBKA 1MVOA 2W42A 3DZGA 1JAZA 2VNHA 4PFSA 2PFQA 4MI3A 4GXJA 1M66A 1NLFA 4M0FA 4YUAA 1VPDA 4OBEA 3KHKA 1K9SA 3VVMA 3VKFA 1FNSA 1BE6A 1K0UA 3L4BA 5KT3A 4EVRA 3IHLA 1MZPA 2P2NA 3QPAA 3GEBA 2FUKA 1R0RE 1NULA 4A8JB 1XIVA 3P2EA 1WCNA 4Y2GA 1RLMA 1ZQOA 1ZDMA 1DC5A 3NBXX 4XR4A 1ST2A 3OX2A 2SBTA 4WA8A 3ZJTA 4FS3A 2PZLA 1W48A 1NN5A 3MCVA 1WRBA 1X7DA 5K03A 2WPNA 5IJXA 4TXLA 1DV1A 2AEJA 2PUFA 3PE3A 2QTLA 3I01M 3I6BA 4NL9C 1QWSA 2Z4RA 3TW8B 1JV2B 3LC7O 1E3DA 4KH0A 5H80A 2HXYA 1GSAA 4MYHA 3HFRA 2W7PA 1N1GA 4L4YA 2NQ2C 3GLIE 1JE0A 1ODJA 3DEAA 2KX7A 5IMSA 1F2VA 3DV0B 3PMNA 4AURA 1EVEA 4L6AA 5K0NA 5HF8A 3NORA 2J6HA 3EQ2A 2F59A 7ADHA 4QFMA 3D0QA 3U9LA 3TZ6A 2X0EA 3CLSC 4QJIA 4HAVA 4OOFA 2OZLA 3CNEA 4BE4A 5AW0A 3UWMA 4KG7A 1JSZA 3I30X 5AM1A 2GPYA 4KGVA 4GRAA 5KT5A 4Q9LA 4WVLA 3R77A 1ZNYA 3PW2A 3UMRA 4M7OA 4IVNA 4BVFA 5DO9A 3GYBA 2ZIXA 4IRUB 1OKKD 2UVPB 2C31A 2GJ8A 2XV1A 3UKJA 4O2AB 3AEKA 3O3NB 1G16A 4PEVA 2R4QA 5HIIA 3GIMA 3WYFA 1ZCZA 2IOFA 3GFRA 5CH3A 4BLQA 1LH0A 4QRHA 5KVAA 3MAAC 3PC7A 3T3IA 3SS8A 2VHZA 4GOLD 4EY7A 3KP1A 4L8WB 2YW9A 2AJDA 2R7NA 4JLMA 3CZAA 5DW0A 1E89A 2PV7A 4M1WA 3O03A 4Q1CA 3OQBA 4DEZA 2R6AA 1LDYA 2O19A 1OA0A 1PFUA 4FMPA 4MVJA 2WBLC 3LECA 4TL6A 4Q3EA 3V6HA 1MVLA 1XQ9A 1U4SA 3MMPA 3K9QO 2NAFA 4ZMBA 4YX9A 5KFGA 2FOLA 4XSGA 1QONA 1Z4KA 2BGLA 4QDOA 1USGA 5FORA 2PSHA 1X0XA 4HNVA 3QLEA 4JOBA 2DUWA 3RIMA 1E1YA 4BV8A 4GBED 4WH0A 1UFKA 5BW5A 3H5WA 3VNSA 3C1AA 1S5PA 3MWEB 3EXFB 2OV4A 2H54A 1XCOA 1NQOA 3ETNA 4TQGA 2XVZA 2B94A 2BMVA 3PA8A 1GRRA 1KETA 3EC1A 1PG0A 3ZVKA 4XQ8A 1EVIA 2X0FA 3RRYA 5AVOA 5HCNA 4J76A 8ADHA 3AEXA 1QDUA 4XFJA 1SHTX 4RTOA 2A94A 2I6GA 1W25A 1BC5A 1XCPA 2HBYA 1IU9A 4CL3A 4R7ZA 1DXHA 3H9EO 2XQGA 3VSCA 4QNNA 3IR7A 4IVPA 4ZJPA 3C3WA 4QDTA 4U7JA 1JLLA 3D4NA 4A7PA 4YDHB 2R8HA 4YV0A 2E7ZA 3AUUA 3C3MA 1FTGA 2QBYB 4JP5A 1NY6A 3UXNA 4XWWA 4M1ZA 3GR6A 2Y4OA 5K6AC 4DWWA 4IW3B 5E3IA 3BZBA 2NO0A 1YS9A 2WILA 3JQBC 1XNSA 2VJCA 4QG3A 3D2SA 1XTRA 2PT5A 4HKTA 1PQPA 2AG1A 2V8BA 3HUUA 1U7DA 1UKVY 2OFOA 2WKRA 3O4VA 2C9CA 4CMEA 2AF3C 3LAWA 5CDFE 4DCVA 3TLZA 1JRLA 1JXEA 1Z18A 4FQ7A 3CPSA 1M1XB 4IVRA 2Q9AA 2MYNA 2ZROA 2AG5A 2G83A 1Z22A 5D4BA 4ES6A 1L5NA 5IVPA 2WA1A 2EC5A 1G7TA 2PS0A 1Y8AA 4U2KA 3VHXA 4BKMA 5EIBD 1UJ2A 1KFJB 2F76X 3TKLA 2REBA 2H4XA 5JTUA 3ENWA 1NONA 2JZBB 1Q1BA 3U13A 1ZN7A 3WYAA 3JPQA 5JOQA 5AUPB 1QCKA 2OZLB 2H59A 2WJ6A 4K9KA 2FJ0A 2J9XB 4B4KA 2HU7A 1N0UA 2H8GA 1JEYB 5B1HA 3G9ZA 3A1NA 4KX5A 4PJ0U 5P21A 3MELA 5BQXA 3D3KA 3TO5A 1WUKS 1QCDA 4H4EA 5L45A 1IPHA 3SZUA 8ICRA 1FYWA 3ZLUA 2OV6A 3K6SB 4J4HA 4X20B 4Q39A 3U3XA 1DDOA 4OLBA 2RK6A 2E21A 4M9CA 1DIOB 3MXTA 2G76A 2C0QA 3NWJA 1X0VA 2IH5A 3VM6A 1WOMA 4LF7B 2C2XA 1YBVA 4QQKA 2EWMA 4QUJA 2K2QB 2SCUA 3GLGB 3DOOA 4JYCA 3ZH9B 4YRFA 4CQJA 2Z5FA 4AJNA 4N5HX 2FN4A 1I5RA 2Q4EA 1XA0A 1VPWA 1J2MA 2K89A 3T5JA 4Y8VA 1RZ3A 4YJHA 1R5BA 1N6HA 3TOZA 4CG1A 5ESDA 4EP1A 1CEQA 4X6LA 2OV3A 1N5JA 1RLTA 1KY2A 1T8SA 1XDSA 4I8DA 1W2WB 3Q8KA 7ICNA 4S0ZA 2QD4A 4KQWA 3TPFA 4UUPA 2JLQA 4NIMA 2G07A 5EEHA 1J1ZA 2B1GA 4EAQA 2PXCA 4B7XA 3MWKA 5ALJA 4R0NA 1H94A 4UZFA 3E03A 2A1AA 3SXJA 3GRRA 3LCVB 4EGJA 1T4CB 5KFTA 2B6GA 5K2OA 4Q00A 2X2PA 1D2CA 4X60A 4CQMD 3GN2A 5DM2A 3J80A 2HLNA 3TUJC 3M3PA 2ZB4A 1W34A 4FMDF 3ZBTA 4RVHA 4TN5A 4PX5A 1OWNA 4OI2A 4L5YA 2WWRA 2PPVA 3W79A 3NHSA 4OB8A 1PGNA 2NTYC 5AW1A 4X62B 4WA7A 2Q1XA 5K1ZA 5HG0A 4QA9A 1R9MA 5T4FA 1NNUA 4O8ZA 4YP9A 3F1LA 3GDHA 5MGNA 1J33A 1AXGA 3KOUA 4TM8A 5TV2A 3H2YA 4YRCA 1RQNA 1U63A 3ID6C 3N75A 2WNHA 1P61B 3IEKA 2R86A 1JLLB 1N3LA 3F7TA 5B1IA 4OK6A 5CVEA 4NJ8A 4LOJA 1ECJA 4AJOA 1J99A 4PHPA 5SYAA 1WL8A 1Q21A 4F2PA 1I4OA 1HM5A 3P9YA 1S9DA 1YZLA 2CMGA 1KNQA 2RJNA 4CCHA 3AHJA 5ADVA 1F2UA 3LVBA 1VXRA 2C3UA 3SNKA 3JQPA 4Z4CA 5JJBA 2P41A 5IZ4A 3GFSA 3KEGA 1MV8A 1DBQA 4REQA 4BMSA 4S2EA 5KFLA 1QRRA 5D3MB 3BH6A 1LSSA 3CXRA 2JZOA 5KOJB 4RM2A 4INZA 5TR9A 1ZXXA 1BFKA 2R5WA 1QS0B 4ZEVA 4LXYA 1GU7A 4D9IA 1SBTA 4P7KA 4WT7A 3HO6A 1O95C 2NUTA 5FD8A 1WB4A 5FTLA 2HLHA 1DIAA 5TGDA 2ZVDA 2GZMA 2EX1A 3MOGA 2W5UA 3RVNA 3WDLA 1MFPA 1UDXA 1TUEA 2DLCX 4MRNA 5IX8A 2YWFA 2GUWA 2IHJA 1E58A 4J07A 3EA4A 3HM2A 2VWQA 4L75A 1CETA 1NLMA 1GKIA 2FPRA 5JU6A 1N48A 1D2HA 5KYXA 2IYEA 5LU8A 3IJPA 4K9RA 4EQ6A 2YYAA 3KJFA 4W5NA 3GWGA 1TVKA 2XBUA 1NNSA 2ZETA 5DMHA 2DHEA 2C7QA 1JXOA 1X8KA 2H4HA 4D9HA 2YL2A 3HVRA 2V0CA 2BGWA 3S5UA 1E2EA 5DFAA 2ZSIA 4M6WA 2IIVA 4EHDA 4YHHB 3H6GA 4RS4A 2P2GA 4ND3A 3C2MA 2UUCB 1W75A 4CLRA 5E1DA 4YYZA 1A98A 1KI1A 3IAHA 4U6QA 5FP0A 3DH0A 1W93A 3JQFC 3DKVA 4F5ZA 4QHTA 2VDOB 1CQZA 1RRCA 3TW6A 3WFJA 2EGUA 5CXUA 1JG3A 4P2HA 4YMUA 4URFA 2NTVA 2JASA 3F8SA 4PYMA 1R6BX 5E95A 2QF7A 2AGPA 3UWOA 1OLSA 4Z3OA 5CBKA 1EDBA 3G8YA 3WB1A 3DMTA 1Y5MA 4RD0A 2G36A 4AX8A 3BF7A 2BRUA 4OP1A 2BHSA 4R1QA 3L8YA 3BVPA 2XUZA 4OGWA 5GIOE 3IGFA 4HQ0A 3L06A 1ZS9A 2IIPA 4LFAB 4R2HA 3K35A 1O54A 1J5PA 2V0GA 4GX2A 4DLEA 3VOSA 4NBUA 1U28C 4CLEA 1MXFA 2GNPA 3JYPA 5CH8A 4Y2SA 4RULA 3G82C 3L6CA 1OZFA 3U4MA 4Q82A 1A0PA 4N12A 4YV1A 1VOTA 1EU1A 3OEEA 1A7UA 3CXUA 4LECA 5IIMA 1D5WA 1GL6A 4RQTA 5LQSA 2H1HA 2WSIA 3BJZA 2M9NA 3KEOA 3MBOA 4KO2S 3CWCA 4LFBB 1MOSA 2ID8A 3RAQA 3ZNNA 3ZIAD 3DTVA 2VZLA 2FE1A 4KYTA 4POOA 1EH5A 2ZRIA 3EZ2A 3DWEX 5EERA 1D6MA 4RTLA 5IF9A 3OJUA 1C30A 1DQPA 2JVIA 4P38A 4CT4B 3O1HB 2RKBA 5EJ4A 1KDVA 3ABQB 4R9SA 2BBSA 3U5ZB 2AQHA 2X19A 1J6UA 1I9CA 1VM6A 2R8JA 1WVMA 4RC9A 4R8KA 3I37X 3KFXA 1JHOA 4TLEA 3D4LA 1NVVQ 8ICQA 4MR9A 5FQOA 4K9NA 2DKXA 4YJ3B 2ZK7A 3MPOA 3PTLA 4YRDA 1F2UB 2PCLA 2HXGA 3ACBA 1CUVA 1GO2A 2I8AA 4Y9RA 1KDTA 2VYQA 5LLSA 2ZJ0A 1J1UA 3FLAA 3PXAA 1E6MA 3GEMA 4L85A 3JSAA 3UMYA 3H9QA 1NK6A 8ICIA 2Y27A 1IFXA 1AGPA 9ABPA 3E3AA 3PQ3A 4J7XA 3M5CA 3LW7A 4RCVA 4BE7B 1ZJ4A 1DS6A 4FHZA 4M0AA 1Y6RA 2GT1A 1QG2A 1CUXA 4NBRA 1UBOS 3A6JA 1H2WA 2ZYTX 3W3ZB 1SVWA 5HJ2A 4FILA 3RSFA 3ALRA 2FWAA 1UK8A 3E81A 4I08A 4PZUA 4X8LA 4MLDA 1BNOA 4NJMB 1MC8A 2CDNA 4F3NA 5HA5A 3B2NA 1YB6A 3CWQA 1DAHA 1PW7A 5KFQA 1EG2A 4TV9F 4DL5A 1KDHA 2AE1A 4EMTA 1Z19A 1P3JA 2CT8A 4C2UA 1F06A 1MQ8B 3Q87B 1NVFA 4D6PA 4RYDA 3U17A 3VPXA 2PL5A 1JDBB 5JBQA 1Q0QA 3OIUA 3AF0A 4ZYXA 3OIYA 1TVKB 2O07A 1YBHA 4Z1OA 1PZFA 2DHDA 4Q4CA 1C9NA 3PBKA 3AERB 1RHRA 7YASA 3IL2A 4M6WB 4A10A 2LI6A 1FMTA 3ZE2B 3L3BA 3T5CA 3ILHA 3GARA 2P2YA 4ENSA 4II3A 3E7FA 2ISPA 1ONOA 1KYXA 2BCJQ 4Q7JB 1UF9A 4IOLA 5LZ8A 2N0SA 2PG3A 2GZDA 1XTSA 2F67A 4YTEA 2XYRA 4D8VA 2ZIUA 1GLVA 3I9V1 3UJHA 2FAXA 3D6NB 1PKXA 2ODAA 3DKKA 4TWIA 3B6IA 1LZLA 4KRGA 3Q41A 4FFOA 2E89A 1XZQA 3MIIA 1R0XA 3B1YA 1YMUA 3LVFO 4V1CA 4LJRA 4DABA 4QW8A 3FMPB 3REQA 4PGYA 4L78A 3BC1A 1AGNA 4FFBA 3W5SA 3TFRA 2VHWA 3IOCA 1Q8KA 1PJSA 2QI9C 1F6DA 2I4RA 4N0EA 1QLJA 1H2FA 1KMHB 1J8VA 3MQ2A 3AM9A 4ZCLA 2I91A 4L8LA 3RSHA 2PO5A 5CFOA 3I53A 1KBOA 1OT3A 4GL4A 4BB5A 2HYDA 4EDFA 2VA2A 1Q3UA 4RD1A 5L1LA 1ESEA 1O7JA 1PUZA 4L0MA 2YXLA 1U3WA 3DLIA 1J5EB 4V2IA 3KAJA 1MXHA 1UPFA 1MSWD 2K4HA 1GPH1 1SGWA 1GZUA 5LDGA 2H29A 4RHXA 5BNIA 3DYBA 3R5HA 4RK7A 1SU7A 3A06A 2OM2A 2W55A 5H16A 3F7OA 2VWHA 4RK4A 4R1OA 2PT6A 3KXKA 1B41A 1CR0A 2MIIA 3TQSA 3TK1A 3I45A 3R7SA 3F4BA 4WJZA 4BNYA 5KYWA 1HL3A 2BW0A 4N49A 1PTKA 5K3AA 3MLAA 5KSPA 4LZAA 4BNVA 2LYAA 2F90A 1Y5IA 3GRZA 4YD2A 1RRVA 3B9JA 4DC0A 1R5JA 4NONA 4MR9B 2ZZKA 3LKVA 1BWRA 2VP4A 5FLEX 4J3NA 3HB4X 4D9GA 4B6FA 1L7RA 3TLKA 1YZ7A 3SBEA 3G5TA 1TZKA 3RYHB 5BYAA 1Z2CA 1WXEA 3UQ2A 1L7DA 1KDOA 1NLUA 4MWBA 4WBNA 3A6LA 4ZK2A 3GIWA 1T1EA 3NBZC 2C9YA 2H1IA 1RXVA 4YMIA 1Z36A 4Z8XA 3H87A 2EFHB 2Y1WA 1Z45A 5DHAA 1V9CA 1TA0A 1OXKB 2IWHA 3CZQA 1KARA 4P3OA 2ECPA 3QE4A 1PL8A 1WWUA 1YSCA 3WR5A 3TI7A 2J07A 5J1SB 1YB2A 4TZKA 1VSUA 3THSA 4NY8A 4M38A 2DH6A 1G98A 1FPMA 5CDUA 1CP3A 5FXMA 4RZSA 3F5FA 1KEJA 2XOKD 4IXTA 2G5CA 1ZGBA 3SF8A 2RDIA 4ACBA 1J5XA 4XX1A 5HP4A 1DEAA 5HKAA 1L4KA 3CX3A 2XQJA 4FINA 4KE6A 2ZSBA 4BJHB 2DRIA 4MA0A 3WIUA 3WLJA 2YXEA 3U0VA 3ASYA 4EFMA 2C2YA 1APBA 4BZQA 4N7JA 5AK0A 5CA0F 4DM3A 4PYQA 1X9HA 1ZJ6A 3ZWMA 2CNLA 4L8FA 2FEWB 1UOEA 5BR8B 1T3ZA 1T2DA 2VJAA 1GQQA 3MOIA 3GJYA 3QRWA 4ZU6X 2K8BB 4FFPA 3I5AA 2PBFA 3OZWA 2REOA 3PSTA 5LVAA 1VJDA 2VSYA 2XCRB 1Y7TA 4JJ7A 5JAOA 3QOFA 1UP4A 2I4LA 2QX6A 3L1UA 3NKVA 3H2BA 1P73A 3AUXA 1PHRA 4HB0A 4LJSA 2ZIUB 3R24A 4RLHA 5SICE 3K75D 1Z56C 1C4WA 1TEHA 1ONBA 4DNFA 2BBOA 4XTCS 3UWPA 3AL0C 3G7UA 3OIWA 5HK9A 4OHFA 4D8TA 3HVUA 1NNLA 1DQRA 2PO7A 4DCCA 4V1CB 1BE0A 4OHVA 4M9LA 5J2TF 3DE3X 4OAQA 1I6MA 1U2DA 2QM7A 4IIFA 2VZEA 3DOJA 3EZFA 4MA5A 3NBFA 1ZH4A 1QU3A 3GVCA 1DOAA 3TKAA 3KHLA 4JUZA 1DO8A 4IFTA 1ZONA 3QJ5A 4URYR 1BVHA 3LWLA 3F49S 1K8RA 1GG8A 2PZKA 5I7HA 1O8BA 2W2NA 3H8WA 3SZRA 2DMRA 3KBBA 1P9LA 1D8BA 5JS7A 1QR2A 1UOQA 4TQUS 2P30A 2ZREA 5H9VA 3AFNA 3K1AB 3KK0A 1IHDA 1JYSA 2OCYC 2HI0A 2QN8A 1PLLA 4TYQA 3VKWA 3MPUA 2ZUCA 3DPUA 4H60A 1JEQA 1BHSA 4LF4B 1O6GA 4N7MA 2VRCD 1W8DA 1U9CA 4E1VA 3RANA 5F64A 1JEDA 1ZJMA 4HPWA 3O84A 2CLFB 5C7LO 3BL5A 1F0YA 1I1OA 5K3FA 1J9GA 1KFSA 1WUDA 1WV1A 1WW2A 2HK7A 5KFAA 4F93B 5IK2D 3QOWA 4XIJA 4FYJA 1ECLA 1I6KA 5C8DA 1ZXLA 4RTRA 1PG5A 1HZZA 2A3NA 2VA8A 9MHTA 4H1HA 5DXJA 5G41A 2VRWA 3E1SA 4IAOA 2GF0A 2Y76A 1XQXA 3DEZA 3HFSA 3G2NA 3LXXA 4ZCMA 4D6YA 1OUMA 4KHZA 3T3FA 1NR5A 2HIHA 1FVHA 3OF5A 1L5RA 3R0IA 4QLAA 1MUUA 3CZRA 3TE7A 2W90A 4AVYA 2WY2D 4QYSA 1Y6QA 1T5BA 4D4JA 3L05A 3AEQA 1ADGA 4UVIA 2VPIA 3FIUA 3V8QA 4V0NA 4HAXA 2PD6A 1JAIA 1TA4A 3EEBA 1JKJB 5FTNA 1ZD9A 2GESA 3DL4A 4UPEA 1X8LA 2BTOA 4J6EA 3GHYA 3E15A 3CUWA 3PJRA 2ZCVA 5AJHA 4R1SA 1XVIA 1CUFA 1G5PA 3H9GA 2CB0A 4DADA 2ZWIA 4C3UA 3CG0A 2D3WA 4OY3A 2GK6A 2X0IA 3NRCA 4LZNA 1JTVA 2QNRA 2WG0A 1GL9B 4D99A 2V0NA 4M2YA 1Z07A 1AKEA 1QGED 1WPGA 2OLEA 4HGQA 2LTAA 5LUBA 4Q05A 3PCRB 1HRDA 5C7YA 3F9RA 1HYQA 3EQZA 1GWNA 2BELA 5J8YA 4G9GA 2OBMA 1J0DA 3MJ4A 4TZ0A 5KNBA 3BH7A 4LHEA 4RKEA 2FU5C 3H3FA 1UZUA 2B9EA 1MIHA 2RJ3A 4DUYB 3B6KA 4R2MA 3L7MA 3S2ZA 2VJKA 5CFRA 3EXG2 3E9ZA 3LU1A 2NSLA 3QA9A 3L02A 5HF9A 2YMPA 3TVTA 3CRQA 5CHGA 3WP0A 3BQ7A 3A1CA 3O6VA 4ZDJA 1AD2A 1TLFA 5I8WA 2ATVA 1M0WA 4H2DA 5IH7A 4I5EA 2XVTA 3OT1A 1MENA 3OZRA 2OYRA 4GG1A 1Y9AA 3RV3A 3HWTA 1XXLA 2I54A 1D6NA 3QVOA 4CIYA 1QSYA 2O2JA 1BA2A 3JAWA 2BE7A 2HUNA 3BAZA 1XMPA 1C2TA 3AUKA 1A8QA 4P7JA 3VC2A 4D97A 2FPMA 2O6LA 4TTRA 4GLLA 1SV0C 4I27A 2PS1A 1KIFA 3LVWA 3GCGA 1UKCA 1JG2A 5DTMA 1URPA 3LD9A 5CA1F 3K0FA 5KNDH 3ZE0B 2RGYA 3FTDA 2BQUA 4X71A 3R6WA 5JARA 2P0EA 3KG2A 2RIPA 3NNSA 1VGQA 2YYZA 4YIKA 1PR4A 2DXIA 1TEZA 1GD1O 1G55A 9ICJA 3SZ2A 4L9WA 3WMEA 2FZ4A 2VTBA 4FZRA 3ZDBA 2QAJA 4I6JA 2CEKA 1VJCA 4OU5A 5I7SA 1JEQB 5KSZA 1VLJA 1S89A 3A4VA 3L7JA 3OP1A 2QXTA 3QXGA 2UYQA 3KJZA 3QPUA 3BRCA 1W4LA 1XKTA 4PZOA 1F2TA 1MPXA 2JB9A 1OIVA 1MC4A 4YG2A 1F7VA 5K0JA 1JLRA 1YJQA 1UODA 2JLUA 3W6UA 4W1PA 3DUFB 2WFLB 3D8UA 4MKFA 4C04A 5K3FB 5JFGA 2L69A 4IPTA 2PWAA 4JR2A 1IXKA 1TL7C 1YUBA 2K87A 1OWMA 3GC6A 1MJ5A 3CKLA 2OL4A 4Z53A 4IXMA 3OQMA 3G2LA 3RRZA 3C1YA 4MCAA 1JZQA 5T67A 3NAZA 3ZU4A 2HTEA 4D96A 3D9QX 4Z4HA 4UBIA 3OFJA 5GVRA 2QX9A 2FLLA 3LDAA 5F52A 3JPRA 3BTSA 2GA9A 1V3QE 4KQ9A 1Z5WA 3RU3A 2FKAA 1UKYA 3I0NA 3QHPA 3QXHA 3GPBA 2Y66A 5JDCA 1QE5A 3I4LA 2QOEA 4LCJA 5IJ9B 1GTVA 1MEEA 2O1SA 4F2WA 1T9GS 1DJOA 3OWHA 3UT5B 1ES9A 1Z26A 3W5DA 1SOAA 3T52A 3NM6B 2JK0A 1BHO1 2PEZA 4RK5A 3TE6A 4BTVA 2QP9X 2Z2IA 5BWNA 3ZXUB 2PAAA 3SFTA 3QFHA 1J25A 1T0BA 2WU3A 3N7UA 3GQBA 1LC0A 5T3YA 1GO3F 2V7VA 1CYDA 5I7UA 3F2BA 3OY7A 3O2SB 2IT1A 2WJVA 1YOBA 1R0ZA 4Z7NB 3LDFA 3AMVA 1HFJA 2AYYA 4P2BA 2OMEA 5T7BA 4Z4IA 3WL4A 1FSGA 3KL2A 1ORTA 3LL4A 2XWQA 4CTMA 1KTVA 2G0TA 2WB2A 3H4BA 5LQAA 3M33A 1IDN1 3UMVA 1ODCA 5HFJA 1ZM2A 3MWFA 4JC5A 3QVGA 3BE8A 2F55A 3TTTA 1DEXA 3DS8A 1FQOA 3DAFA 1YQ9A 4WHMA 3JW8A 4F71A 4BX3A 4HB2A 2JZCA 3DZBA 3IURA 3K8ZA 3GPLA 3DMHA 2FQWA 3K20A 5HOEA 4FO6A 5KYYB 1K6IA 1ZGJA 2EFGA 1B16A 3VPCA 2ADFA 2G08A 2D0OB 1Q1ZA 1LNQA 3Q8XB 2JDIA 1U0GA 4A26A 3U4GA 2AFIE 3WGGA 1HDYA 1JWAB 4RFLA 2AX4A 2AR0A 5I7OA 4QTTB 3KKAA 1O96B 3TECE 3OT1B 5KTSA 3OZSA 1XDUA 3ORHA 4NL4H 2ORYA 3L1KA 1T5IA 1JXQA 2J59A 3OCZA 2ATCA 3JAWB 1ZJ5A 2YN0A 1H1TA 3BHNA 3P19A 4LFCB 1Z6ZA 3N3BC 1WXIA 2FMPA 2V7XA 5LMZA 4ED1A 5AKJA 3G0CA 4K26A 2QIPA 4AO8A 3PT5A 1QJCA 4XUSA 1UWKA 3TAXA 1TEVA 4IEFB 5FOSA 3I9MA 2CHEA 3K0FB 3QVJA 4A8JA 3KVOA 4EJSB 2XDWA 1Z0AA 1QLNA 2RFLA 4HRVA 1C4KA 4FZMA 4RPHA 3R6DA 4YH1A 421PA 4A3SA 1R00A 2AXEA 2H1SA 4WY5A 4UASA 5JD4A 1A8UA 2VTBB 3O2NA 3IERA 3ZS8A 3AM5A 4KXVA 2AEFA 4BIMA 1OI4A 2V3VA 3FYUC 4IX1A 4YO8A 3WWPA 1RXCA 5G1PA 5GJCA 3TW8A 2ZE7A 3B7WA 2I67A 4OB7A 2JI6A 2J41A 2OHHA 5T57A 1QAOA 2VF5X 2AZMA 3PICA 1QZ3A 3I1FA 4GW3A 2FVXA 1DJQA 4FDMA 4X54A 1TM5E 5DNAA 3DV0A 5KSYA 3UUFA 4PNEA 4CT5A 3MGAA 3CHYA 4DY6A 2X7JA 2YHUA 1XELA 3OIFA 3HVHA 4G23A 4KSYA 4PL2A 4ZYWA 3B7GA 2BDTA 4TT3D 4ALMA 1JIQA 3MD9A 3GP8A 1DJPA 3WNCA 4C76A 4FHGA 1TOAA 3ANLA 3I6MA 4QXAA 1OJ7A 4NV0A 4H3SA 5LYYA 1C8KA 4HWGA 4FYVA 2QRMA 1JDVA 2ILVA 1NTRA 2QVGA 3GZ4A 1FJXA 2QAGC 3E2EA 4QSHA 1SN7A 5GOZA 4DA0A 2HA2A 3TIVA 1B4FA 1EWTA 2UVPA 3ZHRA 1L8QA 3RBVA 1EVYA 1CEZA 2ZJ6A 5LR6A 2GBLC 1QFYA 2EYUA 5A4KA 3BM5A 2FSPA 4ZU3A 1KL7A 4LRXA 1B6SA 4PFKA 5CFMA 3HVKA 2N1RA 4O08A 1E94E 2Q1UA 5CVVA 3N2IA 1LBIA 5G3ZA 3TR0A 4YCJA 5M2QA 5KKAA 2I2XB 3BQ9A 1MJHA 3H0CA 1BMTA 1LW6E 4KH1A 2HPAA 2QX8A 3IP3A 5JIBA 3NUQA 1XP8A 4XFKA 5DV9A 5KFRA 4QICA 4EW3A 5BRAA 1AXEA 3QMPA 2QRNA 1Y82A 4LY0A 1ZQ1C 4M3NA 2QMEA 5LXTF 5CM8B 2GFQA 3W04A 1JHQA 1EM6A 4ARBA 4CIAA 3E9QA 3LBAA 2Q9CA 2G9RA 5E4TA 2OWOA 5IINA 3RBZA 1K1QA 4YRNA 1J09A 2JGDB 2Y77A 3RJGA 3O38A 3FWPA 3OPNA 4GVLA 1CJBA 1OOEA 3AM1A 2JV3A 4G81A 2H1OA 1PGOA 4GX1A 5T5QA 3MWEA 4KKVA 3EXFA 1D09A 4MV0A 4F92B 2JLXA 2E4AA 1X2EA 2VAMA 4XLTA 3ZC3A 4XDGA 3PDJA 1IG6A 4UDNA 3T5TA 3W2FA 4DWIA 5FUXA 2PMBA 5ALXA 1N1DA 3CVVA 5AHXA 3HJBA 3HZOA 5JLAA 3EPPA 1FNNA 2HHVA 3VAZA 2HF7A 2WUDA 2ZBDA 2ZJFA 5C81A 3IAAA 3QXXA 1TCAA 4Z3KA 2DZDA 3ABOB 1ZINA 4REMA 4XJXA 1K5PA 3P9SA 3TOVA 4LQDA 1MJGA 4F7WA 2PY6A 3TW4A 4G5OA 4PHDA 4XM1A 5A4IS 2OCEA 1N2CE 2P7IA 5KWEA 2FUG1 4C4RA 4XWYA 3T5KA 1QSSA 2VH5R 4XWAA 2QBYA 3UPUA 2MWMA 1GZHB 1UEJA 1HNZB 4RY8A 1QCCA 2GN1A 3BWDD 4UZEA 3MFQA 3RJZA 3Q8MA 2JG3A 2YC2C 4QWDA 1NRXA 3R4CA 2ZIFA 4J0EA 2P2ZA 1XKQA 4KRXA 2C5FA 2PIDA 2QY9A 1N5KA 4XJTA 5TPZA 2IJGX 4YRAA 2IOYA 2RK3A 4NK5A 4D56A 5J0TA 4DF3A 3OX4A 4Q48A 4YUYA 2ACVA 2VCEA 2O2YA 5HYVA 4JBLA 2H9YA 4GYKA 1M2KA 3OHMA 1QTRA 1DB3A 4IHJB 4GE3A 1KO1A 4R8VA 1YDHA 2RHOA 1VJ1A 1U0NA 4Z6KA 4L07A 1C5KA 4F4CA 3B3AA 8ATCA 2O0KA 1J24A 1RXEA 2A9RA 1X66A 3Q85A 1CRXA 3WRXA 3I9FA 4PH5A 3KXIA 4Z86A 1YRBA 4EGQA 2IE8A 2JZBA 4KYVA 5C5EA 1NMZA 3GUVA 4BFVA 2R8IA 3OJ0A 4BCCA 4MRVA 4NLZA 1ZIYA 2QLBA 2Q3JA 2ZRBA 3WWYA 4JLOA 4OIMA 4R1MA 2PL9A 2FE4A 3BK2A 3PB3A 3BFJA 3O94A 1JEYA 4LISA 5KG5A 4I4IA 2HHTA 1OBHA 2KOBA 1JN0A 4KXYA 2BONA 1Z6YA 4NK4A 1FP6A 2IKQA 3PF8A 4BJ1A 1U9JA 1IXZA 3SMQA 3KIPA 2ZSFA 3BZUA 3K6SA 5DX0A 2CD7A 4X20A 2Z30A 1KJ9A 1RXYA 3ZUGA 2Q2QA 1HR0B 4ZD6A 2C4MA 5I7WA 3RS9A 4KFSA 5JS1A 1PJRA 3F73A 4MW0A 3RHFA 4DPKA 2QTVB 5HQJA 3CT6A 3ZY6A 5BOSA 3BICA 3R3JA 3ISCA 1G2QA 3GLGA 4EW6A 2PMDA 1ABEA 2EG9A 1RQ2A 1WDWB 3L7KA 1VLMA 2EEZA 1URJA 1IHUA 3DXYA 3HUDA 4YT5A 1MOZA 2O1EA 1JSXA 2WIJA 3K09A 4K9LA 5FRDA 1VI2A 1RW4A 4ZZ3A 4QOFA 2PUVA 2CK3A 2IP1A 3BGOS 3V8VA 5HVNA 1KR2A 2NUAA 1XAGA 1E9AA 4K6KA 2PU7A 3ZHTA 2DBQA 1RKQA 3WQRA 4IIYA 1T4CA 4TMWA 4TYPA 3T0FA 3F6SA 1LJLA 1BDMA 2V7GA 3PZRA 1JIHA 2GXQA 3TZEA 3ZCRA 2Q4DA 4PTZA 4JVNA 1QNFA 5D46A 4AG3A 1PI3A 3KZ1E 1Q44A 3DTTA 5HBRA 5L40A 2WSYB 4DBLC 1SO8A 2IDZA 4Z54A 2AKEA 2ZR8A 2PVSA 1YDMA 2OCAA 2WD8A 2BH2A 1PN3A 1FPQA 2XGJA 2NV0A 4C29A 3ANXA 3HNRA 5EXPA 2RDMA 2PS9A 5C4IA 2V9WA 3TB4A 4AD8A 4MP3A 3GRFA 1TO6A 3B5IA 2OHVA 3FDSA 1N3BA 2OOSA 4I5GA 1JNYA 3S2EA 2DM6A 3JU3A 4BECA 1PZGA 3I73A 2R1TB 3KT6A 3FTNA 1RI2A 2NZVG 4L27A 5A0TA 5D1NA 3K5WA 4M0CA 3EPLA 1OXSC 2CHGA 3ZJVA 1LK5A 1MG0A 1OX6A 2PUGA 5F9HA 1PVQA 3QBJA 3OAAA 2R11A 2PK3A 5JCJA 4ND8A 4MW1A 2O0HA 1XMJA 4LTMA 4HBZA 2XMGA 5D3MA 3VO1A 5KOJA 4WN9B 3HB5X 3VPSA 2PMWB 4G8DA 1IBMB 1QS0A 3I64A 4AO6A 3LC0A 4Q19A 1OGJA 4ASUA 3NONA 2NPIA 3PR1A 4LXIA 3D3EA 4RANA 3OI7A 4KQXA 5TMDA 2WT8A 2OV1A 3H86A 3W9YA 3CE9A 1REQA 5D00A 3ONNA 5FL3A 1ZK3A 3IEUA 1MN8A 5EIOA 1O97C 1THMA 9ICWA 4RTMA 3CINA 1B7GO 2W37A 4D25A 3D6JA 1B15A 4CTNA 4CNBA 3BL6A 4IRDA 1TM3E 3K92A 5F73A 1RAAA 2WI8A 1LFAA 5IIKA 1BQ3A 1W0JA 1I4LD 1H3EA 3IOEA 3DOUA 3IMCA 4HATA 4F2SA 2HHUA 4EJFA 1PKEA 2BIFA 3TFWA 1CRPA 5GONF 2X86A 1DAEA 3ZHUA 5FUWA 2ZXEA 3M2PA 5I51A 4JT4A 1LNZA 3HR4A 5BOSB 2CCJA 5AK6A 4Y3UA 5I45A 4M21A 3K9NA 5DBCA 1HMYA 5ICGA 3VYRB 2WTMA 3LI2A 4KR9A 1NBOA 2ZE8A 4R9VA 1D0VA 4K6CA 1JFFB 2YX1A 2NUBA 2KJQA 1EGVB 3H18A 4H3VA 4S1VA 3R3YA 1T5TA 3WBBA 2Y0CA 1SHZA 1A4XA 3WISA 1VMIA 5EZ6B 4FM9A 1K3UB 1HDOA 3NP7A 2NUAB 1YS1X 1KQNA 1FNDA 2B8WA 2HHQA 1EWQA 4YRMA 5B2EA 2VF7A 1FBNA 1RACA 1YS2X 5DJ5A 3HB0A 4QGGA 2VDMB 3NPAA 2XTJA 3HGQA 1KHHA 3H04A 4UATA 3Q0IA 1OA1A 2OORC 3HP1A 3E3OA 2QTWB 4FDAA 4M8LA 1G8MA 4LV5B 5BYJA 2Z5GA 2E5LB 3BD9A 4PXYA 4LSZA 1L8AA 3CIFA 2SICE 4QZDA 4ZREA 1J9EA 2NM0A 5EHZA 1A9QA 1J07A 4E03A 3QEAZ 3E22B 4JX9A 1WCV1 3GRYA 5EHXA 3OOWA 1TYZA 5JD3A 1RZUA 1QYCA 3D1JA 4DBLE 3RG2A 2O52A 1K3FA 3C6ZA 4YJFB 4DMFA 3NGDA 4RZQA 5BURA 4I5FA 2EZ8A 5CA7A 1T3TA 3D3NA 1ZRSA 3LKDA 3TZLA 1Z00A 1R8SA 1BOOA 3ZG6A 4LGMA 4B6PA 5ALUA 2Q5EA 2NADA 2I76A 4IWXA 3I9JA 4YJ3A 2GF2A 2DWQA 1YQWA 3QTLA 3OG9A 3OIGA 1VYUA 4BZWA 1H6BA 4ND8B 3QYAA 5AXDA 3WB0A 1Y63A 2C20A 2P35A 4DNOA 5GZ6A 3D7KA 5JMWA 1ZBDA 4PGFA 1GN9A 3CGGA 1T6ZA 4KMMA 4C4YA 4GQBA 3NALA 4YXFA 4BDSA 2I6SA 3TBFA 3Q3JB 1YQDA 4CIVA 2DBRA 4IIXA 1W76A 2FEXA 2W2QA 1VKZA 4BO2A 3EODA 1REQB 1SH7A 4ARAA 2IDJA 4IV5A 1MV5A 3P26A 4ZHQF 1NLYA 4NJMA 4O4HF 2XMDA 5REQA 3TQ1A 4OLFA 4NNJA 1Q0PA 1I80A 4G5SA 5ALWA 2V7QD 1FFXB 2XAAA 5KFZA 4ARIA 1A2KC 1F9AA 2E18A 5IMBA 1WBJB 1NBMD 4ZHSA 2VJQA 4BO6A 1X2BA 2HHCA 2O2GA 1MU0A 3T38A 1Z47A 3V8NA 3AERA 1G64A 4FGJA 5KFFA 1NBIA 4L9SA 1L7PA 7ICVA 3ZS9A 2EQ5A 1SVLA 1YZ3A 4E12A 3DCYA 3H9BA 1UP7A 3Q8QB 4IY1A 4WFJA 5FA5A 5FAXA 4CCAA 3EAGA 3PVCA 4B83A 3BIWA 2AOWA 3RYCB 4K03A 2HOFA 2JBWA 4UE3S 3UWSA 1VBMA 3ISBA 1G5FA 5A4JA 3T1TA 3Q9SA 2BUAA 1P4AA 1FDVA 2ZJ5A 4IF6A 4ML3A 1YFKA 2O2IA 2XUKA 5DB8A 5B7QA 4KI7A 4M0LA 3U56A 1JBQA 4Y18A 4DE5A 3HCAA 2VPTA 1J8DA 2ZM5A 4NZYA 4IIUA 2AR9A 4JOCA 1RYBA 3WVNA 1NW8A 2VF2A 4B3GA 4DIEA 4F4ZA 1J42A 3OETA 4F50A 5DNYB 1YUMA 2RHWA 1EFLA 3TFOA 1OBOA 5JU5A 3MA0A 3OKPA 3ZHVA 2JAQA 5LFAA 5EIXA 4E5UA 3D6TB 1KMHA 1VJRA 1XDBA 1Z6QA 3JVVA 4XDYA 2GM3A 1FA9A 3ZQ4A 3UMCA 3PW7A 1TO2E 2VWPA 1SD5A 2ZB2A 5KJEA 5AM3A 2LP4Y 2P3OA 5BN5B 2C8LA 5D7BA 2EAOA 2IHUA 3WHPA 2LBOA 4LVSA 8ICMA 1EWVA 2DPLA 3EW7A 3O31A 4KO4S 3PFNA 3LPNA 1POWA 3I5MA 2AN3A 5DBHX 4GI3A 2P8JA 3ECSA 1N2JA 4FEAA 4TSRA 1UJCA 4L22A 1RT9A 3QFRA 1DVRA 3D6UA 5J4HA 5CFPA 4R7GA 1Q91A 2RKOA 1Z00B 1RC1A 1FFEA 3DTVD 3ITEA 3I1YA 2YHSA 4A1OA 3A6HA 3ZE7A 5C2JB 3CZCA 4TV8B 1RQXA 1ZD5A 1ZZEA 1NDQA 5KFJA 2A59A 1GVHA 2VNIA 4ICAA 2NRZA 1JU3A 4DSNA 4C08A 1V6CA 2PWBA 3RM3A 4XA5A 4UTOA 2RCYA 4NCKA 2YVKA 3LUGA 1U0HC 3M6KA 3RYHA 1XD9A 3U9SA 3K1RB 3SX2A 1DX9A 5I9NA 1HDEA 5IAEA 5JALA 5EQDA 5JTIA 1N34B 4WWHA 1FZQA 1RC8A 1R4ZA 4BCDA 2Q6VA 3CLTC 4J1TC 1IIBA 1X6VA 1Y1KE 5AKIA 3P4UA 1XQYA 4WSOA 1XWFA 3EPIA 3QEOA 5G1OA 3KZCA 3H97A 2QNIA 2VYCA 4IVQA 2QYTA 3T1NA 1Y42X 1S97A 4QJ5A 1SPXA 3T3DA 2BMAA 1NUHA 1DOZA 1WZIA 5J0OA 2P11A 3NETA 2R2GA 2I2FA 1E4EA 4FNAA 4HDRB 4J0FA 5REQB 5B6IA 2ORED 4XEUA 4ZTBA 1LPPA 4MVXA 2I0FA 4HBGA 4CE6A 3EVEA 1Q1GA 5EI5A 4C5CA 4ZIRA 4CM8B 2Z2ZA 2DSTA 2JIOA 4MR8B 4IJ5A 2A9FA 3HKEB 4N9WA 1EJ6A 2XWBF 4DL3A 1GPBA 1NOJA 2AIRA 1N6IA 3CKYA 1O2DA 4G5QA 4LMBA 1G5TA 3FMVA 4MEJA 2O6KA 4ZJUA 3B1JA 5K8VA 521PA 1SQ6A 1CDEA 3BXZA 3IVMA 2ZR0A 3NHZA 4P3YA 1W0KD 3P9XA 3RQIA 3DR3A 2OEHA 1SHJA 3LK9A 3F1KA 4Z7QB 3FXAA 4DR2B 2YIJA 4GVPA 3QHAA 1L3CA 4IFBA 4YP3A 4HGRA 3NB0A 5C37A 2DUYA 3WGJA 3CUKA 2NU8B 3SWWA 2GRAA 1IOVA 4GP7A 2ZTSA 3MINB 2C7GA 1Z0KA 2ETXA 4UE2A 2P6UA 4W9NC 1YJAA 2VZ9A 2BGNA 1H0SA 3FOAA 1MEOA 5FBLB 4JLWA 3QPDA 3KWLA 1YACA 4EBDA 1OAKA 4BFTA 3LFUA 1U98A 2VSQA 4LDQA 5FPHA 2WVGA 3DVAB 5B66U 1JH8A 3GIDA 5JT1A 2QVCA 4AZ3B 3W5UA 5JISA 1YAJA 5TE9A 2CUTA 1RU3A 3AP2A 2KE7A 4UFNA 2HIMA 4J0HA 4BKUA 2KEYA 1M67A 2C7VA 2FGKA 3LUBA 1P7VA 1QMGA 4DA7A 4P4OA 2ORIA 3H1FA 3VPBA 4XPZA 4YQZA 2P67A 2A3RA 3RSZA 4WZBA 2JANA 4NMWA 3UG6A 3SYLA 1Z75A 2GM4A 5L53A 2B5WA 3O9ZA 1EE9A 3GJ4A 2GCNA 1Z74A 4MWGA 3DMPA 3G8BA 3ELUA 3NR2A 1XC9A 3CP8A 2CF5A 5I48A 5DTIA 4MV3A 3K1AA 4UTRA 4B9MA 4MW4A 2IY7A 1LBQA 3QLJA 1J2NA 4GWLA 1N77A 3U26A 1UADA 2V03A 4NLKA 2AI2A 4ER5A 3R7DA 1WNFA 3LYHA 2QMZA 4UNSA 4I8XA 2YJ3A 2ESEA 1P31A 3UJNA 4FMCF 2AXTU 4G5RA 1VHQA 2XO7A 4D98A 5H81A 1R6DA 1TJ4A 3BGWA 1LDGA 1PYGA 3PR2B 4MKIA 3OZEA 4ZOHC 3Q5GA 3AF2A 1BFUA 2A1TS 2W83A 2XGQA 4TRMA 4Z6EA 2YUTA 4QO8A 2AYXA 5LM3A 5GOTA 2M1XA 5ALMA 3C6YA 4MJXA 1WS6A 3ASZA 4DQVA 1STOA 1BXZA 1E2QA 2ZS8A 4W6ZA 4Q45A 2OE2A 3WLPA 3U19A 2O3TA 4CF4A 3W2EA 4OQQA 5EXEA 1Y48E 3TINA 5J3JA 2P40A 5L3RA 3FTCA 3OVMA 5JV5A 1UPAA 3V1NA 2E4XA 1P0QA 4ZAWA 1PNTA 1NZPA 1FNBA 2ONJA 4JXZA 3PNBA 4Z4QA 2DR3A 2ESRA 5IYZF 4K8RB 1LTKA 1JECA 1PUXA 1E4EB 5SZKB 4S12A 3WTCA 3CVUA 3PQ7A 4CIDA 3UC5A 1JKJA 4R6XA 2AFVA 3VR6H 3T95A 1Q7RA 1QIIA 1CCWA 2I1QA 3RNLA 4ZIRB 3UFBA 1BPEA 4A6PA 1C7ZA 1EFHA 4M46A 3BE5A 4BQRA 4L9AA 4FE3A 1VHWA 1NOKA 1NJ1A 3AIKA 3OECA 3QU5A 1QYVA 1ND6A 1ZJJA 3NHYA 3Q15C 3OHSX 3PMLA 1MJNA 2C1EA 4L5IA 2HZ7A 4YRSA 1TAQA 3RH0A 2LDXA 3M2TA 3VH2A 3EPKA 2H0RA 1SUPA 4TXNA 3BS5A 1IY1A 1VZ3A 2V97A 3D4IA 3WO1A 3NTXA 4TS9A 4I5IA 2QUHA 4M1MA 1LRKA 1KH3A 1RPTA 4Z7OB 4FTWA 4YONB 2GKGA 2KJ8A 4M60A 3I5XA 3O75A 2F3UA 621PA 3FW1A 4UB2A 3P9CA 3FFWA 4MPDA 5JTTA 2C2EA 2WJWA 1QGOA 1LBSA 3FPLA 3V42A 2VSXA 1Z8FA 3CEMA 1UM8A 1ORDA 2XGSA 1F8XA 4EB3A 3PEWA 1I2MA 2W8BB 2O20A 5AW5A 5HJ7A 2Z2JA 1QV7A 2EJUA 2OG2A 4ZEOA 1QSLA 1E6UA 4RFSA 2DAPA 1Y9JA 4L16A 4LX8A 3ZNQA 5B1SA 4LZPA 1DTSA 3NBUA 5LQCA 3B20A 1Q0UA 3SJ7A 2I2DA 5ICFA 1RAHA 3WGHA 2HQRA 4WZBB 1AQLA 2PMZF 3IO5A 3VR4A 2AQ8A 1JB9A 1KZHA 2QJWA 4FZJA 4EL0A 4ED6A 9LDTA 5LQMA 1C7FA 4G4IA 1A50B 4MIEA 7ICQA 4R9RA 1I30A 1SZDA 2QRZA 4HLQB 1G8SA 3IP5A 3N0VA 1M1YE 3SOPA 1GA1A 3PEUA 4M1EA 1IJBA 5CD1A 2VXCA 3AUSA 3VJKA 9ATCA 3IEIA 4XD7D 3UCFA 1N9GB 2PV0A 1LD3A 2JXJA 3ZHCA 5CLJA 3MJCA 4GXIA 2OCIA 5AVUA 4PZ0A 1QQ6A 1OXXK 3GNTA 3FSGA 3I34X 3N6XA 8ICUA 2XUHA 3RJMA 4M9GA 3GZNB 5F2EA 3DUFA 2WFLA 4X9XA 3PDHA 1EP9A 2RGEA 4Z0TA 1BYUA 2AVDA 3TZQA 4LRUA 4KIUA 5CT8A 2EKZA 1UM9B 3FNRA 4JWKA 3BSWA 1WZCA 1D2MA 3LPAA 1VL8A 3JPYA 1ZD2P 2XCTB 3VU0A 3GUUA 2FR1A 3DFUA 3O47A 5LA6F 1T8YA 1TLLA 4F4YA 2LW7A 3U7QB 1GNLA 9ICIA 4O2BB 5JXWA 1JL3A 3FYHA 4JUIA 4PZYA 1ZHFA 3LGAA 2PAFA 4X6XA 3NYIA 5AWFC 4F5NA 1MHTA 3UAGA 2DJ5A 4LF8B 1W5AA 5IJ9A 4AU1A 5C3MA 4ECYA 3UT5A 1PLJA 2BF4A 3LT5A 4KLCA 2NNLD 1UL1X 3T4XA 3PNCA 5KQLA 4ETWA 2NTEA 1ORRA 3KAQA 5KL8B 3MMNA 4TMKA 5EJIA 4RVSA 5J5CA 3IPRA 5F77A 5FBHA 5DXFA 2IQ5A 5AXCA 3H1GA 1GL3A 3NXSA 4KIWA 4OX9B 1NJXA 2WM2A 1P7CA 4MWZA 1MQSA 1GKKA 2QVYX 1PL6A 4JLUA 5BV7A 3WYCA 3A1UA 4C8LA 3SX0A 4WK4B 1A7AA 5LQRA 2CXTA 1GTG1 2H48A 1RCTE 3CM0A 4C2AA 1Q84A 5BSTA 3THWB 3BS5B 4RAOA 1YQUA 1AMOA 2O2HA 4TKMA 3RSCA 4DF8A 1Y6FA 1SVKA 4E33A 4RQ5A 2AZ4A 4L5BA 4DOCA 5KFXA 3RJIA 4GXTA 1TM2A 2R2AA 3FE2A 2JJ8A 3Q5DA 2C4KA 3VMMA 5KYYA 1Q0ZA 2X8WA 3NEAA 5FNZA 1LEHA 3OCUA 4DLRA 2EV9A 5D51S 3USCS 5AICA 2G4CA 5JZVA 1OYVA 3RI3A 3A9RA 1R7RA 5KNBD 1W47A 3FTEA 2P3LA 2HHAA 2ZYSA 1O96A 3GPDG 4LF6B 4GC9A 1GPKA 5COQA 2RG7A 4WAUA 2WUVA 3AOEC 4KWIA 3UB2A 1EMDA 3I4FA 4MUYA 2WWYA 4RFSB 2QQGA 2Z1MA 2PI5A 1ZEMA 3WLRA 5KDLA 3NAMA 5CT4A 4ETNA 4NCBA 2ZWMA 2R0QC 3RVQA 4A8EA 1G66A 2BSAA 1VRCA 3PUJA 1F8FA 2Q41A 3U7IA 2DVMA 2BAGA 4EJSA 5EUMA 4GOMD 1B26A 4Q5IA 4U9HS 2PRYA 1CZHA 4NOJA 1HT3A 1LW7A 3N28A 2JGJA 2C7RA 1ULHA 1U3FA 3HB7A 5CDYA 5KAPA 3DF9A 3DSRA 2HZBA 1OQAA 3PJDA 4C4TA 3JZDA 2XITA 1NN0A 2WJHA 1FVXA 5DYWA 5KC8A 1KZ6A 4OOEA 3JWGA 3F90A 5DRTA 4QM6A 2XUAA 3Q8RB 2WZCA 1FX1A 4JK1A 3BA1A 1YZGA 2ZQZA 1S4MA 3SFZA 4K3UA 4UB1A 4P4TA 2AQKA 5B1YA 4CL2A 1B4DA 2Q1TA 1NKVA 4C8MA 1ZWKA 2YZNA 1LX7A 2E1EA 3G1UA 4BFZA 2FJ6A 4DMLA 1H6DA 3P97A 2RE8A 1ZICA 3VA7A 3R0JA 2OBNA 2J7KA 1N61A 2KFNA 4IQ4A 2HK8A 4XQ0A 4ZO9A 1TAGA 4QDXA 1PSWA 3TFSA 4LYFA 2G77B 3GDFA 1ZGZA 4RXTA 4X95A 2Q2VA 3LHSA 4WOCA 1COOA 4KSBA 3HU3A 4DLYA 5TJ9A 2OBLA 3OM8A 4WMLA 1VE9A 3OCWA 1O8CA 3W3AD 1QYXA 2K6GA 1WXDA 3FNQA 1XTBA 3W9SA 4JSTA 3X1KA 2DWUA 1DKOA 4GOOD 1F20A 2DERA 4PSUA 4GYYA 4RHUA 2Y4NA 4QPJC 3AHCA 3ASVA 4CG0A 2Q2WA 3ZD6A 3RARA 1JQ3A 4URXR 3QLVC 2CRXA 1L7OA 4JC8A 4BKQA 4KJZA 1B73A 1RHJA 4ARSA 2QZZA 1NFQA 1ZOPA 1WSBA 4K40A 4PYLA 1JKMA 2XF8A 4HVLA 1DIRA 1SC9A 3LUPA 1YH3A 1TYAE 4HSGA 3EF1A 1O3YA 5K4HA 2QN3A 2ZLBA 3GHHA 3T7EA 3LRPA 1Z6XA 3FYSA 5ALQA 1C9YA 5JVDB 2JGDA 4LHVA 1EE2A 2HSGA 3M6MD 4G1UC 3AQIA 1F17A 3BJMA 1IZ7A 1QVVA 4W5QA 4F9TA 5HMLA 4ZYUA 1XF9A 4G2NA 4WJKB 1N0IA 1IPFA 3ZXYA 1C41A 2Y0PA 1Z5GA 4ZV4A 1HFKA 3KZMA 1E2JA 3OTHA 1YK0A 1UCFA 2KBEA 2Q5QA 1SU4A 4G1MB 3M8RA 4DLPA 3O1JC 1ZQRA 4W99A 1TF5A 1X40A 3CURA 2Q07A 3H2HA 4BNXA 3QEJA 1AKMA 2AEEA 3HL4A 2QX4A 2JW5A 1H0RA 2AMLA 3D7LA 5AMXA 4U9IS 4ZICA 1LB1B 2CNBA 1XZJA 1NM5A 5AI5A 4JV0A 3KLPX 2DFLA 2HPHA 4KLNA 1EUYA 4EF4A 4N0PA 4BDPA 5EPEA 2D5BA 3VC8A 1W5SA 4D9FA 3OJSA 4TYNA 3AL2A 1Y1LA 5KJ1A 4D0NA 4LZWA 4KPUB 3IQGX 1KEUA 1EHCA 4HXYA 4OK5A 1ZJWA 3V8EA 2JDID 4B35A 2C83A 3PNLA 3HABA 3HDYA 3C3KA 1ISHA 1XJCA 3KZNA 2HMYB 1O6BA 1HFEL 4QNRA 1R3DA 3SQOA 2BI8A 3UUWA 2XXJA 2NVUA 4OP2A 2CXHA 5TX7A 5BWOA 2LKDA 1ZD1A 1C3LA 3MSXA 3PWZA 4ENUA 5AVQA 5H68A 2QRQA 3S1LA 3RBAA 2FDXA 4Z6CA 4YYEA 5F3WB 4DVGA 3FOBA 4OLJA 2JIDA 1IY0A 2IFTA 2VHXA 5A5FA 4IHJA 1TUIA 1PK8A 3AHEA 2Z6UA 4F4IA 4RWZA 1AXRA 3O90A 1ZK0A 1JLKA 4BFYA 2ZU0C 4KAXA 3MOSA 1F8UA 3KSZO 1ORWA 2DP4E 5HR5A 3L4JA 1SBHA 3NM4A 1CEYA 1HUOA 4OV6B 2J0EA 1CUEA 2BEJA 3RAGA 3OQ1A 3KZKA 4QPDA 1G6Q1 3FGOA 4IH1A 2O48X 4LZDA 3UUGA 5J2CA 4QLBA 4WXRA 1XGKA 3ZBUA 4YALA 4BHTA 2DH5A 1E61A 1JTFA 4C8NA 4ZO4A 4MS3A 3UXMA 2VYVD 3B3FA 3MRXA 5C4GB 2J6CA 4D5EA 4H7JA 1D1TA 1YQEA 1UIRA 3AOGA 5CRIA 2JZNA 2C8JA 1ZQWA 3B70A 1ZMOA 5GZ3A 2ET6A 3A6EA 4PQFA 1G3MA 1DTWB 1IUNA 4O3QA 4QWBA 1A9ZA 4DM7A 3PZBA 1PWZA 1OB2A 2WF6A 4UPDA 1Q15A 4AG5A 3GV8B 1WPQA 3CRNA 2VH2A 3C29A 2XMCA 3NDIA 1QVWA 2QTVA 2FDCA 1M6HA 1CNMA 4WNYA 1YA6A 4ZGBA 3CFYA 3O4GA 1HUQA 2XZPA 1XROA 3RVOA 2JVJA 1WULS 2HT6A 4V24A 2BCRA 4QXQA 1BH6A 1XXHB 4Z5XA 3BAFA 1FFYA 2OQIA 1FSFA 4MKXA 3A1WA 2PUCA 1I7PA 1Q0LA 3LUKA 3OZXA 5JXJA 3C7AA 3DD1A 1L1EA 3ROZA 3U60B 2ZXFA 3BQ0A 5EY5B 4A0SA 3U44B 4PXSA 2HMUA 3OIDA 1NK9A 2J4DA 4PTYA 3LSYA 1N2ZA 1OUQA 1OYYA 1K7EB 1VPEA 1GGFA 1E59A 3GT7A 3OF3A 1Z29A 3PWTA 3DT9A 1H9AA 1PR3A 1QHSA 2QUKA 1N33B 2HT1A 1A2QA 2X6TA 3IP7A 3V4LA 2WJGA 2OK8A 3IE0A 4AWAA 3T79A 3E5HA 4J4BA 3TRJA 1RP7A 3CZMA 2OEPA 1ND5A 1BE1A 2DY1A 2EP8A 4NENB 3IX7A 1BO6A 1QV9A 1JHUA 2PFGA 4TWRA 3NFYA 4RTNA 1CR4A 2E3JA 3ZGLA 4K28A 1KLNA 4YR0A 2DQYA 3O9VA 2C2DA 5CDHA 1WKCA 2UUBB 3RS3A 5DEOA 3GEGA 6ADHA 2Q28A 3E0FA 1MJGM 1UXJA 2XT0A 1UC8A 5IG2A 1IULA 3HCFA 2JIPA 1FFSA 2GSDA 5KL1B 4CG3A 3MF4A 1G20E 2HO4A 1L5GB 3HCPA 3O1IC 5AKLA 1U6KA 5JAQA 5ECDA 1F1BA 2GOLA 4BFCA 1T8UA 2OC9A 1C9MA 1GRVA 5JCOC 3P94A 4LK2A 1RNLA 2R1TA 3CZ5A 1ZU4A 2C7OA 5F9FA 2DFKB 3VO8A 2IY9A 4QOIA 4ALNA 1CY4A 1R6AA 1T9ZA 4XUCA 2R62A 1QZTA 2NVUB 3HDTA 4PAOA 2J87A 1NG9A 3GJ8A 4BQQA 3K6RA 1NURA 3N53A 3GAFA 1PK1A 5E8RA 2QG9A 4AJPA 1A9XB 2NO6A 2YXPX 3RS4A 3KQWA 4WN9A 2OFFA 2C5LA 2Y1XA 1WDLA 3JASA 1E2BA 5HRCA 1ML3A 2D1QA 3WQSB 3P9QA 1FXWA 2CFTA 1AM4D 5F51A 3AW9A 5TPZD 3I6IA 2UYCA 3VR2A 4UBJA 3N2NA 2PH7A 1NJZA 1I3OA 3LQ2A 1OZ0A 4G63A 4BLPA 1VXOA 1UFRA 2NT3A 4ZCQA 2I78A 3LUAA 5KTQA 4A6XA 3PSIA 2OXEA 3K72B 4FHCA 2FHPA 3EVCA 3EGXB 2OWEA 1FS4A 2I9GA 1OX5A 5K0CA 4KACA 4MS3B 5KG6A 3CO0S 2LYBA 2IKSA 1PJ2A 2RHCA 4XYEA 3D2LA 3WGNA 4JXKA 4QBKA 3BQNB 4MVCA 3R20A 4IGFA 4ZEXA 1P75A 3U81A 2DU8A 1CUZA 2Y0BA 4AZSA 3X1MA 4LOHA 4ZA2A 2RGGA 1DQSA 1LLCA 1FYDA 4I2BA 3MTDA 4E1AA 1KZ7B 2ZRDA 5A5DA 3FAZA 4YNBA 1R6VA 4NJEB 3LNCA 4OQNA 2YVLA 2JAXA 3EDQA 2Q6KA 2B1JA 2CL7X 1U7TA 1SJ9A 1OFGA 4EPWA 4MVJM 1T36B 2BFEB 4AIIA 4JB8A 1K66A 1JFFA 4JYBA 5BNFA 3S28A 2PE5A 4IQUA 5NLLA 3BN3A 1C81A 3PR4A 4AWXA 2QVLA 4FWBA 4O4IB 4OL9A 1ABFA 4KLTA 2OB2A 4HMQA 5KG2A 4CXMA 5FUYA 1QE3A 4P82A 3T7IA 5KFNA 2XDQB 1YL5A 3CWZA 1Q7CA 1K5OA 1G2OA 5KYGA 3ZDQA 2CLEB 4MVJD 5BSGA 2HSWA 2IW1A 3ZU3A 5HIMA 2HV9A 2R00C 1XVAA 3O8DA 1KOJA 1GU0A 2Q8NA 5KVSA 2FSIA 4L8VA 1NKBA 3WDSA 2CK3D 5JBNA 3PITA 2WKSA 4IKOA 5HWSA 1HGXA 3VH4A 2V65A 2EU8A 5HF5A 3E22A 2ECKA 1O6CA 2H2HA 1V5FA 3UAYA 3W2GA 2VBCA 3CR7A 3MWLA 1EINA 4RF2A 1PHPA 3TNLA 5H0IA 3IEVA 2I4MA 2D1RA 1XQWA 1XEFA 3UJPA 1CVRA 2ZG6A 1TK8A 4YJFA 1X15A 4YP5A 3C3YA 1V1JA 1Y4UA 3UIEA 2F1KA 2OHFA 2H16A 1H9BA 3B8HA 1VIDA 1L7VC 4J1QA 2JGMA 4Q3OA 1ORIA 1DUSA 2QGZA 4GGOA 4CLHA 1YULA 2FSSA 1PFKA 4J2OA 3VDQA 2ZKLA 3PV0A 2WU1A 2A14A 2E37A 2WW8A 4ZOAA 4J0DA 1TW3A 4YD1A 3ICOA 1IM8A 1U0LA 5IKEA 4AECA 3TEJA 3ROFA 2FP3A 4B79A 5IZCA 2IP2A 3LK6A 3EH2A 4F45A 4M49A 3G2PA 4ERXA 3VH3A 3U4IA 1PK1B 1AIPA 3R7LA 3VVCA 5AOCA 5CB0A 3K32A 5FBKA 4ZARA 4PLCA 1RTTA 3B2EA 3Q2IA 2W4QA 2GI4A 2LR0A 3JASB 4KQ2A 2BY4A 3CTMA 1U2ZA 5E38A 1PUIA 2PSDA 3I6YA 4YHBA 4BV3A 3ETCA 1H2YA 1P8AA 1BOFA 2PQ6A 2XB6A 2WJJA 2SKCA 2E1FA 5JADA 1XLTA 2IUSA 1NT2A 4EATA 2QTRA 3OAAD 1ZXIA 4O3NA 1V26A 3NM5A 2Q4TA 4Y9UA 4GXKA 4L73A 3BMNB 3R0QA 1WMEA 2W43A 1U0RA 2INGX 1GKYA 3TSYA 5B3JC 2JAHA 1AKNA 4L3OA 3C43A 2KD1A 5EN4A 1PR9A 2EZ4A 3K05A 2DLDA 4KWHA 5IBPA 4XEHA 2C99A 1UWCA 3JPSA 4JGBA 5D84A 4NMMA 1FFXA 1FJ2A 3CW2A 1FP2A 3HCOA 4OHPA 3W8RA 3UMJA 2DTDA 3K4GA 3QMMA 3R6LA 4UNQA 3MUOA 3NIFB 2B99A 3MRVA 1YR8A 4JP8A 2I65A 3H1EA 2OSVA 2WAQF 3ETLA 1GPAA 3PXXA 5FWAA 2RJOA 4M98A 3UJ7A 5ITZA 4CM4B 2C5BA 3LQ1A 3MW8A 1N4DA 4GBMA 2FVYA 3EXHC 5CVUA 5G2OA 4QPNA 4J0JA 1FU8A 5GTHU 4X7RA 1TC1A 5E0KB 1QAQA 1Z68A 5COBA 1YC5A 3T5DA 1P7YA 1YZVA 2NGRA 4GD3Q 1AROP 5ECWA 2UV8A 3BHJA 4XUEA 3RYCA 4PL1A 4KQGA 4W5WA 1JU9A 4EKDA 1KKXA 3L4SO 3RO7A 4EUNA 4EI2A 1CQPA 3GEPA 1NKCA 4QFCA 1ZJYA 4A8HA 3KEFA 2AG0A 4PAMA 3UB4A 2PVPA 2DBZA 4V0QA 4EELA 3DW3X 1T2UA 2O14A 5E6UA 1P5ZB 3C5FA 2EAUA 4Y2RA 4FBGA 1SZHA 3U62A 1KQGA 3ZDAA 4EABA 4RKQA 4CKCB 4KMRA 4Y6RA 4RNNA 2AK3A 4LYGA 4PQGA 4DR5B 3I9V6 4LBVA 1W0CA 2ZAOA 3EXEB 3E9EA 5LJIA 1X39A 2O57A 2BSXA 1V5WA 1ZQLA 2ISOA 1Y1TA 3B13B 4I2DA 1ZWLA 3ENNA 3GG2A 9ICUA 1P5FA 5BN5A 3UAOA 5CVCA 4L5CA 2FSUA 3TL2A 1DXYA 3GROA 4FFMA 4Q15A 2BGRA 3N6VA 4JOQA 1KH2A 4TPKA 1ENPA 2GEDA 3J81k 2NZ8A 3NEJA 1CXZA 4MVJP 5E9AA 1MB3A 4R2KA 5B5SA 1IIPA 3WSVA 2BM9A 5IILA 2DFPA 1G38A 1IBCA 3JX9A 5ABPA 3IIKA 4YCXA 1FSZA 4FCWA 4HYTA 2WRZA 2O23A 5JDIA 4YMTA 4DVJA 3CRW1 4FMBB 2TMYA 2UKDA 1E9BA 4UD6A 2KV2A 3REOA 2FLWA 2V3WA 3PJGA 2IGTA 1KNXA 4TV8A 3OLZA 1CY8A 3VYUB 1XZHA 5FL7A 2O50A 5HJ5A 4XARA 2QUIA 4DNXA 3OJOA 2PGOA 4G89A 3V2IA 4MPJA 1GNRA 5K0GA 2M2IA 4WD3A 4INOA 1E1LA 3R74A 4PZNA 4NAVA 4LRQA 5CTJA 2QQ5A 3RRNA 3OWXA 2GBFA 3NHAA 1Y80A 4LWQA 1KEEA 1DAKA 1NX6A 4W63A 2PZBA 5M34A 2Z57A 1XUOA 5M04A 1WHSB 1NI4B 2FFHA 4RXUA 3S8MA 2ES4A 3LA8A 2HJHA 1D0IA 4PIPA 1H8HA 5KQMA 2Q21A 1J7KA 3AUJB 3BMQB 1WABA 2JJQA 2ZITA 9ICVA 2VJYA 2XDAA 4UMDA 1Q12A 1DKRA 4KQEA 2OFWA 4IJVA 3RPEA 3L1VA 2ATIA 4H0FA 2HWWA 3R0XA 5EFZA 4F2DA 4YJDA 5CXQA 4C3ZA 3SR4A 4FWIB 4HDRA 1KVRA 2P2LA 5K8IA 1GGHA 1XDDA 1P5JA 5B36A 1XU9A 4IHQA 2BKXA 4CZ2A 3TVDA 3DVRX 4MMYB 1UKAA 4CM8A 2EJTA 1NP3A 2QLLA 1MT0A 4MR8A 1SGGA