1N5WA

Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 48
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n5wA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n5wA01
5EE9A 1RM6C 1VLBA 3AE4B 2AX5A 1NEKB 2OHFA 3SFDB 4HRSA 1V97A 4YT0B 2CU3A 1PFDA 3RPFC 3DWGC 1FIQA 1FXAA 1SIJA 2E3TA 2M19A 1CJEA 3B2FA 5EE3A 1N5WA 3AE2B 1ZXIA 3AV8A 1QLBB 3AB5A 1NI3A 3P4QB 5EE0A 1JWBD 2QIEB 2WDVB 4US9A 1OFFA 2MJDA 1DOYA 1V8CA 3AH7A 1WRIA 2Q5WD 3SFEB 1FFVA 4YSYB 3AE1B 2K9XA 2JX5A 1RYJA 1FO4A 3B9JA 1TKEA 1XLOA 1JROA 4N59A 1GAQB 1QOBA 3AEEB 1E10A 2BT6A 1A70A 1N5XA 2QJLA 1AYFA 3KWLA 3P4RB 1PUTA 2ACZB 3AEAB 1JQ4A 2BS4B 2W3SA 3PO0A 3W5VB 1NENB 2H89B 1QOAA 3AM9A 2L52A 3LB8C 4JWSC 5H8YE 2WLBA 3AEDB 1TKGA 2EKIA 3NVVA 1WXQA 3AECB 3P1MA 2DBYA 2WDRB 4YTPB 1QOFA 1N62A 4N6EB 5AUIA 3VRAB 4US8A 1FMAD 3VR9B 4C7YA 1F0ZA 1DOXA 1XLPA 1JRPA 1QF6A 1EWYC 1OQRA 3FAHA 2WQYB 3WCQA 3ZYYX 5MPOA 1RWSA 3EUB2 2B76B 1N60A 1E0ZA 1YQ4B 2L83A 2MJ3A 4YSXB 1TKYA 1E6EB 2MJEA 2CJOA 1XO3A 1ROEA 2JQRB 5G5GA 1WWTA 3CIRB 3VR8B 1J7CA 5AUKA 3AE9B 4ZHOA 1DGJA 3NS1A 3ABVB 3VRBB 4C7ZA 2KAJA 3AN1A 1JW9D 5H92C 2HTME 1NYRA 3AE3B 5G5HA 1ZUD2 3HVZA 1FRDA 2BS2B 1WGKA 3AEFB 1SB3C 4N58A 2WP9B 4USAA 3LXFA 1GPXA 1FFUA 1N61A 3AE6B 2W54A 2K5PA 3NRZA 5EE1A 1L5PA 4YSZB 4YTMB 3NVZA 1NVID 1R7SA 2DWQA 4JX1C 4YXDB 3AMZA 1I7HA 1CZPA 1YJIA 2Y5CA 1L6UA 1J7AA 2PVOD 3SR6A 1XLQA 1NYQA 1AWDA 2KMMA 1E9MA 2LEKA 2MH7A 2WS3B 3DWMA 2WU2B 4HROA 5C3JB 1XLNA 1FM0D 1L0VB 1J7BA 4P6VF 3CWIA 1KF6B 5GXGB 3AE8B 3AEBB 1PDXA 1T3QA 3B2GA 1YQ3B 2FBWB 1JALA 1FRRA 4ZOHC 1DOIA 1RFKA 4IDIA 1VJKA 3ETRA 4YTNB 3NVYA 4WWMA 2PKOA 1KFYB 2WU5B 2PVGC 2BS3B 1UWMA 2W3RA 1OQQA 3W9CB 4ZHPA 2PIAA 3AE5B 4JWUC 2H88B 2W55A 1IUEA 1FXIA 3BIID 3P4PB 4KX6B 3NVWA 2CJNA 2M56B 2WDQB 3HRDD 4WQMA 3W5UB 3FC4A 1TJEA 2G1EA 1QT9A 3P4SB 4ITKA 3HUIA 4FXCA 1YJJA 3P63A 1KRHA 1WYGA 1ZOYB 1L6VA 1N63A 1B9RA 2N0SB 4LTUA 1E7PB 1SF0A 3L4PA 2K22A 3AE7B 3AEGB 5C2TB 1TYGB 1ZP0B 4A9AA 1QOGA 4C80A 1VDVA 1JWAD
chains in the Genus database with same CATH superfamily
1T4GA 4RT2A 3PHWB 4C4TA 4Q8FA 1MA7A 3C29A 1SXDA 1YJ1A 3HX0A 1PFDA 2HVHA 2VRRB 3H7SA 2G9HD 1Z5SB 1LKYA 3IHPC 3ECIA 1ZXIA 2KMDA 2ZG6A 4UATA 2KNBA 3QIJA 2QIEB 1RAXA 3M62B 5AKHA 1OFFA 1TZ1A 3KUZA 4IC9A 1ZQGA 3FKYA 3Q8CA 3C1ZA 2KD1A 1FFVA 4KTQA 3QEBZ 3BZCA 3WAPA 3QU9A 5J0XA 2H3QA 5BOLA 4K4IA 5J2CA 2KHQA 2Q0ZX 4KLOA 2V1YA 3PSPA 2CN1A 2WGSA 4BKGA 2Y0SC 1C78A 2V4IB 1N5XA 1U4AA 3BZDB 2VIXA 3ZTDA 3APCA 2CHWA 2CXYA 2PFNA 3R2TA 3E2EA 2MU2A 2KEYA 2NRXA 1XSLA 2FJ6A 2ISPA 1HZ5A 1Q5WB 4M0AA 3ZRFA 3SDLC 2DBYA 1KFDA 5BMHA 2HW3A 4KZ0A 4WJQA 5AKKA 2K8BB 4OVZA 2KTQA 2WXQA 4RNNA 2NMQA 4KVGB 2DFLA 2KSOB 2KN4A 2KOBA 1ZRNA 1U4BA 3PPAA 8ICMA 2CHZA 2ZVOA 3QHTA 4EELA 5KL8B 1WWTA 2N9PC 2QC8A 2OJWA 3TQ1A 5J2JA 1H8CA 5J0UA 4I2JA 2I38A 2KDFB 2MP2B 1V1OA 3RRGA 3QQ8B 4YR3A 2LKYA 2BCVA 2GLEA 3M8RA 3PVXA 1TY2A 4LJOB 3U8ZA 1KEJA 3PY8A 1V5OA 4MEMA 3F5AA 4EEYA 1X9SA 4YMNA 9ICIA 4BWJA 4F50A 1IG6A 1UBQA 2AJQA 2X8XX 4BDPA 2D10A 2RPVA 3L08A 1WR6E 4XWTA 5AK5A 3GV7B 2W43A 5DBAA 3VUXA 2YB1A 3PR4A 3OLMD 1UF0A 1E8XA 2PI4A 4GDLB 4J9SA 4HROA 1CRXA 4KLEA 4C0ZA 4BX9C 2ASQA 3H4BA 2PXIA 4KLLA 4MF8A 4YR0A 7ICOA 4QZIA 4IDIA 4B9SA 4FBJB 2KFJA 1TV9A 1UBIA 2DKZA 5ALFA 3HWTA 4I29A 4IRKA 1BMLC 2M9NA 2JZ3B 4R64A 3PMNA 2MA9B 5DG8A 5IILA 2UVUA 4CYEA 1RRBA 4IRCA 1GC7A 1HE8A 5HP4A 4AYBC 1SBBB 2LXCA 2M4NA 3R7RA 2CJNA 3SD7A 4Q8EA 1QT9A 1EU3A 4P0PB 2IOFA 1JX4A 3Q8FA 4J9MA 1OQYA 1TYGB 4ECYA 3ZI4A 4HPLB 2W04A 4LZDA 3ZJTA 3M1YA 2RDGA 3UPQA 1V38A 5CJ7A 2OHFA 2HBLA 3C23A 4HRSA 3SFDB 4UBCA 2L1AA 5DKWA 3PHXB 5LXHA 1FXAA 3B2FA 2HOIA 2ZIWA 2G07A 4EYHB 1ZQJA 1PVQA 1OTRB 4RQ3A 4OVUA 1CMXB 3ISDA 4ACOA 4GLSC 3MC9A 2Q5WD 4GXKA 5DLFA 3OPXA 2BHNA 1L8LA 4C8KA 1XLOA 1D4BA 4Y2UA 5KG2A 2K60A 3K9OB 2D6FC 3BZKA 4MF2A 2HJ8A 1C20A 4XC2A 1NJZA 1Q8KA 1L7PA 4JGHB 4OJOA 2JU6X 3AEAB 3IBEA 5AM1A 3TI0A 1SL2A 4MH0E 5LLIA 5KFHA 4KIKA 5TZVA 1SIFA 2W11A 1NK6A 5DQGA 2XC9A 3RD2A 2JR5A 2V3SA 2GWSA 4AUQC 2ZIVB 1UA0A 2O6VB 4YR2A 5E6PA 2GH1A 1NZPA 5CR0A 3PRMB 3OJ4B 3FAHA 2WQYB 4GDKB 4JK1A 1BNOA 5D4BA 1E0ZA 3RR8A 1ZQTA 1Y88A 4FJVB 2KX3A 5KG4A 4BXOA 2CJOA 3Q8RB 5FR6A 3VR8B 1WGRA 2VA8A 3KKAC 4WJNA 4ANVA 3Q3MC 3B08A 5J0YA 3NS8A 3ZUNA 1STEA 9ICRA 3C21A 1WX7A 5KHQA 5H92C 5ALUA 4KDIC 3KHLA 4W9FA 3F2CA 4HAIA 3SU8X 1L4ZB 3C0RB 4PGQA 2K4IA 3VH4B 1QCKA 1EO6A 1GNUA 4NLNA 2N7EA 2KNJA 2M17A 4OO1J 2XK5A 4JLCA 4OZBA 4NY8A 5D94A 8ICLA 3GILA 2BVCA 2LUMA 4RGOS 5KFLA 5G2NA 4G9BA 2WU2B 2DHZA 4O3PA 3N7SC 4IM2A 1WGHA 3CWIA 5AM5A 1V6EA 1WMHA 1YX6B 3U30A 1RYRA 1T3QA 2XI9A 3TAQA 9ICPA 3N4MB 4ZOHC 3WK8A 2Z8LA 3ZKJC 4BKSA 4KX3A 1NJYA 1K53A 2W9BB 3UXPA 2BS3B 4EUTA 2B3AA 1DGSA 1RZTA 1WWVA 4DEZA 2C9WB 4UB6U 2JUOA 3QZ7A 2W55A 3BIID 3Q8BA 3H0RB 5ALEA 3HW8A 2R8GA 2Q4TA 1L0YB 1BNPA 2K6QA 5E6JA 2R8IA 2TSSA 4XRHA 4HVBA 2MUTB 3IAS1 4C80A 3KTQA 2NPTA 2GRIA 4PHDA 4HDOA 1ET6A 3H0MB 2KN7A 3HPOA 4CCHA 2PEAA 1PGBA 2BYEA 4IW0A 8ICWA 4I2IA 3DWGC 4IWPA 3W1SA 5EOZA 3Q8SB 2NVUI 4BBNC 4BWMA 1V86A 2XNAC 2EZZA 2MBHA 5AIBA 1ZQPA 2KDEB 2BKFA 1JMSA 4YSYB 5DQIA 4M9JA 3HIZA 3PW7A 2PLPA 2DAFA 3B9JA 4Z6DA 4GN1A 3PREA 4KN4A 4QZ9A 3KUDB 2DQNB 3ZQ4A 2KHVA 1YMHE 2HOQA 5EWEA 3V7KA 1PUTA 3NY5A 2BS4B 5K4LA 2D3AA 2FUHB 1ZPSA 4DFPA 1WSPA 2NTSA 4CO7A 3RT3B 3P1MA 2G4DB 4YL8A 4M47A 3VTUA 5KFFA 2MX2A 3PR5B 4MELA 2KTFA 1WM2A 5J0OA 5CA7A 4O3SA 1HTOA 5DPWA 2R2QA 3RFAA 3QX1A 2ZJAA 2HBKA 4OD0A 4QZ8A 3SV3A 4FO6A 1OEYJ 1UELA 2KC2A 1D3ZA 2LXAA 4HCPB 3UQAA 1TVAA 1WE6A 1KN5A 4NNJB 3VRBB 4YVZA 4AP4C 1LV5A 1VZ8A 2JPHA 4A55A 3JW0X 5J0WA 5ALQA 1ACCA 5HMLA 5G5HA 4M2YA 2WXFA 1SGGA 2DKXA 4ED1A 2N7DA 1FCLA 3ENEA 4F5OA 2QB1A 4TUQA 1JWMD 2CHXA 1NOMA 4RGMA 3K9PB 1MC8A 7ICFA 3B0YA 4YSZB 4C8MA 4K4GA 1F1HA 4QZGA 1YJIA 1UQVA 2F77X 1YN5A 3GIJA 5IO9A 3D2NA 2BPFA 1JCKB 9ICSA 2KLGA 4R8UA 3V6KA 1MVKA 4C00A 1KF6B 4YQWA 1WX8A 4P4OA 3U4EG 2BCRA 2KMCA 3QXGA 2D3BA 3BS5B 2FBWB 1KTKA 3I9V1 3AXCA 4OHJA 1TS2A 3T3FA 4DCCA 2K25A 3D2QA 3A1QA 2QARA 3AE5B 4UB3A 1NK0A 1C76A 3IG5A 2WXHA 3N1ZC 4JWUC 3ZXRA 2YLMA 1X9WA 4F1SA 1NZBA 2LD9A 4C4VB 5BMIA 4DBGA 4DFJA 2ZJDA 9ICCA 3TADA 4KX5A 3Q8MA 1X6IA 3PSFA 3L4PA 4B0MA 4BKSD 2RDJA 2W9AA 1OXJA 2FMQA 8ICTA 4PHEA 2EAPA 7ICUA 3ZRCA 1ISNA 2WXMA 3F2BA 2KD0A 2XY6A 3CRXA 1K51A 1SJED 1DOQA 4BGDA 4DSIA 4G0NB 8ICEA 2KYWA 4QAYA 2L5YA 2XGPA 4ED0A 8ICAA 1ZOLA 4KKJA 4LLGM 2KQ7A 2KICA 3R66C 4GXBA 1C3TA 1B43A 9ICQA 2KWCA 4J9RA 1WX9A 2YN4A 1NK7A 3E56A 4LNFA 2RLTA 3C8YA 2MBEA 3GDXA 3Q8PB 4Q44A 3RBDA 4E71A 4EOYA 2I2YA 1V9PA 3SEIA 5KNIA 2EAOA 4OJ5A 3QARA 4I6LB 2ACZB 2WAQF 5AKXA 2J6TA 2ZJ8A 3AM9A 2BCQA 4EZLA 1Z3EB 1SE4A 3LWMA 5C0YA 5IA7A 1ZD2P 5DLGA 1FMAD 4P7IA 3TL5A 1JRPA 2GLSA 3T8MA 4BZAA 2A19A 3KBBA 3T9LA 1WJ6A 2F1JA 3VCBA 1MJDA 4M01A 2KSOA 5HMMA 4YSXB 2W8LA 2DX5B 2UYZB 1WZ0A 5C1ZA 2ON8A 4M9HA 5AI5A 5BYRA 5DBBA 2W9MA 3ABVB 2VA2A 4I2GA 1PYWD 4M02A 1I35A 1MQ3A 4IL6U 5FP0A 2HTME 5AKYA 3I5JC 1CK1A 1ZUD2 3M63B 2ZUBA 1WGKA 1IP9A 3C2MA 5E6NA 4NJ7A 3NZSA 3SENA 2DPJA 3Q8AA 1FXTB 4LK0M 4Z6EA 2J6UA 4W9EA 2KP7A 4PK1A 4W9CA 3H1UA 2IO1B 4KLHA 9ICNA 2DLBA 2HI0A 1NKEA 2MW5A 4FFDA 1AWDA 2L32A 2J52A 3B0XA 4OJLA 2LASA 4GDLA 5C3JB 4EENA 3QYPA 4F71A 1TBEA 2YVCA 2Z59B 4QWBA 1HA5A 1VZ6A 9ICHA 4LJXA 1WGYA 4OCZA 3SAGA 3EHVA 3RZWC 3Q69A 8ICZA 3VXWA 1TE2A 1JALA 5KFMA 3QA8A 2MBOA 2AL6A 3PZ8A 2KQSA 4DXFA 3DDHA 2BCUA 3MR3A 1C9FA 3W2DA 1JIHA 2N9KA 2EQYA 2DAJA 2W03A 2ESEA 2BPCA 2PTLA 2ZIXB 3PW4A 9ICFA 4EFOA 2KE7A 2CRXA 7ICPA 4G50A 2BYVE 1JUDA 5KG5A 4PL1A 4NLCA 2K22A 4KLTA 1VRAB 3ZD8A 1D8BA 1ZP0B 2HTHA 5KFAA 2KX0A 4MSMB 5D3IB 2R61A 4I27A 4DL4A 4M8MA 4PGXA 1XSNA 3TKAA 1R4NI 1AQ6A 3DQVA 4GXIA 4NQLB 4DHJB 5DG7A 1AN8A 3U7ZA 5AI6A 3V61A 1QTMA 3R8BA 2DPIA 3TCAA 3AI5A 5EE0A 2QEJC 4NQKE 3C5GA 1J2NA 3JPNA 4QZEA 3RZFA 2H3FA 1S0VA 1KJTA 4LJPB 3H7PB 5D2MB 7ICQA 2K9XA 2OCEA 4ZYSA 1WCLA 1TKEA 2XN9C 5T14A 3GQCA 5G55A 3W1YA 4AQ7A 1GAQB 2ONQA 2VJ4A 3TARA 5ALOA 1SXTA 5JH5C 1OEYA 2WXPA 5AK6A 4DHZB 4E0DA 3RH4A 3I3TB 2NPTB 3RNEC 2H89B 4ED7A 2KDBA 1QQ7A 5J2GA 1E7VA 2FPLA 4TUPA 2EKIA 1S0OA 3RFZB 2OWOA 4I2HA 1QZEA 3TEXA 4NLBA 3QUBA 2XY7A 2FPMA 4NL9A 2O6VA 3MJWA 1IV8A 2KXJA 5KFVA 2BKEA 3UQ0A 1QF6A 4A90A 5MPOA 1LM8B 3C1YA 4ECTA 4XWWA 2XVTA 1I4XA 4J9PA 3G6XA 4MHVA 3PRZA 4LNIA 5CHVC 1EF1A 2MJ3A 3HKZF 4UAUA 1L3VA 1F52A 2LM1A 1WXSA 4C8NA 3S6JA 1ROEA 2QB0B 4QWEA 1D9DA 2IBKA 3L5KA 3N20C 4DLEA 3R2IA 3WKDA 5IIKA 3QE9Y 2KAJA 5HHIA 4YMOA 3AEFB 5HKHA 2WHIA 2XCPA 1S1QB 2ODGA 4GC6A 3ETLA 4FZNA 4CDGA 5HHHA 1NI2A 1SE3A 5JHAA 1WJUA 2K5PA 2EMSA 5DGAA 3PT2B 4I2AA 4RQ7A 4WIPA 2UVVA 1X42A 3TADC 4RGTA 2KIVA 1MQ2A 1BUIC 1C4CA 5GTIU 4KITB 2OEHA 5ALHA 1HQRD 1V1PA 2SAKA 4J9QA 1T8EA 1JXLA 3H40A 2KZMA 1WI0A 4P1CC 1ZRMA 3D2SA 4XDDA 1YQ3B 5HI1A 3TEYA 1DOIA 2IA6A 1HZ6A 4UB4A 3C19A 3EECA 4K3BA 3NVYA 2F2AB 2FMSA 1E8ZA 4XE0A 3TAPA 1OQQA 3RBEA 3M9MB 1SKWA 1KM7A 4LVSA 2HHWA 3IFWB 4TQ1A 4GC7A 3IDWA 4KSKC 1KRHA 4DQPA 4KMOB 1T94A 1N63A 1LVHA 5E79U 1P7DA 3AULA 3Q3FA 1B9RA 1IBXB 4IQTA 3RJEA 3SQIA 2FIDA 3Q3JA 3NRZA 4F92B 2MUTA 2DZKA 1VLBA 2CU1A 1BT0A 3VUYA 5AZFA 4J03A 2ZUDA 5BOMA 4MM3A 2EAMA 3V72A 1T3NA 1U49A 2G45B 3EFCA 5JHBA 3V6CB 2E8MA 3HT3A 4NJ8A 3ZD9A 2HHVA 1P9DU 2D5GA 3QK0A 2WXIA 3AV8A 3V7JA 3A1QB 1YZ7A 2BB5A 3MHSD 1WRIA 4EEWA 7ICTA 3KD3A 4A6QA 4K7SA 4J9NA 3UGBB 5DCNA 1D5ZC 2REXA 1XD3B 1RYJA 3Q6BA 2FLPA 4N59A 1VZ7A 4M6WA 1E10A 1KFSA 2MBBB 2IY1B 3L3FX 1AW7A 1A70A 4K3CA 3L17A 4DFDA 5BYQA 4A20A 5D49A 4O3QA 2AU0A 3EC8A 4HJGE 3V62A 1S10A 4BUGA 4B9NA 4PYZA 3ZDAA 2Y9TA 3H8WA 5AI8A 4GXJA 3QEAZ 1UGMA 2QILA 4EBDA 4P16A 4WJOA 5KL1B 3M8SA 1COOA 4MH8A 5KT2A 3ZNGC 2VZKD 3N1YC 5EWGA 1ZQLA 2WXOA 8ICUA 5FK9C 3DEEA 2RPQA 3L54A 4ZDVA 3A33B 5KG3A 1I42A 2WX0A 2B0CA 1ZQNA 3ZNHB 1KFTA 1XO3A 1KKXA 4BFRA 1SZHA 1KBUA 5ALZA 3FYHA 2OXOA 4KLQA 2O6VD 5KFZA 2JV3A 5AICA 3HVZA 3NJTA 3DV9A 2AHOB 3ALRA 2LI6A 4JWMA 4KGTA 4WWOA 2E8PA 1G6JA 4M8NA 4ECZA 2CS4A 2I6XA 2V0GA 4JB3A 2V4RA 2EDUA 3AMZA 3RJJA 2BWFA 4GFJA 4KLSA 1L6UA 4KGSA 1BPYA 3SMVA 3IG8A 3JPTA 4F91B 4ACFA 2JRZA 2MAXA 1ZYQA 3VFKA 1ZQMA 2DF4B 5AKZA 5IIIA 4XGAB 2KZ3A 2YMLA 1PDXA 1RDFA 4RM9A 3PTFC 3BS5A 3H8MA 1VJKA 3BVMA 4I2FA 5KFWA 3AUOA 4JL9A 4URKA 3RJHA 2WAQC 2Z7JA 9ICMA 1IPGA 5L9XA 2RRDA 2Y5BB 4XYCA 4QIWF 1IUEA 1FXIA 4C4VA 4ZRJA 3HUIA 4UB2A 2YMQA 1TK5A 3AU4A 3P63A 1XC9A 2N0SB 4AWJA 5KT7A 2KC1A 4RQ2A 2C28A 1JWAD 1SV4A 2F8KA 1KW4A 2A1JA 2WXJA 1KQQA 5JUMA 5J0RA 4UBBA 5ALXA 3UM9A 3P2BA 2CU3A 1L0XB 3MDAA 2DZMA 2BQQA 1U45A 2WWZA 3RCZA 4RQNA 3ZLZA 4RQ0A 1HUZA 1A77A 4US9A 2LRWA 3ZTCA 3BVZA 1TAMA 1L7YA 2BR0A 4N9F4 4F2RA 5CHFA 2JX5A 1FO4A 4TUUA 1ZDXA 2AQ1B 2R18A 3TACB 5CHGA 4W9IA 3Q8LA 1PK3A 2LGSA 1H4RA 1L2NA 8ICNA 2I1JA 4PGYA 4EX7A 1NJWA 2XEWA 4G11A 5D7GA 2A5UA 3GIMA 1L6NA 1JI7A 1QQ5A 2XICA 2WFAA 3H4DA 4DSEA 2KJRA 2WLBA 5JZEB 3NVVA 2OYYA 5ALPA 4R66A 2LYBA 3K4GA 2NRVA 4UDUC 3RB3A 3GFKB 2JZZA 3TIXA 1SV0A 4B9UA 2HHTA 3GV8B 2LYAA 1BPXA 5DDMA 2E1FA 1T6BX 2H3ZA 1MI0A 5ALVA 5KHOA 5G5GA 4ED8A 2LVOA 3UXOA 4NWIA 9ICXA 1E8WA 2JSVX 2VZKB 1SKSA 1RQNA 3PSTA 5J8YC 4IUMB 3PZPA 2C5LC 4B9TA 4TKNA 5IP4D 3NGDA 2AEHA 1HXYD 1A5RA 3LXFA 4USAA 1VCBA 5C23A 1FFUA 4JV0A 1N61A 3R7QA 3WU2U 1S0NA 1NKCA 4GIVA 4KMUA 4JX1C 5FR3A 2GBRA 3C5FA 4IKGA 4EKUA 4RU9A 2Y5CA 1QLNA 4KLIA 4MGZE 1NYQA 4IRDA 3GB1A 3PLVA 2MH7A 3KZXA 2E1EA 2AGQA 4TV3A 1FM0D 5LNK1 2ALZA 2LI5A 4CF5A 3VDZA 3MTNB 2IZVB 2HJ1A 5KG1A 3GS2A 2GO7A 3QX7A 2VH2A 1J19A 1GB4A 3MGHA 1FRRA 5DPTA 1ZQZA 3QUQA 4WWMA 3Q8QB 3PX0A 1KFYB 4KLJA 1UWMA 3N28A 2W8KA 4I2DA 3L16A 4O3MA 2M1MA 1MHXA 2LRUA 1L5UA 2D07B 1ZQRA 2ZIXA 4UAWA 2UVWA 3Q2AC 3I76A 4YD2A 1Q10A 5ALGA 2BF8B 4YXMA 4FXCA 4JPSA 3PSEB 2NBUA 4F4WA 3U52E 1V1PB 1UD7A 3UQ2A 3GZNB 4ASWC 5JTIA 2MSED 2J7QB 1NEKB 2K1FA 1V97A 5C5JA 5AI4A 3HKZC 2NRWA 1YOVB 2MRLA 1CUKA 1QQRA 3KOOA 3RH6A 3T5HA 4IM0A 4UB1A 2ATLA 3N30A 2PKEA 2JXTA 3PGEA 1X9XA 2QKQA 4CNQA 2JXXA 5ALWA 4MEXA 4DOAA 1SE2A 1UT8A 3CMMB 3H7PA 3OHAA 4LDTB 1S8OA 1SWWA 2N9XA 1HUOA 3BY4B 3DHHC 3URYA 3K1RB 1HEKA 2WXKA 1KOTA 2L76A 3SD5A 5B66U 2EELA 4RPYA 1F9JA 1QOAA 3CSFA 2AGPA 5H8YE 5J18A 4RUCA 2F8LA 4MM3B 1SKRA 4S0RA 5J2AA 1OUQA 4MFFA 2LMCA 3Q8KA 4G3IA 2XGQA 8ICYA 1QOFA 1N62A 2NS5A 5GMVA 1F0ZA 1UUPA 3N1XC 2IJ0A 3H9DA 2W9CA 4RNMA 4TQ0A 5AKGA 3B1LX 2N9LA 2JXJA 1ZQEA 1GB1A 1WY8A 4FS1A 4M6WB 4NXZA 3PVLA 4F4ZA 3JPRA 3ZIMA 4XUSA 4B95A 3PO5A 2QB0A 1L7NA 2NTTA 3GV5B 2LGXA 2M8SA 3APDA 2FNJB 3ML9A 3VQIA 4WWPA 1JW9D 3GZNI 8ICIA 4YD1A 1QSLA 3ISBA 3T5KA 4C4SA 4ECXA 4HJKA 3TBLD 3NHEB 2JYTA 2KLCA 5EE1A 3ZNID 1NJXA 3U26A 5KT6A 1NVID 5J2EA 2IOHA 5J2KA 2K8HA 3KYDD 2G0AA 2VKQA 2RDBC 1ZE3D 4MSQB 4OZCA 2LEKA 2Z0DB 1MG8A 2I9GA 3V6JA 1TY0A 4NV0A 5CRXA 2G08A 1LXDA 1ET9A 1O08A 5GXGB 1KLGD 4PZNA 3B2GA 5KG0A 3NZ3A 1DXSA 2IO3B 1L7MA 3IT4B 3OTQA 1D6EC 3ISCA 3MC1A 1CEZA 1NK9A 3KLSX 3IM1A 8ICJA 8ICXA 4LNKA 2OH2A 1RXVA 4L23A 4PHAA 1YQBA 3MDCA 2JY6A 1ZQHA 1Z00A 4QZCA 2WDQB 2JZBB 4MGYE 3CF6E 1Q3VA 3SEBA 3PRPB 1L6VA 2INNE 1E7PB 5HG2A 3HILA 2IMWP 1IBXA 3M9OB 4HXDA 1YNTE 5JXVA 3JSVA 5AI9A 3UMGA 1OGWA 4QW8A 5KFKA 3T5JA 3RAQA 3OJUA 2IHNA 1RXWA 3KWVA 2WF6A 1JXEA 1S76D 1FIQA 1SIJA 3MABA 1CJEA 4FADA 3M95A 1BVSA 1URJA 5J2HA 4XA5A 2KQ4X 1D5XC 2E8OA 3WK9A 1PVRA 3MR5A 1R4MB 3AH7A 3ALBA 5KAFU 5DB7A 8ICGA 3SFEB 3AE1B 1E5WA 4RQ6A 1KLNA 3I28A 5D46A 3O65B 1DK3A 1JROA 1V2YA 5KFIA 4HPMB 2IYDB 3ZDCA 3JPPA 3NRWA 4AJYB 2A1AA 4DHJD 3KWLA 2NO4A 3W5VB 4CF4A 2A1JB 3M3JA 2L52A 3AU2A 4JUZA 1PGAA 3VVWB 2A3VA 3QUCA 1ZJMA 1V9JA 9ICBA 3AECB 4NAMA 4ARCA 4N6EB 3GE8C 4US8A 3TFRA 1NKBA 4P0QB 1DOXA 2LYHA 1XLPA 2SEBD 1EWYC 2N1RA 2BTEA 3WCQA 2DYOA 2LWPA 2VANA 1KRPA 5IINA 2K4HA 1EWCA 2LVPA 3SHQA 3MBYA 4B9VA 1C77A 1SEBD 4MACA 4L2YA 3V60A 4NLGA 2KJHB 3C28A 3CIRB 1MSWD 2JMGA 4RF0A 1NK4A 3AE9B 4R3DA 3NS1A 3AU6A 2JWZA 4QIWC 4LNNA 4C7ZA 1L4DB 2E8NA 4RNAA 1FD6A 4FE3A 2GOLA 2XO7A 2G4SA 4PS7A 4YP3A 1V81A 2FI1A 3L10B 3RJIA 4JWNA 2N9EB 4DL7A 4KLMA 2F3NA 2YTUA 1SL0A 1L8OA 1F44A 2AWTA 5L1KA 3DBHB 3JVZX 1L5PA 4QJFB 1TFRA 4X5VA 5EWFA 5LXIB 4QZBA 4TURA 5J17A 5AIAA 1R4MI 1LB2B 2Y9UA 4PL2A 3GIKA 4UAVA 5J2BA 1F2RI 7ICIA 2KMMA 4UARA 4QWDA 2R2OA 3DWMA 3CNHA 4C4RA 1QILA 3EA6A 4CE6A 4FULA 4B6WA 2AQ0A 4KLGA 5HNKA 1R4NB 5KFUA 3GE3C 5J2FA 1WXVA 1KH0A 1RG6A 4LCDE 3UXNA 2W7OA 1SSNA 1YN3A 3ETRA 1WJNA 1KLUD 3QUTA 4W9DA 3PZDA 2KVSA 2PVGC 3VAWA 4O3OA 4Y2JA 5DB9A 2PMVA 2H88B 1WRDB 4YG2A 3IT6B 3LVVA 5D3DA 3EWAA 7ICLA 3MHZA 3BINA 3LYYA 4MFAA 3NOBA 2WF8A 2ZW0A 4JMUA 5KFTA 1Y8RC 3AEGB 5AHXA 1JWSD 3H8JA 1QOGA 4FLHA 4HDQA 2IPKD 3AE4B 2BW2A 4A3OA 4I28A 4GGQA 2D3DA 2N1VA 4JV1A 4ANWA 7ICNA 3W1SC 3UF8A 2AQ2B 5EE3A 5KFYA 1ZQOA 5DBCA 1E7UA 4FJYA 5HR6A 4IOIE 4B9LA 5B5EU 4FS2A 3QU7A 1J2MA 7ICGA 4R63A 4DQQA 1XWLA 2NR2A 4FZMA 1MG4A 3DBHI 4O1NA 3VC8A 2Y5PA 2WTFA 5KFJA 8ICPA 4KDLB 4II2B 1K1QA 3QC8B 2WXNA 3RTVA 4M9LA 2W7PA 4ECSA 5KFCA 1P3QU 3P4RB 4UAZA 2VH1A 5TISU 4HWIB 4DK5A 1PK1A 4DF8A 3BVGA 1BPDA 4C56C 3ICXA 3MFIA 3K75D 4RFBA 3RB6A 1S77D 4W9JA 2H3IA 2WDRB 4Y2QA 1IM4A 4RZRA 2KWVB 4D2KA 2HCFA 2F44A 4DSLA 2FMPA 4PJ0U 1HJPA 4ED2A 4DSFA 1A6SA 4UASA 2INDC 1EU4A 5DPSA 4NJ6A 1PGXA 1XEEA 1ZQUA 3PZ7A 1TKYA 3N32A 4OJ6A 2L8JA 3MC0B 2BBCA 2KTRB 2K4EA 3KFUF 4HLEA 5L1JA 1S3SG 2YX8A 2EZYA 3KQ4A 1NYRA 1BPZA 4KLFA 4MJSB 4N58A 4XX5A 1PQSA 2AH5A 3NVZA 2C7NB 1X6JA 4IWQA 2KOXA 2W9CB 2XY5A 5CHWA 4YXDB 1RFAA 4F4YA 2MHJA 3SI8A 4NLKA 4DOCA 1I4PA 3E0FA 3SR6A 4TMAB 3DVGX 1E9MA 4FHJA 7ICKA 1XLNA 1K52A 1L0VB 3QU4A 5BO4B 1J97A 1J7BA 3HP6A 1TT5B 3HK0A 2JRHA 2EZXA 3ZDTA 2KFNA 3K1ZA 2ZXHA 4ECQA 1MPEA 1J8CA 4FA6A 4CQNA 1IGDA 1RYUA 1KSPA 5ALSA 1K5OA 2PFPA 2GBMA 2BWES 1UA1A 2ZIUA 3BWUD 4NPNA 2MEKA 2ZW1A 4DFMA 3ORYA 2JEJA 4O5CA 5L95C 4ELUA 2AGOA 3JPQA 1D8LA 2JEFA 2IOFK 5KAIU 3IN5A 4F72A 2BYFA 4KX6B 4J3OD 1N48A 2JGAA 1WFYA 3HRDD 7ICVA 2WNMA 3W5UB 1TJEA 3VTWA 2ZPYA 3JPOA 1ZOYB 2KKCA 5DB6A 4Y2VA 3BK2A 4R65A 3OG5A 5IOIA 3A4RA 1IYFA 3QU5A 3AEVA 2K8CB 1ED1A 3N7RC 8ICRA 1YT3A 1CI4A 3PW5A 4F2SA 4GIBA 2L7RA 1RM6C 2W82A 5AEKB 3PSIA 2BQRA 2JWUA 4J9KA 2L0FA 4YT0B 3IV6A 3EPIA 4Y2YA 8ICHA 4K7WA 4ZRPA 3ZVVA 4OZAA 4KLDA 2KZRA 5DGBA 3AB5A 1NI3A 4ED6A 4M9NA 1FNWA 2ZNVB 5KT4A 1WWUA 4QZFA 3WKCA 3ZJUA 1KL9A 1C79A 3S2AA 4DDGD 3TSSA 2KZZA 7ICJA 1Z00B 2K0PA 1SWVA 4HK2A 1LFDA 4H2AA 1LQBA 4NM1A 2AQ4A 4K81A 3F5EA 2UVRA 4UQGA 2WF5A 2ZCCA 4WQOB 3BS7A 1EF5A 3M9NB 2LHTA 3MC8A 3TEZA 3I63C 3JSVB 3U7DA 2FLNA 4DFKA 2JRIB 2MLBA 3RJFA 3NZUA 4UAYA 8ICBA 1NENB 4W9GA 3RUIB 1TAQA 3KHHA 4EBEA 2DL0A 2HBMA 3MGVA 1TKGA 4IR9A 2N1WA 3D32A 3RJGA 4XQ8A 2LFIA 2V3NA 4WJ3B 2KACA 4BKTA 5CWRA 5ALIA 1ZW7A 4B0EA 2WXLA 4ECRA 4QZDA 1V49A 3IP4B 2YEPB 2ZEQA 3DVNV 4P4MA 4QW9A 4J6IA 4PS3A 5ALNA 3DVGY 3GOEA 3ONSA 1AROP 2WF7A 3KHGA 2BPGA 1L7OA 4HKZE 5KFPA 1ZQIA 1YQ4B 2PE9A 2JHDA 8ICCA 2D3CA 3DHGC 3DBSA 3QZ8A 5AI0A 4MGIE 2JQRB 4C8OA 1U9LA 1XXGA 1D8YA 3DBRB 1J7CA 3N3KB 8ICFA 4ZHOA 2QLTA 3JYUA 3AQEA 3UQBA 3E58A 3WIMA 2RP5A 4P1BC 3ONNA 2G09A 4M9GA 3ZDBA 2W9NA 5CB1A 4PS8A 5ALKA 2O2VB 4F5NA 5KFQA 1D5MC 1FNUA 5AM4A 3UMCA 5IIMA 1SGHA 4AS1A 2WB1F 2DENB 2DWQA 1ZD4A 2G5IB 5F3XB 2BCSA 4K7UA 1Z1BA 3RI7C 4RT3A 4F5QA 1JWUD 3KYCD 3EW9A 3PMLA 5KFOA 3IAM1 2RDIA 2HHSA 2WDTB 2I1KA 2ES6A 4DQRA 2WHEA 3I1YA 5HR7A 2E5SA 4P6VF 2M0AA 1FCCC 1LO5D 1UGJA 4DSJA 1JMLA 1Z1VA 1RFKA 2GBJA 2JEGA 3TJPA 5AKIA 4ANUA 2KG5A 5KFXA 3IG3A 4K1RB 1WUDA 2G06A 9ICKA 4P2HA 5KG7A 3FM9A 5F9NA 4B9MA 4RQ8A 1F77A 3CW2C 3AQFA 2ZJ5A 1Q0WB 4OVVA 2YMPA 3RULA 4UW9A 2JEIA 4MEYA 3OJSA 1Z4NA 3P4SB 2JZBA 4BJQA 2L00B 4ARIA 4TQRA 2ZPNA 3AE7B 2LVQA 2GB1A 4IQVA 3DOWA 4FHKA 4A9AA 3T79A 4RQ1A 1VDVA 1QKZA 4QWAA 2NCNA 2Y3AA 4KV2A 3O0FA 3X23A 3DBRI 4FJZA 1XO1A 3WK7A 2M19A 2E3TA 5HHDG 2DGZA 2JH7A 2XCAA 3HJEA 3WKEA 2OEDA 3BQ1A 4WURA 5FKAC 3P4QB 5IN7A 3RNBC 4WH4A 1C4AA 4DQSA 4EEKA 3ZDEA 1IIPA 5JRTA 4DO9A 3SAFA 3U2SC 1UT5A 3UIPB 3QCAA 3V6HA 4O0IA 2LPEA 1QOBA 8ICSA 1QSYA 4F8RA 2BT6A 2MCNB 4U6PA 3ZDDA 4GB9A 4NZLB 3VH3B 4ANXA 2C2DA 1JQ4A 2KV2A 3MJ5A 3OAWA 3T3OA 3PO0A 1OW5A 1BPEA 4JWSC 2PFQA 5DB8A 3DPDA 3EYZA 3H8HA 4GLXA 2HHUA 2L0TA 4A8EA 4LDTD 2J53A 4NL9C 3TANA 3A0HU 4P0QA 3WKAA 3OWEB 1S9FA 3AU5A 3LK9A 4NAWA 8ICKA 3ZYYX 4ELTA 2NRTA 1RWSA 4ZYNA 1B4FA 2KVRA 5KFGA 3ZXVA 5ALDA 4Q43A 1E8YA 2L05A 1B1ZA 2M0XA 1PK1B 1UH6A 4EZKA 1Z4OA 1S0MA 2KANA 1WM3A 3RMKC 3WANA 2EMTA 1WZ3A 1CQVA 2ZCBA 2PFOA 3TUOA 1F5SA 2C7MB 2IO0B 9ICWA 2DZIA 4XZ4A 1GPXA 4FBUA 4O5EA 1Q1OA 3FDSA 3AE6B 3HVDA 2G5HB 4HKQA 4KN7A 1WF9A 4FZLA 5AK4A 1C7YA 2RGFA 2FE8A 3QWZB 2LMRA 3WKBA 1J7AA 2FIFA 3MR2A 4DL5A 1P98A 3ZGZA 2KK0A 3NUQA 2WS3B 4RM8A 2BDUA 1ZQQA 1AARA 2KWUB 3A4SC 4MT5A 2KT7A 1WXAA 3G6YA 2B21A 2D8CA 3RH5A 2C60A 1I4RA 4ZRQA 2BDPA 2UWQA 4YWGG 1XNSA 4OW0A 4CHKA 5HFYA 4DF4A 2WYQA 1ZQAA 2R8KA 3OHBA 4BAXA 2IGDA 4YTNB 2MQJA 2BKRB 3ZO5B 2QMTA 2IDYA 4CRXA 1P0RA 2FPKA 2JF5A 1J0GA 2W3RA 1FEZA 4IQUA 5KFBA 4TQSA 4WJPA 5DDYA 3TEWA 2F1IA 4F3OA 2PMZF 3AL0B 2JT4B 1VR9A 3QJZA 2QSDA 3P4PB 5KFRA 2MSNA 5F9LA 2C22A 9ICVA 4WQMA 2KKPA 3SZ2A 1SZPA 4ITKA 4Y2RA 1SF0A 1M4VA 2GBNA 3MFHA 2ZTEA 4F5PA 3THVA 1KDHA 2Z0EB 4W9KA 5AUIA 2YQEA 2FLLA 2BYTA 5EE9A 2LUEA 1IXRA 1QQ6A 1V80A 4E3CA 2V4LA 3BYYB 3BYTB 4IG7B 2IBIB 4Y2SA 3N9YC 4GOCA 4W9HA 5A0LA 1IGCA 3KVFB 4MDKE 2LM4A 3ZNZB 2Y1JA 1LGRA 4IWOA 2P66A 1FEHA 1JWBD 2ZIUB 4B6JA 2NV3A 2KDIA 2MJDA 4A8XC 2V3PA 5CEHA 3EGRA 3I57A 4ZRIA 5AKLA 1C4PA 2A4ZA 2D11A 2RD0A 3QAQA 2NO5A 2FCQA 4RCOA 3EPGA 3WA0A 1NK5A 2ISOA 3QU2A 4M0WB 2J0JA 2HHQA 3GP7A 2F76X 4Z6FA 2DYBA 5BYSA 4NM2A 1E90A 2KWDA 3LDZE 1ZQXA 4RH6A 4HPPA 4NY0A 1X2IA 2ZVNA 1GO3F 3CP8A 4EZ9A 1TTNA 4C7YA 3RNAC 3ED5A 1RPLA 2YB4A 4Y2PA 3PW2A 1COKA 2CKHB 2RMMA 2C2EA 2P6UA 3P42A 4ICVA 1M6YA 2BB6A 1HTQA 1N60A 4KGRA 5DG9A 5J0PA 1O03A 3R9KA 1ZXHA 1E6EB 1N6ZA 4U7CA 2V9HA 2IGHA 2H5XA 4L1BA 3WAOA 2WX1A 1P7FA 4A3PA 2KTRA 2Y1IA 2YEPF 2RHFA 3LVWA 2BQUA 3AE3B 4B9KA 1VJ5A 3VUWA 4EE2A 4Y2TA 1RLFA 1TGZB 4HCNB 4MJSA 5J2RA 9ICOA 1V5TA 1X9MA 4DOBA 4HEA1 2R8JA 2W54A 2ICIA 2ZTCA 4F4XA 4FBTA 2C7HA 3NUHB 4DDID 2NBWB 3IHQB 1UNSA 1WJ4A 2OOBB 9ICLA 4DL2A 3VHTC 4DQOC 2J6SA 1UCVA 9ICGA 4AJWA 1K1SA 2HOFA 3OJ3A 2EANA 3IVFA 4DXAB 2KFKB 3DVNU 4QNLA 2HE7A 3JPSA 3WALA 1X66A 1L3TA 1XCTL 2WXGA 3KW5B 3H0LB 1B0XA 1VD2A 3PW0A 2WU5B 4O3RA 3W9CB 4ZHPA 5L1LA 2LJ5A 3C2LA 1F2RC 3RAXA 2KKVA 3PNCA 2DUYA 4REZA 3UIOB 3A9JB 2K8AA 1V85A 3MGIA 1RQLA 3C2KA 9ICAA 1JRUA 2LHEA 2MWSB 2YY6A 4X57B 4PYUA 1NDDA 2K8CA 4J9LA 3DBLB 2AQ3B 3M6ZA 5CP2A 4JV2A 4DS4A 1I4QA 1S5LU 2RQ5A 1T5XD 1LKYB 1XCQL 2BGFA 4BVUC 1YN4A 3FILA 4CGZA 1DRGA 1SJHD 1QSSA 1DK2A 2J42A 4HYKA 3MFGA 2ZTDA 3PLUA 2JYEA 5TR5A 3G6VA 1ESFA 4WWNA 5ALLA 2JVCA 3AEEB 3ML8A 1GOZA 4I6PA 5KT5A 3SAHA 3O13A 2WB1C 1WR1A 4DLGA 1EXNA 4RNOA 1Z2MA 2LBOA 5T8IA 5IKCM 3F2DA 2D3GA 1N56A 4BOZB 2MRPA 3A9KA 1WGDA 4RQMA 4IR1A 2H3VA 3RNCC 3APFA 4YTPB 4K4HA 4GSWA 3VR9B 1TIFA 1X1MA 4EZJA 2GMIC 2WF9A 4EZ6A 2PE6B 1BGXT 1SV0C 1OQRA 3LYSA 3SYZA 1YX5B 2B76B 4DHZE 3ZJVA 2PJHA 4Z6CA 1ZQBA 2L83A 4IC7B 3A0BU 1XQQA 5I4DA 4DWIA 2BQ3A 5AUKA 1SL1A 3NTUA 3PV1A 3N97B 3BDPA 3AN1A 8ICQA 1UZXB 2QCZA 5DQHA 4DL6A 1T0SC 2BS2B 2O2VA 2D2QA 2IO2B 1WG8A 3DBLI 1ZQWA 2MBQA 1ZQKA 2K4PA 1RYSA 2HSZA 1ZD5A 1Q3UA 1D9FA 2OM6A 2K6DB 3EFUA 5J2DA 3IRUA 2Y0SF 5IIOA 3PO4A 3V6EB 1MHHE 3TFSA 4RGNA 4NAWB 1R7SA 1I7HA 1CZPA 2XBBC 1TK8A 2NYVA 1ZQYA 1MFWA 4DL3A 3J9CA 3OSPA 2FUG1 1GJZA 2HVIA 1ZQ1C 7ICEA 4QWCA 3OGUA 9ICTA 2DZJA 4EX6A 3WK6A 1NK8A 1C1YB 4ZRKA 3AE8B 3QNMA 4W9LA 3HM3A 5IIJA 2EKEC 2MA1A 4RPXA 1ZQFA 4XDCA 4ICAA 4BOSC 2KHWB 4QZAA 2PKOA 5CTRC 5KG6A 5AM2A 2GI9A 3ZW3A 4PPXA 3WK4A 5D6JB 4LZGA 1WIAA 1WCNA 3M6KA 2KFZA 5J0QA 2LHDA 3WK5A 1ZJNA 3ZDMC 3NVWA 5AKEA 2LJIA 2KJ6A 4EYIB 4JE3B 4MFCA 4YTMB 1YJJA 4UB8U 2ZXIA 1WYGA 1M94A 5C2TB 4WAAA 2EH9A 3LDAA 7ICHA 1Y56A 3E9SA 3RRHA 3CSTA 2I5HA 2E6XA 2UU7A 5AZHA 2AXTU 1S97A 3UMBA 1KLVA 9ICEA 3CYMA 3RPFC 3KH0A 5J2IA 2HBJA 2ZIWB 4ZH4A 1N5WA 3KHRA 1L3UA 1T7PA 2DYMA 1QLBB 3MR6A 3J81j 2QHOA 2WDVB 2X38A 4PH5A 2BZFA 2ASJA 4OJPA 3EZ5A 2K8BA 2ASLA 3HHMA 1V8CA 1DOYA 4I2EA 2KN5A 1XSPA 5TSSA 3KZIU 4IQWA 5ALJA 1EUVB 5L1IA 4YMMA 5ALRA 2ZZPB 2QDFA 4YFKA 4KSLC 1FPYA 1P7EA 2V9WA 4NLZA 2QJLA 3GU3A 1AYFA 3Q14C 5KTQA 5AK3A 3RN9C 4J9OA 5H2FU 2MP2A 3MP9A 3BQ0A 3LB8C 4AYBF 1ENFA 4KIKB 1WXQA 2INPE 3R3MA 1QH9A 3RF9A 2JZPA 2L3ZA 1ZQDA 3RYTA 2HMXA 2J4XA 3GIIA 5KT3A 3VTVA 1HEZE 4RPZA 2AL3A 1K8RB 5ALTA 2FCNA 1PZNA 4GU2A 3N7PD 4YCXA 4BXOB 1SE9A 3UINB 5L1MA 2ASDA 1A0PA 2N7JA 2KIWA 2PMZC 1DGJA 2KJ5A 5KFEA 1GC6A 2INCC 3PV8A 4M04A 2N4FA 1FRDA 4IS7A 2PI5A 2WP9B 5BPCA 2IHMA 3V3XA 2O6KA 1WYWB 2K89A 2IY0B 2KVCA 2RSUA 2I1QA 2FCSA 2YMMA 1JN3A 2XK5B 4KLUA 4RQ5A 1ZETA 3H8SA 2NBVB 1WE7A 4FN2A 1TK0A 4O3NA 4F7ZA 1T0RC 4I2BA 4P0PA 2PVOD 2PPHA 2VJ5A 1I4GA 4GMVA 4PHPA 4DXGA 4QZHA 1YZ6A 1TKDA 4LNOA 1TS4A 1WMHB 4DSKA 4C8LA 2J0MA 3AEBB 2RR9A 1WGGA 1Q46A 8ICVA 2FE9A 4JQWC 2KDMA 3M7DA 4Q2JA 1PVPA 5KFDA 2BPSA 4WAFA 1GUAB 4RMAA 1BPBA 2ZNVC 5ALYA 3PX6A 3BK1A 3X0WA 5KFSA 1TZOA 1ZQSA 2C2RA 4RF1A 2FDRA 3LWLA 3WAMA 4ICUA 2NRZA 4TUSA 2G1EA 2BGWA 1ZDVA 3Q8EA 2KJ8A 3OSNA 5E6OA 1XU4A 4LTUA 3PS6A 1U48A 2LGIA 3Q3OC 1NBFC 3DHIC 2ZUCA 4KKIA 4JIOU 1XF5L 2AX5A 2K3UA 2OJRA 1L3SA 7ICMA 3BQ7A 3RR7A 1XT9B 2R8HA 4ECWA 2HHXA 1PUZA 4O9MA 3KUCB 3AE2B 3SV4A 1N2XA 2XIDA 2ZIVA 4DS5A 2M0NA 1XS9D 1XO0A 1ECWA 5EDSA 1A76A 4F5RA 4DWFA 2J0KA 3IXSA 4GDKA 3NG0A 4F4KA 2AYOB 3V7LA 4IM3A 3RB0A 1U47A 3RB4A 4I2CA 4EBCA 5IAAC 5BMGA 1I4HA 4ELVA 3T5LA 4M0WA 2W3SA 1F0MA 1TS3A 3AEDB 4S17A 2K39A 3UI3A 1YD8U 3PX4A 2HDOA 3H6NA 5DPRA 2HD5B 2WXRA 3FILB 5J29A 3VRAB 2LGDA 2RDHA 4M00A 1BXTA 1KTQA 2F1HA 3EUB2 1TAUA 5L83A 2VA3A 5AM3A 4NJCA 2MJEA 1MN8A 4RQ4A 9ICUA 4BBNF 4O5KA 5J0SA 1B22A 4I6NB 2CPRA 4II3B 1SXEA 1T0YA 4PT5A 2GBKA 5J8YA 2V4QA 2HDEA 4DQIA 1P1AA 3A9KB 4RUAA 1SB3C 4G3XB 3HM6X 1NNLA 2W9BA 2KO3A 2IGGA 1WH3A 4Y2XA 2CR5A 4P4PA 1ZQCA 3BQ2A 2P6RA 3DDCB 3LJ3A 3L13A 8ICOA 1UHUA 1X40A 4E74A 7ICRA 2LZ6A 3DCGA 5J0TA 1Z19A 2KJ9A 4ED3A 4CF3A 4UB5A 3BJYA 1ZGUB 3BQTA 4ECUA 2PW9A 1K50A 1ZD3A 4AOFA 3GZFA 3RNFC 1GG3A 2B6GA 1XLQA 2P35A 4R8UB 7ICSA 3RNGC 4TSSA 2FCMA 5KFNA 3D6JA 1UPHA 1UWXA 2DNFA 4MGKE 1TS5A 1T0QC 5GTHU 4YXJA 3KKAA 2KFKA 3F53A 3RJKA 4AP9A 2GOWA 2LGYA 1ZQVA 5JU5A 4KZCA 5AM0A 1FNVA 2G3QB 3V05A 3T3NA 1H38A 1HIWA 5AKJA 2QARB 2KK8A 4Q45A 3B0AA 1ZKHA 2PIAA 4F8CB 1DYQA 3L0WB 9ICJA 4F93B 4PZOA 2JH1A 2KMAA 4YN4A 3H7IA 2M56B 2KVZA 3Q3NC 5AZGA 2FAZA 3FC4A 5CX3A 1YIWA 3A9JA 3NASA 5ALMA 1EM7A 3TMPB 1WXMA 4ECVA
chains in the Genus database with same CATH topology
5EE9A 2R61A 3BYYB 3BYTB 3KWVA 3N9YC 1PFDA 1FIQA 1IGCA 1AN8A 1SIJA 2G9HD 1CJEA 3U7ZA 1ZXIA 3R8BA 2KQ4X 1D5XC 1FEHA 1JWBD 2QEJC 2QIEB 5EE0A 1OFFA 2MJDA 3Q8CA 4A8XC 3AH7A 2V3PA 3EGRA 3I57A 1FFVA 3SFEB 3AE1B 2K9XA 4ZYSA 1C4PA 1TKEA 2XN9C 1JROA 4AQ7A 1GAQB 2ONQA 1SXTA 2WXPA 4RCOA 1C78A 2V4IB 1N5XA 3BZDB 3KWLA 3W5VB 2H89B 3GP7A 2L52A 1PGAA 5BYSA 3R2TA 2KWDA 2EKIA 1HZ5A 3RFZB 3AECB 4NAMA 4RH6A 2DBYA 3TEXA 4ARCA 4N6EB 5BMHA 4US8A 4C7YA 1DOXA 1XLPA 4OVZA 2RMMA 2SEBD 1QF6A 1EWYC 3P42A 2WXQA 2BTEA 4A90A 2NMQA 2DYOA 3WCQA 5MPOA 2BB6A 4XWWA 1N60A 1I4XA 4KGRA 2KN4A 2MJ3A 1EWCA 1ZXHA 1C77A 1E6EB 1SEBD 4MACA 4L2YA 2IGHA 1ROEA 4L1BA 1WWTA 3CIRB 1P7FA 4RF0A 4R3DA 3AE9B 3NS1A 2YEPF 3R2IA 4C7ZA 1L4DB 2I38A 2KAJA 4RNAA 1V1OA 1FD6A 3AE3B 4EE2A 3AEFB 1TY2A 4HEA1 1SE3A 2W54A 2K5PA 1L5PA 2ICIA 4WIPA 3NUHB 2RPVA 4XWTA 1UNSA 4RGTA 1BUIC 1F2RI 4DQOC 4GDLB 1C4CA 2KMMA 3DWMA 4HROA 1HQRD 1V1PA 1QILA 3EA6A 4XDDA 1KH0A 1YQ3B 5HI1A 3TEYA 1XCTL 1SSNA 2WXGA 1DOIA 4IDIA 1HZ6A 1YN3A 3ETRA 3NVYA 1KLUD 1BMLC 2SAKA 2WU5B 2PVGC 4XE0A 3W9CB 1OQQA 4ZHPA 2PMVA 1SBBB 1F2RC 2H88B 3IT6B 2CJNA 5D3DA 4REZA 4TQ1A 3MHZA 1QT9A 1EU3A 3LYYA 1KRHA 3Q8FA 2LHEA 2ZW0A 1N63A 1B9RA 1IBXB 3AEGB 1TYGB 1JWSD 1QOGA 3NRZA 2IPKD 3ZJTA 1VLBA 2BW2A 3AE4B 2RDGA 2OHFA 2AQ3B 3SFDB 4HRSA 2L1AA 1I4QA 1T5XD 1XCQL 2AQ2B 1FXAA 5EE3A 3B2FA 1YN4A 2D5GA 3FILA 2WXIA 4IOIE 3AV8A 4GLSC 1SJHD 2BB5A 1WRIA 2J42A 2Q5WD 3MFGA 4A6QA 1D5ZC 1RYJA 2JYEA 4O1NA 1ESFA 1XLOA 1VZ7A 2Y5PA 4N59A 1D4BA 1E10A 3AEEB 5JXVA 1GOZA 2WXNA 3O13A 1AW7A 1A70A 3P4RB 2JU6X 3AEAB 5BYQA 3BVGA 5T8IA 4HJGE 4C56C 4RFBA 2QILA 4P16A 4YTPB 2WDRB 3VR9B 4D2KA 4MH8A 1OQRA 3FAHA 2WQYB 4GDKB 2VZKD 1EU4A 2WXOA 2B76B 1E0ZA 3ZJVA 5FK9C 1PGXA 2L83A 1XEEA 3PZ7A 1TKYA 2CJOA 1XO3A 5I4DA 3MC0B 2BBCA 3VR8B 5AUKA 1STEA 3AN1A 5H92C 3KQ4A 1NYRA 3HVZA 2BS2B 4N58A 1L4ZB 4KGTA 1MHHE 4RGNA 2V0GA 3NVZA 4NAWB 4OZBA 1R7SA 4YXDB 3AMZA 1I7HA 1CZPA 1L6UA 2LUMA 4RGOS 3J9CA 4KGSA 1I4PA 3SR6A 2FUG1 4TMAB 1E9MA 2WU2B 1XLNA 1K52A 1L0VB 1J7BA 3CWIA 3AE8B 1PDXA 1T3QA 1MPEA 4CQNA 4XDCA 4ZOHC 1IGDA 2Z8LA 1VJKA 3BVMA 1K53A 2PKOA 2BS3B 3BWUD 2GI9A 2MEKA 2ZW1A 2W55A 1IUEA 1FXIA 2LHDA 3BIID 3Q8BA 4KX6B 3NVWA 2LJIA 4J3OD 2WNMA 4JE3B 3HRDD 3W5UB 1TJEA 1L0YB 5E6JA 3HUIA 4YTMB 1YJJA 3P63A 1WYGA 1ZOYB 3BK2A 2N0SB 5C2TB 2TSSA 3E9SA 1Y56A 5BMGA 3IAS1 4C80A 2E6XA 2GRIA 1JWAD 1RM6C 1ET6A 2W82A 2WXJA 2JWUA 1PGBA 4YT0B 2CU3A 4ZRPA 3RPFC 1L0XB 3DWGC 3W1SA 4OZAA 1N5WA 2DYMA 1QLBB 3AB5A 1NI3A 2XNAC 1FNWA 2WDVB 2X38A 4US9A 1DOYA 1V8CA 3BVZA 3ZJUA 1C79A 5TSSA 4YSYB 3TSSA 2PLPA 2JX5A 2K0PA 1FO4A 3B9JA 1ZDXA 2AQ1B 4H2AA 1P7EA 3ZQ4A 1YMHE 2QJLA 1AYFA 3TEZA 1PUTA 2BS4B 5D7GA 1NENB 3MP9A 3LB8C 1ENFA 1ZPSA 2WLBA 1TKGA 1WSPA 2NTSA 3NVVA 1WXQA 2INPE 2JZPA 2LFIA 2V3NA 3P1MA 2KACA 4B0EA 2WXLA 2J4XA 4UDUC 2YEPB 1HEZE 4HKZE 1YQ4B 1T6BX 1MI0A 2JQRB 1XXGA 5G5GA 2N7JA 1J7CA 4ZHOA 1DGJA 3VRBB 2JSVX 2VZKB 1VZ8A 4A55A 1ACCA 5G5HA 2WXFA 1FRDA 1FCLA 1D5MC 1FNUA 1HXYD 2WP9B 4USAA 3LXFA 3V3XA 1FFUA 1N61A 1JWMD 4AS1A 4RGMA 4YSZB 4JX1C 2DWQA 5FR3A 4IKGA 1YJIA 1YN5A 2Y5CA 1JWUD 2PVOD 1I4GA 1JCKB 1NYQA 3GB1A 2MH7A 3IAM1 5LNK1 4DXGA 1FM0D 1MVKA 1TS4A 4P6VF 1KF6B 3U4EG 2M0AA 3GS2A 3AEBB 1FCCC 1LO5D 1UGJA 2FBWB 1GB4A 1KTKA 3I9V1 1JMLA 1RFKA 1FRRA 2KDMA 1TS2A 4OHJA 4Q2JA 4WAFA 4WWMA 1KFYB 1UWMA 3BK1A 1TZOA 4RF1A 3AE5B 1C76A 2WXHA 1MHXA 4JWUC 1F77A 5BMIA 1Q10A 2G1EA 3P4SB 1ZDVA 4FXCA 4JPSA 3Q8EA 4ARIA 4LTUA 3L4PA 2LGIA 3AE7B 1V1PB 2GB1A 3U52E 4A9AA 4B0MA 4KKIA 1VDVA 1QKZA 2Y3AA 2WXMA 1XF5L 2AX5A 1NEKB 2K3UA 1K51A 1SJED 1V97A 2M19A 1QQRA 2E3TA 4KKJA 4LLGM 5HHDG 3AE2B 2OEDA 2JXTA 4WURA 5FKAC 3P4QB 4WH4A 1C4AA 1SE2A 3IXSA 3U2SC 3E56A 3C8YA 1QOBA 2BT6A 3URYA 2I2YA 2WXKA 1I4HA 4NZLB 1JQ4A 2ACZB 3MJ5A 3T3OA 4M0WA 2W3SA 3PO0A 2EELA 1QOAA 3AM9A 1TS3A 4JWSC 5H8YE 3AEDB 4MM3B 3UI3A 1SE4A 2LMCA 3H8HA 2WXRA 3FILB 1QOFA 1N62A 3VRAB 2J53A 1FMAD 1F0ZA 1UUPA 2RDHA 1JRPA 2IJ0A 1BXTA 3OWEB 3ZYYX 4TQ0A 1RWSA 3EUB2 2N9LA 1GB1A 4YSXB 4NJCA 2MJEA 1B1ZA 2ON8A 5BYRA 2NTTA 3VQIA 3ABVB 1PYWD 4PT5A 1JW9D 2HDEA 2HTME 1CK1A 1ZUD2 1CQVA 1WGKA 3TUOA 1SB3C 1GPXA 2IGGA 3Q8AA 3AE6B 4LK0M 3HVDA 2JYTA 5EE1A 4HKQA 1NVID 2PW9A 1K50A 2DLBA 2FE8A 1J7AA 1ZE3D 1XLQA 1AWDA 2L32A 4OZCA 2J52A 2LEKA 5C3JB 2WS3B 3ZGZA 4TSSA 1UWXA 1HA5A 1TY0A 1VZ6A 1TS5A 1ET9A 4MT5A 4ZRQA 5GXGB 1I4RA 1KLGD 3Q69A 3B2GA 3NZ3A 4YWGG 4OW0A 1JALA 5HFYA 3V05A 1FNVA 3IT4B 3T3NA 2IGDA 1D6EC 3PZ8A 4YTNB 4DXFA 2QMTA 2IDYA 1C9FA 3KLSX 3W2DA 2W3RA 2N9KA 4L23A 2PIAA 1DYQA 3TEWA 1VR9A 2PTLA 2QSDA 3P4PB 2M56B 2WDQB 4WQMA 3FC4A 4ITKA 3SEBA 1L6VA 2INNE 1E7PB 1SF0A 1M4VA 1EM7A 2K22A 5HG2A 1IBXA 1VRAB 1ZP0B 1YNTE 5AUIA 2BYTA 5D3IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EE9 A;  1RM6 C;  1VLB A;  3AE4 B;  2AX5 A;  1NEK B;  2OHF A;  3SFD B;  4HRS A;  1V97 A;  4YT0 B;  2CU3 A;  1PFD A;  3RPF C;  3DWG C;  1FIQ A;  1FXA A;  1SIJ A;  2E3T A;  2M19 A;  1CJE A;  3B2F A;  5EE3 A;  1N5W A;  3AE2 B;  1ZXI A;  3AV8 A;  1QLB B;  3AB5 A;  1NI3 A;  3P4Q B;  5EE0 A;  1JWB D;  2QIE B;  2WDV B;  4US9 A;  1OFF A;  2MJD A;  1DOY A;  1V8C A;  3AH7 A;  1WRI A;  2Q5W D;  3SFE B;  1FFV A;  4YSY B;  3AE1 B;  2K9X A;  2JX5 A;  1RYJ A;  1FO4 A;  3B9J A;  1TKE A;  1XLO A;  1JRO A;  4N59 A;  1GAQ B;  1QOB A;  3AEE B;  1E10 A;  2BT6 A;  1A70 A;  1N5X A;  2QJL A;  1AYF A;  3KWL A;  3P4R B;  1PUT A;  2ACZ B;  3AEA B;  1JQ4 A;  2BS4 B;  2W3S A;  3PO0 A;  3W5V B;  1NEN B;  2H89 B;  1QOA A;  3AM9 A;  2L52 A;  3LB8 C;  4JWS C;  5H8Y E;  2WLB A;  3AED B;  1TKG A;  2EKI A;  3NVV A;  1WXQ A;  3AEC B;  3P1M A;  2DBY A;  2WDR B;  4YTP B;  1QOF A;  1N62 A;  4N6E B;  5AUI A;  3VRA B;  4US8 A;  1FMA D;  3VR9 B;  4C7Y A;  1F0Z A;  1DOX A;  1XLP A;  1JRP A;  1QF6 A;  1EWY C;  1OQR A;  3FAH A;  2WQY B;  3WCQ A;  3ZYY X;  5MPO A;  1RWS A;  3EUB 2;  2B76 B;  1N60 A;  1E0Z A;  1YQ4 B;  2L83 A;  2MJ3 A;  4YSX B;  1TKY A;  1E6E B;  2MJE A;  2CJO A;  1XO3 A;  1ROE A;  2JQR B;  5G5G A;  1WWT A;  3CIR B;  3VR8 B;  1J7C A;  5AUK A;  3AE9 B;  4ZHO A;  1DGJ A;  3NS1 A;  3ABV B;  3VRB B;  4C7Z A;  2KAJ A;  3AN1 A;  1JW9 D;  5H92 C;  2HTM E;  1NYR A;  3AE3 B;  5G5H A;  1ZUD 2;  3HVZ A;  1FRD A;  2BS2 B;  1WGK A;  3AEF B;  1SB3 C;  4N58 A;  2WP9 B;  4USA A;  3LXF A;  1GPX A;  1FFU A;  1N61 A;  3AE6 B;  2W54 A;  2K5P A;  3NRZ A;  5EE1 A;  1L5P A;  4YSZ B;  4YTM B;  3NVZ A;  1NVI D;  1R7S A;  2DWQ A;  4JX1 C;  4YXD B;  3AMZ A;  1I7H A;  1CZP A;  1YJI A;  2Y5C A;  1L6U A;  1J7A A;  2PVO D;  3SR6 A;  1XLQ A;  1NYQ A;  1AWD A;  2KMM A;  1E9M A;  2LEK A;  2MH7 A;  2WS3 B;  3DWM A;  2WU2 B;  4HRO A;  5C3J B;  1XLN A;  1FM0 D;  1L0V B;  1J7B A;  4P6V F;  3CWI A;  1KF6 B;  5GXG B;  3AE8 B;  3AEB B;  1PDX A;  1T3Q A;  3B2G A;  1YQ3 B;  2FBW B;  1JAL A;  1FRR A;  4ZOH C;  1DOI A;  1RFK A;  4IDI A;  1VJK A;  3ETR A;  4YTN B;  3NVY A;  4WWM A;  2PKO A;  1KFY B;  2WU5 B;  2PVG C;  2BS3 B;  1UWM A;  2W3R A;  1OQQ A;  3W9C B;  4ZHP A;  2PIA A;  3AE5 B;  4JWU C;  2H88 B;  2W55 A;  1IUE A;  1FXI A;  3BII D;  3P4P B;  4KX6 B;  3NVW A;  2CJN A;  2M56 B;  2WDQ B;  3HRD D;  4WQM A;  3W5U B;  3FC4 A;  1TJE A;  2G1E A;  1QT9 A;  3P4S B;  4ITK A;  3HUI A;  4FXC A;  1YJJ A;  3P63 A;  1KRH A;  1WYG A;  1ZOY B;  1L6V A;  1N63 A;  1B9R A;  2N0S B;  4LTU A;  1E7P B;  1SF0 A;  3L4P A;  2K22 A;  3AE7 B;  3AEG B;  5C2T B;  1TYG B;  1ZP0 B;  4A9A A;  1QOG A;  4C80 A;  1VDV A;  1JWA D; 
#chains in the Genus database with same CATH topology
 1T4G A;  4RT2 A;  3PHW B;  4C4T A;  4Q8F A;  1MA7 A;  3C29 A;  1SXD A;  1YJ1 A;  3HX0 A;  1PFD A;  2HVH A;  2VRR B;  3H7S A;  2G9H D;  1Z5S B;  1LKY A;  3IHP C;  3ECI A;  1ZXI A;  2KMD A;  2ZG6 A;  4UAT A;  2KNB A;  3QIJ A;  2QIE B;  1RAX A;  3M62 B;  5AKH A;  1OFF A;  1TZ1 A;  3KUZ A;  4IC9 A;  1ZQG A;  3FKY A;  3Q8C A;  3C1Z A;  2KD1 A;  1FFV A;  4KTQ A;  3QEB Z;  3BZC A;  3WAP A;  3QU9 A;  5J0X A;  2H3Q A;  5BOL A;  4K4I A;  5J2C A;  2KHQ A;  2Q0Z X;  4KLO A;  2V1Y A;  3PSP A;  2CN1 A;  2WGS A;  4BKG A;  2Y0S C;  1C78 A;  2V4I B;  1N5X A;  1U4A A;  3BZD B;  2VIX A;  3ZTD A;  3APC A;  2CHW A;  2CXY A;  2PFN A;  3R2T A;  3E2E A;  2MU2 A;  2KEY A;  2NRX A;  1XSL A;  2FJ6 A;  2ISP A;  1HZ5 A;  1Q5W B;  4M0A A;  3ZRF A;  3SDL C;  2DBY A;  1KFD A;  5BMH A;  2HW3 A;  4KZ0 A;  4WJQ A;  5AKK A;  2K8B B;  4OVZ A;  2KTQ A;  2WXQ A;  4RNN A;  2NMQ A;  4KVG B;  2DFL A;  2KSO B;  2KN4 A;  2KOB A;  1ZRN A;  1U4B A;  3PPA A;  8ICM A;  2CHZ A;  2ZVO A;  3QHT A;  4EEL A;  5KL8 B;  1WWT A;  2N9P C;  2QC8 A;  2OJW A;  3TQ1 A;  5J2J A;  1H8C A;  5J0U A;  4I2J A;  2I38 A;  2KDF B;  2MP2 B;  1V1O A;  3RRG A;  3QQ8 B;  4YR3 A;  2LKY A;  2BCV A;  2GLE A;  3M8R A;  3PVX A;  1TY2 A;  4LJO B;  3U8Z A;  1KEJ A;  3PY8 A;  1V5O A;  4MEM A;  3F5A A;  4EEY A;  1X9S A;  4YMN A;  9ICI A;  4BWJ A;  4F50 A;  1IG6 A;  1UBQ A;  2AJQ A;  2X8X X;  4BDP A;  2D10 A;  2RPV A;  3L08 A;  1WR6 E;  4XWT A;  5AK5 A;  3GV7 B;  2W43 A;  5DBA A;  3VUX A;  2YB1 A;  3PR4 A;  3OLM D;  1UF0 A;  1E8X A;  2PI4 A;  4GDL B;  4J9S A;  4HRO A;  1CRX A;  4KLE A;  4C0Z A;  4BX9 C;  2ASQ A;  3H4B A;  2PXI A;  4KLL A;  4MF8 A;  4YR0 A;  7ICO A;  4QZI A;  4IDI A;  4B9S A;  4FBJ B;  2KFJ A;  1TV9 A;  1UBI A;  2DKZ A;  5ALF A;  3HWT A;  4I29 A;  4IRK A;  1BML C;  2M9N A;  2JZ3 B;  4R64 A;  3PMN A;  2MA9 B;  5DG8 A;  5IIL A;  2UVU A;  4CYE A;  1RRB A;  4IRC A;  1GC7 A;  1HE8 A;  5HP4 A;  4AYB C;  1SBB B;  2LXC A;  2M4N A;  3R7R A;  2CJN A;  3SD7 A;  4Q8E A;  1QT9 A;  1EU3 A;  4P0P B;  2IOF A;  1JX4 A;  3Q8F A;  4J9M A;  1OQY A;  1TYG B;  4ECY A;  3ZI4 A;  4HPL B;  2W04 A;  4LZD A;  3ZJT A;  3M1Y A;  2RDG A;  3UPQ A;  1V38 A;  5CJ7 A;  2OHF A;  2HBL A;  3C23 A;  4HRS A;  3SFD B;  4UBC A;  2L1A A;  5DKW A;  3PHX B;  5LXH A;  1FXA A;  3B2F A;  2HOI A;  2ZIW A;  2G07 A;  4EYH B;  1ZQJ A;  1PVQ A;  1OTR B;  4RQ3 A;  4OVU A;  1CMX B;  3ISD A;  4ACO A;  4GLS C;  3MC9 A;  2Q5W D;  4GXK A;  5DLF A;  3OPX A;  2BHN A;  1L8L A;  4C8K A;  1XLO A;  1D4B A;  4Y2U A;  5KG2 A;  2K60 A;  3K9O B;  2D6F C;  3BZK A;  4MF2 A;  2HJ8 A;  1C20 A;  4XC2 A;  1NJZ A;  1Q8K A;  1L7P A;  4JGH B;  4OJO A;  2JU6 X;  3AEA B;  3IBE A;  5AM1 A;  3TI0 A;  1SL2 A;  4MH0 E;  5LLI A;  5KFH A;  4KIK A;  5TZV A;  1SIF A;  2W11 A;  1NK6 A;  5DQG A;  2XC9 A;  3RD2 A;  2JR5 A;  2V3S A;  2GWS A;  4AUQ C;  2ZIV B;  1UA0 A;  2O6V B;  4YR2 A;  5E6P A;  2GH1 A;  1NZP A;  5CR0 A;  3PRM B;  3OJ4 B;  3FAH A;  2WQY B;  4GDK B;  4JK1 A;  1BNO A;  5D4B A;  1E0Z A;  3RR8 A;  1ZQT A;  1Y88 A;  4FJV B;  2KX3 A;  5KG4 A;  4BXO A;  2CJO A;  3Q8R B;  5FR6 A;  3VR8 B;  1WGR A;  2VA8 A;  3KKA C;  4WJN A;  4ANV A;  3Q3M C;  3B08 A;  5J0Y A;  3NS8 A;  3ZUN A;  1STE A;  9ICR A;  3C21 A;  1WX7 A;  5KHQ A;  5H92 C;  5ALU A;  4KDI C;  3KHL A;  4W9F A;  3F2C A;  4HAI A;  3SU8 X;  1L4Z B;  3C0R B;  4PGQ A;  2K4I A;  3VH4 B;  1QCK A;  1EO6 A;  1GNU A;  4NLN A;  2N7E A;  2KNJ A;  2M17 A;  4OO1 J;  2XK5 A;  4JLC A;  4OZB A;  4NY8 A;  5D94 A;  8ICL A;  3GIL A;  2BVC A;  2LUM A;  4RGO S;  5KFL A;  5G2N A;  4G9B A;  2WU2 B;  2DHZ A;  4O3P A;  3N7S C;  4IM2 A;  1WGH A;  3CWI A;  5AM5 A;  1V6E A;  1WMH A;  1YX6 B;  3U30 A;  1RYR A;  1T3Q A;  2XI9 A;  3TAQ A;  9ICP A;  3N4M B;  4ZOH C;  3WK8 A;  2Z8L A;  3ZKJ C;  4BKS A;  4KX3 A;  1NJY A;  1K53 A;  2W9B B;  3UXP A;  2BS3 B;  4EUT A;  2B3A A;  1DGS A;  1RZT A;  1WWV A;  4DEZ A;  2C9W B;  4UB6 U;  2JUO A;  3QZ7 A;  2W55 A;  3BII D;  3Q8B A;  3H0R B;  5ALE A;  3HW8 A;  2R8G A;  2Q4T A;  1L0Y B;  1BNP A;  2K6Q A;  5E6J A;  2R8I A;  2TSS A;  4XRH A;  4HVB A;  2MUT B;  3IAS 1;  4C80 A;  3KTQ A;  2NPT A;  2GRI A;  4PHD A;  4HDO A;  1ET6 A;  3H0M B;  2KN7 A;  3HPO A;  4CCH A;  2PEA A;  1PGB A;  2BYE A;  4IW0 A;  8ICW A;  4I2I A;  3DWG C;  4IWP A;  3W1S A;  5EOZ A;  3Q8S B;  2NVU I;  4BBN C;  4BWM A;  1V86 A;  2XNA C;  2EZZ A;  2MBH A;  5AIB A;  1ZQP A;  2KDE B;  2BKF A;  1JMS A;  4YSY B;  5DQI A;  4M9J A;  3HIZ A;  3PW7 A;  2PLP A;  2DAF A;  3B9J A;  4Z6D A;  4GN1 A;  3PRE A;  4KN4 A;  4QZ9 A;  3KUD B;  2DQN B;  3ZQ4 A;  2KHV A;  1YMH E;  2HOQ A;  5EWE A;  3V7K A;  1PUT A;  3NY5 A;  2BS4 B;  5K4L A;  2D3A A;  2FUH B;  1ZPS A;  4DFP A;  1WSP A;  2NTS A;  4CO7 A;  3RT3 B;  3P1M A;  2G4D B;  4YL8 A;  4M47 A;  3VTU A;  5KFF A;  2MX2 A;  3PR5 B;  4MEL A;  2KTF A;  1WM2 A;  5J0O A;  5CA7 A;  4O3S A;  1HTO A;  5DPW A;  2R2Q A;  3RFA A;  3QX1 A;  2ZJA A;  2HBK A;  4OD0 A;  4QZ8 A;  3SV3 A;  4FO6 A;  1OEY J;  1UEL A;  2KC2 A;  1D3Z A;  2LXA A;  4HCP B;  3UQA A;  1TVA A;  1WE6 A;  1KN5 A;  4NNJ B;  3VRB B;  4YVZ A;  4AP4 C;  1LV5 A;  1VZ8 A;  2JPH A;  4A55 A;  3JW0 X;  5J0W A;  5ALQ A;  1ACC A;  5HML A;  5G5H A;  4M2Y A;  2WXF A;  1SGG A;  2DKX A;  4ED1 A;  2N7D A;  1FCL A;  3ENE A;  4F5O A;  2QB1 A;  4TUQ A;  1JWM D;  2CHX A;  1NOM A;  4RGM A;  3K9P B;  1MC8 A;  7ICF A;  3B0Y A;  4YSZ B;  4C8M A;  4K4G A;  1F1H A;  4QZG A;  1YJI A;  1UQV A;  2F77 X;  1YN5 A;  3GIJ A;  5IO9 A;  3D2N A;  2BPF A;  1JCK B;  9ICS A;  2KLG A;  4R8U A;  3V6K A;  1MVK A;  4C00 A;  1KF6 B;  4YQW A;  1WX8 A;  4P4O A;  3U4E G;  2BCR A;  2KMC A;  3QXG A;  2D3B A;  3BS5 B;  2FBW B;  1KTK A;  3I9V 1;  3AXC A;  4OHJ A;  1TS2 A;  3T3F A;  4DCC A;  2K25 A;  3D2Q A;  3A1Q A;  2QAR A;  3AE5 B;  4UB3 A;  1NK0 A;  1C76 A;  3IG5 A;  2WXH A;  3N1Z C;  4JWU C;  3ZXR A;  2YLM A;  1X9W A;  4F1S A;  1NZB A;  2LD9 A;  4C4V B;  5BMI A;  4DBG A;  4DFJ A;  2ZJD A;  9ICC A;  3TAD A;  4KX5 A;  3Q8M A;  1X6I A;  3PSF A;  3L4P A;  4B0M A;  4BKS D;  2RDJ A;  2W9A A;  1OXJ A;  2FMQ A;  8ICT A;  4PHE A;  2EAP A;  7ICU A;  3ZRC A;  1ISN A;  2WXM A;  3F2B A;  2KD0 A;  2XY6 A;  3CRX A;  1K51 A;  1SJE D;  1DOQ A;  4BGD A;  4DSI A;  4G0N B;  8ICE A;  2KYW A;  4QAY A;  2L5Y A;  2XGP A;  4ED0 A;  8ICA A;  1ZOL A;  4KKJ A;  4LLG M;  2KQ7 A;  2KIC A;  3R66 C;  4GXB A;  1C3T A;  1B43 A;  9ICQ A;  2KWC A;  4J9R A;  1WX9 A;  2YN4 A;  1NK7 A;  3E56 A;  4LNF A;  2RLT A;  3C8Y A;  2MBE A;  3GDX A;  3Q8P B;  4Q44 A;  3RBD A;  4E71 A;  4EOY A;  2I2Y A;  1V9P A;  3SEI A;  5KNI A;  2EAO A;  4OJ5 A;  3QAR A;  4I6L B;  2ACZ B;  2WAQ F;  5AKX A;  2J6T A;  2ZJ8 A;  3AM9 A;  2BCQ A;  4EZL A;  1Z3E B;  1SE4 A;  3LWM A;  5C0Y A;  5IA7 A;  1ZD2 P;  5DLG A;  1FMA D;  4P7I A;  3TL5 A;  1JRP A;  2GLS A;  3T8M A;  4BZA A;  2A19 A;  3KBB A;  3T9L A;  1WJ6 A;  2F1J A;  3VCB A;  1MJD A;  4M01 A;  2KSO A;  5HMM A;  4YSX B;  2W8L A;  2DX5 B;  2UYZ B;  1WZ0 A;  5C1Z A;  2ON8 A;  4M9H A;  5AI5 A;  5BYR A;  5DBB A;  2W9M A;  3ABV B;  2VA2 A;  4I2G A;  1PYW D;  4M02 A;  1I35 A;  1MQ3 A;  4IL6 U;  5FP0 A;  2HTM E;  5AKY A;  3I5J C;  1CK1 A;  1ZUD 2;  3M63 B;  2ZUB A;  1WGK A;  1IP9 A;  3C2M A;  5E6N A;  4NJ7 A;  3NZS A;  3SEN A;  2DPJ A;  3Q8A A;  1FXT B;  4LK0 M;  4Z6E A;  2J6U A;  4W9E A;  2KP7 A;  4PK1 A;  4W9C A;  3H1U A;  2IO1 B;  4KLH A;  9ICN A;  2DLB A;  2HI0 A;  1NKE A;  2MW5 A;  4FFD A;  1AWD A;  2L32 A;  2J52 A;  3B0X A;  4OJL A;  2LAS A;  4GDL A;  5C3J B;  4EEN A;  3QYP A;  4F71 A;  1TBE A;  2YVC A;  2Z59 B;  4QWB A;  1HA5 A;  1VZ6 A;  9ICH A;  4LJX A;  1WGY A;  4OCZ A;  3SAG A;  3EHV A;  3RZW C;  3Q69 A;  8ICZ A;  3VXW A;  1TE2 A;  1JAL A;  5KFM A;  3QA8 A;  2MBO A;  2AL6 A;  3PZ8 A;  2KQS A;  4DXF A;  3DDH A;  2BCU A;  3MR3 A;  1C9F A;  3W2D A;  1JIH A;  2N9K A;  2EQY A;  2DAJ A;  2W03 A;  2ESE A;  2BPC A;  2PTL A;  2ZIX B;  3PW4 A;  9ICF A;  4EFO A;  2KE7 A;  2CRX A;  7ICP A;  4G50 A;  2BYV E;  1JUD A;  5KG5 A;  4PL1 A;  4NLC A;  2K22 A;  4KLT A;  1VRA B;  3ZD8 A;  1D8B A;  1ZP0 B;  2HTH A;  5KFA A;  2KX0 A;  4MSM B;  5D3I B;  2R61 A;  4I27 A;  4DL4 A;  4M8M A;  4PGX A;  1XSN A;  3TKA A;  1R4N I;  1AQ6 A;  3DQV A;  4GXI A;  4NQL B;  4DHJ B;  5DG7 A;  1AN8 A;  3U7Z A;  5AI6 A;  3V61 A;  1QTM A;  3R8B A;  2DPI A;  3TCA A;  3AI5 A;  5EE0 A;  2QEJ C;  4NQK E;  3C5G A;  1J2N A;  3JPN A;  4QZE A;  3RZF A;  2H3F A;  1S0V A;  1KJT A;  4LJP B;  3H7P B;  5D2M B;  7ICQ A;  2K9X A;  2OCE A;  4ZYS A;  1WCL A;  1TKE A;  2XN9 C;  5T14 A;  3GQC A;  5G55 A;  3W1Y A;  4AQ7 A;  1GAQ B;  2ONQ A;  2VJ4 A;  3TAR A;  5ALO A;  1SXT A;  5JH5 C;  1OEY A;  2WXP A;  5AK6 A;  4DHZ B;  4E0D A;  3RH4 A;  3I3T B;  2NPT B;  3RNE C;  2H89 B;  4ED7 A;  2KDB A;  1QQ7 A;  5J2G A;  1E7V A;  2FPL A;  4TUP A;  2EKI A;  1S0O A;  3RFZ B;  2OWO A;  4I2H A;  1QZE A;  3TEX A;  4NLB A;  3QUB A;  2XY7 A;  2FPM A;  4NL9 A;  2O6V A;  3MJW A;  1IV8 A;  2KXJ A;  5KFV A;  2BKE A;  3UQ0 A;  1QF6 A;  4A90 A;  5MPO A;  1LM8 B;  3C1Y A;  4ECT A;  4XWW A;  2XVT A;  1I4X A;  4J9P A;  3G6X A;  4MHV A;  3PRZ A;  4LNI A;  5CHV C;  1EF1 A;  2MJ3 A;  3HKZ F;  4UAU A;  1L3V A;  1F52 A;  2LM1 A;  1WXS A;  4C8N A;  3S6J A;  1ROE A;  2QB0 B;  4QWE A;  1D9D A;  2IBK A;  3L5K A;  3N20 C;  4DLE A;  3R2I A;  3WKD A;  5IIK A;  3QE9 Y;  2KAJ A;  5HHI A;  4YMO A;  3AEF B;  5HKH A;  2WHI A;  2XCP A;  1S1Q B;  2ODG A;  4GC6 A;  3ETL A;  4FZN A;  4CDG A;  5HHH A;  1NI2 A;  1SE3 A;  5JHA A;  1WJU A;  2K5P A;  2EMS A;  5DGA A;  3PT2 B;  4I2A A;  4RQ7 A;  4WIP A;  2UVV A;  1X42 A;  3TAD C;  4RGT A;  2KIV A;  1MQ2 A;  1BUI C;  1C4C A;  5GTI U;  4KIT B;  2OEH A;  5ALH A;  1HQR D;  1V1P A;  2SAK A;  4J9Q A;  1T8E A;  1JXL A;  3H40 A;  2KZM A;  1WI0 A;  4P1C C;  1ZRM A;  3D2S A;  4XDD A;  1YQ3 B;  5HI1 A;  3TEY A;  1DOI A;  2IA6 A;  1HZ6 A;  4UB4 A;  3C19 A;  3EEC A;  4K3B A;  3NVY A;  2F2A B;  2FMS A;  1E8Z A;  4XE0 A;  3TAP A;  1OQQ A;  3RBE A;  3M9M B;  1SKW A;  1KM7 A;  4LVS A;  2HHW A;  3IFW B;  4TQ1 A;  4GC7 A;  3IDW A;  4KSK C;  1KRH A;  4DQP A;  4KMO B;  1T94 A;  1N63 A;  1LVH A;  5E79 U;  1P7D A;  3AUL A;  3Q3F A;  1B9R A;  1IBX B;  4IQT A;  3RJE A;  3SQI A;  2FID A;  3Q3J A;  3NRZ A;  4F92 B;  2MUT A;  2DZK A;  1VLB A;  2CU1 A;  1BT0 A;  3VUY A;  5AZF A;  4J03 A;  2ZUD A;  5BOM A;  4MM3 A;  2EAM A;  3V72 A;  1T3N A;  1U49 A;  2G45 B;  3EFC A;  5JHB A;  3V6C B;  2E8M A;  3HT3 A;  4NJ8 A;  3ZD9 A;  2HHV A;  1P9D U;  2D5G A;  3QK0 A;  2WXI A;  3AV8 A;  3V7J A;  3A1Q B;  1YZ7 A;  2BB5 A;  3MHS D;  1WRI A;  4EEW A;  7ICT A;  3KD3 A;  4A6Q A;  4K7S A;  4J9N A;  3UGB B;  5DCN A;  1D5Z C;  2REX A;  1XD3 B;  1RYJ A;  3Q6B A;  2FLP A;  4N59 A;  1VZ7 A;  4M6W A;  1E10 A;  1KFS A;  2MBB B;  2IY1 B;  3L3F X;  1AW7 A;  1A70 A;  4K3C A;  3L17 A;  4DFD A;  5BYQ A;  4A20 A;  5D49 A;  4O3Q A;  2AU0 A;  3EC8 A;  4HJG E;  3V62 A;  1S10 A;  4BUG A;  4B9N A;  4PYZ A;  3ZDA A;  2Y9T A;  3H8W A;  5AI8 A;  4GXJ A;  3QEA Z;  1UGM A;  2QIL A;  4EBD A;  4P16 A;  4WJO A;  5KL1 B;  3M8S A;  1COO A;  4MH8 A;  5KT2 A;  3ZNG C;  2VZK D;  3N1Y C;  5EWG A;  1ZQL A;  2WXO A;  8ICU A;  5FK9 C;  3DEE A;  2RPQ A;  3L54 A;  4ZDV A;  3A33 B;  5KG3 A;  1I42 A;  2WX0 A;  2B0C A;  1ZQN A;  3ZNH B;  1KFT A;  1XO3 A;  1KKX A;  4BFR A;  1SZH A;  1KBU A;  5ALZ A;  3FYH A;  2OXO A;  4KLQ A;  2O6V D;  5KFZ A;  2JV3 A;  5AIC A;  3HVZ A;  3NJT A;  3DV9 A;  2AHO B;  3ALR A;  2LI6 A;  4JWM A;  4KGT A;  4WWO A;  2E8P A;  1G6J A;  4M8N A;  4ECZ A;  2CS4 A;  2I6X A;  2V0G A;  4JB3 A;  2V4R A;  2EDU A;  3AMZ A;  3RJJ A;  2BWF A;  4GFJ A;  4KLS A;  1L6U A;  4KGS A;  1BPY A;  3SMV A;  3IG8 A;  3JPT A;  4F91 B;  4ACF A;  2JRZ A;  2MAX A;  1ZYQ A;  3VFK A;  1ZQM A;  2DF4 B;  5AKZ A;  5III A;  4XGA B;  2KZ3 A;  2YML A;  1PDX A;  1RDF A;  4RM9 A;  3PTF C;  3BS5 A;  3H8M A;  1VJK A;  3BVM A;  4I2F A;  5KFW A;  3AUO A;  4JL9 A;  4URK A;  3RJH A;  2WAQ C;  2Z7J A;  9ICM A;  1IPG A;  5L9X A;  2RRD A;  2Y5B B;  4XYC A;  4QIW F;  1IUE A;  1FXI A;  4C4V A;  4ZRJ A;  3HUI A;  4UB2 A;  2YMQ A;  1TK5 A;  3AU4 A;  3P63 A;  1XC9 A;  2N0S B;  4AWJ A;  5KT7 A;  2KC1 A;  4RQ2 A;  2C28 A;  1JWA D;  1SV4 A;  2F8K A;  1KW4 A;  2A1J A;  2WXJ A;  1KQQ A;  5JUM A;  5J0R A;  4UBB A;  5ALX A;  3UM9 A;  3P2B A;  2CU3 A;  1L0X B;  3MDA A;  2DZM A;  2BQQ A;  1U45 A;  2WWZ A;  3RCZ A;  4RQN A;  3ZLZ A;  4RQ0 A;  1HUZ A;  1A77 A;  4US9 A;  2LRW A;  3ZTC A;  3BVZ A;  1TAM A;  1L7Y A;  2BR0 A;  4N9F 4;  4F2R A;  5CHF A;  2JX5 A;  1FO4 A;  4TUU A;  1ZDX A;  2AQ1 B;  2R18 A;  3TAC B;  5CHG A;  4W9I A;  3Q8L A;  1PK3 A;  2LGS A;  1H4R A;  1L2N A;  8ICN A;  2I1J A;  4PGY A;  4EX7 A;  1NJW A;  2XEW A;  4G11 A;  5D7G A;  2A5U A;  3GIM A;  1L6N A;  1JI7 A;  1QQ5 A;  2XIC A;  2WFA A;  3H4D A;  4DSE A;  2KJR A;  2WLB A;  5JZE B;  3NVV A;  2OYY A;  5ALP A;  4R66 A;  2LYB A;  3K4G A;  2NRV A;  4UDU C;  3RB3 A;  3GFK B;  2JZZ A;  3TIX A;  1SV0 A;  4B9U A;  2HHT A;  3GV8 B;  2LYA A;  1BPX A;  5DDM A;  2E1F A;  1T6B X;  2H3Z A;  1MI0 A;  5ALV A;  5KHO A;  5G5G A;  4ED8 A;  2LVO A;  3UXO A;  4NWI A;  9ICX A;  1E8W A;  2JSV X;  2VZK B;  1SKS A;  1RQN A;  3PST A;  5J8Y C;  4IUM B;  3PZP A;  2C5L C;  4B9T A;  4TKN A;  5IP4 D;  3NGD A;  2AEH A;  1HXY D;  1A5R A;  3LXF A;  4USA A;  1VCB A;  5C23 A;  1FFU A;  4JV0 A;  1N61 A;  3R7Q A;  3WU2 U;  1S0N A;  1NKC A;  4GIV A;  4KMU A;  4JX1 C;  5FR3 A;  2GBR A;  3C5F A;  4IKG A;  4EKU A;  4RU9 A;  2Y5C A;  1QLN A;  4KLI A;  4MGZ E;  1NYQ A;  4IRD A;  3GB1 A;  3PLV A;  2MH7 A;  3KZX A;  2E1E A;  2AGQ A;  4TV3 A;  1FM0 D;  5LNK 1;  2ALZ A;  2LI5 A;  4CF5 A;  3VDZ A;  3MTN B;  2IZV B;  2HJ1 A;  5KG1 A;  3GS2 A;  2GO7 A;  3QX7 A;  2VH2 A;  1J19 A;  1GB4 A;  3MGH A;  1FRR A;  5DPT A;  1ZQZ A;  3QUQ A;  4WWM A;  3Q8Q B;  3PX0 A;  1KFY B;  4KLJ A;  1UWM A;  3N28 A;  2W8K A;  4I2D A;  3L16 A;  4O3M A;  2M1M A;  1MHX A;  2LRU A;  1L5U A;  2D07 B;  1ZQR A;  2ZIX A;  4UAW A;  2UVW A;  3Q2A C;  3I76 A;  4YD2 A;  1Q10 A;  5ALG A;  2BF8 B;  4YXM A;  4FXC A;  4JPS A;  3PSE B;  2NBU A;  4F4W A;  3U52 E;  1V1P B;  1UD7 A;  3UQ2 A;  3GZN B;  4ASW C;  5JTI A;  2MSE D;  2J7Q B;  1NEK B;  2K1F A;  1V97 A;  5C5J A;  5AI4 A;  3HKZ C;  2NRW A;  1YOV B;  2MRL A;  1CUK A;  1QQR A;  3KOO A;  3RH6 A;  3T5H A;  4IM0 A;  4UB1 A;  2ATL A;  3N30 A;  2PKE A;  2JXT A;  3PGE A;  1X9X A;  2QKQ A;  4CNQ A;  2JXX A;  5ALW A;  4MEX A;  4DOA A;  1SE2 A;  1UT8 A;  3CMM B;  3H7P A;  3OHA A;  4LDT B;  1S8O A;  1SWW A;  2N9X A;  1HUO A;  3BY4 B;  3DHH C;  3URY A;  3K1R B;  1HEK A;  2WXK A;  1KOT A;  2L76 A;  3SD5 A;  5B66 U;  2EEL A;  4RPY A;  1F9J A;  1QOA A;  3CSF A;  2AGP A;  5H8Y E;  5J18 A;  4RUC A;  2F8L A;  4MM3 B;  1SKR A;  4S0R A;  5J2A A;  1OUQ A;  4MFF A;  2LMC A;  3Q8K A;  4G3I A;  2XGQ A;  8ICY A;  1QOF A;  1N62 A;  2NS5 A;  5GMV A;  1F0Z A;  1UUP A;  3N1X C;  2IJ0 A;  3H9D A;  2W9C A;  4RNM A;  4TQ0 A;  5AKG A;  3B1L X;  2N9L A;  2JXJ A;  1ZQE A;  1GB1 A;  1WY8 A;  4FS1 A;  4M6W B;  4NXZ A;  3PVL A;  4F4Z A;  3JPR A;  3ZIM A;  4XUS A;  4B95 A;  3PO5 A;  2QB0 A;  1L7N A;  2NTT A;  3GV5 B;  2LGX A;  2M8S A;  3APD A;  2FNJ B;  3ML9 A;  3VQI A;  4WWP A;  1JW9 D;  3GZN I;  8ICI A;  4YD1 A;  1QSL A;  3ISB A;  3T5K A;  4C4S A;  4ECX A;  4HJK A;  3TBL D;  3NHE B;  2JYT A;  2KLC A;  5EE1 A;  3ZNI D;  1NJX A;  3U26 A;  5KT6 A;  1NVI D;  5J2E A;  2IOH A;  5J2K A;  2K8H A;  3KYD D;  2G0A A;  2VKQ A;  2RDB C;  1ZE3 D;  4MSQ B;  4OZC A;  2LEK A;  2Z0D B;  1MG8 A;  2I9G A;  3V6J A;  1TY0 A;  4NV0 A;  5CRX A;  2G08 A;  1LXD A;  1ET9 A;  1O08 A;  5GXG B;  1KLG D;  4PZN A;  3B2G A;  5KG0 A;  3NZ3 A;  1DXS A;  2IO3 B;  1L7M A;  3IT4 B;  3OTQ A;  1D6E C;  3ISC A;  3MC1 A;  1CEZ A;  1NK9 A;  3KLS X;  3IM1 A;  8ICJ A;  8ICX A;  4LNK A;  2OH2 A;  1RXV A;  4L23 A;  4PHA A;  1YQB A;  3MDC A;  2JY6 A;  1ZQH A;  1Z00 A;  4QZC A;  2WDQ B;  2JZB B;  4MGY E;  3CF6 E;  1Q3V A;  3SEB A;  3PRP B;  1L6V A;  2INN E;  1E7P B;  5HG2 A;  3HIL A;  2IMW P;  1IBX A;  3M9O B;  4HXD A;  1YNT E;  5JXV A;  3JSV A;  5AI9 A;  3UMG A;  1OGW A;  4QW8 A;  5KFK A;  3T5J A;  3RAQ A;  3OJU A;  2IHN A;  1RXW A;  3KWV A;  2WF6 A;  1JXE A;  1S76 D;  1FIQ A;  1SIJ A;  3MAB A;  1CJE A;  4FAD A;  3M95 A;  1BVS A;  1URJ A;  5J2H A;  4XA5 A;  2KQ4 X;  1D5X C;  2E8O A;  3WK9 A;  1PVR A;  3MR5 A;  1R4M B;  3AH7 A;  3ALB A;  5KAF U;  5DB7 A;  8ICG A;  3SFE B;  3AE1 B;  1E5W A;  4RQ6 A;  1KLN A;  3I28 A;  5D46 A;  3O65 B;  1DK3 A;  1JRO A;  1V2Y A;  5KFI A;  4HPM B;  2IYD B;  3ZDC A;  3JPP A;  3NRW A;  4AJY B;  2A1A A;  4DHJ D;  3KWL A;  2NO4 A;  3W5V B;  4CF4 A;  2A1J B;  3M3J A;  2L52 A;  3AU2 A;  4JUZ A;  1PGA A;  3VVW B;  2A3V A;  3QUC A;  1ZJM A;  1V9J A;  9ICB A;  3AEC B;  4NAM A;  4ARC A;  4N6E B;  3GE8 C;  4US8 A;  3TFR A;  1NKB A;  4P0Q B;  1DOX A;  2LYH A;  1XLP A;  2SEB D;  1EWY C;  2N1R A;  2BTE A;  3WCQ A;  2DYO A;  2LWP A;  2VAN A;  1KRP A;  5IIN A;  2K4H A;  1EWC A;  2LVP A;  3SHQ A;  3MBY A;  4B9V A;  1C77 A;  1SEB D;  4MAC A;  4L2Y A;  3V60 A;  4NLG A;  2KJH B;  3C28 A;  3CIR B;  1MSW D;  2JMG A;  4RF0 A;  1NK4 A;  3AE9 B;  4R3D A;  3NS1 A;  3AU6 A;  2JWZ A;  4QIW C;  4LNN A;  4C7Z A;  1L4D B;  2E8N A;  4RNA A;  1FD6 A;  4FE3 A;  2GOL A;  2XO7 A;  2G4S A;  4PS7 A;  4YP3 A;  1V81 A;  2FI1 A;  3L10 B;  3RJI A;  4JWN A;  2N9E B;  4DL7 A;  4KLM A;  2F3N A;  2YTU A;  1SL0 A;  1L8O A;  1F44 A;  2AWT A;  5L1K A;  3DBH B;  3JVZ X;  1L5P A;  4QJF B;  1TFR A;  4X5V A;  5EWF A;  5LXI B;  4QZB A;  4TUR A;  5J17 A;  5AIA A;  1R4M I;  1LB2 B;  2Y9U A;  4PL2 A;  3GIK A;  4UAV A;  5J2B A;  1F2R I;  7ICI A;  2KMM A;  4UAR A;  4QWD A;  2R2O A;  3DWM A;  3CNH A;  4C4R A;  1QIL A;  3EA6 A;  4CE6 A;  4FUL A;  4B6W A;  2AQ0 A;  4KLG A;  5HNK A;  1R4N B;  5KFU A;  3GE3 C;  5J2F A;  1WXV A;  1KH0 A;  1RG6 A;  4LCD E;  3UXN A;  2W7O A;  1SSN A;  1YN3 A;  3ETR A;  1WJN A;  1KLU D;  3QUT A;  4W9D A;  3PZD A;  2KVS A;  2PVG C;  3VAW A;  4O3O A;  4Y2J A;  5DB9 A;  2PMV A;  2H88 B;  1WRD B;  4YG2 A;  3IT6 B;  3LVV A;  5D3D A;  3EWA A;  7ICL A;  3MHZ A;  3BIN A;  3LYY A;  4MFA A;  3NOB A;  2WF8 A;  2ZW0 A;  4JMU A;  5KFT A;  1Y8R C;  3AEG B;  5AHX A;  1JWS D;  3H8J A;  1QOG A;  4FLH A;  4HDQ A;  2IPK D;  3AE4 B;  2BW2 A;  4A3O A;  4I28 A;  4GGQ A;  2D3D A;  2N1V A;  4JV1 A;  4ANW A;  7ICN A;  3W1S C;  3UF8 A;  2AQ2 B;  5EE3 A;  5KFY A;  1ZQO A;  5DBC A;  1E7U A;  4FJY A;  5HR6 A;  4IOI E;  4B9L A;  5B5E U;  4FS2 A;  3QU7 A;  1J2M A;  7ICG A;  4R63 A;  4DQQ A;  1XWL A;  2NR2 A;  4FZM A;  1MG4 A;  3DBH I;  4O1N A;  3VC8 A;  2Y5P A;  2WTF A;  5KFJ A;  8ICP A;  4KDL B;  4II2 B;  1K1Q A;  3QC8 B;  2WXN A;  3RTV A;  4M9L A;  2W7P A;  4ECS A;  5KFC A;  1P3Q U;  3P4R B;  4UAZ A;  2VH1 A;  5TIS U;  4HWI B;  4DK5 A;  1PK1 A;  4DF8 A;  3BVG A;  1BPD A;  4C56 C;  3ICX A;  3MFI A;  3K75 D;  4RFB A;  3RB6 A;  1S77 D;  4W9J A;  2H3I A;  2WDR B;  4Y2Q A;  1IM4 A;  4RZR A;  2KWV B;  4D2K A;  2HCF A;  2F44 A;  4DSL A;  2FMP A;  4PJ0 U;  1HJP A;  4ED2 A;  4DSF A;  1A6S A;  4UAS A;  2IND C;  1EU4 A;  5DPS A;  4NJ6 A;  1PGX A;  1XEE A;  1ZQU A;  3PZ7 A;  1TKY A;  3N32 A;  4OJ6 A;  2L8J A;  3MC0 B;  2BBC A;  2KTR B;  2K4E A;  3KFU F;  4HLE A;  5L1J A;  1S3S G;  2YX8 A;  2EZY A;  3KQ4 A;  1NYR A;  1BPZ A;  4KLF A;  4MJS B;  4N58 A;  4XX5 A;  1PQS A;  2AH5 A;  3NVZ A;  2C7N B;  1X6J A;  4IWQ A;  2KOX A;  2W9C B;  2XY5 A;  5CHW A;  4YXD B;  1RFA A;  4F4Y A;  2MHJ A;  3SI8 A;  4NLK A;  4DOC A;  1I4P A;  3E0F A;  3SR6 A;  4TMA B;  3DVG X;  1E9M A;  4FHJ A;  7ICK A;  1XLN A;  1K52 A;  1L0V B;  3QU4 A;  5BO4 B;  1J97 A;  1J7B A;  3HP6 A;  1TT5 B;  3HK0 A;  2JRH A;  2EZX A;  3ZDT A;  2KFN A;  3K1Z A;  2ZXH A;  4ECQ A;  1MPE A;  1J8C A;  4FA6 A;  4CQN A;  1IGD A;  1RYU A;  1KSP A;  5ALS A;  1K5O A;  2PFP A;  2GBM A;  2BWE S;  1UA1 A;  2ZIU A;  3BWU D;  4NPN A;  2MEK A;  2ZW1 A;  4DFM A;  3ORY A;  2JEJ A;  4O5C A;  5L95 C;  4ELU A;  2AGO A;  3JPQ A;  1D8L A;  2JEF A;  2IOF K;  5KAI U;  3IN5 A;  4F72 A;  2BYF A;  4KX6 B;  4J3O D;  1N48 A;  2JGA A;  1WFY A;  3HRD D;  7ICV A;  2WNM A;  3W5U B;  1TJE A;  3VTW A;  2ZPY A;  3JPO A;  1ZOY B;  2KKC A;  5DB6 A;  4Y2V A;  3BK2 A;  4R65 A;  3OG5 A;  5IOI A;  3A4R A;  1IYF A;  3QU5 A;  3AEV A;  2K8C B;  1ED1 A;  3N7R C;  8ICR A;  1YT3 A;  1CI4 A;  3PW5 A;  4F2S A;  4GIB A;  2L7R A;  1RM6 C;  2W82 A;  5AEK B;  3PSI A;  2BQR A;  2JWU A;  4J9K A;  2L0F A;  4YT0 B;  3IV6 A;  3EPI A;  4Y2Y A;  8ICH A;  4K7W A;  4ZRP A;  3ZVV A;  4OZA A;  4KLD A;  2KZR A;  5DGB A;  3AB5 A;  1NI3 A;  4ED6 A;  4M9N A;  1FNW A;  2ZNV B;  5KT4 A;  1WWU A;  4QZF A;  3WKC A;  3ZJU A;  1KL9 A;  1C79 A;  3S2A A;  4DDG D;  3TSS A;  2KZZ A;  7ICJ A;  1Z00 B;  2K0P A;  1SWV A;  4HK2 A;  1LFD A;  4H2A A;  1LQB A;  4NM1 A;  2AQ4 A;  4K81 A;  3F5E A;  2UVR A;  4UQG A;  2WF5 A;  2ZCC A;  4WQO B;  3BS7 A;  1EF5 A;  3M9N B;  2LHT A;  3MC8 A;  3TEZ A;  3I63 C;  3JSV B;  3U7D A;  2FLN A;  4DFK A;  2JRI B;  2MLB A;  3RJF A;  3NZU A;  4UAY A;  8ICB A;  1NEN B;  4W9G A;  3RUI B;  1TAQ A;  3KHH A;  4EBE A;  2DL0 A;  2HBM A;  3MGV A;  1TKG A;  4IR9 A;  2N1W A;  3D32 A;  3RJG A;  4XQ8 A;  2LFI A;  2V3N A;  4WJ3 B;  2KAC A;  4BKT A;  5CWR A;  5ALI A;  1ZW7 A;  4B0E A;  2WXL A;  4ECR A;  4QZD A;  1V49 A;  3IP4 B;  2YEP B;  2ZEQ A;  3DVN V;  4P4M A;  4QW9 A;  4J6I A;  4PS3 A;  5ALN A;  3DVG Y;  3GOE A;  3ONS A;  1ARO P;  2WF7 A;  3KHG A;  2BPG A;  1L7O A;  4HKZ E;  5KFP A;  1ZQI A;  1YQ4 B;  2PE9 A;  2JHD A;  8ICC A;  2D3C A;  3DHG C;  3DBS A;  3QZ8 A;  5AI0 A;  4MGI E;  2JQR B;  4C8O A;  1U9L A;  1XXG A;  1D8Y A;  3DBR B;  1J7C A;  3N3K B;  8ICF A;  4ZHO A;  2QLT A;  3JYU A;  3AQE A;  3UQB A;  3E58 A;  3WIM A;  2RP5 A;  4P1B C;  3ONN A;  2G09 A;  4M9G A;  3ZDB A;  2W9N A;  5CB1 A;  4PS8 A;  5ALK A;  2O2V B;  4F5N A;  5KFQ A;  1D5M C;  1FNU A;  5AM4 A;  3UMC A;  5IIM A;  1SGH A;  4AS1 A;  2WB1 F;  2DEN B;  2DWQ A;  1ZD4 A;  2G5I B;  5F3X B;  2BCS A;  4K7U A;  1Z1B A;  3RI7 C;  4RT3 A;  4F5Q A;  1JWU D;  3KYC D;  3EW9 A;  3PML A;  5KFO A;  3IAM 1;  2RDI A;  2HHS A;  2WDT B;  2I1K A;  2ES6 A;  4DQR A;  2WHE A;  3I1Y A;  5HR7 A;  2E5S A;  4P6V F;  2M0A A;  1FCC C;  1LO5 D;  1UGJ A;  4DSJ A;  1JML A;  1Z1V A;  1RFK A;  2GBJ A;  2JEG A;  3TJP A;  5AKI A;  4ANU A;  2KG5 A;  5KFX A;  3IG3 A;  4K1R B;  1WUD A;  2G06 A;  9ICK A;  4P2H A;  5KG7 A;  3FM9 A;  5F9N A;  4B9M A;  4RQ8 A;  1F77 A;  3CW2 C;  3AQF A;  2ZJ5 A;  1Q0W B;  4OVV A;  2YMP A;  3RUL A;  4UW9 A;  2JEI A;  4MEY A;  3OJS A;  1Z4N A;  3P4S B;  2JZB A;  4BJQ A;  2L00 B;  4ARI A;  4TQR A;  2ZPN A;  3AE7 B;  2LVQ A;  2GB1 A;  4IQV A;  3DOW A;  4FHK A;  4A9A A;  3T79 A;  4RQ1 A;  1VDV A;  1QKZ A;  4QWA A;  2NCN A;  2Y3A A;  4KV2 A;  3O0F A;  3X23 A;  3DBR I;  4FJZ A;  1XO1 A;  3WK7 A;  2M19 A;  2E3T A;  5HHD G;  2DGZ A;  2JH7 A;  2XCA A;  3HJE A;  3WKE A;  2OED A;  3BQ1 A;  4WUR A;  5FKA C;  3P4Q B;  5IN7 A;  3RNB C;  4WH4 A;  1C4A A;  4DQS A;  4EEK A;  3ZDE A;  1IIP A;  5JRT A;  4DO9 A;  3SAF A;  3U2S C;  1UT5 A;  3UIP B;  3QCA A;  3V6H A;  4O0I A;  2LPE A;  1QOB A;  8ICS A;  1QSY A;  4F8R A;  2BT6 A;  2MCN B;  4U6P A;  3ZDD A;  4GB9 A;  4NZL B;  3VH3 B;  4ANX A;  2C2D A;  1JQ4 A;  2KV2 A;  3MJ5 A;  3OAW A;  3T3O A;  3PO0 A;  1OW5 A;  1BPE A;  4JWS C;  2PFQ A;  5DB8 A;  3DPD A;  3EYZ A;  3H8H A;  4GLX A;  2HHU A;  2L0T A;  4A8E A;  4LDT D;  2J53 A;  4NL9 C;  3TAN A;  3A0H U;  4P0Q A;  3WKA A;  3OWE B;  1S9F A;  3AU5 A;  3LK9 A;  4NAW A;  8ICK A;  3ZYY X;  4ELT A;  2NRT A;  1RWS A;  4ZYN A;  1B4F A;  2KVR A;  5KFG A;  3ZXV A;  5ALD A;  4Q43 A;  1E8Y A;  2L05 A;  1B1Z A;  2M0X A;  1PK1 B;  1UH6 A;  4EZK A;  1Z4O A;  1S0M A;  2KAN A;  1WM3 A;  3RMK C;  3WAN A;  2EMT A;  1WZ3 A;  1CQV A;  2ZCB A;  2PFO A;  3TUO A;  1F5S A;  2C7M B;  2IO0 B;  9ICW A;  2DZI A;  4XZ4 A;  1GPX A;  4FBU A;  4O5E A;  1Q1O A;  3FDS A;  3AE6 B;  3HVD A;  2G5H B;  4HKQ A;  4KN7 A;  1WF9 A;  4FZL A;  5AK4 A;  1C7Y A;  2RGF A;  2FE8 A;  3QWZ B;  2LMR A;  3WKB A;  1J7A A;  2FIF A;  3MR2 A;  4DL5 A;  1P98 A;  3ZGZ A;  2KK0 A;  3NUQ A;  2WS3 B;  4RM8 A;  2BDU A;  1ZQQ A;  1AAR A;  2KWU B;  3A4S C;  4MT5 A;  2KT7 A;  1WXA A;  3G6Y A;  2B21 A;  2D8C A;  3RH5 A;  2C60 A;  1I4R A;  4ZRQ A;  2BDP A;  2UWQ A;  4YWG G;  1XNS A;  4OW0 A;  4CHK A;  5HFY A;  4DF4 A;  2WYQ A;  1ZQA A;  2R8K A;  3OHB A;  4BAX A;  2IGD A;  4YTN B;  2MQJ A;  2BKR B;  3ZO5 B;  2QMT A;  2IDY A;  4CRX A;  1P0R A;  2FPK A;  2JF5 A;  1J0G A;  2W3R A;  1FEZ A;  4IQU A;  5KFB A;  4TQS A;  4WJP A;  5DDY A;  3TEW A;  2F1I A;  4F3O A;  2PMZ F;  3AL0 B;  2JT4 B;  1VR9 A;  3QJZ A;  2QSD A;  3P4P B;  5KFR A;  2MSN A;  5F9L A;  2C22 A;  9ICV A;  4WQM A;  2KKP A;  3SZ2 A;  1SZP A;  4ITK A;  4Y2R A;  1SF0 A;  1M4V A;  2GBN A;  3MFH A;  2ZTE A;  4F5P A;  3THV A;  1KDH A;  2Z0E B;  4W9K A;  5AUI A;  2YQE A;  2FLL A;  2BYT A;  5EE9 A;  2LUE A;  1IXR A;  1QQ6 A;  1V80 A;  4E3C A;  2V4L A;  3BYY B;  3BYT B;  4IG7 B;  2IBI B;  4Y2S A;  3N9Y C;  4GOC A;  4W9H A;  5A0L A;  1IGC A;  3KVF B;  4MDK E;  2LM4 A;  3ZNZ B;  2Y1J A;  1LGR A;  4IWO A;  2P66 A;  1FEH A;  1JWB D;  2ZIU B;  4B6J A;  2NV3 A;  2KDI A;  2MJD A;  4A8X C;  2V3P A;  5CEH A;  3EGR A;  3I57 A;  4ZRI A;  5AKL A;  1C4P A;  2A4Z A;  2D11 A;  2RD0 A;  3QAQ A;  2NO5 A;  2FCQ A;  4RCO A;  3EPG A;  3WA0 A;  1NK5 A;  2ISO A;  3QU2 A;  4M0W B;  2J0J A;  2HHQ A;  3GP7 A;  2F76 X;  4Z6F A;  2DYB A;  5BYS A;  4NM2 A;  1E90 A;  2KWD A;  3LDZ E;  1ZQX A;  4RH6 A;  4HPP A;  4NY0 A;  1X2I A;  2ZVN A;  1GO3 F;  3CP8 A;  4EZ9 A;  1TTN A;  4C7Y A;  3RNA C;  3ED5 A;  1RPL A;  2YB4 A;  4Y2P A;  3PW2 A;  1COK A;  2CKH B;  2RMM A;  2C2E A;  2P6U A;  3P42 A;  4ICV A;  1M6Y A;  2BB6 A;  1HTQ A;  1N60 A;  4KGR A;  5DG9 A;  5J0P A;  1O03 A;  3R9K A;  1ZXH A;  1E6E B;  1N6Z A;  4U7C A;  2V9H A;  2IGH A;  2H5X A;  4L1B A;  3WAO A;  2WX1 A;  1P7F A;  4A3P A;  2KTR A;  2Y1I A;  2YEP F;  2RHF A;  3LVW A;  2BQU A;  3AE3 B;  4B9K A;  1VJ5 A;  3VUW A;  4EE2 A;  4Y2T A;  1RLF A;  1TGZ B;  4HCN B;  4MJS A;  5J2R A;  9ICO A;  1V5T A;  1X9M A;  4DOB A;  4HEA 1;  2R8J A;  2W54 A;  2ICI A;  2ZTC A;  4F4X A;  4FBT A;  2C7H A;  3NUH B;  4DDI D;  2NBW B;  3IHQ B;  1UNS A;  1WJ4 A;  2OOB B;  9ICL A;  4DL2 A;  3VHT C;  4DQO C;  2J6S A;  1UCV A;  9ICG A;  4AJW A;  1K1S A;  2HOF A;  3OJ3 A;  2EAN A;  3IVF A;  4DXA B;  2KFK B;  3DVN U;  4QNL A;  2HE7 A;  3JPS A;  3WAL A;  1X66 A;  1L3T A;  1XCT L;  2WXG A;  3KW5 B;  3H0L B;  1B0X A;  1VD2 A;  3PW0 A;  2WU5 B;  4O3R A;  3W9C B;  4ZHP A;  5L1L A;  2LJ5 A;  3C2L A;  1F2R C;  3RAX A;  2KKV A;  3PNC A;  2DUY A;  4REZ A;  3UIO B;  3A9J B;  2K8A A;  1V85 A;  3MGI A;  1RQL A;  3C2K A;  9ICA A;  1JRU A;  2LHE A;  2MWS B;  2YY6 A;  4X57 B;  4PYU A;  1NDD A;  2K8C A;  4J9L A;  3DBL B;  2AQ3 B;  3M6Z A;  5CP2 A;  4JV2 A;  4DS4 A;  1I4Q A;  1S5L U;  2RQ5 A;  1T5X D;  1LKY B;  1XCQ L;  2BGF A;  4BVU C;  1YN4 A;  3FIL A;  4CGZ A;  1DRG A;  1SJH D;  1QSS A;  1DK2 A;  2J42 A;  4HYK A;  3MFG A;  2ZTD A;  3PLU A;  2JYE A;  5TR5 A;  3G6V A;  1ESF A;  4WWN A;  5ALL A;  2JVC A;  3AEE B;  3ML8 A;  1GOZ A;  4I6P A;  5KT5 A;  3SAH A;  3O13 A;  2WB1 C;  1WR1 A;  4DLG A;  1EXN A;  4RNO A;  1Z2M A;  2LBO A;  5T8I A;  5IKC M;  3F2D A;  2D3G A;  1N56 A;  4BOZ B;  2MRP A;  3A9K A;  1WGD A;  4RQM A;  4IR1 A;  2H3V A;  3RNC C;  3APF A;  4YTP B;  4K4H A;  4GSW A;  3VR9 B;  1TIF A;  1X1M A;  4EZJ A;  2GMI C;  2WF9 A;  4EZ6 A;  2PE6 B;  1BGX T;  1SV0 C;  1OQR A;  3LYS A;  3SYZ A;  1YX5 B;  2B76 B;  4DHZ E;  3ZJV A;  2PJH A;  4Z6C A;  1ZQB A;  2L83 A;  4IC7 B;  3A0B U;  1XQQ A;  5I4D A;  4DWI A;  2BQ3 A;  5AUK A;  1SL1 A;  3NTU A;  3PV1 A;  3N97 B;  3BDP A;  3AN1 A;  8ICQ A;  1UZX B;  2QCZ A;  5DQH A;  4DL6 A;  1T0S C;  2BS2 B;  2O2V A;  2D2Q A;  2IO2 B;  1WG8 A;  3DBL I;  1ZQW A;  2MBQ A;  1ZQK A;  2K4P A;  1RYS A;  2HSZ A;  1ZD5 A;  1Q3U A;  1D9F A;  2OM6 A;  2K6D B;  3EFU A;  5J2D A;  3IRU A;  2Y0S F;  5IIO A;  3PO4 A;  3V6E B;  1MHH E;  3TFS A;  4RGN A;  4NAW B;  1R7S A;  1I7H A;  1CZP A;  2XBB C;  1TK8 A;  2NYV A;  1ZQY A;  1MFW A;  4DL3 A;  3J9C A;  3OSP A;  2FUG 1;  1GJZ A;  2HVI A;  1ZQ1 C;  7ICE A;  4QWC A;  3OGU A;  9ICT A;  2DZJ A;  4EX6 A;  3WK6 A;  1NK8 A;  1C1Y B;  4ZRK A;  3AE8 B;  3QNM A;  4W9L A;  3HM3 A;  5IIJ A;  2EKE C;  2MA1 A;  4RPX A;  1ZQF A;  4XDC A;  4ICA A;  4BOS C;  2KHW B;  4QZA A;  2PKO A;  5CTR C;  5KG6 A;  5AM2 A;  2GI9 A;  3ZW3 A;  4PPX A;  3WK4 A;  5D6J B;  4LZG A;  1WIA A;  1WCN A;  3M6K A;  2KFZ A;  5J0Q A;  2LHD A;  3WK5 A;  1ZJN A;  3ZDM C;  3NVW A;  5AKE A;  2LJI A;  2KJ6 A;  4EYI B;  4JE3 B;  4MFC A;  4YTM B;  1YJJ A;  4UB8 U;  2ZXI A;  1WYG A;  1M94 A;  5C2T B;  4WAA A;  2EH9 A;  3LDA A;  7ICH A;  1Y56 A;  3E9S A;  3RRH A;  3CST A;  2I5H A;  2E6X A;  2UU7 A;  5AZH A;  2AXT U;  1S97 A;  3UMB A;  1KLV A;  9ICE A;  3CYM A;  3RPF C;  3KH0 A;  5J2I A;  2HBJ A;  2ZIW B;  4ZH4 A;  1N5W A;  3KHR A;  1L3U A;  1T7P A;  2DYM A;  1QLB B;  3MR6 A;  3J81 j;  2QHO A;  2WDV B;  2X38 A;  4PH5 A;  2BZF A;  2ASJ A;  4OJP A;  3EZ5 A;  2K8B A;  2ASL A;  3HHM A;  1V8C A;  1DOY A;  4I2E A;  2KN5 A;  1XSP A;  5TSS A;  3KZI U;  4IQW A;  5ALJ A;  1EUV B;  5L1I A;  4YMM A;  5ALR A;  2ZZP B;  2QDF A;  4YFK A;  4KSL C;  1FPY A;  1P7E A;  2V9W A;  4NLZ A;  2QJL A;  3GU3 A;  1AYF A;  3Q14 C;  5KTQ A;  5AK3 A;  3RN9 C;  4J9O A;  5H2F U;  2MP2 A;  3MP9 A;  3BQ0 A;  3LB8 C;  4AYB F;  1ENF A;  4KIK B;  1WXQ A;  2INP E;  3R3M A;  1QH9 A;  3RF9 A;  2JZP A;  2L3Z A;  1ZQD A;  3RYT A;  2HMX A;  2J4X A;  3GII A;  5KT3 A;  3VTV A;  1HEZ E;  4RPZ A;  2AL3 A;  1K8R B;  5ALT A;  2FCN A;  1PZN A;  4GU2 A;  3N7P D;  4YCX A;  4BXO B;  1SE9 A;  3UIN B;  5L1M A;  2ASD A;  1A0P A;  2N7J A;  2KIW A;  2PMZ C;  1DGJ A;  2KJ5 A;  5KFE A;  1GC6 A;  2INC C;  3PV8 A;  4M04 A;  2N4F A;  1FRD A;  4IS7 A;  2PI5 A;  2WP9 B;  5BPC A;  2IHM A;  3V3X A;  2O6K A;  1WYW B;  2K89 A;  2IY0 B;  2KVC A;  2RSU A;  2I1Q A;  2FCS A;  2YMM A;  1JN3 A;  2XK5 B;  4KLU A;  4RQ5 A;  1ZET A;  3H8S A;  2NBV B;  1WE7 A;  4FN2 A;  1TK0 A;  4O3N A;  4F7Z A;  1T0R C;  4I2B A;  4P0P A;  2PVO D;  2PPH A;  2VJ5 A;  1I4G A;  4GMV A;  4PHP A;  4DXG A;  4QZH A;  1YZ6 A;  1TKD A;  4LNO A;  1TS4 A;  1WMH B;  4DSK A;  4C8L A;  2J0M A;  3AEB B;  2RR9 A;  1WGG A;  1Q46 A;  8ICV A;  2FE9 A;  4JQW C;  2KDM A;  3M7D A;  4Q2J A;  1PVP A;  5KFD A;  2BPS A;  4WAF A;  1GUA B;  4RMA A;  1BPB A;  2ZNV C;  5ALY A;  3PX6 A;  3BK1 A;  3X0W A;  5KFS A;  1TZO A;  1ZQS A;  2C2R A;  4RF1 A;  2FDR A;  3LWL A;  3WAM A;  4ICU A;  2NRZ A;  4TUS A;  2G1E A;  2BGW A;  1ZDV A;  3Q8E A;  2KJ8 A;  3OSN A;  5E6O A;  1XU4 A;  4LTU A;  3PS6 A;  1U48 A;  2LGI A;  3Q3O C;  1NBF C;  3DHI C;  2ZUC A;  4KKI A;  4JIO U;  1XF5 L;  2AX5 A;  2K3U A;  2OJR A;  1L3S A;  7ICM A;  3BQ7 A;  3RR7 A;  1XT9 B;  2R8H A;  4ECW A;  2HHX A;  1PUZ A;  4O9M A;  3KUC B;  3AE2 B;  3SV4 A;  1N2X A;  2XID A;  2ZIV A;  4DS5 A;  2M0N A;  1XS9 D;  1XO0 A;  1ECW A;  5EDS A;  1A76 A;  4F5R A;  4DWF A;  2J0K A;  3IXS A;  4GDK A;  3NG0 A;  4F4K A;  2AYO B;  3V7L A;  4IM3 A;  3RB0 A;  1U47 A;  3RB4 A;  4I2C A;  4EBC A;  5IAA C;  5BMG A;  1I4H A;  4ELV A;  3T5L A;  4M0W A;  2W3S A;  1F0M A;  1TS3 A;  3AED B;  4S17 A;  2K39 A;  3UI3 A;  1YD8 U;  3PX4 A;  2HDO A;  3H6N A;  5DPR A;  2HD5 B;  2WXR A;  3FIL B;  5J29 A;  3VRA B;  2LGD A;  2RDH A;  4M00 A;  1BXT A;  1KTQ A;  2F1H A;  3EUB 2;  1TAU A;  5L83 A;  2VA3 A;  5AM3 A;  4NJC A;  2MJE A;  1MN8 A;  4RQ4 A;  9ICU A;  4BBN F;  4O5K A;  5J0S A;  1B22 A;  4I6N B;  2CPR A;  4II3 B;  1SXE A;  1T0Y A;  4PT5 A;  2GBK A;  5J8Y A;  2V4Q A;  2HDE A;  4DQI A;  1P1A A;  3A9K B;  4RUA A;  1SB3 C;  4G3X B;  3HM6 X;  1NNL A;  2W9B A;  2KO3 A;  2IGG A;  1WH3 A;  4Y2X A;  2CR5 A;  4P4P A;  1ZQC A;  3BQ2 A;  2P6R A;  3DDC B;  3LJ3 A;  3L13 A;  8ICO A;  1UHU A;  1X40 A;  4E74 A;  7ICR A;  2LZ6 A;  3DCG A;  5J0T A;  1Z19 A;  2KJ9 A;  4ED3 A;  4CF3 A;  4UB5 A;  3BJY A;  1ZGU B;  3BQT A;  4ECU A;  2PW9 A;  1K50 A;  1ZD3 A;  4AOF A;  3GZF A;  3RNF C;  1GG3 A;  2B6G A;  1XLQ A;  2P35 A;  4R8U B;  7ICS A;  3RNG C;  4TSS A;  2FCM A;  5KFN A;  3D6J A;  1UPH A;  1UWX A;  2DNF A;  4MGK E;  1TS5 A;  1T0Q C;  5GTH U;  4YXJ A;  3KKA A;  2KFK A;  3F53 A;  3RJK A;  4AP9 A;  2GOW A;  2LGY A;  1ZQV A;  5JU5 A;  4KZC A;  5AM0 A;  1FNV A;  2G3Q B;  3V05 A;  3T3N A;  1H38 A;  1HIW A;  5AKJ A;  2QAR B;  2KK8 A;  4Q45 A;  3B0A A;  1ZKH A;  2PIA A;  4F8C B;  1DYQ A;  3L0W B;  9ICJ A;  4F93 B;  4PZO A;  2JH1 A;  2KMA A;  4YN4 A;  3H7I A;  2M56 B;  2KVZ A;  3Q3N C;  5AZG A;  2FAZ A;  3FC4 A;  5CX3 A;  1YIW A;  3A9J A;  3NAS A;  5ALM A;  1EM7 A;  3TMP B;  1WXM A;  4ECV A; 
#chains in the Genus database with same CATH homology
 5EE9 A;  2R61 A;  3BYY B;  3BYT B;  3KWV A;  3N9Y C;  1PFD A;  1FIQ A;  1IGC A;  1AN8 A;  1SIJ A;  2G9H D;  1CJE A;  3U7Z A;  1ZXI A;  3R8B A;  2KQ4 X;  1D5X C;  1FEH A;  1JWB D;  2QEJ C;  2QIE B;  5EE0 A;  1OFF A;  2MJD A;  3Q8C A;  4A8X C;  3AH7 A;  2V3P A;  3EGR A;  3I57 A;  1FFV A;  3SFE B;  3AE1 B;  2K9X A;  4ZYS A;  1C4P A;  1TKE A;  2XN9 C;  1JRO A;  4AQ7 A;  1GAQ B;  2ONQ A;  1SXT A;  2WXP A;  4RCO A;  1C78 A;  2V4I B;  1N5X A;  3BZD B;  3KWL A;  3W5V B;  2H89 B;  3GP7 A;  2L52 A;  1PGA A;  5BYS A;  3R2T A;  2KWD A;  2EKI A;  1HZ5 A;  3RFZ B;  3AEC B;  4NAM A;  4RH6 A;  2DBY A;  3TEX A;  4ARC A;  4N6E B;  5BMH A;  4US8 A;  4C7Y A;  1DOX A;  1XLP A;  4OVZ A;  2RMM A;  2SEB D;  1QF6 A;  1EWY C;  3P42 A;  2WXQ A;  2BTE A;  4A90 A;  2NMQ A;  2DYO A;  3WCQ A;  5MPO A;  2BB6 A;  4XWW A;  1N60 A;  1I4X A;  4KGR A;  2KN4 A;  2MJ3 A;  1EWC A;  1ZXH A;  1C77 A;  1E6E B;  1SEB D;  4MAC A;  4L2Y A;  2IGH A;  1ROE A;  4L1B A;  1WWT A;  3CIR B;  1P7F A;  4RF0 A;  4R3D A;  3AE9 B;  3NS1 A;  2YEP F;  3R2I A;  4C7Z A;  1L4D B;  2I38 A;  2KAJ A;  4RNA A;  1V1O A;  1FD6 A;  3AE3 B;  4EE2 A;  3AEF B;  1TY2 A;  4HEA 1;  1SE3 A;  2W54 A;  2K5P A;  1L5P A;  2ICI A;  4WIP A;  3NUH B;  2RPV A;  4XWT A;  1UNS A;  4RGT A;  1BUI C;  1F2R I;  4DQO C;  4GDL B;  1C4C A;  2KMM A;  3DWM A;  4HRO A;  1HQR D;  1V1P A;  1QIL A;  3EA6 A;  4XDD A;  1KH0 A;  1YQ3 B;  5HI1 A;  3TEY A;  1XCT L;  1SSN A;  2WXG A;  1DOI A;  4IDI A;  1HZ6 A;  1YN3 A;  3ETR A;  3NVY A;  1KLU D;  1BML C;  2SAK A;  2WU5 B;  2PVG C;  4XE0 A;  3W9C B;  1OQQ A;  4ZHP A;  2PMV A;  1SBB B;  1F2R C;  2H88 B;  3IT6 B;  2CJN A;  5D3D A;  4REZ A;  4TQ1 A;  3MHZ A;  1QT9 A;  1EU3 A;  3LYY A;  1KRH A;  3Q8F A;  2LHE A;  2ZW0 A;  1N63 A;  1B9R A;  1IBX B;  3AEG B;  1TYG B;  1JWS D;  1QOG A;  3NRZ A;  2IPK D;  3ZJT A;  1VLB A;  2BW2 A;  3AE4 B;  2RDG A;  2OHF A;  2AQ3 B;  3SFD B;  4HRS A;  2L1A A;  1I4Q A;  1T5X D;  1XCQ L;  2AQ2 B;  1FXA A;  5EE3 A;  3B2F A;  1YN4 A;  2D5G A;  3FIL A;  2WXI A;  4IOI E;  3AV8 A;  4GLS C;  1SJH D;  2BB5 A;  1WRI A;  2J42 A;  2Q5W D;  3MFG A;  4A6Q A;  1D5Z C;  1RYJ A;  2JYE A;  4O1N A;  1ESF A;  1XLO A;  1VZ7 A;  2Y5P A;  4N59 A;  1D4B A;  1E10 A;  3AEE B;  5JXV A;  1GOZ A;  2WXN A;  3O13 A;  1AW7 A;  1A70 A;  3P4R B;  2JU6 X;  3AEA B;  5BYQ A;  3BVG A;  5T8I A;  4HJG E;  4C56 C;  4RFB A;  2QIL A;  4P16 A;  4YTP B;  2WDR B;  3VR9 B;  4D2K A;  4MH8 A;  1OQR A;  3FAH A;  2WQY B;  4GDK B;  2VZK D;  1EU4 A;  2WXO A;  2B76 B;  1E0Z A;  3ZJV A;  5FK9 C;  1PGX A;  2L83 A;  1XEE A;  3PZ7 A;  1TKY A;  2CJO A;  1XO3 A;  5I4D A;  3MC0 B;  2BBC A;  3VR8 B;  5AUK A;  1STE A;  3AN1 A;  5H92 C;  3KQ4 A;  1NYR A;  3HVZ A;  2BS2 B;  4N58 A;  1L4Z B;  4KGT A;  1MHH E;  4RGN A;  2V0G A;  3NVZ A;  4NAW B;  4OZB A;  1R7S A;  4YXD B;  3AMZ A;  1I7H A;  1CZP A;  1L6U A;  2LUM A;  4RGO S;  3J9C A;  4KGS A;  1I4P A;  3SR6 A;  2FUG 1;  4TMA B;  1E9M A;  2WU2 B;  1XLN A;  1K52 A;  1L0V B;  1J7B A;  3CWI A;  3AE8 B;  1PDX A;  1T3Q A;  1MPE A;  4CQN A;  4XDC A;  4ZOH C;  1IGD A;  2Z8L A;  1VJK A;  3BVM A;  1K53 A;  2PKO A;  2BS3 B;  3BWU D;  2GI9 A;  2MEK A;  2ZW1 A;  2W55 A;  1IUE A;  1FXI A;  2LHD A;  3BII D;  3Q8B A;  4KX6 B;  3NVW A;  2LJI A;  4J3O D;  2WNM A;  4JE3 B;  3HRD D;  3W5U B;  1TJE A;  1L0Y B;  5E6J A;  3HUI A;  4YTM B;  1YJJ A;  3P63 A;  1WYG A;  1ZOY B;  3BK2 A;  2N0S B;  5C2T B;  2TSS A;  3E9S A;  1Y56 A;  5BMG A;  3IAS 1;  4C80 A;  2E6X A;  2GRI A;  1JWA D;  1RM6 C;  1ET6 A;  2W82 A;  2WXJ A;  2JWU A;  1PGB A;  4YT0 B;  2CU3 A;  4ZRP A;  3RPF C;  1L0X B;  3DWG C;  3W1S A;  4OZA A;  1N5W A;  2DYM A;  1QLB B;  3AB5 A;  1NI3 A;  2XNA C;  1FNW A;  2WDV B;  2X38 A;  4US9 A;  1DOY A;  1V8C A;  3BVZ A;  3ZJU A;  1C79 A;  5TSS A;  4YSY B;  3TSS A;  2PLP A;  2JX5 A;  2K0P A;  1FO4 A;  3B9J A;  1ZDX A;  2AQ1 B;  4H2A A;  1P7E A;  3ZQ4 A;  1YMH E;  2QJL A;  1AYF A;  3TEZ A;  1PUT A;  2BS4 B;  5D7G A;  1NEN B;  3MP9 A;  3LB8 C;  1ENF A;  1ZPS A;  2WLB A;  1TKG A;  1WSP A;  2NTS A;  3NVV A;  1WXQ A;  2INP E;  2JZP A;  2LFI A;  2V3N A;  3P1M A;  2KAC A;  4B0E A;  2WXL A;  2J4X A;  4UDU C;  2YEP B;  1HEZ E;  4HKZ E;  1YQ4 B;  1T6B X;  1MI0 A;  2JQR B;  1XXG A;  5G5G A;  2N7J A;  1J7C A;  4ZHO A;  1DGJ A;  3VRB B;  2JSV X;  2VZK B;  1VZ8 A;  4A55 A;  1ACC A;  5G5H A;  2WXF A;  1FRD A;  1FCL A;  1D5M C;  1FNU A;  1HXY D;  2WP9 B;  4USA A;  3LXF A;  3V3X A;  1FFU A;  1N61 A;  1JWM D;  4AS1 A;  4RGM A;  4YSZ B;  4JX1 C;  2DWQ A;  5FR3 A;  4IKG A;  1YJI A;  1YN5 A;  2Y5C A;  1JWU D;  2PVO D;  1I4G A;  1JCK B;  1NYQ A;  3GB1 A;  2MH7 A;  3IAM 1;  5LNK 1;  4DXG A;  1FM0 D;  1MVK A;  1TS4 A;  4P6V F;  1KF6 B;  3U4E G;  2M0A A;  3GS2 A;  3AEB B;  1FCC C;  1LO5 D;  1UGJ A;  2FBW B;  1GB4 A;  1KTK A;  3I9V 1;  1JML A;  1RFK A;  1FRR A;  2KDM A;  1TS2 A;  4OHJ A;  4Q2J A;  4WAF A;  4WWM A;  1KFY B;  1UWM A;  3BK1 A;  1TZO A;  4RF1 A;  3AE5 B;  1C76 A;  2WXH A;  1MHX A;  4JWU C;  1F77 A;  5BMI A;  1Q10 A;  2G1E A;  3P4S B;  1ZDV A;  4FXC A;  4JPS A;  3Q8E A;  4ARI A;  4LTU A;  3L4P A;  2LGI A;  3AE7 B;  1V1P B;  2GB1 A;  3U52 E;  4A9A A;  4B0M A;  4KKI A;  1VDV A;  1QKZ A;  2Y3A A;  2WXM A;  1XF5 L;  2AX5 A;  1NEK B;  2K3U A;  1K51 A;  1SJE D;  1V97 A;  2M19 A;  1QQR A;  2E3T A;  4KKJ A;  4LLG M;  5HHD G;  3AE2 B;  2OED A;  2JXT A;  4WUR A;  5FKA C;  3P4Q B;  4WH4 A;  1C4A A;  1SE2 A;  3IXS A;  3U2S C;  3E56 A;  3C8Y A;  1QOB A;  2BT6 A;  3URY A;  2I2Y A;  2WXK A;  1I4H A;  4NZL B;  1JQ4 A;  2ACZ B;  3MJ5 A;  3T3O A;  4M0W A;  2W3S A;  3PO0 A;  2EEL A;  1QOA A;  3AM9 A;  1TS3 A;  4JWS C;  5H8Y E;  3AED B;  4MM3 B;  3UI3 A;  1SE4 A;  2LMC A;  3H8H A;  2WXR A;  3FIL B;  1QOF A;  1N62 A;  3VRA B;  2J53 A;  1FMA D;  1F0Z A;  1UUP A;  2RDH A;  1JRP A;  2IJ0 A;  1BXT A;  3OWE B;  3ZYY X;  4TQ0 A;  1RWS A;  3EUB 2;  2N9L A;  1GB1 A;  4YSX B;  4NJC A;  2MJE A;  1B1Z A;  2ON8 A;  5BYR A;  2NTT A;  3VQI A;  3ABV B;  1PYW D;  4PT5 A;  1JW9 D;  2HDE A;  2HTM E;  1CK1 A;  1ZUD 2;  1CQV A;  1WGK A;  3TUO A;  1SB3 C;  1GPX A;  2IGG A;  3Q8A A;  3AE6 B;  4LK0 M;  3HVD A;  2JYT A;  5EE1 A;  4HKQ A;  1NVI D;  2PW9 A;  1K50 A;  2DLB A;  2FE8 A;  1J7A A;  1ZE3 D;  1XLQ A;  1AWD A;  2L32 A;  4OZC A;  2J52 A;  2LEK A;  5C3J B;  2WS3 B;  3ZGZ A;  4TSS A;  1UWX A;  1HA5 A;  1TY0 A;  1VZ6 A;  1TS5 A;  1ET9 A;  4MT5 A;  4ZRQ A;  5GXG B;  1I4R A;  1KLG D;  3Q69 A;  3B2G A;  3NZ3 A;  4YWG G;  4OW0 A;  1JAL A;  5HFY A;  3V05 A;  1FNV A;  3IT4 B;  3T3N A;  2IGD A;  1D6E C;  3PZ8 A;  4YTN B;  4DXF A;  2QMT A;  2IDY A;  1C9F A;  3KLS X;  3W2D A;  2W3R A;  2N9K A;  4L23 A;  2PIA A;  1DYQ A;  3TEW A;  1VR9 A;  2PTL A;  2QSD A;  3P4P B;  2M56 B;  2WDQ B;  4WQM A;  3FC4 A;  4ITK A;  3SEB A;  1L6V A;  2INN E;  1E7P B;  1SF0 A;  1M4V A;  1EM7 A;  2K22 A;  5HG2 A;  1IBX A;  1VRA B;  1ZP0 B;  1YNT E;  5AUI A;  2BYT A;  5D3I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...