2JGAA

Crystal structure of human cytosolic 5'-nucleotidase iii in complex with phosphate and magnesium
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRRKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
publication title Crystal Structure of Human Cytosolic 5'-Nucleotidase II: Insights Into Allosteric Regulation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2jgaA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jgaA01
1YDFA 5ALEA 3W5CA 2QLTA 4J2TA 2C9MA 5AM3A 1RMTA 2YFYA 3QXGA 3QUTA 5AKHA 5AHXA 2WFAA 3W5DA 4EZEA 3AR9A 4UW9A 5ALTA 3L0YA 3L8FA 5AKKA 2FUCA 2I54A 5AVTA 1RLOA 1Z4QA 3KD3A 4FE3A 2HI0A 2WM8A 5AW7A 2I33A 3QNMA 2B1RA 3QU4A 3M9LA 1Q92A 2RB5A 5AICA 4DFDA 3F9RA 2FPWA 4IFTA 4JDPA 5ALNA 5ALSA 3I6BA 2FDRA 3ET5A 1O08A 3SMVA 3FVVA 4UM7A 5AW4A 2WF6A 1NNLA 4CE6A 5AVWA 3L0BA 4HGNA 3ZVLA 2EAUA 2Q5EA 3SKXA 4H1WA 2G08A 1RKUA 3CNHA 1T9ZA 1XVIA 4YH1A 3VAYA 3L1VA 5AVRA 3AR8A 3W5BA 1KYTA 3L8GA 2Q4TA 3M1YA 2GFHA 3DDHA 3E8MA 4YCMA 5AVUA 3QU9A 3WK5A 2AUTA 4UAVA 3FPBA 2I34A 2C88A 4BX0A 3L0CA 2C4NA 4CNQA 1U7OA 2ZG6A 2I6XA 5T41A 5AK4A 1VFPA 5A3SA 1Z4IA 5E0OA 2BDUA 5ALVA 5AKIA 1RRCA 1Z4KA 4YGYA 4YCLA 5AVVA 3EF1A 4L57A 3UMBA 2HDOA 4Y2PA 3WKBA 5AKJA 4KN8A 3GYGA 2B1QA 2P69A 2W43A 3R09A 2ZBEA 3I1YA 4UARA 2HEGA 4GXTA 4OCZA 3KC2A 4XE5A 3EPRA 5AM1A 2FI1A 4Y2SA 1Z5GA 2ZBDA 2IYEA 3WK8A 3I76A 5AM2A 2OYCA 3QU2A 2MSNA 1N8NA 1TJ4A 4NV0A 1ZRMA 2ZBFA 2HSZA 3SF0A 3QX7A 5AKXA 2WF7A 1WVIA 5ALMA 5ALKA 1QYIA 2YY6A 2PR7A 2RBKA 3MPOA 3NIWA 2IOFK 2WF5A 2WHEA 2JGAA 2OBBA 5ALPA 4F71A 2FEAA 3E84A 3S6JA 1RKVA 4HGRA 2YJ5A 1VJ5A 4YCNA 5ALOA 4KX5A 1SU4A 2G80A 4UM5A 3SLRA 1T5TA 5AW8A 2FPXA 2CFRA 3L5KA 3A1EA 3ZI4A 5ALYA 4BKMA 3AR7A 4UU1A 2PKEA 3KZXA 3FPSA 3PGVA 3EF0A 3IRUA 4GIBA 3ZTWA 1S2OA 3WK4A 3KBBA 2R8YA 4E88A 2B30A 4Y2UA 1RLMA 3NUQA 3ET4A 1TE2A 1Z4OA 5AVYA 5AI8A 2WF9A 2DQSA 3WGVA 3U19A 1TJ5A 4CF4A 4EENA 2RAVA 2YMQA 4EX7A 1J8DA 3L1UA 4AS3A 1L8OA 4Y3UA 4RESA 3N1UA 1QH9A 2FPSA 2NYVA 3QU7A 1SWWA 2HO4A 4FFDA 2YJ3A 1L7MA 1ZD3A 2FPUA 1RQLA 4Y2JA 4Y2VA 3AR5A 5AW2A 2GO7A 2W11A 2P11A 4UMEA 4I9FA 1XP5A 4BNDB 2GHQA 5ALZA 3U7HB 5AW6A 2FPRA 4HGPA 4BX2A 2IOFA 4QQFA 3NALA 3N5KA 1Z4MA 5AKYA 3I28A 3SHQA 3A3YA 5IT4A 4ZEVA 2EARA 2I55A 3ONNA 5AKEA 4NWIA 2HCFA 3NANA 5A3QA 1YMQA 2YMMA 3OCXA 2W4MA 5A3RA 2HF2A 2JAUA 2R8EA 4KNVA 5AW9A 3ZVMA 5ALGA 5ALUA 1WR8A 2B0CA 2D2VA 3OCWA 1XPJA 1QQ5A 1SWVA 1WZCA 3QU5A 3MN1A 5AK5A 4UU0A 3R9KA 2HHLA 1Z4LA 2GHTA 2FUEA 1U02A 3L8HA 1YV9A 4OHFA 5AI5A 3W5AA 4L6AA 4EX6A 1YNSA 3BA6A 2G0AA 2B82A 3A1DA 5ALLA 4Y2RA 3QUBA 3BWVA 4ZEWA 4EEKA 2X4DA 3R4CA 4B6JA 1LTQA 4XPZA 2JAOA 1RMQA 3FGOA 1S8OA 4Y2QA 4BBJA 1RKQA 4XQ0A 4EELA 4I9GA 2HX1A 4Y2XA 4YIKA 2HOQA 3E81A 3QLEA 5ALWA 2NO5A 1U2SA 1CR6A 2B8EA 2YN4A 3ZUPA 4UMDA 1L6RA 4J03A 2QYHA 3ZX5A 3ED5A 1L7OA 3OPXA 2AMYA 2PQ0A 1NF2A 4DW8A 3IB6A 1ZOLA 1FEZA 5AK6A 3HYCA 1QQ7A 3A1CA 3QGMA 3ZWDA 3NRJA 3CZ4A 2OA0A 4Y2YA 2O9JA 1L7PA 3UMCA 2AGVA 1ZJJA 2YMLA 2G07A 3OCZA 1U7PA 4UMVA 2G06A 1Z4NA 4AP9A 4MWOA 1O03A 4UMFA 5ALJA 4RETA 5ALQA 5AM5A 4O8CA 2ZXEA 3OTQA 3SKYA 2P27A 5AIBA 3U26A 5AI0A 2YMPA 1Q91A 3FZQA 3NAMA 3U7GA 1RDFA 4NAVA 5AKLA 2OM6A 2G1AA 3RFUA 3TLMA 2VKQA 1QQ6A 3WK7A 3WKDA 1K1EA 1WPGA 3B9RA 5AIAA 2YBDA 5IS2A 4CF3A 3U7FB 3HLTA 3ZWKA 5AVZA 5ALRA 5AW1A 2B8JA 3DAOA 4DCCA 5AW5A 4OD0A 2AH5A 4BEVA 3PDWA 4C4RA 3QUCA 2R8ZA 2MU1A 4HAIA 5ALXA 2ZBGA 3ZTYA 5AKGA 4UASA 1J97A 5AVXA 5AW0A 4BX3A 1N9KA 1TJ3A 4XOUA 3DNPA 1RQNA 2IOHA 2ZOSA 4QJBA 1RMYA 2G09A 4HYTA 5JJBA 4G9BA 3ZU6A 2O2XA 3UM9A 2CFSA 5AESA 3KDPA 1LVHA 3U13A 4HGQA 2YJ4A 5AVSA 3MC1A 5AI4A 4CF5A 4F72A 3AR3A 1RC8A 3QYPA 1ZD4A 5IT0A 1YS9A 3L8EA 4KYTA 1X42A 3WK9A 4PNHA 2JAWA 3ZX4A 5AI6A 3N28A 2EATA 4UAUA 1RPZA 4NABA 3ESRA 3WKCA 3UMGA 3KOOA 3ZVNA 1ZS9A 3WKEA 4AS2A 3PCTA 4UATA 1MH9A 3OCVA 5AVQA 1NRWA 3EWIA 4NFLA 1Z88A 2CN1A 2C8KA 4BYGA 3WKAA 2I7DA 3FM9A 1Z4JA 1L8LA 3L7YA 3ZW7A 4MUMA 3J7TA 4G63A 5AK3A 4BEWA 3U7EB 4HGOA 1AQ6A 3QUQA 4KX3A 5AM0A 3PGLA 3D6JA 3K1ZA 5ALFA 1RLTA 3N8GA 5ALDA 4C4TA 4ZEXA 1ZRNA 1JUDA 2NO4A 4FYPA 2ODAA 1VJRA 2BY4A 1T5SA 3P96A 3E58A 3WK6A 1Z5UA 1TA0A 4OFZA 1IWOA 3DV9A 1YJ5A 3NASA 2JARA 3AR2A 5ALHA 2CFTA 2Q4RA 3SD7A 3RF6A 5AI9A 1ZD2P 2P9JA 2GMWA 4BNDA 1PW5A 2RARA 4L6CA 4C4SA 1L7NA 4DWOA 4IG4A 3AR4A 1EK1A 2HF7A 3WGUA 2WF8A 1Z4PX 2R8XA 4KNWA 2BDEA 3N07A 5AW3A 2YJ6A 3ESQA 5ALIA 1Y8AA 4YIHA 3OCUA 4JB3A 5FP0A 3MMZA 2IA5A 1F5SA 4Y2TA 3IJ5A 3B9BA 2C8LA 5AM4A 3AR6A 1CQZA 3OCYA 5AKZA 1EK2A 3B8EA 1U2TA 1ZD5A
chains in the Genus database with same CATH superfamily
4HADA 3HDGA 4YLEA 1U8XX 3GOHA 1MJNA 4G5XA 3MFQA 3TINA 2ZIWA 1ZNWA 1W2HA 4P2BA 1RPLA 1M2FA 3BDVA 1G5QA 1FRFS 1HURA 2J5RA 3QP9A 1KBOA 1XZMA 2QYOA 3W8FA 2ZRIA 4K40A 4PSAA 1T0IA 3G2JA 1K7CA 1XWIA 4FFNA 5JZSA 2XUZA 3LECA 4JJ7A 4QDTA 4F3YA 1W4CA 4F8EA 1U6KA 3OEYA 4BNWA 3H99A 4U6QA 3GCGA 1JDUA 2GCEA 3IT3A 2MA1A 5KJEA 4IJ6A 3UICA 2LV8A 1O7JA 1L5QA 1SRRA 4DBVO 5AVUA 3ICWA 3P9SA 2IW3A 2CE7A 4UHHA 2PRKA 4LAFA 2E5WA 2X3FA 4X5OA 5JAIA 3IRVA 5LBUA 1Q0LA 4LQDA 3NBFA 4PFJA 4XE5A 2QTHA 1MZPA 1KRWA 3HZOA 3B3JA 1UKEA 1S1CA 3I2FA 5G3YA 1VL8A 1KK1A 4LGVA 1LJ8A 1T9KA 3I58A 3KU1A 3ICXA 4JIMA 3MJSA 1Z08A 1XD9A 5KT5A 4Z0HO 2R79A 4L2IA 3EVGA 5J0SA 3BF7A 1YAJA 3CMCO 4XPIB 3KQTA 3NBXX 2GXAA 3QXJA 4URHA 3T5PA 3MA0A 4TXHA 3EF0A 1KSFX 2XDYA 2GPSA 1ZQOA 4GMHA 4KQGA 4DYDA 1Z4OA 4Z7OB 1QZXA 3G2OA 4BEJA 2VI5A 3T3NA 1ECJA 1KJWA 2RAFA 1W44A 13PKA 3RTEA 1II0A 2DT5A 3M6WA 1KJJA 5CH3A 3BTOA 3C6QA 1AKUA 1ZI6A 3IMEA 4QGHA 3QMMA 1B8OA 4LHEA 2ZIVA 4IXWA 3WQRA 4MAAA 4Z4FA 1UKYA 3MGCA 4O33A 1DKPA 4HYEA 1ORTA 1P0QA 4KNVA 3G5MA 4Y0NA 1I1QB 4I6EA 2ZUTA 3U4QB 1AN9A 4EB6B 3IALA 2BFEB 1KFDA 3VNQA 4TUQA 2BR0A 4RL4A 1IM4A 4BVBA 2XCRB 2BCVA 4YD1A 4FZVA 5DJ5A 2CLKB 1A2BA 1SVLA 2FZKA 2JIOA 3N05A 2YL2A 3I42A 3L6DA 4RV5A 2NZYA 1DE0A 3VMFA 1Z6ZA 1RP7A 1U2SA 1T2NA 4G5FA 4INAA 2AW5A 2CLOB 3WB2A 3IAS1 4DEZA 3CINA 2EX4A 3A1CA 3GPLA 3UXMA 5K4HA 5IYZF 2WFLB 1PWHA 3C98A 3LWLA 4CGYA 1Z4NA 1A8PA 1IN7A 1F5NA 4B9EA 2GEUA 4O8CA 2PFPA 1SOWA 1YI8A 4PWZA 4B2YA 3HKDA 2B5WA 1OREA 1TIPA 3P0EA 1JMVA 4BKPA 3GLIB 1DOQA 2XCAA 2HA5A 2GPYA 1NR7A 1QORA 4DJFC 4BEVA 3DVLA 1ZSYA 3FDXA 1JIXA 2D13A 1JAYA 5IDWA 5JJBA 2IDMA 2AV6A 2HMVA 5AVJA 2DPHA 3EFBA 1CUKA 2OHFA 1OYOA 3BE8A 1JFTA 2Q4BA 4ZVMA 3DE1X 4O2AF 1ISPA 2WB2A 1NHGA 3C8UA 4J0FA 4OXRA 4X6LA 4G36A 3ROPA 5DSTA 3QMVA 3HJRA 1AJEA 1X2EA 3NOOA 5F7JA 4MW5A 4UTRA 4OXYA 5BT8A 3I01M 4GICA 1NX6A 2Y77A 3ABSB 2ZE7A 3I9KA 5BP7A 3H2SA 4CFYA 1BNCA 2D0IA 1IXSB 4QE3A 3NIBA 1NR1A 1R37A 3MCUA 1V47A 4GR4A 2ZTUA 3OMXA 4TMVA 4YJHB 4H3KB 2B4KA 4UUNA 4AMZA 2CMHA 4TWZA 4RVHA 3K0AB 3C6MA 4DQ0A 3W9YA 5KKCA 3ZWNA 5IVKA 3HJFA 2E0IA 3VDMA 3FLEA 4KR7A 4BQOA 1SKYE 5L9XA 3GV0A 4RLQA 2LDXA 3FCCA 3R3HA 2R97A 4FT4A 5HZHA 1YS4A 1UKZA 4UEJA 4G5QA 3D0OA 1JKJA 3JCZA 2QL9A 5E7QA 3ZI0A 1N5DA 2W93A 3GLKA 2IHJA 2VJNA 3I6IA 1JR2A 4L8LA 4WEOA 3X2EA 4FOLA 3IDOA 3V72A 1B22A 5IMSA 3EGDB 5CT4A 4B76A 1FL9A 1YL7A 2Q6KA 3T99A 1I2CA 3K16A 4P08A 4FEGA 4OQFA 1U2QA 4I46A 4DABA 1E5VA 3ACDA 5JBNA 4JN6B 1YK0A 3I30X 2BSAA 2D4AA 4MP8A 1Y3HA 4RF2A 1ZBDA 2G17A 1D8TA 5CB6A 2IELA 3E2PA 1J20A 4P84A 2CB0A 2PI4A 4MW7A 4C08A 2CY0A 1K7EB 3F4BA 1UDCA 1QLJA 3BRWA 4CXMA 3FWZA 3I09A 1WETA 1R12A 4A6EA 1BKSB 4YJDA 3X44A 4TT8A 1G5RA 4L4ZA 5F4ZA 2J3EA 4ZN6A 5A4MS 1T4DA 1M6NA 3AF6A 1Z62A 3NWJA 2FFAA 2VA2A 2PKEA 4K05A 4V0ME 3H16A 3RTGA 2ZULA 2JRLA 3L79A 2BMJA 1CX9B 4M46A 4TT3D 4EX7A 4D6PA 2WW8A 3I1FA 4KQIA 1XSNA 1C1DA 3V7UA 1RPJA 2BMDA 4EAAA 2D6FC 1I5EA 1QF9A 3OZUA 1T6YA 2YMMA 4ROSA 3AM4A 1E4VA 1E6MA 3DT6A 3PSTA 3D2SA 3PFNA 4MP6A 4YRIA 2OC4A 3DAPA 4ND4A 5KOYA 3HPQA 4D42A 2BFDB 3DLBA 1XMXA 1AKEA 3ONFA 3AHGA 2IS1A 5L4NA 2IPMA 2QVGA 2AG5A 4B6EA 3IEXA 3IAEA 3MW8A 3HKZC 1S2LA 2PFSA 3Q2KA 5LZ4A 2SECE 3CPJB 4G6ZA 4TM7A 3BXFA 5CVDA 5BSGA 4JLJA 4AF8A 3N97B 2DERA 1T3SA 4U6NA 2MWMA 3QPCA 3U3OA 2VJ5A 3ROQA 4TSFA 3TARA 4L5IA 3M5CA 1MRNA 3W3AA 1THMA 4YMGA 2DETA 1W0KD 1RKXA 1FO4A 4YC7A 1DQRA 2V5AA 1F51E 4IJWA 3DBIA 5ALJA 5DSXA 5FBWB 4RETA 5A9SB 4QYIB 2EF0A 1ZNYA 4CCSA 3DKVA 2GBIA 4BRUA 4GE3A 3LRXA 4YXWD 5ITZB 2J6SA 2D00A 3FWNA 2XVZA 5BUSA 1E9AA 4UFOA 3TW4A 3FPAA 1X9WA 4NDNE 1B41A 3HJGA 3WNVA 1G20B 1BXZA 3P0FA 4MRMB 2FLLA 4BX3A 2HWKA 4PAQA 2FG6C 3QFCA 5AHOA 3ROZA 4JC4A 4BCBA 3CVXA 1LPOA 1LVHA 3ERCA 1XG5A 2YJ4A 1XZCA 3WWOA 5B53A 3S2SA 4F72A 1BMFA 4MO9A 3VNRA 4PFQA 2Y1KA 1DJMA 4WZAE 3VC2A 1J0DA 1PEAA 4ITRC 1VCOA 2A0FA 2QUBA 3F96A 3KJGA 5HOQA 4X8MA 3VGPA 1FY2A 3ZZ0A 3PX6A 2X42A 3MIIA 3MWFA 1CEZA 4LQLA 1ZQHA 4F91B 5JI3E 1XS9D 3WFZA 1QCYA 4RTKA 1FB5A 2BI4A 5T8KC 4EG5A 1ID1A 3AR2A 3CBGA 3K1AB 3R75A 3M1IA 3I5UA 3RF7A 4NP6A 4HK4A 1XRPA 2OCAA 3V4FA 5THXA 3G0GA 3PYMA 1IBLB 1MPXA 4E08A 3RYHB 4L5BA 1BOOA 4RE5A 1MVLA 2F1JA 1P62B 2IYFA 1W88A 2OCBA 3G8CA 3G2QA 2EWWA 3VNUA 2YB4A 4K9KA 4N4AA 2PXXA 3RRNA 5CJ2A 1QCKA 4P32A 4TKVB 4XRHA 4LWZA 4J9NA 3B53X 4OMUA 3IP1A 3BC1A 1RZVA 3MELA 3N8KA 4OA5A 2JFVA 1PVVA 3HVHA 2E4AA 4IFTA 3GV8B 2D2XA 4RENA 4A15A 1PFVA 4ECSA 3QJ5A 2GNOA 3MTJA 5K7SA 4JP2A 4IVRA 1PNRA 2EAUA 2DFLA 4JA0A 2WB4A 2XKJE 4HF7A 3JWEA 1R2QA 1JL3A 3ND5A 1N1EA 2O8VA 2KZMA 4F5YA 2YC2C 3KPWA 2R6JA 3UXOA 2GAIA 1W59A 4HAZA 5BO5A 3F6RA 3SYMA 4PHFA 1JLLB 4XYBA 1JLKA 2AT1A 3TN7A 3TQHA 1QMGA 4XYMA 3AP2A 4E1AA 2K8BB 4NJEA 4PRYA 1RAFA 1VPEA 2C77A 2HUNA 4HHEA 1S0OA 1PFKA 5IDXA 4PYLA 1EFTA 3I9FA 1W35A 1CY4A 5CNIA 3WJ7A 3PWZA 2C2HA 4FNOA 4JH0A 4K46A 3LY5A 3CUYA 4CGZA 1MAUA 1JHAA 3K75D 4ICIA 4BFLA 5AW8A 4C1NA 1E5TA 4Q01A 1P4AA 4WX2B 1E9FA 2RI6A 3IRUA 4DHEA 4IXTA 2BFFB 2GJ4A 3A1WA 4KE6A 3K9CA 3I62A 4YR7A 4JQSA 1E1DA 4I2GA 2B5VA 1EFRD 1NQAO 1RYNA 3VR4D 4UNIA 4LBZA 4IIEA 4AF7A 4G85A 2JD2A 4GW3A 3I28A 5L3QA 3P2EA 4P54A 1AK2A 2R6CA 3LYSA 3PC2A 2OGZA 3C3YA 1OAOA 1Z75A 2K2WA 1W34A 1EGQA 1XD2A 4XYLA 1Y5IA 2FPMA 1H8EA 1K7XB 1RJDA 3AUKA 2AL7A 2JPDA 4CLOB 1FP6A 1DDIA 1UK6A 3AF0A 1E2JA 4KUHA 2IRWA 4QZDA 3MWYW 4IPTA 3NHAA 2F1HA 5F9MA 2OLEA 1BFDA 3JQGB 3N2GB 3K7EA 3LRPA 4RGVA 2COUA 4FOTA 4HQFA 2W22A 3HKZF 1VPDA 3N8NA 1UPXA 3A9WA 4XDYA 1T1IA 3W6ZA 2AGVA 1MN6A 4C4OA 2XRZA 4TROA 3HN7A 1H5QA 2QJTA 5B66U 5K99A 4BQNA 1ZINA 2KHVA 3I5XA 5AKLA 2X8LA 3UAZA 2ZUUA 1LNZA 3LI2A 3C45A 4RDCA 1RW4A 1ORVA 1WDWB 2C4TA 4C4ZA 1P0IA 1H2BA 2FSIA 4HQOA 3B9JA 2BC9A 4ER6A 4YMSA 4P35A 2NRTA 4I4TB 4BB9A 5EYPB 1L5WA 3NBQA 5CBPA 2HXYA 4RSMA 4NYMQ 2VNKA 2Z2ZA 2A9RA 1XMJA 1E62A 2OBYA 1KARA 5FLKA 3V9AA 4D4GA 1NXTA 4L85A 1SG0A 2MYNA 4Y6GB 4HPWA 3OOWA 4NBTA 3FRJA 2VTDA 4R05A 4BC0A 1JROA 5D84A 2D1QA 2WD7B 2DR2A 3HBMA 2RK6A 1QNFA 3NVZA 4PZLA 3CLKA 1WUYA 1RC0A 1JBQA 3K4QA 2AR9A 1GITA 1T10A 2EKZA 1S5LU 4PGQA 1DT3A 4FW8A 1AQ6A 5I9MA 2VTEA 2IYVA 4XJXA 3BFJA 3RRHA 4WASA 2JEYA 5J2HA 3DLIA 1S8NA 5B57C 4JROA 1DKQA 4KDRA 1CRXA 3H1BA 4W9NA 4PM4A 3PC7A 3KVVA 1EX9A 3WGGA 2IIBA 3GFTA 3EXG1 5GMOA 3S3TA 3PR5B 3SZ3A 4RT2A 1RJ9A 3IDFA 1MQ9A 3HNOA 3VYVA 5KNCH 5DULA 5GGYA 4D9MA 1K75A 4V02A 2HHXA 1F2DA 1RM4A 2DULA 1DTWA 3V1KA 1ENZA 5LSAA 2Z5GA 4HNAA 2OORA 2B6HA 4OYLA 1HE4A 1EFPB 2KS6A 1AGYA 2I54A 3F5QA 2F9MA 4E30A 1XU9A 2CGEA 1K1QA 2XTMA 3C87A 4Q3KA 5LIRA 3WSVA 2DVMA 1XWWA 4YMIA 1ZMXA 3AFOA 3A4LA 1OLXB 4RHEA 4QPZA 3K8YA 1JG3A 1OTHA 3CX7A 3MUFA 4D4JA 4OHYA 1Z8NA 2EWVA 2PV7A 3SZLA 2F8TA 1E59A 3CN7A 1F0KA 4I2VA 4KH0A 2Z2YA 1AY0A 3JS5A 4DLEA 4W5RA 4BFVA 3OY7A 2EDUA 1L1QA 4M0AA 3AUJB 8ICZA 1A76A 3NBAA 3D3QA 3JWIA 5BXYA 5ILOA 3B1KA 3CP8A 1C9MA 3ENNA 1V4VA 4NAUA 5JT1A 4G0ZA 4UUAA 4J94A 2PEZA 3WC4A 2EP8A 1B73A 2NTYC 3EA4A 2YVQA 3PFIA 4RW0A 3WLTA 5HM6A 5H3CA 4L3WA 3G1WA 3TJMA 1XZEA 1OUMA 3KAPA 3V32A 4KYVA 4NULA 4XM0A 5TLSA 1N1DA 2Z4RA 4H7IA 3UVEA 1E79A 4C0HA 1XU7A 4FMCB 5IAGA 1L4YA 1WWUA 2JEIA 5ITWA 1R8XA 2D7CA 3ZTWA 4H1UA 2EZ9A 3OU2A 5TRTA 3IS3A 2I4MA 2P3LA 1GSAA 5JFGA 5T7BA 4RY0A 3ESCA 2B6GA 3AESA 4JLWA 4PZEA 1KY4A 4C5BA 2OV4A 5HCUA 2G76A 1SR8A 1H65A 3QMWA 1BHO1 1E20A 1R18A 3DMHA 1P5JA 1B8UA 3K6KA 4EGCB 4OHRA 3UK6A 2MU2A 3L8ZA 3HFSA 4AM8A 4DJ5X 2G9VA 3PJFA 4LKOA 2V6IA 1VBFA 3GRPA 5A3RA 4BMXA 1QGAA 4XIJA 3LHKA 4UB1A 3E8SA 2XDWA 2B4AA 4LJLA 3EVAA 1B2RA 2ZRHA 2ZRDA 1SB3C 1G55A 3ZDYB 1EWYA 3STXA 2FW8A 1S2DA 2C2BA 4A6PA 3PJRA 3DS8A 3OKAA 3KQVA 1GA4A 4PPXA 4PO9A 2ADOA 4QOSA 1KGDA 3DVAA 4O2BB 2C5FA 4ZHQB 2JCGA 1BEEA 5DG7A 3S70A 4H7KA 4IIFA 4LC9A 2QXTA 1W36D 2ICAA 1XR3A 4ZQIA 5B3JA 1XCJA 3BSWA 4HFNA 1XJCA 1Y3IA 3AHIA 2PL1A 2R7AA 2LWIA 1MO6A 4F86A 2C59A 4NE9A 3O3CA 3KLBA 1GQOA 2RD2A 3KQHA 1SZDA 5C7LO 2GO1A 4JL6A 1T29A 4J9KA 3H17A 2G9UA 1TEXA 1U9LA 1EI9A 2R7LA 5DBAA 2CXRA 5IUKC 4KMOA 1TYEB 4WT7A 1LDYA 1AK9A 1P39A 1JT9A 3L8EA 1KZYC 4BV9A 5BNIA 4B33A 3LYHA 1G7TA 1NUPA 2OCYC 2W48A 3VYUB 4LHSA 1VPLA 3H75A 1N5IA 1UBLS 3W05A 1T0HB 2C29D 2I7DA 4NBRA 4TWIA 3QBDA 1Z33A 2G5PA 1PJSA 9ICXA 3CF2A 1XXHB 5HK9A 4NICA 1DQSA 2GAOA 1OH8A 5IAJA 4JYAB 4PNEA 2QT1A 2JLRA 4YHBA 2YYZA 5IXSA 5G4LA 2AG6A 3EZ9A 2GD1O 4WTOA 4LE1A 1FZTA 4O3NA 4B87A 3SWWA 1IK4A 3LU1A 1PYGA 4MB2A 2NZ2A 3MUOA 5KTKA 3NLLA 4AZVA 5ERGB 1KQ3A 4KR6A 1QXSA 4B3JA 3CLUC 4R8UA 1XQ1A 5KSPA 1WULS 4B73A 1RC1A 1PU2A 4PO1A 1Y7TA 4ZPJA 2UZAA 4HDRA 3RFFA 3CUSA 3W5HA 2J0UA 2BFAA 4EKYA 2GPWA 1MAVA 2ODBA 2FUKA 1A5SB 3D6MA 2XB8A 1CETA 4C29A 3M9XA 1FYFA 3UMVA 3BS7A 4ZREA 4LF6B 5IZCC 4ZC8A 3D2BA 3GGCA 2VPTA 2A9QA 3VKFA 3DOJA 4RMHA 2QMQA 3ETRA 5F21A 1XVIA 1ORHA 1GA1A 2UKDA 1TPYA 4E5NA 4GNRA 4WK2B 1ZR2A 5B1EA 2UVDA 4P4UA 1JLSA 5DHSA 2PA0A 2QX6A 3LT2A 4E6PA 3HRKA 5CH8A 2FDXA 2I3BA 3DBLA 2C7BA 3UXHA 4MGYR 1XA0A 5C31A 2RG7A 1RTKA 3EUWA 1YR6A 4J2OA 1N2OA 4Q7QA 3VC3A 2C1EA 1GR0A 3DOFA 1E1LA 2OHHA 3PXCX 1RBZA 4C7OA 3UANA 3AONB 1U3FA 3IDWA 3STUA 2FHSA 2GLUA 4G1UC 2VK4A 4G5YA 2F3RA 1U0LA 1RQ2A 4UPEA 4J16C 3HBFA 4LV6A 4AN1A 4WERA 4RS4A 2Z7JA 4LTDA 2VUTA 5FX2A 4E5MA 3F71A 2DUJA 4KPUA 4OHMA 3L46A 2HCFA 1T9CA 4ED6A 2GEVA 2GK3A 2O59A 2VN8A 2CXUA 3HVJA 1IUNA 2KMDA 3DOCA 2Y1FA 3D43A 1SWVA 4AZ0A 3UFXB 2VP5A 1QTIA 4TYPA 5EFOA 3CUVA 2OEPA 3A1DA 1DJOA 1M34B 1SZCA 3IR5A 1TT5B 3KWFA 4F84A 2AQIA 4PL2A 1U5BA 1BXRA 5C5IA 5ERYA 3V7FA 5A5DA 5TF0A 1CR6A 1AQNA 4RIHA 2QYHA 3IX7A 5A06A 4KE9A 4IQVA 1ZQ1A 4OHVA 5CP2A 4CKXA 2XTJA 1A04A 1T1JA 2M6KA 1EKXA 4NL9C 2VDRB 2FN3A 3PFWO 2BFCB 4NONA 2FW6A 1SD2A 3U7QA 1PFGA 5KG4A 2J9GA 3BB4A 4M0DA 3C21A 1TX4B 2GF2A 3PQFA 5KYYB 2EL9A 3MGGA 3LNCA 4QWWA 5A3VA 2PVSA 1WWKA 1NDHA 1VKZA 5EIXA 1UC5B 4ZV7A 4O5CA 3WU2U 2YY7A 5ADVA 3I5AA 3EZ5A 4LDAA 1ZUNA 4MHVA 1Y8RA 1YASA 1U28C 3V80A 1ZUWA 3VTFA 3FYCA 3MAAC 1KETA 1HJPA 5AVXA 2QW8A 1W76A 2BMAA 4I1RA 2BELA 1QX4A 2DLDA 1TM4E 1SHLA 3ZZUA 4IDEA 2PPVA 1DQPA 2ERYA 1DFHA 4GZ3A 3AR3A 4W1PA 4C78A 4D02A 3T06B 5JTTA 4L3VA 3ZX4A 5KQGA 1G21B 4MLPA 1YACA 3TSWA 4CIDA 1SEVA 2VCEA 5J59A 1U0RA 1O5TA 2Q7DA 4NFLA 1SEPA 4UFPA 3M9NB 3L7YA 2VR1A 2WJVA 4IRXA 1B8NA 4KGXA 3QEOA 3AQEA 4H4EA 4KWCA 4R9NA 2BCUA 4UQGA 1NVWQ 1LRJA 1P73A 3TTYA 1TT7A 3AU2A 4EFLA 5EJ7A 1SHTX 3PXBA 3IEUA 4R1LA 5H8WA 4Q15A 1YDWA 4GOKA 4QFCA 3E18A 3F3KA 3FZEA 5B1SA 1KJZA 1QGOA 4BLTA 1UPTA 3GLHE 4NLCA 5LN1A 3HKBB 1PP4A 4U2CA 4Q3OA 2KLHA 1O4VA 4CMHA 3SLGA 4MUGA 2QT9A 4MR9B 4DDUA 4XA8A 4B35A 7ICVA 3BD7A 4TN1A 2R8JA 5CA0B 4DV5B 3GNSA 1RYYA 4IYRA 4C7JA 3P1JA 5DTJA 2E5LB 1OILA 4RQ2A 2ODQA 1AQUA 4HVAA 4NNPA 4RQ6A 1SBCA 1QYXA 1XCPA 3LFHA 1GYPA 2GN1A 2HTFA 3UOGA 2W2VA 4QUIA 4Q3EA 4H1WA 4CEIA 2RGNA 4DLZA 4QUHA 5EJ5A 1M1UA 1TCUA 3LCUA 5C4IA 3ZU5A 1T3ZA 2OWOA 1NI3A 4AIIA 5ALVA 2FUG6 3N2EA 4JVMA 4MEAA 1CYEA 1M0EA 1V45E 4KGDA 1PQ4A 4D8XA 1Y5RA 3NBMA 4FC6A 4ZYXA 2Y4OA 3NEPX 3VR5A 2C2RA 2IS4A 2QA5A 4FHEA 4V3CA 1QAMA 3RRZA 4DJTA 1SQ0A 2O5VA 3KFXA 5JDIC 1N8NA 1E92A 3C5HA 2NX2A 2DM6A 1QE0A 3SHWA 2CMGA 3F0TA 1SVNA 4ZZIA 4A03A 1CQJB 2HD4A 5EJIA 2EIXA 1FX1A 1BVRA 1DWQA 1ZFNA 1UQVA 4OKSA 2EAMA 2I9PA 5FBVB 4ADSG 1Z3IX 3ENWA 2GLEA 1I4TD 1UPBA 3TG2A 3WBFA 3ZDZB 5GTHU 4NCKA 1PI3A 1YCFA 3O3OB 2DLNA 2XNHA 3KJIA 4OREX 2PRJA 5KOJA 4JVLA 3ZZ1A 4GP6A 3QH4A 4DRXA 1TUBA 1NMZA 3LYUA 5LL6P 3WZLA 1X7WA 3TAXA 1FLDA 3R0QA 2IF0A 3DMGA 1R6UA 2AN3A 1WG8A 5C81A 1KE1A 4EB3A 1LPBB 1U7DA 4LI0A 5IILA 4QZEA 2CVOA 3KV1A 3RUHA 5D5PA 4D0GA 1T2FA 3GMDA 4KLMA 5CR0A 2ACKA 4LIPD 2IZZA 3TKAA 4Y2QA 4J43A 5E6UA 1X1RA 3MILA 4MEBA 3C5WP 4D26A 3FHTA 2IZ1A 4FZLA 3EQZA 4MK4A 4FBGA 1RRFA 4ZDJA 4R9UC 5COAA 4J29A 1BDMA 1AHPA 3CE6A 3IEKA 4NPAA 4RMNA 1PK1A 3RS4A 1J5XA 2GCOA 1HZJA 2DJ5A 3SC4A 5DN6A 5A62A 2XQVA 3P9ZA 2ZIXA 5IC5A 1WHTA 2ZXFA 3CLUD 3Q12A 2G9NA 3AT1A 3MINB 4YN4A 3SQIA 3R3VA 4WESB 1EGVB 1E2FA 4L5AA 5JH7A 1KSGA 1G6Q1 4L74A 4ZCMA 4MVJI 2GK7A 3QKTA 1SXJE 3T3IA 4B9UA 2NZXA 3I53A 1CP3A 5KTNA 1J9EA 1DWOA 1RJEA 2AVNA 3NDBB 1NJ5A 2OB2A 3EEYA 4HWPA 2FCAA 1D2EA 1D7AA 1SN7A 5BV7A 2DUYA 1TK8A 5CITA 1N6LA 2ZDQA 1E1KA 4A8TA 1X42A 2EJBA 1VKOA 5TNXA 2ZZKA 3VH3A 3PWTA 2CJXA 4YRDA 4YJ3A 4WXMA 3QK7A 1GPBA 1NOKA 2O2ZA 3T5MA 1N5JA 3I45A 2R8KA 2Z1MA 1PJCA 2X5KO 1ZQSA 2H31A 3I34X 1QPZA 3BERA 2IEBA 2OAGA 1ADFA 5HFJA 3B1WA 3T6KA 2KKPA 3Q7QA 2NSDA 4DN6A 3AGQA 4D4MA 3AR4A 3ISJA 1BMTA 4FFVA 1P1KA 3BUSA 3RJFA 3RR2A 1GPUA 1SQFA 4WNAB 1IEQA 4OB6A 2IU6A 3DEKA 4F3OA 1Z6XA 8ICCA 3RW9A 2EBHX 1NW4A 4TZ0A 3G8BA 3QKRA 2GBCA 3EVFA 4Q9LA 1KMQA 3F4LA 3Q1KA 4BLUA 1EFVB 2VA3A 3W2FA 4TQRA 3UNXA 2QYTA 1B14A 4HH1A 3N7SC 4NBLA 4W9RA 3UA4A 1JXEA 3GVIA 4DSOA 3GEHA 3V7WA 2HR1A 3ACBA 4GVXA 1H9BA 1ZU4A 5D49A 2KMLA 3N70A 4M49A 4HV4A 1UPCA 3WZMA 2NVOA 3OCCA 1D0VA 3HY4A 2E4WA 1T4MA 2DPGA 3KETA 6AT1A 1FDVA 3D54D 4CN8A 4IS3A 5EWLA 4C2UA 3A6FA 3AVPA 4DGQA 2SCUA 4BKRA 3GYGA 4BV2A 1QBKC 2I2AA 2YWGA 3I6YA 4DNPA 1UKAA 4RJKA 3GRVA 1Q0SA 3PSAA 1RKBA 1DEKA 4PYKA 2MSNA 2EYUA 1NFFA 3UAOA 3KCQA 4YO8A 1ORRA 5ALMA 1QYIA 5L3VA 1VL0A 4OXIA 2X8JA 4V0MA 2LDBA 4CRWB 5C1OA 2YHBA 1LWNA 3H9GA 2GSDA 4LJ5A 3KZXA 3OBIA 2HMXA 3SHTA 1HDGO 2FOIA 4UHFA 1QQBA 3WK4A 4AW9A 1U1DA 2NNWB 4F93B 1MV8A 4Z86A 4ZJYA 4UB4A 3KXLA 2GCIA 1GNVA 2SKCA 1OD6A 4D8WA 1A5BB 5LXTA 4IJQA 4LF8B 1JALA 1BE0A 3ZS9A 3B1JA 4Y3UA 3STWA 3LP8A 1L3UA 1EJ6A 4UZFA 4I14A 4DF3A 3CVUA 4LXYA 1A7UA 3ZKWB 3MSXA 4RNOA 2RKOA 1Q6ZA 1OX4A 5FQOA 1GP2A 1E64A 2ZAIA 1B43A 4ZI7A 1A6SA 3NDIA 5I9BA 2CYCA 3LGXA 1E9RA 1ISIA 4GFDA 3L2OB 4H3SA 3JYHA 4ENWA 2ZYSA 1SVUA 1FU4A 4DDMA 1UC8A 5EZSA 4M1OA 4CMEC 3C3WA 1LLDA 2NRVA 1KKUA 1DXHA 3AV0B 5TS3A 4BP3A 4CT5A 2DGZA 3FGOA 3HTXA 1X39A 1S4MA 1L3SA 5EPOA 1N7HA 2QVLA 3E81A 4V38A 1YRBA 5HBRA 3EODA 2XWBF 5ADWA 3C1OA 3R5HA 3R3XA 3QEBZ 4JYPA 1V9LA 5I9IA 1O6ZA 2GUWA 3FPFA 4EG4A 1EJBA 2M6SA 2GEDA 2MYUA 3LNTA 2O0LA 3G7NA 3C5VA 5SZJA 4CQJA 5BOSB 2HYDA 1EK5A 4Z99A 3AIKA 5EHIA 1XZIA 1M2OB 1S2GA 4EKIA 4EUEA 3G59A 3WICA 5L4LA 5JANA 1HORA 2NPOA 4BLSA 3IKTA 4PLTA 3NVYA 4GQIA 2C0PA 3I0ZA 4CKEB 2NPIA 3CT4A 3JRNA 3Q0EA 5B7PA 1K6EA 6PFKA 3X1DA 2P6MA 2RH8A 4WBNF 2GTIA 3F7MA 2AKEA 3COJA 3PGXA 4WZAA 4MINA 5CM8B 2WQ7A 4I50A 4LG1A 2JZOA 4DZZA 4RWEA 5BSTA 4ED7A 4IVNA 4DR6B 5BQOA 4US8A 4X0EA 2ZRFA 1E3LA 1MGPA 3PPIA 2BLNA 3HXLA 3DDZX 1X94A 1UIRA 3GJZA 1T35A 3TCKA 1EVQA 2VRWA 2W2OA 3MTBA 4V1CI 3IOEA 2XB4A 1CJVC 2CHFA 5AQ1A 4NKRA 5JROA 4WCDA 5KMGB 2XE4A 1OIVA 2JAPA 3FKJA 2H48A 5D8DA 1ZD2P 3JAWA 1C1YA 2FZWA 5KJCA 4KUGA 3IHKA 2FCRA 1T91A 1GQSA 5IJ9A 4U39A 3WNDA 4IVQA 1II8A 1ES9A 3U44A 2H8GA 2OZLA 2PU5A 4MLZA 2LPEA 3CZMA 5DDIP 2E48A 1WBDA 1W94A 3C7CB 1QCDA 2BFWA 4XD2A 4FS3A 3SM9A 5F9HA 2JI4A 4BNGA 2L5YA 4P38A 1QS0B 3LX6A 4KYIB 3IAM6 1DXYA 2WICA 1X6JA 1YVUA 3VDQA 1BD4A 1G38A 2C98A 3O38A 3ETLA 1IM2A 4YJFA 3H9EO 3VPFA 4GXJA 1CVLA 2RB5A 2KSOB 1UT8A 1SVIA 4LDQA 2IEAA 5FOTA 4CI9A 5F3RA 3VPHA 3DE3X 3R24A 5AVWA 3GLRA 4EJ6A 4W8HA 2AN9A 3LKZA 3PEYA 3CZRA 3OM0A 2RHTA 2ZU0C 2Y1JA 1LPNA 2DKXA 2P4QA 2ZJ7A 4ZT5A 2XMCA 2V0GA 5T4EA 1E0DA 2ZU6A 2BZ1A 2A9VA 1E9DA 4KIFA 3RB4A 5CCBA 1MNAA 2DKOA 5FOQA 2XHEA 4DR4B 1RG6A 3DVRX 3AHCA 3HKEB 4DBLC 2X1LA 3CNEA 3LKVA 2OGSA 4WCVA 3GX1A 2AXPA 4QM7A 3H4TA 5JWRA 3W5UA 3VNAA 1B26A 2B25A 3NBZC 3NWOA 3BXHA 3LOQA 4G56A 3FPHA 2C3PA 3HRDD 4YI5A 4F92B 3CUEF 3WRWA 4EKEA 3JWPA 1VA5A 4XB6B 5CK5A 3PFCA 4BNMA 2OFWA 5I6DA 1CY1A 4DJJA 1REQA 1XD8A 1ZQUA 2EQBA 2A1JA 4FILA 3MR2A 4YMHA 1RHRA 3H2YA 1QFYA 4HQRA 1LB2B 5CHGA 3VCBA 1Z0DA 4G4SP 4QIWC 3Q8KA 3E0QA 3A7EA 4DY4A 1W5EA 4CU2A 2WQZA 3HP7A 4CQMA 2DZDA 3NTVA 2POQX 4IIVA 4JYMA 2YY5A 1VYVA 1TD9A 1HR0B 2BGUA 5DYTA 4DM4A 1E3EA 3BE5A 2X6RA 1L5HB 4QDXA 2FFRA 1QH9A 1FSGA 1R16A 2IEIA 2QTBA 4ZYZA 4ITUA 3JTMA 4F50A 2GHQA 4IR1A 1FP4A 3HXMA 1AUQA 1ZJ4A 3LSYA 4UUBA 3NJRA 3PIDA 2FJ0A 4ZQFA 4MUYA 1XA4A 2R8EA 1Z25A 5IXYA 4N47A 4RORA 5LJIA 1J2NA 1KJQA 4L28A 3OPYB 3KOYA 1UZMA 4BB0A 1TLFA 1DJNA 4H7JA 3DBHA 2ECOA 4C03A 4UVDA 1OTYA 2WJGA 4W5WA 1Z47A 4WQMA 3AM1A 3ACCA 2BJHA 1NSYA 1GUYA 4EYQA 2JGNA 4QTTB 1RI3A 5JSHA 2A9PA 2FP4B 1Q15A 4Y1GA 2Q21A 1VJTA 4PPYA 2NUTB 2OT3B 3CRZA 1P17A 3SAJA 4Y9DA 3PV8A 4WA7A 2OCEA 3NGLA 4YFVA 4JDUA 3ZCRA 4W9NC 1OWNA 1ODFA 2JIQA 3FWPA 4Q05A 5JDCA 4F46A 1JTFA 5L7TA 4N54A 3F49S 1O5OA 1OWPA 4J3NA 4MX8A 2ASDA 1D1TA 4IV5A 5KQPA 2PIDA 3OE4A 3R3WA 1QO9A 4RMJA 4B2LA 1Y5LA 3LDHA 5KYXB 1C4KA 3NP9A 4KUEA 5IJ0B 2VOJA 5K3OA 1PR1A 3IMCA 4BNYA 3B1FA 3TI0A 4RZSA 4GI1A 1HLGA 1WUIS 1CUGA 4DDTA 4IV0A 2Q1WA 4L5JA 1R0YA 4GXRA 2YASA 4PSKA 3IFSA 4MRVA 4GYYA 1VRWA 1X13A 5I7VA 1ESNA 4NC9A 4PG6A 2ACEA 5DT9A 3BL6A 1TA9A 1S3GA 4MUHA 3GA7A 3IHWA 5CT8A 1NQXA 1XZBA 3PB3A 3GIJA 2LYHA 2AD5A 5F7XA 1N1MA 5TPWA 2FXIA 2OFFA 4EY3A 2DR0A 2WWRA 4UAZA 2WAOA 4TN5A 4WE3A 4G8JA 1BXKA 2GEBA 1KZ1A 4XLZA 5AJWA 3UT0A 5GVSA 4QAJA 3DV0B 5BSFA 4UNPA 5BW5A 4AUEA 1CUDA 1DV1A 2F3TA 2AC7A 1KJIA 1ZM3A 2BZ0A 4EJFA 2CF5A 4UVEA 4WCFC 3AWIA 3AYXB 1YXMA 3TI9A 3DO8A 4TSFD 1Q83A 1ZOSA 5EOVA 2JLSA 5DHAA 3W3AD 4QTXA 9ICWA 3QUTA 2XGSA 5AK0A 3IERA 2NZVG 1TKDA 1XZAA 1IULA 4FE3A 3WDSA 3PC4A 2C94A 3C1ZA 4OJMX 1JQDA 1IXRC 3QF4A 4INZA 4L76A 1Q92A 5BWCA 1EFHA 4O4IA 3DC2A 4H15A 1KWKA 3CRNA 1JXQA 3LLMA 5L3RA 4FYYA 1NUSA 1K5OA 1KY3A 4DMCA 3HMKA 1KYTA 4DMUB 3VR6H 4IS2A 3FD8A 2ZRBA 1YB5A 4S1OA 2WNIA 2ZKLA 1HDOA 3KHKA 1M8KA 3G6KA 1HDYA 3HP4A 3EXAA 1C3XA 1EEHA 2J9FB 3ND9A 3O4FA 1EE9A 3Q2OA 3AB8A 2G25A 4RVSA 1KAOA 3KKZA 3BF8A 2BSQA 2Q0ZX 1BMFD 4IDPA 1PDWA 4JVSB 3PE3A 3C8HA 3L7JA 4GD3Q 1E60A 4M7OA 1RZTA 4KQHA 3EN0A 2GZRA 2C07A 2Q2QA 2H4JA 2GN2A 4YASA 5EKUA 1G9XA 3T9CA 3WAJA 3CCFA 4LVNA 4FX2A 4L4UA 4PCAA 3IBFA 1CPYA 3KB8A 3B1XA 1T5TA 3CX8A 7ICFA 3GH3A 3CEAA 2V4QA 2V55B 2FLVA 4I2HA 5BMOA 2IW1A 1IMOA 3GYBA 2O48X 2WSLA 5HIKA 4JLDA 3QPUA 4MRRA 4PW0A 3ZWPA 4RESA 4QIWF 1O4WA 2BHRA 4BUGA 3VKHA 4OVKA 4PX2A 2GPTA 4HEA1 2QORA 1GG5A 3MGHA 1I2AA 5AKYA 5KG5A 1QOQB 2HHWA 4HTFB 3PDIA 1ZWLA 1KQNA 1JR3E 1A9XA 3VRHA 5KFKA 4XB1A 3RB3A 2Z9CA 3TZKA 1DIBA 3DA8A 4JX9A 5EWMB 4LRXA 1PVPA 4B83A 4CMIB 1GNPA 4E0BA 3DL4A 3AERA 1KA9H 3AILA 1GTVA 4LBYA 3FNQA 3LCVB 3TTUA 3KKMA 2NO5A 4LDJA 2QROA 3RJGA 2ZI9A 2WSBA 2QZZA 5MFPA 3R3ZA 3TMYA 2W6NA 4FR0A 1QGUA 2OLJA 5ES3A 3BFPA 1IE3A 1W36C 4M37A 2O1SA 2G72A 3QLTA 4RPYA 3LT4A 1Z34A 5BYAA 2VWPA 4PNZA 3KTDA 3AL0B 5CRIA 3L5OA 3VSEA 3RFUA 4LC0A 5JXGA 4QWMA 2AYXA 4ME6A 1JA9A 5DHRA 2F3QA 4PGFA 1PF7E 1YZHA 3OQIA 1N92A 5KFOA 3WAGA 4BATA 3JQ8A 3A26A 2DG2A 1AXGA 4UASA 5K3EA 3OBBA 1W19A 2Q5IA 4H1HA 4E15A 3GI1A 2H7CA 5LQSA 1K4KA 3DF7A 3ZYCA 3GJRA 2A92A 3TZEA 4GP7A 1P91A 2QAGC 3T7IA 4JZKA 5G1NA 3HXTA 3CLTC 3W2EA 4ZAYA 2ZIEA 4BNVA 3I83A 3MBOA 3QSYA 4LNUB 3MR5A 4DMFA 4G2NA 3PNVA 3U1TA 4QW9A 2P79A 2WIJA 1W4ZA 5AQEA 2FUNB 3H2GA 2E49A 3SQNA 1AN0A 5KYVA 1XZDA 1H8ED 2XEXA 2LTAA 5EEHA 5B6PA 3DL7A 4UJ5A 1VYTA 2QG4A 5CJJA 2GJKA 1Z19A 2VAMA 1YJQA 1KU0A 2EJWA 1IONA 2JLUA 2QL6A 4ZTZB 4BNLA 2PD6A 5FTKA 5DCYA 2BDTA 2D5AA 1A95A 2VJYA 1KFEB 4ZCPA 2GAFA 1M74A 5JS8A 4IM7A 1NVEA 4I5EA 2VQ6A 3AUTA 2QW0X 2RHDA 5BR1A 4MVJH 1N33B 2YJGA 4MSUA 5EHXA 4CTJA 4E5UA 2Z5LA 4OGGA 3FVVA 3D59A 1W46A 4P0PB 2IODA 3PPYA 2VWGA 2PGAA 2HSWA 3ZYZA 1SBZA 3P97A 1I10A 3RVBA 3J81j 3RI3A 1GTG1 4FGSA 1SIWA 3PQ5A 2GVNA 4YR0A 2IY9A 5AK4A 4QZIA 2FKNA 2KFZA 3ZXUB 1NIPA 4LN1A 1GVNB 4F2PA 2G6BA 3G79A 3JALA 3TAUA 3K2EA 1DAMA 2QPOA 4D8YA 4BAUA 4YJGB 5DTQA 2XKKA 5JSQA 2H7VA 5F2KA 5EP1A 1X77A 1JFVA 4JT9A 4RVUA 1XC7A 2CXPA 1A7AA 1WDKA 4EA8A 3U48A 4GSKA 1KS9A 4F9FA 3BWYA 2YY6A 4M1WA 2PR7A 3NI2A 3GJXC 2XUAA 1ECFA 3CU5A 3BBLA 3GLIE 5ENVA 2PL9A 4KVZA 3KQMA 1PR5A 5DN9A 2DTEA 2G67A 1VL2A 3VYTB 2ZUEA 1NQ5A 3DF9A 3WLOA 4JODA 4BPBA 1VIYA 3WG9A 2HMUA 3UQZA 3ZNOA 4BJ3A 3WQHA 1UM8A 3ND6A 4AMYA 3PF8A 3A4NA 1FLNA 4NJOA 5HR6A 3HEBA 1UOQA 4YV2A 3T1QA 1JIUA 5IIOA 2XY7A 4P3NA 4HEHA 4X44A 5MDHA 4BMDA 2RQ5A 3UN1A 3ZLJA 4WHMA 4FDTA 1GPNA 1HDXA 2M1XA 2VDOB 4KMUA 2KD1A 4RPIA 1M33A 2NV6A 4BE9A 2L0XA 3BDIA 3CR3C 2KSQA 3E9ZA 4DG9A 1WLSA 5C9ZA 1NSFA 5CJPA 2JAOA 3A3KA 3O47A 5CWRA 6YASA 4YRZA 3EEFA 1ACJA 2H7XA 3WLMA 2MSLA 1FNBA 1V7CA 2VA8A 2GKGA 1PYOA 2FMPA 1N2IA 1DLIA 4ND2A 4FNMA 2M0NA 1YVDA 4FS1A 5KG0A 2IPNA 1PS8A 1P2SA 4AP9A 1U7PA 4NZMA 1RYBA 3Q7PA 3QQPA 2VTBA 4YP9A 1NG1A 5FI1B 3BJMA 1HF3A 2RHGB 4M53A 3C6ZA 2OAP1 3TH5A 3NAMA 4IJUA 5TMBA 1U1FA 5I4BA 5I7WA 5G0UA 4LMBA 4FKZA 1K7YA 3TECE 1WPGA 1WYGA 1YGYA 1E79D 5A6SB 1U47A 5HHHA 1U90A 4DNQA 4KGVA 2MU1A 3BPSA 3FYUA 1N2XA 5I4KA 2ZT8A 3K9LA 1Q3VA 4OOFA 2VWHA 3UJCA 2QR5A 1Z6AA 3QFFA 3H87A 1JHZA 3SHOA 2PVPA 1SCAA 1KYVA 3UEOA 5IEJA 1UFRA 3V42A 4AJEA 1PL6A 2R8OA 5F76A 3GO4A 2I4IA 5I8ZA 4GYWA 5JTIA 3Q98A 5C32A 4DQPA 2Z4TA 5AVQA 1BAPA 2BGNA 1O1YA 4KXFB 2ZDGA 1YZNA 1GRRA 4TS9A 1ZI8A 1HGXA 2XE6A 1H93A 4CFSA 1T6XA 1A5ZA 2WMNB 3PNLA 4H35A 2AJTA 5HCIA 1M1XB 3VH2A 3MJFA 4OQXA 2RHHA 1Z3CA 3IXLA 2XKBA 1NVFA 3CVJA 3WHLA 1DK3A 3T0GA 1SXQA 4M21A 5CGZA 3SENA 3A25A 4J6FA 1YIDA 4YIHA 1UFQA 3EGCA 1OBHA 2EX0A 1DO2A 1K0UA 3DKRA 4P9NA 3GFOA 1C4XA 2VDWB 4HX2A 2BRUA 4DCUA 2ZB3A 2WHYA 2Y1OA 5JMTA 2Q62A 2C83A 1Z4QA 3KD3A 1RACA 1NE2A 4S1NA 2IOYA 4ODIA 3NM4A 4HVLA 1P2DA 1D8YA 3OPYI 4AQDA 2JANA 3ROXA 2PLFA 4HAWA 4F0JA 3FUXA 4HN9A 1O08A 4GLFA 2W00A 4MV7A 3HCRA 3TTVA 4BBAA 2IFTA 1QDLB 2AQ4A 5KWJA 3RYCB 1SV0A 3EHDA 4G81A 1QHEA 3PZBA 2QTWB 1DK2A 2X2EA 4J1SA 5K1ZA 2Y93A 4EY8A 3AJAA 2QP9X 1MJHA 4RTRA 1OSNA 4IRUB 5FTNA 4ILKA 4E5YA 4Z7NB 4GQAA 4KIGA 3TQSA 1JTVA 1SBQA 2XGMA 2CD9A 1JHYA 3DQPA 1G3UA 4QATA 3IIEA 2CXSA 2AI3A 3QX7A 2JBAB 2FSSA 1U2EA 3WYFA 2BKEA 3DLCA 2PXIA 3DTVA 3R7NA 1ACLA 2R1ZA 3U3RA 1DAKA 1U9ZA 2R1VA 4QU5A 4Q1BA 2VDNB 4RD6A 1Q21A 1XTRA 2ZT5A 3ZDBA 2GBLC 3QVSA 1E96A 2HJSA 3M3DA 2I87A 4H1VA 10MHA 3AM3A 1NLFA 4KFSA 1ZD3A 1RQLA 4GU5A 1AO3A 3I05A 5DGXA 3T38A 5EIAA 5DEIA 1J90A 1NY6A 1IIPA 3L7DA 1USUA 3EGXA 2ZTSA 4M7WA 1K06A 1RFLA 2WU0A 4ALJA 3C6BA 4LJYA 2G7ZA 4J9SA 5BUZA 4NATA 1WW3A 5TF4A 4B7CA 3IO3A 1XNRB 5JUWA 1BOFA 1E3MA 2W9CA 1IOLA 3G9ZA 4HJXA 5F77A 3PTZA 5CW2A 1WMAA 3CLTD 3MWDA 5HHTA 5DB6A 3DVQX 1AZSC 4JYBA 4AX4A 3K3PA 1Y4SA 5IVHA 3NAGA 3SICE 5JS7A 2H2AA 1P61B 1R0KA 1XA3A 4GHWA 4N3NA 2A7QA 4QQ8A 1G8PA 5DX8A 1GNQA 3E15A 4MQ5A 4C0AC 5KNCA 3NOVA 4QJ3A 2GTHA 2HPZA 2PYIA 4KQMA 4RKEA 2DWQA 4IGEA 5IG2A 3P26A 3K09A 4RHFA 1QRUA 1SXJA 3KKNA 1R15A 4BQRA 3D3KA 2FWNA 1Y9DA 2CDCA 3MUNA 3MT0A 1I01A 1VJ0A 1TK9A 3FAZA 5KOHB 1RVDA 4II3A 1XTVA 4R1SA 5TX7A 3H0RB 2ZBGA 1FJ2A 3LQ4A 4BNJA 2K4EA 3FVQA 2NT3A 3ZGXA 1N63A 3ZNNA 1QFZA 1YT5A 3GILA 2Q6TA 4QBHA 3MWJA 3B9QA 4GOMD 4CIYA 1OV4A 1BPZA 4AB1A 2AJDA 4E22A 1A8UA 2W98A 2X5NA 4DLUA 2XZLA 3I3SR 1G1AA 1Q7BA 4PH5A 1VDVA 1F8YA 1NRWA 2J07A 2JKVA 5EZ5A 1KGSA 4QVKA 3MJHA 4ZCLA 3SQXA 4DIKA 2C4WA 2C2DA 2UVVA 5ECDA 1CQWA 4E14A 3HO1A 3LUDA 4M2YA 4OGKA 3I9V6 4B3DA 4E1VA 3V7NA 5A9TA 5FUXA 2V74B 4JQCA 2QT0A 1M1YE 1NK4A 4D81A 2GEKA 3JY6A 1RIFA 3O7WA 3ZKAA 4FFBB 3N0VA 4V1CB 6ADHA 1Z22A 5JALA 3GLUA 2O2SA 2ZI6A 1Q77A 3AF1A 4ZA2A 4EQ6A 1BRMA 4BKUA 2O7VA 1UWKA 5AHXA 2N0SA 4Q12A 2QNRA 3IE2A 3D0QA 1Z0ZA 2P91A 1WCWA 1ZIXA 1X1DA 2VZ9A 4LXUA 3INYA 3KD2A 5LYYA 4QOIA 3Q9SA 3F2VA 2Y6VA 2R8BA 3KSMA 3TE6A 4DIUA 5KFGA 1JWBB 4IMIB 5HIAA 1XTSA 2VPWA 3QTBA 2BBTA 4D9BA 2JA2A 4JI3B 4H7PA 1EQ2A 3V4ZA 1ODKA 4K7JA 4QYSA 2JIZA 4PN7A 2XNJA 5HGXA 2B2CA 2IL1A 2HQ1A 2DQNB 4QZHA 1E2DA 3DPIA 4KMSA 1K5GA 2P6OA 2VANA 1UQTA 1YE5A 2YW9A 7ICKA 1ZK2A 1B4DA 2PRSA 4IQ8A 4Q7EA 5ICFA 1NXOA 1UADA 4O4LF 1VJ5A 1Z5WA 5AXBA 4XQ8A 2FPXA 3SDZA 3V2UA 3ZY6A 1R5OA 4J0DA 3TSYA 2NZJA 1MA3A 4OYYA 2H65A 5A0VA 4JBGA 5D5QA 4DIFA 1S89A 1HE3A 3AETB 2JW5A 4TOIA 2C3MA 4ECWA 1CQPA 2MSEB 1HEKA 3Q4GA 2FEWB 3NEYA 4ASUA 1L5GB 4PR3A 3HNPA 5J1SB 2PKCA 5HR7A 4I4LA 3ZWMA 1WABA 2FPRA 1GL6A 3PD0A 2HA6A 3WA7A 1T0UA 4PQEA 3IP6A 4BN4A 1H0KA 3CPEA 3L0SA 1PTJA 3IP8A 5TVKA 5KYWB 5DGBA 3RSOA 3UH0A 5FADA 3PSPA 1QH1B 5EZQA 5K8CA 1C7QA 1YV9A 5AXDA 4JJAA 2H1SA 4HQNA 4YVFA 4LVOA 3DHYA 3HJCA 4IDQA 4ZJPA 3K92A 1JAHA 2XZDA 2BQRA 3K35A 2WHXA 1C0IA 5B6IA 1NBHA 1DRJA 4EG1A 2D8CA 1CY0A 2Z4SA 3MBYA 5IHXA 1RBQA 4ID9A 2EJTA 4AJNA 3MS7A 5C5JA 3THXA 4Q1EA 2JJ8A 3AZQA 3VR5D 3ISVA 5KQMA 2IXDA 4MLCA 5EZYF 2QPLA 3KR1A 2RGUA 3NOXA 1PNQA 2XJ4A 1YKSA 2D0DA 2ZB8A 3EZXA 4NOLA 4NLZA 1U7TA 4UOEA 3O8DA 1INLA 3L3BA 3GB9A 4KQ2A 3A1TA 5J2TB 1COKA 1UK8A 4OFBA 3MD9A 5KTTA 4MVJE 5ICCA 2F8LA 1DQNA 1DMSA 3F9IA 1L5RA 4MW4A 4WGGA 1TJ3A 5E2IA 4MW1A 5FOVA 4TRMA 5EMHA 2V7QA 1VSBA 3LD9A 3S8EA 1VLQA 1ILWA 1PT7A 1Y89A 5JNSA 3DFZA 5DGDA 5M29A 4DSAA 1XTBA 1QFSA 3RROA 3GELA 3M6IA 4F96A 3FE2A 3OTGA 2CCJA 5DYIA 3BQ2A 4LZJA 1GKIA 3FOFC 2Q5JA 1KDVA 4KK3A 2BPCA 4RTNA 2QUIA 3L3FX 3INRA 1UOEA 2MUTB 1PK3A 1AB6A 3HXKA 1SUPA 1XEWY 3OE5A 2JV3A 2CUZA 3PQCA 2GBGA 3BS5B 1E3TA 3IPYA 2EOAA 3SS9X 2B8WA 5GTIU 1TMGE 3L6BA 3DLTA 3CUWA 3NPAA 3S1AA 4BGUA 4RK5A 5FEUA 4CZ2A 2PGDA 1CUCA 3Q3JB 3COPA 1M8GA 1TF2A 5J9FA 3FLMA 1E2NA 1CUWA 4TZKA 4LHWA 5AM3A 1P9LA 3PITA 3RHTA 5KQLA 3UJBA 4U9IS 2BBWA 4ZICA 1EK0A 3CTPA 4A8JA 5DN6D 3Q7SA 3GN1A 1NNEA 2QVZX 4TQGA 2B1RA 5I7FA 1MAHA 3RIMA 3LOUA 4X1OA 5BW4A 4KLQA 3HNRA 4TUYA 3PENA 4RA9A 2R68A 1QV9A 3O8NA 5AVRA 4CIXA 3BWCA 2W04A 4DG8A 3ABQB 3KKPA 1NG9A 2AUTA 2C4VA 3I5YA 3L0CA 3RK0A 2Q5HA 2XADA 4G1BA 1HFJA 1L4FA 3LGSA 3L93A 2YZKA 4Q9IA 1FX0A 2CLEB 1PEKE 1ZJYA 4YNBA 1KH1A 1LK5A 3IQEA 3JYPA 3SFTA 2BTQB 1OVMA 5FNVA 2C42A 2BH2A 2WIKA 1EWVA 2O3RA 3ST7A 1XHEA 5KWVA 3WYBA 2F3SA 2H3VA 3HP1A 2BQ3A 5B55A 3T54A 1ZD8A 3AEUA 4K0RA 5FJIA 5CEEA 3FF4A 4M9SA 3TYXA 1KO4A 3C8MA 3ISTA 3KWJA 2Z56A 5ESDA 3F6BX 2H1CA 4WLOA 5CD1A 1KFKB 1NUAA 4GPEA 3OEHA 5FTLA 1U3DA 2XGPA 3W4KA 4DL2A 4YAEA 4KFRA 3AXTA 3OEEA 3PQ7A 2HDHA 3OETA 4O9MA 4N41A 3DMYA 5JS1A 4E4RA 4R41A 1CE8A 1EQAA 1B6GA 4OGWA 4BGIA 3VM6A 4J91A 1X1SA 1F38A 4LI3X 3UGQA 3WJ2A 5IT4A 3LPNA 1Y4UA 4MJLA 5L1MA 2I78A 1LJUA 1X86B 1Z63A 1K5HA 4KXLA 1XXHE 1V11A 4IIJA 4DDHA 5KVQA 1TZJA 1BWSA 4EW6A 3B3FA 4TLBA 4FONA 1UJ4A 1K98A 3O2JA 1BA3A 5LFAA 3ZJYA 4YCAA 1UZAA 5K2OA 3O73A 1UFOA 3RTVA 5HZGA 4RD2A 3KZCA 4BN0A 4EEYA 1F6WA 4QARA 1PAUA 1RKQA 3RU2A 4EELA 3Q9LA 1VL6A 4I50F 1CZLA 4M99A 1ZMTA 5CFLA 4KODA 5CB8A 3ZUPA 1NW8A 1D2GA 1E99A 3AH8A 3ENVA 1R4NA 1FLVA 4K9PA 1K3FA 1H66A 5C5CA 4IMRA 1PN3A 2RGGA 2OK7A 4NU6A 2FPIB 1R6AA 4X62B 1YONA 5SY9A 4JLUA 4YAWA 5AJVB 3ODPA 1C9EA 4X64B 5BT9A 1SV4A 4X9XA 1AUPA 5FWXA 3TE7A 1GZVA 1H1DA 3KT0A 4I3GA 2H17A 1Z7YA 1NYTA 4IVPA 3BREA 4BLOA 2VUHB 4X6YA 4FUQA 1CDDA 4MS1A 2ZIZA 4UZEA 2ZEJA 1NF3A 4KLRA 1OW5A 2Y1EA 2HRQA 2H9IA 1KRPA 4CF5A 1TM2A 2IPAB 3RRXA 3ZTTA 3ZWWA 1LFDB 3H3XA 3ESYA 3RGWS 5EXPA 2I1QA 4HCJA 3AKEA 2DC1A 2TYSB 2X1MA 3EWIA 3FDZB 1XKQA 3NG1A 4CEJB 4UNSA 2WG0A 4R9VA 2X2OA 4M0UA 4LPKA 421PA 4PJ0U 1LV5A 4BGEA 4GYKA 3D3WA 3E58A 5JO9A 1SUEA 4UAJA 2L2QA 4IL6U 2JK1A 2GMWA 1RWQA 3BXPA 4I08A 4IDOA 3WYAA 1KY5A 3B6KA 1TTQB 3AP3A 2E3JA 2WF8A 2DUMA 5H81A 1JMSA 3H1EA 5U4QA 1YU6A 1JH9A 2C7VA 3K9BA 4YMVA 1YS6A 1XEAA 1K3TA 4YG2A 1ZYUA 3KJEA 3OM1A 4G5GA 3O0DA 4XVCA 5HQTA 1T2DA 3GMIA 2H16A 9ICAA 2QRVA 3VPGA 3A6LA 4IQFA 1M34E 4HGNA 5CNJA 3SQLA 2GKSA 1FTGA 1PK7A 3R6WA 1NQOA 4YH1A 1KF0A 3F7OA 2BBOA 3KFLA 1OI3A 4AWXA 1XNJA 2F77X 5E9QA 1ZQCA 4AJIA 3JD3A 4O3FA 1W2WB 3PUKA 1W85B 3CEMA 4QHTA 3MYRA 5C7IO 4IDFA 3R7BA 3ZJ4A 3ZWYA 5A7HA 3D1VA 1OFUX 2IY8A 1YS1X 4B6RA 1J2RA 3UCEA 5CU7A 4HDSB 4UHBA 4D3DA 1OGIA 2ZBFA 2PZAA 2WHRA 2BGJA 1XDSA 1EWRA 3OOHA 3SAGA 1FVFA 4YCXA 3OZRA 4PC3A 1ZN8A 5PNTA 1NF8A 5F9LA 3O4HA 3HUEA 4HN2A 3TPFA 1ODCA 4EGSA 4J6EA 1Q1NA 4F9EA 4FQ8A 3FTDA 3ULKA 1GLVA 1NKBA 1I30A 5GTDA 3N76A 2AOUB 3NKFA 5I9TA 1I5OA 1V7ZA 4AP5A 1FFUA 4QZ9A 1A98A 4B3IA 1JR3A 1G21E 5FWDA 9ICRA 4HDNB 4DA6A 3LPCA 2ZXUA 2IPXA 4XVHA 4FIDA 3JRXA 4CIBA 2YHIA 2B4YA 4QXOA 5D5HA 3WRXA 4TURA 4Q9AA 2VZ0A 4JL8A 3P8ZA 5FLYA 1LD3A 3KUUA 3OQ1A 1DCKA 2KJQA 3GY0A 4DQQA 4Q37A 3TFOA 4F2SA 3UUGA 4O25A 3W2TA 3OICA 1YB2A 3VR1A 3KUCA 1YDEA 1ZW1A 1E9BA 1ZKMA 4IF4A 4KEAA 2Q4EA 1DC7A 5I4CA 2XUIA 3GP3A 1NMXA 3PHHA 2RGXA 3VHXA 3C7TA 1P19A 5JARA 3MCWA 1A3CA 3G0BA 2VNAA 4I2EA 4YR9A 1C1XB 3H2JA 3VOSA 5EXSA 4DIDA 5A5VA 5JOQA 1UMCA 2ZJBA 5DDMA 4C8NA 3Q72A 1TIKA 2PS1A 5AYVA 2OCKA 4PYRA 4MEXA 3O2SB 5CRXA 4EVRA 2O23A 5H3LA 4C80A 1DEOA 4EPTA 2AH5A 4CQMD 3JZFA 4HYTA 3KHLA 4CTNA 4LYJA 3EIQA 1YS7A 2A0XA 5KYUB 3EXHB 4LOHA 1ZO8A 5HQ3B 1BVSA 3RJHA 4LDPA 2PRYA 4X63A 3F6EX 4XPIA 2X14A 4QELA 4R1TA 2GHRA 4MITA 2BD0A 1UBMS 4X60A 5JCXA 4O4IF 1VMKA 5SZHB 4V0OA 1OAOC 5JQGB 1W7AA 1I3KA 2IH5A 3TEFA 4MI3A 1E4EA 2WTNA 3WB9A 2C96A 3VKUA 3NAQA 1K5PA 1W0CA 5DK4A 4B74A 1LPPA 3UH1A 3PVCA 2QENA 4UBIA 3O1JC 1PD0A 2FEOA 2PFOA 4ZFNA 3ZZMA 3ZJ5A 2E55A 3DZJA 3WGUA 3FPJA 3B2QA 3RFXA 4LRTB 2W6OA 3GNQA 3U4QA 3QA9A 4EB6A 3FOBA 4I3HA 2JMGA 1QLHA 3K4GA 1AQYA 2W6PA 4EY6A 1N2CE 1S77D 5GQSA 4KTQA 1KEWA 5DGCA 4TKLA 3I64A 4MQBA 1ESMA 5FUWA 2IYZA 1FMTA 1EP2B 3P0JA 3ET5A 2VPYA 4OI0A 2WG1A 3RASA 3HW8A 4QD3A 3S8YA 3K73O 2QP4A 2VUSA 4A73A 4UCXA 4UQOA 1J8MF 4MVJG 1BTOA 3BS4A 4LTNA 4TQAA 3UW1A 2JDIA 2X1VA 3A9SA 1MN8A 4LHVA 4IQ4A 2WFLA 3H7AA 2YZ7A 3A9TA 1Y6RA 2O1XA 3ORQA 4YCLA 3FX2A 2ENUA 2QD3A 2GZSA 5H5JA 3V8PA 3A1FA 1E2UA 9LDBA 4MAFA 1KDHA 3D31A 1YJXA 1OQAA 4BFUA 3GLIA 3EGEA 5EHZA 1DIOB 4ZYLA 1BHSA 4JBNA 2F55A 4B1FA 2OYRA 2HJHA 3GPIA 2P6UA 1L5KA 1S02A 3WGYA 2BDPA 1NT2A 3KL2A 4XQCA 1RM3A 4N3CA 2AHOA 5M7EA 3MB8A 3PHCA 4IKOA 2J41A 2O2GA 3BRWD 3ZUGA 4KLZA 2XA2A 1RLMA 4M0MA 5J2IA 4BZXA 4B4VA 5B2FA 2Z5VA 1EDBA 1RRVA 2JNWA 2VOEA 2JJ1A 5BSHA 1VJCA 2J3HA 2X6QA 2N42A 3DZIA 3MTQA 3HH8A 5FA6A 4M38A 3QU7A 2V9CA 1CQIA 1WCYA 3EQ9A 2ZTMA 2OORC 4OX9Y 1XFAA 5TEVA 3KKOA 4S05A 3G0IA 4FYMA 1QFJA 1D9ZA 4TTTS 4LOIA 5IBCA 3UK7A 2GRAA 1ADBA 3LQRA 1DIGA 2I4RA 5B4TA 4KBYA 2Q3MA 3ROTA 3WWZA 4O63O 4TMXA 4Z3KA 1SG9A 4YAOA 2CBZA 3TZBA 3IT1A 1WXQA 3WLLA 1X70A 1OMOA 3UPUA 1LPMA 3UQ0A 3EPJA 3WQSB 3L9WA 4CG3A 3F8SA 2OV2A 3I61A 1F7UA 4A8EA 4DW8A 1ONNA 4ND7A 5TQVA 1NOJA 2GM3A 1PSWA 4FCTA 3T8YA 3T3EA 1N56A 2EV9A 4GG1A 5FOXA 1F1BA 4HB3A 1DRVA 3ZLVA 1KK2A 4WECA 1JF8A 4NH4A 4OLJA 5FFMA 1Q91A 4KMMA 2P67A 1Z07A 1T24A 1K8XB 1U7WA 4QYWA 4Z4HA 4JBLA 1TO6A 5K8UA 1IEWA 3KS9A 3LC2O 3ZNQA 4WOJA 4PTYA 4MKHA 5C1BA 2PKQO 3OG9A 1NVBA 3ONEA 2Q29A 3LWBA 5E4YA 1WV0A 5F98A 1LFAA 4NYIR 4ZAXA 5BN3B 1VIAA 4BS9A 1K63A 1IFXA 2LXNA 2WR8A 4ZQHA 4XFDA 3GQVA 5E1MA 1QSGA 2W8LA 2V65A 3MC1A 2XZOA 2NT4A 4BFZA 5J47A 1FMJA 1NJFA 1OYWA 1E9EA 2AMVA 5FBHA 4PR0A 4B84A 2O3QA 3EMBA 4GFJA 4Q4AB 1SV0C 1HPLA 2HUPA 4A0FA 2YHAA 3E4DA 1CG6A 2C9BA 3PDJA 1M5RA 4HH3C 3CY6A 5DNEA 4MUFA 2ON6A 1W25A 1MO2A 2QN1A 1SXEA 1VG8A 4BPRA 2HHVA 4FCCA 5BURA 4B9MA 3UK0A 5CBKA 5C37A 4ZMBA 3RUFA 5H1YA 2PQ2A 5TY0A 3LBYA 1JHRA 2GYYA 1YOBA 1FK8A 3O2QB 2WTFA 1BW9A 4FNAA 5AO9A 2XRMA 4N0MA 1I7DA 4OLAA 5AM4A 4PFKA 5AKZA 1KVRA 1WNTA 3RC8A 1YDFA 3SIRA 3EIFA 1PUJA 1TV9A 1HDCA 2JFFA 4K8RB 1CDOA 1RYRA 1KKXA 1AVTA 4EHHA 3CG0A 5GIPE 3GJ0A 5B3JC 3W1WA 5KT4A 4JR1A 1E4OA 1OROA 3KRTA 3U3MA 3UJ9A 2FHPA 5CLLA 3TKYA 3WIUA 1POWA 1G60A 1Y7IA 4AMVA 4LV8B 2IEGA 1EMDA 1XDDA 4GRDA 5EP3A 4KLHA 4EUKA 1THGA 1F8XA 1KYQA 1VRCA 1Z2OX 1GRCA 4UBBA 3BQNB 5BR7A 3KTFA 2HCBA 2JLZA 5JZBA 4MZDA 3N6XA 1T1GA 4WOBA 2NP6A 2XICA 1QG0A 5BWBA 2X5OA 1UP4A 4E7OA 4DLRA 4OP2A 1M5TA 5ITZA 2V9PA 2C2OA 2R8IA 4KSYA 2A35A 4Y2SA 2NZWA 1M6HA 1TRKA 3OU6A 2Q0XA 3D5TA 2GR9A 4BWMA 3QQ5A 2NRWA 4H59A 1JKFA 2HSZA 1E0SA 4QO8A 1XAHA 4KN9S 4K9OA 4MMZB 2H0RA 3EZ7A 3THWA 1PLJA 4IHJA 1RWKA 4QICA 4FHDA 1GADO 1P7VA 1Y8ZA 1XQXA 5JYBA 5CDHA 2K7ZA 2IUFA 1FJGB 3TMAA 3USZA 4RTMA 4ARAA 1PFYA 5CVUA 3GGPA 1H05A 1UZNA 4L9SA 2XUJA 4CF4A 1X9XA 1SL2A 4ZXFA 4RNCA 3K09C 3ICCA 1G5FA 1TRHA 1ZCZA 1ADGA 3EEQA 2OMKA 1ZIPA 4TWAA 1Q17A 3NHFA 2BJWA 1E89A 3COVA 5BN5A 3RAQA 1BU8A 1QVAA 1SB8A 5CM2Z 2IS2A 3NALA 3IKLA 2IZOA 2PM8A 5EIEA 1C20A 1D8LA 1TVKA 3AX6A 4ZIRB 5KSOA 4LJAA 1PQYA 3OQPA 3A6ZA 3R8XA 1IPHA 3WA6A 1MZVA 3AHJA 3MGBA 3F3SA 1RYFA 4HAUA 3RCBA 4JC8A 1U7HA 1MA0A 1WO8A 3QVVA 1CVIA 2AHRA 1T6BY 1BO6A 2KHQA 2W6CX 3WBBA 2YN4A 4U4AA 1ZGHA 1JA1A 3VFDA 4CKCB 2BKXA 3O8OB 2BN4A 2RDJA 3DCJA 1AXRA 3IB3A 2Q8PA 3JASB 3ZVRA 2MCFA 4A23A 5JWOA 3B1YA 2PBFA 4UMFA 2GJ8A 3AW8A 1CZRA 4UBKA 3RTCA 2J6TA 3OP4A 2AGOA 4I5FA 3WGKA 1JN0A 5DSZA 4FFMA 2Z6UA 1RQPA 1KNQA 2OZVA 2XUOA 2IHKA 3RC1A 1J09A 4K6CA 5AVZA 3LK7A 3K9NA 4EBFA 3TQIA 2A5GA 2OXFA 2Z04A 1RWNA 3FNEA 3NC4A 5BSVA 2RGCA 5U4XA 1RQNA 4DQKA 2VWQA 4S35A 4ENRA 4YHHB 3PXUA 1P7CA 4XWAA 3B7GA 2V9ZA 1O2DA 4EPXA 4YT8A 1YS9A 2REQA 4L3OA 3AUYA 2GWHA 2AG1A 2ODNA 1JVSA 1SBYA 2QSYA 2HZ7A 3QFRA 3I9LA 4PC7A 4ZAZA 2TECE 5J2FA 3V6LA 3LUBA 5E7IA 3D8UA 3U3ZA 3O84A 1NRIA 2UVPB 3L7NA 1XZ8A 1EK6A 2AOTB 4GRAA 4G97A 2V6JA 3L0IB 2HHTA 3VNSA 3A6DA 3LWNA 4EHAA 4Q18A 1M1YA 4GC7A 2IZ7A 4I55B 1GIAA 1QIGA 1CS4C 5DHFA 3FSRA 1YRWA 3RVJA 4PIMA 2RHOA 3E9DA 1MGOA 2J7KA 3MB5A 5ALIA 4U2DA 1YBFA 3F4KA 5EY5B 3PICA 3TBKA 1ZQ1C 2PQMA 4DIMA 3KP1A 3QOXA 2GNPA 4EL5A 3T4XA 3P0RA 1F06A 2QV0A 4D4LA 4BCCA 5F2NA 4HI0E 3QITA 2AYYA 1F6BA 3JSAA 3S1LA 4M1TA 4I4NA 3LE8A 3G2LA 1UCFA 3AI3A 5I8WA 3M9LA 3NETA 1OY1A 5BXQC 4CG2A 5ALNA 2YTUA 3Q0TA 1FYEA 3B13B 3HCEA 4E3WA 3GPCA 1MW9X 4C0WA 1KQPA 1WCIB 1I4DD 1JFFB 1RXYA 4DFPA 1EE2A 1GO3F 1NJZA 2WOOA 1IN8A 5CIWA 3GJTA 1R5BA 3PE6A 1N2JA 5BQPA 4YCMA 1V1MB 3M7DA 2BCRA 3TOVA 4EB0A 3HB0A 1GSIA 4D0RA 1RLIA 2I6XA 1YL6A 4H7FA 4OQPA 4TMZA 1W9HA 5FHRA 2I91A 2B4TO 3PX0A 3ZHUA 3TK1A 1P5RA 3COWA 1D07A 3K9QO 3BGSA 2ATXA 4MQEB 4R84A 2FY8A 4QJ4A 3PX7A 4TRRA 3MWKA 1Z82A 1WVIA 3P2YA 4L7VA 2GERA 5EYPA 4ZCTA 3QFHA 3HR7A 1IHYA 3WLFA 5MN6A 1XZQA 2WHPA 3S2YA 4B9NA 1T8PA 5E95A 3U56A 4KKVA 9ICPA 3VUEA 1XYGA 4BXOA 2J85A 3CNBA 4P4GA 4COOA 3C6XA 5FTJA 3RH5A 3KBBA 2BTOA 3VYRB 2HDWA 5HFNA 3ENQA 3FMGA 3MMSA 1DJLA 2FV8A 4NCNA 4I9HA 3TD9A 4AJ2A 1PKEA 4AJJA 1JB1A 3CJQA 4KSBA 1QFMA 1YULA 4KPYA 4LZGA 1O6GA 4LZZA 1IVNA 3HCNA 3HVKA 1KOJA 4FFRA 3VX3A 4YAKA 2O2HA 2OGWA 4ZI3A 5AW9A 4BMOB 5L7YA 4EYIB 4FHCA 2DBRA 5LQJA 1N5LA 3BH7A 4YT2A 5CT9A 2OL4A 3T5TA 4QZBA 5LLDA 3AZPA 5J4VA 2FPPB 4JEIA 5CNMA 5FKJA 3OZ7A 3LHFA 3RS5A 2EZUA 4Y9RA 3KOUA 1AURA 3KVYA 4ZEWA 2RGNC 2JFOA 4X5VA 2IYTA 1T9GR 3TQOA 2HX1A 3JPYA 4M9JA 3BMCB 2CKDA 2VPXA 2W9AA 2CV2A 4RFSA 4F4FA 3FUVA 4ED1A 1E4YA 8LDHA 1P2UA 1JDNA 2CLDX 5LWHA 2F3NA 4PZDA 4TKMA 2XJ9A 1L3CA 5BWOA 1J07A 4IV8A 1AKNA 3RYFA 4Q7JB 4ZYYA 3D3JA 3GLHA 2JGEA 4ND8B 3KR2A 1VRVA 2BKLA 3T3DA 3ZJVA 3BYZA 2WKSA 1ODSA 4IOKA 2W0SA 2PUCA 5IBRA 2PZKA 4WFKA 4MVJA 5ICSA 3IIMA 4HNGA 4YB8A 1IJKA 4TLLB 5G40A 3DUFA 4PV7A 4X7RA 3M49A 1BWQA 4BNFA 2ZUBA 2WY2D 3URKA 4KLJA 1NY5A 1VIVA 3DTVD 1ZESA 1CP2A 2YIMA 4AUNA 3IEPA 1E6KA 1ND6A 3ZTYA 4YJ2B 3FPLA 1XDWA 1U3UA 1GPLA 1KOFA 1M3SA 4A8JC 2VRNA 1HBJA 2H51A 3UAWA 2XODA 1P2TA 2QY9A 3LBIA 3AVXA 4J0KA 1MOQA 1V1JA 4U3JA 1ULHA 4JK3A 1L5OA 2IQIA 3CPSA 4GLOA 4RJIA 1CYDA 1WY7A 3A4YA 2EZTA 4TKUA 3VU0A 4LGYA 4ZZ0A 3O5AA 4LJ8A 9ICUA 4N6OA 4WY2A 3EEIA 4Z1MA 5JCPA 4B85A 3GRYA 3PUJA 5K0FA 4PHAA 1E18A 2H1RA 2PAFA 1NZDA 5DRTA 1XEWX 2FUG1 4JJZA 2KHZA 2V4MA 1KKMA 4J07A 3LT1A 4NDAA 3FPCA 3RYIB 4B3FX 3MT8A 2X3UA 1NV9A 3HUFA 2WU8A 3F5FA 4EJSB 4C0BA 2QTAA 5DCWA 4CF6A 1FIUA 4K4GA 5I45A 2HMTA 3CS3A 1G20E 4Q19A 3O7MA 1K9SA 1V2HE 3SXJA 4CT0A 3W5CA 1MB9A 4DM7A 1RMTA 3BBPA 3NRBA 5KNCD 7GPBA 2H1VA 3OT1B 3JD2A 3MRXA 1A69A 3GUCA 5BV8A 3ELUA 3QKSA 4X8OA 1FCJA 2I7XA 3OH8A 3R41A 3TRKA 2DL0A 2Y3IA 4C0QC 1QYWA 2HU7A 2YHUA 5D3MA 4HYKA 2FE9A 4TMTA 1T9ZA 1OWOA 7ICIA 1KOGA 2EJVA 3QE0A 1V3VA 1ZC3A 3NKVA 2E4XA 4F85A 5KNDH 5DIZA 1MX9A 2Y66A 4G1CA 4RDXA 1O6FA 4LEIA 1DXQA 4YGYA 4EPYA 4BZZA 1GR1A 1IHUA 1RWMA 1WHSA 2IHNA 2Z95A 3CWZA 1W73A 5KTPA 4WH0A 4GKKB 2QRPA 2WBLC 1NKTA 2GGSA 2D3WA 3GHHA 3LUHA 1GAXA 3N75A 2Z6AA 4UTPA 1WXFA 4IH1A 4QT0A 4HSGA 2XYGA 1EG7A 4ELUA 1K6JA 5BW8A 3OFKA 1IY1A 5ALYA 4DSFA 2YX8A 1UDWA 2EWMA 2H4FA 3UKJA 4PZYA 3DOUA 2QN3A 3RRFA 3CCCA 1LBTA 1GFIA 3VA7A 2HA4A 2C5LA 2UYCA 1NXPA 1ZVMA 1R0BA 1U9YA 3AF5A 3CZ9A 2CUNA 1P45A 2RGRA 1UMBB 2YIDA 3KT8A 5JC8A 4QYXA 1YFJA 5E79U 1XXHA 1FJXA 3AUOA 1U2PA 4CCWA 4BASA 2G1KA 4AUKA 3TFQA 3OIGA 1JAIA 4R8VA 1SL0A 4Q16A 3P20A 1V4NA 3VGJA 3OCXA 3FHJA 3IP9A 5HEKA 5CAEA 3V8BA 1XGKA 1YJ8A 3NHLA 3MJ4A 1LTQA 3H9JA 3O1HB 4QPCA 2PAAA 5EUMA 2F3PA 3KYDB 1NK7A 1N9ZA 3OLYA 5L51A 3E4CA 3RQIA 4UMDA 3AHFA 4IG9A 5T5QA 4ZQGA 4WZBB 1Z17A 1P7WA 1KI3A 1T8EA 2JIZD 4TQSA 4DV3B 3R5TA 2NQ8A 1O58A 3H5WA 4ALNA 4JITA 4CKWB 3O9MA 4XVUA 1FUUA 3KZNA 1EINA 1RYUA 3JYLA 1NVVR 1ZK4A 5DBFA 4ZH4A 4W82A 5MF6A 5KO2A 4E5KA 1N5OX 4A2PA 1K27A 5KFZA 4M1QA 1RXWA 1HM5A 4BC1A 4OF4A 4AROA 3LS2A 3FZGA 5FI3A 4AN0A 1Z7GA 2Z8YA 3HGMA 2FW7A 4BJ5A 5IZ4A