2EDUA

Solution structure of rsgi ruh-070, a c-terminal domain of kinesin-like protein kif22 from human cdna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
98
structure length
98
Chain Sequence
GSSGSSGEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESFLKANILGLAAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-070, a C-terminal domain of kinesin-like protein KIF22 from human cDNA
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Kinesin-like protein KIF22
total genus 20
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12836 HHH_3 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2eduA01
2EDUA 2I5HA
chains in the Genus database with same CATH superfamily
5HMLA 9ICLA 2A1JB 5J2JA 2LKYA 4FBTA 2OXOA 3GV7B 1T7PA 2KICA 3GDXA 4CDGA 1NK5A 1XSLA 5ALXA 5AM3A 4I2BA 2K4IA 3TFRA 1QQ5A 1SKWA 4PZOA 3ISBA 4EENA 2ASDA 1L6NA 4ECRA 4F5RA 4B9TA 7ICQA 2BR0A 3PV8A 2OCEA 1TE2A 3LVWA 5ALWA 2JXJA 1X9MA 4PHAA 1J2NA 2RP5A 3IHQB 4NJ8A 4UB8U 3SAGA 3RRHA 2YN4A 1Z19A 1ZQQA 2ZJ5A 2J6SA 1SL1A 1FEZA 3WK7A 5KFMA 3OJSA 5L1KA 3KBBA 3RJJA 3A0HU 3L3FX 2BKEA 1MSWD 4OJPA 2BDPA 5HMMA 3PR4A 1XO0A 1DOQA 4JWMA 2KFZA 2E1EA 4KLGA 1N48A 5AM5A 3PW4A 3OGUA 2WF7A 7ICMA 4RUAA 3T5JA 5KFSA 4O5CA 5DB9A 1V38A 1DRGA 3RRGA 3ETLA 2FE9A 3IRUA 4B9LA 5BOLA 2M0NA 2HHUA 5ALTA 4QZAA 3QU9A 4MFCA 2DF4B 4P0QB 2KVCA 3PO5A 1TAUA 3RJEA 5G5GA 5IINA 4IS7A 1ED1A 3V6KA 1ZJNA 2JGAA 3FC4A 3H8SA 2PMZF 3NVVA 4J9MA 1JUDA 3IDWA 1BPBA 2F1JA 2K89A 4F72A 4UAYA 1KRPA 5KT3A 4Y2XA 2K4EA 4R64A 3DV9A 3PMNA 4YD1A 4DFMA 3H0LB 3PSFA 5KFKA 3AQEA 2IHNA 3UXOA 1Q8KA 1D8LA 3QUQA 2OYYA 3LYSA 4J9SA 2P6UA 3Q8MA 1NK4A 9ICHA 3SYZA 2AQ4A 3AL0B 3MR2A 4DWIA 5ALOA 1A76A 4BUGA 5DQGA 3WK9A 1X9XA 2G08A 5KFHA 4LZDA 4KTQA 1F0MA 4E0DA 8ICGA 5ALFA 1J97A 4KMUA 4C80A 2F1HA 2MUTB 2JZBB 3TKAA 1KFDA 4F5PA 3CRXA 3TARA 1U49A 2W9AA 4IR9A 4QWDA 2KSOA 2KN7A 2MSNA 4GXIA 4UB3A 2JHDA 5J2AA 1X9SA 1XU4A 1JRPA 5L9XA 4F50A 1ZJMA 1ZQRA 3SV4A 4P4MA 1L5UA 2PFQA 2NV3A 3EUB2 1KQQA 2D8CA 4UQGA 3ONNA 3RJKA 4IR1A 4IRKA 4BXOB 4DSLA 2FPKA 3QE9Y 4C8NA 5AI0A 3CYMA 2R8GA 1HEKA 4NLNA 2BPFA 4I2CA 9ICPA 5HR7A 2ODGA 2FI1A 1UT5A 2R8IA 1X9WA 2ZTEA 3KHHA 5KFUA 5K4LA 3PX0A 5J0UA 3BQTA 1RDFA 4Z6CA 5J2HA 2BZFA 3WK5A 4M2YA 3C2MA 4BGDA 4P0PA 2B6GA 3FDSA 1L7PA 5KG7A 4KLDA 1NJXA 5HR6A 4RT2A 5DKWA 2IOHA 5EE3A 3QU2A 4J9KA 3RJHA 2NRTA 1U9LA 3KD3A 2ZTCA 3HKZC 4LZGA 2GH1A 9ICQA 4M04A 4IRDA 1KFTA 4Y2JA 3F2CA 5CJ7A 5AKZA 2NO5A 4DCCA 4DLEA 1NKBA 4F2SA 2P35A 2KTQA 4NL9A 4FZLA 4J9LA 4F4ZA 5KFEA 3PSTA 4BDPA 8ICHA 2MRLA 2DUYA 2E8MA 4DEZA 2F2AB 4ELUA 5KFVA 5KL8B 5DG9A 2EZZA 2AHOB 2CXYA 4C4SA 4ICAA 1ZQJA 3M8RA 2BHNA 1HUOA 3PW0A 2N1RA 1RQLA 2MAXA 3PW7A 5J29A 3OHBA 4YXMA 9ICOA 1NKCA 4M47A 1KN5A 1UQVA 4I2HA 5CRXA 2XY5A 2W9BA 4KLOA 1JI7A 2IA6A 1RYRA 4QZDA 1JROA 1SXDA 3B9JA 4A8EA 2ES6A 2B0CA 2EAMA 5KFPA 3ED5A 2DBYA 4PGQA 3OJUA 4I2JA 2GOLA 3DDHA 5KNIA 4LJXA 2LPEA 4C7YA 5D46A 3UQ0A 4X5VA 3SENA 1T4GA 3RAQA 2F3NA 3ALRA 5GTIU 4I2IA 3QX7A 5KG6A 3LWLA 1TAQA 5TISU 2V9WA 4Y2TA 1SWWA 4UBBA 9ICKA 2HDOA 3AU2A 4DL4A 2VA8A 3AM9A 4ED7A 4EEYA 2PFNA 2HBJA 4YXJA 1PVRA 4K4HA 4YMOA 3BS5A 4YMMA 5AK6A 4KN7A 2HW3A 1KW4A 2DPJA 5KFGA 1QQ6A 3IN5A 4PPXA 4KX5A 1LVHA 4YVZA 3V72A 4QZEA 4QWCA 3KHRA 2FLNA 4O3PA 4Y2VA 1BPYA 1RYUA 4FO6A 1KFSA 1NK7A 2W54A 1N5XA 2WF5A 4O3OA 8ICAA 4I2DA 1X42A 2XCPA 2ASLA 3RBDA 3TANA 4UB5A 3H0MB 3H4DA 2EAPA 1JXEA 3TADC 3RB6A 1SB3C 4RQ4A 1OUQA 1NZBA 4B6JA 4PL2A 4RUCA 1JX4A 1D9DA 4DQQA 7ICNA 4DOAA 1S77D 1NI3A 8ICEA 5AKEA 1PUZA 3KTQA 2E5SA 5J0SA 4KX3A 1SKRA 1IG6A 2KK0A 4OJOA 4Y2QA 3LK9A 1ZQMA 4NM1A 2ZUBA 1ZQPA 3A0BU 4MHVA 2LYAA 1SL2A 4JB3A 2O6KA 3Q8RB 5IIKA 2OEHA 2Y9UA 1N56A 1K5OA 4F71A 5AI8A 2XIDA 5AKKA 3ICXA 3HX0A 2G5IB 3QUTA 1N5WA 3OSNA 1S10A 2ZG6A 1HIWA 3RR7A 1XNSA 4O3RA 1RQNA 2FJ6A 3D2SA 2W9BB 2UVRA 1X2IA 4MEYA 2VJ5A 2ZXHA 3FM9A 3PW5A 2F1IA 4JV1A 2E1FA 1K1QA 4TUSA 8ICLA 2BPCA 2QB0A 5B5EU 4DSEA 2V4QA 4QZHA 3GFKB 4DLGA 1YZ6A 2PKEA 2C28A 4RQMA 3HPOA 4J9OA 4JWNA 2RQ5A 1TV9A 1SV4A 4ECWA 8ICZA 3C2KA 1ZQTA 4M0AA 5ALEA 2JV3A 2LYBA 2WF9A 3PR5B 2DFLA 4EEKA 8ICFA 1YT3A 2D3DA 1Z4OA 1X6JA 4C8MA 3MBYA 3KKAC 3M9NB 1OW5A 2J6TA 4CNQA 1RM6C 1BNOA 4I2EA 4QW8A 1S0OA 4I29A 3KHGA 4C7ZA 5AIBA 2F76X 4NWIA 3WKAA 2LM4A 5J0OA 1QLNA 4Y2SA 3EWAA 2BCRA 3NRWA 4ECUA 1NJZA 4RPYA 2V4RA 2XI9A 2KKPA 5DBCA 2HHVA 1ZQWA 1TAMA 3UMGA 7ICRA 1QSYA 5JUMA 2A1JA 3N7PD 1Z1BA 5KT6A 1SZPA 5AKYA 1ZQLA 2HBMA 4F4XA 1ZQDA 2WB1C 2OHFA 3T79A 2XY7A 1FIQA 4GIBA 1F5SA 4FZNA 4DSIA 3UM9A 4RQ6A 4F91B 2AGOA 1L8OA 4QZIA 5KFYA 3MR3A 2PXIA 5CEHA 1SGGA 3WK6A 5IIOA 3MGVA 2F8KA 2ZJ8A 1S5LU 4ED6A 2RLTA 1DXSA 2HBLA 3OHAA 3ORYA 1XSNA 9ICRA 5GTHU 2HHQA 1JXLA 2PI4A 4ZOHC 4RNMA 3NASA 5KFZA 4FS2A 2ZIWA 4NLKA 2VA2A 8ICPA 1LKYA 4I27A 1U47A 3T5LA 2YB1A 2JEGA 4Q43A 4YR3A 4EBEA 4IQWA 1V9PA 4ECQA 5TZVA 3PY8A 4OJ5A 4OD0A 4GXJA 4OJLA 2FDRA 2YMQA 3RB0A 1Q3UA 5AKIA 1SV0A 2YMPA 5HHHA 1ZQBA 1Z00A 4CF4A 1COKA 3T3FA 2UVVA 2IOFK 4M9JA 5DB7A 2KIWA 2HHSA 1NK6A 5KAFU 4PGXA 1L3VA 4U7CA 1L7OA 3MGHA 2J6UA 4DL6A 4J9NA 3C29A 4QZ9A 1ZQUA 5ALRA 4YQWA 2LYHA 1HUZA 4Z6EA 1BVSA 1ZQFA 3PO4A 1KL9A 1UCVA 1UT8A 2VKQA 3SEIA 5KT2A 9ICEA 3MFIA 3V7LA 4NY8A 1MN8A 4JMUA 1IM4A 4EZ9A 5AKLA 2JH7A 3BQ7A 1SZHA 3EZ5A 5J0TA 4P0QA 2E8NA 4NLCA 4DOCA 4QWBA 3PVXA 3AU6A 2GWSA 2BGWA 1T8EA 3C5GA 2ZTDA 4R8UB 3Q8LA 4J9RA 2YX8A 3LDAA 4FFDA 2YMMA 3RH6A 5DGBA 4KLHA 3NVWA 5DGAA 3Q8PB 1WYGA 5KFAA 2WB1F 1ZQAA 7ICKA 4B9SA 2BCUA 3EPGA 4I2GA 8ICOA 2C2EA 2KP7A 2XGQA 3L5KA 3L4PA 1L8LA 2KFNA 5AKHA 4KLEA 2M9NA 3QYPA 3M9OB 4O9MA 4KLMA 5AI6A 2BQUA 2ZIUA 2ZIXB 5HP4A 3TI0A 3GV5B 1LKYB 5ALZA 4U6PA 5JRTA 4IL6U 9ICCA 5J2BA 3ISCA 5F9NA 3HKZF 3H40A 2EZXA 3JPRA 4F93B 4QZFA 3CW2C 4UAZA 3NVYA 3GILA 2FMPA 5DDMA 4TUQA 4IQVA 1ZQHA 1N61A 4EX7A 1DK2A 2MA1A 8ICXA 1J2MA 3IG8A 2K8BB 2NRXA 2KOBA 4O3NA 2E8OA 1WUDA 4AYBC 2W9MA 4K4IA 4OCZA 1RPLA 4IRCA 5AHXA 4UATA 5ALNA 1NK8A 5B66U 4ED1A 4GC7A 4LVSA 5T14A 1ZD4A 2JEJA 5JU5A 5KFDA 2AGQA 2KHQA 4DF8A 5KFCA 2LM1A 1N62A 2E3TA 9ICIA 2YB4A 2CN1A 4MF2A 4F4YA 3K1ZA 3E58A 4DSKA 4FBUA 5DLFA 4YN4A 5J0PA 2OWOA 3TACB 4UB6U 2A19A 2Q4TA 2HHWA 2QKQA 4FE3A 4F5OA 5J8YC 4YR2A 4XUSA 4USAA 3PMLA 4M9LA 2HOIA 1O08A 4F5NA 4Y2PA 3AQFA 1AQ6A 4NL9C 3WK8A 3MR6A 3BQ1A 4KLQA 1QTMA 1SV0C 2DQNB 2DGZA 3RH4A 2ASJA 2K60A 2W11A 4KLSA 4FS1A 4Q8FA 3CP8A 4DL2A 4DFKA 5KG3A 3KZXA 1ZYQA 3NRZA 1A0PA 1M6YA 4IC9A 2VANA 1XO1A 3RR8A 3KKAA 2HHTA 5EWGA 4K4GA 4O5EA 4C4RA 4B9VA 5J2IA 4C4TA 4I2AA 1XWLA 5CB1A 4ELVA 3GIJA 3F2DA 4DQRA 2WF6A 2BDUA 4HYKA 2BCSA 1KBUA 4I2FA 4RQ1A 4Z6FA 4PL1A 5EE0A 3PX4A 2W43A 5J2DA 3NS1A 2Y0SC 4QZBA 1XSPA 4QWAA 4JV0A 2FPLA 5KFBA 1C7YA 3RB3A 3VC8A 4QWEA 5J0RA 1RXWA 2W55A 4F8RA 1TK0A 1FFVA 4UBCA 5KAIU 7ICUA 4BWMA 4PHPA 4DF4A 4KLIA 4PH5A 5J2FA 4J9PA 2P66A 4Q45A 4B9UA 3WKCA 1ZOLA 3H8WA 4DL3A 5CA7A 9ICGA 1PVQA 2GO7A 4Y2UA 3BDPA 4XQ8A 2FLLA 5KG5A 2W04A 3QEBZ 2C2RA 1KDHA 3C28A 2QARA 2UVUA 3M6ZA 5J0QA 4KLLA 3KHLA 4QZ8A 4RZRA 4PJ0U 2R8HA 3AMZA 3Q8SB 5F3XB 5AM2A 5BPCA 1T3NA 1ECWA 4I28A 1S0VA 5KFTA 2G5HB 1CI4A 3BS7A 2PFPA 1H38A 4KITB 4UAVA 3NVZA 1X66A 3TADA 4DS5A 1RYSA 5DQHA 4CE6A 1KSPA 2HVIA 3H4BA 1SL0A 1S8OA 2VIXA 3O0FA 3H7IA 3N4MB 3NTUA 2JEIA 3C2LA 1MQ3A 2KHVA 3ISDA 3SV3A 3EPIA 5DLGA 1MA7A 3T5HA 9ICJA 5DQIA 8ICBA 4NLZA 3HP6A 4TURA 2WF8A 3T5KA 4PHDA 8ICIA 1JALA 5AK5A 5F9LA 4UB1A 2HI0A 2C2DA 1NK0A 1L3UA 3UMBA 4F2RA 8ICNA 3R9KA 4DO9A 1TK5A 1VLBA 7ICLA 3DEEA 1COOA 5CP2A 5ALIA 5KG4A 1N60A 1D8BA 1WCNA 4C8OA 1D8YA 2ZIVA 5ALGA 1V97A 5ALPA 2G09A 1QSSA 2LHTA 7ICVA 5KFJA 1HJPA 5ALMA 1RXVA 2XC9A 5DB6A 3M1YA 2EQYA 2ZUDA 3SZ2A 1FFUA 3B0XA 5AM1A 1URJA 2IBKA 3Q8QB 5EE1A 4XA5A 2ISPA 8ICWA 1BNPA 3NUQA 1ZRMA 1ZQXA 7ICTA 9ICWA 4O3SA 5ALUA 2IOFA 1KTQA 7ICPA 3ZDBA 2NRVA 4M9HA 3G6VA 4KN4A 2K8CB 1U4BA 2JH1A 3WU2U 4MFFA 2H3VA 2W9CA 2P6RA 4BX9C 4NLBA 5ALYA 5EWFA 4IQUA 4Y2YA 4JV2A 8ICQA 3S6JA 7ICFA 5KG1A 3UQ2A 2W7PA 5L1IA 1ZQIA 3JPPA 9ICTA 3N28A 1S97A 5KTQA 5C0YA 4R63A 2NRWA 1L7NA 3AEVA 3OTQA 3NGDA 3GIIA 3HILA 4YFKA 8ICVA 5J0XA 3UPQA 1PK3A 5KFQA 3V7JA 4O5KA 1ZD5A 1O03A 2G06A 4RQ8A 2WTFA 3QXGA 5CHGA 2XO7A 3I28A 1XS9D 2JEFA 1Z1VA 3H0RB 2ZUCA 3HJEA 4ECTA 2Y9TA 1X40A 3QUBA 2C22A 3GU3A 2XCAA 4R65A 3GIKA 2KE7A 4US9A 1ZXIA 4UW9A 2W03A 1ZQCA 1IV8A 1LV5A 3G6XA 2YTUA 1P7DA 1NK9A 2R8JA 1JN3A 8ICYA 2RHFA 5ALQA 1IXRA 5KG2A 1C20A 2KD1A 2K4PA 5EOZA 3KOOA 5AI4A 2WAQC 4BWJA 4EZ6A 2HOFA 4BJQA 3TFSA 3RH5A 1ZD3A 2KV2A 5C5JA 5J2CA 1T94A 1PVPA 3LWMA 4UB2A 2F8LA 5HHIA 4NM2A 5BOMA 1PZNA 4ECYA 3N7RC 4QNLA 3SQIA 4RQ5A 3ZDAA 3TQ1A 3N97B 1Z00B 1SXEA 4UB4A 3FAHA 1NOMA 5L1MA 2KVSA 3RJIA 3GZFA 2AXTU 5G5HA 4RQ0A 4DS4A 4B9MA 4F4WA 2KJ5A 2JZBA 4Q44A 1SWVA 4RQ2A 1NJYA 1BPXA 2I9GA 3OPXA 1DGJA 5ALSA 5AM4A 1ZQVA 4MF8A 4NV0A 4C8LA 2WAQF 2BQRA 1TFRA 2R18A 1WWUA 3SI8A 2WHEA 4PHEA 2ZIVB 2OH2A 3THVA 1A6SA 2LI6A 4DQPA 1S0NA 3UXPA 4R66A 1N2XA 2HOQA 1NNLA 3ZI4A 1IIPA 2ESEA 4UASA 3ZD8A 4M6WA 1Q3VA 1BPEA 9ICVA 2VA3A 4YR0A 2QB1A 2NYVA 3MGIA 2AQ0A 2DKXA 1KKXA 2KMDA 1Z4NA 2XGPA 2ZIWB 3UMCA 3RAXA 4GLXA 3SD7A 8ICMA 3AUOA 4YD2A 7ICJA 3WKEA 4ECSA 3WK4A 2ZXIA 4QIWC 2H3ZA 1Q46A 4DQSA 1MQ2A 1ZQEA 3D2NA 1UHUA 2GLEA 1ZETA 5KT7A 5DDYA 9ICBA 1ZRNA 3C1YA 4US8A 4CGZA 1SKSA 5EWEA 1YZ7A 3BS5B 3RBEA 3QU4A 5KT4A 1U45A 3ETRA 3QUCA 4CF5A 5KFWA 4XRHA 5IIJA 1CEZA 5KG0A 2HHXA 5J0YA 3JPOA 1QH9A 3JPQA 5CR0A 1VJ5A 4CRXA 3MDCA 4ACOA 1S9FA 1WCLA 4TQSA 1X6IA 3IM1A 1BPZA 4F5QA 2ATLA 2W7OA 4JK1A 2IHMA 5AI9A 5EE9A 4RQ3A 1F44A 3K1RB 5DBAA 5D4BA 3WKDA 4AP9A 2BCVA 2W9CB 2BQ3A 4DOBA 4GC6A 3PW2A 1ZQ1C 3H8JA 1RZTA 2BCQA 3D2QA 5AI5A 3BJYA 4F4KA 2K8AA 2FPMA 3ZDCA 3QU5A 3F5EA 3G6YA 3KZIU 4BXOA 5IIIA 3MFHA 1DK3A 3BQ2A 2Q0ZX 1L7MA 2KIVA 3PSPA 4F3OA 1S0MA 2DWQA 9ICSA 1MC8A 2QLTA 4RPXA 9ICMA 3HRDD 2H5XA 2KSOB 3IG5A 2DL0A 5DG7A 3M9MB 3SR6A 2W8LA 3HW8A 7ICGA 1NKEA 2E8PA 5DG8A 1ZQGA 3PNCA 3M8SA 1D9FA 1AROP 4G3IA 4YMNA 1CRXA 4KLFA 2EZYA 4G9BA 2KZMA 3KFUF 5D49A 5HNKA 1B4FA 5IIMA 5IILA 2R8KA 2EDUA 4M6WB 5E79U 2ISOA 4ECXA 1NZPA 1Z3EB 3MR5A 1L3TA 3RJGA 4QZGA 4ED2A 2PI5A 5DBBA 2H3QA 1L3SA 9ICFA 1RG6A 5AKXA 2KJ9A 4DSJA 5ALVA 4DL7A 2JR5A 3PZPA 1UA0A 1S76D 9ICNA 8ICTA 3E0FA 1BGXT 3HT3A 1ZQYA 4RQ7A 3F53A 4F92B 2KEYA 4PZNA 1KEJA 2HBKA 3LVVA 3VCBA 3K4GA 5H2FU 3J81j 4IQTA 4YG2A 2F44A 2ALZA 3K75D 3CNHA 5ALJA 7ICSA 4J03A 4O3QA 1UPHA 1QQ7A 5A0LA 4EYIB 2UVWA 1ZQKA 2KZ3A 5CWRA 4C8KA 5AIAA 2ZIXA 3N7SC 3WKBA 1U48A 2W8KA 3QEAZ 8ICCA 1K1SA 3RJFA 2XVTA 5DB8A 3RFAA 3B0YA 4QZCA 1V85A 4Y2RA 4QJFB 2Y0SF 3E2EA 1TKDA 1BPDA 4J9QA 2L5YA 5KFNA 2DPIA 7ICOA 1ZD2P 2AU0A 5AK4A 3JPTA 1ZQZA 2VJ4A 4UARA 3F2BA 3JPNA 3PX6A 1SIJA 3TAPA 2YY6A 4OJ6A 4CF3A 2ZJAA 4DFJA 4O3MA 3I76A 4KLJA 5AKGA 3I1YA 4P0PB 2IMWP 1GO3F 4DQIA 5FP0A 4KMOB 3QNMA 8ICRA 2KJ8A 5AKJA 2PMZC 4JUZA 5L1JA 1LB2B 2AGPA 1TK8A 4QIWF 1NJWA 8ICUA 2MU2A 1WWVA 1XC9A 2OM6A 3C21A 4GXKA 1B0XA 2NO4A 2A3VA 7ICEA 5L1LA 4OO1J 5AM0A 2W3RA 2QB0B 3UXNA 4B9NA 2HSZA 2HVHA 2AH5A 4ED0A 4ECZA 4PGYA 2F77X 4UAUA 3SAHA 1KLNA 5J2EA 3C5FA 1PK1B 1OXJA 2B21A 2KG5A 1CUKA 4WJ3B 8ICJA 1B43A 5KFXA 9ICXA 4DFPA 4GFJA 1N63A 4M9GA 2QARB 2BPGA 3QZ8A 1QCKA 4M9NA 2CRXA 2EAOA 8ICSA 1PK1A 3EW9A 1DGSA 3RB4A 3OSPA 3ZDDA 3Q8KA 4KLUA 4Q8EA 4DFDA 2Y1JA 5ALLA 4EBCA 2HCFA 1QSLA 4AYBF 3H8MA 4NXZA 5J0WA 1T3QA 3ZDEA 3C1ZA 2WFAA 3BQ0A 2G0AA 3RTVA 5ALHA 3RF9A 2XICA 3GIMA 3HWTA 2JRZA 3SAFA 4P2HA 3SMVA 3M6KA 5JTIA 2EANA 2KNJA 3V6JA 4EELA 2W3SA 5AK3A 4ED3A 2LMRA 2PFOA 4RPZA 3EYZA 4HAIA 2CPRA 3U26A 3MC1A 5AICA 4NLGA 5KFIA 5J2KA 4TUPA 3C23A 3F5AA 1TVAA 4MEXA 3GV8B 8ICKA 4RT3A 2MUTA 3V6HA 2JMGA 3IV6A 2I6XA 2RDIA 3MDAA 1WG8A 2YMLA 2HMXA 1UA1A 5ALKA 2RDJA 2EH9A 7ICIA 4P4OA 2XY6A 4YP3A 4EBDA 3D6JA 3TAQA 2DKZA 4O0IA 2A1AA 5ALDA 3JPSA 1B22A 4UAWA 4ZH4A 4ED8A 4EYHB 2RRDA 5KFRA 2K4HA 3FYHA 2D6FC 7ICHA 3MABA 1ZQOA 2FLPA 1EXNA 1FO4A 4RNNA 2FMSA 4ELTA 5KL1B 2AJQA 2KKVA 4KLTA 1A77A 1JIHA 4C0ZA 2I1QA 4QW9A 2Z7JA 3PSIA 1ZQNA 2H3FA 4DSFA 2I5HA 4FZMA 4P4PA 4RQNA 4R8UA 1VDVA 3ZD9A 4EX6A 4ECVA 3AN1A 4CCHA 1ZQSA 2KZZA 5KFLA 4RNOA 4MFAA 2ZIUB 2G07A 3BZKA 4RU9A 3IP4B 3QU7A 5KFOA 2H3IA 3BZCA 1Y88A 2NRZA 4Z6DA 5J2GA 4YCXA 9ICAA 2LBOA 3GQCA 2Y1IA 4TQRA 3QZ7A 2YQEA 5KT5A 2FMQA 5KFFA 3V7KA 5J8YA 3M7DA 4DL5A 9ICUA 1JMSA
chains in the Genus database with same CATH topology
2EDUA 2I5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EDU A;  2I5H A; 
#chains in the Genus database with same CATH topology
 5HML A;  9ICL A;  2A1J B;  5J2J A;  2LKY A;  4FBT A;  2OXO A;  3GV7 B;  1T7P A;  2KIC A;  3GDX A;  4CDG A;  1NK5 A;  1XSL A;  5ALX A;  5AM3 A;  4I2B A;  2K4I A;  3TFR A;  1QQ5 A;  1SKW A;  4PZO A;  3ISB A;  4EEN A;  2ASD A;  1L6N A;  4ECR A;  4F5R A;  4B9T A;  7ICQ A;  2BR0 A;  3PV8 A;  2OCE A;  1TE2 A;  3LVW A;  5ALW A;  2JXJ A;  1X9M A;  4PHA A;  1J2N A;  2RP5 A;  3IHQ B;  4NJ8 A;  4UB8 U;  3SAG A;  3RRH A;  2YN4 A;  1Z19 A;  1ZQQ A;  2ZJ5 A;  2J6S A;  1SL1 A;  1FEZ A;  3WK7 A;  5KFM A;  3OJS A;  5L1K A;  3KBB A;  3RJJ A;  3A0H U;  3L3F X;  2BKE A;  1MSW D;  4OJP A;  2BDP A;  5HMM A;  3PR4 A;  1XO0 A;  1DOQ A;  4JWM A;  2KFZ A;  2E1E A;  4KLG A;  1N48 A;  5AM5 A;  3PW4 A;  3OGU A;  2WF7 A;  7ICM A;  4RUA A;  3T5J A;  5KFS A;  4O5C A;  5DB9 A;  1V38 A;  1DRG A;  3RRG A;  3ETL A;  2FE9 A;  3IRU A;  4B9L A;  5BOL A;  2M0N A;  2HHU A;  5ALT A;  4QZA A;  3QU9 A;  4MFC A;  2DF4 B;  4P0Q B;  2KVC A;  3PO5 A;  1TAU A;  3RJE A;  5G5G A;  5IIN A;  4IS7 A;  1ED1 A;  3V6K A;  1ZJN A;  2JGA A;  3FC4 A;  3H8S A;  2PMZ F;  3NVV A;  4J9M A;  1JUD A;  3IDW A;  1BPB A;  2F1J A;  2K89 A;  4F72 A;  4UAY A;  1KRP A;  5KT3 A;  4Y2X A;  2K4E A;  4R64 A;  3DV9 A;  3PMN A;  4YD1 A;  4DFM A;  3H0L B;  3PSF A;  5KFK A;  3AQE A;  2IHN A;  3UXO A;  1Q8K A;  1D8L A;  3QUQ A;  2OYY A;  3LYS A;  4J9S A;  2P6U A;  3Q8M A;  1NK4 A;  9ICH A;  3SYZ A;  2AQ4 A;  3AL0 B;  3MR2 A;  4DWI A;  5ALO A;  1A76 A;  4BUG A;  5DQG A;  3WK9 A;  1X9X A;  2G08 A;  5KFH A;  4LZD A;  4KTQ A;  1F0M A;  4E0D A;  8ICG A;  5ALF A;  1J97 A;  4KMU A;  4C80 A;  2F1H A;  2MUT B;  2JZB B;  3TKA A;  1KFD A;  4F5P A;  3CRX A;  3TAR A;  1U49 A;  2W9A A;  4IR9 A;  4QWD A;  2KSO A;  2KN7 A;  2MSN A;  4GXI A;  4UB3 A;  2JHD A;  5J2A A;  1X9S A;  1XU4 A;  1JRP A;  5L9X A;  4F50 A;  1ZJM A;  1ZQR A;  3SV4 A;  4P4M A;  1L5U A;  2PFQ A;  2NV3 A;  3EUB 2;  1KQQ A;  2D8C A;  4UQG A;  3ONN A;  3RJK A;  4IR1 A;  4IRK A;  4BXO B;  4DSL A;  2FPK A;  3QE9 Y;  4C8N A;  5AI0 A;  3CYM A;  2R8G A;  1HEK A;  4NLN A;  2BPF A;  4I2C A;  9ICP A;  5HR7 A;  2ODG A;  2FI1 A;  1UT5 A;  2R8I A;  1X9W A;  2ZTE A;  3KHH A;  5KFU A;  5K4L A;  3PX0 A;  5J0U A;  3BQT A;  1RDF A;  4Z6C A;  5J2H A;  2BZF A;  3WK5 A;  4M2Y A;  3C2M A;  4BGD A;  4P0P A;  2B6G A;  3FDS A;  1L7P A;  5KG7 A;  4KLD A;  1NJX A;  5HR6 A;  4RT2 A;  5DKW A;  2IOH A;  5EE3 A;  3QU2 A;  4J9K A;  3RJH A;  2NRT A;  1U9L A;  3KD3 A;  2ZTC A;  3HKZ C;  4LZG A;  2GH1 A;  9ICQ A;  4M04 A;  4IRD A;  1KFT A;  4Y2J A;  3F2C A;  5CJ7 A;  5AKZ A;  2NO5 A;  4DCC A;  4DLE A;  1NKB A;  4F2S A;  2P35 A;  2KTQ A;  4NL9 A;  4FZL A;  4J9L A;  4F4Z A;  5KFE A;  3PST A;  4BDP A;  8ICH A;  2MRL A;  2DUY A;  2E8M A;  4DEZ A;  2F2A B;  4ELU A;  5KFV A;  5KL8 B;  5DG9 A;  2EZZ A;  2AHO B;  2CXY A;  4C4S A;  4ICA A;  1ZQJ A;  3M8R A;  2BHN A;  1HUO A;  3PW0 A;  2N1R A;  1RQL A;  2MAX A;  3PW7 A;  5J29 A;  3OHB A;  4YXM A;  9ICO A;  1NKC A;  4M47 A;  1KN5 A;  1UQV A;  4I2H A;  5CRX A;  2XY5 A;  2W9B A;  4KLO A;  1JI7 A;  2IA6 A;  1RYR A;  4QZD A;  1JRO A;  1SXD A;  3B9J A;  4A8E A;  2ES6 A;  2B0C A;  2EAM A;  5KFP A;  3ED5 A;  2DBY A;  4PGQ A;  3OJU A;  4I2J A;  2GOL A;  3DDH A;  5KNI A;  4LJX A;  2LPE A;  4C7Y A;  5D46 A;  3UQ0 A;  4X5V A;  3SEN A;  1T4G A;  3RAQ A;  2F3N A;  3ALR A;  5GTI U;  4I2I A;  3QX7 A;  5KG6 A;  3LWL A;  1TAQ A;  5TIS U;  2V9W A;  4Y2T A;  1SWW A;  4UBB A;  9ICK A;  2HDO A;  3AU2 A;  4DL4 A;  2VA8 A;  3AM9 A;  4ED7 A;  4EEY A;  2PFN A;  2HBJ A;  4YXJ A;  1PVR A;  4K4H A;  4YMO A;  3BS5 A;  4YMM A;  5AK6 A;  4KN7 A;  2HW3 A;  1KW4 A;  2DPJ A;  5KFG A;  1QQ6 A;  3IN5 A;  4PPX A;  4KX5 A;  1LVH A;  4YVZ A;  3V72 A;  4QZE A;  4QWC A;  3KHR A;  2FLN A;  4O3P A;  4Y2V A;  1BPY A;  1RYU A;  4FO6 A;  1KFS A;  1NK7 A;  2W54 A;  1N5X A;  2WF5 A;  4O3O A;  8ICA A;  4I2D A;  1X42 A;  2XCP A;  2ASL A;  3RBD A;  3TAN A;  4UB5 A;  3H0M B;  3H4D A;  2EAP A;  1JXE A;  3TAD C;  3RB6 A;  1SB3 C;  4RQ4 A;  1OUQ A;  1NZB A;  4B6J A;  4PL2 A;  4RUC A;  1JX4 A;  1D9D A;  4DQQ A;  7ICN A;  4DOA A;  1S77 D;  1NI3 A;  8ICE A;  5AKE A;  1PUZ A;  3KTQ A;  2E5S A;  5J0S A;  4KX3 A;  1SKR A;  1IG6 A;  2KK0 A;  4OJO A;  4Y2Q A;  3LK9 A;  1ZQM A;  4NM1 A;  2ZUB A;  1ZQP A;  3A0B U;  4MHV A;  2LYA A;  1SL2 A;  4JB3 A;  2O6K A;  3Q8R B;  5IIK A;  2OEH A;  2Y9U A;  1N56 A;  1K5O A;  4F71 A;  5AI8 A;  2XID A;  5AKK A;  3ICX A;  3HX0 A;  2G5I B;  3QUT A;  1N5W A;  3OSN A;  1S10 A;  2ZG6 A;  1HIW A;  3RR7 A;  1XNS A;  4O3R A;  1RQN A;  2FJ6 A;  3D2S A;  2W9B B;  2UVR A;  1X2I A;  4MEY A;  2VJ5 A;  2ZXH A;  3FM9 A;  3PW5 A;  2F1I A;  4JV1 A;  2E1F A;  1K1Q A;  4TUS A;  8ICL A;  2BPC A;  2QB0 A;  5B5E U;  4DSE A;  2V4Q A;  4QZH A;  3GFK B;  4DLG A;  1YZ6 A;  2PKE A;  2C28 A;  4RQM A;  3HPO A;  4J9O A;  4JWN A;  2RQ5 A;  1TV9 A;  1SV4 A;  4ECW A;  8ICZ A;  3C2K A;  1ZQT A;  4M0A A;  5ALE A;  2JV3 A;  2LYB A;  2WF9 A;  3PR5 B;  2DFL A;  4EEK A;  8ICF A;  1YT3 A;  2D3D A;  1Z4O A;  1X6J A;  4C8M A;  3MBY A;  3KKA C;  3M9N B;  1OW5 A;  2J6T A;  4CNQ A;  1RM6 C;  1BNO A;  4I2E A;  4QW8 A;  1S0O A;  4I29 A;  3KHG A;  4C7Z A;  5AIB A;  2F76 X;  4NWI A;  3WKA A;  2LM4 A;  5J0O A;  1QLN A;  4Y2S A;  3EWA A;  2BCR A;  3NRW A;  4ECU A;  1NJZ A;  4RPY A;  2V4R A;  2XI9 A;  2KKP A;  5DBC A;  2HHV A;  1ZQW A;  1TAM A;  3UMG A;  7ICR A;  1QSY A;  5JUM A;  2A1J A;  3N7P D;  1Z1B A;  5KT6 A;  1SZP A;  5AKY A;  1ZQL A;  2HBM A;  4F4X A;  1ZQD A;  2WB1 C;  2OHF A;  3T79 A;  2XY7 A;  1FIQ A;  4GIB A;  1F5S A;  4FZN A;  4DSI A;  3UM9 A;  4RQ6 A;  4F91 B;  2AGO A;  1L8O A;  4QZI A;  5KFY A;  3MR3 A;  2PXI A;  5CEH A;  1SGG A;  3WK6 A;  5IIO A;  3MGV A;  2F8K A;  2ZJ8 A;  1S5L U;  4ED6 A;  2RLT A;  1DXS A;  2HBL A;  3OHA A;  3ORY A;  1XSN A;  9ICR A;  5GTH U;  2HHQ A;  1JXL A;  2PI4 A;  4ZOH C;  4RNM A;  3NAS A;  5KFZ A;  4FS2 A;  2ZIW A;  4NLK A;  2VA2 A;  8ICP A;  1LKY A;  4I27 A;  1U47 A;  3T5L A;  2YB1 A;  2JEG A;  4Q43 A;  4YR3 A;  4EBE A;  4IQW A;  1V9P A;  4ECQ A;  5TZV A;  3PY8 A;  4OJ5 A;  4OD0 A;  4GXJ A;  4OJL A;  2FDR A;  2YMQ A;  3RB0 A;  1Q3U A;  5AKI A;  1SV0 A;  2YMP A;  5HHH A;  1ZQB A;  1Z00 A;  4CF4 A;  1COK A;  3T3F A;  2UVV A;  2IOF K;  4M9J A;  5DB7 A;  2KIW A;  2HHS A;  1NK6 A;  5KAF U;  4PGX A;  1L3V A;  4U7C A;  1L7O A;  3MGH A;  2J6U A;  4DL6 A;  4J9N A;  3C29 A;  4QZ9 A;  1ZQU A;  5ALR A;  4YQW A;  2LYH A;  1HUZ A;  4Z6E A;  1BVS A;  1ZQF A;  3PO4 A;  1KL9 A;  1UCV A;  1UT8 A;  2VKQ A;  3SEI A;  5KT2 A;  9ICE A;  3MFI A;  3V7L A;  4NY8 A;  1MN8 A;  4JMU A;  1IM4 A;  4EZ9 A;  5AKL A;  2JH7 A;  3BQ7 A;  1SZH A;  3EZ5 A;  5J0T A;  4P0Q A;  2E8N A;  4NLC A;  4DOC A;  4QWB A;  3PVX A;  3AU6 A;  2GWS A;  2BGW A;  1T8E A;  3C5G A;  2ZTD A;  4R8U B;  3Q8L A;  4J9R A;  2YX8 A;  3LDA A;  4FFD A;  2YMM A;  3RH6 A;  5DGB A;  4KLH A;  3NVW A;  5DGA A;  3Q8P B;  1WYG A;  5KFA A;  2WB1 F;  1ZQA A;  7ICK A;  4B9S A;  2BCU A;  3EPG A;  4I2G A;  8ICO A;  2C2E A;  2KP7 A;  2XGQ A;  3L5K A;  3L4P A;  1L8L A;  2KFN A;  5AKH A;  4KLE A;  2M9N A;  3QYP A;  3M9O B;  4O9M A;  4KLM A;  5AI6 A;  2BQU A;  2ZIU A;  2ZIX B;  5HP4 A;  3TI0 A;  3GV5 B;  1LKY B;  5ALZ A;  4U6P A;  5JRT A;  4IL6 U;  9ICC A;  5J2B A;  3ISC A;  5F9N A;  3HKZ F;  3H40 A;  2EZX A;  3JPR A;  4F93 B;  4QZF A;  3CW2 C;  4UAZ A;  3NVY A;  3GIL A;  2FMP A;  5DDM A;  4TUQ A;  4IQV A;  1ZQH A;  1N61 A;  4EX7 A;  1DK2 A;  2MA1 A;  8ICX A;  1J2M A;  3IG8 A;  2K8B B;  2NRX A;  2KOB A;  4O3N A;  2E8O A;  1WUD A;  4AYB C;  2W9M A;  4K4I A;  4OCZ A;  1RPL A;  4IRC A;  5AHX A;  4UAT A;  5ALN A;  1NK8 A;  5B66 U;  4ED1 A;  4GC7 A;  4LVS A;  5T14 A;  1ZD4 A;  2JEJ A;  5JU5 A;  5KFD A;  2AGQ A;  2KHQ A;  4DF8 A;  5KFC A;  2LM1 A;  1N62 A;  2E3T A;  9ICI A;  2YB4 A;  2CN1 A;  4MF2 A;  4F4Y A;  3K1Z A;  3E58 A;  4DSK A;  4FBU A;  5DLF A;  4YN4 A;  5J0P A;  2OWO A;  3TAC B;  4UB6 U;  2A19 A;  2Q4T A;  2HHW A;  2QKQ A;  4FE3 A;  4F5O A;  5J8Y C;  4YR2 A;  4XUS A;  4USA A;  3PML A;  4M9L A;  2HOI A;  1O08 A;  4F5N A;  4Y2P A;  3AQF A;  1AQ6 A;  4NL9 C;  3WK8 A;  3MR6 A;  3BQ1 A;  4KLQ A;  1QTM A;  1SV0 C;  2DQN B;  2DGZ A;  3RH4 A;  2ASJ A;  2K60 A;  2W11 A;  4KLS A;  4FS1 A;  4Q8F A;  3CP8 A;  4DL2 A;  4DFK A;  5KG3 A;  3KZX A;  1ZYQ A;  3NRZ A;  1A0P A;  1M6Y A;  4IC9 A;  2VAN A;  1XO1 A;  3RR8 A;  3KKA A;  2HHT A;  5EWG A;  4K4G A;  4O5E A;  4C4R A;  4B9V A;  5J2I A;  4C4T A;  4I2A A;  1XWL A;  5CB1 A;  4ELV A;  3GIJ A;  3F2D A;  4DQR A;  2WF6 A;  2BDU A;  4HYK A;  2BCS A;  1KBU A;  4I2F A;  4RQ1 A;  4Z6F A;  4PL1 A;  5EE0 A;  3PX4 A;  2W43 A;  5J2D A;  3NS1 A;  2Y0S C;  4QZB A;  1XSP A;  4QWA A;  4JV0 A;  2FPL A;  5KFB A;  1C7Y A;  3RB3 A;  3VC8 A;  4QWE A;  5J0R A;  1RXW A;  2W55 A;  4F8R A;  1TK0 A;  1FFV A;  4UBC A;  5KAI U;  7ICU A;  4BWM A;  4PHP A;  4DF4 A;  4KLI A;  4PH5 A;  5J2F A;  4J9P A;  2P66 A;  4Q45 A;  4B9U A;  3WKC A;  1ZOL A;  3H8W A;  4DL3 A;  5CA7 A;  9ICG A;  1PVQ A;  2GO7 A;  4Y2U A;  3BDP A;  4XQ8 A;  2FLL A;  5KG5 A;  2W04 A;  3QEB Z;  2C2R A;  1KDH A;  3C28 A;  2QAR A;  2UVU A;  3M6Z A;  5J0Q A;  4KLL A;  3KHL A;  4QZ8 A;  4RZR A;  4PJ0 U;  2R8H A;  3AMZ A;  3Q8S B;  5F3X B;  5AM2 A;  5BPC A;  1T3N A;  1ECW A;  4I28 A;  1S0V A;  5KFT A;  2G5H B;  1CI4 A;  3BS7 A;  2PFP A;  1H38 A;  4KIT B;  4UAV A;  3NVZ A;  1X66 A;  3TAD A;  4DS5 A;  1RYS A;  5DQH A;  4CE6 A;  1KSP A;  2HVI A;  3H4B A;  1SL0 A;  1S8O A;  2VIX A;  3O0F A;  3H7I A;  3N4M B;  3NTU A;  2JEI A;  3C2L A;  1MQ3 A;  2KHV A;  3ISD A;  3SV3 A;  3EPI A;  5DLG A;  1MA7 A;  3T5H A;  9ICJ A;  5DQI A;  8ICB A;  4NLZ A;  3HP6 A;  4TUR A;  2WF8 A;  3T5K A;  4PHD A;  8ICI A;  1JAL A;  5AK5 A;  5F9L A;  4UB1 A;  2HI0 A;  2C2D A;  1NK0 A;  1L3U A;  3UMB A;  4F2R A;  8ICN A;  3R9K A;  4DO9 A;  1TK5 A;  1VLB A;  7ICL A;  3DEE A;  1COO A;  5CP2 A;  5ALI A;  5KG4 A;  1N60 A;  1D8B A;  1WCN A;  4C8O A;  1D8Y A;  2ZIV A;  5ALG A;  1V97 A;  5ALP A;  2G09 A;  1QSS A;  2LHT A;  7ICV A;  5KFJ A;  1HJP A;  5ALM A;  1RXV A;  2XC9 A;  5DB6 A;  3M1Y A;  2EQY A;  2ZUD A;  3SZ2 A;  1FFU A;  3B0X A;  5AM1 A;  1URJ A;  2IBK A;  3Q8Q B;  5EE1 A;  4XA5 A;  2ISP A;  8ICW A;  1BNP A;  3NUQ A;  1ZRM A;  1ZQX A;  7ICT A;  9ICW A;  4O3S A;  5ALU A;  2IOF A;  1KTQ A;  7ICP A;  3ZDB A;  2NRV A;  4M9H A;  3G6V A;  4KN4 A;  2K8C B;  1U4B A;  2JH1 A;  3WU2 U;  4MFF A;  2H3V A;  2W9C A;  2P6R A;  4BX9 C;  4NLB A;  5ALY A;  5EWF A;  4IQU A;  4Y2Y A;  4JV2 A;  8ICQ A;  3S6J A;  7ICF A;  5KG1 A;  3UQ2 A;  2W7P A;  5L1I A;  1ZQI A;  3JPP A;  9ICT A;  3N28 A;  1S97 A;  5KTQ A;  5C0Y A;  4R63 A;  2NRW A;  1L7N A;  3AEV A;  3OTQ A;  3NGD A;  3GII A;  3HIL A;  4YFK A;  8ICV A;  5J0X A;  3UPQ A;  1PK3 A;  5KFQ A;  3V7J A;  4O5K A;  1ZD5 A;  1O03 A;  2G06 A;  4RQ8 A;  2WTF A;  3QXG A;  5CHG A;  2XO7 A;  3I28 A;  1XS9 D;  2JEF A;  1Z1V A;  3H0R B;  2ZUC A;  3HJE A;  4ECT A;  2Y9T A;  1X40 A;  3QUB A;  2C22 A;  3GU3 A;  2XCA A;  4R65 A;  3GIK A;  2KE7 A;  4US9 A;  1ZXI A;  4UW9 A;  2W03 A;  1ZQC A;  1IV8 A;  1LV5 A;  3G6X A;  2YTU A;  1P7D A;  1NK9 A;  2R8J A;  1JN3 A;  8ICY A;  2RHF A;  5ALQ A;  1IXR A;  5KG2 A;  1C20 A;  2KD1 A;  2K4P A;  5EOZ A;  3KOO A;  5AI4 A;  2WAQ C;  4BWJ A;  4EZ6 A;  2HOF A;  4BJQ A;  3TFS A;  3RH5 A;  1ZD3 A;  2KV2 A;  5C5J A;  5J2C A;  1T94 A;  1PVP A;  3LWM A;  4UB2 A;  2F8L A;  5HHI A;  4NM2 A;  5BOM A;  1PZN A;  4ECY A;  3N7R C;  4QNL A;  3SQI A;  4RQ5 A;  3ZDA A;  3TQ1 A;  3N97 B;  1Z00 B;  1SXE A;  4UB4 A;  3FAH A;  1NOM A;  5L1M A;  2KVS A;  3RJI A;  3GZF A;  2AXT U;  5G5H A;  4RQ0 A;  4DS4 A;  4B9M A;  4F4W A;  2KJ5 A;  2JZB A;  4Q44 A;  1SWV A;  4RQ2 A;  1NJY A;  1BPX A;  2I9G A;  3OPX A;  1DGJ A;  5ALS A;  5AM4 A;  1ZQV A;  4MF8 A;  4NV0 A;  4C8L A;  2WAQ F;  2BQR A;  1TFR A;  2R18 A;  1WWU A;  3SI8 A;  2WHE A;  4PHE A;  2ZIV B;  2OH2 A;  3THV A;  1A6S A;  2LI6 A;  4DQP A;  1S0N A;  3UXP A;  4R66 A;  1N2X A;  2HOQ A;  1NNL A;  3ZI4 A;  1IIP A;  2ESE A;  4UAS A;  3ZD8 A;  4M6W A;  1Q3V A;  1BPE A;  9ICV A;  2VA3 A;  4YR0 A;  2QB1 A;  2NYV A;  3MGI A;  2AQ0 A;  2DKX A;  1KKX A;  2KMD A;  1Z4N A;  2XGP A;  2ZIW B;  3UMC A;  3RAX A;  4GLX A;  3SD7 A;  8ICM A;  3AUO A;  4YD2 A;  7ICJ A;  3WKE A;  4ECS A;  3WK4 A;  2ZXI A;  4QIW C;  2H3Z A;  1Q46 A;  4DQS A;  1MQ2 A;  1ZQE A;  3D2N A;  1UHU A;  2GLE A;  1ZET A;  5KT7 A;  5DDY A;  9ICB A;  1ZRN A;  3C1Y A;  4US8 A;  4CGZ A;  1SKS A;  5EWE A;  1YZ7 A;  3BS5 B;  3RBE A;  3QU4 A;  5KT4 A;  1U45 A;  3ETR A;  3QUC A;  4CF5 A;  5KFW A;  4XRH A;  5IIJ A;  1CEZ A;  5KG0 A;  2HHX A;  5J0Y A;  3JPO A;  1QH9 A;  3JPQ A;  5CR0 A;  1VJ5 A;  4CRX A;  3MDC A;  4ACO A;  1S9F A;  1WCL A;  4TQS A;  1X6I A;  3IM1 A;  1BPZ A;  4F5Q A;  2ATL A;  2W7O A;  4JK1 A;  2IHM A;  5AI9 A;  5EE9 A;  4RQ3 A;  1F44 A;  3K1R B;  5DBA A;  5D4B A;  3WKD A;  4AP9 A;  2BCV A;  2W9C B;  2BQ3 A;  4DOB A;  4GC6 A;  3PW2 A;  1ZQ1 C;  3H8J A;  1RZT A;  2BCQ A;  3D2Q A;  5AI5 A;  3BJY A;  4F4K A;  2K8A A;  2FPM A;  3ZDC A;  3QU5 A;  3F5E A;  3G6Y A;  3KZI U;  4BXO A;  5III A;  3MFH A;  1DK3 A;  3BQ2 A;  2Q0Z X;  1L7M A;  2KIV A;  3PSP A;  4F3O A;  1S0M A;  2DWQ A;  9ICS A;  1MC8 A;  2QLT A;  4RPX A;  9ICM A;  3HRD D;  2H5X A;  2KSO B;  3IG5 A;  2DL0 A;  5DG7 A;  3M9M B;  3SR6 A;  2W8L A;  3HW8 A;  7ICG A;  1NKE A;  2E8P A;  5DG8 A;  1ZQG A;  3PNC A;  3M8S A;  1D9F A;  1ARO P;  4G3I A;  4YMN A;  1CRX A;  4KLF A;  2EZY A;  4G9B A;  2KZM A;  3KFU F;  5D49 A;  5HNK A;  1B4F A;  5IIM A;  5IIL A;  2R8K A;  2EDU A;  4M6W B;  5E79 U;  2ISO A;  4ECX A;  1NZP A;  1Z3E B;  3MR5 A;  1L3T A;  3RJG A;  4QZG A;  4ED2 A;  2PI5 A;  5DBB A;  2H3Q A;  1L3S A;  9ICF A;  1RG6 A;  5AKX A;  2KJ9 A;  4DSJ A;  5ALV A;  4DL7 A;  2JR5 A;  3PZP A;  1UA0 A;  1S76 D;  9ICN A;  8ICT A;  3E0F A;  1BGX T;  3HT3 A;  1ZQY A;  4RQ7 A;  3F53 A;  4F92 B;  2KEY A;  4PZN A;  1KEJ A;  2HBK A;  3LVV A;  3VCB A;  3K4G A;  5H2F U;  3J81 j;  4IQT A;  4YG2 A;  2F44 A;  2ALZ A;  3K75 D;  3CNH A;  5ALJ A;  7ICS A;  4J03 A;  4O3Q A;  1UPH A;  1QQ7 A;  5A0L A;  4EYI B;  2UVW A;  1ZQK A;  2KZ3 A;  5CWR A;  4C8K A;  5AIA A;  2ZIX A;  3N7S C;  3WKB A;  1U48 A;  2W8K A;  3QEA Z;  8ICC A;  1K1S A;  3RJF A;  2XVT A;  5DB8 A;  3RFA A;  3B0Y A;  4QZC A;  1V85 A;  4Y2R A;  4QJF B;  2Y0S F;  3E2E A;  1TKD A;  1BPD A;  4J9Q A;  2L5Y A;  5KFN A;  2DPI A;  7ICO A;  1ZD2 P;  2AU0 A;  5AK4 A;  3JPT A;  1ZQZ A;  2VJ4 A;  4UAR A;  3F2B A;  3JPN A;  3PX6 A;  1SIJ A;  3TAP A;  2YY6 A;  4OJ6 A;  4CF3 A;  2ZJA A;  4DFJ A;  4O3M A;  3I76 A;  4KLJ A;  5AKG A;  3I1Y A;  4P0P B;  2IMW P;  1GO3 F;  4DQI A;  5FP0 A;  4KMO B;  3QNM A;  8ICR A;  2KJ8 A;  5AKJ A;  2PMZ C;  4JUZ A;  5L1J A;  1LB2 B;  2AGP A;  1TK8 A;  4QIW F;  1NJW A;  8ICU A;  2MU2 A;  1WWV A;  1XC9 A;  2OM6 A;  3C21 A;  4GXK A;  1B0X A;  2NO4 A;  2A3V A;  7ICE A;  5L1L A;  4OO1 J;  5AM0 A;  2W3R A;  2QB0 B;  3UXN A;  4B9N A;  2HSZ A;  2HVH A;  2AH5 A;  4ED0 A;  4ECZ A;  4PGY A;  2F77 X;  4UAU A;  3SAH A;  1KLN A;  5J2E A;  3C5F A;  1PK1 B;  1OXJ A;  2B21 A;  2KG5 A;  1CUK A;  4WJ3 B;  8ICJ A;  1B43 A;  5KFX A;  9ICX A;  4DFP A;  4GFJ A;  1N63 A;  4M9G A;  2QAR B;  2BPG A;  3QZ8 A;  1QCK A;  4M9N A;  2CRX A;  2EAO A;  8ICS A;  1PK1 A;  3EW9 A;  1DGS A;  3RB4 A;  3OSP A;  3ZDD A;  3Q8K A;  4KLU A;  4Q8E A;  4DFD A;  2Y1J A;  5ALL A;  4EBC A;  2HCF A;  1QSL A;  4AYB F;  3H8M A;  4NXZ A;  5J0W A;  1T3Q A;  3ZDE A;  3C1Z A;  2WFA A;  3BQ0 A;  2G0A A;  3RTV A;  5ALH A;  3RF9 A;  2XIC A;  3GIM A;  3HWT A;  2JRZ A;  3SAF A;  4P2H A;  3SMV A;  3M6K A;  5JTI A;  2EAN A;  2KNJ A;  3V6J A;  4EEL A;  2W3S A;  5AK3 A;  4ED3 A;  2LMR A;  2PFO A;  4RPZ A;  3EYZ A;  4HAI A;  2CPR A;  3U26 A;  3MC1 A;  5AIC A;  4NLG A;  5KFI A;  5J2K A;  4TUP A;  3C23 A;  3F5A A;  1TVA A;  4MEX A;  3GV8 B;  8ICK A;  4RT3 A;  2MUT A;  3V6H A;  2JMG A;  3IV6 A;  2I6X A;  2RDI A;  3MDA A;  1WG8 A;  2YML A;  2HMX A;  1UA1 A;  5ALK A;  2RDJ A;  2EH9 A;  7ICI A;  4P4O A;  2XY6 A;  4YP3 A;  4EBD A;  3D6J A;  3TAQ A;  2DKZ A;  4O0I A;  2A1A A;  5ALD A;  3JPS A;  1B22 A;  4UAW A;  4ZH4 A;  4ED8 A;  4EYH B;  2RRD A;  5KFR A;  2K4H A;  3FYH A;  2D6F C;  7ICH A;  3MAB A;  1ZQO A;  2FLP A;  1EXN A;  1FO4 A;  4RNN A;  2FMS A;  4ELT A;  5KL1 B;  2AJQ A;  2KKV A;  4KLT A;  1A77 A;  1JIH A;  4C0Z A;  2I1Q A;  4QW9 A;  2Z7J A;  3PSI A;  1ZQN A;  2H3F A;  4DSF A;  2I5H A;  4FZM A;  4P4P A;  4RQN A;  4R8U A;  1VDV A;  3ZD9 A;  4EX6 A;  4ECV A;  3AN1 A;  4CCH A;  1ZQS A;  2KZZ A;  5KFL A;  4RNO A;  4MFA A;  2ZIU B;  2G07 A;  3BZK A;  4RU9 A;  3IP4 B;  3QU7 A;  5KFO A;  2H3I A;  3BZC A;  1Y88 A;  2NRZ A;  4Z6D A;  5J2G A;  4YCX A;  9ICA A;  2LBO A;  3GQC A;  2Y1I A;  4TQR A;  3QZ7 A;  2YQE A;  5KT5 A;  2FMQ A;  5KFF A;  3V7K A;  5J8Y A;  3M7D A;  4DL5 A;  9ICU A;  1JMS A; 
#chains in the Genus database with same CATH homology
 2EDU A;  2I5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...