1N5WA

Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 48
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n5wA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n5wA01
3P4QB 1GAQB 2MJDA 4YSZB 3AM9A 1E10A 4P6VF 2L52A 3W5VB 1J7CA 1A70A 3CWIA 2PVOD 2CU3A 3AEAB 4N59A 3LB8C 1L6UA 1N5WA 1NYRA 3P4RB 3VRAB 1OQRA 1RWSA 1YJIA 2W3SA 1DOIA 1WRIA 2BS4B 1IUEA 1QF6A 2MH7A 5AUIA 1F0ZA 3ETRA 1XLNA 3WCQA 4LTUA 1TKGA 1JALA 5G5GA 1VJKA 4FXCA 3VR9B 1AYFA 1NYQA 4C7ZA 3SFEB 3NS1A 2N0SB 1XLQA 2W3RA 1WYGA 4HRSA 2WLBA 3ZYYX 1QOBA 3AV8A 4ZHPA 1YJJA 2K5PA 3EUB2 1JWAD 1FXAA 3RPFC 1WGKA 1XLOA 1ZXIA 1PDXA 1UWMA 3AE6B 1N61A 3BIID 2HTME 4YXDB 1ZOYB 3AE1B 2AX5A 1T3QA 2BT6A 1KFYB 2JQRB 1TKYA 2L83A 1TKEA 3PO0A 2KMMA 1FIQA 4IDIA 1N5XA 4YTPB 1JWBD 1KF6B 1QOFA 1ROEA 4C80A 1CJEA 3W9CB 1PUTA 5AUKA 1ZUD2 3AE9B 4N6EB 4US9A 5G5HA 2M56B 2MJ3A 3B2GA 4JWUC 1L0VB 1YQ3B 1V8CA 2K22A 5C2TB 1I7HA 3DWMA 4WQMA 4USAA 3KWLA 1FRRA 2BS2B 1DGJA 2WS3B 1CZPA 3P4PB 4ZOHC 1E7PB 1ZP0B 3AEFB 3AE8B 3SFDB 2WU5B 5GXGB 3P63A 3NVZA 1FXIA 4ZHOA 3AEDB 2WDRB 1XO3A 1B9RA 1FFUA 2OHFA 3CIRB 1E9MA 2ACZB 1GPXA 2K9XA 2JX5A 1JW9D 2B76B 4ITKA 2QJLA 1EWYC 2WQYB 3AE3B 1QOGA 2WU2B 3FC4A 3W5UB 2M19A 1DOXA 1TJEA 3FAHA 2MJEA 1J7BA 5EE9A 3HVZA 1FO4A 3AB5A 2QIEB 2E3TA 4JX1C 1J7AA 2PKOA 1JROA 4KX6B 1N62A 1FRDA 3B9JA 2BS3B 3P4SB 1VDVA 1NEKB 3AE5B 3AE4B 1RM6C 3AEGB 3B2FA 4YTNB 4A9AA 3HUIA 1V97A 1L5PA 1N60A 2WP9B 5C3JB 2WDQB 2DBYA 2Y5CA 4YSYB 4WWMA 1AWDA 3NVWA 4JWSC 1JQ4A 4HROA 1SIJA 3AH7A 1FFVA 1RFKA 1YQ4B 1SB3C 1NENB 5H8YE 4N58A 2EKIA 3HRDD 2H88B 3AE7B 4YTMB 1JRPA 3NVYA 3AN1A 1TYGB 3AMZA 1L6VA 2PIAA 1E0ZA 2G1EA 2CJOA 4YT0B 2LEKA 3P1MA 3AEEB 1RYJA 1FMAD 3L4PA 4C7YA 2WDVB 4YSXB 1NI3A 1NVID 3AECB 3DWGC 3AE2B 1VLBA 3VR8B 5EE0A 1N63A 1DOYA 2W55A 1XLPA 3NVVA 3SR6A 2W54A 2DWQA 3ABVB 2CJNA 3AEBB 3LXFA 1SF0A 5EE3A 3VRBB 1OQQA 2Q5WD 4US8A 2H89B 2FBWB 3NRZA 1R7SA 1FM0D 1WWTA 1E6EB 1QT9A 1WXQA 1QLBB 1QOAA 5EE1A 1KRHA 5H92C 2PVGC 5MPOA 1OFFA 2KAJA 1PFDA
chains in the Genus database with same CATH superfamily
5J2RA 1GAQB 4NLZA 3HPOA 2WXIA 4DL4A 4P6VF 2AL3A 1TIFA 1L6UA 3VRAB 4IRCA 2GI9A 1D8YA 1DOIA 3RJGA 2LVQA 3OG5A 2KC1A 2DQNB 2Z0DB 2G4DB 4WJPA 2KDMA 4C56C 3QA8A 3ETRA 4RT3A 4TURA 5G5GA 3GS2A 2C7MB 3V6EB 4DDGD 2YY6A 4B6JA 1NYQA 1NBFC 3MTNB 2AJQA 5JXVA 2ISPA 2H5XA 4GIBA 2CHZA 3QZ7A 4LJOB 1ZXIA 1F0MA 3PO4A 4JE3B 4M0WB 2FI1A 1FIQA 4HYKA 4IDIA 4KX5A 1MN8A 2W9AA 4F5PA 3N28A 8ICSA 1P7FA 2YVCA 5IIKA 3H8SA 2LM4A 1KDHA 1LO5D 3UIOB 3Q69A 1UELA 2NS5A 5BYQA 4KITB 1P0RA 1V8CA 1NJXA 2DFLA 3DVNV 3TL5A 2YN4A 3NASA 1SXDA 2K39A 2WU5B 1NDDA 2E1EA 3NZUA 4ZRIA 4UATA 4QWAA 2Y1JA 1E9MA 1EO6A 2AQ3B 8ICXA 1ZD2P 3V72A 2EAPA 2DAFA 2EMSA 2J52A 5KFHA 4IC9A 1SV4A 3L3FX 3HT3A 5H2FU 5FP0A 4TKNA 2MJEA 2R2QA 1AROP 2N9PC 5AM2A 4JPSA 5D2MB 3PV1A 3SYZA 2KN5A 2DLBA 3CRXA 3QU2A 1ZQGA 4EZ9A 3ZDMC 5GTHU 2DAJA 3TQ1A 5KFKA 1ZQOA 2UVVA 2D2QA 4YTNB 4BOSC 1T3NA 1L5PA 4HCPB 5IAAC 2C22A 4RQ3A 1FCCC 2WP9B 2Z0EB 3QE9Y 3PSFA 5HR6A 1PGAA 5D49A 2Y5CA 1AWDA 2JEIA 2E8OA 4OD0A 4DQQA 2HHSA 5ALZA 4DSFA 4RPZA 5DG9A 4I6PA 2H3IA 4LNNA 5IOIA 5ALVA 3SD5A 4YTMB 4B0MA 2NRTA 5DPRA 4BBNC 2DKXA 2YMLA 8ICRA 1SKRA 2JEFA 3NG0A 4KLFA 5AIAA 1TTNA 4UASA 4RM9A 3TI0A 4GDKB 2Q0ZX 4A55A 3SQIA 2XNAC 3OJUA 3R66C 1R4NB 3I57A 4GXIA 4RT2A 1ZQQA 2LRWA 4LJXA 5HI1A 5ALOA 4I2DA 3BS7A 4J03A 1Q10A 2LGDA 3H1UA 4BGDA 2KDBA 1UT8A 4KVGB 3KUZA 3WA0A 3PO5A 1WGYA 2UU7A 1NK6A 5K4LA 3F2CA 4QWEA 8ICUA 5H92C 5AK6A 1YOVB 4YSZB 1KBUA 1JXEA 2DZJA 4DS4A 4RQNA 3MC0B 4DQPA 1F1HA 3ZI4A 4ECXA 1OQRA 2HE7A 2W3SA 9ICUA 1WY8A 4NV0A 3ECIA 5J0PA 4M8MA 1QTMA 2MBBB 3HP6A 2KTRB 3E0FA 3NS1A 1TAMA 2YMMA 3PV8A 2FUHB 1Y8RC 3MC8A 1C78A 4HLEA 1PDXA 3BIID 3QUTA 3RRGA 2HTME 3C0RB 4ECRA 4DHJB 2QB0B 2JU6X 4J9OA 2AX5A 1U48A 4I6LB 1MPEA 4AP4C 4QWDA 2KLCA 3Q8BA 4I2CA 1TVAA 4OVUA 1N5XA 1N48A 1B0XA 1TK8A 4O3MA 4O5CA 1OEYJ 3RJIA 1WR6E 2WXMA 2BQUA 3KKAC 3NUHB 5ALRA 2MJ3A 2P6RA 5KFAA 3SD7A 4O1NA 2UYZB 4LK0M 4J9KA 2CS4A 1KLNA 1I4PA 3QX1A 1WF9A 2KK8A 4EZJA 4W9CA 1S9FA 3THVA 4F2RA 2KQ7A 8ICEA 4A3PA 1U9LA 2BDPA 1TKDA 3RBDA 2AL6A 2NPTB 2XEWA 4EELA 1DOQA 2FPLA 1XNSA 3AE3B 9ICRA 2KSOB 2G09A 2R8IA 4FZNA 2JZBB 3BQ0A 4K7SA 1ZQLA 1J7AA 2MQJA 5KG2A 5CHFA 3P4SB 3AE4B 1GC6A 3VUWA 4EYHB 1ZOLA 4O9MA 4KIKA 2G08A 2M1MA 2KC2A 3PGEA 4HWIB 1D5MC 1RQNA 3KHGA 5KG6A 4M2YA 1ZQ1C 2EKIA 4C8LA 2GMIC 1NK7A 4RQ5A 2L1AA 3M63B 3NGDA 1TYGB 1QQ6A 2LXCA 2Y5BB 1BPYA 4GMVA 2N7JA 2JPHA 5AI6A 2DUYA 2YB1A 4NLGA 2Y9UA 3P1MA 1VD2A 1NZPA 1V38A 1WJUA 2PMZC 4C4RA 3BQTA 1ZYQA 4YN4A 4W9HA 1AQ6A 2R8JA 5ALMA 2RPQA 4EZKA 2YMPA 2A4ZA 2FIDA 2IMWP 2I1KA 4IRDA 2XC9A 1VZ7A 1KM7A 4WJQA 5HHDG 2KANA 1H8CA 2L7RA 1B1ZA 3GV8B 3V3XA 1LKYA 2IBKA 1WM3A 2JUOA 2MJDA 2KWVB 4XYCA 1DOXA 2X38A 3AEAB 1V85A 2ZIXB 3CW2C 5D46A 1J19A 1FNWA 3ZJVA 4EEKA 2P66A 3C1YA 4DOCA 1WRIA 3W1SA 2EZXA 2IO0B 1KN5A 2BCVA 1ZQFA 1KLUD 4C7ZA 4UB1A 1VRAB 5AKXA 4IM0A 1U49A 1WSPA 3MGVA 3ZDAA 1KTQA 4PHDA 1TBEA 3WANA 5FR3A 2GOWA 3KHLA 1BUIC 2KDFB 4W9KA 5GMVA 3V05A 2LHEA 3MR5A 4DCCA 3PO0A 1KFYB 4E3CA 3Q8SB 4F4XA 5J2BA 1NK5A 2O2VB 2PXIA 2IO1B 3T5JA 3PVLA 5AM0A 3M8RA 4MELA 3DQVA 2FCNA 2DPJA 1SGHA 2M56B 4JWUC 4GU2A 1DRGA 2FPKA 3FDSA 7ICRA 3PLVA 3ZUNA 3VQIA 1ISNA 5ALJA 5IIIA 1MFWA 3LDAA 2V4QA 2K8CA 2XK5B 3A1QB 2KFKB 3CF6E 3PPAA 3H40A 4B9SA 2KNBA 3ZDDA 4ZHOA 1MHXA 4D2KA 2WX1A 1SWVA 1PYWD 4OZBA 1GPXA 1C4PA 3O65B 5L9XA 1VCBA 2QJLA 1ZW7A 3R3MA 4UARA 4MFAA 4UB3A 2H3VA 2FLLA 3AU6A 4WQOB 3AI5A 4KX6B 1P3QU 3TJPA 2QKQA 3A9KB 4BXOB 9ICLA 2WAQC 4NL9A 3NZ3A 3M95A 1SV0C 3AEGB 2LI6A 4DOAA 3NJTA 4PHEA 4W9LA 4HJGE 2V3NA 4GDKA 2WXJA 3TEZA 3T3NA 1F44A 3PW5A 2KZ3A 4XQ8A 4EKUA 2H88B 4P4MA 5J8YA 1R4NI 3CYMA 2VRRB 4BUGA 2WXRA 4MH0E 1UWXA 4PH5A 1L4ZB 2G1EA 3KOOA 4YD2A 4NNJB 3MC9A 3N1ZC 2QEJC 1NOMA 4RNAA 4QZAA 2WHEA 1XT9B 2EKEC 2XCAA 1X9WA 4GXKA 2LRUA 3QHTA 3PRZA 2RLTA 3LXFA 1ZQZA 2DL0A 5EWGA 2Q5WD 3AULA 2FBWB 5J0YA 1NK0A 2N1VA 4NJ8A 1UHUA 4I2IA 5AKZA 4IQWA 1FM0D 1R7SA 2BF8B 1KLVA 1L2NA 1QQRA 1WWTA 1A77A 2ZNVB 4LDTB 4YG2A 1Q3VA 3QYPA 2RSUA 4PL2A 1V1PB 2RDBC 1HXYD 3HIZA 5AI0A 5ALIA 4ZH4A 2Z59B 4IM2A 4I2AA 3LB8C 2FCSA 2GRIA 3JPRA 9ICJA 3ZD8A 2D3GA 2WTFA 1GG3A 2JH1A 3C2KA 2QB0A 1I4QA 2WXGA 1QH9A 4LNOA 3GV5B 3EC8A 2FUG1 5JHAA 4A3OA 2SEBD 3UQAA 3SFEB 1V5TA 2BR0A 2R8KA 3ZYYX 9ICFA 4R64A 4TQ1A 2PMZF 4LLGM 4DEZA 3KFUF 2VZKB 3MC1A 3B0XA 4EEWA 2JWUA 4MEXA 3PSTA 2Y9TA 1SKWA 4OJOA 4KLLA 2VH2A 2MA1A 4AOFA 1T3QA 3DVNU 2NBUA 4F91B 3BK1A 1L8LA 2CXYA 3QEBZ 2KDEB 5G2NA 3FM9A 5L1MA 1CJEA 2C7HA 1UNSA 2AHOB 4HVBA 3QNMA 3LJ3A 2NPTA 1L0VB 1TT5B 2O6KA 1E8XA 4PGQA 4K3CA 4MJSB 5J2IA 3SI8A 1X2IA 5AI8A 5E6JA 2BTEA 4DF8A 2KSOA 5F9LA 1E7PB 1WI0A 3CSFA 4G3XB 5E6OA 2VIXA 4ZRKA 1G6JA 3CNHA 1FNVA 2M17A 3SEBA 3U4EG 3OLMD 3ZNZB 2WQYB 1I42A 3FC4A 1XCQL 2HHUA 1GJZA 1L7PA 2O6VB 1J97A 3QAQA 4OW0A 1SJED 5LNK1 2DNFA 3LYSA 2ZTCA 3RN9C 2M4NA 4DSKA 5DB6A 4CQNA 4DFJA 4B9TA 3T79A 2EANA 2K0PA 4QZDA 5C0YA 7ICJA 1JQ4A 2HDOA 3TIXA 2C5LC 2RPVA 5J2KA 4DQOC 8ICQA 3Q3NC 5KFOA 1ZQJA 1NK8A 1JWMD 1C9FA 5JZEB 4JIOU 3AMZA 1F9JA 2ZIUB 8ICTA 4NWIA 9ICKA 4F5RA 1PVRA 3D2SA 2LEKA 1L7OA 3MHSD 2K4PA 1GNUA 5KFFA 1L8OA 1OXJA 4P0QB 9ICAA 2BYVE 4XWTA 1ZRMA 1JI7A 3TUOA 1T0QC 7ICKA 4DXGA 4FS2A 3ZNID 2V4LA 2DWQA 9ICSA 4UQGA 4PS3A 4FZMA 3KZXA 1V5OA 2MBEA 3LDZE 3N97B 4WWPA 5B5EU 2BKFA 3FYHA 4GC7A 4AJYB 2XI9A 4MGYE 4DL6A 1WXQA 1QOAA 1KW4A 1TAUA 1KJTA 5KT2A 2IGGA 3Q3FA 4J6IA 5IILA 2K1FA 3C23A 1NJWA 2KVRA 3AM9A 3NTUA 3L08A 3ZNGC 4KSLC 3W5VB 2K3UA 3CWIA 3KLSX 3U2SC 4QZHA 3I5JC 1L6NA 2V9WA 2Y0SC 1K52A 3IG8A 3LYYA 4KN7A 2F1JA 4P0PB 2K8BA 3HHMA 4S0RA 4EFOA 4UAZA 4KLQA 4W9EA 3DBHI 5IIJA 1IBXB 4Y2RA 1ET6A 1TZOA 5ALKA 4M0AA 2KICA 3D2NA 2HW3A 2D10A 1ZDVA 3C28A 3VCBA 2KLGA 3N30A 1ZQNA 3X23A 1JX4A 3EGRA 4RU9A 1L7MA 5DBAA 3ZDTA 1XS9D 1XWLA 2E1FA 4ED2A 4JV1A 4KDLB 4YTPB 4B95A 2BYTA 3F2DA 4HPMB 2QARB 3EHVA 3BYYB 3C5GA 2PI4A 4GXBA 1M94A 5KG3A 1PVPA 1FEZA 4CDGA 3B0YA 1TZ1A 4F3OA 3KWVA 1WIAA 4LNKA 3APDA 2PFPA 2IOFK 3KYDD 2ES6A 5J0UA 2ZCBA 1ZQHA 4WAFA 2N1WA 4FHJA 4OJLA 1XXGA 3AEDB 1T6BX 5B66U 2D07B 3RMKC 2LGXA 2L05A 4BXOA 5DBBA 2XY5A 2KVSA 2XIDA 3GILA 3RNBC 3IXSA 4W9JA 2Y3AA 4F5OA 1K5OA 1ESFA 4UW9A 3WK9A 4ECQA 1DGSA 2J4XA 4IR1A 5EE9A 1J7BA 5KG1A 2JR5A 1SE3A 4MM3A 3G6YA 2HOIA 2H3FA 3ZQ4A 1L0XB 3LWLA 1N62A 2J42A 3JPPA 3APCA 4IWPA 1KTKA 4UDUC 3TANA 2LD9A 3ZJUA 2WX0A 1A76A 3B2FA 4RGMA 4P2HA 3DHHC 4M47A 1WJ6A 4YSYB 4E71A 1CI4A 4JWSC 2A1JA 3S2AA 2OEDA 1SB3C 3RBEA 3SZ2A 4WWNA 5KT5A 4IR9A 1DXSA 3IG3A 9ICMA 5D4BA 4O3RA 1UPHA 3BQ2A 4PYUA 3OSPA 4DSJA 1RYJA 4C4VA 1VR9A 3OHAA 3B1LX 2LMRA 1WX9A 2SAKA 1IIPA 5EE0A 1M4VA 5AHXA 5KG4A 1V1PA 1ZD3A 2W55A 2XGQA 1WH3A 2MBHA 4QAYA 4UB4A 2CKHB 1WG8A 3WK7A 1SF0A 4IM3A 3Q3MC 4DXFA 3B08A 2LUEA 1V1OA 1F2RI 2Y5PA 2WXHA 1YD8U 2WNMA 1NKBA 1KLGD 5KFLA 3Q6BA 2WXLA 1HIWA 2GLEA 2E6XA 2IGHA 3ZDCA 4FE3A 4F8CB 5AK4A 2C2RA 4F72A 4N59A 4KLUA 3HVDA 4K7WA 1NYRA 2J53A 4ACOA 3CP8A 2LYBA 5J0QA 3P42A 4LTUA 3LVVA 3QX7A 4M9NA 4B0EA 3RR8A 1V80A 4H2AA 4DO9A 4ED0A 4DSIA 4C8MA 5ALEA 4RQ2A 2XGPA 2EELA 1ZQCA 4KTQA 1ZQYA 4C8NA 4WJ3B 1E5WA 3A9JB 1PK1A 3C1ZA 3UM9A 1PVQA 2KFNA 4IL6U 1YJJA 3AV8A 1Q3UA 4EX7A 3H7PB 3D32A 1XLOA 2PLPA 3RRHA 4R66A 4K81A 4DFKA 4MJSA 4II3B 5AM5A 3JSVB 3OTQA 4ICAA 1NI2A 4P4OA 5J2DA 2RDHA 3V7KA 2ZXIA 4LNIA 3RH6A 4K4HA 1YT3A 2WYQA 4F5QA 3GIKA 5L1KA 1JMLA 4AJWA 3IAM1 3PTFC 2BCRA 2BW2A 1I7HA 1KSPA 2C2EA 1P9DU 1DK3A 1Q8KA 3P4PB 4ED7A 2K4IA 4FBUA 1MVKA 4UB2A 1ZQBA 2O6VA 5IIOA 2IY1B 2Y0SF 3IG5A 1Q0WB 2DZKA 3H0LB 3CIRB 2IHNA 2LVOA 2I1QA 5BMIA 5J2FA 1AW7A 3NOBA 4NAMA 2KHWB 2L0TA 3U26A 1E90A 4Q8EA 1JRUA 1UA0A 4TQRA 1JROA 5KFEA 3EFUA 4KLEA 4M9JA 1VDVA 2N1RA 3JPSA 2LUMA 4NAWA 4ANWA 1L7NA 2D6FC 1E8YA 2FE8A 5T14A 4U6PA 2WDQB 4MH8A 4PPXA 1U4BA 4DDID 1SIJA 3ISDA 5L83A 3OAWA 3H4DA 4KLJA 2J6TA 3KUCB 4DOBA 3T5LA 5AM4A 4RQ1A 2D3BA 5JHBA 4U7CA 2LXAA 1XC9A 2HHXA 4C4TA 1WWVA 4MFFA 1XEEA 2CRXA 5D6JB 3IHQB 2MW5A 4P16A 5KFUA 2HHWA 5HMLA 3UF8A 3ETLA 2CJOA 4TUSA 4FBTA 3E2EA 3F5AA 3F2BA 1T0RC 4F1SA 2JYEA 3ZJTA 2QCZA 4ANUA 1GO3F 3N7SC 4DK5A 3X0WA 5KFTA 1VLBA 3AE2B 4AUQC 4TUPA 1IGCA 7ICGA 2B6GA 3WAPA 1BPZA 4I2HA 4LJPB 1NZBA 1QZEA 2A5UA 2PFOA 8ICNA 2INDC 2KTFA 3AEBB 5CX3A 1SL0A 2D5GA 2JRZA 4P0PA 5HHHA 5EDSA 2KWUB 3VXWA 4F4ZA 2KHVA 2LKYA 1P98A 1ZQXA 4M6WB 1OFFA 2ZCCA 4CHKA 1GOZA 5KAIU 2LHTA 4LVSA 3Q8EA 5JRTA 2BQQA 2VH1A 3DDCB 4OZAA 2KD1A 2NV3A 1A70A 3P4RB 3IHPC 1X6JA 5AKKA 2I6XA 4ELVA 3ZW3A 5G55A 2MSNA 4O3NA 2GLSA 3WCQA 2UWQA 3BWUD 1JUDA 2Q4TA 3UXOA 8ICGA 3KYCD 3IBEA 1S77D 3QIJA 4ZRQA 4KGSA 1IXRA 1S0VA 2ZVOA 5L1LA 3HM3A 1ZQSA 3V6CB 1ZQVA 3GQCA 5KHQA 4TUQA 1D9DA 2WLBA 2QARA 3IM1A 3R7QA 2AWTA 3HK0A 3NHEB 2REXA 2OWOA 1S0OA 3BS5B 1XCTL 2WHIA 3GIIA 5DG7A 2PFQA 2HJ1A 4DSEA 3AE1B 3C19A 5DBCA 2MRLA 2JQRB 2N9EB 5AKYA 2G4SA 3IFWB 1QQ5A 4FHKA 1ZPSA 3W9CB 4RNMA 2ASDA 4NPNA 1QILA 3OJ3A 3F5EA 3DOWA 1O08A 3TEWA 1BVSA 4UB6U 2K22A 4DL2A 2D11A 5AKJA 4PGYA 4S17A 3G6XA 2AGOA 4RGOS 3MP9A 4CO7A 1PGBA 2L8JA 3KWLA 2KX3A 5ALYA 4EBCA 3TAPA 2LI5A 1WMHA 2IHMA 2ZEQA 1FXIA 5ALWA 3SAHA 1YNTE 4ECVA 1Z2MA 3WAOA 4ARCA 5ALHA 5KT6A 3QJZA 5F3XB 3RH5A 2JHDA 3ISBA 1P1AA 1K51A 4TMAB 1SXEA 3N7PD 4FFDA 1SGGA 2M9NA 4J9PA 3ML9A 3PHWB 2F44A 5BMGA 4Y2JA 3AE5B 1NKCA 3EYZA 2YEPF 3RJKA 2E8MA 3K1RB 1KQQA 3U7DA 4KLMA 2DZIA 5AI4A 3UMCA 3SAGA 4IKGA 1KOTA 3UPQA 2DBYA 3W1SC 4J9NA 1SE4A 5AKEA 2WXKA 1CRXA 3AEVA 3Q3JA 2M19A 5I4DA 3L5KA 3T3OA 2EDUA 3HRDD 9ICQA 3AE7B 3OGUA 4HDOA 2LGYA 4JLCA 4Y2XA 4J9RA 4WIPA 4WAAA 5FR6A 3WK5A 4RQMA 4B9NA 8ICOA 9ICGA 2LMCA 5BYSA 2QB1A 1JXLA 5KG7A 3HW8A 1YJ1A 3I63C 3DEEA 1XO0A 3D6JA 1YN3A 4MHVA 3DWGC 1WGGA 1RPLA 3KHRA 1S10A 2IDYA 4EE2A 2HOQA 4FS1A 3BZDB 5J2EA 1KFDA 2MX2A 2VA3A 4HJKA 4EUTA 2MUTB 4KLOA 1KKXA 5IA7A 1COOA 2CHWA 2M0XA 3PW2A 1IV8A 2PE9A 3RULA 1B4FA 1NKEA 1MG8A 3WKDA 2QC8A 2VJ5A 3UINB 4CYEA 5KFCA 1HEZE 3I9V1 3A0HU 1MHHE 2A1AA 3KW5B 4GC6A 4Y2VA 4QWBA 2MBOA 2BPFA 4RMAA 3EW9A 1DK2A 7ICFA 2F2AB 4GLSC 1SE9A 2KO3A 3B0AA 1EF1A 4KMUA 3WK6A 3PNCA 7ICIA 2PTLA 1X1MA 2XN9C 2TSSA 2BB6A 4RH6A 1YN4A 3H8WA 3RFZB 1T94A 4RNNA 2WXQA 2GOLA 1LXDA 3JSVA 2JXXA 1VJKA 3PX0A 2GBNA 1WX7A 3W1YA 5CWRA 3TARA 1ZGUB 4GOCA 3CMMB 4K1RB 1QOBA 2QLTA 4M9LA 4NL9C 4I2JA 5DDYA 3HX0A 1JWUD 4RNOA 3VUYA 2G5HB 1HTOA 3BDPA 3ONSA 3G6VA 4QJFB 4QW9A 5KT4A 5KFWA 2DPIA 1HQRD 4NLNA 2BT6A 4R3DA 2EAOA 2BCQA 2KMMA 1KRPA 2J0KA 4MFCA 2YTUA 1JWBD 1KFSA 1IYFA 3PW4A 2VA8A 3AE9B 1ZXHA 5J8YC 5BOMA 4C8KA 1S1QB 4O3PA 8ICLA 1BXTA 5J17A 4RUCA 3QARA 8ICAA 3PR5B 4M0WA 5T8IA 2K60A 3AEFB 5CP2A 3WKEA 3AE8B 4AWJA 3RJHA 1RYSA 3AQFA 2XICA 2HHTA 4XUSA 4FA6A 3U52E 3MDCA 1YZ7A 3ZDEA 1STEA 3BZCA 3DBHB 3MBYA 2IY0B 2F77X 2ZTEA 3V7JA 1UQVA 4DL7A 2E3TA 4Z6DA 4ZYNA 2C2DA 2D3CA 4MT5A 3QQ8B 3DVGY 3C29A 3HKZF 1QCKA 3ORYA 3IDWA 4JL9A 1BGXT 4J3OD 5KHOA 4EBEA 2ZW1A 3AUOA 1UA1A 4Y2QA 4JMUA 4RPYA 4Q43A 4YCXA 2N7EA 4M02A 4A20A 2BHNA 2K6QA 3WKCA 3VTUA 1Z4OA 3ZRCA 2BGFA 4MGKE 2JY6A 1CMXB 3M6ZA 1ZQTA 1PGXA 1TY2A 2DYMA 1A0PA 2PIAA 5TSSA 5DQIA 1I4GA 3ZRFA 5J2HA 9ICTA 2W9CB 1MSWD 5FK9C 5DPTA 4YD1A 1LVHA 4ICUA 3UXPA 2NRZA 1KH0A 1LGRA 3RNAC 5AEKB 1YQBA 2WGSA 1C1YB 5AZHA 1HTQA 1XLPA 3SR6A 1TAQA 3DV9A 4RQ4A 5KT7A 3KVFB 7ICMA 5DGBA 4JV2A 3RJJA 1YIWA 4KN4A 2RMMA 1QLBB 3Q14C 3Q3OC 3AU5A 2KAJA 3R9KA 1PFDA 1UT5A 3SMVA 7ICVA 4K3BA 7ICLA 2L52A 9ICWA 4YMMA 3S6JA 5TZVA 4RUAA 1T8EA 3A4RA 4B9KA 4MEYA 2FMPA 1L0YB 4TQSA 2MH7A 5AUIA 1XLNA 4DQRA 4NY8A 1TKGA 4XE0A 5C23A 3VR9B 1AYFA 2J6UA 1C20A 2GWSA 2I2YA 2HBMA 3EUB2 3IV6A 4NQLB 3TCAA 3AE6B 1TS5A 5AKHA 2JYTA 4ECUA 4QZEA 1BNPA 1RFAA 3GZFA 4OJ6A 4NXZA 3ZVVA 1TKEA 2WWZA 3M9OB 1EF5A 3DHIC 2KTRA 3IRUA 2AQ0A 3J9CA 5D7GA 3PSIA 3M9MB 1GB4A 4OJ5A 4OJPA 1ROEA 3QCAA 2ON8A 4RFBA 3ZLZA 4US9A 4REZA 3JPQA 3RUIB 1SL2A 1YQ3B 3PRPB 2ASQA 4NM1A 1S3SG 3ENEA 1J0GA 2N9KA 2JZ3B 4NLKA 3WU2U 5KFZA 4YR0A 1YMHE 2JVCA 2QMTA 3IN5A 3RZFA 2ICIA 3SFDB 2RGFA 2J0MA 4BKTA 4I27A 4J9MA 1UGJA 1XO3A 4DQIA 2KG5A 4F4WA 1WE6A 4Q45A 5FKAC 1RLFA 4RF0A 4DWIA 2CU1A 4GGQA 1F77A 1GC7A 3LK9A 2KOBA 3DBSA 4GN1A 4M9HA 3BQ7A 5AK3A 1V6EA 2IBIB 2QSDA 3WKBA 4QZ8A 3PLUA 3SHQA 2INPE 9ICXA 3Q8CA 4ECZA 3RZWC 3TBLD 2HDEA 4YWGG 2L00B 2JZBA 4WWMA 2GBKA 4KSKC 5ALXA 3JPNA 1FFVA 5H8YE 5DQGA 1I4XA 2VJ4A 1T5XD 2ZIWB 3HILA 2ASLA 2KIVA 1L6VA 3MFHA 2KVZA 3DCGA 1ZQAA 2MUTA 4LDTD 4II2B 3KBBA 4HDQA 4BFRA 5KG5A 2XO7A 3VVWB 3MR3A 1C7YA 4C7YA 4DLEA 2V0GA 4ED6A 2W04A 4ED8A 1KEJA 4I29A 3U7ZA 3OJSA 4KZCA 7ICPA 2KEYA 3VC8A 1HUOA 3I3TB 2BZFA 3NVVA 4JK1A 2NO4A 5KFIA 3GZNB 2HBKA 1EU3A 2MA9B 3RYTA 5DG8A 4DS5A 8ICZA 2EQYA 3R7RA 2L3ZA 5CHWA 2R61A 1V81A 4YL8A 1E6EB 2RR9A 4PZNA 1K8RB 1X66A 5AKGA 5HKHA 2RDJA 2KMCA 4ED3A 5KFPA 5DB9A 1NNLA 1TFRA 2DHZA 2FPMA 3HWTA 2BKEA 3OHBA 2EMTA 1TY0A 2K4HA 2N7DA 2W9NA 4JQWC 1U45A 5KFYA 2PEAA 5IO9A 1K1QA 3ZKJC 1R4MB 4YFKA 5AM1A 3EPGA 4L1BA 8ICJA 1TS4A 2ZUCA 1F5SA 7ICSA 4Y2PA 4AYBF 2G3QB 3KUDB 2ZIXA 2INNE 4ZHPA 4F8RA 4NJ7A 2AXTU 1ZQKA 3T5HA 2UVRA 1X9XA 3VH4B 4BOZB 3DHGC 1PQSA 5J0OA 2G5IB 2EZYA 3MHZA 2V3PA 4O3QA 5ALSA 8ICBA 1Z1VA 2VKQA 3PSPA 1D9FA 3KD3A 2ZG6A 3H4BA 4CRXA 4DFPA 1XO1A 5AM3A 3MFIA 4GSWA 4O5EA 4Z6CA 3UI3A 4QZCA 2O6VD 2WF7A 4YXMA 5HHIA 3CSTA 2NRVA 3RB3A 4K4IA 4ZYSA 1BPEA 2WS3B 2HVHA 3TADA 2W9MA 2O2VA 1M6YA 5GXGB 4C8OA 2KXJA 2FDRA 5ALUA 2D3DA 4UB8U 3C5FA 3PSEB 4KV2A 2XBBC 4RGNA 4O3OA 2OH2A 3NRWA 4JB3A 2B0CA 1S0NA 2K9XA 3GOEA 2QHOA 2MCNB 2BYFA 4ARIA 2I1JA 4TSSA 2XK5A 2W7PA 3A1QA 1A5RA 2KFKA 1TJEA 3FAHA 1JCKB 2BPSA 3AB5A 1E8WA 3OJ4B 3WK8A 4QZGA 1HE8A 2ZUBA 1ZQDA 1SIFA 1IP9A 2FIFA 3O13A 1D8LA 1XD3B 3OWEB 4A9AA 2I9GA 9ICCA 5J2GA 2L0FA 3JPOA 3UQ0A 2CR5A 1Y88A 2W9CA 4ECYA 1V86A 2B21A 1S5LU 3Q8PB 1SBBB 1YQ4B 5HNKA 5AI5A 2VA2A 3A9KA 1CK1A 4MDKE 3AN1A 1EXNA 1NK4A 2RHFA 4BAXA 4O3SA 2I38A 3Q2AC 2LVPA 3ZNHB 2KDIA 2WF6A 2L76A 1TV9A 4CF3A 2KZRA 3V61A 5J2JA 2R8HA 1ZQWA 3L4PA 2WDVB 4QZIA 4C4SA 1NI3A 5CTRC 2EZZA 3A0BU 1AN8A 3V60A 1PK3A 1WGRA 3K75D 2KV2A 5HP4A 2LZ6A 2IOHA 2W8LA 1OQQA 1FNUA 1I4RA 2OYYA 2MSED 3M62B 4UB5A 3QU5A 4DL5A 1NJZA 2W9BB 3H7IA 2IA6A 5KFSA 2Y1IA 2NR2A 1I4HA 1UBIA 3L16A 2B3AA 3TACB 7ICTA 2AYOB 2KZZA 1ET9A 2ZJ5A 1ZE3D 2ZZPB 3PHXB 4IG7B 1RWSA 1SJHD 1FCLA 3VHTC 1IUEA 1FD6A 3EZ5A 3RNCC 3QZ8A 4R65A 4HEA1 3V62A 3ZXRA 4HXDA 1YX5B 5DLGA 2N0SB 1XU4A 4FN2A 5ALDA 3IP4B 3C8YA 4J9LA 2ISOA 2Z7JA 4E74A 1ACCA 4PHAA 2KX0A 2F8LA 3EFCA 4WH4A 4RQ6A 2DGZA 1JWSD 1QSYA 4FLHA 1UWMA 5C5JA 3AQEA 1L3TA 4DXAB 2DYOA 1TKYA 4ANVA 4NJCA 2G45B 3VDZA 5ALFA 3M7DA 3LWMA 1YN5A 2D8CA 3I1YA 2KJ5A 1OUQA 2EH9A 2KKPA 5ALLA 4LNFA 1F52A 1UZXB 2ONQA 2WF8A 1NJYA 2JT4B 2FLPA 2GBRA 2R2OA 4YXJA 4GB9A 1FRRA 4OHJA 1DGJA 2KHQA 4G11A 4DLGA 4KLTA 4C0ZA 5CEHA 2AEHA 2WDRB 4IS7A 4KMOB 8ICCA 3GIMA 1QSSA 1WJ4A 3PX4A 1DYQA 4IWOA 4PJ0U 4IWQA 2FLNA 3UQ2A 3ML8A 4OO1J 1WM2A 2B76B 2LJ5A 4IW0A 4JWNA 4KIKB 3TEYA 2WF9A 3P2BA 3PS6A 3GU3A 9ICHA 3H8JA 3VUXA 3D2QA 4I2EA 5KFVA 5IIMA 2QIEB 5TR5A 1ZQUA 3T9LA 3O0FA 5AKLA 3QK0A 4KGTA 3RAXA 8ICHA 4PT5A 3SEIA 3RFAA 2ZTDA 2ZIWA 5ALGA 2YB4A 1V2YA 1EU4A 2K6DB 1VZ6A 2KKCA 2X8XX 4WJNA 3VTWA 2W43A 4NM2A 1JN3A 4HROA 3AH7A 4FJYA 2ZUDA 9ICPA 4Y2YA 1HUZA 1SEBD 1Z19A 1JRPA 2RD0A 5KFNA 3DDHA 4RQ7A 4B9UA 5J0WA 2IO3B 3UIPB 4W9IA 5BPCA 4X5VA 5JTIA 4YT0B 2CN1A 2BDUA 3GZNI 4GDLB 2AH5A 4L2YA 1RG6A 2E8NA 2RDIA 2NO5A 4DQSA 1L5UA 1RXVA 3H7SA 3WALA 1P7DA 1LKYB 1CUKA 1E7VA 5J0XA 4MGIE 2LFIA 1GUAB 2V1YA 9ICOA 2FMSA 2G9HD 2ZIUA 1RAXA 3GE3C 8ICFA 2R18A 5L1JA 3RR7A 2WXFA 3PW0A 3TFRA 5C1ZA 3APFA 3IAS1 2IYDB 1OGWA 1WXVA 4P0QA 3MFGA 3PY8A 2KWCA 1IM4A 2KKVA 2WXOA 1R4MI 5JU5A 2UVUA 4F92B 2BCUA 4NLBA 2CU3A 5KFXA 2V4IB 2QDFA 1SWWA 4F2SA 1D8BA 1C76A 4OVVA 3NUQA 1TK0A 4QNLA 4FBJB 2OCEA 4IRKA 2W82A 4EYIB 3GIJA 2KQSA 3FILB 2E5SA 2YQEA 1JALA 4A8EA 7ICNA 1L4DB 3JW0X 4FXCA 2DZMA 4GLXA 2IO2B 3PT2B 1XQQA 1A6SA 2KMAA 3NY5A 2W3RA 4DL3A 4CGZA 5GTIU 2ATLA 1WGHA 1JWAD 3ZIMA 3U30A 3PR4A 2GBMA 3ICXA 3PX6A 1D5XC 2AQ1B 5CJ7A 4MSMB 4RPXA 2W03A 3QXGA 4Y2UA 1C4CA 1ZOYB 2K8CB 2F1IA 2V4RA 2PPHA 3SDLC 1Z00B 4JGHB 1IBXA 4EZ6A 1WR1A 2WB1F 1KF6B 2DKZA 2F76X 2ZJAA 1PUTA 2LASA 2DF4B 1ZUD2 3N1YC 1QSLA 5C2TB 2KTQA 5DB8A 3BYTB 2M0AA 5DCNA 4YQWA 1WJNA 4YR3A 2KJ8A 1XSPA 5IN7A 4XWWA 2LYAA 2JWZA 1L3SA 2CHXA 3UXNA 3HM6X 2OXOA 4K4GA 1U4AA 2GB1A 4FADA 3L17A 4ED1A 3TFSA 1E8ZA 8ICKA 2FE9A 4ANXA 1Z4NA 2KWDA 2MAXA 2KYWA 3I76A 1WE7A 3HKZC 3MR2A 3TAQA 3W5UB 3MABA 3C21A 2NMQA 3UMGA 3HVZA 2BWES 4NY0A 1SKSA 1J2NA 2A3VA 2DX5B 3B9JA 4UAUA 3NS8A 2GO7A 3MDAA 3DVGX 1LFDA 3WIMA 2ZIVB 1J8CA 3EECA 3HUIA 1X40A 1V97A 3RI7C 4MGZE 3AL0B 2F3NA 2HVIA 5CB1A 3TSSA 1U47A 1UBQA 3VAWA 1UF0A 2NBVB 3PZ7A 7ICEA 3JVZX 3NVYA 3DBRB 4EZLA 4UAYA 2IPKD 4FJVB 4KX3A 4BZAA 3PZ8A 2N4FA 2OOBB 5J2CA 2G0AA 5KFDA 3TEXA 5DDMA 4QZFA 3IT6B 2MHJA 5HFYA 2JF5A 4F7ZA 4A8XC 1PZNA 2W9BA 8ICVA 4OVZA 4ZRPA 1AARA 4DF4A 3C2LA 2HSZA 2BCSA 2KQ4X 5J0RA 2C28A 2PFNA 4Z6EA 3BY4B 1RZTA 3M3JA 4BKGA 3SU8X 3QUQA 1LM8B 4HKZE 2DENB 2LGSA 3KTQA 2BQRA 2MU2A 3NRZA 4ELUA 4UBBA 3DBLB 1BT0A 3EA6A 2KVCA 4QZ9A 1S0MA 4MEMA 2JGAA 4IOIE 5KL8B 5EE1A 1T7PA 5KFQA 4BKSA 3M1YA 3GFKB 1V49A 2DYBA 1E10A 2BPGA 4YP3A 1K1SA 2NBWB 3RNEC 2PVOD 4XDCA 2HHVA 4URKA 4P1BC 4F4YA 3N7RC 3V6JA 4PS7A 1T0YA 4I2FA 5E6PA 3SAFA 3Q8AA 3VFKA 4EENA 4RZRA 4Y2TA 1HJPA 3MJWA 4CF4A 1HEKA 3E56A 1ZQPA 4FZLA 5BO4B 1WYGA 4B9MA 1HZ5A 2C7NB 4AQ7A 4RQ8A 3RB0A 1HZ6A 5CHGA 4UAWA 3LVWA 5AICA 2V9HA 5J0SA 1WCNA 2ESEA 4IUMB 5KFBA 2L83A 2BPCA 4CF5A 4BWJA 1ZQEA 1KL9A 3H0RB 4UBCA 3A9JA 3BK2A 4KKJA 4DHJD 4LZGA 4J9SA 3KH0A 1EWCA 3B2GA 3H7PA 4LZDA 4KDIC 4HCNB 3UQBA 2C60A 2HOFA 8ICMA 4BDPA 4USAA 3N9YC 1UUPA 4ZOHC 5J2AA 3JYUA 2AQ2B 2H3QA 2J7QB 3P63A 3VTVA 2YX8A 8ICYA 2WXNA 1WYWB 1MQ3A 3OSNA 2LPEA 4FJZA 4ASWC 4N9F4 4PGXA 1SXTA 2WU2B 3RJFA 4O5KA 4OZCA 4KLGA 1UGMA 4PHPA 3H9DA 1OEYA 1WZ3A 3PZPA 5LXIB 3BVZA 2BGWA 1FRDA 2BB5A 1SZHA 3RCZA 3A4SC 2ZJDA 1S8OA 3H0MB 3BJYA 5J0TA 5C3JB 3N1XC 3MR6A 4ZDVA 4GDLA 3T5KA 3QU9A 5KNIA 3NVWA 4HAIA 4I28A 1O03A 3BZKA 2W8KA 2MRPA 3QWZB 2KACA 1OTRB 2FJ6A 1ZD5A 3EWAA 2ZVNA 3KKAA 4B9LA 4MSQB 4B6WA 1I35A 9ICVA 1UH6A 4BX9C 2JRHA 2KD0A 4A6QA 1E0ZA 4PYZA 1VJ5A 2ODGA 3F53A 7ICQA 8ICPA 4ACFA 1IPGA 3QC8B 2FMQA 3RAQA 3PREA 4BBNF 2HTHA 1N63A 2G06A 3A33B 1DOYA 1B22A 3Q8FA 2ZPNA 5ALTA 4ECTA 4M9GA 1OQYA 3GE8C 2XY6A 3VRBB 3T8MA 5DB7A 4XC2A 2WFAA 3GP7A 3I28A 2K8BB 4L23A 3ALRA 1IG6A 3FILA 1ENFA 2IJ0A 1WRDB 3P4QB 4XRHA 4C00A 1D4BA 4PZOA 3PMLA 2LGIA 1EM7A 1V9PA 3V6HA 4XZ4A 1TE2A 4YR2A 9ICIA 4AYBC 2FCMA 2KJHB 4XX5A 1SSNA 4R8UB 4ELTA 4M01A 4BWMA 2MP2B 2KFZA 1F0ZA 5KFRA 3SV4A 4M6WA 3ALBA 4X57B 4HK2A 2G07A 1Z00A 4FULA 4W9DA 1WGDA 2HMXA 4W9FA 4NZLB 5HMMA 5ALPA 4R63A 3RT3B 3R2IA 4YXDB 1SE2A 4F5NA 1S76D 4EOYA 3BQ1A 2PW9A 1L7YA 2KIWA 7ICOA 1OW5A 3AU4A 1BPDA 4NQKE 3Q8KA 4B9VA 4XA5A 4Q44A 1SL1A 2ZW0A 3N3KB 5EWFA 3V6KA 3BS5A 2KE7A 3WKAA 2I5HA 2W11A 2WXPA 1L3VA 4WQMA 1LV5A 1XSNA 2BS2B 4EX6A 4BVUC 5HR7A 4W9GA 2BWFA 4IQUA 5E79U 4MM3B 4P1CC 2JZPA 2ZPYA 4G0NB 8ICIA 3NVZA 4QW8A 1EUVB 1B9RA 1FFUA 2FCQA 4G50A 2YLMA 4O0IA 2ACZB 1X6IA 3R8BA 4DWFA 3QUBA 2ZIVA 4MACA 1HA5A 5KL1B 1ZJMA 1EWYC 1D6EC 4KGRA 1FPYA 4DFMA 4MF2A 3IVFA 3K4GA 7ICHA 3HJEA 2F8KA 2INCC 3PVXA 1Q5WB 2A1JB 4WWOA 1MI0A 2PKOA 1N56A 5L95C 3H6NA 3MGIA 3GB1A 4KKIA 1N6ZA 5D3DA 4PS8A 2A19A 3M6KA 2RP5A 1Z1BA 3DBRI 1QQ7A 2PKEA 5BYRA 3E9SA 1C79A 4G9BA 4G3IA 2NTSA 1LB2B 3PW7A 3RF9A 5A0LA 1K53A 4NJ6A 4ZRJA 4C4VB 1NENB 1QKZA 1ZDXA 2EAMA 5CA7A 3SENA 1XSLA 5DGAA 1BPXA 1V9JA 2N9XA 1WX8A 3RTVA 1RDFA 1E7UA 3ED5A 3PMNA 5AI9A 2KJRA 2MLBA 3W2DA 2E8PA 2UVWA 3L0WB 4F4KA 3RNFC 4F71A 3BVMA 1H38A 2LYHA 2AGQA 3ZO5B 8ICWA 2IZVB 1BMLC 3AECB 3DBLI 2XY7A 3VR8B 4Q8FA 3L13A 2PE6B 3ABVB 5DQHA 4TUUA 3ZGZA 5EE3A 1JIHA 5D94A 3URYA 5IP4D 2XVTA 1VZ8A 2KMDA 3SV3A 5CHVC 3N4MB 5LXHA 5DKWA 3TADC 2HJ8A 1Q1OA 4DHZB 2OM6A 2BVCA 5KG0A 3GDXA 1SV0A 3JPTA 2RRDA 1J2MA 2LBOA 5DLFA 1J7CA 1PK1B 2AU0A 3E58A 1RYRA 1WCLA 2YMQA 1MC8A 4GIVA 1ZQRA 2BS4B 4I2BA 2PJHA 2JV3A 1YZ6A 2MWSB 2V3SA 2AGPA 2FNJB 1Y56A 1QLNA 1MG4A 1SZPA 1WXSA 1ZQIA 4LCDE 2ZXHA 1T0SC 2K5PA 3RPFC 4P4PA 1D5ZC 2C9WB 2XCPA 3EPIA 3H8HA 2NYVA 1N2XA 5L1IA 2RQ5A 1FEHA 4RQ0A 7ICUA 4DSLA 1B43A 2KK0A 2KOXA 5DPSA 1NK9A 1RYUA 3RB4A 3RH4A 2N9LA 4M8NA 1TGZB 2VZKD 2JMGA 1QOFA 1C77A 4C80A 3AXCA 3BVGA 3N32A 5AUKA 5G5HA 1Z3EB 9ICNA 1YX6B 2F1HA 2IOFA 3Q8RB 1FXTB 4HPLB 3L10B 4IQTA 4EBDA 3RJEA 3R2TA 1T4GA 3DWMA 4HKQA 5CR0A 1K50A 2KT7A 4CE6A 5CRXA 2KJ6A 1ZP0B 2KP7A 2GBJA 2VANA 3V7LA 5TISU 4BJQA 2OHFA 2HHQA 3VH3B 3PRMB 1L3UA 4KLSA 2H3ZA 4ITKA 4NAWB 5J29A 3MGHA 2WDTB 3K1ZA 1WUDA 4DFDA 4QZBA 2K4EA 4JX1C 5AZFA 2BBCA 2KN7A 4QIWC 2BS3B 5KT3A 1JMSA 1XF5L 4XGAB 5LLIA 2OJWA 4F93B 1UCVA 2JZZA 3QU4A 4GXJA 1WXMA 2PI5A 4TV3A 5IKCM 1Q46A 2K89A 2M8SA 4Q2JA 4AS1A 2HBLA 3M8SA 2WAQF 2RDGA 2ZNVC 4M04A 5AK5A 2L5YA 1X9MA 4K7UA 1COKA 1URJA 2BKRB 1BPBA 3ISCA 2MEKA 5BOLA 1F2RC 2HD5B 2GH1A 4I2GA 2K8HA 2YEPB 1ECWA 1D3ZA 4JV0A 3MJ5A 1FMAD 3K9PB 1ZRNA 1CEZA 2JSVX 4TQ0A 1NVID 4WJOA 2Z8LA 1S97A 2HI0A 1ZQMA 4ICVA 2CPRA 1P7EA 1X42A 3IT4B 2CJNA 2LM1A 2OEHA 4US8A 4KLIA 1CQVA 2H89B 3L54A 1MQ2A 4R8UA 4MF8A 2MP2A 2KNJA 2QILA 1QT9A 4Y2SA 4YMOA 4E0DA 2K25A 2K8AA 3ONNA 2NCNA 3ZD9A 1KRHA 2PVGC 5MPOA 2JEJA 3KZIU 3RB6A 4GFJA 4EEYA 1X9SA 4KLHA 4KLDA 1N5WA 3BINA 3ZXVA 2LHDA 1YJIA 9ICEA 1WXAA 1TS3A 1QF6A 2ALZA 3DPDA 5KTQA 4CCHA 2MBQA 1IGDA 1ZD4A 4I6NB 1XLQA 1WZ0A 3U8ZA 1RQLA 4HRSA 3TKAA 2LWPA 5JH5C 3WAMA 4CNQA 4YVZA 2WB1C 1FXAA 1WGKA 3KQ4A 2KN4A 5DPWA 1N61A 4NLCA 2JXJA 4AP9A 5HG2A 3GV7B 3ZDBA 2JH7A 5BMHA 2KJ9A 4M00A 4PK1A 1WMHB 5AKIA 4N6EB 1C3TA 3Q8LA 5EWEA 2AQ4A 3NZSA 4P7IA 4HPPA 4KZ0A 3RD2A 1WFYA 3OPXA 1CZPA 2KFJA 3Q8MA 4F50A 4OCZA 4IQVA 4J9QA 2NRWA 3WK4A 4DHZE 5KFJA 5IINA 5KFGA 2JRIB 2LJIA 5J18A 4RGTA 3KHHA 3RNGC 3N20C 4RM8A 2P6UA 2JX5A 3QUCA 1JW9D 2J6SA 4RCOA 1QOGA 1RXWA 1Z5SB 4ECSA 3PZDA 5AZGA 2M0NA 2BQ3A 1LQBA 2J0JA 3TMPB 2BYEA 2NVUI 1FO4A 5EOZA 1ZKHA 4XDDA 4UAVA 3UMBA 3K9OB 4WURA 2P35A 1WWUA 1H4RA 1ED1A 1MJDA 1TS2A 1NEKB 2D3AA 3T3FA 1RM6C 5JUMA 5AIBA 2JXTA 1N60A 5D3IB 2HBJA 2JEGA 4RF1A 1BNOA 5E6NA 1C4AA 3ZTCA 1PUZA 1RFKA 4YMNA 9ICBA 2PMVA 4N58A 3ZTDA 1UD7A 4JWMA 3J81j 1KFTA 2ASJA 1GB1A 2R8GA 1ZETA 2KZMA 3FKYA 1ZJNA 4ECWA 2IGDA 5KAFU 3AEEB 2ZJ8A 4YSXB 3AU2A 3QU7A 2FAZA 3QEAZ 4JUZA 1RRBA 1TK5A 3H8MA 2NRXA 2W54A 5ALNA 2OJRA 3Q8QB 3C2MA 4PL1A 4IC7B 4BKSD 5F9NA 4FO6A 4QIWF 2L32A 4DBGA 2HCFA 2NTTA 4A90A 1MA7A 5KFMA 2W7OA 4QWCA 3UGBB 3M9NB 2WF5A 5ALQA 4Z6FA
chains in the Genus database with same CATH topology
1GAQB 3AM9A 1E10A 2WXIA 4P6VF 2L52A 3W5VB 2K3UA 2PVOD 3CWIA 3KLSX 4XDCA 3U2SC 1L6UA 3VRAB 1K52A 2GI9A 3LYYA 1DOIA 1L0YB 3Q8AA 4C56C 2KDMA 2MH7A 5AUIA 3ETRA 1XLNA 1TKGA 3GS2A 5G5GA 4XE0A 3VR9B 1AYFA 1NYQA 1IBXB 1ET6A 1TZOA 3E56A 2I2YA 1WYGA 1HZ5A 5JXVA 4AQ7A 1HZ6A 3EUB2 1ZDVA 1ZXIA 3AE6B 1TS5A 2JYTA 3EGRA 4JE3B 2L83A 1TKEA 1FIQA 5D7GA 3J9CA 4IDIA 4YTPB 2BYTA 1GB4A 1P7FA 1ROEA 3BK2A 4KKJA 4RFBA 2ON8A 3BYYB 4US9A 1LO5D 1EWCA 4REZA 3B2GA 1YQ3B 5BYQA 1V8CA 3KWVA 2N9KA 4USAA 3N9YC 1UUPA 4WAFA 1YMHE 4ZOHC 2QMTA 2ICIA 3SFDB 2WU5B 2AQ2B 3P63A 1XXGA 3AEDB 1UGJA 1T6BX 1XO3A 2WXNA 1E9MA 2AQ3B 2J52A 5FKAC 3IXSA 4RF0A 1SXTA 2Y3AA 2WU2B 1F77A 4AS1A 1ESFA 2M19A 2J4XA 2MJEA 4OZCA 1J7BA 1SE3A 5EE9A 4JPSA 2DLBA 3ZQ4A 1L0XB 3BVZA 1N62A 1FRDA 2BB5A 2J42A 1KTKA 2QSDA 4UDUC 3ZJUA 4RGMA 3B2FA 4YTNB 1L5PA 2INPE 3Q8CA 1FCCC 2WP9B 5C3JB 1PGAA 2HDEA 2Y5CA 4YSYB 4YWGG 4WWMA 1AWDA 3NVWA 4JWSC 1FFVA 2OEDA 1SB3C 2KACA 5H8YE 1I4XA 4YTMB 4B0MA 1T5XD 1L6VA 4A6QA 1E0ZA 4GDKB 1RYJA 4A55A 1VR9A 2XNAC 2V0GA 4C7YA 3I57A 3U7ZA 2SAKA 5EE0A 1M4VA 1N63A 1DOYA 3Q8FA 5HI1A 1Q10A 1V1PA 2W55A 3NVVA 1EU3A 1SF0A 3VRBB 4DXFA 1V1OA 1F2RI 3GP7A 2R61A 2Y5PA 4L23A 2WXHA 1E6EB 2WNMA 1KLGD 3FILA 1ENFA 5H92C 2WXLA 2IJ0A 2E6XA 2IGHA 3P4QB 4YSZB 1D4BA 2LGIA 1EM7A 4N59A 3MC0B 3HVDA 1NYRA 2J53A 1TY0A 1OQRA 1SSNA 2W3SA 1F0ZA 3P42A 4LTUA 4B0EA 4L1BA 4H2AA 1TS4A 3NS1A 2EELA 2INNE 3AV8A 1YJJA 4NZLB 4ZHPA 1XLOA 1C78A 2PLPA 3R2IA 1PDXA 3BIID 4YXDB 1SE2A 2HTME 2JU6X 2AX5A 1MPEA 2RDHA 2PW9A 3MHZA 2V3PA 3Q8BA 1N5XA 2WXMA 2ZW0A 1JMLA 3NUHB 3IAM1 2MJ3A 3UI3A 2BW2A 1I7HA 2WXPA 4O1NA 4ZYSA 4WQMA 4LK0M 2BS2B 1I4PA 2WS3B 3P4PB 4MM3B 1MVKA 2JZPA 5GXGB 3NVZA 1B9RA 1FFUA 3CIRB 4RGNA 2ACZB 3R8BA 5BMIA 2K9XA 4MACA 1HA5A 1EWYC 1D6EC 3AE3B 4KGRA 4ARIA 1AW7A 4TSSA 4NAMA 1TJEA 3FAHA 1JCKB 3AB5A 1MI0A 1J7AA 2PKOA 1JROA 3GB1A 4KKIA 5D3DA 3P4SB 1VDVA 3AE4B 3O13A 3OWEB 2LUMA 4A9AA 2FE8A 5BYRA 3E9SA 1C79A 2WDQB 2NTSA 4MH8A 1K53A 1SIJA 1D5MC 1SBBB 1YQ4B 1NENB 1QKZA 2EKIA 1ZDXA 1CK1A 2L1AA 3AN1A 1TYGB 1XEEA 4P16A 2I38A 2N7JA 2CJOA 3W2DA 3P1MA 3ZJTA 2JYEA 3BVMA 3L4PA 2WDVB 1NI3A 3AECB 1BMLC 3AE2B 1VLBA 3VR8B 1IGCA 1AN8A 3ABVB 3ZGZA 3AEBB 5EE3A 1VZ7A 1OQQA 1FNUA 1I4RA 3URYA 5HHDG 1VZ8A 2D5GA 1B1ZA 1I4HA 3V3XA 1OFFA 1GOZA 2MJDA 3Q8EA 1ET9A 4OZAA 1J7CA 1A70A 2X38A 1DOXA 3AEAB 1FNWA 1ZE3D 3ZJVA 3P4RB 1RWSA 1SJHD 1FCLA 1WRIA 3W1SA 2BS4B 1IUEA 1FD6A 3WCQA 3BWUD 4HEA1 1KLUD 4C7ZA 4ZRQA 4KGSA 1Y56A 2N0SB 1VRAB 1WSPA 2WLBA 3C8YA 1ACCA 2K5PA 3RPFC 4WH4A 1XCTL 1D5ZC 1JWSD 5FR3A 1BUIC 1UWMA 3V05A 3H8HA 2LHEA 1FEHA 3AE1B 3PO0A 1KFYB 2DYOA 1TKYA 2JQRB 4NJCA 2N9LA 2VZKD 1QOFA 1C77A 4C80A 1ZPSA 1YN5A 3BVGA 3W9CB 5AUKA 1QILA 5G5HA 2M56B 4JWUC 3TEWA 2K22A 2ONQA 3R2TA 4HKQA 3DWMA 4RGOS 3VQIA 3MP9A 1PGBA 3KWLA 4OHJA 1FRRA 1K50A 1DGJA 1ZP0B 4ZHOA 1FXIA 1YNTE 2WDRB 1MHXA 2OHFA 4D2KA 1DYQA 1PYWD 4OZBA 1GPXA 1C4PA 4ARCA 4ITKA 2B76B 2QJLA 4NAWB 3TEYA 2QIEB 1K51A 4JX1C 4TMAB 2BBCA 4KX6B 4KGTA 2BS3B 4PT5A 5BMGA 1XF5L 3NZ3A 3AE5B 2YEPF 3AEGB 4IKGA 1EU4A 1VZ6A 4HJGE 2V3NA 2DBYA 1SE4A 2WXJA 2WXKA 3TEZA 3T3NA 4HROA 4Q2JA 3AH7A 2RDGA 5I4DA 3T3OA 3HRDD 1SEBD 2H88B 3AE7B 1JRPA 2MEKA 4WIPA 1F2RC 2WXRA 1UWXA 1L4ZB 2G1EA 2YEPB 4YT0B 4L2YA 2LMCA 3MJ5A 4GDLB 5BYSA 1FMAD 2QEJC 2JSVX 1YN3A 4TQ0A 1NVID 3DWGC 4RNAA 2Z8LA 2IDYA 4EE2A 2LFIA 1P7EA 3BZDB 3IT4B 2G9HD 2CJNA 2WXFA 3LXFA 2Q5WD 4US8A 2H89B 1CQVA 3IAS1 2FBWB 1R7SA 1FM0D 2QILA 1QQRA 1WWTA 1QT9A 3MFGA 3I9V1 1HEZE 1KRHA 1MHHE 2PVGC 5MPOA 2WXOA 4GLSC 1V1PB 1HXYD 2CU3A 2PTLA 2V4IB 3LB8C 1N5WA 2XN9C 2TSSA 2GRIA 2BB6A 1C76A 1YN4A 1YJIA 2LHDA 4RH6A 3RFZB 1TS3A 2WXQA 2W82A 1QF6A 1I4QA 3Q69A 2WXGA 3FILB 1L4DB 1JALA 4FXCA 1VJKA 2FUG1 1IGDA 2SEBD 3SFEB 1XLQA 2W3RA 4HRSA 3ZYYX 1QOBA 4TQ1A 1JWUD 1JWAD 1FXAA 4LLGM 1WGKA 3KQ4A 2VZKB 1D5XC 2AQ1B 2KN4A 1N61A 2JWUA 1ZOYB 5HG2A 1C4CA 1HQRD 1T3QA 2BT6A 4R3DA 2KMMA 3BK1A 5BMHA 1IBXA 1JWBD 1KF6B 1CJEA 1PUTA 1UNSA 1ZUD2 1ZXHA 3AE9B 4N6EB 1BXTA 1L0VB 5C2TB 3BYTB 5E6JA 2M0AA 2BTEA 4XWWA 4M0WA 1CZPA 5T8IA 1E7PB 3AEFB 3AE8B 2LJIA 2GB1A 1FNVA 4RGTA 3SEBA 3U52E 3U4EG 1STEA 2JX5A 1JW9D 2KWDA 2WQYB 4RCOA 1QOGA 3FC4A 1XCQL 3W5UB 2NMQA 3HVZA 1FO4A 4XDDA 2E3TA 4WURA 4OW0A 1SJED 5LNK1 3B9JA 4MT5A 1TS2A 1NEKB 1RM6C 4CQNA 4J3OD 3HUIA 1V97A 2ZW1A 2JXTA 1N60A 5D3IB 2K0PA 4RF1A 3TSSA 1JQ4A 2RPVA 4DQOC 1C4AA 3PZ7A 1RFKA 2PMVA 4N58A 1JWMD 3NVYA 1GB1A 1C9FA 1PGXA 3AMZA 2IPKD 1TY2A 2DYMA 3PZ8A 2PIAA 5TSSA 1I4GA 2IGDA 3TEXA 2LEKA 3IT6B 5FK9C 3AEEB 5HFYA 4A8XC 4YSXB 4OVZA 4ZRPA 1KH0A 4XWTA 2KQ4X 3TUOA 4DXGA 1XLPA 3SR6A 2W54A 2DWQA 4HKZE 3NRZA 3EA6A 2L32A 2NTTA 4A90A 4IOIE 1WXQA 1QLBB 1QOAA 2RMMA 5EE1A 2IGGA 2KAJA 1PFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4Q B;  1GAQ B;  2MJD A;  4YSZ B;  3AM9 A;  1E10 A;  4P6V F;  2L52 A;  3W5V B;  1J7C A;  1A70 A;  3CWI A;  2PVO D;  2CU3 A;  3AEA B;  4N59 A;  3LB8 C;  1L6U A;  1N5W A;  1NYR A;  3P4R B;  3VRA B;  1OQR A;  1RWS A;  1YJI A;  2W3S A;  1DOI A;  1WRI A;  2BS4 B;  1IUE A;  1QF6 A;  2MH7 A;  5AUI A;  1F0Z A;  3ETR A;  1XLN A;  3WCQ A;  4LTU A;  1TKG A;  1JAL A;  5G5G A;  1VJK A;  4FXC A;  3VR9 B;  1AYF A;  1NYQ A;  4C7Z A;  3SFE B;  3NS1 A;  2N0S B;  1XLQ A;  2W3R A;  1WYG A;  4HRS A;  2WLB A;  3ZYY X;  1QOB A;  3AV8 A;  4ZHP A;  1YJJ A;  2K5P A;  3EUB 2;  1JWA D;  1FXA A;  3RPF C;  1WGK A;  1XLO A;  1ZXI A;  1PDX A;  1UWM A;  3AE6 B;  1N61 A;  3BII D;  2HTM E;  4YXD B;  1ZOY B;  3AE1 B;  2AX5 A;  1T3Q A;  2BT6 A;  1KFY B;  2JQR B;  1TKY A;  2L83 A;  1TKE A;  3PO0 A;  2KMM A;  1FIQ A;  4IDI A;  1N5X A;  4YTP B;  1JWB D;  1KF6 B;  1QOF A;  1ROE A;  4C80 A;  1CJE A;  3W9C B;  1PUT A;  5AUK A;  1ZUD 2;  3AE9 B;  4N6E B;  4US9 A;  5G5H A;  2M56 B;  2MJ3 A;  3B2G A;  4JWU C;  1L0V B;  1YQ3 B;  1V8C A;  2K22 A;  5C2T B;  1I7H A;  3DWM A;  4WQM A;  4USA A;  3KWL A;  1FRR A;  2BS2 B;  1DGJ A;  2WS3 B;  1CZP A;  3P4P B;  4ZOH C;  1E7P B;  1ZP0 B;  3AEF B;  3AE8 B;  3SFD B;  2WU5 B;  5GXG B;  3P63 A;  3NVZ A;  1FXI A;  4ZHO A;  3AED B;  2WDR B;  1XO3 A;  1B9R A;  1FFU A;  2OHF A;  3CIR B;  1E9M A;  2ACZ B;  1GPX A;  2K9X A;  2JX5 A;  1JW9 D;  2B76 B;  4ITK A;  2QJL A;  1EWY C;  2WQY B;  3AE3 B;  1QOG A;  2WU2 B;  3FC4 A;  3W5U B;  2M19 A;  1DOX A;  1TJE A;  3FAH A;  2MJE A;  1J7B A;  5EE9 A;  3HVZ A;  1FO4 A;  3AB5 A;  2QIE B;  2E3T A;  4JX1 C;  1J7A A;  2PKO A;  1JRO A;  4KX6 B;  1N62 A;  1FRD A;  3B9J A;  2BS3 B;  3P4S B;  1VDV A;  1NEK B;  3AE5 B;  3AE4 B;  1RM6 C;  3AEG B;  3B2F A;  4YTN B;  4A9A A;  3HUI A;  1V97 A;  1L5P A;  1N60 A;  2WP9 B;  5C3J B;  2WDQ B;  2DBY A;  2Y5C A;  4YSY B;  4WWM A;  1AWD A;  3NVW A;  4JWS C;  1JQ4 A;  4HRO A;  1SIJ A;  3AH7 A;  1FFV A;  1RFK A;  1YQ4 B;  1SB3 C;  1NEN B;  5H8Y E;  4N58 A;  2EKI A;  3HRD D;  2H88 B;  3AE7 B;  4YTM B;  1JRP A;  3NVY A;  3AN1 A;  1TYG B;  3AMZ A;  1L6V A;  2PIA A;  1E0Z A;  2G1E A;  2CJO A;  4YT0 B;  2LEK A;  3P1M A;  3AEE B;  1RYJ A;  1FMA D;  3L4P A;  4C7Y A;  2WDV B;  4YSX B;  1NI3 A;  1NVI D;  3AEC B;  3DWG C;  3AE2 B;  1VLB A;  3VR8 B;  5EE0 A;  1N63 A;  1DOY A;  2W55 A;  1XLP A;  3NVV A;  3SR6 A;  2W54 A;  2DWQ A;  3ABV B;  2CJN A;  3AEB B;  3LXF A;  1SF0 A;  5EE3 A;  3VRB B;  1OQQ A;  2Q5W D;  4US8 A;  2H89 B;  2FBW B;  3NRZ A;  1R7S A;  1FM0 D;  1WWT A;  1E6E B;  1QT9 A;  1WXQ A;  1QLB B;  1QOA A;  5EE1 A;  1KRH A;  5H92 C;  2PVG C;  5MPO A;  1OFF A;  2KAJ A;  1PFD A; 
#chains in the Genus database with same CATH topology
 5J2R A;  1GAQ B;  4NLZ A;  3HPO A;  2WXI A;  4DL4 A;  4P6V F;  2AL3 A;  1TIF A;  1L6U A;  3VRA B;  4IRC A;  2GI9 A;  1D8Y A;  1DOI A;  3RJG A;  2LVQ A;  3OG5 A;  2KC1 A;  2DQN B;  2Z0D B;  2G4D B;  4WJP A;  2KDM A;  4C56 C;  3QA8 A;  3ETR A;  4RT3 A;  4TUR A;  5G5G A;  3GS2 A;  2C7M B;  3V6E B;  4DDG D;  2YY6 A;  4B6J A;  1NYQ A;  1NBF C;  3MTN B;  2AJQ A;  5JXV A;  2ISP A;  2H5X A;  4GIB A;  2CHZ A;  3QZ7 A;  4LJO B;  1ZXI A;  1F0M A;  3PO4 A;  4JE3 B;  4M0W B;  2FI1 A;  1FIQ A;  4HYK A;  4IDI A;  4KX5 A;  1MN8 A;  2W9A A;  4F5P A;  3N28 A;  8ICS A;  1P7F A;  2YVC A;  5IIK A;  3H8S A;  2LM4 A;  1KDH A;  1LO5 D;  3UIO B;  3Q69 A;  1UEL A;  2NS5 A;  5BYQ A;  4KIT B;  1P0R A;  1V8C A;  1NJX A;  2DFL A;  3DVN V;  3TL5 A;  2YN4 A;  3NAS A;  1SXD A;  2K39 A;  2WU5 B;  1NDD A;  2E1E A;  3NZU A;  4ZRI A;  4UAT A;  4QWA A;  2Y1J A;  1E9M A;  1EO6 A;  2AQ3 B;  8ICX A;  1ZD2 P;  3V72 A;  2EAP A;  2DAF A;  2EMS A;  2J52 A;  5KFH A;  4IC9 A;  1SV4 A;  3L3F X;  3HT3 A;  5H2F U;  5FP0 A;  4TKN A;  2MJE A;  2R2Q A;  1ARO P;  2N9P C;  5AM2 A;  4JPS A;  5D2M B;  3PV1 A;  3SYZ A;  2KN5 A;  2DLB A;  3CRX A;  3QU2 A;  1ZQG A;  4EZ9 A;  3ZDM C;  5GTH U;  2DAJ A;  3TQ1 A;  5KFK A;  1ZQO A;  2UVV A;  2D2Q A;  4YTN B;  4BOS C;  1T3N A;  1L5P A;  4HCP B;  5IAA C;  2C22 A;  4RQ3 A;  1FCC C;  2WP9 B;  2Z0E B;  3QE9 Y;  3PSF A;  5HR6 A;  1PGA A;  5D49 A;  2Y5C A;  1AWD A;  2JEI A;  2E8O A;  4OD0 A;  4DQQ A;  2HHS A;  5ALZ A;  4DSF A;  4RPZ A;  5DG9 A;  4I6P A;  2H3I A;  4LNN A;  5IOI A;  5ALV A;  3SD5 A;  4YTM B;  4B0M A;  2NRT A;  5DPR A;  4BBN C;  2DKX A;  2YML A;  8ICR A;  1SKR A;  2JEF A;  3NG0 A;  4KLF A;  5AIA A;  1TTN A;  4UAS A;  4RM9 A;  3TI0 A;  4GDK B;  2Q0Z X;  4A55 A;  3SQI A;  2XNA C;  3OJU A;  3R66 C;  1R4N B;  3I57 A;  4GXI A;  4RT2 A;  1ZQQ A;  2LRW A;  4LJX A;  5HI1 A;  5ALO A;  4I2D A;  3BS7 A;  4J03 A;  1Q10 A;  2LGD A;  3H1U A;  4BGD A;  2KDB A;  1UT8 A;  4KVG B;  3KUZ A;  3WA0 A;  3PO5 A;  1WGY A;  2UU7 A;  1NK6 A;  5K4L A;  3F2C A;  4QWE A;  8ICU A;  5H92 C;  5AK6 A;  1YOV B;  4YSZ B;  1KBU A;  1JXE A;  2DZJ A;  4DS4 A;  4RQN A;  3MC0 B;  4DQP A;  1F1H A;  3ZI4 A;  4ECX A;  1OQR A;  2HE7 A;  2W3S A;  9ICU A;  1WY8 A;  4NV0 A;  3ECI A;  5J0P A;  4M8M A;  1QTM A;  2MBB B;  3HP6 A;  2KTR B;  3E0F A;  3NS1 A;  1TAM A;  2YMM A;  3PV8 A;  2FUH B;  1Y8R C;  3MC8 A;  1C78 A;  4HLE A;  1PDX A;  3BII D;  3QUT A;  3RRG A;  2HTM E;  3C0R B;  4ECR A;  4DHJ B;  2QB0 B;  2JU6 X;  4J9O A;  2AX5 A;  1U48 A;  4I6L B;  1MPE A;  4AP4 C;  4QWD A;  2KLC A;  3Q8B A;  4I2C A;  1TVA A;  4OVU A;  1N5X A;  1N48 A;  1B0X A;  1TK8 A;  4O3M A;  4O5C A;  1OEY J;  3RJI A;  1WR6 E;  2WXM A;  2BQU A;  3KKA C;  3NUH B;  5ALR A;  2MJ3 A;  2P6R A;  5KFA A;  3SD7 A;  4O1N A;  2UYZ B;  4LK0 M;  4J9K A;  2CS4 A;  1KLN A;  1I4P A;  3QX1 A;  1WF9 A;  2KK8 A;  4EZJ A;  4W9C A;  1S9F A;  3THV A;  4F2R A;  2KQ7 A;  8ICE A;  4A3P A;  1U9L A;  2BDP A;  1TKD A;  3RBD A;  2AL6 A;  2NPT B;  2XEW A;  4EEL A;  1DOQ A;  2FPL A;  1XNS A;  3AE3 B;  9ICR A;  2KSO B;  2G09 A;  2R8I A;  4FZN A;  2JZB B;  3BQ0 A;  4K7S A;  1ZQL A;  1J7A A;  2MQJ A;  5KG2 A;  5CHF A;  3P4S B;  3AE4 B;  1GC6 A;  3VUW A;  4EYH B;  1ZOL A;  4O9M A;  4KIK A;  2G08 A;  2M1M A;  2KC2 A;  3PGE A;  4HWI B;  1D5M C;  1RQN A;  3KHG A;  5KG6 A;  4M2Y A;  1ZQ1 C;  2EKI A;  4C8L A;  2GMI C;  1NK7 A;  4RQ5 A;  2L1A A;  3M63 B;  3NGD A;  1TYG B;  1QQ6 A;  2LXC A;  2Y5B B;  1BPY A;  4GMV A;  2N7J A;  2JPH A;  5AI6 A;  2DUY A;  2YB1 A;  4NLG A;  2Y9U A;  3P1M A;  1VD2 A;  1NZP A;  1V38 A;  1WJU A;  2PMZ C;  4C4R A;  3BQT A;  1ZYQ A;  4YN4 A;  4W9H A;  1AQ6 A;  2R8J A;  5ALM A;  2RPQ A;  4EZK A;  2YMP A;  2A4Z A;  2FID A;  2IMW P;  2I1K A;  4IRD A;  2XC9 A;  1VZ7 A;  1KM7 A;  4WJQ A;  5HHD G;  2KAN A;  1H8C A;  2L7R A;  1B1Z A;  3GV8 B;  3V3X A;  1LKY A;  2IBK A;  1WM3 A;  2JUO A;  2MJD A;  2KWV B;  4XYC A;  1DOX A;  2X38 A;  3AEA B;  1V85 A;  2ZIX B;  3CW2 C;  5D46 A;  1J19 A;  1FNW A;  3ZJV A;  4EEK A;  2P66 A;  3C1Y A;  4DOC A;  1WRI A;  3W1S A;  2EZX A;  2IO0 B;  1KN5 A;  2BCV A;  1ZQF A;  1KLU D;  4C7Z A;  4UB1 A;  1VRA B;  5AKX A;  4IM0 A;  1U49 A;  1WSP A;  3MGV A;  3ZDA A;  1KTQ A;  4PHD A;  1TBE A;  3WAN A;  5FR3 A;  2GOW A;  3KHL A;  1BUI C;  2KDF B;  4W9K A;  5GMV A;  3V05 A;  2LHE A;  3MR5 A;  4DCC A;  3PO0 A;  1KFY B;  4E3C A;  3Q8S B;  4F4X A;  5J2B A;  1NK5 A;  2O2V B;  2PXI A;  2IO1 B;  3T5J A;  3PVL A;  5AM0 A;  3M8R A;  4MEL A;  3DQV A;  2FCN A;  2DPJ A;  1SGH A;  2M56 B;  4JWU C;  4GU2 A;  1DRG A;  2FPK A;  3FDS A;  7ICR A;  3PLV A;  3ZUN A;  3VQI A;  1ISN A;  5ALJ A;  5III A;  1MFW A;  3LDA A;  2V4Q A;  2K8C A;  2XK5 B;  3A1Q B;  2KFK B;  3CF6 E;  3PPA A;  3H40 A;  4B9S A;  2KNB A;  3ZDD A;  4ZHO A;  1MHX A;  4D2K A;  2WX1 A;  1SWV A;  1PYW D;  4OZB A;  1GPX A;  1C4P A;  3O65 B;  5L9X A;  1VCB A;  2QJL A;  1ZW7 A;  3R3M A;  4UAR A;  4MFA A;  4UB3 A;  2H3V A;  2FLL A;  3AU6 A;  4WQO B;  3AI5 A;  4KX6 B;  1P3Q U;  3TJP A;  2QKQ A;  3A9K B;  4BXO B;  9ICL A;  2WAQ C;  4NL9 A;  3NZ3 A;  3M95 A;  1SV0 C;  3AEG B;  2LI6 A;  4DOA A;  3NJT A;  4PHE A;  4W9L A;  4HJG E;  2V3N A;  4GDK A;  2WXJ A;  3TEZ A;  3T3N A;  1F44 A;  3PW5 A;  2KZ3 A;  4XQ8 A;  4EKU A;  2H88 B;  4P4M A;  5J8Y A;  1R4N I;  3CYM A;  2VRR B;  4BUG A;  2WXR A;  4MH0 E;  1UWX A;  4PH5 A;  1L4Z B;  2G1E A;  3KOO A;  4YD2 A;  4NNJ B;  3MC9 A;  3N1Z C;  2QEJ C;  1NOM A;  4RNA A;  4QZA A;  2WHE A;  1XT9 B;  2EKE C;  2XCA A;  1X9W A;  4GXK A;  2LRU A;  3QHT A;  3PRZ A;  2RLT A;  3LXF A;  1ZQZ A;  2DL0 A;  5EWG A;  2Q5W D;  3AUL A;  2FBW B;  5J0Y A;  1NK0 A;  2N1V A;  4NJ8 A;  1UHU A;  4I2I A;  5AKZ A;  4IQW A;  1FM0 D;  1R7S A;  2BF8 B;  1KLV A;  1L2N A;  1QQR A;  1WWT A;  1A77 A;  2ZNV B;  4LDT B;  4YG2 A;  1Q3V A;  3QYP A;  2RSU A;  4PL2 A;  1V1P B;  2RDB C;  1HXY D;  3HIZ A;  5AI0 A;  5ALI A;  4ZH4 A;  2Z59 B;  4IM2 A;  4I2A A;  3LB8 C;  2FCS A;  2GRI A;  3JPR A;  9ICJ A;  3ZD8 A;  2D3G A;  2WTF A;  1GG3 A;  2JH1 A;  3C2K A;  2QB0 A;  1I4Q A;  2WXG A;  1QH9 A;  4LNO A;  3GV5 B;  3EC8 A;  2FUG 1;  5JHA A;  4A3O A;  2SEB D;  3UQA A;  3SFE B;  1V5T A;  2BR0 A;  2R8K A;  3ZYY X;  9ICF A;  4R64 A;  4TQ1 A;  2PMZ F;  4LLG M;  4DEZ A;  3KFU F;  2VZK B;  3MC1 A;  3B0X A;  4EEW A;  2JWU A;  4MEX A;  3PST A;  2Y9T A;  1SKW A;  4OJO A;  4KLL A;  2VH2 A;  2MA1 A;  4AOF A;  1T3Q A;  3DVN U;  2NBU A;  4F91 B;  3BK1 A;  1L8L A;  2CXY A;  3QEB Z;  2KDE B;  5G2N A;  3FM9 A;  5L1M A;  1CJE A;  2C7H A;  1UNS A;  2AHO B;  4HVB A;  3QNM A;  3LJ3 A;  2NPT A;  1L0V B;  1TT5 B;  2O6K A;  1E8X A;  4PGQ A;  4K3C A;  4MJS B;  5J2I A;  3SI8 A;  1X2I A;  5AI8 A;  5E6J A;  2BTE A;  4DF8 A;  2KSO A;  5F9L A;  1E7P B;  1WI0 A;  3CSF A;  4G3X B;  5E6O A;  2VIX A;  4ZRK A;  1G6J A;  3CNH A;  1FNV A;  2M17 A;  3SEB A;  3U4E G;  3OLM D;  3ZNZ B;  2WQY B;  1I42 A;  3FC4 A;  1XCQ L;  2HHU A;  1GJZ A;  1L7P A;  2O6V B;  1J97 A;  3QAQ A;  4OW0 A;  1SJE D;  5LNK 1;  2DNF A;  3LYS A;  2ZTC A;  3RN9 C;  2M4N A;  4DSK A;  5DB6 A;  4CQN A;  4DFJ A;  4B9T A;  3T79 A;  2EAN A;  2K0P A;  4QZD A;  5C0Y A;  7ICJ A;  1JQ4 A;  2HDO A;  3TIX A;  2C5L C;  2RPV A;  5J2K A;  4DQO C;  8ICQ A;  3Q3N C;  5KFO A;  1ZQJ A;  1NK8 A;  1JWM D;  1C9F A;  5JZE B;  4JIO U;  3AMZ A;  1F9J A;  2ZIU B;  8ICT A;  4NWI A;  9ICK A;  4F5R A;  1PVR A;  3D2S A;  2LEK A;  1L7O A;  3MHS D;  2K4P A;  1GNU A;  5KFF A;  1L8O A;  1OXJ A;  4P0Q B;  9ICA A;  2BYV E;  4XWT A;  1ZRM A;  1JI7 A;  3TUO A;  1T0Q C;  7ICK A;  4DXG A;  4FS2 A;  3ZNI D;  2V4L A;  2DWQ A;  9ICS A;  4UQG A;  4PS3 A;  4FZM A;  3KZX A;  1V5O A;  2MBE A;  3LDZ E;  3N97 B;  4WWP A;  5B5E U;  2BKF A;  3FYH A;  4GC7 A;  4AJY B;  2XI9 A;  4MGY E;  4DL6 A;  1WXQ A;  1QOA A;  1KW4 A;  1TAU A;  1KJT A;  5KT2 A;  2IGG A;  3Q3F A;  4J6I A;  5IIL A;  2K1F A;  3C23 A;  1NJW A;  2KVR A;  3AM9 A;  3NTU A;  3L08 A;  3ZNG C;  4KSL C;  3W5V B;  2K3U A;  3CWI A;  3KLS X;  3U2S C;  4QZH A;  3I5J C;  1L6N A;  2V9W A;  2Y0S C;  1K52 A;  3IG8 A;  3LYY A;  4KN7 A;  2F1J A;  4P0P B;  2K8B A;  3HHM A;  4S0R A;  4EFO A;  4UAZ A;  4KLQ A;  4W9E A;  3DBH I;  5IIJ A;  1IBX B;  4Y2R A;  1ET6 A;  1TZO A;  5ALK A;  4M0A A;  2KIC A;  3D2N A;  2HW3 A;  2D10 A;  1ZDV A;  3C28 A;  3VCB A;  2KLG A;  3N30 A;  1ZQN A;  3X23 A;  1JX4 A;  3EGR A;  4RU9 A;  1L7M A;  5DBA A;  3ZDT A;  1XS9 D;  1XWL A;  2E1F A;  4ED2 A;  4JV1 A;  4KDL B;  4YTP B;  4B95 A;  2BYT A;  3F2D A;  4HPM B;  2QAR B;  3EHV A;  3BYY B;  3C5G A;  2PI4 A;  4GXB A;  1M94 A;  5KG3 A;  1PVP A;  1FEZ A;  4CDG A;  3B0Y A;  1TZ1 A;  4F3O A;  3KWV A;  1WIA A;  4LNK A;  3APD A;  2PFP A;  2IOF K;  3KYD D;  2ES6 A;  5J0U A;  2ZCB A;  1ZQH A;  4WAF A;  2N1W A;  4FHJ A;  4OJL A;  1XXG A;  3AED B;  1T6B X;  5B66 U;  2D07 B;  3RMK C;  2LGX A;  2L05 A;  4BXO A;  5DBB A;  2XY5 A;  2KVS A;  2XID A;  3GIL A;  3RNB C;  3IXS A;  4W9J A;  2Y3A A;  4F5O A;  1K5O A;  1ESF A;  4UW9 A;  3WK9 A;  4ECQ A;  1DGS A;  2J4X A;  4IR1 A;  5EE9 A;  1J7B A;  5KG1 A;  2JR5 A;  1SE3 A;  4MM3 A;  3G6Y A;  2HOI A;  2H3F A;  3ZQ4 A;  1L0X B;  3LWL A;  1N62 A;  2J42 A;  3JPP A;  3APC A;  4IWP A;  1KTK A;  4UDU C;  3TAN A;  2LD9 A;  3ZJU A;  2WX0 A;  1A76 A;  3B2F A;  4RGM A;  4P2H A;  3DHH C;  4M47 A;  1WJ6 A;  4YSY B;  4E71 A;  1CI4 A;  4JWS C;  2A1J A;  3S2A A;  2OED A;  1SB3 C;  3RBE A;  3SZ2 A;  4WWN A;  5KT5 A;  4IR9 A;  1DXS A;  3IG3 A;  9ICM A;  5D4B A;  4O3R A;  1UPH A;  3BQ2 A;  4PYU A;  3OSP A;  4DSJ A;  1RYJ A;  4C4V A;  1VR9 A;  3OHA A;  3B1L X;  2LMR A;  1WX9 A;  2SAK A;  1IIP A;  5EE0 A;  1M4V A;  5AHX A;  5KG4 A;  1V1P A;  1ZD3 A;  2W55 A;  2XGQ A;  1WH3 A;  2MBH A;  4QAY A;  4UB4 A;  2CKH B;  1WG8 A;  3WK7 A;  1SF0 A;  4IM3 A;  3Q3M C;  4DXF A;  3B08 A;  2LUE A;  1V1O A;  1F2R I;  2Y5P A;  2WXH A;  1YD8 U;  2WNM A;  1NKB A;  1KLG D;  5KFL A;  3Q6B A;  2WXL A;  1HIW A;  2GLE A;  2E6X A;  2IGH A;  3ZDC A;  4FE3 A;  4F8C B;  5AK4 A;  2C2R A;  4F72 A;  4N59 A;  4KLU A;  3HVD A;  4K7W A;  1NYR A;  2J53 A;  4ACO A;  3CP8 A;  2LYB A;  5J0Q A;  3P42 A;  4LTU A;  3LVV A;  3QX7 A;  4M9N A;  4B0E A;  3RR8 A;  1V80 A;  4H2A A;  4DO9 A;  4ED0 A;  4DSI A;  4C8M A;  5ALE A;  4RQ2 A;  2XGP A;  2EEL A;  1ZQC A;  4KTQ A;  1ZQY A;  4C8N A;  4WJ3 B;  1E5W A;  3A9J B;  1PK1 A;  3C1Z A;  3UM9 A;  1PVQ A;  2KFN A;  4IL6 U;  1YJJ A;  3AV8 A;  1Q3U A;  4EX7 A;  3H7P B;  3D32 A;  1XLO A;  2PLP A;  3RRH A;  4R66 A;  4K81 A;  4DFK A;  4MJS A;  4II3 B;  5AM5 A;  3JSV B;  3OTQ A;  4ICA A;  1NI2 A;  4P4O A;  5J2D A;  2RDH A;  3V7K A;  2ZXI A;  4LNI A;  3RH6 A;  4K4H A;  1YT3 A;  2WYQ A;  4F5Q A;  3GIK A;  5L1K A;  1JML A;  4AJW A;  3IAM 1;  3PTF C;  2BCR A;  2BW2 A;  1I7H A;  1KSP A;  2C2E A;  1P9D U;  1DK3 A;  1Q8K A;  3P4P B;  4ED7 A;  2K4I A;  4FBU A;  1MVK A;  4UB2 A;  1ZQB A;  2O6V A;  5IIO A;  2IY1 B;  2Y0S F;  3IG5 A;  1Q0W B;  2DZK A;  3H0L B;  3CIR B;  2IHN A;  2LVO A;  2I1Q A;  5BMI A;  5J2F A;  1AW7 A;  3NOB A;  4NAM A;  2KHW B;  2L0T A;  3U26 A;  1E90 A;  4Q8E A;  1JRU A;  1UA0 A;  4TQR A;  1JRO A;  5KFE A;  3EFU A;  4KLE A;  4M9J A;  1VDV A;  2N1R A;  3JPS A;  2LUM A;  4NAW A;  4ANW A;  1L7N A;  2D6F C;  1E8Y A;  2FE8 A;  5T14 A;  4U6P A;  2WDQ B;  4MH8 A;  4PPX A;  1U4B A;  4DDI D;  1SIJ A;  3ISD A;  5L83 A;  3OAW A;  3H4D A;  4KLJ A;  2J6T A;  3KUC B;  4DOB A;  3T5L A;  5AM4 A;  4RQ1 A;  2D3B A;  5JHB A;  4U7C A;  2LXA A;  1XC9 A;  2HHX A;  4C4T A;  1WWV A;  4MFF A;  1XEE A;  2CRX A;  5D6J B;  3IHQ B;  2MW5 A;  4P16 A;  5KFU A;  2HHW A;  5HML A;  3UF8 A;  3ETL A;  2CJO A;  4TUS A;  4FBT A;  3E2E A;  3F5A A;  3F2B A;  1T0R C;  4F1S A;  2JYE A;  3ZJT A;  2QCZ A;  4ANU A;  1GO3 F;  3N7S C;  4DK5 A;  3X0W A;  5KFT A;  1VLB A;  3AE2 B;  4AUQ C;  4TUP A;  1IGC A;  7ICG A;  2B6G A;  3WAP A;  1BPZ A;  4I2H A;  4LJP B;  1NZB A;  1QZE A;  2A5U A;  2PFO A;  8ICN A;  2IND C;  2KTF A;  3AEB B;  5CX3 A;  1SL0 A;  2D5G A;  2JRZ A;  4P0P A;  5HHH A;  5EDS A;  2KWU B;  3VXW A;  4F4Z A;  2KHV A;  2LKY A;  1P98 A;  1ZQX A;  4M6W B;  1OFF A;  2ZCC A;  4CHK A;  1GOZ A;  5KAI U;  2LHT A;  4LVS A;  3Q8E A;  5JRT A;  2BQQ A;  2VH1 A;  3DDC B;  4OZA A;  2KD1 A;  2NV3 A;  1A70 A;  3P4R B;  3IHP C;  1X6J A;  5AKK A;  2I6X A;  4ELV A;  3ZW3 A;  5G55 A;  2MSN A;  4O3N A;  2GLS A;  3WCQ A;  2UWQ A;  3BWU D;  1JUD A;  2Q4T A;  3UXO A;  8ICG A;  3KYC D;  3IBE A;  1S77 D;  3QIJ A;  4ZRQ A;  4KGS A;  1IXR A;  1S0V A;  2ZVO A;  5L1L A;  3HM3 A;  1ZQS A;  3V6C B;  1ZQV A;  3GQC A;  5KHQ A;  4TUQ A;  1D9D A;  2WLB A;  2QAR A;  3IM1 A;  3R7Q A;  2AWT A;  3HK0 A;  3NHE B;  2REX A;  2OWO A;  1S0O A;  3BS5 B;  1XCT L;  2WHI A;  3GII A;  5DG7 A;  2PFQ A;  2HJ1 A;  4DSE A;  3AE1 B;  3C19 A;  5DBC A;  2MRL A;  2JQR B;  2N9E B;  5AKY A;  2G4S A;  3IFW B;  1QQ5 A;  4FHK A;  1ZPS A;  3W9C B;  4RNM A;  2ASD A;  4NPN A;  1QIL A;  3OJ3 A;  3F5E A;  3DOW A;  1O08 A;  3TEW A;  1BVS A;  4UB6 U;  2K22 A;  4DL2 A;  2D11 A;  5AKJ A;  4PGY A;  4S17 A;  3G6X A;  2AGO A;  4RGO S;  3MP9 A;  4CO7 A;  1PGB A;  2L8J A;  3KWL A;  2KX3 A;  5ALY A;  4EBC A;  3TAP A;  2LI5 A;  1WMH A;  2IHM A;  2ZEQ A;  1FXI A;  5ALW A;  3SAH A;  1YNT E;  4ECV A;  1Z2M A;  3WAO A;  4ARC A;  5ALH A;  5KT6 A;  3QJZ A;  5F3X B;  3RH5 A;  2JHD A;  3ISB A;  1P1A A;  1K51 A;  4TMA B;  1SXE A;  3N7P D;  4FFD A;  1SGG A;  2M9N A;  4J9P A;  3ML9 A;  3PHW B;  2F44 A;  5BMG A;  4Y2J A;  3AE5 B;  1NKC A;  3EYZ A;  2YEP F;  3RJK A;  2E8M A;  3K1R B;  1KQQ A;  3U7D A;  4KLM A;  2DZI A;  5AI4 A;  3UMC A;  3SAG A;  4IKG A;  1KOT A;  3UPQ A;  2DBY A;  3W1S C;  4J9N A;  1SE4 A;  5AKE A;  2WXK A;  1CRX A;  3AEV A;  3Q3J A;  2M19 A;  5I4D A;  3L5K A;  3T3O A;  2EDU A;  3HRD D;  9ICQ A;  3AE7 B;  3OGU A;  4HDO A;  2LGY A;  4JLC A;  4Y2X A;  4J9R A;  4WIP A;  4WAA A;  5FR6 A;  3WK5 A;  4RQM A;  4B9N A;  8ICO A;  9ICG A;  2LMC A;  5BYS A;  2QB1 A;  1JXL A;  5KG7 A;  3HW8 A;  1YJ1 A;  3I63 C;  3DEE A;  1XO0 A;  3D6J A;  1YN3 A;  4MHV A;  3DWG C;  1WGG A;  1RPL A;  3KHR A;  1S10 A;  2IDY A;  4EE2 A;  2HOQ A;  4FS1 A;  3BZD B;  5J2E A;  1KFD A;  2MX2 A;  2VA3 A;  4HJK A;  4EUT A;  2MUT B;  4KLO A;  1KKX A;  5IA7 A;  1COO A;  2CHW A;  2M0X A;  3PW2 A;  1IV8 A;  2PE9 A;  3RUL A;  1B4F A;  1NKE A;  1MG8 A;  3WKD A;  2QC8 A;  2VJ5 A;  3UIN B;  4CYE A;  5KFC A;  1HEZ E;  3I9V 1;  3A0H U;  1MHH E;  2A1A A;  3KW5 B;  4GC6 A;  4Y2V A;  4QWB A;  2MBO A;  2BPF A;  4RMA A;  3EW9 A;  1DK2 A;  7ICF A;  2F2A B;  4GLS C;  1SE9 A;  2KO3 A;  3B0A A;  1EF1 A;  4KMU A;  3WK6 A;  3PNC A;  7ICI A;  2PTL A;  1X1M A;  2XN9 C;  2TSS A;  2BB6 A;  4RH6 A;  1YN4 A;  3H8W A;  3RFZ B;  1T94 A;  4RNN A;  2WXQ A;  2GOL A;  1LXD A;  3JSV A;  2JXX A;  1VJK A;  3PX0 A;  2GBN A;  1WX7 A;  3W1Y A;  5CWR A;  3TAR A;  1ZGU B;  4GOC A;  3CMM B;  4K1R B;  1QOB A;  2QLT A;  4M9L A;  4NL9 C;  4I2J A;  5DDY A;  3HX0 A;  1JWU D;  4RNO A;  3VUY A;  2G5H B;  1HTO A;  3BDP A;  3ONS A;  3G6V A;  4QJF B;  4QW9 A;  5KT4 A;  5KFW A;  2DPI A;  1HQR D;  4NLN A;  2BT6 A;  4R3D A;  2EAO A;  2BCQ A;  2KMM A;  1KRP A;  2J0K A;  4MFC A;  2YTU A;  1JWB D;  1KFS A;  1IYF A;  3PW4 A;  2VA8 A;  3AE9 B;  1ZXH A;  5J8Y C;  5BOM A;  4C8K A;  1S1Q B;  4O3P A;  8ICL A;  1BXT A;  5J17 A;  4RUC A;  3QAR A;  8ICA A;  3PR5 B;  4M0W A;  5T8I A;  2K60 A;  3AEF B;  5CP2 A;  3WKE A;  3AE8 B;  4AWJ A;  3RJH A;  1RYS A;  3AQF A;  2XIC A;  2HHT A;  4XUS A;  4FA6 A;  3U52 E;  3MDC A;  1YZ7 A;  3ZDE A;  1STE A;  3BZC A;  3DBH B;  3MBY A;  2IY0 B;  2F77 X;  2ZTE A;  3V7J A;  1UQV A;  4DL7 A;  2E3T A;  4Z6D A;  4ZYN A;  2C2D A;  2D3C A;  4MT5 A;  3QQ8 B;  3DVG Y;  3C29 A;  3HKZ F;  1QCK A;  3ORY A;  3IDW A;  4JL9 A;  1BGX T;  4J3O D;  5KHO A;  4EBE A;  2ZW1 A;  3AUO A;  1UA1 A;  4Y2Q A;  4JMU A;  4RPY A;  4Q43 A;  4YCX A;  2N7E A;  4M02 A;  4A20 A;  2BHN A;  2K6Q A;  3WKC A;  3VTU A;  1Z4O A;  3ZRC A;  2BGF A;  4MGK E;  2JY6 A;  1CMX B;  3M6Z A;  1ZQT A;  1PGX A;  1TY2 A;  2DYM A;  1A0P A;  2PIA A;  5TSS A;  5DQI A;  1I4G A;  3ZRF A;  5J2H A;  9ICT A;  2W9C B;  1MSW D;  5FK9 C;  5DPT A;  4YD1 A;  1LVH A;  4ICU A;  3UXP A;  2NRZ A;  1KH0 A;  1LGR A;  3RNA C;  5AEK B;  1YQB A;  2WGS A;  1C1Y B;  5AZH A;  1HTQ A;  1XLP A;  3SR6 A;  1TAQ A;  3DV9 A;  4RQ4 A;  5KT7 A;  3KVF B;  7ICM A;  5DGB A;  4JV2 A;  3RJJ A;  1YIW A;  4KN4 A;  2RMM A;  1QLB B;  3Q14 C;  3Q3O C;  3AU5 A;  2KAJ A;  3R9K A;  1PFD A;  1UT5 A;  3SMV A;  7ICV A;  4K3B A;  7ICL A;  2L52 A;  9ICW A;  4YMM A;  3S6J A;  5TZV A;  4RUA A;  1T8E A;  3A4R A;  4B9K A;  4MEY A;  2FMP A;  1L0Y B;  4TQS A;  2MH7 A;  5AUI A;  1XLN A;  4DQR A;  4NY8 A;  1TKG A;  4XE0 A;  5C23 A;  3VR9 B;  1AYF A;  2J6U A;  1C20 A;  2GWS A;  2I2Y A;  2HBM A;  3EUB 2;  3IV6 A;  4NQL B;  3TCA A;  3AE6 B;  1TS5 A;  5AKH A;  2JYT A;  4ECU A;  4QZE A;  1BNP A;  1RFA A;  3GZF A;  4OJ6 A;  4NXZ A;  3ZVV A;  1TKE A;  2WWZ A;  3M9O B;  1EF5 A;  3DHI C;  2KTR A;  3IRU A;  2AQ0 A;  3J9C A;  5D7G A;  3PSI A;  3M9M B;  1GB4 A;  4OJ5 A;  4OJP A;  1ROE A;  3QCA A;  2ON8 A;  4RFB A;  3ZLZ A;  4US9 A;  4REZ A;  3JPQ A;  3RUI B;  1SL2 A;  1YQ3 B;  3PRP B;  2ASQ A;  4NM1 A;  1S3S G;  3ENE A;  1J0G A;  2N9K A;  2JZ3 B;  4NLK A;  3WU2 U;  5KFZ A;  4YR0 A;  1YMH E;  2JVC A;  2QMT A;  3IN5 A;  3RZF A;  2ICI A;  3SFD B;  2RGF A;  2J0M A;  4BKT A;  4I27 A;  4J9M A;  1UGJ A;  1XO3 A;  4DQI A;  2KG5 A;  4F4W A;  1WE6 A;  4Q45 A;  5FKA C;  1RLF A;  4RF0 A;  4DWI A;  2CU1 A;  4GGQ A;  1F77 A;  1GC7 A;  3LK9 A;  2KOB A;  3DBS A;  4GN1 A;  4M9H A;  3BQ7 A;  5AK3 A;  1V6E A;  2IBI B;  2QSD A;  3WKB A;  4QZ8 A;  3PLU A;  3SHQ A;  2INP E;  9ICX A;  3Q8C A;  4ECZ A;  3RZW C;  3TBL D;  2HDE A;  4YWG G;  2L00 B;  2JZB A;  4WWM A;  2GBK A;  4KSK C;  5ALX A;  3JPN A;  1FFV A;  5H8Y E;  5DQG A;  1I4X A;  2VJ4 A;  1T5X D;  2ZIW B;  3HIL A;  2ASL A;  2KIV A;  1L6V A;  3MFH A;  2KVZ A;  3DCG A;  1ZQA A;  2MUT A;  4LDT D;  4II2 B;  3KBB A;  4HDQ A;  4BFR A;  5KG5 A;  2XO7 A;  3VVW B;  3MR3 A;  1C7Y A;  4C7Y A;  4DLE A;  2V0G A;  4ED6 A;  2W04 A;  4ED8 A;  1KEJ A;  4I29 A;  3U7Z A;  3OJS A;  4KZC A;  7ICP A;  2KEY A;  3VC8 A;  1HUO A;  3I3T B;  2BZF A;  3NVV A;  4JK1 A;  2NO4 A;  5KFI A;  3GZN B;  2HBK A;  1EU3 A;  2MA9 B;  3RYT A;  5DG8 A;  4DS5 A;  8ICZ A;  2EQY A;  3R7R A;  2L3Z A;  5CHW A;  2R61 A;  1V81 A;  4YL8 A;  1E6E B;  2RR9 A;  4PZN A;  1K8R B;  1X66 A;  5AKG A;  5HKH A;  2RDJ A;  2KMC A;  4ED3 A;  5KFP A;  5DB9 A;  1NNL A;  1TFR A;  2DHZ A;  2FPM A;  3HWT A;  2BKE A;  3OHB A;  2EMT A;  1TY0 A;  2K4H A;  2N7D A;  2W9N A;  4JQW C;  1U45 A;  5KFY A;  2PEA A;  5IO9 A;  1K1Q A;  3ZKJ C;  1R4M B;  4YFK A;  5AM1 A;  3EPG A;  4L1B A;  8ICJ A;  1TS4 A;  2ZUC A;  1F5S A;  7ICS A;  4Y2P A;  4AYB F;  2G3Q B;  3KUD B;  2ZIX A;  2INN E;  4ZHP A;  4F8R A;  4NJ7 A;  2AXT U;  1ZQK A;  3T5H A;  2UVR A;  1X9X A;  3VH4 B;  4BOZ B;  3DHG C;  1PQS A;  5J0O A;  2G5I B;  2EZY A;  3MHZ A;  2V3P A;  4O3Q A;  5ALS A;  8ICB A;  1Z1V A;  2VKQ A;  3PSP A;  1D9F A;  3KD3 A;  2ZG6 A;  3H4B A;  4CRX A;  4DFP A;  1XO1 A;  5AM3 A;  3MFI A;  4GSW A;  4O5E A;  4Z6C A;  3UI3 A;  4QZC A;  2O6V D;  2WF7 A;  4YXM A;  5HHI A;  3CST A;  2NRV A;  3RB3 A;  4K4I A;  4ZYS A;  1BPE A;  2WS3 B;  2HVH A;  3TAD A;  2W9M A;  2O2V A;  1M6Y A;  5GXG B;  4C8O A;  2KXJ A;  2FDR A;  5ALU A;  2D3D A;  4UB8 U;  3C5F A;  3PSE B;  4KV2 A;  2XBB C;  4RGN A;  4O3O A;  2OH2 A;  3NRW A;  4JB3 A;  2B0C A;  1S0N A;  2K9X A;  3GOE A;  2QHO A;  2MCN B;  2BYF A;  4ARI A;  2I1J A;  4TSS A;  2XK5 A;  2W7P A;  3A1Q A;  1A5R A;  2KFK A;  1TJE A;  3FAH A;  1JCK B;  2BPS A;  3AB5 A;  1E8W A;  3OJ4 B;  3WK8 A;  4QZG A;  1HE8 A;  2ZUB A;  1ZQD A;  1SIF A;  1IP9 A;  2FIF A;  3O13 A;  1D8L A;  1XD3 B;  3OWE B;  4A9A A;  2I9G A;  9ICC A;  5J2G A;  2L0F A;  3JPO A;  3UQ0 A;  2CR5 A;  1Y88 A;  2W9C A;  4ECY A;  1V86 A;  2B21 A;  1S5L U;  3Q8P B;  1SBB B;  1YQ4 B;  5HNK A;  5AI5 A;  2VA2 A;  3A9K A;  1CK1 A;  4MDK E;  3AN1 A;  1EXN A;  1NK4 A;  2RHF A;  4BAX A;  4O3S A;  2I38 A;  3Q2A C;  2LVP A;  3ZNH B;  2KDI A;  2WF6 A;  2L76 A;  1TV9 A;  4CF3 A;  2KZR A;  3V61 A;  5J2J A;  2R8H A;  1ZQW A;  3L4P A;  2WDV B;  4QZI A;  4C4S A;  1NI3 A;  5CTR C;  2EZZ A;  3A0B U;  1AN8 A;  3V60 A;  1PK3 A;  1WGR A;  3K75 D;  2KV2 A;  5HP4 A;  2LZ6 A;  2IOH A;  2W8L A;  1OQQ A;  1FNU A;  1I4R A;  2OYY A;  2MSE D;  3M62 B;  4UB5 A;  3QU5 A;  4DL5 A;  1NJZ A;  2W9B B;  3H7I A;  2IA6 A;  5KFS A;  2Y1I A;  2NR2 A;  1I4H A;  1UBI A;  3L16 A;  2B3A A;  3TAC B;  7ICT A;  2AYO B;  2KZZ A;  1ET9 A;  2ZJ5 A;  1ZE3 D;  2ZZP B;  3PHX B;  4IG7 B;  1RWS A;  1SJH D;  1FCL A;  3VHT C;  1IUE A;  1FD6 A;  3EZ5 A;  3RNC C;  3QZ8 A;  4R65 A;  4HEA 1;  3V62 A;  3ZXR A;  4HXD A;  1YX5 B;  5DLG A;  2N0S B;  1XU4 A;  4FN2 A;  5ALD A;  3IP4 B;  3C8Y A;  4J9L A;  2ISO A;  2Z7J A;  4E74 A;  1ACC A;  4PHA A;  2KX0 A;  2F8L A;  3EFC A;  4WH4 A;  4RQ6 A;  2DGZ A;  1JWS D;  1QSY A;  4FLH A;  1UWM A;  5C5J A;  3AQE A;  1L3T A;  4DXA B;  2DYO A;  1TKY A;  4ANV A;  4NJC A;  2G45 B;  3VDZ A;  5ALF A;  3M7D A;  3LWM A;  1YN5 A;  2D8C A;  3I1Y A;  2KJ5 A;  1OUQ A;  2EH9 A;  2KKP A;  5ALL A;  4LNF A;  1F52 A;  1UZX B;  2ONQ A;  2WF8 A;  1NJY A;  2JT4 B;  2FLP A;  2GBR A;  2R2O A;  4YXJ A;  4GB9 A;  1FRR A;  4OHJ A;  1DGJ A;  2KHQ A;  4G11 A;  4DLG A;  4KLT A;  4C0Z A;  5CEH A;  2AEH A;  2WDR B;  4IS7 A;  4KMO B;  8ICC A;  3GIM A;  1QSS A;  1WJ4 A;  3PX4 A;  1DYQ A;  4IWO A;  4PJ0 U;  4IWQ A;  2FLN A;  3UQ2 A;  3ML8 A;  4OO1 J;  1WM2 A;  2B76 B;  2LJ5 A;  4IW0 A;  4JWN A;  4KIK B;  3TEY A;  2WF9 A;  3P2B A;  3PS6 A;  3GU3 A;  9ICH A;  3H8J A;  3VUX A;  3D2Q A;  4I2E A;  5KFV A;  5IIM A;  2QIE B;  5TR5 A;  1ZQU A;  3T9L A;  3O0F A;  5AKL A;  3QK0 A;  4KGT A;  3RAX A;  8ICH A;  4PT5 A;  3SEI A;  3RFA A;  2ZTD A;  2ZIW A;  5ALG A;  2YB4 A;  1V2Y A;  1EU4 A;  2K6D B;  1VZ6 A;  2KKC A;  2X8X X;  4WJN A;  3VTW A;  2W43 A;  4NM2 A;  1JN3 A;  4HRO A;  3AH7 A;  4FJY A;  2ZUD A;  9ICP A;  4Y2Y A;  1HUZ A;  1SEB D;  1Z19 A;  1JRP A;  2RD0 A;  5KFN A;  3DDH A;  4RQ7 A;  4B9U A;  5J0W A;  2IO3 B;  3UIP B;  4W9I A;  5BPC A;  4X5V A;  5JTI A;  4YT0 B;  2CN1 A;  2BDU A;  3GZN I;  4GDL B;  2AH5 A;  4L2Y A;  1RG6 A;  2E8N A;  2RDI A;  2NO5 A;  4DQS A;  1L5U A;  1RXV A;  3H7S A;  3WAL A;  1P7D A;  1LKY B;  1CUK A;  1E7V A;  5J0X A;  4MGI E;  2LFI A;  1GUA B;  2V1Y A;  9ICO A;  2FMS A;  2G9H D;  2ZIU A;  1RAX A;  3GE3 C;  8ICF A;  2R18 A;  5L1J A;  3RR7 A;  2WXF A;  3PW0 A;  3TFR A;  5C1Z A;  3APF A;  3IAS 1;  2IYD B;  1OGW A;  1WXV A;  4P0Q A;  3MFG A;  3PY8 A;  2KWC A;  1IM4 A;  2KKV A;  2WXO A;  1R4M I;  5JU5 A;  2UVU A;  4F92 B;  2BCU A;  4NLB A;  2CU3 A;  5KFX A;  2V4I B;  2QDF A;  1SWW A;  4F2S A;  1D8B A;  1C76 A;  4OVV A;  3NUQ A;  1TK0 A;  4QNL A;  4FBJ B;  2OCE A;  4IRK A;  2W82 A;  4EYI B;  3GIJ A;  2KQS A;  3FIL B;  2E5S A;  2YQE A;  1JAL A;  4A8E A;  7ICN A;  1L4D B;  3JW0 X;  4FXC A;  2DZM A;  4GLX A;  2IO2 B;  3PT2 B;  1XQQ A;  1A6S A;  2KMA A;  3NY5 A;  2W3R A;  4DL3 A;  4CGZ A;  5GTI U;  2ATL A;  1WGH A;  1JWA D;  3ZIM A;  3U30 A;  3PR4 A;  2GBM A;  3ICX A;  3PX6 A;  1D5X C;  2AQ1 B;  5CJ7 A;  4MSM B;  4RPX A;  2W03 A;  3QXG A;  4Y2U A;  1C4C A;  1ZOY B;  2K8C B;  2F1I A;  2V4R A;  2PPH A;  3SDL C;  1Z00 B;  4JGH B;  1IBX A;  4EZ6 A;  1WR1 A;  2WB1 F;  1KF6 B;  2DKZ A;  2F76 X;  2ZJA A;  1PUT A;  2LAS A;  2DF4 B;  1ZUD 2;  3N1Y C;  1QSL A;  5C2T B;  2KTQ A;  5DB8 A;  3BYT B;  2M0A A;  5DCN A;  4YQW A;  1WJN A;  4YR3 A;  2KJ8 A;  1XSP A;  5IN7 A;  4XWW A;  2LYA A;  2JWZ A;  1L3S A;  2CHX A;  3UXN A;  3HM6 X;  2OXO A;  4K4G A;  1U4A A;  2GB1 A;  4FAD A;  3L17 A;  4ED1 A;  3TFS A;  1E8Z A;  8ICK A;  2FE9 A;  4ANX A;  1Z4N A;  2KWD A;  2MAX A;  2KYW A;  3I76 A;  1WE7 A;  3HKZ C;  3MR2 A;  3TAQ A;  3W5U B;  3MAB A;  3C21 A;  2NMQ A;  3UMG A;  3HVZ A;  2BWE S;  4NY0 A;  1SKS A;  1J2N A;  2A3V A;  2DX5 B;  3B9J A;  4UAU A;  3NS8 A;  2GO7 A;  3MDA A;  3DVG X;  1LFD A;  3WIM A;  2ZIV B;  1J8C A;  3EEC A;  3HUI A;  1X40 A;  1V97 A;  3RI7 C;  4MGZ E;  3AL0 B;  2F3N A;  2HVI A;  5CB1 A;  3TSS A;  1U47 A;  1UBQ A;  3VAW A;  1UF0 A;  2NBV B;  3PZ7 A;  7ICE A;  3JVZ X;  3NVY A;  3DBR B;  4EZL A;  4UAY A;  2IPK D;  4FJV B;  4KX3 A;  4BZA A;  3PZ8 A;  2N4F A;  2OOB B;  5J2C A;  2G0A A;  5KFD A;  3TEX A;  5DDM A;  4QZF A;  3IT6 B;  2MHJ A;  5HFY A;  2JF5 A;  4F7Z A;  4A8X C;  1PZN A;  2W9B A;  8ICV A;  4OVZ A;  4ZRP A;  1AAR A;  4DF4 A;  3C2L A;  2HSZ A;  2BCS A;  2KQ4 X;  5J0R A;  2C28 A;  2PFN A;  4Z6E A;  3BY4 B;  1RZT A;  3M3J A;  4BKG A;  3SU8 X;  3QUQ A;  1LM8 B;  4HKZ E;  2DEN B;  2LGS A;  3KTQ A;  2BQR A;  2MU2 A;  3NRZ A;  4ELU A;  4UBB A;  3DBL B;  1BT0 A;  3EA6 A;  2KVC A;  4QZ9 A;  1S0M A;  4MEM A;  2JGA A;  4IOI E;  5KL8 B;  5EE1 A;  1T7P A;  5KFQ A;  4BKS A;  3M1Y A;  3GFK B;  1V49 A;  2DYB A;  1E10 A;  2BPG A;  4YP3 A;  1K1S A;  2NBW B;  3RNE C;  2PVO D;  4XDC A;  2HHV A;  4URK A;  4P1B C;  4F4Y A;  3N7R C;  3V6J A;  4PS7 A;  1T0Y A;  4I2F A;  5E6P A;  3SAF A;  3Q8A A;  3VFK A;  4EEN A;  4RZR A;  4Y2T A;  1HJP A;  3MJW A;  4CF4 A;  1HEK A;  3E56 A;  1ZQP A;  4FZL A;  5BO4 B;  1WYG A;  4B9M A;  1HZ5 A;  2C7N B;  4AQ7 A;  4RQ8 A;  3RB0 A;  1HZ6 A;  5CHG A;  4UAW A;  3LVW A;  5AIC A;  2V9H A;  5J0S A;  1WCN A;  2ESE A;  4IUM B;  5KFB A;  2L83 A;  2BPC A;  4CF5 A;  4BWJ A;  1ZQE A;  1KL9 A;  3H0R B;  4UBC A;  3A9J A;  3BK2 A;  4KKJ A;  4DHJ D;  4LZG A;  4J9S A;  3KH0 A;  1EWC A;  3B2G A;  3H7P A;  4LZD A;  4KDI C;  4HCN B;  3UQB A;  2C60 A;  2HOF A;  8ICM A;  4BDP A;  4USA A;  3N9Y C;  1UUP A;  4ZOH C;  5J2A A;  3JYU A;  2AQ2 B;  2H3Q A;  2J7Q B;  3P63 A;  3VTV A;  2YX8 A;  8ICY A;  2WXN A;  1WYW B;  1MQ3 A;  3OSN A;  2LPE A;  4FJZ A;  4ASW C;  4N9F 4;  4PGX A;  1SXT A;  2WU2 B;  3RJF A;  4O5K A;  4OZC A;  4KLG A;  1UGM A;  4PHP A;  3H9D A;  1OEY A;  1WZ3 A;  3PZP A;  5LXI B;  3BVZ A;  2BGW A;  1FRD A;  2BB5 A;  1SZH A;  3RCZ A;  3A4S C;  2ZJD A;  1S8O A;  3H0M B;  3BJY A;  5J0T A;  5C3J B;  3N1X C;  3MR6 A;  4ZDV A;  4GDL A;  3T5K A;  3QU9 A;  5KNI A;  3NVW A;  4HAI A;  4I28 A;  1O03 A;  3BZK A;  2W8K A;  2MRP A;  3QWZ B;  2KAC A;  1OTR B;  2FJ6 A;  1ZD5 A;  3EWA A;  2ZVN A;  3KKA A;  4B9L A;  4MSQ B;  4B6W A;  1I35 A;  9ICV A;  1UH6 A;  4BX9 C;  2JRH A;  2KD0 A;  4A6Q A;  1E0Z A;  4PYZ A;  1VJ5 A;  2ODG A;  3F53 A;  7ICQ A;  8ICP A;  4ACF A;  1IPG A;  3QC8 B;  2FMQ A;  3RAQ A;  3PRE A;  4BBN F;  2HTH A;  1N63 A;  2G06 A;  3A33 B;  1DOY A;  1B22 A;  3Q8F A;  2ZPN A;  5ALT A;  4ECT A;  4M9G A;  1OQY A;  3GE8 C;  2XY6 A;  3VRB B;  3T8M A;  5DB7 A;  4XC2 A;  2WFA A;  3GP7 A;  3I28 A;  2K8B B;  4L23 A;  3ALR A;  1IG6 A;  3FIL A;  1ENF A;  2IJ0 A;  1WRD B;  3P4Q B;  4XRH A;  4C00 A;  1D4B A;  4PZO A;  3PML A;  2LGI A;  1EM7 A;  1V9P A;  3V6H A;  4XZ4 A;  1TE2 A;  4YR2 A;  9ICI A;  4AYB C;  2FCM A;  2KJH B;  4XX5 A;  1SSN A;  4R8U B;  4ELT A;  4M01 A;  4BWM A;  2MP2 B;  2KFZ A;  1F0Z A;  5KFR A;  3SV4 A;  4M6W A;  3ALB A;  4X57 B;  4HK2 A;  2G07 A;  1Z00 A;  4FUL A;  4W9D A;  1WGD A;  2HMX A;  4W9F A;  4NZL B;  5HMM A;  5ALP A;  4R63 A;  3RT3 B;  3R2I A;  4YXD B;  1SE2 A;  4F5N A;  1S76 D;  4EOY A;  3BQ1 A;  2PW9 A;  1L7Y A;  2KIW A;  7ICO A;  1OW5 A;  3AU4 A;  1BPD A;  4NQK E;  3Q8K A;  4B9V A;  4XA5 A;  4Q44 A;  1SL1 A;  2ZW0 A;  3N3K B;  5EWF A;  3V6K A;  3BS5 A;  2KE7 A;  3WKA A;  2I5H A;  2W11 A;  2WXP A;  1L3V A;  4WQM A;  1LV5 A;  1XSN A;  2BS2 B;  4EX6 A;  4BVU C;  5HR7 A;  4W9G A;  2BWF A;  4IQU A;  5E79 U;  4MM3 B;  4P1C C;  2JZP A;  2ZPY A;  4G0N B;  8ICI A;  3NVZ A;  4QW8 A;  1EUV B;  1B9R A;  1FFU A;  2FCQ A;  4G50 A;  2YLM A;  4O0I A;  2ACZ B;  1X6I A;  3R8B A;  4DWF A;  3QUB A;  2ZIV A;  4MAC A;  1HA5 A;  5KL1 B;  1ZJM A;  1EWY C;  1D6E C;  4KGR A;  1FPY A;  4DFM A;  4MF2 A;  3IVF A;  3K4G A;  7ICH A;  3HJE A;  2F8K A;  2INC C;  3PVX A;  1Q5W B;  2A1J B;  4WWO A;  1MI0 A;  2PKO A;  1N56 A;  5L95 C;  3H6N A;  3MGI A;  3GB1 A;  4KKI A;  1N6Z A;  5D3D A;  4PS8 A;  2A19 A;  3M6K A;  2RP5 A;  1Z1B A;  3DBR I;  1QQ7 A;  2PKE A;  5BYR A;  3E9S A;  1C79 A;  4G9B A;  4G3I A;  2NTS A;  1LB2 B;  3PW7 A;  3RF9 A;  5A0L A;  1K53 A;  4NJ6 A;  4ZRJ A;  4C4V B;  1NEN B;  1QKZ A;  1ZDX A;  2EAM A;  5CA7 A;  3SEN A;  1XSL A;  5DGA A;  1BPX A;  1V9J A;  2N9X A;  1WX8 A;  3RTV A;  1RDF A;  1E7U A;  3ED5 A;  3PMN A;  5AI9 A;  2KJR A;  2MLB A;  3W2D A;  2E8P A;  2UVW A;  3L0W B;  4F4K A;  3RNF C;  4F71 A;  3BVM A;  1H38 A;  2LYH A;  2AGQ A;  3ZO5 B;  8ICW A;  2IZV B;  1BML C;  3AEC B;  3DBL I;  2XY7 A;  3VR8 B;  4Q8F A;  3L13 A;  2PE6 B;  3ABV B;  5DQH A;  4TUU A;  3ZGZ A;  5EE3 A;  1JIH A;  5D94 A;  3URY A;  5IP4 D;  2XVT A;  1VZ8 A;  2KMD A;  3SV3 A;  5CHV C;  3N4M B;  5LXH A;  5DKW A;  3TAD C;  2HJ8 A;  1Q1O A;  4DHZ B;  2OM6 A;  2BVC A;  5KG0 A;  3GDX A;  1SV0 A;  3JPT A;  2RRD A;  1J2M A;  2LBO A;  5DLF A;  1J7C A;  1PK1 B;  2AU0 A;  3E58 A;  1RYR A;  1WCL A;  2YMQ A;  1MC8 A;  4GIV A;  1ZQR A;  2BS4 B;  4I2B A;  2PJH A;  2JV3 A;  1YZ6 A;  2MWS B;  2V3S A;  2AGP A;  2FNJ B;  1Y56 A;  1QLN A;  1MG4 A;  1SZP A;  1WXS A;  1ZQI A;  4LCD E;  2ZXH A;  1T0S C;  2K5P A;  3RPF C;  4P4P A;  1D5Z C;  2C9W B;  2XCP A;  3EPI A;  3H8H A;  2NYV A;  1N2X A;  5L1I A;  2RQ5 A;  1FEH A;  4RQ0 A;  7ICU A;  4DSL A;  1B43 A;  2KK0 A;  2KOX A;  5DPS A;  1NK9 A;  1RYU A;  3RB4 A;  3RH4 A;  2N9L A;  4M8N A;  1TGZ B;  2VZK D;  2JMG A;  1QOF A;  1C77 A;  4C80 A;  3AXC A;  3BVG A;  3N32 A;  5AUK A;  5G5H A;  1Z3E B;  9ICN A;  1YX6 B;  2F1H A;  2IOF A;  3Q8R B;  1FXT B;  4HPL B;  3L10 B;  4IQT A;  4EBD A;  3RJE A;  3R2T A;  1T4G A;  3DWM A;  4HKQ A;  5CR0 A;  1K50 A;  2KT7 A;  4CE6 A;  5CRX A;  2KJ6 A;  1ZP0 B;  2KP7 A;  2GBJ A;  2VAN A;  3V7L A;  5TIS U;  4BJQ A;  2OHF A;  2HHQ A;  3VH3 B;  3PRM B;  1L3U A;  4KLS A;  2H3Z A;  4ITK A;  4NAW B;  5J29 A;  3MGH A;  2WDT B;  3K1Z A;  1WUD A;  4DFD A;  4QZB A;  2K4E A;  4JX1 C;  5AZF A;  2BBC A;  2KN7 A;  4QIW C;  2BS3 B;  5KT3 A;  1JMS A;  1XF5 L;  4XGA B;  5LLI A;  2OJW A;  4F93 B;  1UCV A;  2JZZ A;  3QU4 A;  4GXJ A;  1WXM A;  2PI5 A;  4TV3 A;  5IKC M;  1Q46 A;  2K89 A;  2M8S A;  4Q2J A;  4AS1 A;  2HBL A;  3M8S A;  2WAQ F;  2RDG A;  2ZNV C;  4M04 A;  5AK5 A;  2L5Y A;  1X9M A;  4K7U A;  1COK A;  1URJ A;  2BKR B;  1BPB A;  3ISC A;  2MEK A;  5BOL A;  1F2R C;  2HD5 B;  2GH1 A;  4I2G A;  2K8H A;  2YEP B;  1ECW A;  1D3Z A;  4JV0 A;  3MJ5 A;  1FMA D;  3K9P B;  1ZRN A;  1CEZ A;  2JSV X;  4TQ0 A;  1NVI D;  4WJO A;  2Z8L A;  1S97 A;  2HI0 A;  1ZQM A;  4ICV A;  2CPR A;  1P7E A;  1X42 A;  3IT4 B;  2CJN A;  2LM1 A;  2OEH A;  4US8 A;  4KLI A;  1CQV A;  2H89 B;  3L54 A;  1MQ2 A;  4R8U A;  4MF8 A;  2MP2 A;  2KNJ A;  2QIL A;  1QT9 A;  4Y2S A;  4YMO A;  4E0D A;  2K25 A;  2K8A A;  3ONN A;  2NCN A;  3ZD9 A;  1KRH A;  2PVG C;  5MPO A;  2JEJ A;  3KZI U;  3RB6 A;  4GFJ A;  4EEY A;  1X9S A;  4KLH A;  4KLD A;  1N5W A;  3BIN A;  3ZXV A;  2LHD A;  1YJI A;  9ICE A;  1WXA A;  1TS3 A;  1QF6 A;  2ALZ A;  3DPD A;  5KTQ A;  4CCH A;  2MBQ A;  1IGD A;  1ZD4 A;  4I6N B;  1XLQ A;  1WZ0 A;  3U8Z A;  1RQL A;  4HRS A;  3TKA A;  2LWP A;  5JH5 C;  3WAM A;  4CNQ A;  4YVZ A;  2WB1 C;  1FXA A;  1WGK A;  3KQ4 A;  2KN4 A;  5DPW A;  1N61 A;  4NLC A;  2JXJ A;  4AP9 A;  5HG2 A;  3GV7 B;  3ZDB A;  2JH7 A;  5BMH A;  2KJ9 A;  4M00 A;  4PK1 A;  1WMH B;  5AKI A;  4N6E B;  1C3T A;  3Q8L A;  5EWE A;  2AQ4 A;  3NZS A;  4P7I A;  4HPP A;  4KZ0 A;  3RD2 A;  1WFY A;  3OPX A;  1CZP A;  2KFJ A;  3Q8M A;  4F50 A;  4OCZ A;  4IQV A;  4J9Q A;  2NRW A;  3WK4 A;  4DHZ E;  5KFJ A;  5IIN A;  5KFG A;  2JRI B;  2LJI A;  5J18 A;  4RGT A;  3KHH A;  3RNG C;  3N20 C;  4RM8 A;  2P6U A;  2JX5 A;  3QUC A;  1JW9 D;  2J6S A;  4RCO A;  1QOG A;  1RXW A;  1Z5S B;  4ECS A;  3PZD A;  5AZG A;  2M0N A;  2BQ3 A;  1LQB A;  2J0J A;  3TMP B;  2BYE A;  2NVU I;  1FO4 A;  5EOZ A;  1ZKH A;  4XDD A;  4UAV A;  3UMB A;  3K9O B;  4WUR A;  2P35 A;  1WWU A;  1H4R A;  1ED1 A;  1MJD A;  1TS2 A;  1NEK B;  2D3A A;  3T3F A;  1RM6 C;  5JUM A;  5AIB A;  2JXT A;  1N60 A;  5D3I B;  2HBJ A;  2JEG A;  4RF1 A;  1BNO A;  5E6N A;  1C4A A;  3ZTC A;  1PUZ A;  1RFK A;  4YMN A;  9ICB A;  2PMV A;  4N58 A;  3ZTD A;  1UD7 A;  4JWM A;  3J81 j;  1KFT A;  2ASJ A;  1GB1 A;  2R8G A;  1ZET A;  2KZM A;  3FKY A;  1ZJN A;  4ECW A;  2IGD A;  5KAF U;  3AEE B;  2ZJ8 A;  4YSX B;  3AU2 A;  3QU7 A;  2FAZ A;  3QEA Z;  4JUZ A;  1RRB A;  1TK5 A;  3H8M A;  2NRX A;  2W54 A;  5ALN A;  2OJR A;  3Q8Q B;  3C2M A;  4PL1 A;  4IC7 B;  4BKS D;  5F9N A;  4FO6 A;  4QIW F;  2L32 A;  4DBG A;  2HCF A;  2NTT A;  4A90 A;  1MA7 A;  5KFM A;  2W7O A;  4QWC A;  3UGB B;  3M9N B;  2WF5 A;  5ALQ A;  4Z6F A; 
#chains in the Genus database with same CATH homology
 1GAQ B;  3AM9 A;  1E10 A;  2WXI A;  4P6V F;  2L52 A;  3W5V B;  2K3U A;  2PVO D;  3CWI A;  3KLS X;  4XDC A;  3U2S C;  1L6U A;  3VRA B;  1K52 A;  2GI9 A;  3LYY A;  1DOI A;  1L0Y B;  3Q8A A;  4C56 C;  2KDM A;  2MH7 A;  5AUI A;  3ETR A;  1XLN A;  1TKG A;  3GS2 A;  5G5G A;  4XE0 A;  3VR9 B;  1AYF A;  1NYQ A;  1IBX B;  1ET6 A;  1TZO A;  3E56 A;  2I2Y A;  1WYG A;  1HZ5 A;  5JXV A;  4AQ7 A;  1HZ6 A;  3EUB 2;  1ZDV A;  1ZXI A;  3AE6 B;  1TS5 A;  2JYT A;  3EGR A;  4JE3 B;  2L83 A;  1TKE A;  1FIQ A;  5D7G A;  3J9C A;  4IDI A;  4YTP B;  2BYT A;  1GB4 A;  1P7F A;  1ROE A;  3BK2 A;  4KKJ A;  4RFB A;  2ON8 A;  3BYY B;  4US9 A;  1LO5 D;  1EWC A;  4REZ A;  3B2G A;  1YQ3 B;  5BYQ A;  1V8C A;  3KWV A;  2N9K A;  4USA A;  3N9Y C;  1UUP A;  4WAF A;  1YMH E;  4ZOH C;  2QMT A;  2ICI A;  3SFD B;  2WU5 B;  2AQ2 B;  3P63 A;  1XXG A;  3AED B;  1UGJ A;  1T6B X;  1XO3 A;  2WXN A;  1E9M A;  2AQ3 B;  2J52 A;  5FKA C;  3IXS A;  4RF0 A;  1SXT A;  2Y3A A;  2WU2 B;  1F77 A;  4AS1 A;  1ESF A;  2M19 A;  2J4X A;  2MJE A;  4OZC A;  1J7B A;  1SE3 A;  5EE9 A;  4JPS A;  2DLB A;  3ZQ4 A;  1L0X B;  3BVZ A;  1N62 A;  1FRD A;  2BB5 A;  2J42 A;  1KTK A;  2QSD A;  4UDU C;  3ZJU A;  4RGM A;  3B2F A;  4YTN B;  1L5P A;  2INP E;  3Q8C A;  1FCC C;  2WP9 B;  5C3J B;  1PGA A;  2HDE A;  2Y5C A;  4YSY B;  4YWG G;  4WWM A;  1AWD A;  3NVW A;  4JWS C;  1FFV A;  2OED A;  1SB3 C;  2KAC A;  5H8Y E;  1I4X A;  4YTM B;  4B0M A;  1T5X D;  1L6V A;  4A6Q A;  1E0Z A;  4GDK B;  1RYJ A;  4A55 A;  1VR9 A;  2XNA C;  2V0G A;  4C7Y A;  3I57 A;  3U7Z A;  2SAK A;  5EE0 A;  1M4V A;  1N63 A;  1DOY A;  3Q8F A;  5HI1 A;  1Q10 A;  1V1P A;  2W55 A;  3NVV A;  1EU3 A;  1SF0 A;  3VRB B;  4DXF A;  1V1O A;  1F2R I;  3GP7 A;  2R61 A;  2Y5P A;  4L23 A;  2WXH A;  1E6E B;  2WNM A;  1KLG D;  3FIL A;  1ENF A;  5H92 C;  2WXL A;  2IJ0 A;  2E6X A;  2IGH A;  3P4Q B;  4YSZ B;  1D4B A;  2LGI A;  1EM7 A;  4N59 A;  3MC0 B;  3HVD A;  1NYR A;  2J53 A;  1TY0 A;  1OQR A;  1SSN A;  2W3S A;  1F0Z A;  3P42 A;  4LTU A;  4B0E A;  4L1B A;  4H2A A;  1TS4 A;  3NS1 A;  2EEL A;  2INN E;  3AV8 A;  1YJJ A;  4NZL B;  4ZHP A;  1XLO A;  1C78 A;  2PLP A;  3R2I A;  1PDX A;  3BII D;  4YXD B;  1SE2 A;  2HTM E;  2JU6 X;  2AX5 A;  1MPE A;  2RDH A;  2PW9 A;  3MHZ A;  2V3P A;  3Q8B A;  1N5X A;  2WXM A;  2ZW0 A;  1JML A;  3NUH B;  3IAM 1;  2MJ3 A;  3UI3 A;  2BW2 A;  1I7H A;  2WXP A;  4O1N A;  4ZYS A;  4WQM A;  4LK0 M;  2BS2 B;  1I4P A;  2WS3 B;  3P4P B;  4MM3 B;  1MVK A;  2JZP A;  5GXG B;  3NVZ A;  1B9R A;  1FFU A;  3CIR B;  4RGN A;  2ACZ B;  3R8B A;  5BMI A;  2K9X A;  4MAC A;  1HA5 A;  1EWY C;  1D6E C;  3AE3 B;  4KGR A;  4ARI A;  1AW7 A;  4TSS A;  4NAM A;  1TJE A;  3FAH A;  1JCK B;  3AB5 A;  1MI0 A;  1J7A A;  2PKO A;  1JRO A;  3GB1 A;  4KKI A;  5D3D A;  3P4S B;  1VDV A;  3AE4 B;  3O13 A;  3OWE B;  2LUM A;  4A9A A;  2FE8 A;  5BYR A;  3E9S A;  1C79 A;  2WDQ B;  2NTS A;  4MH8 A;  1K53 A;  1SIJ A;  1D5M C;  1SBB B;  1YQ4 B;  1NEN B;  1QKZ A;  2EKI A;  1ZDX A;  1CK1 A;  2L1A A;  3AN1 A;  1TYG B;  1XEE A;  4P16 A;  2I38 A;  2N7J A;  2CJO A;  3W2D A;  3P1M A;  3ZJT A;  2JYE A;  3BVM A;  3L4P A;  2WDV B;  1NI3 A;  3AEC B;  1BML C;  3AE2 B;  1VLB A;  3VR8 B;  1IGC A;  1AN8 A;  3ABV B;  3ZGZ A;  3AEB B;  5EE3 A;  1VZ7 A;  1OQQ A;  1FNU A;  1I4R A;  3URY A;  5HHD G;  1VZ8 A;  2D5G A;  1B1Z A;  1I4H A;  3V3X A;  1OFF A;  1GOZ A;  2MJD A;  3Q8E A;  1ET9 A;  4OZA A;  1J7C A;  1A70 A;  2X38 A;  1DOX A;  3AEA B;  1FNW A;  1ZE3 D;  3ZJV A;  3P4R B;  1RWS A;  1SJH D;  1FCL A;  1WRI A;  3W1S A;  2BS4 B;  1IUE A;  1FD6 A;  3WCQ A;  3BWU D;  4HEA 1;  1KLU D;  4C7Z A;  4ZRQ A;  4KGS A;  1Y56 A;  2N0S B;  1VRA B;  1WSP A;  2WLB A;  3C8Y A;  1ACC A;  2K5P A;  3RPF C;  4WH4 A;  1XCT L;  1D5Z C;  1JWS D;  5FR3 A;  1BUI C;  1UWM A;  3V05 A;  3H8H A;  2LHE A;  1FEH A;  3AE1 B;  3PO0 A;  1KFY B;  2DYO A;  1TKY A;  2JQR B;  4NJC A;  2N9L A;  2VZK D;  1QOF A;  1C77 A;  4C80 A;  1ZPS A;  1YN5 A;  3BVG A;  3W9C B;  5AUK A;  1QIL A;  5G5H A;  2M56 B;  4JWU C;  3TEW A;  2K22 A;  2ONQ A;  3R2T A;  4HKQ A;  3DWM A;  4RGO S;  3VQI A;  3MP9 A;  1PGB A;  3KWL A;  4OHJ A;  1FRR A;  1K50 A;  1DGJ A;  1ZP0 B;  4ZHO A;  1FXI A;  1YNT E;  2WDR B;  1MHX A;  2OHF A;  4D2K A;  1DYQ A;  1PYW D;  4OZB A;  1GPX A;  1C4P A;  4ARC A;  4ITK A;  2B76 B;  2QJL A;  4NAW B;  3TEY A;  2QIE B;  1K51 A;  4JX1 C;  4TMA B;  2BBC A;  4KX6 B;  4KGT A;  2BS3 B;  4PT5 A;  5BMG A;  1XF5 L;  3NZ3 A;  3AE5 B;  2YEP F;  3AEG B;  4IKG A;  1EU4 A;  1VZ6 A;  4HJG E;  2V3N A;  2DBY A;  1SE4 A;  2WXJ A;  2WXK A;  3TEZ A;  3T3N A;  4HRO A;  4Q2J A;  3AH7 A;  2RDG A;  5I4D A;  3T3O A;  3HRD D;  1SEB D;  2H88 B;  3AE7 B;  1JRP A;  2MEK A;  4WIP A;  1F2R C;  2WXR A;  1UWX A;  1L4Z B;  2G1E A;  2YEP B;  4YT0 B;  4L2Y A;  2LMC A;  3MJ5 A;  4GDL B;  5BYS A;  1FMA D;  2QEJ C;  2JSV X;  1YN3 A;  4TQ0 A;  1NVI D;  3DWG C;  4RNA A;  2Z8L A;  2IDY A;  4EE2 A;  2LFI A;  1P7E A;  3BZD B;  3IT4 B;  2G9H D;  2CJN A;  2WXF A;  3LXF A;  2Q5W D;  4US8 A;  2H89 B;  1CQV A;  3IAS 1;  2FBW B;  1R7S A;  1FM0 D;  2QIL A;  1QQR A;  1WWT A;  1QT9 A;  3MFG A;  3I9V 1;  1HEZ E;  1KRH A;  1MHH E;  2PVG C;  5MPO A;  2WXO A;  4GLS C;  1V1P B;  1HXY D;  2CU3 A;  2PTL A;  2V4I B;  3LB8 C;  1N5W A;  2XN9 C;  2TSS A;  2GRI A;  2BB6 A;  1C76 A;  1YN4 A;  1YJI A;  2LHD A;  4RH6 A;  3RFZ B;  1TS3 A;  2WXQ A;  2W82 A;  1QF6 A;  1I4Q A;  3Q69 A;  2WXG A;  3FIL B;  1L4D B;  1JAL A;  4FXC A;  1VJK A;  2FUG 1;  1IGD A;  2SEB D;  3SFE B;  1XLQ A;  2W3R A;  4HRS A;  3ZYY X;  1QOB A;  4TQ1 A;  1JWU D;  1JWA D;  1FXA A;  4LLG M;  1WGK A;  3KQ4 A;  2VZK B;  1D5X C;  2AQ1 B;  2KN4 A;  1N61 A;  2JWU A;  1ZOY B;  5HG2 A;  1C4C A;  1HQR D;  1T3Q A;  2BT6 A;  4R3D A;  2KMM A;  3BK1 A;  5BMH A;  1IBX A;  1JWB D;  1KF6 B;  1CJE A;  1PUT A;  1UNS A;  1ZUD 2;  1ZXH A;  3AE9 B;  4N6E B;  1BXT A;  1L0V B;  5C2T B;  3BYT B;  5E6J A;  2M0A A;  2BTE A;  4XWW A;  4M0W A;  1CZP A;  5T8I A;  1E7P B;  3AEF B;  3AE8 B;  2LJI A;  2GB1 A;  1FNV A;  4RGT A;  3SEB A;  3U52 E;  3U4E G;  1STE A;  2JX5 A;  1JW9 D;  2KWD A;  2WQY B;  4RCO A;  1QOG A;  3FC4 A;  1XCQ L;  3W5U B;  2NMQ A;  3HVZ A;  1FO4 A;  4XDD A;  2E3T A;  4WUR A;  4OW0 A;  1SJE D;  5LNK 1;  3B9J A;  4MT5 A;  1TS2 A;  1NEK B;  1RM6 C;  4CQN A;  4J3O D;  3HUI A;  1V97 A;  2ZW1 A;  2JXT A;  1N60 A;  5D3I B;  2K0P A;  4RF1 A;  3TSS A;  1JQ4 A;  2RPV A;  4DQO C;  1C4A A;  3PZ7 A;  1RFK A;  2PMV A;  4N58 A;  1JWM D;  3NVY A;  1GB1 A;  1C9F A;  1PGX A;  3AMZ A;  2IPK D;  1TY2 A;  2DYM A;  3PZ8 A;  2PIA A;  5TSS A;  1I4G A;  2IGD A;  3TEX A;  2LEK A;  3IT6 B;  5FK9 C;  3AEE B;  5HFY A;  4A8X C;  4YSX B;  4OVZ A;  4ZRP A;  1KH0 A;  4XWT A;  2KQ4 X;  3TUO A;  4DXG A;  1XLP A;  3SR6 A;  2W54 A;  2DWQ A;  4HKZ E;  3NRZ A;  3EA6 A;  2L32 A;  2NTT A;  4A90 A;  4IOI E;  1WXQ A;  1QLB B;  1QOA A;  2RMM A;  5EE1 A;  2IGG A;  2KAJ A;  1PFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...