2JGAA

Crystal structure of human cytosolic 5'-nucleotidase iii in complex with phosphate and magnesium
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRRKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Cytosolic 5'-Nucleotidase II: Insights Into Allosteric Regulation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
total genus 98
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2jgaA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jgaA01
4DWOA 1U7OA 3AR4A 1QH9A 4BEWA 1Z4QA 1RKVA 3ONNA 5AKGA 4YCNA 4YGYA 4L6CA 5ALWA 4JDPA 1EK1A 3EF0A 1YNSA 3QXGA 4OCZA 2B8JA 5ALUA 2NYVA 1TE2A 4BBJA 3ESRA 4DW8A 1RKUA 4NV0A 2JARA 3I1YA 4OD0A 4KX5A 3SD7A 4L6AA 3OCXA 2FPSA 4HGNA 4ZEXA 5AW1A 2NO5A 2HOQA 5AIBA 4B6JA 1Z5UA 1Z4KA 5AVVA 3L8HA 4JB3A 2C8LA 4L57A 2AH5A 4I9GA 3SF0A 4UMEA 4KNVA 1Z4IA 3NAMA 5ALNA 4F72A 3NASA 1IWOA 1YMQA 4NAVA 5AKYA 1VJ5A 2HX1A 2PKEA 3I6BA 1CQZA 3ZW7A 3U7FB 2FUCA 5AVRA 2G07A 5AW2A 3BA6A 3QU9A 2HEGA 2HDOA 5ALQA 4CF3A 2I54A 2W43A 4DFDA 4UARA 4G9BA 1YDFA 5AW9A 5AESA 4G63A 2I33A 2IA5A 3SLRA 2OA0A 1RMYA 3WK6A 4EELA 5AVTA 4EX6A 5AKJA 2C8KA 1TA0A 3WKDA 1Z4NA 2FDRA 5AHXA 3ET5A 2B1QA 2IOHA 5AI0A 1XPJA 2CFRA 5AW8A 2WF5A 4XOUA 3WKAA 1WPGA 4C4RA 3DAOA 3OCWA 1L6RA 2R8XA 3QU5A 2JAOA 3UMGA 5A3SA 5AK4A 3AR5A 4KNWA 4IG4A 3WKEA 5AM2A 3L8GA 5FP0A 2RARA 3L0CA 2AGVA 1PW5A 3OCYA 3L8FA 2QYHA 3FGOA 2Q5EA 3DV9A 4UMVA 2YJ5A 4RETA 1VJRA 1U2SA 3M1YA 5A3RA 1ZD4A 5ALPA 2YMMA 5AI6A 4UASA 1U02A 4HYTA 3L7YA 3N8GA 2G1AA 1ZD2P 2B82A 3L1VA 2FUEA 5AK3A 3ZTYA 3OCZA 3NUQA 4FE3A 1JUDA 3ZVNA 5AW4A 3ESQA 2WM8A 2ZBEA 3R4CA 3QUQA 1Z4JA 4Y2UA 1RMTA 1EK2A 3L8EA 4GXTA 4E88A 2EAUA 2RB5A 1WZCA 2YBDA 5JJBA 2O9JA 3B9BA 4BNDB 3HLTA 1K1EA 3AR3A 5AVZA 2HF2A 2GHQA 4NABA 2P69A 1RKQA 3ZU6A 1TJ4A 1YJ5A 2CFTA 5ALIA 2FEAA 3PDWA 5ALOA 2OBBA 2CFSA 5ALHA 3ZUPA 1Z4MA 4BNDA 5A3QA 1J97A 2I6XA 3R09A 3N1UA 1ZJJA 4I9FA 2YFYA 3J7TA 5AKZA 2FPXA 1Y8AA 4UU1A 4EX7A 3A1CA 5ALRA 3W5CA 3WKCA 4DCCA 1QYIA 1U2TA 3PCTA 1ZRMA 3SKXA 4CNQA 2ZBDA 1ZS9A 3VAYA 1VFPA 3A1DA 3WK5A 3ZVLA 4O8CA 4UU0A 5AIAA 3ET4A 2JAUA 5ALFA 1CR6A 2B8EA 1L7MA 3MC1A 5AM3A 3SKYA 1TJ3A 3S6JA 3WKBA 5AVQA 2BDEA 5ALZA 2EATA 4J03A 5ALVA 3IJ5A 3W5BA 1NF2A 3DDHA 2C88A 5ALMA 5AM5A 3QU2A 2MSNA 3M9LA 3L1UA 2JGAA 2WF8A 4C4TA 1WR8A 3KDPA 3QU4A 3DNPA 3KZXA 4Y3UA 1F5SA 3ZX4A 1SWWA 3L5KA 2GHTA 1YV9A 4PNHA 1ZRNA 3B8EA 4GIBA 5AW6A 3QLEA 3WGUA 4Y2QA 3A3YA 3EPRA 2YMLA 2NO4A 3FM9A 3QNMA 4XE5A 3QYPA 4Y2YA 3QX7A 2AMYA 2D2VA 3KOOA 4KYTA 4BX3A 2IOFK 5AK5A 4UAUA 1ZD5A 5IS2A 3WGVA 1T9ZA 2IYEA 2G06A 3ZWKA 4F71A 1N9KA 3BWVA 4OHFA 3K1ZA 2G80A 3AR6A 1S8OA 3GYGA 1RPZA 2Q4TA 2DQSA 5AW3A 1QQ6A 3OCUA 4EEKA 2QLTA 5E0OA 1Z4PX 2W4MA 2EARA 3NALA 2I55A 3P96A 1J8DA 3AR8A 1O08A 4YH1A 1L7OA 5AKLA 5AVSA 1L8OA 4BYGA 3U7EB 4MWOA 4CF5A 5AK6A 3U7GA 3SHQA 1Z4LA 3N5KA 5AVXA 4HGRA 2PQ0A 3E84A 3EWIA 1RRCA 1KYTA 1RDFA 1X42A 2ZBGA 1NNLA 4ZEWA 1L7PA 3AR9A 4BX0A 5ALEA 4Y2PA 2P11A 3MMZA 1LVHA 2FPRA 3SMVA 4CE6A 1T5TA 5AM4A 3NANA 4Y2VA 5AKXA 3U13A 4RESA 2BDUA 1RLTA 3MN1A 5AVYA 4AS3A 3CNHA 2YJ3A 3ZWDA 4QJBA 3ZTWA 4H1WA 4HGOA 1SWVA 2GMWA 2RAVA 4HAIA 1ZOLA 5ALSA 5AM0A 5ALGA 5AKEA 2GO7A 1U7PA 3WK4A 2GFHA 4ZEVA 2P9JA 3MPOA 3N28A 4QQFA 5AKHA 4EZEA 2G08A 3NIWA 2VKQA 2IOFA 3WK7A 3B9RA 3HYCA 2JAWA 3I28A 5AI4A 3IB6A 1L8LA 3ZX5A 2ZXEA 3E81A 5AW0A 4AP9A 2X4DA 2W11A 3E58A 3KBBA 4XQ0A 3QU7A 4BEVA 1TJ5A 3U19A 2G0AA 3PGLA 2HHLA 3QGMA 4UAVA 1S2OA 4NFLA 3ZVMA 4Y2SA 2HI0A 1T5SA 2MU1A 4HGQA 1ZD3A 4Y2TA 3WK8A 3FVVA 5AM1A 2G09A 1MH9A 3W5DA 2Q4RA 3OTQA 2AUTA 1RLMA 3FZQA 2YY6A 4KN8A 2YJ4A 5T41A 5AVWA 2HCFA 3IRUA 3QUTA 4UATA 4UW9A 4UM7A 2ZOSA 4FFDA 3R9KA 1LTQA 3KD3A 2ZG6A 2OYCA 1XP5A 3AR2A 1RMQA 1Z88A 3FPSA 1XVIA 1QQ5A 2P27A 4HGPA 2HF7A 5AI5A 1Z5GA 5AW5A 1AQ6A 3EF1A 3D6JA 1O03A 5AI8A 5AKIA 5ALTA 4Y2RA 2ODAA 3W5AA 2WFAA 1NRWA 1Q91A 1RC8A 2CN1A 3WK9A 3ED5A 2C4NA 3AR7A 2HSZA 3OCVA 5ALXA 5AI9A 4XPZA 1QQ7A 4IFTA 5AKKA 2WF6A 4BKMA 4Y2XA 2HO4A 4Y2JA 5ALDA 2BY4A 1YS9A 3RFUA 3NRJA 3UMBA 4EENA 4MUMA 4UMFA 5AW7A 4BX2A 2I7DA 3E8MA 3F9RA 5IT0A 3QUBA 5ALKA 3PGVA 3ZI4A 4YIHA 5ALYA 2O2XA 1Q92A 3OPXA 3TLMA 3UM9A 5ALLA 2FPUA 2YMPA 3N07A 4UMDA 3U26A 2B30A 2B1RA 1RLOA 1WVIA 1N8NA 3KC2A 2PR7A 3RF6A 2WF9A 4J2TA 3QUCA 4AS2A 1L7NA 2YN4A 4YCMA 2FI1A 2WHEA 1FEZA 1SU4A 4FYPA 2ZBFA 4UM5A 4NWIA 2B0CA 4CF4A 2OM6A 2YJ6A 4YIKA 1RQLA 4C4SA 3L0BA 5IT4A 2RBKA 5AICA 2R8EA 4KX3A 2R8YA 1RQNA 3FPBA 2FPWA 2I34A 2WF7A 5ALJA 4YCLA 5AVUA 2C9MA 3I76A 3A1EA 2YMQA 3U7HB 1Z4OA 4OFZA 2R8ZA 3CZ4A 3L0YA 3UMCA
chains in the Genus database with same CATH superfamily
1X1SA 2W9BB 1OFTA 3G0IA 4DWOA 3NHRA 1A04A 3ID6C 2ONJA 4MYTA 4UEKA 3ZN2A 3PE6A 1A0PA 3LDAA 2CGEA 4DLYA 2IU4A 1S8FA 2EV9A 2BBOA 4P35A 4C0BA 2BF7A 2Z57A 3I9FA 5GONA 2O54A 2MYPA 4Z54A 1Z63A 2WWTA 4MQFA 1ZL2A 1YCDA 2FEKA 1GGHA 2V3VA 4D46A 1FJHA 3C4JA 3EY9A 2UZIR 3OZRA 2NUAA 1P2TA 2HK7A 1GVHA 4JI5B 4DR1B 2QR3A 4GPAA 3AU2A 3K2QA 4HXGA 4J0GA 3ZVKA 1NK7A 1EFLA 2VLBA 3Q3HA 1KEWA 5KSZA 3PYXA 4LZAA 3IEXA 3TOXA 1MNAA 2F76X 1NJZA 3A0HU 5CCEA 5J43A 3SLKA 4NCNA 1RBMA 1JIJA 3L8HA 1S2GA 1NUSA 4AY3A 1B00A 3D3KA 2QLBA 5JRTA 1SXIA 1TUEA 2V6IA 3LPAA 1QF7A 4FGUA 3GIDA 4RNDB 4JBWA 2VPPA 3SF0A 3SR3A 3VPFA 3E9CA 2DU8A 3D4NA 2GGSA 3N2GA 1Q16A 3OQHA 4B85A 1WOMA 2CC2A 4Q00A 2P4HX 4E15A 3FNGA 3QMPA 1V1RB 3ZD9A 2Y05A 1GQOA 1QX3A 2WU4A 5BW6B 5CDTA 1SH7A 3UMYA 2ADFA 1NN3A 4IFBA 3PY8A 2NMVA 1T4CB 2XB6A 1QCDA 1CY8A 1UMCB 2IP1A 2VP9A 3E23A 3L7OA 4IMPA 5E4YA 2QJWA 1KMQA 1J42A 1KXJA 3N53A 2XNKA 4ES6A 5ER9A 1ISHA 2H48A 2Z9DA 1QC5A 5ILGA 5KYXB 4HQOA 3U3OA 3ZE2B 1X13A 7ICKA 2YV1A 4LAFA 4US1R 5H7XA 3LC1O 2XCPA 1BYIA 5JNVA 5U4XA 2A1UB 2ZRNA 4FHZA 5CA0B 4OYLA 1C9JA 1QJCA 4G9BA 4KK3A 2JVJA 3BMOB 1Z00A 3AL0C 1U0LA 2BISA 1JHQA 5GGXA 6REQB 3FN4A 2BSAA 4IDOA 4R1UA 3GMIA 4Q7EA 4B7XA 9ICPA 4ERNA 1M73E 2HSEA 3MWJA 4NFHA 2W70A 2FJ0A 4K2AA 2ZK7A 1DKLA 1B0PA 3V8NA 3NR2A 4F6CA 3B13B 1CBUA 2P7IA 3FNFA 4WY5A 2DM6A 1QV7A 4RA9A 1KMHB 5HFAA 3K4PA 4DLTA 2ZIXA 3U3RA 1ZC3A 2DBQA 2OV3A 1EWRA 1IZZA 3ZWAA 4AJPA 5AW8A 1N2HA 2WF5A 3W3AH 3IVGA 4NBKA 5LQMA 2BFFB 2JCXA 3ILVA 3A2MA 5AUQA 4J1TC 2QN3A 3R9WA 2ZATA 4N01A 4ASUD 5I7OA 2QRHA 1D9XA 1E6CA 1XQVA 3DAHA 2ATCA 1BDHA 5ITWA 3LVQE 2VTDA 5GM2A 2BRUC 2HVIA 1Q7EA 1SXJD 1XNRB 1TI7A 5KHLB 3DGFC 5E8RA 3L3FX 4TWRA 4TLMB 1ZRSA 4XUEA 3T41A 2BPCA 4I4LA 3WQBA 5KO2A 3RANA 3FGOA 3GCWA 7ICEA 3DV9A 2ZSKA 4ND6A 4C0SA 1PWYE 2L2QA 5KNCD 1M1YE 2J5XA 4CXMA 4EGAA 5A3RA 2HMTA 3LRTA 4IDQA 4YCSA 2R8OA 3ZZ1A 1BNPA 4UAJA 1U3WA 3WSWA 3D8SA 3M6ZA 1KVRA 1IN8A 3CVXA 2G1AA 4G5QA 1SC4A 4ECQA 4XKJA 4YRRA 1E2PA 1XVVA 3NP9A 2LHTA 3ZTYA 4UHHA 4AMVA 3RREA 4LC1A 5CJ2A 3G7UA 1OR8A 4BMNA 3ZVNA 3PJDA 1VKRA 3FYHA 1X7GA 3ASUA 5EHZA 2L0XA 5EE3A 1I51A 1GKIA 3BEOA 4G3IA 3ZQ4A 4BE4A 3W5CA 2D1SA 1QDEA 1ZETA 4ZGWA 1WUYA 2G63A 4DLKA 4HX9A 1WXQA 1QH1A 4WXMA 1J25A 3OPQA 5GAJA 3VR2D 2XZLA 3C7DB 4FVTA 3UPDA 2BMWA 2YBDA 4ZGGA 1IK4A 3E3OA 3VOBA 1QGED 4D3ZA 1N8TA 1V8BA 4JR0A 4XVQA 5KT4A 4YR3A 2XICA 2GA8A 3WHKA 2I3AA 4KJXA 3AR3A 4QPPA 5C5CA 5JAOA 2H0RA 4Q4DA 4D92A 4GI7A 4KG7A 4D8XA 3B9PA 5L9AA 5I7UA 3V46A 4DMHA 2E18A 3A4IA 4X5VA 4UKDA 1KIAA 5DI3B 1NUTA 4IIXA 1QO9A 4MW1A 4EUKA 1PWZA 1MPXA 4ZPXA 4CT4B 4HVCA 3AB7A 5AH0A 4B8ZA 2Y76A 3WAGA 3R3ZA 4O1MA 3FTDA 4JQZA 1AKEA 1VPTA 1W36D 5L7WA 1PVVA 5DBHX 4QYSA 4MP3A 4TTAA 2NTEA 3HCFA 4RZRA 1E1CA 5C7OO 5I4BA 1WDLA 2DWCA 3GVCA 1KJNA 1S2LA 4D4JA 5HUQA 2FX2A 2G6TA 4KLAA 1VG1A 4RV4A 3WKCA 4DHEA 5J2AA 3PT9A 3SKXA 3C1UA 4MW0A 5A3VA 3RB6A 3RSOA 1ZS9A 3HFSA 1H5NA 1VHDA 4QZEA 3DZ8A 1G8JA 2B99A 3TLGB 4KCGA 4RS3A 2GESA 3GIJA 4F2RA 1M33A 5H3HA 5BWNA 4D74A 1I2ZA 3B1YA 1DT3A 2QUBA 2HMWA 1FFWA 2NUBA 3O91A 3DBIA 1PKXA 2RDMA 1GZVA 2G76A 3R40A 1BNOA 5LXTB 1Y6QA 3DVRX 1GADO 1RLIA 1Y4SA 1AIPA 2W71A 4QBGB 4B6SA 3QHAA 4X1IA 3WO1A 4CKBA 1OH7A 4WFJA 3KJXA 2BMFA 1PWEA 5BT8A 4R64A 2VYVA 3ZE8A 3QIVA 5CFRA 1JIUA 5DM60 1ARZA 2NRZA 3CINA 5EIXA 2GKOA 3OJCA 2BGKA 1UC8A 2IF0A 2YQ5A 1F6DA 1Z15A 4HGYA 5ERGB 3W2TA 1N1EA 3OHBA 4IH4A 6CHYA 2AXNA 2VYNA 1KKLA 1DGQA 1R5NA 4INJA 3TEFA 1U1DA 3GWGA 3RD5A 5CDFE 2P62A 1S3IA 3ISVA 4QD3A 1ZRNA 5HFNA 5H9WA 3ZH9B 3BAZA 1J1ZA 4X6YA 3E0FA 1ZHOA 2OPBA 4UBCA 4TN1A 4S05A 3HUTA 3Q8WA 5FUQA 4LQ4A 1E20A 3O82A 4JBHA 5FBHA 5GJVC 4B33A 3O8RA 2BMAA 3K0AA 3WIBA 2I6SA 2JA1A 3GG9A 2YXLA 2YR0A 4GPIB 5CT9A 4I2BA 2BV3A 3KIPA 1LK7A 1KMIY 4O4IF 4OXKA 3D4BA 3TE6A 1XD8A 3UK0A 2CLDX 1YCFA 4F8YA 1XTSA 4YUVA 1PBNA 2ZRHA 2YQZA 1LRJA 1NKCA 5A0FA 1L5RA 3FGPA 4F71A 1P77A 3G23A 1NM5A 1A76A 3BWVA 4G1FA 4LVUA 2W9CB 1FRNA 1KEEB 4W5RA 4R2WA 2Z6AA 2R1VB 2V4ZA 4LI3X 1UQRA 4UJ3A 3DKKA 5K0LA 3B1XA 3IBYA 3BCHA 1KZ7B 2Q4TA 1S5LU 2WABA 3IOMA 4GC7A 2AHOA 4D3YA 1XDWA 2PLNA 4YRBA 4IG9A 2W2MA 3A7DA 1TVKB 2HKIA 4AXXA 1U3DA 1FDIA 4GZ6A 2W5UA 3QBTA 3Q2KA 1P2GA 3AR8A 3FTNA 4J6EA 1GUBA 3EGDA 1XZEA 2FP4B 2VJ4A 3OU2A 4J9VA 1M1YA 3U7EB 3ZZMA 3Q6MA 5DRTA 3ZIDA 1RYZA 4M1SA 1DVRA 3JTEA 4HAOA 3A27A 1RWBA 1YMUA 4I2GA 2E1FA 4PEVA 4Q48A 5E95A 2QTZA 4JN6B 3KQHA 3OF5A 4LZLA 3LNTA 3EWIA 2Q3FA 1QR2A 1EVQA 1UZMA 2FW0A 3USES 2BC9A 5EP4A 1X42A 1VE5A 2PBRA 3GHHA 4EHAA 1GZDA 5JPCA 5K6TA 4QBHA 2E4UA 4QC2A 2X23A 5GTDA 2QUHA 4MZDA 1Z28A 3V34A 1VOTA 3N7UA 3PIDA 1FYVA 2IIVA 4I4CA 4NP6A 1CS0B 2JLCA 1QNFA 3BRCA 2F3QA 4RQUA 2EJVA 2Q5HA 3QV1A 4WRRA 2NT3A 3NC4A 1UDBA 4ZODA 3TNJA 1IM8A 3C6YA 4UD6A 4BDPA 4QTZA 5K2MA 4IDFA 3WMWA 5EHGA 3MQFA 5K03A 4I1IA 1AA6A 2O14A 4A0RA 5KZMB 5TJ9A 3V4LA 2Q1XA 3OZDA 5FBZA 5HIJA 2J4DA 2ZJ1A 3A9UA 3LLSA 3MN1A 2W6IA 2BL4A 1XWFA 2DPGA 4W8OA 3CNHA 5F9NA 4CN9A 1SV4A 3HUEA 2OK7A 1S3SA 3IPYA 1L2TA 4HO1X 4JZYA 5A0LA 1N5OX 3F6EX 4ZALA 4BVBA 2RAVA 3AINA 2BBTA 4IDHA 5DLFA 3AVYA 3RRMA 3QE2A 3RS0A 2YDXA 1E1RA 1XJ5A 1QFXA 4YALA 4QNNA 3WICA 4QO8A 1W0KD 1NP3A 3FGZA 3CRXA 1GFZA 2F2TA 2I6UA 1JEYB 2CNOA 2B6NA 3ZLJA 5AKHA 4M47A 2OZEA 3K3PA 221PA 4XLLA 5B7GA 1C0EA 1JR3A 4HTFB 3RAQA 3GLFB 4X00A 4B7UA 3G0GA 1A8QA 1WOYA 5ANRB 5C51B 4YUAA 3DMTA 1BEUB 4A10A 3BS5A 5HKKA 4ETNA 1V26A 2F64A 3WB9A 4D42A 4WN9B 8ABPA 1YC2A 2X8JB 2WJ4A 1XTZA 5AYVA 4KGZA 3NCHA 4GVXA 1NFQA 5DHUA 1WQ3A 4KBYA 2P66A 1Q57A 2CUNA 2OECA 2UYOA 3T7DA 5FTNA 2D2IA 3R0ZA 2QMZA 4U02A 4D3SA 3AUUA 4G0QA 2FW8A 4OLJA 2C9BA 3JRWA 3KAKA 4Z51A 3ZNQA 1ZMXA 3TX6A 3VDQA 2IODA 1WSWA 2NO9A 2XY7A 2DQYA 3AHJA 2PM8A 4FWBA 4HWOA 3ZCRA 4AKEA 5DN9A 4CM4A 2Z2YA 1NKSA 3DFFA 3TE7A 5J4HA 2I71A 2AFHE 4KO4S 2WG1A 1RI2A 1NVTA 3C6QA 2W55A 4TS9A 5JO0A 4ZC1A 1T7PA 3BUSA 3U4GA 2YJNA 4Q1FA 3U37A 4PO9A 1JSXA 2YZ7A 2BFMA 4P84A 5JO9A 2C7PA 2JEFA 3MCTA 5KS2A 4NJEA 2B20A 3TNDA 1QLJA 4EA6A 5K0GA 2Q4RA 3OTQA 1OLOA 3SCZA 2O2HA 1LW7A 2X2FA 5EKSA 3DPSA 1XO0A 4M2YA 1Y8QB 2Z3ZA 4ENWA 7ICMA 1IG6A 3Q5EA 1Q2UA 3UENA 3CPHA 4RZSA 5AJZA 2FHSA 5J5AA 5DB8A 1LTQA 5JCXA 1ZI9A 3P26A 4OJPA 1UPHA 2PMDA 3SS8A 2ALJA 2YNMC 4PHEA 2YHIB 5JECA 5MHTA 1B8NA 1CQPA 4N5HX 1WXDA 2P27A 3NHPA 4FONA 5FOQA 4AN4A 2ZP1A 1QE0A 3DEYX 3DTVB 3T1YB 3G2LA 1NIPA 5GP1A 3RVJA 1Z5GA 3RR8A 2FRXA 4NOKA 4NZYA 5K0EA 4L0DA 2V0GA 4JEMA 3TZ6A 4UDXX 2WQ7A 3D4LA 1U6IA 1AMUA 4RTQA 1COWA 2R68A 3LM8A 1Q3TA 1BXZA 1EX6A 4RACA 5JE8A 2Z4RA 4K3UA 3OTIA 1JVBA 4GOOD 4LHYA 5GOTA 4DMRA 3AY3A 3TBHA 3TLXA 3W5AA 2H85A 1CUHA 4R9SA 3N75A 4HQKA 1DO8A 5LFAA 5K3FA 3ONDA 4J0KA 2I7VA 2QZPA 3MD9A 4BB6A 3M7DA 3UVEA 2EGHA 4A2WA 1EXVA 2M6KA 3GN2A 1BVHA 4RKFA 4IR1A 1I6WA 1DQZA 1QH1B 1GXSA 5EA2A 3ZWXA 2QE7D 2Y0PA 1XTKA 2GPBA 2VAWA 3H2GA 4PU0A 1BVRA 4R1PA 4ZWNA 1WVGA 3TAQA 5KQRA 3F73A 2JIRA 4DLUA 1WDWB 4MYSA 3VR5H 3VOTA 4QXRA 3GNQA 4CMGA 4CCHA 4DMLA 2HFJA 1D8AA 2OAP1 3E9ZA 2X42A 1D8TA 2QTVB 2BD0A 3GJ3A 4CV1A 3LQ4A 1DNPA 1I32A 1XZJA 3P5SA 3ORYA 3SJ7A 1S2MA 3BKWA 4H7JA 4JLAA 4DARA 2H2WA 3D6TB 2AX4A 3UJ7A 5A6SA 4YIHA 3OPXA 2OEHA 5G53C 1WUDA 2FPUA 2JKYA 2OHJA 3DDCA 3M2PA 1WP9A 3PYMA 3QG1A 1O96B 1NZJA 3TMYA 3VU0A 4EDHA 8ICLA 5CG2A 3Q0EA 1T91A 1LJUA 5LB4A 1QANA 2XLBA 5ETJA 4MRMB 1GL3A 3RF6A 4RL6A 1W93A 1SK9A 4BO9A 4GOMD 4GMGA 4DDTA 1EDBA 2ES6A 3QUCA 5K8LA 4W8HA 1P7PA 2WTXA 2B1GA 2HK6A 4CL3A 3G1WA 3T5HA 4MOWA 1FEZA 4X41A 3SHFA 1RI1A 4E1AA 1A2BA 2ZUWA 3DT9A 1EVKA 1NTRA 4J29A 5EPOA 3OZXA 4G5HA 4UVEA 2HVHA 1BTOA 1RCFA 4E7PA 5CX1B 4ZPJA 3SV3A 3BHMA 4P7BA 3W0LB 4XXHA 3DUFA 4JR2A 4KTTE 5LD2C 4R63A 1FSGA 3FTFA 2HA2A 5JUWA 2E5FA 1ZNZA 4FC7A 1M6VA 4MKHA 3UICA 4LBZA 4K6OA 3BOSA 2WF7A 1IE3A 3V80A 4YCLA 2PKQO 2QB1A 1NA5A 4MEYA 2X5XA 4AROA 5U1PA 4AIIA 2ON6A 2VJBA 1TO1E 3I8SA 4MVYA 1R8YA 2YUIA 3O0DA 2EU8A 1I13A 5E1OA 1IATA 4QYWA 3WL7A 2HPHA 2P77A 2ZWOA 4OUDA 3UMJA 1O97C 3UMCA 1Z1BA 4WESA 4MUEA 3ZJ4A 4EO9A 1S2DA 3PHHA 4C6TA 2II6A 5EJEA 1GTVA 3MK31 1W87A 4IDNA 3LWNA 3D6VA 2ZYWX 2CZQA 3CZRA 3L43A 5B53A 5BUQA 1XE3A 1YHYA 3HZZA 2OBYA 4MLCA 3L8DA 5EY5B 2XUOA 3QUSA 5ICEA 4W6QA 5G5HA 2XTMA 4YAIA 4OCZA 5J8YC 4HN2A 3ZKAA 5DISB 4PYMA 2KOBA 2QUJA 1GUYA 4YO8A 3W8NA 2RGNC 2NYVA 1MV8A 3GMTA 3X1JA 4KLDA 4BO1A 5DYWA 1L5ZA 2QVYX 3PSHA 4V0LA 3RWOA 5L3QB 5H2FU 2D59A 3H1BA 3OZBA 2QLMA 3BCSA 1ISFA 4IDBA 4I81A 4TMKA 4EB6B 1B6SA 1CPYA 4IKOA 4JUCA 4EJFA 2TYSB 3W5SA 2JCGA 1LA2A 2XTNA 4N7BA 3PPIA 2JDIA 3RIXA 4UVGA 3JQ8B 5LQKA 4UB5A 1PJ4A 3AWDA 3LOPA 3M1IA 5FI1B 1Z4KA 1QHNA 1MDFA 4LJ9A 5F52A 3PNMA 3BMXA 1PX0A 2Q99A 3N2GB 1Z83A 3Q87B 5CYOA 5IJAA 3JARB 1D03A 2JI6A 4R2HA 1GAXA 4TS4A 1NFFA 3JVUA 4N18A 2BEKA 2NNWB 1IHYA 3GBPA 3E2EA 4D4IA 5F3WB 1KQQA 2GEVA 3JZMA 2PWZA 5P21A 2XHZA 1VL6A 3CLSC 1J90A 3FDFA 2QN8A 4QZHA 1J2UA 1A8UA 2NADA 2VDWA 5J2GA 3PL1A 5TC4A 1N5WA 4C7KA 4EHDA 2NU7B 1A2OA 4CIBA 2ZCVA 5C52B 2ZXFA 1LV5A 4AZ0A 3S7ZA 3F2DA 5LLDA 2AJ8A 2AJQA 1JBQA 2IU3A 3UMMA 1EBBA 3M6LA 1Z3CA 2E21A 4FXPA 4BASA 1E9BA 1OKKA 2X8LA 3H1GA 3GMSA 1DAEA 4NU8X 1KW4A 4O5EA 5HK8A 2KLHA 4KLTA 5DASA 3U39A 3OQOA 1JL3A 1JPJA 1YJ8A 3CR7A 1Z39A 3OPYI 4EHIA 5BOMA 2LYAA 1NUPA 4N5LA 1NBWB 5DVZA 3NPAA 2WJPA 3HKEB 3AEYA 5BN3B 4LA4A 2EKLA 4F46A 1K4MA 3EYWA 2Q27A 2AK3A 3S2EA 5K3DA 1IXSB 4BVEA 2XUPA 2IA5A 2G88A 2MRLA 3TD2A 1FUYB 1NASA 2E4YA 3F5DA 3LUPA 3P9RA 5AKJA 3QQPA 1TA0A 1YVUA 3D7MA 3DL4A 1M2EA 1RLJA 3VNAA 3V6JA 2UVRA 3ZHUA 4BDSA 4II3A 3DH0A 1R0SA 3A1WA 2QX4A 4WXPA 5A4MS 3ADCA 1WCV1 3P9NA 5F12A 3DCNA 5KYUB 5CHEA 2GN6A 4WINA 4DHWA 1MVOA 3HCAA 4ERXA 4ZOLA 1E3IA 5A7FA 1PFVA 9ICBA 3OD5A 3G1UA 3ZDCA 4R69A 4RVGA 4NMMA 1A5SB 3KT8A 2WKQA 4MI1A 4JUZA 3K6SB 1Z17A 1Z34A 4UB3A 3O93A 4FMCF 1HG1A 3MFQA 4GFDA 2GLTA 4IWXA 4ZAGA 3CW8X 1TEZA 3FHLA 3L93A 3FWPA 4XTCS 2G71A 5FP0A 2RARA 1G2PA 4HMQA 5IPFA 4G4IA 1VHQA 2PMCA 4C5AA 3FMIA 3RWMB 5LOVB 5EFOA 1G8AA 4CJXA 3ZBPA 2V4UA 4FE7A 1JWAB 3A58B 5KYYB 3KWLA 4DR2B 4E11A 3L41A 4L74A 1XRJA 1XVLA 4Q4AB 1K7YA 3GFPA 2YXDA 2Q5QA 3AEQA 3HYRA 4LDJA 5BY2A 4EVRA 2PUFA 4ENUA 2FPIA 3THYA 3FI0A 2DWUA 2CXHA 5LVAA 2RGWA 2I7TA 5TPZA 2FLNA 1SC9A 5J2UA 1W76A 2CNLA 4D98A 5K0TA 1F8YA 4V38A 1BWPA 3OCZA 1KU0A 4K5QA 1JZQA 3UXPA 1QRAA 2NYUA 5DHRA 4CQNA 2PUJA 1C9NA 1U8ZA 2R7AA 4XD7A 3RS3A 4WEQA 4DSEA 1T0UA 3OEYA 4TKMA 1YQWA 2HSDA 4YXWA 1E4OA 4DCPA 5CLJA 4QJFB 4R2IA 5KQGA 3HPRA 3AF6A 1RM4A 3M49A 4KXFB 3UWMA 1M0WA 1J0AA 1G64A 1PT8A 4DS5A 3Q7PA 4NY1A 5SY6A 1PZNA 1HUQA 2X41A 1M74A 3JPRA 3CFYA 4EITA 2VZLA 1NRXA 3FD8A 1QH8B 4EBCA 5I9LA 1OUQA 1XKLA 5B4VA 3AYZB 3WLQA 4YA6A 4ZOQI 1TT5A 3JVVA 5L7TA 4CEIA 4PC1A 3UMFA 8ICMA 1JQLB 1V5IA 1B1AA 4ZQIA 2ZAIA 1TJ4A 4HN9A 4I4IA 2O3SA 3LDHA 1EXNA 3KO8A 5DE3A 2CUKA 5J9FA 2AV6A 2E2WA 2IYWA 1KWGA 3ZJUA 3R5HA 2X0RA 4KFUA 2FOXA 1TT5B 3PDWA 4H4EA 4BMOB 5BWBA 1XWIA 3ZR4B 4QXAA 4WK6A 5KTRA 3ER8A 1BGXT 3ENZA 3N1UA 4ZZ3A 1S9FA 3IUBA 3J7TA 5AHOA 3SYLA 3V7FA 5JC1A 4AJ4A 5JFGA 2ZIUA 4Q7KA 2D13A 1FYFA 2HA5A 2QSYA 3I9V1 3A4MA 3OLXA 2HLNA 4D0SA 4JJ4A 5DTQA 5IDXA 3Q7EA 3CX7A 2VA9A 3EQ6A 4CQMD 1QF6A 3PMNA 1MAHA 4Y8VA 4NENB 4DJ5X 4B9NA 3VAYA 3V2HA 3A1DA 5JW6A 3MLAA 2WV7A 1YU6A 2RH8A 3QX3A 1YRBA 3HBFA 4KUHA 2JAUA 3VZDA 5C1OA 5ALFA 1WCLA 3NBYC 4C8LA 1L7MA 3KQNA 4CGZA 1B42A 3ETJA 4YD2A 2QW1A 1S4MA 4DMUB 3G8CA 1WCNA 3M5PA 3BJMA 3AU6A 4BBPA 3GXBA 4QGAA 5SY9A 3UJ6A 5KFSA 3VR5D 2XCQA 3IJ5A 2LR0A 1NJSA 3CLVA 4Q4AA 5K0CA 5KWJA 4WZZA 2XD9A 4K7JA 1W6RA 4CF7A 1W49A 3NTXA 5E79U 1K92A 4RVOA 4ZI5A 1PP4A 4DNPA 3F9IA 5BVHA 2I91A 1AH2A 5HJ2A 2RG7A 3PRKE 3R5XA 4JT9A 4NHOA 3W4JA 2QQGA 2WF8A 3FCUB 3E9RA 3SYMA 1CUWA 4DF4A 1WR8A 3C0KA 1G8YA 4W5HA 1SL0A 5B7QA 4ZT2A 3LWMA 2WB1C 3GZ4A 3HHEA 3OLZA 1P6UA 4L15A 2FEPA 2FZLA 3ZX4A 4F0JA 5JNUA 1SBTA 5HG0A 1QYXA 1THZA 2FZCA 3QVWA 3EPJA 4M8LA 2NV2B 1WY7A 1KY4A 2BMDA 1M6HA 3AUYA 3EEOA 2VDPB 1G7TA 2X1LA 2RIPA 3BSFA 3EXHB 2XUGA 1KAOA 4HLDA 4OHZA 1J49A 4I1UA 1BXRB 3IUYA 1N5MA 3V1TC 4RTJA 3ZCUA 5BR4A 5TE9A 3FRIA 5A4JA 1W5BA 1G19A 5A1JA 2H3HA 2NU8B 5JSYA 2PGLA 2DFLA 3A0UA 4Q44A 4MO9A 3X1YA 3ZNNA 3SEIA 3VR5A 2F55A 1RJEA 4WAUA 1Y6FA 4KUGA 4O4JF 2OGSA 1Q3KA 1T6ZA 1MB3A 2OD2A 5H59A 1SK8A 4YYZA 1E32A 4OHFA 4Q3BA 5BQ3A 4X8OA 2BJWA 3LTEA 1PR9A 3OWHA 6ADHA 2J59A 4HB0A 4IR9A 2D0OB 5E1BA 4EPRA 2PS0A 4W1PA 3E3NA 3ZI0A 4PYIA 4EO4A 3CVOA 4O33A 4PGGA 1QQ6A 2HRCA 1XZ8A 1RSZA 3OEHD 4W9RA 3TOVA 1I01A 3T06B 2FF5A 5BOSA 4JX9A 4M8SA 4YP3A 1GCGA 3O3NB 2FUG6 1BX0A 3AUAA 4LDNA 2DL0A 5LA6B 3PW7A 1V9LA 1X8XA 2KZZA 2UUBB 4UAWA 3AWIA 4DL6A 2YB4A 1L4HA 5L45A 1PZMA 4MFFA 2GKSA 2MDTA 1T6BY 4WCFB 1MT3A 2EIXA 1BVYF 3M9MB 16PKA 1VB5A 1XNGA 2GD2A 2HB6A 1H94A 1ODLA 2HPVA 3JV7A 4MQLA 5JPDA 4M7PA 1WHSB 1YE8A 3UG7A 1OI2A 3SP1A 1CFZA 5BQOA 2W98A 2DFNA 3E84A 4MXDA 1RPAA 4C08A 1U4OA 4FXOA 3IMKA 5KU1A 4D9JA 3OM8A 2Y67A 4EUEA 7ICPA 1L5WA 3BZKA 2ZBGA 1DRWA 1F0KA 1NNLA 1OAAA 3N59A 2WYWA 3ZOKA 4O2AF 2VOJA 5TV2A 4B6FA 1V6CA 3RADC 3QVJA 1CB0A 1KRWA 3JQ7A 1UC5B 1TZBA 2ZT5A 4I8XA 2WWHA 1Z2PX 3G2QA 3JQPA 4IV5A 3ELBA 1I7SB 1VMEA 4JJ7A 1NDUA 4Z4IA 5CP2A 1JIXA 4RWZA 1EWVA 2R60A 2FP4A 4NAUA 3ZGLA 4CE6A 4Q7MB 5AM4A 4BV8A 1BOFA 2EC5A 3HKEA 5BN3A 3KR0A 1Z5WA 2R3SA 1H2EA 1GPNA 2KSQA 2XSZA 2KZ3A 3CPJB 1CKEA 1ESCA 1RAFA 3Q41A 3O2JA 2XMBA 4FDMA 4WSOA 4AB1A 5BNZA 1CR2A 2RAUA 1XA0A 2NU6A 2WI8A 4PXSA 1YQGA 2EHJA 4YMTA 1G6KA 2GYYA 3GGCA 4JUFA 5DYGA 1CJBA 2W6JA 1ZM3A 3UJ9A 3UWPA 3FG9A 2C1XA 1MHPA 2J30A 1NQXA 1RD4A 5AM0A 2YHSA 3EB9A 3BGOS 4Y6LA 5CNMA 5JIBA 1LBSA 2ZPUA 2RONA 4DSJA 1A72A 1XC7A 3N2NA 3OIVA 4HF7A 2HQSA 2WYVA 1MO2A 4HYKA 1NNI1 3KOZA 4YRCA 1E3TA 5DTRA 1G59A 2QA5A 3AL3A 3A6PC 4M22A 5L1MA 5BURA 1BS2A 2IOYA 2YW2A 3OSUA 1UKVY 3K8YA 4WX2B 4YRDA 5EI5A 3THXB 2JG3A 2C78A 1JDZA 2W7TA 3R7WA 2BMJA 1J2MA 2QI9C 5KYVA 3ADOA 4R66A 5BSVA 2H1SA 1G8MA 3RUAA 5A0VA 3EZ6A 2GCOA 4P54A 5I3ZA 2ZYRA 5AI4A 3C8MA 4KYVA 1Q0RA 3QKUA 1P45A 4U5XA 2WZDA 4YQZA 5J2UF 1USIA 3SX2A 5J3JA 2ZIGA 3AONB 1H3EA 2YWRA 3W6PA 2IUYA 3O5AA 2JFVA 1O0SA 2YOFA 4K9SA 4KH1A 4DZRA 4UDOA 3PGLA 3KX2A 1T26A 5KFOA 4W82A 2C5GA 4Z9AA 4CEIB 4YJGA 5EL0A 2OC4A 3JQFA 2PSJA 1MAWA 2V9CA 1GV1A 1GPUA 1SGGA 1CUAA 1LSUA 1RXIA 5DBAA 5GONB 1W47A 4JIGA 5DGDA 3PR4A 2C2RA 1O9BA 1TIKA 2VHTA 4ELVA 1N5KA 3FPJA 4G0OA 4HN4B 2FR8A 2AQIA 3F78A 3K09A 4LCBA 2IUTA 4YMSA 5IVKA 3B36A 2P2CA 1ZQVA 1CRWG 2BMEA 4G5OA 3ZI7A 4TT3D 5JOQA 2X58A 5EJ8A 5SZJA 3EFOA 4R83A 4NCIA 2IRWA 4IQGA 2E37A 2XXJA 2Y1IA 2O05A 1NE2A 3TCXB 4C06A 5AVWA 1UR5A 3TQTA 1WMBA 4R0MA 1US8A 4UW9A 1GCOA 1NI4A 1H2YA 2EP5A 2FDXA 3KXPA 1IHDA 2QPAA 1UFVA 3ESBA 1R00A 4I0WB 3KV1A 4KB5A 4LZDA 3KE8A 2X6RA 3K1AB 1GNLA 1Q21A 3LRPA 4Y2GA 3WDKA 3M1LA 2IU6A 3P9QA 3WGIA 1IC6A 2H9AA 3VH1A 2V6FA 2F3SA 1XAIA 1Q1ZA 1B8VA 3C6XA 2LM4A 2HJWA 3HJAA 1Q7TA 4IIJB 3ZQUA 5CT8A 2WVAA 5IUNC 4X3PA 2VRNA 3KJEA 1F1JA 3LLUA 3BE6A 3KFLA 3RG8A 1I6LA 3BN3A 3MCWA 2BFAA 3PWKA 3RRYA 3EVTA 3EH2A 3SOZA 5IZCC 4RFSB 6AT1A 3OT5A 4K1LA 1KK1A 2E0IA 5ALTA 3NZEA 5CTJA 4D80A 1SBHA 3EZLA 5AWFC 3W9YA 1S97A 2I2CA 2R5NA 1LBEA 1CX9B 4F86A 1OROA 1NQOA 1U4BA 3L5OA 3QXHA 5F1KA 4CV0A 1U2PA 1K5OA 1FYEA 1RTTA 2ZRBA 3A37A 5ALXA 4IDCA 3W5UA 3O8NA 1EUCB 5AUNB 1MW9X 3GPDG 5FAKA 3BQTA 4PAWA 2GKGA 1EWYA 4QOHA 3FMFA 3VGPA 3N8KA 4AJHA 1YZUA 2HMYB 2VHXA 4ZQHA 4HB3A 1UBSB 4FCTA 3OD1A 3A6HA 3FNRA 1JB9A 1I7NA 4IRUB 1M2OA 4U2KA 2IYPA 2RHWA 3LW8A 2I7DA 1NYQA 3C97A 1HLGA 2DY0A 1Z08A 3R3WA 3M34A 2P2YA 2PVPA 2H3VA 1V16A 3MIIA 2WIJA 2EZ8A 3RPEA 4AX8A 4ICAA 4L8YA 5ILQA 2LYBA 2CWWA 4BMSA 4AJ1A 4CCWA 4P3YA 1XD9A 4IIEA 2VP5A 1HSZA 3RVRA 4D79A 1AQNA 3IQWA 2XGMA 2O0JA 4AS2A 2ZM6B 3NYWA 4OHPA 5TPZD 1OW5A 3PXCX 2JEJA 1YRQA 3GD7A 5NULA 3ERCA 2R2AA 1JEOA 3MINA 3VMFA 2I2BA 2O6HA 1O5IA 2SHKA 2JHFA 1MO4A 3E1KA 3F49S 4NE7A 2I9GA 4RQ5A 2WKSA 4NDNE 3GLGE 3EGXA 3W5VA 3CC8A 2CNBA 1CYEA 1JKJB 3RKRA 4OA5A 4D97A 1U5AA 4HDMA 5T4FA 2DPJA 3CNQS 3IHKA 2R8YA 3PF9A 5DOZA 5JH7A 1SOWA 5EIWA 1QF9A 2YOGA 1GTZA 3UJAA 3GXOA 5JASA 4FD3A 1V3TA 2A9VA 2QP9X 4BP1A 1E1KA 5JYBA 1PJSA 2FMSA 4FBGA 2FOLA 4KVAA 5ICFA 1YULA 4BNYA 2Q4BA 2IPXA 1E6LA 1RPNA 4MCHA 5BV2P 1GKYA 1GDHA 1ZCJA 4Q01A 4EKDA 1GRNA 3ZCXA 5JRDS 3MR5A 4F4ZA 2OGZA 2VRCD 3IOYA 5IYZA 1OWOA 4ZAFA 1RKVA 1W8DA 1C3EA 2O3TA 3FFXA 3F5QA 4NK4A 1K3TA 1F20A 3TXYA 4NNJA 2WAOA 3NNNA 1EZ1A 1E6EA 3IERA 2WAQF 1QYRA 1IBSA 2FR0A 3L77A 3SSMA 3VI4B 4YHHB 5EEHA 1Z29A 2OAEA 1CETA 4JH0A 1S2IA 1PS8A 1OIXA 4BAZA 6REQA 3WISA 3HWWA 2JIMA 2VJQA 5J0UA 1E0KA 4LSZA 5JQGA 1MJNA 1P60A 2GAJA 4OQNA 3S2UA 4XQCA 3UXNA 1CQIA 2XUJA 1P5FA 1BH2A 3SD7A 4ECSA 3E1GA 5CLLA 3V97A 1A77A 5EJGA 3HXQA 4YD1A 1U48A 3EXFB 3GIWA 2J3JA 2O2GA 3E8XA 2NO5A 3RRHA 3KALA 3NMUF 1TT7A 3WGKA 3MWLA 2EG9A 3KDAA 3AG5A 4TV9F 5AVVA 1AS0A 2GS9A 1SG9A 1YZTA 1Z6TA 1XNJA 2J5KA 3F3SA 2J08A 1Y33E 2RFLA 4WMLA 4K81B 1EK5A 2GX6A 4MYHA 4ZU3A 3ONEA 4W1QA 1X7ZA 1UPBA 5FI3A 3D2CA 4JP3A 3GLFA 3ABIA 2J3IA 1ZAYA 2OLKA 1A1SA 1C7EA 1M2WA 2PKXA 1E1MA 5FFNA 1PQ4A 4N47A 4UFPA 3VPDA 5AKYA 5M5BA 3MQ4A 4JV0A 4HQNA 2R6CA 1VJ5A 2Q5JA 3DE5X 4DC0A 4PBSA 4Q9AA 2UXDB 1TUIA 1G3IA 1F2TA 4IXTA 4C76A 2PD4A 4J0JA 2RGEA 4GNRA 2HPAA 2KVCA 2YVLA 4GKBA 1M1XB 1Y9AA 3I6BA 4LHSA 4C7OA 3N4MB 2ZYTX 3A7EA 1JAIA 3AVWA 1ODKA 3C6ZA 5AVRA 4Q4HA 1QIKA 5BOSB 3PNYA 2C84A 2UZAA 5CTAA 4E22A 3EGOA 2Q3BA 4DJJA 4C4YA 1USWA 4RF2A 7REQA 5KFZA 1IEQA 1JJAA 1ZWLA 2F67A 4GEGA 3M4XA 1AV7A 5E4TA 3AILA 3K15A 4PLFA 1G63A 2ZSFA 1A98A 3F1LA 4UNSA 2PUBA 2IXGA 2PI5A 2AN1A 5E1DA 1QHHA 2WA1A 3BWBA 3LGSA 3MR6A 3THRA 2PHZA 2RMKA 4DO9A 3P2YA 5G4KA 1WSBA 4NARA 1Z4NA 5CDFA 1NMXA 2Z3VA 1NQUA 1PEYA 1ZJYA 2CE2X 3GUVA 2P5TB 1JALA 2QAJA 4C6RA 4IYRA 5E6UA 4B87A 2PIAA 5J0TA 3DVAB 4IHQA 2Q3LA 4OQ4A 3I9MA 1QIJA 1R50A 3IP6A 1XXHE 3A31A 1RQGA 3HDTA 1FFUA 1MO6A 3QWAA 4B74A 1FVOA 2GOYA 3DBOB 3LQRA 4US2R 1K88A 2PRIA 1EUDA 2CHQA 5K1ZA 5L1LA 2JFFA 4GVPA 1NL3A 2LCQA 4NAHA 4OIFA 5KHAA 1MBZA 5JRZA 1E79D 1L6IA 2J4CA 3DPUA 3K05A 4BP3A 4D4KA 4KNWA 1OY1A 1U3TA 1P4HA 4H7PA 1L7QA 3QPAA 1KMNA 4UTRA 2G6BA 4DS3A 3G8BA 4L8GA 5J8YA 1T1EA 2NT4A 3OCYA 1ZGHA 3JX9A 2DQZA 3L8FA 1SCKA 1TM2A 1Q95A 3NRWA 2QYHA 2QENA 2QN9A 4QYIA 4UMVA 3TR5A 1P29A 4AS1A 4C0QC 1VZ3A 4ZEOA 1NJGA 1D2MA 2K2WA 2ZUUA 4A8HA 3SV4A 2H1OA 2FMTA 1ZD4A 1YZGA 3FNBA 2AHOB 3T54A 4DEYA 3BMQA 3G9TA 1SBNE 5KQSA 3HU1A 3HKDB 2CBZA 3HJFA 5CVUA 3F97A 3QFTA 3CM0A 3U7QA 1XMOB 4R16A 2ZRQA 3OICA 2ZIWB 5BWCA 1PE0A 4TV8B 2H1WA 2FWIA 5DU2A 1CB7A 2IYUA 3EEIA 3PEFA 4OQPA 3LOQA 4LJRA 3TADC 1E64A 1NJXA 1RZTA 2XZTA 4OVKA 4WOJA 1USKA 1Z8DA 3QTTA 3WRWA 2J3QA 1VLVA 4Q45A 3A9RA 3DNMA 4DC1A 4I8DA 3OY2A 3TG2A 1S0NA 1A9TA 1E5QA 4E88A 3RRBA 3HADA 5T4HA 3KKAA 2BPGA 4HH3C 4PC3A 1EAYA 4C78A 1XPUA 3ADDA 3BGVA 3FHCB 2HHSA 1T2VA 3VR4H 3QYFA 4MDFA 4WZBE 4FLEA 4ZICA 4ADSG 1DBIA 1LLDA 4PRZA 3W2IA 2VXCA 2G67A 3BSSA 3KM0A 4CETA 3NB0A 2H4HA 4QUGA 4RPGA 4ZC8A 3KNZA 1GVNB 5KQMA 2HMAA 1NF9A 4JC4A 3H11A 2UZ0A 1JH8A 1JDBB 3DZDA 1S7GA 2EWMA 2PX2A 3AT1A 3FYDA 4UAYA 2AG5A 2Q1SA 2R84A 4QDZA 1GGJA 1P9WA 3G59A 3BFXA 3OZSA 4Q1EA 5KI6A 4YPVA 3HXMA 1E2BA 4P22A 1BPBA 4K4GA 4EB6A 4BNDA 4EKYA 3TPCA 2I6XA 1Y3HA 1XZNA 2VPZA 4HEHA 4LYDA 1ZM2A 3VO2A 4E03A 3J7AC 2ZKLA 3N6VA 4NLKA 4MQEA 1XSEA 2FMFA 3JWEA 4WV3A 4UU1A 2ZCJA 1YR9A 4CV3A 1AKYA 1YXMA 3DCJA 3EARA 3MCAA 4B3JA 2WYOA 1WL8A 2ZJ6A 4XYBA 4D6XA 1DXOA 1RFGE 5D3MB 2QROA 3PKIA 4FI3C 4M0EA 5C46F 3LUAA 4RD0A 3JQAB 5TPWA 2I87A 1QAMA 3KHSA 3NVMB 3HYSA 3HXOA 3DQQA 4KBGA 4K9NA 1I9CA 1KH3A 5ICGA 4K2HA 5K8JB 3D0KA 2XYVA 2DFPA 2NZUG 2ZAGA 2IUFA 1ZOPA 2GD0A 1M7HA 4L4RA 4G07A 3T5DA 2H3ZA 1W9MA 3FPCA 4GHWA 3AESA 3L1HA 1NLMA 4TKUA 1YJQA 4NXMB 3CX8A 3UTCA 3PL5A 2OEPA 1PRYA 1MOPA 3O1JC 3ZU3A 3VV3A 3MJFA 1XX6A 3RVQA 3AETB 5T6BA 5LU8A 2BH2A 1SHKA 3EFBA 1AKNA 2OMEA 1W94A 3OEHA 3VC3A 4C4TA 2C07A 3HGMA 3IQFA 5H68A 3TN7A 4QFCA 3ROFA 1WV1A 3K0FB 5JATA 3WZLA 4R1MA 2GCOB 1PR2A 1T2UA 3LCMA 2W54A 4CLHA 3IIEA 4GI2A 4L3WA 2BGNA 1GO3F 1SWWA 2B3TA 2JF0A 2ODBA 2DGDA 4G36A 3TAXA 4I1SA 4BLWA 3GLFE 3MWFA 4CEHA 2JEZA 4A5OA 2WFLB 1OBHA 4NM2A 2HXGA 3C16C 3EPRA 1YFZA 4RK0A 3D43A 4FCCA 4YR7A 3TLCA 5KTSA 4IZ6A 1UPAA 1NUUA 4NL4H 2R5WA 4XIYA 3G1TA 2ZREA 5FWDA 4RABA 4KIGA 2WIGA 2C4WA 3CA8A 4BVKA 2RHCA 4AJIA 3RFCA 2R62A 1VQ1A 3DBLB 3SGLA 1CLUA 1FXSA 3L7NA 4TZ6A 4S0XA 1N61A 1Y37A 2IYRA 1XZBA 2EX1A 2YX1A 4J1SA 4O4IA 4RZUA 4XYEA 4BQIA 2B0JA 4P31A 3ZD6A 1MPTA 1GQFA 4ZO7A 1O0CA 1PL0A 3AJAA 3PC6A 4E4YA 1I7PA 2BHRA 3IIKA 3RRGA 1K8YB 4OGGA 3AR6A 1OZGA 1X40A 5KNLA 1TVCA 3TNLA 4GWLA 1U2GC 3M82A 2DQSA 3OUTA 3P2MA 1QRTA 2GAIA 5KX5B 2HWUA 3B6MA 1DKRA 1UJMA 2VHUA 4LSWA 2PA0A 2YUTA 1HYHA 3V4ZA 1F0PA 1FS6A 2EW1A 2FWNA 2V7QA 1YQTA 1CLEA 5AJWA 1EINA 5FR1A 3OUZA 4WW0A 2I55A 2XUQA 4H1HA 5J0YA 3BE8A 1UDXA 4JK3A 1DBVO 3RYIB 1NMZA 2VJKA 3HB0A 5FXMA 4IF4A 3IUQA 3EIXA 4RSGA 1LY1A 4NOJA 4UVIA 2GN4A 1SBIA 3PVSA 3OM0A 3C1TA 3WB2A 5FX2A 3U7GA 5A3JA 3UBTA 1JHRA 2JLZA 4DL4A 1SUBA 2DFKB 4OI2A 3SX0A 4MKZA 5AVXA 1NG9A 3MGVA 1GHTA 3CN9A 2Z98A 1TECE 4N0PA 3S0JA 3GFTA 2H16A 3PEEA 3KZCA 4N48A 1X1BA 4RDXA 4YACA 1QFZA 2DH6A 4JJGA 2WLSA 2M1XA 2QRNA 3CH7A 4MFAA 2GTPA 3QF4A 4MITA 1T1RA 2IYQA 3PB3A 4N4AA 1XGKA 3W2GA 2RHHA 5ABPA 2CV1A 2JMGA 2MR5A 3CRRA 3EGXB 3AB3A 3ILHA 3HB4X 2IEBA 2ZI3A 3BDIA 3SHTA 2H52A 4MKRA 2BCRA 2WUGA 2XQGA 1T2DA 5ALEA 13PKA 2GN2A 1F6WA 4UFNA 4ZAXA 1FLVA 4K46A 3DQZA 2PH1A 3AMZA 2CVHA 2FSVC 4R8KA 4EHKA 4L7QA 4HH0A 4WN3A 4RLHA 3U13A 1MV5A 2P9FA 3O26A 3U44A 1Y3CE 1SRQA 4LNHA 1N8KA 2X7HA 3LNCA 4PLVA 1FFDA 1U7XA 4CKBB 1SQ0A 4KIUA 4MI6A 4WK4B 2PPLA 1HDOA 4GBED 5G1PA 1PKEA 1XCGB 2BVNA 2JHGA 3AM9A 4WJ3B 3QBDA 5ICSA 1E6MA 5KVAA 1UOOA 5EUQB 3QFFA 3JPSA 3IDOA 3KVRA 4HNTA 4EWLA 2H5IA 4QDTA 5TQ2A 3OIFA 1NVGA 1XZAA 1ZOOA 1IZ0A 2PL9A 5IX8A 5KU7A 2DMRA 4KVZA 3KVNA 3PXAA 2BEJA 3MA0A 2Y3IA 1Z6XA 1LSJA 1VTKA 3MJHA 3KZNA 2VL7A 4RD4A 3D2NA 1UAYA 3V6HA 3KXLA 1U7PA 3WK4A 2K4IA 2C99A 4OJ6A 4U5QA 4C7MA 5KJFA 3CNNA 5LNK1 1MAAA 1SXJA 1Z0JA 2JK0A 5CCDA 3AFOA 3IAXA 3GFSA 4I2DA 2HDWA 3DUFB 1LPPA 4EJMA 3HFRA 1XD2A 4JY7A 1RYSA 2D0PB 3P9YA 5LQRA 3C5WP 1KLNA 1VSQA 4O59O 3DBVO 2MCFA 2A5GA 2DRIA 1CY1A 1OFUX 2Q3MA 4HK4A 2JAWA 4O2RA 3PUJA 2J1LA 2QTFA 1J1IA 1J9GA 4KPUA 4NESA 5FA6A 3Q1LA 4YP6A 5IC6A 1L8LA 3IG5A 4DCOA 3HN6A 3I2YX 4AP9A 1UBEA 1S8NA 2SNIE 3QU7A 1TJ5A 1Y1QA 2B5WA 1OXTA 4MR8A 2DHDA 3U09A 1JX4A 3EYZA 3RTDA 4PZCA 4U2FA 4QPCA 3ACBA 4UTNA 3MMXA 3O8BA 1FFAA 2NXEA 1QCZA 2HU2A 1BXKA 2Q0SA 1UEIA 2ZRLA 2PXCA 2X19A 3LBNA 4FT2A 4FYHA 2POQX 4GI3A 4U39A 3TRFA 3VPSA 3OO0A 3WLFA 2MA1A 3H2YA 3H9EO 2ASJA 2EAPA 1OIVA 2IW3A 3TI7A 4J9SA 1I24A 3NOVA 1J56A 3SXJA 1VI5A 1GNTA 4G5FA 5I5GA 3ZHZA 1GT91 1ZVMA 4ACBA 1C7FA 3VU1A 2NZVG 1P4GA 1PUZA 3RJTA 3DB1A 4PLYA 4CZ2A 2G09A 1QTQA 2HWXA 1WA5A 5C1BA 5CA7A 4LVOA 4FFVA 3R6LA 3C5FA 4RJKA 2R6AA 1GL7A 1QAQA 3D6MA 1TMKA 3PWTA 4GGOA 4XDZA 1J2TA 1Z8FA 2ZOSA 3CRMA 4QG3A 4BTVA 4K9OA 2VO1A 1DU4A 5HHHA 3NORA 1G8PA 3FPSA 2G9VA 3RE1A 3QKSA 2OK8A 2PJUA 4LXTA 3PD7A 3ZHOA 1DFGA 2Y6UA 3WDMA 2IVZA 4EZ6A 5DB7A 3NVDA 4FQ7A 4Q1CA 4QIHA 2VQSA 4ZCPA 5J2TF 5T8KA 3UK1A 3S7TA 3UQZA 4EA8A 4HBGA 2P4QA 3EF1A 1NLYA 3T7AA 3UAVA 5DWQA 2IZZA 1BPZA 2DQKA 2XNJA 3KUXA 3S28A 4M1ZA 1SELA 3WMXA 4BNGA 4EG0A 4BWMA 3K9WA 3GQVA 2VJCA 1SOUA 2J8ZA 1PZHA 3EDQA 4XFKA 4EP1A 4CLRA 4F3RA 3BBPA 4GOLD 4XPZA 2OH2A 4R2MA 4BBZA 4J8PA 4YTEA 1CP2A 1P33A 1UDWA 1X38A 4X7RA 4G24A 1F14A 1U9IC 4RU9A 1VCHA 5EHXA 2A9KA 1OBFO 2RHRA 1FZTA 3BPSA 3HR7A 1E2FA 1LH0A 2Z1NA 1VDZA 4IV8A 1QVWA 3RFVA 3NRJA 4IIDA 3OC6A 4YI3A 4PZYA 3S8YA 2ZI6A 1W5SA 4OGKA 4OHMA 2C2XA 3K4QA 4UMFA 2NZYA 4LPSA 4QRHA 5B1EA 4GYKA 4MW5A 1VBMA 1BE1A 2XDWA 2QVLA 4XI9A 4K6MA 5DWDA 1TK8A 2FPIB 5JVDB 1G21E 4MS4A 2QARB 3B9JA 1FBNA 5IUKC 1TQ2A 2Z0MA 3AY6A 4MRVA 2A9OA 2W6QA 3B48A 4NJ8A 5REQB 4YWJA 3CKYA 4YUYA 3LPLA 4OXNA 5L1JA 1DX6A 2W2KB 3TFOA 4RDHA 3NHJA 1W6UA 4EI9A 2JEOA 2PWYA 2GJKA 2ZIVB 3JD4A 3KYCA 2O2ZA 4H7KA 3H5NA 3RR2A 4XIFA 3EOZA 4KQIA 4ER7A 3SYZA 2CWDA 2H4ZA 4HR7A 2GO1A 4M98A 3QVMA 2XRMA 3CV3A 3G9QA 1GTG1 3T79A 2C2GA 4D9NA 4DG8A 3Q7QA 1LF5A 5BV1A 1O9HA 1QG6A 2O1EA 1AXRA 1EFKA 3OLVA 1M8FA 4LF8B 2V6MA 3DV0B 3WJ1A 4DR6B 3G8DA 1TNDA 2LMRA 3WGOA 1VLLA 2C3PA 2XMGA 3MAAC 2VJLA 3K72B 1QH8A 1A5ZA 2FN9A 3MERA 3T1NA 4G0ZA 3BRSA 3M81A 4JOSA 4OLHA 4L5YA 5JNSA 2QD4A 1H3FA 2R7MA 4JMPA 4N3AA 5HOQA 5DEOA 1XLUA 1VJTA 3PNBA 1T0PA 2CJWA 3OJLA 4FSHA 4U7HA 1LK0A 3PW4A 2BCGY 1NQVA 1CE8A 2P30A 2ZJFA 4TMTA 5JADA 1QKJA 2DLDA 3PE3A 5L1IA 4Y6RA 3H87A 4F5EA 1ONOA 4DSAA 3LT0A 1F8XA 1RI5A 4LF4B 5JXWA 3FPGA 5KCZA 5LZ4A 1V9SA 1UC4B 2ZBRA 4BFXA 2IYOA 3VTZA 2ZJ7A 3JYLA 3KQYA 2R8KA 4TV9B 2VF8A 1S3FA 1J0XO 4QU8A 5KX5A 1R0WA 3RU2A 2BSQA 1JJFA 1ZUD1 2DB3A 3CQ9A 5ALUA 3D59A 3W5IA 2QSZA 4Q4HB 2NM0A 4ND5A 3DLTA 2XR1A 2O7RA 1VCIA 4OD0A 2J0VA 4DSKA 1IOWA 4MCAA 4ISBA 4OU4A 4A6PA 4MDEA 5H80A 5B3LA 3HU2A 2PT7A 1TM3E 3OCXA 4G4GA 3IAAA 3TH5A 4UBIA 5AD1A 1IM4A 3K1TA 2BTQA 2VQEB 4TWBA 2FLPA 1IMJA 3PUXA 5TDHA 4OUDB 2OXOA 2AWNA 1PTJC 2H8GA 4JB3A 2J09A 3DZCA 4GGPA 4QTXA 3VJLA 1RQPA 3A05A 2F1KA 5DT2A 1L0BA 3DBLA 2PVCA 4QFDA 4L95C 3X1ZA 1HETA 2VTBB 2XBMA 4F72A 5J2EA 2B5VA 2V9ZA 1X0XA 1U5CA 1ZQZA 4IGAA 3QXXA 1A4XA 2HCTA 4AZTA 2Y1FA 1A9SA 3R7WB 1IWOA 1E1QA 2FZ4A 1UOPA 2ISCA 4IKEA 4LDAA 2Q5IA 1ODFA 3WR5A 5LQAA 3DA8A 4I2VA 1RYDA 5KFXA 5JWRA 1GTJ1 1EQ2A 1JR3E 2YINC 3H97A 2CFIA 3BD6A 4OYRA 3PC8A 3V7KA 1P6XA 2IZ0A 4QZDA 1Q6YA 2XW6A 1AVTA 2XWQA 1K2WA 3GGSA 2G5GX 3KDSE 3WQSB 4TVBA 4BIMA 3STWA 1C4WA 1CQIB 1CQZA 4HLCA 1I5RA 5L3QA 2DT8A 3FNEA 1M34A 5LCXA 2OGTA 2XYQA 1RKBA 4AIRA 5KOJA 3U7FB 3OJFA 2QAIA 3BRWA 2J9XB 2PGNA 1Y4ZA 1XHLA 3A25A 2PT5A 3J81A 2YCBA 2AVNA 2HYDA 3QE3A 2ZVJA 1B6RA 2WQZA 1PYGA 3RWBA 5GJWC 3ZYZA 4QEKA 4J9RA 1TAGA 2G9QA 3AUKA 4OAOA 3NC1C 4QOGA 1FPMA 1CEXA 1JG3A 3RB3A 1WULS 2DHCA 2PGJA 3DR3A 1IWBB 1HI9A 3KUKA 4IHKA 4OK6A 4HQFA 1S9HA 4G25A 4G63A 4PWYA 1V45E 3CN7A 3T61A 5HOEA 4D26A 4N76A 5JU6A 2Z5GA 3MXOA 2V9PA 3C85A 1XF9A 1HQCA 1UCFA 1NMYA 4UPDA 3DB2A 3KB6A 2Q0ZX 2WIDA 4ZT4A 1ULHA 2OFPA 2Q3CA 2H7CA 2WJ3A 3KEMA 3OFND 1GGKA 1PCXA 4FQ5A 3P2OA 5I7RA 1NBME 4LGCA 1UM9B 1U9LA 1RE0A 2NU7A 4KLNA 2CYCA 1AKQA 2GBFA 4AY4A 5IJ9A 4KRXA 4OQQA 4ZA2A 3MD0A 3N87A 3UN1A 3OJUA 2GVDC 5DG9A 2ZRCA 3EC2A 3I5MA 3S2GA 2WHXA 2X5KO 2ZRJA 2XCAA 1YL7A 2BFWA 2WFLA 1X7XA 5DRYA 3VX3A 4NCJA 1GKKA 1WMFA 1FYWA 1PV4A 4XYMA 2PX3A 1A4UA 1WF3A 3AXSA 3PQ4A 1NPDA 1EP1B 2FVXA 5AM2A 4C8KA 5A06A 3ZIAD 2BYTA 1DUSA 1E5DA 4S1TA 3E0XA 3TAHA 3CZPA 3QKTA 5GVSA 4WNAB 2AGVA 1LPMA 2WDZA 5COBA 5DXAA 5FWYA 3I9LA 2Q9AA 3KJGA 4PG8A 4IHJA 3AGQA 5FYQA 3TNYA 1AUXA 3ZCSA 1BPEA 2UVDA 4JKIA 1VPWA 2EGGA 1TAUA 5JEEA 1AY0A 1C50A 4RK5A 2FN8A 5AUOB 4KQJA 1G4AE 1BEEA 1SKBA 3TSWA 1DQYA 3TFRA 1MP0A 3RJ5A 2VXYA 2YXPX 3W8FA 1O6ZA 4OM7A 2O8CB 3R44A 1U47A 5LL6P 5TRTA 3WYDA 4F21A 4ZEMA 4DL9A 4CKWA 3UQ2A 3NUQA 1KNQA 1TPYA 4WKBA 4A73A 2XVYA 3L8YA 4GLLA 2YJTD 3LFUA 4WCFC 1TKDA 5F7XA 3DC2A 4RZ2A 3U62A 2FY8A 3WRXA 1KDHA 2YNMA 2ZBEA 5BSRA 1KJQA 3Q8KA 2GLUA 2P79A 1GITA 2LRHA 2RI0A 3TFQA 3DZIA 3W1VA 2OM2A 3GFVA 4GXTA 3W5DA 1D8YA 3MIZA 3G6VA 5DTMA 3N5CA 3Q8SB 2Q0XA 2Y68A 4MW6A 3TL3A 1LS6A 5ELMA 3UB3A 3W8EA 2VF5X 3T34A 4G97A 1SKQA 4AZVA 4EGCB 2WIBA 4L27A 2DWOA 2HF2A 1AS3A 1FFXB 1IDOA 1Y88A 1J99A 4P4NA 4TQAA 4Z1MD 4KQFA 2PNFA 2VJYA 2WU8A 4B4DA 4KIJA 3TLBA 4CIXA 3O8CA 3AHDA 5FHRA 4BO4A 3IV6A 1HYEA 4MUJA 5KNBD 3NOQA 2RHDA 1EU1A 4QXMA 3WL5A 1Q3HA 4DY4A 3H1FA 4TTQA 5DNWA 4KPYA 3SVZA 4PE5B 2ZUCA 2AE1A 2V1UA 1FW8A 5DDIP 2O8DA 1VHJA 3VMMA 3FUVA 3ZEAA 3ZS8A 2A3NA 3X2EA 4Z6CA 2UXCB 5BWLA 4RM2A 3BS5B 5AHWA 2ECFA 4GPEA 1XD2B 3A6GA 1Z5NA 1DBPA 3IQGX 4QJ4A 3LWLA 1QGAA 4GUDA 4Y18A 2ZSUA 4ZVVA 1N2XA 3RS5A 5JXGA 4K86A 4NJMB 4E2ZA 5LUAA 1EP9A 1ZZEA 3SXUB 3F2VA 2F3RA 4W5JA 1QO0A 1RXYA 2JANA 2DYKA 1FRVA 3G0DA 4NECA 3H5LA 3RVMA 2XCUA 2ODNA 3QOWA 2H29A 2W58A 4OP1A 3TZKA 5AM3A 2CJPA 1YR8A 1DBQA 2G9RA 4H18A 5G0VA 4NC9A 1OASA 1U7ZA 2AHRA 4KC0A 1JHVA 2JFXA 2RGGA 4D82A 1QIGA 3WLNA 3KELA 5CM8B 3NTQA 5HMLA 2B61A 2LCIA 5EKUA 3W5BA 3FIUA 5DW3A 4EF5A 2CKDA 2XY4A 4C1NA 4NV3A 5DYYA 4BDTA 4TXHA 1TC2A 5CGQB 3ACCA 1SB9A 1E94E 1GPAA 4OXXA 3L4KA 2H5LA 1B23P 3B3FA 3STTA 3DBHA 3L1UA 4LJ5A 3TGLA 1X6IA 2FOIA 3WNDA 4R3WA 2C28A 2QXTA 4AZWA 2BHSA 1JHZA 3NETA 5JSQA 1PJZA 3HEAA 3L9WA 1Y81A 4XJTA 3OA2A 2O8BA 1C3VA 1NJ6A 1R7RA 1ZI6A 1KDZA 4CM6A 5BYAA 2GHTA 2JFWA 1X87A 4R65A 4M9GA 2ID4A 1TAMA 1E3WA 1P7WA 3B6JA 4TQRA 3QM1A 4JAVC 4ZOCA 5GQSA 1BPDA 1L8XA 2Q6VA 2O07A 5F9LA 2AXPA 2B94A 1JX6A 2G5PA 2FE9A 1L1QA 2ZVQX 2X77A 3IJRA 1BZYA 4PNZA 2IV2X 3BWXA 4RVCA 4XE5A 5LJLA 3VSAA 5U9CA 1JJVA 2YBEA 3NVAA 3BQ0A 3NBKA 3B2NA 2AQHA 5KMGB 2C22A 1LI4A 3SQNA 2Q0HA 4Z0PA 4Z4CA 5BUCA 4N8SA 5AK5A 4AUMA 1F3OA 4FJ1A 4DPKA 1UA0A 3FPEA 4GX0A 4HMOA 3RUCA 5CEEA 1CW2B 4CQLA 4MV1A 2IYEA 2G06A 2WRZA 2EZXA 3ROGA 1DRVA 1NIJA 2DKFA 2PSEA 1KI1A 1ESDA 1AM4D 4O3NA 2FFHA 3ETCA 3H13A 4PPYA 3NC0C 4U2GA 1NXTA 4XQGA 3I2IA 3EPGA 1R9MA 1L3SA 3SI7A 4R8UB 2DKZA 3OF2A 2AG0A 4CGYA 1TFUA 3RIGA 4EPYA 5KVCA 2BQ3A 1TF5A 1XAGA 2IHYA 5CBPB 5E0OA 3OT1B 4IIGA 5A9TA 3VTAA 4NZPA 2GI4A 2NU6B 2W4MA 5TQ0A 5BQFA 2CPRA 2V45A 1THMA 4R8UA 3GGGA 3WGHA 1TU0A 1P2VA 4PZOA 1F6BA 1TYDE 2A1UA 3EDRA 1FUIA 8ICXA 1Z0KA 2WTMA 2FMIA 4TYPA 1JVSA 4ENPA 1GPMA 4I3HA 3VR0A 2Y6VA 5LOVA 3GUCA 3WC4A 2FQYA 4F5QA 3JPPA 1TCUA 2X1HA 5AVSA 5HF8A 5EZYF 3CW2A 4BYGA 4IZOA 5HKOA 5IM4F 1ZNQO 4FOPA 3PO5A 2RHMA 2QW8A 3KOMA 3CKMA 3W9BA 4GH5A 1K4YA 1T2CA 2GCIA 2C2ZA 3M6AA 1ZH2A 4KPFC 4WUTA 4BVLA 2VLIA 1N36B 3LPDA 3JPOA 2AE2A 4L4XA 2F9MA 1KI6A 1U9CA 4JEHA 2GEDA 4LFAB 4IM7A 2O3UA 2V5VA 1ZQWA 1L1EA 1U0FA 2NUTB 3K2IA 1ZGCA 3KEGA 4QVIA 3LTNC 4X60A 5EERA 4B1FA 4JI8B 2CXXA 3TLYA 3ETGA 1YA8A 1ZM4A 1IZYA 5EWGA 1U3UA 4ENQA 4DDVA 2CW5A 1H4TA 3HKCB 4M7WA 5FOSA 3K9QO 5THXA 3K70C 1O6BA 4KE9A 4IRXA 3AOGA 4E5YA 4NS4A 1N63A 1JRPA 1DJOA 4JU9A 3GAFA 3F7MA 5EIAA 3WAKA 2PQMA 1I30A 1WQ4A 1FMJA 4ZMBA 3KQQA 1EESA 2ZI7A 1BAPA 2NXJA 4TVOA 4QWAA 4KLUA 3BMNB 3AERA 2GZMA 1XMVA 3FRJA 2YIVX 4NMLA 3ITEA 4RQ6A 1RRGA 4QZ9A 3JPTA 2QUIA 3KUDA 4QU5A 1XV5A 4RVHA 1BU8A 4YJFB 3SEAA 5EJ2A 4D8YA 1IY9A 1TCBA 2GFIA 3VR2A 4F8RA 2R18A 2OB1A 2ZSIA 5IT9A 2YWHA 2VDUE 3SQOA 1R9NA 1DXSA 4HKTA 1T9BA 1F2TB 1SG6A 4KH0A 3WE7A 1OZHA 2H08A 5C2JB 4PZ9A 2GFHA 3AK4A 4DNXA 3C1YA 3ZU4A 1DELA 2IEDA 4MAFA 1QDLB 3A9SA 1L4FA 5BT9A 1MHTA 3E2PA 5AVOA 4RT3A 1BN7A 1PV2A 3PV8A 4JCOA 5COQA 2O7NA 2PLFA 2NGRA 3MWDA 1QAOA 3S55A 1CJUC 4H3SA 5TLSA 4V1CB 4Z8YA 3CG0A 1FDRA 1I4DD 4B3GA 4RWEA 5JD5A 2W9AA 1IBMB 2ZB7A 1D6MA 3BZBA 3IKVA 3N05A 1RWNA 5BSHA 1QMGA 3FXAA 3KQKA 2VSOA 5JALA 4B46A 1BXGB 2BM0A 4JEUA 1GAQA 4PHHA 1PT9A 2Q46A 3IL2A 3G13A 1KKUA 1HYBA 1N3BA 3PFGA 1KU6A 4CKEB 1M2NA 4M9HA 4B3SB 4LNUA 4O25A 4A0SA 2OZLA 1J2RA 4YASA 3WGQA 1DAIA 4B48A 1FMTA 1E2HA 4IIHA 3WLSA 3ALRA 4BO3A 4C7BA 3LZDA 1SXPA 3V5NA 1CNFA 5I8WA 3FVVA 3R9IA 1D7AA 1JJBA 1M7GA 2VRWA 4Z7JA 5AM1A 1QP4A 1Q5PA 3H2JA 3JD2A 1RLMA 3G6KA 4Z7NB 4HY3A 3UWOA 3A6LA 4DLVA 3GGPA 2QRGA 3AJDA 3NT2A 1XR3A 1AT1A 1H0RA 2IXDA 4UATA 4LYYA 4QSHA 4B2LA 3AVVA 2GNOA 3O9MA 4HPJB 3I05A 2ECOA 4EKIA 3VR1A 2VXOA 3CB4A 4NMWA 4YMMA 4PNPA 3M33A 2OKCA 3AF1A 4RENA 4E5SA 4KQ2A 3GB9A 1Y3DE 3IESA 1SV0C 3FZYA 1E2MA 1EM8B 2IDKA 2E1PA 1NOJA 3H40A 1DMSA 3ZGOA 2EDCA 2QU8A 5DPMA 2EJBA 5CX1A 3ECCA 3IBTA 1O03A 2SECE 4FGLA 1FX1A 4XDYA 3V32A 3ZZTA 3VVCA 1OQAA 2QTRA 1XQ6A 4DJDC 3R0IA 4PX5A 1Z5ZA 5BPFA 3HJEA 1AHIA 1BFDA 2ARKA 2C00A 3JALB 3AU8A 3U31A 3U4DA 3JQFC 4B3IA 1DZ3A 3V00A 1LD3A 2V9WA 1A9YA 3AFNA 3I5XA 4QGGA 1NVWQ 1JV2B 3KU1A 4FZVA 1HNWB 3MWEA 3L6CA 4NI5A 1TXGA 2IE0A 1Z7BA 2OCGA 1MORA 2P2SA 4EIWA 1P31A 2PMZF 3NKVA 1RABA 1UFKA 3O84A 4W7HA 4F6RB 2QAGB 4Y2JA 3N0WA 4JQSA 1OWLA 2Q6OA 2W6JD 1N2EA 1C9EA 4ROSA 4EKGA 2J0EA 6NULA 3LYAA 3AIKA 3C5GA 3C87A 4QUIA 2X4IA 4FFSA 5A9RA 3AYXB 1U9YA 1C29B 2AN9A 5CVJA 1YQDA 3O8OA 4ER6A 4BX2A 5JI2E 2V55B 1GD1O 4U2CA 2K7FA 3CEPB 4I50F 2QG4A 2VAVA 4OB8A 2OTCA 3I4LA 4HS9A 1KY2A 3SENA 4UHEA 3EVDA 1V3VA 3O6VA 2AJCA 1DIHA 1N3IA 3B2QA 4F1WA 1JFTA 3W4IA 2J6SA 1DRGA 4DLLA 3CUTA 2ID8A 3KJZA 3R6GA 1QZTA 4B9AA 1FSFA 1DXHA 5FA5A 3RAXA 2CE7A 4YAGA 1H4VB 4PICA 3UXMA 4BVHA 5H3CA 1X9IA 4QSMA 1QVVA 1ZWKA 3WA6A 4R7GA 4J4TA 3CBGA 1E6WA 5B7NA 4UM5A 5EMMA 4HUJA 4KMUA 1NR7A 2JFHA 3DDSA 5F5LA 3TJMA 4CKZA 1WTAA 2QIOA 4P2GA 3G2OA 1T9AA 2CMDA 3ND5A 4LRQA 4RPIA 4G86A 5H16A 2R8EA 5IMBA 4YXWD 2ECKA 3DEKA 1GGFA 1KH2A 1M8GA 3PHLA 3FPBA 4CLXA 1Y0BA 5DX8A 1HR0B 5FBLB 4BFVA 1NSTA 1YZHA 1T1IA 4EDFA 4TV8F 4EFMA 4NR0A 1KORA 1W75A 4FFOA 1A7KA 2TECE 1SUWA 1ORRA 2VJAA 1SQ6A 3KOXA 2FPLA 3OX2A 3VU3A 3ZLTA 3JAMA 4BQQA 4IGFA 1X6JA 1SG0A 2NPFA 1Z4OA 2H2HA 2XMPA 2Z9CA 4FS3A 1R0LA 2G7MC 5IC5A 2H1CA 4LYGA 4WJKB 5E7MA 3RSLA 1ABBA 1WB9A 1N33B 2O5VA 4ECUA 1L3BA 1ZI8A 4U3JB 3EGDB 1EFTA 1G66A 1OYOA 2OORA 3JQ9A 4RV9A 1EUYA 1Z4QA 1NQAO 2J0UB 1EFCA 4FHDA 1VPVA 1YZLA 5DB4A 5FLKA 4B6GA 4QW8A 4MGHA 4RZXA 5AXBA 3FOAA 4KAJA 4ZFNA 2O8VA 2O0LA 3DDOA 3PGJA 1G41A 2QD3A 1P7VA 3K6JA 4MARA 5BQXA 1DAMA 5JRJA 4F8JA 4YC7A 1YGYA 3D4PA 4FFNA 4EHNA 3H2IA 3R8FA 5DX0A 4WDRA 5FBWB 2Q1WA 3A06A 1MC8A 3LHSA 4IWNA 1I5EA 4UUQA 2G9ZA 2QE6A 4BNZA 3ZE7A 3GFKB 7ICUA 1GG9A 4LJ7A 1RC8A 2FPSA 2GBLC 2QKQA 3OZTA 1UBRS 4ZJZA 1NYTA 5KTYA 2WHQA 4K6GA 5AIBA 1D07A 1GAJA 3ETLA 3H04A 2C2WA 3MTJA 4WADA 4RQMA 2O06A 1ESNA 3K2EA 4DLNA 1XA4A 2WYUA 3S68A 5KEIA 4LJ6A 1AKUA 2VA8A 3HB1A 4UM9B 4Y6GB 1LVGA 3AQFA 3ZVRA 4PGYA 3SR6A 4KNVA 1EFRD 1C80A 5LYJA 1EGQA 1P4AA 4BGVA 2NQTA 2Q50A 3FLAA 3OAAD 4Z5XA 4FOSA 4B3DA 3F4KA 2ZETA 3WLPA 2E85A 3BWYA 3UPQA 4QRIA 3TQ1A 3AV3A 1KI6B 3HWTA 2NRWA 4HDMB 1U0TA 3QMWA 4C3UA 2GH1A 1SXEA 2EX4A 2VAMA 3FSGD 3LY9A 3NGXA 4MVJD 4EY8A 2SCUA 3BB3A 5DV9A 1TPZA 2Y93A 1FTGA 4YT2A 3LUHA 3TZHA 3GRYA 1WPQA 2KIVA 4J6FA 2AG1A 4C8MA 1WW2A 4X20B 5IMSA 4IRMA 5FO0A 3SBEA 4BRSA 1OU0A 4DBLC 1KK0A 1E9EA 4I46A 4A8JA 1J70A 2AZXA 1J5EB 4C43A 4CF3A 1ZP6A 2QV0A 2ETXA 5HNKA 4ZDWA 2RAFA 4AF8A 1WXXA 4NOMA 1DAHA 5FNVA 4DEXA 3D2BA 5C5DA 1M5RA 2FSVA 2PWPA 3NEJA 4XASA 3WOHA 3MPUA 4HAVA 1P3JA 4KN6A 4EHBA 3RFTA 4WOPA 5DBCA 4MF2A 4JXXA 3WKDA 2WM3A 3PQ6A 2UZ4A 4OB6A 1CS0A 4Y9UA 4DM4A 2B1QA 2G4VA 4LWOA 1A9PA 2LNDA 4I9UA 3HILA 1E5XA 3OEED 2V03A 1SVMA 4LGMA 1NSYA 1T8SA 1Y63A 2P2LA 1RACA 1DV1A 2P1RA 4XOUA 4MV5A 3LECA 2E5SA 2EJCA 3QVOA 4OJKA 2HUPA 1Z68A 3DAOA 3OCWA 1NW6A 4FDTA 4MB2A 3EZNA 5HIMA 5TARA 3LPCA 3MJ4A 4OYHA 3FUXA 5G0SA 5IKPA 2DGZA 3OEWA 4I2HA 4LRSB 1DQPA 3HWSA 1DAOA 4C4XA 3EMBA 3MUNA 4LWZA 3QPWA 2ROQA 4HUTA 4I36A 2WTFA 3MMSA 3LCUA 4K28A 5EAIA 2XWJI 3COVA 5EJIA 2C82A 1QHFA 3MF4A 4KP7A 4A2QA 4G0VA 4WD3A 1X1EA 3L3BA 4RFSA 2PZ8A 3A6KA 3BHIA 5AOAA 4B43A 4AUNA 4BTEA 4HT3B 5FEUA 2YJ5A 3WGLA 5TEVA 1R6UA 3H4BA 3K75D 1RYNA 4NCBA 4FHCA 5IAOA 1Y6GA 1X1CA 1TZKA 1E6KA 3OTOB 2JFNA 3HT3A 4X8MA 1FLDA 1N7IA 4MGIR 1T8RA 3C8HA 3TS1A 5GWXA 4FI3F 4YMIA 4Z2YA 2NZ8A 2PUWA 2BM8A 3HA5A 4HAUA 3UJ8A 2CNWA 2W6NA 3EVEA 1H42A 2IHBA 4PGXA 3RUEA 1MAVA 1LWNA 2OP1A 2OG2A 1VHWA 3SU8A 4C89A 1F1BA 1P2UA 3TANA 1TKRA 4M0MA 4CR8A 4HRYA 5D49A 1JDPA 4QOIA 2IQ5A 3ZHTA 4ENRA 2MWMA 1XAHA 1APBA 2DULA 2E4XA 2VIIA 3B9QA 3MRVA 4JYMA 5DHPA 2GJ4A 4FSDA 3DOIA 3WNVA 5M04A 1ENZA 2WAXA 3LKDA 5HJ5A 1QFYA 4F3YA 3VYSB 1G5QA 3D6UA 1I7DA 4O2AA 4OXQA 3AHFA 1XTRA 2VK8A 4PGAA 5F35A 3ANLA 4JUBA 5KT3A 4A8JC 3HV2A 2VTBA 2B35A 1IN4A 3UA3A 1SFRA 4B7CA 1JROA 4RTMA 5JJ5A 2DBYA 1PLLA 4MUKA 3MTBA 4MZXA 2JJ1A 2LTAA 1KTVA 1ISJA 1SKWA 2GF9A 2I65A 3EFEA 3R20A 5LQNA 1P5HA 4MW7A 3Q3EA 3H11B 1FP2A 2M2IA 3HY6A 1G5PA 5K2OA 2PA3A 3H7AA 2VP2A 3H17A 3CYMA 3TLEA 3TRIA 3WMEA 1H1LA 4E30A 4RTOA 2K2QB 1ZH6A 3OX1A 4BMDA 3FWNA 4LE0A 1BHSA 1Z4MA 2IDZA 3HXTA 4A0FA 3S5JA 1YI1A 3R09A 1E9AA 1CY2A 2AMLA 3TWOA 1ZJJA 2VQ6A 3SR4A 3NDRA 1AKWA 1LBQA 4G1CA 5DBBA 3A1NA 1GQQA 5I9SA 5AUPB 1HDYA 1VCOA 4DCGA 1A9ZA 1E9RA 1T9CA 2FMPA 2G36A 2VHZA 3FSEA 4L5CA 1XCBA 2R5FA 3DTVA 2C2MA 1OYWA 4UNPA 5B4TA 1T8UA 3ZJYA 2QN6A 4DB4A 2F9FA 1QTIA 3S4YA 1ORVA 4TYNA 2FQWA 3LT2A 5AIAA 2AOTA 4EZ9A 4RQAA 4R3NA 1QU2A 3NJRA 2QVCA 4X6LA 4O02B 3VNSA 3UK6A 1XK7A 3RARA 1BMTA 2EXXA 3TTYA 521PA 3KLBA 2GHRA 4ZJPA 5JS8A 1NI5A 1RVDA 3DTNA 3HKDA 3FBWA 2IK8A 1OOEA 3SZ2A 5FLEX 5L4SA 4PCLA 4DSNA 3HACA 5KQPA 2QR2A 3PQCA 4N7MA 1O95C 1U2ZA 2NQ8A 4EB8A 2YWBA 5JZVA 1H93A 3I3OA 3U4QB 3M6IA 1NZPA 1HSOA 1A69A 1NT2A 2OY0A 2ZR7A 5IM4A 4BS9A 4AJJA 4RNMA 1DTSA 1GZUA 2D2EA 4FMBB 4GXIA 4HVAA 3M83A 1XK6A 2O0HA 4OSOA 4TWJA 5F78A 3UJCA 2RJ3A 3THWA 3FRHA 2RRDA 3RO7A 2C42A 4LV6A 2A0XA 2JHDA 3QLVA 3EPHA 5HF5A 2FN7A 5MFZA 1NHGA 3KFUF 1UBHS 4RHFA 5ADWA 2OZVA 4MEXA 3KUUA 3PVXA 1ZGAA 2XH8A 4FT4A