1L5UA

Crystal structure of bacillus dna polymerase i fragment product complex with 12 base pairs of duplex dna following addition of a dttp, a datp, and a dctp residue.
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*AP*C)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l5uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l5uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l5uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l5uA01
4YMNA 1MSWD 1BPDA 4BXOB 3FDSA 4E7HA 4KHYA 5HHHA 2PFQA 4J9QA 1L3SA 3V7JA 5DG9A 8ICWA 2FLPA 1SKWA 4Z4FA 4Q43A 4CJVA 2OPRA 1KLMA 3L2WA 4P4MA 2ASJA 4IRCA 4FJIA 2W9MA 2W8KA 5DLGA 4DQPA 4CJUA 3L2QA 4Z4EA 3ZCMA 4KAZA 4B9MA 1KFSA 4GXKA 2ZUDA 3UQ0A 3TQ1A 7ICLA 3T5JA 2D0AA 1U49A 4EZ9A 4UQGA 1WSEA 2C2DA 5J0TA 3H7IA 3T5LA 3DLGA 4KLEA 2WONA 4ECTA 4AHVA 1EXQA 3P83D 1Z00A 4FZZA 3DLHA 4CEOA 4DTNA 2E4LA 3RB0A 3V9WA 4GC7A 5HLFA 4F3OA 3RH6A 4HYKA 4E3SA 3B6PA 1JL2A 2F8TA 3GIMA 3P5JA 5J2KA 1RBTA 1CZBA 4W5RA 3K5LA 1FXXA 3GV5B 3DRRA 3V6HA 4DL4A 2P6UA 3V1QA 1TK5A 4NLKA 3UIQA 4M3WA 4FJ8A 2BCRA 4PPXA 3PW5A 4I2IA 2KN7A 2AJQA 1BI4B 4DQIA 3LAMA 4FLWA 4CJWA 4NLNA 3I0RA 5CR0A 2ISPA 8ICBA 4CECA 5J0PA 3C1YA 1RDCA 1LWFA 4IKFA 2G8HA 3KK1A 3CQ8A 3V6JA 2P6RA 4PQUA 1C6VA 3Q8QB 1TAUA 2I1QA 5KGWA 3CM5A 2G8KA 4FBTA 3PR5B 3AVLA 4AHTA 1FK9A 1JX4A 3DLKA 4ID1A 1VSEA 1Q8IA 4FYDA 1D9DA 3C5FA 2W9AA 5DG8A 4N47A 4H8KA 4LH5A 5J2IA 4O5EA 3MXJA 4CIEA 1ZQMA 4N76A 2OYQA 2PI5A 1S1WA 1HNIA 4YD2A 5KGXA 4B8AB 9ICIA 2IHMA 4NXZA 3TABA 5KFQA 3LPUA 5KFLA 3NFAA 3LWLA 3P1GA 5BOMA 3CG7A 2IMWP 3B0YA 2XO7A 1J53A 4CFDA 4O5BA 2W9CA 4F5RA 3CYMA 7ICKA 5DB8A 3VQBA 4G1QA 3T3FA 1KVBA 1BIUA 2DY4A 2YNFA 5KT5A 5KT4A 1RTIA 4FLVA 5KI6A 4CFCA 4OKKA 4BE1A 4CJFA 3C94A 4PGQA 4ELVA 3N97B 3V7KA 3KKSA 2AU0A 3EY1A 1SL2A 4F2SA 3QZ7A 4DF4A 3CM6A 3RWUA 1ZQEA 3DLEA 3ETLA 4MQ3A 3LALA 2D0BA 3U3GA 4CJ4A 3TFSA 5F9LA 4FBUA 5KFKA 4E7KA 2BCVA 3SQ2A 1ZQWA 1ZETA 4I2EA 4PGXA 2C28A 3JPRA 5KG0A 3VQPA 3SCXA 5DQHA 4N5SA 4RUAA 4ZH4A 4I9QA 5FRNA 3OS0A 2HB5A 1RZTA 4GVMA 4UAWA 1Z00B 3QEAZ 3JPTA 3BGRA 2HMIA 4J9OA 4Z4CA 3BQ2A 4IR9A 1J5OA 1RT6A 3TAFA 5FDLA 1YTUA 4F5OA 4FCYA 4IQUA 3ZSXA 8ICEA 1C1BA 2HHXA 3AV9A 5KFYA 4RW4A 5KFZA 3OYJA 3ZSVA 1CEZA 2I9GA 2GWSA 4RPZA 3V7LA 3KHLA 1RBVA 1WNSA 4GMJB 4KB0A 4XA5A 3AUOA 1TL1A 7ICEA 2ISOA 4QWBA 3TARA 3RH4A 4IG0A 1QLNA 4ECSA 4R65A 1I3AA 4GLXA 4H4MA 3AO1A 3ZSYA 3EW9A 2X78A 4QZAA 4KLFA 4KMUA 3ZDAA 5HRPA 1UA1A 3SPYA 4GXIA 1ZJNA 3KD5E 4CF1A 5C25A 3ISBA 4ECVA 3NF9A 4EYIB 3U3YA 5CYQA 1NKBA 3TANA 2IGIA 3M9NB 2NRXA 1BPZA 4MEYA 2BGGA 4FJ9A 4E7JA 4KTZA 3ZDDA 4DQRA 4Q8FA 4ELUA 4Q8EA 4O3SA 4QWCA 2BKEA 4Z6CA 4DU3A 3IHQB 3UXNA 9ICNA 1VSDA 2OWOA 2FBYA 4EBCA 4QZIA 3K2PA 4ED6A 3O3GA 1QS4A 3SJJA 4I2FA 3G0ZA 3HK2A 3HW8A 5KG5A 4KLLA 1ZJMA 4FVMA 2FLLA 1IG9A 5L1IA 4M0AA 2ZJ8A 3RJFA 4CK1A 1ZQNA 2NRWA 2VWKA 3L2VA 4JV2A 2AQ0A 1QTMA 4CF0A 2W9CB 2NRVA 1C0TA 4JWNA 5J0QA 7ICJA 2PY5A 1DTQA 3DLRA 3G6VA 2PXIA 5KFOA 3F73A 1VSMA 4Z4HA 1ZQRA 1U4BA 1JLEA 3VQ8A 3IS9A 7ICHA 4JUZA 2HVHA 4YVZA 1ZQIA 1SKRA 1TKXA 4FJMA 2NRTA 1RDAA 3DYAA 4CJ3A 1N5YA 4NY8A 2OZMA 4E89A 2FC0A 4CEFA 4M04A 1IO2A 2EX3A 3C2MA 5KFJA 3RJGA 2B5JA 3GQCA 5KFUA 1TK8A 1RNHA 4UB3A 3QEWA 3GV7B 3ZT2A 3H8WA 5KFWA 2R8GA 2OPQA 3Q8KA 3HPHA 3QO9A 1ITGA 3HP9A 1CUKA 3LAKA 3JYTA 4UB2A 2G8IA 5J0RA 4O5KA 7ICQA 4CJTA 5F9NA 1RXVA 3B0XA 4YR3A 3JPQA 4I29A 5HRRA 1A77A 1NK6A 4UB4A 5J2EA 5EU7A 4F50A 2X6NA 4KLHA 4F4ZA 4QW8A 1PZNA 4W5OA 2VG7A 4QZCA 5KFAA 4LSNA 4KLGA 9ICWA 1K1SA 2XHBA 4YMOA 4PHDA 4NYNA 5CZ2A 1ZQJA 3L2RA 1D8LA 2W8LA 1NOMA 8ICTA 1T03A 2ATLA 4PGYA 4J9PA 1KRPA 3QERA 4FJHA 4DSKA 3FYHA 3KJVA 3EPIA 2FMPA 4B9LA 1TKZA 1BQNA 3L8BA 2FBXA 1ZQVA 1RT1A 2R8IA 4M41A 2DFHA 1S97A 4JRPA 1JLAA 4YR2A 4RPYA 3SI8A 3V1OA 1ZQUA 3AVAA 5CHGA 1T8EA 1KEJA 5HMMA 2YNIA 3OYFA 4PUOA 1QQCA 1JLGA 4I9LA 4FJXA 3H8SA 4KN7A 7ICGA 5EWGA 5CJ7A 1XSNA 1W9HA 3HT3A 4PWDA 8ICGA 4J9KA 2OPPA 4FM0A 4K4IA 5KFGA 2ITGA 3I0SA 5DBBA 4IRDA 2FBVA 4RW6A 4CF2A 1IH7A 3GILA 4B08A 4OGEA 1G15A 4HUEA 5DB9A 4FO6A 4NCBA 3TWHA 4B3OA 4J2DA 4B9SA 4C8KA 3RMBA 4DTUA 2F8SA 4QCLA 1Z25A 4I2BA 3MDAA 1B22A 3MR3A 1U45A 3AVIA 4LZDA 5L1KA 4DFPA 5J0YA 1N56A 1JMSA 4UB5A 3Q8MA 4R5PA 3RAXA 1WSJA 3BQ0A 2Q3SA 1LB2B 9ICBA 5CB1A 4RNMA 2Y1JA 1VSKA 3ISCA 2XY6A 2F1JA 4FLTA 2HHWA 4J2EA 3THVA 3C95A 1RPLA 4HHTA 1K1QA 1BHLA 3RMDA 5K14A 3K5OA 5BPCA 1RTHA 4FW1A 4FK0A 4DTSA 5J0UA 2KFNA 5KG6A 2O4IA 3AO4A 3KLIA 1C0MA 4LVSA 3SPZA 3QEVA 1VSIA 4F5QA 3TI0A 2JEFA 4Z0UA 2V4RA 4RG8A 2KZ3A 5IIMA 5KFDA 4RUCA 3ZSOA 3GIJA 3OYIA 4B9TA 3UPQA 5DDMA 3M8PA 2DTUA 1ZQLA 2VANA 3SV3A 2HHSA 3QEIA 1NJWA 1JLQA 1NK8A 4CEEA 4DF8A 1S9EA 2HHQA 4O3NA 7ICVA 3OYDA 4NM2A 3C6TA 4IDKA 2JZBA 1Y88A 3VA0A 1HRHA 1NOYA 3JSMA 1B43A 3VN5A 3JPOA 5FRMA 3PO4A 3HO1A 3LPTA 5IIIA 4KLOA 1LAWA 3S3NA 3RBEA 3SUOA 3LK9A 1N6QA 4K4HA 2VG6A 4AHUA 4IFVA 3OYEA 4B9UA 4I27A 4YG2A 1TAQA 3EPGA 4F4KA 3VQQA 1D8YA 4MFAA 4I2CA 4CIGA 4E1NA 1BL3A 3OYAA 5J2HA 3OGUA 2ZE2A 2ZUCA 2UVWA 4IG3A 4KPYA 2BDPA 4BDPA 5J0OA 3Q8LA 2EHGA 3HL8A 1XWLA 3RB6A 4CJPA 1HPZA 3SYZA 2A1JA 1S1UA 4E7IA 2HHTA 1U04A 4RNOA 1ZYQA 9ICAA 3VQEA 5EOZA 5KG1A 1ZQPA 3HPOA 5J2CA 5KT3A 3SV4A 7ICTA 3S9HA 1XHZA 4MFFA 2XCPA 3RTVA 4NLGA 1MU2A 4M6WA 3KHGA 2C2EA 4BACA 4RU9A 4F5NA 4O4GA 4RQ2A 2G8FA 1RILA 4M9GA 1ZQKA 2A1RA 4F2RA 3MEGA 2M9NA 4ELTA 3SZ2A 2LYHA 3MEDA 1BPXA 4YFKA 4ED7A 4K8ZA 4CFBA 4JK1A 3L3VA 3PW2A 3FFIA 3AU2A 4CGIA 4RT2A 2MUTA 4LSLA 3ZT4A 2IAJA 5J2DA 2P1JA 5E41A 1KFDA 2OZSA 4F4YA 4ZHRA 3ZT0A 1RTDA 2BR0A 1KVAA 4ECXA 1UT5A 3KKRA 1JIHA 1HYVA 3NHGA 1XU4A 3MABA 2AGOA 3GDXA 4CHYA 1XC9A 1U47A 1S77D 2W9BA 9ICUA 3RJHA 3U6FA 3ITHA 5HRNA 4FW2A 1KDHA 4KLJA 3MR6A 3AA3A 3KHRA 2GBZA 3K58A 4TQRA 3VQDA 1A5XA 1NK4A 2UVUA 4B9NA 1XSLA 4DO9A 1CZ9A 2JZBB 3BQTA 4X5VA 3AVBA 3VQ4A 5KG7A 1NJZA 4R64A 3RMCA 5C24A 4FJLA 5J2AA 2XY8A 4KLIA 5BOLA 3LP2A 3OYGA 4KTQA 2R7YA 2YNGA 3V9XA 3SUNA 3S3OA 3MECA 4KHUA 2I5JA 4KHNA 4JRQA 5DMRA 3QZ8A 3RJJA 2NUBA 4CGGA 1JLFA 3AVFA 2ZD1A 4DL5A 1T3NA 2W42A 4CEQA 5KG3A 2YNHA 1KVCA 3LDAA 3RB3A 4Z6FA 1RDDA 4DWIA 4TSXA 4P4OA 4DSIA 1BISA 4UB1A 3AVCA 1B9FA 2KTQA 3HWTA 5HMLA 1FKPA 3ZD9A 2LSNA 7ICNA 4CCHA 9ICXA 3RJIA 1SV5A 4M6WB 4RT3A 5C5JA 3VQCA 5CA7A 3C2LA 4CFAA 5CYMA 4I7FA 5J2NA 5DBAA 3OHBA 3KLFA 3VA3A 5DKWA 2BPFA 4M3YA 4RQ7A 1NK0A 7ICPA 4CHOA 1DTTA 2ASDA 3NH2A 3Q8RB 1ZBUA 2B6AA 2KZZA 3PMNA 1NOZA 3K59A 4IQTA 2MUTB 5KFVA 3WNFA 5KTQA 5KFFA 1QE1A 9ICMA 2FLNA 3NGIA 5KFTA 3V1RA 2IOCA 4JV1A 4DQSA 4QZEA 1O1WA 4CK2A 3ZDBA 3ZT3A 1YTAA 1T4GA 1GOAA 1HJRA 1EKEA 4FM1A 2VA2A 3NF8A 3TAMA 1Z26A 5HRSA 5IIKA 3HSTB 3WNGA 4O3PA 2DFLA 4GXJA 2W9BB 2QXFA 1BQMA 4KB1A 3IRXA 1AROP 1S6PA 8ICMA 3QNNA 1S0NA 1LV5A 4H4OA 1GOCA 3NE6A 5L1LA 5J1EA 4O5CA 1REVA 3BDPA 7ICRA 2FMQA 3ALYA 3HYFA 4DG1A 5J2BA 1TV9A 2ASLA 4CHQA 1RYRA 4DSEA 3NCIA 4J9SA 1C1CA 3MFHA 9ICSA 4YP3A 2BPCA 3RJEA 4FLYA 1ZQCA 5CY4A 8ICRA 3ZSWA 4EEYA 3IAYA 2ZTCA 4ECRA 1SL1A 1SUQA 4P4PA 5J2QA 3E2EA 3D0PA 2FMSA 5KT7A 4KO0A 4FK2A 2XRIA 2VWJA 4KRFA 4HUGA 4YXJA 3NH0A 3SQ1A 4J2BA 1KSPA 1Z3EB 3AVMA 3RJKA 4DTOA 1FKOA 3M8RA 2P5OA 1Q9YA 5EWFA 2AQ4A 8ICYA 4J9NA 5IIOA 1S76D 3K5NA 4EP5A 3K5MA 5KFHA 4KLUA 3MR5A 4O44A 3RR8A 1D5AA 1TV6A 3ZDEA 3MGIA 1HJPA 4DL2A 3SUQA 9ICHA 4Z4GA 5JS2A 4MF8A 4J9MA 5JUMA 3G6XA 2GUIA 3UXPA 5SZTA 3PX6A 4JLHA 2HHUA 3MGHA 2G8VA 8ICQA 2ZQBA 5HBMA 4Y1DA 5D3GA 2IDOA 3HJFA 4G3IA 4I2AA 1WAJA 4ED0A 1NK7A 1V9PA 4TUQA 1VSLA 4DU4A 2MAXA 1TVRA 2Z1JA 4NCAA 1L5UA 3PY8A 7ICOA 1HQEA 2E6MA 2D0CA 4JV0A 4CIFA 1T05A 4KN4A 8ICCA 4CGJA 4ICLA 3PMLA 4DS4A 3OYCA 1S1XA 5IIJA 4LY7A 4JWMA 5DB7A 4ECYA 4M9JA 3PR4A 2KZMA 1CXQA 1JKHA 3ISDA 3C5GA 4O3RA 1NK5A 3MBYA 3C1ZA 3ZT1A 1N48A 4FJNA 4LD0A 4M42A 5CP2A 4MF2A 8ICIA 3V6DA 1UAXA 3NBPA 1KLNA 4NM1A 3RB4A 4QAGA 3N4MB 1S1TA 4RNNA 3DMJA 4FJ5A 1S5JA 5CWRA 3AO3A 4CHNA 3QESA 3ULDA 1S0OA 3QIOA 2FBTA 4RQ4A 1UOCA 5SWMA 3NDKA 4M3RA 4M9LA 4KLMA 9ICFA 8ICVA 3G10A 3LDSA 1B9DA 4BXOA 1QSLA 4E0DA 2X6SA 4KLSA 3NF7A 3EWAA 4M3XA 5DG7A 4FZXC 3Q8SB 1XHXA 4E7LA 4KHSA 1S9FA 2XY7A 1ASVA 3QLHA 1VRUA 5KFEA 1IKVA 4C8NA 9ICLA 1KCFA 1BPEA 5J2JA 3ORYA 3IM1A 1CXUA 1S1VA 9ICPA 3SQ0A 1J54A 3KD1E 2JEGA 2IC3A 4BWMA 3HM9A 9ICQA 4I2JA 4CEZA 4OPKA 5J2GA 4ED3A 4MFCA 2YHAA 7ICFA 1SL0A 4YXMA 3PVXA 4ED1A 4RW8A 2BE2A 3F9KA 4FLUA 3PNCA 1A5WA 4QZ8A 1JLCA 4FS1A 9ICRA 5KT2A 5KG4A 3HPGA 2YKMA 3NGYA 5KFMA 3JPPA 4DLGA 2YKNA 4WE1A 1BCMA 3K4GA 1TVAA 5IILA 1BPYA 4CEDA 4FLZA 4BE2A 4OVLA 1C7YA 4QWEA 4F93B 4CE9A 4K4GA 2Y1IA 5DLFA 2PI4A 1UT8A 4KKOA 3LP0A 3NAEA 2BCSA 3PX0A 3T1AA 3UQ2A 3TAPA 1ZQAA 3AA4A 5J2FA 3KIOA 3ASMA 4QZBA 4I2HA 4UAZA 1LW0A 3H08A 8ICUA 3H8JA 2UVVA 4E19A 1F21A 3MFIA 1S0VA 1RT5A 2PYJA 2WOMA 3CFRA 5CZ1A 3PW4A 4N56A 3SI6A 1YVUA 3AO5A 4O0IA 3MEEA 2XGPA 1ZBIA 3OYHA 2FPLA 2IHNA 4QZ9A 2F1IA 5DQIA 1X1PA 4Q45A 4CJKA 2XY5A 4YCXA 3M8SA 2YHBA 2J6SA 3KK3A 2XCAA 3OSPA 3QNOA 2B21A 1TL3A 4CHPA 1LWEA 1QSYA 3T5KA 4B8CA 3C23A 4QZDA 1S9GA 4DFKA 3QINA 2RKIA 4E1MA 3OYNA 4DSJA 1QSSA 2G8WA 2VA3A 3QIPA 1VRTA 4YNQA 4YD1A 1A5VA 3RRGA 2ETJA 2V4QA 5HP1A 1RYSA 4XIUA 2BQRA 3O3HA 3TR8A 1LW2A 4QOZB 4DSFA 4W5NA 1WSHA 3ZSZA 3CFPA 4JS5A 1HNVA 4BDYA 1XSPA 2C22A 1Q9XA 4I2PA 4O3QA 3O4NA 4IFYA 2UVRA 1WN7A 2J6TA 2VG5A 2BQUA 5KFBA 5KG2A 4ZTFA 5FROA 1NK9A 2P66A 3OVNA 1RT3A 5J0SA 4PHEA 3HXMA 1DLOA 3M9OB 4DL3A 3PUFA 1XO1A 3MXIA 3VQ5A 3E01A 3TAQA 5C42A 1COOA 2IA6A 4AILC 4M3TA 1UA0A 3RH5A 1D9FA 1WLJA 4Q44A 4ZTJA 4FJKA 2AGQA 1DOQA 5KFIA 2O4GA 2BCUA 1VK0A 4ED8A 1RT4A 3ZSQA 5DGAA 3C6UA 9ICCA 1ZQTA 5KFNA 1IKXA 2OPSA 3NH1A 2G8UA 4CF8A 2KQ2A 1J9AA 1WCLA 3QE9Y 3T5HA 4C8OA 1SZPA 2PYLA 1JXBA 4DTJA 4GC6A 5J29A 2Z1HA 7ICUA 3RAQA 3SUPA 4O0JA 5DDYA 4FXDA 2DFEA 4IBNA 4O55A 1Y97A 3QETA 4XQ8A 3NGZA 4Q0BA 1TKTA 3JPSA 3K57A 3AVKA 2OA8A 4DFJA 1NKEA 3VQ6A 5KT6A 3SQ4A 2ZJ5A 1KTQA 4QW9A 2Z1GA 3OYLA 3LP3A 4EBDA 4KLTA 8ICJA 2VA8A 3JPNA 3AA2A 2E6LA 5I3UA 3AVHA 4OJRA 4DL7A 4TURA 3IG1A 4OGCA 3H40A 4DU1A 5DK5A 4FM2A 1ZQYA 4C8LA 1S6QA 3S3MA 2ZUBA 3L3UA 4DOBA 2QKKA 3AVGA 4IQWA 3QEBZ 8ICNA 1RTJA 3DLBA 3UXOA 3B6OA 1NJXA 3KLHA 2P51A 4RPXA 2RN2A 2PZSA 3TAEA 4CGHA 4CJQA 4FLXA 1X9MA 1WSIA 2RDJA 4FJ7A 1WAFA 5DQGA 1ZQDA 2F96A 4R8UA 9ICJA 2A1JB 1HMVA 3PX4A 3NGDA 2HW3A 4FK4A 3GIKA 4CEAA 5KFPA 4ECWA 9ICKA 4NYFA 1HUOA 4F92B 4RQ6A 4HVJA 3CFOA 3C21A 4RQ8A 1ZQXA 3VQ9A 4DOAA 4PY5A 1C0UA 2XGQA 4RQ1A 1U9LA 2PFOA 1WCNA 1EXNA 3PW7A 3NF6A 3V9UA 3V4IA 1JXLA 2ZTDA 2JEJA 1LWCA 1JLBA 4ECZA 3ISNC 1ZQSA 1XS9D 3DOLA 4CJRA 1BIZA 4DL6A 2DPJA 3L2UA 3MAQA 4BE0A 4I2DA 4JS4A 3G6YA 1QHTA 3EYZA 2FPKA 4OLAA 2DFFA 8ICSA 4DFMA 3HP6A 5D46A 4DTPA 3O3FA 4DTXA 5KRSA 1LAVA 1CLQA 8ICLA 4Q5VA 4I2QA 4MEXA 4L8RB 5J0WA 4FJGA 4CEBA 1TK0A 4M45A 4YN4A 4OLBA 5D49A 3KLEA 4CF9A 1RT7A 3OY9A 5DGBA 1ZQHA 2QK9A 3OS1A 2X74A 4DEZA 3HX0A 1SKSA 3LZIA 1ZQFA 1ASWA 5JS1A 3AVNA 4KHWA 2XC9A 2BPGA 3D45A 3QEXA 5J0XA 4CESA 3ZD8A 3H4DA 1ZQQA 1HQUA 1IKYA 4UBCA 5KFRA 4CHZA 5J2PA 3QEPA 4UAYA 2IS3A 3OS2A 4YFUA 4LZGA 5D4BA 1EETA 2WTFA 4F8RA 7ICIA 1C1AA 3TAGA 1ZBLA 1U48A 5KFCA 2JGUA 4AHSA 3DOKA 4TQSA 9ICEA 3OSNA 3WNEA 5L1JA 1NKCA 4CERA 1K6YA 1WSGA 4F3TA 2JEIA 3OYMA 4YMMA 4KFBA 3KK2A 4ECUA 4CGDA 7ICSA 3AO2A 1RBUA 2PFNA 8ICPA 1L3TA 3TFRA 4P2HA 1MC8A 4R8UB 1TGOA 1JL1A 5KRTA 2BCQA 1KFTA 2R8JA 4M9HA 1EX4A 4NLZA 4B9VA 4N41A 4Z6DA 2Z1IA 4QWAA 2ATQA 2HNYA 4LH4A 4KTWA 4R66A 5DBCA 2D5RA 1I39A 3M8QA 3RBDA 3O4QA 4FZYA 3OYBA 2RPIA 3BQ1A 2ZTEA 4F5PA 1UWBA 1IM4A 1VSJA 4O3OA 4BWJA 2Q0ZX 1JN3A 3PO5A 1EP4A 1H38A 1DGSA 4UBBA 2PFPA 4OKEA 3DI6A 2BANA 4RW9A 3A2FA 1S10A 4PH5A 4OPJA 4KLQA 4KI6A 1VSFA 4DTRA 1A76A 2JLEA 1BGXT 1X9WA 4EBEA 8ICFA 4J2AA 4DMNA 4F4XA 4EYHB 4DLEA 5HP4A 2HHVA 4CJEA 4ECQA 1MQ3A 4R63A 9ICOA 3VQAA 1ZBFA 2DPIA 5EWEA 4AHCA 1S0MA 1RT2A 3Q8PB 4F4WA 1WSFA 1T7PA 5KFXA 2H5XA 3V9ZA 2HNZA 2C2RA 1ZQBA 2RDIA 4YQWA 9ICVA 3KLGA 1X9SA 5DB6A 8ICXA 4M3UA 3AU6A 3OHAA 8ICAA 4EZ6A 3NTUA 4FS2A 2BHNA 8ICZA 9ICTA 3DRPA 4DQQA 3H4BA 4J9RA 4HUFA 3RRHA 2V9WA 2NRZA 7ICMA 2A1SA 2ZJAA 4J9LA 1R0AA 1HYZA 3LP1A 1IXRA 3RMAA 1XI1A 1ZBHA 4DS5A 8ICHA 4F91B 5HROA 1ASUA 4KI4A 4QZHA 2P5GA 4QWDA 1BVSA 8ICOA 4ID5A 4CJLA 4KLDA 3GV8B 4M9NA 1X2IA 1MQ2A 1YT3A 4HTUA 4RQ0A 2AGPA 3HVTA 5TZVA 3V6KA 4TUPA 4CK3A 4W5QA 3GFKB 4CJ5A 2BGWA 4FJJA 2J6UA 3OJUA 1L3UA 3SNNA 5HNKA 3HVRA 4DTMA 3LANA 2RF2A 4CGFA 4GW6A 5J2MA 4AHRA 2BQ3A 1TFRA 4RW7A 3OYKA 1ZQGA 1VSHA 4I2GA 3ZSRA 4NCGA 3GIIA 3C2KA 3BJYA 5KFSA 4Y1CA 4RQ5A 1RXWA 3I8DA 3AA5X 3PW0A 1RBSA 4Z6EA 3VQ7A 1JXEA 5L9XA 3LZJA 4M47A 4M2YA 4XRHA 2ALZA 4W5TA 3V9SA 4KV8A 4KITB 4KREA 2F1HA 1L3VA 1NJYA 4AH9A 4DSLA 4I28A 3ZDCA 1RDBA 4QZFA 4BGDA 3AVJA 2IBKA 3OJSA 2QKBA 4HCCA 3MDCA 4IRKA 4BDZA 2FPMA 4PHAA 4OKJA 1BI4A 3WNHA 4KHQA 5IINA 3DM2A 4C8MA 2B4JA 4RZRA 1HUZA 3MXMA 3KHHA 1W0HA 4IQVA 4O9MA 1IKWA 4CJSA 3MR2A 3DRSA 3K75D 2R8HA 2HNDA 5HHIA 2YV0X 4QZGA 4Z4IA 1B92A 4ED2A 2KFZA 2HVIA 1TKDA 4K8XA 2KW4A 1ZQOA 1BPBA 4PA1A 5T7BA 4PHPA 4DOCA 4IR1A 4TUSA 1HYSA 1RCHA 5I42A 4YR0A 3RR7A 3EZ5A 4HCBA 2GV9A 4MFBA 3T19A 4M3ZA 3M9MB 9ICGA 8ICKA 2R8KA 4RQ3A 3PV8A 4EP4A 1GOBA 4XUSA 3KTQA 1ZQZA 3LWMA 1BCOA 3V81A 1RBRA 3V72A
chains in the Genus database with same CATH superfamily
4YMNA 1QHAA 1WYGA 2IVYA 4Y6IA 2FVCA 3QBCA 3CJCA 2PFQA 4J9QA 4US8A 3UD3P 2AWZA 8ICWA 1RJJA 1DHMA 4Z4FA 1P7DA 2D7SA 2OPRA 4G6VB 3BN7A 1KLMA 2R7RA 4ZPDA 5IT0A 3ZETA 4DV5J 1NH8A 4ID5B 1NRKA 1SWWA 3L2WA 1RBOB 5F0WA 3MAAB 4FWRA 4AM7A 1HBMB 2EWSA 3R1HA 5AQUA 3EVWA 3RZAA 4YY3K 3L2QA 3QU5A 3O9RA 1Q8BA 1T9XA 1DK3A 1DY3A 1APSA 3L3FX 4A8FA 2K89A 2A6MA 3EGWB 2JLGA 1MW7A 5H9EK 3TQ1A 2A3VA 3ZTPA 3CJBA 5ALNA 3O9UA 2RHSB 3H2VE 2LLZA 1JB0C 1BNPA 1SV0A 3T5LA 2HBLA 4ISFA 1KAYA 3CDAA 4ECTA 2ZOMA 3GJRB 1Z00A 3GWCA 2OSQA 3RB0A 2UXDJ 3ZI4A 4GC7A 4IO8A 4F3OA 4GVEA 3IG5A 5A8WA 4WE1B 1VAZA 2ZDPA 4KV8B 1U1PA 4KE5A 1PJ7A 4NYZA 2UXBF 3I9ZA 4NXNJ 2ASYA 3DRRA 4XAKA 3X3UA 5D4PA 1KWMA 3F2KA 3UIQA 5L46A 2AF6A 1SI9A 3VGSA 3PW5A 2C3YA 1VQ4N 2KN7A 1LQ9A 1BI4B 1LEOA 2CPXA 4USTA 4Y3CA 2ISPA 3HOSA 5D8HB 1RFQA 5J0PA 3H59A 5A6WA 2DRAA 2DGUA 2ZIUB 2W04A 2QEXS 3KK1A 1HWKA 3CQ8A 1PBAA 2UV8A 3GZFA 3MOZA 5HMYA 3D2EB 4ZCLA 2Z56B 3CM5A 2G8KA 3FCVA 5LJVA 2L9DA 1FERA 3PR5B 1G3OA 1JX4A 4H5WA 1DEJA 2G5HB 4BUGA 4GVBB 1VSEA 1Q8IA 2XMKA 3IXQA 3VGTA 2LQ5A 2NXJA 1D9DA 1FEZA 4B9QA 3MMAB 2M8HA 2VL1A 1Q82O 3TVKA 4JI7J 4LH5A 5ELZA 3MXJA 2PI5A 2HZCA 2QI2A 3BEGB 3KK3B 4CH1A 3KUEA 4TU8A 2R7QA 2UXBK 2IHMA 2YXLA 3TQEA 5KFQA 3SDEA 4BR0A 3V5RA 2E2PA 3QJJA 3P1GA 3CC7S 5BOMA 4MKYA 2IA0A 2IMWP 2XO7A 1J53A 1QM9A 4F5RA 7ICKA 4QIVA 3VQBA 3M2VB 1BIUA 4CZJA 2DY4A 1N0UA 4DV2J 4G65A 5KT4A 2GNKA 3I33A 5KI6A 2HFOA 3BV8A 3M3ZA 4Y2IA 2AU0A 3WXKA 1HNVB 3Q89A 2VG5B 2WVEA 3U3GA 5F9LA 1U6FA 1ZQWA 3J7YI 1A6LA 4PGXA 2RNEA 2GZOA 2FDRA 2QWNA 4PWWA 1UEVA 4C9DA 4N5SA 5IWAF 3TUPA 2ZBIA 3DLGB 2HB5A 5C7PA 2YWFA 3LL3A 3ULHA 2HMIA 4IR9A 3WKEA 2QEXN 1AT1B 4F5OA 1FE4A 8ICEA 1VQ9S 5C10A 2XZTB 4RW4A 2G0JA 5KFZA 2BJ9A 2FPHX 1Q95G 1VDHA 1RBVA 2IVNA 4GMJB 3W5XA 2CYYA 1OY8A 4QWBA 4F71A 1M1KO 3TARA 4ECSA 4R65A 3MTJA 3GU3A 3AO1A 3ZSYA 1N5QA 3EW9A 3C15A 3M8ZA 3CDBA 3PKYA 2H4WB 3LM2A 2V67A 3R2DJ 2QB0B 1ZJNA 1Q3UA 3ISBA 1H6KX 3T9NA 4LF9F 3UN2A 5CYQA 3CC7N 4H5RA 2WFAA 2NSCA 3T1YJ 3W5ZA 1NU4A 3PRVA 3DLKB 3M9NB 2NRXA 3CO0P 1HUXA 4MEYA 3HD1A 1BY9A 3ZDDA 1PG5B 4I69A 4Q8EA 2JWLA 4QWCA 2B0CA 1GFWB 1ESVA 5AZIA 3IHQB 4YHHJ 3LDQA 2RD5C 1PKUA 3SLCA 1VSDA 2QFJA 2DBBA 1HNIB 4QZIA 5AKKA 3MMVA 3ATVA 1RGIA 4IOAL 4YORA 1ZJMA 1IG9A 2ZJ8A 3W64A 3RJFA 4RL1A 3EWGA 4CK1A 1IUJA 2LU2A 3RSEA 3OL7A 1QTMA 2JH3A 4O8KA 5AM5A 4ZVPB 3OVAA 1LXJA 1CLFA 4K25A 5KFOA 1VSMA 1ZQRA 4JKBA 1P9QC 1SWVA 3I5CA 3CO9A 3C46A 1K73O 3NAIA 3E51A 4LF9K 3GJQB 1ZQIA 4FN5A 3NG8A 2FSJA 2B4VA 1RHQB 1VQ9N 4NY8A 5CH7B 3KWMA 1RAFB 4E89A 1PAEX 1EKSA 3TJ8A 2FJEB 2F63A 2A2DA 3OTEA 4ZVSB 3C28A 4FWNA 4BRCA 2KG5A 1WC0A 5KFUA 4WP3A 1TK8A 3FZBA 1YKWA 2DCUB 3R8EA 1RNHA 2GGPB 3HI9A 4B3MF 3WXJA 3M8WA 5KFWA 1UTAA 5ALRA 4TKTA 1J5OB 1ITGA 3HP9A 4UB2A 1NBWA 5FDLB 3DFEA 4WWSA 2ACYA 1RXVA 4YR3A 1C1BB 1UJ6A 4I29A 2J7UA 1RKJA 1A77A 1NK6A 4UB4A 2PA3A 4K43A 5J2EA 1O08A 1XNSA 4P0PA 1Q79A 5IT9U 4H5NA 4DU8A 2ZJQL 4BY9C 2GVDB 5KFAA 5J1NA 1K1SA 4PHDA 8ICTA 1T03A 4PGYA 4J9PA 1J5EJ 3KJVA 4B9LA 1GMVA 1WKLA 2FBXA 1ZQVA 1GLAG 1RT1A 1Z6RA 4C11A 1YJ7A 2GELA 4M41A 1S97A 5C25B 4HT5A 4JRPA 5AQYA 2GCFA 4CWBA 1X5OA 3QFPA 4A59A 1JLAA 2GX9A 3H7HB 4LR8A 4YOUA 2J76E 2P9SB 4MO4A 1MA7A 2O8DB 2ROEA 2M7SA 1JJ4A 1D0EA 7ICGA 3P4UB 3U9DA 5CJ7A 3PG9A 1L6NA 4DV7K 4MMOA 5KPZA 4CZLA 4IDHA 8ICGA 4J9KA 2MZQA 2IYGA 4K4IA 5KFGA 3RFAA 2BA9A 5EVZA 1N5VA 4OZ0A 2PGCA 2G2OA 3LQVA 4A8QA 2WW4A 3WEEB 4TU9A 4ES3A 4IOCL 1ZTTA 1X5PA 4DTUA 1B22A 2XMTA 2EWHA 4DFPA 2AH5A 4OCZA 2JC0A 2WF8A 2Q6CA 2KG0A 3BQ0A 2Q3SA 1LB2B 9ICBA 1QH9A 3IS9B 3KJQB 2XSFA 4LRFA 4X65K 3WC0A 1IR0A 4LF8F 1TKXB 5BR8K 2F1JA 2YHXA 4C3KA 1YRTA 3H0PA 3RMDA 4RX6A 3M1YA 1WKKA 2EKNA 5J0UA 4MJKA 2O4IA 1FRKA 4I0WA 4LVSA 1L8LA 2UUAF 3EDRB 3VCDA 1G4CA 3KOAA 2KU7A 5LMNF 2MB0B 4BCAA 1R59O 5AZJB 5IIMA 4XO0A 3TACB 1N5TA 3ZSOA 1VOMA 2F5GA 3M8PA 4C2MA 1ZQLA 2VANA 2FJAB 4ZVTB 2E1YA 2QA4G 2W25A 1JLQA 5ITHA 4DF8A 4LSNB 3J80Y 4O3NA 4IDKA 2JZBA 3VA0A 4I4BA 2HI0A 1R3NA 1HRHA 1HFEL 3JSMA 3FC4A 1B43A 2BJ1A 4H0PA 5FRMA 4ACOA 3FBCA 1TKZB 1BQNB 2E8OA 3KUGA 1J97A 4KLOA 1LAWA 1CJTB 4LFCK 3S3NA 3DXMA 4XH1A 1NZAA 5HMXA 3OYEA 3THWA 2V8PA 4X64F 2CIMA 3PSFA 4QIGA 3EPGA 5GAHU 2I9SA 4CIGA 3M05A 2YNIB 2F7VA 2E1ZA 4CVNE 2KYZA 1JLGB 2CQIA 4B3SJ 4CW7B 1VRQC 3HKZF 2DB1A 2I7PA 4LF2A 5ETLA 4DX6A 5J0OA 4USJC 2AJ2A 3BKUA 3FFKB 3HX9A 3UMBA 2B43A 3ETMA 4WIQA 2A1JA 1Y7PA 4FYVB 3MPUB 2JRSA 3N01A 3FZLA 1WHWA 3U26A 3MCMA 4B3OB 2HHTA 1U04A 4RNOA 3H42A 1WF2A 3PHEA 2BRKA 1NMEB 2CKWA 3NL0A 3VC8A 1Y4ZB 5J2CA 7ICTA 5AQNA 5KQ8A 1MU2A 4P2SA 4O4GA 3UVJA 2R2SA 1JJ2M 2G8FA 4R5PB 3D2FA 3TSUA 2BOAA 1GTEA 4F2RA 2KNJA 2M9NA 2NYIA 3VF0B 1B0VA 3MEDA 3S41A 2PAVA 1BPXA 4ED7A 1Q78A 2W2OP 3PW2A 4CGIA 4LSLA 4JNEA 2IAJA 3HKZD 3WHIA 5J2DA 5LL6Z 3W2VA 1FVSA 1GMWA 3DXKB 2PN6A 5D15A 4WJBA 3BREA 1RTDA 2R2TA 3ZT0A 2BR0A 4JHDB 2ALYB 1M5HA 3Q7BA 3H2UB 2ZH7A 1KVAA 3KLIB 3CMEN 1JIHA 4O4RA 5AE2A 3NHGA 1MROA 3CC2N 4GNIA 2W2NP 4CHYA 1S77D 3U6FA 3ITHA 3THYA 4OJ1A 4OJ6A 2Z58B 1XR5A 4CLKA 3HT0A 4BRKA 4KLJA 3MR6A 3U02A 3AA3A 2DGXA 3P31A 2E8PA 3H5YA 4TQRA 3VQDA 2V2ZA 2Z2ZA 1BXNA 1A5XA 3Q8YA 4AUKA 1XSLA 3NRZA 3C6TB 1IN0A 2IM3A 3DDHA 1ZRNA 1CJKB 5KG7A 3R7BB 3WIUA 4R64A 3ULEB 5C24A 4AXIA 2D6FC 3CJ4A 3QWPA 3FZKA 4I6MB 2DGWA 4NPOA 1N6QB 4XH5A 3MMCB 2V8HA 4QS9A 4A8XA 2BV3A 3OYGA 1RBAA 3SUNA 3S3OA 3MECA 2PA8D 4KHNA 4C3MA 2CQGA 4JRQA 3RAMA 1NGGA 4KGZB 5DO2A 1JLFA 3L7OA 4KQZA 2VPZB 2W42A 3KOOA 3OL9A 1KR4A 3FRZA 4ZOHC 1HBNB 4LBIA 2QL7B 4EHUA 4TSXA 4P4OA 1BISA 1B9FA 3QGHA 3HWTA 4QBUA 2LSNA 7ICNA 9ICXA 2JSXA 4M6WB 1FX2A 3G4SS 3C2LA 1H0HB 3TZWA 1QVFM 3AH6A 3QX7A 3SCKE 3SFGA 2QA2A 5FD1A 4CHOA 4DV6F 3G2XA 1DTTA 4FF1A 4JAXA 5CHIA 2CJYB 2ZM6J 4ETZA 4Z7CA 3SSQA 3RBXA 5B0CA 4MKAA 5ALFA 2RUGA 5I3QA 1HEKA 4DQSA 1O1WA 1X4EA 4LF7K 3VHQA 3CNHA 1HJRA 1EKEA 4E98A 2CAJA 5D4LA 3G9CA 1Z26A 5HRSA 2QV6A 1XNQF 2I5HA 4ZPTR 4O3PA 4EAHD 2OELA 4KMOB 3GCWP 2W9BB 3D28A 1SZ2A 4GV3A 4LF1A 1BQMA 5K20B 3IRXA 2YKQA 1NSQA 1S6PA 3NWGA 2CDQA 2LXUA 3GYGA 3TNVA 4H4OA 4IUFA 1GOCA 1EARA 1RWMB 1A9NB 2HEKA 1X4DA 3MDQA 3O9QA 2P9LB 1AA1B 3BDPA 1N54B 4AYBF 4DV4J 1DT9A 2EDUA 2EC0A 2J9DE 3GFYA 5J2BA 1SAZA 1RYRA 2W2QP 4PL8A 3VF6A 3NCIA 4UOCA 9ICSA 2KT5A 5ALLA 3GDQA 2K8BB 4FLYA 1Q46A 2OHFA 8ICRA 4K0KJ 2B7BB 3ZSWA 3AD7C 3T69A 3GOIA 5B08A 1YK9A 3LP2B 4AL6A 2X1GA 2MZ1A 3MM7B 2YNGB 1YAGA 4DTOA 2ZHOA 2OEMA 2P9KA 2P5OA 2AQ4A 8ICYA 4NB4A 2O8EA 5LT5A 4EP5A 3JXUA 4HWIA 3GYXB 3CW2C 3RR8A 4O44A 1D5AA 3ZDEA 2DR6A 3MGIA 1NDCA 9ICHA 3IM9A 5JS2A 4MF8A 4J9MA 3E0FA 4DPWA 3IRUA 5SZTA 2MKKA 3KNGA 3PX6A 3I56S 3F5TA 1ELOA 2NCKL 4JLHA 3UN5A 3I87A 4ILMA 3BUZB 3B4DA 3GG4A 5HBMA 2ZITA 4B3TF 2GX8A 1NJIO 4ZOSA 4DXLA 3HJFA 4KH0B 1NK7A 1VSLA 1L7OA 4USWA 3WK8A 1F0MA 4JI3J 2MAXA 1GLJO 1SIWB 3PY8A 1TMMA 2O8FB 2KIVA 2E6MA 5AI0A 2P9EA 2FHJD 4TY8A 3Q0AA 1CG2A 4P71A 1RT6B 8ICCA 1VHXA 5F8HA 4FXVA 3EVMA 3PZPA 3N7PD 4DS4A 1S1XA 2E88A 4JWMA 5DB7A 1K8AT 1QE1B 3VGKA 5HQMA 3V2UC 3ISDA 3HSZA 4O3RA 5HOOA 2UV8G 4DPOA 1RAOA 4FJNA 2AD9A 1UL3A 2YH1A 4TLRA 4LF4J 3TAMB 3DAWA 5E79U 4MF2A 2OFGX 5HJXA 1AQ6A 2MQMA 4ENOA 3NBPA 1E6YA 1KLNA 4B3TK 4IJNA 4QAGA 3D9BA 3QU9A 4FPBA 4RNNA 1S5JA 5J1EB 2KK0A 2XO6A 1F5AA 2NUHA 1M90T 2FBTA 1CJUA 4RQ4A 5A8RA 2BW7A 5AKYA 2QN6B 1W97L 3CEDA 2RQCA 9ICFA 3EZWA 8ICVA 3G10A 3WQTA 3LDSA 1Y64A 2D74B 1C1CB 2RMLA 3IDWA 4IJAA 3L9ZA 5T7LA 2YTCA 3B54A 3JSBA 3EWAA 3I56N 4LVNP 1N36K 2E1RA 2PFDA 4FZXC 4DR7K 3Q8SB 4CBUA 2XY7A 3CI5A 2ZH8A 9ICLA 1AW0A 2IBOA 2ZGZA 3BM7A 5J2JA 1RWXB 2QB1A 3SQ0A 2CUYA 1LKYA 3ILOA 2O6KA 2IRYA 4I2JA 4AF1A 2YHAA 2NUUG 3GZ7A 1X31C 2CA9A 4MYTA 3C16A 4JKEA 2DVIA 3K2YA 3TSQA 4XDDA 3R7SB 2B3TB 3CCUS 2HQFA 1PVRA 4BRQA 2CQ1A 2C2OB 3EZOA 4WK3A 2O5DA 4FNIA 2ZNZA 4CZFA 5D3GB 2VF3A 2XYGB 2JVOA 5KFMA 3JPPA 4I6WA 2R7TA 3PYDA 4WE1A 1FXRA 4M5LA 2RILA 3NCQA 4TYBA 1HQEB 3MCNA 1D3WA 5AQJA 1C7YA 4KT0C 4QWEA 4DUZF 4DR5K 3JYTB 4F0KA 4BS2A 3HVWA 2Y1IA 3P39A 2ZH5A 2PI4A 2V5HG 3O5TB 2BCSA 4BQZA 4U8VA 1R8PA 3UQ2A 5F8MA 5EHHA 5J2FA 5JMVA 5GAGU 4PPDA 4DV1J 4UAZA 3M2RA 2ZIUA 2UVVA 4IH6A 3MFIA 2WUSA 1S0VA 3TTFA 2ZKTA 1SXEA 5ETMA 4OI1A 3R7NB 4YOTA 3SI6A 1YVUA 4O0IA 1KHVA 1KC8O 2MZTA 3MEEA 5H1SV 3HZEA 4C4TA 3A5NC 1UWAA 3OYHA 1HBOB 4K4VA 4JKGB 1F5CA 4CF4A 2DGTA 5AQWA 1ECWA 3TEHB 1P90A 1X1PA 3DHWC 4ZLPA 5IOLA 1OIAA 5E2QA 4K2XA 1X5SA 3T1HJ 2MJUA 3QT6A 3KK3A 4C7YA 1SZHA 4CHPA 1QSYA 1T3VA 3FMBA 4PWDB 4DUZK 4CT8A 1V4TA 3TR5A 5B0BA 3H45C 2KG1A 3PYGA 4YD1A 1A5VA 3KYLA 2NPFA 4XIUA 2EAOA 2DHSA 2P2CB 3BQ7A 3CJ7A 1DJ0A 4DSFA 2R4FA 1WSHA 1JJHA 1URRA 4P0QB 1XTZA 1HNVA 3D6FB 1U2VA 3O4NA 4IFYA 1MDUB 2J6TA 1N2XA 2VG5A 3WUHA 4LF5J 2BQUA 5GAEU 4HLBA 4NLDA 1SB3C 3HXMA 3ZLJA 1DLOA 2PC6A 2D3DA 3MXIA 5LY3A 3TAQA 4NLYA 2HOQA 3F2BA 1WSVA 5AQTA 2KSOB 3CCSS 1WLJA 2W6KA 2OHDA 1DOQA 4OX9J 4WF9Q 2I1RA 2YKMB 3IAS9 1RTHB 3ET6A 2KVQE 4U9RA 5ADXA 3NGKA 2L9WA 4QR2A 1IKXA 4WQ4C 4DR2J 3NH1A 2KVIA 2G8UA 3KUHA 4CI6A 1Q82T 1WCLA 1NUEA 1TUWA 3WKDA 2BJ7A 3MWTA 3T5HA 1P6TA 3THXA 3ZYYX 5JXSA 2PYLA 2CQ0A 2MZJA 3VAKA 1JXBA 4DTJA 3EMTA 5J29A 5HSPA 7ICUA 3RAQA 2Z1HA 1JJ2R 2F2AB 3MM8B 4DR1J 1WC3A 2R7SA 3QYYA 3QETA 4XQ8A 1HBUA 4EX7A 2XMUA 2CH5A 5F8GA 3EEQA 1S99A 4ZP7A 5BJRA 3WQUA 2KRRA 1RT5B 1HKGA 2WOMB 1V5VA 5IT4A 1XJWB 5KT6A 4DMZA 1VQMS 2E2NA 3CCLN 1NGEA 2B4UA 3VEOA 1EQMA 2IRUA 3OYLA 4ILLA 1IBLJ 4GKKF 2VA8A 2H9ZA 2XWYA 3AA2A 2E6LA 5I3UA 4IFVB 1B64A 3VR1A 1MWZA 3S3MA 2ZUBA 5FLXY 1SH3A 3L3UA 4DOBA 2QKKA 3BSCA 1NSPA 3AVGA 2BE9B 4IQWA 1NLVA 3P6YC 1IV8A 1RTJA 2ZOGA 4GIBA 1AZSB 3ICLA 2XMMA 3TAEA 5ALOA 5CEHA 4DR3F 3P49B 2DR9A 5DQGA 5M2RA 1OPZA 3HZ6A 4R8UA 9ICJA 1HMVA 1YLXA 4FSVA 3NGDA 2HW3A 5BRDA 1HNZK 3VENA 3CCSN 2HLTA 4NYFA 1HUOA 5AM2A 3VQ9A 4I2PB 2HHHF 3NS5A 2PD1A 4AM6A 2RQ5A 2HVZA 3CTRA 2XI3A 4KHMA 5T14A 2CRXA 3CIZA 4DDFA 3BF4A 3J80U 4XPCA 3NLCA 2JEJA 1JLBA 2GJIA 1VQ8S 1ZQSA 2YMLA 4CJRA 3C3LA 3L2UA 3MAQA 4YOXA 1WDTA 3TJAA 4DZDA 1RAJA 1RDWX 3EYZA 1IG8A 4IQXA 1LOTB 4DFMA 3J7AP 2H4YB 3HP6A 5D46A 4DTPA 1R8CA 1M5KC 5HN0A 2AEFA 5HK4A 2GGPA 1CLQA 5ALHA 4RBTA 4CLTA 1GMWD 2VBXA 4L8RB 1IBKJ 2GLEA 4LFBJ 3C6UB 1TK0A 4M45A 2OPSB 4OLBA 3I28A 4MIAA 4BVOA 1VQMN 3WU2U 4RBVA 3A0BU 2D1CA 2CNOB 2HGLA 1X4HA 5E3CA 1BD6A 1EO1A 3KNAA 4IQMA 1JI7A 3OY9A 1R6YA 5DZ6A 2ZH2A 3OS1A 3QT8A 5AXKA 1VISA 3CCTA 2NYVA 1SKSA 2HHHK 1QVFR 1OY6A 5AQZA 3AVNA 2PSZA 2BPGA 1FFWB 2JVRA 1TKTB 3QEXA 1NGHA 1TL7B 4X66F 1M6YA 3H0LB 1XQIA 1B7YB 5AKJA 4I67A 2G9OA 2DHGA 5LM7E 4OJGA 4UBCA 3EGNA 2DNZA 5J2PA 4KGXB 3QEPA 2IJNA 2IS3A 4YFUA 4LZGA 5D4BA 1EETA 1PVQA 5SUHA 1OQ3A 4F8RA 3H5UA 5IQQA 3TAGA 1HPMA 3W2WA 2FY8A 9ICEA 4ZPAA 4DPXA 3AM9A 4CERA 3LO3A 2GWKA 1UCNA 4US9A 2JEIA 3KK2A 3H2LA 4JI0K 1VQ8N 2CGLA 2FB0A 2PFNA 8ICPA 2XZWA 2XMJA 2DEIA 1HARA 5HL7Q 1TGOA 3BGFA 2QW9A 2CN1A 5GADI 4F04B 2BCQA 1KFTA 4M9HA 1SJQA 2G09A 4ZPBA 2EZXA 3IP4B 3LGMA 4B9VA 4ZJLA 4Z6DA 4X66K 3IAM9 2ATQA 3I82A 3OXFA 3FQLA 3MEKA 3CD6N 4ZPVR 5DBCA 5AKZA 3M8QA 1I39A 1FEEA 3OYBA 3HVAA 2RPIA 5GVQA 4XH4A 1UWBA 4KRWA 1IM4A 1TAMA 4O3OA 4CLZA 1VSJA 1NBEB 1ZM2A 4UBBA 2PFPA 2DIUA 1NWKA 4RW9A 3OHRA 3VGLA 1TFWA 1Q1KA 3J7ZO 1RHKB 4PH5A 2BH1A 1MWMA 2HWIA 3LW5C 3POTB 3O6QA 4NI2B 2HS3A 4KLQA 4PQAA 2GEMA 2QMXA 8ICFA 4J2AA 4DMNA 4DLEA 3WX4A 3UO0A 3CCRS 3CJ8A 5A0LA 3KG0A 4ECQA 1MQ3A 2I6WA 1HNWJ 3SSRA 1CQMA 2HQGA 1KDNA 3GR1A 2B56A 1Q3VA 1ZM4A 5B8HA 1RT7B 4Y2PA 3Q8PB 4PPZA 2HVDA 1WSFA 4PHTX 1GLLO 5KFXA 1JCFA 3MR7A 3V9ZA 2A18A 3OLAA 3MAHA 3U27A 2W2MP 4DR4J 9ICVA 4AE5A 2AHOB 5DB6A 1F6TA 2LYBA 1U1KA 2G2YA 4DG1B 2QA4S 4NXMJ 3OHAA 1CJTA 2CPYA 2EFGA 1MWQA 4G1PA 2R42A 1KEKA 4DQQA 3C65A 4J9RA 4NMXA 3FAHA 2V9WA 2HCFA 4C0ZA 3QRRA 1IXRA 3SBGA 3RMAA 2JL9A 4DS5A 1HQUB 2NRRA 5G5HA 2RS8A 1HNXF 4KI4A 4QZHA 2P5GA 3NVVA 1K9MT 1BVSA 1H1VA 4KO0B 4CJLA 4KLDA 3D0HE 2C2KB 1RWNB 3CF5Q 1YT3A 2AGPA 2ZJRQ 2NRHA 1FNXH 3T6BA 1B7FA 3NMUA 3LDNA 3C7NA 2CXYA 2FC9A 4M5DB 3F9MA 3CXCM 3TADC 3OJUA 5HNKA 3QUBA 2RF2A 4CGFA 3TA2A 9RUBA 4RW7A 4KFBB 2X3DA 2I8EA 3I31A 3AY0A 2V8VA 4LUBA 3NVZA 1RCXB 4WP9A 3C2KA 4LQ3A 4NA3A 4RQ5A 2LBOA 1U6ZA 2Y8YA 3AB2B 3PW0A 4YDXA 2HQDA 5L9XA 4ALZA 4NOHA 1WBDA 4M47A 3CWJA 1QAYA 3FC9A 4KITB 3QNWB 4KREA 2CWKA 1L3VA 1N32J 3SR6A 4JI5F 1KVIA 3VEVA 1T9TA 5GIOA 1J2VA 2CPDA 4BGDA 4OZ2A 4FDFA 4HCCA 3MDCA 4PHAA 4OKJA 1RSCA 4UAVA 5IINA 4WXWA 2P6SA 2B4JA 2COLA 4RZRA 2LXIA 1HUZA 1TELA 4KGVB 5HMZA 2BX6A 3VZIA 2FJWA 4M5NA 4CJSA 4BHQA 1ZC6A 3FE1A 2QA4N 3DRSA 1NZPA 3MR2A 2JHDA 2HNDA 3QXGA 2G13A 2YV0X 4JD2B 4QZGA 1B92A 4ED2A 3N28A 1WC1A 1PAUB 2KYXA 1BPBA 2ZDOA 5AK5A 4U8YA 1RA7A 2ZFHA 2K06A 3SQGA 1SC4B 2QGFB 1T95A 5I42A 1S1TB 4ISGA 1DRZA 4HCBA 1MMLA 2GV9A 3S7RA 3V4MA 1GK8A 4M3ZA 3VF4A 1QAXA 3PV8A 2EK1A 2IHR1 4XUSA 3JAMO 3LWMA 1BCOA 3V81A 4NLQA 4P73A 3DRPB 4ANCA 3MMCA 2QLTA 2LU1A 4ZVEA 3UFCX 4MHVA 4E7HA 5HHHA 2EANA 1L3SA 3V7JA 5DG9A 2FLPA 2KT2A 1SKWA 4WFBL 4Q43A 5HROB 3VEWA 1JJCB 4FF2A 1BC6A 4UAUA 3CCQS 4UUXA 2ASJA 4IRCA 3BSNA 4B3RF 2JX2A 3WXIA 3MGJA 2M9KA 5C2FA 3R5CA 3ZTRA 2KE7A 4JI1F 5C12A 2ZWOA 1JNZB 5IFMA 4B9MA 3GG1A 1H7WA 1U6BA 1XNRJ 1RHUB 1S72S 4GXKA 5LSLA 4AD6A 2W54A 3BB5A 7ICLA 2YCHA 2CQCA 3VZHA 4EZ9A 4UQGA 1WSEA 2C2DA 2RDDA 3IGNA 2DNKA 4NCGB 4IO9L 4C98A 5TKYA 2IVMA 2ZH9A 2Q0UA 3ZO7A 2UUBK 2FVQA 1IBCB 1FJCA 2PT0A 1SKUB 4FWLA 8RUCA 4IXCA 1N63A 4CEOA 4DTNA 4FZZA 2N82B 4K50A 3CMAN 1RQLA 1TUVA 3B6PA 1JL2A 2AP1A 4A62A 2HQCA 2BUNA 4W5RA 1IQTA 3V6HA 2P6UA 2NLXA 3MCAB 1K8KA 4NLKA 3IDHA 4CTAB 3TEGA 2AIRB 1WG4A 2YX6A 2HBYB 2V94A 4B3RK 2NV3A 4A8OA 1NZBA 2X3GA 4I2IA 1EWRA 2AJQA 3LAMA 2ZF5O 2F8MA 4CJWA 8ICBA 3PEJA 4JI1K 3BYRA 2ES6A 4NRUA 1LWFA 4X4TA 4IKFA 1ZA2B 1DQ9A 2ZOFA 1G6BA 4OO1J 1IKWB 3HHNB 2P6RA 1XR7A 4CZCA 3FBBA 5I4MA 1Z1VA 4J8FA 4WQ4A 3OR1A 4UY8T 5KGWA 1OH7A 3CP8A 1TYQB 5F8LA 4A48A 1IBMJ 3AVLA 4AHTA 1FK9A 4ID1A 3LA0A 2FJVA 2WHOA 1X4AA 1WDDA 5B0GA 2IOFK 1HYSB 2W4DA 4OJPA 4ZITA 4N47A 1HWLA 2GMJA 2OIHA 2HSTA 5CXTA 5K8NA 1ZQMA 4N76A 1GO3F 9ICIA 2RQMA 2ZIVA 1G99A 1B3TA 5THWA 5KFLA 2YMPA 2DNHA 1QDUB 1QQMA 3CG7A 2H3VA 1S72N 2M2BA 5KAFU 4CYUA 2W9CA 3CCES 1NDLA 5DB8A 3UPFA 1TFYA 1KVBA 5AQIA 2F9DA 1KLMB 5CE3A 1RTIA 1VQ5S 2VWBA 3ZETB 4CFCA 4BE1A 3NAHA 3NS7B 2J9CA 2HGMA 2OEHA 3KKSA 1SL2A 4K59A 3QZ7A 3SAHA 4Y2TA 3CM6A 3JTNA 3LH2S 1NPRA 2WZ1A 2RT3A 1UVLA 4FBUA 2QLBB 1X4GA 3M6GA 5KFKA 3WT0A 2F8LA 2DO4A 4QZVB 3ENWA 4F36A 3VEYA 4WTYA 3C6HA 1PSDA 3VQPA 4ZH4A 1I94K 2C2ZB 1XUPO 1FWPA 2O8FA 1YJWS 1NZ8A 1Z00B 3QEAZ 1NPPA 2QE5A 2DNGA 1T11A 3NUQA 4J9OA 4Z4CA 2GOLA 1RT6A 1VI7A 1U2CA 5A8WB 4U6PA 3PKMA 1CI4A 3MMJA 3QBWA 2A10A 4L75A 2HHXA 3VAMA 3AV9A 4ZN1A 4KH1B 4ERDA 4RPZA 2YVSA 4KB0A 4OFZA 2MQ8A 4XA5A 3AUOA 4B1ZA 3HSGA 2HWTA 1QLNA 4WYLA 3U8XA 4LBHA 1I3AA 3FSYA 2V51B 4NWBA 2X78A 4KMUA 3NMRA 5HRPA 1RG6A 3HHLD 3D66A 2R18A 3KK1B 4Q0BB 4URSA 1ZZNA 4CF1A 1QD1A 4DHVA 2L41A 2KOBA 4ECVA 1H73A 4EYIB 2FJ6A 3D6TB 5JVGQ 3E8OA 4CRJA 3ENOA 4CP5A 3CPEA 1BPZA 2BGGA 3CCEN 2B6GA 5F8NA 4FJ9A 2OD4A 4DQRA 4Q8FA 3K7RA 4BR9A 1VQ5N 2BKEA 3OFEA 4ZVFA 3GR0A 9ICNA 3UE5A 2OWOA 2RQ4A 4EBCA 3A8IA 4O0NA 3ZTSA 2FY1A 4OQJA 3K2PA 1H2TZ 1KKXA 3BSAA 1QS4A 4PG4A 2KXFA 3SDEB 1I6JA 3HFZB 2HQ3A 4KLLA 3QRQA 2JMGA 5BN9A 5H1SQ 4M0AA 5D77A 3TOQA 5E0OA 5DM6Q 3NVWA 1ZQNA 2F8EX 4GV9A 2NRWA 2LQ8A 2VWKA 2AQ0A 2AP6A 4LRAA 4CF0A 3QU7A 1C0TA 3GU0A 5J0QA 2V68A 1XMQF 4DV5K 3H5SA 2Z57B 4I6YA 3HILA 1DTQA 1IXKA 3DLRA 4JI8F 2PXIA 3LOUA 1VQLS 2Y0BB 2RJZA 4PL7A 5AKHA 1YJWN 1Q16B 5C2DA 3VQ8A 4QS7A 5KOXA 1H2VZ 4Y0WA 4FJMA 3DYAA 4CJ3A 1PUZA 1WF1A 3J81O 1TU0B 1X3MA 3UW1A 2VICA 3S01A 2N3OA 4H0XB 2FC0A 4CEFA 1IO2A 4URQU 2GHVC 2B5JA 2YKAA 1T6CA 2ZWPA 2EZYA 1B4SA 4BR2A 3D1OA 3ISND 1DQAA 3GP9A 4UB3A 1AUDA 5FPMA 3JQKA 2ZH6A 3ZT2A 5HR6A 2HMIB 3I4PA 3LAKA 3UWTA 3JYTA 4CNYA 4UOGA 4CZIA 5FLXU 2J8SA 3IN5A 3AXMA 3WX8A 3FUYA 4QIWF 5M2UA 2VBYA 3B0XA 4NXNK 2O8BB 1AYEA 3UDLA 3TTCA 5HRRA 4RW4B 3AMZA 4EFHA 5A0YA 1XC3A 4ZVHA 4JI8K 4QW8A 4W5OA 1GQEA 9ICWA 1RWWB 4YB7A 1Q0NA 1ZQJA 2WBRA 3C15B 2ZUGA 2ATLA 1KRPA 3Q24A 3FYHA 5D6GA 3I8BA 3AAQA 3L8BA 1XQSC 4P52A 2R8IA 2P9GA 2BJDA 2UXBJ 1YJVA 1YUWA 2ZBPA 4ZKAA 4YR2A 4WFZA 4ZIWA 3TU5A 2CPJA 3PSPA 4LBPA 1F60B 3V1OA 1ZQUA 5LJ3Y 2VQEF 1IKYB 1KEJA 3CCJS 2O8CA 2F9JA 1QQCA 5F41A 4I9LA 4FJXA 4KN7A 2YQ1A 1UW4A 4JI7K 3OLBA 1XSNA 1W9HA 3HT3A 4PWDA 4CZHA 2VV5A 2FXUA 3D7EO 1FNOA 2RRAA 2OPPA 2Y9TA 4QIWD 2E5HA 1VQLN 3PIOQ 3I0SA 2CPFA 5D0HA 1NDKA 3FEYB 2RP5A 3GILA 1FEHA 4OGEA 2EVZA 1PJ6A 3UE2A 1G15A 5DB9A 4J03A 1O8BA 1F9FA 3QSIA 3CDUA 4J2DA 3K1ZA 4B9SA 4C8KA 3RMBA 1X7VA 3RJMB 2CNNB 4I6AA 4I2BA 1U45A 3FGVA 2KL8A 1ZXOA 3O6WA 3GJTB 1JMSA 4UB5A 4NLVA 1KW4A 2ZG6A 3PACA 4K5RA 5AQQA 3HKZC 1B4FA 3IKMA 2KM8B 3TADA 3KZXA 4RNMA 2V63A 1FJGF 3HFVA 3G25A 3DCAA 1VLOA 4UATA 4FLTA 2HHWA 2AYMA 3THVA 2KSOA 3C95A 4J5OA 3NNCA 1K1QA 1XMOF 2KRBA 3NS1A 1PVPA 3M32A 5FJ4A 1O03A 5BPCA 1S7IA 1RTHA 1JWWA 4DTSA 2YX8A 2OGUA 1KC8T 1ZD5A 2Y1LB 5E5NA 1UEKA 2MQOA 1VK8A 5M2PA 3SPZA 1SH2A 1UFLA 1VSIA 4F5QA 1HJOA 1NNDA 4ZP9A 2AW0A 2AXTU 3ETRA 2YKOA 1NMNA 5KFDA 2O67A 3G82A 5D0EA 3GIJA 5JRTA 3WXMB 3UPQA 5DDMA 4P0PB 3QEIA 4UB6U 2KHDA 2OMLA 5IWAJ 2BRLA 2DNYA 3CCJN 1Y9OA 1RT2B 1YI2N 4EIAA 4ZCIA 2OP5A 1S9EA 4NM2A 1DRGA 2UUCF 1T03B 1NGFA 2YWGA 3KJVB 5E33A 5E26A 1PC4A 4PR6A 1TUGB 1RAEB 5IIIA 1RT1B 5ALPA 5F8IA 4C11B 2K2PA 3LK9A 1V97A 2ZNYA 3T1YK 4IFVA 1F5BA 1D8YA 4MFAA 2MMYA 3L4BC 4LFAF 1BL3A 1V3SA 3DN9A 5AQXA 5AJ3F 2FYXA 1F3VA 2ZE2A 2ZUCA 1FNMA 2V2KA 4K4UA 2DHHA 2XTJP 5CA5A 4BDPA 3BPDA 4PEOA 2EHGA 5EX3A 4CLUA 3HL8A 2E8MA 2VJUA 3P5TL 4LF9J 2B8QA 2X51A 4E7IA 3R3TA 4V1Ak 1GLCG 9ICAA 3SIPB 2DHXA 3VQEA 2MZRA 5KG1A 3HPOA 4LF6F 5HL7L 3SV4A 3JXOA 3KMSA 4FOEA 2MY7A 1XHZA 2XCPA 5K5MA 1W7AA 4NLGA 4PKIA 1MN9A 4QR1A 3A8JA 5JICA 1DXSA 4F5NA 2MQPA 1RILA 1GT8A 4M9GA 1ZQKA 4NEZA 2A1RA 1FKAF 2Z0GA 1Q7YO 3SZ2A 4YFKA 3TJ9A 5GAHI 3MM5A 4EHTA 4JK1A 3L3VA 2HBZB 2VOPA 2VDHA 3L7PA 3MUTP 2C1EB 1SQKA 1H72C 3GFHA 2HFZA 2A2CA 3VV2B 1KFDA 5H9FK 1BLUA 2OZSA 2JC1A 4F4YA 4K5SA 1UT5A 4DV0F 3KKRA 1HYVA 2OM6A 3DM2B 3MABA 2CJQA 1XC9A 3HHKA 1X8DA 1HX1A 4TNOA 1NH7A 3FKBA 3VEZA 4CO0A 1HL6A 3CE8A 4LF6K 3M8PB 3AQPA 4B9NA 4MLHA 3J7YU 1M1HA 3C66A 1RQNA 2XLIA 4B1VA 1YG0A 4B3MJ 1S59A 2GO8A 5AM3A 4IDKB 2JZBB 1HW8A 2M70A 4CGZA 4MYUA 2ZIXB 2NZTA 3JSMB 3AVBA 4H5VA 4KH6A 3KD3A 2BZ2A 3AL0B 2CVEA 3D6MB 3IC1A 1I3OB 4H03B 4FJLA 2OLWA 2RH3A 1D8BA 5KQDA 4KLIA 4CNQA 5BOLA 4C0OC 2H54B 4CDGA 2KVSA 5ADXH 2OSRA 4C1NK 2EC2A 2QIFA 2R7YA 3K8VA 2ZH1A 2VFTA 5LXYA 3I5BA 4KHUA 3K5PA 3GBTA 4CGGA 3CF5L 1GMUA 2ZJPL 3OA9A 2HFSA 3W7BA 3CJAA 2JLFA 4CEQA 5KG3A 2RS2A 3UMGA 1U0HA 1N60A 3BR9A 4OHXA 2V6AA 3Q8UA 2OEKA 5KPTA 3CGIA 1KP6A 4DWIA 2GTDA 4OYOA 4K4WA 1DK2A 2M88A 4UB1A 4RJVA 3J7YP 4ZN3A 4P2FA 1VBKA 1FKPA 5HANA 3L5KA 5AFUA 4C7ZA 4EFAC 4ZVUB 1MU2B 5AI5A 3VWSA 2ZHAA 5CA7A 5AM1A 4KHPF 2GC8A 5CYMA 4I7FA 5DBAA 2M0GB 2DD8S 3UVJB 3D2FB 4FWSA 2XG8A 3TRGA 3QU2A 4X62F 4K41A 4CO5A 1Z1ZA 1NGJA 1NK0A 3MEDB 4ETXA 1ZAXA 4AL7A 2GAHC 3NH2A 3QRPA 3Q8RB 1ZBUA 2KZZA 5ALMA 2ASOA 2YJFA 3K59A 4NI2A 5KFVA 4LSLB 3SMZA 2IAJB 9ICMA 2KKVA 2FLNA 3NGIA 2CPIA 4IEIA 3J7A1 3HRDD 2LMIA 4CK2A 2WK4A 1YTAA 1T4GA 1RTDB 4OYIA 4F7VA 2VBZA 1U1RA 3I0RB 2XMVA 1MROB 5IIKA 2F40A 4YS2A 3WNGA 4NLUA 2DFLA 2XEXA 4LF8J 2QXFA 3B78A 2EFOA 4KB1A 3ITHB 1QCKA 3THYB 8ICMA 2ABYA 1BQXA 3RF9A 4NYOA 1ZBSA 2MKSA 4HH1A 2RU9A 4PXBA 4KJIA 3NVMA 2Z2YB 1SS6A 4O5CA 1REVA 2QYCA 5ETRA 5BRFA 3MN9A 1FO1A 4NLBA 3MPVA 4DG1A 1TV9A 1XIQA 4PCQA 1FFVA 2UUAJ 1WG1A 5IS2A 5LMNJ 4X62K 1MNEA 2FSKA 3AD8C 1FWLA 1GLEG 2A1BA 2FTRA 4Y2KA 5CY4A 3K17A 1EKRA 4EEYA 3RYLA 2ZTCA 3BS7A 4JV5F 4P7VA 4JKHA 4P4PA 5J2QA 3FEXB 4CZKA 3IMQJ 1JALA 5KT7A 4KO0A 4FK2A 2XRIA 4HUGA 5CD4A 2VQFF 3NH0A 1KD1T 3MD1A 4PAAA 1KSPA 1Z3EB 3RJKA 4M5IA 3TW0A 3MECB 4ZIVA 3OPKA 3HF5A 2RAQA 2YNFB 3G6ES 4AL5A 3CERA 2KM8C 1C2PA 3MR5A 1JLFB 3DV9A 4WFAQ 1FRLA 2HSEB 2W6LA 3W65A 2MU2A 3G6XA 4GMKA 2GUIA 2DNLA 2HHUA 4BRLA 5BPMA 4X64J 4Y1DA 1K5OA 5CAAA 3L95X 2IDOA 4OJ3A 4I2AA 4ED0A 4A47A 2PKEA 2QTWA 4F4AA 3PHTA 2WCXA 4IO1A 1MMDA 1TVRA 4OLPA 3L4QA 3NNHA 4NCAA 1JNRB 4H0OA 2QWOA 3OL6A 4CIFA 3BZCA 4JKFA 2KHVA 3HMJG 4CGJA 2GIRA 1DTTB 2IJRA 2WBNA 1QZ6A 4XTTA 4LY7A 4TXSA 2YWKA 4P72A 4M9JA 2B9YA 3MM9A 4NLTA 3PR4A 1CXQA 2XS2A 2LVWA 3HLUA 3IRWP 1NK5A 3LGHA 2ASPA 4ZJOA 2F4VF 3CC4N 1N52B 3AFGA 3ZT1A 3VVUA 4LD0A 4M42A 2H48B 1OW5A 3QPIA 1BQMB 1UAXA 4OZNA 3O0FA 1TUYA 4X4OA 4H4OB 1S1TA 5IT9O 4KH5A 1W2IA 3AO3A 4OD0A 3ULDA 2FGCA 3OXGA 1FJEB 1S0OA 3QIOA 2O66A 3KBBA 1I1GA 3HHEA 5SWMA 1FDAA 3G6EN 4M9LA 4KLMA 3KZBA 5ADZA 2W3SA 2WAQF 1Q5YA 2CDRB 3GSIA 2G06A 4NLXA 3RRKA 2HIQA 4PXEA 4JI2F 1RLCL 3AOCA 2X6SA 3BF1A 1YJ9N 3NGUA 1VS3A 3NF7A 1XHXA 2RE2A 1XEZA 3MI7X 4A8MP 2E9TA 1ASVA 3CDEA 1VRUA 1IIPA 2F4VK 5KFEA 2Q0RA 3KKAA 4GKJF 2P9KB 3IGVA 2Z30B 4FWMA 2JEGA 4NL9C 2IC3A 3HI0A 3FCHA 2O8EB 3DRXA 3MM6A 4ED3A 3I96A 3THTA 3HHDA 7ICFA 4O44B 2A40A 1N61A 4F72A 4YXMA 3PVXA 5GIPA 4ED1A 4RW8A 3QMLA 9ATCB 3F9KA 2YQ0A 1Y11A 1RM6C 3OPXA 4QZ8A 2YX4A 4WKRA 2WAQD 5KG4A 3R97A 3HPGA 2VASA 1HIYA 1KKHA 3HJEA 3CMQA 4LRBA 5DDQC 4JKAA 2DGZA 1BCMA 5ETTA 1FDDA 4BR5A 2VODA 5EGYA 4CEDA 1TL4A 3N6MA 4FWPA 3E9PA 3GB0A 4TY8B 1WNEA 4F93B 4CTAA 4CE9A 3SMVA 3QUQA 5DLFA 1NNEA 3PX0A 3JQMA 4DPUA 4EI2A 1S1XB 3TAPA 3AA4A 1NM1A 4GKJK 3KIOA 5LOQA 3UM9A 8ICUA 1UFKA 2IM2A 2VG7B 1NGAA 1MMNA 3DGPA 4G9ZA 4YY3F 2PYJA 1ZM3A 3VEXA 1Y0HA 1TYQA 3PRBA 4DV6J 3N0VA 4BRPA 3NBPB 1E6YB 3VOVA 1IWAA 5BPNA 3F0NA 3OTCA 5F2RA 1BO5O 4M63C 4DV4K 3W1YC 1S5ZA 2XY5A 3M8SA 1MG7A 1CJUB 5A8RB 2J6SA 3OSPA 1TL3A 4D3HA 1LWEA 3T5KA 4JEPA 3AY9A 4B8CA 4QZDA 3QAUA 3QINA 3M4XA 5ALXA 2UP1A 4C6AA 4K0KK 3CJRA 5T7LB 2PBDA 4E1MA 4DSJA 1QSSA 5D4NA 2VA3A 2J9DA 3PJXA 3QIPA 3IUCA 3RRGA 4RW6B 4LIWA 5GAGI 2V4QA 5HP1A 1RYSA 2BQRA 3A8KA 3O3HA 1LW2A 4QOZB 3R5DA 5DM6L 3OTOF 1X9JA 2K8AA 2M4MA 4WFXA 2MYFA 2YH0A 1XSPA 3PJWA 1OJ4A 2UVRA 4ANEA 1LKYB 5EY4A 5KFBA 3O8WA 4ZTFA 2OJ3A 3D1QA 2DBYA 1NK9A 2P66A 4OYZA 3C16B 3A5OC 3UD4P 3I9V9 3C2PA 1XN9A 1LKZA 5J0SA 1OY9A 2MY8A 1PYTA 2Y3YA 4DL3A 1KAZA 2LEPA 1XO1A 2ZC3A 3VQ5A 2YJEA 2E2OA 4ILJA 3GTYX 3GPAA 1D9FA 5K8MA 1P27B 4ZTJA 3B4MA 2EG1A 3MD3A 4DOZA 5K9FA 2HLUA 2D3O1 4JI3K 2BCUA 1WG5A 3B6BA 2QA1A 3E9LA 1VK0A 4BX9C 3F5EA 1RT4A 3ZSQA 4RWTA 1WOSA 3PM9A 5DGAA 3NCPA 5KFNA 4ZCMA 2W7PA 1RZMA 4K4YA 1S57A 1RE1B 4FPIA 3QE9Y 3FBEA 3OTOK 3TO8A 4B3TJ 1VIXA 2LPEA 3K9KA 2DK2A 4GC6A 5AQSA 3SUPA 3M2RB 2CG8A 2IVPA 5GAEI 3VQTA 3NGZA 4Q0BA 3JPSA 4JI4K 1CBKA 2VFSA 1ZPVA 4LF4K 1HI0P 4DUYF 1QZ5A 4DFJA 2DTJA 1VQOS 3VQ6A 4OX7A 3SQ4A 2ZJ5A 1SQGA 5HJYA 4GY2B 1CS4B 3MEEB 2A3ZA 4A8EA 4EENA 2NQPA 4KLTA 4ZPWR 2GFFA 2Y8WA 2ASMA 4P7TA 3DHXA 1FI4A 2QJ3A 4OJRA 1V6HA 3ENAA 2HGNA 4OGCA 2VBWA 2HURA 5DK5A 4FM2A 1ZQYA 1WC6A 2RHQB 4CLLA 2KEYA 5BYQA 4K4XA 8ICNA 2YB4A 3UXOA 1SC1B 3PIOL 4M94A 3H8MA 1YRXA 2P51A 1D1UA 4MIBA 2W2PP 1WHXA 1X9MA 2RDJA 1WB9A 3K0SA 2JGAA 1ZQDA 1SVDA 2ZXIA 1S1UB 5BYRA 4TLQA 5KFPA 3LVWA 3G71S 9ICKA 4BLGA 2CJ9A 2H5IB 4B1XB 1ZQXA 3OR2A 3PSIA 5E3PA 4DOAA 1U2VB 4DUYK 4CZGA 4IFYB 3OD2A 4PY5A 4C97A 1C0UA 3N6LA 2G2ZA 4RQ1A 4HAIA 2PFOA 1WCNA 3V9UA 1OWXA 3WQPA 1JXLA 3RW7A 1CQNA 3MK6A 4ECZA 3CDWA 3DOLA 2CPHA 2VGMA 1DLOB 4ID8A 1PYSB 1QHTA 2FPKA 1A6SA 1MA9B 8ICSA 2AMCB 3LYSA 3O3FA 2FHJA 1WC5A 1IJEB 1Y00A 2YPYA 4I2QA 5G5GA 3UCGA 3ET6B 1J2MA 3JB9k 4FYXB 1SCJB 2O8BA 2EI5A 2FVPA 4YN4A 1IKXB 5D49A 3N79A 1VQON 2KI2A 1FRJA 3JSRA 2NPIA 4EO8A 5CHCB 2GIFA 2HAFA 5DGBA 1ZQHA 3THXB 3QU4A 2X74A 4DEZA 3HX0A 1N33F 4IWVA 3HHLB 1RGVA 4V19J 4QYZJ 2WBMA 1HBUB 3D45A 1HHSA 5J0XA 4CESA 3FR0A 1H3DA 2K1RA 3QT7A 3N5FA 3ZD8A 4DUZJ 1RK8A 3DU6A 2NXCA 3I55S 1IKYA 4FE3A 5KFRA 2WVFA 2DKXA 4FKYA 3GFXA 5I3UB 1UQVA 2DGQA 3ID8A 3T1HK 7ICIA 3J7AN 3G71N 3NRBA 2OFHX 4AHSA 1UCVA 3DOKA 4J90A 1KQKA 1BMQB 2F44A 1IM6A 1RABB 3OSNA 3MDFA 3WNEA 5BREA 3ZZOA 1RTJB 1YBAA 2EFVA 4C8ZA 5M1KA 4X4VA 2YNHB 3TX8A 2ADCA 3AO2A 1UVJA 1N33K 1VC6A 3QB0A 2V2QA 1Q86T 4UOFA 1MC8A 4R8UB 1HMVB 1NMDA 5KRTA 3VCBA 2POKA 1FW6A 4WKYA 2D0PA 1T6DA 1JRPA 4N41A 3NASA 4QWAA 5AE1A 4KTWA 4X4QA 2D5RA 1C0GA 3RBDA 4DL0C 4M5GA 3ZX2A 4QOTA 4RO0A 1OVQA 3UMCA 4F5PA 3EICA 5J2NB 4JN4A 1VBYA 3U1MA 4HDGA 1JLBB 2Q0ZX 3BGOP 3PO5A 5M1NA 1EP4A 1ZAVA 2Q79A 3QUCA 2XLKA 2IYIA 3R8YA 1YDLA 4YMEA 1A0OB 4DPTA 2BDUA 3BBBA 3OW2M 1OXJA 3ED5A 5ETPA 4OX9K 3W3DA 4KI6A 4DTRA 1A76A 4I64A 4DV7F 5KNIA 1F0XA 3LF0A 3NGTA 4HHHA 5HP4A 4DR2K 2V7ZA 2OAUA 3B8AX 3I55N 4P2MA 1S0MA 3MCOA 2M8DB 2HHPA 3AQOA 1RT2A 1Q8KA 4F4WA 2H3QA 1H2UX 3KXDA 3BF3A 3CJ3A 2C2RA 2EPIA 3PXGa 1KXPA 3P8BB 2YX7A 4LJXA 1W25A 2V9KA 4M3UA 3AU6A 1VJQA 2DY9A 2H65B 1RP5A 3AQEA 2GO7A 4EZ6A 4FS2A 4B17A 3GG0A 2BHNA 4UTGA 3KK7A 1R89A 2CWXA 3KVGA 2FJDB 3H4BA 4HUFA 3RRHA 1U2RA 4P75A 7ICMA 4X65F 2A1SA 2ZJAA 1GH8A 1R0AA 4NWIA 5BR8F 3SD7A 1IBLK 1XI1A 1AFIA 5L38A 1ZBHA 3C19A 2MHEA 4BC7A 3N9UC 3H3NO 1ASUA 4USUA 2WW8A 5J2PB 8ICOA 3CJTA 5AT1B 1IG6A 5J8YC 1EETB 4E8UA 4DU7A 4HTUA 3D2SA 3IP0A 4USVA 1VQNS 3GFKB 3W2WB 2J6UA 1KL9A 1L3UA 3SNNA 3UDVA 3IBWA 2YQ3A 4NEYA 3HVRA 1CRXA 1U24A 2P9IA 2P9PA 1QJHA 4GKKJ 2DITA 3OYKA 3BS9A 3KK2B 4IOBA 3PFOA 3EGVA 1V4SA 5BPLA 4I2GA 2HK3A 4ZS6A 1GEHA 2K7KA 2VPXB 1ACMB 4CD3A 3CD7A 4Y1CA 5A76A 1NM2A 2DR7A 3I8DA 3OXLA 1HR0F 2F9TA 3VQ7A 1JXEA 4NL9A 3LZJA 3N7SC 3M8QB 4PRFA 4L73A 3SFUA 3V9SA 2XI9A 1U2FA 1UWBB 4KPCA 4HI2A 2MGZA 2GHWA 4DR3J 3SQOP 4LFCF 1T05B 3CETA 2AZ1A 1K47A 4QZFA 3DLLL 2HQIA 4RNHA 2IBKA 3FSIA 2RHKA 4RW9B 4IRKA 1YJNS 2KLAA 1A7GE 1HD0A 4KHQA 5JVHQ 2KH9A 2YHWA 1YX2A 2LYVA 3DM2A 2DRBA 2HHHJ 2HAIA 3QJPA 2D0OA 3KHHA 1W0HA 4IQVA 4O9MA 1C4AA 1ZS6A 4OI0A 1IBKK 2FZKB 4F3QA 4BRGA 1OVYA 5HHIA 2BJ8A 2KFZA 3Q7CA 2WB4A 4A2AA 2YX1A 4F67A 2KW4A 1ZQOA 2KJWA 4PA1A 1VC5A 3QGIA 3O8MA 3IV6A 4OMFG 4DOCA 1LVHA 4NA2A 3CMES 1HR0K 1ZD4A 5LMUF 2ERRA 3DMJB 3EZ5A 3SEIA 3CC2S 4BC4A 2ZIXA 1U25A 2YMQA 3DLJA 8ICKA 4OI3A 4RQ3A 1VQNN 1GOBA 3KTQA 4RNFA 4PKDB 2O01C 1RBRA 3V72A 3FZFA 1MSWD 2Q36A 3AA8A 5IQ6A 1BPDA 3FDSA 4KHYA 1V38A 2DNNA 3S6JA 2HOIA 5DDOC 1IJFB 4HVZA 1WI8A 2DEJA 1U1OA 2ACMA 2F77X 4M63A 1URNA 1N5SA 2W9MA 2AJ0A 2QWPA 2HBJA 4DQPA 4X66J 3L7UA 3C7NB 3FSXA 2JFKA 4KAZA 1GX5A 1RADB 1KFSA 2RF2B 4O3MA 3PYFA 2RHFA 2ZUDA 3T41A 4Y2RA 2WF7A 4RW7B 2D0AA 1FWKA 2BE2B 2GVZA 1RHRB 2ILZA 5LMUK 1YIJS 5J0TA 3ILJA 2VH7A 4KLEA 2WONA 4L72B 5GMKa 1YJNN 4JYAF 2PMWA 5CRXA 1EXQA 3P83D 1WI6A 3U7JA 3DLHA 2LA4A 2E4LA 2RSQA 4OZ3A 3V9WA 3OL8A 4KAIA 2H3ZA 3RH6A 4E3SA 2P9UA 2Y9UA 2YKNB 2F8TA 3GIMA 3P5JA 2PE8A 2PIIA 1U0SA 4M5KA 1IR1A 3P96A 3GV5B 4FKXA 4X4NA 5I3PA 3M1FA 3HHLC 3KWGA 4FJ8A 4PPXA 4CT9A 3DDNA 1Q81T 1MWKA 2WVCA 4HHUA 2CZVC 4FLWA 4MO5A 4NLNA 3I0RA 1T9VA 2GQQA 2LQBA 2Q97A 3IR6B 3VAIA 1F1BB 3JSYA 2Q66A 4BGAA 5IM0A 1UPHA 5AKLA 2XQCA 2BBEA 2HFVA 3V6JA 3DRSB 4PQUA 2HNDB 2I1QA 3J7Z5 2IMOA 5EE3A 4FBTA 3NY0A 4MLEA 5BRHA 4UUWA 1RHMB 2JWNA 4JYAK 1A0PA 1IJJA 3SQGB 4FYDA 2QKQA 3PSTA 4MDBA 5I42B 1RAGB 4JK9A 4H8KA 4DR4K 1DGJA 4QJFB 3F5AA 2JOQA 2VPYB 4OX6A 3N6NA 4CIEA 4LSZB 1S1WA 4NXMK 1NB7A 4YD2A 3SSSA 4B8AB 1JK9B 3L6QA 4NXZA 2W7OA 3O9SA 3V81B 3DKDA 2EKYA 3LPUA 1W26A 5AQHA 2KHQA 3MMBA 3B0YA 4CZMA 4CFDA 2C3PA 4O5BA 2ZXHA 4Z7YA 3D3BJ 1KAXA 4G1QA 3T3FA 4E1JA 2YNFA 2KO1A 4FLVA 1YIJN 4FYWB 4OKKA 2HVEA 4CJFA 4ELVA 1U1NA 4LF7F 3V7KA 3EY1A 2BJ3A 4RTFD 4F2SA 4DF4A 1ZQEA 3DLEA 1B0XA 1NAQA 1J27A 3HCXA 4CF3A 1FD2A 3LALA 2EFPA 3CRXA 4FFDA 3W60A 3CJQA 2BCVA 2ADBA 4OYAA 3SQ2A 1ZETA 1HNXJ 2FZGB 1HA1A 1WOPA 5KG0A 1VR6A 5DQHA 5FRNA 4RUAA 5AXNA 3ZFVA 1NHVA 3OS0A 7FDRA 2O3DA 5DS7A 1N8RT 2XZDB 1RZTA 4M8LA 3US5A 2Y9HA 4JKCA 3L4IA 4GVMA 4G1IA 4UAWA 1KVJA 3SBMA 3JPTA 3BGRA 4JOUA 1YHQN 3J80O 4OI4A 1VQKN 3TAFA 1YTUA 5ALZA 4WCEL 4IQUA 3M6ZA 2G08A 1PO6A 4U96A 3ZX0A 2MLYA 5KFYA 2NLWA 3ZSVA 1CEZA 3V7LA 3KHLA 1VIOA 4GRSA 1K8KB 4FZMA 5DM7L 1WNSA 3IWXA 3EM1A 2AEJA 4JKDA 3C0BA 2K7JA 5G0RB 4IG0A 4FVCA 1RHJB 5KAIU 3SJHA 4H4MA 4GLXA 1OH6A 2QWLA 1RACB