2EDUA

Solution structure of rsgi ruh-070, a c-terminal domain of kinesin-like protein kif22 from human cdna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
98
structure length
98
Chain Sequence
GSSGSSGEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESFLKANILGLAAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-070, a C-terminal domain of kinesin-like protein KIF22 from human cDNA
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Kinesin-like protein KIF22
total genus 20
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12836 HHH_3 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2eduA01
2I5HA 2EDUA
chains in the Genus database with same CATH superfamily
1BPEA 4ELUA 3HKZF 5AI6A 5DLGA 3RF9A 1ZQWA 4CGZA 3OJUA 2F2AB 4QWEA 3ZDAA 1N5XA 5EE3A 5EWGA 5AKYA 1NNLA 1TE2A 5L1MA 1F0MA 1X42A 3ETRA 5KFDA 2M9NA 1SXEA 2ZXIA 4UARA 4NLNA 3PW2A 4R64A 4JB3A 4Z6DA 5AICA 3HT3A 4I28A 3WKCA 1RM6C 2ODGA 2AQ4A 3SR6A 3IM1A 3PO4A 2FMSA 4I2AA 3PY8A 2HHUA 4FS2A 5HNKA 2A1JA 2W9MA 5AK5A 3EYZA 3FC4A 4F5NA 2ALZA 5J2CA 4KLIA 4NM1A 4B9NA 5J8YA 5KFYA 7ICSA 4C0ZA 1DRGA 2P35A 3JPQA 3BQ2A 2F8LA 2ZIXB 4O3SA 5DQGA 1ZQ1C 4OJ5A 2P6UA 4QZEA 2HI0A 5L1KA 1ZQEA 4TQSA 1ZQKA 1S0OA 2EZYA 1L8OA 5CA7A 3SZ2A 3BZKA 4J9NA 3PSIA 5G5GA 4U6PA 1WCNA 3EUB2 1UT8A 3C29A 2AU0A 3R9KA 1EXNA 4PHAA 1YZ7A 4RNMA 2A1JB 1Y88A 4UB2A 4KX5A 1KL9A 4QWAA 5AKJA 8ICRA 3SD7A 2VA2A 2Q4TA 2PMZC 3IG8A 2ZTCA 1B22A 3CP8A 5CRXA 2KD1A 4JV0A 4FZLA 2XGQA 2R8JA 2V9WA 2EZXA 4YCXA 5KG0A 3WKEA 3JPRA 3OSPA 3TADA 1XWLA 3WK4A 3QU7A 3T3FA 4ED3A 1U9LA 2QARA 2KMDA 2DWQA 2ZTDA 1Z3EB 4GIBA 5KT3A 5J0OA 3QUQA 4FO6A 8ICHA 3MFHA 4RQNA 5J0WA 5AKXA 3C2KA 3RJKA 5ALJA 1Z00B 1AROP 3RR7A 5ALDA 1MQ2A 1KFDA 2XICA 1NK6A 2OCEA 2BCRA 8ICMA 2O6KA 3E2EA 3IHQB 5J2FA 5IIOA 2A19A 1L3UA 2V4QA 3RRGA 2EAOA 2WF8A 1QSSA 3M8SA 1DGSA 3IDWA 3BQ1A 4DQSA 5AKZA 5DQHA 2KVCA 3PX6A 1X9SA 3K4GA 2C28A 4RPXA 2F76X 2QB1A 8ICJA 3JPSA 1ZD5A 2W8KA 5J0PA 2UVRA 3WKDA 2D6FC 2C2EA 1T7PA 5AM2A 3Q8SB 4J9MA 3NVYA 2P66A 2BQRA 3MDCA 2HBJA 3LVWA 5J8YC 4ECVA 1JXEA 4RQ8A 4DSIA 3GIIA 1ZOLA 4XA5A 3IG5A 3HKZC 2KJ5A 2HVIA 2CPRA 5KFJA 3F2BA 2YTUA 8ICTA 2FLPA 1Q3UA 3QU9A 2I9GA 1RQNA 5EWEA 3SAFA 5KFOA 1ZQDA 3SAGA 5KFQA 3BQ0A 4PJ0U 4ECUA 4UBBA 1A76A 2KZMA 4BWMA 3VCBA 2WF5A 4LZGA 3RRHA 3M8RA 2YN4A 8ICBA 3I76A 4FZNA 4M9GA 2MAXA 5AIAA 2KSOA 4F72A 4DLEA 1IXRA 4B9SA 2OWOA 2JV3A 9ICEA 4UAUA 2E3TA 1V38A 3NS1A 5KNIA 3EWAA 4YMNA 4EX6A 2DKZA 1S10A 1L3TA 3ZI4A 1WWUA 1DGJA 1OUQA 1ZQFA 4DQQA 9ICAA 5ALVA 1N60A 4DL7A 4YQWA 5KFLA 5KFEA 4RQ6A 5J0RA 1L5UA 4GC6A 1SGGA 2LYAA 4LJXA 2WF6A 1KFTA 4KN7A 1COOA 5HR7A 3H40A 1MQ3A 2UVVA 5J0YA 5HMMA 4Y2PA 2XY7A 3VC8A 3Q8MA 2AGPA 5ALXA 2Q0ZX 5AM3A 5KFFA 1NZBA 5ALSA 4USAA 3Q8QB 3RTVA 2KJ9A 5KG5A 2H3VA 2C2DA 5ALWA 5J0SA 7ICIA 1KFSA 4ECWA 4KLFA 1BPBA 2KKPA 3BZCA 2R8GA 4ELVA 1NJZA 4Y2JA 4RQ0A 4YFKA 3GV7B 4F5QA 5ALOA 2A3VA 4F93B 5AKIA 9ICGA 3NVVA 2ZIWA 1IV8A 1ZRNA 2QB0B 4CE6A 7ICOA 2DPJA 3HP6A 1SV0A 4QZDA 4UAWA 4F92B 5AI9A 2E8NA 3F5EA 4CDGA 5D4BA 4J03A 4C4SA 1BPYA 3MBYA 2ZXHA 2KG5A 4F91B 4XUSA 1S0MA 1SZHA 3ISBA 4MFFA 3F53A 2G08A 4UATA 4US9A 2IHMA 4QWCA 4YR0A 4J9QA 4FFDA 5DGAA 4TUPA 4Q8EA 5JU5A 4QZCA 2KVSA 2W9CB 4KTQA 3M7DA 2E8MA 5AK4A 1NK7A 2Y0SF 2KK0A 5GTIU 8ICQA 2XI9A 9ICXA 2BZFA 2BHNA 1KW4A 3T79A 3KOOA 2H5XA 3KZIU 1AQ6A 1N2XA 5E79U 2R8HA 1ZQUA 1U47A 3WKBA 1ZQQA 5CHGA 3QZ7A 1ZQRA 3PR4A 4C8KA 4KMUA 4P2HA 1NOMA 1DXSA 4PHDA 3L4PA 5J2EA 4DFJA 1ZQAA 9ICFA 3QUBA 3RAQA 4KLLA 2PFNA 4PL1A 4DS5A 4CRXA 3B0XA 4J9LA 1ED1A 5EWFA 4I2FA 3NRWA 2JEJA 1KTQA 2GLEA 4Y2TA 2NO5A 1ZJMA 3QEAZ 3OSNA 3ZDDA 5KFRA 4I27A 4IRKA 3KKAA 3LYSA 1K5OA 3GDXA 1L6NA 2NO4A 9ICKA 2K4HA 4ED7A 4O5KA 2K8BB 5L1LA 1U4BA 1RPLA 4UB1A 4C80A 4M2YA 1ZQBA 5KAIU 3ZDCA 1SL0A 2ISOA 2DBYA 5DG7A 2BDUA 2R8IA 4FBTA 4KLTA 1VJ5A 3SV3A 5JUMA 2D3DA 4R8UA 1ZQZA 5AK3A 3HPOA 4RUAA 9ICOA 1JUDA 3T5KA 1ZQMA 3UMGA 5KFCA 4NJ8A 2BCUA 4ELTA 1PK3A 2EAPA 4IL6U 2AJQA 4DSJA 2KP7A 4RZRA 3KFUF 4M6WB 1ZQNA 2OHFA 3OTQA 5AKHA 4M47A 3N7SC 1T8EA 1XSPA 7ICFA 1BPZA 5J2BA 5KFIA 1KEJA 4TUQA 1KN5A 3KHRA 3C1ZA 1COKA 3FM9A 7ICPA 4YD1A 5KL1B 4I2HA 3SI8A 9ICMA 1IM4A 1TK5A 3Q8PB 4GXJA 3MC1A 1XSLA 4DQPA 1L7PA 3C5FA 4DFKA 3N97B 4YN4A 4GC7A 1X40A 4UW9A 1SWWA 1XS9D 5TISU 4ACOA 5JTIA 4F2RA 3G6VA 1NK9A 3NGDA 1PK1A 2KIVA 5KAFU 4BGDA 3PNCA 1Q3VA 2KHQA 3C28A 3KZXA 2BPCA 3KD3A 4C8MA 1TV9A 4EYHB 4MFCA 4O3OA 1B4FA 4UB3A 3H8SA 4O0IA 4KN4A 3RH5A 3AN1A 2CN1A 1UHUA 4KLEA 2JXJA 3QUTA 3EPGA 4RU9A 4EELA 5KFXA 2LM4A 4DSFA 4QWBA 2K89A 3QX7A 3RBDA 1RQLA 3QNMA 2K4EA 5C5JA 3PSTA 3NUQA 1S77D 1TKDA 1JMSA 3NRZA 2PFPA 4Y2YA 1JRPA 4Z6EA 1RYSA 9ICUA 1F44A 2W11A 2WB1C 4ED8A 1SXDA 2ATLA 3RAXA 1V97A 5J2GA 3A0BU 3TQ1A 1NKEA 4Y2SA 2BCQA 2B6GA 2E8OA 4IR1A 4LZDA 3E58A 4ED0A 1Z1VA 3B9JA 4EENA 1K1SA 2HVHA 4GXIA 4O5CA 9ICCA 5G5HA 8ICFA 3QZ8A 2BQUA 5J0TA 1KDHA 2KOBA 1ZQSA 4RQMA 8ICGA 4M6WA 3SENA 3UQ2A 1ZQTA 5DB7A 1CUKA 1NI3A 2XCAA 4DEZA 2XIDA 4F4ZA 3V6HA 2UVUA 2JZBA 3IRUA 1IG6A 4ECXA 7ICKA 2QARB 8ICYA 8ICKA 4AYBC 2KNJA 8ICPA 4PGYA 4TURA 7ICNA 2RLTA 1FFVA 1HEKA 3V7LA 2VA8A 1L7MA 3ED5A 2AGOA 3OHAA 2G09A 3WU2U 2E1EA 2KHVA 3QE9Y 5KG6A 3PW4A 1KRPA 5B66U 1NK5A 1ZQHA 1NK8A 2OXOA 2FMQA 4QZIA 4P0PA 2WF9A 4DQIA 2E8PA 1JALA 2W54A 4QNLA 5IIJA 2NV3A 2KFZA 8ICUA 4KLDA 2R8KA 4QZ9A 3DDHA 4BXOA 4C8NA 5J2KA 4ECQA 4K4HA 3UMCA 2NRTA 4NL9A 3H0RB 3DEEA 2YMMA 3AU6A 2L5YA 4O9MA 8ICAA 3CYMA 5ALHA 1WCLA 4U7CA 5KG3A 2IBKA 3Q8LA 2ZUBA 4UBCA 4DL2A 3RB3A 5ALRA 4ICAA 2JEIA 2KKVA 3F2DA 2FPLA 5ALGA 8ICSA 3AM9A 3RR8A 2B21A 2EQYA 4F4XA 2KN7A 2XY6A 2BR0A 2F3NA 3TAQA 2ZJAA 4BDPA 4KMOB 2GWSA 4ED2A 4UB8U 4FE3A 2RP5A 2YMLA 4DSLA 1JROA 3PSPA 5J2JA 4K4IA 1BGXT 1BPDA 3SMVA 4B9UA 4OJOA 4M9NA 3K1ZA 4DWIA 1U49A 2MRLA 4RQ2A 1Q46A 5HP4A 3HWTA 3EZ5A 1A0PA 5DB6A 4F5PA 2DQNB 4BX9C 5KG2A 2HHXA 4Q45A 1J2MA 1D9DA 3JPPA 1ZQGA 3ORYA 3N7PD 1RYRA 4YXMA 3PO5A 4XRHA 4JV2A 5J2AA 4YVZA 5J0UA 3V6JA 3ISCA 1UA0A 2HHQA 1JN3A 1QQ5A 2H3ZA 2WAQC 4OO1J 1T94A 5DB9A 5J0XA 4B9TA 4E0DA 3K75D 1WUDA 2N1RA 2HHTA 3CW2C 4PHPA 2RDJA 2BKEA 2K4PA 2K4IA 3JPTA 4G9BA 5A0LA 4PPXA 3M6KA 4FZMA 4P0QA 1WWVA 4DL4A 4YR2A 5IIIA 1YZ6A 3M1YA 5IILA 4ECRA 1B43A 1LKYA 3N7RC 3TKAA 1Z00A 4OD0A 4JUZA 4R65A 1XU4A 1XO0A 4DFMA 4NL9C 4WJ3B 3UQ0A 2IOHA 4O3NA 3RJIA 5KTQA 2LI6A 2YQEA 5KG1A 2IA6A 8ICOA 1JIHA 2J6UA 3RJEA 2G5HB 2BQ3A 2VKQA 3M9OB 4IQTA 3N4MB 3PR5B 2ZG6A 4F5OA 5ALTA 3BQTA 2WAQF 3PVXA 1RZTA 1F5SA 2NRXA 4OJLA 4KLJA 4MFAA 2XO7A 1LKYB 5AI5A 3EPIA 1SL1A 2YMPA 4QZ8A 2FLNA 4BXOB 4HAIA 2YB1A 3H4DA 2LMRA 5KT2A 4QJFB 4UAYA 5CP2A 2FE9A 1QCKA 4DOBA 2ZIUA 1L3SA 2YY6A 3MR6A 5KT7A 3V72A 1KKXA 1V9PA 4EBEA 1KLNA 2W8LA 3OHBA 1N62A 4MEYA 4NXZA 3D6JA 2AH5A 4O3PA 1XO1A 1QTMA 3PW7A 3C2MA 3KHGA 1NK4A 3HILA 1D9FA 3GU3A 2Y9TA 3SQIA 5J2HA 4I2EA 2GOLA 3N28A 2ES6A 2CRXA 2PI5A 1ZQXA 4QZBA 4F3OA 3SV4A 3CRXA 5KFZA 5JRTA 3RB6A 5KFUA 4JV1A 1S8OA 2J6TA 2KZ3A 3AL0B 3ETLA 1ZYQA 4QZHA 5BOLA 1O08A 3WK7A 4F71A 4IS7A 3THVA 1S0NA 1U48A 4K4GA 1ZQIA 3EW9A 2W9BA 3WK9A 5KG4A 4JK1A 1T3NA 3SEIA 5F9LA 5KFAA 1S0VA 4O3MA 2W7OA 2W7PA 2DF4B 2HOIA 4I29A 4YMMA 3V7JA 3BJYA 3PZPA 1TK8A 8ICNA 5L1IA 1ZXIA 2BCVA 2ESEA 2DGZA 2IOFA 3ALRA 4UASA 2HBLA 4ZH4A 4RNNA 5IIMA 4JWNA 1UA1A 9ICVA 2HW3A 1QH9A 4EYIB 2K60A 4RQ5A 1PVQA 1FIQA 3NVWA 5J0QA 1MC8A 1CRXA 1OW5A 4P4OA 1IIPA 3MR2A 1P7DA 1S5LU 1FEZA 1QQ7A 2WB1F 1S9FA 2EAMA 5AKEA 2FPMA 2ZIXA 9ICNA 2AQ0A 4NLZA 2QLTA 2D8CA 4CCHA 4J9KA 1A77A 4IRCA 4YD2A 4ECSA 7ICGA 4DO9A 4KLGA 5AKLA 3NASA 3KBBA 1HIWA 3CNHA 4KLMA 2ZIWB 4G3IA 2JGAA 5ALKA 4F4YA 4F5RA 5DBCA 3ZD8A 1L7OA 2NRVA 5ALNA 9ICRA 1ZQJA 3F2CA 2OEHA 3GZFA 3C23A 5AI4A 2KTQA 4ECZA 4KLUA 4CF4A 4B9VA 1PK1B 4NV0A 4I2CA 1C7YA 2ASLA 4I2JA 8ICXA 1DOQA 5AM5A 4EBCA 1T4GA 2PFQA 4FS1A 3D2QA 8ICZA 5ALYA 3A0HU 3H0MB 1RYUA 3ZDEA 3RFAA 1FFUA 4J9OA 2F44A 2F1IA 5ALPA 1ZQVA 4DOAA 1TAQA 5ALFA 3QUCA 4DSEA 1UPHA 1URJA 3S6JA 2MSNA 4UQGA 1RXWA 3M6ZA 1XC9A 3M9MB 1H38A 1N61A 2FI1A 5CEHA 5KFSA 4M04A 3KTQA 4PZNA 4OCZA 4RPYA 1WYGA 4CF3A 4RQ7A 1NK0A 2RDIA 1DK2A 4PGXA 1SKSA 3TI0A 5L1JA 5DLFA 2ZIVA 1DK3A 3UPQA 4F4KA 1ZD2P 4NM2A 3MGHA 4IQVA 8ICWA 2AGQA 1MSWD 3QU2A 3OGUA 2NRZA 3NVZA 4RUCA 3MFIA 3Q8RB 1HUZA 4IC9A 2OYYA 3HW8A 3QEBZ 3O0FA 1WG8A 1ZETA 2Y9UA 5D46A 4Q44A 5KFKA 1KBUA 4YXJA 2RQ5A 5KFTA 2ASDA 4I2IA 4ECTA 4UB4A 5AM0A 4B9LA 1U45A 2HCFA 5HHHA 5AK6A 3LDAA 5IIKA 5AKGA 3T5LA 3H8WA 3C1YA 3GIKA 3QU5A 5BOMA 3U26A 4YMOA 4OJ6A 2MA1A 1Z4OA 4KLHA 3PMNA 1BVSA 1X9XA 1TAUA 1ZD3A 2G07A 1JXLA 4RPZA 2F1JA 3WK5A 4IQWA 4GLXA 8ICCA 4QIWF 4IRDA 3GV8B 3LWLA 4RT2A 2KIWA 3Q8KA 1A6SA 4C8OA 2BPFA 4KX3A 4R66A 3C5GA 2KEYA 1SV4A 3PX0A 4JWMA 4Q8FA 4MEXA 3ZD9A 3RH6A 2E1FA 2YMQA 2IOFK 5DGBA 2VIXA 2PXIA 4Y2VA 4C8LA 1PZNA 5HHIA 4EBDA 5DDYA 1SIJA 4DL5A 4DF4A 2JH7A 4ECYA 4PHEA 5AM1A 1K1QA 7ICEA 2C2RA 2JZBB 1CEZA 4Z6CA 3GQCA 2WF7A 4QZFA 7ICLA 1ZJNA 3T5HA 4BWJA 4KITB 1ZQLA 4O3RA 5J2DA 3TFSA 3WK6A 1SL2A 2FPKA 5CB1A 1N56A 3I28A 4DCCA 4DQRA 2WFAA 1XNSA 3PW5A 2YX8A 5KFNA 2PI4A 2HOFA 2FDRA 2H3FA 2JRZA 3TAPA 4GXKA 5GTHU 1QSYA 3BDPA 7ICUA 2ZUDA 2G0AA 3F5AA 4ZOHC 2ZUCA 1B0XA 1RDFA 7ICJA 1Q8KA 3I1YA 4QZAA 3C2LA 2ZIUB 3LVVA 2RRDA 2LKYA 7ICQA 2ZIVB 3ONNA 5BPCA 5KFGA 3UMBA 4QW8A 1BNPA 5AI0A 5CR0A 2JEGA 3L5KA 4IQUA 1XSNA 1LVHA 5KFPA 1ZQYA 5HMLA 2JHDA 1SZPA 1ZRMA 2PMZF 3SYZA 3IV6A 2HBKA 4BUGA 1TAMA 2RHFA 5TZVA 1MN8A 4NLCA 1X66A 1PUZA 4MF8A 3H7IA 2XGPA 5FP0A 4EEYA 3IP4B 3B0YA 1NJYA 2LYBA 5EE1A 2CXYA 4DOCA 3IN5A 2QB0A 4ED1A 4KLSA 4EZ9A 5B5EU 3V7KA 3FAHA 4MHVA 5DBAA 2DPIA 2NRWA 1X6IA 1MA7A 5K4LA 4Y2RA 2W9BB 2DUYA 2ASJA 1X9WA 2DL0A 3BS5A 4C4TA 1HJPA 5J29A 5ALZA 4FBUA 2LM1A 4JMUA 5CJ7A 4P4MA 1N48A 3RJFA 2KZZA 2H3QA 3G6YA 2FLLA 2ZTEA 2W9CA 2EH9A 4C4RA 4M0AA 3UXNA 1N5WA 3MGVA 1BNOA 3QXGA 1JX4A 2E5SA 3TANA 3RH4A 3AQEA 2J6SA 2KE7A 5H2FU 3FDSA 2W43A 3TARA 2BPGA 3PX4A 4Y2UA 4RQ1A 3JPNA 4IR9A 9ICTA 2Y1JA 2DFLA 5DB8A 2PKEA 2G06A 4EZ6A 4TQRA 4QIWC 3RB0A 4O5EA 7ICTA 2F1HA 5HR6A 5KFWA 2PFOA 3RBEA 4YP3A 3MGIA 2IMWP 2HBMA 2FJ6A 2JH1A 3UXPA 5KG7A 1UQVA 3TACB 2XCPA 5T14A 2HOQA 1ZQCA 3KHHA 3HX0A 3GILA 4KLQA 3AQFA 4Y2QA 2W9AA 2F77X 4EX7A 9ICJA 1X9MA 3SAHA 3H0LB 2IHNA 1SB3C 1D8BA 5ALIA 1M6YA 3OPXA 2P6RA 1N63A 1ZD4A 2K8AA 2HDOA 2W55A 4QW9A 2R18A 4NLKA 8ICEA 1LV5A 2A1AA 4PH5A 5F9NA 3BS7A 1X6JA 4AP9A 9ICPA 5KT6A 1ZQOA 1D8LA 4UB6U 1PVPA 4CF5A 4RT3A 5AM4A 4RQ3A 4Z6FA 4F4WA 4DS4A 1VLBA 1NJXA 3UXOA 2VA3A 1YT3A 3KHLA 2HHVA 4F2SA 1D8YA 4OJPA 3PSFA 2HHSA 5ALMA 4KLOA 2Z7JA 2DKXA 3RJGA 2AHOB 4C7YA 4I2DA 7ICMA 5DQIA 5C0YA 3D2NA 4P0PB 1C20A 4J9RA 9ICHA 3TFRA 2B0CA 5DBBA 2ZJ8A 2YB4A 1PVRA 1SKWA 3H8JA 5AHXA 3TADC 5J2IA 4Y2XA 3WK8A 4MF2A 1RXVA 2HSZA 3V6KA 2BGWA 4UAZA 5AIBA 2I5HA 2LBOA 1FO4A 4F50A 3FYHA 4C7ZA 9ICSA 1SWVA 5DKWA 2EANA 3MDAA 4NLBA 1QQ6A 3MABA 1LB2B 8ICVA 5CWRA 3BS5B 2QKQA 3GIJA 2HMXA 4M9HA 4B6JA 4M9LA 1UT5A 4DL6A 3GIMA 4LVSA 3OJSA 2VANA 4Q43A 4PZOA 3L3FX 3AU2A 4QWDA 1QLNA 2W04A 2M0NA 1VDVA 4DL3A 1NKBA 3RJJA 2KFNA 2K8CB 5DDMA 5KFMA 5D49A 4X5VA 1J97A 2LHTA 4UB5A 2AXTU 4DSKA 1J2NA 2C22A 4UAVA 3H4BA 1UCVA 3NTUA 8ICLA 5DG9A 9ICLA 2XVTA 4NY8A 2V4RA 3MR3A 1Z4NA 3DV9A 2I1QA 1NZPA 2EDUA 4ED6A 4DFPA 2XY5A 1Z19A 2G5IB 1NJWA 2GO7A 3HJEA 2WTFA 3ZDBA 3AMZA 2NYVA 3GFKB 4TUSA 4EEKA 2KJ8A 4B9MA 4YG2A 2ZJ5A 1KSPA 4R8UB 5ALEA 3QU4A 2W03A 2XC9A 5KL8B 4NWIA 5KFVA 4XQ8A 3LK9A 7ICRA 3AUOA 2GH1A 5IINA 1V85A 4US8A 1ECWA 4R63A 4GFJA 5KFHA 2I6XA 5EE9A 3PW0A 4I2BA 8ICIA 4DLGA 3LWMA 2WHEA 4O3QA 5ALLA 1TK0A 2JMGA 2LYHA 5KFBA 1S76D 2ISPA 2JEFA 3C21A 4J9PA 4P0QB 5AI8A 3T5JA 4NLGA 4A8EA 1ZQPA 4PL2A 4CNQA 3M9NB 5KT5A 2VJ5A 3MR5A 1L3VA 3WKAA 1RG6A 2MUTB 2KV2A 4M9JA 4HYKA 9ICQA 5L9XA 3KKAC 2HHWA 3ISDA 2UVWA 1CI4A 3H8MA 4I2GA 3K1RB 2EZZA 3D2SA 1NKCA 2BCSA 2VJ4A 9ICWA 1SKRA 2BDPA 1X2IA 3BQ7A 2F8KA 7ICVA 3ICXA 3RB4A 4DF8A 3PV8A 5KT4A 4YR3A 5ALUA 3GV5B 4DFDA 2OM6A 4RQ4A 1L7NA 4PGQA 3J81j 4J9SA 5EE0A 2Y1IA 1T3QA 3HRDD 2W3RA 3RJHA 1BPXA 2FMPA 3G6XA 5F3XB 3JPOA 4AYBF 2KSOB 7ICHA 4QZGA 1JI7A 1O03A 2LPEA 3UM9A 1GO3F 2H3IA 3PMLA 3E0FA 5ALQA 5EOZA 1Z1BA 1KQQA 1TFRA 2JR5A 2OH2A 2MU2A 3QYPA 2MUTA 5AKKA 3AEVA 2Y0SC 4P4PA 4RNOA 2KICA 1HUOA 1QSLA 1S97A 9ICBA 1TVAA 1L8LA 1SV0C 5DG8A 4F8RA 4BJQA 9ICIA 2W3SA 1OXJA
chains in the Genus database with same CATH topology
2I5HA 2EDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5H A;  2EDU A; 
#chains in the Genus database with same CATH topology
 1BPE A;  4ELU A;  3HKZ F;  5AI6 A;  5DLG A;  3RF9 A;  1ZQW A;  4CGZ A;  3OJU A;  2F2A B;  4QWE A;  3ZDA A;  1N5X A;  5EE3 A;  5EWG A;  5AKY A;  1NNL A;  1TE2 A;  5L1M A;  1F0M A;  1X42 A;  3ETR A;  5KFD A;  2M9N A;  1SXE A;  2ZXI A;  4UAR A;  4NLN A;  3PW2 A;  4R64 A;  4JB3 A;  4Z6D A;  5AIC A;  3HT3 A;  4I28 A;  3WKC A;  1RM6 C;  2ODG A;  2AQ4 A;  3SR6 A;  3IM1 A;  3PO4 A;  2FMS A;  4I2A A;  3PY8 A;  2HHU A;  4FS2 A;  5HNK A;  2A1J A;  2W9M A;  5AK5 A;  3EYZ A;  3FC4 A;  4F5N A;  2ALZ A;  5J2C A;  4KLI A;  4NM1 A;  4B9N A;  5J8Y A;  5KFY A;  7ICS A;  4C0Z A;  1DRG A;  2P35 A;  3JPQ A;  3BQ2 A;  2F8L A;  2ZIX B;  4O3S A;  5DQG A;  1ZQ1 C;  4OJ5 A;  2P6U A;  4QZE A;  2HI0 A;  5L1K A;  1ZQE A;  4TQS A;  1ZQK A;  1S0O A;  2EZY A;  1L8O A;  5CA7 A;  3SZ2 A;  3BZK A;  4J9N A;  3PSI A;  5G5G A;  4U6P A;  1WCN A;  3EUB 2;  1UT8 A;  3C29 A;  2AU0 A;  3R9K A;  1EXN A;  4PHA A;  1YZ7 A;  4RNM A;  2A1J B;  1Y88 A;  4UB2 A;  4KX5 A;  1KL9 A;  4QWA A;  5AKJ A;  8ICR A;  3SD7 A;  2VA2 A;  2Q4T A;  2PMZ C;  3IG8 A;  2ZTC A;  1B22 A;  3CP8 A;  5CRX A;  2KD1 A;  4JV0 A;  4FZL A;  2XGQ A;  2R8J A;  2V9W A;  2EZX A;  4YCX A;  5KG0 A;  3WKE A;  3JPR A;  3OSP A;  3TAD A;  1XWL A;  3WK4 A;  3QU7 A;  3T3F A;  4ED3 A;  1U9L A;  2QAR A;  2KMD A;  2DWQ A;  2ZTD A;  1Z3E B;  4GIB A;  5KT3 A;  5J0O A;  3QUQ A;  4FO6 A;  8ICH A;  3MFH A;  4RQN A;  5J0W A;  5AKX A;  3C2K A;  3RJK A;  5ALJ A;  1Z00 B;  1ARO P;  3RR7 A;  5ALD A;  1MQ2 A;  1KFD A;  2XIC A;  1NK6 A;  2OCE A;  2BCR A;  8ICM A;  2O6K A;  3E2E A;  3IHQ B;  5J2F A;  5IIO A;  2A19 A;  1L3U A;  2V4Q A;  3RRG A;  2EAO A;  2WF8 A;  1QSS A;  3M8S A;  1DGS A;  3IDW A;  3BQ1 A;  4DQS A;  5AKZ A;  5DQH A;  2KVC A;  3PX6 A;  1X9S A;  3K4G A;  2C28 A;  4RPX A;  2F76 X;  2QB1 A;  8ICJ A;  3JPS A;  1ZD5 A;  2W8K A;  5J0P A;  2UVR A;  3WKD A;  2D6F C;  2C2E A;  1T7P A;  5AM2 A;  3Q8S B;  4J9M A;  3NVY A;  2P66 A;  2BQR A;  3MDC A;  2HBJ A;  3LVW A;  5J8Y C;  4ECV A;  1JXE A;  4RQ8 A;  4DSI A;  3GII A;  1ZOL A;  4XA5 A;  3IG5 A;  3HKZ C;  2KJ5 A;  2HVI A;  2CPR A;  5KFJ A;  3F2B A;  2YTU A;  8ICT A;  2FLP A;  1Q3U A;  3QU9 A;  2I9G A;  1RQN A;  5EWE A;  3SAF A;  5KFO A;  1ZQD A;  3SAG A;  5KFQ A;  3BQ0 A;  4PJ0 U;  4ECU A;  4UBB A;  1A76 A;  2KZM A;  4BWM A;  3VCB A;  2WF5 A;  4LZG A;  3RRH A;  3M8R A;  2YN4 A;  8ICB A;  3I76 A;  4FZN A;  4M9G A;  2MAX A;  5AIA A;  2KSO A;  4F72 A;  4DLE A;  1IXR A;  4B9S A;  2OWO A;  2JV3 A;  9ICE A;  4UAU A;  2E3T A;  1V38 A;  3NS1 A;  5KNI A;  3EWA A;  4YMN A;  4EX6 A;  2DKZ A;  1S10 A;  1L3T A;  3ZI4 A;  1WWU A;  1DGJ A;  1OUQ A;  1ZQF A;  4DQQ A;  9ICA A;  5ALV A;  1N60 A;  4DL7 A;  4YQW A;  5KFL A;  5KFE A;  4RQ6 A;  5J0R A;  1L5U A;  4GC6 A;  1SGG A;  2LYA A;  4LJX A;  2WF6 A;  1KFT A;  4KN7 A;  1COO A;  5HR7 A;  3H40 A;  1MQ3 A;  2UVV A;  5J0Y A;  5HMM A;  4Y2P A;  2XY7 A;  3VC8 A;  3Q8M A;  2AGP A;  5ALX A;  2Q0Z X;  5AM3 A;  5KFF A;  1NZB A;  5ALS A;  4USA A;  3Q8Q B;  3RTV A;  2KJ9 A;  5KG5 A;  2H3V A;  2C2D A;  5ALW A;  5J0S A;  7ICI A;  1KFS A;  4ECW A;  4KLF A;  1BPB A;  2KKP A;  3BZC A;  2R8G A;  4ELV A;  1NJZ A;  4Y2J A;  4RQ0 A;  4YFK A;  3GV7 B;  4F5Q A;  5ALO A;  2A3V A;  4F93 B;  5AKI A;  9ICG A;  3NVV A;  2ZIW A;  1IV8 A;  1ZRN A;  2QB0 B;  4CE6 A;  7ICO A;  2DPJ A;  3HP6 A;  1SV0 A;  4QZD A;  4UAW A;  4F92 B;  5AI9 A;  2E8N A;  3F5E A;  4CDG A;  5D4B A;  4J03 A;  4C4S A;  1BPY A;  3MBY A;  2ZXH A;  2KG5 A;  4F91 B;  4XUS A;  1S0M A;  1SZH A;  3ISB A;  4MFF A;  3F53 A;  2G08 A;  4UAT A;  4US9 A;  2IHM A;  4QWC A;  4YR0 A;  4J9Q A;  4FFD A;  5DGA A;  4TUP A;  4Q8E A;  5JU5 A;  4QZC A;  2KVS A;  2W9C B;  4KTQ A;  3M7D A;  2E8M A;  5AK4 A;  1NK7 A;  2Y0S F;  2KK0 A;  5GTI U;  8ICQ A;  2XI9 A;  9ICX A;  2BZF A;  2BHN A;  1KW4 A;  3T79 A;  3KOO A;  2H5X A;  3KZI U;  1AQ6 A;  1N2X A;  5E79 U;  2R8H A;  1ZQU A;  1U47 A;  3WKB A;  1ZQQ A;  5CHG A;  3QZ7 A;  1ZQR A;  3PR4 A;  4C8K A;  4KMU A;  4P2H A;  1NOM A;  1DXS A;  4PHD A;  3L4P A;  5J2E A;  4DFJ A;  1ZQA A;  9ICF A;  3QUB A;  3RAQ A;  4KLL A;  2PFN A;  4PL1 A;  4DS5 A;  4CRX A;  3B0X A;  4J9L A;  1ED1 A;  5EWF A;  4I2F A;  3NRW A;  2JEJ A;  1KTQ A;  2GLE A;  4Y2T A;  2NO5 A;  1ZJM A;  3QEA Z;  3OSN A;  3ZDD A;  5KFR A;  4I27 A;  4IRK A;  3KKA A;  3LYS A;  1K5O A;  3GDX A;  1L6N A;  2NO4 A;  9ICK A;  2K4H A;  4ED7 A;  4O5K A;  2K8B B;  5L1L A;  1U4B A;  1RPL A;  4UB1 A;  4C80 A;  4M2Y A;  1ZQB A;  5KAI U;  3ZDC A;  1SL0 A;  2ISO A;  2DBY A;  5DG7 A;  2BDU A;  2R8I A;  4FBT A;  4KLT A;  1VJ5 A;  3SV3 A;  5JUM A;  2D3D A;  4R8U A;  1ZQZ A;  5AK3 A;  3HPO A;  4RUA A;  9ICO A;  1JUD A;  3T5K A;  1ZQM A;  3UMG A;  5KFC A;  4NJ8 A;  2BCU A;  4ELT A;  1PK3 A;  2EAP A;  4IL6 U;  2AJQ A;  4DSJ A;  2KP7 A;  4RZR A;  3KFU F;  4M6W B;  1ZQN A;  2OHF A;  3OTQ A;  5AKH A;  4M47 A;  3N7S C;  1T8E A;  1XSP A;  7ICF A;  1BPZ A;  5J2B A;  5KFI A;  1KEJ A;  4TUQ A;  1KN5 A;  3KHR A;  3C1Z A;  1COK A;  3FM9 A;  7ICP A;  4YD1 A;  5KL1 B;  4I2H A;  3SI8 A;  9ICM A;  1IM4 A;  1TK5 A;  3Q8P B;  4GXJ A;  3MC1 A;  1XSL A;  4DQP A;  1L7P A;  3C5F A;  4DFK A;  3N97 B;  4YN4 A;  4GC7 A;  1X40 A;  4UW9 A;  1SWW A;  1XS9 D;  5TIS U;  4ACO A;  5JTI A;  4F2R A;  3G6V A;  1NK9 A;  3NGD A;  1PK1 A;  2KIV A;  5KAF U;  4BGD A;  3PNC A;  1Q3V A;  2KHQ A;  3C28 A;  3KZX A;  2BPC A;  3KD3 A;  4C8M A;  1TV9 A;  4EYH B;  4MFC A;  4O3O A;  1B4F A;  4UB3 A;  3H8S A;  4O0I A;  4KN4 A;  3RH5 A;  3AN1 A;  2CN1 A;  1UHU A;  4KLE A;  2JXJ A;  3QUT A;  3EPG A;  4RU9 A;  4EEL A;  5KFX A;  2LM4 A;  4DSF A;  4QWB A;  2K89 A;  3QX7 A;  3RBD A;  1RQL A;  3QNM A;  2K4E A;  5C5J A;  3PST A;  3NUQ A;  1S77 D;  1TKD A;  1JMS A;  3NRZ A;  2PFP A;  4Y2Y A;  1JRP A;  4Z6E A;  1RYS A;  9ICU A;  1F44 A;  2W11 A;  2WB1 C;  4ED8 A;  1SXD A;  2ATL A;  3RAX A;  1V97 A;  5J2G A;  3A0B U;  3TQ1 A;  1NKE A;  4Y2S A;  2BCQ A;  2B6G A;  2E8O A;  4IR1 A;  4LZD A;  3E58 A;  4ED0 A;  1Z1V A;  3B9J A;  4EEN A;  1K1S A;  2HVH A;  4GXI A;  4O5C A;  9ICC A;  5G5H A;  8ICF A;  3QZ8 A;  2BQU A;  5J0T A;  1KDH A;  2KOB A;  1ZQS A;  4RQM A;  8ICG A;  4M6W A;  3SEN A;  3UQ2 A;  1ZQT A;  5DB7 A;  1CUK A;  1NI3 A;  2XCA A;  4DEZ A;  2XID A;  4F4Z A;  3V6H A;  2UVU A;  2JZB A;  3IRU A;  1IG6 A;  4ECX A;  7ICK A;  2QAR B;  8ICY A;  8ICK A;  4AYB C;  2KNJ A;  8ICP A;  4PGY A;  4TUR A;  7ICN A;  2RLT A;  1FFV A;  1HEK A;  3V7L A;  2VA8 A;  1L7M A;  3ED5 A;  2AGO A;  3OHA A;  2G09 A;  3WU2 U;  2E1E A;  2KHV A;  3QE9 Y;  5KG6 A;  3PW4 A;  1KRP A;  5B66 U;  1NK5 A;  1ZQH A;  1NK8 A;  2OXO A;  2FMQ A;  4QZI A;  4P0P A;  2WF9 A;  4DQI A;  2E8P A;  1JAL A;  2W54 A;  4QNL A;  5IIJ A;  2NV3 A;  2KFZ A;  8ICU A;  4KLD A;  2R8K A;  4QZ9 A;  3DDH A;  4BXO A;  4C8N A;  5J2K A;  4ECQ A;  4K4H A;  3UMC A;  2NRT A;  4NL9 A;  3H0R B;  3DEE A;  2YMM A;  3AU6 A;  2L5Y A;  4O9M A;  8ICA A;  3CYM A;  5ALH A;  1WCL A;  4U7C A;  5KG3 A;  2IBK A;  3Q8L A;  2ZUB A;  4UBC A;  4DL2 A;  3RB3 A;  5ALR A;  4ICA A;  2JEI A;  2KKV A;  3F2D A;  2FPL A;  5ALG A;  8ICS A;  3AM9 A;  3RR8 A;  2B21 A;  2EQY A;  4F4X A;  2KN7 A;  2XY6 A;  2BR0 A;  2F3N A;  3TAQ A;  2ZJA A;  4BDP A;  4KMO B;  2GWS A;  4ED2 A;  4UB8 U;  4FE3 A;  2RP5 A;  2YML A;  4DSL A;  1JRO A;  3PSP A;  5J2J A;  4K4I A;  1BGX T;  1BPD A;  3SMV A;  4B9U A;  4OJO A;  4M9N A;  3K1Z A;  4DWI A;  1U49 A;  2MRL A;  4RQ2 A;  1Q46 A;  5HP4 A;  3HWT A;  3EZ5 A;  1A0P A;  5DB6 A;  4F5P A;  2DQN B;  4BX9 C;  5KG2 A;  2HHX A;  4Q45 A;  1J2M A;  1D9D A;  3JPP A;  1ZQG A;  3ORY A;  3N7P D;  1RYR A;  4YXM A;  3PO5 A;  4XRH A;  4JV2 A;  5J2A A;  4YVZ A;  5J0U A;  3V6J A;  3ISC A;  1UA0 A;  2HHQ A;  1JN3 A;  1QQ5 A;  2H3Z A;  2WAQ C;  4OO1 J;  1T94 A;  5DB9 A;  5J0X A;  4B9T A;  4E0D A;  3K75 D;  1WUD A;  2N1R A;  2HHT A;  3CW2 C;  4PHP A;  2RDJ A;  2BKE A;  2K4P A;  2K4I A;  3JPT A;  4G9B A;  5A0L A;  4PPX A;  3M6K A;  4FZM A;  4P0Q A;  1WWV A;  4DL4 A;  4YR2 A;  5III A;  1YZ6 A;  3M1Y A;  5IIL A;  4ECR A;  1B43 A;  1LKY A;  3N7R C;  3TKA A;  1Z00 A;  4OD0 A;  4JUZ A;  4R65 A;  1XU4 A;  1XO0 A;  4DFM A;  4NL9 C;  4WJ3 B;  3UQ0 A;  2IOH A;  4O3N A;  3RJI A;  5KTQ A;  2LI6 A;  2YQE A;  5KG1 A;  2IA6 A;  8ICO A;  1JIH A;  2J6U A;  3RJE A;  2G5H B;  2BQ3 A;  2VKQ A;  3M9O B;  4IQT A;  3N4M B;  3PR5 B;  2ZG6 A;  4F5O A;  5ALT A;  3BQT A;  2WAQ F;  3PVX A;  1RZT A;  1F5S A;  2NRX A;  4OJL A;  4KLJ A;  4MFA A;  2XO7 A;  1LKY B;  5AI5 A;  3EPI A;  1SL1 A;  2YMP A;  4QZ8 A;  2FLN A;  4BXO B;  4HAI A;  2YB1 A;  3H4D A;  2LMR A;  5KT2 A;  4QJF B;  4UAY A;  5CP2 A;  2FE9 A;  1QCK A;  4DOB A;  2ZIU A;  1L3S A;  2YY6 A;  3MR6 A;  5KT7 A;  3V72 A;  1KKX A;  1V9P A;  4EBE A;  1KLN A;  2W8L A;  3OHB A;  1N62 A;  4MEY A;  4NXZ A;  3D6J A;  2AH5 A;  4O3P A;  1XO1 A;  1QTM A;  3PW7 A;  3C2M A;  3KHG A;  1NK4 A;  3HIL A;  1D9F A;  3GU3 A;  2Y9T A;  3SQI A;  5J2H A;  4I2E A;  2GOL A;  3N28 A;  2ES6 A;  2CRX A;  2PI5 A;  1ZQX A;  4QZB A;  4F3O A;  3SV4 A;  3CRX A;  5KFZ A;  5JRT A;  3RB6 A;  5KFU A;  4JV1 A;  1S8O A;  2J6T A;  2KZ3 A;  3AL0 B;  3ETL A;  1ZYQ A;  4QZH A;  5BOL A;  1O08 A;  3WK7 A;  4F71 A;  4IS7 A;  3THV A;  1S0N A;  1U48 A;  4K4G A;  1ZQI A;  3EW9 A;  2W9B A;  3WK9 A;  5KG4 A;  4JK1 A;  1T3N A;  3SEI A;  5F9L A;  5KFA A;  1S0V A;  4O3M A;  2W7O A;  2W7P A;  2DF4 B;  2HOI A;  4I29 A;  4YMM A;  3V7J A;  3BJY A;  3PZP A;  1TK8 A;  8ICN A;  5L1I A;  1ZXI A;  2BCV A;  2ESE A;  2DGZ A;  2IOF A;  3ALR A;  4UAS A;  2HBL A;  4ZH4 A;  4RNN A;  5IIM A;  4JWN A;  1UA1 A;  9ICV A;  2HW3 A;  1QH9 A;  4EYI B;  2K60 A;  4RQ5 A;  1PVQ A;  1FIQ A;  3NVW A;  5J0Q A;  1MC8 A;  1CRX A;  1OW5 A;  4P4O A;  1IIP A;  3MR2 A;  1P7D A;  1S5L U;  1FEZ A;  1QQ7 A;  2WB1 F;  1S9F A;  2EAM A;  5AKE A;  2FPM A;  2ZIX A;  9ICN A;  2AQ0 A;  4NLZ A;  2QLT A;  2D8C A;  4CCH A;  4J9K A;  1A77 A;  4IRC A;  4YD2 A;  4ECS A;  7ICG A;  4DO9 A;  4KLG A;  5AKL A;  3NAS A;  3KBB A;  1HIW A;  3CNH A;  4KLM A;  2ZIW B;  4G3I A;  2JGA A;  5ALK A;  4F4Y A;  4F5R A;  5DBC A;  3ZD8 A;  1L7O A;  2NRV A;  5ALN A;  9ICR A;  1ZQJ A;  3F2C A;  2OEH A;  3GZF A;  3C23 A;  5AI4 A;  2KTQ A;  4ECZ A;  4KLU A;  4CF4 A;  4B9V A;  1PK1 B;  4NV0 A;  4I2C A;  1C7Y A;  2ASL A;  4I2J A;  8ICX A;  1DOQ A;  5AM5 A;  4EBC A;  1T4G A;  2PFQ A;  4FS1 A;  3D2Q A;  8ICZ A;  5ALY A;  3A0H U;  3H0M B;  1RYU A;  3ZDE A;  3RFA A;  1FFU A;  4J9O A;  2F44 A;  2F1I A;  5ALP A;  1ZQV A;  4DOA A;  1TAQ A;  5ALF A;  3QUC A;  4DSE A;  1UPH A;  1URJ A;  3S6J A;  2MSN A;  4UQG A;  1RXW A;  3M6Z A;  1XC9 A;  3M9M B;  1H38 A;  1N61 A;  2FI1 A;  5CEH A;  5KFS A;  4M04 A;  3KTQ A;  4PZN A;  4OCZ A;  4RPY A;  1WYG A;  4CF3 A;  4RQ7 A;  1NK0 A;  2RDI A;  1DK2 A;  4PGX A;  1SKS A;  3TI0 A;  5L1J A;  5DLF A;  2ZIV A;  1DK3 A;  3UPQ A;  4F4K A;  1ZD2 P;  4NM2 A;  3MGH A;  4IQV A;  8ICW A;  2AGQ A;  1MSW D;  3QU2 A;  3OGU A;  2NRZ A;  3NVZ A;  4RUC A;  3MFI A;  3Q8R B;  1HUZ A;  4IC9 A;  2OYY A;  3HW8 A;  3QEB Z;  3O0F A;  1WG8 A;  1ZET A;  2Y9U A;  5D46 A;  4Q44 A;  5KFK A;  1KBU A;  4YXJ A;  2RQ5 A;  5KFT A;  2ASD A;  4I2I A;  4ECT A;  4UB4 A;  5AM0 A;  4B9L A;  1U45 A;  2HCF A;  5HHH A;  5AK6 A;  3LDA A;  5IIK A;  5AKG A;  3T5L A;  3H8W A;  3C1Y A;  3GIK A;  3QU5 A;  5BOM A;  3U26 A;  4YMO A;  4OJ6 A;  2MA1 A;  1Z4O A;  4KLH A;  3PMN A;  1BVS A;  1X9X A;  1TAU A;  1ZD3 A;  2G07 A;  1JXL A;  4RPZ A;  2F1J A;  3WK5 A;  4IQW A;  4GLX A;  8ICC A;  4QIW F;  4IRD A;  3GV8 B;  3LWL A;  4RT2 A;  2KIW A;  3Q8K A;  1A6S A;  4C8O A;  2BPF A;  4KX3 A;  4R66 A;  3C5G A;  2KEY A;  1SV4 A;  3PX0 A;  4JWM A;  4Q8F A;  4MEX A;  3ZD9 A;  3RH6 A;  2E1F A;  2YMQ A;  2IOF K;  5DGB A;  2VIX A;  2PXI A;  4Y2V A;  4C8L A;  1PZN A;  5HHI A;  4EBD A;  5DDY A;  1SIJ A;  4DL5 A;  4DF4 A;  2JH7 A;  4ECY A;  4PHE A;  5AM1 A;  1K1Q A;  7ICE A;  2C2R A;  2JZB B;  1CEZ A;  4Z6C A;  3GQC A;  2WF7 A;  4QZF A;  7ICL A;  1ZJN A;  3T5H A;  4BWJ A;  4KIT B;  1ZQL A;  4O3R A;  5J2D A;  3TFS A;  3WK6 A;  1SL2 A;  2FPK A;  5CB1 A;  1N56 A;  3I28 A;  4DCC A;  4DQR A;  2WFA A;  1XNS A;  3PW5 A;  2YX8 A;  5KFN A;  2PI4 A;  2HOF A;  2FDR A;  2H3F A;  2JRZ A;  3TAP A;  4GXK A;  5GTH U;  1QSY A;  3BDP A;  7ICU A;  2ZUD A;  2G0A A;  3F5A A;  4ZOH C;  2ZUC A;  1B0X A;  1RDF A;  7ICJ A;  1Q8K A;  3I1Y A;  4QZA A;  3C2L A;  2ZIU B;  3LVV A;  2RRD A;  2LKY A;  7ICQ A;  2ZIV B;  3ONN A;  5BPC A;  5KFG A;  3UMB A;  4QW8 A;  1BNP A;  5AI0 A;  5CR0 A;  2JEG A;  3L5K A;  4IQU A;  1XSN A;  1LVH A;  5KFP A;  1ZQY A;  5HML A;  2JHD A;  1SZP A;  1ZRM A;  2PMZ F;  3SYZ A;  3IV6 A;  2HBK A;  4BUG A;  1TAM A;  2RHF A;  5TZV A;  1MN8 A;  4NLC A;  1X66 A;  1PUZ A;  4MF8 A;  3H7I A;  2XGP A;  5FP0 A;  4EEY A;  3IP4 B;  3B0Y A;  1NJY A;  2LYB A;  5EE1 A;  2CXY A;  4DOC A;  3IN5 A;  2QB0 A;  4ED1 A;  4KLS A;  4EZ9 A;  5B5E U;  3V7K A;  3FAH A;  4MHV A;  5DBA A;  2DPI A;  2NRW A;  1X6I A;  1MA7 A;  5K4L A;  4Y2R A;  2W9B B;  2DUY A;  2ASJ A;  1X9W A;  2DL0 A;  3BS5 A;  4C4T A;  1HJP A;  5J29 A;  5ALZ A;  4FBU A;  2LM1 A;  4JMU A;  5CJ7 A;  4P4M A;  1N48 A;  3RJF A;  2KZZ A;  2H3Q A;  3G6Y A;  2FLL A;  2ZTE A;  2W9C A;  2EH9 A;  4C4R A;  4M0A A;  3UXN A;  1N5W A;  3MGV A;  1BNO A;  3QXG A;  1JX4 A;  2E5S A;  3TAN A;  3RH4 A;  3AQE A;  2J6S A;  2KE7 A;  5H2F U;  3FDS A;  2W43 A;  3TAR A;  2BPG A;  3PX4 A;  4Y2U A;  4RQ1 A;  3JPN A;  4IR9 A;  9ICT A;  2Y1J A;  2DFL A;  5DB8 A;  2PKE A;  2G06 A;  4EZ6 A;  4TQR A;  4QIW C;  3RB0 A;  4O5E A;  7ICT A;  2F1H A;  5HR6 A;  5KFW A;  2PFO A;  3RBE A;  4YP3 A;  3MGI A;  2IMW P;  2HBM A;  2FJ6 A;  2JH1 A;  3UXP A;  5KG7 A;  1UQV A;  3TAC B;  2XCP A;  5T14 A;  2HOQ A;  1ZQC A;  3KHH A;  3HX0 A;  3GIL A;  4KLQ A;  3AQF A;  4Y2Q A;  2W9A A;  2F77 X;  4EX7 A;  9ICJ A;  1X9M A;  3SAH A;  3H0L B;  2IHN A;  1SB3 C;  1D8B A;  5ALI A;  1M6Y A;  3OPX A;  2P6R A;  1N63 A;  1ZD4 A;  2K8A A;  2HDO A;  2W55 A;  4QW9 A;  2R18 A;  4NLK A;  8ICE A;  1LV5 A;  2A1A A;  4PH5 A;  5F9N A;  3BS7 A;  1X6J A;  4AP9 A;  9ICP A;  5KT6 A;  1ZQO A;  1D8L A;  4UB6 U;  1PVP A;  4CF5 A;  4RT3 A;  5AM4 A;  4RQ3 A;  4Z6F A;  4F4W A;  4DS4 A;  1VLB A;  1NJX A;  3UXO A;  2VA3 A;  1YT3 A;  3KHL A;  2HHV A;  4F2S A;  1D8Y A;  4OJP A;  3PSF A;  2HHS A;  5ALM A;  4KLO A;  2Z7J A;  2DKX A;  3RJG A;  2AHO B;  4C7Y A;  4I2D A;  7ICM A;  5DQI A;  5C0Y A;  3D2N A;  4P0P B;  1C20 A;  4J9R A;  9ICH A;  3TFR A;  2B0C A;  5DBB A;  2ZJ8 A;  2YB4 A;  1PVR A;  1SKW A;  3H8J A;  5AHX A;  3TAD C;  5J2I A;  4Y2X A;  3WK8 A;  4MF2 A;  1RXV A;  2HSZ A;  3V6K A;  2BGW A;  4UAZ A;  5AIB A;  2I5H A;  2LBO A;  1FO4 A;  4F50 A;  3FYH A;  4C7Z A;  9ICS A;  1SWV A;  5DKW A;  2EAN A;  3MDA A;  4NLB A;  1QQ6 A;  3MAB A;  1LB2 B;  8ICV A;  5CWR A;  3BS5 B;  2QKQ A;  3GIJ A;  2HMX A;  4M9H A;  4B6J A;  4M9L A;  1UT5 A;  4DL6 A;  3GIM A;  4LVS A;  3OJS A;  2VAN A;  4Q43 A;  4PZO A;  3L3F X;  3AU2 A;  4QWD A;  1QLN A;  2W04 A;  2M0N A;  1VDV A;  4DL3 A;  1NKB A;  3RJJ A;  2KFN A;  2K8C B;  5DDM A;  5KFM A;  5D49 A;  4X5V A;  1J97 A;  2LHT A;  4UB5 A;  2AXT U;  4DSK A;  1J2N A;  2C22 A;  4UAV A;  3H4B A;  1UCV A;  3NTU A;  8ICL A;  5DG9 A;  9ICL A;  2XVT A;  4NY8 A;  2V4R A;  3MR3 A;  1Z4N A;  3DV9 A;  2I1Q A;  1NZP A;  2EDU A;  4ED6 A;  4DFP A;  2XY5 A;  1Z19 A;  2G5I B;  1NJW A;  2GO7 A;  3HJE A;  2WTF A;  3ZDB A;  3AMZ A;  2NYV A;  3GFK B;  4TUS A;  4EEK A;  2KJ8 A;  4B9M A;  4YG2 A;  2ZJ5 A;  1KSP A;  4R8U B;  5ALE A;  3QU4 A;  2W03 A;  2XC9 A;  5KL8 B;  4NWI A;  5KFV A;  4XQ8 A;  3LK9 A;  7ICR A;  3AUO A;  2GH1 A;  5IIN A;  1V85 A;  4US8 A;  1ECW A;  4R63 A;  4GFJ A;  5KFH A;  2I6X A;  5EE9 A;  3PW0 A;  4I2B A;  8ICI A;  4DLG A;  3LWM A;  2WHE A;  4O3Q A;  5ALL A;  1TK0 A;  2JMG A;  2LYH A;  5KFB A;  1S76 D;  2ISP A;  2JEF A;  3C21 A;  4J9P A;  4P0Q B;  5AI8 A;  3T5J A;  4NLG A;  4A8E A;  1ZQP A;  4PL2 A;  4CNQ A;  3M9N B;  5KT5 A;  2VJ5 A;  3MR5 A;  1L3V A;  3WKA A;  1RG6 A;  2MUT B;  2KV2 A;  4M9J A;  4HYK A;  9ICQ A;  5L9X A;  3KKA C;  2HHW A;  3ISD A;  2UVW A;  1CI4 A;  3H8M A;  4I2G A;  3K1R B;  2EZZ A;  3D2S A;  1NKC A;  2BCS A;  2VJ4 A;  9ICW A;  1SKR A;  2BDP A;  1X2I A;  3BQ7 A;  2F8K A;  7ICV A;  3ICX A;  3RB4 A;  4DF8 A;  3PV8 A;  5KT4 A;  4YR3 A;  5ALU A;  3GV5 B;  4DFD A;  2OM6 A;  4RQ4 A;  1L7N A;  4PGQ A;  3J81 j;  4J9S A;  5EE0 A;  2Y1I A;  1T3Q A;  3HRD D;  2W3R A;  3RJH A;  1BPX A;  2FMP A;  3G6X A;  5F3X B;  3JPO A;  4AYB F;  2KSO B;  7ICH A;  4QZG A;  1JI7 A;  1O03 A;  2LPE A;  3UM9 A;  1GO3 F;  2H3I A;  3PML A;  3E0F A;  5ALQ A;  5EOZ A;  1Z1B A;  1KQQ A;  1TFR A;  2JR5 A;  2OH2 A;  2MU2 A;  3QYP A;  2MUT A;  5AKK A;  3AEV A;  2Y0S C;  4P4P A;  4RNO A;  2KIC A;  1HUO A;  1QSL A;  1S97 A;  9ICB A;  1TVA A;  1L8L A;  1SV0 C;  5DG8 A;  4F8R A;  4BJQ A;  9ICI A;  2W3S A;  1OXJ A; 
#chains in the Genus database with same CATH homology
 2I5H A;  2EDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...