2EDUA

Solution structure of rsgi ruh-070, a c-terminal domain of kinesin-like protein kif22 from human cdna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
98
structure length
98
Chain Sequence
GSSGSSGEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESFLKANILGLAAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF22
publication title Solution structure of RSGI RUH-070, a C-terminal domain of kinesin-like protein KIF22 from human cDNA
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 20
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12836 HHH_3 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2eduA01
2I5HA 2EDUA
chains in the Genus database with same CATH superfamily
4YD1A 1JALA 2D8CA 2BGWA 4B9TA 5KG0A 5KFKA 5DB9A 1ECWA 1T94A 5L9XA 4UATA 4C80A 5KFYA 1H38A 1JUDA 3F2CA 2W9BA 2Y0SF 2A1JA 2KZ3A 4I2FA 3PMLA 4DF4A 4F4KA 2BDPA 1BNOA 3NRWA 1N5XA 2ZUDA 3QE9Y 5HHHA 1KN5A 1N62A 4QZCA 3EPGA 2MUTA 3SAGA 4KTQA 2HHQA 4PZNA 4JV0A 5IIJA 1B0XA 2K4IA 2LYAA 3M9NB 4FS2A 2IOFK 5AM3A 3K4GA 2JRZA 1ZQSA 1ZQIA 4QWDA 5KT6A 4M9GA 4M6WB 2BKEA 5AKYA 3SAFA 3BQTA 2W54A 1XSPA 1TV9A 4TURA 4KN4A 2ZTEA 3WK8A 3KHHA 1SWWA 4DL2A 2BPCA 2ZIWB 2P6UA 1L8LA 2M9NA 4RQ5A 3PSPA 5L1IA 1COOA 5ALHA 5J29A 2FLLA 3MABA 1UT5A 9ICRA 2BQUA 7ICQA 1QQ6A 3BS7A 1S0OA 1HUOA 3RJHA 5F9LA 1IXRA 4PZOA 3BQ0A 5HNKA 1S0VA 1V38A 4I2HA 2HBMA 1MA7A 3C23A 3BZCA 3C2MA 4NV0A 2RLTA 3I28A 3SR6A 3LVWA 4P0QB 1S0NA 2ASDA 2ZXHA 4MEYA 3CRXA 3SYZA 3V6KA 1L6NA 2KZMA 3C5FA 7ICIA 2EAPA 5AM0A 4ED0A 3OPXA 3BS5B 2JEGA 8ICXA 2QB0B 5AI9A 4QWBA 7ICRA 4FFDA 8ICYA 1NK4A 4F93B 5BOMA 5AM2A 1MN8A 2KJ5A 4F4ZA 3H0RB 1NNLA 1M6YA 5ALNA 3N7SC 3RBEA 3ALRA 2BCSA 1CUKA 4QZEA 4B9MA 1K1QA 4I2GA 2VKQA 1UHUA 1FO4A 2AQ4A 7ICJA 3LYSA 1DGJA 1F0MA 2OYYA 3PNCA 2AGOA 3EUB2 7ICUA 2JR5A 3UXNA 2DF4B 2MRLA 8ICEA 4G9BA 1S76D 5KFIA 5CJ7A 1SWVA 5DDYA 4UB5A 3ORYA 4PHDA 2AJQA 5EWGA 4KLMA 3RB4A 4OD0A 1NKEA 7ICTA 1QSLA 5ALVA 2HDOA 3MR6A 4Y2TA 1SV4A 3HRDD 1DRGA 4C8LA 2ZTCA 5J8YA 3BJYA 3U26A 5B5EU 3RH6A 4DSFA 4BXOA 1KRPA 1J2MA 8ICWA 1LB2B 1UCVA 5AIBA 3QUQA 4FBUA 5ALLA 4TUSA 1QH9A 4QWAA 5ALXA 3V6HA 1PVRA 5KG4A 2W55A 2B6GA 1N56A 2WB1F 4Y2YA 1FFVA 3IHQB 2EZZA 1NKCA 5J0QA 5KFCA 4KLQA 1SXDA 4M6WA 3EWAA 3BQ7A 4CF3A 4ECZA 3WU2U 2OHFA 5J0SA 4QJFB 5L1LA 1NZPA 3F5EA 4FZLA 2V4QA 2F8KA 9ICOA 4HAIA 4I2CA 2AHOB 2VJ4A 2ZIWA 4YVZA 3FYHA 2F76X 1RYRA 3FDSA 2DKZA 3H0MB 1KFTA 3WK5A 4C8KA 1S97A 4KLOA 2GOLA 4US9A 2VA3A 3FM9A 2EAOA 4DL3A 4UB6U 1X6JA 4A8EA 3PMNA 4J9LA 3J81j 3M9MB 1ED1A 3B0YA 4BJQA 3T5KA 1ZQQA 4C7YA 1N61A 2KTQA 4XA5A 2VANA 4DL6A 4RQ6A 1QSYA 4ED1A 4B9UA 1Q8KA 9ICXA 2ZUBA 5ALSA 2ZG6A 4C4SA 1ZQFA 3H4DA 1Z4NA 1D9DA 2JH7A 1RXWA 4M04A 5KG3A 3Q8LA 2HCFA 3PY8A 1Q46A 3IRUA 5KFQA 3RBDA 2G5HB 2GH1A 5CEHA 4C8NA 5IILA 5D46A 3GDXA 2GWSA 2C2EA 5KFRA 3ISCA 3UMCA 4UAZA 8ICLA 1QLNA 3NVYA 4F5QA 3T3FA 4B9NA 2L5YA 3QU7A 1SL1A 2ZXIA 3KFUF 3Q8MA 5KFLA 2XCAA 5ALUA 4RQ1A 3T5LA 2KSOA 5CRXA 2E8OA 3RH5A 1WCNA 2QLTA 1Z4OA 2KHQA 4PHAA 4EEKA 2VIXA 4NM2A 2QARA 3IM1A 4ED2A 5T14A 2HOQA 3HPOA 4DOAA 3H8JA 1Q3UA 5J2DA 1F5SA 3TADC 1KTQA 3C1YA 3QU2A 2E3TA 4O3SA 2W04A 2KKVA 3LDAA 3RB0A 1NK9A 4B6JA 1L3VA 3GIJA 4FO6A 1ZQEA 4RPXA 2CRXA 4EBEA 3OTQA 5A0LA 4UAUA 4O0IA 4RT3A 3RRHA 1C7YA 2K4PA 5HMLA 4M0AA 5AKEA 2ALZA 5AK4A 8ICCA 5KFVA 5HR6A 4DQQA 4MF2A 3LWLA 3LK9A 2KMDA 2IMWP 2Y9UA 4RPZA 4OJPA 8ICSA 3GV5B 4CRXA 1Z19A 4MHVA 4Y2UA 2R8HA 5J2HA 8ICJA 2AXTU 4ECSA 3NGDA 3JPOA 2FLPA 1L7PA 1X42A 4F71A 7ICMA 4O5EA 2KJ9A 2MSNA 3GFKB 2JGAA 1CEZA 4KX5A 5IIMA 9ICQA 2G06A 5ALYA 4O5CA 1ZD3A 3UXPA 5IINA 3DDHA 3OSPA 4O3RA 4I28A 2PMZF 3ETLA 2KEYA 2K8CB 2DPIA 4FBTA 4KLSA 2EZXA 2VA2A 4B9VA 4U6PA 8ICOA 4FZNA 1HIWA 4LZGA 3SD7A 5F9NA 3AM9A 8ICBA 1X40A 4QZGA 1P7DA 2PXIA 5DQIA 3IG8A 3VCBA 4LJXA 4QZAA 3M8SA 8ICAA 5KFPA 1NJYA 2FDRA 1O08A 3SENA 4NLNA 4NLCA 3WK7A 4EZ9A 2H3QA 3IG5A 3IN5A 4EBDA 3NRZA 1LKYB 5C0YA 1B4FA 3MGIA 4BGDA 4YFKA 1UA0A 3T79A 2UVRA 4DFMA 5CB1A 5AI8A 4CGZA 1L5UA 1DXSA 1UQVA 4UAWA 5ALWA 3TFSA 1X2IA 1JX4A 2HHWA 4I2IA 3AQEA 1FEZA 1SL0A 3OHBA 1KEJA 3PVXA 3QUTA 3KHRA 2R18A 4YD2A 3LWMA 2B21A 4AYBF 2WB1C 4PPXA 1T3QA 3SZ2A 2XY6A 9ICBA 4DFKA 1Z00A 2ZJAA 4GFJA 4I2DA 4IRDA 3MBYA 2XGQA 1DGSA 4UB8U 3JPPA 1ZQWA 4GC6A 4F5OA 4ED8A 3MGHA 2E5SA 3OSNA 2PFPA 2BR0A 1HJPA 5G5GA 4KLJA 5EE1A 4EZ6A 3NUQA 3PX4A 5L1KA 1Z1VA 2DUYA 3HWTA 3KKAC 5ALZA 5J2JA 4YR2A 5AK6A 4ED6A 3AUOA 3KHGA 4DL4A 4F5RA 1KL9A 2HBJA 1ZD2P 2CPRA 4USAA 5ALKA 8ICNA 1S8OA 3RFAA 4QW9A 9ICWA 3OJUA 3I76A 1SZHA 3G6XA 4EX7A 1ZQLA 1PVPA 2E8MA 1J2NA 3UMBA 2ZIXB 4MEXA 4DCCA 1N48A 4F3OA 1TAQA 2N1RA 3KD3A 3N7PD 3D2SA 5TISU 4DOBA 4PHPA 4GIBA 4UB1A 3RJFA 1ZQBA 5AICA 1OW5A 2NRXA 2KVCA 2E1FA 2E1EA 2ESEA 3QU5A 2DKXA 4OJOA 2ATLA 3MR2A 1JMSA 3L3FX 5AM4A 2NRWA 4J9MA 1KBUA 4P0PA 2ZIVA 2HHTA 1XO0A 3Q8KA 2HOFA 3BZKA 3WK6A 5AKXA 5KFTA 9ICAA 2K89A 5AM5A 1ZJNA 3M6ZA 1ZRMA 4DO9A 5AHXA 2C28A 4PGYA 2KK0A 5EE0A 2ZIUA 3PW4A 1L3SA 4BDPA 2HBLA 2OWOA 3MGVA 4DFPA 4Z6FA 2PI5A 4MFFA 5KFSA 8ICHA 4F92B 2V4RA 1PZNA 7ICVA 4B9LA 1ZQTA 5IIIA 3E2EA 2DQNB 4I2BA 2R8JA 2YN4A 8ICVA 4UAVA 1RQLA 1ZQCA 4QZFA 2FJ6A 4YCXA 2LYBA 5KG2A 2I9GA 4O5KA 4PJ0U 1U47A 1Z1BA 1ZQAA 4DQIA 5DG9A 3EPIA 3RR7A 2PFOA 5D4BA 3FC4A 2BCQA 5AK5A 2WF6A 2XC9A 4IRKA 2MA1A 2LI6A 2XIDA 1S77D 2YTUA 5BOLA 4DEZA 3ZD8A 5KG5A 4FE3A 7ICGA 1X9WA 4ECQA 5AKHA 3CYMA 5KFBA 4GLXA 2OEHA 1YZ6A 2KD1A 3RJKA 4B9SA 2Q0ZX 4RZRA 1A76A 5FP0A 3KBBA 2XI9A 1KLNA 5JTIA 4KLGA 7ICSA 1PUZA 5D49A 4JWNA 4EELA 4IR1A 3KZIU 3C21A 2W9AA 2B0CA 3F53A 1NZBA 4ECVA 3NASA 5EOZA 2JEIA 4KMOB 3AQFA 5L1JA 3TAPA 4NLBA 3M1YA 4ELUA 4JB3A 4RPYA 2K4EA 2G07A 1FIQA 2KP7A 3K1ZA 3UXOA 1ZQHA 2IA6A 4UBBA 2VJ5A 1PVQA 2HVHA 2BCVA 5DGBA 2LM4A 5AKKA 2YMQA 5J0OA 2H3VA 2JEFA 5AKJA 1XS9D 3ISDA 4ECYA 4YN4A 3NTUA 2PMZC 3LVVA 1UPHA 2NYVA 3Q8SB 1S0MA 2QKQA 4KX3A 2BDUA 4NY8A 4RQNA 2OH2A 2DL0A 2JEJA 1BNPA 2BHNA 1JI7A 3DV9A 4F5NA 1TFRA 3WK9A 4YG2A 3PO5A 2RRDA 4O9MA 5AKLA 5KAFU 2ZIXA 5KT2A 4DQSA 4K4HA 4C4RA 4GXKA 3MFHA 3M9OB 3V7JA 3C2KA 5KFJA 1NK8A 1XU4A 4O3OA 4NJ8A 5K4LA 4DQRA 4IQVA 4QZBA 2LYHA 1CI4A 5HMMA 8ICKA 2C2DA 2W3RA 3DEEA 2HHSA 2WF8A 1RXVA 3Q8QB 4F4XA 3H8MA 1L7NA 4OJ6A 1KKXA 3OJSA 1NI3A 1BPBA 4R63A 5KG1A 1T3NA 1ZQKA 4R8UB 2HMXA 3MR3A 4NLKA 1NOMA 4GXJA 3ETRA 5HHIA 4QWCA 2KOBA 2Y1IA 4DFJA 4AYBC 4R64A 1KQQA 3UMGA 1DK3A 3QUBA 5ALTA 5C5JA 4ZH4A 4Z6DA 4Y2JA 3ZDAA 9ICPA 4ECXA 5CA7A 5B66U 5J0WA 4TUQA 2NRTA 5KNIA 2RQ5A 1MQ3A 3T5JA 4PH5A 4GXIA 8ICPA 2K8AA 4DQPA 1TAMA 3Q8PB 1WCLA 3RAQA 4DSJA 1RPLA 3VC8A 2ISPA 2AGQA 7ICEA 5CWRA 4BWMA 3N97B 2CN1A 5DDMA 2HI0A 3WKCA 5DGAA 4P0QA 3SAHA 4PHEA 4RNOA 1SV0C 2PFNA 1L7MA 4XUSA 1YT3A 4YXJA 5HP4A 3GILA 3PW5A 8ICUA 2F1HA 3SQIA 9ICEA 3QNMA 2WF5A 2UVWA 3MR5A 3BS5A 3AU2A 2QB0A 3O0FA 2K8BB 2F1JA 2KJ8A 2KV2A 3GQCA 1ZQXA 2JXJA 2JZBB 1NKBA 1D8BA 3RJIA 2BCRA 2HHUA 4EYHB 2RDIA 5J2KA 2YY6A 3OGUA 3UM9A 1VJ5A 2BCUA 3C29A 2EH9A 3CW2C 7ICFA 1JRPA 1S10A 4I29A 1NK0A 3PR5B 4QZHA 4BX9C 3SV4A 4EBCA 5KAIU 3AN1A 5EE9A 5J2BA 1KFSA 1SB3C 1URJA 2F44A 4CCHA 3C2LA 5AKIA 5KFAA 1WWUA 4XRHA 4J03A 2NO4A 3GU3A 3Q8RB 4UB4A 9ICJA 5AI4A 3JPTA 1ZQ1C 7ICNA 1EXNA 2JH1A 2C2RA 4KLIA 1SKRA 3A0BU 5KFZA 2FLNA 1ZD5A 3NVZA 1RG6A 5KL1B 7ICHA 4M2YA 3BQ2A 3WKDA 2WTFA 9ICVA 2EANA 3GV8B 4YR3A 4F2RA 2XY7A 1RYSA 4C8OA 1KFDA 2W9BB 3D2QA 2A1JB 8ICIA 4F50A 5ALOA 3PZPA 3L4PA 2FMPA 3WK4A 4Q43A 1TAUA 1Q3VA 5KFXA 1WYGA 1PK1B 3ZDBA 2LHTA 3HJEA 1NK7A 1ZQPA 5DBAA 5H2FU 1F44A 4C8MA 4M9JA 4DOCA 1VDVA 2MUTB 2NO5A 1L7OA 3RAXA 4RNMA 3WKBA 3K1RB 1JROA 2DGZA 1NK5A 5IIKA 4KLTA 9ICUA 4OJ5A 1Z3EB 4JV2A 5JRTA 1KSPA 9ICGA 3ED5A 3WKEA 3B0XA 4F91B 1V97A 3HILA 4EX6A 3QUCA 2PI4A 3WKAA 2UVUA 3HW8A 3H0LB 3D6JA 5AI6A 4CE6A 4BWJA 1U49A 3NVWA 3M6KA 4NWIA 5KFUA 1X66A 2YB1A 1ZETA 3R9KA 3F2DA 3NVVA 5J2GA 4EEYA 4RUCA 2R8GA 2HVIA 1B43A 4XQ8A 9ICNA 2MAXA 3TARA 5EWEA 5KFDA 4IQTA 5EE3A 4Y2VA 2I6XA 4DSEA 4K4GA 2D3DA 2JZBA 4C0ZA 2W8KA 3JPQA 3T5HA 1N63A 3TADA 1ZQJA 3H40A 5KFGA 1MSWD 4O3QA 8ICMA 9ICIA 1LVHA 5J0PA 4WJ3B 2QB1A 2NRZA 1WUDA 3RJGA 3F2BA 3GZFA 4LVSA 3PW7A 4FZMA 5GTHU 5BPCA 4RUAA 5J2FA 3FAHA 3GV7B 1RZTA 2XICA 4ECWA 1A0PA 3QX7A 4P2HA 2M0NA 4YP3A 5ALDA 2KZZA 1LV5A 1XO1A 5DLGA 1QQ5A 2IHNA 2H3ZA 3HKZF 3PSFA 2NRVA 2IBKA 9ICMA 4YR0A 1O03A 4DL5A 3RRGA 1TK8A 2F3NA 3V7KA 4IQUA 4M9LA 4UBCA 4UASA 4M9HA 1XWLA 3SI8A 1X9MA 4KLEA 3KOOA 2XVTA 4NL9C 3GIIA 4DL7A 3MDAA 2HHVA 3TI0A 2YX8A 8ICFA 1XSNA 4RQ0A 2YQEA 5J0TA 4JMUA 4Y2SA 2KICA 1JN3A 3M7DA 3PX0A 2Y9TA 2K60A 1HUZA 2E8NA 1ZOLA 4KMUA 2BQRA 3F5AA 4J9PA 4RQ3A 3TKAA 2DBYA 1D8YA 4Y2PA 2BZFA 5AKZA 4KLHA 5KFWA 2ISOA 2NV3A 4Q44A 3TQ1A 3TAQA 4J9NA 4OJLA 2J6TA 3GIKA 2BPFA 5J2EA 4UAYA 2E8PA 1PK1A 4PL1A 5DKWA 2J6UA 4BXOB 3D2NA 3UQ0A 2KIWA 4O3NA 1ZQMA 4YMOA 2ASJA 1TKDA 3PW0A 4ZOHC 1SIJA 1XNSA 4IR9A 4Q8EA 4BUGA 4IL6U 2BPGA 1TK5A 2LKYA 2EQYA 3MFIA 4NXZA 2HHXA 2O6KA 5CP2A 1ZQGA 1N2XA 5KT5A 1JXEA 5J8YC 1QTMA 1CRXA 5KT3A 3SEIA 1SGGA 2FI1A 4NLZA 1UT8A 8ICZA 2ASLA 2FPMA 2R8IA 4KN7A 8ICTA 5AM1A 4CDGA 3OHAA 5F3XB 2KE7A 7ICPA 1T8EA 1LKYA 4RQ2A 1XC9A 3ICXA 2UVVA 3SMVA 1U48A 4QZ9A 4RU9A 3BDPA 5HR7A 2HSZA 2KFNA 1PK3A 2KHVA 3PO4A 5IIOA 1BGXT 2F1IA 2FMSA 3PSIA 4DS4A 4LZDA 2PFQA 3JPSA 3H7IA 2LPEA 3KKAA 3V72A 9ICKA 4KLDA 4YXMA 2K4HA 5KFHA 4NL9A 4Y2XA 3E0FA 3CNHA 4O3PA 1ZYQA 5GTIU 4PL2A 5AI5A 1ZQDA 3TANA 2ZUCA 5DBCA 1MQ2A 1SL2A 1OUQA 5DG8A 3MC1A 5KG7A 4PGQA 2W7PA 2GO7A 2W7OA 2KNJA 2F8LA 4J9KA 4QZ8A 3RTVA 5DLFA 2Y1JA 5L1MA 2WFAA 2ZJ8A 1YZ7A 4ELTA 1UA1A 1IV8A 2Q4TA 1BPYA 2KSOB 4I2AA 9ICTA 3H4BA 3TACB 4DWIA 2WAQC 2XO7A 2W03A 5J2IA 4EENA 3RB3A 1NJZA 2IHMA 2QARB 3RJEA 3HX0A 4IS7A 3PV8A 1RM6C 5AI0A 2XCPA 4NM1A 4F4WA 3KTQA 4TQRA 3RF9A 7ICKA 3KHLA 5TZVA 5EWFA 8ICGA 5KT4A 4OO1J 1FFUA 2P6RA 4QZIA 3SV3A 2W3SA 5KFMA 4R65A 1ZD4A 4P4PA 2W11A 4I2JA 3BQ1A 2J6SA 1WWVA 4QIWF 2FMQA 3IDWA 5ALFA 2G5IB 3AU6A 4F2SA 4CF5A 7ICLA 1QSSA 1MC8A 2DFLA 3N7RC 9ICSA 4RQ8A 4TQSA 1K1SA 3RH4A 3EZ5A 3B9JA 1WG8A 1BPZA 3V7LA 3ZDCA 2W9MA 4JWMA 2CXYA 4IC9A 3QZ8A 2XY5A 3K75D 4R66A 4RNNA 4OCZA 2ODGA 1ZQZA 2RP5A 1GO3F 1TK0A 3G6YA 4MFCA 5DG7A 4MF8A 4KLLA 3ZI4A 3GIMA 1IM4A 3IP4B 3PSTA 4MFAA 4QZDA 3IV6A 5J0UA 3ISBA 4ED7A 4YQWA 4DSKA 2IOFA 1A6SA 2AGPA 2Z7JA 2W9CB 2H5XA 2P66A 3HKZC 1D8LA 4JV1A 4NLGA 2ZJ5A 3QU9A 2H3FA 4RT2A 4F5PA 4ECUA 4EYIB 4QW8A 2OXOA 1TE2A 2WF7A 2RHFA 1BPEA 4Z6CA 3THVA 4X5VA 3M8RA 2I1QA 3C28A 1QCKA 2BQ3A 5J0YA 2KN7A 3NS1A 4JUZA 5E79U 5ALIA 4RQMA 3UQ2A 4K4IA 3AMZA 3TFRA 1ZQVA 1J97A 1X6IA 2F2AB 5CHGA 3QEAZ 4RQ4A 1DK2A 4M47A 1ZQRA 5CR0A 4DFDA 1HEKA 2HOIA 3UPQA 2H3IA 2Y0SC 2G0AA 4UB3A 2KKPA 4J9QA 4DSIA 8ICQA 2YMMA 9ICFA 2GLEA 5DB7A 5KL8B 5KG6A 5J0RA 4ELVA 1SKSA 2YB4A 3L5KA 4HYKA 4IRCA 2JV3A 5DB8A 4FS1A 5ALGA 3JPRA 5DQGA 1RDFA 1C20A 4F72A 5ALJA 2P35A 1SKWA 4C4TA 4YMNA 3HP6A 2G08A 4UW9A 1Z00B 4CNQA 2KIVA 4P4MA 1NK6A 3ONNA 3PR4A 1DOQA 1T7PA 3KZXA 5ALPA 4ECRA 1ZXIA 4UB2A 5DB6A 1ZQUA 1IG6A 2KFZA 1K5OA 2KVSA 1KW4A 5J2CA 4E0DA 1ZQYA 9ICHA 2A3VA 2DWQA 1L3UA 1BPXA 2VA8A 1ZJMA 3E58A 4KLFA 3RB6A 2W43A 5KFNA 3V6JA 1NJXA 1RQNA 2FPKA 3EW9A 1N60A 2FE9A 2I5HA 3N28A 3S6JA 2JHDA 4PGXA 1B22A 1JIHA 4J9SA 4GC7A 2LM1A 2HBKA 4US8A 1BVSA 3EYZA 2F77X 1OXJA 4RQ7A 4JK1A 2PKEA 1AROP 4R8UA 4F4YA 1U4BA 2YMPA 1ZRNA 3MDCA 3G6VA 2V9WA 3CP8A 1SV0A 4G3IA 1KDHA 4TUPA 4Q45A 4KITB 4ICAA 4DLEA 4P0PB 4DS5A 4Y2QA 4M9NA 5DQHA 2WAQF 2ZIVB 4I27A 4QNLA 2W9CA 1X9XA 5JU5A 4ED3A 4F8RA 1JXLA 5ALMA 3C5GA 3ZDDA 2JMGA 2ZIUB 2W8LA 1T4GA 2XGPA 2C22A 3QXGA 1TVAA 4AP9A 1X9SA 5ALEA 1S9FA 3H8WA 7ICOA 3ZDEA 4P4OA 4O3MA 2DPJA 4J9OA 4ECTA 5KFOA 5AIAA 5G5HA 2AU0A 2G09A 3QYPA 4KLUA 1L3TA 1IIPA 5J0XA 4DLGA 4DSLA 5ALQA 1V85A 2ES6A 4UQGA 2WHEA 4ACOA 4DF8A 1V9PA 1XSLA 2IOHA 3I1YA 1COKA 2LBOA 2EDUA 4I2EA 1S5LU 2LMRA 4IQWA 5AK3A 1U45A 3RJJA 9ICLA 1U9LA 1QQ7A 9ICCA 2WF9A 2AQ0A 4QIWC 5KT7A 4Q8FA 3A0HU 4YMMA 1VLBA 4Z6EA 4Y2RA 4UARA 4U7CA 2FPLA 2MU2A 1L8OA 3PW2A 3JPNA 4J9RA 3H8SA 1SXEA 5J2AA 5AKGA 3C1ZA 1SZPA 2R8KA 3QZ7A 1N5WA 3HT3A 2OCEA 2YMLA 2OM6A 2D6FC 3AL0B 5ALRA 2KG5A 2ZTDA 1ZQNA 2EAMA 4QWEA 3QEBZ 3AEVA 4C7ZA 1D9FA 3PX6A 2AH5A 5KFEA 1RYUA 1NJWA 4CF4A 2A1AA 3N4MB 2A19A 3RR8A 1BPDA 3ZD9A 1A77A 2RDJA 3QU4A 1Y88A 2EZYA 1AQ6A 5KFFA 2HW3A 8ICRA 1ZQOA 5DBBA 5KTQA 5JUMA
chains in the Genus database with same CATH topology
2I5HA 2EDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5H A;  2EDU A; 
#chains in the Genus database with same CATH topology
 4YD1 A;  1JAL A;  2D8C A;  2BGW A;  4B9T A;  5KG0 A;  5KFK A;  5DB9 A;  1ECW A;  1T94 A;  5L9X A;  4UAT A;  4C80 A;  5KFY A;  1H38 A;  1JUD A;  3F2C A;  2W9B A;  2Y0S F;  2A1J A;  2KZ3 A;  4I2F A;  3PML A;  4DF4 A;  4F4K A;  2BDP A;  1BNO A;  3NRW A;  1N5X A;  2ZUD A;  3QE9 Y;  5HHH A;  1KN5 A;  1N62 A;  4QZC A;  3EPG A;  2MUT A;  3SAG A;  4KTQ A;  2HHQ A;  4PZN A;  4JV0 A;  5IIJ A;  1B0X A;  2K4I A;  2LYA A;  3M9N B;  4FS2 A;  2IOF K;  5AM3 A;  3K4G A;  2JRZ A;  1ZQS A;  1ZQI A;  4QWD A;  5KT6 A;  4M9G A;  4M6W B;  2BKE A;  5AKY A;  3SAF A;  3BQT A;  2W54 A;  1XSP A;  1TV9 A;  4TUR A;  4KN4 A;  2ZTE A;  3WK8 A;  3KHH A;  1SWW A;  4DL2 A;  2BPC A;  2ZIW B;  2P6U A;  1L8L A;  2M9N A;  4RQ5 A;  3PSP A;  5L1I A;  1COO A;  5ALH A;  5J29 A;  2FLL A;  3MAB A;  1UT5 A;  9ICR A;  2BQU A;  7ICQ A;  1QQ6 A;  3BS7 A;  1S0O A;  1HUO A;  3RJH A;  5F9L A;  1IXR A;  4PZO A;  3BQ0 A;  5HNK A;  1S0V A;  1V38 A;  4I2H A;  2HBM A;  1MA7 A;  3C23 A;  3BZC A;  3C2M A;  4NV0 A;  2RLT A;  3I28 A;  3SR6 A;  3LVW A;  4P0Q B;  1S0N A;  2ASD A;  2ZXH A;  4MEY A;  3CRX A;  3SYZ A;  3V6K A;  1L6N A;  2KZM A;  3C5F A;  7ICI A;  2EAP A;  5AM0 A;  4ED0 A;  3OPX A;  3BS5 B;  2JEG A;  8ICX A;  2QB0 B;  5AI9 A;  4QWB A;  7ICR A;  4FFD A;  8ICY A;  1NK4 A;  4F93 B;  5BOM A;  5AM2 A;  1MN8 A;  2KJ5 A;  4F4Z A;  3H0R B;  1NNL A;  1M6Y A;  5ALN A;  3N7S C;  3RBE A;  3ALR A;  2BCS A;  1CUK A;  4QZE A;  4B9M A;  1K1Q A;  4I2G A;  2VKQ A;  1UHU A;  1FO4 A;  2AQ4 A;  7ICJ A;  3LYS A;  1DGJ A;  1F0M A;  2OYY A;  3PNC A;  2AGO A;  3EUB 2;  7ICU A;  2JR5 A;  3UXN A;  2DF4 B;  2MRL A;  8ICE A;  4G9B A;  1S76 D;  5KFI A;  5CJ7 A;  1SWV A;  5DDY A;  4UB5 A;  3ORY A;  4PHD A;  2AJQ A;  5EWG A;  4KLM A;  3RB4 A;  4OD0 A;  1NKE A;  7ICT A;  1QSL A;  5ALV A;  2HDO A;  3MR6 A;  4Y2T A;  1SV4 A;  3HRD D;  1DRG A;  4C8L A;  2ZTC A;  5J8Y A;  3BJY A;  3U26 A;  5B5E U;  3RH6 A;  4DSF A;  4BXO A;  1KRP A;  1J2M A;  8ICW A;  1LB2 B;  1UCV A;  5AIB A;  3QUQ A;  4FBU A;  5ALL A;  4TUS A;  1QH9 A;  4QWA A;  5ALX A;  3V6H A;  1PVR A;  5KG4 A;  2W55 A;  2B6G A;  1N56 A;  2WB1 F;  4Y2Y A;  1FFV A;  3IHQ B;  2EZZ A;  1NKC A;  5J0Q A;  5KFC A;  4KLQ A;  1SXD A;  4M6W A;  3EWA A;  3BQ7 A;  4CF3 A;  4ECZ A;  3WU2 U;  2OHF A;  5J0S A;  4QJF B;  5L1L A;  1NZP A;  3F5E A;  4FZL A;  2V4Q A;  2F8K A;  9ICO A;  4HAI A;  4I2C A;  2AHO B;  2VJ4 A;  2ZIW A;  4YVZ A;  3FYH A;  2F76 X;  1RYR A;  3FDS A;  2DKZ A;  3H0M B;  1KFT A;  3WK5 A;  4C8K A;  1S97 A;  4KLO A;  2GOL A;  4US9 A;  2VA3 A;  3FM9 A;  2EAO A;  4DL3 A;  4UB6 U;  1X6J A;  4A8E A;  3PMN A;  4J9L A;  3J81 j;  3M9M B;  1ED1 A;  3B0Y A;  4BJQ A;  3T5K A;  1ZQQ A;  4C7Y A;  1N61 A;  2KTQ A;  4XA5 A;  2VAN A;  4DL6 A;  4RQ6 A;  1QSY A;  4ED1 A;  4B9U A;  1Q8K A;  9ICX A;  2ZUB A;  5ALS A;  2ZG6 A;  4C4S A;  1ZQF A;  3H4D A;  1Z4N A;  1D9D A;  2JH7 A;  1RXW A;  4M04 A;  5KG3 A;  3Q8L A;  2HCF A;  3PY8 A;  1Q46 A;  3IRU A;  5KFQ A;  3RBD A;  2G5H B;  2GH1 A;  5CEH A;  4C8N A;  5IIL A;  5D46 A;  3GDX A;  2GWS A;  2C2E A;  5KFR A;  3ISC A;  3UMC A;  4UAZ A;  8ICL A;  1QLN A;  3NVY A;  4F5Q A;  3T3F A;  4B9N A;  2L5Y A;  3QU7 A;  1SL1 A;  2ZXI A;  3KFU F;  3Q8M A;  5KFL A;  2XCA A;  5ALU A;  4RQ1 A;  3T5L A;  2KSO A;  5CRX A;  2E8O A;  3RH5 A;  1WCN A;  2QLT A;  1Z4O A;  2KHQ A;  4PHA A;  4EEK A;  2VIX A;  4NM2 A;  2QAR A;  3IM1 A;  4ED2 A;  5T14 A;  2HOQ A;  3HPO A;  4DOA A;  3H8J A;  1Q3U A;  5J2D A;  1F5S A;  3TAD C;  1KTQ A;  3C1Y A;  3QU2 A;  2E3T A;  4O3S A;  2W04 A;  2KKV A;  3LDA A;  3RB0 A;  1NK9 A;  4B6J A;  1L3V A;  3GIJ A;  4FO6 A;  1ZQE A;  4RPX A;  2CRX A;  4EBE A;  3OTQ A;  5A0L A;  4UAU A;  4O0I A;  4RT3 A;  3RRH A;  1C7Y A;  2K4P A;  5HML A;  4M0A A;  5AKE A;  2ALZ A;  5AK4 A;  8ICC A;  5KFV A;  5HR6 A;  4DQQ A;  4MF2 A;  3LWL A;  3LK9 A;  2KMD A;  2IMW P;  2Y9U A;  4RPZ A;  4OJP A;  8ICS A;  3GV5 B;  4CRX A;  1Z19 A;  4MHV A;  4Y2U A;  2R8H A;  5J2H A;  8ICJ A;  2AXT U;  4ECS A;  3NGD A;  3JPO A;  2FLP A;  1L7P A;  1X42 A;  4F71 A;  7ICM A;  4O5E A;  2KJ9 A;  2MSN A;  3GFK B;  2JGA A;  1CEZ A;  4KX5 A;  5IIM A;  9ICQ A;  2G06 A;  5ALY A;  4O5C A;  1ZD3 A;  3UXP A;  5IIN A;  3DDH A;  3OSP A;  4O3R A;  4I28 A;  2PMZ F;  3ETL A;  2KEY A;  2K8C B;  2DPI A;  4FBT A;  4KLS A;  2EZX A;  2VA2 A;  4B9V A;  4U6P A;  8ICO A;  4FZN A;  1HIW A;  4LZG A;  3SD7 A;  5F9N A;  3AM9 A;  8ICB A;  1X40 A;  4QZG A;  1P7D A;  2PXI A;  5DQI A;  3IG8 A;  3VCB A;  4LJX A;  4QZA A;  3M8S A;  8ICA A;  5KFP A;  1NJY A;  2FDR A;  1O08 A;  3SEN A;  4NLN A;  4NLC A;  3WK7 A;  4EZ9 A;  2H3Q A;  3IG5 A;  3IN5 A;  4EBD A;  3NRZ A;  1LKY B;  5C0Y A;  1B4F A;  3MGI A;  4BGD A;  4YFK A;  1UA0 A;  3T79 A;  2UVR A;  4DFM A;  5CB1 A;  5AI8 A;  4CGZ A;  1L5U A;  1DXS A;  1UQV A;  4UAW A;  5ALW A;  3TFS A;  1X2I A;  1JX4 A;  2HHW A;  4I2I A;  3AQE A;  1FEZ A;  1SL0 A;  3OHB A;  1KEJ A;  3PVX A;  3QUT A;  3KHR A;  2R18 A;  4YD2 A;  3LWM A;  2B21 A;  4AYB F;  2WB1 C;  4PPX A;  1T3Q A;  3SZ2 A;  2XY6 A;  9ICB A;  4DFK A;  1Z00 A;  2ZJA A;  4GFJ A;  4I2D A;  4IRD A;  3MBY A;  2XGQ A;  1DGS A;  4UB8 U;  3JPP A;  1ZQW A;  4GC6 A;  4F5O A;  4ED8 A;  3MGH A;  2E5S A;  3OSN A;  2PFP A;  2BR0 A;  1HJP A;  5G5G A;  4KLJ A;  5EE1 A;  4EZ6 A;  3NUQ A;  3PX4 A;  5L1K A;  1Z1V A;  2DUY A;  3HWT A;  3KKA C;  5ALZ A;  5J2J A;  4YR2 A;  5AK6 A;  4ED6 A;  3AUO A;  3KHG A;  4DL4 A;  4F5R A;  1KL9 A;  2HBJ A;  1ZD2 P;  2CPR A;  4USA A;  5ALK A;  8ICN A;  1S8O A;  3RFA A;  4QW9 A;  9ICW A;  3OJU A;  3I76 A;  1SZH A;  3G6X A;  4EX7 A;  1ZQL A;  1PVP A;  2E8M A;  1J2N A;  3UMB A;  2ZIX B;  4MEX A;  4DCC A;  1N48 A;  4F3O A;  1TAQ A;  2N1R A;  3KD3 A;  3N7P D;  3D2S A;  5TIS U;  4DOB A;  4PHP A;  4GIB A;  4UB1 A;  3RJF A;  1ZQB A;  5AIC A;  1OW5 A;  2NRX A;  2KVC A;  2E1F A;  2E1E A;  2ESE A;  3QU5 A;  2DKX A;  4OJO A;  2ATL A;  3MR2 A;  1JMS A;  3L3F X;  5AM4 A;  2NRW A;  4J9M A;  1KBU A;  4P0P A;  2ZIV A;  2HHT A;  1XO0 A;  3Q8K A;  2HOF A;  3BZK A;  3WK6 A;  5AKX A;  5KFT A;  9ICA A;  2K89 A;  5AM5 A;  1ZJN A;  3M6Z A;  1ZRM A;  4DO9 A;  5AHX A;  2C28 A;  4PGY A;  2KK0 A;  5EE0 A;  2ZIU A;  3PW4 A;  1L3S A;  4BDP A;  2HBL A;  2OWO A;  3MGV A;  4DFP A;  4Z6F A;  2PI5 A;  4MFF A;  5KFS A;  8ICH A;  4F92 B;  2V4R A;  1PZN A;  7ICV A;  4B9L A;  1ZQT A;  5III A;  3E2E A;  2DQN B;  4I2B A;  2R8J A;  2YN4 A;  8ICV A;  4UAV A;  1RQL A;  1ZQC A;  4QZF A;  2FJ6 A;  4YCX A;  2LYB A;  5KG2 A;  2I9G A;  4O5K A;  4PJ0 U;  1U47 A;  1Z1B A;  1ZQA A;  4DQI A;  5DG9 A;  3EPI A;  3RR7 A;  2PFO A;  5D4B A;  3FC4 A;  2BCQ A;  5AK5 A;  2WF6 A;  2XC9 A;  4IRK A;  2MA1 A;  2LI6 A;  2XID A;  1S77 D;  2YTU A;  5BOL A;  4DEZ A;  3ZD8 A;  5KG5 A;  4FE3 A;  7ICG A;  1X9W A;  4ECQ A;  5AKH A;  3CYM A;  5KFB A;  4GLX A;  2OEH A;  1YZ6 A;  2KD1 A;  3RJK A;  4B9S A;  2Q0Z X;  4RZR A;  1A76 A;  5FP0 A;  3KBB A;  2XI9 A;  1KLN A;  5JTI A;  4KLG A;  7ICS A;  1PUZ A;  5D49 A;  4JWN A;  4EEL A;  4IR1 A;  3KZI U;  3C21 A;  2W9A A;  2B0C A;  3F53 A;  1NZB A;  4ECV A;  3NAS A;  5EOZ A;  2JEI A;  4KMO B;  3AQF A;  5L1J A;  3TAP A;  4NLB A;  3M1Y A;  4ELU A;  4JB3 A;  4RPY A;  2K4E A;  2G07 A;  1FIQ A;  2KP7 A;  3K1Z A;  3UXO A;  1ZQH A;  2IA6 A;  4UBB A;  2VJ5 A;  1PVQ A;  2HVH A;  2BCV A;  5DGB A;  2LM4 A;  5AKK A;  2YMQ A;  5J0O A;  2H3V A;  2JEF A;  5AKJ A;  1XS9 D;  3ISD A;  4ECY A;  4YN4 A;  3NTU A;  2PMZ C;  3LVV A;  1UPH A;  2NYV A;  3Q8S B;  1S0M A;  2QKQ A;  4KX3 A;  2BDU A;  4NY8 A;  4RQN A;  2OH2 A;  2DL0 A;  2JEJ A;  1BNP A;  2BHN A;  1JI7 A;  3DV9 A;  4F5N A;  1TFR A;  3WK9 A;  4YG2 A;  3PO5 A;  2RRD A;  4O9M A;  5AKL A;  5KAF U;  2ZIX A;  5KT2 A;  4DQS A;  4K4H A;  4C4R A;  4GXK A;  3MFH A;  3M9O B;  3V7J A;  3C2K A;  5KFJ A;  1NK8 A;  1XU4 A;  4O3O A;  4NJ8 A;  5K4L A;  4DQR A;  4IQV A;  4QZB A;  2LYH A;  1CI4 A;  5HMM A;  8ICK A;  2C2D A;  2W3R A;  3DEE A;  2HHS A;  2WF8 A;  1RXV A;  3Q8Q B;  4F4X A;  3H8M A;  1L7N A;  4OJ6 A;  1KKX A;  3OJS A;  1NI3 A;  1BPB A;  4R63 A;  5KG1 A;  1T3N A;  1ZQK A;  4R8U B;  2HMX A;  3MR3 A;  4NLK A;  1NOM A;  4GXJ A;  3ETR A;  5HHI A;  4QWC A;  2KOB A;  2Y1I A;  4DFJ A;  4AYB C;  4R64 A;  1KQQ A;  3UMG A;  1DK3 A;  3QUB A;  5ALT A;  5C5J A;  4ZH4 A;  4Z6D A;  4Y2J A;  3ZDA A;  9ICP A;  4ECX A;  5CA7 A;  5B66 U;  5J0W A;  4TUQ A;  2NRT A;  5KNI A;  2RQ5 A;  1MQ3 A;  3T5J A;  4PH5 A;  4GXI A;  8ICP A;  2K8A A;  4DQP A;  1TAM A;  3Q8P B;  1WCL A;  3RAQ A;  4DSJ A;  1RPL A;  3VC8 A;  2ISP A;  2AGQ A;  7ICE A;  5CWR A;  4BWM A;  3N97 B;  2CN1 A;  5DDM A;  2HI0 A;  3WKC A;  5DGA A;  4P0Q A;  3SAH A;  4PHE A;  4RNO A;  1SV0 C;  2PFN A;  1L7M A;  4XUS A;  1YT3 A;  4YXJ A;  5HP4 A;  3GIL A;  3PW5 A;  8ICU A;  2F1H A;  3SQI A;  9ICE A;  3QNM A;  2WF5 A;  2UVW A;  3MR5 A;  3BS5 A;  3AU2 A;  2QB0 A;  3O0F A;  2K8B B;  2F1J A;  2KJ8 A;  2KV2 A;  3GQC A;  1ZQX A;  2JXJ A;  2JZB B;  1NKB A;  1D8B A;  3RJI A;  2BCR A;  2HHU A;  4EYH B;  2RDI A;  5J2K A;  2YY6 A;  3OGU A;  3UM9 A;  1VJ5 A;  2BCU A;  3C29 A;  2EH9 A;  3CW2 C;  7ICF A;  1JRP A;  1S10 A;  4I29 A;  1NK0 A;  3PR5 B;  4QZH A;  4BX9 C;  3SV4 A;  4EBC A;  5KAI U;  3AN1 A;  5EE9 A;  5J2B A;  1KFS A;  1SB3 C;  1URJ A;  2F44 A;  4CCH A;  3C2L A;  5AKI A;  5KFA A;  1WWU A;  4XRH A;  4J03 A;  2NO4 A;  3GU3 A;  3Q8R B;  4UB4 A;  9ICJ A;  5AI4 A;  3JPT A;  1ZQ1 C;  7ICN A;  1EXN A;  2JH1 A;  2C2R A;  4KLI A;  1SKR A;  3A0B U;  5KFZ A;  2FLN A;  1ZD5 A;  3NVZ A;  1RG6 A;  5KL1 B;  7ICH A;  4M2Y A;  3BQ2 A;  3WKD A;  2WTF A;  9ICV A;  2EAN A;  3GV8 B;  4YR3 A;  4F2R A;  2XY7 A;  1RYS A;  4C8O A;  1KFD A;  2W9B B;  3D2Q A;  2A1J B;  8ICI A;  4F50 A;  5ALO A;  3PZP A;  3L4P A;  2FMP A;  3WK4 A;  4Q43 A;  1TAU A;  1Q3V A;  5KFX A;  1WYG A;  1PK1 B;  3ZDB A;  2LHT A;  3HJE A;  1NK7 A;  1ZQP A;  5DBA A;  5H2F U;  1F44 A;  4C8M A;  4M9J A;  4DOC A;  1VDV A;  2MUT B;  2NO5 A;  1L7O A;  3RAX A;  4RNM A;  3WKB A;  3K1R B;  1JRO A;  2DGZ A;  1NK5 A;  5IIK A;  4KLT A;  9ICU A;  4OJ5 A;  1Z3E B;  4JV2 A;  5JRT A;  1KSP A;  9ICG A;  3ED5 A;  3WKE A;  3B0X A;  4F91 B;  1V97 A;  3HIL A;  4EX6 A;  3QUC A;  2PI4 A;  3WKA A;  2UVU A;  3HW8 A;  3H0L B;  3D6J A;  5AI6 A;  4CE6 A;  4BWJ A;  1U49 A;  3NVW A;  3M6K A;  4NWI A;  5KFU A;  1X66 A;  2YB1 A;  1ZET A;  3R9K A;  3F2D A;  3NVV A;  5J2G A;  4EEY A;  4RUC A;  2R8G A;  2HVI A;  1B43 A;  4XQ8 A;  9ICN A;  2MAX A;  3TAR A;  5EWE A;  5KFD A;  4IQT A;  5EE3 A;  4Y2V A;  2I6X A;  4DSE A;  4K4G A;  2D3D A;  2JZB A;  4C0Z A;  2W8K A;  3JPQ A;  3T5H A;  1N63 A;  3TAD A;  1ZQJ A;  3H40 A;  5KFG A;  1MSW D;  4O3Q A;  8ICM A;  9ICI A;  1LVH A;  5J0P A;  4WJ3 B;  2QB1 A;  2NRZ A;  1WUD A;  3RJG A;  3F2B A;  3GZF A;  4LVS A;  3PW7 A;  4FZM A;  5GTH U;  5BPC A;  4RUA A;  5J2F A;  3FAH A;  3GV7 B;  1RZT A;  2XIC A;  4ECW A;  1A0P A;  3QX7 A;  4P2H A;  2M0N A;  4YP3 A;  5ALD A;  2KZZ A;  1LV5 A;  1XO1 A;  5DLG A;  1QQ5 A;  2IHN A;  2H3Z A;  3HKZ F;  3PSF A;  2NRV A;  2IBK A;  9ICM A;  4YR0 A;  1O03 A;  4DL5 A;  3RRG A;  1TK8 A;  2F3N A;  3V7K A;  4IQU A;  4M9L A;  4UBC A;  4UAS A;  4M9H A;  1XWL A;  3SI8 A;  1X9M A;  4KLE A;  3KOO A;  2XVT A;  4NL9 C;  3GII A;  4DL7 A;  3MDA A;  2HHV A;  3TI0 A;  2YX8 A;  8ICF A;  1XSN A;  4RQ0 A;  2YQE A;  5J0T A;  4JMU A;  4Y2S A;  2KIC A;  1JN3 A;  3M7D A;  3PX0 A;  2Y9T A;  2K60 A;  1HUZ A;  2E8N A;  1ZOL A;  4KMU A;  2BQR A;  3F5A A;  4J9P A;  4RQ3 A;  3TKA A;  2DBY A;  1D8Y A;  4Y2P A;  2BZF A;  5AKZ A;  4KLH A;  5KFW A;  2ISO A;  2NV3 A;  4Q44 A;  3TQ1 A;  3TAQ A;  4J9N A;  4OJL A;  2J6T A;  3GIK A;  2BPF A;  5J2E A;  4UAY A;  2E8P A;  1PK1 A;  4PL1 A;  5DKW A;  2J6U A;  4BXO B;  3D2N A;  3UQ0 A;  2KIW A;  4O3N A;  1ZQM A;  4YMO A;  2ASJ A;  1TKD A;  3PW0 A;  4ZOH C;  1SIJ A;  1XNS A;  4IR9 A;  4Q8E A;  4BUG A;  4IL6 U;  2BPG A;  1TK5 A;  2LKY A;  2EQY A;  3MFI A;  4NXZ A;  2HHX A;  2O6K A;  5CP2 A;  1ZQG A;  1N2X A;  5KT5 A;  1JXE A;  5J8Y C;  1QTM A;  1CRX A;  5KT3 A;  3SEI A;  1SGG A;  2FI1 A;  4NLZ A;  1UT8 A;  8ICZ A;  2ASL A;  2FPM A;  2R8I A;  4KN7 A;  8ICT A;  5AM1 A;  4CDG A;  3OHA A;  5F3X B;  2KE7 A;  7ICP A;  1T8E A;  1LKY A;  4RQ2 A;  1XC9 A;  3ICX A;  2UVV A;  3SMV A;  1U48 A;  4QZ9 A;  4RU9 A;  3BDP A;  5HR7 A;  2HSZ A;  2KFN A;  1PK3 A;  2KHV A;  3PO4 A;  5IIO A;  1BGX T;  2F1I A;  2FMS A;  3PSI A;  4DS4 A;  4LZD A;  2PFQ A;  3JPS A;  3H7I A;  2LPE A;  3KKA A;  3V72 A;  9ICK A;  4KLD A;  4YXM A;  2K4H A;  5KFH A;  4NL9 A;  4Y2X A;  3E0F A;  3CNH A;  4O3P A;  1ZYQ A;  5GTI U;  4PL2 A;  5AI5 A;  1ZQD A;  3TAN A;  2ZUC A;  5DBC A;  1MQ2 A;  1SL2 A;  1OUQ A;  5DG8 A;  3MC1 A;  5KG7 A;  4PGQ A;  2W7P A;  2GO7 A;  2W7O A;  2KNJ A;  2F8L A;  4J9K A;  4QZ8 A;  3RTV A;  5DLF A;  2Y1J A;  5L1M A;  2WFA A;  2ZJ8 A;  1YZ7 A;  4ELT A;  1UA1 A;  1IV8 A;  2Q4T A;  1BPY A;  2KSO B;  4I2A A;  9ICT A;  3H4B A;  3TAC B;  4DWI A;  2WAQ C;  2XO7 A;  2W03 A;  5J2I A;  4EEN A;  3RB3 A;  1NJZ A;  2IHM A;  2QAR B;  3RJE A;  3HX0 A;  4IS7 A;  3PV8 A;  1RM6 C;  5AI0 A;  2XCP A;  4NM1 A;  4F4W A;  3KTQ A;  4TQR A;  3RF9 A;  7ICK A;  3KHL A;  5TZV A;  5EWF A;  8ICG A;  5KT4 A;  4OO1 J;  1FFU A;  2P6R A;  4QZI A;  3SV3 A;  2W3S A;  5KFM A;  4R65 A;  1ZD4 A;  4P4P A;  2W11 A;  4I2J A;  3BQ1 A;  2J6S A;  1WWV A;  4QIW F;  2FMQ A;  3IDW A;  5ALF A;  2G5I B;  3AU6 A;  4F2S A;  4CF5 A;  7ICL A;  1QSS A;  1MC8 A;  2DFL A;  3N7R C;  9ICS A;  4RQ8 A;  4TQS A;  1K1S A;  3RH4 A;  3EZ5 A;  3B9J A;  1WG8 A;  1BPZ A;  3V7L A;  3ZDC A;  2W9M A;  4JWM A;  2CXY A;  4IC9 A;  3QZ8 A;  2XY5 A;  3K75 D;  4R66 A;  4RNN A;  4OCZ A;  2ODG A;  1ZQZ A;  2RP5 A;  1GO3 F;  1TK0 A;  3G6Y A;  4MFC A;  5DG7 A;  4MF8 A;  4KLL A;  3ZI4 A;  3GIM A;  1IM4 A;  3IP4 B;  3PST A;  4MFA A;  4QZD A;  3IV6 A;  5J0U A;  3ISB A;  4ED7 A;  4YQW A;  4DSK A;  2IOF A;  1A6S A;  2AGP A;  2Z7J A;  2W9C B;  2H5X A;  2P66 A;  3HKZ C;  1D8L A;  4JV1 A;  4NLG A;  2ZJ5 A;  3QU9 A;  2H3F A;  4RT2 A;  4F5P A;  4ECU A;  4EYI B;  4QW8 A;  2OXO A;  1TE2 A;  2WF7 A;  2RHF A;  1BPE A;  4Z6C A;  3THV A;  4X5V A;  3M8R A;  2I1Q A;  3C28 A;  1QCK A;  2BQ3 A;  5J0Y A;  2KN7 A;  3NS1 A;  4JUZ A;  5E79 U;  5ALI A;  4RQM A;  3UQ2 A;  4K4I A;  3AMZ A;  3TFR A;  1ZQV A;  1J97 A;  1X6I A;  2F2A B;  5CHG A;  3QEA Z;  4RQ4 A;  1DK2 A;  4M47 A;  1ZQR A;  5CR0 A;  4DFD A;  1HEK A;  2HOI A;  3UPQ A;  2H3I A;  2Y0S C;  2G0A A;  4UB3 A;  2KKP A;  4J9Q A;  4DSI A;  8ICQ A;  2YMM A;  9ICF A;  2GLE A;  5DB7 A;  5KL8 B;  5KG6 A;  5J0R A;  4ELV A;  1SKS A;  2YB4 A;  3L5K A;  4HYK A;  4IRC A;  2JV3 A;  5DB8 A;  4FS1 A;  5ALG A;  3JPR A;  5DQG A;  1RDF A;  1C20 A;  4F72 A;  5ALJ A;  2P35 A;  1SKW A;  4C4T A;  4YMN A;  3HP6 A;  2G08 A;  4UW9 A;  1Z00 B;  4CNQ A;  2KIV A;  4P4M A;  1NK6 A;  3ONN A;  3PR4 A;  1DOQ A;  1T7P A;  3KZX A;  5ALP A;  4ECR A;  1ZXI A;  4UB2 A;  5DB6 A;  1ZQU A;  1IG6 A;  2KFZ A;  1K5O A;  2KVS A;  1KW4 A;  5J2C A;  4E0D A;  1ZQY A;  9ICH A;  2A3V A;  2DWQ A;  1L3U A;  1BPX A;  2VA8 A;  1ZJM A;  3E58 A;  4KLF A;  3RB6 A;  2W43 A;  5KFN A;  3V6J A;  1NJX A;  1RQN A;  2FPK A;  3EW9 A;  1N60 A;  2FE9 A;  2I5H A;  3N28 A;  3S6J A;  2JHD A;  4PGX A;  1B22 A;  1JIH A;  4J9S A;  4GC7 A;  2LM1 A;  2HBK A;  4US8 A;  1BVS A;  3EYZ A;  2F77 X;  1OXJ A;  4RQ7 A;  4JK1 A;  2PKE A;  1ARO P;  4R8U A;  4F4Y A;  1U4B A;  2YMP A;  1ZRN A;  3MDC A;  3G6V A;  2V9W A;  3CP8 A;  1SV0 A;  4G3I A;  1KDH A;  4TUP A;  4Q45 A;  4KIT B;  4ICA A;  4DLE A;  4P0P B;  4DS5 A;  4Y2Q A;  4M9N A;  5DQH A;  2WAQ F;  2ZIV B;  4I27 A;  4QNL A;  2W9C A;  1X9X A;  5JU5 A;  4ED3 A;  4F8R A;  1JXL A;  5ALM A;  3C5G A;  3ZDD A;  2JMG A;  2ZIU B;  2W8L A;  1T4G A;  2XGP A;  2C22 A;  3QXG A;  1TVA A;  4AP9 A;  1X9S A;  5ALE A;  1S9F A;  3H8W A;  7ICO A;  3ZDE A;  4P4O A;  4O3M A;  2DPJ A;  4J9O A;  4ECT A;  5KFO A;  5AIA A;  5G5H A;  2AU0 A;  2G09 A;  3QYP A;  4KLU A;  1L3T A;  1IIP A;  5J0X A;  4DLG A;  4DSL A;  5ALQ A;  1V85 A;  2ES6 A;  4UQG A;  2WHE A;  4ACO A;  4DF8 A;  1V9P A;  1XSL A;  2IOH A;  3I1Y A;  1COK A;  2LBO A;  2EDU A;  4I2E A;  1S5L U;  2LMR A;  4IQW A;  5AK3 A;  1U45 A;  3RJJ A;  9ICL A;  1U9L A;  1QQ7 A;  9ICC A;  2WF9 A;  2AQ0 A;  4QIW C;  5KT7 A;  4Q8F A;  3A0H U;  4YMM A;  1VLB A;  4Z6E A;  4Y2R A;  4UAR A;  4U7C A;  2FPL A;  2MU2 A;  1L8O A;  3PW2 A;  3JPN A;  4J9R A;  3H8S A;  1SXE A;  5J2A A;  5AKG A;  3C1Z A;  1SZP A;  2R8K A;  3QZ7 A;  1N5W A;  3HT3 A;  2OCE A;  2YML A;  2OM6 A;  2D6F C;  3AL0 B;  5ALR A;  2KG5 A;  2ZTD A;  1ZQN A;  2EAM A;  4QWE A;  3QEB Z;  3AEV A;  4C7Z A;  1D9F A;  3PX6 A;  2AH5 A;  5KFE A;  1RYU A;  1NJW A;  4CF4 A;  2A1A A;  3N4M B;  2A19 A;  3RR8 A;  1BPD A;  3ZD9 A;  1A77 A;  2RDJ A;  3QU4 A;  1Y88 A;  2EZY A;  1AQ6 A;  5KFF A;  2HW3 A;  8ICR A;  1ZQO A;  5DBB A;  5KTQ A;  5JUM A; 
#chains in the Genus database with same CATH homology
 2I5H A;  2EDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...