2JGAA

Crystal structure of human cytosolic 5'-nucleotidase iii in complex with phosphate and magnesium
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRRKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Cytosolic 5'-Nucleotidase II: Insights Into Allosteric Regulation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
total genus 98
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2jgaA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jgaA01
5AVXA 1RKUA 2DQSA 2ZXEA 3CNHA 2WF5A 2WFAA 2WF8A 4Y2TA 3A1DA 3ESQA 3S6JA 2HF2A 2IOFA 5ALDA 1IWOA 2YY6A 4ZEWA 2R8XA 2HF7A 4YCNA 2I33A 1L8LA 1VJ5A 4BX0A 3AR4A 2JARA 2JAWA 2IOFK 2NYVA 3E58A 3J7TA 4HYTA 4HGOA 1QQ5A 1ZRMA 1YNSA 3IRUA 3DV9A 3AR8A 2Q5EA 3EF1A 3I1YA 2HI0A 2YMPA 4KN8A 3UM9A 5AW0A 5AKGA 3U13A 4FE3A 1YJ5A 4UMVA 5AVYA 2D2VA 4Y3UA 2W43A 4YH1A 3KDPA 4Y2RA 4NAVA 4I9GA 5AM3A 3E84A 2YMLA 3WK9A 4KX5A 3WKEA 5AM2A 2R8ZA 3NAMA 4CE6A 2RAVA 1Z5UA 1Y8AA 4C4TA 3ZTYA 2ZBDA 5A3RA 2Q4RA 3ZWDA 3DNPA 3QXGA 5AW8A 1RQLA 1ZD3A 2G08A 3ZWKA 4DWOA 2YJ4A 3WK6A 4UM7A 4BEVA 5AVWA 3U7HB 2JAUA 3TLMA 1U7OA 3AR9A 4YCLA 1L7NA 1Z5GA 2YMQA 1WVIA 4J2TA 2FUCA 2B1QA 3EWIA 5ALKA 1TJ5A 3QUBA 3B8EA 3DAOA 3QU5A 4IFTA 3SLRA 4YIHA 2GHTA 2FPUA 2I55A 3CZ4A 3MN1A 2JGAA 4UMFA 2OA0A 3L8HA 1YS9A 1SU4A 1WR8A 5ALVA 1RKQA 3ZX4A 1Z4MA 1WZCA 4BNDA 2YMMA 2R8YA 4GXTA 4Y2XA 1RMYA 4L6AA 5E0OA 1L8OA 2ZBEA 5AI5A 4G63A 4EX6A 5A3SA 5AKYA 4XPZA 4OCZA 3WKDA 3FM9A 2IA5A 1L7PA 5AIAA 1RDFA 1U7PA 3ZVLA 3WGUA 4BEWA 1Z4JA 5ALIA 3KOOA 5AIBA 3U19A 3MPOA 1L7MA 2WHEA 1RLOA 1QQ7A 2AH5A 4HAIA 1PW5A 4KX3A 3VAYA 3N8GA 2MU1A 4UW9A 4BX3A 3PGLA 1NF2A 1Z4OA 2P27A 3PCTA 1YV9A 1WPGA 3NASA 1J8DA 2B30A 2FPRA 2BDEA 4YCMA 5AW4A 4B6JA 2HO4A 4XOUA 2I6XA 4E88A 3IB6A 5AM1A 3SKXA 3HYCA 2G0AA 4XE5A 4BYGA 4MWOA 2ZOSA 4G9BA 3E8MA 3SKYA 3L0BA 5AHXA 2VKQA 2FEAA 2OBBA 5ALZA 5ALUA 1Z4QA 5AKKA 5AW1A 3E81A 2WM8A 3OPXA 4DCCA 5ALQA 3UMCA 4JDPA 1VJRA 3AR6A 5ALMA 2FPWA 5AK5A 2YJ3A 5AW9A 3B9BA 2C9MA 5AK6A 4AP9A 3I28A 2P9JA 1VFPA 3FZQA 3QUQA 5AI9A 3B9RA 4OFZA 4YGYA 1LTQA 3OCWA 5ALEA 5AKXA 4C4RA 2B0CA 3U7EB 2I34A 2ZBGA 4IG4A 4JB3A 4L57A 5AW3A 4C4SA 4UMDA 4CF4A 3AR7A 5AICA 5AKIA 4DFDA 4NWIA 5AM5A 2FDRA 5AI8A 2Q4TA 1Q91A 2B8JA 2B8EA 1RRCA 2YN4A 2I7DA 4KNWA 4UAUA 3RFUA 2HHLA 3KC2A 2R8EA 4F71A 5AVRA 1RLTA 5AKLA 4BNDB 4EZEA 4HGQA 2NO5A 4KYTA 4F72A 1U2SA 1QH9A 5AESA 3W5DA 3OTQA 1N8NA 3KZXA 2X4DA 4NABA 3WK7A 3SHQA 1FEZA 3GYGA 3R9KA 4YIKA 3KBBA 4UAVA 4RESA 1CQZA 3SMVA 5ALJA 3A3YA 2RARA 2IOHA 1RMTA 2MSNA 1TJ4A 1Z4PX 2CFRA 1Z4IA 3ONNA 1MH9A 3DDHA 4ZEVA 2FI1A 4Y2JA 4UU0A 2GO7A 3L5KA 5AM4A 1YMQA 2EATA 2EARA 5AKZA 1F5SA 4Y2QA 4I9FA 4XQ0A 2G09A 4CF3A 3QU4A 4KNVA 5IT4A 4GIBA 1SWWA 2G1AA 3A1CA 1XVIA 2YJ6A 3PGVA 2W4MA 5AKHA 1NRWA 3U26A 3L7YA 3ZX5A 1KYTA 5AVUA 3SD7A 2RBKA 4Y2UA 2B82A 2WF6A 3D6JA 1T5TA 5AI4A 1TA0A 1Z88A 3WK4A 3QYPA 4Y2PA 1RLMA 3AR3A 4UATA 1O08A 1N9KA 5AW5A 1ZD2P 4DW8A 3L8EA 3AR5A 2G07A 4BBJA 3NUQA 1AQ6A 1ZJJA 3QLEA 4Y2SA 4Y2YA 3FGOA 4UARA 5ALFA 3ZW7A 1Z4LA 3MMZA 3QU7A 3ZVMA 3ZVNA 2JAOA 5AK3A 3L0CA 2PQ0A 3L8GA 3W5CA 1RKVA 3WKBA 3WGVA 1CR6A 3QX7A 2G06A 3W5AA 1NNLA 5AVZA 2C8KA 2W11A 4UU1A 3QNMA 5AI6A 3WKAA 3IJ5A 2CN1A 2EAUA 2ODAA 1EK2A 2WF7A 3BWVA 4FYPA 3BA6A 5T41A 2OM6A 5AVTA 1YDFA 3SF0A 2HDOA 3QU2A 3OCXA 1Z4NA 2FPXA 3WK8A 2NO4A 5AW2A 2G80A 1EK1A 5JJBA 5A3QA 1TE2A 2IYEA 3N5KA 3N28A 4PNHA 1K1EA 1L7OA 5AI0A 5AW6A 5ALTA 2GFHA 2AUTA 3QUCA 4BKMA 1T9ZA 3PDWA 5ALLA 4EEKA 1J97A 3EPRA 3ET5A 3OCZA 5ALYA 3OCUA 3M9LA 3UMBA 3P96A 1Z4KA 4ZEXA 4QQFA 2GMWA 3N07A 2B1RA 3WKCA 3NANA 1ZOLA 3NALA 2BDUA 4NFLA 1RQNA 4NV0A 3FVVA 1ZS9A 4HGNA 5AW7A 3F9RA 3FPBA 5FP0A 3MC1A 3L8FA 4OHFA 2YBDA 4CNQA 4FFDA 3NIWA 5AKJA 2I54A 3QUTA 5ALRA 5ALPA 5AVSA 3U7GA 2RB5A 4BX2A 2CFTA 4MUMA 1XPJA 5ALXA 3QGMA 2HX1A 3WK5A 2OYCA 3W5BA 1JUDA 5ALHA 4HGRA 3ET4A 2C88A 3R09A 3RF6A 1S2OA 3UMGA 1ZRNA 4J03A 3K1ZA 5IS2A 4EELA 3HLTA 5AVVA 4L6CA 2ZG6A 2P11A 1O03A 2BY4A 3L0YA 3KD3A 2GHQA 2HCFA 2HSZA 5ALOA 3N1UA 4O8CA 2WF9A 3I6BA 2QLTA 2ZBFA 3QU9A 5ALGA 4RETA 5IT0A 4AS2A 1L6RA 1ZD4A 1X42A 3AR2A 3EF0A 1LVHA 3A1EA 4QJBA 5AK4A 1RC8A 3ED5A 4HGPA 2O9JA 1RPZA 3I76A 2PKEA 3ESRA 4UM5A 5ALNA 5AM0A 2AGVA 4Y2VA 3OCVA 1XP5A 3ZI4A 5AKEA 3U7FB 4H1WA 3OCYA 3ZTWA 1S8OA 4UASA 1RMQA 1Q92A 4OD0A 2C8LA 5ALWA 3R4CA 3ZU6A 3ZUPA 2C4NA 1SWVA 1U2TA 3FPSA 2AMYA 1QYIA 4AS3A 2PR7A 1U02A 2FUEA 2YJ5A 2O2XA 4UMEA 2HEGA 3L1UA 5ALSA 1T5SA 2HOQA 3M1YA 2CFSA 4EX7A 4CF5A 2P69A 1QQ6A 3NRJA 1ZD5A 2QYHA 2FPSA 4EENA 5AVQA 1TJ3A 2YFYA 3L1VA
chains in the Genus database with same CATH superfamily
4N82A 2P6UA 2XYRA 1ODLA 1T6ZA 1QRDA 2EX0A 4F06A 1V7QA 3OPMA 3G0HA 1YZUA 1DKRA 2EV9A 4MQ6A 4NBTA 4OA5A 4URUR 5DYIA 3STVA 4FWIB 1BDBA 1DBPA 3OOJA 3AB3A 2FJ0A 2RK6A 4FGKA 8ICQA 4NL9A 3MTDA 4N5NA 4O4LF 3VTAA 3G5TA 2Y27A 3L6BA 5KQLA 3KQSA 2V9CA 2IYFA 3TLCA 3FPKA 1EPUA 4Q4CA 1EQAA 3DJYA 3SNHA 1PR5A 4KO1S 3EUEA 3VZSA 1U3GA 3P2OA 4U2DA 2FEMA 1TK8A 3LWBA 4Z8YA 3QBVA 4HYTA 3R8CA 1THGA 3U7RA 4FBTA 3NM4A 2IDJA 4YVFA 2VQDA 3RSZA 4B9AA 2I6SA 2NT3A 3H1PA 1NUSA 2ZBPA 4IZOA 4DIFA 1W1UA 3D4PA 4CMKA 1CYEA 2C2RA 1TV9A 5ARDA 4B9MA 3EDYA 4I2FA 3KAQA 4QC2A 1YZHA 4JK3A 2YMLA 2ZRKA 4TYQA 1IYZA 5GY7A 4XJSA 4F4YA 2Q3MA 1XK6A 3Q8SB 1ZX1A 4FJ2A 3KDSE 4L5YA 2G72A 3I1JA 4G1BA 4KR2A 2Q99A 2B2CA 3FLMA 3IUNA 3SP1A 4OHMA 3CYMA 2JCYA 3EQ7A 4QZDA 1SB9A 4INAA 4L5CA 2PMCA 3ON5A 4KN6A 1VA5A 1ZCFA 2XTMA 2AG8A 2VTKA 1RXCA 3FFTA 4M9ZA 5H0IA 3HXPA 4RGYA 1DFHA 2CZQA 1ND5A 3DDSA 3IIKA 2FFJA 1XI2A 2G08A 1AO3A 3L05A 2VJPA 3GLVA 3NQ41 1LPPA 5ESDA 2GAIA 2AHOA 3P9RA 3FNGA 1ONPA 2E6KA 5HOQA 3T7SA 1B6GA 1S01A 2Q62A 1BGWA 4KGXA 3SAHA 3KZIU 3BWBA 1M2WA 5E7MA 1YCGA 3NVVA 3HKCA 3QLTA 3E2EA 5IANA 3QFSA 5CEJA 1HE2A 2IC5A 5AJVB 5KX5A 1SHLA 3DM9B 4Y0NA 4OPMA 2GVNA 1TADA 2HDNB 2OENG 3LOPA 4HNVA 4KYVA 5J3JA 4HAZA 4IIYA 3QU5A 4IFTA 4IXNA 1YBHA 4JQCA 4MUJA 2ISSD 5HR5A 3FSEA 3DWEX 2JHDA 1AS2A 1NBHA 1CXZA 2XWPA 4LYDA 5JXIA 4UB2A 3TOCA 1OH7A 2QTMA 2KJ5A 3DB1A 3RSQA 2YX8A 2J0UA 3E3MA 3SLKA 2CYBA 1D7AA 3NFYA 1T0PA 3FOWA 3TMKA 2W6JA 2WHPA 1IUOA 3KELA 4J49A 4POAA 4LAFA 4X7RA 4YC7A 2F77X 5CB6A 1DBVO 4JWMA 3SENA 3B53X 1ZJ4A 3O3NB 3OPNA 1Z2OX 2YCLA 2CXQA 2QAGB 5KNBA 3MT8A 5KYGA 4OJTA 2XB8A 5FTKA 1M6YA 4JHLA 4XIYA 4X84A 2VA3A 4BKPA 4KWHA 3OBBA 4C7BA 5JQWA 1OLOA 5A5EA 1X3LA 2UYQA 1LQTA 3ELBA 3FUTA 1CR1A 4UAZA 1BS1A 1RM3A 1N92A 2GETA 2WMYA 5DYYA 3QEOA 5FYQA 3NDJA 3VSEA 4EUSA 4KE9A 4QE3A 1N2CA 1NZBA 1W75A 2DTEA 2NWQA 1SBCA 2PZAA 4CN8A 2CLOB 2ID4A 3UGQA 5GIOE 4CQMA 2QZSA 4J1NA 2W3SA 4DE5A 5DI3A 2FF5A 3FPHA 4OLHA 3TSZA 4M7OA 5AIAA 2W8LA 3RJIA 1VMEA 5KOHB 1NQ5A 1RI5A 3G7UA 1LV7A 1RDFA 4N54A 5LDDC 2YXBA 4Z0HO 1OFUX 1ANKA 3HYRA 3K0HA 1UDBA 1QG0A 2J33A 1U9LA 4FBMA 4FFWA 3UMSA 2BM0A 4C7JA 4L0QA 3UMYA 1CF9A 3CW9A 2EKQA 2YR0A 2OD9A 4B3BA 2ZRFA 4NM2A 1NQXA 2YXLA 5EJ5A 4ZI2A 4YPOA 4QGFA 2FEKA 3MJFA 5CX1A 1UMDA 5JUWA 2XC9A 3LLCA 4RY8A 2AXPA 3RH0A 5FLKA 3E0QA 5JZBA 3JVIA 4JYMA 5KU7A 5KWSA 1UKYA 4LWOA 1R9GA 2XT9A 1FA9A 1XZDA 1YQUA 3M6XA 4MV3A 3JARA 3ELUA 5CB8A 5D84A 5IJ0B 5EZ5A 2O14A 1KFDA 1W36C 2A0XA 1G5TA 1HT2E 3FUUA 3IUBA 2CHQA 1V43A 4KBGA 4W99A 3NHBA 5C4GB 1Q0QA 5DLDA 4MWBA 4PGXA 2NVUA 5KSWB 2B4AA 2Y66A 2BZ1A 4ZYVA 4RH1A 4I8DA 1I3CA 3IB6A 2ANBA 3TNYA 4L75A 1WB4A 4XFJA 2FWBA 3ITKA 3AVYA 1K68A 2I2WA 1AX9A 4TV9B 2FE4A 3E22B 5L51A 3LFHA 4BTEA 1H23A 5IFKA 4BV9A 4FDUA 5IG2A 1IBSA 4MWCA 1DB3A 1S0UA 4I4NA 4ZDIA 1JMSA 4Y30A 5J5VA 1SOAA 1T2UA 2BMWA 1PGPA 3O90A 3QWAA 4FN5A 1EZ1A 1K7CA 2BI4A 3D64A 1A50B 3RVMA 4TN1A 2KB0A 2JFHA 9ICTA 2Z6UA 1J0EA 3IHWA 3W4KA 1PWHA 4YJKA 3D4NA 1Z4QA 2Q5QA 5E6UB 3OKCA 1DAKA 2BFCA 5LCXA 1Y5RA 3TTYA 1M8PA 3NBAA 1WW3A 5LJLA 3DV2A 2K4PA 1NXWA 2AU0A 3RM3A 3OWHA 3KJHA 3ST7A 3OQJA 3ZGOA 3Q8PB 3AETA 3A6ZA 3BJRA 1GVHA 3TRJA 4O3MA 5A6SB 1G21A 2J48A 1VDVA 1Q7RA 1T8UA 1Z45A 4FINA 4LNUB 4C2UA 4MVJM 3Q72A 5K20A 3P9YA 1BN6A 4JC5A 4JV5B 3WB0A 3JQ8B 3BOSA 3FIUA 4LF6B 4AP9A 3L4KA 4NOMA 3IILA 3WWZA 1N34B 1N2GA 1TM1E 2R6GA 2X0FA 3WMGA 1BPEA 3HWWA 4E07A 3QV1A 4LECA 3V3KA 4URYR 1YWGO 4YMUA 4ROSA 2EWMA 5CDYA 1SZJG 4PLGA 5CGZA 4DNQA 1I6WA 2YZMA 1K4KA 1YQGA 3KKLA 4Z9XA 3HTXA 5L3QA 4N48A 5A7FA 2FQXA 1V8OA 1QPZA 2A3NA 2KBEA 1NGSA 3EA0A 3M4YA 5EE1A 1OVMA 4JLPA 5E4FA 1IPEA 1CQJB 1C30B 3UJDA 1UFRA 3AG5A 4ZZ0A 2X5JO 3AESB 2BCEA 5CVDA 3VOAA 2ZUBA 5CXSA 1D3AA 2YJTD 5EZYA 4UB4A 3S2IA 3FTNA 4QZVA 3FSRA 3SVLA 1ZOSA 3FDZA 1M66A 4ZQIA 4JV0A 2J09A 4QXRA 5LQAA 4TLBA 2OILA 3ZW9A 4W8GA 5A0LA 5A3VA 1RIIA 1D5WA 3FTPA 1K3UB 4R9SA 2VAPA 4FWTA 1QTNA 1Y33E 2J85A 3LPAA 4KQGA 4X5OA 1TNDA 4B4OA 2B8EA 2IZ7A 2PEZA 3P2KA 5FNVA 4BVJA 3UV3A 1K1QA 1GPH1 3AC0A 3E8SA 3MTBA 3TKLA 1XDGA 2REXB 2OOSA 3GJ7A 3N2EA 3RFUA 3I83A 2QB0A 5LU8A 2ASEA 4XQCA 3UCXA 3SY8A 2ZUCA 5AKLA 4O5CA 3SF8B 1XF9A 1RU3A 3VO8A 5GAJA 2Z4RA 4H3SA 1A9PA 1E9EA 4J9SA 3O8BA 4NABA 4RCYA 5BPCA 3CF4G 3TTUA 2H51A 3X3HA 2AQ4A 3OM8A 4Y6QA 1UZMA 2H1FA 1D2RA 3SHQA 3V1KA 1JPVA 2Q0ZX 2PH7A 4I4TB 5JYEA 5KWEA 2PYDA 3IB3A 3PEVA 4RZHA 5EWLB 1XTQA 4DDVA 1EFUA 3ANLA 3WHIA 5ILQA 4ZI7B 2VTDA 4ZREA 3AH8A 4M0CA 1W19A 3QOFA 5A9TA 4F3YA 1L5YA 1QOPB 3S8MA 4IO1A 2ZXIA 1FIQA 4QJFB 2HZBA 4DT1A 5IC4A 1V41E 4C9BA 5FT9A 4LOIA 2D4HA 1KW4A 3RRGA 2JAQA 4UNNA 3ZY4A 1R15A 2LWIA 2VBIA 3DL4A 2FHPA 3HP7A 3RABA 3ZGXA 5LR6A 3IR5A 5F3WB 3HO6A 3P0HA 3TS1A 4BZPA 3HDQA 3IMEA 4MLPA 4YNBA 1B0UA 3TH5A 3M3DA 2X22A 4TYMA 4PGMA 1M2FA 4TV8A 4URVR 1W48A 5KKAA 3R5KA 4RW0A 1N6LA 4O2BA 4F86A 4BNLA 3ZDEA 4F5EA 3L5KA 3KK0A 2IS1A 3O2JA 1VRCA 1KYWA 3B36A 5ELMA 3L6EA 3KUKA 1IVNA 1UKEA 3L6OO 2C31A 1FZQA 2B69A 3QE4A 5CBPB 5ETJA 1QZTA 3NIBA 2XUKA 4D0GA 3TZKA 1JDPA 4REQB 2DE0X 5D51S 2RJOA 1B8NA 3OEYA 4XJTA 3V1NA 4EBEA 1SXIA 2ZVJA 1D5CA 1JQEA 4B17A 4BNYA 3VSAA 4NJ8A 3UA3A 2XA2A 4YWJA 5A4AA 1Y8RB 1J9GA 1JIIA 3GFKB 1R64A 4OYLA 1HLDA 2CJWB 2QUHA 3WWCA 1YI0A 4EB6A 3BK2A 2OCBA 4RTRA 2Q4EA 1V0JA 3X1YA 4QT4A 4K9SA 5A3JA 1UOQA 5K01A 4TV9F 4J91A 4RK7A 4RV9A 1JWLA 2GWHA 3WK4A 3UK0A 4CLDA 4EAAA 2OXEA 3QYPA 3NT5A 5G02A 4KGDA 1SV0A 2W6ZA 2M9NA 4KLAA 3RIGA 4D2IA 1SKMA 1EFAA 3SQMA 1H8HD 1SXJB 1BZYA 2I66A 4RZIA 2WJJA 1CVRA 3W9BA 4DA8A 1AHNA 2OAEA 3HFRA 1YRLA 3Q8LA 3GFVA 1IY2A 3WRVA 3AI1A 1P2TA 3O9ZA 4AURA 1Z28A 4P4SA 1CUZA 3CSSA 5EZSA 3W1VA 3TRKA 3A32A 3QEMA 3WJ2A 4ZN6A 2CE7A 3LYLA 3ITDA 2Y67A 3OPVA 3HNPA 4I46A 1QVRA 4B3DA 1F4VA 3DDWA 5ECYA 2DY0A 2B4RO 3OA0A 3G6KA 3GZNB 1CETA 3LCUA 1U8ZA 4U7GA 4TV9A 4BB9A 4US0R 4IOMA 3V7KA 3GUYA 3HDVA 3QU7A 3L93A 1FP4B 4E4RA 2I62A 5JAPA 4LY9A 1WB9A 3GLUA 1QNLA 3OO0A 2ZE7A 1GPMA 3EZLA 2X2EA 4XH9B 3ETCA 3ZNQA 3E3NA 4C0HA 1GCAA 3KKAA 2OH2A 3L40A 4M22A 4K6OA 4BKRA 5LL6P 4E2FA 5E7IA 3A8TA 3H5TA 3BJIC 1UDXA 1U8FO 1Z06A 2D6FA 4BQNA 3IBSA 4Z5XA 4WA8A 3A0HU 1SIUA 3BHMA 4IMIB 3SDBA 3M1IA 4BTVA 4ND4A 4DMMA 1TC2A 2W7PA 4B7XA 2O0MA 4Q1VA 5L53A 1TT5A 3GCXA 1BQ3A 1MN8A 1EYZA 3L7LA 2IUTA 3M6UA 2XB4A 2JFGA 4M46A 5T41A 4HH4A 4FFVA 3ZWAA 4PCVA 1IPFA 2ZI5A 2ATEA 2EJVA 1QYCA 4L02A 2FSGA 3SJCA 3C41J 2M0NA 2O3SA 1JIKA 4BVHA 3ONDA 1MRNA 5KTYA 2XO7A 4ZWNA 1QBKC 1ZSVA 1KORA 3DBVO 2QX9A 1L8XA 4DEVA 2JEIA 1IN7A 2ACVA 4BFYA 2WD7B 3DLIA 2XNSA 3N5KA 5D6OA 1FTYA 1OZAA 4TVKA 4O5EA 1AQIA 2BLNA 8ICHA 5JSUA 4P0PA 4O4IB 5B7PA 1UFQA 1E5DA 3GVIA 1CY7A 4RHFA 2YKGA 1ZUHA 3MUOA 1G3UA 1BEUB 2WZDA 4ZYZA 1DPFA 4IAOA 4PGAA 4MQUA 1MTZA 3Q40A 3EC7A 3OCZA 4DSAA 2ZIWA 5GINE 1BPBA 1YFJA 3JQGA 3OT1A 1VLVA 2SECE 3ADOA 2FLLA 3NXSA 2QXUA 3PLRA 4FWBA 4IDEA 1M2VB 1AXEA 2EFHB 3BKXA 4J9KA 2YX1A 9ICVA 4MRPA 3NALA 4F7DA 1PEYA 1HTTA 1PO7A 1FDVA 2YHIB 5KMGA 1XNHA 4HNGA 4FYXA 4ENVA 4UXJA 4QT0A 4BEJA 2W9XA 3LPMA 3F8TA 3JSAA 3QBDA 3NAGA 4AB1A 4F2GA 1MJ5A 2CMDA 1NZPA 1D9ZA 3HLKA 3ND6A 2EZTA 4GD3Q 4HGNA 2JI4A 4YJDA 3T3EA 2ZWPA 4M9NA 2FWIA 5G0SA 4WKPA 2AOVA 3FWHA 3IEVA 4IP0A 3L8FA 4YP7A 1JQDA 4ECXA 2EQ5A 2R66A 4R8RA 2I54A 5C5EA 1Q2XA 4HK4A 5DJ5A 2EKPA 2R47A 4Q48A 5B6JA 4BX2A 2FV8A 8ICXA 3DVLA 3RTGA 1BW9B 2H8GA 2OGWA 3BTOA 2QRHA 1R9NA 4FFMA 2C42A 4GWLA 4QUHA 4RLFA 2BQRA 1RZTA 1BWPA 4AICA 1JUDA 3MTAA 1V9CA 1BEEA 4PBTA 4S0XA 1PBNA 1XUOA 1ONBA 3OLXA 2C88A 3JR7A 4I4CA 4FDVA 4YRJA 2VJKA 3LYUA 4BNIA 3OJLA 1ZIXA 2J0VA 3I61A 3A70A 5KFBA 4F50A 1HLPA 3OH8A 4QO7A 4X93A 5BYJA 3UQZA 4CU5A 1LDGA 1SZHA 1RVV1 1OE0A 1KY2A 2OKCA 2P9BA 2VZ8A 4E5SA 5I51A 4FDTA 1HNXB 2NM0A 1G7SA 4OHUA 1H3EA 4OM7A 3DBHB 1VPEA 2R8PA 3HJRA 1A5ZA 4FOSA 2JC3A 5J0OA 1KAMA 1KVUA 3HDHA 4MUGA 3DFMA 3BMOB 4UEQA 3L06A 5JZMA 4FT4A 1RE0A 3ZIAD 3QU9A 2HN9A 2ZTVA 4IDOA 1ULSA 5BW5A 1Z83A 2O2EA 3X1DA 4D8UA 2G1JA 2AI2A 1OOEA 1ZPDA 3CLRD 2PUVA 3GGSA 3TQTA 5K0NA 1O95D 2HWXA 2IXAA 4QTUB 3N8DA 5B4UA 4JCOA 1KEUA 5AM0A 1KAGA 2C5HA 5DHUA 3TX2A 1T8EA 3AFNA 4QBFA 3OCVA 5L9XA 3UHFA 1GAXA 3HKZF 3KL2A 3DWGA 3ZCTA 4Z7OB 4DB2A 3NYRA 3G13A 4ELUA 1EFKA 1XV5A 1NF8A 1AZWA 3BWCA 1V3TA 1XR3A 8ATCA 1KGSA 2QTTA 3BMQA 4TQSA 5EHQA 5K3EA 1C5KA 2NV2B 1KKLA 3S4YA 4F11A 3C3KA 5J47A 1OH8A 1E6MA 1YA8A 3NS1A 2YJ5A 3FCXA 4KQJA 4YUYA 1Q1ZA 1JKJB 1R5JA 4QQRA 3DOOA 3MAJA 4YRBA 4ZZIA 2CMGA 3BAZA 3BCSA 3O03A 4EPTA 3IHQB 1ZVQA 5LD2C 3NZEA 2QD2A 1C4XA 1EK5A 3BJEA 2W70A 4PINA 4A6XA 1ZD5A 1NXOA 4EY6A 5K6RA 1KDPA 2C5SA 3RCBA 2AI3A 3B13B 5KJ6A 4FMDB 1SUAA 1E2JA 2HL6A 2ISCA 4AM8A 4BMYA 3T1TA 1NV9A 2ZT5A 4QGHA 5AVXA 1JG1A 5DCWA 3IEMA 3D7MA 1JR3E 4D9BA 3PS9A 3CNHA 5BSFA 2XICA 3FBGA 5ALDA 3FZNA 4MA5A 3PW4A 4CQLB 3HV2A 2P8SA 3IEKA 1L7RA 3JPOA 1J8VA 4Q3EA 4NMXB 2JGLA 3UMRA 2CNWD 4RDHA 3KVYA 4BNZA 1U48A 3THRA 1ELOA 5CA1B 1TAGA 1DIHA 2JKYA 2HRZA 3EXG2 3W8FA 4J9MA 3G79A 1AGNA 1G19A 4HN9A 2XQKA 2BFEB 1I10A 3E58A 2CBGA 4LUCA 4MMZB 5H8WA 1GFIA 3IKTA 2OV1A 2V98A 3AR8A 4IWNA 4P9NA 2QXTA 4M8SA 1YD7A 1M2OB 5ILGA 4Y9RA 4B3RB 5LQRA 5AVYA 3AUUA 3C6XA 3DPIA 3UK6A 3LYSA 1H1LA 4YH1A 4LHEA 1EUDA 1L5SA 2ZWAA 4I9GA 4DSLA 2P3QA 2QMHA 3VPFA 2B36A 4GFJA 3WK9A 1C1DB 3AF4A 5IJWA 4EA6A 4DKJA 2OYCA 4YJ3A 2OG2A 4Z1MA 2MAXA 2G82A 2GJAA 5FX2A 4B35A 4BV2A 1IWBB 4P4PA 1ZH2A 5K0GA 3OJSA 1MAAA 3N4MB 4ECRA 2IW3A 2Q4RA 4RV5A 1NVDA 2NVBA 1QORA 4IMPA 3DYBA 4PLCA 3WL4A 3RVBA 1GZDA 4TTVA 3G1WA 1OU0A 5KG7A 2QOEA 3RB3A 2RCNA 2H5EA 2C5FA 4FYKA 3AY0A 4BNNA 3ORQA 1ZNXA 5D3ZA 1N8SA 3GCGA 1N6KA 4R1NA 4JLWA 4FBLA 1PZHA 1T2EA 2BHSA 3CNQS 1TYAE 2E4WA 4E21A 3V4PB 4EB0A 3NH6A 3U7QB 3DVAA 3TW4A 2DM6A 1U7OA 1V8BA 3GGGA 4Y18A 4TTAA 3CLHA 2C0CA 2QG4A 3IDWA 1KP9A 3E27A 4KVGA 5K8JB 1H65A 3S1AA 4IXMA 4DFJA 1D2MA 2X2PA 4NYJQ 1C9YA 1VHJA 5TPWB 4LBYA 3T7TA 3TBHA 4DABA 2O05A 5I6DA 4HO1X 1N6HA 4FB4A 1E5LA 5JCPA 4RXTA 1ODJA 1UJMA 4BPBA 3UWDA 2GQ0A 1DE0A 3Q3VA 1ZR4A 5SZHB 1WQ4A 2OO5A 4HZIA 1M2GA 2FPUA 3DZJA 1YOBA 3AHCA 5HDQA 4BJ1A 1CS0B 3C24A 4MJLA 4UMFA 3AF6A 5HILA 5EIBD 1QHNA 1O4VA 4GXNA 3L0OA 2WG0A 5EOZA 3CRVA 3TBKA 4PG4A 3F2IA 3SEAA 4G09A 2FN4A 2CLDX 3II6X 4O2RA 2J0QA 3B48A 1ZQTA 1X8XA 1URPA 1QZZA 1UPAA 4QPZA 4Y6GB 3CZ5A 4ZAVA 5H59A 3TX6A 2BGTA 2X15A 2DBVO 3DNFA 4MR9B 1AXGA 2RIPA 1LLQA 3BX1A 5SV2A 3ND8A 2J5KA 2X1HA 3OURA 3T95A 2OLKA 3O31A 4UDYX 1NUUA 2GB4A 2GYYA 2OBNA 3H9GA 5GM1A 2VK8A 3PQ2A 4P0TA 1KYZA 4U8GA 1EJ2A 5ICCA 1CS4C 2BD0A 2BGIA 1QRSA 1ILWA 4Q1DA 3SC6A 4PCAA 4YAUA 3W04A 5BV1A 2AEJA 3NVAA 2EJCA 3KOOA 1ONSA 4O25A 5I01A 1NG9A 3RANA 1RJ9B 4R2HA 1OWMA 4YRRA 5EI5A 4H60A 4F2DA 1OFGA 5IAJA 4BE9A 1VSVA 2P4HX 1GAEO 1NMYA 1THMA 2NZ2A 2AOXA 2CPRA 5GWXA 4DEYA 4LIPD 3SBOA 5FO1A 2C1XA 3VDMA 4H7PA 4ZT6A 5J0XA 3H17A 4QLBA 4XIJA 1OT5A 3HM2A 3GLIA 3PX6A 2C8VA 2C97A 3F5AA 2P27A 1NG1A 1JL3A 5CPFA 3FKJA 5JW6A 3VSCA 1R66A 1SC9A 1LPSA 4UB8U 2OEHA 4ESVA 5AW4A 5TPZA 2JEFA 4R9VA 4ECEA 1C2YA 1G98A 1PJ2A 2ADMA 3HYLA 4RJKA 3NXKA 3KOWA 2JIPA 2ONCA 3LA8A 2XKBA 3QVXA 5CH8A 1FLAA 2BLLA 2Z8XA 5BQ3A 5L3VA 1Z6TA 3CLUC 4HDRA 1IBLB 4B2PA 4U5XA 5COQA 4R71A 3GLGA 2H3EA 4XCVA 3ZE8A 2J4CA 1WRBA 4U2KA 5BSUA 1A04A 4JR2A 4KLCA 3E8MA 2WPNA 2VIXA 1QIFA 3IBYA 3D3JA 3MRXA 5HKOA 4YCDA 1T3ZA 5IWAB 3BXGA 4BLRA 2W3RA 1G8MA 1O58A 3DO5A 1X38A 3ZXXA 2PTHA 4G97A 3Q12A 2AE1A 2V7QA 5AKKA 2C2EA 3LZDA 4ECTA 1GADO 4XW2A 4CKBA 3OPXA 3D2SA 1IQ0A 1XKXA 2G0NA 1XZEA 3BKWA 4WNYA 5FUBA 1YS1X 1NBMA 1NYTA 1GRQA 5J0PA 1JIVA 2WIAA 2O0HA 1FX0B 1BMDA 3SJZA 3SSAA 1MQ8B 4MKRA 3EEYA 3FIJA 4ZVPA 4QTZA 5H02A 2O07A 1OC4A 4TWRA 4WD3A 5KDDA 1K5HA 2F64A 1Y3DE 4BUGA 4KPUA 3VHQA 3H1FA 5BMVA 1KJWA 5JALA 1ACMA 1AHHA 1CUKA 3DVRX 3EA4A 1SC1A 5FBLB 2XTNA 5J2TA 4KUHA 1PL6A 3V9PA 1OB2A 5KFPA 1Y7TA 2RONA 2QX7A 4DIDA 3B9RA 5LP1A 1H38A 4YREA 2BPOA 4DUGD 3QIAA 5C4IA 2VDOB 3U7JA 4B9SA 4MIYA 4CEJA 2XVZA 4CKCB 3THWB 5TMEA 3TIIA 4R63A 3VSDA 2Q5HA 3U7QA 2QUIA 3OMLA 3C21A 3Q5GA 2O23A 521PA 3ZU4A 3OQPA 4QZEA 1X8LA 1HQCA 4X1KA 4JKYA 2PXXA 3PWZA 2UXDB 4KMOB 2B61A 4TMYA 3U40A 3W9UA 1TO1E 1KIAA 1FMTA 5KEIA 3T99A 5A1TA 4V03A 1R0RE 3O83A 1GZSA 4YDQA 1MT0A 2Q4TA 1GGNA 1U2EA 2MSDB 2B8JA 5AVOA 4E5PA 5HZMA 3BTUA 3ALRA 2CB9A 3P9IA 2NZUG 5TQ0A 2CJFA 1Z7GA 1PS8A 3CNNA 4JK1A 4B4DA 3PQ8A 1TUGA 4MKZA 2J3DA 1B43A 3A1SA 2EFJA 4ZK2A 5BPFA 3RB6A 2VRCA 2RHRA 4G1VA 1OBHA 3TEFA 4F1KA 3GQBB 4CM7A 1DJNA 3V4OA 1RQ7A 4FBUA 1AGPA 1U2SA 1QH9A 1TF2A 1SQ6A 3MCZA 4X6XA 4CM4A 2G5TA 2PPLA 2WU1A 4OFBA 4J3NA 4RPGA 1N8NA 4FMCB 2EERA 1NU6A 4J0CA 4PZYA 2PUAA 1JR2A 2BR3A 2C2ZA 5CP2A 3H87A 3GJ5A 2O2YA 2BMAA 3RB4A 3MJEA 3OFSA 4Q05A 1C3VA 3FW1A 3WGNA 4CFYA 4US2R 1NX9A 4OO3A 1A82A 3KBBA 1FDTA 2DY1A 3EGXB 4JSTA 4P4LA 3RHFA 4O33A 2AE2A 3HR4A 5KFRA 4MR7B 4PNEA 3AKEA 3LM8A 2F1OA 3FOFC 4C76A 4ED3A 3A6LA 3UQYS 3WNZA 1NJ6A 3UT0A 2DHRA 2XVYA 1P2GA 3MZ0A 4HS4A 3B1XA 3W1WA 4QNLA 1G1MA 1N1EA 4UOQA 3GEBA 2H00A 2H52A 1CEXA 4FP9A 1ENYA 4LDNA 4JJIA 4A8TA 1GPYA 1TJYA 1BRMA 2PH1A 4XR4A 5CT8A 2QT1A 3WYAA 4HRYA 4BMZA 1TLFA 3DW1X 1CUHA 1N5RA 2H3HA 5I47A 1I1QB 2EFCB 5FI0B 4QECA 4WEOA 4D96A 1SK9A 3LZCA 3EIUA 4L8WB 5CVUA 4A0RA 4EG6A 3U4QB 3IKJA 4ZEOA 3FHLA 4P2BA 4UAWA 2G1AA 2VNSA 4YT8A 2NXWA 4JLJA 1S2MA 3BL5A 1PL8A 3PGVA 3TLXA 5KQPA 2GCIA 1UM9A 2OCGA 3EOBI 3X1MA 5DCUA 1W49A 3R6WA 5LSAA 4E33A 2ZTUA 3BSYA 5JBNA 4MWEA 4E2ZA 1BD4A 3L9WA 1MX5A 4DL9A 4JNCA 2LPEA 2IXTA 2GBPA 5A7GA 5AJTA 3O26A 3PITA 3HABA 1TA0A 3UENA 4Z4EA 2COEA 3OOHA 2C83A 4JMPA 4PF1A 4QZFA 2LUOA 1AKWA 1DRWA 4IHJA 2JKZA 2W58A 4CNBA 4CIAA 5L3RA 4DW8A 4ZIRB 1M8KA 3AMVA 5JYCA 4OSEA 2Z08A 4ER0A 5EFZA 1CBUA 4Q01A 1QKKA 5FWAA 3BTSA 2WT9A 3OHBA 1P45A 3H5IA 1O6ZA 3K0CA 4LPKA 3TQOA 3Q6IA 4E15A 1OAOA 4P86A 4Q6BA 1W36B 3A6EA 4UUNA 8ICAA 1U9CA 3EASA 2W03A 4OJQA 1RQPA 3CPEA 1PN3A 2XUHA 5HIKA 3K0FB 2DJIA 2OZKA 4BN4A 2W2TA 3BFVA 3L7IA 4W7SA 4QTYA 1Q16A 5C7IO 5DLFA 1K9SA 1N8KA 4C3UA 5FL7D 2I6TA 2V0CA 1PL0A 3ZVMA 5MHTA 2ZSDA 3RO7A 4CWAA 1N1DA 4HDCA 1A69A 3BCHA 1CJVC 3ZLJA 3F2BA 1RM0A 3UB4A 4A16A 4BJ5A 3EAFA 1X40A 1EWKA 3NBUA 2A0UA 1DRVA 4ZCTA 2P9GA 2Y2VA 4ISBA 3F6YA 4MI9A 3D8HA 1YR7A 2DKFA 2HUPA 2IEGA 3T5DA 2GUWA 2XT0A 1QSGA 4LZWA 1P1JA 4NLCA 3QNMA 1OFUA 3AETB 3C3AA 1F8XA 3OUZA 3MLEA 3LCMA 2X1MA 3S0JA 1K88A 1LDMA 1C20A 2FG5A 2RI1A 2PMEA 3T5GA 4OREX 4CLOB 5K9ZA 2R68A 4INPA 2CSXA 3AB8A 2Z95A 1L4FA 3NNDA 3COWA 2P2CA 4IQ4A 1OJLA 4Q82A 2ZRPA 721PA 4TRMA 2KE5A 3U0BA 3GQCA 3TRHA 4EHKA 3IKLA 1A7JA 5DI9A 1YQEA 4D74A 4F6CA 4RTMA 1GTJ1 2BHTA 3BMNA 5AW2A 2C28A 3OECA 1XRLA 4HSGA 1ZOOA 2X0EA 2XRZA 4DARA 2CXXA 2R8HA 1XD8A 4F5QA 1E59A 2VBGA 2BEWA 3V2HA 5L4SA 3AUSA 1NY5A 4Y6SA 4ZVVA 1ZQ1C 2A1JA 1SAYA 2PS9A 4F4UA 3PGXA 3ZPXA 1TZBA 5AW6A 3UAVA 3UQ2A 4G0PA 1JIQA 2O1EA 3GA0A 4CLRA 4WLNA 5F51A 3RAFC 3TLKA 4XX0B 1QG2A 1S0MA 1U3UA 1XIVA 3B3QA 2ERCA 3PENA 3HWRA 2HMYB 3L1IA 4KAFA 2IHJA 4MWTA 3VNAA 2JJQA 1E1MA 1QZ3A 4AZ0B 2OLEA 1VRVA 1VBMA 3NKFA 4MEJA 1ZY2A 3RVPA 1JEEA 5EKDA 2QLLA 4ZEXA 5JNLA 3CP8A 1N2BA 2WVAA 1JEOA 5JIBA 4FT2A 4R2MA 5EGNA 3WKCA 2DCMA 4W8OA 2C2WA 1ZOLA 1WD5A 4FZNA 3OF5A 1FFWA 1OX4A 1X80B 2VHXA 4TKUA 3V46A 4ZAWA 2Y0PA 1KQFA 3R0ZA 2E5FA 4YRTA 3STWA 2IZ6A 5IDXA 1P2DA 4DFPA 3Q7SA 5H5JA 5EESA 3SF8A 3ICQB 2IY9A 3BQ9A 1KTQA 2Q49A 4DRXA 1IHPA 1B0ZA 2IK8A 3KFXA 3LY9A 1BDIA 1XLWA 3KZNA 2QN9A 3VQTA 2QG9A 4KKXB 4RVGA 1U2GC 1W1IA 1THTA 1Z82A 3BZUA 3FOBA 2EU8A 5J2JA 1W88A 2C7VA 3QWFA 3F3SA 4I1YA 3EZ2A 3WK5A 1CV2A 1T2DA 4Q4AB 1VYTA 2IDMA 2EZXA 2XCUA 3QEJA 2O20A 5KFYA 3P9XA 4JL8A 3L82B 3X1KA 4LJKA 1HZZC 4G26A 2HSJA 4NBKA 5DCLA 1JKIA 2C2OA 3PHLA 2WV9A 3PI7A 4MYHA 4OQZA 8ICSA 4B32A 2P9EA 3IP6A 1GA6A 3C6BA 1ECJA 2O57A 4YA6A 4MWGA 3V2GA 4NBLA 8AT1A 1HE5A 1UBSB 2P65A 2PQMA 4M1OA 4RD3A 3A3NA 1P74A 3MABA 2P4QA 2PKWA 2QE7A 1V6CA 3H5LA 4TV8B 5EIOA 5LZ7A 3WMXA 4HF7A 2NSHA 4B82A 1JXOA 3USCS 1G6KA 2BKUA 3LNTA 2BR0A 2ZBVA 5EJ2A 4CKEB 5HKBA 5COBA 1EX7A 2GHQA 4YCAA 3I6MA 4M1WA 4LJ6A 4COOA 1DARA 1BGXT 3QG1A 1YA4A 2PT9A 4OQFA 4RE5A 1UBRS 2VA2A 2V74B 2BHNA 1E9SA 3E8XA 1E60A 4S05A 2DRIA 1ZJ6A 3VJLA 4BB5A 1E3LA 4NNPA 3R6GA 4OB7A 2KFZA 1VE7A 2IWRA 3M5DA 2DFLA 1SVLA 3GGDA 4M1ZA 3QFCA 3ZIAA 1QV7A 2R8GA 2GXQA 3H4TA 4G4IA 4RSHA 5LXTF 2F4NA 4CCYB 5BSKA 3K53A 3I37X 3PHBE 4M2YA 1SEPA 4JR1A 4X0EA 1IHYA 3B3JA 3AKYA 4C78A 2FWAA 5E6SB 3ZU6A 1SVKA 1NAIA 4G1MB 2O5CA 2HLNA 1DUSA 1RXSA 2WTFA 2FMKA 1U2TA 3KPVA 5TRTA 1BPDA 1U49A 3HDTA 5CT4A 2E1EA 1WMFA 4HWKA 1BX0A 5AO9A 4ZC1A 3GNSA 2VHCA 5GJWC 3GG9A 4PFSA 3OUTA 1E2IA 4PN3A 1Z62A 1GRNA 3GC6A 5EWGA 4K3VA 4ZVKA 3P26A 1Z1VA 2HOQA 2MOKA 2YVQA 3MCVA 4G5FA 4EX7A 1AKRA 2KPOA 4LGCA 2AJCA 2JHPA 3RRYA 2DXIA 4X90A 3NDBB 1VJGA 4R2KA 1WJGA 2C5GA 1N9GA 1C2TA 4BXOB 3IA7A 5L4NA 2ZUFA 1DJQA 1QX4A 1TJ3A 1M5UA 1CJMA 1EUCA 1OGYA 2Q0XA 3CVJA 3O2SB 3AXSA 1DS6A 4NPHA 3OX2A 4TL6A 4WVLA 3DULA 1R0SA 3BGIA 4JC0A 1UKAA 4NVRA 2WFAA 4AL4A 5FNZA 4L07A 1OIWA 1NJFA 5E9WA 4MIKA 3KLBA 1WMBA 2X8JA 3RLIA 2SCUA 4FX5A 3ISDA 1JG7A 4K87A 3VC2A 2HBJA 1KAOA 1Q3TA 2EF1A 3B2NA 1TCBA 2P91A 1G4HA 5M3BA 4EARA 1R8QA 2ZDQA 3P0FA 4RL4A 3OZUA 2QRVB 1PT9A 3C4QA 3FVWA 1PNVA 1XYVA 1YB6A 4HDNA 4AX4A 3A36A 5ITVA 4O3RA 1M0TA 2A35A 2WYHA 2BIFA 2WSBA 3IEPA 3PX4A 4MQFB 2DHCA 2EW8A 2HK6A 5JE8A 1E7QA 5KYWB 1B4DA 1T2NA 5CM8B 3QYFA 1ZRMA 1KOFA 4ADSG 4Q3CA 1MG5A 8ICFA 3D3NA 9ICEA 4UDXX 2ICAA 1JNYA 1I36A 3ZOKA 1JFRA 3HGQA 4MF8A 1KBUA 2N0SA 2W43A 3OZIA 3QTLA 3F4BA 1M2EA 2BGJA 2NXEA 4BNUA 5AM3A 2YHAA 3WHPA 5GJBA 3A9UA 5HBGA 1P7PA 5IEBA 2VT7A 1ZQXA 3KHTA 4HJXA 2GYVA 4JZYA 1RADA 1DC6A 4OHBA 1VZ3A 4R3WA 1CDZA 3M5CA 2OO5C 3PKZA 2GBIA 1AK9A 2AN1A 4RFSB 4JU9A 3W5IA 1XEXB 4ZDJA 5AJUA 1QU3A 1UFVA 4AJNA 4QBIA 1C0IA 4Q9JA 2YTUA 1H9AA 1ZGAA 1W0KA 4IPTA 1XHEA 1UQTA 3N8KA 4J3JA 4BMDA 1NW8A 1YASA 1ZD3A 2V6JA 1EWYA 2NPFA 1X74A 2BEWB 1WB6A 1QX3A 2RHCA 4UM7A 3TM5A 5KOIA 3GP8A 2YS6A 2ATVA 3DUFB 2C9OA 4UEWA 4AYWA 4B3HA 4DBZA 1NMEA 1OBVA 3VPHA 3CMCO 4U5QA 2HVHA 3M6ZA 1ORTA 1OVGA 1OY1A 2GXUA 2GS9A 2YYAA 3LPNA 4ZAXA 2HIGA 3W3AA 1ECWA 4KLHA 2HO5A 4KN4A 3H16A 3L7MA 1VBFA 3CT4A 4Q21A 4AJLA 4C6TA 5KT4A 2LW7A 2B1QA 1TKAA 4XB6B 3EIOA 1PEKE 4ZJZA 3OZXA 1KJ9A 1I3NA 1GAQA 2WAXA 5DHQA 2PUGA 4E09A 3BRWA 2CL6X 2Z5FA 4UBMA 1ISHA 3ORSA 4EHBA 2FPKA 1RYFA 3Q8WA 4PC2A 4TL7A 3TF5A 2R5NA 3CT6A 3I9MA 8ICOA 3U49A 4YIHA 3ROKA 4V39A 3I64A 4Z9AA 1LLCA 1JZQA 1VPLA 2QP9X 3D0RA 3ESDA 1F2VA 1CNMA 2L82A 5JNUA 5JTTA 4U0KA 5B36A 1BE0A 4N4AA 1JEAA 3V8BA 2BHRA 2FZCA 2NU7A 3G23A 4FLEA 2FK8A 2W2OA 4WDRA 2VJBA 3IBGA 3ZX4A 1Z4MA 3FCSB 3GD5A 2HBMA 2E85A 3A6FA 2CJXA 2EKDA 2YMMA 4RY2A 1LJLA 2VAVA 1O8BA 3KOMA 4M87A 1IXKA 2AYYA 1C1XA 2NQTA 4HFJA 3QMVA 1RHMA 4G1FA 2YN0A 3BIFA 1TFRA 4WZBA 4D57A 3IT1A 1NT4A 1YRQA 2PGIA 5A3SA 6GPBA 3UJ6A 2DQZA 5DNEA 1WKCA 4BJ3A 3RFAA 2B4KA 2R11A 1Q46A 4LF9B 3IPXA 3VPSA 1N33B 4RSGA 1SM4A 2I2DA 4BEWA 3HJHA 3UG7A 1IXYA 1I24A 1R8XA 2OBFA 1YF3A 4XQGA 2G9VA 4UTXA 2FMPA 1VDZA 2NUBA 2PTGA 4MW2A 4YV1A 5JCXA 1COWA 2IYZA 2RKWA 3L46A 1BRTA 1RKBA 1DAIA 4M60A 4R05A 4AMGA 5A04A 3ER9A 1RAEA 4UTOA 1V16A 3CF0A 4MV1A 1T2AA 3CBGA 1FXWA 2C3MA 1XO1A 3INTA 4FNOA 5DG8A 3SEZA 4KMSA 4BDTA 4XSVA 5CEFA 5I7VA 2C61A 1WVMA 4XQEA 1FFUA 3EVTA 2PANA 3SQLA 1MXFA 4GR4A 3E18A 3LRPA 1E6EA 4DTCA 1N0VC 2QB1A 2OUIA 5E4YA 2CXYA 1KHHA 5HUHA 1XP8A 4I50B 4BQPA 1P0FA 1U1EA 2DTXA 2VPWA 3GDWA 4AY2A 4ZU6X 4U7HA 4HN4B 1CHNA 2VTVA 4TS1A 2CLEB 4E2WA 5EEHA 4E1VA 1BDMA 2IXFA 3IDQA 5L1MA 1F2UB 4P31A 1TK3A 4G37A 2XOKD 1H9BA 2Y6UA 9ICHA 3EXFB 4KV9A 4O4LB 3KVOA 1A7KA 5C7OO 1FY2A 4ZI3A 5BVGA 4F7WA 3VZBA 1WM1A 2XR1A 4DIBA 3B0XA 5TIIA 1JLRA 4CMBA 1E6KA 2HYDA 1ED1A 4MPTA 4S1NA 5E9AA 4C8LA 2Y6VA 1JU9A 3F74A 2OP0A 1H05A 2RG7A 2OBBA 1LLDA 4LEIA 3VR1A 4C06A 2Q6TA 3EAGA 4KCGA 4HR7A 1J06A 4EY4A 3EXG1 2J67A 3E81A 2VQ3A 1W59A 1PWXA 2PZJA 1BMQA 7ICJA 1ADYA 2IKQA 1BH6A 3OC0A 3NTLA 4ZVQA 1NI3A 4J1QA 4LC9A 2DKZA 4WCFB 1FFEA 1OGJA 2H2DA 3HKBA 4NBRA 5JZ9A 2JRCA 1H9CA 1SIBE 1M2NA 1N25A 3OU6A 2BBTA 2AZTA 1VPWA 3OJCA 1DO8A 2P75A 5EYPA 5DOVA 4OXXA 1HYEA 3G2PA 4ZGWA 1YBMA 5HCIA 2VUUA 4JS0A 4RSRA 4DLLA 4AS1A 1TUEA 1V1JA 3PKIA 4Z7JA 2ECQA 3PEUA 1OI3A 4RUAA 2QV7A 3IKMB 3L4BA 5T7BA 4OXYA 1QPBA 1SIWA 1UANA 3BK1A 3FYTA 3M5PA 3OMWA 4R83A 1SUWA 1EE1A 5BXYA 1MJNA 1RAHA 4C8OA 4P98A 1NATA 4J1SA 2B0CA 5AJWA 3KR1A 4OAQA 4DY6A 2WWFA 4KLNA 3TMAA 2RH5A 3RKUA 4JB3A 4ZHQB 5K4AA 2AJTA 4QASA 3TLGB 5KFIA 4M9QA 2D3DA 4LZOA 1NHGA 4XRHA 1X2BA 2EP8A 3JZAA 4P4OA 3VUEA 4QJIA 4P3PA 1YS7A 4DFDA 4RA9B 5FWYB 2HYIC 3DLBA 3VCBA 5AM5A 4J7CA 2IV2X 3D5EA 4CCAA 2PFNA 5KFSA 1R74A 1AROP 2DWUA 2H4XA 2Q5IA 1I2MA 3W78A 2EAOA 2G1PA 1G21E 2WWWA 1DCKA 1FW8A 2B4TO 1KI9A 2O52A 4O08A 4PSKA 2VI5A 1BPYA 1S4MA 1V6AA 2R8EA 4KR9A 1GNTA 2W2VA 1ADGA 2AMFA 2WIGA 4B6FA 5TEWA 2FZ4A 1UA1A 1WPRA 3C3BA 3C1OA 1R4ZA 3QVTA 1SFRA 3CUTA 4NZNA 2XA1A 5FWXB 1VGQA 2WZQA 3M6LA 1OFIA 3LC7O 1J4AA 2BUAA 4H6VA 4WQMA 121PA 3GDXA 4Z4QA 3WGZA 3GLFB 5JLJA 2AL7A 5C81A 3N0WA 2ZUDA 5T4HA 4YR7A 4KRYA 3DBRA 4RESA 1ESZA 1PP4A 1PV2A 1TAHA 4OMFG 3DKIA 1PJLA 1YBVA 2AN3A 1TKBA 4ETWA 4YQFA 2VSOA 3WB2A 4LOKA 3TKAA 1HUQA 4QYXA 2H31A 1H0RA 4FMPA 4MVXA 4OBWA 3UJ3X 2NPOA 4Q18A 1VKHA 3BQ1A 2PWYA 2BW0A 1BE1A 3HW8A 1BXGB 2Q9CA 1G6OA 3I2HA 3MWDA 2ISOA 1D2GA 4RK0A 3S29A 4C04A 1P6UA 1Z4PX 3DPUA 2ACKA 1K8ZB 1WS6A 2IOQA 2OO3A 4LHZA 5CX1B 3ROPA 1GTSA 5A4DA 2OHGA 4CTOA 3O7MA 5BWLA 2IRWA 5JD4A 1MEJA 4YMSA 4RAOA 3MGGA 2NQ8A 4X64B 5AM4A 1YMQA 3CBQA 4M0PA 2DECA 3RK1A 3OHPA 4GVXA 4NBUA 5LMZA 2Z6QA 2H1VA 1U1DA 3PW2A 3DWFA 3UICA 3BE5A 1VSBA 4YYEA 2NZYA 4YUWA 3CCBA 4PGFA 4BN0A 3AONB 4DIEA 4DIOA 5EL0A 2ZRLA 5D7NA 2MJLA 2DZDA 3D9QX 4HAYA 4RQTA 5JARA 1WA5A 1AN0A 1E63A 3AVPA 1KFSA 2R85A 2YNMD 2XI9A 3EGDB 1KLNA 1E1LA 1U4OA 3OZWA 2BM8A 3L6DA 4MGKR 4RJ2A 1AKEA 5LYYA 5BN4A 1LV5A 3R0IA 5HYVA 1CIJA 4OI1A 2X7XA 1ZICA 3HVUA 3NC1C 2O8CB 1MABA 4GU5A 3HO8A 2FQYA 5KYVA 4DCPA 2VDQB 3F73A 2H3ZA 1G9TA 1PX2A 7GPBA 5I7EA 1KBOA 2BKXA 3PF8A 2O8DB 4AKIA 3OJEA 4O3SA 1CIVA 2ZITA 4JVLA 1DGJA 3I8XA 1A2KC 1A9RA 4HZGA 4Y8VA 3T7KA 4ERNA 5F1KA 1AV6A 3VTFA 2GARA 1WCWA 2H92A 3L7JA 3SEFA 4DJFC 1ZQCA 2HGSA 5DM2A 1Z0KA 4QXQA 3U4GA 1N9ZA 1QHIA 1RWKA 3ZZNA 4E3WA 3UKJA 1E0KA 3B1YA 3ILVA 4K26A 1S89A 2CUTA 3PL5A 4KGZA 1ECPA 3VZDA 2DR2A 1CIPA 3KZOA 1WCIA 1XAJA 2QUJA 4BS9A 4J9UE 3GNQA 1QZUA 1ZQNA 3IOEA 4MW0A 2I29A 3UJ7A 5DULA 4DPKA 1BXZA 4JLBA 4TTTS 3NWEA 1K5OA 1PQ4A 4XD7D 1GN8A 1L5WA 1NFRA 1XDDA 3KR2A 4QU8A 1R00A 2EBUA 3NOOA 4YMIA 3ESXA 3CLTD 4QYWA 5KTSA 4D9KA 4NCAA 2ODWA 2P2YA 3PQ4A 5K03A 2VJMB 3E1GA 3H84A 5JYBA 4RPYA 1ZQUA 2E5LB 4BNMA 3I6IA 4XJVA 3U1VA 2VTBA 2BPFA 3SV3A 1XZJA 2A7QA 2VAXA 1E2UA 1NSTA 4DV2B 3W4IA 1SKYE 1U1FA 2VDLB 4DCMA 1X92A 1T3LA 4PWZA 3U4QA 2AR9A 3BZBA 4CR6A 2Q2QA 1MOQA 4C8MA 2G04A 4U00A 3L4EA 4XCQA 2B7BA 3AY3A 3C28A 1E79D 3LSTA 1NYQA 2UVVA 1UBHS 2CNOA 4LGMA 4R51A 5EWFA 4U7WA 2G5GX 4X00A 1QTIA 2CCJA 2VNIA 4UNQA 1VCIA 3LGSA 4Z0PA 4BC0A 2FRXA 5KX5F 1RRVA 2PJDA 3GUHA 10MHA 1SCUB 2VYFA 4MUEA 3HK2A 4FHDA 2J9FA 4FS3A 4D99A 1MNQA 4CGZA 2EVWX 1TXGA 2HDOA 3M9NB 1T15A 2YB1A 3I9NA 6CHYA 3HEAA 2RHTA 5LM3A 3QVMA 2ON6A 1PTKA 4AQDA 4G1CA 2A88A 4B75A 3RJTA 4PG8A 1EFPB 4L5AA 4O0LA 4A2QA 4GXRA 5CLLA 4UNSA 3BA1A 3NM5A 2XHEA 4GPD1 3BD8A 4J4HA 2IW1A 2JL1A 4M0LA 4C4YA 2GN8A 1DIRA 3QPBA 5G1OA 3E05A 4HWOA 3RV3A 2P6PA 4I2CA 1VB5A 3EN0A 1GXSB 2ZJ8A 2M6SA 5FD8A 4U8HA 1PR4A 3UF0A 2ZQZA 5IM4F 5KT3A 1NV8A 4CIVA 1P2SA 1JVNA 4EATA 2QU7A 4R7TA 3I6QA 1YZTA 2WU8A 4W1SA 3IVMA 5I7UA 1DWPA 1J5EB 3FLEA 3LL4A 5H16A 2ZI7A 3NIDB 4GX5A 1JILA 3PUJA 4Z86A 4C80A 2MA1A 4MWDA 4R64A 1YR8A 1KE2A 3DEKA 3QMPA 3REGA 3INGA 3K4PA 3E2MA 2QGNA 3ZD8A 1RC1A 1W9MA 3C3CA 4R98A 2C5LA 5TNXA 4LXUA 5DSTA 5P21A 5SY9A 3L07A 4BUCA 5K8VA 1ZN2A 1MJGA 2OZVA 4KODA 1QFSA 2WNSA 3LC2O 2WSSD 4XFKA 2P9FA 3A9RA 1V8PA 1ZYQA 3LXRA 1Z2EA 3SYRA 3FVVA 4FYIA 4LJXA 3GQBA 1FDIA 1G5FA 2LVBA 2PVSA 3DE6X 1U0EA 1PHPA 3PGA1 2XF8A 2BZFA 4H17A 1Z2AA 4P32A 1KVRA 3K9NA 3BGDA 4AY6A 2X4LA 2CFTA 4BIIA 4HB0A 1X9GA 1CQIA 1QCZA 4AYXA 3RS3A 2NXJA 1SCIA 2W8BB 3KXKA 3GGOA 5DYGA 4H6WA 1LNQA 3BILA 4CUKA 5LDGA 1QLHA 3DEAA 1JS1X 5CIWA 1E5QA 2I9GA 2ARKA 4EZBA 3FG9A 4FNAA 1FUEA 1JX6A 1SVMA 2NT4A 2QN7A 2XBLA 3G7NA 4HN2A 3VBEA 5FWDA 3RG8A 5IFLA 4XLZA 4URHA 3QWIA 3SDSA 2OZEA 3HSYA 4HKTA 3L4JA 1H4VB 2RH9B 2QTCA 3PE6A 4HNSA 4AY4A 4B3CA 4ARIA 1UWKA 2NU8A 2JHAA 1WUDA 4C21A 4JUFA 5CJ7A 3HJGA 1E6UA 5DN6A 3ND7A 2OC9A 2H4ZA 2Z58A 3TNFA 3ZWVA 2IUFA 3KIPA 4O2AF 5IUJC 1EFVA 1TVKB 4ZRDA 1OXSC 2VF7A 3PYMA 3A1FA 3UGJA 1KQ3A 3OJ0A 5FLEX 2X2OA 1QIDA 3JCZA 1AA6A 1GGKA 4MW6A 4DQPA 2AVNA 3FDXA 4XWAA 1FNBA 3MR3A 3DT6A 3ETNA 4Z1MD 1R37A 1WWKA 2RJ3A 1LVHA 1KK3A 1N6RA 1YZ3A 3B6IA 1KJZA 1OYWA 2A0WA 1HYHA 3BIOA 1P1RA 1P2FA 1ULUA 1V45E 3LBYA 1ZCZA 2N47A 4IGKA 4PLHA 4MVYA 5FOQA 9ATCA 5IXYA 1SZPA 1EZZA 4XDHA 4KU4A 4YMVA 1T9AA 5ULLA 2FR8C 5BOMA 7ICUA 1EHIA 3C0KA 3GRVA 1UBTS 2P66A 2FMXA 3SC4A 3A7EA 2WYUA 3DL0A 1A9OA 1KYVA 2MHCA 3DTTA 3KQVA 1P44A 2FR0A 1CY6A 1IBCA 4IG9A 4LRYA 4Z9FA 3ZUPA 4B81A 5ADWA 3L41A 3W5UA 2QB5A 1YZYA 1D6JA 3QZ8A 1RI1A 3VU0A 3MBIA 4DQLA 3TTVA 3C5HA 3GV5B 3KOYA 2WB2A 4D6XA 4US8A 2ASDA 4IR9A 1ULHA 2Z1NA 1AK2A 1OIVA 3ZJTA 4ECUA 1MIOA 1KEKA 1FU7A 2PUWA 2ZKLA 4RIGA 3LU1A 1DGSA 1ZI6A 4OQEA 1HWYA 4RS3A 4BLSA 4YAGA 5JPCA 4RTJA 2V3CC 3BDAA 1UEJA 4HX9A 3JR3A 4CM5A 4ER3A 1C9NA 3WYGA 4AO7A 2IBSA 5KHOC 2VK1A 2HMWA 3ZK7A 1JBQA 2OK8A 5DQHA 2C78A 4PHCA 4UVEA 2NUPA 1PQWA 2ADFA 2G8LA 3E48A 2AMJA 3IAS6 3O3CA 3S6JA 5GTHU 1I1OA 3E7DA 5K3AA 3RIMA 1B2RA 1IWOA 1Y9ZA 2MSWA 3ZQKA 1PYGA 4IV8A 3V8QA 3GX1A 3W3AD 4RTQA 5JFOA 4AUNA 4PS0A 3OHMA 1PS0A 3CRW1 3PA8A 3PO5A 4IR1A 1UM8A 3MGHA 2EJBA 1PGQA 4JBXA 3RU3A 2Y05A 3B5EA 4GKJB 3WAGA 4RGBA 2NYVA 2Y0EA 5EUBA 2O3JA 4GWKA 3ZR4B 2XUOA 3WTBA 1TM4E 5KDOA 1INLA 2HADA 2JVIA 3HN2A 1BU5A 1Z75A 4NXNB 5KO2A 2JFWA 5H3CA 4KIFA 4O2BB 5IDWA 9GPBA 2P5TB 1BU8A 2MMCA 2XUZA 3G5LA 2HMUA 4V0NA 1KDRA 4ZVMA 3QTBA 4IQUA 4G4JA 5KFXA 3W1EA 3UOWA 2CLLB 2BKLA 2G40A 3VR2D 5E8JA 1SIOA 2PZ8A 2BMFA 3HNOA 3LYHA 4BGIA 1F0MA 3SQDA 2PN1A 1ORIA 3GPIA 4AI6A 5KMGB 4EUEA 4ZC8A 5MF6A 1RZVA 1BVSA 4FD3A 2ZB3A 2J7KA 4GX0A 3OE1A 2Q3HA 1KO8A 4PYRA 1PVOA 3F53A 1KH2A 3GILA 4GRAA 1RBQA 3R7BA 3P45A 1LWNA 2C3UA 3TADC 3CEPB 1MU0A 1TGVA 3WK6A 4HWSA 2E4XA 1VLJA 5EIHA 3CNBA 1UMKA 2YYZA 2KZZA 3RS7A 3ENNA 4MVJD 5EPEA 1X87A 3O93A 1IUKA 3JATB 3FPEA 4JSYA 1Y81A 1YE8A 1LC3A 2C4MA 3DMPA 3GJ0A 3NKVA 3TSCA 5C18A 5J2UB 2Q28A 13PKA 3C45A 5HF8A 2SNIE 3GFOA 2HJ9A 4LE2A 1U2GA 1XMSA 3SQOA 2UUBB 1KAEA 4B4UA 4Y98A 1ENZA 4XDYA 2HJVA 1UUFA 4U2BA 1RZ3A 2N1RA 2F3RA 2TMKA 3PNVA 1JQ3A 4J1TA 3DR3A 1E2HA 1JXQA 2FTKE 2VZEA 5KYTA 4QXAA 3KZMA 3ECAA 3C6YA 3RFTA 3QOYA 1JQ5A 3THVA 2NTNA 3UUGA 1H8HA 2W37A 3QZUA 2Y68A 1VHWA 1KERA 2VEDA 3KYJB 3Q3EA 4LFAB 3K1JA 3MWYW 5JZOA 2PGAA 3L8HA 4CMGA 3WL6A 5HMMA 3R3SA 1J07A 4OQQA 2ZUTA 1ULBA 2QQGA 1WR8A 3LG2A 3LX6A 3JYHA 4MINA 2DSNA 2I4NA 3HXKA 4NEHB 1CUDA 3WICA 4ELTA 2YB4A 4LXQA 2IE0A 5CB4F 6REQB 4Q45A 1UIMA 2RCYA 2UZ1B 4K0RA 2O3RA 1N6PA 1H5QA 1RWXA 2H6EA 5T4EA 2GZ3A 5K0CA 5FPHA 5I7AA 3RTVA 2IYXA 4Y2XA 3TZBA 4QAQA 2ZPUA 3PB3A 4P7BA 3AYZB 3KEFA 3J80A 3O4VA 1JG3A 3BDIA 3P0RA 3E5RA 3HFGA 3ISCA 4XVRA 5KTNA 1N78A 1NK8A 1JKXA 2RGAA 3B9PA 4ZVRA 2O50A 2CVPA 5JH7B 1U3WA 4AN4A 2GPAA 1UBFA 4U2CA 1Q0HA 1T1IA 3RF7A 5HG0A 4PQRA 4L28A 4QDJA 1ZQQA 3NCTA 3M3PA 1HH4A 1YRHA 4MAMA 1U0OC 1ZU4A 1RLUA 2QN1A 2V5UA 3RR2A 2WTBA 4YR0A 5B6IA 3H3FA 3AT1A 1ZGCA 4NQRA 3CQ9A 3IAM1 4HAIA 2C4UA 1CJKC 1L7EA 2CZGA 5ITZA 4Z49A 1WXGA 4LMPA 3V97A 3C39A 1MFZA 4NHOA 2DLCX 1II0A 4YP3A 3ANNA 3MSXA 2VAMA 1Z6YA 2PR2A 2YJNA 3GRUA 3ABQB 5JO0A 4AECA 1J8DA 4DS3A 1TT7A 2Y0BA 5DBAA 2ZJ1A 2ORVA 5TPZD 4EHAA 1W36D 2FSSA 4P4UA 1QCKA 1XNGA 3U16A 3RRZA 1U0HC 1QGZA 1UMDB 2VP4A 4DMCA 3OY2A 1DBRA 2ZCVA 2ECKA 2HHSA 2QNBA 4YR2A 4HB2A 4IDBA 5L45A 4QU0A 1N0HA 1R6XA 4ER6A 2P2LA 1OXVA 3HYCA 3P4YA 4XKJA 4B3XA 2UYCA 2JFFA 5J58A 3WHLA 5H9VA 1M2VA 2QL9A 4ECYA 1TLTA 4DV0B 3GJZA 2J6TA 3MERA 3MS4A 1Y4SA 3OFJA 4MGYR 1EP3B 5HW0A 4TTPA 1AVTA 2VWPA 4ARBA 5JS6A 1E2QA 3EISA 2H0RA 2YOGA 3JVEA 4UD6A 2Q3FA 1NYRA 4YHBA 3G89A 2F6RA 3ANXA 4U63A 1QGOA 4JJ6A 3D3QA 2I6FA 2GYUA 4DXAA 5SZJA 3O1IC 1NONA 1B1AA 1HT0A 2NTVA 3CUEF 3NVWA 1MO6A 4PYQA 2NUPB 4V0SA 2IIPA 3NDRA 4RULA 2FP4A 2RMKA 4NU0A 5ALQA 3UMCA 1YZNA 4LY6A 5LQNA 1P4SA 3M4JA 3U3JA 1CC1S 1VJRA 3SAFA 1S2NA 1FLDA 2IYRA 4TPKA 5JJIA 3IYLW 4YMHA 3PXEA 4OL9A 1T4CB 3K0SA 3FF4A 2IIQA 4DV4B 2JBHA 4LBZA 3ADCA 7ICGA 1GG2A 1N2ZA 2B2NA 3MT0A 4Q9KA 4FZRA 4NE7A 2KJ8A 2V55B 1CT9A 5IHPA 1EE9A 4HDRB 2QORA 3CIFA 3EC1A 1ZM7A 3B8HA 1CG6A 3R23A 4GXQA 3FBTA 3E0XA 4LJ7A 3NUGA 3VHRA 1QH1A 2ZYTX 4ENQA 1AKMA 1QKIA 3KAPA 5CLGA 2AKEA 3NVYA 1JDJA 1R12A 1P7ZA 4MUHA 2I34A 3H42B 2A1IA 3IL2A 1SXGA 3BMOA 1T3QA 4QEDA 4BB6A 4IG4A 1PSDA 2QYTA 4FOPA 2FX5A 3NFRA 3O2NA 1S4QA 4DLEA 4IQWA 4ZVUA 4K7JA 5TC4A 3ZQ6A 1R4AA 1JR3A 3ITEA 4PLYA 5U4XA 1FF9A 3ASYA 3RBAA 3UFXA 3QHQA 1X86B 1HSZA 2V8OA 5BN4B 3KQYA 2HU5A 1PVDA 4J16A 1L5KA 1ZJZA 3IAAA 1S96A 3MRTA 1QHHA 4M9UA 3N2GA 3H5RA 2OMKA 3SZLA 4R68A 1QRUA 4UDNA 1UQVA 2LCIA 5AESA 3IQXA 1T3SA 1NQVA 1LI5A 1NMQA 4PG7A 1SUBA 2YL2A 4WTOA 4AZ3A 3GT0A 4KPUB 5BMVB 4KI0A 3BUSA 3O0DA 4M6WA 3O3MB 3WDSA 4DGQA 2DKOA 5CB0A 5K6TA 2Q8PA 5F7XA 3NTUA 2D4AA 4WBNB 3OI7A 2X4DA 3V7JA 3R7SA 4BO5A 1PQUA 2ZRCA 4E13A 1OJ7A 2NAPA 3BWYA 4C0AC 4JEMA 2G1KA 5DTMA 4CTNA 1IZ9A 5T67A 5IU6A 1W94A 5J1SB 5J4YA 2IV3A 3GRKA 1XVAA 4F5WA 2KVSA 3IVRA 3QOWA 1QSYA 1W73A 3H6GA 3VC3A 2JFPA 3A3YA 1C7EA 1UBEA 2BFBB 2EIHA 3CEJA 4F9FA 2FK7A 2OCEA 2FUNB 2KWIA 3K5WA 2WRZA 3Q0IA 5DK4A 3ROQA 3ONNA 2R86A 5JJLA 3IBFA 4KOEC 1W4RA 4YJHA 1W6RA 3UK1A 3LP6A 3ZV6A 5EUQB 5TF4A 4JLOA 4BBAA 1SHZA 4EY5A 2JIMA 4Y2JA 3LUAA 3QVGA 2C5AA 2PL9A 4X95A 1C4OA 4BP9A 3T0IA 1NMSA 3JD2A 4PSAA 4MUXA 2D1YA 1TYCA 3PEEA 5F33A 1L5FA 2PK3A 1QWSA 3NI2A 1EXVA 4LSMA 4P80A 1UMCB 1YKFA 1T8WA 4IIEA 4AJ9A 1MUUA 3BS5B 1N7JA 4NOKA 1T10A 1W0CA 4Q1CA 3PYLA 1TM2A 4K88A 1AHPA 4GI7A 5FNVF 1IAVA 3AIMA 3AO0B 1C9MA 3ZJ4A 3D0QA 1M6HA 5IMSA 1PS9A 3CZRA 4KP7A 3ETDA 3L7YA 1NBOA 2HJSA 2DSTA 3U37A 5IAKA 4AIRA 4DYVA 3LBNA 2XCRB 4BPRA 4A36A 2EXXA 2AOWA 4ZJPA 3OJFA 4C7OB 2WG1A 1FSZA 3VR5D 1P18A 3TW8A 2J8ZA 3RNOA 1CE8B 1UPCA 1ZW6A 2JGEA 5DLPA 1VBNA 4ZI7A 3HJFA 4DNOA 5CUQA 2ISPA 1BS9A 2PX4A 4BP8A 4I1PA 1SVUA 5KG6A 4OGGA 1R5BA 2LKYA 1V5IA 1X9IA 2IEAA 1OHHA 1FNMA 2OHHA 3H75A 5AW5A 5HUJA 2ZXUA 4X20B 4K6GA 3KJQA 2EG5A 1GNSA 1XCPA 2G76A 1E9FA 4GECA 3BB4A 2OAGA 3EUAA 4E03A 5LOVF 1K5GA 1AQ6A 1E7YA 5FLXA 3D1LA 4EA9A 2IELA 3KPUA 2BFDA 3OSZA 4WN9A 2IU0A 5EXPA 2Q3JA 2I67A 1M2KA 1JG4A 4RK1A 4QFCA 3EH1A 5T3UA 4ZOEA 3VC1A 2MYPA 3P5BA 2O59A 1J42A 2UYYA 1QJ4A 1KZ7B 4OV6B 2P9TA 5AK3A 1EVLA 1ZRHA 1PK9A 4M0DA 3KUDA 5A4MS 5EPOA 3ZCXA 3WKBA 4IX1A 3EUFA 5AUOB 2ROQA 4D9HA 4JX8A 1G5RA 4BQFA 2B9EA 2P9ZA 3HCFA 2FFRA 1WDLA 2FZ5A 3IFSA 3QBJA 1GKLA 3T38A 1WHSA 4UU8A 3AVVA 4Y6LA 1W34A 2B6NA 4AMZA 3WLQA 4UU1A 3TZHA 2OORC 2V3WA 1LBSA 1UFKA 8OHMA 1IY1A 4IJKA 2XTZA 5HEKA 1T6YA 3PFFA 2Y4NA 4CF7A 1AH2A 1G5PA 4FYPA 2NZWA 3KV1A 3KE9A 4HHEA 1D07A 1JX4A 3BA6A 4WBSA 1LY1A 4MV8A 3PMLA 1G20B 1U5AA 3COPA 2IUUA 1F7VA 1E3TA 1E66A 4XA8A 1W7AA 1FFYA 3G6XA 3PJFA 1Z0JA 1M0WA 4RPXA 2QB0B 3E9MA 3M34A 2FPXA 2HXGA 2I65A 3EFBA 3FR7A 3NHMA 3I01M 2VBCA 2W6NA 2AC7A 2GPSA 3PGKA 4IDNA 4GZMA 3G5AA 1U9IC 4C5BA 4CJXA 4WINA 1CEQA 4AZWA 2ASJA 1NYLA 5CDHA 3DQQA 4OQXA 4IIJF 1NI5A 1PBTA 4TMTA 3LY7A 1ZGBA 4L7QA 1NOIA 1EESA 4OK5A 5B53A 1XPOA 2I1VB 3MGKA 1Z0UA 3K0EA 5J23A 2A92A 3CX4A 3FBWA 4MPRA 3GXBA 5DOZA 2EGGA 1J97A 1E6CA 2VUSA 2AEEA 5C52B 5E2AA 3R74A 1UP7A 5KIAA 3UCEA 4HYEA 2AQIA 3BZKA 1E9DA 4YCJA 1UFOA 4EQ6A 4EW6A 3OEED 2ZSIA 1C7QA 5HTKA 2IITA 4BVBA 3U6BA 1D4ZA 1S0OA 2OHOA 3FOCA 3HG7A 2FUG1 3OG9A 4EI2A 3PQ5A 3RV4A 2EDCA 2GCOB 5TVKA 4Z4GA 2GLXA 3A4NA 5D3MA 3UJ9A 3GEHA 2QJRA 1TVMA 1ZD1A 3C3JA 4HAUA 2NUAB 2R62A 2HRDA 3NAZA 1A1SA 4ZARA 1IG6A 2AW3A 5KTPA 1RWPA 1L4UA 1GFWA 3NKLA 3OT1B 4A0SA 5WRFA 1Z5WA 2QJOA 3BXPA 3DMTC 4NARA 1TMOA 2ZJBA 4PHPA 4X3CA 2XWBF 5AKJA 2D62A 2YHIA 3QUTA 3ICOA 5L3SB 2GZAA 4YFVA 4WFIA 1JDNA 4LXXA 4X6YA 3DXYA 2LHTA 1K0FA 1N7GA 3G9ZA 3Q9SA 5JNWA 4K0KB 4RVOA 4FNMA 2EP5A 1H94A 4Q3BA 3LQ1A 2ZTSA 1T35A 3GP3A 3CLSC 5D4BA 3G85A 5IABA 1BWQA 3ANTA 5CFZA 3JPRA 2XE6A 3TIVA 3PIDA 3UZUA 4R5HA 1RYMA 4F4IA 4V0KA 5C1PA 3LY5A 4TXMA 4JA2A 1CUXA 5JDCC 3D3WB 1SU8A 3V1YA 1E9AA 4DVGA 1KSHA 1K6MA 4EELA 3HLTA 4K9LA 3VC8A 4RHYA 4NCXA 4YI3A 5HIIA 2EP7A 3GLHB 1EVEA 9ICGA 4G0MA 1V48A 3HP4A 3UW1A 4HVLA 5LNK1 2VYVD 3IALA 3D2AA 3IJEB 3LNCA 2HA0A 5L3QB 1DMSA 4JFAA 1L5ZA 4Q8FA 4MUNA 3B38A 2JPDA 4U9HS 4O0IA 1X42A 1MOSA 1RCTE 3AR2A 3OEWA 1X66A 5KFNA 1BXRB 3ED5A 2ODQA 1Q6ZA 3JQFA 5B7QA 3FROA 5EZYF 2HRRA 3AUXA 1T91A 3UB2A 1O6CA 2VLIA 1VJTA 3S2SA 1BQEA 4GWGA 3AIOA 4Q1AA 4DVJA 5JMWA 4DKXA 1VLMA 3VR6H 3THXB 2OFPA 3B2QA 4K4HA 2DOKA 5CA1A 3MLAA 1Q7CA 5A02A 4I36A 2YIJA 2PMKA 4YXMA 4KWEA 4M3NA 2QZJA 3A4LA 2ZUVA 3EOZA 1TF7A 1CQIB 1H5UA 5KG3A 2HA5A 2OXCA 4IIHA 4JN6B 3GG2A 1E4YA 3NGLA 1S3FA 2YRWA 4K6MA 4Z6KA 1HG0A 4RH0A 2FRDA 3FSGD 4B85A 2LBOA 2CXTA 4V2IA 1G63A 2R8RA 1DTWB 4WZZA 2G25A 4UQOA 1YONA 2QR2A 2ZIFA 3KQQA 3AY6A 1FYVA 4M88A 2YCBA 5FAXA 1NULA 3MTQA 1PT8A 4PLVA 1D0IA 1GZ4A 3F96A 4EENA 4UQGA 4JXXA 1UF9A 1Q15A 1WV0A 3FGNA 4HUJA 4QGBA 3WYBA 1L4HA 4WV3A 1ZXXA 3T0FA 1RKUA 2ZXEA 2BFOA 1C7IA 2IQ5A 4WSOA 4C05A 1HXHA 3ESQA 5L7WA 4U6SA 1CUJA 1XRPA 5FUYA 3GUZA 3E1SA 1ZQEA 2LGJA 5D86A 4OJPA 1FTNA 1VPDA 1BOFA 2FA9A 3JWPA 3NR2A 4QLAA 3WLKX 1PTJC 3F7OA 4NPAA 5CW2A 2RBEA 3AR4A 4OLFA 3ZEIA 3QPUA 2JARA 2RGGA 1VRWA 1ZCJA 2KZMA 1A8SA 1PE0A 3M6IA 1SXQA 5BQOA 4CQLA 1OR8A 3INRA 3DH0A 3DV9A 1ZQBA 4ZI5A 4BNFA 3RH6A 4IDCA 5KFJA 3PO4A 2IGTA 3GCWA 1GAWA 1MEOA 3PP8A 4ZCQA 1V1RB 3MFHA 2ZRHA 1UC4B 3EW7A 1KSFX 4F6RB 4PRYA 4UMVA 4F3OA 3MYYA 1ACLA 1XMJA 4QPPA 1EP9A 2QIOA 1IK6A 4A23A 2VJYA 5LQJA 2A5DA 4I5EA 3JQEA 2O2SA 1VL2A 1D2NA 1VGVA 3CB2A 3IGFA 1Z5UA 1G5HA 3VYUB 4DMKA 8ICYA 4XUCA 1QF6A 4C4TA 1FNNA 4BJHB 4BWMA 2FYTA 3EEFA 3V00A 4Q7KA 4CETA 4LF5B 4PBSA 3T5HA 3ZWDA 4TROA 4YN4A 1DOHA 1MGPA 1YQDA 3DNPA 3NWBA 1V39A 4FEEA 3SZMA 2Q5JA 2IIBA 1DADA 4XPIB 1OAOC 3O8OB 4YUXA 4KLZA 1AMUA 4C0JA 1CUUA 3QNWA 1SA0B 5IJAA 5BQPA 4B8ZA 5K4HA 1NQUA 3JPQA 2M6LA 1K5DA 2YJ4A 2WM9B 4MQEA 4BEVA 2BQUA 3FMGA 1MHTA 5IAOA 1AHIA 3VVLA 1VMAA 3O0FA 5E7JA 4FI3C 4IW3B 4BGVA 5KVSA 2MTBA 1O96B 2QRVA 3GPDG 4FYWA 2R7KA 3TLMA 1UT8A 3GLIE 2QAJA 1MA3A 4HTFA 2G4LA 1KWKA 4L1KA 1C9DB 1NKVA 1G66A 1WIWA 1Z5GA 3FJYA 4LW8A 1PFGA 3RW9A 1R3UA 2OCPA 3G17A 2HWWA 3NB0A 5HF9A 5HIMA 4ZYTA 4I2EA 4B80A 1OLXB 4EZ9A 1K2WA 2ZT6A 3B7PA 4QYTA 4YRCA 4YP1A 3DAOA 3I2IA 3QA9A 3U4MA 4JP1A 3CLUD 2FLVA 2PQ6A 2F67A 4JWKA 3DDZX 4YAJA 4HV4A 4TLMB 1KI8A 4DLNA 4CBVA 2JNWA 2V6MA 4EQ6B 4XOIA 5JMPA 2JCGA 1CPYA 3KTAA 3TB4A 3PXGA 1KFTA 4EBDA 2CFCA 2ILTA 2GN4A 3COYA 1OXUA 1JSZA 1XQXA 3O8NA 2PVCA 4L2IB 5JXWA 4TVSA 5A6VA 3AEUB 3R7FA 4DR3B 4DLVA 4IUCS 5TQ2A 4D6YA 1YS9A 4XIIA 1VI5A 3N5CA 2QS9A 4RYLA 1RYDA 2O7NA 4NYIQ 4YMTA 2W2KA 1J2RA 2LRHA 3V6HA 1N2XA 2XEXA 3H2JA 4KIUA 2Y2UA 2ZUUA 4OF4A 4U3JA 4M9CA 3SN6A 2QLNA 4KN7A 5CP8A 2XY6A 9ICLA 1IM2A 2J3MA 3HMKA 3H0MB 4FO6A 2XRYA 1XTVA 3GBSA 5EMNA 3R8XA 4QM7A 4DL2A 5M04A 1LFAA 2AGQA 4UD2A 4DA7A 2J7PA 4EX6A 4KAJA 1Z5PA 4F1WA 1ZUD1 2OXTA 5LNK6 1J5PA 1U7ZA 5EVJA 3ZKAA 4UUOA 3UAOA 1QCCA 3EUB2 2W98A 3FOEC 1IRIA 1JLKA 4IY1A 4KR6A 1T8SA 2A0FA 4MRRA 1T5HX 2FN7A 3P9NA 4Z4CA 3WDMA 5HKKA 1NW4A 2IPXA 2LIPA 3ZN2A 3BMNB 2OESA 5DP2A 4O8ZA 1JU3A 3BXFA 4WA7A 2VYND 1KNQA 5BSMA 1ZMXA 2JHGA 3K1YA 3I32A 4L0MA 3GN1A 3HUTA 3RUEA 3DFUA 1FQKA 3E7PA 3AINA 4MKGA 4M0AA 2YOFA 5BN1A 2VQEB 4YRAA 4JBNA 2JEYA 3AEQA 5IASA 4DS4A 2QSZA 3IUQA 4GUDA 5FJJA 4WL0A 1Z33A 1G9XA 4Q7MB 1E2PA 5KJ1A 3OETA 4YCXA 1VHQA 1RC0A 3KVNA 3R0QA 4U7DA 4XSHA 1KWGA 4OJOA 1BMTA 4RS4A 3QXSA 2CL5A 1WHTA 4YI5A 2P5YA 5EJMA 4YXWA 3IAHA 2Q21A 2RHDA 2RHJA 1H3NA 1MVNA 2AKYA 1T1JA 1XALA 3B1VA 3ONWA 3NV9A 1RQXA 1VIMA 3LW7A 3NATA 3O8LA 4Q4HB 1L6NA 2ZANA 3U9TA 2II6A 3SDZA 5EJ4A 1Y8ZA 5BWOA 2ZUEA 5K8UA 1P3Y1 3GEIA 2TRSB 6ADHA 2QGZA 1E9RA 1CZUA 3AILA 1U4NA 4BQIA 1I4EB 5ALZA 2XUGA 1J1UA 3FUXA 4A8JB 4IRXA 1XCJA 2WKPA 3LF1A 1L4YA 4LTDA 2GJ4A 3TR6A 4OXKA 1BPXA 3DOEA 3UJCA 5BMOA 3ZYZA 4BHTA 1T25A 1V4VA 1C7JA 2NW6A 3AFMA 4GKVA 4JGBA 4JXKA 3EXIA 3QYJA 5DMXA 3NBQA 4GR9A 1KDOA 3OT4A 2PRJA 4TXLA 3CTPA 1K08A 5F64A 4I2HA 2OD7A 2ZZKA 2HR1A 1DLJA 2C9MA 3MYRA 1H66A 4TX1A 4Y1EA 4YAOA 3S70A 2CVQA 4G84A 3IIJA 1T1EA 4I2DA 4RQNA 3REFA 3DOJA 4OUDB 1JT2A 2ZVQX 3FUVA 4UM8B 1Y9JA 1LQ2A 2B94A 4IJMA