1N5WA

Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
total genus 48
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n5wA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n5wA01
2W55A 3B9JA 2ACZB 2E3TA 2M19A 3KWLA 4HRSA 1FRRA 1QOFA 1WYGA 4JWUC 4YTNB 2HTME 2WLBA 4ITKA 4N59A 4C7ZA 1VJKA 2PVGC 4LTUA 1RM6C 4KX6B 1TKEA 3AN1A 1ZOYB 1KFYB 1N61A 3DWGC 5H8YE 1NENB 1NYRA 2MJEA 3AEDB 5H92C 3FAHA 1XO3A 1FFUA 4USAA 1WWTA 2LEKA 2JX5A 3P4QB 5AUKA 3RPFC 3AE4B 1TJEA 3AEEB 1NI3A 3B2GA 2WP9B 2WDRB 3NVVA 1ROEA 3AB5A 1PFDA 1N63A 2CU3A 2L83A 2QIEB 3P1MA 5EE9A 1RYJA 1B9RA 5G5GA 1WXQA 1T3QA 2Y5CA 3B2FA 2PIAA 1KF6B 1TKYA 5GXGB 5C2TB 1XLOA 1WRIA 1N5XA 1YQ3B 1J7CA 1AYFA 1PUTA 1L5PA 1WGKA 1QOBA 1YJJA 2WQYB 4WWMA 3AEGB 1R7SA 3EUB2 1QOGA 3AE3B 1GAQB 5EE3A 4WQMA 3AE7B 4US8A 2WDQB 1RWSA 1I7HA 5EE0A 2FBWB 2N0SB 2B76B 2Q5WD 1YJIA 4N58A 3NVYA 5AUIA 2KAJA 5EE1A 3WCQA 3AM9A 3P4PB 1FMAD 2K9XA 1XLQA 3NRZA 4YXDB 1E10A 1IUEA 2QJLA 4YTMB 1L0VB 2CJNA 3P4RB 4ZHPA 3VRAB 3SR6A 2G1EA 4C7YA 3AH7A 4JWSC 2DBYA 1NEKB 3AECB 1DOXA 2WS3B 1DOIA 1J7BA 3AE8B 1JQ4A 4ZOHC 4YSXB 3BIID 3ETRA 3SFEB 1GPXA 1QLBB 4FXCA 1SB3C 3AE6B 3PO0A 3ZYYX 1E0ZA 1JROA 2CJOA 2M56B 2OHFA 2MJDA 1FXAA 1L6UA 1FXIA 3P63A 1FFVA 2BT6A 2AX5A 1EWYC 5C3JB 1QOAA 1VLBA 3L4PA 1L6VA 1NYQA 5MPOA 4YSZB 1XLPA 1SF0A 2BS4B 3FC4A 1JWBD 1N62A 1PDXA 2H89B 4YSYB 4JX1C 1CJEA 2BS3B 3AE5B 3AEFB 3W5VB 5G5HA 1UWMA 2KMMA 1JW9D 2H88B 2DWQA 3AV8A 4P6VF 1OQRA 1TKGA 2WDVB 1FRDA 3LB8C 4C80A 1DOYA 1J7AA 3W9CB 1FIQA 3VR9B 2PVOD 1ZXIA 3VRBB 1CZPA 3NVZA 2W54A 1N60A 4US9A 1E6EB 2WU5B 1DGJA 1F0ZA 1N5WA 1V97A 2W3RA 3NS1A 1NVID 1ZP0B 2L52A 2MH7A 1TYGB 3AE9B 4YTPB 3W5UB 2W3SA 1VDVA 4IDIA 1ZUD2 1JRPA 3AE1B 1E9MA 1RFKA 3HRDD 3SFDB 3VR8B 2K5PA 2WU2B 4ZHOA 1E7PB 2BS2B 1SIJA 1AWDA 1QT9A 1OFFA 2EKIA 3AEAB 1FO4A 1JALA 1FM0D 3AE2B 3NVWA 1YQ4B 3AMZA 3LXFA 4YT0B 1JWAD 3HVZA 4HROA 2PKOA 3AEBB 3CWIA 2JQRB 1KRHA 3P4SB 2K22A 2MJ3A 1QF6A 1XLNA 3CIRB 1OQQA 4N6EB 3DWMA 1A70A 3HUIA 3ABVB 4A9AA 1V8CA
chains in the Genus database with same CATH superfamily
3OHBA 2ACZB 3NGDA 4NWIA 4HRSA 4OJPA 5HFYA 1IM4A 4RQMA 1VR9A 5IIIA 4KSKC 4BAXA 5J0PA 4TQSA 4M6WA 4URKA 1MN8A 5L1IA 1C4AA 4NLZA 1A77A 2LGDA 2AGPA 1T7PA 9ICNA 3U4EG 5J0OA 1WXMA 2ZW0A 2NTTA 1Y8RC 5KT7A 4M8MA 1R4MB 3VQIA 2KFKA 5FP0A 3NOBA 1NI3A 4QWCA 4RM9A 2HHWA 2YTUA 3S2AA 3AB5A 3M6KA 4DL2A 1L8LA 5KFLA 7ICIA 3OWEB 1SL1A 2QB0B 1KBUA 3KQ4A 3TIXA 1FXTB 3V62A 4KKIA 1C78A 2Y5BB 3V3XA 3IFWB 3M62B 2R2OA 3KHLA 3LDAA 1HUOA 1WGKA 2RR9A 2LWPA 1C79A 5AKXA 1FCLA 3EUB2 1ZPSA 1UNSA 2WYQA 4OHJA 2N0SB 5KFJA 2W8KA 1WJ4A 2Y1IA 4Q2JA 3BVZA 1ZYQA 3V7KA 1WX8A 5KFQA 5F9NA 2JSVX 3GB1A 3UGBB 1IUEA 3UM9A 5ALLA 2ZIVA 4RQ1A 2AJQA 1SKRA 7ICPA 4FZLA 3BZCA 1JWUD 2KVCA 3D32A 2FUHB 4M2YA 3FM9A 4M0WA 3EYZA 2HBLA 4FS1A 1WXVA 5CTRC 2YY6A 4AYBC 1ENFA 3W1YA 1SB3C 2JZBA 2LHDA 3APFA 2VZKD 5AM3A 3GIMA 7ICHA 2I1KA 2L0FA 3A9KA 3RN9C 3KHGA 1ISNA 4ZRQA 2FLNA 4UAZA 2MX2A 3HW8A 2LM1A 4UB5A 3EGRA 3NRWA 4DFDA 1X9WA 4M0AA 9ICAA 3U30A 2KDIA 4ACFA 3RRHA 2WXMA 4F5OA 1JI7A 3WAPA 3ZVVA 4F5QA 4R63A 2RQ5A 1NKEA 3QUCA 4KLFA 3MGHA 9ICSA 1GOZA 2WDVB 3GDXA 5KFWA 2BPSA 3W9CB 4DHJD 5E6JA 1K5OA 3KKAC 3H40A 3DEEA 1TY2A 3M1YA 2BGFA 3KZIU 4KLEA 2CN1A 2L76A 2BDUA 4HPPA 1LQBA 2ZNVC 2YMLA 2PE6B 3RNAC 3RNEC 3TQ1A 3QARA 3MGVA 5J18A 4LLGM 3ML9A 4DFJA 2VA2A 2J53A 4P16A 2G5HB 3PRPB 4KLHA 4EENA 2GBNA 2BKEA 3WK8A 3A9JB 4R66A 3LK9A 2BTEA 4CGZA 1AQ6A 3QX1A 1D5MC 2BF8B 1QF6A 4YD1A 1JXEA 3IAS1 4B0EA 3LJ3A 2FMPA 1QQRA 1FNUA 4A8XC 1KLVA 2WFAA 1STEA 3MFGA 5GTHU 4DQQA 2PVGC 2QB0A 4M8NA 1D3ZA 1RM6C 3S6JA 4I2JA 2LBOA 2A1AA 5HP4A 4LZDA 2C2RA 5KL1B 2WXNA 2MUTB 2GOWA 3PR4A 4LK0M 2C7MB 1T0RC 4NLCA 3RBDA 5GTIU 4EYHB 1E90A 3GS2A 5I4DA 4I2EA 1SZPA 2HHTA 2ZPYA 1G6JA 3DBHI 2M9NA 1K52A 2IYDB 3QJZA 3DV9A 5KFTA 4RQ0A 3PPAA 4PS7A 5KFBA 5TR5A 4MDKE 1YZ7A 1RYUA 8ICEA 3AE7B 5BYRA 3SDLC 1ZQFA 2D07B 3PW7A 2ZIXA 3PW5A 3P4PB 2K9XA 3ZRFA 4JUZA 1XWLA 1JMSA 2I5HA 4QZBA 3VRAB 2OEHA 2JGAA 1MQ2A 4F93B 3WU2U 2IY0B 2ISOA 3WIMA 1NOMA 2F77X 4IR9A 3ZO5B 4ASWC 2XY7A 2QHOA 4ANXA 4F5NA 2W11A 3J9CA 4Y2VA 2V4QA 1PQSA 2ONQA 3VH3B 2Y9UA 5EWGA 4FHKA 3SAHA 1NK4A 4BVUC 1C76A 1MA7A 3RR7A 3L4PA 5L1KA 1NYQA 3C5FA 3PSPA 4NLKA 1XLPA 2HCFA 1TS3A 1XCTL 1UCVA 5HMLA 4YSYB 1JMLA 2EZXA 4YCXA 5D7GA 2RPVA 3A1QB 3ZD9A 4ZYNA 3W5VB 2KWDA 2DNFA 1Z3EB 2KMMA 5IO9A 2BCVA 4P1BC 4QZIA 3NZUA 3LB8C 3Q3JA 5TISU 1NZPA 2Z8LA 4KGSA 1Z00A 4DCCA 5ALEA 1Y56A 4RGOS 4ECRA 3FYHA 3ZDAA 1EU3A 1NJXA 1D8YA 2H3QA 4W9LA 1SE4A 3MFHA 4CO7A 2KMCA 4W9EA 1EF5A 3H4BA 1K1SA 3RJEA 4PH5A 4R65A 1OFFA 4LDTB 2EKIA 2KTFA 1LKYA 3KWVA 4XDCA 3LXFA 4EZJA 1S3SG 1JWAD 2ASJA 2R8KA 3L08A 4BBNF 4TUQA 2J6TA 2NPTA 2RD0A 1KRHA 2W8LA 2HTHA 3DWMA 4NAMA 1COKA 4W9CA 1WWUA 4QZEA 3R8BA 1SE9A 2EMTA 5HKHA 5CHGA 4ECVA 5ALSA 3WK4A 3QXGA 5KFDA 4UW9A 2FCNA 2L1AA 2N9LA 2INNE 3MP9A 1Q3UA 4HJKA 1SWVA 5DLFA 1V86A 2PW9A 4UAUA 3P4QB 5AUKA 1L7YA 2C22A 9ICGA 3WA0A 1EF1A 5KFFA 2VJ4A 9ICJA 2DZMA 4J9KA 3EPGA 2KQ4X 2N4FA 1KQQA 5CHVC 4A3OA 9ICWA 4ECSA 2PJHA 4IC9A 5ALOA 3K9PB 1U45A 1B9RA 4F72A 1XXGA 1TBEA 4HK2A 2DFLA 2L00B 1TKYA 3HP6A 3OJSA 5CHWA 2KJ5A 2WF8A 5GXGB 4KIKA 3VVWB 2DQNB 4MH8A 4F8CB 2PTLA 3PVLA 4AJYB 3AQEA 1RWSA 3IP4B 1PVPA 5CB1A 1V9PA 1MQ3A 3ECIA 2KXJA 1S9FA 1V5OA 3FILB 4N58A 2LRUA 3PO5A 3ZNGC 4JB3A 5KFYA 1XD3B 2A19A 5KT3A 3O13A 2N7JA 1B22A 2P6RA 4M04A 4CE6A 4Y2YA 1WZ3A 4ECYA 2LI5A 2RDHA 3N30A 1F9JA 3H8SA 2AGQA 2WS3B 1KFSA 2RPQA 2UVUA 3H1UA 5AKEA 4QZDA 1V85A 2EAOA 5AK5A 3Q8LA 4DQRA 4Q8EA 5FR3A 3KHHA 4R3DA 5AKGA 1HEZE 4LNIA 1TZOA 1HE8A 2A1JB 1F2RC 4IRKA 4KLTA 2N1VA 3ZW3A 1T94A 5J2GA 3OSNA 3C2KA 3QZ8A 4A55A 3HKZC 4E3CA 1SV0C 3UQ0A 2FDRA 3H0LB 4FZMA 5DB6A 1KM7A 1GG3A 1UD7A 4RGTA 2JXJA 3CSFA 3DVNU 3N20C 2NTSA 3M8RA 2H88B 4ZDVA 4PS8A 2VKQA 2YMPA 2BCQA 4KLSA 4ZRIA 4TUPA 4DHZE 2M0AA 5KL8B 2NRZA 3E58A 1ZXIA 3VRBB 4RM8A 3KH0A 3PZ8A 4OCZA 1M6YA 4QIWF 2MP2A 3V7JA 2W3RA 3SAGA 4YTPB 2IPKD 2CHXA 4B9MA 3VUWA 2JZZA 4LDTD 1NNLA 2KZ3A 1RRBA 3DVGX 3N7RC 2HVIA 3E2EA 3HRDD 5D46A 3AE1B 4ZHOA 4O9MA 9ICTA 1LO5D 4MEYA 7ICQA 4MGZE 1ZQCA 2EZZA 2KP7A 4QZHA 2XCAA 2YQEA 2PFOA 1NBFC 2G9HD 3BYYB 3DVGY 2J4XA 4KLOA 4I2DA 3M7DA 2JEIA 3CWIA 1RAXA 1GC6A 2Z0EB 3R7RA 3ML8A 3H0RB 3Q3MC 4GXBA 1ZGUB 2N1RA 2HHXA 4CDGA 2W55A 2LXAA 3B9JA 4B9NA 4OO1J 1XO0A 2KACA 3O0FA 3QUTA 4M00A 2JY6A 1PYWD 5BO4B 4C7ZA 1WFYA 1N2XA 2DX5B 5KG4A 2EDUA 2ZXHA 4IW0A 2D3CA 1ZD2P 1NYRA 4LNNA 4I2FA 2UVRA 4BXOB 4WJ3B 1JCKB 2BQQA 2LEKA 2ZXIA 8ICNA 2MQJA 4KTQA 5LNK1 4DDID 3PLUA 8ICPA 3PGEA 4WJPA 1ROEA 2JWZA 4ED1A 2MWSB 1F5SA 5AI4A 1KEJA 5E6PA 3RJIA 3DBRI 3RAXA 1WJNA 1SXTA 3DBSA 3AQFA 1SL2A 1PUTA 4IRCA 3JW0X 1WIAA 1X2IA 2E8OA 1SKSA 4KSLC 3G6YA 1YJIA 1CK1A 4B9SA 4JWMA 3R66C 1XLQA 2BB6A 3I9V1 1E10A 5DKWA 2A1JA 1TKDA 3QHTA 5D4BA 3R9KA 1LV5A 1NEKB 1WCNA 2BWFA 1DOIA 2KVZA 1A0PA 3WAOA 2FIFA 1L0YB 4I2IA 2YB1A 3CMMB 2KK8A 1UZXB 1XU4A 2EMSA 2L0TA 2KFNA 4ELTA 4JV1A 2B0CA 1L6UA 2KSOA 4QWDA 2J42A 1FFVA 2BPGA 1TTNA 2WXJA 5MPOA 5HHDG 1S0NA 1WZ0A 1JWBD 3RNBC 1WXAA 2E8MA 2X8XX 1L5UA 4YWGG 1CJEA 3UQBA 3E9SA 5C23A 3HX0A 1P9DU 2FPKA 2HI0A 4MSQB 1BNPA 4DSEA 3GOEA 4DS4A 3RR8A 2ZIUB 1Z4OA 1UGMA 2D3AA 2BVCA 3BQTA 4MT5A 2FE9A 3IHQB 3HILA 2DENB 1Y88A 4IM2A 5DCNA 3DHGC 3HM3A 1ZP0B 3I5JC 1OUQA 2INCC 2LYHA 4S17A 3JPSA 2W3SA 1ZUD2 1P1AA 3V6KA 2D5GA 3WKBA 4ZRKA 1IPGA 4C4SA 5J2CA 5HNKA 1HXYD 3RNCC 1V1PA 2FCQA 3BQ2A 1N56A 2IA6A 2W9BB 5KG6A 4QW9A 1YN3A 2C5LC 2XGQA 4BXOA 5EWEA 4GXJA 1UA1A 5AI5A 3TKAA 5DBCA 8ICYA 1ZQUA 3GIKA 2GLEA 1WYGA 5HHHA 3KKAA 1S10A 2HHQA 2HTME 5J0TA 3QAQA 4PYZA 4W9HA 2KV2A 2KFJA 4DQIA 4YMNA 4GLSC 2KD1A 3RZWC 2D10A 1ZQAA 4F2RA 4J9LA 1CQVA 1KFYB 1ZRMA 2DPIA 1NK0A 4EBCA 4F5RA 5H92C 5KT2A 3QCAA 3RBEA 3BQ0A 2DL0A 2KQSA 3ISDA 8ICGA 4NNJB 5J2KA 2XO7A 3B0AA 2R8GA 3QE9Y 4QW8A 3OJUA 1PFDA 3WK9A 1L8OA 1C7YA 3CRXA 2AQ0A 1ZQOA 2EAMA 3F5AA 3TADC 5CHFA 3WK7A 4U6PA 2ASDA 2Y3AA 1A76A 2UWQA 1S5LU 1F0MA 2KEYA 2FCMA 3OG5A 4US8A 1XO1A 3T5LA 3RI7C 5EDSA 3MR3A 4DQOC 1VZ6A 2IZVB 1P0RA 4ED8A 2WAQC 2A5UA 3PZ7A 2QJLA 5H2FU 1WYWB 4FBTA 3O65B 2AQ2B 2KMDA 2CHZA 4L23A 3NUQA 4ECWA 4EZ9A 5IILA 1XSLA 2G08A 4W9GA 3AECB 4AP9A 1WX7A 3J81j 1WGYA 5DG8A 4ELVA 5KFGA 4FLHA 4MGIE 1JQ4A 1QLBB 3ZJVA 1TK0A 4O5KA 4WWNA 4M6WB 5J0WA 2PI5A 4PJ0U 5AI8A 3C29A 4TMAB 5IIMA 1YX5B 3DBRB 3KLSX 4KMOB 3EC8A 4DOAA 1ZQPA 3TEWA 1WGHA 2KFKB 3DQVA 2N7DA 2JMGA 4ECQA 2NBWB 2V4IB 4B6WA 2MBBB 2Y1JA 4OZCA 5C1ZA 3Q2AC 2G09A 2DAFA 1ZQTA 5IIOA 3QEBZ 2K1FA 2OJWA 2IBKA 2NRXA 2LVOA 7ICLA 3VCBA 3RH5A 1UUPA 3GIJA 3MDAA 2GBRA 4NLGA 2DHZA 5J2HA 1OQRA 1V81A 5AZGA 1WCLA 2KE7A 3TAPA 2AL6A 1KFTA 4Q44A 4RQ4A 3P42A 2W54A 4NPNA 4XZ4A 5DLGA 1F0ZA 1WMHA 2KIWA 2WXGA 8ICWA 3RAQA 2YLMA 1X9SA 9ICLA 4P0QB 5KNIA 1UELA 5JRTA 1RFKA 2L5YA 1OEYA 3MHSD 4PS3A 3ORYA 1NDDA 2ZTCA 4GFJA 2KN5A 3THVA 9ICKA 2BZFA 2KC1A 4M01A 3PR5B 2JZBB 3AMZA 1TZ1A 3VXWA 4C4VA 3A9KB 8ICXA 4NQKE 3RT3B 3P4SB 2MBHA 2IO3B 5FKAC 1IYFA 4WJNA 5KFPA 4J9QA 4IQUA 2YMQA 1ZQKA 1V8CA 2PMVA 5D2MB 5DPRA 4MFCA 1E8XA 1KJTA 3CF6E 3BS5B 1V2YA 3ONNA 7ICEA 3DCGA 4F50A 4OJLA 3I3TB 1QSYA 5KT5A 3ZJTA 2IOHA 4QWBA 2G07A 2FUG1 2DYOA 3PHWB 7ICSA 4OW0A 1SE3A 5KFRA 2JX5A 4YP3A 1SJED 4GIBA 1CEZA 2BPCA 2ZG6A 1C20A 2MHJA 3ZDEA 1RQNA 1RQLA 4GN1A 4PT5A 3B2FA 1B0XA 2NVUI 3TACB 3V72A 1ZQWA 9ICEA 4BKGA 3C1ZA 4K4GA 3QUBA 3A0HU 4HXDA 4LNOA 4BKSA 1TY0A 2HVHA 1TAQA 9ICOA 5CEHA 1UBIA 2MBEA 5J2JA 5HI1A 3U26A 2QKQA 3GV7B 2N9PC 5KFEA 2VIXA 1U9LA 4YR3A 2O6KA 1SXEA 2CJNA 2M0XA 2MBOA 2BYTA 5AK4A 2QLTA 5J2AA 2JR5A 2HHUA 1A6SA 1KOTA 1J7BA 3AE8B 1PGXA 4PHDA 1ZQYA 4KLIA 4DO9A 1YX6B 3RFZB 2J6SA 5ALUA 3I63C 1DGSA 4B9LA 5T8IA 3Q8KA 1JROA 2M56B 5AHXA 4RT3A 1OW5A 1ZQVA 1T8EA 4F8RA 1NKCA 5HG2A 4AYBF 4PHEA 4Y2XA 3H7SA 4GGQA 4F4WA 1PDXA 1DXSA 2H89B 5KFXA 4O0IA 2LHEA 3MJWA 2JZPA 2BS3B 3K4GA 1YN4A 3F2BA 3T9LA 3ZLZA 5G5HA 4CRXA 1UWMA 4P0QA 3E0FA 4DL6A 4RF0A 2LUEA 4XC2A 1NZBA 5DB7A 3MR2A 2UVVA 4YVZA 4DL4A 4DBGA 2MSNA 2EELA 3U8ZA 4A90A 1QQ5A 4II2B 3NVZA 2MU2A 2FMQA 1Z2MA 2I6XA 1U4AA 1UF0A 2RSUA 2WGSA 2ZIXB 4ICVA 2V9WA 5ALWA 4AP4C 4RQ6A 1NK9A 2KLGA 4GC7A 4XDDA 3ISCA 3HIZA 4LJXA 2CR5A 2GOLA 4HAIA 4PL1A 4E0DA 4G3IA 3BS5A 4PGXA 7ICNA 2KO3A 1WWVA 4M9LA 4GLXA 1ESFA 4X57B 4DLGA 4YT0B 2WF5A 2N9EB 4ARIA 5J0QA 3RULA 2MJ3A 3RUIB 2EKEC 4ED7A 5AM5A 4RFBA 4G11A 1MG4A 2E3TA 4XRHA 4ECZA 4DSJA 4AJWA 4WWOA 1HTQA 5KFVA 4RQ2A 5AKIA 1QILA 3HHMA 3KVFB 3M3JA 4MSMB 3PSEB 5DPSA 3QZ7A 3JPQA 2ICIA 4YMOA 3RB6A 1T4GA 1KLNA 1J2MA 3EZ5A 5JXVA 4GDKA 1L7PA 1ZD5A 1Z00B 1PK1B 1BGXT 5FK9C 3B2GA 2BHNA 4B0MA 4QWEA 2BKFA 2MBQA 3M6ZA 2KZMA 3MJ5A 2KD0A 1L3SA 2CU3A 4JE3B 2OCEA 5KFCA 2KJ6A 4GC6A 4IRDA 4TURA 1IGCA 1KF6B 2HD5B 1XLOA 3L10B 4C00A 1YQ3B 5J8YC 4DOCA 3IDWA 1C77A 5A0LA 2WQYB 3AEGB 2ZUDA 2JEJA 3QNMA 3PS6A 3MC8A 3V05A 1LKYB 3GV8B 1SV4A 4DL3A 1AN8A 3H8WA 1KTQA 4NJCA 5E6NA 2ATLA 1XF5L 1FMAD 3RFAA 2NPTB 4LJPB 4YXDB 2QB1A 3TAQA 1O08A 1Q3VA 8ICLA 4EBDA 3SR6A 3A0BU 7ICOA 2GB1A 4M47A 2Z0DB 1SGGA 1VD2A 2DYBA 3TI0A 4KZ0A 4Y2PA 1AW7A 4NAWB 2HJ8A 1D5ZC 2MAXA 2EZYA 1V80A 3ICXA 1AARA 2GMIC 1COOA 5AK6A 3AE6B 1SL0A 3ETLA 1L0XB 4K1RB 4MGKE 4F92B 2V4LA 2AYOB 2D3GA 3UXPA 2H3IA 2KFZA 5KG1A 1VLBA 3RF9A 1V49A 3Q14C 2BGWA 5CWRA 3RJJA 4J9SA 1UPHA 2ZJ5A 2E8NA 2R2QA 1CMXB 2LJIA 1WX9A 2FAZA 4EELA 3PX6A 2KJ8A 1ED1A 3Q8SB 4YXJA 2KKCA 4NM2A 4QZCA 2LZ6A 3AL0B 3CW2C 1V1OA 4KIKB 1FEHA 5J0YA 4RNMA 4CF3A 4FO6A 3K1ZA 1JWMD 1J7AA 3K1RB 2W82A 2NCNA 1IBXB 3BQ1A 2RRDA 3BK1A 3LWMA 1DGJA 1JUDA 3MHZA 3V6HA 4F5PA 4EZ6A 1M4VA 2AQ1B 2HJ1A 1PK3A 1V9JA 1K50A 3N32A 4ANUA 2KK0A 2AH5A 4AOFA 5KFNA 8ICIA 3ZUNA 2K8CB 4WH4A 2DZJA 2I2YA 1N6ZA 5BYSA 4HJGE 4ZRPA 3RB3A 3PVXA 3RD2A 4DSIA 4R64A 1FM0D 3MBYA 1KW4A 2BYVE 1X1MA 4TKNA 2ZIWB 2ESEA 1F52A 3QA8A 2K22A 5F9LA 4QZFA 1MI0A 2VANA 2KKPA 2KLCA 1PK1A 1EU4A 1J19A 4QNLA 2OOBB 4YTNB 1ZQIA 3C2LA 1GNUA 4O5EA 2WLBA 2JF5A 3SQIA 4ICUA 3MGIA 2N1WA 1Z1BA 2HDEA 3N3KB 5H8YE 3ZNID 5DDMA 2AEHA 2F8KA 4XQ8A 2ZW1A 4DQPA 4HDQA 2JH1A 4DFMA 3BY4B 2WX1A 2MLBA 2ODGA 1XCQL 3DPDA 2BCUA 4QAYA 2MP2B 5KHQA 2LI6A 3SZ2A 2KZRA 4BUGA 4B9UA 5BMIA 3HWTA 8ICZA 4KKJA 1NK5A 1EXNA 4U7CA 4NAWA 4FBJB 3BWUD 4I6LB 2Q5WD 2PPHA 3PSIA 4NM1A 3WCQA 8ICRA 3F5EA 2OXOA 5D6JB 2C2DA 4IWPA 2D6FC 1YJ1A 2W9CA 1TAUA 3R2IA 5L1MA 1I4RA 4HCNB 3AH7A 2DBYA 4F4XA 5D49A 2W7OA 3QC8B 3AULA 3HJEA 4YSXB 4KITB 1VJ5A 4EEKA 4KLUA 2R8JA 1EWCA 1WGDA 3Q8QB 2R8HA 4GB9A 4F4YA 1PUZA 1H38A 2HHSA 1SWWA 3TADA 2J7QB 1WRDB 5C3JB 2WXKA 5B5EU 3ZXVA 4DOBA 3RNGC 3GE8C 4OZAA 2NO4A 3BQ7A 4GU2A 3ZTDA 4PGYA 3MC0B 4PGQA 4A6QA 1L7MA 4UAYA 4GXKA 2K25A 2NRVA 3HKZF 2AXTU 1KFDA 2HBJA 3CNHA 4DSKA 2HE7A 2K8CA 5IA7A 3QU7A 1VCBA 1BPEA 2VRRB 4RF1A 2AQ3B 1RFAA 2GH1A 4D2KA 3SAFA 1WF9A 1YZ6A 5ALHA 1N60A 4G3XB 4EOYA 1E6EB 1PVRA 8ICOA 8ICMA 2ZIWA 3APDA 2DGZA 5J2EA 1V97A 3KUCB 3KFUF 2MH7A 1J0GA 2F3NA 3PRZA 3H7IA 3MDCA 1ZQRA 4I2HA 4I6NB 2M0NA 3BZKA 2LYBA 4PZNA 4DSLA 4UBCA 1JRPA 1Z5SB 3QUQA 3BVMA 1ZQBA 3GQCA 1X9MA 3BJYA 5K4LA 2L7RA 3CYMA 2KTRA 3UIOB 2N7EA 5KTQA 1HTOA 1I4XA 1IGDA 2KSOB 3U7ZA 1D4BA 4PHPA 2CKHB 3EFCA 4O3NA 4MH0E 1P98A 5AI6A 4NZLB 4EEYA 2QEJC 3RYTA 2CPRA 1WJ6A 4BJQA 3C28A 2WXQA 4DF8A 1T6BX 4N59A 3SMVA 3H8JA 3PZPA 5DG7A 2JYEA 5IIJA 2KJ9A 4K81A 2PLPA 2IOFA 4P0PB 2RLTA 1L6NA 3AEDB 5JH5C 4USAA 5HHIA 1DOQA 2PFPA 4RQ7A 2EAPA 5DG9A 4QZ9A 1JRUA 4YFKA 9ICFA 3JPTA 2F2AB 2JU6X 1ET6A 2M17A 2Y0SF 3FKYA 4M9HA 2YB4A 5KT6A 3PV1A 1L3UA 4OVVA 4P7IA 2J6UA 3HVDA 3LYYA 3I28A 2PIAA 3D2SA 2H3FA 1EUVB 4KVGB 4Z6FA 4ED0A 2MSED 4O3MA 9ICBA 1YJJA 2WF9A 5DGAA 4LCDE 1V1PB 2INPE 2KJHB 9ICVA 1SEBD 5AZFA 1ZQNA 1MVKA 4M9JA 1UT8A 3NRZA 5GMVA 4J9MA 2C9WB 1N48A 4PZOA 5AKYA 3QYPA 5BMGA 1T0SC 2VA8A 3QQ8B 3M9OB 1Z1VA 5CR0A 1ACCA 2V9HA 1ECWA 3PMLA 4KLJA 3C0RB 2ZNVB 4JK1A 3ZYYX 2XY6A 4CF5A 1OXJA 7ICVA 1FXAA 3OPXA 1ZRNA 5ALKA 5CP2A 3Q8RB 2BQUA 4I2GA 3TEXA 5KG5A 4UB6U 3RRGA 5TSSA 2AQ4A 7ICTA 2FPLA 3IRUA 2GWSA 4JL9A 3L54A 2MA1A 3TMPB 4DSFA 4TSSA 3X23A 1ZD4A 2KANA 2WDTB 2MEKA 4P6VF 2LKYA 2KTQA 2K89A 4KMUA 4C80A 3AUOA 2C7NB 4K3CA 1FIQA 9ICUA 5L9XA 4ZRJA 2V3PA 3A4RA 3C19A 3HPOA 4US9A 4I27A 3SHQA 4Z6EA 1BPYA 2FLPA 1HIWA 1P7FA 4KN7A 2WWZA 1TYGB 4KGTA 2FNJB 3DHIC 1QLNA 2X38A 3UF8A 4FA6A 1ZDXA 1D9FA 4DLEA 2Z7JA 4RT2A 1MSWD 3C23A 2KNJA 8ICJA 1D6EC 2KVSA 4TV3A 3TBLD 3IAM1 4MJSA 4I2CA 4DXAB 3C21A 4P0PA 3B1LX 2REXA 3IN5A 2VA3A 2ZPNA 4OJ6A 2RMMA 3UQAA 1ZQJA 2HOQA 4I2BA 4OZBA 2WX0A 4X5VA 2O6VA 8ICCA 2F76X 2WB1F 5JUMA 4LVSA 1U49A 2JUOA 2Y9TA 4EYIB 3IM1A 2IGHA 1FD6A 1RXVA 3BZDB 2CRXA 4N9F4 4YR2A 3TSSA 2F8LA 1S76D 4C0ZA 4C4RA 3SV3A 2O2VA 2ZJDA 1O03A 3JVZX 3QWZB 4DS5A 4FHJA 2P66A 2INDC 1OEYJ 3MC9A 4JQWC 4K7WA 3DHHC 2RDGA 3VDZA 1ZE3D 4Z6CA 3D2NA 2UYZB 4RPYA 4FJVB 2WXOA 1TVAA 1BT0A 1LXDA 2XVTA 2JT4B 3RTVA 2IO0B 3ZI4A 2FJ6A 3T3FA 3ZNZB 2C2EA 1E8WA 4I29A 1WMHB 4HLEA 4GSWA 5DBBA 4UB3A 2E1FA 4UAWA 4OJOA 2RDJA 1D8BA 2ZJ8A 2Y5PA 1N5XA 1J7CA 1AYFA 4ECUA 1KTKA 1R7SA 4J6IA 3AE3B 2KKVA 2KHQA 3PSFA 5ALDA 5EE3A 1GAQB 5L83A 3WKDA 5KFOA 2IMWP 2KHVA 5EE0A 4F3OA 1YQBA 5ALFA 2PMZC 4B6JA 3NVYA 1Q46A 8ICTA 4HWIB 5EE1A 5KFIA 5AUIA 4C4VB 2HBMA 4KLMA 1S1QB 1XQQA 2JEGA 2DAJA 2XK5B 2WXRA 7ICJA 8ICHA 3PV8A 2QC8A 2J0KA 1P3QU 1RLFA 4DDGD 3UMCA 4OVZA 3OSPA 2WAQF 3OHAA 4C8OA 1L4ZB 3IVFA 1ZQMA 5KG3A 2WTFA 2KWVB 1K1QA 3NZSA 3PO0A 3T3OA 1T5XD 2CJOA 1HUZA 1FXIA 3P63A 2IHNA 4BWMA 1YOVB 4XWTA 4XWWA 5J0SA 2Q0ZX 1R4NB 2BS4B 5EOZA 3KZXA 3WK5A 4GIVA 4KLGA 4RQ5A 1JWSD 2LASA 1D9DA 1MPEA 2BCRA 1ZW7A 4MGYE 4S0RA 3KYDD 5J0UA 2IDYA 1KKXA 4PHAA 4JV2A 4IOIE 3AU5A 1CUKA 4RPZA 1NJZA 2K4IA 2QCZA 2E8PA 4MF2A 4KV2A 5IN7A 3H7PA 4DL5A 3JSVB 2JVCA 1WXSA 3N7SC 7ICGA 2F44A 3VC8A 5DQIA 1XT9B 1YD8U 1F77A 4WAFA 4EZKA 4ECTA 3V60A 3W2DA 3GE3C 3VR8B 3N1YC 1ZQ1C 4UATA 2WU2B 7ICKA 3QX7A 4F2SA 2KIVA 2IBIB 2IOFK 2ALZA 4IKGA 4Y2SA 4ECXA 2ZCCA 4M9GA 3BS7A 2LJ5A 2CU1A 4IM3A 3L16A 1WY8A 3SD5A 2QARA 4BOSC 3CIRB 1OQQA 4MF8A 3U52E 2R8IA 3L0WB 3DVNV 4RUCA 4FE3A 4JWUC 3ZKJC 4WURA 1PGBA 3T5HA 1VJKA 3EHVA 4I6PA 4QZ8A 4ELUA 4KX6B 3M9MB 4FJZA 1C9FA 2OWOA 2F1JA 7ICUA 4UB2A 3FAHA 3H6NA 4NL9C 2LGIA 3A33B 4PYUA 4UASA 3C2MA 5D3IB 2MCNB 3N4MB 1DRGA 5T14A 2NRTA 2KN4A 3R2TA 2RP5A 4ED6A 2BB5A 2K8BA 3NASA 5J0RA 5AI9A 2I1JA 4BWJA 1XEEA 1NJYA 2QIEB 2XK5A 4REZA 4MM3B 2PE9A 3H4DA 1WUDA 3H9DA 1WRIA 3KYCD 4WWMA 3WALA 3D2QA 2KICA 4BKTA 3ISBA 1ZQEA 1MFWA 3M63B 3WANA 2G0AA 3I1YA 2JPHA 1QKZA 3I57A 2DF4B 3B0YA 4RNNA 2WNMA 1E8ZA 4GXIA 3L3FX 2K39A 2FMSA 1E7UA 5AIAA 4L2YA 2WF7A 4KX3A 1QTMA 2GBJA 1YIWA 4YTMB 1MJDA 4FBUA 2K4PA 1B43A 4J9NA 5BMHA 4AS1A 2G1EA 4JWSC 5AKJA 2IGDA 4NY0A 3AU2A 3RJKA 5F3XB 1GB1A 1SXDA 5DGBA 4NJ7A 2PXIA 2V4RA 4FXCA 1NI2A 1JIHA 1UQVA 2SEBD 4O3SA 1XNSA 3PT2B 4RUAA 4J9OA 2PKEA 3JPNA 4GDKB 4KGRA 1SGHA 5L1LA 4NLBA 3A4SC 2OJRA 1FNWA 4JMUA 4YXMA 3FC4A 4WJQA 3UQ2A 1L3VA 3JSVA 4BKSD 2G3QB 4O3QA 3VUYA 4UDUC 2K4HA 2XI9A 3AV8A 3Q6BA 1ZDVA 2JRZA 2B21A 3Q8CA 2LHTA 2PVOD 3N1ZC 3NZ3A 3E56A 3PHXB 2ASLA 1QQ6A 1NVID 1WSPA 3GZNI 4EKUA 2K4EA 2IJ0A 5KFZA 5CRXA 4Q8FA 1S77D 2K5PA 1UHUA 4P4PA 3SD7A 3IG3A 4HEA1 3K75D 1JN3A 4C56C 3AI5A 1JALA 2XGPA 1ZQQA 4Y2QA 1J2NA 1YQ4B 1BVSA 3Q3FA 2CXYA 1UA0A 1EO6A 2I1QA 1NK6A 1QSSA 2DZIA 3Q3NC 2L3ZA 5J2RA 1XLNA 2K8HA 2ZTDA 5IAAC 2WXLA 2IO2B 3VAWA 1P7DA 4PPXA 1D8LA 3QIJA 1QOFA 2YMMA 2H5XA 2EANA 5AZHA 2RDBC 1KLUD 4RH6A 5IIKA 3L5KA 5KT4A 4Z6DA 4DWIA 2LMRA 2Q4TA 4MM3A 2M4NA 3KHRA 4I2AA 1ET9A 3DWGC 1WR6E 1V38A 2HOIA 1B1ZA 2R18A 3OLMD 1MC8A 1RG6A 4J9PA 5AEKB 1SV0A 3AE4B 2BW2A 4J3OD 1HA5A 4NJ8A 4Y2UA 2MA9B 3G6XA 2NV3A 3TFRA 2PFNA 4UAVA 1TGZB 2L83A 1N63A 3P1MA 4LNFA 3T8MA 4F1SA 1HZ6A 2KJRA 5G5GA 1WXQA 2ZVOA 3ZNHB 4NQLB 2ZVNA 2BPFA 1ZJNA 3DBLI 1MG8A 4HVBA 3BYTB 1L2NA 1C3TA 4DL7A 5ALNA 2KHWB 3Q8BA 4IQTA 4BDPA 2F1HA 2G4DB 4HCPB 4MFFA 2AL3A 1Q5WB 2KAJA 8ICKA 4WJOA 1P7EA 3WKEA 1QQ7A 4HPLB 4GDLB 2ZUBA 3ZGZA 2JHDA 2IO1B 5ALRA 4B9TA 4W9FA 2XNAC 3D6JA 5J2BA 1SZHA 1L4DB 2Z59B 5KFMA 2XY5A 3RJGA 4P4OA 2W9NA 1KH0A 4YQWA 1GPXA 5J2DA 2IGGA 3NY5A 4CYEA 7ICRA 2CS4A 1I35A 4YR0A 2WXPA 2ASQA 5AK3A 1ZOLA 5KFHA 2DZKA 2JWUA 1CI4A 1X9XA 3B08A 3N97B 3SV4A 1GJZA 2PI4A 1NKBA 5HMMA 2N9KA 3Q8FA 1WG8A 1K8RB 1N62A 1YN5A 1HQRD 3V6JA 3AEFB 3PW2A 4QZAA 3GU3A 3R3MA 2KOXA 4KDLB 4JIOU 3GFKB 3ZJUA 8ICQA 2WXIA 1X6JA 2KDBA 4IL6U 3PNCA 4MACA 3WKCA 1VZ8A 4O3RA 4UARA 1AROP 2G06A 1L7OA 4UQGA 4AQ7A 4HKZE 2WU5B 1I4HA 2RHFA 2NYVA 1BPXA 2GO7A 2BYEA 2L52A 2W03A 2W9CB 3RB0A 2D2QA 3DOWA 3SU8X 2FE8A 3PTFC 4YMMA 3RZFA 4FJYA 3TANA 3UPQA 1E9MA 2D11A 1TE2A 3N1XC 2YX8A 2LGSA 4KX5A 1L7NA 1QSLA 1GC7A 3ALBA 2NBVB 4MEMA 5L95C 1WGGA 2KMAA 4BX9C 3HVZA 4QWAA 3KOOA 3AEVA 5DPTA 1WI0A 5KG0A 3HUIA 2JEFA 2BDPA 1OGWA 4WQOB 8ICBA 1BXTA 4RPXA 2E1EA 4EUTA 4IR1A 2D3DA 5KFUA 4E74A 4ITKA 1ZQHA 4PL2A 2ZJAA 4LTUA 2AU0A 3GZNB 3AN1A 3RH6A 4WAAA 3MFIA 5ALJA 4RMAA 1IP9A 1SJHD 3NUHB 2IHMA 5KG7A 3L17A 4XGAB 5AM2A 2GRIA 4P2HA 4MEXA 3H8MA 1S0OA 3LDZE 1TS5A 1JX4A 1KN5A 1SE2A 4GDLA 9ICIA 4XX5A 2KDMA 5IKCM 4W9KA 7ICMA 2WHEA 4JV0A 5C2TB 2DUYA 3VH4B 1TT5B 3MTNB 3RJHA 1ZXHA 1L5PA 3VHTC 3TEZA 3OJ4B 3KUZA 4FADA 4Y2JA 2AWTA 3UXNA 4ANWA 2NBUA 2KTRB 1RZTA 2W9AA 5AIBA 4W9JA 5JZEB 4RQNA 3T5KA 1TS4A 4K7UA 4IS7A 2M1MA 4DF4A 2LD9A 1WR1A 3QU9A 1H8CA 1L0VB 1LB2B 2XIDA 2C7HA 2MRLA 1K53A 4DFPA 4O3PA 3CP8A 3HM6X 4G0NB 5ALQA 2NO5A 1ZD3A 2JH7A 3UINB 2MRPA 5AKLA 4RGNA 3Q8EA 1FCCC 4Y2RA 1RYSA 2ZTEA 4TQ1A 5CX3A 3A9JA 4Q45A 5IINA 1BUIC 1MHHE 9ICPA 3SEBA 3DBLB 3N9YC 1QOAA 3PREA 1UGJA 4O5CA 2G45B 2JXTA 5ALXA 2KNBA 2NR2A 5JTIA 3GILA 4YL8A 2HHVA 3BINA 2BKRB 4QJFB 3W1SC 2V0GA 3AE5B 5AI0A 4NJ6A 5G55A 2GBKA 1NJWA 3TJPA 3V6CB 4ANVA 3OAWA 3LVWA 4DEZA 4DHZB 5J17A 1OTRB 1ZQSA 2YN4A 1LVHA 1HEKA 3RCZA 4DQSA 2MUTA 5CA7A 1Q8KA 5JU5A 3N7PD 5ALPA 1U4BA 2JZ3B 1DK2A 5KAFU 4ED2A 2B3AA 2W43A 5DBAA 1IG6A 3AE9B 1Z19A 1Q10A 1PZNA 7ICFA 4MELA 4IDIA 1VDVA 4R8UB 1FNVA 3NHEB 1E7VA 1ZJMA 5ALIA 1E8YA 3DDCB 4NXZA 1SIJA 2LGYA 3EFUA 4WWPA 2KG5A 4BBNC 4W9IA 1C4CA 4UB8U 3L13A 2BQ3A 4KN4A 2ZZPB 2FPMA 5J29A 1CRXA 2PKOA 2XN9C 1I42A 1I4PA 2JQRB 4AWJA 3Q3OC 2YEPB 4OVUA 3CSTA 4DWFA 4N6EB 5TZVA 3QU4A 1K51A 3UI3A 4A9AA 2B6GA 5EWFA 5J0XA 3QU5A 2M19A 1X6IA 2JRHA 4CQNA 3PRMB 3MR6A 3T5JA 2K6QA 3URYA 1FPYA 3SI8A 3QK0A 3ZDBA 4MHVA 3LVVA 5ALTA 1ZOYB 4EZLA 1NENB 2MJEA 4JWNA 1UH6A 1PGAA 1XO3A 2HW3A 2L05A 3RPFC 1QCKA 3ZQ4A 5AKZA 2KVRA 9ICXA 2J0MA 5ALZA 3PZDA 2ISPA 5BOLA 3TARA 1YNTE 3EA6A 2AHOB 1IV8A 3ZDTA 5EE9A 3A1QA 4DXGA 1X42A 5KAIU 4TQ0A 2Y5CA 2KX3A 4IM0A 2DKXA 2BBCA 2A4ZA 5C5JA 1WH3A 2L32A 3DBHB 2JRIB 2V3SA 1QOBA 4EEWA 4ZH4A 4AUQC 1F1HA 3EECA 2ON8A 4IQVA 4WQMA 2EQYA 8ICVA 1YMHE 2B76B 2K0PA 4MJSB 4CCHA 1L3TA 3ALRA 5D3DA 3IHPC 4RU9A 4FN2A 4I28A 1KLGD 1T0YA 2ES6A 2KWCA 4C7YA 2FIDA 4NL9A 4Y2TA 2O6VB 1SKWA 2JV3A 1DOXA 5HR7A 1D5XC 4FZNA 3NTUA 4XUSA 2LXCA 4G9BA 4BGDA 2KN7A 2O2VB 3C8YA 1NK8A 1E0ZA 4RQ3A 5AM0A 2HMXA 3AU4A 1SBBB 4NV0A 1Z4NA 1R4NI 4ACOA 2AX5A 4JGHB 2D8CA 3I76A 3KTQA 1L6VA 4JPSA 3PY8A 2KT7A 2VH2A 1UBQA 3JPPA 2VH1A 5IOIA 2W04A 2LVQA 4FS2A 4ARCA 5G2NA 5E79U 4LZGA 3G6VA 3N28A 1IIPA 4C8LA 1TFRA 4R8UA 3MR5A 4C8KA 2KZZA 2IY1B 3M95A 4M02A 4W9DA 4QIWC 3LYSA 4RCOA 2F1IA 3TEYA 3BVGA 1MHXA 8ICAA 4UB4A 2KQ7A 3FDSA 2KYWA 4KLQA 2BR0A 2DYMA 4J03A 3VR9B 5AKKA 5HR6A 4KLLA 3ZTCA 3V6EB 5JHAA 3QU2A 4F4ZA 2AGOA 3C1YA 4BOZB 1SIFA 2L8JA 5AM4A 4C4TA 4IWQA 4CNQA 4KZCA 4TUSA 5AM1A 2LM4A 1YT3A 4TUUA 3KW5B 4EBEA 3OTQA 2UVWA 2Y0SC 3ED5A 3SFDB 1RYRA 1E7PB 2BS2B 3LWLA 2WXFA 2WF6A 3ZDMC 5LXIB 2BWES 2HDOA 1WE6A 5KG2A 5BOMA 1ZQGA 4F4KA 4B9KA 4EE2A 1KSPA 5BPCA 1WGRA 3GV5B 3AE2B 3UMBA 3WKAA 4KLDA 3FILA 1FEZA 4K3BA 4HROA 1S0MA 8ICSA 3IG5A 3GIIA 5DB9A 4LJOB 4ZYSA 2XBBC 4IWOA 4A3PA 9ICMA 2ZEQA 1S0VA 1RPLA 3WAMA 1E5WA 1VRAB 2LYAA 1LGRA 1TKEA 5DQHA 3SYZA 2KDFB 1N61A 5KFSA 5ALMA 4NY8A 3HT3A 4QZGA 3PO4A 1WWTA 2DLBA 2K8AA 4IC7B 3TL5A 2N9XA 3H7PB 4ICAA 2C60A 1KRPA 2WP9B 3T3NA 1V5TA 3NVVA 1WJUA 1T0QC 2V1YA 3ZIMA 1V6EA 5DB8A 1F2RI 3RJFA 1WE7A 2ZCBA 3M8SA 5LLIA 4RNOA 3UIPB 5JHBA 1QOGA 3IBEA 1J97A 3VFKA 5J2FA 4TQRA 2JYTA 1GO3F 4OD0A 2R61A 2O6VD 3AM9A 4RZRA 4P4MA 2NRWA 3ZDCA 2LUMA 1BPZA 2FCSA 4E71A 1QH9A 2LVPA 3Q8PB 2G5IB 3IT6B 4BZAA 2QARB 4ZHPA 4IQWA 3KBBA 3ONSA 1TK8A 1LFDA 2PMZF 2P35A 5ALVA 3JYUA 1TIFA 3R7QA 5DQGA 3VTVA 2HOFA 1BMLC 1DYQA 3BIID 4IUMB 5CJ7A 5FR6A 2E5SA 1ZETA 2QSDA 5BYQA 3TUOA 3DDHA 1XS9D 5DPWA 2LFIA 2LGXA 4YG2A 3AU6A 1TV9A 9ICCA 4XYCA 2UU7A 3RNFC 3IG8A 4EFOA 1EWYC 1BPDA 2H3ZA 4F71A 5AKHA 4FULA 4FFDA 2GLSA 2K8BB 1QZEA 3OGUA 3AXCA 3U2SC 4II3B 2WB1C 1OQYA 1BPBA 2H3VA 4EX6A 2J0JA 9ICRA 5E6OA 2VJ5A 2BYFA 1SSNA 1X66A 1Q0WB 3ZRCA 5LXHA 1CZPA 2EH9A 2KWUB 4BFRA 1XSNA 1RDFA 4LNKA 5KFAA 1GB4A 3NS1A 3PMNA 3IT4B 4HKQA 3PLVA 3F2DA 5J8YA 5L1JA 2RDIA 1KL9A 2KC2A 1DOYA 1TK5A 4OJ5A 1R4MI 4MFAA 1AWDA 1QT9A 2QMTA 3JPRA 4K4HA 3OJ3A 4GMVA 3MABA 4RGMA 2OEDA 3AEAB 1IXRA 5KFKA 1FO4A 1ZQDA 1GUAB 3NVWA 3WK6A 4YN4A 2QDFA 1M94A 2G4SA 3ENEA 1ZQZA 3BK2A 4JLCA 3MC1A 4Q43A 2LMCA 2WXHA 2A3VA 3ZDDA 2NS5A 5AICA 3SENA 3RB4A 3H8HA 4P1CC 4HYKA 2PFQA 3ABVB 1XC9A 4IG7B 1UWXA 2RGFA 1VZ7A 4DFKA 3Q8AA 3KWLA 1FRRA 3X0WA 1ZQLA 2WHIA 2D3BA 2XEWA 2C28A 4HDOA 4PK1A 1J8CA 2XCPA 4A8EA 2DPJA 2GBMA 1WM3A 1X40A 1URJA 3H0MB 3U7DA 3IXSA 3Q69A 1C1YB 3F53A 2KX0A 1FFUA 4XE0A 1TJEA 3AEEB 2BCSA 2W9MA 2OM6A 1S97A 3JPOA 2K3UA 4UBBA 1ZKHA 2E6XA 2WDRB 3K9OB 2GI9A 4CF4A 5J2IA 1RYJA 4K7SA 5ALYA 1T3QA 2TSSA 3QEAZ 4C8MA 2MW5A 2ZIUA 2M8SA 2PEAA 4WIPA 3Q8MA 4XA5A 3ZD8A 4DXFA 3F2CA 2W7PA 2WDQB 8ICUA 1I7HA 4KDIC 2FBWB 3PX4A 3GP7A 4M9NA 2YVCA 4G50A 3NG0A 3PW4A 3UXOA 2FI1A 3TCAA 3KUDB 3EW9A 3P4RB 3KD3A 5C0YA 4A20A 1S8OA 2XC9A 2LRWA 2SAKA 4NLNA 1I4QA 3EPIA 9ICHA 4ZOHC 3SFEB 3ETRA 3GZFA 3T79A 1U48A 2DKZA 1KDHA 4YD2A 3M9NB 2W9BA 1DK3A 2OHFA 2MJDA 1I4GA 4L1BA 4DK5A 2K60A 2ZIVB 5ALGA 4O1NA 2BT6A 1B4FA 8ICFA 4F91B 2FLLA 2VZKB 4YSZB 4H2AA 1SF0A 1C4PA 4CHKA 2YEPF 4M0WB 1EM7A 4JX1C 4RNAA 3VTWA 1U47A 2OH2A 3PW0A 2JXXA 1RXWA 2V3NA 4UB1A 1JW9D 2OYYA 2DWQA 1JXLA 3BDPA 4B9VA 2CHWA 2QILA 3VTUA 4F7ZA 1TKGA 4HPMB 1FRDA 2I38A 1IBXA 1Q1OA 4K4IA 3RH4A 3SEIA 1HJPA 3UMGA 1BNOA 5B66U 5KHOA 1LM8B 9ICQA 3NS8A 2ZUCA 3RMKC 5IP4D 4O3OA 3EWAA 4B95A 1N5WA 3HK0A 3PSTA 1NK7A 2K6DB 2NMQA 3IV6A 2BQRA 2J52A 4DHJB 1ZQXA 3W5UB 1HZ5A 3VUXA 3C5GA 1H4RA 2XICA 3V7LA 4GOCA 4EX7A 3B0XA 5D94A 5DDYA 1F44A 1UT5A 3APCA 3NJTA 4ED3A 3P2BA 2KDEB 3V61A 1XSPA 1A5RA 2P6UA 2I9GA 1TAMA 3W1SA 1PVQA 2KOBA 1WM2A 3AEBB 1TS2A 3PX0A 2HSZA 2HBKA 4J9RA 1T3NA 3TFSA 1A70A 3ZXRA 4RQ8A 2LPEA 4C8NA
chains in the Genus database with same CATH topology
4HRSA 2ACZB 1BXTA 2QEJC 4NZLB 1WYGA 5HFYA 2HTME 2WXQA 1T6BX 4ITKA 4N59A 2JYEA 1VR9A 4LTUA 4GLSC 1C4AA 3AN1A 2PLPA 1CQVA 1KFYB 3U4EG 3AEDB 5H92C 4USAA 1SJHD 2ZW0A 2NTTA 3NUHB 3VQIA 2GRIA 1NI3A 2JU6X 1ET6A 3AB5A 1TS5A 1PFDA 3OWEB 1SE2A 3HVDA 3KQ4A 2KDMA 3LYYA 2PIAA 4KKIA 1C78A 5C2TB 3V3XA 1WGKA 1ZXHA 1L5PA 2Y3AA 3TEZA 1C79A 1YJJA 1FCLA 3EUB2 1V1PB 1ZPSA 2INPE 1UNSA 4OHJA 4US8A 2N0SB 1SEBD 4Q2JA 1TS4A 1MVKA 3BVZA 4DQOC 1VZ6A 2JSVX 3GB1A 3NRZA 3PZ7A 1IUEA 2QJLA 1L0VB 2AQ2B 4L23A 5BMGA 1JWUD 1K53A 3AECB 4M0WA 1JQ4A 1ACCA 1QLBB 3ZJVA 1ENFA 4RGNA 3Q8EA 1SB3C 1FCCC 2LHDA 2VZKD 3ZYYX 4TQ1A 1BUIC 1FXAA 1MHHE 4TMAB 4ZRQA 3KLSX 3SEBA 3EGRA 3N9YC 1QOAA 3TEWA 1UGJA 3TEXA 2JXTA 5TSSA 2V4IB 4OZCA 2WXMA 2V0GA 3AE5B 4TSSA 1UUPA 2MEKA 4P6VF 1OQRA 1GOZA 2WDVB 4C80A 3W9CB 1FIQA 5E6JA 2V3PA 3P42A 2W54A 4US9A 1TY2A 1F0ZA 1P7FA 4KGTA 3AE9B 2WXGA 1Q10A 1TYGB 2X38A 1VDVA 4IDIA 1ZDXA 1FNVA 4LLGM 1RFKA 1SIJA 2J53A 4P16A 1C4CA 1D6EC 3IAM1 3AMZA 2PKOA 2XN9C 1I4PA 2JQRB 2BTEA 3P4SB 5FKAC 2YEPB 2RMMA 1QF6A 1D5MC 4OZBA 4N6EB 4A9AA 3UI3A 1V8CA 2PMVA 3IAS1 4B0EA 2M19A 4CQNA 1QQRA 2IGHA 3URYA 1FNUA 3BZDB 4A8XC 1FD6A 1STEA 3MFGA 2PVGC 3TSSA 1RM6C 1ZOYB 3ZJTA 2FUG1 1NENB 2MJEA 2RDGA 1ZE3D 2DYOA 1PGAA 1XO3A 4OW0A 1SE3A 2JX5A 2WXOA 2WXNA 3RPFC 3ZQ4A 1SJED 4LK0M 3GS2A 5I4DA 1YNTE 3EA6A 5EE9A 4DXGA 4TQ0A 4PT5A 2Y5CA 1K52A 3B2FA 2BBCA 2L32A 1N5XA 2Y5PA 1J7CA 1AYFA 1QOBA 1KTKA 1R7SA 1TY0A 3AE3B 2ON8A 1GAQB 5EE3A 4WQMA 3AE7B 5BYRA 5EE0A 5HI1A 1YMHE 2B76B 2K0PA 3NVYA 5AUIA 5EE1A 3P4PB 5D3DA 2K9XA 2WXRA 1KLGD 2CJNA 3VRAB 4C7YA 2BYTA 1DOXA 4OVZA 1D5XC 1L4ZB 1J7BA 3AE8B 1PGXA 3J9CA 2ONQA 3RFZB 3PO0A 5T8IA 3C8YA 3T3OA 1T5XD 1E0ZA 1JROA 2CJOA 2M56B 1FXIA 1SBBB 3P63A 1C76A 2AX5A 4XWTA 5HG2A 4XWWA 3L4PA 1L6VA 1NYQA 4JPSA 1XLPA 2BS4B 1TS3A 1XCTL 1PDXA 1JWSD 2H89B 4YSYB 1JMLA 2LHEA 1MPEA 2JZPA 2BS3B 5D7GA 1YN4A 2RPVA 4ARCA 2IDYA 3W5VB 2KWDA 5G5HA 4IOIE 1UWMA 2KMMA 4RF0A 4RCOA 3LB8C 3TEYA 2Z8LA 3BVGA 1MHXA 4KGSA 2EELA 4A90A 2DYMA 3VR9B 1Y56A 4RGOS 3NVZA 1EU3A 4WAFA 1F77A 4XDDA 1SE4A 3W2DA 3SFDB 3VR8B 2WU2B 1E7PB 2BS2B 2WXFA 1OFFA 4EE2A 2EKIA 3KWVA 4XDCA 4IKGA 3AE2B 1ESFA 3LXFA 3FILA 4YT0B 1JWAD 4ARIA 4HROA 1KRHA 2MJ3A 3CIRB 1OQQA 3DWMA 4NAMA 3U52E 4ZYSA 4RFBA 3R8BA 2E3TA 4JWUC 1QILA 1PGBA 1VRAB 2L1AA 2N9LA 4WURA 2INNE 1VJKA 3MP9A 4KX6B 1TKEA 2ICIA 1C9FA 1N61A 5JXVA 2PW9A 3FAHA 3P4QB 1WWTA 2LGIA 5AUKA 5D3IB 2DLBA 2KN4A 3R2TA 2BB5A 5FK9C 3B2GA 2WP9B 4B0MA 3T3NA 2KQ4X 3NVVA 1XEEA 3MJ5A 2CU3A 2QIEB 4JE3B 1F2RI 1B9RA 1XXGA 4REZA 1KF6B 1IGCA 1TKYA 4MM3B 5GXGB 1XLOA 1WRIA 1YQ3B 1C77A 2WQYB 4WWMA 3AEGB 1QOGA 4MH8A 3V05A 2PTLA 1AN8A 1RWSA 1QKZA 3I57A 2WNMA 4N58A 2JYTA 2R61A 3FILB 4NJCA 3AM9A 1XF5L 1FMAD 2LUMA 3O13A 4YXDB 2N7JA 4L2YA 3IT6B 4YTMB 4ZHPA 4AS1A 5BMHA 3SR6A 2G1EA 4JWSC 2RDHA 2GB1A 2IGDA 2WS3B 1AW7A 1GB1A 1DYQA 1BMLC 3BIID 4NAWB 1D5ZC 2QSDA 5BYQA 4FXCA 3TUOA 5FR3A 4R3DA 3AE6B 1HEZE 1L0XB 2LFIA 2SEBD 1TZOA 4GDKB 1F2RC 4KGRA 1EWYC 1VLBA 1FNWA 4A55A 3FC4A 2LJIA 3U2SC 4RGTA 4UDUC 2NTSA 1V1OA 2H88B 3AV8A 1FEHA 1ZDVA 1JWMD 2M0AA 1J7AA 2W82A 1SSNA 3Q8CA 2PVOD 1ZXIA 3VRBB 1CZPA 3PZ8A 3NZ3A 3E56A 3BK1A 1DGJA 3MHZA 1NVID 2W3RA 3NS1A 1GB4A 1M4VA 1WSPA 2AQ1B 2IPKD 3IT4B 4YTPB 4HKQA 1K50A 2IJ0A 3AE1B 3HRDD 4ZHOA 1DOYA 2K5PA 4WH4A 1LO5D 2QMTA 1QT9A 1AWDA 4RGMA 2I2YA 1IBXB 5BYSA 4HJGE 4ZRPA 2OEDA 3AEAB 2G9HD 3BYYB 4HEA1 1FO4A 1JALA 1FM0D 4C56C 3NVWA 1YQ4B 2J4XA 3CWIA 3BK2A 2LMCA 2WXHA 2K22A 1MI0A 1XLNA 3H8HA 3ABVB 1UWXA 2WXLA 1VZ7A 1EU4A 2W55A 3Q8AA 3B9JA 2KACA 3KWLA 1FRRA 1QOFA 4YTNB 1PYWD 2WLBA 4C7ZA 1KLUD 4RH6A 2HDEA 1ET9A 3DWGC 3IXSA 5H8YE 1NYRA 3Q69A 1B1ZA 2ZW1A 1JCKB 5LNK1 1FFUA 2LEKA 4XE0A 3AE4B 1TJEA 3AEEB 2BW2A 4J3OD 1HA5A 2K3UA 2WDRB 2E6XA 1ROEA 1XCQL 2L83A 1N63A 3P1MA 2GI9A 1RYJA 5BMIA 1HZ6A 5G5GA 1WXQA 1T3QA 2TSSA 4KKJA 1SXTA 4WIPA 1PUTA 4DXFA 3BYTB 2WDQB 3BWUD 1I7HA 3Q8BA 2FBWB 2Q5WD 1YJIA 1CK1A 2KAJA 3WCQA 1P7EA 1XLQA 2BB6A 3I9V1 1E10A 4GDLB 3P4RB 3R2IA 3ZGZA 1I4RA 3AH7A 2DBYA 1NEKB 2SAKA 2XNAC 1L4DB 1DOIA 1I4QA 1L0YB 4ZOHC 1KH0A 4YSXB 3SFEB 3ETRA 1GPXA 2IGGA 1EWCA 2WXPA 2OHFA 2MJDA 1L6UA 1I4GA 2JWUA 4L1BA 4O1NA 2J42A 1FFVA 2BT6A 5C3JB 2WXKA 2WXJA 5MPOA 5HHDG 2VZKB 4YSZB 4H2AA 1SF0A 1JWBD 1C4PA 2N9KA 2YEPF 3Q8FA 4OZAA 1N62A 1YN5A 1EM7A 4JX1C 1CJEA 4YWGG 1HQRD 4RNAA 3E9SA 3MC0B 3AEFB 4A6QA 3ZJUA 2V3NA 3GP7A 1JW9D 2QILA 2DWQA 2WXIA 1TKGA 1FRDA 2I38A 4MT5A 1IBXA 4RF1A 4MACA 2AQ3B 1VZ8A 4D2KA 1N60A 4AQ7A 4HKZE 1E6EB 2WU5B 1N5WA 1V97A 1ZP0B 1I4HA 2MH7A 2L52A 2NMQA 2J52A 3W5UB 2W3SA 2FE8A 1HZ5A 1ZUD2 2D5GA 1JRPA 1E9MA 3BVMA 1HXYD 1V1PA 3W1SA 3HVZA 3AEBB 1I4XA 1TS2A 1IGDA 3U7ZA 1YN3A 1D4BA 1A70A 3HUIA 1K51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W55 A;  3B9J A;  2ACZ B;  2E3T A;  2M19 A;  3KWL A;  4HRS A;  1FRR A;  1QOF A;  1WYG A;  4JWU C;  4YTN B;  2HTM E;  2WLB A;  4ITK A;  4N59 A;  4C7Z A;  1VJK A;  2PVG C;  4LTU A;  1RM6 C;  4KX6 B;  1TKE A;  3AN1 A;  1ZOY B;  1KFY B;  1N61 A;  3DWG C;  5H8Y E;  1NEN B;  1NYR A;  2MJE A;  3AED B;  5H92 C;  3FAH A;  1XO3 A;  1FFU A;  4USA A;  1WWT A;  2LEK A;  2JX5 A;  3P4Q B;  5AUK A;  3RPF C;  3AE4 B;  1TJE A;  3AEE B;  1NI3 A;  3B2G A;  2WP9 B;  2WDR B;  3NVV A;  1ROE A;  3AB5 A;  1PFD A;  1N63 A;  2CU3 A;  2L83 A;  2QIE B;  3P1M A;  5EE9 A;  1RYJ A;  1B9R A;  5G5G A;  1WXQ A;  1T3Q A;  2Y5C A;  3B2F A;  2PIA A;  1KF6 B;  1TKY A;  5GXG B;  5C2T B;  1XLO A;  1WRI A;  1N5X A;  1YQ3 B;  1J7C A;  1AYF A;  1PUT A;  1L5P A;  1WGK A;  1QOB A;  1YJJ A;  2WQY B;  4WWM A;  3AEG B;  1R7S A;  3EUB 2;  1QOG A;  3AE3 B;  1GAQ B;  5EE3 A;  4WQM A;  3AE7 B;  4US8 A;  2WDQ B;  1RWS A;  1I7H A;  5EE0 A;  2FBW B;  2N0S B;  2B76 B;  2Q5W D;  1YJI A;  4N58 A;  3NVY A;  5AUI A;  2KAJ A;  5EE1 A;  3WCQ A;  3AM9 A;  3P4P B;  1FMA D;  2K9X A;  1XLQ A;  3NRZ A;  4YXD B;  1E10 A;  1IUE A;  2QJL A;  4YTM B;  1L0V B;  2CJN A;  3P4R B;  4ZHP A;  3VRA B;  3SR6 A;  2G1E A;  4C7Y A;  3AH7 A;  4JWS C;  2DBY A;  1NEK B;  3AEC B;  1DOX A;  2WS3 B;  1DOI A;  1J7B A;  3AE8 B;  1JQ4 A;  4ZOH C;  4YSX B;  3BII D;  3ETR A;  3SFE B;  1GPX A;  1QLB B;  4FXC A;  1SB3 C;  3AE6 B;  3PO0 A;  3ZYY X;  1E0Z A;  1JRO A;  2CJO A;  2M56 B;  2OHF A;  2MJD A;  1FXA A;  1L6U A;  1FXI A;  3P63 A;  1FFV A;  2BT6 A;  2AX5 A;  1EWY C;  5C3J B;  1QOA A;  1VLB A;  3L4P A;  1L6V A;  1NYQ A;  5MPO A;  4YSZ B;  1XLP A;  1SF0 A;  2BS4 B;  3FC4 A;  1JWB D;  1N62 A;  1PDX A;  2H89 B;  4YSY B;  4JX1 C;  1CJE A;  2BS3 B;  3AE5 B;  3AEF B;  3W5V B;  5G5H A;  1UWM A;  2KMM A;  1JW9 D;  2H88 B;  2DWQ A;  3AV8 A;  4P6V F;  1OQR A;  1TKG A;  2WDV B;  1FRD A;  3LB8 C;  4C80 A;  1DOY A;  1J7A A;  3W9C B;  1FIQ A;  3VR9 B;  2PVO D;  1ZXI A;  3VRB B;  1CZP A;  3NVZ A;  2W54 A;  1N60 A;  4US9 A;  1E6E B;  2WU5 B;  1DGJ A;  1F0Z A;  1N5W A;  1V97 A;  2W3R A;  3NS1 A;  1NVI D;  1ZP0 B;  2L52 A;  2MH7 A;  1TYG B;  3AE9 B;  4YTP B;  3W5U B;  2W3S A;  1VDV A;  4IDI A;  1ZUD 2;  1JRP A;  3AE1 B;  1E9M A;  1RFK A;  3HRD D;  3SFD B;  3VR8 B;  2K5P A;  2WU2 B;  4ZHO A;  1E7P B;  2BS2 B;  1SIJ A;  1AWD A;  1QT9 A;  1OFF A;  2EKI A;  3AEA B;  1FO4 A;  1JAL A;  1FM0 D;  3AE2 B;  3NVW A;  1YQ4 B;  3AMZ A;  3LXF A;  4YT0 B;  1JWA D;  3HVZ A;  4HRO A;  2PKO A;  3AEB B;  3CWI A;  2JQR B;  1KRH A;  3P4S B;  2K22 A;  2MJ3 A;  1QF6 A;  1XLN A;  3CIR B;  1OQQ A;  4N6E B;  3DWM A;  1A70 A;  3HUI A;  3ABV B;  4A9A A;  1V8C A; 
#chains in the Genus database with same CATH topology
 3OHB A;  2ACZ B;  3NGD A;  4NWI A;  4HRS A;  4OJP A;  5HFY A;  1IM4 A;  4RQM A;  1VR9 A;  5III A;  4KSK C;  4BAX A;  5J0P A;  4TQS A;  4M6W A;  4URK A;  1MN8 A;  5L1I A;  1C4A A;  4NLZ A;  1A77 A;  2LGD A;  2AGP A;  1T7P A;  9ICN A;  3U4E G;  5J0O A;  1WXM A;  2ZW0 A;  2NTT A;  1Y8R C;  5KT7 A;  4M8M A;  1R4M B;  3VQI A;  2KFK A;  5FP0 A;  3NOB A;  1NI3 A;  4QWC A;  4RM9 A;  2HHW A;  2YTU A;  3S2A A;  3AB5 A;  3M6K A;  4DL2 A;  1L8L A;  5KFL A;  7ICI A;  3OWE B;  1SL1 A;  2QB0 B;  1KBU A;  3KQ4 A;  3TIX A;  1FXT B;  3V62 A;  4KKI A;  1C78 A;  2Y5B B;  3V3X A;  3IFW B;  3M62 B;  2R2O A;  3KHL A;  3LDA A;  1HUO A;  1WGK A;  2RR9 A;  2LWP A;  1C79 A;  5AKX A;  1FCL A;  3EUB 2;  1ZPS A;  1UNS A;  2WYQ A;  4OHJ A;  2N0S B;  5KFJ A;  2W8K A;  1WJ4 A;  2Y1I A;  4Q2J A;  3BVZ A;  1ZYQ A;  3V7K A;  1WX8 A;  5KFQ A;  5F9N A;  2JSV X;  3GB1 A;  3UGB B;  1IUE A;  3UM9 A;  5ALL A;  2ZIV A;  4RQ1 A;  2AJQ A;  1SKR A;  7ICP A;  4FZL A;  3BZC A;  1JWU D;  2KVC A;  3D32 A;  2FUH B;  4M2Y A;  3FM9 A;  4M0W A;  3EYZ A;  2HBL A;  4FS1 A;  1WXV A;  5CTR C;  2YY6 A;  4AYB C;  1ENF A;  3W1Y A;  1SB3 C;  2JZB A;  2LHD A;  3APF A;  2VZK D;  5AM3 A;  3GIM A;  7ICH A;  2I1K A;  2L0F A;  3A9K A;  3RN9 C;  3KHG A;  1ISN A;  4ZRQ A;  2FLN A;  4UAZ A;  2MX2 A;  3HW8 A;  2LM1 A;  4UB5 A;  3EGR A;  3NRW A;  4DFD A;  1X9W A;  4M0A A;  9ICA A;  3U30 A;  2KDI A;  4ACF A;  3RRH A;  2WXM A;  4F5O A;  1JI7 A;  3WAP A;  3ZVV A;  4F5Q A;  4R63 A;  2RQ5 A;  1NKE A;  3QUC A;  4KLF A;  3MGH A;  9ICS A;  1GOZ A;  2WDV B;  3GDX A;  5KFW A;  2BPS A;  3W9C B;  4DHJ D;  5E6J A;  1K5O A;  3KKA C;  3H40 A;  3DEE A;  1TY2 A;  3M1Y A;  2BGF A;  3KZI U;  4KLE A;  2CN1 A;  2L76 A;  2BDU A;  4HPP A;  1LQB A;  2ZNV C;  2YML A;  2PE6 B;  3RNA C;  3RNE C;  3TQ1 A;  3QAR A;  3MGV A;  5J18 A;  4LLG M;  3ML9 A;  4DFJ A;  2VA2 A;  2J53 A;  4P16 A;  2G5H B;  3PRP B;  4KLH A;  4EEN A;  2GBN A;  2BKE A;  3WK8 A;  3A9J B;  4R66 A;  3LK9 A;  2BTE A;  4CGZ A;  1AQ6 A;  3QX1 A;  1D5M C;  2BF8 B;  1QF6 A;  4YD1 A;  1JXE A;  3IAS 1;  4B0E A;  3LJ3 A;  2FMP A;  1QQR A;  1FNU A;  4A8X C;  1KLV A;  2WFA A;  1STE A;  3MFG A;  5GTH U;  4DQQ A;  2PVG C;  2QB0 A;  4M8N A;  1D3Z A;  1RM6 C;  3S6J A;  4I2J A;  2LBO A;  2A1A A;  5HP4 A;  4LZD A;  2C2R A;  5KL1 B;  2WXN A;  2MUT B;  2GOW A;  3PR4 A;  4LK0 M;  2C7M B;  1T0R C;  4NLC A;  3RBD A;  5GTI U;  4EYH B;  1E90 A;  3GS2 A;  5I4D A;  4I2E A;  1SZP A;  2HHT A;  2ZPY A;  1G6J A;  3DBH I;  2M9N A;  1K52 A;  2IYD B;  3QJZ A;  3DV9 A;  5KFT A;  4RQ0 A;  3PPA A;  4PS7 A;  5KFB A;  5TR5 A;  4MDK E;  1YZ7 A;  1RYU A;  8ICE A;  3AE7 B;  5BYR A;  3SDL C;  1ZQF A;  2D07 B;  3PW7 A;  2ZIX A;  3PW5 A;  3P4P B;  2K9X A;  3ZRF A;  4JUZ A;  1XWL A;  1JMS A;  2I5H A;  4QZB A;  3VRA B;  2OEH A;  2JGA A;  1MQ2 A;  4F93 B;  3WU2 U;  2IY0 B;  2ISO A;  3WIM A;  1NOM A;  2F77 X;  4IR9 A;  3ZO5 B;  4ASW C;  2XY7 A;  2QHO A;  4ANX A;  4F5N A;  2W11 A;  3J9C A;  4Y2V A;  2V4Q A;  1PQS A;  2ONQ A;  3VH3 B;  2Y9U A;  5EWG A;  4FHK A;  3SAH A;  1NK4 A;  4BVU C;  1C76 A;  1MA7 A;  3RR7 A;  3L4P A;  5L1K A;  1NYQ A;  3C5F A;  3PSP A;  4NLK A;  1XLP A;  2HCF A;  1TS3 A;  1XCT L;  1UCV A;  5HML A;  4YSY B;  1JML A;  2EZX A;  4YCX A;  5D7G A;  2RPV A;  3A1Q B;  3ZD9 A;  4ZYN A;  3W5V B;  2KWD A;  2DNF A;  1Z3E B;  2KMM A;  5IO9 A;  2BCV A;  4P1B C;  4QZI A;  3NZU A;  3LB8 C;  3Q3J A;  5TIS U;  1NZP A;  2Z8L A;  4KGS A;  1Z00 A;  4DCC A;  5ALE A;  1Y56 A;  4RGO S;  4ECR A;  3FYH A;  3ZDA A;  1EU3 A;  1NJX A;  1D8Y A;  2H3Q A;  4W9L A;  1SE4 A;  3MFH A;  4CO7 A;  2KMC A;  4W9E A;  1EF5 A;  3H4B A;  1K1S A;  3RJE A;  4PH5 A;  4R65 A;  1OFF A;  4LDT B;  2EKI A;  2KTF A;  1LKY A;  3KWV A;  4XDC A;  3LXF A;  4EZJ A;  1S3S G;  1JWA D;  2ASJ A;  2R8K A;  3L08 A;  4BBN F;  4TUQ A;  2J6T A;  2NPT A;  2RD0 A;  1KRH A;  2W8L A;  2HTH A;  3DWM A;  4NAM A;  1COK A;  4W9C A;  1WWU A;  4QZE A;  3R8B A;  1SE9 A;  2EMT A;  5HKH A;  5CHG A;  4ECV A;  5ALS A;  3WK4 A;  3QXG A;  5KFD A;  4UW9 A;  2FCN A;  2L1A A;  2N9L A;  2INN E;  3MP9 A;  1Q3U A;  4HJK A;  1SWV A;  5DLF A;  1V86 A;  2PW9 A;  4UAU A;  3P4Q B;  5AUK A;  1L7Y A;  2C22 A;  9ICG A;  3WA0 A;  1EF1 A;  5KFF A;  2VJ4 A;  9ICJ A;  2DZM A;  4J9K A;  3EPG A;  2KQ4 X;  2N4F A;  1KQQ A;  5CHV C;  4A3O A;  9ICW A;  4ECS A;  2PJH A;  4IC9 A;  5ALO A;  3K9P B;  1U45 A;  1B9R A;  4F72 A;  1XXG A;  1TBE A;  4HK2 A;  2DFL A;  2L00 B;  1TKY A;  3HP6 A;  3OJS A;  5CHW A;  2KJ5 A;  2WF8 A;  5GXG B;  4KIK A;  3VVW B;  2DQN B;  4MH8 A;  4F8C B;  2PTL A;  3PVL A;  4AJY B;  3AQE A;  1RWS A;  3IP4 B;  1PVP A;  5CB1 A;  1V9P A;  1MQ3 A;  3ECI A;  2KXJ A;  1S9F A;  1V5O A;  3FIL B;  4N58 A;  2LRU A;  3PO5 A;  3ZNG C;  4JB3 A;  5KFY A;  1XD3 B;  2A19 A;  5KT3 A;  3O13 A;  2N7J A;  1B22 A;  2P6R A;  4M04 A;  4CE6 A;  4Y2Y A;  1WZ3 A;  4ECY A;  2LI5 A;  2RDH A;  3N30 A;  1F9J A;  3H8S A;  2AGQ A;  2WS3 B;  1KFS A;  2RPQ A;  2UVU A;  3H1U A;  5AKE A;  4QZD A;  1V85 A;  2EAO A;  5AK5 A;  3Q8L A;  4DQR A;  4Q8E A;  5FR3 A;  3KHH A;  4R3D A;  5AKG A;  1HEZ E;  4LNI A;  1TZO A;  1HE8 A;  2A1J B;  1F2R C;  4IRK A;  4KLT A;  2N1V A;  3ZW3 A;  1T94 A;  5J2G A;  3OSN A;  3C2K A;  3QZ8 A;  4A55 A;  3HKZ C;  4E3C A;  1SV0 C;  3UQ0 A;  2FDR A;  3H0L B;  4FZM A;  5DB6 A;  1KM7 A;  1GG3 A;  1UD7 A;  4RGT A;  2JXJ A;  3CSF A;  3DVN U;  3N20 C;  2NTS A;  3M8R A;  2H88 B;  4ZDV A;  4PS8 A;  2VKQ A;  2YMP A;  2BCQ A;  4KLS A;  4ZRI A;  4TUP A;  4DHZ E;  2M0A A;  5KL8 B;  2NRZ A;  3E58 A;  1ZXI A;  3VRB B;  4RM8 A;  3KH0 A;  3PZ8 A;  4OCZ A;  1M6Y A;  4QIW F;  2MP2 A;  3V7J A;  2W3R A;  3SAG A;  4YTP B;  2IPK D;  2CHX A;  4B9M A;  3VUW A;  2JZZ A;  4LDT D;  1NNL A;  2KZ3 A;  1RRB A;  3DVG X;  3N7R C;  2HVI A;  3E2E A;  3HRD D;  5D46 A;  3AE1 B;  4ZHO A;  4O9M A;  9ICT A;  1LO5 D;  4MEY A;  7ICQ A;  4MGZ E;  1ZQC A;  2EZZ A;  2KP7 A;  4QZH A;  2XCA A;  2YQE A;  2PFO A;  1NBF C;  2G9H D;  3BYY B;  3DVG Y;  2J4X A;  4KLO A;  4I2D A;  3M7D A;  2JEI A;  3CWI A;  1RAX A;  1GC6 A;  2Z0E B;  3R7R A;  3ML8 A;  3H0R B;  3Q3M C;  4GXB A;  1ZGU B;  2N1R A;  2HHX A;  4CDG A;  2W55 A;  2LXA A;  3B9J A;  4B9N A;  4OO1 J;  1XO0 A;  2KAC A;  3O0F A;  3QUT A;  4M00 A;  2JY6 A;  1PYW D;  5BO4 B;  4C7Z A;  1WFY A;  1N2X A;  2DX5 B;  5KG4 A;  2EDU A;  2ZXH A;  4IW0 A;  2D3C A;  1ZD2 P;  1NYR A;  4LNN A;  4I2F A;  2UVR A;  4BXO B;  4WJ3 B;  1JCK B;  2BQQ A;  2LEK A;  2ZXI A;  8ICN A;  2MQJ A;  4KTQ A;  5LNK 1;  4DDI D;  3PLU A;  8ICP A;  3PGE A;  4WJP A;  1ROE A;  2JWZ A;  4ED1 A;  2MWS B;  1F5S A;  5AI4 A;  1KEJ A;  5E6P A;  3RJI A;  3DBR I;  3RAX A;  1WJN A;  1SXT A;  3DBS A;  3AQF A;  1SL2 A;  1PUT A;  4IRC A;  3JW0 X;  1WIA A;  1X2I A;  2E8O A;  1SKS A;  4KSL C;  3G6Y A;  1YJI A;  1CK1 A;  4B9S A;  4JWM A;  3R66 C;  1XLQ A;  2BB6 A;  3I9V 1;  1E10 A;  5DKW A;  2A1J A;  1TKD A;  3QHT A;  5D4B A;  3R9K A;  1LV5 A;  1NEK B;  1WCN A;  2BWF A;  1DOI A;  2KVZ A;  1A0P A;  3WAO A;  2FIF A;  1L0Y B;  4I2I A;  2YB1 A;  3CMM B;  2KK8 A;  1UZX B;  1XU4 A;  2EMS A;  2L0T A;  2KFN A;  4ELT A;  4JV1 A;  2B0C A;  1L6U A;  2KSO A;  4QWD A;  2J42 A;  1FFV A;  2BPG A;  1TTN A;  2WXJ A;  5MPO A;  5HHD G;  1S0N A;  1WZ0 A;  1JWB D;  3RNB C;  1WXA A;  2E8M A;  2X8X X;  1L5U A;  4YWG G;  1CJE A;  3UQB A;  3E9S A;  5C23 A;  3HX0 A;  1P9D U;  2FPK A;  2HI0 A;  4MSQ B;  1BNP A;  4DSE A;  3GOE A;  4DS4 A;  3RR8 A;  2ZIU B;  1Z4O A;  1UGM A;  2D3A A;  2BVC A;  3BQT A;  4MT5 A;  2FE9 A;  3IHQ B;  3HIL A;  2DEN B;  1Y88 A;  4IM2 A;  5DCN A;  3DHG C;  3HM3 A;  1ZP0 B;  3I5J C;  1OUQ A;  2INC C;  2LYH A;  4S17 A;  3JPS A;  2W3S A;  1ZUD 2;  1P1A A;  3V6K A;  2D5G A;  3WKB A;  4ZRK A;  1IPG A;  4C4S A;  5J2C A;  5HNK A;  1HXY D;  3RNC C;  1V1P A;  2FCQ A;  3BQ2 A;  1N56 A;  2IA6 A;  2W9B B;  5KG6 A;  4QW9 A;  1YN3 A;  2C5L C;  2XGQ A;  4BXO A;  5EWE A;  4GXJ A;  1UA1 A;  5AI5 A;  3TKA A;  5DBC A;  8ICY A;  1ZQU A;  3GIK A;  2GLE A;  1WYG A;  5HHH A;  3KKA A;  1S10 A;  2HHQ A;  2HTM E;  5J0T A;  3QAQ A;  4PYZ A;  4W9H A;  2KV2 A;  2KFJ A;  4DQI A;  4YMN A;  4GLS C;  2KD1 A;  3RZW C;  2D10 A;  1ZQA A;  4F2R A;  4J9L A;  1CQV A;  1KFY B;  1ZRM A;  2DPI A;  1NK0 A;  4EBC A;  4F5R A;  5H92 C;  5KT2 A;  3QCA A;  3RBE A;  3BQ0 A;  2DL0 A;  2KQS A;  3ISD A;  8ICG A;  4NNJ B;  5J2K A;  2XO7 A;  3B0A A;  2R8G A;  3QE9 Y;  4QW8 A;  3OJU A;  1PFD A;  3WK9 A;  1L8O A;  1C7Y A;  3CRX A;  2AQ0 A;  1ZQO A;  2EAM A;  3F5A A;  3TAD C;  5CHF A;  3WK7 A;  4U6P A;  2ASD A;  2Y3A A;  1A76 A;  2UWQ A;  1S5L U;  1F0M A;  2KEY A;  2FCM A;  3OG5 A;  4US8 A;  1XO1 A;  3T5L A;  3RI7 C;  5EDS A;  3MR3 A;  4DQO C;  1VZ6 A;  2IZV B;  1P0R A;  4ED8 A;  2WAQ C;  2A5U A;  3PZ7 A;  2QJL A;  5H2F U;  1WYW B;  4FBT A;  3O65 B;  2AQ2 B;  2KMD A;  2CHZ A;  4L23 A;  3NUQ A;  4ECW A;  4EZ9 A;  5IIL A;  1XSL A;  2G08 A;  4W9G A;  3AEC B;  4AP9 A;  1WX7 A;  3J81 j;  1WGY A;  5DG8 A;  4ELV A;  5KFG A;  4FLH A;  4MGI E;  1JQ4 A;  1QLB B;  3ZJV A;  1TK0 A;  4O5K A;  4WWN A;  4M6W B;  5J0W A;  2PI5 A;  4PJ0 U;  5AI8 A;  3C29 A;  4TMA B;  5IIM A;  1YX5 B;  3DBR B;  3KLS X;  4KMO B;  3EC8 A;  4DOA A;  1ZQP A;  3TEW A;  1WGH A;  2KFK B;  3DQV A;  2N7D A;  2JMG A;  4ECQ A;  2NBW B;  2V4I B;  4B6W A;  2MBB B;  2Y1J A;  4OZC A;  5C1Z A;  3Q2A C;  2G09 A;  2DAF A;  1ZQT A;  5IIO A;  3QEB Z;  2K1F A;  2OJW A;  2IBK A;  2NRX A;  2LVO A;  7ICL A;  3VCB A;  3RH5 A;  1UUP A;  3GIJ A;  3MDA A;  2GBR A;  4NLG A;  2DHZ A;  5J2H A;  1OQR A;  1V81 A;  5AZG A;  1WCL A;  2KE7 A;  3TAP A;  2AL6 A;  1KFT A;  4Q44 A;  4RQ4 A;  3P42 A;  2W54 A;  4NPN A;  4XZ4 A;  5DLG A;  1F0Z A;  1WMH A;  2KIW A;  2WXG A;  8ICW A;  3RAQ A;  2YLM A;  1X9S A;  9ICL A;  4P0Q B;  5KNI A;  1UEL A;  5JRT A;  1RFK A;  2L5Y A;  1OEY A;  3MHS D;  4PS3 A;  3ORY A;  1NDD A;  2ZTC A;  4GFJ A;  2KN5 A;  3THV A;  9ICK A;  2BZF A;  2KC1 A;  4M01 A;  3PR5 B;  2JZB B;  3AMZ A;  1TZ1 A;  3VXW A;  4C4V A;  3A9K B;  8ICX A;  4NQK E;  3RT3 B;  3P4S B;  2MBH A;  2IO3 B;  5FKA C;  1IYF A;  4WJN A;  5KFP A;  4J9Q A;  4IQU A;  2YMQ A;  1ZQK A;  1V8C A;  2PMV A;  5D2M B;  5DPR A;  4MFC A;  1E8X A;  1KJT A;  3CF6 E;  3BS5 B;  1V2Y A;  3ONN A;  7ICE A;  3DCG A;  4F50 A;  4OJL A;  3I3T B;  1QSY A;  5KT5 A;  3ZJT A;  2IOH A;  4QWB A;  2G07 A;  2FUG 1;  2DYO A;  3PHW B;  7ICS A;  4OW0 A;  1SE3 A;  5KFR A;  2JX5 A;  4YP3 A;  1SJE D;  4GIB A;  1CEZ A;  2BPC A;  2ZG6 A;  1C20 A;  2MHJ A;  3ZDE A;  1RQN A;  1RQL A;  4GN1 A;  4PT5 A;  3B2F A;  1B0X A;  2NVU I;  3TAC B;  3V72 A;  1ZQW A;  9ICE A;  4BKG A;  3C1Z A;  4K4G A;  3QUB A;  3A0H U;  4HXD A;  4LNO A;  4BKS A;  1TY0 A;  2HVH A;  1TAQ A;  9ICO A;  5CEH A;  1UBI A;  2MBE A;  5J2J A;  5HI1 A;  3U26 A;  2QKQ A;  3GV7 B;  2N9P C;  5KFE A;  2VIX A;  1U9L A;  4YR3 A;  2O6K A;  1SXE A;  2CJN A;  2M0X A;  2MBO A;  2BYT A;  5AK4 A;  2QLT A;  5J2A A;  2JR5 A;  2HHU A;  1A6S A;  1KOT A;  1J7B A;  3AE8 B;  1PGX A;  4PHD A;  1ZQY A;  4KLI A;  4DO9 A;  1YX6 B;  3RFZ B;  2J6S A;  5ALU A;  3I63 C;  1DGS A;  4B9L A;  5T8I A;  3Q8K A;  1JRO A;  2M56 B;  5AHX A;  4RT3 A;  1OW5 A;  1ZQV A;  1T8E A;  4F8R A;  1NKC A;  5HG2 A;  4AYB F;  4PHE A;  4Y2X A;  3H7S A;  4GGQ A;  4F4W A;  1PDX A;  1DXS A;  2H89 B;  5KFX A;  4O0I A;  2LHE A;  3MJW A;  2JZP A;  2BS3 B;  3K4G A;  1YN4 A;  3F2B A;  3T9L A;  3ZLZ A;  5G5H A;  4CRX A;  1UWM A;  4P0Q A;  3E0F A;  4DL6 A;  4RF0 A;  2LUE A;  4XC2 A;  1NZB A;  5DB7 A;  3MR2 A;  2UVV A;  4YVZ A;  4DL4 A;  4DBG A;  2MSN A;  2EEL A;  3U8Z A;  4A90 A;  1QQ5 A;  4II2 B;  3NVZ A;  2MU2 A;  2FMQ A;  1Z2M A;  2I6X A;  1U4A A;  1UF0 A;  2RSU A;  2WGS A;  2ZIX B;  4ICV A;  2V9W A;  5ALW A;  4AP4 C;  4RQ6 A;  1NK9 A;  2KLG A;  4GC7 A;  4XDD A;  3ISC A;  3HIZ A;  4LJX A;  2CR5 A;  2GOL A;  4HAI A;  4PL1 A;  4E0D A;  4G3I A;  3BS5 A;  4PGX A;  7ICN A;  2KO3 A;  1WWV A;  4M9L A;  4GLX A;  1ESF A;  4X57 B;  4DLG A;  4YT0 B;  2WF5 A;  2N9E B;  4ARI A;  5J0Q A;  3RUL A;  2MJ3 A;  3RUI B;  2EKE C;  4ED7 A;  5AM5 A;  4RFB A;  4G11 A;  1MG4 A;  2E3T A;  4XRH A;  4ECZ A;  4DSJ A;  4AJW A;  4WWO A;  1HTQ A;  5KFV A;  4RQ2 A;  5AKI A;  1QIL A;  3HHM A;  3KVF B;  3M3J A;  4MSM B;  3PSE B;  5DPS A;  3QZ7 A;  3JPQ A;  2ICI A;  4YMO A;  3RB6 A;  1T4G A;  1KLN A;  1J2M A;  3EZ5 A;  5JXV A;  4GDK A;  1L7P A;  1ZD5 A;  1Z00 B;  1PK1 B;  1BGX T;  5FK9 C;  3B2G A;  2BHN A;  4B0M A;  4QWE A;  2BKF A;  2MBQ A;  3M6Z A;  2KZM A;  3MJ5 A;  2KD0 A;  1L3S A;  2CU3 A;  4JE3 B;  2OCE A;  5KFC A;  2KJ6 A;  4GC6 A;  4IRD A;  4TUR A;  1IGC A;  1KF6 B;  2HD5 B;  1XLO A;  3L10 B;  4C00 A;  1YQ3 B;  5J8Y C;  4DOC A;  3IDW A;  1C77 A;  5A0L A;  2WQY B;  3AEG B;  2ZUD A;  2JEJ A;  3QNM A;  3PS6 A;  3MC8 A;  3V05 A;  1LKY B;  3GV8 B;  1SV4 A;  4DL3 A;  1AN8 A;  3H8W A;  1KTQ A;  4NJC A;  5E6N A;  2ATL A;  1XF5 L;  1FMA D;  3RFA A;  2NPT B;  4LJP B;  4YXD B;  2QB1 A;  3TAQ A;  1O08 A;  1Q3V A;  8ICL A;  4EBD A;  3SR6 A;  3A0B U;  7ICO A;  2GB1 A;  4M47 A;  2Z0D B;  1SGG A;  1VD2 A;  2DYB A;  3TI0 A;  4KZ0 A;  4Y2P A;  1AW7 A;  4NAW B;  2HJ8 A;  1D5Z C;  2MAX A;  2EZY A;  1V80 A;  3ICX A;  1AAR A;  2GMI C;  1COO A;  5AK6 A;  3AE6 B;  1SL0 A;  3ETL A;  1L0X B;  4K1R B;  4MGK E;  4F92 B;  2V4L A;  2AYO B;  2D3G A;  3UXP A;  2H3I A;  2KFZ A;  5KG1 A;  1VLB A;  3RF9 A;  1V49 A;  3Q14 C;  2BGW A;  5CWR A;  3RJJ A;  4J9S A;  1UPH A;  2ZJ5 A;  2E8N A;  2R2Q A;  1CMX B;  2LJI A;  1WX9 A;  2FAZ A;  4EEL A;  3PX6 A;  2KJ8 A;  1ED1 A;  3Q8S B;  4YXJ A;  2KKC A;  4NM2 A;  4QZC A;  2LZ6 A;  3AL0 B;  3CW2 C;  1V1O A;  4KIK B;  1FEH A;  5J0Y A;  4RNM A;  4CF3 A;  4FO6 A;  3K1Z A;  1JWM D;  1J7A A;  3K1R B;  2W82 A;  2NCN A;  1IBX B;  3BQ1 A;  2RRD A;  3BK1 A;  3LWM A;  1DGJ A;  1JUD A;  3MHZ A;  3V6H A;  4F5P A;  4EZ6 A;  1M4V A;  2AQ1 B;  2HJ1 A;  1PK3 A;  1V9J A;  1K50 A;  3N32 A;  4ANU A;  2KK0 A;  2AH5 A;  4AOF A;  5KFN A;  8ICI A;  3ZUN A;  2K8C B;  4WH4 A;  2DZJ A;  2I2Y A;  1N6Z A;  5BYS A;  4HJG E;  4ZRP A;  3RB3 A;  3PVX A;  3RD2 A;  4DSI A;  4R64 A;  1FM0 D;  3MBY A;  1KW4 A;  2BYV E;  1X1M A;  4TKN A;  2ZIW B;  2ESE A;  1F52 A;  3QA8 A;  2K22 A;  5F9L A;  4QZF A;  1MI0 A;  2VAN A;  2KKP A;  2KLC A;  1PK1 A;  1EU4 A;  1J19 A;  4QNL A;  2OOB B;  4YTN B;  1ZQI A;  3C2L A;  1GNU A;  4O5E A;  2WLB A;  2JF5 A;  3SQI A;  4ICU A;  3MGI A;  2N1W A;  1Z1B A;  2HDE A;  3N3K B;  5H8Y E;  3ZNI D;  5DDM A;  2AEH A;  2F8K A;  4XQ8 A;  2ZW1 A;  4DQP A;  4HDQ A;  2JH1 A;  4DFM A;  3BY4 B;  2WX1 A;  2MLB A;  2ODG A;  1XCQ L;  3DPD A;  2BCU A;  4QAY A;  2MP2 B;  5KHQ A;  2LI6 A;  3SZ2 A;  2KZR A;  4BUG A;  4B9U A;  5BMI A;  3HWT A;  8ICZ A;  4KKJ A;  1NK5 A;  1EXN A;  4U7C A;  4NAW A;  4FBJ B;  3BWU D;  4I6L B;  2Q5W D;  2PPH A;  3PSI A;  4NM1 A;  3WCQ A;  8ICR A;  3F5E A;  2OXO A;  5D6J B;  2C2D A;  4IWP A;  2D6F C;  1YJ1 A;  2W9C A;  1TAU A;  3R2I A;  5L1M A;  1I4R A;  4HCN B;  3AH7 A;  2DBY A;  4F4X A;  5D49 A;  2W7O A;  3QC8 B;  3AUL A;  3HJE A;  4YSX B;  4KIT B;  1VJ5 A;  4EEK A;  4KLU A;  2R8J A;  1EWC A;  1WGD A;  3Q8Q B;  2R8H A;  4GB9 A;  4F4Y A;  1PUZ A;  1H38 A;  2HHS A;  1SWW A;  3TAD A;  2J7Q B;  1WRD B;  5C3J B;  2WXK A;  5B5E U;  3ZXV A;  4DOB A;  3RNG C;  3GE8 C;  4OZA A;  2NO4 A;  3BQ7 A;  4GU2 A;  3ZTD A;  4PGY A;  3MC0 B;  4PGQ A;  4A6Q A;  1L7M A;  4UAY A;  4GXK A;  2K25 A;  2NRV A;  3HKZ F;  2AXT U;  1KFD A;  2HBJ A;  3CNH A;  4DSK A;  2HE7 A;  2K8C A;  5IA7 A;  3QU7 A;  1VCB A;  1BPE A;  2VRR B;  4RF1 A;  2AQ3 B;  1RFA A;  2GH1 A;  4D2K A;  3SAF A;  1WF9 A;  1YZ6 A;  5ALH A;  1N60 A;  4G3X B;  4EOY A;  1E6E B;  1PVR A;  8ICO A;  8ICM A;  2ZIW A;  3APD A;  2DGZ A;  5J2E A;  1V97 A;  3KUC B;  3KFU F;  2MH7 A;  1J0G A;  2F3N A;  3PRZ A;  3H7I A;  3MDC A;  1ZQR A;  4I2H A;  4I6N B;  2M0N A;  3BZK A;  2LYB A;  4PZN A;  4DSL A;  4UBC A;  1JRP A;  1Z5S B;  3QUQ A;  3BVM A;  1ZQB A;  3GQC A;  1X9M A;  3BJY A;  5K4L A;  2L7R A;  3CYM A;  2KTR A;  3UIO B;  2N7E A;  5KTQ A;  1HTO A;  1I4X A;  1IGD A;  2KSO B;  3U7Z A;  1D4B A;  4PHP A;  2CKH B;  3EFC A;  4O3N A;  4MH0 E;  1P98 A;  5AI6 A;  4NZL B;  4EEY A;  2QEJ C;  3RYT A;  2CPR A;  1WJ6 A;  4BJQ A;  3C28 A;  2WXQ A;  4DF8 A;  1T6B X;  4N59 A;  3SMV A;  3H8J A;  3PZP A;  5DG7 A;  2JYE A;  5IIJ A;  2KJ9 A;  4K81 A;  2PLP A;  2IOF A;  4P0P B;  2RLT A;  1L6N A;  3AED B;  5JH5 C;  4USA A;  5HHI A;  1DOQ A;  2PFP A;  4RQ7 A;  2EAP A;  5DG9 A;  4QZ9 A;  1JRU A;  4YFK A;  9ICF A;  3JPT A;  2F2A B;  2JU6 X;  1ET6 A;  2M17 A;  2Y0S F;  3FKY A;  4M9H A;  2YB4 A;  5KT6 A;  3PV1 A;  1L3U A;  4OVV A;  4P7I A;  2J6U A;  3HVD A;  3LYY A;  3I28 A;  2PIA A;  3D2S A;  2H3F A;  1EUV B;  4KVG B;  4Z6F A;  4ED0 A;  2MSE D;  4O3M A;  9ICB A;  1YJJ A;  2WF9 A;  5DGA A;  4LCD E;  1V1P B;  2INP E;  2KJH B;  9ICV A;  1SEB D;  5AZF A;  1ZQN A;  1MVK A;  4M9J A;  1UT8 A;  3NRZ A;  5GMV A;  4J9M A;  2C9W B;  1N48 A;  4PZO A;  5AKY A;  3QYP A;  5BMG A;  1T0S C;  2VA8 A;  3QQ8 B;  3M9O B;  1Z1V A;  5CR0 A;  1ACC A;  2V9H A;  1ECW A;  3PML A;  4KLJ A;  3C0R B;  2ZNV B;  4JK1 A;  3ZYY X;  2XY6 A;  4CF5 A;  1OXJ A;  7ICV A;  1FXA A;  3OPX A;  1ZRN A;  5ALK A;  5CP2 A;  3Q8R B;  2BQU A;  4I2G A;  3TEX A;  5KG5 A;  4UB6 U;  3RRG A;  5TSS A;  2AQ4 A;  7ICT A;  2FPL A;  3IRU A;  2GWS A;  4JL9 A;  3L54 A;  2MA1 A;  3TMP B;  4DSF A;  4TSS A;  3X23 A;  1ZD4 A;  2KAN A;  2WDT B;  2MEK A;  4P6V F;  2LKY A;  2KTQ A;  2K89 A;  4KMU A;  4C80 A;  3AUO A;  2C7N B;  4K3C A;  1FIQ A;  9ICU A;  5L9X A;  4ZRJ A;  2V3P A;  3A4R A;  3C19 A;  3HPO A;  4US9 A;  4I27 A;  3SHQ A;  4Z6E A;  1BPY A;  2FLP A;  1HIW A;  1P7F A;  4KN7 A;  2WWZ A;  1TYG B;  4KGT A;  2FNJ B;  3DHI C;  1QLN A;  2X38 A;  3UF8 A;  4FA6 A;  1ZDX A;  1D9F A;  4DLE A;  2Z7J A;  4RT2 A;  1MSW D;  3C23 A;  2KNJ A;  8ICJ A;  1D6E C;  2KVS A;  4TV3 A;  3TBL D;  3IAM 1;  4MJS A;  4I2C A;  4DXA B;  3C21 A;  4P0P A;  3B1L X;  2REX A;  3IN5 A;  2VA3 A;  2ZPN A;  4OJ6 A;  2RMM A;  3UQA A;  1ZQJ A;  2HOQ A;  4I2B A;  4OZB A;  2WX0 A;  4X5V A;  2O6V A;  8ICC A;  2F76 X;  2WB1 F;  5JUM A;  4LVS A;  1U49 A;  2JUO A;  2Y9T A;  4EYI B;  3IM1 A;  2IGH A;  1FD6 A;  1RXV A;  3BZD B;  2CRX A;  4N9F 4;  4YR2 A;  3TSS A;  2F8L A;  1S76 D;  4C0Z A;  4C4R A;  3SV3 A;  2O2V A;  2ZJD A;  1O03 A;  3JVZ X;  3QWZ B;  4DS5 A;  4FHJ A;  2P66 A;  2IND C;  1OEY J;  3MC9 A;  4JQW C;  4K7W A;  3DHH C;  2RDG A;  3VDZ A;  1ZE3 D;  4Z6C A;  3D2N A;  2UYZ B;  4RPY A;  4FJV B;  2WXO A;  1TVA A;  1BT0 A;  1LXD A;  2XVT A;  2JT4 B;  3RTV A;  2IO0 B;  3ZI4 A;  2FJ6 A;  3T3F A;  3ZNZ B;  2C2E A;  1E8W A;  4I29 A;  1WMH B;  4HLE A;  4GSW A;  5DBB A;  4UB3 A;  2E1F A;  4UAW A;  4OJO A;  2RDJ A;  1D8B A;  2ZJ8 A;  2Y5P A;  1N5X A;  1J7C A;  1AYF A;  4ECU A;  1KTK A;  1R7S A;  4J6I A;  3AE3 B;  2KKV A;  2KHQ A;  3PSF A;  5ALD A;  5EE3 A;  1GAQ B;  5L83 A;  3WKD A;  5KFO A;  2IMW P;  2KHV A;  5EE0 A;  4F3O A;  1YQB A;  5ALF A;  2PMZ C;  4B6J A;  3NVY A;  1Q46 A;  8ICT A;  4HWI B;  5EE1 A;  5KFI A;  5AUI A;  4C4V B;  2HBM A;  4KLM A;  1S1Q B;  1XQQ A;  2JEG A;  2DAJ A;  2XK5 B;  2WXR A;  7ICJ A;  8ICH A;  3PV8 A;  2QC8 A;  2J0K A;  1P3Q U;  1RLF A;  4DDG D;  3UMC A;  4OVZ A;  3OSP A;  2WAQ F;  3OHA A;  4C8O A;  1L4Z B;  3IVF A;  1ZQM A;  5KG3 A;  2WTF A;  2KWV B;  1K1Q A;  3NZS A;  3PO0 A;  3T3O A;  1T5X D;  2CJO A;  1HUZ A;  1FXI A;  3P63 A;  2IHN A;  4BWM A;  1YOV B;  4XWT A;  4XWW A;  5J0S A;  2Q0Z X;  1R4N B;  2BS4 B;  5EOZ A;  3KZX A;  3WK5 A;  4GIV A;  4KLG A;  4RQ5 A;  1JWS D;  2LAS A;  1D9D A;  1MPE A;  2BCR A;  1ZW7 A;  4MGY E;  4S0R A;  3KYD D;  5J0U A;  2IDY A;  1KKX A;  4PHA A;  4JV2 A;  4IOI E;  3AU5 A;  1CUK A;  4RPZ A;  1NJZ A;  2K4I A;  2QCZ A;  2E8P A;  4MF2 A;  4KV2 A;  5IN7 A;  3H7P A;  4DL5 A;  3JSV B;  2JVC A;  1WXS A;  3N7S C;  7ICG A;  2F44 A;  3VC8 A;  5DQI A;  1XT9 B;  1YD8 U;  1F77 A;  4WAF A;  4EZK A;  4ECT A;  3V60 A;  3W2D A;  3GE3 C;  3VR8 B;  3N1Y C;  1ZQ1 C;  4UAT A;  2WU2 B;  7ICK A;  3QX7 A;  4F2S A;  2KIV A;  2IBI B;  2IOF K;  2ALZ A;  4IKG A;  4Y2S A;  4ECX A;  2ZCC A;  4M9G A;  3BS7 A;  2LJ5 A;  2CU1 A;  4IM3 A;  3L16 A;  1WY8 A;  3SD5 A;  2QAR A;  4BOS C;  3CIR B;  1OQQ A;  4MF8 A;  3U52 E;  2R8I A;  3L0W B;  3DVN V;  4RUC A;  4FE3 A;  4JWU C;  3ZKJ C;  4WUR A;  1PGB A;  3T5H A;  1VJK A;  3EHV A;  4I6P A;  4QZ8 A;  4ELU A;  4KX6 B;  3M9M B;  4FJZ A;  1C9F A;  2OWO A;  2F1J A;  7ICU A;  4UB2 A;  3FAH A;  3H6N A;  4NL9 C;  2LGI A;  3A33 B;  4PYU A;  4UAS A;  3C2M A;  5D3I B;  2MCN B;  3N4M B;  1DRG A;  5T14 A;  2NRT A;  2KN4 A;  3R2T A;  2RP5 A;  4ED6 A;  2BB5 A;  2K8B A;  3NAS A;  5J0R A;  5AI9 A;  2I1J A;  4BWJ A;  1XEE A;  1NJY A;  2QIE B;  2XK5 A;  4REZ A;  4MM3 B;  2PE9 A;  3H4D A;  1WUD A;  3H9D A;  1WRI A;  3KYC D;  4WWM A;  3WAL A;  3D2Q A;  2KIC A;  4BKT A;  3ISB A;  1ZQE A;  1MFW A;  3M63 B;  3WAN A;  2G0A A;  3I1Y A;  2JPH A;  1QKZ A;  3I57 A;  2DF4 B;  3B0Y A;  4RNN A;  2WNM A;  1E8Z A;  4GXI A;  3L3F X;  2K39 A;  2FMS A;  1E7U A;  5AIA A;  4L2Y A;  2WF7 A;  4KX3 A;  1QTM A;  2GBJ A;  1YIW A;  4YTM B;  1MJD A;  4FBU A;  2K4P A;  1B43 A;  4J9N A;  5BMH A;  4AS1 A;  2G1E A;  4JWS C;  5AKJ A;  2IGD A;  4NY0 A;  3AU2 A;  3RJK A;  5F3X B;  1GB1 A;  1SXD A;  5DGB A;  4NJ7 A;  2PXI A;  2V4R A;  4FXC A;  1NI2 A;  1JIH A;  1UQV A;  2SEB D;  4O3S A;  1XNS A;  3PT2 B;  4RUA A;  4J9O A;  2PKE A;  3JPN A;  4GDK B;  4KGR A;  1SGH A;  5L1L A;  4NLB A;  3A4S C;  2OJR A;  1FNW A;  4JMU A;  4YXM A;  3FC4 A;  4WJQ A;  3UQ2 A;  1L3V A;  3JSV A;  4BKS D;  2G3Q B;  4O3Q A;  3VUY A;  4UDU C;  2K4H A;  2XI9 A;  3AV8 A;  3Q6B A;  1ZDV A;  2JRZ A;  2B21 A;  3Q8C A;  2LHT A;  2PVO D;  3N1Z C;  3NZ3 A;  3E56 A;  3PHX B;  2ASL A;  1QQ6 A;  1NVI D;  1WSP A;  3GZN I;  4EKU A;  2K4E A;  2IJ0 A;  5KFZ A;  5CRX A;  4Q8F A;  1S77 D;  2K5P A;  1UHU A;  4P4P A;  3SD7 A;  3IG3 A;  4HEA 1;  3K75 D;  1JN3 A;  4C56 C;  3AI5 A;  1JAL A;  2XGP A;  1ZQQ A;  4Y2Q A;  1J2N A;  1YQ4 B;  1BVS A;  3Q3F A;  2CXY A;  1UA0 A;  1EO6 A;  2I1Q A;  1NK6 A;  1QSS A;  2DZI A;  3Q3N C;  2L3Z A;  5J2R A;  1XLN A;  2K8H A;  2ZTD A;  5IAA C;  2WXL A;  2IO2 B;  3VAW A;  1P7D A;  4PPX A;  1D8L A;  3QIJ A;  1QOF A;  2YMM A;  2H5X A;  2EAN A;  5AZH A;  2RDB C;  1KLU D;  4RH6 A;  5IIK A;  3L5K A;  5KT4 A;  4Z6D A;  4DWI A;  2LMR A;  2Q4T A;  4MM3 A;  2M4N A;  3KHR A;  4I2A A;  1ET9 A;  3DWG C;  1WR6 E;  1V38 A;  2HOI A;  1B1Z A;  2R18 A;  3OLM D;  1MC8 A;  1RG6 A;  4J9P A;  5AEK B;  1SV0 A;  3AE4 B;  2BW2 A;  4J3O D;  1HA5 A;  4NJ8 A;  4Y2U A;  2MA9 B;  3G6X A;  2NV3 A;  3TFR A;  2PFN A;  4UAV A;  1TGZ B;  2L83 A;  1N63 A;  3P1M A;  4LNF A;  3T8M A;  4F1S A;  1HZ6 A;  2KJR A;  5G5G A;  1WXQ A;  2ZVO A;  3ZNH B;  4NQL B;  2ZVN A;  2BPF A;  1ZJN A;  3DBL I;  1MG8 A;  4HVB A;  3BYT B;  1L2N A;  1C3T A;  4DL7 A;  5ALN A;  2KHW B;  3Q8B A;  4IQT A;  4BDP A;  2F1H A;  2G4D B;  4HCP B;  4MFF A;  2AL3 A;  1Q5W B;  2KAJ A;  8ICK A;  4WJO A;  1P7E A;  3WKE A;  1QQ7 A;  4HPL B;  4GDL B;  2ZUB A;  3ZGZ A;  2JHD A;  2IO1 B;  5ALR A;  4B9T A;  4W9F A;  2XNA C;  3D6J A;  5J2B A;  1SZH A;  1L4D B;  2Z59 B;  5KFM A;  2XY5 A;  3RJG A;  4P4O A;  2W9N A;  1KH0 A;  4YQW A;  1GPX A;  5J2D A;  2IGG A;  3NY5 A;  4CYE A;  7ICR A;  2CS4 A;  1I35 A;  4YR0 A;  2WXP A;  2ASQ A;  5AK3 A;  1ZOL A;  5KFH A;  2DZK A;  2JWU A;  1CI4 A;  1X9X A;  3B08 A;  3N97 B;  3SV4 A;  1GJZ A;  2PI4 A;  1NKB A;  5HMM A;  2N9K A;  3Q8F A;  1WG8 A;  1K8R B;  1N62 A;  1YN5 A;  1HQR D;  3V6J A;  3AEF B;  3PW2 A;  4QZA A;  3GU3 A;  3R3M A;  2KOX A;  4KDL B;  4JIO U;  3GFK B;  3ZJU A;  8ICQ A;  2WXI A;  1X6J A;  2KDB A;  4IL6 U;  3PNC A;  4MAC A;  3WKC A;  1VZ8 A;  4O3R A;  4UAR A;  1ARO P;  2G06 A;  1L7O A;  4UQG A;  4AQ7 A;  4HKZ E;  2WU5 B;  1I4H A;  2RHF A;  2NYV A;  1BPX A;  2GO7 A;  2BYE A;  2L52 A;  2W03 A;  2W9C B;  3RB0 A;  2D2Q A;  3DOW A;  3SU8 X;  2FE8 A;  3PTF C;  4YMM A;  3RZF A;  4FJY A;  3TAN A;  3UPQ A;  1E9M A;  2D11 A;  1TE2 A;  3N1X C;  2YX8 A;  2LGS A;  4KX5 A;  1L7N A;  1QSL A;  1GC7 A;  3ALB A;  2NBV B;  4MEM A;  5L95 C;  1WGG A;  2KMA A;  4BX9 C;  3HVZ A;  4QWA A;  3KOO A;  3AEV A;  5DPT A;  1WI0 A;  5KG0 A;  3HUI A;  2JEF A;  2BDP A;  1OGW A;  4WQO B;  8ICB A;  1BXT A;  4RPX A;  2E1E A;  4EUT A;  4IR1 A;  2D3D A;  5KFU A;  4E74 A;  4ITK A;  1ZQH A;  4PL2 A;  2ZJA A;  4LTU A;  2AU0 A;  3GZN B;  3AN1 A;  3RH6 A;  4WAA A;  3MFI A;  5ALJ A;  4RMA A;  1IP9 A;  1SJH D;  3NUH B;  2IHM A;  5KG7 A;  3L17 A;  4XGA B;  5AM2 A;  2GRI A;  4P2H A;  4MEX A;  3H8M A;  1S0O A;  3LDZ E;  1TS5 A;  1JX4 A;  1KN5 A;  1SE2 A;  4GDL A;  9ICI A;  4XX5 A;  2KDM A;  5IKC M;  4W9K A;  7ICM A;  2WHE A;  4JV0 A;  5C2T B;  2DUY A;  3VH4 B;  1TT5 B;  3MTN B;  3RJH A;  1ZXH A;  1L5P A;  3VHT C;  3TEZ A;  3OJ4 B;  3KUZ A;  4FAD A;  4Y2J A;  2AWT A;  3UXN A;  4ANW A;  2NBU A;  2KTR B;  1RZT A;  2W9A A;  5AIB A;  4W9J A;  5JZE B;  4RQN A;  3T5K A;  1TS4 A;  4K7U A;  4IS7 A;  2M1M A;  4DF4 A;  2LD9 A;  1WR1 A;  3QU9 A;  1H8C A;  1L0V B;  1LB2 B;  2XID A;  2C7H A;  2MRL A;  1K53 A;  4DFP A;  4O3P A;  3CP8 A;  3HM6 X;  4G0N B;  5ALQ A;  2NO5 A;  1ZD3 A;  2JH7 A;  3UIN B;  2MRP A;  5AKL A;  4RGN A;  3Q8E A;  1FCC C;  4Y2R A;  1RYS A;  2ZTE A;  4TQ1 A;  5CX3 A;  3A9J A;  4Q45 A;  5IIN A;  1BUI C;  1MHH E;  9ICP A;  3SEB A;  3DBL B;  3N9Y C;  1QOA A;  3PRE A;  1UGJ A;  4O5C A;  2G45 B;  2JXT A;  5ALX A;  2KNB A;  2NR2 A;  5JTI A;  3GIL A;  4YL8 A;  2HHV A;  3BIN A;  2BKR B;  4QJF B;  3W1S C;  2V0G A;  3AE5 B;  5AI0 A;  4NJ6 A;  5G55 A;  2GBK A;  1NJW A;  3TJP A;  3V6C B;  4ANV A;  3OAW A;  3LVW A;  4DEZ A;  4DHZ B;  5J17 A;  1OTR B;  1ZQS A;  2YN4 A;  1LVH A;  1HEK A;  3RCZ A;  4DQS A;  2MUT A;  5CA7 A;  1Q8K A;  5JU5 A;  3N7P D;  5ALP A;  1U4B A;  2JZ3 B;  1DK2 A;  5KAF U;  4ED2 A;  2B3A A;  2W43 A;  5DBA A;  1IG6 A;  3AE9 B;  1Z19 A;  1Q10 A;  1PZN A;  7ICF A;  4MEL A;  4IDI A;  1VDV A;  4R8U B;  1FNV A;  3NHE B;  1E7V A;  1ZJM A;  5ALI A;  1E8Y A;  3DDC B;  4NXZ A;  1SIJ A;  2LGY A;  3EFU A;  4WWP A;  2KG5 A;  4BBN C;  4W9I A;  1C4C A;  4UB8 U;  3L13 A;  2BQ3 A;  4KN4 A;  2ZZP B;  2FPM A;  5J29 A;  1CRX A;  2PKO A;  2XN9 C;  1I42 A;  1I4P A;  2JQR B;  4AWJ A;  3Q3O C;  2YEP B;  4OVU A;  3CST A;  4DWF A;  4N6E B;  5TZV A;  3QU4 A;  1K51 A;  3UI3 A;  4A9A A;  2B6G A;  5EWF A;  5J0X A;  3QU5 A;  2M19 A;  1X6I A;  2JRH A;  4CQN A;  3PRM B;  3MR6 A;  3T5J A;  2K6Q A;  3URY A;  1FPY A;  3SI8 A;  3QK0 A;  3ZDB A;  4MHV A;  3LVV A;  5ALT A;  1ZOY B;  4EZL A;  1NEN B;  2MJE A;  4JWN A;  1UH6 A;  1PGA A;  1XO3 A;  2HW3 A;  2L05 A;  3RPF C;  1QCK A;  3ZQ4 A;  5AKZ A;  2KVR A;  9ICX A;  2J0M A;  5ALZ A;  3PZD A;  2ISP A;  5BOL A;  3TAR A;  1YNT E;  3EA6 A;  2AHO B;  1IV8 A;  3ZDT A;  5EE9 A;  3A1Q A;  4DXG A;  1X42 A;  5KAI U;  4TQ0 A;  2Y5C A;  2KX3 A;  4IM0 A;  2DKX A;  2BBC A;  2A4Z A;  5C5J A;  1WH3 A;  2L32 A;  3DBH B;  2JRI B;  2V3S A;  1QOB A;  4EEW A;  4ZH4 A;  4AUQ C;  1F1H A;  3EEC A;  2ON8 A;  4IQV A;  4WQM A;  2EQY A;  8ICV A;  1YMH E;  2B76 B;  2K0P A;  4MJS B;  4CCH A;  1L3T A;  3ALR A;  5D3D A;  3IHP C;  4RU9 A;  4FN2 A;  4I28 A;  1KLG D;  1T0Y A;  2ES6 A;  2KWC A;  4C7Y A;  2FID A;  4NL9 A;  4Y2T A;  2O6V B;  1SKW A;  2JV3 A;  1DOX A;  5HR7 A;  1D5X C;  4FZN A;  3NTU A;  4XUS A;  2LXC A;  4G9B A;  4BGD A;  2KN7 A;  2O2V B;  3C8Y A;  1NK8 A;  1E0Z A;  4RQ3 A;  5AM0 A;  2HMX A;  3AU4 A;  1SBB B;  4NV0 A;  1Z4N A;  1R4N I;  4ACO A;  2AX5 A;  4JGH B;  2D8C A;  3I76 A;  3KTQ A;  1L6V A;  4JPS A;  3PY8 A;  2KT7 A;  2VH2 A;  1UBQ A;  3JPP A;  2VH1 A;  5IOI A;  2W04 A;  2LVQ A;  4FS2 A;  4ARC A;  5G2N A;  5E79 U;  4LZG A;  3G6V A;  3N28 A;  1IIP A;  4C8L A;  1TFR A;  4R8U A;  3MR5 A;  4C8K A;  2KZZ A;  2IY1 B;  3M95 A;  4M02 A;  4W9D A;  4QIW C;  3LYS A;  4RCO A;  2F1I A;  3TEY A;  3BVG A;  1MHX A;  8ICA A;  4UB4 A;  2KQ7 A;  3FDS A;  2KYW A;  4KLQ A;  2BR0 A;  2DYM A;  4J03 A;  3VR9 B;  5AKK A;  5HR6 A;  4KLL A;  3ZTC A;  3V6E B;  5JHA A;  3QU2 A;  4F4Z A;  2AGO A;  3C1Y A;  4BOZ B;  1SIF A;  2L8J A;  5AM4 A;  4C4T A;  4IWQ A;  4CNQ A;  4KZC A;  4TUS A;  5AM1 A;  2LM4 A;  1YT3 A;  4TUU A;  3KW5 B;  4EBE A;  3OTQ A;  2UVW A;  2Y0S C;  3ED5 A;  3SFD B;  1RYR A;  1E7P B;  2BS2 B;  3LWL A;  2WXF A;  2WF6 A;  3ZDM C;  5LXI B;  2BWE S;  2HDO A;  1WE6 A;  5KG2 A;  5BOM A;  1ZQG A;  4F4K A;  4B9K A;  4EE2 A;  1KSP A;  5BPC A;  1WGR A;  3GV5 B;  3AE2 B;  3UMB A;  3WKA A;  4KLD A;  3FIL A;  1FEZ A;  4K3B A;  4HRO A;  1S0M A;  8ICS A;  3IG5 A;  3GII A;  5DB9 A;  4LJO B;  4ZYS A;  2XBB C;  4IWO A;  4A3P A;  9ICM A;  2ZEQ A;  1S0V A;  1RPL A;  3WAM A;  1E5W A;  1VRA B;  2LYA A;  1LGR A;  1TKE A;  5DQH A;  3SYZ A;  2KDF B;  1N61 A;  5KFS A;  5ALM A;  4NY8 A;  3HT3 A;  4QZG A;  3PO4 A;  1WWT A;  2DLB A;  2K8A A;  4IC7 B;  3TL5 A;  2N9X A;  3H7P B;  4ICA A;  2C60 A;  1KRP A;  2WP9 B;  3T3N A;  1V5T A;  3NVV A;  1WJU A;  1T0Q C;  2V1Y A;  3ZIM A;  1V6E A;  5DB8 A;  1F2R I;  3RJF A;  1WE7 A;  2ZCB A;  3M8S A;  5LLI A;  4RNO A;  3UIP B;  5JHB A;  1QOG A;  3IBE A;  1J97 A;  3VFK A;  5J2F A;  4TQR A;  2JYT A;  1GO3 F;  4OD0 A;  2R61 A;  2O6V D;  3AM9 A;  4RZR A;  4P4M A;  2NRW A;  3ZDC A;  2LUM A;  1BPZ A;  2FCS A;  4E71 A;  1QH9 A;  2LVP A;  3Q8P B;  2G5I B;  3IT6 B;  4BZA A;  2QAR B;  4ZHP A;  4IQW A;  3KBB A;  3ONS A;  1TK8 A;  1LFD A;  2PMZ F;  2P35 A;  5ALV A;  3JYU A;  1TIF A;  3R7Q A;  5DQG A;  3VTV A;  2HOF A;  1BML C;  1DYQ A;  3BII D;  4IUM B;  5CJ7 A;  5FR6 A;  2E5S A;  1ZET A;  2QSD A;  5BYQ A;  3TUO A;  3DDH A;  1XS9 D;  5DPW A;  2LFI A;  2LGX A;  4YG2 A;  3AU6 A;  1TV9 A;  9ICC A;  4XYC A;  2UU7 A;  3RNF C;  3IG8 A;  4EFO A;  1EWY C;  1BPD A;  2H3Z A;  4F71 A;  5AKH A;  4FUL A;  4FFD A;  2GLS A;  2K8B B;  1QZE A;  3OGU A;  3AXC A;  3U2S C;  4II3 B;  2WB1 C;  1OQY A;  1BPB A;  2H3V A;  4EX6 A;  2J0J A;  9ICR A;  5E6O A;  2VJ5 A;  2BYF A;  1SSN A;  1X66 A;  1Q0W B;  3ZRC A;  5LXH A;  1CZP A;  2EH9 A;  2KWU B;  4BFR A;  1XSN A;  1RDF A;  4LNK A;  5KFA A;  1GB4 A;  3NS1 A;  3PMN A;  3IT4 B;  4HKQ A;  3PLV A;  3F2D A;  5J8Y A;  5L1J A;  2RDI A;  1KL9 A;  2KC2 A;  1DOY A;  1TK5 A;  4OJ5 A;  1R4M I;  4MFA A;  1AWD A;  1QT9 A;  2QMT A;  3JPR A;  4K4H A;  3OJ3 A;  4GMV A;  3MAB A;  4RGM A;  2OED A;  3AEA B;  1IXR A;  5KFK A;  1FO4 A;  1ZQD A;  1GUA B;  3NVW A;  3WK6 A;  4YN4 A;  2QDF A;  1M94 A;  2G4S A;  3ENE A;  1ZQZ A;  3BK2 A;  4JLC A;  3MC1 A;  4Q43 A;  2LMC A;  2WXH A;  2A3V A;  3ZDD A;  2NS5 A;  5AIC A;  3SEN A;  3RB4 A;  3H8H A;  4P1C C;  4HYK A;  2PFQ A;  3ABV B;  1XC9 A;  4IG7 B;  1UWX A;  2RGF A;  1VZ7 A;  4DFK A;  3Q8A A;  3KWL A;  1FRR A;  3X0W A;  1ZQL A;  2WHI A;  2D3B A;  2XEW A;  2C28 A;  4HDO A;  4PK1 A;  1J8C A;  2XCP A;  4A8E A;  2DPJ A;  2GBM A;  1WM3 A;  1X40 A;  1URJ A;  3H0M B;  3U7D A;  3IXS A;  3Q69 A;  1C1Y B;  3F53 A;  2KX0 A;  1FFU A;  4XE0 A;  1TJE A;  3AEE B;  2BCS A;  2W9M A;  2OM6 A;  1S97 A;  3JPO A;  2K3U A;  4UBB A;  1ZKH A;  2E6X A;  2WDR B;  3K9O B;  2GI9 A;  4CF4 A;  5J2I A;  1RYJ A;  4K7S A;  5ALY A;  1T3Q A;  2TSS A;  3QEA Z;  4C8M A;  2MW5 A;  2ZIU A;  2M8S A;  2PEA A;  4WIP A;  3Q8M A;  4XA5 A;  3ZD8 A;  4DXF A;  3F2C A;  2W7P A;  2WDQ B;  8ICU A;  1I7H A;  4KDI C;  2FBW B;  3PX4 A;  3GP7 A;  4M9N A;  2YVC A;  4G50 A;  3NG0 A;  3PW4 A;  3UXO A;  2FI1 A;  3TCA A;  3KUD B;  3EW9 A;  3P4R B;  3KD3 A;  5C0Y A;  4A20 A;  1S8O A;  2XC9 A;  2LRW A;  2SAK A;  4NLN A;  1I4Q A;  3EPI A;  9ICH A;  4ZOH C;  3SFE B;  3ETR A;  3GZF A;  3T79 A;  1U48 A;  2DKZ A;  1KDH A;  4YD2 A;  3M9N B;  2W9B A;  1DK3 A;  2OHF A;  2MJD A;  1I4G A;  4L1B A;  4DK5 A;  2K60 A;  2ZIV B;  5ALG A;  4O1N A;  2BT6 A;  1B4F A;  8ICF A;  4F91 B;  2FLL A;  2VZK B;  4YSZ B;  4H2A A;  1SF0 A;  1C4P A;  4CHK A;  2YEP F;  4M0W B;  1EM7 A;  4JX1 C;  4RNA A;  3VTW A;  1U47 A;  2OH2 A;  3PW0 A;  2JXX A;  1RXW A;  2V3N A;  4UB1 A;  1JW9 D;  2OYY A;  2DWQ A;  1JXL A;  3BDP A;  4B9V A;  2CHW A;  2QIL A;  3VTU A;  4F7Z A;  1TKG A;  4HPM B;  1FRD A;  2I38 A;  1IBX A;  1Q1O A;  4K4I A;  3RH4 A;  3SEI A;  1HJP A;  3UMG A;  1BNO A;  5B66 U;  5KHO A;  1LM8 B;  9ICQ A;  3NS8 A;  2ZUC A;  3RMK C;  5IP4 D;  4O3O A;  3EWA A;  4B95 A;  1N5W A;  3HK0 A;  3PST A;  1NK7 A;  2K6D B;  2NMQ A;  3IV6 A;  2BQR A;  2J52 A;  4DHJ B;  1ZQX A;  3W5U B;  1HZ5 A;  3VUX A;  3C5G A;  1H4R A;  2XIC A;  3V7L A;  4GOC A;  4EX7 A;  3B0X A;  5D94 A;  5DDY A;  1F44 A;  1UT5 A;  3APC A;  3NJT A;  4ED3 A;  3P2B A;  2KDE B;  3V61 A;  1XSP A;  1A5R A;  2P6U A;  2I9G A;  1TAM A;  3W1S A;  1PVQ A;  2KOB A;  1WM2 A;  3AEB B;  1TS2 A;  3PX0 A;  2HSZ A;  2HBK A;  4J9R A;  1T3N A;  3TFS A;  1A70 A;  3ZXR A;  4RQ8 A;  2LPE A;  4C8N A; 
#chains in the Genus database with same CATH homology
 4HRS A;  2ACZ B;  1BXT A;  2QEJ C;  4NZL B;  1WYG A;  5HFY A;  2HTM E;  2WXQ A;  1T6B X;  4ITK A;  4N59 A;  2JYE A;  1VR9 A;  4LTU A;  4GLS C;  1C4A A;  3AN1 A;  2PLP A;  1CQV A;  1KFY B;  3U4E G;  3AED B;  5H92 C;  4USA A;  1SJH D;  2ZW0 A;  2NTT A;  3NUH B;  3VQI A;  2GRI A;  1NI3 A;  2JU6 X;  1ET6 A;  3AB5 A;  1TS5 A;  1PFD A;  3OWE B;  1SE2 A;  3HVD A;  3KQ4 A;  2KDM A;  3LYY A;  2PIA A;  4KKI A;  1C78 A;  5C2T B;  3V3X A;  1WGK A;  1ZXH A;  1L5P A;  2Y3A A;  3TEZ A;  1C79 A;  1YJJ A;  1FCL A;  3EUB 2;  1V1P B;  1ZPS A;  2INP E;  1UNS A;  4OHJ A;  4US8 A;  2N0S B;  1SEB D;  4Q2J A;  1TS4 A;  1MVK A;  3BVZ A;  4DQO C;  1VZ6 A;  2JSV X;  3GB1 A;  3NRZ A;  3PZ7 A;  1IUE A;  2QJL A;  1L0V B;  2AQ2 B;  4L23 A;  5BMG A;  1JWU D;  1K53 A;  3AEC B;  4M0W A;  1JQ4 A;  1ACC A;  1QLB B;  3ZJV A;  1ENF A;  4RGN A;  3Q8E A;  1SB3 C;  1FCC C;  2LHD A;  2VZK D;  3ZYY X;  4TQ1 A;  1BUI C;  1FXA A;  1MHH E;  4TMA B;  4ZRQ A;  3KLS X;  3SEB A;  3EGR A;  3N9Y C;  1QOA A;  3TEW A;  1UGJ A;  3TEX A;  2JXT A;  5TSS A;  2V4I B;  4OZC A;  2WXM A;  2V0G A;  3AE5 B;  4TSS A;  1UUP A;  2MEK A;  4P6V F;  1OQR A;  1GOZ A;  2WDV B;  4C80 A;  3W9C B;  1FIQ A;  5E6J A;  2V3P A;  3P42 A;  2W54 A;  4US9 A;  1TY2 A;  1F0Z A;  1P7F A;  4KGT A;  3AE9 B;  2WXG A;  1Q10 A;  1TYG B;  2X38 A;  1VDV A;  4IDI A;  1ZDX A;  1FNV A;  4LLG M;  1RFK A;  1SIJ A;  2J53 A;  4P16 A;  1C4C A;  1D6E C;  3IAM 1;  3AMZ A;  2PKO A;  2XN9 C;  1I4P A;  2JQR B;  2BTE A;  3P4S B;  5FKA C;  2YEP B;  2RMM A;  1QF6 A;  1D5M C;  4OZB A;  4N6E B;  4A9A A;  3UI3 A;  1V8C A;  2PMV A;  3IAS 1;  4B0E A;  2M19 A;  4CQN A;  1QQR A;  2IGH A;  3URY A;  1FNU A;  3BZD B;  4A8X C;  1FD6 A;  1STE A;  3MFG A;  2PVG C;  3TSS A;  1RM6 C;  1ZOY B;  3ZJT A;  2FUG 1;  1NEN B;  2MJE A;  2RDG A;  1ZE3 D;  2DYO A;  1PGA A;  1XO3 A;  4OW0 A;  1SE3 A;  2JX5 A;  2WXO A;  2WXN A;  3RPF C;  3ZQ4 A;  1SJE D;  4LK0 M;  3GS2 A;  5I4D A;  1YNT E;  3EA6 A;  5EE9 A;  4DXG A;  4TQ0 A;  4PT5 A;  2Y5C A;  1K52 A;  3B2F A;  2BBC A;  2L32 A;  1N5X A;  2Y5P A;  1J7C A;  1AYF A;  1QOB A;  1KTK A;  1R7S A;  1TY0 A;  3AE3 B;  2ON8 A;  1GAQ B;  5EE3 A;  4WQM A;  3AE7 B;  5BYR A;  5EE0 A;  5HI1 A;  1YMH E;  2B76 B;  2K0P A;  3NVY A;  5AUI A;  5EE1 A;  3P4P B;  5D3D A;  2K9X A;  2WXR A;  1KLG D;  2CJN A;  3VRA B;  4C7Y A;  2BYT A;  1DOX A;  4OVZ A;  1D5X C;  1L4Z B;  1J7B A;  3AE8 B;  1PGX A;  3J9C A;  2ONQ A;  3RFZ B;  3PO0 A;  5T8I A;  3C8Y A;  3T3O A;  1T5X D;  1E0Z A;  1JRO A;  2CJO A;  2M56 B;  1FXI A;  1SBB B;  3P63 A;  1C76 A;  2AX5 A;  4XWT A;  5HG2 A;  4XWW A;  3L4P A;  1L6V A;  1NYQ A;  4JPS A;  1XLP A;  2BS4 B;  1TS3 A;  1XCT L;  1PDX A;  1JWS D;  2H89 B;  4YSY B;  1JML A;  2LHE A;  1MPE A;  2JZP A;  2BS3 B;  5D7G A;  1YN4 A;  2RPV A;  4ARC A;  2IDY A;  3W5V B;  2KWD A;  5G5H A;  4IOI E;  1UWM A;  2KMM A;  4RF0 A;  4RCO A;  3LB8 C;  3TEY A;  2Z8L A;  3BVG A;  1MHX A;  4KGS A;  2EEL A;  4A90 A;  2DYM A;  3VR9 B;  1Y56 A;  4RGO S;  3NVZ A;  1EU3 A;  4WAF A;  1F77 A;  4XDD A;  1SE4 A;  3W2D A;  3SFD B;  3VR8 B;  2WU2 B;  1E7P B;  2BS2 B;  2WXF A;  1OFF A;  4EE2 A;  2EKI A;  3KWV A;  4XDC A;  4IKG A;  3AE2 B;  1ESF A;  3LXF A;  3FIL A;  4YT0 B;  1JWA D;  4ARI A;  4HRO A;  1KRH A;  2MJ3 A;  3CIR B;  1OQQ A;  3DWM A;  4NAM A;  3U52 E;  4ZYS A;  4RFB A;  3R8B A;  2E3T A;  4JWU C;  1QIL A;  1PGB A;  1VRA B;  2L1A A;  2N9L A;  4WUR A;  2INN E;  1VJK A;  3MP9 A;  4KX6 B;  1TKE A;  2ICI A;  1C9F A;  1N61 A;  5JXV A;  2PW9 A;  3FAH A;  3P4Q B;  1WWT A;  2LGI A;  5AUK A;  5D3I B;  2DLB A;  2KN4 A;  3R2T A;  2BB5 A;  5FK9 C;  3B2G A;  2WP9 B;  4B0M A;  3T3N A;  2KQ4 X;  3NVV A;  1XEE A;  3MJ5 A;  2CU3 A;  2QIE B;  4JE3 B;  1F2R I;  1B9R A;  1XXG A;  4REZ A;  1KF6 B;  1IGC A;  1TKY A;  4MM3 B;  5GXG B;  1XLO A;  1WRI A;  1YQ3 B;  1C77 A;  2WQY B;  4WWM A;  3AEG B;  1QOG A;  4MH8 A;  3V05 A;  2PTL A;  1AN8 A;  1RWS A;  1QKZ A;  3I57 A;  2WNM A;  4N58 A;  2JYT A;  2R61 A;  3FIL B;  4NJC A;  3AM9 A;  1XF5 L;  1FMA D;  2LUM A;  3O13 A;  4YXD B;  2N7J A;  4L2Y A;  3IT6 B;  4YTM B;  4ZHP A;  4AS1 A;  5BMH A;  3SR6 A;  2G1E A;  4JWS C;  2RDH A;  2GB1 A;  2IGD A;  2WS3 B;  1AW7 A;  1GB1 A;  1DYQ A;  1BML C;  3BII D;  4NAW B;  1D5Z C;  2QSD A;  5BYQ A;  4FXC A;  3TUO A;  5FR3 A;  4R3D A;  3AE6 B;  1HEZ E;  1L0X B;  2LFI A;  2SEB D;  1TZO A;  4GDK B;  1F2R C;  4KGR A;  1EWY C;  1VLB A;  1FNW A;  4A55 A;  3FC4 A;  2LJI A;  3U2S C;  4RGT A;  4UDU C;  2NTS A;  1V1O A;  2H88 B;  3AV8 A;  1FEH A;  1ZDV A;  1JWM D;  2M0A A;  1J7A A;  2W82 A;  1SSN A;  3Q8C A;  2PVO D;  1ZXI A;  3VRB B;  1CZP A;  3PZ8 A;  3NZ3 A;  3E56 A;  3BK1 A;  1DGJ A;  3MHZ A;  1NVI D;  2W3R A;  3NS1 A;  1GB4 A;  1M4V A;  1WSP A;  2AQ1 B;  2IPK D;  3IT4 B;  4YTP B;  4HKQ A;  1K50 A;  2IJ0 A;  3AE1 B;  3HRD D;  4ZHO A;  1DOY A;  2K5P A;  4WH4 A;  1LO5 D;  2QMT A;  1QT9 A;  1AWD A;  4RGM A;  2I2Y A;  1IBX B;  5BYS A;  4HJG E;  4ZRP A;  2OED A;  3AEA B;  2G9H D;  3BYY B;  4HEA 1;  1FO4 A;  1JAL A;  1FM0 D;  4C56 C;  3NVW A;  1YQ4 B;  2J4X A;  3CWI A;  3BK2 A;  2LMC A;  2WXH A;  2K22 A;  1MI0 A;  1XLN A;  3H8H A;  3ABV B;  1UWX A;  2WXL A;  1VZ7 A;  1EU4 A;  2W55 A;  3Q8A A;  3B9J A;  2KAC A;  3KWL A;  1FRR A;  1QOF A;  4YTN B;  1PYW D;  2WLB A;  4C7Z A;  1KLU D;  4RH6 A;  2HDE A;  1ET9 A;  3DWG C;  3IXS A;  5H8Y E;  1NYR A;  3Q69 A;  1B1Z A;  2ZW1 A;  1JCK B;  5LNK 1;  1FFU A;  2LEK A;  4XE0 A;  3AE4 B;  1TJE A;  3AEE B;  2BW2 A;  4J3O D;  1HA5 A;  2K3U A;  2WDR B;  2E6X A;  1ROE A;  1XCQ L;  2L83 A;  1N63 A;  3P1M A;  2GI9 A;  1RYJ A;  5BMI A;  1HZ6 A;  5G5G A;  1WXQ A;  1T3Q A;  2TSS A;  4KKJ A;  1SXT A;  4WIP A;  1PUT A;  4DXF A;  3BYT B;  2WDQ B;  3BWU D;  1I7H A;  3Q8B A;  2FBW B;  2Q5W D;  1YJI A;  1CK1 A;  2KAJ A;  3WCQ A;  1P7E A;  1XLQ A;  2BB6 A;  3I9V 1;  1E10 A;  4GDL B;  3P4R B;  3R2I A;  3ZGZ A;  1I4R A;  3AH7 A;  2DBY A;  1NEK B;  2SAK A;  2XNA C;  1L4D B;  1DOI A;  1I4Q A;  1L0Y B;  4ZOH C;  1KH0 A;  4YSX B;  3SFE B;  3ETR A;  1GPX A;  2IGG A;  1EWC A;  2WXP A;  2OHF A;  2MJD A;  1L6U A;  1I4G A;  2JWU A;  4L1B A;  4O1N A;  2J42 A;  1FFV A;  2BT6 A;  5C3J B;  2WXK A;  2WXJ A;  5MPO A;  5HHD G;  2VZK B;  4YSZ B;  4H2A A;  1SF0 A;  1JWB D;  1C4P A;  2N9K A;  2YEP F;  3Q8F A;  4OZA A;  1N62 A;  1YN5 A;  1EM7 A;  4JX1 C;  1CJE A;  4YWG G;  1HQR D;  4RNA A;  3E9S A;  3MC0 B;  3AEF B;  4A6Q A;  3ZJU A;  2V3N A;  3GP7 A;  1JW9 D;  2QIL A;  2DWQ A;  2WXI A;  1TKG A;  1FRD A;  2I38 A;  4MT5 A;  1IBX A;  4RF1 A;  4MAC A;  2AQ3 B;  1VZ8 A;  4D2K A;  1N60 A;  4AQ7 A;  4HKZ E;  1E6E B;  2WU5 B;  1N5W A;  1V97 A;  1ZP0 B;  1I4H A;  2MH7 A;  2L52 A;  2NMQ A;  2J52 A;  3W5U B;  2W3S A;  2FE8 A;  1HZ5 A;  1ZUD 2;  2D5G A;  1JRP A;  1E9M A;  3BVM A;  1HXY D;  1V1P A;  3W1S A;  3HVZ A;  3AEB B;  1I4X A;  1TS2 A;  1IGD A;  3U7Z A;  1YN3 A;  1D4B A;  1A70 A;  3HUI A;  1K51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...