1NKCA

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after five rounds of primer extension, following incorporation of dctp, dgtp, dttp, and datp.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkcA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkcA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkcA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkcA01
4HUFA 4RNMA 4O55A 3AU6A 3PVXA 4CJLA 4HUGA 3RB0A 3WNFA 5IIOA 1KCFA 4R5PA 5J29A 3LAKA 4RW6A 4M9NA 3SUOA 5KFEA 1T8EA 2NUBA 4YD1A 2OWOA 1R0AA 9ICWA 4B9SA 1NK0A 4O3RA 1HYVA 4EZ9A 3WNEA 5FRNA 4O3QA 1UOCA 5KT5A 4O3SA 2I1QA 4CFBA 3AO5A 1NKEA 1JLGA 3LALA 3M8SA 1S0VA 5DB8A 2FBTA 4ECWA 4DEZA 4YFUA 4FLWA 4MFAA 4LY7A 3RMDA 4IBNA 1U49A 3TAGA 3M8QA 8ICXA 3QEBZ 1X1PA 9ICRA 4QW8A 5DG7A 3TR8A 2KFNA 4CEAA 3ZDEA 5KFSA 3S3OA 1KFDA 1ZQUA 1HPZA 4JWNA 4NLZA 1EX4A 2HVIA 8ICLA 1LW2A 3NF8A 5DMRA 4DSLA 2IAJA 3H8JA 3O3FA 3OYLA 5L9XA 1JLEA 4K8XA 2GWSA 2D0CA 4IQVA 2ETJA 4O3NA 3DMJA 4C8LA 3K58A 4ED6A 4J9QA 4RG8A 1O1WA 4KI6A 4NYNA 1ZQNA 1S1VA 4AHCA 3RMBA 3OYBA 3DLKA 4FJMA 1BPYA 4CJPA 2C2DA 3VN5A 4EYHB 2YNIA 5J2HA 4BXOB 4PWDA 8ICMA 4GVMA 4IDKA 3Q8QB 1QS4A 3V7JA 3MR3A 3Q8RB 5DKWA 1D5AA 2W8LA 1S9FA 3KKRA 3MDCA 2KN7A 4YVZA 5CB1A 2BQRA 3RMAA 1D8YA 3TAPA 3OYKA 4K8ZA 7ICUA 5DDMA 4N47A 3AO2A 3I0SA 1HJRA 3KHLA 4DQQA 1CXUA 1RBUA 4F4ZA 1ZQHA 9ICFA 5JS2A 1XC9A 4F2SA 5HP4A 4DMNA 1J53A 4CFCA 3TAMA 5J2NA 1WCLA 7ICOA 4DF8A 8ICUA 4OVLA 4Q44A 5DDYA 5J0WA 5KFNA 4E7IA 2J6UA 3QIPA 4Q5VA 4Z0UA 2IBKA 3H08A 2AGQA 2HHUA 4HUEA 4YMMA 4GXKA 9ICBA 5CZ2A 2BDPA 4Z4HA 1BISA 4RQ8A 4HCCA 2JGUA 3PO4A 2OPQA 2ASDA 1C0UA 1UAXA 4JV0A 5CWRA 3H4BA 3VQ5A 2ZJ5A 2P5GA 4F4WA 4B9MA 2ZJ8A 1ZQQA 2F1IA 3ORYA 2BPFA 1HQEA 1BIZA 1NOMA 2NRWA 3LWMA 2RDJA 3SQ0A 4F5NA 4GXJA 3Q8MA 2KFZA 2RF2A 4OJRA 5L1KA 2YNFA 4C8NA 4DG1A 4DSKA 4JWMA 3NFAA 4FJXA 2I5JA 1RBTA 4BE2A 4BDZA 4IQWA 2A1RA 3TABA 3SQ2A 5KFLA 4DFMA 3PW7A 2NRXA 1QLNA 5DQIA 2YNHA 3HVTA 4UB1A 2BPGA 3RAQA 5J0SA 4ED8A 1IKXA 1WSFA 1ZBLA 2A1JB 3QO9A 4QZEA 1SKSA 3AVJA 4P4OA 4OLAA 1BQNA 3JPTA 3PW4A 3NBPA 1VSDA 4DTSA 5CA7A 1U47A 7ICPA 2ZE2A 3KLFA 4O9MA 2XCPA 1GOAA 3PMLA 4RW7A 3E2EA 4CECA 5CZ1A 2VA8A 1X9MA 1RTHA 1L3TA 3KK2A 4H4MA 2UVRA 1BQMA 5KFPA 1I39A 1BGXT 1V9PA 1HUZA 1LW0A 2HHSA 1PZNA 3DM2A 4F93B 4RUAA 5IILA 1WSIA 3ITHA 4QOZB 4KLFA 3SQ1A 4IR9A 4XQ8A 2HHWA 4AHUA 3JSMA 4F3OA 5J2GA 3CM5A 3VQPA 3VQ6A 2JEIA 4FJNA 2Z1JA 4Z4EA 1XS9D 3KTQA 4CJSA 3RRHA 2BGWA 3Q8SB 4LD0A 1TK8A 4CEEA 4KN7A 3V7KA 1IXRA 4KLJA 3ZDAA 4Z4GA 2B6AA 1IKVA 4FLVA 1TVRA 5KRTA 1BHLA 2F96A 3NF6A 3ZD8A 3N97B 1VSHA 4FZYA 3PR5B 3RH4A 3RTVA 4BGDA 4IG0A 1JLAA 4M0AA 4FLYA 3H8WA 1SKWA 2PYLA 3IHQB 4Q0BA 1JXEA 1C1AA 4IRDA 5HP1A 3JPSA 4QZBA 4DFKA 4DL4A 3RH6A 1IH7A 2W9BB 1B9DA 1KEJA 2ISOA 4H4OA 1VSEA 5J2DA 4BDYA 1SL0A 4HTUA 1HNIA 3TANA 4ZHRA 3KJVA 1S0NA 3PX0A 3N4MB 2ZUDA 1Z26A 3UXNA 3HK2A 8ICCA 1S0OA 5KFXA 1VK0A 3C95A 1JLCA 4PQUA 3OYEA 8ICFA 4F4KA 3KLIA 1UA0A 2P6UA 4Z4FA 3K2PA 5DBCA 4DOBA 4N5SA 2HHVA 5KT3A 4DQIA 5KFBA 7ICNA 3HL8A 3HP6A 2XRIA 2WOMA 3ISNC 5D49A 5J2CA 4DTRA 4YD2A 1Q8IA 4CEZA 3AVGA 4RZRA 1CZBA 4J9OA 3MXMA 1ZQYA 4CJ5A 3KLGA 2FMSA 1N6QA 4CJTA 1ZQEA 3KD1E 4NLNA 1F21A 2ISPA 2ATQA 3AVBA 4FBUA 4UQGA 3T5JA 3UQ2A 4J9LA 5DG9A 1DLOA 4CJFA 3AV9A 2FLLA 1JLQA 8ICHA 1K1QA 1KLMA 1ZQMA 2ZJAA 3HPOA 3PMNA 1S6PA 5DQHA 3RB6A 1JL2A 4F5QA 5KFYA 1WNSA 3SNNA 4JK1A 4M9GA 4CEQA 4I28A 3AVHA 3K57A 5KFQA 5KFKA 4P4MA 4KLSA 1XU4A 2ZD1A 8ICNA 4CJQA 3UIQA 4L8RB 2GV9A 2VA3A 4OKKA 3SPYA 2UVWA 2ZTCA 3RRGA 4NLKA 4KMUA 4NCGA 4CGGA 2XHBA 3H8SA 3EYZA 1A5XA 3GIKA 1Q9XA 3AA3A 4E7JA 5J0YA 5JS1A 4J9SA 2X6SA 5KG7A 4KB0A 3RH5A 4PPXA 2NRTA 4B8CA 3ZSWA 9ICNA 1KTQA 4NYFA 2PXIA 2IA6A 4F4YA 3D45A 4X5VA 4FJ5A 2FPMA 1NK8A 4PHDA 2MAXA 5KFAA 3O4NA 4KITB 1QE1A 3PV8A 4B08A 3U3YA 2IGIA 3QEWA 1Z25A 1BPXA 4R8UA 1DOQA 4ECTA 1H38A 2IDOA 3NGDA 4CGIA 4LSNA 4QZIA 5KRSA 2BKEA 2NRZA 2D0BA 3CYMA 3Q8PB 1RT1A 3ZDCA 1U9LA 4UBCA 3ISDA 3GV7B 3BQ1A 4W5QA 3KHHA 2F1JA 1Z00A 4I2HA 4B9NA 4CEBA 3EY1A 4CK2A 1ZQSA 3KLEA 3VQDA 1CUKA 2R8HA 4PHAA 2AU0A 1VSKA 4F3TA 2P5OA 2IS3A 4RQ7A 1U48A 2OPPA 3Q8KA 3S3NA 4EEYA 4ECZA 3H7IA 3C23A 4RQ1A 5D4BA 4CESA 2FPKA 2BCRA 3GILA 3PW5A 4KTWA 2ZQBA 5K14A 3VA3A 4KLHA 5KTQA 4CJVA 3AVKA 4E1MA 4UB3A 9ICPA 3ZSVA 3IAYA 2V9WA 1MQ2A 4M9LA 1ZQDA 1EP4A 4KLEA 5KG4A 3T5HA 4RUCA 2BQUA 4CF8A 3S3MA 7ICLA 3QETA 4FJIA 5DGBA 4OGCA 2G8FA 4I2DA 8ICTA 2VWJA 1VSJA 3SCXA 1ZQVA 3TAEA 2BANA 4BE0A 4DLEA 5IIKA 4ECYA 4ED7A 1NK4A 1RT7A 1B9FA 4F91B 3SI8A 1RCHA 1J9AA 1SL2A 4CF9A 3V9XA 1VRUA 3ETLA 3OHBA 4CHPA 3B6OA 5KG6A 5I42A 4ED1A 4OKEA 5TZVA 8ICOA 1TKXA 2PFQA 4W5OA 1N48A 4DU1A 2FMQA 3RR7A 8ICYA 2VG6A 8ICPA 4E0DA 4EP4A 3BQTA 4J2AA 1S1TA 5KT7A 4YXJA 4KLQA 1TL3A 4XA5A 2XGPA 2R8IA 3OYCA 1U04A 2JLEA 4YG2A 1ZQJA 8ICZA 5CY4A 1C1CA 4CJ3A 3DRSA 3S9HA 3HW8A 3CG7A 5HBMA 3MECA 2QXFA 4CEFA 1ZBIA 4H8KA 3RJFA 4LH5A 2W9CA 1GOBA 2OA8A 1D9DA 5KFFA 4KAZA 2VWKA 1N5YA 3DLRA 4DOAA 4OLBA 1ZBUA 5BOLA 3JPNA 3SI6A 9ICMA 3PX6A 3CFOA 4I7FA 4MF2A 1KVBA 3IG1A 2HNZA 4PHEA 4RQ4A 2A1SA 4KO0A 2D0AA 3DLGA 5KT2A 2BCSA 1SUQA 4KLTA 2J6TA 3PNCA 3VQ9A 1FKOA 4FJ8A 5HRRA 4M6WA 5C42A 4QZCA 2C2RA 4DO9A 4F2RA 2DFHA 4FZZA 4KLOA 4FO6A 2VG7A 1JMSA 3PW2A 4O3OA 4G3IA 1BVSA 5FRMA 2HMIA 1WSJA 7ICFA 1XO1A 3F9KA 4GMJB 4FJ9A 4AHRA 4FS1A 2I9GA 5KFRA 3HSTB 3OYHA 2VANA 4UB4A 4FJJA 2E6LA 4M3ZA 1RPLA 8ICQA 8ICRA 4KHWA 5KFGA 1ZQTA 2DY4A 1RTIA 3QEPA 2AQ4A 3PW0A 1JX4A 4IQTA 1RXVA 1NJZA 3MABA 2P6RA 3ZDDA 4M41A 4DTNA 2QK9A 1RBVA 1X9WA 4B8AB 1CZ9A 1HUOA 4I9LA 1RTDA 4RW4A 3ISCA 1NK9A 1B22A 2JEFA 4E89A 1CXQA 3AO4A 4RPXA 4E7HA 3K59A 1HYSA 3KHGA 1IG9A 2KZMA 4J9MA 4Z4IA 2G8VA 3TQ1A 1K1SA 3G6YA 4I2QA 5J2AA 3PX4A 9ICXA 4KKOA 2JZBA 4OPKA 3HYFA 2XCAA 4QWDA 4TQRA 2KQ2A 5KFJA 4I2JA 4PGXA 1ZQBA 1KRPA 4FW1A 3RAXA 1C1BA 1S9EA 2YKNA 3ZCMA 4KHQA 1NK5A 4FYDA 3ZDBA 5EWEA 1EXQA 4F8RA 2DPJA 5EOZA 3ZT1A 1SV5A 3CM6A 2DFEA 3KIOA 3I8DA 3RB4A 5CYQA 1RDBA 2C2EA 2XY8A 4NXZA 5KFOA 3L2VA 4MF8A 4ECUA 3P83D 5FDLA 1A5VA 2G8WA 4KTQA 4RQ3A 4QZ9A 2RDIA 3C21A 1Y88A 1Y97A 4QCLA 2BPCA 4KV8A 2G8UA 4IRCA 3RJHA 2YKMA 4JLHA 3MR6A 4J2BA 4GC7A 1JLBA 4I2FA 3OYAA 1TV9A 5KFVA 3QINA 5EWGA 4QAGA 2FPLA 4E19A 1XWLA 1L3VA 4YCXA 2AGOA 4MFCA 4TURA 4CJ4A 3D0PA 4O3PA 4QZFA 3OYGA 1SL1A 3GIIA 3QNOA 2NRVA 4RQ0A 4DWIA 1TVAA 8ICWA 1MQ3A 3AA4A 2MUTA 5DB9A 4F4XA 1HYZA 5T7BA 9ICEA 1VSLA 3TFSA 1LWCA 3TAFA 5BPCA 2W9MA 4DQRA 3K5OA 4BDPA 1ZBHA 1D9FA 3NGIA 3K5LA 1JIHA 4J9PA 5E41A 4B9TA 3HM9A 3UXPA 3CFRA 3NDKA 4J9KA 4M3XA 2HB5A 2DFFA 5CR0A 2ASLA 4PA1A 4RNNA 4TUSA 5DGAA 1S76D 4CIGA 1IKYA 2C28A 3NF7A 3RR8A 4CHNA 4GLXA 5HRPA 1VSMA 4YP3A 2BCVA 3THVA 3OVNA 2KZZA 3T5LA 1KVCA 1MSWD 1WSGA 4CGDA 4QZDA 4KLLA 2BHNA 1ZQFA 3ZSYA 2GUIA 3B6PA 3C2MA 2Q3SA 4ID1A 5J0UA 4KRFA 2P51A 1WCNA 1VRTA 4FS2A 3OY9A 7ICKA 1TKTA 3ZD9A 3U6FA 3SYZA 2YHAA 4YNQA 4G1QA 1CEZA 2C22A 9ICLA 4I29A 2ALZA 1HNVA 1ZQPA 3AA2A 3TWHA 1L5UA 4RQ2A 4FJLA 1EKEA 1RT6A 1RYSA 3L2UA 2B5JA 3CFPA 4KHUA 1REVA 5JUMA 3K5NA 2FBVA 2W9CB 5KFDA 5J2KA 4KLDA 4CGHA 9ICAA 4YR3A 9ICOA 3EZ5A 3NH1A 1U4BA 4Y1DA 3VQAA 7ICRA 4YQWA 3V6JA 4Y1CA 4DQSA 3Q8LA 4DU4A 4BE1A 3NGZA 3AVNA 3PO5A 4O5EA 4CJRA 7ICEA 2FLNA 1XHXA 1NOYA 3DLHA 3AUOA 2EHGA 4EBCA 5IIJA 5CHGA 3QZ7A 4YR0A 3EWAA 4IR1A 3JPQA 1K6YA 9ICSA 4UAWA 2HW3A 1GOCA 4M04A 4AHSA 3RJJA 3T1AA 4ECQA 4I2GA 3V9SA 4I2EA 4QWCA 4YMNA 4GW6A 4DSFA 3P1GA 1C0MA 2PYJA 2PI4A 1WAFA 3RJIA 4PHPA 4FK0A 5J2IA 4LVSA 4IQUA 1Z3EB 3MBYA 3AU2A 1W0HA 4DQPA 4O0IA 4CK1A 4RQ5A 4EYIB 3C1ZA 3NH2A 2V4QA 4W5RA 4FM2A 1QQCA 3V9ZA 2B4JA 2P1JA 3HPGA 5HHHA 4Z4CA 3G0ZA 4QZAA 4N76A 2DPIA 4BXOA 1WLJA 3QIOA 4RT2A 3C5GA 2O4GA 1ZQXA 4FBTA 1L3UA 1RT2A 2J6SA 4CGFA 3QEXA 5J2MA 1KSPA 3C6TA 3H40A 9ICHA 4ZH4A 4CHZA 2YNGA 1S1UA 4R66A 3ZSZA 7ICJA 4NM2A 4NLGA 4NM1A 1S10A 4KLUA 4FM1A 4M3RA 3SJJA 4QZGA 5KFHA 5DG8A 4QZHA 4MFBA 5J0XA 2BGGA 1XSPA 4I27A 1WSEA 3IS9A 1C6VA 8ICBA 1QSLA 3SV3A 3L3UA 1LV5A 1QSYA 2FMPA 1XHZA 2HVHA 3KD5E 1HQUA 4ECRA 9ICTA 3VQEA 3OYFA 4IG3A 4KLIA 3M8RA 5L1IA 1ZQRA 4GXIA 3LZJA 1T3NA 4KHYA 9ICCA 3TARA 4RQ6A 5L1JA 4TSXA 3ZSQA 3NE6A 1A5WA 1LWEA 3BJYA 5DLGA 3VQQA 3DOKA 1MC8A 3VQBA 2VG5A 4FVMA 1SKRA 2KW4A 1RTJA 1S77D 4DL5A 3MFHA 4UBBA 3KKSA 3QEAZ 4MEXA 1RT5A 4UB5A 3VQCA 1AROP 3G6VA 3ZSOA 1TKDA 3BQ0A 3L8BA 2OZMA 7ICTA 2BCUA 3MAQA 3LP1A 4EZ6A 3WNGA 3RJKA 1ASWA 4CGJA 2Y1JA 2E6MA 5EWFA 1S9GA 1TGOA 3V7LA 4B9LA 1MU2A 1DTTA 3QESA 3SUQA 3BDPA 1JLFA 3RWUA 4CJWA 1S97A 1RT4A 1ZQCA 1UT5A 4I2CA 1EETA 3P5JA 1RT3A 2A1JA 4CHYA 2B21A 4DL7A 3MEEA 3KK1A 4R63A 1TL1A 4KN4A 3MFIA 5HRSA 1I3AA 3RJEA 3C94A 4W5NA 4DF4A 3MR2A 3M9MB 4KHSA 3RBDA 5EU7A 2PI5A 4FM0A 1COOA 1BCMA 4KHNA 4BACA 4KREA 8ICJA 4JRPA 4FZXC 3MEDA 3U3GA 4JUZA 3VQ7A 5BOMA 4ECSA 5SZTA 4ZTJA 3AVFA 4M45A 4TQSA 1RDCA 3B0YA 4IFVA 5CP2A 3SV4A 1BPZA 3ZT2A 3ULDA 4XUSA 2GBZA 3FYHA 5KI6A 2R8GA 4AH9A 4P2HA 5J2QA 7ICQA 5I3UA 5IIIA 4PUOA 1A77A 3V6HA 5J2FA 1LB2B 4M2YA 3OYDA 5HRNA 4FK2A 1L3SA 5KG5A 3V72A 3ZT0A 3NF9A 4O0JA 4XRHA 1SZPA 3LWLA 4E7LA 1ZQOA 3OGUA 2XC9A 4B9VA 4I2AA 3GIMA 3V4IA 4RPZA 2HHXA 7ICSA 1X9SA 3T3FA 2XY7A 4JV1A 4O5BA 1C0TA 2ZTDA 4GC6A 3QERA 1ZQWA 4CK3A 5HNKA 4DOCA 1J54A 4DTPA 8ICVA 4YR2A 3PY8A 4RT3A 3UXOA 4EBDA 1ZQZA 3RJGA 3AVAA 4I2IA 4I2PA 3ZSRA 2W9BA 2BE2A 3KK3A 3NCIA 4FLUA 4J2DA 3O3GA 1KVAA 3PUFA 3V9WA 4DU3A 3GV5B 3OHAA 3QZ8A 1NJYA 2ZUCA 5FROA 4J2EA 2YV0X 4KLGA 3GQCA 2F8SA 3SQ4A 2X74A 2WONA 4OPJA 1NOZA 3SPZA 4JS5A 5J2JA 4FJ7A 5KFZA 4J9NA 2OPSA 5DLFA 2IHNA 5J0OA 1T05A 1WN7A 4YN4A 8ICGA 1B92A 1RXWA 3ZSXA 2XO7A 3PR4A 4CJKA 4KPYA 1IKWA 4DTMA 5HHIA 2JEGA 2BQ3A 1RDAA 3MR5A 4TUPA 4FLTA 1C7YA 4QWBA 1BIUA 4CEDA 3DI6A 2G8IA 3C2LA 5J2PA 3NH0A 4CHOA 3DLBA 5KGXA 5KG2A 4DSEA 3FFIA 1U45A 3MGIA 3DLEA 1UWBA 1T4GA 2ASJA 4KLMA 3QEVA 2RPIA 3O3HA 3MGHA 3LDSA 1ZQLA 1FXXA 1WSHA 1ZQKA 4FLZA 2UVVA 5HMMA 5DQGA 4FLXA 5KT6A 1NKBA 4ELUA 4JRQA 3HO1A 1KLNA 3EPIA 3LAMA 4EP5A 4CERA 3H4DA 2KTQA 4LZDA 1JXLA 2PFPA 1BPEA 1BL3A 4QWAA 4Z6CA 3GDXA 4OKJA 5KFIA 4N41A 4KB1A 4PGQA 2WTFA 4ICLA 3GFKB 3EPGA 3LZIA 4I2BA 4PY5A 3LK9A 2F1HA 4ZTFA 4R8UB 2W9AA 5J0QA 2Z1GA 2PFOA 3QEIA 5KFMA 4F92B 2FBXA 9ICGA 9ICVA 1S0MA 1KDHA 3V9UA 1ZQIA 3ISBA 1YTAA 3ASMA 4NCBA 1VSIA 3JPOA 5D46A 1YVUA 4LSLA 2G8KA 2EX3A 5CJ7A 4RNOA 2FC0A 4DFPA 4RPYA 3OSPA 5KFCA 1XI1A 1Z00B 4CCHA 4AHVA 1A76A 3HVRA 1JN3A 3SUNA 7ICVA 8ICEA 3M8PA 1BI4A 3E01A 4CIFA 2XGQA 3G6XA 3L3VA 1ZBFA 2H5XA 4HYKA 2IC3A 9ICUA 3AA5X 4DFJA 4ELTA 1YTUA 3TFRA 3OS0A 4DS4A 3JPRA 4M3YA 1FK9A 5IINA 4QZ8A 5KFWA 9ICJA 7ICIA 8ICIA 4N56A 4CJUA 1S1WA 4Q45A 1D8LA 4KI4A 4WE1A 1TK0A 4M9JA 3HT3A 3G10A 2JEJA 4FJHA 4LZGA 3C2KA 2E4LA 5DK5A 4EBEA 3KLHA 3BQ2A 1KFTA 2O4IA 2DTUA 4CHQA 3OS2A 4NY8A 4FJGA 4B3OA 4Q43A 1S5JA 1BPBA 3VQ4A 4FXDA 3ZT4A 2W42A 1DGSA 2R8JA 5CYMA 1RBSA 2OPRA 4C8OA 2ATLA 3L2QA 5KG0A 4DSJA 4UAZA 1N56A 2OZSA 1IM4A 4K4GA 2IMWP 3DRPA 4YFKA 3A2FA 4KFBA 2VA2A 4E1NA 3K4GA 2X78A 3OSNA 2LYHA 5L1LA 3VA0A 1B43A 1LAVA 3MDAA 3KHRA 3V1RA 3RBEA 3AVIA 3V6DA 4C8KA 3OS1A 4FW2A 4NCAA 3AVLA 1S6QA 4E3SA 4E7KA 2ZTEA 4HHTA 4J9RA 1NKCA 4DSIA 2QKBA 1W9HA 3AO3A 1RBRA 4DTXA 3UPQA 4FCYA 4Q8FA 4JS4A 2UVUA 3NHGA 4RU9A 3DRRA 4LH4A 3B0XA 4RW9A 4FJKA 1QTMA 4IRKA 8ICSA 2HNDA 4CJEA 7ICGA 1J5OA 5J1EA 2RN2A 4R64A 2RKIA 5DBBA 4UB2A 9ICQA 7ICHA 4F5OA 3HX0A 1XSLA 4M3UA 2F8TA 3TI0A 3LP2A 5DB6A 3RMCA 4M6WB 4CIEA 3V1OA 3L2WA 3ALYA 3BGRA 4AHTA 3AVMA 4CE9A 2XY5A 3EW9A 1HJPA 2XY6A 3LDAA 3QNNA 5J2EA 1WAJA 3V81A 3L2RA 1JXBA 4PGYA 2BCQA 8ICKA 1NK6A 3OJSA 2FLPA 4IFYA 2FBYA 1KFSA 3MEGA 2HNYA 3V6KA 4MEYA 5KT4A 2HHTA 4CF2A 4DL3A 3SZ2A 2IOCA 5KG3A 4O5KA 5KFUA 4K4HA 4CF0A 1DTQA 3OJUA 1EXNA 1RILA 3QLHA 2M9NA 5IIMA 3V1QA 2HHQA 4DL6A 4FK4A 1ZYQA 1IO2A 3NAEA 4DS5A 3OYNA 5HROA 3WNHA 3O4QA 4O4GA 2R8KA 3VQ8A 4ED3A 4DL2A 4JV2A 4BWMA 1ZQGA 1YT3A 3K5MA 4HVJA 2ZUBA 3UQ0A 3SUPA 1NJWA 3GV8B 4ED2A 3LPTA 5J0RA 4M3WA 5KG1A 2X6NA 3IRXA 1HMVA 4ID5A 1ASVA 4KTZA 2QKKA 4ELVA 5D3GA 2JZBB 1FKPA 4F5RA 4BWJA 1TV6A 3TAQA 4Z6EA 9ICKA 3CQ8A 4PH5A 5C24A 5DBAA 9ICIA 4M47A 1QSSA 5KGWA 5F9LA 1RZTA 3K75D 1BPDA 4K4IA 4M3TA 3LPUA 4MQ3A 3MXIA 1TKZA 3C6UA 1S1XA 3HPHA 3FDSA 2Z1IA 4I9QA 2PY5A 4Q8EA 4UAYA 3T19A 1XSNA 3HJFA 2YHBA 1JKHA 1TK5A 4O5CA 3F73A 2BR0A 4C8MA 1G15A 4O44A 1JL1A 1Q9YA 4IKFA 2D5RA 1TAUA 2Q0ZX 4ED0A 1X2IA 8ICAA 4Z6DA 1BI4B 2V4RA 2AQ0A 3QE9Y 1LWFA 2Z1HA 4W5TA 3OYMA 1ZQAA 1RDDA 1QHTA 4CEOA 1ZETA 1UA1A 3I0RA 4CF1A 3T5KA 2W8KA 3NGYA 3M9OB 5J0TA 1NK7A 2P66A 1BCOA 4DLGA 2IHMA 3RB3A 5C5JA 3NTUA 2MUTB 4YXMA 2Y1IA 4Z6FA 3HP9A 2AGPA 4RW8A 4P4PA 1RNHA 2DFLA 4DTJA 1T03A 4XIUA 5J2BA 1ASUA 4DTUA 1ZJMA 4CFDA 2R7YA 3M9NB 2PFNA 3C1YA 4F50A 4F5PA 4ECXA 3HWTA 3LANA 4CFAA 3LP3A 4MFFA 3MXJA 5DB7A 3DOLA 4AILC 3OYIA 5HLFA 4OGEA 1UT8A 3JPPA 3AVCA 3GIJA 4B9UA 2AJQA 4ECVA 4R65A 3C5FA 2LSNA 2KZ3A 4QW9A 5C25A 1ITGA 1RYRA 1NJXA 1TFRA 3DYAA 3LP0A 3ZT3A 1ZJNA 2OYQA 5J0PA 2PZSA 1VSFA 4M42A 3IM1A 5F9NA 4HCBA 1LAWA 4YMOA 3AO1A 1HRHA 3HXMA 5SWMA 2ITGA 2G8HA 4DTOA 5HMLA 1TAQA 4M9HA 7ICMA 3OYJA 5KFTA 4QWEA 3JYTA 1T7PA 1CLQA 4TUQA
chains in the Genus database with same CATH superfamily
1MROB 2DCLA 3WNFA 4BC4A 4KH5A 4R5PA 2DEIA 2CNLB 5J29A 3LAKA 4M9NA 1A6LA 3P49B 1T8EA 4YD1A 1R0AA 4B9SA 1F9FA 4OYXA 1NK0A 4O3RA 2CUYA 1HYVA 2I0XA 3C14B 3KJNB 3F5TA 1UOCA 1NNLA 1FEZA 5KT5A 4P10A 2DRBA 3DGPA 2W11A 3CDEA 3TTCA 3CNQP 1S0VA 4P71A 4X62J 4ECWA 1FT8A 2OEJA 4EIAA 3A3PB 2KI2A 3V81B 4TYBA 4JV5J 3TAGA 2KLAA 4LF6J 3A8IA 3M8QA 1FKAF 3H45C 3RBXA 3QEBZ 9ICRA 3TR8A 4K4ZA 2KFNA 2MHEA 2DVIA 2Z2MA 1YX2A 4NLZA 4LUBA 4DV1K 2R2SA 1MWKA 3TUZC 1Q3VA 3UCZP 4C0ZA 1JB0C 1XMOK 4OJOA 1DTQB 2W54A 3SSSA 4K8XA 2UUBF 3QLHB 2ETJA 1S7HA 4O3NA 3DMJA 3K58A 4ED6A 1UJ4A 4HLBA 1WTFA 4QIWD 2L08A 3ZXWA 2GO7A 3OYBA 4FJMA 3SK3A 1P9YA 3H3NO 3VCBA 4EYHB 5GIPA 3KUGA 4BXOB 4NLRA 3A8KA 1OVQA 1QS4A 3D6JA 4LF9F 4NLVA 2FIUA 2A2DA 5DKWA 1MWQA 3SMZA 3QBXA 3KKRA 4JI7J 1V5VA 4CT9A 3UD5A 5HQ8A 3I56S 3O9QA 1FKPB 3CJBA 1S1UB 4WIIA 3G25A 1GK8A 1RBUA 4F4ZA 2RUGA 3O2IA 1ZQHA 1YZ7A 2E1PA 1T9VA 4NL5A 3N5BA 3L4BC 1Q53A 1S1XB 3G87A 4NZ6A 1X8DA 4F2SA 5HP4A 2E1MC 3TAMA 2BE9B 3GU0A 3HDSA 4YY3J 3MM6B 4OVLA 1AB8A 4QS8A 4WZMA 1BXNA 4UZBA 1VOMA 1FJGK 3QIPA 1ED1A 4Q5VA 2MRLA 2LCWA 3H08A 3RG6A 4HT7A 2HHUA 1OPZA 3O8WA 2WB4A 4YMMA 3TVZA 1IIPA 4KR0B 3EN9A 1BISA 3QU9A 2P9KA 2A19A 1U0HB 1NB2A 3OTQA 3FEZA 1RJJA 3CCQS 2ASDA 2BH1A 2D69A 1VC6A 3H4BA 5CWRA 5ETPA 1RT5B 4K41A 4B1XB 2ZJ5A 5THWA 1XNRJ 4B9MA 4M5LA 4FFDA 3FSXA 3NNCA 4RW8B 3F41A 2UP1A 2KHOA 3EO3A 1KC8O 3ZTSA 2KFZA 4RBVA 3CCMS 2ZJRL 3L7OA 2ZC3A 4ES1A 4AQYJ 1DTTB 2RLTA 2ZH5A 2ZBCA 2VQEF 4QIVA 3FBEA 3M8YA 4BE2A 3IUCA 1N88A 2LBOA 4IQWA 2A1RA 4LR9A 1S5ZA 4YOEA 5KFLA 4DFMA 1QLNA 4UB1A 2BPGA 3R6GB 3MF5A 2A1JB 3T69A 1ACMB 2CQCA 3ZEUB 3AVJA 2O8BB 3JTOA 4OLAA 3F53A 3SAFA 1I94F 4PJ0U 1ZAVA 2N3OA 2KH9A 1BWEA 1WEYA 5IWAJ 2DNPA 4RW7A 4JI6J 2F4VK 4CECA 4CIOA 5CZ1A 1VQOS 3EE9A 5I4MA 3KK2A 4H4MA 3K1RB 4C0BA 2UVRA 3C29A 3H25A 2ZIWB 1DXSA 5FJ4A 2WW8A 3MR7A 3AT1B 2ZIUA 2KT5A 2V2ZA 1ZZNA 3X1LB 2AIRB 2V67A 5IILA 3ILIA 1RQNA 3SQ1A 3CF5Q 5DM7Q 4ZLLA 5J2GA 3VQPA 1D0EA 2FJEB 3LW5C 1VI7A 1NNDA 5D78A 4A8XA 4CTAB 3CD6S 4FPAA 2A0FB 3UKRA 4WYWA 1GLCG 2KHQA 3M30B 3Q8SB 2QARB 4LD0A 4CP5A 1WDDA 3J7ZT 3AAPA 4YDDB 1T44A 1IXRA 2H4YB 2B6AA 4DU7A 1TVRA 1C0TB 2F96A 4RQMA 2XQCA 2FUG9 2NXJA 4WK1A 2QMUB 4FZYA 4PXCA 4WU3A 3RH4A 5F0WA 3THWA 3H8WA 4Q0BA 2F2AB 4IRDA 1VQ8N 5AKJA 3J7Z5 5HP1A 3WXIA 5E2QA 3RF9A 2EWHA 3ZI4A 3UO0A 1IH7A 2W9BB 2L3MA 4KX5A 4IQXA 2WUSA 1N36K 5BR9A 4DR3K 4BDYA 1ICEB 4QPTA 4HTUA 2IVYA 4FYYB 2OLWA 5G5GA 3GTYX 4ZHRA 5K8OA 3CC2S 3M32B 4X4VA 1SBRA 2VFSA 4OZ2A 1LW2B 3N4MB 1Z2ZA 1Z26A 3UXNA 3MGJA 3OVSA 3FRYA 1JLCA 4PQUA 4QYZJ 1XMBA 4J9UE 4UOFA 3VGUA 1LOUA 2IRUA 3QU7A 5ETSA 4WQ5A 2D3UA 3EICA 2CQBA 4Z4FA 3D2NA 4NZ7A 2VH7A 3F2DA 1S57A 1FFSB 4K4UA 5DBCA 2WCXA 2VDHA 3BYRA 2HHVA 3DI6B 5CZVA 5KFBA 7ICNA 5AICA 3HP6A 2NPFA 5J2CA 3CNHA 3J7YI 3TO8A 5ALWA 4YD2A 3O9UA 3VGVA 2HHHK 2QWRA 1L7NA 1LOTB 3DLEB 2V4JB 2O8FA 2HOQA 1N6QA 3PEHA 4P7VA 3KD1E 3GWCA 2GAGC 4WYLA 5ETKA 3T5JA 4CF4A 2I8EA 4CZFA 4ZS6A 1M5OC 1HD1A 1U1PA 1N33K 3HZ6A 3TA1A 3HPOA 4CQ1A 1S6PA 5JTIA 5DQHA 4AXJA 5LMNJ 3K7RA 2KMDA 4NLCA 5KFYA 1SXEA 1WNSA 3LGNA 4LREA 2UUWA 4JK1A 4M9GA 4CJ7A 2CQDA 3BKFA 2FHKA 1WUAA 1BOTO 2V63A 2Q66A 5KFQA 5KFKA 4DFDA 1RDRA 4NX9A 4CH7A 2ITMA 1BUPA 5EY4A 8ICNA 3J7ZO 3GCWP 4CJQA 1WB9A 4OKKA 2EEYA 3I9V9 4NCGA 4CGGA 3H8SA 2E7VA 3HKZD 3EYZA 5FLXO 1Q9XA 2HFZA 4WP9A 5J0YA 2EXUA 4DV1J 5AR0A 1YQHA 3W65A 4L73A 1XMOJ 2RF2B 2HQGA 2QT7A 3M8PB 5D4NA 3JS9A 2C42A 4Y2UA 1VLYA 2IA6A 1S4FA 2FPMA 4EELA 4NYZA 4PHDA 4JYAK 4UASA 2IA0A 3DEEA 2IC3B 3UNYA 4B08A 2C2ZB 3MM8B 2DKXA 3NS5A 2IGIA 2B4VA 4WXWA 3D9BA 4X66K 2EAPA 3CDWA 5C0YA 2VJ4A 2AJFE 4LSNA 2F9DA 2XBPA 5EGYA 3CYMA 1RT1A 3RAMA 3ZDCA 3L7UA 1L8LA 3M5RA 1U9LA 2WBNA 4CO5A 4WE1B 2PMHA 3BQ1A 2Y9TA 4W5QA 1RTHB 1NPKA 4DX7A 2WFBA 4CEBA 1UETA 2DNMA 3CJ7A 3H46O 3KLEA 5DDOC 1CUKA 3GR0A 1MLAA 3IP4B 2AU0A 1VSKA 5E33A 2OPPA 4IJAA 1W7AA 1FJGJ 2NLWA 4WFNL 4EEYA 2P35A 4RQ1A 5D4BA 2VKZG 5ALFA 4UARA 1WOPA 4WQ5C 3VA3A 4CJVA 2H3ZA 1PK1A 2K3IA 2IOFK 1T95A 2EVZA 3QQCD 2XLIA 4K4SA 1VLBA 4TY9A 2ZZNA 2ZITA 2X1AA 1FRIA 3T5HA 2BQUA 3FZFA 2KJWA 1ZPVA 4FJIA 1DQ9A 4OGCA 3R7BB 3SCXA 1JJCB 1SJ1A 1ZM2A 2FZGB 4IS7A 2I7NA 4DR7J 3O9RA 1L6NA 1SKUB 4ZCLA 5EVZA 2E20A 1J9AA 2EK1A 2AYMA 3AXKA 4JEPA 1RSCA 4CM2A 1NZPA 3K89A 1FW6A 2CADA 4ED1A 4EEKA 5TZVA 4FSVA 3R7SB 4UATA 1RADB 4Y2SA 5AZJB 1RLCL 8ICYA 1V9OA 2PFDA 3QGGA 3BF1A 1X9JA 4KLQA 1TL3A 2E1AA 2RB7A 3HVWA 4HR2A 5T14A 2R8IA 2V8PA 1RHMB 3WQPA 3Q22A 4YG2A 3S01A 5FPDA 2F4VJ 4M5DA 2QWQA 2FVSA 1XNSA 4NLPA 5CY4A 2MGZA 1C1CA 2UV8A 5BPLA 1X66A 4FXVA 4PCQA 1R27B 1YJUA 3QNMA 3O9TA 1JMTA 1ZBIA 1N5TA 2WOMB 1GOBA 2OA8A 2GVDB 2HVZA 4V19S 2DGSA 5B0AA 4DOAA 3DLRA 4OLBA 5JMVA 3B54A 2GEMA 4C2MA 2D0AA 3FCHA 3DLGA 4PL2A 2BCSA 4YOXA 2GGPA 1OVYA 5F8MA 1DLOB 1FKOA 1WOSA 4TLQA 3UPFA 2DHGA 5HRRA 2ZM6F 1NCLA 4DO9A 3EVMA 5A0LA 4KLOA 3ED5A 2VG7A 4X64F 1QVFM 2CH6A 2ADBA 3JS6A 2J8AA 3C0BA 2XYPB 1DZ5A 1Q5VA 4USMA 4GFJA 4F4AA 4OJPA 2RUSA 5D3GB 4AHRA 1Q7YO 2YB4A 3SMVA 2I9GA 5KFRA 4BLGA 1CQNA 1TV6B 5AIAA 2VANA 4FYVB 4KPCA 8ICQA 8ICRA 4Y2KA 4C7QA 2E8MA 4OO1J 2P9NA 2D3DA 1RTIA 5KPTA 1WELA 3PW0A 2AF6A 4RO0A 4ZP8A 2OTLN 2N4CA 5EN1A 1N36J 3AAWB 5T41A 1NJZA 1DAXA 1N61A 1X0PA 1YJ9S 4M41A 1OYEA 1RBVA 4O44B 4B8AB 4KY3A 3DRYA 2BXJA 4BRCA 2MQOA 2L41A 3BO4A 4UY8T 1F5CA 1YKWA 4B02A 1LWFB 3UVJA 4HACA 1IG9A 2GX8A 4Z4IA 2G8VA 2P9LB 3CCTA 9ICXA 4KKOA 5C15A 2JZBA 4JB8B 4OPKA 3FBBA 3HYFA 3NGKA 1FRKA 3RW6A 2KQ2A 1KRPA 1VQNS 2Y8YA 2YKNA 3ZCMA 1NK5A 4UY85 2NZ4A 1LKYA 4JMUA 5EWEA 2BJ8A 1T03B 2ZIVA 3LF0A 4CD1A 2HHHJ 4F8RA 1ZA1B 1R89A 4UQTA 2V51B 2PA3A 4JK9A 3WBZA 4A8KA 4IOCQ 4NXZA 2LXUA 1S8OA 1K47A 3L4PA 2G8WA 1LFWA 2PBDA 1N33J 1V5IB 2BPCA 4JLHA 2I6WA 2XZDB 3HT0A 3WXMB 4P6QA 1T11A 3C19A 4E19A 4YCXA 1REGX 4PZVA 4UZCA 2QM1A 3O5BA 2HS4A 4QZFA 3AL0B 3OYGA 3KMQA 1U1MA 3HMJG 4IQMA 4M5JA 1DK3A 9ICEA 3GFZA 3D3BJ 3LM2A 2P9IA 1O03A 3TAFA 4ZP6A 4C4WA 2GWKA 4P75A 3A0BU 5CCLA 5AKHA 5HL7Q 4ZCIA 4OIXA 4ZN3A 3K5LA 2I9SA 3D68A 1CJVB 3HM9A 3UXPA 4TY8B 3W5YA 3HZGA 2DFFA 3QRRA 2A41A 3C15A 4OJ3A 4A61A 4CHNA 4R5PB 2HF3A 1QUPA 1YBAA 4ZDNA 1RK8A 1PC5A 4YP3A 5TKYA 3THVA 5L38A 1KVCA 5AM2A 2LEPA 1V85A 3IR5B 3PJXA 4ZVOB 4KLLA 5L46A 1F0XA 1VQ4N 2BHNA 1RAGB 4X66J 3Q8UA 1A0PA 4ID1A 3WC0A 1WCNA 2MLZA 2P51A 1RU2A 5EE9A 3DGPB 7ICKA 1TKTA 4UY8O 2GUPA 3ZZRA 4G1QA 4JI0F 1O08A 4I29A 4DCPB 4BC3A 4J9VA 2ALZA 1GMWD 1EKEA 1YXQA 3NAHA 4CO1A 3M8QB 2UUAF 1RYSA 3P38A 1RA6A 1Q8KA 3J7YP 3MECB 3TADA 5JUMA 1VK3A 5E0OA 2O8CA 4LRAA 4KLDA 4ZOSA 1L7PA 1U4BA 1MNEA 1X3NA 3NOGA 4B1ZA 4YQWA 2ZBIA 1FDDA 1RM6C 2HNZB 4DU4A 3DMJB 2MZSA 2MYFA 3D4JA 4QIFA 3IMQJ 3FCVA 4LJXA 5C42B 3DLHA 2CQ4A 2HSEB 1NJIO 3MM7A 3CIPA 1BHNA 3EXYA 3MCSA 4IR1A 1N5WA 4OHWA 9ICSA 4UAWA 2EANA 1SIWB 2HYIB 4USTA 4BCAA 4DHYA 1AXQA 3EDRB 3T1AA 4FN5A 4ECQA 2DD8S 4I2EA 1S3XA 1NZ8A 1PBUA 4GW6A 2QB0B 3ZZTA 3P1GA 3N28A 3T6BA 2PI4A 2VIXA 1WAFA 4FOIA 2XLKA 1LK5A 4OYBA 2IM2A 4Y2AA 4ED5A 5J2IA 4LVSA 2J0XA 4H0TB 2OSRA 4RBTA 2BE7D 5C7PA 3AU2A 2GHVC 5AXMA 3SSQA 4RQ5A 2KKHA 2E1FA 3MWPA 3V9ZA 2P1JA 3O1BA 3QIPB 2DPIA 2CAJA 1E3MA 2CH5A 1CQMA 1ZQXA 2F5GA 4F67A 1L3UA 2DR6A 2PEBA 3SCKE 3NRZA 2HKEA 3T1HF 3AARA 2HZAA 2IOHA 1GH8A 1HARA 2CDRB 2M2BA 2ZKTA 3M7VA 2DH7A 3ZSZA 7ICJA 4U96A 4NYOA 4NLGA 4KLUA 4FM1A 5D6GA 3SJJA 4QZGA 2O8EA 2H54B 4QZHA 3K2YA 5J0XA 1PILA 2W03A 4EGLA 5AM0A 4EX6A 3NUQA 4FYXB 3C3LA 1LV5A 1IQZA 5F3TA 1X5OA 2FMPA 4TVAB 4ZVUB 2HVHA 3KD5E 1B3TA 4LF5F 9ICTA 3LZJA 4WIQA 2Y0SF 2GH1A 3NXZA 2WB1F 3TRGA 3HTVA 3CJQA 4OZ1A 3VR1A 4AL7A 2C2KB 5AQZA 2LECA 4LFCF 2XVTA 1R6YA 2KK0A 3W5ZA 1AA1B 2VG5A 1IM6A 2CG4A 2UV8G 1SKRA 3KNAA 2KW4A 1RTJA 3G82A 4JP8A 3NMUA 3KKSA 1IJJA 2ZH3A 1VAZA 3BPDA 4NLQA 1RXOB 4B3RF 4H4MB 2DR8A 2HQCA 1Z6RA 1XTZA 4FWLA 1LWCB 2MSNA 4ZPAA 1ASWA 5JXSA 3TADC 2D8CA 2WVBA 4JI5K 2K4EA 4IYQA 1N0UA 2EFGA 1SC1B 1HLWA 1JLFA 2HOEA 2MKYA 2IHR1 1S97A 1H3DA 4FPIA 1EWQA 4I2CA 1EETA 3P5JA 3M4XA 4ZOHC 3I31A 3FC9A 2B21A 3UKRB 1LWXA 4C3LA 3L4QA 4CI0B 4R63A 1TL1A 4F04B 1T0TV 3MFIA 3NP5A 5HRSA 2VDIA 5H9FK 4LRCA 3HHLD 1FDNA 3AJDA 2E1ZA 2DEJA 3RBDA 3OTCA 5ALXA 2UUTA 2B6AB 2EZYA 5G0RA 3HHLC 4J37A 3CPWR 5IV4A 8ICJA 2Z4PA 3MEDA 3J80O 2VHGA 4JUZA 2HGMA 2VASA 1HA1A 3OVBA 3MUVP 4ECSA 4DPXA 3THWB 3SJHA 4PKDB 5GAEU 4UTGA 2CQIA 3AVFA 2RU3A 4TQSA 2ES6A 2VWBA 5F3ZA 3SMPA 3SV4A 5HP1B 5J2QA 1XQSC 4LRDA 3LVVA 1AUSL 3V6HA 1REVB 1LB2B 5KG5A 3DKDA 2KKZA 3D2QA 4ZHRB 2XMMA 4O0JA 1RABB 4XRHA 4QU7A 1ZQOA 4J5OA 3OBWA 2XC9A 1ZD3A 3FBFA 1T9XA 1KQFB 4Y2PA 4RPZA 1S72N 4DR1K 2RMLA 3T3FA 1DBDA 1RQLA 1TUWA 3A5NC 4BQZA 1N32K 4C0HA 1ZQWA 5BRHA 4F71A 2NO4A 2CPXA 1M90T 1S5LU 2UUCF 3PY8A 1RG6A 2AV5A 1NGIA 2QA4S 1T6DA 1GLBG 4UOGA 4A8YA 3ZX0A 1ZQZA 2KHCA 4I2IA 2K7JA 4LSZB 1SAZA 3TZYA 1N6QB 3HM8A 4OX7A 4J2DA 5KQ8A 3WK7A 1UZDA 3V9WA 1RBLA 3GV5B 2RQ4A 2MQPA 2MKJA 2ZUCA 2X51A 4J2EA 4KLGA 1A7GE 2OUGA 3GQCA 3NCRA 4M95A 4KC5A 3TQEA 1FERA 3IAS9 4C1NK 2FZKB 3RUBL 5M1FA 5ALDA 3TSUA 5DLFA 2IHNA 5J0OA 3ELHA 1WN7A 3EZWA 3MC1A 3ZSXA 1H73A 4KPYA 3W64A 4DTMA 5HHIA 1HQ2A 2YMLA 4OZJA 4PL1A 4TUPA 4KHMA 4QWBA 1M5SA 5GAGU 2FYXA 2G8IA 3C2LA 3H5YA 1U25A 5BPMA 1M1KO 2B43A 1KOHA 1HNXK 2LQJA 4IOAL 3ONNA 3FFIA 1U45A 1T4GA 5A0YB 4MO5A 1BE4A 2P6TA 4BG9A 2JOQA 3QFUA 3KWMA 2YJFA 2UVVA 3NGUA 1NKBA 4K0KF 3NS1A 3FMWA 1HNWJ 4LF7K 4UAUA 4XDDA 1Q86T 3EPIA 3AGKA 3H4DA 1ZA2B 1JXLA 3N0VA 1BL3A 3TYTA 4FNHA 5KFIA 2WTFA 4OHVA 1Q95G 3DHXA 2MJNA 4G9ZA 1KHVA 3LK9A 3VETA 3QUQA 1RHKB 2ZH7A 1FFGB 4LSNB 1LWEB 2FBXA 5A8RB 3QDKA 3V9UA 3KBBA 3ISBA 3DOKB 3N4WA 4MN4C 2QLTA 2HBZB 2D3O1 1YTAA 3ASMA 5GVQA 2W1BA 3IMXA 2KN4A 4BRAA 3AHPA 2XHWA 4NMXA 4DFPA 1X5SA 4RPYA 1X60A 2RHQB 3BN4A 1SQGA 4CCHA 4AHVA 2NS1B 3HVRA 3SUNA 3JSBA 4ZPTR 1XMQF 4WXOA 3PSPA 2YWGA 3KLEB 3E01A 2LYVA 4CIFA 1J2NA 4OI4A 3T1YF 2F4FA 1Q18A 1X4GA 2DNRA 1YTUA 4FWRA 1WI6A 5LSOA 1UAWA 4JI2K 2QWLA 4QZ8A 3H0PA 9ICJA 1PK3A 7ICIA 4KHPK 1T9TA 3LDNA 1JALA 1OYDA 3A5LC 4CJUA 1S1WA 4JI4F 4ZPWR 5D4OA 2QEXN 1D8LA 2U1AA 4OYZA 2EBEA 3WIVA 4B3TF 2GIRA 4CNQA 3AA9A 2VPXB 3PKYA 3KLHA 3BQ2A 1KFTA 2WF8A 2DTUA 3DRXA 4XPEA 3EWGA 2YPYA 3OS2A 5A6WA 2PMWA 4NY8A 2QYCA 1KBUA 3H8YA 3EGWB 2DKOB 5HAOA 5FP0A 3EGVA 4DR4K 2I6XA 5JLFA 4FXDA 5CHCB 4CLYA 4I6AA 2R8JA 4DR6K 2PC6A 1RBSA 3NVYA 3KHYA 2OPRA 4C8OA 3L2QA 2ZJPQ 5B7WA 1N56A 4K4GA 2IMWP 5JVHL 4KGXB 4YFKA 4MAKA 3BBBA 2EFOA 2LLZA 4KFBA 4F0KA 5B09A 3R1HA 1Q86O 4KH4A 3OSNA 4LFAF 5F3XB 1SC6A 3HF5A 2QW9A 1B43A 1VQ9N 1FI4A 4DR5K 4BR5A 4CI6A 1TL3B 2VONA 3KHRA 1N34K 1W7WA 5ETRA 3V4IB 4H03B 3AVIA 1DQ8A 4OYPA 1F5SA 4M5DB 4IH6A 2H3VA 4IO9Q 3IBPA 4HHTA 2W7OA 4AF1A 4DSIA 1W9HA 2DGQA 3H7HB 3UPQA 4ZVPB 4K4VA 2LYBA 3VALA 2UVUA 4JS4A 5LJ5Y 4X4OA 4LH4A 2HNDA 1ECWA 1I6JA 4JI5J 2UU9K 5J1EA 4NL9A 4LF8K 4P2SA 4XK8C 4R64A 3D54A 4I2PB 3BYPA 4K2XA 2HZVA 2A10A 2OHDA 7ICHA 4F5OA 3DLGB 5BR8K 2GGPB 5AFUH 1FKOB 4M3UA 2DNZA 3OD2A 1U8WA 2K4PA 3RMCA 1DQAA 1YBTA 1SB3C 2KYZA 1WORA 4OI6A 3V1OA 4FO0A 3L2WA 5H9FJ 1Q3UA 3BM7A 2RH3A 4AHTA 4LT6A 3GL1A 1SH0A 3L9ZA 2ZXHA 5J2EA 5AQWA 1WAJA 1OUQA 4JI8F 1JXBA 4PGYA 3CERA 1NK6A 2FLPA 1CULA 2R7VA 4Z2XA 1AT1B 2FBYA 2H3IA 4S0MA 1AYEA 3TX8A 2FGOA 2HNYA 3GSDA 4BROA 1YVNA 4C3MA 4Y2IA 2ESEA 5CEHA 4MEYA 5BN9A 5J1PA 2HHTA 3VQTA 1U0SA 3WXKA 4DL3A 2IOCA 3PSIA 2VPZB 1HI1A 4O5KA 1VQ6S 2GQQA 2P9NB 1EXNA 1RILA 2MKKA 3D6TB 5IIMA 1QQOA 1HNZJ 4DL6A 2ZWPA 4FK4A 1M1HA 2VBWA 3ZO7A 3H98A 1B7FA 3O4QA 1HHSA 2MQMA 5GMEA 1VQLS 3QUTA 7FD1A 4DL2A 2HBRB 2YH0A 1YT3A 3K5MA 5F8LA 4DMZA 2F40A 3TUPA 2MKIA 2ZUBA 4PXBA 4YB1P 1KXPA 4YN3B 1JK9B 4HACB 2G5HB 4DR1J 1XERA 4LQ3A 4M5NA 3F5AA 2APOA 2DR9A 1VJ5A 2JZBB 2RHKA 1N32J 2OJ3A 1COKA 3DN9A 1WWVA 4X62F 1I94J 1PVPA 5EE1A 4PH5A 5DBAA 4URQU 3ZZOA 1F0MA 1UTAA 1YIJN 4JV5F 4QOTA 4LF6F 4K4IA 1LKYB 3EZUA 1HR0F 2EAMA 2E8OA 2WSEC 2D4WA 2ZFHA 3EVWA 3LH2S 2CGLA 1XSNA 2DNNA 4M5GA 1W26A 1AQ6A 5F8JA 1DT9A 1QHAA 2YHBA 4EFHA 4LSLB 2BR0A 4C8MA 2W01A 1SJFA 4I6MA 4DZDA 4H5RA 1Q9YA 3I5AA 2FJWA 1TAUA 2YKQA 3CJ0A 1N63A 4JI3K 1KBRA 2A3JA 3W1YC 3W66A 2V4RA 3QE9Y 2Z1HA 3OYMA 5DRKA 3HRGA 3LGHA 3BV8A 4CEOA 2GHWA 4HTLA 2R7SA 2MSTA 2DGUA 2A40A 3AOCA 1XNQK 2P66A 1VS3A 4ZVGA 3QU5A 3HP9A 4BUGA 1RWPB 3VEWA 4JI7F 4WFBQ 4DTJA 3FFKB 2P9IB 4XIUA 3NWGA 3SEOA 1OY9A 3CJ4A 4DTUA 3TPQA 4CNYA 2R7YA 5B8HA 4DL0C 3FM9A 2DIVA 3M9NB 1HWUA 2F77X 5AJ3K 4F50A 1H2TZ 2KXHA 4F5PA 1IG6A 5G4DA 4PYDA 4NL9C 3DOLA 5HLFA 4OGEA 1UCVA 3WHIA 4L3NA 2OD6A 3TWZA 3VF2A 3C15B 3CJTA 3ATVA 1RBOB 1U1LA 4YY3F 2MQLA 1RHRB 3W5XA 7FDRA 3IV6A 4DQ8A 3IO1A 5C25A 3CJ3A 1ITGA 4HTJA 1V3ZA 1SJ3P 3DRPB 3LP0A 3NAIA 2VFVA 1VSFA 4P52A 1B99A 3IM1A 1XBWA 5F9NA 4HCBA 4Z37A 2A42A 2D3ZA 4XTTA 1RDWX 1TE2A 1TKTB 2JNJA 3M2UA 1Q8LA 2JZ5A 2YX8A 4N77A 1XC3A 1HW8A 2QKQA 2QV6A 1O8BA 1XNRF 1YHQN 2G8HA 3SENA 2ZHBA 1U8SA 1N8RO 2EFVA 3C28A 4XO0A 3OYJA 3BR9A 4OI0A 4QWEA 2Y0SC 3K9JA 2WB1C 1HUXA 4C1NI 3QGHA 4GY2B 4AQYF 4HUGA 2HBKA 2O8CB 3NL0A 3MGVA 5JRTA 3HOSA 3SUOA 5KFEA 9ICWA 1QZ5A 1G2EA 2GQCA 4JI2J 3QYYA 4O3QA 1NDLA 2IFXA 1NKEA 3AO5A 3M8SA 5IWAF 2VBZA 3HHLB 3JQKA 4X4RA 3LL3A 4DEZA 1NDKA 4MFAA 1E4FT 1LVHA 4HDHA 3CO0P 2CQGA 3TZZA 8ICXA 2J7UA 4RQNA 1R43A 3JTNA 4QW8A 4CLUA 5DG7A 4PAAA 1KOOA 4CEAA 2KRRA 5KFSA 3IAM9 3S3OA 4LR8A 1ZQUA 3CJRA 1HPZA 3SQOP 2POKA 3BSOA 3NF8A 4DR4J 4FWNA 1WUDA 1DY3A 4KJIA 3H8JA 3NASA 4Y6IA 3DOMA 4DR6J 1YSJA 2GWSA 1H7XA 4IQVA 1SQEA 1PIEA 4J9QA 1CI4A 2LHTA 5BYSA 1O1WA 4RG8A 4NYNA 1ZQNA 2BW7A 1S1VA 4O4GB 4AHCA 2M0GB 1BPYA 2RIJA 2C2DA 1KQQA 3D1OA 3BO2A 3VN5A 2YNIA 5J2HA 4PWDA 2W6LA 4DR5J 2F3NA 2DGXA 3CD7A 3FSIA 5IT9O 3CI5A 2QJ3A 2JGAA 3MDQA 3MDCA 2BQRA 1DK2A 1D8YA 3A0IX 4K8ZA 7ICUA 2E5GA 4NLYA 5CQGA 2H3FA 1IBKK 5AXKA 3MX2A 1SXLA 5AQYA 1YRUA 2UU9J 2M4MA 1RU1A 2MLXA 1VQ7S 4DMNA 3V5RA 3KDNA 1IJEB 5J2NA 2L48A 2BABA 3LQVA 1VBXA 5BR8J 8ICUA 1GT8A 4Q44A 5DDYA 5J0WA 2HG4A 5IM0A 4OYWA 4CT8A 3RSEB 3C8YA 4WKRA 4OPHA 1R8PA 2BDPA 4QR1A 2JGUA 2GVZA 3ZFVA 2VG5B 2CZ9A 3R5BA 5ALLA 3I0RB 3G82B 3UWTA 2C3OA 4JB3A 1PJ7A 4F4WA 2WTUA 5HR6A 1ZQQA 1QD1A 4RX6A 3ORYA 5KL1B 4L74A 1BIZA 2NRWA 3LWMA 2RDJA 4W92B 4F5NA 4GXJA 3BF3A 3Q8MA 1TL5A 3RGIA 4C7YA 3T41A 3PKMA 4P7TA 1WUUA 1S99A 2LP4A 2YNFA 4PKHA 4C8NA 4JWMA 4FJXA 3D67A 4A8FA 2KVCA 1H72C 5LMNF 3TABA 2I38A 3PW7A 5DQIA 2YNHA 3RAQA 2MHNA 4MDBA 3D2FB 2QWNA 1TL1B 4Z7CA 2W7AA 2NREA 1VSDA 1U47A 7ICPA 4CDGA 2ZE2A 1RQ0A 2JHEA 5G0RB 4RNFA 4WTOB 4DUYK 1SJRA 4UUXA 2B0CA 4PG8A 1L3TA 2GOLA 1UPHA 1VRQC 1BQMA 5KFPA 2Q0UA 1OO0B 1HUZA 2R3VA 3DM2A 3M6VA 4ILLA 4DV1F 5BREA 2MDAA 1WC5A 4XQ8A 3JSMA 1XMOF 2CJYB 4PQAA 1OWXA 5CXTA 3PYDA 3C6AA 3BEGB 3VQ6A 1R3NA 5KNIA 3AH6A 2JEIA 4CE6A 4Z4EA 4CJSA 4RW6B 3WQTA 1HD0A 2VPWB 1XO0A 2W2QP 2CPFA 3MEKA 3DAWA 2G5IB 4Z4GA 1VHXA 1UKUA 1WC3A 3VGTA 1IKVA 4BRGA 2JRSA 5KRTA 1J2MA 5H1SQ 3NF6A 2YY6A 4BVOA 3N97B 4PG7A 1VSHA 3PR5B 3LOUA 3RTVA 2COLA 4BGDA 2GMJA 1RWVB 1SKWA 4WFAQ 1URJA 2ZJRQ 1C1AA 3H2LA 2JWLA 1OW5A 5GAHU 4DFKA 5AJ3J 3NMAA 4OJGA 2YB1A 4N7TA 5AQSA 1R6VA 3D6RA 2C2OB 4H4OA 5M1QA 3F56A 1WBBA 5L9NA 1SL0A 3WQUA 4MDAA 2FHJA 3GSIA 2CWXA 3TANA 4FNIA 3ET6B 3E58A 1Q81T 1DGKN 3KJVA 3I32A 1NZBA 3HK2A 4EHTA 1FJGF 1S0OA 1SI9A 1VK0A 1O13A 2J0WA 3OYEA 4F4KA 2DK2A 3CCEN 3D7EO 5DZ6A 2YX1A 2P6UA 2NXCA 2P9PB 4DOBA 3ISND 1XR6A 2KJ9A 2XS5A 3ISNC 5D49A 1Q8IA 4CEZA 3W7BA 4RZRA 3QGIA 3QT7A 3FFIB 2PMZD 2H3GX 3GG4A 3C16A 1ZQYA 1VBKA 2CQ3A 1ZQEA 4NLNA 2HVDA 2FSNA 4FBUA 4ICAA 1WC6A 4ILMA 2ASPA 3CWJA 2NZTA 8ICHA 2W04A 2ZJAA 1NU0A 2G13A 5F41A 1PAUB 2G2ZA 4DN0A 4E2FB 2KJ5A 1N4LA 3RRKA 2W3SA 4DCOB 1V3SA 5B08A 4Y2JA 3W2WA 4MIAA 1HWIA 3RU0A 4B1WB 4I28A 3AVHA 2KG0A 4ATNA 4PZNA 2F8EX 4KT0C 2I7PA 4KLSA 2F4VF 3LVWA 1P9QC 2EI5A 3CJ8A 1KL9A 1YUWA 2P2CB 4L8RB 1FRJA 2G0IA 2OPQB 2VA3A 2JFDA 5CZXA 4NRTA 4JI1K 2BKPA 3U1MA 1UQVA 1WI8A 3IBFB 3AA3A 4E7JA 1EX8A 2QTWA 3CP8A 2HBJA 5JS1A 5KG7A 4JKGA 2B9WA 3UDLA 4B8CA 4NYFA 1KTQA 2H4WB 5M1OA 2LM4A 4MKYA 3TOQA 4AM7A 2LQBA 4FYWB 2DITA 3TSQA 4KITB 3F0NA 3U3YA 3QEWA 3HVTB 1X4EA 1VJWA 3BREA 4ECTA 4NB4A 3NGDA 1HL6A 1Q81O 3K8WA 2X1FA 2NRZA 3W0LA 4B3SK 2VFUA 4E8UA 2NSBA 4IKAA 1BQNB 1S1WB 4PZOA 3NBPB 3ICXA 4JD2A 4JKDA 1K8KA 2W2NP 4UBCA 1N60A 2ASMA 4FXWA 1IBKJ 3BUZB 4CBXA 4G1IA 2E5LK 3KLHB 2RHFA 3WEEA 3CCVN 3I55N 1N36F 2DB1A 1V97A 2KP7A 4CK2A 4DUTA 2QSFA 3ITHB 2K4HA 1Y9OA 2FQQB 4F3TA 2OPRB 2K8GA 1YJNS 3Q8KA 2E2QA 4CZIA 3M2RA 3S3NA 4AUKA 5F0XA 4OZ0A 4DUZK 3C23A 4KFBB 5C10A 5K14A 3GFYA 4KLHA 4K8RA 5KTQA 4CH1A 3OBYA 1S72S 1QZ6A 4E1MA 3ZSVA 3IAYA 2CQ0A 3TEHB 1S4EA 4DBQA 1MQ2A 3UDCA 2HIQA 5KG4A 4RUCA 5CAAA 2IVOA 3S3MA 2CNKB 3MMCA 2HHHF 1WG5A 5DGBA 1EB0A 2G8FA 4WF9L 2VWJA 2DR5A 5D0EA 1VSJA 4IG0B 3TAEA 2BANA 4BE0A 4DLEA 5IIKA 1YJTA 3S7RA 3W2VA 1NK4A 5A8KA 5AQKA 2DNOA 1QM9A 1N33F 1WF2A 3PJ9A 5GMDA 1YDLA 1RCHA 4N8OA 1SL2A 2CA9A 4U9RA 3R9LA 2C3UA 4PWUA 4CHPA 5KG6A 3ENWA 5ETQA 5I42A 4OKEA 2Q2RA 4CZLA 8ICOA 2PFQA 3T9NA 2A18A 2E9ZA 2Q31A 4W5OA 4DU1A 2FMQA 5BPNA 4M63A 3RR7A 4J2AA 1S1TA 5U47A 3MWTA 1X4HA 2CJKA 1VIOA 3D2EA 4IEIA 3SCJE 4QS9A 3OYCA 2JLEA 3VZIA 1HKCA 3WK9A 5GTHU 3OR1B 4F9OA 5AQMA 3QT6A 4DUYJ 4OHYA 4CJ3A 1X5TA 3DRSA 3S9HA 1VISA 5T7LA 3LPEA 5J1NA 2HNYB 3NS7B 3H5UA 4USJC 4H8KA 3OW2M 3TSPA 1NM1A 1YJRA 1D9DA 1SCJB 4U8YA 3AJ1A 4KAZA 2C3MA 4NEZA 2A6MA 2QIFA 3JPNA 3SI6A 9ICMA 3AGRA 3CFOA 1D8BA 3FQKA 4PHEA 3WX8A 3BGFA 4KO0A 1GXTA 1QUVA 2MY7A 1NAQA 1WSRA 3NVVA 2ZBRA 1VQKN 1JXVA 2BJDA 3PIOQ 3PRVA 2XLJA 3S6EA 1URRA 4FO6A 3PW2A 5ALPA 2Q3PA 4G3IA 3KD3A 2XMUA 3FUYA 4E98A 3KK7A 1MN9A 2YX4A 4NA2A 2HMIA 1WSJA 4X66F 7ICFA 1XO1A 4FF3A 1X31C 4LFCJ 5TISU 2E9TA 4CO4A 3UN3A 4FJ9A 3MOJB 2BA9A 1M5PC 4QYRA 4A8SA 2V9KA 1BLUA 4UB4A 3VESA 3SEIA 2E6LA 2B4PA 3QSYB 2FJ6A 3NVKA 1ZQTA 4DV6K 2DY4A 4P2XA 3O1WA 3CIZA 3GE1A 4CZMA 3QEPA 2ZVIA 4YOTA 1DARA 3QU4A 2C2NA 2P6RA 5DM7L 3ZDDA 2JLFA 4KB7A 1QVGR 1X9WA 5ALZA 2K60A 3DV9A 1OIAA 4DPYA 1U2VA 2QGFB 2WZ1A 1VQMS 4E89A 1CXQA 1N2XA 2VODA 2QL7B 1HYSA 1WOOA 1FE0A 3C2PA 3D0GE 1B0PA 1K1SA 3G6YA 5ALUA 3PX4A 1OSCA 4LFBK 5AKLA 1QE1B 2H3EB 4JAXA 2Y8WA 2BW2A 4B1UB 4TQRA 2X7IA 3IXQA 1EWRA 4I2JA 1ZQBA 3QFHA 2M0NA 4KHQA 2D7SA 4FYDA 2YN4A 1EXQA 2F44A 2YWHA 2ZVSA 2MZRA 2DPJA 2W2PP 3O1LA 3CM6A 2DFEA 1SZ2A 1RDBA 4TKTA 1WEXA 5D0HA 5KFOA 5AI6A 3L2VA 3P83D 1DURA 3BS5A 1TZ0A 1JI7A 4RQ3A 2X1GA 2YQEA 3C21A 1Y88A 1Y97A 4OX9K 5HLFB 2V8HA 1W2IA 2BEFA 2AXTU 2JWKA 1WWUA 3OTBA 3RJHA 2YKMA 1DRZA 5KFVA 3JQMA 3AB4B 5AI8A 1O0PA 1XWLA 3IR7B 5IQQA 3KJFB 3G8SA 1WKKA 3VGMA 3QUCA 2AGOA 4M63C 1SQFA 4TURA 4DX8H 4O3PA 4GVBA 1F3VA 2CKWA 3LP0B 2NXEA 4DWIA 1U26A 1TVAA 8ICWA 2RRBA 1VQ9S 2FHMA 2VL1A 3AA4A 5FD1A 4F4XA 1HWLA 2HRUA 3VMFB 2XI2A 4LIRA 4DQRA 2HRYA 3K5OA 3PYGA 3M2UB 5KOXA 4BDPA 1BMQB 1KQSM 2UUCJ 2HBQB 5F8HA 1ZBHA 3SBMA 3NGIA 4HHHA 1EP4B 4JI1J 4J9PA 4IDHA 5E41A 5CE3A 3D6FB 3CFRA 4OV6A 2OO4A 2UZAA 2Y1LB 1C4AA 5CR0A 2ASLA 3IBWA 4FKXA 5DGAA 4URGA 2C28A 3TX0A 2K3KA 2K8AA 3HSGA 2BCVA 3M6WA 3MMAB 3UKUB 4LR7A 3MPUB 3ZSYA 4IH5A 4A57A 2GUIA 5D15A 3C2MA 1TKXB 5J0UA 4KRFA 2MQQA 3GJQB 2HPUA 1A0OB 4B3SJ 4HI1A 3ZX2A 1SH3A 3VGKA 1CEZA 1Z4NA 9ICLA 3LPYA 2QXLA 2VJVA 3AA2A 3TWHA 1L5UA 4RQ2A 4FJLA 2E66A 2J5AA 2E5LJ 3CFPA 1BNPA 4J8FA 4JNEA 4KHUA 3ENHA 5D77A 4MH8A 3K5NA 5ADXH 1X6JA 2HAIA 2W9CB 5KFDA 1HPZB 5J2KA 2U2FA 9ICAA 4YR3A 4NPOA 3EZ5A 1NZAA 1FTRA 5HATA 5KAKA 4QJFB 3MD3A 3V6JA 3DDKA 2DHXA 3Q8LA 1S79A 3IG1B 2K8CB 4BE1A 5ALTA 2HRTA 2FF3B 1NRKA 3R9KA 4OL8A 3RZAA 1KKHA 3AVNA 4DUZJ 1XHXA 5AE1A 3J81U 2AYEA 4K4TA 1CPZA 4OJLA 5LJ3Y 1IR0A 3VOVA 2CPDA 4R0EA 3VV2B 2YNIB 4PWDB 5AQHA 5DZ7A 1SVDA 2AP6A 5E5NA 4YR0A 1CBKA 4A8WA 3HULA 5KQDA 3JPQA 1L3KA 3QGPA 4NLWA 2KSOA 1RA7A 2NRHA 2XYGB 3AD9C 1YF5L 2HW3A 2GMHA 3AJ2A 1GOCA 2OCEA 4M04A 2Q79A 2YX6A 3NGTA 4EFAC 4FZNA 3EGZA 2B3TB 4PWWA 3R7NB 5FIIA 4DOZA 2F8KA 4Q2LA 2W24A 3RJIA 5ALRA 4PG4A 1UVLA 4C97A 1K9MT 4X2BA 4CLPA 1Z3EB 3MBYA 3TTDA 1W0HA 3PHTA 4DQPA 2V34A 3FMBA 4CK1A 1K73O 4W5RA 4FM2A 2B4JA 3HPGA 3NG8A 3T1YJ 5IM0B 3G0ZA 2DY1A 4QZAA 5JLHA 3THYA 3EMTA 2HLTA 1WLJA 2E2PA 2BRKA 3TZWA 4UW9A 1TMJA 2GCFA 1SB6A 1RT2A 1VQPN 3D66A 3MCNA 5J2MA 1KSPA 3BF4A 2YNGA 4JI4J 3CCSN 4RWTA 3MN9A 4EO8A 2VJ5A 2BDUA 2EH9A 1V3RA 2OI2A 4NM2A 2HGLA 2HQDA 2AMCB 3TNVA 3V4MA 1S59A 1FJEB 5KFHA 1MW7A 1PJ6A 2BGGA 3CQXA 3J81j 3WKAA 2R7XA 4I27A 1WSEA 2YNFB 5CYQB 1C6VA 1QSLA 4PEOA 2ADCA 4P0QB 2WRMA 5ALSA 3HFVA 1QSYA 3VAGA 4HEA9 5FDLB 2G1HA 3DXKA 1HQUA 2P9CA 4X64K 2WAQF 1FNMA 5L1IA 1ZQRA 4M5HA 3LYSA 4GXIA 4OZ5A 1BD6A 9ICCA 2IMOA 2ZHAA 4KHYA 4P0PB 3L4IA 5L1JA 2VFRA 3FZMA 4O3MA 1CRXA 4DV0K 5DLGA 3KOAA 4CD3A 3VQQA 4NI2A 4C98A 1MC8A 4ILJA 2RS8A 1W2BM 3MFHA 3QEAZ 3PSFA 2G4BA 4H5TA 5GAEI 4LJMA 3H5XA 3ZSOA 4ENOA 2OKQA 3VVTA 3L5KA 4X4PA 4DV6J 3T79A 2E6MA 5AK4A 4FWMA 5BXIA 1TGOA 1MU2A 1DJ0A 1IUJA 4JOUA 4MK8A 2NQPA 4YOYA 1HBOA 4DV4K 3JSMB 4WJ3B 3C65A 4J7CA 1UT5A 2M3DA 4LF4K 3HSDA 1RDUA 1RT3A 1IKYB 2E5JA 2VUGA 3FSYA 4Y00A 1T9WA 3MEEA 1YTYA 1K9MO 5D8HB 4KN4A 3WKBA 3RJEA 5LMUK 3MR2A 1XK8A 2BM1A 4LFBJ 1IKVB 4BACA 3T7ZA 4JRPA 3OL7A 1D1UA 2HBYB 4K2JA 5GADU 1VRTB 4KMOB 1MDUB 1YJ7A 4M45A 3BKTA 2DIUA 1RDCA 4IFVA 5CP2A 1BPZA 1M5HA 1HNVB 3BZCA 2R7TA 1ATSA 4AH9A 4P2HA 4FVUA 7ICQA 5I3UA 3KYLA 2B5JB 5IIIA 4PUOA 5J2FA 4H4OB 3JAMU 2ROGA 3TTFA 2PN6A 4OX9J 4OJ6A 2DNLA 1P1TA 4FK2A 1L3SA 5LXYA 1RBAA 2KG5A 3GPAA 3K0SA 5ADZA 2QMXA 1SZPA 3LWLA 4E7LA 4XH4A 1NO8A 1Y5LB 4IXCA 2Q6BA 1M5VC 1BDGA 4WTYA 2Y9UA 4I2AA 3UDVA 5F8GA 2HHXA 1X9SA 4PABA 1KS2A 3ZTRA 2DRDA 1U24A 5GAGI 4DN9A 1VC0A 2H3QA 3M6UA 5HNKA 4DOCA 1J54A 1KNZA 8ICVA 1KC8T 4D3HA 3P5BP 1U7LA 4GO7X 4LVNP 2CQHA 2OIHA 2CN1A 2JL9A 2V8GA 2V7ZA 4ILHA 3GB0A 2VIHA 3ZSRA 3OTOK 2BE2A 2GNKA 1HR0J 3KK3A 3HLUA 3NCIA 4FLUA 2CZ4A 4IOCL 3O3GA 5AK5A 1JRPA 3OHAA 2NCKL 1NSQA 3QZ8A 3Q24A 1NJYA 2FC8A 2W6KA 2YV0X 1TAMA 2F8SA 3POTA 4NWIA 3AN1A 4JS5A 5J2JA 3FEXB 4FJ7A 5AI0A 3L09A 4Y2RA 2NV3A 2IOFA 4WP8A 1T05A 1SWWA 1TL7A 1M0SA 5ALKA 2DY9A 3W2WB 5JMNA 5DS7A 2FVQA 1Y3KA 1KN5A 3ZX3A 2BQ3A 2QZ8A 1VLOA 1BIUA 2ZF5O 1ZXIA 5J2PA 1NDPA 3NH0A 3TA2A 4BVPA 1IBLK 5EXWA 2YMMA 4NXMK 4IJNA 3ICLA 4RBUA 2WSCC 3THXA 4KLMA 5HL7L 1XJWB 2Q43A 3LDSA 4OX8A 1FXXA 1KKXA 3IG5A 2GLEA 1ZQKA 4R0JA 2L9WA 4JI5F 2LM1A 5HMMA 1NHUA 3Q23A 4W98A 4DV3K 3G96A 1HEKA 4JRQA 4PR6A 3NVZA 4C80A 1KLNA 4MFBB 3JSYA 3LAMA 5M1PA 2KTQA 2LQ8A 1ZBTA 3ILLA 2F3JA 3ZC4A 4X4NA 5AQTA 3GDXA 3ENOA 4OKJA 3R5CA 4ISGA 4PGQA 4YUDA 4LF2A 4IG3B 1WC4A 2W55A 2F1HA 3A8EA 1S7IA 2HCFA 2BRLA 3AB2B 3H8MA 3I56N 2BVZA 1OQ6A 2QWMA 5KFMA 1RWXB 1S0MA 3D5MA 4UOCA 4JD2B 2LPEA 1K8KB 1VSIA 3GZ7A 4C7ZA 2OMLA 4OQJA 2QB1A 2RNEA 1CG2A 3OSPA 3WEEB 2DGWA 1HNZF 2X3GA 2ZOMA 2KIWA 2ILYA 8ICEA 2E9RX 1SJ4P 2KVQE 3DXSX 2I2YA 1BI4A 3VEYA 4DCHA 1RUSA 4CZKA 1Q0NA 4CF3A 3TVYA 4FZMA 1FO1A 3G6XA 3EM1A 2LYAA 3L3VA 3P31A 2CJBA 3AA5X 1NXIA 1FK9A 5IINA 4ER8A 5KFWA 3K0JA 3M2VB 2YJEA 4DR1F 3CCQN 5K14B 1URNA 4Y0FA 3KK1B 4RLEA 3PYFA 2Z7JA 2CVEA 4P9SA 1N32F 1UWAA 4Q45A 3AMZA 2O1PA 3M1VA 4KI4A 1PJ5A 1Z2LA 3CCMN 4Z7YA 2AZ1A 4AL5A 2E4LA 4BRHA 4EBEA 3MMCB 5E3AA 2WVFA 4FJGA 1RAFB 4Y2QA 4B3OA 4Q43A 4NMLA 3AQOA 2CRLA 1S5JA 3VQ4A 2Z2ZA 3W2VB 2JLGA 4PXEA 2AJ2A 2BV3A 2W42A 1DGSA 4H0XB 2XHCA 3UM9A 2ZXIA 4DSJA 3J81Y 3G8QA 2ILZA 1SH2A 2QI2A 3G86A 2PIIA 1EKSA 1RP5A 5I42B 2EC0A 3R1LA 3K4GA 1T94A 2XS2A 1UVKA 1YWXA 3EXCX 3VA0A 1S1TB 5K8NA 2FPHX 4K4XA 3D2EB 3V6DA 2CPYA 2GZOA 3OS1A 3AVLA 4E3SA 5K8PA 1HNXF 4E7KA 4WJBA 4J9RA 1HWJA 1RBRA 4DTXA 2LKZA 5T7LB 1O51A 3CD0A 4CO0A 3B6BA 4A8QA 1T9YA 2WBMA 1MROA 3DRRA 3AFGA 4A2BA 1QTMA 7ICGA 1YK9A 3CC7S 1J5OA 3F2CA 3DCAA 1B4SA 1UJ5A 2DO0A 2RN2A 4UB2A 4ZVFA 4LF7F 4KO0B 4DV4J 1IQTA 3HX0A 1TL4A 2KL8A 1XSLA 3GOIA 4LF4J 4PG5A 3TI0A 1QAIA 3C14A 2DGTA 5AKKA 1NGFA 2H51B 3PNIA 4NXNK 1ELOA 3MN6A 2DGZA 3ALYA 5LMUJ 2H5IB 5KAFU 4HT5A 2HMIB 2J4RA 2KKPA 3SXLA 2HFNA 2PFUA 3V81A 2LMRA 2BCQA 4UAVA 8ICKA 4BRIA 3OJSA 1N5SA 2AX0A 2E7XA 1KFSA 2A2CA 1KW4A 5K20B 1VJQA 2CXYA 1FDAA 1KD1O 2J7WA 4K5RA 3E9PA 1ZAXA 1CC7A 1WHVA 2KNJA 2XSFA 4CF0A 2PD1A 1DTQA 1UWBB 1WHWA 2FGCA 3J7AP 2UXDK 3CC2N 3QLHA 1PAEX 2M9NA 4C8YA 1IO2A 3NAEA 4CZJA 4IL6U 5HROA 3S6JA 4Q2MA 5AM5A 2CYYA 1QH9A 1GQEA 3N79A 1ZQGA 3GYNA 2P5VA 3CVKA 5CCMA 3QJJA 5G5HA 4OFZA 3UQ0A 1NJWA 4ED2A 3LPTA 4ACOA 1HYSB 4JI2F 1YGYA 3QB0A 4ID5A 4KHPF 4RNHA 4ICLB 2QKKA 4ELVA 2ZDOA 5ALOA 1FKPA 4BWJA 4RCHA 5DM6Q 4Z6EA 2G09A 9ICKA 4AYBF 4MKBA 4V19X 2H5JB 4I4BA 1QSSA 3K75D 2EZZA 3LPUA 3C6UA 2HDOA 1S1XA 3FDSA 2J9EA 4PG6A 2ZH6A 3OTOJ 4UAYA 5GAEP 1GXUA 2WF5A 1C4CA 3HJFA 1UEUA 1UP1A 5C12A 3I55S 4O5CA 4I6YA 3F73A 2RAQA 3DLLQ 1K8AO 3MM6A 2ROEA 4DR4F 4JKCA 3BO3A 3KDOA 3FBCA 3ZTPA 2LFVA 4DR6F 2YHYA 2Q0ZX 3VEXA 4Y2MA 8ICAA 2M8HA 2YKMB 4PYAA 2L9DA 5RUBA 1VGYA 1IR2A 2ZH4A 1RDDA 3O6QA 1ZETA 2JHDA 1U0HA 4CF1A 3A5MC 4GVBB 4DR5F 3VAFA 3NGYA 2K1RA 3O80A 1DEJA 1N34F 1U1QA 2IHMA 3RB3A 1TUYA 4YXMA 2AGPA 4RW8A 4P4PA 1IBLJ 4NXMJ 1CS4A 2B9EA 1ASUA 4HHJA 1J5EK 5BN8A 1VIXA 3JAMY 2PFNA 2ZBQA 4A48A 4R25A 3HWTA 3HJEA 2UU9F 4C4RA 3LP3A 5DB7A 1Y3JA 4AILC 3OYIA 4DV3J 3LM9A 3P96A 3AVCA 4B9UA 3OLAA 2AJQA 2KHDA 2V52B 5BR8F 3WXLA 3SIPB 1OJ4A 4R65A 2LSNA 3ZEUA 3KKAA 2ZKUA 5CYMB 2QLWA 1RYRA 2UXBK 3M6KA 3GZFA 1Q7YT 3DYAA 1ZJNA 2B4UA 2W4CA 3R2DJ 1RWNB 3IR6B 1LAWA 4UOHA 2QFJA 4YMOA 3N7PD 3CJ1A 3ENQA 4QIWF 5HR7A 2ZIWA 2MLYA 4NLXA 1UFKA 2QO3A 3A1YG 1GX5A 1IVZA 5GAGP 4NLOA 2V94A 4C0OC 1TUGB 3CJCA 4DTOA 1QVFR 5HMLA 2AEMA 4M9HA 2MKSA 5KFTA 3O0FA 2W41A 2WAQC 5H9EK 3JYTA 1CLQA 4TUQA 4CTAA 3AU6A 3C7NB 3RB0A 1KCFA 1D09B 2QARA 3SAHA 2BX6A 2NUBA 1YITN 3GU3A 2OWOA 1VQKS 5JVGL 4ED4A 4IOXA 4HAIA 4MK7A 1K44A 5MAOA 2DHHA 3WNEA 3IFRA 2AYBA 4O8KA 3L6QA 4O3SA 4U67Q 1RAAB 4CFBA 3MUMP 3LALA 2V50A 3CCRS 4CLLA 4FLWA 2ERRA 2PGCA 4IBNA 1U49A 1JCEA 3IA0A 4WCEQ 2V2KA 2ZIXA 3P39A 3MEGB 3EL2A 3ZDEA 2NYHA 2ZOFA 1IV0A 1KFDA 1P1LA 4JWNA 3M32A 2HVIA 1LW2A 1E6VB 4K42A 1BC6A 3P3DA 1VK8A 1Y5IB 2MPUA 3BSCA 4C3KA 1YI2S 1JLEA 3OYLA 2D0CA 1B0TA 1U1OA 2JC0A 3QT8A 3R27A 1RWKB 1F2GA 4KI6A 3RMBA 1KN6A 2P9UA 2VC0A 3ETOA 3THYB 4CLSA 5ALIA 4IDKA 2HFVA 3V7JA 1KR4A 1S9FA 5EUHA 4H54A 1DFDA 1SGGA 1HMVB 3QNWB 2E1CA 2IJRA 2DKZA 2KN7A 4YVZA 2EG1A 3CMES 3RMAA 2G9OA 2E5IA 1NLKL 1NHVA 2ZWOA 2YNGB 3OYKA 4A8MP 2RRNA 4OJHA 4N47A 1UL3A 1FCAA 4B9QA 1CXUA 4M5KA 2IDLA 4CBUA 9ICFA 5AJ3F 3VGLA 1R8AA 1XC9A 1FWKA 2FDRA 4EMDA 1C0FA 1EZZB 4GIBA 4PXDA 2KE7A 3CHWA 1LFPA 4CFCA 3U27A 2R2TA 2CQPA 4OZ3A 1WCLA 7ICOA 4DR3J 2ZJPL 2NPIA 3DXKB 1HQUB 1IBCB 4DHVA 1XUPO 1TR0A 5KFNA 4E7IA 2P9GA 4NXNJ 3WKCA 1PKUA 2E5SA 1IBMK 2AGQA 1UPPA 1FNOA 4C11B 3FNNA 1NGJA 4HUEA 3IRUA 4GXKA 9ICBA 5A2QY 5CZ2A 6FDRA 4RQ8A 4NI2B 4H5WA 3PJWA 5CRXA 2MMYA 1H98A 1C0UA 4IC9A 4F02A 4LQ9A 4IO9L 2AWZA 2XI9A 2ZJ8A 3TUJC 2F1IA 4OLOA 3VAIA 2BPFA 4LIWA 1HQEA 1E6YA 1FJ7A 2RF2A 4H0VB 1YJ9N 2ZH2A 1TFWA 5L1KA 2UXDJ 4QBUA 3I76A 3H0RB 4WBFA 3NFAA 1HBOB 4RUHA 3AEVA 3MMJA 1HI8A 4LC9B 2QX0A 4TN2A 1NJIT 1WWHA 2NRXA 1N0VC 5EHHA 1BA1A 2MSSA 1ZBLA 1RT3B 3QO9A 5KPRA 3W9IA 3CW2C 2L9NA 2OFGX 4P4OA 2ASYA 1AUDA 3JQJA 1QAYA 5CA7A 1OXJA 3L3CA 5EDWA 4O9MA 1WG1A 2XCPA 1KAXA 1GOAA 3FZHA 1R7IA 1HLUA 1FFWB 5EE0A 4NE9C 3A12A 1RTHA 1YJWN 4AXIA 2YH1A 3H0MB 2MZTA 3NCQA 2GJFA 1I39A 2OH2A 1BGXT 1V9PA 4Y34A 2WFAA 3M8WA 5GAHI 2Q0RA 1PO6A 1LW0A 1TMMA 2XSJB 1PZNA 2FJXA 1WSIA 2XB2D 4QOZB 2FVPA 5ETVA 4KLFA 3NGRA 4IR9A 5I3UB 2HHWA 3N6NA 4AHUA 4F3OA 4NJ8A 1WKLA 3CM5A 1JJ2M 3B9JA 4A8EA 4FJNA 4Z94A 4NLBA 1XS9D 3RRHA 3ID8A 3F2BA 3EEQA 1TK8A 2HMPA 4KN7A 4JYAJ 3V7KA 3HBTA 2K4IA 1R0AB 3MMBA 4KLJA 1ZZFA 2WW4A 1ZM3A 2F8MA 1FEHA 4DB3A 1XR5A 2OM6A 2X1BA 4M1KA 3ZD8A 2D9OA 2M7SA 3ULEA 4BRDA 1UVJA 4Y3CA 4FZVA 2IM1A 4ZA1A 2HHPA 3CCJN 4GVEA 1JLAA 4M0AA 3IHQB 2CVIA 3AQFA 1B0VA 1IBKF 1BNOA 1J5EJ 4H0YB 3FQLA 3JPSA 1T6CA 5E3CA 3OPXA 1YG0A 4DL4A 2GJIA 4QNLA 3RH6A 5BYRA 1B9DA 5HN0A 3KK3B 1YLXA 1KEJA 2NSCA 1HKBA 1JJ4A 4IFEA 1VSEA 5J2DA 3ZETA 4ISFA 3FE1A 2XO6A 1KEKA 2VKQA 5AM4A 2DNQA 1EIYB 3HKZF 3PX0A 2YX7A 2ZUDA 1WEZA 2R7UA 2AKWB 5KFX