1YZ7A

Crystal structure of a c-terminal segment of the alpha subunit of aif2 from pyrococcus abyssi
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
176
structure length
176
Chain Sequence
KAKLQEFKRAQKAENLLKLAAEKLGKDFETAWREVWVPLEEEWGEVYAAFEDAAKDGIDVLKGHVPDEWLPVLKEIIDNYVEVPTVTIDAEFEITVPKPNGVEIIKEALIRARDRANKEKDVEVKFTYLGAPRYRIDITAPDYYKAEEVLESIAEEILRVIKEAGGEATLLRKEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Relationships of the Intact aIF2alpha Subunit from the Archaeon Pyrococcus abyssi
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
molecule keywords Probable translation initiation factor 2 alpha subunit
total genus 59
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 1yz7A01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 1yz7A02
2A1AA 2QN6B 1YZ7A 3AEVA 2A19A 2QMUB 1KL9A 1YZ6A 1Q8KA 3J81j 2AHOB 3QSYB 1Q46A 3CW2C
chains in the Genus database with same CATH superfamily
2HZCA 3F2DA 2DRAA 1S1UB 3V6HA 1NDCA 3D4JA 3GZ7A 4OZ2A 2HRYA 4BX9C 1S0MA 2YNFB 2R2RA 2KZMA 3T5KA 3MM9B 5IIMA 4DV6F 3A1YG 2V8GA 2A6OA 1AFJA 5AE3A 1WORA 3NP5A 5G5HA 4PZOA 2CNOB 4EYHB 3BPDA 3PEHA 4LBPA 1KVIA 4B9NA 4CH0S 5ETLA 4NM1A 2HMXA 4FBTA 4JI0J 1NJIT 5C2CA 4FZLA 9ICBA 4K4UA 3FEXB 2QYCA 4RQ1A 4KSEB 3IP0A 1U2CA 2LQ5A 4DOBA 3M6WA 1WHWA 4I7FB 1FXLA 4ILMA 1OO0B 3J7A1 3C2KA 1S79A 4KPYA 5DB7A 2GA7A 2WF7A 1G1XA 3KFWX 4HI1A 1W2IA 1KN6A 5G0RA 4X2BA 1VHFA 3VZHA 3D6JA 2KVIA 2ADCA 3QT8A 2UUCJ 2IJNA 2Z7JA 4UAWA 1Q8BA 3RZAA 3S01A 3RJIA 4DR6J 3P3DA 5GMDA 1S8OA 3GIMA 3TA0A 2OGUA 1X6JA 2V2ZA 1ZXIA 4A47A 3IM8A 2YTUA 1E6YB 4M5LA 3W8GA 1WG5A 5HL7Q 2JOQA 1HQUA 1BWEA 2PSZA 4NV0A 4NLVA 4B6JA 4QW9A 1KW4A 2RVJA 5K14A 2DGQA 3P8BB 5BJRA 1F1BB 1ZBTA 1VQ6S 5CYMB 3BH7B 3MMCB 2LEAA 1ZA2B 1HWIA 1ULRA 4PGQA 1RU2A 4J9SA 1CG2A 5CCMA 4YMMA 5LMUJ 3HVTB 2E5JA 4F3OA 5L9XA 4F0KA 5AKLA 2IM1A 4J9UE 4FS1A 1IWAA 2KFYA 1VR6A 1FESA 2JH7A 4CM0A 1SC3B 1V85A 1K44A 3L5KA 4F67A 2FY1A 2ZJ5A 4QWAA 3ZZYA 3RH6A 2KVQE 1NO8A 4ZVEA 3KLEB 4EEYA 1XK8A 2HBJA 1UA1A 1AUDA 3QNWB 4TKTA 3FGVA 3W2WA 3QUCA 1MWYA 2MQPA 1GMWD 1O5JA 2P9GA 4DSFA 2Q3PA 1M0SA 2BOPA 1R0CB 2OEHA 2CUYA 5HVFA 3H8MA 2HQCA 3EZUA 1CC7A 8ICWA 3HVRA 2HFOA 1NM2A 4DX6A 4CQ1A 2E9TA 2VH7A 3N97B 5D15A 1NAQA 4S0MA 4ILRA 1KN5A 1NHUA 2E5GA 1TUGB 4CH7A 2KK0A 3OVBA 5ALIA 1ZQJA 3ZTRA 1ZQOA 2B0GA 2XWXA 2M70A 3WC0A 1RE1B 2MXYA 2BQUA 1HBNB 2UV8A 1S6UA 1RAJA 1OW5A 3M1VA 2A6MA 5ALGA 3GFYA 5HMZA 2E7VA 2JEJA 1X7VA 3GJQB 3C6UB 5CAAA 3CD6S 2EZZA 2PC6A 4CLPA 9ICMA 3M30B 2FVPA 1UVMA 3OT9A 3HFZB 3M8QB 2RF2A 1YBTA 1S0VA 2UV8G 1H98A 1HI8A 2PFFB 2BEFA 4ID5B 4WFZA 2J0QD 2F8HA 2IC3A 5ITHA 1S59A 2G0AA 3ILJA 3EZ5A 4RW9B 3BSNA 5KFVA 1SKSA 1KQKA 2YKNB 4CE6A 2ZOFA 4GKKF 2CDQA 4ZLNA 3NNCA 5D8HB 3OJUA 5IWAF 5CA7A 1S6PB 2XZDB 4C98A 1HHQA 1NK6A 1CJUA 1IWGA 2YN4A 5ETTA 1RG6A 1NJWA 3C23A 2HHUA 2RUGA 2L41A 1U2FA 1EP4A 3LP0B 4OX9J 2IA0A 4H54A 1YBUA 3EGZA 5EE1A 3LW5C 2ZNZA 4ZP7A 3VQTA 4PUOA 2FC9A 1N5TA 4USHA 1K47A 2QTWA 2H54B 2GS8A 4DHVA 2ZBCA 3G87A 1RTJA 4G1IA 2VQEJ 5A0YB 4X65J 5KFPA 1LWEA 1SBRA 1OY6A 5KG3A 1N54B 1B3TA 3D2QA 3EX7B 4OMFG 4O4RA 1X4EA 2QLBB 1TELA 1SKUB 1YGYA 1RABB 3P45B 3ZO7A 3TADA 4I0WA 3M9NB 3HT0A 1NUEA 4ZP6A 1Z00B 3H8SA 1QLNA 3TAMB 2N7CA 1RYRA 4GKJJ 3AL0B 5KT3A 3PW2A 4LFAF 4DSJA 3TAMA 4EENA 5K9FA 5B0GA 3HW8A 2VDHA 4KLIA 4YR0A 3CO0P 3EUB2 3AUOA 5DGAA 4PG7A 3I9V9 3FYHA 9ICRA 3KK2B 3NVWA 2NCKL 4EZ9A 7ICSA 5BR8J 3TRGA 1R8HA 1U8WA 1RDFA 4FYVB 3QU4A 1RWWB 5F8JA 3ETLA 2DHHA 2KHDA 2JC1A 4NL9A 4UZCA 3JPRA 2ZBPA 2HFZA 3KMSA 4Z7CA 4LJXA 3OTQA 1UT5A 4F2RA 1P9QC 3G96A 1N52B 4QYZK 2DXDA 2YB4A 2Y0BB 3PJ9A 5ALKA 3VAMA 1FD8A 3OTEA 1UWBB 1WDDA 2QL7B 1M1HA 3N4WA 3LP0A 4OYAA 1TL1B 2IMWP 1SXDA 2W04A 3QT7A 3PEJA 3FC9A 3TAQA 1KOOA 2Y8WA 4M5NA 4IDKB 4Q5VA 2FDRA 3BKTA 2OWOA 2NR0A 5KOWA 1N32J 1UKUA 4WFBQ 3SAFA 5H2FU 4PHPA 1CS4A 2ZDPA 1RPLA 1V5VA 3W8PA 2O67A 5LJ3Y 5E3CA 3IG1B 1Z4NA 1KVJA 2WVEA 2P5VA 4F91B 2MHEA 3OTOJ 2Y1LB 1V38A 1NI3A 2C28A 4UBCA 1QY7A 2DKOB 1KHWA 4DV3J 1ZQKA 1TVAA 4A8YA 3PO5A 4FP9A 2E5LF 5IT0A 3G86A 4JI2F 4NJ8A 1UPMB 3J7AN 3PO4A 4CO2A 3AY0A 5BYRA 5CZVA 2XVTA 4J9KA 1V3SA 1L7PA 3QIPA 3D0IE 3UCGA 2BHNA 4Q45A 1RWVB 3EVOA 4YD2A 4ED5A 1F0MA 3DLKA 4RU9A 2HHQA 3HVWA 4ACOA 4AP9A 4RPFA 1ZQGA 5D78A 4DXLA 1WJ9A 2HQ3A 4F5NA 4MFBA 2ZJAA 4DDFA 1HMVB 3NOGA 4HTJA 7ICFA 4FFDA 4JI4F 2EFQA 4RQ7A 1BXNA 1WC1A 2WTFA 4NLSA 2EK6A 2H3VA 2YNGB 2BJ7A 4FDFA 2D7SA 3HZEA 2AJFE 4WU2A 5CYMA 1V6HA 4Y2RA 1U7LA 4QWBA 1AB8A 1TUWA 2DGOA 1KHVA 2QGFB 2XSJB 3BBFA 2LLZA 1ZH5A 5KFIA 4DS4A 3HK2A 3BZCA 1H73A 5BYQA 3W5ZA 3MGJA 4CO4A 4L75A 4NI2B 3DRPA 2RKIA 1TL7A 5ALWA 1H2TZ 2ZH8A 3BR8A 2ROPA 3BGUA 1UP1A 3R7SB 1NEEA 5K20B 1L5UA 4DF4A 4LRFA 4EZ6A 3M7VA 3MEDB 2OTLS 1N5YA 1EKRA 2R7SA 1B0PA 4LZGA 1TVRB 4OHZA 3N4MB 4B3TJ 4RQ5A 4FXDA 1QQ7A 4ECYA 2CVIA 3GG0A 2ZXIA 2G09A 5KG4A 2GNKA 1DOQA 3CO9A 2PIIA 3NY0A 3MGIA 3MMCA 1UWBA 5J2EA 2WOMB 4P4MA 2Q6BA 1TV6A 2ERRA 1IKYB 1J5EJ 5LL6d 4LSNB 2Z2ZA 3TQ1A 2UVUA 1L7MA 1MA7A 2IAJB 4ZPWR 5HANA 4IFYB 3FSIA 3A3OB 1T9XA 2HHHF 1UCVA 1CQMA 2VFTA 2YKQA 9RUBA 1HARA 3M2UB 2DFLA 4Y28C 1OYDA 3UD3P 1WF0A 3RFAA 4UARA 2FJAB 3MR2A 3UE2A 3V6JA 2CADA 2QL5B 5HBMB 3TJ8A 4XIUA 2LMRA 1XR6A 4Y2UA 3PHEA 4M9HA 1IKWA 2Q66A 2DBBA 2E5LJ 3CW2C 1HNWF 3SCLE 3ZZOA 1X6IA 1DJ0A 3JB9k 1WTFA 1G2EA 3IO1A 4UOFA 1X8DA 4QZ9A 3DGPB 2ILYA 1UZHA 1VRTA 2I9GA 4P6QA 1U0HA 5B0DA 3L3FX 2XO7A 4P0QB 3ZDBA 1U48A 2LU2A 4MEXA 1JLCA 2RQMA 3W9JA 2XNRA 1QSLA 5AI6A 3Q83A 3KK3A 2MGZB 4ZK7M 2LKZA 1H74A 2R8KA 3T1YF 3M9OB 2DIVA 4BJQA 2NO4A 5F8LA 3ILIA 2CYYA 4NLWA 2QKQA 3VAHA 2AXTU 1SIZA 4N56A 5KG7A 4DPWA 4RUCA 4GVBB 2R7TA 1T3NA 1K5OA 3SSRA 4ED4A 4JI5F 1X0FA 4DR4F 4O3OA 2KT3A 2CRXA 3AMZA 1K8AT 4YN4A 3DN9A 1D3WA 1ZRNA 2FJEB 4QZHA 1PG5B 4RO0A 1YJNS 2DIUA 1TZ0A 1IUJA 4FBUA 4ED6A 1TKZB 1U1KA 1VI7A 4WIIA 4DX7A 3C14B 3Q8YA 4PXBA 5EWFA 2BQRA 2EW9A 1J2NA 1PK1A 1BQNA 4BWMA 3T1HF 3WC2A 1WEZA 2W2NP 2D9OA 1SUQA 1FX4A 1ZD5A 2A19A 2KP7A 3QJPA 4YQWA 4WKRA 3I5AA 1ZQBA 3AU6A 1SXLA 2BCRA 4WIQA 1BPBA 1C0UA 2Z2MA 2ROEA 5J0YA 4ZCMA 5HNKA 3EWGA 2QLWA 2FHOB 5E33A 4WFAQ 3NGDA 2P9EA 3KKAA 3J7YI 5HP1A 2DB1A 5LMUF 2EKNA 1C1CA 2JH3A 4WP8A 4ECWA 1N0UA 4KLJA 3NMRA 3EM1A 3IBWA 1UEUA 5G4DA 4PZVA 2QIFA 5C24B 3BGRA 4LIWA 3JYTB 3ISBA 3NVVA 1SI9A 2CQ4A 2BUNA 2QZ8A 1T02A 2AZ3A 4PWUA 2H4WB 3WKBA 3M6XA 1NJZA 4JV2A 3B54A 1FKOA 2JL9A 2XI2A 4EO8A 1HBMA 5JTIA 3TZZA 2XYHB 2P6UA 1KDNA 3FBCA 7ICTA 2KJ8A 3C16A 1LWEB 2XWYA 2YX7A 2AV5A 2ZIXA 4X5VA 4MJKA 2F8MA 2J76E 2CJKA 2I5HA 2G1DA 4GC6A 4ECZA 4WYLA 2E8NA 1VRUA 3EDQB 2KSOB 1D8BA 3ZDCA 3S7RA 5AKZA 3UDVA 4F92B 1N5YB 3I9ZA 4U67Q 1PJ7A 4AL6A 1OS5A 4DR2F 1K1QA 1S12A 1VHIA 3NGTA 3N28A 3N9UC 4CYUA 2Z2LA 3MM6A 2GFFA 3NS5A 4OJGA 2FHJA 3FQKA 2MKCA 3OL6A 2EBGA 3D2NA 2LP4A 1ZPVA 4CH1A 3BS5B 1L8OA 1DBDA 3QYPA 3KJVB 1KONA 3S1TA 1IJFB 5GAEU 4LF9J 4KGZB 3T19A 1XN9A 2RQCA 3CC7S 3I0RA 3AD7C 2EC0A 4A8SA 3X1LB 7ICJA 3X3UA 1AT1B 1AROP 4LBHA 2ZWOA 4HL9A 1X60A 2YMPA 5DM7Q 4NLPA 5IQ6A 1PAUB 1U49A 3SYZA 1UVIA 4P71A 2AW0A 4NX9A 5HMWA 2M7SA 1I51B 1U1PA 2KJ5A 4I2IA 1VBKA 2UXDJ 2OM6A 2VFRA 4OYZA 4USJC 4OX6A 1VQ9S 3J81Y 1FFVA 3PFOA 3K59A 4RWXA 1YG0A 2B9YA 4X66J 2L3MA 5J2QA 3MM5A 3ONNA 2B56A 5ALQA 4USAA 2I5JB 5KG2A 5ETQA 1JLAB 3AODA 4YFKA 5GADU 5HQLA 2HNZA 4LF5J 4DCJB 1Q0NA 2LYVA 2POKA 3I0SB 3IRWP 5C42A 1HUZA 2RMLA 2VPYB 1NJYA 4ANEA 3AQOA 5KL1B 4KE5A 1ZTTA 2CJ9A 4DCCA 3JS9A 2CZ9A 5HJYA 3FSXA 4ATNA 1DURA 1LKYA 1C1CB 1TMJA 3RUBL 3MCOA 3R8YA 2HDOA 1L3VA 1T94A 1VIXA 2VB6A 1JLQA 3CCES 2XIDA 1RAOA 2OYYA 1NZBA 3LVVA 3SIPB 3PW7A 5E3QA 1RT1A 2HHPA 3R6LB 3OL8A 1A7GE 2GAGC 5DB6A 2FGOA 3CCWA 1RT3A 4TYAA 2Z58B 1HNIB 1LW0B 2G13A 3SCKE 1D0EA 3CULA 5H9FJ 2BANA 2LYHA 5KFOA 3HFKA 1IBKF 1Q46A 3IG8A 4TN2A 2JJ4D 3DU6A 2ABYA 2GHPA 4KH1B 3RBDA 1ECWA 5E41A 3MPDA 1N56A 4I27A 2DPIA 2UUCF 1CPZA 3GU0A 1FFGB 2W9MA 1RT7B 4C11B 3RBZA 1S76D 4RQNA 1NHKL 3OFEA 2F3NA 3K5OA 4KO0B 3AFGA 3M1YA 2OMLA 4RW9A 2QA4S 2AF6A 4L73A 5KG5A 5ETVA 4LSLA 1VCTA 4LF6F 4KLLA 3HXMA 3GCXP 4QZDA 2BPFA 2ZUDA 1FJGJ 3MCMA 2IOHA 1HWUA 1BPDA 1CEZA 4Y3CA 5AM2A 2B4UA 4DG1B 4LREA 1TFWA 2CFXA 1ZPWX 9ICKA 5AKYA 1GTHA 3TX0A 1LNQA 4Y00A 4JI6F 4US8A 3SI8A 3AD9C 4O0IA 4V19X 1Q4RA 3KLFB 1UFLA 4ZHRB 5A0LA 4LF4F 1XSLA 4J9MA 2XQCA 5AICA 1BHNA 2H3QA 3ICLA 2CJQA 1VLBA 4DV6J 1BNOA 3SCJE 4WPAA 3T5JA 5C0YA 8ICQA 2WSEC 1HNWJ 1SQGA 3OTCA 2GQQA 2KTQA 3WK7A 3RYLA 5FLXU 4CRJA 2DVIA 4Q0BB 1DRGA 2H3FA 4K4WA 3PSTA 4JI0F 4ENOA 4GXKA 5ALFA 1AZSA 2DHSA 4C8YA 2KFZA 4NEYA 2HYIB 2H4YB 3VVTA 4HACA 5LOQA 1PGZA 1BMQB 1TK0A 2IOFK 1RT2A 2JWNA 7ICOA 2KT5A 5IC6B 4CGZA 1SV5B 4DCPB 4QYRA 4ZCKA 2WB1D 3H5YA 1ZJNA 2F40A 1VMBA 5IIOA 1HNZJ 2DXFA 2MSTA 4KKOA 1RM6C 4MEYA 1F44A 4YDXA 3MEDA 5J1PA 5KAKA 3I55S 4X64F 1BWVA 2DNZA 3H90A 4I6WA 2VODA 4RBVA 4X4QA 4C0ZA 4NM2A 1X40A 2OPQB 3DGPA 2MKKA 4KV8A 3FCVA 3O0FA 3C14A 4AYBD 3MR7A 5CXTA 4IUFA 2ZC4A 2PD1A 3AAWB 2VG5A 1RA6A 2AHOB 4RW6A 5DLFA 3CVKA 3MPUB 3M8RA 3NAHA 4I2EA 2JHEA 1PVRA 4IH7A 3F2CA 2IJRA 4M5HA 4DFPA 3ISNC 4H4MA 1R0AA 1LK5A 1QJHA 2AD9A 1RT4B 1BPZA 3PRDA 3QEBZ 2OFGX 1GQEA 5DO2A 2YWHA 1P27B 2FHJD 2HI0A 2J5AA 1X66A 2XYGB 1EQMA 4C6AA 1HPZB 1EETA 1PBUA 2I0XA 5HMMA 1VJWA 3PYGA 1FFSB 1HBUB 4KX3A 3M8YA 4CZCA 1PSDA 1YZ7A 2GO7A 1N34J 2JH1A 1JKHB 3RJJA 2DH7A 4NLUA 4KLMA 2HSEB 2DNNA 3HKWA 1YI2S 3LALA 3TANA 3L7UA 2IBOA 2OFHX 3UXNA 3DOKA 5J0UA 3LQVA 3BQ0A 1FRJA 4XAKA 2HQGA 3EGVA 3DMJB 3SDEB 5GTHU 3FEZA 5TISU 1RTIA 3MDCA 2WHOA 3OR2B 5FLXY 2X1FA 3QATA 3U7JA 2B8QA 2W2QP 4UAYA 1R8BA 1GMUA 1KEJA 3MOJB 4B3OA 3Q8QB 2MZ1A 8AT1B 3R3TA 2ZE2A 1RAGB 3BQ2A 2ZIUB 2YQ0A 4DV7J 2C3MA 2ZIVA 1N5XA 3QFWA 2W9CB 1HBNA 1JMSA 4ED8A 1HW9A 2DTJA 2QSFA 2BPCA 3O2IA 3U26A 1FK9A 2R7RA 4JBCA 2DYAA 3RRGA 3MEKA 2RH3A 5ETKA 1QAYA 1D09B 2J9EA 1FIQA 4ZVHA 4D3HA 2PFOA 3J7YU 1QDUB 5E3AA 3DOLB 3M32B 5IIKA 4WFXA 3UNYA 1PBAA 4YD1A 5KFMA 3OXLA 2BYCA 4QZEA 3BSCA 3EDRB 3T9NA 4B08A 3OJSA 3FMWA 4KYZA 4DV1J 8ICYA 2ZFHA 3HI9A 2IMOA 2RHSB 1X4BA 4U95A 1JLAA 1S1TB 2QJ3A 2RHQB 5DDRC 2Q1LA 2MHNA 3DRSA 2OPRA 2B51A 2OEMA 2QC3A 4J7CA 3OFGA 3GV5B 3M8ZA 5CWRA 2HMIB 1CRXA 1NH7A 4IRDA 2XMMA 1V3ZA 2HS0A 4A46A 7ICGA 2HOFA 1VDHA 4F5OA 4CLSA 4BC9A 1TAMA 3B0YA 4M94A 4RKUC 4OLOA 2YVSA 1NSAA 4I68A 1DXSA 1GXTA 1KVKA 1X4DA 4NLXA 4ZOSA 1UTAA 4DR7F 2NRVA 2EZYA 1UJ5A 2MKSA 2ATLA 5HR6A 1SVDA 3KG1A 3AJ2A 2SXLA 3ENAA 3PM9A 2YB1A 3QEAZ 2JRSA 1FA0A 2HGNA 2KRRA 5DLGA 2A18A 3R1LA 3IFEA 1VQOS 4PQAA 3VF0B 1WOPA 3AQPA 2XEXA 3KLGB 1S49A 1JB0C 2DEJA 5KFNA 1N5QA 4ZPDA 4MIWA 1N48A 4EK2A 2ALYB 2EBEA 1H3DA 3HJEA 4O4GA 4ED2A 3IXQA 9ICCA 2Y9UA 2ZHOA 1H0HB 2OEKA 4QQBA 1SJ3P 4DR2J 1FNOA 1L3UA 4UBBA 2F7VA 3CIZA 3LAMA 3MDAA 3NKYA 2DGZA 4NMLA 3V81B 3PW5A 4IO9Q 5G5GA 2KZ3A 2FJWA 1P1TA 4ED1A 2LYBA 2K60A 2W11A 3GPAA 1TL3B 4DMZA 1KOHA 2VBWA 2ZIWB 1MMLA 5D3GB 2ZBRA 5ALSA 4ZS6A 4K4YA 5AI8A 1H2UX 3IA0A 3IM9A 1QE1A 1IXRA 4PABA 4C48A 2Y1JA 2GVZA 2E5HA 2PMZD 1IM4A 2HHXA 5ALTA 4LVNP 3BM7A 1HI0P 3KK3B 1FEHA 2BRKA 3BQ7A 4B9MA 4NXNJ 3CMES 4CM2A 3Q2TC 2VIXA 9ICNA 4P74A 2W9AA 3HD2A 1D8LA 4LUBA 2UUBJ 3LP1A 5J2NB 1CJTA 3CWJA 1RAAB 3MMBB 5KT7A 3QAUA 5ETPA 2D6FC 4C8LA 1TU0B 4JI7F 3K5NA 1QVFR 4G1QB 4NYPA 3UN5A 1JALA 3K1RB 3I0RB 3MCNA 3LPEA 1UEKA 2NYIA 5F8NA 2KU7A 4IFVB 3M6KA 5HHHA 4WE1A 3O6QA 2IJFA 2ZOGA 3W64A 2R7OA 4BS2A 3R7NB 2M4MA 4J9PA 2Y9TA 3KLVA 3FM9A 1S7HA 4K50A 3KOAA 2DWQA 2G5IB 4YXJA 3IR7B 1T8EA 4B3MF 2Y0SC 2ATCB 3ADAC 1SV5A 2LMIA 1Y11A 1GFWB 4C7QA 3KWMA 4H4OB 4C8MA 4DV5J 3LAKA 5A6PA 4LZDA 1LW2B 9ATCB 4EFAC 1MWQA 1N33F 2FJVA 4R64A 1S6PA 1WF2A 1DGJA 4EYIB 1JLFA 4IG3A 3R5JB 2ZH3A 2MQQA 2W43A 4N8OA 3MHYA 4NCGB 3GSIA 3MGHA 5HMXA 1Q82T 3EZOA 3IR6B 2BM1A 4IQMA 3T1YJ 1UCNA 2GGPB 1FKPB 1T3QA 4O4GB 2MY7A 1PZNA 5I3PA 4FS2A 3RB0A 3CDAA 4FPIA 1B0VA 4QR0A 2OD6A 5GAGU 1CJTB 4FNHA 2HOIA 2JFKA 1CVJA 4N5SA 2Q43A 1R3NA 2MRLA 5KT5A 3NTUA 3CMQA 2NXCA 4QIWF 3AJDA 1SB3C 4GO5X 3P49B 4KITB 3FSYA 4XPEA 1JK9B 1NKEA 5ALYA 3CJRA 1XU4A 8ICOA 4FYWB 1WHYA 4UQGA 2CQCA 2OLWA 3Q86A 2GMHA 4B3TF 1U09A 3I82A 4NPOA 1MWZA 3CSKA 3M9MB 4Z37A 2ZIVB 4DL6A 5U47A 2KV2A 3WIUA 3QGPA 2A3VA 4EWTA 4K7QA 1RUSA 3NOCA 5KAFU 3UN3A 3OTBA 4KGXB 1KL9A 3CCSS 3JSYA 2RHFA 2DNYA 1NK8A 1UVKA 4HH1A 2YX8A 3CCRS 4YP3A 4OZ3A 4N76A 1PVPA 1NDLA 1KBRA 1KP6A 3LK9A 3IDWA 4UF4A 3RGIA 4K8RA 4FPRA 5H1SV 1PO6A 5ETSA 3HRDD 3G4SS 3Q24A 2QN6B 4U6PA 3PMLA 3K58A 3HHLD 1U24A 2MZSA 3NGSA 2AIRB 2NZ4A 3BEGB 3WKDA 3DRRA 4QNLA 4I2QA 1ZQTA 3IAS9 1X5SA 3I0SA 4I1TA 2PGCA 4ZDNA 1QAIA 2B43A 3PKYA 5FJ4A 9ICQA 2DHXA 5J2GA 2IVFB 2XB2D 2VKZG 4UAVA 5ETMA 4IG3B 3IRUA 4M5JA 3IS9B 2HMIA 1SPBP 1DQ8A 2QARA 4YMNA 4LRAA 2ZH4A 4AYBC 1T03B 1VQ4S 1XMOF 5DG8A 2VBXA 2MUTA 1FRMA 1KQQA 1Y7PA 2K8AA 3IN5A 3U02A 3TUPA 4XDDA 4X84A 3PX0A 2VFSA 2PEHA 3GYGA 2KM8C 3NRWA 1Q53A 1Q7LB 4I64A 5M2RA 1N32F 3TZWA 2HAIA 7ICKA 2JLFA 3QWUA 3PMNA 2HOQA 4MK9A 2EG2A 3BGOP 5A0YA 2LCWA 5IINA 2XYPB 5THWA 1HNVB 3HHEA 4UY85 3MGVA 4NL9C 4PR6A 3ETOA 1WC6A 4QR2A 8ICAA 3FRYA 3CJ5A 3MPVA 1S77D 2Y1RI 2MJNA 3MUMP 4OL8A 4Q7AA 2VKRA 1SZHA 2CXYA 4OV1A 5CYQB 2XLJA 2HWTA 4PEOA 4X4VA 2V50A 4Y2JA 2V67A 2EZXA 1RXWA 3HHLA 4DCOB 2QB0A 3TUJC 1Q16B 3OV7A 3HZGA 1T3OA 4CRXA 4ES2A 3DM2A 3F2BA 2DNOA 4DV2F 2UXDF 1Q86T 2AYBA 3KHLA 2CPFA 3C3LA 2OD4A 2G2YA 2ZKUA 4Y2QA 3QX7A 1R7IA 2MEWA 2AH5A 1A0PA 5M2UA 4KHPJ 1CULA 2KG5A 1OPIA 3CCLS 3TJAA 3KNGA 1KR4A 1Q8LA 3WZ0A 8ICTA 4QU6A 3TA2A 4DV2J 4DSIA 2PA8D 2HWIA 4C4RA 2YY3A 1FJCA 1U1QA 3IAM9 4URSA 5GAEI 4IG0B 3K75D 5I42B 1RAIB 2E7XA 1NXIA 1WF1A 4G1PA 1TKXB 2BACA 2JXJA 2YMQA 1EETB 3KTQA 1P8GA 4DX8H 4OI6A 2XY6A 3LANA 3W5XA 5KFTA 1CI4A 5J1EB 5F3ZA 2CG4A 1UQVA 1EB0A 3UDCA 4CF3A 1B7YB 4PWDA 1XQIA 3DRSB 3Q0AA 2N3LA 4N47A 4RUAA 4LFCJ 2E1CA 3MAAA 5F0UA 4GKJF 1NZPA 2OKQA 1RWKB 4ED0A 3ZD8A 4IC9A 4LSNA 5J8YA 2MKJA 4I4BA 2HNDA 3UCUP 5B0EA 3A0HU 5ALMA 4PL1A 3J81j 1YKWA 3FFIA 1D9DA 1OQ3A 3G6YA 3W3SA 3DDHA 1O0PA 2WRMA 2KL8A 2HZVA 8ICLA 3KZXA 1R43A 1TK5A 1N4LA 3NNAA 3UMBA 3UQ0A 2CPRA 4USTA 1HHSA 4RQ2A 3KHRA 2JC0A 3C15B 2RP5A 3ITHA 3AU2A 4DEZA 3SCIE 3TFSA 4W90B 1UJ6A 1FO1A 4PG5A 8RUCA 1GXUA 2LPEA 4P4OA 1KSPA 2JEGA 4LR8A 2DHGA 1NH8A 5C5JA 5J8YC 3JPTA 1ZM3A 2YWGA 5F0WA 2WCXA 2HHTA 4IL6U 3TVYA 1SWWA 3NG8A 3C6TA 2D3DA 4WP9A 5EDWA 1RWOB 3IM1A 4B9TA 1BLUA 1ZAXA 6FD1A 1SJFA 4XRHA 3V72A 1JLCB 2P8IA 4K5SA 4C11A 1RT7A 3VCBA 1HA1A 1HUOA 3H42A 4USVA 4LIRA 1JLGA 8ICZA 4O5KA 4YMEA 3M8SA 1FO4A 2Y3YA 2N7YA 2CJYB 4L6V3 3MECB 1UW4A 2AWZA 2OSQA 4Y6IA 5L1KA 4QU7A 4AE5A 5K8MA 2UUWA 3PSIA 3KLIA 4MTPA 4I2PA 3D6FB 4U8VA 2XI3A 3Q22A 4NXMF 2WSCC 1Q3UA 4K4XA 1ZRMA 2M8DB 1DTQB 4M2YA 2OP5A 4MHVA 4OZJA 4HHUA 3S8SA 2F9JA 1ROFA 2WAQC 1WWHA 4LSZB 3AA9A 4UOGA 2VANA 1I6JA 9ICJA 2QLJB 4D3GA 3F73A 2JVOA 2VHGA 3POTA 1N5WA 2AJ2A 4JK1A 3GP9A 3BBBA 2JZBB 3NWGA 3NMAA 4AT1B 4WZQA 2WVBA 3AHPA 2EWHA 3I1YA 1SH0A 2J0XA 1YJUA 1Z2LA 2BPGA 9ICAA 2KYZA 1U1NA 1KLMB 1FEZA 1FRKA 1VISA 2Z57B 4ZVGA 3UFCX 2IHR1 3THTA 2O5DA 5HBMA 1VBYA 1RISA 2X51A 2ZHBA 5EE0A 3D1HA 2RRBA 5IIJA 4WTYA 2EPIA 2EI5A 3D28A 3ENQA 4IQVA 3HDSA 3SAGA 1NRKA 1RT6B 3VALA 2YMMA 2V34A 1U02A 4CLLA 3HKZC 3K17A 1NK4A 3MOZA 4DPOA 3GFKB 4ZOHC 4KJIA 4NCAA 4WK1A 3N7RC 2FPHX 4QIWD 2ACMA 5HLFA 4I6AA 1IIPA 2HEKA 1IKYA 4N77A 4N41A 3TW0A 2EFPA 5DB8A 2I6XA 2FMQA 1UW9A 1MQ2A 3G8SA 5CHCB 2G0JA 4CLWA 1Q79A 2VPZB 3GTYX 7ICNA 4OJPA 1PCAA 2OPSB 2FPLA 4N8NA 3GJRB 2VF3A 5AKHA 2Y0SD 3UM9A 2CDRB 1RXVA 2QMXA 1WWVA 2R8GA 2PMHA 3H40A 3R5AA 4YEAA 3H0LB 4DUTA 3SSQA 4OYOA 4QZ8A 3QZ8A 3QIDA 2DQNB 3PVXA 3CC2S 1XTZA 2RILA 4M9LA 1XNSA 2ADBA 2ZZMA 1Q3VA 2MZJA 2JMGA 2HBZB 3C16B 2DITA 1OIAA 1B4FA 1ZQVA 1U47A 2DGVA 3DDKA 4RPZA 3MPYA 1S9GA 2FY8A 4K4SA 2HNYA 4R5PA 3OTOF 4K0KJ 2QA4G 4QZAA 2PDAA 1NOMA 3N7SC 2V6AA 4RW8B 3OTDA 4O3RA 1LWXA 4M6WA 3OFHA 2H5XA 3TACB 2WW8A 2K2PA 4ERDA 1YVFA 4YHHJ 2IVYA 2MLZA 1F3FA 5A8KB 4LJMA 5CYQA 2OMOA 1WWUA 5KT6A 8ATCB 4PQUB 5DGBA 2WF6A 3D54A 1S97A 4ILLA 4U8YA 4G1QA 3RAMA 3F44A 3CJ8A 5AM5A 2B4OA 2FVQA 4Y2TA 1FE0A 1RA7A 2ZZTA 5BOLA 1KBUA 1H2VZ 5IC4B 4LFBJ 2W7PA 2V63A 1ZQQA 3CT9A 3D9BA 3R2CJ 3KLEA 4IQTA 1WC3A 2Z56B 2ZH6A 4FO6A 3DLJA 2E3TA 4BWJA 5KFSA 4DQPA 4LMZA 5CRXA 3UCZP 3O8WA 2PMWA 2DRBA 9ICIA 2VUGA 5FDLA 1JIHA 3EE3A 4CCHA 2O01C 4OJHA 4M1KA 1RTJB 5AKJA 5T7LB 1SQFA 2C2MB 4IH6A 4NYZA 4OYPA 4ZCLA 1RQ0A 3NNHA 4P72A 2CKWA 2FQQB 1URNA 2MZTA 4NLZA 1AUSL 3ZNUA 3O5TB 1ACMB 3OVSA 4DQRA 3GSDA 4CT8A 5IS2A 5E5NA 2DGXA 3WKEA 3KZIU 2KSOA 2QLXA 5CB1A 3QBCA 3U1MA 4M63A 4QBUA 1RBLA 4F4YA 4PGXA 5KFCA 2GHVC 2G0IA 2ZBQA 1T11A 1U1MA 3CEDA 1LKYB 1HNVA 2V8DA 3HHNB 4K4ZA 2JEFA 2AJ1A 5HATA 5L9NA 2KE7A 3KK2A 2FD2A 2LXFA 3M8PA 5C25A 2QB0B 1XSPA 4NOHA 1KRPA 2ZM6F 1DARA 8ICEA 3KUEA 3UR3C 2LA4A 1F0XA 2DJWA 1CJUB 1MLAA 2L9NA 3AXKA 1VRUB 1JWWA 1RWPB 2QSWA 5D4LA 3N7PD 4CIOA 3H2LA 1REVA 9ICUA 1APSA 3EPGA 4ZIWA 3WKCA 1FWKA 2U1AA 1BQMB 2HURA 3C6UA 2FIUA 4PHDA 4FF3A 3FZ2A 4ECSA 3F5AA 1DY3A 1A76A 2F8EX 2E1PA 2R7QA 1I94J 2MQOA 1B0XA 3LF0A 4Y2SA 3UVJA 2GIRA 3LTOA 3UD5A 1G4CA 3E3XA 2HVIA 3HVTA 2ZXHA 5MAOA 1SH3A 2CA9A 1BNPA 3OR1B 1Q8KA 1LQ9A 4A8WA 3V6DA 4MAKA 1S48A 2FYXA 2F8KA 2JX2A 1HD0A 4O23A 1O51A 5GMKa 5SZTA 4RBTA 4DLEA 2BBEA 4HHJA 4I2HA 2ZUAA 2AEFA 1H7WA 2IAJA 5LMNJ 4KLQA 1CJKA 1OWXA 1W2BR 2VKQA 4F4XA 4GXJA 2ZJ8A 1QQ6A 4TQRA 2QO3A 1M1KT 2BA9A 4DQIA 2FJ6A 3BPSP 1N62A 1WOOA 2K3KA 3MAQA 5B5EU 1E6VB 4ED3A 1RK8A 3GQCA 3RB6A 1TQLA 3BYPA 2OH2A 3MM8A 4LRCA 2HS4A 1GK8A 2DRDA 2R7WA 1ZAVA 3LUYA 3DM2B 2WB1C 1U45A 4HT5A 1GEHA 5GTIU 3BO4A 4X4OA 4O5CA 3HJFA 4V19J 3C6TB 1ZS6A 1M6YA 4KPCA 5L1MA 4QIEA 4PWWA 4HACB 5J2MB 2RUSA 2DEIA 3VAIA 4P2FA 3TP2A 3I31A 1BC6A 1UZDA 2UVVA 2LM4A 3T6BA 4MF8A 1FK9B 4X4TA 4MH8A 4JI8J 4CF4A 4F7VA 3C5FA 1HL6A 1RWNB 2GZOA 3BKUA 2J6UA 4AXJA 2M88A 3NAIA 3IR5B 1IBLF 5J2BA 2CQDA 2H3ZA 4DR4J 2AKWB 4B3RF 3QFHA 2M9KA 2ISPA 3CP8A 2VJVA 4F5PA 2RD5C 4TLQA 2Q4TA 2RF2B 3QUQA 3A8EA 4YHHF 4UY8T 1TKDA 2BM0A 4PKDB 3Q8MA 1YJRA 4YB1P 3MM9A 4ELTA 1VQSA 2XHCA 3MMAA 1C1BA 1S1VA 2FJXA 4MK8A 2Y9HA 3ZXWA 2KN4A 2HSZA 2P6SA 3H8WA 4W4MA 3PIPQ 2ZJQQ 8ICCA 4C8OA 4AYBF 3CJQA 1R8AA 4O3SA 5AKIA 5D4NA 5HQ8A 2I5JA 4PPDA 2NRXA 1ZZFA 1Z2ZA 2MSNA 1GTEA 4DL0C 1Y4ZB 4WF9Q 1CULB 1HIYA 1JXLA 2N4CA 4JWNA 2RQ4A 3H25A 1AYEA 3E51A 1YLXA 1XMBA 3AA8A 3K5MA 1AFIA 2WONA 3KFUF 3TI0A 2VBZA 4HR2A 5CP2A 1WKKA 8ICNA 2CPIA 1TUVA 4ZIVA 4F71A 3VZIA 1RCOB 3LO3A 2FUG9 1VS3A 7AT1B 1EZZB 4XUSA 3VGTA 2YBVA 2F1IA 3QT5A 1LWFA 1ZJMA 2E9RX 2UUBF 4US9A 2W1BA 1SB6A 4A8OA 4PXEA 1Y10A 5EX3A 4KLOA 1FI4A 4XPCA 4ZLPA 2E8PA 4USKA 3LGMA 3VCDA 5B66U 3F0NA 2F4VF 3CCZA 5K14B 3C2MA 3QU5A 2IC3B 2DR6A 1AZSB 1LV5A 1O08A 1QCKA 2RE1A 3PRVA 1RQNA 1KQFB 3SQGB 5F8IA 5AM1A 3OL7A 2B6AB 3CDEA 2HG4A 2OJ3A 3SDEA 4LF6J 3IHQB 2V8HA 2OI2A 5AI4A 2E1MC 1N61A 2XBPA 4GO7X 1LFWA 2AQ0A 1IKXB 4WU3A 3V7JA 1VQMS 3TKAA 1RT1B 1DFDA 1RTZA 4LVOP 4RR5A 4P9SA 3LGHA 2HFVA 5DDOC 2V2KA 2IPOB 2I6WA 4JI6J 1HNXJ 3Q8LA 1LK7A 3W66A 5KG6A 3TEGA 1Q8IA 5CZXA 1RAEB 2C3YA 3M2VB 4OZ5A 3THVA 2GCFA 2CRLA 3CJKB 3SFGA 2A2CA 2NXNA 2YWKA 5AM3A 2BQ3A 2YNHA 4OYIA 1P9YA 4DOAA 4LF2A 2YKPA 5J2PB 3HX9A 3KJNB 2FVRA 3AQFA 1RKJA 3OUYB 2CJXB 4OYWA 5DZ6A 8ICBA 1Z1VA 4IFYA 4X4PA 4Z2XA 1YJVA 3MEGB 3P6YC 1TV9A 3W9IA 4PHEA 4PWDB 2HKEA 2BCQA 3PHTA 4RQMA 3T9ZA 4IKAA 8ICSA 4JI5J 2ZWPA 4P7VA 4DL4A 1NBEB 2E29A 2KXNB 3JTOA 2OPRB 4UB4A 4KT0C 3OW2R 2IBKA 2YNIB 7FD1A 1WKJA 3QO9A 4UUWA 3CC4S 5L46A 4ZPVR 1FRHA 2W25A 4AUKA 2J6SA 1KNZA 2O1PA 1IKVA 1XERA 1VQNS 1YDLA 2BJ1A 3N6NA 5KFYA 4R8UB 1RACB 3PW0A 3B8HA 4NLTA 3Q8KA 2DL0A 3MF5A 2YKMB 4HEA9 3PW4A 5EUHA 2MKIA 3MD1A 5CYJA 4GVBA 1HPZA 2W3RA 4P0QA 3VR1A 3GJSB 2AJ4A 2CQ1A 1Y0HA 5D6GA 3KMQA 1JX4A 3B0XA 7ICMA 5T41A 1OQ6A 5ETRA 3BBCA 4ZN1A 4O0NA 4B3RJ 4WP3A 2OPPA 1PC4A 5F9NA 4K2JA 5DBBA 2BE9B 1WI6A 3DRYA 1HNIA 4I28A 5L1JA 4C7ZA 1HWLA 5I3QA 1HWKA 3HMJG 4NEZA 4EX7A 1ZQRA 3PFEA 1DLOB 1OSDA 3PX6A 3CF5Q 2J7WA 5D0RA 3GB0A 1REVB 2E9ZA 3QJJA 3RU0A 1ZAWA 3ZDDA 2HNYB 3HWTA 2I2YA 3CCTA 1CJVA 2XMAA 4E2FB 1BQXA 2GAHC 2AGOA 2MYFA 1TKTB 1SH2A 4PZNA 2VA8A 2MKHA 3TOQA 1HYSA 3B4MA 3EGNA 4DV4F 4QW8A 3V7LA 5J2AA 4J37A 2MQNA 4P75A 2DNGA 1HNXF 1QTNB 1UEVA 1MMNA 5D49A 4NLRA 3SAHA 1NK5A 2A1AA 3GWCA 3DLLQ 5KAIU 5AE2A 2L9WA 1FVQA 1TE2A 2KEYA 3P96A 1LB2B 4MKVA 2F9DA 1VQPS 3K7RA 2ASJA 2C3UA 3JSMA 3W2WB 2F8LA 1FHTA 1JLBB 5HMLA 1RWMB 1RADB 4DPXA 3F53A 1ZQZA 5J0TA 1VK3A 9ICOA 3H7IA 3KK1A 4I2JA 5H9FK 2K1RA 1UA0A 1RKIA 2J6TA 3BR9A 3CD5A 4DR3F 2MSSA 1TTHB 3JTNA 1D9AA 5ETOA 1WC5A 2WSFC 1N36J 3D6MB 2BX6A 4QIVA 4LRBA 2CZ4A 9ICGA 2Y1IA 1WSRA 1KD1T 4CNQA 3FK4A 1PK3A 5KT2A 2QB1A 1KTVA 2XS7A 1UHUA 1NK0A 2BJ9A 1BVSA 3PSFA 1R8CA 2DH8A 1XR7A 3FUYA 2R7VA 1V9PA 4MK7A 1HLWA 3MCSA 1N88A 1R31A 3MM8B 1NPPA 4NZ7A 4NLCA 4J03A 5IWAJ 2XS2A 3I87A 7ICQA 2NPIA 2GMJA 2VL1A 2B7CB 5TZVA 4O5EA 2ZKTA 3W1YC 4R66A 1XMOJ 1VQLS 2ZDOA 4IR1A 4Z7YA 1EXNA 2YNGA 2OTJS 3I4PA 3EJMA 1MQ3A 3D1OA 2NS1B 2WBRA 1KKXA 1OUQA 5F3TA 1TL5A 1S1UA 1VBZA 2MA1A 3W60A 2HBQB 4FF1A 4IQXA 4ZCIA 4B3SJ 3MUTP 1VRQC 4F02A 4PG4A 2C2NA 2MTLA 3KLFA 1IBMF 3ENWA 2ESEA 2BABA 8ICHA 3SEOA 1IQTA 3LP1B 4ZA1A 4A8FA 3DKDA 4USUA 1S0OA 1JXEA 2E1EA 3IV6A 2ACYA 1X4GA 2ZD1B 2WF8A 3K2YA 1OY8A 1IR2A 4IOCQ 2M52A 5B0FA 2V4JB 2HHVA 3AOAA 4I67A 4UB3A 3WKAA 1IV8A 3GR0A 3LGNA 2KG1A 3MZIA 3WX4A 2W9BB 2P66A 4BHQA 4YB6A 3J7Z5 4O3QA 3S6JA 4DS5A 1RGVA 1ZQMA 2IIHA 3DHWC 1WACA 4PH5A 3PCOB 4DG1A 1Q5YA 1ZQHA 5GVQA 1W25A 4P0PA 3T41A 3HHLB 4OFZA 3RRKA 1RBAA 4KGMA 1RQLA 1NHVA 4QZGA 2E7WA 2MDAA 4DSLA 3ZZZA 2BCUA 3PR4A 3FMBA 2B6AA 4WFYA 2MGZA 3UMGA 4C80A 3EVWA 2YKNA 2P2CB 4CLKA 3VGVA 3QGHA 5LSRA 4KN4A 4UASA 1B0TA 3ITHB 2ZIUA 3V4IB 3CRXA 3CCMS 2JLGA 1YX2A 3OBIA 2L9DA 1U0HB 1FNXH 4KIAA 3T79A 3C1YA 2R2SA 3V2UC 5CA5A 2W54A 9ICXA 4Q0BA 3M8QA 3QZ7A 5E3PA 4IYQA 1FXRA 5IQQA 3PR5B 4FN5A 5ALNA 5L1IA 3OUYA 3ENVA 3WHIA 4DR6F 2NXEA 4ELUA 4AL7A 1WEYA 2OCEA 3PSPA 4MFBB 4B9SA 1G7CB 2BE2B 2B9XA 2KXHA 2I1QA 2YH0A 2GC8A 1RT2B 3QGGA 1WOSA 1SJRA 2YQ1A 3D0HE 1SQEA 5RUBA 2G07A 2BE2A 1MU2A 5LMNF 4DN9A 1VJQA 4WJ3B 3NCRA 3SEIA 3M2UA 2KXFA 1J5OB 1WKLA 4OIXA 5L8RC 3QMQA 3DU5A 9ICHA 2FJDB 1NNDA 2BE7D 4F36A 3NS6A 1C1BB 3IGVA 1OPZA 4KFBB 1N6QB 5AXKA 1RLDA 3GIIA 1VJ5A 3AXMA 3C28A 1V9OA 1H72C 3PRBA 5KG1A 1MN8A 2JDJA 2F77X 1RWUA 1KEKA 2KHVA 5T14A 4FNIA 4QWEA 2QL9B 1MROA 3ONQA 3PJWA 2FGCA 1LWCA 4P52A 5B0CA 4DV5F 3C21A 4KO0A 3J81U 3DI6A 5K8NA 5AJ3J 4DQSA 2HZAA 3K4GA 4R0JA 4BC7A 3VAKA 5CHGA 2CQBA 1LW0A 7ICEA 4JV5F 1DQAA 2JRZA 4MFCA 3JSBA 3SMZA 1JXVA 4X4RA 2R3VA 1L7NA 1HR0F 4U96A 2R4FA 5HJXA 1HHTP 2BOAA 4KN7A 4UT4A 2XMWA 4OJ5A 1SKRA 2E5IA 1T9TA 1C20A 1WHVA 1X9WA 4RW4A 2F1FA 5EN1A 4ZVPB 3AOBA 4GRSA 4BUGA 5AT1B 3P5BP 2BJ8A 2ZTEA 2DGUA 1Y9OA 3W65A 2OELA 4QR1A 2LQ8A 3HVAA 4KH0B 3VHQA 1S1WA 3ELHA 4Y2CA 3HFVA 3ZFVA 3QWPA 2KFNA 3TNVA 4DOZA 3BSOA 1YSJA 5JXSA 2LEPA 4K4VA 1HEKA 4ICLA 2ZVIA 1BPYA 3UWTA 3DOMB 1XR5A 4WZMA 5HR7A 4J9NA 4P2HA 5AK5A 4FYYB 2ZEJA 2V2QA 4J90A 1HQEB 3D6HB 3GZFA 3V5RA 1C0TB 4TU9A 4X65F 1CC8A 3GR1A 1TFRA 3H59A 3QT6A 5ALLA 1J97A 3NRBA 4OJ1A 2H5IB 4H4OA 4XO0A 2ZZNA 1CBKA 4DBQA 3NGRA 5IV3A 1U25A 2F63A 3JPQA 5J2CA 1U0SA 3IRXB 3MI7X 3VVUA 3US5A 2GJIA 3MMBA 4ZP9A 3OVAA 5B0AA 2OPQA 4UB2A 4ECXA 2NYHA 1S1XB 4UB5A 4NA3A 2W8LA 4WWSA 2B4VA 1TKXA 2R2UA 4HDGA 3FVYA 4USIA 1GNKA 8ICFA 2IFXA 3MDFA 4JI3F 8ICRA 4ZVUB 4P2MA 4AXIA 1DTTB 3CDWA 1D9FA 1FDAA 5DETA 5DZ7A 5EWEA 1RAHB 1S5LU 3RH5A 1G6BA 1DAXA 2ZVSA 1DTQA 1T9WA 5A76A 4KMUA 4B9UA 2B9WA 5E2QA 1ZYQA 2GO9A 4RQ4A 4DPYA 3NS7B 1F3VA 2GQ2A 2W4CA 4ES3A 4QYZJ 5JU5A 1PIEA 1YTYA 1UVNA 4HT7A 4OCZA 2K06A 3T6JA 3U27A 3ZC4A 1S4FA 1SJ4P 3I6PA 4GFJA 4DWIA 4F5RA 3O1LA 4IOBA 2QA2A 5GAHU 2YNIA 1UMJA 4UOCA 3DOKB 4RQ8A 5SUHA 3QU2A 1L3TA 4LFCF 2B9EA 3OLBA 1S0NA 2FLLA 5F9LA 3QRPA 2HK3A 2KVSA 1K73T 4DSEA 3DMJA 1LFPA 4NXNF 3R5GA 4C2MA 4A8MP 2DNMA 3BN4A 2XMJA 4QZFA 4O3MA 2GIFA 5H9EK 1X5OA 5AI5A 3BN7A 2EAPA 4F3QA 4RQ6A 1D8YA 2X7IA 3ZTSA 1Y5IB 2FB0A 2CN1A 1F5SA 4PAAA 2J0SD 4TY8A 2CPDA 3FBFA 1M90T 4IQWA 3QAEA 4MIBA 1IR0A 5D4PA 1RWXB 4RNOA 2VFUA 1M5VC 3G71S 4PPZA 5A8KA 4TQSA 3QLHB 2L08A 4Y34A 2GLEA 2CQ3A 1NDPA 3RW7A 2GVDA 2VFVA 1ZQEA 3ISDA 1MU2B 2GW8A 4F0HA 5J0SA 1MW7A 3E2EA 1T7PA 2YXLA 4E0DA 2KI2A 4X62F 3A4TA 4F4ZA 1IBMJ 2V2VA 4ZVRB 4TNOA 2WHEA 1K1SA 5A8WB 3BGRB 4W92B 4HH0A 4HAIA 3GIJA 2PO4A 4IQUA 4DUYJ 2GWSA 1GO3F 4RPXA 4R63A 1EP4B 2JNJA 5AXLA 5GAGI 3FQLA 3MFHA 4OJ6A 5DDQC 3HHKA 4KLEA 4MFAA 2IRXA 3M6VA 5HROA 5ALJA 3JQMA 2DKZA 1YWXA 3BGLA 5J2IA 1PAEX 3G8TA 7ICUA 4F25A 4KKOB 1X4HA 4ECRA 1YJWS 1T0TV 4ITSA 2YX4A 4PCQA 2CZVC 3JAMY 3CE8A 2Z8QA 5J2FA 1X4AA 4NLBA 3I32A 4ANCA 3KDOA 3QUTA 1S9EA 4IO1A 3SXLA 1VK8A 4OQJA 4C0OC 5IT4A 2MJUA 4DPUA 3PTWA 1VBXA 5GMEA 3I5BA 1GMVA 1TMMA 5KL8B 4EBCA 5KFZA 4OYBA 2LXUA 2HS3A 4FXWA 4PG8A 1N36F 4GLXA 4ZITA 5IXUA 3LDAA 3ISZA 5KFBA 3QQCD 1NZAA 1HBOB 3R7BB 4BLGA 2J9CA 4YY3J 2VU5A 5KFLA 4J9OA 2AYEA 3BKFA 4QZIA 1RU1A 2CPHA 2HNZB 3GLJA 3E8OA 3W62A 2AJQA 1RZMA 4LQ9A 2IOFA 5B09A 3DDIA 4KGKA 2Z2YB 4DUZJ 3BH6B 1FJ7A 3BS5A 1RHUB 4LF4J 1B7FA 1M5OC 1BQMA 1Z00A 2DGWA 3AB4B 3CJ4A 3EW9A 3R9KA 3CDUA 1R0AB 2P9CA 1UETA 5DG7A 2PXIA 2IY5B 1X5PA 2F1HA 4DUYF 4BGDA 5EE9A 1ZQ1C 2DR5A 4J5OA 4K4HA 4ANDA 1VOMA 1DHMA 1SC6A 3MECA 2GHWA 2DO4A 3L9ZA 1MN9A 4JV1A 1VC0A 4DFKA 1PKUA 1ZQUA 2LU1A 3RJFA 4YB7A 1N33J 2G1HA 1FDBA 1X4FA 4M5MA 3LPYA 4YDDB 3GYXB 3DRPB 1OYEA 9ICPA 3ZNJ1 4IS7A 1WG8A 2YWFA 3V81A 5ALHA 5HN0A 4IG0A 2YWEA 4ZJOA 2LEBA 3BB5A 3ISND 1N34F 4M5IA 4R8UA 2DCUB 1R27B 1REGX 2ZM6J 4R0EA 5KFWA 2RSQA 4QIWC 3G82A 1SL1A 1KDHA 1RYSA 4Q8FA 4USMA 2FE9A 7ICHA 1GT8A 1R8PA 2ZJPQ 1NMEB 1WSVA 4C3LA 2QYGA 2XO6A 4HKQA 4JYAF 5DS7A 2E5SA 3N0VA 2F4FA 1R6YA 3F41A 3NASA 2H51B 2YNHB 2LQJA 1YJTA 3S6EA 2DCLA 1PYSB 1ZETA 1NK9A 3IRXA 2OSRA 4K5RA 4BCAA 1TR0A 1NSKL 5A2QY 4DR1J 2XICA 2LDIA 4I29A 2BZ2A 4O44B 3UN2A 3AEVA 3NS1A 4YMOA 4MF2A 1COKA 2DNPA 4RX6A 2IM3A 2UP1A 1Z1ZA 4GIBA 4I2AA 2C3PA 4I2GA 2VOOA 2K8CB 4KQZA 4TUPA 4QCLA 1RHKB 3KKAC 1DRZA 1IJEB 3ICXA 3J7ZT 3UMCA 2ASLA 2BJDA 4LF8F 3DGVA 3IBFB 3UD4P 2B4PA 4NLKA 2LFVA 1XMQF 3ET6B 4UZBA 4ECVA 3DLKB 1WC0A 1VQ8S 3KDNA 4PQUA 4TLRA 2C2EA 3VV2B 1HIWA 1P7DA 3GJTB 4CI0B 1PILA 1WDTA 5HK4A 1FD2A 1HMVA 4K4IA 4GVLA 1SCJB 1RAFB 5AKKA 2DXEA 5F8GA 3OSPA 3LWMA 2RU9A 2KICA 1Z3EB 4PHAA 3M8PB 5C25B 9ICSA 3KJVA 3UXOA 1UVJA 4ZPCA 1WC4A 3PXGa 4ZP8A 4M04A 3ISCA 1M5HA 1ZQPA 2AZ1A 2HFNA 4E98A 3RAXA 2CNNB 3KUHA 2BMBA 3GIKA 3QSYB 1ZM9A 3ED5A 1F2HA 3A13A 4OZ0A 4NA1A 1ZM2A 4KLSA 4L76A 2NO5A 2C2KB 3HSJA 4F26A 5AM0A 2NQPA 3WDOA 3WQPA 1S72S 2FZGB 2WW4A 2OXOA 4Y2PA 1EKSA 2D8CA 1RTDB 1DTTA 2LM1A 2F44A 4I2DA 1P6TA 3U1NA 3PV8A 2D3OR 1Z19A 4NLOA 4L72B 2JZBA 3RBXA 1Q95G 3PYFA 3SBMA 5J0QA 2LXIA 1HBMB 2DNKA 4IDKA 4ID5A 1U8SA 4G6VB 2CWXA 4JMUA 5LJ5Y 4K4GA 4PXCA 2W01A 4KMOB 1X9MA 2IDLA 2ZUGA 4CP5A 5D46A 4TXSA 5FDLB 4WFNQ 3QU7A 3THPA 2KRBA 1UPPA 4GKKJ 2KDOA 2EC2A 2VG6B 3B4DA 1Q1KA 1FJEB 3N5FA 1GH8A 1O6XA 4FXVA 2XMVA 4IOAQ 1HQEA 4ZVQB 2BCVA 2DBYA 4PYAA 4LF7J 4C8KA 2V68A 4DR3J 5JUMA 1HR0J 2LYAA 2RDJA 4M8LA 2KM8B 3EPIA 2KYXA 2UUAF 4C3MA 1UJ4A 4OZ1A 4RZRA 5EOZA 2LBOA 5IM0A 1ED1A 4ZLLA 1QUPA 3TYTA 3C8YA 4PXDA 5ALPA 2GO8A 1HWJA 4JI2J 1E6YA 3HD1A 4I2CA 2LHTA 2M2BA 1JMTA 1IBLJ 5AHXA 2XS5A 3KJFB 4WKYA 1A0OB 1QH9A 2VASA 3IP4B 1JUDA 2B5JB 1TL7B 4DU8A 2XTJP 4UB8U 3LP2A 5DKWA 4M6WB 1EIYB 4KHPF 1UAWA 5K4LA 2YWWA 4OI3A 1RHRB 4PRFA 1W26A 1C0UB 4I2FA 3BJYA 4NE9C 2IYGA 1F5AA 3MEEB 3CNQP 3RBEA 2HQDA 3AJ1A 3TZYA 4EU0A 3MEEA 2XLKA 5E0OA 4ER8A 4JB3A 2CQGA 3KUGA 4NXMJ 1PK1B 3JXOA 1WELA 4ALZA 2JR5A 1MROB 4FKYA 3DOMA 5LM7E 2QG9B 4NY8A 2BRLA 3RG6A 4E8UA 2EXUA 4I2QB 5KFGA 3Q89A 2UUTA 3ZDAA 2CIMA 3DI6B 3E01B 2QLTA 3WU2U 2BVZA 1G3OA 1XS9D 2PI4A 4MYUA 4OO1J 1RHJB 3CTRA 1M5PC 5BR8F 3JYTA 1KLNA 3KJQB 1CQNA 3KNAA 2VG7B 3B78A 3O3LA 1TK8A 1J2MA 4B3SF 5CJ7A 2FJBB 1LWCB 2UU9F 2JSXA 2FVSA 3NGUA 3RTVA 3HKZF 2EAMA 2YH1A 2A3JA 2YKOA 3NL0A 2LA6A 4OI0A 3VWSA 3L95X 1PJ5A 2MAXA 1Z1BA 1YITS 5J1NA 2VPXB 5C24A 2C22A 2WVCA 2H5EA 4TY9A 1SV0C 3MEGA 2WBMA 1YIJS 3F5EA 4WE1B 4RW8A 1LEOA 3ETMA 3R9LA 3RJMB 1S1VB 2RAQA 3MM5B 2W7OA 1S10A 4X4NA 1CJVB 3FAHA 1L6NA 2Q6CA 1O03A 4ED7A 2R8IA 2F76X 2D3ZA 1MN7A 5KFJA 3NCQA 1WUDA 3JSRA 3HHDA 1KKHA 1UL3A 1JI7A 3RF9A 2K4PA 3K57A 2HBYB 1BGXT 3KLGA 2K7KA 3L09A 5MLCV 1J5OA 2KG0A 5BYSA 3NRZA 2A2DA 3MUVP 1T03A 3FC4A 1SIWB 4OZLA 2KKHA 2LI6A 3NBPB 1RTHB 2F65A 1LXJA 2WF5A 5ALDA 1R0BG 2DGTA 5KFQA 4KX5A 4W98A 1NLKL 1C4AA 1YRTA 2YTCA 5KFHA 1VYAA 4RW7A 3SQOP 2FLNA 3EYZA 3J80Y 4ELVA 4KHMA 4Y65A 1F9FA 1ZQNA 4DFMA 8ICPA 2OUGA 1L8LA 5J0XA 2BW2A 1XC9A 4LRDA 2EQYA 1A77A 2CJBA 1FFUA 4OJLA 4X64J 1WG4A 5AK4A 3D67A 4U7UK 3KKFA 2LDYA 1S1XA 3KBBA 4X62J 2RKIB 1BUXA 4ECQA 3N01A 4B3OB 1YZ6A 2P35A 2XZWA 2DNQA 2DHAA 3ZTOA 2KIWA 4DR7J 2V0NA 4UUXA 1T9VA 4YR2A 5DBAA 2XSJA 1B43A 4F04B 2FZCB 3HSGA 2BJ3A 3V6KA 1UWAA 2KVCA 2XCAA 5AK3A 1COOA 2XHWA 3H2VE 4NI2A 6FDRA 3EGWB 5AKXA 3TZXA 3OHBA 4J9RA 2AX1A 3CCUS 4CDGA 3V4MA 3MXHP 4C8NA 1NSPA 1VQYA 2J8AA 4RNNA 4PYDA 3BQTA 3SR6A 5AJ3F 5EHHA 2RS2A 5KFFA 3G6XA 4UOHA 2NUHA 2CWKA 4ES1A 4ZLJA 4QZBA 1C4CA 2COLA 4ZMMA 3H7HB 4DFJA 4MKBA 1HD1A 4JB8B 4NCBA 3FFIB 4UQTA 3NUQA 5D3GA 3CJ0A 4QJFB 4RUHA 3UPQA 2R9LA 4O3PA 1GMWA 3WIVA 1RT5A 2MY8A 2Z4PA 3AQEA 2V8PA 2B3TB 1A6SA 5JRTA 2ZE2B 2RT3A 3DYAA 3FDSA 2ISOA 3SMVA 2IHNA 4LBIA 4F5QA 5EGYA 3CDBA 2O6KA 1ZQLA 4H4KA 2ZH9A 4K4TA 2EFOA 2KKPA 3IG1A 3WK5A 4HLBA 1AA1B 3HP6A 2WK4A 1DZ5A 1U6ZA 1ZTWA 4K0KF 2E8MA 2YMLA 1SXEA 3C66A 4UAZA 1WG1A 4XK8C 3W63A 1Q5VA 3CJSA 1MSWD 1S1TA 4RT2A 4QJVA 2CPXA 3MM6B 1EQ0A 3M30A 5D4OA 2E66A 4MKAA 1FF2A 1OMSA 4KRWA 1NNLA 1RP5A 3H5XA 1Y00A 5DDPC 2JFDA 2CPYA 3LOUA 2M0NA 4USWA 4A48A 1AQ6A 8ICIA 1NPKA 1SV4A 5EE3A 3M6UA 4NMXA 4RJVA 3DC2A 3JPSA 1Q78A 5F3XB 1JJ4A 1GX6A 2W4DA 2I1RA 2FI1A 4EBEA 1T05B 3TWZA 2K1RB 1RXOB 1TKTA 2YKMA 2DK2A 4F50A 2ZBIA 4C4WA 3ZI4A 1JNZB 2EVZA 5IM0B 2LVWA 2E1FA 1D8ZA 1I5OB 4DV0J 3ETRA 3GCWP 4AFFA 5AE1A 4RPYA 5LXRA 3MMJA 3H5UA 4CLFA 2HW3A 4A8XA 4YR3A 4B02A 1MNEA 4M5DB 3W2VA 3M6ZA 4CO3A 4HI2A 5BPCA 3BDEA 4EO6A 1SC4B 2QARB 3TR5A 1FERA 2I8EA 1RBOB 2HHSA 4IR9A 4KHRA 1T95A 2MQ8A 4K59A 5D0EA 3BO2A 1ZD4A 2G9OA 1LXNA 4PGYA 1F5BA 3ZZPA 2C3OA 2ROGA 2B5JA 3KLHB 5CQGA 4R5PB 5A6WA 4RNHA 2AJ0A 3OL9A 3OPXA 4WYWA 1L7OA 3C1ZA 1UVLA 4NWBA 4X66F 4UB1A 4TU7A 4O9MA 1OJ4A 4M5GA 2MKYA 1U1RA 1N5VA 1C0TA 1NU4A 2KD1A 5CH7B 1JN3A 4C97A 2VG6A 3M7DA 3H5SA 4JI1J 3BS7A 2R7XA 2AT1B 1SIJA 1ELOA 2V9KA 2QRRA 1F60B 5ALVA 2OPPB 3IWNC 2RRAA 1ZOTA 2LKYA 4DF8A 5DQHA 3G9CA 4EUVA 3K0JA 2DNRA 3MR3A 4QIFA 2GOLA 1QVGR 3FJ2A 4F93B 1IR1A 1S99A 1F9EB 2H5JB 2VDIA 2AEMA 1GXLA 4F2SA 2A1BA 2CAJA 2V69A 1TAUA 4OYXA 2J0WA 5K5MA 2EEYA 2X1GA 1V3RA 4DR1F 1KWMA 3R5CA 1UFWA 2BKOA 1LW2A 4IRKA 4JWMA 2MPUA 3QSIA 1IN0A 2C42A 3Q8SB 3KK1B 2HGMA 1YK9A 2GV1A 5I3UB 3EWAA 4KLDA 4JYAJ 3VGUA 4UAUA 3C46A 4NA2A 1YBAA 2CQ0A 3D2SA 4NZ0A 3UI3A 4ZN3A 4RL1A 2V4RA 1XMQJ 4QOTA 3QNMA 3DEEA 2BCSA 8ICMA 2YY6A 5J2QB 2VOPA 2ES6A 2HBRB 2XMTA 2GVDB 4NYOA 4CNYA 1VRTB 4CO0A 3OGUA 3M4XA 4LT6A 4OI2A 4OX8A 3IWXA 1HBOA 3K89A 4KFBA 1N6QA 4R65A 4I2BA 2DR7A 2J7UA 4PL2A 1N8RT 1KLMA 2KO1A 3QRRA 3TUIC 3ZZ0A 3DLGA 1NJXA 1TV6B 4FF4A 5FIIA 4JI8F 1PVQA 4TUQA 2BZFA 2ZIWA 5HSPA 3NLCA 1B70B 3DLEB 4NCGA 1BQNB 1SGGA 2W7AA 3QU9A 1U1LA 5D0GA 3ZZTA 3DRXA 2AGQA 1A9NB 3F56A 4F8RA 3BO3A 4L3KA 2PFPA 4U7CA 4TUSA 2MB0B 2DY9A 2VA2A 1AXQA 4M5KA 3B82A 4XDCA 4IH5A 4FZVA 3H0PA 3C2LA 4Z6FA 2NXUA 4ETXA 5L1LA 1PYTA 1RZTA 4RLEA 2ZITA 3HHLC 3K8WA 2RQKA 3H0RB 1AW0A 4RW4B 1KQGB 2KZZA 9ICTA 4EX6A 7ICPA 4MMOA 1U2RA 6AT1B 2N3OA 4DV1F 2ZUBA 1S9EB 2CXEA 4CYUB 1S4EA 4P0PB 3Q23A 5LT5A 4DPTA 2QMWA 4URGA 5HI7A 4DL5A 4DUZF 5KFRA 3GYNA 2M8HA 4UB6U 5LSLA 1IBKJ 3MPWA 1EJ7L 3KD3A 3DLGB 4ZVSB 2ZH1A 1QQ5A 2H1YA 1N63A 2MQLA 2ZG6A 4IFVA 2VICA 7ICLA 1Z4UA 3NBPA 4FVMA 4RT3A 1K9MT 2I38A 3UQ2A 2U2FA 3RJKA 2H48B 3D3CJ 4KLGA 5F41A 3MTKA 1V5IB 2W2MP 2WFAA 2IA6A 2E8OA 3AB2B 3LYSA 2DNHA 4YN3B 3JPNA 4IRCA 3HT3A 1U4BA 2G2ZA 2E1AA 3QE9Y 3DYAB 5GAHI 5J1EA 3LWLA 1EX8A 2F5GA 2RRDA 4Y2VA 1X2IA 3CCQS 2XGQA 4KC5A 3VQSA 3NVZA 2QEXS 3UXPA 2KT2A 2A0FB 4DR5F 1DGSA 3KYLA 2HQFA 3QYYA 3H8JA 4RUBA 3T3FA 1DK2A 3CXCR 1KC8T 4OI1A 4EGLA 1TVRA 1FTRA 4ZJLA 1IKWB 3IC1A 4QPTA 2AMCB 2NPFA 2FZKB 1NDKA 2D69A 2QFIA 2HHHJ 3CJTA 1ICEB 5KFDA 4BXOA 4CLYA 5IT9Y 3GONA 4M47A 3WK6A 2W9CA 2C2OB 5IV4A 3TFRA 2K4IA 5A8RA 3IWLA 2YNFA 1TL1A 4QZCA 2WVDA 3B6BA 4RQ0A 1JNRB 1PC5A 4JI3J 1YRUA 5ADZA 2HPUA 5J2MA 1KFDA 4OLPA 2F2AB 2B6GA 2G2OA 2EAOA 4CLTA 3PYDA 3Q2SC 2RB7A 3AN1A 2K3IA 1ZQAA 4M9NA 4ZPTR 2ILZA 5D77A 4FVCA 4OHVA 3T1AA 4DR5J 2F4VJ 2ZD1A 3JSMB 4JI7J 2J8SA 1FFWB 2C2RA 4F4KA 2IRYA 2PEBA 4KR0B 4R25A 5ALUA 2MZRA 1QSYA 2EH9A 3MC1A 1RB0A 3L3CA 5J2JA 1VLOA 2UVRA 4HYKA 3ALRA 3RH4A 3A3PB 2VD3A 1WCLA 3MM7A 3PY8A 3AOCA 2AEJA 2HIYA 4TVAB 2GJFA 4QZVB 2J7KA 1YRXA 5AKEA 4DQQA 1NKBA 7ICVA 2HQIA 1CJKB 1N5SA 3MAAB 1RI7A 5C42B 2NLWA 1FEEA 2W24A 4PG6A 5DJBA 1X5TA 2EFVA 3G82B 3EXYA 1URJA 2LQ9A 5DBCA 1S7IA 2RLTA 3A3NB 3GFHA 1N0VC 4A8KA 2KHQA 1S9FA 4OZNA 4H4MB 4RNMA 2HRUA 3CYMA 4UTGA 1FRIA 2CPZA 3FEYB 2IM0A 2YPZA 2DKXA 2G06A 3ZDEA 7ICRA 3KLIB 1JJCB 3OPKA 1TKZA 3SENA 2RU3A 2MUTB 5A8RB 1XNRJ 3ILOA 4YG2A 2A1JB 1Y5LB 2XGPA 3QIPB 2OAUA 5L39A 3D1QA 1RTDA 4P10A 2QMUB 4N7TA 5KFAA 4CO5A 3V4IA 3G2XA 5KFEA 3KXDA 1HQUB 2NYVA 1SZPA 3PJXA 8ICGA 2HVDA 4C0HA 1IM6A 5HLFB 1DQ9A 2XCPA 5ALEA 3FBBA 4C0BA 3HJVA 1SKWA 2I9SA 1C2PA 3EUNA 2R8HA 3WX8A 5CABA 4EELA 1R89A 1V97A 1RCXB 4TU8A 4HTIA 3FNNA 3QO9B 1S1WB 3MAHA 3IG5A 1QD1A 2OPSA 2AYMA 1UPHA 4OI4A 1E6VA 3KHHA 4J91A 4YUDA 2AGPA 2GX8A 3GU3A 1XNQJ 2FVCA 2HCFA 2WAQF 5C7PA 3Q8UA 2OHFA 4B9LA 3DLHA 2DPJA 2XNQA 1FKAF 4CLZA 5HQMA 3QUBA 1JLEB 2Y0SF 2DR8A 5B08A 3BS9A 2J9DE 3KG4A 2HBKA 1FWPA 2HIQA 1YHQS 4OYMA 2MU2A 3L4PA 4OHWA 3POTB 2P6RA 3P5TL 3TAPA 2ZH7A 3PZPA 3GIRA 1Y3KA 3JPPA 4M5DA 3H98A 2DUYA 4OJOA 1WYGA 3CJKA 2WONB 4AD6A 3LVWA 2ZC3A 2QT7A 2JEIA 1X9SA 4F3MA 3TO8A 2Z0GA 3M05A 3T5LA 4WTOB 1L3SA 2R7UA 2XI9A 5ETNA 2FTRA 3FCWA 4TURA 2Z30B 1S9GB 5KFKA 2V94A 2VQEF 3A12A 4EBDA 2A1JA 1X0PA 1SJ1A 3OLAA 3PX4A 3OR1A 5KFUA 3DHXA 3D3BJ 3I4HX 2KNJA 4DZDA 3PG9A 1NKCA 2R18A 3C5GA 4OD0A 3M2RA 1IKXA 3SSSA 2UXBF 4WCEQ 3FZBA 5HVHA 4X4SA 3GV8B 2HRTA 2PFDA 3GILA 1M5SA 2N4DA 4YVZA 4WXWA 1XIQA 3VAFA 4RQ3A 3RR7A 1JLEA 4DZ6A 2CQIA 3EXCX 1T9UA 3ZZRA 2PFQA 5B0BA 1HFEL 2K8BB 3HILA 1YQHA 3CGIA 4U9RA 2VG5B 1D1UA 8ICJA 1O8BA 4JI4J 3NCPA 2XMKA 3PNCA 1B4SA 1IG6A 1T4GA 3D2WA 4QWDA 3WK4A 4BBYA 2UVWA 3GG1A 5G0RB 4OX9F 1X9XA 1U6BA 3DRRB 1X4CA 2HNDB 2WB4A 4Z6DA 3D68A 1ZQYA 4ETZA 2VZ9A 4DLGA 2CPJA 4CDIA 5D4BA 1NSQA 5J0OA 1PJ6A 1FE4A 4OHXA 1Q7YT 4MT1A 4DL3A 3GDXA 4ZPAA 3Q8PB 3L4BC 2VJ5A 4ICLB 2YQEA 4DO9A 1JRPA 1FTCA 5J2NA 1RT6A 3GMGA 3VAJA 4L3NA 2ODGA 2JHDA 2VIHA 3W5YA 4DV3F 1K0TA 1FKOB 1ZD3A 5ALOA 3R6GB 3J80U 2M9NA 2VONA 5K8OA 1X42A 2BW7A 4CT9A 4EI2A 4QWCA 4ZH4A 3QRQA 2CQHA 3Q8VA 1JJHA 2LECA 1H38A 1XBWA 4J9LA 3OXGA 5CD4H 2VC1A 2L5YA 4YB5A 1FWLA 4GMKA 2XZTB 1FDDA 1VLYA 3NWRA 2IHMA 1HW8A 4OHYA 2XSFA 5ALXA 4EMDA 2GMLA 3C15A 9ICWA 1OSCA 4FZMA 2PMZF 2D1CA 4X4UA 9ICLA 3RB4A 3EVMA 1IQZA 1RHMB 2A10A 3ZTPA 3HM9A 1IVZA 2CQ2A 2UXBJ 3SQGA 2EK1A 2HLTA 2WF9A 2BR0A 1GX5A 2VG7A 2AP6A 1F5CA 4URQU 3T1HJ 1XO0A 2GIQA 1OXJA 1WNEA 4LF1A 2VQFJ 2WOMA 2QE5A 3BQ1A 4LQ3A 4ID8A 4YS2A 3M32A 3MURP 4CF5A 4Q8EA 4Q43A 2BDUA 2O66A 3UQSA 1JLGB 2KN7A 3BGFA 3D6TB 2UU9J 2XY7A 4P2XA 5J2HA 1VFJA 4LSLB 4FF2A 1QE1B 2GQCA 4FYXB 4CNZA 2E44A 2OO4A 2RDDA 4ZKAA 2DR9A 4YOEA 2BGWA 3DLEA 3UDLA 5I42A 3MTJA 2RDIA 4G3IA 1KS2A 2BANB 1FCAA 1Y88A 2R2TA 3K8VA 2EG1A 4YY3F 1LVHA 4LVSA 1VIOA 1B99A 5AK6A 3NGKA 4QPXA 5F8HA 4ZVOB 1C7YA 4DI6A 4DV7F 2HHWA 1X31C 4Y2MA 1S6OA 4RNFA 3RRHA 2NSCA 1BPEA 2W55A 1ZQIA 1MC8A 2KIVA 4XA5A 5JVHQ 5DRKA 3A8JA 3BSAA 3D66A 2ASYA 4DX5A 2ZH5A 2B0CA 2FHKA 2QA1A 1QSSA 4YFUA 3TADC 1FNMA 4QIGA 4LFAJ 1FT8A 3GFXA 2H3IA 2JZ5A 5HHIA 2V8VA 3HULA 1ZZNA 4DL2A 3RB3A 2EDUA 4RU2A 3UNGC 4UATA 4A8EA 1XSNA 2FHMA 5A8WA 2AYGA 5KOXA 5HVGA 2V4JA 2HWHA 1WEXA 8ICKA 3KHGA 1I94F 2ZHAA 1HBUA 3MMAB 1JROA 5EX0A 3AM9A 4EEKA 1H7XA 3AT1B 2VC0A 1VC5A 4ZHRA 1J27A 3TEHB 1OY9A 1H6KX 3BZKA 3EMTA 3DLBA 3CIMA 1RHQB 2HFUA 3CD7A 3M2RB 2BJEA 7ICIA 3R5BA 3W2VB 4CLUA 3I5CA 1HJPA 3WBZA 5HAOA 1U26A 2IDEA 4XQ8A 3JQKA 4NLQA 3EICA 4C3KA 1KFTA 2BXJA 2ZTCA 1U1OA 1HNZF 4A8QA 1S57A 3D0GE 2B7BB 1RYUA 2ZH2A 2FLOA 1NPRA 2WZ1A 4LF9F 3A8IA 4K2XA 1VC6A 1L3KA 4KB7A 5B7WA 5ALZA 4Q2LA 3ZZUA 1Z4OA 2CVEA 1FX2A 4KY3A 2MZQA 3TJ9A 2NV3A 2G4BA 2X1BA 2HVHA 4DU7A 2BDPA 2XC9A 2NREA 5C2GA 3DXSX 1TAQA 1YT3A 2VJ4A 1BD6A 3FRZA 4MIAA 2NRWA 3RJEA 3C2PA 1J5EF 4U7UD 2W3SA 1WD6A 2CNKB 4WJBA 1B22A 3ILLA 1XO1A 3FKBA 3B9JA 2P6TA 3OR2A 1A6LA 1QAJA 3W9HA 2V9WA 5KNIA 4JI1F 5KT4A 9ICEA 5K8PA 3MR5A 2ZNYA 3UPFA 3D7SB 2AU0A 4LFBF 3OFFA 5T7LA 3L7PA 2X3GA 5J0PA 2RJZA 3PYEA 5L38A 5AI9A 5DQGA 4HDHA 2HBLA 2W9BA 2HVEA 1SWVA 3G6VA 5DM6Q 4KTQA 3Q8RB 4KLHA 1FRLA 4DV4J 2LQBA 2MLXA 8ICVA 4Y2IA 3TVZA 4FE3A 4BDPA 3R27A 2KMDA 2G0CA 2R42A 2PFNA 1I1GA 3NEKA 2NSBA 2HBMA 3TVKA 2OEJA 4L74A 2WB1F 1CSJA 5KG0A 2ZUCA 4NLNA 1F6TA 1NB7A 3H4BA 2NZCA 2WAQD 4DN0A 5AKGA 3MWBA 3AD8C 2F3JA 1KTQA 1ZQWA 2MLYA 4JUZA 2V4QA 5E3RA 2KKVA 2F1JA 2BKNA 2H9ZA 1QUVA 3ET6A 3KLHA 3I96A 5BXIA 5E79U 4DL7A 4PUOB 2OIHA 5HP1B 3MD3A 3CCJS 5KTQA 3DCAA 4FKXA 2W2OP 3D5MA 2PE8A 9ICVA 2RQ5A 4ICAA 5DB9A 4C8ZA 1FXDA 2FDNA 1YJ9S 4F4WA 4A4JA 4FYDA 1UFKA 4DFDA 5HROB 2K7JA 2CPEA 2KJWA 5J29A 1IKVB 3HCXA 4NLDA 5IFMA 4P73A 4Q44A 3CB4A 4RWWA 2PKEA 3I28A 4FZNA 4DJBA 1S6QB 5KFXA 3KOOA 3A8KA 3KG0A 4Y2AA 1RSCA 4B17A 2UZAA 5BOMA 3M8WA 4ZVTB 4OV6A 1HKAA 2HGLA 4M0AA 1VQ5S 2V5HG 7FDRA 1ZOLA 1SUQB 9ICFA 1FJGF 3DV9A 1IBCB 4UW2A 4ZVFA 4NLGA 3I76A 2FMSA 3N5BA 3W7BA 1QAXA 4WBFA 3T5HA 2EFNA 3CCVS 3NXZA 2JLEA 1U9LA 4M9GA 1WCNA 3LH2S 5J0WA 5IOLA 3CJ3A 4HHHA 1U6FA 4NZ6A 2X1AA 2YPYA 2RRNA 1RT5B 4YCXA 2CJAA 4F72A 4B3MJ 3C29A 1UT8A 1TL4A 4F4AA 5JVGQ 1BE4A 3UR0A 1XNQF 5CD4A 2QLFB 2Q79A 3N6LA 3TX8A 2Y8YA 1BPXA 1XWLA 1HYSB 2XLIA 2GVZB 4NWIA 1YJ7A 4KLTA 3QXGA 1Y5NB 5DQIA 2DGSA 2H3EB 4Z6CA 2NRTA 3W61A 3A0BU 1SL0A 3FBEA 4UW9A 5HO4A 4DOCA 3BV8A 1TL3A 1T9YA 3OD2A 2XG8A 2VBYA 3OXFA 3MBYA 4OJ3A 4AQYJ 3TQEA 5AIAA 5LXYA 2CG8A 1M1GA 1ZQDA 3G8QA 2E1RA 3VGSA 4OX7A 1EHWA 4JV5J 3UDEA 1HQ2A 5HMYA 2MQMA 4NRUA 2RS8A 1CUKA 3E0FA 5LSOA 3RW6A 1XNRF 4O3NA 3R97A 3H8YA 1QM9A 1WHXA 2RNEA 2C2DA 3M1VB 3PIOQ 3MM7B 4MYTA 3R1HA 1F9HA 3CD0A 5AIBA 3DNCA 4KAIA 3R2DJ 1XJWB 1ZQCA 3PNIA 5H9EJ 3TUZC 4LF5F 3VC8A 5AI0A 2H65B 3M2VA 1ZQSA 3E58A 3JAMU 2O3DA 3OQ2A 4I2PB 3VTIA 1BY9A 3E01A 4MFFA 2IRUA 2VPWB 3MABA 2JVRA 3MR6A 1DK3A 2DY1A 2NUUG 1CS4B 1LOUA 3QJLA 1NK7A 3WK9A 1TP7A 4V1Ak 4G65A 1SJQA 2L48A 3HF5A 2M0GB 2YX1A 4I6YA 1MG7A 4Q2MA 3DDNA 2KOBA 4P2SA 3DFEA 4ZJQA 4RW6B 4Y0FA 1T05A 1JLFB 2NXJA 3SV4A 3V7KA 2GH1A 1ZQFA 4WXOA 3HO1A 5D0HA 3HX0A 1NZ8A 3CPWR 4AL5A 2K4EA 2N82B 3HPOA 1GAOA 3C19A 3GE9A 2VJUA 4KV8B 5GADI 2MMYA 3ORYA 2KJVA 1PUZA 2HVZA 5AXMA 5JJBA 1ITPA 2DO0A 1SL2A 1RT3B 1WI8A 1R6VA 4G9BA 5J2DA 3G6ES 2W2PP 4M9JA 3JPOA 2UXCF 3BYRA 4DV0F 4RBUA 4LF8J 4JP8A 3V6DB 5IILA 2G5HB 2PT0A 2PA3A 1ZQXA 3LP2B 3QPIA 1K0VA 4JV0A 1JLQB 1I3OB 4KLFA 1JKHA 3GV7B 2QX0A 5J2PA 3PKMA 1RJJA 3HSZA 3DXBA 3SD7A 4ZPBA 3ULHA 3UW1A 3HKZD 4KGVB 1LWFB 3IGNA 4F0MA 1PYOB 1QTMA 3JTPA 3H4DA 4NXZA 2ZJRQ 1S5ZA 4I7FA 1LKZA 2M5YA 2ALZA 2XY5A 5EWGA 3SFUA 1ZD2P 4O44A 1FDNA 2EANA 2PI5A 4C9DA 5F8MA 1SC1B 4CTAA 2WVFA 2OHDA 3AH6A 2Q0ZX 4I69A 2AX0A 5CR0A 1ZA1B 5AXNA 5I4MA 2KHCA 4Y2KA 3BF4A 3WK8A 4LR9A 2IYIA 1TFYA 1VQ7S 3UO0A 2FLPA 1ZM4A 4H4KC 2W8KA 1URRA 3K5LA 2YQ3A 2N1RA 3SZ2A 4P7TA 4AQYF 4GC7A 2D9PA 2K4HA 5IZHA 3CJ2A 4LR7A 1XEZA 2EFGA 1EAYC 1JQGA 3H2UB 1RLCL 1N60A 3CUNA 1FVSA 1B64A 1NCLA 2W4PA 3PDNA 2DNLA 3RR8A 1JJ2R 2FC8A 2B21A 4NRTA 1DLOA 2ZIXB 2IVMA 2DISA 3RJHA 2GJ2A 3H0MB 3TARA 1HI1A 4DSKA 2GGPA 4PPXA 4LF7F 1MMDA 4Y2YA 2PMZC 2D41A 5A2QU 3R5DA 2BKPA 5ALRA 3P4UB 1P1LA 2JGAA 4J9VA 2XM3A 8ICUA 2G08A 3RJGA 2NRZA 2C2ZB 3HLUA 3BDPA 4KBIA 2ZTDA 2FPMA 2HAFA 2K8GA 3OHAA 2HK2A 4C4SA 2FMPA 2D3UA 2D3O1 3CNHA 4XTTA 1M5KC 1RTHA 2RIJA 2M3DA 2DF4B 4P4PA 2UXCJ 4ECTA 2VQFF 5FP0A 5IIIA 5AM4A 3LA0A 3QGIA 2UUAJ 5DDMA 5J0RA 1VGYA 4YXMA 2ZOMA 1RTIB 2C1EB 3RAQA 3IBCB 2W03A 4CO1A 3GFZA 3H20A 3O44A 2KH9A 5HP4A 5DG9A 1FKPA 2DH9A 1CLFA 2B8PA 5M2PA 2VV5A 3ZTQA 3IS9A 3CMAS 2JV3A 1S6QA 3QLHA 4MKYA 8ICXA 2VA3A 3SQIA 4J9QA 5E7OB 3MFIA 3K5PA 3OSNA 1KQSR 3DOLA 4CWBA 3NVYA 1VQKS 2K89A 4PJ0U 1F2GA 1J2VA 3FCHA 2YKAA 2XMUA 5J2KA 3VAGA 3ZD9A 5CCLA 4Y2XA 1N2XA 5CEHA 5JMNA 1Q81T 2DT9A 2FPKA 2BKEA 2PN6A 2J9DA 1FRXA 3N6MA 1W7WA 1VDVA 4B9VA 2XULA 2HFSA 2X3DA 1EARA 3BZQA 4CTAB 4NLYA 1WUUA 4WK3A 5IT9U 2AQ4A 3I56S 2BV3A 2KB2A 3BREA 2HLUA 4M95A 4GXIA 2QV6A 4NASA 4KLUA 4C7YA 4JOUA 1RT4A 5I3UA 2DD8S 2CQPA 4NL5A 4RW7B 3N79A 3K1ZA 1SV0A 4TY8B 2CNLB 2KJ9A 3SV3A 3PACA 2EKYA 4BXOB 4Z6EA 3HSDA 3UVJB 1NB2A 5FD1A 3TA1A 4ECUA 5DDYA 3JQJA 1RDRA 4HVZA 2IM2A 1KFSA 3IMQJ 1Y3JA 2D74B 2APOA 3L7OA 1IXKA 4TYBA 4C4TA 2R8JA 3U1LA 4I56A 1JLBA 1WTBA 2QFJA 2ASDA
chains in the Genus database with same CATH topology
2A1AA 2QN6B 1YZ7A 3AEVA 2A19A 2QMUB 1KL9A 1YZ6A 1Q8KA 3J81j 2AHOB 3QSYB 1Q46A 3CW2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A1A A;  2QN6 B;  1YZ7 A;  3AEV A;  2A19 A;  2QMU B;  1KL9 A;  1YZ6 A;  1Q8K A;  3J81 j;  2AHO B;  3QSY B;  1Q46 A;  3CW2 C; 
#chains in the Genus database with same CATH topology
 2HZC A;  3F2D A;  2DRA A;  1S1U B;  3V6H A;  1NDC A;  3D4J A;  3GZ7 A;  4OZ2 A;  2HRY A;  4BX9 C;  1S0M A;  2YNF B;  2R2R A;  2KZM A;  3T5K A;  3MM9 B;  5IIM A;  4DV6 F;  3A1Y G;  2V8G A;  2A6O A;  1AFJ A;  5AE3 A;  1WOR A;  3NP5 A;  5G5H A;  4PZO A;  2CNO B;  4EYH B;  3BPD A;  3PEH A;  4LBP A;  1KVI A;  4B9N A;  4CH0 S;  5ETL A;  4NM1 A;  2HMX A;  4FBT A;  4JI0 J;  1NJI T;  5C2C A;  4FZL A;  9ICB A;  4K4U A;  3FEX B;  2QYC A;  4RQ1 A;  4KSE B;  3IP0 A;  1U2C A;  2LQ5 A;  4DOB A;  3M6W A;  1WHW A;  4I7F B;  1FXL A;  4ILM A;  1OO0 B;  3J7A 1;  3C2K A;  1S79 A;  4KPY A;  5DB7 A;  2GA7 A;  2WF7 A;  1G1X A;  3KFW X;  4HI1 A;  1W2I A;  1KN6 A;  5G0R A;  4X2B A;  1VHF A;  3VZH A;  3D6J A;  2KVI A;  2ADC A;  3QT8 A;  2UUC J;  2IJN A;  2Z7J A;  4UAW A;  1Q8B A;  3RZA A;  3S01 A;  3RJI A;  4DR6 J;  3P3D A;  5GMD A;  1S8O A;  3GIM A;  3TA0 A;  2OGU A;  1X6J A;  2V2Z A;  1ZXI A;  4A47 A;  3IM8 A;  2YTU A;  1E6Y B;  4M5L A;  3W8G A;  1WG5 A;  5HL7 Q;  2JOQ A;  1HQU A;  1BWE A;  2PSZ A;  4NV0 A;  4NLV A;  4B6J A;  4QW9 A;  1KW4 A;  2RVJ A;  5K14 A;  2DGQ A;  3P8B B;  5BJR A;  1F1B B;  1ZBT A;  1VQ6 S;  5CYM B;  3BH7 B;  3MMC B;  2LEA A;  1ZA2 B;  1HWI A;  1ULR A;  4PGQ A;  1RU2 A;  4J9S A;  1CG2 A;  5CCM A;  4YMM A;  5LMU J;  3HVT B;  2E5J A;  4F3O A;  5L9X A;  4F0K A;  5AKL A;  2IM1 A;  4J9U E;  4FS1 A;  1IWA A;  2KFY A;  1VR6 A;  1FES A;  2JH7 A;  4CM0 A;  1SC3 B;  1V85 A;  1K44 A;  3L5K A;  4F67 A;  2FY1 A;  2ZJ5 A;  4QWA A;  3ZZY A;  3RH6 A;  2KVQ E;  1NO8 A;  4ZVE A;  3KLE B;  4EEY A;  1XK8 A;  2HBJ A;  1UA1 A;  1AUD A;  3QNW B;  4TKT A;  3FGV A;  3W2W A;  3QUC A;  1MWY A;  2MQP A;  1GMW D;  1O5J A;  2P9G A;  4DSF A;  2Q3P A;  1M0S A;  2BOP A;  1R0C B;  2OEH A;  2CUY A;  5HVF A;  3H8M A;  2HQC A;  3EZU A;  1CC7 A;  8ICW A;  3HVR A;  2HFO A;  1NM2 A;  4DX6 A;  4CQ1 A;  2E9T A;  2VH7 A;  3N97 B;  5D15 A;  1NAQ A;  4S0M A;  4ILR A;  1KN5 A;  1NHU A;  2E5G A;  1TUG B;  4CH7 A;  2KK0 A;  3OVB A;  5ALI A;  1ZQJ A;  3ZTR A;  1ZQO A;  2B0G A;  2XWX A;  2M70 A;  3WC0 A;  1RE1 B;  2MXY A;  2BQU A;  1HBN B;  2UV8 A;  1S6U A;  1RAJ A;  1OW5 A;  3M1V A;  2A6M A;  5ALG A;  3GFY A;  5HMZ A;  2E7V A;  2JEJ A;  1X7V A;  3GJQ B;  3C6U B;  5CAA A;  3CD6 S;  2EZZ A;  2PC6 A;  4CLP A;  9ICM A;  3M30 B;  2FVP A;  1UVM A;  3OT9 A;  3HFZ B;  3M8Q B;  2RF2 A;  1YBT A;  1S0V A;  2UV8 G;  1H98 A;  1HI8 A;  2PFF B;  2BEF A;  4ID5 B;  4WFZ A;  2J0Q D;  2F8H A;  2IC3 A;  5ITH A;  1S59 A;  2G0A A;  3ILJ A;  3EZ5 A;  4RW9 B;  3BSN A;  5KFV A;  1SKS A;  1KQK A;  2YKN B;  4CE6 A;  2ZOF A;  4GKK F;  2CDQ A;  4ZLN A;  3NNC A;  5D8H B;  3OJU A;  5IWA F;  5CA7 A;  1S6P B;  2XZD B;  4C98 A;  1HHQ A;  1NK6 A;  1CJU A;  1IWG A;  2YN4 A;  5ETT A;  1RG6 A;  1NJW A;  3C23 A;  2HHU A;  2RUG A;  2L41 A;  1U2F A;  1EP4 A;  3LP0 B;  4OX9 J;  2IA0 A;  4H54 A;  1YBU A;  3EGZ A;  5EE1 A;  3LW5 C;  2ZNZ A;  4ZP7 A;  3VQT A;  4PUO A;  2FC9 A;  1N5T A;  4USH A;  1K47 A;  2QTW A;  2H54 B;  2GS8 A;  4DHV A;  2ZBC A;  3G87 A;  1RTJ A;  4G1I A;  2VQE J;  5A0Y B;  4X65 J;  5KFP A;  1LWE A;  1SBR A;  1OY6 A;  5KG3 A;  1N54 B;  1B3T A;  3D2Q A;  3EX7 B;  4OMF G;  4O4R A;  1X4E A;  2QLB B;  1TEL A;  1SKU B;  1YGY A;  1RAB B;  3P45 B;  3ZO7 A;  3TAD A;  4I0W A;  3M9N B;  3HT0 A;  1NUE A;  4ZP6 A;  1Z00 B;  3H8S A;  1QLN A;  3TAM B;  2N7C A;  1RYR A;  4GKJ J;  3AL0 B;  5KT3 A;  3PW2 A;  4LFA F;  4DSJ A;  3TAM A;  4EEN A;  5K9F A;  5B0G A;  3HW8 A;  2VDH A;  4KLI A;  4YR0 A;  3CO0 P;  3EUB 2;  3AUO A;  5DGA A;  4PG7 A;  3I9V 9;  3FYH A;  9ICR A;  3KK2 B;  3NVW A;  2NCK L;  4EZ9 A;  7ICS A;  5BR8 J;  3TRG A;  1R8H A;  1U8W A;  1RDF A;  4FYV B;  3QU4 A;  1RWW B;  5F8J A;  3ETL A;  2DHH A;  2KHD A;  2JC1 A;  4NL9 A;  4UZC A;  3JPR A;  2ZBP A;  2HFZ A;  3KMS A;  4Z7C A;  4LJX A;  3OTQ A;  1UT5 A;  4F2R A;  1P9Q C;  3G96 A;  1N52 B;  4QYZ K;  2DXD A;  2YB4 A;  2Y0B B;  3PJ9 A;  5ALK A;  3VAM A;  1FD8 A;  3OTE A;  1UWB B;  1WDD A;  2QL7 B;  1M1H A;  3N4W A;  3LP0 A;  4OYA A;  1TL1 B;  2IMW P;  1SXD A;  2W04 A;  3QT7 A;  3PEJ A;  3FC9 A;  3TAQ A;  1KOO A;  2Y8W A;  4M5N A;  4IDK B;  4Q5V A;  2FDR A;  3BKT A;  2OWO A;  2NR0 A;  5KOW A;  1N32 J;  1UKU A;  4WFB Q;  3SAF A;  5H2F U;  4PHP A;  1CS4 A;  2ZDP A;  1RPL A;  1V5V A;  3W8P A;  2O67 A;  5LJ3 Y;  5E3C A;  3IG1 B;  1Z4N A;  1KVJ A;  2WVE A;  2P5V A;  4F91 B;  2MHE A;  3OTO J;  2Y1L B;  1V38 A;  1NI3 A;  2C28 A;  4UBC A;  1QY7 A;  2DKO B;  1KHW A;  4DV3 J;  1ZQK A;  1TVA A;  4A8Y A;  3PO5 A;  4FP9 A;  2E5L F;  5IT0 A;  3G86 A;  4JI2 F;  4NJ8 A;  1UPM B;  3J7A N;  3PO4 A;  4CO2 A;  3AY0 A;  5BYR A;  5CZV A;  2XVT A;  4J9K A;  1V3S A;  1L7P A;  3QIP A;  3D0I E;  3UCG A;  2BHN A;  4Q45 A;  1RWV B;  3EVO A;  4YD2 A;  4ED5 A;  1F0M A;  3DLK A;  4RU9 A;  2HHQ A;  3HVW A;  4ACO A;  4AP9 A;  4RPF A;  1ZQG A;  5D78 A;  4DXL A;  1WJ9 A;  2HQ3 A;  4F5N A;  4MFB A;  2ZJA A;  4DDF A;  1HMV B;  3NOG A;  4HTJ A;  7ICF A;  4FFD A;  4JI4 F;  2EFQ A;  4RQ7 A;  1BXN A;  1WC1 A;  2WTF A;  4NLS A;  2EK6 A;  2H3V A;  2YNG B;  2BJ7 A;  4FDF A;  2D7S A;  3HZE A;  2AJF E;  4WU2 A;  5CYM A;  1V6H A;  4Y2R A;  1U7L A;  4QWB A;  1AB8 A;  1TUW A;  2DGO A;  1KHV A;  2QGF B;  2XSJ B;  3BBF A;  2LLZ A;  1ZH5 A;  5KFI A;  4DS4 A;  3HK2 A;  3BZC A;  1H73 A;  5BYQ A;  3W5Z A;  3MGJ A;  4CO4 A;  4L75 A;  4NI2 B;  3DRP A;  2RKI A;  1TL7 A;  5ALW A;  1H2T Z;  2ZH8 A;  3BR8 A;  2ROP A;  3BGU A;  1UP1 A;  3R7S B;  1NEE A;  5K20 B;  1L5U A;  4DF4 A;  4LRF A;  4EZ6 A;  3M7V A;  3MED B;  2OTL S;  1N5Y A;  1EKR A;  2R7S A;  1B0P A;  4LZG A;  1TVR B;  4OHZ A;  3N4M B;  4B3T J;  4RQ5 A;  4FXD A;  1QQ7 A;  4ECY A;  2CVI A;  3GG0 A;  2ZXI A;  2G09 A;  5KG4 A;  2GNK A;  1DOQ A;  3CO9 A;  2PII A;  3NY0 A;  3MGI A;  3MMC A;  1UWB A;  5J2E A;  2WOM B;  4P4M A;  2Q6B A;  1TV6 A;  2ERR A;  1IKY B;  1J5E J;  5LL6 d;  4LSN B;  2Z2Z A;  3TQ1 A;  2UVU A;  1L7M A;  1MA7 A;  2IAJ B;  4ZPW R;  5HAN A;  4IFY B;  3FSI A;  3A3O B;  1T9X A;  2HHH F;  1UCV A;  1CQM A;  2VFT A;  2YKQ A;  9RUB A;  1HAR A;  3M2U B;  2DFL A;  4Y28 C;  1OYD A;  3UD3 P;  1WF0 A;  3RFA A;  4UAR A;  2FJA B;  3MR2 A;  3UE2 A;  3V6J A;  2CAD A;  2QL5 B;  5HBM B;  3TJ8 A;  4XIU A;  2LMR A;  1XR6 A;  4Y2U A;  3PHE A;  4M9H A;  1IKW A;  2Q66 A;  2DBB A;  2E5L J;  3CW2 C;  1HNW F;  3SCL E;  3ZZO A;  1X6I A;  1DJ0 A;  3JB9 k;  1WTF A;  1G2E A;  3IO1 A;  4UOF A;  1X8D A;  4QZ9 A;  3DGP B;  2ILY A;  1UZH A;  1VRT A;  2I9G A;  4P6Q A;  1U0H A;  5B0D A;  3L3F X;  2XO7 A;  4P0Q B;  3ZDB A;  1U48 A;  2LU2 A;  4MEX A;  1JLC A;  2RQM A;  3W9J A;  2XNR A;  1QSL A;  5AI6 A;  3Q83 A;  3KK3 A;  2MGZ B;  4ZK7 M;  2LKZ A;  1H74 A;  2R8K A;  3T1Y F;  3M9O B;  2DIV A;  4BJQ A;  2NO4 A;  5F8L A;  3ILI A;  2CYY A;  4NLW A;  2QKQ A;  3VAH A;  2AXT U;  1SIZ A;  4N56 A;  5KG7 A;  4DPW A;  4RUC A;  4GVB B;  2R7T A;  1T3N A;  1K5O A;  3SSR A;  4ED4 A;  4JI5 F;  1X0F A;  4DR4 F;  4O3O A;  2KT3 A;  2CRX A;  3AMZ A;  1K8A T;  4YN4 A;  3DN9 A;  1D3W A;  1ZRN A;  2FJE B;  4QZH A;  1PG5 B;  4RO0 A;  1YJN S;  2DIU A;  1TZ0 A;  1IUJ A;  4FBU A;  4ED6 A;  1TKZ B;  1U1K A;  1VI7 A;  4WII A;  4DX7 A;  3C14 B;  3Q8Y A;  4PXB A;  5EWF A;  2BQR A;  2EW9 A;  1J2N A;  1PK1 A;  1BQN A;  4BWM A;  3T1H F;  3WC2 A;  1WEZ A;  2W2N P;  2D9O A;  1SUQ A;  1FX4 A;  1ZD5 A;  2A19 A;  2KP7 A;  3QJP A;  4YQW A;  4WKR A;  3I5A A;  1ZQB A;  3AU6 A;  1SXL A;  2BCR A;  4WIQ A;  1BPB A;  1C0U A;  2Z2M A;  2ROE A;  5J0Y A;  4ZCM A;  5HNK A;  3EWG A;  2QLW A;  2FHO B;  5E33 A;  4WFA Q;  3NGD A;  2P9E A;  3KKA A;  3J7Y I;  5HP1 A;  2DB1 A;  5LMU F;  2EKN A;  1C1C A;  2JH3 A;  4WP8 A;  4ECW A;  1N0U A;  4KLJ A;  3NMR A;  3EM1 A;  3IBW A;  1UEU A;  5G4D A;  4PZV A;  2QIF A;  5C24 B;  3BGR A;  4LIW A;  3JYT B;  3ISB A;  3NVV A;  1SI9 A;  2CQ4 A;  2BUN A;  2QZ8 A;  1T02 A;  2AZ3 A;  4PWU A;  2H4W B;  3WKB A;  3M6X A;  1NJZ A;  4JV2 A;  3B54 A;  1FKO A;  2JL9 A;  2XI2 A;  4EO8 A;  1HBM A;  5JTI A;  3TZZ A;  2XYH B;  2P6U A;  1KDN A;  3FBC A;  7ICT A;  2KJ8 A;  3C16 A;  1LWE B;  2XWY A;  2YX7 A;  2AV5 A;  2ZIX A;  4X5V A;  4MJK A;  2F8M A;  2J76 E;  2CJK A;  2I5H A;  2G1D A;  4GC6 A;  4ECZ A;  4WYL A;  2E8N A;  1VRU A;  3EDQ B;  2KSO B;  1D8B A;  3ZDC A;  3S7R A;  5AKZ A;  3UDV A;  4F92 B;  1N5Y B;  3I9Z A;  4U67 Q;  1PJ7 A;  4AL6 A;  1OS5 A;  4DR2 F;  1K1Q A;  1S12 A;  1VHI A;  3NGT A;  3N28 A;  3N9U C;  4CYU A;  2Z2L A;  3MM6 A;  2GFF A;  3NS5 A;  4OJG A;  2FHJ A;  3FQK A;  2MKC A;  3OL6 A;  2EBG A;  3D2N A;  2LP4 A;  1ZPV A;  4CH1 A;  3BS5 B;  1L8O A;  1DBD A;  3QYP A;  3KJV B;  1KON A;  3S1T A;  1IJF B;  5GAE U;  4LF9 J;  4KGZ B;  3T19 A;  1XN9 A;  2RQC A;  3CC7 S;  3I0R A;  3AD7 C;  2EC0 A;  4A8S A;  3X1L B;  7ICJ A;  3X3U A;  1AT1 B;  1ARO P;  4LBH A;  2ZWO A;  4HL9 A;  1X60 A;  2YMP A;  5DM7 Q;  4NLP A;  5IQ6 A;  1PAU B;  1U49 A;  3SYZ A;  1UVI A;  4P71 A;  2AW0 A;  4NX9 A;  5HMW A;  2M7S A;  1I51 B;  1U1P A;  2KJ5 A;  4I2I A;  1VBK A;  2UXD J;  2OM6 A;  2VFR A;  4OYZ A;  4USJ C;  4OX6 A;  1VQ9 S;  3J81 Y;  1FFV A;  3PFO A;  3K59 A;  4RWX A;  1YG0 A;  2B9Y A;  4X66 J;  2L3M A;  5J2Q A;  3MM5 A;  3ONN A;  2B56 A;  5ALQ A;  4USA A;  2I5J B;  5KG2 A;  5ETQ A;  1JLA B;  3AOD A;  4YFK A;  5GAD U;  5HQL A;  2HNZ A;  4LF5 J;  4DCJ B;  1Q0N A;  2LYV A;  2POK A;  3I0S B;  3IRW P;  5C42 A;  1HUZ A;  2RML A;  2VPY B;  1NJY A;  4ANE A;  3AQO A;  5KL1 B;  4KE5 A;  1ZTT A;  2CJ9 A;  4DCC A;