1L5UA

Crystal structure of bacillus dna polymerase i fragment product complex with 12 base pairs of duplex dna following addition of a dttp, a datp, and a dctp residue.
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*AP*C)-3'
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l5uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l5uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l5uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l5uA01
4RQ5A 2G8WA 3DOKA 3OYFA 3V7LA 4R8UA 2M9NA 1LV5A 1H38A 3ZCMA 4G1QA 3OYMA 1N6QA 1JLAA 4CHNA 3LZJA 3TARA 3T5KA 1Z00A 3V9XA 3AU6A 5J2NA 4J9RA 2JEJA 4E3SA 3VA0A 8ICXA 1UWBA 4CJUA 4GLXA 1HQUA 3NF7A 5HP4A 4M9NA 4CESA 3MR2A 1I3AA 4E7IA 4I2EA 1TL3A 4KAZA 2FBXA 3E2EA 3BDPA 1SL2A 2I1QA 4NM2A 4F5PA 5CJ7A 4JUZA 2ZJ8A 4ECVA 1ZQAA 2IHMA 5IIKA 1RBRA 3T5JA 3PY8A 5KT6A 4E19A 7ICKA 4RW4A 1NKEA 4W5TA 5DLGA 2LSNA 9ICJA 3OHAA 2ASDA 3PO5A 4KLLA 4ZH4A 4KLJA 2W9BB 4IFYA 1TAUA 1A5XA 3K57A 5KFXA 4XUSA 3CG7A 1KVBA 2P5OA 5J2CA 5KFQA 1SZPA 1JL1A 1WN7A 2F1JA 2F1IA 1JXEA 4DSLA 4OLAA 5DG8A 3VN5A 4CIGA 4EEYA 1B9DA 4CHOA 3VQEA 5I42A 4FJ9A 8ICQA 4QZDA 4GC7A 3DI6A 2DFEA 4X5VA 3MGHA 2J6UA 4RW7A 1IO2A 3AVNA 4RQ6A 3MDCA 5EWFA 9ICRA 1UOCA 4MFCA 2FBTA 4RW9A 1CZ9A 2ISPA 2X74A 4Q45A 4DTSA 4DFKA 4FM1A 4RQ4A 5J2HA 2UVVA 1ZBHA 4M9JA 3KLFA 1WCNA 2YHAA 3S3MA 3Q8SB 1TVAA 9ICBA 1G15A 1CZBA 4DL3A 4O9MA 4NYNA 1ZQOA 3I0SA 3IM1A 3JPRA 1B43A 3RMDA 3ZDCA 4B08A 2W9CB 2FLLA 2XC9A 4M9LA 1LWFA 1NK4A 3JPOA 1RDDA 1VSJA 5F9LA 1RTDA 1C6VA 4RW8A 4DSFA 3WNFA 4BXOA 4I27A 3CFRA 2G8VA 3AVKA 4BE1A 5KFMA 2ALZA 4QZFA 4KTZA 1ZQMA 4G3IA 3V6DA 3SQ4A 4BGDA 1EXNA 1JLFA 1RCHA 3BGRA 4AHSA 2HHSA 4CEFA 1COOA 1WSJA 1XU4A 9ICVA 1LW0A 4YMMA 2KTQA 1AROP 1NKBA 1LAWA 5JS1A 3D0PA 2YHBA 3MEEA 3LK9A 3ISBA 4KTQA 4KPYA 5FRNA 2JEGA 1TKZA 3C1YA 4CE9A 2YKMA 4BE2A 3ZDEA 2IMWP 1EP4A 3TI0A 4RQ3A 4OLBA 4CHZA 3AA2A 3K5LA 4DU1A 5CYMA 5DQIA 3MBYA 4QZGA 3HWTA 4AHTA 3B0YA 4UB3A 4Z6EA 1KEJA 9ICEA 3LPUA 3V9ZA 2E4LA 4FJ8A 3PV8A 2IHNA 4PY5A 3U3GA 3LDSA 4XA5A 3V9UA 4YP3A 2V4RA 4CJ5A 5KT3A 4ECWA 3NH0A 3K59A 3G6YA 4QW9A 2C2EA 4DLGA 1WNSA 4MEYA 3AV9A 3OS2A 5IIMA 4PHAA 7ICSA 3KLIA 1EXQA 3HYFA 3C2KA 2BR0A 4CGFA 3U6FA 2IA6A 4KHQA 4J9KA 1T3NA 1Y88A 1REVA 3HT3A 1RXVA 4E7JA 3RWUA 2F8TA 3SUPA 3VQ8A 4I2BA 1WSHA 3VQ7A 4JRQA 3PMNA 3ISNC 3ZSWA 3WNHA 1BPEA 2JEIA 3AVFA 1ZQEA 3OYIA 5IINA 1HYZA 1GOCA 8ICFA 4I29A 2JEFA 1X9SA 4QWAA 5KT4A 4OGEA 2F1HA 4IR9A 3LALA 4CJSA 5EWGA 2YNFA 3T3FA 1Y97A 3EW9A 1X2IA 2I5JA 1ZBUA 4CIEA 4O0IA 5J2QA 3PMLA 4YNQA 2W8KA 2XCPA 2BPFA 3VQDA 3M8RA 1NJWA 1U04A 4YQWA 1JN3A 7ICLA 2HNDA 1ZETA 1TV6A 1ZQVA 5L1LA 1ASUA 3ZDBA 2RF2A 9ICWA 1BL3A 2P51A 3L2VA 4RW6A 3P1GA 4ED1A 5DGAA 4B9SA 4K8XA 1Q9YA 3QINA 2OPRA 4JWNA 5HHHA 3OSPA 1F21A 3ULDA 2QKKA 2FPLA 2P5GA 3NAEA 4M45A 2NRWA 1J53A 3TABA 1L3SA 2AQ0A 1T05A 3OYEA 4RQ1A 4ED7A 5C25A 3NTUA 4TQRA 7ICVA 2G8IA 1C1AA 5D46A 1ITGA 4CF1A 5EU7A 1C0UA 2ZD1A 3RB0A 7ICTA 4DOCA 3RJIA 2ZE2A 2KZ3A 1WCLA 4PGQA 2KFZA 3LZIA 1B9FA 1XWLA 4J9OA 5DB7A 3ZT4A 3C6UA 4P4MA 3AVCA 4LZDA 3QZ7A 2PFNA 1MQ2A 2PFOA 4HTUA 4PGXA 4CK2A 4E89A 4KLTA 1HPZA 1BQNA 4BWJA 3B0XA 4F5QA 4KTWA 5KG7A 4QZBA 1HJPA 2HHWA 2XHBA 2X6SA 4M04A 3V6JA 3RB4A 2VG5A 3RMAA 9ICIA 2HMIA 1JXLA 1W0HA 3T1AA 1ZQXA 2XGQA 2QXFA 3NGZA 5KFPA 3RH6A 4Z6DA 2V4QA 4F2SA 3JPQA 4DQSA 2IBKA 1RTIA 1XO1A 1U49A 4CFAA 1R0AA 1JLBA 1W9HA 3HK2A 3HJFA 4H4OA 1RT5A 5J0TA 1S9EA 3BQ2A 3NF6A 4HCBA 4ED2A 2B4JA 4M3WA 5HBMA 3JYTA 4KHWA 4PGYA 4IQVA 4TQSA 1A76A 5DLFA 3KLGA 1ZQHA 1I39A 9ICQA 5HLFA 4QZ8A 5KFKA 3JPNA 3RJHA 4PHPA 4KHUA 1RBTA 4AILC 1MSWD 1ZQCA 3UIQA 4M6WA 4DO9A 2O4IA 1C7YA 3FFIA 4O3OA 2MUTA 5L1IA 3CYMA 4CJ3A 3HVTA 1UT5A 2VA3A 4QAGA 1FXXA 5J2AA 3ZD8A 4DTOA 3HW8A 3AVIA 3GIKA 4IG0A 3DLGA 3OYAA 3EPIA 2ZQBA 4CEZA 4FZXC 1A77A 4EZ9A 3AVAA 1IKWA 1BHLA 3L3VA 3MXJA 4YD2A 4R5PA 4FJJA 3MXIA 3EWAA 2BE2A 1VRTA 1IM4A 3L8BA 2A1SA 2ZTDA 3RJGA 4KLDA 8ICKA 1ZQYA 5DBBA 2Z1IA 2YNIA 4FLYA 5HHIA 2WTFA 1RT7A 3TAGA 4EZ6A 3C94A 1NJYA 4E7HA 3C23A 3JSMA 2GBZA 3HP6A 5KGXA 2A1JA 4ECUA 3DM2A 2AU0A 4UB5A 4CEEA 3C2MA 4CJFA 1VSEA 5L1JA 1JIHA 3RBEA 4IRDA 5FROA 3VQAA 4L8RB 4FO6A 4KLHA 4QZ9A 3SQ2A 1KRPA 1T8EA 4NCBA 4GXKA 1BQMA 1HYVA 7ICQA 5L1KA 4BXOB 2FMSA 4FYDA 4MQ3A 4TSXA 3RR7A 4Z4HA 2EHGA 4ECQA 4KHYA 4DF4A 4AHRA 3H40A 4I7FA 3QETA 1HMVA 1FK9A 4GC6A 4OPJA 3AO2A 1WLJA 1ZQDA 2HHXA 3LP3A 1BPZA 3IHQB 4KV8A 4DSEA 1KFTA 3AU2A 3M8SA 4YXJA 3TWHA 1Q9XA 3RJJA 2XO7A 3K75D 4PPXA 3Q8PB 1TV9A 4UQGA 3O4NA 3BJYA 4I2JA 4MF8A 4ED8A 4FLZA 4MFAA 3OHBA 2C2RA 2HHQA 3AVMA 3C21A 4QW8A 3GIMA 3ITHA 4KRFA 4M42A 5KFOA 4FW1A 1QQCA 4C8NA 1JLCA 1WAFA 1TFRA 4AHUA 4IFVA 4DFMA 1XI1A 1NK6A 2A1JB 4I2IA 4DSIA 2Q0ZX 3HP9A 4MEXA 4DL5A 1KVCA 4FJHA 4PA1A 4CF0A 4OKJA 4CGIA 9ICCA 1NOMA 3NF8A 5BPCA 3VQ4A 4TUPA 4CGDA 4BDPA 3VQ6A 3TFRA 3RRGA 4KFBA 3OYKA 3NH1A 1SV5A 3RJEA 3H8WA 4I9LA 1RT4A 5KFZA 3BQ1A 4RNMA 1QS4A 4KMUA 4DFJA 3TAEA 1QSSA 1NK8A 2Y1IA 4NLNA 7ICGA 1YT3A 2HHVA 1KCFA 4N5SA 4GW6A 2R8GA 4EYHB 3H4BA 2ZUCA 1S1WA 4BACA 1WSFA 3QESA 2JZBB 4DL4A 5F9NA 4QZCA 4I2GA 4PHEA 3TAPA 3KK2A 5J0QA 8ICCA 9ICSA 1FKOA 4UAYA 1L5UA 1KLNA 1D9DA 4HUFA 1HUZA 2WONA 5CR0A 5CWRA 1TGOA 3OYJA 3V9SA 3OS1A 8ICJA 7ICEA 2W42A 1GOAA 1EKEA 1S0VA 2IS3A 1TKXA 5J0WA 7ICMA 2B5JA 5E41A 2OYQA 3PR5B 4K8ZA 4DWIA 4F4WA 5JUMA 3DRSA 5KFWA 1UAXA 3ZSVA 1JLQA 4I2CA 3AO5A 4B3OA 3ZDDA 1RBUA 5KFTA 3DRPA 7ICOA 5KFNA 9ICFA 3I0RA 2O4GA 2HHUA 3ZSYA 3EY1A 1S9GA 4RPXA 4JWMA 4KLSA 8ICBA 4KKOA 4CGHA 1ZQGA 2JGUA 3JPSA 4FXDA 3H8SA 4FBTA 1IKYA 2D0CA 4M47A 3N97B 3QNOA 1VRUA 4C8MA 3HPHA 4K4IA 4Q8FA 4RU9A 3V81A 2KN7A 4ED0A 1L3VA 1DTQA 5DBCA 2OZMA 4PH5A 4YD1A 5J0XA 2QKBA 2HNYA 1LW2A 1A5VA 3ZSXA 4CJTA 4KI6A 3RRHA 1MU2A 3LP0A 3PW5A 2PXIA 3O3HA 4M9GA 3RMCA 3DMJA 3O4QA 5C5JA 3F9KA 3V1RA 3QEBZ 1S6PA 1RDAA 1RDBA 4HUEA 2DFFA 5SWMA 1S1VA 1ZQQA 4RPZA 2FLNA 1BPBA 5DB6A 3L2WA 4KI4A 2BCSA 3QIOA 2FMQA 4EBCA 2BGGA 5KT5A 2EX3A 4DFPA 4O5BA 2W9MA 4P4PA 5IIOA 4M3ZA 5KG0A 4F4KA 3IRXA 3FYHA 2AGPA 3KK3A 7ICNA 1KSPA 2UVWA 1S1TA 4OGCA 3SI8A 4CF2A 4DS4A 4IR1A 3GIJA 3NCIA 5KFFA 4GMJB 8ICSA 2ZUBA 4KLGA 3M9NB 3C6TA 3VA3A 1ZQWA 1S0MA 1HQEA 1JXBA 3KHHA 4QWBA 5L9XA 2IGIA 3K5MA 4M6WB 9ICHA 4FJIA 4OPKA 2DTUA 3WNGA 3NHGA 5J0YA 4KHNA 5HRRA 1KFSA 4AHCA 5IIIA 4RNOA 3TANA 7ICHA 1S6QA 4J9MA 2Z1GA 2GWSA 3V1QA 5J0SA 2G8FA 3V4IA 1MQ3A 5KT7A 2XY8A 4M3RA 1D5AA 1KTQA 4M2YA 5HRNA 3OJSA 1U48A 4FJMA 4KLFA 4EYIB 4DTRA 5HRPA 3VQBA 3OS0A 1BISA 2DPIA 1S76D 4M41A 4Z4IA 3OJUA 2D5RA 3CFPA 3FDSA 3ETLA 2RN2A 4KLMA 5J2PA 2KW4A 4N56A 3JPTA 4M3TA 2ZTEA 4LD0A 3P83D 9ICUA 4I2DA 3V7KA 2ASLA 5J2BA 1RNHA 4UB1A 1VK0A 4NCGA 3GV8B 5KI6A 1SUQA 4KN4A 2NRXA 2RDIA 1VSMA 4H4MA 4FLWA 3RJFA 4HHTA 4UB2A 1BI4A 3PX6A 1VSFA 3E01A 4DOBA 5DQGA 2DFLA 5KT2A 9ICKA 3PW2A 3AA3A 4DMNA 4QZIA 2RKIA 5T7BA 3Q8QB 4XRHA 4O4GA 3DLKA 4AHVA 4FK0A 2AQ4A 2QK9A 5CZ2A 4IG3A 3SV4A 3QEVA 4RQ8A 1VSDA 2J6SA 2ASJA 3KIOA 3OYHA 1IH7A 1L3TA 1EETA 5FDLA 8ICWA 4F8RA 4Z6FA 2HHTA 3KTQA 3HL8A 3TAQA 5J0PA 4FS1A 1ZQRA 2BKEA 3ASMA 3C2LA 3M8PA 4FZYA 4ECRA 1SKRA 4GXIA 4J2EA 4CEQA 4O3PA 4KLIA 4KLUA 3TAMA 2BCRA 4EBEA 4NCAA 1BPDA 4HUGA 2PY5A 4DTPA 4IRCA 1XC9A 2PI4A 4Q0BA 4F93B 4KLOA 4NY8A 4CEBA 4CERA 1D9FA 3QEPA 3GV5B 4O0JA 2C22A 4RQ2A 4B8CA 4KB1A 4E1MA 1TK0A 2D0BA 2DFHA 1KLMA 2FC0A 1LWEA 3Q8LA 1ZQKA 3KD5E 4HVJA 3Q8RB 4F3OA 3G6VA 4DQIA 2JLEA 3TR8A 2F8SA 5BOLA 4Z6CA 4FK2A 5KG2A 2D0AA 3THVA 1DOQA 9ICXA 4DU3A 3BQ0A 3AVBA 5DDMA 2P1JA 3NFAA 1C0TA 1U47A 9ICNA 3OYNA 2P66A 5CZ1A 5CHGA 4N76A 4UBCA 1D8YA 4B9TA 4KHSA 5DKWA 4DL7A 3PUFA 4PHDA 2PYLA 2BHNA 1ASVA 4DQRA 3OYBA 3GILA 8ICLA 2XY7A 3QNNA 2MAXA 3PO4A 4IQWA 1X9WA 9ICPA 4YCXA 3T19A 5KFEA 4C8KA 4RT3A 4C8OA 4F50A 3SUOA 3V6HA 2P6UA 2BCVA 4HYKA 4Q8EA 4JRPA 4DL2A 4O5CA 5SZTA 5J2GA 3DOLA 4ID5A 2W9CA 4NXZA 3SYZA 1ZQNA 3M9OB 3RH4A 5HMMA 1NOYA 4FCYA 2YNHA 4MFFA 3AO3A 4CJVA 3V1OA 4I2HA 3H8JA 5CA7A 3OY9A 3KHRA 7ICUA 2R8IA 2AGOA 2IC3A 1DLOA 1RT2A 3MR3A 4O55A 1Z00B 2BQUA 4FVMA 4UAWA 1RTHA 3Q8MA 5KG1A 3DLBA 4KB0A 8ICUA 2IOCA 2OPSA 3HM9A 1UA1A 5KFHA 3SV3A 2E6MA 4UAZA 5DB8A 4O3NA 4Y1CA 4CF8A 3QO9A 1YVUA 2PI5A 4F92B 4FJGA 5J1EA 1N48A 4ZTFA 2WOMA 3GV7B 2PFQA 4B9LA 2F96A 4CJEA 4BDZA 4I9QA 8ICEA 9ICTA 3RAXA 2H5XA 3C5FA 1KVAA 4TURA 5D49A 2IAJA 5DDYA 2B6AA 2VA8A 1ZQJA 2NUBA 4YXMA 2OWOA 2BANA 4B9NA 2ZJ5A 4FLTA 5J2DA 4QOZB 1BIUA 3ZSOA 3AVHA 1TAQA 5KRSA 3IG1A 1XSNA 1JMSA 3QEXA 4O5EA 2AJQA 4YMNA 1SL0A 2ISOA 4JLHA 3ISDA 7ICRA 5KFCA 4M0AA 3M9MB 4F5RA 3UXOA 1RZTA 1ZQFA 1TKTA 3GIIA 1T4GA 3U3YA 3N4MB 5KFYA 1QTMA 1UT8A 2P6RA 4E1NA 4ED6A 1Z25A 4CEOA 3ZD9A 4WE1A 3H08A 3PNCA 2R8HA 5KGWA 2BPCA 4ECSA 2BQ3A 4DTUA 4J9LA 2HNZA 3KLEA 4NLZA 4FLUA 8ICGA 1O1WA 3RJKA 3LWMA 4CGJA 2I9GA 4N41A 3T5HA 3VQ9A 3V7JA 3SUQA 4E0DA 4F2RA 4RQ7A 3MABA 3C1ZA 1SKWA 4ZHRA 5D3GA 1ZBLA 4IQTA 3JPPA 3VQ5A 4FBUA 1A5WA 3AVJA 3OSNA 3T5LA 2KZZA 1KDHA 5CB1A 4J9QA 5HRSA 3LP1A 3MEGA 4JS5A 2R8JA 8ICPA 5DQHA 4LVSA 4NLKA 5J2EA 1B22A 4I2FA 3KJVA 3L2UA 4Q44A 4OKKA 1JKHA 5KG3A 4CECA 2OZSA 4YFKA 5DGBA 5KFJA 3UXPA 1ZQBA 4DTNA 1RBSA 2FBVA 1ZQPA 2BQRA 4CJ4A 3ZT3A 1IKVA 8ICOA 2ATQA 5J2MA 4F5OA 5DG9A 4RNNA 4R65A 4RZRA 3AUOA 1JLGA 2G8HA 1WAJA 1CUKA 4UB4A 4FJ7A 2NRZA 2W9AA 3NH2A 3S9HA 3G10A 1ZQZA 1RT6A 4RT2A 1X1PA 3KKRA 4TUSA 5JS2A 1Q8IA 3CM6A 3LDAA 4DSKA 3PR4A 4K4GA 4KLEA 3LANA 8ICZA 4MF2A 3GDXA 3MDAA 4Z4CA 1DGSA 3DRRA 1NK5A 3NGYA 2RDJA 4LH5A 4CEAA 2KZMA 4DU4A 3CQ8A 2DY4A 4CK3A 1RT3A 2LYHA 1S1UA 4FM2A 8ICNA 4YVZA 4TUQA 4CIFA 7ICFA 4LH4A 8ICIA 4B8AB 4Z4EA 1QSLA 4M3XA 3SQ1A 4F4YA 3LAKA 4FJLA 1RYRA 4CF9A 2Q3SA 4YFUA 3HX0A 5J2JA 4ZTJA 4OVLA 4LY7A 1BPXA 1DTTA 3SUNA 9ICLA 2HW3A 3NF9A 4IBNA 4K4HA 4BWMA 3IAYA 4FJNA 3LAMA 2FMPA 1BGXT 3MEDA 2GUIA 1T03A 2G8KA 3RAQA 1SL1A 4O3QA 4KITB 3UQ2A 2R8KA 4W5NA 2HVIA 1V9PA 3HPOA 4P4OA 5KFAA 3KHLA 3IS9A 3EYZA 4GVMA 4NYFA 5EWEA 1K6YA 1TK5A 1ASWA 5KG4A 1C1CA 2FLPA 4YN4A 3MGIA 2E6LA 3LP2A 4B9MA 2VANA 3BQTA 3GFKB 1YTUA 5HROA 3K5OA 5CP2A 4CJKA 2UVUA 1JLEA 1K1SA 1VSHA 3SI6A 4FS2A 4NLGA 2OA8A 3PW4A 3DLHA 2BCQA 4QWEA 4J2AA 4FK4A 1J54A 1RT1A 1ZBIA 1VSIA 1HNIA 3AO1A 5KFLA 4F3TA 2BGWA 3PW7A 2VA2A 4NM1A 3SCXA 3S3NA 3AA5X 3K2PA 5HNKA 1NOZA 1S1XA 4CFBA 2AGQA 3M8QA 1CXUA 5CY4A 4GXJA 4J9NA 4CHQA 3RH5A 3NGIA 1CEZA 3HVRA 9ICOA 3AA4A 4R64A 3NBPA 3NDKA 4EP5A 3PX0A 4R63A 1S97A 1ZQUA 4E7LA 2YNGA 1BCOA 3L3UA 4E7KA 3DYAA 3P5JA 3MECA 5KTQA 4W5OA 3OYLA 1ZJNA 1VSLA 4J2DA 4J2BA 3PVXA 3C5GA 1BIZA 4P2HA 1UA0A 3K4GA 4CJQA 4OKEA 3H4DA 4BDYA 2VG7A 3VQQA 1ZQLA 4F91B 3KKSA 3L2QA 2R7YA 8ICTA 4J9SA 5I3UA 1ZQSA 4LZGA 4XIUA 1KFDA 3RMBA 3SPYA 4IDKA 4O44A 1CXQA 3GQCA 1XHXA 4Y1DA 4DSJA 4UBBA 5KFIA 3V9WA 3PX4A 3H7IA 4ELUA 1IXRA 1Z3EB 4JV2A 4RUAA 1C0MA 4FZZA 1TL1A 3LPTA 4JV1A 4LSNA 4RQ0A 4M3YA 4CEDA 4F5NA 2VWJA 5C42A 1BCMA 1T7PA 4Z4GA 1ZQTA 5DB9A 1FKPA 3QEAZ 3QEWA 1TK8A 2YV0X 4KLQA 2BCUA 3QIPA 4HCCA 3OYGA 3SZ2A 4ICLA 2KFNA 4JS4A 1QE1A 4KN7A 3KHGA 3HSTB 5J29A 1RDCA 7ICJA 4FLXA 5KFVA 1HRHA 1Z26A 9ICGA 4ECXA 3V72A 5DK5A 4M3UA 4FW2A 1U45A 4PQUA 4QZHA 2ITGA 1J5OA 3O3GA 1EX4A 1QHTA 3TQ1A 4ED3A 2NRTA 3CFOA 3V6KA 2GV9A 3EPGA 1IG9A 1WSGA 3HPGA 4BE0A 8ICYA 3TFSA 1JX4A 2X6NA 3K5NA 2HVHA 2UVRA 4MFBA 4I2AA 1NKCA 4DLEA 2A1RA 5KFDA 1XS9D 3RB6A 3RTVA 3AO4A 1GOBA 2C28A 4IQUA 4CK1A 2ZTCA 3ORYA 3QE9Y 2IDOA 1ZBFA 4ECYA 2Y1JA 2MUTB 1HYSA 5IILA 4PWDA 3MR5A 4RUCA 1B92A 4R66A 2BDPA 4C8LA 4OJRA 4CFCA 1IKXA 2NRVA 3MR6A 8ICAA 3L2RA 4IKFA 4H8KA 1HJRA 1S77D 1HUOA 4DQPA 4FJ5A 1K1QA 2XCAA 3QERA 1NK9A 4CGGA 3MAQA 4XQ8A 4PUOA 3LWLA 5KFGA 3RR8A 5KFRA 1RTJA 5J0OA 1ZQIA 3QEIA 1XHZA 4DQQA 4ID1A 3I8DA 4LSLA 4B9UA 4O3RA 4YR3A 1BVSA 3RB3A 2ZJAA 1N5YA 1RYSA 5FRMA 1PZNA 4QCLA 1XSLA 5DG7A 3VQCA 4DS5A 1JL2A 1LB2B 1S5JA 2X78A 3C95A 9ICAA 2OPQA 4R8UB 1TKDA 3TAFA 3ISCA 1RPLA 2RPIA 2W8LA 4QZEA 5TZVA 4JV0A 2V9WA 4YG2A 3ZSZA 1U4BA 3KLHA 2W9BA 9ICMA 3SQ0A 1S9FA 2DPJA 3RBDA 5K14A 4CJRA 4M9HA 1N56A 1RXWA 1BI4B 1NK0A 3A2FA 3NE6A 3AVGA 5HMLA 7ICPA 2PFPA 3F73A 4DEZA 2FPMA 1MC8A 7ICIA 3OYDA 3ZT1A 4CHPA 3WNEA 3DLRA 3G0ZA 1QLNA 3QZ8A 1NK7A 3MFIA 5CYQA 4QWCA 5KFSA 4F4XA 4ECZA 4W5QA 4I28A 1D8LA 1NJZA 3K58A 2FPKA 4DTMA 4F4ZA 3MFHA 4FLVA 3SNNA 5KRTA 3VQPA 1ZYQA 3PW0A 1VSKA 2HB5A 3NGDA 1XSPA 2VWKA 8ICVA 4RPYA 4AH9A 3HXMA 2PYJA 1LAVA 1LWCA 4N47A 2YKNA 5J2KA 2ZUDA 2ETJA 3SJJA 2G8UA 4KO0A 1TVRA 3CM5A 4Q43A 4EP4A 3B6OA 2Z1JA 4FM0A 8ICHA 4B9VA 1ZJMA 3KD1E 4QWDA 3UQ0A 3G6XA 4O5KA 5J2IA 4ELVA 4CFDA 4EBDA 2FBYA 1QSYA 2BPGA 4Q5VA 2XY5A 5J0UA 4DF8A 3ZT0A 4ELTA 4Z0UA 1X9MA 3ZSRA 2B21A 3KK1A 4IRKA 4JK1A 5KFUA 5KG5A 2JZBA 3O3FA 1CLQA 4ECTA 3EZ5A 4Z4FA 1S0NA 3OYCA 4RG8A 4CJWA 3UPQA 1S0OA 5HP1A 5BOMA 4QZAA 2XGPA 4CHYA 5J0RA 1SKSA 5J2FA 4DOAA 2ATLA 5KFBA 3S3OA 1U9LA 3ZSQA 3B6PA 2XY6A 2OPPA 4FJXA 3ALYA 4YR2A 4O3SA 4CJPA 2C2DA 4DL6A 4I2PA 4YMOA 3QLHA 1BPYA 1HNVA 4W5RA 2J6TA 5C24A 4CJLA 4J9PA 5KG6A 4DTJA 4DG1A 4FJKA 3AVLA 2XRIA 1WSIA 3UXNA 3ZT2A 3OGUA 2Z1HA 1NJXA 3Q8KA 3MXMA 3SPZA 5EOZA 2KQ2A 4KREA 1C1BA 1S10A 4CCHA 3D45A 2VG6A 4YR0A 1RILA 8ICRA 1RBVA 1WSEA 3HO1A 3ZDAA 1L3UA 8ICMA 2PZSA 5DMRA 4I2QA 3OVNA 5IIJA 5DBAA 5D4BA 4DTXA 1J9AA 3DLEA 1YTAA
chains in the Genus database with same CATH superfamily
5K8MA 2KM8C 5AQSA 3WX4A 3OYFA 1VQNS 1LV5A 4X4TA 3ZCMA 4G1QA 4KC5A 2FQQB 2EFPA 3D7SB 4CHNA 1LVHA 3MF5A 1Z00A 1F5CA 3AU6A 4E3SA 1KONA 2E7WA 2PFDA 3CJ2A 4CJUA 4GLXA 2CPFA 3NF7A 5HP4A 4M9NA 2XLJA 1MWZA 1I3AA 5AQIA 1FFGB 1YIJN 2GLEA 2AEJA 1ZH5A 2VJUA 4NM2A 1V5VA 2HZCA 4CJ7A 3HCXA 4JUZA 4FVCA 3BF1A 3PEHA 5I3QA 1ZQAA 3CHWA 3UNGC 3T5JA 5KT6A 3ZZZA 1V4TA 3MMJA 2ILYA 4USTA 4RW4A 2CXYA 1HEKA 1SIZA 4J9UE 5L39A 4HR2A 1M1HA 4AUKA 5AQZA 2MLYA 3OHAA 4YOUA 4KLJA 1HWLA 4CBUA 2W9BB 1KWMA 3K57A 4IQXA 2KVSA 1HBNA 4BQZA 4XUSA 1N8RO 1KVBA 1G6BA 5J2CA 3PRDA 1SZPA 3TVKA 1JL1A 4PG8A 3LA0A 2F1JA 4Y0FA 4P7VA 4FE3A 2HLUA 2F1IA 2IYIA 4Y65A 4DSLA 1RHQB 3VN5A 1KLMB 3VQTA 1YZ6A 4ZVUB 4CHOA 3I87A 2OUGA 3G6EN 2DFEA 3QRRA 2J6UA 1WJ9A 4RW7A 2RP5A 3L7UA 1S6QB 3BGRB 3UKUA 3W9JA 1GLDG 3KK1B 2NSBA 1N62A 9ICRA 4DV1J 3G9CA 1UOCA 2FJAB 3R3TA 1YX2A 3OUYA 2FBTA 1XMQJ 3ETOA 3MM9B 4Q45A 5HL7Q 4BRAA 1KP6A 5A8RA 4DFKA 2CGKA 1N8RT 4NXNJ 4OIXA 4X66J 4M9JA 3KLFA 1WCNA 4CWBA 1CZBA 1E3MA 4DL3A 3AY9A 3I0SA 3HHLB 3OTQA 4LFBF 3QLHB 3QFUA 1V3SA 4B08A 2FJEB 4WQ4A 3NEKA 4NO7A 3DMJB 3JPOA 2EC2A 1SXDA 4BY9C 3EXYA 2PMZD 2MKHA 1SJQA 2EC0A 1RTDA 2LPEA 2AD9A 3VEYA 4RW8A 4IOBA 5D78A 4DR6K 2WVDA 4I27A 3BR9A 2G8VA 4OX6A 2RB7A 2KT3A 1Q3VA 4FPAA 2VIHA 2EVZA 4QZFA 2DXEA 4KTZA 1ZQMA 3WXIA 3FKBA 1HD1A 4BGDA 1EXNA 3M8QB 1JLFA 2KDOA 2Y1LB 4LF5F 1Q5VA 5AKYA 1XU4A 1M6YA 4K4SA 3HF5A 3BSCA 3LK9A 3ISBA 3IMQJ 3Q0AA 2JEGA 3V4MA 2Q43A 1TKZA 2YKMA 4BE2A 5A8RB 4MKYA 2IMWP 5GMDA 4UQTA 4JEPA 3I56N 3K5LA 3MBYA 3ETMA 1V4SA 4AHTA 3B0YA 1AQ6A 2BTFA 3R3LA 4FWNA 3QU5A 1KEJA 3SCJE 3V9ZA 2WONB 2IHNA 4PY5A 3U3GA 1RAGB 1RHMB 2QA4N 4XA5A 3V9UA 4YP3A 2V4RA 3NH0A 3G6YA 4DLGA 3UI3A 3TSQA 2G13A 3ZX2A 3KLIA 4OD0A 4O5FA 3HYFA 1ITPA 3K8VA 1ZBTA 1REVA 1Y88A 4G6VB 4OJ6A 4E7JA 2F8TA 2VJ4A 3M6KA 1HNXJ 1RWWB 2Z8QA 3AJ1A 2E20A 3LM2A 3VQ7A 4ITSA 3ISNC 1D3WA 2ROGA 2R2UA 2GMLA 4ZP6A 1GMWA 3ZSWA 1JLAB 3NASA 2JEIA 4JKFA 1QVFM 1Q46A 3AVFA 4ZVSB 4ISFA 1XMBA 3OYIA 1SWWA 2QARA 2XQCA 3MUVP 1X9SA 2B9EA 1RGIA 5AKHA 2HSZA 2YNFA 4KRWA 3UKRA 3T3FA 3MD1A 2ZIWA 3PMLA 2BKOA 2MQPA 2DGSA 2BE2B 3OR1B 2BPFA 3VQDA 2A41A 1S48A 5CE3A 7ICLA 3ZYYX 1JI7A 2WBRA 4CLUA 3D6FB 2VBZA 1ZETA 4DV5F 1TV6A 2MKYA 1ZQVA 2OIHA 3O9SA 3Q8UA 3CCMN 3ZDBA 9ICWA 2I0XA 4M7XA 4TY8B 1BL3A 3NP5A 3P1GA 4K8XA 1RQ0A 2I7PA 1Q81T 2OPRA 3CC7S 3OSPA 3NAEA 2NRWA 1J53A 2F3JA 3NGSA 2F7TA 2W24A 4O8KA 2D41A 2YJFA 3U8XA 2AQ0A 2CZ4A 4BLGA 2GIQA 3OYEA 1VK8A 2A19A 4XH1A 4V19J 2NYVA 4BX9C 7ICVA 2KN4A 2ZJQQ 5D46A 1U6ZA 4CF1A 5EU7A 3CT9A 4B9QA 3CCJN 2YQ0A 1U1QA 7ICTA 5I42B 2ZE2A 2MKIA 2GTDA 2C3OA 4PGQA 1H72C 1B9FA 3FFKB 1XWLA 4J9OA 2OJ3A 2QWOA 4PG7A 3EZWA 7AT1B 3AVCA 2UUBK 2CPHA 2KKVA 1KKXA 2J7UA 2VQEF 2PFNA 1KOOA 2W43A 4HHUA 1S72N 2PFOA 4GV9A 4E89A 1B0XA 1PAUB 2JMGA 2WSCC 1BQNA 4OFZA 3DGPB 4F5QA 2VKRA 5J2NB 2FHOB 2C2OB 2QG9B 4C7QA 3RMAA 3RB4A 1WWVA 2VG5A 9ICIA 5M1PA 1W0HA 3I0SB 4RNHA 1ZQXA 2KEYA 2XGQA 2QXFA 4YY3J 4JB8B 3KG4A 3NGZA 3J7YP 2D3UA 2CQ0A 2VIXA 1Y5LB 5F8NA 2GVDA 2QWNA 5BPNA 4DQSA 4HT5A 4CFAA 3NMRA 1VQMN 1SQFA 4O8UA 4IQMA 1G2EA 2ABYA 3C15A 1CSJA 2V0NA 2B4JA 2CPJA 2IFXA 3R5JB 2ZWOA 5HBMA 1YJNS 1UQVA 2F40A 2UXBJ 4PGYA 5AXKA 1IG6A 4X4SA 3FUYA 4IJNA 3I32A 3LPYA 4ETXA 2HBKA 3JPNA 2CPDA 3RJHA 2VFTA 2H1YA 2RHQB 1RBTA 4AILC 1MSWD 3HBTA 1TFWA 1DAXA 3UE2A 3FFIA 4DCHA 4LR7A 3J7A1 1WC1A 2F2AB 1Z19A 3HVTA 2QTDA 1UT5A 1GLLO 3C0BA 3J8AA 4WP9A 3AVIA 2ASPA 4IG0A 2DISA 5AQMA 3FEXB 2ZOFA 3EPIA 2KD1A 3SK3A 1UFWA 2HQ3A 1QZ5A 1A77A 4BRCA 4EZ9A 5F41A 1BHLA 4JI7F 5DETA 2K7JA 1IM4A 4KHPK 4UOHA 2W01A 1N33K 2G07A 1K0VA 2ZXHA 2VPXB 2ZTDA 2YX1A 3VENA 8ICKA 4NXMF 5KPZA 5DBBA 3CC2S 4Y2MA 4FLYA 2WTFA 1S4EA 3TAMB 4K25A 3MAHA 4X4VA 2HOFA 3CWJA 1IBMF 3JSMA 4MKVA 2Y0SC 2BABA 3P6YC 3GJRB 5KGXA 1N5QA 3TADC 4CEEA 2ODGA 3TSUA 4NLYA 2E2OA 1S12A 1JIHA 1FEHA 4L8RB 3MWBA 4UAVA 4QZ9A 1TKTB 4OYOA 1SJ4P 3T1YF 2HSTA 5L1KA 4NJ8A 4FYDA 2DCLA 3NVZA 2EHGA 4ECQA 3SMVA 2OD6A 4I7FA 1G7CB 2DNLA 2K3IA 1QQOA 3AO2A 1WLJA 4B3RK 3MXHP 4KV8A 3IHQB 3HKZF 1Q86O 3IR6B 2PDAA 3AU2A 3UQSA 3IRUA 2K8GA 2GA7A 4PYDA 4DKWA 1UJ6A 1LW0B 3RJJA 2OTLN 1HNVB 2CQGA 4PPXA 1BA0A 4PHTX 1HNWF 4OI1A 2F65A 4Y2YA 5DM6L 1N32F 4DHYA 3OBWA 4MFAA 2C2RA 2FSNA 4YDUA 2HHQA 2K89A 4Y2UA 1PCAA 4IH7A 4KRFA 4US8A 4M42A 3H7HB 5KFOA 3ADAC 3HHLA 1JLCA 1YJ9S 5AQKA 5AZJB 2HOEA 4IFVA 5AQGA 3E0FA 1Q95G 2A1JB 3HVAA 4BRKA 1IKVB 2Q0ZX 1KQSM 4MEXA 1F5AA 3KLIB 3RU0A 1IM6A 2HRUA 1YHQN 2A1BA 4PA1A 4YHHJ 4OKJA 4CGIA 2YKOA 3NF8A 2G0JA 2HWIA 2VBXA 3X3UA 1LEOA 4DCJB 1HQEB 3VAKA 3VQ6A 1R43A 3RF9A 1Q82O 3RRGA 2R7QA 3WKEA 2RH3A 3OYKA 3NH1A 1Z1VA 5EE1A 3DGPA 3SQOP 1T3OA 1QS4A 1QSSA 2Y1IA 5AQFA 4ZVGA 2HHVA 1OH7A 3ZZRA 1KCFA 2VHGA 4N5SA 4K2JA 3G82A 1MN8A 2IMOA 3F2BA 4BACA 2JZBB 4QZCA 4BG8A 4CDIA 9ICSA 1FKOA 5AKJA 1KLNA 2IVMA 4LR8A 4USMA 1RT5B 3NS1A 2WONA 3L4PA 1FO4A 1CULB 3BO2A 1TGOA 4WFZA 1UVNA 2MHNA 2DR9A 3DHWC 1GOAA 1EKEA 4TY8A 3MK6A 1TKXA 1OXJA 3N4WA 1SUQB 3RVCA 2YXLA 5E41A 3HZEA 2MHEA 3K8WA 4EU0A 1SAZA 2AYEA 5JUMA 2XS2A 2CQDA 1UAXA 4AXIA 2DH9A 2J0SD 4CGZA 4ZVEA 1GMWD 1W2BR 2E5LK 4YOWA 1S6UA 9ICFA 3MN9A 5DDRC 3A5MC 3KLHB 5LMUJ 2HHUA 2ZC3A 2LKYA 5D4NA 4CO1A 1NGIA 2BM0A 1FKPB 2YB1A 5AIAA 2QFJA 3CJQA 1X31C 4ICLB 1ZQGA 2GQ2A 5CABA 3OTEA 1HHSA 1HHTP 3M2VB 4KSEB 3UCZP 2D0CA 1DRGA 4P74A 4F0MA 3QNOA 4C8MA 2W7AA 3V81A 1NZ8A 1DTQA 1L3VA 2F4VF 2MMYA 2YX7A 5DBCA 2OGUA 5RUBA 1J27A 2FSJA 4PRFA 1HL6A 2LVWA 1A5VA 1H3DA 1RAHB 1X4BA 3TEHB 2FHMA 4KT0C 4KI6A 5F8IA 3CDEA 5T7LA 3ALRA 1TL3B 3VHQA 2GHPA 4A47A 4M9GA 4C23A 3RMCA 1LWFB 5ETLA 2LU2A 3ILIA 3VAGA 5C5JA 3W61A 4B3SF 1RDAA 4HUEA 1RDBA 3BSOA 3BUZB 5AM0A 3IFRA 3UD3P 2HBMA 3IDHA 4HHJA 1VQOS 2FLNA 2CAJA 4I4BA 3OPXA 4CH0S 5KT5A 4LRDA 5C15A 2IOFA 4P4PA 5IIOA 4F4KA 4FKYA 3FYHA 2GGPA 3N4PA 3G2XA 2E1YA 4NA3A 1N63A 1U8SA 4WQ4C 4JI8F 3H1VX 2JXJA 2JC1A 4FWSA 2ZUBA 1F2HA 3P8BB 5CHCB 4PPZA 3QT6A 1QCKA 4C1NI 1OWXA 1ZQWA 5AQNA 3VA3A 1JXBA 2NRHA 1S6OA 4QWBA 4DV3F 3KWGA 1PAEX 5T14A 5M1NA 9ICHA 2UUTA 1F6TA 5AT1B 5ALSA 3WNGA 2WC9A 1KFSA 4AHCA 2IVYA 2WBMA 3VEWA 2HHHF 4JI4K 4KR0B 2Z1GA 3CQYA 4JK9A 2ZBPA 5JU5A 2P9SB 2G8FA 3HJEA 2VL1A 2YKQA 5JTIA 2QIFA 4M2YA 1ULRA 4FJMA 3ENHA 2P2CB 2UUAJ 4DG1B 3MCMA 2EG2A 4EYIB 4OCZA 1BUXA 3OS0A 1RT6B 9ATCB 4ZMMA 1S76D 1S9EB 1T3QA 3OJUA 3O6WA 3FDSA 3RGIA 1WC4A 5LMNJ 3O6QA 4QYZK 5AKEA 3MPWA 1K8KB 1R0BG 2C2KB 2FDRA 2X7IA 2DHXA 1M1GA 2P6SA 3B78A 2ASLA 1RA7A 4WCEL 5J2BA 2MXYA 2G9OA 3J80Y 3K89A 4BC3A 3A8YA 3LF0A 4Q7AA 1RDRA 4LF7J 2D3O1 4H4KA 3VF6A 5M2UA 3AD9C 3PX6A 2IIHA 4DV7J 4DOBA 2QYCA 4H5WA 2FVCA 4DPWA 4KBIA 2W2OP 5M2PA 3UDLA 3PW2A 4UY85 4DMNA 1RU1A 3GU3A 3U27A 4XRHA 4O4GA 3DLKA 3MWPA 2UUBF 2AQ4A 4K4TA 2QK9A 3VPZA 1NJIO 3D1QA 4JYAF 5TKWA 5AI4A 3QEVA 1VSDA 1HUXA 4NZ6A 5DDQC 4MLEA 2QL7B 5HATA 4DV4J 3L09A 3KIOA 4RX6A 1HIYA 1ZA2B 4U96A 1RAAB 5FDLA 2C3UA 3UCGA 1VRQC 4UOGA 1G3OA 1XNRJ 4I56A 1ZQRA 5JVGQ 4AXJA 1SZ2A 4F72A 3M8PA 4LF4F 4GXIA 1H2VZ 2FJWA 4J2EA 4IYQA 4GVEA 3C6AA 3W8GA 4KLIA 2MZRA 2R3VA 1N32K 1P1LA 4DR4F 3I4HX 2BCRA 4IKAA 3H46O 5HO4A 4BBYA 2NZTA 4WPAA 5LL6d 4QIWC 4Q0BA 2W4DA 4OX9J 2XICA 3MUTP 4F93B 3CJ1A 2G0AA 2MSNA 2Y0SD 2V2VA 3TNVA 3SCLE 4JI5J 4HDGA 5AXNA 1M5VC 2KG1A 2FUG9 5LJ5Y 4RQ2A 4DR3F 5B8HA 3VALA 3J7AN 1TK0A 2WF5A 1HR0F 2DFHA 5EY4A 2FZKB 3KD5E 4HVJA 4F3OA 4DQIA 4FYXB 4DR2J 2W6LA 3AB2B 4WK3A 3THVA 1LXNA 4DU3A 2VZ9A 2F9JA 5DDMA 1GLJO 2ZG6A 3NFAA 1JROA 3OYNA 5GADI 3QIPB 1ZRNA 1D8BA 4NMXA 2N3OA 5LOQA 2QZ8A 5AKKA 3DJCA 5DKWA 3WKDA 2A6AA 4PHDA 3GMGA 3DYAB 4FWKA 4P0PB 1ASVA 3VF2A 1YRUA 3PO4A 2QV6A 4I6AA 9ICPA 3T41A 2AJ2A 2OCEA 2ZIVA 4FDFA 4LRFA 1JXVA 1C1BB 1OJ4A 5ALVA 1CULA 4GKKF 5D0EA 1WHXA 4JRPA 3WEEB 2O8BA 1YJUA 5J2GA 3DOLA 4LFBK 4JI0K 2FY8A 3ED5A 1ZQNA 1MW7A 1RTDB 1GT8A 3BBCA 4XK8C 4QS8A 1NOYA 3AO3A 4CJVA 2UUAK 5CA7A 2F7VA 4RW8B 3BV8A 3ZI4A 3UWTA 5EE9A 2Z2MA 4NXNF 2ZIUA 3THTA 1TL1B 3S7RA 2BQUA 4LRBA 1H1VA 1BNPA 3OXFA 3QUCA 1RTHA 5CQGA 5ALYA 3Q8MA 3DLBA 2A1AA 3NVMA 4NCGB 8ICUA 2OPSA 3B54A 3FZ2A 5KFHA 5DB8A 4Y1CA 1R8PA 4KKOB 4LF5K 4O4RA 1B70B 1T03B 4B9LA 4CJEA 1NAQA 3E01B 8ICEA 2W1BA 2P9CA 2E7XA 4ANEA 3FLCO 4TURA 3BQ7A 3O8WA 3D2FB 3B4DA 5GAGI 3PEJA 4JI6K 1FJGF 2B6AA 3WK6A 2CJQA 4BUGA 4B9NA 5LMNF 4JI1F 3I4PA 1KNZA 1CJTA 1X3NA 3QYPA 4G9ZA 2E8AA 3ID8A 1XSNA 4IO8A 3QEXA 2YKPA 3H59A 3NGUA 2AJQA 3L4BC 4URSA 4B1WB 2ZDOA 2Z4PA 1TP7A 3FZFA 2ISOA 1REVB 4YS2A 1VQ7S 3FZMA 1FESA 3CXCR 2F76X 3M9MB 5AR0A 4RNFA 3O0FA 2HMPA 5C2FA 4AYBF 1VISA 3N4MB 2P6RA 3ZD9A 4WE1A 1C4AA 5DRKA 1RT2B 4KAIA 1SH3A 1SJ3P 5KGWA 3CJKA 5AM1A 4J9LA 3O80A 4NLZA 1Y4ZB 2B7BB 1O1WA 3LWMA 3LM9A 1IKXB 3KUHA 2I9GA 4ILRA 2CIMA 3T5HA 3V7JA 1YKWA 3TTFA 4U9RA 2QL5B 3BH6B 1K8AT 1XEZA 4RQ7A 3C1ZA 4P2FA 1GTHA 4IQTA 3VMFB 3M8YA 3R7NB 2EAPA 4JI5F 3IFEA 2AJ1A 4ICAA 1EB0A 1M0SA 2C3YA 4NYOA 2P9PB 1KDHA 5HRSA 1YJRA 3LP1A 2DKOB 1X4HA 5DQHA 3C6HA 4NLKA 1NB2A 2R2TA 4I2FA 1WUAA 3L2UA 5A0YB 3GU0A 1GMUA 4Q44A 2I6WA 5GAGU 3VGVA 4B3MJ 4DR4J 1ZQBA 2KRBA 3LP0B 2FBVA 1ZS6A 2JFDA 2BQRA 2I9SA 1R89A 8ICOA 2VCPA 1PUZA 2E66A 1W2IA 4R65A 3I55N 5BRDA 2EDUA 1CUKA 2VICA 2W9AA 4M5IA 2VDHA 2RIJA 4UARA 5L38A 1X1PA 1KQSR 3WC2A 3KKRA 4YDDB 1XK8A 4BRDA 4PEOA 5D0HA 5ALUA 1TUYA 4K4GA 3VOVA 3LANA 1QUPA 3BZKA 4MF2A 4XH5A 3LUYA 2G2OA 1VQ8N 1WKKA 3F53A 5DZ6A 3DRRA 4OYPA 1KQFB 3NGYA 4LQ3A 3T79A 3ILOA 4GVBA 2DY4A 4RTFD 1O8BA 1S1UA 4FM2A 4TUQA 7ICFA 1JLEB 2NUHA 3WIVA 2NYHA 4CF9A 1GEHA 3QT7A 3G6ES 1TL7B 3QSYB 4DR6F 2VC1A 1E4FT 3KJVB 4JI3F 3PKMA 4LY7A 1BPXA 1BQNB 5HSPA 1Q78A 9ICLA 4DUZJ 4FZNA 5M2RA 3DWLA 2A2DA 4BWMA 1A7GE 2DTJA 4DV7F 3W66A 4YB5A 3C28A 2DHHA 3KMQA 1T03A 4CNYA 4PR6A 2XZTB 5DO2A 3RAQA 2VPZB 3E1YA 1SL1A 1WTFA 3MM9A 3CCLS 5GADU 2V8HA 3QU2A 3QT5A 5E2QA 1FEZA 3HPOA 4P4OA 1CS4A 3DV9A 1B0PA 4HTJA 4G65A 2QGFB 2ITMA 5E3AA 4GVMA 3JXUA 3BF4A 1ASWA 2LECA 4PWDB 2Q6CA 2IOFK 3Q22A 4ILLA 1PVPA 2K8CB 4ZP7A 3WXJA 2IOHA 2E6LA 3TRGA 1VQPN 4TYAA 7FDRA 3DLJA 3BQTA 3OLAA 1ZZNA 3GFKB 3POTA 2E1RA 5HROA 1UHUA 3K5OA 4E2FB 1XNQJ 2UVUA 4WU2A 1JLEA 1K1SA 4E98A 1U6FA 1Q3UA 2PKEA 4JD2B 4FS2A 3SI6A 4NLGA 3TQEA 3DLHA 1D8ZA 3FQKA 4J2AA 3FC9A 1JCGA 1RHUB 1J54A 5KFLA 1AXQA 3EUNA 1NHKL 4DL0C 3U9ZA 3AA5X 3K2PA 1OH8A 5HNKA 1SC1B 2PD1A 3M8QA 4FPRA 4NEYA 3NAIA 3NGKA 4CLKA 4BVPA 2UU9F 5B0CA 3QU9A 4PG6A 2DH7A 3RH5A 2IJRA 2KVQE 9ICOA 2NXNA 3NDKA 4EP5A 1HBMA 3LDQA 3MCAB 4CI0B 4IOAQ 3C14B 4QYRA 1NGEA 1FKOB 2RU9A 4B1UB 3CULA 4OJ5A 4L73A 2MDAA 3MECA 4OX7A 3MCPA 1ZJNA 1O03A 2EANA 2Y1RI 1IV8A 2VG6B 1UA0A 4NI2B 4DR6J 4K0KJ 2VG7A 3VQQA 1D09B 2OEMA 2DGWA 2R7YA 3VESA 8ICTA 3NGRA 2QLBB 1OPIA 3SPYA 3POTB 4IDKA 3GQCA 1CC7A 1RKIA 3EX7B 3MGJA 4DB3A 5ETRA 4CRJA 1URRA 4FZMA 2NNWA 3H7IA 5E5NA 3Q89A 2E1EA 1U1KA 4FZZA 1DK3A 2DR7A 4JV1A 3FEYB 5AXMA 4RQ0A 2B3TB 4M3YA 1BCMA 2WVCA 4C4RA 4B3RF 2BCUA 1FDAA 1SJRA 4DV1K 4QIEA 5B0AA 2KFNA 1NSPA 4PL1A 4KN7A 2YY6A 3KHGA 1RDCA 4BR0A 1IBLF 2ACYA 3TTCA 1UL3A 4FSVA 4OHYA 4KH5A 1OY8A 2E44A 3SMSA 1DTQB 5L9NA 3M32A 4JKEA 4LMZA 4X65K 4UATA 2BANB 6FDRA 1IIPA 1T11A 2YX6A 4ED3A 1M1KT 2BV3A 4IFVB 2F8KA 5ALPA 4WWSA 3CD7A 1IG9A 4KQZA 4B1VA 2HVEA 1X4GA 1JX4A 2HVHA 1RSCA 3CB4A 4ACOA 2C3MA 2A1RA 4PKDB 4QZVB 1RLDA 2D8CA 3RB6A 1Q8KA 3P39A 4OYZA 3EN9A 4IQUA 2ZTCA 2IDOA 2RUGA 2Y1JA 1WI6A 2CVIA 2HLTA 2XMUA 2BOPA 3ZZTA 4PWDA 1W97L 3MR5A 1T9WA 1B92A 4R66A 1IWGA 4USWA 1F60B 1WTBA 4CLWA 3OL7A 2DBYA 2NRVA 3DLGB 1N54B 3MR6A 3ZZUA 5C2CA 1U24A 2QA1A 4DR5K 2KM8B 4H8KA 3OL6A 1M5HA 3QUTA 3GFXA 2XCAA 4K0KK 2FTRA 4DV2J 4JKCA 5KFRA 2RUSA 5AQRA 4MAKA 4DQQA 1YBTA 3NMAA 3QAUA 3I8DA 4LSLA 4B9UA 3ZTPA 4BR5A 4O3RA 1ZAWA 1PC5A 3RB3A 2ERRA 4NLQA 3HRGA 2NO5A 1XSLA 3W5YA 1CZAN 1JL2A 1FJEB 1UZDA 2QMWA 1JLGB 2M8DB 2MGZB 1S5JA 4LF2A 1XMQF 2X78A 3C95A 4JKHA 4N77A 1RM6C 4H4OB 4QIWD 3D66A 1TKDA 5L8RC 3HFZB 1RABB 3TAFA 2KICA 2RPIA 4F3MA 3F41A 1QVGM 2Y8YA 1U4BA 3CJBA 3AQOA 4DDFA 4R0EA 4W4MA 3CD0A 5I3UB 2MKSA 5JRTA 2OM6A 4YB7A 5K14A 4I0WA 3BEXA 1NGGA 3GJTB 2GWJA 5LSOA 2N7YA 4Z94A 4CJRA 1N56A 3MEKA 3PTWA 3I1YA 3SAFA 4GKKK 5L1MA 4TY9A 4P0QB 1ZM4A 2FPMA 2IY5B 1ZOLA 1QLNA 4P72A 5CYQA 4Y2QA 3W2WB 3EUB2 2IDEA 3W3DA 5ETKA 1VQLS 4M7YA 4AE5A 4OJLA 3G25A 3RG6A 3OVAA 3DOLB 4ID5B 5KRTA 3VQPA 3PW0A 1VSKA 5A8WA 2HB5A 4PKIA 3X1LB 1PK1B 2H54B 1I1GA 4XDDA 4OJGA 4ZK7M 4AH9A 4GKKJ 3HXMA 2HOIA 3W9IA 3A0HU 4N47A 1UEKA 4WKRA 2OELA 2CH5A 3DFEA 2YTUA 3M3ZA 4JK7A 4KGXB 3FAHA 2YWWA 4EP4A 3THYA 1UPMB 2UXCK 2YY3A 5AQXA 3HM8A 4B9VA 1S49A 2DEIA 1YZ7A 2UXBK 4QWDA 3UQ0A 2XMVA 4M5DA 5IV4A 2N4CA 2FBYA 1QSYA 2BPGA 2CG4A 1JWWA 5J0UA 1HPMA 3ZT0A 4ELTA 2LQBA 3ZSRA 2B21A 3KK1A 3OPKA 5F8MA 2BEFA 5A8KB 2Y3YA 3L6QA 2LI6A 5EX5A 3O3FA 4OLOA 2YHXA 3UVJB 1GLBG 5BOMA 4CHYA 1WHWA 3DXSX 1HYSB 5AQTA 3N6NA 4DOAA 2ATLA 5KFBA 1F2GA 1U9LA 2OEJA 2YMPA 2XY6A 4BQLA 4FJXA 3ALYA 4F3QA 2CGJA 4O3SA 2MZ1A 2EFGA 3VTIA 5ALNA 4OZ2A 4DPUA 3G87A 1HX1A 3QFHA 2B4UA 4PL2A 3SAHA 2JZ5A 3NRWA 4US9A 5A8WB 4CJLA 3NRZA 4ZCLA 2DF4B 2GNKA 1URNA 4K4VA 1VK3A 4FJKA 2VD3A 1K5OA 1VQ5S 4E8UA 1HWJA 2XRIA 1WSIA 2FVRA 3ZT2A 4XEIA 1BO5O 5IT9O 1RTJB 4H5VA 3GL1A 2W6KA 1OW5A 3S6JA 3QPIA 1S10A 5HR7A 4CCHA 1KKHA 4DX7A 1GX5A 5HQMA 3CGIA 4YR0A 2I1RA 8ICRA 1AZSA 3QGPA 5M1OA 2HURA 3UCUP 3CD5A 1L3UA 1QZ6A 1K73O 1R27B 4I2QA 1X9JA 5D4BA 1NMEB 1J9AA 2UZAA 1A0OB 3PRVA 4NPOA 4ZHRB 1XUPO 1KAXA 4RQ5A 1WYGA 1NHVA 5FJ4A 4K0KF 3CCQS 4A8FA 4YHHK 3V7LA 4RPFA 4R8UA 2OP5A 1VHXA 2HFVA 2VQFJ 3V81B 3TARA 5J2NA 3VA0A 4WXWA 1HQUA 3W7BA 2VGNA 4CESA 4USKA 1VR6A 1PJ5A 1WC6A 3ENOA 3K2YA 4ZPAA 3FK4A 2XM3A 3GYNA 1TL3A 2CNLB 3BDPA 3FVYA 1H7WA 5B08A 2I1QA 2OSQA 3KK2B 5CJ7A 1S1VB 3NY0A 3NWRA 3PHTA 2DO0A 2HPUA 2ZBQA 3Q83A 4DU8A 5IIKA 3PY8A 3QFWA 3NCQA 4UZCA 1R6VA 4E19A 2E2PA 4W5TA 3CMES 3JSBA 3F2KA 2LSNA 2HAIA 4DV3K 2GAGC 3KK3B 4ZH4A 3HT0A 3KOAA 1S1TB 3DRRB 4WQ5C 3CG7A 5KFQA 3GSIA 3PJ9A 3WQPA 5J8YC 2RS8A 5FPMA 1UFLA 1WN7A 1X0FA 1FRJA 1SXLA 4XDCA 1JXEA 4X64F 5J2QB 2P9IA 2H51B 3BBBA 3NCRA 2XMJA 4EEYA 2MZJA 1KQQA 3W2VB 3VQEA 3VC8A 2PMWA 4JV5F 1C0TB 2PA8D 4X5VA 1QVFR 1DT9A 1HA1A 2IBOA 4RQ6A 3CCVS 3MDCA 3HJVA 2WK4A 3MEEB 1YJNN 3S01A 1CZ9A 2BM1A 2DNHA 2X74A 2NLWA 4DTSA 2HIQA 1KR4A 1WBBA 4FM1A 4H5TA 5EOYA 4P7TA 2UU9K 3CJSA 3J81Y 2ASOA 4RWXA 4UY8O 3Q8SB 5A0YA 2B4PA 4WTYA 2B6GA 2BBEA 1H73A 5IZHA 3WKAA 3JPRA 3JSMB 1XO0A 5F3ZA 2Y9TA 1ZM3A 3VZIA 3TX0A 3ILLA 5F9LA 4YDXA 2Q1NA 1FD8A 2YI1A 4A57A 2YNHB 5GIPA 1UZHA 3FCVA 1Q18A 4BXOA 3CFRA 4TYBA 5HP1B 4JI0J 4FL9A 4DR2K 2J0QD 3M1VB 4YN3B 2R18A 5LMUF 2B4VA 4BE1A 1HMVB 2BKPA 2ZHOA 1SB6A 1AZSB 4NLUA 2KB2A 4UAUA 1XR7A 3I8BA 2UUCF 2CG8A 4DV0J 3BGRA 2XLIA 4DZ6A 2HHSA 2XSFA 5BR9A 3T9ZA 2BDUA 3ONQA 2WHOA 2DRAA 5AKLA 1WSJA 1NZAA 2E3TA 9ICVA 1LW0A 2ILZA 1AROP 2QA4S 3PCOB 3MEEA 5CR4A 3HILA 1KQKA 1EP4A 4X2BA 4RQ3A 5F3XB 3M1FA 4CHZA 3IKMA 1VJ5A 2CDRB 3TADA 3RBZA 3D7EO 3ITHB 5T41A 4NOHA 2O8CA 3K1ZA 9ICEA 3PV8A 4K2XA 3LDSA 4PZVA 3CPEA 3K59A 1QQ5A 2ADBA 2GO7A 3HHKA 1WNSA 1BC6A 1YQHA 3T6JA 3AV9A 4QU7A 4EFHA 3PHEA 1YF5L 1GTEA 1HQ2A 3GYGA 1NCLA 3C2KA 1HBUA 2Y8WA 2CDQA 4KHQA 2H9ZA 1M90O 3SUPA 2GHVC 3OTOK 1RYUA 4I2BA 3KWIA 3DU6A 3CO0P 2VBWA 3WNHA 1HI8A 3ET6A 4DPTA 3CD6N 1X8DA 5HJXA 1I3OB 8ICFA 4I29A 2VUGA 1BQXA 2JEFA 2JWKA 3KLVA 1L7NA 3GE9A 5KT4A 1T95A 2FSKA 5H9FJ 1RWNB 4OGEA 2YQEA 1YJ9N 1QQ6A 3EW9A 4USAA 3LDNA 1XNRF 2G5IB 2K4HA 2MQMA 4YNQA 3UDVA 2J0XA 2J8AA 2RE2A 2A40A 2GHWA 4QIWF 4YQWA 1NG9A 1S4FA 4LF8J 2HNDA 2K8AA 3A8KA 4JYAJ 1O0PA 2RF2A 4K50A 2WVEA 3OUYB 1SQGA 1W26A 2PFUA 4LF1A 4BVOA 1F21A 2YKNB 2FPLA 2YNGB 4RO0A 3OVSA 3R97A 3U1MA 4M45A 4A8XA 2HZAA 1L3SA 3TABA 3GTYX 2BVZA 3CVKA 2JNJA 4RQ1A 4C0ZA 1J5EJ 2G8IA 1ITGA 2F8LA 1C0UA 2ZD1A 2CWXA 3RB0A 4WF9Q 1S9GB 2MEWA 2GV1A 3MM6A 2KZ3A 3SBTA 3ENWA 1VAZA 5DB7A 2JWLA 1J2VA 2HF4A 2YX8A 1UPPA 1N5WA 2IRUA 1BG3A 5KQ8A 4PGXA 1SC3B 1FIQA 3AJ2A 2WRMA 2GW8A 2NSCA 5I4MA 3AD8C 3OL8A 1OS5A 2QJ3A 1TUVA 4BWJA 4DPOA 2E1FA 2X6SA 4M04A 1VQNN 3TUPA 4TU9A 2HMIA 5KAIU 2AW0A 2ZH5A 5C24B 1B7FA 1T6DA 3MAAB 4JK8A 2ZH1A 3QB0A 3RH6A 5GAHU 4F2SA 3JPQA 3BKUA 2IBKA 1TE2A 1ICEB 5F0UA 1U49A 1W9HA 3HK2A 2W3SA 3HJFA 3EGNA 4HI1A 5J0TA 1YBAA 3BQ2A 2AP1A 2D3ZA 4OQJA 5HMXA 3D0HE 5F0XA 4LR9A 1KN6A 4KHWA 4WJBA 3TP2A 3NL0A 4IQVA 2GX8A 2JV3A 3CUNA 3VZHA 2CRXA 4D3HA 4GKJK 3AQPA 3EGVA 4F9OA 1HBUB 1IBCB 1SC6A 2BZFA 3SDEB 4PHPA 2JHEA 1ATRA 1SV0C 2K1RA 4ILMA 2HEKA 3AL0B 5LMUK 2GCFA 4M6WA 1RT1B 2W4CA 2E5LJ 2O4IA 2QEXN 1X9XA 3D6HB 5ETMA 3O1WA 2MUTA 3CYMA 1HKAA 1OKJA 3LQVA 3DN9A 1IG8A 3NCPA 2IM2A 4IZ9A 3RJMB 2VA3A 3K17A 2DHSA 1FXXA 5J2AA 4ZJLA 1X5OA 3J80U 2DGOA 1VCTA 3AH6A 2ZH7A 3VR1A 2Q79A 2ZQBA 4X66K 1HNZJ 4FZXC 1WD6A 4ZVHA 3AVAA 3RRKA 1SZHA 2DQNB 3ZZYA 4AT1B 4FJJA 3EWAA 2XZDB 3CCVN 2WB1F 1VRTA 3AJDA 3L8BA 5LJVA 4AL7A 2HNDB 3FNNA 5H1SV 4ZPCA 3PG9A 2Z1IA 1X60A 5DM6Q 1Y3JA 1EARA 1RT7A 1WSVA 1CJTB 3C94A 3M30A 3C23A 3P3DA 2MKCA 2A1JA 3HZ6A 2R2SA 3DM2A 2DR5A 5EDWA 4JNEA 2BA9A 4RQMA 2FVQA 3CIMA 1S79A 1VSEA 5L1JA 4IRDA 2E88A 4KLHA 2QWMA 5F3TA 4WFYA 5AQJA 2DNOA 2LYAA 4GXKA 1BQMA 1SWVA 2LXUA 3DXKB 4BXOB 2FMSA 3OA9A 4TSXA 4FYWB 4DOZA 2DHAA 3UD4P 4AHRA 3MN6A 2DYAA 2DUYA 1HMVA 3DLKB 4Y28C 4GC6A 4QPXA 1VQMS 2EH9A 3LP3A 3D2EB 1BPZA 4YY3F 2NQPA 1KFTA 2LMRA 3DLLL 3M8SA 2QWPA 1RCXB 1UEVA 1VI7A 4CYUA 3O4NA 3BJYA 4NA2A 2HI0A 3OHBA 5IC6B 2UUAF 3CETA 3MC1A 2L41A 4L3QA 3C21A 2AX0A 4QW8A 1GLCG 1Q81O 3VAIA 3GIMA 2XIDA 3ITHA 2GJ2A 1QQCA 2BZ2A 1HKGA 5AK4A 2LQ5A 4EX6A 4DFMA 1XI1A 1NK6A 4CT9A 1HKCA 2QMUB 1RI7A 3HP9A 4H5RA 4DL5A 2V5HG 1WOPA 2E5JA 4FOIA 1KVCA 2QLJB 5A6PA 1Y5NB 2DXDA 3A0IX 9ICCA 1NOMA 1SVDA 3W65A 4DI6A 5KAFU 2QLTA 5BPCA 4CGDA 4KJIA 5MLCQ 5EX3A 1VQ4N 3H98A 4DV0K 1SV5A 3RJEA 3H8WA 3JQKA 1RT4A 4DZDA 5DZ7A 3BQ1A 2QARB 4RNMA 4DFJA 3WIUA 1RWXB 1NPRA 4C7YA 3F9MA 3G71S 7ICGA 1ZAXA 1YK9A 2R8GA 4A4JA 4EYHB 2XHWA 3QO9B 2ZUCA 3PSTA 3BS9A 1WSFA 2XO6A 5J1EB 3O9UA 4I2GA 1RLCL 4MIAA 3M8ZA 3SR6A 3VGMA 3R7BB 5E3QA 4HKQA 3TJ8A 4DQ8A 2BKNA 4DR3K 2ROEA 2AEMA 2MPUA 3I55S 4OI0A 5ALRA 4P2XA 1YJVA 4HUFA 3SEIA 3HHNB 4DUZF 4LSLB 2P9UA 3NG8A 3TVZA 1XC3A 2D9OA 3R5CA 3V9SA 4LBIA 2AXTU 8ICJA 2E5HA 3AA8A 3K0JA 2NZCA 2IS3A 5J0WA 4ZLNA 4FF2A 1H2TZ 1Q53A 7ICMA 1FWLA 2ZGZA 3PR5B 4C8YA 4Y3CA 1ZTTA 1BWVA 2MGZA 4ALZA 5C2GA 2KRRA 4A59A 4B3OA 2QWQA 3HULA 3QX7A 1RBUA 4GFJA 3ZEUB 2J7WA 2HBQB 1IJEB 2I6XA 1RT7B 1OQ6A 3ZSYA 4X4QA 5GMKa 3EY1A 2KSOB 4Y2TA 4RPXA 4GMKA 2FC8A 4FF3A 4KLSA 4WQ5A 4CGHA 4OHXA 1L3KA 4CH7A 4FBTA 4DHVA 3DOKB 1OPZA 2H4WB 1VRUA 3FE1A 1EJ7L 2UV8G 4EUVA 1HNXF 3CERA 2KN7A 3J81j 4ED0A 1BD6A 3R1HA 3SBGA 4LVOP 3JSRA 5BR8K 1J5OB 3AY0A 3HI0A 2HNYA 4TN2A 4Y2JA 1C4CA 4NMLA 4M5GA 4RBVA 2NR0A 2EEYA 3ZSXA 4IC9A 1WOSA 2VWBA 2PXIA 3O3HA 4C80A 1UETA 3O4QA 1Q8BA 4MH8A 2H3IA 2DGQA 3V1RA 3ICXA 1HBMB 3PJWA 3KKFA 2DFFA 1XNRK 1LWCB 4DV1F 5SWMA 3NS6A 1S1VA 1ZM2A 3BZCA 1NPPA 2WUSA 2J76E 2ZDPA 1BPBA 2M88A 4Y6IA 2BCSA 3QIOA 5JVGL 2Q4TA 4EBCA 2BGGA 1U2FA 3E9PA 4AYBC 4O5BA 2W9MA 2R7RA 4M3ZA 4A5BA 4Y34A 2AGPA 3KK3A 1HWUA 1KSPA 2UVWA 1NWKA 4OGCA 2WFBA 3BPDA 3IBPA 3SI8A 4CF2A 3GIJA 3NCIA 3EWGA 2LBOA 4DCPB 5D15A 4H4MB 3D28A 2YMLA 4KLGA 4GV3A 3M9NB 1S7HA 3CCSN 4NLTA 3KHHA 4BRIA 5L9XA 1LNQA 1TFYA 2WTUA 5CYMB 2PFFB 2DNGA 4FJIA 3BB5A 3NHGA 5J0YA 4X65F 1TL7A 5E26A 5B0FA 3ZTRA 3CMAS 5IIIA 2HMIB 4CF5A 4RNOA 4ILGB 7ICHA 2DXFA 1S6QA 4CO2A 4JMUA 4J9MA 2ZITA 3LL3A 4CNQA 1RK8A 2GWSA 3R1LA 1WBDA 4FWPA 1JUDA 1P1TA 2KO1A 1D5AA 1F9EB 4A5AA 1KD1O 3OD2A 2YX4A 3THPA 1KQGB 4OI6A 1MROB 1EQMA 1RAEB 5GAEP 5HRPA 3ZZ0A 2KL8A 4PG4A 1RQNA 4UZBA 2VU5A 5CRXA 3ETLA 4CDGA 4PWWA 4PQUB 5J2PA 2QB0B 3JYTB 4N56A 3DXMB 2ZTEA 1N36J 1R3NA 2QLFB 3P83D 1X42A 1G99A 3C7NB 1WUUA 1VK0A 3WHIA 3GV8B 5E0OA 1SUQA 5ALFA 4KN4A 2RDIA 5GVQA 5ALKA 4K4WA 2O8FB 2JH7A 3C6TB 3A8EA 1GLFO 1BI4A 4EHUA 1VSFA 3E01A 4GVLA 5DQGA 1DXSA 3OV7A 4BGBA 3D6MB 1FRIA 2ES6A 1PBAA 2E5SA 4B3TF 1OSDA 5CZ2A 4MYTA 1EKRA 3V5RA 4HLBA 1JJCB 4RQ8A 1ZPVA 3C19A 4H0OA 1X6IA 3RSEB 2FJDB 1HW9A 1L3TA 4DR2F 3CCRN 3R6GB 2A0FB 4CLSA 3O9RA 2XWXA 2WVFA 4FS1A 2G4BA 3W1YC 2M0GB 4IO1A 1TYQA 3MURP 3VAMA 1SKRA 3THWB 4CEQA 4O3PA 3KDOA 1IBLK 2GJIA 1GK8A 2YHYA 5FLXU 1PO6A 2VB6A 3PJXA 3AGRA 4NCAA 1N34J 1BPDA 2ZIXA 4HUGA 2PY5A 2KSOA 4DTPA 2UXBF 2PI4A 3CDWA 4ED5A 5K8PA 2LFVA 3B82A 4KLOA 4B3TJ 1KAZA 4CEBA 3H2LA 1NZBA 1H2UX 3QEPA 4O0JA 4B8CA 5JLFA 1N52B 3RUBL 2FC0A 1KLMA 3S8SA 1LWEA 3Q8RB 2R42A 3G6VA 1DLOB 1Z4UA 2F8SA 2D0AA 3EM1A 1VQKN 2GGPB 1RDWX 5ALGA 3GB0A 5AJ3J 3DI6B 1Z05A 1N36F 2JH3A 2OPSB 2JSXA 5H9EJ 2P66A 5E3RA 1KTVA 5CHGA 4N76A 2FDNA 3ZC4A 3NBPB 3ZZPA 4B9TA 4LFAJ 2JR5A 3QUBA 4DL7A 3MR7A 1V9OA 2PYLA 4WKYA 1VOMA 2FXUA 1LKYB 4DQRA 3GILA 1DK2A 3OYBA 2XY7A 3N6LA 2MAXA 4IQWA 1X9WA 1A6SA 1OSCA 2OLWA 1H74A 3HX9A 1S5LU 4X62K 1Z2ZA 1M5PC 3H3NO 3OW2M 2KHDA 5GMEA 1KBUA 4BRLA 3QBWA 4O5CA 3G8TA 3AEVA 3SYZA 2GH1A 1U1PA 2KHCA 5AJ3F 4FCYA 5K4LA 2YNHA 3VGTA 1EAYC 3I9ZA 3OY9A 1DQAA 4LSZB 2R8IA 2AGOA 2G2ZA 1RAOA 2CN1A 2IC3A 1DGJA 3CCRS 3IUCA 3MR3A 4A8KA 4FVMA 3PYFA 4TLRA 2RQ5A 2ZVSA 3I9V9 4DX8H 5GAEI 2IOCA 3AD7C 1T9YA 3ISND 4Y2KA 3QO9A 4F92B 4FJGA 3CNQP 5J1EA 2ASMA 2C42A 4GV6A 5C2DA 3DRYA 3KKAC 4HI2A 3CO9A 3EKSA 3PSIA 4I9QA 2LEBA 3RAXA 1N32J 5HAOA 4OJ3A 3C5FA 2ZH8A 4C11B 4I68A 2VA8A 2BANA 4C4TA 2OFGX 2ZJ5A 1LK7A 3KHYA 1V85A 5J2DA 1LK5A 3ZSOA 1TAQA 5KRSA 3BYRA 1O5JA 5AFUH 3Q2TC 2B5JB 2RRAA 3HSZA 1WUDA 1SL0A 2ZNZA 1X4CA 2AKWB 3GZFA 3ISDA 3TX8A 4DUTA 7ICRA 5ALJA 3Q86A 1WOOA 5KFCA 1RZTA 2IRXA 1SV0A 2HWHA 5BREA 4CEOA 2H4YB 2K4IA 3KOOA 1U09A 4EO6A 2BQ3A 2WW4A 1L7MA 1RTHB 2HQIA 2ZH3A 1NBWA 2VH7A 2E5GA 8ICGA 3RJKA 2PMZC 4CGJA 5ETQA 3MOJB 4N41A 1WACA 3FC4A 1EKSA 2A3JA 2V2QA 4CD1A 4WIQA 1SKWA 2OTJN 4ZHRA 3FJ2A 3JPPA 3E8OA 1T9XA 3N28A 6AT1B 1A5WA 4QBUA 3AVJA 2EZYA 4ZS6A 2E9TA 3OSNA 5FPEA 2KZZA 1DQ8A 1A6LA 2NRRA 1WKLA 1S99A 4JS5A 5EGYA 4G9BA 5J2EA 4A48A 3KJVA 1QAIA 2FZCB 2Q6BA 3H8YA 1XERA 4QR2A 2ZZNA 1MU2B 5DGBA 4CECA 5HVFA 1D9AA 1ZQPA 5J2MA 4R25A 5DG9A 3MPUB 4JI4J 3AUOA 4RZRA 2HF3A 2BJ8A 1WAJA 4UB4A 4IO9L 4FJ7A 2RE1A 1LCUA 2C3PA 4FWMA 3BS5A 2OEHA 3DDHA 1FCAA 3AAPA 1RT6A 4RT2A 3C2PA 1UVMA 3HKWA 5JS2A 2GMJA 5F0WA 4M5HA 2RT3A 3IRXB 2ZOGA 3PR4A 2DGXA 4KLEA 2DY1A 3GDXA 3CCUN 3MDAA 4OZ5A 4IFYB 2RDJA 5ETPA 2KZMA 5CYJA 4KHPF 3VERA 3F5EA 3DEEA 4CK3A 2CQHA 5AQUA 5D8HB 2F8HA 1YBUA 4MO4A 4YVZA 4DV6K 4EWTA 4B8AB 2F77X 4HAIA 3OFGA 2Q3SA 3D67A 3HX0A 2KHQA 3NS7B 3W5ZA 5DJBA 3W2VA 1FE0A 3SIPB 4H5NA 1DTTA 1BLUA 2R7VA 2GWKA 3A1YG 3R5GA 2KU7A 4ZPVR 1E6YA 1Z4OA 2FMPA 3MMAB 1BGXT 3MEDA 1WDTA 2NXEA 1YITS 3BS5B 1CLFA 4J8FA 2HVIA 3FGUA 1V9PA 4PUOB 3KHLA 3OFEA 4B3OB 3IS9A 3EYZA 2M2BA 1VBZA 3FZBA 1VQON 1UCNA 3DXMA 4PAAA 1K6YA 1HW8A 4L74A 5ALTA 3H42A 1C1CA 2FLPA 2KLAA 3D2SA 3GIRA 4WTOB 4MDAA 4A61A 2VANA 2UXDF 1YTUA 4GO5X 1C20A 2LLZA 4DBQA 3J81O 2HSEB 2W25A 4B1YB 2FE9A 3P49B 1REGX 2XWYA 3PW4A 2DKXA 3F44A 3BN7A 2YN4A 1FD2A 1TAMA 1HNIA 1F9HA 3PW7A 1O51A 2B9YA 5ALDA 4UW9A 1YDLA 3S3NA 4QR1A 1NM1A 1NOZA 3SBMA 1OYDA 5AM5A 4C7ZA 5CY4A 4GXJA 2F4VK 4LF7K 3AA4A 1X4AA 3QT8A 4QNLA 1XMOF 1VQ8S 2O8EA 3QIDA 3MM5A 4KH0B 4E7LA 3O08A 4E7KA 1RE1B 2P9LA 2D69A 2H5IB 5AHXA 1FKAF 1FFWB 1TUUA 3UPFA 2PGCA 3FCHA 2Q66A 1NU4A 2ZGYA 4BG9A 2F8MA 1ZQLA 4OJPA 1B0TA 1FVQA 4AM6A 3MM6B 3TUJC 3QNMA 1YVNA 2G2YA 1RDUA 3ZZOA 1ZQSA 4LZGA 4XH4A 1KFDA 5F8JA 4KH6A 2HYIB 5AIBA 3ZLJA 3KDNA 5IT4A 4OI3A 4L72B 1FJGJ 4Y00A 2DNQA 3CJ0A 3V9WA 4G1QB 3CC4S 3CD6S 3HSDA 1W7WA 3MEGB 2HQDA 4J37A 3LPTA 4LSNA 2QL9B 1T7PA 4Z4GA 5LL6Z 3E58A 1TK8A 2BW7A 3I6PA 2LA6A 4URQU 3LDPA 3PKYA 3O9TA 4LBPA 5A2QO 2HS0A 5B09A 1FX2A 5BXIA 5B5EU 3HSTB 3LO3A 2V51B 1ZRMA 5AK5A 5KFVA 1HRHA 2GO8A 2GELA 4M1KA 3CMEN 9ICGA 4U7CA 4DR1J 4CLPA 3IBWA 1DY3A 1U45A 4KY3A 4UF4A 2ITGA 1J5OA 1OY9A 4P52A 1QHTA 1I94J 2MQNA 2RRBA 4I6WA 2V8GA 3FQLA 3ZX0A 3CFOA 4BR9A 1I5OB 2CPIA 3F2DA 8ICYA 4UOCA 2X6NA 5I9EB 3KUEA 2B4OA 3AQEA 2HFOA 4NLRA 1ZOTA 2UVRA 2ZWHA 4DLEA 1GOBA 2IC3B 4LRCA 4LF6J 4A8YA 3AXKA 1NGFA 3LTOA 2ZNYA 1IBKF 1WG4A 3QE9Y 1HWIA 4ECYA 5IILA 2NXUA 5AICA 5DM7L 4RUCA 3GCWP 2HQCA 4Y2PA 2BDPA 3TO8A 2QE5A 4OJRA 5IWAJ 1ELOA 2IJFA 3VQSA 5BR8F 2QXLA 2X51A 1RWKB 1VC0A 2KJ5A 1CPZA 1S77D 1S1WB 2FLOA 4ZPDA 4FJ5A 3QERA 1NK9A 4XQ8A 2VQEJ 2E1AA 2B6AB 2XI2A 5KFGA 5J0OA 1ZQIA 3QEIA 2ZOMA 4ID1A 4MKAA 1B64A 1KAYA 2LQ9A 1IBKJ 2HFZA 2KJWA 3FBBA 5LSRA 2V34A 1PZNA 1WF2A 4QCLA 5AZIB 3UB5A 4NXNK 2KKPA 1X66A 4ZN1A 1FJCA 3KG1A 3KNAA 3LPEA 3Q24A 4CBWA 3AOCA 4R8UB 2FPHX 1P9YA 2ZH9A 4TKTA 1RWMB 4K4YA 5AQYA 4QZEA 4YG2A 4JBCA 4Z7CA 2LEAA 2MLZA 4FP9A 5AE2A 4BC9A 3KLHA 2R7SA 2FB0A 1RBLA 4DV6F 2MA1A 2WHEA 1S9FA 1HLWA 3KZBA 5HLFB 1S22A 1YLXA 2CKWA 1DFDA 3CIZA 2KT2A 3H20A 4NLOA 2VC0A 4ISEA 2NCKL 1VDHA 3S41A 1SPBP 1RXWA 2AJ4A 1BI4B 5HMLA 5FLXY 3SJHA 2PFPA 5KAKA 2FIUA 1MC8A 4W92B 3OYDA 4CHPA 2H65B 3WNEA 5A2QU 1NH8A 3D68A 5A2QY 1JKHB 4QWCA 5KFSA 1P8GA 2HRTA 2VGMA 2K4PA 2L9WA 4USUA 4BHQA 3M1YA 1D8LA 1NJZA 1X5PA 1GMVA 1R6YA 1R31A 3KNGA 1SB3C 2HAFA 2JH1A 3AAQA 4DV0F 4AP9A 2XMKA 4F67A 1VIOA 3P4UB 2CADA 2ZF5O 4O44B 3MUMP 1RTZA 1U1LA 2D1KA 2PYJA 2Z58B 2XNRA 2YKNA 5J2KA 4M5MA 4CO5A 3SJJA 4CIOA 1GFWB 1IBMJ 1GXLA 1TVRA 2KE7A 3A4TA 3VAJA 1T05B 4Q43A 3EE3A 2Z1JA 1RP5A 3WUHA 1Y0HA 4V19S 4YOTA 1YG0A 1CJVA 4O5KA 1KW4A 5J2IA 4RL1A 3D0GE 4CFDA 3M30B 3KG0A 2CJBA 2H3ZA 4RW7B 2XY5A 1NLKL 2UUCJ 4CZHA 2VKQA 4LF4K 4DUYF 4IRKA 5KFUA 2CYYA 1E6VB 4ECTA 3EZ5A 1CLQA 1GX6A 4CJWA 2CFXA 5HP1A 2XGPA 1NH7A 3D6TB 1AT1B 3R7SB 3AXMA 3T1YJ 3S3OA 1PJ6A 3B6PA 2YCHA 1ZQ1C 3FR0A 4ZJOA 1NLVA 2XG8A 3EVOA 2P35A 2I5HA 4DL6A 2C2DA 4DV2F 5E7OB 1EO1A 5GAHI 4F0KA 1FE4A 1XJWB 4YMOA 1HNVA 4G1IA 2J6TA 4J9PA 5KG6A 1TKZB 2WB1C 4DG1A 4PG5A 1U0SA 1CI4A 3AVLA 2VYPA 4CZFA 3MXMA 1NJIT 1K47A 4KIAA 5EOZA 2G0CA 2KQ2A 2YH0A 1C1BA 2ACMA 3QICA 1F44A 3ATVA 5HJYA 2HBZB 4F4AA 3TEGA 3P96A 4ES2A 3BGUA 1RILA 2IM1A 2MRLA 3EGZA 1WSEA 1BWEA 8ICMA 4ZPWR 2MY8A 1HFEL 5IT9U 4KGMA 3DLEA 4KO0A 1SQEA 4A8QA 1MWQA 1IKYB 3M2RA 3DOKA 4NLPA 5ALZA 2YKMB 2WSFC 1H38A 3CPWM 5D4LA 1N6QA 4L3NA 3T5KA 4DR3J 3V9XA 1YJWN 1DARA 2XTJP 1P6TA 3JAMO 3EDQB 3TA1A 3CC2N 4H4KC 2QC3A 3NVKA 2QKQA 4DR1K 4KAZA 5AI0A 3E2EA 3GYXB 1SL2A 3B9JA 4F5PA 1VQ6N 2ZJ8A 5J8YA 1UWAA 4R5PB 3HVWA 4DJBA 4A8SA 4B1XB 3VF0B 4JAXA 1X40A 1NKEA 5DLGA 4WP8A 1U2VA 4KLLA 1OIAA 2HBJA 3DXBA 3WK8A 5A0LA 5KFXA 3V2UC 4LT6A 4X64J 3AODA 2P5OA 4KHMA 2FC9A 4QR0A 1FJGK 4Z37A 2QEXS 3FBCA 3PSFA 4OLAA 4PXEA 1PGZA 5DG8A 4YORA 4BR7A 3MX2A 2K2PA 2R7OA 5I42A 2ZKTA 5CD4H 4FJ9A 1VLYA 3DI6A 1F5BA 3MGHA 4J91A 3A13A 1BMQB 4WFNL 3AVNA 4ETZA 2GAHC 5EWFA 4H0XB 1YWXA 1QD1A 2CH6A 4MFCA 4RW9A 2MSTA 5DM7Q 5CZXA 2E2QA 2E9RX 2IVNA 4BRPA 3WT0A 4CTAA 2WF9A 1UP1A 2DGUA 5J2HA 2IJNA 4X62F 3WQTA 3J7ZO 1N4LA 3M5RA 1S5ZA 3TUIC 2Q2RA 1EQYA 4KGKA 2LEPA 3BGFA 1C0UB 2J9CA 3IM1A 8RUCA 3RMDA 3ZDCA 2YBVA 3KZXA 4CLZA 3OTCA 3UDEA 2E2NA 4M9LA 1RDDA 2O1PA 5EE0A 2ATCB 3CMQA 4OYXA 4FF1A 1C6VA 1ZD2P 3PNIA 4MK7A 3M4XA 5AJ3K 1M90T 3WNFA 2ZBCA 1FRMA 1IQZA 4K59A 3AVKA 2ZIUB 2N7CA 5KFMA 1IXKA 3KXDA 4BREA 3ET6B 3T69A 2IA0A 3IV6A 1CVJA 3SQ4A 2BOAA 3WKCA 4CEFA 1NDPA 1XMOJ 2ZJPL 1COOA 1P8ZA 2KTQA 4EEKA 2RQCA 1LAWA 2YHBA 1NGBA 4KTQA 2HGNA 2RQMA 3MTKA 3R5BA 1JJ4A 3HSGA 4EI2A 4QIFA 1Q16B 2WOMB 3N9UC 2KG0A 1PILA 5D4OA 5AQWA 2NV3A 4OLBA 2I38A 5IT9Y 4ZDNA 3RAMA 3CCMS 5KQDA 4P71A 4QZGA 4CH1A 3U26A 4ES3A 4UB3A 1NNLA 3LPUA 5J1PA 1OUQA 2E4LA 2CJXB 5KT3A 4XPEA 3IR7B 2C2EA 4DPXA 4MEYA 3OS2A 4FNIA 1FTCA 4PHAA 7ICSA 2UXCJ 4ID8A 3SENA 1EXQA 1UPHA 1KOHA 1CJUB 4CGFA 2F9TA 2VJ5A 2IA6A 1T3NA 1VHFA 1KXPA 3H5YA 3RWUA 3VQ8A 1CS4B 5FD1A 3M6UA 1JLQB 1WSHA 2EFVA 1SS6A 2V6AA 4GNIA 4OV1A 1U2VB 2J9DA 1J6ZA 1ZQEA 3LDOA 5IINA 1GOCA 2VFSA 3NVVA 4HTLA 1CQMA 1FRHA 1IR1A 4LF5J 2F1HA 2RQ4A 1LWXA 4CJSA 2KJ8A 4MMOA 4PXCA 2I5JA 4CIEA 4O0IA 3BSAA 1RUSA 1FW6A 2XCPA 3TVYA 2CGLA 1YHQS 3M8RA 1NJWA 1U04A 1JN3A 1FK9B 2ZIVB 4HL9A 1NDLA 4OYMA 2UXDK 1N34F 2E29A 3NNAA 5GTIU 2VFRA 3BO4A 5L1LA 5EVZA 1RDFA 1SJFA 2DNMA 3N0VA 3OTDA 2RVJA 2PMHA 1RJJA 4EX7A