1YZ7A

Crystal structure of a c-terminal segment of the alpha subunit of aif2 from pyrococcus abyssi
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
176
structure length
176
Chain Sequence
KAKLQEFKRAQKAENLLKLAAEKLGKDFETAWREVWVPLEEEWGEVYAAFEDAAKDGIDVLKGHVPDEWLPVLKEIIDNYVEVPTVTIDAEFEITVPKPNGVEIIKEALIRARDRANKEKDVEVKFTYLGAPRYRIDITAPDYYKAEEVLESIAEEILRVIKEAGGEATLLRKEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Probable translation initiation factor 2 alpha subunit
publication title Structure-Function Relationships of the Intact aIF2alpha Subunit from the Archaeon Pyrococcus abyssi
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 59
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 1yz7A01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 1yz7A02
2QN6B 2QMUB 2AHOB 1Q46A 1Q8KA 3AEVA 1KL9A 2A1AA 1YZ7A 3CW2C 3J81j 1YZ6A 3QSYB 2A19A
chains in the Genus database with same CATH superfamily
1SH0A 2OUGA 4IFVB 3QBCA 2AJ2A 2FLPA 3PKYA 4M5DA 1U1QA 2MKSA 3N0VA 4NM2A 3C6UB 1SZHA 2LQ8A 4YUDA 3F56A 1F5AA 1N33J 3RB4A 2VD3A 2BEFA 4MHVA 4OHWA 4A8OA 5HP1B 4M5NA 4OHXA 2DH8A 4QR0A 2YXLA 5D4BA 4IQMA 4ID8A 4LMZA 3K8VA 1WC3A 2R8KA 2MZQA 3UQ2A 1CPZA 4GMKA 3E8OA 4AT1B 1MU2B 3IGNA 4JI4F 4YR3A 1OY9A 3THPA 2XGPA 1HBOB 3NNAA 2NPIA 3C16A 3UMGA 1TP7A 1VDHA 2IJNA 3I9ZA 2UU9J 4KB7A 2JV3A 1EQ0A 3UNYA 2ZD1A 1I6JA 3MCNA 4XK8C 2ZM6F 3K5NA 4AL6A 2V2KA 2Q6CA 2IVFB 2RU3A 1ZTTA 1IWGA 5K8NA 4EEKA 2N3LA 2BJ8A 5IC4B 4F2RA 4EGLA 1RA6A 4NEZA 3QX7A 4CLWA 2V0NA 3M8SA 3ILOA 2HURA 3CXCR 2VPXB 1KVJA 1VQOS 3BGRA 2KG5A 4O44B 3VZIA 4Q7AA 3Q22A 4C7YA 1FRXA 1S49A 3PX4A 3C66A 4Q45A 4IFVA 5EX3A 9ICHA 1GQEA 5J0UA 3Q8UA 3PXGa 9ICQA 3CVKA 2GJFA 3C6UA 2CPRA 4ED0A 4F93B 2CVEA 2WHEA 1YDLA 4NE9C 2QARB 2BQUA 3CCUS 2IDLA 2DNQA 1IG6A 5DBCA 3SXLA 1U1MA 5HP1A 2B4UA 3NGKA 2HNDB 1ZQAA 3OPKA 2R7UA 3PO4A 2C2OB 3WZ0A 4DSKA 5KFLA 3GV8B 4I28A 2K7JA 1HBUB 1QSLA 4USIA 4JI8F 2QZ8A 4Z7CA 1CUKA 4F04B 5KFBA 3ZZRA 1IM4A 1MU2A 3W9JA 4I2JA 1DRGA 1HBOA 1JJ2R 4OJGA 1QVFR 2FVPA 7ICNA 2OSRA 2P9CA 3LO3A 2Q79A 3TA2A 1YJVA 2ZUDA 4IH5A 3DDKA 2ROPA 2JLGA 3O2IA 2BDUA 2F4FA 3GIKA 4JI2F 1YVFA 2GFFA 2KNJA 1VLYA 3TACB 3G8SA 2CADA 3OTBA 5DJBA 1RWXB 2IA0A 1DTQA 3PW2A 4O44A 1LQ9A 1Z00B 5BOMA 1A77A 4DPYA 2XVTA 3US5A 2HKEA 1IKYB 1U1KA 1UEKA 1WG8A 9ICGA 2XZWA 2MA1A 2MU2A 1FXRA 1AQ6A 4DSIA 2DO4A 2QARA 3VWSA 2VASA 3L4PA 4WZQA 2PI4A 1IN0A 3H0RB 4ZVHA 1IBMJ 1D9DA 4RQNA 1YI2S 4DV3J 2BJ3A 4ZVGA 3KK2B 2HNDA 3T1HF 1UVIA 3JYTA 3IWLA 1XO0A 3PY8A 2F8HA 1HBUA 3RAMA 2V67A 2PN6A 3MGIA 1EKSA 5KFUA 4M2YA 2W54A 2MYFA 3NAIA 4ED4A 3VF0B 4C8KA 1BPZA 1KWMA 3HHLD 2ZUGA 2IOFA 1VIXA 3MGVA 5IILA 1WWHA 2H3EB 4ZPAA 3O0FA 4LBPA 3TOQA 1C4CA 1KN6A 4DFDA 3I5CA 2K06A 1YRXA 2UVUA 2V8PA 2VUGA 3LTOA 1ECWA 2CKWA 1P7DA 2EBEA 2LHTA 2EC0A 4U7CA 1OYDA 4RR5A 3V6DB 3PTWA 1SIJA 3P96A 5K5MA 2R9LA 4K4YA 1Z00A 5EE9A 4RW8B 5DB6A 3DRYA 1FE4A 3BPDA 3MAQA 3ENQA 1IKYA 2M7SA 1EAYC 3CJ8A 1XMBA 5CR0A 4RQ1A 5AM5A 4LF6J 4DCJB 4CF5A 1PC4A 4RNNA 2DFLA 4OYBA 8ICLA 3C15B 3KK2A 5D4NA 4IO9Q 3RW6A 5IWAF 4CF3A 2AWZA 2J9CA 2H5IB 1F3VA 3QUTA 2EXUA 3HHNB 1P6TA 4QZVB 4LRCA 4DR3J 2FPLA 4TNOA 2DQNB 2QGFB 2AYGA 4X4OA 3TW0A 5L1JA 3HMJG 4JI7F 6FDRA 1OPIA 2VKRA 1KBRA 4CH1A 3IRWP 1R0BG 5KFFA 5ALHA 4RQ0A 4DR4F 2HHQA 1IIPA 1K5OA 5EX0A 4K4VA 3V6DA 1FEEA 1Q78A 3CMAS 1VJWA 3GIJA 4I2CA 2G5HB 5AKIA 1L3VA 2VJ5A 4RW8A 1XO1A 2QLXA 2GGPB 5ALKA 2R7XA 4K4IA 3TVZA 2EPIA 2VHGA 3RJHA 5E3CA 4WE1A 4Y2IA 3GYNA 3K17A 2D3DA 2W4CA 2F2AB 2FPKA 4IOBA 3J81U 2KT5A 4CF4A 3EVMA 2HQFA 2K7KA 4QZIA 2B4OA 3LQVA 3C15A 2I5JB 4ZVUB 1UZHA 1QSSA 3MPWA 3MM9B 2KG0A 4YMMA 3TO8A 1KHWA 3UMCA 4CDGA 1MLAA 3WX4A 4PZNA 3HKZD 3K59A 4J9LA 1BPYA 4FXVA 2AZ1A 1U1RA 3FCWA 4GVBB 2E5LJ 2FQQB 2VANA 5H1SV 4ACOA 2M4MA 4YD2A 4P0PB 4UUWA 2J8AA 3E58A 4L74A 3QJLA 5DZ6A 4USWA 1L3SA 1D09B 4PWDB 2HBRB 2LA4A 5M2RA 2CPEA 1JLFB 3IM9A 1S0OA 1FRJA 2Z8QA 2BJ9A 4ED6A 4PXCA 1JNZB 4GC6A 2CAJA 2ZZNA 2KM8C 4X4PA 1APSA 5KG0A 2VV5A 3UW1A 2DR6A 5SZTA 2GGPA 1GMVA 1NSQA 3M6WA 2GH1A 1HMVA 2XI3A 2R7TA 2L41A 3X1LB 2AEMA 5AIBA 4OJ6A 3JPSA 2ZHBA 2CJBA 1DARA 2A2DA 3N7RC 3O8WA 2V4RA 5CYJA 1HQ2A 4UBCA 2LDYA 2OM6A 3I4PA 2PFOA 2EKNA 4NLZA 3IG8A 5AKZA 2YNIB 4Y0FA 5KL1B 2KYZA 4DV7F 1VR6A 3MM9A 2NXUA 4O4GA 1F9HA 3T41A 1IQTA 3G2XA 4J5OA 1NH7A 4O5EA 4NRTA 4QZBA 2I8EA 4FP9A 4F25A 4QQBA 1C1CB 1GMUA 1S9EB 1NHVA 3ZNJ1 3GYGA 1WWVA 2KZZA 4GVBA 2NXEA 2KYXA 3K2YA 2ASJA 1RTIB 5IM0B 2YNGB 4P0PA 3QMQA 3KJNB 2XI9A 1N36F 3QU2A 4PWDA 4QZDA 4MT1A 3GFYA 1JLFA 4NLDA 1SXLA 4ENOA 4KLDA 2BZ2A 4LFAF 2VJVA 4OZ3A 2VKZG 4AQYJ 3THVA 1X9XA 3ZZTA 1KD1T 1MN9A 3MMCA 1SZPA 1CSJA 1SWVA 3HDSA 1Y5NB 1BVSA 5HP4A 1AFJA 3KDOA 1C0UB 5GAGU 1UL3A 1T94A 1RQ0A 3CCZA 1WYGA 1Q8LA 2L9NA 5ALFA 5J2QB 1RM6C 3MM6B 1RBAA 2LEBA 2R8HA 2HBJA 4OYIA 4I2PB 1K1QA 5LMUF 2A1AA 4TYAA 3W62A 2FJDB 1Q3UA 4B9TA 5D4OA 4BC7A 1BWEA 3NVVA 2YNIA 2VG7B 3LW5C 4ZCIA 5J8YC 2HQIA 2OAUA 3NTUA 3PYDA 2VODA 4NLSA 3EW9A 4FKYA 1FJGF 3EUB2 1FRLA 1QAXA 1C1CA 2VQEF 3OLBA 2KJVA 1S9EA 3WKAA 4PPXA 2G0AA 2DNKA 4UOHA 3KZIU 2XHCA 2FJVA 2IPOB 1RTIA 2MJUA 2O66A 5IM0A 3UCZP 2YNGA 3U02A 1N5XA 2FZCB 2OSQA 1NDKA 2HRUA 3C28A 1SH2A 4DBQA 4P6QA 2ABYA 2C22A 1QTMA 1S6OA 2WSCC 2PD1A 3CDAA 4C8ZA 5EUHA 4A48A 4UQGA 2ASDA 4F92B 2F8MA 1YX2A 2HZVA 4Z6DA 8ICTA 5F8GA 4ECRA 4B3MF 2GO9A 3ZZUA 4OYAA 4R0JA 2H9ZA 1RAGB 2XMTA 5TISU 5G0RA 3VGUA 2AKWB 3KK1B 2ZZMA 1X6JA 2H4WB 1F5CA 3AJ2A 5J2QA 3Q8LA 3OSPA 3MM6A 2H5EA 5AICA 2J5AA 1REVB 4I2PA 2OEJA 2HIYA 2KI2A 3BJYA 1KVIA 1R6YA 4M5KA 5DGBA 4LR7A 2VG7A 1NDPA 1XMOF 2VFRA 3AM9A 1LWFB 2VOOA 3IRUA 4AYBC 3OXLA 3DGVA 2XWYA 3AODA 3WBZA 5ADZA 3NCRA 1RT3B 3QFHA 2JMGA 4B08A 2HRTA 4OJOA 2GHVC 3GJTB 4KT0C 5HMLA 4O3QA 5KFQA 1RZTA 4RUAA 3HD2A 2C3OA 3SFGA 1D1UA 2R2SA 3CJ0A 4DI6A 4HLBA 1D0EA 3LA0A 9ICPA 2CZ4A 3M32A 5J2FA 3MUVP 1DFDA 3KK1A 4OQJA 3ISBA 1L3UA 2NRTA 4OX8A 2Q0ZX 4Q2MA 1IBCB 9ICNA 4TY9A 3KMSA 5HVGA 2VFUA 1NK9A 2IM1A 3MEGB 4ANEA 2QEXS 1HLWA 1REVA 1QLNA 5BJRA 5ETVA 3HI9A 4Z7YA 3UFCX 3QUBA 3W2WB 3NEKA 3N4MB 3G71S 4C4SA 9ICMA 3GB0A 8ATCB 2CQ0A 1X8DA 3PJWA 2IMOA 1DOQA 2GW8A 2XS5A 3MR5A 4UZBA 1LWFA 3LP2B 2KP7A 2HFUA 3BYRA 3FEZA 2ZOFA 2Z7JA 5H9EJ 2MSSA 4J03A 2GLEA 1YJUA 3AY0A 1RT3A 3TUJC 3TX8A 5HMYA 4DR7J 5KFKA 2DBBA 1KC8T 2UU9F 2OWOA 3NKYA 1FK9B 3RYLA 2A6MA 4CT8A 8ICHA 3N28A 1B99A 3CCQS 2H51B 3X3UA 2DEJA 2EG2A 4USMA 4DV4J 3NVYA 1TAUA 3TJ8A 3ZO7A 1MC8A 4NLGA 4QWBA 2LPEA 1N0UA 1X4CA 2IHR1 2HHTA 1TUGB 1OWXA 4PR6A 4QCLA 3H0PA 1IKWB 3NOGA 1BNPA 2AT1B 4QWEA 3RJKA 4WIQA 9ICSA 8ICAA 4JMUA 3CCTA 3P3DA 3MEGA 2E5IA 4Y2AA 4LQ3A 3AB4B 3M2VB 3K4GA 4Y65A 3O6QA 4KLUA 1F2HA 2GHWA 3G87A 4HI1A 3W2WA 2QL7B 4EYIB 3VC8A 1SWWA 2KD1A 2WK4A 2YKPA 4HH0A 3BSOA 4QU7A 2DGQA 3W60A 2C1EB 3LP2A 5AE1A 5F8JA 3JSMB 5EWFA 1QAYA 1YJTA 2DRBA 4M5GA 5KG7A 1TZ0A 2ILYA 3SZ2A 1RWVB 4OYMA 2CQGA 4OZLA 1FK9A 1R0CB 2HFOA 2YKAA 4PG4A 2W2QP 2N3OA 1PGZA 3GJRB 2WSEC 2RIJA 3B6BA 4M04A 4OHYA 4FYXB 3D2QA 4F71A 2JNJA 1K0VA 1UA1A 1WHWA 5I3QA 2GCFA 1FNMA 3WK4A 4HEA9 3FUYA 1ZOLA 1WF0A 3C5FA 1IKWA 5J29A 7FD1A 1X9WA 4LF4J 3NS6A 3GP9A 3HKWA 1ZBTA 5FIIA 4P2XA 1TUVA 3MGJA 2EAMA 3H0LB 1UPMB 4KE5A 1ZAWA 3M2VA 5LL6d 2FMSA 1D9FA 1YGYA 1S97A 3KUEA 1Y0HA 5CB1A 2C2NA 1H73A 2PGCA 4UY8T 1PZNA 3V6KA 4Y2UA 2HMIB 2AJ1A 2EFOA 1VI7A 5T7LB 5L39A 4QYZK 3JPQA 1OJ4A 5DLGA 4Y00A 5I3UB 4K4WA 1VBKA 5LSOA 2NXCA 3H8YA 2WW4A 2CPJA 3JSMA 3ZDAA 3ALRA 1M5OC 4C0HA 7FDRA 2DR9A 2IYGA 2C28A 4DR2J 3JPOA 2HLUA 4C8YA 8ICOA 3OV7A 3EWAA 1Y5IB 1B7FA 4NJ8A 2Y0SF 2J76E 2RAQA 3POTB 3RGIA 1YBAA 2HFZA 5AE3A 4ZCKA 3Q0AA 1A6SA 4NLRA 5CHGA 1EZZB 2LMRA 4FYYB 3FAHA 1FXDA 3J7Z5 5GMKa 3UVJB 1H38A 1QQ7A 2N1RA 2LQ9A 1X0PA 4P72A 3H5XA 2Y3YA 3GV5B 2XICA 2WSFC 1CJKB 2NSCA 2D3O1 9ICEA 1YJNS 4OX6A 1VBZA 3NS7B 4R65A 3PJXA 4CWBA 1DTTB 2E66A 1NPPA 5IIOA 4IQTA 1FD8A 4K4TA 2HMIA 4PPDA 8ICRA 4LIRA 4ES1A 2LYAA 5I3UA 3BBFA 3O3LA 1KSPA 1RBOB 4WYLA 3HSDA 1Y4ZB 4H4MB 2CDQA 5C25B 1S6PB 4ZOSA 3NGSA 1RDFA 3GONA 1RB0A 3M9OB 4F2SA 1A0PA 1HPZB 4WFXA 8ICQA 4P52A 5ALSA 1MMLA 3GZ7A 2IC3A 2EFVA 1CVJA 1ZQWA 1T05B 4P7VA 3BQ1A 4DR3F 1WJ9A 5CRXA 1JXVA 2MZRA 3Q2TC 3IGVA 1RYSA 4ZVPB 3TQ1A 2B4VA 4P4PA 3POTA 2DNPA 3KXDA 1FT8A 3QUCA 4GKJJ 4Y34A 1SC1B 4TLRA 2LQ5A 1N8RT 3QXGA 3ISDA 2HCFA 1VS3A 2JEIA 2PT0A 4GVLA 2XLJA 1RHQB 3VGTA 3UVJA 2YQ3A 3TRGA 3SR6A 1DLOB 4NL9A 4NXNJ 1BWVA 4FZMA 3DXBA 3C23A 3FRZA 3HX0A 3HHKA 4NLWA 4B3TJ 1CJKA 3PR4A 4DV1J 2DWQA 3L3FX 3EPGA 2EZYA 3UN5A 4ANDA 1QY7A 1VQMS 4DQPA 1DTTA 2M0NA 3MCSA 4ZPWR 4DUYJ 3ZTPA 2ZBPA 2YKNB 2KN7A 3H0MB 8ICPA 1O6XA 2VPYB 2PMWA 3K5MA 8ICSA 1SQEA 3K89A 4H4MA 5C25A 1S6PA 4ZK7M 2RHFA 1JXEA 4F50A 3NRZA 1HPZA 4Y2PA 5AK4A 4FO6A 4CI0B 1RLCL 4YXMA 1XWLA 2G2OA 1ZM3A 1VYAA 2ZC3A 1KVKA 1T05A 3DOMB 4DWIA 2ADBA 4OJLA 3TUZC 1PC5A 1RKJA 2BXJA 2YVSA 2M5YA 1WC5A 2DTJA 3IWXA 5E3QA 1HIWA 2YN4A 3PG9A 5AI9A 2EH9A 4O4RA 2NLWA 3KLIB 4NXMJ 3C6TB 2VIHA 1YT3A 2XCPA 4FZLA 4DS4A 1WOOA 3DGPB 3FSYA 5ETTA 4IR9A 1RAHB 2EKYA 5GMDA 4D3HA 1DLOA 3EDQB 4NWBA 3J81j 4F5PA 2PKEA 3AQOA 4YS2A 3MWBA 2YKMB 1ZQEA 1AW0A 1S77D 1T7PA 2M3DA 1DJ0A 2OHFA 5CXTA 3QGGA 4G1QB 5IT9U 3AU6A 2GAGC 1MWZA 2YKNA 4MFFA 3PR5B 4B9UA 3RJMB 3DLLQ 4IOAQ 1IVZA 2FLNA 4X4TA 3IP0A 2QB0B 2V8DA 3CO9A 3QRRA 1R43A 1PK1B 2EEYA 5ALRA 2DIVA 3QT5A 1NU4A 4W4MA 1FTRA 2KXNB 4H4OB 1PBUA 5HNKA 3DOMA 4OIXA 4OHZA 4OX9J 1CEZA 4ZCLA 3VQSA 3D0GE 4EYHB 4S0MA 2WVDA 1WHXA 3CMQA 3OSNA 3C6TA 4Q0BB 4N7TA 1R31A 5HO4A 1QVGR 1HKAA 3DGPA 4Q43A 2ATLA 4CLUA 3DDIA 1NMEB 1LK7A 3ZXWA 1H74A 5GADU 2FI1A 1M5KC 1NO8A 3VCBA 2AX0A 2P6SA 2FJ6A 2YKMA 1V3ZA 1I94J 1U0HB 2MKJA 4OZ0A 4G1QA 1XN9A 5AKJA 2FTRA 1NAQA 3T3FA 8ICWA 3R5JB 1Y3JA 4RNMA 3W9HA 1KR4A 1K44A 3BO2A 2HWHA 4E98A 1IBLJ 1X4HA 2MKIA 1T3OA 3O1LA 3UDLA 3RB0A 2BJDA 2QB0A 1IR2A 2GMJA 1PK1A 5KAIU 1ZQIA 1Q8IA 1ZH5A 3C2MA 3KD3A 5EHHA 1LXJA 4DL5A 1YIJS 5A0LA 3MC1A 3WK6A 4HHJA 2WHOA 4ZLNA 3DOKA 2VC0A 3MCOA 2MQ8A 1X5PA 1HNZJ 4ZIVA 4Y2JA 1WI8A 3JXOA 3TUIC 4WXOA 2MDAA 4Q0BA 4CLYA 2Y1RI 1LWCB 1XIQA 2VDIA 1RDRA 4NLOA 4FYVB 1FEZA 3BGLA 4F72A 1RT2B 4ZVQB 2VU5A 4Y2KA 1S0VA 3IAS9 4MFCA 3M2UB 1RAOA 1N52B 1U0HA 3TZXA 2ZH2A 1KL9A 3U27A 3LGMA 2BACA 5D4PA 3Q24A 5HQLA 1CG2A 3WKDA 2OH2A 2B8QA 3N6LA 4LVSA 4RJVA 4MEYA 4MIWA 1ZZNA 1VLBA 3D67A 1WG5A 1Y7PA 2VBYA 2BR0A 2G9OA 2P2CB 4YN4A 1U48A 2MGZB 3BQ2A 3M8QB 1U47A 5CWRA 1COOA 3GSIA 2BRKA 4KLQA 5L1KA 2KB2A 3HLUA 8ICNA 2QC3A 2R7RA 3Q8VA 5CYMB 4WU2A 1TL4A 4Y2SA 1ZQBA 4KYZA 4ES3A 4ZLPA 1WF2A 3H98A 2WVCA 1VQ4S 2R18A 4KC5A 2HRYA 1HNXJ 3HJFA 3QT6A 1LWCA 4DQIA 2ZJ8A 4ZPDA 3WK7A 1JLCB 1U1OA 1NSKL 2JLEA 3MPDA 3GZFA 3VR1A 4DDFA 2FHMA 1VBXA 2YWHA 4XRHA 5KFAA 3MHYA 1XNSA 4QIFA 3M2UA 3CJQA 5K9FA 2K8AA 1AFIA 1VHIA 4F4YA 1TK0A 3CUNA 2VA8A 3ADAC 1UW9A 1FRHA 4QZFA 3KUHA 2M9KA 2MQLA 4KHPF 1SL0A 1AUSL 5F3XB 3FFIB 1SV4A 3CTRA 2EC2A 3PO5A 4WFAQ 1Y88A 2VL1A 3GILA 4QZ8A 2HI0A 2JWNA 2MGZA 3M8QA 4NWIA 1WTBA 2VG5B 5CYMA 2PFFB 1M1KT 5GTHU 5AM2A 2C2ZB 4M5MA 2MXYA 1X2IA 1G6BA 3M6XA 1VJQA 2DGWA 3JAMY 1YQHA 1SKSA 4WBFA 4DG1B 3QAUA 1FD2A 5AKYA 4ES2A 4UW9A 4UB3A 1XR5A 4OYPA 2HHWA 1JLCA 3E2EA 4YB5A 3UXPA 3BKTA 1KLMB 4TUPA 2Z0GA 1WEXA 1WELA 1JK9B 2E9RX 2EVZA 4F5OA 7ICOA 2WVEA 1WHVA 3OUYB 1AB8A 2RF2B 2KJWA 4I4BA 1PBAA 1SV0A 2NPFA 5LMNJ 3T6BA 4LIWA 3ELHA 4KQZA 2Z57B 2JRSA 3G6YA 1H0HB 1ZXIA 2R2RA 4A4JA 2QLBB 4M5JA 2B4PA 2D8CA 4USTA 3FFIA 3H8WA 3GE9A 4DOZA 5HHHA 2KVQE 4GLXA 1VIOA 2FUG9 4RNFA 2DHAA 5IQQA 1F5BA 2HPUA 2GIFA 4WKRA 2VG5A 2K60A 3ORYA 2YWFA 3Q83A 2V9WA 3BS7A 5KG2A 4D3GA 4RX6A 1GXTA 4N41A 4FN5A 2W9BB 3ONQA 4ZITA 3DRPB 4DG1A 3T79A 3OL8A 2FMQA 1YHQS 4DZDA 4O9MA 1Z1VA 5AKKA 2UUCJ 4M9JA 5ALOA 5C24B 3GG0A 4JI3F 5K8OA 1KLMA 5KG3A 1S0NA 2ZJPQ 3F5AA 4NA2A 4HHUA 3EMTA 4LSNB 3FBCA 4FPIA 2DEIA 5J2NA 3OUYA 2RF2A 3N6MA 2EK1A 1J5EJ 2FY8A 2QL5B 3TKAA 4EMDA 2Z2MA 1HNIB 3T9ZA 3HHEA 1DY3A 4LRFA 1OIAA 2LKYA 5ALVA 5KFGA 3KFUF 3RJFA 3WK9A 1S79A 1QTNB 2L5YA 1T0TV 3WDOA 1RWNB 2EG1A 3VAIA 3H59A 1UT8A 4CYUB 3MR6A 1MWQA 3R7BB 2H1YA 5L46A 1RADB 4MF2A 4DR2F 4NMLA 4DFJA 3FJ2A 3UXOA 2F3NA 4RQ8A 2FMPA 2W9BA 4CTAB 3ZZOA 3NWGA 3DRPA 4U8VA 2HGLA 1HARA 1NM2A 1Z2ZA 3D1QA 1T11A 2JX2A 7ICRA 1VQ9S 9ICCA 3KK3B 3CIZA 3HHLB 1P1TA 3HD1A 2VKQA 3H2LA 5L38A 5C24A 4HACB 4PJ0U 1ZQHA 4WIIA 5CD4A 3BKUA 4WU3A 1L3KA 4LSNA 1U9LA 1HBNB 2MY7A 2VZ9A 3HSGA 1N32J 3AA8A 1RQNA 3D3BJ 2MKYA 4FBTA 2HHHJ 1W2IA 5HI7A 3EVWA 2B9YA 3GFKB 1D3WA 5E2QA 1DRZA 1FERA 1HNIA 3D9BA 4N76A 5E79U 1ZQTA 3QZ7A 2HOIA 1OS5A 2X3DA 4IRKA 1VK3A 4RBTA 4DV5J 3OL9A 1ZD2P 5IS2A 1SJFA 4X4QA 4QPXA 5ALPA 3RRKA 1YITS 3M30B 4KLSA 4EEYA 3G82B 3RBZA 4X5VA 4CYUA 3FYHA 1HWUA 2ZNYA 4P0QB 4JV2A 1N5YB 1WWUA 1GK8A 4BJQA 1V6HA 2DISA 1X4GA 3GFHA 2B6AB 3FQKA 4OI0A 3FCHA 3QNWB 2DBYA 4CTAA 1K1SA 5G4DA 3I32A 1V38A 4GKJF 5J0PA 3UPQA 4M8LA 3KK3A 3HHLA 2FIUA 3S01A 1C1BB 4LJMA 4DL2A 1BQXA 3SI8A 4HACA 3ILIA 2W24A 3D5MA 2WRMA 1NHKL 2BCRA 5DB8A 5HN0A 3ICLA 3BV8A 2G07A 4C80A 5KFWA 2NR0A 1HBNA 2KT3A 1MG7A 5IFMA 3ZDCA 4QZGA 1N4LA 4JI4J 4GIBA 1DK3A 3WK8A 4ZPVR 1S10A 2W9MA 1UKUA 3NLCA 5D4LA 1WHYA 3LP1B 4DUYF 2ZM6J 2J0WA 4K5SA 3IHQB 4NLXA 4UATA 2R42A 4MTPA 4WKYA 1X4EA 3NMAA 1WOSA 4C0ZA 1DGSA 3M30A 3M7VA 3G82A 3GDXA 2D69A 1ZQOA 4C97A 9ICOA 5ALQA 4YFKA 1WEYA 4U8YA 2IM0A 4P0QA 5KFSA 5L1MA 4ZPCA 1N5YA 3VAGA 5ALJA 4E0DA 2B6AA 3O44A 4PHEA 3OXFA 4DLEA 1GX5A 5GAGI 3M8WA 1L8OA 1JMTA 2HK2A 3JTPA 3BR8A 1UETA 3OHAA 1C1BA 2QFJA 1F44A 3EXCX 5JTIA 4CIOA 2WB1C 3QT7A 2K4EA 3FMWA 3VTIA 3S6JA 1GT8A 1SJ1A 4CO5A 4QZHA 5EDWA 2I9GA 1S5LU 1GNKA 5LJ3Y 2C3YA 3CCSS 2E29A 3QATA 3W64A 4DEZA 3AHPA 3N7PD 4F5QA 4KLLA 2ZFHA 5HMXA 3CB4A 3K7RA 4KGKA 2H3FA 2GX8A 1FRMA 5J0TA 3OHBA 1XQIA 4QNLA 3R7SB 5CAAA 1FA0A 2A1BA 1B64A 1SL2A 3LP1A 3NS5A 3TFSA 3FEYB 3AD9C 1RT4B 3ZZYA 2NZ4A 2CYYA 5B66U 4DV2J 1K8AT 2E5GA 3R3TA 2NO4A 3KZXA 1S1VB 1TKXB 3CJRA 1D8LA 1RUSA 4F4XA 5D6GA 2VBWA 1VBYA 2HZCA 2D9PA 2ZH4A 3R5DA 9ICAA 2D9OA 3KDNA 4ELVA 3JTNA 4ECXA 3BPSP 4HDHA 3N4WA 4KTQA 2F9JA 2CA9A 4K50A 1QUVA 1WD6A 2YX7A 2ZXHA 5A8KB 1ZQRA 1UFKA 1B4SA 4C98A 5KFDA 4ETXA 3TP2A 3NOCA 4WFYA 2C42A 3W8PA 2CXEA 4Z37A 2Y0SD 3BSAA 2X1FA 1RCOB 2F7VA 1BPXA 1HJPA 4P4OA 3KLFB 1EETB 2D74B 3QLHB 2DNLA 2VICA 3BO4A 4OJ1A 2BKNA 4HH1A 4BWMA 2ISPA 3GPAA 2RE1A 4ED1A 1S1XB 5DB9A 5GAHU 2V2QA 4TN2A 2VDHA 4UB5A 2G09A 2RS2A 3MMBB 1RT4A 4Y2CA 2Q66A 3BSNA 1IBLF 5KT6A 2MJNA 2MB0B 4MFBB 3UD4P 1S1VA 3PYEA 1TKXA 1U7LA 2UXDF 3DFEA 4LF2A 3R5CA 3OFEA 2E5JA 4N8OA 3QSYB 3H7IA 3H90A 2XY7A 2RHQB 4RT2A 3RBEA 3EPIA 4PXEA 1DXSA 4B3RF 4J9KA 4PABA 4UB6U 2R7WA 9ICUA 2QN6B 1ZRMA 2BJ7A 2GMHA 2M9NA 5A8KA 4RPZA 4Y28C 3H5SA 3CJTA 1HNZF 2M2BA 2IJRA 1LEOA 1H2UX 3AU2A 3EVOA 5EN1A 5ITHA 5ETLA 2G2ZA 2KIWA 2MUTB 1K0TA 2J6UA 2QV6A 1S12A 2BM0A 1UVMA 2ZBIA 4DCOB 3KHRA 4K4GA 2V8HA 5IWAJ 3KLFA 3CD6S 1EETA 2OPRB 2OMLA 3UN3A 4F5RA 2APOA 2XMVA 3FBEA 2AU0A 1LK5A 1LXNA 3UE2A 2W01A 4OV1A 2VA2A 3KLGB 1S1XA 2V34A 3QWPA 3HT0A 1B3TA 5DM7Q 1UCVA 4HKQA 2KKHA 2XY6A 2HMXA 3SCJE 3IM1A 2DT9A 3T1AA 3MMBA 4CLSA 2DGZA 1TL1B 4DPTA 5MAOA 4ZKAA 2G0JA 3TAMB 4MFBA 3U1LA 5J1EB 4I2QB 2ZHOA 1OUQA 3MCMA 3GV7B 3KUGA 1VDVA 2B5JB 1FRKA 3J7ZT 2CPIA 5DBAA 1N5SA 1S6UA 2FPMA 4OJ3A 1BMQB 3ZDBA 2KU7A 4F7VA 3W2VB 1PKUA 3TARA 3H42A 1FTCA 5KNIA 1FO4A 1PJ7A 4C8OA 3W9IA 3OVAA 3FCVA 4URQU 4YOEA 3PX0A 5C7PA 2BW7A 2I1RA 1NZBA 2FJAB 1Y5LB 2MHNA 2PMZC 2V8VA 1WF1A 2MUTA 5AIAA 4DHVA 5J0XA 2Z4PA 2BANB 5CD4H 2UXCJ 3P8BB 5ALGA 1ZQQA 2R8JA 1U6FA 1X4FA 4Q5VA 7ICKA 3HCXA 5B5EU 2I0XA 2LQJA 2OPRA 2UUTA 2AZ3A 4YFUA 3MFHA 4DN0A 1NK4A 1Q4RA 4ZH4A 3PFEA 2YWWA 4MYTA 1HNVA 3QFWA 3KLGA 3A13A 1RK8A 2W9AA 4OYXA 3HF5A 2IVMA 1U8SA 1GH8A 1SKUB 3W8GA 2QYCA 5B7WA 2MLYA 1ZQUA 1TL1A 2E5HA 1Q79A 4JYAF 1OQ3A 3TAMA 1VMBA 4TXSA 4PHDA 5J1EA 2VJUA 2DXEA 3TADA 4UZCA 4I2QA 1EIYB 2I2YA 2C3MA 4WFNQ 5KFZA 3DDNA 2RQ4A 2B5JA 4X64J 3D3CJ 3A3PB 2YQ0A 1S7IA 2Z2ZA 5ALDA 2HGNA 2D6FC 3ISZA 3I96A 3AOCA 3NRWA 3BGFA 5AM3A 3CD5A 3P5BP 1V85A 1HEKA 4CQ1A 2K8CB 2CNLB 4QIWC 1S4EA 3QUQA 2UUWA 5AI4A 5A2QY 3HSZA 1VQLS 2RQKA 3RBDA 1SUQB 4DSEA 2BANA 3LGHA 2C2MB 1NNDA 2HW3A 1SQGA 4NI2A 5JMNA 1OSCA 2Q6BA 4DV7J 1RG6A 3UR0A 3MR2A 2E8NA 2J7UA 1W7WA 3PRVA 1XR7A 2QJ3A 2HHXA 1V5IB 1R8AA 4U7UD 3DN9A 1JLAB 3D0HE 1FFWB 3LGNA 3TZZA 1H98A 4DR1J 5LMNF 1ACMB 1FVQA 3T6JA 1PAEX 3SV3A 4Z6CA 4KHRA 1N36J 3EUNA 2ZH3A 4KN4A 1D8BA 3CP8A 3HW8A 5BR8F 2XMAA 5KFVA 2JZ5A 2FHJD 3TR5A 3IV6A 1HD0A 4ECTA 3OR1B 5HVHA 1P9YA 4DUZF 3HVTB 5F0UA 3Q8QB 2DL0A 3CT9A 4OI2A 4USJC 1Z1BA 2KL8A 4J9PA 4CM0A 1KW4A 3H25A 1QE1B 3BKFA 4CLZA 1OO0B 2VOPA 3K75D 4OCZA 5LMUJ 1SUQA 3TA1A 4KX5A 2XYPB 5AXKA 2C2EA 3ISND 1RE1B 3C2LA 1RXOB 2M8HA 4B6JA 1Q3VA 5D0RA 2DHXA 4LR9A 1ZPVA 2E7XA 2R4FA 4KITB 4ECYA 3SCIE 2ASLA 3VZHA 2QYGA 4DLGA 2K3KA 3M1YA 2J9DE 4RQ4A 1NSPA 3BH7B 3VAJA 3MD1A 2VQEJ 2AGPA 3MEDB 2SXLA 1TL5A 1JLAA 3BZCA 1JROA 3Q2SC 3DRXA 3HFKA 2HWIA 2GQQA 2OPSB 4HHHA 2MQMA 4Y2VA 4NYZA 1T03B 1ZJNA 4L75A 2DPJA 2Q4TA 3UWTA 4CNZA 3QJPA 1UFWA 2XS7A 1RAEB 3GFZA 1J2NA 2D41A 3IXQA 2LLZA 3OBIA 1Q5YA 3OR1A 5AKGA 4KHMA 4ZOHC 3NGTA 3HVTA 2WOMB 1JMSA 1XNQF 1X5SA 5KFIA 4NL9C 2WF7A 2OEMA 2V5HG 2CQBA 3HK2A 5CP2A 7ICTA 3BQ7A 2CDRB 4C11B 4LVNP 1GO3F 3HJEA 1HQEB 5IOLA 2F77X 1NCLA 1QE1A 3KKAA 4JI0F 2OMOA 1CJUB 3RJJA 1HNWJ 4C0BA 4F5NA 5AHXA 5D0GA 3UCUP 5ALEA 3EWGA 1NK6A 1JI7A 4K0KJ 3NL0A 1ZQPA 2ZZTA 3DLGB 5IIJA 4QIVA 4Q44A 2CNNB 1KN5A 5C2CA 4NLQA 2EDUA 3MDAA 2XWXA 2XS2A 1PSDA 1N32F 2M8DB 1RZMA 4PRFA 1G1XA 1RYRA 4ZN1A 2OXOA 4ZJOA 3R8YA 3H8MA 2OPSA 2OJ3A 5HR6A 2ZKUA 4ED7A 3R2DJ 1R0AB 4C9DA 4FKXA 4IKAA 1W25A 3RUBL 4KLIA 1T03A 3DHXA 3PACA 3QIPB 4FXDA 4XDDA 2LDIA 1XERA 4LT6A 2P6RA 5DS7A 1RTDB 4DV5F 4LF5F 3MZIA 4P2FA 2LXUA 4MK9A 2A18A 2RMLA 4A46A 1KEJA 3L7PA 4M5LA 3M8PA 2WOMA 3L7OA 4KLJA 5J2AA 3LUYA 3EM1A 2DCLA 2XYHB 2QL9B 2YB4A 2KVSA 4C11A 3AXKA 4QZEA 1HQEA 2VQFJ 3Q8KA 3CRXA 2XSFA 4RQ2A 3K57A 1CJUA 4H4KA 2ZBCA 3QE9Y 2KFYA 2QE5A 2BMBA 4F36A 4YB1P 3DLGA 3WU2U 1V9PA 4B3SJ 3R1HA 4WP3A 5D15A 2OPPB 2HQCA 4YG2A 4I6YA 4TY8B 2J0XA 4DR5J 3GMGA 8ICJA 2H65B 2BV3A 1S6QA 1HHQA 1WUUA 1ZQZA 5AM4A 2RH3A 4CLLA 2UUAF 1RKIA 4RKUC 1R0AA 2BZFA 2MEWA 5DZ7A 4OI1A 2VJ4A 9RUBA 2HVDA 5E41A 3M9MB 2DH7A 1P1LA 2ESEA 3QIPA 2ZH7A 2E1MC 2FGOA 4CZCA 3H5YA 1RTDA 1WSRA 1KBUA 2GJIA 2X3GA 4EBCA 4F0HA 5J0RA 4L6V3 3VVUA 4F3QA 9ICBA 2CQHA 2FZKB 5J2CA 7ICJA 4FXWA 2DGXA 4P9SA 3WC0A 4LFBJ 1DTQB 4NM1A 4RW9B 2BPGA 7ICQA 4PXBA 3DU6A 2PIIA 4HAIA 4C8LA 3M7DA 5GADI 4P10A 1Z4UA 4O3PA 1DGJA 3G96A 3K5PA 2DB1A 3CNHA 3J81Y 5AXLA 4LR8A 1R89A 2W11A 1PVRA 4EU0A 2DNHA 1F3FA 1JKHB 3C19A 3Q86A 4NLVA 5KOWA 1M0SA 1H6KX 3CO0P 3W63A 2WF8A 5AI0A 1K47A 3R7NB 3JYTB 3SCKE 1NOMA 3SMVA 1RLDA 2OPPA 2HVZA 2XHWA 3BGUA 2KKVA 4TY8A 1NPKA 3SAFA 2MQPA 3FMBA 2UV8G 2NQPA 1I3OB 3I6PA 3V6HA 1ZQMA 2IHMA 2QTWA 4I0WA 4P7TA 2H3QA 3ETRA 3GCWP 3TJ9A 1K9MT 4OLPA 4DV2F 2X7IA 2BCQA 4GO7X 5A6WA 3GG1A 3CJ4A 5F9LA 4DQRA 4W98A 2JJ4D 3M6VA 1M5PC 4EO8A 4RW9A 4I1TA 2ERRA 1D8YA 5L9NA 2GWSA 3MF5A 1Y3KA 4FF3A 4X4NA 3EICA 4B9MA 1UVJA 3UQ0A 1FFUA 3N9UC 2V9KA 2K8BB 3J7YU 2BGWA 1J27A 7AT1B 8ICGA 1N5QA 5HMMA 1HI8A 3FQLA 3PRBA 2CRXA 2BA9A 3R6GB 1JKHA 4EX7A 1HR0F 2FJXA 2G1HA 3D0IE 3M05A 2F9DA 2FVSA 3UPFA 1KQGB 2VPWB 5B0GA 1J97A 3BN4A 4DPOA 3G4SS 2QKQA 3D6JA 2W1BA 2RLTA 3BSCA 3HRDD 1EHWA 1ZM9A 4GC7A 3AL0B 5C5JA 2HBZB 2XGQA 2LVWA 2CQIA 4UB8U 2W43A 2DHSA 2KV2A 2XI2A 3C2PA 1T8EA 1U0SA 3CJSA 1FE0A 4DX5A 4U95A 4AYBF 4DOBA 2AQ4A 2WW8A 3QGPA 5D49A 3BF4A 4O3RA 5ETMA 3D66A 2F1JA 1F9EB 3MM7B 3D6HB 2Y8WA 5DDOC 2LEPA 4M63A 3V5RA 1REGX 2K4PA 1KHVA 4QZ9A 1N54B 2ZVIA 4J9RA 4JV5F 1BNOA 2DCUB 3NG8A 3BBBA 4WE1B 2F8LA 2JFDA 4WTOB 2EAPA 3C8YA 2AYMA 4Y2QA 4AP9A 2HAFA 2A0FB 1LWEB 1HWKA 2HWTA 2WVFA 4XPCA 1RISA 1AROP 1N56A 4M1KA 3AOAA 1VQ8S 3R27A 1RT6B 3CMES 3IDWA 3IRXB 1SIWB 5ETRA 5I42B 1YLXA 1JALA 1PYOB 3V7KA 4ZCMA 2GVZB 4NCGB 3UMBA 3FZ2A 5CZXA 5AJ3J 4WP9A 1X42A 2P35A 2WAQC 3CJ2A 3CDBA 5DLFA 4KLOA 1E6YB 1TE2A 2WCXA 3T5KA 3F2DA 2V94A 4YD1A 4TU7A 3LANA 3MM7A 3R97A 2PXIA 3M8RA 3PNCA 3OVBA 2P8IA 2D7SA 4OJ5A 2JDJA 1PYTA 1HMVB 2RQMA 2DRDA 4QW9A 3F5EA 4CGZA 4X65J 1W26A 4O3SA 3GR0A 2HAIA 1DQ8A 2WZ1A 1H3DA 1SV0C 2IRXA 1T3QA 2BPCA 3B4MA 4K2XA 5F3TA 2B0CA 5J2HA 4MH8A 2UXCF 1PK3A 4IC9A 4CO3A 4MJKA 3FM9A 1LWEA 3F0NA 2HS3A 2POKA 4O4GB 7ICHA 4Y2RA 5KT5A 3THTA 3SYZA 4Q2LA 4WPAA 4KLEA 1Q7LB 1RT6A 4BLGA 5F8NA 3KNAA 3IRXA 2E9ZA 4ELTA 2ZH9A 4E2FB 2RKIB 5I42A 1MN8A 1Q81T 4UAVA 2GVZA 4NCGA 4RZRA 3RH5A 3S7RA 5JU5A 1SCJB 4C3KA 2ATCB 1WC1A 1VCTA 1S1UB 2F44A 4QWAA 1E6YA 1VGYA 2DNMA 4ZJQA 4N5SA 4DR6J 5G5GA 5AI8A 4X64F 1C20A 3MMCB 4RT3A 1BLUA 1B22A 3C21A 2YMLA 4KH1B 3MPUB 1C7YA 1WEZA 1MWYA 3D6FB 1VRQC 4BX9C 3RAQA 3SBMA 5J2DA 4QYRA 4O0NA 3OFFA 3ENVA 3D6TB 8ICEA 3ITHA 3TI0A 2O1PA 5LXRA 1WSVA 4NCBA 4QJVA 1TL3B 1LW0B 5DG9A 4NLBA 2IOFK 2XLKA 4EX6A 3LPYA 2GNKA 1G2EA 2U1AA 5HMZA 4PZOA 4G1IA 1X9SA 2OKQA 2ES6A 4U96A 2AHOB 5I4MA 3ZD8A 1T3NA 1EXNA 4CO1A 2OO4A 3CCLS 9ICRA 1QD1A 3VAFA 2N4CA 1OMSA 4I67A 2YTUA 3UQSA 2RKIA 3GU0A 1YWXA 3J80Y 2OD6A 2AGQA 4OD0A 1Z19A 1IXKA 1TUWA 4URGA 3BB5A 4DR1F 4J90A 3H4BA 2VF3A 3DC2A 4KGXB 2E9TA 3OT9A 2ZUCA 2CFXA 4XTTA 5BPCA 5EWGA 3EZOA 1S1UA 3PNIA 2YPZA 2OPQA 2HBKA 3FRYA 1X0FA 3TJAA 2RUGA 2HDOA 2QLFB 5KG4A 3ENAA 5DG7A 1RHJB 2ZEJA 4NASA 2JR5A 3QAEA 5G0RB 4F02A 2BABA 2ZJAA 4V19J 1FNXH 2BJEA 2NRXA 8ICMA 1URNA 5HSPA 1JIHA 2LA6A 1TL3A 2RDIA 2BCVA 1LW0A 1L7PA 1ZJMA 1S59A 2QB1A 2RQCA 4RNOA 2PC6A 3FSXA 4J9MA 1XK8A 4P75A 1N5TA 2I38A 1WG1A 2QMXA 1MSWD 3BQTA 5C42B 3PSFA 3D2SA 2CJAA 4MK7A 1Y00A 1F5SA 4YXJA 4QZAA 5F8HA 5DQHA 4C0OC 1T9VA 4USVA 2CG8A 3UO0A 4J7CA 3A8IA 1TKZB 5J2GA 4R25A 3CC2S 2ZIXB 4NPOA 5H9FK 1NDLA 1FWKA 4KO0B 1RXVA 3B4DA 1Q46A 3I31A 1SKWA 4OJHA 2AGOA 4DV0F 3I9V9 4GFJA 1ZETA 5A76A 3J7AN 2NYIA 1SGGA 2OLWA 4QOTA 4GKKJ 2I9SA 4DFMA 4O5KA 2WF9A 3B54A 3WHIA 2AYEA 2B0GA 8AT1B 2XBPA 3HHLC 5HK4A 2CPFA 4CLKA 1PVQA 4PKDB 1NRKA 3M32B 4A8YA 1FFSB 3VGSA 3WQPA 2D3UA 5HHIA 1RP5A 3RJGA 1SIZA 5D0HA 2ZBRA 2M70A 4NXZA 1C2PA 1RABB 1HQUB 2CQCA 1J2MA 1PAUB 3HJVA 4C4RA 3TAQA 1HNWF 5L9XA 3IA0A 5ALZA 4NLYA 1ICEB 5C42A 2RRBA 2RT3A 2I1QA 4K0KF 3NMRA 3DYAB 4RPFA 1FJEB 3WKEA 4B9SA 4BC9A 4J9VA 3UD5A 3OL7A 2H4YB 4R66A 1M1GA 1CQNA 2PEBA 2IFXA 1UMJA 1TKZA 5KT2A 1CQMA 1ZOTA 5JRTA 2OTLS 2ZIXA 4DFPA 4KO0A 1Q16B 3EJMA 4AL7A 2WF5A 1ZQ1C 2Y1JA 4LF7F 3NGUA 1TTHB 4DF4A 3D4JA 4CO4A 6FD1A 1L7OA 1RYUA 2V6AA 2JXJA 1RAFB 2B3TB 2OTJS 1XR6A 1R27B 1V3SA 5BYSA 4FE3A 5J2BA 3B78A 2KHVA 4NV0A 5JXSA 4NCAA 4PH5A 4KMUA 4Z6EA 1O0PA 5HANA 1KOOA 2NS1B 2XTJP 4PHAA 4PZVA 5B09A 1ZQJA 1J2VA 5FLXY 2PE8A 2WBMA 3RR8A 3IWNC 4RUCA 3LP0B 3WIUA 1VQ7S 2YH1A 2EFNA 4KGZB 3NWRA 4F8RA 2VQFF 3Q8PB 1HQUA 1WKLA 4MK8A 5TZVA 4I2FA 3OFHA 3RJIA 4I56A 5E7OB 3D1HA 1RTHB 5ETSA 4KHPJ 4XDCA 1BPBA 3VAHA 5AK3A 1B70B 4IL6U 4EO6A 4TQRA 1BXNA 4P2MA 3DYAA 1NB7A 2JH7A 1HD1A 3M8ZA 2N82B 4B3SF 1T02A 4RLEA 2B9WA 2QLTA 2DPIA 3NVZA 1HBMB 4QJFB 3GLJA 4JV1A 1TR0A 1PUZA 1IV8A 4DR5F 3UXNA 1SKRA 3LPEA 5KFTA 1DK2A 8ICBA 2DKOB 7ICPA 2FVQA 5CZVA 3UR3C 1U6ZA 4YR2A 3RU0A 4NMXA 3QYPA 8ICFA 2MSNA 4EUVA 4B02A 2XNRA 1SI9A 1HW8A 5EGYA 1TELA 2GIQA 3OFGA 2V63A 5E33A 3HKZC 1WDDA 3QGHA 4LREA 4KGMA 1ED1A 5AKXA 4DFKA 2I5HA 3QZ8A 7ICLA 2QRRA 2MZJA 3B82A 2V4QA 1B0PA 3QT8A 3C2KA 3KG1A 2LYBA 2PFPA 4LFBF 5BYRA 1EX8A 2HNYB 4WTYA 4ZJLA 4OJPA 3MR7A 3B0XA 3NS1A 4ECVA 1NXIA 3LP0A 4NZ0A 3A8KA 1RCXB 3MD3A 4A8MP 2G13A 3CYMA 1BC6A 5FD1A 3M9NB 3EXYA 3H20A 3G6ES 3BEGB 4P2HA 1RTHA 2E1PA 3KLHA 1PJ5A 4MF8A 5GAHI 4I6WA 4NLNA 5J1NA 4DJBA 1OYEA 2H48B 3W65A 4DZ6A 4K4SA 4A47A 2D3OR 5KFRA 2W2PP 4C8MA 1HWIA 2GO8A 4K4XA 1HBMA 1XNRF 8ICVA 2J0QD 4X4UA 2MQQA 2DIUA 1S8OA 1ROFA 1ELOA 1OQ6A 2JOQA 3LAKA 2IYIA 1U2RA 4QYZJ 3PX6A 2HNZB 2QLJB 2Y9HA 5KFOA 5B0AA 3UI3A 1V97A 4MKVA 3MECB 1SBRA 4ZVTB 1NLKL 4XQ8A 2RNEA 3PZPA 1FEHA 3M8YA 4JI3J 3H2UB 4YB7A 1A6LA 3I28A 2R7OA 1U2FA 4YDXA 2B21A 2NCKL 3MPVA 4WXWA 5ETQA 3OJSA 2A10A 3T5JA 2HNYA 2EK6A 4IOCQ 2XCAA 2BQRA 1Z1ZA 5EOZA 2GA7A 2DR7A 4DSLA 5DKWA 4CNQA 1U8WA 2GO7A 1Y9OA 4KLHA 8ICIA 4F4ZA 5ETKA 3F44A 3MUTP 2MY8A 3QU5A 2PSZA 2XMWA 1S5ZA 2ZUBA 5ALLA 3D6MB 8ICUA 3V72A 2MLZA 2OEKA 2LU1A 1GMWD 1G7CB 2RUSA 2CQDA 3PHEA 1NB2A 2JRZA 4PQUB 1NEEA 3Q8YA 2IC3B 4IUFA 1B0XA 2DKXA 1XSLA 1RHKB 1MA7A 3AQEA 3QEBZ 2FVRA 4CNYA 2IM2A 1NZPA 5CYQB 4JP8A 4G3IA 3EZ5A 3MEEB 2HNZA 2JEJA 2AEJA 2NXJA 4PG7A 3BO3A 9ATCB 4I2DA 1HUZA 2GZOA 3P5TL 5JJBA 3MECA 4R63A 1RU2A 1G3OA 2O67A 2JVOA 2BRLA 2X1BA 2Y1IA 1UJ4A 1NPRA 2F1HA 3CD0A 1KLNA 2W9CB 4IQXA 3JQJA 1C0TB 2B43A 4O3OA 1KQQA 3KLEB 4M47A 1HL6A 3N5FA 5A2QU 3JB9k 4Q8FA 3SEIA 1FDAA 1N5VA 1BGXT 1LW2B 4DU8A 1U24A 1R7IA 1VC5A 4CP5A 3AUOA 2B8PA 5A0YB 3ISCA 3H2VE 2PEHA 2RDDA 4C3MA 3ZI4A 2OIHA 4CH7A 5K8PA 1F6TA 2D1CA 2AXTU 1KOHA 3C5GA 1N48A 2Y9TA 1TAQA 3TADC 5KFMA 4PQUA 1IKVB 2L3MA 3CGIA 2LM1A 3N5BA 4PL2A 3GU3A 2UUBJ 3AQFA 1DURA 2PFQA 3IC1A 5CYQA 4UW2A 3PJ9A 2JH1A 3MEEA 5AE2A 2B9XA 2ZNZA 4CCHA 3H8JA 5AJ3F 4Y2XA 2YNHB 3AQPA 4EI2A 3D7SB 2QT7A 1SJ3P 3FSIA 2GQCA 2IA6A 4YY3J 1CLFA 4MAKA 4E8UA 1KQKA 1NZ8A 1T95A 1MNEA 2EI5A 4K4ZA 2W9CA 2X1GA 1ZTWA 1C0TA 1XBWA 1WORA 3PEJA 3SD7A 4R0EA 3KLEA 1BY9A 1IWAA 1NKBA 2AX1A 2XIDA 5L1IA 4KLGA 1LW2A 2KZMA 4X65F 2E8MA 4W90B 2BHNA 1TFRA 3BS5B 3Q8MA 2RVJA 5KG6A 5A0YA 2IOHA 4RU9A 3PDNA 2AF6A 2E7VA 3BGOP 2Q43A 3ZZZA 5AXNA 2A1JB 5C0YA 3SAHA 3MMJA 4PXDA 2IMWP 1JJHA 1NHUA 4OMFG 1MMNA 1IKVA 4FS1A 3V81B 1B43A 2JL9A 5GTIU 3ZTRA 1T9TA 5DO2A 3OLAA 4RUBA 5D77A 3TX0A 4JOUA 4L73A 5E5NA 3QO9B 4YMNA 3DLEB 4ZLJA 1QQ6A 4KLFA 5AK5A 2ZVSA 3S6EA 2YNHA 4ICLB 2LXFA 5F3ZA 2AEFA 4P4MA 2CPHA 1Q8KA 4Y2MA 4PWWA 2W3RA 1WDTA 2QSFA 4FDFA 1OY8A 3E3XA 3NCQA 3PSIA 1SXDA 4I6AA 4DR6F 4RBUA 5E3RA 1QSYA 2CQPA 3I55S 3AAWB 4X62F 4LZDA 4JI1F 5J0WA 3HULA 3JS9A 4I29A 2ZITA 1IBKF 4K4HA 4NLKA 3CEDA 4LRAA 1JXLA 1U26A 4F67A 3VQTA 3NP5A 4J9UE 4MKYA 3BQ0A 4YHHF 3RAXA 1YRUA 3SSRA 3DHWC 2XYGB 3BS5A 1RWUA 3DKDA 1LKYB 2XY5A 5DB7A 2A3VA 4US8A 5AM1A 2QA2A 1ZPWX 2LYVA 1T9WA 2OGUA 5DGAA 3HT3A 2ZIUB 3VGVA 3NY0A 3TUPA 2A1JA 2RP5A 2KZ3A 2FLLA 3V81A 4ZP7A 2J7KA 3GSDA 4LF9J 2AD9A 1JN3A 4UTGA 1C4AA 2FVCA 2Z30B 4A8XA 1EQMA 1U1LA 2Y9UA 5LSLA 1LWXA 4DOAA 1WC0A 4P2SA 3QO9A 4DL0C 2ODGA 5D3GB 3DOKB 3DLEA 2R3VA 2CRLA 4KKOB 1H2VZ 4ICLA 2DNNA 1UW4A 3JQKA 2W8KA 2UZAA 9ICKA 3KKAC 2OCEA 2J9DA 4G9BA 3CNQP 5IIIA 2IBOA 2XMMA 2DXFA 1RTZA 3M6UA 1BPDA 4AYBD 3B9JA 1QUPA 4USKA 2CQ4A 2MKCA 4DF8A 4ZS6A 3K5LA 1RGVA 1HUOA 4JI5F 5AT1B 1BE4A 5B0FA 3WX8A 3OTOF 1LKYA 3GJSB 3QU7A 1FX4A 2J6TA 4GXKA 3JTOA 4NEYA 4BXOB 2IRUA 5ETOA 2ZIUA 1PCAA 2UXDJ 4US9A 2EFGA 3TA0A 4DX7A 3B0YA 4CLFA 1TFYA 1SL1A 2W55A 4ECUA 4A8FA 4B3RJ 3RH6A 5KFHA 3R5AA 3HSJA 1JLEB 5EWEA 2CQ1A 1QM9A 1FCAA 4Q8EA 5LM7E 5D3GA 4DSFA 1HW9A 3SSQA 4KKOA 1RXWA 1U1PA 1ZAVA 1CC7A 1RA7A 3F2BA 5D0EA 3GIRA 4GKKF 4R5PB 4H4KC 2XEXA 3DM2B 1M5HA 3OTCA 1RHUB 4HR2A 4U67Q 3SMZA 2H5XA 2HVHA 1XC9A 4GO5X 4CRXA 4MYUA 4IQUA 5AKLA 3JQMA 3NASA 3E0FA 2HHPA 2FHJA 3QPIA 1NBEB 1Q86T 2AYBA 2HFVA 4KMOB 3P45B 2ZH1A 1HI0P 2ZDOA 5J2PB 1AT1B 2NV3A 4BXOA 4DL3A 1Q53A 4J9OA 3PIOQ 5AXMA 3CW2C 3DOLB 4ECQA 4N56A 9ICXA 2VONA 2HBQB 1RAJA 2FE9A 2XULA 8ICCA 2CJQA 4MKBA 1B0TA 4UOFA 3E01B 1AXQA 1RT7B 1JLEA 2BKEA 1LB2B 1F2GA 3SEOA 2BQ3A 3F41A 2JHDA 4X84A 4UUXA 5J2MB 2KVCA 2XZTB 2DXDA 4CDIA 4HTIA 2DNOA 1BHNA 1I51B 4A8SA 4RW4B 5CJ7A 4R5PA 4DQQA 3DM2A 4ELUA 2YTCA 1QCKA 4NOHA 4TYBA 5ETNA 3L9ZA 1B0VA 4RW7B 4JV0A 1HYSB 2MHEA 3NBPB 2HQDA 1GTHA 4J37A 4OZ5A 5J2KA 2MMYA 5AI5A 4XAKA 5HBMB 4OI6A 3PIPQ 1FWPA 1KFTA 2QIFA 3G9CA 2L9DA 4I2AA 3C46A 1X66A 1BD6A 2OELA 2FC8A 4PAAA 2I5JA 3TEGA 4X66F 2WB1F 5EE3A 5JUMA 4QWCA 1T9XA 3PW5A 1SXEA 5THWA 4KV8B 5J2EA 1R8CA 5GAEU 5J2PA 4JYAJ 2FC9A 4LRDA 3AFGA 1HWJA 3DOLA 4UASA 2RRNA 1UPPA 1NK5A 5KAFU 5MLCV 2XQCA 1XS9D 1Z2LA 5CA7A 3E01A 1RT7A 3KMQA 5KFJA 1UVLA 3KKFA 3G6VA 2YKOA 5HLFB 1CJVB 4ZVRB 4N47A 1S99A 5J2MA 3UN2A 4KX3A 1N34J 2LP4A 2YWEA 2GMLA 3K1RB 3MGHA 1ZQYA 5M2PA 1CULB 4RW4A 4C3LA 1L3TA 3J7YI 4ZPBA 5HQ8A 5BOLA 5B0CA 4RW7A 4WK1A 1AZSB 1HYSA 3NBPA 1RJJA 2NRVA 4EBDA 2GJ2A 5HBMA 4RBVA 3PKMA 3CSKA 3S8SA 5J2NB 2BE2B 3CJKB 3MBYA 2CZVC 1U6BA 2BUNA 4NYOA 2G1DA 1X9MA 4KV8A 4WF9Q 4MIBA 1RAIB 1L8LA 3FGVA 1LFWA 1QDUB 2DNZA 1IJEB 2G5IB 3LVWA 3K8WA 5BR8J 3I5AA 2YX8A 3PFOA 5CCLA 3W3SA 3QEAZ 4U7UK 5U47A 5E0OA 3CCJS 1VC0A 3PSPA 3U1MA 3KJQB 3ZZ0A 4DUZJ 2F4VF 1AA1B 2VC1A 2OD4A 4ZA1A 3MMAB 3KHGA 3QU4A 4DCPB 2DHHA 4R8UB 4N8NA 5HLFA 2YY6A 1CJVA 2YMMA 4KN7A 1TK8A 7ICMA 3W61A 4CLPA 2CWKA 4ZVFA 4RUHA 4B9NA 3P4UB 2W7AA 2CZ9A 3AD7C 1BQNB 4NLPA 3FEXB 3TYTA 2EQYA 1CULA 2B7BB 2C3PA 1C0UA 7ICEA 4O3NA 3JPRA 2LM4A 3BR9A 3NGRA 5AI6A 1AZSA 3MM8B 2F3JA 1SC4B 4RO0A 4MEXA 4ZDNA 4V1Ak 2R7VA 2M88A 3SQGB 5F8MA 2YMPA 4AE5A 2HYIB 1X5TA 3GIMA 2BE2A 3CJKA 4QR2A 2FB0A 3BDPA 5AKHA 1IKXB 3PM9A 1CI4A 3LF0A 1V9OA 4EFAC 1FKPB 1FHTA 2ZBQA 3V7LA 3AN1A 3KYLA 4DO9A 4WFBQ 1NJWA 2V8GA 3I76A 3K5OA 5HJXA 4JUZA 1J5OB 2NRWA 1VQ5S 9ICWA 1HA1A 1OSDA 1XNQJ 1S72S 2MKKA 3MMAA 5C2GA 4R8UA 1VHFA 1TVAA 2ROGA 2F63A 5B0BA 4JI0J 2E3TA 2BX6A 3GJQB 1N0VC 1BQNA 1IR0A 3M4XA 3R2CJ 2WONB 5D8HB 5HQMA 2EFQA 2RILA 5LXYA 2O5DA 2AIRB 2ASYA 1CS4B 3MM8A 3GQCA 5HROB 3K58A 1DBDA 4DU7A 4I7FB 2CJYB 2HK3A 3SQGA 4PYAA 3U7JA 4LUBA 5KFCA 4OX7A 1FVSA 1URJA 4USAA 1RBLA 1ZQDA 5DM6Q 1QH9A 2ZIVB 4OYZA 2PMZF 1N33F 4ZVEA 2CIMA 4RW6B 2QFIA 2DY1A 2CPDA 4JI6J 1IKXA 3TANA 1NJIT 4RQ7A 4J9NA 2XM3A 3FZBA 1JQGA 2DY9A 2AJQA 1FKPA 1TKTB 3QRPA 1GAOA 1X4AA 1ZM4A 1J5OA 3MEKA 3MI7X 4LF5J 1RPLA 3CIMA 2YB1A 4KSEB 3SIPB 2JEGA 1PG5B 4A8EA 2E1AA 5DG8A 3SDEB 4RQ3A 3J80U 2KFNA 2DNYA 1VK8A 4ER8A 2UP1A 2YQEA 2YKQA 4ILLA 4LRBA 4DXLA 3HP6A 1PO6A 2UUBF 3MTJA 2R7QA 2NYVA 1NJYA 4MIAA 5DBBA 2MQNA 1YBUA 1NZAA 5J2IA 2G2YA 2B6GA 3HXMA 2E8OA 4G65A 2WONA 7ICGA 3OTQA 5FP0A 3F2CA 4DSJA 2ADCA 4BBYA 4YY3F 1CS4A 4O5CA 2MZSA 4CM2A 5HROA 1N5WA 4LFCJ 4U6PA 2DITA 1V3RA 1N6QB 2K1RB 4I7FA 2KEYA 1RACB 5H9EK 4QIWF 5ETPA 2ZIVA 1BUXA 5CA5A 4RW6A 2KT2A 4M9HA 3M2RB 3W5XA 5DDMA 2UUAJ 2F5GA 3C14B 2F8EX 4WCEQ 3QRQA 4FBUA 2G4BA 4K5RA 1TKTA 1YZ7A 3CDWA 4C4TA 3FNNA 4KAIA 4PG5A 2ZXIA 4YMEA 1ZQNA 1Y11A 3SDEA 1MQ2A 1A7GE 2M0GB 5DETA 2MRLA 1U25A 4EZ9A 4CLTA 4GRSA 1HI1A 1NDCA 4M95A 2EW9A 1X60A 1NKEA 3RB3A 2KJ5A 5KL8B 4RPYA 1RTJB 3N7SC 3W7BA 2P66A 4IFYB 3ILJA 2Z58B 3JSRA 1LOUA 2VFVA 3CCRS 3K0JA 4CO0A 4DUTA 5DQGA 2QG9B 2YH0A 3I5BA 3DNCA 4RQ5A 2VBZA 2JC1A 4XPEA 3T19A 4RWWA 1ULRA 1S7HA 3NAHA 4USHA 2HHVA 2CPXA 2UVVA 1N6QA 2K1RA 4PG8A 1SB3C 1AYEA 5KT3A 4KY3A 1SJQA 4IG0B 4R64A 1U1NA 1GFWB 3L09A 3M2RA 3ZC4A 1QAIA 4F3OA 1TKDA 3C14A 1IBMF 4DV3F 3CCES 3RFAA 1UCNA 8ICKA 2KDOA 3I82A 1UQVA 1PVPA 3R1LA 4CRJA 9ICTA 1JX4A 2U2FA 4ICAA 4KIAA 2HS4A 1X40A 4W92B 2QMUB 3MPYA 4QIEA 1Q7YT 4LF9F 1QAJA 2EAOA 4MFAA 2DGVA 4FF4A 4C8NA 2K4HA 3LDAA 4PGYA 3OPXA 3OJUA 1RTJA 1PILA 4QWDA 4IFYA 8RUCA 4I27A 2O6KA 2H3IA 3IS9B 3BN7A 3IFEA 4F0KA 1OPZA 1UP1A 4NL5A 3QU9A 4ETZA 1VISA 1HR0J 5FLXU 3V6JA 2L08A 3AA9A 2AW0A 4ZN3A 2XMJA 4FYWB 4IG0A 3CPWR 5F8IA 4LF6F 4KLTA 1OW5A 2KJ8A 1YBTA 4F4AA 2HHSA 3RJEA 5T7LA 2M52A 1N60A 4G6VB 5DDYA 3TAPA 3T1YJ 1TQLA 2Y8YA 4PWUA 1KRPA 5LT5A 3V4MA 4YQWA 4QIGA 3ZD9A 2W8LA 1RSCA 2W4DA 3ICXA 3PCOB 2CWXA 1B4FA 4PQAA 2AJFE 2CN1A 4QR1A 2OFGX 4OYOA 1S57A 3G6XA 1RT5B 2PO4A 2ZUAA 3OTDA 3KOOA 2F1FA 2K3IA 4C6AA 1F9FA 3HILA 2ZKTA 2XLIA 1RT1B 1V5VA 5AM0A 4CE6A 3JPTA 2PI5A 2NSBA 4L72B 2RS8A 3I87A 3SQIA 4JV5J 3Q23A 3DRRB 1KQFB 3DLKB 1KKHA 2PA8D 3I0SB 2YQ1A 2YPYA 5CQGA 5SUHA 4IO1A 3IS9A 3ZFVA 5L1LA 3KNGA 3PYGA 2UXBJ 3Q89A 1X6IA 4I2GA 4YMOA 3CDEA 2L48A 2CNOB 2JZBB 3B8HA 2WB4A 2RQ5A 1KONA 1S9GB 4OLOA 1L7NA 1NJXA 1URRA 2L9WA 4U9RA 2DNRA 1HNVB 7ICSA 4NA3A 1FDDA 1NK8A 2CJXB 1LV5A 4ID5B 1KDNA 2KO1A 1FKOB 3FC4A 2KICA 4AFFA 2AJ4A 2LBOA 1FNOA 5IINA 1FIQA 3GTYX 3MFIA 4K2JA 2AH5A 2ZDPA 4PCQA 5KG1A 1U09A 1RT5A 2IAJB 2W2MP 2FD2A 1X5OA 3U26A 2MZ1A 2C2RA 2P6TA 2O01C 4J91A 2E5LF 4HYKA 4MKAA 2EZXA 3JPPA 2JGAA 1RT1A 2LQBA 9ICIA 3LOUA 2IBKA 3UNGC 2G0CA 2QLWA 5FDLB 3L7UA 2ACYA 1VQPS 3DRRA 5K20B 3DLKA 1O5JA 2CXYA 2UVWA 1YG0A 5I3PA 3I0SA 2K4IA 3L3CA 1VQYA 2BOPA 1KEKA 5IV3A 4HL9A 4C4WA 4LBHA 4BDPA 2JZBA 4NI2B 4ALZA 3NNHA 4WYWA 1N88A 1S9GA 4HI2A 2XC9A 1DAXA 3R6LB 1VRUB 3QWUA 3C29A 1NK0A 1JJ4A 2HVEA 2MZTA 4ID5A 3DV9A 3IG5A 1NUEA 1FKOA 2KHDA 3BBCA 4HVZA 5IV4A 2P6UA 5KFPA 4I2IA 4IG3B 6AT1B 3ZDEA 1ZQSA 1UEVA 2JEFA 1NK7A 4DCCA 2V2VA 3AD8C 2IAJA 3NUQA 2CJ9A 1HWLA 1R8PA 4BGDA 4DL7A 2ZTDA 1N61A 3HO1A 2N4DA 2J0SD 3JSYA 3KTQA 2E8PA 4ZP6A 4L3KA 5E3AA 3RRHA 2E1FA 5J0SA 5FDLA 4IH6A 2K2PA 2BPFA 3KLIA 2NZCA 3CCMS 2KKPA 3LWLA 4AUKA 2B56A 3MURP 2Q1LA 2KFZA 2G06A 4AQYF 2Z2YB 1N34F 2PFNA 2DNGA 3W5YA 4BHQA 3IM8A 1QQ5A 4NY8A 1IQZA 3MAHA 2HBMA 4FF2A 3A3OB 3PEHA 2F76X 5DDRC 1H7XA 4KH0B 5J1PA 1NJZA 1TV9A 1VRUA 4JB3A 1EARA 3IBFB 2A2CA 3VVTA 5IXUA 1WCLA 1R8BA 1SV5B 2R2TA 1XSPA 3ULHA 2JHEA 4WZMA 3PW7A 1Y10A 2LFVA 1XU4A 4QW8A 2XO6A 3P49B 3QJJA 4I2EA 4I68A 1HHSA 4AD6A 1U49A 3LH2S 3VAKA 5BXIA 4PG6A 4IG3A 1TV6B 3N79A 4F4WA 4I2BA 4NRUA 3D28A 4J9QA 2XZDB 3UD3P 2W4PA 2C2DA 2DK2A 2RB7A 2JFKA 4H4OA 3SFUA 3RRGA 4ED8A 2I6WA 5K8MA 1Q0NA 1TMJA 1JLBB 2YWGA 3V7JA 3MABA 5KOXA 3TZWA 3NXZA 1HHTP 4LQ9A 2LYHA 1ZS6A 3TEHB 1TVRB 4DS5A 3FVYA 4OFZA 4DMZA 4X2BA 2KE7A 2HIQA 4UAZA 4WFZA 4KPCA 3RZAA 3SQOP 2AP6A 4UAWA 2ROEA 3HVAA 4AXJA 2W03A 4BWJA 2DUYA 4UB4A 4NZ7A 1UVNA 3Q8SB 4ED3A 1ZQLA 4M9LA 3FBBA 1FX2A 1ZM2A 3DRSB 4DL4A 2QSWA 4KLMA 2W7OA 2RSQA 2BKOA 1UJ6A 4DOCA 2DR8A 4UF4A 4XUSA 1SV5A 1Z3EB 2ALZA 2BVZA 4O23A 1GXLA 2FDRA 2Y0SC 5F0WA 2KMDA 1UJ5A 4DV0J 1FDNA 4DV6J 2RRAA 1M5SA 1TV6A 2KOBA 3ET6B 2DRAA 2ILZA 1K73T 1UVKA 1RWKB 2ZOMA 1JLBA 1DHMA 3MDCA 5AKEA 5LSRA 5ALXA 4PUOB 1KTVA 3W66A 1LNQA 3M8PB 1TVRA 1XTZA 2WFAA 2MKHA 3F73A 2DGUA 4K8RA 5CH7B 2EANA 2NO5A 2WAQF 1WC6A 4ED2A 3QIDA 2ZOGA 2RD5C 2ZJ5A 1U45A 4CH0S 5K4LA 2HOFA 2A19A 3HVRA 4LJXA 3CF5Q 2VH7A 3GFXA 4IH7A 2KVIA 4YVZA 1RT2A 2ZH6A 3U1NA 1R6VA 4UB2A 2F1IA 2KXFA 2DGSA 3GWCA 4FVMA 2JH3A 5FJ4A 1ZZFA 2ZWOA 3AOBA 3DRSA 2K8GA 2ZTCA 3L5KA 2HOQA 2XG8A 3UCGA 4BS2A 5D46A 3PW0A 3OXGA 3TFRA 4KFBB 1JUDA 1S6QB 1GTEA 1GXUA 4JI6F 2V4JB 4TUQA 2H3ZA 3SCLE 4LF7J 3BYPA 4TKTA 4IR1A 2FJBB 2F65A 1EJ7L 5RUBA 2DVIA 5DRKA 2LXIA 3NCPA 3QSIA 3CCVS 3G8TA 5KAKA 3ET6A 2XB2D 1EB0A 4ED5A 2WB1D 1H72C 4IRDA 1P8GA 5A8WB 2C2KB 5IZHA 5KFYA 2F40A 4M5IA 3H5UA 4PUOA 4JBCA 4DR7F 4F91B 3PYFA 2XNQA 2W2NP 1GMWA 5J2JA 3AEVA 3ZTSA 2W04A 4B17A 3E51A 3BREA 3HM9A 3HZGA 1O8BA 4DV4F 2HS0A 2KM8B 1RI7A 2BKPA 4YP3A 2YX1A 1PYSB 2YNFB 2ZC4A 3HPOA 1PJ6A 3CJ5A 4F4KA 2V50A 3M1VB 5ALYA 2QA4S 3EGZA 1R3NA 3CDUA 9ICVA 2PFDA 4RPXA 5J0QA 5KT7A 2OI2A 4PPZA 4LFCF 3A8JA 3D2NA 1MN7A 2VIXA 3GIIA 2DO0A 5B0EA 4IDKB 2E7WA 4IS7A 9ICJA 2CQ3A 5BYQA 1FDBA 4KFBA 1A9NB 2P5VA 1FJCA 4M6WB 3M6KA 2V4JA 4LF8J 1YJ7A 2NUHA 2GC8A 2W25A 1X4DA 3ILLA 2WTFA 1LVHA 1T4GA 5G5HA 3UDEA 4Y3CA 2LMIA 4OO1J 2OHDA 1AUDA 4UAYA 5A8WA 2BE7D 2IRYA 1WKKA 1S48A 5IC6B 1MROB 4LBIA 1L7MA 2OEHA 4M9NA 4WJ3B 5CABA 2J9EA 4UARA 3DLJA 3IAM9 4RU2A 4OHVA 2N7YA 3IG1B 2PMHA 4FYDA 4G1PA 3A3NB 2YNFA 5HR7A 5KFEA 3M1VA 3I56S 3IN5A 3DLBA 4M94A 4TLQA 4PGXA 1UZDA 3IO1A 4LF4F 3MTKA 4TUSA 3HWTA 4ZHRB 3MOZA 1XMQJ 5GMEA 2BDPA 1NKCA 1G4CA 2ZIWB 4FNHA 2W3SA 3JSBA 3DXSX 3VAMA 1XNRJ 4IDKA 3ETMA 3PMLA 3PSTA 4FZNA 5KFNA 4NA1A 3PVXA 4ZP8A 4QZCA 3IR7B 4M6WA 3A1YG 3G8QA 2G08A 1COKA 2VG6B 1RHMB 2H5JB 3KJFB 4I2HA 1FWLA 5AK6A 3WIVA 1SQFA 4DX6A 3QNMA 3RTVA 4OZ1A 3D68A 3T9NA 1GEHA 1NI3A 2XSJB 3BH6B 5L8RC 4L76A 4GXIA 3I1YA 1E6VB 3A4TA 2BBEA 1WNEA 7ICVA 4NLCA 3ZTQA 1MROA 4ERDA 4QU6A 4UAUA 1WTFA 2VBXA 4OI3A 4AXIA 2HQGA 2KTQA 4C2MA 2VFSA 2ZE2B 2P9EA 3IR5B 5GVQA 2QX0A 2FZGB 2F8KA 3IG1A 2HQ3A 1HIYA 8ICXA 1KFSA 4K7QA 3FBFA 5HAOA 1RWPB 1SPBP 3TVKA 4O3MA 3R9KA 3M6ZA 1BQMB 1JLGB 4ECWA 2J6SA 1Z4OA 4FNIA 4ZHRA 2KH9A 5EE1A 2XO7A 2RDJA 2DYAA 1L6NA 2ZIWA 1TL7B 4KR0B 4PHPA 3RG6A 2HFSA 4F0MA 4ILMA 4UT4A 4O0IA 1OXJA 3ED5A 3T5HA 4EWTA 4HT7A 1WUDA 1OY6A 2LCWA 4OV6A 1ZD5A 3DMJB 3V2UC 3A8EA 4UQTA 1DZ5A 5J8YA 1UTAA 2VG6A 1N62A 3ISNC 3FC9A 3NVWA 3A0HU 3T1YF 1TAMA 2KHQA 5KFXA 1CRXA 1JLQB 1VC6A 3HZEA 4RQMA 1NH8A 2PMZD 2YWKA 4P73A 4Z6FA 2GOLA 1S76D 5IT0A 2LEAA 2HBYB 2XSJA 5HATA 2FDNA 5HJYA 1E6VA 1N63A 1ZQKA 3A12A 3HVWA 2ZWPA 3R9LA 3V4IB 3KG0A 3ZTOA 1KS2A 2ZE2A 3JAMU 2DF4B 4UB1A 2WVBA 4YDDB 3EDRB 3O5TB 1UEUA 2DH9A 4ZP9A 2D3ZA 2RHSB 3WC2A 1XEZA 2W2OP 5H2FU 2XMUA 3MM5B 1ZQXA 4C7QA 4DPXA 3D54A 3WK5A 1D9AA 2UXBF 4NXNF 2ZH8A 3HFVA 1BPEA 5CHCB 1BQMA 1JLGA 2FGCA 2B51A 3RBXA 4B3OB 3CE8A 4B3TF 4LSLB 1MQ3A 2FHKA 3QQCD 5GAEI 5DQIA 2GIRA 1TL7A 4N77A 2MQOA 5CEHA 3SV4A 4DV1F 1UPHA 5IIKA 4PYDA 1R8HA 1IR1A 1IXRA 3RH4A 2GS8A 3CWJA 3DMJA 2ZJRQ 3MAAB 2AQ0A 2KXHA 4XO0A 2FLOA 1F1BB 2FYXA 3W1YC 1VQKS 4IYQA 3HHDA 2DD8S 2V68A 1JLQA 4QIWD 3DEEA 2FHOB 3LYSA 4EK2A 2NUUG 1FJ7A 1JWWA 2Y0BB 1FRIA 2R2UA 5B08A 4YB6A 4UOCA 2HHUA 2QA4G 3UDVA 4A8QA 2HEKA 4ZVOB 2ZTEA 1SB6A 1RAAB 2NREA 1VFJA 1WC4A 2CPYA 1FXLA 4TU9A 3V4IA 4FZVA 2OYYA 3CCWA 3C3LA 2IM3A 3CJ3A 2HGMA 3EX7B 2CPZA 4NLTA 1RWMB 3OR2B 2GAHC 3EGVA 4NXMF 5HL7Q 1YJRA 2JSXA 3KLVA 3ITHB 3AJDA 3NGDA 1RU1A 4FPRA 3HKZF 5ALUA 3DLHA 3MM5A 4USUA 3D2WA 4JI8J 1F0XA 4B3OA 1S1TB 4EENA 1O51A 1UA0A 2MLXA 4LSLA 2C3UA 1JJCB 2KRRA 2LKZA 3I4HX 5F41A 2BCSA 4M5HA 3OTEA 1UT5A 2UVRA 1EP4B 3MAAA 3MUMP 4KPYA 2MAXA 1I5OB 4CT9A 1W2BR 1F0MA 1JRPA 1KQSR 3KHHA 5IIMA 2N7CA 4JI2J 3HFZB 1H7WA 2CUYA 2Q3PA 4HT5A 4UOGA 2ZG6A 1KFDA 4AL5A 2OPQB 3PHTA 4X4SA 2WBRA 1O08A 3SENA 2BM1A 1CJTB 1EKRA 4OX9F 4GXJA 3AJ1A 2V69A 1Q5VA 4RNHA 4X62J 4URSA 4JI1J 3D1OA 2QMWA 1SH3A 3EZUA 1IBKJ 3CULA 4X4RA 3OR2A 2LI6A 2IY5B 2E5SA 4JB8B 4YHHJ 4B9VA 4A8KA 4C7ZA 1P27B 2GHPA 1S4FA 3T1HJ 1KNZA 3PMNA 5K14B 5JVGQ 1S1WB 4ZMMA 3VCDA 3VHQA 3GR1A 2R8GA 1S1TA 3AH6A 4OZ2A 1Z4NA 3OL6A 1T9YA 1I94F 3R5GA 3KWMA 4MMOA 2YBVA 4QBUA 2VPZB 1WI6A 2MSTA 2MTLA 2RU9A 5A6PA 4FS2A 4DN9A 4ZIWA 3DU5A 3S1TA 1LFPA 2IHNA 8ICYA 1EP4A 1DQ9A 2ALYB 3N6NA 2DKZA 1Q1KA 3ENWA 5F9NA 1D8ZA 1UWBB 4P74A 2AV5A 1WG4A 2FJEB 4RWXA 4RQ6A 4Z2XA 2KHCA 2OP5A 4YR0A 2J8SA 2Z2LA 4KGVB 2Z56B 3MDFA 4K59A 2QA1A 3WKBA 1CJTA 4J9SA 5H9FJ 2P9GA 3EYZA 1S0MA 3NRBA 3VV2B 3T5LA 3TZYA 4RL1A 1YJ9S 2XMKA 3HX9A 1B7YB 2EBGA 2RRDA 8ICZA 1SC6A 4ATNA 1XSNA 4L3NA 4WK3A 3K1ZA 2Y1LB 2K89A 3OW2R 4JI5J 2COLA 1IM6A 3DDHA 5ALMA 2BE9B 5IQ6A 1FFGB 4ILRA 1WOPA 3FKBA 1UWAA 3OTOJ 3RR7A 5K14A 4LF1A 3QLHA 3LALA 1S1WA 3L95X 3AB2B 2FY1A 1FO1A 4OZNA 3W5ZA 2KIVA 2ZH5A 3MXHP 4Y2YA 2PA3A 2HVIA 1H2TZ 1FFVA 3ONNA 2V2ZA 4NLUA 4JI7J 3BS9A 2HZAA 9ICLA 4ZLLA 2CG4A 4DR4J 5KTQA 1UWBA 4DX8H 4KBIA 2IVYA 5CCMA 4DV6F 1Q8BA 7ICUA 3TQEA 1VLOA 1FI4A 3PV8A 3FDSA 4DPWA 2BYCA 4TVAB 4Y6IA 2GVDB 3PW4A 4FFDA 4HTJA 7ICFA 4C48A 1PIEA 1NSAA 1ZQGA 2AMCB 4YN3B 4ECZA 3C1YA 3QYYA 4F3MA 2X51A 3CC4S 3ZZPA 4OI4A 2FPHX 1HNXF 4I64A 3LK9A 3KJVB 3IMQJ 4B9LA 5LJ5Y 3GYXB 3PRDA 1TK5A 3IR6B 4P71A 1WCNA 2HFNA 3GCXP 4QPTA 4JK1A 3OD2A 3IBCB 4PGQA 2KK0A 4Y2TA 2BCUA 4JWMA 1A76A 1SJ4P 1ZD3A 3KBBA 2HG4A 2OFHX 1KDHA 3QGIA 4YCXA 4IRCA 3WKCA 3SSSA 2MPUA 4IQWA 3R5BA 1ZAXA 2W7PA 2HSZA 1RWWB 4NYPA 2QO3A 1YKWA 2E1EA 4BUGA 2IIHA 1QJHA 1RHRB 5B0DA 5KG5A 2GQ2A 4XIUA 5F8LA 2KG1A 3DI6B 3LAMA 4YEAA 3W2VA 2GVDA 3NNCA 4A8WA 5HVFA 1F60B 3I0RB 5LOQA 2EZZA 1ZQVA 1SJRA 5J0OA 1M6YA 1KTQA 4XA5A 3EGWB 1N2XA 4K4UA 1ZA2B 1ZRNA 2DGOA 3DCAA 1YTYA 3Q8RB 2EWHA 3BDEA 4FVCA 2BW2A 3KJVA 3RB6A 4X66J 1WACA 3N01A 4ECSA 3H8SA 3H7HB 2RJZA 2VB6A 3IBWA 3ETLA 3KLHB 2DJWA 5A8RB 3OQ2A 3ETOA 2ISOA 1JNRB 2IDEA 1O03A 3KFWX 2BJ1A 3AXMA 4BCAA 3EGNA 4OZJA 3RF9A 3KOAA 5IT4A 7ICIA 2X1AA 3LWMA 4IQVA 1M90T 3CC7S 2CNKB 3FK4A 2JLFA 1YJWS 4UY85 2EFPA 3MOJB 2KN4A 4EELA 4ITSA 1NNLA 2GV1A 1X31C 4HDGA 4V19X 3CD7A 3J7A1 1VQ6S 4I69A 1FESA 2HLTA 2ACMA 1YK9A 4LFAJ 4LF8F 2BOAA 4EBEA 1SVDA 1VQSA 4OYWA 3EE3A 1WKJA 4NZ6A 1ZYQA 1XJWB 4KJIA 3ZNUA 4DQSA 1FKAF 1YZ6A 3DI6A 3AMZA 1YSJA 3ZDDA 4TU8A 3I0RA 2VA3A 1FF2A 1P9QC 1RWOB 4FF1A 4CO2A 4LVOP 4F26A 2A3JA 1IJFB 2KSOB 4ZVSB 4EZ6A 1X7VA 1TFWA 2KJ9A 2CVIA 1ZQCA 2NRZA 1VOMA 1I1GA 1MMDA 1L5UA 2UUCF 2H3VA 2HBLA 5A8RA 3H40A 1Q95G 5ALTA 2LU2A 4LSZB 1M1HA 2B7CB 5HMWA 1FJGJ 3UDCA 3KHLA 1YRTA 5EE0A 1XMQF 4KRWA 5E3PA 3OVSA 2YY3A 2G0IA 3L4BC 2NXNA 1J5EF 1ITPA 3H4DA 2F4VJ 4WWSA 2FJWA 5KT4A 3JPNA 4JWNA 1SC3B 2CQ2A 2JC0A 2KRBA 4OL8A 1LKZA 4DL6A 2LECA 3C1ZA 1IUJA 2O3DA 1VRTB 1VQNS 3N97B 1TU0B 5ALWA 4B3MJ 3G86A 2H54B 4ZPTR 1JB0C 2YX4A 2E1RA 3RW7A 4DPUA 2AJ0A 5DDQC 5ALIA 9ICFA 2A6OA 3LVVA 2UV8A 2WF6A 2KSOA 1UAWA 5J0YA 1TMMA 4M5DB 2R7SA 4H54A 3P6YC 3TNVA 5DDPC 4WP8A 1CC8A 3BZQA 3TVYA 2VFTA 1VJ5A 2ZHAA 2ZJQQ 3OGUA 1UHUA 3BM7A 2YMQA 1A0OB 2DHGA 2NYHA 2WAQD 4X4VA 5IT9Y 1XMOJ 1ZQFA 5M2UA 5ALNA 2J7WA 5T41A 4TQSA 1S9FA 2PDAA 2IJFA 1CBKA 4M0AA 3MEDA 4LZGA 1RQLA 1DQAA 1UFLA 1T9UA 2HHHF 1HFEL 2I6XA 4M9GA 3C16B 2E44A 3BZKA 5JVHQ 2E1CA 3MR3A 1U2CA 2DGTA 5T14A 3KG4A 2HSEB 4ANCA 1U02A 4PEOA 3TWZA 3F53A 2ZD1B 3SAGA 5D78A 4TURA 3AT1B 1VRTA 2CJKA 3UM9A 1X4BA 4PL1A 1U4BA 1KP6A 2B9EA 1MW7A 4UBBA 1ZD4A 2DR5A 1GX6A 2R8IA 3A0BU 4WJBA 3IP4B 1KKXA 4NX9A 1Q82T 1M5VC 2JVRA 3VALA 3BGRB 1ZA1B
chains in the Genus database with same CATH topology
2QN6B 2QMUB 2AHOB 1Q46A 1Q8KA 3AEVA 1KL9A 2A1AA 1YZ7A 3CW2C 3J81j 1YZ6A 3QSYB 2A19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QN6 B;  2QMU B;  2AHO B;  1Q46 A;  1Q8K A;  3AEV A;  1KL9 A;  2A1A A;  1YZ7 A;  3CW2 C;  3J81 j;  1YZ6 A;  3QSY B;  2A19 A; 
#chains in the Genus database with same CATH topology
 1SH0 A;  2OUG A;  4IFV B;  3QBC A;  2AJ2 A;  2FLP A;  3PKY A;  4M5D A;  1U1Q A;  2MKS A;  3N0V A;  4NM2 A;  3C6U B;  1SZH A;  2LQ8 A;  4YUD A;  3F56 A;  1F5A A;  1N33 J;  3RB4 A;  2VD3 A;  2BEF A;  4MHV A;  4OHW A;  4A8O A;  5HP1 B;  4M5N A;  4OHX A;  2DH8 A;  4QR0 A;  2YXL A;  5D4B A;  4IQM A;  4ID8 A;  4LMZ A;  3K8V A;  1WC3 A;  2R8K A;  2MZQ A;  3UQ2 A;  1CPZ A;  4GMK A;  3E8O A;  4AT1 B;  1MU2 B;  3IGN A;  4JI4 F;  4YR3 A;  1OY9 A;  3THP A;  2XGP A;  1HBO B;  3NNA A;  2NPI A;  3C16 A;  3UMG A;  1TP7 A;  1VDH A;  2IJN A;  3I9Z A;  2UU9 J;  4KB7 A;  2JV3 A;  1EQ0 A;  3UNY A;  2ZD1 A;  1I6J A;  3MCN A;  4XK8 C;  2ZM6 F;  3K5N A;  4AL6 A;  2V2K A;  2Q6C A;  2IVF B;  2RU3 A;  1ZTT A;  1IWG A;  5K8N A;  4EEK A;  2N3L A;  2BJ8 A;  5IC4 B;  4F2R A;  4EGL A;  1RA6 A;  4NEZ A;  3QX7 A;  4CLW A;  2V0N A;  3M8S A;  3ILO A;  2HUR A;  3CXC R;  2VPX B;  1KVJ A;  1VQO S;  3BGR A;  2KG5 A;  4O44 B;  3VZI A;  4Q7A A;  3Q22 A;  4C7Y A;  1FRX A;  1S49 A;  3PX4 A;  3C66 A;  4Q45 A;  4IFV A;  5EX3 A;  9ICH A;  1GQE A;  5J0U A;  3Q8U A;  3PXG a;  9ICQ A;  3CVK A;  2GJF A;  3C6U A;  2CPR A;  4ED0 A;  4F93 B;  2CVE A;  2WHE A;  1YDL A;  4NE9 C;  2QAR B;  2BQU A;  3CCU S;  2IDL A;  2DNQ A;  1IG6 A;  5DBC A;  3SXL A;  1U1M A;  5HP1 A;  2B4U A;  3NGK A;  2HND B;  1ZQA A;  3OPK A;  2R7U A;  3PO4 A;  2C2O B;  3WZ0 A;  4DSK A;  5KFL A;  3GV8 B;  4I28 A;  2K7J A;  1HBU B;  1QSL A;  4USI A;  4JI8 F;  2QZ8 A;  4Z7C A;  1CUK A;  4F04 B;  5KFB A;  3ZZR A;  1IM4 A;  1MU2 A;  3W9J A;  4I2J A;  1DRG A;  1HBO A;  1JJ2 R;  4OJG A;  1QVF R;  2FVP A;  7ICN A;  2OSR A;  2P9C A;  3LO3 A;  2Q79 A;  3TA2 A;  1YJV A;  2ZUD A;  4IH5 A;  3DDK A;  2ROP A;  2JLG A;  3O2I A;  2BDU A;  2F4F A;  3GIK A;  4JI2 F;  1YVF A;  2GFF A;  2KNJ A;  1VLY A;  3TAC B;  3G8S A;  2CAD A;  3OTB A;  5DJB A;  1RWX B;  2IA0 A;  1DTQ A;  3PW2 A;  4O44 A;  1LQ9 A;  1Z00 B;  5BOM A;  1A77 A;  4DPY A;  2XVT A;  3US5 A;  2HKE A;  1IKY B;  1U1K A;  1UEK A;  1WG8 A;  9ICG A;  2XZW A;  2MA1 A;  2MU2 A;  1FXR A;  1AQ6 A;  4DSI A;  2DO4 A;  2QAR A;  3VWS A;  2VAS A;  3L4P A;  4WZQ A;  2PI4 A;  1IN0 A;  3H0R B;  4ZVH A;  1IBM J;  1D9D A;  4RQN A;  1YI2 S;  4DV3 J;  2BJ3 A;  4ZVG A;  3KK2 B;  2HND A;  3T1H F;  1UVI A;  3JYT A;  3IWL A;  1XO0 A;  3PY8 A;  2F8H A;  1HBU A;  3RAM A;  2V67 A;  2PN6 A;  3MGI A;  1EKS A;  5KFU A;  4M2Y A;  2W54 A;  2MYF A;  3NAI A;  4ED4 A;  3VF0 B;  4C8K A;  1BPZ A;  1KWM A;  3HHL D;  2ZUG A;  2IOF A;  1VIX A;  3MGV A;  5IIL A;  1WWH A;  2H3E B;  4ZPA A;  3O0F A;  4LBP A;  3TOQ A;  1C4C A;  1KN6 A;  4DFD A;  3I5C A;  2K06 A;  1YRX A;  2UVU A;  2V8P A;  2VUG A;  3LTO A;  1ECW A;  2CKW A;  1P7D A;  2EBE A;  2LHT A;  2EC0 A;  4U7C A;  1OYD A;  4RR5 A;  3V6D B;  3PTW A;  1SIJ A;  3P96 A;  5K5M A;  2R9L A;  4K4Y A;  1Z00 A;  5EE9 A;  4RW8 B;  5DB6 A;  3DRY A;  1FE4 A;  3BPD A;  3MAQ A;  3ENQ A;  1IKY A;  2M7S A;  1EAY C;  3CJ8 A;  1XMB A;  5CR0 A;  4RQ1 A;  5AM5 A;  4LF6 J;  4DCJ B;  4CF5 A;  1PC4 A;  4RNN A;  2DFL A;  4OYB A;  8ICL A;  3C15 B;  3KK2 A;  5D4N A;  4IO9 Q;  3RW6 A;  5IWA F;  4CF3 A;  2AWZ A;  2J9C A;  2H5I B;  1F3V A;  3QUT A;  2EXU A;  3HHN B;  1P6T A;  4QZV B;  4LRC A;  4DR3 J;  2FPL A;  4TNO A;  2DQN B;  2QGF B;  2AYG A;  4X4O A;  3TW0 A;  5L1J A;  3HMJ G;  4JI7 F;  6FDR A;  1OPI A;  2VKR A;  1KBR A;  4CH1 A;  3IRW P;  1R0B G;  5KFF A;  5ALH A;  4RQ0 A;  4DR4 F;  2HHQ A;  1IIP A;  1K5O A;  5EX0 A;  4K4V A;  3V6D A;  1FEE A;  1Q78 A;  3CMA S;  1VJW A;  3GIJ A;  4I2C A;  2G5H B;  5AKI A;  1L3V A;  2VJ5 A;  4RW8 A;  1XO1 A;  2QLX A;  2GGP B;  5ALK A;  2R7X A;  4K4I A;  3TVZ A;  2EPI A;  2VHG A;  3RJH A;  5E3C A;  4WE1 A;  4Y2I A;  3GYN A;  3K17 A;  2D3D A;  2W4C A;  2F2A B;  2FPK A;  4IOB A;  3J81 U;  2KT5 A;  4CF4 A;  3EVM A;  2HQF A;  2K7K A;  4QZI A;  2B4O A;  3LQV A;  3C15 A;  2I5J B;  4ZVU B;  1UZH A;  1QSS A;  3MPW A;  3MM9 B;  2KG0 A;  4YMM A;  3TO8 A;  1KHW A;  3UMC A;  4CDG A;  1MLA A;  3WX4 A;  4PZN A;  3HKZ D;  3K59 A;  4J9L A;  1BPY A;  4FXV A;  2AZ1 A;  1U1R A;  3FCW A;  4GVB B;  2E5L J;  2FQQ B;  2VAN A;  5H1S V;  4ACO A;  2M4M A;  4YD2 A;  4P0P B;  4UUW A;  2J8A A;  3E58 A;  4L74 A;  3QJL A;  5DZ6 A;  4USW A;  1L3S A;  1D09 B;  4PWD B;  2HBR B;  2LA4 A;  5M2R A;  2CPE A;  1JLF B;  3IM9 A;  1S0O A;  1FRJ A;  2Z8Q A;  2BJ9 A;  4ED6 A;  4PXC A;  1JNZ B;  4GC6 A;  2CAJ A;  2ZZN A;  2KM8 C;  4X4P A;  1APS A;  5KG0 A;  2VV5 A;  3UW1 A;  2DR6 A;  5SZT A;  2GGP A;  1GMV A;  1NSQ A;  3M6W A;  2GH1 A;  1HMV A;  2XI3 A;  2R7T A;  2L41 A;  3X1L B;  2AEM A;  5AIB A;  4OJ6 A;  3JPS A;  2ZHB A;  2CJB A;  1DAR A;  2A2D A;  3N7R C;  3O8W A;  2V4R A;  5CYJ A;  1HQ2 A;  4UBC A;  2LDY A;  2OM6 A;  3I4P A;  2PFO A;  2EKN A;  4NLZ A;  3IG8 A;  5AKZ A;  2YNI B;  4Y0F A;  5KL1 B;  2KYZ A;  4DV7 F;  1VR6 A;  3MM9 A;  2NXU A;  4O4G A;  1F9H A;  3T41 A;  1IQT A;  3G2X A;  4J5O A;  1NH7 A;  4O5E A;  4NRT A;  4QZB A;  2I8E A;  4FP9 A;  4F25 A;  4QQB A;  1C1C B;  1GMU A;  1S9E B;  1NHV A;  3ZNJ 1;  3GYG A;  1WWV A;  2KZZ A;  4GVB A;  2NXE A;  2KYX A;  3K2Y A;  2ASJ A;  1RTI B;  5IM0 B;  2YNG B;  4P0P A;  3QMQ A;  3KJN B;  2XI9 A;  1N36 F;  3QU2 A;  4PWD A;  4QZD A;  4MT1 A;  3GFY A;  1JLF A;  4NLD A;  1SXL A;  4ENO A;  4KLD A;  2BZ2 A;  4LFA F;  2VJV A;  4OZ3 A;  2VKZ G;  4AQY J;  3THV A;  1X9X A;  3ZZT A;  1KD1 T;  1MN9 A;  3MMC A;  1SZP A;  1CSJ A;  1SWV A;  3HDS A;  1Y5N B;  1BVS A;  5HP4 A;  1AFJ A;  3KDO A;  1C0U B;  5GAG U;  1UL3 A;  1T94 A;  1RQ0 A;  3CCZ A;  1WYG A;  1Q8L A;  2L9N A;  5ALF A;  5J2Q B;  1RM6 C;  3MM6 B;  1RBA A;  2LEB A;  2R8H A;  2HBJ A;  4OYI A;  4I2P B;  1K1Q A;  5LMU F;  2A1A A;  4TYA A;  3W62 A;  2FJD B;  1Q3U A;  4B9T A;  5D4O A;  4BC7 A;  1BWE A;  3NVV A;  2YNI A;  2VG7 B;  3LW5 C;  4ZCI A;  5J8Y C;  2HQI A;  2OAU A;  3NTU A;  3PYD A;  2VOD A;  4NLS A;  3EW9 A;  4FKY A;  1FJG F;  3EUB 2;  1FRL A;  1QAX A;  1C1C A;  2VQE F;  3OLB A;  2KJV A;  1S9E A;  3WKA A;  4PPX A;  2G0A A;  2DNK A;  4UOH A;  3KZI U;  2XHC A;  2FJV A;  2IPO B;  1RTI A;  2MJU A;  2O66 A;  5IM0 A;  3UCZ P;  2YNG A;  3U02 A;  1N5X A;  2FZC B;  2OSQ A;  1NDK A;  2HRU A;  3C28 A;  1SH2 A;  4DBQ A;  4P6Q A;  2ABY A;  2C22 A;  1QTM A;  1S6O A;  2WSC C;  2PD1 A;  3CDA A;  4C8Z A;  5EUH A;  4A48 A;  4UQG A;  2ASD A;  4F92 B;  2F8M A;  1YX2 A;  2HZV A;  4Z6D A;  8ICT A;  5F8G A;  4ECR A;  4B3M F;  2GO9 A;  3ZZU A;  4OYA A;  4R0J A;  2H9Z A;  1RAG B;  2XMT A;  5TIS U;  5G0R A;  3VGU A;  2AKW B;  3KK1 B;  2ZZM A;  1X6J A;  2H4W B;  1F5C A;  3AJ2 A;  5J2Q A;  3Q8L A;  3OSP A;  3MM6 A;  2H5E A;  5AIC A;  2J5A A;  1REV B;  4I2P A;  2OEJ A;  2HIY A;  2KI2 A;  3BJY A;  1KVI A;  1R6Y A;  4M5K A;  5DGB A;  4LR7 A;  2VG7 A;  1NDP A;  1XMO F;  2VFR A;  3AM9 A;  1LWF B;  2VOO A;  3IRU A;  4AYB C;  3OXL A;  3DGV A;  2XWY A;  3AOD A;  3WBZ A;  5ADZ A;  3NCR A;  1RT3 B;  3QFH A;  2JMG A;  4B08 A;  2HRT A;  4OJO A;  2GHV C;  3GJT B;  4KT0 C;  5HML A;  4O3Q A;  5KFQ A;  1RZT A;  4RUA A;  3HD2 A;  2C3O A;  3SFG A;  1D1U A;  2R2S A;  3CJ0 A;  4DI6 A;  4HLB A;  1D0E A;  3LA0 A;  9ICP A;  2CZ4 A;  3M32 A;  5J2F A;  3MUV P;  1DFD A;  3KK1 A;  4OQJ A;  3ISB A;  1L3U A;  2NRT A;  4OX8 A;  2Q0Z X;  4Q2M A;  1IBC B;  9ICN A;  4TY9 A;  3KMS A;  5HVG A;  2VFU A;  1NK9 A;  2IM1 A;  3MEG B;  4ANE A;  2QEX S;  1HLW A;  1REV A;  1QLN A;  5BJR A;  5ETV A;  3HI9 A;  4Z7Y A;  3UFC X;  3QUB A;  3W2W B;  3NEK A;  3N4M B;  3G71 S;  4C4S A;  9ICM A;  3GB0 A;  8ATC B;  2CQ0 A;  1X8D A;  3PJW A;  2IMO A;  1DOQ A;  2GW8 A;  2XS5 A;  3MR5 A;  4UZB A;  1LWF A;  3LP2 B;  2KP7 A;  2HFU A;  3BYR A;  3FEZ A;  2ZOF A;  2Z7J A;  5H9E J;  2MSS A;  4J03 A;  2GLE A;  1YJU A;  3AY0 A;  1RT3 A;  3TUJ C;  3TX8 A;  5HMY A;  4DR7 J;  5KFK A;  2DBB A;  1KC8 T;  2UU9 F;  2OWO A;  3NKY A;  1FK9 B;  3RYL A;  2A6M A;  4CT8 A;  8ICH A;  3N28 A;  1B99 A;  3CCQ S;  2H51 B;  3X3U A;  2DEJ A;  2EG2 A;  4USM A;  4DV4 J;  3NVY A;  1TAU A;  3TJ8 A;  3ZO7 A;  1MC8 A;  4NLG A;  4QWB A;  2LPE A;  1N0U A;  1X4C A;  2IHR 1;  2HHT A;  1TUG B;  1OWX A;  4PR6 A;  4QCL A;  3H0P A;  1IKW B;  3NOG A;  1BNP A;  2AT1 B;  4QWE A;  3RJK A;  4WIQ A;  9ICS A;  8ICA A;  4JMU A;  3CCT A;  3P3D A;  3MEG A;  2E5I A;  4Y2A A;  4LQ3 A;  3AB4 B;  3M2V B;  3K4G A;  4Y65 A;  3O6Q A;  4KLU A;  1F2H A;  2GHW A;  3G87 A;  4HI1 A;  3W2W A;  2QL7 B;  4EYI B;  3VC8 A;  1SWW A;  2KD1 A;  2WK4 A;  2YKP A;  4HH0 A;  3BSO A;  4QU7 A;  2DGQ A;  3W60 A;  2C1E B;  3LP2 A;  5AE1 A;  5F8J A;  3JSM B;  5EWF A;  1QAY A;  1YJT A;  2DRB A;  4M5G A;  5KG7 A;  1TZ0 A;  2ILY A;  3SZ2 A;  1RWV B;  4OYM A;  2CQG A;  4OZL A;  1FK9 A;  1R0C B;  2HFO A;  2YKA A;  4PG4 A;  2W2Q P;  2N3O A;  1PGZ A;  3GJR B;  2WSE C;  2RIJ A;  3B6B A;  4M04 A;  4OHY A;  4FYX B;  3D2Q A;  4F71 A;  2JNJ A;  1K0V A;  1UA1 A;  1WHW A;  5I3Q A;  2GCF A;  1FNM A;  3WK4 A;  4HEA 9;  3FUY A;  1ZOL A;  1WF0 A;  3C5F A;  1IKW A;  5J29 A;  7FD1 A;  1X9W A;  4LF4 J;  3NS6 A;  3GP9 A;  3HKW A;  1ZBT A;  5FII A;  4P2X A;  1TUV A;  3MGJ A;  2EAM A;  3H0L B;  1UPM B;  4KE5 A;  1ZAW A;  3M2V A;  5LL6 d;  2FMS A;  1D9F A;  1YGY A;  1S97 A;  3KUE A;  1Y0H A;  5CB1 A;  2C2N A;  1H73 A;  2PGC A;  4UY8 T;  1PZN A;  3V6K A;  4Y2U A;  2HMI B;  2AJ1 A;  2EFO A;  1VI7 A;  5T7L B;  5L39 A;  4QYZ K;  3JPQ A;  1OJ4 A;  5DLG A;  4Y00 A;  5I3U B;  4K4W A;  1VBK A;  5LSO A;  2NXC A;  3H8Y