1NKCA

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after five rounds of primer extension, following incorporation of dctp, dgtp, dttp, and datp.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkcA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkcA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkcA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkcA01
4YXJA 5DG8A 4OKJA 9ICSA 1QSSA 4EBDA 2NRXA 4BDPA 4UBCA 5KG2A 3DMJA 1QS4A 4DU3A 4JUZA 4HUFA 3KK1A 3OYGA 4I2PA 2M9NA 4B9VA 4E7HA 2UVWA 2ZUDA 4DSKA 3TR8A 3V1RA 8ICRA 1BPBA 4YP3A 2VA3A 4TUSA 2BKEA 1KCFA 3QEAZ 3L2QA 1LWEA 3MXMA 4KLOA 2P66A 3B6OA 3S3NA 3LAMA 3NGDA 3GIKA 2JZBB 4AHUA 5FROA 2ZJ8A 4F5OA 3G6YA 4CFBA 4M9JA 4ECXA 1BHLA 4DQRA 1SV5A 4FJ9A 1DLOA 2C2EA 2KW4A 4FLTA 5KFGA 2JLEA 3MECA 3QEIA 4O3PA 3LZIA 1ZQQA 4HCCA 4DTXA 3CFRA 4HUGA 3PW7A 8ICWA 3IG1A 1ZQGA 4ED8A 3K2PA 4XA5A 5HMMA 1NK9A 2OZSA 1T05A 4FBUA 1QTMA 4O5EA 1C0UA 4N76A 4CGDA 4F92B 4N41A 4Q5VA 2D5RA 2FC0A 8ICLA 2I1QA 3K75D 4NM2A 7ICTA 3OHAA 3KHLA 1JXBA 1NJYA 4KN4A 3KD1E 3H4DA 4FXDA 4C8NA 4ED0A 3ASMA 2J6SA 3V7LA 2PYLA 3HO1A 4UB5A 1MU2A 1LV5A 4RZRA 1XS9D 3EY1A 3UXNA 5I3UA 1YVUA 1KEJA 4P4PA 3HVRA 4M3YA 3AVBA 2Q0ZX 1LAWA 3IRXA 2IOCA 3GQCA 1CLQA 3TFSA 2OPPA 3RAQA 4ELTA 8ICQA 4BGDA 3OYMA 4UAYA 3ZSRA 4DFPA 2HNYA 4CF2A 2A1RA 1Q9YA 1BISA 5KT3A 3KTQA 4KLGA 4N5SA 1WN7A 5IIJA 3JPQA 9ICUA 4KLFA 3H08A 3AO5A 4FJHA 2BANA 4XIUA 5KFFA 4DTMA 5KFRA 3L2RA 4FO6A 2RN2A 3WNEA 5K14A 1BGXT 3T1AA 1RT2A 3A2FA 4F5PA 3HL8A 3VQPA 4RPZA 7ICSA 5KFMA 4DL2A 4IQWA 3QERA 5J0QA 5HP4A 1BIZA 2BCVA 3TWHA 3Q8KA 4YD1A 1MC8A 1JMSA 4XUSA 3MAQA 3I8DA 3OSNA 4IQVA 3TARA 5EU7A 3PR5B 1RDBA 4M0AA 2AQ4A 3LDSA 4CFCA 3OGUA 1ZQLA 1IKYA 3L8BA 3C6UA 1RBUA 4E89A 3NH1A 3NF6A 1RILA 1S1UA 4CK3A 3DLEA 1JLAA 4W5OA 1EX4A 4FM1A 5D49A 1U49A 4KFBA 5CYMA 3VQ7A 1IM4A 4F8RA 3DI6A 2PFOA 3VQ6A 3MXIA 1EXNA 2KTQA 3U3GA 1TKZA 5J2FA 3VQ4A 3SCXA 3SPYA 1UT8A 2IHNA 5FDLA 4Q43A 1S76D 1RTDA 2G8HA 4DSJA 5DDMA 2YNHA 1S0NA 8ICNA 1VSKA 3TABA 1GOAA 1COOA 2NRZA 4NCGA 4AHTA 4YVZA 4DF4A 1HRHA 3JPTA 1BPEA 3MXJA 4ECUA 2RKIA 4L8RB 3PV8A 4ID5A 3ISBA 3UPQA 1BQMA 2WONA 7ICLA 2BQ3A 2W9BB 3RMDA 4F5NA 1RTJA 1S10A 2XY7A 4MF8A 4KTZA 4IFVA 3LDAA 2GWSA 4ED7A 1VSDA 4I2JA 3RJFA 3E01A 5KFQA 3NHGA 2IC3A 3JPRA 3UQ0A 1X9SA 3TQ1A 4YFKA 4GC6A 1NKEA 3QLHA 4CHPA 1U4BA 3SI8A 1TL1A 4AHCA 2BPGA 3ULDA 3Q8SB 3MBYA 2YV0X 4CHYA 1ZQPA 4ECRA 7ICRA 3PX4A 5CP2A 4CEBA 5J2MA 5KGWA 4PWDA 5J2HA 4FS1A 4JV0A 4GMJB 3T19A 3EPIA 2HHTA 2ZUCA 1ZBHA 1BIUA 5CY4A 2KFNA 1MQ3A 4P4OA 4DSEA 2DPJA 3SQ1A 4PY5A 5J2AA 4OPKA 3QZ7A 4YN4A 3HP6A 5JS1A 5DG9A 8ICVA 4C8KA 4DQSA 4HHTA 3HX0A 4M3UA 1H38A 5HRPA 2FLLA 4QZBA 1R0AA 3AVCA 4CJ4A 2AJQA 1TAUA 2OZMA 4FJ7A 4KITB 1YT3A 7ICGA 4BXOA 2E4LA 3BQ2A 4ECQA 3AU2A 4Z4HA 4FK4A 4JRPA 4CGJA 3HJFA 3QNOA 4ELUA 4EYIB 4PUOA 8ICHA 1ZBUA 1NJZA 5J1EA 1KFTA 3V6DA 4MF2A 2O4IA 1NKCA 3HXMA 1J9AA 4NYFA 3JSMA 3AO4A 2ALZA 4RQ2A 3AA4A 4X5VA 3QE9Y 4KHWA 3CFOA 1UAXA 4FJGA 1HPZA 3C5GA 2VA8A 4CF1A 4RNMA 3C5FA 1A5XA 3G6XA 1JKHA 1EP4A 3AA2A 3PW4A 1RBSA 4UAZA 2X6NA 3NTUA 2ATLA 2F8TA 1FXXA 4C8MA 2R8GA 4O0JA 4QW9A 4ED3A 2BPCA 2W8LA 3PNCA 3V7KA 1JXEA 1S9FA 4PGYA 4FW1A 3OYJA 2V4RA 4YFUA 5CWRA 3LALA 4M9LA 4R8UA 4KHSA 3UQ2A 7ICPA 1XSLA 4FK0A 1ZJMA 2Z1IA 3KLIA 1VRUA 4B8AB 3EYZA 4J9SA 1WSGA 3CM6A 3OYBA 2YKNA 3RB0A 4RW4A 1RT1A 4NLKA 3AO1A 4Z4IA 4OJRA 4E1NA 4JWNA 1PZNA 3T5HA 4LD0A 1JX4A 4F4KA 3RRGA 1KLMA 1S1WA 1LAVA 1K1QA 1VSFA 4OLAA 1IKWA 1KFDA 4FJNA 4DOAA 2IGIA 4TURA 4K4IA 1HQEA 2BDPA 4IQUA 3OJUA 1Z3EB 1FKPA 4CF8A 3SUOA 2HB5A 5DG7A 4I2AA 1WSHA 1WSEA 3Q8LA 1SUQA 3OYNA 4TUQA 3KHRA 3H40A 2IAJA 4Z4CA 3MDCA 3RR8A 3KK2A 3GV7B 1RTHA 4PHPA 2HHUA 1GOCA 2PI5A 2BGWA 5CHGA 1S0VA 3RB3A 2HVHA 3ZT3A 4QZ8A 3NGIA 2XY8A 3DLHA 3V4IA 4W5NA 4IQTA 5KG5A 3I0RA 3LP0A 3AVHA 4NCAA 3SV4A 5J0PA 4AHSA 3QESA 1IH7A 5KRSA 4DL3A 1ASVA 3GFKB 1UWBA 4DFKA 3O4QA 4W5RA 5HNKA 1Z25A 8ICEA 1DGSA 1VRTA 2OPQA 4QWBA 5JUMA 5EWGA 3MEGA 4FLZA 3F9KA 3K59A 3KK3A 5KFDA 9ICAA 4O5CA 4RUCA 3NGZA 3NGYA 4KHQA 3H8WA 5J2GA 3M9NB 3VQQA 3I0SA 4F3OA 4P4MA 1ZQJA 4KLQA 3M8QA 1EXQA 3LPUA 2G8KA 2DFEA 4CEFA 3O3GA 4H4MA 4IRCA 1L5UA 2RDJA 1CZ9A 7ICQA 3RRHA 4FJ8A 2UVRA 4YMMA 3FYHA 4FJIA 4JS5A 3QEXA 2LYHA 1C1BA 3TAQA 4Z6DA 4M3XA 5J2PA 3T3FA 8ICAA 3V6HA 1Z00A 3B0YA 4JLHA 3VQAA 3V7JA 3OYHA 4H8KA 4FZYA 1B9DA 2D0AA 3ORYA 3OYAA 4CEZA 2BGGA 4RW7A 1RT5A 1WLJA 5CB1A 1RNHA 3P1GA 3RR7A 4FLWA 3HYFA 3PMNA 9ICTA 2VG5A 4ECTA 2NUBA 2KFZA 4YMOA 1KVCA 3RBDA 5HMLA 3ZDAA 3ISNC 1K1SA 1RT7A 4Z6CA 3LWMA 4K4HA 2V9WA 4DSIA 3KHGA 4QZFA 4Z0UA 4M3WA 1A5WA 2ZE2A 4N56A 2A1SA 3K5MA 3SYZA 4PA1A 4B9NA 3Q8RB 2G8IA 3B0XA 4FBTA 4CJRA 1JXLA 1W9HA 4CJKA 1X9MA 5IINA 2E6MA 1NJWA 3PX6A 2P51A 4FM0A 2VG7A 2C2DA 2FMQA 3MR5A 4MEYA 9ICHA 1RDAA 4F50A 4E7JA 4B3OA 3ISDA 4J9MA 4KHYA 1RDCA 4QCLA 4QZAA 2QXFA 1J5OA 2QK9A 2HHXA 2KZZA 2ZD1A 2H5XA 2W8KA 4RQ4A 1LWCA 1Y88A 2XRIA 2X74A 4F91B 5TZVA 4RQ0A 3AUOA 2J6UA 3AO2A 7ICUA 3KHHA 4DLGA 2V4QA 2OYQA 2W9AA 4CGHA 4YMNA 4QOZB 5J2CA 4OLBA 3GV8B 3ZSOA 3VQ5A 1IKXA 4JV2A 2LSNA 4J2EA 2W9CB 2F1JA 3KLEA 3PO5A 9ICBA 3ZSQA 3RH6A 4KLUA 1BQNA 1WCLA 3LP3A 4QZIA 4B9MA 4E3SA 1YTAA 4B8CA 3OY9A 4QWEA 1XO1A 4E0DA 4RQ1A 2IHMA 4R8UB 3L2UA 3RJEA 5KFZA 4FZXC 8ICMA 4H4OA 4JS4A 3NF8A 4CECA 4HTUA 4IRKA 3K5LA 4CJSA 4CJEA 4PGQA 4DS5A 3OYCA 4BE2A 2RDIA 2RF2A 1NJXA 4M3RA 5DQIA 7ICVA 4FZZA 2FBVA 4J9OA 2ETJA 3DLRA 5J2KA 2Y1JA 9ICWA 5KT4A 1RT6A 1WAFA 1ZBIA 4KI4A 3S3MA 5KG6A 1B92A 1RPLA 4K8XA 1MSWD 1ASWA 3V9ZA 2BPFA 4FJJA 3H7IA 3V6KA 4DS4A 2AU0A 5CR0A 3C1YA 5IIKA 4C8LA 4YD2A 4IR1A 5J29A 4DL5A 3V1QA 3HSTB 2Z1JA 4LVSA 3KD5E 1KFSA 5KFWA 3NH0A 3SJJA 2DFLA 1DTTA 3SI6A 1DOQA 4I2DA 2Y1IA 8ICOA 4IDKA 1YTUA 1S0OA 2YNGA 1HQUA 2HVIA 4KLLA 3AVLA 4E7KA 4M9NA 3OHBA 4FLXA 4OVLA 1TK0A 1KLNA 3QIOA 4DU1A 4RNNA 3BQ0A 3SUQA 3DLBA 4F93B 1L3VA 3NF9A 9ICGA 3PVXA 5DB6A 5KFVA 5EOZA 4IRDA 4PHDA 4CJFA 1WSFA 1S1XA 2B21A 1ZETA 4KO0A 4QWDA 1G15A 1U48A 4O3NA 7ICNA 2IS3A 4J9KA 4ID1A 2G8FA 2F1HA 4CK1A 2AGPA 1RYRA 3HP9A 4I2CA 3RMCA 5T7BA 3OYDA 4KREA 8ICXA 1TV6A 2W9MA 3RJKA 1ZBLA 4E1MA 5J0TA 3SUPA 1X9WA 4Z4FA 4HUEA 3HPHA 4EP4A 5KT6A 5BOLA 4NM1A 4DMNA 1HJPA 2DFHA 4CE9A 1J53A 3ZDBA 3ZSWA 3MABA 5L1IA 1ZQBA 3THVA 4P2HA 9ICFA 3ZT2A 3K57A 1RBVA 4R66A 4DQPA 4FJKA 4QZGA 3C6TA 1TVAA 4Z6FA 1IKVA 3RJIA 4RU9A 3HVTA 1JLQA 3G0ZA 3NBPA 3U3YA 3E2EA 8ICTA 1X1PA 2BE2A 1XU4A 3ZSXA 4F4XA 4OGCA 8ICKA 3V9WA 1BI4A 5DBCA 3JPNA 4BDYA 3VQ8A 4QWAA 3KJVA 1J54A 3CM5A 3N97B 1XI1A 2P6RA 2Z1GA 1FKOA 5HBMA 3OJSA 7ICHA 3TAGA 4ED6A 3LK9A 8ICPA 3PY8A 3C1ZA 2JGUA 4AHVA 3RMBA 4DO9A 4B08A 4RNOA 4M41A 3C2LA 4KN7A 4J9QA 3EW9A 3JPPA 2FLNA 1TGOA 3AVMA 5DQGA 4JWMA 1JLBA 2PYJA 2KZMA 3OYIA 5KFTA 5DK5A 2ZTEA 1LW2A 4O5BA 4R63A 4O44A 1TKDA 3JPOA 3V9XA 4LH5A 2BQRA 4ZHRA 2QKBA 1NOMA 3S9HA 3CYMA 3CFPA 3AA5X 4TQSA 3MFIA 2RPIA 3SPZA 2VG6A 1A77A 2AGQA 1REVA 4KLEA 1IO2A 4BACA 3OS2A 4DFJA 3AV9A 2I5JA 4I2BA 5J2QA 1ZQKA 1N6QA 5F9LA 1SL2A 1B43A 4IFYA 4CCHA 1ZQEA 1XC9A 2E6LA 3TANA 3C23A 2XCPA 3M8SA 3FFIA 3RAXA 1ZQWA 1Z00B 2BCQA 3IS9A 2PZSA 3M8PA 1Q9XA 2P1JA 4FYDA 1RYSA 2PY5A 4FJMA 3ZDEA 3NAEA 3SZ2A 2Z1HA 2UVVA 4OKKA 1ZQSA 2DY4A 5KTQA 4Q45A 4RQ3A 4CHQA 3LPTA 3C2MA 2C2RA 3F73A 1C6VA 1NOZA 1CEZA 5C42A 3DM2A 3VN5A 3SV3A 3AVFA 3IHQB 4AH9A 1RXVA 3QZ8A 2IA6A 3RBEA 8ICCA 3RH5A 5HP1A 2X6SA 4O5KA 2G8UA 4F4WA 4E19A 4IR9A 1JL2A 3DOKA 3U6FA 2ZJ5A 4WE1A 5KT7A 2YNIA 1HYSA 5CYQA 5KFCA 2PFNA 4FVMA 4F5RA 3PW5A 9ICEA 3D0PA 4O4GA 1GOBA 4CJ5A 4KLTA 3LP1A 4KB1A 5KG4A 1UA1A 1B22A 9ICRA 5KG3A 1XHZA 4FCYA 3OYFA 3HK2A 3G10A 4I2HA 3HPGA 3OYLA 2R8IA 5IIIA 3GIJA 3BQ1A 4M04A 1QQCA 4UB2A 5KFKA 1UA0A 4PPXA 4DTSA 4CEOA 5DB8A 1Q8IA 4R64A 2A1JB 4YNQA 4ZTFA 4R5PA 1LB2B 3V9UA 4M3TA 2HNZA 5KFLA 8ICYA 3PW2A 4QZCA 4CF0A 3TAPA 1N5YA 3ZSVA 4RQ7A 4KLSA 4DTNA 4F5QA 2Q3SA 1C7YA 3RB6A 4M9HA 2KZ3A 5D46A 3K5OA 3QEWA 2XCAA 4DTUA 1ZQYA 4GVMA 4KTQA 3QETA 2BHNA 1UT5A 3O3FA 4EBCA 3DLGA 1C1AA 1DTQA 2FPMA 4RQ6A 4M42A 4B9LA 4ECWA 2D0CA 7ICFA 1BPDA 2B4JA 1U45A 4C8OA 3QEBZ 3AVJA 3MEDA 1LWFA 3L2VA 4FLVA 2P5GA 4CEQA 4M9GA 1T3NA 8ICJA 4QZEA 4YG2A 5HHHA 4RW6A 4MFAA 1TK5A 3NCIA 2XGQA 3KLGA 2OA8A 1ZQUA 4FK2A 1ZQCA 3OYEA 4CFAA 4XRHA 2W42A 4YQWA 3T5JA 1ZQRA 2PFQA 2XY5A 3SUNA 1KTQA 3DRPA 4KLDA 4Q0BA 4CFDA 4CJQA 9ICQA 2BQUA 1BPXA 2NRWA 1T7PA 1L3TA 2ZJAA 2UVUA 1U04A 4KLMA 4CJLA 1JIHA 1QE1A 3CG7A 3PMLA 2FLPA 1TL3A 4UQGA 4TQRA 9ICJA 4O9MA 5KFPA 3DLKA 3GIIA 5KFAA 4KMUA 3TAEA 4FJLA 3H8JA 1VSLA 1KRPA 4DOBA 1QSYA 4KLJA 3BQTA 4UBBA 2JEJA 1BCOA 4F4YA 5KFJA 3MGHA 5DLFA 3OS1A 4KV8A 4I2FA 3L3VA 4JRQA 2IBKA 4IBNA 1TKXA 4O0IA 4I27A 4DQQA 3RJGA 1CXQA 5DLGA 2R7YA 1ITGA 4IG3A 8ICSA 3RWUA 5KT2A 3RH4A 5DGBA 1XHXA 4M47A 3PUFA 3MGIA 1WAJA 5IIMA 1U9LA 2IDOA 1D8LA 1D9DA 3ZDCA 1IG9A 2NRVA 4DL7A 2ISPA 2GUIA 3V6JA 5F9NA 4DTRA 2YKMA 3T5KA 2YHAA 2ATQA 2R8KA 4KPYA 1D9FA 4G3IA 2WOMA 5KFSA 4I29A 3NH2A 3VA0A 1JLGA 2VWJA 3CQ8A 1RBRA 2P6UA 1S6QA 3OYKA 4DTOA 4LSNA 5KGXA 3K5NA 5KFEA 1TKTA 2GV9A 4HVJA 5KFHA 5J0RA 1HJRA 4DWIA 3MR2A 3FDSA 4RT3A 5HLFA 7ICOA 5DBAA 1ZBFA 1HNVA 4RPXA 1ZQTA 2PXIA 1HUZA 1V9PA 3V72A 4M45A 5J2NA 3HWTA 2FBXA 1S0MA 4CF9A 3KKRA 4NLGA 2F8SA 4NLNA 4BXOB 1JL1A 2KN7A 8ICIA 3Q8QB 3Q8MA 8ICGA 4O3SA 2MAXA 4CIEA 1RDDA 1RTIA 5J0WA 2VWKA 3H4BA 1S1TA 2FBYA 4W5TA 1WCNA 3PR4A 1NK6A 3RJHA 4GC7A 1S77D 3NDKA 1KDHA 4UAWA 3SNNA 8ICUA 4KHUA 4EP5A 2ITGA 4UB4A 2ZQBA 5L1LA 3MEEA 1F21A 1A76A 4HYKA 1CXUA 1FK9A 4LH4A 4Q44A 5BPCA 1S9GA 1ZQMA 5CZ2A 4B9UA 4N47A 4CERA 3ALYA 5L9XA 1ZYQA 5J2IA 4BWMA 1UOCA 3ZD8A 3MDAA 4GW6A 1JN3A 2G8WA 4CJ3A 1HUOA 5KG0A 4M3ZA 5J0YA 2FBTA 4LZGA 1NOYA 3PO4A 2R8HA 3IM1A 4E7IA 1T8EA 4LSLA 4UB1A 3VQCA 5DKWA 5J0SA 4PQUA 3T5LA 1D8YA 3TFRA 4NY8A 3AVNA 1ZQNA 9ICIA 1AROP 2F96A 4MFCA 5C24A 5DB9A 2ISOA 3IAYA 4CGFA 4Y1DA 4DFMA 4QW8A 2YHBA 4OKEA 3VQEA 1N56A 1BPYA 9ICXA 4AHRA 1L3SA 4MEXA 2ZTCA 1K6YA 3DOLA 5FRMA 1VSHA 3HT3A 3P5JA 2QKKA 1QHTA 4OGEA 9ICPA 4CJVA 2VANA 3K4GA 4M6WB 4NLZA 5FRNA 5J0UA 4CIGA 4PH5A 4CJUA 1ZQVA 4BE0A 3WNFA 1BL3A 4FM2A 4Q8EA 1BPZA 4UB3A 2B6AA 3QIPA 4CGIA 3M8RA 5SWMA 4CIFA 4O3QA 4RQ8A 7ICKA 4NYNA 3C2KA 4EEYA 2XHBA 3V9SA 1RZTA 3AU6A 1X2IA 5J2DA 4W5QA 5DDYA 4O3OA 5EWFA 4CHNA 1RCHA 4HCBA 2FPLA 3B6PA 4CGGA 3VQDA 4FJXA 1KVAA 4EBEA 1SKRA 4NCBA 1ZQOA 3MR3A 5CZ1A 2A1JA 4PHAA 4DLEA 5HRSA 3KLHA 3K58A 3RB4A 1A5VA 1C1CA 3SQ0A 4O3RA 4JK1A 3MFHA 5KFYA 1ZQZA 2ASJA 1N48A 4DTPA 1LW0A 3NE6A 7ICMA 4PGXA 1SL1A 1VSMA 5KFBA 4F4ZA 1HYVA 3ETLA 3LANA 1NK4A 4BE1A 4DF8A 4GXJA 3OVNA 3SQ4A 1RT3A 2FMSA 3S3OA 9ICVA 3LWLA 4R65A 1B9FA 3M9OB 2ASDA 1C0MA 3KLFA 4J2BA 2J6TA 4CJWA 4IG0A 3EZ5A 4J9PA 7ICJA 1SKSA 3M9MB 1L3UA 4O55A 5DBBA 2XO7A 1BI4B 5HRNA 4ICLA 1VK0A 3DYAA 3V1OA 4CK2A 5J0OA 4RT2A 2KQ2A 2BCRA 4RUAA 3AVGA 3KKSA 1D5AA 4J2DA 3H8SA 5KFOA 3UXPA 4ZTJA 1T03A 3ZSZA 1ZQAA 1VSJA 4TSXA 1HYZA 4ECVA 1JLCA 1NK0A 1SZPA 4ELVA 7ICIA 1VSIA 2DFFA 4MFBA 3OS0A 3ZT4A 2W9BA 5DMRA 1ZQFA 5C5JA 4DU4A 2HHWA 4KKOA 3OSPA 4J9NA 4DSLA 1VSEA 1NK5A 3G6VA 3ZCMA 3QNNA 4I9LA 5SZTA 4KI6A 3AVIA 3ITHA 4CEAA 4CHOA 4IKFA 1WSIA 5KFXA 3SQ2A 2XGPA 4GLXA 2EX3A 1W0HA 1SL0A 5HROA 4DG1A 1KVBA 1XWLA 4M2YA 5KG7A 5J2JA 2R8JA 5KG1A 1HNIA 3VA3A 3ISCA 2MUTA 4I2GA 4XQ8A 4KTWA 5CJ7A 4DSFA 4GXIA 4ED2A 1S5JA 2JEGA 4M6WA 1S97A 4GXKA 4I9QA 4G1QA 5C25A 2DTUA 3TAMA 4RG8A 4ED1A 3GIMA 5E41A 1ZQDA 2HW3A 9ICMA 4KRFA 4DTJA 2HHQA 8ICFA 1CZBA 4MQ3A 3P83D 1JLFA 3D45A 1XSPA 4DL6A 2OWOA 2C22A 3RMAA 5D3GA 2X78A 5J2EA 4ECSA 1RXWA 3C21A 1TK8A 2O4GA 4K4GA 2XC9A 4I7FA 3JPSA 2P5OA 1QLNA 4KB0A 4EYHB 4YXMA 4LZDA 1QSLA 1JLEA 4QAGA 2FPKA 1RT4A 4Y1CA 5EWEA 2NRTA 2MUTB 2HHSA 4E7LA 1Y97A 8ICZA 3DRRA 5KFNA 5DB7A 4BWJA 4PHEA 1ZJNA 3QINA 1S1VA 5IIOA 3NFAA 4CESA 2PI4A 4F3TA 3UIQA 2AGOA 3V81A 3BDPA 2OPSA 1U47A 4OPJA 4CEDA 3UXOA 1BCMA 4KLIA 4J9RA 3KIOA 3GV5B 5J0XA 1XSNA 2I9GA 2HHVA 1EETA 4RW9A 3RJJA 2VA2A 4I2EA 3C94A 1ZQXA 5KFIA 2PFPA 3EWAA 3LP2A 4BDZA 3VQ9A 3O4NA 3PW0A 3QEVA 4K8ZA 4YR2A 3C95A 3BJYA 1CUKA 3QEPA 2JEIA 4B9SA 1HMVA 4NXZA 4QWCA 2FMPA 1T4GA 3O3HA 1NK7A 4DOCA 9ICCA 3WNGA 1TVRA 3ZD9A 5J2BA 3DRSA 5BOMA 3BGRA 4FS2A 3LZJA 4J9LA 3NF7A 3Q8PB 2YNFA 4LY7A 4YR0A 4RW8A 3EPGA 3LAKA 5HRRA 4CHZA 3AVAA 4I28A 4YR3A 4F2RA 1Z26A 5CA7A 5KRTA 3RTVA 1IXRA 5L1JA 3N4MB 1NKBA 4QZDA 4Z4GA 3AVKA 4ZH4A 5KI6A 3MR6A 5L1KA 1ZQIA 2IMWP 3AO3A 3ZT0A 4Q8FA 3HPOA 1TFRA 3PX0A 4JV1A 3HM9A 2ASLA 4ECYA 2F1IA 4FJ5A 2HNDA 1I39A 2BR0A 4F2SA 9ICNA 2C28A 1MQ2A 4CEEA 5KFUA 4J2AA 1ZQHA 2BCSA 2ZTDA 1S6PA 5I42A 9ICLA 3AA3A 1EKEA 4ECZA 1RBTA 4YCXA 4DEZA 1I3AA 5DQHA 3QO9A 2JEFA 5D4BA 2BCUA 4KHNA 1WSJA 2JZBA 3ZDDA 4QZ9A 4RPYA 2GBZA 2WTFA 1KSPA 4Z4EA 5HHIA 3WNHA 3JYTA 4FW2A 3ZSYA 4FLYA 1ASUA 3VQBA 1WNSA 5DGAA 4Z6EA 2D0BA 4I2IA 2OPRA 3TI0A 4KLHA 1O1WA 1TAQA 5IILA 1C0TA 1S9EA 4RQ5A 2XY6A 2ZUBA 3GILA 5KT5A 1TV9A 9ICKA 3TAFA 4EZ6A 4CJPA 2W9CA 1BVSA 4B9TA 4TUPA 3HW8A 4QZHA 8ICBA 3ZT1A 4CJTA 4FLUA 4DL4A 2G8VA 2EHGA 4DQIA 4I2QA 3L3UA 2HMIA 1NK8A 1SKWA 5JS2A 2B5JA 4KAZA 3GDXA 3L2WA 7ICEA 2AQ0A 2DPIA 4EZ9A 9ICOA 4MFFA 4AILC
chains in the Genus database with same CATH superfamily
4YXJA 1OW5A 3EZOA 3IBCB 4J9VA 4EBDA 4BDPA 5AXKA 4JUZA 3OYGA 3O8WA 2M9NA 2MLXA 2UVWA 2K3IA 4WU3A 1H7WA 2FY1A 1YJ7A 3LGNA 5F2RA 4CT8A 2Z56B 4MLHA 4F26A 2KHQA 4DMZA 3QEAZ 4KH4A 4DR3F 4IDKB 2IRUA 3B6OA 3NGDA 1IIPA 2JZBB 3R7SB 5EDWA 5MAOA 4KX3A 1SV5A 5E3CA 4FJ9A 4M7XA 3KLFB 2P6SA 2C2EA 1DHMA 3MECA 1KLMB 4O3PA 1RT3B 3OLBA 3HKZC 5HBMB 4HUGA 4X4QA 1NJIO 3QQCD 2VQFF 2OZSA 1T05A 3RSEB 1C0UA 3RW6A 4TNOA 4OI1A 2ZHOA 3C6TB 3W5YA 3LUYA 1ILYA 2GX8A 2GGPB 3F41A 1TUVA 1U1RA 1RHUB 4LMZA 2P9GA 3NRBA 2LMRA 4KN4A 4NWIA 4BJQA 2WK4A 1M5PC 4OYAA 4DR3K 1OH6A 1X5OA 5AZJA 1NNEA 3BSNA 3DRSB 4B3MK 2EANA 3ENAA 2UUTA 3FEYB 2J6SA 2DNHA 3QUBA 3CC2S 3V7LA 4EGLA 1YITN 3DRXA 1MU2A 3QBXA 2COLA 3QT6A 2C2NA 2ZH4A 4OYMA 4LF4J 2R7TA 3SEOA 1RACB 3OTBA 5I3UA 2JL9A 1YVUA 4P4PA 4QR2A 2MMYA 3AVBA 1S7IA 1CLFA 5FLXO 4KGVB 2O8FB 4G9BA 3D0GE 4USTA 2OIHA 4CF3A 4P2SA 3OHRA 2QWPA 3BS5A 3RAQA 4JEPA 1N34J 2HNYA 4I1TA 5HVFA 1TAMA 5KT3A 5ELZA 3AOCA 5IIJA 1JLCB 1K8KA 4ICLB 4C2MA 4IL6U 2HZVA 1P90A 4XIUA 3IRUA 2MGZA 4DTMA 1OVQA 2W40A 2I7PA 3J7YP 3A2FA 1E4GT 1SIJA 3HL8A 5HQLA 2CVIA 5D3GB 1B7FA 3WKDA 1FKPB 1BIZA 5A8KA 2WVEA 4YD1A 2M7SA 3O44A 1JMSA 2EXUA 2M52A 4LF9J 4LRBA 3TARA 2XZTB 3MOJB 1WOQA 2BABA 3H20A 4M0AA 5KOWA 4P6QA 1BWFO 1ZQLA 2XNRA 3NVYA 2RJZA 1QQ6A 3NH1A 1O0PA 2YPYA 1RILA 1NSPA 5BYSA 3DDIA 3CETA 3CCQS 1S1UA 4LVOP 1KQKA 5AQLA 4U8VA 3FJ2A 3UDLA 3MPUB 1EX4A 1SH3A 3G8QA 4JKAA 1FRMA 1OSCA 3BV8A 4ILMA 3MXIA 1EXNA 1EO1A 3SCXA 1UT8A 3BBBA 4MKYA 4CDIA 3HDSA 3CI5A 4CD3A 1S76D 2G8HA 2F8HA 4CO3A 5FP0A 1FJCA 1N34K 2YNFB 1BNPA 1R59O 3D6HB 4AHTA 3AB4B 4ECUA 1KBRA 4B17A 2XNQA 1BQMA 2R7WA 2B0GA 4MF8A 3T79A 1IJJA 1V3ZA 3HULA 1HA1A 5LMNJ 3E01A 1OSDA 5AQHA 3M32B 5LJVA 1J5EJ 2IC3A 3JPRA 5A6WA 4PKHA 3O08A 4UTGA 2AKWB 3IP4B 2G06A 5AM0A 4CZMA 4X4TA 4EI2A 3HKZD 4BR9A 2DCUB 2HCFA 1EX8A 1TQLA 2YV0X 1ZQPA 4ECRA 4NLBA 1QM9A 2FJDB 5J2MA 5LL6d 2OPSB 5K5MA 4NMXA 4A61A 3BM7A 4GMJB 3FBEA 3GONA 3T19A 4H03B 2ZUCA 2P9EA 1BIUA 1QQNA 2V5HG 5CY4A 2RQMA 3M5RA 3G82B 2P2CB 3CP8A 4YN4A 3NVZA 1Z1BA 8ICVA 1FK9B 4C8KA 4DQSA 4M3UA 3CQXA 3JAMY 5HRPA 1UVKA 4QZBA 2W11A 1R0AA 2HBLA 3KK7A 1TAUA 3AGRA 3OL8A 2OZMA 3ULHA 4FJ7A 1YT3A 4BXOA 1CJTA 2E4LA 3DU5A 3AU2A 4FK4A 4O8UA 1Q8KA 2ACMA 4ELUA 4EYIB 4HT5A 3V6DA 2KHOA 3HXMA 2FXUA 4FWPA 2DBBA 2XI2A 1M5SA 2ALZA 3ILJA 2VFRA 2EI5A 1RAIB 1RT5B 2J4RA 4NJ8A 3FK4A 4X5VA 3Q86A 4KHWA 1NM1A 1BO5O 2J7UA 1HPZA 2VA8A 4IO1A 2FJEB 3O2IA 4GY2B 4JI1K 3AA2A 5EX5A 2PN6A 3GCWP 4UAZA 2A18A 2DGSA 2FGCA 2ATLA 2WOMB 4DOZA 1GO3F 4JI3J 3R5JB 4C97A 5AI6A 5D4OA 4C8MA 4QW9A 2GJFA 3D2NA 3PNCA 1X6IA 4JI8K 1JXEA 5E5NA 2L48A 2QGFB 4KIAA 5CWRA 4UW9A 1BQMB 4ZPBA 5CHIA 5G5GA 4M9LA 4R8UA 5M2RA 4KHSA 4ANEA 1ZJMA 1HKAA 2HGNA 1VRUA 3AH6A 4J8FA 2HGLA 2F7TA 1QQ5A 2YKNA 3M6UA 4LQ3A 1T6DA 5CRXA 5GAEP 3VHQA 5ALHA 2QSFA 4QQBA 3LP0B 5AXLA 4BS2A 2E20A 1PZNA 1LCUA 1F6TA 1LAVA 3WHIA 3W2VA 4L73A 1VSFA 1QVFM 4M5LA 2ZIVB 2RUSA 1KFDA 2L3MA 2D0OA 1RHKB 2W43A 4F67A 1FKOB 4H4KA 2BDPA 1Z3EB 3SBMA 5DG7A 5KL1B 4RU2A 3NCRA 4B3MF 1RABB 3MGVA 4JV5F 5GAGP 3W62A 3R5DA 1NLVA 2HHUA 1GOCA 2PI5A 2DHSA 2BGWA 4G9ZA 2KU7A 4EU0A 5CHGA 1SQFA 1TZ0A 5B0AA 4QZ8A 5DDOC 2KD1A 3R3LA 1KHVA 3FSYA 1V85A 3LP0A 2NZTA 3TZZA 4AM7A 3I55N 3N79A 2JSXA 2DRAA 3W60A 3NRWA 1KN6A 2AMCB 2IDLA 2MY8A 5GAHI 1UWBA 2IC3B 4W5RA 3C6HA 8ICEA 4RUHA 4NLQA 3ZZUA 5AKHA 3VEWA 1S1TB 3W5XA 3BBFA 1BXNA 3AN1A 1VQLS 1E4FT 9ICAA 4RUCA 1BHNA 2JVRA 1NU4A 1BA1A 5HANA 1HNVB 2L08A 3CC2N 2WF7A 4P4MA 4YN3B 2MKHA 1EXQA 3LPUA 1OWXA 4J5OA 4H4MA 2MQPA 1L5UA 4EFAC 3W7BA 2WSEC 4KHMA 1KVJA 4HHUA 4LF8F 3I33A 2UVRA 1RTZA 2LYHA 3ZTSA 1C1BA 4IXCA 2HK3A 2DR5A 2V7ZA 4JI8F 6FD1A 3T3FA 1YX2A 2MZTA 3IS9B 3V4MA 2AWZA 5DM6L 4NI2B 2NREA 2D0AA 3ORYA 2HPUA 4WXOA 2OTJN 5F3TA 5CB1A 3N4PA 2MJNA 3RR7A 2FZCB 1WACA 4PXDA 4ZOHC 3PMNA 2JLGA 1WEYA 1VQ9N 3BZKA 3EO3A 4ILGB 4LSZB 3RBDA 2N7CA 1RT7A 1RAJA 2V69A 3C6UB 4NA3A 5D0HA 1JJCB 1S12A 5A76A 2QLBB 3KHGA 2P9SB 2EZZA 4ZLJA 4CI6A 1A5WA 3EZUA 5M1PA 2DR6A 4N56A 2HNDB 1XBWA 4JI4J 2A1SA 3AJ2A 4PA1A 2Z0GA 4B3SJ 4CJKA 3WC0A 1X9MA 2EPIA 2QB0B 4YDUC 4A8FA 3PX6A 2CQCA 2P51A 1SS6A 3CD7A 2C2DA 3KKAA 3MR5A 1RJJA 4F02A 5HSPA 3VEVA 4MIBA 1VQ8N 4DV1K 1RDAA 4E7JA 4F0KA 1VQ6N 3OL9A 4J9MA 3Q83A 1T3QA 4QZAA 2FF3B 2ZOMA 3MM5A 4RW8B 3D7SB 3R5CA 3N7PD 1BG3A 2M88A 1GX6A 1YTYA 2CYYA 2J6UA 3AUOA 4IQMA 3R8EA 3DRPB 2ZWHA 7ICUA 3KHHA 4UB6U 4KHRA 2VKZG 3IRXB 1F5AA 2W9AA 2WUSA 2AP1A 2WF9A 2K7KA 3NASA 4YDUA 3VQ5A 4E1JA 4LF7K 2BJEA 1N8RT 2WMMA 2W9CB 4LREA 1YBTA 2VDHA 2F1JA 9ICBA 3ZSQA 3EXCX 3T7ZA 4LIRA 9RUBA 4PR6A 2AF6A 4FYYB 1TYQA 1YTAA 4QWEA 1XO1A 2NNWA 1AUDA 4K0KJ 1V6HA 3S6EA 2IHMA 4R8UB 3IR7B 2VJ5A 2LKYA 1WWUA 3LF0A 4JI0K 4H4OA 4JS4A 3VGSA 4IYQA 4HTUA 3H8MA 5A0LA 2BMBA 4PGQA 3UD3P 1NJXA 3GYNA 5DQIA 5HR6A 1Y11A 2FBVA 4P74A 2ETJA 3NOCA 5F0UA 3DLRA 3BYPA 5AKKA 1RT6A 1WAFA 1ZBIA 1NWKA 3IG1B 3S3MA 5KG6A 4M8LA 3VPZA 3CCLS 4CF5A 4DS4A 2ZBQA 3C1YA 3M4XA 3SFUA 4YHHF 1WUUA 4IC9A 4GFJA 3WK4A 2Q2RA 3V1QA 2RLTA 1JWWA 3JSMB 4LVSA 3IBFB 2YTCA 4JI6K 5KFWA 3KNAA 3NH0A 2A3ZA 1DOQA 3TWZA 1BOTO 4I2DA 2Y1IA 8ICOA 3AARA 1HL6A 3OTDA 1SC3B 1S0OA 3W9HA 2EAMA 2P9UB 1TVRB 2JWNA 1CZAN 2VFUA 4KLLA 4JI3K 2FVCA 1PYSB 4C0ZA 1BUPA 1QZ6A 2FIUA 2H3QA 2KV2A 1WI6A 4OVLA 3KK1B 4DB3A 2RH3A 4K43A 3QIOA 1DGJA 3DLBA 1F0MA 2A2DA 4DX7A 9ICGA 2VC0A 2CG8A 3KDNA 4IO9L 4PL8A 2HFOA 3QFWA 4NWBA 5EGYA 4BC9A 4J9KA 5LSOA 4C1NI 2FVSA 2HSEB 1RYRA 4B3TK 4DV2F 4I2CA 1RDRA 2MHNA 2C3YA 3SCLE 2YBVA 3GZ7A 3QNWB 3QGIA 3OYDA 2OTLS 8ICXA 2R4FA 1M6YA 3QXGA 4CF4A 4CP5A 4KO0B 5ALIA 4Y2SA 1ZAVA 3C15A 3CCSS 3OL7A 3D66A 2VZ9A 3MN5A 1X9WA 5JLFA 4Z4FA 4HUEA 3HPHA 4EP4A 1SVDA 2DXFA 4NM1A 4DMNA 4DV3K 2MKCA 3EJMA 4CE9A 4UZBA 3T1YF 3B6BA 4RWTA 2Z8QA 3I9ZA 1FRXA 2IJRA 1RBVA 1QQ7A 3C6TA 2GMHA 4Z6FA 1IKVA 2RP5A 4RU9A 3FC4A 1JLQA 2XEXA 3UI3A 8ICTA 1X1PA 3ZSXA 4OJLA 4PCQA 1B0TA 1BI4A 2HKEA 3BPDA 2J9DE 4QWAA 2MQNA 1VGYA 2FSKA 3I5CA 2VKRA 5HBMA 5AM3A 5FDLB 3F2CA 4ED6A 2UUCK 3LK9A 2DNZA 3PY8A 4YB5A 5D6GA 4JN4A 3RMBA 4B08A 4RNOA 4M41A 3C2LA 4KN7A 3FZKA 2FLNA 4RLEA 1TGOA 1IQTA 4JWMA 3AM9A 5J2QB 2KZMA 2ITMA 2ZTEA 4IH5A 2MZJA 4O44A 2MQ8A 3V9XA 3H5XA 2BQRA 4FWNA 3QJLA 3S9HA 4WP3A 1ATSA 4TQSA 3MFIA 4PXCA 5H9FK 3SPZA 2RU3A 3BEXA 1NUEA 4B3MJ 4CJ7A 3WEEA 1NDLA 3U8XA 5EX0A 1N63A 3AHPA 1H0HB 1N6QA 5F9LA 1SL2A 4LF8K 5CZVA 2YMMA 2NQPA 5TISU 1SH2A 2XCPA 1UVIA 1JLQB 1ZQWA 5LSRA 3M8PA 3E9LA 2P1JA 3CCES 4DR5F 1N0UA 2E8NA 1RWXB 3SZ2A 5M1NA 2KKPA 1KWMA 3IG8A 3EXYA 3ENWA 6AT1B 3FCHA 2XQCA 1KW4A 2C2RA 2H51B 4IEIA 3F73A 1HBOA 3C15B 4CIOA 5C42B 1CEZA 3SAFA 3DM2A 3VN5A 3OW2M 1VQNS 3RBEA 3QGPA 2X6SA 4JKDA 3BH6B 4E19A 4IR9A 3DOKA 1D1UA 2YNIA 1KOOA 4ZCMA 3VEZA 1H2TZ 4CZEA 4F5RA 3PW5A 2W2NP 2NUHA 4O4GA 1GOBA 4CJ5A 4KLTA 3LP1A 3QJPA 2V34A 3PZPA 4P10A 2KYZA 3WXIA 3OYFA 3HK2A 1K8AO 1EQ0A 4WP8A 1ZS6A 3SBTA 4J7CA 3OYLA 2Q0UA 2R8IA 5IIIA 1NSKL 3GIJA 3DGPB 2C42A 4Y2PA 1I94K 3MEEB 5KFKA 1T3VA 4NRTA 2OYYA 4DTSA 3D4JA 2R7UA 1M5HA 3TACB 4H0VB 1LKYB 3QUQA 2XM3A 2RU9A 4Y2XA 1IJEB 4YNQA 4R5PA 1LB2B 5KFLA 8ICYA 3HKWA 3EX7B 1IBLJ 2YQ3A 2ZXIA 4RQ7A 3IWNC 3I96A 3SCIE 3W61A 2P9UA 2QARA 4YS2A 1CI4A 1IQZA 5M1KA 1ZQYA 1PAUB 2DR9A 3QETA 5G5HA 2WB4A 3O3FA 4DV0K 1HKGA 2G2ZA 3JS9A 1AZSB 4WYWA 3NY0A 2FPMA 2NZ4A 1VK3A 7ICFA 5ETLA 2B4JA 1GTHA 1GNKA 1F1BB 3HD1A 2VOPA 5J2PB 4M9GA 3AQPA 3I0SB 1T3NA 4ZCKA 2HRYA 4QZEA 4W92B 1C2PA 4OFZA 1WC4A 3B54A 5HATA 4KR0B 4IOCL 4M5IA 2RNEA 3I5BA 3BN7A 3CJTA 1RKJA 4FK2A 1QVFR 3BZQA 2ZJQL 1VBZA 2ZH9A 4XRHA 4YQWA 2G0JA 2PFQA 4DQ8A 4JK9A 5HROB 1S1UB 3UKRB 3I0RB 4M94A 1HBMB 3T1HJ 3OVBA 1BWEA 1L3TA 2RDDA 3MM5B 3CC7S 3K9JA 1SC1B 1YIJS 1N36F 3CG7A 1B4FA 3JQMA 4YDDB 3WK7A 3KBBA 1WSRA 2B4OA 3GIIA 1TKXB 2QW9A 1NPRA 1DRZA 3TAEA 2ZH8A 3V6DB 5AI0A 1SXEA 3H8JA 3CD6S 4O0NA 4DOBA 5ALDA 3TSQA 3ENQA 4FXWA 3J7YU 4KGMA 3SMSA 4KV8A 2DGWA 1WKKA 5B0EA 2W4CA 2VG7B 2IBKA 3MD3A 1R0BG 1M90O 2QB0A 1V38A 4NLSA 1FXLA 1S9GB 4O0IA 1DY3A 4I27A 1Z05A 5ADXH 4IO8A 1DQ8A 3CJ9A 4DZDA 2E2QA 2YKNB 2VIHA 4BVPA 3RWUA 5FIIA 1XHXA 1VOMA 4GKKK 2LEAA 3S1TA 3R7NB 1ZA1B 3MGIA 1WAJA 2H3ZA 3WKEA 4O23A 2VG5B 3RF9A 4FZNA 3TEGA 3ZNJ1 1FNMA 2NRVA 2YCHA 4DTRA 3Q8YA 3E01B 4QIEA 3O5TB 3MPYA 2YKMA 2YHAA 1P1TA 1GLJO 4GNIA 2R8KA 2Y9TA 5KFSA 3EGWB 5EY4A 3D2EB 5K20B 5ALOA 3MN9A 4K50A 5GAHP 2J9EA 4QJVA 2LU2A 4A8OA 5KGXA 1N34F 1TKTA 3MTKA 4A8EA 4F3MA 4USMA 1GLCG 4HVJA 1JK9B 1HJRA 3VAGA 3MR2A 3FDSA 1ZQ1C 2WCXA 2AP6A 2JOQA 1ZQTA 1HUZA 3M05A 3BO2A 4ZN3A 4M45A 3IXQA 3K89A 3OBIA 1IJFB 2FBXA 1N32J 4DR7J 1S0MA 3UKUB 2F8SA 1UWBB 1XMQK 2A10A 8ICIA 1O8BA 2MAXA 4CIEA 2HQIA 1HUXA 4BRHA 4LFAF 3H4BA 4BG8A 4AL5A 3IMXA 3AXKA 4CLZA 2CJKA 4GC7A 1M1KO 2W25A 4PZVA 2L9WA 1I5OB 2V63A 3GOIA 1HJOA 5A8RA 3SNNA 1R7IA 3G71S 4EP5A 2QG9B 2HSZA 3MEEA 3AA8A 3PEHA 1RGVA 1F21A 1QE1B 1RQ0A 3L7OA 4HYKA 3MCSA 1CXUA 4Q44A 3MM7A 1S9GA 1ZQMA 3CD6N 4KX5A 3NWRA 1DZ5A 3SMPA 5L9XA 5JRTA 2UV8G 4BWMA 3MDAA 3O6WA 4L76A 1LWXA 3R5BA 4GW6A 4H5WA 2DQNB 1VIXA 1PVRA 1JN3A 4Y2KA 2QMXA 2G07A 3IFRA 4M3ZA 2LQBA 5AXMA 2CXEA 3PO4A 3QICA 3OFHA 4E7IA 4LSLA 1NM2A 3KLHB 1RU1A 5IT9Y 2FYXA 1EKRA 1W2BM 5IV4A 3TFRA 2QSWA 2VFTA 9ICIA 3C14A 1AROP 4KJIA 3M2UB 5AQKA 3W66A 1JLFB 4ED4A 3M32A 3W2VB 1U0HB 2YHBA 3VQEA 1BPYA 2D1KA 1VRUB 5ETTA 3FCVA 3P5JA 4OGEA 2KKHA 3B78A 4DV3J 1W7AA 1EQMA 4QR1A 4V19S 1YF5L 4X62J 3JTNA 5J0UA 4CIGA 4BE0A 2FHMA 3WNFA 5JVGL 4Q8EA 1BPZA 1DXSA 3QIPA 4WF9Q 2VONA 3C6AA 4RQ8A 4LFBJ 4C6AA 1AXQA 3GJSB 1RAGB 4K5SA 1Q8BA 5E3RA 3EGZA 2DGQA 3IM9A 3MM8A 1S6QB 2FDNA 4PWWA 4JD2B 2QA1A 2CPDA 3OFFA 3LDOA 3CMAN 4FJXA 3R5GA 2AYBA 2G1HA 2VG6B 2XMKA 4NOHA 4DLEA 2E9TA 3KLHA 3RB4A 5D0GA 2LLZA 4J03A 4A8SA 1NMNA 1LOTB 2VQFK 1MN8A 1N48A 4DTPA 3D68A 3O1LA 5D8HB 3CDEA 4PYAA 4PGXA 3D0HE 4FPIA 1NAQA 1GMUA 3ID6A 3MMBB 1UVJA 4M95A 4GXJA 2FMSA 1HNXK 2FJWA 1X4AA 3GR0A 3ZYYX 9ICVA 1M90T 4LR7A 1B9FA 5BN9A 4J2BA 1U1NA 2W6LA 1VHFA 2CRLA 4CO0A 3CC4S 2PA3A 1SKSA 4YY3J 3M9MB 3MPVA 4HH0A 3P49B 1BI4B 4ICLA 3DYAA 5AR0A 4ISGA 1CJVA 2KQ2A 1S99A 3AVGA 1D5AA 3OTOF 2HHHK 4LRCA 3GE1A 4OZ1A 1U2CA 4IG0B 1ZQAA 1VSJA 1FFUA 2A6MA 1HYZA 4ECVA 4IJAA 1S57A 1NK0A 1VSIA 4BUGA 2LHTA 2DFFA 1UEUA 2W41A 5ETRA 3OS0A 3DLKB 3MMBA 1ZQFA 1WEZA 2C2ZB 4JI7J 1VSEA 3ZCMA 1OYEA 3QNNA 5SZTA 3IFEA 2V68A 4U67Q 3DXMA 3HHLD 2XICA 1ZAWA 4EELA 4JYAJ 1OY6A 3PHEA 3SQ2A 4ZPAA 5AE3A 2DGXA 1W0HA 2OEKA 2PAVA 2YH1A 4JI3F 1H2VZ 1XWLA 5CD4H 4FF3A 1Z4UA 4BRAA 2VYPA 2FHJD 3MEDB 4ZHRB 3DNCA 3ENVA 2ZEJA 2QE5A 1HD1A 5IXUA 3UE5A 2LQJA 1B0PA 4Q7AA 3TAMA 2K60A 4K25A 4ZK7M 4DTJA 2HQFA 8ICFA 4MQ3A 4WTOB 3P83D 3AY9A 3D45A 3GLJA 1KAZA 4MTPA 5AQYA 2E7VA 2V2ZA 2QL5B 2D3DA 2XIDA 4GIBA 1JLBB 2FSNA 4B3RJ 4HHHA 2ZM6J 3IUCA 3SDEB 5J2EA 3VGMA 5J1EB 3QUCA 1IXKA 4YHHK 1U1KA 4LF6F 4ZVSB 3HLUA 3JPSA 2VFVA 4KB0A 3QT7A 1QSLA 1JLEA 2C3PA 5B08A 3LM9A 2XYGB 5GAGU 2K4HA 2FPKA 1CJKB 2XSJA 1UFKA 3PM9A 1UEVA 1OPZA 1PUZA 1VI7A 2JFKA 4E7LA 3CJKA 2F77X 4QYRA 1U1PA 4NPOA 4BWJA 1S1VA 3NFAA 1RAEB 4EK2A 4WU2A 2P9IB 3A8IA 2OPSA 1LK5A 4JKEA 4CEDA 3UXOA 1WWHA 1BCMA 3T6BA 5AQTA 4AL7A 3KIOA 1N60A 4IQXA 2YQ0A 1KR4A 2DGOA 3AT1B 3PDNA 2OAUA 4LF7F 3CDAA 2WHEA 2VA2A 4WK1A 2A2CA 3BS5B 3QU5A 3LP2A 3M1FA 2XMTA 1MWKA 2CWXA 3VQ9A 3PW0A 1VISA 1T9YA 4K8ZA 1HLUA 1RUSA 4HL9A 5FD1A 4CZGA 1ZD2P 2XHWA 2AX0A 1P27B 2NPFA 3ICLA 2FDRA 1HMVA 4ID5B 2V0NA 1T4GA 4Z94A 1DGKN 1H1VA 4X66J 1AYEA 4FS2A 1O5JA 3LZJA 1YWXA 1RE1B 2YNFA 4UY8T 1Q18A 2F7VA 1DJ0A 1J27A 1BDGA 2K4PA 3HT0A 5D15A 5EE1A 3G6EN 2ZZNA 3WEEB 1JLGB 2LQ9A 5KOXA 3R2DJ 5C15A 1K44A 4QZDA 4Z4GA 4YUDA 2E5GA 1RQNA 3PKYA 5EOYA 1D3WA 5TKWA 4OYBA 4OX9J 1ZQIA 4G65A 3H25A 2P9LA 3ZT0A 2YWKA 4Q8FA 4I6MB 1U8WA 1TFRA 3SQIA 4B1WB 3UMCA 4RBUA 4JV1A 3IN5A 1M5OC 3GBTA 2IBOA 2VF3A 3THPA 4ECYA 2F1IA 2ZFHA 2HNDA 1NGHA 3C2PA 2EEYA 2P9SA 5K8OA 1NSAA 4A8YA 1S6PA 1C1CB 1A9NB 5I42A 1RWMB 1L7MA 1RBTA 1Q53A 1AT1B 3GU0A 1T9UA 3CNHA 3QO9A 2JEFA 3VF4A 5D4BA 1VQ4N 1WSJA 5DZ6A 4UOHA 2GBZA 1U2FA 1S79A 1T6CA 1A0OB 2ZM6K 5AKLA 2RRNA 3JYTA 2DY1A 4FW2A 4FLYA 1IKVB 2KNJA 1ASUA 4G1QB 3VQBA 1N2XA 1E6YA 1HR0K 1ZRNA 1UQVA 2M5YA 1O1WA 2V8PA 4QPXA 1PVQA 3DXSX 3K2YA 1Q4RA 2BJ3A 3ZX3A 3HFZB 2ZUBA 2HRTA 1NSQA 3HRDD 1U26A 5IOLA 3KDOA 2CJXB 1BVSA 2BJDA 3OXFA 3A13A 1FNXH 3VOVA 4QZHA 2BM0A 4I2QB 3ZT1A 1TMJA 4CJTA 3DU6A 1NXIA 3AQEA 3BB5A 2UXCK 2D69A 2OSRA 2EHGA 4DQIA 5I9EB 4WWSA 1NK8A 4BCAA 3KMSA 3O0FA 3GDXA 2CGLA 1I51B 3P4UB 4J91A 2A19A 2FHOB 2LDYA 4KAIA 1NRKA 4P7VA 5GAEI 1KONA 9ICOA 1V97A 4AILC 1KKXA 2IVYA 2IA0A 4OKJA 9ICSA 1YQHA 1QSSA 3N4QA 4JNEA 2AYGA 4CBUA 2V4JA 3RGIA 1NH7A 2BX6A 2GZOA 2VBWA 4E7HA 2CQ1A 4UUWA 2KICA 2E7WA 4A5BA 4DSKA 2U1AA 4CLWA 2VQFJ 2DGZA 8ICRA 1U6FA 3VENA 3NAHA 4YP3A 2VA3A 3TYTA 3ET6A 2GNKA 3L2QA 1LWEA 3MK6A 1ACMB 3S3NA 3GIKA 1CJKA 4BR4A 2ZJ8A 1IBKJ 4F5OA 2ZIWA 3X3UA 3G6ES 4M9JA 3U26A 1FT8A 1SC4B 4XAKA 4ECXA 3CCJS 2HHHJ 1BHLA 5EXWA 4NZ6A 3PACA 1HFEL 3M6ZA 4C8YA 5KFGA 2KG1A 1R8CA 4BC2A 3QEIA 3THWB 1S6PB 2WHOA 3N6MA 4CBXA 4K4WA 4MIWA 1G3OA 2HOQA 1XO0A 4HCCA 3QX7A 2H54B 4YB6A 3D7EO 3PW7A 3GTYX 1HNZJ 1NGFA 3K2PA 2E8OA 5HMMA 1NK9A 1EB0A 4FBUA 2F9TA 4FZMA 2F8LA 1U7LA 2ZWPA 1JROA 2CQDA 4N41A 2OP5A 2D5RA 2Y0BB 4NM2A 3LM2A 7ICTA 3KHLA 4USUA 1BU6O 1JXBA 2RB7A 1I94F 2C2KB 4IOXA 2AXTU 3W9IA 5GVQA 5K8PA 4DV5J 2MU2A 4WFZA 4UB5A 4P2FA 2Q31A 4RZRA 2Q6CA 3EY1A 2BUNA 5BPNA 3C0BA 1YRTA 3AFGA 1KEJA 1ZZNA 3KKFA 2EZYA 3DXMB 2Q0ZX 1FFGB 1N5QA 2G9OA 4CGZA 3GQCA 1KEKA 5T14A 2OPPA 1VLYA 5J8YA 4ELTA 8ICQA 2QFIA 4M5MA 4UAYA 4XK8C 3ZO7A 4DFPA 4HWIA 1QDUB 1XMOK 1BISA 4NXNJ 2IM2A 4KLGA 4U6PA 1N52B 4D3GA 1EWQA 3L6QA 2V67A 1Q81T 5KFFA 1PK3A 3LYSA 3MI7X 3L2RA 5L9NA 1UKUA 2ZM6F 3N01A 3WNEA 2VPZB 5ADZA 3HJVA 4CH1A 3VGKA 1RT2A 4Y28C 4F5PA 4WQ5C 5BYQA 2DIUA 2F65A 5AQZA 2Y9UA 2FC9A 3OBWA 1ZTWA 5KFMA 3D6JA 4DL2A 1J2VA 4IQWA 3QERA 1RWKB 1PGZA 3GYGA 3L09A 3GR1A 3KUGA 1R43A 5DZ7A 4XUSA 3DFEA 4U9RA 3I8DA 3OSNA 4IQVA 1RDBA 3LDNA 5ALJA 7AT1B 4JKHA 3BSAA 4CD1A 3CVKA 4OX9F 2AQ4A 3HFVA 1VR6A 3I55S 1MMLA 4BY9C 4HVZA 3C6UA 4ALZA 3W64A 1RBUA 4E89A 3NF6A 4LF5J 3T1YK 2YWGA 2PMHA 1JLAA 1UJ4A 4FF1A 4ISEA 5D49A 5AQUA 3HSGA 2M4MA 5DO2A 4A46A 4LF1A 1IM4A 4F8RA 3DI6A 2PFOA 3JAMO 2ASMA 1TKZA 5J2FA 2JZ5A 5B0FA 3TJAA 2IHNA 4IDHA 3VZHA 2DTJA 1RTDA 4DSJA 3GFXA 4C9DA 3UE2A 1APSA 4IOAL 4DHVA 4USHA 4P0QA 4X4RA 3PYFA 2XULA 2KJVA 3NCQA 3BZCA 1X8DA 4ZJQA 3THXB 1WKLA 3CPWR 2G09A 1G6BA 3ISBA 2WONA 2WW4A 4OO1J 5AKYA 4F5NA 5BRHA 2XY7A 3FRYA 2CVEA 4PAAA 4C7QA 4IFVA 2YHXA 4KTZA 3LDAA 2QZ8A 2R7VA 3TVZA 3W3DA 3RJFA 1HNIB 2OPQB 3S41A 3NHGA 4PZOA 4K4ZA 4DPYA 1MW7A 1X9SA 3VTHA 1NKEA 3HILA 1U4BA 3Q8VA 2GFFA 3ULDA 2I6WA 1ATRA 3PX4A 1HKBA 4CEBA 4JI5F 1HWKA 1YIJN 1VQ5N 3I4PA 3L7UA 5J2HA 3ZXWA 1YJNS 3KWGA 3EPIA 1ZBHA 1SJ4P 4NLUA 3CCZA 4GKKJ 4P4OA 2P9NA 2YWFA 1PIEA 4DUZF 1P8GA 4HHTA 4NMLA 3VAKA 2F9WA 1H38A 1I3OB 3KUHA 1EAYC 3R2CJ 2CQ3A 4DR1F 1VC5A 3ONNA 2AJQA 3U1MA 2MLYA 1HQUB 2MZQA 2DITA 7ICGA 2ZH6A 2JNJA 4Z4HA 4CGJA 5B09A 3DOKB 4PUOA 1ZBUA 5J1EA 2H1YA 4TU7A 2O4IA 1SKUB 1ZM9A 1NZ8A 2LKZA 4ZPCA 3SSSA 3JSMA 4NYFA 3QYPA 1BNOA 4BGAA 1FRLA 4RQ2A 1MWYA 1K8AT 1OJ4A 2XB2D 2AIRB 3NS1A 3OPXA 3CFOA 1X9XA 1YK9A 3KJQB 1UAXA 2HF4A 4X62F 2YMLA 1KAXA 3N5BA 4PWDB 2J0SD 2DGVA 4P0PB 1PC4A 2MKSA 3ZX0A 2ZVSA 1JKHA 2W6KA 4K59A 3PW4A 3HSDA 1ZM2A 1RTDB 2RSQA 2X6NA 4CTAA 3NTUA 3LW5C 3ICXA 1BA0A 2GWJA 4M63A 5LMUJ 4CLPA 5C0YA 4XDCA 2HLTA 3NS7B 4ZVGA 4ED3A 1FJEB 2IJNA 1S9FA 4PGYA 2GAHC 4OJ6A 3LALA 1CVJA 1YDLA 4DR2F 1RWWB 2ZUGA 1LWFB 1SH0A 3KLIA 4ZLPA 2DRBA 2Z1IA 3HTVA 2D74B 1RXOB 2D4WA 4J9SA 2E2OA 5J8YC 4WQ5A 3OTOJ 4BRIA 1VJQA 1C0FA 1SAZA 1JX4A 1HBUB 4P0PA 1S1WA 1N62A 2XTJP 1L6NA 2H3FA 4N7TA 4OLAA 4PYDA 2E1ZA 5IM0A 3JTOA 4UAUA 1X4FA 1YLXA 3ZZTA 1YJRA 1IM6A 1VQYA 1HQEA 4CLYA 3RU0A 4IQUA 3OJUA 3SUOA 4X2BA 4I2AA 1WSEA 3Q8LA 1SUQA 2NRRA 4CE6A 1Z4NA 2HWHA 1HNWJ 2JVOA 4Z4CA 2NXJA 4CWBA 1VQLN 3GV7B 1CJTB 5D0RA 1NGBA 1Y3KA 1R0AB 2AHOB 2UXDJ 1SQEA 1WWVA 1S0VA 1IKWB 4OD0A 1VQOS 3F9MA 3AA9A 2O8FA 3VAJA 3DLHA 3VCDA 4NXMJ 4W5NA 4IQTA 1SCJB 3AL0B 4LF9F 1UAWA 3AVHA 1I94J 3SV4A 1WC3A 4AHSA 4RNFA 2QLWA 1DGSA 1VRTA 2OPQA 4QWBA 1B0VA 4K0KF 3MEGA 3H0LB 4FLZA 4FYXB 3F9KA 1PG5B 3KK3A 4O5CA 2ZH7A 5AQWA 2YN4A 4AUKA 4KHQA 3PRBA 5DM6Q 3VQQA 3UNYA 4JI1J 2UXBK 3AD8C 1ZQJA 4AD6A 2F9DA 4CEFA 1G4CA 3W8PA 5AJ3K 2AZ3A 1ZD5A 3RRHA 1Q82T 1VRQC 4DZ6A 4YMMA 3MOZA 3FYHA 3QEXA 4X4PA 3VCBA 1PJ5A 3TAQA 5J2PA 1XN9A 3HHEA 8ICAA 3B0YA 1UETA 3VQAA 3V7JA 3OYHA 4OYWA 3ENHA 2H5EA 4CEZA 1C0UB 2RE2A 5CYMB 2VWBA 2MZRA 1RT5A 1WLJA 4U67L 4FLWA 2IVFB 1H73A 9ICTA 2VG5A 2QWOA 4I6AA 3HHLC 2CJ9A 2QYCA 4YMOA 3JB9k 3E3XA 3MDQA 5ALQA 3ZDAA 1K1SA 3TUJC 3LWMA 2V9WA 2Y8YA 1EARA 1FA0A 1FD2A 4Z0UA 1T05B 1JLAB 2UUWA 3K5MA 3E8OA 1HNXJ 2F3NA 2UP1A 4X65K 3R97A 3B0XA 2V51B 4CJRA 1YBUA 3LDQA 5ETKA 1W9HA 5IINA 2E6MA 2DHXA 5EE0A 3MM7B 3MECB 4FM0A 1FRHA 4DUZK 2FMQA 1F3FA 4DPUA 3F0NA 4MEYA 9ICHA 2R2UA 1N5WA 2KFYA 4B3OA 2ALYB 2H9ZA 1XR7A 2A1BA 1XNQF 3TUPA 4C4SA 1Q86O 4X4SA 4QCLA 2QXFA 3ZTRA 1J5OA 1HYSB 2NSCA 2HHXA 4PG5A 2EBEA 4OZ3A 1OPIA 5LMNK 3KOOA 2CGJA 3ZZ0A 5B5EU 1LWCA 3BPSP 2NV3A 1O08A 2MSSA 2XRIA 4RKUC 3ONQA 4TU9A 4F91B 4RQ0A 2ZJPQ 1UJ5A 4OYZA 1HBOB 2HMIB 1N33J 3CW2C 4LFAK 2J0QD 1VBYA 1AQ6A 4CGHA 1FE0A 4YMNA 4FNHA 3GV8B 3ZSOA 2Z7JA 1FJGJ 4MK8A 4JI1F 4C8ZA 4D3HA 2FE9A 3NWGA 4JV2A 2HURA 4J2EA 4BRPA 3GB0A 2ZH1A 3KLEA 3P6YC 2CQ0A 3RH6A 4DCCA 4Q0BB 2KK0A 4NCGB 1X6JA 3LP3A 2DKXA 4B9MA 4E3SA 3OY9A 3NVMA 5K4LA 4E0DA 3O6QA 4DV6J 4P0QB 3OW2R 3QU4A 1AW0A 3L2UA 3RJEA 3W63A 3OR2B 8ICMA 2ZF5O 1RI7A 4IRKA 4CJEA 1NDPA 2RF2A 3LVWA 1D8BA 3B8HA 2LQ5A 4FZZA 1RHRB 5E2QA 5JXSA 5CHCB 2X1AA 2Y1JA 2KM8C 1J2MA 2IIHA 2KE7A 4AXJA 3LDPA 4USAA 5KT4A 4GKKF 2GX9A 4P72A 2CNLB 2XMAA 4K8XA 1ASWA 3TTDA 3M7DA 1GQEA 3V6KA 2FZGB 5ITHA 2O67A 3C29A 5CR0A 2CXYA 4K4SA 2LVWA 4DL5A 3CXCR 1U1QA 4H5TA 2WSFC 3SJJA 2DFLA 3SI6A 4CLSA 4NLDA 5IC4B 4Z37A 1CPZA 3SENA 1YTUA 2VCPA 4ZJLA 1Q7LB 2VASA 4L6V3 4QNLA 4M9NA 1JXVA 2OM6A 4FLXA 2QWMA 3TZXA 3MMVA 1SB3C 2LI6A 1KLNA 3BH7B 2CQ2A 4DR2J 1OH7A 3C8YA 3NEKA 1VC0A 5F0XA 2VPXB 5DB6A 2QLJB 3ET6B 4WFBQ 2K8GA 4RR5A 4IRDA 4WF9L 5H9EK 1RFQA 2FHJA 1ZETA 4QWDA 3J7Z5 1JUDA 2VD3A 3ADAC 2EG2A 4CK1A 3N7SC 2AGPA 2Q3PA 4WE1B 2D3UA 2XG8A 4R0EA 3RMCA 1WORA 5T7BA 4NLOA 2HBMA 2DNOA 1TL1B 4KREA 2R7OA 1DK2A 3P3DA 3RJKA 1KQSR 3B8AX 5HVHA 4E1MA 4B3SK 4C48A 1IR0A 5KT6A 2E8PA 4DI6A 1VQMS 5BOLA 3I32A 1HJPA 2RHQB 3CJ2A 1J53A 2LECA 3MABA 2WVDA 1GLLO 1ZQBA 3THVA 3K57A 4NX9A 1QJHA 3DGVA 2M70A 3H5SA 2NXCA 3RJIA 3DDNA 3HVTA 3M7VA 3G0ZA 3U3YA 3D3BJ 2G0AA 3E2EA 4WYLA 1XU4A 5EE3A 4OGCA 3QMLA 4FOEA 5DBCA 5LOQA 1RSCA 1J54A 3I31A 3CM5A 2P6RA 2Z1GA 2ZH3A 3TAGA 5E0OA 3G8SA 3A5OC 2KJWA 1REVB 3C1ZA 3RG6A 4M5DB 2QWRA 3EW9A 3JPPA 4C80A 4DCPB 3OFGA 1HBUA 2ZVIA 1JLBA 1SV5B 2PYJA 3PXGa 3OYIA 5KFTA 5DK5A 4GO7X 2MKKA 4Y2TA 4AL6A 1GLAG 2GJ2A 1WG1A 5B0GA 3QBCA 3B82A 2E3TA 1UMJA 2J0XA 1JCFA 4A57A 2DEIA 5IS2A 3CYMA 3GMGA 3WQTA 3FAHA 3SR6A 1E6VB 1I1GA 4DU8A 2VG6A 1A77A 1REVA 1ZXIA 2UUBJ 3CCUN 4FZVA 4I2BA 4CO4A 9ATCB 5J2QA 4JKCA 1HI1A 4DV5F 1ZQEA 2G1DA 1F0XA 1YITS 2IRXA 2KL8A 4W98A 1GLBG 3RAXA 5GADU 1Z00B 2W03A 1X5SA 3I6PA 3IRWP 4DX5A 1EP4B 1RYSA 2CZ9A 4ZPVR 3GDQA 3FZMA 4ETXA 3VEXA 4MK7A 3NAEA 3QDKA 2Z1HA 3WDOA 2GVZA 1HBNB 4OKKA 1ZQSA 4U8YA 4B1UB 2DHHA 2DY4A 4Q45A 4H4MB 5GINA 4MIAA 4RQ3A 4CHQA 3LPTA 1FERA 4CZIA 1SQKA 2HBQB 4OYPA 1NOZA 3F5AA 3SV3A 2D7SA 3OUYB 1RXVA 2VB6A 3P38A 4OJ5A 8ICCA 3VQTA 4O5KA 1FDNA 2FSJA 1B7YB 2GHVC 4F0MA 1JL2A 3VETA 4DR5K 2ZJ5A 4B1XB 2G08A 2UXBJ 2PFNA 4WKRA 4FVMA 4M1KA 3D0PA 5T7LB 3T6JA 4LF5F 2JR5A 4KB1A 3IA0A 1UA1A 1B22A 4DBQA 9ICRA 4ISFA 3EGVA 2GJIA 5KG3A 4I64A 1XHZA 3WIUA 4FCYA 3AAWB 3S7RA 2VBXA 1V5IB 3G10A 3RRKA 4ED5A 2CRXA 3Q2SC 1QQCA 1YRUA 3HD2A 1MA9B 1T02A 2AT1B 2CZ4A 2D3OR 3P31A 1F5SA 1FTCA 3HOSA 1FE4A 3UVJA 5BR8K 2FVPA 1NGEA 3VZIA 5DB8A 3OA9A 5FPEA 4ZVQB 4USJC 4R64A 3WKCA 2MPUA 1IR2A 4OJHA 3NMRA 4C98A 2A1JB 4G1PA 1XC3A 3V9UA 1RT6B 3EL2A 4OPAA 1Y4ZB 3TAPA 2DNKA 4DTNA 4F5QA 1XR6A 2Q3SA 2KOBA 1C7YA 2P35A 3HSCA 2XS2A 5D46A 1AA1B 2XWYA 5LY3A 3QEWA 1WF1A 2K89A 4KTQA 3VESA 2F4VK 4MKVA 4IOCQ 1UT5A 4EBCA 4WYBA 2CJAA 4C0OC 1G7CB 3T1YJ 2KJ5A 2W54A 1XNSA 4RQ6A 3OR1B 2GH1A 1N33F 3O5BA 4ECWA 2D0CA 2E5SA 4C7ZA 3QEBZ 2KRRA 5JVGQ 2K2PA 3TAMB 2JDJA 2BE9B 2P5GA 4EHTA 2C3UA 5A2QO 3JQJA 1C1BB 2J8SA 4LF4F 3CMEN 4FSVA 5L8RC 4JD2A 4HH1A 2XGQA 2OA8A 1ZQUA 2V2VA 1NGGA 1LXNA 4LRAA 2W42A 3T5JA 2HIYA 3CRXA 1MROB 3WXJA 1KTQA 2OXOA 4CJQA 2HS3A 9ICQA 4YY3K 1F9EB 4GVLA 4YORA 2QLTA 3GWCA 1W25A 1BPXA 3GFHA 3DOLB 1FEHA 1F5BA 1HQ2A 1U04A 2QA4S 1Y64A 4IOAQ 4ANDA 1QE1A 5BJRA 1U2VB 2FLPA 3ILLA 3UN2A 3OTEA 4TQRA 5ETVA 9ICJA 4LFAJ 5GIPA 3DLKA 2N7YA 3VMFB 4HTIA 4OHZA 5KFAA 4KMUA 3W2WA 4FJLA 3AGKA 4O8KA 3KNGA 4IWVA 3KWIA 1RBAA 1QSYA 2QKQA 4KLJA 1W2IA 3H6EA 4PXBA 4HTLA 3L95X 4OLPA 5L38A 3KZBA 2JEJA 1J5EK 1PKUA 4F4YA 3IWLA 1YZ7A 1J97A 2VQEK 5ALRA 3D6FB 2A3VA 2ATCB 4ZCIA 3K0JA 4TLRA 2H48B 4NEZA 3AOAA 5THWA 1CXQA 4OX6A 4EENA 1VC6A 1ITGA 4DV7F 4HI1A 8ICSA 1XUPO 4RW7B 4I56A 4U7UK 3AAQA 1S5ZA 2DUYA 1YJWS 5I3UB 4WK3A 1S72S 1HNZK 5IIMA 1VQ6S 1U9LA 4BRDA 1D8LA 4WZMA 3P39A 1D9DA 1IG9A 2ZIUA 2OTJS 4KH1B 3QRRA 4DL7A 2ISPA 3HRGA 2GUIA 2PA8D 4CW7B 1WHXA 2DH8A 4JKBA 2WC9A 4NI2A 3T5KA 2BUPA 4Y2CA 3RJMB 4EAHD 4KPYA 1D9FA 4UQTA 3LA0A 3HHNB 2M0NA 2WOMA 2YKPA 3VA0A 3CQYA 1WDTA 2C3MA 2M3DA 3A12A 3THTA 2P6UA 1S6QA 5CD4A 4CZHA 3MHYA 1V3RA 2BACA 2OGUA 2E9ZA 4LSNA 3K5NA 2JJ4D 1FEZA 5KFEA 1KQQA 2GV9A 3R6GB 3W8GA 5AQVA 2VUGA 5ALVA 2ZJRL 5KFHA 3U4LA 1KC8O 4E8UA 3P8BB 5I4MA 2YKAA 4TLQA 1ZBFA 3WQPA 2PXIA 3DLGB 5DJBA 2GMLA 4XEIA 5CAAA 4NLGA 2MY7A 1K0VA 5DDRC 3O80A 3SMVA 4NLNA 4MT1A 2H3VA 1JL1A 2KN7A 1Q7YO 1TUUA 1S3XA 3Q8QB 5IQ6A 8ICGA 4CNZA 4O3SA 1RDDA 1RTIA 3CDBA 4RL1A 2EQYA 3CCRS 4W5TA 4X64J 1S5LU 5MLCV 1D8ZA 5GADP 1ZH5A 3RJHA 5D4LA 3AXMA 1KDHA 4UAWA 1RISA 2VODA 2ITGA 4KSEB 4NL5A 2YKOA 3BSOA 1WOOA 1FK9A 4ZOSA 4J37A 5CZ2A 2LEBA 3CCMS 2ROGA 5AK4A 3Q23A 2D1CA 1RDWX 1UOCA 1DAXA 3ZD8A 5F3ZA 2F9JA 3CJ0A 4PZNA 2FJXA 3J8AA 4CJ3A 5AQQA 5JLHA 5KG0A 1NOYA 1FESA 1UP1A 2O8DB 2R8HA 2CKWA 2DXEA 3IM1A 1T8EA 3KLIB 4UB1A 4WXWA 3VQCA 3WQUA 2KVCA 4BVOA 3HZEA 1D8YA 4NY8A 3AVNA 4MFCA 4CYUA 5C24A 2ISOA 3IAYA 1MROA 5HLFB 1C20A 2XMUA 2XO6A 4Y1DA 1RHMB 3MTJA 1K6YA 3OL6A 4NASA 3HT3A 1VSHA 3M8YA 2CPRA 4CTAB 2VANA 3K4GA 4M6WB 4F0HA 3H59A 2YX8A 4LF7J 1E6YB 1MU2B 3CMQA 4JKGB 3HZGA 4C4TA 4CGIA 4ZPDA 3H1VX 3JYTB 2N4DA 3FFIB 2KHVA 4DR1J 2WF8A 4EEYA 1RZTA 4KHPK 3ALRA 3AU6A 2E7XA 1PYTA 1X2IA 2KVSA 1BY9A 1GK8A 4O3OA 3ZNUA 2AV5A 1RCHA 4CHNA 2FPLA 4CGGA 4QIGA 3HMJG 3F2BA 2W55A 3HZ6A 2WTUA 2A1JA 4UARA 4U7CA 3CCRN 2B51A 3HHKA 3K58A 1A5VA 3SQ0A 1C1CA 5M1OA 4FOIA 5KFYA 4USIA 4H4KC 1VQPS 4X4NA 3K0SA 1CQMA 1PBAA 2HAFA 4HLBA 1SL1A 2QLFB 2Y1RI 2E2PA 1RQLA 2HWTA 1RP5A 4NL9C 2QA4G 3ETLA 2BW7A 2OUGA 2JH3A 4JV5J 3OVNA 5LJ5Y 4A8QA 2HDOA 3PIPQ 1P8ZA 5L1MA 4WJ3B 3M9OB 3Q7BA 4IEEA 1IUJA 4R0JA 5LJWA 2F40A 3EZ5A 1OMSA 5T7LA 4J9PA 3WZ0A 7ICJA 1L3UA 3FE1A 1HW9A 4O55A 5DBBA 1YRXA 3E1YA 5HRNA 1U1OA 4NYOA 3V1OA 1ZD4A 4Y2JA 4OJGA 1K0TA 2MKJA 3SJHA 4DV4F 2K7JA 2VBYA 4US8A 3EWGA 4JI6F 1HQEB 1NGIA 1G1XA 3D9BA 2HNYB 2C1EB 1VQ5S 3DGPA 4LFBF 1SZPA 2IY5B 1HHQA 2VOOA 2J7KA 1Y9OA 4OL8A 4KMOB 3ZT4A 5DMRA 5JVHQ 2QO3A 1TL5A 1RM6C 3DM2B 2R7RA 3OSPA 3TNVA 5B66U 4DSLA 1NK5A 3TUIC 3G6VA 3IC1A 5F1XA 4JYAF 1VQ7N 2H4YB 2QL7B 2BKPA 3LL3A 4IO9Q 4KI6A 1Q8LA 3AVIA 4DV7J 2JC1A 2GVZB 3C7NA 1WSIA 1P9QC 2XGPA 3OTQA 3QNMA 3NKYA 5HR7A 2WF5A 1SL0A 2DD8S 3IWXA 1KVBA 4PG4A 4DV2J 5J2JA 1R89A 2R8JA 1OQ6A 3TP2A 3WX8A 2Q4TA 3L5KA 1TL7A 2XZWA 1RHJB 1XMQJ 1RCOB 1R31A 2ZITA 2JLFA 1PK1A 2RVJA 2HIQA 2L9DA 4DPTA 4GXIA 1FX2A 1H6KX 1UPMB 4ZDNA 1S5JA 4NXMK 4B9QA 3W5ZA 2FVRA 3D2WA 1AZSA 1NGCA 1NLKL 2DTUA 3CMES 5E41A 4FO0A 4X64F 3E51A 1VQ8S 9ICMA 2HHQA 1JLFA 5CCLA 5ALNA 4DL6A 5A8KB 5ADXA 1X60A 3H2VE 3RMAA 5D3GA 4ZPTR 2PD1A 1LKZA 3C21A 2CQPA 1T3OA 2O4GA 4K4GA 3HFKA 4EYHB 3JXOA 2DH7A 4Z7CA 4BHQA 2P9CA 2DVIA 1H3DA 3H8YA 5LXYA 3G8TA 3EDRB 2MUTB 1DQAA 3H98A 1N5XA 4Y2MA 4OMFG 3A5LC 2P9KA 5DB7A 3LPYA 4CM2A 4PHEA 1ZJNA 1S49A 1TL3B 4F3TA 3UIQA 3NVKA 2K8CB 3V81A 1U47A 2E1YA 3SQOP 4XH5A 4QS8A 2BANB 2BTFA 5J2MB 2XHCA 3F44A 3J80O 5FJ4A 3UD5A 2Y9HA 4A2AA 2V8HA 1EETA 5H1SV 3RJJA 2AW0A 1WHVA 3QSYB 3MN7A 2VDIA 2OTLN 3C94A 4JBCA 3VERA 4WFNL 1F44A 3HHDA 2G2YA 4WIQA 1SJ3P 5AIAA 2HAIA 1NHVA 3O4NA 1R8PA 4YR2A 4KPCA 3C95A 3BJYA 1CUKA 4LUBA 4A62A 3QEPA 1HNZF 2HRUA 4DR4J 2NO5A 4B9SA 4DDFA 1SC6A 1UFLA 4NYPA 4K7QA 4NXMF 4XPEA 3O3HA 1NK7A 4DOCA 9ICCA 2A42A 4RUBA 3WK8A 5AKIA 3CEDA 2O8BA 3BGRA 2KI2A 4Y0FA 2AEMA 3JAMU 3K9KA 3G2XA 3Q8PB 2DNNA 3KFUF 4RW8A 2PFUA 4YR3A 4F2RA 1CG2A 3H5YA 2GAGC 3M6XA 3RTVA 1IXRA 5L1JA 4JI0F 2CJBA 2HOIA 4ZH4A 1QQOA 2R18A 1Z19A 1EIYB 3SMZA 4JMUA 2QARB 3F2KA 2WB1C 1KKHA 3PX0A 2JHEA 1SV4A 4M5KA 3U27A 5B0CA 2ASLA 4FJ5A 2OJ3A 2ZJRQ 4NLTA 2YWWA 2C28A 5ETOA 2EDUA 3MPDA 1KVKA 2ACYA 5E26A 4GV9A 2BCSA 4KGXB 3CF5Q 3CTRA 3P5TL 3AA3A 4JI4F 4ECZA 4YCXA 2H5JB 3TA0A 1YJ9N 2YPZA 3IDHA 3MM8B 3GP9A 2YJFA 2DK2A 2JZBA 4QJFB 4QZ9A 1WF0A 3EKSA 4AFFA 2PGCA 2AJ2A 3WNHA 5IWAK 2KO1A 2OMOA 3CJAA 2ZG6A 2FZKB 1Y5LB 5BRFA 5AIBA 4Z6EA 4I2IA 4FWSA 4KLHA 4TY8A 3DOMB 1C0TA 3I28A 1S9EA 2VJUA 3FZ2A 2HEKA 3CJSA 4FWMA 5M1FA 4LBIA 1URJA 3ENOA 2DF4B 5EHHA 3FZLA 1TV9A 1HNWF 2XMJA 4F72A 3L3FX 4U96A 2OPPB 5F8HA 1T95A 1VFJA 8ICBA 4HKQA 4FLUA 1VRTB 1SPBP 1FD8A 5AI5A 1L3KA 3NNCA 1KN5A 4I2QA 3TADC 2Y1LB 3FBFA 5FLXU 3D2QA 5JS2A 2X1BA 2WRMA 3AY0A 7ICEA 4IH6A 5BPMA 3FM9A 4B3OB 3RUBL 3QMQA 3NS6A 4MFFA 1S1XB 2LPEA 2FQQB 4HI2A 1RAHB 2KIWA 2W24A 4AF1A 1YG0A 3UFCX 2B0CA 1YHQS 4DU3A 4FPRA 3KK1A 4H0TB 3EGNA 3R6MA 4DR4K 1E3MA 4OZ5A 1Y5IB 5B0DA 3V1RA 3EE3A 4OI0A 1BPBA 2I5HA 1FWPA 4TUSA 2BKEA 2V2QA 4MJKA 2VPYB 2RMLA 4KLOA 2P66A 2IYGA 2JHDA 2OCEA 1YXQA 4Y0WA 2QA2A 1K9MO 4YOXA 3S01A 3G6YA 4CFBA 2MEWA 5D4NA 1N4LA 1HARA 1QH9A 3LPEA 4DQRA 1DLOA 2ZIXA 7FDRA 2KIVA 3PYDA 3CCWA 2MHEA 2JMGA 2HBYB 1S1WB 1K9MT 1ZQQA 5AKJA 2G0IA 3HKZF 3CFRA 1RBOB 3NL0A 4XA5A 4O5EA 2DNYA 3OT9A 4N76A 1M1HA 1SIWB 5IWAF 4FWQA 4CGDA 2ZHBA 1DFDA 4Q5VA 3KLVA 2FC0A 3CCVN 3MEKA 8ICLA 5K8NA 2X3DA 5GTHU 1GTEA 1V4SA 3OHAA 4W4MA 1BQXA 3RAMA 1SV0C 3UCZP 4I6MA 3ZZPA 1VQ7S 3KD1E 5FPDA 3D5MA 3D6TB 2VV5A 5AK6A 3DDKA 2QEXN 1S22A 2D3ZA 6FDRA 4USKA 3UO0A 5BXIA 1K5OA 3HBTA 3HO1A 2PYLA 2QFJA 4YOVA 3CWJA 3I8BA 1XS9D 5LT5A 2FF6A 3UXNA 1LXJA 3SQGB 1NU0A 3HVRA 4M3YA 3G25A 4BRKA 2IM1A 1COKA 3BGRB 2ZKUA 1KTVA 1CLQA 3TFSA 2J9DA 5KL8B 3OYMA 2A6AA 3VF2A 1DRGA 2A1RA 1GEHA 3LH2S 5A2QU 5JMNA 3PSFA 3HM8A 4N77A 5AQNA 4RJVA 3V4IB 2ZD1B 1WN7A 9ICUA 1FXRA 2ABYA 2VHGA 2M8DB 2CPJA 4DV2K 2JH1A 3H08A 4ILLA 4FJHA 2BEFA 2Z58B 4FKXA 4MDBA 2D41A 3IP0A 2RN2A 3J81O 1BGXT 3PJXA 4IUFA 3OPKA 3KUEA 3R9KA 3GJRB 4AYBC 2KP7A 1SV0A 2ODGA 1X4DA 5KAKA 4LFCJ 1MC8A 3MAQA 5EU7A 2PEHA 2NO4A 1X31C 2DHAA 2GO9A 3N0VA 1P1LA 3GJTB 4PQAA 2A3JA 3OGUA 3GG1A 3L8BA 4MYUA 3D1QA 3SDEA 4X4OA 2LBOA 2BH1A 3DLEA 2ZE2B 4W5OA 3GZFA 1VQ4S 1XR5A 4FM1A 2PMZD 4K4VA 1U49A 3MMCB 4KFBA 5CYMA 2E66A 3L0QA 5CABA 1EQYA 1H2UX 3DLLQ 2QX0A 1KP6A 3ZETB 2EFOA 4CO5A 5FDLA 1A6SA 8ATCB 1H72C 2WZ1A 4BLGA 2L9NA 4CBWA 2YNHA 2KEYA 4RQNA 1BWVA 2D3O1 4C11B 1S0NA 5ALGA 2QV6A 1IV8A 2AA4A 3MXHP 3TABA 3FKBA 3NGSA 3LGMA 1COOA 4DF4A 1HRHA 3JPTA 3UD4P 3TADA 3MXJA 4LRFA 1WHYA 4L8RB 3IBWA 3PV8A 2FHKA 2YMPA 3UPQA 2E1FA 2PC6A 7ICLA 2BQ3A 2W9BB 3U7JA 1S10A 2DRDA 4YY3F 1T9XA 4ED7A 2AYMA 3VGLA 4I2JA 2EWHA 5C2FA 2MB0B 2KRBA 3QAEA 5AE2A 1HI0P 4C3MA 3CC4N 3LP2B 1C0GA 2ROEA 4YFKA 4GC6A 3TA2A 4CHPA 3SI8A 1H98A 1TL1A 1UW9A 3OFEA 3WBZA 3Q8SB 2OSQA 7ICRA 2DIVA 5CP2A 3Q2TC 4JI7K 4XDDA 4MFBB 2K1RA 5KGWA 1VCTA 4MKAA 1NNLA 2OMLA 3WXKA 2H5IB 3D28A 1UWAA 1TFYA 4EX6A 5AQSA 4IFEA 3W0LA 2HHTA 4ZP7A 4UUXA 2B7CB 2KFNA 1MQ3A 4DSEA 3SQ1A 4PY5A 4F04B 5J2AA 1NGAA 3QZ7A 4OI4A 5GMDA 3HX0A 1C4AA 2FLLA <