2EDUA

Solution structure of rsgi ruh-070, a c-terminal domain of kinesin-like protein kif22 from human cdna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
98
structure length
98
Chain Sequence
GSSGSSGEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESFLKANILGLAAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF22
publication title Solution structure of RSGI RUH-070, a C-terminal domain of kinesin-like protein KIF22 from human cDNA
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 20
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12836 HHH_3 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2eduA01
2EDUA 2I5HA
chains in the Genus database with same CATH superfamily
3GIMA 4IQVA 2FDRA 7ICJA 3H4DA 1N5WA 5KFNA 1XSLA 4ELVA 5DQHA 4I2EA 1BPZA 4EYHB 2R18A 4GXJA 2VJ5A 2OYYA 3F2DA 5KFKA 5EWFA 9ICLA 4Y2RA 2GH1A 3AL0B 3A0BU 1X6JA 2Y0SC 3QUQA 2NYVA 4MHVA 5AKYA 5HHHA 4J9LA 4F72A 1Q3VA 1Q3UA 2HHUA 1N56A 1PVRA 5HNKA 4XUSA 3OJSA 2DPIA 3ZDEA 1N5XA 1BPYA 4OJPA 2KJ5A 3RAXA 5ALFA 2ZIVA 7ICGA 5CJ7A 2JEFA 3ZDAA 2ODGA 4PHPA 4YR3A 3H8WA 3MFHA 1TKDA 4J9QA 8ICSA 2ZUDA 2BCRA 2HOIA 3MR5A 5BOLA 4RPYA 4NM2A 3N28A 4F71A 1S5LU 3KHGA 4Q8EA 2ZIUA 4KN4A 3Q8RB 4F5NA 3PW4A 1WG8A 1ZD5A 5KT7A 1T4GA 4CCHA 2PKEA 2V4QA 3M6KA 3HW8A 1U48A 1QCKA 5KG6A 5DBCA 3UQ0A 2A1JA 3BJYA 1XU4A 5CHGA 4Z6FA 1KRPA 3BQ1A 4QZBA 1XNSA 1CUKA 3IM1A 1SGGA 4I29A 1MC8A 1YZ7A 3SR6A 3SV4A 1QH9A 3IP4B 3RH4A 2C2EA 5KFBA 2MUTA 4P4MA 5ALSA 4CRXA 3BQ7A 1PVQA 5AKKA 4NLZA 2L5YA 5KFEA 5J0SA 5KG4A 4YCXA 2AJQA 4M47A 4ECRA 5HMMA 4ECWA 5DG8A 5EOZA 5KFZA 5D46A 4OJOA 3V6HA 9ICXA 4DLGA 9ICFA 2W04A 4ECTA 2HBJA 1UPHA 3KBBA 3WKDA 1D9DA 4IQWA 7ICHA 2KICA 2K60A 3QZ7A 2ZG6A 3GDXA 2KFNA 2CRXA 5DDYA 4YQWA 4KLDA 3V7LA 4HYKA 2HHWA 3AMZA 4UASA 2PFNA 1J97A 2PI5A 1RYRA 4EYIB 4I28A 9ICSA 4BXOA 3RF9A 4RT2A 4UATA 9ICNA 4EZ6A 3NVZA 4YXJA 4ECSA 4M2YA 3S6JA 2H3FA 4P4PA 4IS7A 3I76A 3PMLA 1NJXA 4DF4A 3RFAA 3F2CA 4I2GA 3Q8SB 5AKEA 1DOQA 1CRXA 1JIHA 2K8AA 3O0FA 2ESEA 2MRLA 3JPPA 4YMNA 3M8RA 4XA5A 4NWIA 1B0XA 2KD1A 2WF8A 2KOBA 4KLHA 5KFOA 3IV6A 3WKEA 2F8LA 4ECQA 1L7PA 2QARB 4DQIA 1NK4A 3EW9A 1GO3F 4UBBA 4KLQA 2RRDA 4JK1A 5DQIA 3UPQA 5ALLA 2P6UA 2R8IA 5J2EA 4EENA 3C1YA 5J2IA 1VJ5A 2D8CA 2ZUCA 4YFKA 2ISPA 4QW9A 9ICHA 1WWVA 1SXEA 3BQTA 2XGQA 3NRWA 4EBEA 1B4FA 4BXOB 5AK4A 2QKQA 1JMSA 5AIBA 1ZQIA 4USAA 1FFUA 2Q4TA 4M6WA 4ZH4A 4Q43A 2W9BA 3R9KA 3MABA 5KL1B 5EE1A 2Y9UA 4YXMA 3V6KA 9ICUA 2IA6A 3CYMA 2O6KA 4O0IA 2P66A 1T7PA 4YR2A 7ICPA 4F8RA 3GIKA 4KN7A 4PHAA 1ZQDA 3RJKA 3Q8PB 7ICOA 1LVHA 5J0WA 5J2DA 2F77X 1NK9A 4LZDA 5ALPA 1JXLA 2HDOA 2IMWP 3H8JA 4UAWA 3NGDA 2PFOA 3BQ0A 3MR6A 5TISU 5L9XA 2HBLA 1SL1A 4M04A 3WK4A 4BWMA 1X42A 2H3VA 2ZXHA 1X40A 3UMCA 4BDPA 5AICA 4NM1A 4ED6A 8ICXA 1JXEA 1SXDA 3NS1A 4M6WB 4DL3A 1MA7A 3PR4A 1KBUA 4BUGA 1WWUA 2JZBB 3HT3A 3BZKA 1MQ2A 3RJJA 2E8NA 4UB8U 4US8A 1U9LA 2M9NA 3RJGA 1NK0A 3G6VA 4DSJA 2FMSA 2ASLA 1BPXA 2GWSA 1HIWA 3SI8A 2G08A 8ICBA 2KIWA 4Y2UA 3KHHA 4B9VA 1K1SA 3WKCA 5AKHA 3H8SA 2WTFA 2AQ4A 2EZXA 9ICQA 1NJWA 4FZNA 2BCVA 1O03A 4QZDA 3DEEA 9ICJA 1UHUA 5J8YC 2QB0A 3OSPA 1X9WA 1COOA 4UB1A 1SKWA 4I2JA 1MSWD 4C80A 1RQLA 4O3QA 2AGOA 1ZQKA 1NK8A 3WK8A 3PW0A 2ZIWA 2OWOA 2XY7A 1C20A 4DSLA 3H7IA 3K1ZA 3I28A 9ICTA 1ZQBA 4ELUA 3TADC 1X9XA 5KG0A 4YD2A 3M7DA 4F5RA 2RQ5A 8ICNA 4GFJA 1D9FA 5ALQA 1ZQZA 3OHBA 2XCAA 5ALWA 3PSFA 3MDCA 1NKBA 4MEYA 5G5HA 2CN1A 2KZZA 5KG5A 2A1AA 4DSEA 5KT2A 4IR9A 1M6YA 2HHSA 3Q8KA 2K8BB 4C4SA 3GU3A 4KX3A 4IC9A 1IXRA 4PL2A 4GC7A 5ALEA 3KFUF 1Y88A 1SB3C 2AQ0A 4M9GA 2XICA 1SL0A 2OH2A 2ZIWB 3JPNA 5DGBA 1AQ6A 4R8UA 3JPOA 7ICKA 3M6ZA 1SZHA 3NRZA 3AU6A 3FM9A 1S76D 1TFRA 1XO1A 3KD3A 1KL9A 4UB3A 4IRKA 8ICYA 1IM4A 5TZVA 2PI4A 2LHTA 1PK1B 2HOFA 1RPLA 1LV5A 2DL0A 1Z00A 5ALHA 1FFVA 4O5CA 2YN4A 4NY8A 3RJEA 3QU5A 3E0FA 2K8CB 4FZMA 4JV0A 3OSNA 4YD1A 2BPGA 1X9MA 3F2BA 4CF3A 1U4BA 4KLGA 4Y2TA 4EZ9A 4ECYA 2KKPA 1ZQSA 3M9NB 3RH5A 4Z6CA 2BQ3A 3UM9A 4C7ZA 4RPZA 3LWLA 2AH5A 3PVXA 2DF4B 5J2JA 5DQGA 2JMGA 2OEHA 9ICPA 3QEBZ 5D4BA 4UAYA 4R8UB 2AHOB 4JB3A 5DBAA 2D6FC 1Z19A 1ZYQA 2GO7A 3D2QA 4DL7A 4C4TA 2MA1A 2LYBA 4TQRA 1K1QA 5AM4A 1Z00B 1ZQGA 2K89A 1UQVA 2LBOA 4DF8A 2AGPA 2KE7A 3HILA 2RDIA 5DG7A 1MQ3A 3RJFA 1ZD4A 1ZQEA 4QW8A 1ZXIA 4C8KA 5KFXA 1D8LA 3QU2A 5E79U 3KKAC 4PGQA 2ZIXA 5J0UA 4UAZA 1XSPA 2Y1JA 2F2AB 3PV8A 4RNOA 3H40A 3CRXA 5DLGA 2JEIA 4MFAA 7ICQA 2K4PA 3PW5A 4P4OA 1A6SA 4FFDA 4GXIA 8ICQA 2IOHA 5DB8A 2XO7A 4Y2SA 1S0OA 3D2NA 3AN1A 1PUZA 1PK3A 1UT8A 4RQMA 2H5XA 2HSZA 2DGZA 2JRZA 2YMMA 2RLTA 3V72A 3SAFA 1TV9A 2XY6A 5J2KA 3V6JA 2XC9A 4OCZA 1ZQNA 3IRUA 3KZIU 2R8HA 2WF9A 5KFQA 3WU2U 5T14A 4FO6A 4Q44A 4IQUA 7ICEA 2ZIXB 3L5KA 3RRGA 1ZRMA 5GTIU 4ZOHC 2BHNA 2IOFA 3SV3A 1N48A 2RHFA 3LVWA 4F93B 1XS9D 4ICAA 1H38A 3BS7A 2BR0A 3MGVA 9ICEA 3ALRA 7ICFA 3RB4A 4RQNA 1J2NA 2BGWA 4OJ6A 4DFMA 1QTMA 2I1QA 4B9MA 1ZJNA 2BQUA 4DSKA 5KT3A 1ZQPA 5J2AA 9ICAA 4U7CA 1V97A 5L1IA 2JV3A 3WKBA 4BJQA 1OXJA 5EE9A 5KFPA 3PY8A 4F4ZA 1S10A 5J2HA 1S0MA 1S97A 3MFIA 2YMLA 4X5VA 4YR0A 4US9A 5BOMA 3BS5A 3QU9A 4O3NA 3ZI4A 2HMXA 5KTQA 2RDJA 3MC1A 2VJ4A 8ICAA 3GFKB 1QQ6A 3QE9Y 3SMVA 2ZIVB 4OJ5A 2WAQC 3LWMA 3THVA 1BGXT 1ZQWA 1HUZA 2BZFA 4KLOA 5J0OA 1BNOA 3H0MB 2W43A 3QUTA 1TVAA 2AGQA 4AYBF 2FJ6A 4Y2XA 3U26A 1HUOA 2C2RA 4MFCA 3N7RC 2FPKA 2ATLA 2Y1IA 4GXKA 1S8OA 2G07A 2Y9TA 2ZIUB 1KDHA 3T5LA 2LYHA 4P0PA 4RUAA 2PMZF 5JTIA 3F53A 5J0XA 2A1JB 2WAQF 2E8PA 5AKGA 4R65A 5ALNA 2UVUA 1ZQYA 8ICCA 1ZQQA 2F1JA 4PH5A 3ISCA 1A0PA 3BS5B 3MR3A 4DOBA 4F3OA 4KLSA 1YT3A 4KTQA 2G5IB 5ALJA 5EE3A 3FAHA 2NO5A 9ICIA 2HHQA 2MUTB 5DKWA 2KN7A 3HWTA 2E3TA 5GTHU 4RQ5A 2BDPA 3AEVA 1KN5A 5AK5A 4Q8FA 2R8GA 1N2XA 4CE6A 9ICKA 1KLNA 3ZD8A 2W55A 4MF2A 1VLBA 4DL6A 2W11A 4PJ0U 1JROA 4TQSA 3PW7A 4TUQA 2YB4A 4QIWF 5ALRA 4J9OA 3TFSA 1ZRNA 2YB1A 1S9FA 2HVIA 5G5GA 1NKEA 1ZQUA 3FYHA 5HR6A 4KLIA 5J2CA 4O3MA 4P0PB 4NL9A 3BQ2A 2LM1A 2OHFA 4JWNA 4C8MA 2VKQA 5J0QA 1F44A 3T5JA 2JH1A 1CEZA 3ED5A 1QSLA 2DQNB 3GILA 1YZ6A 4KLEA 7ICTA 4FBUA 3HP6A 1D8YA 4J9PA 5IIOA 4ECZA 2OCEA 2PFQA 3QEAZ 4CNQA 4DS5A 8ICLA 4O3OA 3TQ1A 4R66A 2FPLA 4DOAA 2E8OA 2LI6A 2ZJ5A 1T3QA 4HAIA 1NNLA 5B66U 4O9MA 5IIIA 2FLLA 3E2EA 5F9NA 3IN5A 1U49A 3H0RB 1N60A 1SIJA 4KITB 2KHQA 4PZNA 3C29A 3RBEA 4RQ7A 3ICXA 3AQFA 4RU9A 1RXWA 5DB7A 1TE2A 3WK9A 4ED1A 5IILA 5DGAA 4K4GA 4R64A 2YY6A 8ICZA 4KLLA 7ICSA 2AU0A 5DG9A 4ELTA 1QSSA 2NV3A 3N7SC 1RYSA 3UXOA 4FS1A 3NASA 5A0LA 3JPQA 3L4PA 4I2BA 4PHEA 1XWLA 1NI3A 4Y2JA 2H3QA 3IDWA 5L1LA 2W9BB 5ALYA 4NV0A 2H3IA 3HPOA 2BCQA 3PSPA 4R63A 5ALKA 2WFAA 4NLNA 3HKZF 4J9RA 3SD7A 4KLTA 2PXIA 5DLFA 1B22A 4EEYA 1X6IA 1RZTA 5AI8A 3RRHA 8ICTA 2LMRA 4C4RA 4UB2A 4M9NA 4DSFA 4DCCA 4I27A 5C0YA 2KZ3A 3C1ZA 3QXGA 4B6JA 2WF6A 4C0ZA 1L7MA 1OUQA 4QWAA 4GC6A 2A19A 3IG5A 4QZAA 3AU2A 5KT4A 1L3UA 4K4HA 1SV0A 3HX0A 3GIJA 2KP7A 3RB6A 8ICUA 3JPRA 5J0PA 4RT3A 1URJA 1LKYA 3OTQA 3N97B 4CDGA 3TAPA 1BNPA 9ICWA 3NVVA 5KFUA 1LB2B 4DFJA 3QZ8A 3F5AA 2DFLA 1ZQTA 2KSOA 5JRTA 2BPCA 3CNHA 1ZQFA 4QZ9A 9ICGA 1QQ7A 5ALZA 2G09A 1TAUA 1KKXA 2EZZA 1ZQVA 4IR1A 1AROP 2FPMA 4IL6U 5ALMA 4F2SA 2I5HA 4EX6A 2QB0B 4YN4A 2IHNA 4QJFB 2BCUA 3C23A 3CW2C 5KG1A 1SWWA 3WKAA 3B9JA 4IRDA 1LKYB 2NRXA 1TAQA 2NRWA 1S0NA 2EAPA 1U47A 3ZDCA 2XCPA 3A0HU 1X9SA 8ICGA 1L5UA 4XRHA 4P2HA 5IIKA 9ICBA 3B0XA 5AK3A 2W9MA 1NOMA 4RQ3A 1S0VA 2KSOB 3SAHA 3RJIA 5KFWA 2CXYA 2BQRA 1TAMA 2W7PA 2BDUA 1SV4A 2KNJA 2V4RA 2BKEA 2ZJ8A 1UCVA 2HI0A 7ICUA 2IHMA 1HJPA 2JHDA 5HMLA 3EWAA 2K4HA 2W9CA 4LZGA 4KX5A 2DUYA 3MDAA 2P35A 5KFCA 1B43A 3V7KA 5IIJA 4FE3A 5H2FU 4OO1J 2YX8A 4J03A 5KFLA 2EZYA 8ICJA 2A3VA 2F8KA 4DOCA 5J8YA 5EWEA 4MFFA 2C2DA 4FZLA 4P0QA 2UVVA 2KIVA 4WJ3B 2EH9A 1Q46A 1L3VA 3C5FA 3LVVA 4I2DA 1PVPA 1Z4OA 3E58A 4DFKA 4B9NA 2LYAA 4FS2A 1QQ5A 2N1RA 5AI6A 7ICLA 1ECWA 5AKZA 3TADA 3UMBA 4RNMA 2E8MA 3ZDBA 1ZQAA 2V9WA 2EDUA 2KJ8A 2KVSA 3HRDD 5DBBA 3LK9A 3N4MB 1NK7A 4NJ8A 3K4GA 4FBTA 1NJYA 2KKVA 3UXPA 4KLJA 4ECUA 2KMDA 3TI0A 7ICMA 3M8SA 2WB1F 1WCNA 4G3IA 4KMOB 3G6YA 5B5EU 2W03A 3PNCA 3RJHA 2KTQA 3MGHA 2E1FA 4DO9A 2ISOA 4MEXA 3MGIA 1VDVA 4QWCA 3GQCA 2P6RA 3PW2A 2KHVA 2B0CA 4J9MA 1JALA 4DLEA 2E1EA 1Z1BA 4BX9C 4J9SA 2ZTDA 2DKXA 2NRTA 4Z6DA 1Z4NA 3DV9A 1T8EA 5AIAA 2KVCA 8ICMA 1N63A 3GV7B 3T5HA 5CB1A 4DS4A 3PZPA 2MAXA 4QWBA 2R8JA 5K4LA 3PX4A 1BPBA 4K4IA 1BPDA 4YMOA 4O5EA 1TK5A 1QLNA 1ZD3A 3K75D 3EPGA 3PO5A 1J2MA 4ECXA 1SKRA 3OPXA 2HVHA 2G5HB 3GV5B 3M9OB 4ED3A 1RG6A 4O3RA 3NTUA 4QZHA 2GLEA 3ISDA 2OXOA 3C21A 4PL1A 3D2SA 3GIIA 3RTVA 2ZTEA 4ED2A 3TFRA 5KFIA 1SL2A 4OJLA 3T3FA 3QX7A 8ICEA 1KSPA 2JR5A 3ETLA 4Z6EA 1KTQA 1XC9A 5J2BA 3KHLA 2DKZA 4AYBC 3SENA 5J0YA 2Y0SF 1C7YA 4NL9C 4JV1A 4CF5A 2R8KA 4KLFA 4ED7A 7ICRA 2W3RA 4JUZA 4DL5A 4F2RA 2KJ9A 4C8OA 2EAMA 5CRXA 2PMZC 8ICOA 3TACB 3AUOA 2LPEA 5KT5A 5L1JA 4IQTA 3KKAA 5AKIA 3UXNA 5AI0A 4F92B 4AP9A 1KFDA 8ICWA 2GOLA 4Y2PA 2HHVA 2ZTCA 4EEKA 4YVZA 5ALIA 3QU4A 4CF4A 2VANA 2F1HA 1SZPA 5AM0A 2W7OA 4JWMA 3NVYA 1JI7A 4RQ2A 2C28A 1ZQLA 1T3NA 5KG2A 4QZCA 1SKSA 3PSTA 1A76A 2HHXA 5EE0A 2JH7A 2NRZA 2RP5A 4QZEA 5L1KA 4C8NA 7ICNA 4YP3A 5J0TA 4QIWC 1L3SA 4DL4A 3MBYA 4O5KA 2F1IA 2AXTU 2QARA 2WHEA 3KHRA 2MSNA 2F3NA 5KFFA 1KW4A 3CP8A 3OHAA 4I2HA 4XQ8A 1QSYA 4GLXA 4F5QA 4RQ6A 3Q8MA 2BPFA 1D8BA 1A77A 4UARA 1N62A 2I9GA 8ICPA 4UB5A 5CP2A 4IRCA 4I2AA 3LDAA 5JUMA 3C28A 1ZQJA 2ZUBA 4NLBA 3F5EA 1HEKA 4U6PA 2DPJA 3NVWA 3EUB2 2ES6A 1DGSA 2VA3A 3RR7A 2LM4A 3JPTA 3UQ2A 4O3PA 4YMMA 4QZFA 5HP4A 1KQQA 4F5PA 3ZD9A 3PR5B 9ICMA 1F0MA 2M0NA 1ED1A 1L6NA 4QNLA 3AQEA 2G06A 5KFAA 1ZQRA 4DFPA 5L1MA 4QZ8A 4F4KA 1FIQA 4BGDA 4F4WA 3TAQA 4F5OA 2J6SA 3B0YA 1DRGA 4C7YA 1RM6C 8ICRA 4DL2A 4ACOA 2KEYA 1KFSA 5KFVA 1XO0A 2KZMA 2HOQA 3FC4A 3SEIA 2F76X 1SV0C 2G0AA 2XY5A 1KFTA 3SZ2A 3TANA 1ZQOA 1WCLA 5KL8B 4MF8A 2XGPA 4B9UA 4UW9A 1UA0A 1N61A 2WF7A 8ICIA 4RNNA 3C2MA 1DK3A 3KTQA 2WF5A 2HCFA 5AM1A 1L3TA 5AKXA 3T5KA 4C8LA 2ZJAA 5AKLA 1L7NA 5AM3A 1X2IA 5AI4A 2FLNA 4I2FA 1NZBA 3ORYA 1NK6A 2W9AA 4B9LA 1NZPA 4I2IA 3WK6A 2JZBA 4NLGA 1L8OA 3QUCA 5KFJA 2D3DA 4YG2A 4KLMA 3HKZC 3K1RB 1V85A 3ISBA 5DB9A 1DGJA 5J2GA 1ZQ1C 2BCSA 2QLTA 4QZGA 1RDFA 3JPSA 3Q8LA 3ONNA 3T79A 2FMQA 4I2CA 7ICVA 2FE9A 1JX4A 2K4IA 2JEJA 3H0LB 3C2LA 4JV2A 1DK2A 1L8LA 3SYZA 1X66A 4F91B 4B9SA 3H8MA 5AHXA 4TUSA 5KFSA 1Z3EB 3C2KA 3LYSA 3RAQA 1JRPA 4DSIA 5ALOA 5AM2A 4DFDA 4M9JA 4QZIA 1TK8A 4NLCA 5EWGA 5CWRA 3EYZA 1F5SA 1WYGA 3IG8A 1ZD2P 5KAFU 2ASJA 3RB0A 2B6GA 5KFTA 8ICHA 4PGXA 3G6XA 9ICOA 3GV8B 1K5OA 1RQNA 1BVSA 2CPRA 5J29A 5FP0A 2YMPA 2LKYA 3VCBA 5ALGA 5HHIA 2OM6A 4BWJA 3EPIA 2QB1A 2JEGA 1Q8KA 2HBMA 1EXNA 5KFYA 4UB4A 3OJUA 1DXSA 1U45A 2DWQA 4CGZA 1CI4A 2JXJA 4UB6U 5AKJA 7ICIA 4E0DA 5C5JA 3I1YA 4EBCA 4EELA 1NKCA 4DEZA 4TURA 5DB6A 4DQRA 2F44A 4RQ1A 4OD0A 2XI9A 2MU2A 2C22A 3Q8QB 1O08A 1ZETA 5KFGA 2W3SA 9ICCA 1V38A 5HR7A 2HW3A 5IIMA 3WK7A 2XIDA 4RQ4A 3PSIA 2Q0ZX 4F4YA 2W8KA 3OGUA 1PK1A 1P7DA 4PZOA 4PHDA 4Y2VA 4GIBA 1NK5A 3QNMA 3QUBA 5KFMA 4F4XA 2VIXA 3ETRA 5KAIU 4Q45A 2ZXIA 3M9MB 4DQQA 5CEHA 1JUDA 2EAOA 9ICVA 3KOOA 1JN3A 4RQ0A 4B9TA 5DDMA 3PO4A 1ZQCA 4M9HA 3GZFA 4TUPA 4KLUA 3PX6A 1ZQHA 5KG3A 5KFDA 2EANA 3L3FX 3SQIA 8ICVA 2NRVA 4NXZA 1IIPA 2NO4A 3ZDDA 2FI1A 4KMUA 5IINA 5J0RA 5CR0A 2H3ZA 3DDHA 3QYPA 2EQYA 4JMUA 4RUCA 2PFPA 3HJEA 3MR2A 2YMQA 3TARA 3WK5A 2K4EA 4UAVA 4RPXA 1XSNA 3RB3A 5D49A 5ALUA 1MN8A 3QU7A 2UVWA 1PZNA 3IHQB 3H4BA 5KG7A 4EBDA 3J81j 2XVTA 1UA1A 1ZQXA 2W8LA 1SWVA 4F50A 1WUDA 1RYUA 2FLPA 5BPCA 4O3SA 8ICKA 5KNIA 3D6JA 3AM9A 2YTUA 5ALVA 3FDSA 5ALDA 1OW5A 1FO4A 3SAGA 2E5SA 1ZQMA 1S77D 4NLKA 2KV2A 5AI5A 5CA7A 4ED8A 5KFHA 5ALTA 3BZCA 1IV8A 3EZ5A 2FMPA 2KK0A 2WB1C 2B21A 5KFRA 3V7JA 2DBYA 4UQGA 2J6TA 1COKA 4QWEA 2W54A 1TK0A 2HHTA 1ZOLA 4LJXA 4A8EA 4QWDA 2YQEA 4Y2YA 3RR8A 4UAUA 5F9LA 2Z7JA 5AK6A 1UT5A 5AM5A 4UBCA 1FEZA 2VA2A 2HBKA 3KZXA 3BDPA 3RH6A 2IBKA 4RQ8A 2I6XA 4ECVA 4PPXA 2J6UA 2W9CB 5F3XB 1BPEA 4PGYA 1RXVA 5ALXA 4M0AA 5KT6A 4J9NA 3VC8A 1NJZA 3TKAA 4EX7A 2JGAA 1IG6A 1Z1VA 2KFZA 3PX0A 4DQPA 1L7OA 1KEJA 3M1YA 5J2FA 4DQSA 2ALZA 4DWIA 1T94A 2KG5A 4J9KA 4G9BA 8ICFA 5AI9A 3PMNA 4P0QB 2ASDA 4M9LA 3N7PD 3RBDA 1V9PA 5JU5A 4ED0A 3C5GA 3NUQA 2UVRA 2IOFK 9ICRA 2VA8A 1ZJMA 3UMGA 4LVSA 4Y2QA 4RZRA
chains in the Genus database with same CATH topology
2EDUA 2I5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EDU A;  2I5H A; 
#chains in the Genus database with same CATH topology
 3GIM A;  4IQV A;  2FDR A;  7ICJ A;  3H4D A;  1N5W A;  5KFN A;  1XSL A;  4ELV A;  5DQH A;  4I2E A;  1BPZ A;  4EYH B;  2R18 A;  4GXJ A;  2VJ5 A;  2OYY A;  3F2D A;  5KFK A;  5EWF A;  9ICL A;  4Y2R A;  2GH1 A;  3AL0 B;  3A0B U;  1X6J A;  2Y0S C;  3QUQ A;  2NYV A;  4MHV A;  5AKY A;  5HHH A;  4J9L A;  4F72 A;  1Q3V A;  1Q3U A;  2HHU A;  1N56 A;  1PVR A;  5HNK A;  4XUS A;  3OJS A;  2DPI A;  3ZDE A;  1N5X A;  1BPY A;  4OJP A;  2KJ5 A;  3RAX A;  5ALF A;  2ZIV A;  7ICG A;  5CJ7 A;  2JEF A;  3ZDA A;  2ODG A;  4PHP A;  4YR3 A;  3H8W A;  3MFH A;  1TKD A;  4J9Q A;  8ICS A;  2ZUD A;  2BCR A;  2HOI A;  3MR5 A;  5BOL A;  4RPY A;  4NM2 A;  3N28 A;  4F71 A;  1S5L U;  3KHG A;  4Q8E A;  2ZIU A;  4KN4 A;  3Q8R B;  4F5N A;  3PW4 A;  1WG8 A;  1ZD5 A;  5KT7 A;  1T4G A;  4CCH A;  2PKE A;  2V4Q A;  3M6K A;  3HW8 A;  1U48 A;  1QCK A;  5KG6 A;  5DBC A;  3UQ0 A;  2A1J A;  3BJY A;  1XU4 A;  5CHG A;  4Z6F A;  1KRP A;  3BQ1 A;  4QZB A;  1XNS A;  1CUK A;  3IM1 A;  1SGG A;  4I29 A;  1MC8 A;  1YZ7 A;  3SR6 A;  3SV4 A;  1QH9 A;  3IP4 B;  3RH4 A;  2C2E A;  5KFB A;  2MUT A;  4P4M A;  5ALS A;  4CRX A;  3BQ7 A;  1PVQ A;  5AKK A;  4NLZ A;  2L5Y A;  5KFE A;  5J0S A;  5KG4 A;  4YCX A;  2AJQ A;  4M47 A;  4ECR A;  5HMM A;  4ECW A;  5DG8 A;  5EOZ A;  5KFZ A;  5D46 A;  4OJO A;  3V6H A;  9ICX A;  4DLG A;  9ICF A;  2W04 A;  4ECT A;  2HBJ A;  1UPH A;  3KBB A;  3WKD A;  1D9D A;  4IQW A;  7ICH A;  2KIC A;  2K60 A;  3QZ7 A;  2ZG6 A;  3GDX A;  2KFN A;  2CRX A;  5DDY A;  4YQW A;  4KLD A;  3V7L A;  4HYK A;  2HHW A;  3AMZ A;  4UAS A;  2PFN A;  1J97 A;  2PI5 A;  1RYR A;  4EYI B;  4I28 A;  9ICS A;  4BXO A;  3RF9 A;  4RT2 A;  4UAT A;  9ICN A;  4EZ6 A;  3NVZ A;  4YXJ A;  4ECS A;  4M2Y A;  3S6J A;  2H3F A;  4P4P A;  4IS7 A;  3I76 A;  3PML A;  1NJX A;  4DF4 A;  3RFA A;  3F2C A;  4I2G A;  3Q8S B;  5AKE A;  1DOQ A;  1CRX A;  1JIH A;  2K8A A;  3O0F A;  2ESE A;  2MRL A;  3JPP A;  4YMN A;  3M8R A;  4XA5 A;  4NWI A;  1B0X A;  2KD1 A;  2WF8 A;  2KOB A;  4KLH A;  5KFO A;  3IV6 A;  3WKE A;  2F8L A;  4ECQ A;  1L7P A;  2QAR B;  4DQI A;  1NK4 A;  3EW9 A;  1GO3 F;  4UBB A;  4KLQ A;  2RRD A;  4JK1 A;  5DQI A;  3UPQ A;  5ALL A;  2P6U A;  2R8I A;  5J2E A;  4EEN A;  3C1Y A;  5J2I A;  1VJ5 A;  2D8C A;  2ZUC A;  4YFK A;  2ISP A;  4QW9 A;  9ICH A;  1WWV A;  1SXE A;  3BQT A;  2XGQ A;  3NRW A;  4EBE A;  1B4F A;  4BXO B;  5AK4 A;  2QKQ A;  1JMS A;  5AIB A;  1ZQI A;  4USA A;  1FFU A;  2Q4T A;  4M6W A;  4ZH4 A;  4Q43 A;  2W9B A;  3R9K A;  3MAB A;  5KL1 B;  5EE1 A;  2Y9U A;  4YXM A;  3V6K A;  9ICU A;  2IA6 A;  3CYM A;  2O6K A;  4O0I A;  2P66 A;  1T7P A;  4YR2 A;  7ICP A;  4F8R A;  3GIK A;  4KN7 A;  4PHA A;  1ZQD A;  3RJK A;  3Q8P B;  7ICO A;  1LVH A;  5J0W A;  5J2D A;  2F77 X;  1NK9 A;  4LZD A;  5ALP A;  1JXL A;  2HDO A;  2IMW P;  3H8J A;  4UAW A;  3NGD A;  2PFO A;  3BQ0 A;  3MR6 A;  5TIS U;  5L9X A;  2HBL A;  1SL1 A;  4M04 A;  3WK4 A;  4BWM A;  1X42 A;  2H3V A;  2ZXH A;  1X40 A;  3UMC A;  4BDP A;  5AIC A;  4NM1 A;  4ED6 A;  8ICX A;  1JXE A;  1SXD A;  3NS1 A;  4M6W B;  4DL3 A;  1MA7 A;  3PR4 A;  1KBU A;  4BUG A;  1WWU A;  2JZB B;  3HT3 A;  3BZK A;  1MQ2 A;  3RJJ A;  2E8N A;  4UB8 U;  4US8 A;  1U9L A;  2M9N A;  3RJG A;  1NK0 A;  3G6V A;  4DSJ A;  2FMS A;  2ASL A;  1BPX A;  2GWS A;  1HIW A;  3SI8 A;  2G08 A;  8ICB A;  2KIW A;  4Y2U A;  3KHH A;  4B9V A;  1K1S A;  3WKC A;  5AKH A;  3H8S A;  2WTF A;  2AQ4 A;  2EZX A;  9ICQ A;  1NJW A;  4FZN A;  2BCV A;  1O03 A;  4QZD A;  3DEE A;  9ICJ A;  1UHU A;  5J8Y C;  2QB0 A;  3OSP A;  1X9W A;  1COO A;  4UB1 A;  1SKW A;  4I2J A;  1MSW D;  4C80 A;  1RQL A;  4O3Q A;  2AGO A;  1ZQK A;  1NK8 A;  3WK8 A;  3PW0 A;  2ZIW A;  2OWO A;  2XY7 A;  1C20 A;  4DSL A;  3H7I A;  3K1Z A;  3I28 A;  9ICT A;  1ZQB A;  4ELU A;  3TAD C;  1X9X A;  5KG0 A;  4YD2 A;  3M7D A;  4F5R A;  2RQ5 A;  8ICN A;  4GFJ A;  1D9F A;  5ALQ A;  1ZQZ A;  3OHB A;  2XCA A;  5ALW A;  3PSF A;  3MDC A;  1NKB A;  4MEY A;  5G5H A;  2CN1 A;  2KZZ A;  5KG5 A;  2A1A A;  4DSE A;  5KT2 A;  4IR9 A;  1M6Y A;  2HHS A;  3Q8K A;  2K8B B;  4C4S A;  3GU3 A;  4KX3 A;  4IC9 A;  1IXR A;  4PL2 A;  4GC7 A;  5ALE A;  3KFU F;  1Y88 A;  1SB3 C;  2AQ0 A;  4M9G A;  2XIC A;  1SL0 A;  2OH2 A;  2ZIW B;  3JPN A;  5DGB A;  1AQ6 A;  4R8U A;  3JPO A;  7ICK A;  3M6Z A;  1SZH A;  3NRZ A;  3AU6 A;  3FM9 A;  1S76 D;  1TFR A;  1XO1 A;  3KD3 A;  1KL9 A;  4UB3 A;  4IRK A;  8ICY A;  1IM4 A;  5TZV A;  2PI4 A;  2LHT A;  1PK1 B;  2HOF A;  1RPL A;  1LV5 A;  2DL0 A;  1Z00 A;  5ALH A;  1FFV A;  4O5C A;  2YN4 A;  4NY8 A;  3RJE A;  3QU5 A;  3E0F A;  2K8C B;  4FZM A;  4JV0 A;  3OSN A;  4YD1 A;  2BPG A;  1X9M A;  3F2B A;  4CF3 A;  1U4B A;  4KLG A;  4Y2T A;  4EZ9 A;  4ECY A;  2KKP A;  1ZQS A;  3M9N B;  3RH5 A;  4Z6C A;  2BQ3 A;  3UM9 A;  4C7Z A;  4RPZ A;  3LWL A;  2AH5 A;  3PVX A;  2DF4 B;  5J2J A;  5DQG A;  2JMG A;  2OEH A;  9ICP A;  3QEB Z;  5D4B A;  4UAY A;  4R8U B;  2AHO B;  4JB3 A;  5DBA A;  2D6F C;  1Z19 A;  1ZYQ A;  2GO7 A;  3D2Q A;  4DL7 A;  4C4T A;  2MA1 A;  2LYB A;  4TQR A;  1K1Q A;  5AM4 A;  1Z00 B;  1ZQG A;  2K89 A;  1UQV A;  2LBO A;  4DF8 A;  2AGP A;  2KE7 A;  3HIL A;  2RDI A;  5DG7 A;  1MQ3 A;  3RJF A;  1ZD4 A;  1ZQE A;  4QW8 A;  1ZXI A;  4C8K A;  5KFX A;  1D8L A;  3QU2 A;  5E79 U;  3KKA C;  4PGQ A;  2ZIX A;  5J0U A;  4UAZ A;  1XSP A;  2Y1J A;  2F2A B;  3PV8 A;  4RNO A;  3H40 A;  3CRX A;  5DLG A;  2JEI A;  4MFA A;  7ICQ A;  2K4P A;  3PW5 A;  4P4O A;  1A6S A;  4FFD A;  4GXI A;  8ICQ A;  2IOH A;  5DB8 A;  2XO7 A;  4Y2S A;  1S0O A;  3D2N A;  3AN1 A;  1PUZ A;  1PK3 A;  1UT8 A;  4RQM A;  2H5X A;  2HSZ A;  2DGZ A;  2JRZ A;  2YMM A;  2RLT A;  3V72 A;  3SAF A;  1TV9 A;  2XY6 A;  5J2K A;  3V6J A;  2XC9 A;  4OCZ A;  1ZQN A;  3IRU A;  3KZI U;  2R8H A;  2WF9 A;  5KFQ A;  3WU2 U;  5T14 A;  4FO6 A;  4Q44 A;  4IQU A;  7ICE A;  2ZIX B;  3L5K A;  3RRG A;  1ZRM A;  5GTI U;  4ZOH C;  2BHN A;  2IOF A;  3SV3 A;  1N48 A;  2RHF A;  3LVW A;  4F93 B;  1XS9 D;  4ICA A;  1H38 A;  3BS7 A;  2BR0 A;  3MGV A;  9ICE A;  3ALR A;  7ICF A;  3RB4 A;  4RQN A;  1J2N A;  2BGW A;  4OJ6 A;  4DFM A;  1QTM A;  2I1Q A;  4B9M A;  1ZJN A;  2BQU A;  4DSK A;  5KT3 A;  1ZQP A;  5J2A A;  9ICA A;  4U7C A;  1V97 A;  5L1I A;  2JV3 A;  3WKB A;  4BJQ A;  1OXJ A;  5EE9 A;  5KFP A;  3PY8 A;  4F4Z A;  1S10 A;  5J2H A;  1S0M A;  1S97 A;  3MFI A;  2YML A;  4X5V A;  4YR0 A;  4US9 A;  5BOM A;  3BS5 A;  3QU9 A;  4O3N A;  3ZI4 A;  2HMX A;  5KTQ A;  2RDJ A;  3MC1 A;  2VJ4 A;  8ICA A;  3GFK B;  1QQ6 A;  3QE9 Y;  3SMV A;  2ZIV B;  4OJ5 A;  2WAQ C;  3LWM A;  3THV A;  1BGX T;  1ZQW A;  1HUZ A;  2BZF A;  4KLO A;  5J0O A;  1BNO A;  3H0M B;  2W43 A;  3QUT A;  1TVA A;  2AGQ A;  4AYB F;  2FJ6 A;  4Y2X A;  3U26 A;  1HUO A;  2C2R A;  4MFC A;  3N7R C;  2FPK A;  2ATL A;  2Y1I A;  4GXK A;  1S8O A;  2G07 A;  2Y9T A;  2ZIU B;  1KDH A;  3T5L A;  2LYH A;  4P0P A;  4RUA A;  2PMZ F;  5JTI A;  3F53 A;  5J0X A;  2A1J B;  2WAQ F;  2E8P A;  5AKG A;  4R65 A;  5ALN A;  2UVU A;  1ZQY A;  8ICC A;  1ZQQ A;  2F1J A;  4PH5 A;  3ISC A;  1A0P A;  3BS5 B;  3MR3 A;  4DOB A;  4F3O A;  4KLS A;  1YT3 A;  4KTQ A;  2G5I B;  5ALJ A;  5EE3 A;  3FAH A;  2NO5 A;  9ICI A;  2HHQ A;  2MUT B;  5DKW A;  2KN7 A;  3HWT A;  2E3T A;  5GTH U;  4RQ5 A;  2BDP A;  3AEV A;  1KN5 A;  5AK5 A;  4Q8F A;  2R8G A;  1N2X A;  4CE6 A;  9ICK A;  1KLN A;  3ZD8 A;  2W55 A;  4MF2 A;  1VLB A;  4DL6 A;  2W11 A;  4PJ0 U;  1JRO A;  4TQS A;  3PW7 A;  4TUQ A;  2YB4 A;  4QIW F;  5ALR A;  4J9O A;  3TFS A;  1ZRN A;  2YB1 A;  1S9F A;  2HVI A;  5G5G A;  1NKE A;  1ZQU A;  3FYH A;  5HR6 A;  4KLI A;  5J2C A;  4O3M A;  4P0P B;  4NL9 A;  3BQ2 A;  2LM1 A;  2OHF A;  4JWN A;  4C8M A;  2VKQ A;  5J0Q A;  1F44 A;  3T5J A;  2JH1 A;  1CEZ A;  3ED5 A;  1QSL A;  2DQN B;  3GIL A;  1YZ6 A;  4KLE A;  7ICT A;  4FBU A;  3HP6 A;  1D8Y A;  4J9P A;  5IIO A;  4ECZ A;  2OCE A;  2PFQ A;  3QEA Z;  4CNQ A;  4DS5 A;  8ICL A;  4O3O A;  3TQ1 A;  4R66 A;  2FPL A;  4DOA A;  2E8O A;  2LI6 A;  2ZJ5 A;  1T3Q A;  4HAI A;  1NNL A;  5B66 U;  4O9M A;  5III A;  2FLL A;  3E2E A;  5F9N A;  3IN5 A;  1U49 A;  3H0R B;  1N60 A;  1SIJ A;  4KIT B;  2KHQ A;  4PZN A;  3C29 A;  3RBE A;  4RQ7 A;  3ICX A;  3AQF A;  4RU9 A;  1RXW A;  5DB7 A;  1TE2 A;  3WK9 A;  4ED1 A;  5IIL A;  5DGA A;  4K4G A;  4R64 A;  2YY6 A;  8ICZ A;  4KLL A;  7ICS A;  2AU0 A;  5DG9 A;  4ELT A;  1QSS A;  2NV3 A;  3N7S C;  1RYS A;  3UXO A;  4FS1 A;  3NAS A;  5A0L A;  3JPQ A;  3L4P A;  4I2B A;  4PHE A;  1XWL A;  1NI3 A;  4Y2J A;  2H3Q A;  3IDW A;  5L1L A;  2W9B B;  5ALY A;  4NV0 A;  2H3I A;  3HPO A;  2BCQ A;  3PSP A;  4R63 A;  5ALK A;  2WFA A;  4NLN A;  3HKZ F;  4J9R A;  3SD7 A;  4KLT A;  2PXI A;  5DLF A;  1B22 A;  4EEY A;  1X6I A;  1RZT A;  5AI8 A;  3RRH A;  8ICT A;  2LMR A;  4C4R A;  4UB2 A;  4M9N A;  4DSF A;  4DCC A;  4I27 A;  5C0Y A;  2KZ3 A;  3C1Z A;  3QXG A;  4B6J A;  2WF6 A;  4C0Z A;  1L7M A;  1OUQ A;  4QWA A;  4GC6 A;  2A19 A;  3IG5 A;  4QZA A;  3AU2 A;  5KT4 A;  1L3U A;  4K4H A;  1SV0 A;  3HX0 A;  3GIJ A;  2KP7 A;  3RB6 A;  8ICU A;  3JPR A;  5J0P A;  4RT3 A;  1URJ A;  1LKY A;  3OTQ A;  3N97 B;  4CDG A;  3TAP A;  1BNP A;  9ICW A;  3NVV A;  5KFU A;  1LB2 B;  4DFJ A;  3QZ8 A;  3F5A A;  2DFL A;  1ZQT A;  2KSO A;  5JRT A;  2BPC A;  3CNH A;  1ZQF A;  4QZ9 A;  9ICG A;  1QQ7 A;  5ALZ A;  2G09 A;  1TAU A;  1KKX A;  2EZZ A;  1ZQV A;  4IR1 A;  1ARO P;  2FPM A;  4IL6 U;  5ALM A;  4F2S A;  2I5H A;  4EX6 A;  2QB0 B;  4YN4 A;  2IHN A;  4QJF B;  2BCU A;  3C23 A;  3CW2 C;  5KG1 A;  1SWW A;  3WKA A;  3B9J A;  4IRD A;  1LKY B;  2NRX A;  1TAQ A;  2NRW A;  1S0N A;  2EAP A;  1U47 A;  3ZDC A;  2XCP A;  3A0H U;  1X9S A;  8ICG A;  1L5U A;  4XRH A;  4P2H A;  5IIK A;  9ICB A;  3B0X A;  5AK3 A;  2W9M A;  1NOM A;  4RQ3 A;  1S0V A;  2KSO B;  3SAH A;  3RJI A;  5KFW A;  2CXY A;  2BQR A;  1TAM A;  2W7P A;  2BDU A;  1SV4 A;  2KNJ A;  2V4R A;  2BKE A;  2ZJ8 A;  1UCV A;  2HI0 A;  7ICU A;  2IHM A;  1HJP A;  2JHD A;  5HML A;  3EWA A;  2K4H A;  2W9C A;  4LZG A;  4KX5 A;  2DUY A;  3MDA A;  2P35 A;  5KFC A;  1B43 A;  3V7K A;  5IIJ A;  4FE3 A;  5H2F U;  4OO1 J;  2YX8 A;  4J03 A;  5KFL A;  2EZY A;  8ICJ A;  2A3V A;  2F8K A;  4DOC A;  5J8Y A;  5EWE A;  4MFF A;  2C2D A;  4FZL A;  4P0Q A;  2UVV A;  2KIV A;  4WJ3 B;  2EH9 A;  1Q46 A;  1L3V A;  3C5F A;  3LVV A;  4I2D A;  1PVP A;  1Z4O A;  3E58 A;  4DFK A;  4B9N A;  2LYA A;  4FS2 A;  1QQ5 A;  2N1R A;  5AI6 A;  7ICL A;  1ECW A;  5AKZ A;  3TAD A;  3UMB A;  4RNM A;  2E8M A;  3ZDB A;  1ZQA A;  2V9W A;  2EDU A;  2KJ8 A;  2KVS A;  3HRD D;  5DBB A;  3LK9 A;  3N4M B;  1NK7 A;  4NJ8 A;  3K4G A;  4FBT A;  1NJY A;  2KKV A;  3UXP A;  4KLJ A;  4ECU A;  2KMD A;  3TI0 A;  7ICM A;  3M8S A;  2WB1 F;  1WCN A;  4G3I A;  4KMO B;  3G6Y A;  5B5E U;  2W03 A;  3PNC A;  3RJH A;  2KTQ A;  3MGH A;  2E1F A;  4DO9 A;  2ISO A;  4MEX A;  3MGI A;  1VDV A;  4QWC A;  3GQC A;  2P6R A;  3PW2 A;  2KHV A;  2B0C A;  4J9M A;  1JAL A;  4DLE A;  2E1E A;  1Z1B A;  4BX9 C;  4J9S A;  2ZTD A;  2DKX A;  2NRT A;  4Z6D A;  1Z4N A;  3DV9 A;  1T8E A;  5AIA A;  2KVC A;  8ICM A;  1N63 A;  3GV7 B;  3T5H A;  5CB1 A;  4DS4 A;  3PZP A;  2MAX A;  4QWB A;  2R8J A;  5K4L A;  3PX4 A;  1BPB A;  4K4I A;  1BPD A;  4YMO A;  4O5E A;  1TK5 A;  1QLN A;  1ZD3 A;  3K75 D;  3EPG A;  3PO5 A;  1J2M A;  4ECX A;  1SKR A;  3OPX A;  2HVH A;  2G5H B;  3GV5 B;  3M9O B;  4ED3 A;  1RG6 A;  4O3R A;  3NTU A;  4QZH A;  2GLE A;  3ISD A;  2OXO A;  3C21 A;  4PL1 A;  3D2S A;  3GII A;  3RTV A;  2ZTE A;  4ED2 A;  3TFR A;  5KFI A;  1SL2 A;  4OJL A;  3T3F A;  3QX7 A;  8ICE A;  1KSP A;  2JR5 A;  3ETL A;  4Z6E A;  1KTQ A;  1XC9 A;  5J2B A;  3KHL A;  2DKZ A;  4AYB C;  3SEN A;  5J0Y A;  2Y0S F;  1C7Y A;  4NL9 C;  4JV1 A;  4CF5 A;  2R8K A;  4KLF A;  4ED7 A;  7ICR A;  2W3R A;  4JUZ A;  4DL5 A;  4F2R A;  2KJ9 A;  4C8O A;  2EAM A;  5CRX A;  2PMZ C;  8ICO A;  3TAC B;  3AUO A;  2LPE A;  5KT5 A;  5L1J A;  4IQT A;  3KKA A;  5AKI A;  3UXN A;  5AI0 A;  4F92 B;  4AP9 A;  1KFD A;  8ICW A;  2GOL A;  4Y2P A;  2HHV A;  2ZTC A;  4EEK A;  4YVZ A;  5ALI A;  3QU4 A;  4CF4 A;  2VAN A;  2F1H A;  1SZP A;  5AM0 A;  2W7O A;  4JWM A;  3NVY A;  1JI7 A;  4RQ2 A;  2C28 A;  1ZQL A;  1T3N A;  5KG2 A;  4QZC A;  1SKS A;  3PST A;  1A76 A;  2HHX A;  5EE0 A;  2JH7 A;  2NRZ A;  2RP5 A;  4QZE A;  5L1K A;  4C8N A;  7ICN A;  4YP3 A;  5J0T A;  4QIW C;  1L3S A;  4DL4 A;  3MBY A;  4O5K A;  2F1I A;  2AXT U;  2QAR A;  2WHE A;  3KHR A;  2MSN A;  2F3N A;  5KFF A;  1KW4 A;  3CP8 A;  3OHA A;  4I2H A;  4XQ8 A;  1QSY A;  4GLX A;  4F5Q A;  4RQ6 A;  3Q8M A;  2BPF A;  1D8B A;  1A77 A;  4UAR A;  1N62 A;  2I9G A;  8ICP A;  4UB5 A;  5CP2 A;  4IRC A;  4I2A A;  3LDA A;  5JUM A;  3C28 A;  1ZQJ A;  2ZUB A;  4NLB A;  3F5E A;  1HEK A;  4U6P A;  2DPJ A;  3NVW A;  3EUB 2;  2ES6 A;  1DGS A;  2VA3 A;  3RR7 A;  2LM4 A;  3JPT A;  3UQ2 A;  4O3P A;  4YMM A;  4QZF A;  5HP4 A;  1KQQ A;  4F5P A;  3ZD9 A;  3PR5 B;  9ICM A;  1F0M A;  2M0N A;  1ED1 A;  1L6N A;  4QNL A;  3AQE A;  2G06 A;  5KFA A;  1ZQR A;  4DFP A;  5L1M A;  4QZ8 A;  4F4K A;  1FIQ A;  4BGD A;  4F4W A;  3TAQ A;  4F5O A;  2J6S A;  3B0Y A;  1DRG A;  4C7Y A;  1RM6 C;  8ICR A;  4DL2 A;  4ACO A;  2KEY A;  1KFS A;  5KFV A;  1XO0 A;  2KZM A;  2HOQ A;  3FC4 A;  3SEI A;  2F76 X;  1SV0 C;  2G0A A;  2XY5 A;  1KFT A;  3SZ2 A;  3TAN A;  1ZQO A;  1WCL A;  5KL8 B;  4MF8 A;  2XGP A;  4B9U A;  4UW9 A;  1UA0 A;  1N61 A;  2WF7 A;  8ICI A;  4RNN A;  3C2M A;  1DK3 A;  3KTQ A;  2WF5 A;  2HCF A;  5AM1 A;  1L3T A;  5AKX A;  3T5K A;  4C8L A;  2ZJA A;  5AKL A;  1L7N A;  5AM3 A;  1X2I A;  5AI4 A;  2FLN A;  4I2F A;  1NZB A;  3ORY A;  1NK6 A;  2W9A A;  4B9L A;  1NZP A;  4I2I A;  3WK6 A;  2JZB A;  4NLG A;  1L8O A;  3QUC A;  5KFJ A;  2D3D A;  4YG2 A;  4KLM A;  3HKZ C;  3K1R B;  1V85 A;  3ISB A;  5DB9 A;  1DGJ A;  5J2G A;  1ZQ1 C;  2BCS A;  2QLT A;  4QZG A;  1RDF A;  3JPS A;  3Q8L A;  3ONN A;  3T79 A;  2FMQ A;  4I2C A;  7ICV A;  2FE9 A;  1JX4 A;  2K4I A;  2JEJ A;  3H0L B;  3C2L A;  4JV2 A;  1DK2 A;  1L8L A;  3SYZ A;  1X66 A;  4F91 B;  4B9S A;  3H8M A;  5AHX A;  4TUS A;  5KFS A;  1Z3E B;  3C2K A;  3LYS A;  3RAQ A;  1JRP A;  4DSI A;  5ALO A;  5AM2 A;  4DFD A;  4M9J A;  4QZI A;  1TK8 A;  4NLC A;  5EWG A;  5CWR A;  3EYZ A;  1F5S A;  1WYG A;  3IG8 A;  1ZD2 P;  5KAF U;  2ASJ A;  3RB0 A;  2B6G A;  5KFT A;  8ICH A;  4PGX A;  3G6X A;  9ICO A;  3GV8 B;  1K5O A;  1RQN A;  1BVS A;  2CPR A;  5J29 A;  5FP0 A;  2YMP A;  2LKY A;  3VCB A;  5ALG A;  5HHI A;  2OM6 A;  4BWJ A;  3EPI A;  2QB1 A;  2JEG A;  1Q8K A;  2HBM A;  1EXN A;  5KFY A;  4UB4 A;  3OJU A;  1DXS A;  1U45 A;  2DWQ A;  4CGZ A;  1CI4 A;  2JXJ A;  4UB6 U;  5AKJ A;  7ICI A;  4E0D A;  5C5J A;  3I1Y A;  4EBC A;  4EEL A;  1NKC A;  4DEZ A;  4TUR A;  5DB6 A;  4DQR A;  2F44 A;  4RQ1 A;  4OD0 A;  2XI9 A;  2MU2 A;  2C22 A;  3Q8Q B;  1O08 A;  1ZET A;  5KFG A;  2W3S A;  9ICC A;  1V38 A;  5HR7 A;  2HW3 A;  5IIM A;  3WK7 A;  2XID A;  4RQ4 A;  3PSI A;  2Q0Z X;  4F4Y A;  2W8K A;  3OGU A;  1PK1 A;  1P7D A;  4PZO A;  4PHD A;  4Y2V A;  4GIB A;  1NK5 A;  3QNM A;  3QUB A;  5KFM A;  4F4X A;  2VIX A;  3ETR A;  5KAI U;  4Q45 A;  2ZXI A;  3M9M B;  4DQQ A;  5CEH A;  1JUD A;  2EAO A;  9ICV A;  3KOO A;  1JN3 A;  4RQ0 A;  4B9T A;  5DDM A;  3PO4 A;  1ZQC A;  4M9H A;  3GZF A;  4TUP A;  4KLU A;  3PX6 A;  1ZQH A;  5KG3 A;  5KFD A;  2EAN A;  3L3F X;  3SQI A;  8ICV A;  2NRV A;  4NXZ A;  1IIP A;  2NO4 A;  3ZDD A;  2FI1 A;  4KMU A;  5IIN A;  5J0R A;  5CR0 A;  2H3Z A;  3DDH A;  3QYP A;  2EQY A;  4JMU A;  4RUC A;  2PFP A;  3HJE A;  3MR2 A;  2YMQ A;  3TAR A;  3WK5 A;  2K4E A;  4UAV A;  4RPX A;  1XSN A;  3RB3 A;  5D49 A;  5ALU A;  1MN8 A;  3QU7 A;  2UVW A;  1PZN A;  3IHQ B;  3H4B A;  5KG7 A;  4EBD A;  3J81 j;  2XVT A;  1UA1 A;  1ZQX A;  2W8L A;  1SWV A;  4F50 A;  1WUD A;  1RYU A;  2FLP A;  5BPC A;  4O3S A;  8ICK A;  5KNI A;  3D6J A;  3AM9 A;  2YTU A;  5ALV A;  3FDS A;  5ALD A;  1OW5 A;  1FO4 A;  3SAG A;  2E5S A;  1ZQM A;  1S77 D;  4NLK A;  2KV2 A;  5AI5 A;  5CA7 A;  4ED8 A;  5KFH A;  5ALT A;  3BZC A;  1IV8 A;  3EZ5 A;  2FMP A;  2KK0 A;  2WB1 C;  2B21 A;  5KFR A;  3V7J A;  2DBY A;  4UQG A;  2J6T A;  1COK A;  4QWE A;  2W54 A;  1TK0 A;  2HHT A;  1ZOL A;  4LJX A;  4A8E A;  4QWD A;  2YQE A;  4Y2Y A;  3RR8 A;  4UAU A;  5F9L A;  2Z7J A;  5AK6 A;  1UT5 A;  5AM5 A;  4UBC A;  1FEZ A;  2VA2 A;  2HBK A;  3KZX A;  3BDP A;  3RH6 A;  2IBK A;  4RQ8 A;  2I6X A;  4ECV A;  4PPX A;  2J6U A;  2W9C B;  5F3X B;  1BPE A;  4PGY A;  1RXV A;  5ALX A;  4M0A A;  5KT6 A;  4J9N A;  3VC8 A;  1NJZ A;  3TKA A;  4EX7 A;  2JGA A;  1IG6 A;  1Z1V A;  2KFZ A;  3PX0 A;  4DQP A;  1L7O A;  1KEJ A;  3M1Y A;  5J2F A;  4DQS A;  2ALZ A;  4DWI A;  1T94 A;  2KG5 A;  4J9K A;  4G9B A;  8ICF A;  5AI9 A;  3PMN A;  4P0Q B;  2ASD A;  4M9L A;  3N7P D;  3RBD A;  1V9P A;  5JU5 A;  4ED0 A;  3C5G A;  3NUQ A;  2UVR A;  2IOF K;  9ICR A;  2VA8 A;  1ZJM A;  3UMG A;  4LVS A;  4Y2Q A;  4RZR A; 
#chains in the Genus database with same CATH homology
 2EDU A;  2I5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...