4C4SA

Structure of beta-phosphoglucomutase in complex with an alpha- fluorophosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
215
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 76
structure length 215
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4sA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4sA01
3QU2A 1YV9A 2ZBDA 5AKZA 4KNVA 1Q92A 3QXGA 2GHTA 1N9KA 3OCVA 1Z4MA 2R8YA 2R8XA 5AKLA 4YH1A 1RPZA 2R8ZA 5ALNA 3FPBA 2YN4A 5ALIA 3FGOA 4NV0A 3ZTYA 3MC1A 1ZD3A 1Z4KA 1Z4QA 2RARA 2WF8A 2GMWA 4OFZA 3KDPA 3K1ZA 1Z5GA 4FYPA 3R4CA 3RFUA 1WR8A 2EAUA 2HX1A 3M9LA 2YJ3A 3ZUPA 4F71A 5AM5A 2FI1A 2YMPA 2HCFA 4HAIA 4I9GA 4UU0A 5ALYA 2I6XA 3AR4A 4CF5A 4XOUA 5IS2A 5AKKA 5ALMA 1S8OA 5ALOA 2HF2A 1RC8A 3U7EB 1RMYA 2YFYA 5AK5A 4Y3UA 1RKUA 2C4NA 4Y2SA 3HYCA 3IB6A 5AKEA 3CNHA 5AVTA 2D2VA 3WKCA 1ZS9A 4CF3A 3FVVA 1RLMA 4H1WA 3NANA 1YDFA 5AVYA 1EK2A 2YMLA 3L8FA 1RMQA 1RKVA 4PNHA 3NRJA 1J8DA 5AK4A 2BY4A 3ONNA 5AIAA 5AVWA 2IOFK 3U7HB 2C8LA 4BEVA 2I34A 2ZBGA 5A3SA 2P9JA 4QJBA 4DW8A 2MU2A 2MSNA 1RQLA 3SD7A 2C9MA 3VAYA 3ZVMA 2FDRA 1RKQA 2DQSA 1WVIA 4BX3A 1U2SA 2WHEA 4Y2PA 2B8EA 1IWOA 5ALEA 2HEGA 4QQFA 3WGUA 2W11A 2G80A 3MMZA 2HSZA 3L8GA 4L6CA 3B9BA 3L0YA 5ALJA 2JAUA 2GO7A 4HGRA 5AVXA 5ALGA 4RETA 5AW2A 1ZRMA 3QU4A 3QUCA 3FPSA 2G07A 5AESA 1L7PA 2Q5EA 3AR6A 1RRCA 5ALXA 4B6JA 1RLTA 1Z4IA 3N5KA 2FUCA 1XPJA 5AI8A 5ALKA 2AUTA 2CFSA 5AVUA 4BBJA 3R9KA 1Z4LA 1YJ5A 1O03A 4YIHA 3PGVA 5AI9A 3WK5A 4EZEA 3L8EA 1ZD5A 2AH5A 3W5DA 5AM2A 2YMQA 3AR3A 5AW9A 3L0BA 4HGNA 2HDOA 3PCTA 4UM5A 2G0AA 2FPUA 2BDUA 3AR9A 4KNWA 2O9JA 1L8OA 2B82A 2GHQA 3R09A 2C88A 4UAUA 1NRWA 1ZRNA 2YJ4A 5ALFA 4YIKA 4G63A 3L8HA 1U02A 5ALRA 4Y2QA 2AGVA 2WM8A 1Z4JA 1Z4NA 5AVVA 1PW5A 4YGYA 3W5BA 3DV9A 3B9RA 3E84A 2YBDA 1QYIA 3PGLA 3I76A 3U13A 2FUEA 2ZG6A 3ZVLA 1K1EA 1L7MA 2ZOSA 4OHFA 4XE5A 5IT0A 2W43A 5AIBA 2OA0A 2OBBA 4HGOA 2I7DA 3E58A 3S6JA 1SWWA 5JJBA 5ALHA 1XVIA 4EELA 1JUDA 1L7OA 4MWOA 2BDEA 3I6BA 3SF0A 2RBKA 5AW5A 1LTQA 2ZBEA 1KYTA 4O8CA 2YJ5A 4CF4A 2JAWA 2YJ6A 2MU1A 3M1YA 2IOHA 5T41A 1L6RA 1SWVA 4GIBA 4OD0A 1AQ6A 5AVSA 3U7FB 3DAOA 1TA0A 3B8EA 2FPXA 3ZX5A 5AW0A 2JARA 3QX7A 3QUQA 5ALLA 5ALSA 3WK7A 1RQNA 2B0CA 4C4SA 4BEWA 2HI0A 3QNMA 3WK8A 3ET4A 1NNLA 1Z88A 3U26A 3WKAA 3U19A 2FEAA 4RESA 3NIWA 1T5SA 3L0CA 4KYTA 3OCYA 1RLOA 1TJ4A 4EX6A 3ZU6A 5ALWA 4L6AA 3ZI4A 4UMFA 5IT4A 3ZX4A 2G08A 3OTQA 3RF6A 3GYGA 4DCCA 2C8KA 5ALVA 5ALUA 2W4MA 3AR2A 3QU7A 3TLMA 3WKBA 4KX5A 4AS3A 5AW8A 3EPRA 4Y2RA 5AM0A 3P96A 3HLTA 1T9ZA 3EF1A 4MUMA 1VJ5A 2WF6A 5AKIA 1U2TA 4NFLA 4J03A 3KZXA 3QUTA 5AW4A 4EEKA 5AVRA 1VFPA 2X4DA 4HYTA 4UW9A 2YMMA 2B1QA 2OM6A 3ZVNA 3ESQA 1Z4PX 2PKEA 3N8GA 4UAVA 4JDPA 3OCWA 3L1VA 2PR7A 4CE6A 3UMBA 4EENA 1MH9A 3BA6A 3A3YA 2R8EA 3WKDA 2IYEA 3PDWA 4XQ0A 4UMEA 2CFTA 1ZD4A 4L57A 3L7YA 3NAMA 4I9FA 2OYCA 4ZEXA 5AM4A 4FFDA 1QQ6A 2FPWA 4ZEWA 3ZWDA 3F9RA 2YY6A 3DDHA 3N1UA 3I28A 3WKEA 1CQZA 2Q4RA 1O08A 3E81A 3UMCA 3KBBA 4KN8A 4EX7A 4E88A 4YCNA 1CR6A 5AKHA 5ALQA 3WK4A 3QYPA 3ZWKA 4YCMA 4C4RA 3WK9A 3AR7A 4FE3A 2WFAA 4OCZA 3CZ4A 1XP5A 2GFHA 1SU4A 4Y2VA 3SKYA 4Y2XA 2I33A 4DFDA 3E8MA 2B8JA 4NWIA 5ALZA 4UARA 1QH9A 5AI0A 2EARA 4GXTA 1J97A 2PQ0A 2WF5A 3FM9A 3W5CA 4BYGA 3OCZA 2JAOA 2FPSA 5AKGA 3QLEA 5AVQA 3DNPA 4BNDB 4UMDA 4KX3A 5E0OA 3EF0A 5AKJA 3IJ5A 3OPXA 3I1YA 3KOOA 1RDFA 3KD3A 2P69A 3J7TA 1RMTA 5ALPA 3N07A 3WGVA 2ODAA 2HO4A 3D6JA 3A1DA 2G09A 3QUBA 2FPRA 1TE2A 5AK3A 5AM1A 3FZQA 1U7OA 4BNDA 1EK1A 2P27A 3AR8A 3W5AA 1YS9A 2HHLA 3NASA 3SLRA 3ESRA 1L8LA 4UASA 5ALTA 2P11A 5AICA 5AKYA 4J2TA 1YMQA 3U7GA 3QU5A 2CFRA 2G06A 3SKXA 4G9BA 5AI6A 5AI5A 4DWOA 3N28A 2B1RA 5A3QA 3L5KA 1NF2A 2IA5A 5AHXA 4UMVA 2IOFA 4XPZA 3ZW7A 2RAVA 1Y8AA 3BWVA 5AW7A 1ZOLA 3UMGA 3SMVA 5AKXA 1LVHA 2WF9A 2G1AA 2NO5A 5AK6A 2QYHA 1X42A 4UATA 3L1UA 4IG4A 1N8NA 5A3RA 3QU9A 1Z5UA 3AR5A 3OCXA 2HF7A 3ET5A 3A1CA 5FP0A 2ZBFA 2AMYA 4ZEVA 4NAVA 5AW1A 2I54A 3A1EA 2NYVA 3WK6A 2CN1A 4F72A 1ZD2P 3IRUA 4UU1A 1VJRA 5AW3A 4Y2YA 5AVZA 4YCLA 3MN1A 4C4TA 5AM3A 4HGQA 2B30A 4Y2UA 4UM7A 3UM9A 4BKMA 4NABA 4JB3A 4BX0A 1QQ7A 2NO4A 1QQ5A 1TJ3A 1L7NA 2ZXEA 1F5SA 1T5TA 2EATA 3MPOA 1TJ5A 1WZCA 2HOQA 2Q4TA 5AW6A 2O2XA 3KC2A 3ED5A 3NUQA 1Z4OA 4CNQA 2JGAA 4IFTA 4AS2A 1WPGA 3NALA 3OCUA 2WF7A 3ZTWA 2RB5A 1S2OA 4Y2JA 1ZJJA 1Q91A 2I55A 4AP9A 5AI4A 5ALDA 3QGMA 3EWIA 3SHQA 4BX2A 4HGPA 2QLTA 1U7PA 2VKQA 1YNSA 4Y2TA 1FEZA
chains in the Genus database with same CATH superfamily
1NBIA 1QG2A 3ODPA 4Z99A 3NHLA 2FX3A 2HXYA 4U5QA 2R8IA 2UVUA 3TAHA 3T3PB 4WX2B 4LOLA 1XZNA 3WHIA 2RARA 4BBPA 4BX8A 3V3KA 1Q8KA 3FNFA 5DKWA 3DOHA 3MPUA 1KAOA 3WB0A 5JASA 4QHSA 2WJPA 1CJKC 5JXJA 1GTRA 4P4SA 4YT2A 3EEBA 4LTMA 2AJQA 1N5IA 3QTLA 5CITA 2HA7A 4GL2A 2DE0X 2PV7A 4G67A 3NANA 2CNOA 3TSYA 1UQVA 3ZQUA 4HTFB 3D2LA 3GGSA 2GF9A 3ROFA 2RG7A 1PUZA 1ESDA 2FUKA 3WLOA 1XFAA 4AWXA 2NRZA 4MW0A 2Q5QA 4MLPA 3BMXA 3GV5B 3UWSA 4QYWA 4N9WA 2M98A 4HWPA 2V7QA 4NECA 1DIGA 2ZLBA 4KJXA 1C30A 3IKTA 1AHHA 9ICUA 1DJQA 4BZPA 5JQGA 1NC3A 1L3UA 4QA9A 4GYWA 4YCCA 2ES4A 1ZC3A 1Z8HA 2BDUA 1A9XA 2DTXA 3P2EA 2BJHA 2Z9DA 1YIAA 3VHXA 3RB3A 1FQOA 3PDJA 3AF0A 5CFRA 1UDCA 4QUHA 1IB0A 1SHJA 3N0VA 3PJGA 3GLFA 2ZG6A 5LP6F 3ZVKA 4DBLC 1YJ8A 2BM9A 1ZHOA 3Q9LA 3PZPA 2UZ4A 4UHCA 3KTDA 2DU8A 1L6RA 4KLLA 3IT0A 3QPDA 1JG4A 5ALLA 2NIPA 1A8IA 1F60A 1IPHA 3G6WA 1AROP 4NJEA 1VLJA 1YT5A 2Z4SA 2NU6B 2MYUA 3ZU6A 1X13A 1JBEA 1FFXA 2PMWB 1WXQA 2IL1A 4DMLA 1KH1A 1V8OA 9MHTA 4AS3A 1UBOS 4ZMSA 2GEFA 4B87A 3SZ2A 4EEKA 621PA 2A9VA 5FA8A 3VR5H 4MQFA 2GBFA 2E4UA 1MH9A 1O58A 5KWSA 1DL5A 5IN4A 1A9ZA 3OZ7A 3GBPA 1W5BA 3UXPA 4C4AA 1DELA 3UB2A 1IEWA 4CQLA 3MG9A 2XNKA 1X94A 3Q4GA 5HNKA 3H75A 4WZAA 4OQPA 1DQSA 5IINA 1IY1A 1DE0A 2FZCA 1XO1A 1H1DA 3RVOA 3W5CA 2W93A 4WINA 1J0CA 3I9V1 2FSSA 3KYDB 2P5UA 3JD0A 1GG9A 5D8DA 4EYSA 3OPQA 2GK3A 4S04A 1GNRA 2FQWA 2G09A 2W9MA 2ZYDA 1F5NA 3UFBA 1XVUA 2BGRA 1OFHA 2WG1A 1P7CA 3KJNA 3ULKA 1QIIA 4DV2B 3L0PA 2HHLA 4XGQA 2P9TA 2JZBB 4JGIA 1OCEA 4WGFA 4FWTA 1W75A 1SKYB 5E3IA 2RHFA 3FVRA 1TMGE 4YRSA 3AF3A 1YVDA 3HYRA 3DH0A 2PI5A 1XRQA 1UXGA 1U8ZA 4DYVA 4F4XA 5DQIA 2OH2A 1GQYA 4LF6B 2XA1A 1JIHA 4JBIA 3OFKA 3AQEA 1T24A 1UAGA 3HCCA 2YWEA 1BVUA 2B2CA 4PLGA 1UM9B 5CR0A 1P2TA 3V2HA 1JB9A 1ODLA 2ZTSA 3OJLA 4IR7A 1IZZA 5F2OA 1IG6A 1FZTA 1GP2A 5IAOA 1KVUA 3RRZA 4BCBA 1WIWA 4EHFA 3RGWS 2WMOB 3ZBTA 1AH2A 2OZLA 1ECJA 1K88A 4S1OA 1OXTA 4LBVA 5C4GB 1H38A 1RBYA 1WETA 3UMRA 2FMQA 5EIFA 1XD2A 1IIRA 2IXDA 3JQEA 2OORA 1J70A 5GY7A 2QUHA 4UDNA 2WILA 1TU3A 3OWXA 2IYOA 5DBHX 4TUQA 3IBYA 4FUTA 3T7DA 3ORFA 5K6AA 1XUOA 2QLNA 3L7DA 3FA2A 5IJAA 3SYKA 3IDAA 2VZ0A 4GKVA 2WTAA 3VM6A 3MTDA 1EUQA 1TKCA 4TS1A 5J5CA 1JXLA 2LTAA 1NRJB 3FHTA 1YZHA 4JD5A 1WPXA 2W11A 1BX3A 1UPBA 3SS7X 2BUAA 1GQ2A 5IKPA 1OFTA 2GO7A 3OQPA 1OHHA 5IZCC 1QTIA 3Q5EA 1OZAA 3BK2A 3NDIA 4QWWA 4OQXA 3ZDQA 4ZVVA 2JCVA 2NXJA 4ZYLA 3CX4A 3FKSA 1E9FA 4QDZA 3R7AA 2QGNA 3IUSA 4B9SA 2NQ2C 2AK3A 1JDVA 2QV0A 1EGHA 4P4NA 4MA5A 2O4CA 4CI0B 4QYMA 2AGVA 2WM8A 1XN1A 4AY3A 3MGAA 1SKWA 3PW5A 4LCJA 2Y66A 3CLUC 5BNZA 1W93A 3HU3A 4W6QA 3G2LA 3SIWA 4B43A 1VLBA 4AO6A 2KW5A 1XI2A 1ECFA 1N0IA 3KQQA 3AF6A 5CLFA 2J5RA 1K6MA 3ML1A 8ICMA 4Z6DA 4AK9A 3TO5A 2HHUA 4CCSA 3JATB 3Q3GE 4GIBA 4CEHB 4ND7A 5JCZA 1NLUA 2I6UA 4JB2A 3L7BA 2DOKA 4KDEA 3QVSA 4FDLA 4NZ9A 2K2WA 2AE2A 1NXSA 4ACOA 4C7BA 4G8CA 2C3MA 2H7YA 1YI1A 3J81A 5DG8A 2JFQA 3WS7A 3KCNA 2WU4A 2PKXA 3KVOA 4AJKA 4G0UA 1GFWA 4MV9A 4I2IA 3HKZF 4OHWA 5DTRA 1WS6A 3U48A 2QMEA 2XGPA 2RCNA 2HYDA 3UKJA 3QELB 3BS5B 2XPCA 4FT2A 4DR5B 3THOA 3DLPX 1QGYA 3G6KA 4BE9A 2AJCA 3N05A 2OO7A 4EMTA 1R66A 1AV6A 1VBFA 1XC7A 2KG5A 4FFDA 3X1KA 3PRYA 1KI3A 3DXFA 1JTEA 5T3YA 4LVSA 1WP9A 3AYZB 1GNLA 3CVWA 2IOQA 3CN7A 3LZCA 5CIQA 1RI4A 3RSCA 2ZSDA 4OBXA 2AHOB 5DKFA 3E03A 2ZYTX 1V1MA 4TWRA 4QG7A 2IDZA 5F77A 5SZKB 4W5JA 4YONB 4I4CA 3RH0A 4XUDA 1O4VA 4KLMA 1P5RA 1IUNA 3NNDA 3X1ZA 2A58A 2WW8A 1H5UA 1HYGA 4CKZA 3C85A 5FBKA 3QXSA 4HMQA 2XNDA 5JV5A 4MVJF 4K88A 2IPMA 5K4GA 4ISBA 4UATA 1I7NA 3M2TA 1M10A 4JP8A 3FTQA 1G5QA 2WHRA 3U4AA 5FP0A 2JFFA 3LYUA 1J8FA 3LO5A 4NAVA 3AI3A 2Z5FA 5C4MA 4K9RA 1ZK0A 4Z9BA 1G98A 2H00A 3A4VA 1DK2A 6REQB 4CKBB 2OY0A 2XKAA 4H15A 1NUHA 4CNQA 4TN1A 5DM0A 3CPEA 3UK0A 2ZVPX 3DCJA 2Z95A 1GR1A 4KXYA 2HLPA 3VBEA 5AJZA 1Z18A 5G02A 4G3IA 4BVBA 1MHTA 1W36C 3DM5A 2PWAA 2JGDB 4PYJA 1KS2A 1KIAA 1E2KA 1VL2A 4WOCA 1HL7A 2CJXA 1U2DA 2E87A 4X1IB 3MWLA 4RS4A 3PX7A 3UQ0A 4Q5IA 2Q5LA 1E8DA 3AKDA 3JVDA 1XNJA 4RF3A 3K1AB 5G3YA 5C52B 5KOJA 5DZSA 2QRVB 3OO0A 3O4HA 5JD6A 3HRIA 1OBFO 1B0PA 2BM0A 2ZSBA 5IJ0A 1BCRB 4C4XA 3B3AA 1R6TA 3NM5A 1AG9A 4PNZA 4C30A 3O8LA 1TRKA 5A0VA 4QEZA 3UJCA 3PY8A 1OAAA 2DFNA 3PXEA 1DX4A 3OQHA 4O3OA 5KOIA 1ONNA 5B2ZA 1II8A 3L6UA 4BV9A 3THYA 3BORA 1N34B 1IJEA 1C1XB 2IX9A 4OBEA 1OAOC 1W9MA 2HIGA 4HUQB 2C7VA 3DSRA 2Z9BA 3VKUA 3JAKB 1PK8A 2EIHA 3B12A 1G5PA 2KLBA 3A0UA 1X7WB 3VH4A 1X2BA 3O94A 3U6KA 3W5BA 3PQCA 5LQUA 2JLRA 1MB4A 1KKUA 3AP1A 4NOMA 4LQ4A 1FMCA 3I2IA 4WKNA 2YOFA 1FP1D 3U56A 1A6SA 5LB2A 3ZNQA 3BMQA 3L0OA 3C5HA 1MOZA 2B4TO 3QFHA 2F4NA 2XQGA 3OI7A 3RFXA 1QF6A 4E12A 2AC7A 5GONB 5KYUA 2E37A 4D57A 4CODB 3CWQA 2FPXA 2Q8NA 3LWNA 3EA5A 4J43A 3FGNA 4IEEA 4A03A 4DVJA 1Q0RA 1A5ZA 3A1SA 4JT8A 3UN1A 3JD3A 4RESA 2PS3A 4IZHA 4GYKA 1BW9B 3GRRA 1ZNZA 1QIKA 1CE8B 4BO5A 2ATVA 2ZIXA 2BW0A 4YMGA 2HL6A 4YALA 3DE0X 1L5SA 4FHZA 3F6BX 4AJJA 4H59A 3M6VA 4YEDA 2W6ZA 5CNMA 4B45A 2AQ8A 2QMOA 1NKVA 1Y3DE 7ICTA 5FWDA 3VYVA 2QK4A 5EUQB 4AY6A 4FUQA 1KU6A 3CLVA 1K6IA 2B4QA 5D3ZA 4BNUA 2R6HA 4F5QA 3FYCA 3PWZA 2OM6A 2QRQA 5DPMA 3FGPA 3PVXA 4LDJA 4OLJA 4KXLA 2IXGA 4DPMA 2DFVA 4KPUB 3QP9A 2SKDA 4QU0A 4H3HB 2VN8A 3NHBA 2PAAA 1KDRA 3PVCA 4I4TB 2IUSA 1Q16A 3IG8A 4UTXA 3CMCO 3OG9A 1KGDA 3PGXA 4YRTA 3R7BA 5EWEA 3QKSA 1BXGB 1NVMB 4NCJA 1UBGA 3RYCB 1FRFS 5BMVB 5ADHA 2VHJA 1QVRA 1BJRE 4G07A 5IHPA 3NOXA 3PDCA 3B6MA 4XJVA 4Q1DA 1K8ZB 1OXSC 2W8ZA 1SG9A 4MLCA 5AKJA 2FQ1A 4EG6A 4MJXA 3Q10A 4WADA 3R7DA 1TW2A 3VR2D 3MOIA 2CZQA 4FKMA 4MB2A 3I9NA 2EVWX 1LJLA 4QZ9A 3PMNA 5IBQA 1L4FA 2B36A 2FMPA 1G8JA 4E5DA 3JPQA 1DQYA 3OEED 2CL7X 2H8GA 3DFFA 4BQOA 2IOFA 2G70A 1X86B 3DB2A 2PFQA 4O63O 3MR3A 1FQKA 5JSFA 4W9RA 1M1YE 4JLPA 4OMFG 3URMA 3HJBA 1WYGA 4ZVTA 4BQEA 4A0HA 2OUKA 4B3TB 5KKCA 2QD4A 3TQFA 2HSDA 3R6DA 4IX9A 1ZAKA 2DY0A 1JFFA 4AJ9A 4JMPA 2ZU0C 1DK3A 1S97A 3WGHA 3UBTA 4ECXA 3ROMA 3NBZC 5EJ4A 1F0PA 4Y1GA 1QF9A 1Y3HA 4BX2A 3ZHZA 3FW1A 3KVNA 3ZQKA 1KEPA 3WQRA 4TSKA 1XDSA 4GBJA 2QX4A 4FHEA 1SXJD 3AUOA 3L8ZA 4NY1A 1AB5A 1VIDA 2GCOB 4LOIA 1H2AS 2C1XA 1WUHS 4NC9A 1QQTA 2H3IA 5DCYA 4BZWA 1ZJYA 2Q1YA 1CKEA 4HAIA 2PH3A 3W5IA 2WHQA 2HDNB 1WWUA 2I7VA 1SVSA 3I01A 3MRXA 4OXKA 2VPPA 2W2VA 3LCCA 3MBYA 2YFYA 3SXUB 5DXFA 1TIKA 5CD9A 2ZTMA 2HV8A 5IZCA 5BN4A 3KKZA 2FOXA 1EK2A 3X1WA 4ZIRB 3LF1A 3ANMA 4YDSA 2ROQA 3DNFA 1YQEA 3MHTA 3B6EA 4R1OA 2EP8A 4EJ0A 4X45A 4Q4JB 3FNIA 1NW8A 5JY1A 2VCYA 4B82A 3I5AA 2W55A 1JROA 2H3QA 5KNCH 2IEAA 1H2YA 2JC3A 2UUOA 3PFNA 3N8NA 4ZFNA 1NUQA 2YOHA 4YJ2A 4Y67A 3CKMA 5A3JA 3I53A 2HCTA 2N1BA 4N54A 2D1FA 4EM6A 4IOKA 5DN9A 3H7IA 2HF8A 2AFIA 3V7KA 4H1UA 2ZRAA 3W0LB 5E8JA 3RS9A 4XQEA 4RGYA 3AU8A 2J6TA 2JRLA 2XIJA 3WX0A 2D5IA 4O2BA 2QT1A 2PWBA 4HN4B 1O96B 3UGJA 3TPFA 4DJAA 2JK1A 4L3VA 4DG9A 1J2TA 3KTQA 4A5OA 4QIWC 3VPAA 1TUGA 1NJ6A 3N5CA 1V48A 1Q57A 1ZCJA 4ONEA 2RCYA 1S3SA 3VO8A 1H2WA 4L0CA 2J30A 3VR6H 4CF4A 1X9GA 3EH2A 2DF4B 5MN5A 2OG2A 4INPA 4DDHA 2EU8A 2E55A 4EK9A 4PIPA 5IWCA 3NTXA 2O1SA 3QNMA 4R6XA 3KBOA 2E85A 3WAKA 3N6RA 4KAJA 4C8NA 3C1UA 3K1TA 3RJ9A 4WOJA 1B6SA 2JVJA 1QRDA 3NCTA 1B3RA 2G88A 1QIJA 2J41A 4WBNB 2QYOA 3BTOA 1U3FA 4II3A 2GGSA 4FDTA 4O08A 1ZI9A 2CVPA 4X1OA 1V2HE 3C16C 4ZJZA 1RE1A 5DNWA 2AGPA 4J1SA 1OFUX 3OM8A 4IQ8A 2EX0A 4P0PA 3ZE9A 1PQYA 2WAQC 4B44A 5D7BA 5KFOA 3T3EA 4I8IA 3JQRA 2AGOA 3ENZA 5AM4A 4TZ6A 1Q3KA 2FPWA 3N6XA 3HA5A 1O08A 4DFMA 3CG0A 3WDSA 1JR4A 2LWIA 2BE9A 3G7UA 1AN9A 3ZDZB 2QOEA 3E3MA 3FHLA 2HRQA 1AGRA 3H9EO 3PF9A 1KZ7B 4KX3A 1QPGA 5L1MA 1ZGZA 2FWMX 1ILWA 1Z0UA 3QOWA 1JDBC 2ZETA 4UREA 2VANA 2HH9A 5HKKD 2QN6A 4LZPA 2C5FA 4G81A 1P9NA 3DOIA 1AD2A 1KFEB 5HKAA 2G4VA 4EF5A 4RQ2A 1QS0A 1Z68A 5DQGA 1SKMA 4BWGA 1OV4A 2NZVG 2C5BA 3T5HA 1YULA 1R1DA 3AX6A 2XA9A 3G6XA 5C81A 2X0EA 1QRRA 2KE7A 3KEFA 4ZCQA 1G2IA 5H70A 1GTG1 3ZWPA 5FLKA 3ACBA 4AYXA 3ZWQA 1HWYA 3EVBA 4C0WA 1CJSA 2Q9BA 4QQ8A 3KE9A 3I8SA 1VOTA 2CXQA 4KE8A 1DC4A 3HLKA 4NENA 3MIZA 2RGBA 3PO4A 1G8PA 1AZTA 4NV3A 3F6EX 3SM3A 7ICRA 1C7JA 4GNRA 4IUCS 5JNLA 4M6WA 3GILA 3CZAA 2XJ4A 1IXRA 1T0UA 2EZXA 3GAMA 1EB8A 1NYLA 1WVMA 1Z16A 5KTYA 3MINA 1YA8A 2FB9A 3X1MA 3S27A 4HZIA 3E9MA 2PK3A 4BC1A 3EOAI 1RG6A 5KFDA 1JQAA 4WOBA 3T3HA 1VCNA 2X5JO 5KYKA 4QBTA 1IPFA 1Q77A 5C8DA 1MFPA 4HLNA 4WZBB 2IIBA 2NO9A 4GDFA 2QWXA 3S2GA 1IN4A 1M0TA 4LC1A 5KT3A 4NZZA 1V8FA 3FTNA 2A1UA 4LDNA 3HKEB 4RMJA 5TQ2A 5LQDA 3OF3A 3PNPA 4RQ1A 3PE4A 5AIAA 1OAOA 3LQQA 3A32A 1Q74A 3ZK9A 4KTVE 2G36A 2XECA 4J49A 3ZZTA 1HA3A 3ISVA 1QR6A 4KR3A 4A0QA 3GEPA 5BWLA 4MLZA 4DGQA 5K2OA 1NT2A 4B4WA 4ZVRA 3S29A 1RRMA 4G0WA 5M5BA 1C1YA 3U6BA 2OSBA 1IDN1 4OL9A 3EZ5A 5I4CA 4BUGA 1ODSA 4IDNA 5KNIA 1JB1A 3AESA 4TT3A 5AVUA 4TRRA 3WVNA 3CS3A 4H4EA 4D74A 2WV9A 3SENA 1ZM2A 4CF7A 2JKZA 1YBVA 2G1UA 2CY0A 2PRJA 5JNWA 3PQ4A 4M9XA 1KH3A 1OI7A 1ACLA 1QLJA 4IFEA 3OQNA 2Z5LA 1HDOA 1ZQMA 2O2DA 2QRJA 1KAQA 3O5AA 3AEZA 3NUZA 5B4UA 1E3JA 4DCGA 1F1BA 5A4KA 4J91A 5F3RA 3U3DA 1CY2A 9ICOA 4CCYB 3PI7A 2HHHB 2EF0A 1WCLA 3DMTA 4MVJD 2GLEA 4XQCA 3SBXA 3PX0A 1JZSA 3COZA 2FJ0A 1EQ2A 5D87A 3NONA 2NXEA 4JFRA 3OOSA 2KS6A 1CUEA 1WCV1 5TMBA 3LVVA 2EGHA 3EPKA 4BMOB 3EXG2 5IP5A 1NFRA 3H4BA 3GJ6A 1PS9A 4FBMA 4B4UA 5EINA 2OL4A 2CHEA 3PFGA 3C3AA 1DRUA 4UQGA 5H3LA 4EGCB 3RHFA 3C23A 4UOZA 4GAEA 2PRSA 1FQWA 3FGZA 4QTZA 1WLYA 4IIBA 1E9EA 3HCAA 3T5JA 3F74A 4QIHA 4ZCMA 2ZS7A 5J9FA 1CF4A 4JUFA 3EF1A 4X7RA 1X2EA 2HVHA 2BSXA 8ICZA 3DKIA 3FLBA 3EPIA 1ONBA 2FJ6A 4TWBA 2WIFA 2OGWA 1HO3A 5EKUA 4ROSA 5U9CA 4FFBA 1W5AA 4MQLA 4OAOA 5CLQA 3CJRA 4W1PA 1VHWA 3M6ZA 2YQ5A 5JC1A 3VNBA 5A6VA 4IQ0A 3DOEA 1JVNA 4HDKB 3F1KA 5JSUA 4HDMA 3WWYA 4GW3A 1SCNE 2HZBA 3ZHVA 2A59A 4BECA 3AERA 3BN3A 3K31A 2FPPA 3FDIA 5HIMA 7ICLA 3H5IA 1IQUA 3BIFA 5LZ2A 3U81A 4C0JA 1ESCA 3K8OE 5LIRA 3OQJA 4HVLA 1HYQA 3FF1A 3CUSA 5CP8A 4W1SA 3D6FA 5DN6D 4ASUD 3HVIA 2DF8A 1M5TA 2BMDA 1Y7LA 3IEIA 4O1MA 4AZTA 3KFXA 1UINA 2XEXA 3WNQA 1XEWX 1Q0ZA 2G5IB 2GD2A 1XL1A 3F8SA 4YJKA 2DFKB 5A62A 3N28A 4P7BA 3HCWA 3OEWA 2OGUA 1JIQA 1BHO1 2RAVA 2BH9A 5BQ3A 4N0QA 2BZFA 1PT8A 4CM6A 3D3QA 3CJQA 3SEZA 4ZWNA 3ENNA 2C7RA 1N5LA 5HGJA 2YASA 4C08A 3Q7EA 3O8BA 4R2JA 1Y5LA 4JKIA 1S5LU 1MV5A 4LY0A 4HH3C 4FSDA 1AZWA 4FFPA 3IEVA 2Q5OA 5CT4A 3MT7A 3TLYA 3DZ8A 5TMEA 2NUAA 4FS8A 3Q6NA 4CYMA 1PBTA 4Q1FA 1C9EA 1VMIA 3W34A 3KQNA 1P8AA 5KFGA 1KEEB 4GI2A 4DRXA 3M2PA 5JCXA 2CBXA 5LZ7A 1C7QA 4I1IA 4PEVA 5JPDA 4ETMA 1YDHA 2P4HX 2C92A 4BMCA 1LU9A 4EPTA 4LSGA 1VE3A 5FI5A 4R8UA 2JGRA 3TJMA 2UVPB 4HNUA 1EVQA 1EHIA 3VTFA 3M1LA 1GKYA 4YRZA 3LZDA 1MC1A 1MOPA 2HBLA 3IOMA 4HWSA 1JX6A 3TOCA 3QKRB 5LYJF 2Z56A 4Y2SA 4LY6A 5ADVA 4DLYA 4MPPA 3QHQA 9ICVA 4GOKA 3SWWA 2Z2XA 2FE1A 1XU4A 3HDTA 3BTSA 2XV1A 4CG3A 4D26A 3NGDA 1KO7A 4UVGA 1SA0A 3GHHA 4OGGA 1CUBA 3GP3A 4Q39A 3T52A 2PUWA 4R9VA 2NQTA 2O20A 1Z29A 5IWAB 5EJ5A 1N1MA 4RK0A 1C7YA 2PZ8A 5AESA 1T1RA 3S68A 4KQ2A 4HQOA 3REOA 3DBHB 3MWKA 1NKEA 2BV3A 1T1SA 4WK0B 4OHUA 3EVFA 4IX1A 1L4HA 2P9FA 2HDOA 3FMOB 3HC7A 2IHKA 5BV7A 2WY2D 3T8YA 1ZQBA 1ZCZA 5I7UA 3BQ0A 3GOHA 3EX7C 3O82A 4WNAA 4L5BA 2OO3A 4LWQA 3H9JA 4TLCA 4MP3A 2QE6A 3QWHA 4I4NA 4E7OA 3BL5A 2X5KO 3E58A 2GHIA 2W98A 4UCQA 2R66A 2J7KA 1OR8A 3GARA 4MWOA 3S5UA 3PFFA 1P9LA 2DULA 2E4WA 3KHUA 4YAJA 4MVWA 4WLVA 4QZHA 1NVBA 1A95A 4EG5A 4AZ0B 1E58A 4ZU6X 1BX0A 1UMBA 2FE9A 3R74A 3FZYA 1OT3A 1FUUA 3K0BA 1VJTA 3OF2A 2R65A 1U7XA 1WHTB 1XZQA 5ISMA 3C97A 2ZRKA 1XPOA 2HJVA 5IK2A 2VVTA 2E4AA 3EASA 5KINB 3R3JA 3G1UA 1TAGA 3QUTA 3AEQB 4CM9D 4RT2A 1FK8A 4LVCA 3IMKA 5EQFA 2FVYA 4AUKA 2QLLA 1UK7A 5L1KA 1YS4A 3HKCB 3PJRA 1D6SA 5BP7A 2FKNA 2F8KA 2DHEA 1I6WA 1IOVA 5K3FA 3M5WA 4R16A 4QVKA 4PSUA 1O87A 1JPVA 3EC2A 1Z35A 2ZJ6A 4R1PA 3RHZA 5T7BA 2C0QA 1U0GA 2GEBA 2XC9A 2BQUA 4OQDA 5GTDA 1AMOA 4RV9A 4Y2VA 3AOEC 3VHQA 4MYHA 3A9WA 1OXMA 4EHHA 1K7SN 2ZWOA 5ENZA 2DAPA 4OJKA 3TFWA 5HKLA 3A10A 1JRLA 1GAQA 1MAAA 1V9LA 3DBRB 3RREA 3L40A 4F3KA 4KN7A 3CKYA 2QP3A 3EH1A 2AU0A 1GUFA 5K3BA 4ZTUB 1TE2A 2ONKA 2A19A 3E0FA 4GC6A 2GPAA 2YZ7A 1N2HA 5KFSA 1F4VA 1Y8RB 5ARBA 1YTLA 1H8EA 1EP3B 2ZXFA 2EQ5A 1X9XA 1LW6E 1K9VF 4RA9A 5J2KA 3IO3A 3QJYA 1CDEA 3AHIA 3QVGB 2OORC 2O8FA 3CVYA 3LRPA 5AXCA 4I2CA 1K5DA 1GN8A 4R5HA 5KYTA 2Z04A 1LC3A 4JR0A 1SCQA 5K6AC 2PE5A 1C1HA 4KHZA 3OSZA 3KDSE 2BBSA 5DM1A 4TSFA 1Y1PA 1LLDA 2DG2A 3EVZA 3ZE7A 1KYWA 3VNVA 1PU2A 4D98A 2DH6A 1L5QA 3TGWA 1XDWA 4MULA 2FLPA 5LC1A 1EXDA 5D5PA 3B7GA 3QU2A 4PLPA 4J9OA 4M47A 4LE2A 5FKJA 4ZO7A 2WYOA 2XH8A 2UYCA 4CLDA 1ZLYA 5J2AA 1N6LA 1DIOB 1EBBA 1VKRA 2HC9A 4P4GA 3ZGZA 1CB7A 3BXHA 5CJJA 1R6BX 3V6LA 1ZYQA 2V97A 4J1TA 1K0UA 2GM4A 1RSZA 1VYUA 1WY5A 2R1VB 1P45A 1P74A 1KMNA 4EUSA 4PIVA 5JU6A 1P5ZB 4HNRA 2XE7A 1WAMA 3RRNA 4EJFA 5E7MA 4FOOA 2JMGA 1J8DA 4WZBE 4F2WA 4R6WA 2H3HA 4KLCA 4FEGA 1N3IA 3CZ5A 1ZP6A 1GAXA 5KG5A 4H0CA 5KFKA 2WIAA 5B3LA 1E0AA 4RENA 2QD5A 2IVZA 1E3DA 1ZQ9A 1P0CA 5BWBA 4G5GA 4PC7A 4HF7A 2Y1LA 5J5AA 3GEDA 2J4FA 1T3TA 4F8JA 3TFQA 1WCIB 4IDQA 4H4DA 4UUMA 4IAOA 3V46A 3OHMA 5BSMA 1BNPA 2R1TA 4RPHA 2W4QA 2V6JA 3HXOA 1RAGA 4GZMA 3R5TA 3DQPA 1PJQA 1S0UA 3WDLA 2NAFA 3TANA 1XX6A 3K2QA 1GZ3A 4KNYA 3L1KA 4UTRA 4KXWA 1QTQA 1NONA 2Q99A 2ANBA 1W4ZA 2D6FA 3AH8A 3K5PA 4HVAA 4HOYA 2ZE8A 5KAMA 4P34A 2VWGA 2W6IA 8ADHA 4I81A 6LDHA 1AKTA 4WLUA 4TTJA 1RZ3A 2DQNB 4CTOA 1OB2A 1DCMA 4XR4A 3P9XA 1JG3A 2NWQA 4I55A 3TTYA 4UHJA 4EKNB 3AIMA 3TK1A 1JN0A 3GNQA 3KWMA 4MIKA 2OAQ1 4K9QA 8ICEA 2GAOA 1K7FB 2ZI7A 1MQ3A 4L4UA 1ZL2A 1B15A 1ZQOA 1AT1A 1MB3A 2LBPA 4JLAA 3TIXB 5JVDA 1KRWA 1DZ3A 2YB1A 4ZEOA 1N36B 2HA2A 1QAOA 2FWIA 4R0MA 2A7QA 5T4BA 1QH8A 1NKSA 1S76D 3P96A 2QTLA 3DBLB 2D8MA 2CXHA 2YIJA 3EXHC 2K4IA 3KZXA 1KYIA 1ZN2A 5IVPA 5AQEA 3CZQA 5DM70 4I6JA 2G63A 1D8AA 4ZO8A 3BREA 3Q8PB 2NO6A 4K86A 3KJFA 2PS1A 3O21A 4AAYA 1Z74A 3VGPA 3HUFA 1KI7A 4OM8A 2AQKA 1TM3E 3GJTA 2TSYB 3ROXA 3EK2A 1IY2A 1J99A 1AXEA 3A3OA 2ZRLA 4E4RA 5BN3B 4X62B 2WFAA 4Z86A 1V7QA 3NMUF 2H7VA 4DEZA 4KSCA 3NHKA 2KVSA 4DS5A 3GBSA 1E6EA 1XQ6A 4I1YA 2RHWA 1U47A 3DMRA 1IQPA 2WG2A 5FNVB 1PJSA 1URPA 1FXWF 1SNYA 1L6NA 5AYVA 1OH6A 3E3AA 3BM5A 1GU7A 4Q4CA 1YS9A 4Q9DA 4L8LA 2X1VA 4K46A 1LPAB 2F00A 2VZEA 3V00A 2A88A 3U49A 4C7ZA 2BPGA 4RAOA 1ZOLA 1U2DC 3UHJA 5HTKA 5CBKA 2X9LA 2FZLA 4UOQA 3Q7IA 5FFNA 3EZGA 2DTEA 1W5TA 3O38A 1ESZA 1L1EA 2Y0EA 1LBHA 2I6FA 2R48A 4NX2A 2W7PA 2Q3MA 1U48A 2QN9A 3A1NA 3ZU2A 2C04A 3ZTTA 3DE3X 3T94A 1ZD8A 2Q3JA 3PEVA 2Q0SA 4QWDA 4B3MB 2WF7A 1XSEA 1GPWB 1TUIA 4A8EA 2B7LA 1PR9A 3MUFA 4LVUA 4DREA 1RAHA 5IC4A 4ZICA 2N9UA 3NW9A 5GOTA 2DFPA 4PS0A 2HLHA 4IO1A 3T7EA 1NUTA 5DM2A 5DNUA 2ORYA 2PMKA 3W2GA 4QNMA 1RPZA 2Y1IA 2WUGA 4IJ6A 5DH9A 4LG1A 3ZWXA 4JNKA 1AK2A 2IH2A 3B5JA 2IU6A 2I9KA 2KP7A 3G88A 1AK9A 5AM5A 2FI1A 4BRSA 4JVNA 3RVJA 2KZMA 4L02A 1Z06A 1II9A 4WOKA 2IV3A 5MGBA 2AG6A 1FSFA 4J94A 2VP6A 4BNZA 4HYQA 3LIPA 5BN5B 2DM6A 3H2KA 1OW3B 1HT2E 3FVVA 5MDHA 2ZT6A 1WV0A 3ZHUA 2X8WA 1LSSA 4Q9HA 2YIMA 1NN0A 5A3SA 4FBLA 4K0KB 1H6BA 4GF5A 1NHGA 5IM5A 2YZGA 3JQ8B 1MOQA 3GNTA 2QTHA 1QBKC 2R8PA 3D6TB 1JLHA 4L8WB 4IP0A 2UUBB 3I2GA 1QVWA 3U4IA 3U37A 3H2YA 2A0WA 5DCLA 2JHCA 4J9KA 5BYJA 1QNLA 4MV7A 2EZ8A 1ZI8A 1NZJA 4YP6A 3UJ8A 2C99A 4CUJA 2Q7DA 4GX5A 5CBPA 1QDLB 1TM4E 2AL7A 4XSHA 4JI3B 4GO1A 3CRZA 1IAVA 2B83A 3HFSA 4X7BA 3MFIA 5JTTA 3LUCA 4DL9A 3A28A 3B20A 3ZJVA 2VA3A 2BCQA 3O2JA 3PRJA 4QYIB 3U44B 1XLTA 2WWGA 3JR3A 4LBZA 4OXXA 4B8ZA 3UCXA 2XVYA 5KSOA 2ENUA 2AQ0A 1PO7A 3KWLA 5DTMA 1EEXB 3JALB 4UTNA 2RBKA 3NIDB 1JI0A 4WACA 1DLJA 2IY7A 2Z3WA 5CU7A 2Z0MA 3SSOA 2AR0A 1Q1EA 2PT6A 2OAP1 2FSGA 1SQ5A 2XRYA 5FL7D 1M34B 3LYHA 3SQLA 1TYBE 1M1YB 4NCKA 2ZIUA 4B8WA 5T4HA 4V0LA 1C50A 3DMYA 3PNMA 1GPAA 4ITUA 2GKSA 4NLGA 3BJRA 5MFPA 2J6HA 2WOJA 4INAA 1MX9A 1C20A 1I2ZA 4YO8A 1WB9A 2NADA 1LVGA 5KFXA 3QU7A 4NICA 4Q4AA 2C03A 5ADWA 2AZDA 3S55A 3TBHA 4HFJA 5JSKA 3VVCA 1E4YA 1T9ZA 4MUMA 4FMDF 4RY2A 1TQHA 1JIUA 3HGTA 4YDRA 1VMEA 3WZMA 5IVDA 5K8UA 3N7UA 2GARA 4I27A 3NJRA 5EGNA 2XNSA 2SKCA 1RIIA 3OAAA 3HX0A 3FOZA 3AOEA 3E1SA 2CFTA 4ED6A 2XB4A 4DR2B 5HQ3B 4ZYVA 1CUWA 4XYGA 4UJ5A 3SZMA 1RXYA 3TZLA 3A1TA 1J5XA 2DFLA 2PQMA 3AETA 4XIGS 2VHUA 4KHPB 3OE5A 3B1VA 3GIDA 3DHNA 2ZI9A 3F49S 2W3RA 2QTVB 1VTKA 2FEOA 2E5WA 2O48X 1RXUA 3KB8A 3GJ3A 1W46A 1F7VA 3AR7A 1CC1S 4WK4B 3GY0A 1P4AA 1VHQA 1G1AA 2GD1O 4P3KA 3OFND 3JRWA 1NXPA 2DQYA 3STYA 3RC9A 1Y5IA 3VNAA 2H1RA 1ZXBA 3AEKB 1SVLA 3D1VA 3D4OA 2AOTA 1Q20A 3N4MB 2P27A 3SYNA 1L8LA 2V8BA 4RYDA 1YMQA 2CHVA 3EPGA 5FWXA 1PGPA 1K7YA 2FY8A 2A1JA 3ONDA 3L0IB 5D01A 1Z34A 4B2YA 3O92A 4QC2A 3TS1A 3JZAA 5HR7A 2QYTA 4RANA 1KDZA 5A7HA 3S2IA 3A3KA 4PZPA 1ZONA 1IJKA 3AUTA 3EISA 2Z83A 3KHTA 3CLRC 1PT9A 4QXQA 1VZ3A 2Q6LA 4DL2A 1S0VA 2JLQA 2ZUVA 3OX2A 1JEQB 1ZVMA 1E3WA 7ICOA 2VJLA 3UT5B 1U3WA 1DLIA 3BXXA 2OV2A 3U0VA 4EITA 4NLCA 4PCAA 5JWRA 4NONA 5F7JA 4Z2YA 2H5LA 2M9NA 2UUAB 1B00A 3R6TA 4LOKA 4RKRA 4KQXA 3GV0A 4CUKA 5G1OA 1DAPA 2Z4RA 1QM5A 1XXHA 2JF0A 2HBRA 2VAPA 4TTIA 5D1NA 3CRW1 4PM4A 3K1ZA 1PUIA 4FYPA 3D7MA 3R4CA 5TR9A 3OT5A 3TX2A 2BRUA 5L40A 4EHIA 4V1CA 5BNIA 4AQYB 5BT8A 2P9EA 4ENSA 2RJ3A 5JD4A 4X8MA 4EYIB 2A84A 1XWLA 2ZUWA 2Q49A 4AJOA 4CMAA 5J4YA 3OFVA 4UAZA 3QFCA 1A97A 2V4RA 2EKZA 3CNHA 4MFFA 2Q9AA 1QYDA 1Z5VA 1QOZA 1H6DA 4ZGBA 4EF6A 4BCDA 3ROQA 4BO8A 5DLGA 1TVEA 1J06A 7MDHA 2CXSA 5KNBH 3FMPB 1EWVA 4PX5A 5ALEA 4RLSA 5CA0F 4CF6A 4FI3C 1CRLA 1KW4A 2YYZA 1BKYA 5K05A 4RVHA 3NVKI 2VHVA 1I1QB 3RUDA 1CUCA 4UB1A 3IUQA 2OC4A 4LK3A 2O8CB 3HTXA 5FPYA 1I7PA 4QUBA 5ECDA 4BNYA 3WYBA 2BHSA 4XVCA 3N7TA 4V0KA 2QZZA 4UBMA 2GCIA 1RCTE 5KT5A 1Y8QB 3K4PA 3JQ7A 3HM2A 4EJSB 3DLTA 3DDZX 2IYLD 3TQIA 3KT0A 4X60A 2XA2A 4YR3A 2HWKA 4I9NA 1DBRA 3DLAA 2NRVA 2AN5A 2BEWB 7AT1A 3HFJA 4TOIA 2R0QC 1X14A 4O5CA 4XE5A 3JX9A 1TL7C 2ECQA 4QTTB 1X1BA 3NWEA 3GO4A 2IC5A 4D9NA 1AV7A 4MF2A 2FR8A 3P0RA 3U60B 4B6GA 2HRBA 4BWMA 1ZUHA 4KWCA 4IQTA 2AEMA 2WT4A 3DZJA 2DBVO 3BQ1A 1LWOA 2BSAA 2JJ1D 5J0WA 1YUNA 4KITB 3EXHA 2OCKA 5ESXA 3HNPA 3BGDA 1G60A 4P4OA 1SBQA 4PHCA 5A4AA 2VF2A 5K4LA 4CL0A 2AGQA 3MUOA 4ZZ2A 3RKUA 4NV1A 3G5TA 3T1VA 1JDNA 2O07A 3NAZA 4E33A 3NC0C 2W54A 2EWVA 2SHKA 4QICA 5CVUA 4JLMA 2DLCX 4PFQA 1VFPA 2JXJA 3UWDA 2BTQB 2OHJA 3P0FA 1MUUA 2Q6VA 4XIYA 4ZYWA 3DV2A 5D7NA 4TUPA 3HR7A 2FCAA 4PHHA 2AFVA 2NZWA 2Y9UA 1Q83A 2Y0DA 2FSVA 4TLAA 3RAXA 4DSZA 5AHWA 2ZI4A 2R6R1 2Y0SF 4PRYA 1AKRA 3TTUA 4QWAA 4EUFA 1U2ZA 1QHSA 5I4IA 1OKKD 3NGXA 2VK2A 2QGZA 3I3SR 4L78A 2G9UA 3DNPA 4YMWA 1O9GA 4IIFA 3J7TA 2GR9A 1IXRC 3PFCA 1LTKA 5EP4A 3OJSA 4NESA 1IVSA 4O8ZA 3OQIB 3AUSA 3A3NA 6ABPA 3SOPA 1E1CB 1E5QA 4ZHQF 2BP7A 3GI1A 5A3QA 3IAFA 1V16A 3OOEA 1Q2XA 2WNIA 5FUWA 5CTAA 4DSIA 3KG2A 2ZT8A 2G77B 2BM8A 4NS1A 4ZEMA 4I6EA 1YS7A 3GIIA 1CBUA 2GCEA 5GV8A 2N75A 1ZR2A 2Z4TA 2HRDA 5BVGB 2UXCB 1EHCA 5F51A 2BYTA 4QTYA 4HNAA 3LOPA 2B25A 3HSYA 1SXDA 1M6NA 4US2R 1RJFA 2X8LA 1ULSA 3BXOA 2HO5A 1UXJA 3IIIA 2VDWB 1QO0A 3SVLA 1Q7CA 4MICA 1DGJA 2E6UX 2NUPA 3U0BA 3QPCA 3K53A 3QWBA 5L6LB 4ZAGA 4XLZA 1ML4A 2EZ9A 4RIHA 1NATA 1MABB 4MINA 5TS2A 4ZT4A 2AXPA 4Q93A 1QZUA 5EZYF 4FOSA 2WMYA 5EJIA 5FOVA 1P3Y1 3S8MA 4Z54A 1CRPA 3E2EA 4XOUA 4WJKB 2ZIWB 4I6GA 4HRXA 1S2MA 1NP7A 4HLCA 1GQSA 1BPXA 2WWTA 4EIWA 1ZUIA 2KJ8A 2XVTA 2JHGA 4D9EA 3LHDA 2QLBA 1Q0PA 4X3OA 5EESA 4XWOA 1XA0A 2HMTA 3DMTC 3FSRA 4P93A 4AN1A 4X91A 1KYYA 2G17A 4Q8FA 3RU7A 4MWZA 4BMYA 4LN1A 2LE0A 1YTUA 3WIOA 1Y3CE 3W8RA 3T0FA 5K0JA 4NNOA 1ETHA 3KXLA 4AJEA 3GFGA 2G1PA 1ABBA 4FSXA 4F1KA 3R0ZA 3RVDA 1E3MA 3IKJA 2C20A 4IIVA 3RHSA 2H5XA 4TT8A 1BNCA 1QONA 2QRKA 4D3SA 2B0JA 3KLOA 4N8EA 2VJ4A 4BE7B 1Z6PA 2WAYA 4MARA 4RH0A 1U7UA 2VNAA 2WVGA 3WOVA 3EDMA 3OEHA 1TNDA 2YB4A 4DWVA 5P21A 2IPAB 3MLEA 4F97A 1KFBB 2GS9A 4ZXPA 1SHUX 3NHMA 3EDQA 1QK3A 1QKJA 1GILA 2YWJA 3PR2B 2ZSHA 1VSVA 5D3MB 1SVWA 1LCIA 4GC5A 3FKJA 3GT7A 1HNWB 3QLJA 1JPJA 1PJAA 3ORQA 1NK0A 5JJBA 1WSAA 2IYTA 2REXB 3NBQA 3O84A 1XAJA 4G25A 1CQJB 2DHCA 2C54A 4JI5B 3V1TC 2HQOA 4MIOA 4Q44A 1DT3A 1S2LA 3RWBA 2NU9A 4YD1A 3BDVA 3MWEB 2EP5A 1CZRA 3I32A 2E1PA 4UZSA 5DNVA 4ZDIA 2GUWA 2CB9A 3PSTA 4PCVA 5IYZB 2KHQA 1RXSA 3IERA 4OQQA 2IWHA 4LF5B 3CV3A 4C6SA 2Y6UA 4FEYA 3L1IA 5E6UA 1M34E 2AXNA 4HO1X 1RCUA 4YQZA 2IQIA 5CFPA 4NU6A 4QYSA 3QJ5A 4LPKA 3T7RA 4KWIA 2KJ5A 4LZLA 3PI6A 4RGQA 1EI9A 4I9FA 4OJOA 3EXEB 5DMHA 4F56A 5FJJA 2C2RA 3LXMA 2F2TA 1J2MA 4UOEA 3CMMA 4DL7A 5HKBA 1CS0B 5C8VA 1DGQA 1QPBA 4BFLA 3UJ9A 3AT1A 2ECKA 4V2UA 1USWA 2M1XA 3OZIA 2M2IA 3AY0A 4F2HA 1P5JA 3EFHA 2RMKA 3GF4A 1M6HA 4G26A 3KOOA 2IGBA 3E53A 3IDQA 2XTJA 5IJWA 1SD5A 2VL7A 1E9SA 3B8HA 1E2MA 5F21A 3FZQA 4P22A 4Q7JB 1SY7A 4Z9AA 4DV6B 1YZYA 2CVHA 3SJ7A 3TAPA 4IW3B 1WHSB 2Z2YA 1FFAA 3VPBA 2MRLA 3IL2A 1PTKA 1ZXIA 4AECA 4DQKA 1L5YA 2J9XB 3F4KA 4X1KB 4M3NA 3VNQA 1N2EA 2E49A 2NACA 4IG4A 2VJMA 2VP4A 3A0BU 2ERCA 1GRVA 3E8XA 1F9AA 3FUWA 4E4TA 3IXQA 5LP6B 3ELYA 4WCVA 5JROA 1E2FA 4FZ3A 4YFKA 3MDAA 4P36A 4RPLA 3OOJA 1Y98A 2O2XA 3I2JA 5JDIA 3SS9X 1OXJA 2R84A 3MSXA 1NNSA 2RC5A 2UVDA 5KQPA 4AP9A 1Z7EA 4PHTA 2R4QA 2ZWMA 4D42A 2QQGA 2NVWA 3PEFA 3GFRA 3LPLA 1YFZA 2FJUA 3DLBA 1KQFA 3EWNA 3FPBA 3IEKA 3AILA 5CYPA 3D31A 2Y4NA 2DUWA 3HBFA 4TYNA 1UZAA 3L7KA 2EL7A 3IBCA 2WMDA 5FH9A 4UB2A 2QJFA 1Z0SA 2RHCA 4U7GA 2YINC 4WW0A 3K8ZA 1IUKA 2HAEA 3H6GA 2I6XA 1Z5OA 1WXIA 2C5AA 4ZGWA 7ICEA 3IPYA 2HHCA 2A1AA 1LEHA 2ODBA 1GGFA 1XHEA 2V3CC 3ZY3A 4G4SP 1LPSA 1LW7A 1NFFA 3W5HA 3TIVA 3BCUA 1TAHA 5FV7A 4LDZA 2WSMA 2P9JA 3PQ8A 2XMRA 1KR2A 1YQGA 2DQSA 3K1YA 2NSDA 3ORRA 1GPNA 5J29A 1PFQA 4UE6A 3HWSA 4I4LA 2CRXA 1GU0A 4JUAA 3JXEA 5EGSA 4O3QA 2JEGA 1DP4A 4YRNA 2OPBA 3VSEA 3QE4A 4DLUA 3WJ2A 4EVRA 1O89A 1P2SA 3EOZA 5CB0A 2UYOA 3RQIA 5K6RA 1K3FA 4YQWA 2WHXA 3AJRA 3QFRA 4FDVA 3ISJA 2GI4A 4K1XA 1FTSA 4MMYB 1LRLA 5DRYA 4QBFA 1AHIA 5KOHB 3VBCA 4CMCA 3V7YA 5FNZA 4YJ3A 3IUJA 2JGKA 1TYCA 4BN5A 2Y0BA 4DL3A 2NRXA 5A4FS 5A7GA 4HS9A 4EKIA 3OZAA 4E08A 5I5EA 3EC1A 3TX6A 3DHVA 1Z0DA 4G09A 4KQKA 1NIPA 3AHHA 1EAMA 4GG1A 2XDQA 3HS3A 4BNGA 2PX2A 4K9SA 4KVAA 4GQBA 4G41A 2WYIA 4XDZA 2WD9A 4NNJA 1QIHA 4ALLA 4DPKA 2QEQA 3QF7A 2AOVA 1HETA 1BOFA 2YICA 1HE2A 2QPOA 4RO0A 4KIWA 5IDVA 5IANA 4CR7A 1UK8A 5JAUA 4TRJA 3KTOA 3QA3E 3KRTA 3GDWA 1FMTA 1U2TA 4J03A 1MOSA 4CQMD 1U6IA 4ECEA 2A4MA 1RVV1 1HLPA 2RFLA 2R6AA 3TD2A 4UHDA 2FP4B 4AUMA 1B6GA 1NMEA 3IQFA 4E1BA 1IOWA 2ZIGA 4IH9A 3CNLA 5G0TA 3WKEA 5EERA 4PSKA 1ES9A 1GSOA 2NU7A 3B85A 5FBQB 8AT1A 1HZZA 2G7MC 3VC1A 1AQJA 1R18A 4ZVUA 3FOAA 1KRHA 4O1IA 5G4KA 2FMIA 1RDFA 1JEEA 4HRYA 3MB5A 2UYYA 5ITZA 4U7CA 3I8OA 3G8AA 1IN1A 3L0ZA 2MWMA 3GEEA 3M3DA 3CCCA 1QP8A 2HPAA 2J31A 4IEFB 3JD4A 4LISA 4DQXA 1ZM9A 1YZ6A 1SGWA 2PXAA 5AWFC 3GEGA 1JXOA 1YQ9A 5CX1A 3LM8A 1L7AA 1NUSA 5IKEA 2X6TA 2QS9A 1E0KA 2NP6A 5CVDA 3GVXA 3EGXA 1ZUWA 3RS8A 4LNHA 1G2QA 1RIFA 2W6JA 3P2MA 3RJZA 1TUBB 1B1CA 2I2DA 4B76A 4J1TC 4JDUA 2AZMA 3PV0A 4W99A 4M1YA 3HRHA 1YDWA 4PBSA 3ZY4A 5I9IA 5AM3A 2HA0A 5JRZA 1FDTA 4P58A 1SRRA 3ZIDA 4X97A 3ED5A 2MINA 1PX2A 3PC4A 2ETXA 2XAAA 4DLEA 3SX2A 3VC7A 5E7JA 9ICTA 3VU1A 4O2AF 4FE4A 5DDIP 1Y48E 5GADl 4HNHA 5F7XA 1M8KA 3I72A 3BZWA 1O5OA 4JYMA 3DKRA 2YTZA 4RY9A 4IR1A 5EHZA 4OQFA 2W7OA 3P0HA 3A7EA 4C0SA 1NBWB 3NVMB 1YMUA 2QI9F 2PGNA 4ZCIA 1K8YB 4PHAA 4HEHA 4MDFA 3WXBA 5DYWA 5DTEA 4MIEA 1N6PA 3FUUA 4AKGA 3S44A 1UC8A 1N3LA 3VPGA 4I4IA 4CF3A 1GCOA 5HUJA 2P0YA 2D6FC 3L4EA 1G7SA 2F1KA 5LD2B 1QCYA 3WLNA 2WICA 1VPDA 4W5NA 4R1UA 1M2NA 3LLUA 1MXFA 2IQ5A 2PXCA 2HRCA 1D9DA 2R7MA 2A33A 4U2BA 2ZYRA 4HTFA 5K2MA 7ICPA 2QM0A 3RVBA 5EXEA 3QU4A 1H1LB 2PBLA 4BLRA 4MHVA 4KBGA 4C3VA 2H63A 1JL3A 2EFJA 1HEKA 4QSMA 4J2HA 3E7FA 3K8YA 5AD1A 2IXBA 3T34A 4D79A 3GW8A 4ZAVA 1ZBDA 4G9EA 2A3VA 3IKMB 3C7AA 4RTNA 4ER5A 1CLEA 1TQDA 2GASA 5ETJA 3AY3A 3GL9A 3QKWA 2I3DA 2NTVA 1KK0A 1A2KC 3MTQA 3K05A 8ICCA 1OA1A 4KUHA 4LIPD 2FXVA 2ZJFA 2HSGA 5EWLB 3NBXX 3QA9A 4GXRA 4O4JB 1L7VC 3GCGA 4U5XA 3SSMA 3FZGA 5EJEA 3OZBA 3OQVA 3H4IA 1WDTA 2LMRA 1Y5MA 3B6JA 1Z6AA 2NXNA 2GNOA 4YMLA 2A9JA 3TMYA 5IUNC 1PTJC 4MPRA 2XMBA 5CIYA 2E3JA 5AVSA 4L0QA 1W88B 1NBHA 3N8HA 4C7KA 3GG2A 5D5QA 4BRUA 2HBYA 3MRVA 2AR7A 4XDHA 4JBYA 1RWXA 2IYNA 4KQIA 4KYTA 2M6SA 4U3JB 3VZBA 2PZKA 4FSHA 2DPHA 2NU6A 1JJIA 2Y77A 4YMOA 2GAIA 1ACMA 2HK6A 1QOPB 2D1RA 2XUZA 1EB9A 3JPOA 3A1WA 4Q19A 3DL4A 2X4DA 4H6WA 4W6ZA 3F97A 4CV1A 3FRIA 5MHTA 1PK3A 4KN4A 1GPDG 2JLYA 4DAOA 5KAFU 1WDMA 3BRQA 3WWOA 3EXG1 5KQRA 5TLSA 4OJLA 1IVYA 4JYZA 4H3KB 1U7HA 3L7JA 3RVSA 2BR4A 5B6JA 1BMFD 2W58A 4AWBA 1HX7A 4OCZA 3H18A 4EGSA 4Z9YA 2VRCA 3F3SA 4UARA 4BKOA 2NNWB 1MVOA 1PZMA 3U62A 2J3IA 2A5LA 1LUAA 4L07A 2ZIFA 1C9YA 2BR5A 4PXAA 4BNDB 3L4JA 2OHXA 4MF8A 1P7PA 4DFJA 4F2PA 4K6FA 1MPTA 5C32A 3GIJA 2X4IA 1ZQGA 1NAIA 3SHWA 1H9CA 5H16A 5F9FA 2AV6A 4LJ6A 5SY6A 4ADSG 2DGZA 1JEOA 1O6BA 5GZ1A 4KFSA 1VA5A 2JZBA 1KI2A 3Q8LA 2E8OA 2YR0A 3VR5D 1D4ZA 4YMUA 4KFCA 3HJHA 1DUVG 2CMKA 2W3SA 1XWIA 1T15A 4E5MA 4UU1A 1E2BA 5LNK1 4HATA 1TVAA 3DG9A 1G63A 3KPJA 4BCCA 4C8OA 4PR3A 1W2GA 2HOQA 3RUHA 3CU5A 5J8YC 1DUSA 3BQ7A 4NL9A 3NALA 3I58A 4MP6A 4MV3A 2QR2A 1V9PA 2FHSA 5I8PA 2OYSA 3QI7A 1XQWA 2W2NA 1RS0A 4BNVA 4F93B 2XMDA 1UM9A 5DCUA 5A06A 1ZSVA 1OXUA 1V3QE 3FGOA 9ICKA 8ICXA 3OPNA 2ISPA 1FNCA 1ID1A 1T3HA 1NMXA 1XMXA 3FYSA 1SXJE 1E1KA 4U6SA 3IAS1 3WQBA 3MTGA 4E07A 2QV7A 1SOVA 1XHFA 2F43B 3FYHA 1GYRA 4NG4A 1FYEA 4LGCA 1VCMA 5CM8B 1L0BA 4N4AA 1U1EA 3UJHA 5J2CA 3RARA 3O75A 3ZNOA 4IRDA 1EE2A 4BFZA 2CWWA 4QEKA 1XLTC 2WQ6A 3C3JA 4M0EA 1KR5A 2PGIA 3ZY5A 1I33A 3OH8A 3SC3A 4TKVB 3BILA 2VATA 1IK4A 3VAYA 1NJSA 3WIBA 1E8NA 4LYAA 3N75A 1EDEA 3KQTA 1ST2A 2XE8A 4NKRA 4GWGA 2VQEB 5GINE 3VX3A 4E1VA 3B9BA 2EJVA 3W4JA 5JAPA 2G07A 2PI4A 1ZNQO 2WJJA 3SC6A 3ND8A 4Y6LA 3ZDCA 2CFSA 5FFFA 3SYRA 1I80A 1PEDA 4EZEA 3VSDA 1SB9A 4E14A 3DXZA 3D54D 4RK7A 2WAAA 3D3NA 3QW2A 3SIPA 3W2FA 2CVFA 3ENWA 1I5EA 4K6KA 1SB3C 2ICAA 3PW7A 1IRXA 2OB1A 1FDVA 4MKZA 3P71T 3EQ2A 3T5LA 1V6AA 2PO5A 4UKDA 4R84A 2CCJA 2RH9B 5EMKA 1I4WA 3TGLA 1K27A 1SCUB 4D9KA 3OF5A 1QSGA 3CP8A 3DE6X 4B6FA 3PD1A 3SBOA 3UXMA 1WOYA 2QTGA 4BEJA 3DP7A 3DE4X 1ZQNA 2IY9A 3LKBA 4XWYA 3PGJA 3DPSA 1L3CA 1F0MA 3FH0A 3GQBB 2A86A 3JATA 3CRVA 4CEHA 3DB1A 1HEUA 1ESMA 4NJMB 1M2VA 2JGJA 4FGJA 3QVTA 4G0XA 3WHKA 4QPZA 5BUCA 1HNNA 3G23A 4YRGA 5C37A 1YKFA 4DM3A 4IXWA 4KX5A 2QR5A 3M34A 3CO5A 3NTUA 3MMPA 3UG6A 3R9XB 2HZ7A 3PA6A 4HYTA 4DVGA 1XTQA 3DW1X 4UTZA 2ZQ5A 5EJGA 1XNQB 4WGGA 2R6JA 2HWYA 2R79A 3JR7A 4RXTA 2XNCA 2QZPA 1J00A 3QELA 3BS5A 3URKA 1XXLA 2PSFA 2ZVJA 5GAJA 2YVUA 5CEJA 2PNJA 3B6ZA 2WEKA 4UVHA 5KYVA 1RQPA 3IPRA 1KBZA 4UBBA 3NTOA 4PG7A 4N5HX 4KDRA 2LYHA 1AS2A 3ZS9A 2ZCVA 2Y99A 4N8SA 2X0RA 1CCWA 2YHBA 3PHIA 1XKLA 3WE7A 1O6GA 1QE0A 2D5LA 1IEQA 1HG1A 1E62A 5DTJA 4GOLD 4AU1A 5JI3E 4OKSA 5TEWA 2X0KA 3FDXA 3N07A 5CB1A 5EP3A 4KXUA 2WU8A 2AHOA 5ITWA 1ZICA 1WMBA 2B35A 1TPZA 3T6KA 2MAXA 3HYTA 3OZDA 1W0JD 2FVXA 1K75A 2P9BA 3U7GA 4PFKA 3ROZA 3EW9A 3WYNA 7ICSA 3ASZA 1DIAA 3CKLA 1C41A 4QZDA 4DLTA 1SV4A 4QBIA 2BRUC 2QRPA 1EYZA 1HDEA 2P5TB 3UB3A 3JAMA 4EBDA 3P0EA 5BSFA 3SEAA 5HGXA 4R2XA 3LPMA 3FYTA 2O0LA 4QQNA 2EHDA 5JXWA 2SECE 4F6RB 4XQ9A 1U0RA 4ZHSA 3GLGB 1JYFA 3MBOA 3C5FA 3WDKA 4EH1A 1PNVA 4C01A 2Z6QA 1BH2A 1GCAA 4J7AA 4J6EA 4HWKA 2DH5A 1KZGB 1Z36A 1HE5A 5KG0A 4L9AA 4H08A 4EABA 1XK7A 6REQA 4CKBA 1U0BB 4CIYA 2O8EB 1OYVA 2FSPA 3N97B 1V1RB 4H60A 4JJFA 1RAEA 5ILQA 3WLJA 1NW3A 1SN7A 2C98A 4AROA 2J59A 3U3OA 4OQNA 3MELA 1J8MF 3EFBA 1R3UA 1BRMA 2D8CA 9ICFA 1WZEA 4QRHA 1XCPA 4A73A 2JGDA 5EIXA 4OGFA 4XIIA 5LBUA 3ZV6A 2YVLA 3EVDA 3F3KA 3GQCA 4XYBA 4C04A 5KG7A 3TH5A 4X1IA 3MWGA 4BV8A 2VIXA 3BS7A 2BMAA 1T8SA 1G2OA 3SVTA 3UFXB 4QX6A 3PJEA 3K1AA 5B58C 5J2BA 1XEAA 3GXBA 1Y6JA 4Q45A 2E48A 3ZE1B 4UXHA 2QRVA 4N39A 3WNCA 2FR8C 1UWVA 4BNKA 1W19A 7GPBA 1BCRA 2IBKA 2VUUA 4IR9A 3TLEA 5C80A 1QFSA 1KK3A 1RWBA 1WWKA 3IOEA 2UDPA 1EX9A 2W6QA 4DMHA 1HDGO 3LC2O 1EK0A 3KETA 3MSCA 2AJLI 4M7WA 5BO5A 5J40A 3PQ7A 3EPJA 1C4KA 2AI1A 1YB1A 2UVWA 4NH4A 3LUKA 2D00A 3MHPA 1C1XA 3NTRA 1H65A 4WV3A 4IBOA 4W5TA 2I62A 4HUQA 4BJ6A 3O3CA 4KVGA 3MTAA 3CGWA 3K16A 3JAKA 1PTJA 4J3FA 5DT9A 1VSBA 1AIPA 3N58A 1ADCA 3RK0A 1P4RA 5DASA 4X6LA 4RKYA 1SXPA 5BWCA 1X7WA 4ZODA 4RE5A 3W7BA 1QH1B 1T3SA 2XZTA 1AZSC 1U4NA 1RYUA 3IQXA 4AF7A 1FDIA 2Y1CA 3ISCA 2ZB3A 4MVJE 2FSVC 4M9HA 3VR1A 1BG6A 5HJ2A 2WUEA 3Q15C 4MAFA 5CYFA 1NNLA 1WUJS 3HUTA 4R64A 1VHJA 5GONA 5EWJB 4RCYA 5JCJA 5B5SA 1J2YA 5IIJA 3C8ZA 3KSBC 1ATIA 1SUDA 1AF7A 2J5XA 4I3GA 3H04A 1N9ZA 5FORA 3TNDA 3RYIB 1FE8A 1BW9A 4NHEA 1CE8A 3BERA 4OHVA 4EVSA 5IH3A 2PY6A 1EFRD 4L95C 4PGAA 4K9DA 1GUZA 4TVSA 2XTAA 5TQ0B 3Q8SB 4D8XA 2QTRA 1KVSA 4KN6A 4N8DA 1P19A 5K3AA 2F9LA 2JHFA 4HWGA 5IARA 2WR8A 4DSNA 3KAKA 2JBWA 5AJTA 3ZUGA 3VVBA 3RR7A 3IAM6 2LZ0A 3MWFA 4U2KA 3WV5A 4G3XA 2VQ6A 4B40A 5B1SA 1NZPA 4KPUA 4JLUA 4P35A 2HU2A 3VZSA 2XHZA 2P8JA 2WINI 1H2EA 4I4TA 1R4ZA 2WTEA 2N46A 1MX5A 4ARSA 3PMLA 5BT9A 2VDJA 4F60A 1BXGA 3RYCA 2H4JA 5BMVA 1VZ2A 4RJLA 4ECYA 1VECA 3ELBA 3OLZA 3JS5A 2YDXA 4F21A 3RVRA 3EMVA 1NG1A 3CEPB 1GKLA 5IF9A 2ZREA 5TMPA 2QIPA 4QLOA 5HMMA 5FR1A 3H86A 1JVBA 4YRRA 4X6UA 3W6OA 1BFKA 4MRSA 5AJWA 1OW5A 1DOZA 4RORA 4O3SA 5J8YA 2GN0A 4M88A 3UTCA 1WDWB 3GP8A 2BKXA 3DV0B 4PY2A 4DT1B 4RV4A 1N5OX 3RRJA 2R8JA 2C2XA 4LSMA 2C3OA 4M1SA 2LCFA 3KEMA 3AM3A 3JW8A 1OWNA 3I64A 4XVUA 4QULA 1K2VN 1NK9A 5AK0A 2ZXEA 2EATA 4RVFA 4BO4A 1MJ5A 3BTVA 4J9QA 4C0XA 1A1VA 3BD7A 3IBTA 5A5VA 3DO6A 3NM6B 3H2BA 3H9GA 4I7EA 4IHJF 5AI4A 1BDJA 4LFCB 4JEUA 2BCVA 5BQOA 1AVTA 3EXIB 2NO1A 4B33A 1FTGA 2E21A 2ZR8A 3ZZNA 2B4AA 3REFA 4ZYUA 4L6IA 1TOAA 2WHPB 4F3TA 8ICIA 1W6UA 1L7BA 1FFDA 4OLAA 3AKCA 3GPBA 4TVBA 1ZJ5A 2BBTA 1CHDA 4QQRA 1WR8A 5BWMA 1J0DA 3G2NA 3FLMA 5KFJA 5I7OA 3BMCB 2GCOA 3SBDA 2IIVA 2XLBA 4PPFA 4LS3A 3LK6A 2GPWA 1EK5A 5J0UA 2J09A 1JU9A 5LBTA 2CL6X 1KSFX 3U7EB 2V1XA 2HHQA 1I51A 2GBGA 2H2FA 5BNFA 2RKWA 1KE1A 3AF2A 2P40A 4JB8A 3ZCRA 1G9SA 4CIVA 4D3FA 1RMQA 3HK2A 2ZYUX 3SXUA 4JI0B 2X42A 5HM6A 4A0GA 3TW8B 4KGDA 2G40A 2XY5A 1ABEA 3KQUA 2WSSA 1KQPA 2B8EA 3OD5A 1KJJA 3PXXA 1JH9A 1YJCA 1AKEA 2GETA 3P26A 4ZIRA 1MDBA 2P41A 1F0YA 4Q4JA 1T9DA 2SCUA 2HMXA 4R66A 3MK31 5CHGA 5HIJA 1F8FA 8ICJA 3K2EA 4Q18A 2OOSA 1U0HC 4ZRDA 2AH5A 1S3IA 1AQLA 4Q3NA 4EB3A 3SI8A 4DIFA 2PKCA 3HR4A 1DBVO 4UE2A 1PWXA 2UYHA 1EXNA 3HXMA 1DC7A 1STOA 5CW2A 1RXIA 3FR7A 9LDTA 1U9JA 4DY4A 5ICCA 2XY4A 5T67A 4A7PA 2PL3A 4HJRA 2B8TA 3TPZA 2NUBA 2VYVD 2ID9A 3IE1A 3DVRX 4JUCA 1Z2CA 4DLLA 2XAUA 2J5KA 3BGSA 1DRVA 1O96A 1SVIA 2JD2A 1KERA 5E79U 3TKYA 2I8CA 3D5TA 3OP4A 3LLMA 1TTTA 2EFYA 2WPDA 1BX1A 2OAEA 3LJKA 3NHSA 5HTOA 5HRCA 3OZFA 5KNCD 2HI0A 4K28A 1ZQHA 3ABOB 4ILKA 2ZJ5A 2CPRA 3C4VA 1R9JA 4ZYTA 3P2JA 1N6OA 1N2BA 1NQTA 5SYNA 5KG6A 4HFRA 3EPLA 3EE6A 5CPFA 1O97C 2HBQA 3FPCA 3PYLA 4G23A 3KZNA 1JHDA 3V9AA 4WBNA 3RBDA 3VA7A 2IYVA 4TYYA 1E2UA 3ZGVA 5BUSA 4LF7B 2YH2A 5E9JA 2GXQA 3MJCA 3ES9A 3HCNA 2IZ5A 3EEFA 1V8PA 3GRUA 1XQ9A 1ZQDA 1NVVR 5H82A 2CL0X 2BFFB 2D06A 2WD8A 3VR6D 4KYIB 2EDCA 1MKYA 5F7ZA 1R00A 5EZ6B 3GJSA 1OREA 3HGQA 5ALZA 3PUXA 5C2JB 2NXCA 3ND7A 3ZWVA 4ENUA 5EE3A 5COAA 5JDIC 3MGKA 3AGPA 2F1OA 3OCJA 3ONEA 1OX4B 1KO4A 1ULZA 4HRAA 4NE9A 4QOJA 1XMPA 2J1LA 1GNTA 1GZHB 4IY1A 3LDUA 1WB5A 1KDOA 4V0QA 2F76X 4GPIB 3N8IA 3CSUA 3RYHB 2IGTA 2X76A 4O1HA 3DHYA 1ZCFA 3H4VA 4ZV7A 1TU4A 4G97A 4EYQA 3L5KA 2PSDA 4BWVA 1IG0A 4YUXA 2JVKA 4LX8A 4D0NA 4IS7A 3AEUB 4P3XA 3FAZA 3CRQA 1WZUA 2VJOA 2XCSB 2OVFA 2R8HA 3AUXA 1IWBB 2WD7B 3ZHBA 3IRUA 2A5GA 1RRKA 1OROA 3F73A 4C5AA 2DWUA 5G5GA 4YVZA 3LMKA 1L7NA 4XRRA 1WUTA 5ILGA 1ODKA 1PZXA 3KL4A 1R6XA 3ZHQA 2V7PA 3FSGD 3GLGE 4QLAA 3K9QO 1E6KA 3GZFA 4GP6A 3LSTA 4D7AA 3P52A 3W8NA 3WMGA 3DMPA 4IG9A 5FBRB 3TL2A 2PUBA 1E2JA 1W73A 2XGMA 1DC6A 4QGBA 4C89A 2YIDA 2BMJA 4ZK2A 1A9RA 3LA6A 3P19A 1DC3A 4G84A 3L9XA 3CLSC 5BSRA 2C83A 3NWPA 5YASA 1DEAA 4K6CA 3VR4H 4YP3A 5EFOA 1VCHA 4BLPA 4IRMA 4OMUA 2CK3A 2DJIA 4WK2B 2WIJA 5L9AA 2X14A 4IHAA 4PSDA 3DVAA 1FTWA 4M87A 4F84A 3ZLJA 1ZQ1A 2CLEB 2NPOA 2QENA 1HQDA 1KFTA 2BY4A 3CEJA 5GJCA 4DZTA 3HKEA 3EUFA 3MAJA 5DK4A 3GZNB 3S99A 4YUVA 4OREX 2JJ2D 4BAGA 4YACA 3P97A 1K5GA 4PGFA 2KPOA 4C0HA 4M2YA 3PUVA 3VUFA 3EGEA 2UKDA 1T3LA 1EDDA 4I2GA 4KW7A 1BXZA 4X1YB 1NI4B 4F86A 2C8VA 4HGYA 4OPMA 3L8EA 1NF3A 3E2PA 2JS7A 3ZGYA 2WKRA 4MVJG 2XZLA 3IP1A 4TTPA 4S2UA 4ZCRA 3U61B 1T9GR 3WAJA 4NOJA 4K0RA 1ZD1A 4UAUA 3QUAA 4X7MA 4DBVO 2QJOA 3PHBE 3O1JC 2A9FA 5KFNA 2A1TS 1DOHA 2C3PA 3FPJA 3V4ZA 3DZHA 4NXZA 4JI8B 2BDPA 5K0TA 1P1CA 3PL1A 3T3GA 3PKIA 3DKKA 3C3YA 4UUOA 4C20A 1A8UA 3E2IA 1JUDA 4ME6A 1J7JA 3K9BA 1L4KA 1LTQA 3NKFA 3FXAA 1G5HA 4CCYA 3H2HA 4B3XA 4DSAA 4BNIA 4OB7A 4CMIB 3AQIA 4EUEA 3IV9A 1ABFA 2BE7A 2R7LA 4F5EA 1HZZC 3HB1A 2XOKA 3RUCA 4LVNA 4CT5A 1A9SA 1TAQA 5A1JA 1PYDA 1NVAA 5JS2A 2OO5A 3P9NA 4J1QA 1JT2A 1JIKA 4OJNA 3DWGA 1MENA 4TS3A 4S1NA 4J76A 2X3UA 4GSYA 3K1RB 3K9CA 4B5KA 3ZK8A 4L50A 3BWYA 1ESEA 3DUFB 4JLBA 5HK8A 3ABRB 1TO2E 2BKUA 5I3CA 3L1VA 3I0NA 4Q4DA 1MW9X 5BW4A 1WXWA 4WOPA 3CVVA 3KFVA 2YHIA 1JA9A 4DV0B 3SDZA 4QSHA 2VSOA 2O6LA 1RLUA 3C2LA 2HLDD 1M8JA 2PN1A 5F2KA 5EXTA 4GQAA 1UOPA 2HJRA 3AW8A 3DW3X 4OO1J 5SYMA 2IYFA 4DL5A 1D2EA 3LXXA 1DBQA 4P32A 1BVHA 4HDKA 4NMMA 1TQ8A 3TJZA 3O0DA 3AUFA 2AC2A 5I7SA 3H97A 3L93A 1JHPA 3GMDA 4YMNA 3UOWA 4Q7MB 2DUJA 4F4KA 2AFHB 4DQQA 2MMCA 5JATA 1CR4A 2I3ZA 3PRKE 4P3PA 2QKQA 8ICAA 2QPAA 5KVSA 5DNYB 4XWWA 1KZ4A 1I24A 4F1WA 3E22B 2PLWA 3SKXA 2KV2A 1AE1A 4WL0A 4UMVA 4KGXA 2PQ2A 2LR0A 2QNBA 5DGCA 5E9AA 1WF3A 1JILA 1FUYB 3HDQA 3OIFA 4L4XA 1FDUA 1O8CA 3IIKA 4QFBA 4K6OA 1XU9A 1WU7A 4GRDA 5KJFA 4Z2AA 4KRYA 5DLDA 2P0AA 4CIDA 3IOCA 4MUBA 8ICVA 1ZQPA 4F4CA 1WXXA 4PG5A 1EJ6A 4UHFA 1P31A 4N82A 1HPLA 1ENPA 3FCOA 4LSWA 1PNQA 4Y2JA 1Y9ZA 1ZSNA 4BNHA 5F2NA 4OU4A 2WZDA 3PJFA 1LF5A 2QXYA 4JODA 2RIRA 5C8YB 1EIWA 1S01A 1KEEA 1AQUA 1MN6A 3R9IA 4A6PA 4U0KA 3KFUF 3QMPA 2GUGA 2D2EA 5CPBA 3PNSA 4G85A 5TT1A 1CR0A 3AHJA 4GX0A 3K4QA 3J81k 1T8TA 1R7RA 1U0NA 2H16A 3BEOA 1TK3A 2UVPA 2GNPA 4H77A 1UM8A 2YNMC 2PL5A 4AKIA 1L4BA 3I04M 4WAUA 1YE5A 3UPQA 3INRA 2EW8A 1R8XA 4MUGA 4K9KA 1A2BA 2JEYA 1L5GB 3KB6A 4RJIA 3WLQA 5IIMA 1R3DA 3C6MA 3BC1A 3QKRA 3A6DA 3AI1A 1KN5A 4U2GA 1B73A 4B7UA 1ZU5A 1HH4A 1PZEA 4OFWA 5B4VA 2VRNA 3RH5A 4RIEA 4WH0A 4X41A 4ALIA 1L5OA 3ZYCA 1QMPA 4IIGA 1JPUA 4C07A 3SSAA 1A72A 1CJMA 2XVZA 2ENWA 1JG2A 3VMFA 4PL2A 3HPRA 3JZMA 3WBKA 2ZYHA 3IKVA 3QBTA 4BBJA 5H3HA 4B31A 1M0SA 3H9BA 5IHXA 3N2NA 1RP1A 1ZXLA 2C2HA 3N2GB 4QO8A 4C9BA 2OQVA 4KN9S 3DBHA 5DCWA 4FT4A 1DV1A 4DS4A 1GXSB 4TLBA 4DNFA 2C57A 1W2HA 1KSGA 1WLSA 4YMVA 4R98A 4ALKA 1YVPA 4MUXA 3ICVA 2W6CX 5J1TB 4ZT6A 5K0EA 2ESEA 3LKDA 4RF4A 1MDFA 5BSWA 7ABPA 4DRZA 3CX7A 3F2VA 2FSIA 5ALHA 3IMFA 1AXRA 2X5OA 2ZUFA 1I36A 1H66A 3OPVA 5C0YA 2E8MA 4EQZA 4FIZA 3NHFA 1OPXA 3QUQA 4I5DA 1OTXA 1XLVA 3HP4A 1H2XA 1ARZA 1HFWA 4LQCA 2IDMA 1KVTA 4BP8A 5FI3A 2ZZNA 5LB4A 3G13A 4RSGA 4KQJA 3TFSA 5FI1B 1ZIYA 5LWHA 1D4OA 3PT5A 3V4RA 4OHKA 3TBFA 2P9YA 1WHTA 1G66A 2ACEA 1QYRA 3HBMA 5AVRA 3QENA 4O3MA 1RPJA 3THRA 3PFKA 5LWQA 1PD0A 2W6OA 3ETHA 1Y9DA 1G21E 2ERYA 3ZVRA 4MV1A 2IZOA 2P75A 4LJ9A 3GEIA 3NAMA 3AEQA 4TLEA 1G5FA 4WY2A 3D3EA 3ETCA 3DOFA 1FS4A 3ZHSA 1D4FA 5KFAA 2ESRA 2Z5VA 5BW6B 1SXJB 1L6IA 5SICE 4FBGA 4C29A 1XP5A 4Y1FA 4BV2A 2FLWA 2EANA 4J9PA 4HQ0A 4M2LA 2P78A 1IH8A 2OYRA 4NL9C 5E6RB 3WTBA 3KVVA 4EZ9A 4QUGA 3LCVB 1UC4B 1JJAA 4DR7B 1UDAA 1ZQCA 1W1UA 2SNIE 3GT0A 3VUEA 5DSZA 1BVRA 3CWCA 5J0SA 1B0AA 4ZYXA 1QR2A 4OHMA 3DBRA 1SK9A 3PUKA 1NYTA 2O23A 4V0NA 2P6PA 5AI6A 5GV7A 3EZXA 4I19A 1D5CA 5HHIA 3AIIA 1FP2A 4Q7EA 3RO7A 5HOQA 5JJIA 2HRRA 5AW1A 5LQJA 3EIFA 3OKFA 1TDJA 2QAGB 5EJ8A 3DQZA 2ACVA 1O2DA 2BJWA 5AVZA 3TINA 1EFAA 4UBOA 4YAIA 1QE5A 2LV8A 1T5TA 2JEJA 3ACDA 1CG6A 1LI4A 2KOBA 3WLIA 2ZIAA 1S77D 5MN6A 1GA1A 1KORA 2WI8A 4FN4A 2JFGA 4AICA 1NJ5A 2ZTUA 5HCNA 4RD4A 2P2CA 4FOPA 4J9UE 2VIIA 2J6BA 4FCVA 5DB9A 3ZTYA 3KJQA 3NFRA 1E77A 4HAXA 4B2PA 4ZZ1A 3SDBA 4LOJA 1AU9A 1PJ3A 2IFTA 3HGMA 4TTSA 5GIOE 1DFHA 4YBRA 4M49A 3NHZA 2V9ZA 4BMXA 1F3LA 1HQCA 2OLJA 4FMDB 2PKQO 1RFGE 4UU0A 3OLXA 1C9MA 4QUJA 3L06A 2Q4BA 1XMJA 4RFSB 1Y1QA 2Y68A 3OPYB 4YQEA 4Z49A 5DW3A 2CB0A 4FFRA 1RPAA 1E1YA 2OHOA 2OXIA 3MD0A 3L8FA 1W5EA 1SHLA 3DWEX 2R1VA 3ZGLA 1WSDA 1CEEA 1M6WA 4DG5A 2XY6A 1KFDA 1THMA 1HLDA 1YCDA 3IPCA 4I14A 1JHMA 1GFIA 4OP2A 4ECQA 1RHMA 3IDFA 1PVVA 4K5QA 4R9SA 4HY3A 2EV9A 4RPJA 3N5KA 2YL2A 1X9SA 5KSZA 3Q6MA 4KR6A 3BXPA 2R6GA 4WXRA 4EI8A 2ZULA 2EGUA 1UPTA 5A02A 1YASA 1MQSA 3MABA 5FO0A 2WAXA 4DILA 3OHAA 1WCIA 5BNTA 4R54A 3L8HA 2H7CA 1A9OA 3LVRE 2W71A 3PNOA 3CJTA 1VKOA 5L51A 1TCCA 1BDHA 4IM7