1YZ7A

Crystal structure of a c-terminal segment of the alpha subunit of aif2 from pyrococcus abyssi
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
176
structure length
176
Chain Sequence
KAKLQEFKRAQKAENLLKLAAEKLGKDFETAWREVWVPLEEEWGEVYAAFEDAAKDGIDVLKGHVPDEWLPVLKEIIDNYVEVPTVTIDAEFEITVPKPNGVEIIKEALIRARDRANKEKDVEVKFTYLGAPRYRIDITAPDYYKAEEVLESIAEEILRVIKEAGGEATLLRKEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Relationships of the Intact aIF2alpha Subunit from the Archaeon Pyrococcus abyssi
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
molecule keywords Probable translation initiation factor 2 alpha subunit
total genus 59
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 1yz7A01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 1yz7A02
3QSYB 3AEVA 2AHOB 3J81j 2QN6B 1YZ7A 1YZ6A 1Q46A 2A1AA 3CW2C 1Q8KA 2A19A 1KL9A 2QMUB
chains in the Genus database with same CATH superfamily
3QIPA 4TNOA 2H5JB 2HBRB 3VR1A 3SQOP 3WKBA 1ZQUA 3HSZA 4KJIA 4KN7A 4YVZA 2GIQA 3WDOA 2YKNB 2JZBB 1HNXF 2OFGX 1KBRA 4P74A 1HBUB 2VJVA 5J1NA 4LSNA 5CYMA 1Y11A 3OL9A 1KBUA 3JQMA 2HHVA 4L76A 3UE2A 1CC7A 3SQGA 1N5YA 3J81U 2XSJA 3AOBA 4DOBA 4C0HA 1BPXA 2KV2A 5HHIA 4YS2A 5J2MB 5AK4A 3F5AA 3SYZA 2PD1A 3M8YA 3KLFA 2C2ZB 1DK2A 4WFXA 3FDSA 5AK5A 4UQTA 2G2YA 4DQPA 2HAIA 2FMSA 2V63A 5AM0A 7ICEA 4WPAA 2OMLA 1F2GA 4MFBA 3G6YA 3NMRA 1B7FA 3C15B 3MECA 3OPKA 3I0SB 3K1ZA 1VRTB 4CLKA 3A3PB 5CA5A 2WSFC 2EFNA 2H3VA 3EPIA 2MUTA 7ICOA 1F5BA 1RWXB 4NLVA 5IT9U 4U67Q 2V67A 3KKAC 2GIRA 4LJMA 1WC1A 2AIRB 2CNKB 4A8OA 5IS2A 3ISBA 4F8RA 1U26A 3OXGA 2CG8A 3K58A 4J90A 4DN9A 2VA3A 5AKYA 1VHIA 1BQMB 5ETMA 4GC7A 2V8DA 2ZD1A 1Y00A 1L7MA 1N0UA 5KFYA 1JLEB 4DV6F 4QU7A 3ZDCA 1S1VB 5KFSA 1ECWA 1PIEA 3D6HB 3MR6A 2ZJAA 1SKRA 3NGSA 2B8QA 2KTQA 1DY3A 5KOWA 3E8OA 1U6FA 2WBMA 2AT1B 4YFUA 3C2MA 2NXUA 3AM9A 2VOPA 5I3UB 1KTQA 1Y9OA 4RQ7A 4ZOHC 2R8IA 1HNVA 4BS2A 4CF3A 1SXLA 9ICGA 5FLXY 4KN4A 4I2HA 3NASA 1URRA 3C5FA 1NK7A 1X4DA 3AQEA 5ETKA 1KN5A 2PFOA 2IVFB 4DX8H 2M88A 2RVJA 1A6LA 2G1DA 3KKAA 1H38A 3G6ES 2KKVA 1EQ0A 1LB2B 1OS5A 3IAS9 2IVYA 4CLZA 3C1ZA 4J37A 1RKJA 2DR5A 4X4SA 4RQ2A 2ASJA 3W5XA 1PBUA 4F36A 1WSVA 1RAAB 1SUQA 2Y9TA 2BZFA 3R7BB 5B0EA 1NKCA 3IM9A 3NCRA 2QL7B 1R8BA 2FZKB 4UZCA 3CC4S 1Q78A 3AB2B 2J8SA 3HI9A 2EFPA 1XR5A 4DF8A 2X51A 2RQMA 3FRZA 4X4VA 2KMDA 2HBMA 8ICSA 4M5NA 3GR1A 1AW0A 3PJWA 1Q53A 2OAUA 3C23A 3KLHB 3KZIU 5G0RB 2DUYA 3U02A 2EFVA 1X5TA 3J7YI 3TP2A 4DEZA 2WF7A 4EBCA 4KHMA 2J9CA 1OJ4A 4HDGA 3KNAA 4DWIA 1FT8A 3ILIA 2XULA 1O6XA 4CLTA 1N33F 2FIUA 4YY3F 3BH6B 3NGKA 4J9OA 4LR8A 5KFOA 2J9DE 2I1RA 3RJGA 1R6YA 2IOFK 3SAFA 4B9TA 2GGPB 1WEXA 4I27A 7ICGA 3CW2C 3BV8A 2UUAF 3IG8A 2FPHX 3ZZPA 3HJFA 4IG0A 4FP9A 2B6GA 5J2QA 1VJQA 4OHXA 1LVHA 3MGHA 2QFIA 1J5EF 1UQVA 2ZBRA 4OYPA 4DR4F 1RT3B 1Y0HA 3KMQA 1NBEB 4I2EA 4IQTA 4LIRA 2LXIA 3IBWA 5BYSA 2FZGB 4IQXA 3CD7A 5EOZA 2HKEA 3FFIB 2ALZA 2CZVC 3G8QA 2GAGC 3VGSA 4I2PA 1IQZA 1FNOA 3PHTA 1JLGB 3AUOA 2AYGA 4KIAA 1UWBB 1UA1A 4OYIA 2RS8A 5J0UA 2I9SA 1VQOS 3CULA 3ZO7A 3ICLA 4IR1A 3I82A 2G13A 5AE2A 5CAAA 2MKHA 1QSSA 3UD4P 3HDSA 1NK6A 3W8PA 5RUBA 1SIWB 1PJ6A 2OHFA 2YNHA 4DR3J 3CD0A 3BSNA 1NCLA 4NYZA 2DIVA 2BA9A 3PACA 2WVFA 3ZZYA 5IFMA 2UVUA 3JSRA 4ELTA 1JWWA 1SKSA 4F71A 4USKA 1RXOB 2HHUA 1HJPA 1NEEA 5J2FA 1NRKA 2C2KB 4PJ0U 5AI5A 2O1PA 3FEZA 1NUEA 4G3IA 4OJ6A 4KAIA 4AFFA 2PDAA 5F8HA 3SCIE 1JROA 5KTQA 1PSDA 3LUYA 3P8BB 1ZAVA 3QX7A 3DYAA 3QJJA 2JV3A 3D1QA 3IM1A 4XDCA 3IO1A 3NOGA 2WONB 5B7WA 2HK2A 1S97A 4IO1A 4GO7X 1U1MA 4P7VA 1VLOA 2ZTEA 3CEDA 1ZQQA 3KG0A 4F04B 3KFUF 2RP5A 2DNKA 5K5MA 2XBPA 3J7YU 3RB3A 2DK2A 2ZIWB 2BKPA 3MUVP 1TKDA 5KFFA 3OXFA 2Q66A 3DRPB 4PQUB 1N5TA 2VUGA 4UB6U 3A8JA 3R1LA 1TKXA 2FMPA 2F40A 2HHHF 1JJCB 1FJ7A 3HFKA 2VQEF 4Y34A 3NWGA 2ZC3A 4F5RA 1MMDA 2M5YA 1CBKA 2W1BA 3AAWB 4CNQA 1VR6A 1L7OA 2MQ8A 4AYBF 3FQKA 3PZPA 2FVRA 2AU0A 3V2UC 2FLLA 4FZLA 2FPLA 2I2YA 2YPYA 2CJAA 3BZQA 4O9MA 3JPSA 1QUVA 4QU6A 3KNGA 3LAKA 4TLQA 3KLIB 1VK3A 3BYPA 1BC6A 1ZRMA 1XMBA 5DB7A 4KLSA 4WFBQ 1KLMB 1SL0A 2DTJA 3OTDA 9ICIA 2N4DA 4CRJA 5J2NB 3ALRA 2HQCA 3GFKB 2K1RA 4YDDB 5AKKA 1FXDA 2HBQB 2ZH7A 3DLEA 1I94F 3CMQA 5CB1A 4ED5A 4GLXA 2KK0A 4ZP6A 4RUHA 3X3UA 3TEHB 2QMXA 3QLHA 1ZQZA 1F9FA 1FHTA 1IBLF 2YMPA 2GH1A 5CWRA 5E7OB 4WJ3B 2QEXS 3M8QB 3VZHA 3OSPA 4UW2A 3MMCB 2P2CB 2B5JA 2Z56B 2PFPA 3GJSB 4LF7J 3DDNA 3DOLB 1RAFB 9ICMA 2E3TA 3K59A 3WX8A 1DTTA 2KXFA 3N28A 1FFWB 3JSMA 2DB1A 2GCFA 3FK4A 5DETA 4J9SA 1FFVA 4QOTA 5HROA 5J0YA 4QJFB 2JH3A 4HHJA 3KJQB 1TL1B 7ICPA 4ZHRB 2F3JA 1MQ2A 1LWEB 4ZK7M 4EX6A 4NXZA 2LKZA 2JC0A 4RT3A 1ZJNA 2FUG9 2KYXA 5KFJA 3KLGB 3OR1B 1HQUB 1S48A 2HS0A 4YXJA 2Y0SC 4A8XA 4K0KJ 4EGLA 3U1NA 3V7JA 2G5HB 4FNHA 4HL9A 3KUEA 4I6AA 4QZEA 3UDCA 1T3QA 1FCAA 8ICXA 1ELOA 2K06A 1VJ5A 5D8HB 3ZXWA 1OSCA 1YSJA 3F73A 4ECWA 3BGRB 1U1RA 3A12A 2RAQA 4GIBA 5AJ3F 2WAQF 3U27A 3WK6A 1ZD2P 4I1TA 2AYMA 4R5PB 1N54B 1JUDA 1RLDA 5EE1A 5C42A 2KRRA 4R0JA 3RR7A 1FTCA 4ES1A 2HOQA 2MXYA 3NGRA 4QWDA 4USVA 2CPZA 4B9UA 2KICA 4AT1B 3M8PA 2GS8A 3D28A 4DV1F 3BZKA 4IOCQ 1A0PA 4I56A 3ILLA 1QE1B 3N9UC 3FC4A 1LKYA 3TJAA 5J29A 1ZETA 3SIPB 4C8ZA 4C8YA 3K5OA 1T9VA 1UT8A 2UZAA 3TUIC 3QYYA 1X42A 2C2EA 2DHXA 5KG7A 3QWPA 4URGA 2OPRA 4EZ9A 3DMJB 3EX7B 4ID8A 4B3OB 3V4IA 2R4FA 1GXLA 3A1YG 1U02A 1PK1A 1FKPB 3LH2S 3B8HA 2DXFA 1PJ5A 4U9RA 4Z2XA 3IMQJ 1REVB 2DYAA 2VICA 1FIQA 4LRBA 3HHEA 1G7CB 3TJ9A 3IGVA 1UZHA 3SBMA 3SSRA 4PUOA 5ETVA 3AB4B 4EK2A 2H4YB 4UATA 3TZWA 4LREA 1GK8A 3M8RA 3ELHA 3C66A 3C8YA 1WDDA 3M32A 2W24A 3VAIA 1ZQPA 3C2KA 3ICXA 2KZZA 5ALUA 2AJFE 2VBWA 2CPRA 4B3TJ 5E41A 1UFLA 3NNCA 4P4PA 4ZIWA 3FSIA 1UVMA 2I8EA 2AGOA 4XUSA 4X66F 3KHHA 3L3CA 2I6WA 2VKZG 4LBIA 3ISNC 4KV8B 4MAKA 3SCJE 2NSBA 4NX9A 4ZPWR 1MN7A 5FDLA 1PAEX 2HWIA 1D8ZA 3HT0A 3FYHA 4CLUA 2BJ8A 2BV3A 2ZKTA 1MN8A 1FD8A 3DDIA 2HHWA 3R5CA 3DOMA 1CPZA 2DRDA 2KVSA 4PG4A 3QGPA 1DHMA 4TXSA 3V72A 2DR7A 3LDAA 5T7LB 2M3DA 5E5NA 1BGXT 2HNDA 2IYGA 3R5BA 4AQYF 4RW6A 1VS3A 2MLZA 3PNCA 2LKYA 1JNRB 1RTHA 4ZKAA 3THTA 4G1PA 1HQEB 4J9NA 1JLCB 1K73T 3I5CA 1L3TA 2V34A 3RUBL 4KLJA 2AKWB 2D69A 2F8EX 1FEZA 3LP0A 7ICRA 1YRXA 1YJWS 4QYRA 1ZM2A 4JK1A 1L5UA 2P6UA 3W2VA 4I67A 4CO2A 1WWHA 3AOAA 5HQLA 5ALZA 3MMBB 3DOKA 4YMMA 1RWOB 2RD5C 2HRUA 2IM3A 1HNIB 2EW9A 1AA1B 4BBYA 4PXCA 3P45B 2ROGA 4P2MA 2UXBF 4E2FB 2JVRA 3TOQA 2KHDA 4LF9F 3DRSB 1CQMA 2MSTA 1RYSA 2FDNA 2QG9B 1P9QC 2KN7A 4ED3A 4UAUA 4LFBJ 4F93B 3TAQA 2DEIA 2DNYA 2Y1RI 3SSSA 4DQRA 4B9MA 4CCHA 2XMAA 1F9HA 5J2EA 3K89A 2ROPA 2MYFA 4KGZB 4M5JA 5DG9A 5J8YC 1BE4A 1KR4A 4MIAA 3GMGA 1B0XA 2HBJA 5IIKA 1J2MA 5F41A 5HBMB 2UXCJ 4ZPCA 5GMEA 1N8RT 2QJ3A 3R6GB 1VQYA 2AJQA 4OZLA 1OSDA 2NO4A 5A8RA 4PHDA 2R7QA 2E5IA 3EMTA 2PA8D 1ZQCA 1T0TV 3A8IA 1APSA 1SL2A 4DX6A 4OJ1A 1VQ6S 3LK9A 5HMMA 2CJ9A 1CJUB 3BJYA 1YBUA 2JLGA 4JI8F 3RJJA 3MABA 4MF8A 2G4BA 4G1QA 3DGPB 2MQPA 2JC1A 2WHEA 2OEHA 4GFJA 2BJDA 4USHA 4KO0A 1Q5VA 2C2DA 2BYCA 3CWJA 1TL4A 2C2OB 2HGLA 2YWWA 2HG4A 4CH1A 3BQTA 2OEMA 2CNOB 2XTJP 3BPDA 2MQNA 1BY9A 2W2NP 2WSEC 1RU2A 4EYIB 4OJ5A 3RB6A 4C0ZA 3SMZA 1H7XA 3EDRB 2BEFA 2RDDA 3U26A 4NLKA 2FY8A 4RQMA 1EKRA 3KTQA 2K8GA 1JLBA 4QZ8A 2Q6BA 4X4PA 2B43A 3W9JA 4C8NA 1C1CB 3FVYA 5F8LA 3FM9A 2AGPA 2FQQB 9ICTA 1MSWD 4UAVA 3M6WA 1KFSA 3CJTA 2G0AA 4KLTA 4EMDA 1QAJA 3C1YA 3TKAA 4NY8A 3PFOA 2OPSA 4FF3A 2GVZB 3M30B 5DQIA 4K4TA 5DZ7A 2NYIA 1UP1A 3UCUP 4R65A 5LMUJ 3RYLA 4ACOA 4FF4A 2CFXA 2R7SA 1S1UB 3HF5A 3N97B 1YK9A 1RT7B 5AXKA 1DARA 3BBFA 3NP5A 3J81j 1RZMA 1QVGR 3IBFB 1U47A 2XI9A 2QLJB 3N7SC 4RUCA 2V4JB 4TUSA 3JSYA 3QMQA 2NRXA 1ZQJA 4UTGA 5D0HA 5HJXA 5K9FA 3S01A 1JX4A 2ZH2A 2G09A 4AL6A 5EWEA 1NXIA 2O67A 3M9OB 5D0EA 2O6KA 5A76A 3TWZA 1Y3KA 2WVBA 3SXLA 5C25B 2IRYA 3H7HB 1IBKJ 3C29A 2E9TA 2E7XA 5BXIA 3PW7A 1T9TA 3R97A 3AOCA 1WKJA 2I5JA 3W1YC 2Z2YB 1VC0A 4NLUA 1GMUA 2KP7A 5ALGA 3GIMA 4WYLA 3FRYA 1RZTA 2EBGA 1T02A 5B09A 1S79A 2CUYA 2K4EA 4TU7A 1HA1A 3J7A1 3LQVA 4PQAA 3Q2SC 1NK9A 2QMUB 4CLWA 2H5IB 1L6NA 2QA2A 2VBYA 1S0VA 5LXYA 3GTYX 2HQFA 3PSFA 2DO4A 3W5ZA 1M90T 1AROP 1F60B 4LF8F 1CJTB 2E9RX 3N01A 3RU0A 1ROFA 4OHWA 5CQGA 5C2CA 4PGQA 2PMZF 3D9BA 4U95A 4JWMA 2Z7JA 4QIWF 3DEEA 4DV0J 1Q79A 4ZVFA 4G65A 4ANDA 4CDIA 4CZCA 5F0UA 3LGNA 2CPHA 2C3OA 3SEOA 4K4IA 3C3LA 3M6KA 1V5IB 3GG0A 4EENA 2U1AA 4CF5A 1KONA 1U25A 2FPKA 4B3SF 4B9LA 3UN3A 3OXLA 1UTAA 1GTEA 2BHNA 3HLUA 1Q95G 2YKOA 4GVBA 2LYBA 4PGYA 3O5TB 3BDEA 5HP4A 3QO9B 5L9XA 1OPZA 4M5IA 3C6UB 4H4OB 3IR6B 4IFVB 4ZLNA 2K4IA 4FVCA 1Q7YT 2IPOB 3UCZP 2J6TA 5CP2A 4OYXA 3DC2A 2UVRA 2HRYA 4F02A 4RNOA 2OI2A 5L39A 4NCGB 1NPPA 1N36J 4NPOA 1SQEA 1Q8LA 3ZDBA 2MGZA 2WVCA 1XEZA 2OIHA 3E3XA 2XI2A 2ZUDA 2Z8QA 1RCOB 2EFGA 1NSQA 3H2LA 8ICAA 4A8QA 4IRDA 3BBCA 1S1TB 2W8LA 3MM9A 1M0SA 1UCVA 3OW2R 5A2QY 3PFEA 2DH8A 5ADZA 3VF0B 1HQ2A 4A8EA 2OPPB 1HBOB 5E79U 1JLFA 1JN3A 3H59A 4F4XA 2M7SA 2AMCB 4N56A 3V6JA 3GR0A 4X4TA 2XMKA 4CE6A 1UCNA 4RPZA 8ICFA 1C1BB 3N5BA 1N6QA 4Y2XA 2KOBA 1D9DA 3T5HA 3DU5A 3SI8A 4PHAA 1U09A 4DMZA 4OI4A 5LOQA 3N7PD 2MQLA 1U1KA 1KFTA 3M9MB 3EUNA 4M94A 3MR3A 1XR7A 4KLUA 5D6GA 1HIYA 1U1OA 1ZD5A 1M1KT 1RHKB 4UOGA 1FRXA 2A1BA 2QTWA 3C28A 4CLSA 4OLPA 4Y2YA 2MZTA 2C42A 4B3RF 1Y4ZB 1WG8A 2B7CB 1BWEA 3MAAA 1RQNA 3HZEA 1TR0A 4KITB 4Q44A 2ZHOA 5HLFB 4MT1A 2DFLA 5AM5A 2IY5B 1RJJA 4QCLA 1P9YA 2JEFA 5EE3A 4ECSA 3PW4A 1FWKA 4JWNA 1LKZA 1NDPA 3TRGA 1ICEB 4B08A 3PW2A 1F5CA 4NM2A 1NLKL 1B64A 2RQCA 1TTHB 4AQYJ 1CULA 4GXJA 4KYZA 3M8WA 4CYUB 1UVLA 4OL8A 4CLPA 4LJXA 2AJ2A 4CLYA 4I2QA 3AJDA 3DLKB 1VBKA 1VQKS 2GO8A 1ZQGA 3OTQA 3NS5A 4R63A 4WP9A 1Y5LB 4ZPVR 3QUBA 2XCPA 4YD1A 1SQGA 3QXGA 1VDHA 4J5OA 4LSZB 2GJ2A 3RW6A 2A1JB 4YY3J 3I4HX 2BKOA 5DM6Q 5F8IA 1KL9A 2W9BA 1DTQA 2WF8A 2DH7A 3Q86A 8ICZA 2NYHA 3NEKA 2ALYB 2QLFB 1X7VA 2WBRA 3CT9A 3KJNB 2R2RA 1FJCA 4MMOA 5G4DA 3S1TA 2NS1B 4O3SA 1IKXB 3H8JA 1HIWA 3TO8A 4Y2KA 4IG3A 5KFHA 2M9NA 2NRVA 1ZQDA 1RHMB 4AL5A 1WACA 4RNNA 4F4KA 3M2UA 4I2CA 3HP6A 1QSYA 2W01A 4ZVTB 5AKGA 3FQLA 2K8AA 4C2MA 2E8OA 2QRRA 3C6TA 1ULRA 5DKWA 4DCJB 1TV6A 3DLGA 2VFTA 5F9NA 4IO9Q 1S59A 1GEHA 2JWNA 4F4ZA 2WRMA 2XLJA 2EDUA 4A4JA 4P2SA 2RDJA 2FLPA 4FYXB 2E7WA 4X5VA 3MEEA 4YP3A 3ETRA 1YJRA 3DI6A 3TJ8A 2O01C 4F5PA 2F44A 1UFWA 1EETB 5CZVA 2PT0A 1GH8A 3QUQA 4IOBA 1HNWJ 3DNCA 3SDEB 1K44A 4C3MA 8ICNA 4TU8A 2K60A 2RT3A 4P73A 1D09B 3BN7A 3ITHA 1ZQVA 3BKTA 1TUGB 2HIQA 3IV6A 3JPQA 2B21A 5KL1B 1ZJMA 2JRSA 2OPQB 4PZOA 2Q79A 3H4BA 4LF2A 5AKXA 4USAA 2VG7A 3K75D 1FE4A 4JI0F 1DGJA 3BSCA 1RYUA 4OHVA 4DSKA 1WC0A 1N34F 4Y2IA 4AE5A 2NRZA 2DGWA 1FDBA 1JKHA 5AKIA 1W2BR 9ICFA 1U6BA 2GO7A 5L38A 1T03B 3LP1B 5KFBA 3QUTA 2QGFB 2I1QA 2KHQA 2EBEA 5LJ3Y 2K7KA 2EXUA 3AXKA 1ZQNA 2F4VF 4C48A 3H42A 4JV1A 1JNZB 1UEKA 2H51B 1OXJA 4FXVA 2KHCA 4PWUA 1U45A 2RRBA 2CQHA 4O3RA 2UXDF 5H2FU 2PIIA 5IM0A 3OL8A 2VIHA 4JI0J 1NJIT 2EH9A 4JI1F 3NLCA 3OVSA 2XQCA 4ZVSB 4NMLA 5E33A 5AM3A 4KKOA 3P5TL 1M5KC 2XI3A 1KQSR 1YDLA 2DHHA 3AJ1A 2NZCA 1P1LA 2CQCA 2JVOA 3CIZA 3G9CA 2H9ZA 2BW7A 1K0VA 2KD1A 2DT9A 9RUBA 3P49B 3RBEA 2O66A 3WQPA 2H3IA 1SV5B 1E6YB 3S6JA 1EP4A 2PI4A 3OL7A 4I2BA 2XGPA 1QUPA 3W60A 4ERDA 1JLQA 2QYGA 2PEHA 4ZVUB 1EARA 1MU2A 1XR6A 4ZS6A 2MKIA 2CJKA 4MIBA 4C11B 2N3OA 2N7YA 4CM0A 3PO4A 7ICTA 3GONA 1TFRA 4QZAA 3HW8A 3QE9Y 2MKJA 4P4MA 3MM8B 3V81B 2F4FA 2NSCA 2EK1A 1CI4A 2DNMA 3I56S 4LRCA 3JPOA 1T4GA 4ZMMA 2HNZB 4NLRA 3HVTB 2B6AB 5ALPA 1IKVB 5IC4B 1S4FA 2RRNA 1TP7A 3US5A 4M95A 4CNYA 2F8MA 2CQ3A 2QLBB 2OP5A 4UY85 2VPWB 3M2RB 4BX9C 4DU8A 2Z30B 3D67A 3I0RA 3HKZF 2AJ1A 5DB6A 2CVEA 1XWLA 1YX2A 1RADB 4DO9A 3RZAA 5KFKA 1PO6A 4P0QA 3OVBA 4ZIVA 5HMYA 4O4RA 3OR2A 1T8EA 3S7RA 3A8EA 3PEJA 1NSKL 1HWIA 3ZZUA 3H7IA 4JV5F 2XVTA 2W54A 2QC3A 2EK6A 2FVPA 3POTB 2BRLA 4J91A 2CQ0A 1RAIB 4RW7A 2IM1A 1T9UA 1FFSB 2HBZB 4Q0BB 1JJ4A 2QN6B 5HMLA 3PRBA 4TYAA 2LBOA 3H2VE 1ED1A 4K2JA 4ENOA 1N60A 4ITSA 3R5AA 3H25A 2GW8A 4F0HA 1FI4A 5AKEA 2W9CB 3B54A 4R66A 1LW0A 2BUNA 1Z3EB 4MTPA 4DUZJ 4L74A 4DX5A 5LSOA 2I5HA 2DCUB 2DD8S 4PR6A 2IHNA 1R0AB 2BE9B 2AEFA 2WB1C 3TNVA 1GMVA 5HANA 2BANB 2VFUA 3IAM9 1Z1VA 2YWFA 2WSCC 4UB2A 4PPXA 5J2DA 4ZCLA 4TY8B 1SGGA 1H2VZ 3RB0A 1ZA2B 2J9EA 4JP8A 3Q8SB 2FMQA 3TEGA 1NU4A 1CJKA 2ZJRQ 2PC6A 4RKUC 1Q3UA 5J2HA 1KKHA 3K2YA 4OV6A 4QZGA 3IS9A 2DPJA 1NHKL 1KRPA 4MFAA 2XO7A 2LU2A 4QZ9A 3WHIA 7ICIA 3KJVA 1XJWB 1AZSA 1NPRA 9ICEA 4MEXA 4Z6DA 2DJWA 4Y2PA 3MC1A 1ZPWX 5K14B 4O44B 2DF4B 4DR7F 2LP4A 1UJ5A 5DBBA 2C2MB 4KFBA 2PXIA 1Y5NB 1PCAA 1XNSA 3NNAA 3BGLA 5B5EU 1MNEA 3MI7X 3MPUB 1SQFA 1FDDA 9ICUA 1SIZA 5C5JA 1DLOB 2LQ5A 4CTAA 1ZQRA 3CUNA 5CXTA 3V6DA 2ZJ8A 1RT5A 2XSFA 3KG1A 4NLDA 2FD2A 2HNYA 1S76D 3MTJA 4EFAC 4CQ1A 3GFZA 2H3ZA 2LM1A 4ZJQA 1H98A 4JV5J 2OTLS 4ZVQB 2ZIXA 4ANCA 2BBEA 1YBAA 3NVWA 2XZDB 3MGVA 5KFDA 2DIUA 3BR9A 3NGTA 2A3VA 1G6BA 3Q23A 2GA7A 4O3QA 5K4LA 2YKMA 4QWAA 4EUVA 1RE1B 2AF6A 3GLJA 5HVGA 4DR5J 1VOMA 2DY9A 4UQGA 3VGVA 2IJFA 4QIVA 3VGUA 4Z6FA 4E0DA 1KQGB 5I42A 1IBMJ 3BQ2A 1WORA 2EVZA 2QL5B 1TFWA 4LF4F 1C2PA 1AT1B 3QWUA 2D41A 2E7VA 4RBUA 4O4GA 1RA6A 4RZRA 1MWQA 4X64F 5LT5A 4PCQA 5LSLA 3R5GA 3MM6B 4ZCIA 3MM7A 1B99A 2HHPA 2VJ5A 5AI4A 1IM6A 3SD7A 3NRZA 5BR8F 3MOJB 2KT2A 1ZAXA 4FYVB 1S6OA 1ZYQA 1YJ7A 3AD9C 3WIVA 8ICKA 2EWHA 1QLNA 1F1BB 2E1FA 1RABB 4DL7A 1ZQTA 4NLBA 2BM0A 3JYTB 2DR9A 2R8HA 4J9MA 4PZVA 7ICNA 2OXOA 2QA4G 1S1WA 1PYTA 3B4MA 3ADAC 1FX4A 1CEZA 1O8BA 2Y3YA 3QU4A 3D0HE 4Q5VA 4KPYA 2ZIUA 4DG1A 5IIOA 5JUMA 1RSCA 4WFYA 2JJ4D 4C0OC 2WB1D 3OLBA 1A76A 9ICAA 3ETMA 5AXLA 1R89A 1HPZB 2IVMA 1U2FA 2E1PA 4RBVA 2ZM6F 4KC5A 4G1IA 4MJKA 3TAMA 2YX7A 2R7WA 3T19A 2E8PA 4M6WB 1JK9B 1R6VA 3QT5A 1H2UX 3JTPA 1XSNA 2U2FA 2VU5A 4NI2B 4O23A 2AJ0A 4U8VA 4DR1F 2J7UA 4KLHA 4JI3F 5KG5A 3FAHA 3HHLD 5A8KA 4DBQA 4YOEA 4OYZA 3UDEA 1S1XA 4ICLA 5J2JA 5ITHA 2MLXA 2FVCA 4LFAJ 3ENVA 1P1TA 3SV4A 1LWFB 2V8GA 3RG6A 2IC3A 2IDEA 5J1EA 2CPEA 2XMWA 4MKYA 2LEAA 2RB7A 3GZFA 3VQTA 4YMNA 1FRIA 2QKQA 3GIRA 2EAOA 3Q8MA 4O5KA 2UUBF 3EZOA 3EXYA 3X1LB 3SENA 1S5LU 1SJ3P 3IRXA 1X4FA 2X1FA 4Z6EA 2ZOMA 1SJFA 2MHNA 5HO4A 1HBNA 4A8WA 1C0UA 2HPUA 1V3SA 1UL3A 2HMIB 1B0VA 3W9HA 2F8KA 1HWLA 4ES2A 4C8KA 1T11A 2BPGA 4K4HA 2XC9A 1VRQC 4AYBD 2G07A 3F41A 2V2ZA 4ED2A 2A6MA 1VYAA 3BPSP 1COKA 2E8NA 1N34J 3G87A 2BQ3A 8ICOA 2GWSA 5FLXU 4FF1A 1NB7A 2V5HG 4RQ1A 4MK9A 4LVOP 2N82B 4UY8T 8ICEA 4ZDNA 3CJ4A 2CZ9A 1D8YA 1HWKA 1HW9A 5C0YA 2YKQA 4AYBC 5LMUF 2QE5A 4DSLA 3J7AN 1WTBA 2VG6A 4NL9A 2XLIA 3BQ1A 2D6FC 3QRPA 4YFKA 3K57A 2R2TA 3UCGA 1NI3A 1IXKA 1GO3F 3M2VA 1S9FA 3KHLA 5A0LA 2JNJA 1VQNS 4QR2A 1FK9A 3JSBA 2DNGA 1KLNA 2DNHA 4Y2QA 1RTZA 4X62J 2MZJA 4YMEA 4W92B 5K8NA 5KAFU 3EVWA 1AUDA 2KT3A 1JLAB 1HNXJ 3W2WB 2O3DA 2PO4A 1IKYA 1MLAA 4IC9A 1RT1B 3PYEA 3M6UA 4RW4B 2QB0A 2YWKA 1LW2B 3K5PA 8ICPA 4ZOSA 5IWAF 2AJ4A 3J7ZT 1WEYA 3W8GA 3M8SA 3UXOA 4M2YA 4MFCA 4AD6A 1I6JA 2D9PA 1C0TB 1IR1A 1KQKA 4JI8J 3QQCD 1YI2S 4CT8A 2Y9HA 2YNIB 4M47A 2YNGB 2H48B 3TUJC 2G2OA 4PGXA 1D3WA 3UMBA 1NJYA 1FF2A 2ZNYA 4LF9J 2ZFHA 1SV4A 3E01A 2YWGA 5F9LA 4HHUA 1TZ0A 3T5JA 5L1LA 3L3FX 2HSEB 3NGDA 8ICIA 4DFDA 4X65J 3VC8A 4MH8A 5B0AA 3G8TA 4IDKB 2CQ4A 2MZRA 5C24B 2N1RA 1RTDA 2M9KA 4ZLJA 5F3ZA 7AT1B 1JB0C 2ABYA 2QLWA 2EKYA 4OQJA 2QMWA 1KTVA 1REGX 2HHXA 3IP4B 1YBTA 3MM5B 5AM4A 4A8FA 2W2MP 2RMLA 1TMJA 4BUGA 2DR6A 3O44A 8ICVA 2IAJB 1HNZF 3GWCA 1V3RA 5AKLA 4DV3J 4ZCKA 4GO5X 4R8UB 5KG4A 4KGXB 5EX3A 1K8AT 4K4WA 3D2SA 1R27B 4F26A 1SH2A 2ZZTA 5AKJA 1X31C 2GVDA 5AE3A 1R8CA 2E5GA 3MR2A 2CQ2A 5DDQC 2LM4A 2LXFA 1TL7B 5L1KA 4FXDA 3GG1A 1CS4B 1I5OB 1SB6A 3TZZA 4NCBA 3OUYB 1TL3B 2GIFA 2W43A 2AWZA 2WZ1A 3FBEA 4YQWA 4NLOA 1BLUA 3M8ZA 4CF4A 3HHKA 1HYSB 1P6TA 1RT4A 9ICOA 4XPCA 2J6UA 2FE9A 7ICQA 1WUUA 3OBIA 2C3UA 4N41A 3TA1A 2C3MA 2BCUA 5T41A 3KZXA 2KSOA 1CSJA 4KSEB 3Q8LA 5B0CA 2F7VA 3LP2B 5D3GB 1VI7A 2DNNA 3MPDA 1WC6A 4PXBA 2WAQD 4HDHA 4RW8A 4QIGA 1IUJA 1JIHA 4RNFA 4DLGA 4N7TA 2L41A 4GXIA 4RL1A 3PSIA 2F63A 2HSZA 4GKJF 1Y7PA 5L1MA 3OV7A 2AHOB 2HAFA 2VG5B 1M5VC 1Z00B 3ETLA 1QAIA 4PL2A 4TUQA 3MAHA 3GFXA 3ZZRA 3HHLA 1NDKA 4DV0F 4JI5J 4WE1B 2FJ6A 1RP5A 4U8YA 5KFQA 1WF1A 1YRTA 2ZXIA 4JUZA 1W25A 4RNHA 4B3TF 4NZ0A 1KQQA 4ID5B 3GU3A 5ALHA 3AQFA 3NUQA 2ZUBA 2Z4PA 1N88A 1ZA1B 3QEAZ 3K5NA 8ICHA 2WW4A 1RT6A 1M1HA 3FEYB 1TKZB 2C2NA 4GRSA 1TVRA 3AD7C 1RBAA 5J2PB 3R1HA 1VLYA 1XIQA 1C4CA 4HI2A 4HEA9 4N76A 5ALMA 3FNNA 2GMJA 2QV6A 1WWVA 2E8MA 1DGSA 4IFYB 1XO0A 1WDTA 4L6V3 2C1EB 1UEUA 3QJPA 3H90A 2W11A 2XY7A 4MFFA 2G06A 4Q2LA 1UVKA 2CDQA 3UNYA 2BJ7A 1YZ7A 3DV9A 4ZPTR 1L8OA 4OJOA 3C16A 1FX2A 4I69A 1ZQWA 1Y5IB 5A8WA 1WC4A 2BZ2A 4F4YA 3A0BU 7ICMA 3DN9A 5KT6A 2RUSA 4RW9B 1WELA 2KJWA 4RQ4A 2FDRA 2V2VA 3D5MA 2L9DA 4IQWA 1BQNB 1N56A 3MDFA 1VIXA 3CRXA 2RKIA 1RPLA 2UUBJ 1NZBA 2X1BA 1I51B 5A6WA 2F76X 1S6PB 1RQ0A 1UKUA 5KT7A 2BE2B 2R2UA 2LFVA 2HI0A 2PN6A 3MAQA 1RHUB 2Q3PA 2AQ0A 1KWMA 3NY0A 4KLLA 4BXOB 4UW9A 1TKTA 4BC9A 1X9SA 1IJEB 1LK5A 3RR8A 2M4MA 1HI8A 2K3IA 3UO0A 4KMUA 3CVKA 5HVFA 2WOMA 3NCPA 3DCAA 1EIYB 1ZQXA 4K4GA 1NNDA 4RJVA 3ZDEA 1N52B 2DBYA 1RTIA 2GFFA 3WKCA 2ZBPA 4KLOA 2NR0A 5GAGU 4Y2MA 4UB5A 3QU7A 4Q7AA 3P6YC 4L3NA 5L8RC 2V8PA 4B9VA 2HVIA 5G5GA 3KJFB 1MG7A 1Q8IA 2YXLA 3TADA 2CAJA 4X2BA 4UOFA 2D3OR 4M9JA 5MLCV 1DZ5A 1HNWF 4I29A 1FJGJ 1IIPA 2CRXA 2MRLA 3ISZA 1KOHA 2Q43A 1W2IA 4DJBA 4DPTA 1AFIA 3QRRA 1BNOA 5DGAA 3A13A 5GADU 1V97A 1NZ8A 3VAJA 2C22A 3J80Y 2QX0A 3V6KA 1S6QB 4DV4F 5HR6A 1HL6A 5E3AA 2Y0SD 1U49A 2X7IA 3KMSA 5KFWA 4LFCF 2JEJA 3UD3P 4X64J 2VONA 4HTIA 4NLQA 3ILJA 4ZP9A 2DPIA 1S9GA 2HLTA 1PG5B 1SI9A 1U0HA 4QZIA 2JFKA 2VODA 3TVKA 1S0MA 5GVQA 1I94J 3DFEA 1XMQJ 3BS5A 3U1MA 4IRCA 2KZMA 2D9OA 1IN0A 2CQBA 2VQEJ 4BDPA 2HURA 3H8WA 2NRTA 4F5QA 2H5EA 1CJVB 1FD2A 3RAQA 4M0AA 1T9YA 2YX4A 4WWSA 2ZG6A 5C2GA 5DJBA 5EUHA 4NXNF 1RAEB 4YR0A 3B4DA 3CD6S 2L48A 2D74B 2JXJA 4FPRA 3T6JA 3NS1A 2CQ1A 2GMHA 4M5KA 2LQ9A 5DO2A 1ZXIA 2UV8G 1KDNA 1V6HA 2YH0A 5KAIU 3F56A 5FP0A 1X4EA 4NL9C 3OSNA 3GFYA 4N47A 3TUZC 5DB8A 3N5FA 3RJFA 4QR0A 4P9SA 4OJPA 4HYKA 1RBLA 4WYWA 1TVAA 5ALNA 1VQ9S 2NYVA 2F65A 4I7FB 4Y6IA 2E29A 3UNGC 1XC9A 2OSQA 4XDDA 4OYBA 3WC0A 4V19X 3W64A 4AUKA 3AN1A 2GAHC 1C4AA 4K8RA 4OFZA 3IBCB 1IQTA 5ETNA 8ICTA 5KFGA 4IR9A 2AZ3A 1U1QA 1I1GA 3FUYA 1SB3C 3KK1A 2DXEA 1WD6A 4UUXA 2V8VA 3J7Z5 5DLFA 5FIIA 3H20A 3QIDA 3ET6B 2G2ZA 2R7RA 2GNKA 2OD4A 2CQDA 5IT9Y 2OYYA 5IQQA 3TX8A 3MMAB 3AH6A 4DFPA 2XGQA 4DQIA 4K4YA 5CA7A 3KOOA 1CVJA 4PWDB 1X8DA 4O3MA 2DNQA 1V85A 3OFHA 3DRRA 3HFZB 2B3TB 5KFVA 1PC5A 1WI8A 3HVRA 3OLAA 2VF3A 4C4RA 2CPDA 2YNFB 4RX6A 3KWMA 4L72B 3FJ2A 1MROB 2ZE2A 5KFTA 4OLOA 3W62A 4RQNA 2C3PA 4P72A 2VPYB 1ZRNA 4P0PA 2VL1A 3PSTA 4GC6A 4PPDA 1T05A 4ZN3A 5KG0A 4MYTA 3TX0A 3PTWA 1J5EJ 1VQLS 1FNMA 1X5PA 1AYEA 2GJIA 1N5XA 5D0RA 3UPFA 5HK4A 2ATLA 4USUA 2ASYA 3CTRA 1EQMA 4NXMJ 2QLTA 2QT7A 4C7ZA 2I38A 1OQ6A 2HOIA 1URNA 3SZ2A 3BO3A 6FD1A 3A0HU 1FKOB 3A8KA 3T1YF 3BS7A 2PI5A 4I2FA 1KHVA 2CQGA 3K5MA 3IG1A 3M7VA 1J2VA 3QGGA 2EZXA 2XWXA 3WZ0A 2Y1IA 4DU7A 4LSLB 3T3FA 4JI7J 1PAUB 2G1HA 5IQ6A 1O0PA 3R2DJ 1YHQS 1M1GA 2HHSA 4DPUA 1ZOLA 1RBOB 9ATCB 2P5VA 3MEGA 2ZIVA 3SAHA 4ZH4A 1FA0A 2OHDA 5AM1A 4HACA 1RTJB 1TK5A 3CCVS 3CPWR 4DV4J 2F5GA 1UPMB 5K8MA 2XB2D 3OT9A 2XMJA 5J2CA 1DBDA 4DL5A 4N8OA 4X62F 3KK3A 5IILA 4YEAA 3PMNA 2DNPA 1Y3JA 3KK3B 5LJ5Y 4DCOB 5ALEA 5D4BA 5J0WA 5BYQA 1IG6A 1RTJA 1N5VA 3GV5B 4HACB 4C7QA 3ORYA 4LF8J 1NHUA 1MQ3A 5CJ7A 3D54A 3E51A 2ZIVB 1TV9A 3MEGB 2FHKA 4QR1A 4HKQA 1RAHB 3CXCR 4YMOA 1SH3A 4LSLA 3CJ0A 5HMXA 4WFZA 3OL6A 1NKBA 5IWAJ 4QJVA 1N5QA 1Z4NA 3FKBA 3IG1B 2I9GA 2ZUCA 3J81Y 2AW0A 5B0GA 2B9YA 2ZC4A 4F67A 2AH5A 3QSYB 5DQHA 1FKOA 3PJ9A 1Q3VA 2E5HA 1N2XA 5GMKa 5KG6A 2NO5A 3E58A 2FVSA 1FRHA 2DITA 3JAMU 4IH5A 1QDUB 5AIAA 3GCWP 7ICHA 3EGWB 4X4QA 3KLVA 3GJQB 3JQJA 4F3QA 3CNHA 1NAQA 3N4MB 4C4TA 4I2GA 3IP0A 3QT6A 1T05B 1CUKA 1NK4A 1PVQA 4EI2A 4P0PB 3PIPQ 1RACB 2V9KA 4NLZA 1MROA 2ZE2B 1VBXA 4AP9A 2YNFA 4DOAA 1NPKA 2HBLA 1D8LA 2Z58B 3AJ2A 2KM8C 4PEOA 1QCKA 3DRRB 3L09A 1UVIA 2IM2A 2D8CA 2A3JA 4PWDA 4DV7J 1URJA 4LF7F 3TR5A 3MMAA 1Z1BA 2BDUA 1U2RA 1LQ9A 3T1HF 4LBHA 4LBPA 3S6EA 8ICUA 4LFAF 2EC2A 1BD6A 3L5KA 3ET6A 5EE9A 1LXJA 1KVKA 1IV8A 3KK1B 2LDYA 2MQMA 1M5OC 1X2IA 3BBBA 2ACMA 1S72S 3V7LA 1SJ4P 2C28A 2GO9A 5ALLA 4CO5A 1F5SA 4M04A 2BXJA 4C4WA 5CR0A 1FDNA 5ALVA 2IA0A 1L3KA 3GJRB 1NZAA 5L9NA 4NJ8A 2ES6A 3OJUA 4QIWD 2CWKA 5H9EK 5KFAA 3WIUA 4I7FA 3KBBA 1X66A 2JGAA 1HLWA 3DHXA 1RAGB 3ZD8A 2KB2A 5CHGA 1SC3B 3BN4A 4LQ9A 3G4SS 2HRTA 4MKAA 5AKHA 4QW8A 2YWHA 2GQQA 3QU9A 2LLZA 4WF9Q 2R7TA 2NPFA 4PL1A 2H4WB 1HD0A 2YY3A 4U6PA 3M9NB 1IJFB 2XNRA 3Q8VA 4JI2F 4CM2A 3CNQP 1RISA 1S77D 4Y65A 3TYTA 2UVVA 3IC1A 1YGYA 2MKCA 2HFVA 3B82A 1ZQIA 1ZS6A 1CJVA 1NJXA 4NLTA 4P2HA 2E66A 1QQ7A 1RAOA 2A2CA 4Y2CA 4EZ6A 3KDOA 2RU9A 3BR8A 8ICRA 8AT1B 2HBYB 5ETPA 2YTCA 3FBBA 3BS5B 3P5BP 1WYGA 3CJ3A 5AIBA 3NGUA 2VA2A 3Q22A 5AKZA 1V9PA 2XS5A 3W61A 3WX4A 4OZ2A 3UQ2A 4YR3A 9ICRA 1U0HB 3I1YA 2VQFJ 4DFJA 1S9GB 1X0FA 4QYZJ 5B0BA 1JRPA 3DLJA 4S0MA 2P6RA 2WTFA 3GV8B 3T6BA 4NL5A 3H40A 3TQEA 4FBTA 5F8NA 1S6QA 1ACMB 2FJDB 3QAUA 1VISA 1ZAWA 2MHEA 4K50A 2BMBA 2UV8A 5DQGA 2KKPA 1L7NA 5AT1B 4TYBA 1KVIA 4OI3A 3EM1A 2Y9UA 3R8YA 3ZFVA 4G9BA 3CCRS 3ONQA 1GXUA 1HKAA 2EQYA 1SXDA 5E3QA 3AQOA 4Y3CA 4FZMA 4DQQA 3MURP 4TU9A 4WBFA 2V68A 4ECYA 3T79A 4DOCA 2EZYA 4CNZA 3MCOA 4K2XA 1RTIB 2Z57B 1X6JA 2ATCB 2D3ZA 2A2DA 3RH5A 2BX6A 3OTEA 3M4XA 3ULHA 2V8HA 2BGWA 1XERA 4NYPA 4M5GA 1WOSA 2WOMB 2JH1A 3MWBA 1M5HA 2J7KA 4EO6A 2VOOA 4DFKA 1VJWA 2QYCA 4D3HA 1TKTB 4BXOA 4OZJA 1KDHA 4NLGA 5IXUA 2HIYA 4ZPDA 1H7WA 1EKSA 2VDHA 3VCDA 2BE2A 4TVAB 1X40A 4FYYB 2J76E 3D3CJ 1S6PA 4PRFA 5AE1A 2AGQA 1WNEA 2JDJA 3VGTA 2RKIB 4DX7A 1O5JA 1BQNA 1K1QA 2KI2A 5D4OA 2KN4A 3WK5A 4RW9A 2KEYA 2Q4TA 4UB1A 4HR2A 4PH5A 5A2QU 3EXCX 1VFJA 5A8WB 3HKZC 3JS9A 2RE1A 2D3UA 4ZVGA 2NXCA 4HH0A 3C16B 2POKA 1JXLA 2VJ4A 2R8KA 4TQSA 3W3SA 4I2JA 2LDIA 3BKUA 1Q5YA 3GILA 1F6TA 2CDRB 1ZOTA 2R9LA 5KT5A 4O3NA 4KH1B 2ZBCA 3RRHA 4NV0A 1FERA 1UAWA 4IFYA 3TQ1A 4Z6CA 3TI0A 4GXKA 2CG4A 3JPRA 4PPZA 1SVDA 1KKXA 1OMSA 1RWKB 5HR7A 2HFUA 5J2PA 2LI6A 4Q8FA 1TVRB 3GFHA 1TKZA 4A8YA 2DL0A 1HFEL 1RT6B 5K8OA 4A8SA 4DUZF 2PSZA 2APOA 1QAYA 2VBZA 2VDIA 4F5NA 4NOHA 4XAKA 3RF9A 4ID5A 4IL6U 5TZVA 3PCOB 2R7OA 4I2AA 1FKAF 4DR6F 3VQSA 3MEKA 3N4WA 3KHGA 3TZYA 3MR7A 2ILYA 4WE1A 3VWSA 4P2FA 4MF2A 3HHLB 1RDFA 2PFDA 5LSRA 2LQ8A 3H0PA 2KJ5A 3LA0A 3LWMA 3UR3C 1KOOA 3R3TA 3I4PA 1Z00A 3DLBA 2VG5A 4LRFA 4NXNJ 3BO4A 3ZZ0A 5J8YA 2YWEA 2B9EA 1OIAA 2H3FA 4X4OA 4ZN1A 5CABA 4NEYA 3GPAA 4YUDA 3WC2A 1UJ6A 3CCZA 4RW8B 2BPCA 2EG2A 3AHPA 2ZHBA 4DR2J 5D3GA 3LP2A 4L3KA 4W98A 2KSOB 9ICWA 4OZ3A 1K1SA 2R2SA 1JALA 1RA7A 1VQ8S 4ED1A 4YB7A 2VKRA 1F9EB 4DSJA 2M8DB 1RT4B 4WP8A 1ZQYA 5CH7B 2QA1A 1HYSA 3T9ZA 3EVMA 1A0OB 1FEEA 9ICCA 2YB4A 2ACYA 2KJVA 4OO1J 5B0FA 2ZHAA 1TL3A 3OUYA 1CS4A 1DJ0A 1TL7A 3FCVA 2V50A 1EXNA 2OJ3A 3IRUA 2JR5A 4JI4J 2AX1A 3L7PA 4DZ6A 2GVDB 4TURA 1W26A 4QPXA 2BPFA 2VH7A 3CCQS 4R8UA 2CRLA 1QAXA 2F77X 5KFXA 2DNZA 3NAHA 1H6KX 2IAJA 3KYLA 4NLXA 1VBYA 3D66A 3MPYA 4HLBA 2YN4A 2JSXA 2ZZNA 2KE7A 2DGQA 1B4FA 4O5CA 2R7UA 2ZH4A 3T1HJ 4YR2A 2GOLA 2UUCJ 1YITS 3CMAS 3MM5A 2CPFA 1IBCB 3EGZA 2KIVA 3CF5Q 4KT0C 3MDAA 2DRBA 5D78A 5J2IA 1RTDB 5C24A 3KUGA 4IDKA 3TACB 1IM4A 2J0QD 3PEHA 3BB5A 5D49A 3HRDD 2HVZA 1YIJS 2DR8A 2GX8A 4DQSA 4ZVOB 1WI6A 3I31A 3JTOA 3LANA 2R7VA 3E01B 4KRWA 3I5AA 1GMWA 2DGXA 2EFQA 5IV3A 1BWVA 3G6VA 3QZ8A 2YNGA 1RM6C 2YBVA 4ETXA 4IH7A 4PXDA 1NK8A 2YNIA 1NHVA 1MWZA 1C0TA 3PKMA 4JI3J 1LV5A 2KT5A 4CP5A 5F8GA 2BCSA 4AXIA 4USIA 3WKEA 5BYRA 4IQVA 2RHSB 3RW7A 3CJRA 1VQMS 1H72C 2ISPA 1F3FA 4YB6A 1FVQA 1BPYA 3D0GE 3I76A 3M6ZA 1LW2A 1WEZA 2QB0B 1YJNS 2OFHX 4RW4A 1RT1A 3CO0P 3V5RA 4Y28C 3HFVA 4WIIA 1IKYB 1G4CA 2ZXHA 1PKUA 3W2WA 6FDRA 3GB0A 1JLAA 1Q46A 3CYMA 3R6LB 4QQBA 4UAWA 2NV3A 1C7YA 2RHFA 2DRAA 4LZDA 1CC8A 3P96A 4LF5J 3OVAA 3BSAA 3L7UA 3RH6A 4WFAQ 5DM7Q 2ZTDA 3DXBA 3ZI4A 1FK9B 3RBZA 4XO0A 2KYZA 2LYHA 2KVQE 1Z4OA 1Q8KA 3M2VB 1PGZA 1RWPB 4DR6J 2YMMA 3W65A 4J9VA 2GHPA 5GAGI 2R18A 4QYZK 2JL9A 4OJGA 3NOCA 3CCSS 2MLYA 4M9LA 1IWAA 2E9ZA 2VG6B 4PYDA 1TAMA 4M5HA 3I9ZA 3QU2A 2ESEA 1OPIA 7ICUA 4HT5A 4LFBF 3MCSA 5EE0A 4Y2AA 2X3DA 1QM9A 2WB1F 2CNLB 2E44A 4CDGA 3R9KA 2KFZA 1M5PC 4ED4A 2V0NA 1WJ9A 3VHQA 1PUZA 4RT2A 3EWGA 2AXTU 1KN6A 1YG0A 3T1YJ 1ZQOA 7FDRA 4B9NA 3MZIA 1NKEA 3T1AA 1U8WA 2MKKA 5LMNJ 4F5OA 4D3GA 2J6SA 2YKPA 3UQ0A 4F91B 1BQXA 4ED7A 4IQMA 1RKIA 3K5LA 3TARA 1Q81T 1M6YA 2FJVA 2HMIA 2NQPA 4RPXA 1A7GE 4OIXA 3D7SB 2HBKA 3ONNA 1QD1A 2ZWPA 4RO0A 2K4HA 1C0UB 1HBNB 2VJUA 4N8NA 2EI5A 2QA4S 2FPMA 8ICCA 3IRXB 2NREA 3AD8C 2EG1A 3HVWA 1RWUA 3C5GA 1WKLA 2M2BA 2FC9A 3AQPA 2VPXB 2F1JA 5J1EB 1R3NA 3GE9A 2W8KA 2IC3B 2OEKA 4C80A 1LWFA 3D6MB 2J8AA 1UT5A 2RH3A 2QIFA 3ZTOA 9ICSA 3UQSA 1RDRA 1VQ5S 3LVWA 4Y00A 1WWUA 4ICLB 2ADCA 1S1XB 1NO8A 1N36F 4WTYA 1ZQLA 3EGNA 4DL0C 2B9XA 5A8KB 3C2PA 1NDLA 4ICAA 5HQ8A 2CKWA 4NI2A 2P9EA 1HNZJ 4C6AA 1N5SA 4M6WA 2OKQA 2O5DA 1UW4A 3TAMB 4X66J 3VAMA 4FYDA 2VZ9A 2FJWA 2PFQA 1HPZA 1RXWA 4OYWA 5FD1A 1PZNA 4F7VA 1ZTWA 5J0QA 4P52A 5HJYA 3NCQA 2LHTA 2ZIUB 4DG1B 4X84A 1PILA 5KFIA 4NZ7A 5KT4A 5KG1A 3QNWB 3L4BC 3PO5A 3SFUA 4US8A 3MTKA 2HZAA 2CPXA 4R64A 3EUB2 2MMYA 4IKAA 1S1WB 4J03A 2BQRA 4UZBA 3CCWA 3CO9A 5AXNA 4O5EA 3JYTA 2JEGA 2PKEA 1DQ8A 5IT4A 4KE5A 3CD5A 1ZQKA 4NASA 2HS4A 3QT8A 1HWUA 2DWQA 1PYSB 3T9NA 2MKYA 3MM7B 2P9GA 3MM6A 8ICMA 2UU9J 3SCKE 4Q2MA 3N0VA 1WF2A 4XTTA 1FRLA 4O4GB 1LNQA 3IR5B 3CMES 5ETLA 3Q0AA 3SMVA 2LEBA 3K17A 3CCMS 3NKYA 4KHPJ 1KW4A 5I42B 5IZHA 9ICVA 2QB1A 1YJVA 4OJHA 4WKYA 2V4QA 1QTNB 1N4LA 2KRBA 3D3BJ 4U7UK 3CCES 4CIOA 2YKMB 4WCEQ 1GXTA 5D4PA 2I6XA 2DO0A 1H74A 1R0CB 2GZOA 2XMMA 4EU0A 1QVFR 2ZIXB 1T9XA 4FKYA 1U1PA 3FMBA 1HUZA 3PG9A 1SC4B 3HJEA 4J9PA 1P7DA 5M2RA 1K9MT 4F0KA 2V9WA 2HNYB 2LA6A 2HK3A 2F4VJ 2FHJA 4A46A 2WFAA 4DF4A 3Q89A 1RT5B 3V6DB 4ECRA 4CTAB 3PX0A 2F1HA 2FY1A 1DLOA 4I6WA 4UOCA 4JMUA 1U7LA 5KFRA 2GHWA 2XHCA 5GAEU 4XA5A 4KFBB 5CD4H 4M5MA 2A10A 3QJLA 4O44A 5K14A 1YJ9S 1GMWD 5IINA 3HX0A 2GC8A 1JMSA 1D8BA 1AZSB 3CJQA 2COLA 3KJVB 4QBUA 1S0OA 2YB1A 2RUGA 2VHGA 3SV3A 3IS9B 4C8OA 3I28A 2MA1A 4HTJA 3CJ5A 2RQ4A 1CJKB 4N77A 3KXDA 8ICGA 3BH7B 1BXNA 2GQ2A 4AL7A 3JTNA 4WFNQ 4TY8A 1ZZNA 2HYIB 1N32F 2BANA 4KLDA 5D4NA 5E2QA 3NVZA 1K5OA 3AY0A 1R0AA 2WVEA 1DOQA 2NXJA 3CC2S 2XY6A 2ERRA 2KNJA 3WBZA 1QTMA 1RQLA 2E5LF 3CSKA 1OY9A 1LW0B 2F2AB 3A4TA 1KS2A 2W9CA 1DFDA 3AA8A 3FSYA 5J1PA 4QWEA 1K47A 4U96A 4C8MA 2XZWA 4BLGA 1EB0A 3CJ8A 4QPTA 3K0JA 2IJRA 5CCMA 2G9OA 5HSPA 4UB8U 3HXMA 4M5LA 3PDNA 3LTOA 1R8HA 4ZVPB 2KO1A 4Q0BA 1X5SA 2UUTA 5JVHQ 1IXRA 3F2CA 1RG6A 1UJ4A 2VD3A 4RW7B 5EX0A 4TY9A 5HQMA 4OJ3A 4F4WA 1XTZA 2FI1A 3JB9k 3POTA 3SEIA 2XHWA 3Q24A 4QW9A 2IHR1 3F2DA 2K4PA 3AFGA 2Y1JA 1JJ2R 4US9A 2EAPA 1O08A 1GNKA 2EKNA 5D15A 4LT6A 3OR2B 1DRGA 3DU6A 3G86A 5G5HA 4I0WA 4P0QB 2DNRA 1SC1B 4KB7A 3UM9A 4RU9A 5ALWA 1S0NA 4B17A 4ZLLA 4EBEA 1SKUB 1R7IA 3VVUA 3I0RB 2HZCA 3BKFA 4ZVEA 3M2RA 3NS7B 5KFUA 1SKWA 2LMIA 4DR5F 2OWOA 1L3SA 2ZH6A 1ZM9A 2OCEA 3RH4A 1IKVA 3KKFA 4ED0A 4L73A 2NRWA 2B6AA 3PY8A 3HVTA 2HNZA 3EWAA 2ROEA 1COOA 3UD5A 5CCLA 3FMWA 3RTVA 1UPPA 1YWXA 4M9HA 4URQU 4ALZA 4DV5J 2HFSA 3KG4A 4I64A 3MM8A 3V81A 3KFWX 4DCPB 4RUAA 1FRMA 4C11A 3UN2A 4DPWA 1MU2B 5DS7A 3E2EA 3GIKA 5F0WA 1JLQB 5GADI 5DDYA 2HHQA 4OI0A 1X9XA 5B08A 3N6MA 3JPNA 8RUCA 1EP4B 1E6YA 4K4XA 1SV5A 4YD2A 3RJKA 2YQ1A 2WK4A 5ETRA 1YKWA 1S57A 1O03A 4IQUA 1H0HB 1SPBP 2W2PP 2OD6A 4EWTA 4DN0A 1UVNA 3MHYA 5JMNA 1KHWA 2AEMA 4Y2VA 3O1LA 4PG6A 2RU3A 3QSIA 1WC5A 5BOLA 3NRBA 4B3MJ 1QH9A 3R5DA 2ZZMA 3WKAA 1XK8A 1NK0A 2KU7A 4KKOB 3JPPA 3PRVA 2BJ9A 1TAQA 2CPIA 1F5AA 4Q45A 1HW8A 2FZCB 1X9WA 3TANA 3FBCA 4DR3F 3GDXA 5KFEA 5ETSA 3MPWA 3RGIA 5IM0B 4MKVA 3G71S 2IRUA 4H4KA 4DSIA 4O0NA 2N7CA 3DRYA 2XG8A 2YVSA 1ZQSA 4DPXA 4B3MF 3CDAA 2BJ3A 1FFGB 1WTFA 5SZTA 3HILA 3FZ2A 5ETQA 2V2QA 5KT3A 3H4DA 4KGMA 1KP6A 5ALDA 3LP1A 5J0TA 4B3RJ 2UXBJ 1T03A 1B0TA 8ATCB 3NVVA 4JI6F 1NOMA 4F4AA 1HHTP 3GZ7A 4Y2RA 5H1SV 3WKDA 2DQNB 1JKHB 3B0XA 5AICA 3L95X 2ZH9A 2VG7B 3IWNC 2HW3A 3EPGA 4KLFA 3OPXA 2OPQA 5DDOC 2XMVA 1JXEA 3F2BA 7ICSA 3BO2A 5AI0A 4J9RA 4NRUA 1X6IA 4DOZA 3ITHB 5M2UA 3MPVA 1QQ5A 5I3PA 1Z1ZA 4NA3A 3ZDAA 3G2XA 4ZVHA 3SDEA 3PHEA 2M0NA 3B9JA 1EETA 2ZH8A 5IIIA 3H8SA 2YPZA 4X65F 2BDPA 1R43A 3DI6B 3MEEB 1N33J 2VIXA 1VK8A 9ICLA 1GTHA 3MD3A 4ILMA 4UT4A 1RHQB 3SSQA 3MBYA 1YVFA 2OM6A 3DLGB 1TV6B 2DH9A 4OZ5A 3EYZA 3UI3A 1XN9A 2PFFB 4RU2A 4IS7A 4I2DA 2DGSA 4UBCA 2HDOA 3C6TB 2B0GA 1RB0A 5SUHA 2MKSA 2DCLA 1RYRA 2WB4A 3BQ0A 4ELUA 3FZBA 3M2UB 1ZPVA 2LCWA 4TLRA 5DG7A 5ALYA 5D4LA 2CVIA 8ICLA 1GX6A 4IG3B 1VLBA 2GV1A 1NJZA 3T41A 1IKXA 2JEIA 3VZIA 5EGYA 1FEHA 3H0LB 1SXEA 2E1EA 2P8IA 4NLNA 1DTQB 2W9BB 4XPEA 2A1JA 4PHEA 2MPUA 1KNZA 3HJVA 2JH7A 5DG8A 4LFCJ 6AT1B 1N48A 1AXQA 3CDUA 4CO3A 3W63A 4FNIA 3HULA 3DDHA 2W9MA 1WHWA 3UR0A 4YB1P 1XNRF 3VAKA 2YQ0A 3MGIA 2EPIA 3DLKA 4I2QB 2HZVA 2PE8A 5HNKA 1SIJA 3UMGA 4CYUA 1X4HA 2HFNA 1CULB 3THPA 3LGHA 1SZHA 3W66A 2Y1LB 1CG2A 4FDFA 1A6SA 3QBCA 2KXHA 4B6JA 4OZNA 3EE3A 1LXNA 1I3OB 2KXNB 5BOMA 1UEVA 5HLFA 3O8WA 4ZJOA 3Q8RB 1LEOA 3MAAB 2OGUA 3PIOQ 4A47A 2G0JA 5KFNA 2Y8YA 5AK3A 3G6XA 5EWGA 1U8SA 4OX9F 4OX9J 4C3LA 1FO4A 5L1IA 4P7TA 5DDRC 4FN5A 2ADBA 4JI4F 4ATNA 1FRJA 5HMWA 2XYHB 3PMLA 3HX9A 4QIEA 4NWBA 4OYAA 2VKQA 3MR5A 3N79A 3KOAA 1VBZA 3GYNA 4UAZA 4R0EA 5KFPA 1YJTA 5FJ4A 1NSAA 1XMOF 2F8LA 4I68A 3OFEA 1N6QB 1C1BA 1VHFA 3Q8PB 1BUXA 4YCXA 2NUUG 4NLPA 4M1KA 4KLIA 3A3OB 2XS2A 2OMOA 2RSQA 4EEYA 1OY6A 3K1RB 3OFFA 3SAGA 2OELA 2CPYA 2W3RA 3FC9A 4E98A 1JLFB 2DVIA 1GAOA 1HBOA 5ALQA 1RWNB 2OPPA 4K5SA 5E3RA 4ECVA 1LFWA 4IH6A 1J2NA 3VV2B 3OHBA 3WK9A 3MM9B 2LYVA 1U2CA 4ECXA 1S1TA 3LGMA 2FHMA 4QZBA 2YKAA 3H8MA 2OTJS 2WCXA 1ZQMA 5IIMA 4PKDB 2MGZB 1HR0F 4UBBA 1XSLA 1HHSA 3MFIA 4PG7A 4NCGA 3MD1A 1L3UA 3H5YA 1ZM4A 2RDIA 1X9MA 2HWHA 2ZNZA 1Z19A 4NZ6A 4NWIA 3D1OA 2FHOB 3SR6A 3Q8KA 4ZP7A 1ZQFA 1OQ3A 3GYGA 1F2HA 4IFVA 1MA7A 3C6UA 4H4OA 2UXCF 3QO9A 4OX8A 1T9WA 4CLLA 4PG8A 2FGCA 4GVBB 3K8VA 2VPZB 3NAIA 2HFZA 2H54B 3OTBA 5KL8B 1MW7A 4NA2A 1U9LA 1KC8T 3ZC4A 4KLEA 4BWMA 1U24A 2B9WA 5IT0A 4A8KA 4O0IA 3T5KA 5AHXA 2B4PA 2E1CA 5F8MA 3PYDA 2NCKL 5IIJA 2RS2A 1EAYC 1PJ7A 3HM9A 1BPZA 3PW5A 3ENAA 3AL0B 3K4GA 3IXQA 1OY8A 2IHMA 3ZZZA 5E3PA 2YTUA 3OGUA 2XICA 4XIUA 2J0XA 3R5JB 3MUMP 1CJTA 3PKYA 3S8SA 2ZVSA 1TFYA 2X1AA 1X4BA 4LF4J 1IVZA 1LFPA 4OI1A 9ICPA 5CZXA 3LYSA 1Z2LA 1NNLA 4BWJA 2IRXA 1S6UA 5LL6d 2W4DA 3I5BA 1D1UA 4URSA 3B78A 3D2QA 5KAKA 1FXRA 1XQIA 3PW0A 4F25A 2D3O1 1HHQA 3MF5A 1ZZFA 1S49A 4FYWB 1DRZA 4ZLPA 2I5JB 4LRAA 5J0XA 4JI6J 4Y2TA 8ICBA 4OD0A 3TVYA 5DRKA 1Q16B 2LEPA 3D6TB 4KHRA 5C25A 4F0MA 1BPBA 3RBXA 2A6OA 2WW8A 4DS5A 1KSPA 3HKZD 2K8BB 4ECZA 4FS1A 4M9GA 2HQ3A 2FLNA 1BPEA 2W7PA 2IYIA 2A1AA 3OJSA 4JB3A 1QY7A 2G5IB 5HN0A 2V4JA 2A0FB 4ECQA 2XWYA 3PNIA 4U7CA 1SV0A 4EO8A 3JXOA 2LMRA 1WCNA 3MDCA 1SWWA 4USTA 3ILOA 3UDLA 3FCWA 2Z2LA 4DR7J 4P2XA 4CGZA 1RT7A 4RPYA 1TUWA 2RHQB 4F3MA 4QZDA 4C8LA 1S1UA 2VC1A 2XM3A 1U0SA 3PRDA 2W7AA 1WG5A 3ZNJ1 2CQPA 2HMXA 3BF4A 2W3SA 2ZDOA 2Y0BB 3LF0A 4QWBA 4WKRA 1EHWA 4CO0A 1VQ7S 5LMNF 3M05A 5J2KA 3M30A 2GVZA 2OPSB 4N5SA 2BJ1A 2RQ5A 4PWWA 1TL5A 7ICKA 1ZM3A 2BKEA 2YQEA 3EJMA 1XU4A 2ASDA 1IWGA 3ZTRA 1TE2A 4F3OA 4MIWA 4P10A 5AI6A 4HHHA 2Q6CA 1SBRA 2MZ1A 1XNQF 1F0MA 1RU1A 1UHUA 2HHTA 3I6PA 4IYQA 2WF6A 1UA0A 4Q8EA 2CXEA 5J2BA 1C1CA 3NRWA 2HVDA 3R27A 3DLHA 2PEBA 1JLBB 2JHDA 5C7PA 5AXMA 3MOZA 1TAUA 2MQQA 2KHVA 4A8MP 4TKTA 4AXJA 4CO1A 2ZH1A 1WUDA 5HATA 3UXNA 1SJ1A 1FVSA 2LXUA 3QZ7A 2Z2MA 4H4KC 3B6BA 2AX0A 3BGOP 2VQFF 4OHZA 3GJTB 2KL8A 5KNIA 3PR4A 2LYAA 3IFEA 2AEJA 1Q7LB 1RHJB 1H3DA 4LMZA 3DGVA 1D9AA 4KO0B 4DS4A 8ICYA 4JV2A 4FXWA 3DGPA 4RBTA 4G1QB 3IHQB 3LVVA 4UASA 2CIMA 2OH2A 4RQ0A 4DSFA 3PYGA 4V1Ak 3AODA 1CJUA 1CQNA 3AXMA 3V7KA 4X4UA 3ETOA 2DHGA 5A8RB 2ZH5A 2LQJA 3CCTA 2KG5A 3BZCA 3FGVA 3VVTA 2IMWP 2FC8A 3NVYA 3UN5A 3H8YA 2KH9A 3N7RC 5HBMA 4CWBA 2DHSA 2NUHA 2MY8A 2BRKA 2JHEA 1NSPA 4Q43A 1XMOJ 4K5RA 4UUWA 1Q82T 2JRZA 3WU2U 4HI1A 3CJSA 1DAXA 3ZTSA 4RQ3A 3DRSA 3IN5A 3MFHA 4MK8A 2LQBA 5DDPC 2V6AA 1MN9A 3HHNB 3O2IA 3J80U 1HNIA 1VMBA 2B4VA 2X1GA 1SJQA 3DOKB 2QFJA 1G2EA 3MMBA 2KG1A 4FE3A 3W2VB 4FF2A 4DV2J 5ALTA 3TADC 5L46A 3CJ2A 1YZ6A 1PBAA 1BMQB 1UETA 4DZDA 2UUCF 2F3NA 2J7WA 2EFOA 3LP0B 1MC8A 4ED6A 3MCMA 3HSJA 5H9FJ 3L4PA 4E8UA 2W7OA 5BJRA 1EJ7L 3WK4A 2LVWA 5D77A 4PABA 3TVZA 4OI6A 4U7UD 5K20B 3SQIA 3GU0A 4DV2F 1JLCA 4DL3A 1BHNA 2DGVA 4FBUA 1HQEA 1BNPA 1DQ9A 2IBKA 1RTHB 3M6VA 3HD2A 5KG3A 4BJQA 2GQCA 4RW6B 3CGIA 2HNDB 2VA8A 1H2TZ 4DR2F 5T7LA 3PYFA 2CNNB 3U7JA 2ZTCA 3BQ7A 3DOMB 4DUYJ 3RAXA 2IIHA 1RWMB 4DXLA 2IA6A 2K3KA 3OTOJ 2XY5A 2AYBA 3UWTA 2ZDPA 1OYDA 3PVXA 4UOHA 3VALA 5FDLB 4G6VB 1B22A 2R3VA 1DXSA 1HI1A 1MWYA 4KV8A 4WTOB 1FDAA 3L7OA 2JOQA 5KFMA 1OWXA 3M1YA 1JXVA 1O51A 3LPEA 1TMMA 4ZVRB 2LU1A 3K7RA 2W2QP 5LM7E 4OZ0A 1GT8A 3EICA 2DKOB 1GQEA 2V4RA 2W25A 4FZNA 3M32B 2UU9F 2CJXB 2RQKA 3RJIA 4RQ6A 1JJHA 3H5XA 3IG5A 5JJBA 4PUOB 1SH0A 4CO4A 1W7WA 3NG8A 1REVA 3VCBA 1FE0A 2ZBIA 1YT3A 1ZBTA 2ODGA 5IOLA 1FKPA 3W9IA 3UPQA 1PK1B 4R25A 1WG1A 5DLGA 3ISDA 4LR7A 2SXLA 4P6QA 4L75A 3A3NB 3V4IB 3H98A 2W4CA 5I4MA 5THWA 2DNOA 4B3OA 2YX8A 3DMJA 2OPRB 3O6QA 1FFUA 4DPOA 2XMTA 5AI9A 3HWTA 4LRDA 4OMFG 4JI7F 2L5YA 5J0OA 4JI5F 4XK8C 2PA3A 1LKYB 2ZOGA 3DDKA 1QE1A 3IRWP 3JPTA 1XNQJ 4TUPA 2CA9A 1N63A 4YB5A 2DHAA 2ZITA 4Y2UA 1YRUA 7ICVA 4WU2A 4P71A 3M8PB 3C2LA 4KPCA 4LVNP 2HCFA 3GIIA 2P6TA 4KLMA 4FZVA 4RLEA 1S12A 1F44A 2AYEA 2MTLA 1B4SA 3I96A 3HO1A 2K89A 2FJXA 5C42B 2MAXA 4R5PA 2BACA 4NXMF 2AP6A 3TW0A 2EC0A 2BJEA 4OJLA 1WOOA 4ER8A 1SV0C 3C21A 4FS2A 1BVSA 1IBMF 4PXEA 1EZZB 4RWWA 4NA1A 4NM1A 3NTUA 5ALRA 2QLXA 4DCCA 3HVAA 3BGRA 2RJZA 4XRHA 2CPJA 1U6ZA 1KQFB 1D9FA 1PVRA 4HT7A 3CCUS 2JLFA 3IGNA 2NLWA 5HHHA 2PMHA 4C4SA 2ZUAA 5HAOA 3IM8A 1VCTA 1VC5A 4DUTA 4C98A 3HT3A 2MJUA 2ZBQA 3R9LA 1PC4A 1T3OA 1HQUA 1XO1A 3HZGA 3W7BA 3OR1A 3KLGA 2PMWA 4QIFA 4USMA 1LWEA 4I4BA 4ZHRA 1TL1A 2R42A 4O3OA 3I55S 2ZKUA 3WK7A 1AFJA 5HROB 4DV3F 3H2UB 4QIWC 4OX7A 1XBWA 3JSMB 3CC7S 4WZMA 4J9UE 1HWJA 3QT7A 2VFVA 2GHVC 2OSRA 3QU5A 1RUSA 1DTTB 1RXVA 2Y0SF 3TA0A 5H9EJ 2QL9B 5TISU 3DOLA 1GFWB 4DV5F 2E1AA 2B5JB 5HL7Q 3QUCA 5LXRA 3MMCA 4QWCA 2IOFA 1YTYA 3M8QA 4IUFA 4YDXA 5CEHA 1HI0P 5E0OA 3HHLC 1N62A 3BEGB 1WF0A 2HQDA 1M5SA 2IMOA 2AV5A 3QLHB 2OO4A 4DR4J 3THVA 4YHHJ 2J9DA 1RWVB 3D6FB 4K59A 3JAMY 4JB8B 9ICKA 3DLEB 3MMJA 5AM2A 4KLQA 2K1RB 4MHVA 5DBAA 4HVZA 4LF5F 1P27B 4LR9A 2UUAJ 3ISND 4DFMA 5J2NA 2KJ8A 1RK8A 2VASA 2BOPA 2A18A 1ZH5A 1KLMA 3P4UB 4QZVB 4PG5A 1WSRA 1WHYA 2BCRA 3OFGA 3ZTQA 2BCQA 3KLIA 1R0BG 2UVWA 2BOAA 4K4UA 4QNLA 2R8JA 1Q0NA 2E5SA 3HCXA 4NCAA 1ZD3A 2MZQA 3PM9A 2HGNA 5EWFA 1QSLA 1PYOB 2JLEA 5ALIA 4UAYA 4XQ8A 2AD9A 4MK7A 1DURA 4QZHA 3RJHA 1TKXB 2UUWA 2P9CA 1FWLA 1HARA 4PQUA 3DRPA 3HPOA 1NDCA 2K7JA 2V69A 2MB0B 1UVJA 1UZDA 2ZIWA 4C9DA 2WF9A 3ED5A 2DKXA 3BS9A 1NH7A 2A19A 2L9WA 2HQGA 1L7PA 4DUYF 3D4JA 4OYOA 2QO3A 2J0SD 4CT9A 1Z4UA 3MCNA 1MMNA 8ICJA 4UF4A 4C7YA 4P75A 1OYEA 4NLWA 1VGYA 4LZGA 2WONA 1WOPA 1X4AA 3AU6A 1TK0A 3GYXB 2Q1LA 3DYAB 1S7IA 4PHPA 3CP8A 2OLWA 4MYUA 5K8PA 2F9JA 3QFHA 2B51A 3P3DA 3QPIA 2BR0A 3HMJG 1DK3A 5EDWA 2XIDA 3FCHA 3BM7A 9ICNA 5HI7A 3MUTP 1FRKA 4QZCA 1D0EA 1UMJA 4RPFA 1UPHA 4KMOB 2K8CB 2CN1A 2LA4A 1X5OA 1NM2A 2YNHB 1QJHA 3PXGa 1JMTA 2V94A 1AQ6A 3ENQA 2GLEA 2K2PA 3GP9A 2DY1A 2GMLA 2X3GA 3Q2TC 3ZNUA 4EBDA 2EANA 3IDWA 1SL1A 4KGVB 1NH8A 2FTRA 2VFRA 1IBKF 1LWXA 2H3EB 3T5LA 3LW5C 1XNRJ 2J0WA 1UWBA 1RCXB 5DBCA 4DL2A 1JLGA 2F8HA 1NK5A 2FLOA 3HSGA 4I2PB 3RJEA 4EX7A 3FFIA 2MZSA 1TUVA 1VDVA 1SCJB 2EAMA 3TUPA 9ICJA 2Q0ZX 3TFRA 2G08A 1Y10A 2CWXA 4RQ5A 2D7SA 4JI1J 1RT3A 4YN3B 4ZA1A 3O0FA 3UW1A 4LF6J 1XSPA 3QATA 1Y88A 5DZ6A 1KVJA 5DDMA 3IR7B 4ELVA 5J2QB 2ZJ5A 3U1LA 2P66A 4IG0B 4ZITA 2KIWA 2MJNA 1WC3A 2GGPA 2JMGA 4Y2SA 2XO6A 4K4ZA 3VTIA 4J9KA 3PSPA 3VAGA 1WHVA 2P6SA 4PYAA 4B02A 4DR1J 3Q8UA 3CCJS 2BABA 4CH0S 3GCXP 4FO6A 3PX4A 4WZQA 5GAEI 5KG2A 4BHQA 2MSSA 3RFAA 2ZEJA 4ETZA 3R2CJ 5JTIA 5U47A 2CQIA 5I3QA 4FVMA 4HH1A 2Y8WA 2I0XA 4KHPF 2ZM6J 3NNHA 1X60A 5G0RA 3KLHA 4C0BA 4TQRA 4ZPAA 1VQSA 5EN1A 3G96A 4X4NA 3KHRA 1VC6A 4GKKF 2ZOFA 1IBLJ 4TN2A 3TFSA 4ZPBA 4WXWA 2W9AA 1R31A 4RNMA 2NZ4A 3CE8A 2AZ1A 5DB9A 2XNQA 2XYGB 2W2OP 1A77A 4Z7YA 2RILA 5T14A 4MKBA 2CJBA 2DISA 1SUQB 2OUGA 2QSFA 1RI7A 1YQHA 2NPIA 5DGBA 1ZQAA 1N5WA 3GSDA 2BE7D 1FTRA 4ZP8A 1ZQ1C 2RIJA 2HGMA 2CJQA 3EDQB 1DQAA 4CI0B 2NXNA 5F8JA 1RWWB 2ISOA 2CZ4A 2VBXA 4ILRA 3C19A 4GVLA 2HEKA 1P8GA 2KVIA 2RRDA 3OD2A 2RLTA 2W03A 1HUOA 4F50A 1ZTTA 2BCVA 1HNVB 4WK3A 1JI7A 4DSEA 1N0VC 8ICQA 2XS7A 4UB3A 1NJWA 2FJEB 2MDAA 4KX3A 5I3UA 2H65B 5D0GA 2H1YA 3HSDA 4J7CA 1S10A 1ZD4A 1T94A 2YH1A 3VAHA 3KUHA 1G1XA 2KKHA 3EGVA 3FSXA 1S1VA 2XMUA 4LQ3A 2L9NA 1JLEA 2BQUA 2ZD1B 4K4SA 4ILLA 4JOUA 2HWTA 1KEJA 1SWVA 1BQMA 2FYXA 3EVOA 3EW9A 1X4GA 4F2RA 4JV0A 3B0YA 2XZTB 1S5ZA 4OYMA 1NB2A 3I87A 4YG2A 4CH7A 3V6HA 4DHVA 2DXDA 5HMZA 5J2GA 3HKWA 2W55A 3PJXA 3EZ5A 2P35A 3JQKA 4JYAF 4FKXA 3Q83A 2ZUGA 2MUTB 2HQIA 1VRTA 2BM1A 5CD4A 1UFKA 3I0SA 2M70A 3OHAA 3BSOA 4KBIA 3M6XA 3MECB 4NLCA 3C15A 3FBFA 1F0XA 4WJBA 4YN4A 4MFBB 4UB4A 2QSWA 2IBOA 2B8PA 4ANEA 2F9DA 4EELA 2YMLA 1L8LA 2MY7A 1S8OA 3KLFB 1GX5A 2PMZD 5J2MA 4JBCA 3R7SB 5ALXA 2JFDA 5M2PA 5F3XB 4Z7CA 3PX6A 2XSJB 1N5YB 3SQGB 4LIWA 1LK7A 2EEYA 1FO1A 5CYMB 4LSNB 2W04A 3QEBZ 2XEXA 1HBUA 2YX1A 2JZBA 2YKNA 4Z37A 5ALOA 3QNMA 4QZFA 3ENWA 3Q8YA 5KFLA 1K0TA 7FD1A 3QIPB 4LF1A 3RRGA 3M1VA 1S9EA 3LO3A 2DEJA 5ALFA 2MEWA 3KDNA 1U48A 4OV1A 3NXZA 4CRXA 2IM0A 3DRXA 3KLEB 1IR0A 2KM8B 2DKZA 4KLGA 4DI6A 3G82A 1VQPS 2G0CA 1RGVA 2QZ8A 1VIOA 3QGIA 1KD1T 5CRXA 3PR5B 1HR0J 2KVCA 5E3CA 5GAHU 2ZJQQ 3CDBA 4ECUA 4NMXA 2B7BB 2FB0A 1TQLA 1E6VA 1WCLA 2KZ3A 3CJKA 1JQGA 2FHJD 1X0PA 2YY6A 3F0NA 4JI2J 1LWCA 4PAAA 1N32J 2WVDA 1XMQF 5J2AA 2HOFA 3N6LA 3RRKA 2PGCA 1Q4RA 4RR5A 3GIJA 5B0DA 2VFSA 2G0IA 3E0FA 1VRUB 1N61A 2HVHA 1V3ZA 2KJ9A 1ZQBA 3UMCA 2B0CA 2E5LJ 5A0YB 5GAHI 3TAPA 2VV5A 4WK1A 5MAOA 4K0KF 1OUQA 1OW5A 1V9OA 3IA0A 4B9SA 4B3SJ 3OTCA 2NXEA 5ETOA 3OTOF 2KFYA 4NRTA 3GSIA 2LPEA 1IR2A 2DNLA 5HP1B 4DV6J 4BGDA 1G3OA 3UVJA 3CDWA 2WHOA 3K8WA 4NE9C 1J27A 2F1FA 2ZH3A 9ICXA 4DV1J 4NEZA 2QARB 2JZ5A 2V2KA 5B66U 1FJGF 4I28A 4WP3A 1RLCL 2YMQA 2Z2ZA 2ILZA 3NBPA 4CLFA 1WHXA 2PFNA 5AI8A 3Q8QB 4H54A 4OX6A 4BC7A 5AJ3J 1H73A 4LUBA 3BGFA 2ASLA 4EEKA 4WU3A 5CYQA 5AK6A 1TELA 2FJAB 1U4BA 3ZZOA 1WKKA 4I2IA 4DV7F 3GQCA 1WG4A 3H0RB 1VQ4S 5CYJA 3W5YA 4KY3A 3RJMB 4NYOA 2L08A 2AQ4A 1FXLA 4PZNA 2VB6A 2UXDJ 1IKWA 2OEJA 3DM2A 4IOAQ 3HHDA 3BYRA 2UP1A 4H4MA 2XLKA 4K4VA 4ECTA 1NMEB 2E5JA 3V4MA 1CRXA 3TA2A 4NLYA 9ICQA 4C97A 1HMVB 1U1NA 2BKNA 1FWPA 3HD1A 3M7DA 4USJC 2XCAA 2DGUA 2Z0GA 3D6JA 3KD3A 2ZJPQ 4Y2JA 2IDLA 4RUBA 5KFZA 3C14A 3LWLA 4GMKA 1MMLA 5BPCA 1J5OB 2BW2A 3DHWC 4F92B 2FVQA 3KK2A 4YXMA 1R8AA 1RAJA 1UW9A 9ICHA 2JX2A 5F3TA 3H0MB 1B43A 2MQOA 5JVGQ 9ICBA 4M63A 4FPIA 4NLSA 3HK2A 2HHHJ 2KG0A 1T3NA 2WAQC 2HVEA 1HBMB 1LOUA 1B0PA 2L3MA 4F72A 3ZDDA 3WK8A 2E1MC 7ICFA 1TK8A 3AA9A 2HS3A 3DKDA 1U1LA 5EHHA 1A9NB 2B4UA 4OHYA 3N6NA 1FJEB 2RF2B 4KGKA 3G8SA 3MEDA 1RT2B 3UXPA 2M8HA 1S4EA 4M5DB 5L1JA 4I6YA 4OI2A 2RRAA 1FESA 4W4MA 1Z2ZA 2IJNA 4J9LA 4M5DA 5IV4A 5BR8J 2B56A 1RT2A 3MEDB 5ALJA 3OQ2A 2RF2A 1CLFA 1FNXH 1T7PA 1PVPA 4GKJJ 2KDOA 1F3VA 5KOXA 4X4RA 4O3PA 2GJFA 4ED8A 3O3LA 4OCZA 3AMZA 1X4CA 5J0RA 1HBMA 4M8LA 3D0IE 4V19J 3H5UA 4DPYA 3BREA 2W4PA 4JYAJ 4F2SA 3TZXA 3RAMA 3QYPA 2KFNA 3AU2A 3D2WA 1PK3A 1S7HA 3KK2B 1J97A 3SCLE 3SFGA 2D3DA 3NMAA 5GTHU 2LECA 1J5OA 4IRKA 1XS9D 2WF5A 2DGOA 1KFDA 2N3LA 3AT1B 3C14B 4Y0FA 3D1HA 4K7QA 4C3KA 2J5AA 3D68A 1Q1KA 1L3VA 2DGZA 1EX8A 3QRQA 3ZD9A 3UDVA 4KQZA 4EYHB 1HMVA 5GTIU 4DL4A 2RNEA 3LAMA 5IC6B 1BPDA 2H5XA 1NZPA 1HEKA 5D46A 5ETTA 3ZTPA 4H4MB 3F5EA 5J0PA 2BVZA 3NS6A 5CHCB 5J0SA 3DM2B 3IWLA 4ES3A 1IKWB 4YHHF 3CIMA 2R7XA 2R8GA 1C20A 2CYYA 2ZWOA 4BCAA 2XYPB 2VC0A 4A48A 3RB4A 5JRTA 5CYQB 1HD1A 3BGUA 4ZCMA 2HLUA 4W90B 3CDEA 5HVHA 3CCLS 3VAFA 5H9FK 5GMDA 4KX5A 5A6PA 4KR0B 2ZVIA 3NBPB 1S99A 3I32A 1SC6A 2H3QA 1B3TA 1UWAA 3H5SA 2MU2A 4FFDA 2F1IA 2N4CA 3EZUA 2QARA 4UARA 1QQ6A 4M9NA 4MEYA 1RHRB 4USWA 2MSNA 7ICLA 3UVJB 3AEVA 2CXYA 1ZQEA 2D1CA 3PV8A 1YLXA 5HP1A 1V5VA 1T95A 5ALKA 1YJUA 2C2RA 3BDPA 3D2NA 1SJRA 4GKKJ 3NWRA 5A0YA 2YQ3A 3I9V9 3LALA 7ICJA 2C3YA 4WXOA 1VRUA 1V38A 2IFXA 2E1RA 5KFCA 2PMZC 4KH0B 4DL6A 1Q86T 2HFOA 4DLEA 4RWXA 5JXSA 4DDFA 1B7YB 1B70B 1KEKA 1LWCB 4LVSA 2M0GB 2FJBB 2VANA 4RQ8A 3CJKB 2B4OA 3ZZTA 1E6VB 1R8PA 3MXHP 3DLLQ 1ITPA 4P4OA 2CADA 3RBDA 1ZQHA 2CJYB 4J9QA 3FEXB 1OO0B 1AB8A 3GV7B 2FGOA 4KTQA 3R7NB 3F53A 5JU5A 3G82B 4OZ1A 5ALSA 3C46A 1AUSL 3QGHA 3DXSX 2IOHA 3ISCA 3QFWA 8ICWA 3NL0A 3F44A 3KLEA 2EZZA 2M52A 4ZJLA 3UFCX 1Q8BA 1TU0B 2DGTA 4HAIA 3CB4A 3LPYA 3LOUA 3L9ZA 2DBBA 3MGJA 3QAEA 5KT2A 3IWXA 4LF6F 1SZPA 4WIQA 1S9EB 3M1VB
chains in the Genus database with same CATH topology
3QSYB 3AEVA 2AHOB 3J81j 2QN6B 1YZ7A 1YZ6A 1Q46A 2A1AA 3CW2C 1Q8KA 2A19A 1KL9A 2QMUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSY B;  3AEV A;  2AHO B;  3J81 j;  2QN6 B;  1YZ7 A;  1YZ6 A;  1Q46 A;  2A1A A;  3CW2 C;  1Q8K A;  2A19 A;  1KL9 A;  2QMU B; 
#chains in the Genus database with same CATH topology
 3QIP A;  4TNO A;  2H5J B;  2HBR B;  3VR1 A;  3SQO P;  3WKB A;  1ZQU A;  3HSZ A;  4KJI A;  4KN7 A;  4YVZ A;  2GIQ A;  3WDO A;  2YKN B;  2JZB B;  1HNX F;  2OFG X;  1KBR A;  4P74 A;  1HBU B;  2VJV A;  5J1N A;  4LSN A;  5CYM A;  1Y11 A;  3OL9 A;  1KBU A;  3JQM A;  2HHV A;  4L76 A;  3UE2 A;  1CC7 A;  3SQG A;  1N5Y A;  3J81 U;  2XSJ A;  3AOB A;  4DOB A;  4C0H A;  1BPX A;  2KV2 A;  5HHI A;  4YS2 A;  5J2M B;  5AK4 A;  3F5A A;  3SYZ A;  2PD1 A;  3M8Y A;  3KLF A;  2C2Z B;  1DK2 A;  4WFX A;  3FDS A;  5AK5 A;  4UQT A;  2G2Y A;  4DQP A;  2HAI A;  2FMS A;  2V63 A;  5AM0 A;  7ICE A;  4WPA A;  2OML A;  1F2G A;  4MFB A;  3G6Y A;  3NMR A;  1B7F A;  3C15 B;  3MEC A;  3OPK A;  3I0S B;  3K1Z A;  1VRT B;  4CLK A;  3A3P B;  5CA5 A;  2WSF C;  2EFN A;  2H3V A;  3EPI A;  2MUT A;  7ICO A;  1F5B A;  1RWX B;  4NLV A;  5IT9 U;  4U67 Q;  2V67 A;  3KKA C;  2GIR A;  4LJM A;  1WC1 A;  2AIR B;  2CNK B;  4A8O A;  5IS2 A;  3ISB A;  4F8R A;  1U26 A;  3OXG A;  2CG8 A;  3K58 A;  4J90 A;  4DN9 A;  2VA3 A;  5AKY A;  1VHI A;  1BQM B;  5ETM A;  4GC7 A;  2V8D A;  2ZD1 A;  1Y00 A;  1L7M A;  1N0U A;  5KFY A;  1JLE B;  4DV6 F;  4QU7 A;  3ZDC A;  1S1V B;  5KFS A;  1ECW A;  1PIE A;  3D6H B;  3MR6 A;  2ZJA A;  1SKR A;  3NGS A;  2B8Q A;  2KTQ A;  1DY3 A;  5KOW A;  3E8O A;  1U6F A;  2WBM A;  2AT1 B;  4YFU A;  3C2M A;  2NXU A;  3AM9 A;  2VOP A;  5I3U B;  1KTQ A;  1Y9O A;  4RQ7 A;  4ZOH C;  2R8I A;  1HNV A;  4BS2 A;  4CF3 A;  1SXL A;  9ICG A;  5FLX Y;  4KN4 A;  4I2H A;  3NAS A;  1URR A;  3C5F A;  1NK7 A;  1X4D A;  3AQE A;  5ETK A;  1KN5 A;  2PFO A;  2IVF B;  4DX8 H;  2M88 A;  2RVJ A;  1A6L A;  2G1D A;  3KKA A;  1H38 A;  3G6E S;  2KKV A;  1EQ0 A;  1LB2 B;  1OS5 A;  3IAS 9;  2IVY A;  4CLZ A;  3C1Z A;  4J37 A;  1RKJ A;  2DR5 A;  4X4S A;  4RQ2 A;  2ASJ A;  3W5X A;  1PBU A;  4F36 A;  1WSV A;  1RAA B;  1SUQ A;  2Y9T A;  2BZF A;  3R7B B;  5B0E A;  1NKC A;  3IM9 A;  3NCR A;  2QL7 B;  1R8B A;  2FZK B;  4UZC A;  3CC4 S;  1Q78 A;  3AB2 B;  2J8S A;  3HI9 A;  2EFP A;  1XR5 A;  4DF8 A;  2X51 A;  2RQM A;  3FRZ A;  4X4V A;  2KMD A;  2HBM A;  8ICS A;  4M5N A;  3GR1 A;  1AW0 A;  3PJW A;  1Q53 A;  2OAU A;  3C23 A;  3KLH B;  3KZI U;  5G0R B;  2DUY A;  3U02 A;  2EFV A;  1X5T A;  3J7Y I;  3TP2 A;  4DEZ A;  2WF7 A;  4EBC A;  4KHM A;  2J9C A;  1OJ4 A;  4HDG A;  3KNA A;  4DWI A;  1FT8 A;  3ILI A;  2XUL A;  1O6X A;  4CLT A;  1N33 F;  2FIU A;  4YY3 F;  3BH6 B;  3NGK A;  4J9O A;  4LR8 A;  5KFO A;  2J9D E;  2I1R A;  3RJG A;  1R6Y A;  2IOF K;  3SAF A;  4B9T A;  2GGP B;  1WEX A;  4I27 A;  7ICG A;  3CW2 C;  3BV8 A;  2UUA F;  3IG8 A;  2FPH X;  3ZZP A;  3HJF A;  4IG0 A;  4FP9 A;  2B6G A;  5J2Q A;  1VJQ A;  4OHX A;  1LVH A;  3MGH A;  2QFI A;  1J5E F;  1UQV A;  2ZBR A;  4OYP A;  4DR4 F;  1RT3 B;  1Y0H A;  3KMQ A;  1NBE B;  4I2E A;  4IQT A;  4LIR A;  2LXI A;  3IBW A;  5BYS A;  2FZG B;  4IQX A;  3CD7 A;  5EOZ A;  2HKE A;  3FFI B;  2ALZ A;  2CZV C;  3G8Q A;  2GAG C;  3VGS A;  4I2P A;  1IQZ A;  1FNO A;  3PHT A;  1JLG B;  3AUO A;  2AYG A;  4KIA A;  1UWB B;  1UA1 A;  4OYI A;  2RS8 A;  5J0U A;  2I9S A;  1VQO S;  3CUL A;  3ZO7 A;  3ICL A;  4IR1 A;  3I82 A;  2G13 A;  5AE2 A;  5CAA A;  2MKH A;  1QSS A;  3UD4 P;  3HDS A;  1NK6 A;  3W8P A;  5RUB A;  1SIW B;  1PJ6 A;  2OHF A;  2YNH A;  4DR3 J;  3CD0 A;  3BSN A;  1NCL A;  4NYZ A;  2DIV A;  2BA9 A;  3PAC A;  2WVF A;  3ZZY A;  5IFM A;  2UVU A;  3JSR A;  4ELT A;  1JWW A;  1SKS A;  4F71 A;  4USK A;  1RXO B;  2HHU A;  1HJP A;  1NEE A;  5J2F A;  1NRK A;  2C2K B;  4PJ0 U;  5AI5 A;  2O1P A;  3FEZ A;  1NUE A;  4G3I A;  4OJ6 A;  4KAI A;  4AFF A;  2PDA A;  5F8H A;  3SCI E;  1JRO A;  5KTQ A;  1PSD A;  3LUY A;  3P8B B;  1ZAV A;  3QX7 A;  3DYA A;  3QJJ A;  2JV3 A;  3D1Q A;  3IM1 A;  4XDC A;  3IO1 A;  3NOG A;  2WON B;  5B7W A;  2HK2 A;  1S97 A;  4IO1 A;  4GO7 X;  1U1M A;  4P7V A;  1VLO A;  2ZTE A;  3CED A;  1ZQQ A;  3KG0 A;  4F04 B;  3KFU F;  2RP5 A;  2DNK A;  5K5M A;  2XBP A;  3J7Y U;  3RB3 A;  2DK2 A;  2ZIW B;  2BKP A;  3MUV P;  1TKD A;  5KFF A;  3OXF A;  2Q66 A;  3DRP B;  4PQU B;  1N5T A;  2VUG A;  4UB6 U;  3A8J A;  3R1L A;  1TKX A;  2FMP A;  2F40 A;  2HHH F;  1JJC B;  1FJ7 A;  3HFK A;  2VQE F;  4Y34 A;  3NWG A;  2ZC3 A;  4F5R A;  1MMD A;  2M5Y A;  1CBK A;  2W1B A;  3AAW B;  4CNQ A;  1VR6 A;  1L7O A;  2MQ8 A;  4AYB F;  3FQK A;  3PZP A;  2FVR A;  2AU0 A;  3V2U C;  2FLL A;  4FZL A;  2FPL A;  2I2Y A;  2YPY A;  2CJA A;  3BZQ A;  4O9M A;  3JPS A;  1QUV A;  4QU6 A;  3KNG A;  3LAK A;  4TLQ A;  3KLI B;  1VK3 A;  3BYP A;  1BC6 A;  1ZRM A;  1XMB A;  5DB7 A;  4KLS A;  4WFB Q;  1KLM B;  1SL0 A;  2DTJ A;  3OTD A;  9ICI A;  2N4D A;  4CRJ A;  5J2N B;  3ALR A;  2HQC A;  3GFK B;  2K1R A;  4YDD B;  5AKK A;  1FXD A;  2HBQ B;  2ZH7 A;  3DLE A;  1I94 F;  3CMQ A;  5CB1 A;  4ED5 A;  4GLX A;  2KK0 A;  4ZP6 A;  4RUH A;  3X3U A;  3TEH B;  2QMX A;  3QLH A;  1ZQZ A;  1F9F A;  1FHT A;  1IBL F;  2YMP A;  2GH1 A;  5CWR A;  5E7O B;  4WJ3 B;  2QEX S;  3M8Q B;  3VZH A;  3OSP A;  4UW2 A;  3MMC B;  2P2C B;  2B5J A;  2Z56 B;  2PFP A;  3GJS B;  4LF7 J;  3DDN A;  3DOL B;  1RAF B;  9ICM A;  2E3T A;  3K59 A;  3WX8 A;  1DTT A;  2KXF A;  3N28 A;  1FFW B;  3JSM A;  2DB1 A;  2GCF A;  3FK4 A;  5DET A;  4J9S A;  1FFV A;  4QOT A;  5HRO A;  5J0Y A;  4QJF B;  2JH3 A;  4HHJ A;  3KJQ B;  1TL1 B;  7ICP A;  4ZHR B;  2F3J A;  1MQ2 A;  1LWE B;  4ZK7 M;  4EX6 A;  4NXZ A;  2LKZ A;  2JC0 A;  4RT3 A;  1ZJN A;  2FUG 9;  2KYX A;  5KFJ A;  3KLG B;  3OR1 B;  1HQU B;  1S48 A;  2HS0 A;  4YXJ A;  2Y0S C;  4A8X A;  4K0K J;  4EGL A;  3U1N A;  3V7J A;  2G5H B;  4FNH A;  4HL9 A;  3KUE A;  4I6A A;  4QZE A;  3UDC A;  1T3Q A;  1FCA A;  8ICX A;  1ELO A;  2K06 A;  1VJ5 A;  5D8H B;  3ZXW A;  1OSC A;  1YSJ A;  3F73 A;  4ECW A;  3BGR B;  1U1R A;  3A12 A;  2RAQ A;  4GIB A;  5AJ3 F;  2WAQ F;  3U27 A;  3WK6 A;  1ZD2 P;  4I1T A;  2AYM A;  4R5P B;  1N54 B;  1JUD A;  1RLD A;  5EE1 A;  5C42 A;  2KRR A;  4R0J A;  3RR7 A;  1FTC A;  4ES1 A;  2HOQ A;  2MXY A;  3NGR A;  4QWD A;  4USV A;  2CPZ A;  4B9U A;  2KIC A;  4AT1 B;  3M8P A;  2GS8 A;  3D28 A;  4DV1 F;  3BZK A;  4IOC Q;  1A0P A;  4I56 A;  3ILL A;  1QE1 B;  3N9U C;  3FC4 A;  1LKY A;  3TJA A;  5J29 A;  1ZET A;  3SIP B;  4C8Z A;  4C8Y A;  3K5O A;  1T9V A;  1UT8 A;  2UZA A;  3TUI C;  3QYY A;  1X42 A;  2C2E A;  2DHX A;  5KG7 A;  3QWP A;  4URG A;  2OPR A;  4EZ9 A;  3DMJ B;  3EX7 B;  4ID8 A;  4B3O B;  3V4I A;  2R4F A;  1GXL A;  3A1Y G;  1U02 A;  1PK1 A;  1FKP B;  3LH2 S;  3B8H A;  2DXF A;  1PJ5 A;  4U9R A;  4Z2X A;  3IMQ J;  1REV B;  2DYA A;  2VIC A;  1FIQ A;  4LRB A;  3HHE A;  1G7C B;  3TJ9 A;  3IGV A;  1UZH A;  3SBM A;  3SSR A;  4PUO A;  5ETV A;  3AB4 B;  4EK2 A;  2H4Y B;  4UAT A;  3TZW A;  4LRE A;  1GK8 A;  3M8R A;  3ELH A;  3C66 A;  3C8Y A;  1WDD A;  3M32 A;  2W24 A;  3VAI A;  1ZQP A;  3C2K A;  3ICX A;  2KZZ A;  5ALU A;  2AJF E;  2VBW A;  2CPR A;  4B3T J;  5E41 A;  1UFL A;  3NNC A;  4P4P A;  4ZIW A;  3FSI A;  1UVM A;  2I8E A;  2AGO A;  4XUS A;  4X66 F;  3KHH A;  3L3C A;  2I6W A;  2VKZ G;  4LBI A;  3ISN C;  4KV8 B;  4MAK A;  3SCJ E;  2NSB A;  4NX9 A;  4ZPW R;  1MN7 A;  5FDL A;  1PAE X;  2HWI A;  1D8Z A;  3HT0 A;  3FYH A;  4CLU A;  2BJ8 A;  2BV3 A;  2ZKT A;  1MN8 A;  1FD8 A;  3DDI A;  2HHW A;  3R5C A;  3DOM A;  1CPZ A;  2DRD A;  2KVS A;  4PG4 A;  3QGP A;  1DHM A;  4TXS A;  3V72 A;  2DR7 A;  3LDA A;  5T7L B;  2M3D A;  5E5N A;  1BGX T;  2HND A;  2IYG A;  3R5B A;  4AQY F;  4RW6 A;  1VS3 A;  2MLZ A;  3PNC A;  2LKY A;  1JNR B;  1RTH A;  4ZKA A;  3THT A;  4G1P A;  1HQE B;  4J9N A;  1JLC B;  1K73 T;  3I5C A;  1L3T A;  2V34 A;  3RUB L;  4KLJ A;  2AKW B;  2D69 A;  2F8E X;  1FEZ A;  3LP0 A;  7ICR A;  1YRX A;  1YJW S;  4QYR A;  1ZM2 A;  4JK1 A;  1L5U A;  2P6U A;  3W2V A;  4I67 A;  4CO2 A;  1WWH A;  3AOA A;  5HQL A;  5ALZ A;  3MMB B;  3DOK A;  4YMM A;  1RWO B;  2RD5 C;  2HRU A;  2IM3 A;  1HNI B;  2EW9 A;  1AA1 B;  4BBY A;  4PXC A;  3P45 B;  2ROG A;  4P2M A;  2UXB F;  4E2F B;  2JVR A;  3TOQ A;  2KHD A;  4LF9 F;  3DRS B;  1CQM A;  2MST A;  1RYS A;  2FDN A;  2QG9 B;  1P9Q C;  2KN7 A;  4ED3 A;  4UAU A;  4LFB J;  4F93 B;  3TAQ A;  2DEI A;  2DNY A;  2Y1R I;  3SSS A;  4DQR A;  4B9M A;  4CCH A;  2XMA A;  1F9H A;  5J2E A;  3K89 A;  2ROP A;  2MYF A;  4KGZ B;  4M5J A;  5DG9 A;  5J8Y C;  1BE4 A;  1KR4 A;  4MIA A;  3GMG A;  1B0X A;  2HBJ A;  5IIK A;  1J2M A;  5F41 A;  5HBM B;  2UXC J;  4ZPC A;  5GME A;  1N8R T;  2QJ3 A;  3R6G B;  1VQY A;  2AJQ A;  4OZL A;  1OSD A;  2NO4 A;  5A8R A;  4PHD A;  2R7Q A;  2E5I A;  3EMT A;  2PA8 D;  1ZQC A;  1T0T V;  3A8I A;  1APS A;  1SL2 A;  4DX6 A;  4OJ1 A;  1VQ6 S;  3LK9 A;  5HMM A;  2CJ9 A;  1CJU B;  3BJY A;  1YBU A;  2JLG A;  4JI8 F;  3RJJ A;  3MAB A;  4MF8 A;  2G4B A;  4G1Q A;  3DGP B;  2MQP A;  2JC1 A;  2WHE A;  2OEH A;  4GFJ A;  2BJD A;  4USH A;  4KO0 A;  1Q5V A;  2C2D A;  2BYC A;  3CWJ A;  1TL4 A;  2C2O B;  2HGL A;  2YWW A;  2HG4 A;  4CH1 A;  3BQT A;  2OEM A;  2CNO B;  2XTJ P;  3BPD A;  2MQN A;  1BY9 A;  2W2N P;  2WSE C;  1RU2 A;  4EYI B;  4OJ5 A;  3RB6 A;  4C0Z A;  3SMZ A;  1H7X A;  3EDR B;  2BEF A;  2RDD A;  3U26 A;  4NLK A;  2FY8 A;  4RQM A;  1EKR A;  3KTQ A;  2K8G A;  1JLB A;  4QZ8 A;  2Q6B A;  4X4P A;  2B43 A;  3W9J A;  4C8N A;  1C1C B;  3FVY A;  5F8L A;  3FM9 A;  2AGP A;  2FQQ B;  9ICT A;  1MSW D;  4UAV A;  3M6W A;  1KFS A;  3CJT A;  2G0A A;  4KLT A;  4EMD A;  1QAJ A;  3C1Y A;  3TKA A;  4NY8 A;  3PFO A;  2OPS A;  4FF3 A;  2GVZ B;  3M30 B;  5DQI A;  4K4T A;  5DZ7 A;  2NYI A;  1UP1 A;