1NKCA

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after five rounds of primer extension, following incorporation of dctp, dgtp, dttp, and datp.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkcA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkcA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkcA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkcA01
1RDBA 2AGOA 4KHQA 5T7BA 5KT7A 4DG1A 2I5JA 4Z4FA 1KCFA 1CZ9A 2NRTA 3KD5E 8ICTA 3V9ZA 3GV5B 3LAKA 3RH6A 1NK6A 1S9GA 4IG0A 3H8JA 4FLYA 3OGUA 4RUCA 3SJJA 4XUSA 4CJ5A 2J6SA 4KLEA 3RMAA 1CEZA 5KG0A 4CERA 4CHOA 3H40A 2BR0A 5HNKA 5C25A 2NRWA 4RW8A 1ASUA 3S3NA 1BQNA 2HHVA 3AVJA 1Z00B 2BGGA 3M8QA 1GOAA 1RILA 4QWCA 9ICEA 3BQ0A 3BQTA 4CJ4A 1WSJA 9ICSA 1ASVA 5HRSA 1A5VA 3NH2A 4DOBA 3QESA 3PW0A 3H7IA 4HCBA 1L3SA 4KHYA 4QZIA 4IBNA 2HVIA 8ICAA 3RWUA 2R8HA 3C1ZA 4FBUA 3VQ5A 2B21A 4FJIA 4FJMA 4LSNA 4F2RA 2DY4A 3RJIA 1Z3EB 3SQ0A 3C2KA 3UQ0A 3UXOA 4DS4A 3L2UA 4RNNA 1ZQKA 5FDLA 1VRTA 4PWDA 3BDPA 4J2AA 4FK4A 4E1MA 1NK0A 3KKSA 2Z1HA 3MR6A 5J2DA 2BDPA 4E0DA 3V9SA 4FJGA 3RJHA 1JL1A 8ICYA 4Q43A 4DL5A 1ZQTA 2XY5A 3V4IA 1XO1A 1S10A 4ED7A 2Y1JA 2D0CA 3LDAA 3K2PA 5K14A 3OJSA 4LH5A 4E19A 3QEXA 4KLHA 2PFOA 4M6WB 1B9DA 4YG2A 4F91B 3SI8A 4Z6EA 3G10A 4FLXA 4KI6A 3RJKA 4IDKA 2F1IA 4J9OA 2OWOA 3A2FA 3HPOA 1T7PA 4MEXA 3B6PA 4DTSA 1LWCA 1NOZA 2VWJA 5KI6A 5DB6A 4FJ7A 4ECYA 5FROA 2IGIA 4KHUA 3IRXA 4C8MA 3UXPA 3TI0A 4EZ9A 7ICGA 1EKEA 4BE2A 3SUNA 5KT5A 4L8RB 4PY5A 3SV3A 4ECVA 1RTHA 1T03A 2B4JA 3MXMA 5KFDA 1CXQA 2NRVA 3SQ4A 4YXJA 7ICHA 4BGDA 1BIUA 2A1JB 3D45A 3VQ8A 3PR4A 3RB4A 1TL3A 4PHAA 3PW4A 1BPBA 3E01A 3QERA 2JEJA 3Q8RB 3LP1A 1W0HA 5EOZA 3OYLA 3EYZA 1MQ3A 2NUBA 4W5QA 4I9LA 7ICPA 2DFLA 1X9MA 4AHUA 4CHYA 1S1XA 3ZCMA 3MECA 3NHGA 1RXVA 9ICPA 1YVUA 1NOYA 4Q8FA 5KGWA 1KVCA 4XA5A 3F9KA 1KVAA 5KFLA 2IHNA 1SL0A 3S3MA 1L3VA 4E1NA 4EBCA 4O3OA 3ZDDA 1QTMA 4ECUA 3L2WA 3V9WA 1KFDA 4NCAA 4DSIA 2E6LA 3ZSVA 4KFBA 7ICSA 5CY4A 3MR2A 4MFFA 4KO0A 1JLBA 1L3TA 3G6XA 3VA3A 4YCXA 3L2RA 5KRTA 4BE1A 4RQ2A 3HP6A 3DI6A 4UAYA 2OPSA 1RT4A 5CYQA 3GILA 1HNVA 4QW8A 1GOCA 1RTIA 4FJ9A 4F3OA 3UIQA 1NK4A 4TUPA 4KLQA 1NK7A 4O3SA 4ID5A 4W5NA 4Q44A 3RR8A 2ZE2A 1MQ2A 4OGEA 2R8JA 4Q5VA 3L8BA 1ZQMA 2W8KA 9ICLA 1XU4A 8ICCA 3V1QA 2RKIA 9ICJA 1WCLA 1QS4A 5JUMA 4J2BA 1JIHA 3CYMA 2ZUCA 3GV7B 4O3PA 5KG6A 1C0MA 4EBEA 3Q8KA 4DU3A 4QCLA 2Z1JA 2BCVA 4ED6A 2BCSA 4NM1A 4F4XA 4M3RA 4AHVA 2FPLA 4R5PA 3V7LA 4M3YA 4J9MA 4FS2A 7ICEA 1VSLA 1CUKA 2PYJA 4PHPA 5CB1A 4UAZA 5L9XA 9ICKA 3DLKA 2RDJA 3P83D 3MR3A 5DQHA 5KG5A 3M8RA 1GOBA 2IOCA 8ICEA 1NK5A 2GBZA 4QZAA 1ZBFA 3M9NB 3MBYA 3L3VA 4QZ9A 2IC3A 1KSPA 4I2PA 4ELUA 1TL1A 4KRFA 3MDAA 4NLNA 3G6VA 1RBVA 1XC9A 4QOZB 2WONA 4BDPA 2Q3SA 3L2VA 4I7FA 4OPJA 1A5WA 2EHGA 4NLGA 2W9BA 2KZ3A 4M0AA 4ELVA 5L1KA 3OYIA 2IS3A 5IILA 4Z0UA 1UWBA 3AVAA 5DMRA 4MQ3A 3K5MA 2OZSA 1BISA 5HROA 2R8IA 2FLNA 3CM6A 4C8OA 1IG9A 3TAPA 5FRMA 4KTZA 4Z4IA 1U49A 1ZQXA 3H8WA 1S0VA 3HWTA 2VG6A 3HK2A 4FJHA 9ICAA 4J2DA 3AA2A 4DSEA 3DM2A 2OZMA 4KB0A 3AA5X 4UB3A 1ZQPA 3MDCA 4DQRA 2MAXA 3N97B 4CGFA 4KTQA 5CYMA 3KHGA 2B5JA 4FLWA 3N4MB 4UB4A 3B6OA 4Z6DA 4O4GA 4QAGA 2HHSA 4CJVA 4Z4EA 7ICTA 2DTUA 1X1PA 2F8TA 3AVGA 5CP2A 3V7JA 3AVMA 3AVCA 2AGQA 3KIOA 2VA2A 3SI6A 5D3GA 4CGJA 4PGXA 2BQ3A 4CEEA 3ZD9A 7ICKA 1XWLA 4YR0A 1RTJA 4B9UA 1U9LA 5DLGA 1K1QA 3OYMA 3U3GA 2W9CA 4B9VA 2JLEA 3OYBA 2XY7A 2DPJA 2VG5A 5KFSA 5J0PA 4CGIA 4LD0A 8ICPA 1AROP 2PXIA 4O9MA 4E7JA 3LPUA 2RPIA 4CJWA 1IM4A 4QZHA 2FMSA 9ICCA 4NM2A 4F5QA 3K57A 3KLFA 1D5AA 5EWGA 3KKRA 5CA7A 4ECZA 1NJWA 4F5OA 3MXIA 4RNOA 4CGDA 3AUOA 8ICHA 3HJFA 8ICNA 1JXBA 1IKYA 4UB2A 4NLKA 9ICNA 4LY7A 1BPEA 1KTQA 3K5OA 2FLLA 5J2KA 4PGQA 5HHIA 4RNMA 4I2EA 1BHLA 3AO5A 3MGIA 4DOAA 4W5RA 4YD1A 1H38A 1S6QA 4F5PA 4CECA 4HUEA 2P1JA 4CHNA 4FJXA 3AA4A 1ZQAA 4MFBA 4I2DA 1VSFA 4EYHB 4O0JA 3EPGA 8ICMA 4Y1CA 2KFNA 4H4OA 2E4LA 4IKFA 1T8EA 4CJSA 1YTUA 4FM1A 1N5YA 3AVKA 3LWLA 5J2JA 3Q8QB 1B43A 3RAXA 3C23A 5CWRA 8ICGA 2RN2A 3JPPA 2PYLA 4FJ8A 2D0AA 4JV1A 1HYZA 5J2NA 3V6JA 3WNFA 3JPTA 4E7IA 2ATQA 3TAEA 2BPGA 2PI5A 4JV2A 2QK9A 1ZQRA 2C2EA 3QEAZ 4HHTA 2ZTCA 4Q0BA 3KK3A 2ZQBA 2P6RA 2FLPA 4F5RA 4FYDA 3ISCA 3C95A 3RB3A 1RT6A 3UPQA 1BCMA 3SNNA 4IQWA 4FLTA 2YNFA 1LAVA 4F92B 2QXFA 1QE1A 2G8WA 4PPXA 3PW2A 2FBXA 4TQSA 1BIZA 3OYCA 7ICQA 5IIJA 1QSSA 2C28A 4YR3A 1C7YA 4QZGA 3NH0A 2UVUA 1X9WA 4J9LA 2KN7A 1U04A 1KRPA 3VQCA 1Q9XA 5J2FA 4CJ3A 4PA1A 3T5HA 2HNZA 3DLRA 1RT5A 4CJKA 3OYHA 2PI4A 4DS5A 5J2CA 4I27A 1NKCA 5KFOA 2X6NA 1Z26A 3AO4A 1RDAA 1WCNA 1BI4B 2LYHA 3ZT2A 3FYHA 2C2RA 2G8UA 4GVMA 5J0RA 4KLFA 8ICKA 2XY6A 4DL6A 3QIPA 2AJQA 4CJFA 3RB0A 3JSMA 2BQRA 3C5GA 1D9DA 1DTQA 5DKWA 2PZSA 3KLHA 3KHRA 1WAFA 3TAQA 4LH4A 3ZSOA 1N6QA 3VQ4A 2BCQA 9ICMA 1S6PA 1HUOA 3GQCA 5CHGA 1XS9D 5DQIA 1HPZA 3O3GA 4PQUA 5KFKA 3PMNA 4YVZA 2VA8A 3K5LA 3DRPA 3KHHA 4GC7A 3ZDBA 5KFBA 4Q45A 3QZ8A 2J6TA 2HB5A 4JRPA 1F21A 4FZXC 5DB8A 4P4OA 2XHBA 4DFPA 3RRGA 4G3IA 7ICLA 3NGIA 4DTUA 2DPIA 1BQMA 4QWDA 4JUZA 1XI1A 5KFXA 4NCBA 4M9NA 3H4BA 3TANA 1TGOA 3PO4A 3WNEA 4TQRA 4DL7A 4M41A 1KLNA 3MXJA 2G8IA 9ICFA 3NGZA 3V6HA 4FJ5A 1C1BA 1ZYQA 4CJUA 1K1SA 5DG9A 1JLCA 3SUOA 2R7YA 1VRUA 5J2QA 3RJGA 1IKWA 8ICJA 3QZ7A 3V7KA 1LV5A 3TWHA 5DQGA 2WOMA 2P5OA 4ZHRA 1BCOA 2O4GA 3IHQB 1Z25A 2UVWA 4M42A 5D46A 4KTWA 2YV0X 4OLAA 1ZQHA 3PX4A 4RPZA 1S5JA 4DL3A 3AU6A 5IIOA 4E7KA 3ZSXA 3JPNA 1SV5A 1WSGA 1WN7A 3ORYA 1EXQA 4YFKA 3F73A 2ZUBA 4R64A 1WSFA 4DQQA 3O4QA 5HRRA 2AQ4A 1BL3A 4JS5A 4P2HA 4CJRA 3MGHA 5KFGA 1ZQQA 1KEJA 1HRHA 1TVRA 3KLIA 3JPRA 4R66A 4FW1A 4TUQA 1U47A 3NDKA 2OPPA 4DQPA 4I29A 1LWFA 2Z1IA 4DTMA 4KMUA 3ZT4A 2X78A 4YMNA 4W5TA 1S0OA 2NRXA 3HT3A 2C22A 3OYFA 1ZQGA 3AVNA 1W9HA 3DYAA 1JL2A 1O1WA 2MUTA 3I0RA 4YP3A 4IFVA 4FW2A 2BANA 3LZJA 1JXEA 4RQ3A 3FFIA 4KN7A 7ICRA 4LZDA 4YNQA 1NK8A 2ISOA 1RT2A 1TKDA 4QZCA 2FBVA 4GC6A 4ID1A 4R8UA 2HHUA 4EP5A 3O3HA 3VQPA 1HQUA 1FKOA 4N47A 4I9QA 5J0SA 2PFNA 4Z6CA 3KJVA 3VQ6A 2JZBB 1ZQOA 4I2HA 2BQUA 4BXOA 1Q8IA 4AILC 3JPQA 4X5VA 2ISPA 1KVBA 4Z4HA 4AH9A 3MAQA 4KLTA 3ALYA 1VSIA 3IAYA 4ECSA 3QEIA 2BHNA 2F8SA 3C6TA 4B9TA 2M9NA 1S97A 4I2AA 3L3UA 3NTUA 3M8SA 4AHRA 4AHSA 3HVTA 1ZJMA 5KFPA 3V9XA 1UAXA 4F2SA 3HPHA 2Q0ZX 1ZQJA 4DFJA 4F8RA 3WNGA 4IQVA 2ASDA 4QZ8A 3UXNA 5KFFA 4DLGA 7ICJA 3KTQA 4ELTA 1ZQWA 4F4YA 7ICIA 1VSEA 4B08A 3PVXA 1EETA 5J0UA 1BGXT 2R8GA 3Q8MA 3OHBA 1HYVA 4RW6A 2I9GA 8ICUA 2E6MA 2OPRA 3OYEA 5IIMA 3ZSRA 3KLEA 1XSLA 1TK5A 4E7LA 1QSYA 4M3XA 3T3FA 9ICQA 4B8AB 4FO6A 4KHNA 2XY8A 2NRZA 1RPLA 3DOKA 2ZJAA 4QZEA 1U48A 3QINA 1VSHA 3OVNA 2FPMA 3HO1A 1S1VA 5EU7A 4N56A 1S1TA 4GXIA 3NF9A 4F50A 4BDYA 2RF2A 3Q8SB 4JLHA 4TURA 4F4KA 3T1AA 3SQ2A 2XGPA 2IA6A 2OPQA 5KFEA 4OKJA 4LVSA 5F9LA 4RQ6A 1LW0A 4KAZA 1ASWA 4JK1A 2EX3A 1SL2A 2KZMA 3VQQA 5J2PA 1D9FA 1Z00A 4CJEA 4KLLA 4O3NA 1T4GA 4DTNA 5L1LA 3RR7A 1RBTA 4OKKA 1D8YA 3C2MA 4M45A 3PX6A 5CJ7A 4DFMA 9ICTA 4BWMA 5DLFA 3SPYA 1C0UA 5KT6A 5KT4A 9ICWA 4KV8A 4I2CA 4KKOA 4DFKA 2XCPA 4KHSA 4OJRA 4KLOA 2AU0A 4PUOA 3NAEA 4K4IA 4OLBA 3BQ1A 4CF2A 4DU4A 4FJJA 3QEVA 3OS2A 4HYKA 4N5SA 1J5OA 4I2FA 5KG3A 3V72A 3V9UA 2YHBA 4BE0A 2KTQA 4FLVA 4IFYA 4CHQA 4CJTA 1X2IA 4J9SA 4ECXA 4PHEA 3MABA 1S1UA 1S9EA 2FMPA 2BPCA 3TFRA 5J29A 5KFNA 1VSMA 2HHXA 3AO1A 3RMCA 4RQ7A 2B6AA 3OJUA 2GWSA 1I3AA 3DRSA 4J9NA 3H08A 5DG8A 8ICFA 3TAGA 4Z4CA 4AHTA 2A1SA 4CEDA 4FLUA 2ZJ5A 4RUAA 2C2DA 3ZSQA 4CGGA 4QZBA 1BPXA 1FK9A 4RQ8A 5J0YA 3RAQA 1SUQA 4M6WA 1SKWA 4KREA 3OS0A 3FDSA 8ICIA 4IQUA 5I3UA 5D49A 1KLMA 3VA0A 4QWEA 3LANA 2QKKA 4UB5A 5J2EA 4C8KA 2P51A 3SV4A 4RW9A 2UVRA 3DLBA 4DSFA 5KGXA 7ICNA 5IINA 1RBSA 3LALA 2AGPA 3MEEA 1JMSA 4NYFA 4ECWA 2XGQA 1HUZA 2GUIA 4RT3A 1QHTA 2DFEA 4DTOA 5DDMA 4CIFA 5HMMA 4CEZA 4KPYA 2KFZA 1RTDA 2G8KA 4RPXA 4EP4A 2HHTA 3RH4A 2JGUA 3NH1A 4XQ8A 1MSWD 3CFPA 4FCYA 5F9NA 2DFFA 4RG8A 3PY8A 2A1JA 5EWFA 9ICUA 1C6VA 4R63A 3U3YA 1HYSA 1RDCA 2KZZA 1YTAA 1ZQNA 4WE1A 3L2QA 4CF9A 1JXLA 4F4WA 3LK9A 2FPKA 3THVA 4M47A 5KFUA 2XC9A 4HUGA 4CESA 4KN4A 1VSDA 3KK2A 4RQ1A 1C0TA 3HSTB 9ICBA 2ETJA 8ICSA 4DEZA 1A77A 1SZPA 3LP3A 4O5BA 4I2JA 4J9KA 2XCAA 2IBKA 4M9HA 2ASLA 4GXJA 3M9MB 2MUTB 1LWEA 1COOA 3AVIA 1IH7A 3SUQA 4QZDA 2BCRA 1T3NA 3QE9Y 1JLEA 4J9RA 4R65A 1TKXA 4LZGA 2VA3A 1N56A 5J2IA 4CIEA 5C24A 4CJLA 2IDOA 4M3TA 4B9NA 1TVAA 3AV9A 4YFUA 5J2MA 2JEIA 5KRSA 1JLAA 4AHCA 2YKMA 4KI4A 2F1HA 2P6UA 3G0ZA 2YHAA 1JX4A 1TV9A 5L1IA 4CFCA 3LPTA 3WNHA 1SKSA 2HHWA 9ICGA 1NOMA 4DSKA 2BCUA 4M9LA 4CCHA 3QIOA 2H5XA 4H8KA 1DTTA 1KFSA 3NGYA 4RQ5A 4QWBA 5J0QA 1C1CA 4M9JA 2G8VA 1N48A 1ZBLA 3UQ2A 9ICHA 1BPYA 1BVSA 4KLSA 4O55A 1ZQCA 5HMLA 8ICOA 3BGRA 1S0NA 3EZ5A 4ICLA 4CEOA 1RCHA 2VANA 3AVHA 4KB1A 2HVHA 2ATLA 3M9OB 4NY8A 3BQ2A 3V6KA 4FJKA 1ZQZA 3DLGA 4Y1DA 5L1JA 3RMBA 1RT1A 4DL4A 3OYJA 1ZQDA 3OHAA 3OYGA 1MU2A 4F5NA 2D0BA 5DGBA 4YXMA 1ZBHA 1L3UA 3CFRA 4KITB 3CFOA 4J9PA 5DGAA 4JS4A 1XHXA 3AVBA 4DTRA 2BPFA 4JWMA 3PR5B 4ED1A 3RTVA 3C5FA 5KFRA 3MFHA 3LZIA 3SQ1A 4O5EA 5KFCA 3S9HA 2O4IA 2LSNA 1EP4A 5HRNA 4ECRA 3DOLA 4EBDA 1D8LA 4YD2A 3ISBA 2HNDA 4NXZA 5KFMA 4F3TA 3OSNA 1CLQA 9ICVA 3C94A 4HUFA 4CK1A 4FK0A 1Y88A 1ZQBA 1X9SA 1REVA 1RDDA 1HMVA 4DF4A 3ISDA 2Z1GA 3ZSZA 3K5NA 3GDXA 4N76A 3JPOA 4CEQA 3PW7A 8ICWA 1LW2A 4G1QA 3QEBZ 1KDHA 3NE6A 7ICUA 2R8KA 3Q8PB 1LB2B 4UQGA 2KQ2A 3VQAA 5BOLA 2W9BB 4IR1A 4CEBA 3GIMA 2W8LA 2BGWA 3QNOA 5CZ2A 7ICFA 3H4DA 5JS2A 7ICOA 4B3OA 2V9WA 4KLJA 3U6FA 3MEGA 1RXWA 3V6DA 5KFQA 3T5KA 3ZD8A 1SL1A 4I28A 3JPSA 3MEDA 4BACA 2V4RA 5KT3A 2XO7A 3HL8A 1EXNA 4CK2A 4ECQA 3ZT1A 4CEAA 1C1AA 3TARA 3NF6A 3OYNA 1ZQEA 4DL2A 4M3WA 8ICVA 3V1OA 1A5XA 1EX4A 3E2EA 3QLHA 2QKBA 2P66A 1B9FA 2D5RA 3NF8A 1K6YA 4CHZA 4CJPA 4RW4A 4YMMA 3TR8A 3ZT3A 3GIJA 3HW8A 4K4HA 5KFIA 4OKEA 2BKEA 4MEYA 3ZSYA 1RBRA 4CE9A 3VQDA 5D4BA 3QETA 7ICVA 4FZZA 2W9CB 3SYZA 9ICIA 2PFQA 5HP1A 4RU9A 4E3SA 5DB7A 2YNGA 3IG1A 3K75D 2ASJA 4CFAA 4DLEA 3RJFA 1MC8A 4KLGA 5HHHA 4TSXA 5J0TA 2ITGA 3SCXA 1RZTA 1TK8A 5EWEA 2ZJ8A 3T5LA 4M3UA 2W9MA 4J2EA 4RT2A 2ZTEA 3ETLA 3T5JA 4XRHA 5J0WA 4IRKA 1ZQVA 3C1YA 1B92A 1HJPA 3K58A 3TQ1A 2BE2A 1S76D 1RYRA 1NJYA 1UA0A 2V4QA 3CQ8A 4RW7A 4YR2A 8ICBA 2Y1IA 1CZBA 3CG7A 2G8HA 5DDYA 4IRDA 1HNIA 3LP0A 3VQ9A 3AO2A 4MF2A 3AU2A 3P5JA 4XIUA 9ICOA 3EW9A 1G15A 3PO5A 2ALZA 4IG3A 1S77D 3DLHA 5DBBA 4HTUA 1RYSA 4O3RA 1R0AA 1JLGA 8ICLA 4I2BA 3H8SA 4I2QA 4OGCA 4DSJA 1HQEA 4E7HA 2XRIA 4K8ZA 5DB9A 4GW6A 3ITHA 4N41A 1WSIA 2JEFA 8ICRA 2KW4A 5JS1A 1QLNA 4EZ6A 1RT7A 4K4GA 5TZVA 1J53A 4W5OA 3ZDEA 1J54A 4DMNA 4UB1A 5HP4A 2ZTDA 3NF7A 2UVVA 5KFYA 4B9LA 3HX0A 3SPZA 4ED2A 1L5UA 3LDSA 2JEGA 3DLEA 4YQWA 1BI4A 4PH5A 3ZDCA 2X6SA 1WAJA 5KFWA 5KFHA 1RT3A 3PMLA 4CF0A 9ICRA 3BJYA 3KD1E 1ZQYA 4C8NA 4DF8A 1JLQA 5J2BA 4DWIA 2VWKA 3ULDA 2RDIA 5KFVA 4Z6FA 3K59A 1IO2A 1I39A 4IRCA 3P1GA 4O0IA 4DQSA 1NJZA 4UAWA 5DK5A 3TAFA 4B9MA 1UT8A 3JYTA 3PX0A 2HNYA 5DBCA 3VN5A 3C21A 3SZ2A 3ZDAA 2WTFA 4FK2A 4P4PA 4P4MA 3AA3A 2F96A 2PFPA 2PY5A 3HPGA 3O4NA 4Z4GA 5KG7A 3PW5A 4H4MA 1TKZA 3VQEA 2OA8A 4YMOA 1ZETA 5C5JA 5HLFA 4RPYA 2FC0A 4ECTA 1U4BA 2IHMA 5C42A 1VK0A 1FXXA 5KFZA 3QO9A 4LSLA 4O5KA 3HVRA 4DTXA 1ZQUA 4QWAA 1WLJA 3I0SA 3RBEA 4O44A 2P5GA 4FJNA 3O3FA 4F4ZA 3HP9A 5J1EA 1XHZA 8ICZA 4B8CA 4UBCA 4O3QA 4GLXA 2W9AA 1UA1A 2W42A 4BDZA 1T05A 4M3ZA 5IIIA 1WSEA 4MF8A 3ISNC 5KFJA 3GV8B 3CM5A 4QW9A 1U45A 4EYIB 2FBYA 4DOCA 1NJXA 2VG7A 2YNHA 3T19A 4CIGA 2FMQA 4CF1A 1TAQA 5J0OA 2F1JA 4CF8A 3C2LA 5KG2A 4FXDA 4FJLA 3AVFA 4FLZA 1ZQIA 4C8LA 4CHPA 3LAMA 1RBUA 3PUFA 2FBTA 4FVMA 1CXUA 3OS1A 2X74A 8ICQA 4OPKA 4ZH4A 1ZQFA 1QSLA 1BPDA 5CR0A 2IAJA 3B0YA 3RB6A 3GFKB 1HJRA 4EEYA 3HYFA 9ICXA 1DOQA 1PZNA 1XSNA 3VQBA 3G6YA 4MFAA 1XSPA 4M2YA 3NGDA 3RJJA 3IM1A 4PGYA 1ZQLA 3NCIA 2AQ0A 1V9PA 4CK3A 4YN4A 1J9AA 3RRHA 3QEPA 3PV8A 5KFAA 3RBDA 4HCCA 3TABA 4E89A 1JKHA 3KLGA 4DO9A 4FS1A 1FKPA 4I2IA 3RJEA 3KHLA 4JWNA 4FM2A 1LAWA 1Q9YA 2J6UA 1NKBA 2HMIA 3PNCA 3MFIA 1ZQSA 3OYDA 3ZT0A 1S0MA 4NCGA 5CZ1A 1TV6A 3V1RA 3OYAA 2JZBA 5KFTA 4KLIA 4IQTA 3SUPA 1TAUA 4RZRA 3OY9A 4GMJB 4DSLA 4FBTA 4PHDA 4M04A 3M8PA 4CFDA 4NLZA 5IIKA 3Q8LA 2A1RA 3TFSA 3LWMA 4M9GA 3D0PA 3EY1A 2DFHA 1JLFA 1B22A 3AO3A 1ZBIA 4QZFA 3GIIA 3NFAA 7ICMA 2HHQA 1WSHA 5J0XA 3LP2A 4FM0A 4I2GA 8ICXA 5SWMA 1NK9A 1ZJNA 3QNNA 1Y97A 3TAMA 4J9QA 5J2HA 4MFCA 1ITGA 4KLMA 4ZTJA 1A76A 4ED0A 3QEWA 4B9SA 1TKTA 5KG1A 3RH5A 1DLOA 3AVLA 3C6UA 5J2AA 4R8UB 1IKXA 3DMJA 2IMWP 5BOMA 3OSPA 1VSKA 5DG7A 5I42A 2ZUDA 4OVLA 1NKEA 5KT2A 2YKNA 4O5CA 5KTQA 1S1WA 2YNIA 3ZSWA 4CGHA 4CJQA 5HRPA 4KLDA 1QQCA 4DTPA 1IKVA 4BXOB 4ZTFA 1TFRA 3ASMA 2HW3A 4F93B 1IXRA 4FZYA 1VSJA 4BWJA 4GXKA 1KFTA 1UOCA 2G8FA 4ED8A 5E41A 4CFBA 3HXMA 4DTJA 3EWAA 5KG4A 1YT3A 3NBPA 3HM9A 4IR9A 4Q8EA 5HBMA 3K4GA 1SKRA 2ZD1A 4DU1A 3EPIA 3B0XA 2OYQA 3KK1A 3RMDA 5BPCA 3I8DA 1DGSA 1RNHA 4CEFA 4RQ4A 1ZBUA 4RQ0A 3IS9A 3DRRA 4TUSA 3V81A 3S3OA 5DBAA 1S9FA 5J2GA 4KHWA 4JRQA 4ED3A 2GV9A 1JN3A 4NYNA 4KLUA 3MR5A 3GIKA 1UT5A 4JV0A 1TK0A 3OYKA 4DQIA 2I1QA 1BPZA 1WNSA 5SZTA 4K8XA 3VQ7A 5FRNA 4HVJA 4UBBA
chains in the Genus database with same CATH superfamily
4KHQA 1X6IA 2CGKA 3DEEA 2Q3PA 2WF8A 4DG1A 3US5A 2GO9A 3THTA 2ZEJA 1S1VB 3F44A 3KD5E 3GG4A 3I28A 5D78A 2UXCJ 3BS9A 1RQ0A 4XTTA 3PJ9A 3SK3A 1NK6A 1S9GA 4IOAL 2EWSA 1S12A 1PO6A 2WVFA 1YIJN 3BM7A 4XUSA 5KG0A 4CERA 1TE2A 2RHFA 2KSOA 4CTAB 2BR0A 5AQRA 3OTCA 5HNKA 3ZYYX 2HHVA 3MX5A 3C15A 2VQFF 1NWKA 4IO8A 1YITN 3SEOA 3BQ0A 3MMAB 4CJ4A 1XC3A 2NXUA 3AH6A 2IRUA 3T6BA 2D3UA 5BRFA 4CNQA 2W01A 5HATA 2V94A 2RHSB 3GJQB 4K0KJ 1M1KT 8ICAA 1ULRA 3Q83A 3C1ZA 4NPOA 3DNCA 4AFFA 2CG4A 1PVPA 2DNGA 3CRXA 1J5OB 4M5DB 2OAUA 4IEIA 2NLWA 3BDPA 4F26A 2KEYA 4J2AA 3LVVA 4FK4A 3HM8A 3HSJA 1GXUA 2VC1A 1Q82T 2W3RA 3KKSA 3CCZA 3MR6A 4ZN1A 5J2DA 3HSDA 2ZH3A 4A2AA 1LCUA 1SQKA 1XR7A 3DRSB 4FJGA 2RH3A 3CCEN 3RJHA 4Q43A 2HMXA 1R59O 5HMZA 2UUBJ 3U02A 3D2FB 1OJ4A 2AJ2A 2YY6A 2Y1JA 1L7MA 3LDAA 3QUTA 3K2PA 3GTYX 4A57A 3EICA 3DHXA 2ROGA 2OMOA 4NWBA 2K2PA 2PFOA 2BW2A 1KW4A 2IJFA 4KSEB 1B9DA 3BZKA 4ZKAA 1AXQA 3F56A 3QYPA 3SI8A 4BR5A 1FNOA 3G10A 4BC2A 2F1IA 2OWOA 3V4MA 1TTHB 3LO3A 1F2GA 1DBDA 1OQ3A 1XUPO 1URNA 4YORA 1NOZA 1V9OA 5KI6A 3MEEB 4DV3K 2FHJA 4KHUA 4OX9K 1FFWB 1VHIA 1PG5B 2IVMA 4EZ9A 2KN4A 2FVRA 7ICGA 1ZBTA 4LRBA 1LEOA 2VBYA 4BE2A 1HBNB 4CIOA 4DN9A 2FJEB 3MXMA 3IDWA 2NRVA 1GMUA 3M6WA 5ALUA 2ZM6K 4Y3CA 5IT9U 2A1JB 2IRXA 4UOGA 1TL3A 2BABA 2N3OA 3NASA 3I8BA 4WE1B 3VZHA 5H9FJ 3QERA 3Q8RB 3B4MA 3LP1A 3PHEA 5EOZA 1UJ6A 5H1SV 1W0HA 5AQMA 3UQSA 4PPDA 3B54A 1KC8T 1FVSA 1WHWA 4OI2A 3HTVA 4KE5A 1RACB 4AHUA 4KH1B 3NHGA 4BR0A 3AXKA 1RXVA 2QSWA 4A4JA 1BUPA 1YSJA 3F9KA 2RUGA 2Q6BA 1KVAA 5KFLA 3ULHA 5GTHU 1KBRA 2MSSA 4K4TA 3EZOA 3HVWA 1QTMA 2CGLA 4NCAA 4DSIA 2E6LA 3H25A 2YQ1A 4OI4A 3RG6A 3T9ZA 2C2KB 2NLXA 3AD7C 4B1UB 4DKWA 4NA1A 2GWKA 2HEKA 4YCXA 3AN1A 2VFUA 3C6UB 4JI0J 1Y64A 4BRFA 4JD2A 4RQ2A 3HP6A 2OPSA 5CYQA 3GILA 5AZIB 2ZJPQ 1P1TA 4QW8A 1JLAB 3H5YA 4EO6A 1FJCA 3UIQA 1NK4A 1N34J 1NK7A 4O3SA 1VISA 4Q44A 5E7OB 3KLVA 4ZP8A 2P9IB 4ETXA 2FHKA 5T41A 3I56N 2W8KA 9ICLA 1XU4A 3PJWA 1A0PA 4PL1A 3CEDA 2VKQA 4C4WA 3G82A 5AKXA 3N0VA 3FSYA 3H6EA 1UETA 3UD4P 2ZUCA 4O3PA 2LQ5A 5KG6A 1C0MA 2D0OA 1DTTB 4EBEA 4QCLA 3M30B 4IS7A 1HNZJ 4B1WB 1OQ6A 2Z1JA 4F4XA 2M52A 3QU7A 2FPLA 4KGKA 2LU1A 7ICEA 1CUKA 1VBKA 2RSQA 5CB1A 3ENVA 4K5RA 1APSA 3ZFVA 5CAAA 2AJ0A 2G4BA 3P83D 4WP9A 4X62K 3MR3A 3BGRB 1M90T 4C4SA 4ICLB 4F67A 4QZAA 4QZ9A 2KM8B 4M5MA 5GAGP 1SH3A 2E8MA 3MDAA 1RT1B 4NLNA 1KAXA 5AKZA 5KOXA 2R42A 2NS1B 1RBVA 4LVNP 1U6ZA 4L3KA 2WONA 5FIIA 4QNLA 1SB3C 1Z05A 2YJEA 5GMEA 2FD2A 3IWNC 3O08A 4QS9A 4BGAA 5L1KA 3THYB 7FD1A 1NNDA 2QFJA 3ZZTA 1UWBA 3C66A 1BISA 1MA7A 1T9WA 2IIRA 3CULA 4KT0C 2W55A 4ZDNA 2YHYA 4C48A 3NCPA 1ZQXA 3MXHP 4P6QA 3H8WA 4DB3A 2V68A 4LF6J 1DGKN 4NI2B 1S0VA 1WKKA 4X66J 1R43A 2CRXA 4FJHA 9ICAA 5A0YA 4OJ5A 3ULEB 5EUHA 1NDLA 3AA5X 3MDCA 3N97B 1JCFA 1IBCB 1U7LA 1GLCG 3HHLD 5CYMA 1BQNB 4AXJA 1MN7A 4ANDA 2LU2A 4HVZA 4UB4A 1HMVB 4O4GA 4YS2A 7ICTA 2WVCA 2DTUA 1LW2B 1XEZA 4G1QB 5LT5A 3ID6A 3AVMA 5ETRA 3KIOA 3EX7B 1BWVA 4PGXA 4OYWA 5A6WA 4CEEA 1CS4A 3AA8A 4WXOA 4YR0A 4B9UA 3BBFA 2CPIA 2BJEA 3QUBA 2O8CB 2F76X 3MAHA 2ZBPA 2RQ4A 2JLEA 2XY7A 2DPJA 5LXYA 3QUCA 2MZQA 3QMQA 5T7LA 3VTHA 3WXLA 3I55S 4LD0A 3LL3A 1GLJO 1TR0A 4USUA 1AROP 3HFVA 2YMLA 4B3OB 4A8XA 1SXDA 4O9MA 4E7JA 4CZGA 4CJWA 1IM4A 4QZHA 2FMSA 3EZUA 3KMSA 3M6KA 3L4QA 4MIBA 1KQSM 1HNWK 1D5AA 5EWGA 4P2MA 4WKYA 3HT0A 1ZM2A 2ZVSA 4TU9A 3TVYA 1NG9A 3M1YA 1OWXA 3SCKE 1JXBA 4UB2A 9ICNA 2ZZTA 4YB1P 2YB4A 2LECA 5AZJB 4DOAA 1MROA 3W60A 4F5PA 3P96A 4CECA 4NMLA 2FPHX 2K8CB 4J91A 4NZ0A 2QWOA 5EE3A 1EWRA 5B7WA 3PYFA 3IBCB 3T1YF 4EYHB 2RE2A 1U25A 1UAWA 3EPGA 2R7VA 2QYGA 1XO0A 2WAQF 2X7IA 3OUYA 1T8EA 2CQ0A 2QLJB 1YTUA 3AVKA 1SH2A 1MMDA 3Q8QB 1VQ9S 4UW2A 3RAXA 3SDEA 2MA1A 1RHJB 1T03B 1WI6A 3UMBA 2EBEA 1CJVA 4JV1A 1A6LA 1P90A 4DR7F 2OTJN 4E7IA 3TAEA 2BE2B 1GLDG 1ZQRA 1Q46A 2ACMA 3QEAZ 4RW7B 4A46A 3KK3A 2EFQA 4JKGA 4P73A 2FLPA 1S79A 1NB2A 2UV8A 1FRIA 3I1YA 3ISCA 3LP0B 2LQ8A 2OEHA 2CJXB 1RCOB 3MM8B 4IQWA 4BR9A 4F92B 3P5BP 3UDVA 3U26A 3E66A 1S1XB 2EWHA 4JI5K 5B08A 4DR4J 3SCIE 4CLTA 4TQSA 1BIZA 1R0AB 4YR3A 1C7YA 4QZGA 1BOTO 3NH0A 4OZ2A 2W2OP 2X3GA 4YY3F 1X9WA 2VDHA 4J9LA 2PT0A 4I6MA 3NOCA 4AD6A 2HLTA 4DCPB 2V63A 5J2FA 3DLRA 1RT5A 5AKJA 3NVVA 3OXLA 5E3AA 3M4XA 4DS5A 3NGKA 2YKAA 4CT8A 1JJ4A 1DJ0A 1GXTA 1D1UA 1NBWA 2X6NA 2GV1A 1T9TA 1T3QA 4GVEA 3AAWB 5AM0A 1RHUB 3NS1A 4IH5A 3VF4A 2QN6B 2G8UA 1DKGD 3PDNA 1QAYA 3DXBA 3QIPA 3KNAA 5AKLA 1RT3B 4CJFA 1HJOA 1MW7A 3FCHA 1IG6A 4MKBA 2VIXA 1JLQB 5DKWA 1U1OA 2UXDF 2PZSA 1V4SA 2A42A 1FD2A 5F8HA 4LH4A 1TELA 4AL5A 1Y0HA 2FB0A 3NOGA 2ZNYA 3WK5A 1HUOA 1OYDA 1PYTA 4DR3F 1XS9D 3O3GA 4PQUA 5KFKA 4YVZA 2LVWA 4FFDA 3NS7B 1GAOA 1VQKS 3KHHA 2PEBA 4C1NI 4X4OA 3MWTA 4ITSA 4Q45A 3QZ8A 1TKZB 1WWVA 4FZXC 4URGA 2XHBA 4KBOA 4P7TA 4DFPA 4Y2YA 5HLFB 2W6KA 3DLKB 2EK6A 2MQ8A 2G2YA 1L7NA 4RNHA 4YB7A 3FSIA 2KNJA 4M9NA 2A3VA 4QYZK 1NEEA 1DQ9A 3CMQA 3SEIA 4DX8H 2R7TA 1UCVA 2NREA 5JMNA 3SMZA 4FJ5A 2O66A 3FZKA 1C1BA 5J1EB 5EE1A 2DR7A 3UVJB 4OMFG 5L38A 1VRUA 4RPFA 3P39A 5AQOA 4CZLA 5J2QA 1U0HA 1OH8A 3LDPA 4KGMA 2MY8A 4FXVA 4GY2B 1LV5A 4OYZA 1GNKA 4CNZA 4EELA 2WOMA 4K59A 2R2UA 1BCOA 2KHQA 2EXUA 3IHQB 2PMWA 3BGFA 4ENOA 1NSKL 1HFEL 1S5JA 5IIOA 5EE9A 4E7KA 3ZSXA 1G3OA 4MLHA 3ORYA 1H6KX 2MKHA 1IJEB 1KN6A 3FZLA 2MQQA 1BL3A 4WTOB 1HIYA 2GS8A 1X4BA 4WTYA 4JS5A 5AQKA 3H2UB 1ZD4A 2ZBIA 3S1TA 1TVRA 4ALZA 3G9CA 4TUQA 4KMUA 1R0CB 2XS7A 3TP2A 1NPKA 4HH0A 2NRXA 1UEUA 3HT3A 3IC1A 3FJ2A 1ZQGA 1RDFA 4WCEQ 3GJTB 5HAOA 4QU7A 3I0RA 2EBGA 2J5AA 5L9NA 2PA3A 4RQ3A 3KLGB 7ICRA 4YNQA 4BBYA 1TL7B 2V69A 2UU9F 4UY8O 4UOHA 1RWKB 4YHHF 3HVAA 4X62J 3KXDA 2Y8YA 2XLIA 4U8YA 1XIQA 5M2UA 1FKOA 5F0WA 3EXCX 3ZZYA 1TV6B 3OBIA 3HHNB 3FZFA 2OO4A 2BQUA 4BVPA 4WK3A 2K60A 3CVKA 2VC0A 3VGUA 3B8HA 4YN3B 5BYQA 4LJMA 4RCHA 2YWGA 2ISPA 2ZC3A 2FLOA 1ZPWX 1LK5A 1WUUA 2HS0A 2E88A 4Z4HA 2H4WB 4A8YA 1LNQA 1VSIA 2BHNA 3MPDA 4B3RF 2F8SA 4B9TA 5A2QY 3VESA 1S97A 3AJ2A 4I2AA 2RQKA 2IVOA 1X9JA 1D3WA 5F2RA 3HVTA 2BOPA 1UAXA 4DFJA 4CRXA 3OQ2A 4F8RA 2YWFA 1J6ZA 3NCRA 4MDAA 3CCRS 2HSTA 4DLGA 1UL3A 4ELTA 3KVGA 3GL1A 4DR2K 3M6ZA 2FJ6A 1DLOB 1VSEA 4OYIA 3OA9A 5AM3A 3Q8MA 2KXFA 2OPRA 2Z2ZA 3OYEA 3FEZA 3H0LB 2YNIB 1Q8BA 3OVAA 5AQZA 3W2WB 1WF0A 3T3FA 4IQXA 1IKVB 4ZPDA 3D3BJ 1QCKA 1D8BA 1RPLA 1UVIA 3H7HB 3CMES 5ETSA 4C0OC 1KVJA 1I1GA 1S6UA 1YJTA 2FPMA 1H7WA 2HHPA 4GKKK 2HOEA 5A2QU 4GXIA 2CJQA 2RF2A 3JS9A 3TUPA 3SIPB 4ZVTB 4FN5A 1I51B 2P5VA 3SQ2A 5JVHL 2NR0A 2IA6A 3KK1B 3TW0A 4RQ6A 1LW0A 4LF5F 1ZQ1C 3D6MB 4LFCJ 1G4CA 1SL2A 3DRRB 1HNWJ 3VQQA 3OL6A 2EFOA 3V81B 4JYAK 5JVGQ 4NLVA 2HOIA 4B3TK 5K20B 1REGX 4OX7A 4M45A 3T1YK 4J03A 1SB6A 3N6MA 5DLFA 2J0WA 3SPYA 5C12A 4Y2VA 4I2CA 2XCPA 4KHSA 5T14A 3CTRA 3BSOA 3R6LB 2OYYA 4PUOA 2HBRB 1UJ4A 2I5JB 3BP8A 3EKSA 4CF2A 4DU4A 3DHWC 2K06A 2ZOFA 4DR7K 3GSIA 2X1BA 3PHTA 3KLHB 3C28A 3PG9A 4IFYA 4Y0WA 1MN8A 4IG0B 4J9SA 4BQZA 4PHEA 3QBWA 1S9EA 2BPCA 5J29A 1VSMA 3QJPA 4U7BA 2P9NA 4RQ7A 3WC0A 2B6AA 3OJUA 3VMFB 5C25B 1N36K 5ALNA 1RP5A 3H08A 3M8QB 4ER8A 2O8BA 4J7CA 1HUXA 3GG0A 2MYFA 4FLUA 1BXNA 3ZSQA 5ALQA 4KH6A 1BPXA 2QSFA 4DL0C 1I94J 1HQ2A 3OS0A 1X4AA 8ICIA 2V0NA 5I3UA 3AB4B 4QZVB 1KLMA 2AYBA 4FKXA 1YBAA 2QKKA 4PCQA 4C8KA 4ZPBA 3SV4A 2UVRA 4JI5J 5E84A 3DJCA 4BQLA 3M1VA 1RBSA 2M8HA 2Y3YA 3AY9A 2GFFA 5FDLB 1COKA 4NYFA 1YDLA 3AOAA 3VV2B 3GE1A 2GUIA 2IA0A 5IWAF 2DFEA 4DTOA 1HNXJ 1PILA 4CIFA 2V34A 1Q16B 5A8RB 1RTDA 2XMTA 4BY9C 2UXDK 2HHTA 4EI2A 5LMNF 3L9ZA 5F9NA 3PY8A 5EWFA 4DR3K 2DNHA 3C65A 5HQ8A 3V4IB 1K73T 2V2QA 1HYSA 3SQIA 2KZZA 3GYGA 3G25A 3THVA 5E26A 3HJVA 2Q4TA 4HUGA 1N62A 3C14B 2DB1A 3QX7A 3KK2A 2AD9A 1Q8KA 4XH1A 2UUAJ 4RQ1A 1C0TA 3F9MA 3G4SS 4GO7X 4I2JA 4H4KC 1AQ6A 2IBKA 2N3LA 3H45C 3DYAB 5AXNA 2KOBA 4ANCA 2MUTB 2BKNA 4C11B 3AVIA 4NZ7A 4NL9C 1Q86T 2F44A 1RTHB 4QZDA 3MAAA 3CCQN 3QE9Y 2WAQC 4J9RA 1TKXA 2GO8A 3W8GA 4CIEA 5C24A 4CJLA 2MZTA 4B9NA 3LDOA 1CULA 4CZJA 2DL0A 1YHQS 1FNXH 5KRSA 5LL6d 3KG1A 1XERA 4HWIA 4LF7F 2FXUA 1TV9A 3GYNA 4FE3A 5AKGA 1SKSA 4UQTA 2UP1A 4R0EA 5LMUK 3H42A 1N8RT 1W7AA 2AJFE 4CYUA 3MECB 2XBPA 2GAGC 3GBTA 2G0CA 4RQ5A 1J5EJ 1C1CA 3A3NB 3MMVA 3GSDA 5GADI 2CVIA 1Q7YO 1ZBLA 4TU8A 2V51B 4O8KA 5ALMA 4OCZA 5B0BA 1IR1A 2XSJB 2HWIA 5BR8F 5I4MA 3O44A 3EZ5A 2KIWA 2AIRB 2EKYA 5G0RA 1LKYB 2ATLA 2CPZA 4NY8A 3DI6B 3WXIA 3ZZRA 1IUJA 3WK4A 3OTBA 3QWUA 1HNVB 5D4OA 5DZ6A 4P72A 5AQTA 4F5NA 4AYBD 2D9PA 5DGBA 2D0BA 1TP7A 4ID5B 4YHHK 2F3JA 2RDDA 5LOQA 3QATA 4KITB 4EX7A 4W92B 3CJQA 2CYYA 1H72C 5HO4A 1FFUA 4JS4A 4MN4C 1MNEA 4FKYA 1FA0A 2BPFA 2CUYA 3PR5B 4X4RA 1HWJA 1D8ZA 1LOTB 4JKCA 5FP0A 5AK4A 2E9TA 4Y0FA 4BC7A 3ZTQA 4X84A 1SI9A 5AI4A 2C2NA 5H2FU 4O5EA 3JXOA 1N5WA 2LSNA 5FD1A 4USWA 4PJ0U 1D8LA 1U1RA 4B3RK 4F3TA 3UKRB 4GKJF 1CLQA 4LFBJ 9ICVA 3IDHA 3ZX0A 4QPTA 2I38A 1ZQBA 5ETPA 2F77X 1OUQA 3ZZOA 4ZCIA 3ZSZA 1TL1B 4N76A 1K44A 4CEQA 3B4DA 3NE6A 1PCAA 1FIQA 5KNIA 5AQNA 3F2DA 3CJ8A 2JFKA 1LB2B 2ROPA 1MN9A 3DXSX 2MKJA 2ZH6A 3ENQA 1B99A 4KV8B 1Q5VA 4JI4K 3GIMA 4AL6A 2W8LA 1TMMA 1GMWA 3MMBB 1YX2A 4LBPA 5HR7A 2Q6CA 3H3OB 4KPCA 4Y2JA 5CZ2A 3L3FX 2ROEA 4JI8F 1FVQA 2E8OA 1KEKA 5JS2A 3MEGA 1P8GA 4DR2J 3T5KA 2E1ZA 1LXNA 1NHVA 3DM2B 4HEA9 2ZJPL 2QA2A 3U8XA 2R4FA 2V4RA 5KT3A 4UOFA 3CCJN 4CK2A 3FQKA 4DUTA 4CF5A 3ZT1A 4CEAA 1C1AA 3VQSA 4XO0A 3W63A 1W2BM 2ZH7A 8ICVA 4YDXA 1EX4A 3MN6A 1VQ8N 3TTDA 1I3OB 4J37A 2W04A 2QKBA 2P66A 3K17A 1N5VA 1O51A 4CHZA 4GKKJ 4YMMA 2YN4A 3TR8A 3ZT3A 3GIJA 3HW8A 4TLQA 5ETMA 4U7CA 1G7CB 2FJBB 1YJRA 4BRCA 5GAEI 2RU3A 3VQDA 2ZHAA 3QETA 7ICVA 2HGMA 2CNNB 2VG5B 2E9ZA 2YPYA 1H3DA 3ED5A 2XZDB 2J4RA 2ZIXA 1N32K 3PSFA 4CFAA 3VOVA 4JYAJ 2POKA 5J0TA 4Q2LA 2GWJA 4UTGA 2FC9A 2VD3A 1DGJA 4B3TJ 4M3UA 2W9MA 3K1RB 5CD4H 4PYDA 2DITA 5J0WA 1FRXA 1WHXA 1GX5A 5DZ7A 1B92A 4NL5A 3K58A 4CGZA 1IKYB 3UCZP 4H54A 3FC4A 4JKHA 5F0UA 2KHCA 4RWXA 3MM5B 8ICBA 3ONNA 1NH7A 3CDAA 1A6SA 5K8MA 4IRDA 2H51B 4MF2A 3E58A 1FO4A 3AU2A 2MGZA 3UD5A 2VFSA 4XIUA 1DRGA 4A5BA 1G15A 4IG3A 1S77D 4F3QA 3S41A 3DLHA 4HTUA 2IM2A 3MM9B 4O3RA 3DDIA 1JLGA 1Q7LB 5GAEP 3KKFA 3CJTA 4UASA 4I2QA 2J9DA 4KX5A 4DSJA 1HQEA 5E33A 1OXJA 3BF1A 4E7HA 1NI3A 5K9FA 4H4OB 4FO0A 3FBFA 3ITHA 3TA0A 8ICRA 1N36J 4OZLA 3LTOA 1QLNA 4EZ6A 1N5YB 1RT7A 4K4GA 2DHGA 5HOOA 5HP4A 2ZTDA 3NF7A 3R5AA 3EDRB 3HX0A 3ID8A 3SPZA 4ED2A 5IWAK 2JEGA 2M2BA 3MCSA 4YQWA 1BI4A 4PH5A 1Z4UA 1E6YB 1ZS6A 4JI6J 1WAJA 4HHJA 1UZHA 3OLBA 1SV4A 4Q0BB 1DZ5A 4YB5A 3PMLA 2LKYA 3OBWA 2CJBA 4C8NA 3ZTRA 2HKEA 5LMNK 3PSPA 4DWIA 2GEMA 2VWKA 1HBOB 2Z30B 5J1NA 3JTOA 4IRCA 2GIFA 3OL9A 2ZBCA 3T1HF 1QE1B 4IC9A 1G6BA 4PXCA 2QB0A 3AXMA 3C21A 1ZH5A 3SZ2A 2WTFA 2SXLA 3ENOA 4I6WA 2CQDA 2DKZA 2L9DA 2QLWA 3O4NA 3LM9A 1FRKA 3KZXA 4V19X 2BACA 1ZETA 1YZ7A 5C5JA 3I5CA 2GO7A 2QX0A 4ZVOB 4NRTA 4LRCA 4ECTA 5D0EA 2G06A 1VK0A 1FXXA 5KFZA 5JICA 3MM6A 4WKRA 4C3LA 3PSIA 2LQ9A 3BH6B 3CSKA 3HVRA 4DTXA 4XH4A 1Q4RA 1RKJA 2LYBA 3A5MC 1WLJA 3JSRA 4HT7A 1RAGB 2B9EA 4C3KA 4B8CA 4UBCA 2ZH5A 1QUPA 4BDZA 2LCWA 1WSEA 3IMXA 4US9A 1S6PB 4AQYF 3I96A 5CHCB 4LF7K 1YAGA 1NCLA 1YIJS 3WXMB 2AJ1A 2MQNA 5F8JA 5DDQC 2F1JA 1H74A 2QWPA 1SC6A 4FLZA 2WMMA 2X51A 4CHPA 3BR9A 3M7DA 4A8QA 1AW0A 3D6HB 2E1MC 1UTAA 1CXUA 1BU6O 3JS6A 4NA2A 3AOCA 1RWOB 2QL7B 4BRKA 3CMAN 5LMUJ 9ICXA 1HD0A 3VQBA 3TA2A 3TKAA 4DX5A 4M2YA 3NGDA 2B56A 3DXKB 3JTNA 3WK9A 1ZQLA 1IKWB 4CK3A 4YN4A 3RRHA 3QEPA 1U2RA 1HBMA 3RBZA 1PUZA 3P4IA 4ZHRB 3D2QA 4NLOA 4B1VA 4FS1A 2CGJA 1FKPA 2O6KA 1X7VA 4I2IA 3RJEA 2WB1F 3ADAC 1RAJA 5M1QA 4H0OA 2PE8A 3CCES 2HZVA 4DPTA 4JI3K 1SWWA 1ZQSA 3OYDA 3CQXA 2NXJA 3MMJA 3ZT0A 2N7CA 4X64K 2M7SA 4UZBA 2JL9A 1F9EB 3OYAA 1BA0A 5KFTA 1T3OA 2XHWA 1B0XA 3SBTA 3OY9A 5DRKA 4GMJB 4DR1K 2VODA 4FBTA 4M04A 5IFMA 3M8PA 2WF9A 2MLXA 2QWQA 4GKJK 3Q8LA 3G6EN 1T6CA 4OLPA 3O5BA 1FJGJ 1RBLA 2OPPB 1LWFB 4QZFA 3GIIA 3NFAA 5GAEU 3SENA 3GR0A 2RNEA 5A8WB 2KVIA 4PWUA 4FM0A 2ZH2A 3V5RA 5SWMA 2YX1A 3U9ZA 1NK9A 3JTPA 4IWVA 3VHQA 3TAMA 4J9QA 4MFCA 1S99A 3KJQB 4ZTJA 3FFIB 5AJ3F 4ED0A 3NGSA 2VBXA 4Y2KA 2EQYA 1PYOB 1TKTA 3G71N 3NCQA 1K0TA 3IG1B 2DO4A 4XPCA 3AVLA 3C6UA 3NVMA 2BXJA 2O67A 1IKXA 2H54B 4GFJA 3RU0A 1VSKA 5DG7A 1Z1BA 5I42A 2AWZA 4O5CA 5KTQA 3CJ0A 2QARB 3IO1A 4CJQA 3OW2R 2KD1A 4DTPA 4JEPA 2HRYA 4G9BA 3CCTA 1LXJA 4ZTFA 4JI7J 1TFRA 4DV1F 2G0IA 2ZIUA 1KFTA 4KAIA 1UOCA 4RUBA 5ALEA 3KFUF 4OFZA 3TUIC 4JI4J 5I9EB 3HXMA 2E5JA 3M30A 1GLEG 3KUGA 2NNWA 3AGRA 1SKRA 3HOTA 2VZ9A 1V97A 3C16A 5IM0A 2MJUA 3EPIA 1Q0NA 4DHYA 4ZJQA 2JZ5A 2CPJA 3OTEA 1RG6A 2XHCA 5HVHA 4C4TA 3RSEB 1TFWA 1KWMA 2EZYA 5ETOA 3CIPA 4PG4A 5FPEA 3W61A 3EKUA 4ED3A 1JN3A 4NYNA 1KQFB 4ILLA 4JV0A 4LMZA 1WNSA 3PKMA 4F02A 1Q1KA 3TO8A 5FRNA 3DLEB 1S8OA 4HVJA 2OP5A 2HS3A 2CPEA 2AGOA 4CLWA 5T7BA 1OH6A 5KT7A 5AK3A 2B9XA 2J9DE 5D0HA 4WCEL 5EN1A 3A5NC 2K4PA 4I6YA 3BKTA 2EFGA 4Z4FA 2LA4A 3UDEA 1T02A 1CZ9A 8ICTA 4WFYA 4Y2IA 3V9ZA 2IOHA 2A3JA 4NI2A 2AYMA 1X60A 4FLYA 2EZXA 1N32J 2AP1A 1QQ6A 3NRZA 4BX9C 4OYXA 4CHOA 1K8KB 4H5WA 3L4BC 2NRWA 2KG5A 1ASUA 1BQNA 3AVJA 2BGGA 1XMOK 3L09A 4DV5F 4KY3A 4QWCA 2UXBF 9ICEA 4HR2A 2VGMA 2DCUB 3BR8A 4MKAA 9ICSA 5C2FA 4B1XB 1V85A 4DOBA 4K4ZA 1C0UB 4FPBA 4TY8B 2GVDA 4A8KA 4KHYA 4X65F 2B7CB 1FW6A 3RWUA 2R8HA 4FBUA 3VQ5A 2YX8A 2KT2A 4FJMA 2LQBA 4LSNA 1T3VA 4CZIA 4F2RA 3SQ0A 3CD0A 2XMAA 4B3MF 1OKJA 2I1RA 1VJQA 3N79A 3UXOA 5HMWA 4RNNA 3L2UA 2HQ3A 2DVIA 5BR9A 1PBAA 1VRTA 3ICXA 3I55N 1EX8A 1S1UB 4NV0A 3OR2B 4ZLLA 3PEHA 4DV0F 2P6TA 3KJFB 3NS5A 2BDPA 2ZZMA 2YNHB 1JL1A 4DL5A 3T1HK 3VCDA 4LF9K 3EVMA 1ZAWA 4A8MP 2QFIA 2E2QA 5K14A 2P9CA 4E19A 3D1QA 3D6FB 2IJRA 1BLUA 1SUQB 3MCAB 1F2HA 1X5SA 4ETZA 2JMGA 4K8RA 3FGUA 4FLXA 1MMLA 4IDKA 4CI0B 2Z57B 2ASPA 2DWQA 1W26A 2FHMA 3A2FA 1T95A 3MOZA 4RW9B 1T7PA 2WUSA 1RWUA 1U8SA 3PIPQ 5DB6A 3PRBA 3HOSA 4ZVRB 2LDYA 1JJ2R 3R1XA 4GV6A 5JVGL 1X5TA 5KT5A 4L8RB 4PY5A 3ETMA 1T03A 3J8AA 2I5HA 2B4JA 3O6WA 1CXQA 2XZTB 3M32A 3SQ4A 2VPYB 7ICHA 4KHMA 3OTOJ 5BRDA 1VQ9N 1Z2ZA 3VQ8A 3LGHA 3PR4A 3VGTA 1RWMB 3ZETB 2HMIB 3CQYA 1FFGB 4URSA 3QFWA 2FDRA 2DH8A 1BPBA 3E01A 1SIJA 3OVSA 4NXMJ 2HVDA 3OYLA 4K4UA 3EYZA 2NUBA 3BYRA 2P9EA 4DMZA 4NLUA 2I6XA 4P7VA 2O8FA 1X9MA 2BUNA 4CHYA 1S1XA 2JH1A 3ZCMA 1FDNA 9ICPA 3NMAA 2JR5A 5KGWA 1KVCA 4X4TA 2Y9TA 1EKRA 1SVDA 4KMOB 2EPIA 4DU7A 3S3MA 5ETKA 3ILIA 2RAQA 5AM4A 4W98A 7AT1B 1KFDA 4DCJB 7ICSA 5IQ6A 2KYZA 3MR2A 5CZXA 2QA1A 2NRHA 3H46O 2JH7A 3VA3A 5AXLA 2E5LF 4HAIA 4EHUA 3GWCA 4RBUA 1V6HA 4DV2F 2YKNB 3D3CJ 4WK1A 3M2UB 1RTIA 4F3OA 3IM9A 2F7TA 3P45B 4TUPA 4KLQA 4QJVA 3RR8A 2ZE2A 4WU2A 2H3EB 4W4MA 1MQ2A 3VGVA 4LRFA 3KNGA 3AB2B 4ZVFA 8ICCA 2YQ3A 2GUPA 1WCLA 2BYCA 2QYCA 4ZLNA 1RAOA 2F4VF 4CZFA 3TUJC 3GZFA 3Q8KA 4DU3A 1OY8A 4K2JA 1SS6A 3DU5A 1WOQA 3NEKA 4ED6A 2BCSA 4FYYB 3FCVA 1AZSA 4AHVA 4ZS6A 4R5PA 2W2NP 3DGPA 3V7LA 3HSZA 3OL8A 1G1XA 1VQKN 1VSLA 3CJKA 1SGGA 4YOYA 3DXMB 3DLKA 4JI3J 3VETA 5DQHA 5KG5A 2ZWOA 4X64J 5CYJA 2JV3A 1ZBFA 3SMSA 3D0IE 4Y2UA 3DLGB 4I2PA 1N5QA 4OL8A 1X9XA 4DR1J 4A8OA 4IH6A 3RBXA 5AJ3K 1ZZFA 1PBUA 2O01C 2CKWA 1YJ7A 4OZNA 1MU2B 3MX2A 4BDPA 2UXCF 2K1RB 5M2PA 3UVJA 4OPJA 4LUBA 3FE1A 2EHGA 2P9KB 1KQSR 1UQVA 4HH1A 3OPXA 3VTIA 3KZBA 2HQFA 3OYIA 4YDUC 3HHDA 1N5SA 5K8PA 3K5MA 3CCLS 5HROA 2QM1A 2FLNA 1QVFM 1SJQA 1IG9A 3TAPA 5AKIA 3SD7A 1XQIA 3VGKA 4FWMA 4KTZA 1U2VB 4MDBA 5LJVA 5CR4A 2KT5A 1EP4B 1BDGA 1LFPA 2IOFK 3HWTA 2VG6A 2ZUAA 2HNDB 3A8YA 1WYGA 2CJYB 4DSEA 2OZMA 1CPZA 1ZQPA 3GFZA 3VWSA 2WVBA 4CGFA 4NLCA 1ILYA 2W7PA 4KTQA 5CABA 2G1HA 1DY3A 4B9QA 3KDNA 4K0KF 2BMBA 1S4FA 3WU2U 5AKYA 5ALXA 3B6OA 2CQ2A 4CJVA 2HHSA 2QRRA 2XZWA 2VKZG 3BPSP 1X1PA 2YX4A 3AVGA 5GTIU 2C3PA 1DARA 2XQCA 4V19J 2VA2A 5D3GA 4JI1K 2N82B 3SI6A 1TUYA 3AQFA 3Q8UA 1R0BG 5CH7B 1IJFB 1NUEA 3ZD9A 1DURA 2ZOGA 3AHPA 3QIDA 2O5DA 2FF6A 1IV8A 3LA0A 4OHZA 1U9LA 1VQYA 5DLGA 1K1QA 3D7EO 4C0ZA 3WX8A 3U3GA 5F8MA 4H0PA 1F9FA 1HKBA 8ICPA 1RADB 3M2RA 4IO1A 4F04B 4DQ8A 2A19A 2UUBF 3F5EA 1E4FT 1IN0A 3NAIA 5HSPA 4F5QA 1HR0K 3K57A 1FRJA 2PSZA 3KLFA 5CA7A 3JXUA 1E6VB 4F5OA 3MXIA 2LPEA 1YG0A 3EMTA 3AUOA 3J7YI 4CO2A 2WB1C 1Q5YA 3QU4A 3I9V9 4OZ1A 4Y2TA 4K4YA 1BPEA 2GIRA 4C98A 1RJJA 2B4UA 4NMXA 4RNMA 4I2EA 4DX6A 1BHLA 9RUBA 1WWHA 4YD1A 3C7NA 4PEOA 2HOQA 5HQMA 4DV5K 2UXBK 1NHUA 3M2VB 2ZVIA 1QQ5A 3MF5A 2V2ZA 3AA4A 1GO3F 4DR6F 1H0HB 5AQXA 4CBUA 4I2DA 5CD4A 1VSFA 2NXCA 1BNOA 8ICMA 2Q97A 4Y1CA 4X65K 2E4LA 3QT8A 2DXEA 4V19S 4F7VA 3IV6A 3Q23A 5ALZA 4FM1A 3W9JA 1N5TA 3EVWA 3VGMA 1XMOJ 4Y2SA 3UFCX 5J2JA 1B43A 3C23A 4FYVB 3J81O 4CE6A 2C3MA 4B3MK 1VS3A 3JPPA 2ZH8A 2PYLA 1BO5O 2OSQA 5J2NA 3PLAA 3MEKA 3IBFB 3T79A 3AAQA 4BRQA 2DNOA 2CXYA 4FWOA 4RBTA 2Y0SC 1PK3A 2F9DA 3CCSS 5AQLA 4DV0K 4FWRA 4ED4A 1H73A 2IM3A 3AMZA 3P31A 2MHNA 3CMEN 3C95A 3M6VA 4HL9A 3RB3A 1RT6A 4U7UK 3D9BA 2HBJA 2YNFA 2EFPA 3H1VX 4LRDA 4IUFA 4PPXA 3HD2A 3PW2A 5IIJA 2JOQA 1QSSA 2W2QP 5M2RA 2LFVA 1ZRMA 4HT5A 4GVLA 2UVUA 4NYPA 1N0VC 4JI0F 3A0IX 2KN7A 1U04A 4F0KA 2KB2A 2CPXA 1XMQJ 1Q9XA 4CJ3A 2XI2A 1ICEB 4LF9J 5KPTA 1N34F 2GHVC 2GMLA 4ZJOA 3D0HE 3I82A 1NKCA 5KFOA 3HSGA 2OUGA 1Z26A 3DOMB 5TKYA 1RDAA 3FYHA 4NA3A 2QEXS 4DL6A 2AJQA 1U2CA 3R5CA 4MIAA 2GGPA 2JXJA 4H4KA 3NLCA 1V3ZA 2BQRA 1HNZF 2HQDA 1RCXB 1HWKA 4R79A 2YH1A 2CWKA 2XI3A 3GYXB 3KLHA 4DJBA 4DPOA 2RT3A 5CZVA 3TAQA 4J9UE 4NL9A 3ZSOA 2MQOA 1F3FA 2BCQA 2C2OB 4ILJA 5IT0A 1RUSA 3GQCA 2DNYA 2HNYB 5F3TA 4XAKA 2VA8A 3K5LA 4LF4K 4Y2PA 4GRSA 2A40A 1OSDA 5KFBA 4JI2J 1GLAG 1FKAF 4H4MB 5ALVA 2WFBA 2HB5A 3MUMP 4P4OA 2VJ4A 4OX8A 1L7PA 4A48A 4AF1A 2QC3A 3NGIA 5C42B 3K8VA 1UP1A 1NM1A 1SXEA 3QO9B 1BQMA 2HQIA 4RTFD 1XI1A 4OZJA 4NCBA 2H5JB 4DV7K 3PO4A 5J8YC 4DL7A 4QIWD 5HL7Q 1NDCA 2JGAA 1FEZA 3C19A 1FDBA 3NGZA 4O44B 3V6HA 2P9SB 5AE1A 3N4QA 4CJUA 2E5LK 2HURA 1JLCA 3SUOA 2I9SA 4LF6F 2ZUGA 3C29A 4G6VB 4X66F 1T05B 4DV2K 3V7KA 3BB5A 2PKEA 2Q36A 3TWHA 2K8BB 5CQGA 1TMJA 5HVGA 3KJNB 2P5OA 5LJ5Y 2CQ1A 2W24A 2DPNA 1HBUB 2CPRA 4KQZA 3O9UA 1NGHA 5KQDA 1Z25A 2DKOB 4PG5A 4TNOA 2QZ8A 5E5NA 2YV0X 1NMEB 2KT3A 4CZKA 4A8SA 4E2FB 2ZIVA 4ZP7A 5TISU 3J81j 3CCVN 2F4VK 4RL1A 1SV5A 4USVA 2AKWB 2MSNA 1WN7A 4NLRA 3ISND 3HKZF 4R64A 5HRRA 2AQ4A 3M8ZA 2A1BA 1K9MT 3TACB 3C14A 3BDEA 5KPZA 4CJRA 3MGHA 5KFGA 1ZQQA 1KEJA 2IAJB 1U1LA 1TL5A 3KLIA 5B09A 2W1BA 4L3QA 3JPRA 4Y6IA 2M4MA 4A2BA 1U47A 2ASYA 4DQPA 2LXIA 2Z1IA 4DTMA 2HG4A 1YJWN 3EGWB 3SFUA 1S0OA 5ALTA 2LMIA 3FZMA 3O9TA 3R7NB 3AVNA 1W9HA 3DYAA 3D1HA 1JL2A 2IM0A 1RYUA 1P8ZA 3CDBA 2HK2A 2MUTA 1BQXA 4JNEA 3G4SN 2UXCK 2ISOA 1YJUA 1TKDA 2FGOA 3KYLA 4DDFA 4R8UA 1YJNS 5JU5A 1QDUB 1RK8A 2RJZA 5MAOA 3VQPA 1FWLA 4NCGB 5GADP 2OEKA 1RAEB 3C8YA 1RDWX 2Q2RA 2JZBB 1ZQOA 3CHWA 2RU9A 2W03A 1Q8IA 1YHQN 3QFHA 3E51A 4EWTA 3K9KA 3PM9A 1NH8A 3D2NA 2RRNA 4ID8A 4ATNA 1ZA1B 1N61A 4KLTA 3ALYA 1WOPA 3GONA 3QEIA 1JLFB 4K0KK 3IM8A 1VQON 3L3UA 2F8LA 3BS5B 4AHSA 3UKUB 1KQGB 3LP2B 1NGGA 3NRBA 2GVZB 2Q0ZX 4WFAQ 2KE7A 1XNRK 1RWPB 3GJRB 4IQVA 3P4UB 1N88A 2WF7A 3ONQA 3WKAA 3OFEA 3M6XA 3IMQJ 4F4YA 3UE2A 1BGXT 1NJIT 4ZIWA 4RW6A 1WHVA 3CCQS 3GCXP 5BN8A 1KVIA 2E5SA 2VL1A 3O5TB 4Z37A 2QO3A 1XSLA 4Y2RA 2E1YA 1TK5A 2DD8S 4BROA 4RKUC 4M3XA 2MSTA 3ZZPA 4KHNA 4JI1J 3CDWA 4BR4A 2NRZA 4QZEA 1U48A 4DR4F 2A6AA 2QA4N 2FI1A 2NXEA 3TEGA 3QRPA 2HFZA 4U67Q 1JALA 4N8NA 2LHTA 5D4LA 2DGOA 5BJRA 2DRAA 2OELA 2R3VA 2YTUA 2V4JB 3NF9A 1WEYA 2Z56B 5AE3A 2CPHA 5HBMB 3BZCA 4F4KA 3T1AA 4JKDA 1X0PA 4G65A 1G99A 2OPQA 5KFEA 3N9UC 3CC7S 2DHSA 4TYAA 1HR0J 1ASWA 3IS9B 4JK1A 2DR9A 4R25A 3P6YC 5J2PA 5M1KA 2Y9UA 1X5PA 1Z00A 5FLXO 1H2TZ 3OTDA 2YJFA 1WSRA 1SC3B 3RR7A 4CO1A 4DR6K 4ZVEA 1FESA 3PX6A 1UW4A 2V5HG 3FAHA 1N63A 1NLVA 1WC0A 9ICTA 1VRQC 3JAMU 4P0PB 2DGTA 5IV4A 2DHAA 1FNMA 3AJDA 4KV8A 4EK2A 4KKOA 5H9FK 4DV5J 4OJRA 4KLOA 4FWKA 1S5LU 4DG1B 1WD6A 2IBOA 4N7TA 1J2VA 4OJPA 4BC5A 2AYEA 3QEVA 5K8OA 4RU2A 1DTQB 2MKKA 4N5SA 4I2FA 2YHBA 3CCWA 3RW6A 1M5PC 5LM7E 3NNHA 1V3RA 4ECXA 3ENHA 4JBCA 3TFRA 5KFNA 2KSOB 1ZXIA 2HHXA 3Q0AA 3ET6B 2GWSA 3CCMS 2EFVA 1QZ6A 3BSNA 3R27A 3C15B 1S7IA 1HKGA 4Z4CA 2CG8A 2A1SA 1LQ9A 3WEEA 1VJWA 1VMBA 4ZLPA 3SMPA 4R0JA 2C2DA 2YWHA 3AD8C 4ZCLA 1YF5L 2WBNA 4QZBA 1FK9A 4JI0K 4YDDB 4M6WA 1UFWA 2AF6A 3POTA 2HFOA 4I68A 2KP7A 2OD6A 2DYAA 3LANA 5G4DA 3JQMA 1N34K 5AXMA 2E29A 2KH9A 2UUWA 3A8JA 2R2SA 4DSFA 5IINA 3LALA 4CT9A 3K0JA 1JMSA 4HKQA 3LUYA 4ECWA 1QHTA 4DV4J 2B9YA 5DDMA 3FEYB 2NRRA 4CEZA 2BBEA 4KPYA 2KFZA 2QT7A 3AT1B 2VPXB 3CT9A 2YTCA 5GADU 3RH4A 3NH1A 2QKQA 3S6JA 1F5CA 3CW2C 5A6PA 1JCEA 2JH3A 1Y9OA 4JKBA 4FCYA 3P3DA 2KDOA 1F9HA 9ICUA 3QNWB 1C6VA 3CCJS 2E2OA 1YTAA 2RHKA 2DBBA 2OHFA 3PRVA 2FPKA 4B1YB 4M47A 1VQ8S 6FDRA 3HDSA 5LJWA 4LF2A 4KN4A 2NV3A 3MGVA 3VVUA 3BREA 1W2IA 1VR6A 3PTWA 1WNEA 1RKIA 1NJIO 4XDCA 8ICSA 4DEZA 1SZPA 4X62F 2V8DA 4J9KA 2DGQA 4USJC 1JWWA 4LF4J 4GXJA 3AY0A 3M9MB 4O5FA 4IFVB 1IH7A 2KO1A 2F5GA 1VQ7S 1TUWA 3SCJE 2YX6A 2BCRA 1NHKL 4LF6K 3HCXA 2NZTA 1RWNB 5F8GA 1JLEA 4M5GA 4LZGA 1N56A 3NWGA 3R2DJ 4M3TA 1E6YA 1TL3B 4YFUA 5HVFA 4JP8A 4QJFB 3D4JA 3Q86A 1IBKJ 3K8WA 4DV7J 2YKMA 4KI4A 1CZAN 3LP1B 4M5JA 1JX4A 2ILZA 1GFWB 2ZBQA 5L1IA 3WNHA 2HHWA 3TOQA 3J80U 2ZJRQ 4DSKA 4M9LA 2E5LJ 4MMOA 3HX9A 1GH8A 2CQGA 1HWUA 3GB0A 3RW7A 2RD5C 2ZH4A 5C0YA 2KK0A 1KFSA 3NGYA 4H5TA 2KVQE 3W7BA 5J0QA 5EXWA 1HX1A 1NAQA 2Z0GA 1NMDA 1SKUB 4CM0A 3EJMA 1PK1B 1SQEA 2ZITA 2HIQA 2DHHA 4CVNE 4US8A 3DDKA 1ZOLA 3VF2A 3HSCA 3L6QA 4DR5K 3QXGA 1S0NA 4QS7A 1K8AT 2CDRB 2HVHA 1BWFO 3M9OB 2NO5A 4MYTA 5ALRA 3RMBA 1Y11A 5CYQB 4NLPA 3FZHA 3OYJA 1Q79A 3A3OB 1RAHB 3OHAA 3OYGA 1N33J 2ADCA 4YXMA 1ZBHA 3BYPA 1NGAA 3PIPL 1WC5A 8ATCB 5DGAA 2QLTA 3TADA 3G82B 3HHLC 1XHXA 1YVNA 4DTRA 3WT0A 4LFCF 3HKWA 4FOEA 4JWMA 1HNWF 4EEKA 3RTVA 2WK4A 5ALPA 3BN7A 4O8UA 2K4IA 3R8EA 3PJXA 3OW2M 1W2BR 1TQLA 1NM2A 4CZHA 5HRNA 3DOLA 2EH9A 2MEWA 4OV1A 2KKZA 3LYSA 4P10A 3OSNA 4IOCQ 3R9LA 2R7RA 3C94A 4HUFA 2X3DA 1X9SA 1REVA 1RDDA 3GPAA 2BVZA 2Z1GA 3JPOA 8ICWA 1RISA 2ZC4A 3QEBZ 3WKCA 7ICUA 2HFUA 3UDLA 1NDKA 5D15A 3Q2SC 5E79U 2YI1A 1B0TA 2HVEA 3WX4A 3TSUA 3VQAA 2LQJA 2XLKA 2A2DA 4TKTA 4CEBA 1M5VC 3ILJA 1UWBB 3PFOA 2OM6A 1ZD3A 2HFSA 2HZAA 2BX6A 1VDVA 2P35A 5GAGI 1XNRJ 1GK8A 1YRXA 7ICFA 1F60B 1VQNN 2V9WA 1WTFA 4DR4K 3D2EA 5GINA 1UJ5A 4KLJA 3U6FA 2GQCA 5KFQA 3V6DA 2M0GB 3D54A 4CQ1A 3JB9k 4WQ4C 3MEDA 4WFXA 2C3UA 2IMOA 1I94F 4ES3A 3NL0A 5CYMB 2D7SA 5GMDA 4ZVQB 2Y9HA 4O4GB 2EKNA 4KR0B 1ZQEA 4DL2A 2VYPA 2A0FB 2B8PA 4JI5F 3PKYA 1Z4OA 3QLHA 1Z2LA 3CMAS 1QZ5A 3J81Y 4KB7A 4CJPA 1CS4B 1VIOA 1WG1A 4OKEA 1HNXF 1C4AA 2CIMA 2DJWA 3ILLA 3NGRA 4FWPA 2DY1A 4P52A 5D4BA 3JQKA 4FZZA 5AQVA 3SYZA 2R7XA 5T7LB 1RGIA 5HP1A 3CJ5A 1GLFO 4RU9A 4E3SA 1FWPA 2YNGA 3IG1A 3EN9A 3J7AN 3VC8A 1MC8A 3O8WA 4U96A 4KLGA 5HHHA 1W7WA 2ITGA 2FVSA 3O9SA 3SCXA 1TK8A 1SJRA 4CWBA 1NB7A 2CQ3A 4DR6J 2ZTEA 3ETLA 3T5JA 1HD1A 4B1ZA 5DM7Q 4IRKA 4USHA 3QUQA 3C1YA 2YMMA 2F8KA 1FX2A 2A10A 1S76D 5EHHA 1RYRA 1QH9A 2OJ3A 2WCXA 2UUAF 2V4QA 4YR2A 2WC9A 2LDIA 3CG7A 2G8HA 5DDYA 1MROB 4UW9A 3NP5A 3G6ES 3AO2A 5B66U 2F9TA 2RRBA 1WSVA 9ICOA 1XNQJ 3EW9A 4AYBF 1WWUA 2ALZA 2XYPB 4XH5A 2E8AA 1U6FA 8ICLA 1VQPN 1RDRA 4ILRA 4OGCA 1W97L 2XRIA 3H5SA 3OUYB 4GW6A 4XEIA 4B3SJ 1X4CA 4E98A 1NPRA 3G71S 2KHDA 2GLEA 3HHEA 2DT9A 1H2UX 2HAFA 4F4AA 3SDEB 4W5OA 3ZTPA 3QGIA 2C3OA 3CO0P 4UB1A 2QA4G 3DLLQ 1KHWA 2UVVA 3O3LA 5KFYA 1CJVB 2ILYA 5KOWA 2BE9B 2HPUA 3DLEA 1JB0C 5F41A 1BNPA 1NNLA 3I4HX 2EANA 5KFWA 5KFHA 4CBXA 1JJ2M 3SAFA 5THWA 3KK3B 2Z2YB 1J5EF 1NPPA 4DF8A 4JHDB 4PZOA 4LQ3A 4DCHA 2RDIA 5KFVA 3K59A 1IO2A 5F0XA 5AQWA 4UAWA 3TAFA 1H7XA 2FC8A 3I32A 3JYTA 2QWNA 1FX4A 5DBCA 1K8KA 2Q1LA 3ZDAA 2JWKA 4NLQA 2NUHA 4P4PA 4KX3A 3FQLA 1QD1A 3DLJA 3BO4A 2PFPA 4CLYA 2M3DA 4I6MB 3A12A 2YMPA 5SUHA 4Z4GA 2D1KA 2IYGA 4DFDA 2OA8A 3KG4A 1RT5B 2IY5B 2EEYA 2E1EA 3A5LC 4RPYA 2KYXA 4I1TA 4FWNA 3IWLA 1M1KO 5LXRA 5AIAA 3FFKB 4A5AA 4LSLA 2NXNA 1FJEB 2KRBA 1ZQUA 3QIPB 3TPQA 2P5GA 3LW5C 3ZLJA 4F4ZA 3HP9A 1XHZA 2APOA 4O3QA 1VGYA 2AP6A 2W42A 4M3ZA 4HLBA 1Q82O 2FJAB 5KFJA 2BM1A 3GV8B 3DKDA 2BE7D 4LFBF 4PQUB 2KFYA 2ZWHA 1U1QA 1HKCA 4WF9Q 1T9VA 2VG7A 2YNHA 3TVKA 4OJ3A 1RFQA 4H0YB 1UVJA 7FDRA 3C2LA 5KG2A 2XNQA 4A59A 3SQGA 3WQPA 4C8LA 2M5YA 3LAMA 2E5GA 4Y2QA 2V7ZA 1B3TA 4FVMA 2ZZNA 4L74A 4CDIA 3MR7A 1ZQFA 2ASMA 3MN5A 2MHEA 2BJ3A 2FYXA 5EX5A 2IYIA 1BPDA 4PZNA 3B0YA 3RB6A 3GFKB 1HJRA 1RGVA 3HYFA 1DOQA 1PZNA 2RIJA 5F8IA 4I56A 4NOHA 3G6YA 1GLLO 1C1BB 5F1XA 2MQLA 4EFHA 3RJJA 2GW8A 3DRYA 4PGYA 2FHJD 4DUZK 2AQ0A 2HHHK 5J2QB 2ZG6A 4DR2F 2RQ5A 2CADA 3PV8A 1CJTA 1H2VZ 3UNYA 4E89A 1JKHA 3TJ9A 1L8OA 2H9ZA 3GOIA 3QICA 3KZIU 4GV9A 2CQPA 2VF3A 4BHQA 2W2PP 4DR5J 5G5GA 2LEBA 2D9OA 2O1PA 3R6MA 1A9NB 4LFCK 4I64A 2J6UA 2HMIA 1KC8O 1S0MA 3K1ZA 4J5OA 4FF4A 1R3NA 3OT9A 3DDHA 1ZOTA 4DU8A 4GKKF 4YDUA 4USTA 2MLZA 5CCMA 2PBDA 2IIHA 2CPDA 2DK2A 4TY9A 4CFDA 4NLZA 5IIKA 1TVRB 5L8RC 4RNFA 2KM8C 3D0PA 2FSNA 3N4PA 5IT9O 1B22A 4X4NA 2EI5A 1EARA 3NY0A 4CH1A 3MCPA 3UB5A 1OYEA 4RW4B 2HHQA 4JYAF 8ICXA 2YHXA 4P75A 1HLWA 1Y97A 4B3TF 4HACB 4KLMA 1ELOA 3IR6B 3WHIA 4KC5A 3EGNA 1K0VA 4B9SA 4LREA 1OY9A 2JRSA 1NGIA 5J2AA 3DMJA 3HKZD 4LJXA 3OSPA 1N4LA 2ZUDA 4FVUA 3QT6A 1FKOB 5DDRC 2YKNA 1S1WA 4FYXB 5HMYA 2V8HA 5HL7L 5KL8B 1R89A 4WJ3B 1DRZA 4P9SA 2CQHA 1JCGA 3AEVA 3OXFA 1IXRA 4BWJA 4GXKA 5FLXY 4WFBQ 2G8FA 4ED8A 2Q31A 4YOTA 3OL7A 1I94K 4RQNA 4CDGA 4DXLA 2DBYA 1XMBA 1YT3A 1HNIB 4PXBA 3H59A 3WIUA 2JFDA 4Q8EA 2JDJA 1N36F 4JAXA 3D28A 1ATSA 1MMNA 3HVTB 1FRHA 2ZD1A 1U09A 2VQEJ 3GJSB 2YCHA 1ED1A 3TA1A 3TZYA 3RMDA 1M90O 1Q8LA 2KL8A 3V2UC 4CEFA 2P9PA 4HHHA 3R9PA 2RP5A 2D3DA 2ZIWA 4ZP6A 4X4VA 4E8UA 5DBAA 1UPHA 3MUTP 1HNXK 2IFXA 5J2GA 4KHWA 4JI6F 1U24A 4C8YA 2OPRB 4EIAA 5IQQA 4KLUA 4XDDA 2GQ2A 4OJHA 3GIKA 2KXHA 1DQ8A 1TK0A 3OYKA 1BPZA 1S7HA 4K8XA 3VQ7A 1JQGA 3N28A 2OGUA 2P9KA 2OSRA 2NZ4A 5KPRA 5KL1B 1SH0A 1FDDA 2PA8D 2XMVA 2O8EA 2KKHA 2NRTA 2VFVA 1HEKA 3W5XA 4G9ZA 3GV5B 2QL5B 4IXCA 2RF2B 3CCLN 3LAKA 3A8KA 2UUAK 2F4FA 2J0SD 3SJJA 4XPEA 2J6SA 3VEOA 1LW0B 2M88A 3MK6A 3R1LA 1X6JA 1R6VA 2RB7A 3CJ4A 3BKUA 3K2YA 4RW8A 1SPBP 3VEZA 3ENWA 4UAUA 1GOAA 1RILA 3BSCA 3BQTA 1VQ5N 2PFDA 3J7Z5 1HL6A 2ZWPA 3QFPA 1T9YA 1ASVA 5IOLA 4TXSA 1A5VA 3MCMA 1TU0B 2KJ9A 3T7ZA 3PW0A 4PYAA 1L3SA 1RXOB 2RMLA 2VKRA 1RM6C 3NWRA 4IBNA 2HVIA 4YEAA 2XMMA 3N5BA 1RAIB 4CO0A 2YPZA 1JI7A 2H5EA 4PUOB 3RVCA 1T9XA 3J7YP 4WFAL 2AMCB 1VC0A 2DY4A 1Z3EB 4MKVA 3C2KA 1A0OB 2M9KA 1YRUA 3ISZA 1QQMA 4YOWA 4OHYA 4IFYB 4PWDA 3JSYA 2QMWA 3M7VA 1S9EB 4Y00A 1SV0C 1J5EK 1QY7A 3PACA 3L7PA 4E1MA 2P9NB 2B6AB 1FEEA 4E0DA 2UUTA 2MQMA 3BEXA 4OPHA 8ICYA 3G8TA 2O8BB 2XY5A 5LMUF 1XO1A 1S10A 4OJGA 1DK2A 4ED7A 2D0CA 4U67L 2CZVC 3IBWA 2QE5A 1D4XA 3QEXA 4MK8A 1V38A 3SMVA 1YJ9N 2YQEA 5I3UB 1TZ0A 2LLZA 1KLMB 4L72B 4P0QA 2BRKA 4KI6A 4UUXA 3RJKA 4ZPCA 1HHSA 5L39A 4J9OA 5A8KB 1BMQB 3HPOA 4MEXA 2DKXA 3B6PA 3N7PD 1WTBA 1LWCA 2W3SA 2YY3A 4EHTA 4BVOA 2VWJA 5FROA 1HIWA 1VAZA 2IGIA 2ES6A 4C8MA 2GX9A 3GZ7A 4HHUA 1EKEA 1S4EA 5M1OA 2J8SA 4QR0A 1RTDB 3SV3A 1KOHA 9ATCB 4NASA 2F63A 1X0FA 1OPIA 4FZVA 5J8YA 4YXJA 2OKQA 1BIUA 3D45A 1RLDA 4BR7A 3CIZA 4LFBK 3PW4A 4HTLA 1HYSB 3W2VA 1FJGF 1LWXA 3WUHA 3U1NA 4CO5A 4I9LA 1YLXA 3CCSN 2MZRA 7ICPA 2QTWA 3BUZB 2OD4A 3G8QA 4CP5A 4O3MA 1C0TB 3IG5A 2AEFA 4XA5A 2ZGYA 1KKXA 1QHAA 2HF3A 1AT1B 3M6UA 4QQBA 1E4GT 2IHNA 1DXSA 1SL0A 1UEVA 4LFAJ 3E8OA 3ZEUA 2IVPA 3OXGA 4O3OA 3ZDDA 4AYBC 4ECUA 4KRWA 2QV6A 3ZSVA 4CLZA 4KO0A 1L8LA 1JLBA 4HI1A 2HRUA 4K4WA 2F9JA 3MAAB 4USKA 3G6XA 2P8IA 4JI7F 2RS8A 3MM7A 1TKXB 5KRTA 3NRWA 5BXIA 4BE1A 2W4CA 5C24B 4ZOSA 3CC4S 3NNAA 1QVFR 1CULB 1R27B 1XR6A 4JI4F 1RDUA 4DPYA 3LDLA 1GOCA 5CE3A 3RAMA 4JV5K 1VI7A 3KUEA 2QEXN 2R2TA 2VOOA 3QU5A 2FVPA 2EC0A 3CNQP 4QU6A 4Q5VA 3L8BA 1ZQMA 2OEMA 5LL6Z 3J7ZT 1SZHA 3W65A 1Y5IB 3BS7A 4IEEA 4CYUB 4DUZJ 4QYRA 3E1YA 9ICJA 2HHHJ 1IM6A 5JUMA 1EJ7L 3GV7B 2CH6A 1F0XA 3BBBA 4HTJA 3NBPB 2XB2D 2MZJA 3W62A 2P9LA 2BCVA 1C1CB 2FJXA 4M3YA 3L4PA 4JK9A 5LY3A 1YJVA 1YQHA 4MLEA 3MOJB 4PHPA 5L9XA