2EDUA

Solution structure of rsgi ruh-070, a c-terminal domain of kinesin-like protein kif22 from human cdna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
98
structure length
98
Chain Sequence
GSSGSSGEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESFLKANILGLAAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Kinesin-like protein KIF22
publication title Solution structure of RSGI RUH-070, a C-terminal domain of kinesin-like protein KIF22 from human cDNA
rcsb
source organism Homo sapiens
total genus 20
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12836 HHH_3 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2eduA01
2EDUA 2I5HA
chains in the Genus database with same CATH superfamily
4OD0A 4QZBA 2D3DA 4QWBA 2VIXA 3D2NA 5AI8A 2G07A 4C4RA 4IQUA 4ED1A 2PFPA 1S0NA 7ICQA 4NY8A 5D49A 3V7LA 3L4PA 4FE3A 2KG5A 2E1FA 1OXJA 2NRVA 2M0NA 1ZQXA 2XCAA 2H3IA 3LWMA 5KL1B 2ZTDA 1OUQA 2GWSA 5KFAA 4RQ3A 4K4HA 1ZQZA 3MDCA 4DFDA 4ECZA 3HKZC 2LBOA 2BKEA 5AK4A 3D2SA 4ED0A 2A1JB 4NLCA 7ICOA 5GTIU 2HHVA 2BQ3A 2HHTA 2KKVA 5DG7A 3PSIA 4YN4A 1Z4OA 2KSOB 5ALXA 1B0XA 4CGZA 4BUGA 5CRXA 4PGQA 1SL2A 3BDPA 4TQRA 1ZQEA 4J9QA 1F5SA 2DGZA 2JZBB 9ICSA 4GXKA 2W3SA 4LJXA 4YP3A 1B4FA 2ZIXB 3B0YA 3A0HU 3AM9A 1ZQIA 2YMQA 1ZQFA 3M9MB 2OCEA 5CB1A 5KFCA 3RAXA 1UT8A 3THVA 3ISCA 5L9XA 5ALMA 1J97A 3ICXA 2IOHA 3PW7A 5EE3A 4UQGA 2ZIUA 2CPRA 4ECQA 1N48A 2KICA 2FPKA 2F1IA 1ZQPA 2IOFA 4BJQA 1SL0A 3KHHA 9ICNA 3BS5B 2XICA 4Y2YA 2KNJA 4UB1A 2Y9TA 4I2DA 5J0QA 3N97B 5D4BA 4YCXA 1ZQTA 1JROA 4O3RA 4Y2VA 4C7ZA 5JU5A 3RJFA 3SMVA 3QZ7A 2G0AA 2QB0A 3PX6A 3ED5A 1CUKA 4GIBA 4ED3A 5KT6A 4F3OA 4J9RA 4OCZA 8ICIA 4J9MA 4QWDA 4QZ9A 4OJPA 2WAQF 5KT7A 5IIJA 1T8EA 1Z00B 2ISPA 4JB3A 1UHUA 3AU6A 1TK5A 4DOCA 5ALEA 9ICLA 3WK4A 5ALYA 1L3TA 2YB1A 2JEGA 1JUDA 2F2AB 4MF2A 3F2DA 1KSPA 8ICMA 4I2IA 2GO7A 5ALFA 3SI8A 1WWVA 2BPGA 5C5JA 3KTQA 4CNQA 2HBKA 3C1YA 2ATLA 1IG6A 5KFXA 4QZCA 3H8WA 2K60A 4UATA 2W43A 1HUOA 3ZDBA 7ICHA 3IV6A 4ECWA 7ICSA 2RHFA 1BGXT 2R8JA 1LKYB 1YT3A 3UXOA 1JN3A 2AXTU 3TFRA 3C29A 4E0DA 4OO1J 3L5KA 2K89A 3TADA 5KFLA 5ALJA 3IRUA 4Y2JA 3LVVA 4M9HA 2C2EA 2ES6A 4C8KA 3PVXA 4MFFA 1S5LU 3M7DA 5AM1A 2Y0SC 2AQ4A 1OW5A 3UM9A 2W03A 3HP6A 4PPXA 2AGOA 4CCHA 2FJ6A 4UB4A 4QW9A 4TURA 3PSFA 2MUTB 4DL2A 1WYGA 1NK6A 3M9OB 5KG3A 1ZD4A 2Q0ZX 3IN5A 5ALLA 4QWEA 3CRXA 3G6VA 3WU2U 2KJ5A 5DLFA 1LVHA 4DOBA 4M9JA 4CF4A 4I2AA 1NK5A 2JH1A 5KG1A 5L1LA 2BPFA 3TADC 1S0OA 2K4HA 4TUSA 3MC1A 1MQ2A 3OHAA 3GIIA 2JEJA 2YY6A 1NZBA 3SQIA 2XGQA 3LYSA 1L3VA 2A3VA 1F44A 2C2RA 4OJ6A 5ALRA 3BZCA 3PR4A 3HPOA 7ICIA 1KW4A 4FZNA 2BCRA 3G6YA 5KFTA 8ICVA 1V85A 4ED6A 1JALA 3RRHA 3NS1A 3Q8MA 5EE9A 4DF4A 5DB7A 4NWIA 5AI5A 3O0FA 3LDAA 3QUBA 2D6FC 2NRTA 1TAQA 4RPZA 3BJYA 2L5YA 4QW8A 3V6HA 1XS9D 8ICFA 5L1MA 1FFVA 1XO1A 1TVAA 2HHXA 4DL5A 5IINA 4DL4A 3SZ2A 1S77D 4DFPA 3BQTA 5AKEA 2W9MA 2IHMA 2ZIXA 4YR3A 1ED1A 1BPEA 3Q8LA 5L1JA 3BQ7A 2KHQA 1D9DA 3T5HA 1X42A 1ZJMA 3GDXA 4ELVA 2HOIA 4B9NA 1L8OA 3RRGA 2BDPA 1SWVA 1U45A 3RR7A 3L3FX 2IHNA 1SWWA 4DQRA 1NK7A 4DSIA 2FDRA 2VKQA 4Q8EA 4MF8A 9ICRA 9ICVA 2XI9A 2BHNA 4QZEA 2Y1JA 1RYSA 4O3OA 5DB8A 2IMWP 4XRHA 4O3QA 3H7IA 4KLDA 2XGPA 4DCCA 1ZQSA 5ALSA 1PVRA 4O3NA 4JV0A 2A1AA 4KTQA 3UMCA 4YG2A 5A0LA 4B9MA 4UASA 4KMOB 4LZDA 3M9NB 1MC8A 4IQTA 3GV7B 5AKZA 1Z3EB 3EPIA 7ICJA 2Y1IA 2RP5A 4RUAA 3VC8A 5KNIA 4NM1A 2QARB 1TK8A 2KV2A 3RJGA 2ZIVA 4K4GA 4GC6A 1IIPA 3HX0A 1NJWA 3ZDAA 2HHUA 4I27A 5AK6A 1Z00A 4FZLA 4F4XA 1A77A 5AI9A 5F3XB 1S9FA 3RBEA 4RPYA 1FO4A 3KBBA 2WTFA 2HBJA 1UCVA 2KE7A 1TAMA 5ALPA 4KMUA 9ICKA 1C7YA 1NK9A 2I6XA 1B43A 1V38A 4O3SA 2PMZC 1JIHA 4YXJA 1IV8A 4I2EA 4UAWA 2BQRA 4CF5A 1ZRNA 2XY5A 4AP9A 1C20A 4DL6A 1F0MA 1KRPA 4UARA 1X66A 1LKYA 1L3SA 4KLOA 2N1RA 2QB0B 8ICJA 4Y2QA 1XC9A 3WKBA 4JWNA 4NLKA 1NI3A 5KG7A 5DQIA 3HW8A 2EZYA 2HHSA 2KP7A 3UXPA 4J9KA 5ALOA 1BNOA 4DFKA 5AM4A 5J0RA 2DKZA 2XY6A 2V4QA 1RYRA 4LVSA 3N7PD 5AKJA 1T4GA 1KQQA 1NJXA 2VANA 5DLGA 4EX6A 3RBDA 2KMDA 2AJQA 1NJZA 4M0AA 3SAHA 3QXGA 1SIJA 4RQ1A 4GXIA 3BZKA 1COOA 1RM6C 1J2MA 5L1KA 1EXNA 2F8LA 3UXNA 5CJ7A 2CRXA 5CR0A 2ASDA 7ICGA 2W3RA 3RTVA 5AIBA 2PFOA 2F3NA 4Z6CA 5ALUA 5FP0A 5DB9A 4YR0A 3KD3A 5ALVA 4C80A 4UBBA 4NV0A 3WK9A 3KFUF 2WF6A 5KFSA 1DK3A 5J2JA 1XNSA 2MAXA 2OXOA 2LYBA 2WB1F 1SKSA 3MGVA 3AQFA 2PFNA 1DXSA 3T5JA 2C22A 2ZUDA 1ZQDA 4Y2XA 2R8IA 2W9CB 1U49A 4PL1A 1QCKA 1L7MA 2DUYA 4JMUA 1KEJA 1AQ6A 5CEHA 2ZUCA 4UAVA 3MBYA 8ICTA 3ONNA 7ICLA 3KZXA 5J2FA 3PY8A 2NYVA 2PXIA 1JXLA 7ICNA 5J0SA 1SXDA 5J2GA 3RFAA 4XQ8A 2LPEA 5IIKA 3B0XA 1U47A 5AKGA 5J0WA 1Q46A 1DK2A 4QWCA 3M6ZA 4PHDA 5HNKA 3CP8A 2JMGA 4PHPA 3IM1A 2F1JA 1UT5A 3WKEA 2V9WA 3TFSA 3HJEA 3WKCA 5AHXA 4RNMA 4I2JA 2E8OA 3MR6A 4KLMA 3KOOA 2WFAA 5AKXA 5J2KA 2ZUBA 5DDMA 3PX0A 2VJ4A 1NK8A 4ICAA 4BXOB 4EYHB 1JX4A 9ICIA 3F5AA 4F91B 1KFSA 2JHDA 5G5GA 1MQ3A 1TK0A 4DF8A 3BQ0A 3OHBA 3LVWA 2JEIA 3LK9A 5DB6A 9ICTA 3N28A 3QEAZ 2HHWA 3JPSA 3I28A 5ALGA 1V9PA 1CI4A 2WF9A 4ECYA 1ZQCA 4X5VA 2FMPA 1BPZA 3AUOA 2QARA 5AI0A 4GLXA 2NRWA 2WAQC 4Y2PA 8ICHA 4ZOHC 2XVTA 2LI6A 3QU5A 1FIQA 4M9GA 2XO7A 4JK1A 1ECWA 2OHFA 3H8SA 5TZVA 2JH7A 5J2IA 1XSLA 5IIOA 1ZXIA 3GZFA 3V72A 2F76X 2HBLA 2NV3A 1L7OA 1N60A 2JGAA 3RF9A 2KEYA 4RNOA 2VA8A 2C28A 4C8NA 4MHVA 1X2IA 3NVVA 5KT3A 2PKEA 3HT3A 3EW9A 2KZMA 3HKZF 1SZPA 4RQ6A 1SKRA 4Q8FA 3MR5A 7ICFA 5KFNA 3H8JA 1S10A 2G06A 3ETRA 4QJFB 2EZZA 2FMQA 4PH5A 4GXJA 4FS2A 5J2BA 4I28A 2KK0A 5JTIA 4R66A 1SKWA 2F1HA 2I5HA 3PW5A 4U7CA 3RJHA 2WHEA 8ICZA 4O5KA 2ZIVB 4DLGA 4NLBA 5J29A 1BNPA 3AQEA 5IIIA 5KT5A 4J9LA 4YMNA 5DGBA 1RQLA 3I1YA 4PHAA 5E79U 2BGWA 9ICBA 1K1QA 4KLFA 2JXJA 2GOLA 3WK8A 1QQ5A 5AI4A 4YFKA 3RH4A 2A19A 2V4RA 1AROP 3H0MB 3Q8QB 4BDPA 8ICWA 5KAFU 8ICLA 3SEIA 3MGHA 2W11A 4Y2UA 4IQWA 2KZ3A 5AKIA 3K1ZA 4I2BA 1MN8A 3U26A 4P0PA 5AKKA 3H40A 4RZRA 1ZQMA 4DLEA 4YVZA 5EE0A 2QKQA 1T94A 1SL1A 5AI6A 4ED2A 5DBCA 2R8HA 3PR5B 1VDVA 2YB4A 1DOQA 3E0FA 5ALTA 2W9CA 4KLQA 3RJIA 1TKDA 5KG2A 3SENA 3H4BA 3G6XA 4NL9A 2LMRA 5AK3A 4M6WB 4LZGA 2YMLA 4DO9A 7ICUA 1N5XA 4EELA 1TV9A 5HR7A 2H5XA 1NNLA 4NJ8A 4F8RA 2K4IA 3WKDA 5KFEA 5AKHA 2K8AA 4RU9A 3NRWA 3QU9A 4DS5A 3H8MA 2NRZA 1Q3VA 5G5HA 4QZDA 3C23A 4F92B 5KFFA 3HILA 3TQ1A 4MFCA 2KZZA 1ZQRA 4UB6U 1LV5A 2DF4B 1SXEA 4O5EA 5KFVA 4F93B 5IIMA 2EAMA 3DDHA 3SYZA 2ZTCA 2HVIA 4FFDA 3JPQA 4I2HA 2MSNA 1X9XA 1X9MA 2K8BB 1H38A 4M9LA 4DSLA 1ZYQA 3OTQA 1ZQOA 3PX4A 4G9BA 1UPHA 2NRXA 7ICTA 4NL9C 1PVQA 4Q45A 5HHIA 5KFUA 2KTQA 2OYYA 2KN7A 5AICA 4NLZA 1A76A 3D6JA 4PGYA 3QZ8A 3DEEA 4QZAA 4BXOA 5TISU 1RDFA 4O5CA 1IXRA 4QZIA 2W8KA 2JEFA 1ZETA 5GTHU 4EBDA 2J6SA 1QSSA 1BPDA 4EEKA 2Y0SF 4OJLA 3KHGA 5HP4A 3GFKB 1QSYA 1ZD5A 4U6PA 4EEYA 1KFTA 3GILA 2EQYA 3RR8A 4DQQA 5F9LA 2HVHA 4AYBF 2XY7A 2W9AA 1ZD2P 3SR6A 5EWGA 1U9LA 4IL6U 4RQ8A 4YMOA 1MSWD 4ECUA 3F2BA 2KD1A 4YD1A 3SAFA 3CNHA 5J2HA 4G3IA 1FFUA 4QWAA 4JUZA 5KFQA 3SD7A 1L7PA 5J0TA 3A0BU 2AQ0A 2K4PA 4RQ4A 1JMSA 4C4TA 4P4MA 9ICHA 2DBYA 1A0PA 3MFIA 9ICFA 1PVPA 5K4LA 3JPTA 2IBKA 2Q4TA 3QUQA 3PW2A 3IG8A 4RQ5A 1PK1A 5J0UA 3ISBA 4JWMA 4QZGA 5JRTA 1BPBA 4ECTA 1S0MA 1KL9A 2IA6A 4B9VA 2BR0A 2P6UA 5J0PA 1DRGA 3AEVA 2W8LA 4UW9A 1HJPA 3T3FA 1WG8A 3RJEA 2D8CA 9ICOA 3ALRA 4YQWA 7ICKA 4F5QA 9ICJA 1RG6A 2YTUA 4O3PA 1K1SA 3OJSA 4JV1A 2B21A 5DGAA 3TANA 3PSPA 4EYIB 1XSNA 5J2AA 3R9KA 5BOMA 2H3VA 3RB3A 3V6KA 2AGQA 2W55A 1ZQWA 9ICXA 4J9SA 3EZ5A 4IR1A 3IG5A 1ZQKA 4QZFA 3Q8KA 3JPRA 5DQHA 1ZJNA 3GV8B 1KLNA 4Z6DA 4K4IA 8ICXA 2HBMA 8ICBA 4EX7A 7ICRA 2WF8A 4C8LA 3S6JA 2DWQA 3NUQA 4NLGA 1WCNA 2E8PA 1S8OA 1T3QA 2KOBA 1ZQBA 5KG5A 2XIDA 4NXZA 4UB8U 4UBCA 3NTUA 4OJ5A 2DL0A 3F53A 4F5NA 2B6GA 4P0QA 2WB1C 4CDGA 2FLNA 8ICNA 5KFGA 5DBAA 4J9NA 3JPOA 4UB3A 3EPGA 4DSJA 1S76D 1X40A 1ZQNA 3ZDCA 2W54A 4M6WA 4QIWF 2E1EA 3EYZA 4ED8A 2ALZA 2K4EA 4DSEA 3QUCA 3UPQA 3NRZA 5ALNA 1WCLA 1CEZA 3QU7A 4I29A 1K5OA 4PGXA 5AK5A 2E8NA 2AU0A 3EUB2 4C7YA 1TFRA 1URJA 9ICWA 3H0RB 2BCVA 7ICMA 3IP4B 1D9FA 2EZXA 2ODGA 9ICAA 4UB2A 4J9PA 4RUCA 4DS4A 2KHVA 4DFJA 2VA2A 2KKPA 5DDYA 2EAPA 5T14A 3ISDA 3C21A 3Q8SB 3UQ2A 4P0PB 2HOQA 4PL2A 2ZIWA 3H0LB 4P4PA 8ICSA 4YD2A 3UMGA 4NM2A 2DKXA 2I9GA 2AHOB 4EBEA 4ELTA 4FBTA 4US9A 4ECSA 2KJ9A 2HI0A 2QLTA 2BCSA 9ICGA 2G5IB 4P4OA 2R18A 1L6NA 4M04A 1P7DA 5C0YA 1N56A 3J81j 1IM4A 4BGDA 1L7NA 1NKEA 5ALKA 1KN5A 1NK4A 2HSZA 2ASLA 2MA1A 4Q44A 1MA7A 4KX5A 3D2QA 3RB6A 1QTMA 3M1YA 1O03A 3IDWA 1U4BA 2BCUA 5KG4A 4DL3A 1GO3F 4CRXA 8ICUA 3WK7A 1NKCA 3ZI4A 3JPPA 2UVRA 5HHHA 4DWIA 8ICCA 2BQUA 2EAOA 4UAZA 2KIWA 3GIMA 5KTQA 2ISOA 1NK0A 4B9LA 1ZQVA 4RT3A 3NVWA 4IR9A 2EANA 2G5HB 1JRPA 1N5WA 5ALZA 4I2GA 1NOMA 3PZPA 1Q8KA 3V6JA 2PI5A 3PW4A 1Z4NA 4WJ3B 3C2LA 2UVUA 5ALDA 1NZPA 3IHQB 3PV8A 5KL8B 2ZJAA 4Q43A 4C0ZA 4RQ7A 3Q8PB 2NO5A 2KFNA 2BCQA 2Y9UA 3EWAA 1J2NA 2G08A 2ESEA 2DQNB 1QQ7A 3FDSA 3TAPA 2B0CA 5ALHA 3H4DA 1ZQYA 3MR3A 5CHGA 2LM4A 2P66A 9ICQA 4RPXA 1ZQGA 1DGJA 3M8SA 4O9MA 5AM3A 3NASA 5KG0A 8ICEA 2BDUA 4DSFA 2CXYA 4DSKA 5J0XA 4DQIA 5KFJA 4P2HA 4F72A 2OEHA 5KFMA 4F2RA 2ZTEA 1T7PA 5KFWA 2O6KA 3PMLA 3VCBA 2HDOA 5ALWA 3QYPA 4F4YA 3FYHA 2XCPA 1QH9A 3C2MA 3RB4A 5EOZA 4PZNA 2UVVA 2DPIA 1JXEA 4KLLA 1PUZA 9ICUA 3GIKA 2OWOA 2C2DA 1PZNA 1SV0A 3DV9A 1PK1B 2ZXIA 3M6KA 3OPXA 3OGUA 5H2FU 4B9TA 3T5LA 2K8CB 5KFDA 3LWLA 1XWLA 2M9NA 1RZTA 2EDUA 4Z6FA 2FLPA 2H3FA 5BOLA 4EBCA 3Q8RB 1CRXA 2BZFA 3SAGA 2HMXA 4TUQA 1D8YA 4Y2TA 2PFQA 3N7SC 2ASJA 4YR2A 7ICPA 4ECXA 2LYHA 3MDAA 5AIAA 1BVSA 4PHEA 5J0OA 4M2YA 1RPLA 2HOFA 4KLGA 4RQNA 2DFLA 2R8GA 1KTQA 1PK3A 4US8A 1L3UA 5KT4A 3ZD9A 2FE9A 5DKWA 1YZ7A 5B5EU 5J0YA 5KT2A 5KFYA 2LHTA 7ICEA 2GH1A 1SV0C 4UAUA 7ICVA 4JV2A 2W9BA 4R64A 4USAA 4DFMA 1KDHA 1ZQJA 2MU2A 1U48A 4RT2A 4O0IA 2XC9A 8ICQA 3QX7A 2YX8A 1KFDA 5IILA 4IRDA 2AGPA 2FPMA 1HUZA 1S0VA 9ICPA 4FBUA 1N63A 2P35A 3E58A 3KHLA 1KBUA 1TE2A 3C5GA 3RH6A 4P0QB 3BS7A 1RQNA 4ECRA 4Z6EA 3MFHA 3WK5A 3KHRA 2J6UA 2ZXHA 5EWEA 3QUTA 3OJUA 3C2KA 4KLEA 4B9SA 5KFZA 2IOFK 5ALIA 4CF3A 5AM2A 1ZQQA 2RQ5A 1ZQUA 3K75D 4KLSA 4QZ8A 5KFPA 4KITB 1TAUA 1VJ5A 2JV3A 3QNMA 3RB0A 1N61A 4QNLA 1SV4A 4F4WA 4AYBC 4PZOA 4OJOA 4F4KA 2KFZA 1YZ6A 2J6TA 4BWJA 1QLNA 1A6SA 2ZIWB 5F9NA 5J2CA 5J2EA 2GLEA 1X6IA 2UVWA 4RQMA 3QEBZ 3TKAA 3K4GA 5AKLA 3E2EA 3AN1A 1COKA 3ZD8A 2Z7JA 3MR2A 5EWFA 3F2CA 2KJ8A 3TACB 4EENA 1UA0A 1N62A 1ZQHA 4ELUA 2FLLA 2R8KA 2LM1A 3QE9Y 1Z1BA 1XSPA 4B6JA 5JUMA 3GV5B 4RNNA 3HRDD 4FZMA 4IC9A 1ZD3A 2YMMA 2LKYA 3M8RA 4GC7A 4F50A 5B66U 4DL7A 3TI0A 2A1JA 4F5RA 9ICCA 4TUPA 4KLJA 5D46A 4J03A 5KFRA 4R8UB 1V97A 4TQSA 4DEZA 3FM9A 1ZQAA 3NVZA 2ZJ5A 4DQPA 3RH5A 2KSOA 3WK6A 2W7OA 2JRZA 1Z1VA 3ETLA 1UA1A 1B22A 3C28A 2HCFA 3AL0B 2F77X 8ICGA 2ZG6A 4F5PA 4IQVA 5HMMA 4RQ2A 4KLUA 2JZBA 2VA3A 4R63A 2RDJA 3OSPA 1BPXA 2LYAA 4UB5A 5L1IA 2FMSA 9ICEA 9ICMA 3TAQA 5AM5A 8ICOA 3NVYA 4J9OA 2H3QA 3I76A 1X6JA 2H3ZA 2YQEA 4FO6A 1RXVA 3ORYA 4CE6A 1T3NA 1S97A 1SGGA 5KFIA 4O3MA 3FAHA 3BS5A 2W04A 3HWTA 1D8LA 2KIVA 2FPLA 3RAQA 4DOAA 5CA7A 5CWRA 4A8EA 2E3TA 5DG9A 8ICPA 1FEZA 5KAIU 3AU2A 2VJ5A 3F5EA 5EE1A 3QU2A 4B9UA 3QU4A 2RLTA 4QIWC 2P6RA 2HHQA 4Y2RA 2BPCA 2I1QA 1JI7A 2G09A 5DQGA 1UQVA 5AKYA 2AH5A 1WWUA 1WUDA 2JR5A 3OSNA 3PNCA 1QSLA 1N2XA 3RJKA 4MEYA 3TARA 1HEKA 2DPJA 4MFAA 5AM0A 4QZHA 3PSTA 2YMPA 2ZIUB 1XU4A 3GIJA 4M47A 2KVCA 1XO0A 3KZIU 3T79A 3MABA 4RQ0A 4FS1A 5J2DA 3WKAA 2OH2A 2CN1A 2F44A 5KG6A 5DG8A 3GU3A 2HW3A 2NO4A 4MEXA 4F4ZA 5HMLA 4IS7A 4GFJA 3ZDDA 4XA5A 2W7PA 3PO4A 2YN4A 3MGIA 1QQ6A 3C5FA 4KN4A 2QB1A 5J8YA 4NLNA 4IRKA 3BQ2A 3CYMA 4KX3A 5KFKA 4I2CA 1RXWA 4KLHA 3AMZA 2RRDA 3RJJA 3BQ1A 3SV4A 1ZRMA 5CP2A 2ZJ8A 4KLTA 1Z19A 3B9JA 4ED7A 5BPCA 4R65A 2E8MA 3PO5A 5ALQA 4BX9C 4BWMA 2PI4A 2W9BB 4HAIA 1HIWA 1DGSA 4I2FA 5KFOA 2WF7A 2MUTA 4ECVA 1RYUA 4EZ6A 8ICYA 4XUSA 1LB2B 1X9SA 4ACOA 3GQCA 3CW2C 3PW0A 1L8LA 3ZDEA 1KKXA 1VLBA 3N7RC 3K1RB 4ZH4A 8ICAA 2PMZF 3V7JA 4F5OA 1ZQ1C 4C4SA 3KKAA 4HYKA 1O08A 2FI1A 4C8MA 2EH9A 1M6YA 3NGDA 8ICKA 5KFHA 5HR6A 4YMMA 5J8YC 1ZQLA 4M9NA 1Y88A 4IRCA 5KFBA 4F2SA 1NJYA 4KLIA 2OM6A 4C8OA 2KVSA 3T5KA 5DBBA 1ZOLA 1BPYA 2WF5A 1NKBA 2RDIA 1X9WA 2F8KA 1D8BA 3C1ZA 1L5UA 4Y2SA 1SZHA 8ICRA 4KN7A 4F71A 4UAYA 4EZ9A 3PMNA 1SB3C 3UMBA 4R8UA 4DQSA 2MRLA 3KKAC 4PJ0U 3UQ0A 3FC4A 3N4MB 4YXMA 3JPNA 2E5SA 3SV3A 1Q3UA 3V7KA
chains in the Genus database with same CATH topology
2EDUA 2I5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EDU A;  2I5H A; 
#chains in the Genus database with same CATH topology
 4OD0 A;  4QZB A;  2D3D A;  4QWB A;  2VIX A;  3D2N A;  5AI8 A;  2G07 A;  4C4R A;  4IQU A;  4ED1 A;  2PFP A;  1S0N A;  7ICQ A;  4NY8 A;  5D49 A;  3V7L A;  3L4P A;  4FE3 A;  2KG5 A;  2E1F A;  1OXJ A;  2NRV A;  2M0N A;  1ZQX A;  2XCA A;  2H3I A;  3LWM A;  5KL1 B;  2ZTD A;  1OUQ A;  2GWS A;  5KFA A;  4RQ3 A;  4K4H A;  1ZQZ A;  3MDC A;  4DFD A;  4ECZ A;  3HKZ C;  2LBO A;  2BKE A;  5AK4 A;  3D2S A;  4ED0 A;  2A1J B;  4NLC A;  7ICO A;  5GTI U;  2HHV A;  2BQ3 A;  2HHT A;  2KKV A;  5DG7 A;  3PSI A;  4YN4 A;  1Z4O A;  2KSO B;  5ALX A;  1B0X A;  4CGZ A;  4BUG A;  5CRX A;  4PGQ A;  1SL2 A;  3BDP A;  4TQR A;  1ZQE A;  4J9Q A;  1F5S A;  2DGZ A;  2JZB B;  9ICS A;  4GXK A;  2W3S A;  4LJX A;  4YP3 A;  1B4F A;  2ZIX B;  3B0Y A;  3A0H U;  3AM9 A;  1ZQI A;  2YMQ A;  1ZQF A;  3M9M B;  2OCE A;  5CB1 A;  5KFC A;  3RAX A;  1UT8 A;  3THV A;  3ISC A;  5L9X A;  5ALM A;  1J97 A;  3ICX A;  2IOH A;  3PW7 A;  5EE3 A;  4UQG A;  2ZIU A;  2CPR A;  4ECQ A;  1N48 A;  2KIC A;  2FPK A;  2F1I A;  1ZQP A;  2IOF A;  4BJQ A;  1SL0 A;  3KHH A;  9ICN A;  3BS5 B;  2XIC A;  4Y2Y A;  2KNJ A;  4UB1 A;  2Y9T A;  4I2D A;  5J0Q A;  3N97 B;  5D4B A;  4YCX A;  1ZQT A;  1JRO A;  4O3R A;  4Y2V A;  4C7Z A;  5JU5 A;  3RJF A;  3SMV A;  3QZ7 A;  2G0A A;  2QB0 A;  3PX6 A;  3ED5 A;  1CUK A;  4GIB A;  4ED3 A;  5KT6 A;  4F3O A;  4J9R A;  4OCZ A;  8ICI A;  4J9M A;  4QWD A;  4QZ9 A;  4OJP A;  2WAQ F;  5KT7 A;  5IIJ A;  1T8E A;  1Z00 B;  2ISP A;  4JB3 A;  1UHU A;  3AU6 A;  1TK5 A;  4DOC A;  5ALE A;  9ICL A;  3WK4 A;  5ALY A;  1L3T A;  2YB1 A;  2JEG A;  1JUD A;  2F2A B;  4MF2 A;  3F2D A;  1KSP A;  8ICM A;  4I2I A;  2GO7 A;  5ALF A;  3SI8 A;  1WWV A;  2BPG A;  5C5J A;  3KTQ A;  4CNQ A;  2HBK A;  3C1Y A;  2ATL A;  1IG6 A;  5KFX A;  4QZC A;  3H8W A;  2K60 A;  4UAT A;  2W43 A;  1HUO A;  3ZDB A;  7ICH A;  3IV6 A;  4ECW A;  7ICS A;  2RHF A;  1BGX T;  2R8J A;  1LKY B;  1YT3 A;  3UXO A;  1JN3 A;  2AXT U;  3TFR A;  3C29 A;  4E0D A;  4OO1 J;  3L5K A;  2K89 A;  3TAD A;  5KFL A;  5ALJ A;  3IRU A;  4Y2J A;  3LVV A;  4M9H A;  2C2E A;  2ES6 A;  4C8K A;  3PVX A;  4MFF A;  1S5L U;  3M7D A;  5AM1 A;  2Y0S C;  2AQ4 A;  1OW5 A;  3UM9 A;  2W03 A;  3HP6 A;  4PPX A;  2AGO A;  4CCH A;  2FJ6 A;  4UB4 A;  4QW9 A;  4TUR A;  3PSF A;  2MUT B;  4DL2 A;  1WYG A;  1NK6 A;  3M9O B;  5KG3 A;  1ZD4 A;  2Q0Z X;  3IN5 A;  5ALL A;  4QWE A;  3CRX A;  3G6V A;  3WU2 U;  2KJ5 A;  5DLF A;  1LVH A;  4DOB A;  4M9J A;  4CF4 A;  4I2A A;  1NK5 A;  2JH1 A;  5KG1 A;  5L1L A;  2BPF A;  3TAD C;  1S0O A;  2K4H A;  4TUS A;  3MC1 A;  1MQ2 A;  3OHA A;  3GII A;  2JEJ A;  2YY6 A;  1NZB A;  3SQI A;  2XGQ A;  3LYS A;  1L3V A;  2A3V A;  1F44 A;  2C2R A;  4OJ6 A;  5ALR A;  3BZC A;  3PR4 A;  3HPO A;  7ICI A;  1KW4 A;  4FZN A;  2BCR A;  3G6Y A;  5KFT A;  8ICV A;  1V85 A;  4ED6 A;  1JAL A;  3RRH A;  3NS1 A;  3Q8M A;  5EE9 A;  4DF4 A;  5DB7 A;  4NWI A;  5AI5 A;  3O0F A;  3LDA A;  3QUB A;  2D6F C;  2NRT A;  1TAQ A;  4RPZ A;  3BJY A;  2L5Y A;  4QW8 A;  3V6H A;  1XS9 D;  8ICF A;  5L1M A;  1FFV A;  1XO1 A;  1TVA A;  2HHX A;  4DL5 A;  5IIN A;  4DL4 A;  3SZ2 A;  1S77 D;  4DFP A;  3BQT A;  5AKE A;  2W9M A;  2IHM A;  2ZIX A;  4YR3 A;  1ED1 A;  1BPE A;  3Q8L A;  5L1J A;  3BQ7 A;  2KHQ A;  1D9D A;  3T5H A;  1X42 A;  1ZJM A;  3GDX A;  4ELV A;  2HOI A;  4B9N A;  1L8O A;  3RRG A;  2BDP A;  1SWV A;  1U45 A;  3RR7 A;  3L3F X;  2IHN A;  1SWW A;  4DQR A;  1NK7 A;  4DSI A;  2FDR A;  2VKQ A;  4Q8E A;  4MF8 A;  9ICR A;  9ICV A;  2XI9 A;  2BHN A;  4QZE A;  2Y1J A;  1RYS A;  4O3O A;  5DB8 A;  2IMW P;  4XRH A;  4O3Q A;  3H7I A;  4KLD A;  2XGP A;  4DCC A;  1ZQS A;  5ALS A;  1PVR A;  4O3N A;  4JV0 A;  2A1A A;  4KTQ A;  3UMC A;  4YG2 A;  5A0L A;  4B9M A;  4UAS A;  4KMO B;  4LZD A;  3M9N B;  1MC8 A;  4IQT A;  3GV7 B;  5AKZ A;  1Z3E B;  3EPI A;  7ICJ A;  2Y1I A;  2RP5 A;  4RUA A;  3VC8 A;  5KNI A;  4NM1 A;  2QAR B;  1TK8 A;  2KV2 A;  3RJG A;  2ZIV A;  4K4G A;  4GC6 A;  1IIP A;  3HX0 A;  1NJW A;  3ZDA A;  2HHU A;  4I27 A;  5AK6 A;  1Z00 A;  4FZL A;  4F4X A;  1A77 A;  5AI9 A;  5F3X B;  1S9F A;  3RBE A;  4RPY A;  1FO4 A;  3KBB A;  2WTF A;  2HBJ A;  1UCV A;  2KE7 A;  1TAM A;  5ALP A;  4KMU A;  9ICK A;  1C7Y A;  1NK9 A;  2I6X A;  1B43 A;  1V38 A;  4O3S A;  2PMZ C;  1JIH A;  4YXJ A;  1IV8 A;  4I2E A;  4UAW A;  2BQR A;  4CF5 A;  1ZRN A;  2XY5 A;  4AP9 A;  1C20 A;  4DL6 A;  1F0M A;  1KRP A;  4UAR A;  1X66 A;  1LKY A;  1L3S A;  4KLO A;  2N1R A;  2QB0 B;  8ICJ A;  4Y2Q A;  1XC9 A;  3WKB A;  4JWN A;  4NLK A;  1NI3 A;  5KG7 A;  5DQI A;  3HW8 A;  2EZY A;  2HHS A;  2KP7 A;  3UXP A;  4J9K A;  5ALO A;  1BNO A;  4DFK A;  5AM4 A;  5J0R A;  2DKZ A;  2XY6 A;  2V4Q A;  1RYR A;  4LVS A;  3N7P D;  5AKJ A;  1T4G A;  1KQQ A;  1NJX A;  2VAN A;  5DLG A;  4EX6 A;  3RBD A;  2KMD A;  2AJQ A;  1NJZ A;  4M0A A;  3SAH A;  3QXG A;  1SIJ A;  4RQ1 A;  4GXI A;  3BZK A;  1COO A;  1RM6 C;  1J2M A;  5L1K A;  1EXN A;  2F8L A;  3UXN A;  5CJ7 A;  2CRX A;  5CR0 A;  2ASD A;  7ICG A;  2W3R A;  3RTV A;  5AIB A;  2PFO A;  2F3N A;  4Z6C A;  5ALU A;  5FP0 A;  5DB9 A;  4YR0 A;  3KD3 A;  5ALV A;  4C80 A;  4UBB A;  4NV0 A;  3WK9 A;  3KFU F;  2WF6 A;  5KFS A;  1DK3 A;  5J2J A;  1XNS A;  2MAX A;  2OXO A;  2LYB A;  2WB1 F;  1SKS A;  3MGV A;  3AQF A;  2PFN A;  1DXS A;  3T5J A;  2C22 A;  2ZUD A;  1ZQD A;  4Y2X A;  2R8I A;  2W9C B;  1U49 A;  4PL1 A;  1QCK A;  1L7M A;  2DUY A;  4JMU A;  1KEJ A;  1AQ6 A;  5CEH A;  2ZUC A;  4UAV A;  3MBY A;  8ICT A;  3ONN A;  7ICL A;  3KZX A;  5J2F A;  3PY8 A;  2NYV A;  2PXI A;  1JXL A;  7ICN A;  5J0S A;  1SXD A;  5J2G A;  3RFA A;  4XQ8 A;  2LPE A;  5IIK A;  3B0X A;  1U47 A;  5AKG A;  5J0W A;  1Q46 A;  1DK2 A;  4QWC A;  3M6Z A;  4PHD A;  5HNK A;  3CP8 A;  2JMG A;  4PHP A;  3IM1 A;  2F1J A;  1UT5 A;  3WKE A;  2V9W A;  3TFS A;  3HJE A;  3WKC A;  5AHX A;  4RNM A;  4I2J A;  2E8O A;  3MR6 A;  4KLM A;  3KOO A;  2WFA A;  5AKX A;  5J2K A;  2ZUB A;  5DDM A;  3PX0 A;  2VJ4 A;  1NK8 A;  4ICA A;  4BXO B;  4EYH B;  1JX4 A;  9ICI A;  3F5A A;  4F91 B;  1KFS A;  2JHD A;  5G5G A;  1MQ3 A;  1TK0 A;  4DF8 A;  3BQ0 A;  3OHB A;  3LVW A;  2JEI A;  3LK9 A;  5DB6 A;  9ICT A;  3N28 A;  3QEA Z;  2HHW A;  3JPS A;  3I28 A;  5ALG A;  1V9P A;  1CI4 A;  2WF9 A;  4ECY A;  1ZQC A;  4X5V A;  2FMP A;  1BPZ A;  3AUO A;  2QAR A;  5AI0 A;  4GLX A;  2NRW A;  2WAQ C;  4Y2P A;  8ICH A;  4ZOH C;  2XVT A;  2LI6 A;  3QU5 A;  1FIQ A;  4M9G A;  2XO7 A;  4JK1 A;  1ECW A;  2OHF A;  3H8S A;  5TZV A;  2JH7 A;  5J2I A;  1XSL A;  5IIO A;  1ZXI A;  3GZF A;  3V72 A;  2F76 X;  2HBL A;  2NV3 A;  1L7O A;  1N60 A;  2JGA A;  3RF9 A;  2KEY A;  4RNO A;  2VA8 A;  2C28 A;  4C8N A;  4MHV A;  1X2I A;  3NVV A;  5KT3 A;  2PKE A;  3HT3 A;  3EW9 A;  2KZM A;  3HKZ F;  1SZP A;  4RQ6 A;  1SKR A;  4Q8F A;  3MR5 A;  7ICF A;  5KFN A;  3H8J A;  1S10 A;  2G06 A;  3ETR A;  4QJF B;  2EZZ A;  2FMQ A;  4PH5 A;  4GXJ A;  4FS2 A;  5J2B A;  4I28 A;  2KK0 A;  5JTI A;  4R66 A;  1SKW A;  2F1H A;  2I5H A;  3PW5 A;  4U7C A;  3RJH A;  2WHE A;  8ICZ A;  4O5K A;  2ZIV B;  4DLG A;  4NLB A;  5J29 A;  1BNP A;  3AQE A;  5III A;  5KT5 A;  4J9L A;  4YMN A;  5DGB A;  1RQL A;  3I1Y A;  4PHA A;  5E79 U;  2BGW A;  9ICB A;  1K1Q A;  4KLF A;  2JXJ A;  2GOL A;  3WK8 A;  1QQ5 A;  5AI4 A;  4YFK A;  3RH4 A;  2A19 A;  2V4R A;  1ARO P;  3H0M B;  3Q8Q B;  4BDP A;  8ICW A;  5KAF U;  8ICL A;  3SEI A;  3MGH A;  2W11 A;  4Y2U A;  4IQW A;  2KZ3 A;  5AKI A;  3K1Z A;  4I2B A;  1MN8 A;  3U26 A;  4P0P A;  5AKK A;  3H40 A;  4RZR A;  1ZQM A;  4DLE A;  4YVZ A;  5EE0 A;  2QKQ A;  1T94 A;  1SL1 A;  5AI6 A;  4ED2 A;  5DBC A;  2R8H A;  3PR5 B;  1VDV A;  2YB4 A;  1DOQ A;  3E0F A;  5ALT A;  2W9C A;  4KLQ A;  3RJI A;  1TKD A;  5KG2 A;  3SEN A;  3H4B A;  3G6X A;  4NL9 A;  2LMR A;  5AK3 A;  4M6W B;  4LZG A;  2YML A;  4DO9 A;  7ICU A;  1N5X A;  4EEL A;  1TV9 A;  5HR7 A;  2H5X A;  1NNL A;  4NJ8 A;  4F8R A;  2K4I A;  3WKD A;  5KFE A;  5AKH A;  2K8A A;  4RU9 A;  3NRW A;  3QU9 A;  4DS5 A;  3H8M A;  2NRZ A;  1Q3V A;  5G5H A;  4QZD A;  3C23 A;  4F92 B;  5KFF A;  3HIL A;  3TQ1 A;  4MFC A;  2KZZ A;  1ZQR A;  4UB6 U;  1LV5 A;  2DF4 B;  1SXE A;  4O5E A;  5KFV A;  4F93 B;  5IIM A;  2EAM A;  3DDH A;  3SYZ A;  2ZTC A;  2HVI A;  4FFD A;  3JPQ A;  4I2H A;  2MSN A;  1X9X A;  1X9M A;  2K8B B;  1H38 A;  4M9L A;  4DSL A;  1ZYQ A;  3OTQ A;  1ZQO A;  3PX4 A;  4G9B A;  1UPH A;  2NRX A;  7ICT A;  4NL9 C;  1PVQ A;  4Q45 A;  5HHI A;  5KFU A;  2KTQ A;  2OYY A;  2KN7 A;  5AIC A;  4NLZ A;  1A76 A;  3D6J A;  4PGY A;  3QZ8 A;  3DEE A;  4QZA A;  4BXO A;  5TIS U;  1RDF A;  4O5C A;  1IXR A;  4QZI A;  2W8K A;  2JEF A;  1ZET A;  5GTH U;  4EBD A;  2J6S A;  1QSS A;  1BPD A;  4EEK A;  2Y0S F;  4OJL A;  3KHG A;  5HP4 A;  3GFK B;  1QSY A;  1ZD5 A;  4U6P A;  4EEY A;  1KFT A;  3GIL A;  2EQY A;  3RR8 A;  4DQQ A;  5F9L A;  2HVH A;  4AYB F;  2XY7 A;  2W9A A;  1ZD2 P;  3SR6 A;  5EWG A;  1U9L A;  4IL6 U;  4RQ8 A;  4YMO A;  1MSW D;  4ECU A;  3F2B A;  2KD1 A;  4YD1 A;  3SAF A;  3CNH A;  5J2H A;  4G3I A;  1FFU A;  4QWA A;  4JUZ A;  5KFQ A;  3SD7 A;  1L7P A;  5J0T A;  3A0B U;  2AQ0 A;  2K4P A;  4RQ4 A;  1JMS A;  4C4T A;  4P4M A;  9ICH A;  2DBY A;  1A0P A;  3MFI A;  9ICF A;  1PVP A;  5K4L A;  3JPT A;  2IBK A;  2Q4T A;  3QUQ A;  3PW2 A;  3IG8 A;  4RQ5 A;  1PK1 A;  5J0U A;  3ISB A;  4JWM A;  4QZG A;  5JRT A;  1BPB A;  4ECT A;  1S0M A;  1KL9 A;  2IA6 A;  4B9V A;  2BR0 A;  2P6U A;  5J0P A;  1DRG A;  3AEV A;  2W8L A;  4UW9 A;  1HJP A;  3T3F A;  1WG8 A;  3RJE A;  2D8C A;  9ICO A;  3ALR A;  4YQW A;  7ICK A;  4F5Q A;  9ICJ A;  1RG6 A;  2YTU A;  4O3P A;  1K1S A;  3OJS A;  4JV1 A;  2B21 A;  5DGA A;  3TAN A;  3PSP A;  4EYI B;  1XSN A;  5J2A A;  3R9K A;  5BOM A;  2H3V A;  3RB3 A;  3V6K A;  2AGQ A;  2W55 A;  1ZQW A;  9ICX A;  4J9S A;  3EZ5 A;  4IR1 A;  3IG5 A;  1ZQK A;  4QZF A;  3Q8K A;  3JPR A;  5DQH A;  1ZJN A;  3GV8 B;  1KLN A;  4Z6D A;  4K4I A;  8ICX A;  2HBM A;  8ICB A;  4EX7 A;  7ICR A;  2WF8 A;  4C8L A;  3S6J A;  2DWQ A;  3NUQ A;  4NLG A;  1WCN A;  2E8P A;  1S8O A;  1T3Q A;  2KOB A;  1ZQB A;  5KG5 A;  2XID A;  4NXZ A;  4UB8 U;  4UBC A;  3NTU A;  4OJ5 A;  2DL0 A;  3F53 A;  4F5N A;  2B6G A;  4P0Q A;  2WB1 C;  4CDG A;  2FLN A;  8ICN A;  5KFG A;  5DBA A;  4J9N A;  3JPO A;  4UB3 A;  3EPG A;  4DSJ A;  1S76 D;  1X40 A;  1ZQN A;  3ZDC A;  2W54 A;  4M6W A;  4QIW F;  2E1E A;  3EYZ A;  4ED8 A;  2ALZ A;  2K4E A;  4DSE A;  3QUC A;  3UPQ A;  3NRZ A;  5ALN A;  1WCL A;  1CEZ A;  3QU7 A;  4I29 A;  1K5O A;  4PGX A;  5AK5 A;  2E8N A;  2AU0 A;  3EUB 2;  4C7Y A;  1TFR A;  1URJ A;  9ICW A;  3H0R B;  2BCV A;  7ICM A;  3IP4 B;  1D9F A;  2EZX A;  2ODG A;  9ICA A;  4UB2 A;  4J9P A;  4RUC A;  4DS4 A;  2KHV A;  4DFJ A;  2VA2 A;  2KKP A;  5DDY A;  2EAP A;  5T14 A;  3ISD A;  3C21 A;  3Q8S B;  3UQ2 A;  4P0P B;  2HOQ A;  4PL2 A;  2ZIW A;  3H0L B;  4P4P A;  8ICS A;  4YD2 A;  3UMG A;  4NM2 A;  2DKX A;  2I9G A;  2AHO B;  4EBE A;  4ELT A;  4FBT A;  4US9 A;  4ECS A;  2KJ9 A;  2HI0 A;  2QLT A;  2BCS A;  9ICG A;  2G5I B;  4P4O A;  2R18 A;  1L6N A;  4M04 A;  1P7D A;  5C0Y A;  1N56 A;  3J81 j;  1IM4 A;  4BGD A;  1L7N A;  1NKE A;  5ALK A;  1KN5 A;  1NK4 A;  2HSZ A;  2ASL A;  2MA1 A;  4Q44 A;  1MA7 A;  4KX5 A;  3D2Q A;  3RB6 A;  1QTM A;  3M1Y A;  1O03 A;  3IDW A;  1U4B A;  2BCU A;  5KG4 A;  4DL3 A;  1GO3 F;  4CRX A;  8ICU A;  3WK7 A;  1NKC A;  3ZI4 A;  3JPP A;  2UVR A;  5HHH A;  4DWI A;  8ICC A;  2BQU A;  2EAO A;  4UAZ A;  2KIW A;  3GIM A;  5KTQ A;  2ISO A;  1NK0 A;  4B9L A;  1ZQV A;  4RT3 A;  3NVW A;  4IR9 A;  2EAN A;  2G5H B;  1JRP A;  1N5W A;  5ALZ A;  4I2G A;  1NOM A;  3PZP A;  1Q8K A;  3V6J A;  2PI5 A;  3PW4 A;  1Z4N A;  4WJ3 B;  3C2L A;  2UVU A;  5ALD A;  1NZP A;  3IHQ B;  3PV8 A;  5KL8 B;  2ZJA A;  4Q43 A;  4C0Z A;  4RQ7 A;  3Q8P B;  2NO5 A;  2KFN A;  2BCQ A;  2Y9U A;  3EWA A;  1J2N A;  2G08 A;  2ESE A;  2DQN B;  1QQ7 A;  3FDS A;  3TAP A;  2B0C A;  5ALH A;  3H4D A;  1ZQY A;  3MR3 A;  5CHG A;  2LM4 A;  2P66 A;  9ICQ A;  4RPX A;  1ZQG A;  1DGJ A;  3M8S A;  4O9M A;  5AM3 A;  3NAS A;  5KG0 A;  8ICE A;  2BDU A;  4DSF A;  2CXY A;  4DSK A;  5J0X A;  4DQI A;  5KFJ A;  4P2H A;  4F72 A;  2OEH A;  5KFM A;  4F2R A;  2ZTE A;  1T7P A;  5KFW A;  2O6K A;  3PML A;  3VCB A;  2HDO A;  5ALW A;  3QYP A;  4F4Y A;  3FYH A;  2XCP A;  1QH9 A;  3C2M A;  3RB4 A;  5EOZ A;  4PZN A;  2UVV A;  2DPI A;  1JXE A;  4KLL A;  1PUZ A;  9ICU A;  3GIK A;  2OWO A;  2C2D A;  1PZN A;  1SV0 A;  3DV9 A;  1PK1 B;  2ZXI A;  3M6K A;  3OPX A;  3OGU A;  5H2F U;  4B9T A;  3T5L A;  2K8C B;  5KFD A;  3LWL A;  1XWL A;  2M9N A;  1RZT A;  2EDU A;  4Z6F A;  2FLP A;  2H3F A;  5BOL A;  4EBC A;  3Q8R B;  1CRX A;  2BZF A;  3SAG A;  2HMX A;  4TUQ A;  1D8Y A;  4Y2T A;  2PFQ A;  3N7S C;  2ASJ A;  4YR2 A;  7ICP A;  4ECX A;  2LYH A;  3MDA A;  5AIA A;  1BVS A;  4PHE A;  5J0O A;  4M2Y A;  1RPL A;  2HOF A;  4KLG A;  4RQN A;  2DFL A;  2R8G A;  1KTQ A;  1PK3 A;  4US8 A;  1L3U A;  5KT4 A;  3ZD9 A;  2FE9 A;  5DKW A;  1YZ7 A;  5B5E U;  5J0Y A;  5KT2 A;  5KFY A;  2LHT A;  7ICE A;  2GH1 A;  1SV0 C;  4UAU A;  7ICV A;  4JV2 A;  2W9B A;  4R64 A;  4USA A;  4DFM A;  1KDH A;  1ZQJ A;  2MU2 A;  1U48 A;  4RT2 A;  4O0I A;  2XC9 A;  8ICQ A;  3QX7 A;  2YX8 A;  1KFD A;  5IIL A;  4IRD A;  2AGP A;  2FPM A;  1HUZ A;  1S0V A;  9ICP A;  4FBU A;  1N63 A;  2P35 A;  3E58 A;  3KHL A;  1KBU A;  1TE2 A;  3C5G A;  3RH6 A;  4P0Q B;  3BS7 A;  1RQN A;  4ECR A;  4Z6E A;  3MFH A;  3WK5 A;  3KHR A;  2J6U A;  2ZXH A;  5EWE A;  3QUT A;  3OJU A;  3C2K A;  4KLE A;  4B9S A;  5KFZ A;  2IOF K;  5ALI A;  4CF3 A;  5AM2 A;  1ZQQ A;  2RQ5 A;  1ZQU A;  3K75 D;  4KLS A;  4QZ8 A;  5KFP A;  4KIT B;  1TAU A;  1VJ5 A;  2JV3 A;  3QNM A;  3RB0 A;  1N61 A;  4QNL A;  1SV4 A;  4F4W A;  4AYB C;  4PZO A;  4OJO A;  4F4K A;  2KFZ A;  1YZ6 A;  2J6T A;  4BWJ A;  1QLN A;  1A6S A;  2ZIW B;  5F9N A;  5J2C A;  5J2E A;  2GLE A;  1X6I A;  2UVW A;  4RQM A;  3QEB Z;  3TKA A;  3K4G A;  5AKL A;  3E2E A;  3AN1 A;  1COK A;  3ZD8 A;  2Z7J A;  3MR2 A;  5EWF A;  3F2C A;  2KJ8 A;  3TAC B;  4EEN A;  1UA0 A;  1N62 A;  1ZQH A;  4ELU A;  2FLL A;  2R8K A;  2LM1 A;  3QE9 Y;  1Z1B A;  1XSP A;  4B6J A;  5JUM A;  3GV5 B;  4RNN A;  3HRD D;  4FZM A;  4IC9 A;  1ZD3 A;  2YMM A;  2LKY A;  3M8R A;  4GC7 A;  4F50 A;  5B66 U;  4DL7 A;  3TI0 A;  2A1J A;  4F5R A;  9ICC A;  4TUP A;  4KLJ A;  5D46 A;  4J03 A;  5KFR A;  4R8U B;  1V97 A;  4TQS A;  4DEZ A;  3FM9 A;  1ZQA A;  3NVZ A;  2ZJ5 A;  4DQP A;  3RH5 A;  2KSO A;  3WK6 A;  2W7O A;  2JRZ A;  1Z1V A;  3ETL A;  1UA1 A;  1B22 A;  3C28 A;  2HCF A;  3AL0 B;  2F77 X;  8ICG A;  2ZG6 A;  4F5P A;  4IQV A;  5HMM A;  4RQ2 A;  4KLU A;  2JZB A;  2VA3 A;  4R63 A;  2RDJ A;  3OSP A;  1BPX A;  2LYA A;  4UB5 A;  5L1I A;  2FMS A;  9ICE A;  9ICM A;  3TAQ A;  5AM5 A;  8ICO A;  3NVY A;  4J9O A;  2H3Q A;  3I76 A;  1X6J A;  2H3Z A;  2YQE A;  4FO6 A;  1RXV A;  3ORY A;  4CE6 A;  1T3N A;  1S97 A;  1SGG A;  5KFI A;  4O3M A;  3FAH A;  3BS5 A;  2W04 A;  3HWT A;  1D8L A;  2KIV A;  2FPL A;  3RAQ A;  4DOA A;  5CA7 A;  5CWR A;  4A8E A;  2E3T A;  5DG9 A;  8ICP A;  1FEZ A;  5KAI U;  3AU2 A;  2VJ5 A;  3F5E A;  5EE1 A;  3QU2 A;  4B9U A;  3QU4 A;  2RLT A;  4QIW C;  2P6R A;  2HHQ A;  4Y2R A;  2BPC A;  2I1Q A;  1JI7 A;  2G09 A;  5DQG A;  1UQV A;  5AKY A;  2AH5 A;  1WWU A;  1WUD A;  2JR5 A;  3OSN A;  3PNC A;  1QSL A;  1N2X A;  3RJK A;  4MEY A;  3TAR A;  1HEK A;  2DPJ A;  4MFA A;  5AM0 A;  4QZH A;  3PST A;  2YMP A;  2ZIU B;  1XU4 A;  3GIJ A;  4M47 A;  2KVC A;  1XO0 A;  3KZI U;  3T79 A;  3MAB A;  4RQ0 A;  4FS1 A;  5J2D A;  3WKA A;  2OH2 A;  2CN1 A;  2F44 A;  5KG6 A;  5DG8 A;  3GU3 A;  2HW3 A;  2NO4 A;  4MEX A;  4F4Z A;  5HML A;  4IS7 A;  4GFJ A;  3ZDD A;  4XA5 A;  2W7P A;  3PO4 A;  2YN4 A;  3MGI A;  1QQ6 A;  3C5F A;  4KN4 A;  2QB1 A;  5J8Y A;  4NLN A;  4IRK A;  3BQ2 A;  3CYM A;  4KX3 A;  5KFK A;  4I2C A;  1RXW A;  4KLH A;  3AMZ A;  2RRD A;  3RJJ A;  3BQ1 A;  3SV4 A;  1ZRM A;  5CP2 A;  2ZJ8 A;  4KLT A;  1Z19 A;  3B9J A;  4ED7 A;  5BPC A;  4R65 A;  2E8M A;  3PO5 A;  5ALQ A;  4BX9 C;  4BWM A;  2PI4 A;  2W9B B;  4HAI A;  1HIW A;  1DGS A;  4I2F A;  5KFO A;  2WF7 A;  2MUT A;  4ECV A;  1RYU A;  4EZ6 A;  8ICY A;  4XUS A;  1LB2 B;  1X9S A;  4ACO A;  3GQC A;  3CW2 C;  3PW0 A;  1L8L A;  3ZDE A;  1KKX A;  1VLB A;  3N7R C;  3K1R B;  4ZH4 A;  8ICA A;  2PMZ F;  3V7J A;  4F5O A;  1ZQ1 C;  4C4S A;  3KKA A;  4HYK A;  1O08 A;  2FI1 A;  4C8M A;  2EH9 A;  1M6Y A;  3NGD A;  8ICK A;  5KFH A;  5HR6 A;  4YMM A;  5J8Y C;  1ZQL A;  4M9N A;  1Y88 A;  4IRC A;  5KFB A;  4F2S A;  1NJY A;  4KLI A;  2OM6 A;  4C8O A;  2KVS A;  3T5K A;  5DBB A;  1ZOL A;  1BPY A;  2WF5 A;  1NKB A;  2RDI A;  1X9W A;  2F8K A;  1D8B A;  3C1Z A;  1L5U A;  4Y2S A;  1SZH A;  8ICR A;  4KN7 A;  4F71 A;  4UAY A;  4EZ9 A;  3PMN A;  1SB3 C;  3UMB A;  4R8U A;  4DQS A;  2MRL A;  3KKA C;  4PJ0 U;  3UQ0 A;  3FC4 A;  3N4M B;  4YXM A;  3JPN A;  2E5S A;  3SV3 A;  1Q3U A;  3V7K A; 
#chains in the Genus database with same CATH homology
 2EDU A;  2I5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...