1YZ7A

Crystal structure of a c-terminal segment of the alpha subunit of aif2 from pyrococcus abyssi
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
176
structure length
176
Chain Sequence
KAKLQEFKRAQKAENLLKLAAEKLGKDFETAWREVWVPLEEEWGEVYAAFEDAAKDGIDVLKGHVPDEWLPVLKEIIDNYVEVPTVTIDAEFEITVPKPNGVEIIKEALIRARDRANKEKDVEVKFTYLGAPRYRIDITAPDYYKAEEVLESIAEEILRVIKEAGGEATLLRKEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable translation initiation factor 2 alpha subunit
publication title Structure-Function Relationships of the Intact aIF2alpha Subunit from the Archaeon Pyrococcus abyssi
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
total genus 59
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 1yz7A01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 1yz7A02
1YZ7A 3CW2C 1KL9A 2QN6B 1Q8KA 1Q46A 2QMUB 1YZ6A 2AHOB 3QSYB 3J81j 3AEVA 2A19A 2A1AA
chains in the Genus database with same CATH superfamily
2LKYA 2FHJA 1O5JA 3MURP 1UT8A 1WEXA 2HGLA 4U67Q 1R3NA 1LFPA 1S12A 4KO0B 4ZPWR 2F1FA 4YMMA 2YMPA 6AT1B 3QT5A 4YD2A 1DK2A 3V6DB 1FDNA 4V19X 5KFVA 2OHDA 3PSTA 2HYIB 3A12A 2NRWA 3Q89A 5ETQA 1YTYA 4PCQA 5CH7B 2HWTA 3HHEA 4LF2A 1S0NA 2QLTA 3N97B 1BQXA 1WOOA 1FO1A 2CJAA 4DR7J 4PPDA 2L3MA 3DHXA 5DDPC 2UUCJ 3IBWA 4ZN3A 3H20A 2K4IA 3GIKA 1VRQC 4B3TF 3OR1B 4IKAA 4ES1A 4WU2A 5HP1A 1RGVA 2FVPA 2YY6A 1JLEA 4W92B 1JMSA 4IRKA 5T7LA 2UUBJ 2F8HA 2E29A 2CQ3A 3CW2C 1VCTA 4QWBA 1VJWA 1X7VA 1S0MA 2FUG9 3OTBA 3WBZA 4NLUA 4R8UA 1L3SA 2HHTA 1Z2ZA 2DPJA 4C4TA 4DV5J 5IM0A 5E5NA 4B3OB 3UN3A 2KIWA 2GGPA 1U48A 3SMZA 3DFEA 2QSFA 1NJXA 1SH3A 2DB1A 1Y88A 2WFAA 3I1YA 1V97A 3MFIA 2DBYA 4PWWA 5C25B 2VOPA 2JFKA 2DITA 1FJGJ 1QDUB 1HIWA 2OSRA 4PZNA 2OP5A 1XBWA 1KKXA 5AIAA 2ZH3A 5D0EA 1RAJA 3AJDA 5AM5A 4F71A 4QZAA 5F41A 1VC5A 3PSPA 2V6AA 9ICTA 4CQ1A 1YJ7A 1JIHA 1ZQFA 1CBKA 2PFDA 2I5JA 3PTWA 5I3PA 3MAQA 3J7YI 3S6EA 2FGOA 3MCSA 4JP8A 4YEAA 4QZEA 2J76E 1KQQA 3CJ2A 2XCAA 4ZP7A 2PI5A 4DCJB 2OEHA 1YITS 5B0EA 2B8PA 1X5SA 3H4BA 3QNWB 7ICLA 4JI8F 3KFUF 5LT5A 4OYBA 5B0AA 4JUZA 4MFBA 3O1LA 1TVAA 2E44A 2KDOA 1RBAA 5EWGA 1HW9A 4C80A 1KW4A 4C4SA 4XPCA 1UMJA 4C7YA 3FCHA 1UVNA 1VDHA 2HQ3A 1K1SA 3QXGA 4RW9B 2DR6A 5EGYA 4DQSA 5SUHA 2KVSA 5CA5A 4KLMA 1YDLA 4CT9A 3G8TA 4F92B 3SEIA 2DGUA 3IHQB 4AT1B 1WKLA 1X5OA 2FC9A 3GSIA 4PHEA 4LF7F 5ETOA 2GO8A 2YWHA 5IWAF 8ICBA 4A48A 2MRLA 1LXJA 1JJHA 4CLWA 4G9BA 1KVJA 3MPUB 1LW0A 1ZQZA 3CD6S 1S79A 3JSYA 3M2VA 4EEKA 3BPSP 2FDNA 3QZ7A 4S0MA 2XWYA 3BH7B 5J2MA 2W2QP 3ZI4A 1X6JA 1QY7A 2J0WA 2GQ2A 5LXYA 3KK2A 2EZXA 1ZQKA 3E01B 3VWSA 4QIGA 1LKYA 1AUDA 4WP3A 3BQ7A 2YKAA 2VH7A 4NPOA 5HVGA 2P6RA 1T3QA 3M8PA 3W9JA 3BQ2A 4Z7CA 1MA7A 5BYRA 4I68A 2ZBRA 5KT5A 4PL1A 5AI4A 4RW8A 1RTDA 2W3RA 2ZIUB 2O66A 2OPPA 3BGFA 1S72S 4M5KA 4MK9A 1U0HB 2VG5A 3OQ2A 2G07A 2HNZB 1TKDA 1NEEA 1LWXA 2DNHA 2W3SA 1N61A 4Y2QA 4DL2A 5AE1A 2HK2A 3N5FA 1VQPS 2Y0BB 3BZQA 4MIBA 3Q8RB 5GMKa 2WOMB 4PXDA 3MECA 4U8YA 5AHXA 1PVPA 2BJ8A 2P2CB 1VQ4S 2M2BA 2E9RX 5A8KB 1KKHA 2BRLA 3EUNA 2C2EA 1TL7B 4DX6A 4NRUA 4C8OA 3R3TA 3JPTA 5DGAA 2NXUA 5LM7E 3F56A 1JLCB 2DPIA 3DYAA 4I2GA 4FVMA 3ETOA 2R8HA 4X64F 4K4IA 2YPYA 4GKKJ 3S1TA 1T7PA 5KFIA 4RW7B 3RUBL 1PC4A 1DTTA 2LKZA 4JYAJ 2ZOMA 1AQ6A 3ISZA 3THTA 4ZHRB 2AJQA 1TVRA 1TKXB 3NGKA 3RJJA 3HVRA 3GIIA 3BQTA 2V94A 4X2BA 1HPZA 5HN0A 3UDVA 4I2QB 1KTVA 2IIHA 5DG9A 2FE9A 3BPDA 4YOEA 2XI3A 3RB3A 1XSLA 1T9YA 2R8JA 2D3ZA 1NPPA 2NREA 5AM3A 3PHEA 1HUZA 4BS2A 3GR0A 5L1KA 4IRDA 5KG4A 4FXWA 1VQ5S 1UPHA 1NZBA 2BJDA 1AXQA 2QB0A 4YR2A 5HANA 1RK8A 2DY1A 5HJXA 1S1TB 3LP0B 4ACOA 4J9OA 3AQPA 2GHPA 3DU6A 4R65A 1XR7A 1ZQWA 4NYPA 4B3RF 1SH0A 4GVBB 3QJLA 1U1NA 3IWXA 1NM2A 1WF1A 4US9A 1S59A 4O0IA 2RSQA 2UZAA 3LO3A 4YXJA 2MQ8A 4O23A 2HVIA 3MM9A 2V2ZA 2V9KA 3ILOA 2NO4A 1XNSA 4Y2UA 2F4VF 5K8NA 3L7PA 5HATA 3D6JA 2E7VA 1YK9A 4RKUC 5L1MA 1NK6A 5KOWA 3LF0A 4ANEA 3JAMY 2H65B 4O3PA 2V34A 2J9EA 5LJ5Y 4ED2A 2W9BB 2RQ5A 2P8IA 1RPLA 3KG1A 5HMMA 3FBEA 4JI1J 3SCIE 3TARA 1S49A 4F7VA 2HBQB 3TA2A 3ZZZA 1Q86T 2N7CA 1DGJA 3FSXA 1RISA 4O3NA 4WFBQ 2E5LF 1Q8KA 1BC6A 1S1XA 4RLEA 1WCLA 3PYGA 5FDLB 2YKNA 1GFWB 1BWEA 3CO0P 1S9EB 4YG2A 2RD5C 2V50A 2XZDB 4R63A 3NP5A 3TJ8A 2IOFK 2Y1RI 5KAFU 2RLTA 5ALGA 2XY7A 2WAQC 2HG4A 4KN4A 4I2EA 1U24A 3W2WB 1D8BA 1Q82T 4WYLA 2E9ZA 3Q86A 3B0YA 1XMQF 3IC1A 1JLGB 2K89A 2E1EA 2V5HG 5AI5A 3HF5A 1ZZFA 1WC6A 3GFYA 4PWUA 1CC8A 1TK0A 2YX4A 4DV1F 2B3TB 9ICRA 2R2SA 3KMQA 3KZIU 1O0PA 1N5QA 4P2XA 1Y5NB 2VPYB 4M9LA 1FFVA 2RF2B 2RIJA 2NYVA 4QIWD 5CYMA 1HWKA 3S8SA 8ICFA 4ILRA 3NRZA 2YNFB 4YMNA 1N36F 5B0FA 3ILIA 4DV4F 3AL0B 2YMQA 4QZBA 1KEJA 3N79A 3ULHA 7ICHA 1NBEB 1YI2S 3HFVA 3UCUP 2N3LA 2HS0A 3FDSA 4FZLA 3QGPA 4DPTA 4LREA 1WELA 1FRIA 4P7TA 3BBFA 4OI6A 1X4FA 3AUOA 3JPSA 4Y2CA 2V9WA 1RTJB 4E8UA 1HQUB 2RAQA 2FZKB 5I42A 2CPZA 3VC8A 3JYTB 2AJFE 1CSJA 5GADU 1HBMB 2YQ1A 5KL1B 4O9MA 1V9PA 1PCAA 2V4JA 5DGBA 3NAHA 4NLKA 4RW4A 3CNQP 5AKEA 4RNMA 1R8BA 2QA4G 5KNIA 1VRTA 4IG3A 4UOFA 1KNZA 2MJUA 4MEYA 5CWRA 2Q43A 5IQ6A 8ICUA 1BMQB 5IT4A 1QQ5A 2V8GA 4PXEA 3M8QB 3MEGB 4NE9C 2ACYA 1LWEB 1RABB 3C14B 2WRMA 4CLKA 1BLUA 4FKXA 4ZMMA 4LR8A 2W25A 3AOBA 3PJWA 3P96A 3CCLS 1B0XA 2RE1A 3IBCB 4BC7A 3BKUA 2JDJA 4DO9A 1KOOA 3QO9B 2K4PA 2JNJA 1ZM4A 4ZS6A 3O6QA 3OBIA 5D4LA 1RHMB 1CS4B 3SZ2A 5H9EK 3QZ8A 4UT4A 4LR7A 9ICHA 2W7AA 1U0SA 3FBBA 3ELHA 3IAS9 3LGMA 2RRBA 3RH4A 2PGCA 1HNZJ 2KHDA 4F5QA 2KG5A 1RWKB 2Q6CA 3C66A 3W5ZA 1M1KT 2EANA 1HWIA 4KPYA 1D8ZA 1VLYA 3UVJA 2VA8A 1IR2A 3OFFA 2EQYA 4EZ9A 1N8RT 3W5XA 5J1NA 4H4KC 3OHBA 1BPBA 2KG1A 3PRVA 5I3UB 2J0QD 2BCQA 4IDKA 1N5YB 1GX5A 3HILA 7ICNA 4UAUA 1UWAA 1LEOA 1KQKA 1TL4A 1KDNA 2P9EA 3GCWP 3ONQA 4NLPA 2ZUBA 3KKFA 1S7HA 3NVVA 4P2HA 3EE3A 2XS2A 5DDRC 2CNOB 2CYYA 3SI8A 1E6YA 5BOMA 3V81B 2C2NA 2WAQF 2UVVA 2M9KA 1D9FA 3DHWC 4TURA 3WK8A 1F2GA 5C42B 1SJFA 3HJFA 4IUFA 3VVUA 2UV8G 1PK1B 3R7NB 3QUQA 2BJ9A 5E2QA 2YNHA 5CP2A 3B6BA 1FD8A 3E58A 1U9LA 4Y65A 1XMOF 3PHTA 1H38A 2VG6A 2I1RA 2HNYB 5HMLA 4TU7A 3SENA 5RUBA 3GLJA 2R7WA 3IS9A 7ICIA 1WI8A 3L9ZA 3GZ7A 4Y2XA 5CZVA 3Q8QB 1HW8A 4KGKA 3M8RA 1H2UX 2RP5A 1YZ6A 1EKRA 4W98A 2MUTB 4HTJA 1ZH5A 2WVCA 2EI5A 5ALSA 1A76A 5ALNA 4PAAA 3UXNA 1JNRB 3WX8A 5MLCV 3HWTA 5HK4A 4GLXA 3LAMA 5CRXA 2K7JA 3MAAA 3SFUA 4LFAF 2FY8A 2VBXA 5IINA 3BGRB 1RXOB 1EQMA 1S9GB 1YGYA 4F04B 3BS7A 3P5BP 3BYRA 4CI0B 5ALUA 3RJEA 3ENAA 3TVKA 2R8KA 1DFDA 5DETA 1O6XA 2NXJA 4J5OA 3OUYB 5KG7A 1SBRA 5T41A 5H9EJ 4Y0FA 2YNIA 3A3OB 3EDRB 1T03A 3I0SB 4UW9A 3H8YA 1WF2A 3H8SA 4Y6IA 2ZH1A 2ATCB 4PWDB 3ONNA 1AZSB 2DRBA 3NVWA 5KL8B 4UQTA 1CC7A 2DO4A 3WK5A 3CCZA 2XY5A 3VCBA 1RT1A 3PR4A 3ZTOA 1KVIA 2AZ1A 2BV3A 3PYDA 3WK4A 3BQ0A 1PJ7A 1UETA 2KTQA 3FC9A 1XWLA 1OPIA 1FHTA 5E33A 2QL9B 3J80U 2MQOA 1JLAA 3I5BA 2YWKA 1YBAA 1LB2B 2CQ2A 1B3TA 1IJFB 3R5AA 1VLBA 4ZVEA 1L3UA 5KAKA 1WOSA 1RQ0A 8ICIA 3AT1B 2M8DB 3UM9A 1M0SA 4AP9A 3V5RA 4DOBA 1FK9A 2C3MA 1DQAA 4LIWA 2LA6A 4H4OB 4NXZA 3NXZA 4QOTA 2K06A 2PO4A 3GFZA 4GC7A 2LLZA 1A9NB 2F3JA 3K17A 3HHDA 2CKWA 3PVXA 1S5ZA 3NNAA 2YXLA 2F1IA 4WE1B 2HSEB 2AKWB 2CADA 4P73A 4I2HA 2BCVA 4EYHB 1YSJA 2R2RA 2D3OR 1CULB 5J0XA 3HT0A 3RF9A 4PG5A 4K2JA 5A8WA 1PBUA 3DOMB 3D67A 1X42A 2ZJRQ 3D1HA 3RYLA 1GT8A 4N77A 3CC4S 2VFVA 4J9MA 3HFZB 3CE8A 2QN6B 3MF5A 9ICNA 4KLUA 2MZRA 4RT3A 1WC1A 4RW6B 2B0CA 4ZLLA 1S77D 2IVFB 2DQNB 1XR5A 4M5JA 1HLWA 3EGVA 3QYYA 4ZVQB 5AKYA 1RTZA 1SQGA 1JKHA 3CRXA 1T4GA 4AQYJ 3MM7B 5DQGA 9ICVA 1R43A 2EFVA 3O44A 3TW0A 4X4PA 1FTRA 4B3MF 1YX2A 2HRYA 4QCLA 1CG2A 4LSZB 3SCLE 2PN6A 3QEAZ 4ZPVR 5A2QU 3OPXA 3CCRS 4DV6F 4LUBA 2IHNA 1RWPB 1SH2A 4OI4A 1FRHA 4R25A 1GMVA 5IFMA 1QD1A 2KN4A 1Y00A 3KJVA 2H48B 4P6QA 4H4MB 3EGNA 4WK3A 4OL8A 5M2RA 3JSMB 1ZQEA 3SV4A 2M5YA 4IR9A 1WC3A 3QT7A 3RR8A 3QLHA 9ICAA 4F4YA 4CLFA 2KICA 1CVJA 3RJGA 4LRBA 4ZN1A 4IH7A 2PFPA 1VI7A 2MGZB 4DSEA 5D4NA 4X4NA 4TUSA 4QJVA 2P9GA 4ZPAA 1S97A 4IQMA 3TADA 2BYCA 4RWWA 3QPIA 1BQNB 1TAUA 2GVDA 1D8LA 3L5KA 2N82B 3CMQA 4L72B 4RUAA 3BSCA 3OTDA 1JB0C 2UP1A 3VGTA 2R2TA 3HKWA 7FD1A 3ICXA 2VJUA 3KK3B 2HHXA 4DL0C 3IWNC 2R7OA 3D1QA 2M0NA 4EO6A 4DPUA 4CO5A 3D0IE 5HNKA 2XQCA 2EFGA 2XSJA 3M30A 4ECUA 2YNGA 4F67A 3H5UA 3PEHA 8ICMA 3LUYA 2FVSA 2C2MB 5AIBA 2BACA 5CCMA 1A77A 2Y1JA 4XIUA 4QR1A 2DL0A 1ZQMA 5DG8A 4OYZA 3PV8A 1RAGB 4QR0A 1IQZA 3B8HA 1IUJA 1I94F 1KTQA 2ODGA 3TAMB 3M2UB 5B0BA 1NK7A 2AQ4A 4ZJLA 4FS2A 3BO3A 4CNZA 1ITPA 4L75A 4G1QA 3EVOA 1NDCA 3DRPA 2O6KA 1FD2A 2UUBF 2HBJA 4PXBA 1UVIA 8ICGA 3TANA 5DKWA 1QH9A 5L1LA 3EZUA 2MZ1A 3ITHB 2EZZA 3JPOA 3J7Z5 2MKJA 2WF7A 3D54A 2ZUGA 4DV2F 3H5SA 1RXVA 3T5LA 4YCXA 2DNYA 5EWFA 2CPJA 2AYBA 2DHAA 3QNMA 2XI9A 1VISA 1Z4OA 1HIYA 4P7VA 1FJGF 2A1JA 1KVKA 4C9DA 1SIZA 4RR5A 1UA1A 2DGVA 1DTQB 5AKIA 4RL1A 2AGOA 1VRUB 4A8KA 3RRGA 3UR0A 1HNXJ 9ICIA 3U1MA 4UASA 4CH7A 4DUZF 1R0CB 8ATCB 1L8OA 3KKAA 1GTHA 4OCZA 2HGNA 3D3BJ 2OEMA 3LW5C 2HOFA 3GJQB 3N7SC 2BA9A 3C3LA 2G13A 3BR8A 1EQ0A 3V6HA 3OTQA 2CJKA 3Q24A 2AEFA 1N63A 3J7AN 3L09A 1J97A 5EHHA 3CEDA 2BE7D 3T1AA 3T1YJ 1ZQUA 1B0TA 3OXGA 2A0FB 2CXYA 3TA0A 3MMCA 2HS3A 1FO4A 4PGQA 2XO7A 4RBTA 4U6PA 2F76X 3H25A 1SL0A 3G2XA 3SCJE 4WPAA 3N4WA 2F63A 3KDOA 5JRTA 2ERRA 3D0GE 3AQOA 4UF4A 2E9TA 1HJPA 4MK7A 5L1IA 3OHAA 1EB0A 3H42A 1JLQB 3R97A 1DLOA 4MKBA 2NRZA 1UKUA 4PUOA 2VFUA 3LDAA 4NMXA 4YR0A 2MKYA 2JC1A 4YR3A 2BXJA 3RJHA 2P66A 5HVFA 2BOPA 1S4EA 4N41A 2CG4A 1FFWB 4DG1B 3GQCA 3EDQB 3M9NB 5EE0A 2PEHA 5HROA 5CCLA 2HFZA 1G2EA 3RW6A 4USJC 2ZUAA 3FQLA 4TQSA 2DNKA 5J0SA 4FN5A 3CCSS 4P52A 1FXRA 1HD1A 1FE4A 1WG4A 2IM3A 2MAXA 4EBDA 1UHUA 4F4AA 3MFHA 1ZQHA 2R7RA 4BX9C 4DR3J 3D6MB 4P4PA 3MGHA 1FKPB 4UUWA 4KKOA 4LSNA 1NK9A 1RACB 4C8KA 3G82A 2ZDPA 1C1CA 2XMKA 7ICMA 3PW0A 4KB7A 4NLXA 2P5VA 4M9NA 4ED7A 3AD8C 4RPZA 1R8AA 4DR6J 4QU7A 3VAMA 3BSAA 1ZQTA 2ZJAA 4FF4A 1SZPA 2NXCA 3KNGA 1ZQXA 1RUSA 2WVDA 2VB6A 5J2HA 2XS5A 1H7XA 1NMEB 3LP1B 4Z6EA 1GMWA 1UW9A 4XA5A 4C3MA 2J9CA 1PKUA 2AGPA 4A8FA 4KC5A 2ALYB 3NBPB 1X66A 4CO4A 2DNLA 2GAHC 4O5CA 2LQBA 1DBDA 4LF8J 2W2NP 1F5AA 5I3QA 1F5CA 3CCMS 3KWMA 2EFNA 2VQEJ 5HR7A 4EX7A 4DFKA 2W4PA 8ICSA 5J0OA 2PMHA 1N88A 3J80Y 1A0OB 1L5UA 1B22A 4OJOA 4DL5A 3LVVA 3MEEA 4YHHJ 3KFWX 8ICKA 4JYAF 4KMUA 4ID5B 3R5DA 1DRGA 1X31C 4USMA 1LV5A 3SSQA 3JSRA 2KV2A 4FNHA 2FJ6A 4WCEQ 3GU3A 2ISPA 3EMTA 1QUPA 4MKAA 2OPQB 2KT2A 2KP7A 2BE2B 2W9BA 1MU2A 4X4TA 1HMVA 4O4GA 3CP8A 4PXCA 4F72A 2KG0A 4M95A 2JEJA 2HDOA 3QAEA 4DR1F 2IYGA 3VQTA 3R5BA 4OHXA 4EU0A 3PSIA 2AXTU 2H3EB 5FDLA 5GAEU 4F36A 1RT5B 4KLFA 3AD9C 4M5DA 5KFZA 1RWXB 2Y0SC 9ICJA 4Z7YA 2OGUA 4UAWA 3ZD8A 4HKQA 2HPUA 1HWLA 4EEYA 2WONA 3VAIA 5AI0A 3LK9A 2ZTDA 2OFGX 4PKDB 4PG7A 6FDRA 7ICUA 3W7BA 4N8NA 2HNDB 2PE8A 3R27A 1RT7B 2FHKA 1T05B 2GLEA 2DNPA 2H4YB 2IM2A 1F60B 2GH1A 5DDMA 4V19J 3AJ2A 2FLLA 3Q2SC 3I56S 3OSPA 4F02A 2HOQA 2DNRA 2HWHA 1O8BA 5J2EA 3G8SA 2W4DA 2F77X 2BABA 1RYUA 2RF2A 2HMXA 4HT7A 4KIAA 1UWBB 4USVA 3R5GA 3KBBA 5KT2A 3LALA 3UDLA 1N32J 2WTFA 4HHHA 2BM0A 2Z0GA 2BANA 4BXOB 2YNFA 1HBUA 3NS7B 1Z2LA 4ED3A 1LOUA 4YP3A 1BVSA 4JI1F 5DZ6A 2HFNA 3G9CA 4FS1A 1SJ1A 1ZRNA 4C0BA 3G86A 5KG1A 5F3XB 4USWA 3KLFA 4NCGB 3CDEA 3ZNJ1 3C28A 4K0KJ 2BKEA 9RUBA 2ILYA 2CQBA 1IVZA 3U02A 2D3DA 2AHOB 1QE1A 4E2FB 3EZOA 4ZVGA 4CH0S 1F44A 2KRBA 2FZCB 1FKAF 3DLBA 4JI7J 4LF5F 4WP8A 2OH2A 2NPIA 2XZWA 2A3JA 1NUEA 1L6NA 4IFVB 2W24A 3FQKA 3M6XA 1HBNB 3M9OB 3C14A 3U7JA 1U2RA 1RAHB 2LEBA 3RZAA 4ETZA 2DWQA 3R7BB 4EMDA 2UVWA 3H5YA 2BDPA 4DI6A 1CJVB 4Y2SA 2FB0A 2OO4A 3NAIA 1RKJA 3H4DA 3E8OA 3W3SA 4Y2PA 3J81U 1G3OA 1GQEA 2Z58B 2ZG6A 4M2YA 4MTPA 1WHVA 2H5IB 5A0YB 5HQLA 2HBLA 1U1QA 2Z56B 4RQ4A 2VA3A 1FVQA 2OPSB 1S7IA 3NS1A 1P9YA 5B08A 2HOIA 3EGWB 1J5EJ 1S76D 4J03A 2PEBA 4F0MA 1FDDA 5J2GA 4K4TA 5LOQA 2B4PA 4TU8A 2FLNA 3Q8VA 4R0JA 3DOKB 2GIFA 1HQEA 2DYAA 3VV2B 3C1YA 7ICQA 1T8EA 3CC2S 4LJXA 1PUZA 1R6VA 5ALMA 3CJRA 2IA6A 2ZVIA 1HHQA 2FPKA 2ZIVA 4JI4F 5KTQA 3WZ0A 2YX8A 3B78A 2W01A 2BQRA 8ICRA 2BUNA 4MFCA 1D9AA 2VPWB 1CPZA 3RBZA 2Y0SF 1RAOA 3PZPA 4LZGA 2ZHOA 4I2BA 1KFDA 4Z6FA 2CNNB 4OJHA 5AKHA 3IFEA 3F2CA 1CJKB 1ZJNA 2XICA 4XRHA 1S1VA 3FEZA 3GU0A 4NL9C 3QIPB 2R7QA 4ED5A 1VFJA 2BZ2A 3PIOQ 1T0TV 4EUVA 3UMBA 2AX0A 3I55S 1UQVA 5IIOA 1KFTA 4EWTA 4EZ6A 1UTAA 1U2FA 2C2KB 2Z30B 1CEZA 8ICZA 4KH1B 1C0UA 1OQ3A 1F3FA 4KLHA 5AXMA 2V4RA 2DISA 3IXQA 4C3KA 2B4OA 2GVZA 1PYOB 3GV8B 1SI9A 5DZ7A 3GE9A 4NASA 3HXMA 1LK7A 5DS7A 1KRPA 2CPFA 4IO1A 4UY8T 4KV8B 5CAAA 4MFFA 2B5JB 1YJNS 2PKEA 2DRAA 4ITSA 3HHLC 3W9HA 2G0JA 3HSGA 2HIQA 2VU5A 2G0CA 4CIOA 1PJ5A 1F0MA 1UEKA 3EICA 3HP6A 2XHWA 3LH2S 3VAJA 3UD4P 1JJCB 2GNKA 2MUTA 3POTB 2IRXA 2QJ3A 1QQ6A 3UPFA 4EBEA 2JEGA 2QG9B 3L4BC 4USUA 2D9OA 4NZ6A 3I76A 2F9DA 2HRUA 3MMAB 1YLXA 2V8HA 4KRWA 4GO7X 3T1HF 2IM1A 1T9UA 4MT1A 1RT6B 2NYHA 3KLEB 3TI0A 3BSOA 3R2CJ 4F3QA 1REGX 1VK3A 5HAOA 5HMXA 2HZVA 2FYXA 1KLMB 4LT6A 5DDYA 2DD8S 3MEKA 3MPWA 1HYSA 4ECZA 4QYRA 4C48A 1JN3A 4I4BA 5ALDA 2VKRA 5CHCB 1IKXA 2QMXA 4E98A 2KL8A 3FCVA 3JSBA 4F4WA 4RPXA 4KMOB 5C2CA 4QZGA 2A2DA 2LU1A 4KGVB 3CJKA 4CLSA 1SKSA 1NK5A 2Y8WA 4DSFA 4MH8A 4TYAA 1R0BG 1SXLA 5BJRA 3T41A 1ZM9A 3ZTPA 2DNZA 3H8WA 3PR5B 4X66J 5KFHA 2ISOA 2EC0A 5KFDA 3R9LA 3ZNUA 3NGDA 1KC8T 2F1JA 3PJ9A 2CPIA 5AXLA 1RQLA 3H0LB 3OL9A 3ZZ0A 1SCJB 2B6AA 3RRHA 1V3ZA 4IQWA 2E66A 2GW8A 9ICXA 2VG7B 3GFHA 3TVYA 3V6JA 1S6OA 2BKNA 4YXMA 4Q43A 3B9JA 1N5XA 5EE3A 4FXDA 1CI4A 1RHQB 4C8MA 2E7WA 3M1VA 1SJ3P 4ZVHA 3M32A 3CC7S 4CP5A 1U02A 4XO0A 2KT5A 4AE5A 3HJVA 2QX0A 2QA4S 2QL7B 3WK7A 2M4MA 3I4PA 4HHUA 3JQMA 4BUGA 4QW8A 3OJSA 2B0GA 7ICGA 3CJTA 1ZA2B 1YKWA 2PFQA 5HBMB 1Z00B 3TEHB 3ICLA 2F40A 5JVGQ 1RDRA 3HFKA 3NGUA 1XNQJ 2IJNA 3MPDA 2DXDA 4M1KA 3AD7C 2LI6A 2HZAA 1X0PA 4J9QA 8RUCA 5M2PA 5KFLA 4UB1A 1N60A 4CO0A 3K5LA 1RTHB 2M8HA 3KLIB 4PPZA 1KD1T 1KQGB 1N5WA 2HBRB 1XO1A 3BS9A 2L5YA 3TVZA 3WC0A 3H2UB 4ZITA 3PRDA 4I2DA 1SQFA 5AE2A 3F53A 5F8JA 5HI7A 1C7YA 2EFPA 4YMEA 2FVCA 2BW7A 1GMUA 4CDGA 5KG5A 4NLDA 1NSQA 3FM9A 2VFTA 5H9FK 4YFKA 4Y2TA 4CF5A 1WYGA 2VA2A 4KFBA 1D3WA 3ENQA 3TZZA 4I56A 3KLVA 3R1LA 2R7TA 2W7OA 1FEEA 3ISNC 5C0YA 1WF0A 1TUVA 3OW2R 2F8LA 2MMYA 2NSCA 3H0MB 5IS2A 2W2OP 4OZ1A 3NVZA 1KFSA 4HTIA 2IMOA 4H4MA 1ZD5A 1KR4A 4YB6A 1RWWB 2AJ1A 4NJ8A 3LPYA 4LFCJ 4XQ8A 3OR2B 4WFZA 2UUAJ 3JSMA 3CDUA 1VQSA 3CO9A 2AX1A 2E1AA 3MCOA 2H3FA 2XMVA 5J2QA 5HSPA 1QVGR 8ICLA 1T95A 4OHWA 2QYGA 3R5JB 4BHQA 1EXNA 4ZVUB 3JTNA 3ZC4A 4CM2A 4M6WB 4ECSA 3MM6B 2ZVSA 2C28A 5K8PA 3FMBA 1SXDA 3K2YA 1TK5A 4JB8B 2WF6A 4NL5A 1UT5A 3MM5A 4OMFG 2DF4B 4XTTA 3VZHA 3GWCA 5EOZA 2IHMA 2UUTA 2YB4A 2D3UA 3BZCA 2D74B 4AQYF 5AM0A 1S8OA 1NHUA 2FMPA 1SC3B 1S1UB 3BQ1A 3C6UA 2CDQA 4M9GA 1CUKA 3WU2U 2UU9J 4X4RA 1J2NA 2DXFA 3PKYA 2OJ3A 4ZVFA 4YUDA 1GAOA 1LQ9A 2WAQD 1IBCB 2DCLA 5CD4H 3JTOA 3UDEA 2FLOA 2D7SA 1LKZA 3OXFA 5LMUF 3DXBA 3RAMA 3F73A 2HHUA 1LWCB 1U1LA 4KBIA 2ASDA 1MG7A 3D6TB 4ZPCA 2PI4A 4JI6J 1NH7A 3W5YA 2XMJA 3DM2A 4ZPTR 1NHVA 2RVJA 2IHR1 4KAIA 4Q0BA 4ELTA 4DJBA 5JJBA 1RP5A 3C5GA 2LM4A 3ADAC 8ICNA 3THVA 1X4HA 3NRWA 1FKOB 3J81Y 2Q3PA 1SGGA 2CZ4A 3QIDA 1Z3EB 3TJ9A 4CTAB 5B66U 4DS4A 2W9MA 1TQLA 3K59A 3LP2A 2C1EB 1ULRA 1RU1A 4DX8H 4C8NA 4USKA 3AODA 1F3VA 1DQ9A 2ATLA 2NPFA 3AXKA 5ETTA 2K3KA 4TY8A 3DRSB 2HW3A 4KPCA 5FLXY 3HULA 5CYJA 1RE1B 1NZPA 3C6TA 1UFLA 3M6KA 5L1JA 4ECRA 1X4GA 2GQQA 4LVSA 4GXJA 2CNKB 2YTCA 3E0FA 1Q8LA 3IRUA 2HI0A 4JV5F 1B7FA 1YBUA 3D0HE 3RAXA 3CMAS 2H3QA 3FAHA 1Q3UA 2D3O1 3MM8A 3MMBB 4JBCA 1QTNB 3DRRB 4H4KA 1Q7LB 1UPPA 4CF4A 2GAGC 1Z4NA 1NB7A 3TNVA 2IJRA 4O0NA 4YN4A 3HDSA 4DX7A 4Y2AA 1Y5IB 3BGUA 5D6GA 1FA0A 2DH9A 3TAPA 2DHGA 5GAHU 2LEPA 2JGAA 1WWVA 5KFRA 2BQUA 2NXNA 2QT7A 4LMZA 3DC2A 2RH3A 4XAKA 4CLLA 1R0AB 1CJUA 1ZQJA 5GTHU 4I7FA 3UMCA 5D0HA 3MEDB 1WDDA 3CCQS 1M90T 2KJ9A 5GAHI 2VBYA 3KK1B 1ZQQA 2NQPA 4OX8A 1TL5A 1U45A 1R8HA 1TKZB 1FCAA 3GG0A 2OYYA 2NUUG 3GJRB 4LF4J 2ZWOA 1FXDA 2KZMA 4HH1A 9ICCA 1P1TA 4MKVA 2UXDJ 3C15B 3IGNA 2ZC3A 4I2JA 4DR5J 4EENA 4KH0B 4KLGA 1GNKA 2POKA 2W4CA 1UVKA 4ECVA 3PFEA 2QL5B 2OI2A 1TFYA 3HHLB 4W4MA 4CO2A 2H54B 1DQ8A 2DTJA 1IKVB 2FHOB 3GIRA 3HD2A 1HNXF 4F5RA 2HURA 1A0PA 4JV0A 1OO0B 4PYDA 3BGLA 2W7PA 4FNIA 1FTCA 1BD6A 1VQ8S 3OVBA 3HPOA 1FRLA 2QARB 2KSOB 1BPEA 1YJRA 4QZ9A 2CJXB 1Z1VA 1U1MA 5CB1A 1S57A 3MD3A 2VL1A 2PMWA 1RSCA 4MF8A 1D9DA 2N7YA 3ET6A 1TP7A 3LA0A 3F5AA 4NLRA 3T1YF 1V3RA 3L7UA 1JLFB 5AM2A 1DK3A 4C7QA 3ZZYA 4PHPA 2E1MC 1ZTWA 3W2VB 2MKHA 3V72A 1XEZA 7ICVA 4DMZA 1IBMJ 4F3OA 3MABA 3PJXA 3K75D 7ICEA 2JRZA 1QTMA 4YB7A 3JPPA 4OJ1A 2HHSA 4F0KA 4WKRA 5DJBA 2KZZA 1IKYB 4CO3A 2AV5A 3FVYA 4KHPJ 2HZCA 4NLOA 2XYGB 4RPYA 5D78A 3TP2A 1HI8A 2CQGA 4U8VA 3MR6A 1B4SA 4B02A 2G2OA 5AXKA 2GZOA 2QIFA 3I5AA 2LA4A 3RBEA 4TXSA 5J0YA 1PJ6A 4HDHA 7ICFA 1NPKA 4ZLJA 2E1PA 4FBTA 1EHWA 2QLJB 5A8RB 1RYRA 4CF3A 4ICLB 1NPRA 3SDEA 5HL7Q 4DR3F 2J7KA 4CZCA 4EYIB 3VHQA 5DLFA 4DLGA 3ZZRA 4IFYB 1RCXB 1Q81T 2Y1IA 3VCDA 2KHVA 2ZM6J 2IA0A 4X65F 2JVRA 4K7QA 4B9SA 3V7KA 1RTIA 3JAMU 1WOPA 1HKAA 5F8GA 9ICWA 3IG8A 3ISBA 2GC8A 5DO2A 2ZZNA 3UPQA 2HVEA 2OEKA 3H59A 3VAFA 3M7DA 3G87A 3OJUA 2XC9A 1MN7A 2KKHA 2ZIWB 4J9VA 4F93B 4O3RA 5JUMA 2QGFB 1X60A 2AH5A 3DMJA 4B9NA 3GJSB 5J2PA 3I0RA 2CRXA 1O03A 3HVTA 2C2DA 3M8WA 3D2SA 2YKMA 1HNVB 3AOAA 1DXSA 2WF5A 1CJTA 3UQSA 4DCPB 1VQMS 1NRKA 4Q5VA 4WXOA 4LF8F 2JZBB 2VODA 2R7SA 2V2VA 4ZJOA 3QFHA 4EGLA 3R6GB 3Q2TC 2F4FA 2WVFA 2XNRA 1DOQA 3QU2A 1S6QB 3UXPA 2KRRA 3L95X 2R42A 2VIXA 2RKIA 2ZDOA 4YHHF 2DIUA 4K4HA 4IH5A 1SZHA 3LGNA 1GX6A 2K7KA 4FFDA 1TZ0A 5KFYA 2HQCA 4KYZA 1ZD4A 5JVHQ 1C0TA 2OPRB 1PIEA 4NLVA 2KJVA 7AT1B 1WHXA 4NY8A 4D3GA 2WSEC 3FSYA 4M8LA 2HBMA 2EDUA 3QRRA 1RAEB 2ZIXB 2YKQA 3R7SB 1H0HB 2BZFA 5CXTA 1QCKA 4ZOSA 3UO0A 4GXIA 2PFOA 3GV7B 3B4MA 2ZH7A 3OPKA 4B08A 5J2IA 1ZTTA 2ZD1A 4GIBA 2BJ7A 2CWKA 1DRZA 5KT3A 4NX9A 1X0FA 2CQCA 4A8WA 1P8GA 2I8EA 4MKYA 2XYHB 4C11A 3QU7A 2LDIA 1TL3B 2Q79A 2QFJA 5EX3A 3FC4A 5HP1B 1RBOB 1ZAXA 4P10A 4X62J 4MAKA 4NYZA 1JLEB 4RT2A 1XIQA 2VQFJ 5G4DA 2OWOA 2K4EA 3HX9A 2AYGA 5T7LB 3KD3A 1HBNA 2JH7A 3IV6A 4QZFA 4OI1A 1W7WA 1ZQGA 2O1PA 5C7PA 1BPDA 1C20A 2DBBA 5ALIA 3GR1A 1HHTP 1NKCA 2D41A 1V38A 4R8UB 3BO4A 2BCUA 5DDOC 3MR3A 2YH1A 1ZQRA 5LSLA 2K8AA 5AJ3J 7ICPA 2GGPB 5K20B 2C2OB 2DEIA 3N4MB 1RXWA 1SB6A 2MQNA 1N32F 3N6MA 4LF7J 2R18A 2J8SA 3PW7A 4A46A 2Z2MA 5AI9A 3M8YA 5EE9A 5G0RA 3SD7A 3MGJA 5KFCA 1ZPVA 2H3VA 5AKZA 3SQGA 2J5AA 3K5NA 5IXUA 5J0RA 2OPSA 5ALVA 3HZEA 5J1EA 1FRXA 4I2PA 4BWJA 1IV8A 1V3SA 1L3KA 1SUQA 4OHYA 4PPXA 4N47A 4WZMA 2W11A 3DOKA 3ZDCA 1TL1A 1Q78A 2MQMA 3GPAA 4CRJA 2RS2A 2DH7A 2ZZMA 4UATA 4NI2A 1JXLA 4PQAA 3PO4A 2I5JB 2VONA 4JB3A 3PNIA 3QQCD 2OUGA 3THPA 4RQ1A 2IBKA 1IKWA 4RUHA 2B9XA 5J2AA 1PGZA 3KHHA 1GXTA 1TV6A 3L7OA 1JROA 1VS3A 3DGPA 3HHNB 4UB6U 3DOLA 4R5PA 2C3PA 1ZQLA 2QTWA 5KFXA 4A8MP 2JRSA 1F0XA 3A4TA 4OI0A 2WK4A 4UOHA 4PG8A 2IC3A 1M5HA 4PJ0U 3HCXA 4NOHA 5AM1A 2ILZA 3H40A 4OJ6A 4FDFA 1EZZB 3OTEA 2MZJA 5ALHA 3ZTQA 2OFHX 2A6MA 2VF3A 1SL1A 3DV9A 1PO6A 5HLFA 1WWUA 1SV5A 2ZBIA 3PKMA 2B9EA 3VGVA 2VC0A 1LW0B 4CT8A 3RG6A 1S0VA 2CPHA 2QLWA 3M2VB 1EP4A 4ECQA 2LQ5A 4CLPA 4LF6J 1K9MT 2BGWA 3EPGA 2AGQA 4O4RA 3EGZA 1KN6A 1XS9D 1Y7PA 1VQLS 3TACB 2XVTA 4N7TA 4Y2RA 4X4SA 4GXKA 1JXVA 2B4VA 5J2MB 3A1YG 4WIIA 4YY3F 3QT6A 4A47A 1JMTA 3KK2B 3RH6A 2DK2A 9ICMA 1VQKS 1LKYB 2BW2A 1NB2A 3M8PB 4MEXA 2XMUA 3AOCA 2MKKA 3MMAA 3DEEA 2YN4A 3IM9A 3FBFA 4RW8B 1Q8BA 1RTDB 2W55A 2OPPB 1JLBA 3CJ5A 1WJ9A 2VG5B 3V7LA 2KVCA 1KEKA 4LVOP 1BY9A 1KLMA 1IWAA 9ICBA 3CJQA 3T5KA 1ZS6A 1N0UA 1RT2A 1YWXA 2QKQA 2F8EX 4NRTA 1S6UA 2VKZG 2GO9A 1UA0A 4P75A 1KOHA 2ZNZA 1J5OB 3MECB 3VVTA 3EZ5A 3ZDDA 1WEZA 5AI6A 3KOAA 4B3RJ 2QMUB 4UB2A 3MUMP 4UAVA 1HEKA 4HR2A 5ALLA 4BBYA 2FPLA 4EK2A 4OHZA 5ALFA 3MGIA 1S6PA 1RT4A 2JWNA 4Y28C 2RUGA 1TUWA 3DYAB 2J7WA 1RA6A 2QV6A 4RX6A 4J9PA 2VUGA 2F4VJ 3PW2A 1YG0A 4RQ3A 4DQRA 1DTTB 2CIMA 4DL7A 4C97A 4Q45A 3IMQJ 2H3ZA 4KLOA 2KXNB 1B0PA 4OQJA 1U1KA 1HPZB 3CCVS 1U4BA 3M8ZA 2JL9A 2N1RA 2EPIA 1ZQBA 3R6LB 4QZCA 2KO1A 4NZ0A 1IBLF 2PA3A 2Y8YA 2WVBA 1N54B 5AE3A 4DZDA 4LBPA 2VASA 1UVLA 2Z7JA 1EIYB 3NGRA 1VHFA 5AM4A 4LRAA 2B21A 7ICTA 1KSPA 3FCWA 1TE2A 1F9EB 4OJGA 4KLEA 1ED1A 3NLCA 4LJMA 3UCGA 5HBMA 5CZXA 3UDCA 2KM8B 1Z00A 4NLNA 4KR0B 1RT3A 2QB0B 1S9FA 3PO5A 1L3VA 1RCOB 2FGCA 3Q8UA 2X1BA 2D9PA 4FZNA 1M5PC 2NRXA 1V5VA 4UAZA 3KUHA 4DS5A 4PZVA 1MQ3A 1LW2B 1D1UA 1XQIA 1J2MA 1XMQJ 3IM1A 5CYQA 2LP4A 2BRKA 3NWRA 3V4IA 2D69A 5EUHA 4F3MA 1W2BR 4ZJQA 4X66F 2UVRA 3LGHA 3MM9B 1UCVA 3P5TL 4OIXA 3SQOP 3H7IA 4L3NA 2HHQA 1YJ9S 4IRCA 3B0XA 1BXNA 2WHEA 3LPEA 5E0OA 3MGVA 4LQ3A 3DCAA 1TKTA 5EDWA 4CNQA 1ZOLA 4DQPA 2MU2A 1ZRMA 5E79U 4DF4A 2J0SD 1WTBA 2KI2A 3H2VE 4ER8A 3KHRA 4DQIA 2GMJA 2FVQA 4NA1A 1JRPA 2Z2LA 2F9JA 2RUSA 4YDDB 1XMBA 1YRUA 3JPNA 3OTCA 4PYAA 2QA2A 5K9FA 2XY6A 2DR9A 3GILA 7FDRA 5EX0A 3L3CA 1LVHA 2EC2A 1Q53A 4DCOB 1HBOA 3NUQA 2K1RA 2L9WA 2PXIA 1S1XB 3CD5A 1NZAA 3DRXA 3RU0A 2YKNB 2BPGA 3ZTRA 4G1PA 4AUKA 2RS8A 4QU6A 2VHGA 4WBFA 5CA7A 1N52B 1C1BA 1DARA 2ABYA 1T9VA 1U1PA 2HQGA 4ZKAA 2JC0A 7ICOA 4C3LA 1UVMA 3K1ZA 3PFOA 4QWAA 2W9CA 2DY9A 1M5VC 4KLLA 1UJ5A 4DU7A 1HARA 3VF0B 3T3FA 2LXFA 2AWZA 2YB1A 2VKQA 5HHHA 3R9KA 4UBBA 3E2EA 5C24A 1XK8A 1OW5A 1SJQA 1DY3A 2ZXHA 5B0CA 1HNWF 2VJ4A 2QLFB 3ZO7A 3A3PB 2XYPB 3I6PA 2XLJA 3KG0A 2DR5A 1NNDA 3CJ0A 2MQLA 3LTOA 4J90A 3DDKA 2KYZA 3RB4A 3HMJG 2BKPA 2E7XA 4WFYA 4HACA 3DI6B 1TTHB 3D66A 3K5PA 1ZM2A 9ICEA 4PZOA 4M04A 3QYPA 3OL7A 2A1BA 4NZ7A 9ICKA 2Y0SD 1OPZA 1VR6A 1M6YA 5AI8A 3HJEA 2VC1A 4MK8A 3N6NA 1X4AA 1YBTA 4P2SA 3CPWR 5CJ7A 2K4HA 2KEYA 2X1FA 4JWNA 3CUNA 4Y2MA 3BDPA 3HW8A 2ADCA 2ROEA 3IRXB 5I42B 3CJ8A 2MY8A 2FPMA 2V4JB 3TQ1A 4ED6A 4RW4B 1B64A 2MZSA 1I6JA 4TUPA 1VRTB 4IG3B 2GJIA 9ICQA 3KLGA 1FIQA 1HI1A 5J0TA 4LF1A 3O0FA 1REVA 4FYVB 5GADI 3BF4A 3PIPQ 2ZBQA 2OCEA 3A8KA 2W43A 5K8OA 2CRLA 2RQMA 1H74A 2EW9A 4B6JA 4I1TA 3H2LA 4G3IA 2VBWA 2C2RA 4KQZA 1XJWB 4P0QA 2YX7A 3K5OA 2XSFA 1NZ8A 1Y0HA 2L41A 5AKLA 3C8YA 4NMLA 5KFBA 4OX6A 4UARA 3F5EA 3JXOA 3T9ZA 1TMJA 1KQSR 3N7PD 1SPBP 1ZETA 3GSDA 5H2FU 2ZOGA 3K8WA 2JH3A 1V85A 3HO1A 4GKJJ 1MSWD 2W9AA 4ED1A 4I69A 4O44A 4E0DA 2UU9F 3X1LB 4PHAA 3HK2A 4FP9A 3KJFB 2CQ0A 1AUSL 4NWIA 2W2MP 3IG1B 3VGUA 3DRRA 1RWVB 2FQQB 2HQFA 2JOQA 3UVJB 3KKAC 1E6VA 3PX6A 2GMLA 1S1WB 2DHSA 3DDNA 2EAMA 4O3SA 3QSYB 4JI6F 2C42A 4HAIA 4WFNQ 4IDKB 4NLSA 4CYUB 5L9XA 4WIQA 5KFMA 2XMMA 4KE5A 3VALA 4U95A 4C0HA 1KL9A 4KLIA 2YWGA 1IM6A 2X51A 5EE1A 2YMMA 1KP6A 1IR0A 4PEOA 1IJEB 1E6YB 3HLUA 4XK8C 3Q8MA 2V8VA 3QFWA 1Q5VA 5D3GA 5KG2A 3KK1A 2R4FA 2A3VA 2AD9A 4O3QA 2J0XA 2HVHA 5JXSA 3TZYA 3HI9A 2M9NA 2XIDA 5ALQA 3WKEA 1N5VA 1XN9A 3KHGA 4YQWA 3D2WA 2JH1A 2MTLA 1PVRA 1NSPA 1SKUB 3M6VA 2YNHB 1XTZA 1H2VZ 1ZAVA 2DGWA 1SJ4P 3CYMA 1VGYA 2IJFA 1XNRJ 8ICEA 2PC6A 3AHPA 2FPHX 3RGIA 3HHLA 1K5OA 5J2NA 1FJCA 5AKKA 1DZ5A 3OLAA 4GMKA 1UCNA 4TNOA 4OYMA 4TLQA 3IS9B 3A8EA 3ZZPA 1U6FA 1B7YB 2FIUA 1HQ2A 4NLTA 1PYSB 4F5PA 5ALKA 4IG0A 4I2AA 2QLXA 5ETRA 1X9MA 3FFIB 4WU3A 4K4GA 1X40A 5F3ZA 4WK1A 2ZE2A 5A0LA 3OFEA 2E5GA 4RQ6A 4JV2A 4DL4A 3MAAB 1PILA 1T94A 4OX7A 1TAMA 3OFHA 5C2GA 4ZCLA 2NZ4A 3I9ZA 4NLBA 5E3PA 3CWJA 4PQUA 2E8PA 4ELUA 4GFJA 4UB5A 4EX6A 3HHLD 1IKYA 4O3MA 2B8QA 3UQ2A 3I4HX 2W1BA 2YNIB 1KN5A 1T03B 1UL3A 4UUXA 5MAOA 2W03A 4LSLA 4DR5F 2F8MA 3BB5A 2GV1A 3QUBA 1URRA 4HT5A 5AK6A 1RYSA 4NLQA 2UXCJ 2HHWA 4AYBC 7ICRA 1RT1B 2Z57B 5KFPA 4URGA 2V8DA 4UZBA 4HI1A 2E8MA 2LHTA 1A7GE 3LOUA 4AD6A 2EEYA 5ADZA 1D0EA 4KLDA 8ICTA 2YH0A 1CLFA 1CQMA 1JLAB 4QW9A 4ZPDA 2AJ2A 2J9DE 2HHHF 1H6KX 4MF2A 2AP6A 1B4FA 1V9OA 4DXLA 2JEIA 4DX5A 2AJ4A 5KFKA 1H7WA 1RBLA 3A0HU 4NCBA 3SXLA 3M2RA 4P0PB 1MN9A 1FK9B 4KHRA 1TU0B 2HK3A 2GQCA 3W8GA 2RU3A 4I2CA 4OZNA 2H5JB 4UOCA 5K14A 3BH6B 2EG2A 4Q8EA 3FMWA 1WC4A 3TJAA 2I6XA 2XCPA 4JI0J 1VJQA 3G6ES 2KU7A 2R7XA 3FBCA 3KG4A 1FWLA 5KFJA 3UNYA 4OYOA 2MSSA 3P4UB 5IIJA 4OX9J 1Q7YT 1HL6A 1U8WA 2D6FC 3TO8A 4KHPF 5IIIA 1LWFA 1UEUA 5A8WB 1IQTA 1UAWA 3SIPB 5GMDA 2BDUA 1N33F 3H5XA 2RHFA 4BDPA 2XBPA 3MCMA 4ZP6A 2RDJA 1FRMA 3OL6A 3CVKA 2PMZF 3A8IA 4IQTA 4EBCA 4NXMJ 3SQIA 2DH8A 3SAFA 1QAXA 3CJ3A 1SC4B 1N56A 1HNIA 4B9MA 1QM9A 2HGMA 3C23A 1Q95G 5KG3A 3WHIA 4CWBA 1JKHB 4DOCA 4LF9F 1I3OB 3CCES 2BM1A 3CCWA 1RHUB 4KO0A 4DL3A 3W62A 3GTYX 1XO0A 2ZM6F 3V6DA 3D9BA 2AYEA 2ZIXA 3NWGA 3KOOA 1N0VC 3UXOA 4ANDA 1OYEA 5HVHA 2UXBF 3R2DJ 3OFGA 2LCWA 2KOBA 2LQ9A 1JALA 1DJ0A 2KB2A 1NCLA 4M5MA 3KJVB 4JMUA 1URJA 7ICKA 4FYYB 3OR1A 1HHSA 1TL3A 1I94J 2AZ3A 2FC8A 1RADB 1HR0F 3QLHB 4U7UD 2RRNA 2CPRA 2FLPA 2EK1A 2YWFA 4FYDA 4OI2A 3GIMA 2I9GA 4C7ZA 1UJ6A 2G1DA 2CNLB 5AT1B 3GDXA 4RNHA 2FHJD 4B3OA 3M8SA 3OGUA 2H51B 4UB8U 1FFGB 4DV2J 4R0EA 1T02A 2CJ9A 2GVDB 2KHCA 2WBMA 2ZZTA 4AYBF 3IR7B 3ISND 3CF5Q 4JI2J 1H73A 4FF3A 1ZM3A 1TUGB 3AH6A 5C25A 3MUTP 3CTRA 2RHSB 2IPOB 3KNAA 2IVYA 2YTUA 2DHHA 3GZFA 1RHRB 5ALJA 3GJTB 4EO8A 3ISDA 1L7OA 1WG1A 3G4SS 2VANA 2AJ0A 2CZ9A 3J7YU 2QE5A 1YJUA 2DKXA 3CJ4A 5B7WA 4DUZJ 2XSJB 3M30B 2OKQA 4MMOA 4DSKA 2HIYA 2YNGB 1X9XA 1RLDA 4DR7F 3H98A 3DU5A 4IQUA 1BGXT 2G08A 4DPYA 2UUCF 3AMZA 4J9KA 1PAUB 2WSCC 1LXNA 5F8MA 3MDCA 4P9SA 3CD7A 1IN0A 3Q8PB 2BR0A 5ETNA 3IRWP 4X62F 2Z2ZA 4K4VA 4M5LA 1AROP 2VQFF 2DGXA 4M5HA 4G1QB 3Q0AA 2MXYA 3DRPB 3QT8A 2B4UA 1F5BA 3DGVA 4HVZA 1GEHA 5IC6B 2CA9A 3RFAA 4X84A 3D7SB 1FEHA 4RW9A 4DV5F 3AM9A 2KNJA 4RNFA 2OELA 2Y9HA 4X4OA 2FY1A 5AJ3F 1L7PA 1NXIA 5B0GA 1ZQYA 4QYZK 1QSLA 3I28A 3Q8LA 3UR3C 3DLKB 1FX4A 4DPXA 4RUBA 2ROPA 4C8LA 1L8LA 3M9MB 3ETLA 1CQNA 2NV3A 4F26A 3FEXB 2LBOA 1MMDA 5J2CA 1SB3C 3D68A 2A1JB 2R8GA 1QLNA 2RRAA 2ZWPA 2Z2YB 3FZBA 2OMOA 2XEXA 1BNPA 5DM6Q 2FJDB 2FMQA 4OLOA 5LL6d 9ICFA 2FMSA 3UN2A 4GC6A 5KFEA 6FD1A 2FJEB 3E01A 3OD2A 3HSJA 3A3NB 4AXJA 1SIWB 1AB8A 2ZH6A 1FJ7A 3UQ0A 3FZ2A 3H0RB 3C46A 5FP0A 1AW0A 5J0QA 1X4EA 3BYPA 2ZIUA 1U0HA 1YJVA 3MMCB 4KSEB 2UVUA 1NJIT 2JX2A 2HNZA 4RQ7A 2DR7A 3EXYA 1NK0A 2ALZA 2XTJP 2DNGA 3BS5B 2B56A 3ZTSA 1W26A 3OVAA 3TEGA 2DXEA 4A8EA 3WDOA 1ACMB 3TUZC 2WOMA 4NA3A 1YHQS 1J5OA 2H5XA 1DLOB 5A8KA 1FFSB 3CDAA 5F0UA 4PUOB 1U49A 3HVWA 1TL7A 1HFEL 2G0IA 3H7HB 3KLHB 1MMNA 2G0AA 1SV0C 3MPVA 3PACA 5LSRA 1JK9B 3IN5A 1VQ6S 4ELVA 5A6WA 4XUSA 1JLCA 2VDIA 2DEJA 8ICYA 1IIPA 2BJ3A 4FYWB 1PVQA 5HROB 3OL8A 4ZVRB 4LF6F 4RW7A 3PYFA 4KN7A 2P6TA 4URQU 4ZHRA 4QZDA 3S7RA 3MTKA 1TKXA 4A8OA 5IOLA 2ROGA 1WNEA 1ZBTA 1K44A 8ICHA 2IY5B 5K8MA 1WG5A 1GK8A 4I2QA 4KKOB 5DLGA 4BCAA 5J2BA 3RJFA 4LSNB 4B3SJ 1MMLA 3O8WA 3W66A 5DRKA 2ZUDA 3G82B 2VIHA 4P4MA 1C1CB 2JV3A 5ALPA 3L3FX 1U47A 5J2FA 4A8XA 4WF9Q 4DR1J 3FKBA 2DNOA 4RQ5A 5G5GA 1KHWA 4P71A 4CGZA 1TFRA 4QYZJ 4F50A 2PFNA 2MLYA 2XZTB 1S1TA 3LP0A 1WD6A 4ENOA 4M5NA 4QWDA 2BOAA 2V8PA 4GVBA 1LW2A 1RAIB 4TY9A 7ICJA 3WIUA 2IRUA 3RR7A 4IO9Q 1RG6A 1QSYA 4ZVSB 3T79A 1XC9A 2DGQA 3SFGA 2KH9A 1FNOA 5HP4A 2AQ0A 4GKKF 4DN9A 5AK4A 2LXIA 1X4BA 1M5KC 1RZTA 3FJ2A 3MEEB 3CCTA 4A8QA 2HBYB 1Q4RA 1JNZB 3K57A 1YQHA 1Y4ZB 3ILJA 2H5EA 3QUTA 5J8YA 3JS9A 4W90B 4EELA 4BGDA 1WHWA 2OXOA 5D46A 1W25A 5KFNA 2HMIB 1MU2B 1RDFA 2XM3A 1HMVB 4O4GB 2H3IA 4RQ0A 3UI3A 2J6SA 2ES6A 3IM8A 3SSSA 5E3RA 2ADBA 3HKZC 5ALOA 1K8AT 1YJTA 3W60A 3H8JA 3NCPA 4K4ZA 1V6HA 2VFSA 3UN5A 4CE6A 1T9TA 4KITB 1S9EA 1SQEA 4M5DB 2LECA 4QZ8A 1S0OA 3TQEA 3IO1A 2QEXS 2E1FA 4YMOA 3ETRA 5GAEI 4U96A 2FZGB 3WKBA 3HSZA 2WONB 4DSJA 4Q2MA 3EUB2 3W2WA 3UD5A 3CXCR 3QX7A 3AB4B 2P35A 1JLGA 4LR9A 4LF5J 1A6LA 3NS6A 1RAFB 2DGOA 1UFKA 3HRDD 4RBVA 2CDRB 3PSFA 1Q1KA 3N5BA 2L9NA 4NCAA 2KFYA 1D8YA 4B17A 5BYQA 4ZVPB 3FRZA 3OLBA 2BEFA 4EFAC 3C5FA 5F0WA 2M88A 3CDBA 5J2JA 4DV0J 2P6UA 3NG8A 2RNEA 3CDWA 2VV5A 2ZJ5A 2JZ5A 3DI6A 2BANB 1HBUB 1K1QA 4N5SA 2ZC4A 4Q2LA 1OUQA 5J0UA 1B0VA 4IOCQ 2MYFA 2CAJA 4WFXA 4FPRA 2E5JA 3QWUA 1RTJA 2M52A 3H8MA 3KLFB 1HQUA 3GIJA 5CABA 5AXNA 3JYTA 1HBMA 3IRXA 2FHMA 3MOJB 2GJFA 3PW4A 5KT6A 1ZQVA 3MOZA 2ZKTA 1MQ2A 1ROFA 2VOOA 2EXUA 2NCKL 3M6UA 5ALRA 3AEVA 2AEMA 2V63A 5DBCA 1OQ6A 4US8A 1Q0NA 1QE1B 5KFSA 2YPZA 3NCQA 2IM0A 4JI4J 1ZYQA 4U7CA 2HLUA 3M8QA 3MEGA 4WTYA 2X1AA 4AL6A 3EWGA 1LWEA 1ZQOA 2MSTA 1HWUA 1MWYA 1R7IA 3TX8A 1F6TA 4HL9A 5F8LA 2QA1A 4ES2A 2Y9TA 1IBKJ 1FNMA 5DB9A 3MD1A 2EZYA 4QJFB 2EK6A 3PRBA 1U8SA 2DUYA 4F8RA 2NR0A 2G2ZA 4NLGA 1HUOA 2ZITA 2KKVA 1H98A 1ICEB 2Z8QA 1ZD2P 3VR1A 3QO9A 2ZJ8A 4UY85 3WKAA 1N48A 1M5SA 2GCFA 5KFAA 1CS4A 2CPEA 2OLWA 4J7CA 2V2KA 2K8GA 4J9LA 4DSLA 5FLXU 2Y9UA 3B4DA 4OYXA 2A19A 2LYHA 3C1ZA 4RU2A 3IG1A 2WW4A 1TELA 1QJHA 3DDIA 5TZVA 4Z2XA 4KGXB 1ZQPA 1HQEB 3W61A 2WB1C 1RJJA 1S1WA 1F9FA 5I3UA 1BQMB 2BHNA 2ZEJA 3HKZF 1YT3A 5BR8J 4JI5J 5ITHA 2F1HA 4NLCA 1ZOTA 2O5DA 2G09A 2HWIA 4K5SA 4N76A 2ZIVB 2WBRA 3IAM9 1N5YA 1Q79A 4CYUA 2ZKUA 3RJMB 3AJ1A 1C4CA 3QATA 3CD0A 1N34J 1EETB 3TZWA 3T1HJ 3F44A 1ZQIA 4ID8A 3V81A 1C2PA 4ED4A 5DDQC 5C42A 4K4WA 1S1VB 1H3DA 5L39A 2EAPA 1PK1A 3K4GA 1RHJB 3U1NA 3DLGB 1N6QB 1RU2A 5DB7A 2DO0A 4PH5A 3MDFA 2CQIA 5LXRA 1C0UB 4ZOHC 3ALRA 3NCRA 1COOA 4WJ3B 1G7CB 2Y1LB 1S99A 3CCJS 1F2HA 1N4LA 2GVZB 4GKJF 3NGTA 4A4JA 2HAFA 2JLFA 2HNYA 4KLSA 2RQKA 2NXEA 2KVIA 3D3CJ 1NK8A 1HNZF 4ICAA 4QQBA 2ZXIA 4HEA9 1S5LU 2HRTA 2UUWA 1U26A 1ECWA 4D3HA 1WSRA 5J1PA 2GOLA 4L74A 2K60A 4LBIA 3NKYA 4G6VB 1ZQDA 3FFIA 4DF8A 1L7MA 1FVSA 4USIA 1VBXA 1FF2A 3HVAA 9ICGA 2EKNA 4X4QA 3PNCA 8ICQA 3BN4A 1DURA 2VDHA 1NJWA 5DM7Q 3OV7A 1D09B 2V69A 3T5JA 2MKCA 2V67A 3QU4A 5AKJA 4DLEA 1N5SA 3SSRA 1YJWS 3JPQA 5KFUA 2H4WB 3QMQA 1U25A 3IDWA 2C3YA 3MBYA 1FI4A 1VQNS 3BGRA 3I32A 1S9GA 2XLIA 4LFBJ 4NEYA 2QSWA 2QMWA 4IL6U 4AL7A 4JV1A 5IZHA 4K5RA 4CLYA 2LU2A 2ZUCA 4OZ5A 9ICLA 1HYSB 3OUYA 1R89A 3J81j 2Q4TA 3BREA 1FERA 1IKXB 3I0SA 4Z6DA 1WEYA 2QLBB 2V2QA 4B9LA 2KZ3A 4PWDA 1X9SA 1AZSA 1M1GA 2QYCA 1G6BA 3A8JA 2HEKA 2M0GB 3GFKB 3SR6A 3CJKB 1QAYA 1XNRF 3TFSA 4P74A 3M6ZA 3FGVA 1UP1A 5IT0A 1SXEA 2HFOA 2YX1A 1SC6A 5BPCA 1X4DA 3FSIA 2H1YA 4ECXA 5ETPA 2CPYA 5ALEA 4OFZA 4O3OA 3PCOB 2WF9A 2RQCA 3B82A 4DV7J 2A6OA 3NS5A 4WFAQ 1Q5YA 1RB0A 1I1GA 2B6AB 4J9RA 4MJKA 4PRFA 1NLKL 1FDAA 1M1HA 3CSKA 3TUIC 1T9WA 3FNNA 2OSQA 4Y34A 3IA0A 3M1VB 1R8PA 2ZNYA 3C2MA 4P0PA 4H4OA 3M32B 3QBCA 5KOXA 2WB1F 2ACMA 1U1RA 2V0NA 4U7UK 3OT9A 3EWAA 1VQYA 3C29A 3GB0A 1WWHA 5ALWA 4WE1A 1BWVA 4DFPA 2ZBPA 4GO5X 3LVWA 5IIMA 2AMCB 4OYPA 4F5NA 1UVJA 1X5PA 4RBUA 1CULA 4ILMA 2QRRA 4DR4J 5D4BA 5IT9U 4M94A 4OJLA 1GTEA 1T11A 1MLAA 2KFNA 3DOMA 5CR0A 1AA1B 2KHQA 4NXNJ 4KX3A 4IS7A 1OS5A 5KFOA 3UFCX 2WHOA 2JHEA 4F91B 3DLEB 4URSA 2UXCF 4J9UE 4WJBA 3WX4A 5J0WA 1AFJA 4RW6A 4TYBA 3NVYA 4DUYJ 1MNEA 3F41A 5LMNJ 4Y2IA 1XU4A 4RJVA 2LYVA 1FRKA 4I28A 1HA1A 2IAJB 1U6ZA 3CIZA 3MM7A 4O5EA 4K4UA 4ECYA 2PFFB 1TMMA 3LQVA 3ZDAA 3PG9A 4KFBB 4P72A 2AEJA 3M7VA 2R9LA 1VQOS 3CT9A 9ICPA 3C16B 3J7A1 2F7VA 1VYAA 3W63A 2VJ5A 3K1RB 3VZIA 2HVZA 2XMAA 5AK3A 2HHVA 1VBZA 4JI0F 1YRXA 5LMUJ 1LFWA 1IXKA 4M9HA 3Q8YA 1FRJA 2VBZA 4OD0A 2JXJA 2LMRA 3E51A 4BWMA 4OX9F 1U6BA 1GXUA 3EW9A 3HZGA 3WK6A 3FRYA 5D4PA 5A76A 4ES3A 4DPOA 3PW5A 4TVAB 1MWQA 3D2QA 3C19A 2RJZA 2MGZA 5J2QB 1RWUA 2HFUA 2XMTA 5J2KA 3MXHP 3G6VA 3GG1A 5F8HA 4XPEA 3NRBA 2FJWA 1BQNA 4NXMF 4FPIA 3B54A 4R64A 3OTOJ 5GMEA 5AK5A 3MM5B 4NM2A 2DR8A 1Z1ZA 2NUHA 4OYWA 1Z4UA 4JI3J 3QGGA 3OSNA 1RWNB 1RHKB 4O5KA 2K3IA 4JWMA 3V2UC 3GCXP 3KK3A 1UPMB 3ISCA 2V68A 5K4LA 3C6UB 2I5HA 9ICSA 5EWEA 2I1QA 3VAKA 4JOUA 4OJ5A 4OZ2A 8AT1B 3QJJA 5IV4A 1R27B 1G4CA 2BE9B 1WC0A 4JV5J 2KVQE 2ZTCA 4UW2A 1VJ5A 3Q8SB 3H0PA 1Z19A 3SAHA 2BCRA 1SC1B 2MZTA 1U1OA 1WTFA 2Q1LA 2PA8D 4I6YA 2OEJA 3NY0A 1PSDA 4C6AA 3MR7A 1HWJA 2HCFA 3UD3P 3TAMA 3M2UA 4YS2A 4DR2J 3OVSA 1VK8A 3M6WA 2IYIA 1ZD3A 2EH9A 2GHVC 4ZCMA 5KFTA 1T3NA 4K8RA 2BQ3A 3DM2B 2YY3A 4PHDA 4WP9A 2DRDA 2DVIA 4Q0BB 5J2DA 4YDXA 5I4MA 2EWHA 3ITHA 2LEAA 2XS7A 1FWPA 1FXLA 5DQHA 1SIJA 2W04A 4TQRA 1UZHA 3P8BB 4YB5A 2XMWA 5H9FJ 2APOA 3X3UA 4NLZA 1XR6A 1X5TA 2FTRA 3LP2B 4QIFA 4DCCA 3DLKA 2IDLA 3NASA 4ZCIA 2FVRA 2DGTA 4F2RA 3AQFA 2LQ8A 3T6JA 2VJVA 4JI2F 3LYSA 2XWXA 3ZZTA 2DGSA 3N6LA 4TY8B 3DXSX 2XGPA 3HSDA 2HLTA 2B51A 1S10A 4C4RA 1DTQA 1F1BB 1VIOA 3KYLA 5KG6A 1VRUA 3C6TB 3Q8KA 1HI0P 3ENWA 1WCNA 3SMVA 2MHEA 2G2YA 3P6YC 4RPFA 1ZQNA 4KLQA 3AQEA 4KX5A 3L4PA 4DV3J 4F25A 2M7SA 4KGMA 3MM8B 2DNQA 2IMWP 4DL6A 2KIVA 2RHQB 1MROB 1AYEA 3F2DA 2I6WA 3QRQA 4OV1A 1NKEA 1ZJMA 2O67A 3PXGa 4C8YA 4Z6CA 4DWIA 4F2SA 2L48A 1CJUB 1SWVA 5IILA 4I7FB 3BS5A 3EPIA 3EVWA 1OJ4A 1K0TA 3US5A 3SBMA 5GVQA 4FBUA 2J8AA 3DLHA 1JLQA 1NH8A 3KXDA 1GH8A 2NRTA 2XULA 3IWLA 3J7ZT 4GVLA 2C3UA 2CJQA 1WUDA 3T6BA 2B7CB 1IXRA 3NL0A 3KLHA 2LXUA 4ZLNA 3FYHA 3QWPA 1VC0A 2EG1A 4DG1A 5T14A 1WI6A 2FD2A 4Q7AA 2RILA 2Q6BA 3HM9A 3U26A 5LJ3Y 3UCZP 1UZDA 4LVNP 2W2PP 4A8YA 4QIVA 3BDEA 3KDNA 4CNYA 4PG4A 1KLNA 3KJQB 5F9NA 1FKPA 1APSA 3NNHA 5F8NA 1SL2A 3GV5B 2BPCA 2MEWA 4WTOB 3TUJC 1PZNA 4X65J 1NDLA 4LQ9A 2F8KA 4OV6A 3ET6B 2RT3A 2DHXA 4U9RA 4OZ3A 1WACA 1P6TA 2WB4A 5ALZA 2G1HA 2FJXA 4DU8A 2PMZD 3LP1A 2R8IA 4QZHA 1U2CA 4DFDA 4M47A 2F2AB 1VQ7S 1EX8A 2BJEA 3O2IA 4KLJA 4B9UA 2KM8C 2NS1B 2ZJPQ 4QBUA 1SJRA 2EVZA 3NBPA 2VD3A 5IIKA 3PDNA 3A0BU 1H72C 5L46A 5CD4A 3RJKA 2LPEA 3RTVA 3NTUA 1IR1A 3NNCA 5ALTA 5U47A 1BHNA 3D28A 4YB1P 1P1LA 4RNOA 2MQPA 4QPTA 2GS8A 2KN7A 3UE2A 2E5IA 4KGZB 3W64A 8ICPA 2IBOA 4Y3CA 3TR5A 2E8OA 4DFJA 1RWOB 4ZPBA 4FF1A 2K2PA 1U09A 4ID5A 3G6XA 1G1XA 4K2XA 2MY7A 1Q16B 2PIIA 1RLCL 2XI2A 2LDYA 4K59A 4WYWA 4NYOA 1UJ4A 1J2VA 1UFWA 3QGHA 1DHMA 1BPYA 5AKGA 2OPQA 3SDEB 2JHDA 2BE2A 3IP4B 3MZIA 4M5GA 4B3SF 2OIHA 3WIVA 2JJ4D 3GYGA 2HQIA 2HMIA 4CCHA 2MB0B 3R1HA 1RTIB 2CJYB 1NI3A 4DR6F 4QIWC 2YQ0A 4KHMA 1GMWD 1ZQSA 5FIIA 3MPYA 2W8KA 4ZP9A 2DFLA 3WK9A 1RT5A 4HI2A 1X9WA 4QWEA 2C22A 2YMLA 4F4ZA 4DEZA 1OYDA 2I38A 3BJYA 3DMJB 3QE9Y 5J2PB 3I0RB 5IT9Y 2A18A 2ZBCA 1QVFR 3HVTB 1QSSA 4MHVA 4LZDA 1OIAA 2BJ1A 3AA9A 5B0DA 4QIEA 3Q22A 4B3TJ 5H1SV 1RWMB 3GMGA 4AYBD 4QZIA 1JQGA 3ZXWA 1FDBA 2YKMB 2FJVA 1Y9OA 2N4CA 3QSIA 1CJTB 2DIVA 3WQPA 2HNDA 2CQPA 1RT7A 5D4OA 1T05A 3DN9A 3VQSA 1KHVA 3VAGA 2VQEF 2FJAB 4ECWA 3G6YA 3AU6A 3IBFB 2KD1A 1ZA1B 3TKAA 3JQKA 3BN7A 3C2PA 5F9LA 2GJ2A 4A8SA 2WW8A 2E1CA 3GONA 2CVEA 2FJBB 2R7VA 4FKYA 2RKIB 4ZCKA 1JI7A 3EJMA 1UWBA 3FUYA 1RI7A 2BCSA 4MYTA 4ATNA 4YVZA 4BXOA 4ZA1A 2CJBA 1C0TB 3AY0A 3SAGA 2JSXA 2BX6A 2E5SA 2G06A 3HX0A 3JPRA 5A2QY 4PR6A 4IQVA 3TYTA 2QC3A 3VAHA 4J91A 3S6JA 2P9CA 1VBYA 2BVZA 4NCGA 4UAYA 4ZH4A 2EAOA 4FYXB 2I2YA 1KQFB 1Y10A 1Y3JA 2X1GA 2CQ4A 5GAGU 5FD1A 3QGIA 3BSNA 3AXMA 1OY9A 3BM7A 2EFQA 2J9DA 4KY3A 2ZD1B 4R66A 2VFRA 1V5IB 3KUEA 3LWMA 4MFAA 3BKTA 3KMSA 4C11B 3PX4A 3NMAA 1PK3A 1K73T 5GAGI 1Q3VA 2U1AA 3ILLA 3TA1A 2KJWA 4QWCA 4DZ6A 2ZH2A 1T9XA 1WUUA 2CN1A 4IFVA 4JI8J 4NM1A 5LSOA 1QUVA 2GWSA 4G1IA 1SWWA 5J0PA 1PBAA 4L6V3 1RM6C 2QO3A 1FESA 1COKA 2IDEA 1B99A 1K0VA 1CJVA 2RB7A 5IM0B 4C0ZA 5B5EU 2UV8A 1EAYC 4Q8FA 2GX8A 2LYBA 4DV0F 4OYIA 5F3TA 3N28A 4CLUA 5IWAJ 2AYMA 4XDDA 5A0YA 2OMLA 3F2BA 1F9HA 5G0RB 1UW4A 2G9OA 3SQGB 5KFFA 1NU4A 4YN3B 4I29A 2G5HB 3TRGA 1O08A 2L08A 3G96A 5J1EB 3E3XA 2F65A 4I2PB 1LNQA 2KYXA 4LRFA 4ANCA 4RU9A 4DOAA 3DDHA 1SUQB 2JLGA 2IRYA 2PD1A 4UTGA 3V7JA 2U2FA 4UZCA 4M63A 4K0KF 2RU9A 4TN2A 4C0OC 5D8HB 4TU9A 1WDTA 1JXEA 4I2IA 2PT0A 1TL1B 1VDVA 4Y00A 3BBCA 4QIWF 1BQMA 4YY3J 3AU2A 4KT0C 1VOMA 2HFSA 4DDFA 4DOZA 4NI2B 3N7RC 2WF8A 5A6PA 3HHKA 3PYEA 1N2XA 4USTA 1RQNA 3NMRA 3O3LA 5KT4A 1IKWB 3CIMA 3MUVP 3FK4A 2E5HA 4JI7F 5THWA 2KFZA 2W54A 3UMGA 1TV6B 4LRCA 3G71S 3DGPB 4IOAQ 1EETA 3K7RA 4ECTA 2HQDA 4IC9A 1CJKA 3DOLB 4IOBA 4I0WA 4R5PB 4MFBB 2NZCA 3ZD9A 3SYZA 1I5OB 1FT8A 3QIPA 2LFVA 3SEOA 2XNQA 4X4UA 5SZTA 4DBQA 1IBKF 3BR9A 2JVOA 2WVEA 4L3KA 2IC3B 4OJPA 2P6SA 3DLGA 1N6QA 3CNHA 4B9VA 2MKSA 5JTIA 1NHKL 2HHPA 4I67A 3NOCA 2DGZA 1VQ9S 4AFFA 4ZIWA 2ZHAA 4ZLPA 4ALZA 4DFMA 1ZXIA 8ICOA 1NSAA 4KV8A 5HLFB 1SV5B 4C2MA 1OY8A 2LMIA 2B5JA 4MIWA 4X64J 1J5EF 3D6FB 1EP4B 4FXVA 4CRXA 4JK1A 3BGOP 5D0RA 2OTJS 1EKSA 1SV4A 2MPUA 4ED0A 2ZHBA 3LWLA 2HAIA 4IYQA 4M5IA 1DAXA 4C98A 3POTA 4DUTA 2KE7A 5D15A 3DNCA 3MHYA 5BR8F 4JI5F 2ZTEA 2DT9A 3N9UC 2ZH9A 1OWXA 2KT3A 5FJ4A 4CDIA 1NDPA 1QAJA 3AAWB 1IBLJ 1WSVA 2ZFHA 1YIJS 1VBKA 3I31A 1N34F 2EBGA 4Y2VA 1NJYA 3HT3A 3NGSA 1RT6A 3KLEA 3ETMA 5JMNA 1JLBB 5HR6A 2CWXA 2J6TA 2J7UA 4DN0A 1KONA 2HVDA 2ZOFA 3RBXA 1CRXA 5TISU 1AT1B 1OY6A 1RT2B 3ENVA 5DBAA 2L9DA 1C4AA 2M3DA 1WC5A 3T9NA 2RQ4A 4ZK7M 4BJQA 2QZ8A 4HLBA 3M4XA 2HFVA 3C2KA 3BBBA 1WG8A 5GTIU 1SV0A 4PL2A 2BBEA 3ZFVA 5ALYA 2KXFA 4I64A 1X4CA 1VC6A 1YVFA 2NYIA 2Z4PA 1P27B 1Q46A 8ICXA 2Y3YA 1S6PB 1RT4B 2SXLA 2R7UA 5AICA 5J29A 2A1AA 3RJIA 3KTQA 2PDAA 4RWXA 1ELOA 4F4XA 4MYUA 1ZQ1C 1TVRB 2VG7A 4CH1A 3FEYB 1AFIA 1Y11A 1BPZA 4PG6A 1FWKA 1GXLA 4RO0A 4GRSA 4F4KA 4N56A 3WKDA 5HQMA 4TUQA 2GA7A 1IG6A 2R3VA 4F5OA 3DKDA 4UBCA 1XSNA 4ZVTB 4LRDA 4Y2YA 5DBBA 2KKPA 2AT1B 4P2FA 2E5LJ 1S4FA 3RAQA 1JJ4A 4I6AA 3IP0A 4IQXA 5BXIA 3I5CA 4HYKA 4QNLA 2OAUA 4LFBF 5BOLA 2WZ1A 4HDGA 3ED5A 2ZH5A 1ZAWA 3IG5A 4J9SA 1RT3B 2LYAA 2N3OA 1KDHA 2KMDA 3QU5A 3EX7B 2ASLA 5D49A 2VPXB 2BKOA 5ETMA 4PGYA 2OHFA 1NSKL 4PGXA 2EBEA 5CQGA 5KFWA 5F8IA 5CYQB 2E1RA 3K89A 3WC2A 2MLXA 4Q44A 3V4IB 3HD1A 3DLEA 5KAIU 4ZDNA 3G8QA 1RTHA 3D4JA 4DV1J 1BNOA 3KLIA 2EFOA 2HBKA 3RBDA 3TUPA 4UQGA 4NV0A 4FZVA 1HNWJ 2CPDA 3N0VA 3D2NA 4YD1A 2XG8A 3RB6A 3QJPA 2CVIA 4DV7F 2IAJA 2WSFC 5M2UA 2MZQA 2GIRA 1PC5A 1TKTB 2HBZB 3OXLA 5ETKA 2XO6A 4HH0A 3AN1A 1TK8A 5HMYA 1N36J 4DQQA 1JX4A 4DV4J 4USHA 3WKCA 1BE4A 4Y2KA 4WZQA 5K5MA 1URNA 4OO1J 2XB2D 3UNGC 2CUYA 3C16A 2BPFA 3GP9A 4WKYA 1HBOB 3P45B 3UW1A 2V4QA 2K1RB 3TX0A 4OYAA 1OMSA 5L9NA 3I87A 1QAIA 4KLTA 3H90A 2CPXA 1ZQCA 3IGVA 2K8CB 1RZMA 4RNNA 3OR2A 1R31A 1RA7A 2JFDA 2ZH8A 3C2LA 2LVWA 4DR4F 3P49B 1C1BB 2DCUB 8ICCA 1ZZNA 1XNQF 3SV3A 2XHCA 1RKIA 3RB0A 1NDKA 3CGIA 2W9CB 3U27A 3JTPA 4NXNF 3T5HA 5HQ8A 3RH5A 1FE0A 2E3TA 1U7LA 4M6WA 3BKFA 3MM6A 5C24B 2I9SA 4J9NA 9ATCB 4FO6A 2HS4A 3K58A 3Q83A 4DUYF 2FI1A 4QZVB 5LMNF 1W2IA 2AIRB 3TADC 2GHWA 2F3NA 3BV8A 4H54A 3D5MA 3MMJA 1SVDA 4FZMA 5ETVA 4M0AA 4NEZA 2COLA 2AU0A 2AW0A 1P7DA 5L38A 2ASJA 5KG0A 5CYMB 2YKPA 3HKZD 3RW7A 1LK5A 1F5SA 2IOFA 4K50A 4K4YA 1QQ7A 3ORYA 1S1UA 4HACB 2RDDA 3PMLA 3P3DA 5KFQA 4LIRA 1Z1BA 4I2FA 3M05A 4Y2JA 2DNMA 3W1YC 4OLPA 1VHIA 3V4MA 2ASYA 2BMBA 5JU5A 3W8PA 1EJ7L 1XSPA 2VZ9A 3I9V9 2Q0ZX 1YZ7A 2XLKA 2KK0A 5D77A 3A13A 2ESEA 2YWWA 2I0XA 5C5JA 1LWCA 2Q66A 5E3QA 4TLRA 3MCNA 2CFXA 3Q23A 3AB2B 2F44A 4LFCF 5B09A 3ZZUA 2UUAF 1TFWA 4RQ8A 1ZQAA 2CQDA 1NO8A 2GMHA 1KBUA 4RZRA 3KLGB 5D0GA 1REVB 3R5CA 2JR5A 2CXEA 2OM6A 1X2IA 5E7OB 8ICAA 2RRDA 1KS2A 4NWBA 1PAEX 1MN8A 1PG5B 3EXCX 3TOQA 3JQJA 3TZXA 1TV9A 5DG7A 2HSZA 5AKXA 1B43A 4C4WA 1FKOA 3ZDEA 1KBRA 2MSNA 1JUDA 3MWBA 4CTAA 5E41A 2O01C 4P0QB 3S01A 2D1CA 4X4VA 3MC1A 3MAHA 4FE3A 3OTOF 4USAA 4FF2A 4ZP8A 2O3DA 4RQMA 1X8DA 8ICWA 4IH6A 4NLYA 3V6KA 4OHVA 2YKOA 4F0HA 2NSBA 9ICUA 3VTIA 4ZVOB 2X7IA 1Q8IA 3UWTA 3MI7X 3DRSA 4JI3F 3NOGA 1XMOJ 2MQQA 3QUCA 8ICJA 5HHIA 2DNNA 4YFUA 2OD6A 4O44B 2ZJQQ 3ZZOA 3IR6B 2MLZA 2OTLS 3KUGA 4K4SA 3K8VA 2YVSA 3NEKA 5EN1A 1H2TZ 1WORA 2R2UA 2B43A 3MMBA 3DRYA 2CQ1A 1FX2A 2MHNA 1IWGA 3TWZA 1E6VB 5HJYA 1WHYA 1MROA 4WWSA 3TAQA 4DSIA 4M9JA 2CG8A 5KT7A 1Y3KA 2OD4A 4RUCA 1ZPWX 4ETXA 4DR2F 4J37A 1GO3F 2DKOB 2CQHA 3PEJA 3MR2A 3F0NA 4HHJA 3EYZA 1OSDA 3PM9A 2WCXA 1R0AA 4NLWA 1X6IA 1FNXH 4LFAJ 1JJ2R 4NL9A 5L8RC 3MEDA 2RDIA 1WKKA 3AFGA 2GIQA 2CZVC 1SKRA 4P2MA 1FFUA 5D3GB 1NJZA 2B9WA 3LAKA 3EVMA 4FVCA 3D1OA 2VICA 1TKZA 1XERA 2PSZA 4XDCA 2M70A 2PMZC 3GYXB 2G4BA 1BUXA 3CULA 3BEGB 3C15A 1TAQA 3ZDBA 4I6WA 3EM1A 5HMWA 4X5VA 3R8YA 1J27A 4G65A 1L7NA 3MDAA 4CO1A 2A2CA 2VG6B 1NOMA 1VLOA 5ALXA 4C8ZA 3N01A 1IKVA 3MR5A 2WB1D 3KJNB 4L76A 3I82A 5J2NB 1O51A 4V1Ak 2VPZB 4QR2A 2YQEA 4N8OA 2J6UA 1EARA 2X3DA 1R8CA 3LANA 5KFGA 4DV3F 2YWEA 2QARA 2KSOA 1MC8A 3C21A 4KJIA 4OZJA 4IG0B 2IOHA 5G5HA 4OZLA 1DGSA 4AXIA 3PY8A 5BYSA 2NLWA 3W9IA 3CJSA 2QB1A 7ICSA 2HHHJ 2FDRA 2B6GA 4UOGA 2ZE2B 2EKYA 1T3OA 5DB8A 3SCKE 1JLFA 4NA2A 1MW7A 2NRVA 3PMNA 4B9TA 3W2VA 4BLGA 5ETLA 4I27A 1L3TA 3KHLA 2K8BB 2B7BB 2G5IB 1RAAB 2QFIA 4P4OA 1N62A 4CLZA 1N5TA 2E8NA 1JWWA 4PQUB 1NKBA 4LF4F 2D8CA 3IR5B 2JEFA 5IQQA 2UXDF 4Z37A 2KXHA 2KJ5A 4DHVA 1PYTA 4LSLB 3AA8A 5IC4B 4K4XA 3DLJA 3CB4A 1N33J 4LBHA 3QEBZ 4UB4A 2MDAA 2N4DA 4DPWA 1B70B 1BPXA 2DKZA 3K0JA 5A8RA 4ICLA 1NK4A 2C2ZB 2DJWA 5HMZA 1VMBA 3DLLQ 3GFXA 3PX0A 2W8LA 2YQ3A 4RQ2A 2MKIA 2C3OA 2H9ZA 4IFYA 2F5GA 5J8YC 2GO7A 3I96A 4LF9J 1R6YA 1TR0A 3QRPA 3BZKA 3D6HB 3QU9A 4UB3A 4B3MJ 4PABA 2LQJA 4CM0A 1WKJA 1I51B 1OXJA 4L73A 3TFRA 3M2RB 3MTJA 4CLTA 2UXBJ 4TKTA 9ICOA 1UEVA 4DV6J 3CMES 2HKEA 5DB6A 1NNLA 2ZIWA 1IM4A 4BC9A 3QAUA 1YRTA 2IVMA 4EI2A 3BO2A 1S48A 2YBVA 2ZH4A 2XGQA 2LM1A 5K14B 5ETSA 5E3CA 5IV3A 1IBMF 3CCUS 4MIAA 4ILLA 3KZXA 4IR1A 4ERDA 8ICVA 1P9QC 3O5TB 2MA1A 2NO5A 4QPXA 1HNVA 3M1YA 3T19A 4OJ3A 1VIXA 1HD0A 2JLEA 2JMGA 5E3AA 1M5OC 5DQIA 1A6SA 5CHGA 1LWFB 1FJEB 2JZBA 4WXWA 1HR0J 3RRKA 1KWMA 1SKWA 3W65A 2IFXA 2GFFA 4ZIVA 4ED8A 1NAQA 4OZ0A 3GYNA 1S6QA 1Y5LB 2KJ8A 2X3GA 2RMLA 4KTQA 2B9YA 3VGSA 1FEZA 4AL5A 1OSCA 4RQNA 5HO4A 3U1LA 1K47A 3K5MA 1MWZA 3JB9k 2MJNA 2AF6A 5CEHA 1HNIB 2OPRA 4OI3A 2A10A
chains in the Genus database with same CATH topology
1YZ7A 3CW2C 1KL9A 2QN6B 1Q8KA 1Q46A 2QMUB 1YZ6A 2AHOB 3QSYB 3J81j 3AEVA 2A19A 2A1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZ7 A;  3CW2 C;  1KL9 A;  2QN6 B;  1Q8K A;  1Q46 A;  2QMU B;  1YZ6 A;  2AHO B;  3QSY B;  3J81 j;  3AEV A;  2A19 A;  2A1A A; 
#chains in the Genus database with same CATH topology
 2LKY A;  2FHJ A;  1O5J A;  3MUR P;  1UT8 A;  1WEX A;  2HGL A;  4U67 Q;  1R3N A;  1LFP A;  1S12 A;  4KO0 B;  4ZPW R;  2F1F A;  4YMM A;  2YMP A;  6AT1 B;  3QT5 A;  4YD2 A;  1DK2 A;  3V6D B;  1FDN A;  4V19 X;  5KFV A;  2OHD A;  3PST A;  2HYI B;  3A12 A;  2NRW A;  3Q89 A;  5ETQ A;  1YTY A;  4PCQ A;  5CH7 B;  2HWT A;  3HHE A;  4LF2 A;  1S0N A;  2QLT A;  3N97 B;  1BQX A;  1WOO A;  1FO1 A;  2CJA A;  4DR7 J;  4PPD A;  2L3M A;  3DHX A;  5DDP C;  2UUC J;  3IBW A;  4ZN3 A;  3H20 A;  2K4I A;  3GIK A;  1VRQ C;  4B3T F;  3OR1 B;  4IKA A;  4ES1 A;  4WU2 A;  5HP1 A;  1RGV A;  2FVP A;  2YY6 A;  1JLE A;  4W92 B;  1JMS A;  4IRK A;  5T7L A;  2UUB J;  2F8H A;  2E29 A;  2CQ3 A;  3CW2 C;  1VCT A;  4QWB A;  1VJW A;  1X7V A;  1S0M A;  2FUG 9;  3OTB A;  3WBZ A;  4NLU A;  4R8U A;  1L3S A;  2HHT A;  1Z2Z A;  2DPJ A;  4C4T A;  4DV5 J;  5IM0 A;  5E5N A;  4B3O B;  3UN3 A;  2KIW A;  2GGP A;  1U48 A;  3SMZ A;  3DFE A;  2QSF A;  1NJX A;  1SH3 A;  2DB1 A;  1Y88 A;  2WFA A;  3I1Y A;  1V97 A;  3MFI A;  2DBY A;  4PWW A;  5C25 B;  2VOP A;  2JFK A;  2DIT A;  1FJG J;  1QDU B;  1HIW A;  2OSR A;  4PZN A;  2OP5 A;  1XBW A;  1KKX A;  5AIA A;  2ZH3 A;  5D0E A;  1RAJ A;  3AJD A;  5AM5 A;  4F71 A;  4QZA A;  5F41 A;  1VC5 A;  3PSP A;  2V6A A;  9ICT A;  4CQ1 A;  1YJ7 A;  1JIH A;  1ZQF A;  1CBK A;  2PFD A;  2I5J A;  3PTW A;  5I3P A;  3MAQ A;  3J7Y I;  3S6E A;  2FGO A;  3MCS A;  4JP8 A;  4YEA A;  4QZE A;  2J76 E;  1KQQ A;  3CJ2 A;  2XCA A;  4ZP7 A;  2PI5 A;  4DCJ B;  2OEH A;  1YIT S;  5B0E A;  2B8P A;  1X5S A;  3H4B A;  3QNW B;  7ICL A;  4JI8 F;  3KFU F;  5LT5 A;  4OYB A;  5B0A A;  4JUZ A;  4MFB A;  3O1L A;  1TVA A;  2E44 A;  2KDO A;  1RBA A;  5EWG A;  1HW9 A;  4C80 A;  1KW4 A;  4C4S A;  4XPC A;  1UMJ A;  4C7Y A;  3FCH A;  1UVN A;  1VDH A;  2HQ3 A;  1K1S A;  3QXG A;  4RW9 B;  2DR6 A;  5EGY A;  4DQS A;  5SUH A;  2KVS A;  5CA5 A;  4KLM A;  1YDL A;  4CT9 A;  3G8T A;  4F92 B;  3SEI A;  2DGU A;  3IHQ B;  4AT1 B;  1WKL A;  1X5O A;  2FC9 A;  3GSI A;  4PHE A;  4LF7 F;  5ETO A;  2GO8 A;  2YWH A;  5IWA F;  8ICB A;  4A48 A;  2MRL A;  1LXJ A;  1JJH A;  4CLW A;  4G9B A;  1KVJ A;  3MPU B;  1LW0 A;  1ZQZ A;  3CD6 S;  1S79 A;  3JSY A;  3M2V A;  4EEK A;  3BPS P;  2FDN A;  3QZ7 A;  4S0M A;  2XWY A;  3BH7 B;  5J2M A;  2W2Q P;  3ZI4 A;  1X6J A;  1QY7 A;  2J0W A;  2GQ2 A;  5LXY A;  3KK2 A;  2EZX A;  1ZQK A;  3E01 B;  3VWS A;  4QIG A;  1LKY A;  1AUD A;  4WP3 A;  3BQ7 A;  2YKA A;  2VH7 A;  4NPO A;  5HVG A;  2P6R A;  1T3Q A;  3M8P A;  3W9J A;  3BQ2 A;  4Z7C A;  1MA7 A;  5BYR A;  4I68 A;  2ZBR A;  5KT5 A;  4PL1 A;  5AI4 A;  4RW8 A;  1RTD A;  2W3R A;  2ZIU B;  2O66 A;  2OPP A;  3BGF A;  1S72 S;  4M5K A;  4MK9 A;  1U0H B;  2VG5 A;  3OQ2 A;  2G07 A;  2HNZ B;  1TKD A;  1NEE A;  1LWX A;  2DNH A;  2W3S A;  1N61 A;  4Y2Q A;  4DL2 A;  5AE1 A;  2HK2 A;  3N5F A;  1VQP S;  2Y0B B;  3BZQ A;  4MIB A;  3Q8R B;  5GMK a;  2WOM B;  4PXD A;  3MEC A;  4U8Y A;  5AHX A;  1PVP A;  2BJ8 A;  2P2C B;  1VQ4 S;  2M2B A;  2E9R X;  5A8K B;  1KKH A;  2BRL A;  3EUN A;  2C2E A;  1TL7 B;  4DX6 A;  4NRU A;  4C8O A;  3R3T A;  3JPT A;  5DGA A;  2NXU A;  5LM7 E;  3F56 A;  1JLC B;  2DPI A;  3DYA A;  4I2G A;  4FVM A;  3ETO A;  2R8H A;  4X64 F;  4K4I A;  2YPY A;  4GKK J;  3S1T A;  1T7P A;  5KFI A;  4RW7 B;  3RUB L;  1PC4 A;  1DTT A;  2LKZ A;  4JYA J;  2ZOM A;  1AQ6 A;  3ISZ A;  3THT A;  4ZHR B;  2AJQ A;  1TVR A;  1TKX B;  3NGK A;  3RJJ A;  3HVR A;  3GII A;  3BQT A;  2V94 A;  4X2B A;  1HPZ A;  5HN0 A;  3UDV A;  4I2Q B;  1KTV A;  2IIH A;  5DG9 A;  2FE9 A;  3BPD A;  4YOE A;  2XI3 A;  3RB3 A;  1XSL A;  1T9Y A;  2R8J A;  2D3Z A;  1NPP A;  2NRE A;  5AM3 A;  3PHE A;  1HUZ A;  4BS2 A;  3GR0 A;  5L1K A;  4IRD A;  5KG4 A;  4FXW A;  1VQ5 S;  1UPH A;  1NZB A;  2BJD A;  1AXQ A;  2QB0 A;  4YR2 A;  5HAN A;  1RK8 A;  2DY1 A;  5HJX A;  1S1T B;  3LP0 B;  4ACO A;  4J9O A;  3AQP A;  2GHP A;  3DU6 A;  4R65 A;  1XR7 A;  1ZQW A;  4NYP A;  4B3R F;  1SH0 A;  4GVB B;  3QJL A;  1U1N A;  3IWX A;  1NM2 A;  1WF1 A;  4US9 A;  1S59 A;  4O0I A;  2RSQ A;  2UZA A;  3LO3 A;  4YXJ A;  2MQ8 A;  4O23 A;  2HVI A;  3MM9 A;  2V2Z A;  2V9K A;  3ILO A;  2NO4 A;  1XNS A;  4Y2U A;  2F4V F;  5K8N A;  3L7P A;  5HAT A;  3D6J A;  2E7V A;  1YK9 A;  4RKU C;  5L1M A;  1NK6 A;  5KOW A;  3LF0 A;  4ANE A;  3JAM Y;  2H65 B;  4O3P A;  2V34 A;  2J9E A;  5LJ5 Y;  4ED2 A;  2W9B B;  2RQ5 A;  2P8I A;  1RPL A;  3KG1 A;  5HMM A;  3FBE A;  4JI1 J;  3SCI E;  3TAR A;  1S49 A;  4F7V A;  2HBQ B;  3TA2 A;  3ZZZ A;  1Q86 T;  2N7C A;  1DGJ A;  3FSX A;  1RIS A;  4O3N A;  4WFB Q;  2E5L F;  1Q8K A;  1BC6 A;  1S1X A;  4RLE A;  1WCL A;  3PYG A;  5FDL B;  2YKN A;  1GFW B;  1BWE A;  3CO0 P;  1S9E B;  4YG2 A;  2RD5 C;  2V50 A;  2XZD B;  4R63 A;  3NP5 A;  3TJ8 A;  2IOF K;  2Y1R I;  5KAF U;  2RLT A;  5ALG A;  2XY7 A;  2WAQ C;  2HG4 A;  4KN4 A;  4I2E A;  1U24 A;  3W2W B;  1D8B A;  1Q82 T;  4WYL A;  2E9Z A;  3Q86 A;  3B0Y A;  1XMQ F;  3IC1 A;  1JLG B;  2K89 A;  2E1E A;  2V5H G;  5AI5 A;  3HF5 A;  1ZZF A;  1WC6 A;  3GFY A;  4PWU A;  1CC8 A;  1TK0 A;  2YX4 A;  4DV1 F;  2B3T B;  9ICR A;  2R2S A;  3KMQ A;  3KZI U;  1O0P A;  1N5Q A;  4P2X A;  1Y5N B;  2VPY B;  4M9L A;  1FFV A;  2RF2 B;  2RIJ A;  2NYV A;  4QIW D;  5CYM A;  1HWK A;  3S8S A;  8ICF A;  4ILR A;  3NRZ A;  2YNF B;  4YMN A;  1N36 F;  5B0F A;  3ILI A;  4DV4 F;  3AL0 B;  2YMQ A;  4QZB A;  1KEJ A;  3N79 A;  3ULH A;  7ICH A;  1NBE B;  1YI2 S;  3HFV A;  3UCU P;  2N3L A;  2HS0 A;  3FDS A;  4FZL A;  3QGP A;  4DPT A;  4LRE A;  1WEL A;  1FRI A;  4P7T A;  3BBF A;  4OI6 A;  1X4F A;  3AUO A;  3JPS A;  4Y2C A;  2V9W A;  1RTJ B;  4E8U A;  1HQU B;  2RAQ A;  2FZK B;  5I42 A;  2CPZ A;  3VC8 A;  3JYT B;  2AJF E;  1CSJ A;  5GAD U;  1HBM B;  2YQ1 A;  5KL1 B;  4O9M A;  1V9P A;  1PCA A;  2V4J A;  5DGB A;  3NAH A;  4NLK A;  4RW4 A;  3CNQ P;  5AKE A;  4RNM A;  1R8B A;  2QA4 G;  5KNI A;  1VRT A;  4IG3 A;  4UOF A;  1KNZ A;  2MJU A;  4MEY A;  5CWR A;  2Q43 A;  5IQ6 A;  8ICU A;  1BMQ B;  5IT4 A;  1QQ5 A;  2V8G A;  4PXE A;  3M8Q B;  3MEG B;  4NE9 C;  2ACY A;  1LWE B;  1RAB B;  3C14 B;  2WRM A;  4CLK A;  1BLU A;  4FKX A;  4ZMM A;  4LR8 A;  2W25 A;  3AOB A;  3PJW A;  3P96 A;  3CCL S;  1B0X A;  2RE1 A;  3IBC B;  4BC7 A;  3BKU A;  2JDJ A;  4DO9 A;  1KOO A;  3QO9 B;  2K4P A;  2JNJ A;  1ZM4 A;  4ZS6 A;  3O6Q A;  3OBI A;  5D4L A;  1RHM B;  1CS4 B;  3SZ2 A;  5H9E K;  3QZ8 A;  4UT4 A;  4LR7 A;  9ICH A;  2W7A A;  1U0S A;  3FBB A;  3ELH A;  3IAS 9;  3LGM A;  2RRB A;  3RH4 A;  2PGC A;  1HNZ J;  2KHD A;  4F5Q A;  2KG5 A;  1RWK B;  2Q6C A;  3C66 A;  3W5Z A;  1M1K T;  2EAN A;  1HWI A;  4KPY A;  1D8Z A;  1VLY A;  3UVJ A;  2VA8 A;  1IR2 A;  3OFF A;  2EQY A;  4EZ9 A;  1N8R T;  3W5X A;  5J1N A;  4H4K C;  3OHB A;  1BPB A;  2KG1 A;  3PRV A;  5I3U B;  2J0Q D;  2BCQ A;  4IDK A;  1N5Y B;  1GX5 A;  3HIL A;  7ICN A;  4UAU A;  1UWA A;  1LEO A;  1KQK A;  1TL4 A;  1KDN A;  2P9E A;  3GCW P;  3ONQ A;  4NLP A;  2ZUB A;  3KKF A;  1S7H A;  3NVV A;  4P2H A;  3EE3 A;  2XS2 A;  5DDR C;  2CNO B;  2CYY A;  3SI8 A;  1E6Y A;  5BOM A;  3V81 B;  2C2N A;  2WAQ F;  2UVV A;  2M9K A;  1D9F A;  3DHW C;  4TUR A;  3WK8 A;  1F2G A;  5C42 B;  1SJF A;  3HJF A;  4IUF A;  3VVU A;  2UV8 G;  1PK1 B;  3R7N B;  3QUQ A;  2BJ9 A;  5E2Q A;  2YNH A;  5CP2 A;  3B6B A;  1FD8 A;  3E58 A;  1U9L A;  4Y65 A;  1XMO F;  3PHT A;  1H38 A;  2VG6 A;  2I1R A;  2HNY B;  5HML A;  4TU7 A;  3SEN A;  5RUB A;  3GLJ A;  2R7W A;  3IS9 A;  7ICI A;  1WI8 A;  3L9Z A;  3GZ7 A;  4Y2X A;  5CZV A;  3Q8Q B;  1HW8 A;  4KGK A;  3M8R A;  1H2U X;  2RP5 A;  1YZ6 A;  1EKR A;  4W98 A;  2MUT B;  4HTJ A;  1ZH5 A;  2WVC A;  2EI5 A;  5ALS A;  1A76 A;  5ALN A;  4PAA A;  3UXN A;  1JNR B;  3WX8 A;  5MLC V;  3HWT A;  5HK4 A;  4GLX A;  3LAM A;  5CRX A;  2K7J A;  3MAA A;  3SFU A;  4LFA F;  2FY8 A;  2VBX A;  5IIN A;  3BGR B;  1RXO B;  1EQM A;  1S9G B;  1YGY A;  4F04 B;  3BS7 A;  3P5B P;  3BYR A;  4CI0 B;  5ALU A;  3RJE A;  3ENA A;  3TVK A;  2R8K A;  1DFD A;  5DET A;  1O6X A;  2NXJ A;  4J5O A;  3OUY B;  5KG7 A;  1SBR A;  5T41 A;  5H9E J;  4Y0F A;  2YNI A;  3A3O B;  3EDR B;  1T03 A;  3I0S B;  4UW9 A;  3H8Y A;  1WF2 A;  3H8S A;  4Y6I A;  2ZH1 A;  2ATC B;  4PWD B;  3ONN A;  1AZS B;  2DRB A;  3NVW A;  5KL8 B;  4UQT A;  1CC7 A;  2DO4 A;  3WK5 A;  3CCZ A;  2XY5 A;  3VCB A;  1RT1 A;  3PR4 A;  3ZTO A;  1KVI A;  2AZ1 A;  2BV3 A;  3PYD A;  3WK4 A;  3BQ0 A;  1PJ7 A;  1UET A;  2KTQ A;  3FC9 A;  1XWL A;  1OPI A;  1FHT A;  5E33 A;  2QL9 B;  3J80 U;  2MQO A;  1JLA A;  3I5B A;  2YWK A;  1YBA A;  1LB2 B;  2CQ2 A;  1B3T A;  1IJF B;  3R5A A;  1VLB A;  4ZVE A;  1L3U A;  5KAK A;  1WOS A;  1RQ0 A;  8ICI A;  3AT1 B;  2M8D B;  3UM9 A;  1M0S A;  4AP9 A;  3V5R A;  4DOB A;  1FK9 A;  2C3M A;  1DQA A;  4LIW A;  2LA6 A;  4H4O B;  4NXZ A;  3NXZ A;  4QOT A;  2K06 A;  2PO4 A;  3GFZ A;  4GC7 A;  2LLZ A;  1A9N B;  2F3J A;  3K17 A;  3HHD A;  2CKW A;  3PVX A;  1S5Z A;  3NNA A;  2YXL A;  2F1I A;  4WE1 B;  2HSE B;  2AKW B;  2CAD A;  4P73 A;  4I2H A;  2BCV A;  4EYH B;  1YSJ A;  2R2R A;  2D3O R;  1CUL B;  5J0X A;  3HT0 A;  3RF9 A;  4PG5 A;  4K2J A;  5A8W A;  1PBU A;  3DOM B;  3D67 A;  1X42 A;  2ZJR Q;  3D1H A;  3RYL A;  1GT8 A;  4N77 A;  3CC4 S;  2VFV A;  4J9M A;  3HFZ B;  3CE8 A;  2QN6 B;  3MF5 A;  9ICN A;  4KLU A;  2MZR A;  4RT3 A;  1WC1 A;  4RW6 B;  2B0C A;  4ZLL A;  1S77 D;  2IVF B;  2DQN B;  1XR5 A;  4M5J A;  1HLW A;  3EGV A;  3QYY A;  4ZVQ B;  5AKY A;  1RTZ A;  1SQG A;  1JKH A;  3CRX