1NKCA

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after five rounds of primer extension, following incorporation of dctp, dgtp, dttp, and datp.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkcA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkcA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkcA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkcA01
3AA4A 4AHSA 4DL5A 3PW0A 3TAFA 2W8LA 1BI4A 2D0AA 2BCSA 4N47A 2IAJA 1HYSA 3JYTA 5BOMA 4DU4A 3K58A 2PXIA 3V6JA 2VA3A 3OYJA 3NGZA 5KG5A 1D8LA 3SPYA 3Q8QB 2YNFA 1JLBA 2AGQA 3Q8KA 3CYMA 2R8KA 3ETLA 3AO2A 4M9LA 4CHPA 4M6WA 1TVRA 3K57A 1JLQA 2JEFA 5E41A 8ICYA 5DB9A 4LZGA 2PFPA 4LH5A 4M9HA 7ICKA 2OPQA 4DTRA 4NCAA 2X74A 3PMNA 1NK9A 2ZQBA 4BWMA 2HHTA 5KFJA 4KTZA 4QWBA 3V7KA 1NKBA 2PYJA 4CJTA 3SQ0A 4E0DA 3SPZA 4QZ8A 1GOCA 3G6XA 4F4XA 1KFSA 4FBUA 1QE1A 3EPGA 1S0NA 4B9NA 4CK2A 1YTUA 4DTJA 1TKDA 1ZQEA 3UQ2A 3K59A 2WOMA 4I29A 1RT4A 4DS5A 4QZIA 5KI6A 3NGIA 4KITB 4J9QA 5FROA 5FRMA 4I2GA 4HUEA 3MXJA 3ASMA 3PO5A 4GC7A 5KFVA 3VQDA 4Z4IA 9ICJA 2HNYA 1A5VA 4KLDA 7ICPA 4FJHA 3THVA 8ICNA 4RW6A 3V72A 1COOA 2DFLA 4F91B 4CFCA 2AGOA 1S6QA 2O4GA 5IIIA 3BQ0A 2ASDA 4XIUA 4XQ8A 3M9NB 1S1UA 3ISCA 4FS1A 1U45A 4Z4HA 5J0WA 1HQEA 5J2GA 4CF9A 1AROP 2XGPA 2W42A 2QKBA 3AVLA 3PW4A 8ICKA 4RZRA 3PUFA 1ZQGA 5J0XA 2B4JA 3ZT1A 1WCNA 3C5GA 1RDCA 1TL3A 2G8FA 4W5TA 3LP1A 5CP2A 8ICRA 1IKYA 4I2AA 3QIOA 4QAGA 4RG8A 2BCRA 4IRKA 4DG1A 1DOQA 4M47A 1ZQPA 3DRPA 3JPSA 2ATQA 3FFIA 5KFXA 3ZSYA 4BDPA 3KLIA 1WCLA 5HHHA 3VQ5A 3ZSOA 4F4ZA 4ECTA 4FK0A 5KFUA 1ZBFA 5KGWA 3HO1A 1ZBHA 2ZD1A 4QZFA 2ZJ8A 1RT6A 4ECUA 1ZQBA 4I2FA 1D5AA 3G6YA 3HXMA 4DSFA 4RQ3A 5KFFA 2NRXA 2J6TA 2VWJA 4FJMA 3DOKA 4ELVA 5J0QA 3QIPA 4Z4GA 5DGBA 4YCXA 3ZCMA 5J2CA 4FJGA 4FYDA 4OVLA 4QCLA 5DQHA 2XGQA 7ICNA 4BDZA 3C2KA 3PW5A 9ICUA 4DF4A 2FMSA 9ICKA 3KHLA 1T7PA 4ZHRA 4TUSA 4L8RB 4HYKA 3C23A 3LDSA 2DY4A 1RBTA 3C2LA 8ICCA 1LWEA 4O44A 3OYBA 4Q0BA 5JS1A 7ICVA 9ICSA 1S0VA 3OY9A 3V6HA 4MFAA 2HB5A 5C5JA 3EYZA 4W5QA 5K14A 3HT3A 3OYAA 2GBZA 2Z1JA 3AVKA 4UQGA 2Z1HA 1X9MA 4I2QA 3LPTA 5CZ2A 4XA5A 4NY8A 4FCYA 5J2AA 3ZDDA 2P5OA 2AJQA 3OS2A 4KRFA 1JX4A 3VQQA 2XCAA 5KG6A 3ISBA 4O0IA 8ICWA 3C1ZA 1RBUA 1VSFA 3JPTA 1S9GA 4AILC 4J2AA 4Z6DA 3RJJA 3RH4A 3JPQA 4E7KA 2OZSA 3SQ2A 1TGOA 8ICMA 3KHRA 2G8UA 4P4MA 3KLHA 8ICOA 1XHXA 1RT3A 5BOLA 4EP5A 4TSXA 5HRNA 4RNMA 1S10A 4KO0A 3OYIA 1XU4A 5KFYA 5DLGA 1WNSA 3GIJA 3NH1A 4N41A 1JLEA 2HVHA 1WAJA 4UB4A 5DDMA 3BQ2A 8ICSA 4FLVA 5KG2A 3B6PA 4EZ9A 1RT5A 1LW2A 5JUMA 3JPRA 2ZTEA 2J6SA 2JEJA 1Z26A 5J0OA 4F2SA 1RTJA 1U04A 3VQ4A 2LYHA 3VQBA 1K6YA 2VG5A 1KDHA 4QWCA 1KCFA 2ATLA 4Z4CA 3PY8A 2JGUA 4RQ8A 3HL8A 5KG4A 4CE9A 2BKEA 2OPSA 5KFMA 3OYNA 3PO4A 5SZTA 1XSNA 8ICGA 1BQMA 4KKOA 4NM1A 3SV4A 8ICJA 4YXJA 5KRSA 4DQSA 1U47A 4X5VA 1L3UA 2I9GA 5L9XA 3SYZA 4K4HA 4OPJA 5DG7A 1WSIA 3CM5A 1IKVA 3HPHA 3MDAA 1C1AA 1RT1A 2EX3A 3TAEA 4QZAA 4YNQA 1RTDA 4UB3A 1U49A 4YFUA 5HRSA 3AVBA 4E89A 4I2EA 3NF7A 5IIKA 1RBVA 2R8JA 4QWAA 2R8IA 3M8PA 4KN7A 3WNEA 4PHPA 2W9BA 4DL6A 1QQCA 3RB6A 1N48A 4JWNA 4I2CA 3C1YA 3OYDA 4RUCA 2B6AA 3QLHA 4E3SA 9ICCA 1QSSA 4FJXA 3MECA 1W9HA 2F8SA 1Z00A 2HNZA 5CZ1A 3RMBA 2IHMA 5KFPA 4J9OA 1N6QA 3H08A 3KTQA 1BPZA 4F50A 1RDDA 3ZSVA 1ZQSA 1HUOA 5IILA 3K5OA 4NYNA 2W9CA 4IFYA 3VN5A 3MEGA 4FLZA 2LSNA 1CXQA 1TKZA 2HVIA 3MFIA 7ICEA 3NDKA 3DYAA 3M9MB 3H4BA 2YKMA 3AVCA 1S1XA 4QZDA 4KMUA 5L1LA 4KAZA 3Q8RB 5HMLA 4KLLA 5KT5A 3U3GA 3NH0A 4KI6A 2P51A 1NJZA 1ZQWA 4NLNA 4RQ1A 1HNIA 5KFHA 3HWTA 1ZQYA 3BJYA 1KRPA 2QXFA 5D3GA 4R63A 3KK2A 4KHSA 5CY4A 4EYIB 4TURA 2ZTDA 3K4GA 5J2MA 4JV2A 4O3NA 3PW2A 4M42A 3Q8MA 3JPPA 2OPRA 4IRDA 1A5WA 3P5JA 4DTXA 3C6TA 4DL2A 3RR8A 1B9FA 1WSEA 4CJVA 1GOAA 2HHUA 3K5LA 5J2PA 2BGGA 4KLQA 2E4LA 2ZE2A 2FPMA 2BR0A 2BCQA 2AGPA 8ICIA 3V9XA 2XO7A 5EWEA 3HSTB 3RB0A 1QTMA 3PNCA 1KFTA 4JUZA 1VRUA 3KLEA 5DLFA 1DGSA 4CHNA 4HCCA 4YXMA 4F8RA 5J2QA 9ICFA 1GOBA 3I8DA 4BACA 5F9NA 2ASJA 1X2IA 4YR2A 1S9FA 2JEGA 5L1JA 3OYKA 2RDIA 5KFIA 5CJ7A 3RBDA 5J2JA 3BQ1A 4F93B 1RT2A 1UA0A 4J9PA 7ICRA 3V81A 4DTSA 2ITGA 5KG1A 4RW4A 4TQRA 4RW9A 3WNGA 4CCHA 4PGQA 3NF9A 3MEEA 5L1IA 1VK0A 4JV1A 1IH7A 4FZYA 1S77D 4AHRA 1S76D 3QEWA 1IM4A 3LWLA 4M3YA 4I2DA 3RH6A 2QK9A 2PI5A 2IMWP 4KI4A 2V4QA 3TAPA 3I0SA 4CEOA 4FM2A 1BIUA 2GV9A 2VG6A 4LVSA 4DSLA 1TV9A 1RILA 2HNDA 4O3PA 3H8WA 3S9HA 3KD1E 3GFKB 2HHSA 4FJIA 4DOCA 3OSNA 4KLHA 4KLJA 3K75D 2OA8A 1EX4A 3UXOA 3TI0A 4Q8EA 7ICOA 1ZQFA 5J2KA 3LAMA 1NK0A 3MBYA 1VRTA 1NKCA 3AO5A 3NGYA 4CEBA 4R5PA 3U6FA 3TFRA 4DTOA 4DFKA 4Q8FA 3L2VA 3RMDA 2IDOA 1KSPA 4CGFA 1BGXT 1BVSA 5C25A 3O3FA 1ZQZA 3RJGA 2KW4A 4DSJA 1RNHA 3VA3A 3MR3A 4ID5A 3DRSA 2O4IA 4KLTA 4IG0A 4KHUA 4EZ6A 4NYFA 9ICPA 5IIMA 1ZYQA 1REVA 2IOCA 1KTQA 2ZUBA 2RF2A 1L3TA 5J29A 3IG1A 3UIQA 4CK3A 2ZJAA 3K5NA 1K1SA 4E7HA 3OS0A 4P2HA 4HUFA 4CEZA 3IAYA 1WLJA 1J9AA 2BPGA 2YHAA 9ICHA 3ZT2A 5DQGA 4LH4A 1CEZA 4CJ3A 1QLNA 7ICSA 3QZ8A 4EBDA 3VQ9A 3HP9A 3O3HA 1BL3A 1JLGA 3QZ7A 5F9LA 3RAXA 1A76A 3DLKA 1RYSA 5SWMA 4Y1CA 5KFSA 9ICGA 3IHQB 2YKNA 3MFHA 5DBCA 3TARA 1TV6A 2A1SA 4FM1A 1NOMA 2C2RA 5KFDA 2BQ3A 1CZ9A 4IRCA 4BWJA 4B8CA 3SNNA 7ICHA 5J2FA 4DQPA 4NLZA 2FBTA 4J2BA 2XC9A 4KB0A 5KG0A 2ZUCA 1V9PA 4ECZA 4HHTA 5KRTA 5J2EA 1NKEA 2KZ3A 3TR8A 3UPQA 3BQTA 3EPIA 4E7IA 1ZQLA 1FXXA 4JLHA 5T7BA 3OSPA 2FC0A 1TL1A 4RU9A 4QZBA 1G15A 3DRRA 4KLSA 4OPKA 4Z6FA 2FLPA 1ZQUA 4FLWA 4RQ7A 1J53A 2UVRA 1TK5A 5FDLA 2P5GA 4MQ3A 1WSHA 1RTHA 3LP3A 1RYRA 4I28A 4JS4A 3V6DA 3OJUA 5C24A 4DQQA 3SZ2A 4GVMA 4M3UA 5DB7A 4QWDA 4IQWA 4M45A 5J1EA 3CFPA 3AVNA 3ZDBA 3KK1A 2AU0A 1HYVA 4LY7A 1ASWA 4PH5A 2VA8A 3C6UA 4K8ZA 2FMQA 4LSLA 3M8SA 3RH5A 2UVUA 9ICRA 3NGDA 3MGHA 3ISNC 4DTPA 1LB2B 1KVAA 2B21A 3T5LA 4O5KA 4CJQA 4FJNA 4MFFA 5TZVA 3VQ6A 4FVMA 2Y1IA 4DSEA 2D0BA 3QNOA 3L2QA 4FLYA 4B3OA 3QEAZ 3ZSXA 3QEBZ 5HLFA 1SKRA 4CEFA 1MC8A 3E2EA 1BI4B 2ALZA 1ZQJA 3TQ1A 7ICFA 4DU3A 4DF8A 1KFDA 3KK3A 2JZBA 4RQ2A 4KLFA 4QZ9A 4ED3A 1ZQKA 5J2IA 1X1PA 1RCHA 4M3RA 4CGGA 4R66A 4B9MA 4C8OA 1LWFA 4DTMA 3LPUA 5D4BA 2PY5A 3EW9A 4R8UA 1JKHA 1TAUA 1XWLA 3HK2A 4YFKA 3AVGA 2XY7A 1QSLA 3BDPA 4K8XA 2X78A 1KLNA 1ZBUA 2BE2A 2YHBA 1S6PA 4GXKA 2YNGA 4CFAA 4R8UB 1MQ3A 1BHLA 3ZD9A 4O55A 4DOBA 4Q43A 4RNNA 3P83D 4KHYA 2AQ4A 1TVAA 2M9NA 4J9MA 1KVBA 3UQ0A 4KHNA 3L2WA 3ULDA 2HW3A 1XO1A 1Q8IA 1JN3A 1S0OA 3KLFA 5DDYA 1VSJA 4BE0A 2XRIA 4I2JA 5J0UA 2V9WA 4I9QA 1T4GA 4ED0A 2A1RA 7ICUA 3AO1A 4OKKA 4I2BA 9ICEA 4CGDA 3DI6A 5KT4A 1BCOA 5HRRA 3OYEA 1N56A 4B8AB 1NJXA 3TABA 1C1BA 1JLAA 4JV0A 2HHQA 1L3VA 3EZ5A 3LP0A 4YD1A 4B08A 4J2DA 4PGYA 4ZTJA 4AHTA 1NOZA 4BGDA 2KQ2A 2BCUA 3IS9A 1NK6A 3RJHA 4YMOA 3GV5B 4BDYA 4O5EA 4M2YA 3SQ1A 1BCMA 3GV8B 1XHZA 5CHGA 1HNVA 8ICLA 5J0TA 3V9SA 2XY6A 2MAXA 2BGWA 1ZQHA 2FBXA 5C42A 3L3UA 1I39A 3RAQA 3SUNA 4IQTA 4OGCA 3TAGA 4ZH4A 3PMLA 1HJRA 4KHWA 4AHCA 2W8KA 4B9TA 2VANA 1QHTA 2JEIA 1CUKA 5J2BA 3VQCA 3DMJA 4YMMA 7ICQA 3AU2A 3RJKA 1A77A 3NH2A 3GILA 4JRPA 3B0YA 5KFAA 1BPBA 2PZSA 2MUTB 1D9FA 4IQVA 4CHZA 4DO9A 4C8MA 3OYCA 4RW7A 4LSNA 3HPGA 4Z4FA 3F9KA 7ICTA 2ZJ5A 4DTUA 1L5UA 2JZBB 1VSLA 4QW9A 3RMAA 3H7IA 4CJUA 4P4PA 3TANA 4I27A 8ICVA 2XY5A 4ED2A 4JRQA 1T03A 1DTQA 4W5NA 1SL2A 1ZJNA 4TQSA 3SUPA 1LAVA 4RPXA 3QO9A 1ZQOA 9ICBA 4QZEA 4EYHB 5J0RA 1FK9A 1Y97A 1IKWA 2YNHA 3Q8PB 4B9LA 4AHVA 4KLOA 1S9EA 4ED1A 4PWDA 1CXUA 3AO3A 3PX0A 1NK8A 2V4RA 5KFOA 4KLUA 3C5FA 2W9MA 3T19A 1FKPA 1CLQA 4FO6A 1ASVA 3KIOA 3ZT0A 1EXNA 1XS9D 4DWIA 5DK5A 1W0HA 5KFCA 3C95A 3H8JA 1C0UA 4O9MA 3DLEA 4CECA 4N5SA 5KFQA 4M04A 1MU2A 4DEZA 4FJ5A 4J9KA 4J9NA 4QW8A 1RDBA 2VA2A 2ISPA 8ICZA 1YVUA 4EEYA 5DMRA 4KB1A 1Z3EB 2C2EA 3AA5X 3O3GA 3AV9A 8ICPA 4NLKA 3HX0A 3JSMA 3O4NA 2OPPA 5HRPA 4CHYA 3OHBA 4KREA 4PQUA 4JK1A 4UB2A 4I2HA 1ZQXA 3P1GA 3CQ8A 3FYHA 5EWFA 4CJKA 5EOZA 1KLMA 4B9VA 4O3SA 3C94A 4RPZA 4CEQA 4CF1A 4RT3A 1SL1A 9ICAA 4ED8A 3V9WA 5L1KA 1SKSA 1VSDA 1BQNA 4PUOA 8ICBA 3HVTA 3OYLA 2FMPA 3SI8A 4MF2A 1Q9YA 4CGHA 2R8HA 1FKOA 3GV7B 4ECWA 1ZQAA 2ETJA 4F4WA 2PFNA 2IBKA 3G10A 3KHHA 3TAMA 4B9UA 1B9DA 4M41A 9ICVA 3T5HA 4LD0A 4CIEA 4NCGA 1LW0A 9ICMA 2WTFA 8ICXA 1IO2A 2DPIA 4KFBA 3FDSA 4BE1A 4M3ZA 1Y88A 1BPDA 3MR5A 3L8BA 4FXDA 2HHXA 4Z4EA 5KGXA 7ICLA 5KFNA 2F1IA 5D49A 1ZBIA 3HVRA 3ORYA 1HPZA 4K4GA 5CA7A 5J0YA 4KPYA 4I9LA 2PYLA 2F96A 4BE2A 8ICEA 5IIOA 2UVWA 3NF6A 1T05A 4OKEA 1ZQVA 2E6LA 4W5OA 4BXOA 1BPYA 4IR9A 9ICNA 2E6MA 1WSGA 3AUOA 4NM2A 3AVMA 4NLGA 4Q45A 1S1WA 3SV3A 9ICIA 3Q8LA 5J2DA 2BQUA 2NRVA 1RDAA 3ZT4A 4FZZA 5CB1A 1SL0A 1WN7A 2BCVA 3CFOA 4XRHA 5KFLA 3KKRA 4F4YA 1JIHA 3MDCA 2KZMA 3QESA 4DLEA 3SUQA 2DFEA 1U9LA 2G8WA 1HRHA 4MFCA 4QWEA 4QZCA 1UT5A 2NRWA 1S0MA 2RDJA 4RPYA 3LZJA 1RXVA 3AO4A 3RJFA 1NK4A 4FJKA 1UWBA 3MR6A 4R65A 2OWOA 3TAQA 4GC6A 4FJ9A 2P6UA 3NTUA 1C7YA 2NRTA 2W9CB 3RRHA 2D0CA 3S3OA 1SZPA 4YP3A 1Z25A 1S5JA 3LWMA 5J2HA 3RBEA 2ISOA 4RQ5A 4PHAA 4F5RA 4EP4A 2C2DA 3QEXA 1MSWD 3UXNA 1RBSA 1HJPA 3VA0A 3WNFA 2G8IA 1O1WA 4J9RA 3ZDEA 3KKSA 3AVAA 3GIMA 4MEXA 1J5OA 4M3XA 9ICLA 3NHGA 4FM0A 4RQ4A 4F5PA 2F1JA 2P1JA 3L3VA 1JXLA 4FLUA 4IG3A 1EETA 3G6VA 2W9BB 5J0SA 5CR0A 4ECVA 2DPJA 3DOLA 4BXOB 3OJSA 4QOZB 1H38A 5KT6A 4NXZA 4DFMA 4F5NA 2EHGA 1C1CA 1RT7A 3MAQA 4WE1A 2FBYA 1NJWA 1A5XA 4Z6CA 4LZDA 2R8GA 4DFPA 4KTQA 1NK7A 3OGUA 4GXIA 4RW8A 3PVXA 4GW6A 4F2RA 2FPKA 3OYMA 4I2PA 3LK9A 1RXWA 4YR0A 5KFGA 1SKWA 3MGIA 2IS3A 1K1QA 5BPCA 3RWUA 1EKEA 3MEDA 4H4MA 2KFNA 3B6OA 3KHGA 2BHNA 4FLXA 3AU6A 2D5RA 2HMIA 3I0RA 1YT3A 5KFZA 1D9DA 2KTQA 1ZQRA 5HMMA 3F73A 4F3OA 4CJWA 3LDAA 2OZMA 3S3MA 4ECQA 4AH9A 4J2EA 1D8YA 4ELTA 3V7LA 4J9LA 2RPIA 4Q5VA 4Z0UA 3V7JA 3HM9A 4PHDA 4CJFA 4TUPA 4F92B 4KLEA 1B92A 4UBCA 4O5BA 1VSEA 2F1HA 4DSIA 1DTTA 4HCBA 1T3NA 2BQRA 4CF0A 2F8TA 4M0AA 1N5YA 2P66A 4FK4A 3DLHA 3OYGA 3ISDA 3V1QA 1C6VA 1UT8A 1RTIA 3ZDCA 7ICIA 3SUOA 7ICGA 2PI4A 4CESA 1LAWA 2C22A 3EWAA 1TFRA 1JL1A 3QETA 4FZXC 5DG8A 5EWGA 4CGJA 4O3RA 1QS4A 1BISA 4GMJB 1VSHA 4J9SA 2P6RA 8ICTA 1SV5A 2X6NA 3UXPA 4DQIA 4UB5A 4OJRA 3QEIA 4AHUA 4P4OA 4NCBA 4DMNA 4CFDA 4IKFA 4C8KA 3T5JA 4RUAA 4DL3A 4O0JA 4EBEA 4PA1A 3H8SA 4QZHA 2J6UA 1TKTA 4FBTA 3K5MA 3HYFA 3DM2A 2NUBA 2GWSA 4Y1DA 3AA3A 2KZZA 3TFSA 2Q3SA 3PR4A 3ZSQA 2I5JA 4CEAA 1ZBLA 4CGIA 2KN7A 1X9WA 1ZQDA 2RN2A 3GDXA 2BPCA 2GUIA 3OHAA 3ZSZA 1F21A 1MQ2A 4CEEA 4CJRA 3NF8A 4C8NA 3N97B 3DLRA 4DS4A 4M3WA 4OLBA 4F5QA 1JLFA 3ZD8A 9ICWA 9ICTA 4I2IA 4TUQA 3ITHA 2IHNA 5CYMA 5KT3A 1I3AA 4IFVA 3PX6A 8ICHA 3QEPA 5DB8A 4I7FA 1TKXA 4CK1A 3RRGA 1PZNA 2G8VA 3AA2A 4CJPA 4ICLA 3M8RA 9ICQA 2PFOA 1DLOA 2FBVA 5DG9A 4DSKA 1J54A 3HW8A 4FW2A 3H40A 4IR1A 2FLLA 3OS1A 4FK2A 2DFHA 2HHVA 1ZJMA 2BDPA 4ECSA 5DKWA 4JS5A 1IG9A 3ALYA 3KLGA 1RZTA 2OYQA 3SCXA 3V1RA 4F4KA 4ECXA 4DTNA 3RMCA 2DFFA 3U3YA 1XC9A 4YVZA 4YMNA 5HBMA 3VQPA 3MXMA 3GIKA 5I42A 2KFZA 4KLMA 4RQ0A 2BPFA 4KLIA 4HTUA 5KFWA 3IRXA 4FS2A 3PW7A 3RJIA 9ICXA 7ICMA 4O5CA 1XI1A 3RB4A 2FLNA 3V9ZA 2Z1GA 3DLGA 4O3QA 1ZQQA 3RTVA 1KVCA 3PV8A 3WNHA 5HROA 1Z00B 3AVHA 4PGXA 3TWHA 9ICOA 2BANA 3NCIA 4RT2A 3SQ4A 3C2MA 4ECRA 5KFKA 4FJ8A 4YD2A 4C8LA 1XSLA 1UA1A 1JLCA 4MFBA 5D46A 5DBBA 1NJYA 4K4IA 5FRNA 1HQUA 3M9OB 4GLXA 1ASUA 1VSKA 4IBNA 4M3TA 4CERA 3HPOA 1QSYA 4ECYA 5KT2A 4FJJA 8ICAA 2XHBA 4M6WB 5EU7A 4IDKA 4RQ6A 2G8KA 3G0ZA 1JXEA 3K2PA 1B43A 1S1VA 1WSFA 1NK5A 1TK0A 3VQ8A 4YR3A 1WAFA 3LALA 4CFBA 4O3OA 3AVFA 1UAXA 3N4MB 3L2RA 2H5XA 3SJJA 4YN4A 5JS2A 5HNKA 3JPOA 3V1OA 3V9UA 4O4GA 1BPXA 3MXIA 1VSIA 3V4IA 4FLTA 4B9SA 4ID1A 2WONA 5KFEA 4UAZA 1L3SA 4CJSA 4CIFA 4MEYA 4PHEA 4RNOA 4CHOA 4CHQA 5KTQA 3CG7A 3KJVA 3LP2A 1JMSA 3D0PA 2XY8A 4MF8A 5J0PA 3JPNA 4DL4A 3KD5E 3E01A 3MABA 3T1AA 3SI6A 4M9JA 3NE6A 2DTUA 4GXJA 3OVNA 1Q9XA 1U48A 4G3IA 4HVJA 2IA6A 2HHWA 3ZSRA 1EXQA 3NAEA 4E19A 4CF8A 5DGAA 3IM1A 1R0AA 2UVVA 3A2FA 5KG7A 3GIIA 2IC3A 3AVIA 3VQAA 2B5JA 4H4OA 3CFRA 5DQIA 4UAYA 5KFTA 4Z6EA 4E1NA 1S1TA 4CIGA 1TK8A 3RB3A 3M8QA 2Y1JA 1CZBA 4UB1A 3OYHA 4KV8A 2R7YA 4CF2A 2I1QA 3NBPA 5DB6A 1ZQNA 3Q8SB 8ICUA 1NOYA 1ZQCA 4PY5A 4N76A 4M9GA 4XUSA 2ZUDA 4ELUA 3H4DA 4W5RA 3HJFA 4DQRA 1ITGA 2QKKA 4CJEA 3NFAA 3OYFA 4DL7A 8ICFA 1HMVA 1UOCA 5KG3A 3RJEA 2XCPA 4FJ7A 4JWMA 5CYQA 2X6SA 2YNIA 5HP1A 3EY1A 7ICJA 1ZQTA 1S97A 1RBRA 2G8HA 3LANA 3BGRA 4OLAA 4YG2A 3ZSWA 1RPLA 1ZETA 1LV5A 4DOAA 3HP6A 3O4QA 4CEDA 3T3FA 4KTWA 1YTAA 2JLEA 2A1JB 4R64A 5DBAA 1SUQA 4E1MA 1ZQMA 3CM6A 3ZT3A 2PFQA 4DLGA 2C28A 1T8EA 1U4BA 8ICQA 1IXRA 4OGEA 3V6KA 4CJLA 1C0TA 3MR2A 5IINA 4G1QA 4UBBA 4UAWA 3QERA 3D45A 3VQEA 1EP4A 2VWKA 1ZQIA 3LZIA 2A1JA 5KFBA 1KEJA 1HUZA 5KT7A 4E7JA 4KN4A 3C21A 4Q44A 4QZGA 5I3UA 3QE9Y 4YQWA 2MUTA 5HHIA 1XSPA 4ED7A 4IQUA 3DLBA 1JXBA 3QINA 3LAKA 1VSMA 4ED6A 4CJ5A 2Q0ZX 3QEVA 1BPEA 2NRZA 4M9NA 3AVJA 1X9SA 4EBCA 2IGIA 2YV0X 5IIJA 4FJLA 3QNNA 3S3NA 1IKXA 1C0MA 4CJ4A 5KFRA 3B0XA 5HP4A 4PPXA 4DU1A 2VG7A 3GQCA 5J2NA 4ZTFA 3PX4A 2AQ0A 5CWRA 1JL2A 2RKIA 4F5OA 1WSJA 4N56A 4DFJA 4H8KA 4HUGA 3RR7A 4KLGA 1B22A 2ASLA 2Z1IA 1BIZA 3L2UA 2ZTCA 4E7LA 4OKJA 3PR5B 3VQ7A 1HYZA 4KHQA 1LWCA 3ZDAA 1TAQA 2FPLA 3T5KA 4F3TA 4FW1A 2W9AA
chains in the Genus database with same CATH superfamily
3IGVA 3AA4A 3TAFA 4CF5A 1FRHA 4MYTA 2WOMB 4I6MB 3G71N 4B3OB 2P9PA 3CCUN 4CLSA 3JYTA 2PXIA 3V6JA 3SPYA 3Q8QB 1N63A 1N60A 4OYIA 3CJKB 1VQNS 2KHQA 5HSPA 3ETLA 3AO2A 4M9LA 5ALPA 5E41A 8ICYA 5DB9A 1N5VA 2UU9F 2NO4A 4DPWA 4X4SA 2PFPA 4NWIA 2OPQA 1U1OA 5LJVA 3NOGA 3H2LA 2R7UA 2ZQBA 4FPRA 4H54A 4KGVB 4BREA 2XI9A 4CO5A 4DR7K 2QX0A 4KTZA 2VOPA 4XK8C 1Q81O 2CPZA 4QZ8A 5AI9A 3G6XA 3P5BP 2B3TB 2YX1A 5A2QO 4F4XA 1XNRJ 3EPGA 1S0NA 2IM1A 3VAFA 1TKDA 1ZQEA 4L3NA 4IH6A 2LVWA 4C11B 2QWRA 2AT1B 4I29A 4EFHA 2OFGX 4X66K 5ETPA 4KITB 1Q8KA 2DNHA 4RO0A 4HUEA 4TVAB 1Q1KA 4P73A 4KLDA 3OTOK 4OX6A 3D7EO 2KXNB 2KHOA 2ZH1A 3V72A 5I9EB 4F91B 1S6QA 4WQ5C 5IIIA 3UPFA 2ASDA 4XIUA 3FNNA 4BGAA 4US8A 4XQ8A 2VG7B 3D66A 1XMOK 1S1UA 4C0BA 4DU7A 3ATVA 2CQBA 1MMDA 4Z4HA 2NLWA 3KFUF 3GPAA 3KJNB 5KPZA 3TPQA 2HI0A 1UAWA 1Q8BA 1NGFA 3SDEA 1WUAA 2B4JA 1S7HA 4OZNA 1WCNA 1RDCA 1ZM3A 3M5RA 4DN9A 1NHUA 3QUBA 1UFKA 4W90B 2ZGZA 5KPTA 3FZKA 4URSA 3MD3A 4XH4A 3AN1A 3VQTA 3AGKA 3IRWP 4RG8A 1WSRA 3KK3B 4IRKA 3JAMU 2QB0A 4I67A 4Y0WA 5FLXY 3K9JA 4JAXA 3FFIA 4DFDA 4KMOB 5AKEA 3MMAB 3KUHA 1NJIO 2QW9A 1WCLA 2CPHA 2Z2MA 4F4ZA 4PKHA 2K4PA 3NS6A 3EZOA 2ZZTA 1M5PC 1EKSA 1ZBFA 1I94F 2QLXA 4CO3A 3FRYA 3GU0A 3LDQA 1ZQBA 1PAEX 1D5AA 3HXMA 4RQ3A 3K1RB 5HI7A 4ELVA 5J0QA 1TL1B 4ILRA 2QV6A 1MLAA 5DGBA 4YCXA 1Y00A 3ZCMA 4LF6K 4FYDA 5L8RC 5DQHA 2XGQA 1O51A 3G86A 4ZPBA 4CLZA 4BDZA 3L7OA 4DF4A 5HQ8A 4FP9A 3KHLA 5LM7E 3UDVA 3TSQA 2XS5A 3A5MC 3J7ZO 3C23A 5F0WA 2DY4A 2E7XA 5B7WA 3WKDA 5JS1A 3O0FA 1S0VA 3OY9A 2LEAA 1G2EA 3M6VA 3V6HA 4QPXA 4H0VB 5C5JA 4W5QA 4DV3J 1RA7A 2CQDA 3OYAA 1S99A 1I5OB 3MGVA 2Z1HA 1FDDA 4I2QA 4LBIA 4XA5A 2HHPA 4FCYA 2NNWA 2OEHA 1Q86O 1JX4A 3ISBA 2Q0RA 1RBUA 2OMOA 3O9TA 3GE1A 3JPTA 4DV7J 1S9GA 3OTCA 3EN9A 4Z6DA 3RH4A 1GLLO 3ILJA 3J80U 3HT0A 2DXFA 3IO1A 3M6KA 5IC4B 5ADXA 2XQCA 4RW8B 2PMHA 3UO0A 1WSVA 1BDGA 3CCJN 1S10A 4ZA1A 4XEIA 3OYIA 5KFYA 3WX8A 3GIJA 4N41A 3VGUA 3ED5A 1JLEA 3BQ2A 3OW2R 3M6WA 5ALFA 2H3ZA 1KAYA 2HRTA 2RB7A 3KLEB 3SR6A 2OHDA 3A8IA 3QSIA 1LW2A 4DBQA 2J6SA 3TKAA 2FUG9 2D3O1 3F56A 1Z26A 5BRHA 1X3MA 2MDAA 4DUZF 1G3OA 1RTJA 3CC2S 2VG5A 2NUUG 1KDHA 1UKUA 5J2PB 1JWWA 4K4XA 4OJ6A 2RSQA 2BKEA 2P35A 2CA9A 2FHMA 3PO4A 5SZTA 4NYOA 3QU7A 8ICGA 2M0GB 3SEOA 4KKOA 1VBYA 1TUWA 1TYQB 8ICJA 2WB1C 4BUGA 1FFGB 3DXKB 2WSCC 2XM3A 1FX4A 3SYZA 1HPMA 1KD1O 4K4HA 4ZHRB 4YOTA 4MTPA 3NGUA 4F71A 3HPHA 1RT1A 2DGSA 4CWBA 2EX3A 1LOTB 1DBDA 4QZAA 4LF8K 1U1QA 1KC8O 1HW8A 3BGOP 1S1XB 3F44A 1H7XA 4PWWA 2YY3A 2H9ZA 5HRSA 3VAMA 3NF7A 5IIKA 2GTDA 2E8NA 3M8PA 1FX2A 2MKCA 4LFAK 3RB6A 1QAYA 1N48A 3OYDA 1EETB 1D3WA 4RUCA 1Q79A 2ERRA 3PRBA 9ICCA 2OUGA 4P72A 3L3CA 4FJXA 4LRCA 4ZMMA 3W3DA 2VG6B 3MECA 5FPDA 3H8YA 4QNLA 2OKQA 2F8SA 3KLIB 3RMBA 2HNZA 4K5RA 5FP0A 4J9OA 4A46A 1N6QA 1SC3B 4F50A 2Z56B 1OXJA 5IV4A 5IILA 1FJEB 4RBVA 2HSTA 3K5OA 1BMQB 4ITSA 3K8WA 4IFYA 3FE1A 3VN5A 3MEGA 1JJ4A 3MFIA 3TOQA 2FJXA 1F9FA 3FQLA 4PJ0U 4LF9K 1LXNA 3GIRA 4YS2A 2CQ4A 2CWKA 2K4HA 1S59A 3WKAA 5HMLA 5AM2A 3GLJA 2ATCB 5ALQA 3U3GA 3T7ZA 2C2KB 3PYDA 3JQMA 3UR3C 2QL5B 4RQ1A 3HJVA 5KFHA 5GADP 4K5SA 1P27B 3KK2A 3NP5A 1PVRA 2HVEA 3VGKA 5HVFA 2E1EA 4JV2A 4AL5A 4M42A 2GZOA 3JPPA 2L41A 1NBEB 1A5WA 3P5JA 5GTIU 1S48A 2P9LA 1VLOA 1S1WB 3C6TA 3KG1A 4ICLB 2JH7A 2YX7A 2K60A 1RBAA 5M2RA 5HVHA 4NI2A 2EG2A 3AD9C 3KJQB 5DDOC 2HHHK 3NAIA 2E4LA 4CRJA 2BR0A 4UOHA 1FJGJ 3O08A 2XO7A 2E8PA 5EWEA 1MNEA 3PNCA 2J9CA 2ZJRQ 5DLFA 4HCCA 4YXMA 4MDAA 3H7HB 3BR8A 4KQZA 1J5EF 3PKYA 1WACA 2HQFA 1GOBA 2B9YA 3SENA 4YOXA 1YI2N 2JEGA 5L1JA 2IY5B 1FFUA 5KFIA 3W5YA 1IIPA 2RQKA 5IOLA 2P8IA 1RT2A 4F93B 3DYAB 5HJYA 3V81A 4CH0S 4I6WA 2ITGA 4DV6J 4RW4A 4TQRA 3MWBA 4CCHA 1JRPA 3NF9A 2KM8C 2GV1A 1HNXJ 1ZBSA 2KU7A 3QEWA 1MN7A 2JR5A 2D3OR 3RH6A 1KEKA 4I6MA 3MCMA 4KI4A 3I0SA 2WF5A 4FM2A 4YB7A 1U1LA 4M8LA 2GV9A 3H5SA 2VG6A 3UMGA 5ALVA 2B6AB 2KP7A 3I96A 4DV2F 4Y3CA 3GFKB 4DOCA 2XMAA 4KLHA 2CG4A 3K75D 1H98A 2OA8A 1EX4A 3IWXA 4DMZA 5E3AA 1MN9A 2XHWA 1VRTA 3NNAA 4MN4C 3OXFA 1SBRA 2JC1A 3IM8A 4R5PA 2C3PA 5K8NA 2GMLA 3B78A 3SMSA 4Q8FA 4ETZA 1ZQZA 4X2BA 4DV0K 4DSJA 2WFAA 3ZETA 2F8HA 4KC5A 4KLTA 4KHUA 3R1XA 4EZ6A 4HWIA 1ZYQA 1YJ9S 1FRIA 5C2CA 3UE5A 2RF2A 3L6QA 1ZXIA 3WXKA 1U8SA 3D6MB 3UIQA 4K4WA 4CK3A 4MYUA 1MROB 4EENA 2JGAA 2W25A 3IUCA 3R27A 3OS0A 4P2HA 5DZ7A 4CEZA 3IAYA 3M1VB 1L8OA 2BPGA 2BV3A 1GXUA 2AJFE 4IDHA 4H4KC 1VQ8S 1WF2A 1NPPA 3IWLA 3P31A 1TTHB 2AWZA 3AHPA 2YBVA 5A0YA 3QZ7A 5E7OB 4Y1CA 4OX9J 5AQNA 3IHQB 2YKNA 3HHKA 1UCVA 2A1SA 1SB6A 1NOMA 4JB3A 1WOPA 1TL3B 1Z4UA 4E1JA 4NXMF 3CC7N 3W2WB 4H5WA 4QIEA 4J2BA 3R9KA 4WZQA 1NZ8A 3CWJA 3P5TL 3MM8B 2ZUCA 4ECZA 2HBLA 2KZ3A 5F3ZA 1RU2A 3UPQA 3BQTA 3EPIA 4WFYA 5RUBA 5AI8A 4XPEA 1DZ5A 5T7BA 5G5HA 3VF2A 3VEYA 3QFPA 4RU9A 3NS7B 1G15A 3TTFA 4NLRA 3HD2A 3M6UA 4RW6B 3UMCA 2B4PA 4X4RA 1CJUB 1GTEA 4IEIA 2ZD1B 2UVRA 1U24A 1NZAA 4P75A 4NJ8A 1ATNA 3MI7X 5CA5A 1TK5A 3CCVN 1URJA 4I56A 2P5GA 1XNQF 3ONNA 4B3RJ 1WSHA 2R7TA 4Y2AA 1RYRA 4I28A 4RWTA 1N5SA 3OJUA 3N6MA 4M3UA 4NXNF 4OYMA 4WYLA 4Z7YA 2UUCK 4X62J 4DPTA 2AA4A 5J1EA 3EDRB 3CFPA 1GT8A 3AVNA 3RRKA 2W01A 3TZXA 3ZDBA 1RWNB 3CCTA 5IC6B 4LY7A 1ASWA 3EVOA 2RQ5A 4K8ZA 2E9TA 3C15A 3NRBA 2GMJA 2XTJP 4I1TA 3KOOA 3M8SA 3MGHA 3ISNC 2CRLA 4I6YA 2HZVA 4HI1A 4O5KA 2LU1A 2ZM6K 1WF0A 1OQ6A 4FJNA 3P6YC 3VQ6A 1A6LA 3ENVA 4JI3F 3O9UA 4FE3A 3M6XA 3L2QA 1HQEB 4FLYA 4Y2XA 4ZJOA 1CSJA 3T9NA 4KB7A 4HAIA 3ZSXA 1EWQA 1N34F 4C3MA 4CEFA 3LDPA 1HIWA 3A12A 2EEYA 1MC8A 3I6PA 3TQ1A 4CTAA 2KJ8A 1VI7A 5CQGA 2ESEA 1VQOS 2P5VA 4ED3A 2DNLA 1ZQKA 2P9SB 1URRA 2HZAA 2HBMA 5CRXA 4CNQA 1IKYB 4OCZA 2FF3B 2QA4G 2PA3A 2QMXA 2XYPB 4F26A 5D4BA 3SQOP 2FLOA 4NZ0A 1TAUA 3WEEB 3AVGA 3BDPA 4K8XA 4ZVPB 1ZM4A 1YSJA 3Q2SC 4P7VA 4AQYK 2HDOA 5AK6A 2W3RA 1WUUA 1OUQA 2OH2A 1MWKA 3NVWA 2KH9A 1JALA 2G06A 1QZ5A 2LECA 4PAAA 1TVAA 5AE1A 2WB4A 3C8YA 2NREA 2DHGA 2ZIUA 2K3KA 1JN3A 1S0OA 4WQ5A 3GR1A 4NMLA 2XRIA 1VQ7N 5J0UA 3FBBA 5AXKA 4DHYA 4KH5A 3AO1A 2AYMA 1C0TB 2UXDK 3LO3A 1CVJA 3SBTA 5AQQA 4OHVA 4OI6A 4D3GA 2QFJA 3R1HA 4YD1A 1HWUA 2GNKA 1IWGA 3G8TA 4ZTJA 3HX9A 1NOZA 3IS9A 2BCUA 2KQ2A 1SPBP 2ZJQL 4YB6A 1LWCB 3RJHA 2L9WA 2CKWA 8ICLA 5GMDA 1NUEA 3ZLJA 2MAXA 2G1HA 2E3TA 2BGWA 3O5TB 3MM7A 2O3DA 3L3UA 1I39A 1IBMK 4PQAA 2GLEA 3SUNA 4OGCA 3M30A 4ZH4A 3ULHA 4ZVQB 4FO0A 3BKTA 1IKXB 2KJWA 4ZN3A 5E79U 4M5NA 2F9JA 3QMQA 2VANA 1WWHA 4JKHA 4KGKA 2IAJB 3I31A 1HYSB 1M5SA 3VQCA 1RWPB 3GTYX 4LRFA 4DV7K 4KGZB 5B8HA 3RJKA 3GILA 2LA4A 3B0YA 1K47A 5KFAA 4IQVA 1PAUB 4Y2PA 3CC4S 3OYCA 2DNGA 2CJXB 3F9KA 7ICTA 4NXMJ 1L5UA 5BRDA 1VSLA 4QW9A 4CJUA 4P4PA 3TANA 3ITHB 1WORA 3EVMA 2G5IB 1OYDA 4ILJA 2RUGA 1ZJNA 3M2RA 4TQSA 1JCGA 4OI0A 5ALEA 4RPXA 4USAA 2EZXA 2LDYA 2IC3B 1X8DA 2R2RA 5J0RA 2QWOA 1L7MA 4UAUA 2MZQA 1M5KC 3N7RC 4AHVA 4KIAA 2CZ4A 2VIHA 3MHYA 3THYB 3G6ES 4ED1A 1CULB 4JKCA 4QR1A 2WF7A 2DGQA 1O08A 2EW9A 1U1MA 3S01A 3PX0A 1SJ4P 4G6VB 1CLQA 2HLUA 2VF3A 3TZZA 1K44A 1XS9D 3HD1A 5DK5A 2V2KA 2ABYA 3H8JA 1GMVA 4NO7A 5AIAA 1M5HA 3U02A 2CXEA 1PSDA 4KAIA 3DLEA 2O8CB 4LRBA 1SJRA 2DR6A 1MU2A 2QLJB 2KG1A 4J9KA 1EQ0A 3FMBA 2DXDA 2RQMA 2N4DA 2WVEA 2R7SA 1YRTA 2Q66A 2C2EA 3I9ZA 3AA5X 3O3GA 5AJ3F 2YJFA 2OFHX 4QIFA 9ATCB 3MWPA 8ICPA 4NLKA 5L38A 1S72S 4DV1J 3A0IX 2CJ9A 3JSMA 2W11A 5AM4A 5ALLA 4DV2J 3TUZC 3CMAN 1VQPS 5KAIU 3F2BA 5HRPA 2LEPA 4OI1A 2E2OA 4I2HA 1ZQXA 1CG2A 3FZFA 3CF5Q 3HFVA 4R5PB 4DR4J 2ZDOA 4OX9K 1NSPA 4B9VA 5LY3A 3RZAA 2F76X 3S1TA 5J8YC 4JI3J 1SB3C 2QM1A 4LR9A 4CF1A 9ICAA 4G65A 2P9KB 3WXJA 1R8HA 1ATRA 3ZEUB 1W2BR 4YOYA 1NZBA 2PMZD 3NBPB 1VRQC 3OYLA 3J7A1 5D4LA 2BJ7A 4MF2A 3M32B 3H20A 1FKOA 4ILMA 1BUXA 2ETJA 2ZBIA 2PFNA 2HGLA 1TR0A 4OHZA 4M41A 2GO8A 3T5HA 5H9EJ 1S72N 9ICMA 2J7UA 1F3FA 1IO2A 4KFBA 3OVBA 3LM2A 4BR2A 1Y88A 1GQEA 3V4IB 3U1MA 3IG1B 3V81B 1K73O 1UVLA 4NA3A 3C66A 4PKDB 1HI8A 3SQIA 5KFNA 5GAGP 1RACB 1HWKA 1RDUA 1RSCA 4YB1P 2VFVA 1FCAA 3MCPA 4DCOB 4JI0K 4I9LA 1RUSA 1DFDA 4P7TA 8ICEA 5IIOA 1IR2A 1T05A 4K42A 1ZTWA 1ZQVA 9ICNA 4DUYK 1OKJA 1NGBA 2M52A 3B9JA 4NOHA 1K0TA 2M5YA 5T7LB 2EBGA 1CLFA 1L8LA 3VPZA 4U8VA 4O4GB 1VHIA 5IS2A 2BQUA 2GGPB 5C2GA 3ZT4A 5CB1A 1F9EB 2BCVA 5AQRA 5TISU 1E6VA 1JIHA 3MDCA 2YWWA 1S1VB 5F8IA 2ADBA 2DFEA 2QARB 4P0QA 4MK7A 3QLHB 4HACA 4BVOA 1NEEA 4QZCA 1WB9A 1LKYA 1PK1B 4AD6A 2K8CB 4RPYA 1FERA 4F3QA 2BH1A 1RXVA 4PL8A 1KXPA 3U9ZA 1EX8A 1UWBA 2E5LF 2XG8A 4R65A 2P9CA 2CVIA 1X4HA 1H2TZ 5DM6L 3ZTPA 1U6FA 4B3TK 3TAQA 5HBMB 4FJ9A 4IOAL 2P6UA 5EXWA 5BYSA 2IIRA 3GYNA 1SZPA 4YP3A 1Z25A 2Q6BA 2ISOA 2ZH3A 1KC8T 2FZKB 4RQ5A 4PHAA 1WKLA 4EP4A 4DHVA 2YPYA 1N6QB 1HJPA 2PKEA 4N7TA 3VA0A 3WNFA 5C24B 4JK7A 2G8IA 2HNZB 5CD4H 4HEA9 5ETTA 3W7BA 1DJ0A 4URQU 4KYZA 2CFXA 3ZDEA 3KKSA 1A7GE 3GIMA 3WKBA 1S7IA 2V68A 1FE4A 1YJNS 4FM0A 4AYBC 4F5PA 2P1JA 1X42A 1WG8A 1PBUA 3AB2B 1HBNB 4IG3A 2K2PA 3MK6A 4OYZA 2A41A 2CPYA 4QOZB 1FRMA 4NXZA 4TU7A 3GJRB 2V9KA 2EHGA 4NMXA 2MQOA 2VDHA 4UTGA 5ETNA 1WI6A 4XTTA 3J7ZT 1BE4A 2K8AA 2W2PP 1NJWA 4I69A 1VQ7S 5ALDA 2ZUAA 1R8CA 2DH7A 5B0GA 3K0JA 2D6FC 5HQLA 2V8GA 2R8GA 4CBWA 4KTQA 4YY3K 2WF8A 1AFIA 3R6LB 2VU5A 3LGMA 1UEKA 5AI5A 1BA1A 3PVXA 5AT1B 1CBKA 1N33J 1TV6B 1RXWA 1ATSA 1SKWA 3MGIA 2QWLA 3QU5A 1K1QA 5BPCA 4P0PB 3MEDA 5AQGA 3B6OA 3LQVA 4DV1F 1F5BA 5H1SQ 2HMIA 2GX9A 5D78A 1YT3A 4F0HA 3KKAA 1ILYA 4F3OA 1OO0B 3N4PA 3LPEA 2OI2A 3LDAA 4DUZK 3TVYA 4J2EA 3BEXA 4ELTA 1SV5B 3UKUB 1FNOA 3W1YC 3PSFA 3HM9A 1IM6A 1JLEB 5E33A 4Z0UA 4CJFA 2W41A 3CMEN 4UBCA 1VSEA 3M8PB 4OX7A 1HBMB 4WF9L 2WTUA 1ZD3A 3D4JA 4LF7K 3ZTQA 3R8YA 4CF0A 2RRBA 1PUZA 4YEAA 3P4IA 1XERA 2HSEB 4EK2A 2RQ4A 1CJKB 1YVNA 3DV9A 1VQMN 1C6VA 4LSZB 7ICIA 4F0MA 2NZTA 3SUOA 2A10A 5E5NA 7ICGA 4CESA 4Y0FA 2C1EB 5JVHQ 3QETA 4CGJA 1T9VA 2MZJA 3DGPA 2DGWA 2A3VA 4KKOB 4GMJB 4DV5F 1BQMB 2X3DA 2KJVA 2M88A 4FNHA 1SV5A 2E5IA 1SQEA 2EQYA 3C6HA 2LA6A 3JTPA 4UB5A 3EDQB 2YQ0A 2H5IB 1MU2B 4NCBA 4CFDA 2ZUGA 4DR6J 4A8XA 4C8KA 3C29A 3H0PA 2AZ1A 2E1CA 5IQQA 3B54A 4DL3A 3H8SA 2J6UA 1XK8A 3K5MA 2BJ8A 3L0QA 5GINA 3EZUA 3PIPL 2E8OA 1N54B 3FC4A 4OZ3A 3KHYA 1EQMA 3AA3A 3CIZA 3ZSQA 3UNYA 1ZBLA 2ALYB 1AT1B 2DQNB 1NGIA 1X0PA 1ZQDA 2RHQB 1J97A 3EO3A 3GDXA 1GO3F 4U9RA 2GUIA 4ENOA 1EHWA 3MM6B 1F21A 1QQ5A 2QZ8A 3BUZB 4C8NA 4BHQA 4DS4A 2LDIA 5AQJA 1DTQB 3ZD8A 2CNNB 2EAOA 1RI7A 3QGIA 3W8GA 3CCLN 2LM4A 2ZWOA 3ITHA 4M63A 2WBNA 2QWMA 5KT3A 1R31A 5A2QU 8ICHA 3QEPA 2Y0SF 5EHHA 5BREA 3RRGA 4P0PA 1PZNA 2VJ5A 5B0FA 4FF3A 2J9DE 3M8RA 4FKYA 5DG9A 1HWJA 1S5LU 2LXUA 3Q8YA 2CZ9A 2W2QP 1J54A 4KY3A 3H40A 1SJ3P 2DFHA 2GVDB 2DNZA 2CJYB 1ZJMA 1R0BG 4ECSA 2GIQA 4WFNL 3ALYA 3KLGA 3FUYA 3RMCA 3PJXA 3R9PA 3CE8A 3U3YA 1HIYA 1RCXB 4YDDB 3E51A 4E2FB 1WTFA 2D7SA 3GIKA 1VC5A 1KKXA 2LLZA 4K4TA 4BRHA 4KLMA 4RQ0A 2OM6A 3EMTA 3PW7A 3RJIA 4GV3A 4O5CA 3NY0A 1RADB 1RAAB 1SH2A 4PZOA 2XVTA 4C23A 3L4IA 1ZQQA 2VGMA 4UZCA 2UXCF 2PMZF 3PV8A 4JI7F 3SMPA 3WNHA 5HROA 1KN6A 3AVHA 3TWHA 4RT2A 3SQ4A 4WP8A 3JAMO 5AQFA 4YD2A 2WW4A 4OZLA 2DGXA 3FCVA 3PYFA 1AUSL 3OA9A 5D46A 5FRNA 1KWMA 1ASUA 2WUSA 2OCEA 3D1OA 1VSKA 3AOBA 2DNNA 3FK4A 2RKIB 5JU5A 1QSYA 4ECYA 5BYQA 4FJJA 4DPYA 4H5TA 2XHBA 1JLQB 1RTDB 4RQ6A 2X1AA 2UUBJ 1FT8A 4BRAA 1JXEA 3BSNA 2X7IA 4UF4A 1UHUA 1WSFA 3BV8A 1DKGD 4Y28C 5HATA 1WAFA 3NUQA 1SKUB 4B3MF 4O3OA 3L2RA 3SJJA 2OEKA 1IBMF 4YN4A 1Y7PA 4JI8F 3JPOA 2OO4A 3CEDA 3QUCA 3LF0A 2BE9B 3MXIA 4WFZA 3ZTOA 2A42A 2HBYB 3V5RA 1XNRK 1VSIA 2Y9TA 3V4IA 1YI2S 4UAZA 4CHQA 4PHEA 5ALXA 3CG7A 3KJVA 3LP2A 3I32A 3LVWA 3QIDA 5GAEU 3B6BA 5IWAJ 4A5BA 4A5AA 1V4SA 2DNRA 4MIWA 2ROEA 3ADAC 4DR2J 1OJ4A 4QU6A 2W7AA 3OVNA 3KK7A 4FSVA 5DDRC 3ZZOA 2Y9HA 4EAHD 2D0OA 2IJRA 1REGX 3ZZTA 2XWXA 5DGAA 2W2NP 1W26A 2RS2A 5ADZA 3C15B 2R9LA 1FWLA 5KG7A 3O6WA 3DHXA 3VQAA 3NGKA 2Z0GA 1WELA 2DNQA 3L4BC 4UZBA 3M3ZA 1KHVA 2PSZA 4NL9C 1UPHA 2EK1A 1S1TA 1WDTA 3DU6A 4K7QA 2C2OB 3JS6A 3VCBA 1YBTA 3I56N 3RB3A 3OYHA 3H3OB 3M32A 1OMSA 5CXTA 2HFVA 3NBPA 4C0ZA 1ZQNA 4JI2K 5HMZA 4C7YA 1ZQCA 4IOAQ 4JEPA 5L1MA 4BRMA 2HOFA 3CCMS 4ELUA 2ZUDA 3H4DA 1RP5A 2P9IA 3GJTB 2G2ZA 4NE9C 4CJEA 1RWUA 3H2VE 2KVQE 3OYFA 3T69A 8ICFA 3TA1A 2MGZA 1HMVA 1UOCA 5KG3A 4DDFA 3I55S 5ELZA 2B4VA 2X6SA 4B3SF 1ZQTA 1QVFM 2NSCA 3W2WA 3THXA 1RHQB 4OLAA 2XYHB 4OV1A 4LFCK 4QBUA 1GLDG 3I5BA 1ZETA 5GMKa 3HP6A 3MPYA 2MZ1A 3UDEA 4KTWA 3CDWA 2JLEA 2K4IA 4QQBA 4DV4J 4FXWA 2R7XA 3H90A 3LH2S 4XO0A 1FXDA 1XMQJ 3OFHA 2PFQA 1FD8A 4GFJA 1T8EA 1U4BA 3A8YA 4B1WB 2B43A 4DR1J 1UL3A 1LFPA 3V6KA 4BG9A 3MM9A 2G2YA 1FJGK 4LSNB 4ANCA 1ZQIA 1SV0C 4OLOA 4H5RA 1SH3A 4Q44A 1F5AA 4YQWA 3LP1B 5HHIA 1XSPA 1ESVA 1W2IA 2QWNA 1YRXA 3A5OC 1GLCG 3THYA 2Y1RI 4ED6A 4JI8K 3NNHA 2HF4A 3HLUA 4PPDA 2VFRA 4LF6J 1Q7LB 5AQTA 3NCQA 2GO7A 3AQPA 3FEYB 4CJ4A 1VQ9N 4GVLA 1VBXA 4ZJQA 2GIFA 2DHHA 4DU1A 2OJ3A 2I2YA 4O4RA 2AQ0A 1JL2A 3SBGA 2RKIA 3CCJS 2ILZA 5BRFA 2Q2RA 1BIZA 1DGKN 1NNEA 4AL7A 4B1ZA 2X51A 2H4WB 1EB0A 1DEJA 2I38A 1LWCA 5CAAA 3MN6A 3AQEA 3H1QA 2WZ1A 2W9AA 2J0WA 4AHSA 1ULRA 1SV4A 3PW0A 4DV7F 4JI5F 2UUAF 3I0SB 1C1BB 2QKQA 2IAJA 1HYSA 4X4VA 4WJBA 3THWB 4DU4A 2GC8A 3QBWA 3K58A 3D1QA 2AGQA 2R8KA 2ZIUB 1N36F 1JLQA 2JEFA 1RB0A 2YJEA 2B0GA 1JNRB 4C0OC 3HRGA 4IOCL 1UQVA 4W4MA 1FDAA 4M9HA 7ICKA 2AJ1A 4H03B 4JBCA 2X74A 1DQ9A 2W2OP 4BWMA 4EO6A 1WUDA 2MHNA 3H5UA 4XH1A 1K8KB 3MR7A 3V7KA 1NKBA 2ADCA 4U7BA 3SPZA 3E01B 1GOCA 3E66A 1QE1A 3CGIA 4B9NA 3IBFB 4DTJA 1N5WA 3K59A 4C3KA 2FVPA 1IBCB 4DS5A 3DI6B 5KI6A 4GKKK 5C7PA 3IFRA 2QLBB 3VZHA 3EUNA 4J9QA 5FROA 5AQIA 5FRMA 4CH7A 1GX5A 2CN1A 3MXJA 3PO5A 4GC7A 3IMXA 3ZC4A 2P9SA 3VQDA 2SXLA 5FLXU 1A5VA 3H0LB 2P9LB 5IT0A 3DKDA 2K06A 1KAXA 4WK1A 1T9TA 1Q7YO 2NUHA 1NB2A 1T9UA 3M9NB 1R89A 4MO4A 1U0SA 3R97A 4TYAA 4DCJB 3ISCA 3QUQA 3HHDA 1WG1A 5J0WA 5K5MA 3SAHA 2ZH5A 4ILLA 1TFWA 4ZLNA 2W42A 4WIQA 3EKUA 1H6KX 3AVLA 2MA1A 3MN5A 3FCHA 2CXYA 4RZRA 1VDHA 5K4LA 3ZT1A 2G8FA 4DJBA 4DB3A 4W5TA 3LP1A 3K89A 8ICRA 1IKYA 4GY2B 1XN9A 2RHSB 2ZIWA 4DG1A 1DOQA 4M47A 4AE5A 1ZQPA 3VEXA 3P4UB 4MAKA 1JLFB 3AXKA 3PRDA 3ZSYA 3KLIA 3OQ2A 3Q0AA 3VQ5A 1Q95G 3PZPA 4H5NA 3RG6A 4ECTA 4CI0B 4BRIA 1VMBA 5D0EA 4FWMA 2ZBQA 5KGWA 2YCHA 1ZBHA 2ZD1A 3KFWX 3JSRA 4I2FA 1VISA 3G6YA 3IRXB 4CLWA 1FNMA 2J6TA 4PXCA 2EZZA 4DPUA 2KVSA 3QIPA 1IQZA 2DHSA 4H0PA 3CUNA 1CJKA 3IV6A 9ICUA 2KT2A 5J1EB 4DN0A 2FMSA 2JVOA 4ZN1A 1N5YB 4ZHRA 5ALWA 3QJPA 1DRZA 3LDSA 1SAZA 1GX6A 3QICA 3C2LA 1GH8A 7ICVA 3E3XA 1HBMA 1RQNA 2F8MA 3A3PB 5AQWA 1XMQF 2IM3A 4MFAA 3UM9A 2IRUA 4Y2CA 3HT3A 2GBZA 4EGLA 1XR7A 2AX1A 1PYSB 2K1RB 2HFOA 3ZDDA 2AJQA 4Q7AA 2IHR1 2XCAA 3BBBA 8ICWA 5A8WA 3C1ZA 1VSFA 5FD1A 1X5SA 4QJVA 2OXOA 4B17A 4BLGA 2ZWHA 2CYYA 3BGFA 3OL8A 4IKAA 3JPQA 3KZIU 3SQ2A 1MROA 3PHEA 8ICMA 3ZTSA 2QI2A 4WJ3B 2G8UA 4P4MA 5AXLA 2A40A 1H2UX 2QFIA 5JRTA 2XO6A 4X66J 2UUCF 3O9QA 3UN3A 1MWZA 1Q82T 1KQSR 1KBUA 1GLBG 2FJAB 4UW2A 1XU4A 3N28A 4UT4A 2NSBA 3N9UC 1WAJA 4UB4A 8ICSA 3ZETB 4NZ6A 2O8DA 4OJOA 2G13A 3UKUA 4KH0B 5KG2A 4HHHA 3B6PA 1GXTA 2RQCA 1QY7A 1RT5A 1YJ7A 4H0TB 2XWYA 4JI7K 3MPDA 4USWA 1U04A 3VQ4A 5AM3A 2LYHA 3DEEA 1WKJA 1BD6A 2DBBA 2HMIB 1K6YA 1I94J 3W5XA 4QWCA 3Q8VA 3PY8A 2JGUA 4RQ8A 4CE9A 2IDEA 3VGMA 1O13A 4RWWA 3OYNA 2RF2B 4O8UA 2VJUA 3IP0A 2V5HG 3HFZB 4YXJA 2UZAA 2FSKA 2ZG6A 3CCRN 1VK8A 3LOUA 2VJ4A 2DGZA 3BPSP 4OPJA 5DG7A 3HHLD 4PABA 1IKVA 3CM5A 3MDAA 1WWVA 1SC6A 2UUTA 4RW4B 1RTDA 5D4NA 4US9A 3AVBA 4OZ0A 4BC4A 4JI5J 2UXDJ 1B7YB 4I2EA 4P2FA 5HMYA 3R6MA 4QWAA 4YB5A 2ROGA 3C1YA 4ISEA 4IG3B 2KSOA 5AFUH 3QQCD 2B6AA 3P45B 2QARA 4P0QB 4OX8A 1ZAXA 2V4JA 3MM5A 5DM7Q 4DCCA 2CADA 1NGAA 3QU4A 2APOA 5JJBA 5CZ1A 1JJ2R 1U1PA 5HROB 1X3NA 1Y5LB 4ZDNA 3RSEB 2J5AA 1VOMA 4NL9A 5AM5A 3ZSVA 4CLPA 4K4SA 1ZQSA 4A8YA 2W43A 3G4SN 2C3YA 4FLZA 3VC8A 4PG8A 2LSNA 3VVTA 1TKZA 3OLAA 1RT2B 3DYAA 2UUBF 3GYXB 1XO0A 2DH8A 2KM8B 1XNRF 4MMOA 2YKMA 2PMZC 3AVCA 3NG8A 3KK2B 4KMUA 3TX8A 3CXCM 3U27A 4KLLA 4QZVB 2E29A 1NGEA 3FJ2A 4KI6A 4NLNA 1S4FA 1HNIA 2V6AA 2BM0A 2EFPA 1ZQYA 3BJYA 4ZVTB 4IO9L 2LMRA 4DX6A 4EYIB 5E0OA 3D2EA 3K4GA 1HNWJ 4O3NA 3A3NB 3TJAA 5AI0A 2GVZB 4IRDA 4JI7J 2UXCJ 4DTXA 4WU3A 5IQ6A 4DL2A 3RR8A 1CJTA 2EFGA 1B9FA 1WSEA 4A8MP 2HIQA 1GOAA 4XDDA 2O01C 3BF4A 1N62A 3V9XA 5AI4A 3RB0A 3B82A 4BQLA 3D54A 1QTMA 2FGOA 1LOUA 4JUZA 4CHNA 1LKZA 1N34K 1NSAA 2UV8G 5J2QA 1HPZB 1EKRA 1ZD2P 3N7PD 3IP4B 3FFKB 2DEIA 2HOIA 1M1KT 4YR2A 5EY4A 4EX6A 5E3CA 4CLUA 2YMLA 2AW0A 2W2MP 1M1KO 2CQHA 4CO2A 1I1GA 3L7PA 4AQYJ 1ZD5A 5KG1A 1JJHA 2CQ0A 4BRPA 1U1NA 1KLMB 3W0LA 3OBYA 4PQUB 1AZSA 4P74A 1S77D 1IM4A 3LWLA 1PO6A 4K2JA 4KBIA 3UN2A 5A8WB 3VF0B 2WVDA 4M3YA 2QK9A 2IMWP 1Y11A 5I3PA 2ACMA 2VH7A 3CDEA 5E2QA 3FSXA 4LVSA 1TV9A 4FVUA 2G07A 2CPRA 1L3KA 3CXCR 3GFYA 5ETSA 3H8WA 3KD1E 5IFMA 2XEXA 4JI6K 4PUOB 2JWKA 3D5MA 4Q2LA 3F9MA 1SQGA 4U67L 1MMNA 2CGLA 4KLJA 3P96A 4Q0BB 1LWEB 3CP8A 2UV8A 1ZQFA 2ZH2A 3LAMA 1Y10A 3MBYA 4CZEA 4LUBA 3PIOL 1LK5A 2E1ZA 4CEBA 3VGVA 4DTOA 2JZ5A 1TP7A 2KKVA 3U7JA 3RMDA 4MLEA 1BGXT 3DOMA 4QPTA 3KKAC 5BR8F 3VA3A 1AQ6A 3D68A 3DRSA 1APSA 1S22A 1IV8A 2LKZA 4NYFA 9ICPA 2HAFA 3EEQA 2D8CA 2BE7D 4AYBD 3C2PA 2IOCA 2ZUBA 1YRUA 4CLYA 4H4KA 3U26A 2MQNA 2ZJAA 3WX4A 3QJJA 3TP2A 1WG4A 1ZOTA 4NX9A 1WLJA 1J9AA 2YHAA 3ZT2A 5A0LA 4LIRA 4GV9A 1YJWS 1S49A 3TJ8A 3HP9A 2Z58B 4R0EA 4TYBA 1BL3A 4XH5A 5AQZA 2G0CA 4OZ1A 3RAXA 3DLKA 5KFSA 3H25A 3MMBA 4BR0A 4MK9A 1TV6A 5ALGA 1NM1A 1R8AA 3GU3A 3HSGA 2BQ3A 4DOZA 4K4VA 1RDWX 2YWEA 2KYXA 2BUNA 3IAS9 4DQPA 2FBTA 1VLYA 4JI4J 2HQ3A 2YNIB 4KB0A 5KG0A 3O3LA 1V9PA 5J2EA 2BOAA 1S9GB 3M30B 4E7IA 4USIA 1FXXA 4JLHA 2QWPA 5D8HB 3OSPA 2FC0A 3A5NC 4QZBA 3HJEA 5DJBA 4CZFA 1NRKA 5EVZA 4KLSA 4OPKA 2YHWA 4R79A 3PACA 1RWWB 2RRAA 1ZQUA 3CPWM 2C42A 5B0DA 3NLCA 3QT7A 1B3TA 1HBNA 1Q16B 2E9RX 3KWGA 2GFFA 3UD3P 3G87A 2DGVA 4GIBA 1XMBA 4MQ3A 3NVZA 2LP4A 4JS4A 4ANEA 1SGGA 3AQFA 1B99A 3N4QA 5C24A 4GVMA 3SZ2A 2KXFA 4UASA 3PYEA 4QWDA 2QB0B 4YUDA 1SIWB 4M45A 4USTA 2FYXA 5J1NA 1C2PA 1QQOA 2YVSA 2ASOA 1HYVA 4NV0A 2F1FA 2VA8A 4CO1A 3C6UA 4TU9A 1Q82O 2FMQA 3VR1A 4GV6A 4PWDB 4DTPA 3NGDA 1U2CA 3MOJB 1KVAA 1D09B 4YMEA 1H7WA 1RWMB 1NGCA 5GAEI 4DSEA 1N36K 1V3RA 2D0BA 1W2BM 3IS9B 4FYYB 2ZH8A 4V1Ak 4DR1F 3THTA 2E1FA 3THWA 4YN3B 1EAYC 1MA9B 3CCLS 4DR4K 3KG0A 2EC0A 1NAQA 1BI4B 2ALZA 3H1VX 1OH7A 4DF8A 3KK3A 3CD5A 2RVJA 1TL7A 4QZ9A 3SLCA 2YPZA 1CS4A 4CM2A 1RHRB 1ZPWX 1X1PA 1RKIA 3IC1A 1RCHA 3ZZUA 4LF7J 4DTMA 2JLFA 3TA0A 2AEJA 2HMPA 4BC5A 2PY5A 3M6ZA 1JKHA 3EJMA 5IT9Y 1Q3VA 2JRZA 1XWLA 1QSLA 2MZTA 2ZC4A 3MN9A 3PKMA 5ETVA 1FW6A 1S6PA 2KVCA 1TUGB 3ZD9A 4O55A 3I28A 4Q43A 4RNNA 4YOEA 5H2FU 3P83D 2QSWA 2M9NA 1KVBA 4OO1J 4X84A 1XMQK 3O1WA 3WKCA 1GLEG 2HRYA 4BVPA 3Q24A 3AAQA 3CJ7A 3QAEA 2UUWA 1K0VA 3NGRA 4KFBB 1HA1A 1DK3A 4BE0A 4HHJA 2Z2ZA 3MD1A 4ED0A 2A1RA 7ICUA 4OKKA 9ICEA 3IR6B 4OZ5A 2MPUA 3R5JB 2L5YA 1N56A 1C1BA 3P39A 4JV0A 2HHQA 3N79A 3LP0A 2KK0A 1VQMS 4JV5F 4PGYA 1SUQB 1NK6A 2AJ2A 2NYHA 4YMOA 3WT0A 5AQSA 3TSUA 2XZWA 3GV8B 3K7RA 3I8BA 4J37A 1S79A 1LVHA 3MPVA 2XY6A 2DT9A 3KBBA 5T41A 1WTBA 4IQXA 3BR9A 2FBXA 2PFDA 4YDUC 5HR6A 1NLVA 4D3HA 4FWRA 4GVBA 5HMWA 4BY9C 4IUFA 4P10A 4IQTA 1JLBB 3PMLA 4LF8F 4KHWA 2QTWA 4L76A 4AHCA 1ZA1B 3O80A 3LUYA 1CQMA 1QHTA 2Y1LB 2DRBA 5J2BA 3JSMB 1DY3A 7ICQA 1A77A 1JI7A 1TQLA 2LXIA 2FDRA 2PZSA 2MUTB 4CHZA 2AP1A 4LF5J 5HJXA 2BJDA 3M6GA 3OTBA 4RW7A 4URGA 4LSNA 2QRRA 5HN0A 4ZVEA 3RMAA 3AAWB 5KOXA 2GCFA 4DX5A 2IYGA 3TW0A 3GFXA 1NNDA 2XY5A 1KN5A 3CJ8A 3ZZZA 1T03A 3AOAA 5HLFB 5IM0B 3ZO7A 1C0FA 1J2NA 4FWQA 1VYAA 1ZQOA 2BM1A 3UDLA 3UQSA 3B4MA 3SJHA 4V19S 3PSPA 2J7WA 4E98A 4EUVA 4A47A 1GLAG 4B9LA 3W2VB 4LFCF 3OTQA 1IG6A 4KLOA 1S9EA 4YDXA 5I4MA 2CQPA 5B66U 2OTLN 4ZS6A 1YGYA 2CGJA 2GAGC 1X4FA 1TKTB 2OIHA 1U02A 3ZT0A 2EVZA 1VIXA 1EXNA 5L39A 1EP4B 1PC5A 1RM6C 5TKYA 3CIPA 3C95A 4MIBA 1C0UA 1T03B 4O9MA 3OFFA 1QUPA 1GMWD 4FZMA 4N5SA 3LP2B 4G1IA 4M04A 5BN9A 4FJ5A 3I5AA 1T02A 4UY8O 1HWIA 4J9NA 4QW8A 2ISPA 2OP5A 1W97L 2JFKA 1T11A 1OH6A 3AV9A 3O1BA 3LGHA 4CO4A 3QFHA 3V4MA 5DETA 3KYLA 2HBJA 3SXLA 4ZP6A 1BO5O 1KVJA 5J8YA 3UNGC 3DRXA 3BYPA 4M5KA 1AZSB 4A48A 4PQUA 2G0AA 1K9MT 4UB2A 1YQHA 3F5TA 1UWAA 3FYHA 4NRUA 3RAMA 4CJKA 5EOZA 1KLMA 5ADXH 1FDBA 4O3SA 4J8FA 3C94A 1QAJA 4OI3A 3CI5A 1RWKB 4DR5F 4ED8A 1RGIA 5L1KA 1VSDA 4HH0A 3AA9A 2F4VK 1V3SA 2FXUA 1QUVA 4TY8B 2FMPA 2V94A 2M70A 3AFGA 4ECWA 1ZQAA 3KWMA 1R59O 3LL3A 3Q89A 4F4WA 4ED5A 2ZVSA 2IBKA 4B9UA 1ICEB 3MAHA 3DLGB 4CIEA 1LW0A 4OZJA 3SSSA 2IDLA 2WTFA 4H4OB 2ILYA 2ITMA 4NLVA 3D1HA 1BPDA 1ZAVA 3MR5A 2RHKA 2X1GA 5HR7A 3DXMA 3AJDA 4JD2B 2F1IA 4U7UD 1N5QA 2OD4A 3QT5A 4WTYA 3ORYA 2VODA 3O8WA 4K4GA 5C25B 1KR4A 1ZC6A 3J81Y 5LT5A 1XMOF 2Z2YB 1FRLA 2D0PA 2PYLA 3HI9A 4DQ8A 2GVDA 1C1CB 2ZOFA 3SQGB 2OTJS 4X65F 3A8KA 5M1NA 4I6AA 4IR9A 1WSGA 3DN9A 2EFQA 3AUOA 4NM2A 3AVMA 3D2SA 1N32K 4NLGA 3HM8A 4Q45A 2L48A 2VFTA 1S1WA 2FI1A 3C6TB 3SV3A 2GIRA 5EX3A 9ICIA 2L9NA 5KQDA 1C4AA 2WC9A 4DV6K 5J2DA 4FZZA 1WN7A 1J2VA 3CFOA 2XHCA 4B1VA 3W62A 1D1UA 4CQ1A 2BVZA 5AQKA 4F4YA 4EWTA 1UVMA 1UFWA 4MO5A 2BMBA 3MECB 3CD6S 3SUQA 5D4PA 4K43A 1N52B 1S0MA 3U1LA 1NHVA 3AO4A 4TLRA 4X4PA 4RNHA 1TL5A 4FJKA 2DB1A 2LCWA 2HYIB 2HRUA 4BS2A 5F8JA 4GC6A 1Z05A 1M90O 2W9CB 4LQ3A 2D0CA 2BA9A 2DO0A 5J2HA 4F5RA 1YX2A 5C15A 3J81O 1MSWD 3C16A 4CM0A 1RBSA 1X0FA 1RAFB 4UOGA 4K0KK 4KE5A 2ZVIA 1O1WA 4GNIA 2CZVC 1GAOA 2FY8A 4MEXA 5LMNK 3A13A 3UR0A 2ZEJA 1WKKA 3MEKA 4G1PA 1YBUA 1T9WA 1Y5IB 3L3VA 3T79A 1EETA 3NAHA 2YMQA 2W9BB 3CD0A 2YB4A 4LF8J 4Y2YA 4CBUA 1H38A 5KT6A 4WKRA 4F5NA 4HT7A 2VOOA 3MAQA 3Q7BA 2ZDPA 1J27A 4O5FA 3ZXWA 2PAVA 1KAZA 3OV7A 1A5XA 3WXMB 3POTA 3EX7B 4CT8A 4PG6A 4S0MA 4B3RK 3W8PA 5H9EK 2KKZA 3OPKA 3AAPA 3RW6A 2GWKA 4JYAJ 8RUCA 2DR8A 1M90T 4X62F 3K17A 3OGUA 4JV5J 2M7SA 2D9OA 4F67A 2FVRA 4J5OA 4RW8A 4ZJLA 4BRFA 1Y0HA 4LR7A 4Y2SA 3TQEA 2FHJA 5AXNA 1PJ7A 3MMBB 2RUSA 3C65A 4H0OA 4X64J 1O8BA 2IS3A 1EKEA 4ZCIA 2RJZA 4H4MA 4K0KF 2KFNA 5ALZA 2J8SA 4HVZA 2BHNA 1EZZB 3DFEA 2D5RA 3K5PA 3I0RA 5KFZA 2PMWA 1ZZNA 2KTQA 2G5HB 1LK7A 3A8JA 4OYWA 4CJWA 4B1XB 2H4YB 4X4TA 4AH9A 1D8YA 3CQYA 3V7LA 2FHJD 1TL4A 1GLJO 3GBTA 2DKZA 2DHAA 2RPIA 5F2RA 3V7JA 1NPRA 3ZX2A 3E0FA 4O5BA 2F1HA 3P49B 3LM9A 4HCBA 4Y34A 2DNKA 2COLA 3M4XA 4OPHA 4DR6F 4M0AA 1N5YA 4NASA 2KIVA 1K5OA 3T1YK 3VEVA 4DL0C 2VICA 1WHWA 4BG8A 1RWVB 1Z1ZA 1RGVA 1K9MO 2PI4A 1LAWA 2GA7A 4BRQA 1RYUA 3EWAA 3OD2A 4GKKJ 3CULA 1JL1A 4FZXC 1Q18A 2KD1A 5HL7Q 5EWGA 4O3RA 4OPAA 1RLDA 3I82A 3ZX3A 2P6RA 4C7QA 4O23A 1Q4RA 2W4CA 4DQIA 3OBIA 4OYPA 5JLFA 3GG0A 4OMFG 3WK9A 3BBFA 4P4OA 4AHUA 2W4PA 4IKFA 2QC3A 4UY8T 3CJ3A 2N82B 4KHPF 3T5JA 2ZIWB 5GVQA 3X3UA 2A6AA 4IJAA 4USKA 2QMUB 4PA1A 3BS5A 4NEZA 2C3MA 3C6AA 4QZHA 3TVKA 4ZLLA 4LF9F 3G9CA 3TEHB 3HYFA 3RBZA 2D3UA 1TMJA 3R8EA 2DCUB 2GWSA 4LF4F 2NUBA 1DTTB 4EO8A 3RJMB 3PR4A 1P9QC 1V5IB 1JJ2M 4DKWA 2RN2A 7AT1B 3CJAA 3N5FA 2G1DA 5AQPA 3OHAA 3CJBA 2VJVA 1MQ2A 4CEEA 3AGRA 2KI2A 1WHYA 3NF8A 2WSFC 3LPYA 4B02A 3BQ7A 2KRBA 4J91A 1VQ6N 3UI3A 9ICWA 1H0HB 4PL2A 4I2IA 4TUQA 1MWMA 5ALIA 4IFVA 3N7SC 2IIHA 1TKXA 4CK1A 4NI2B 4FF4A 3AA2A 2P9EA 1S6UA 4CJPA 4ICLA 9ICQA 4ZPAA 5BJRA 1VCTA 1BQXA 3CO0P 2HOEA 2Z57B 1SZ2A 4FOIA 2HKEA 2RT3A 2KEYA 3OS1A 1ROFA 3F53A 3FLCO 4DR4F 1V85A 2PC6A 3L7UA 2RHFA 1T05B 3SDEB 2BDPA 2BW7A 2HFZA 2UUCJ 4A61A 1S12A 3JXOA 4IC9A 1NNLA 2CPJA 5D0RA 2K4EA 4YMNA 3F0NA 5EGYA 5HBMA 1RAJA 3MXMA 1SVDA 2VKQA 5KAKA 1X9JA 4KR0B 4CLFA 3DXMB 2N7CA 3MDQA 4KLIA 1PJ5A 1XNQJ 3DOLB 2LKYA 4FS2A 4L75A 1PKUA 3TUJC 2CJKA 4QS9A 9ICXA 5JXSA 4IFYB 4JKFA 1XI1A 3RB4A 4LREA 2XMKA 5G4DA 4M5HA 3V9ZA 3DLGA 3GYGA 4B6JA 4O3QA 2F3JA 2C2ZB 1E6VB 2VQEK 1U6ZA 3FKBA 3MF5A 1JLAB 4PGXA 5BPNA 5IT9O 2CRXA 2E5LJ 3C2MA 4ECRA 5KFKA 2R4FA 1LCUA 4FJ8A 1UA1A 2IMOA 3KWIA 4N8OA 1RXOB 4BC2A 3BGUA 4MFBA 2KSOB 2N1RA 1RHJB 5F41A 5GAHU 3Q8UA 4CLKA 2VPZB 2BABA 3BB5A 2FGCA 3M9OB 3CC7S 1B0VA 3BO2A 2RU9A 4M3TA 3HPOA 5KT2A 1SCJB 8ICAA 2L3MA 4P6QA 2CVEA 2B9EA 2XIDA 2MKSA 3J80Y 1NU4A 2G8KA 3G0ZA 3L5KA 1B0PA 2EI5A 1R8BA 2ZKTA 1U2VB 3KLVA 2K7KA 2ZWPA 1NK5A 2RDDA 3JYTB 3HTVA 4PG5A 1VQ8N 3TSPA 3DXKA 4CFBA 1RAGB 4JKGA 2I1RA 2JFDA 1N5XA 2DL0A 3AVFA 5AQUA 2QIFA 3WHIA 4O0NA 3SFGA 2YX6A 4OQJA 3V9UA 3C7NB 5A8RA 3TX0A 4FLTA 4U96A 2R42A 3ISZA 4AP9A 5KFEA 2HAIA 1L3SA 4CJSA 1YJ9N 1HFEL 5M1KA 4DR5J 2ZIVB 4MEYA 4CHOA 1IJEB 2Q31A 4QIVA 3VAHA 4AUKA 3TZYA 2DNOA 3PFEA 1X7VA 3C14B 4LF4K 4CD3A 2QE5A 3ET6B 3PSIA 4MF8A 2XY8A 2WMMA 3KD5E 3FZ2A 2JRSA 4RWXA 1KONA 2DTUA 2O8DB 1B4SA 2EG1A 2F5GA 5ETKA 5K9FA 2WF9A 4G3IA 4ES1A 1FTRA 5AE2A 3ZEUA 1EXQA 1CULA 1YZ6A 3CDUA 1YG0A 1R0AA 4ZVFA 3GCXP 3M8WA 4JOUA 4C48A 1YHQN 3J7Z5 5B0CA 4FF1A 3FQKA 2W55A 4BRKA 2IC3A 3AVIA 2YNFB 2N4CA 2VDIA 1VC6A 1GMUA 1PIEA 2HFUA 5DQIA 4UAYA 1HBUA 1WC6A 2I5HA 1FEZA 4Y2VA 4CIGA 2CQ2A 3K2YA 5CR4A 1KP6A 3RFAA 2X1BA 3GP9A 1N32F 4UB1A 1HNWF 4M7XA 2AF6A 4ILGB 3MCNA 3BS9A 2R7YA 4DV5J 3S6JA 3G4SS 2VPWB 2B0CA 2WHEA 3GOIA 2QT7A 3PRVA 2KXHA 2DNMA 1ITGA 2F65A 2A6OA 4M5DB 2QKKA 3CCWA 2V52B 3EM1A 3DLEB 3NFAA 2QEXN 3DC2A 4OJ5A 2O67A 3S8SA 1A0PA 4EHUA 1S57A 1IN0A 4FJ7A 4JWMA 1X40A 4LR8A 5LL6d 1HKAA 1XJWB 2V51B 5CYQA 3R3TA 3OTDA 1HW9A 2MYFA 3LANA 3J7AP 3BGRA 3VQSA 1VFJA 3DDKA 1P1TA 1RPLA 2MHEA 2UUAJ 1WC1A 3T3FA 1SUQA 1XEZA 4M95A 3VEZA 2DUYA 2V2ZA 3CM6A 5C0YA 3ZT3A 3CW2C 4TLQA 4DLGA 4LT6A 2C28A 4YHHK 2HK3A 4OGEA 5B09A 3OT9A 1C0TA 3G8QA 3MR2A 4UATA 3H6EA 2KLAA 5F3XB 2VWKA 2KT5A 2MZSA 3CPEA 1QAIA 4KN4A 1FA0A 3HOSA 3C21A 5I3UA 2C3UA 3KG4A 4B1UB 3BN7A 3ID6A 3OL6A 3DLBA 5DZ6A 3LAKA 4CJ5A 1BPEA 2NRZA 1V97A 3LDOA 2IGIA 1A6SA 2YV0X 5IIJA 1FK9B 1IKXA 2PFFB 4JI1K 5KFRA 2KVIA 3B0XA 4ACOA 3CT9A 2N3LA 3H59A 5SUHA 4PPXA 3JTOA 3D0HE 3RYLA 1IR1A 4I0WA 3PX4A 1WEYA 4X4UA 4K8RA 1CI4A 4GMKA 1EJ7L 8AT1B 4F5OA 1WSJA 4N56A 1N88A 4HTIA 4KLGA 1B22A 1FFSB 2Z1IA 3J7YI 4IWVA 4E7LA 4OKJA 3OPXA 4CP5A 2BZ2A 1P90A 3DXSX 1ZM9A 3PR5B 5C2DA 3ZDAA 4HTLA 3WQUA 1TAQA 5M2UA 2FPLA 4F3TA 3QWUA 2OEMA 4JNEA 3VF4A 2JVRA 1QH9A 4AL6A 1BI4A 1WEXA 2BCSA 3W61A 1KVKA 1F0MA 1FESA 4N47A 2A1AA 1QQ6A 3BZKA 5BOMA 5IXUA 3QDKA 4YOWA 3R7BB 4B3SJ 3M8ZA 2VA3A 4NA2A 3OYJA 3NGZA 5KG5A 1D8LA 3Q8KA 1R6VA 3KLFB 4M6WA 1TVRA 4NLQA 4H5VA 4DTRA 4NCAA 2J7KA 1NK9A 2VYPA 3ETRA 2HHTA 2MSNA 2H3FA 4CJTA 1NZPA 3SQ0A 5EE0A 3U1NA 4CNYA 4FBUA 3L4PA 3B8AX 4CK2A 4RCHA 3VEWA 3CC2N 3UQ2A 2P9GA 3ILLA 4QZIA 1YITS 3NGIA 4FF2A 2ZIVA 4DUTA 1OY9A 3OTEA 3C3LA 4DV5K 3ASMA 1WHXA 3W65A 2ZIXA 2HNYA 2HSZA 3NS5A 4HHUA 7ICPA 4FJHA 3GCWP 3THVA 4RW6A 4CZCA 1COOA 2DFLA 3AQOA 3BQ0A 2VGNA 1SIZA 1U45A 2UU9J 3HZGA 2DR5A 2OLWA 1HQEA 5J2GA 1BWVA 4CF9A 2XGPA 2KNJA 3PW4A 8ICKA 2KHCA 1ZQGA 1H74A 1TMMA 1WYGA 5J0XA 1UMJA 1TU0B 1NGHA 3C5GA 1TL3A 4B3MK 2GHPA 4L72B 5CP2A 7FD1A 1DLOB 3KK1B 2DD8S 3QIOA 4CI6A 1F5SA 4QAGA 5A0YB 2BCRA 4RQMA 2RMLA 4FDFA 4WXWA 4CZMA 4IQMA 4CZKA 3NVMA 2M8HA 1Z4NA 3PYGA 4L74A 6FDRA 2BZFA 2DKXA 3JPSA 2ATQA 5KFXA 1HNXF 2GELA 1AW0A 5HHHA 3ID8A 4RKUC 3ZSOA 2P9UA 4C98A 3VGLA 1YJTA 2UXCK 2YH1A 5KFUA 4OJHA 2F3NA 2LYAA 1FXRA 1RT6A 2G08A 4ECUA 1S8OA 3DGPB 4KGXB 1ZAWA 5L46A 1D4XA 3WQPA 2G0JA 2NRXA 3O1LA 1OWXA 3RW7A 4WFBQ 3J80O 4FJMA 1PC4A 3I1YA 3DOKA 1J5EJ 2D4WA 2ES6A 1VQ6S 3UVJA 3HBTA 2QGFB 4FJGA 4OVLA 4YOVA 2WFBA 9ICKA 1FJGF 1T7PA 1FRXA 3MM8A 1YJWN 4L8RB 4HYKA 2C3OA 3FCWA 3PCOB 1RBTA 4RR5A 1LWEA 3OYBA 4Q0BA 2FC8A 5H9FK 1X5PA 1H73A 2GQ2A 4ZPTR 2ZXHA 3ALRA 5DDPC 1G1XA 4ZP9A 3TZWA 3IRUA 4BRCA 4MK8A 4ZOHC 1HL6A 5CCMA 4NY8A 1I6JA 3AODA 4IFVB 1NMNA 1XQSC 4DUYF 1DURA 3J7AN 4MT1A 5BR8J 5KG6A 4O0IA 2RP5A 3BH7B 2HG4A 2CQGA 1KQGB 1NGDA 2G9OA 2E1RA 4E7KA 1T3OA 2KN4A 2KB2A 5DO2A 4ZK7M 3WQTA 1QAXA 5KOWA 5BOLA 5MLCQ 3CCQN 1FIQA 4OX9F 4TSXA 5B08A 5HRNA 3X1LB 4JP8A 1WHVA 3HDSA 3HI0A 4KO0A 4FZLA 2NPIA 5J1PA 1FFWB 3NH1A 2HBZB 1SXDA 3W9JA 4FLVA 1PVQA 2P9NA 4WE1B 2G0IA 1YITN 2ZTEA 1FEHA 2JEJA 1U6BA 5J0OA 4F2SA 4JKBA 1OH5A 4U7CA 4E8UA 4AM7A 3R5DA 3VQBA 4OHWA 1RAHB 4IS7A 2FPHX 3V2UC 5BN8A 3HL8A 5KG4A 4K4YA 5HAOA 2D3ZA 4MHVA 2Z7JA 3KUEA 2KKHA 5K14B 1QZ6A 5KFMA <