1L5UA

Crystal structure of bacillus dna polymerase i fragment product complex with 12 base pairs of duplex dna following addition of a dttp, a datp, and a dctp residue.
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*AP*C)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l5uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l5uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l5uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l5uA01
2XGPA 3Q8RB 4FW1A 1PZNA 4J9LA 4W5NA 4CJVA 4M3RA 5L9XA 4XA5A 3HYFA 1ZQQA 5KI6A 1K1QA 1RPLA 5DLFA 4EYHB 1ZBUA 5DG9A 1A5VA 4CGFA 9ICWA 4YR0A 4Q45A 5F9NA 1ZQIA 4DQIA 2IDOA 4KHQA 3MR3A 1SL2A 3EZ5A 5DKWA 4B9NA 1T05A 1VSMA 4RQ1A 2GBZA 1ZQAA 1JMSA 5IILA 2F8SA 1C0TA 1UOCA 4UBCA 1N56A 2R8GA 3T1AA 4YR2A 3OYBA 5J2MA 2VA8A 4O5BA 5KG6A 1S1WA 4KHSA 2KW4A 4EBEA 4Q8EA 4PA1A 4RPXA 1ASWA 3AO1A 4IFVA 1UA1A 2W9MA 2RKIA 3RMBA 1YTAA 4MQ3A 4FJIA 3QEVA 3BQTA 5FROA 4FJ5A 1VSDA 4F4WA 2XGQA 3QNNA 4M9HA 3OVNA 5KG7A 4GW6A 1WNSA 3UQ2A 5J0QA 2ASLA 5D46A 2OWOA 3T5JA 5T7BA 1N5YA 3MEEA 1ZQGA 3N4MB 3DI6A 3TAEA 4I2AA 4GLXA 1ASUA 1NJZA 3H4BA 4XUSA 4RQ3A 1ZQSA 4XIUA 3VQ5A 1XHXA 3MBYA 5KT4A 3RWUA 3E2EA 4UB2A 4PWDA 3V72A 3U3GA 3V6JA 1DTTA 3LDSA 3C1ZA 2VG6A 1ZYQA 1ZJMA 3H7IA 4DL2A 2DPJA 3CFOA 4QOZB 4I9LA 1S97A 3PX6A 9ICCA 4HUFA 3SV3A 8ICXA 1BIUA 3P83D 4CGIA 4ECYA 2ZJ8A 2HHVA 4CIGA 1EETA 4QWAA 8ICMA 4RQ0A 4M3TA 5L1IA 3OYDA 2IGIA 3PNCA 2IHNA 1VRUA 2DY4A 1JKHA 8ICTA 3RMCA 3QLHA 2C28A 2B4JA 5KRSA 4M9GA 3PW4A 3HX0A 1BPYA 3OYGA 5JS1A 3OYHA 4KLDA 2O4GA 1K1SA 2P51A 1WSEA 2ZQBA 3ZSZA 5IINA 4KLTA 3KK3A 4F50A 1JIHA 4UB5A 3D45A 1U48A 3TANA 4KB0A 4FJHA 1MC8A 2W8LA 4DSJA 1T7PA 4BXOB 3RH5A 2BPFA 4BXOA 5J2EA 1ZQCA 3NH2A 3L2UA 5J2CA 4DTXA 4F5RA 8ICEA 2Z1IA 4B8AB 4DQSA 4JK1A 3G6YA 2IC3A 4DF8A 3UXNA 4NM1A 3T5KA 2PFPA 1RT1A 3TI0A 1D8YA 4CEEA 1KFDA 4CEQA 5DK5A 1KFTA 5J2QA 1Q9YA 1BHLA 4KLSA 4IKFA 1D9FA 3DLKA 4E7KA 3CFPA 3OYKA 3KK1A 4AH9A 1CZ9A 2UVUA 1NOMA 4F3TA 4RQ6A 5D4BA 4UB4A 4M45A 1EX4A 4J9MA 4KO0A 2KZ3A 5KG3A 4RW9A 1C1BA 3QZ7A 4Q5VA 2IA6A 4PHAA 8ICJA 5KFAA 5DBCA 3OJUA 1VSKA 3LP3A 3DOKA 2FMQA 4FBTA 5HHIA 1S1XA 2ZE2A 1XSLA 3OYMA 4FJJA 3RAXA 4MF2A 2YNFA 1IXRA 7ICTA 3MFIA 3SPZA 8ICGA 4DS4A 3LAKA 2ZUBA 3MXJA 2J6TA 4W5TA 4NLZA 2YV0X 9ICQA 4QZCA 3QO9A 5DLGA 2QKBA 4TURA 8ICHA 4HHTA 1D8LA 2XY7A 4DS5A 3C2KA 3QEWA 4KLJA 2C2DA 3BQ1A 4QZAA 3OHBA 3LP2A 3RTVA 4CEZA 2BDPA 4ED7A 1LWCA 3SI6A 2Q0ZX 2JLEA 5DG8A 2X74A 3NF7A 1I3AA 4M9NA 3L2WA 5J2HA 1XU4A 1RT7A 1J53A 1LB2B 4F4ZA 2BCRA 4E7LA 2WONA 5C5JA 4OPJA 2HNZA 4O0IA 2AU0A 3H8WA 5KFVA 3M8PA 3LZJA 2XY8A 4JLHA 4NLGA 5D49A 3BQ0A 4FJ9A 4KI4A 5CA7A 2F96A 3OY9A 3VA3A 3TAGA 4E3SA 5EWFA 2Z1HA 4BGDA 2F1HA 3C23A 2ZUDA 3LANA 4RT3A 3TAQA 4IDKA 3ZSRA 2G8IA 3V7KA 4CEFA 1S9FA 3C2MA 3KLHA 4O3RA 4I2HA 2BE2A 1JLQA 4C8MA 4FJNA 1TKTA 1RTIA 1ZQOA 8ICUA 2C2RA 1JXBA 3D0PA 4JRQA 4Q0BA 4Q8FA 5CYQA 2FC0A 1TVAA 4JS4A 4C8KA 3ZSOA 1ZQJA 4CESA 3V4IA 1A5WA 4BACA 4CF8A 4QZGA 3AVCA 7ICUA 4EYIB 4N56A 4KHYA 1NJYA 2OZMA 3RJIA 4FLYA 3O3FA 3IM1A 3ORYA 4E1MA 4FLTA 3QEBZ 2R8JA 8ICLA 4YMNA 4KLLA 4R63A 2BCVA 4FZZA 1RNHA 7ICEA 4OLAA 2NRZA 3VQEA 4CJSA 2JZBB 4KRFA 5KT6A 1XC9A 4NLKA 2JZBA 4CEAA 3ISDA 3I0RA 1VSHA 1ZQEA 2RF2A 4E19A 3AVGA 1RBSA 3WNHA 5HNKA 1BL3A 2G8FA 4MF8A 4K8XA 3O3HA 3NDKA 2DFFA 4J9NA 2BANA 3AVHA 1TL3A 4Z4IA 2VANA 1Z26A 1HQEA 3JPPA 1XHZA 1Y97A 4DU3A 2VG7A 4I29A 4GC7A 2XRIA 4CERA 1ZQVA 4PH5A 5KFTA 3JYTA 1NK4A 3ZT4A 5J0XA 4DSEA 4PY5A 4F2RA 1S1UA 4CJKA 3AU2A 3VQ6A 4I2IA 4O5EA 4PHDA 4RW6A 3OYEA 2NRVA 3AO2A 4IRKA 3I8DA 5DGAA 1DGSA 5KFCA 1SUQA 1UWBA 5SZTA 4JUZA 4RPYA 2A1SA 3OS2A 3NGIA 5BOMA 1RTJA 4QZEA 4F91B 4KN7A 9ICIA 1U4BA 3L8BA 4DSFA 1LW0A 1I39A 5J0OA 3B6OA 4CJ4A 4M3WA 4CGDA 4CFDA 3QEIA 5KFEA 3EW9A 2HVHA 4J9QA 3Q8SB 5L1JA 3EY1A 5J2IA 2FBTA 1HJRA 5F9LA 1L5UA 3LAMA 4YG2A 3GV8B 2JEFA 4FJGA 4QZIA 4CHNA 1QS4A 1KRPA 3VQBA 4O44A 4KHUA 4ED6A 4CJUA 3RJHA 1HUZA 2FBXA 4GC6A 4TQRA 2ZD1A 4HCCA 4TQSA 2B21A 3VQDA 4PGYA 4UB3A 3KIOA 3RJFA 3VQ9A 1T3NA 1TL1A 3L3VA 1HYZA 4G1QA 3LK9A 5CHGA 3PX0A 3TARA 2IOCA 4BDYA 3UIQA 1ZQWA 4FJKA 1MSWD 4DL6A 2V4QA 3AVMA 3DLEA 4MFBA 1JLBA 3HPOA 1KFSA 1CUKA 1HMVA 1A77A 1WAFA 2PXIA 3CM6A 4FLWA 3PMLA 3GIIA 3G6XA 1HNVA 2ETJA 2VWKA 4F5PA 5CYMA 4CFBA 4Z6FA 1D5AA 5KFMA 3ALYA 5KFRA 4DU4A 4CK2A 3QNOA 3OYFA 5KT7A 1NKCA 3KLFA 3K5NA 4Z0UA 4IG3A 5HHHA 2FPLA 3CG7A 3C1YA 4CJRA 3Q8LA 3RB4A 4QW9A 1WLJA 4UAWA 4ED2A 3DLGA 4F4XA 4E7IA 5IIKA 5J0PA 4Z6DA 1NK7A 4NXZA 3MECA 2E4LA 1NK9A 1QSYA 4B9LA 5HLFA 2ISPA 2QKKA 3V9WA 5KFSA 4FJLA 3ZDCA 3S3OA 3CYMA 1WN7A 1JL2A 4W5QA 5HP4A 2I9GA 2RDIA 3KD5E 4J2BA 4J9PA 4AHRA 2OZSA 1LW2A 2BQRA 4PGQA 5KFKA 3QERA 4I9QA 4J2EA 1L3VA 4RPZA 5HRNA 4I2PA 5DBBA 2GWSA 3AVFA 4DOCA 2I1QA 2W42A 3AA4A 2M9NA 3KLIA 3UQ0A 4DFJA 3PVXA 2NUBA 2BGWA 2H5XA 4QZDA 3JPSA 4CFCA 2RPIA 3FDSA 4I2FA 5FDLA 1IM4A 3KHHA 3OGUA 5KT5A 3V9SA 2FLNA 1SKWA 4RQ5A 3A2FA 8ICBA 3GQCA 3PR4A 3MGHA 3V9UA 4KTZA 5KTQA 2F1JA 2KFNA 4FS2A 3ZDDA 4ECRA 3Q8KA 5KFBA 1LV5A 2VA2A 2XY6A 4KAZA 4QWDA 2BCQA 1RYRA 4K4IA 2HHWA 3EYZA 3CFRA 3RJGA 2OYQA 3SI8A 2PFOA 1VSFA 4N47A 4FLZA 1XWLA 2JEGA 5KT3A 1C7YA 1IH7A 5KFPA 4CGHA 4FM2A 3MXIA 1TKZA 5DB8A 1K6YA 5DG7A 3NGDA 2W8KA 4O5KA 4OJRA 1NK0A 3ZT1A 3OYAA 1T03A 4DL4A 4IQTA 5KFGA 4PUOA 2P6UA 3EPGA 9ICAA 5KFWA 3RH4A 4I2EA 4YN4A 3DRRA 2W9CB 1RT2A 2W9CA 1Q9XA 4DL7A 3G10A 2XY5A 1XSNA 2P5GA 1FKOA 4B9MA 3PMNA 3OYCA 5HRPA 4KLFA 1F21A 1BIZA 2EHGA 3SQ2A 4RG8A 3ETLA 3HXMA 4O5CA 5HRRA 4FW2A 4FJMA 3BQ2A 2F1IA 3VQCA 4UBBA 3IRXA 4CHPA 1JL1A 4M2YA 5J2DA 8ICWA 2E6LA 4PPXA 2ZJAA 2AGQA 4YXMA 4CE9A 9ICOA 1S6PA 4OGCA 3O4NA 1WSFA 1HYSA 2RDJA 1S0NA 2ZTCA 4R8UB 4NY8A 1COOA 4R8UA 1RCHA 5TZVA 4DTJA 4DSKA 4O3SA 4CEBA 4E7HA 3HPGA 9ICXA 2ISOA 4DTNA 1C6VA 1EKEA 3C6UA 4DMNA 3T5LA 1BCOA 2G8WA 4EBCA 4YR3A 1BPXA 4JWMA 2HHTA 3BDPA 4YXJA 9ICSA 4C8LA 2AQ0A 3HVRA 4ZH4A 2A1JB 1KEJA 3OS1A 3KJVA 2A1JA 7ICHA 7ICNA 4HUEA 2PZSA 4W5OA 2BHNA 2HHUA 1YVUA 1QE1A 5I3UA 1LAVA 2G8UA 4M3UA 1GOBA 4N76A 1DOQA 5IIJA 3DM2A 1J5OA 4ECZA 2ZTEA 3OYJA 4ELVA 1D9DA 2RN2A 2KQ2A 3PO4A 7ICJA 1KLMA 5DB6A 1L3UA 7ICKA 2LSNA 4CK1A 3DLHA 4F93B 4LSLA 1ZBIA 3ZT0A 4M41A 3GIKA 5J2BA 1T4GA 1NK6A 3HW8A 1RDDA 1TV6A 1ZQHA 4DF4A 3RR8A 4FJXA 3AV9A 3LALA 3V9XA 4M0AA 2X78A 5C25A 1B9DA 3G6VA 3NF6A 4ED0A 2R8HA 4CEOA 8ICOA 2PFQA 3ZDAA 1MQ3A 5CB1A 3C95A 5HMMA 8ICFA 2DPIA 1H38A 4TUSA 3T5HA 4ID1A 2FBVA 8ICCA 4C8NA 2AGPA 3GV5B 3PW0A 4RNMA 2BPCA 4QW8A 1TAUA 7ICMA 4UQGA 1ZQDA 3HK2A 1UAXA 4DLGA 3T19A 4RQ7A 4AHVA 4KMUA 1HNIA 1S0OA 3QIOA 4ECWA 3HVTA 2ZTDA 5JUMA 2V9WA 5KFLA 3L2VA 4FYDA 1W0HA 3K5MA 5I42A 1FXXA 1HPZA 2DTUA 1KDHA 4F4YA 3AU6A 2JEIA 3GV7B 2HNDA 5J29A 9ICLA 9ICMA 5KFNA 4LZDA 1RT5A 4KHNA 1TVRA 2V4RA 3AVJA 3PW2A 4QWBA 5J0SA 3ZT2A 2MAXA 1HQUA 4ELTA 3MFHA 3RR7A 2FLLA 4OKKA 4I7FA 2JEJA 5KFXA 4CJFA 2XCPA 4HVJA 3MEDA 1NK5A 3QZ8A 1S10A 4OKEA 5HROA 3PW7A 4O3PA 4M3YA 4BE0A 1CXQA 3VQQA 1QSSA 3MGIA 3VQ7A 1S0VA 1Q8IA 4AHSA 5KG5A 3C5GA 4ECQA 4IRCA 1X9SA 3KHGA 2FBYA 9ICTA 3K57A 2YNIA 4B3OA 4GMJB 5EWGA 4B9SA 1BQMA 5JS2A 1WSGA 1FKPA 1JLAA 3MR2A 4QZHA 4O0JA 3AVKA 4F5QA 3TAPA 4CF9A 4L8RB 5KFOA 4CHYA 3PW5A 2C22A 3AA2A 1BPDA 5KGXA 3ITHA 5DB7A 3WNFA 1RTDA 1CEZA 4R5PA 5KFYA 1U49A 4E89A 4JWNA 8ICIA 4KFBA 2BQUA 2PFNA 3NBPA 3H4DA 5IIMA 3PUFA 4TUPA 2ZJ5A 4GVMA 2R8IA 3HT3A 4FK0A 3BGRA 4JV1A 4QCLA 5DB9A 3B6PA 3TR8A 1LWFA 1RDCA 4KHWA 4PHPA 1HYVA 3OJSA 4O3NA 7ICGA 1KVBA 5IIIA 2FPKA 1NKBA 1IG9A 4AILC 3NH0A 4ZHRA 2G8VA 1JXEA 2IMWP 4ZTFA 3H40A 4C8OA 1IKXA 1WSIA 4RQ4A 3KK2A 4J9SA 4P4PA 4DL5A 3LPUA 4H4MA 3SYZA 3MEGA 2DFLA 4H4OA 4ICLA 4GXKA 5L1LA 2NRTA 4FO6A 4CGJA 4MFFA 5KT2A 4CHOA 4E0DA 1S6QA 4JV2A 5KGWA 1RXVA 1RTHA 3NF8A 3PX4A 5EWEA 1XI1A 3VQ4A 1SZPA 4O3OA 3T3FA 5C42A 4I2GA 1BQNA 4IQVA 4M47A 5CR0A 2IHMA 4CGGA 2D0CA 3U3YA 2BKEA 4EP4A 4EZ9A 4E1NA 5KFZA 1VK0A 4MEYA 3C6TA 1QTMA 3ZSQA 1O1WA 3WNGA 5C24A 4HCBA 3UXOA 4CECA 4H8KA 4I2DA 8ICAA 4FJ8A 1ZBLA 4Y1CA 3B0YA 8ICYA 4MFAA 4RQ8A 2ASJA 2KN7A 2UVRA 4CIEA 4RW8A 4YP3A 3EPIA 2HNYA 3AO4A 4RW7A 3ZCMA 3HO1A 3MR6A 1ZQUA 4ID5A 7ICSA 3FFIA 1KVCA 3LP1A 4FLUA 5DGBA 3VQPA 1RBTA 2VWJA 4CF0A 1REVA 2W9AA 2P1JA 3RJKA 4ZTJA 1CXUA 3SUNA 1ZQZA 4YMMA 3DLRA 5FRMA 4ECVA 1L3SA 2UVVA 3IHQB 3S3MA 4IRDA 4NYFA 3V1RA 4IR9A 1AROP 9ICEA 1RILA 4J2DA 4TUQA 8ICVA 1X2IA 3K75D 2FMSA 1ZETA 1WSHA 4J9KA 1KTQA 1J9AA 2G8HA 3GDXA 3ISCA 1B22A 4R66A 3K5OA 4LY7A 3NAEA 2HW3A 4N41A 1BPZA 1SL1A 1WAJA 3ISNC 4QAGA 4IBNA 3V6DA 1V9PA 3K59A 3HWTA 3SQ0A 3S9HA 3OSPA 2KZZA 1C0UA 4FS1A 1RT6A 3QEAZ 2X6NA 3SUOA 2PI4A 4RZRA 3RB3A 4FCYA 4P4MA 4KLEA 1RYSA 3SV4A 5DQGA 2MUTB 1FK9A 2MUTA 2HHSA 2Y1IA 3RBDA 4W5RA 9ICKA 5DDMA 4RNNA 1X1PA 7ICOA 3LWLA 4F5OA 2XC9A 3UPQA 4KV8A 3SCXA 4YFKA 4FZYA 1ZQLA 3U6FA 2OPSA 4BE2A 9ICFA 1B9FA 3MABA 1KCFA 3GIMA 4M42A 2KFZA 1XSPA 3RJEA 4DFMA 2HHXA 2XHBA 1ZBFA 2PYLA 1KSPA 4FM1A 3PR5B 3PV8A 3V81A 4DTRA 2C2EA 5KFQA 3RRGA 2B5JA 4P4OA 3OS0A 5IIOA 1ZJNA 1TAQA 1A76A 4YMOA 3V1QA 4NM2A 4KI6A 2BQ3A 4DLEA 3F9KA 2W9BB 2P6RA 2W9BA 3RH6A 4RU9A 3MDAA 5DDYA 3K2PA 5KG1A 2A1RA 3DRSA 4E7JA 4RNOA 4YD2A 1JN3A 4B9VA 3CM5A 4KLOA 4FVMA 2OPQA 5D3GA 5DQHA 3PY8A 4HUGA 5KG2A 1RZTA 2PY5A 5BOLA 2IAJA 3ULDA 4CJ3A 1JLEA 3RAQA 3OYIA 3JPOA 3KTQA 4HYKA 4B8CA 1X9WA 4EBDA 3V9ZA 1KVAA 4KLIA 4CJ5A 1WSJA 2KZMA 2ITGA 3IS9A 4UAYA 3IAYA 3DOLA 3SQ4A 4FLVA 1QLNA 3TABA 4Z4EA 4F2SA 4M3XA 3VQAA 4XRHA 2YNHA 4DL3A 2P66A 4AHCA 4GXJA 2WTFA 8ICRA 2R7YA 4M3ZA 4FJ7A 1ZQTA 4J9RA 3S3NA 4ED3A 3LDAA 9ICRA 4QWCA 3TFSA 3QINA 3AO3A 1ZQKA 4I2QA 3ZDBA 2QK9A 2D0AA 4F5NA 3E01A 4CJQA 3OYNA 2ZUCA 3ZT3A 4KITB 1YTUA 4YFUA 4F8RA 4YVZA 2HVIA 1S9EA 3FYHA 2G8KA 1XO1A 1DTQA 4KLUA 3C21A 3V6HA 4J9OA 3DLBA 1BISA 4DQRA 1VSJA 1J54A 4B9TA 1HRHA 1Z3EB 3KKRA 3DMJA 1ZQPA 2HMIA 1X9MA 9ICHA 1KLNA 7ICIA 1YT3A 1U9LA 2YKNA 1HJPA 3OSNA 4RUAA 2AQ4A 5HRSA 4OGEA 3V6KA 1EXQA 2IS3A 4OVLA 4ELUA 4EP5A 4Q44A 4M6WB 2VA3A 2LYHA 4M6WA 1QHTA 3MAQA 3TFRA 4LVSA 1ZQYA 1JLGA 1EXNA 1QQCA 4KREA 2EX3A 4CF1A 2UVWA 3BJYA 2DFHA 4NCAA 3V1OA 2P5OA 3DRPA 3CQ8A 1NKEA 4LZGA 5CZ2A 3MR5A 4AHUA 3TQ1A 2B6AA 4RW4A 3OYLA 3DYAA 4KB1A 4LH4A 4XQ8A 1ITGA 1ZQBA 3QESA 3M9OB 2D5RA 4NCGA 3NCIA 2WOMA 5J2JA 4BDPA 7ICPA 4O9MA 3I0SA 4PQUA 5J0YA 4R65A 1GOAA 3P5JA 1BI4B 4OLBA 3VA0A 1BI4A 1NOYA 3ASMA 4B08A 1BPBA 4CHZA 5J2FA 4DFKA 4Y1DA 9ICUA 3RMAA 1W9HA 3VN5A 3RRHA 4DG1A 1C0MA 1NJWA 1S0MA 3AA3A 5J0RA 3C94A 4KN4A 4DOAA 4KLMA 3H8JA 1WCNA 2VG5A 3HL8A 3TAMA 4BDZA 2XO7A 1RT4A 4DQPA 4CEDA 2Q3SA 1SL0A 3HJFA 4RQ2A 3SUPA 8ICKA 3N97B 7ICVA 3C2LA 3NGZA 3KKSA 4K8ZA 1QSLA 3HSTB 5K14A 4FBUA 2R8KA 3QIPA 4J2AA 4P2HA 2X6SA 3KHLA 2F8TA 1U04A 3WNEA 4PGXA 2YHBA 1TFRA 4OPKA 4IQUA 1GOCA 4FM0A 3RMDA 1RBVA 2HB5A 3NFAA 3UXPA 4DOBA 3PO5A 4DTMA 2ATQA 4LSNA 4NLNA 3RBEA 4ED1A 4CIFA 3ZD8A 2J6UA 4KLQA 2FPMA 4K4GA 1N48A 3L2RA 3V7JA 1NJXA 3THVA 3NHGA 4QZ9A 2E6MA 4O55A 1LWEA 4QZFA 3VQ8A 4KPYA 3O3GA 5CZ1A 3AUOA 4CJTA 1C1AA 4M9LA 4QZBA 4M04A 3F73A 1HUOA 2Z1GA 1JXLA 5E41A 4RT2A 4IR1A 3TWHA 1RBUA 3B0XA 4WE1A 3JPTA 1B92A 4IQWA 4KTWA 2QXFA 3JSMA 4PHEA 1ZQXA 1JX4A 1BGXT 1Z00B 4CJLA 4DTSA 2HHQA 2GUIA 3AA5X 4CJEA 1Z00A 4ED8A 1R0AA 3ZSYA 5HMLA 4BWJA 5KFUA 1UT8A 4I2BA 1NOZA 3HPHA 5L1KA 1NK8A 3M9NB 5CY4A 4I27A 3M8QA 2ASDA 4DWIA 2NRXA 4DQQA 2BCUA 3KLGA 3K4GA 9ICBA 2AGOA 2D0BA 4BE1A 2OA8A 1S1TA 2ALZA 3LZIA 4OKJA 7ICLA 8ICQA 4F92B 1UA0A 3RB0A 1BVSA 5J0TA 3L2QA 4Q43A 3QE9Y 3QETA 2BPGA 5FRNA 4JV0A 4R64A 5KFIA 4IG0A 1S9GA 3JPRA 3AO5A 4ECTA 4EZ6A 1WCLA 2JGUA 4CJWA 3SJJA 1TV9A 3KLEA 3ZD9A 5CWRA 1BCMA 5CP2A 5EU7A 4F4KA 3M9MB 3M8RA 3Q8QB 2IBKA 3P1GA 1U45A 4I2JA 1MQ2A 4GXIA 1JLCA 5HP1A 5KFHA 3JPNA 4DTPA 1N6QA 4CF2A 9ICVA 3K58A 1ZQFA 2GV9A 4LD0A 8ICNA 1UT5A 4CFAA 5J2PA 4KTQA 3QEPA 4ECXA 5HBMA 1IO2A 5J2KA 4O4GA 1RXWA 4DEZA 3QEXA 3HM9A 1CZBA 1ASVA 4Z4CA 3RB6A 4G3IA 4DFPA 1MU2A 3NTUA 4I28A 1DLOA 4QZ8A 1VSLA 1TKXA 2DFEA 5DBAA 4HTUA 1TGOA 1TK8A 3SZ2A 3ZSVA 3O4QA 1VRTA 1S76D 3KHRA 2OPPA 5KFFA 3M8SA 1SKRA 1SKSA 5KG0A 1ZQMA 3KD1E 5KRTA 1G15A 4MEXA 3IG1A 5J2NA 1XS9D 2J6SA 5EOZA 1RDAA 4CHQA 3JPQA 4AHTA 4DO9A 3SUQA 1VSEA 1BPEA 9ICJA 4Z6EA 4UB1A 3HP6A 1TKDA 3NF9A 3GIJA 4CK3A 1C1CA 4O3QA 2AJQA 1RT3A 4KKOA 9ICGA 2PI5A 3SNNA 2KTQA 1ZQNA 4MFCA 1S77D 5KG4A 4UAZA 2NRWA 3ISBA 8ICZA 2YKMA 4Z6CA 2I5JA 5SWMA 1A5XA 3SQ1A 3G0ZA 4DTOA 3NE6A 3AVLA 7ICQA 3RJJA 1S5JA 1Z25A 5J0WA 1RBRA 4I2CA 4FK2A 4DSLA 2YHAA 4DU1A 4X5VA 5CJ7A 3K5LA 3AVNA 4K4HA 4NYNA 1IKYA 4RUCA 3LP0A 3TAFA 1Y88A 1IKWA 5KFDA 1U47A 4BWMA 3MDCA 2BCSA 3AVAA 2XCAA 3NH1A 1EP4A 2ATLA 2FLPA 5KFJA 3OHAA 2OPRA 2Z1JA 1LAWA 3V7LA 4YCXA 3EWAA 9ICNA 3C5FA 1VSIA 4JRPA 4B9UA 1L3TA 4YD1A 3LWMA 1RDBA 4CJPA 1IKVA 3AVBA 3GILA 1T8EA 2O4IA 3NGYA 3AVIA 5J2AA 1ZQRA 8ICPA 3LPTA 4ECSA 1S1VA 4KLHA 4QWEA 3HP9A 3ZSWA 5J1EA 3ZSXA 1SV5A 4M9JA 3GFKB 3Q8PB 4DSIA 4F3OA 2Y1JA 4Z4FA 4EEYA 3MXMA 3Q8MA 4KLGA 4ECUA 3L3UA 5DQIA 1ZBHA 2YNGA 4TSXA 7ICFA 4FK4A 3SPYA 2FMPA 4CCHA 2BR0A 4YQWA 8ICSA 4FLXA 5J2GA 4Z4HA 3H08A 5DMRA 4FXDA 4LH5A 4YNQA 1B43A 2PYJA 1TK0A 7ICRA 1CLQA 2BGGA 4N5SA 4FZXC 1JLFA 3ZDEA 5BPCA 4IFYA 9ICPA 4JS5A 1TK5A 4DTUA 4NCBA 3H8SA 4Z4GA 5J0UA
chains in the Genus database with same CATH superfamily
2XGPA 2VU5A 1A0OB 1GX5A 4J9LA 1DGKN 2FGOA 3N6NA 5L9XA 4TYBA 4XA5A 3DJCA 2DTJA 2X3DA 3HYFA 3VGSA 1RPLA 2NR0A 3D2FA 4JI4K 4EYHB 4P7TA 1ZAVA 4Z7CA 4JI1J 4CGFA 1KQKA 1FRXA 2KKVA 1ZQIA 1O5JA 3HHKA 3CQYA 5DKWA 2N82B 3AJ2A 1VSMA 2GBZA 3M8WA 2ZC3A 1SQGA 2R8GA 1Q5VA 1Y5LB 2VA8A 3DLLQ 4O5BA 1S1WA 4KHSA 3DDNA 1I51B 2E5LK 2OSRA 4IFVB 4XDDA 1CC8A 2WK4A 4TKTA 2NZTA 1TELA 1YTAA 4MQ3A 4QBUA 4DUZJ 4FJIA 1V3ZA 5AXKA 2V2KA 4M5JA 3QEVA 2K8CB 3BQTA 4PZVA 2ROPA 2XGQA 3QNNA 3CC7N 1YJUA 3QFHA 2ZITA 3OVNA 2E2QA 2VQEJ 1Z19A 4Y2KA 2OWOA 4H4KA 2CZ4A 4HL9A 4X65K 2UUWA 1U2VA 3G9CA 2AZ1A 4M5MA 3TAEA 4GLXA 3KFWX 1NJZA 3CC7S 3H4BA 4EAHD 2W04A 4XUSA 5GAHU 1ZQSA 3PLAA 2JOQA 5JVGL 5KT4A 3RWUA 3QFWA 3EGZA 1H2UX 3DAWA 2W11A 2HIQA 2KHQA 4IYQA 1DTTB 4FXWA 5AI0A 1KL9A 1XO0A 3C1ZA 3MCSA 3F2BA 2X1AA 2VG6A 1ZYQA 1ZJMA 2B8QA 1UVKA 4PPDA 3J7YI 4CT8A 4HUFA 3SV3A 3K9JA 1BIUA 2AJFE 1VQ4N 3R8EA 3G82B 1X5SA 4K4ZA 3UDLA 3Q83A 2OHFA 1EETA 5M1KA 3RU0A 4Y2TA 2AYEA 1GNKA 2XBPA 5CHCB 3OYDA 2IHNA 1O13A 3JSRA 1UJ6A 1JKHA 2VASA 1VQ4S 1RQ0A 3CJQA 5BN9A 2P9LB 2Y9UA 3VZHA 2E8AA 5AM0A 4NCGB 3BO3A 4ZCMA 3OYGA 2RT3A 3PHEA 3OYHA 1K73O 1K1SA 2ZJRQ 4X84A 2ZQBA 3KK3B 3ZSZA 5IINA 4LRDA 4KLTA 4DR1F 4GIBA 3HKZF 2XVTA 1KKHA 1EO1A 2F3NA 4ANCA 3HD2A 3GU3A 1U48A 3TANA 3R3LA 4KB0A 3SK3A 3RFAA 1S22A 4IDHA 5KAKA 3DRXA 1X60A 3CJ5A 2W8LA 2OANA 2O01C 1D4XA 3RH5A 4URGA 3TAMB 2W2MP 2F2AB 1KOOA 4J90A 1MG7A 3ZTPA 4DQSA 2IC3A 2VGMA 1RT1B 4B1UB 3CJ4A 3O9UA 4LR9A 4O3MA 1NJIO 2LPEA 1D8YA 1FWLA 4FWNA 4LF1A 5T7LA 2LQ9A 2RQCA 2VBZA 4WFXA 1NM1A 3R8YA 4E7KA 3KK1B 2LA4A 4NX9A 2E2PA 5A8KA 2DJWA 2UVUA 4HT5A 5DZ6A 4F3TA 2CPXA 4AYBD 4J9MA 1X4AA 3QZ7A 3MMCA 2AEJA 2NUUG 2IA6A 3LPYA 4PHAA 4IOXA 1S1XB 4DR2J 3DOKA 2ZE2B 3SCLE 3K9KA 3MMVA 4FBTA 1B7FA 3A3PB 4CTAA 4H0YB 2JRSA 4MF2A 4LJXA 1XMOJ 2MZRA 2YNFA 5HAOA 4RUHA 2UXCK 3MFIA 5B0AA 3SPZA 1LQ9A 3N5BA 2Y9HA 5LJWA 2FF6A 3LAKA 3R2DJ 3H2LA 5F0XA 4BRPA 1S79A 4DDFA 4QZCA 3MMAB 5CHIA 4J8FA 4B6JA 4K25A 2KHOA 8ICHA 4QU7A 2EG1A 3JSBA 5JU5A 2NYVA 4EIAA 4BREA 2CQHA 4OX7A 3BQ1A 4JI7K 3J7YP 3OHBA 2KIWA 2B4UA 4CZHA 4C11A 3FGUA 1IG6A 4UB6U 5DG8A 4M1KA 1UJ4A 3NF7A 4M9NA 1RAAB 3VENA 3M6GA 2MZSA 5FPMA 1LB2B 4F4ZA 1FE4A 2JLFA 5E3CA 2BCRA 4OPJA 1HBUB 2QA4G 3LO3A 1NWKA 5B0BA 2FDNA 3DDHA 1NSAA 5KFVA 3LZJA 2O8DA 2XY8A 4JLHA 4WFNL 3AM9A 4NLGA 3HZEA 4A8XA 2DBYA 1SZHA 2DPNA 2F96A 4E3SA 3O8MA 3ZNJ1 3LANA 2GHVC 1RFQA 5IV4A 3E9PA 3ZSRA 3L95X 4CEFA 1S9FA 3CDUA 1GLCG 1CJKA 3TA0A 3NOGA 3O9QA 2BTFA 4D3GA 2BE2A 4U6PA 3W5XA 3KNAA 1TKTB 2HQ3A 4C8MA 2F65A 2V63A 8ICUA 5HO4A 4Q0BB 1RSCA 3SCIE 4F71A 2DBBA 3U1MA 2XEXA 4UY8O 4IEEA 4KSEB 4H54A 3AOAA 1NNLA 4CESA 3T1HF 2DNKA 4EYIB 4N56A 4BHQA 1WF2A 4DCOB 3O3FA 4FLTA 2G0AA 8ICLA 2FHJD 1FJEB 3BGUA 1YVFA 2G9OA 2VKQA 2JZBB 5KT6A 2CJBA 1JCGA 3VMFB 4KH0B 3I0RA 4E19A 1CRXA 2BE9B 3AVGA 2YH0A 3UN3A 4AL6A 1FNXH 3C7NA 1EAYC 2V51B 4Z37A 5HNKA 1BL3A 2G8FA 5HR6A 1YI2N 4P7VA 3NDKA 2BANB 4J9NA 4M5HA 4BJQA 4YDUA 1HW8A 1HQEB 4C0ZA 4ZVSB 2LI6A 2UV8A 4Y6IA 5CD4H 4DU3A 4P0PA 2RSQA 1F2HA 1NMDA 4JI5F 1RQLA 3JYTB 2NZCA 5BPMA 1YI2S 2IDEA 4CERA 1ZQVA 5KFTA 5HN0A 3ZT4A 3GFZA 2ATCB 3WK4A 2HRUA 1WSVA 2LA6A 1N33K 1GLEG 4RW6A 1PO6A 4BCAA 1RKIA 3I8DA 1VQ5N 1DGSA 5KFCA 1UWBA 4OJGA 3CDEA 4YB5A 3W2WA 5SZTA 2A1SA 2WVCA 3NGIA 1TUGB 1SGGA 1RTJB 5KPTA 5GMDA 2GMHA 3KYLA 1U4BA 4DSFA 1F6TA 1VQ5S 5J0OA 5F3XB 2EANA 2ASOA 4CGDA 3BO4A 4XH5A 2HIYA 3QEIA 3EW9A 2HVHA 2BBEA 1R8AA 4I4BA 3A1YG 5L1JA 3AFGA 2H3ZA 3A13A 1C0GA 3LAMA 4A57A 4OQJA 2XQCA 5IS2A 4EMDA 4N77A 1S49A 3IA0A 2HFVA 3TSPA 3FRZA 2B21A 2CA9A 3I32A 1AZSA 2QMXA 1XNRF 3T1YF 3VQ9A 1T3NA 1TL1A 3G96A 2GQ2A 4G1QA 1S7IA 5CHGA 3MCMA 2IOCA 2RH3A 1ZQWA 3TTDA 5J1EB 4BG8A 3AVMA 3DLEA 1JLBA 5JVGQ 1HMVB 2DHGA 3MM7A 4LIWA 5ALRA 1A77A 1WAFA 4DR3J 3CM6A 1HNVB 3HZ6A 3GIIA 2CNOB 2BV3A 3WXKA 5CYMB 4KBOA 4CFBA 4Z6FA 1VJWA 3CWJA 1D5AA 4QQBA 5JVHL 4DV1J 3MCPA 3UQSA 3KLFA 1K0VA 4K0KF 2JXJA 2OH2A 2K60A 1WLJA 4ED2A 1WYGA 2XS5A 4F4XA 2E1CA 4M94A 1A7GE 3CJ3A 1BOTO 5IIKA 2MJUA 2B4PA 5HLFB 3LDOA 2BW7A 4HR2A 1E4FT 4B9LA 2ISPA 2VQFK 5LJ5Y 3SAFA 3KG0A 3CQXA 4PR6A 2HF3A 2ZOMA 3ID6A 4O0NA 2IDLA 4BRNA 2DNLA 1WN7A 1H7XA 5HP4A 2I9GA 3R6LB 1LW2B 3AD8C 2VFSA 4LR7A 4J9PA 4AHRA 2ZJPL 2I38A 5KFKA 1WOSA 4I9QA 4J2EA 4D3HA 2VBYA 2UXBK 3M2RA 4I2PA 3AVFA 2D69A 1SS6A 3KLIB 2YMMA 2CH6A 2W42A 4CDIA 3C29A 4DU8A 1QTNB 3UQ0A 2QFIA 2Z2LA 4QZDA 4CFCA 5FDLA 3CIPA 3DNCA 5BN8A 5J2MB 3J7ZT 3V4MA 4BRIA 1SKWA 3MM9A 3A2FA 2EK6A 3GQCA 4KC5A 5AI6A 1U1MA 4K4UA 1V38A 3A8YA 3MD3A 5BPNA 2UUCK 5ALHA 1S7HA 2M70A 4MKYA 3F5AA 4URSA 4DR6J 4WP3A 2QWMA 1FHTA 4ECRA 5KFBA 1S72N 2VA2A 2XY6A 4DV6K 2LEBA 1FF2A 3M2VB 1QAJA 3CFRA 2B9YA 5AJ3K 3QX7A 1YQHA 1UEKA 2VONA 2XWXA 1OS5A 1JCEA 1XWLA 2JEGA 2Q3PA 4G1IA 4KY3A 1R89A 1S72S 2PIIA 1KW4A 2WF7A 2JSXA 5DG7A 3NGDA 8AT1B 2ZWPA 4DZDA 1Q78A 4OJRA 1BLUA 3BP8A 3NXZA 5ALTA 4LF4F 1T03A 1FFGB 2XIDA 3C15B 4JKGA 3EPGA 1IR1A 4RU2A 2P35A 4LFAF 2MYFA 3DRRA 2HMPA 2W03A 1RT2A 1X42A 4WQ5A 4ZP9A 2K4IA 3W63A 2I5HA 1HA1A 2P5GA 1FKOA 4B9MA 5AQWA 1RJJA 1F5BA 3TR5A 3OYCA 3W65A 2KICA 1U8WA 4DR4F 3AA8A 1F21A 3IMXA 2LVWA 1MMLA 2MKCA 4Z94A 4V19S 5ALJA 4FZNA 3VCDA 1YJ7A 1FDAA 2LQ8A 4CO1A 2F1IA 4CHPA 3MM5A 5J2DA 8ICWA 1HWUA 4DV2J 2ZJAA 2AGQA 3RW7A 2P9KA 1ROFA 2RQKA 3QYPA 2W40A 1IBMK 4C7YA 1HYSA 2O8CB 1PG5B 1Q82T 3PSIA 3QLHB 3ENWA 5TZVA 4OI6A 4DSKA 3CULA 2HSZA 2HFSA 4C6AA 1J5EF 2CGJA 3C6UB 2HQGA 1VK3A 2LXIA 3NY0A 1YJNN 1BE4A 3SMVA 3T5LA 1BCOA 3VGKA 2RAQA 1RBLA 2CG8A 2F9JA 3ICXA 1R8PA 3GYGA 4CH0S 1BDGA 1IBCB 1SJRA 5FLXO 4C8LA 1RWMB 3PCOB 2NNWA 1VJ5A 3OTBA 4ZH4A 2RLTA 1YJNS 3OS1A 1I94F 3D68A 3L5KA 4W5OA 4CO5A 2HHHJ 2HYIB 4FFDA 2ZVIA 5M1QA 2YWKA 4K5RA 4CLKA 1J5OB 4N76A 1DOQA 1MMNA 5K8MA 2DH7A 4ECZA 2ZTEA 3OYJA 4ELVA 2RN2A 3MD1A 1UVNA 2QSFA 3W9HA 4MT1A 2EW9A 7ICKA 2HGMA 1LKYA 4PZOA 4WFYA 1Q7YT 3LA0A 4M41A 4GKJK 1NK6A 1RDDA 1ZQHA 5AICA 3FSYA 3RR8A 2XS2A 3N7PD 4FJXA 1S4EA 2UUAF 2I7PA 3QBXA 3D3BJ 1ZOLA 3M1FA 2D0PA 1LXJA 3KHYA 3H0PA 2KKPA 2H4YB 1FIQA 2R8HA 1ESVA 4KRWA 3R7NB 1MQ3A 5HMMA 8ICFA 4JI3K 4TUSA 4XDCA 2MLXA 2QYGA 1WWHA 4NL9C 5GIOA 3W5ZA 4U7UD 3KVGA 1FWKA 2Q4TA 2U1AA 4RNMA 3U9DA 4QW8A 2E88A 2H3EB 1HNIB 2BKNA 4P74A 1ACMB 1WG5A 2KSOA 4M8LA 5DZ7A 3HVTA 2ZTDA 3C19A 2V9WA 5I42B 3OXGA 3K5MA 3ETRA 4S0MA 3Q0AA 2KNJA 2DTUA 4H5NA 1P9QC 5ALKA 3VEXA 5ALLA 1FFUA 4ID8A 2XNQA 2NPFA 2HNDA 5SUHA 4CZEA 5KFNA 4KHNA 4JI0K 1TVRA 4QWBA 5J0SA 1KD1T 2W7OA 5AI9A 3MFHA 3RR7A 1BQXA 3H5XA 4OKKA 2YJEA 3FE1A 3PNIA 2UUBK 2JEJA 1N5XA 2ZIXA 2RRNA 5KFXA 3MEDB 3BGOP 3HFZB 4EK2A 1TQLA 3QZ8A 1KNZA 3O1WA 5HROA 5L39A 4O3PA 2CXEA 4BE0A 2P9IB 4M3YA 1HKGA 1CXQA 4EHTA 2HURA 4LFBF 3VQQA 3UKUA 3VQ7A 1S0VA 1DQAA 1BO5O 1XNQJ 5AQFA 1BC6A 3KLHB 2DR9A 4DR5F 3MWPA 1SIJA 3KHGA 1ATNA 2F4VK 2FBYA 2YNIA 1HR0K 1BQMB 5EWGA 4BGBA 1UEUA 3UO0A 2XI2A 5JS2A 1JLAA 3IR6B 3SFGA 5JRTA 2RU9A 3PXGa 4O0JA 2LMRA 1RE1B 1PBAA 3TAPA 3HVAA 2KIVA 2CPHA 4L8RB 2JGAA 3PW5A 2E2OA 2C22A 1K9MT 1BPDA 5KGXA 3TNVA 1RTDA 4R5PA 1U49A 5IT9O 4E89A 5LMNJ 8ICIA 4KFBA 2ZH1A 2PFNA 5IIMA 3MCOA 2ZJ5A 3D6MB 2K1RB 4WFBL 2Q1LA 5DB9A 3DOMA 2WHOA 3WK7A 1LWFA 2ZZTA 1H2VZ 4WCEQ 1RDCA 3ILJA 5FLXU 1U8SA 3FMWA 1DK2A 1PAEX 1K9MO 3G71N 4B3TF 3QBCA 1J2MA 4OZLA 1Z05A 4PG4A 1ZM2A 1IG9A 4OJ6A 1BNPA 1H72C 1L3KA 1JXEA 1PJ7A 4RUBA 4ILLA 4ZTFA 2HMXA 3G71S 1WSIA 1FESA 3WX4A 1NHKL 2DNMA 3U7JA 1NRKA 2ZXIA 1HFEL 3ZZRA 3IP4B 1F5CA 4ICLB 2DFLA 5LSRA 2KVIA 4WZQA 2KT3A 4CGJA 3L3FX 5IXUA 1N36J 2OHDA 3FUYA 1HKAA 5EWEA 2QV6A 1XI1A 5C42A 3T3FA 5AQRA 3L4IA 3E8OA 1BQNA 4M47A 2FC8A 1XMQJ 2ZNZA 2PFDA 2C3YA 5EHHA 5HVHA 4MEYA 1O1WA 1A9NB 4HCBA 4CECA 3KDOA 1WB9A 2XSJB 4I2DA 2XTJP 5D4LA 1ZM4A 4FJ8A 4M63A 3TJAA 3KMSA 1ZBLA 1Q8KA 3NVVA 4RW8B 5H9FJ 3VV2B 2B9WA 4QPTA 4QS9A 3IR7B 3PJXA 4Y2MA 4AD6A 3IRWP 2NSCA 2LXUA 2MQLA 2WF5A 4ID5B 2PMZC 2I6WA 2P9GA 4USUA 5EX3A 3FFIA 2A19A 4F04B 3CCEN 3PSTA 3CP8A 1FTCA 1F1BB 1ZM9A 1GXLA 3VQPA 2EFPA 2HBJA 3MAAB 1AFJA 3DGPB 3RJKA 4LRAA 1CXUA 4KGZB 5AQYA 3BS7A 3CCES 3UCGA 5ALGA 1X5PA 4OJPA 3BV8A 2FGCA 1L3SA 3IHQB 1LFPA 5ETNA 4IRDA 3K7RA 3DEEA 4LBIA 4J2DA 3J7Z5 2VDHA 1ZETA 1WSHA 4NLYA 3DKDA 2E9RX 2G8HA 3ISCA 3D2SA 3NAEA 2JZ5A 4JI8F 1SL1A 1CG2A 2KL8A 3ISNC 3V6DB 4GV9A 2KJVA 3KNGA 3K59A 3HWTA 2OSQA 3SQ0A 1VQON 4DB3A 4M5IA 2KZZA 5AKGA 5AI8A 1ZS6A 4ZLJA 3QEAZ 3PFOA 3FZHA 1YJTA 1ZTTA 2ZHAA 3RB3A 2PAVA 3CIMA 4DCCA 1Y10A 3FVYA 1RYSA 2QI2A 2ZBIA 2NRHA 1H1VA 3MHYA 2MUTA 1VQOS 2R3VA 3CC2N 3RBDA 4DV3F 4YHHJ 4W5RA 9ICKA 7ICOA 2ZH8A 2DGOA 2GUPA 4YFKA 4FZYA 3EUB2 3ET6A 1NB7A 2QARA 5E3AA 4QOTA 1HIWA 1U09A 3CC2S 3GIMA 5IT9U 3FBEA 2KFZA 4DFMA 2HHXA 1X3NA 2MA1A 3J81U 1KSPA 1RLCL 3PV8A 5RUBA 3V81B 1URRA 4A4JA 2AH5A 2OJ3A 4P4OA 1X4BA 1QJHA 4A2AA 5IIOA 1ZJNA 1TAQA 4YMOA 4NM2A 1FO4A 4YS2A 1Z2LA 2OD6A 4DLEA 4GVEA 3UMGA 2MKYA 3DRSB 3MDAA 1OY8A 1YRUA 3H2VE 5KG1A 4LFCF 2OPQB 5AIAA 5D3GA 2MPUA 5LMUJ 5KG2A 2PY5A 2IAJA 3AHPA 2MTLA 3ILOA 1PVQA 1FJCA 3KTQA 1TMMA 1NMEB 1X9WA 5E79U 4EBDA 3V9ZA 5MAOA 1WSJA 2KZMA 4LVOP 3L0QA 4JB8B 4UAYA 3GJQB 3DOLA 4NZ6A 3IAYA 2RDDA 1QLNA 3WEEB 4M3XA 2V4JB 4XRHA 2YNHA 1GLBG 4UUXA 2WTFA 2CQCA 4C3KA 8ICRA 2BJ9A 1HUXA 2W2QP 1YZ6A 5JLHA 4DCJB 6AT1B 1TL7B 3GJSB 3VQSA 5E26A 4L73A 1YX2A 3TFSA 3QINA 3AO3A 3I8BA 3NRWA 1FRIA 1NBEB 2CG4A 3WC0A 4I2QA 4UW9A 1UTAA 3E01B 3W8GA 4NXNJ 4YY3F 1PIEA 4KITB 5A76A 4IO9Q 1Q8LA 4XTTA 1N8RT 3PYEA 2HVIA 1Q3VA 1TFYA 3NAHA 2GX8A 1DTQA 3C21A 1K44A 4ES1A 5MLCQ 2H3FA 4Y2IA 3DLBA 3CVKA 2FJWA 2J9CA 1VSJA 4B9TA 1BA1A 4Y34A 2HMIA 9ICHA 1I3OB 4OIXA 1KQGB 1YT3A 1RCXB 1R8CA 1HNXF 2IVMA 3IAS9 3NASA 2G06A 5GADI 2V2ZA 4NXMF 3IBWA 3RVCA 4OGEA 3AAPA 4OVLA 4ZN3A 4Q44A 2KJWA 2I2YA 4M6WA 1WACA 1CZAN 1JRPA 3OXLA 3ZTOA 2E66A 2QRRA 4KREA 1QQCA 1D1UA 3N28A 3W66A 3K89A 1U1KA 2EX3A 2DFHA 1VQYA 3DRPB 2H48B 4OYOA 3CQ8A 2B6AB 1NKEA 4USIA 2HQCA 3TQ1A 7AT1B 4UASA 2O67A 2IYGA 4QR0A 4XQ8A 5F3ZA 3C16B 3I5CA 3BSAA 2J0SD 2EAPA 4CLPA 1V85A 5T14A 2QWLA 1FXRA 4O9MA 4MMOA 4OHWA 3T1HK 5J0YA 1ZRMA 2LM1A 1F3FA 4B3SF 1NOYA 4F3MA 3ASMA 1BPBA 3R1HA 5E33A 2W2NP 1OQ6A 4YOYA 2OMLA 4ES3A 4BBYA 9ICUA 3CJRA 1G4CA 1RWKB 2DB1A 2HOFA 3GSDA 4KN4A 2XNRA 3P4IA 2VG5A 1RT4A 3TZWA 4CEDA 3UMBA 3GBTA 2Q3SA 2ZHOA 3HJFA 5FLXY 3SUPA 3C2LA 1VQ9N 3HSTB 3QIPA 3KOOA 2AJ0A 3KBBA 2IFXA 4IKAA 3KHLA 4GKKJ 4JI5K 6FD1A 4KR0B 3U8XA 3IRUA 1TFRA 3K0SA 1KVIA 1FWPA 1VQ9S 4YOEA 3O2IA 3ZTRA 3PO5A 2GH1A 4DTMA 2E7XA 3HM8A 3RBEA 4FO0A 3WX8A 1N62A 1REGX 3L4BC 1LWEB 4BC9A 3B78A 2E6MA 5K9FA 3VEYA 2F3JA 4KIAA 4O55A 3CCUN 3ZZTA 3IFRA 3TJ9A 1NGCA 2IJRA 3DLJA 3U26A 1U0HB 3AUOA 2MY7A 4M9LA 2XI9A 2KJ9A 5E3RA 4DI6A 3M32A 3CCUS 2W4DA 4BRQA 1ZTWA 5E41A 4CM2A 1FXLA 2FQQB 4C8ZA 1F44A 1ELOA 1Y5IB 3JPTA 4BR5A 3JSMB 1U6BA 2QXFA 4UAVA 4CI6A 1OVQA 5GADP 3FFKB 1XERA 4CJLA 2HHQA 2UUTA 4Y2UA 2BJDA 3ZSYA 4BWJA 4O5FA 3GR0A 4W98A 4I2BA 4NV0A 2MQOA 2OO4A 3M9NB 3D7SB 3KOAA 5CY4A 3IWNC 5A2QU 2DNNA 2ZIWB 2ASDA 4I6YA 4LF5J 4W92B 4ZMMA 2AJ2A 1J2NA 3MM6B 3SBMA 2AGOA 2R7TA 1XNRK 1S1TA 1SWVA 5EXWA 2HKEA 2Z58B 3K1RB 2K8AA 1UA0A 1OUQA 1OJ4A 2CUYA 3VOVA 5J0TA 4ILHA 4Q43A 3QE9Y 1E6VA 5FRNA 4U9RA 1OKJA 4IG0B 1MN7A 2FYXA 5KFIA 4HAIA 1S9GA 4MO4A 1JUDA 3THWB 1QQNA 1NGBA 4C0HA 2JGUA 3SJJA 1TV9A 3L6QA 3ZD9A 5AQUA 4L74A 1P7DA 1Q86T 3UDEA 4K0KK 2I0XA 4JI4J 2IBKA 3IWLA 1U45A 1TTHB 1MQ2A 2CWKA 1JLCA 1TYQB 3ZETA 1ZQFA 2GV9A 1RAIB 1CULB 1VBZA 4WQ4C 2EPIA 4GV3A 4KTQA 4IH6A 1T02A 1GLAG 5HJXA 2NO5A 3A0BU 2OI2A 2QYCA 1ATSA 1WC5A 1CZBA 3RG6A 2CGKA 4ENOA 2VGNA 1UWAA 2KRRA 1DLOB 3NTUA 1TKXB 5HANA 1HQ2A 3H25A 1IBKF 2DFEA 4Q7AA 5B8HA 3TACB 1R0CB 3ENVA 1TK8A 5IT9Y 2DNRA 1VRTA 3D67A 1VI7A 5KFFA 3M8SA 3J81Y 1DGJA 4QNLA 5G0RA 3UW1A 1RA6A 3OTQA 4TU7A 3EKUA 3KJQB 5HQMA 1LKZA 3PKYA 5J2NB 1MWKA 4P0QA 2F63A 4MEXA 3IG1A 1G15A 2C2MB 1RDAA 5DM6Q 4PYAA 3SUQA 2EWSA 4X65J 3GCWP 3OR2A 2K8BB 1D0EA 1QHAA 4H0TB 1C1CB 2P9NA 4NWIA 2P9PA 1SB6A 5C24B 2YX7A 4KKOB 3TSQA 1DRGA 2GHWA 4Y0WA 3NL0A 2KTQA 4JNEA 1ZQNA 3CSKA 1SQFA 1N5QA 1LXNA 1T9YA 4RW7B 2CDRB 2GAHC 4B1WB 4IZ9A 1JALA 4Z6CA 2YKMA 2BX6A 4CLLA 3H46O 4DTOA 3AVLA 3CT9A 2CPZA 1N52B 3VPZA 4I2CA 3GYXB 3TVYA 1VMBA 5CJ7A 4B3RK 3LP0A 4KX3A 4RUCA 3CF5Q 4LFAK 1CJUB 3OBWA 1IKWA 5KFDA 1IM6A 4BWMA 3HI9A 3MDCA 2WRMA 4MYTA 1WKLA 2OPRA 3L4QA 5GMKa 4DR4K 1FRMA 1L3TA 2X1FA 1FJ7A 1MA7A 3FM9A 1IKVB 4OI3A 2R2UA 1SB3C 1PC5A 2WF9A 3OPXA 3G4SN 1AB8A 3TEGA 2WF6A 8ICPA 4ECSA 1ED1A 2LEPA 1Q81O 2CDQA 2QLWA 2K8GA 1J5EK 4M9JA 2LYVA 2AJ4A 5AQKA 4USWA 3G4SS 4DSIA 1YBAA 2OFHX 4CM0A 2MY8A 3BEXA 3MXMA 4EO8A 2DYAA 3L3UA 5DQIA 3TP2A 3HULA 7ICFA 3SPYA 4NLXA 1DAXA 4LF6F 4ZPTR 2BR0A 4PKGA 2YKPA 8ICSA 1D09B 2DK2A 1T3VA 4Z4HA 4NZ0A 4FXDA 1N5TA 1I94K 1Q7LB 2PYJA 4X4RA 1LEOA 3LDPA 1CLQA 4DV7J 1MWYA 4N5SA 1F2GA 2GHPA 3ZDEA 3ZNUA 2O8EB 3C14A 4DUYJ 1TUUA 9ICPA 4DTUA 1BMQB 2FUG9 1ZQ1C 1YLXA 4W5NA 3FLCO 4M3RA 3BSCA 1H7WA 1RGVA 2DWQA 4RWXA 2PO4A 2UXCJ 1MDUB 1ZQQA 5KI6A 3MMBB 2IHR1 2UUAK 3VZIA 5J1PA 1A5VA 5GTIU 1HHTP 4Q45A 5F9NA 2D3UA 4PG6A 2IDOA 3CCWA 1GLDG 3TKAA 1JLEB 4KHQA 2CPYA 3MR3A 2E1YA 1SL2A 1HEKA 5ALIA 4OI0A 4RQ1A 4JI7J 2AHOB 4X64J 1UOCA 3IS9B 2KB2A 1IV0A 5AKIA 2FHMA 2AX1A 3K0JA 2V7YA 1WBBA 3CJ1A 1DK3A 4Q8EA 3KG4A 2C3OA 4IFVA 1UA1A 2W9MA 1XR6A 3RMBA 1PC4A 2KVQE 4HI1A 3LVVA 1M90T 4PABA 3HDSA 3LVWA 4RO0A 1WOOA 4AXJA 5ALZA 4NE9C 4CW7B 3MM8B 3OV7A 1WNSA 3UQ2A 4DR2F 5J0QA 2BJ1A 5D46A 1N5YB 3Q89A 1PYOB 3DI6B 5T7BA 3B6BA 5K5MA 5F1XA 1ZQGA 3VGUA 2BM0A 2ZKUA 4BC2A 4KHMA 1M90O 2DVIA 3VQ5A 1WHVA 3W3DA 1UETA 4EUVA 1XHXA 3MBYA 3BH6B 3SAGA 4OX8A 2JH7A 4PWDB 1L8LA 1JXVA 2N3LA 2XG8A 1NNEA 2HVEA 3V2UC 3U3GA 2EH9A 1X9JA 1DTTA 1MLAA 3TW0A 3LDSA 3B54A 2GQQA 2HSEB 3FMBA 3MCNA 3H7IA 4DL2A 2A40A 5AHXA 4WF9L 2DPJA 3CFOA 4I9LA 1S97A 2AEFA 4A8EA 4LFBK 3SSQA 8ICXA 2PMHA 3ZX0A 3P83D 1HHSA 4A8QA 2QFJA 1N60A 2ZJ8A 5A2QY 2GWJA 3G82A 4CIGA 4WFZA 4DR5K 2QN6B 2E7VA 3IGVA 8ICMA 2O8FB 4A8YA 1N34F 1GQEA 2ASMA 1TE2A 2F7VA 3VEWA 2C28A 5E7OB 3PW4A 3HX0A 2P9LA 4A2BA 1FRJA 2CJXB 3F0NA 4GV6A 1OPIA 4K41A 1FDNA 1O0PA 2K3IA 4I67A 2P51A 1WSEA 1G7CB 2YBVA 3CUNA 2DXFA 1DQ8A 3VEOA 3KK3A 4PL2A 5C2CA 4J5OA 2E3TA 4F50A 2NRRA 3VF6A 2CVEA 3P5TL 3GIRA 4AM6A 4DSJA 3M6WA 2Q31A 3BF3A 2BPFA 1ZQCA 3IBFB 4NA2A 4B3TK 3RBZA 2Z1IA 3TU5A 2VBXA 4TVAB 3BKFA 1Q16B 4NM1A 4LF9F 5HSPA 2PFPA 1RT1A 1NM2A 1T44A 1V9OA 3QT5A 3O9RA 4CEEA 1KFDA 1EZZB 4Y2YA 3SCJE 4RTFD 5DK5A 4CEQA 3P96A 4K50A 4E98A 3KG1A 5IOLA 1Q9YA 3DLKB 2MHNA 1BHLA 4KLSA 4IKFA 3P3DA 2DRBA 3PG9A 3KK1A 4AH9A 1CZ9A 1UW9A 1NOMA 2WB1D 4RQ6A 4UB4A 3J80O 5KG3A 1N88A 1B99A 4DCHA 4F7VA 1U6FA 5AQPA 3GFHA 5KFAA 4WK3A 5DBCA 1TL5A 3OJUA 1RU1A 3Q2SC 3ATVA 3LP3A 1VHFA 2FZKB 5ETQA 2V0NA 5HHIA 1S1XA 2ZE2A 2J8AA 3MX2A 3FKBA 1P90A 2LDYA 1VLOA 1IXRA 5F2RA 3BKTA 8ICGA 2LQ5A 4BRDA 3H42A 2J6TA 3OVBA 2ADCA 3KZIU 1VHIA 2YV0X 4WE1B 2GLEA 1ZZFA 3QGGA 2WW4A 3MMAA 2FVPA 2A3JA 3VF2A 1D8LA 4QIWF 5B0EA 2LXFA 3W9JA 4C4TA 2C2DA 4UUWA 4QZAA 4XPCA 4FWQA 5I3PA 4FWRA 1Q4RA 4PRFA 1LWCB 2BDPA 1LWXA 2MSNA 1FXDA 4OYBA 1I3AA 1CQMA 2DR7A 3L2WA 4F0KA 1X4GA 1J53A 2WONB 4ZIWA 4QYRA 4OYIA 3JS6A 2RHKA 1HBUA 3OFEA 4O0IA 4X66F 3S41A 5LXRA 4U8YA 2FE9A 3H8WA 4ZJQA 4ZPDA 3D2NA 3G8QA 1HX1A 4KH5A 2RHSB 3BQ0A 1QUPA 1QM9A 4FJ9A 3MPWA 5CA7A 3VA3A 3TAGA 2Y0BB 4NLSA 3M30B 4IOAL 4BGDA 2MKKA 3CCTA 2F1HA 5BREA 5B08A 2QWOA 1GTEA 4KH6A 4JI8K 2G8IA 3BZKA 2AYMA 5ALSA 4JYAJ 2VQFJ 1P6TA 3B9JA 3N0VA 4ZVGA 1S3XA 2HWIA 3W7BA 1IUJA 3A8IA 1TKTA 2C2RA 2QL9B 1EWQA 2ITMA 1Y5NB 3IC1A 3R5AA 4Q0BA 2K89A 1SH3A 3QMLA 3QU5A 1RWOB 4Q8FA 5CYQA 2UXBJ 3ZSOA 2MMYA 4DV3K 1NGJA 1NB2A 4C9DA 4BACA 4QZGA 1HW9A 2W3SA 3VAKA 2UXDF 7ICUA 3OL7A 4NMXA 1NJYA 3ZTQA 2D3DA 4DR3F 1IJEB 3IM1A 3BPDA 1RK8A 3OVSA 4CO4A 5M1PA 4OX9F 2YHYA 2EKNA 2R8JA 4R63A 2BCVA 2VYPA 1QAIA 3QDKA 4DV1F 3THTA 4NZ7A 3LGMA 1XC9A 2UUCJ 3R5DA 4NLKA 2JZBA 2F8LA 3EGNA 4DV6J 3H8YA 2GWKA 4M5KA 4AT1B 3O3HA 4WJBA 5LL6d 2BANA 4NYPA 3AVHA 3POTB 4NA3A 2VANA 2W55A 1HQEA 1KAYA 3JPPA 3X1LB 1Y97A 2EC0A 4LFCK 4I29A 4ILMA 3KD3A 4FPIA 3JYTA 2CFXA 1S1UB 1RACB 4OZ3A 1QUVA 4DR7J 2DXEA 3AU2A 2GS8A 2WB1C 3VQ6A 4I2IA 3JTPA 4O5EA 4NYOA 4MDBA 4PHDA 3F9MA 2NRVA 3D3CJ 2ZXHA 2IM1A 5DGAA 2A6AA 4LR8A 3EVMA 1VS3A 3QQCD 2FHJA 2LBOA 4KHRA 3U1NA 3OS2A 2WBNA 4G6VB 5D6GA 3ALRA 2HI0A 5FD1A 5AXLA 1RTJA 4QZEA 1LW0B 5AQXA 4QYZJ 1RYUA 2FVQA 3WUHA 4JHDB 1S57A 4CJ4A 2J0QD 5KFEA 4J9QA 4ILRA 5IFMA 3NEKA 3Q8SB 1VAZA 4CRXA 1IBMJ 5A6WA 5TKWA 4DR6F 3U27A 3O0FA 3OLAA 4YY3K 1EP4B 3LDNA 2KV2A 1B0TA 4FJGA 1UFKA 3IGNA 3CJCA 4O44B 2E1EA 3UFCX 1SJ4P 4K2JA 4OHZA 1EQYA 2F77X 5U47A 4CJUA 3RJHA 2FBXA 4BRMA 4GC6A 2J76E 1F5SA 1K0TA 1S8OA 4AM7A 2WVFA 3MCAB 3ENBA 4C1NK 3VQDA 4PGYA 4UB3A 3KIOA 3BS5B 5AI4A 1VQPN 4NO7A 1HNXK 3RJFA 1RP5A 2QE5A 4NXMK 1U1LA 3B8HA 3BM7A 2GMLA 1QZ5A 3AGKA 4BDYA 5G5HA 2JJ4D 3HPOA 1HMVA 2PXIA 2EG2A 4FLWA 3G6XA 1HNVA 3KKAA 2VPWB 1TL4A 2ETJA 4F5PA 5CYMA 1JJHA 4DU4A 4CK2A 3OYFA 5HQLA 4CZIA 1QQ6A 5KT7A 3R5GA 2EKYA 4DV2F 4YOXA 3K5NA 4GRSA 3A8EA 3CMEN 2FPLA 2E1ZA 4MKBA 2ZJQQ 3QUBA 3WXLA 3PFEA 2GA7A 3HSDA 4QW9A 1OVYA 4GO5X 1NXIA 1NK7A 5EX0A 3CMES 2E4LA 3ENAA 5HLFA 2QKKA 3V9WA 2G5IB 2DGQA 1CQNA 4JI3J 4FJLA 2DY9A 3ZDCA 2B9XA 4RBUA 1JL2A 4W5QA 2EBGA 1SC6A 3D2FB 3O9SA 3KD5E 4J2BA 4JK7A 1CLFA 1LW2A 2BQRA 2YWHA 1BA0A 3SSSA 1WNEA 2N7YA 1KAZA 2F8KA 2Z30B 5F8MA 4RPZA 3O08A 3RF9A 9ATCB 2V6AA 3SLCA 3AD7C 2I1QA 2M9NA 1UW4A 3KLIA 2UV8G 2H5XA 3JPSA 2ASYA 1NLVA 2RPIA 5AQJA 3CD5A 1M5PC 5ADXA 5KT5A 4H0OA 3V9SA 2LU1A 2FC9A 3PR4A 4C3MA 4KTZA 3J8AA 4OFZA 4IOCL 3ZDDA 3NNAA 4KAZA 4QWDA 1LK7A 2BCQA 2H3VA 2UUBJ 5ELZA 3VERA 3RJGA 3EL2A 4N47A 2DHHA 5HMWA 1Y00A 3AXKA 1TKZB 1C7YA 2G13A 2IRUA 1YJ9N 1VC0A 4FWLA 5AE3A 4K5SA 1KQFB 3UB5A 3NUQA 1RWXB 3FEZA 4K7QA 4O5KA 3KWGA 4OV6A 3ZT1A 1HARA 1RDFA 4PUOB 4DL4A 1XEZA 4IQTA 1RCOB 3C15A 1YJ9S 5KFWA 2F4VJ 4YN4A 3AB4B 2NLWA 4J03A 2W9CB 2KP7A 1W7AA 2G4BA 1NU4A 2YH1A 4DL7A 4TXSA 3S8SA 3B4DA 3DCAA 4OHXA 1N0VC 4NL9A 2E20A 1Z4OA 5F3TA 2VC1A 3SQ2A 3QYYA 3BDEA 5D0EA 4O5CA 5HRRA 4CZKA 4FJMA 1FERA 3F56A 4GNIA 3NNHA 5C7PA 3VQCA 2HOIA 1JL1A 4M2YA 5K8PA 3CCRN 2DD8S 1R3NA 2E6LA 4KHPJ 3SQGB 1S6PB 2YI1A 4CE9A 2QMWA 3ADAC 2RRDA 2WSCC 1TR0A 4ED5A 3HJVA 3NMUA 4R8UB 2KYZA 3D7EO 3R6MA 2DXDA 4PWWA 2YX6A 1M1KO 3CCRS 4ZVHA 1RCHA 4X4PA 2W4CA 5FPNA 2BRKA 3SXLA 4DTNA 1BWFO 1C6VA 4CLSA 3C6UA 1XBWA 1X66A 4PL7A 4IC9A 2NXJA 4I6MB 2ROEA 4DMNA 2DGZA 2MQ8A 4EBCA 4JWMA 5B0DA 5ALEA 4JV5J 4KGXB 4PKIA 1XNQF 1W7WA 2CRXA 3HVRA 2WFAA 1NHVA 1KEJA 2N7CA 1NHUA 2EWHA 1QE1B 4C4SA 2PZSA 5I3UB 1JCFA 5H9EK 5DJBA 1LAVA 1PVPA 2Z56B 3DM2B 3ZX2A 1M1GA 1COKA 1J5OA 1D9DA 1KLMB 2KQ2A 3PO4A 7ICJA 2ZZNA 3QAEA 3O9TA 5DB6A 1Q95G 4JKDA 3F2KA 3OFFA 4LSLB 1KOHA 1XQIA 4DJBA 1TV6B 5GAEU 1IBKK 1B4FA 5J2BA 1B0VA 1T4GA 3NS6A 5LMNF 1XR7A 1J6ZA 1Q53A 2GVDB 5D78A 5AI5A 3AQEA 5HMZA 4FYXB 3QU7A 4M0AA 3FAHA 2X78A 4XH1A 4P9SA 3LUYA 2CQBA 1TUWA 3O1BA 4ED0A 1BNOA 5AM4A 1YRTA 3KUHA 2KFYA 2FVSA 1XC3A 5BRFA 2RHQB 4OMFG 4C2MA 5DM7L 2DCUB 3GP9A 3AARA 2DPIA 1QQ5A 2E5GA 4FPBA 3T5HA 2FJEB 3WKDA 4C8NA 2CAJA 2X1GA 4CT9A 3NRBA 3PW0A 2CADA 1WKKA 2YJFA 2OEMA 2YX8A 1ZQDA 1NGDA 1YJWS 4RQ7A 4KMUA 1HNIA 2Y1RI 2RUGA 1GEHA 2LP4A 3UNYA 5AJ3F 3LF0A 5I42A 1W0HA 1FXXA 3J80Y 1N36F 4Z2XA 1KWMA 2ZC4A 1KDHA 1X5OA 3R2CJ 6FDRA 1FFVA 3GV7B 3EUNA 5J29A 2J4RA 2QL7B 1KC8T 4CJ7A 3AVJA 3HRDD 1HQUB 2W25A 4MKVA 3O5BA 4G9BA 1RZMA 1YGYA 1P27B 2XCPA 4HACA 4OZ5A 3MEDA 5BYSA 4OKEA 2E1AA 4OZJA 4EENA 4DR1J 1X6JA 4RKUC 2P9IA 1TUVA 3MGIA 2AD9A 4DUTA 2R7XA 2RILA 4WPAA 2YTCA 2OM6A 4AHSA 1KS2A 3H5SA 3C5GA 4FF4A 4IRCA 1VJQA 3RGIA 3KUEA 3K57A 4GMJB 2CH5A 1BQMA 4WYLA 3VF4A 2JDJA 4B1XB 2YHXA 5C2FA 2DGVA 5JXSA 4NLWA 4QZHA 2Z2ZA 3PIOL 3CCMN 2C3PA 4CF9A 1W25A 1K47A 5KFOA 3ITHB 4CHYA 5DB7A 4MLEA 3P5BP 1VHXA 4LF6K 1CEZA 4L76A 1TFWA 4MH8A 3CMAN 5D4NA 3H4DA 3Q8UA 3PUFA 3CCMS 3MPDA 1HD1A 2Y0SC 3BGRB 2HG4A 4QIVA 2K1RA 3IXQA 3TR8A 4W90B 3PDNA 1HYVA 2HZCA 3AJDA 3CJ9A 1M5KC 5GIPA 4G65A 3CMAS 4PAAA 3OL6A 3C7NB 3HJEA 3R7BB 1C4CA 2XSFA 1KVBA 1ZD5A 3MK6A 2HWHA 2GX9A 3NH0A 1UPMB 3MTJA 2G8VA 2IMWP 2A3ZA 1N5VA 3U4LA 3HZGA 2PC6A 1SC1B 2Q36A 1VDHA 3AOBA 4H4MB 1QD1A 4DL5A 3LPUA 3QRQA 1JMTA 2HRTA 1VYAA 3DFEA 2BVZA 2VOPA 4ICLA 2NRTA 1FEEA 4FO6A 3B82A 1OPZA 4MFFA 4CHOA 5EE1A 2H5JB 5KGWA 1RXVA 2GVZB 3VQ4A 4O3OA 1KR4A 4I2GA 1SIWB 2PFUA 2CJ9A 1PYSB 3H90A 3U3YA 3GFYA 2E44A 2BKEA 2LLZA 4EZ9A 4GMKA 2E5IA 5ALXA 2OELA 3C6TA 2QTDA 1QTMA 3ZSQA 4V1Ak 3ZFVA 1HD0A 2UP1A 2XSJA 4ZP6A 2YY6A 2MHEA 1NEEA 2FXUA 2UVRA 2VOOA 4CIEA 4RW8A 1U2RA 4DR2K 3HO1A 4MLHA 3MR6A 1HPMA 4ID5A 2B4OA 3QGPA 4ZN1A 2ZWOA 1FX2A 4MTPA 1RAGB 4YN3B 3TADC 1XMOK 3KWIA 3ZZUA 2GV1A 4CE6A 3CNQP 4PKHA 4CF0A 4DU7A 4LBHA 5LXYA 5BJRA 4ZTJA 3MAAA 1AW0A 4OPHA 3DGPA 4YMMA 2ZF5O 1U02A 4M7XA 2I1RA 1D9AA 1WWUA 2FVCA 3S3MA 2YQ0A 1KQQA 2QTWA 3BGLA 9ICEA 1RILA 4TUQA 1X0FA 2EEYA 2VH7A 1E3MA 8ICVA 2RRBA 2OEHA 3GDXA 1B22A 4RNFA 4OZ0A 3AQPA 2BUPA 1O51A 1CVJA 1N34K 3V6DA 4OYPA 1EARA 1C0UB 1CBKA 2KT5A 1RT6B 2Q0UA 2YHWA 2CZ9A 1FJGF 4FS1A 3VVTA 4C4RA 4ATNA 2EC2A 2HS0A 1FK9B 1T9XA 4IS7A 4ZCKA 1B3TA 4TY9A 4JMUA 2A6OA 2MB0B 4JKAA 4KV8B 3QSIA 3OD2A 3K1ZA 3Q8VA 1ZQLA 1SXDA 2OPSB 1UZHA 2RQMA 3PIPL 2L3MA 1BD6A 9ICFA 1B9FA 4H5RA 1KCFA 2QWPA 1XSPA 4BG9A 1X40A 1ZBFA 2PYLA 2EI5A 4FM1A 3PR5B 3UDVA 3V81A 2B5JB 4DTRA 1WC6A 4L72B 2B8PA 1U6ZA 4ZITA 2YWEA 1A76A 4NJ8A 5ETLA 3AH6A 4KI6A 2HBKA 1XR5A 2W9BB 3F9KA 2SXLA 2P6RA 4WIQA 1ZBTA 1VQ6N 2JFKA 1W97L 3DRSA 1H98A 4RNOA 4YD2A 1T3QA 3VEZA 4B9VA 4FVMA 2OPQA 3PY8A 3MEKA 2HF4A 3ULDA 1KQSR 1VQ6S 3QU2A 4JP8A 4HYKA 2HHPA 4OYWA 3BB5A 4B8CA 4NASA 1V3RA 1FRHA 3GU0A 3SQ4A 4Z4EA 3WEEA 4PXDA 1C0FA 2V4JA 4AHCA 1QQ7A 5D8HB 5HOOA 5LL6Z 5KQDA 3TQEA 1S48A 1ZQTA 4WFAL 1F5AA 1T03B 4WYWA 3T1YJ 1TL7A 9ICRA 3PZPA 2IVYA 4F5NA 3EXCX 3VAMA 3E01A 3I96A 3OYNA 3ZT3A 2Z8QA 5EUHA 5FIIA 4OJHA 1YTUA 2YN4A 4QJFB 4OHVA 1S9EA 2CWXA 5EX5A 1XO1A 4OYXA 3EE3A 4KLUA 4ZIVA 5AT1B 1BISA 1EWRA 1J2VA 1V3SA 4X66K 1WHWA 3M7VA 2PA8D 1KLNA 2PSZA 5BYQA 2YKNB 1RB0A 2I9SA 4K0KJ 3LW5C 4DV5F 3IUCA 3OSNA 3O5TB 2AQ4A 3M6UA 3EE8A 1RI7A 4JBCA 3V6KA 2KEYA 2KXFA 4ELUA 1X31C 2VA3A 3TTCA 2XS7A 5AIBA 2H51B 4NLUA 1K73T 3MAQA 1QVGR 3TFRA 4KB7A 1JLGA 5F0UA 4I6AA 5CQGA 3QT8A 4E8UA 1YVNA 3KLVA 4LF5F 1IQTA 5ETVA 3V1OA 3FQKA 3DRPA 2OLWA 3SD7A 2B0CA 4LZGA 5CA5A 4AHUA 1P1TA 2IY5B 2B6AA 1ZAXA 3KZBA 3VVUA 4LH4A 1ZQBA 3UR0A 2PFFB 2OEJA 1ATRA 3C16A 4LMZA 2D5RA 3I0SB 4PQUB 2NQPA 4F67A 4R65A 2CJQA 2A1AA 1DXSA 2VFUA 3PYDA 5B0CA 4IXCA 2UXDK 3VA0A 2JV3A 1MMDA 3JXOA 2IOFA 4DR3K 2V5HG 5J2FA 4DFKA 1NJIT 2X7IA 1R31A 4Y1DA 4OX9K 4HDGA 4ZCIA 3RRHA 3FNNA 2WZ1A 1C0MA 4K43A 4O8KA 4WBFA 4DV1K 3BZQA 1YKWA 1RWPB 4DOAA 4KLMA 3H8JA 1ZD3A 1SAZA 3UPFA 5DDOC 1K8KB 4DV0F 8ICKA 3KKSA 1QSLA 2D6FC 4FBUA 4K4XA 2JHEA 2R8KA 1QQMA 2XYHB 4P2HA 8ATCB 2X6SA 3HBTA 2F8TA 2YHBA 4OPKA 3AEVA 1GOCA 1RBVA 2HB5A 1VCTA 1UZDA 3UXPA 2ZOFA 2DL0A 3EICA 4LF4J 4LSNB 1WEXA 3O3LA 4WQ4A 4CIFA 3ZD8A 2M8HA 2G0IA 5I3QA 4LFAJ 2CVIA 4AF1A 4K4GA 1HKCA 2AKWB 3V7JA 2H1YA 3THVA 4ANDA 1H0HB 1LWEA 4PZNA 3HVTB 4KPYA 1EB0A 2FHKA 4HTJA 4DXLA 2AIRB 3MPYA 1FTRA 4FF1A 4OO1J 1U0HA 3G2XA 4ALZA 1OXJA 2HPUA 3F73A 1MWMA 1O8BA 1HUOA 2NXCA 3LPEA 3QJPA 1SV0C 3TWHA 1HIYA 4C48A 3B0XA 2GIQA 2A2CA 5A8WB 1B92A 2KN4A 2CPJA 4LC9B 3JSMA 2I8EA 4IFEA 4DR6K 2GGPA 3BF1A 2IBOA 3G8SA 2VHGA 1NBWA 4ED8A 3TA1A 1R0AA 1SXLA 4KQZA 2G2ZA 4J7CA 3RUBL 3CDAA 4NLVA 1J5EJ 1UT8A 2AYGA 3IV6A 2LYBA 4DX5A 3M8QB 2GQCA 1HI0P 2KKZA 3MR7A 3MDQA 2ZIWA 3KLGB 5TISU 1B64A 1BUXA 3MM6A 3K4GA 9ICBA 4J9UE 2E5SA 1X4CA 4RBVA 4BE1A 2OA8A 2XMMA 1RWWB 2BUNA 2IM2A 3F2DA 4HH0A 5I4MA 2EBEA 4ZJOA 5DDRC 4M5DB 1Y3JA 3OL8A 3W61A 2ZHBA 2RE1A 4UY8T 2V8DA 2XB2D 3R9PA 4RCHA 4IG0A 1P9YA 4USMA 3FSIA 4BR2A 4ECTA 4ZPAA 3KLEB 3CPWR 4CJWA 3THWA 1BCMA 5CWRA 1X7VA 4DV4J 4A8FA 1HNZF 4DV2K 5A0YB 3M8RA 2PGCA 2M4MA 3Q8QB 2B56A 4I2JA 5HP1B 2UUAJ 3QNMA 4GXIA 3C65A 5KFHA 1TYQA 4DTPA 3QT7A 4FPAA 2M88A 4M5NA 5GAGI 9ICVA 1KN6A 2X3GA 3EWGA 3QFUA 2D8CA 5J2PB 4H0VB 3LDQA 1CULA 1RAFB 1UT5A 3DV9A 5HBMB 3EVWA 5EDWA 4CFAA 1IIPA 3VESA 3H5UA 3QEXA 5THWA 3HM9A 2D1CA 1CS4B 3WQUA 2E1RA 2RIJA 4DFPA 2FSNA 2AT1B 1DLOA 1VSLA 3D1QA 2E5HA 1TKXA 3D1OA 1PK3A 4HTUA 2MSSA 5HL7Q 5BXIA 1U7LA 2HHHK 4JKHA 3RAMA 3HLUA 4DV7F 2VCPA 3QGIA 4UB8U 1T95A 2LMIA 5J2NA 5AKHA 4DUYF 4CHQA 4CNYA 3S6EA 1RU2A 3FGVA 1KQSM 1AUSL 1AFIA 4AHTA 4DO9A 2HAFA 3VHQA 1VSEA 3IP0A 3JAMO 4Z6EA 4U67Q 3HP6A 1TKDA 3NF9A 2HK3A 5BRDA 1K5OA 2ZM6F 1C1CA 1E6YB 4FE3A 4AYBC 5F8LA 1Z1VA 3N6MA 4L6V3 4KKOA 3THPA 2N1RA 1RHQB 2PI5A 1G3OA 2IYIA 2NRWA 1MROB 1GMVA 2DKZA 3NWRA 1YAGA 3P38A 2PMZF 2ZUGA 4NLTA 4UTGA 3SQ1A 2B4VA 1WG8A 4U8VA 4LFBJ 4X64F 1WWVA 3H0RB 1F9HA 5EY4A 2BOPA 4R0JA 3JXUA 3MN5A 1UJ5A 1Y0HA 4X5VA 4DR5J 4U96A 2J9DE 3P45B 2MQQA 3BQ7A 1F60B 1CJUA 2BCSA 1GH8A 4CGZA 3NVYA 3VTIA 2XCAA 3NH1A 2QWQA 3UD4P 2WFBA 2W6LA 2RS2A 1LAWA 1CC7A 3EWAA 4CH7A 3C5FA 2JR5A 4B9UA 3BPSP 2C3MA 2W2OP 1RA7A 5AKLA 3LWMA 3GYNA 3EM1A 1IKVA 2A10A 4A61A 4G9ZA 2UYTA 1X4DA 2KT2A 1J27A 1VC5A 1H74A 5J2AA 1ZQRA 2J5AA 5GAGP 2IRYA 3R97A 3A0IX 1YJVA 1WUDA 3OTDA 4B3TJ 1GMUA 4WKYA 2ADBA 3DXMB 2E8PA 3Q8PB 5AM5A 2M0NA 1F3VA 2RB7A 3Q8MA 4ZVFA 4ECUA 2JX2A 2YNGB 5F0WA 3M6VA 1ZBHA 1IWAA 4TSXA 4FK4A 4ISFA 1I5OB 5GINA 2FMPA 1URJA 1XNQK 1UAWA 2QLJB 3SDEB 7FD1A 4A8SA 1EQ0A 1FX4A 4N8OA 3QIDA 1ZBSA 4LH5A 2ESEA 2H3GX 2ZFHA 1TK0A 3FSXA 2LDIA 3FZBA 5ALWA 3CJAA 3AODA 2YWFA 4FNIA 5BPCA 3H98A 4UARA 3L09A 3SAHA 1HBMB 3BUZB 5J0UA 3VAGA 4OJ3A 3Q8RB 1PZNA 3HHEA 4BR4A 5LMNK 4FF3A 3T69A 2JVOA 2D3ZA 1HLWA 4X62F 3MMBA 4FXVA 1X3MA 2ABYA 3KDNA 4YR0A 3LYSA 1WEZA 4WWSA 2M7SA 4G1PA 3FK4A 1T6CA 1T05B 4MK7A 2M2BA 3QNWB 1HHQA 2J9EA 3PTWA 1ZQAA 1WSRA 1C0TB 1M1HA 2E1PA 3G8TA 4UBCA 4CD1A 1GAOA 3OYBA 4YR2A 4MDAA 2N4CA 4RBTA 4EBEA 4RPXA 2RKIB 2B9EA 1HNWF 4QZVB 2FY8A 4CZGA 1YJRA 5CEHA 2VV5A 4NYZA 4FJ5A 3CD0A 4UOGA 1N36K 4M9HA 5L8RC 4JI6F 1MWQA 2XLIA 3LH2S 3MM8A 2ASLA 3MEEB 1N5YA 3WKBA 3N4MB 3DI6A 3M8YA 2KXHA 4L3QA 1ASUA 2CQIA 3PRVA 3MUTP 4XIUA 4B3RF 4B1ZA 5C15A 3BBCA 4UB2A 3AD9C 4PWDA 1AYEA 1I1GA 3D28A 3ULHA 4BRLA 3EJMA 4X2BA 2HLUA 2DUYA 1FI4A 4QOZB 3PEHA 3PX6A 3NKYA 2W7AA 2KHCA 4ECYA 2HHVA 3CJSA 2VWBA 3MXHP 2VJ4A 2X1BA 4J91A 3SFUA 3I76A 4RQ0A 2XM3A 1VRUB 2O8FA 2IGIA 3D6JA 3OR1B 2DY4A 3CPWM 5CCLA 3CXCR 2B4JA 5KRSA 3SQOP 5ALPA 4LF8J 4JK9A 4C23A 3MZIA 2Q79A 4KLDA 4A5AA 2KXNB 3FZFA 4WFNQ 5KAFU 1JIHA 4UB5A 1YXQA 3D45A 2RQ5A 3SJHA 4LFCJ 4FJHA 4JYAF 1MC8A 1WUAA 1IQZA 5ALDA 4LF7J 4BXOB 4DKWA 4M95A 3D6HB 3OFGA 1QQOA 1WOPA 3CW2C 5J2CA 2R7QA 4DTXA 8ICEA 4B8AB 3ULEB 1HBOB 3G6YA 1VFJA 5EE9A 4DF8A 3DLLL 1U2CA 3QICA 2QB0B 4RLEA 4PG8A 1L7OA 5J2QB 3AL0B 3VR1A 4CNZA 4OI4A 5C10A 3DLKA 1VIXA 1WF0A 1PBUA 3CFPA 2QWNA 1SWWA 1IWGA 5AE1A 1YG0A 4L3NA 1G2EA 2XI3A 4KO0B 2F44A 4RW9B 1C1BB 3C6HA 2YTUA 4JI2J 1WTBA 1GLFO 4UY85 3OXFA 3WK6A 3CJ7A 1YBUA 1X4FA 4P52A 1YUWA 1VSKA 3TZYA 4NI2A 3TPQA 3FZKA 1XSLA 1OH5A 3HSJA 3OYMA 1Q18A 2HOEA 2D4WA 4TYAA 5IWAJ 3HMJG 3TVKA 4ISEA 2ZIVB 3FCWA 3DXBA 3BGFA 4DS4A 2L41A 3SBTA 3NGKA 1H2TZ 1SCJB 4W5TA 3UWTA 3HFVA 3QO9B 3R27A 1W2IA 4DR7F 1HNXJ 2QKBA 4TURA 4MK9A 2QZ8A 1YRXA 2XY7A 4EHUA 4DS5A 3NCQA 4NXMJ 3C2KA 4K4TA 1P8ZA 4YUDA 2XMJA 4KLJA 3LP2B 3NLCA 3RTVA 2HFOA 3BF4A 4ED7A 1U1PA 1LWCA 3SI6A 2B6GA 2Q0ZX 2ZH6A 2X74A 1QH9A 2P9SA 1RT7B 2IRXA 3O6WA 5J2HA 4UF4A 2V69A 2ZNYA 4F36A 1VR6A 4PWUA 2WONA 2O8BB 4A48A 2HNZB 2A6MA 1IBLF 4ISGA 3UCZP 3ZYYX 1FVQA 3M8PB 5LY3A 2ZJRL 4MJKA 4Y2AA 5KNIA 5CRXA 3ZLJA 2ALYB 2IMOA 2BXJA 4KI4A 3OY9A 5ALOA 1HJOA 1Y4ZB 2NREA 4B3SJ 1A6LA 4J9VA 3M30A 3NS1A 2IPOB 1SZ2A 4IDKB 1NDLA 4AP9A 2Q0RA 4P6QA 1S9GB 3OL9A 2EVZA 3V7KA 2UU9F 3C2MA 3QBWA 3FZLA 4I2HA 2C2NA 1JLQA 1RTIB 1FJGK 3MN9A 1C20A 1H3DA 2WSFC 2H3IA 4NL5A 2B7CB 2RS8A 2K3KA 1JXBA 3OUYB 4JRQA 3E58A 3FCVA 2D3OR 3UCUP 1VLBA 3TX8A 1WEYA 2FC0A 1KTVA 4ZS6A 1TVAA 2EZYA 1ZQJA 3V4IB 2OXOA 4ERDA 1NUEA 3ONNA 4PXEA 3TUJC 3BH7B 2OZMA 3RJIA 5AQLA 1YIJN