1N5WA

Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
total genus 48
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n5wA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n5wA01
1L6VA 3P63A 1J7AA 3AE5B 3P4RB 3AE1B 3B2GA 1FO4A 1WXQA 5AUKA 1QLBB 3AEGB 4WQMA 2PVOD 1RYJA 1WGKA 2L83A 4WWMA 2W3RA 3NRZA 1FM0D 3FC4A 1L0VB 1JALA 1E7PB 1JQ4A 1ROEA 1UWMA 4JWUC 5EE3A 1FFVA 3DWGC 1ZXIA 4C7YA 1N62A 4N59A 5EE1A 3VRAB 1ZOYB 1A70A 2K5PA 2ACZB 1EWYC 2WU2B 1N63A 3AECB 2G1EA 1WYGA 1YJJA 1L6UA 1FXIA 2H88B 3B9JA 1N5XA 1AYFA 1IUEA 1VJKA 4N6EB 1N61A 2WDRB 3SR6A 3AEEB 3AMZA 1NENB 1QOGA 1FRRA 5G5GA 3PO0A 3W9CB 3P4SB 2PIAA 1JRPA 4LTUA 2WU5B 3LXFA 4YTPB 1CJEA 2WLBA 5C3JB 4ZHOA 1SIJA 2EKIA 1XLNA 3ETRA 4C7ZA 1QOFA 1V8CA 2QJLA 3KWLA 1NVID 2FBWB 2Y5CA 3SFEB 4YSZB 1GPXA 2WDQB 3NVZA 3AEFB 5C2TB 1YQ3B 2WP9B 4ZOHC 1RFKA 3VR9B 2WQYB 2M19A 3NS1A 1JWBD 1VDVA 1QT9A 2B76B 4ZHPA 1TJEA 1KF6B 3B2FA 1DOIA 4KX6B 1NEKB 2N0SB 3SFDB 1FRDA 3AE4B 3ZYYX 1B9RA 2H89B 1TKGA 1PDXA 1RM6C 3W5VB 3AE6B 4HRSA 2LEKA 1CZPA 2PVGC 1ZP0B 3AV8A 1N5WA 2WS3B 3LB8C 1JWAD 3FAHA 1AWDA 2Q5WD 4HROA 1ZUD2 1NYRA 3AB5A 1FIQA 3AE3B 2DWQA 4P6VF 4IDIA 3HVZA 2HTME 4JX1C 2CJOA 1FFUA 2BS2B 3BIID 3AN1A 1QOBA 2W54A 3CIRB 1J7CA 4US8A 1OQQA 2E3TA 1PUTA 2MH7A 2PKOA 3ABVB 3AEBB 4YSYB 5AUIA 3P4QB 1QF6A 4JWSC 3L4PA 1YQ4B 5MPOA 3NVYA 1WWTA 2BS4B 3AE9B 4YXDB 2KMMA 1NYQA 1DOXA 2W55A 1WRIA 1TKYA 4ITKA 2CJNA 3P1MA 2L52A 1GAQB 5H8YE 3AH7A 1JW9D 5H92C 3AE8B 5EE0A 3NVVA 1VLBA 4A9AA 2MJDA 3HRDD 1F0ZA 3HUIA 1XO3A 2K9XA 3EUB2 1R7SA 2DBYA 4YTNB 1E6EB 4C80A 3RPFC 4FXCA 1T3QA 4US9A 3VR8B 3AE7B 1N60A 3WCQA 1FMAD 1OQRA 1SB3C 3P4PB 5GXGB 3AE2B 1XLPA 3VRBB 3AEDB 3DWMA 1DGJA 1E9MA 2KAJA 2K22A 1NI3A 1PFDA 2CU3A 1DOYA 3AEAB 1XLOA 1RWSA 2BT6A 1E0ZA 3AM9A 1OFFA 2MJ3A 2WDVB 3NVWA 4YTMB 4USAA 5EE9A 2MJEA 1JROA 1I7HA 1E10A 1TYGB 1KRHA 1J7BA 2AX5A 1TKEA 2BS3B 2JQRB 2JX5A 1QOAA 1FXAA 1SF0A 2W3SA 1XLQA 4N58A 1V97A 1KFYB 4YT0B 3W5UB 4YSXB 2QIEB 2OHFA 1L5PA 2M56B 3CWIA 1YJIA 5G5HA
chains in the Genus database with same CATH superfamily
4DOAA 4K3CA 2OYYA 7ICJA 2KYWA 8ICXA 3KUZA 1XCQL 2JY6A 1D9DA 5KT2A 5KL8B 4GB9A 1CK1A 1P98A 3R66C 3M8RA 2UVWA 4UBBA 1KLGD 2ZG6A 4KMUA 2IBKA 4RUCA 4N9F4 5DB7A 1KSPA 2OJRA 3DWGC 4IM0A 4K3BA 2ZIVB 2NV3A 4YN4A 5KFRA 1FNVA 2LGYA 4ECSA 2ZPNA 3MDCA 1AYFA 1KLNA 1NK5A 2Z0EB 2K4EA 2FPMA 2W04A 3DVGX 4NLCA 3P4SB 2YVCA 3T5KA 3RJGA 3HW8A 2V3NA 3PX6A 4IC7B 1F9JA 2JEGA 3GE8C 4FADA 4K4HA 2NPTB 2AGPA 2WNMA 3W2DA 4YFKA 2LRUA 2KJ6A 3UPQA 3V6CB 1MA7A 4R64A 2WTFA 2NS5A 2NTSA 1RZTA 1ZETA 1VDVA 2LBOA 4B9KA 2UU7A 1L4ZB 4LK0M 2QCZA 4Y2QA 2K89A 3FDSA 2KDEB 3KYCD 5ALHA 2HDEA 2GBMA 3AUOA 5JRTA 4EKUA 3MBYA 1C7YA 1XT9B 2ZUBA 4P0QA 4Q43A 1K1QA 2KFKB 3AV8A 2RGFA 3TQ1A 3VAWA 1AWDA 1ZE3D 5KAFU 4K7SA 1ZUD2 2A1JB 4UARA 2HVIA 4RCOA 4TKNA 4IR9A 1GJZA 3GILA 3HVZA 1TS5A 1SXTA 4NPNA 2R8JA 3X23A 2I5HA 2BB6A 8ICGA 2PFQA 2WF9A 5J0RA 4US8A 2JVCA 1V5TA 2F3NA 1PUTA 5KFXA 4J3OD 4EZKA 2KIWA 2AH5A 1WWTA 4RNMA 4YXDB 4K7UA 1Q8KA 1YMHE 5CHVC 1DOXA 1TKYA 3A0BU 4F71A 8ICWA 2LZ6A 4KLDA 4P4PA 3OJSA 3AE8B 2L05A 4GXBA 2PFPA 4B0MA 2QB0B 3ED5A 3WKAA 4EX7A 1FNWA 1D3ZA 2ZTDA 3KD3A 2W9BA 2M0NA 1JWUD 1RYRA 2R18A 2YMQA 3MC0B 5AK3A 3V3XA 4FBUA 4ANWA 1GB4A 1SE4A 2CS4A 3N1ZC 4MACA 1S0VA 1BGXT 4TQ0A 2XIDA 2LWPA 2CPRA 4UASA 2MP2A 2HHTA 4MFCA 1MG4A 4R63A 4GXKA 3RN9C 1DOYA 1XLOA 2JXXA 2IY0B 1SGHA 1V1PA 2JGAA 3N4MB 3IXSA 5DGBA 2L1AA 1D8BA 4LLGM 5J0PA 2BPGA 4KLMA 4M8MA 4MGIE 2I2YA 4R8UA 3NTUA 4BFRA 2FUG1 3EC8A 2FCMA 2M56B 3L13A 2HBMA 4C00A 3EFUA 3RI7C 3EYZA 4I2GA 3H7SA 3MJ5A 2EMSA 4HCPB 1XEEA 1AROP 4F4YA 4DQIA 4ED7A 3B1LX 1KLVA 5JXVA 2KSOA 1QZEA 1FNUA 4AOFA 3QU4A 5KFKA 3DDHA 2N9PC 4PS8A 4CGZA 2VA3A 2DAFA 1WYGA 2J0KA 5HI1A 4KLTA 5GTHU 2H88B 3WAOA 2WXIA 4GXIA 2G07A 1N61A 1SXEA 5ALZA 1F2RC 2WF5A 4YR3A 3FYHA 3F2CA 4KMOB 5KFEA 2AEHA 3PSTA 2J6TA 2BYEA 3RT3B 1WR6E 4YXJA 4MF8A 2L32A 2F76X 2G45B 4CDGA 2VKQA 1ZD4A 3MFHA 3NJTA 1KTKA 3NUQA 1KJTA 7ICEA 1I4XA 2HD5B 4U7CA 2GLEA 2HTHA 3PX4A 4M8NA 2Q0ZX 2KOBA 2BDPA 4M0AA 1EF5A 3IAM1 2F77X 2YQEA 2XGQA 3SD7A 2IO2B 3DVNU 4M9NA 3ZQ4A 3OSPA 2N9EB 3LB8C 3P2BA 1UBIA 4KKJA 4AWJA 2PXIA 1WZ3A 5ALUA 3Q8SB 2LI6A 4IDIA 3QX7A 1KW4A 5J2HA 3BQ7A 5ALIA 2NRZA 2DNFA 2N7EA 4HYKA 3T3FA 2FMPA 1YN4A 5ALSA 2J0JA 4NJ6A 2WXNA 3BYTB 3AEBB 2IY1B 1PGBA 5AUIA 4QWAA 2EZYA 2Z7JA 2FDRA 2MW5A 3H9DA 3ONSA 5MPOA 4KGSA 2H3VA 2PEAA 4PK1A 3Q8EA 1E5WA 2ZIXA 3CNHA 1Q5WB 1X6IA 1WI0A 2GO7A 4TURA 1A76A 4I2FA 2WB1F 4PGXA 1RXWA 3OTQA 2H3IA 2MSNA 3MGIA 3TFRA 1O08A 1R4MI 2C7MB 1TBEA 3BZDB 3VTVA 7ICIA 4DCCA 1XO3A 5KFUA 4O3PA 2N9KA 4CQNA 5DG8A 4C80A 4GGQA 1QQRA 4I2HA 4GC7A 1ZQHA 1L4DB 3L0WB 2JWUA 4IQVA 3CRXA 1Y8RC 3BVMA 4YD1A 2OH2A 1WX8A 4XZ4A 3PRMB 3S2AA 4JQWC 4H2AA 4RQ5A 1RWSA 3GV7B 3EHVA 2QHOA 3WA0A 4B9MA 1TZOA 4JL9A 1O03A 1KRHA 4BOSC 1LQBA 4FZLA 3ZJTA 4YT0B 5D3IB 1L2NA 5IINA 3UMGA 2WB1C 1SWWA 3JPTA 1SZHA 5DG7A 2KV2A 4W9KA 3GDXA 1T0RC 4B9SA 1V5OA 5T8IA 1C78A 5KFOA 3C1YA 3ZIMA 1WIAA 1TV9A 9ICCA 5JUMA 4RQ6A 3QIJA 3AEGB 3R3MA 1IP9A 5AKHA 4P7IA 3Q8FA 2QARB 1WGKA 3Q3MC 2KZMA 5AZFA 4A6QA 3IHQB 1L0VB 1ZQXA 4WAFA 1D8LA 3SZ2A 4IM2A 3B0YA 2LM1A 4I2CA 4DS5A 2C9WB 4XA5A 4ELTA 3IV6A 1KKXA 2KIVA 5DPRA 4I2JA 4DXFA 1N6ZA 3B9JA 1N5XA 1KDHA 3IBEA 4WH4A 4GDKB 4TSSA 1WM2A 1FRRA 3H0LB 5J29A 3RRGA 4AJYB 4L1BA 5FK9C 4RUAA 3SV4A 2ODGA 2QJLA 3KQ4A 3N30A 4FHKA 4JE3B 4IM3A 2KC1A 4OZBA 3W1SA 2MBHA 4J9KA 2E8OA 1HEZE 5IN7A 5KT3A 4E3CA 2K8CA 3EECA 3RCZA 3H7PA 4OZAA 1C9FA 2FCSA 2W8LA 2WHIA 3RJFA 2YB1A 3LWMA 1NI2A 2AQ2B 1E8WA 1TE2A 2PMZC 2VJ4A 4RQ3A 2NRVA 1ACCA 2KD0A 4IQTA 1R4NI 2E5SA 3PZPA 5KAIU 9ICUA 1T0SC 2AQ3B 2KN5A 4P6VF 3M9MB 2A5UA 3DBRI 2DZIA 2HTME 4QZ9A 3I76A 2EZXA 2IOFA 3AN1A 4DLGA 4DSLA 3K9PB 3QQ8B 4QWEA 4B9VA 1UPHA 2DHZA 2ZNVB 2KMDA 3L16A 2XBBC 2CHWA 3N1XC 3RMKC 3TIXA 1YQ4B 3PW2A 2ZW0A 5ALEA 1L6NA 1TGZB 3A4RA 3AE9B 2LHEA 4S0RA 2K8AA 4YD2A 2KMMA 3NG0A 4KLSA 1N2XA 4DL4A 5KFNA 2LI5A 5IAAC 3R7RA 3T3OA 1ZD2P 1S5LU 4G9BA 2K0PA 2WHEA 2WXQA 5IKCM 3LDZE 3V6EB 4BOZB 2LPEA 3M9OB 1JW9D 4I6LB 3NVVA 1UA1A 3GU3A 3DBSA 3PPAA 2GRIA 2YLMA 1UNSA 2HOIA 1T3QA 4ECQA 3WCQA 5DLGA 1WE7A 2K25A 3O0FA 3AE2B 1K1SA 4K1RB 3DBHB 5KG2A 1X9WA 3RJEA 3L17A 4ZRQA 2C22A 3OHBA 1OW5A 3GZNB 4P16A 3VUWA 4M47A 3RB3A 1T94A 4YTMB 3KOOA 4GLSC 4AS1A 2G5IB 3VQIA 1XLQA 2FAZA 5DPSA 1J2NA 4LJPB 4FULA 1MJDA 4WJQA 3PVXA 1K51A 1XXGA 2YX8A 2M9NA 5KHQA 1PK1A 3RH4A 2BWES 4Z6CA 3PTFC 2HHQA 5HR7A 4NY8A 2SEBD 8ICLA 3GIIA 4QNLA 4JV2A 2ZXHA 5L1MA 2V1YA 5TZVA 1HE8A 3C8YA 4W9CA 2NVUI 2IZVB 5AKJA 3NRZA 1V9JA 1UWXA 4E71A 1CI4A 5KFIA 5KFAA 2FE8A 2EAPA 4J9RA 4JWUC 5KFVA 2XICA 2P35A 2OWOA 1SEBD 2P6UA 5K4LA 5AI4A 1NJXA 2V4IB 3MC1A 2QC8A 2WU2B 3VRAB 3AECB 4ECTA 1ZQLA 3PSFA 1YJJA 4ICUA 2LGDA 1FXIA 2ZVNA 3DVNV 1VJKA 2I1QA 5BOLA 1WCLA 3JPOA 1K8RB 1YNTE 3N7SC 5ALNA 4RFBA 4NAMA 2JZBA 4MEXA 4J9SA 4NWIA 2A3VA 5AM1A 2K8BA 8ICAA 3MR2A 1C4CA 5KTQA 4C4VA 3URYA 2IHMA 4ECVA 1LXDA 2G9HD 4YMNA 1E7VA 4W9HA 4M9JA 4KITB 4ZOHC 3ZLZA 3GP7A 2A1AA 4UB6U 3SU8X 1SGGA 4ED3A 3T5LA 1WRDB 4UB4A 3AL0B 1ZDXA 3VUXA 4PHEA 4J9PA 1TKGA 3ML9A 4YR2A 2D6FC 2L3ZA 4MGZE 1OUQA 1NKBA 4RH6A 5KFPA 5J2KA 1X9SA 1MC8A 2N1RA 4K4GA 2KHWB 4XYCA 2F8KA 4M02A 3FAHA 3V62A 4DFPA 5AK5A 1UT8A 4HPPA 2MBBB 2J4XA 3D2NA 3PLUA 4GFJA 5J2FA 2DGZA 4O3QA 1F5SA 1NJWA 5HMMA 4MSMB 3F53A 4C4TA 3ZGZA 3JSVB 4JPSA 1MPEA 1TS4A 2X38A 4DL6A 3IT6B 3ZRFA 2IGHA 4JWSC 3LYYA 2KDBA 4OCZA 2C2EA 1C4AA 4LJOB 3FM9A 3M63B 4M6WB 2GBNA 1CRXA 5KHOA 3HJEA 3AQEA 7ICVA 1WE6A 3WAPA 2KFJA 2KG5A 2ZW1A 2HBJA 4KZCA 3QU9A 1Z3EB 2ON8A 4A9AA 3U2SC 3H8HA 5DB8A 4Q8EA 2EELA 4ELVA 2W9BB 3VH4B 4RQ8A 2KQ4X 4RM9A 3IFWB 1WGYA 4O3RA 2XK5A 3I57A 2HJ8A 5GXGB 4TUQA 5ALMA 4BKTA 4BXOA 4FS1A 4P1CC 2GB1A 3I28A 3RYTA 2G5HB 2DKXA 4BGDA 5EE9A 3N3KB 3RB0A 4PS7A 1JROA 1I7HA 2BCVA 5BMGA 5BO4B 1QILA 2H3FA 1V1OA 4DOBA 4YR0A 3UI3A 3E58A 2KDFB 1U9LA 3DHIC 3B2GA 3I1YA 2D11A 4GIBA 3JSVA 5DCNA 4UB2A 4DXGA 2M4NA 1FO4A 5AUKA 4EFOA 1L7OA 3SD5A 2O2VA 3U4EG 5J0QA 4X57B 3Q3NC 2KVZA 3V7LA 2QKQA 9ICIA 4O5CA 1JALA 1ZRMA 1GUAB 4OVZA 3ZO5B 3K1ZA 3D32A 4R65A 5EE1A 3JPRA 4TQRA 4A8EA 1WGDA 3ETLA 4W9LA 3KZIU 5FR3A 4AUQC 4UDUC 9ICMA 4NL9C 3D2SA 5A0LA 5HG2A 5J8YA 3SDLC 2I6XA 4YTPB 1XO0A 2MBOA 3MP9A 4Y2RA 3Q6BA 5TSSA 5E79U 5BYRA 3KHGA 1JCKB 2ZVOA 4ANVA 4OJ6A 2Y5CA 2E6XA 1HTOA 2BTEA 5F3XB 2BR0A 8ICJA 2KT7A 2H5XA 2V3SA 5EDSA 5DDMA 4LZGA 1X9XA 3RJIA 4WQOB 5AHXA 1URJA 2LVOA 3AE6B 2LEKA 3E0FA 3AI5A 3G6VA 4GXJA 2XY7A 2PFOA 2MEKA 3AE3B 4AQ7A 8ICUA 2KHQA 2MQJA 2BQQA 5KG3A 5KL1B 4PHDA 1PVQA 5ALYA 3MHZA 4U6PA 2IA6A 4XWTA 2ZTCA 3BQ2A 1QOBA 1QH9A 4KSLC 2DZMA 3DOWA 1PK1B 2HCFA 2F1IA 3HKZC 3QXGA 3PW5A 4UAYA 3U7ZA 4ZRIA 1T6BX 2BS4B 5BYQA 2J6UA 5B66U 5J0SA 2KSOB 1DRGA 8ICHA 3N97B 1QSYA 2ISOA 2JUOA 4Q2JA 2BBCA 2NR2A 4NM1A 4TQSA 1M4VA 2KFNA 2KO3A 2EZZA 3HX0A 2FMSA 1LO5D 1ZQRA 2RR9A 3GOEA 4FBJB 1L8LA 3HRDD 2R8KA 3GZFA 7ICGA 2OCEA 2IO3B 5J0XA 4W9DA 3TJPA 3W1YA 1P7EA 1C20A 4F3OA 3VR8B 4KN7A 1V9PA 4C8MA 4BWMA 3PNCA 1FMAD 3P4PB 2N9LA 2KD1A 3KUCB 3KHLA 1PVPA 1NI3A 5KT6A 2VH2A 3SQIA 1KRPA 3UQAA 1ZD3A 2JYEA 4NL9A 1OTRB 1TKEA 2RLTA 3V7KA 4ZDVA 1X9MA 1EM7A 1KOTA 2KJ8A 3KBBA 2DPIA 2FLPA 4I2EA 1F2RI 1E8XA 3ZUNA 2RQ5A 1J2MA 4KTQA 1GO3F 1SKRA 3M62B 4NZLB 3K1RB 1UUPA 1WX9A 1KFDA 1V38A 4Y2YA 1YQBA 2PVOD 1HEKA 3DCGA 4L23A 4KN4A 1NK8A 1QKZA 3TEZA 4PJ0U 2R2QA 1PK3A 1KLUD 2IGGA 1I4HA 4Y2JA 4KLOA 8ICQA 2I1KA 3TEWA 4PZNA 1WXAA 3PS6A 3CP8A 3Q8BA 5KFDA 3ZNID 3DBLB 2XC9A 4XC2A 1R4MB 1T8EA 4FJVB 2ZXIA 1Z19A 2OM6A 3GQCA 2JHDA 1WCNA 2PFNA 4DWIA 4GLXA 1T5XD 4GU2A 1T3NA 3OGUA 2MLBA 3OJUA 1NENB 1ESFA 3QA8A 2D07B 4B9TA 5C3JB 3KYDD 4LJXA 2WXRA 4UW9A 5AEKB 1Q10A 4G3XB 2WDTB 4DF8A 4F92B 4EYHB 4F5PA 1WWUA 1L3TA 1RFKA 5J18A 2M19A 3RZFA 1WJNA 4GC6A 1IIPA 3U30A 1KF6B 2GMIC 3M8SA 2LVQA 2H89B 3Q8CA 7ICHA 5CEHA 1Q3UA 3WK9A 5D46A 1NDDA 2AL6A 4J9QA 3QU7A 5FKAC 3BQ1A 2XO7A 2V3PA 5C0YA 2I38A 2INNE 2NBUA 2DYBA 4IL6U 2L0FA 2HOFA 2Z0DB 3BK2A 2L8JA 4I2AA 2JT4B 1NK7A 2RRDA 1WY8A 1JIHA 2AHOB 2QB0A 2ZJAA 3LVWA 9ICNA 4RU9A 2G4DB 3EGRA 5D7GA 2JZ3B 4RT2A 1BPXA 3KUDB 3QWZB 4Q44A 2WXKA 2F1HA 1WRIA 2WXHA 4R3DA 2MP2B 2JRIB 1XCTL 2DL0A 5BOMA 1QSSA 1MQ3A 3DEEA 1FD6A 4OD0A 2HBKA 4F93B 4YTNB 3V6HA 2Y9TA 5TISU 2WF7A 3QEAZ 1HUZA 9ICRA 4I6PA 4A20A 2D8CA 3DVGY 2XVTA 4J9LA 2Y9UA 3CW2C 3KH0A 3NS8A 4A8XC 2Y5BB 3ZXRA 1SWVA 2G08A 5AIAA 2C28A 4DFJA 1WXVA 5E6JA 1I4QA 1NK6A 3R2TA 4IG7B 4JB3A 2OEDA 1ZQWA 4J9MA 3PW0A 1ZQYA 3HP6A 1H38A 8ICEA 2AXTU 2D3AA 4BVUC 3GV8B 2WGSA 2D3DA 4Y2UA 8ICFA 2ONQA 1J7AA 2BF8B 4DLEA 1WXQA 1XSLA 2ISPA 1PVRA 2BB5A 2LUEA 4F2RA 1QLNA 1OXJA 2BQ3A 4NLNA 1A0PA 1Y88A 2VH1A 4FJYA 4BKSA 2O6VD 3ZI4A 1V2YA 1LVHA 1FEHA 1ZQMA 3Q8PB 1YJ1A 4PHPA 3RFAA 1COKA 1K50A 5G2NA 2KICA 3TCAA 2IOFK 2ZIVA 1X2IA 4EZJA 3W9CB 1L3UA 1IXRA 5G5GA 3KLSX 5J2AA 7ICPA 4C4VB 2QARA 2WLBA 4DL7A 1XLNA 3KWLA 4C7ZA 1QOFA 3N20C 2LM4A 2IGDA 4AP4C 1SL1A 3TARA 2WP9B 4NJ8A 4JV0A 4BJQA 2DF4B 2KOXA 2R61A 1WXMA 4EE2A 1DOIA 5AI0A 8ICYA 5KG4A 5E6PA 1PDXA 2YMLA 1RG6A 2QSDA 2W9CA 2ZIUA 3GIKA 5D4BA 3IRUA 4P0PB 2A19A 5ALJA 4BBNC 1PUZA 1SL0A 1NYRA 1VZ8A 3JYUA 4I2DA 2DZKA 4F7ZA 2VIXA 2J53A 2L7RA 2NO4A 4BWJA 4NAWA 4NJ7A 4XDCA 5DKWA 1ZQFA 1I4PA 2BYTA 2OJWA 4CHKA 2CJOA 2W9AA 4GIVA 1Z1VA 1XS9D 4ECRA 2MH7A 4UBCA 2FLNA 2PTLA 2XY5A 3IG3A 3A1QA 4DHZE 1QF6A 2G3QB 1D9FA 1VRAB 4R8UB 5AKKA 4IKGA 3RUIB 2JV3A 8ICCA 5D3DA 4ZH4A 3DPDA 1XU4A 1C1YB 2CN1A 3RBDA 1SBBB 4AJWA 3P1MA 2FCQA 1L7PA 1RQNA 4ED8A 1D5MC 5EE0A 2DQNB 4NY0A 2IHNA 4OO1J 4N6EB 3OG5A 1I4RA 4DK5A 5CB1A 1CUKA 3IG5A 2Y1JA 1TZ1A 3LJ3A 2HW3A 3BVGA 8ICZA 2L76A 3ZNHB 2XI9A 1S0NA 2RSUA 4URKA 5EOZA 4QWDA 3B0XA 1XNSA 4PGQA 3HK0A 4C8LA 3PO5A 3OPXA 4ZRPA 1DGJA 1NK9A 4ACFA 2CU3A 3AEAB 2N7DA 2MJ3A 1TAQA 2HBLA 1Z00A 5F9NA 1ZQTA 4JWMA 2O6VB 3SHQA 2B6GA 1TK0A 5GMVA 2NRTA 4DDID 1J7BA 2BS3B 1MQ2A 2JX5A 3IP4B 5E6NA 5AZHA 4F5NA 1KFYB 1Z2MA 2KVCA 1HZ6A 2D3BA 1L5PA 5KNIA 1P1AA 4RNOA 1GB1A 1L6VA 3DV9A 4IQUA 3QE9Y 3DBRB 2KFZA 4GSWA 2J0MA 2MX2A 2LUMA 3RNBC 2A1JA 4DL5A 2RHFA 9ICQA 1BNPA 2L83A 3VCBA 3J81j 4OJPA 3QZ7A 2V4LA 1L3VA 1E7PB 2K1FA 3ICXA 5DBBA 1ROEA 3BVZA 2BVCA 5IILA 4P4OA 3TANA 1BPZA 2GBRA 3MR6A 3R8BA 5CX3A 1D8YA 1NNLA 4OZCA 4L2YA 2LMCA 4KX3A 3T5JA 1ZQJA 3AMZA 1BPBA 1WGHA 2INDC 3C5FA 3LXFA 2NPTA 2IO0B 4HXDA 2NMQA 5DBAA 3HPOA 1F44A 2JYTA 2MHJA 1ZQNA 2MSED 2NCNA 2ASQA 3AEFB 3PSEB 3QX1A 1RQLA 3VC8A 1QQ5A 4RQNA 2QEJC 4O3NA 3PR5B 1ZJMA 4CCHA 3DBHI 2KK8A 2WAQF 1X6JA 4PZOA 2KDIA 4QZBA 1Z4OA 4QZEA 2KQ7A 1WSPA 3KTQA 4FZNA 4OHJA 4O5KA 5IIKA 2WYQA 2MUTB 3SAGA 3OWEB 2KLCA 2KJ9A 2KN4A 2ZTEA 2JPHA 4KIKA 4HROA 1ECWA 4AYBF 4R66A 4QZDA 3EFCA 3PV8A 3IDWA 5AM4A 2Z8LA 3KZXA 2BCQA 3IN5A 4CF3A 2WXLA 4LNIA 5IP4D 3DHGC 5FR6A 4F91B 5KFFA 1NKEA 8ICMA 3UMCA 3EWAA 4M00A 5KFYA 4EBEA 1HQRD 3JVZX 4TQ1A 5HFYA 3ZRCA 4KLHA 2VJ5A 4YVZA 5TR5A 3NVYA 1TIFA 3V6KA 4C4SA 4EUTA 2KKVA 5F9LA 4YMMA 3PMNA 1K52A 4LNNA 5KFQA 1E90A 3UQ0A 1Q3VA 2KDMA 1WF9A 2KVSA 3C28A 3DBLI 5I4DA 4ZYNA 3TL5A 5J17A 5H8YE 1HTQA 4DL3A 1AARA 1F1HA 2KHVA 4E0DA 4I6NB 3H40A 2W7PA 1SV4A 1U4BA 5HMLA 4QZAA 3UMBA 5KFSA 4MH0E 3GIJA 1KN5A 3LYSA 1NZBA 2ZNVC 2W7OA 3N32A 1UQVA 2C7NB 2BW2A 1E8ZA 2ESEA 1E0ZA 1JQ4A 1SL2A 3PX0A 3AM9A 3ZDBA 4UAVA 7ICTA 4XDDA 4HKZE 3VTWA 2K60A 1GC6A 4EBCA 4UATA 1IG6A 1TTNA 1TYGB 4Y2PA 3ALRA 1SV0A 4O3SA 4F8RA 3EA6A 5C5JA 3HVDA 9ICVA 5DBCA 2RDJA 1MVKA 5DG9A 3OHAA 4C8OA 3TEXA 3V60A 4OVUA 2R8GA 3C1ZA 9ICWA 1U4AA 4LVSA 4DQRA 1PYWD 2KWUB 3E56A 1WH3A 4ZRJA 3ZTDA 2DYOA 4PL2A 4EZ6A 5L83A 1MG8A 3K9OB 1UWMA 2VRRB 3SI8A 3MR5A 3N1YC 3CIRB 3DQVA 2BGWA 5IOIA 4DHZB 4HCNB 4WJ3B 1VZ6A 4IC9A 3BZCA 1ZQGA 4NV0A 2RDGA 2K4HA 2ICIA 7ICMA 1TK5A 1YZ6A 1QOGA 1WUDA 1WGGA 3N28A 2YY6A 3H7IA 4XUSA 3MGVA 3JPPA 2YEPF 2FI1A 1GNUA 5HHIA 3B08A 4RF1A 8ICTA 1D5ZC 3M6ZA 3Q3JA 5KG7A 2KZZA 2LYHA 3SFEB 1VJ5A 1JWSD 3K75D 1P3QU 2LXCA 3CYMA 2WQYB 3VTUA 3X0WA 2RDIA 1RLFA 3BY4B 4P0QB 1X1MA 2PE9A 3B2FA 1NEKB 2GOWA 3FILB 3THVA 1L8OA 2N9XA 4GOCA 1I35A 4A3PA 1QQ7A 1LKYA 2KTRB 4RM8A 9ICGA 4M0WA 1KQQA 2AGOA 2UYZB 5CHWA 1MSWD 8ICPA 4E74A 4ZYSA 4MM3B 3BS5A 4OVVA 3R9KA 1J8CA 3ML8A 1SXDA 5IIMA 3RH6A 3UQ2A 4P0PA 3UINB 4HJGE 5CA7A 4AYBC 3PREA 3UGBB 5JZEB 1G6JA 4FS2A 1PZNA 3A9KA 4WWNA 4HEA1 4PYUA 3ZD9A 4KZ0A 4UB3A 4C4RA 3SEBA 4IWQA 4NLBA 4Z6DA 4BBNF 4UAZA 3D6JA 4DQPA 2KJ5A 3ZDEA 3Q8AA 3O65B 1S9FA 2FCNA 1QQ6A 4DQQA 8ICKA 4DSKA 3MC9A 4ITKA 2IBIB 3AH7A 3GS2A 1HUOA 3SENA 5HHDG 1F0ZA 2HHXA 5IA7A 2BHNA 2NBWB 1R7SA 3CF6E 4KGRA 2MCNB 3EW9A 4F72A 1IM4A 4QZHA 5J0OA 1UZXB 4FLHA 1ZJNA 3QK0A 1RDFA 3RB6A 4NLKA 2DX5B 3AEDB 3AULA 4DWFA 1E9MA 1AQ6A 1UCVA 5LXHA 4RQ2A 1JRUA 1TAMA 2KNJA 2LASA 3K4GA 4KX5A 4NXZA 3L08A 4IWOA 1MI0A 2MBQA 2WF8A 1SJED 3BZKA 1ZKHA 3U7DA 3QYPA 5BPCA 3W5UB 2XCPA 3A1QB 3RJJA 1ZQVA 3PT2B 2K3UA 3B0AA 3PRZA 1SIFA 2BWFA 2AYOB 4MEMA 2PW9A 4M9LA 3VHTC 4S17A 5L9XA 2ZZPB 1BNOA 1CMXB 4EEKA 3BDPA 1ENFA 1RYJA 4OW0A 3ZVVA 3VUYA 2MA9B 1S0MA 5KG5A 1C79A 1ZGUB 1EU3A 2KVRA 4CF5A 1S10A 1ET9A 2HOQA 5EE3A 2DKZA 2FPLA 2YB4A 4M9GA 4B9NA 3CSFA 7ICNA 3GE3C 2K5PA 4JGHB 2AJQA 1IV8A 5CTRC 1L6UA 2JRZA 4CRXA 1C4PA 2IPKD 1L0XB 2NRXA 1NOMA 4A3OA 3PW4A 5HR6A 2G0AA 3PO0A 3MABA 3M6KA 1TAUA 5KG0A 9ICAA 3PVLA 4WJOA 4CYEA 4JK1A 5AKEA 3ZDDA 2HHSA 1T0YA 2JXTA 1WGRA 1TK8A 3W1SC 3ISCA 4D2KA 1V8CA 2KWCA 3R2IA 1WG8A 4W9EA 1NK0A 1YQ3B 5C2TB 2LGSA 4RNNA 4RQ7A 1JX4A 4FBTA 3Q8MA 4YL8A 4ECZA 1F0MA 3IAS1 3ZJVA 1ZQIA 3AE4B 5AI6A 4DOCA 3H7PB 4TUUA 1YX6B 5D2MB 5J2RA 4Y2VA 1UHUA 3RR8A 4K81A 5ALKA 5AKYA 4MH8A 4F4WA 2VANA 4IRKA 2LVPA 9ICSA 2HVHA 2C5LC 3H6NA 3UF8A 3KHHA 1FIQA 2MU2A 4RGNA 5CR0A 2J52A 3ONNA 4NJCA 5LLIA 4KDIC 3MDAA 3ZW3A 2O2VB 5KFLA 2KACA 1JXLA 1Q0WB 8ICNA 3Q8LA 1FFUA 1S76D 2PJHA 3BIID 3WK5A 1RYSA 1NBFC 4ANUA 1J19A 4LDTD 4YSYB 3RNEC 3UM9A 3H0RB 4J6IA 3QU5A 3PRPB 2HJ1A 2LXAA 5AKGA 1WWVA 3TAPA 1OGWA 4RF0A 4MGKE 3GFKB 3U52E 3RNGC 2O6KA 1WMHB 5C1ZA 2L5YA 1GAQB 2QILA 2WFAA 1Q1OA 2KWVB 2J6SA 2BYVE 1UGMA 3Q8KA 3EUB2 4RT3A 5BMIA 1VR9A 5AKXA 2YMMA 3IM1A 2BCRA 2NO5A 4B6WA 4FZMA 4NAWB 4RQMA 2JWZA 1V49A 2DENB 9ICPA 1XSNA 1PGXA 2ZJDA 3MGHA 3TEYA 2KANA 3QUBA 2KEYA 3NVWA 4M9HA 2LFIA 2B0CA 4FFDA 2WF6A 2GLSA 2PE6B 4DQSA 1B4FA 2HDOA 1SF0A 4KLGA 3TI0A 2LKYA 3C2LA 2WWZA 4GMVA 5E6OA 2KN7A 5ALPA 4M2YA 2MWSB 5G5HA 9ICFA 2D5GA 2R8IA 5AI9A 4F50A 1V85A 9ICLA 4WQMA 3SAHA 2W82A 3TBLD 2E1EA 5H2FU 4FHJA 1SE9A 2XCAA 3KKAA 1WZ0A 3FC4A 2W9NA 3TMPB 4LDTB 4CE6A 2AQ0A 2IJ0A 5C23A 1TVAA 4J9OA 2E1FA 4BAXA 4QIWC 4RQ0A 1ZXHA 2J7QB 2A4ZA 4ANXA 5JH5C 3VH3B 1V6EA 4ARCA 3PR4A 1BUIC 4LNKA 2GI9A 1FPYA 5ALGA 4NQKE 3V61A 4RQ1A 4KLIA 2JF5A 3A9JA 2BKRB 4F5RA 4OJLA 3RTVA 2PIAA 1B1ZA 4JV1A 4B95A 3J9CA 3L5KA 1TS3A 2KLGA 1Y56A 3TADA 4DEZA 3L10B 4W9FA 5J2BA 4DSJA 1KM7A 2PPHA 2IYDB 3NVZA 4UAUA 5D49A 2PMZF 3QNMA 2HHVA 3BS7A 1QT9A 4FN2A 4J03A 1WJ4A 2BPCA 5BMHA 3PV1A 3NOBA 3TFSA 2DPJA 2E8NA 3HIZA 5DLFA 4M01A 4MSQB 1JWMD 1JI7A 2W8KA 3KHRA 1ZP0B 4DXAB 2QLTA 1V80A 3PHXB 1JXEA 2K8BB 4P1BC 5IO9A 2AGQA 1EU4A 4DSEA 2BQUA 2ASDA 4BXOB 3AB5A 3I3TB 2DWQA 2EKEC 3MJWA 2V4RA 5JTIA 2LD9A 4ASWC 2F44A 4MT5A 4XWWA 3AEVA 4FE3A 4PS3A 4B0EA 3ALBA 3ZD8A 2W9MA 1WFYA 4BUGA 2BDUA 4DSIA 2AWTA 5IIJA 3NRWA 4BKSD 2NRWA 2DUYA 5ALOA 1UF0A 7ICOA 5D94A 3RB4A 1BPEA 2K9XA 4EX6A 2LYBA 3T8MA 4C8NA 4Y2SA 1E6EB 1YZ7A 1ZQEA 1MN8A 2C2RA 1UA0A 1E8YA 4F8CB 4BX9C 3NZ3A 4BDPA 1WYWB 3LDAA 4HDQA 4ICVA 3Q3FA 4M6WA 2K22A 1ZQOA 3H8JA 2INPE 3M3JA 3QUQA 8ICOA 3H4DA 3IHPC 3T79A 3A33B 4FJZA 3T9LA 4EEYA 3WK7A 2W43A 3LWLA 2I1JA 1DGSA 3LVVA 4TUPA 2XGPA 1KFTA 2BYFA 3ZNZB 1DOQA 1ZQAA 2J42A 3UXPA 5LXIB 2H3ZA 2LGIA 2D10A 4WURA 5DPWA 5KFTA 2JRHA 4G11A 2XK5B 1EUVB 4F4XA 1L3SA 3P63A 3I5JC 1HJPA 4KLQA 2ZUDA 1U47A 2D3CA 2FIDA 5KFBA 2K6QA 2LHTA 3QUTA 3SV3A 5KFWA 3A0HU 1HA5A 4RPYA 4JUZA 2F2AB 4II2B 1FM0D 3T3NA 3BINA 3PY8A 2ZJ5A 4EBDA 5AM0A 5DPTA 1X42A 1IBXB 1FFVA 5HHHA 1L5UA 2HSZA 4DFMA 3PGEA 3CMMB 1RRBA 1ZOYB 4NLZA 5AICA 4ELUA 1D5XC 3WKDA 1SKSA 4F4KA 4KDLB 5ALXA 1K53A 2Y0SF 1X66A 2KMAA 3TKAA 2V9WA 1BMLC 2M0AA 2M8SA 2F1JA 4DFDA 2IOHA 3TACB 1CJEA 1BT0A 3H8WA 5AK4A 1LV5A 2JMGA 3QCAA 3ETRA 1L7NA 1ZQUA 1NVID 3L54A 4MDKE 3TSSA 1COOA 2WXMA 5KFZA 4YSZB 4EYIB 4Y2XA 2CHZA 2WDQB 3HHMA 1DYQA 2K39A 3BWUD 4RGTA 4CNQA 3WIMA 4YXMA 3BK1A 4BKGA 1ZQBA 3RNAC 3GB1A 4LNFA 3Q8RB 5CRXA 2N1WA 3OAWA 1RM6C 4YP3A 4Q8FA 2K8CB 1MHHE 1XD3B 2L0TA 4RGMA 1JUDA 3EZ5A 3TUOA 4ECXA 4A55A 2PVGC 5DQHA 2WS3B 4F4ZA 2R8HA 1JWAD 1LM8B 4KVGB 1RFAA 4A90A 1OQYA 4RMAA 3HWTA 2RDBC 5G55A 4DO9A 4XX5A 4DBGA 4UB8U 3QEBZ 4QZGA 1DK2A 4JX1C 4YQWA 3V7JA 3OLMD 3JPNA 3QZ8A 4IOIE 4PHAA 1B0XA 5IIOA 5L1KA 3EPIA 1FXTB 4JWNA 2WXGA 3BJYA 2BPSA 3MC8A 1NZPA 2RPVA 3ECIA 4NM2A 4W9JA 2W55A 1SJHD 2FNJB 2PKEA 2M17A 3C5GA 1UD7A 4DQOC 4HPMB 4MF2A 2KNBA 4QWCA 3WALA 4RQ4A 4KGTA 7ICRA 4ED1A 2DBYA 4XE0A 1LGRA 1T0QC 3NZUA 1B43A 3AE7B 5J0TA 1VCBA 2K8HA 3RR7A 4RNAA 5D6JB 4QZFA 3MTNB 3MFIA 5J2JA 4XRHA 2ES6A 2ASLA 2W03A 1TT5B 1X40A 2FMQA 2N4FA 2CRXA 3GZNI 4USAA 1A77A 3PO4A 2CHXA 4KV2A 3G6YA 1S77D 3S6JA 4N58A 7ICSA 1JMSA 4I29A 2QIEB 1YN3A 3IVFA 2TSSA 3CWIA 4PGYA 2V0GA 2MA1A 2K4PA 3SAFA 3NHEB 1QLBB 2QDFA 2Y3AA 8ICIA 1NK4A 1ZQDA 4G50A 4MM3A 3I9V1 4O1NA 1WM3A 1P9DU 2RP5A 4JMUA 1N56A 2XEWA 2FPKA 2KTQA 2X8XX 2LGXA 2BPFA 3OJ3A 5AKIA 4ED0A 4TV3A 2ACZB 1F77A 3RF9A 2YN4A 3UXOA 1RXVA 1IUEA 2KX0A 5KFCA 5HNKA 5J0WA 1ZQ1C 1WX7A 4Q45A 1N48A 3I63C 2LJIA 4I27A 3BQTA 2WU5B 4O3MA 4PYZA 2WAQC 1DK3A 1TY2A 3ISBA 4ZHOA 1SIJA 3AU4A 1U48A 2EMTA 3IT4B 3AU6A 1AN8A 2JZBB 3Q3OC 3RH5A 5EWGA 5KG6A 5ALVA 1NKCA 1PQSA 3VR9B 3NS1A 1JWBD 2ZEQA 1M6YA 3N7PD 9ICHA 4LCDE 2MRLA 3TAQA 4WJPA 1FRDA 3BQ0A 1V86A 3UIOB 3C0RB 2BCUA 2EH9A 1JMLA 5AI8A 1YOVB 4C56C 4B9LA 4RZRA 4BZAA 4HK2A 5J2EA 2EAOA 1IPGA 3NASA 1Q46A 4QZ8A 2FLLA 5AKLA 7ICQA 1LB2B 2NBVB 1ZQZA 5J0YA 3G6XA 5AI5A 5JHAA 2W11A 1D4BA 3WK6A 2B21A 3BS5B 1EF1A 2KZRA 4I2IA 2JU6X 1SZPA 3C2MA 2KK0A 2NYVA 2W54A 2BCSA 1J7CA 1OQQA 3A9JB 2E3TA 2JH7A 1A5RA 1SE2A 3AXCA 3HT3A 1WJUA 1B22A 2KC2A 4FA6A 3PMLA 1VZ7A 3QARA 2JXJA 2XNAC 2REXA 3M95A 3WK8A 2XY6A 1XWLA 3HKZF 3PZ7A 4W9GA 2KX3A 3KWVA 2CXYA 4QW8A 3WK4A 3KKAC 2BKFA 3ZXVA 1KFSA 4JIOU 4O0IA 3ISDA 1S0OA 1KBUA 2XN9C 2EDUA 3RPFC 4US9A 2MBEA 1XQQA 3VXWA 5DDYA 3DWMA 3QC8B 2KAJA 2AU0A 1V1PB 1VD2A 1L0YB 4IRCA 3M7DA 3QAQA 5KG1A 4DSFA 4LZDA 4RPXA 2ZUCA 3JPSA 2MJEA 3N9YC 3VVWB 3ZKJC 4EEWA 2JZZA 2BQRA 4HVBA 2ZJ8A 8ICRA 1BVSA 1TS2A 1L7YA 2JQRB 2HMXA 4HLEA 2W3SA 1V97A 3V72A 5FP0A 4CF4A 4EENA 1R4NB 3RZWC 1YJIA 1B9RA 3HILA 4F1SA 1Z5SB 3ZDMC 3EPGA 5AM5A 3AQFA 4QZCA 3WU2U 5DB9A 2P6RA 1SV0C 4IR1A 3ZDAA 1ZPSA 1ET6A 3SEIA 4ED2A 4TUSA 5AIBA 2M0XA 1NJYA 3PSPA 2EQYA 2W3RA 2UWQA 4HKQA 3JPQA 3H8MA 3RRHA 1ZQCA 1WR1A 4ECYA 4C7YA 1N62A 5ALLA 1C77A 5BYSA 2MAXA 1A70A 1N63A 2NTTA 4K4IA 1UBQA 1QTMA 3C2KA 3L3FX 2Y5PA 3FILA 4QJFB 1F52A 3AEEB 3APCA 3SR6A 1GOZA 3WAMA 2D3GA 2WX1A 1ZW7A 2UVVA 4IS7A 2KE7A 1UH6A 1JRPA 4LTUA 5JU5A 2FUHB 3VFKA 5AKZA 1ZD5A 3NY5A 4MFAA 1WXSA 4HJKA 1WMHA 4CO7A 2PI5A 2EKIA 4QWBA 4DS4A 2RDHA 3NUHB 3WANA 1LFDA 3U8ZA 1GPXA 2R2OA 5HP4A 5J2GA 2WXPA 4WAAA 4ECWA 5EWFA 2YTUA 4GDKA 2B76B 4ZHPA 3GV5B 3RNFC 4KX6B 3ZYYX 2WXJA 1RPLA 1C76A 2RMMA 2V9HA 2GBKA 3W5VB 3WKCA 1D6EC 1HIWA 3GIMA 1GC7A 1CZPA 1PGAA 2WXOA 2ZCCA 2F8LA 7ICKA 1J97A 4F5OA 1P7DA 2ASJA 2LRWA 4G0NB 4II3B 4KLJA 3H0MB 4DF4A 2G09A 9ICEA 3PZDA 4C0ZA 2AL3A 2DYMA 2VA8A 3M9NB 4RGOS 3RFZB 3VDZA 2BS2B 5AZGA 1TKDA 1H4RA 4Z6EA 2PKOA 1MFWA 3P4QB 2YEPB 5KFMA 3ZNGC 1YD8U 3R7QA 2ATLA 5ALQA 2UVUA 3E9SA 3ZTCA 2Y0SC 4PH5A 3CSTA 2CJNA 2KMCA 4P2HA 3PLVA 2B3AA 1T4GA 2IDYA 5L1LA 3RNCC 5H92C 1ED1A 2ZIWA 2ZCBA 3MR3A 5DQGA 1VLBA 4JLCA 1Z4NA 1EXNA 1STEA 1GG3A 9ICJA 2Z59B 2GWSA 4WIPA 3VRBB 1SB3C 4EZLA 1P7FA 1XLPA 3F5AA 2N7JA 3N7RC 5DB6A 2JEFA 2UVRA 4KLFA 8ICBA 2N1VA 4XQ8A 5DGAA 3AU2A 2K4IA 3TADC 3RJHA 4I2BA 4I28A 2HE7A 2RD0A 2KQSA 3A9KB 1QOAA 1FXAA 2DZJA 4IW0A 4K7WA 5J0UA 1SE3A 7ICFA 4DDGD 1UGJA 3V05A 5EWEA 4DHJB 4HRSA 2GOLA 4Z6FA 5DQIA 5B5EU 4FO6A 5CP2A 5KFHA 3AE5B 3M1YA 4DL2A 3AE1B 4MJSB 2WXFA 2JEJA 1IGCA 1M94A 1FCCC 4HPLB 5ALDA 2GH1A 1Z1BA 3APDA 2ZIXB 3ENEA 4UB5A 5GTIU 2JSVX 1C3TA 3KVFB 1ZXIA 1XO1A 4N59A 1XSPA 1U49A 4QAYA 4IWPA 5J2IA 1EWYC 2BKEA 4PPXA 1RYUA 5AK6A 2AQ1B 2G1EA 3UQBA 1QCKA 2KKPA 3Q14C 3NZSA 3Q8QB 1ZQSA 3HM6X 2M1MA 2WDRB 1I42A 5HKHA 5J8YC 4XGAB 3U26A 3QUCA 4B6JA 1BXTA 3P42A 4QZIA 3E2EA 1V81A 4KKIA 1YT3A 5ALRA 4KLUA 4WWOA 4EOYA 4HAIA 2BZFA 1SKWA 1JN3A 5J2DA 2KZ3A 4F5QA 1TJEA 2BGFA 3OSNA 4YG2A 3SFDB 1DXSA 3RULA 1YIWA 1OEYA 4EZ9A 4C8KA 3QJZA 2LYAA 1BPYA 5L95C 1IBXA 3PZ8A 4MELA 2H3QA 4ARIA 4HWIB 5KT7A 5ALTA 2Q4TA 2Q5WD 2VZKB 2E8PA 5L1JA 4MJSA 2LMRA 5J2CA 3FKYA 2MRPA 4TMAB 5KT4A 1CQVA 9ICTA 1A6SA 1T7PA 3ZDCA 2CR5A 2KJHB 3DDCB 4OJ5A 5L1IA 2C7HA 2KXJA 2IMWP 2W9CB 4YMOA 1S97A 4ED6A 2HHWA 2KWDA 3ABVB 3F2DA 1KH0A 4QIWF 3Q69A 4WJNA 3L4PA 3APFA 7ICUA 2FIFA 4UQGA 1NYQA 2DLBA 3SYZA 3F2BA 3D2QA 2VA2A 1RAXA 2L52A 5CHFA 4EELA 3ZDTA 2VZKD 2EAMA 2G4SA 5LNK1 4FXCA 4PL1A 2ZIWB 4G3IA 1N60A 1ZQQA 1OQRA 4YCXA 4IRDA 4J9NA 2KJRA 3RD2A 4MFFA 1AW7A 2FE9A 4O5EA 2CU1A 1PFDA 4OJOA 1OFFA 3BYYB 3MFGA 1HZ5A 3QHTA 2KP7A 4KLLA 3IG8A 1E10A 2E8MA 2G06A 4O9MA 2AX5A 3NGDA 1CEZA 2OOBB 4DHJD 4P4MA 2OHFA 3AU5A 4UB1A 2OEHA 1J0GA 4UAWA 3C19A 3P4RB 3T5HA 3KFUF 3PHWB 4KIKB 2YMPA 4YWGG 4KSKC 1E7UA 4ZRKA 1BPDA 1FEZA 1KTQA 4WWMA 2RPQA 3RBEA 1ZYQA 4WWPA 2ZIUB 2JZPA 3V6JA 4ACOA 1QSLA 8ICSA 4GDLA 3C29A 2KKCA 3H1UA 4NNJB 4W9IA 2K6DB 4GDLB 1FCLA 1ZQKA 4O3OA 4MGYE 4KLEA 2D2QA 5JHBA 4X5VA 1ZQPA 2LJ5A 1I4GA 2CKHB 3MHSD 2L00B 2P66A 3PSIA 2FBWB 2PI4A 2JEIA 1OEYJ 4NQLB 4ICAA 2WX0A 1S1QB 3DHHC 3HM3A 1KL9A 2MUTA 3RAXA 2AQ4A 2ALZA 2EANA 2N0SB 5KFJA 5IIIA 8ICVA 4REZA 3RAQA 3C23A 3H8SA 2SAKA 1N5WA 1WJ6A 2GBJA 5AM3A 1KEJA 1EWCA 4IQWA 3F5EA 5CJ7A 2PLPA 9ICBA 3OJ4B 4ECUA 1TY0A 2JR5A 1ZRNA 4LNOA 1YX5B 4Y2TA 3WKBA 4MEYA 1UT5A 3O13A 1MHXA 4IUMB 2KTFA 3PW7A 3RJKA 2DFLA 4NLGA 2V4QA 2DAJA 4DFKA 9ICXA 3Q2AC 1S3SG 1XC9A 2I9GA 5T14A 4AP9A 1UELA 1K5OA 1P0RA 1HXYD 1NJZA 2FJ6A 3JW0X 1IGDA 9ICKA 3UIPB 1H8CA 3A4SC 5CHGA 2C2DA 1ZDVA 4B9UA 3KW5B 2IO1B 1L7MA 3C21A 1TFRA 5AM2A 3UXNA 2PMVA 2Y1IA 5KT5A 1SSNA 1ISNA 3H4BA 2MJDA 3ORYA 2OXOA 1S8OA 3HUIA 1ZOLA 2HHUA 4QW9A 3QU2A 4HDOA 2HI0A 3WKEA 2C60A 1EO6A 4PT5A 9ICOA 2LHDA 7ICLA 2ZPYA 5ALWA 5KFGA 1U45A 1YN5A 4MHVA 3SMVA 5ALFA 4F2SA 2INCC 2BT6A 1XF5L 2KFKA 2JH1A 2WDVB 4M04A 3LK9A 4M0WB 4GN1A 1Z00B 2O6VA 2QMTA 1LKYB 2KTRA 4YSXB 4RPZA 1IYFA 2QB1A 3ZJUA 5CWRA
chains in the Genus database with same CATH topology
1MVKA 4DXGA 3TEXA 1FO4A 5AUKA 1XCQL 1QLBB 2Y3AA 4O1NA 3U4EG 3I9V1 1CK1A 1PYWD 3E56A 1KLGD 2DYOA 1JALA 4OVZA 1UWMA 3DWGC 5EE1A 3CIRB 2ACZB 1F77A 1FNVA 1VZ6A 5FR3A 4UDUC 1IUEA 1AYFA 2ICIA 2RDGA 5HG2A 1QOGA 3P4SB 2LJIA 2V3NA 2WU5B 4YTPB 2YEPF 3MP9A 4RF1A 1TY2A 4ZHOA 5TSSA 1SIJA 1D5ZC 5BYRA 3IT4B 2WNMA 1JCKB 3W2DA 1AN8A 2Y5CA 3SFEB 2E6XA 1JWSD 2NTSA 3VR9B 2WQYB 3NS1A 1JWBD 1VDVA 2BTEA 1L4ZB 4LK0M 3B2FA 1NEKB 2HDEA 3FILB 1FRDA 1JMLA 3AE6B 4M0WA 4C56C 2LEKA 3AV8A 4ZYSA 1AWDA 1ZE3D 4MM3B 1ZUD2 2MEKA 3AE3B 4RCOA 4AQ7A 1D4BA 3MHZA 3HVZA 1TS5A 1SXTA 4HJGE 2JU6X 4XWTA 2BB6A 1QOBA 2W54A 1J7CA 4US8A 1OQQA 2E3TA 1PUTA 4HEA1 1SE2A 4J3OD 3SEBA 3U7ZA 1T6BX 2BS4B 1WWTA 1VZ7A 5BYQA 4YXDB 2XNAC 1YMHE 3Q8AA 1DOXA 1TKYA 4Q2JA 2BBCA 4ITKA 3PZ7A 1M4VA 3KWVA 3AH7A 3GS2A 3AE8B 4B0MA 1LO5D 1FNWA 5HHDG 3HRDD 1F0ZA 1JWUD 3MC0B 3V3XA 1R7SA 4KGRA 2XN9C 1GB4A 3RPFC 1P7EA 4US9A 1SE4A 3VR8B 4MACA 4TQ0A 1FMAD 3P4PB 2N9LA 3AEDB 3DWMA 1E9MA 2KAJA 1V1PB 1NI3A 1DOYA 1XLOA 1L0YB 3N9YC 1V1PA 1MI0A 2MJEA 2JYEA 3IXSA 2L1AA 4LLGM 2JQRB 1TKEA 1TS2A 2I2YA 1SJED 2W3SA 1EM7A 1V97A 2FUG1 3W5UB 1F2RI 2K3UA 2M56B 1YJIA 1B9RA 2PW9A 4NZLB 1UUPA 3MJ5A 4OZBA 1ZPSA 1ET6A 1XEEA 2PVOD 4L23A 1RYJA 1ENFA 4OW0A 5JXVA 1QKZA 1C79A 2W3RA 3TEZA 1EU3A 1FNUA 4HKQA 2IGGA 1KLUD 1I4HA 3TEWA 1ET9A 5EE3A 4C7YA 1N62A 1C77A 5BYSA 1A70A 2K5PA 3Q8BA 1N63A 2NTTA 1WYGA 5HI1A 1L6UA 2Y5PA 2H88B 3FILA 1C4PA 2IPKD 1L0XB 2WXIA 4N6EB 1T5XD 1N61A 3AEEB 3SR6A 1GOZA 1NENB 1ESFA 1F2RC 3PO0A 4LTUA 1JRPA 5C3JB 2WXRA 2JXTA 4D2KA 2EKIA 1V8CA 1Q10A 2RDHA 3NUHB 3R2IA 1GPXA 2L32A 2WXPA 1YQ3B 5C2TB 1RFKA 1KTKA 2M19A 4ZHPA 2B76B 1I4XA 3ZJVA 3IAS1 1KF6B 4KX6B 3ZYYX 2WXJA 3AE4B 1C76A 2H89B 2RMMA 3Q8CA 3W5VB 3IAM1 1D6EC 1PGAA 2WXOA 1CZPA 3ZQ4A 4KKJA 3LB8C 4MH8A 5FKAC 2V3PA 2I38A 2INNE 1FIQA 4RGNA 2J52A 4IDIA 4NJCA 3BK2A 2KACA 2DYMA 4RGOS 3RFZB 1FFUA 2BS2B 1YN4A 3BIID 2WXNA 2PKOA 3BYTB 3AEBB 4YSYB 1PGBA 5AUIA 3P4QB 2YEPB 3EGRA 5MPOA 5D7GA 4KGSA 3Q8EA 4RF0A 2WXKA 1WRIA 2WXHA 3E9SA 4R3DA 3U52E 2CJNA 1XCTL 2IDYA 1GAQB 2QILA 5H92C 3BZDB 1VLBA 1FD6A 1XO3A 1STEA 3EUB2 2N9KA 4YTNB 4CQNA 4C80A 5BMIA 1VR9A 1QQRA 1L4DB 4WIPA 2JWUA 3VRBB 1SB3C 4NAWB 1P7FA 1XLPA 3BVMA 2N7JA 4A8XC 1PGXA 4H2AA 1RWSA 5E6JA 3TEYA 1I4QA 3NVWA 3R2TA 2LFIA 1TZOA 2OEDA 1KRHA 3ZJTA 1QOAA 1FXAA 1SF0A 4YT0B 5D3IB 1SE3A 1UGJA 3V05A 5G5HA 4HRSA 2D5GA 5T8IA 1C78A 1J7AA 2ONQA 3AE5B 3AE1B 1WXQA 2WXFA 4WQMA 3AEGB 2W82A 1IGCA 2BB5A 3Q8FA 1FCCC 1WGKA 4A6QA 3FC4A 1L0VB 4WAFA 2JSVX 1FEHA 2IJ0A 1ZXIA 4N59A 1K50A 1EWYC 1ZXHA 2G1EA 2AQ1B 4DXFA 4ARCA 4WH4A 3B9JA 1N5XA 1BUIC 2GI9A 2WDRB 4GDKB 4TSSA 3W9CB 1FRRA 5G5GA 3KLSX 2PIAA 1B1ZA 2WLBA 3J9CA 4L1BA 5FK9C 1TS3A 2QJLA 1XLNA 1BXTA 4C7ZA 1QOFA 3KQ4A 1Y56A 3KWLA 3P42A 2IGDA 4JE3B 4KKIA 3W1SA 3NVZA 1HEZE 2WP9B 1QT9A 2R61A 1TJEA 4EE2A 1DOIA 4OZAA 1C9FA 3SFDB 5BMHA 1PDXA 2AQ2B 2QSDA 1JWMD 1IBXA 3PZ8A 1ACCA 1ZP0B 4ARIA 2Q5WD 2VZKB 1EU4A 1NYRA 1VZ8A 2AQ3B 3AB5A 2DWQA 4P6VF 2J53A 4TMAB 1CQVA 4XDCA 2HTME 1I4PA 2BYTA 2CJOA 3AN1A 2KWDA 2MH7A 3ABVB 4MT5A 4XWWA 1KH0A 2PTLA 3Q69A 1QF6A 3L4PA 1YQ4B 2ZW0A 1VRAB 4B0EA 4IKGA 3AE9B 2LHEA 2KMMA 5D3DA 3T3OA 1NYQA 2DLBA 1SBBB 2K0PA 3P1MA 2WXQA 2L52A 1JW9D 1D5MC 5EE0A 3NVVA 1I4RA 2VZKD 2K9XA 2GRIA 5LNK1 1UNSA 1E6EB 4FXCA 3BVGA 1T3QA 1N60A 3WCQA 1OQRA 3AE2B 3NZ3A 4ZRPA 1AW7A 1DGJA 4ZRQA 2K22A 4P16A 1PFDA 2CU3A 3AEAB 2INPE 1OFFA 2MJ3A 3BYYB 3MFGA 1HZ5A 4YTMB 4GLSC 4AS1A 1E10A 3VQIA 2JX5A 1J7BA 2AX5A 2BS3B 1XLQA 1KFYB 2J42A 1HZ6A 2LGIA 2OHFA 1K51A 1XXGA 1L5PA 4WURA 1GB1A 1L6VA 3P63A 3P4RB 2SEBD 4YWGG 2LUMA 3C8YA 1HA5A 2L83A 4WWMA 3NRZA 1FM0D 1UWXA 3T3NA 1E7PB 2FE8A 1ROEA 1IBXB 4JWUC 3BVZA 1FFVA 2JZPA 1SEBD 2V4IB 3VRAB 1ZOYB 2WU2B 3R8BA 3AECB 1YJJA 4GDLB 4OZCA 1FXIA 4L2YA 1D5XC 2LMCA 1FCLA 1VJKA 3AMZA 1YNTE 1K53A 2M0AA 4NAMA 4RFBA 1BMLC 3LXFA 1I4GA 1CJEA 2NMQA 3ETRA 1C4CA 1NVID 2JYTA 3TSSA 2FBWB 3URYA 2WXMA 4YSZB 2G9HD 2WDQB 3AEFB 1DYQA 4ZOHC 3BWUD 3GP7A 2QEJC 4RGTA 3BK1A 3GB1A 1ZDXA 2N0SB 1TKGA 1WSPA 4REZA 1RM6C 1MHHE 4RGMA 3TUOA 4OHJA 4RH6A 4A55A 2PVGC 2SAKA 3OWEB 1N5WA 2WS3B 2KN4A 1JWAD 3FAHA 1EWCA 4A90A 4HROA 2J4XA 2PLPA 2Z8LA 1TY0A 4JX1C 2WXLA 3O13A 1MHXA 3ZGZA 4JPSA 1MPEA 1TS4A 2X38A 1HQRD 4TQ1A 5HFYA 3IT6B 4IOIE 2IGHA 4JWSC 3LYYA 3NVYA 2WXGA 1C4AA 1HXYD 2RPVA 1IGDA 2W55A 1K52A 1SJHD 2KDMA 1ZDVA 2ZW1A 4DQOC 5I4DA 2PMVA 5H8YE 1SSNA 2ON8A 4KGTA 3U2SC 4A9AA 2MJDA 3H8HA 2EELA 3HUIA 2DBYA 4XE0A 2KQ4X 4PT5A 3AE7B 3I57A 2LHDA 4RNAA 5GXGB 1YN5A 2BW2A 2GB1A 1E0ZA 1JQ4A 2BT6A 1XF5L 3AM9A 2WDVB 4XDDA 4USAA 4HKZE 5EE9A 1JROA 1I7HA 1TYGB 2QMTA 5BMGA 1QILA 1V1OA 4N58A 3UI3A 4YSXB 2QIEB 1YN3A 3B2GA 3EA6A 2TSSA 3CWIA 3HVDA 3ZJUA 2V0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6V A;  3P63 A;  1J7A A;  3AE5 B;  3P4R B;  3AE1 B;  3B2G A;  1FO4 A;  1WXQ A;  5AUK A;  1QLB B;  3AEG B;  4WQM A;  2PVO D;  1RYJ A;  1WGK A;  2L83 A;  4WWM A;  2W3R A;  3NRZ A;  1FM0 D;  3FC4 A;  1L0V B;  1JAL A;  1E7P B;  1JQ4 A;  1ROE A;  1UWM A;  4JWU C;  5EE3 A;  1FFV A;  3DWG C;  1ZXI A;  4C7Y A;  1N62 A;  4N59 A;  5EE1 A;  3VRA B;  1ZOY B;  1A70 A;  2K5P A;  2ACZ B;  1EWY C;  2WU2 B;  1N63 A;  3AEC B;  2G1E A;  1WYG A;  1YJJ A;  1L6U A;  1FXI A;  2H88 B;  3B9J A;  1N5X A;  1AYF A;  1IUE A;  1VJK A;  4N6E B;  1N61 A;  2WDR B;  3SR6 A;  3AEE B;  3AMZ A;  1NEN B;  1QOG A;  1FRR A;  5G5G A;  3PO0 A;  3W9C B;  3P4S B;  2PIA A;  1JRP A;  4LTU A;  2WU5 B;  3LXF A;  4YTP B;  1CJE A;  2WLB A;  5C3J B;  4ZHO A;  1SIJ A;  2EKI A;  1XLN A;  3ETR A;  4C7Z A;  1QOF A;  1V8C A;  2QJL A;  3KWL A;  1NVI D;  2FBW B;  2Y5C A;  3SFE B;  4YSZ B;  1GPX A;  2WDQ B;  3NVZ A;  3AEF B;  5C2T B;  1YQ3 B;  2WP9 B;  4ZOH C;  1RFK A;  3VR9 B;  2WQY B;  2M19 A;  3NS1 A;  1JWB D;  1VDV A;  1QT9 A;  2B76 B;  4ZHP A;  1TJE A;  1KF6 B;  3B2F A;  1DOI A;  4KX6 B;  1NEK B;  2N0S B;  3SFD B;  1FRD A;  3AE4 B;  3ZYY X;  1B9R A;  2H89 B;  1TKG A;  1PDX A;  1RM6 C;  3W5V B;  3AE6 B;  4HRS A;  2LEK A;  1CZP A;  2PVG C;  1ZP0 B;  3AV8 A;  1N5W A;  2WS3 B;  3LB8 C;  1JWA D;  3FAH A;  1AWD A;  2Q5W D;  4HRO A;  1ZUD 2;  1NYR A;  3AB5 A;  1FIQ A;  3AE3 B;  2DWQ A;  4P6V F;  4IDI A;  3HVZ A;  2HTM E;  4JX1 C;  2CJO A;  1FFU A;  2BS2 B;  3BII D;  3AN1 A;  1QOB A;  2W54 A;  3CIR B;  1J7C A;  4US8 A;  1OQQ A;  2E3T A;  1PUT A;  2MH7 A;  2PKO A;  3ABV B;  3AEB B;  4YSY B;  5AUI A;  3P4Q B;  1QF6 A;  4JWS C;  3L4P A;  1YQ4 B;  5MPO A;  3NVY A;  1WWT A;  2BS4 B;  3AE9 B;  4YXD B;  2KMM A;  1NYQ A;  1DOX A;  2W55 A;  1WRI A;  1TKY A;  4ITK A;  2CJN A;  3P1M A;  2L52 A;  1GAQ B;  5H8Y E;  3AH7 A;  1JW9 D;  5H92 C;  3AE8 B;  5EE0 A;  3NVV A;  1VLB A;  4A9A A;  2MJD A;  3HRD D;  1F0Z A;  3HUI A;  1XO3 A;  2K9X A;  3EUB 2;  1R7S A;  2DBY A;  4YTN B;  1E6E B;  4C80 A;  3RPF C;  4FXC A;  1T3Q A;  4US9 A;  3VR8 B;  3AE7 B;  1N60 A;  3WCQ A;  1FMA D;  1OQR A;  1SB3 C;  3P4P B;  5GXG B;  3AE2 B;  1XLP A;  3VRB B;  3AED B;  3DWM A;  1DGJ A;  1E9M A;  2KAJ A;  2K22 A;  1NI3 A;  1PFD A;  2CU3 A;  1DOY A;  3AEA B;  1XLO A;  1RWS A;  2BT6 A;  1E0Z A;  3AM9 A;  1OFF A;  2MJ3 A;  2WDV B;  3NVW A;  4YTM B;  4USA A;  5EE9 A;  2MJE A;  1JRO A;  1I7H A;  1E10 A;  1TYG B;  1KRH A;  1J7B A;  2AX5 A;  1TKE A;  2BS3 B;  2JQR B;  2JX5 A;  1QOA A;  1FXA A;  1SF0 A;  2W3S A;  1XLQ A;  4N58 A;  1V97 A;  1KFY B;  4YT0 B;  3W5U B;  4YSX B;  2QIE B;  2OHF A;  1L5P A;  2M56 B;  3CWI A;  1YJI A;  5G5H A; 
#chains in the Genus database with same CATH topology
 4DOA A;  4K3C A;  2OYY A;  7ICJ A;  2KYW A;  8ICX A;  3KUZ A;  1XCQ L;  2JY6 A;  1D9D A;  5KT2 A;  5KL8 B;  4GB9 A;  1CK1 A;  1P98 A;  3R66 C;  3M8R A;  2UVW A;  4UBB A;  1KLG D;  2ZG6 A;  4KMU A;  2IBK A;  4RUC A;  4N9F 4;  5DB7 A;  1KSP A;  2OJR A;  3DWG C;  4IM0 A;  4K3B A;  2ZIV B;  2NV3 A;  4YN4 A;  5KFR A;  1FNV A;  2LGY A;  4ECS A;  2ZPN A;  3MDC A;  1AYF A;  1KLN A;  1NK5 A;  2Z0E B;  2K4E A;  2FPM A;  2W04 A;  3DVG X;  4NLC A;  3P4S B;  2YVC A;  3T5K A;  3RJG A;  3HW8 A;  2V3N A;  3PX6 A;  4IC7 B;  1F9J A;  2JEG A;  3GE8 C;  4FAD A;  4K4H A;  2NPT B;  2AGP A;  2WNM A;  3W2D A;  4YFK A;  2LRU A;  2KJ6 A;  3UPQ A;  3V6C B;  1MA7 A;  4R64 A;  2WTF A;  2NS5 A;  2NTS A;  1RZT A;  1ZET A;  1VDV A;  2LBO A;  4B9K A;  2UU7 A;  1L4Z B;  4LK0 M;  2QCZ A;  4Y2Q A;  2K89 A;  3FDS A;  2KDE B;  3KYC D;  5ALH A;  2HDE A;  2GBM A;  3AUO A;  5JRT A;  4EKU A;  3MBY A;  1C7Y A;  1XT9 B;  2ZUB A;  4P0Q A;  4Q43 A;  1K1Q A;  2KFK B;  3AV8 A;  2RGF A;  3TQ1 A;  3VAW A;  1AWD A;  1ZE3 D;  5KAF U;  4K7S A;  1ZUD 2;  2A1J B;  4UAR A;  2HVI A;  4RCO A;  4TKN A;  4IR9 A;  1GJZ A;  3GIL A;  3HVZ A;  1TS5 A;  1SXT A;  4NPN A;  2R8J A;  3X23 A;  2I5H A;  2BB6 A;  8ICG A;  2PFQ A;  2WF9 A;  5J0R A;  4US8 A;  2JVC A;  1V5T A;  2F3N A;  1PUT A;  5KFX A;  4J3O D;  4EZK A;  2KIW A;  2AH5 A;  1WWT A;  4RNM A;  4YXD B;  4K7U A;  1Q8K A;  1YMH E;  5CHV C;  1DOX A;  1TKY A;  3A0B U;  4F71 A;  8ICW A;  2LZ6 A;  4KLD A;  4P4P A;  3OJS A;  3AE8 B;  2L05 A;  4GXB A;  2PFP A;  4B0M A;  2QB0 B;  3ED5 A;  3WKA A;  4EX7 A;  1FNW A;  1D3Z A;  2ZTD A;  3KD3 A;  2W9B A;  2M0N A;  1JWU D;  1RYR A;  2R18 A;  2YMQ A;  3MC0 B;  5AK3 A;  3V3X A;  4FBU A;  4ANW A;  1GB4 A;  1SE4 A;  2CS4 A;  3N1Z C;  4MAC A;  1S0V A;  1BGX T;  4TQ0 A;  2XID A;  2LWP A;  2CPR A;  4UAS A;  2MP2 A;  2HHT A;  4MFC A;  1MG4 A;  4R63 A;  4GXK A;  3RN9 C;  1DOY A;  1XLO A;  2JXX A;  2IY0 B;  1SGH A;  1V1P A;  2JGA A;  3N4M B;  3IXS A;  5DGB A;  2L1A A;  1D8B A;  4LLG M;  5J0P A;  2BPG A;  4KLM A;  4M8M A;  4MGI E;  2I2Y A;  4R8U A;  3NTU A;  4BFR A;  2FUG 1;  3EC8 A;  2FCM A;  2M56 B;  3L13 A;  2HBM A;  4C00 A;  3EFU A;  3RI7 C;  3EYZ A;  4I2G A;  3H7S A;  3MJ5 A;  2EMS A;  4HCP B;  1XEE A;  1ARO P;  4F4Y A;  4DQI A;  4ED7 A;  3B1L X;  1KLV A;  5JXV A;  2KSO A;  1QZE A;  1FNU A;  4AOF A;  3QU4 A;  5KFK A;  3DDH A;  2N9P C;  4PS8 A;  4CGZ A;  2VA3 A;  2DAF A;  1WYG A;  2J0K A;  5HI1 A;  4KLT A;  5GTH U;  2H88 B;  3WAO A;  2WXI A;  4GXI A;  2G07 A;  1N61 A;  1SXE A;  5ALZ A;  1F2R C;  2WF5 A;  4YR3 A;  3FYH A;  3F2C A;  4KMO B;  5KFE A;  2AEH A;  3PST A;  2J6T A;  2BYE A;  3RT3 B;  1WR6 E;  4YXJ A;  4MF8 A;  2L32 A;  2F76 X;  2G45 B;  4CDG A;  2VKQ A;  1ZD4 A;  3MFH A;  3NJT A;  1KTK A;  3NUQ A;  1KJT A;  7ICE A;  1I4X A;  2HD5 B;  4U7C A;  2GLE A;  2HTH A;  3PX4 A;  4M8N A;  2Q0Z X;  2KOB A;  2BDP A;  4M0A A;  1EF5 A;  3IAM 1;  2F77 X;  2YQE A;  2XGQ A;  3SD7 A;  2IO2 B;  3DVN U;  4M9N A;  3ZQ4 A;  3OSP A;  2N9E B;  3LB8 C;  3P2B A;  1UBI A;  4KKJ A;  4AWJ A;  2PXI A;  1WZ3 A;  5ALU A;  3Q8S B;  2LI6 A;  4IDI A;  3QX7 A;  1KW4 A;  5J2H A;  3BQ7 A;  5ALI A;  2NRZ A;  2DNF A;  2N7E A;  4HYK A;  3T3F A;  2FMP A;  1YN4 A;  5ALS A;  2J0J A;  4NJ6 A;  2WXN A;  3BYT B;  3AEB B;  2IY1 B;  1PGB A;  5AUI A;  4QWA A;  2EZY A;  2Z7J A;  2FDR A;  2MW5 A;  3H9D A;  3ONS A;  5MPO A;  4KGS A;  2H3V A;  2PEA A;  4PK1 A;  3Q8E A;  1E5W A;  2ZIX A;  3CNH A;  1Q5W B;  1X6I A;  1WI0 A;  2GO7 A;  4TUR A;  1A76 A;  4I2F A;  2WB1 F;  4PGX A;  1RXW A;  3OTQ A;  2H3I A;  2MSN A;  3MGI A;  3TFR A;  1O08 A;  1R4M I;  2C7M B;  1TBE A;  3BZD B;  3VTV A;  7ICI A;  4DCC A;  1XO3 A;  5KFU A;  4O3P A;  2N9K A;  4CQN A;  5DG8 A;  4C80 A;  4GGQ A;  1QQR A;  4I2H A;  4GC7 A;  1ZQH A;  1L4D B;  3L0W B;  2JWU A;  4IQV A;  3CRX A;  1Y8R C;  3BVM A;  4YD1 A;  2OH2 A;  1WX8 A;  4XZ4 A;  3PRM B;  3S2A A;  4JQW C;  4H2A A;  4RQ5 A;  1RWS A;  3GV7 B;  3EHV A;  2QHO A;  3WA0 A;  4B9M A;  1TZO A;  4JL9 A;  1O03 A;  1KRH A;  4BOS C;  1LQB A;  4FZL A;  3ZJT A;  4YT0 B;  5D3I B;  1L2N A;  5IIN A;  3UMG A;  2WB1 C;  1SWW A;  3JPT A;  1SZH A;  5DG7 A;  2KV2 A;  4W9K A;  3GDX A;  1T0R C;  4B9S A;  1V5O A;  5T8I A;  1C78 A;  5KFO A;  3C1Y A;  3ZIM A;  1WIA A;  1TV9 A;  9ICC A;  5JUM A;  4RQ6 A;  3QIJ A;  3AEG B;  3R3M A;  1IP9 A;  5AKH A;  4P7I A;  3Q8F A;  2QAR B;  1WGK A;  3Q3M C;  2KZM A;  5AZF A;  4A6Q A;  3IHQ B;  1L0V B;  1ZQX A;  4WAF A;  1D8L A;  3SZ2 A;  4IM2 A;  3B0Y A;  2LM1 A;  4I2C A;  4DS5 A;  2C9W B;  4XA5 A;  4ELT A;  3IV6 A;  1KKX A;  2KIV A;  5DPR A;  4I2J A;  4DXF A;  1N6Z A;  3B9J A;  1N5X A;  1KDH A;  3IBE A;  4WH4 A;  4GDK B;  4TSS A;  1WM2 A;  1FRR A;  3H0L B;  5J29 A;  3RRG A;  4AJY B;  4L1B A;  5FK9 C;  4RUA A;  3SV4 A;  2ODG A;  2QJL A;  3KQ4 A;  3N30 A;  4FHK A;  4JE3 B;  4IM3 A;  2KC1 A;  4OZB A;  3W1S A;  2MBH A;  4J9K A;  2E8O A;  1HEZ E;  5IN7 A;  5KT3 A;  4E3C A;  2K8C A;  3EEC A;  3RCZ A;  3H7P A;  4OZA A;  1C9F A;  2FCS A;  2W8L A;  2WHI A;  3RJF A;  2YB1 A;  3LWM A;  1NI2 A;  2AQ2 B;  1E8W A;  1TE2 A;  2PMZ C;  2VJ4 A;  4RQ3 A;  2NRV A;  1ACC A;  2KD0 A;  4IQT A;  1R4N I;  2E5S A;  3PZP A;  5KAI U;  9ICU A;  1T0S C;  2AQ3 B;  2KN5 A;  4P6V F;  3M9M B;  2A5U A;  3DBR I;  2DZI A;  2HTM E;  4QZ9 A;  3I76 A;  2EZX A;  2IOF A;  3AN1 A;  4DLG A;  4DSL A;  3K9P B;  3QQ8 B;  4QWE A;  4B9V A;  1UPH A;  2DHZ A;  2ZNV B;  2KMD A;  3L16 A;  2XBB C;  2CHW A;  3N1X C;  3RMK C;  3TIX A;  1YQ4 B;  3PW2 A;  2ZW0 A;  5ALE A;  1L6N A;  1TGZ B;  3A4R A;  3AE9 B;  2LHE A;  4S0R A;  2K8A A;  4YD2 A;  2KMM A;  3NG0 A;  4KLS A;  1N2X A;  4DL4 A;  5KFN A;  2LI5 A;  5IAA C;  3R7R A;  3T3O A;  1ZD2 P;  1S5L U;  4G9B A;  2K0P A;  2WHE A;  2WXQ A;  5IKC M;  3LDZ E;  3V6E B;  4BOZ B;  2LPE A;  3M9O B;  1JW9 D;  4I6L B;  3NVV A;  1UA1 A;  3GU3 A;  3DBS A;  3PPA A;  2GRI A;  2YLM A;  1UNS A;  2HOI A;  1T3Q A;  4ECQ A;  3WCQ A;  5DLG A;  1WE7 A;  2K25 A;  3O0F A;  3AE2 B;  1K1S A;  4K1R B;  3DBH B;  5KG2 A;  1X9W A;  3RJE A;  3L17 A;  4ZRQ A;  2C22 A;  3OHB A;  1OW5 A;  3GZN B;  4P16 A;  3VUW A;  4M47 A;  3RB3 A;  1T94 A;  4YTM B;  3KOO A;  4GLS C;  4AS1 A;  2G5I B;  3VQI A;  1XLQ A;  2FAZ A;  5DPS A;  1J2N A;  4LJP B;  4FUL A;  1MJD A;  4WJQ A;  3PVX A;  1K51 A;  1XXG A;  2YX8 A;  2M9N A;  5KHQ A;  1PK1 A;  3RH4 A;  2BWE S;  4Z6C A;  3PTF C;  2HHQ A;  5HR7 A;  4NY8 A;  2SEB D;  8ICL A;  3GII A;  4QNL A;  4JV2 A;  2ZXH A;  5L1M A;  2V1Y A;  5TZV A;  1HE8 A;  3C8Y A;  4W9C A;  2NVU I;  2IZV B;  5AKJ A;  3NRZ A;  1V9J A;  1UWX A;  4E71 A;  1CI4 A;  5KFI A;  5KFA A;  2FE8 A;  2EAP A;  4J9R A;  4JWU C;  5KFV A;  2XIC A;  2P35 A;  2OWO A;  1SEB D;  2P6U A;  5K4L A;  5AI4 A;  1NJX A;  2V4I B;  3MC1 A;  2QC8 A;  2WU2 B;  3VRA B;  3AEC B;  4ECT A;  1ZQL A;  3PSF A;  1YJJ A;  4ICU A;  2LGD A;  1FXI A;  2ZVN A;  3DVN V;  1VJK A;  2I1Q A;  5BOL A;  1WCL A;  3JPO A;  1K8R B;  1YNT E;  3N7S C;  5ALN A;  4RFB A;  4NAM A;  2JZB A;  4MEX A;  4J9S A;  4NWI A;  2A3V A;  5AM1 A;  2K8B A;  8ICA A;  3MR2 A;  1C4C A;  5KTQ A;  4C4V A;  3URY A;  2IHM A;  4ECV A;  1LXD A;  2G9H D;  4YMN A;  1E7V A;  4W9H A;  4M9J A;  4KIT B;  4ZOH C;  3ZLZ A;  3GP7 A;  2A1A A;  4UB6 U;  3SU8 X;  1SGG A;  4ED3 A;  3T5L A;  1WRD B;  4UB4 A;  3AL0 B;  1ZDX A;  3VUX A;  4PHE A;  4J9P A;  1TKG A;  3ML9 A;  4YR2 A;  2D6F C;  2L3Z A;  4MGZ E;  1OUQ A;  1NKB A;  4RH6 A;  5KFP A;  5J2K A;  1X9S A;  1MC8 A;  2N1R A;  4K4G A;  2KHW B;  4XYC A;  2F8K A;  4M02 A;  3FAH A;  3V62 A;  4DFP A;  5AK5 A;  1UT8 A;  4HPP A;  2MBB B;  2J4X A;  3D2N A;  3PLU A;  4GFJ A;  5J2F A;  2DGZ A;  4O3Q A;  1F5S A;  1NJW A;  5HMM A;  4MSM B;  3F53 A;  4C4T A;  3ZGZ A;  3JSV B;  4JPS A;  1MPE A;  1TS4 A;  2X38 A;  4DL6 A;  3IT6 B;  3ZRF A;  2IGH A;  4JWS C;  3LYY A;  2KDB A;  4OCZ A;  2C2E A;  1C4A A;  4LJO B;  3FM9 A;  3M63 B;  4M6W B;  2GBN A;  1CRX A;  5KHO A;  3HJE A;  3AQE A;  7ICV A;  1WE6 A;  3WAP A;  2KFJ A;  2KG5 A;  2ZW1 A;  2HBJ A;  4KZC A;  3QU9 A;  1Z3E B;  2ON8 A;  4A9A A;  3U2S C;  3H8H A;  5DB8 A;  4Q8E A;  2EEL A;  4ELV A;  2W9B B;  3VH4 B;  4RQ8 A;  2KQ4 X;  4RM9 A;  3IFW B;  1WGY A;  4O3R A;  2XK5 A;  3I57 A;  2HJ8 A;  5GXG B;  4TUQ A;  5ALM A;  4BKT A;  4BXO A;  4FS1 A;  4P1C C;  2GB1 A;  3I28 A;  3RYT A;  2G5H B;  2DKX A;  4BGD A;  5EE9 A;  3N3K B;  3RB0 A;  4PS7 A;  1JRO A;  1I7H A;  2BCV A;  5BMG A;  5BO4 B;  1QIL A;  2H3F A;  1V1O A;  4DOB A;  4YR0 A;  3UI3 A;  3E58 A;  2KDF B;  1U9L A;  3DHI C;  3B2G A;  3I1Y A;  2D11 A;  4GIB A;  3JSV A;  5DCN A;  4UB2 A;  4DXG A;  2M4N A;  1FO4 A;  5AUK A;  4EFO A;  1L7O A;  3SD5 A;  2O2V A;  3U4E G;  5J0Q A;  4X57 B;  3Q3N C;  2KVZ A;  3V7L A;  2QKQ A;  9ICI A;  4O5C A;  1JAL A;  1ZRM A;  1GUA B;  4OVZ A;  3ZO5 B;  3K1Z A;  3D32 A;  4R65 A;  5EE1 A;  3JPR A;  4TQR A;  4A8E A;  1WGD A;  3ETL A;  4W9L A;  3KZI U;  5FR3 A;  4AUQ C;  4UDU C;  9ICM A;  4NL9 C;  3D2S A;  5A0L A;  5HG2 A;  5J8Y A;  3SDL C;  2I6X A;  4YTP B;  1XO0 A;  2MBO A;  3MP9 A;  4Y2R A;  3Q6B A;  5TSS A;  5E79 U;  5BYR A;  3KHG A;  1JCK B;  2ZVO A;  4ANV A;  4OJ6 A;  2Y5C A;  2E6X A;  1HTO A;  2BTE A;  5F3X B;  2BR0 A;  8ICJ A;  2KT7 A;  2H5X A;  2V3S A;  5EDS A;  5DDM A;  4LZG A;  1X9X A;  3RJI A;  4WQO B;  5AHX A;  1URJ A;  2LVO A;  3AE6 B;  2LEK A;  3E0F A;  3AI5 A;  3G6V A;  4GXJ A;  2XY7 A;  2PFO A;  2MEK A;  3AE3 B;  4AQ7 A;  8ICU A;  2KHQ A;  2MQJ A;  2BQQ A;  5KG3 A;  5KL1 B;  4PHD A;  1PVQ A;  5ALY A;  3MHZ A;  4U6P A;  2IA6 A;  4XWT A;  2ZTC A;  3BQ2 A;  1QOB A;  1QH9 A;  4KSL C;  2DZM A;  3DOW A;  1PK1 B;  2HCF A;  2F1I A;  3HKZ C;  3QXG A;  3PW5 A;  4UAY A;  3U7Z A;  4ZRI A;  1T6B X;  2BS4 B;  5BYQ A;  2J6U A;  5B66 U;  5J0S A;  2KSO B;  1DRG A;  8ICH A;  3N97 B;  1QSY A;  2ISO A;  2JUO A;  4Q2J A;  2BBC A;  2NR2 A;  4NM1 A;  4TQS A;  1M4V A;  2KFN A;  2KO3 A;  2EZZ A;  3HX0 A;  2FMS A;  1LO5 D;  1ZQR A;  2RR9 A;  3GOE A;  4FBJ B;  1L8L A;  3HRD D;  2R8K A;  3GZF A;  7ICG A;  2OCE A;  2IO3 B;  5J0X A;  4W9D A;  3TJP A;  3W1Y A;  1P7E A;  1C20 A;  4F3O A;  3VR8 B;  4KN7 A;  1V9P A;  4C8M A;  4BWM A;  3PNC A;  1FMA D;  3P4P B;  2N9L A;  2KD1 A;  3KUC B;  3KHL A;  1PVP A;  1NI3 A;  5KT6 A;  2VH2 A;  3SQI A;  1KRP A;  3UQA A;  1ZD3 A;  2JYE A;  4NL9 A;  1OTR B;  1TKE A;  2RLT A;  3V7K A;  4ZDV A;  1X9M A;  1EM7 A;  1KOT A;  2KJ8 A;  3KBB A;  2DPI A;  2FLP A;  4I2E A;  1F2R I;  1E8X A;  3ZUN A;  2RQ5 A;  1J2M A;  4KTQ A;  1GO3 F;  1SKR A;  3M62 B;  4NZL B;  3K1R B;  1UUP A;  1WX9 A;  1KFD A;  1V38 A;  4Y2Y A;  1YQB A;  2PVO D;  1HEK A;  3DCG A;  4L23 A;  4KN4 A;  1NK8 A;  1QKZ A;  3TEZ A;  4PJ0 U;  2R2Q A;  1PK3 A;  1KLU D;  2IGG A;  1I4H A;  4Y2J A;  4KLO A;  8ICQ A;  2I1K A;  3TEW A;  4PZN A;  1WXA A;  3PS6 A;  3CP8 A;  3Q8B A;  5KFD A;  3ZNI D;  3DBL B;  2XC9 A;  4XC2 A;  1R4M B;  1T8E A;  4FJV B;  2ZXI A;  1Z19 A;  2OM6 A;  3GQC A;  2JHD A;  1WCN A;  2PFN A;  4DWI A;  4GLX A;  1T5X D;  4GU2 A;  1T3N A;  3OGU A;  2MLB A;  3OJU A;  1NEN B;  1ESF A;  3QA8 A;  2D07 B;  4B9T A;  5C3J B;  3KYD D;  4LJX A;  2WXR A;  4UW9 A;  5AEK B;  1Q10 A;  4G3X B;  2WDT B;  4DF8 A;  4F92 B;  4EYH B;  4F5P A;  1WWU A;  1L3T A;  1RFK A;  5J18 A;  2M19 A;  3RZF A;  1WJN A;  4GC6 A;  1IIP A;  3U30 A;  1KF6 B;  2GMI C;  3M8S A;  2LVQ A;  2H89 B;  3Q8C A;  7ICH A;  5CEH A;  1Q3U A;  3WK9 A;  5D46 A;  1NDD A;  2AL6 A;  4J9Q A;  3QU7 A;  5FKA C;  3BQ1 A;  2XO7 A;  2V3P A;  5C0Y A;  2I38 A;  2INN E;  2NBU A;  2DYB A;  4IL6 U;  2L0F A;  2HOF A;  2Z0D B;  3BK2 A;  2L8J A;  4I2A A;  2JT4 B;  1NK7 A;  2RRD A;  1WY8 A;  1JIH A;  2AHO B;  2QB0 A;  2ZJA A;  3LVW A;  9ICN A;  4RU9 A;  2G4D B;  3EGR A;  5D7G A;  2JZ3 B;  4RT2 A;  1BPX A;  3KUD B;  3QWZ B;  4Q44 A;  2WXK A;  2F1H A;  1WRI A;  2WXH A;  4R3D A;  2MP2 B;  2JRI B;  1XCT L;  2DL0 A;  5BOM A;  1QSS A;  1MQ3 A;  3DEE A;  1FD6 A;  4OD0 A;  2HBK A;  4F93 B;  4YTN B;  3V6H A;  2Y9T A;  5TIS U;  2WF7 A;  3QEA Z;  1HUZ A;  9ICR A;  4I6P A;  4A20 A;  2D8C A;  3DVG Y;  2XVT A;  4J9L A;  2Y9U A;  3CW2 C;  3KH0 A;  3NS8 A;  4A8X C;  2Y5B B;  3ZXR A;  1SWV A;  2G08 A;  5AIA A;  2C28 A;  4DFJ A;  1WXV A;  5E6J A;  1I4Q A;  1NK6 A;  3R2T A;  4IG7 B;  4JB3 A;  2OED A;  1ZQW A;  4J9M A;  3PW0 A;  1ZQY A;  3HP6 A;  1H38 A;  8ICE A;  2AXT U;  2D3A A;  4BVU C;  3GV8 B;  2WGS A;  2D3D A;  4Y2U A;  8ICF A;  2ONQ A;  1J7A A;  2BF8 B;  4DLE A;  1WXQ A;  1XSL A;  2ISP A;  1PVR A;  2BB5 A;  2LUE A;  4F2R A;  1QLN A;  1OXJ A;  2BQ3 A;  4NLN A;  1A0P A;  1Y88 A;  2VH1 A;  4FJY A;  4BKS A;  2O6V D;  3ZI4 A;  1V2Y A;  1LVH A;  1FEH A;  1ZQM A;  3Q8P B;  1YJ1 A;  4PHP A;  3RFA A;  1COK A;  1K50 A;  5G2N A;  2KIC A;  3TCA A;  2IOF K;  2ZIV A;  1X2I A;  4EZJ A;  3W9C B;  1L3U A;  1IXR A;  5G5G A;  3KLS X;  5J2A A;  7ICP A;  4C4V B;  2QAR A;  2WLB A;  4DL7 A;  1XLN A;  3KWL A;  4C7Z A;  1QOF A;  3N20 C;  2LM4 A;  2IGD A;  4AP4 C;  1SL1 A;  3TAR A;  2WP9 B;  4NJ8 A;  4JV0 A;  4BJQ A;  2DF4 B;  2KOX A;  2R61 A;  1WXM A;  4EE2 A;  1DOI A;  5AI0 A;  8ICY A;  5KG4 A;  5E6P A;  1PDX A;  2YML A;  1RG6 A;  2QSD A;  2W9C A;  2ZIU A;  3GIK A;  5D4B A;  3IRU A;  4P0P B;  2A19 A;  5ALJ A;  4BBN C;  1PUZ A;  1SL0 A;  1NYR A;  1VZ8 A;  3JYU A;  4I2D A;  2DZK A;  4F7Z A;  2VIX A;  2J53 A;  2L7R A;  2NO4 A;  4BWJ A;  4NAW A;  4NJ7 A;  4XDC A;  5DKW A;  1ZQF A;  1I4P A;  2BYT A;  2OJW A;  4CHK A;  2CJO A;  2W9A A;  4GIV A;  1Z1V A;  1XS9 D;  4ECR A;  2MH7 A;  4UBC A;  2FLN A;  2PTL A;  2XY5 A;  3IG3 A;  3A1Q A;  4DHZ E;  1QF6 A;  2G3Q B;  1D9F A;  1VRA B;  4R8U B;  5AKK A;  4IKG A;  3RUI B;  2JV3 A;  8ICC A;  5D3D A;  4ZH4 A;  3DPD A;  1XU4 A;  1C1Y B;  2CN1 A;  3RBD A;  1SBB B;  4AJW A;  3P1M A;  2FCQ A;  1L7P A;  1RQN A;  4ED8 A;  1D5M C;  5EE0 A;  2DQN B;  4NY0 A;  2IHN A;  4OO1 J;  4N6E B;  3OG5 A;  1I4R A;  4DK5 A;  5CB1 A;  1CUK A;  3IG5 A;  2Y1J A;  1TZ1 A;  3LJ3 A;  2HW3 A;  3BVG A;  8ICZ A;  2L76 A;  3ZNH B;  2XI9 A;  1S0N A;  2RSU A;  4URK A;  5EOZ A;  4QWD A;  3B0X A;  1XNS A;  4PGQ A;  3HK0 A;  4C8L A;  3PO5 A;  3OPX A;  4ZRP A;  1DGJ A;  1NK9 A;  4ACF A;  2CU3 A;  3AEA B;  2N7D A;  2MJ3 A;  1TAQ A;  2HBL A;  1Z00 A;  5F9N A;  1ZQT A;  4JWM A;  2O6V B;  3SHQ A;  2B6G A;  1TK0 A;  5GMV A;  2NRT A;  4DDI D;  1J7B A;  2BS3 B;  1MQ2 A;  2JX5 A;  3IP4 B;  5E6N A;  5AZH A;  4F5N A;  1KFY B;  1Z2M A;  2KVC A;  1HZ6 A;  2D3B A;  1L5P A;  5KNI A;  1P1A A;  4RNO A;  1GB1 A;  1L6V A;  3DV9 A;  4IQU A;  3QE9 Y;  3DBR B;  2KFZ A;  4GSW A;  2J0M A;  2MX2 A;  2LUM A;  3RNB C;  2A1J A;  4DL5 A;  2RHF A;  9ICQ A;  1BNP A;  2L83 A;  3VCB A;  3J81 j;  4OJP A;  3QZ7 A;  2V4L A;  1L3V A;  1E7P B;  2K1F A;  3ICX A;  5DBB A;  1ROE A;  3BVZ A;  2BVC A;  5IIL A;  4P4O A;  3TAN A;  1BPZ A;  2GBR A;  3MR6 A;  3R8B A;  5CX3 A;  1D8Y A;  1NNL A;  4OZC A;  4L2Y A;  2LMC A;  4KX3 A;  3T5J A;  1ZQJ A;  3AMZ A;  1BPB A;  1WGH A;  2IND C;  3C5F A;  3LXF A;  2NPT A;  2IO0 B;  4HXD A;  2NMQ A;  5DBA A;  3HPO A;  1F44 A;  2JYT A;  2MHJ A;  1ZQN A;  2MSE D;  2NCN A;  2ASQ A;  3AEF B;  3PSE B;  3QX1 A;  1RQL A;  3VC8 A;  1QQ5 A;  4RQN A;  2QEJ C;  4O3N A;  3PR5 B;  1ZJM A;  4CCH A;  3DBH I;  2KK8 A;  2WAQ F;  1X6J A;  4PZO A;  2KDI A;  4QZB A;  1Z4O A;  4QZE A;  2KQ7 A;  1WSP A;  3KTQ A;  4FZN A;  4OHJ A;  4O5K A;  5IIK A;  2WYQ A;  2MUT B;  3SAG A;  3OWE B;  2KLC A;  2KJ9 A;  2KN4 A;  2ZTE A;  2JPH A;  4KIK A;  4HRO A;  1ECW A;  4AYB F;  4R66 A;  4QZD A;  3EFC A;  3PV8 A;  3IDW A;  5AM4 A;  2Z8L A;  3KZX A;  2BCQ A;  3IN5 A;  4CF3 A;  2WXL A;  4LNI A;  5IP4 D;  3DHG C;  5FR6 A;  4F91 B;  5KFF A;  1NKE A;  8ICM A;  3UMC A;  3EWA A;  4M00 A;  5KFY A;  4EBE A;  1HQR D;  3JVZ X;  4TQ1 A;  5HFY A;  3ZRC A;  4KLH A;  2VJ5 A;  4YVZ A;  5TR5 A;  3NVY A;  1TIF A;  3V6K A;  4C4S A;  4EUT A;  2KKV A;  5F9L A;  4YMM A;  3PMN A;  1K52 A;  4LNN A;  5KFQ A;  1E90 A;  3UQ0 A;  1Q3V A;  2KDM A;  1WF9 A;  2KVS A;  3C28 A;  3DBL I;  5I4D A;  4ZYN A;  3TL5 A;  5J17 A;  5H8Y E;  1HTQ A;  4DL3 A;  1AAR A;  1F1H A;  2KHV A;  4E0D A;  4I6N B;  3H40 A;  2W7P A;  1SV4 A;  1U4B A;  5HML A;  4QZA A;  3UMB A;  5KFS A;  4MH0 E;  3GIJ A;  1KN5 A;  3LYS A;  1NZB A;  2ZNV C;  2W7O A;  3N32 A;  1UQV A;  2C7N B;  2BW2 A;  1E8Z A;  2ESE A;  1E0Z A;  1JQ4 A;  1SL2 A;  3PX0 A;  3AM9 A;  3ZDB A;  4UAV A;  7ICT A;  4XDD A;  4HKZ E;  3VTW A;  2K60 A;  1GC6 A;  4EBC A;  4UAT A;  1IG6 A;  1TTN A;  1TYG B;  4Y2P A;  3ALR A;  1SV0 A;  4O3S A;  4F8R A;  3EA6 A;  5C5J A;  3HVD A;  9ICV A;  5DBC A;  2RDJ A;  1MVK A;  5DG9 A;  3OHA A;  4C8O A;  3TEX A;  3V60 A;  4OVU A;  2R8G A;  3C1Z A;  9ICW A;  1U4A A;  4LVS A;  4DQR A;  1PYW D;  2KWU B;  3E56 A;  1WH3 A;  4ZRJ A;  3ZTD A;  2DYO A;  4PL2 A;  4EZ6 A;  5L83 A;  1MG8 A;  3K9O B;  1UWM A;  2VRR B;  3SI8 A;  3MR5 A;  3N1Y C;  3CIR B;  3DQV A;  2BGW A;  5IOI A;  4DHZ B;  4HCN B;  4WJ3 B;  1VZ6 A;  4IC9 A;  3BZC A;  1ZQG A;  4NV0 A;  2RDG A;  2K4H A;  2ICI A;  7ICM A;  1TK5 A;  1YZ6 A;  1QOG A;  1WUD A;  1WGG A;  3N28 A;  2YY6 A;  3H7I A;  4XUS A;  3MGV A;  3JPP A;  2YEP F;  2FI1 A;  1GNU A;  5HHI A;  3B08 A;  4RF1 A;  8ICT A;  1D5Z C;  3M6Z A;  3Q3J A;  5KG7 A;  2KZZ A;  2LYH A;  3SFE B;  1VJ5 A;  1JWS D;  3K75 D;  1P3Q U;  2LXC A;  3CYM A;  2WQY B;  3VTU A;  3X0W A;  2RDI A;  1RLF A;  3BY4 B;  4P0Q B;  1X1M A;  2PE9 A;  3B2F A;  1NEK B;  2GOW A;  3FIL B;  3THV A;  1L8O A;  2N9X A;  4GOC A;  1I35 A;  4A3P A;  1QQ7 A;  1LKY A;  2KTR B;  4RM8 A;  9ICG A;  4M0W A;  1KQQ A;  2AGO A;  2UYZ B;  5CHW A;  1MSW D;  8ICP A;  4E74 A;  4ZYS A;  4MM3 B;  3BS5 A;  4OVV A;  3R9K A;  1J8C A;  3ML8 A;  1SXD A;  5IIM A;  3RH6 A;  3UQ2 A;  4P0P A;  3UIN B;  4HJG E;  5CA7 A;  4AYB C;  3PRE A;  3UGB B;  5JZE B;  1G6J A;  4FS2 A;  1PZN A;  3A9K A;  4WWN A;  4HEA 1;  4PYU A;  3ZD9 A;  4KZ0 A;  4UB3 A;  4C4R A;  3SEB A;  4IWQ A;  4NLB A;  4Z6D A;  4BBN F;  4UAZ A;  3D6J A;  4DQP A;  2KJ5 A;  3ZDE A;  3Q8A A;  3O65 B;  1S9F A;  2FCN A;  1QQ6 A;  4DQQ A;  8ICK A;  4DSK A;  3MC9 A;  4ITK A;  2IBI B;  3AH7 A;  3GS2 A;  1HUO A;  3SEN A;  5HHD G;  1F0Z A;  2HHX A;  5IA7 A;  2BHN A;  2NBW B;  1R7S A;  3CF6 E;  4KGR A;  2MCN B;  3EW9 A;  4F72 A;  1IM4 A;  4QZH A;  5J0O A;  1UZX B;  4FLH A;  1ZJN A;  3QK0 A;  1RDF A;  3RB6 A;  4NLK A;  2DX5 B;  3AED B;  3AUL A;  4DWF A;  1E9M A;  1AQ6 A;  1UCV A;  5LXH A;  4RQ2 A;  1JRU A;  1TAM A;  2KNJ A;  2LAS A;  3K4G A;  4KX5 A;  4NXZ A;  3L08 A;  4IWO A;  1MI0 A;  2MBQ A;  2WF8 A;  1SJE D;  3BZK A;  1ZKH A;  3U7D A;  3QYP A;  5BPC A;  3W5U B;  2XCP A;  3A1Q B;  3RJJ A;  1ZQV A;  3PT2 B;  2K3U A;  3B0A A;  3PRZ A;  1SIF A;  2BWF A;  2AYO B;  4MEM A;  2PW9 A;  4M9L A;  3VHT C;  4S17 A;  5L9X A;  2ZZP B;  1BNO A;  1CMX B;  4EEK A;  3BDP A;  1ENF A;  1RYJ A;  4OW0 A;  3ZVV A;  3VUY A;  2MA9 B;  1S0M A;  5KG5 A;  1C79 A;  1ZGU B;  1EU3 A;  2KVR A;  4CF5 A;  1S10 A;  1ET9 A;  2HOQ A;  5EE3 A;  2DKZ A;  2FPL A;  2YB4 A;  4M9G A;  4B9N A;  3CSF A;  7ICN A;  3GE3 C;  2K5P A;  4JGH B;  2AJQ A;  1IV8 A;  5CTR C;  1L6U A;  2JRZ A;  4CRX A;  1C4P A;  2IPK D;  1L0X B;  2NRX A;  1NOM A;  4A3O A;  3PW4 A;  5HR6 A;  2G0A A;  3PO0 A;  3MAB A;  3M6K A;  1TAU A;  5KG0 A;  9ICA A;  3PVL A;  4WJO A;  4CYE A;  4JK1 A;  5AKE A;  3ZDD A;  2HHS A;  1T0Y A;  2JXT A;  1WGR A;  1TK8 A;  3W1S C;  3ISC A;  4D2K A;  1V8C A;  2KWC A;  3R2I A;  1WG8 A;  4W9E A;  1NK0 A;  1YQ3 B;  5C2T B;  2LGS A;  4RNN A;  4RQ7 A;  1JX4 A;  4FBT A;  3Q8M A;  4YL8 A;  4ECZ A;  1F0M A;  3IAS 1;  3ZJV A;  1ZQI A;  3AE4 B;  5AI6 A;  4DOC A;  3H7P B;  4TUU A;  1YX6 B;  5D2M B;  5J2R A;  4Y2V A;  1UHU A;  3RR8 A;  4K81 A;  5ALK A;  5AKY A;  4MH8 A;  4F4W A;  2VAN A;  4IRK A;  2LVP A;  9ICS A;  2HVH A;  2C5L C;  3H6N A;  3UF8 A;  3KHH A;  1FIQ A;  2MU2 A;  4RGN A;  5CR0 A;  2J52 A;  3ONN A;  4NJC A;  5LLI A;  4KDI C;  3MDA A;  3ZW3 A;  2O2V B;  5KFL A;  2KAC A;  1JXL A;  1Q0W B;  8ICN A;  3Q8L A;  1FFU A;  1S76 D;  2PJH A;  3BII D;  3WK5 A;  1RYS A;  1NBF C;  4ANU A;  1J19 A;  4LDT D;  4YSY B;  3RNE C;  3UM9 A;  3H0R B;  4J6I A;  3QU5 A;  3PRP B;  2HJ1 A;  2LXA A;  5AKG A;  1WWV A;  3TAP A;  1OGW A;  4RF0 A;  4MGK E;  3GFK B;  3U52 E;  3RNG C;  2O6K A;  1WMH B;  5C1Z A;  2L5Y A;  1GAQ B;  2QIL A;  2WFA A;  1Q1O A;  2KWV B;  2J6S A;  2BYV E;  1UGM A;  3Q8K A;  3EUB 2;  4RT3 A;  5BMI A;  1VR9 A;  5AKX A;  2YMM A;  3IM1 A;  2BCR A;  2NO5 A;  4B6W A;  4FZM A;  4NAW B;  4RQM A;  2JWZ A;  1V49 A;  2DEN B;  9ICP A;  1XSN A;  1PGX A;  2ZJD A;  3MGH A;  3TEY A;  2KAN A;  3QUB A;  2KEY A;  3NVW A;  4M9H A;  2LFI A;  2B0C A;  4FFD A;  2WF6 A;  2GLS A;  2PE6 B;  4DQS A;  1B4F A;  2HDO A;  1SF0 A;  4KLG A;  3TI0 A;  2LKY A;  3C2L A;  2WWZ A;  4GMV A;  5E6O A;  2KN7 A;  5ALP A;  4M2Y A;  2MWS B;  5G5H A;  9ICF A;  2D5G A;  2R8I A;  5AI9 A;  4F50 A;  1V85 A;  9ICL A;  4WQM A;  3SAH A;  2W82 A;  3TBL D;  2E1E A;  5H2F U;  4FHJ A;  1SE9 A;  2XCA A;  3KKA A;  1WZ0 A;  3FC4 A;  2W9N A;  3TMP B;  4LDT B;  4CE6 A;  2AQ0 A;  2IJ0 A;  5C23 A;  1TVA A;  4J9O A;  2E1F A;  4BAX A;  4QIW C;  4RQ0 A;  1ZXH A;  2J7Q B;  2A4Z A;  4ANX A;  5JH5 C;  3VH3 B;  1V6E A;  4ARC A;  3PR4 A;  1BUI C;  4LNK A;  2GI9 A;  1FPY A;  5ALG A;  4NQK E;  3V61 A;  4RQ1 A;  4KLI A;  2JF5 A;  3A9J A;  2BKR B;  4F5R A;  4OJL A;  3RTV A;  2PIA A;  1B1Z A;  4JV1 A;  4B95 A;  3J9C A;  3L5K A;  1TS3 A;  2KLG A;  1Y56 A;  3TAD A;  4DEZ A;  3L10 B;  4W9F A;  5J2B A;  4DSJ A;  1KM7 A;  2PPH A;  2IYD B;  3NVZ A;  4UAU A;  5D49 A;  2PMZ F;  3QNM A;  2HHV A;  3BS7 A;  1QT9 A;  4FN2 A;  4J03 A;  1WJ4 A;  2BPC A;  5BMH A;  3PV1 A;  3NOB A;  3TFS A;  2DPJ A;  2E8N A;  3HIZ A;  5DLF A;  4M01 A;  4MSQ B;  1JWM D;  1JI7 A;  2W8K A;  3KHR A;  1ZP0 B;  4DXA B;  2QLT A;  1V80 A;  3PHX B;  1JXE A;  2K8B B;  4P1B C;  5IO9 A;  2AGQ A;  1EU4 A;  4DSE A;  2BQU A;  2ASD A;  4BXO B;  3AB5 A;  3I3T B;  2DWQ A;  2EKE C;  3MJW A;  2V4R A;  5JTI A;  2LD9 A;  4ASW C;  2F44 A;  4MT5 A;  4XWW A;  3AEV A;  4FE3 A;  4PS3 A;  4B0E A;  3ALB A;  3ZD8 A;  2W9M A;  1WFY A;  4BUG A;  2BDU A;  4DSI A;  2AWT A;  5IIJ A;  3NRW A;  4BKS D;  2NRW A;  2DUY A;  5ALO A;  1UF0 A;  7ICO A;  5D94 A;  3RB4 A;  1BPE A;  2K9X A;  4EX6 A;  2LYB A;  3T8M A;  4C8N A;  4Y2S A;  1E6E B;  1YZ7 A;  1ZQE A;  1MN8 A;  2C2R A;  1UA0 A;  1E8Y A;  4F8C B;  4BX9 C;  3NZ3 A;  4BDP A;  1WYW B;  3LDA A;  4HDQ A;  4ICV A;  3Q3F A;  4M6W A;  2K22 A;  1ZQO A;  3H8J A;  2INP E;  3M3J A;  3QUQ A;  8ICO A;  3H4D A;  3IHP C;  3T79 A;  3A33 B;  4FJZ A;  3T9L A;  4EEY A;  3WK7 A;  2W43 A;  3LWL A;  2I1J A;  1DGS A;  3LVV A;  4TUP A;  2XGP A;  1KFT A;  2BYF A;  3ZNZ B;  1DOQ A;  1ZQA A;  2J42 A;  3UXP A;  5LXI B;  2H3Z A;  2LGI A;  2D10 A;  4WUR A;  5DPW A;  5KFT A;  2JRH A;  4G11 A;  2XK5 B;  1EUV B;  4F4X A;  1L3S A;  3P63 A;  3I5J C;  1HJP A;  4KLQ A;  2ZUD A;  1U47 A;  2D3C A;  2FID A;  5KFB A;  2K6Q A;  2LHT A;  3QUT A;  3SV3 A;  5KFW A;  3A0H U;  1HA5 A;  4RPY A;  4JUZ A;  2F2A B;  4II2 B;  1FM0 D;  3T3N A;  3BIN A;  3PY8 A;  2ZJ5 A;  4EBD A;  5AM0 A;  5DPT A;  1X42 A;  1IBX B;  1FFV A;  5HHH A;  1L5U A;  2HSZ A;  4DFM A;  3PGE A;  3CMM B;  1RRB A;  1ZOY B;  4NLZ A;  5AIC A;  4ELU A;  1D5X C;  3WKD A;  1SKS A;  4F4K A;  4KDL B;  5ALX A;  1K53 A;  2Y0S F;  1X66 A;  2KMA A;  3TKA A;  2V9W A;  1BML C;  2M0A A;  2M8S A;  2F1J A;  4DFD A;  2IOH A;  3TAC B;  1CJE A;  1BT0 A;  3H8W A;  5AK4 A;  1LV5 A;  2JMG A;  3QCA A;  3ETR A;  1L7N A;  1ZQU A;  1NVI D;  3L54 A;  4MDK E;  3TSS A;  1COO A;  2WXM A;  5KFZ A;  4YSZ B;  4EYI B;  4Y2X A;  2CHZ A;  2WDQ B;  3HHM A;  1DYQ A;  2K39 A;  3BWU D;  4RGT A;  4CNQ A;  3WIM A;  4YXM A;  3BK1 A;  4BKG A;  1ZQB A;  3RNA C;  3GB1 A;  4LNF A;  3Q8R B;  5CRX A;  2N1W A;  3OAW A;  1RM6 C;  4YP3 A;  4Q8F A;  2K8C B;  1MHH E;  1XD3 B;  2L0T A;  4RGM A;  1JUD A;  3EZ5 A;  3TUO A;  4ECX A;  4A55 A;  2PVG C;  5DQH A;  2WS3 B;  4F4Z A;  2R8H A;  1JWA D;  1LM8 B;  4KVG B;  1RFA A;  4A90 A;  1OQY A;  4RMA A;  3HWT A;  2RDB C;  5G55 A;  4DO9 A;  4XX5 A;  4DBG A;  4UB8 U;  3QEB Z;  4QZG A;  1DK2 A;  4JX1 C;  4YQW A;  3V7J A;  3OLM D;  3JPN A;  3QZ8 A;  4IOI E;  4PHA A;  1B0X A;  5IIO A;  5L1K A;  3EPI A;  1FXT B;  4JWN A;  2WXG A;  3BJY A;  2BPS A;  3MC8 A;  1NZP A;  2RPV A;  3ECI A;  4NM2 A;  4W9J A;  2W55 A;  1SJH D;  2FNJ B;  2PKE A;  2M17 A;  3C5G A;  1UD7 A;  4DQO C;  4HPM B;  4MF2 A;  2KNB A;  4QWC A;  3WAL A;  4RQ4 A;  4KGT A;  7ICR A;  4ED1 A;  2DBY A;  4XE0 A;  1LGR A;  1T0Q C;  3NZU A;  1B43 A;  3AE7 B;  5J0T A;  1VCB A;  2K8H A;  3RR7 A;  4RNA A;  5D6J B;  4QZF A;  3MTN B;  3MFI A;  5J2J A;  4XRH A;  2ES6 A;  2ASL A;  2W03 A;  1TT5 B;  1X40 A;  2FMQ A;  2N4F A;  2CRX A;  3GZN I;  4USA A;  1A77 A;  3PO4 A;  2CHX A;  4KV2 A;  3G6Y A;  1S77 D;  3S6J A;  4N58 A;  7ICS A;  1JMS A;  4I29 A;  2QIE B;  1YN3 A;  3IVF A;  2TSS A;  3CWI A;  4PGY A;  2V0G A;  2MA1 A;  2K4P A;  3SAF A;  3NHE B;  1QLB B;  2QDF A;  2Y3A A;  8ICI A;  1NK4 A;  1ZQD A;  4G50 A;  4MM3 A;  3I9V 1;  4O1N A;  1WM3 A;  1P9D U;  2RP5 A;  4JMU A;  1N56 A;  2XEW A;  2FPK A;  2KTQ A;  2X8X X;  2LGX A;  2BPF A;  3OJ3 A;  5AKI A;  4ED0 A;  4TV3 A;  2ACZ B;  1F77 A;  3RF9 A;  2YN4 A;  3UXO A;  1RXV A;  1IUE A;  2KX0 A;  5KFC A;  5HNK A;  5J0W A;  1ZQ1 C;  1WX7 A;  4Q45 A;  1N48 A;  3I63 C;  2LJI A;  4I27 A;  3BQT A;  2WU5 B;  4O3M A;  4PYZ A;  2WAQ C;  1DK3 A;  1TY2 A;  3ISB A;  4ZHO A;  1SIJ A;  3AU4 A;  1U48 A;  2EMT A;  3IT4 B;  3AU6 A;  1AN8 A;  2JZB B;  3Q3O C;  3RH5 A;  5EWG A;  5KG6 A;  5ALV A;  1NKC A;  1PQS A;  3VR9 B;  3NS1 A;  1JWB D;  2ZEQ A;  1M6Y A;  3N7P D;  9ICH A;  4LCD E;  2MRL A;  3TAQ A;  4WJP A;  1FRD A;  3BQ0 A;  1V86 A;  3UIO B;  3C0R B;  2BCU A;  2EH9 A;  1JML A;  5AI8 A;  1YOV B;  4C56 C;  4B9L A;  4RZR A;  4BZA A;  4HK2 A;  5J2E A;  2EAO A;  1IPG A;  3NAS A;  1Q46 A;  4QZ8 A;  2FLL A;  5AKL A;  7ICQ A;  1LB2 B;  2NBV B;  1ZQZ A;  5J0Y A;  3G6X A;  5AI5 A;  5JHA A;  2W11 A;  1D4B A;  3WK6 A;  2B21 A;  3BS5 B;  1EF1 A;  2KZR A;  4I2I A;  2JU6 X;  1SZP A;  3C2M A;  2KK0 A;  2NYV A;  2W54 A;  2BCS A;  1J7C A;  1OQQ A;  3A9J B;  2E3T A;  2JH7 A;  1A5R A;  1SE2 A;  3AXC A;  3HT3 A;  1WJU A;  1B22 A;  2KC2 A;  4FA6 A;  3PML A;  1VZ7 A;  3QAR A;  2JXJ A;  2XNA C;  2REX A;  3M95 A;  3WK8 A;  2XY6 A;  1XWL A;  3HKZ F;  3PZ7 A;  4W9G A;  2KX3 A;  3KWV A;  2CXY A;  4QW8 A;  3WK4 A;  3KKA C;  2BKF A;  3ZXV A;  1KFS A;  4JIO U;  4O0I A;  3ISD A;  1S0O A;  1KBU A;  2XN9 C;  2EDU A;  3RPF C;  4US9 A;  2MBE A;  1XQQ A;  3VXW A;  5DDY A;  3DWM A;  3QC8 B;  2KAJ A;  2AU0 A;  1V1P B;  1VD2 A;  1L0Y B;  4IRC A;  3M7D A;  3QAQ A;  5KG1 A;  4DSF A;  4LZD A;  4RPX A;  2ZUC A;  3JPS A;  2MJE A;  3N9Y C;  3VVW B;  3ZKJ C;  4EEW A;  2JZZ A;  2BQR A;  4HVB A;  2ZJ8 A;  8ICR A;  1BVS A;  1TS2 A;  1L7Y A;  2JQR B;  2HMX A;  4HLE A;  2W3S A;  1V97 A;  3V72 A;  5FP0 A;  4CF4 A;  4EEN A;  1R4N B;  3RZW C;  1YJI A;  1B9R A;  3HIL A;  4F1S A;  1Z5S B;  3ZDM C;  3EPG A;  5AM5 A;  3AQF A;  4QZC A;  3WU2 U;  5DB9 A;  2P6R A;  1SV0 C;  4IR1 A;  3ZDA A;  1ZPS A;  1ET6 A;  3SEI A;  4ED2 A;  4TUS A;  5AIB A;  2M0X A;  1NJY A;  3PSP A;  2EQY A;  2W3R A;  2UWQ A;  4HKQ A;  3JPQ A;  3H8M A;  3RRH A;  1ZQC A;  1WR1 A;  4ECY A;  4C7Y A;  1N62 A;  5ALL A;  1C77 A;  5BYS A;  2MAX A;  1A70 A;  1N63 A;  2NTT A;  4K4I A;  1UBQ A;  1QTM A;  3C2K A;  3L3F X;  2Y5P A;  3FIL A;  4QJF B;  1F52 A;  3AEE B;  3APC A;  3SR6 A;  1GOZ A;  3WAM A;  2D3G A;  2WX1 A;  1ZW7 A;  2UVV A;  4IS7 A;  2KE7 A;  1UH6 A;  1JRP A;  4LTU A;  5JU5 A;  2FUH B;  3VFK A;  5AKZ A;  1ZD5 A;  3NY5 A;  4MFA A;  1WXS A;  4HJK A;  1WMH A;  4CO7 A;  2PI5 A;  2EKI A;  4QWB A;  4DS4 A;  2RDH A;  3NUH B;  3WAN A;  1LFD A;  3U8Z A;  1GPX A;  2R2O A;  5HP4 A;  5J2G A;  2WXP A;  4WAA A;  4ECW A;  5EWF A;  2YTU A;  4GDK A;  2B76 B;  4ZHP A;  3GV5 B;  3RNF C;  4KX6 B;  3ZYY X;  2WXJ A;  1RPL A;  1C76 A;  2RMM A;  2V9H A;  2GBK A;  3W5V B;  3WKC A;  1D6E C;  1HIW A;  3GIM A;  1GC7 A;  1CZP A;  1PGA A;  2WXO A;  2ZCC A;  2F8L A;  7ICK A;  1J97 A;  4F5O A;  1P7D A;  2ASJ A;  2LRW A;  4G0N B;  4II3 B;  4KLJ A;  3H0M B;  4DF4 A;  2G09 A;  9ICE A;  3PZD A;  4C0Z A;  2AL3 A;  2DYM A;  2VA8 A;  3M9N B;  4RGO S;  3RFZ B;  3VDZ A;  2BS2 B;  5AZG A;  1TKD A;  1H4R A;  4Z6E A;  2PKO A;  1MFW A;  3P4Q B;  2YEP B;  5KFM A;  3ZNG C;  1YD8 U;  3R7Q A;  2ATL A;  5ALQ A;  2UVU A;  3E9S A;  3ZTC A;  2Y0S C;  4PH5 A;  3CST A;  2CJN A;  2KMC A;  4P2H A;  3PLV A;  2B3A A;  1T4G A;  2IDY A;  5L1L A;  3RNC C;  5H92 C;  1ED1 A;  2ZIW A;  2ZCB A;  3MR3 A;  5DQG A;  1VLB A;  4JLC A;  1Z4N A;  1EXN A;  1STE A;  1GG3 A;  9ICJ A;  2Z59 B;  2GWS A;  4WIP A;  3VRB B;  1SB3 C;  4EZL A;  1P7F A;  1XLP A;  3F5A A;  2N7J A;  3N7R C;  5DB6 A;  2JEF A;  2UVR A;  4KLF A;  8ICB A;  2N1V A;  4XQ8 A;  5DGA A;  3AU2 A;  2K4I A;  3TAD C;  3RJH A;  4I2B A;  4I28 A;  2HE7 A;  2RD0 A;  2KQS A;  3A9K B;  1QOA A;  1FXA A;  2DZJ A;  4IW0 A;  4K7W A;  5J0U A;  1SE3 A;  7ICF A;  4DDG D;  1UGJ A;  3V05 A;  5EWE A;  4DHJ B;  4HRS A;  2GOL A;  4Z6F A;  5DQI A;  5B5E U;  4FO6 A;  5CP2 A;  5KFH A;  3AE5 B;  3M1Y A;  4DL2 A;  3AE1 B;  4MJS B;  2WXF A;  2JEJ A;  1IGC A;  1M94 A;  1FCC C;  4HPL B;  5ALD A;  2GH1 A;  1Z1B A;  3APD A;  2ZIX B;  3ENE A;  4UB5 A;  5GTI U;  2JSV X;  1C3T A;  3KVF B;  1ZXI A;  1XO1 A;  4N59 A;  1XSP A;  1U49 A;  4QAY A;  4IWP A;  5J2I A;  1EWY C;  2BKE A;  4PPX A;  1RYU A;  5AK6 A;  2AQ1 B;  2G1E A;  3UQB A;  1QCK A;  2KKP A;  3Q14 C;  3NZS A;  3Q8Q B;  1ZQS A;  3HM6 X;  2M1M A;  2WDR B;  1I42 A;  5HKH A;  5J8Y C;  4XGA B;  3U26 A;  3QUC A;  4B6J A;  1BXT A;  3P42 A;  4QZI A;  3E2E A;  1V81 A;  4KKI A;  1YT3 A;  5ALR A;  4KLU A;  4WWO A;  4EOY A;  4HAI A;  2BZF A;  1SKW A;  1JN3 A;  5J2D A;  2KZ3 A;  4F5Q A;  1TJE A;  2BGF A;  3OSN A;  4YG2 A;  3SFD B;  1DXS A;  3RUL A;  1YIW A;  1OEY A;  4EZ9 A;  4C8K A;  3QJZ A;  2LYA A;  1BPY A;  5L95 C;  1IBX A;  3PZ8 A;  4MEL A;  2H3Q A;  4ARI A;  4HWI B;  5KT7 A;  5ALT A;  2Q4T A;  2Q5W D;  2VZK B;  2E8P A;  5L1J A;  4MJS A;  2LMR A;  5J2C A;  3FKY A;  2MRP A;  4TMA B;  5KT4 A;  1CQV A;  9ICT A;  1A6S A;  1T7P A;  3ZDC A;  2CR5 A;  2KJH B;  3DDC B;  4OJ5 A;  5L1I A;  2C7H A;  2KXJ A;  2IMW P;  2W9C B;  4YMO A;  1S97 A;  4ED6 A;  2HHW A;  2KWD A;  3ABV B;  3F2D A;  1KH0 A;  4QIW F;  3Q69 A;  4WJN A;  3L4P A;  3APF A;  7ICU A;  2FIF A;  4UQG A;  1NYQ A;  2DLB A;  3SYZ A;  3F2B A;  3D2Q A;  2VA2 A;  1RAX A;  2L52 A;  5CHF A;  4EEL A;  3ZDT A;  2VZK D;  2EAM A;  2G4S A;  5LNK 1;  4FXC A;  4PL1 A;  2ZIW B;  4G3I A;  1N60 A;  1ZQQ A;  1OQR A;  4YCX A;  4IRD A;  4J9N A;  2KJR A;  3RD2 A;  4MFF A;  1AW7 A;  2FE9 A;  4O5E A;  2CU1 A;  1PFD A;  4OJO A;  1OFF A;  3BYY B;  3MFG A;  1HZ5 A;  3QHT A;  2KP7 A;  4KLL A;  3IG8 A;  1E10 A;  2E8M A;  2G06 A;  4O9M A;  2AX5 A;  3NGD A;  1CEZ A;  2OOB B;  4DHJ D;  4P4M A;  2OHF A;  3AU5 A;  4UB1 A;  2OEH A;  1J0G A;  4UAW A;  3C19 A;  3P4R B;  3T5H A;  3KFU F;  3PHW B;  4KIK B;  2YMP A;  4YWG G;  4KSK C;  1E7U A;  4ZRK A;  1BPD A;  1FEZ A;  1KTQ A;  4WWM A;  2RPQ A;  3RBE A;  1ZYQ A;  4WWP A;  2ZIU B;  2JZP A;  3V6J A;  4ACO A;  1QSL A;  8ICS A;  4GDL A;  3C29 A;  2KKC A;  3H1U A;  4NNJ B;  4W9I A;  2K6D B;  4GDL B;  1FCL A;  1ZQK A;  4O3O A;  4MGY E;  4KLE A;  2D2Q A;  5JHB A;  4X5V A;  1ZQP A;  2LJ5 A;  1I4G A;  2CKH B;  3MHS D;  2L00 B;  2P66 A;  3PSI A;  2FBW B;  2PI4 A;  2JEI A;  1OEY J;  4NQL B;  4ICA A;  2WX0 A;  1S1Q B;  3DHH C;  3HM3 A;  1KL9 A;  2MUT A;  3RAX A;  2AQ4 A;  2ALZ A;  2EAN A;  2N0S B;  5KFJ A;  5III A;  8ICV A;  4REZ A;  3RAQ A;  3C23 A;  3H8S A;  2SAK A;  1N5W A;  1WJ6 A;  2GBJ A;  5AM3 A;  1KEJ A;  1EWC A;  4IQW A;  3F5E A;  5CJ7 A;  2PLP A;  9ICB A;  3OJ4 B;  4ECU A;  1TY0 A;  2JR5 A;  1ZRN A;  4LNO A;  1YX5 B;  4Y2T A;  3WKB A;  4MEY A;  1UT5 A;  3O13 A;  1MHX A;  4IUM B;  2KTF A;  3PW7 A;  3RJK A;  2DFL A;  4NLG A;  2V4Q A;  2DAJ A;  4DFK A;  9ICX A;  3Q2A C;  1S3S G;  1XC9 A;  2I9G A;  5T14 A;  4AP9 A;  1UEL A;  1K5O A;  1P0R A;  1HXY D;  1NJZ A;  2FJ6 A;  3JW0 X;  1IGD A;  9ICK A;  3UIP B;  1H8C A;  3A4S C;  5CHG A;  2C2D A;  1ZDV A;  4B9U A;  3KW5 B;  2IO1 B;  1L7M A;  3C21 A;  1TFR A;  5AM2 A;  3UXN A;  2PMV A;  2Y1I A;  5KT5 A;  1SSN A;  1ISN A;  3H4B A;  2MJD A;  3ORY A;  2OXO A;  1S8O A;  3HUI A;  1ZOL A;  2HHU A;  4QW9 A;  3QU2 A;  4HDO A;  2HI0 A;  3WKE A;  2C60 A;  1EO6 A;  4PT5 A;  9ICO A;  2LHD A;  7ICL A;  2ZPY A;  5ALW A;  5KFG A;  1U45 A;  1YN5 A;  4MHV A;  3SMV A;  5ALF A;  4F2S A;  2INC C;  2BT6 A;  1XF5 L;  2KFK A;  2JH1 A;  2WDV B;  4M04 A;  3LK9 A;  4M0W B;  4GN1 A;  1Z00 B;  2O6V A;  2QMT A;  1LKY B;  2KTR A;  4YSX B;  4RPZ A;  1IYF A;  2QB1 A;  3ZJU A;  5CWR A; 
#chains in the Genus database with same CATH homology
 1MVK A;  4DXG A;  3TEX A;  1FO4 A;  5AUK A;  1XCQ L;  1QLB B;  2Y3A A;  4O1N A;  3U4E G;  3I9V 1;  1CK1 A;  1PYW D;  3E56 A;  1KLG D;  2DYO A;  1JAL A;  4OVZ A;  1UWM A;  3DWG C;  5EE1 A;  3CIR B;  2ACZ B;  1F77 A;  1FNV A;  1VZ6 A;  5FR3 A;  4UDU C;  1IUE A;  1AYF A;  2ICI A;  2RDG A;  5HG2 A;  1QOG A;  3P4S B;  2LJI A;  2V3N A;  2WU5 B;  4YTP B;  2YEP F;  3MP9 A;  4RF1 A;  1TY2 A;  4ZHO A;  5TSS A;  1SIJ A;  1D5Z C;  5BYR A;  3IT4 B;  2WNM A;  1JCK B;  3W2D A;  1AN8 A;  2Y5C A;  3SFE B;  2E6X A;  1JWS D;  2NTS A;  3VR9 B;  2WQY B;  3NS1 A;  1JWB D;  1VDV A;  2BTE A;  1L4Z B;  4LK0 M;  3B2F A;  1NEK B;  2HDE A;  3FIL B;  1FRD A;  1JML A;  3AE6 B;  4M0W A;  4C56 C;  2LEK A;  3AV8 A;  4ZYS A;  1AWD A;  1ZE3 D;  4MM3 B;  1ZUD 2;  2MEK A;  3AE3 B;  4RCO A;  4AQ7 A;  1D4B A;  3MHZ A;  3HVZ A;  1TS5 A;  1SXT A;  4HJG E;  2JU6 X;  4XWT A;  2BB6 A;  1QOB A;  2W54 A;  1J7C A;  4US8 A;  1OQQ A;  2E3T A;  1PUT A;  4HEA 1;  1SE2 A;  4J3O D;  3SEB A;  3U7Z A;  1T6B X;  2BS4 B;  1WWT A;  1VZ7 A;  5BYQ A;  4YXD B;  2XNA C;  1YMH E;  3Q8A A;  1DOX A;  1TKY A;  4Q2J A;  2BBC A;  4ITK A;  3PZ7 A;  1M4V A;  3KWV A;  3AH7 A;  3GS2 A;  3AE8 B;  4B0M A;  1LO5 D;  1FNW A;  5HHD G;  3HRD D;  1F0Z A;  1JWU D;  3MC0 B;  3V3X A;  1R7S A;  4KGR A;  2XN9 C;  1GB4 A;  3RPF C;  1P7E A;  4US9 A;  1SE4 A;  3VR8 B;  4MAC A;  4TQ0 A;  1FMA D;  3P4P B;  2N9L A;  3AED B;  3DWM A;  1E9M A;  2KAJ A;  1V1P B;  1NI3 A;  1DOY A;  1XLO A;  1L0Y B;  3N9Y C;  1V1P A;  1MI0 A;  2MJE A;  2JYE A;  3IXS A;  2L1A A;  4LLG M;  2JQR B;  1TKE A;  1TS2 A;  2I2Y A;  1SJE D;  2W3S A;  1EM7 A;  1V97 A;  2FUG 1;  3W5U B;  1F2R I;  2K3U A;  2M56 B;  1YJI A;  1B9R A;  2PW9 A;  4NZL B;  1UUP A;  3MJ5 A;  4OZB A;  1ZPS A;  1ET6 A;  1XEE A;  2PVO D;  4L23 A;  1RYJ A;  1ENF A;  4OW0 A;  5JXV A;  1QKZ A;  1C79 A;  2W3R A;  3TEZ A;  1EU3 A;  1FNU A;  4HKQ A;  2IGG A;  1KLU D;  1I4H A;  3TEW A;  1ET9 A;  5EE3 A;  4C7Y A;  1N62 A;  1C77 A;  5BYS A;  1A70 A;  2K5P A;  3Q8B A;  1N63 A;  2NTT A;  1WYG A;  5HI1 A;  1L6U A;  2Y5P A;  2H88 B;  3FIL A;  1C4P A;  2IPK D;  1L0X B;  2WXI A;  4N6E B;  1T5X D;  1N61 A;  3AEE B;  3SR6 A;  1GOZ A;  1NEN B;  1ESF A;  1F2R C;  3PO0 A;  4LTU A;  1JRP A;  5C3J B;  2WXR A;  2JXT A;  4D2K A;  2EKI A;  1V8C A;  1Q10 A;  2RDH A;  3NUH B;  3R2I A;  1GPX A;  2L32 A;  2WXP A;  1YQ3 B;  5C2T B;  1RFK A;  1KTK A;  2M19 A;  4ZHP A;  2B76 B;  1I4X A;  3ZJV A;  3IAS 1;  1KF6 B;  4KX6 B;  3ZYY X;  2WXJ A;  3AE4 B;  1C76 A;  2H89 B;  2RMM A;  3Q8C A;  3W5V B;  3IAM 1;  1D6E C;  1PGA A;  2WXO A;  1CZP A;  3ZQ4 A;  4KKJ A;  3LB8 C;  4MH8 A;  5FKA C;  2V3P A;  2I38 A;  2INN E;  1FIQ A;  4RGN A;  2J52 A;  4IDI A;  4NJC A;  3BK2 A;  2KAC A;  2DYM A;  4RGO S;  3RFZ B;  1FFU A;  2BS2 B;  1YN4 A;  3BII D;  2WXN A;  2PKO A;  3BYT B;  3AEB B;  4YSY B;  1PGB A;  5AUI A;  3P4Q B;  2YEP B;  3EGR A;  5MPO A;  5D7G A;  4KGS A;  3Q8E A;  4RF0 A;  2WXK A;  1WRI A;  2WXH A;  3E9S A;  4R3D A;  3U52 E;  2CJN A;  1XCT L;  2IDY A;  1GAQ B;  2QIL A;  5H92 C;  3BZD B;  1VLB A;  1FD6 A;  1XO3 A;  1STE A;  3EUB 2;  2N9K A;  4YTN B;  4CQN A;  4C80 A;  5BMI A;  1VR9 A;  1QQR A;  1L4D B;  4WIP A;  2JWU A;  3VRB B;  1SB3 C;  4NAW B;  1P7F A;  1XLP A;  3BVM A;  2N7J A;  4A8X C;  1PGX A;  4H2A A;  1RWS A;  5E6J A;  3TEY A;  1I4Q A;  3NVW A;  3R2T A;  2LFI A;  1TZO A;  2OED A;  1KRH A;  3ZJT A;  1QOA A;  1FXA A;  1SF0 A;  4YT0 B;  5D3I B;  1SE3 A;  1UGJ A;  3V05 A;  5G5H A;  4HRS A;  2D5G A;  5T8I A;  1C78 A;  1J7A A;  2ONQ A;  3AE5 B;  3AE1 B;  1WXQ A;  2WXF A;  4WQM A;  3AEG B;  2W82 A;  1IGC A;  2BB5 A;  3Q8F A;  1FCC C;  1WGK A;  4A6Q A;  3FC4 A;  1L0V B;  4WAF A;  2JSV X;  1FEH A;  2IJ0 A;  1ZXI A;  4N59 A;  1K50 A;  1EWY C;  1ZXH A;  2G1E A;  2AQ1 B;  4DXF A;  4ARC A;  4WH4 A;  3B9J A;  1N5X A;  1BUI C;  2GI9 A;  2WDR B;  4GDK B;  4TSS A;  3W9C B;  1FRR A;  5G5G A;  3KLS X;  2PIA A;  1B1Z A;  2WLB A;  3J9C A;  4L1B A;  5FK9 C;  1TS3 A;  2QJL A;  1XLN A;  1BXT A;  4C7Z A;  1QOF A;  3KQ4 A;  1Y56 A;  3KWL A;  3P42 A;  2IGD A;  4JE3 B;  4KKI A;  3W1S A;  3NVZ A;  1HEZ E;  2WP9 B;  1QT9 A;  2R61 A;  1TJE A;  4EE2 A;  1DOI A;  4OZA A;  1C9F A;  3SFD B;  5BMH A;  1PDX A;  2AQ2 B;  2QSD A;  1JWM D;  1IBX A;  3PZ8 A;  1ACC A;  1ZP0 B;  4ARI A;  2Q5W D;  2VZK B;  1EU4 A;  1NYR A;  1VZ8 A;  2AQ3 B;  3AB5 A;  2DWQ A;  4P6V F;  2J53 A;  4TMA B;  1CQV A;  4XDC A;  2HTM E;  1I4P A;  2BYT A;  2CJO A;  3AN1 A;  2KWD A;  2MH7 A;  3ABV B;  4MT5 A;  4XWW A;  1KH0 A;  2PTL A;  3Q69 A;  1QF6 A;  3L4P A;  1YQ4 B;  2ZW0 A;  1VRA B;  4B0E A;  4IKG A;  3AE9 B;  2LHE A;  2KMM A;  5D3D A;  3T3O A;  1NYQ A;  2DLB A;  1SBB B;  2K0P A;  3P1M A;  2WXQ A;  2L52 A;  1JW9 D;  1D5M C;  5EE0 A;  3NVV A;  1I4R A;  2VZK D;  2K9X A;  2GRI A;  5LNK 1;  1UNS A;  1E6E B;  4FXC A;  3BVG A;  1T3Q A;  1N60 A;  3WCQ A;  1OQR A;  3AE2 B;  3NZ3 A;  4ZRP A;  1AW7 A;  1DGJ A;  4ZRQ A;  2K22 A;  4P16 A;  1PFD A;  2CU3 A;  3AEA B;  2INP E;  1OFF A;  2MJ3 A;  3BYY B;  3MFG A;  1HZ5 A;  4YTM B;  4GLS C;  4AS1 A;  1E10 A;  3VQI A;  2JX5 A;  1J7B A;  2AX5 A;  2BS3 B;  1XLQ A;  1KFY B;  2J42 A;  1HZ6 A;  2LGI A;  2OHF A;  1K51 A;  1XXG A;  1L5P A;  4WUR A;  1GB1 A;  1L6V A;  3P63 A;  3P4R B;  2SEB D;  4YWG G;  2LUM A;  3C8Y A;  1HA5 A;  2L83 A;  4WWM A;  3NRZ A;  1FM0 D;  1UWX A;  3T3N A;  1E7P B;  2FE8 A;  1ROE A;  1IBX B;  4JWU C;  3BVZ A;  1FFV A;  2JZP A;  1SEB D;  2V4I B;  3VRA B;  1ZOY B;  2WU2 B;  3R8B A;  3AEC B;  1YJJ A;  4GDL B;  4OZC A;  1FXI A;  4L2Y A;  1D5X C;  2LMC A;  1FCL A;  1VJK A;  3AMZ A;  1YNT E;  1K53 A;  2M0A A;  4NAM A;  4RFB A;  1BML C;  3LXF A;  1I4G A;  1CJE A;  2NMQ A;  3ETR A;  1C4C A;  1NVI D;  2JYT A;  3TSS A;  2FBW B;  3URY A;  2WXM A;  4YSZ B;  2G9H D;  2WDQ B;  3AEF B;  1DYQ A;  4ZOH C;  3BWU D;  3GP7 A;  2QEJ C;  4RGT A;  3BK1 A;  3GB1 A;  1ZDX A;  2N0S B;  1TKG A;  1WSP A;  4REZ A;  1RM6 C;  1MHH E;  4RGM A;  3TUO A;  4OHJ A;  4RH6 A;  4A55 A;  2PVG C;  2SAK A;  3OWE B;  1N5W A;  2WS3 B;  2KN4 A;  1JWA D;  3FAH A;  1EWC A;  4A90 A;  4HRO A;  2J4X A;  2PLP A;  2Z8L A;  1TY0 A;  4JX1 C;  2WXL A;  3O13 A;  1MHX A;  3ZGZ A;  4JPS A;  1MPE A;  1TS4 A;  2X38 A;  1HQR D;  4TQ1 A;  5HFY A;  3IT6 B;  4IOI E;  2IGH A;  4JWS C;  3LYY A;  3NVY A;  2WXG A;  1C4A A;  1HXY D;  2RPV A;  1IGD A;  2W55 A;  1K52 A;  1SJH D;  2KDM A;  1ZDV A;  2ZW1 A;  4DQO C;  5I4D A;  2PMV A;  5H8Y E;  1SSN A;  2ON8 A;  4KGT A;  3U2S C;  4A9A A;  2MJD A;  3H8H A;  2EEL A;  3HUI A;  2DBY A;  4XE0 A;  2KQ4 X;  4PT5 A;  3AE7 B;  3I57 A;  2LHD A;  4RNA A;  5GXG B;  1YN5 A;  2BW2 A;  2GB1 A;  1E0Z A;  1JQ4 A;  2BT6 A;  1XF5 L;  3AM9 A;  2WDV B;  4XDD A;  4USA A;  4HKZ E;  5EE9 A;  1JRO A;  1I7H A;  1TYG B;  2QMT A;  5BMG A;  1QIL A;  1V1O A;  4N58 A;  3UI3 A;  4YSX B;  2QIE B;  1YN3 A;  3B2G A;  3EA6 A;  2TSS A;  3CWI A;  3HVD A;  3ZJU A;  2V0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...