4C4SA

Structure of beta-phosphoglucomutase in complex with an alpha- fluorophosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
215
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 76
structure length 215
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4sA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4sA01
2B1RA 1S8OA 4C4SA 2HF7A 1RLTA 3ZUPA 3ZTWA 3ZX4A 1LVHA 5AVQA 4NWIA 5ALEA 1N9KA 5ALYA 4NFLA 5AKYA 1VFPA 3F9RA 3R9KA 2PR7A 4BX2A 2C8KA 1RKUA 4CF3A 5ALZA 1J97A 2HCFA 4YIKA 4RETA 2JARA 1J8DA 3KDPA 3U7HB 4Y2QA 2P11A 2YJ6A 3RF6A 5AKEA 1Z4NA 3CZ4A 3AR9A 4BKMA 1JUDA 1QQ5A 1IWOA 5AW3A 5AW6A 5AW8A 5AW7A 3I1YA 5AM2A 1F5SA 3SKXA 3DV9A 3B8EA 3OCUA 4DCCA 5AKGA 2IA5A 3SKYA 3UM9A 1S2OA 2HHLA 2MSNA 5ALSA 5AHXA 4XOUA 2G07A 5AKZA 1RLOA 4OFZA 3N8GA 3OCVA 4Y2PA 2AGVA 5IS2A 3QUCA 2HF2A 3QGMA 2G0AA 1Z4KA 5AW9A 1QYIA 1WVIA 4Y2YA 3L8GA 4HYTA 3U13A 1K1EA 1Z5GA 1ZRNA 3EWIA 4G63A 3ED5A 3IRUA 4JDPA 3SMVA 5AI9A 2B0CA 3WKEA 1KYTA 1RLMA 5T41A 2BY4A 5AW0A 4IFTA 3IB6A 1FEZA 3QUTA 3L5KA 3FPBA 4GXTA 2R8YA 3OCWA 2GHQA 2G1AA 5FP0A 4RESA 5ALGA 2WM8A 2YMPA 3PGVA 3VAYA 1TJ3A 4Y2TA 3UMCA 5AVZA 2B1QA 3QU4A 2HX1A 3L1UA 3OCZA 3N1UA 5AVTA 4NABA 1ZJJA 5AIAA 2GHTA 3ZVMA 3QLEA 3HYCA 5AVVA 3WKBA 5AVSA 4FYPA 3W5BA 2YJ4A 3U7GA 5ALPA 2NO4A 2C4NA 4EELA 3U7FB 4CF4A 1RMQA 1YS9A 1QQ6A 3QUBA 4BNDB 1RPZA 1U2SA 4UATA 3QU2A 3EF1A 3ESQA 1L7PA 3ET4A 1XP5A 4HGNA 4G9BA 1MH9A 1Y8AA 5AVUA 1ZD5A 3S6JA 1TE2A 3ZX5A 1SWVA 1ZD3A 3I6BA 5AI4A 3QU7A 5AW4A 3DAOA 3KD3A 4O8CA 2WF7A 4KX5A 2FPXA 3L8EA 2OA0A 1ZOLA 2ZBDA 5ALQA 3U19A 2HDOA 5AIBA 3HLTA 4HGPA 2C9MA 4EEKA 2X4DA 2I55A 4KNWA 5AVRA 1RMYA 1WPGA 5AM5A 3ZU6A 3M9LA 3P96A 3N07A 2YY6A 2W4MA 3A3YA 2ZBEA 3A1CA 5AICA 1Z4OA 1RC8A 4Y2XA 2W43A 2YJ5A 3QYPA 5AKXA 2EARA 4UARA 4Y2UA 5AI0A 4EX7A 3KZXA 1RRCA 1U02A 3EPRA 1EK1A 3AR2A 4FE3A 1Z4IA 2ZOSA 4UW9A 1WR8A 1QH9A 5AKKA 2WHEA 5ALFA 5ALXA 4PNHA 5AVWA 4BYGA 5JJBA 1RKVA 5ALIA 3ZI4A 5ALVA 4L57A 3QU5A 3AR3A 4GIBA 4BBJA 5AW2A 1CR6A 2NYVA 3ZWKA 4UM5A 4OD0A 3NALA 1U2TA 3AR8A 2IOFA 3AR7A 3SD7A 2I54A 3N5KA 1L7MA 3PCTA 3QNMA 3GYGA 1T5SA 4UU1A 2WF9A 2RB5A 4KNVA 1PW5A 2Q5EA 2ZG6A 3FVVA 3B9BA 4KN8A 2FI1A 4J03A 3L0CA 5AK6A 1ZS9A 3ZVNA 4MUMA 3WGUA 5ALNA 2Q4RA 1NF2A 5AM4A 2FEAA 5ALWA 4NV0A 1L7NA 1L8OA 2EAUA 4YCLA 5AVXA 3A1DA 5AM3A 3SLRA 5AI6A 2C88A 2EATA 3ZWDA 5AM1A 3KC2A 3L0BA 5ALOA 1U7PA 1XVIA 3KOOA 1LTQA 2HEGA 1ZRMA 3CNHA 3WKCA 3UMBA 4YCMA 5E0OA 3W5DA 2FPUA 2YFYA 3UMGA 3OCYA 2MU2A 4OHFA 4UMVA 2YMLA 2FDRA 5ALHA 3ESRA 1N8NA 4UMDA 2G08A 1RQLA 1L8LA 3J7TA 2G80A 2JAOA 2O9JA 4Y3UA 4ZEXA 4UAVA 2JAWA 1RMTA 1Z4MA 4UU0A 2HI0A 4QQFA 3WK7A 3N28A 2WF6A 3L8HA 1AQ6A 3B9RA 1YMQA 5AI5A 3ZW7A 1Z4QA 1YV9A 3AR6A 3QX7A 5AVYA 4AS2A 1O08A 3NIWA 2WF8A 3ONNA 5AKJA 2OBBA 2ZBGA 2R8XA 4AP9A 2I6XA 3RFUA 2BDEA 4QJBA 3U7EB 3ZVLA 1L7OA 4IG4A 3AR5A 5AESA 3E58A 3QUQA 2Q4TA 3ET5A 2ODAA 2BDUA 1NRWA 1RKQA 2FPSA 4I9FA 1L6RA 5AM0A 3A1EA 3EF0A 4HGOA 3D6JA 5AKIA 3AR4A 4Y2RA 2RAVA 2WFAA 1T5TA 3WK5A 2QLTA 3KBBA 4UM7A 5AK5A 1YNSA 4XQ0A 1YJ5A 4CE6A 5ALTA 2YJ3A 3W5AA 4Y2SA 2JGAA 4NAVA 3IJ5A 2MU1A 3E81A 3NRJA 3E8MA 2I34A 2FUEA 2PQ0A 4CNQA 2HOQA 2NO5A 3SHQA 3R09A 2C8LA 3L0YA 4EZEA 2QYHA 3R4CA 2R8ZA 1ZD2P 2G06A 1QQ7A 1T9ZA 4XE5A 4L6AA 2B30A 2R8EA 3DNPA 2RARA 2RBKA 1Z5UA 3TLMA 4B6JA 2CFTA 1O03A 5IT4A 2P27A 2HSZA 4UMEA 5ALUA 2CN1A 3QXGA 3L1VA 3BA6A 2WF5A 2AMYA 1Q92A 2I7DA 3WK4A 2O2XA 4H1WA 2GMWA 2YMMA 4UMFA 3WKAA 5ALJA 4OCZA 4DWOA 4C4TA 5ALMA 5AKHA 4EENA 1CQZA 5A3SA 3MC1A 4KYTA 3WK9A 3MMZA 3OTQA 3SF0A 2JAUA 4BX3A 1WZCA 3FPSA 3NANA 4ZEVA 5AW5A 2ZXEA 3L7YA 4YCNA 4F71A 4JB3A 1XPJA 1Z4JA 4BNDA 2P9JA 2FUCA 3NUQA 2B82A 5ALRA 4Y2VA 2ZBFA 4KX3A 5AW1A 3WGVA 2GO7A 3DDHA 1RDFA 4DFDA 1EK2A 4HAIA 5AI8A 3FZQA 4E88A 5ALLA 1Z4PX 5AKLA 3WK6A 3QU9A 3FM9A 5A3RA 3MPOA 2GFHA 2OM6A 2CFRA 3K1ZA 3NAMA 1VJ5A 2FPWA 2IOHA 1TJ5A 4BEVA 2YN4A 2DQSA 4BEWA 2W11A 3W5CA 4DW8A 4UAUA 1U7OA 2CFSA 3WK8A 2PKEA 2IOFK 4J2TA 4YH1A 4BX0A 3L8FA 5ALKA 4EX6A 3PDWA 2FPRA 1Q91A 2B8JA 1YDFA 2B8EA 4FFDA 4C4RA 2AUTA 2YMQA 3MN1A 2G09A 4Y2JA 3OCXA 3WKDA 5AK3A 3PGLA 2HO4A 2I33A 3BWVA 4F72A 5IT0A 3FGOA 3I76A 4UASA 1X42A 1VJRA 4AS3A 1NNLA 4HGQA 1SWWA 4XPZA 3I28A 1Z88A 4ZEWA 4HGRA 1TA0A 2AH5A 2YBDA 2D2VA 3ZTYA 2OYCA 2IYEA 2P69A 5A3QA 4CF5A 4I9GA 4YIHA 3OPXA 3E84A 1SU4A 4L6CA 3NASA 4YGYA 1RQNA 1Z4LA 3M1YA 3U26A 4MWOA 5ALDA 1ZD4A 1TJ4A 2VKQA 5AK4A
chains in the Genus database with same CATH superfamily
4MFCA 4ODIA 1WQ1R 2HV8A 3NYQA 3ROGA 4RZ3A 1PKXA 1ISMA 3KDPA 2IK8A 1XDDA 1E2FA 1E0JA 4BNXA 3UWPA 4J29A 1KNQA 4FFPA 3W2HA 1TTPB 1N2BA 2C2WA 5I47A 2VDWA 4K9RA 4CMKA 1SXDA 4RKFA 2JF0A 4L5AA 3KZVA 5T3YA 4GFDA 3DHNA 1JMVA 2M6SA 1G6OA 3JATB 3QVXA 4L4YA 1UMCA 1E9RA 2YTZA 2V3VA 4BBPA 3TINA 1OAOA 3N86A 5LZ5A 1Z18A 4GUDA 3B6EA 1X8LA 7ICHA 3URMA 4MKRA 3EWNA 1SIWA 3P0RA 5CCBA 4YJDA 3F0TA 5KTQA 4YASA 4TUYF 3VM6A 1WXXA 2JRCA 4CWAA 2PNFA 1Q0HA 1P33A 3BM5A 1EG2A 1S3SA 3DZHA 2H1SA 3U19A 2C9MA 3H9JA 2NO1A 1JQLB 2MAXA 2V4MA 3KQHA 2C61A 1FJ2A 3A3YA 3OHSX 2AZXA 3FJYA 1L3BA 3VJKA 3U37A 1UAGA 1ZA2A 2CZCA 2ZQYA 5TE9A 1XNHA 4J7UA 1PW7A 3M6WA 5CPFA 5JDIA 2CK3A 1I33A 1R3UA 2ATEA 4DREA 3JRXA 3SD7A 1XT6A 3OX2A 5EA2A 1PEYA 2UUAB 4OHBA 1OFIA 4QWMA 4HT3B 3AHFA 5ECGC 3IE2A 1COWA 1Q19A 2KICA 1UF9A 2NAFA 2ZSIA 1KMMA 2CSUA 3P0HA 2QYTA 4TRNA 4F4KA 3A1DA 4WESB 3CPHA 5CYFA 3IVAA 3U2QA 1CDOA 4B2LA 2PWYA 5SZJA 1D0VA 3IVCA 3JAKB 1K97A 1IZYA 4YYEA 2EDAA 2A1UB 5HF6A 5DDYA 2SICE 4B71A 2G08A 3MGHA 5FWXA 1A6SA 3IHKA 2FSFA 4MDYA 5A9SB 1O97D 3HILA 5EWLB 1WTCA 4RV9A 3M9NB 5EMLA 1NPYA 3SG0A 1Z4QA 4JOSA 4K40A 3RC3A 4F9FA 4AO8A 1L6IA 4LWQA 2BDUA 2FPSA 1S01A 4KAAA 3D6JA 4DR3B 3ZG6A 1L5MA 4LE1A 1MIOA 2VJ4A 2IXDA 3G2PA 3KEQA 4ZO7A 5TGZA 1OC2A 2Z4RA 3STXA 4OAQA 3PE3A 4XJXA 1WUDA 3I4FA 3MCAA 3MT9A 3ZJYA 2G36A 2WR8A 2PX2A 1NNEA 1TT5A 2P27A 3PVXA 1YJCA 4WZBB 5LQJA 3OKPA 3PZPA 2AMYA 1RAAA 2OQ2A 2O2XA 1DUIA 2NXJA 3EVTA 4HYKA 2X9QA 3LGXA 5TQ2B 3C70A 1VLHA 2WJ6A 2FETA 1CI4A 4U39A 1K5OA 3SFTA 2TYSB 2E49A 2V7QD 2YS7A 3BHIA 3SV4A 3HVKA 2C2ZA 2VDUE 3QEBZ 3QU9A 3N3AC 4KXYA 4XJVA 2R8IA 1JL3A 3FCAA 2H11A 4PYNA 4RK7A 3VO1A 2RH8A 3ITNA 4HQ0A 1XNJA 1PCXA 2A7QA 4ARZA 2HHCA 2JC3A 1TU4A 2H8KA 2DBYA 3UAGA 1S0OA 1JEEA 2XIQA 1OW3B 2D59A 2XE4A 2OMEA 1BPDA 4Y6GB 1ACJA 5U4XA 3GFTA 3VVLA 4W5WA 3EFOB 4NDAA 1TYCA 5LMCA 3ZE9A 1SURA 2B5VA 5T6MA 3PR4A 1SU4A 2IH2A 1NT2A 1XC9A 1ZJYA 4WK4B 2ZTLA 2KFZA 1X7WA 2O1XA 1HYBA 4JJZA 2AHRA 1BMFA 2AOXA 3B3QA 3N70A 3IR5A 1NKBA 3FRHA 1J8DA 4MWZA 3KJHA 1LQUA 1P73A 2PE5A 3V8PA 1QZTA 4Z1MA 1L5HB 1Z0UA 1WB4A 1NQOA 1T9AA 1NVEA 5LQRA 4NZZA 3VOSA 2ZDHA 1JNYA 5CT9A 2JD2A 1RRFA 1FSSA 3O7WA 3TMKA 1P7WA 2R1TA 2Q8PA 3B2QA 3KUKA 5ISMA 3O0TA 1DJLA 2PWPA 3O8DA 3GPIA 3DKIA 2A5FA 4ZQIA 3USCS 4QWAA 4RD0A 1P4HA 2X77A 2H2HA 1U0EA 4GI7A 3AL3A 2IYVA 4LQCA 4OI2A 1PDVA 2BGKA 1AT1A 5EJIA 2F2AB 1U0LA 2ZRQA 4P2HA 2C5SA 4BO7A 3R76A 1ZQAA 5BVHA 1J5EB 3P9SA 4OGLA 1Y1PA 1E2LA 2W9CA 3KOYA 5FOQA 4CL8A 3ZHUA 2DFLA 4DLYA 4RW0A 3A9WA 2EGGA 1YE8A 2RH5A 1DL5A 1JG3A 3HJNA 3FKQA 3CNLA 3HH8A 2P6UA 3EH1A 3HKDA 4B5KA 1RRCA 1VE6A 3NWEA 1CUFA 1A4IA 4YG2A 2HWWA 4HEA1 4CMIB 4NCIA 3OTOB 5KFIA 3VR4D 4TMTA 1KS2A 5TZVA 4UOZA 1BE8A 2WZQA 4YMIA 2I54A 5EIAA 4XGRA 1QK3A 3B1VA 4JJ4A 4AZ3A 1R10A 3LVFO 3TM5A 1H5UA 3CG0A 2I1WA 1YFZA 3WHLA 3CWQA 3WR5A 1VJ0A 2KZ3A 1LF5A 4R2KA 1JG6A 2GXSA 4P83A 4G0XA 2CFCA 1G5TA 1LH0A 2F90A 3L77A 6ADHA 1B6GA 2EX1A 1AURA 3PGKA 4MI3A 2E89A 1VG8A 2J3DA 3EOAI 4ELVA 4RHYA 2H51A 4UAYA 1L7EA 2CNLA 3G6XA 1A8QA 2NWQA 2H3ZA 3CFYA 1T2UA 3B1XA 1Q17A 2OOKA 1BWPA 3UHAA 3GLGB 2EDCA 1D2AA 2PRYA 1K8XB 1FFDA 2C7GA 1NMXA 1SC3A 1HDIA 5L3ZA 1YULA 1SHZA 3DA8A 4BFLA 3B48A 3D2CA 3RYTC 3ER8A 3EIUA 3WL4A 1YRQA 4RA6A 3BH7A 2GEKA 1PD1A 4QGHA 5JEEA 3PWSA 1N3YA 3ZI0A 3T5CA 2JHAA 2QRJA 5LL6P 3RTAA 4UTNA 1ZQEA 1GKIA 1W96A 3MUNA 3GD5A 4ER7A 1BX0A 5KYUA 3WDMA 1FYXA 4G09A 2PSSA 1ZIDA 3MB8A 2HK6A 2JLQA 4JI3B 2R62A 3DLPX 4C8KA 2WKSA 4J6EA 1HK7A 3DDHA 1MO4A 3ZDYB 4TL9A 3JR3A 2ISSD 3FGNA 1LNZA 2CJYA 2RAUA 2B3TA 4IV8A 2B1GA 2F9LA 4EY7A 4ZOAA 1J33A 3ZNQA 1BGXT 1JU9A 4NE2A 2W11A 2ZWIA 1Q57A 2XQJA 3F7MA 3PSIA 3B9PA 4LYGA 3I37X 5F77A 3R6TA 3FW1A 4CCYB 1E5XA 2L69A 3KQOA 4UB3A 2GR9A 3AEXA 4K9KA 4IC9A 2G76A 2V4QA 2HJRA 2PL1A 3GVCA 2Z98A 5HHIA 4KQ1A 2FPIB 5IP5A 1Q6ZA 4EYEA 3H7IA 2BGGA 4LSGA 2A1JB 1DBVO 3FG9A 4RQBA 2XI9A 2PVPA 5JD4A 3U6KA 2ZSAA 1LBTA 1N0WA 4FFWA 2C3OA 2QG4A 2W93A 1QK5A 3BQ1A 2AQ4A 2FGJA 2YOFA 4LZZA 5T8KA 4X1IA 2VHVA 5LYJF 1JSZA 4X6UA 3RVKA 1V6AA 2PX8A 5I5GA 2D54A 3K0FB 3KB1A 4KR9A 3ZD6A 3WNZA 2OUKA 5HYVA 1W0CA 4QYSA 1OXKB 1S6YA 5CRIA 3TVDA 1EU1A 2FVXA 1HX7A 2REXB 3C8HA 1ZR2A 2HNAA 1F0PA 3QHPA 3PA8A 4PLHA 1FDVA 3G1TA 3WQHA 1RZTA 3TCXB 3FPBA 3G2HA 3JQ7A 1AKVA 5J47A 2ECPA 3DLIA 3O8OB 1U5BA 3Q11A 3TBHA 5BN1A 1S5PA 1AXRA 1R0LA 2W6ID 4E4RA 3I0MA 5LUAA 5JJKA 3DE7X 3DCIA 4MIOA 1CFZA 1KE2A 4DLRA 3FOAA 5CD1A 4JI8B 3AEZA 3C6YA 3CF0A 4FXPA 1KFSA 1KTQA 4KKVA 4KX5A 5LQKA 2PS1A 3PF9A 4I5DA 3LUPA 2K5UA 5J2TB 4NS1A 4K8OA 4K9PA 3V1KA 2A0WA 5C3UA 1X1CA 2QTHA 3IHQB 5AYVA 4HZIA 1CRPA 2PDAA 1R5NA 5CIWA 2LM1A 1L4YA 1EESA 1DBQA 8ICWA 4HDNA 4P4UA 3ZD9A 4AO6A 3N05A 2KQUA 4BO8A 1XWIA 4WKPA 3VU3A 1ND5A 1BVSA 1Y9AA 4REMA 3VAZA 1TK2A 3GV8B 1WCV1 3FYUB 5FLYA 2XZLA 3AV3A 4DR7B 2GRUA 1VZ2A 4QDJA 4HNRA 1EB9A 3M4ZA 4X20A 2J9ZB 2JLVA 1GRQA 5KNIA 3A26A 1R9MA 2IYAA 4A7PA 3W9UA 1JFFB 4I1OA 4H0NA 1USWA 2QTVA 1DRKA 1QDEA 1Z5OA 2H1VA 3FLEA 3JPTA 3GG2A 4NU6A 1Z4MA 4JJIA 1LLDA 4UU8A 2HI0A 2HHUA 3L8HA 2GSDA 3DDUA 4PIPA 1L4BA 4W5RA 3KKMA 4NY8A 4L5BA 4QXAA 2CL6X 1RWMA 4PIVA 2IUYA 3FTFA 3C5GA 2ZYRA 4LCEA 2QLFA 3AFOA 1YJ8A 3CURA 4TLMB 2HRBA 3SGLA 4I4TF 2FEOA 1DWOA 2RE8A 3HTXA 2P8SA 9ICSA 4J4HA 5A5VA 1Q0LA 4U2FA 5G4LA 3PQEA 2J07A 5SYMA 2O5VA 3MJRA 4CLOB 1FJGB 3TAHA 4DLZA 3NOVA 2Q2WA 4B2YA 2VJNA 2PQ2A 1YZNA 3RTBA 1MNQA 4QJ5A 3DL7A 4R9NA 1RNLA 4L08A 4WEOA 2WTMA 3IEPA 1UPUA 1WEHA 4JA0A 4RVHA 1ML3A 1II8B 2YX1A 1FC0A 2P6OA 4ZXPA 4G1CA 2I78A 3NYIA 5LNK1 4FMCF 1JT9A 4J0DA 4P86A 1JKJB 3TJZA 3H0CA 5TQVA 2X7JA 2QRVB 3AM1A 2BI4A 2WUWE 3JZIA 4BATA 2OZLA 1UKAA 5ALKA 2ADFA 3H87A 3CNOA 7ABPA 4MKFA 3TAXA 1ZQYA 3OFSA 2WJVA 2QDKA 2P41A 1XFAA 4DCUA 1YS2X 3SLGA 3SJAA 3SOPA 2HHSA 4FEGA 5G1PA 1DBWA 2P68A 2WJGA 1R6UA 3RU7A 3ASZA 1I1OA 1MAWA 3LDUA 2X13A 5FORA 3RAEC 3ANNA 2WTEA 1O5OA 4BKUA 2P2SA 3IJEB 2DHRA 2Y99A 3G0DA 2O07A 1P9LA 1GZHB 4F4YA 3AN1A 1CQIB 2GERA 3ICWA 4G4JA 3C8ZA 4AS1A 2VT3A 3USZA 3U81A 2QMEA 5BW6B 3WAJA 1NYRA 1ZGCA 3K9GA 1TI7A 9ICIA 2PO7A 2Y9UA 1EUCA 2PN1A 1QAOA 3RS4A 2V8OA 2FN9A 5DF1A 3U13A 1D4AA 1NSYA 5FFFA 2ZSHA 5DSTA 4L85A 1XRRA 4LJ5A 4PC6A 3D2NA 4LKOA 1QC5A 4L27A 3UCEA 3WB2A 4JR2A 5FA8A 8ABPA 2LMRA 1KJWA 4CIYA 2PUHA 1RI3A 4HY3A 1NVVQ 1N3IA 4AY3A 3BD6A 4TUPA 2XITA 1MQ3A 2NADA 3RH5A 4LJ6A 4EM6A 4LNUB 1EQAA 2WDZA 3AI2A 5LKAA 4J7AA 2VZ0A 3PEYA 2PO5A 3S8MA 5KZMB 3LHIA 4CF7A 1JGTA 3P0JA 1YSCA 4JR1A 4BP1A 1P80A 1ZY2A 2EZUA 3C8UA 1QB7A 2VCHA 3ZIDA 3TG8A 4HRYA 1CUZA 4CKEB 1RJ9B 2UYQA 5BUZA 1QVVA 2G25A 2Q5HA 4IZOA 4X1KB 1F9EA 5FNZA 2JANA 5FB3A 1EJBA 4BLRA 1YONA 3Q7TA 3GT3A 4C0SA 4P84A 4MYTA 1KETA 4M37A 3UA3A 4EUNA 4XFJA 5CVUA 1R9NA 1GLGA 1GJRA 5DTQA 3HBJA 1CR2A 3D5TA 5L1KA 5J0RA 4UKDA 3PKZA 1KBOA 1VSQA 4AMGA 2VAPA 5CNJA 3AIMA 1C1DA 2AWOA 2ZBPA 1U9YA 4JMPA 1A1SA 3PUZA 3BZCA 4C6SA 3T5AA 2ATXA 3DT6A 5JRTA 2Y0BA 2W8BB 2W9AA 3W77A 5BR4A 1NTRA 5EXEA 1WPXA 3CX3A 3NHZA 5CVTA 2WG2A 2EL7A 5EMNA 1GGKA 4LRSB 1RM5A 1X7DA 4RD6A 4AU1A 6REQA 3RU3A 1SKWA 3UCXA 4HXGA 4DDVA 5JS1A 1QAMA 4GPTA 1WCXA 8ICMA 4PAWA 4Q02A 1ZZEA 4RY9A 4K5QA 3EMDA 4ECYA 3LL7A 2KSOB 1ODLA 3EC2A 1SQ0A 2AZMA 4G56A 4A1FA 2ZYHA 2WNHA 4MQLA 4KN4A 4DILA 2YS6A 1J2MA 3UQ2A 1FRVA 1ZQOA 5EP3A 3ADBA 2OZEA 2A4MA 4YMLA 1U6KA 4LMBA 4XVCA 1XTSA 5IT4A 2QAIA 2O8EA 3B6KA 4PGYA 1KRWA 3RFAA 3JQFC 2I8LA 3PT9A 1T3GA 2WD8A 5DBHX 3RJHA 1ID8A 1IM2A 2QD1A 2YXLA 1ZIOA 3RWBA 4EHNA 4AN0A 1QKIA 4NZYA 4G0VA 2JR5A 4IFIA 1JEOA 4OJ6A 3P0EA 4WXYB 3GR6A 1G7RA 3IT1A 3HRHA 3ANXA 4ZPJA 3L4BC 2P66A 4F1KA 3O95A 1DWQA 3V33A 4Q3AA 9ICQA 3KX2A 3NT4A 2ZWOA 4E94A 4JBGA 1M0WA 5DASA 3OQBA 5I3CA 4GVLA 1EA5A 5HHTA 1D9XA 4AW9A 1AQNA 4N3CA 4M2LA 2W9BA 2IBKA 5AVKA 2HU8A 2R0QC 4B9VA 4DSIA 1W581 1IMJA 4BMZA 2P9ZA 3ECCA 1JP7A 2WYHA 1E2UA 4ED6A 2BGWA 3SHFA 4P7BA 1RIIA 3TLKA 3M7IA 2Q3BA 2A9JA 3LY7A 4DCJA 4DQXA 2LKCA 4D9FA 3HRKA 5U1PA 1LDNA 5KHOC 1H1LB 4WWHA 4F5QA 3EEQA 4WVFA 1LTHR 4IZHA 4V1CI 5L1JA 1ODCA 5E4TA 1USUA 3ER6A 1PAUA 1ZQLA 3DEHA 4BLVA 4UBMA 3TPCA 1R3DA 3A9SA 1F2TB 1ZAKA 5K0SA 2ZYAA 2QGNA 3NV7A 4GECA 4GC6A 2BHNA 1O6GA 3UYLA 5AP9A 4CBVA 2R60A 5TMPA 3WFJA 4N3GA 2WYOA 1O97C 2PI5A 1CB7A 5C34B 4KLDA 3BMCA 2QSYA 2VHUA 4MICA 1RE0A 5H7XA 3TQIA 2C4NA 3SHTA 3P8ZA 4HS4A 2JFXA 5DNVA 3T1OA 1I6LA 3LCCA 2IDJA 1SWVA 3DOEA 4WFQA 3NTLA 3NVVA 4Z4HA 2VAVA 4OQZA 3HFGA 1IIRA 1SGWA 1VDMA 1P17A 2FXVA 2VP0A 3PXAA 1Z2NX 3MT7A 4M1WA 4YMMA 4QXRA 1QGUB 3PHLA 1QP0A 1KO4A 4L8GA 1WMEA 1M1NA 4W6QA 3ZV3A 4QDTA 1EE9A 2JBHA 1G4AE 1DELA 3QKTA 2WTUA 2XCTB 4GT1A 1GDDA 1YUNA 3SOZA 5FNVF 4JN6B 3VUFA 2PZFA 2NZYA 1MSWD 1ZESA 1QO7A 1SXJA 4Q1CA 4LMRA 4M9CA 1NW5A 4S35A 1FU4A 1HYGA 1L7VC 4JELA 2N9UA 1A9XB 3ZOKA 1Q7RA 2WSYB 4MVJH 1VYUA 4PGGA 3L49A 4ZRMA 4FU0A 1KFBB 5G40A 4EYHB 1HLGA 3ELYA 3HL4A 1KFDA 3OZDA 1T8WA 4N5MA 2V5UA 8ICRA 3QFFA 1UQTA 3JTEA 4NTZA 4RIGA 1XCOA 4FYIA 4DMRA 2KKPA 1FLAA 2SNIE 1XX6A 1S0NA 4MLDA 5FO0A 1VJGA 1XROA 4DOBA 1I01A 3B89A 3LWLA 2FHSA 4G37A 4Q4JB 2A2ZA 1N3LA 1U5AA 2EVWX 4NG5A 4MDFA 1F9AA 1PZMA 1QZ3A 4U7WA 5EGNA 1L4UA 4XIFA 2P2GA 3R3XA 4IPTA 5BOMA 2H4XA 4AMZA 4YR9A 3E58A 4GL2A 2QQ5A 5J4YA 3GRUA 2W3SA 1MB4A 2BR4A 4PZLA 1KMQA 3Q5EA 4BCBA 3TYXA 3JVDA 3JPRA 1S9DA 1HZZC 2PKWA 3HMQA 4KIJA 4FGZA 2KJ8A 2XXAA 4NZOA 5D3MB 3E8MA 5KFQA 1WB6A 3KKAA 3EDMA 1MRSA 4DQSA 4MVJP 4ACAA 5EIHA 5IANA 4HFRA 2QB0A 3EVFA 3VU1A 1QP8A 2PTHA 4OHOA 1N9GB 1AS2A 3KO8A 4Y2HA 1VGRA 2VA9A 5J3JA 2F1KA 2QBYB 4RYLA 1IDOA 2WYIA 1WHSA 2D4HA 4BV3A 3GZNB 4ZYLA 1P19A 1XVAA 4DY4A 3FX2A 3C3YA 3A25A 2Y71A 2I4LA 4M9LA 4F2WA 4S1VA 2ASDA 2QAGC 2NP6A 4A2CA 2XW6A 4QU5A 5LWHA 2XUPA 5D6OA 4G3IA 4B35A 3CP8A 4DFKA 3NHUA 2C1XA 1JW9B 4Q3LA 3T9FA 3N0VA 2LP4Y 1G1MA 4PQYA 2RGYA 3WLPA 1NGSA 1DTEA 2X22A 1ZO8A 1P9NA 1DWPA 5BUSA 3GUCA 3A9CA 1BQ3A 1A7UA 3BMQB 4Q9IA 2LHTA 3DLBA 4OQ4A 5KFWA 3DAFA 3ND5A 1W44A 4H1TA 3LPNA 1MO3A 1MV5A 4YIHA 3LYLA 4L6CA 2RGXA 3RGGA 2ZE7A 4QXOA 3U26A 2H06A 3OWHA 3ENNA 3OEHD 4C4SA 4ND8B 1Z7GA 4O4HA 3HR8A 2QN6A 2JFHA 1ONSA 2YZ2A 4QZ8A 1QV6A 5JAIA 2QJRA 4IMPA 4ZT4A 4P82A 4GKVA 1OFHA 2G6BA 3A6DA 4S24A 5HA5A 5GJWC 1AF7A 3H99A 3OQIA 1LS6A 5AW0A 2VL7A 2A9QA 3WJAA 2FSVA 3SR0A 1W5FA 3TVTA 4TV8F 1NV9A 3RS2A 1FP2A 3QITA 4YRCA 3OSUA 3WMGA 1U3UA 3CWCA 3TH5A 1TMGE 2BFOA 2VJQA 3HHEA 3F2CA 4R1QA 4MEJA 4M8NE 1Y9DA 2W6OA 5EXPA 3ET4A 1BH6A 3OI7A 4FS3A 1KJYA 4NXNB 4KDCA 1GAWA 3ZQ6A 4D92A 4DR2B 1Q44A 1W88B 5U4QA 3BORA 1YI8A 1YVPA 3BFPA 2Y9PB 5EWGA 2DU8A 1IZZA 5G53C 3F3YA 2OXOA 4H7IA 2YWBA 3R5KA 3CVUA 4OLJA 1GU1A 5SYAA 3FNHA 3ZD7A 3ZY3A 4TQAA 1Q7CA 2COEA 4XZ3A 2OBLA 5KNDA 3TQHA 4A5SA 1XEFA 4FNMA 4YX9A 1QS0A 2B6NA 1Y6FA 4M9NA 3D3NA 3L3BA 4BTEA 1GAXA 1IE3A 4Q7JB 1Y33E 1JR6A 2YRXA 2PGDA 2R5WA 3HKBA 3IDQA 5LYYA 4NF2A 4AJ9A 2M0NA 3DFFA 2FDXA 2D5IA 4FEEA 3PIIA 1RYDA 2ZIXB 5AUPB 2VANA 2VWHA 4U8HA 3PMLA 4U00A 1LW7A 1XTZA 4R2JA 1FFXB 3RUCA 4B9LA 2VQSA 4LHZA 3IESA 4NHOA 4MR7A 1OFTA 2GVZC 3ESRA 1PNQA 2AJCA 4RZSA 3RB8A 2OXRA 2CNOA 2UYHA 1RWVA 7YASA 5B3AA 2Z2KA 2E6UX 2NGRA 1QIHA 1YRWA 1TA9A 3W5IA 4LOJA 5JCOA 3HR4A 1V3VA 3NV9A 2C8VA 3ABIA 4JJGA 4LVSA 4C43A 1KI4A 2JAPA 1IUKA 2K4PA 3EULA 2JS7A 3LTNC 2WMNB 1OFUA 4UNNA 5BN5A 2WHYA 2FUG6 4AZWA 4UXJA 1GLNA 1PLJA 1X86B 4J9UE 2O05A 4RVUA 4E0BA 2PM8A 4YDHB 1ZQDA 1QMPA 3KOWA 4P92A 4XD7D 1OIWA 4MVJF 4D3SA 1LW6E 2LR0A 2XEXA 3MTBA 4AM8A 4ED7A 3EARA 4LVCA 1EFKA 2A5JA 3QNUA 3BZWA 3NHLA 1IRXA 2Z56A 5FPHA 3KXKA 4LOAA 5HKKD 2UZ1B 4W8GA 5EE1A 4CM3A 1OZFA 3GPCA 2VXOA 3S44A 1GUBA 3A1FA 1L4GA 1GCIA 4CN9A 2JATA 3Q85A 2FF7A 4F71A 3U1BA 3BMXA 3THWA 3MWDB 3Q98A 2OFWA 3WGLA 3K0CA 1W0KD 1Z38A 4LTNA 4EEZA 2GBGA 5IJ0B 5HCUA 3LXUX 4E6PA 3VBEA 3HUTA 1HKHA 3AEKB 2I4OA 4MS1A 5C8YB 1VYHA 2HGSA 2QKYA 3T4EA 4RYDA 4JJ7A 4I50B 4M1QA 4J43A 1XDUA 2QR5A 2R3SA 4E2ZA 1H2WA 2RGRA 1W48A 3L7OA 2JGDA 2I33A 4F72A 3AUYA 2PXAA 3FGOA 1E0AA 2PQMA 4AL4A 5CH8A 1SIOA 1C5KA 3RS5A 2IU0A 2J9FA 5T14A 3SQNA 1MEJA 4PN7A 5AO9A 3U44A 4Y9SA 3KHKA 1QH1A 4XUDA 1RJGA 4IH1A 2B4QA 1R15A 1WXEA 1FLDA 1NXXA 4GMDA 4QBKA 2EFJA 2P11A 3ADPA 1O5IA 5EJ6A 3PVZA 2YX8A 4Q4CA 4S12A 4I2FA 2HD4A 5CIQA 3BSWA 2AN5A 4WBNF 5E95A 5J8YA 3MWGA 4D45A 1KR5A 1GO3F 1B3BA 2ZWAA 4O4LF 1PGPA 3F3MA 2I7XA 4BZZA 4M98A 4Y2YA 4GLLA 4TPKA 2R18A 2X4GA 5C7YA 3IS3A 4LV6A 3S70A 4Q9KA 3KKNA 3RNLA 1DI0A 2ZE6A 1JXLA 3VO2A 1OU0A 2WM8A 1BO6A 3WDSA 4BO9A 1KJ9A 4HVTA 2B6HA 1KZHA 2I3DA 4B6QA 1G2OA 2J67A 4H0FA 4M1YA 2B37A 5CITA 4YB8A 4H7FA 4AECA 4ESHA 1UDWA 5IDYA 4K6HA 5KFZA 3RK4A 2E1EA 1JEQA 3JWIA 2W48A 5CUQA 4XM0A 1XKLA 1VLMA 1ZGBA 1JYFA 3AFHA 4CM9D 1Z25A 4RFSB 3BVPA 1TEVA 3DMFA 4RQ1A 1X6JA 3FMGA 3OAAA 2NRXA 4WOBA 1DIRA 4IDBA 3KCNA 4PFJA 4U7FA 1LV8A 4JSRA 1C3LA 1PE0A 1OWOA 3DKVA 2ZAMA 5D3ZA 5KI6A 2RGNA 3L02A 3GGJA 5KYXA 4G84A 4P2GA 1IIBA 3F47A 4FR5A 2YC2C 3AR8A 1EDZA 4AYBC 1LPBB 3EA4A 5K9ZA 3GPBA 1FRQA 2EFEB 3ZHXA 2E37A 3IEUA 4H7EA 2ZJ5A 1U7WA 3IMFA 2VJYA 1J06A 2ACEA 3H5NA 3EUEA 3ZGZA 1SU7A 3TNJA 1LF0A 3ZN2A 4QPZA 4DV6B 3DHEA 4BX9A 1XRNA 1G5PA 3RIGA 4R7ZA 4NLNA 1L7XA 4XVUA 4J9LA 1KR2A 5A71A 4KRXA 1R6DA 3IT3A 2WOOA 4GPZA 1TK8A 5HW0A 7REQA 1PJBA 1XDZA 1BC5A 4JBWA 5EEGA 1VGVA 5B6PA 5ELLA 2W42A 1OYWA 1Z15A 3VPAA 4P8RA 3V6HA 1NAHA 1GPWB 2BFFA 2HW8A 1NBEA 3TANA 5AESA 4EHLA 2A9KA 4RCVA 4POOA 4DLEA 2G71A 1HDCA 4RNOA 2BVNA 5LQCA 2OM2A 2PRSA 1WQ4A 1KK0A 4XVQA 1JKFA 3D7NA 1NI4A 3H17A 2FRVA 2OR3A 3MCUA 3COWA 2FWPA 1IN1A 2KW5A 4P4SA 2JIQA 3ZHCA 3ZDAA 4HH0A 1K7EB 3KAQA 2RARA 3IB3A 2XT9A 3NQ41 3A3PA 5DHRA 5B2EA 2Y9MB 4GKJB 3HZHA 4ID3A 1E1DA 3AVOA 3WL7A 5DWDA 3N8NA 5TF0A 3FF4A 4N76A 5I8ZA 3RS9A 3G9QA 2JGKA 1SAYA 4HAWA 4RH1A 4LBYA 4WLVA 1EGHA 3IULA 4CIVA 1V39A 5BW8A 1B8VA 3TI0A 2ZULA 1RQXA 3FSGA 3Q8KA 2WIFA 1TAHA 2YIMA 1R8QA 5H0IA 4LW8A 2BJWA 1ZLXA 3VVBA 5ETJA 2QA5A 4YACA 4EL0A 3PCXA 1EVZA 2A1AA 1BVHA 2VYFA 2EGUA 1ISPA 1J09A 3VPFA 2ET6A 1OA0A 3BRWD 3E2PA 2PXXA 2QYOA 4MMYB 5J43A 4QREA 3MN1A 2FB9A 2H3VA 4KAXA 3D5EA 1NWHA 4R01A 4J1NA 1D1TA 3DMGA 1D09A 2XTAA 4KN9S 4CM4B 2CVQA 5GV7A 5KL8B 1FQWA 1ZVVA 4YP9A 4TYMA 5IHPA 2QI9C 1UKBA 3EWSA 3JRWA 1G9TA 3KQSA 5DOZA 1VP9A 3DMTC 5BORA 4KCGA 3SVZA 3QEOA 4TXMA 4LBZA 1GAQA 3HFJA 1QYXA 3R9IA 1GUYA 2BCQA 4OG2A 2DJIA 3QYJA 4GPEA 2HDNB 4EW3A 1Y48E 3VU8A 4RPKA 1F06A 1XD2B 2VHEA 3AR9A 1JUDA 3EJ6A 5AW3A 4REQA 1U4NA 1T5LA 2G5PA 5IJXA 1EXWA 5I01A 2I4RA 3NATA 1Q1ZA 2YZGA 3LUBA 2UV8A 1G3MA 4RD3A 4N0EA 1U7DA 2HF2A 3V48A 4RVFA 1M66A 4CQMD 1QYIA 2H1RA 4UB8U 3E5MA 3VTAA 2DWUA 2XT0A 1O96A 5CP2A 2JK1A 3DXYA 1GZDA 2R8YA 2Q0QA 1AB6A 1ISHA 2GAJA 4KUEA 4JQYA 2HX1A 5EWMA 5E7MA 4NABA 3VX4A 5JYDA 2JFNA 4HRAA 1NVUQ 2JFQA 1T3ZA 2PKXA 4TV9B 4AF6A 5J58A 5KQMA 1BXRB 1YS9A 2R25B 1JIXA 2Q46A 3QU2A 1Z36A 3OU2A 5DBAA 1MC4A 5AVUA 1Z1VA 3S6JA 1S8NA 4TZKA 4LV8B 1MO6A 4OIMA 1UAYA 3NPMA 1CDDA 1SOWA 1I4EB 3FKJA 1GTRA 3RHTA 2AJTA 1XMSA 4OB7A 1CY2A 4M7PA 1CUIA 4X85A 1KI6A 2PUEA 4WDRA 3VC8A 1Z4OA 1RC8A 1O87A 2WAQF 3KZCA 5A06A 1BSVA 3K05A 2K2QB 2QW8A 1Z4IA 2ZOSA 3CRNA 4K6KA 3OMLA 1IXRC 2DGDA 4F9EA 3PFGA 4GW3A 2GCEA 3WWEA 1KOFA 2ICAA 1WS6A 1T35A 4GF5A 3HU2A 4ND7A 5GVRA 4LNAA 2OYRA 5EWFA 3RS7A 3V1NA 1QF7A 1OY1A 4XIGS 3PCTA 5FBQB 3VKUA 3P0FA 1PTJC 5B7NA 4M0PA 4BKPA 1BG6A 3LYUA 4JCCA 1WX1A 1NF2A 2DZDA 2ZBRA 5FXMA 1GYRA 5L6MB 4N5IX 1S97A 1H22A 3CT6A 1G1AA 1ZMBA 2PMCA 2G7ZA 3TADC 4F5PA 1H93A 2QN2A 1S1MA 5I51A 4REOA 4COOA 2HCRA 4WZAB 5LP6B 3P94A 3B52X 4FSDA 3WL3A 2ASEA 3F6RA 2X8JA 3ZDCA 1ZQRA 2XXJA 2K4HA 2V7UA 5HZKA 5DI9A 4IGFA 1MAHA 3QF4A 3EF3A 3ZZUA 5EOZA 1DAHA 1ZOOA 3B20A 2YFQA 1NQXA 2B92A 2FU5C 5FTNA 1DEOA 2Y0EA 2ZCJA 1W94A 1TK9A 2I3BA 1UJ2A 3V7JA 2EKLA 5B57C 2VC2B 4C22A 3WGJA 2EKBA 5JARA 3NDIA 2V6IA 2FZCA 1DT3A 1IQPA 3GFSA 3GRRA 3JQBC 1W76A 3ZWOA 3FOWA 5CAEA 4LFAB 4C08A 1QR2A 1MA3A 3VNUA 4WN9A 5B3JA 1YZQA 2BI7A 2PD6A 3QFCA 2IPXA 4QSMA 1CQZA 3GGOA 8ICLA 3LDFA 3LO5A 2D0OB 1GVHA 2R7KA 3W5HA 2Z08A 1JXEA 3VJMA 4JMLA 4D7AA 3IO5A 2P35A 2JJ2A 4PCLA 3PS9A 5JTTA 3VSCA 2P78A 3Q9UA 4TTQA 4LZLA 1QJCA 4EPRA 2DBVO 5T4FA 1VMIA 2HSJA 3BIOA 3SPXA 2DPJA 4N7RA 2G4LA 2Q5JA 1KK2A 4NBTA 3W78A 3CCFA 1BQEA 3I64A 5HF9A 2W7TA 2BFBB 5GIOE 4EKGA 5DBCA 4W1PA 1V6SA 2AUTA 4PANA 3SHOA 1ZVKA 3F96A 2W90A 1LLQA 2IWHA 1AQLA 4L22A 1E8MA 5BVGB 3COVA 2W6PA 2IYFA 1WDWB 1JR4A 1B4DA 3IUBA 3C2QA 1E0SA 3NTRA 5JSZB 5HFNA 4A23A 5I9MA 3UPTA 3CZCA 4FQ8A 1S4QA 1YZKA 5EPUA 3R0XA 3SDSA 4ZDJA 1CTQA 2LI6A 1XE3A 1I2BA 4IJUA 4BO4A 2ESRA 2UXBB 4EI2A 4RNCA 2JD1A 2HA3A 3PQFA 3NXKA 1M7GA 3HVRA 1K5DA 5CDTA 4MVJG 4MUYA 1E3QA 1NSFA 4CLRB 3E9NA 1AKTA 2QPTA 1L6NA 4R9VA 3EIEA 4E08A 1FXWA 4WN3A 2P4QA 3AJ8A 5HM8A 1CWUA 2OZKA 1NJZA 2AGOA 1PVDA 3I3OA 1VBFA 3C7CB 3WLHA 5B58T 1E2IA 2W2KA 2VNHA 2PFQA 4OHKA 1Z75A 5K0GA 1I4LD 4IKPA 1HQYE 3JQCA 3WL8A 2P2CA 4XWKA 1NG9A 2WT8A 5AVZA 4R05A 4DVGA 3G5UA 1XG5A 4RCYA 3RRBA 1HE8B 2Y8EA 3O93A 2Z58A 3ETRA 2E4XA 3T5JA 1Z74A 3DAHA 1YB2A 1QCYA 4LVUA 2GLUA 1G3UA 4QIHA 1PWXA 2OAP1 1QQAA 1WKBA 3BS5A 4LSMA 3G3EA 3N59A 5K4AA 2G5IB 4I99A 4O5CA 3E7WA 3C3WA 1CHDA 4EUFA 1QHHB 3H19A 5K0JA 4L73A 3LYSA 3H4DA 3N76A 2FEKA 3V4RA 2OHFA 1IEWA 3AFNA 3F46A 3C4JA 3ZI4A 1G8MA 4F4UA 2WUVA 3SQIA 1HFWA 2DJ5A 1T0PA 1J42A 4KQ6A 1QLHA 2V58A 3VQTA 2EC5A 4LDNA 1D6MA 3EGDB 2JIBA 4RANA 1KS9A 3L82B 2WFLA 1B6SA 1GCAA 2JW5A 1YDWA 1XOIA 4YDQA 3CONA 3GLQA 4A8HA 5GP1A 1X19A 2O0LA 1BEUB 4Z6FA 4FZVA 1MORA 3QFTA 2CUTA 3H86A 5BV0A 2WIAA 5IABA 4KQIA 5C5EA 4Q9JA 3UVEA 1V11B 4F11A 1BPZA 3I6ZA 2NVUB 4KIUA 2BFWA 2F59A 2ZRPA 4HTAA 4LCJA 3N39C 2IGTA 3OVMA 3OTWA 1NQWA 3AONB 1RKQA 4AYXA 1UBKS 4KLIA 1NUQA 4WVLA 1PWYE 4EFLA 1R6XA 3THRA 2HRDA 1H94A 4NSNA 3W7AA 4XOIA 3ZW9A 4F4IA 4AURA 1XZMA 3DXZA 1WU7A 2R8EA 1J8MF 5BOVA 5HE9A 1MA0A 4YO8A 1S2LA 1LLCA 4WHMA 3H8VA 5TQJA 2P4HX 1WNFA 4C4TA 2OBYA 4PHHA 3L7LA 1WQ3A 5DTRA 1TOAA 2WWYA 4IWNA 4NHEA 2XR1A 4J0GA 3SZRA 4MW1A 4N39A 1AKNA 3KQKA 2YWFA 2AXQA 2HK7A 2IFTA 3C3XA 2ZB2A 3I39X 4A26A 1L7AA 5BSFA 4F8RA 4BEJA 3FDJA 3B3GA 1N7JA 2Z6QA 3HMKA 4HWSA 4DA4A 1DZIA 5A0TA 2QARB 2WVAA 3HJHA 3NMUF 4YHHB 3QKWA 4PICA 2YYSA 3JASB 3BCRA 1JU4A 3C3KA 3N7TA 5D7NA 4DTCA 2O2HA 4V0LA 4QE3A 3B53X 1IHXA 4BO6A 5GTHU 1N2SA 1DC3A 1W35A 4DEXA 3MWLA 2GN9A 1YBHA 4DLXA 2GJAA 1I4OA 1ZUNA 1FP6A 1DGSA 1LI7A 4B84A 1MRNA 4OREX 3BE6A 1FUUA 3LAWA 1FFAA 4PLCA 1BWRA 1P60A 3F4LA 2QLJA 5KCZA 1BU8A 2A92A 1O5TA 3DVLA 3ZDEA 1Y8RA 4TRMA 4YN4A 3LG2A 1GNRA 3MG9A 4ZOLF 3NVYA 3SKYA 5F4BA 3BT7A 5JI2E 1Z6GA 9LDTA 4DYDA 1AHHA 1UFQA 4Z6DA 1W5SA 5JDCC 5BT8A 1GPLA 3FIJA 2WMOB 4O4JA 4CJXA 1JQ5A 2IDMA 2Y1FA 4B31A 2J7KA 3T4PA 4EY3A 1BD3A 1EFPA 3P2YA 4EUSA 3OCWA 3PR1A 3BA1A 3K2EA 2ZEJA 3OE7A 4GICA 1XQYA 2C5LA 3EGCA 4ZYXA 4YRJA 4BN0A 3OKFA 4J8PA 1SV4A 4LBWA 2PWBA 4EFMA 3P9QA 4L3OA 2EWVA 3PNLA 4M9HA 2D00A 3K7EA 4C20A 4F3NA 4NS4A 1JAXA 4D9GA 3QU7A 3I8XA 4JXXA 3DYVA 5FCDA 5C8ZA 3TJRA 2QM3A 3IUQA 3K94A 4MV4A 2QVLA 4TZ6A 3BZKA 1D7AA 1GG9A 2F7SA 3ZK9A 5L8VA 3RFFA 1UEJA 2GJKA 4JV0A 2R44A 3WLIA 5AVWA 3HWRA 5MDHA 2XB2A 2Q45A 1NKSA 3PJEA 1N4AA 1NF3A 1RCTE 2AI3A 1HFKA 4GKBA 3P0IA 5KNLA 1AUQA 3E15A 2D8CA 1Z56C 4R2HA 2JIPA 1EE2A 5CA0F 3G5LA 4E12A 1GTZA 2JGEA 5BSRA 4IL5A 2FLPA 4C0BA 4EF5A 1VG9B 1VPVA 1MP0A 3CSDA 4R8SA 4QLAA 4JA2A 4MZXA 4OJTA 3SF8A 2G7MC 2VBIA 2JAQA 1F3LA 3PHGA 3LVVA 4R9RA 1SD1A 1NRXA 4ALMA 1VPWA 3L6UA 1GFZA 5KFPA 4NH4A 2C5GA 2B2CA 3CKKA 5MGBA 1J2RA 2QV0A 4ZO6A 5IT9A 4AWAA 5A7GA 1U9IA 1ZI9A 2KJ9A 1PUJA 2OBBA 2G1PA 2R85A 1E9DA 1HDGO 3OJCA 1ST2A 5LA6B 4BC0A 1YZVA 3RIMA 2P3LA 3QBJA 5BNZA 3AO0B 4CODB 3DOCA 4PWZA 3DHVA 4YQYA 1YF3A 3A36A 1BCSB 3L05A 4HWPA 2XRZA 7ICFA 3UQYS 3R3SA 1V9PA 2EZ9A 4C0WA 4YMTA 1TJPB 5DK4A 4IXNA 2JJMA 1XU7A 4US2R 5IJAA 4X84A 1SD2A 3JATA 2X2PA 2IZ7A 3RVMA 4QGAA 3I5YA 1KMHB 4HB0A 1M2GA 4JROA 5FD8A 2Y93A 2ILVA 3HDYA 1UJBA 3LCVB 3PDIB 5IZCA 2QD3A 1Y1KE 2WU0A 4MP6A 4F5EA 4DWOA 2ODEA 2ZWMA 5TB5A 3M83A 4DL3A 3LXRA 1DEXA 3UPDA 2E87A 4II2A 3H2ZA 3VMFA 4DJDC 4AYBF 3ZZ0A 4R16A 4ER0A 2IQIA 3Q15C 3I83A 4A8PA 4KLMA 4F4CA 4QPNA 2GILA 2C2EA 4NZMA 3HNPA 3T1HB 4ACOA 3B1FA 1S4MA 2PBFA 4XRHA 2EL9A 3BSSA 3W4JA 5BN4B 5J2UA 1R8SA 1EFAA 5CNIA 2HV9A 3WLFA 4O1MA 5I5EA 4QNRA 3VC3A 5IG2A 2CFSA 3UBTA 2B8JA 2HPHA 3FZNA 1S2GA 5PGMA 3FI9A 3PGLA 4YP7A 2M6LA 4R7TA 5KKNB 3W8EA 1FP4A 1P4GA 2LE0A 4B8WA 3I5AA 1SWWA 2VPQA 3LOQA 1Z88A 2HQ1A 1EFTA 4NLKA 4ITUA 4M0FA 4CF5A 1TAQA 3E27A 1REQA 1WETA 3PV0A 3IA2A 4S04A 4GM4A 2GB4A 4B3CA 3TIGA 4LBVA 2PUVA 3DMDA 4NWIA 3S1SA 2ZLBA 1FP7A 4PVDA 4DA9A 3CEHA 4BBZA 2ZB4A 1Z2AA 3H0KA 4WESA 4JJFA 4YP1A 1G55A 1E1KA 3ZK7A 3WLKX 2R6GA 1WXHA 3R6LA 4H3KB 5AKGA 2VBGA 4DF8A 7ICIA 2GPTA 1XWLA 5GAJA 5TDHA 2OLJA 2OFXA 3TX2A 5A9SA 1Q0SA 3S2IA 1ZK3A 1RJDA 2AXTU 5CA1A 4KVFA 1I7SB 2BC9A 2BI8A 1NKTA 2I7VA 2RDIA 3AU2A 2GYWA 3NO4A 4F6CA 3CMCO 5KFFA 4BHTA 1BDBA 2J32A 5C81A 4U6SA 2FPPB 3CG4A 3PE6A 3NRWA 4NG4A 1DARA 1EFCA 1EEXB 5E79U 1TPYA 2L0XA 4F5RA 2HSWA 2PFKA 4MZDA 4BNDB 1FNDA 1TF5A 4ZO4A 3SX2A 2VYQA 3MGVA 3TZBA 1WHTB 3L79A 3ZX5A 4GPBA 3UC5A 1DUVG 4F3OA 1KI2A 3C5WP 5DM0A 4ETWA 5DP1A 4R31A 1P1FA 4AYTA 8GPBA 2MSWA 2GUWA 4NFHA 3OHPA 3JPYA 3LSTA 3GEIA 2QI9F 5K0NA 1G6HA 3PQ6A 5JVDB 4QNMA 3GJ8A 1W19A 1O6FA 4XDHA 1P5RA 2BCEA 2W70A 4BPRA 2MINB 3OOSA 3U4DA 5DB4A 5HZMA 1KO1A 1Z33A 2WJAA 4KMRA 3H5VA 2X2EA 5G02A 2NW6A 1P7YA 1GQSA 1TLFA 3QKIA 1C3XA 3CO0S 2ZS8A 4HDMA 3G2NA 1O8CA 2H29A 1EG7A 5ALNA 3CLVA 4X7MA 3IUSA 2EBWA 4PYJA 3COYA 3GEDA 4CG1A 4WCDA 1EHIA 2K4IA 1B15A 1S2NA 1XPRA 2RONA 4H6WA 4PFKA 2MIIA 3TSWA 3FZEA 3EFOA 3HE3A 1P2GA 3CRRA 4YV0A 4GWKA 1T10A 2AR7A 3IKTA 3HCWA 5IF3A 4HKTA 2APJA 4HNHA 4CI9A 4NV3A 3NAGA 3MT8A 4MJXA 4Z9AA 1Z8DA 3I32A 3BFKA 1PZNA 5ENZA 4PS0A 1RAEA 1XAJA 4DL9A 2QD2A 4RNNA 1NUSA 1YC5A 4I9FA 4X0EA 3U4CA 2YWJA 3EBOA 4RF3A 2WAQC 2Q0ZX 5JIBA 4J1TC 3IALA 3MRVA 4IDFA 4PPQA 2YJNA 4OOFA 2VH1A 1ZNQO 5JXJA 1Z63A 1BTOA 1E0DA 4YLEA 2CHVA 1XSNA 1BDJA 1KBQA 3KZOA 1UKCA 1OLOA 4P4MA 3QX8A 2RHRA 1W9MA 3V1LA 3G6WA 5ARBA 5ICEA 1Z83A 4M0CA 5H3CA 4QPDA 5EZSA 2KWIA 1LV5A 4ND5A 4R1MA 2ZPUA 3ZV4A 3MM4A 2JCVA 1NM5C 1ACMA 1KORA 2A9FA 3SAGA 3DEIA 2QUBA 3A6JA 4F6LA 2GOYA 1G6Q1 1CJSA 5C46F 1EZ4A 5CWRA 4FW8A 5EZQA 1N2XA 2IU6A 3BMOA 4CMBA 1Z82A 5I8WA 5LWQA 4FKZA 4DW8A 3A2MA 1EIWA 1CETA 3I9V1 3CKLA 3RC1A 5JW6A 5E9WA 4R8LA 3JPPA 2VP2A 1Y7PA 1GTG1 1XZPA 1SXJE 5IKPA 2D2EA 1N61A 1DXYA 4XGIA 2AH5A 5DCWA 1GZ4A 4D5GA 2BZGA 4RQ2A 1DE0A 4JS0A 4AZ0A 1J2YA 3A1WA 4CEHA 1HE2A 2DBRA 3DVAB 3VI3B 2X8LA 2VJBA 1JF8A 4Y0AA 3SC6A 1J22A 4FZLA 3F9RA 4IINA 1ULSA 1RYHA 1MW8X 2C29D 2O1EA 3AF2A 3Q8PB 1QP4A 5EERA 2AOUB 2J1LA 4Y67A 5ICSA 3IQZA 1B8NA 1DXOA 2PY6A 1NC1A 2WUFA 1DAMA 4JBYA 1H6DA 3V3KA 1L9XA 3AERA 2JFFA 2JDID 4MUJA 3A6ZA 2OO5C 3K1AB 3BIFA 1ZYUA 3O4IA 5T57A 4W63A 4W7SA 1D2HA 1C4WA 3OEEA 4G5XA 2AG1A 3GLGA 3G17A 1V97A 1TO2E 2HAEA 2B4YA 2G04A 1C9EA 3ZHTA 2NVBA 1XD9A 3VZBA 3U3RA 3ANMA 3CW2C 2FWJA 4ROSA 4MW6A 2J7PA 2HLNA 4IIJF 2NTYC 1JPUA 1I7DA 5I8PA 1E3TA 3AOEA 4C2TA 1C8LA 2FQXA 3QPWA 5KX5F 4WNAB 4WXEA 3CR3C 5IMBA 3ICOA 3HLKA 4WECA 1CEYA 3OT5A 2NYAA 1E64A 5KOHB 2XKBA 1KI8A 2ZB3A 2BDTA 5AM5A 1FFBA 4BWGA 2J9XB 4YTEA 1RM3A 3W4IA 3DE2X 4TSFA 4B3SB 1NJ8A 3JSAA 1UIMA 3ZXUB 4CLDA 5KFCA 5CEFA 2ZYIA 2FW9A 1VE1A 4C89A 1E79D 3RR7A 3THYA 2GYYA 3ZWCA 2DBZA 1KZGB 4S1OA 2P6PA 1NI5A 1QHXA 5E3HA 5F73A 1Y6JA 1ESZA 2WAXA 3DDSA 3M4XA 1L7MA 5D4BA 1ECFA 5DLFA 3SYRA 2OXTA 3TIFA 2W2QA 4J9MA 2ZJ7A 2GT1A 5F4ZA 2CHEA 4RHCA 3T94A 1VKJA 4MW5A 2WWHA 1DAIA 4TMVA 4NBNA 4CIBA 2HVIA 2NRTA 2H16A 4RAQA 4QG7A 5KVSA 2IYXA 2XMPA 4B7UA 2ILTA 1A5TA 3MF4A 3ZKWA 2R48A 1Q2XA 5DYIA 3PNBA 3B78A 3QG1A 1IBLB 3B9RA 3TZEA 5HCNA 1YZGA 1M2KA 1EVYA 2A1JA 1P2TA 1ORHA 4F45A 1CXZA 5K0LA 5DYTA 3IUMA 1K92A 2FGKA 4N5DA 2BDEA 4QVKA 1VSTA 1LVUA 4MV1A 4QDKA 4PYLA 4W9RA 3ECAA 4EA8A 5EP4A 3Q3CA 4TLBA 1NAIA 3OQNA 1N0UA 3H5TA 2Q4OA 1D4FA 1WKCA 3W3ZB 2FSIA 1DG3A 1ZX1A 3SEFA 3A1UA 1YC2A 3F4BA 1X8JA 3R4CA 4RQ8A 1MZPA 3IP4B 5DEIA 2XMZA 1ODIA 4H7KA 1MAUA 2IE8A 4DOMA 2I03A 4ECSA 3TZCA 1FUIA 1C80A 3HY6A 2VPYA 2ZXHA 4DIKA 3JQRA 2TMYA 3L1KA 3H5AA 1UHUA 4WSOA 1SVIA 3MT0A 1WXGA 5C7IO 2OBXA 4RSRA 2A1TS 3DV2A 3W2IA 4XQCA 1Z00B 4Y2VA 3OJ0A 1S3FA 1JHVA 1JFLA 3RBDA 3E70C 3L9WA 4P4TA 4RKQA 1R16A 4PSUA 4B3XA 5MN5A 1HUQA 3NVWA 1MEEA 3LLSA 1BQ4A 5J2TA 2X4IA 3LUAA 3VPXA 4DNOA 5I7EA 5F7JA 1OTHA 4L3VA 3K5HA 2R5FA 1OZAA 2XF8A 2V4UA 2NRWA 1KMCA 4H35A 4YEDA 4XWGA 3DMRA 2YJZA 3Q8RB 1ZHFA 2ZIUA 4XAQA 3RYFB 5KWEA 5TX7A 2QORA 4O3NA 4RPJA 4G1MB 4HDOB 4N9QA 3E5RA 4QZFA 1SIUA 3UFXA 2MSDB 4B3BA 3NASA 5I4KA 3RRHA 1LKYB 4NLCA 1PU2A 3MWYW 5EUBA 5JXWA 4K4IA 3FYUA 4R1LA 3QLUA 1G8SA 1QYVA 4NECA 3IPAA 3UJ8A 3RODA 4FO6A 1XXHB 1GQQA 5BYBA 3K2QA 1XMIA 4Y7CA 3ETDA 3WX0A 2PLNA 4CN8A 3KTDA 3I1YA 5EKSA 1FMTA 4KFTA 1HLFA 3BICA 3NNNA 3DV9A 3PYXA 1Z47A 2BFMA 3IOEA 5J4LA 5AXAA 1QPZA 3VHQA 4DS4A 3SIXA 2O4CA 4MRNA 3WGMA 4HAVA 1X80A 1WVIA 3KYDB 4MB2A 2O0MA 5BQOA 4C6RA 5HZGA 4B0PA 3VZCA 3U4MA 2Q3MA 1P4JA 1FEZA 4B45A 4UDNA 1FU8A 4MWCA 1FY2A 2Z1DA 2VN8A 3N1UA 3X1XA 2NU9B 3EQ8A 3T12A 3SI7A 4AIRA 1UXKA 4PYKA 3AOGA 2Z3WA 3EB9A 2Q0XA 2OUIA 1DLJA 1UDCA 1G3RA 3TLAA 1L7PA 3E8SA 2O8NA 3EZ9A 2CBZA 1JHXA 5KFRA 4JVOA 2HJHA 1I94B 1Y9EA 3RBZA 3EGWA 2BRUC 4A36A 1H66A 4RCZA 3LZCA 1YR2A 4YDSA 2BE7A 2VYNA 5BY2A 1D2CA 1IOWA 2NX2A 4E09A 3BTUA 2UVWA 2KEYA 3IT2A 2BGUA 1ML4A 4QU9A 1X6VA 1HH4A 1B6TA 1II8A 1JQ3A 4H17A 2B98A 3HJCA 4A0SA 3IODA 2C28A 1JKJA 2ZSKA 3VJLA 4LJ9A 3RADC 4PC3A 4KBGA 4JL5A 3WGUA 5B6IA 2GN6A 2WSIA 4LHYA 3FCUB 4KQ9A 2B25A 4C3ZA 3G0CA 3THOA 3SZUA 4JWNA 1SQ5A 5ICCA 1L5UA 5AM3A 5E4JA 4DF3A 1DJPA 2X6RA 4Q21A 4J9KA 3E9ZA 1ZU5A 3OTHA 1E7YA 5SYNA 3VR2A 3PJGA 2O06A 3GLUA 4G0UA 1ZQVA 1JJFA 4HWGA 1SXGA 3A3OA 3ZJTA 1CRQA 3QOWA 1H4VB 4OJMX 1YXMA 4RPHA 3IILA 4HSGA 5IWAB 4NBWA 5DCUA 4E46A 4UHEA 3LM8A 4W9MC 2JRZA 2H7CA 3ZEIA 3S5JA 5IASA 3UENA 2P5YA 3AUUA 2A33A 3X2EA 2FUNB 3QMMA 4PYOA 3KTAB 2GK7A 3WNBA 1OX6A 1BW9B 4NU8X 2P6NA 1YJ5A 1B0UA 2A0KA 1YL5A 4TWBA 4BNJA 3HSYA 2AI2A 3BREA 3D8RA 3LLUA 3CPEA 4ZZIA 1CVLA 1CRZA 1GPNA 3GJYA 2HHVA 1U8TA 3U1TA 4PSVA 4BMOB 2GEFA 1YHYA 3DG9A 4Q48A 3BXZA 3PJDA 3PEFA 3L1VA 3Q8SB 1N5WA 3JD2A 4XB6B 5DX8A 2BCVA 1W36B 5JU6A 2OE2A 5FWDA 2PSDA 1NVBA 4QUHA 5CCDA 2YMMA 1QHSA 5DN6D 1H69A 3OTQA 2G63A 4BMDA 4C7OA 1UPTA 2V97A 5KNCD 3BK1A 3QMVA 2Y67A 3MYYA 3UPUA 1TVAA 4XEUA 3OLWA 1P1JA 2FA9A 1QQBA 5K5EA 1IM4A 5IC5A 3UK1A 1RQ7A 4YN3A 5GGXA 1CULC 3C97A 3TUJC 4JENA 4MRVA 4O3OA 2ZTSA 4KR3A 2KX7A 4CKEA 2FPRA 2WTXA 2GEBA 3M6XA 2Q9AA 4KLFA 2IL1A 4X1KA 4O5EA 3ZQUA 5ADWA 3HDQA 1PDOA 3T4XA 4DHEA 2IOYA 1IZ8A 1F14A 1L3TA 4FT2A 5JR3A 1R4AA 2GZSA 2UVQA 4KPEC 3AVYA 4AZVA 1EBUA 3M34A 1VCIA 3M6KA 4M53A 1I1QB 4M0DA 5B4TA 1Z0ZA 4XWAA 4RD1A 4EGJA 4YD1A 4YFYA 1L3CA 4ZT3A 3BQ0A 2IVFA 2TSYB 1YA6A 4KR6A 1ZSYA 4XRRA 4BASA 4ZPXA 4I8XA 4RY2A 2I7TA 1TZJA 5KKAA 1JXQA 2H59A 3GV5B 1GYPA 2BEJA 1N6IA 3IE0A 2P9BA 4I66A 4FLMA 2B0CA 3OPVA 1RLMA 1E1RA 3EFBA 3RT9A 2F8KA 4DSAA 3T61A 3UWMA 2P91A 3TLJA 4MEXA 3PGVA 3EAGA 3SZ2A 4AAYA 4L5YA 3RYIB 4AN1A 1VHJA 1RXIA 4US9A 4X44A 2G70A 4TLAA 3FPEA 1UKVY 3K73O 1QTMA 2ZRNA 2OLKA 4FHFA 1EUYA 1W4BA 2WE8A 4N7JA 4LJRA 4CEIB 5J5VA 5IIMA 4I6GA 3RB0A 4OEHA 2M9NA 4RM3A 3GW8A 5B37A 1JDBC 4R0MA 3ZHBA 4LI0A 2VR1A 3WLNA 1VG1A 1YU6A 3IIKA 2PU5A 2G0TA 1XRQA 1OT5A 3VZRA 2YQ5A 1BFKA 2PX4A 2UZIR 2V3CC 4NL9C 2I65A 2FEXA 2G67A 1U02A 3EXG1 1EK1A 4ZVTA 1SUFA 3O73A 1M2VB 1NMEA 4BRUA 2AWNA 1XQXA 4K9DA 4WUTA 5BWOA 4FMDB 2NYVA 3IG5A 5LXTB 4IJ5A 4MFFA 1KSJA 3FTEA 5HBGA 1UH5A 2XUJA 3KKPA 2PWAA 2VHWA 5C1DA 4KQEA 5A4KA 1PZHA 1I24A 2XMBA 1E1NA 1VPDA 1WCYA 5HKLA 4DXAA 2C0CA 1VTKA 4MQ5A 1FK8A 2C4VA 3ID6C 4UFNA 1TXGA 5ILOA 2F3UA 5JJ5A 1DU4A 4DIDA 5IK2D 3KC2A 5REQA 1DRWA 3RROA 4MV0A 4YECA 1DV2A 3WNCA 1OLSA 1M8KA 3PXEA 1SZPA 1MABB 2H5XA 1KYVA 3KIPA 3C7AA 1C7JA 3BGIA 4BO2A 1NLFA 3NHPA 3BTOA 1QLWA 4ETMA 2O7VA 2C22A 1IUOA 4DL4A 1ISFA 3GT4A 3ZV5A 3KXDA 4COKA 5E8JA 5BOSA 4LX8A 1SQFA 3H1EA 2FHPA 5JTIA 2ODAA 1ENZA 1G8HA 4ZC1A 3ETLA 3SBXA 3DVSX 5BQPA 5P21A 4ECEA 4YREA 4BMCA 4LJ7A 2E48A 3W5AA 2A14A 4O4IB 3MMPA 5BXQC 3C5FA 3L6RA 3WA7A 2QT0A 3C45A 1FDTA 4MRRA 3U7QB 2RP5A 3AJAA 3BL6A 1L1EA 3I34X 1XNSA 5C0YA 4DWWA 4GM1A 4C03A 4LYAA 2WU3A 1DUSA 1YTLA 1T4DA 2AZTA 4LJAA 5K6RA 3LQ2A 3FUUA 5CJPA 3D7LA 4W9NC 5AJUA 3N6VA 3HN6A 4RSHA 1QH0A 3ZHSA 1WXWA 2FUKA 1L8AA 4PX2A 5TMEA 2V45A 3MCZA 2NXCA 5L3QA 1TRHA 2C7BA 1KAQA 2G8NA 1OIVA 3TOZA 1K98A 1XN1A 4DFDA 1Q1QA 1E96A 5TPZA 2BBTA 2W98A 1OH8A 5AKLA 3DZBA 2K7FA 3KUDA 3VR4H 4AJKA 1C1XB 2JKZA 4TTTS 2Q5CA 1U4BA 1G98A 4KXUA 1JXMA 1JIUA 3A11A 4G8CA 1KYYA 1COOA 2A57A 1ICEA 4CKBA 1QGUA 1YDFA 3AH8A 2PMWB 7ADHA 4LDPA 4QUJA 2QJFA 4DFPA 3HKEA 1NE2A 3D4BA 2D74A 1P5FA 2IEDA 5SY9A 4PRYA 4JUBA 1XCJA 2ZR7A 2ZI7A 2IYTA 3M6IA 3RRJA 1KI7A 4K8RB 4TMWA 2HTEA 2E3JA 1XPOA 5D46A 2H6EA 3THVA 4MUIA 4LXXA 4MS4B 3M33A 3I2GA 3B3FA 1N9KA 5EHQA 4JP1A 2IDKA 1AHIA 3ND6A 1VOTA 4BNYA 3SFZA 3UAVA 5AM2A 1ORVA 4XSHA 5KTSA 3INNA 2IYLD 4D57A 1PK1B 1KAHA 3L4JA 1O1YA 4CLXA 4FXOA 1RBZA 4DJTA 2KVSA 1J0AA 1Q77A 4X00A 8ICBA 1CQJA 1KA9H 4DB4A 1Y1RA 4Q4JA 2PH1A 1NATA 4U7TB 1CRWG 4RMIA 3EEIA 3ZIAD 2ZDQA 2DVMA 2O2CA 3SDZA 3QLVC 2A94A 4F4JA 3H97A 1NT4A 4TRJA 5FUBA 5GONA 1LQ2A 3F2DA 3O47A 3GH1A 2VF5X 2OBNA 2NU8A 4QW9A 1ZC4A 3RB6A 1VBNA 5D3MA 5K6AC 5JYCA 3K2IA 3HXTA 2F2TA 3G8YA 1Y3AA 3K6RA 4L8YA 4NYIQ 3PSFA 2KE5A 5TXGA 1GM5A 5GZ1A 1A77A 2E8MA 1KQOA 3UMJA 1RZRD 1RKXA 4WIAA 1DGQA 3ZU5A 5KS2A 1NK4A 3GRAA 4DC9A 2OC4A 2JLZA 4GE3A 1UINA 4UOQA 3M8RA 1XA4A 4UEKA 4F2RA 2W2LA 4ALIA 1N9GA 2XVAA 2WU8A 2QBYA 3MD0A 1PNTA 1QRDA 4Q5IA 4OMUA 1I6KA 4EHKA 2VK4A 2D5LA 1QO0D 2C2KA 4PYMA 3G0HA 1H4SA 1FYWA 4GYYA 3CX7A 1DEHA 2PLFA 4MMXB 5L7YA 3SC3A 4IQGA 4M0KA 1V9LA 1O0CA 1Q46A 2YFHA 5H3LA 3BEDA 3I5XA 3I9LA 3BIXA 1Z7BA 1ZXIA 4DUYB 1QZUA 3AU6A 5ITZB 3CN9A 1PL8A 5B64A 4RIHA 4OK6A 1UM9B 1GT91 2FRDA 2EZTA 2ISQA 3H8WA 3K72B 2VCYA 1J00A 2C88A 3MS7A 5BXYA 5BSKA 1G5IA 1R50A 3FRJA 3KEFA 2R7AA 3KXLA 1AN9A 3A70A 1R74A 4UMDA 4IRXA 4QGSA 1CR4A 5KG0A 3U40A 1HTWA 1OBVA 1F7UA 1JJIA 4F4ZA 3ZZMA 4NZ9A 2R87A 3TAUA 1ZZGA 2Q2VA 1N1GA 1M8FA 2Z7JA 2HPZA 3MUFA 3DC2A 4BFSA 4WE3A 1XFDA 2AXEA 3R3JA 3A10A 1YB1A 1KFCB 3RBAA 3LPLA 1V25A 4TKUA 1ZQ9A 2PKCA 2H9AA 2CDRA 4KMUA 2X0EA 5DIZA 2YASA 5AUQA 1T5TA 5AOCA 3MYRA 2V54A 2KIWA 3PX0A 5DN9A 2Y27A 3DF9A 2PQ0A 3LP8A 4C4PA 3QE3A 4Q9HA 3EHEA 1Y98A 1NXOA 1BOOA 2QYHA 4IHJA 3U3KA 4Z2YA 4A5OA 3KLOA 2VHTA 1X1DA 2W6JA 1J07A 1TVCA 3HO1A 1V7CA 3ZU2A 2CD7A 3KHTA 1VI2A 2V59A 4B76A 1USGA 2HWYA 1LPPA 1NVFA 1P44A 3JD3A 3M6FA 1KEWA 1AB5A 4F7DA 5IRCD 4P0PB 4BLSA 1K1QA 3TKLA 1UWCA 4RTJA 3BDAA 4K26A 4YRIA 5A3RA 3LCUA 5TNXA 1U0OC 4YMVA 3AMVA 3L7MA 3I2IA 5JHHB 2OAGA 3MILA 3V8VA 5ILQA 2FKAA 3UMMA 2A35A 3V6JA 2BGIA 1EH5A 1MC5A 4LXIA 1ZITA 1UMBA 4R2XA 1IRIA 5B7PA 1US8A 4ECTA 4R3NA 1H5QA 4BXOA 4HZUA 4E1VA 5EZYB 3K70D 1OI7A 4MTCA 1OV4A 1QMGA 1TLTA 3ESBA 3GLIE 1OXJA 1DBPA 1OH6A 1XU4A 1I5EA 3M6MD 1ZJ5A 2ZJ2A 2DPMA 3C1UA 3HKCB 2YFKA 1H2RS 3U48A 2OY0A 1HM5A 4ECVA 2V1XA 2FPGB 1X1BA 1F5SA 3ENZA 3NC4A 4DCCA 4ZI5A 3UXYA 2RJNA 4Y6QA 4WRRA 2DPXA 1K8ZB 4AKIA 4PZOA 1AF4A 3UV7A 1KC3A 4ABTA 4N8SA 2OFFA 3SC2B 4CMCA 4KBYA 5DYWA 4F6RB 1SVNA 4X6XA 2BBWA 4Y7DA 5H82A 1WIWA 3M5PA 3GLIA 3S5UA 4CT5A 1KYIA 2KN7A 4FLFA 1GD1O 2TMDA 4IX9A 1ESMA 2DLNA 5LKRA 3DEZA 5CXXA 2XE7A 1YQTA 4U6QA 5JAUA 5K20A 2J46A 1E2PA 1K4YA 4KUHA 1U2SA 4QYTA 1TUIA 3ZGOA 2XECA 1Q7TA 2Z1NA 2QN1A 5IMSA 2C2GA 4E03A 2Q9UA 5FUVA 4GVPA 4A16A 1YTUA 4PFQA 4Y9DA 4QLOA 2B9EA 5SICE 1BVRA 1Z26A 4HQNA 4NK4A 4IP0A 2QP9X 4HAXA 1ND6A 2UZ1A 3DEYX 1Z7WA 4D97A 5EHIA 1ODJA 4ARUA 4RPGA 1XZGA 5HS4A 5AKXA 1M34B 4UDXX 4ZAZA 1JX4A 4M2YA 2RGUA 4HVAA 1FBNA 5LQSA 3C4VA 5G3YA 3MWDA 4KLQA 4JBXA 2ODQA 2W7PA 2XAAA 3E1KA 3I2FA 3S99A 2PGIA 3KUUA 3I12A 4DR6B 1RQGA 1X40A 4YRTA 1EQ2A 3NALA 3PA6A 3J80A 5LOVF 1LK5A 4KREA 1PQPA 3Q40A 4Z4IA 3TOSA 4L02A 5DNEA 3VTKA 2R8HA 4BNZA 1RXUA 4NARA 4IX1A 4DRXB 4LZOA 5JQWA 3NGLA 4M99A 5C8YA 1L4KA 1I6MA 2PS0A 3O8QA 4I29A 4QOHA 3TI9A 1YRHA 3T79A 3IP8A 2J3QA 3BHMA 3QTBA 3A4IA 4WKOA 2A0UA 4L95C 2F4NA 2ZUSA 1H2AS 3LYAA 5K2OA 3JS5A 3J7AC 1UZLA 1IHUA 4OJ5A 1G3IA 4DQVA 3PQCA 4AUKA 4XPIB 4FDLA 4GDMA 5EE0A 5TLSA 3K4HA 5L4SA 2OCGA 3NIWA 3PX2A 1YZHA 1Y4DE 3HY3A 1KSPA 4AIIA 4F91B 4F2HA 4IOLA 3IXLA 2P4UA 5T7BA 5CGQB 1GSHA 3ML1A 3VKWA 4KHZA 5JY6A 2JGAA 1WUJS 4G0MA 2D7JA 3UK2A 4C7XA 4D82A 3AVTA 1T8UA 4D6PA 4LK3A 3GJTA 3Q72A 5E1DA 4F5YA 3R5JA 4DF4A 1KZ6A 1JVSA 5DGTA 3OZWA 4OHXA 4LQ4A 4S1WA 5HPYB 1BH2A 1C4KA 3H13A 5E0KB 1ONOA 3GIKA 5JEDA 1UPBA 1N5JA 4X7PA 1XAGA 2P4SA 2Q2NA 3WK9A 2JAUA 2GXUA 3F1KA 3WOHA 3BCSA 2VF8A 4Q93A 1MJNA 1EGAA 3B6MA 4AROA 3VC7A 1EK2A 5DV9A 2XH8A 4KRGA 3Q3JB 3JQGA 5AHKA 2YCBA 1ES9A 2BD0A 4GX1A 2VWGA 1YJAA 2AR9A 4RFSA 3Q1LA 5JQGA 2ZIEA 1PR3A 1MMFB 1UMKA 1ANKA 3L8YA 5LDDC 2A3RA 5F1OA 2N47A 2HHJA 4ZXFA 3P71T 5AK0A 5BMVF 2AKEA 3FH0A 3M4YA 3WKDA 5A9TA 4QBTA 1NJ2A 1CUHA 2EEPA 1NBWB 5E4YA 1QTQA 5GWXA 4GI1A 1H23A 2OV6A 3EYZA 2QV7A 1NJYA 2HJGA 2QW1A 3RQSA 1TTTA 4HUQB 1ECWA 5H70A 2EBFX 5EUCA 3S0JA 1XD8A 3KKKA 5JZMA 3FLBA 4I2DA 3PUWA 4EHJA 4G89A 5FHQA 4ZJUA 1BCRB 2I5PO 1X9SA 2DP4E 5DLEA 1WZEA 4D43A 4Y6PA 5JCJD 3L1HA 2BM9A 4H60A 5F98A 4X1OA 2ZJZA 4YMWA 2G9RA 1SKUA 4L5JA 1I2DA 1NE7A 3W79A 1TMYA 1N1DA 5DYGA 4CIXA 4LY9A 4TXJA 3I1JA 1BE1A 4AC9A 3AEYA 4RPYA 3H9CA 2WTBA 5FI3A 1N3BA 4ECUA 3KVRA 1UJMA 1KY5A 1ILEA 4EYSA 4LF7B 3GJXC 1QVZA 4LHSA 1GQ2A 3ISDA 2Z2IA 2GS9A 2WTNA 4B75A 2QTLA 5A05A 3PQ5A 4OP3A 4ND2A 5THKA 2ATLA 3WMWA 1YOVB 4DKXA 3W3AD 5CXSA 2BEVB 2VLBA 2B21A 1PL6A 3F5QA 5KFEA 5ALPA 4KSYA 1U2GA 2F1HA 4ABYA 2MWMA 1DDIA 4UATA 3ZCVA 2X9NA 4P3PA 1J0EA 2FWIA 4WKNA 5HM6A 1JJBA 1O4VA 1XP5A 4BAZA 4UTZA 4JWTA 4EA7A 4J0HA 3IERA 2RAFA 4GNRA 2FPXA 4KLNA 1EUDB 2RGEA 4BMNA 2B20A 4RNDB 4RXUA 3TGLA 3EEOA 1FPMA 1PWHA 5IKEA 4L0CA 3H6GA 4HCJA 4ZU6X 4ERNA 4TL7A 2R96A 3R8XA 3BWYA 4OK5A 1EE1A 1HYQA 1IG3A 2HL6A 1Y7TA 5DGAA 4QOGA 2GPNA 1JSLA 3OZUA 3PQDA 4TUYB 4Q3KA 5KYTA 1GL6A 4XIJA 3TQ1A 3UA4A 3OP4A 4KLZA 4XM2A 1TIPA 1G21B 5KFKA 1E6KA 4KN8A 13PKA 4UVHA 1PR1A 4JUDX 4LJLA 4O02B 1PR9A 2GPYA 3MNFA 3FETA 4ED1A 2JV3A 4TTPA 4Q1BA 1HTTA 3C7DB 2RBEA 2WUDA 4CM4A 3WYGA 1L5KA 3DC7A 1OBOA 3W2TA 1OWLA 1PK8A 3SCZA 1A4RA 1E3WB 4QTTB 3WICA 5F7OA 4EB6B 4URXR 4FKBA 4H16A 1CIVA 4ZVNA 2XQFA 5A3VA 1IAVA 2WT9A 2HT6A 4MITA 1WW3A 3IP7A 1XD2A 1E7RA 2WWFA 1S8AA 5A4DA 2BCSA 4M7OA 3T95A 1W8IA 3I6QA 3BH6A 2QTFA 4B87A 1ZGZA 2HOQA 5FADA 3EC7A 2AMJA 5K4GA 3WLRA 421PA 1L4NA 1TM2A 1EEHA 1ZD2P 1P5ZB 5C5CA 1VYTA 3H9QA 1UR5A 2IP2A 4L28A 4ZVMA 3GFOA 2DTDA 4AMUA 3SQXA 4O5AA 3WK4A 1SHKA 1GRNA 4ZQGA 4BVLA 2UXDB 3JAKA 4JUFA 5KFUA 1DDGA 3CB2A 2BCJQ 2KSQA 4FYKA 4HBZA 2VOJA 3T3PB 2A1UA 4JLMA 1K7CA 1KAEA 3GP8A 4IDAA 1IN6A 5HE8A 2IEBA 4IGIA 3AP1A 5EWLA 2ZIWB 3EPJA 4IO0A 1T9CA 4ZANA 2XQKA 2OZVA 4WZBE 1CEEA 4QNLA 3WBBA 4KN5A 1CIPA 4LXTA 2ORVA 4NICA 4P58A 5KFOA 3M4JA 2YVQA 2UU9B 4BP9A 4RTQA 2GD2A 4H1HA 3IV9A 2VXYA 3AJEA 4RTPA 1GPH1 3KU4A 4A8JC 2SKCA 5HS6A 1EGMB 2FW8A 3E3NA 4UBIA 4WNCA 3BK7A 1XVLA 3OJSA 3B0XA 3PVCA 1AC5A 1GPJA 4NOKA 4X24A 3F9CA 1LDBA 2R7MA 1K6MA 2CL7X 3TTWA 1D9ZA 1XLVA 3CNBA 4FMBB 3W8NA 1XCBA 2WINI 3VR5D 4MPDA 3V2IA 2QTGA 1NJXA 3BUSA 3JVVA 4WZBA 1I4DD 4D0RA 4DIEA 1IOLA 4EJSC 2GN8A 1RLTA 4BWVA 1SQGA 5TQ2A 1SPXA 3II6X 3G2MA 2Y2VA 1SOVA 1OWPA 2QQFA 3IUYA 4RZUA 5BSEA 3HCEA 3F71A 4D81A 2PJZA 1XI2A 3T7SA 3REFA 2YVAA 1Y0BA 4LWOA 2KYRA 1Q83A 1ZNYA 4RORA 5JC8A 1JSXA 2HYIC 3MRXA 3KOXA 4ZCPA 3FPFA 1PV1A 2ZUDA 2J30A 2HMUA 4D3DA 4UUNA 2BHTA 4UHFA 3H18A 1WVGA 4WZAA 4MYRA 4YY3B 1QG0A 3T38A 1S2DA 1KZYC 5T41A 4U8GA 3AY0A 4NOMA 2R97A 2VZEA 3D6HA 3HEBA 4G25A 5FPYA 4Q6BA 1RI5A 3ETEA 3I6IA 4M21A 4P7FA 2OHOA 2BTQB 5B66U 1Y5IA 1YVUA 2X9LA 2X19A 2PUFA 3H1TA 1TM3E 1RZUA 3C5EA 2FN4A 4G2TA 4R66A 3RIHA 4DJJA 1Z39A 2FUG1 2QOEA 4JGGA 4U3JB 1T0JB 2NMVA 3BWDD 3LI2A 1Y6RA 1PK3A 4Y2XA 4BO5A 1VXRA 4LJSA 4B6PA 3IN5A 2ZBUA 5J29A 2OO3A 3AHHA 2PZ8A 3P2OA 4YAGA 1L5HA 4I2BA 4CRXA 1CY8A 3HUEA 5KQPA 4RXTA 1Y82A 5H2FU 4DKJA 1KF0A 3AZQA 4IRUB 4JI1B 3V8RA 3COSA 4FCVA 1CERA 1CVIA 2ZJ3A 3DE6X 2BKLA 2FMXA 4G81A 1WULS 5CVCA 2GKGA 3NBZC 5C31A 3KU1A 3EHDA 2JCGA 1BYIA 1UK8A 3SLRA 3C1ZA 3TOCA 3ACCA 1JR2A 3EEYA 4IIGA 4E7OA 4OHRA 3ZNNA 4IEIA 2QLNA 4DMHA 2B0JA 1XZAA 3RFCA 5JMPA 4U7GA 4U0KA 2AN4A 3FFTA 5B1SA 1KZ9A 4JI6B 2O2YA 4DMGA 1C20A 4P3OA 5D3KA 3WRXA 4AFNA 1KIFA 2HUPA 2BV3A 3FHLA 2VP9A 4N41A 2PSFA 4DWIA 4ZCMA 1RYEA 4FOOA 4JQCA 1XR3A 4D8WA 1Y5RA 2ACWA 5G5HA 5JZSA 3DOFA 2V65A 2Z8YA 4QBHA 2Q9CA 3GJ0A 3T5KA 2AK3A 4LZGA 3SV3A 4CMIA 3EXHB 4UBCA 1OOEA 3TSCA 5CDUA