2JGAA

Crystal structure of human cytosolic 5'-nucleotidase iii in complex with phosphate and magnesium
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRRKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
publication title Crystal Structure of Human Cytosolic 5'-Nucleotidase II: Insights Into Allosteric Regulation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2jgaA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jgaA01
5ALKA 3QU2A 2C8KA 3AR2A 1T5SA 4UARA 1L7PA 1PW5A 1U2SA 2EATA 4EZEA 5AVZA 2FUCA 4J03A 1JUDA 2G06A 2AMYA 4RETA 3L8FA 5FP0A 2B1QA 1ZJJA 1TJ3A 1WZCA 4DW8A 5AVSA 3OCVA 2I6XA 4F72A 2BY4A 3WK7A 2B8EA 3QU7A 3M9LA 2W4MA 5A3QA 1TJ4A 2X4DA 1U2TA 2BDUA 3NANA 4FYPA 3I1YA 3OPXA 3OCZA 2VKQA 1EK1A 4NFLA 4Y2JA 4IFTA 3QNMA 3PGVA 4L6CA 3F9RA 3KOOA 2IOHA 2HF2A 1QQ5A 2HHLA 3I76A 3MPOA 3L0CA 1NF2A 3QX7A 2IOFK 3NIWA 1L7OA 4UMEA 4BNDA 5IT4A 2WF7A 2HCFA 1Z5GA 2JGAA 3D6JA 1NNLA 3W5CA 3WGUA 3EF0A 3EWIA 2IYEA 3B9RA 3FZQA 3CZ4A 3R4CA 3ZX5A 2GHQA 1Z5UA 4XPZA 5ALXA 5AW5A 4ZEXA 2W11A 4YH1A 1MH9A 2B8JA 1RC8A 3QU5A 3L7YA 1SWVA 2GHTA 3L5KA 3SD7A 3WKAA 5AIBA 1QYIA 1XPJA 2HO4A 5ALLA 3FPBA 2RBKA 1L7MA 1NRWA 3R9KA 4BEVA 1Z4KA 1O08A 2C88A 3N07A 4I9GA 1X42A 4KYTA 3WK5A 5ALTA 4IG4A 3UMBA 2HEGA 3PGLA 1RMQA 1T5TA 2B82A 3K1ZA 5AKEA 4HYTA 3L0BA 2D2VA 2IOFA 4YCLA 2R8XA 4B6JA 2B1RA 5ALMA 2ZBEA 2FPUA 3DDHA 1J97A 5AM3A 2YN4A 2MSNA 4Y2VA 2R8YA 3QU4A 4OFZA 1XVIA 4FE3A 4ZEWA 3SKYA 2WFAA 5ALEA 4EENA 4UMVA 3WKDA 1KYTA 1YJ5A 3FM9A 2YY6A 2I54A 2RARA 2ZXEA 3ONNA 5AVUA 2PQ0A 2PKEA 2P69A 5ALVA 5AW4A 2GFHA 1L8OA 1ZS9A 3QLEA 4NV0A 3E84A 5AW0A 3E8MA 2NYVA 3NAMA 3OCYA 4UASA 3HLTA 3B9BA 1ZD2P 2RAVA 1RLMA 2YFYA 4ZEVA 2G07A 1Z4LA 5AI6A 2G80A 5AW1A 4BKMA 2RB5A 3EF1A 3KD3A 2ZOSA 3N8GA 3OTQA 5AVVA 4NWIA 4OCZA 4C4TA 2P9JA 2WHEA 2FEAA 1QQ6A 3L8GA 2IA5A 3AR3A 1VJRA 2O2XA 3L0YA 2YJ4A 2Q4TA 2ODAA 4MUMA 4H1WA 1RMTA 1RDFA 1Z4NA 2YJ6A 3FPSA 2B30A 2YJ5A 2G0AA 4UW9A 4J2TA 4DWOA 1SU4A 2P27A 4HAIA 5AI4A 1Z88A 4JDPA 1ZD5A 5AIAA 4BEWA 3U7GA 4EX7A 4AP9A 4Y2SA 3NASA 3QGMA 1EK2A 5AW6A 4Y2XA 5AM5A 3WK8A 1TE2A 1ZRMA 1S2OA 4BBJA 1RKQA 1AQ6A 1U7PA 3WK4A 4DFDA 5AVRA 3MC1A 3J7TA 2B0CA 4C4RA 4HGPA 5AKZA 4Y2UA 3ZTWA 3ZI4A 3W5AA 2Q5EA 4HGOA 4BYGA 2OBBA 2YMQA 1YS9A 2OA0A 2FPWA 4UM7A 2WM8A 4GIBA 3WKCA 3ZW7A 5ALPA 2FUEA 1Z4IA 5IS2A 4CE6A 2PR7A 1U02A 5ALQA 1N8NA 1VFPA 3QUBA 5AVTA 3OCUA 2YMPA 1Z4OA 3QYPA 2GO7A 3U19A 3L8EA 5ALWA 3ESQA 3OCWA 5AI0A 3QXGA 5AKJA 5AVQA 3M1YA 5AKKA 1LVHA 3MN1A 2EAUA 3DNPA 4CNQA 1TJ5A 2CFSA 3ZVLA 3S6JA 4F71A 1Y8AA 3A3YA 4XOUA 4Y3UA 3AR9A 5AW9A 3ZVMA 2ZBFA 3AR5A 1ZRNA 2WF5A 1YNSA 2P11A 5AK5A 1SWWA 2YMMA 5AK6A 1RLTA 3AR8A 3NALA 4UATA 2HOQA 3RF6A 1T9ZA 4Y2YA 2EARA 2ZBGA 5AICA 4Y2RA 4BNDB 2OYCA 3VAYA 4MWOA 1FEZA 5AESA 2I7DA 4KNWA 3BWVA 1Z4MA 2I55A 2MU1A 3ET4A 3TLMA 3QUTA 2HX1A 2QYHA 5AW3A 2OM6A 1Z4PX 3AR7A 1RRCA 5AI5A 5AW8A 2NO5A 2YMLA 3ZWDA 3ZTYA 2JAUA 4Y2QA 5E0OA 3E81A 3FGOA 2C9MA 3E58A 3N28A 5IT0A 4C4SA 3WKBA 3R09A 4UU1A 1TA0A 4UMFA 1ZD3A 3SKXA 3PDWA 1L8LA 3CNHA 4HGQA 5ALGA 3U13A 3ESRA 2FPSA 5ALJA 4XE5A 4KX5A 2JAOA 3DV9A 2FPRA 3HYCA 4KNVA 1K1EA 3QU9A 2HSZA 1QQ7A 2AGVA 4UAVA 3A1CA 5AM2A 5AKXA 3ZVNA 4UAUA 1CR6A 1F5SA 2CFRA 2QLTA 1U7OA 5ALIA 2FDRA 5JJBA 1XP5A 4UM5A 5AW2A 5ALZA 5AKLA 3A1EA 5AKYA 4EEKA 1RKVA 3KC2A 5AHXA 3U7EB 3L1UA 4EX6A 4NABA 3W5DA 4FFDA 5AM1A 5T41A 3ED5A 4HGNA 5AK3A 1IWOA 1Q91A 5AKGA 4EELA 5A3SA 2HDOA 5ALNA 1ZD4A 2C8LA 2R8EA 4BX0A 3AR6A 5AKHA 4UMDA 3UMCA 3U26A 1RKUA 2CFTA 5AVWA 1L6RA 3UMGA 4JB3A 3P96A 3B8EA 5AVYA 5AVXA 2HI0A 1WVIA 3SLRA 2O9JA 1RLOA 4CF4A 5ALRA 4Y2TA 3U7HB 5AK4A 3AR4A 1Q92A 5AI8A 4I9FA 3ZX4A 1LTQA 3L8HA 4G63A 4NAVA 4QQFA 2I34A 5ALFA 3ZWKA 3WGVA 5AM4A 5ALUA 5AM0A 3BA6A 1YMQA 1L7NA 4QJBA 4L6AA 2Q4RA 2YJ3A 1WR8A 2JAWA 5ALSA 3WK6A 3WK9A 2I33A 3IRUA 2FI1A 3IB6A 1Z4QA 1YDFA 4UU0A 1QH9A 2DQSA 3MMZA 4E88A 4XQ0A 4DCCA 3QUCA 3ET5A 3SMVA 3PCTA 2ZG6A 4GXTA 1N9KA 3A1DA 4HGRA 4BX2A 1VJ5A 3SHQA 2YBDA 1WPGA 4BX3A 1RQLA 2CN1A 5ALOA 3IJ5A 4YIKA 5ALDA 2GMWA 4L57A 4CF3A 3SF0A 5AW7A 2C4NA 2NO4A 2W43A 4RESA 5ALYA 3N1UA 3RFUA 4CF5A 5AKIA 1O03A 3I28A 2WF8A 3KDPA 3ZU6A 3GYGA 2WF9A 1CQZA 1J8DA 3L1VA 4KX3A 4YCNA 3N5KA 2G08A 1ZOLA 4YGYA 5A3RA 4OHFA 1RPZA 4PNHA 2BDEA 4O8CA 2JARA 2G1AA 1S8OA 4Y2PA 3WKEA 3I6BA 3KBBA 4YIHA 2WF6A 4AS3A 3EPRA 4YCMA 4KN8A 3DAOA 2FPXA 1YV9A 2HF7A 1Z4JA 1RMYA 3UM9A 3U7FB 3FVVA 5AI9A 2AH5A 2G09A 4OD0A 3KZXA 3ZUPA 3QUQA 3W5BA 3NRJA 5ALHA 3OCXA 2R8ZA 4G9BA 2ZBDA 4AS2A 3NUQA 1RQNA 2AUTA
chains in the Genus database with same CATH superfamily
5KPDA 1QHHB 4KVGA 4K03A 4UCFA 4ED7A 3WTBA 1NBWB 3H3XA 1PK8A 3DLBA 3KJZA 3V4PB 5JZSA 6AT1A 3MWFA 3WHIA 1LJLA 2J7KA 4UNRA 2JDID 3TCKA 5K8LA 1I36A 2ODEA 4E5KA 3Q5DA 5AXDA 3DCJA 2E48A 1SVMA 4RA6B 4V0QA 5FWXB 5J1TB 3RJKA 2N0SA 5DCLA 5B1IA 2XODA 2OUIA 3QBDA 1WDWB 3OT1A 3IKVA 3LCJA 1GPYA 4O4HB 2HRZA 2OHHA 4UEJA 3QOFA 4UAJA 1QYIA 3LC0A 3STHA 3IIKA 1H3FA 4IZHA 1SNYA 3LXMA 4G1EB 1GNLA 1XG5A 5IZ4A 4IFEA 4B32A 5JRDS 1YZQA 2DB3A 2VKTA 2H52A 2OO5C 2VUTA 4B6JA 4FI3F 2EAPA 2BJWA 5DQGA 2X14A 3FNQA 1PW7A 2OHVA 3EEYA 4OFZA 3ZWXA 4UAWA 3ONNA 4D42A 4TWJA 3ZW9A 4YONB 3E70C 1N36B 1FLNA 1G3MA 4FJ0A 3INTA 3P4UA 3ZJ4A 3TTTA 1ZQ9A 3EJWA 5DDYA 1VZ3A 2BQ3A 1HQYE 4A27A 2FY8A 1NOJA 4DA8A 3WFIA 1E2MA 1TPYA 3K71B 4RQ3A 2C2OA 3FPFA 1QIDA 3FPSA 1Q0RA 4PZDA 5J5AA 1KJ8A 4RPGA 5CGZA 4BJ3A 3SI8A 3R0XA 2CHQA 3NEPX 4ZYVA 2WE8A 1KETA 1HM5A 2GN9A 4C1NA 2C0PA 5DGAA 1K1QA 4C6TB 2XNJA 3NDPA 3BICA 3EEIA 5C5CA 1YZGA 2JIMA 4UOQA 5I51A 4RZIA 3QIVA 3GLHE 1ISRA 1YJAA 2ODGA 4HK4A 4F04A 2EAUA 4DIUA 2C5HA 3PJGA 3BMNB 4DLXA 1XHEA 4XOUA 4U3JB 3W1VA 5ARDA 1BJKA 4MUYA 4C7ZA 1U0BB 5HM6A 1IM2A 2Q8QA 2FFQA 1ZU4A 2PZKA 4U8GA 5C4MA 4A6XA 2GLTA 4K5QA 1R4MB 4MPRA 2H3IA 1AUQA 4RS3A 2VHXA 4YRSA 2VAXA 2VUHB 1ZAKA 4A2CA 1A8HA 5D4BA 1J7KA 5D84A 4C4SA 1JR6A 1KFDA 3GVHA 3N70A 2IV2X 3EZ7A 3RADC 1OFTA 4R2HA 4RZ3A 4EPYA 3SR0A 4LMRA 2TMKA 3T7TA 1N1MA 2H3FA 3NFYA 1G98A 3O94A 3EWNA 5FLXA 2ZXHA 3HY3A 4WVLA 3FBTA 5K0NA 4E31A 4G24A 3IOBA 2GYUA 2Z3ZA 1LS6A 1KE1A 2C54A 3DZKA 3ODGA 1CY7A 3PC8A 3TLZA 5CVTA 2WWFA 3B2QA 4RW0A 1CPYA 3I9KA 4PZUA 3DE2X 4TMTA 4E46A 3UMGA 4EB0A 4OMCA 2A84A 5LDDC 3AJEA 3IALA 3F97A 3V8EA 4RCYA 1Q0TA 3OSUA 4JK3A 4DLGA 4PYRA 1MV5A 1N7IA 5I7UA 1JEYB 3SS8A 1T4CB 4B48A 2X41A 1V16B 2RD2A 5JALA 1TT5A 3BN3A 1SVOA 3D6AA 5KTOA 2CT8A 3C1TA 5K0ZA 2JEFA 3UWPA 1DFGA 1XHFA 2D2FA 4ABYA 2GK6A 1N3LA 2WRZA 4PNZA 4MQEA 5J0QA 3CVVA 4EABA 8ICJA 3FB4A 1BEUB 1H2ZA 3R20A 1THGA 4UB2A 3THYB 3KJGA 3R7WA 2E82A 4M8SA 1Y5MA 4OD0A 2G09A 2B7LA 1FFEA 2H7VA 2HBQA 2V7BA 3WHLA 4FCVA 4Z8YA 5BXQC 4JOQA 4NK5A 2ONCA 1GGFA 5LQCA 1XQVA 2QUBA 2IHVA 3NHRA 5DNAA 2O8EA 2AMJA 4LYAA 1JHZA 2PH1A 3WGMA 3GV5B 2LM4A 1E60A 4ELVA 3LF1A 2W3RA 2VXYA 4DIDA 1PS8A 2F3UA 1A6SA 3D31A 3RUEA 4YACA 2M1XA 2Z4RA 1OOEA 4KN6A 4M7WA 4G4SP 1R8XA 4JI4B 5DI3A 5IIJA 1HYHA 1EDOA 1TMOA 4Q47A 4AROA 4WLOA 1QRTA 1M0TA 2JVJA 1CJCA 2AXNA 2CLSA 3ZHYA 1H2EA 5CB4A 3TXYA 3H9QA 8LDHA 1NJYA 4B9UA 1PZMA 4HB0A 1FDRA 4NS1A 3TNYA 3W3ZB 5A4DA 3QLTA 1ZGZA 4O3PA 4F5YA 1CZHA 1ZVMA 2D1FA 2XAUA 3N7TA 1SOAA 4L5IA 5CFRA 3IP8A 2NM0A 3S27A 4OK6A 1ODLA 4RHUA 2J9ZB 4XWAA 1EIWA 4JLVA 2WB2A 1WXQA 2MYTA 5AVUA 2XSZD 2YQ4A 1PT7A 2HGSA 2FDXA 5BR8B 2QRJA 2HREA 1VECA 2NXNA 2KICA 3DXZA 4DSZA 2OWDA 5A1JA 2J7PD 4ZHSA 3STYA 4ENRA 1C8KA 1UKEA 2O4CA 1E8NA 3S2EA 1P4AA 5CDSA 3L6UA 1XU7A 4QGSA 1CZUA 3UMJA 3WLAA 2YJ6A 4A73A 2G0AA 3PUJA 2CHGA 3M9XA 5L6LB 4MUAA 2XCPA 1PU2A 5IAGA 4NCAA 5T64A 5IULC 4JELA 4BBJA 3E0XA 1U7PA 3DWGA 1RI5A 2HPAA 5JEEA 2YXDA 3TN7A 3WKCA 3U1TA 1E6LA 5J2TF 1UJNA 1KOFA 1BCSA 4LXUA 2W9BA 3IKJA 5KIAA 721PA 1G291 2IYAA 3HUTA 1USWA 4GQBA 1Q84A 1NMEA 4QD3A 1Y8QA 3AKCA 4EZBA 3CLUD 5TPZD 3QJYA 3BMCB 1P39A 5G0VA 2WB1C 4FDAA 3MUEA 1OHHD 1EQ2A 4KK3A 2HU2A 1OGJA 2GRUA 4X95A 2ZUUA 3ZXYA 1L4NA 1HJPA 5FYQA 2ABWA 2XXJA 2R7NA 4KAFA 2IOYA 2IF2A 3PSHA 1YS2X 4BZPA 4QRIA 3HKDB 4KPUB 2LHTA 2W2MA 2Z2JA 1Z5ZA 4JVSB 2FPPB 1JG3A 4IO1A 5F5NA 4ED1A 5EOVA 1U1GA 2HZBA 2ON6A 4MIYA 1ORWA 2QL5A 3UF0A 3QVWA 5JYBA 5JSFA 3HSYA 4MO9A 3OLWA 3AY7A 1BO6A 3VHXA 3S68A 4NYMQ 3L77A 4LNUB 3N9IA 4UFPA 5J5VA 3MBIA 3NYIA 2OK7A 2X1LA 2QRMA 1GEEA 3W5HA 1I1HA 1SR8A 3E7XA 1ZM7A 1K86A 5AJYA 1AK2A 4BU1A 3M82A 4QE3A 3HU5A 2EV9A 3CRQA 2WW8A 2AD5A 3WV5A 3K4GA 1DQZA 1VLHA 3B1FA 1QZ3A 3IOEA 1M2FA 4XR9A 4C3VA 3KQUA 1TB4A 2PXAA 4C7VA 1PZNA 3GFOA 4ZCTA 3B3JA 5DCYA 1N0IA 5G0TA 1POWA 5KWEA 4ON9A 5BORA 4ND8B 2FOLA 1LNQA 3PGXA 2BRUC 2G83A 3A6HA 1KF0A 5KKAA 2JFBA 4XVHA 4ZAGA 1HLDA 4A3SA 4F4CA 4DL7A 3BMOA 5EJMA 2HXSA 5LZ8A 1YS6A 4J9NA 3RAJA 1JHAA 1PQ4A 4XAQA 1N2ZA 2JLYA 3G5LA 4PGQA 1CF9A 4PLGA 2ZM6B 2EWWA 1MQ9A 4GVPA 1X1QA 4IEFB 1SHJA 1HV8A 3EGCA 3NRJA 2UYGA 2XVAA 3RVOA 1CETA 4UARA 2Y2UA 2GLEA 2FLLA 4ZOEA 2BPCA 3RROA 2I6XA 1ZGGA 2GSWA 1FVOA 3QSGA 1NC3A 3FFBA 3T5BA 2F8MA 4KCGA 1X1EA 4RPZA 4FGKA 2PLFA 2D8CA 4Y1GA 4HWSA 2P5YA 4OATA 2IEBA 2IU3A 1GPLA 4GOXA 4QXRA 2VWPA 3ZVKA 1PZEA 2VK2A 3V8VA 5HDBB 2HYDA 2N1RA 1RRVA 1SWVA 3QFRA 4UVHA 5ALLA 1KU6A 4D74A 2VP6A 1BDMA 3HV0A 3PD0A 4I9GA 1ZGCA 2IS2A 3GRYA 5JS8A 3HHEA 1U8EA 4C5CA 2W42A 1T1EA 3FMPB 4OHMA 3GA5A 3N2EA 3B3AA 4X45A 2UXCB 1HL3A 3EXEB 2J0VA 1LQTA 3DDWA 1E59A 1COOA 4B3HA 2M98A 1W73A 1TM1E 1RLMA 4PU0A 2LPMA 4UUPA 2IYVA 1NYTA 3FRJA 4B6OA 4HI0E 2AFIB 5KG7A 1BMQA 5DYIA 1VE3A 4YP0A 2X42A 3MGVA 4MIKA 3F71A 1DRGA 4QARA 3NM4A 4JMPA 3BQ2A 3AHFA 4IJ6A 5FYDA 4H27A 3U7GA 2G1KA 1A50B 4EYQA 3HDHA 4CQLB 1AQJA 2W2QA 3WLJA 1JMVA 2HHSA 1L9KA 3U17A 3HCWA 1ADGA 4ZVSA 3OHMA 4MWBA 4W99A 4DL4A 1CJUC 2GWRA 1NNI1 2XI9A 1UWLA 3KPUA 2O57A 4B34A 1TUBB 2NVWA 2KOBA 2CNKA 1SY7A 1IQ0A 1TFUA 1W47A 3M1LA 2PUAA 1K9SA 1X8XA 3NWPA 2BFBA 2KBEA 5LQKA 3HU2A 3DFKA 1RZRD 4NPAA 1LPOA 4LI0A 1SL2A 1WV1A 3FFXA 4WY2A 2CDRA 3T38A 5ECYA 1FDSA 1PT5A 2P6NA 2H08A 4AKEA 2C59A 1E89A 2O5EA 4DLRA 2DETA 3IEKA 4X1KB 1PJTA 5EE0A 4JC4A 3QVVA 5KG1A 2HSZA 4DCVA 4BFYA 4JYMA 4ENPA 2C5LA 1G8KA 3PWTA 3RSCA 3ONDA 2PMEA 3CWCA 4ZCIA 2Z5GA 4DQVA 3ZWWA 3ZXUB 3G49A 1Z7GA 4WNCA 2OHIA 1RQGA 1N75A 4I6EA 2J3IA 4MXDA 3UFXB 4Q44A 5IKPA 4CLOA 1ITZA 4W5NA 1ZQHA 4ZU1X 3PUWA 1KI2A 3ANMA 3CXRA 4LWPA 4Q9AA 2CJWA 1CKEA 2YXEA 4XQGA 4XQ0A 1G2PA 2WIAA 1X8LA 4BAZA 2BPFA 2DE0X 3RIMA 2J31A 4JA0A 2F1JA 2G0TA 1RM4A 3VR2D 4RVDA 1ZHFA 4W4TA 3ZDYB 2PH3A 1YS4A 3RAQA 4PVCA 3IJEB 4I3HA 4MKRA 4R6WA 1LW6E 3T95A 1Q1QA 2UVUA 1ATIA 3TSYA 5AO9A 1YV9A 4M0MA 4I2BA 4US2R 4QXPA 5L40A 1K5GA 2QD4A 5A5GA 1OPRA 3QE2A 1LBSA 2QYOA 4N76A 4LSWA 1FDTA 4PY2A 4OP1A 2W00A 2TMYA 1DS6A 4UD2A 3VGPA 1BROA 2REBA 4F4DA 3BXZA 1L0BA 4PAQA 2X5KO 3O1JC 1NQUA 2NZVG 2ZETA 1BYIA 1O4VA 1XC7A 2Y99A 3H8SA 3N2YA 4FJ1A 1WQ1R 4CV3A 1KR5A 1PLKA 4C7BA 1T5LA 4B9VA 4URZR 1ULSA 1PR1A 3CSUA 4P7JA 2RBGA 3C6ZA 2ES6A 2AL7A 5A7HA 3OOWA 4OHUA 2WKWA 2E37A 4M1WA 2J0UB 3NS1A 2VF2A 4PLHA 1TTPB 1UBRS 4OU5A 1KFEB 1YQWA 4U02A 1RMQA 5A0VA 3DL2A 4YRFA 3SV4A 2P35A 1I7SB 1NOKA 4YMHA 4G1FA 2VTKA 2XTZA 3UMRA 1EMDA 3CWQA 4LYFA 1IIBA 1EFRA 3D43A 4FE3A 3RBEA 4BNUA 2CXTA 2QGZA 1A7JA 1Q50A 5AW4A 1XCOA 2H92A 5CX1B 3HYLA 1ZSNA 3TAXA 4M22A 1T1GA 2PWBA 4AJIA 1QPBA 3W04A 4DEVA 3K2QA 4BO7A 4U00A 3U6BA 2ACKA 2EAMA 2JLWA 3KYIB 4EHNA 2D7JA 2DUUA 5FOVA 5ULLA 4OLJA 5IT5A 1KMHB 1XMOB 3NASA 2FCAA 2WB4A 3W2GA 2UZAA 5C53B 2BEWA 1V3VA 1S7CA 3EBLA 2E18A 1Z3EB 3HRDD 1YUNA 1CUCA 3OSZA 4RBNA 1Y5RA 1XRLA 5KFNA 5B7PA 4F1KA 3X1KA 1VHDA 5J63A 4TGLA 4RPXA 3OIUA 4NXMB 1S2NA 3PR3A 4EW2A 4LISA 1PYOA 5I01A 3MR3A 4HXFB 2GOYA 4UTRA 3HB1A 1ZISA 4KB5A 4R2WA 4X41A 1UBCA 1REQB 3THXA 4M0AA 1OJLA 3RUPA 1ILWA 5JUWA 4I7EA 4ND6A 4L8GA 1D07A 3QX9A 4RD4A 1THZA 2VHVA 4ZIRA 2WJGA 1IHYA 1Y37A 4A4DA 2H18A 2MAXA 5CIWA 4B5LA 3OFKA 5AW8A 2A35A 4B6FA 4ZKDA 2IPMA 2VJMA 5I4BA 3FTDA 4WNIA 3U31A 1RCFA 2DSTA 3NCHA 1Y3BE 1ZONA 3NBAA 3KKKA 3A6DA 3EBOA 1IUNA 3AGPA 4C43A 1JKJB 3KKQA 4TUQA 4PYNA 4MX8A 3F3KA 3OLVA 5CXUA 1UCFA 4DWIA 1U7OA 1XX6A 2VTBB 3ZV5A 3DMTA 2JRCA 1RM3A 2L0XA 1WCLA 4ZDIA 1V8ZA 4WIAA 1NI4B 3PNMA 2C2KA 1A8QA 5DXJA 2A8YA 3PVXA 1XTKA 3ENKA 2FRXA 1J9GA 2G5GX 1KDPA 3IXLA 2DUWA 5EYPA 3LFUA 1BGXT 2JANA 4MYTA 4MZDA 4DQRA 4QELA 1SOUA 1LTQA 2A1IA 4V3CA 2WVGA 1WHTB 3ER8A 1J2YA 4GECA 3MWEA 3DULA 1JPJA 4ZYYA 3K1AA 1E3DA 3UQZA 3WQRA 2WJAA 1X9MA 1SULA 1Y5IA 3PV0A 4LQDA 5F1PA 5LC1A 2V3CC 1J8DA 1DT3A 4KDEA 2ZW9A 1U4BA 4OGKA 1KY4A 1XCGB 3IHLA 1ZCFA 1L5KA 1WB9A 1MC1A 4DLSA 2HU8A 3PQ6A 4GSLA 3WJ2A 3N6VA 3SIXA 2QXTA 5COAA 1QOPB 3UJ7A 3A6JA 2JJ8A 3VZBA 1UM8A 1LEHA 1IQUA 2DKFA 3DVQX 4DRZA 4D46A 1NVKA 4KMUA 1OUQA 4KPGA 1XEAA 4NATA 1RWNA 4JUAA 5KJ6A 5HFNA 4L8YA 4AMZA 4ZTBA 2RAPA 4DFKA 1O2DA 1SHLA 5LQNA 2UVRA 2F3SA 4N3BA 1AN9A 1QQ5A 1Q7GA 2WAQF 3WO1A 3ZY3A 4XPIA 3MABA 1XDSA 1KO8A 2Y1DA 4ARZA 5LOVA 5C8ZA 3C5EA 3DE7X 4K46A 4LYJA 4KWHA 3PD7A 1SCNE 2G6BA 3EXIA 1K27A 1SD2A 5SZKB 1N6NA 4O3FA 1YQGA 1PSZA 2WPDD 1L7MA 3QVUA 2ZCVA 2IZZA 2P8JA 2HEGA 8ICNA 1QH8A 3HUEA 4E5SA 3UWSA 4B9TA 1K5DA 2QX4A 4BC0A 2XKAA 2C31A 4NIMA 4JLKA 4B3XA 3ETDA 5DIFA 5IAAA 2YY6A 1JDJA 1ED1A 3N86A 2ODTX 2GFHA 5KHAA 1XTPA 1U9IC 1NQ5A 4ECYA 4C3OB 2L17A 4R84A 2CXHA 2G07A 4C7KA 4B83A 1CZKA 4ZQEA 4TTTS 1PFKA 3IT0A 2HD4A 2H7YA 1G3RA 2V8BA 1UK6A 4OHYA 1R6BX 3L0PA 3AU6A 1A9XB 4PM4A 5CAEB 1GDHA 3I0NA 5TXGA 4ZT6A 2J46A 4HTFB 1M0SA 4X6LA 4J07A 1ZI6A 3HDVA 4QYXA 3DSRA 2VA2A 4AUEA 4E6EA 5FOUA 4WH0A 5BN3B 4LZAA 1JYSA 3LJKA 3IEVA 2PBLA 3AQ4A 5DOVA 4QHTA 3Q3HA 4DBLE 4B2PA 2QBYA 1EJ0A 5BO5A 4WZBA 2G28A 2W9MA 5BSWA 3OCWA 4EY5A 1U7HA 5BNIA 2IY7A 4KLFA 2P9BA 3PGKA 5BR4A 4V0KA 3FSRA 2CJPA 5TNXA 3TQIA 1ZOSA 3DPIA 3ITKA 5KFDA 4I0WB 1ODFA 4NL9A 2K2WA 5KFPA 3UPTA 3OMXA 4BWGA 2D7DA 5TE9A 4LOIA 1VSQA 1P7YA 1JE0A 1SIJA 2CXRA 1Y1TA 3L6RA 4KSBA 4ZXFA 1ZITA 1JLLA 1LJ8A 4G0UA 4M60A 1NBOA 4B43A 5ICCA 3V32A 4XGNA 1OAOC 3L8CA 1APBA 2A1JB 3D4LA 4EW3A 3DDCA 3GQBA 2GNPA 3D6NB 4Q66C 2MSCB 1FNSA 1QNFA 3TBFA 5HK8A 4Q7LA 4BLUA 4YECA 3E6AA 2YV5A 3UJBA 3L8DA 4BC1A 4GP9A 4BCCA 2HPZA 5J0OA 4RQ6A 1NR1A 1NRIA 1A5TA 1U31A 2PUTA 3C8ZA 3G2JA 4RSHA 1CEEA 1QE3A 4LCBA 1E1MA 3PNOA 4BLTA 1DINA 2ZSHA 5EKDA 1WXWA 1I4LD 4D4LA 3OKCA 3LUBA 4B6QA 4YFKA 4NAVA 3GEDA 2XZLA 3TFQA 5KG2A 1KI4A 1NBMD 2XRZA 3W0LB 2VSYA 2I33A 5HR7A 4IXWA 1PV4A 2ORVA 1KZ4A 3KZCA 3OQHA 1Y3IA 2ZG6A 1N61A 1RYRA 3KT0A 1T3SA 5DM70 4U2BA 2ADOA 4TM7A 2YFHA 1W0KD 3LHKA 4YIKA 4WUVA 3H8MA 4XJVA 3DVAA 2ZPTX 2ARKA 1BMTA 1Z6QA 1WNTA 1SELA 2LPEA 5TEVA 2P6UA 1TDJA 3TZQA 4XDZA 5KX5A 1E0JA 4G84A 1FSZA 2HF8A 2ZTSA 3QEAZ 1BWQA 2DHRA 1IM5A 3WYDA 4J9UE 4PHHA 4J7CA 1O6BA 2FPXA 4K9PA 3AJ9A 2PRZA 4K9NA 4FEAA 4HUQA 3HDTA 3GIKA 2FPIA 1FFUA 2V74B 2YYSA 1NRXA 1LDGA 1ZQSA 1NBAA 2CVPA 3WMWA 1B16A 4Q4JB 3LKBA 5SV2A 1KDHA 4BWYA 3MTAA 2ONYA 1U6IA 2RSLA 4G5GA 1NJFA 2CFIA 3UICA 1HEYA 2HW8A 2H2DA 3VMFA 4CUZA 3F9CA 4K4HA 1GTVA 3NANA 1XK7A 4TYMA 4CM3A 3P9QA 2JB9A 5KTQA 4AMBA 4LXIA 5KFAA 4L5JA 5EMLA 4ZU3A 2H65A 3R8CA 4PXAA 1PL0A 2I6TA 2IT1A 4YRLA 2XDQA 3GJ0A 2GDZA 4ILKA 3R3XA 1ZQAA 2KMLA 3INGA 4FOOA 3QWHA 4JI1B 3HCDA 1TVEA 4TRNA 3TE7A 2CBXA 4US8A 2HXYA 4YCLA 1MOPA 4QECA 3HPRA 1YMUA 4GE3A 4M99A 1TIBA 4HBZA 2K7FA 1XRJA 3K1YA 1B7GO 5DXFA 3H9GA 3I30X 1TO1E 3T3IA 2HHWA 5JMWA 2ADFA 2AQ8A 5DBEX 1ESMA 4ESOA 4QEDA 2XXAA 2IHMA 4HLDA 4TSFD 1T8EA 3IAS6 2DPXA 1GGNA 1NP6A 1LLDA 4L95C 3VYSB 2QMQA 4ZZIA 4HUTA 3CZAA 2GJSA 4C0KA 3AFMA 5AQ1A 2XCLA 3PNKA 1NJWA 5FLKA 1H0SA 2ZTEA 5DBFA 1BGVA 4FLMA 2A88A 2WU3A 4RJJA 3II6X 4BGIA 3CLHA 4N5DA 1P4SA 2VDPB 5IBPA 4MOWA 2B0CA 4IDDA 2IXTA 5EHGA 4ED8A 1P0MA 2YR0A 3SS7X 4UQLA 3ADOA 5EC8A 2F1OA 1W4CA 2QSJA 3LLUA 3OCUA 5CFZA 4KR9A 2OK8A 4FFNA 3K0FA 4ND7A 2I76A 2IPXA 2PKXA 1Z07A 3GJYA 1DXYA 4GR9A 1ZM9A 4JC5A 4TTSA 2FHPA 2HBRA 3WRYA 1I2AA 3Q4GA 4OXKA 4U63A 2IF0A 2RGYA 3AI3A 1Z4MA 3L4PA 5J0WA 4ZVLA 5IEJA 2WDZA 3KKAC 2AHOB 4PZ0A 3ZHXA 1K6IA 4R8KA 5M3BA 1WXDA 1RQPA 2Y67A 5IFLA 2E1PA 5K0GA 4IQ8A 4IJMA 2WYHA 3L4KA 5C7YA 1QP0A 1Q7CA 3UJCA 3C21A 3TADA 1SXJB 3QLUC 5C32A 5NLLA 4F9EA 1QF9A 1V5EA 4XCQA 2D5AA 5KKCA 1PR4A 5KT3A 5GTIU 1RXIA 5AM1A 3N39C 1J21A 4PG6A 4DTCA 5AUOB 2FSVC 5LQUA 1JHQA 1QU3A 4NU6A 3QQ5A 1QP7A 1XEXB 1YL6A 5I9BA 1DO0A 4MUXA 4CQMA 2ZBUA 1DRKA 2XOKD 4D99A 3LT4A 4US1R 3K9GA 1KVUA 3WGZA 5DQHA 3HO6A 3WRXA 3WNBA 5CWRA 3LUHA 1SCAA 1HUOA 5J1SB 1HX7A 3SCZA 3QHAA 3JRXA 2C0QA 3RBAA 1FOEB 3KTAA 3TOCA 1ZU5A 3AYZB 2ID4A 1DARA 5KFYA 2OYYA 4MNTA 2X15A 3ZXXA 2B78A 3GIIA 2QRNA 3E9DA 5FTKA 3C1UA 1WMSA 1WWKA 3N0TA 4OBWA 1RPZA 4Z9FA 2J45A 3JPPA 4NDAA 3PU6A 3FTEA 2J6IA 3K0KA 1BTOA 1KI6A 2FF5A 2HF7A 4LOLA 3A6FA 2FJ6A 3WB9A 3INRA 3BB1A 4MR7B 1KU0A 5TQ2B 1XA4A 4I27A 4MP3A 5EQJB 1E66A 2UDPA 1M2KA 2AGPA 2XUJA 3O75A 1Q14A 3SR6A 2NZJA 3LE8A 3UA4A 2YTZA 3CLTC 1JI7A 5HOEA 4EF4A 2K4PA 3B82A 1X8JA 1YB4A 1WD7A 3HGMA 3SF8A 3BT7A 3RYFB 4FDUA 1W34A 1NM5A 4J3NA 1X2EA 4E5UA 1L8AA 1L5ZA 4FGZA 4TMZA 1Q44A 5SZJA 2XCAA 4MULA 5K8TA 1IZYA 3OZ7A 1ZNQO 4M6WA 4GXIA 4UNSA 1R6TA 4YS6A 3WLPA 2L18A 1LJUA 3FJYA 4B73A 3ALRA 2AV6A 4AURA 5EXSA 3Q8SB 1J42A 4QWMA 4CG0A 1PNVA 2Z6AA 3KXLA 5DGDA 3VU8A 3KPWA 3WICA 4EG5A 4M1QA 4ZEMA 2AUMA 4OKNA 3JAWA 2ZU0C 3HCEA 2PVSA 4ZT4A 3VAZA 1L7XA 1EG7A 3VVLA 4OQDA 5FOWA 3C1AA 2PKEA 3TNDA 5HMMA 1VKOA 2RKOA 3EVBA 1SUWA 1JXOA 1AROP 3K9FC 3ZCXA 1W93A 3GVIA 2PA3A 4Q3LA 5LOVF 3QPVA 1RHMA 2RB5A 5GVRA 3D8UA 4DFPA 4HTAA 3TDNA 4UXIA 3TI0A 3ONFA 4TMVA 2B1JA 3IMKA 3L05A 4F8EA 4QGHA 3SZOA 2Z2YA 5EJ7A 4JDPA 4XGKA 4V39A 4L73A 5BSEA 5F12A 4L2IB 2VP3A 4Y2XA 1EFAA 1M2JA 1U7DA 1EP1B 1BH2A 3OZWA 1L4FA 4ZTUB 3K75D 4V2IA 3THRA 3WB1A 3QUBA 3AVTA 4E5PA 4TLDA 1SM4A 1ZIPA 4R1SA 5AVOA 3I6ZA 3NDRA 2FSHA 2BHNA 2YHBA 3I1FA 2IU4A 1HDEA 3OAAA 3P2IA 5ISMA 1V97A 3P9CA 2D2IA 4N3GA 1OI7A 4U2FA 5D86A 3OFND 3V1TC 2M32A 3SR3A 5AW3A 5AUPB 3B2NA 2Q62A 4BZXA 1K5PA 4OJOA 4K9RA 1ND5A 2AJ8A 4LYGA 1UL1X 1ABEA 2ZRAA 3USZA 2RGCA 4RTKA 2FEPA 1OXMA 1PJSA 3AEXA 3K9NA 1QQ7A 4YJGB 3IAAA 2VLBA 4CXMA 1I3NA 4UAUA 2WNHA 1I5OA 1PUXA 1FX0A 2ZATA 2ZPAA 1Z1BA 5HKOA 4DF3A 3ENQA 4RNMA 4CEJB 3A6PC 2ZSDA 1QORA 1JFSA 4N7BA 3QWBA 4ZREA 1JU3A 4KVZA 2RK3A 5K9ZA 3ZBTA 4EELA 4DDMA 4D0NA 5DASA 2G3YA 4GKAA 4K1LA 5IVDA 4W82A 4YAEA 3JTMA 3HO1A 1C8LA 2HI0A 4H6XA 1FSSA 1AXGA 2O1SA 2CCKA 3O5AA 1IDOA 2KIVA 3T1NA 4HP8A 1Q0UA 2PL3A 5EIWA 4QQ8A 1RHJA 4C2TA 2R6DA 4IL6U 3LHFA 5J8YA 2GBPA 1P81A 1DHRA 2PD3A 1PWZA 5AHWA 2C2GA 3L6DA 3BG5A 2P9QA 3RS8A 1GRRA 1U8TA 3TQTA 1ODKA 1JHXA 4LHEA 3OZBA 4ETMA 1EUZA 4YVZA 5KFEA 3E5MA 2Y6UA 1N5OX 3VI4B 2DWQA 2JVKA 1PYDA 4NYJQ 4EYSA 2ZJ5A 4AYBF 3H4VA 5ERXA 3N5KA 1OREA 3JU3A 5A3RA 4IUCS 1R2QA 1U8YA 2ODNA 4GICA 3HW8A 4OLFA 3PXBA 3K31A 5CW1A 1RMYA 1BMFA 4D0LB 4BGDA 3CCCA 3W5BA 4J1TC 3E2EA 1JJ7A 2WIKA 1WABA 2QTFA 1KYQA 2YXLA 2OFOA 4RKFA 1XZIA 4UE2A 4LV6A 2VIIA 3TMAA 4JNKA 1Y1QA 3BDAA 1Y6JA 2QG4A 3THWB 5A3QA 5LA6A 3F2IA 2V8OA 3U4IA 1JA0A 2YZKA 4UVDA 2RCYA 3EYAA 1OZ0A 3F4BA 3T7DA 3MPOA 3T94A 2JBWA 3I1JA 1CUIA 4XJSA 2G9VA 4FIDA 5KX5F 1TKDA 3CW2A 2JFHA 1I3CA 3WKAA 4MQ4A 5KAMA 4WA8A 3TW4A 4W9NA 4F84A 4RQBA 5KU1A 1OYYA 1Z4KA 4YA6A 3H5TA 5ALTA 1M0EA 4PR0A 2B34A 3DW3X 3E23A 4IOJA 2QPTA 1C41A 2BMVA 4DJ5X 1MW8X 4XRGA 1BRTA 2E4UA 2RH8A 2IOFA 2E4YA 3GLIA 1WU7A 3DBRA 1EVEA 1A9QA 3OEWA 3E5NA 2FMIA 1B6SA 3JR7A 2L82A 2E55A 2A3VA 4BQRA 2WSYB 5K45A 2OGUA 2XE6A 3NP9A 3RVNA 4MV7A 3IIIA 4J90A 5DHUA 1JQJC 2P2LA 3N3BC 2HR1A 4QHYA 1HLFA 3HLTA 3I4FA 4PO3X 3OOJA 3GEBA 4R41A 1MOSA 4URYR 5CHGA 3P9NA 5C34B 3KVOA 4JL6A 2PGNA 4EUNA 4LZDA 2QP4A 2Z1NA 4QWAA 1OX4B 3SJZA 1Y8CA 3JPOA 2OQVA 1J56A 1YDEA 4AY3A 5AJVB 2HWXA 1Z3CA 4D8XA 3QGMA 2WTNA 3WL4A 1R9NA 3TRDA 3BGVA 5B3JA 1TK2A 4ZDWA 1R8QA 2CHUA 2FRVA 4BNZA 4Q4CA 2HIMA 3GJZA 2Z6QA 4DV7B 4QDZA 1A3CA 3I32A 3BILA 3M6MD 2QB0A 1B2LA 1YOVB 4MHTA 3M4ZA 1VG1A 2O6LA 1P2VA 1XCBA 2AYYA 4HAVA 3MWLA 5J0TA 3D3WB 5HTKA 2OD7A 3LH5A 3PFNA 1DXSA 2ZSIA 3CSSA 5B64A 2K4EA 1HUZA 3RC9A 5FOXA 1XXLA 2BFFA 4LV5B 3NHBA 2OZEA 1LKZA 1QS0A 4M9CA 3L1IA 2R1VA 3K53A 2RONA 2CMKA 1O95C 4MYUA 3BZCA 5BMVB 2I2CA 4Q6BA 2NO5A 2DPJA 2FWJA 5LMCA 5C8YA 2EWVA 3F2DA 4CPDA 3JPTA 1TM2A 1CB7A 4KEAA 2X5OA 3H05A 5ES4B 5ADWA 2NNLD 3TW8A 4Q45A 3BRSA 1DUIA 2QARB 3R24A 1F0NA 5JSQA 1EX1A 2WQ7A 5BWNA 3G3EA 1D5WA 1XJWA 4FTWA 4OBBA 3HFRA 4RJTA 5HZGA 3EISA 2ECFA 5CLHA 2O19A 3KQMA 4G23A 2ZB7A 5DGHA 3IEUA 4JMUA 3NJ8A 4ER7A 2TS1A 2QRLA 3CFYA 1EAMA 4NYMR 3BHMA 3K6SB 7ABPA 2BJVA 1G21E 3GLUA 3RFVA 3OEEA 4L6AA 3WK6A 4CKBB 2XADA 1JKXA 1OI3A 4FQ7A 2W2NA 3PR1A 4UFNA 2FJPA 2QZPA 4ZAXA 5CEFA 3AJAA 4J1NA 1XEWY 4IIDA 4JI8B 4WN9A 3MUOA 5IYZF 3DMHA 3ITDA 3HXQA 4EGAA 4D8VA 2AFHB 4MR8A 3DM5A 2UAGA 3GRRA 3ICOA 2NVOA 1R18A 4YWHA 2WJ3A 3PR2B 3WSVA 1Q95A 3TQ1A 1HT0A 4IFIA 3IEXA 4Q01A 5GIPE 1Q0SA 2F1RA 2JKZA 2R18A 5THQA 1BQEA 1CF2O 3A6KA 5HKAA 2PJDA 3O2JA 3NVVA 4BUZA 5LUAA 2Q0HA 2VJOA 2Q2VA 3V6MA 1ST3A 1ZI8A 2GKSA 3FCUB 2A4KA 1GZVA 2C9OA 3I5XA 4B6GA 3TZEA 4QUHA 4JQSA 4Q24A 1GA1A 2E87A 1CJBA 2ZPUA 4Z0HO 1VTKA 3KB2A 1CS0A 3UFBA 3RFFA 1DUSA 3RUAA 4YCJA 1HG1A 3BQ0A 1I2DA 4MLZA 3ONEA 2C9YA 4F0JA 5CDHA 1DBWA 5UKDA 2B8EA 4EQ6A 3BH0A 4NU8X 4UUMA 4PG8A 4A6EA 4B44A 2VKQA 4IFTA 3A04A 4NBRA 4Z4EA 1UDXA 1U4SA 1ZOIA 3LPMA 1SKYE 3NVDA 2GCOB 3TZLA 4FOLA 4JVNA 3FGNA 1VG9B 1C9KA 4UVIA 3KS9A 2JHDA 1WHSA 2HK6A 1CG6A 3RKSA 5AOAA 4CV1A 1KJQA 4R9SA 2LUOA 1YR9A 2YHIA 1NLYA 2APJA 3RS2A 2E4ZA 3MWJA 4M7OA 1EK6A 3IB3A 3LLCA 4AKTA 3FHJA 5LM3A 4ZRMA 3KEQA 3OKAA 5HYVA 3SX4A 3RG8A 2QVZX 3ZG6A 3A0HU 4HRYA 4UTZA 5K0JA 1KMNA 3AJDA 3EAQA 2W6IA 3U44A 2AHRA 5LSAA 4FFRA 3DWFA 3OURA 1UZAA 4BBAA 4TTJA 1RI1A 4EUHA 1NTOA 1WNFA 1LH0A 1IVNA 1AQIA 4C76A 3AOEA 3D0KA 4EX7A 1LQ2A 5TS3A 4IPTA 1HTBA 3RYIA 2HV9A 4X8MA 1D09A 4BS9A 2NVUA 3WY9A 1BHJA 2CV2A 1JDTA 1Q2UA 3L6OO 3TIIA 3PFBA 1MJFA 2XWQA 5TVKA 1OZAA 2YMQA 5DB4A 2BUBA 1MP0A 3HWTA 3VDNB 1Z0AA 3SAGA 1RW4A 2NZ2A 5JPIA 1SU6A 5DMXA 3W7AA 4QBGB 3T8YA 2HQOA 3OLQA 1UC5B 1E62A 1P17A 5KFUA 5B30A 3EMKA 5JDCA 4R4JA 4LBZA 4M88A 4WCFB 1L3CA 3TEMA 5K0BA 1QCYA 2OBLA 4EYKA 2Q7DA 1HUQA 3FCYA 1NONA 5JD3A 3WJAA 1T8RA 3RVJA 5IP5A 2OZLB 1UBEA 4D97A 3T5PA 1DAHA 5M29A 1IYZA 3X1MA 5F98A 4GL4A 4D9FA 1RXVA 1XQ6A 2II6A 1N92A 1HDRA 1Z6AA 2DT5A 1OF1A 3KB6A 3CG4A 2NMVA 4HNSA 4ARAA 2ZIFA 3GW8A 3RWBA 1NJGA 3WP1B 3TACB 4ZYWA 2ZBRA 3IVGA 3GJSA 1DSSG 2J3HA 4Z9YA 3HYCA 3F5QA 9ICNA 2X5NA 3HI4A 5DM4A 3N4MB 4BFTA 5AXCA 2GS9A 1F5SA 3H4TA 3EGEA 1Q0PA 1PFQA 1F2UB 3ML1A 2A57A 2C84A 2UV8A 1BXRB 4GFDA 5DGTA 7ICTA 4E1AA 1L5YA 1E8DA 3EA5A 3RUHA 3H0LB 3OP1A 4BNKA 2CHFA 5J9FA 1RAEA 3OJUA 1VKRA 3D0OA 4D9IA 4G9EA 1T9HA 1O57A 1O0BA 4XLZA 5CITA 4DWWA 4IQVA 2IUSA 3VH4A 4MWEA 1QHGA 1MPTA 3HFGA 1MLDA 3TFRA 1W5AA 1FIUA 2OVFA 1RKXA 2R8RA 1JR3D 3C7DB 1PBNA 1MSWD 5TR9A 4CDMA 1Z4QA 2QN6A 1WWUA 1S8NA 4ENVA 3ADDA 4N5HX 3DEJA 2E3JA 3U16A 2I8LA 2YBDA 2QR2A 3RC8A 2V5VA 4C5AA 2JLCA 4J7UA 5EUQB 4X6YA 2PS1A 3LI2A 2ETVA 3WYBA 3RFUA 2AQHA 4XIIA 1A97A 2YIMA 1DAGA 1QBKC 1TW3A 1OA0A 4EHHA 3HCAA 3B1WA 3DO6A 1VLJA 5IZCC 3VYVA 3RAEC 3OIWA 4L9RA 4AS3A 4YCMA 3GT4A 5DGIA 2AZXA 5K5EA 2E4XA 4BCDA 1H9BA 1JIQA 4CFSA 1AJEA 5IJ9B 2WWRA 1SHKA 2QP9X 2PMDA 4AO6A 5D2CA 5KSWB 3BAFA 1NX6A 3IR7A 3FCOA 3P9KA 3OD5A 4D2IA 3PNLA 2PS9A 3ICPA 4FMCB 2B3DA 1P45A 1Z9BA 4ZJPA 1P4RA 4I4TA 4TLCA 4RMHA 4CIAA 3AONB 2R79A 3PFGA 1E1RD 1HT2E 2IYTA 4WDRA 1TVKB 5FDFA 5D3MA 1MC8A 2DP4E 5DISB 5TC4A 1IJBA 1HC7A 3S5JA 1GUAA 3HKCA 3EWIA 4PFQA 4CUJA 1PWHA 3SXUA 1HFKA 3NYQA 1ZM2A 2CEKA 5E6SB 2YYAA 3SZGA 1QOZA 1XPJA 5GONA 1DEOA 2O5CA 3JTEA 2HUPA 4PC7A 5J0UA 3F5AA 4EUSA 3N07A 2LBPA 5KJ1A 3LUGA 5FWDA 1DBIA 1RCTE 1V39A 3HYSA 2JIOA 1V1MB 3LKZA 2IHKA 3KAPA 4N8SA 1D0IA 2QMOA 5DHPA 5ABPA 3PUXA 3WO0A 4MVCA 1BS1A 4NP6A 4O2LA 1AKWA 4YO7A 4HNRA 3F98A 3GGDA 1OU0A 4C89A 3KZ1E 4CJXA 4I4NA 1QKJA 4DQLA 3QLEA 1J09A 3OCYA 3R3HA 2DUYA 3NHMA 2ASLA 4Z6FA 4TRJA 5NULA 5AVVA 4GPAA 1VCHA 3ACBA 4RKEA 4KP7A 4M8LA 4XSHA 2CK3A 2XQIA 2PFGA 5E95A 4MS3B 2I29A 2V9ZA 4UBOA 5DPMA 2Z8XA 2NTNA 4O1IA 3TBKA 4G0NA 1A88A 3W34A 4B85A 4DIKA 3ZDDA 1UKAA 4KQEA 1SU7A 4ZV9A 1AZSC 3SQNA 1X7YB 3WYEA 2VXCA 3AX6A 2BMAA 3Q3CA 2KKPA 1N5RA 2OO7A 3MRXA 2WJZB 2ASVA 1S76D 4NYIR 4A1OA 4P22A 2C9ZA 2GASA 4FSXA 1RJEA 2R751 5IJAA 1FPQA 4OM8A 3H2HA 3VKGA 1DOHA 4PTZA 5JOQA 2ZIVA 3U19A 2AMVA 3RQIA 3B6EA 4UVEA 3ZOZA 4HCJA 2ZSBA 1EDZA 2GN0A 4P6VF 2IXEA 5I7HA 2PT9A 3OUTA 1SBTA 2OFPA 1NY6A 4I2GA 4YUWA 5KFCA 4JBHA 2OM6A 2D3WA 2Y0DA 3Q3JB 4AJ2A 1O3YA 5LLDA 2WWYA 1MO3A 3DFFA 4LF4B 1A8SA 3DPSA 1FMJA 2UUCB 7ICQA 3ZQ6A 4EG6A 1UBOS 5BYJA 2KD1A 3C6MA 4IHJA 4KLEA 3A1CA 3DD5A 1IBLB 5I9TA 2WOJA 4EF6A 4F56A 3TW0A 4FUTA 4RL4A 3A2KA 3ADKA 5LP6A 5IDQA 1O7JA 4NSNA 3OLZA 2BKLA 1GNPA 5BYBA 1SXGA 3PF8A 4HT3B 3UMCA 1FYXA 1GQQA 1H6AA 1W44A 5FORA 4RSGA 1XLTA 3QEMA 4KQFA 2CXXA 4TKVA 3RWOA 2X8AA 3ZX4A 9ICKA 2EW8A 3GNLA 2QN2A 5AM0A 2YQEA 4PGYA 2GVDC 3W2HA 4OI4A 5HM8A 2IUFA 2XA9A 3N8KA 3IB6A 1NHGA 4BVLA 2YNMC 2X8BA 2Q2WA 3NNDA 1DK3A 4B31A 5ED0A 4ND5A 3ABRB 1ORRA 1IULA 1TAGA 1KL9A 1UMKA 9ICRA 3ORHA 1E1DA 3O9ZA 3BB4A 1NUTA 4P4LA 2E1RA 4KQCA 3KEMA 4OBEA 1TC1A 5ENDA 4ZVMA 1JS1X 3ASUA 4P8RA 3I6BA 3RU7A 3FX2A 3WBKA 1BOFA 4ZCRA 1SKRA 2ZI5A 3DBVO 3SYTA 2AH5A 621PA 3ZUPA 2YWCA 5A4IS 1RJFA 1IZ0A 1JVNA 1NXOA 2E6KA 2KHZA 3FYUC 1KMMA 4F93B 1P6QA 5BRNA 3ZDAA 3FPKA 5TGZA 5CB4F 1FNBA 1B8NA 4AWAA 5JY6A 3K72B 3A11A 3MDCA 5JE8A 2IEIA 2EDUA 5ER9A 1G1MA 2A1UB 3ZJYA 4QT4A 1RBMA 4QU0A 3N2GA 2JMGA 2VJQA 4PH5A 2JG3A 4DKJA 1RJ9A 1U7UA 4B3BA 4GOND 3RJ5A 1NNLA 1W88B 3K0CA 1TLFA 3DNFA 1CDZA 4MMZB 4IDGA 3R3SA 2WIDA 4BQEA 2I1QA 1ZJ5A 1RXYA 1DXHA 2XYRA 4O8ZA 2C95A 2OAP1 2EHDA 3VSEA 2PKQP 1ULBA 1XZJA 4MW4A 4QQNA 3I2HA 4FXPA 3OQMA 1U2GC 1ZCZA 4FFBA 3GP3A 1E1NA 2ZSJA 2ZE5A 2G25A 3BWDD 2QF7A 1Z25A 1HFWA 5MFZA 1NDQA 3BS7A 3VHQA 3RVDA 2R8XA 1JMSA 3PNBA 3S70A 4BZWA 3ENNA 1KZ7B 4KLOA 1B74A 4JLMA 4D8WA 6NULA 2OHXA 4D79A 5BOSB 3NGLA 1GV0A 3IDZA 2VC2B 4DL9A 3RUIA 2IEYA 1GFSA 1YAHA 4DDUA 2KHVA 5EIBC 2CXQA 1N2CA 4QU8A 1SQSA 1CUKA 3T41A 2EZYA 5CRIA 3MWGA 1YOBA 2I3GA 4UHHA 3BC1A 3SJ7A 4DR5B 3KLBA 4C05A 1DC8A 2AMFA 4G4JA 3VNAA 1MO6A 4AJLA 1SBNE 3S44A 2ZSUA 3CPHA 2B30A 4MKXA 3LDAA 1IVSA 3NM5A 1ECCA 1LGYA 3PQ5A 5L3QA 4MGIR 3O1IC 4LX8A 1JAIA 3MTQA 1EXDA 1VPDA 1DMRA 2EANA 3ZU3A 5JG7A 2ZXUA 2PSJA 1R9GA 1R9MA 5K3SA 2OB1A 3UMSA 4P4MA 2F67A 1VLVA 4KL8S 4LDZA 5F2KA 1U63A 2BKEA 3CRMA 1SXIA 4HDRB 3KM0A 3K5PA 1ZETA 4JJ7A 1SEPA 5JRZA 4XA5A 1P31A 2XCOA 5JNLA 4DA4A 3CF4A 3CGGA 4KO1S 2QD1A 5F7JA 2PSHA 1B4DA 2A9KA 3HV2A 3U3XA 5AP9A 4BV3A 2BCSA 2KJ5A 3HBLA 2GBGA 1TFRA 4BYMA 1FCJA 5F1OA 2BCUA 4MFAA 1YAJA 2K4HA 4IRCA 3SBXA 4EGFA 4GLBA 5SICE 4KQ1A 3TLJA 4HGNA 3H1AA 4CLEA 1O77A 2HDOA 4DUPA 4ECXA 3AZPA 4LUCA 2GTPA 2PCJA 3WLRA 1L8XA 3LNTA 8ICCA 2XNDA 3BVPA 1ODIA 4FFWA 1KVQA 3SE0A 2ZRQA 2JJ2D 1PF7E 1IL0A 1KIAA 1QTRA 4Y1EA 3TG2A 2FI1A 3S1LA 3QEJA 5GM1A 3R77A 2RHJA 4BXOA 2FN9A 1Z08A 4L51A 9ICTA 1PLJA 1WMDA 3IP9A 3RFXA 1KXZA 2CNOA 5CLJA 3OTGA 2O8VA 4KXQA 1JAYA 5A7GA 3ZKWB 2CKMA 1YTLA 1P7DA 3C2MA 3DFMA 2YQ5A 1QFMA 4ZI2A 1XZEA 3WL8A 3NVWA 2QI9F 4LK3A 2W9CA 3WKEA 1MB2A 3EIUA 4GC7A 2WAMA 2FUNB 3H1FA 2AEFA 4LECA 1DTWA 3IKTA 3NUQA 5D46A 5EJ8A 2PUGA 5CT9A 2OH2A 5T67A 4ZDKA 4MH0R 1F7UA 2XI4A 2ZB8A 2EATA 3PQ8A 1O94D 5CVVA 2IH5A 3FNGA 3LY5A 2HLHA 1QG4A 2JIRA 5J2TB 3BTUA 1KRHA 4KRGA 1GYPA 1I0IA 4MW9A 4H4CA 5K0TA 2IHYA 1QYDA 4YCAA 1ZNZA 1JLSA 1SZPA 3K5HA 2XMZA 1HDXA 4G0VA 1ORTA 1CIJA 4HEQA 3C3YA 1YIDA 1KWGA 4DA9A 4X8HA 2OFXA 2XNCA 1B22A 2C92A 1FFWA 4KQGA 2LIVA 2A5LA 1R10A 3LA8A 4ZAFA 4RPJA 1G6Q1 3OJLA 3ZUGA 4M1TA 3PGLA 2HTEA 2WHQA 2Q9AA 4F97A 4JCOA 5EWGA 1SIUA 5KTNA 3R5SA 3MTEA 3M8KA 2JJ1D 5BVHA 1KKLA 1L5OA 1LBIA 2AUNA 4IJQA 1THMA 3AUFA 2GD1O 3WSTA 1FBTA 3Q2OA 4RAOA 3H5RA 3RH4A 2RHHA 1GN8A 1BVRA 2PGLA 3EW7A 4CIWA 3HI6A 1SCQA 1D2HA 3IOMA 2O0LA 4QYIB 5JASA 1VCMA 1H2RS 1VXRA 1M8GA 5GONF 3DFUA 4V1CA 4N3CA 4BLPA 5AM5A 4MEAA 1K8QA 2Q2OA 2YC4C 1TRHA 4XJTA 1JEDA 1QE0A 4D0SA 4D3FA 4FYXA 2EL9A 5AOBA 3PQ3A 2WTUA 4BJ1A 4DL2A 3T1TA 1RE1A 1L5SA 4O3MA 4Q02A 4ARBA 3F2CA 2EOAA 2VDQB 7ADHA 2XOXA 5FBRB 1L5LA 3WWEA 2JBAB 1R8SA 2O3JA 3MERA 4K9LA 3L04A 2NU8A 4JP1A 4U4AA 5HRCA 2IIBA 5KWIA 2W2LD 1GTRA 2ZYAA 4YAOA 3GUYA 1PJ3A 4HVCA 4PWZA 1W4LA 2WG0A 1T0HB 3RJFA 1UPXA 4BNDB 2M9MA 2DG2A 3HJBA 1KQPA 3B5JA 3EVDA 3VC7A 5BVGB 1KOGA 2H57A 1Y6FA 1ZD8A 2HT6A 4D9HA 3T5LA 2H85A 4EB6A 4FE4A 4HXYA 1OFGA 2NOAA 5DYGA 1FFSA 4RTMA 3NX4A 4F7WA 4BE4A 1S97A 1ODJA 2QLTA 4FILA 3ER6A 2XCIA 5AKYA 3IBSA 2F9LA 3ZDBA 4FHFA 1WUJS 5JPCA 3JVIA 1NG1A 3V80A 4EZIA 2ZXIA 4JBYA 2X4LA 4ENQA 1WSDA 1J0AA 5TISU 3PQDA 3VJMA 1H2FA 5CNMA 4BNMA 2FE4A 4C8LA 4GEKA 5KC8A 2C5EA 1CUHA 2IUYA 4B3SB 1ESCA 2FOXA 4L9AA 3MBOA 1YZLA 1XFAA 1YMQA 2VJNA 1TCUA 4F2RA 4RHEA 3UZUA 3WWCA 2K4MA 4AZ0A 4NHOA 1MPXA 1C1XB 4QO8A 1WYGA 2MT9A 2DQYA 2HPHA 3EPIA 4CF5A 3QA9A 1RSZA 4WV3A 5LP6F 4O5CA 3P27A 2BHSA 4B7XA 3OM0A 2GCGA 4BFUA 3OT1B 1LV7A 3JQ7A 4V0RA 4YJDA 4Q43A 1I7QB 3K2IA 3WA7A 3KPVA 1TK5A 3M1AA 3UC9A 4AF7A 1N3YA 5KDOA 3MS2A 1E18A 1T3ZA 2JZBA 1TM3E 4U9HS 3I9NA 4URFA 2C3OA 4PXYA 2Q28A 4HDMA 4M37A 1G17A 1D9FA 3FUWA 1MB3A 1YS1X 4U7GA 4UPEA 4NESA 1XTBA 3GRVA 3IQGX 3RFTA 3SYKA 5FULA 3UK1A 1OBHA 2VG8A 1AUPA 5BQFA 1UWKA 2ZE8A 3LUCA 5J2FA 3EEQA 5CDGA 3H1EA 4Z9BA 1Y0BA 1T5OA 1U5CA 4Z0NA 4RXTA 2C3MA 3LDFA 3BSSA 5D1HA 4YXWA 2JBHA 2ZVDA 1D8YA 2EHJA 4Y6RA 4E2ZA 4YBRA 4KVFA 4ZJZA 4IX1A 3H2YA 1A9PA 4WECA 5JPDA 2C97A 4R40A 2CJFA 5I4KA 4R9NA 3TOSA 3EB9A 1KRWA 3P1JA 3CPEA 3MGKA 3W1WA 4RGYA 4H59A 3X3HA 1V5IA 3CJQA 3S81A 1YSCA 4F5EA 1FLDA 4FFSA 3FCCA 2UVPA 2WVAA 2J5QA 3FD8A 1GG2A 1QSGA 4ZT7A 2QPOA 2RK4A 4BWMA 1NNUA 4YPFA 1X1RA 2D0OB 1FP7A 2A7QA 2J4FA 1LWNA 2XGOA 3I73A 4DABA 3HN6A 1I2BA 3PX6A 5CH5A 4UBIA 1EI9A 3OWXA 3E2MA 4LF5B 2JW5A 3AR3A 3ILYA 3STTA 2WEKA 1HEIA 5KSOA 4OJ5A 4UM9B 1KYXA 2RGNC 5FWNA 2JFVA 2RC5A 1YMVA 2CUNA 4OAPA 1O9GA 2GBIA 1QVVA 4K86A 4AZVA 2CV0A 1R27A 2ZWPA 3I9JA 3QF7A 2GXUA 5KTPA 3ZTWA 4FB5A 4M55A 2GK4A 1KZ6A 4CT5A 1F8YA 3TB4A 4PVDA 1UC9A 1QVAA 2YMPA 5FTWA 4YASA 1KBUA 1QHEA 4Z99A 1SVNA 1UBKS 2HHCA 5AKJA 1DLIA 2PQ6A 3OVMA 5JYCA 4Z7OB 3PHLA 3DNPA 2QRUA 1H5QA 3SM3A 1KKXA 5B2FA 2CJYA 1WDTA 1JDBB 1C0PA 1LBHA 3OM8A 1KAMA 1ZRNA 2P11A 1DQPA 5GZ1A 3FMGA 3QKRB 4X54A 1V11B 3C5GA 5EJ2A 4GG1A 5EERA 4WLNA 4CGYA 3KLOA 3WQHA 3SX2A 3D6FA 3FNEA 2WI8A 3PDHA 2EJTA 3D6VA 5A2QA 2VA9A 2BN4A 3AEVA 4QVKA 3O8QA 1TT5B 2WAYA 5JT1A 2FPSA 5AOVA 1UKCA 3N87A 4B3JA 3RK0A 3U56A 4WERA 1JNYA 1N5MA 2E8OA 3EIFA 2GZRA 3LWLA 3U7EB 1XKLA 1SG6A 1H66A 3PRYA 4OQ4A 4M0UA 4DJEC 2AMLA 1GNVA 1AMUA 1R15A 3R7WB 2Z6VA 1UAGA 4OSPA 4YRPA 2ZZNA 3OLCX 1IY8A 1KEUA 4IDFA 2YH2A 4U6QA 3IPYA 4Z86A 2XE4A 3LFTA 2HCRA 4DLNA 1CJTC 1T2FA 2FP4A 4H18A 3JQDA 1AKTA 1IATA 4K8OA 2O8EB 4KFUA 4XM0A 2Q2QA 3OZXA 4WL0A 4DDTA 3WMEA 2BKVA 4QEKA 4ONEA 4YJHB 4F4KA 3VJKA 4C7XA 2H5XA 4LVNA 2BR5A 4HGRA 5EP2A 5B3AA 5TQ0B 3OZFA 1QCCA 1CYEA 2PS0A 3NHUA 5E4TA 4ROSA 4DR6B 3RK4A 2WG1A 2FXIA 1WF6A 2ZUVA 4UXHA 1OB5A 3F90A 3L43A 3KKZA 5DI3B 4C0WA 1DTSA 4NONA 1U0HC 1ZIOA 4MJLA 2B8WA 3WWOA 4MDHA 1S10A 4R9VA 4P3KA 3P9SA 3QM1A 3OWHA 1LZLA 4KFCA 3VJRA 1N60A 5AI9A 2XYVA 2NU7B 4R51A 2ZTVA 4PTLA 1P80A 1VBFA 3P2JA 1FXUA 9ICFA 2JL1A 1WZIA 1U2SA 2FUCA 4IS7A 1JUDA 1XKQA 1OSNA 4JU9A 1A9TA 6CHYA 2JGDB 5E6RA 2AG6A 1B41A 3ROGA 3T9FA 2KB0A 4IWXA 4M8IA 3NNSA 5DX0A 4TS9A 4FEGA 4EBBA 1HNXB 2F8TA 3DZCA 3AKDA 4HZUA 1I5EA 1U3TA 3C7TA 3LO8A 5AHRA 4D6XA 1EIZA 2LDBA 1W96A 5EKTA 1P7ZA 3KT3A 1A5ZA 1SEVA 3WZMA 1ZRHA 1JB9A 4R98A 3M9NB 2B8JA 2OXFA 5A9RA 2OOKA 4I1SA 3ZN2A 3OU7A 2W70A 1AV7A 1P0FA 4P0TA 1WP9A 4EMSA 5HZKA 4U6NA 1UBNA 8ICSA 1QTNA 1Q21A 1IN5A 1UP6A 4RLQA 5BW6B 3AMZA 3WZLA 1AKNA 1QK3A 4JOBA 4WZAE 2QRKA 4F5DA 2OCIA 1I9CA 4KWEA 1UOPA 3DTVD 3Q10A 3WLEA 2W9BB 1L5UA 1ZP6A 1RABA 1TF2A 1OASA 4MVYA 4DSKA 3DKVA 1TD1A 3JQGB 1J1UA 1G60A 3ABZA 4E08A 3E84A 1ZIXA 4CMGA 3DE1X 1YDMA 3DO8A 1P4HA 2QDXA 3P9IA 1ZQTA 1IOLA 5E2BA 1I24A 2EIHA 2YN0A 4UVGA 3OTHA 4NU0A 2IA5A 1ABBA 2JDIA 2O2XA 5EESA 2O8FA 2HK8A 3L3FX 1VIYA 2OCGA 1OH8A 4WK4B 4D6YA 3WGGA 4B45A 1J2RA 1J49A 2R4TA 4GLJA 2VFAA 2FWMX 2P66A 3MLEA 4HMQA 3UJNA 3OOEA 4FDMA 2FQXA 1AZLA 1OKKD 1ZXXA 1JIIA 1OW3B 3NWBA 1WIWA 1TC2A 5HNKA 1Q3VA 3PCXA 1GZ5A 1OI2A 3EVCA 2RJNA 4QW9A 2PI4A 3BS5B 9ICJA 1Q3TA 2XB6A 1JHDA 3GK3A 2XX3A 1ZW1A 4WZ6A 1KYYA 1EFPA 3PEVA 3ER9A 2KHQA 3VHXB 4XQEA 4ELUA 5HK9A 1KFKB 1RPTA 4PS0A 3RF6A 2W3SA 1P6XA 4R01A 1N4DA 2QQ5A 2H0AA 2ILTA 4KNWA 3TTSA 5LU9A 4EKNB 4N8DA 3H9EO 3ONWA 2EIXA 4IAOA 4FI3C 3QFFA 2YWBA 1UDBA 2SCUA 3H8VA 4TQSA 1M7BA 1H69A 1YZHA 2Y66A 5LB2A 1EVQA 1AHHA 3O84A 1V7QA 2D8AA 4LWOA 3T3NA 3CNLA 3RS4A 1CY4A 3FWKA 3N2ZB 5HUQA 2FSPA 4BLRA 3R40A 3O4HA 3RRFA 3JQPA 2NIPA 4HNAB 2CFTA 2IPOA 3ZDQA 5B2ZA 1KI3A 3HSKA 3MT0A 4GOJA 4UBLA 4QIHA 1JG6A 3RODA 2QZ9A 2GWSA 3LA6A 2AZTA 2HMXA 3ZWKA 3WGLA 3L7NA 4PGHA 1ULHA 1CRWG 4QUEA 3BULA 3HWWA 3P9XA 4E88A 4NNPA 3IOYA 3HJAA 2JGLA 2P0EA 5E6UB 3OQBA 4FWBA 1D6JA 1N8SA 1RTKA 3Q6IA 3UWKA 5CJ7A 5A9SA 1KRXA 3L3BA 3Q40A 1Z0FA 1ULTA 1YB5A 2W2KA 1PK3A 4GUAA 1KIFA 4QPCA 5LIPA 2V7PA 1AK1A 3C5CA 3LLVA 3PW2A 3TM4A 2YVAA 3PE6A 4EMTA 1P2UA 2FPOA 2AX4A 2A4MA 4OYHA 1C3EA 1M1ZA 2QSUA 4JV0A 1S2LA 4Q3OA 1H4TA 2JGNA 2WJHA 1I0ZA 2JLQA 1S2MA 5CRXA 4MB6A 4C4XA 4BRWA 2OXCA 5HFAA 3NT4A 4I1RA 2C2DA 3N2KA 2F8KA 4AECA 4F6RA 4JBGA 2PL5A 4QNMA 4DXDA 4E0BA 5TRTA 4DLYA 4QVIA 4AUMA 4MAMA 5DBIA 4UKDA 1CQJA 3GNQA 1GZ4A 4B9LA 1XQYA 3GJQA 1W2GA 2J3LA 3D7LA 2P78A 4UE3S 2NRXA 2ERYA 1JFVA 1RPJA 1ZA1A 3L5KA 3ICEA 4D3SA 1CDEA 2HW3A 2GEKA 5E9WA 2CC2A 2UYYA 4QBFA 5KB3A 3AP1A 4LZWA 4MVJP 2B82A 3NQ41 1BW9A 3BSYA 2WIFA 5TMPA 4MRNA 1DPGA 2Y2VA 2I4TA 1JHVA 2W03A 1VIMA 1LB2B 5B55A 3R7SA 4UMVA 4YVFA 1LSJA 2QR3A 5GGYA 1FFYA 4IW3B 4K0KB 4E11A 4EHFA 3HVIA 1XTZA 4X65B 1JSRA 3HU3A 3FH0A 3ETEA 2V6BA 4F6LA 3HKZC 1FTGA 3JWGA 2RDIA 3R0ZA 4OHWA 1FDOA 4AKSA 1AQYA 2C4KA 3OEYA 2FEAA 1U48A 3P0RA 2V4MA 3BRWA 2GHRA 2X9QA 1IHPA 4CMEC 1M75A 1XQXA 2R48A 3IPRA 2C4HA 3IC5A 3BCUA 3KXKA 4EKGA 3K4PA 4Y7DA 3R7NA 2K5UA 1Y7TA 4HNVA 1KTIA 1R66A 2QP3A 2PJRA 5GM2A 4GWKA 4Y2UA 3KYJB 1ZVQA 3AFIA 1ZMXA 1JFLA 4IF4A 2WU0A 1JJAA 3TKYA 3ESZA 4ED3A 3RB6A 3CIFA 5LYYA 1UUFA 1CE8A 3NYWA 1FK8A 2IEGA 5J0XA 2WMYA 1JIJA 2WWXA 3KYCB 2M6LA 4HAYA 2KJ9A 5B58C 2NO7A 4YP6A 3HKEB 4JUBA 1G0OA 1IIRA 3FPLA 1WCNA 1QHFA 2QG9A 3AR9A 1UR5A 2CBZA 3IVXA 1O5OA 3AR8A 3R8XA 4UEOA 3NALA 1LNZA 1T29A 3N76A 1K4KA 4ZZ0A 3QKSB 2Q8PA 2VS1A 4RK7A 1Q1EA 4HH4A 2G1UA 1MUUA 4QA9A 1L4HA 1FO4A 2CJWB 4WBXC 1PNRA 4KOAA 2XYPA 2AZDA 5L8VA 1J2UA 4XVCA 2AG1A 3GR6A 3UB4A 5K4LA 3E9CA 4XYGA 3GPLA 3A32A 4MA5A 1M34A 1ZQMA 1JQLB 4UAVA 2M6KA 3I8OA 4LDJA 2A1TS 2BC9A 3BMXA 1N2SA 9ATCA 4DIFA 1M1UA 1SC3A 2KMDA 3E3MA 3O7WA 1UPAA 4L8FA 4Z4HA 2R84A 1UK7A 4LEIA 1O0CA 4G5YA 4F4WA 1GSAA 2WWHA 3MMXA 4YWJA 3UHPA 3WZ2A 3CRZA 2C0CA 1RWMA 5KFXA 3F6YA 2KPOA 4PFKA 4Y2TA 3EFOA 2DR2A 4PPFA 1T15A 4LSMA 2NRZA 3OHAA 4Y1FA 3JARA 4LRSB 4FZJA 3ET5A 1OHHA 2HIAA 4GXTA 5EHIA 1U7WA 2QQEA 1NK8A 1QRUA 1VJ5A 3CINA 1YB1A 3JYPA 4KQXA 1SIOA 3HEMA 4I2NA 5F3XB 5U4XA 4GXKA 1S8FA 1DE0A 1ZC3A 3GYGA 3LX4A 1FUKA 1MT3A 1DEKA 2P90A 2Y1GA 3FNIA 2V3VA 5BSKA 4DQUA 2VP9A 1VJ0A 3F3MA 1EUDB 3DLAA 1P75A 3ZCTA 5G2OA 2X58A 3KVVA 1Z4JA 3UH1A 1IK4A 3U7FB 3IO3A 1TZKA 4W1PA 1ZJ6A 3PEUA 5DU2A 4F9FA 5HKBA 1P4JA 1E6UA 3MJHA 3P52A 4QNLA 3V8RA 4TTVA 3UAWA 2J67A 1E9DA 2MSEB 1NYQA 1P2SA 1HG0A 3D1VA 2DVMA 1ZL0A 2ZJOA 1GQYA 2IHUA 16PKA 4RETA 1R7RA 1ZLXA 4AK9A 1PGQA 3A9TA 2CB9A 3PBKA 4AJPA 3NWJA 4RIEA 1ZH6A 1XK6A 1GT91 2AR9A 2WU1A 3F2BA 2CXPA 2HBYA 1NXSA 3NIWA 3U7QA 1L7OA 3F6CA 4BDPA 1Z06A 2F3TA 2PUCA 4CMKA 3B9RA 1DWPA 4MJ3A 4F2WA 2AG8A 3VPXA 2P3SA 2HF9A 1P5FA 4P82A 2RBKA 3D4OA 3HFSA 3I34X 1JQ5A 3H6KA 4QQRA 5J2DA 5H59A 1CNMA 3PHJA 1HDGO 2BEWB 2PEYA 3LK6A 4LRQA 4LOAA 2JFNA 3S2YA 2HHXA 1CK4A 3RIGA 3IBFA 1M1YB 4J2OA 4HH0A 3E82A 3BXFA 4QJ3A 4OF4A 2CW5A 3I6QA 1R4AA 3Q8KA 1GM5A 2BFEB 4EY3A 2PRIA 4DRXA 1JJBA 1YCGA 3EYZA 2P69A 4C0AC 2NRTA 1ZS9A 5G1NA 4EMBA 3C3DA 1PTKA 2X1MA 3OPYI 5LNK1 3EZNA 5I9NA 4N6GA 3COYA 4MAFA 1SVIA 4DYHA 3KOMA 2VNIA 2H7XA 1UXOA 1P1BA 1KYIA 2XMQA 1IY2A 1Q1GA 3PTZA 3PX3A 2V0CA 1XCMA 4Y9UA 3UMYA 4JYPA 2VJMB 3W7VA 1GKKA 2Y8EA 1QZTA 2YX1A 5JCJD 1KEJA 2NTEA 4PS1A 2XC9A 1Y4SA 2HQRA 2IEZA 3PZRA 2HDNB 1JIXA 4JIGA 1LRLA 1NW8A 2PR7A 3LRPA 1TQ4A 1DB3A 4PINA 4U9IS 1LVHA 3ST7A 3VR3A 2CLIB 1J20A 4OGLA 3B51X 2MWMA 3TSZA 4LHVA 3C3WA 2O8CA 3PXGA 2WYIA 1DXOA 2BCJQ 4E5MA 2JAPA 1J5XA 3T5HA 3GN2A 1RM5A 2L69A 3PCRB 4CV0A 1WW8A 1X7ZA 4FC6A 2QYHA 3VNBA 2CLOB 4MGZR 1PDWA 3AFOA 2JAUA 4MCAA 2F55A 1KA9H 4BO2A 4CKZA 4R05A 1KNQA 1QH1A 3GZJA 3RD5A 3FOEC 3L92A 4GI2A 4L78A 4OB7A 2HA3A 4I28A 1ZK0A 4PHEA 2YOHA 5BWOA 3MM4A 3DUFA 2I5HA 1LV8A 4GP6A 3DC7A 4LZPA 2KVCA 4BVEA 3EF3A 4RC9A 3PUHA 4F3NA 4AJ1A 3OJXA 4ACAA 1XXHB 2YJZA 4HLUA 2AB0A 4H3HB 4RXUA 3QJ5A 1AKMA 3C3MA 3TTUA 2W04A 5CPBA 2HU7A 1H94A 2IUTA 3AERA 5J5CA 5HP4A 3ACCA 1NUHA 1MF7A 3KE9A 4G1UC 2EAOA 2VOEA 3H97A 3WGVA 3JD2A 1L7NA 2FWIA 2VBFA 5DNYB 1D8LA 3RS5A 1N2XA 2V4RA 1JZQA 3O3CA 3O0TA 1X92A 5BSMA 1NQVA 3CS3A 2H51A 1CFZA 4I6JA 2ZIUA 4CDRA 3SFVA 3KQOA 4S1TA 5KTSA 2QV7A 3EGIA 5GJVC 5KG0A 1K88A 1ZUNA 2VJDA 3IFSA 5AHKA 5LOVB 2GRJA 4QU5A 1GLGA 1SUCA 3ETGA 2J33A 1DU4A 1ZOLA 4YGYA 4XD2A 1NXWA 2E4AA 1IFXA 3NUZA 2OC9A 3EXIB 1BJRE 2VYVD 3A4LA 2X0FA 2P3OA 2Z8ZA 1S8OA 1X80A 4XUDA 1P1FA 4PG5A 5LA6F 4KSCA 3N7SC 3SVZA 4ESVA 2H07A 1N6HA 3SLKA 3K2BA 2PANA 5BUQA 3TLGA 1UFQA 3G5TA 3DFIA 2GZMA 3K9HA 3QH4A 4HDQB 2OWOA 3UT0A 5CA1A 5A02A 4O08A 1CQPA 3GA0A 5AXBA 7YASA 2H17A 4F2SA 2Z57A 2W54A 4CQJA 2W8ZA 5K3BA 1J2TA 3IVAA 3FDFA 1B00A 2QQ0A 3STXA 4YRAA 4EKIA 4CKWA 3K94A 1CXZA 3RARA 2H1CA 1J5PA 2GB4A 2FG7C 4KR7A 1H2XA 3M8SA 3ABSB 1TXGA 3WG9A 4ZVQA 1C0IA 2XH8A 2KLHA 5A4FS 5GIOE 1FP4B 1KW4A 4R3NA 2XB2A 4EVRA 1PVVA 2HCFA 4CEIA 2JGAA 4KR2A 1ZMBA 4KR3A 5AW5A 3QU5A 2CEAA 4LDRA 4C30A 3OECA 4X63A 4R7ZA 1SXJC 1CCWA 1RHRA 1Z0KA 1G5HA 4ECWA 4B3FX 2P1DA 4LQLA 4MV6A 1XBTA 4D02A 2RGWA 1O96B 5KYWB 3I1IA 5LZ9A 4WE3A 2WHPA 2YY5A 2ZB3A 3O92A 4IR9A 3QUAA 2PSFA 5DDIP 3FHTA 1IEWA 2MYUA 5JI2E 1HH4A 5F4ZA 4WZBB 2JIZD 1J0XO 1CRPA 3E27A 2OXOA 1KH1A 4I2DA 2QT9A 2OCKA 3SC4A 4DCPA 3ZWMA 2ZS7A 1S3GA 5FUBA 4CM9A 2B2XA 1HNNA 2Q5QA 1E0DA 2F76X 4NV1A 3ENZA 1OBOA 3EFBA 4KN9S 3V7JA 2IW3A 1RMTA 2ISCA 3K8OE 1ZSYA 2QTLA 2VSOA 2D6FC 2ZUSA 3ABQB 3ZU5A 7ICKA 3L84A 1JBQA 5CNIA 4RK0A 3ME5A 2HA7A 3FN4A 3GQBB 4LZNA 4HGOA 2OA0A 2Q4BA 1YS9A 2Q5IA 3EMBA 3ZH9B 4X94A 3HB0A 4R2MA 4DOCA 5CTAA 1E5TA 3GLFB 1QK4A 1NN0A 4P31A 2OD9A 1MRNA 1XYVA 4ZEOA 1N2BA 4QDTA 1P6UA 1N6PA 3KR2A 2FTKE 1C7EA 1HE3A 2DFKB 2IQIA 5AKKA 3D2SA 5C8YF 2QENA 4OBXA 1TJ5A 4RJ2A 3BOSA 4F71A 3BHJA 4TV8A 3FYSA 3HMKA 3C8MA 4MRSA 1XTVA 4ZA2A 2JD1A 3L93A 3RU3A 4N5LA 1VCIA 1E3WB 4DCTA 3VPBA 1LX7A 3EVZA 4W6ZA 4U7HA 3VOTA 1GL7A 1V8FA 3WS7A 1UT8A 2Y0SF 5JYDA 1D6SA 4HN9A 2YMLA 4R5HA 3T61A 2QMYA 3I62A 3PUKA 4B6EA 2X0KA 3OIFA 3NHYA 1VGRA 1YR2A 2FMSA 3EG9A 1DIOB 3QPCA 4YYEA 1TCVA 3OTWA 4R2XA 2B1GA 2O20A 5CBKA 5KX5B 5JXGA 3E4DA 3LP8A 2Q4OA 1KK3A 4WADA 4YT4A 1K6JA 4I1PA 3VPAA 3YASA 4RU9A 4HUQB 4X20A 2V7WA 4ODIA 3OJFA 2VAWA 3TNJA 3K9LA 4M0CA 4IMJB 4NS4A 4F3RA 1VP9A 1DX4A 1G3UA 1H0KA 1MRZA 2FRDA 9GPBA 3IR5A 4BX8A 1Z00A 2XBLA 1F60A 1BFUA 2A5YB 4P38A 1A0OA 4QWCA 3B0YA 1RT9A 5ITSA 4R83A 4AJHA 3EMVA 2BI8A 3DOFA 4CV2A 4IDAA 5JNSA 2XQKA 3U9SA 3PFFA 3FZGA 4K7JA 4KG7A 4D44A 3P0JA 4M86A 2EZTA 1VRCA 1J06A 2QOEA 2IYNA 1G64A 3R44A 2J9FB 3K0AA 1ORHA 1RBQA 4B84A 1KR2A 3M6LA 2CLCX 4B1FA 4UZSA 3GZNA 3ZS8A 4BB6A 5CP2A 5F7ZA 3DCIA 4Q4AB 1ZAYA 3UJAA 4BN4A 1DWUA 3QVJA 1JSXA 4LX0A 2AUTA 1XGKA 2R60A 2E7ZA 4P4NA 2KQUA 1QSYA 1KHTA 3RV3A 2N46A 1V5WA 2O7VA 4YXJA 1BNPA 1ZXBA 3OFSA 1MNQA 4TT3D 2I2AA 1SK9A 4WMLA 1U2EA 4RDIA 3ZBPA 5EXPA 4M49A 3EZ9A 4RNOA 1VL8A 1OZFA 1N32B 2ZYUX 3N58A 4FZLA 4XA8A 4Q6WA 3VXKA 4KE7A 4P2HA 2OAEA 2P4UA 2CNNA 2BD0A 4I9UA 4B17A 3TXXA 2QN8A 4QJ4A 5DM60 3VUFA 1VLBA 4KQIA 2GJKA 4IDCA 4R1TA 4QOFA 3VR4H 2WMDA 3OU6A 4JWKA 3RF7A 4XWYA 3ZCVA 1B15A 3BEDA 1DOAA 1JFFA 2GPTA 2V1XA 4GAEA 1S1MA 2IYSA 2FLNA 4I2FA 8ICWA 3HL4A 4U5QA 4OGGA 4URVR 4YP9A 3IUPA 5L3SB 5C0OE 2RJOA 3VI3B 3EWAA 3K0FB 3LBAA 1V48A 1V85A 1CNEA 2EKBA 5DT9A 3R6GA 3IRVA 1BE6A 1JEQB 4HFRA 1Q0HA 1D2NA 4IOKA 4LBVA 2QYTA 3SYRA 3JWHA 1UADA 1JIHA 4LHWA 1G5PA 1RPLA 2FEWB 4Q00A 4KQ6A 1T6YA 3QBTA 1TK0A 1K3FA 3G9UA 2I91A 2KWIA 3FMFA 1SU4A 3ND9A 1FFXB 4N82A 4TYNA 3RVLA 3B53X 4C4YA 1J0BA 3HZRA 2MSLA 2Z04A 3GGCA 2KEYA 1E4YA 1YZYA 3HZOA 1S9FA 4AI6A 5IYZB 4MGEA 1GNTA 1Y81A 2V03A 1EXWA 2G82A 1V2GA 1TIPA 2V65A 4DPLA 3CLVA 3BKXA 1URPA 3CNBA 2KJ8A 1CS4C 1E1CB 2OGZA 2YXNA 3ZWQA 2VPPA 4QULA 5KOIA 1IJKA 4KN4A 2AN1A 2FPGA 1M8JA 2QM0A 3WL7A 4MYDA 1YL7A 2QW0X 3VC8A 3I83A 4HDOB 2YMMA 4GBED 4NEQA 4BNWA 4RKWA 4CQMB 2D4HA 3NI2A 3WWDA 2AWOA 2XWJI 4G1CA 1CDDA 4J0DA 2ZRKA 4RABA 1II8A 2XA2A 3RNOA 4M9NA 5IBQA 4PHPA 1OFVA 1QZZA 1YNOA 5HIMA 3KYDA 2QX6A 1X1TA 4UU1A 1ZEJA 1RWXA 1HYQA 5COQA 2COEA 2DULA 5I5GA 4BP9A 1JX6A 1PGOA 2J3QA 1SRQA 4CMIA 3NC4A 5DIZA 5AW2A 1K4YA 1GAWA 2JHFA 1PVDA 3ZGVA 5K6AC 2X9VA 2QX7A 2VOJA 2QTHA 2C8LA 5JSYA 1NY5A 1UAAA 1J2EA 4MKIA 1DG3A 5FUQA 1DG9A 1ZKDA 4BCBA 2ZM5A 4GMGA 4DIOA 1WEKA 1OR8A 2Z83A 1RYHA 3GN1A 4ABTA 4IIJA 1T8SA