2JGAA

Crystal structure of human cytosolic 5'-nucleotidase iii in complex with phosphate and magnesium
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
b'NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRRKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal Structure of Human Cytosolic 5'-Nucleotidase II: Insights Into Allosteric Regulation and Substrate Recognition.
pubmed doi rcsb
total genus 98
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2jgaA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jgaA01
1RLTA 5AVYA 2G09A 3UMCA 5AW4A 4KX3A 1ZRNA 1SU4A 1Z4QA 2DQSA 1WR8A 2G07A 1Z88A 4DCCA 2HCFA 4CF5A 4HGPA 2NO4A 3U26A 3WK7A 4O8CA 1JUDA 3QU9A 3B8EA 5ALLA 3AR4A 4UMEA 3KBBA 5AVUA 3PGLA 4UASA 2C8LA 4AS3A 2OA0A 5AW6A 2WHEA 1RMQA 3DDHA 3A1EA 2Q4TA 2C9MA 5IS2A 4HGQA 2RBKA 4EX7A 3EF0A 4KNWA 5AI0A 4QQFA 5AVSA 3BWVA 2G1AA 5AW9A 1U7PA 1XPJA 3L7YA 2OBBA 3P96A 4Y3UA 1NRWA 2HF7A 1QQ5A 5AVVA 3WK5A 2HSZA 3AR3A 1RQNA 3MN1A 2JAOA 2I7DA 2OYCA 2HDOA 2RAVA 2I33A 4J03A 2HX1A 3NIWA 4J2TA 3ESRA 2FEAA 3W5AA 2GFHA 3A1CA 1U02A 1X42A 5AIAA 3KZXA 4BX2A 3U7HB 5ALFA 2B82A 2FPRA 4BX3A 4OHFA 4Y2XA 1T5SA 4KN8A 4KYTA 4YH1A 1L7PA 2O2XA 1RLMA 4GXTA 2AMYA 2YY6A 4IFTA 3PDWA 5AW1A 3AR5A 5T41A 3L8HA 4NAVA 2CFRA 4BNDA 3WGUA 3UMBA 5ALRA 3ZX4A 1VFPA 2WFAA 5ALWA 5AVRA 4YIKA 4BKMA 1WZCA 3QX7A 2GMWA 4ZEXA 4CNQA 5ALVA 4AS2A 4XE5A 1N9KA 5AK3A 1TA0A 1XVIA 1SWWA 5ALDA 2IYEA 5ALIA 4L6AA 5ALMA 1IWOA 1Z4OA 1KYTA 5AVXA 1TJ3A 2ODAA 3QUBA 4UMFA 2AGVA 2I54A 3SD7A 5E0OA 5ALUA 2BDEA 5AM2A 3M9LA 1ZD2P 3D6JA 5ALQA 3QUCA 3N07A 2FDRA 2D2VA 3I6BA 3ZWDA 4C4RA 4Y2TA 4GIBA 1N8NA 4E88A 2YN4A 3SKXA 2YFYA 3UMGA 3R9KA 3OCZA 2EAUA 5AW5A 1O03A 1Z4LA 5AK5A 2HOQA 4UMDA 3A3YA 2P9JA 2P27A 3I28A 3WK8A 2B0CA 2GHQA 1J97A 1TJ4A 2CFSA 3L5KA 3U19A 2YMQA 5AKHA 4EENA 3ZX5A 4BX0A 1Z4PX 1TE2A 5AI9A 4NFLA 2OM6A 5AI5A 2HEGA 1QQ6A 1T9ZA 2B1RA 1EK1A 2JARA 3FGOA 5AVQA 1Q92A 4BEVA 1Z4JA 3NUQA 2YJ5A 2GO7A 3ET5A 1RLOA 3FPBA 3RFUA 3FPSA 2G06A 1PW5A 2I55A 3WK6A 1RMTA 2JGAA 4L57A 1RKVA 1RMYA 2FPWA 4UW9A 5AVWA 2Q4RA 3MPOA 3SF0A 3QU7A 4UMVA 2RARA 4ZEWA 3E81A 3OCYA 3W5CA 2ZXEA 4G63A 4KNVA 1RC8A 3NALA 4Y2UA 1RPZA 4OFZA 2AH5A 2C4NA 3L8FA 1VJ5A 2FPUA 1CR6A 2ZG6A 3J7TA 3M1YA 3OTQA 3R09A 5ALOA 1MH9A 1ZD3A 1XP5A 2PQ0A 3EWIA 3NAMA 2JAWA 3SHQA 1U2SA 3R4CA 3IB6A 3E58A 2ZBGA 5AW0A 4HGNA 3ZTWA 3WKDA 4G9BA 3ZU6A 4FYPA 3WKEA 5AW7A 1TJ5A 2WF7A 1L7MA 5ALTA 4YCMA 5AIBA 5ALYA 1AQ6A 1YMQA 1YDFA 2B30A 4XOUA 4YIHA 4Y2VA 5AW8A 2YJ6A 1RQLA 2FI1A 1RRCA 3SLRA 3MC1A 4CF4A 3QU4A 3N28A 4OD0A 3QXGA 4C4TA 3K1ZA 1T5TA 3OCUA 2R8EA 2FPXA 3ET4A 2ZBEA 1S8OA 4BEWA 3U7GA 4PNHA 1L7OA 1YJ5A 4Y2JA 3FVVA 4UM5A 3TLMA 1ZOLA 3OPXA 2ZBFA 3QLEA 2FPSA 5ALZA 2WF5A 3PCTA 5AKEA 5AKXA 1Z4NA 4AP9A 3BA6A 3U7EB 3W5DA 3A1DA 5ALHA 4BNDB 4NABA 5AKGA 5AM1A 5A3RA 3ZVNA 5ALNA 3AR8A 4B6JA 4JB3A 4FE3A 2HO4A 1Z5UA 2W4MA 4MWOA 5ALPA 3QU5A 2G80A 2QLTA 1LVHA 3E8MA 5ALJA 5AVTA 5AKZA 1K1EA 1L8OA 3SMVA 5AESA 2EARA 2CN1A 2WF6A 2IOFK 4KX5A 2I6XA 3KDPA 3IJ5A 2W43A 1WVIA 3QUTA 1YV9A 3KOOA 1Q91A 3QU2A 1NNLA 3ZUPA 1ZRMA 5AICA 3ZWKA 1VJRA 3L8EA 2B1QA 3AR2A 1F5SA 2HHLA 1L8LA 2RB5A 2YJ4A 2IA5A 5AKLA 4HYTA 4UU0A 1RKUA 1J8DA 3NRJA 3NASA 3GYGA 3EPRA 3SKYA 2WF8A 2CFTA 2MU1A 3DNPA 2IOFA 3N8GA 2AUTA 1YNSA 4CE6A 1LTQA 2R8YA 2PR7A 5JJBA 3AR9A 3RF6A 3L0YA 3MMZA 2HI0A 4NWIA 2C8KA 1WPGA 4UARA 3KC2A 5ALXA 4MUMA 3UM9A 2JAUA 4DFDA 5FP0A 1Z4KA 3HLTA 2YBDA 2P69A 2YMPA 4C4SA 5AW2A 2Q5EA 1Z4IA 5AM3A 2X4DA 1QQ7A 3L8GA 3WGVA 4OCZA 2VKQA 2FUCA 3S6JA 4QJBA 3AR7A 3DAOA 2B8JA 4F72A 1O08A 4UAVA 2C88A 4L6CA 3E84A 2G0AA 3CZ4A 4UAUA 2BY4A 2ZOSA 2R8ZA 1QH9A 1L7NA 1QYIA 2WM8A 3OCWA 3QUQA 4FFDA 3ED5A 4Y2RA 4EX6A 3WK4A 5ALGA 4Y2SA 5AKYA 4BYGA 3NANA 2PKEA 2NYVA 5AKJA 1S2OA 4UU1A 2IOHA 1RDFA 1RKQA 3ZVMA 3F9RA 3ZTYA 4ZEVA 5AKKA 5A3SA 1CQZA 4EZEA 3W5BA 2NO5A 4Y2YA 2BDUA 1ZS9A 1ZD5A 2QYHA 3B9RA 5AK6A 5ALKA 3ZI4A 3FZQA 2R8XA 3L0CA 4CF3A 5AI6A 4DW8A 3VAYA 5IT0A 3QYPA 3IRUA 1SWVA 3AR6A 4HGRA 4BBJA 5AI8A 3L0BA 3OCVA 4Y2PA 4JDPA 5AM4A 3WKCA 4F71A 1ZD4A 4XPZA 3QNMA 3L1VA 4I9FA 4Y2QA 3B9BA 3ZW7A 3N1UA 2I34A 2YJ3A 2YMLA 4EELA 5AI4A 4YGYA 5AVZA 5AM0A 4EEKA 3N5KA 1U7OA 2O9JA 4HGOA 2ZBDA 1U2TA 3WKAA 5AM5A 2GHTA 1YS9A 4YCLA 5ALEA 2WF9A 1Y8AA 5AKIA 1NF2A 4UM7A 5IT4A 3ZVLA 2W11A 4RESA 4YCNA 2MSNA 5AHXA 1Z5GA 2HF2A 3EF1A 3QGMA 5A3QA 3OCXA 3DV9A 3U13A 4UATA 5AK4A 3I76A 4NV0A 4DWOA 1ZJJA 4I9GA 3WK9A 1EK2A 4XQ0A 4RETA 2B8EA 3ONNA 3U7FB 4IG4A 3FM9A 3KD3A 1L6RA 4H1WA 3WKBA 2EATA 5AW3A 5ALSA 3CNHA 2G08A 2YMMA 2FUEA 3HYCA 4HAIA 1FEZA 3L1UA 3ESQA 1Z4MA 3I1YA 3PGVA 2P11A
chains in the Genus database with same CATH superfamily
1EHCA 1ZOPA 2A0WA 1IBRA 2R4TA 1W44A 3DJYA 1B42A 4C0WA 4F56A 4RAOA 1LV7A 4XWYA 4OG2A 1SPBS 2Y2UA 4WY2A 5JYDA 2C3UA 3DL4A 3R0QA 1L3CA 1G4UR 5BPCA 5DV9A 1JHRA 1S0OA 4ARZA 3CU5A 4GL4A 1P9NA 4IDPA 4Z2AA 3E9QA 3HN6A 1MDBA 1YJXA 4J8PA 2OXOA 1JUDA 5JO0A 2NRXA 3RANA 3QU9A 2RHJA 3KR2A 3LIPA 1YB5A 3IUMA 3GLIE 1GPAA 1ZLYA 2R85A 3R0XA 4KC0A 3EJWA 3NYIA 1ZITA 1IN4A 5C7LO 4OHCA 4L51A 3C7CB 1JYEA 1ULUA 1U9CA 3DNFA 1C0EA 3IKVA 3CYMA 4PZEA 4EPTA 3P27A 5IM4F 5SY6A 1XNQB 1H2YA 1AUQA 2NAFA 3JQBA 4B3TB 1TVCA 2QZZA 2AFHA 5LLTA 3PX6A 2AGPA 5AJWA 1R15A 4QXRA 1DI0A 1QFMA 3BEOA 3LA8A 3QTTA 4WBXC 2J9ZB 4QYXA 5AWFC 1QGOA 4FSHA 1KK0A 1HQKA 3QBVA 2Q3CA 3CQ9A 1SC4A 4HNAB 5TQ2B 1BHQ1 3IR5A 4EX7A 3EF0A 1KY3A 3T3NA 2FUNB 2HYIC 1KMHA 4IJ6A 3VDRA 5LR6A 4H6VA 4KREA 2J31A 3MR6A 1GNQA 2V65A 4IIJB 2YN0A 4GGPA 4D4HA 4GMGA 1XZHA 4QJ3A 2R68A 1QCZA 1UMCB 4NEQA 2BAGA 4K6CA 2ZI5A 3SZ3A 4F86A 3U3RA 3AM1A 2DGZA 4F8RA 1J8QA 1RRGA 2FRXA 3B6ZA 2PZKA 3IUBA 3RFAA 3OF2A 3KAJA 1F44A 2JHFA 4RIIA 3SENA 1FA9A 4F92B 2LD4A 3H87A 3OHSX 4OU5A 4PLYA 3DCIA 4YECA 2RK3A 2ISSD 1IHPA 1IHXA 1NZJA 4P5EA 3OJWA 3QP9A 1M33A 2GN6A 2EZYA 3R6WA 2VK1A 1QHNA 2WSBA 4G1BA 4KPGA 4CN8A 5K8LA 3R3UA 4C87A 4IOKA 4A82A 1Z0KA 2PT6A 4PTYA 2OZLB 2ZWIA 3DMTA 5FL3A 1IHYA 1TOAA 2P6MA 3Q8MA 3FYTA 3MCWA 1BC5A 1GR1A 3AEKA 5E6UB 3V4VB 3PX7A 3DVAB 3K70D 4PWYA 3DEZA 4ZCRA 4KDEA 3DQPA 1TVMA 2ZBVA 4AO7A 1NXVA 3L7MA 1TTQB 4KZKA 2HM7A 3DE2X 3IDAA 1L3IA 1P5HA 2ZJ7A 1OC2A 2WPDA 4BNDA 2NSJA 3MLEA 4MJXA 1Q3UA 1IPHA 3P9SA 3ZX4A 4PLTA 5ALWA 3ZWAA 3TLEA 2OK7A 1MRSA 3ID6C 5JARA 1NXOA 1YI8A 1UQRA 2JFUA 3IV7A 3O4GA 4GKAA 4RVNA 5JQWA 1IWPB 3HB0A 2EH9A 2HU7A 3JQ9C 2MDTA 4R7TA 1QSYA 3D8NA 4EUNA 3NBXX 3HFSA 2CLDX 5AO9A 1SKYB 1NK6A 1BKYA 1PZEA 1SXJB 4J9SA 3CSSA 3LO5A 1UKAA 4CTMA 5ALMA 2PFQA 4P98A 2SICE 2X0RA 1DPFA 3WSTA 5IJ0A 1HLDA 1EVQA 3PP8A 3G17A 4KDCA 1NLZA 4TV9B 5TPZA 3HR8A 3DB2A 4LJAA 4MQLA 3EBLA 4OJ5A 1NQVA 2W71A 3WJ1A 1EQAA 2PUGA 3QXHA 5CWRA 4R5HA 3ECSA 2E5LB 1XGKA 2O8CB 3LP5A 2AN1A 1X40A 1GUFA 4J29A 1R37A 3ZVRA 4ZV7A 4BRSA 3FZNA 3G02A 1W88B 5D86A 2GZHA 2FDRA 2IHBA 2Q5LA 3II6X 1E7YA 1JROA 3AUOA 1O94C 2ODEA 4LSZA 3AM3A 3VMFA 2P91A 3DC2A 3CHYA 3W04A 3QEBZ 4BJ1A 3JPNA 1H4VB 1K98A 3BXEA 3WG9A 4PSCA 4LFBB 2WAMA 3U56A 4UBCA 2IDKA 2VDJA 4MHVA 2KE5A 1Q5PA 2V54A 4WK6A 5CW1A 3P9XA 3WLIA 1IWBB 1U2DA 1N0UA 2VP9A 1KO1A 2F00A 1ZL0A 3IO3A 3AFIA 3R9KA 2R1UA 4L95C 2XCSB 1HTBA 2WJPA 3N2GB 5IUJC 5DDMA 2ZSEA 2WG1A 4QBGB 1FMTA 2TMKA 2V6GA 2NPOA 4MV3A 4ED3A 1R1DA 1XYVA 2H0RA 2NYAA 3A3YA 3LUGA 3R3JA 4FDAA 4GVPA 4LSGA 3GV8B 1O94D 1I1OA 2CWWA 1NF3A 2I4MA 1HZZA 1PWZA 4P2GA 2CFSA 5FO0A 4MKXA 3U62A 5I45A 1R27A 4HI0E 3BIOA 3T3OA 3KSUA 2XQVA 1FDIA 1ZK4A 2J0UB 2P30A 3DOUA 4TKMA 3GY0A 5FFFA 4BX0A 4B9UA 1U1IA 2QRHA 5EZYB 1Z0AA 4M6WB 3NBKA 4UNNA 5DI3A 4I81A 3TAHA 4YPVA 1LK0A 4KLEA 2PYZA 1G3QA 3RJZA 5BUCA 2Z9BA 1E5VA 3M6IA 1U49A 3UXHA 4DMMA 1W36D 1SGWA 2ZRLA 3ZDYB 5CB1A 2Z83A 4II3A 1U2RA 1UPHA 3UW1A 1JJVA 1Y6FA 4KLHA 2OORA 1A69A 3B12A 1UXJA 1WKVA 1ZJMA 3S3TA 3KJHA 3NM5A 3OF5A 2QMOA 2BQUA 1W30A 1NQAO 1SUWA 2QN6A 3DDCA 4JJGA 1QIDA 4MWTA 1LDEA 4F5OA 1Z2EA 1GL9B 2FMSA 1I30A 2I76A 4HZUB 1KC1A 2V5AA 3HADA 1TAQA 2Z1MA 5F3DA 2ZXEA 2FX5A 3N7SC 1RS0A 3OPNA 1YB2A 4IO1A 4K46A 3S1LA 5KOYA 4NLGA 3FGPA 5LZ4A 1RM0A 4K8OA 3SZGA 1E4EA 3QSYA 1WUHS 2EF1A 5BSRA 2ALZA 1F4VA 2NT4A 2PD6A 3P9KA 4RDIA 3SS9X 4Q19A 4EBCA 2ZG6A 4JVOA 2W7PA 1KMHB 4HKTA 4F1WA 1W48A 4FGJA 1SHJA 1E3WA 1T5HX 3BN3A 1JU4A 1UZMA 2WD8A 2XMZA 4XQGA 3BRWA 4YI5A 5J47A 1E3QA 2ZYRA 5KNDA 2V9WA 2BMVA 3R4CA 3WU2U 2ZTCA 1FFCA 4ZRMA 3O0DA 3T6KA 1SBTA 1LRJA 1WXWA 2R2GA 4J3FA 4O02B 4OM8A 1U1CA 3VO2A 2AEFA 2NPIA 3T3FA 3I3SR 1X9IA 3BAZA 3GHHA 3THXA 2YWJA 1RVV1 1YQDA 2ANCA 2WKQA 3MWLA 3DYBA 4I08A 5HCIA 5K6AA 2Q62A 4JWTA 1R6TA 4MICA 5MN5A 2JCBA 3T38A 2ZR0A 3W5JA 4WOBA 5JFOA 1YB6A 4HWRA 4ECQA 4DFMA 3AF6A 2BBWA 3LMKA 2FSPA 3AY3A 2O8BB 4DV2B 5KNIA 2D74A 3HMKA 1PT9A 3LHIA 1W36B 4ZT3A 2V4QA 5FUBA 3SYRA 5LWQA 3NT4A 1FUYB 3H19A 4JMUA 4MVJG 3FNHA 2GPAA 4ZVOA 5A7FA 1ELOA 5TIIA 4ARZB 3QU4A 1K06A 1OUQA 3PYMA 3ZNPA 3GLGB 4Q3OA 2DX7A 3GDFA 5GMOA 4C4TA 1E64A 2WYHA 2FX3A 1E77A 4DNQA 2J5QA 3KBOA 4FEYA 2GXAA 3IM1A 1D3AA 4R16A 3SYLA 1XWLA 2ZU0C 1HUZA 1Z7WA 4Z4QA 1H0HA 2Z2JA 1YT5A 2COKA 2EOAA 2I4RA 4ZV9A 1DQPA 1OVGA 2VWQA 4IJMA 4G5YA 2GPTA 1NW5A 4A8JC 2JB9A 3DWFA 4GLLA 4L76A 4L2IB 2R86A 3KO8A 1XLWA 2EKQA 2NYRA 2O20A 3WISA 1NW6A 1EIZA 3JPWA 1RQXA 3DF7A 1N7IA 4HXYA 4M9XA 4PQFA 3ZV3A 2FPSA 4RZ3A 2H1SA 4XX0A 5ALZA 1X9HA 2JCVA 4UREA 1USKA 4AP9A 5KG7A 3K8ZA 3AOEA 1MH1A 4OUDA 2QF7A 3Q3VA 4XJSA 2X8BA 4Q3DA 2QTTA 4LMRA 3SEQA 3EXIB 2WHYA 5I9LA 3COPA 3AUJB 4MO2A 2XQGA 5ALNA 1V9PA 1BZYA 1I6MA 1P60A 1YVRA 2ORIA 5K8VA 3O92A 2WUFA 2BZFA 1I9CA 4OREX 3SZLA 4FNMA 3UOAB 1G7RA 4C20A 1SUEA 4C4XA 2QKYA 1ZBQA 4BWFB 3R76A 5JOQA 5J4VA 1I7PA 3DZKA 3QKRB 4P7JA 4ZVRA 3P1JA 4ND8A 3A6LA 1Z00B 2AE2A 5IM5A 1OGJA 1W85B 3HZOA 2RC6A 5ENDA 2IS1A 3QBDA 1OI7A 2RGNC 4D0NA 1A9XB 4GE0A 2FP3A 5EGSA 3P0IA 1SU7A 2AG6A 3WB1A 3F5MA 3FUXA 4YXJA 2G36A 3E61A 3H9UA 4N9QA 4NPHA 2OTCA 2ZRCA 1LTHR 1S1CA 1YV9A 2IP4A 2GKGA 3MAGA 2GARA 3P9YA 1WP9A 2HRDA 1UXOA 1KDRA 4D3YA 4ZIRB 4TMWA 4ED7A 3FR8A 1TXGA 3AILA 4AIRA 1NYLA 2KI5A 3SI7A 1ZG3A 2OP0A 2W2TA 2Y0PA 2I7CA 4YWHA 2ZUCA 1GKIA 1XJCA 1WCXA 2A4MA 4H1VA 4NYIQ 1AQJA 2OKGA 4Q9HA 3OZUA 1T3HA 2GAAA 5I51A 2UZ4A 1ZVKA 1ESCA 2M1ZA 5LPNA 3RRBA 2GNAA 4JEHA 3ZV5A 4XFJA 1S0VA 3K3PA 3RBXA 3IBYA 3FMVA 4TKLA 3CNBA 3KEMA 5K20A 4JWNA 4W5TA 1C7YA 3FH0A 3MGKA 2IHMA 2B37A 4Z4CA 3EZFA 3RF6A 3T9DA 1R10A 3RSZA 2GJSA 3K9BA 3K0BA 4UARA 3FTPA 4J9LA 2A1TR 3C3PA 2V9CA 3KUKA 4X00A 5FTNA 4IV8A 2NV0A 4ZOQI 3EYZA 5IF9A 2HBKA 2H11A 4HEA1 4O4JA 4E5KA 1Y8ZA 2EIXA 3QKIA 1IIBA 1QOQB 3JWGA 3KWJA 4B83A 2B9EA 3OJUA 3EX7C 3GEMA 1DJLA 1EINA 1XAGA 3JZAA 3M3HA 4IG9A 4BVHA 4C4ZA 1T4DA 3OOEA 4P4GA 3KHLA 4CF6A 5HIKA 3E22A 3ZCPA 2YMPA 4UDYX 1E66A 4LTDA 4RXTA 2K5UA 3NB0A 1IMOA 2YYZA 1BYIA 3MYRA 3ITDA 4BNTA 5LZ9A 5MGBA 1SEPA 5ICMA 1CW2B 3L8GA 1PQUA 3DP7A 1Z5NA 4EBFA 1URPA 2XXAA 3LT1A 4NOJA 4ND3A 1X9WA 1AN9A 2DKZA 1GV1A 3D5QA 4LDRA 3JD3A 4Q3CA 3RUHA 3VPDA 3L40A 2ZJFA 1TLFA 2UKDA 4RH0A 2UYOA 3GAAA 3L7DA 1Y3DE 3CW2A 4YRBA 2E6UX 4IF4A 4DR1B 4EGQA 3BWXA 2BY4A 4PNZA 2DWOA 1JVNA 4L5IA 5BPFA 5CW2A 3HO6A 4Y2RA 2BBSA 2P2YA 3DEFA 4QXPA 3A4TA 4U3JB 4L3WA 5AP9A 1E59A 3UMYA 3OUUA 3P52A 1DVRA 3HGQA 1QFSA 3MQ2A 2OE2A 1BVYF 3B1XA 4ND1A 4Y9RA 5HTOA 5JADA 1W0KD 2QTBA 3OEEA 1R0LA 1YOVA 2OH2A 2EHJA 3ZDCA 1JEOA 2JV3A 2PAFA 5GTDA 3JWHA 1TMKA 1XLUA 1J42A 2O2GA 1A9PA 4H9GA 2Q2VA 3TTYA 1CDOA 3AESA 3GLHB 4E5SA 3HACA 3TNJA 2IHUA 4FS2A 1CT9A 1E6WA 1L4BA 3ITKA 2OPHA 4AQYB 1JTFA 3FMPB 2R7NA 3B51X 3JASB 5IXYA 3RC8A 3NS7A 4G8CA 3SSNA 2KMDA 4F3OA 1H23A 2WVHA 3IQEA 1Q7CA 4M2LA 1ILWA 2VSQA 3OPYA 2X0DA 3BQ0A 1WB4A 1KAGA 3RFFA 3SAJA 3CZPA 4GICA 5LWHA 1BMFD 3ZI4A 2WPNA 3CNQS 4D6XA 3GFQA 2IWHA 4GC5A 4DSAA 1D2CA 1WKCA 2AK2A 2FN7A 4CR8A 2WAQF 3AL0B 1RZRD 1XHFA 3PC6A 1FIUA 4JCCA 4JL5A 8ICHA 2PQ6A 4I7EA 4ISCA 3T7SA 3KSAC 4PHTA 2A9PA 4AZVA 1VBNA 5FL7D 1CULC 1UEJA 2P79A 5KYKA 3ORRA 1MO3A 4AF6A 4BFWA 5KPDA 2ICAA 5I48A 4PHCA 2CXXA 5B58C 1A77A 1Q0PA 3G1UA 5AHRA 5L3SB 4CV0A 4Y2QA 4KLJA 1W76A 3N05A 4LJKA 4Z0NA 1KH1A 3KJNA 5F2NA 1KH3A 1Y8RB 3IQIX 3E8XA 1KLNA 4L4UA 5HKOA 3GCZA 1A7JA 2HOFA 1GZSA 2SCUA 4IGKA 2RGRA 4AI6A 1D8YA 3L8MA 4FINA 3MTAA 2C98A 5KSOA 1PJSA 3I2IA 1AC5A 1B23P 4ED0A 2WW8A 1X3LA 5HP4A 2QVYX 4GZ5A 3FNBA 3AI3A 5JI2E 2VTBB 4BGDA 1IZYA 2WHXA 4Q1CA 4B6RA 1H5NA 3RTDA 4FJ2A 4AUMA 4OGGA 1HDRA 1DUVG 1QHHB 1TCAA 5ALEA 2WIKA 2PPLA 3OICA 3RIXA 4NJOA 2ETXA 1JU9A 1PEYA 4K1XA 1ZD9A 2QMQA 1G8KA 3WS7A 5A5FA 4S05A 1EBBA 4H1TA 4MRAA 1A4RA 1IZ8A 3OEYA 3PMLA 1IOZA 2XADA 3QG1A 4IGFA 4K40A 1RI3A 4R1LA 5CCDA 3T12A 3UXMA 3O0FA 2OCPA 4M21A 3BFKA 1FO4A 3D4OA 3FRHA 5JXHA 4DL3A 3DC7A 1DZIA 4GWGA 3V34A 1MC4A 2BEVA 2ZITA 3AZPA 3HYSA 4DSFA 2KEYA 1GNTA 1YNOA 1DTSA 1I4WA 3K8OE 4BX9C 1IG3A 4Q3NA 4XB1A 2VF2A 2ZIFA 3RVRA 4CIAA 1N77A 3Q7EA 4IUCS 3KNZA 5KPJA 2GD6A 3C70A 3STTA 2H16A 4B6GA 3TZKA 2FPOA 2Y66A 4JJIA 1YL6A 5LLSA 3TJZA 2F77X 3F7NA 3WO1A 5KFBA 4X66B 3RRNA 2HA2A 4HS4A 1T5OA 1CUYA 2Y4OA 4HWKA 4KQCA 1OW5A 2Q1WA 3SEFA 3PE3A 2HF8A 5K0CA 3QZ8A 2F59A 3TVTA 2A33A 4C4AA 1ZQ1C 1WCNA 3B38A 4FVTA 4I5GA 3B6MA 1UBGA 5EERA 1B6RA 2RHWA 2P68A 1ZQBA 1MJGA 2PT9A 5H2FU 2JEFA 3MJHA 2YOHA 3HEMA 3CTPA 4GG1A 4WMLA 4XYEA 5F12A 5FXMA 5HKKA 4F3TA 2PX0A 2IXDA 3ZHYA 1XLVA 1HNNA 1ONSA 4UNIA 4A8TA 4OQEA 3IDQA 1AS3A 1KARA 5DBFA 2BGWA 1TK3A 3IKTA 1NJXA 2GX6A 4KHPB 2J3LA 1VKZA 3IT2A 2X0FA 2H65A 1ESNA 3FVWA 2HCFA 5LBIA 4CIXA 1PFWA 1E89A 3FAHA 2IXGA 3I42A 3K0CC 3L3BA 1PFVA 4KOEC 1P18A 2GI4A 4QQNA 3WMFA 4CKXA 2TS1A 7ICUA 3EPPA 5BY2A 3O3OB 5CYGA 3PDUA 2O7VA 1X7ZB 3WLJA 4KFTA 4JAVC 1NOJA 4UMEA 4GRDA 2ZYTX 3LI2A 4FGWA 3UV7A 1PSZA 1K88A 2WTMA 1K7CA 4EW1A 1F3LA 1K3FA 1MAWA 2BE9A 3MTJA 1JILA 5IYZB 4LJXA 4UASA 5BUQA 3HCAA 3WGNA 1AGYA 3KWLA 1O96B 4MKHA 2AVNA 3RE1A 4EATA 1RM4A 3JQ9A 2G25A 3AF5A 5AUQA 1MA0A 2BGNA 1Z8FA 2VDVE 3Q0TA 4JQOA 3D6FA 3AJ8A 4LYDA 4QTUB 4NBTA 5KYXA 3RYFB 2O1EA 1G5QA 3LP6A 1U8CB 5J8YA 5TB5A 3SJZA 5B1DA 2PX5A 1ECCA 5DOZA 2O7QA 4D2IA 1SBYA 4NU5A 2R8BA 2PX8A 2X76A 4OHXA 1YRYE 4B7XA 4QJFB 1C2YA 2ZS7A 1EX9A 2W70A 1T13A 2PZLA 2QRUA 2KKVA 1KNXA 4K4IA 2W04A 3M83A 4MB2A 3DBLB 5J9FA 3TQCA 4QUAA 4MYCA 4MQFA 4O4LF 5COQA 1TK0A 3ICOA 3OQ1A 2MCFA 4A7PA 3IOYA 1E0SA 1M1NA 3ETGA 3H1PA 2QRQA 5ICFA 1A9XA 3N2IA 3TLYA 2C5EA 2YVUA 3E2IA 4CT4B 1HE4A 1HFJA 4MUEA 3FXAA 1CVLA 4K6HA 4OL9A 5EMJA 4D92A 1M74A 3QKRA 3T3IA 4B9EA 5KOHA 4H6PA 4QBTA 1EDZA 1JKFA 5CG1A 4EYKA 4YPOA 1KYVA 3VCBA 1GRVA 1YR2A 2Q3DA 1TYEB 1UDBA 1T5SA 2WWGA 3EAFA 3K6RA 4KN8A 3B5EA 4KLCA 4PYOA 4C7XA 5IAKA 3FIJA 5L3QB 2Q7XA 1ADFA 4HYKA 1KW4A 4GVXA 1IK4A 4YI3A 5FPTA 3BMOB 1KPHA 3QLTA 1BPEA 2CHQA 4NAVA 3Q8LA 2QKQA 1AKEA 1XQXA 2GPWA 3E9EA 4IRMA 3W7BA 2HA7A 3JD1A 5ALRA 4ZOLA 4LSWA 2GK4A 4URWR 4CW7A 4ZVVA 2WWVD 1POWA 3QX7A 3K9LA 3DKKA 5MFPA 3DMHA 3LT0A 2ZCJA 4B9MA 3P71T 5KHOC 4XX0B 2B1IA 3WO0A 1R88A 4BMXA 1Q7TA 2FOLA 4NQZA 1GWNA 4KR9A 2XYRA 4HPWA 3H0MB 1E5XA 1NIJA 4XE5A 2QB0B 2EZ9A 2WT4A 4BL5A 1GSAA 1MGOA 4MP3A 4RORA 1I7QB 4G84A 1XVIA 2AKAB 1G7TA 4EGFA 1J99A 3B60A 1ZQIA 1K5HA 1YVEI 3TAQA 1IWOA 1RTTA 1V39A 3HYRA 2IHYA 1SURA 3R6GA 4XUCA 5AVKA 2D6FA 3LF1A 4UMFA 3SNKA 1IG0A 1XZDA 2VYFA 5DQHA 3INNA 4ZU1X 1OH7A 3DBHA 2ZRGA 1JEAA 3BFXA 1V6SA 4D5EA 1T94A 5EXXA 5KCMA 5IXJA 4BVEA 4PC7A 1XMIA 3QYFA 4PPNA 1JEDA 3SYTA 5HZHA 2B36A 3H18A 3WVNA 4QYSA 1ORDA 5KSWB 4NEHB 1W1UA 2HWKA 4IGIA 2IS2A 7ABPA 1FTNA 4IOMA 4KJZA 3WGMA 3BZKA 2XWJI 3AU9A 3QI7A 2P77A 4DLYA 1ABFA 1M8GA 2JCXA 1E9CA 3HXLA 4XCQA 1QHEA 1GAXA 2X7HA 3NHWA 3KFLA 2P1RA 4ROTA 3LUJA 4UUOA 1Q1BA 1J2MA 1SXJE 4OAPA 4V0SA 3L02A 4DMRA 5FI1B 9GPBA 3G2JA 4TWJA 3HCWA 2I2WA 5DRTA 5D3KA 5FHRA 3VZDA 4U8GA 5CFMA 3DHNA 1M1YA 4M0KA 4RIFA 4B3JA 1NTRA 4YAEA 3C3WA 1NUHA 1Q21A 1ZMXA 4EBEA 1QV9A 2JAQA 4Q44A 1K4MA 3IR6A 5BXYA 3ZE7A 1J97A 1EE1A 4CM8B 3E7FA 3GGOA 1NUTA 1OLXA 2XGSA 1SHTX 2WINI 4M0FA 1BS1A 2VSXA 4HD8A 5K6RA 3MJ4A 4O2BA 2CYBA 4P4SA 1ZH8A 4LMBA 5AI9A 3F3YA 2OM6A 3LGXA 1XEXB 2NG1A 3GUZA 1P2UA 2EEPA 5EZYF 3WWEA 1XHLA 4R8UB 2I9KA 2HBLA 4PZDA 2QN8A 5AVQA 4RTKA 5F98A 1P5JA 4ELTA 1EE9A 3DEAA 2MT9A 2QRVB 5EJMA 1U3WA 3RFUA 4BZXA 4I4TA 4LRUA 4B85A 5M29A 4ITRC 1CUXA 3EZ7A 2KZ3A 3M6AA 4FHZA 1QFJA 1R0KA 4A4DA 4E32A 1DXSA 3JYPA 4AG6A 3T3PB 4EPVA 2IEIA 2F1KA 2GESA 1TLTA 4JP5A 4L57A 3PLNA 5H81A 2PN1A 1PG5A 1J90A 4BVJA 2DPLA 1VHDA 1SJ9A 4PGYA 2QUZA 1I7LA 1PJQA 4YK7A 4KLFA 1KBZA 2AC4A 4AUNA 3RVPA 4TURA 3C2LA 4QT0A 3H9BA 4ZQGA 3E81A 4OXRA 2P7HA 2VH1A 4D0GA 2B92A 4OXQA 2Q5IA 5K99A 3I83A 3ILVA 4Y6SA 2OGUA 2Z8ZA 3FF4A 4PYLA 1Y42X 3C87A 1CWUA 3H8VA 4J49A 3IP9A 4PPYA 4Q1BA 5THKA 2QK4A 1AZWA 1VJ5A 1ZRHA 3ZQJA 2ZSBA 3EK2A 4IRDA 1O57A 4J16C 4JMLA 1DGQA 5FUMA 8ICBA 3FOZA 3GJZA 1VZ3A 4YA6A 2GCNA 3WYDA 2PUFA 3AVTA 9ICKA 1I80A 2K4PA 2QW1A 4GC9A 4P53A 8LDHA 5KQLA 4LOLA 4LMAA 2YWXA 4P86A 5CR9A 3SQNA 3M8KA 2B4AA 4WNCA 1FQKA 4G5HA 4GFDA 5BOSA 1Z5ZA 4XJVA 3AEUB 1ZQCA 2GETA 4UHDA 3WYBA 5JZBA 3DLAA 1NJ8A 1ZKDA 3N2LA 5E7QA 5TJHA 3BGOS 1Z68A 2C5LA 4LN1A 1KKXA 1WETA 2JCYA 4ARCA 4YRLA 1BYUA 3RVLA 4MKZA 4ZJPA 5T8KA 5DYNA 2NVWA 2XDQA 4OOEA 4XYGA 3IAM6 3DMRA 2TECE 4MCIA 4FFBB 4K9NA 5E8JA 4PN3A 4UBKA 4WFKA 3BSSA 5BWOA 5HR7A 4W4TA 1CUSA 3BS5A 2E89A 2XB6A 4BWVA 4RGVA 1RRCA 2IYXA 4BNIA 1VL8A 1OHHA 2EWVA 5H80A 3TE6A 2BFFB 3OKAA 3H3JA 2BMEA 1W4RA 2LDBA 4Q7JB 3REFA 2DUNA 4F9TA 2PR7A 4EUFA 1L5YA 2QB5A 4DLUA 4RJIA 4Y6QA 3LCCA 5IVDA 2FRDA 4FCCA 3IEKA 4UUMA 4D8WA 1X1RA 1UC8A 1F2TA 1R00A 5HMLA 1DJNA 1WXIA 2DM6A 2WPDD 3LX8A 4NV3A 3V9PA 2H06A 4BCCA 3T5TA 1EXWA 2WC1A 4H1HA 4QJIA 1J2RA 1E5DA 2NO0A 4WTOA 4BV8A 1P2FA 3OZRA 1U28A 3WQSB 3HXMA 2PUEA 1A8UA 4OMDA 4QIWC 1S01A 1XRNA 4JJKA 1TEXA 2ZQ5A 3HDTA 3O7MA 4ZTUB 4DFJA 3JRWA 2F8SA 2FMHA 1Z6ZA 2J4FA 2XRFA 2XLBA 1JHQA 3DEJA 4XQ9A 1O6ZA 1R5JA 4BFTA 4NP6A 4C05A 4X60A 4RPGA 3RSSA 3E0FA 1QBGA 2VPTA 4PZZA 4E07A 4ZZ1A 3K70C 2HRZA 4GECA 2ZAGA 1Z08A 1Z5UA 1H3NA 4Q4JB 2XX3A 1WAMA 2QUAA 3FJOA 3RARA 2HVIA 3NS1A 2M1XA 3BZCA 2E8MA 1HGXA 1X77A 3NIDB 3OZGA 3PC3A 3R5JA 4NS1A 3UWKA 2N75A 3SMVA 8ADHA 1MEEA 3I53A 2JDID 4MS3B 1GPKA 4QLAA 3USES 1E9AA 5F5LA 3W3AA 2Q6OA 3BMNA 4G4GA 3FCSB 1EIWA 5FA6A 4UVHA 1N5RA 1OU0A 1ENPA 3H5IA 5J0WA 1RAIA 2ETVA 3BCUA 2NOAA 3PUJA 1EWRA 3OU6A 4AKHA 1TA9A 3LCRA 1KQNA 3Q5DA 4Q45A 3D1VA 3UO8B 4FZJA 2A30A 2WSLA 2ZRFA 4YAJA 3LDGA 4ZFNA 4BLTA 2JBHA 3ECCA 4DLVA 5HM8A 4MVJH 1VJRA 2AXNA 5KQMA 1PJTA 1B2LA 1EZ4A 3RVBA 3A9UA 2Q9UA 1Z6PA 1J9GA 1U3DA 3EF3A 1OQAA 3MPUA 4KLNA 4Q4LA 1H2AS 3NRJA 1NBWB 1MPXA 2JJ1A 4J76A 4E0BA 4XWOA 4YMVA 5CT5A 2VUHB 2C2GA 3PNVA 3V8EA 1EGQA 1CRWG 5DYGA 3TXXA 5GJCA 4PO1A 4QDTA 3V32A 5CCBA 1RYEA 1Q1NA 4PNPA 4I2IA 5DIZA 1I0ZA 3GGGA 2NZWA 2R8YA 3GX1A 1UK6A 2FSFA 1WO8A 4EG1A 2Q5FA 4ZCLA 1GTL1 4FO6A 1BGWA 2YZMA 4TV8B 3WNCA 5CK4A 2PSDA 2IHKA 2R87A 7ICEA 3KVNA 3UMFA 4FBUA 1CR4A 4WCFB 1H8HA 3D7SA 1AKUA 1K92A 1U3TA 2J08A 4GUAA 1WBBA 2ANBA 4YFVA 3D3KA 3KJIA 1FMJA 3IQZA 3PNKA 3QKTA 2XYHA 1UK8A 2CDAA 1QC5A 3CPHA 5GV8A 4KOAA 2YUTA 3DDOA 1O97D 5EESA 3D2NA 4R2MA 3KELA 1Y7LA 3K1AB 3OURA 2YXEA 1XYGA 2H4ZA 3M9OB 4HB4A 1PI3A 4HRVA 2BGUA 1YVUA 3I64A 3W8NA 1QVAA 4OCZA 3A1SA 5AK0A 4JYCA 2FUCA 3EG9B 1ICIA 4YRNA 1IY2A 1W5AA 1M5TA 3IP7A 3QLJA 5TV2A 2B78A 3FRJA 5TF4A 4QHSA 3KKKA 3QQPA 2W9AA 1G98A 1UBKS 1IONA 1TUEA 2JL1A 3UKOA 4QZVA 3N6XA 3Q6MA 4YYEA 1RM6C 2X8JA 3D8HA 4HRXA 1ZGCA 1F51E 5KSZA 1O8BA 1P0MA 4F5NA 3TL2A 4RFSB 2RONA 1KJWA 1OV6A 1KKMA 2O1WA 4ECSA 3HU3A 2DUUA 4TTTS 1Y7HA 1S0NA 1PT8A 3LWBA 3PXEA 4KQGA 2CNKA 2PGXA 5JSYA 4FGUA 3A4IA 5KHLB 2CUZA 2FZCA 4QGFA 4GC6A 1DX4A 4TS4A 1ULSA 3K75D 3I6IA 4K28A 3A8TA 4BECA 2AX4A 2HVHA 3O8DA 2PGNA 3R5HA 4JZYA 2J30A 1CQZA 1F2UB 4ENUA 1E1RA 1NQXA 3N53A 3O0TA 2BPGA 4GI5A 4KG7A 4L0QA 4PANA 4DABA 2FG5A 3OU7A 5EHGA 5I7HA 2IH5A 3OQOA 4PR0A 4AIIA 1RQ2A 1HDCA 3NP7A 4DS5A 3GHYA 4IMRA 2O2SA 3LT2A 5D2CA 3TOXA 3JSXA 1M6HA 4PYMA 3SFVA 4DJ5X 1F8YA 1SL0A 4KLGA 3N7AA 2DBRA 4LZLA 4Q6BA 3TEJA 4AB1A 4XR4A 1XTKA 1ZM7A 4FB5A 5KYVA 4P4MA 4RTRA 2REQA 3EEBA 3ZQ4A 1C30A 3E9RA 4IDHA 1ZM2A 2CW5A 2H63A 1DKMA 3OSUA 2EW1A 3KG2A 1TU4A 2C4TA 3OFVA 5DP1A 1OB5A 3ZBQA 4RNOA 1BE1A 2QIOA 1T1GA 2YC2C 4ZA2A 1S76D 4Y0VA 5DK4A 2I2FA 3ND8A 1QO9A 1NURA 3LQQA 2WT9A 4H7DA 4EQ6A 3T0IA 2IXAA 1UXKA 2YJ3A 4TLCA 4EG8A 2Y1EA 4MWBA 5AI4A 1UOEA 1IG6A 3O4RA 4IO0A 1G42A 4L73A 4HC4A 4PQGA 5CK5A 1YF3A 1L4GA 1Q0SA 1YRLA 2O59A 8ICXA 1PWEA 3K7EA 3DLCA 3ISDA 4DS3A 3AM4A 3INGA 3UW3A 2R8RA 1G9XA 1U7OA 2QG6A 2FMXA 3C7TA 4FZRA 4DBZA 2IC5A 1DKPA 3EVAA 4W5OA 2EERA 2HPVA 4WCVA 1A5BB 1IIPA 2QP3A 1YK1A 5CURA 3BE5A 5IT4A 3AVVA 5FRDA 3EXHA 3QGMA 2RRDA 1UWCA 2FWIA 4KIWA 1L7DA 1YR3A 5JS7A 3AUAA 4MMYB 1JDNA 1XSEA 2Z8YA 1ZQLA 4NV0A 1VTKA 1ZA1A 2J59A 4EKIA 5A4KA 1XN1A 4MROA 4FSDA 2FKAA 3UPDA 5DB6A 1RWQA 4QYWA 2F43A 2QN3A 4XX1A 2O2EA 1J24A 1UFKA 1D8LA 5BR8B 3ONNA 1RSZA 1NJ5A 4NZNA 1NE7A 5K3SA 2X3YA 4U7TB 5KG0A 4WESA 3U7FB 4WI1A 1GGEA 1CTQA 4AKSA 1LDGA 1INLA 1MXHA 2OUKA 1XQWA 2R25B 3P0RA 4MK4A 5EIBC 3W4JA 4FONA 2OWOA 2F62A 1U6JA 2COEA 2PVSA 3D02A 2WNSA 3GJYA 5HDBB 4QWBA 3NDPA 3LVVA 4YFYA 3SWWA 8ICWA 3KKEA 3B6JA 2G08A 1N2ZA 4YX9A 4PZCA 3UJNA 2ZB3A 4P4TA 5EVJA 2ZCVA 4XDHA 4ZYWA 3BGWA 5CT8A 4CEIA 2GWHA 4FS1A 4DL2A 1SQ0A 3T79A 3W6ZA 1Y8CA 3EVNA 5TR9A 5A62A 2NU6A 1PK9A 3PU6A 2WAXA 1TT7A 3OA2A 5K09A 3DGFC 4G1VA 4GYJA 2GASA 4DE5A 1RXUA 3RG8A 7ICLA 1NJZA 2VJNA 4RL4A 3TRHA 1YL5A 4DEXA 5ITVA 5IDQA 1P44A 1UJ4A 3C15C 4CF7A 2IHNA 5ADWA 3T5JA 5EGNA 3AUFA 4TVKA 1A3CA 4HWTA 4KKVA 5I9SA 2MJLA 5K0GA 5M5BA 4CLDA 4YCXA 1Y3IA 5CA1B 3GQBB 4P0QB 3D2SA 5FPQA 5CA0A 4CF5A 3PE4A 1M34A 1QOZA 3KX2A 1K8QA 1R12A 2YYSA 4R01A 4GLBA 3F7TA 1XVLA 2WUGA 1ZPDA 3CO0S 3ONEA 4DV0B 2WM2A 2IPMA 4FNOA 3AHDA 1UQVA 2Z09A 4F4CA 4RK4A 2BHNA 1ZUIA 3ANNA 2MTBA 3LYLA 4BLSA 1GD1O 1OJLA 4CM4B 1EWTA 4DTCA 3WC4A 3HE3A 4UNSA 4BO4A 5CJ2A 5C8YA 3F6CA 1YRHA 3OWHA 1VYTA 2ZIXB 2P8SA 5DLPA 1WSAA 3ABQB 2OFXA 4KIFA 4TLDA 3A4VA 3M5WA 4UJ5A 5KAMA 1F2TB 3T7AA 3WRWA 4MCAA 3F4BA 3TI9A 4F4JA 4DDMA 5DULA 2QN1A 4D74A 3ABIA 3B20A 3G6KA 2UVRA 1N7JA 4JKOA 3C8DA 1NQ5A 2GAJA 4HL6A 5C8DA 3KOZA 4LOJA 4MDHA 4NBUA 5AUNB 2R79A 2FFJA 2WILA 3JALB 3KJEA 4X7PA 3D6AA 1L3TA 2O0LA 2ZI9A 2XF8A 3ILYA 3OOJA 4FWBA 4K4GA 4HP8A 2A8YA 4QG7A 2KBFA 2RP5A 2RHRA 4V0RA 2F1RA 1RXEA 2XMGA 4X62B 1NW3A 3ADOA 5J0YA 1WPXA 1HRKA 4KLLA 4PC2A 2E8OA 1B8OA 3X0DA 2JZBA 2KFZA 3GOHA 1OCEA 3PSTA 4PO9A 4R6WA 4KCGA 5FFNA 3S2GA 4ZHQA 5IKMA 3EVDA 2V0CA 5A7GA 2DC1A 3UG7A 2HIMA 2OQ2A 3I6QA 2WRZA 1U47A 2FEAA 2R6ZA 2AYYA 2O5CA 2O5VA 2GFHA 1A9ZA 2ZWPA 4CIVA 2VBFA 3U3DA 3VR4A 1MB9A 3ZGXA 1JZSA 2F3UA 4BNYA 5JVDF 1TVKA 3K0FA 3TADA 3RABA 3GLFA 2AOTB 3U1TA 3U80A 3MUFA 5IIJA 4XIIA 5FPSA 4ERXA 2VT6A 1C1XB 3GCWA 1EGVB 4MW6A 5L1LA 1E6KA 1YZQA 2MU2A 4HDRB 4K88A 5JZSA 1O94A 2R65A 4F8YA 4CKWB 1D2HA 1R4NB 5C8VA 1UCVA 1YFZA 4LRYA 1OAKA 4QEKA 1B41A 3ECAA 4PX2A 4IJWA 4CLXA 1Z6YA 2PV7A 1CIJA 2V97A 1LV5A 3MELA 1ACLA 1DV2A 3GEIA 4HFNA 2ALJA 4LKOA 3RU7A 3TRKA 1LA2A 1RVDA 4ZPJA 3UICA 1PX2A 3P2YA 4A0HA 2IP1A 3Q6NA 3QOYA 5AVRA 1VMAA 2BEJA 3I1IA 4JODA 3CBGA 1JHAA 3BDPA 2IH4A 2ZBQA 2YY5A 4R41A 4MLCA 1OAOA 1E79D 3FPAA 1R6BX 2X86A 1R50A 2ZROA 4YDHB 3K6SB 721PA 1Z3CA 1A9QA 3GV0A 3PKIA 3EVEA 2IBKA 1DG1G 1E60A 1K66A 3MT9A 4Y1FA 3OUTA 1ZIYA 2FLWA 1LZKA 1XCMA 3B82A 4NCKA 4RFLA 3DAHA 4WDQA 2GHIA 4ZRDA 1BCSB 3OT1B 3OTIA 1ODLA 4F4KA 1BA3A 3T0FA 3C3EA 2MA1A 1SIJA 2FLLA 1C8KA 1YS7A 1Z7YA 4DA7A 1CJTC 5A1TA 1ABBA 2VUTA 5KG4A 1R16A 2HXSA 1PIWA 4J0KA 2ODAA 4N7MA 5CBPA 3JD2A 4BWYA 1WMEA 4L28A 2Q9BA 3SD7A 5E0OA 3OU2A 4KTTE 3M9LA 1NBME 4PSAA 1X6JA 1MQ9A 4UU8A 5K3FB 2G5HB 4MQEA 3KLBA 4PFKA 1IM2A 3V3KA 1MO6A 4KAFA 2HMSA 4D8VA 1AV7A 2VT3A 5DW0A 2I62A 5CUQA 4OQQA 1XEXA 3CJRA 5JH7F 3TQRA 1OXBB 2DLNA 4A6DA 2ZT8A 1CCWA 1NSTA 5J2KA 3JYHA 3MWJA 4OI2A 1PK7A 2H4XA 3OFJA 3K5WA 1UT8A 2C2DA 5EE3A 2FB9A 2DG2A 1JV2B 1VA4A 1ZBDA 4QUEA 2H2HA 4EHNA 3D4LA 1FFXA 3DZCA 3FFTA 3OCZA 3WL3A 1V26A 3LWLA 4M49A 4HN4B 4PJ0U 1O9GA 4Z0HO 4CCYA 1EM6A 1MOQA 3C29A 2QVBA 4Q9NA 8ICZA 1MB2A 4WSOA 3KDSE 2OO5C 4PPQA 2FMKA 1KK2A 3MRTA 2P6NA 4B8YA 3D6TB 2Q8PA 1IRXA 3EYWA 2Q27A 2B0CA 1VG0B 4J16A 2QUJA 3DV2A 3GLHE 2H2AA 3EXG1 5C3UA 1KDVA 4BDSA 1DFIA 1M7BA 3AQ4A 5D3ZA 4EEXA 2H6EA 4N4AA 1WZNA 3S2ZA 1QTRA 4HX2A 1A6SA 3OJ0A 4PYNA 5CP8A 4H60A 5CFQA 2WNHA 3P2EA 2ZUTA 1DFHA 1QQ6A 1EGMB 4WECA 4YP6A 3R7LA 3PNYA 2G5IB 3QPCA 2PFNA 3CRXA 1E2BA 1H0RA 2FWAA 2H9IA 3L4BA 3CF2A 4GOLD 1ABEA 4AYXA 7ICQA 4YMTA 3WTBA 1T34A 1IXKA 1UCFA 2G04A 2DUJA 4JVNA 4U7HA 3UG6A 1RMYA 2R5NA 1KP9A 4D9BA 3LPMA 4ZHQF 1KERA 2GEUA 1XCOA 3PHIA 3TTUA 3FW1A 4A2QA 4D9JA 4E08A 2Y1FA 3RB8A 4ASUA 3CGWA 1H1LA 1SR8A 2HPZA 3QH4A 3ZBPA 1B0AA 1N6RA 2X4IA 4IDEA 1OFVA 1RPZA 1UBCA 2UVDA 1KRPA 3NCTA 1SCUB 4JASB 3ESAA 5BW6B 1CS0A 5DFAA 3VDNB 4XEHA 2C2EA 1CQWA 4W9NA 5GIOE 2OWDA 3CPSA 2B7BA 2PEZA 3CRW1 2PXHA 3NTOA 2W2VA 4GBJA 4B9TA 3N2NA 4JMPA 3T1OA 3GCGA 4YV1A 1U6KA 1ACMA 1JQLB 1RWMA 2QAGB 2SKDA 3OIGA 4PR3A 2X5OA 4P31A 3FPEA 2JPDA 5IH3A 3E1KA 1ZQ1A 4OHBA 3OC6A 3H3FA 4OH1A 4NMHA 1O89A 5BSMA 5C8ZA 2H9YA 1SOWA 5DHRA 4PWZA 4WZBE 2PAAA 2QMZA 2XGMA 3SJ7A 3ZU6A 1K5OA 1QH0A 2XDAA 3B48A 3IS3A 3GP8A 1CUIA 4DA4A 4F3RA 3EB9A 1A5TA 3GJ8A 4DYDA 3TN7A 1TV9A 4RE6A 4W1SA 3O94A 1IOLA 3C1ZA 2BI7A 1Y1QA 3KCNA 4XGRA 4OBEA 4BN5A 4EECA 2YFQA 4BNUA 1XZKA 4Q7KA 4GPTA 4YY3B 1NK7A 1FUUA 1LPBB 4HMOA 3WGUA 3ZXXA 3HHEA 1SU8A 4P2BA 5EJ2A 4I9HA 4YP5A 3D7RA 1TYZA 4YJ3F 4G67A 4RCZA 4UNQA 5B1EA 4FWTA 2FDCA 4FS3A 2UZIR 1VRVA 1N6OA 4JV5B 3I1FA 4D98A 1Z0ZA 2P2DA 3H9GA 2YKGA 2YHSA 1DJOA 3I2KA 2XA2A 2FPXA 4MIKA 3ZHVA 2DFDA 1DDIA 4LTNA 2QI9C 4TYNA 2X8WA 3A9SA 1NA5A 2AWNA 1XN4A 4GHWA 1DWOA 1GGKA 4YRAA 1JDZA 2C7OA 1SU6A 1Q3KA 4Q21A 4JB8A 2FETA 1NKTA 2QAGC 2R11A 3UJ8A 2W3RA 2AKYA 2ZETA 3SEAA 1NV9A 3OPXA 3GVCA 5BN1A 1SKUA 4UAGA 1HLFA 1FFXB 3TSCA 4NULA 2GILA 4UBLA 1Y6QA 3SZUA 2RK4A 3EVFA 4YMHA 1ZOIA 4J07A 1T9GS 2XAAA 3SZOA 3O47A 4B3XA 1D2RA 1G8HA 2D0IA 4RGBA 4A5OA 4FYXA 5JEDA 2V7XA 1L2TA 1T1RA 3PIRA 3RVKA 5JBQA 1K0UA 1C1HA 4EJ2A 2JBWA 4ZMRA 2XICA 3K94A 4DXAA 2P67A 5I5EA 3LPNA 2DFLA 1CZNA 4C0BA 5JCOC 1QO0D 2QL9A 3KD2A 3PPWA 4ZYZA 1U9YA 3NBFA 3OCJA 2JEOA 1TVEA 1L8OA 5CEFA 4TMTA 4H7KA 4S2UA 5C0OE 1F5NA 1NPYA 3Q3GE 1D1TA 4WWHA 3SR0A 1H38A 3PEEA 3M49A 2RGEA 2JA2A 3G2MA 3GNQA 3SKVA 1OY1A 1JLHA 3IJ5A 4X0EA 4JB2A 1Y80A 2YZ2A 5HM6A 1PT7A 1SVKA 3SC6A 4UE2A 4ZI7B 3ASVA 1QHFA 5KNBD 5BT8A 1VJDA 5BP7A 1PL0A 5IC4A 2N1RA 1Q91A 1MO4A 3MDCA 2CXOA 4MUBA 3SLGA 121PA 2C9YA 2BCQA 5GGXA 1NATA 3GL9A 3HSSA 2GK6A 1YTLA 3MTDA 3TQIA 4CR7A 1LNQA 3WJAA 2R8GA 1ZOOA 4X91A 4CQMD 3IAS1 3PR2B 5LQAA 3QWAA 3E7PA 3AP2A 4MQ5A 5K51A 2ZBPA 5LMUB 3FWKA 4UD2A 2HWXA 1L8LA 3RR8A 3L4BC 3URKA 2QARB 2V55B 1J8DA 3GILA 2CFOA 2V9ZA 1ULHA 4GR5A 1QCCA 4XJTA 3ZGLA 4AFNA 2KZMA 1YIDA 4CKWA 2QQ5A 5EJ6A 5JY1A 2A5DA 1H0KA 3DNPA 3EIQA 3TL3A 1JA9A 4DNPA 1YNSA 5B30A 1B76A 1XDDA 2CZGA 1JBKA 3F2BA 3BWMA 1H8ED 3IT3A 1JX6A 5TRTA 1EFHA 3BK7A 3H9CA 4EYQA 1NYTA 2V8BA 2I9PA 2P6OA 5EJEA 4IJQA 4TTQA 3L0YA 2HD4A 3DZFA 4HX9A 3ZS9A 4CKEB 5FOQA 1PVDA 1D9XA 4EYSA 1K75A 1H66A 4R83A 1P19A 3NLLA 4S1WA 3NC1C 3WQQA 3O2QB 4DCUA 1T7PA 4AT1A 1QHHA 3ADDA 1SL1A 1W4CA 5EVCA 4A91A 3LZCA 2XUFA 3GW8A 2Q6TA 2NZXA 2HUNA 1R4AA 4M83A 4X24A 2F3TA 5CT4A 2VTBA 3CLSC 2JEZA 2ZIWB 3K05A 5EZ5A 1COWA 4LBVA 2VP3A 1YBHA 2WBLC 2O2JA 2YHIB 2ONKA 1E96A 4ZI2A 4DQSA 2SCUB 4F5EA 3FMGA 1FB5A 4FMPA 4HUQA 1NVXQ 1UUFA 5D5PA 4ETIA 3QVTA 2FZKA 2BFEB 4QJBA 3DAOA 2RD2A 1CX9B 1Q3VA 3OT4A 3A7DA 5HCNA 1P8JA 2G0AA 1RI4A 1RC0A 4JYMA 1XKXA 2VJQA 2W6PA 1C1DA 3D8RA 4GOXA 1G41A 2A84A 4GM1A 1Z19A 5E2BA 1V8BA 3C4VA 5BXQC 1OH8A 1O6GA 5T4BA 4CIDA 3QUQA 5EJFA 4DG8A 5E3HA 2EQBA 3KKAC 1ORHA 3HDQA 3OQHA 3PCRB 3V4OA 1P91A 2QVXX 5AKYA 3GGPA 2H5XA 2PRKA 4O08A 2NYVA 3WNZA 3ZY3A 1NZPA 1U0FA 1KAOA 1M2NA 4RQ8A 2EW2A 3G0DA 4K6GA 5AD1A 4E33A 1GDTA 2MINA 2IUTA 1RPLA 1TCVA 1UKYA 3I4LA 3HY3A 4FQ8A 5FAXA 4QZDA 1XD8A 3W3AD 1M34B 4FYVA 4X1YB 1I24A 1DAMA 1DDGA 2WYIA 4YB8A 3OA0A 3AG6A 2AMVA 3EE6A 1FBNA 4ND7A 3S44A 1DE0A 4BOYA 4E3WA 1J5EB 3K9QO 1JEQB 1QM5A 5LYJB 1TO6A 2WK1A 2GS9A 4UXHA 4DS4A 3MTQA 4OXXA 4J2OA 1N6KA 2RBGA 3RYIA 2HRQA 3NRCA 4YRKA 1NJ6A 4MRMB 1EFAA 3IBTA 5DE3A 1ORIA 3TLJA 2FV8A 1KEPA 3HCFA 3NOQA 5JAPA 3E27A 2DFNA 3LG2A 4B82A 2FPIB 3CWCA 3UXOA 2BMAA 1A9YA 3DZGA 4RYLA 3UJPA 5JALA 2VCYA 3FYHA 1CJVC 1DWPA 2HU5A 3FBWA 1K6IA 3FWHA 2X0JA 2QP4A 4YCAA 4UHJA 5JO9A 3OSZA 5T5QA 3Q8RB 4NFSA 2VJLA 3C24A 2RHLA 4F71A 2FMFA 4GS5A 3J81A 4MUAA 3DUFA 4MTCA 3SXUA 2ZSAA 2ZT5A 1QFZA 3KOYA 3OQVA 5FLKA 1RWXA 1XZAA 3L93A 4ES6A 1SM4A 4IL6U 1DRWA 3EGIA 4NESA 2J0SA 4JNCA 4EEKA 3GLUA 4YYZA 2D59A 3H86A 5E2IA 3SM3A 2OXTA 4NCAA 1NSYA 5E4TA 3G7UA 2ZP1A 2ZWMA 2JGFA 4HGOA 3ZCRA 4CUZA 3DOOA 2QPLA 5SZJA 2QB1A 1VSQA 2DBQA 2FW7A 5J2DA 2Y0DA 2JLVA 4F8EA 5KNCD 1LX6A 3S29A 4G1MB 3HB9A 1QX4A 1MFPA 3BWEA 3JU3A 1IH8A 8ABPA 1JIHA 3GIMA 1EA7A 2HMXA 5C2JB 1NXSA 3MS2A 1L4UA 5DX0A 1T2AA 3HDYA 3I05A 3U13A 4E30A 3ASZA 5J40A 5IJWA 2QL6A 3I09A 4DR7B 3HCPA 3F2CA 2PRSA 1SKBA 3DEHA 2QW8A 4KUEA 3TGPA 3GA7A 1FNSA 1QGUB 2P66A 3RSGA 5EMMA 2QX7A 2IEBA 4Y18A 1WMFA 1I33A 3ZUGA 1GU7A 2DXIA 4RKEA 1WV0A 2XT6A 4G0OA 4MPRA 5BWLA 2OR3A 4KBYA 4P3NA 3IEXA 3D1JA 2N46A 4EQ6B 1IM4A 4BB5A 4FFPA 3CKMA 1NP3A 1WNFA 3OTWA 5HSGA 3LK6A 2B20A 3FVRA 1QONA 2H07A 4MGEA 3IQWA 1X1DA 1Z7EA 4FZNA 2WSSA 3JWIA 1CS4C 1MJHA 3G2NA 1V71A 3IT0A 3NHSA 7ICHA 3RV3A 1T1SA 2GZ2A 4XWTA 1OYVA 4I3GA 2Q0ZX 3AH8A 3E8SA 3WL5A 3FRIA 1G20E 2Z6VA 1Y6GA 2WJHA 1O5TA 1RLTA 3ANTA 4N01A 4F46A 4DAEA 1L8QA 3CZRA 3MAJA 4AWAA 1AQUA 2XKJE 3WWPA 2HH9A 2ZYIA 4JXKA 4KLQA 5DTIA 1Y6JA 5AJUA 3RS2A 1D1QA 5B5SA 1Z28A 3CPEA 1JIKA 4JC4A 2A1AA 3Q5EA 3QA3E 1AUVA 3IYLW 2NTJA 1X7YB 2WD7B 2ZBUA 4HGPA 4EFMA 3IEMA 4GI2A 1YE8A 2F90A 4G37A 3O4IA 5HFNA 4EHFA 1CIVA 4P3YA 3FI9A 2JI9A 1PGJA 1U8ZA 2JFWA 3KBBA 3JD4A 2AU0A 4FN5A 4D43A 4WEOA 4EAQA 3IP5A 1NFRA 1CERA 4UCFA 4NU0A 5GJVC 3GFPA 1HDYA 4JQCA 3H7IA 4XB6B 1G2OA 4F84A 3RH6A 1YQGA 3DAYA 2P2CA 2OA0A 2OFWA 4K9KA 5BO5A 3VJMA 1BX1A 2PXXA 4QECA 4HT3B 1AGNA 4LWZA 4WLNA 2JLYA 2QYOA 2OXFA 4LOHA 4R31A 4IF6A 1DRJA 2EKBA 4QZAA 3SEIA 2VXOA 3D3WB 5AVOA 5T64A 1CNEA 4MV9A 4UHCA 1HNZB 1LLQA 1A8IA 5B6IA 3TKLA 3RVOA 4E2WA 4QQFA 1T2VA 3LYHA 3HDGA 3EG9A 4WLVA 5AW9A 2D1TA 1XPJA 1J2UA 3EN0A 3RS0A 5DHPA 4YMLA 4BZPA 1CNFA 2JFQA 3IDFA 3PRHA 3RRJA 4AWBA 3WK5A 4HQFA 5CXSA 1TKRA 5JH7A 4TLAA 4GKJB 2ZLBA 2EHDA 4NL9C 4OGKA 3N4MB 3EDRA 1JJ7A 4R8KA 3ZWNA 1J8YF 3DTVB 1L3SA 1VHJA 3GARA 3QX8A 3HKBB 4C43A 1XAHA 3W6NA 4GQAA 2P6PA 2OOKA 2X8LA 3PXUA 4B3IA 4ECEA 5J1SB 3F46A 2XWSA 3LNCA 3WFZA 1MR3F 2A4KA 3IMFA 4WCFA 4IY1A 3BWCA 1B74A 1JHUA 2EZTA 2GPJA 2AI2A 2IYZA 5C18A 3IIJA 3THXB 1ULAA 1KH2A 2PO7A 4R40A 3LWZA 2AEEA 3GMIA 1SCDA 4AZ3A 4BB0A 2YY6A 1NMXA 4OQ4A 3PDCA 4E0DA 1PWYE 1VI5A 3AXSA 2B34A 3UH0A 4DA6A 5J2HA 4MUXA 3T54A 3ZXUB 3PNCA 5YASA 4JBHA 3LUFA 3PGA1 4LCJA 1J0AA 1YI1A 2JR5A 1EI9A 2QW0X 2HSEA 4F9EA 4ZAWA 2RMKA 3AQEA 1Z56C 3T5MA 2H00A 4QPNA 2C77A 2VQSA 3LKZA 2ZAOA 4KVZA 1KZ9A 3RKUA 5KVSA 1E4EB 1YHYA 1HDIA 4G0QA 4X84A 4AD8A 5CYPA 4M47A 1NMEA 3QENA 4MHTA 2AXTU 1I2BA 1RD4A 4KLOA 1Z7GA 3HN2A 1NTOA 1T0JB 3BL8A 2KHQA 3KQQA 2G5TA 3M4JA 5JXJA 2Z8XA 2E5WA 4E6PA 4Q7LA 3ROXA 1RCTE 1FF9A 4I4IA 3T3EA 3OHAA 2JFYA 1KRXA 1QG4A 4RPYA 1ONOA 3I9KA 4YEDA 3BE4A 3BMNB 1Q11A 2G9UA 4P4OA 4MS3A 4J0EA 1SO8A 2NW6A 4FU0A 4IICA 2ENWA 4B6QA 3K0AA 3U3XA 1JLLB 1QIIA 2HSDA 2XB9A 4LOAA 4NDAA 4R8SA 1N9ZA 5KT4A 5BORA 4ISBA 3KPJA 4CM6A 4HN9A 3MCUA 8ICUA 1IY1A 1P0PA 3IUNA 5K3EA 2YQZA 5HNKA 1BDBA 2BCGY 1QK3A 1XZPA 3SXJA 2JGMA 4XZ3A 4GMDA 1N8NA 3CLSD 4E88A 4D3DA 1YDWA 1O6BA 4YRZA 2Y9TA 4GWLA 4PZPA 5DM60 2LKCA 3H4DA 4YDSA 4DPKA 1LBSA 3PGXA 4JBIA 5IAGA 3TLAA 3V1TC 1TZBA 1O03A 2ZJ6A 3CX4A 1Z3IX 3ELWA 4GU5A 4INPA 1RBZA 1NM5A 3KT0A 4PRZA 4A0FA 4D9HA 1MJFA 3DAFA 3OM1A 2ZRHA 1TAUA 2HHSA 4BN0A 3LHFA 4Q4CA 1UAAA 2WZDA 1YRWA 1ZJ5A 2UUOA 3AEZA 4M76B 2Q21A 1WUIS 4L8VA 2W48A 3L4EA 5KS2A 2Z4RA 1VIYA 4C80A 2YMQA 1UPUA 2EKLA 2VF5X 1XR3A 1AXEA 1RJDA 3IEIA 3QBJA 3ACBA 4GOOD 3C98A 4LE1A 3G6VA 1SUDA 1RYHA 3O5AA 4YR2A 3M6FA 3C5VA 4JR1A 3RAPR 4QUJA 1N9GB 3PGKA 1MA7A 1DIBA 2X9QA 2OSBA 1DAKA 1WX1A 3AVOA 1JI3A 1WM1A 2RH8A 3GPCA 3H5OA 1H1DA 1E7SA 3BS5B 1XAJA 3LRPA 1Z4JA 4ZKEA 3UFXB 7YASA 3T7DA 3GQCA 2ZVQX 1S10A 3B6IA 1L3VA 1YQEA 4QDUA 3KVYA 4TMYA 3ZWBA 4JI2B 5SV2A 2P4SA 3GLRA 3LOQA 4BMYA 1XOIA 1IM8A 2W0SA 1RHRA 4DIFA 5IAAA 3HU1A 1YC5A 4P0PB 1LDNA 3I92A 2XYGA 3SF0A 4CGZA 4FHGA 4JQZA 4M1WA 1M72A 2QLJA 2AN4A 3MD9A 3K4HA 4ND5A 4PG5A 4WN9A 3W1WA 4CBVA 1VL6A 4DKXA 2A1UA 4M9RA 5GM1A 3PLRA 5G0TA 4PG7A 4EMTA 1SY7A 2C4NA 5LIRA 1GRRA 4QUKA 4RNDB 3VDQA 3KB8A 4ZZ2A 2J7PA 3DCNA 3HUTA 1QH8B 1GAWA 2XOKD 1VL2A 5CLHA 1JSCA 2QV0A 4QDOA 4LGVA 1NT2A 2VVTA 2WM9B 3HLKA 1JXAA 5FOTA 4ID9A 4FJ0A 1VGQA 3EUWA 5AXCA 3N8KA 1FSZA 4L15A 2V7QA 2X5KO 1AX9A 3TOZA 1V7ZA 1VYUA 2HLDA 4UPVA 4HQ0A 2Q4BA 4KMUA 3O82A 2ZBGA 3CVVA 1NGSA 2Z4SA 3L7BA 2HW3A 2OXCA 1UBUS 3DL7A 1SCKA 2JLCA 4IVQA 3UHFA 3W9SA 1Y34E 4HLUC 4O3NA 1WABA 4OFXA 3S8MA 5AIBA 5HILA 5TT1A 5JRZA 1LBQA 2HJRA 2IE0A 2XTZA 2E8NA 4Z3DA 3PUKA 3VR3A 3Q7SA 4XOUA 1RM3A 3IGFA 2FRDC 1QHYA 3UXPA 1T6BY 1UJBA 4DC9A 4CI0B 4ADSG 1OZHA 4CF4A 4OP3A 2XGJA 3G9TA 4LI0A 3T5BA 3U49A 3V2IA 4DADA 3V4RA 3PD0A 3C14C 4EKEA 3CLVA 3K6JA 3PI6A 3CUSA 3V5NA 3H0CA 3K8QA 3DVQX 1T5TA 3CLTC 3KTFA 3KJQA 5I3CA 2R6DA 3D3EA 4MW0A 3FYSA 4TS1A 1OXXK 3PHJA 1VKOA 3OPVA 4BP3A 1TK5A 2VZEA 1OC4A 1L1QA 5ELXA 5KFUA 4KSCA 3KYCA 3CW9A 4NMLA 1XXLA 1NKCA 2BM1A 2XECA 3W5SA 3KQPA 4E7PA 2XODA 4H0NA 5SZKB 3E9DA 9ICXA 1TU3A 1P2VA 1HT3A 1PR9A 2VQ6A 1TYDE 5ES3A 4D57A 2W9MA 1GADO 4PGAA 2ERYA 4BJ6A 5AKXA 1R2QA 2DERA 3MCVA 4WK2B 1DKLA 3FTEA 5ANRB 1DRGA 2OBLA 1YACA 2X19A 1U1DA 5CGZA 5FJIA 1YU6A 1M1ZA 1J8MF 3KR0A 4BO8A 4F3NA 2OV1A 4Q3BA 4YBRA 4GZ6A 4WL0A 3L77A 3PSIA 5K8UA 9LDBA 3PKJA 1OREA 2W42A 3ZVNA 4S0ZA 2IEAA 4JB3A 3E7WA 2W9CB 1TW2A 1X8JA 3D7LA 1L5FA 1BH6A 3GROA 3MFYA 3OEWA 4G81A 3R6DA 1U8TA 4MRSA 3UCXA 5EJ9A 4QXMA 3BH0A 1STOA 3M33A 3QJYA 4HYYA 4ZYTA 1I5EA 4ZVTA 5KOJA 3ZVKA 1U04A 5ARCA 1M2KA 2GN9A 1WU8A 5DHTA 5E9JA 1TD9A 2YOFA 1E1DA 2WT8A 1DQNA 2CWDA 5EPOA 2W9BB 1SBCA 3RW9A 5EOZA 2AOUA 2R6GA 1ZR2A 2YB1A 4GMFA 3HG7A 1QIJA 5E6SA 3V1MA 2WYOA 1GZ4A 2QN2A 3WGQA 3QVXA 3DZBA 5GTIU 2I71A 2IYYA 4TKUB 2H85A 3TW8B 5DMHA 1PZXA 3C6MA 3QEAZ 4MWEA 1K86A 5A0FA 2AZMA 2ZQYA 3C2MA 1DBVO 3LP8A 5KSPA 3HCCA 4DMFA 2W58A 5E1BA 2FE4A 2HHLA 5IUNC 2XMBA 2AHOB 1W6UA 1SKQA 2F3QA 1EG7A 4G89A 4WASA 1T1JA 2B7CA 3F2IA 2AYZA 3FPCA 4HN2A 5ENVA 2OQVA 3X1XA 1XRJA 4DEYA 2BT4A 3N59A 2AW5A 4CE6A 3QVLA 4INZA 5EXEA 1WD5A 1LTQA 1P1RA 4D56A 2J6BA 1IBKB 1XK7A 1RWOA 1KI4A 1WF6A 3OIDA 3OG9A 3AHFA 5D5HA 2PLFA 4M38A 4E22A 4ETMA 1MTZA 3REGA 5CAEB 1K7SN 1RRKA 3E03A 1KPGA 5F5XA 3HJNA 1WCV1 4MUMA 1A71A 2GBLA 1VLVA 3DR5A 3FCEA 5TJ9A 1T3ZA 2IL1A 4B3GA 2WVGA 3H5LA 3MTBA 2H2GA 1GQFA 2PA0A 2FLVA 2YBDA 1AHIA 3BF7A 1JT2A 1R5BA 2DR0A 1P75A 2C5BA 2Q5EA 3NHUA 4F1JA 2ROQA 3VPSA 4DJFC 4C07A 2HHQA 4M7WA 3VKUA 2XEDA 1FVXA 2VDOB 1CR1A 4NK5A 1X70A 1JPNA 4E14A 3U4MA 3NTXA 4H7EA 5HE9A 5LL6P 3AR7A 4B47A 2GJ4A 4N8DA 4QU5A 5K3CA 2D7JA 5A6SB 4ZK6A 2FPPA 2AE1A 2GJ9A 2W6ZA 3G2PA 3A1FA 5KYXB 5U4XA 1FPMA 1SA0B 2ZE7A 3F78A 4PGMA 1YBVA 4QC2A 4B3DA 3I9NA 4PLZA 2JHGA 4DRZA 3PQ3A 4QIHA 4RUCA 2RHBA 3DMGA 4QODA 4OYYA 1SVOA 5D01A 5IIOA 4ZOEA 5BN3A 3ZBTA 1PL6A 2WSYB 1JR3A 3KOXA 5REQA 1M0EA 2IZ1A 3UAOA 2IYAA 1JQJC 3CP8A 1GTJ1 1E1RD 2FWPA 2VT2A 1U0RA 2N1BA 1X0VA 4UJ3A 3U3JA 2E5SA 2WAAA 2JIZD 4DWWA 3RFXA 4XVQA 2Y9MB 4HDOB 4JROA 3UH1A 4WJLA 3AV0B 4QRDA 3PTLA 3OM0A 3LDFA 4MRVA 1H2HA 4ZT7A 2NZ8A 1KI7A 1MQAA 3R3ZA 3W2GA 2ZUDA 4TT3D 1NRXA 3EQ9A 2Y9UA 4UNRA 2FW8A 2YXDA 3TL6A 2QEQA 4OJTA 4M7PA 4ED6A 2CK3D 3BGIA 2NO5A 1OVMA 3FWZA 2PK3A 4E2ZA 2QD5A 4EZ9A 1FP4B 1I3CA 4OJPA 5EWJA 1TM3E 2V6MA 5HS4A 1QIFA 4R0NA 4D8XA 4TQGA 4ZGGA 1JXOA 2JHAA 4O25A 2R8XA 1XTIA 4Y30A 4MW7A 1WU7A 1PVPA 4AUKA 2VAVA 4I6EA 1ZNQO 1E3DA 3RHFA 1EX1A 3UJ3X 1KXJA 2VATA 2R9VA 3JZDA 4HATA 3VR2D 5KTNA 3AW8A 1FYXA 3GP5A 3JV7A 1PTJA 3PDJA 4ZPXA 4A0RA 5TQJA 2KP7A 2YINC 1KFJB 4NLKA 1BJKA 4ZAXA 3GJRA 4H35A 9ICUA 2R2AA 2AJ8A 1AKYA 1ZISA 3B89A 3ZXSA 3K0KA 1M2FA 2I34A 4LQ4A 2YMLA 1XCJA 2ECQA 1Q3TA 3DPUA 4BRWA 4L75A 4XSVA 4DJEC 1DARA 4CCSA 4ZANA 5AM0A 2ABWA 3BSYA 3E2EA 1KK3A 1ED1A 2D1FA 2D5CA 3EZLA 3K9CA 4CUKA 2GBFA 3EGXB 4M1QA 4P22A 1R5OA 3OD1A 3FCYA 2GXQA 2P0YA 2Z2YA 5HTKA 3UHPA 3PCXA 4BZQA 4DM3A 1EUYA 5LA6B 1E2EA 4YAUA 4O3FA 2WYWA 3WKAA 3T9EA 5AXBA 4ITUA 4XDGA 4BMCA 1HM5A 5BV2P 4IJVA 1GPNA 1VKJA 3R6TA 4UZEA 4BB6A 3NOVA 4CQMB 1Y8AA 4HUTA 1NF2A 5EJ4A 5LCXA 4F5DA 3HA3A 1QAOA 1W36C 4NY1A 1JQAA 3A1VA 3UAYA 4PGQA 3JQPA 1KBQA 4NL9A 4B46A 9ICNA 4NNJA 3F6SA 5DCUA 5JYCA 1LBTA 3A6DA 3BQ1A 3KB1A 2W2KA 4O4HA 1H8EA 5B7NA 2HREA 3VUEA 1U9LA 1C8BA 1L4MA 3QQ5A 4Q6WA 4KLIA 3C3CA 5KFZA 3IBFA 5KT6A 1QZZA 1MQSA 4TUYF 1FP7A 1G5HA 2K2WA 2LRHA 2Q2QA 3IVCA 3OMXA 3RU2A 4B87A 4B5KA 3AKCA 1RZ3A 1SCJA 4O5AA 4PYKA 3WB9A 2WY2D 2HY7A 4KW7A 5KFXA 1M1YE 1WVMA 3AF4A 4J43A 4MRNA 1BWSA 4II2A 4KSBA 3WRXA 1JQBA 1JR2A 1V1JA 3ZCUA 2AMFA 2W2OA 3A2LA 2VHQA 2OFOA 4PPGA 4QPJC 4C8KA 4YLYA 4ZZIA 3MTGA 4QZCA 1GTZA 1G8JA 1WOYA 1KKUA 2N42A 3BTSA 5AR1A 3RC2A 4K9OA 5KKCA 3CJTA 5KNDH 4GMKA 3LM8A 2X58A 4YG2A 5BQXA 2DJIA 2FJ0A 2IZ6A 4MYRA 3ZDDA 2IPOA 4TM7A 3HN7A 4CQJA 3PEYA 3KHGA 4B2LA 1V8ZA 1FP2A 1XDBA 5BMOA 3H4BA 2C8VA 2P11A 3VR6D 4AL4A 3V2GA 3VJKA 2PMEA 3EZ2A 3LOUA 3BK2A 3VX3A 1GZ7A 2YV4A 2HWUA 4QL3A 4OLFA 3AIIA 3QFFA 3QIAA 4LVUA 3PRYA 1J1UA 3JASA 4C7JA 1RFLA 2VP5A 5BV8A 1HK7A 4XIGS 2PS1A 4IJ5A 3RLIA 1J1ZA 3GRYA 2XGOA 5KTTA 3K1RB 1E79A 1HY3A 2EFHB 4O8CA 1DC5A 3HCNA 4AO8A 1NXXA 1BHO1 2CSUA 2H52A 5JWRA 4TL6A 5EEHA 1E0DA 3AR4A 4N1AA 2C7QA 3ETHA 2Y1IA 4ZT2A 1JALA 1Q14A 4RH3A 1GKLA 2J46A 4FZLA 2PMKA 4LBYA 3UUEA 3NP9A 1Q3HA 4IQUA 2J3MA 2VYVD 1U45A 2WM3A 3EUFA 4I2HA 1J23A 1V4VA 4LWQA 2CXTA 5E6RB 4C2BA 5BSHA 2DPHA 2ZWVA 4IDDA 1I6KA 4RVDA 3DLHA 3LGSA 1GZ6A 2YICA 2QGZA 2WTBA 2VIXA 1IMJA 1UOPA 4MLZA 2PFSA 4IMJB 3TR6A 3UMJA 1QGZA 2ZM6B 4LHWA 1J4AA 3B70A 1GOTA 4NHOA 4DLRA 4L22A 4L72A 3NVDA 1I7SB 2FWMX 821PA 2PKCA 1ML3A 3LIIA 3CVUA 1RQNA 1QVRA 4JNKA 5ELMA 4QUDA 4LF9B 1ZIOA 4ED2A 3QE0A 4LECA 2O8EA 3R4VA 4N7BA 3E22B 3EIFA 3K0HA 2RAVA 4M46A 4MB6A 1DCKA 3SX4A 1RKBA 3BRSA 3WDMA 4HYQA 5IZCA 3KAQA 3EIUA 4WVLA 5H0IA 5J23A 3AVQA 9ICEA 1MV5A 1B73A 3BS7A 4YAGA 2GJKA 4XPIB 1C0PA 1RI5A 2AOXA 2PT7A 4NM2A 2JI7A 3COSA 1TMYA 3BE6A 2OV6A 3NBQA 4LSMA 3UUGA 5CBKA 3H42B 4ZJZA 1DC8A 4IEFB 4IJKA 4B40A 3QEOA 3VPCA 3QA9A 2P5TB 2IV3A 4YJ2A 1UBEA 5IM4A 3FKQA 3MW8A 4G5QA 1I3KA 4B4WA 1AMNA 5KFTA 4J9QA 2OMKA 2Z43A 1K89A 4B1FA 3AR5A 3UWSA 2I4TA 2YY7A 3L8HA 1JQEA 2Q3EA 3DBVO 1WXHA 5IG2A 5CB4A 4WAUA 4DXDA 3SXPA 2D2XA 1SELA 4O1HA 3SX0A 4EJMA 4U00A 1WZCA 4HCJA 3KYDA 4BXOB 2X6QA 1HIWA 1LB1B 3QY9A 2YJZA 5ER6A 3K5PA 1XS9D 2MSWA 3EBOA 3ZJTA 2X4LA 5KT7A 4ML3A 3V9AA 1QXSA 1JQ3A 1IEXA 2ATLA 4IXWA 4PEVA 5B57C 2P9ZA 1LGYA 1DTWB 1A1SA 1NX6A 2NUPA 1NE2A 4NIMA 3QFCA 4YJHA 5EZ6B 4PFQA 1HLPA 4DV1B 5FUWA 1TTTA 1XI2A 3F8SA 3FF1A 4LQCA 1LWNA 3M4XA 5DLDA 3FNQA 3M3DA 3QWFA 3OQIB 4MZDA 1DO2A 1DRVA 2L69A 1AG9A 3B7GA 3UQ0A 1LPSA 3L0IB 1Z00A 4ICIA 4Y6RA 5DLYA 5GPBA 4CIYA 3GZFA 1B0UA 1KHTA 5K5EA 4HB2A 9ICSA 4TN5A 3RJHA 1JFRA 4CLEA 3GIDA 4MP8A 1U98A 2H1WA 1EGHA 2V0NA 2XR1A 3BZUA 3DDSA 2QT9A 3KU1A 3NCHA 4FKMA 4KHZA 4W9RA 1V5FA 5B2ZA 1XPOA 3NT5A 1NSFA 1YIOA 3ZWDA 5DNEA 1U7WA 5G02A 1D9FA 3L46A 1X3SA 2PPVA 2QN9A 3QJGA 2MSLA 3OQIA 1F20A 4AF8A 4LNHA 1QSGA 1NQOA 1BMQA 4OUDB 2YFYA 4QGBA 4G0MA 5EJIA 2Q2WA 4GSYA 3D9QX 2H92A 4FZMA 3EGDA 3I45A 4RVOA 4KB5A 1DUSA 5TF0A 5EWEA 4BQOA 4JJ4A 3MJCA 4O9MA 1R9MA 2P2SA 4MIOA 4W5JA 4B34A 2J9FA 2V0GA 2P9JA 4BCBA 1BXKA 1SG6A 4EZ6A 2UZAA 1I2MA 3I39X 3PV0A 3GEBA 3WGTA 5JS2A 4N9WA 4CMGA 4RVFA 1YVPA 5JJLA 4YP3A 4LRTB 1YH3A 1CUEA 1VLJA 4B9LA 2CV1A 1XZJA 4RNCA 4HNUA 2A9RA 3F7OA 4L9SA 4KQ2A 1ZK2A 4HF7A 2H7VA 1QQAA 3GLGA 3JQCA 4G4JA 4O59O 2E37A 5JSZB 2JARA 4JBXA 3LC2O 1ZEJA 4NJMA 1D4ZA 2XBMA 2ZB4A 2O8DB 3ORYA 1GXSA 4FYYA 4V1CA 6NULA 2B6NA 2QTMA 3DBIA 3RJTA 1HR0B 1O77A 2F9FA 2GWRA 2BGMA 4KXYA 4BLVA 5J58A 4UM9D 2FW1A 1HNXB 4G41A 3FSEA 3WK6A 3H2SA 1VG8A 3LUPA 1WDLA 1XTSA 4ECUA 1GL3A 5IEBA 5LUBA 5FPKA 2R5FA 1Z6AA 4NLZA 2OLKA 3BD8A 4HQLA 2KJ9A 1WJGA 3I62A 4LDPA 5GINE 5CIWA 3TZEA 2CNNA 4H3KB 2PMDA 3V4ZA 1O0CA 1BN6A 4PZ0A 5AYVA 2QQ0A 4N8SA 4DLGA 4S1OA 4YJFB 4DA8A 1XJWA 4KRFA 5F76A 3ZW8A 3EY4A 3PRKE 3RFVA 1G2QA 1YQXA 3L1HA 1L5HA 4M0EA 3M1YA 1LQUA 2W0MA 5ALOA 4D9IA 2E4YA 3ETDA 3GUUA 2BC9A 1IEVA 3LX5A 5G53C 4G0VA 4EMUA 5J0SA 1KTQA 8ICPA 4JLUA 3OSNA 2FFBA 2H5JA 5FJJA 2JAWA 5MGNA 2WKWA 2QROA 3EQ7A 2CMDA 2PJZA 4NS4A 1N2CE 3E70C 3RVQA 4G5OA 4HDAA 4FC6A 4F45A 3O4JA 5BQPA 3HJFA 5B3AA 3GD5A 2WU1A 1QOPB 2MUTB 3AU6A 7AT1A 2WWHA 3MWDA 1E4VA 1JQDA 5CLFA 3CGGA 5IH7A 3KXKA 2OCIA 2WJGA 2ZJZA 2QR5A 2X9LA 4X1KB 4I14A 2VJKA 2PL5A 1UXHA 2ENUA 3GFVA 4OQMA 3GLGE 3LS2A 2PIDA 4BLQA 1QVVA 4DBVO 2VZ9A 3AF1A 4DHWA 2LGJA 2WUVA 4OEHA 4H59A 4XASA 1UJ5A 1AQNA 1ZY2A 1VKHA 2EQAA 4YAOA 1NN0A 3RB4A 4O0LA 3PSPA 4L5AA 5EZYA 5FULA 4DCSA 4CXMA 4I2FA 3WJ7A 3L9WA 1FE8A 4PZYA 4RKYA 3V6KA 4GF5A 4Z0PA 4C3ZA 4AY2A 2Y1OA 4BNLA 2B3TA 2WYVA 1ZMRA 1VIAA 3D0KA 4J0QA 1ENZA 4AG3A 4TV9F 2JDIA 1XFAA 3KQMA 5GVRA