1NKCA

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after five rounds of primer extension, following incorporation of dctp, dgtp, dttp, and datp.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkcA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkcA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkcA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkcA01
2ZUDA 2KQ2A 1KFTA 1CXQA 4QAGA 4AILC 1UT8A 1ZETA 4F5RA 3DRSA 1WAFA 4P4OA 3GIJA 4I2CA 1NK7A 4FJ9A 3IAYA 4IFYA 3V1QA 3OYMA 1AROP 1ZQCA 4M42A 2R8IA 4GC7A 1EETA 2EX3A 3QZ8A 1RPLA 3EZ5A 7ICFA 2J6SA 3SQ2A 4J9OA 4TQSA 2H5XA 2E6MA 2DFHA 2VWKA 4J9KA 4RW7A 2IHMA 3PR4A 4O4GA 2IDOA 4CEFA 4FLWA 2PFNA 4FM0A 2YNHA 3V9ZA 1VSKA 5J2PA 4NLNA 2WONA 4KHNA 4XUSA 7ICTA 1EXQA 3OJSA 4DL7A 3E01A 9ICKA 1TVRA 1ZJNA 4GXKA 2RF2A 4FLZA 1NK4A 1DLOA 1LW0A 5KFRA 3DMJA 3RBEA 4B8AB 3MR3A 1DTTA 1QTMA 3AV9A 4IBNA 9ICUA 9ICOA 4TUPA 1A5VA 5KFVA 1NK8A 2GWSA 7ICIA 2G8IA 2HVIA 3UQ2A 4DU4A 1EXNA 4CJKA 3ZD9A 5HHIA 4KLMA 3I0RA 1MSWD 4FW2A 4I7FA 2C28A 1WCLA 1JX4A 3PVXA 4M6WB 4Z6FA 3C2LA 4F4ZA 4YMNA 1UAXA 5JS1A 4AHTA 5J1EA 5KFXA 3GFKB 4GXIA 3SZ2A 1IKVA 1JL2A 3P5JA 2A1SA 5DBAA 4B08A 1LWEA 4CFBA 1VSLA 3ZDDA 4EYIB 3PUFA 1TFRA 2P1JA 8ICPA 4RG8A 8ICHA 2V4RA 2KZMA 1X9SA 4E7JA 7ICLA 4E3SA 2W9CA 1ZQZA 3KLIA 2Z1GA 4K4IA 4KLGA 3LALA 4RQ3A 4I28A 4I2HA 3QERA 4I2PA 2HHWA 3KKRA 4LH4A 3FFIA 4YR0A 5HNKA 1Z00A 2G8WA 4DOBA 2ATQA 4W5OA 3K58A 4UQGA 4OGEA 1S6QA 1RBTA 2EHGA 5EWFA 9ICJA 4FZXC 5HRPA 3NH2A 3QO9A 2ALZA 3LDAA 4I2GA 4B9LA 3BQ0A 3LP1A 2RN2A 3C1YA 3NAEA 3CG7A 4FJ5A 4F93B 3DLRA 4DTJA 2FMQA 3ITHA 1YTAA 1BCOA 1ASVA 3T19A 3GDXA 1ZJMA 3SV4A 1KDHA 5HBMA 3AO1A 4FJHA 2R8KA 3HL8A 2BHNA 4F2RA 3NE6A 4XRHA 9ICFA 4FZYA 4M3UA 5JS2A 5KG7A 2IOCA 1VRUA 4YG2A 4DU1A 2FBVA 4DSLA 1BPXA 1I3AA 1HQUA 3IG1A 3NF6A 4M3XA 3HT3A 3V1OA 1V9PA 4FJMA 4GVMA 3AVFA 5KFBA 3PX6A 3HSTB 3QIOA 2BQUA 2Z1IA 1S1VA 4C8KA 4FW1A 2XY8A 4Y1DA 1T05A 3KK1A 1EKEA 4YVZA 8ICWA 2NRZA 3OYCA 1LV5A 4FS1A 3QEWA 4N41A 3V72A 1ZQBA 4QW8A 3RH4A 4FJIA 4BE1A 3RB6A 3KIOA 3SYZA 4P4MA 4QWAA 1ZYQA 4DF8A 4OVLA 1JMSA 1D8YA 1B9DA 2B6AA 1D5AA 2HHVA 1FXXA 4ZTFA 2O4IA 1RBRA 4J9MA 3V6KA 2VA2A 4JK1A 1ZQYA 1QS4A 1BPDA 4YD2A 1W0HA 2FMSA 1L3TA 4DU3A 3SNNA 3QEIA 3RAXA 3N4MB 8ICGA 1FK9A 4PQUA 2Q0ZX 3Q8SB 5KG4A 4KTZA 3V9UA 4C8LA 4MFCA 4I2BA 3GIIA 2W9CB 1HUZA 2FC0A 3S9HA 3OHAA 4RT2A 3AUOA 1S5JA 2GBZA 2P5OA 2NRVA 2BR0A 4DS4A 4Z4GA 3O4NA 4BACA 3RWUA 3H4BA 1BL3A 4DQIA 3MFHA 4CHPA 4FK4A 2NUBA 2FPLA 3V7KA 9ICRA 2W9BB 4C8NA 4FJLA 3V6JA 5FROA 4B9NA 2ZTCA 5D3GA 3Q8RB 4DLGA 1VSIA 2P66A 2BE2A 4CJ4A 3O4QA 2F1JA 5J2KA 1ZQGA 3LP3A 4FJ7A 3AVJA 1TV9A 2AGPA 3L2VA 4CJWA 3ISNC 3O3HA 5J2IA 2GUIA 1S0VA 3KLHA 4ECRA 3SQ1A 3OSNA 5KG2A 2VG7A 3MGIA 3V6DA 3T5KA 1O1WA 3NF8A 5IINA 2DFLA 4RNNA 4B9UA 4Z4FA 4CIFA 4DL3A 3WNHA 2DPIA 4JWNA 3QZ7A 5KT5A 1YTUA 3H08A 1MC8A 3IHQB 3VQBA 4EBCA 4ELVA 4DSIA 3VQAA 4I2DA 5DKWA 2P6RA 4RT3A 2PFQA 4LSNA 4FK0A 4QWCA 3NDKA 5EOZA 2OWOA 4JS4A 4I9QA 1IKXA 1JLEA 3Q8KA 4CF2A 2I9GA 2P5GA 3RR7A 3M9NB 4E0DA 7ICJA 4CJEA 1BHLA 3QE9Y 3DRPA 4DMNA 1GOCA 3L2WA 3DOKA 2PYJA 3EY1A 7ICMA 2HNDA 3AVIA 5KRSA 3NFAA 3FDSA 3T1AA 1N56A 4O0JA 5CZ2A 3A2FA 1IXRA 1ZQHA 3LPUA 7ICEA 4AH9A 3RTVA 3LWMA 4LZGA 4CERA 3HX0A 4FXDA 4DL6A 4KHYA 2E6LA 3AU6A 4ECQA 3CFRA 3SCXA 1IG9A 3MFIA 4F4XA 2NRWA 1JXBA 2FBXA 2OYQA 3VQDA 2P6UA 3C1ZA 1IKWA 3V1RA 4UB3A 2RPIA 2B21A 2BPCA 1ZQMA 5HP1A 1W9HA 4QWBA 4DLEA 4PHDA 1S77D 2OA8A 3AA5X 4FBTA 2ITGA 3AVCA 4QZHA 1KLMA 3Q8QB 5HMLA 2JZBB 3EW9A 1IO2A 2DY4A 5HRNA 3SUOA 4DTXA 4FLYA 3MXMA 3JSMA 1NJYA 3HWTA 1XHZA 3AVGA 4OKEA 4P2HA 4ECZA 3HVRA 5DGAA 5KT3A 5KFEA 2D0BA 7ICSA 4O3RA 4G1QA 1RXVA 1ZQLA 3VQ5A 9ICNA 5J2GA 4AHSA 3UPQA 2PY5A 1J5OA 3OS0A 2J6TA 5DB8A 4NXZA 4Z4HA 2I1QA 3GIKA 3TABA 5DBCA 2J6UA 2F96A 4QZ8A 4BDPA 3G6YA 2W8LA 3HP9A 1UA1A 3C6TA 5KFLA 1S76D 3LWLA 1SKWA 2VANA 4B9VA 1CZ9A 5D46A 1VRTA 3K59A 3HM9A 3ALYA 4E7HA 4CJ3A 1NK6A 4NCAA 5J0WA 4Q44A 4MF8A 3IS9A 2ZJ8A 4DQSA 5KFPA 2FPKA 3AA3A 4J9LA 4NM2A 5KFHA 2NRXA 2C2EA 8ICVA 4UB1A 2WTFA 3U3GA 5J2FA 5DK5A 4EP5A 2B5JA 3JPQA 4DTSA 4F91B 2XY6A 1C7YA 4CF9A 4YD1A 3RJGA 3L3VA 1S9GA 1TAQA 4PA1A 2XY7A 3K5MA 4I2EA 3N97B 1JLCA 4F3OA 3HP6A 4EP4A 5C5JA 1MQ3A 3VQ6A 3NGDA 3V7LA 4RQ5A 4BWJA 4YMMA 2LYHA 3T3FA 3AVHA 1BPYA 3JYTA 4TUQA 4M2YA 5SWMA 4FVMA 3C6UA 2KN7A 3H8WA 1RT1A 4RUAA 4ED2A 4DQPA 2E4LA 4C8OA 4UAZA 1ZQIA 2Y1IA 4K8XA 9ICXA 1RT7A 4O5BA 1EP4A 1DTQA 2YKNA 4H4MA 2ZQBA 5KT7A 3GV5B 1SV5A 1XSPA 5SZTA 4NLKA 5KFOA 4UAYA 1JN3A 9ICHA 4FJJA 4J9SA 5J0UA 5J2JA 4F4WA 4CEQA 3PW4A 4LSLA 4FBUA 3G10A 4FJXA 1JXEA 2ASJA 3RJEA 4HYKA 4R66A 3K5OA 4I2QA 5HROA 4Z6EA 4OKKA 3THVA 4IRDA 3VQ7A 4DTRA 4KLHA 3DLGA 3EPGA 3OYAA 1RZTA 1NJZA 2R8JA 3C94A 5CB1A 3O3FA 3NH0A 4Z6DA 4RQ2A 1NK5A 4P4PA 1S1TA 4B9TA 4M47A 4ID5A 3PW2A 4O3SA 1KFDA 5E41A 1RNHA 1TL1A 3AVLA 9ICIA 1RCHA 1QE1A 1COOA 5EU7A 5HRRA 2AGOA 1LWFA 2VA8A 1KRPA 3RMBA 4IDKA 1JIHA 5HLFA 3T5LA 4CJSA 4QZGA 3L2UA 3QETA 1XHXA 3OYIA 2G8FA 1JL1A 3MR6A 5IIJA 4CF1A 1ZQDA 5I42A 4RPXA 3RR8A 2YNIA 5CY4A 3F9KA 4LD0A 4NYNA 4FLTA 3DYAA 3T5HA 2BGWA 3ISCA 2PFOA 1SKRA 2Z1HA 3C5GA 1HJRA 4AHCA 4I29A 3LAKA 3PO4A 1ZQWA 2BQ3A 4DSEA 4QZFA 1BI4A 1DOQA 5IIKA 2O4GA 1N6QA 9ICLA 1KSPA 3DI6A 5DB6A 4F4YA 5CA7A 1RBSA 7ICKA 4RQ7A 3RRGA 4RQ0A 4J2BA 4RW6A 1ZQNA 2Q3SA 1HYVA 4HUGA 3PNCA 9ICBA 8ICNA 3KTQA 3ZDBA 4CJRA 3GV8B 3TAQA 1C1BA 4RW8A 3PW5A 1UA0A 1S10A 4IQUA 1ZBUA 4WE1A 4YR3A 3UQ0A 1MQ2A 4JUZA 4KLSA 2YNGA 5DDMA 4KTWA 3VQQA 1T3NA 4AHVA 5KT4A 2VG5A 9ICWA 5CYMA 3Q8MA 1WSGA 3KK2A 5J0RA 1ASUA 4RPYA 3K4GA 4LY7A 3RB4A 8ICRA 3HW8A 3ZT4A 1QSSA 3MEEA 2UVRA 5FDLA 2RDJA 4Z4EA 7ICPA 1NOZA 4LH5A 4O3QA 4FLXA 4UB4A 5EWEA 1ZQFA 3H8JA 4F3TA 1ZQKA 1ZQEA 4FLUA 4RW4A 1F21A 4C8MA 1WCNA 3M8SA 3BGRA 1A77A 3VA0A 3GILA 2AGQA 4K4HA 1TKZA 3AA4A 2ZJAA 3ZDEA 1IH7A 4RQ6A 4RUCA 4O5CA 4I27A 4KB0A 3ZT2A 2OZSA 3SI6A 3NCIA 1JLBA 5CWRA 3BQ2A 5KT6A 3SI8A 3OGUA 5DQGA 4IR9A 2BCVA 3MXJA 3TWHA 1C1CA 1A76A 1TV6A 3KHRA 4EZ6A 2PXIA 3NHGA 5KFSA 3QIPA 2VWJA 2BCSA 4Z6CA 3HVTA 4CEOA 4F4KA 3U6FA 1ZQUA 8ICXA 2JEFA 1QQCA 1XU4A 4ECXA 4LVSA 1ZQTA 4W5RA 3KHGA 3NGYA 1BIZA 4YXMA 4JV1A 5JUMA 4Q8FA 2HW3A 3QEPA 3ZT3A 3AVNA 3OS2A 4CJLA 5J2CA 1BPEA 1RT4A 2IS3A 1D8LA 3RMCA 1L3UA 3VQPA 1ZBIA 5C25A 4UAWA 4Q5VA 4CJPA 1NJWA 4J2AA 4OLAA 4RNMA 1RDDA 5IIIA 3B6PA 5HRSA 2G8HA 3TAPA 4O5KA 3TAMA 2DTUA 2V9WA 4O55A 1UT5A 2YHBA 3UXPA 1RDBA 1WSIA 5CYQA 3G6XA 1HNIA 1TKDA 4PUOA 2WOMA 4JV0A 3VQ8A 1Z3EB 3H40A 2UVUA 3LZJA 4N76A 2W8KA 3QEAZ 4I9LA 4ECVA 1Z00B 2XRIA 4TURA 1ZQOA 5KRTA 8ICCA 3MABA 3DLKA 3K75D 3PW0A 1TKTA 3DM2A 3HJFA 4DSKA 1C0MA 1RBUA 4ZH4A 3RJJA 1S0NA 4IFVA 4GMJB 4DFKA 2IAJA 5J0PA 3ZT1A 1J54A 3LANA 4B8CA 3C23A 4KLIA 3BQTA 4UB5A 3RBDA 5DBBA 2X74A 1HUOA 4PY5A 3KHHA 3PMLA 4F2SA 2G8VA 1VK0A 3SPYA 2JLEA 4K8ZA 5KG6A 4Y1CA 1HMVA 2DPJA 4GXJA 3TAEA 3C5FA 3B6OA 4I2FA 4B9MA 8ICYA 2OPSA 1C0TA 4M9GA 4DFJA 4CGFA 1CLQA 3C95A 3NH1A 1HYZA 5C24A 1TAUA 4E7IA 1LWCA 5L1IA 3CQ8A 5J2DA 3KLGA 4TQRA 9ICGA 3CM6A 4J9NA 3AO4A 1XSNA 1ZQAA 4Z4IA 4KI4A 5J0OA 1X2IA 5T7BA 4BGDA 3ZSOA 1TKXA 3DOLA 5HP4A 1N48A 4PHPA 1S1XA 3IRXA 2JGUA 1U4BA 4DTUA 5DLGA 4RQ1A 3HPOA 5KI6A 1HJPA 3LAMA 1NJXA 3T5JA 1RT3A 4ED6A 4DO9A 4F92B 3BQ1A 4DSJA 3MR2A 1U04A 2ASLA 4N56A 2C2DA 1SUQA 4NCBA 1CEZA 3DLEA 2XGQA 1VSMA 4F5OA 4IG3A 3TAFA 3BDPA 3KLEA 3DLBA 3PR5B 2G8UA 4IRKA 1HNVA 3Q8LA 3V6HA 2V4QA 3ISDA 4DWIA 9ICQA 5FRMA 2QXFA 5CHGA 3H4DA 2ZTEA 4KLLA 4HUFA 4ZTJA 2A1RA 1BIUA 3SUPA 2A1JA 1Q8IA 3SJJA 1RYSA 2IGIA 3CYMA 4BE0A 3ZD8A 2R7YA 3QLHA 4MFAA 3GV7B 1ZQXA 2XO7A 4KLQA 4BWMA 3ZDCA 1G15A 1T7PA 3G6VA 2JEIA 3GQCA 1U48A 4R65A 4KHSA 1HPZA 4FCYA 3FYHA 4IQVA 2HMIA 3SUQA 4FK2A 1VSEA 3OS1A 3JPOA 1KVCA 1D9DA 4CFAA 3LP2A 5F9LA 3D0PA 4M3WA 3MAQA 4F5NA 4IR1A 3ZCMA 4RNOA 4LZDA 5DB7A 3AVAA 4ICLA 1U49A 1UOCA 2VG6A 3OHBA 3HPGA 4BXOA 4CJTA 3KK3A 5D4BA 5BOLA 9ICEA 5KFWA 1S1UA 5J2MA 4KN7A 2F1HA 3M9MB 3V4IA 1K1SA 3UIQA 4UBBA 4O0IA 1KVAA 3M8PA 4ED1A 4KITB 1C6VA 2R8GA 3EPIA 4J9QA 5J0SA 5DLFA 3OYBA 2D5RA 2DFFA 4DG1A 5L1KA 4CEBA 4KLFA 3KLFA 4KO0A 4HUEA 4EBEA 1A5XA 1NOMA 4NM1A 1JLQA 7ICHA 4CK3A 5J0QA 3ZSVA 2IC3A 4E1NA 2NRTA 3RH5A 3ZSYA 4RPZA 5DMRA 9ICAA 3TI0A 4YFUA 3RRHA 4CHQA 4M6WA 4GW6A 4QOZB 5L1JA 1U47A 4PHEA 8ICBA 4QZIA 1QHTA 1WSHA 1MU2A 1U9LA 4DFPA 1KCFA 4CEZA 4CJFA 4FM1A 4IRCA 3V9XA 2Z1JA 5BPCA 2DFEA 2KFZA 4RZRA 3RJFA 2ZD1A 3HO1A 2FMPA 3LK9A 4CF0A 4DSFA 3ISBA 5J2NA 4ECYA 1XS9D 5J2HA 3V7JA 5EWGA 2C22A 3GIMA 4QZ9A 1JXLA 2VA3A 3OYFA 1RDCA 2MUTA 3AA2A 1S9EA 5KFKA 4ED3A 2JEGA 3L2RA 2HHXA 3QNNA 2KTQA 4TUSA 2FLLA 8ICOA 1B92A 1RBVA 4KHUA 4FLVA 3V9SA 4IQWA 2BCUA 4O5EA 7ICOA 5KFAA 1DGSA 2HHQA 9ICCA 4PWDA 3SPZA 3L3UA 3H7IA 1XSLA 5DB9A 4ECTA 2OPQA 3CFOA 1KLNA 5KFQA 4H8KA 4HCCA 1RT2A 4FJNA 1LAVA 5DQHA 4QWEA 1D9FA 4I2AA 4M3RA 2QKBA 4R64A 1LW2A 3L2QA 4FYDA 4TSXA 3NF7A 2IBKA 4R63A 4DTOA 1QSLA 4M9LA 4XA5A 2OPRA 2B4JA 4DTNA 9ICSA 4QZBA 8ICSA 4CFDA 2AJQA 1RTJA 4BXOB 5KG0A 4M9NA 2BCQA 3JPNA 2PFPA 3OYLA 2HHTA 4UBCA 3QEVA 4CJQA 1B22A 7ICNA 3OJUA 4X5VA 3OYGA 4JLHA 2JEJA 2BPGA 4IG0A 3P1GA 4CEAA 2BQRA 4BDZA 4CJ5A 1Y97A 2IHNA 4CK2A 2M9NA 8ICIA 4ED8A 1GOAA 1BQNA 4JRPA 4EEYA 4M3YA 1NKBA 8ICUA 1R0AA 4Q0BA 7ICRA 5J2BA 2LSNA 1IKYA 5IILA 3ZSWA 1ZBLA 4CHZA 4E7LA 2BGGA 1CZBA 4ECUA 5J2EA 3AU2A 1REVA 4R5PA 1RTIA 4FJ8A 3OYEA 1T4GA 1BVSA 3LDSA 5DQIA 4AHUA 1ZQPA 4N5SA 1RYRA 3K5LA 4KLOA 4E89A 5J2AA 3C21A 2IMWP 4CFCA 4YR2A 3RJKA 4RQ4A 8ICKA 9ICVA 4BE2A 4PGXA 5CJ7A 9ICTA 4CGHA 3TFRA 5KGWA 3BJYA 2MAXA 1HYSA 5J0XA 2AU0A 4FJKA 3EWAA 3QINA 2YV0X 4KREA 3VQ9A 4CGIA 3ZSQA 9ICPA 5J0YA 3L8BA 4HVJA 2MUTB 4MEXA 1LAWA 4ED7A 2PZSA 3KD5E 3VQCA 4F5PA 5K14A 2BDPA 5KT2A 2ZUCA 1CUKA 4PGYA 3RMDA 1WN7A 4I2IA 4KKOA 2BPFA 4CE9A 4OKJA 4IKFA 2YKMA 1HQEA 1C0UA 5KG3A 2W9BA 3AVKA 3ZSRA 4KLJA 5DDYA 3DLHA 2GV9A 1B9FA 3CFPA 3K5NA 5D49A 4KPYA 2FBTA 4QW9A 3P83D 1ZQJA 1Q9XA 1T8EA 4F50A 4OPJA 2X6NA 5KFYA 4CGDA 3M8RA 1TGOA 3VQEA 3WNGA 4W5QA 4FM2A 2G8KA 2XC9A 3MDCA 2RKIA 3AVMA 2KW4A 4HTUA 4MEYA 1ZBHA 5L9XA 1X9WA 1WSEA 2QKKA 3PV8A 3IM1A 1WLJA 4KLTA 4M04A 3OVNA 3TANA 3WNFA 4RW9A 1ZQSA 4HCBA 1BI4B 4EZ9A 3AO5A 4DOCA 1TK0A 4KLEA 4F8RA 4DF4A 4FS2A 3JPSA 1L3SA 4E19A 1TVAA 4M3ZA 8ICJA 3OYJA 1S6PA 1RILA 3MBYA 1TK5A 3D45A 3HXMA 1VSFA 1SZPA 2RDIA 1ZQVA 2W9AA 3OSPA 1KVBA 4O44A 4DTMA 1LB2B 1RTDA 1NK9A 2HB5A 1GOBA 3MXIA 2F8SA 1S1WA 5IIOA 3HYFA 3OYHA 4GLXA 2KFNA 3PO5A 4KLDA 2BANA 3O3GA 2D0AA 5IIMA 2QK9A 3MR5A 5CR0A 1XO1A 4EBDA 4XIUA 5KFFA 2AQ4A 1BQMA 5HHHA 3NTUA 2XCAA 3WNEA 3C2KA 5C42A 4M3TA 1RDAA 4KHQA 1ZBFA 4YNQA 4KRFA 4CHYA 2ASDA 2FBYA 3TR8A 4NYFA 3OYKA 4KI6A 1B43A 3CM5A 4M45A 4Q45A 2W9MA 1Z26A 4ED0A 5KG5A 2XGPA 1WSFA 5HMMA 4YXJA 3AVBA 2Y1JA 3ZDAA 3SUNA 3KD1E 5J29A 5KGXA 4J2DA 3M8QA 3OYDA 2AQ0A 4GC6A 4YMOA 4HHTA 8ICEA 2UVWA 3ASMA 1K6YA 2JZBA 4PGQA 4ECWA 5KFMA 4ID1A 2HNZA 5TZVA 2FLNA 2YHAA 7ICGA 3RJIA 4F5QA 4DOAA 3JPTA 3HPHA 4JS5A 2YNFA 4JV2A 2XY5A 1SL1A 1XI1A 3JPPA 1KTQA 4DEZA 4YQWA 4DQRA 8ICAA 4KV8A 2OPPA 5KG1A 3DRRA 4OPKA 3RJHA 1C1AA 3OY9A 3I8DA 2HHUA 4CESA 4O3NA 1WNSA 3RB3A 2HHSA 2I5JA 4B9SA 1Z25A 1TL3A 3B0YA 5I3UA 4KB1A 8ICMA 4Z0UA 4MFBA 5DGBA 3B0XA 4CIGA 2UVVA 2FPMA 1X9MA 2ISPA 3AO2A 3ORYA 4E7KA 3G0ZA 4K4GA 4PH5A 4AHRA 3VQ4A 3QESA 1I39A 4PPXA 1JLGA 1NKEA 1UWBA 1SL2A 3MDAA 4KLUA 3NF9A 4CJVA 2FLPA 4I2JA 4XQ8A 8ICZA 1JKHA 1WSJA 5KFCA 9ICMA 4W5NA 1HRHA 5KFGA 4Q43A 4CECA 2XHBA 2ZUBA 1S0OA 3QEXA 4PHAA 1SKSA 2BCRA 3RH6A 4R8UA 4DTPA 4DL4A 2ZTDA 3MGHA 2ETJA 3MEDA 4KN4A 3HK2A 1ZQRA 3ZT0A 7ICQA 4JWMA 1XWLA 1VSHA 4YFKA 4YCXA 1NK0A 3RAQA 5DG8A 5CP2A 4CJUA 4M9JA 4O3OA 3SQ0A 2BKEA 2ISOA 1A5WA 3LPTA 3M9OB 5DG7A 4QZCA 5KFNA 4E1MA 1Y88A 3TFSA 1WAJA 4DS5A 3RB0A 2P51A 3K2PA 4KTQA 3LP0A 4DFMA 2XCPA 4MF2A 1H38A 5DG9A 4NLGA 2R8HA 3SQ4A 2X78A 3F73A 3NBPA 3NGIA 4M0AA 4OJRA 8ICQA 4B3OA 3RMAA 1NKCA 4Z4CA 3PY8A 4N47A 3VA3A 4UB2A 4NLZA 4ELUA 4KFBA 3TAGA 1L3VA 2IA6A 3PW7A 4DL2A 1QSYA 3Q8PB 3SV3A 7ICVA 7ICUA 4MFFA 4Q8EA 1BPZA 5CZ1A 2ATLA 1EX4A 4J2EA 5L1LA 4KAZA 1IM4A 3EYZA 4CEEA 3UXOA 4RQ8A 5KFUA 1S9FA 1S97A 2PYLA 1ASWA 1RT6A 3NGZA 4DL5A 1CXUA 2ZJ5A 4QCLA 2KZ3A 5FRNA 3PX0A 1YVUA 1VSDA 2PI5A 4IQTA 1ZQQA 5KFJA 3KHLA 2X6SA 1TK8A 4BDYA 4OLBA 1N5YA 3UXNA 4YP3A 4OGCA 8ICLA 3H8SA 1BISA 1VSJA 2HVHA 2ZE2A 1QLNA 4G3IA 4M9HA 1KFSA 4CEDA 2W42A 4CGJA 4QZDA 3ZSXA 4J9PA 1RTHA 3OYNA 1FKPA 5F9NA 3ZSZA 4NCGA 3U3YA 4MQ3A 4KHWA 1X1PA 2OZMA 1SL0A 3PX4A 1L5UA 3JPRA 4FJGA 5KFDA 3MEGA 1XC9A 5KFTA 3KJVA 4JRQA 1RXWA 2F8TA 2HNYA 2F1IA 3S3MA 3S3OA 4CHNA 3PMNA 2C2RA 4QWDA 3V9WA 3VN5A 4CCHA 4RU9A 1JLAA 4CGGA 4EYHB 4J9RA 4R8UB 3AO3A 3ETLA 3TARA 4CIEA 4O3PA 5KTQA 4O9MA 1PZNA 3MECA 1JLFA 4ECSA 3ULDA 1BPBA 5KFIA 5BOMA 5J2QA 1ITGA 3QEBZ 4ZHRA 4CF8A 4DQQA 5KFZA 1S0MA 4H4OA 3E2EA 4M41A 1NOYA 3I0SA 3KKSA 1KEJA 1U45A 4NY8A 3LZIA 2D0CA 4KMUA 1T03A 4CK1A 1BCMA 1RT5A 4L8RB 3K57A 1J53A 4FZZA 1K1QA 3S3NA 1Q9YA 1YT3A 3TQ1A 4W5TA 3QNOA 2KZZA 2A1JB 4QZEA 4CHOA 1FKOA 3C2MA 1BGXT 4YN4A 5J0TA 4QZAA 8ICTA 3V81A 4ELTA 8ICFA 1J9AA 4FO6A 2PI4A
chains in the Genus database with same CATH superfamily
2ZUDA 3N6LA 3A4TA 1KFTA 1CXQA 5CHIA 3HRGA 3PJWA 3R5GA 1GLBG 2E7XA 2ACYA 3DRSA 1WHYA 5GMDA 4OZJA 2HMIB 3R9LA 3Q8UA 3IAYA 4IFYA 4C8YA 4GC7A 2DGZA 3LP2B 2P9IB 3UKUA 4CGZA 3SQ2A 4TQSA 2E6MA 5GADU 2UU9J 4LRDA 2VWKA 1IUJA 3D6RA 4FKXA 5ALPA 4FWQA 2EFQA 3GMGA 2HQGA 1U1OA 4DPTA 2P9NB 2EFNA 4G6VB 2IIRA 2K8GA 3THXA 2F9JA 4MN4C 4DL7A 3J81U 3E01A 2WK4A 1TVRA 2YTCA 2QMXA 2YQ3A 1UTAA 1UCVA 4JKCA 1NK4A 5KFRA 2W41A 2ZH7A 2V8HA 3U8XA 2HFZA 5CAAA 1N5WA 3MR3A 1QQ6A 3MCPA 4IBNA 9ICUA 9ICOA 2W2PP 3O80A 4PG6A 3KLFB 2GWSA 1K8AT 3MEGB 3RBXA 1FTCA 4J90A 4JV5J 1EXNA 3U9ZA 3ZD9A 2XZTB 4F9OA 3J7AP 5ETPA 4OYIA 4NLXA 3CC4S 3A0HU 1HBNA 4BR4A 1Z19A 2LYVA 4NLCA 1Y10A 2XG8A 4F4ZA 4GVBB 5EX5A 3UD4P 2H5JB 4GXIA 4ZVUB 1TUUA 5AQJA 2HI0A 4K2JA 2QZ8A 1JL2A 3IFRA 3LDLA 3IP0A 1RFQA 4CFBA 2R4FA 2CWKA 2P1JA 1N5VA 3I0SB 2KICA 4A8EA 1GX6A 1N54B 1I94F 3ZZ0A 4PXEA 2MY7A 5DZ7A 3C28A 1DGKN 3H98A 5GTHU 5I3QA 3CMAN 3U27A 1LFWA 1CI4A 7ICLA 4UY8T 1ZQZA 4K4IA 1Y3JA 3P4IA 4MJKA 3LALA 4WKRA 1FKOB 3MTJA 4MO5A 4KX3A 2XSFA 3PACA 3SAHA 2H3FA 2GEMA 2HHWA 4X65K 3M2UA 3FFIA 3TVYA 3CJ1A 5CCLA 3JQJA 5HNKA 3T6JA 2ATQA 2VBYA 3K58A 1UVJA 3MI7X 4UQGA 2CGJA 1FRLA 2D6FC 1RBTA 2EHGA 2DR6A 5KOXA 3NH2A 3NRBA 3QO9A 1VQNS 3G4SN 4I2GA 4WFYA 3BQ0A 1UAWA 4DX6A 3NAEA 4F93B 2FMQA 3H8YA 3ITHA 2ZDOA 4RW7B 2OPRB 3QGGA 3W7BA 3T19A 3SCKE 4C6AA 5AI0A 2MPUA 3CVKA 3F2CA 5J2PB 5HBMA 2H65B 3AO1A 4FWNA 3THYB 4OI0A 3JXOA 1PK1A 4M3UA 1HLWA 1HNWF 2PFFB 1IBKF 2JGAA 4IG0B 1VRUA 3R5BA 4C2MA 3OQ2A 1BPXA 3IG1A 2LM1A 4C4RA 1CLFA 2XMUA 5AQWA 1HI8A 2VV5A 3T9ZA 4M3XA 3TSQA 3FZ2A 5AQTA 3OL7A 1EWRA 1Q5VA 3AVFA 3MOJB 4Q0BB 2BYCA 1IKYB 4OV1A 5B0BA 2BQUA 4OLOA 4PYDA 1S1VA 4C8KA 4DU8A 2XY8A 4BRCA 4NLQA 5FPDA 3NGRA 3H6EA 3KK1A 2VPXB 4YVZA 4DDFA 1URRA 2NRZA 4KHPF 3QEWA 5DO2A 5IV4A 1R3NA 4I7FB 3RH4A 1ATSA 4FZNA 1FKAF 4FJIA 1QJHA 4BE1A 2HQ3A 2QLWA 4BG8A 2M4MA 2W7AA 5J1EB 3AD9C 1O08A 1JMSA 4KAIA 2D3DA 2B6AA 1FNMA 4CBXA 3CJTA 3CNHA 2KKPA 2J7WA 1RBRA 3T7ZA 2QA2A 3V6KA 4JK1A 4UATA 3OXFA 3CPWR 3O9TA 2F4FA 3AXMA 4OHYA 3WIVA 1W0HA 4ZPVR 1R8HA 3SNNA 4NA2A 2ASYA 2C3PA 1DK2A 3MXHP 1FK9A 3V9UA 4NE9C 2W9CB 3S9HA 3OHAA 1JJ2M 2AZ3A 3AUOA 2GJFA 4F67A 3O4WA 3RRKA 2BR0A 4DS4A 3O4NA 4BRDA 3RWUA 1HWLA 2W6KA 4MIBA 5GADI 3J7ZT 4Z37A 1U8SA 3LVWA 4OJOA 4OZNA 3Q8RB 4CJ4A 2UP1A 4JI8J 5A2QU 3NVKA 2ZM6F 2ZXIA 3R1LA 5J2IA 4WJ3B 3KLHA 3WHIA 1HNZJ 3OSNA 4LRFA 3CHWA 1J6ZA 3AB2B 1L6NA 3T5KA 1O1WA 5AK3A 3NF8A 3LTOA 4IOBA 4B9UA 1NZPA 1CC7A 3WNHA 2VASA 2DPIA 4JWNA 4ZJLA 4YB7A 3K1RB 3OR2B 4CF5A 4DJBA 5AK6A 1HQUB 3M30A 4EAHD 4ELVA 1SJRA 3ZETB 4WKYA 4I2DA 5AFUH 2W55A 2VKQA 2PFQA 1SC1B 3PYDA 2ZJQL 3DGPA 4I9QA 3N01A 4Q7AA 1J2VA 1B3TA 2JMGA 5DS7A 3CCLS 2P5GA 3MMBA 2W11A 3M9NB 3R8EA 1GOCA 1UPHA 3ZTPA 3DOKA 2R42A 3F9MA 1FFGB 2KU7A 2HNDA 5C10A 3NFAA 3FDSA 3ID8A 3A2FA 4ZCKA 1ZQHA 2IM1A 2DRDA 1TMJA 3ULEA 3H3NO 2LI6A 1Q81T 4K4ZA 3EDQB 1XQSC 4B02A 4HKQA 5THWA 2IMOA 4FXDA 2E6LA 2J7KA 2WBRA 3AU6A 4WYWA 3UMGA 5AK5A 4NXMF 4B3MJ 5CZVA 4AYBC 3MFIA 2NRWA 1JXBA 2FBXA 2HKEA 2UV8G 2HRUA 2OYQA 3THPA 5MLCV 3V1RA 1ATNA 1V3RA 2AJ4A 1KTVA 1T3VA 3M1FA 1R6YA 3SCIE 1QTNB 4DLEA 4PG7A 2FSJA 4PHDA 2E1FA 4DR1F 2R7SA 3FGVA 3KKAA 1IWAA 2ZNZA 3EUB2 3AVCA 3GG4A 4Y2UA 5HMLA 4MIAA 2DXEA 1VCTA 1MA9B 3AQFA 3L4IA 2HNZB 5BR8F 4YY3F 2Y0SC 4FLYA 3MXMA 4RNFA 1NJYA 2FHOB 2PD1A 3HWTA 1XHZA 2GQ2A 3D1HA 3HSZA 4NPOA 4DV7F 4KGMA 4ECZA 2MY8A 1YRXA 3N4QA 3KWIA 2XMJA 1ZPWX 5KFEA 5ADZA 2SXLA 2D0BA 3QWPA 2BE2B 1HI1A 4DV3F 2DGVA 1RXVA 5E0OA 4PG5A 3UPQA 2PY5A 2OPPB 5GAHP 2CZVC 2B0GA 5DB8A 1XC3A 4Z4HA 3MM7A 4P73A 3J7AN 5DBCA 3UKRB 3QYPA 4Y2JA 3SBTA 3HP9A 2W8LA 4E8UA 5FLXO 1UA1A 1GK8A 3T1YF 3C6TA 5KFLA 3Q89A 3V6DB 2W43A 2MQPA 2D9PA 1V38A 1LVHA 5D46A 3QGPA 3M32A 2G06A 3H42A 3ZX0A 4PWWA 1BWFO 5ALSA 4LT6A 1NXIA 1KBUA 3C8YA 2KG1A 4MF8A 3THWA 3IS9A 5M1FA 1Q8BA 1H6KX 3D2QA 4LSNB 4X62K 8ATCB 4DOZA 1JKHB 3AA3A 2CQDA 3L4PA 2DNHA 3CCVS 5KFHA 2CA9A 2ROEA 2UUBK 1F5CA 2C2EA 8ICVA 3N9UC 3HKZF 1PAEX 5GAEU 2MKCA 1KKHA 3ETRA 3X3UA 3DRPB 4CF9A 3RJGA 1XTZA 4OYWA 1NNDA 2RIJA 1A7GE 4A4JA 4F3OA 2BUPA 3O9RA 2C2KB 1JWWA 3NGDA 1ROFA 2OFGX 4YMMA 2KSOA 4CDIA 1JCEA 3JYTA 4TUQA 4FVMA 3C6UA 3Q7CA 1Q78A 3HZGA 4FVUA 4WYLA 2YPYA 1RT1A 2NREA 4ED2A 1RAFB 2IOFA 5F8GA 4C8OA 1FWKA 1URJA 4UAZA 1FRJA 3S6JA 4C11B 5F0XA 2E9TA 4OJ6A 4PKHA 1RT7A 2YKNA 1CJUA 1SV5A 4U67L 3TEGA 1FJCA 5KFOA 4FJJA 9ICHA 5J0UA 1KLMB 4LSLA 1VQ4N 1JXEA 1VQSA 4FWKA 2HLUA 3JTNA 4I2QA 5HROA 4OKKA 4FZLA 1JNZB 3THVA 4IRDA 1RSCA 4USHA 4URQU 1IQTA 1SH0A 3QT8A 1SIWB 1YDLA 2R8JA 1PJ7A 4QIVA 3O3FA 3T41A 3NH0A 2C2MB 4Z6DA 2D0PA 2CQIA 2WB1C 1X42A 4D3HA 1KFDA 2CPDA 2FQQB 4CM0A 1XUPO 2VQEF 1COOA 3NS1A 1GEHA 3LL3A 3RMBA 4RBTA 3UE5A 3SR6A 5E5NA 2EFOA 4JI3J 4NZ7A 5C2CA 2CPZA 2DPNA 1ZQDA 2I5HA 1OQ6A 1R8BA 4LD0A 1ZH5A 3DYAA 5AQKA 3ISCA 2KV2A 1OJ4A 2B4VA 2Z1HA 2UXDF 4BUGA 2HNYB 4AHCA 3M2RB 3EGWB 2BQ3A 4OYMA 5AXLA 2YKPA 2PC6A 5LM7E 5AQHA 4RLEA 5K9FA 5EDWA 3AGRA 1JLAB 2UXBJ 2OUGA 4QIGA 1HFEL 1FFVA 1KSPA 2ZJQQ 2HBLA 3EICA 2B5JB 3J7YU 1VRQC 4PZNA 2R7UA 2B9YA 1VHXA 5ALIA 1ZQNA 4KHMA 4CLFA 1HW8A 4JB3A 3KTQA 2YWKA 4B3RF 2B4PA 1EQ0A 3WKAA 4Z7CA 4FSVA 3ENHA 1RT5B 1IBMK 4DCCA 3C7NA 1MQ2A 4KLSA 4OX9F 3HHEA 1O0PA 1SXDA 3RBZA 3H2VE 1NO8A 4DB3A 3BKTA 3H0LB 1OWXA 4JD2B 3EE3A 2M9KA 5KT4A 2G5IB 3KJFB 1YIJS 4Y65A 1EP4B 1MW7A 4QNLA 2HZVA 2YX4A 3VR1A 2RB7A 5F8LA 4LFAF 4IO9L 3KK2A 1EB0A 4A47A 1YJNN 1SC6A 1Q82O 3VEZA 1I6JA 1YRTA 2IFXA 4JI5K 1K9MO 4NRTA 2V94A 4BC2A 2UVRA 1Y9OA 2ZIUA 4LH5A 4FLXA 3LPYA 1ZQFA 2DCLA 5H2FU 4UUWA 4FLUA 1WUDA 4RW4A 4C8MA 2WFAA 4CNYA 1Q8LA 2F7TA 1A77A 3GILA 4K4HA 4YB6A 3B4MA 2B3TB 2A6MA 4PEOA 4KPCA 3DGVA 4JYAJ 2FHKA 3KNAA 1LW0B 1E6YA 1JCGA 4O5CA 1PKUA 5HLFB 3R8YA 2NPIA 3HHLA 3SI6A 2MZTA 3NCIA 1JLBA 5CWRA 1VQ9N 5AKJA 2BCVA 2YBVA 3QJPA 1VQKS 4MHVA 2E29A 2J8SA 2FPHX 1TV6A 3KHRA 2PXIA 3QIPA 5GAEI 4EENA 2B8PA 2GWKA 4Z6CA 2QRRA 3HVTA 3DRXA 1JJ2R 2AYBA 3IBWA 3QMLA 3PDNA 4ECXA 4LFCJ 5A8KA 3FK4A 2XM3A 4YXMA 2QWQA 2NQPA 4NI2B 3TZXA 1F3VA 3D2EA 3QEPA 3ZT3A 3AVNA 4CJLA 5HR6A 2YQ1A 5J2CA 1RT4A 2IS3A 2EANA 3Q7BA 1L3UA 1IKVB 2XLKA 1VGYA 5LY3A 2MDAA 1LWEB 4CJPA 2ZZMA 3MMVA 1NGHA 3F2BA 4RNMA 5EE3A 1RDDA 4EHUA 3POTA 5L38A 5HRSA 1TMMA 3TAMA 4X64F 4A8YA 1C1BB 2MHNA 4RW8B 3IGVA 2NSCA 2ODGA 1QQOA 3UXPA 4TU9A 1RDBA 2R18A 3M7VA 3D6FB 3KLIB 1MROA 3MM6B 4CZMA 4PUOA 3CMES 2O8EA 4FWMA 4JV0A 2LEAA 1Z3EB 3LZJA 1VQ7S 2CPJA 3MUTP 4X4RA 1K47A 4DUYF 1NJIO 2EZYA 2K4PA 4HLBA 1ZQOA 3PKMA 3DLKA 5J1PA 5M2UA 2R3VA 1FJGF 3CDEA 4U67Q 1BA0A 3G2XA 4DSKA 4UY85 1CULB 1RWNB 3FM9A 2OKQA 3BS5B 1YJ7A 2W1BA 2EPIA 5K8PA 5AM2A 4FOIA 3C23A 2E9ZA 4AL7A 1RAIB 3RBDA 4JI4J 3PIPL 3W60A 4PY5A 1JCFA 1JALA 2NV3A 2C3YA 2FHMA 3ETOA 4JKEA 4MH8A 3VETA 3PFEA 1HMVA 4DV6F 4O5FA 2PSZA 3WC0A 4NB4A 4M9GA 4DFJA 4LFBJ 1I94J 4ISEA 1HYZA 5C24A 5A8RA 4HAIA 1LWCA 3VGLA 1QQ5A 4K7QA 9ICGA 1N8RO 3CM6A 1HBOB 2GAHC 1YVFA 4Z4IA 4KI4A 2LXFA 2KMDA 1S59A 2MZJA 2DXDA 1BC6A 3J7YI 3NOCA 3O0FA 1XNQF 4KC5A 3WQTA 1CRXA 3R5DA 3C19A 3NVMA 3KD3A 2JGUA 1R8CA 1X4BA 5KI6A 3LAMA 3KWMA 3T5JA 4JKAA 2B8QA 5LL6Z 4F92B 1AZSA 3MR2A 4JI1F 1VJ5A 1RCOB 5KL1B 2EAMA 1V5IB 2ASLA 2ZIXB 2UUAF 5AQNA 4NCBA 4AUKA 2JC0A 5H9FJ 1CEZA 3DLEA 3GR1A 5LSLA 1N33K 4J9UE 4K41A 3QIDA 1RWOB 2OSQA 3VMFB 3G96A 1N34K 1ZA2B 3TAFA 3BDPA 2IJFA 5AI9A 3HFZB 2V4QA 5FRMA 4PQUB 3ZI4A 2DNGA 1GLAG 4Q2LA 1M5VC 5CHGA 3H4DA 1HNWJ 3MDFA 2L9NA 1BU6O 4C1NI 3AAPA 2VGMA 3HILA 5DRKA 3GFZA 5C2DA 3GV7B 3DRYA 5F0WA 3VZHA 3IGNA 3BF4A 1G15A 4FWSA 2JEIA 2OANA 4IO9Q 3GQCA 1U48A 1K8KA 1KD1T 3O8MA 4FCYA 4IQVA 3PJXA 3C6AA 1J27A 3Q83A 2UUCJ 3OS1A 4XH4A 3O5BA 4TKTA 4GY2B 4CFAA 1VC0A 1U1KA 4K4YA 2KLAA 2B4OA 3D0PA 1PO6A 2FJAB 5IQ6A 5AIBA 2AZ1A 1CSJA 3D0GE 1RWVB 2I7PA 4F5NA 3BSNA 2HSZA 1CC8A 1N5XA 1F3FA 2AYMA 4ICLA 2PT0A 4X4QA 1U1LA 3HPGA 1K73O 2MEWA 5D4BA 9ICEA 4CLSA 2F1HA 3M9MB 4O0IA 5FPMA 3RGIA 2YWWA 1KVAA 4I1TA 4UQTA 1R27B 1C6VA 2R8GA 3R7BB 4LF5K 3TW0A 4YUDA 3KG1A 4HH0A 2DFFA 4DG1A 1NGEA 4EBEA 5IC4B 4CE6A 3I4PA 1JLQA 2CVEA 4JI7K 4G1IA 4RNHA 1MN9A 9ICAA 2BM0A 3BN7A 1SQEA 4M6WA 4QOZB 3NP5A 2APOA 4IC9A 2CPEA 1MU2A 1U9LA 3NS5A 2OLWA 4CJFA 2QO3A 4NYPA 4FM1A 4IRCA 5KQDA 2ZM6J 3QT5A 3W8PA 2DFEA 2QWRA 3Q2SC 2FI1A 4P52A 4MKBA 2FY1A 4IG3B 3T6BA 2OHDA 4DV1K 1UZDA 4HDHA 3KLEB 1RABB 2BE9B 5J2NA 4X65F 2C22A 3GIMA 1A9NB 1VDVA 3AL0B 1PBAA 1CQNA 2RS2A 3ZEUB 2P5VA 3BH7B 3B6BA 2MUTA 1S9EA 1SJ1A 3A3OB 2B43A 4A48A 2JEGA 1QM9A 4NLRA 2CADA 5AQOA 2FLLA 1P8ZA 3ATUA 3J81Y 3BO4A 2J9DE 3L7UA 2BCUA 2HHQA 2NRHA 3H7IA 4M63C 4ECTA 2OPQA 4TY8A 1KLNA 4DQ8A 5GVQA 1AFJA 1KQQA 5JLFA 1U7LA 4H8KA 4HCCA 4UW2A 1V6HA 3I5AA 1D9FA 4PXCA 1QQ7A 4CZIA 4C4WA 4LF9K 4P72A 4C3KA 2WVCA 1NZBA 1QSLA 2BM1A 3FJ2A 4DUZK 2CZ4A 2J0XA 4DTNA 2OGUA 4QZBA 3O1BA 1H2VZ 2AJQA 4K2XA 3Q23A 1D3WA 1VQ5N 1RTJA 4B3TK 2ZIWA 2EFGA 2CQCA 3KK3B 4TXSA 3HKZC 1CJVA 2EKYA 3ENOA 3TU5A 3OYLA 1GXLA 4YB5A 3ZTQA 4UBCA 1B22A 3PIPQ 3FZFA 3OYGA 2V5HG 2XNRA 2Q66A 3VCBA 5ALFA 3AT1B 3P1GA 4BDZA 4AE5A 4NXNK 1JXVA 3N4WA 3D3BJ 8ICIA 3D6HB 1YZ6A 4GV3A 3IG5A 2EXUA 2D69A 3ILOA 3QJLA 3A3PB 1YJRA 3HSJA 1R0AA 1KXPA 7ICRA 2GCFA 5IILA 1UPMB 8RUCA 3THTA 3NRZA 1N63A 5ALNA 2BBEA 3JSBA 3WBZA 3SMPA 2F5GA 4AL5A 4I68A 1GLLO 4CZEA 1QVFM 1BVSA 5DQIA 2P9SB 4N5SA 1RYRA 2ZH6A 3D6JA 8ICKA 2QX0A 2NLXA 3GCXP 1JB0C 4PPZA 2A19A 1U2VA 5KGWA 1HBUA 6FD1A 2W04A 3FSYA 3PRDA 4BR7A 2YV0X 1U1NA 3T1YJ 4H4MB 2G08A 1TTHB 4ZPCA 3A5NC 1N0VC 3TUPA 1VC6A 1P6TA 1VQYA 4M5DA 4DL0C 3M6KA 2IRYA 2CDQA 3KD5E 3KOOA 3VQCA 3CC4N 5K14A 3VEWA 5HVHA 1WYGA 2RQMA 4GKKK 3AA9A 2BKPA 1RHRB 1IJEB 4CE9A 4OKJA 2YKMA 1NPRA 2E8AA 1R8AA 3IWLA 1C0UA 5KG3A 3BEXA 2W9BA 4FL9A 3ZSRA 2ZHBA 1NZ8A 5DDYA 3C14B 3DLHA 2KB2A 2QC3A 1V3ZA 3K5NA 1NGBA 3NGUA 1YBUA 2MZRA 4HI1A 4KPYA 2KP7A 3K5PA 2DNKA 1FDDA 1ELOA 1RADB 1X4AA 3EM1A 4OPJA 2X6NA 2O8FA 4CGDA 4C3LA 3FMWA 3NVWA 3VQEA 5F8JA 1SV0C 3EVMA 2V9KA 4W5QA 2XWXA 5I42B 2GW8A 2EI5A 3OTOK 3QFPA 2EG1A 2LQ9A 2ZDPA 5ETSA 2MGZA 2PA8D 1X5PA 4MKVA 1RCXB 2Q1NA 4M5LA 3TANA 3WNFA 3US5A 2PMWA 2PDAA 3MWPA 2PO4A 4ILGB 3MWTA 3CIMA 3A8JA 3DI6B 2K7JA 1U0HB 3MBYA 2DGXA 3G82B 3AHPA 3TYTA 4OJ5A 3OSPA 4HT7A 4O44A 2HRTA 4DV2K 1WC4A 2HFUA 2CNNB 4JKBA 2WBNA 3DAWA 2XMTA 1S1WA 3DLJA 5IIOA 3HYFA 2XEXA 4GLXA 2KFNA 3PO5A 4KLDA 4WE1B 5HMWA 1N88A 1H73A 2FJEB 5IIMA 1WG4A 5AQFA 1IBLK 2DH8A 1XERA 3I6PA 2A1BA 2XCAA 1VQ6S 4KHQA 2E2QA 3H25A 1ZBFA 3OVSA 5A2QY 4KRFA 1CJTA 5CYMB 4RU2A 4P0QA 1B43A 4ZN1A 1RGVA 2W9MA 2JZ5A 5KG5A 1WSFA 5HMMA 4YXJA 2QARB 2HZCA 3IDWA 2WSCC 4J2DA 1WWUA 3M8QA 3OYDA 2AQ0A 4GC6A 4WWSA 2P9GA 2NYVA 1WC6A 3NGTA 2NZTA 1K6YA 2UXDJ 3TZYA 3TR5A 1F44A 2ZH3A 2WSEC 1KHVA 3IAM9 2OH2A 2FLNA 2YHAA 3RJIA 1GFWB 3VTHA 1X60A 4JS5A 2YNFA 4JV2A 2P9KB 2Y1LB 2YMQA 3HCXA 2VPYB 1XI1A 3JPPA 4BRKA 4YQWA 3DDIA 1Q46A 5KG1A 3DRRA 1C1AA 4DR5K 2DHXA 1MMLA 5HJYA 2KVCA 2YQEA 2HHUA 3R5CA 2QN6B 3N7PD 4B3RJ 1F60B 1PYOB 4X62F 2RU9A 4UASA 2CRXA 2UUBF 2CH5A 2OEHA 1EWQA 2RKIB 4Z0UA 2CDRB 4MFBA 2KYZA 4OX9J 2UVVA 2E66A 1X9MA 4E7KA 3G0ZA 4PH5A 1I3OB 1OS5A 4AHRA 3I56S 1RHQB 1RK8A 1FEEA 1I39A 4PPXA 3GOIA 3MCNA 1RISA 1J5EJ 3NF9A 2FLPA 4LFAJ 2VODA 3DDNA 2Z57B 4OZ3A 4BRQA 4W5NA 3RSEB 3DXBA 1P90A 1HWIA 2AYGA 3QEXA 2NXJA 3PRBA 2GAGC 3ENBA 4P9SA 3PYEA 1QAXA 4DV4F 3BREA 1X4GA 1ZZFA 4ZIVA 1VSHA 2AT1B 1FRKA 3W2WB 5HVFA 5CP2A 4ZCIA 1FF2A 1QVGM 1O8BA 2ISOA 4Y2MA 1I1GA 3JQMA 3M9OB 5KFNA 4NLDA 3VAHA 4ILHA 1WAJA 4B3SK 3CJRA 3LP0A 1UKUA 2XCPA 1J2MA 4MF2A 5DG9A 5C42B 4OJ3A 3SQ4A 2GMLA 5TKWA 4B3OA 1GAOA 2IM3A 2MKHA 3E9LA 2EDUA 3PY8A 4B6JA 3VA3A 4ELUA 5C12A 4KFBA 1L3VA 1U25A 3GLJA 1S6OA 4H4KC 3UWTA 4J7CA 2JX2A 4KJIA 3H7HB 5CXTA 5AQRA 4IXCA 1TZ0A 1QSYA 3Q8PB 1OPIA 3DM2B 4NYZA 1N61A 4A5AA 2D3O1 4IJNA 2M7SA 1EX4A 5A6WA 4CZKA 1ZOLA 2YHYA 3VENA 2VJVA 3DHWC 5D0EA 1Y64A 3L6QA 3SMVA 3NGZA 2WVFA 4QCLA 1E6VB 4HHHA 1VSDA 4Y3CA 1FD2A 3SMSA 4IQTA 2X6SA 4UTGA 2CPHA 2QLBB 2NS1B 4YP3A 1EQMA 3KUGA 2QB1A 3DV9A 2XI2A 2I6WA 2ZE2A 3AODA 2H3VA 5ALTA 4X64J 3CCJS 5GAGP 4J9PA 4BRNA 1SH3A 3OYNA 1VK8A 2V51B 4NCGA 3BB5A 3H20A 5A8WB 2QW9A 2ZIVA 2C3OA 1L5UA 4ES1A 3MEGA 2CJXB 2GS8A 3OBYA 3IRWP 4OI4A 3S6EA 2Q1LA 3SBMA 3S3MA 2Z58B 1ZQ1C 4CHNA 1WDDA 5HOOA 3BR8A 2C2RA 1D09B 4DUYJ 1ZPVA 4CCHA 4DR7J 2GUPA 1ZD4A 4WQ4C 2ZBQA 4EYHB 4J9RA 1MN8A 4FN5A 4CLYA 4CIEA 3CCZA 5AQSA 1IBMF 1PZNA 2Z2MA 3ULDA 5BOMA 1ITGA 2MKJA 3QEBZ 4AXIA 4GV9A 4GO5X 2KJ8A 2KH9A 1S0MA 2P9EA 3E2EA 4YDUA 3I0SA 4AXJA 3KKSA 4NY8A 4U9RA 3MM8B 3JTPA 1WACA 2VQFF 1BCMA 4L8RB 1J53A 1K1QA 3S3NA 1YT3A 3TQ1A 3QNOA 1YF5L 3HULA 3TTFA 2A1JB 1FEHA 4JI5F 4CHOA 3CCVN 4FYYB 1FKOA 1XEZA 1BGXT 4LC9B 4YN4A 3PM9A 4YHHJ 2M52A 2Y9UA 3B6OA 2XC9A 2KQ2A 2G1HA 3ZO7A 2A41A 1B4FA 1NM1A 1F5BA 1X6IA 2HFNA 1ZETA 5CYJA 4F5RA 1WAFA 3CE8A 4PWUA 4I2CA 2MB0B 5AQZA 3R7SB 1P7DA 1XNQJ 1AROP 3WKBA 3K2YA 3OYMA 2EX3A 1MWMA 3QZ8A 1S4FA 2O01C 1VC5A 2J6SA 1HWUA 2KIWA 3RUBL 4AQYK 2DFHA 2HHHJ 2DQNB 4J9KA 2D3ZA 2IHMA 3PR4A 4RW7A 3GJQB 1VQMS 2DGTA 1QVFR 1G2EA 2IVFB 1M90T 4CEFA 1G1XA 2YNHA 3CO9A 3KKFA 2BKNA 5J2PA 5D0RA 2LXIA 2VG6B 3THYA 4KHNA 4XUSA 3LM2A 3MC1A 2UUAJ 7ICTA 4HDGA 3V4IB 1KHWA 5K8MA 4N77A 5A6PA 2MU2A 1FESA 3BGOP 3CJKB 1FVQA 3FLCO 1YGYA 5H9EK 1IWGA 3DMJA 1N32J 2JH3A 1QTMA 1PK3A 2MZQA 3MMAB 3WK9A 1EZZB 1KNZA 1Z4UA 3AV9A 2O8BB 4OYBA 3P45B 2IA0A 2GO7A 3IFEA 2G8IA 3FZMA 1Q4RA 1HKAA 4K25A 5EE9A 3AOBA 3M8ZA 1FT8A 4JKDA 4BR9A 4KLMA 4FW2A 4I7FA 1JX4A 1N60A 4Y2CA 5LMNJ 3KMSA 4AHTA 5J1EA 1DHMA 4ZCLA 4Y2VA 3EVWA 3MECB 1XMQK 3W62A 5KFXA 2MZ1A 2LQ8A 1N0UA 1RDWX 3E1YA 5DBAA 1PILA 4PL1A 3OPXA 3AB4B 3HKWA 2ZD1B 2JH1A 3RJMB 1NGFA 1NHVA 2FC9A 5AFUA 2YH0A 1RP5A 3CCRS 2FLOA 4JBCA 8ICHA 4KHRA 2FF3B 4CLKA 3H46O 1X9SA 4E7JA 2JRZA 2W9CA 3ZXWA 4B1VA 4I28A 3HBTA 4I2HA 2ZF5O 2LM4A 2V6AA 4N7TA 2PBDA 3M5RA 4LH4A 2OO4A 4YR0A 5ETTA 2G8WA 4JI0K 3CC7S 4W5OA 4ZVSB 4I6MA 3E58A 2WHEA 2IVNA 2XMAA 1N2XA 4DR6J 3L3FX 1RT2B 2ALZA 4EFHA 3A0BU 3FEZA 4B9LA 4KMOB 4QIWD 3CG7A 4FJ5A 3ZX3A 4DTJA 2DNNA 4GVEA 1SXEA 3EL2A 1ASVA 4ANDA 3GDXA 4QIFA 2OFHX 3SV4A 1KDHA 1UHUA 2NXUA 4FJHA 1RWMB 1WEXA 9ICFA 4FZYA 2GFFA 4ZVTB 1BDGA 4PPDA 4UF4A 4AF1A 5JVHL 5DJBA 3TACB 4CO3A 2IOCA 1H2TZ 3OR2A 3LH2S 4DSLA 4ZVQB 2P9LB 1HQUA 3VZIA 1T9UA 3SLCA 4X65J 4DCHA 2KL8A 1DBDA 1DTTB 2FVPA 3ZETA 2AF6A 4CD1A 4GVMA 4FJMA 3D4JA 2HOEA 3HSTB 3QIOA 3F56A 2IOFK 3TVKA 1GXUA 2KXNB 4FW1A 3L9ZA 3FSXA 3R5AA 4Y1DA 1EKEA 8ICWA 1N33F 3V72A 4KGVB 3UN2A 1URNA 4QW8A 4RKUC 1N34F 3R1XA 2CJQA 5CHCB 1OH5A 3SYZA 4QWAA 3BGLA 5LJVA 4OVLA 1FFUA 3SAFA 5G0RA 3F2DA 1NRKA 5JLHA 3VALA 1D5AA 4JI6J 4ZTFA 1LNQA 2FTRA 2ITMA 3A8KA 4KH0B 4J8FA 2D7SA 1ESVA 4FXVA 1VQKN 2E1CA 4YD2A 4NLYA 1V5VA 3O9SA 4DU3A 3RAXA 3HHDA 2OEKA 4YMEA 3OVBA 4BQLA 3T1HK 5AQGA 8ICGA 3Q8SB 2ASPA 4KTZA 1HUZA 3HI9A 3AD8C 4NRUA 2VZ9A 4RT2A 2A18A 2BTFA 1RZMA 2GBZA 1WBDA 2PKEA 2NRVA 4UUXA 3AY9A 4I2PB 4BACA 3ALRA 1RB0A 4OYXA 4DQIA 4CHPA 4FK4A 2KJ9A 3VGUA 2NUBA 3TVZA 4FE3A 1QQNA 4C8NA 4FJLA 4B9NA 4CO2A 4X4SA 2ZTCA 5D3GA 5AM1A 5LOQA 2BE2A 3O4QA 4BC4A 1ZQGA 1V3SA 2YPZA 3N6NA 3LP1B 4FJ7A 3MAHA 3K89A 2QYCA 3JSYA 4KB7A 2XLIA 4CJWA 3ISNC 2QLFB 3O3HA 2F44A 1BY9A 3BYPA 4P0PA 1QVGR 2MSSA 2MSNA 2IYIA 4ZCMA 2CNLB 4LF5F 4UW9A 3AARA 3MGIA 3V6DA 3CMEN 2GO8A 5IINA 4RNNA 1G7CB 2E5HA 4USUA 1LKYB 4RR5A 3QZ7A 4K4VA 3VC8A 5KT5A 1HR0K 3H08A 1MC8A 1KDNA 1TL4A 1L7PA 2AA4A 2OEMA 2O8DB 3WEEA 1X7VA 3VQBA 2QKQA 5DDQC 3VV2B 2VIXA 4JI7F 3HTVA 4BRGA 1Z6RA 4RT3A 4I6YA 4LSNA 4ZPWR 2OWOA 4ZMMA 4A8XA 1JLEA 1O5JA 3Q8KA 2XYGB 5F3ZA 1S6PB 1NNEA 2W03A 3RR7A 3FZLA 4CJEA 1BHLA 4U7BA 3DRPA 4YN3B 2W4PA 5BPLA 3RF9A 1R8PA 4MKAA 2ADCA 5KRSA 2JVOA 1T9YA 4O0JA 3H5XA 1WHWA 2BUNA 1KBRA 1OH6A 1UL3A 3KK7A 4IEIA 2O8CB 2H3GX 3M6XA 2KM8B 4M63A 4LZGA 2GV1A 3RU0A 3BS7A 3HX0A 4F72A 4DL6A 2RRNA 2FJVA 4DR4F 3HFKA 4JI2K 3CFRA 3IUCA 2RHSB 2MYFA 4FPRA 1SKUB 4H5NA 2KHOA 2NPFA 2V69A 2M8HA 3L3CA 1RHJB 2HLTA 4WK1A 3ATVA 2B21A 4C11A 1KS2A 4FWRA 4PJ0U 5LMUK 3HZEA 4BHQA 2MKKA 2OJ3A 3ZNJ1 1W9HA 5AJ3K 2HQDA 1S77D 2OA8A 2QWPA 3AA5X 2ITGA 2OSRA 1S72S 1HBMB 1KLMA 2JZBB 4W98A 1IO2A 2OXOA 4IO8A 2CH6A 1VJQA 1PVPA 3SUOA 4L75A 4DTXA 3AOCA 4LF9F 4M1KA 3ZYYX 3SAGA 3J80U 4OKEA 4P2HA 5KAKA 2FIUA 3HVRA 1UW4A 3GZ7A 2VYPA 1X66A 3TZWA 4B3TF 3IO1A 4CYUB 3N4PA 4H0TB 3VQ5A 9ICNA 4LSZB 3OBIA 3PIOL 2J6TA 2HFOA 4NLPA 2M0NA 4Y34A 4K4UA 2M70A 1UVNA 3RVCA 3CF5L 4C23A 4NXNF 3K17A 5L46A 3N5BA 2JC1A 2QYGA 3G6YA 2I5JB 1WG1A 4HEA9 5AKEA 4GRSA 3WQUA 3CWJA 3WK6A 5I3UB 2CG4A 3LWLA 1S3XA 3HM9A 3EGNA 3ALYA 4QIWF 3W9IA 2HBMA 2YWHA 4E2FB 2BJ8A 1OW5A 5JVHQ 2HCFA 1RAJA 4DQSA 3M2RA 3RW7A 5GMKa 4J9LA 3LUYA 2CQHA 2NRXA 3TA1A 1E4GT 1RDUA 3O2IA 2WTFA 5J2FA 4ENOA 5DK5A 2VUGA 4A2BA 4F36A 3TJAA 2HGNA 3QATA 4USIA 2B5JA 3JPQA 3O6QA 4P2XA 4EIAA 4F91B 2NXNA 2XY6A 3QAEA 1C7YA 1OY6A 3L3VA 2XY7A 5D0GA 4O4RA 3HP6A 5ETQA 1MQ3A 4FF4A 5GAEP 4BWJA 3VQTA 3TO8A 1NGIA 2VU5A 5A76A 5B5EU 4ZITA 1N36J 3DDKA 4DCJB 3H90A 3QPIA 2E4LA 4KH6A 3NBPB 5CCMA 3MMCB 2FVQA 1ZQIA 4CI0B 1QZ6A 4W4MA 4GKKF 5ALGA 2HFSA 3CXCM 9ICXA 4O5BA 1EP4A 3V2UC 3DKDA 2C3MA 5KT7A 2UUBJ 2E88A 1SV0A 4V1Ak 5SZTA 4NLKA 2R7RA 1U1QA 5M1KA 1JN3A 2PE8A 2WF7A 1WOQA 4FBUA 1UPPA 3NOGA 4FJXA 4LR9A 2RHKA 4DU7A 4Z94A 3D54A 4WTYA 4YOWA 4JV5K 4HYKA 2O66A 2FDRA 3JSMB 5HANA 4LRAA 3ZLJA 4BS2A 5B0GA 5AQYA 4P7TA 2C3UA 3OYAA 4JKHA 3C94A 3L0QA 3FEYB 4DV4J 3IG8A 4P4PA 1J5OB 3FRYA 1S1TA 3OTOF 3SMZA 1IR0A 1TL1A 4ZLJA 2ZC3A 3NRWA 1LWFA 2VA8A 1WUAA 2YY6A 1KRPA 1JIHA 5HLFA 3L95X 1X3MA 1FWLA 4QZGA 3L2UA 3OYIA 2AEMA 4ZVRB 1TFYA 4CF1A 1PVQA 2YNIA 3DHXA 4X66K 3F9KA 4BJQA 3H5SA 5G5GA 3O3LA 2P9PA 2KKVA 3H5UA 3D1QA 2CXYA 2JFDA 1RAGB 5BXIA 3LAKA 3PO4A 5CZXA 4DV2F 1BI4A 5IIKA 3LDNA 1HEKA 9ICLA 2Y8YA 4QR0A 2LU1A 1CJKA 4EO6A 4F4YA 4IUFA 4LF4J 1VHFA 4HHUA 5CA7A 2NSBA 2NUHA 4RQ0A 1IBLF 4J2BA 2D0OA 2GQCA 3VGTA 1M0SA 2CPIA 1JLCB 3UD3P 1IG6A 2WF5A 1NDLA 4H4OB 3TNVA 1HYVA 4HUGA 2VFTA 9ICBA 3OT9A 1YBAA 3DWLA 3ICXA 3MUMP 1C1BA 2W4CA 4KQZA 4RW8A 2CAJA 2KVIA 4IQUA 4IFEA 3NKYA 2KI2A 2JR5A 3UQ0A 1M5HA 4ICAA 4JUZA 3IR7B 4LF8J 4KIAA 5F8MA 1NGAA 3K0SA 3MM6A 3OL6A 3VQQA 1T3NA 5AZJB 5HQLA 3OFEA 1TUWA 1SXLA 2VG5A 2ZH4A 3TKAA 2AEFA 1DTQB 2VB6A 4PG8A 4QR2A 3MN5A 2LQJA 1WSGA 1ASUA 1TELA 3CCSS 3W0LA 2MKIA 2ZBPA 1XMOJ 2N7CA 3ENVA 2EWSA 4IFYB 1QSSA 1NMEB 3KZXA 2RDJA 1CULA 3F53A 1ZA1B 2M0GB 1NOZA 2VOPA 4UB4A 5EWEA 3H8JA 3BS5A 2ZOFA 1M1HA 3DLGB 3LGNA 2W3SA 1YTYA 1ZQEA 2DKZA 1F21A 2W2OP 4DR2F 3M8SA 3BGRA 3VA0A 3KWGA 1BO5O 1TKZA 4YDXA 3AA4A 1FRHA 4ILJA 4ID5B 2ZJAA 2VFUA 2LHTA 4DZ6A 3BF1A 1M5SA 3GJTB 5L8RC 1QE1B 3PIOQ 3MN9A 3CDWA 4ES2A 4KH1B 3CF5Q 3BQ2A 1OPZA 3VVUA 2VQFJ 5DQGA 4IR9A 3MXJA 2GH1A 3TWHA 1HBOA 3CULA 4EZ6A 2VWJA 4F26A 2J0SD 3UN3A 3LA0A 4F4KA 4JI5J 1ZQUA 3MF5A 4A46A 2FZKB 1FXRA 3NGYA 1N6QB 1HBNB 3ZZOA 4JV1A 1FXDA 3LW5C 4YS2A 1MWKA 2ZH8A 2HAFA 4H4KA 4USMA 3MN7A 2QFJA 2YWFA 1BPEA 4B3SF 4JI8K 1D8LA 1NSPA 3VQPA 1ZBIA 5C25A 2VDHA 2PGCA 2YX1A 4IYQA 2HWIA 4UAWA 3D2NA 4OLPA 2DO0A 5IIIA 3B6PA 3TAPA 2HS3A 4HACB 4BY9C 3OTEA 4Y00A 2DTUA 2YHBA 3KVGA 1AQ6A 1YHQS 4QYRA 5CYQA 2GMHA 4JOUA 5L9NA 1HNIA 1X4EA 5JMVA 1YKWA 2B51A 3H0PA 3PNIA 3WKDA 2DY1A 2QL7B 2GIRA 1G3OA 4N76A 1FA0A 3LF0A 4I9LA 3QRQA 2WVEA 5MLCQ 5KRTA 3ENQA 5AM3A 3SQGB 4FO0A 3MABA 4TYBA 1OXJA 2VKZG 4U6PA 3PW0A 3QO9B 3GDQA 1VQOS 1C0MA 2E5JA 2FDNA 2QJ3A 3I87A 4ZH4A 1IV0A 1X6JA 1S0NA 1KR4A 3ISZA 2J9EA 2VICA 5J0PA 3ZT1A 1J54A 4B8CA 1CQMA 2BMBA 3OVAA 1UVMA 5HBMB 4BR5A 1VQ6N 2AD9A 4WQ4A 3C15B 2I1RA 4USJC 1PK1B 3KHHA 1LFPA 3PMLA 2ZWHA 2CPYA 1NUEA 3E9PA 4B3MK 1NAQA 2JLEA 4K8ZA 2V7ZA 2W7PA 5ALRA 1ZXIA 4GXJA 1VRUB 3MN6A 4B9MA 8ICYA 1C0TA 3C95A 3NH1A 3LDQA 3CQ8A 1HHQA 4DX8H 3TJ9A 1C1CB 1COKA 4US9A 1MMNA 5D77A 1XSNA 4XPEA 4EO8A 5J0OA 1FRMA 1S1VB 1UFKA 3VAIA 5T7BA 5B8HA 2QWNA 3ID6A 3IM9A 2AH5A 2R7WA 4L3NA 5ALZA 8AT1B 5HP4A 3FAHA 4PHPA 4ZPBA 1S1XA 1U4BA 1ICEB 3HPOA 1RQLA 1N52B 3SIPB 3Q22A 4NA3A 3ZC4A 3WC2A 2F3JA 2I6XA 3QU9A 3D0HE 4DSJA 4M5MA 4CZJA 1ED1A 2HBQB 1LOUA 2DUYA 4N56A 3NNAA 3O08A 5FP0A 4YOEA 3QU7A 1SS6A 3C29A 1FFWB 4F5OA 2C42A 4IG3A 3CTRA 9ATCB 2J7UA 4LBPA 3KLEA 3PR5B 3VQSA 1HNVA 5K5MA 3V6HA 3ISDA 3CT9A 3FBEA 1FK9B 3HF5A 2DKXA 2HRYA 3I56N 3ZEUA 3SEOA 2ZTEA 1C0GA 4WFNL 2DGOA 1T9VA 2WOMB 3IRUA 4IL6U 3CYMA 3D5MA 4FDFA 3CDAA 3C46A 5GAHU 4MFAA 4Y2XA 5C7PA 4AQYF 1ZQXA 3G6VA 3QNWB 2R7TA 2QB0A 5H1SV 3N6MA 2F8HA 2AHOB 3WK5A 1TKTB 1HPZA 4LQ3A 3C16B 3PYFA 3BBBA 4LR8A 2A42A 3JPOA 3WK4A 1D4XA 2IAJB 3IXQA 5F0UA 1VQ8S 4FPAA 3EE8A 4M3WA 2KRRA 1AFIA 5HO4A 2HF3A 4F4AA 3EUNA 3ZCMA 4RNOA 4LZDA 4CLZA 3BUZB 1FW6A 2EW9A 5ALQA 3OHBA 2HK2A 3UCUP 4LBIA 3KK3A 3HD1A 3SSSA 5BOLA 5E84A 1FVSA 1YX2A 3DEEA 4KN7A 2LYBA 3UNYA 1K1SA 2OPSB 2DEJA 1YRUA 4UBBA 4ZP9A 3M30B 2GELA 3Q86A 3M8PA 5AM5A 3KLGB 5DDRC 3CXCR 3TX0A 4WP8A 1KQSR 2P9UB 1RTZA 1M5PC 5J0SA 2QL9B 3V5RA 2LA6A 4FF2A 4ID8A 2D5RA 2KHCA 3FQKA 4PZOA 3MMBB 3A8YA 1KOOA 5LJ3Y 1XMQF 2E3TA 3T79A 4HUEA 5E3QA 2D8CA 3DOLB 1UVLA 3KZBA 3DOKB 7ICHA 2HNDB 2IC3A 4LREA 4E1NA 3K0JA 4RPZA 1DKGD 1H72C 5DMRA 4J03A 4MYTA 2A3VA 3ULEB 2P9SA 3HHLD 4CF4A 4ZLNA 5L1JA 1U47A 4PHEA 2H4YB 3OTBA 2ZKUA 1WSHA 2IM2A 4I64A 5ETLA 5IZHA 3CCJN 3EMTA 2NZCA 5G5HA 3J8AA 2V68A 5ALVA 4UT4A 4A8KA 4Y0FA 2K4IA 4PRFA 4R0JA 3R9KA 4DSFA 2QLXA 4RL1A 3ISBA 1XS9D 1Z1BA 3V7JA 3HOSA 4LF5J 4JI3K 4QZ9A 4JI0F 2IYGA 3OYFA 3LM9A 2WTUA 5HR7A 3DJCA 3WT0A 1WF0A 1WEYA 2C2NA 2HHXA 3QNNA 2NUUG 4K5SA 1XNSA 8ICOA 1B92A 1GT8A 4KHUA 1NGGA 3EZOA 1AXQA 9ICCA 5KFAA 1DGSA 1X9JA 3WDOA 3L3UA 2UXBK 3F5TA 1C0FA 3CFOA 4JK7A 4KGXB 1BXNA 3IR5B 4RWWA 1VMBA 1H7XA 2KK0A 4FJNA 5AI5A 1LAVA 3PHTA 5DQHA 4I2AA 2HQCA 4CLPA 4TSXA 1SC4B 3NF7A 2EH9A 2R2UA 4DTOA 2L9DA 1X3NA 4DPWA 4G9ZA 4B1XB 1OY9A 1PBUA 3C6TB 4CFDA 5LSRA 2CQ3A 1LXJA 3SENA 4BXOB 1K0VA 3D68A 2E1YA 1Q7LB 4M9NA 3GL1A 4GV6A 1S1UB 4DR4J 3QEVA 4CJQA 3FCWA 7ICNA 2X3DA 3HJEA 2RRBA 2BQRA 4CJ5A 3K8WA 4CD3A 3THWB 2XQCA 3IS9B 1VR6A 4CK2A 4WF9L 1F2GA 2KHQA 4ED8A 5AQMA 3AJ2A 2CQ1A 4FF1A 2WUSA 2XS7A 3MOZA 5J2BA 3TEHB 2P6SA 2LSNA 1ZBLA 3S01A 4CHZA 1S6UA 2DH9A 2BGGA 1CZBA 1U0HA 1VQMN 1QQMA 2KE7A 1WORA 4P2FA 1D9AA 4M5JA 3CCMN 4CRXA 1UJ6A 5AT1B 3IBFB 1ZXOA 4FJ8A 4DMZA 3OYEA 3MURP 3K5LA 2CNOB 4CFCA 4USKA 4YR2A 2ALYB 2G2ZA 2HVEA 9ICTA 4I0WA 1NLKL 2M3DA 1D8ZA 1RT1B 3L09A 2CQ2A 3EWGA 3BJYA 5J0XA 3WK8A 2K3KA 4JYAK 2VBWA 1RT7B 3VQ9A 5CD4H 5GAHI 5J8YC 1SV5B 3I28A 2ZHOA 4CT8A 3L8BA 2YJEA 5E2QA 2E5IA 3B78A 5IS2A 2QARA 4O8UA 1BG3A 4EWTA 1LAWA 4ED7A 1HW9A 4DV0J 2PZSA 2B9WA 1APSA 3CRXA 4F5PA 1KQFB 2BDPA 4QR1A 3VAFA 3QNMA 4WFNQ 2V63A 3QUBA 1M1GA 2Q0RA 2ZUCA 1CUKA 3UMCA 5HROB 5FIIA 5T7LB 1WN7A 2QI2A 2LPEA 4I2IA 2BPFA 3F41A 2DR9A 4IKFA 1HQEA 1PCAA 2DGQA 5GMEA 1WG8A 3N7RC 4ZS6A 3OD2A 4CZGA 2P9KA 1B9FA 3CFPA 1X31C 4Y2IA 2HVZA 2UXCF 1LW2B 1NB2A 4A59A 3BSAA 3FCHA 3KJNB 3ONNA 3WXJA 3CCRN 3N7SC 4QW9A 4F0KA 3P83D 1HR0F 1T8EA 1SWWA 2FYXA 2E5GA 3UD5A 1K9MT 2OHFA 3B4DA 3O1LA 3MDCA 2RKIA 3AVMA 3VESA 2KW4A 3OL9A 5L9XA 2ABYA 3DYAB 2NYIA 3PV8A 3IWXA 3CC7N 3IM1A 4QJVA 5HATA 4WFBL 3NASA 1HWJA 4RW9A 1ZQSA 5I3PA 1P1LA 5IV3A 2G0JA 3D2WA 2O67A 3FEXB 3GWCA 3HSCA 1L3SA 2GNKA 1TVAA 3BR9A 3SDEA 1S79A 3RSEA 4E19A 8ICJA 3JAMO 3OYJA 4NO7A 1RILA 3SSQA 1TK5A 3GB0A 5M1QA 4BRMA 1REVB 4JI2F 4R5PB 2EK1A 1RTIB 3W2VA 2W9AA 2LXUA 2WB4A 1OYEA 3QU2A 1KVBA 4DTMA 3CD5A 1Q7YT 4O0NA 3AJ1A 2HB5A 1GOBA 4ZLPA 2F8SA 4UAVA 2AKWB 1Y11A 4L3QA 3GBTA 2DNQA 5IOLA 4JI4K 4QS7A 5AJ3F 3O3GA 4LF7J 4OI3A 2XMWA 3GSIA 1IQZA 3CQXA 4EBDA 2RE2A 3OTOJ 1NNLA 5HHHA 4XPCA 5AKIA 5C42A 4M3TA 5ETRA 3TTDA 4CLTA 5AQPA 2YTUA 2ASDA 3TR8A 4LFBK 1LK7A 4Q45A 3JAMU 3KK2B 1RWKB 1Z26A 2XGPA 4OFZA 3AN1A 3AVBA 2B56A 1U6BA 2D4WA 5J29A 1D1UA 5KGXA 3IR6B 8ICEA 3R27A 3ASMA 4EEKA 5KFMA 4ID1A 5F2RA 4A62A 2ZIUB 2P9CA 5TZVA 4Y2RA 3CCUN 4TVAB 1MWZA 1TUGB 4RW4B 3HPHA 2ZH9A 1RGIA 4BRIA 3H0RB 1QDUB 3UMBA 4CF3A 2QWOA 4CQ1A 4JKFA 4DQRA 1FWPA 1IBLJ 8ICAA 2KKHA 2DBBA 4KV8A 5ALOA 5H9FK 3RAMA 2XBPA 3I8DA 4CESA 3HHLB 3UDEA 4KGZB 4C4TA 4B9SA 4UOGA 3W5XA 5ELZA 1TL3A 4KR0B 2G0CA 4L74A 4KB1A 8ICMA 1TV6B 4QS9A 1HNWK 3CJ7A 2FPMA 5A8WA 4WXWA 2ISPA 3AO2A 3ORYA 3G8TA 3MPUB 4BC9A 5HJXA 1HLUA 1VQPS 4IOXA 3VAKA 2HIQA 2Z8QA 1XBWA 2JV3A 4F3MA 4LR7A 2HSEB 1NKEA 4I2JA 3MWBA 1WSJA 2VFSA 4WF9Q 3PYGA 3PSIA 4CECA 2XHBA 2ZUBA 1S0OA 3N0VA 3H0MB 4PHAA 1SKSA 3RH6A 3HHNB 2ETJA 2XZDB 2A3ZA 2DVIA 5FD1A 3ZT0A 3KYLA 2UUCK 3JTOA 1N8RT 1BNOA 1ZC6A 3DXKA 1UVIA 4USVA 3POTB 1RTDB 5DG8A 4FPIA 2IVMA 2BKEA 1RA7A 3V4MA 3QYYA 4UAUA 4DR2J 5B0CA 2BANB 4QZCA 3MPWA 4HR2A 4PZVA 1B0PA 3J80Y 3RB0A 3K2PA 1DEJA 1BQMB 4USTA 2KHDA 2F63A 2GOLA 2FB0A 1MROB 3U7JA 2DRAA 4PUOB 3MZIA 5JTIA 1J2NA 1BUXA 2Z56B 3JQKA 3NGIA 4OJRA 8ICQA 2JOQA 4RUHA 2K1RB 4JV5F 1NKCA 3SQOP 2M5YA 2J8AA 4UB2A 4NLZA 2AW0A 2E44A 2HURA 2RH3A 5C2FA 2ZBCA 1FDBA 1KAXA 3DLKB 1OY8A 1VBXA 1SCJB 1NCLA 3HSGA 2XB2D 2HBZB 1U0SA 4QIEA 2H3EB 4MFFA 3IV6A 2ATLA 4J2EA 1YJUA 4WFZA 5DETA 4RQ8A 5KFUA 1S9FA 1S97A 4HHJA 2ZJ5A 5D6GA 3FBCA 2KZ3A 1U1RA 1ZQQA 1WC3A 4B3SJ 5KFJA 2GC8A 3QBWA 4DV5F 4GKJF 4OLBA 2IRXA 1WELA 3GP9A 3VAGA 4X66F 1HMVB 8ICLA 2OMOA 1BISA 4EX6A 4G3IA 3BSCA 3DU6A 3FRZA 1KFSA 1JRPA 2CG8A 5C24B 5A8RB 3VEYA 1S72N 1LWCB 1T9XA 4CI6A 1BWVA 4OX8A 3IMQJ 2I9SA 2LKZA 3MMAA 2O8BA 4MQ3A 3A1YG 1SL0A 4OHWA 3JPRA 4FJGA 2V2ZA 5KFDA 3I8BA 4JRQA 1YJTA 1RXWA 5B0DA 4NLTA 3PMNA 2VFRA 4WFBQ 3VN5A 3V9WA 4B1WB 1EX8A 1H98A 3AO3A 1AZSB 1B7YB 3CI5A 3P31A 1T3OA 4O3PA 5KTQA 2PMZC 1FDAA 3MECA 4FWPA 1SBRA 1VS3A 1BPBA 5FLXU 4ZHRA 4AYBD 4CF8A 2IBOA 5KFZA 2O6KA 4M41A 2POKA 3OXLA 4TN2A 1NOYA 2ZVSA 2K89A 1KEKA 3EZUA 4KMUA 1T03A 4PG4A 2HWTA 2J9DA 2VC0A 3K57A 2WW4A 1GMUA 3GR0A 4RUBA 3GONA 2KZZA 2GZOA 5E33A 2I2YA 3W5YA 2MHEA 1UZHA 4QZAA 2RMLA 2FJDB 8ICTA 3V81A 3LPEA 4ED4A 2QT7A 1WSRA 2VD3A 2Y0SD 1MDUB 3KUHA 1NGCA 1K8KB 4P4OA 2VJ5A 5JXSA 1TYQA 3V1QA 3W9JA 4M42A 2R8IA 4TNOA 2EKNA 1JJCB 1LCUA 7ICFA 4J9OA 3DNCA 1RT6B 2K4HA 1VHIA 2KD1A 3RW6A 2JLGA 1XJWB 2IDOA 4FLWA 2PFNA 2F9TA 1F9FA 4FM0A 4ZA1A 3V9ZA 2OCEA 4ICLB 1VSKA 3KLVA 4NLNA 3PSFA 1EAYC 4K0KJ 3OJSA 3CJSA 9ICKA 1ZJNA 4GXKA 1Z2LA 2LVWA 2RF2A 1DLOA 4PR6A 1RTHB 4TU8A 1FKPB 3AD7C 4US8A 3U4LA 2QTWA 1OSDA 1WOOA 4B8AB 1QAJA 3EGVA 1DTTA 1R0CB 4ZP8A 9RUBA 1ZD5A 4TUPA 1NH8A 2KJWA 3KDOA 5L39A 2AJ1A 4M95A 5K4LA 2HVIA 1SC3B 3UQ2A 1U8WA 4DU4A 4CJKA 2OEJA 5HHIA 3HOTA 1XNRJ 1MSWD 1FHTA 3K1ZA 1WKLA 3TUJC 2ZEJA 4M6WB 1ZM9A 4RCHA 1PVRA 1MU2B 3BZKA 2W01A 2VJ4A 3SZ2A 1Q86O 4UZCA 4B08A 3ZDDA 4OJ1A 3MM5A 4EYIB 3PUFA 8ICPA 4OI6A 4RG8A 2N3OA 5D8HB 4N8OA 2YKAA 2CPXA 3A8IA 1WWVA 3FVYA 3TWZA 4G1PA 3TADC 3K8VA 2ZKTA 3EXYA 4X84A 3GIRA 2Z1GA 3LGMA 4RQ3A 3Q0AA 2WSFC 2KXFA 3QBXA 3R6LB 3QERA 4I2PA 4NMXA 2YCHA 4N8NA 1F2HA 3KKRA 4KSEB 2H48B 1Z00A 2ZG6A 4PXDA 2Q36A 2ESEA 3H59A 5BREA 3NGSA 1S6QA 2DB1A 5F8HA 5EWFA 2H3QA 1ZRNA 5ALMA 9ICJA 4FZXC 2B7BB 2IOHA 3LDAA 1EETB 3VWSA 3LP1A 4F0HA 2RN2A 1PIEA 3QMQA 3DLRA 1U2RA 2WB1D 1BCOA 4LIRA 2IVPA 4O4GB 4YDUC 3CCQS 1XR7A 2Y9HA 2B9XA 3AAWB 4JN4A 2ACMA 2QSFA 1DJ0A 2WONB 2R8KA 3HL8A 1ULRA 2Q79A 4F2RA 2A6OA 3NE6A 5ALDA 4XRHA 3GFHA 1Z1ZA 2E20A 3IM8A 5BYQA 1LKYA 2RSQA 4YG2A 5HL7L 3MGJA 4DU1A 3CCSN 4ZVGA 1EHWA 1I3AA 1NDCA 2KJVA 3HT3A 3HT0A 2J5AA 3V1OA 4WIIA 3QX7A 5KFBA 1R0AB 2CUYA 1HHTP 3P3DA 3W64A 2LMRA 3EN9A 2H3ZA 3WX4A 2L48A 3BKUA 1QCKA 3EE9A 4L73A 3OYCA 1M6YA 3MM9A 1LV5A 4FS1A 3QBCA 4N41A 3I0RB 2EVZA 1YBTA 2AX0A 1PG5B 3VF4A 2WAQD 1OUQA 3C65A 1KC8O 3KIOA 4P4MA 4DF8A 1IM6A 2IJNA 2O8CA 4L76A 1EQYA 4FWLA 4KGKA 1B9DA 4M5KA 3LO3A 3QUCA 4YEAA 2O4IA 4MTPA 1SJ3P 1Q95G 3WUHA 1WSVA 2EAPA 3P6YC 5KL8B 4LF6K 3QFHA 1BPDA 4JHDB 1CS4B 1EKRA 1SVDA 2FMSA 2COLA 4J9VA 2WF6A 1L3TA 3QXGA 3N4MB 4S0MA 2Q0ZX 4M5DB 3HHKA 2DNZA 4ED5A 2G0AA 4I2BA 2P6TA 1SPBP 2XULA 2LQBA 1N5SA 1R0BG 2P5OA 1VFJA 3UQSA 4TY9A 4CNZA 3ED5A 3ZZRA 5AZIB 3PCOB 1J5EK 3PFOA 4ILMA 3DXSX 3BM7A 3MFHA 1EKSA 5GTIU 2XSJA 1WDTA 9ICRA 2W9BB 4ANEA 2XWYA 1L8LA 1FJ7A 3V6JA 2E7VA 5FROA 4ZVFA 1VSIA 5EY4A 4K59A 1FX2A 1Q0NA