1YZ7A

Crystal structure of a c-terminal segment of the alpha subunit of aif2 from pyrococcus abyssi
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
176
structure length
176
Chain Sequence
b'KAKLQEFKRAQKAENLLKLAAEKLGKDFETAWREVWVPLEEEWGEVYAAFEDAAKDGIDVLKGHVPDEWLPVLKEIIDNYVEVPTVTIDAEFEITVPKPNGVEIIKEALIRARDRANKEKDVEVKFTYLGAPRYRIDITAPDYYKAEEVLESIAEEILRVIKEAGGEATLLRKEKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable translation initiation factor 2 alpha subunit
publication title Structure-Function Relationships of the Intact aIF2alpha Subunit from the Archaeon Pyrococcus abyssi
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
total genus 59
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 1yz7A01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 1yz7A02
3QSYB 2AHOB 3AEVA 3CW2C 2A1AA 1KL9A 1YZ7A 3J81j 2QN6B 1Q8KA 2QMUB 1Q46A 2A19A 1YZ6A
chains in the Genus database with same CATH superfamily
4JP8A 3FBEA 4JI4F 2LU1A 2ALYB 2BJ8A 1KWMA 1S1VA 3PIPQ 3HF5A 1VCTA 2JRZA 4NYPA 5J0XA 3RTVA 4QZIA 2VBWA 3CGIA 3VV2B 3MEGB 2A2CA 4LSLB 4JI1F 3KHLA 3M2VA 1L3TA 1NK0A 4HYKA 1WWHA 3POTA 5J1NA 4J5OA 4DF8A 4Q43A 1FD2A 2A18A 3UW1A 3BO4A 2YMMA 3J81j 3J7ZT 1HBMA 3TQEA 2NXNA 4AUKA 2NXEA 5IWAF 3V6KA 1X9SA 3DOLA 1WWUA 3I1YA 1PJ7A 3PNIA 9ICVA 4CM0A 3A8JA 4DQQA 5C0YA 2YKPA 3M8ZA 4C7QA 3NG8A 8ICWA 2HW3A 1SIWB 4A8MP 3V6HA 4RPFA 1M6YA 4J9QA 1VMBA 1Q81T 4M47A 4MFAA 3EUB2 3TUJC 7FDRA 1FRJA 4ZPBA 5ETSA 4C4WA 1V9OA 1P1TA 2ZKTA 2JMGA 2PN6A 1UZHA 1IKVB 1KQGB 5AM1A 2HKEA 3SQGB 4EWTA 5AKXA 1ZQAA 2YTCA 4PWDA 3HXMA 2K3KA 2JC0A 3DRPA 1KFTA 1W25A 4OX8A 1V3RA 1UVNA 3V72A 1YBAA 2JZ5A 4ZA1A 1WOOA 3V2UC 4PWUA 2WHOA 2NYIA 4UAVA 2DHSA 3OL9A 1IBMF 2Y1IA 4PL2A 1ZQDA 4KV8B 1HMVA 5AKYA 1N56A 2LP4A 4LFAF 2KO1A 2ROEA 2ZJAA 1X40A 4ZHRB 2YNHB 1T94A 5J1PA 5IWAJ 3MDFA 2AYEA 2MSNA 5J29A 1VRTA 3J7YU 1SWWA 2KDOA 4B9VA 2WOMA 1HUOA 5HR7A 3BKUA 3KLGB 3DLLQ 3IWXA 4JV0A 1JNRB 2GMJA 1NZAA 2MSTA 2HI0A 3QUTA 3ETMA 3BBFA 1RK8A 1IR0A 2WCXA 1Q82T 3D1QA 4CH0S 4JI3J 5C42B 2HAIA 5EUHA 4UOGA 2B9YA 2KVQE 3MPUB 4B3OA 2DGWA 3BBCA 2FHKA 5AM2A 1LWXA 4ZIWA 3OVSA 2DITA 3BM7A 4ZPDA 3WDOA 2HBQB 2W3SA 4ZCKA 2H5XA 1PYSB 4M5MA 3BV8A 2W54A 2XGQA 3N97B 2JWNA 2YNFB 1G2EA 5A0LA 2D9OA 4LFAJ 2G5HB 3NVYA 4OYOA 3MR3A 5J0WA 3B0XA 1T11A 5L38A 4GMKA 2E8PA 1VQ6S 4ZP9A 4DN9A 3G8QA 1PBUA 3MABA 2CQ3A 4MEXA 1WI8A 2YQ1A 4KHRA 4Z6FA 4CP5A 3RRKA 4EELA 1AT1B 5J2BA 4J90A 2ILZA 4ZKAA 3US5A 2MUTB 1PKUA 2WF8A 3TX0A 2WVBA 3O1LA 4Y2CA 1NDPA 5A8WA 1SV5A 2YX4A 4OLPA 2MQ8A 1UA0A 3TVZA 4DPXA 1PVRA 3PO5A 1IBLJ 4J9NA 5E41A 1LWFA 1S8OA 3C15B 1BPBA 3IAM9 1N36F 3I28A 2VPZB 4KFBA 3MDAA 4IRDA 2Q66A 3Q8PB 4UAUA 1LEOA 4DEZA 2BBEA 2KJ9A 2LYAA 1B7FA 2HS4A 4NX9A 4MYTA 5KFQA 2HOFA 2BZFA 1WF2A 1YG0A 5ALOA 1TL3B 2RDDA 4QQBA 2CXEA 5AKEA 4WE1B 1NNLA 3ZDDA 1WG4A 1P27B 1RAHB 2LI6A 4RQ5A 4EYIB 1T9WA 3GFHA 1IKYA 4LF8J 2RQKA 1MC8A 5E79U 2LLZA 2V0NA 4AQYJ 4NLYA 4F67A 1F0MA 2D3ZA 2C42A 1RUSA 3BS5A 2KYZA 3UDLA 1WHYA 4ANCA 3SSRA 2E3TA 2ZHAA 1KFSA 1DLOB 3NWRA 2NRZA 1SKSA 3MM8B 3OFGA 1WWVA 1DGSA 4PUOB 4C0BA 2QL7B 2KK0A 2QG9B 1BPZA 1B0XA 5DBAA 2HQDA 3KKFA 1NDCA 1L3UA 2N7YA 1JWWA 4R8UA 3KLIB 3ZD8A 4OFZA 5CAAA 2JNJA 1UFWA 2WFAA 5KFRA 3C46A 1VISA 3ZTQA 1ZQEA 2M4MA 3V5RA 3X3UA 5HO4A 2Q79A 5D4LA 2BANA 1RTDB 1RCOB 1FXLA 3PRDA 2PI5A 2WB1C 4B6JA 2IOFA 2GHWA 2FHJD 2VDIA 4KLTA 2OGUA 2P8IA 3I0SB 5CYQA 2AZ3A 4TY8B 3KZIU 2EBEA 1WG8A 1Z3EB 3Q8LA 2W9MA 1IQTA 3Q23A 2E1RA 2LQJA 1VQ7S 2EQYA 5J0UA 2VB6A 9RUBA 4I2FA 2HVZA 3RU0A 2RRNA 3D6MB 1TFWA 3OR2B 5ALZA 5AE1A 1JLFA 2FVQA 1WC3A 2BE2B 4QZEA 3DRYA 3EPGA 2DVIA 5KG1A 2XSJA 2XMUA 4F26A 2P6SA 2F8EX 1JLBB 1S1WA 2G2YA 2J0WA 4ED5A 3GFYA 2VPWB 3AY0A 1VC0A 2LVWA 2I6WA 3HFZB 2KXHA 3C21A 2A3VA 3DRXA 3DM2A 3AU2A 2FJWA 2LM4A 1S5LU 5J2KA 3ETOA 3ICLA 1Z1ZA 3ILOA 2VFSA 3C2PA 3BGLA 3G2XA 3L7OA 4WIQA 2J8SA 4KLJA 2GHPA 2WSEC 1UWAA 3A8EA 3L3FX 3GILA 1REGX 2JSXA 2LXIA 4DOCA 1PVQA 3O6QA 3UQ0A 1VK8A 4I2CA 2XO7A 3JTNA 2IYGA 2C2EA 4JMUA 1WTBA 1NSAA 1X60A 2QX0A 4IO9Q 5KFGA 1HPZA 2MU2A 3QYYA 1ZQYA 3H59A 3L95X 4DPOA 4U7UK 1S57A 1RKJA 2BCUA 4RNHA 2CJXB 1J27A 3MM7A 1KEKA 2CQ2A 2ZIUB 1JROA 1O0PA 3ZXWA 1SKWA 3F2BA 4UATA 1HWLA 4OHVA 7ICEA 3A4TA 4KO0A 3Q8RB 3BEGB 1JRPA 2VQEF 1NB2A 3D2NA 1RP5A 4OX7A 5B08A 4EMDA 2GVDB 4JWMA 3AB2B 3RR8A 2VG7B 5CXTA 1DK3A 4I67A 4DQIA 1GAOA 1RXWA 5JMNA 2FI1A 1YBUA 5AIAA 5ALGA 4NL9C 2RIJA 4TN2A 2RJZA 4CLLA 2ZC4A 4NLRA 2DH9A 1HL6A 3FFIB 4FNHA 3ET6B 2G09A 3M2UA 1FO1A 3N6NA 3GIKA 4M5IA 1DRGA 1UJ5A 2NRWA 3GMGA 1VQKS 5KFDA 4OL8A 2F8HA 2Z58B 1D8ZA 4DPTA 1S7HA 3KOOA 2HHTA 3D7SB 2DR5A 5D4NA 4EBEA 3AQEA 1JK9B 4JI6F 2OJ3A 3BH6B 4YOEA 3TJAA 1A0OB 2RKIA 4EUVA 5SUHA 3SQOP 1QE1B 4OJ5A 1R0AB 1YKWA 2R7TA 2E1MC 1XU4A 2EZXA 1EQ0A 2GVZB 2YMQA 2EFGA 4RT2A 1FF2A 1YRUA 3LQVA 2G08A 4QYRA 2CPXA 1T05B 8ICQA 1FT8A 3D1OA 1V3ZA 4LF7J 3H2LA 2A1BA 2VQEJ 4KLDA 3TJ9A 2KVCA 4CQ1A 4IQXA 1VYAA 1TV6B 3NAIA 2IMOA 2KZ3A 3K89A 5KL8B 1C0UA 2E7WA 1IKWA 1YJ9S 2IVYA 2BR0A 4JI7F 2MA1A 4PPDA 4CYUA 2V4JB 3CCRS 2GV1A 1KHWA 1F9HA 2D9PA 1GX5A 1L3SA 4PG6A 3QZ8A 4QZVB 2WBRA 4WYWA 3UVJB 4XPCA 4ZLJA 3ITHB 2QV6A 2LECA 4OI0A 2ODGA 4DG1B 1XMBA 4A8YA 2B4UA 3VZIA 5D49A 3QE9Y 1GNKA 5CHCB 4DJBA 3G86A 4P0QA 3M6VA 1NJZA 2ZTEA 1N5SA 4ELTA 2ZOFA 5B7WA 1GX6A 3UE2A 7ICSA 2OO4A 5D6GA 2B4PA 2JH7A 2LCWA 4PZOA 4P4PA 1X5SA 4DU7A 4ED7A 4NCBA 3HLUA 4JI6J 3QT6A 1Y4ZB 1KOOA 2MQQA 4DR2F 1F6TA 3JSMA 3S01A 4KBIA 4MHVA 5CB1A 1DAXA 3F2DA 2R8HA 5AKHA 4DQRA 1TV9A 1BPEA 3RJFA 5IT0A 1RTIA 4NA2A 3B78A 2HVDA 1VJ5A 5E3CA 3CPWR 2EH9A 4LT6A 2BV3A 1FFGB 4O4RA 3N7RC 1HARA 2Y9UA 2LU2A 1T03B 3CJ8A 1FRXA 3HFKA 1GH8A 3RB0A 7ICUA 3GJQB 1WF0A 4O44B 5HROB 3QFHA 3TUIC 4JI7J 3KLHB 2V8HA 4LFBF 3C66A 1U49A 3UO0A 2BYCA 2JFDA 2K4HA 2JC1A 3CCUS 2EKYA 4CI0B 4DS4A 1BPYA 2XWYA 1ZQFA 2MJNA 1A7GE 1YRTA 1Q78A 5DG8A 1U09A 3EGZA 4FKYA 1L8OA 1YITS 1N5QA 3KHRA 2FVPA 3EZOA 3CCJS 2Y0SC 4GO5X 3H20A 3AOCA 3G87A 2ZWPA 1PIEA 3NUQA 3BJYA 1M5OC 4RQ0A 3I5CA 3NS6A 1U2FA 1ZD4A 3PCOB 3GZFA 9ICOA 4MK9A 1OY6A 2XMVA 1U48A 4A8KA 2NQPA 2F7VA 2BM0A 3HT3A 3TRGA 3JAMU 4B3SF 4ZVTB 3LP0B 5HVHA 2B4VA 1V6HA 5F3ZA 5J0TA 2HHXA 3J81U 4QBUA 1N5TA 2BRLA 3V81B 3DRRB 1FEEA 3LALA 3HHLD 2GMLA 4URSA 4RUCA 4LZDA 3BDPA 1S79A 4P2SA 1FWPA 4NLSA 4CDGA 2RRAA 3F56A 2FC9A 2OI2A 1KL9A 5BJRA 2J7WA 3QX7A 2EI5A 3BYPA 2OAUA 2XY7A 4MK8A 3QUCA 1WEXA 2W43A 1FE0A 2B9EA 3P96A 4LFBJ 2CQ4A 2NRVA 4LF5F 2KHDA 2V6AA 3TADC 3PNCA 4DZDA 1FA0A 5HJXA 2GQ2A 3VGSA 4PGXA 2HSEB 2CN1A 1B43A 3OXFA 2V63A 4Q8EA 3ISNC 3RF9A 1HI0P 2CPEA 2V2ZA 5D4PA 2GMHA 4RW4B 2D7SA 3NRWA 4NLPA 3CMAS 1S59A 5EOZA 1FFWB 1SC1B 1OY9A 1RZTA 2KHCA 4M9GA 1IKVA 4K7QA 2NUUG 2W04A 2VJ5A 1U1PA 1HW8A 1LW2B 4K5RA 2RUGA 3HMJG 1LKZA 2CA9A 5CH7B 2YB4A 5H9FK 3HKWA 3H0MB 3TVYA 2YVSA 2M70A 3KDNA 3FNNA 3CRXA 2R7XA 5FDLA 3FDSA 1NJYA 3H8WA 4BC9A 3G82A 3N5BA 1O51A 4HI1A 3CCLS 4A8QA 2YNHA 1RT4B 3VTIA 4KLGA 4L3NA 5KFVA 5GAEI 5KT7A 7ICHA 4LF5J 3IG1A 4M5DB 2A10A 4CTAA 2LYVA 1JXEA 4BXOA 4WPAA 3GE9A 2EDUA 3PX4A 3ZTSA 4TVAB 2M52A 1VHFA 2XIDA 4F4ZA 2JFKA 3SI8A 3UXNA 2YQEA 3K5NA 2MMYA 9ICWA 5DBCA 3CMES 3DDIA 2YKAA 3ILLA 1IIPA 3H8SA 2DL0A 2NZ4A 1R8PA 3TW0A 2AYMA 5ALTA 5C42A 1T4GA 2W9CB 3PEJA 2BDUA 2MPUA 2PMWA 4P72A 1RISA 1RTHA 5AKJA 1VGYA 4PXDA 3BGOP 4ZITA 4N8OA 1HHTP 3E01B 3M1VB 3NGKA 4CH1A 1UFLA 2YNFA 1BLUA 2BM1A 8ICOA 2VOOA 1SQEA 3RFAA 1L3KA 4J9RA 4K4XA 2UUWA 4QOTA 2H5IB 1U2RA 2K1RB 5DDYA 5IT9U 3WK6A 2H3FA 4I2HA 5A2QY 3BPSP 2FTRA 4ERDA 4C98A 4IR1A 2AJ2A 5C24A 1NUEA 2KIVA 2HBRB 4IH5A 3C14A 2CXYA 5ALIA 4NLGA 3AOBA 1UEKA 1DQ9A 3AXMA 1V38A 1H72C 3L4BC 4RW8B 2CNOB 3CCMS 1FHTA 1WELA 5B0BA 4R63A 5IC4B 2V9WA 2HGLA 2XWXA 2V5HG 3QUQA 4LRCA 3D4JA 3DLEA 3NGUA 3CCZA 1OY8A 3KFWX 4NXNF 1SV4A 2J9DE 2JEFA 4USWA 3FC4A 5L1IA 4I68A 4YMEA 2AT1B 5K8PA 4K4HA 1NZPA 5DQIA 2W25A 1UEVA 1ZYQA 3MC1A 1YJWS 2W2QP 4MFCA 1KTVA 2FJ6A 4IC9A 5FIIA 2M9KA 3EDRB 1HNXF 1ZAVA 2FHOB 4NASA 3TUZC 2JL9A 4RKUC 1ZXIA 3IS9B 3CC4S 2R7SA 2O66A 2K4IA 3DMJB 2F5GA 5LXYA 4AT1B 1UHUA 3E2EA 1MN9A 3OFEA 1TVRB 2JXJA 1SPBP 5LL6d 1TL3A 4M5GA 4WE1A 1RT2B 2AJFE 3FKBA 3IAS9 4ECZA 2KTQA 1TUGB 2R9LA 1UPMB 2GHVC 1UWBA 1SKUB 2XZTB 1HWKA 3OPKA 1LXNA 1EZZB 4MTPA 1ICEB 1AW0A 1DGJA 3IP4B 3C5GA 3F5EA 4KX5A 1O03A 1X6JA 2MLYA 3KKAC 3G71S 5CQGA 3MTKA 4QYZJ 2FJDB 1ZBTA 3HSDA 4MEYA 1Y3JA 4I64A 1P1LA 1FWLA 4NXNJ 1BD6A 4KKOB 2E1AA 1S99A 3QQCD 2LMRA 2EK6A 1ZQJA 1MSWD 4C11A 2HHQA 2XI2A 3M9OB 1BGXT 2FE9A 5CR0A 1YT3A 4AP9A 1YBTA 2IRXA 1CLFA 5D0EA 5ETKA 4RW9B 1HNXJ 1BNOA 3UR0A 1RWMB 1RTDA 2O01C 3CXCR 4P4MA 2B9XA 5FP0A 1YJ7A 4C48A 1YGYA 4WZMA 2CNLB 2YNIA 1Y0HA 1WSRA 2Y8WA 4DV4F 4LF9F 3LVWA 1FD8A 1CRXA 4R66A 4H4KA 4NI2A 4DV0J 3OR2A 1CJVB 4OJ3A 2OFGX 3GR0A 2YKQA 3HDSA 3BR8A 3DLKA 4B02A 3WK8A 1S6PA 2JHEA 3C6TB 3RJKA 2MTLA 8ICFA 1CJUB 2PFNA 1BQXA 2G06A 4MAKA 5A6WA 1IM6A 3CJRA 5HQLA 2XEXA 2RDIA 4C4SA 3DDKA 2CFXA 3PR5B 1RI7A 2F1HA 2OPQB 3HT0A 3MM5B 2MEWA 3AD9C 3OXLA 4NE9C 2Q6CA 3VCBA 1PVPA 4I29A 1XN9A 4R5PB 1GMVA 1ZA2B 4J9MA 1PC5A 3R3TA 3W63A 3QGIA 4IRCA 4OI3A 1R0BG 1VRUA 2KT2A 3TA0A 3FBBA 4HTJA 2YWWA 4LVOP 4QZ9A 2FMPA 3CJ0A 1XNQJ 5KFHA 3NWGA 2R42A 2D3OR 4WIIA 4DV4J 4LF9J 1NPPA 4DX7A 3SYZA 4H4MA 2XNQA 4WU3A 1TFRA 3H4BA 2ZJQQ 4Y28C 4J9LA 3I5AA 2DR8A 3GSIA 2OKQA 3C1YA 1WTFA 4EBDA 2MKKA 3ZTPA 4ACOA 4DSEA 2WVCA 2BACA 3K2YA 4U9RA 1F2GA 1T3QA 2FDNA 2KICA 5AK3A 2DNOA 3GSDA 2XMKA 2HLUA 4RO0A 2H9ZA 3KTQA 3OL7A 4ECUA 2LKZA 3NMRA 4FS1A 4KGMA 1VDHA 4FBTA 4X4QA 3AHPA 4ZPWR 2VG7A 2E29A 4P75A 4G1IA 4TU9A 2UV8G 2KM8B 4DR5F 4MYUA 4NXZA 1Q8KA 4Y6IA 1NK9A 4DR3F 5AJ3F 3DLGA 3ET6A 4LRAA 4FNIA 1RDFA 1RDRA 3M30B 1JUDA 2IBKA 3T5KA 3BS9A 4YN3B 4NYZA 2IRUA 3J7Z5 2VASA 1UCNA 1TTHB 5J2PB 2XS2A 4QZCA 3W64A 4X66F 3ENWA 2LEPA 3DRSB 3IV6A 1GEHA 1QE1A 5M2PA 1U1MA 1R0AA 3H4DA 3JPQA 3PTWA 4NWIA 3O8WA 4ZPAA 5KT5A 4C8NA 2BJ9A 7ICLA 3FSIA 1FVQA 2ROGA 1ZTWA 4DV2F 3KLEA 2B6GA 2A6OA 3BZKA 2WVFA 5E3QA 2GAGC 1IR1A 2KG0A 3D6FB 2NV3A 1H38A 3RR7A 1TV6A 2GO8A 3LP1B 4C3LA 5CA5A 3C28A 5C2GA 1T0TV 8ICMA 1PK1B 1TL7B 4DR5J 2V4JA 3VAJA 5EN1A 4PABA 2DK2A 1LB2B 3M7VA 2MQMA 3UVJA 4DR3J 4G6VB 1DTTA 5AJ3J 4DV1F 1SUQB 3FZBA 2B0CA 3ZZRA 3UD5A 4YVZA 1KDNA 3SD7A 1H2VZ 3CB4A 3C6UB 5CYMB 4P10A 2WBMA 4ECYA 1AZSB 4IQWA 5ETPA 5K9FA 2Q0ZX 4CO5A 4YXJA 3SZ2A 1L5UA 2DNNA 1PYOB 4URGA 1CC7A 5TZVA 5JVGQ 2M8DB 3IHQB 2MZTA 4Z6DA 1SJQA 4X66J 3W5XA 9ICAA 2JEJA 2DNQA 1TKXB 1VIOA 1TKDA 5DQGA 2VIHA 1U1RA 2RE1A 5GMKa 1Y5IB 3KJVA 2O67A 3EZUA 1ZQTA 3N6MA 3TARA 1RHUB 4NCGA 1D09B 4DV2J 4F4XA 1QAYA 4Y2MA 1D1UA 3MZIA 1T03A 2AU0A 2KJVA 3NBPA 2VG6B 4O44A 3R1LA 1GMWD 1X4CA 3CMQA 1SL0A 1RWWB 3U1MA 2RH3A 2PFOA 4HAIA 4MFBA 1U0HB 3HHDA 2XI3A 3KK1B 3ETLA 5CZVA 2AX1A 4RQ7A 3L09A 1HW9A 4X4OA 5AI8A 1RT7B 2CG4A 4DV1J 3SBMA 2AV5A 1HNZF 1R89A 3P4UB 3DNCA 3SEIA 4DFDA 2DJWA 3GU3A 4BUGA 4OV1A 2DGXA 2HBYB 3UMGA 2KMDA 2I5HA 2WHEA 3QRRA 4KY3A 5D78A 2IY5B 2VA2A 2BABA 2K8BB 4LUBA 1VRQC 2KP7A 5M2UA 1GTEA 1NJXA 5ALYA 2ZH1A 1WYGA 2F9JA 2DNLA 3EE3A 1SXDA 2OWOA 9ICBA 4WTOB 3ZDCA 2H5JB 1V3SA 4CLKA 2XG8A 3HVAA 4HR2A 2MZ1A 1DFDA 4QR1A 1RA7A 1QAIA 4AXJA 3DOMB 4JBCA 4R25A 3V81A 3QRPA 1LWEB 1M5PC 2FY1A 2BJ3A 4F3MA 5HP1B 2OEMA 1CVJA 4K0KF 5ALXA 1FERA 2BRKA 2FZKB 2CPYA 4ED1A 4TUPA 1FDNA 2BPCA 1SI9A 2ZUAA 4F72A 3CUNA 1U9LA 4OQJA 2KEYA 3QJLA 4NJ8A 1KR4A 2YWFA 1EXNA 1KC8T 2VIXA 5A8RA 8ICJA 3CCES 1HNZJ 3ISBA 3DYAB 2ZBPA 5J1EB 1I6JA 3NTUA 1I51B 5J2NB 3LO3A 2JJ4D 5HVFA 1HBNA 4HACB 4DCOB 1TL1A 4I2DA 4GVBB 2CQ1A 2VFUA 3KWMA 5KG6A 4PL1A 4DCJB 2ATLA 2J9DA 4NLOA 1UCVA 1JMTA 5CA7A 2MXYA 3M8PA 4WKYA 4KLMA 2G2ZA 2WB1D 3DI6A 3DFEA 1ZQRA 2MKHA 4CLSA 2IYIA 1NZ8A 1F5BA 2C2KB 2EKNA 2ZIXA 1FVSA 3AJDA 3W8GA 4K0KJ 2ZH2A 3JAMY 4B9UA 3MMAB 3KLFA 3I82A 1Q8LA 2A1AA 2W24A 3DU5A 4YXMA 2RF2A 3J81Y 3C19A 2UV8A 4USUA 1FXRA 1LV5A 3K4GA 4WJBA 5CP2A 4JB8B 2KSOA 5HQMA 4H54A 2C2RA 2V68A 3MOZA 2FPHX 1AUSL 3RRHA 4C97A 5AM5A 2KM8C 1R8CA 4MIAA 3DKDA 2C3UA 2ZOGA 1KD1T 2IMWP 5D15A 2QB0A 3TX8A 3N5FA 7ICVA 1RHJB 1QLNA 2YKMB 2KL8A 2FLNA 4FF1A 3KDOA 2D8CA 2ZDPA 1N60A 4UAYA 2ZVIA 1QTNB 4DV6F 3GG1A 4RQ1A 3GU0A 4I6AA 1WACA 2F1FA 1B7YB 3MCOA 3K1RB 3CDAA 3ZFVA 2D41A 3IM1A 3JPOA 4DOBA 1CULB 1U7LA 3E01A 1BWVA 4NLWA 2XMAA 5LMUF 1VBKA 1WKJA 2UVWA 3M1VA 3HK2A 1FX2A 3I4PA 4I2QA 1TQLA 4FVMA 3IFEA 3JYTB 1C20A 1JLAB 3CJQA 3OLAA 5LXRA 2K1RA 3M4XA 4M8LA 3MD1A 2X3DA 5AI9A 2E9TA 3TR5A 5SZTA 1ED1A 1K1SA 1V9PA 4C7ZA 2MB0B 2Y3YA 5B66U 1U8SA 4LF1A 1UEUA 2B5JB 4RW8A 2WF5A 3EXCX 5KFNA 4IDKA 1RWKB 2GX8A 2IVFB 3EVMA 1AXQA 1CEZA 4LZGA 3LOUA 1LK7A 3FAHA 2Z30B 5AXKA 3FYHA 1FWKA 5HBMB 1TMJA 3P8BB 3IRUA 5KFFA 1X4GA 4DV6J 5EWEA 3P45B 4NA3A 3WKEA 3HVRA 1WCLA 5E3PA 2R7UA 3H7HB 3Q8QB 5G4DA 3UCZP 1KLNA 4A48A 1RJJA 4Z7YA 3T79A 4LIRA 3LAMA 3FC9A 4F4AA 1JLEA 2HNDA 1S1XA 5LMUJ 3PW5A 3IBCB 2ZXIA 3WBZA 1MLAA 3FQKA 5HATA 4CNQA 1NK4A 5ALPA 5DS7A 4NM2A 2MLXA 3M2VB 4OZ1A 5A6PA 5AM0A 2R8JA 1I94F 1HKAA 1KBUA 4CLZA 4E0DA 3AQPA 3IR6B 3L7PA 2DNYA 2FLLA 3GIRA 3W61A 1QM9A 4YS2A 2K2PA 4CNYA 4DPUA 1KBRA 4YFKA 4CF5A 3SR6A 4OLOA 3MD3A 3QWUA 1HBMB 5IT9Y 5HL7Q 3DOLB 2CAJA 4QW9A 1U1LA 3HKZF 1FJ7A 8ICGA 3DDNA 3IRWP 4KKOA 2RS8A 2JVOA 5LSLA 1FESA 2AJ1A 2R7QA 3O3LA 3BN7A 4MJKA 2B21A 2XBPA 4PG7A 2PFPA 4C4RA 1S6QA 2H51B 2OTJS 1T9UA 3W1YC 5IIIA 2W2NP 5HSPA 4LVNP 2UUTA 1HIYA 3UR3C 4P2MA 2CQBA 5ALRA 2VPYB 8ICAA 1HNWF 3SMZA 2AGOA 1B22A 2CYYA 1SXEA 3NCQA 4PWDB 4QZGA 4OZNA 2EFNA 5T7LA 4EX6A 1TMMA 2HVIA 1O08A 4ZP7A 3DRPB 2L9WA 3PKYA 5L46A 3W5YA 2V69A 2EFPA 1I94J 1K5OA 4HTIA 4Z2XA 2BA9A 4Y65A 5KG7A 3KZXA 2ASYA 4DX6A 1UP1A 1HMVB 1D8BA 2ZJPQ 4F25A 3BF4A 5H9EK 4L75A 3S1TA 3RJGA 2VD3A 4OJPA 4ZVQB 3MEEA 4DL7A 3IR5B 1CJUA 3M8WA 2Q6BA 4O3OA 3IR7B 4YFUA 4J9PA 3HSGA 1MU2A 2ZJ8A 1TP7A 2OYYA 1UVLA 3BGUA 4LBPA 4KLEA 1ZOTA 2L9DA 1NMEB 1SV0A 4MIWA 4DDFA 1FDAA 4DL3A 2UVRA 1TZ0A 5RUBA 4DS5A 2DY1A 2XHWA 3J80U 2MKIA 3D3CJ 1VRTB 2KHQA 3GFXA 2HYIB 4O23A 1SB3C 4R5PA 1UPPA 4EO6A 3HP6A 1Q5YA 2LQ8A 2GS8A 5D3GA 1SZPA 2ZH5A 3UD3P 4TLQA 2N4CA 3OR1A 2ZH3A 4UF4A 5AT1B 4U6PA 4I2GA 3I9V9 3BR9A 5GTIU 2FZCB 1WD6A 1TFYA 4O5EA 2BOAA 3VCDA 2Y0SD 2G2OA 2UU9F 1HNWJ 1HD1A 4OZ2A 4TQSA 2QTWA 3AJ2A 4ELVA 1RCXB 5ETTA 4ZVOB 4QZFA 4B3OB 4QZHA 4UAWA 1S1UA 4BWJA 3K5LA 2Z2ZA 4P7VA 3PIOQ 2MGZB 4DX5A 4KYZA 1AA1B 4K4YA 2ZH4A 4C6AA 2RQMA 5M2RA 1ZPWX 4PG5A 3E58A 4ED0A 2KVIA 4ID8A 1RTZA 2BJEA 4OZ3A 5IZHA 3GZ7A 5DG9A 2MHEA 2XMWA 1AFIA 2M2BA 2ISOA 3AT1B 3OLBA 3QU4A 3NLCA 3Q89A 3EMTA 3V7JA 2OLWA 3UN3A 1IUJA 4EEYA 3ORYA 4F5OA 5F41A 2V2VA 1TKTB 2H5EA 1KP6A 3LWLA 2DNZA 5GAHI 2A2DA 3W62A 4IR9A 2ZBRA 1UZDA 1B4SA 4UBBA 2EW9A 4PHPA 4W98A 2HQFA 2XCPA 3JPRA 1OWXA 1RADB 2FMQA 1Q7LB 3A8IA 4O3QA 3I76A 3ISND 5A8WB 2H4YB 4ECVA 2DRDA 3RRGA 4QWBA 2PMZF 3MECA 3D6TB 1RKIA 3P49B 1TU0B 1LWFB 4Y34A 2NREA 4RZRA 2I2YA 3J7AN 4GIBA 4WKRA 1RAEB 3WK5A 5KFXA 2DNPA 4KFBB 4QWEA 3NXZA 5C7PA 3Q0AA 4ZN1A 5DDMA 1G3OA 4PGYA 5J2PA 3CJ3A 3AQFA 1NJIT 1A0PA 4K4VA 4PEOA 3N4WA 2YXLA 3OHAA 3SAGA 4XTTA 5IQ6A 5AKKA 3ETRA 2IRYA 2G0AA 3EW9A 1U24A 1IKYB 3IP0A 4LBHA 2QYGA 2ZXHA 1XMQF 3BKTA 3BS5B 3QT7A 1HR0F 1W2IA 1FTRA 3QMQA 3R5JB 2NUHA 2ZE2B 1S4EA 3GPAA 1OIAA 1ZM9A 1XR7A 1RU2A 4RUAA 4ECRA 4FYDA 2KU7A 1YJTA 2QMWA 3QGHA 1OYDA 5ALFA 2RRDA 1RWPB 2C2MB 3TNVA 4I7FA 2I5JA 4R8UB 2U1AA 3RB6A 5I4MA 4M5HA 4FYYB 3FBFA 1SL2A 2MLZA 1LKYB 3R5BA 2Z2MA 2BANB 9ICFA 5A8KA 2W4CA 5KFAA 4DOAA 5KFZA 5EX3A 3AQOA 8ICUA 1LWCB 1TKXA 3ELHA 2HHHF 4PKDB 3B4MA 5CYQB 1NM2A 3JS9A 3ZO7A 1M5KC 4LQ9A 1NBEB 4ITSA 1KVIA 2Q43A 3MPWA 3MMCA 4IH6A 5L1LA 4DO9A 2L9NA 4ZDNA 5EX0A 4Z7CA 1JLFB 4JB3A 1XMQJ 1HIWA 4FPRA 2FYXA 2QARA 5HQ8A 4NRUA 2VG6A 2XSJB 1HR0J 3A3NB 2PFFB 4GRSA 5K8NA 1YHQS 3HVTA 1S1WB 1U0HA 2AQ0A 4CO3A 1FRIA 3KK1A 2HCFA 4ANDA 4Y2IA 4LFCF 4ID5B 3RJMB 3EGNA 4DV3F 4DFKA 2EVZA 2KZZA 3PFOA 4DMZA 2M7SA 3QU5A 3MMBA 2WVDA 1ZD3A 4OI4A 1WC4A 2JHDA 1VQOS 2IJNA 1UKUA 2P66A 1SJ1A 2KB2A 1DURA 3M05A 3WIUA 5ALWA 1F9EB 1X8DA 3BYRA 1UW9A 3OVAA 2JX2A 3H90A 3BQ2A 4HH0A 1KKXA 5HANA 5HJYA 4FF3A 2OMLA 2XMTA 3TP2A 1HPZB 2IM0A 1U1NA 3CJ5A 2XM3A 3MBYA 4G1QB 2ZH8A 2VHGA 3KK2B 2DHXA 2LYHA 3QU9A 1Y11A 3F53A 5B0AA 4KC5A 2XLIA 4ZVFA 3PDNA 3BO3A 1DTQA 2MAXA 4KO0B 3UNGC 1WKLA 3RBZA 1X4DA 1M5VC 2VH7A 2GNKA 3KBBA 3PJWA 4KAIA 1FO4A 2F9DA 1WI6A 4GKKF 2G5IB 3QBCA 2KV2A 4LFCJ 4DV3J 4QZ8A 4K4TA 2EZYA 5K14A 1KQSR 2BKEA 1SQGA 4D3HA 3BB5A 3KHGA 1YJVA 1IBCB 2XS5A 3NNHA 5J2NA 5CCMA 3D68A 4QIVA 2W8LA 2EFQA 4ILMA 3IWNC 3M2UB 4F02A 1WORA 4WFBQ 4LREA 3C1ZA 4O3NA 2APOA 4JV5F 3TANA 3T1AA 5I3PA 2GA7A 3F0NA 3FSXA 4C8KA 2VQFF 5D4BA 1X9WA 1RA6A 2HZCA 1D8LA 3GV8B 1IR2A 4MIBA 5DDRC 2UUCF 2XY5A 3PZPA 3CCVS 1RBOB 2RKIB 3MHYA 3K8VA 5T41A 4U67Q 3CD5A 3D0HE 3T1YJ 4ZLNA 1A9NB 4UB6U 3SIPB 3RBDA 3RH6A 3SDEB 1ZAWA 1N63A 1AFJA 2RILA 1U4BA 1GXLA 5KFJA 2KXFA 4DOZA 1TAUA 3ULHA 1YQHA 3HFVA 4GKKJ 2P2CB 1N5YA 3CIMA 1PK3A 4RL1A 4FS2A 3PY8A 3SENA 1C0UB 2HZAA 1IKWB 1VBXA 1EB0A 3BS7A 4CYUB 2KKVA 2R7RA 2FVCA 4OD0A 4C3MA 5KFUA 4B9SA 4ECQA 2CZ9A 3GYGA 1ZQZA 3H2VE 1TELA 4JV5J 3C2MA 3T6BA 4I2BA 3JPTA 2WONB 2MZSA 1TUWA 2AEMA 2NXCA 3R5AA 2VQFJ 2HHWA 2D3O1 1ZQGA 2VZ9A 1CULA 3O5TB 3FUYA 2Z56B 1LFWA 2XZDB 4W90B 4IYQA 4ZJLA 1JB0C 4S0MA 3JSMB 4F0MA 1RYUA 1KN6A 1RHQB 1JLAA 1VDVA 1JIHA 2UXCF 3MEDB 3MAAA 1RTIB 2DKOB 1WHXA 4OCZA 2ZTDA 3G4SS 4DXLA 2GJIA 2DIVA 1ZQHA 2NZCA 4YY3J 2VA8A 5ETMA 3K8WA 5B0EA 3UPFA 4L6V3 4XQ8A 1CPZA 4CWBA 1K0VA 1IBKF 2E9RX 4FP9A 3NNAA 4ED4A 1HWIA 3OXGA 3CULA 2RHQB 5GAHU 1U02A 8ICRA 3V4IB 3OTEA 4L74A 2F4VF 3GTYX 2QLXA 4OJ6A 3O2IA 1PJ5A 2G0JA 4P0PA 4ZOHC 3OUYA 1NHVA 2EPIA 2C3OA 3PW4A 2BXJA 2CPHA 5F3TA 4WP9A 2F76X 2W55A 3R27A 5HMXA 3PW2A 1TK5A 2F40A 1M5HA 1HI8A 2F1JA 1L3VA 4OJ1A 1Q7YT 5DKWA 4USTA 2J0QD 5ALHA 1H74A 2E5GA 2W11A 2O5DA 3PVXA 2CQCA 2K4EA 1H3DA 2W9BA 1Q4RA 2JEIA 3NCPA 3Q8MA 2UXCJ 4OZLA 4ZVUB 1XTZA 3NRZA 2G0CA 4WCEQ 1SJRA 4FZVA 3D6JA 8ICPA 3F44A 4Y2TA 3PHTA 3G6YA 1R27B 3ENVA 4W4MA 1IBKJ 2RS2A 2VKZG 3G8SA 3BQ0A 2DPJA 4YHHF 2QLBB 1UTAA 9ICSA 4BDPA 3LDAA 3MM6A 1S9EA 1U0SA 2F4VJ 2WW8A 3T1HF 2XCAA 3VAMA 1S0MA 1R8BA 2JH3A 5AK5A 1KN5A 2HSZA 3R5GA 1MWYA 1X2IA 5J2CA 5MLCV 3WHIA 2CNKB 4KMUA 2AP6A 4JI3F 3C2LA 4YD1A 1WDTA 9ICUA 2KJWA 2K60A 8ICLA 5GVQA 3ZZPA 3HKZC 2HIYA 2GLEA 4IO1A 3ZTOA 1X5TA 1BWEA 4OZ5A 3LPEA 1RB0A 4M9NA 2E66A 2DCLA 1P9YA 1O5JA 3VGVA 5C2CA 5ETRA 2OHDA 5J2AA 4KLOA 2AZ1A 4I6YA 3EXYA 2Y9TA 4JOUA 2ZHBA 3MAQA 5FDLB 2ISPA 4PWWA 5KAIU 3WKAA 1QTMA 3CC7S 3G82B 3Q8KA 4N47A 3JSBA 1Z4OA 2DNRA 1YJUA 2ZUGA 3Q2SC 3HULA 2C1EB 4YHHJ 2P6TA 2HOQA 1VHIA 2YQ3A 3IG1B 3EGWB 1ZOLA 4CTAB 2DCUB 4BXOB 4IFVA 1S4FA 3D67A 4CF4A 3T1HJ 4W92B 2JZBA 4JK1A 3THVA 2OSRA 2GGPA 3U26A 2I8EA 5LMNF 1AUDA 3JB9k 2DXDA 5B5EU 2P9GA 2ZOMA 4RWXA 4KHPJ 4AYBF 4UY8T 3N28A 4RW6A 1N0UA 1P7DA 4UAZA 2AXTU 4QJFB 4UZBA 4H4OA 2QL5B 3JPNA 4QNLA 5CD4A 2ZTCA 4I2IA 1RSCA 2XTJP 1IBLF 1S7IA 5KFPA 2E8NA 4O0IA 1RTHB 2DEJA 2BZ2A 1L6NA 4B9LA 1ZQNA 2VANA 2C2NA 2DGTA 4Q2LA 2QB1A 1ZZNA 2FB0A 2H3IA 4HEA9 5EWFA 2ZG6A 3VALA 2MGZA 5HMYA 1VQSA 1RTJA 2XMMA 5DM6Q 1JQGA 2CJBA 3M7DA 3P5BP 2RAQA 2HNZA 2JLGA 2IHMA 2HWTA 2QLJB 4FYWB 2BJ7A 4X4NA 3RW6A 4LF8F 4OHYA 2WAQF 2HQIA 3PRVA 5C24B 3C14B 4AQYF 2WZ1A 5JUMA 5BXIA 1TKTA 2W1BA 3UN2A 1BQNA 3RB3A 2HMXA 3MMJA 1XSLA 2E1PA 3M6KA 2QYCA 3HHNB 4MKVA 3OFHA 5LMNJ 1UPHA 2R2RA 3DLEB 5CD4H 2FJEB 5D8HB 1ECWA 1SH2A 2K89A 2V67A 1QDUB 1S49A 1BXNA 1E6YA 3VR1A 2EBGA 5L1MA 2F8MA 4OMFG 3J80Y 1FKPB 5AKZA 1DHMA 1YRXA 1UJ4A 3TA1A 4Y0FA 3H98A 1IN0A 3LUYA 3TZZA 4FKXA 1U47A 3C3LA 2MJUA 5J8YA 2UP1A 2LEBA 2H3EB 2OIHA 1NB7A 4TNOA 5E0OA 4NMXA 2EEYA 1F5SA 3CDUA 1F3FA 4N41A 3E3XA 4U95A 1J97A 2JDJA 5C25A 2MDAA 2PMZC 1OQ3A 2ZH9A 1NXIA 4KGVB 3PHEA 4RQ4A 3EGVA 2IM2A 2QN6B 3R9LA 3CCSS 1UWBB 2J5AA 3A3PB 1FK9A 2FD2A 3DGPA 1H2TZ 9ICIA 2KYXA 2HNYB 2DQNB 1H98A 3S8SA 3ZDBA 3R2CJ 1FIQA 4NEZA 2A19A 1CG2A 5KT3A 3CNQP 4MF8A 4Q7AA 2EK1A 1I5OB 2ZE2A 4C0ZA 3LTOA 2WSFC 1FKOB 1OSDA 1RAFB 1X7VA 4P6QA 3WC2A 4C11B 2GFFA 2KKHA 4CRXA 2RLTA 2ALZA 5IOLA 3FEXB 2VJUA 4B17A 1LKYA 1GQEA 1RZMA 1RAIB 1T9YA 3QPIA 4EZ6A 2PXIA 5FLXU 5AICA 2KT3A 4HL9A 2BE7D 3MPVA 2YNIB 5JJBA 1LWCA 4BJQA 4FFDA 4RBUA 4JI5F 1H6KX 3GP9A 4OHWA 4FXVA 4PCQA 1D3WA 2ZD1A 2XICA 2OHFA 2OD6A 5IQQA 1VFJA 4NI2B 4LMZA 1FTCA 3PX0A 2GJFA 5ALKA 1XS9D 3DLKB 1ZQBA 1S6PB 2I9SA 4PJ0U 2HS3A 2HFZA 2KKPA 2HMIB 1ELOA 2ZWOA 3THTA 1WUDA 5B0GA 1NPKA 2E5LF 4NLBA 3I32A 3NGSA 2OXOA 1IVZA 3FVYA 4ID5A 5KFBA 2C2ZB 1COOA 2HOIA 2VFRA 3M1YA 4ZP6A 1RWNB 3MM9A 1OQ6A 5AI6A 2KVSA 2KH9A 2EZZA 2EANA 1ZQUA 2BCSA 3G6VA 1N61A 2W01A 2ZIWA 1YZ6A 3LW5C 1VRUB 4YR0A 2B8PA 3VAFA 4HHJA 3RJIA 3SFGA 2MKSA 3RGIA 4EI2A 3CDEA 4RQ8A 3BGRA 4ED2A 3RAXA 2ZBQA 2X1FA 1AQ6A 4V19J 7ICMA 2XSFA 4GLXA 3GYXB 3Q8VA 1EJ7L 4P4OA 3GCXP 3HHEA 1KFDA 4JI5J 4MK7A 4H4MB 1C7YA 3ZZYA 4USVA 4GXIA 4G1QA 1XERA 5DLGA 1U26A 3KK2A 2W03A 5KNIA 3G96A 2DY9A 5HMLA 1XMOF 3EUNA 1JJ2R 4PHEA 3G8TA 2ZUDA 5ITHA 2PC6A 8ICHA 1W2BR 3Q86A 2E5LJ 4UTGA 2UUBF 1M90T 4UW9A 4LF7F 2OSQA 2D3UA 2F63A 3QU7A 2CDQA 2OPPB 3GONA 4KQZA 5F8IA 2IHR1 4DV5F 3NAHA 1ZS6A 1V5VA 3VZHA 5KTQA 1S10A 2OELA 1MWQA 4F7VA 5ALDA 2FHJA 1VQLS 4HT5A 1CJKB 3N79A 5CYJA 3R7SB 2KFZA 5J2DA 4F0HA 4BC7A 2KHVA 5JU5A 3QLHB 3DLGB 4ICAA 3ZC4A 2G13A 4RU9A 2IM1A 4KLQA 1XSPA 1REVB 3GQCA 5BYRA 2HFSA 3TAQA 9ICLA 5HNKA 4KHMA 2YKNB 1Z2ZA 3B4DA 2RQ4A 4QWAA 1NZBA 1FXDA 1OJ4A 2XLKA 4F5RA 4NZ0A 1WJ9A 1MQ2A 4MKAA 3T19A 2BCVA 1SKRA 2B43A 4F5PA 1HQEB 1G4CA 1EKSA 1XMOJ 5E3AA 1CQNA 1MW7A 5J0SA 3SDEA 4AXIA 2Q4TA 2UUBJ 4B3RF 3T5HA 1H7WA 3KLEB 1YSJA 2EG2A 4DV5J 1Y88A 2HBMA 1J5EF 3TACB 2QJ3A 1D8YA 7ICGA 5ALQA 1M1GA 8ICSA 1NLKL 5DETA 2W4DA 4FF4A 2B6AA 4FYXB 3HX0A 4RU2A 5CJ7A 2SXLA 1PAEX 1K47A 4K8RA 3AD7C 1SIJA 2YPZA 1QJHA 5HAOA 4QYZK 4NRTA 2LDIA 2NCKL 1Y00A 4ICLA 1Y10A 2AGQA 1DTTB 1M5SA 2XNRA 2VBYA 4ANEA 1RE1B 4DUTA 4M1KA 5J2QA 4ED3A 4PPZA 2W4PA 2F3NA 3JTOA 3RJJA 2ACMA 1VQYA 3HM9A 2WONA 2E1EA 3OD2A 3VVUA 4EGLA 2MKYA 4KPYA 3WZ0A 1XO1A 1Y7PA 2KRRA 3K5PA 2K06A 3W9HA 2AF6A 1RT3B 1SCJB 4CH7A 3JQJA 4KH0B 4M6WA 1WC1A 3OGUA 3V6DB 3PSIA 3FMBA 2ROPA 4OYPA 3KJVB 3SXLA 3KG0A 1FFSB 2ZITA 1TL4A 3MEDA 4M9JA 1X66A 2KI2A 3MUTP 4B3RJ 3AH6A 1AROP 4NCGB 3B6BA 1HFEL 2AYBA 3I6PA 1UAWA 2QE5A 1CUKA 2PFDA 1J5EJ 4CO2A 4WBFA 4ZIVA 1N34F 1SH3A 4FZLA 3NBPB 4F04B 3RG6A 2QRRA 3K59A 1N2XA 2CNNB 4IOBA 2Y8YA 3CDWA 4MFBB 4HH1A 1UJ6A 4FN5A 2EAOA 2VFTA 3LAKA 2MZQA 1NKBA 3V4IA 3U27A 4NY8A 3HI9A 4QIWF 5HR6A 2LA4A 1Z4UA 2FHMA 1FNXH 5IM0A 4EFAC 4ZP8A 8RUCA 2ILYA 2F8LA 3OPXA 1VJQA 5ALLA 2L41A 4Q45A 4ZPTR 1LOUA 3HJEA 2HQ3A 2FY8A 1IM4A 4M94A 4TQRA 2NXJA 1HQ2A 3QFWA 1EP4A 4WFYA 4NXMF 2CKWA 3QRQA 3QIPA 2QT7A 2ADBA 2AGPA 2H3ZA 2CJAA 2DWQA 1FNMA 4C7YA 3GG0A 3TKAA 4QU6A 1X5PA 4KGKA 4H4KC 2JRSA 3OTQA 1PCAA 3KK3B 5HN0A 4CE6A 4L72B 1S5ZA 2PI4A 3AN1A 1UVJA 2OEKA 3BPDA 1XNSA 1HWJA 3J7A1 1HHQA 1NKEA 5IS2A 5GADI 2IA6A 3PG9A 1N34J 3W9JA 4DHVA 4J9KA 4KLUA 3FM9A 4K4UA 3LYSA 4Q5VA 1T3NA 2FGCA 3IG5A 5I3QA 2MYFA 1F5CA 1N6QA 1U1QA 1HHSA 2FDRA 2RSQA 5A8RB 3LK9A 2DHHA 4U8YA 2HEKA 4F71A 5ETNA 2C28A 3K0JA 2HQGA 2I9GA 3DXSX 2N82B 4EEKA 4UUWA 2BW7A 1SWVA 2HBLA 2HBJA 4C2MA 1D9DA 2AD9A 5J2GA 1HBNB 1Q1KA 2FJXA 3NGRA 4TKTA 1TL1B 1Z1BA 3QNWB 4NCAA 5KT6A 1M0SA 4WXOA 5F8GA 1TKZB 1HA1A 4QZBA 4NLQA 4Y2JA 3PRBA 3RAQA 1COKA 4KH1B 3CSKA 5DQHA 2OTLS 1U45A 4CO0A 2EAPA 3IG8A 3C16A 4NXMJ 3HSJA 4HKQA 2DR9A 2F2AB 2UVUA 4Y2QA 3M8PB 1MN8A 5KG3A 3QAEA 3DI6B 1HQUA 1CSJA 4IG3B 5B0FA 3KD3A 5JVHQ 2DB1A 2NSCA 2I6XA 4OYBA 4C9DA 5C5JA 2ZIXB 1RQNA 2ADCA 4DPYA 3MI7X 4KLSA 3CDBA 1LW0A 9ICMA 4KTQA 4Q2MA 2ZH7A 3KLFB 1VLBA 3W8PA 4YD2A 1ZA1B 3H0RB 3TEHB 2RF2B 5A0YB 4JV2A 3GIIA 3FEYB 5KFSA 1VQNS 4A8OA 1DRZA 4GFJA 3HJFA 1B99A 1X42A 2RU9A 2KSOB 3AA8A 4ETZA 4URQU 1A6LA 1IV8A 3TEGA 2KOBA 1OS5A 3QGPA 1Q5VA 5DZ6A 5AE2A 3MFHA 3PJXA 2FJVA 3K5OA 2QB0B 2JV3A 5KFYA 2DD8S 3H8JA 4UARA 1DZ5A 1QUVA 3PW0A 1RYRA 2OPSA 2R7WA 1WC5A 1U8WA 3DU6A 4M63A 3HHLA 1R43A 3TAMA 1C1CA 3FEZA 3DLJA 4K4ZA 3EM1A 3CC2S 3LP2B 3QT5A 2ZH6A 1ITPA 5ETOA 7ICQA 1JI7A 5ALUA 4YB5A 4M5JA 4B3MF 2DR7A 4X4PA 5B09A 2GIRA 3HW8A 3PYEA 3R7BB 2DH8A 2DEIA 1RAAB 2AW0A 2FJBB 4DR7F 4AYBC 4JYAF 4I2QB 1HYSA 1KNZA 4JI8J 5GTHU 3CJSA 2Y9HA 1PG5B 4FZNA 4I2PA 2RRBA 1ZM2A 4USMA 3JPPA 3W60A 4LQ3A 1DY3A 2RT3A 3FK4A 1R3NA 3MEKA 1YVFA 2HIQA 3KUGA 3IGVA 1FI4A 1RACB 4X4RA 1VLOA 1IXRA 5AKIA 4IQTA 2I38A 2UXDF 5ALNA 4IDKB 1C4CA 2CPDA 3HO1A 4IKAA 4F5NA 2VU5A 3OTOF 4DWIA 4Q8FA 2FQQB 3H8MA 2NS1B 2ZZMA 1N5VA 7ICTA 1FKPA 2XZWA 1RQ0A 4KGZB 1PUZA 2ZIVB 1QY7A 2J9EA 2WAQC 2BPGA 4A46A 2CIMA 4YN4A 2AWZA 1S1TB 1BHNA 1JLGA 1URRA 3CW2C 1R7IA 2WB4A 4P71A 5LT5A 1KHVA 4B3MJ 2JVRA 2QLFB 2H3VA 4PQUA 1JLEB 3TWZA 3PJ9A 2HNDB 1FDBA 1S1XB 4IG0B 2CQPA 4DR7J 4JYAJ 3OTBA 2K7JA 3OL8A 3UQ2A 1KLMB 4UB1A 3N7PD 1RAOA 1IKXB 3MGJA 2PGCA 4DV0F 2RB7A 5I42A 2PSZA 2VKQA 2NPIA 2F65A 2LQBA 4FXDA 1ZQSA 5J0OA 2GQCA 4RPYA 1VIXA 7FD1A 2VBXA 2HNYA 1RABB 1PILA 2YNGB 2CJKA 2W3RA 2ZUBA 2UXDJ 1WC6A 3PYDA 2HVHA 4JI4J 2QC3A 4YMMA 1KQFB 1FFUA 1RBAA 3M6WA 3OTOJ 4Y2XA 2O3DA 3DHWC 4PXCA 1FKOA 4N56A 5F8NA 2ZJRQ 4R0JA 3BREA 3IBWA 2OCEA 4KIAA 2BJ1A 4J37A 1SC4B 4JI1J 5A2QU 5LM7E 3FQLA 2UUAF 2IBOA 1S6QB 3ISZA 1WG5A 3R9KA 1BPXA 5DB8A 4YP3A 1OPIA 1RM6C 2IJRA 4LSNB 1S9FA 6FDRA 2POKA 3N01A 1F5AA 2PT0A 4QWDA 3I55S 1XNQF 3X1LB 4CZCA 3ALRA 2BEFA 4DCCA 3LANA 4NZ6A 5LSRA 2O1PA 5T7LB 1KW4A 5CZXA 4O4GA 4HLBA 4YG2A 3QZ7A 3BGFA 1EQMA 4BHQA 2BCRA 5JXSA 5IV4A 3RJHA 2H48B 3UM9A 3OVBA 5DDPC 4E98A 4WP8A 2GO7A 1X4FA 2V8VA 2NRTA 2DR6A 3NL0A 2HMIA 5A76A 3MEEB 1SXLA 2Z2YB 1Q8BA 1MU2B 2BKOA 5E5NA 4NLZA 1WEZA 1WOSA 2QIFA 1RYSA 4OHXA 4JI2F 5G0RA 4IOCQ 4IFYA 4DL6A 5IIJA 2FIUA 4UQGA 3CIZA 2DTJA 2HLTA 2DFLA 1CQMA 4OZJA 5AI0A 2HDOA 4RR5A 2HFUA 2X1AA 2DH7A 5D3GB 5KG0A 2UUAJ 1IBMJ 8ICNA 4RJVA 4EU0A 4O0NA 4NA1A 2R7OA 3OR1B 2NRXA 4M04A 2DNGA 1V85A 4WTYA 2LMIA 3WK4A 1RWOB 2DBBA 1KKHA 1NRKA 1T9TA 2ZC3A 2RQCA 5BR8F 4WXWA 2BJDA 1RT1A 4ZVHA 4JI0F 4HI2A 1HD0A 4I0WA 4JUZA 3WKDA 1S1UB 1WF1A 3BN4A 9ICCA 5CCLA 1GMUA 2HHUA 5BYSA 4OYMA 5G5GA 5FLXY 1G6BA 2HWHA 2QSFA 1S9GA 3AL0B 2NR0A 2RUSA 3ENAA 3GJRB 3PKMA 2XC9A 1XWLA 4PR6A 3CCWA 1KEJA 4QWCA 4ELUA 3EPIA 1JJHA 4M0AA 2LPEA 1B3TA 9ICTA 5GADU 4UB5A 1T9VA 4CLWA 2HPUA 3JPSA 4U96A 2OPPA 4WU2A 2A6MA 3QT8A 5EE9A 1NK5A 3CWJA 4ZJOA 5U47A 4JI2J 2FC8A 3SMVA 1XNRF 4A8FA 2RDJA 4K4GA 1SZHA 2F4FA 5LJ5Y 1AYEA 3RZAA 2BW2A 2G9OA 5J0RA 1CJKA 1PYTA 4DL5A 3QLHA 4UB4A 2VJ4A 3ED5A 2ZDOA 4PZVA 3T9NA 3MECB 4OYWA 4P74A 2RD5C 1T3OA 3I0RB 1REVA 2FPLA 5BR8J 1Q79A 3N9UC 4JI0J 2YKNA 2PEBA 2J7UA 2ZFHA 3HKZD 3S6JA 3A12A 5F8MA 2QEXS 1K8AT 3KG1A 5IIKA 2DO0A 4F2RA 1HQEA 2YB1A 3W2VB 2B9WA 1F9FA 3TO8A 1Y9OA 4Q0BB 1YTYA 2DRAA 2E7VA 4U7UD 1U6ZA 1HI1A 1ZPVA 3RB4A 2MY8A 3KJQB 2CQDA 4YB7A 2DKZA 5J0QA 3FRYA 3ILIA 3ZDAA 1WDDA 3WK9A 2DRBA 2YTUA 1F1BB 3F41A 3NEKA 2FPKA 2OP5A 2J6UA 4DFMA 4PYDA 1N36J 1XNRJ 2B56A 2KT5A 1KRPA 2P35A 5KOWA 7ICJA 3SV3A 5HHHA 3H40A 3SV4A 2WF7A 3M6XA 2IOFK 3QXGA 2DHAA 2HFOA 3AOAA 4ES3A 3MGHA 4TY9A 3ENQA 3CJKA 2BHNA 1S0VA 3D54A 2HRTA 2FLOA 4I7FB 2I5JB 5EDWA 1WG1A 4AL6A 1LVHA 1WC0A 2Q3PA 3OL6A 3M8QB 1X0FA 3W7BA 2VICA 4ZPVR 3HSZA 5A8KB 5IC6B 2DXFA 1IWGA 1RT3A 2CDRB 5EE3A 4XDCA 4NV0A 2C22A 4DLGA 1BPDA 3AD8C 3V6DA 4KLLA 3E8OA 4FPIA 4MFFA 4X62F 4PQAA 1YJRA 1Z19A 1DK2A 4F50A 5GMEA 1A77A 1XQIA 5FD1A 3D2QA 4UY85 4GXJA 3O0FA 3MMCB 1NPRA 3ZZTA 3SCLE 5KT2A 2YX7A 3IA0A 1JKHB 4DQSA 6FD1A 3CJTA 4KJIA 4QZDA 3P6YC 4GKJF 4X4VA 2P6RA 2QARB 2PMHA 4GVLA 4BCAA 2EFOA 1H73A 1NSPA 2RVJA 2AQ4A 4QR2A 2V4QA 2HFVA 3HVTB 3NS5A 1FEHA 3TJ8A 4OJHA 1Z1VA 2KN4A 1JLQA 4Y3CA 2EFVA 3QGGA 4YMOA 5KFKA 2K7KA 3MMBB 5L9XA 3WX4A 3OW2R 1T9XA 3UXOA 3H42A 4DL0C 1J5OA 2VC0A 3HPOA 1RBLA 3QUBA 4DPWA 1EETA 2AIRB 1BMQB 3BZQA 2U2FA 4WP3A 3RYLA 2Z2LA 3MF5A 3NVZA 1H2UX 1UT8A 3N6LA 1XR6A 4XO0A 1FE4A 3VWSA 4DCPB 4X62J 3T3FA 4QIWC 2P5VA 4WK3A 5K5MA 3D0GE 3KK3A 5HMZA 1X9MA 2BVZA 4CO4A 2VONA 5CHGA 5AE3A 2PMZD 4TYAA 4F4WA 1DTQB 3EZ5A 3JTPA 2HK2A 2AHOB 5DLFA 2XY6A 4GKJJ 3DLBA 2DGZA 5ALSA 5J0PA 3MUMP 2ZM6F 3GV7B 4HT7A 3LVVA 1JMSA 1ZZFA 2OEHA 3HCXA 3GB0A 3T41A 1SV0C 1SBRA 4ZLPA 4WZQA 4Y2PA 2X51A 4ZMMA 5AIBA 3CD6S 2HBKA 3QJPA 3CD7A 3HILA 5K14B 4MKYA 3D66A 3D1HA 5DDQC 1E6VA 1ZM3A 3WK7A 2XGPA 4NLKA 4DR6F 2X3GA 2ZZTA 1I1GA 3AFGA 2HZVA 3UPQA 3CO9A 3M9NB 4U7CA 2E5SA 1LXJA 2YPYA 4OX9F 4V19X 1J2NA 4LR7A 2K8CB 4Y2SA 5D77A 2W2OP 2IIHA 2NYHA 2ASLA 1TKZA 4CRJA 3Q8YA 4J91A 4OV6A 3N4MB 4TLRA 2YX1A 1C0TA 1CI4A 4I2EA 2HHPA 3RJEA 3U1NA 3IO1A 5KG5A 1GMWA 5I3UB 2LXUA 5IT4A 1RWVB 5D0RA 2GIFA 4DN0A 4N7TA 5IIOA 1R0CB 4IG3A 1KONA 2QA4S 1NDLA 1MG7A 1SQFA 4I6WA 1G1XA 1MWZA 1JN3A 2A1JA 4OX6A 2KZMA 4HDGA 2R4FA 4K2JA 1JX4A 5MAOA 2V8GA 2V34A 2ZM6J 2UXBF 3PMLA 3BZCA 4WFZA 4CLFA 5L39A 1FJCA 2E8OA 5A0YA 1N32F 2O6KA 2CUYA 3V4MA 1N5YB 1QVFR 3MGVA 1MNEA 1T8EA 3C2KA 4KLFA 3IWLA 1ZETA 2IAJB 1Z00A 3BQTA 1SH0A 1ZQOA 4DR6J 3DXBA 1RLDA 3B54A 3I9ZA 3TQ1A 4ETXA 5THWA 2CPZA 4OX9J 3B8HA 4RQMA 4K2XA 3TZXA 2HQCA 3VHQA 2A3JA 2QLTA 3IBFB 3SCIE 3SFUA 2XYGB 1XK8A 2BGWA 3K75D 2KNJA 4I69A 2C2OB 3LP2A 1GXUA 2C3MA 1L8LA 3M2RA 1VQ8S 3JQMA 7ICPA 1HNVA 4IQMA 3BQ7A 5HMMA 1BVSA 4IRKA 3T9ZA 2N4DA 1HBUA 1J2MA 2VPXB 1S0NA 2YWKA 3AB4B 3WIVA 3MAAB 1XIQA 2UXBJ 3WKCA 1Q95G 3QO9A 4NM1A 2N3LA 1N32J 3FBCA 3SCJE 1IWAA 2DIUA 4LJXA 1UL3A 3B82A 3HWTA 3P5TL 3W2WA 4KSEB 2QO3A 3GLJA 1LK5A 2HURA 1RT6B 4P2XA 4IOAQ 4DR2J 3UN5A 2AJ0A 4I27A 4A4JA 2D1CA 3UDEA 1OUQA 1F60B 2LKYA 1VC5A 1WCNA 4IS7A 4O5KA 2ZNZA 3MEGA 2ZIVA 1FRLA 4LSLA 4P0PB 3OUYB 2B8QA 2Z4PA 3CCTA 3PMNA 1S1TA 1Z2LA 2Y1LB 5HLFB 2JR5A 1TAQA 1URNA 2ZBIA 4Z6CA 1PAUB 1FDDA 3Q8UA 4IG0A 2X1BA 4RQ3A 4G65A 4KRWA 4DR4F 3R97A 4PGQA 4BWMA 4UOHA 2EC2A 3VC8A 4RBVA 2KG1A 2M8HA 4WYLA 5ALJA 1KLMA 2W9BB 2WW4A 3C23A 1IKXA 7ICNA 7ICRA 4LRFA 4NEYA 5DJBA 2W2PP 2DYAA 3NKYA 1CJTB 3W5ZA 3KUHA 2YNGA 2AMCB 3ZZZA 3IGNA 3MR6A 4RW7B 4B3TF 2XHCA 1ZJMA 2V8PA 2EXUA 1ZQ1C 5ALEA 2C2DA 2KJ8A 1D9AA 3SQGA 4I28A 2YH0A 2XO6A 3MM6B 2LA6A 9ICEA 3UMCA 5IILA 3FSYA 1S9EB 4G3IA 4B3SJ 2KJ5A 3CTRA 2BUNA 2GAHC 3D3BJ 4XK8C 4Y2VA 4LRBA 4ZK7M 3UCGA 1U1OA 4J9SA 4LSNA 4KV8A 1NAQA 3PEHA 4J9VA 1QVGR 4USKA 3MUVP 3Q2TC 2C3PA 2AEJA 4X65F 4ZHRA 1NNDA 4DR4J 5IINA 4ED6A 3IM8A 4DL4A 3KFUF 1FJGF 5DG7A 1N54B 3JSYA 4LJMA 2QFJA 1QAXA 4RNMA 3KLGA 3KHHA 4IH7A 1RPLA 2HFNA 2J0XA 3H7IA 2F3JA 4NL9A 3OT9A 2W2MP 2LYBA 1N33F 4O3SA 3EDQB 3G9CA 3GIJA 1VC6A 4B3TJ 1NHKL 4CM2A 1MROB 1PBAA 3GWCA 1QCKA 2VKRA 5EE0A 1QSYA 4IFVB 4HHHA 4RPXA 2JZBB 4RT3A 4ZH4A 2GGPB 4PXBA 1K1QA 4L73A 4A8EA 4YB1P 3DEEA 4X64F 1ZQKA 4RW6B 4ED8A 3GCWP 4H4OB 2DXEA 3M6ZA 1DQ8A 3LGNA 1U6BA 3I5BA 1SC6A 4X65J 2DISA 2G1DA 2GW8A 9ICGA 3KNGA 3OTCA 1FJGJ 1YLXA 4RQNA 8ICTA 3NVWA 1RTJB 3AEVA 5F9NA 3GFZA 2HNZB 2MUTA 1FRHA 4KITB 1G7CB 1NCLA 3BH7B 4TURA 1IG6A 1TAMA 2Q1LA 2BQRA 1N33J 2RHSB 3V7KA 2RNEA 4CT8A 4DFPA 3IRXB 2E1CA 2AH5A 3PYGA 2ZVSA 2MHNA 1EARA 2GO9A 2VV5A 3LWMA 4G1PA 3T5LA 4QIGA 4R0EA 3C15A 4FVCA 4ZPCA 1VBZA 2RP5A 4XAKA 3IXQA 4YUDA 1BQNB 1X4EA 3MXHP 2J7KA 1UVKA 2QZ8A 1ZRMA 4X2BA 4ZVSB 4IQVA 4CLTA 2ZJ5A 4J03A 2NSBA 4NLUA 2XYPB 4ZCIA 4X64J 3KUEA 1RHMB 1E6YB 2YH1A 4NPOA 4ECSA 1BC6A 4QW8A 2YKOA 3QSIA 4K5SA 2G4BA 2HAFA 3OSNA 1R8HA 4DF4A 2DNHA 3KXDA 4BS2A 4KN4A 3I0RA 4CIOA 4DL2A 5BPCA 3O44A 3CO0P 5BOLA 2PD1A 3WQPA 2NYVA 4RQ2A 1ZQPA 3ILJA 1HBOB 2CWXA 3BSAA 3HZGA 7AT1B 3R2DJ 3L7UA 2I1RA 2PO4A 5JTIA 5AI5A 3SAHA 3W2VA 2IFXA 2J9CA 1A6SA 4CDIA 2R2TA 4ZVRB 1RAGB 1DLOA 4OI1A 5C25B 1Y3KA 5EGYA 4Q0BA 5KFTA 2CJ9A 1FCAA 3MM8A 4GO7X 5CABA 4RNFA 4D3GA 4PUOA 2YY6A 1R6VA 2VOPA 1L7OA 1L7PA 4NLNA 3TA2A 2CPJA 4E8UA 5B0CA 1FK9B 3KLIA 4UB3A 3DGPB 3NP5A 4L76A 4P73A 2CZVC 2Y1RI 3KJNB 4RPZA 1OMSA 2CRXA 1ZD2P 4F8RA 4XRHA 5D0GA 4GXKA 2QMUB 1ZQMA 3CP8A 3ISDA 2XULA 2UVVA 3PX6A 1H7XA 5DRKA 2B7BB 5BOMA 4B08A 2J6TA 4FZMA 3I0SA 4PRFA 4U8VA 4TY8A 3HD1A 4C4TA 2K8AA 2CPRA 2D69A 3K1ZA 1QQ5A 2B3TB 3EX7B 3VAKA 1T95A 1UW4A 1HNIB 2DGUA 2VL1A 2OM6A 1C1BB 1M1HA 3M8RA 1Q16B 3M8QA 2YMPA 8ICZA 2RQ5A 3ZD9A 1DBDA 1KS2A 2F8KA 3K5MA 2BE2A 4BLGA 2VODA 5AXNA 4DUYF 5ALVA 4QCLA 1ZTTA 2XYHB 3LGMA 5HP4A 1JLBA 5ETVA 1XC9A 2DGSA 1KVKA 3UXPA 2ZD1B 2GQQA 3M32B 2JH1A 3TADA 2XVTA 4M9LA 1DJ0A 3AODA 3GJTB 4AYBD 1FFVA 2CWKA 3RBEA 5KOXA 2ESEA 5F8JA 1JKHA 1P6TA 4PH5A 4EZ9A 2H1YA 4XIUA 2LQ9A 3ONNA 1RWXB 4QR0A 2YY3A 2GCFA 2RHFA 5CRXA 3MAHA 4YR2A 3NGDA 4AL5A 3R5DA 2R8GA 4YMNA 3MCSA 2R18A 5KAFU 1KQQA 2L5YA 3M8SA 3VAIA 2F77X 3W65A 1JLCB 1K44A 1N4LA 2ZHOA 4YR3A 4ZVEA 3D2SA 4ZOSA 7ICIA 1UT5A 3MM9B 4N8NA 3UFCX 3NNCA 4YB6A 4I1TA 4ES2A 2X7IA 5HMWA 1GXTA 2LDYA 1ZQQA 1RLCL 3I96A 3R5CA 3VQSA 2ZIWB 1S48A 1PSDA 4B9MA 4IUFA 1X4BA 4WJ3B 2LHTA 1GK8A 3EWGA 2ZIUA 6AT1B 1BUXA 2WAQD 3CE8A 4XPEA 3KJFB 5D0HA 3BGRB 1CBKA 4DUYJ 4A8XA 2WVEA 1NH8A 4RNOA 4FBUA 1JXVA 2HG4A 4F3OA 5G5HA 9ICJA 5GMDA 2CJYB 4YDDB 4K4IA 1FJEB 3DCAA 2GVDA 2H3QA 3A13A 2CQHA 3RAMA 4ENOA 4LR8A 1O6XA 1ROFA 5F0UA 3AMZA 2JOQA 2FMSA 2A0FB 2RU3A 3T1YF 5CEHA 2FUG9 2GC8A 3FFIA 1YWXA 5CWRA 1HWUA 4UOFA 4ZS6A 3MFIA 5F9LA 1RT5B 1KOHA 4FO6A 4I2JA 3MPDA 1SJFA 3BO2A 3DGVA 3EWAA 2ZKUA 3HJVA 5KFLA 1JNZB 5H9FJ 4NLTA 4ZCMA 1V97A 1EX8A 3T6JA 1VQ9S 4Q44A 2W8KA 1TR0A 1TL5A 1MN7A 3H5XA 2QFIA 2YMLA 1XBWA 2R3VA 3QYPA 5GAGI 4USAA 1WEYA 2GVZA 5BYQA 3PACA 5DM7Q 1S6OA 2CRLA 3JXOA 3AXKA 1OXJA 1T05A 3H0LB 1X31C 3VAHA 1BQMB 4NLDA 2H54B 3JSRA 2HS0A 5H2FU 5I3UA 5F8HA 4QPTA 4KT0C 1OPZA 4ZJQA 5F0WA 5GAEU 1WHVA 5AI4A 4EO8A 4P2FA 3PW7A 2FJAB 4CO1A 3ZTRA 3NASA 4KPCA 4RBTA 2W7OA 4UUXA 2FVSA 1W26A 2MZJA 3ITHA 4NLXA 1K73T 5AK6A 1HJPA 3P3DA 4DG1A 3TZYA 2W7AA 4YY3F 2WF6A 2CVEA 1X6IA 3CCQS 4MF2A 3OJSA 1JJ4A 2IAJA 8ICBA 1LFPA 4OYXA 1ZQIA 2B6AB 4X4TA 2VG5B 4NOHA 2DHGA 4ILRA 4CCHA 1UVIA 2E1FA 4OZ0A 3NOGA 4ICLB 1N88A 1S0OA 3NGTA 4DX8H 2WTFA 4USJC 5J2QB 2B0GA 4FXWA 4QU7A 5J8YC 4Y00A 3S7RA 2KFNA 3QSYB 4P7TA 3E0FA 5AM3A 3DOKB 3DV9A 2MQPA 5HROA 4M6WB 3WU2U 1YJNS 4LSZB 2OH2A 3KLHA 3OQ2A 3KKAA 1HEKA 4US8A 3WC0A 3FMWA 4QPXA 1B70B 2X1GA 2IJFA 4RUHA 2MQLA 1QSLA 1QD1A 1X4AA 4B9NA 5K20B 2XS7A 2ZBCA 5EWGA 4B9TA 1MMNA 2F44A 4XDDA 1NK7A 3R6GB 4EX7A 2K8GA 2R7VA 2ERRA 2PA3A 1ZQVA 1B0PA 2GOLA 4OYZA 1IJEB 3PSPA 9ICHA 1IQZA 4Y2AA 1RT6A 3OJUA 4TUSA 1BE4A 1ZAXA 1RQLA 4ECXA 4O3RA 1SJ3P 5DBBA 4ATNA 3UWTA 1Q0NA 3H2UB 3HVWA 3LP0A 3SEOA 5IM0B 2M0NA 3DHXA 1SIZA 4O3PA 2LEAA 4AD6A 2HGMA 1NHUA 3DRRA 5B0DA 4JV1A 4M9HA 2EG1A 5DO2A 4V1Ak 3MR7A 2AX0A 3MWBA 5HLFA 4UB8U 1N5WA 1DQAA 2AJ4A 1BNPA 2QL9B 1W7WA 3I87A 9ICRA 4EK2A 2EAMA 2B7CB 3MDCA 5D4OA 3H5UA 1EP4B 4UB2A 2ZEJA 4ES1A 3QIPB 2ATCB 1MMLA 4LR9A 4EBCA 3S6EA 2BQUA 2HHSA 1PGZA 4AL7A 3D28A 5J2JA 1RG6A 1OO0B 5TISU 3KYLA 4P9SA 4USIA 1A76A 3W9IA 4DSJA 3PR4A 1CJTA 4BBYA 3QAUA 1GO3F 2VF3A 3M6UA 4RW4A 1F3VA 3V7LA 4EYHB 4C0HA 1QSSA 2V9KA 2HHVA 1VS3A 1N5XA 4RW7A 3JQKA 2AYGA 3THPA 2OEJA 2QMXA 1CC8A 3OBIA 3R1HA 1WHWA 2NLWA 1ACMB 1N6QB 4NLVA 1LW2A 2PKEA 2V94A 1MMDA 1TVAA 3CEDA 5F8LA 4X4SA 4NMLA 4OJLA 2M3DA 2B4OA 1SGGA 2HRUA 3FCVA 3D0IE 3C8YA 1NO8A 4J9OA 1DOQA 1EKRA 1JJCB 5KFOA 4I2AA 4KHPF 3PV8A 2KRBA 1PZNA 1TUVA 4UBCA 2MKCA 3TFSA 5F3XB 4WFAQ 2BQ3A 1SC3B 1QQ7A 3RH4A 2L08A 2IC3B 2GZOA 3MPYA 5ALMA 4USHA 3GYNA 2E44A 1RT4A 2QSWA 4AE5A 3C16B 3PYFA 3R6LB 4DZ6A 5J2MB 4F93B 1S6UA 3FZ2A 5FJ4A 4RUBA 1RU1A 2CZ4A 4M5DA 2FLPA 4F3QA 3K58A 2VFVA 2VC1A 4RQ6A 1HQUB 2KG5A 4BX9C 2Y0BB 7ICOA 4C0OC 3VAGA 4PYAA 5ADZA 1I3OB 2AKWB 2EWHA 2R2SA 2N1RA 1LW0B 2PEHA 5LOQA 4ZCLA 2XI9A 1N48A 1YI2S 4KB7A 3SSSA 1VQ4S 1LNQA 2W9CA 1MROA 2YN4A 1EHWA 2WRMA 4WK1A 4NLCA 3L5KA 3NS7B 2KE7A 2PIIA 2LXFA 4GC7A 3E51A 5ETQA 8AT1B 3GFKB 5DB9A 1F44A 4Y2YA 4Z37A 4DR1F 2I0XA 3NS1A 3QU2A 3H5YA 9ICXA 4LRDA 1P9QC 1CS4B 4J7CA 2IM3A 5L1JA 2JLEA 2OPSB 2K4PA 5E7OB 5L8RC 5D46A 3LH2S 4WFXA 3HHLB 2HWIA 2OPRB 3TAMB 3EJMA 1C1CB 1XSNA 4UASA 4P2HA 1VJWA 5IV3A 3BSCA 2NPFA 2PDAA 1K9MT 5AKGA 3LF0A 2LQ5A 4TXSA 2MQNA 3TZWA 2FPMA 3BKFA 4KE5A 2OMOA 3MOJB 2YWHA 4XUSA 3AUOA 3QJJA 1NH7A 2R8IA 4PHAA 2HVEA 2VA3A 1KVJA 1WUUA 3ADAC 1DXSA 2FVRA 3VGUA 4DU8A 1HYSB 4QIWD 4MMOA 3MR5A 4X4UA 1GT8A 2WSCC 1URJA 4I2PB 3TUPA 5T14A 3A3OB 2N3OA 3TAPA 4DSFA 2D6FC 3U02A 1Y5LB 3IRXA 4NZ7A 1TK0A 2W7PA 3C5FA 8ICXA 4PZNA 5JRTA 1S76D 3UDVA 1S77D 1Q53A 2VUGA 2D3DA 2KIWA 9ICPA 2BCQA 3G6ES 2DUYA 3R7NB 4DR1J 4LVSA 1S1VB 1B0VA 3Q22A 2HBZB 1S97A 4A47A 4F92B 1NEEA 3UQSA 4LIWA 1NJWA 2QA2A 3IS9A 4DSKA 3DMJA 4RNNA 1DARA 2CADA 1TVRA 2DGVA 1QAJA 3SQIA 3NOCA 4OI2A 4RX6A 1TE2A 1PJ6A 1RT2A 2DT9A 3F73A 1IXKA 5GAGU 1VQPS 5KFIA 2ABYA 3PSTA 5EHHA 3PO4A 3HD2A 1JLGB 3POTB 2QA1A 1HBOA 3K7RA 3NVVA 4PQUB 3CT9A 3Q83A 2P9EA 5AM4A 5IIMA 1LQ9A 3PXGa 3HRDD 2GIQA 2QGFB 2Z0GA 1UVMA 1XO0A 3B9JA 2CJQA 3D2WA 1SJ4P 3MR2A 1ZQXA 3PSFA 3H0PA 3EVOA 3VF0B 3R8YA 5I42B 4LBIA 1U25A 2HK3A 3KNAA 2V8DA 3UMBA 1QH9A 4Y2RA 4C8MA 3HX9A 5KAKA 4M5NA 3AA9A 4DBQA 5J2HA 3H25A 4RW9A 4UZCA 8ICYA 1KTQA 2B51A 9ICKA 1U1KA 4Z6EA 4L3KA 5ETLA 4J9UE 3IDWA 1UQVA 3M8YA 1D9FA 1HNIA 1OYEA 1CJVA 1C1BA 2DGOA 2MZRA 3WKBA 4IL6U 4YEAA 1Q8IA 1XJWB 3C6TA 2L48A 4M5LA 5J2IA 4KGXB 2J0SD 1HLWA 4O4GB 3M32A 4TU8A 1YIJS 2K3IA 2OPQA 3MM5A 2LBOA 2WOMB 1JALA 3L4PA 5AXLA 4ALZA 1FRMA 4PG8A 3VVTA 5L9NA 3EICA 1VK3A 3D9BA 4RLEA 4KLIA 3V6JA 1L7NA 1FEZA 1M1KT 5KFEA 3ONQA 3NRBA 2G1HA 2UZAA 1X4HA 4OIXA 3Q24A 1BY9A 4O9MA 3MCMA 4F0KA 2OUGA 1JLCA 1SVDA 4C80A 2IDLA 3UD4P 5G0RB 4IFYB 1UA1A 2ACYA 1FKAF 3MTJA 3GR1A 1UFKA 5EE1A 1TK8A 5KFWA 5DZ7A 1VOMA 3GIMA 5KFMA 1PO6A 3GV5B 3ZZUA 4WFNQ 3RUBL 3CYMA 2AEFA 3IM9A 4HVZA 3ZDEA 9ATCB 1B4FA 2QKQA 1N62A 4KX3A 2DKXA 2C3YA 4O3MA 1ZD5A 2M88A 1RXOB 2OFHX 1RXVA 4A8WA 1RT1B 2CQIA 3AAWB 2E9ZA 4R64A 1RWUA 3IC1A 3OTDA 8ATCB 3QEBZ 2ZNYA 5DGAA 4N76A 1RHKB 1C4AA 4ZLLA 2IA0A 3QEAZ 1P8GA 2R2UA 1X9XA 2IDEA 2P9CA 2KFYA 3N0VA 4DFJA 4LF2A 4Y2KA 1S9GB 4LF6F 4O5CA 4YCXA 2E7XA 3CJ4A 2DBYA 1U2CA 3UNYA 4DSLA 3N7SC 1IJFB 2PE8A 2HGNA 1SV5B 1RT5A 3M30A 2DGQA 4A8SA 3A0BU 2LM1A 4X84A 4ER8A 2J6SA 2KN7A 1Z4NA 3SCKE 2UU9J 1APSA 4CF3A 1QUPA 3VQTA 4OJGA 1AB8A 2BX6A 3PFEA 5K8OA 4F4YA 4FE3A 1ZQCA 4C8LA 5J0YA 4FDFA 4QIEA 4I56A 3BSOA 1NKCA 2BPFA 3LPYA 3AU6A 3DRSA 4PPXA 3HHLC 1WKKA 2M0GB 3GJSB 2JEGA 4EENA 2YQ0A 2XLJA 3RBXA 2CQGA 4MH8A 3U7JA 1NSQA 2COLA 5K8MA 4ILLA 1BQMA 2V2QA 3BDEA 4OJOA 3TOQA 2CVIA 1UETA 2E5IA 3OSPA 3LP1A 3HHKA 5DB7A 4QJVA 2FZGB 7ICFA 1PK1A 1TL7A 2IOHA 4QIFA 4LF6J 3BSNA 2WB1F 1ZQLA 1D0EA 2GWSA 3PM9A 2ASDA 1L7MA 1T7PA 2M5YA 1FX4A 3GDXA 1PC4A 1SUQA 2MKJA 4K4WA 3OV7A 2E5JA 4ECTA 4M5KA 3C6UA 4X5VA 1YK9A 5CYMA 4CLYA 4ECWA 2F1IA 1AZSA 1SL1A 3HZEA 4ZVGA 1Y5NB 1R31A 3LA0A 2VG5A 3K17A 2BE9B 3A1YG 3DDHA 3KMSA 2NO4A 1Q46A 2P6UA 3G6XA 2Z8QA 2MSSA 4OO1J 2ES6A 3ZNJ1 4CGZA 3F2CA 4FF2A 5J2EA 3CJKB 3ZZOA 8ICIA 4JWNA 3KG4A 1FNOA 3ZZ0A 1B0TA 3QNMA 3FJ2A 4C8YA 1YDLA 1KSPA 4GC6A 3QWPA 5E33A 2G07A 1K0TA 1VR6A 3IMQJ 1RGVA 7ICKA 4KN7A 4RWWA 2XB2D 1VBYA 3DOKA 5KG4A 8ICCA 2WK4A 2ZUCA 3J7YI 1V5IB 2GH1A 4HHUA 1RT7A 5AHXA 2R8KA 3DLHA 2MY7A 2BKPA 1HUZA 4CNZA 3K57A 3H5SA 2GJ2A 3DM2B 1SB6A 2MRLA 3T5JA 1ULRA 1X5OA 4FYVB 2ASJA 2CPFA 3MGIA 1QQ6A 1VQ5S 2KXNB 1Q86T 2ZZNA 2N7CA 1U6FA 2QA4G 4DUZF 1OSCA 2BOPA 1C2PA 5AXMA 1JLQB 3H8YA 1S72S 5E3RA 3I56S 2HHHJ 5KT4A 2NO5A 5KG2A 4MKBA 3W66A 3FCWA 2W9AA 3KMQA 1YZ7A 3ZNUA 3F5AA 9ICNA 2VDHA 2BKNA 3DOMA 1Q3VA 4N77A 2CPIA 4K4SA 1J5OB 1LWEA 3MM7B 2MQOA 1EIYB 1X0PA 2J8AA 5HP1A 5DDOC 1NDKA 1WNEA 3EVWA 3ZI4A 1EETB 4M95A 4OYAA 5HVGA 1H0HB 1N0VC 4N5SA 3QIDA 1VI7A 3A0HU 1NSKL 1N52B 3MURP 3BBBA 4OYIA 4YQWA 4DQPA 1XEZA 2IHNA 2YX8A 3RH5A 4OI6A 3FRZA 4UQTA 4LF4F 4C3KA 3D5MA 1F2HA 1GTHA 2V50A 3DYAA 5J1EA 3SSQA 3IN5A 4DSIA 3KLVA 2XMJA 1N8RT 4F91B 1KDHA 3U1LA 4F5QA 3UI3A 1ZJNA 1RHRB 3SAFA 2H65B 3LGHA 3DN9A 4HACA 1JXLA 3NCRA 1R6YA 4KMOB 3CF5Q 4GVBA 5DGBA 4M2YA 2J76E 3VGTA 5L1KA 4DUZJ 2IVMA 4C8ZA 1NI3A 3UCUP 3CD0A 1ZQWA 4AFFA 5IXUA 9ICQA 4NL5A 2DO4A 3UDCA 1E6VB 4CT9A 2Z57B 4KLHA 3D6HB 3QATA 5LSOA 1F0XA 3TI0A 2HRYA 3CJ2A 1J2VA 3TVKA 2YWEA 1NU4A 4CLPA 3C29A 4PXEA 3L3CA 5H9EJ 4UW2A 5K4LA 4NYOA 1XR5A 5LJ3Y 4XA5A 1ZRNA 2FGOA 2IC3A 1R8AA 3CNHA 1FRKA 1C0TB 3MMAA 2JGAA 2PFQA 5H1SV 2DNMA 2JLFA 4TYBA 3A8KA 5J2MA 3EYZA 5AKLA 1B64A 2D74B 4Y2UA 4DI6A 2BDPA 3AJ1A 4P52A 8ICEA 4NWBA 4LF4J 5AK4A 2E5HA 2L3MA 4DV7F 2DPIA 1WOPA 2VBZA 1Q3UA 4PHDA 1ZM4A 2A1JB 4I4BA 4JI8F 2EC0A 1WSVA 4ZN3A 4HDHA 2LFVA 4BGDA 1UMJA 2NXUA 2M9NA 4DLEA 1T02A 3AM9A 3OHBA 3FGVA 2YKMA 2V2KA 3M9MB 3ISCA 1ZH5A 2G0IA 2AJQA 4R65A 3MCNA 1NOMA 4QZAA 3L9ZA 1MQ3A 3I31A 4KR0B 5HK4A 3W3SA 1VQMS 8ICKA 2I1QA 2YWGA 4P0QB 2RMLA 1S12A 4WWSA 1Z00B 2CG8A 3BQ1A 3WX8A 2PA8D 3I4HX 1MA7A 5KFCA 2V4RA 1NK8A 4PG4A 4F36A 4E2FB 1CS4A 4UT4A 8ICVA 2UUCJ 2Z7JA 2OD4A 4C8OA 2VJVA 1KQKA 3ICXA 5HI7A 3TFRA 2WF9A 3FCHA 5E2QA 4F4KA 2OPRA 3JYTA 2DF4B 4TU7A 3B0YA 5J2FA 2Y1JA 4K50A 4IQUA 3CVKA 2YBVA 3M2RB 4YDXA 3NMAA 2H4WB 1VLYA 3KOAA 1HNVB 3OFFA 2Y0SF 2DNKA 2IPOB 2BMBA 4OHZA 2E8MA 2B5JA 1OW5A 2XQCA 4DV7J 4G9BA 4UOCA 3Q8SB 1HBUB 4K59A 3DC2A 1RAJA 4F2SA 3NY0A 1YX2A 5IFMA 5HBMA 4US9A 4ZVPB 4WF9Q 4PAAA 1GFWB 5KL1B 3TYTA 3QO9B 5DB6A 4MT1A 3RW7A 2KD1A 1EAYC 5HHIA 2QLWA 4CLUA 2CQ0A 1O8BA 4TUQA 1NK6A 3W2WB
chains in the Genus database with same CATH topology
3QSYB 2AHOB 3AEVA 3CW2C 2A1AA 1KL9A 1YZ7A 3J81j 2QN6B 1Q8KA 2QMUB 1Q46A 2A19A 1YZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSY B;  2AHO B;  3AEV A;  3CW2 C;  2A1A A;  1KL9 A;  1YZ7 A;  3J81 j;  2QN6 B;  1Q8K A;  2QMU B;  1Q46 A;  2A19 A;  1YZ6 A; 
#chains in the Genus database with same CATH topology
 4JP8 A;  3FBE A;  4JI4 F;  2LU1 A;  2ALY B;  2BJ8 A;  1KWM A;  1S1V A;  3PIP Q;  3HF5 A;  1VCT A;  2JRZ A;  4NYP A;  5J0X A;  3RTV A;  4QZI A;  2VBW A;  3CGI A;  3VV2 B;  3MEG B;  2A2C A;  4LSL B;  4JI1 F;  3KHL A;  3M2V A;  1L3T A;  1NK0 A;  4HYK A;  1WWH A;  3POT A;  5J1N A;  4J5O A;  4DF8 A;  4Q43 A;  1FD2 A;  2A18 A;  3UW1 A;  3BO4 A;  2YMM A;  3J81 j;  3J7Z T;  1HBM A;  3TQE A;  2NXN A;  4AUK A;  2NXE A;  5IWA F;  3V6K A;  1X9S A;  3DOL A;  1WWU A;  3I1Y A;  1PJ7 A;  3PNI A;  9ICV A;  4CM0 A;  3A8J A;  4DQQ A;  5C0Y A;  2YKP A;  3M8Z A;  4C7Q A;  3NG8 A;  8ICW A;  2HW3 A;  1SIW B;  4A8M P;  3V6H A;  4RPF A;  1M6Y A;  4J9Q A;  1VMB A;  1Q81 T;  4M47 A;  4MFA A;  3EUB 2;  3TUJ C;  7FDR A;  1FRJ A;  4ZPB A;  5ETS A;  4C4W A;  1V9O A;  1P1T A;  2ZKT A;  2JMG A;  2PN6 A;  1UZH A;  1IKV B;  1KQG B;  5AM1 A;  2HKE A;  3SQG B;  4EWT A;  5AKX A;  1ZQA A;  2YTC A;  4PWD A;  3HXM A;  2K3K A;  2JC0 A;  3DRP A;  1KFT A;  1W25 A;  4OX8 A;  1V3R A;  1UVN A;  3V72 A;  1YBA A;  2JZ5 A;  4ZA1 A;  1WOO A;  3V2U C;  4PWU A;  2WHO A;  2NYI A;  4UAV A;  2DHS A;  3OL9 A;  1IBM F;  2Y1I A;  4PL2 A;  1ZQD A;  4KV8 B;  1HMV A;  5AKY A;  1N56 A;  2LP4 A;  4LFA F;  2KO1 A;  2ROE A;  2ZJA A;  1X40 A;  4ZHR B;  2YNH B;  1T94 A;  5J1P A;  5IWA J;  3MDF A;  2AYE A;  2MSN A;  5J29 A;  1VRT A;  3J7Y U;  1SWW A;  2KDO A;  4B9V A;  2WOM A;  1HUO A;  5HR7 A;  3BKU A;  3KLG B;  3DLL Q;  3IWX A;  4JV0 A;  1JNR B;  2GMJ A;  1NZA A;  2MST A;  2HI0 A;  3QUT A;  3ETM A;  3BBF A;  1RK8 A;  1IR0 A;  2WCX A;  1Q82 T;  3D1Q A;  4CH0 S;  4JI3 J;  5C42 B;  2HAI A;  5EUH A;  4UOG A;  2B9Y A;  2KVQ E;  3MPU B;  4B3O A;  2DGW A;  3BBC A;  2FHK A;  5AM2 A;  1LWX A;  4ZIW A;  3OVS A;  2DIT A;  3BM7 A;  4ZPD A;  3WDO A;  2HBQ B;  2W3S A;  4ZCK A;  2H5X A;  1PYS B;  4M5M A;  3BV8 A;  2W54 A;  2XGQ A;  3N97 B;  2JWN A;  2YNF B;  1G2E A;  5A0L A;  2D9O A;  4LFA J;  2G5H B;  3NVY A;  4OYO A;  3MR3 A;  5J0W A;  3B0X A;  1T11 A;  5L38 A;  4GMK A;  2E8P A;  1VQ6 S;  4ZP9 A;  4DN9 A;  3G8Q A;  1PBU A;  3MAB A;  2CQ3 A;  4MEX A;  1WI8 A;  2YQ1 A;  4KHR A;  4Z6F A;  4CP5 A;  3RRK A;  4EEL A;  1AT1 B;  5J2B A;  4J90 A;  2ILZ A;  4ZKA A;  3US5 A;  2MUT B;  1PKU A;  2WF8 A;  3TX0 A;  2WVB A;  3O1L A;  4Y2C A;  1NDP A;  5A8W A;  1SV5 A;  2YX4 A;  4OLP A;  2MQ8 A;  1UA0 A;  3TVZ A;  4DPX A;  1PVR A;  3PO5 A;  1IBL J;  4J9N A;  5E41 A;  1LWF A;  1S8O A;  3C15 B;  1BPB A;  3IAM 9;  1N36 F;  3I28 A;  2VPZ B;  4KFB A;  3MDA A;  4IRD A;  2Q66 A;  3Q8P B;  4UAU A;  1LEO A;  4DEZ A;  2BBE A;  2KJ9 A;  2LYA A;  1B7F A;  2HS4 A;  4NX9 A;  4MYT A;  5KFQ A;  2HOF A;  2BZF A;  1WF2 A;  1YG0 A;  5ALO A;  1TL3 B;  2RDD A;  4QQB A;  2CXE A;  5AKE A;  4WE1 B;  1NNL A;  3ZDD A;  1WG4 A;  1P27 B;  1RAH B;  2LI6 A;  4RQ5 A;  4EYI B;  1T9W A;  3GFH A;  1IKY A;  4LF8 J;  2RQK A;  1MC8 A;  5E79 U;  2LLZ A;  2V0N A;  4AQY J;  4NLY A;  4F67 A;  1F0M A;  2D3Z A;  2C42 A;  1RUS A;  3BS5 A;  2KYZ A;  3UDL A;  1WHY A;  4ANC A;  3SSR A;  2E3T A;  2ZHA A;  1KFS A;  1DLO B;  3NWR A;  2NRZ A;  1SKS A;  3MM8 B;  3OFG A;  1WWV A;  1DGS A;  4PUO B;  4C0B A;  2QL7 B;  2KK0 A;  2QG9 B;  1BPZ A;  1B0X A;  5DBA A;  2HQD A;  3KKF A;  1NDC A;  1L3U A;  2N7Y A;  1JWW A;  4R8U A;  3KLI B;  3ZD8 A;  4OFZ A;  5CAA A;  2JNJ A;  1UFW A;  2WFA A;  5KFR A;  3C46 A;  1VIS A;  3ZTQ A;  1ZQE A;  2M4M A;  3V5R A;  3X3U A;  5HO4 A;  2Q79 A;  5D4L A;  2BAN A;  1RTD B;  1RCO B;  1FXL A;  3PRD A;  2PI5 A;  2WB1 C;  4B6J A;  2IOF A;  2GHW A;  2FHJ D;  2VDI A;  4KLT A;  2OGU A;  2P8I A;  3I0S B;  5CYQ A;  2AZ3 A;  4TY8 B;  3KZI U;  2EBE A;  1WG8 A;  1Z3E B;  3Q8L A;  2W9M A;  1IQT A;  3Q23 A;  2E1R A;  2LQJ A;  1VQ7 S;  2EQY A;  5J0U A;  2VB6 A;  9RUB A;  4I2F A;  2HVZ A;  3RU0 A;  2RRN A;  3D6M B;  1TFW A;  3OR2 B;  5ALZ A;  5AE1 A;  1JLF A;  2FVQ A;  1WC3 A;  2BE2 B;  4QZE A;  3DRY A;  3EPG A;  2DVI A;  5KG1 A;  2XSJ A;  2XMU A;  4F26 A;  2P6S A;  2F8E X;  1JLB B;  1S1W A;  2G2Y A;  2J0W A;  4ED5 A;  3GFY A;  2VPW B;  3AY0 A;  1VC0 A;  2LVW A;  2I6W A;  3HFZ B;  2KXH A;  3C21 A;  2A3V A;  3DRX A;  3DM2 A;  3AU2 A;  2FJW A;  2LM4 A;  1S5L U;  5J2K A;  3ETO A;  3ICL A;  1Z1Z A;  3ILO A;  2VFS A;  3C2P A;  3BGL A;  3G2X A;  3L7O A;  4WIQ A;  2J8S A;  4KLJ A;  2GHP A;  2WSE C;  1UWA A;  3A8E A;  3L3F X;  3GIL A;  1REG X;  2JSX A;  2LXI A;  4DOC A;  1PVQ A;  3O6Q A;  3UQ0 A;  1VK8 A;  4I2C A;  2XO7 A;  3JTN A;  2IYG A;  2C2E A;  4JMU A;  1WTB A;  1NSA A;  1X60 A;  2QX0 A;  4IO9 Q;  5KFG A;  1HPZ A;  2MU2 A;  3QYY A;  1ZQY A;  3H59 A;  3L95 X;  4DPO A;  4U7U K;  1S57 A;  1RKJ A;  2BCU A;  4RNH A;  2CJX B;  1J27 A;  3MM7 A;  1KEK A;  2CQ2 A;  2ZIU B;  1JRO A;  1O0P A;  3ZXW A;  1SKW A;  3F2B A;  4UAT A;  1HWL A;  4OHV A;  7ICE A;  3A4T A;  4KO0 A;  3Q8R B;  3BEG B;  1JRP A;  2VQE F;  1NB2 A;  3D2N A;  1RP5 A;  4OX7 A;  5B08 A;  4EMD A;  2GVD B;  4JWM A;  3AB2 B;  3RR8 A;  2VG7 B;  5CXT A;  1DK3 A;  4I67 A;  4DQI A;  1GAO A;  1RXW A;  5JMN A;  2FI1 A;  1YBU A;  5AIA A;  5ALG A;  4NL9 C;  2RIJ A;  4TN2 A;  2RJZ A;  4CLL A;  2ZC4 A;  4NLR A;  2DH9 A;  1HL6 A;  3FFI B;  4FNH A;  3ET6 B;  2G09 A;  3M2U A;  1FO1 A;  3N6N A;  3GIK A;  4M5I A;  1DRG A;  1UJ5 A;  2NRW A;  3GMG A;  1VQK S;  5KFD A;  4OL8 A;  2F8H A;  2Z58 B;  1D8Z A;  4DPT A;  1S7H A;  3KOO A;  2HHT A;  3D7S B;  2DR5 A;  5D4N A;  4EBE A;  3AQE A;  1JK9 B;  4JI6 F;  2OJ3 A;  3BH6 B;  4YOE A;  3TJA A;  1A0O B;  2RKI A;  4EUV A;  5SUH A;  3SQO P;  1QE1 B;  4OJ5 A;  1R0A B;  1YKW A;  2R7T A;  2E1M C;  1XU4 A;  2EZX A;  1EQ0 A;  2GVZ B;  2YMQ A;  2EFG A;  4RT2 A;  1FF2 A;  1YRU A;  3LQV A;  2G08 A;  4QYR A;  2CPX A;  1T05 B;  8ICQ A;  1FT8 A;  3D1O A;  1V3Z A;  4LF7 J;  3H2L A;  2A1B A;  2VQE J;  4KLD A;  3TJ9 A;  2KVC A;  4CQ1 A;  4IQX A;  1VYA A;  1TV6 B;  3NAI A;  2IMO A;  2KZ3 A;  3K89 A;  5KL8 B;  1C0U A;  2E7W A;  1IKW A;  1YJ9 S;  2IVY A;  2BR0 A;  4JI7 F;  2MA1 A;  4PPD A;  4CYU A;  2V4J B;  3CCR S;  2GV1 A;  1KHW A;  1F9H A;  2D9P A;  1GX5 A;  1L3S A;  4PG6 A;  3QZ8 A;  4QZV B;  2WBR A;  4WYW A;  3UVJ B;  4XPC A;  4ZLJ A;  3ITH B;  2QV6 A;  2LEC A;  4OI0 A;  2ODG A;  4DG1 B;  1XMB A;  4A8Y A;  2B4U A;  3VZI A;  5D49 A;  3QE9 Y;  1GNK A;  5CHC B;  4DJB A;  3G86 A;  4P0Q A;  3M6V A;  1NJZ A;  2ZTE A;  1N5S A;  4ELT A;  2ZOF A;  5B7W A;  1GX6 A;  3UE2 A;  7ICS A;  2OO4 A;  5D6G A;  2B4P A;  2JH7 A;  2LCW A;  4PZO A;  4P4P A;  1X5S A;  4DU7 A;  4ED7 A;  4NCB A;  3HLU A;  4JI6 J;  3QT6 A;  1Y4Z B;  1KOO A;  2MQQ A;  4DR2 F;  1F6T A;  3JSM A;  3S01 A;  4KBI A;  4MHV A;  5CB1 A;  1DAX A;  3F2D A;  2R8H A;  5AKH A;  4DQR A;  1TV9 A;  1BPE A;  3RJF A;  5IT0 A;  1RTI A;  4NA2 A;  3B78 A;  2HVD A;  1VJ5 A;  5E3C A;  3CPW R;  2EH9 A;  4LT6 A;  2BV3 A;  1FFG B;  4O4R A;  3N7R C;  1HAR A;  2Y9U A;  2LU2 A;  1T03 B;  3CJ8 A;  1FRX A;  3HFK A;  1GH8 A;  3RB0 A;  7ICU A;  3GJQ B;  1WF0 A;  4O44 B;  5HRO B;  3QFH A;  3TUI C;  4JI7 J;  3KLH B;  2V8H A;  4LFB F;  3C66 A;  1U49 A;  3UO0 A;  2BYC A;  2JFD A;  2K4H A;  2JC1 A;  3CCU S;  2EKY A;  4CI0 B;  4DS4 A;  1BPY A;  2XWY A;  1ZQF A;  2MJN A;  1A7G E;  1YRT A;  1Q78 A;  5DG8 A;  1U09 A;  3EGZ A;  4FKY A;  1L8O A;  1YIT S;  1N5Q A;  3KHR A;  2FVP A;  3EZO A;  3CCJ S;  2Y0S C;  4GO5 X;  3H20 A;  3AOC A;  3G87 A;  2ZWP A;  1PIE A;  3NUQ A;  3BJY A;  1M5O C;  4RQ0 A;  3I5C A;  3NS6 A;  1U2F A;  1ZD4 A;  3PCO B;  3GZF A;  9ICO A;  4MK9 A;  1OY6 A;  2XMV A;  1U48 A;  4A8K A;  2NQP A;  2F7V A;  2BM0 A;  3HT3 A;  3TRG A;  3JAM U;  4B3S F;  4ZVT B;  3LP0 B;  5HVH A;  2B4V A;  1V6H A;  5F3Z A;  5J0T A;  2HHX A;  3J81 U;  4QBU A;  1N5T A;  2BRL A;  3V81 B;  3DRR B;  1FEE A;  3LAL A;  3HHL D;  2GML A;  4URS A;  4RUC A;  4LZD A;  3BDP A;  1S79 A;  4P2S A;  1FWP A;  4NLS A;  4CDG A;  2RRA A;  3F56 A;  2FC9 A;  2OI2 A;  1KL9 A;  5BJR A;  2J7W A;  3QX7 A;  2EI5 A;  3BYP A;  2OAU A;  2XY7 A;  4MK8 A;  3QUC A;  1WEX A;  2W43 A;  1FE0 A;  2B9E A;  3P96 A;  4LFB J;  2CQ4 A;  2NRV A;  4LF5 F;  2KHD A;  2V6A A;  3TAD C;  3PNC A;  4DZD A;  1FA0 A;  5HJX A;  2GQ2 A;  3VGS A;  4PGX A;  2HSE B;  2CN1 A;  1B43 A;  3OXF A;  2V63 A;  4Q8E A;  3ISN C;  3RF9 A;  1HI0 P;  2CPE A;  2V2Z A;  5D4P A;  2GMH A;  4RW4 B;  2D7S A;  3NRW A;  4NLP A;  3CMA S;  1S59 A;  5EOZ A;  1FFW B;  1SC1 B;  1OY9 A;  1RZT A;  2KHC A;  4M9G A;  1IKV A;  4K7Q A;  2NUU G;  2W04 A;  2VJ5 A;  1U1P A;  1HW8 A;  1LW2 B;  4K5R A;  2RUG A;  3HMJ G;  1LKZ A;  2CA9 A;  5CH7 B;  2YB4 A;  5H9F K;  3HKW A;  3H0M B;  3TVY A;  2YVS A;  2M70 A;  3KDN A;  3FNN A;  3CRX A;  2R7X A;  5FDL A;  3FDS A;  1NJY A;  3H8W A;  4BC9 A;  3G82 A;  3N5B A;  1O51 A;  4HI1 A;  3CCL S;  4A8Q A;  2YNH A;  1RT4 B;  3VTI A;  4KLG A;  4L3N A;  5KFV A;  5GAE I;  5KT7 A;  7ICH A;  4LF5 J;  3IG1 A;  4M5D B;  2A10 A;  4CTA A;  2LYV A;  1JXE A;  4BXO A;  4WPA A;  3GE9 A;  2EDU A;  3PX4 A;  3ZTS A;  4TVA B;  2M52 A;  1VHF A;  2XID A;  4F4Z A;  2JFK A;  3SI8 A;  3UXN A;  2YQE A;  3K5N A;  2MMY A;  9ICW A;  5DBC A;  3CME S;  3DDI A;  2YKA A;  3ILL A;  1IIP A;  3H8S A;  2DL0 A;  2NZ4 A;  1R8P A;  3TW0 A;  2AYM A;  5ALT A;  5C42 A;  1T4G A;  2W9C B;  3PEJ A;  2BDU A;  2MPU A;  2PMW A;  4P72 A;  1RIS A;  1RTH A;  5AKJ A;  1VGY A;  4PXD A;  3BGO P;  4ZIT A;  4N8O A;  1HHT P;  3E01 B;  3M1V B;  3NGK A;  4CH1 A;  1UFL A;  2YNF A;  1BLU A;  2BM1 A;  8ICO A;  2VOO A;  1SQE A;  3RFA A;  1L3K A;  4J9