4C4SA

Structure of beta-phosphoglucomutase in complex with an alpha- fluorophosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
215
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 76
structure length 215
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4sA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4sA01
4Y2YA 4UMDA 3ONNA 3ESQA 4EENA 5FP0A 3FVVA 1RKQA 3HYCA 5ALJA 2G0AA 3KBBA 2NO4A 4YIKA 3SF0A 2HO4A 2JAWA 3QU9A 1Z4QA 4FE3A 2CFRA 2ZG6A 2B1QA 3UMGA 4BNDB 3L0BA 1Z4LA 5ALNA 2FPSA 5E0OA 1RKUA 2JAUA 1QYIA 1TJ5A 2WFAA 3K1ZA 5AKYA 5A3RA 1ZRNA 4UMEA 5ALMA 3ET4A 4EEKA 3U13A 3A1EA 2I54A 5ALYA 2O2XA 4BNDA 3SHQA 4UARA 2OM6A 1YJ5A 4Y2QA 1ZS9A 2C8KA 5ALSA 3QU5A 2B8JA 3SKXA 3AR9A 5A3SA 4I9GA 1RMTA 2I7DA 2G06A 2B82A 3QUCA 3L1UA 2YN4A 3ZUPA 2B30A 3QLEA 3OTQA 1RQNA 2HOQA 3QU2A 1RKVA 2YY6A 5AI6A 2YBDA 3I6BA 5ALUA 3ED5A 3OCVA 3BWVA 4Y2UA 3RF6A 1QQ5A 4CF4A 1Z4MA 4AS2A 3U7EB 5AW1A 2BDUA 5ALZA 3DAOA 4KNWA 3NIWA 2AMYA 2AUTA 3I28A 1XVIA 5AM0A 3WKBA 2I34A 5AI9A 2FUEA 2WF5A 2YMLA 2PQ0A 4F72A 3N28A 5AKZA 5ALGA 4NABA 1QQ6A 2RBKA 5AM1A 5AVSA 3UMBA 2IA5A 5AM5A 1ZOLA 2R8YA 1O03A 3EPRA 2EARA 4NFLA 1KYTA 3UMCA 4XQ0A 2PKEA 2HCFA 5ALHA 3B9BA 3L0CA 4Y2XA 3WK8A 1YS9A 3SMVA 2WF6A 2OYCA 3B8EA 4HGRA 2HF7A 2EAUA 1N8NA 3NRJA 4J2TA 2I33A 3QU7A 4G9BA 5ALOA 3MPOA 3U7HB 1U7PA 4Y2TA 2QYHA 2GMWA 3KDPA 5AW7A 5AI8A 2YJ5A 4HGPA 2D2VA 1SWVA 2Q4RA 3QUQA 3ET5A 3IJ5A 5AW0A 3QNMA 1EK2A 2CFSA 2W43A 3A1CA 1Z5UA 4KN8A 4F71A 1NRWA 1ZD3A 3E58A 3QUBA 4HYTA 4UM5A 5AW5A 4OCZA 4CF5A 1J97A 5AVVA 3CNHA 3W5DA 2HF2A 1QH9A 3EWIA 2NYVA 2FPWA 3QGMA 4Y2PA 4FFDA 2P69A 3MC1A 3FGOA 1S8OA 2C9MA 1YDFA 2HEGA 3L1VA 3U7FB 4L57A 2DQSA 3AR4A 2ZBDA 2B8EA 4UAVA 1WZCA 2P9JA 3OCXA 5ALKA 4FYPA 1Q92A 4JDPA 3AR8A 3EF0A 1TJ3A 2BY4A 2ZXEA 4ZEXA 2FPUA 1TJ4A 2R8EA 1L7NA 1Z5GA 3MN1A 5AW8A 5IT4A 5AW2A 2B0CA 4UATA 4BEWA 1AQ6A 5ALEA 2OA0A 3L5KA 5AW4A 5ALXA 5IS2A 1L7PA 4C4RA 3L0YA 1NF2A 3AR3A 3VAYA 4ZEWA 4BX2A 3SD7A 3U19A 3FPSA 1U2TA 3D6JA 5AK4A 2RB5A 4YCLA 4BYGA 5AI0A 1X42A 1ZJJA 4IG4A 3WGUA 1WR8A 4RESA 2RAVA 5AVWA 3BA6A 4HAIA 2FI1A 1YMQA 3WKDA 1RRCA 1IWOA 5AKHA 3KC2A 2FDRA 3NALA 3GYGA 3E8MA 4XPZA 2IOFA 3EF1A 2ZOSA 3PCTA 2HDOA 4HGNA 3KD3A 4YIHA 4EZEA 3S6JA 3ZVNA 3ESRA 2FEAA 2JAOA 5ALTA 4CE6A 4BX0A 3ZU6A 3FM9A 3L8FA 2C4NA 3AR6A 3QUTA 1QQ7A 3L8HA 2AH5A 4J03A 5AVTA 3RFUA 2C88A 2I6XA 3L8GA 3QX7A 2IOFK 3WKEA 1U7OA 1U2SA 4PNHA 4JB3A 4HGQA 1SU4A 3FZQA 3DDHA 2WF8A 5AVYA 3QYPA 4L6CA 4YCMA 1WVIA 4IFTA 5AVUA 5AKXA 2IYEA 3R9KA 3DV9A 1ZD2P 1RMQA 4L6AA 1L8OA 2ZBEA 1EK1A 3I76A 3AR5A 4OFZA 4AP9A 3ZVMA 2CN1A 3WKAA 5AI4A 1RMYA 4UU1A 4EX6A 3PGVA 3N5KA 4UAUA 3CZ4A 5AVZA 3KOOA 5AW3A 2ZBGA 4NWIA 3SKYA 3AR7A 5AKKA 3A3YA 3ZTWA 3NUQA 1CR6A 1JUDA 4G63A 1LTQA 5ALDA 1T9ZA 5AW9A 3J7TA 3NASA 5AKJA 2WM8A 2RARA 2MU1A 2Q4TA 1SWWA 2FPXA 2FUCA 2YMQA 5ALRA 2R8XA 3N07A 1Z4IA 3IRUA 1CQZA 5AVRA 2JGAA 3MMZA 4NAVA 4B6JA 1L8LA 4Y3UA 3ZWDA 2GHQA 4DFDA 3B9RA 2GHTA 3WK9A 2IOHA 4DW8A 4H1WA 2YMMA 3HLTA 4Y2SA 2C8LA 1XPJA 3M9LA 2YJ4A 4XOUA 2NO5A 2ZBFA 3OCUA 5AK6A 2OBBA 1RLOA 3ZVLA 4GIBA 1ZRMA 1K1EA 3KZXA 1S2OA 3UM9A 3ZTYA 1NNLA 3NANA 3ZX5A 1Q91A 4YGYA 3QXGA 5AKLA 2Q5EA 4UMFA 2MSNA 1VJ5A 2P27A 2G09A 2ODAA 4ZEVA 5AIBA 1FEZA 1Z4PX 2GFHA 5AKEA 4UASA 2VKQA 2YFYA 3SLRA 4O8CA 2WHEA 1YV9A 4YH1A 1Z4OA 4HGOA 1RQLA 5AK3A 4EX7A 3IB6A 3ZW7A 4CF3A 1ZD5A 2BDEA 3L7YA 3WK7A 5ALFA 2W11A 3WGVA 4E88A 3ZX4A 3E84A 3OCWA 3PGLA 3WKCA 3U7GA 4UW9A 1RDFA 5JJBA 3QU4A 5AM2A 4MUMA 5ALQA 1ZD4A 1Z4JA 5AW6A 5AM3A 2P11A 2EATA 1RLMA 5IT0A 1L7OA 3M1YA 5AKGA 2MU2A 2GO7A 5AK5A 4RETA 3W5AA 4BKMA 3W5CA 3N8GA 3PDWA 3TLMA 1L6RA 5AVQA 1RPZA 3F9RA 2HSZA 1Y8AA 3A1DA 4Y2RA 3W5BA 4XE5A 4C4SA 5ALPA 4UU0A 1XP5A 2G1AA 1F5SA 5AKIA 3OPXA 1Z4KA 4I9FA 5T41A 1LVHA 4DWOA 2YMPA 1PW5A 4UMVA 2AGVA 1Z88A 1T5TA 4EELA 1WPGA 2O9JA 1YNSA 3OCYA 1TA0A 2W4MA 4KNVA 4CNQA 4BX3A 2I55A 4YCNA 1T5SA 2X4DA 4OD0A 1TE2A 2WF9A 4UM7A 5AVXA 3E81A 5AM4A 4BBJA 1RC8A 4OHFA 1U02A 4QQFA 3NAMA 2HX1A 2YJ3A 5ALVA 2YJ6A 2R8ZA 5A3QA 3WK6A 1VJRA 2G80A 3ZWKA 5AIAA 2HI0A 3WK4A 3N1UA 3ZI4A 3L8EA 1O08A 2HHLA 3R4CA 4KX5A 1RLTA 2B1RA 4C4TA 3P96A 1L7MA 5ALIA 1MH9A 3I1YA 3AR2A 4AS3A 5AI5A 5ALLA 5AICA 4NV0A 3DNPA 2FPRA 2QLTA 4QJBA 1N9KA 1Z4NA 3U26A 3OCZA 4MWOA 5AESA 2JARA 3FPBA 4GXTA 5AHXA 1VFPA 2G07A 4DCCA 1J8DA 2CFTA 3R09A 5ALWA 4Y2JA 2PR7A 4KX3A 4Y2VA 3WK5A 4BEVA 4KYTA 2G08A 2WF7A
chains in the Genus database with same CATH superfamily
5CLQA 3A4IA 5EHGA 3CVJA 5J0SA 1NLZA 3Q10A 4BCCA 4HN4B 4DNXA 3AVTA 1T34A 3HBNA 1GZ4A 2PUBA 3PYMA 3KR0A 4YMSA 2QU8A 4E15A 4OHVA 2GJKA 3CF0A 4DUPA 1X2IA 3TQOA 1C3VA 4IRCA 4YIKA 1J21A 3V1LA 4DC1A 5HKBA 5JE8A 3IAUA 1TYAE 2IHUA 4B0OA 4M04A 4LKRA 5TT1A 2O1WA 1DQSA 4IQUA 3F47A 4IR1A 3OPYA 2H9YA 3JPNA 1IBKB 3L0BA 3N0XA 2FPSA 1SL2A 4IZIA 1MP0A 1ONNA 2BN4A 2ZDHA 3H42B 4NYIR 1OBOA 3A2LA 1LW6E 2JH9A 5G5GA 3PWZA 2DJ5A 4TRJA 3RH0A 3EUAA 3IUEA 3BB3A 3VC3A 3GEEA 1WHSB 3K9QO 1JG4A 1QKKA 1YCGA 5EQJB 3UWOA 1K9VF 1RXUA 2FSPA 3N7UA 4HRYA 5KJFA 1QM5A 1WHTA 3QSGA 4UARA 2K4MA 3RAGA 4P83A 1JFVA 2QQGA 3WYCA 5J4KA 3T1OA 1M76A 1GZ7A 3WWPA 2L18A 5C5DA 2ZR0A 3KE9A 1NTRA 1FF9A 4MWDA 3HCFA 2QD1A 4TYPA 1BPYA 1SO8A 2ATIA 1MO6A 1VE7A 1W9HA 4O08A 2JF0A 3MQFA 3QBDA 4PSKA 1SQSA 3HU5A 4GOJA 3BN3A 4GD3Q 3QQ5A 1CZNA 3H84A 5KG5A 2I6TA 2LNDA 2E5SA 4Z3DA 3TE6A 1GITA 4ECUA 2KJ8A 2NU6B 1F2DA 1E7MA 2KKPA 4RPLA 5BT8A 3K6SB 3TFOA 1YFLA 3AL3A 3NI2A 4MVJA 2REQB 4WZZA 3RS4A 1Z8DA 3X2SA 2GM5A 1FSSA 2YBDA 4UM8B 3U81A 4C89A 5SV2A 2AMLA 3LVFO 3C8DA 3ECAA 2LKYA 5F3WB 4JOCA 5JSFA 5GONB 4ESVA 4K9MA 4N5DA 1NZBA 4NDNE 2Z57A 1Y9EA 3DBOB 4QLOA 4CCAA 3T5JA 4AKGA 4HTFA 5H9VA 1WUTA 4ZJUA 4Y2UA 2H6EA 3HU3A 1LW7A 1P1JA 2BHLA 2ORYA 3RNOA 5DQHA 3W8FA 4R6XA 4JVLA 4WKNA 3SFZA 2GSDA 4RLFA 1XRNA 3WICA 4G5HA 3LNCA 1VPTA 5AW1A 1B23P 3Q8MA 2NRWA 1RYNA 1Z0AA 2DPJA 2HKIA 5BOMA 2JEIA 2R6GA 3MB8A 4HCJA 1UZMA 1NQTA 2R66A 4PX5A 5FWYB 1SU6A 5IDQA 1I36A 1U5BB 5HHTA 1ZO8A 2WPDD 1QAOA 1NLFA 3B12A 2AYYA 4XDGA 4QBTA 5TC4A 4AKTA 1YOVB 1NWCA 2JRZA 1FRVA 5F23A 2DQNB 1M2KA 2DJIA 2PNFA 1OAOC 1P2GA 2AJDA 4B3TB 3WAKA 5HKLA 1ZUNA 3SR4A 4B46A 1T2VA 4BLSA 3HJCA 3NVKI 3O1LA 1AKQA 1V11A 2OECA 4MKIA 1J7JA 3W7BA 4UXJA 2QAIA 4V0KA 3Q8KA 1QIGA 4BJHB 5AM5A 1ZOLA 2R8YA 2Y9MB 2VDWB 1ZJ4A 1DADA 2EARA 2XNHA 5IBPA 3OLQA 3KL2A 2GM4A 1MUUA 3JPQA 2HVHA 2JZCA 3GXBA 2ALJA 3OE7A 2PMBA 4N9WA 4YYEA 4Y2XA 3CSUA 4G0WA 1SGGA 4CMIB 3W5UA 5DNYB 1BHJA 4AJPA 2PJUA 2OCIA 4I3FA 1JWBB 2H4HA 3B8EA 1Y1KE 3IR5A 4BJQA 2ONKA 3OU6A 2ZU0C 2XUDA 1GUYA 2DQKA 2XX3A 3ZWYA 5EJEA 1N9GA 2NUTB 4MS3A 1U8EA 2W42A 3ER6A 2R44A 1HE2A 3LX6A 2FOXA 2HYIC 3RSCA 5P21A 1DRUA 4Y2GA 3UT5A 5AW7A 3NMUF 1RSZA 4IHAA 3KV1A 4XIIA 4ZZ1A 3U60B 2JBWA 2LKDA 2NU7B 2V59A 3LC1O 3M3HA 3NTOA 4JUCA 4LF5B 3FUXA 2W43A 3RS7A 4KYUA 2P8SA 4O1MA 3U17A 3C7DB 3CBGA 4JI7B 1UA1A 1Z16A 2Y1GA 3JZMA 2WB4A 3O2JA 4E1BA 1FTYA 2GWHA 4YCDA 1S2LA 2PS3A 3MOIA 1FVOA 2X6RA 5JSQA 2KFNA 2X2EA 4FS8A 5CDTA 1RWMA 2HMSA 1JV2B 5JI2E 4H27A 2Q2VA 2KHQA 1MAWA 2X86A 3GFTA 4UCWA 1UPTA 5A0LA 3MGKA 4JX8A 7ADHA 2XE8A 3ZY2A 2J6CA 2KLBA 2X5XA 3PW4A 1A82A 2FPWA 5LP6C 2GTHA 1BDMA 3CZAA 2VDMB 1II8B 3GYBA 3ND5A 5KQSA 2C2HA 5EOVA 1NIJA 3Q7RA 3AVOA 1KRXA 3MGAA 1AY0A 3WXMA 4FW8A 1C4KA 3CE6A 2DR3A 3PRKE 1CCWA 3ODPA 2WT9A 3AR4A 1ZD9A 1UBJS 1J5PA 3ABQB 4CMEC 1KAHA 2NM0A 3ROTA 5DXFA 2PBLA 1RLJA 4XB1A 3OCXA 1NG9A 4O5AA 4LTMA 4ANFA 1C9YA 1W49A 5LBIA 1E3SA 4B17A 3LUJA 1KZHA 5B12A 1Z6QA 5IF9A 5JTIA 3Q9LA 2B0CA 2HXSA 1J42A 2OTCA 1AQ6A 2W2XA 3GPIA 4ZOCA 1KSGA 4EEXA 5JATA 5KSOA 4DNQA 3RJJA 3HZZA 1FDUA 4TV9B 2GUWA 1A04A 5DKWA 5J2AA 2ZRAA 4GPIB 3VJMA 3JWHA 1CBUA 4H3SA 3O93A 4RYDA 4WXEA 4XX0A 2C9CA 3KU4A 4GMFA 3RVJA 3KKPA 2KZ3A 2CHVA 3OFKA 4QJ4A 4U5XA 3PEFA 1ZJMA 1KYZA 4U00A 2OUIA 2JIPA 1AHIA 4D8UA 3GIJA 5HW0A 5HUQA 2K7FA 2I7TA 4RMIA 1E5TA 1VL2A 3QIAA 3RKSA 1GCGA 4JYPA 1Y8QA 1WXHA 1Z5VA 3LCUA 4W5WA 2PS1A 3D8HA 1URJA 4Q9IA 2WZDA 4MF2A 1CY7A 5DXJA 3L2OB 4JUFA 1TJYA 2JI8A 3HP7A 3TI9A 2K4IA 2XWJI 1PEDA 3LY7A 5FTJA 1Z26A 1L5FA 3MSCA 4X90A 3LIPA 1K7EB 4J0DA 3W7VA 1H2WA 3IVAA 5A7FA 3G88A 4B79A 5IH7A 2I8AA 2XF2A 4O2BB 1PGOA 3OLXA 4K6FA 3VPAA 3QP9A 4BN5A 3W5AA 1TYEB 2CDRA 5EWJB 2XE6A 4PYIA 1XRQA 3LY8A 8ICLA 5G0SA 3SXJA 2JPDA 1YFZA 1TUGA 4NCNA 1OWOA 3KAJA 3UMSA 1JMVA 3UC5A 4DY4A 2HDWA 3ZU6A 4WOJA 2CXPA 4H16A 4WD3A 1YQQA 5D85A 3SNHA 1U6KA 3AR6A 2HSDA 5AT1A 1TEZA 1DRKA 3HA7A 3KJGA 1UKAA 3U4AA 2Q1XA 2Q4BA 4P4OA 3M6FA 5M7EA 1Q3TA 4HDMA 4UE2A 1JJBA 1CJUC 2HRBA 2IPNA 4IQFA 4KXYA 3FPKA 4RVDA 3HYSA 1NATA 4MTCA 5FYDA 3RRNA 4ETMA 5JJCA 1JU3A 1S5PA 1C2YA 3GCWA 3KFLA 3K5PA 4R1LA 3U31A 4G5FA 2DYKA 3RF7A 8ICCA 1B16A 1ULUA 3TADA 5F2OA 1PFYA 5JU5A 3X43A 4B3RB 1ZU5A 3NJ4A 3QYPA 2QGNA 3DO6A 1L5RA 3ZUGA 1E94E 3ETJA 3Q85A 4MW4A 5B4TA 1DTWA 3EXIB 2XMRA 4MVWA 1H4QA 1Z0ZA 5IVPA 1N63A 4IFTA 3R0IA 2OILA 3A0BU 1GGKA 3KHKA 3MGVA 3WP0A 3ROZA 1M74A 1WY7A 2FNAA 2O2DA 3EZLA 3STHA 4EW6A 3D0QA 5E4JA 1RIIA 4IP0A 5KKAA 4EFDA 1LEHA 2O8EA 4LIPD 1FMFA 3ZPXA 3JQQA 3OQMA 2XXAA 4K9LA 4Q37A 3LZ6A 3UJAA 3E9RA 3RRYA 4R65A 2RBGA 3UYLA 4KLTA 2P3SA 5TMBA 1JEQB 2VRCD 1C81A 2QRZA 2V6JA 3FMGA 4J7AA 3P2YA 4DLNA 4YAKA 3ICCA 4ZOHC 4DM7A 3IMFA 5CA0F 3IMKA 1O4VA 1OX6A 4OHXA 4O4IF 5BV1A 5FWNA 3VR5A 3KQWA 3NDJA 1CQJB 3C5CA 3AI7A 4C4AA 2UZ1B 4NBUA 1I4OA 1VTKA 1CT9A 2YXBA 3K7EA 5L45A 5K8UA 4N3NA 2VA9A 4LVSA 2FPXA 2JFNA 1DJLA 2PBZA 2XUKA 5KT3A 1PJBA 1UP4A 4PLCA 4Y6SA 1IVSA 1JEYA 3AGPA 4PS1A 4OLAA 4DRZA 1PJAA 3IRUA 2W4IA 2GBGA 2H5XA 4EUEA 3C7KA 2XVYA 5IH3A 2RH4A 1I6KA 1VHWA 2D0OB 4OQ4A 4DMUB 3I2YX 1X38A 2KX7A 3UXNA 4DIMA 3UXEA 3H8MA 3PPWA 1Y4SA 4X9XA 2R96A 4B3IA 1V4VA 2QZ4A 1FX0B 4ENTA 4DAOA 1KVRA 3M6KA 2FN9A 3VR5H 2YMMA 2XMBA 3TLZA 3SP1A 2YZNA 2AW3A 5LB4A 3H13A 3ISCA 1MA0A 3NW9A 1IY2A 3CGGA 3UPUA 5EWLB 1W73A 5AK6A 5H3CA 3RWMB 4HBZA 3FRIA 4ZPJA 2RC5A 1T4MA 1AKVA 2Z83A 3NKLA 3OI7A 2P3QA 4U2FA 2I22A 4BS9A 2XUHA 1NW9B 3AI1A 1KP9A 2BHRA 4HMPA 4MXDA 4HRXA 3EZNA 4O3PA 4V2IA 3WJ7A 2GX6A 3CPSA 1ED1A 4KUHA 3UNXA 4QGHA 2Z4RA 5ENZA 4AY2A 1H05A 2FN3A 3KS9A 3U44A 1P0CA 1H2HA 4ZI7B 4QM7A 4JQCA 1U2GC 4BWFB 2KZZA 4JUAA 1J6UA 3W34A 4MGKR 3W0LB 3JR3A 2UVUA 4X7RA 5EE5B 3L7NA 2MSNA 1Z19A 1M10A 4Q15A 1XCLA 2FZLA 2CXHA 1GN9A 5FUYA 1M1NA 1UFOA 3L8MA 4U2CA 3JVDA 2H85A 1N4DA 2LBPA 1G4UR 3MJTA 2NU8B 3UN1A 2NOAA 4EIWA 4L2IA 4YH1A 2EKDA 1VGVA 3ECSA 1Y5MA 2O7VA 4UHFA 2DSTA 2YNMD 3M70A 5B57C 2AC2A 3DPUA 2I5PO 3KAQA 4MUXA 5DBIA 4P3PA 1OGJA 2ZE8A 2FPLA 2GCOA 4PPQA 3OIYA 3OD1A 1J2TA 1LVUA 1SD2A 3OZUA 1W4BA 2MTBA 5IEBA 5KT5A 4LRTB 3F9IA 4PYJA 3L1IA 1OV4A 2O0MA 2VP5A 5AXAA 4YROA 4QBGB 2X8BA 1JHOA 2ECQA 2IDMA 3LVVA 4LHXA 4LVCA 2BGTA 2P35A 1IU9A 1T2AA 4A1FA 1B6GA 1KDPA 1V11B 2AZMA 2B3DA 2IODA 2XOKA 3GLHB 4MUMA 2WWFA 1PWYE 1SVKA 1WUDA 2I99A 4JYBA 5FTMA 3UK7A 3OHAA 2NZUG 3M4JA 5FCDA 3DEEA 1TMGE 2K8CB 3ZIUA 3AY6A 1SZDA 1BXRB 2WAXA 2VPXA 4HAUA 3WHPA 4E5KA 1XEXB 4FWIB 4GC9A 4RCYA 2B5WA 1G0NA 3NIFB 4FB5A 2QTRA 4MQ4A 2HADA 1JKJA 1SQ5A 1NJ8A 2PKXA 4FDVA 2AXQA 3CS3A 1MTOA 4M54A 4KLAA 4N8SA 3SJZA 4QOEA 1JJAA 3L8ZA 3DEIA 5H59A 1U2GA 3TMAA 3WQBA 3ZEAA 4EGCB 4MWEA 5JFGA 3EXG1 1COZA 3LC0A 1KARA 5ELLA 3TIIA 1BOOA 1Z6AA 1NRXA 5CB6A 1ZHOA 2OXOA 3GA7A 4F92B 4FZ3A 5BPHA 4Z9YA 4I3GA 4R1SA 3HP6A 2KYRA 1EE2A 4GX1A 1TCCA 4LC9A 4PAOA 4WJZA 4JGIA 4XGRA 4Q9JA 3ZE9A 4LDZA 3DM5A 4G8CA 5HJEA 9ICQA 4O02B 4TL6A 1SJ9A 2A78A 1H2YA 3DPSA 3V80A 3IHKA 3H2IA 3E15A 1LSSA 1IZZA 1S02A 4X8HA 2ECOA 4HXGA 3KB2A 4XYLA 3U3MA 3O8CA 2UZ4A 3D2SA 4HAVA 1UK9A 5EUBA 4QIWC 2WEKA 1NW6A 1YNSA 2G25A 4JJKA 2DBYA 3RC9A 3KT6A 3UKJA 3ZV6A 1KP3A 1KTQA 1E9RA 3RYFB 3ZGYA 1T8SA 4HI0E 3I39X 2Z9DA 1F2UA 3FFAA 4E5UA 4DUYB 3PWSA 5JO9A 4FW9A 3ZVKA 4EY3A 4ER0A 3RWBA 1FXWF 5B2FA 4GX0A 2YN2A 3M4ZA 4MHVA 4Q12A 3RS2A 5EKUA 4BP8A 5EXXA 4TTRA 4HDMB 3PL5A 5J4VA 3R3SA 4B6SA 1QVAA 3CVVA 4FR0A 2KJ9A 1JIQA 3U9TA 1ZH6A 2JNWA 1YQWA 2OO3A 2ZVPX 4O8ZA 5E8JA 5A3QA 1DAHA 3A14A 3QRWA 4QTYA 1VSUA 3PRYA 1WAMA 4QYTA 5KVSA 1OA1A 2CZQA 2WAAA 5EJFA 2YS7A 4UBJA 5K0EA 1V85A 4EG1A 5KG6A 1XMSA 9ICMA 1JDTA 2O05A 1QQAA 3T4UA 4ARIA 1JQKA 4M1ZA 3TXAA 3KQLA 4RULA 3D2NA 3ETRA 1M34E 2EKLA 1K97A 1N2SA 1TB4A 3C3JA 4FEYA 1AH2A 8GPBA 2CSUA 2AJTA 2OV8A 4G0NA 1E89A 3RUHA 4DM3A 4DOMA 5ALLA 1U1FA 1NJWA 4RO0A 3ZE6A 4KQ1A 2E4XA 3R2JA 1KIAA 2XHZA 3UZUA 4MRNA 4ABTA 2XCTB 2NP6A 1YQEA 1TV9A 1NK7A 1S97A 1F14A 1RQPA 2CF5A 2CYAA 3Q5GA 3A05A 5CX1B 4M87A 4ZQIA 1IUPA 1T7PA 3GR6A 3HO1A 1PYDA 5EZQA 4UHKA 4O63O 4KX3A 2PR7A 2Y2UA 4CLOA 3EQ7A 2A86A 3G9ZA 1ZESA 3MJRA 2FPGB 1ODJA 3E2MA 4GMHA 4X00A 1F38A 3WMRA 3AEVA 5HZHA 1DZ3A 5JWRA 1THTA 1W35A 2Q9UA 3NBQA 4BWJA 4O5OA 3WLNA 9ICIA 2VBCA 1CUYA 2XT0A 1YZTA 2GYYA 3OCCA 4YBRA 1WKBA 4KQKA 5KS2A 1FJ2A 4C7OB 3L0DA 1WSWA 1DWOA 3N05A 4FCVA 4D46A 3H2HA 1NLYA 3U3OA 2B78A 4B33A 4R16A 3OZBA 4ZDIA 4QATA 2QJWA 3G8AA 4JBWA 4N7RA 3S8YA 3TF5A 1AN9A 2BFCB 4QDTA 3SC3A 3WSTA 4EF4A 2PUAA 4I0WB 4GICA 2LCFA 2ZRIA 4I46A 1QYIA 3FPFA 2ES4A 4NCHA 4DWJA 4NJMB 1UMDA 2UUOA 5DSXA 2B83A 2VZ0A 2PVPA 4RKWA 4LISA 1DUIA 1ICIA 2G40A 2I54A 3PJDA 4LWPA 2O2IA 1AA6A 1PTKA 4BRUA 1EG2A 3D6NB 5KOIA 3UGQA 3U16A 3QY9A 2QTFA 4AQ7A 2YWGA 3GCXA 3MS2A 1K7CA 1OUQA 1SN7A 4K86A 4MV7A 3JARB 2NSJA 3SHFA 4BRZA 3HJGA 3OM0A 3O1IC 1R0WA 2WY2D 4BTVA 4EHBA 5B3KA 5M3BA 1MRZA 5ICCA 3VM6A 3GAAA 2PCJA 2LI6A 3TZHA 2ES6A 5KFMA 4TMXA 3I9MA 4DDVA 4OXYA 1X9XA 3GVCA 4Y7CA 1USGA 4AP6A 1CHDA 4ZQGA 3HB1A 1DAOA 3I1FA 2V3VA 2CLIB 2EP7A 2EZ9A 3TSWA 1APBA 1ZC4A 4FI3F 3WB1A 3FAKA 5ES4B 2RG1A 2ZUEA 3AJAA 4LTNA 5BVHB 2FWNA 1Q20A 4QZVA 1YZLA 2AOUA 2C61A 3R3ZA 3CX4A 4C1BA 1UQTA 1LLCA 4OP1A 2WA2A 5TXGA 4I50F 1RJ9A 2GKSA 4QWAA 2L17A 4HDNB 4BLVA 3TUZC 4CQMD 3C1TA 4RIIA 3M5PA 4WBNF 4DOBA 3RH5A 5I9SA 3WGTA 4RU9A 3HZRA 5EQFA 2WHQA 3K31A 3MBKA 4YRJA 1ZIPA 5G3ZA 1Z6TA 1ODKA 3PPYA 4BO4A 5HGXA 4H2DA 4LJ5A 2E89A 4IUDS 4AS2A 2OGWA 3GJXC 2A4KA 3P26A 3HKEA 1E2NA 1WSAA 3DBLB 2GHIA 5IUJC 3OTGA 1CF9A 2PGAA 1B76A 3P9CA 4BUZA 4UB6U 2W83A 2AUTA 3KLNA 4GW3A 3H5OA 4IDFA 4XLZA 3DH0A 2IS1A 9ICFA 3HUUA 3WKBA 4PHHA 3LYHA 4OAQA 1YKFA 3C3MA 3W05A 4ZO9A 3DW3X 5AI9A 1XS9D 2EXXA 2D8CA 1NVXQ 4BB6A 1X1CA 1DRWA 1VMAA 1UKBA 2O4UX 3GH3A 3WLHA 4CHGA 1GRRA 1XFDA 1L6NA 3KJNA 3RBDA 5EL0A 4NABA 5J23A 1R3DA 1MPTA 2ZYGA 4KLEA 1Z73A 1XXHA 4OM8A 1JE0A 1Y9DA 5EE3A 1UWLA 1RRVA 2I76A 3A2NA 3NT5A 1NVMB 5BSTA 3BHJA 2ZUTA 3SZRA 3MT0A 3VTKA 4B48A 1C20A 1OZHA 2LM1A 1NI5A 2K6GA 1JR2A 3R44A 4E11A 3KHUA 4B4DA 3M6LA 2HWWA 2O3RA 3I2HA 2WNHA 2Q5LA 2GXUA 5DLDA 5KCZA 1KBZA 1R8QA 1Q6ZA 1U1DA 4M60A 1OH7A 3D4LA 1V3TA 3GJ5A 1PLKA 2PRKA 1W5EA 1NV8A 2YH2A 2Z9BA 4XRRA 3TLYA 3ER8A 1J99A 3Q4GA 4HNGA 3JRXA 4WCVA 2V7VA 4I50A 3RRMA 4FBMA 3T1TA 4CCHA 1R2QA 2RE8A 4JFAA 1K2VN 1PN3A 2HIAA 3F67A 3HEBA 4DL2A 1Z7GA 3NH6A 4Q48A 2D5LA 1KO7A 5LMZA 2ZGVA 2R7KA 2O0HA 3NWJA 5L53A 3HW8A 1FVFA 2R86A 3CRNA 5FL3A 3WSWA 2AJCA 1PR5A 1GPWB 3SFVA 1J8MF 1Z3CA 1BJKA 3EMBA 4IR7A 3EZ2A 3HZHA 4B3MB 4F71A 3SN6A 4AECA 4I2NA 3C8HA 5F98A 1K5DA 1E0JA 3EDOA 3UAXA 3RSGA 2GEDA 3Q8RB 4R5HA 4RZXA 4HWGA 4E21A 5C2JB 3RG2A 3MFYA 4CF5A 3QVMA 4I2EA 2NTEA 3CX6A 4I2JA 3NOVA 4REOA 2JVJA 2XUIA 3OPNA 2VT6A 9ICJA 2J6SA 1E5LA 1XTKA 2W2KB 4TM7A 3V7FA 4DBLC 5EUMA 3CLSD 2P5SA 1NW4A 3GGSA 2WI8A 5DBGA 4KQXA 1T3ZA 2PL3A 3FHLA 4Y0VA 1XHEA 2QI9F 3H5IA 5J2UF 2H52A 2ZAIA 2DPYA 3FGOA 4MDYA 3KKZA 4AUMA 1YDFA 1BE1A 4GOKA 2V6MA 4I1OA 4NZMA 1JHPA 4OHRA 3BQ1A 2QJRA 4XIYA 3U7FB 1BCSA 5JAQA 1J70A 4I2DA 2HHJA 1RBYA 3CRW1 4ZWNA 5BUCA 5LXTB 3OJUA 4S1VA 4JYAB 4NV1A 3SX0A 3X2FA 5AOBA 3NH9A 3GFVA 3H11B 1OIWA 2FZ5A 2VK4A 1C9DB 1I9CA 2P2YA 3ETGA 3QZUA 4JDPA 2P9QA 4CKCB 4AJKA 4BIIA 2P2DA 1G38A 2QK4A 5FLEX 5C1DA 3HKBB 1SCUB 2F7SA 2GSWA 3KZ1E 3WLIA 3G7SA 3FAHA 3ILVA 4MGZR 2QBYA 5EOZA 2HPHA 4WBNB 5A4MS 3GPDG 1XEFA 4J6EA 2WWVD 2XOKD 5EMKA 3L6BA 5HFAA 1VA4A 5J3JA 2C4KA 3B8HA 3O4FA 4DTCA 3PQ2A 2PWAA 1KKMA 1PVDA 2POCA 4BLWA 4BO8A 1Y7IA 1ZICA 2NTYC 3LBHA 2VTBB 2OCDA 2COKA 3EUWA 5DI3B 2I67A 1TKCA 3AR3A 3KLBA 3U4DA 2OV1A 4NLCA 1DG3A 2GLEA 4KLHA 2ZIVA 1HT3A 4GI3A 3A3KA 4MR9B 5TPZA 5A04A 5L6MB 1IXRA 1N5OX 4JXZA 4LDPA 3QE0A 1FTGA 1MC4A 3L7BA 2D5CA 1GLVA 4YCLA 5HSGA 3I52A 3RJMA 1LDBA 1NJFA 4BQRA 5L3SB 4KR3A 2H2AA 3PL1A 5DHUA 1A4IA 3LY5A 3EPJA 1IM2A 4D1YA 4OJQA 3GJ7A 2QTWB 4HFNA 5CK5A 3MWJA 1ISSA 1Z06A 2DXIA 3PEWA 2WVHA 2W9XA 4B9MA 3O84A 2II6A 4KQ2A 4PX2A 4WI1A 1MZPA 3OLVA 3E5NA 4ELVA 5GV7A 1MFZA 4AZWA 3ZHBA 2HDOA 3L79A 1A8HA 2PFPA 1B00A 3BH0A 3PGKA 4WDRA 4PXAA 4RXTA 2CBGA 2N42A 4NFYA 4Q3AA 3T3IA 4BFYA 1JH8A 2LD4A 2A9JA 2BE9A 1HEUA 4JYCA 1F2UB 4KWEA 5H3LA 4KDRA 3KT3A 3SC4A 3D4NA 1U7ZA 4M9NA 4AXXA 3G6XA 5JH7B 5HIMA 1AMNA 3K6JA 1MJGM 5DCWA 4CV2A 1PQYA 1H2RS 5U4XA 3GELA 4KLMA 3KZKA 1EXWA 2ZJ2A 1OXBB 1W96A 1XF1A 3FPLA 3N39C 3PDCA 4MV6A 3QEJA 3VNSA 1N1DA 4XQCA 4RQUA 3AQ4A 3OOJA 2WJAA 4YRLA 5GWXA 3QY0A 1HRDA 2DHCA 3NLLA 3H0KA 1IN5A 2QTNA 2WHRA 3BD9A 1KFKB 5BYJA 4G5QA 5CU7A 1WDLA 5LA6F 4UNNA 1QO7A 2CMGA 2F43A 2O23A 3NTLA 2CZCA 3NTQA 2W2QA 1ETHA 1C9NA 3C70A 3FGZA 4XVHA 2XNCA 2ZBVA 1L3SA 4NG4A 4JVMA 4D9IA 1Y9AA 3TLGA 4ECEA 5KJEA 3OTOB 1VRCA 1NTOA 3VC7A 2I3BA 3EBLA 2ECPA 3UJCA 2YX1A 5KX5F 2ERCA 1L3IA 3BRWA 4JQZA 3ROGA 3OZRA 3JALA 1VI2A 1BMTA 4L02A 5TPZD 4DM4A 5IUNC 5CA1B 2XCAA 3SHOA 5EYPB 3W9UA 3UB4A 1UWVA 1Z3EB 3ZDXB 1XTBA 2CKMA 5CFRA 5AI4A 2BUAA 1E3EA 1R6AA 3P0EA 2B6HA 2NV0A 2LV8A 2QKYA 4UAUA 2AEEA 4PAMA 4QNNA 3IP8A 5HHIA 3EGXA 4FEGA 4JX9A 4U7GA 1I4LD 5F1YA 2JH1A 5C3UA 4PAGA 1JTEA 3U37A 2J6UA 1PL0A 1LXCA 4C06A 4DJJA 4LYYA 2L5YA 4IDDA 5FPTA 4AW9A 1HURA 4EHFA 1T2FA 4N5NA 5EINA 4EG7A 4YDRA 2CHUA 4K5QA 4BZZA 2QROA 3FNHA 5LLDA 5A7GA 1X15A 4WESA 4LECA 4ZVMA 3Q5EA 3DMGA 1QNLA 3K2EA 4G01B 2VWHA 4DRXA 4F5PA 4BKRA 1E3WB 2GRAA 5CB4F 1UA0A 4MJXA 3KOYA 4MJLA 1EVIA 2QUBA 2KTQA 2GUGA 3WHIA 3F5QA 1EBBA 3V6HA 4Z54A 4YQYA 3R77A 4KMOA 5SZIA 2JASA 2A5FA 5CDYA 2GHQA 3NTXA 3R20A 2GHTA 3LUFA 5FDFA 2J9RA 4IIHA 5IKEA 1DAPA 1PQUA 4D3FA 1CERA 4DG5A 4YI3A 5CVUA 2J3KA 2BEJA 1N6RA 2KKVA 2V4UA 2CFIA 4D43A 3QF4A 3GVIA 4F06A 1C8VB 1TAGA 2DFPA 1UM8A 1VCHA 1G2IA 1PNQA 3LXRA 4CMIA 1P7CA 2XCIA 4QFDA 1B74A 1PG0A 4DSTA 1XXHE 4AD8A 1VPVA 3B3FA 3DYBA 1EVKA 2W6ID 1IEQA 3DWFA 4F4ZA 2H06A 2IYQA 4MYHA 4EDFA 1NNLA 4D8VA 4Q7QA 3IBGA 2ZIFA 1H5UA 1G19A 3RJTA 4PG8A 4IV5A 1DARA 1SXJA 5KFUA 1QCCA 2I80A 5JRZA 4GZ6A 1AHHA 1ZIDA 1GQOA 2G09A 3OFNA 2BW0A 1AKUA 3IUSA 3OO0A 4PLWA 3AU8A 5U1PA 3W7AA 7ICNA 2GAIA 4FHEA 4RD1A 4DSIA 1I5OA 4IYRA 1RJ9B 3L3FX 1OX4B 2OFOA 3ASUA 1WCYA 1DKUA 1DU4A 1O58A 1GPAA 2QB1A 2JD0A 3H3FA 3M3PA 3QE2A 3VR3A 3ANXA 3BMCA 5M34A 3RDPA 1DUVG 3QITA 2IBMA 3UK2A 3FNFA 4QZFA 4ESOA 4QXOA 4ZVKA 3ID6C 1KI6B 5BSWA 4RA6A 4ZTZB 4MLCA 1ZD5A 2GN9A 5E7QA 3LOQA 3VFDA 2HB6A 5LU9A 3ZWAA 5HDQA 1GL7A 4D9MA 2ASLA 1NXWA 4QXQA 4WXHA 4OPMA 4C78A 2YS6A 2W11A 4DEXA 3D2LA 3HV0A 4B7ZA 2C7QA 3SS9X 3K9LA 2YIDA 4D3XA 1YJ8A 4PFJA 4KFTA 4ZI3A 3JQ8A 3QWIA 5AVOA 2OGSA 2PWPA 4PZCA 1DJMA 1YJBA 3LY9A 1OGIA 3NIDB 3O0FA 1A96A 4IBOA 5F78A 1HLGA 3K9NA 3AINA 4K4IA 3EA0A 2D59A 4LXUA 4M0CA 2XGPA 3OMXA 4KL8S 4P3YA 4ZVTA 3DCIA 1J0EA 2J7PD 1KDRA 2Q2NA 3BIOA 3ANNA 4DQLA 5CBPB 1HE4A 2OXCA 3DVQX 1ISIA 5A6SB 1N5WA 3CNQS 5JU6A 2O6KA 2FETA 4EG8A 1UH5A 3M8KA 1DBWA 2AG8A 1XWFA 3KQMA 3PDWA 1W5TA 4KWHA 5CEFA 1ZOIA 1TO1E 4CL2A 1GV0A 2C2XA 2Q6TA 4YI5A 1YBVA 3REGA 3IC5A 9ICNA 3EVNA 2VDVE 2X8JB 1CRPA 4EG6A 1U2RA 1FDRA 3AIOA 1CULC 5ALPA 1W1UA 2DKNA 3HHPA 1PR3A 4URXR 2F9MA 4KAAA 4UQPA 1SA0B 2D1FA 2JANA 3PQFA 3KEQA 3BIWA 3G9QA 1GG9A 4QFCA 1DP4A 5ERGB 1FFCA 3VZSA 4UNSA 5F9HA 1E98A 3FX2A 2PIDA 4E1AA 1HXHA 2YXNA 5T41A 4KO2S 3ZLTA 4GAEA 4BNGA 2BT4A 2Z08A 4V24A 3I5UA 4RELA 1Z0KA 3T1HB 4CCYA 2NX2A 4US9A 1EWTA 4MDEA 1G21E 1ZUWA 3HPQA 4RFVA 3L6UA 5D2CA 4ZJYA 2CLCX 1CQXA 1EU1A 2W0SA 3D4OA 3TTVA 3AERA 2WD7B 2XNSA 2W4MA 4DVGA 3K73O 4YV1A 5L3VA 2NVUB 1J0XO 4OH1A 5CJJA 4ZOBA 3V1MA 4AZSA 4DLWA 3ZI7A 1F0YA 2M6SA 1XGKA 2FZ4A 3T1NA 2BPGA 3FDFA 5LYJB 2YXDA 3PC6A 5KT4A 1ADCA 1JP7A 2QR3A 4JQYA 4AMYA 4UUAA 1NFRA 1SNYA 4BBJA 4OHFA 1JR3D 1U8CB 3C24A 4YLGA 3RVSA 7REQB 4HUQA 5GJBA 4L16A 3BA1A 3E4CA 4WEQA 1V16B 2RKWA 1PVQA 5ALVA 1GUBA 3V1UA 3BMNA 4ZYWA 1I94B 2COUA 5C52B 1IXZA 1D6JA 3BK2A 2PMCA 2V7UA 2IUSA 2ZRQA 2PPVA 3H11A 3IQZA 3LAWA 8ICJA 4MS1A 4RL6A 1YB1A 3DMPA 4WV3A 3ZWPA 4DNPA 4IXWA 3V97A 1SZJG 4NOJA 1UJ4A 2EG5A 3O4RA 3PQ6A 5EHIA 2BDTA 3GLQA 1JKFA 4INAA 5I7WA 2B1RA 4GOMD 1LLFA 2Y77A 3GL9A 1Z2AA 2Q3BA 4D3ZA 2CT8A 4FZRA 5J2FA 4E94A 1NVEA 4QEDA 1B0ZA 1JLSA 4QOHA 3HR7A 2A0YA 5T5QA 2A3VA 4QGAA 1Z6ZA 2JARA 4WY5A 4J29A 4FILA 2WU4A 4KFSA 4J9QA 5A71A 2ECFA 2FFAA 4U7JA 3HFGA 3RSQA 3AWDA 3ESXA 1T5DX 2EBFX 4MP8A 2HJ9A 1FXUA 2OPBA 3WJ1A 4MR9A 3Q2IA 4Z9XA 4A1OA 3O8NA 4RH3A 2BYTA 1WZIA 2FFHA 4BVFA 1POXA 5E6SA 4JBXA 4Z0TA 1YQUA 1ZN9A 3EIFA 1QO0A 2BR3A 1F60A 2FMTA 3MUOA 3RRGA 5JR3A 4XYEA 4EENA 2V7QA 1IG3A 3KE8A 4FJ2A 4GLOA 4REMA 2ODGA 2GBCA 3ZV4A 5CFLA 2O19A 2FQYA 3PNMA 1C9JA 1XKQA 1BMQA 2IH2A 4BNHA 4TL7A 1VKNA 3QU9A 3A3PA 4D8TA 5KAFU 2H1WA 3PLNA 2BMDA 2DZDA 3GBPA 1W85B 3AUSA 4OA8A 1I51A 3ZTTA 4BP1A 1QPZA 3QA3E 5T14A 1CUKA 1JDZA 1SBYA 4MW1A 3VX4A 1O3YA 2ACWA 1KDHA 2Q49A 2QVLA 4HX5A 4W5NA 1UOPA 4LMPA 1A2OA 4RHCA 4EJFA 3L5OA 2XVXA 3DJYA 4JEMA 4RHEA 4MK4A 4XIJA 2A84A 4A0RA 3FZEA 2TECE 2JJ1A 2YZ7A 1ESMA 4GRIA 4EEKA 1ZI6A 3GX1A 5BSRA 1O94D 1ZX1A 5H81A 3E27A 3ENQA 4Q1EA 4Y6QA 2M2IA 3AL0C 4AQYB 3TEMA 3MWEA 1D8YA 2GPJA 2R18A 4CT4B 5L40A 1UJMA 3ZQ6A 4Q4HA 5T3YA 3MAGA 4C4OA 2BTOA 2RHGB 3P5SA 2QVCA 1W2GA 3F7OA 3E48A 3P9YA 4MEJA 3LGXA 4D3YA 4TLBA 4BAZA 4E5NA 5KL1B 2AR7A 3PXDA 2HA4A 2E1RA 4OGGA 1X9SA 5CNJA 2H7CA 4Q19A 1OXVA 3OQVA 1R4ZA 3DW1X 2FN4A 1MX1A 8ICGA 1ZN7A 4HYYA 4N3BA 4OKIA 4R2IA 3ZCVA 4DSAA 3NEPX 4U9UA 3U44B 1NKTA 3CY6A 2OP0A 1JMYA 5DE3A 4C7VA 3OSUA 1UPFA 1OLSB 2C57A 4NCJA 5AI6A 3V00A 4I99A 5KYYA 1NM5C 4IGAA 2ISPA 1MN6A 4IMPA 4OXNA 3WGHA 5ITSA 1MOQA 4AJLA 1AC5A 4DB2A 4HHEA 3U1BA 3G0BA 1PGQA 3ORFA 1P7ZA 1ZQAA 2YZ2A 3BGIA 1DX9A 4UQGA 3OUUA 2FEXA 1KI8A 2CNKA 2QXTA 2H5JA 3RF6A 3ZHVA 4S3MA 5JCOA 2QRLA 1JLLA 3OURA 3VOAA 4HVCA 7ICKA 3G79A 4WJKB 2YIVX 4WN9B 4OFBA 2AZDA 3FOCA 2XUPA 2D7JA 4IVNA 1BVHA 1NUHA 3QBTA 2AW5A 1Q7CA 1CUHA 1U8TA 4DIKA 4E03A 1XVIA 1P2VA 3DG9A 3MJDA 2DHQA 5G53C 1BW9B 2X8AA 3MLEA 1ARZA 3IPRA 2QUKA 2WOJA 4QVGA 1GPH1 1H42A 1PG5A 4CN9A 4EHKA 3B1FA 3ZNOA 1D8TA 1R9JA 1UPAA 3GEIA 3KKOA 4EECA 2BR4A 1TVCA 1RYEA 5C9ZA 1LU9A 1JH9A 4CKWA 3UMBA 1QYXA 3IX7A 3F8SA 3MRXA 5CLIA 3U1TA 1KF0A 2Z56A 4EFKA 4F60A 1O95C 1WXFA 4JJGA 1RYYA 3JS5A 1RXVA 4OLHA 3WLJA 4F38A 5JCXA 2PKEA 3DLHA 2PH7A 2EJVA 4HX9A 5J2EA 5FO0A 4KE7A 3VO8A 5J2UA 4LFCB 3IEKA 3F7TA 4NPCA 3SV4A 3DBVO 1F9EA 1EGHA 1KDTA 2AYXA 2G67A 3B53X 3DOUA 2H4FA 3MOGA 4MUEA 3JQDA 2BM1A 3AIIA 5I7RA 2Q3EA 2W9CB 3NRJA 1DFGA 2BEWB 2J1LA 4JEIA 4J2TA 3SHWA 1THZA 3I23A 5BNFA 1Q0ZA 4IHQA 4R7TA 3WGOA 3P9ZA 1MNAA 2QYHA 2R7MA 4DQUA 1E7SA 5KFCA 1ULZA 1E1QA 2C5FA 3FIJA 2XIQA 3OOSA 3QMVA 1Q0TA 2RDJA 4F8RA 1AUOA 2QARB 3G6VA 2PZFA 3CYFA 3G7UA 3GLVA 3OZDA 3A4YA 1HMPA 2VP3A 5HFJA 1L5HA 4DSLA 1JSLA 4LSWA 3TAPA 5CRXA 2IBSA 2F9LA 3ADKA 2ZWPA 1Z5UA 3L0PA 5F12A 2AVNA 1LSUA 4P3OA 3A6ZA 2IEDA 2QW8A 5CHEA 3ST7A 5BNZA 3GI1A 1ESZA 4ALLA 4JUIA 2ZJ5A 1SCIA 1RXCA 2IEAA 4WINA 3TNFA 4OCZA 1SBQA 3IDQA 4RV9A 3LQ2A 2G7ZA 5FNVA 4CT0A 4EPXA 5AVWA 3FDSA 2W9BA 4WLFA 3DVRX 3GZFA 3TCKA 1DRVA 1M67A 5BQFA 4X1KB 4S1TA 4JSYA 3T3FA 1S3FA 3M9XA 1JAYA 5I9NA 3VXKA 4LNAA 4XUEA 3FPHA 3DQPA 3RVKA 4MSUA 4W1PA 3WY9A 3U4QB 1IUNA 4GL2A 5IXSA 2DQSA 4OHOA 3INNA 1NXSA 4Z0NA 3STWA 1Q7GA 4HDRB 3BS5B 2IY7A 2ZB3A 1XSPA 3OTWA 3FZYA 2WABA 3CTPA 4O4JB 3KFVA 3SBEA 2J9FA 3D0RA 2QXUA 4KAXA 3IQWA 1ECBA 5IVDA 2D7CA 4EA8A 4HAOA 4NDAA 4R66A 3IPXA 4QYSA 3VJRA 1ZY2A 4B81A 4GMKA 3NHWA 4ENPA 3HDTA 5ISMA 1JSXA 2JR5A 4V0SA 3HB0A 4B09A 1SB3C 4BMOB 2QG9A 1P0FA 2CVHA 2YOFA 3CNOA 2AFHB 3WL3A 2C1EA 5HKKD 3OICA 5L95A 4TYWA 3BZBA 4JP3A 4KN4A 2V3CC 4HWOA 1NBOA 2IT1A 2BKVA 4XYGA 4V38A 2E87A 4REQA 2C92A 1Y34E 1Z7EA 2P2GA 5LFAA 1WMEA 5K3CA 4YEDA 1SBNE 4M8NE 3HY3A 1PZMA 1URPA 1Z0JA 1UHUA 2I6SA 1VLLA 2X0NA 4FX5A 4I1SA 4FPXA 1NJ5A 1ZOPA 1A4UA 3KTFA 4LC1A 4B6OA 5KJ6A 5K6AC 4MQEA 1MIOA 2VP0A 3M4NA 2VFAA 1J06A 2O1XA 1B8OA 3R5XA 2V58A 4O3OA 4MUJA 1W48A 4NJEA 4LXTA 2GF2A 4JVNA 2PH1A 4CI0B 2ZJFA 1RYHA 1TF5A 1X42A 4XQEA 2OD2A 4IG4A 4YP9A 5BVGA 1DG1G 1FSGA 4IFBA 1QGAA 3RU3A 1DKQA 4F4FA 1NDHA 2ZSJA 1NJXA 2LGJA 2RAUA 4JBIA 4P35A 4I29A 1BDBA 4HNUA 3HXOA 4PCVA 5J0PA 1Z2DA 4FMDF 1CX9B 1WEHA 4FZLA 3M5DA 1VHJA 4IEFB 1CUGA 1E2HA 1SC6A 4MS3B 5F77A 2G4VA 3KPVA 5HHHA 2C97A 2V7QD 3MTBA 4UEWA 5E6RB 4Z4QA 2A1JB 3PCTA 3RJGA 4ITUA 4ZMBA 2DH5A 2NSYA 3MJFA 4GNKA 5DM4A 1U28C 5I7AA 4BMYA 3ESRA 3PNKA 2VHEA 1WCWA 1XMJA 2WQ7A 3DL0A 5F9MA 3L77A 4TLLB 2W6MA 4X71A 5KX5B 3O9ZA 4DS5A 2ASEA 2ZB7A 3F6SA 5F4BA 1M0WA 1PR0A 3SZGA 1R6VA 4AN1A 1C7QA 3IE1A 1ORTA 1OREA 1A5BB 3RYHA 3GFRA 2JIDA 4R40A 5IMBA 4ND3A 2VK2A 4OKNA 4BU0A 4WH0A 3IOMA 4B74A 2Q5HA 1E3MA 4GSLA 3O8OB 1US8A 3QPVA 4OQYA 5J5CA 3MS7A 3W9SA 5B5SA 1NM5A 5E3IA 3KWLA 3NORA 4JBGA 1QB7A 2FGKA 2OQRA 2YC2C 3L8GA 3Q0TA 2X5JO 1KVSA 5HXAA 3QPWA 3MWLA 3KP1A 2M1ZA 1YR8A 2NT4A 1K5HA 2CHFA 4AO7A 3B3JA 3UAWA 4DA6A 5CVDA 1QE3A 3PPVA 4AJJA 3DBHB 2QWXA 5JBNA 4BC0A 2G1UA 5H82A 3DE4X 1ILEA 4FR5A 4X85A 1OI7A 1NZPA 4B3FX 1OLOA 3LX5A 3P94A 4YTEA 4LGYA 3HG7A 3AZPA 5DM60 1VXRA 5AD1A 1X94A 4RVCA 4WFQA 4PWZA 4QOFA 3ZGLA 2GPAA 3PA8A 4WVFA 4BQPA 3UWMA 3L40A 4YPVA 4ZQCB 2ZBEA 1EK1A 4PSUA 3RB0A 2FZKA 4IIJB 5CFNA 3V33A 4DPLA 3JD3A 4MKZA 2TS1A 4B3JA 1HEIA 5FI1B 2JZBB 1RTKA 1YASA 1LDMA 3DULA 4C0KA 4X63A 4F3NA 2C5GA 4QGSA 4LZNA 5KSWB 3H2BA 1B8UA 4HEQA 4AUKA 1YFKA 5C81A 1MB9A 4NM2A 4GXQA 4FS2A 3TAQA 2PXAA 3JQGB 3JWJA 4Z1MA 2P0AA 2QUJA 3EASA 3HZOA 1ZGBA 3JSAA 3SZLA 1DE0A 2JZOA 2OHFA 3KYDB 2O7NA 5DG7A 4M9RA 1V8BA 3N8IA 3SU8A 1ECFA 1UXKA 2HA6A 2WAMA 4CG0A 2FUCA 3WGKA 3WGMA 3PZPA 2K89A 1I4EB 2I6FA 4UUQA 1X40A 1Y6RA 1JI0A 3JPOA 2QX9A 1XX6A 2YR0A 3O73A 3QLJA 4PCAA 3MJ4A 2HJSA 1EP9A 4O3MA 4AS1A 1TADA 2JGAA 4GSKA 3KQYA 4NAVA 2ASJA 1QQTA 2RJ3A 4Q34A 1CLUA 4G4GA 1I5RA 3VYTB 3TOCA 4DQPA 3W4KA 3ZWDA 1P44A 5IYZB 3PF8A 2H54A 1TZCA 5E2IA 5EPEA 1CJKC 3LP6A 2RHHA 4GEKA 3DZCA 2OSBA 3DCJA 5DYWA 1PVPA 4URWR 1QYDA 4YYZA 4DR5B 1NXXA 4X61A 3HRDD 2GH1A 5DHAA 2C8LA 3RTGA 4BWMA 2BTQA 3N4MB 3AI2A 3IBCA 4KVZA 5E2BA 5AUOB 3P9KA 2ZM6B 1XMPA 3RB8A 4FGUA 3VZQA 4Y6GB 4K03A 3X1WA 5F1KA 1JEDA 1D4AA 4FZVA 3U9LA 1RXWA 2W6PA 4Q21A 4A6EA 1LV7A 5IASA 1BX1A 2VDJA 2BEUB 1DIBA 2IYWA 3P9QA 3ZX5A 4QVIA 4TQGA 2V7PA 2NV2B 5KU7A 3OQIA 5JNLA 4BUCA 2DKXA 4HXFB 3TRHA 3G5AA 4KQWA 3VH1A 5BV0A 4UMFA 1VG9B 5KYYB 3BH7A 4ZEMA 5F2NA 2P9FA 3HO8A 3KEGA 4XQ8A 1YBHA 3ANTA 2VC2B 4ZHQB 3QVGA 1VB5A 4JQOA 1ZYQA 1F4LA 4ZD6A 5K9ZA 1S4MA 1XDUA 4ZYZA 4RY8A 3S2FA 1RVDA 2UVQA 2XYQA 1DC8A 1J8FA 3PC8A 1JLKA 2WHEA 2I6UA 5A5FA 5D3KA 4DGSA 2VHTA 5DHQA 1N3IA 1TUIA 4MCAA 2DTXA 1FZTA 3H3JA 1P77A 4BNWA 1M2FA 4KLIA 1FY2A 3HH8A 3DEYX 4EX7A 2CLOB 2QDKA 3L07A 1I6WA 3QOXA 4UHHA 5CT4A 2NP7A 1Z08A 4Z4CA 2PZ8A 3ULKA 4G25A 3Q9SA 2AD1A 3HJAA 3NC4A 2VXOA 1N5KA 5J0YA 1GRNA 1Z2OX 1L3BA 4M36A 4XGNA 3PQ7A 5ECWA 4TV8B 1Y1QA 1QUFA 4L27A 4O4JA 4RADA 1QHYA 1I3LA 3A06A 3E03A 1N0UA 3GV0A 4CW7A 3K70B 2XF8A 7ICTA 3QZ7A 1C1XB 1SXJD 1UM9A 2ZVDA 5IDVA 2CXQA 3N6RA 3WMWA 2DOKA 2IS6A 1H85A 5ALQA 2JJ2D 1XVAA 3CISA 3UCXA 3L9WA 4A0SA 1ZQZA 5ADVA 3AQIA 2QGZA 4EBDA 4D92A 2A1TR 3BGWA 5LNK6 2UZ1A 1RTTA 1S1MA 5K8TA 2CKDA 3KYJB 2L82A 1A5SB 1NQOA 1QG6A 1YO6A 3F6RA 4FWBA 3BGVA 2IV7A 4Y9TA 4EPTA 3A36A 3MVEA 2ZI3A 3DV0B 2ZYHA 3DE5X 3MFHA 2Q62A 3LWDA 4G1BA 2IU0A 3WLMA 2VJ4A 1L6RA 3DYIA 4UUOA 5EJGA 3FYHA 1F3LA 1Q46A 4A8EA 2HSZA 2I78A 2JS7A 2C1ZA 3F9RA 4G3XA 2RGGA 5ESXA 2DKZA 2OHVA 2WJ3A 1ZM4A 1XWIA 1G1MA 1VSQA 2WTFA 1X86B 3DFMA 3M6UA 4FMCB 5BRAA 3T9EA 5JSZB 1SKBA 3C3CA 5KNCD 2YXLA 3GGOA 1GU1A 4KXVA 5KNBD 2SICE 3V2GA 2RAFA 4GF5A 4CL3A 1GT91 3ETNA 4F9GA 5BUSA 1XJ0A 3GEDA 3L0IB 3P8ZA 2D1QA 4G26A 4XIFA 5COQA 1GNPA 4XGKA 2GETA 4JMUA 4JV1A 2XCUA 5L7YA 2YZKA 3JQFA 7ICGA 2RGCA 3C98A 3PSPA 4GO1A 4M9XA 3SM9A 4YXFA 2EYUA 3QEMB 5JPDA 1XHLA 1EM8A 1M2JA 3O1HB 1LBQA 4BC1A 4MWGA 3OKFA 3KVOA 4RSRA 1TVKA 3HS3A 3RS0A 3Q7QA 1LDYA 2XUQA 3H5RA 3OCYA 3V4ZA 4JMLA 4AAYA 1AXRA 4RJLA 1E66A 1NK5A 4C7KA 3T3GA 4JY7A 4KAFA 3COJA 3EODA 4GC6A 4LJKA 3AUYA 4QBHA 4XQ9A 1V4BA 8ICSA 1U99A 2EZYA 3F2DA 2IUYA 3ZJYA 5K45A 1G16A 1HM5A 3FWPA 1MX3A 3PTAA 1JIVA 3OU2A 1WY5A 3COVA 2OXIA 1ZQFA 4HY3A 1MC8A 1ZJNA 1ES9A 1KYVA 3NAMA 4GR9A 4MI3A 2V4ZA 5C1PA 1A8PA 5KEIA 4X7PA 3T15A 2GB4A 3N2EA 1PS8A 1FJGB 1CQIA 1KBUA 1GEEA 2PUWA 4WZAA 4LMAA 3TUJC 5K20A 4QPNA 2ORVA 4UE6A 5L3ZA 2X0EA 2O3TA 1IHDA 3UF0A 2KPOA 3RAEC 1U2ZA 2O20A 5H1YA 2AR9A 2FVXA 2IZ0A 3OTIA 2YXPX 1OB5A 4G67A 4BV9A 1VMKA 4L9WA 3ZDRA 3HFRA 1U8XX 1XF9A 2FW0A 4ERNA 5G1OA 2JGJA 4LHEA 1ZUIA 4NYMQ 4B4VA 5DHTA 5I4IA 4G0PA 3OEEA 3KETA 4P33A 3JASB 4NV0A 2G9QA 4J6FA 4ZV4A 3B0XA 3DNPA 4OHMA 4EY4A 2AOVA 4KNYA 4F5EA 3W1EA 4ESHA 3F8TA 4CIAA 3NOQA 2BCQA 1Z2PX 3TW8A 4S24A 4FBUA 1XMIA 4EI9A 3C6YA 1SXGA 1X3SA 1X7XA 1J8DA 3EZ5A 2XECA 3H18A 4NMMA 3FOEC 4NE9A 1MF7A 1UFRA 2D8AA 4XLTA 1KS2A 4LDJA 4EKIA 2GWSA 4KR6A 1QOQB 3W5CA 2AQ0A 3CZRA 4ER3A 3ONNA 1FP6A 1IDN1 1OFUA 3H17A 1BFKA 2GZ2A 3OUZA 4D9BA 3FVVA 1CQJA 1RKQA 3KJIA 3RVDA 3ICQB 1V8FA 4JJZA 3OM9A 4MAAA 1R4MB 4C7JA 5E6RA 2JCXA 4HDSA 1O95D 1SXJE 1DKNA 1SXPA 2PUCA 1CUXA 4LVNA 1Q44A 2ZG6A 3C2KA 2ILTA 4LN1A 2BGKA 3ITDA 3QJGA 1YQXA 3PHLA 3FB4A 1IIRA 1FDVA 1PT9A 1COKA 1E5VA 2WMDA 2JGDA 3LW7A 3EOAI 5A4FS 4TWIA 2WFAA 5A3RA 5AKYA 4NL9C 1HDEA 3G59A 3HBAA 3DE2X 2W9CA 1LNZA 2EHDA 5KDLA 3FNRA 2PMKA 1EINA 3AJDA 3PX7A 3K16A 4FLEA 4FQ5A 4U7WA 3CP8A 1JIIA 2X7JA 3ZCXA 5C8YF 3D6FA 1JQLB 3HBJA 4TS4A 2XADA 1QF9A 2ZJYA 1ZJ6A 2BTQB 1WVGA 3PVZA 3HJUA 2X8LA 5AUPB 5BVHA 2A7XA 5HYVA 5I3CA 1TCBA 1E96A 2GXSA 1JQJC 4O4LB 1Z39A 5EG5A 2IBTA 5LKAA 4M7OA 3E70C 1DC5A 5EJ7A 1Q0PA 4KN9S 3SQXA 4M88A 1NW3A 1T3LA 1NXQA 2QD2A 2ZE7A 4GYYA 3ZNQA 3MGCA 3P9RA 3V8PA 4BNNA 5C1BA 2FN8A 4QVKA 4HWRA 1WHSA 1XZFA 3WYNA 2ETXA 2W9BB 2PRZA 1SXIA 2ID4A 5E95A 2HFKA 3U48A 4C6HA 4F85A 5HMMA 1TQHA 2GAOA 2HA5A 4Y6LA 4TV8F 3AVXA 3R75A 4L8FA 1TIPA 3JALB 4DL9A 1PNVA 3AUXA 1ZQWA 4TLCA 3K9BA 5K0LA 3TJRA 8ICOA 1DEAA 1QVWA 3PUZA 4MW5A 5DN6A 5F3DA 3GMSA 5CHYA 1QU2A 1TT7A 3I9OA 1CUIA 4I28A 4LFBB 621PA 3RJFA 3ZGZA 1PL7A 2Q4DA 1S10A 4QXAA 2NLOA 4ZANA 3SICE 4HOYA 4DNFA 3M5CA 4GOLD 1AKWA 1AV6A 2PBFA 2JAQA 5HE9A 2VTDA 1DK2A 1ECWA 1RD4A 4ZRDA 2A33A 2Z2JA 2J59A 2SKCA 3QA9A 4BB5A 4G85A 1NURA 1PO7A 1ZXXA 3LCJA 4KNWA 1QTRA 5EGSA 5K3FA 5DIFA 5TJ9A 2AN4A 1BH6A 4OSEA 3UA3A 3AF2A 5EPOA 3DMNA 3C48A 5D3MB 4YXWA 7ABPA 4BPBA 4C4ZA 1OYVA 2PI4A 1VZ2A 2HN9A 5K1ZA 2I71A 3ZXUB 3GU3A 4ICIA 3UUFA 4AIRA 2FPGA 1RYBA 3RTCA 2CC2A 3PW5A 2AEJA 2QTHA 4TV9F 4PX9A 8ICVA 2VZ9A 4RAOA 3D1LA 5BOVA 4AJHA 1OUMA 4G24A 5DEIA 1QC5B 1TUEA 2O57A 2PT5A 2ZWIA 3LPDA 1AU9A 1MJ5A 1YDMA 4KQFA 1Q12A 4PR0A 4X92A 1R6UA 2X3FA 3CLRD 4X1IA 1SVIA 4ZQBA 5K8LA 2FWPA 2YVQA 3C23A 3KUDA 1WRBA 1T43A 4AKSA 4AY3A 3NHUA 3VNAA 3NYIA 1PKEA 1ZI8A 1W36B 4OV6B 3WOVA 4EDHA 4Z4HA 2AFIE 5CDFE 3M89A 3OAAD 1AGYA 1GCIA 2ZJ3A 4Q4AB 1J0AA 2VNKA 2XUFA 3X1JA 2A3NA 3OHMA 5CXSA 3WZ2A 1WIWA 4MZXA 4MPRA 3ABSB 4HDKB 3JQAD 3VR6D 4GX2A 1Q1EA 3KQKA 2ZTHA 2ONJA 2RG7A 1G66A 2QN6A 3C1AA 3VSBA 4ADSG 2HIHA 2OMEA 1KPIA 3PXCX 4JC4A 3RB3A 4LVOA 1K6JA 1NASA 4ND5A 1GR0A 4J7XA 4IKOA 1DLJA 1N2XA 2IY8A 1KAOA 2IE8A 4H0NA 3VNVA 4PNZA 1FLDA 4YRDA 1EFCA 1ELOA 1PJ8A 4EUNA 3TW0A 1Y3CE 1KY3A 5BMVF 2GCIA 3NP9A 4GSYA 3TCXB 3LZDA 1MNQA 4IUYA 5REQA 2FSGA 1B8VA 4RQBA 5GTDA 2IP2A 3IEPA 1QHHA 2Y1XA 4XWYA 1IIBA 1AUPA 1VIVA 4B9TA 3VVLA 3L49A 1KMMA 2OXFA 2ZRLA 1GUFA 4IS2A 3HCEA 3UQZA 3LVQE 1Z0IA 3I9NA 5DHSA 3RT7A 3N2ZB 2DF4B 1XC7A 2C84A 2I2BA 4R1TA 3T7TA 4CIDA 3ND8A 3HXQA 3V1YA 2E8OA 3B6IA 3G2JA 2J6HA 1JRPA 4EYHB 1XDBA 2VHXA 3O3OB 4I2CA 3WI7A 1EX9A 1O2DA 1S0UA 3LA8A 3ZWXA 5CDHA 1ORHA 5AH0A 4ND7A 4NFSA 4ZVNA 3AF3A 2PKRA 3NT2A 4ILEA 1P60A 4Q7LA 4FYPA 3VPSA 5JRJA 3FUTA 1E6WA 4RC9A 1Y4AE 1RYMA 1E6KA 3ZCSA 3A70A 1IBSA 2FPUA 1WQ1R 1EAYA 5IJ9B 2MR6A 2HJGA 2PLFA 2PMZC 3FYTA 1L5QA 2W9AA 3B51X 4KPUB 3G0DA 4TKUA 3WGLA 4AJ4A 5ALEA 4B83A 1IXSB 3A26A 4Z1OA 5JI3E 2CMHA 5DGDA 3OZWA 2DHDA 2HC9A 1LB2B 1TLLA 2E3TA 1NVVQ 2A0XA 2YTZA 3A9TA 2W6NA 4MVJI 3TD6A 1QIFA 2FR8A 5FNZA 2QQ5A 3AEYA 3MWFA 4D3DA 3ZZ0A 1MX5A 3M0EA 4RHYA 2A9KA 4HWPA 3FWYA 1HC7A 2YDYA 2O2SA 3PNQA 5FHRA 5E3HA 3D4IA 2IYVA 4E12A 2BI4A 2OP1A 3O4GA 1KO8A 2EWVA 2OXRA 2I29A 2JDIA 2JI4A 1KEJA 4MW7A 4ZEWA 1BQ3A 4QBKA 1N6KA 5T7BA 3R5SA 3S70A 1EJ2A 2ESEA 1ZGCA 5DISB 4B0PA 2IHVA 2IDZA 3ETCA 3DXXA 2GKGA 2GK4A 1GAXA 5JXWA 3WGUA 2GCEA 3GAMA 1AHPA 1U9CA 5GTIU 1E2IA 1IH8A 1MBZA 1SBCA 2WD8A 2XTAA 3K4QA 2J30A 3VOTA 3QKRB 2FN7A 3BB1A 3KT0A 4OUKX 1NVGA 1WJGA 3BS4A 3O21A 3VISA 3L4BA 5JADA 3PLAE 1EXDA 4POOA 2KBFA 5AOAA 2XWSA 4IRUB 3T5KA 1OCEA 3QI2A 1OW3B 1X1DA 5IILA 1Q95A 2X4GA 2YINC 1JIJA 1Y8QB 4MYRA 3WJ2A 4AWBA 4BO1A 4YCSA 4ZYUA 4YIHA 5FBHA 2Z3WA 3ER9A 1BN6A 3BXEA 5JVDA 3KVRA 4M7RA 1KPGA 3GRYA 1GA6A 2XKJE 3IGFA 2XYVA 3RTDA 4DLRA 2QF7A 1O6BA 2LWIA 1L4HA 3W2IA 4B43A 1RJGA 4NLZA 4QC2A 6ADHA 2J32A 1JS1X 2BI7A 4KO4S 4BQSA 5AJWA 2KW5A 1T25A 2BEUA 2BELA 3QUTA 1UK7A 3WNZA 4OJPA 1EVQA 4J94A 4KXXA 3KZOA 4DDHA 3AM1A 2AH5A 1AA9A 1M2VA 3W5IA 4BMXA 4W1SA 4OQNA 2W2PA 4LF7B 1K6IA 4MQ6A 2FZVA 4S1NA 2BLNA 2C88A 4ZHQF 1P7YA 1NLMA 2CUTA 3MXTA 3TQSA 5HF9A 3HVJA 2CK3A 4CQJA 3WKEA 5J58A 2ZZMA 5KG7A 4GZ3A 3DVAA 3ESYA 1SL1A 4HGQA 1RYSA 4P0QA 1N0VC 4HNAB 1UJCA 3MFQA 1QJCA 4EA9A 1SU4A 5HQ3B 1T9GR 3GMIA 5C37A 4YAUA 5AJZA 1ZBQA 1CRQA 2XZTA 4LZGA 1BS9A 2AE1A 4L6CA 3OJSA 4EHIA 2DM6A 2G0NA 3M6MD 1DXHA 1I1OA 3L1KA 4TM8A 4ECZA 4HEA6 5TQJA 4IZHA 1VP9A 1Z0FA 1T4CB 5AKXA 1DZIA 3E22A 1KFEB 1AOXA 2Y1LA 3ADPA 2Q41A 4YJ3F 3X1MA 1KEWA 4RQAA 1UIRA 4H6XA 4RJIA 3SXPA 4DIDA 1HDIA 1G8AA 4K0RA 4UDOA 2G71A 2OBMA 4LGVA 1BAPA 1YONA 4YCAA 4YRQA 2R5NA 2DKOA 1VRWA 1FNBA 1ONOA 1NQWA 4IIXA 1DJOA 1EVYA 3VC8A 2Q0QA 2XITA 5CUQA 5ITWA 3T7SA 5FNVF 3E9CA 3I83A 1KVTA 5K03A 1XZEA 2DBRA 5E4TA 4O3QA 3N5KA 3FTEA 2Q8QA 4JGBA 2OLJA 4O29A 5L3SA 5I7OA 2H3IA 2HWKA 3ZIDA 3H1BA 3D31A 4GPBA 1DAGA 2AJ8A 4LG1A 1BVUA 2PYIA 3PPIA 5AW9A 1GZSA 3WL7A 3SDBA 1PFVA 2ZXIA 3PW0A 4JI0B 3ILSA 2MCFA 3LF1A 2RARA 3L43A 3REOA 1TK5A 4RZ2A 2XD9A 4MHTA 4TKMA 1OH5A 2F8MA 1O0SA 2OCEA 1I6LA 1BDHA 4A10A 3T0IA 4LJ8A 2SNIE 2XV1A 4RAQA 4DCUA 2ZZNA 2GPNA 2P5TB 2X6QA 3NT4A 1RP1A 2BFNA 4CFYA 1J2NA 4R01A 2QVXX 3TTTA 3R76A 2A5JA 1XDSA 1K88A 2PZEA 2ZQZA 2ZW9A 2IWHA 4B3BA 4A36A 3U6KA 4J4TA 1IZ9A 2ADOA 3GMDA 4HH0A 4WGGA 4DSNA 2H9IA 3TVDA 2H51A 2AV6A 4UFNA 1ZJWA 8ICFA 3E61A 3AM3A 2B7BA 5FKJA 1XC9A 1EJ0A 2W6CX 2BBTA 3O8DA 3USZA 2C8VA 3S1AA 1U11A 4QDXA 2LVBA 2BRUA 3ZY4A 1GPLA 4TLAA 5EERA 4F97A 3KAPA 1O9HA 2DERA 3JATB 4XUSA 2UU9B 4MGYR 3AM9A 5KUTA 2D74A 3F97A 1IVYA 4TS3A 3ZU4A 3CRMA 2O2ZA 1I2DA 3KZXA 2HQRA 2PFKA 2NSDA 5DX8A 1VB3A 3RRXA 4G56A 3WIUA 1ESNA 2PTGA 3F6YA 4FOOA 1GKYA 1PJQA 1RR6A 5FQOA 3PB3A 5CG2A 4MQBA 4TUYF 1Z37A 3QXGA 2C78A 1F0PA 1OFIA 2BFFB 3CF6R 4Q1DA 4ZMRA 3JQPA 1PR6A 4AJIA 4AZ0B 4RGYA 1WMBA 2PT7A 1EFVA 2ZTCA 4EHHA 3M83A 1FEZA 3H8JA 1NP7A 3KXPA 2VKQA 4UASA 5EI5A 5JQGA 1WMSA 1WXXA 4F1WA 1E7YA 1NL3A 1WCIB 3NNNA 16PKA 1CDEA 1P4HA 2C2ZA 4IF4A 1SUWA 1JRLA 3UWKA 3N9IA 4HGOA 1F0KA 2ODNA 4MLPA 2ZIXA 2IHBA 3E5HA 4BFCA 1PVOA 3ZW7A 5AJTA 1OU0A 2PJZA 3RSOA 4EITA 4DDTA 5KINB 1UKCA 2XTMA 3QPCA 5GOZA 1Z0DA 1ZKMA 1QGYA 3DJFA 4XM1A 3WGVA 2RK4A 5BO5A 3D3QA 2LR0A 1ESDA 4PG6A 1D2HA 3F71A 1E1LA 2HXGA 3LXXA 2XUZA 5LJIA 5DHFA 4ETWA 3WKCA 3OWXA 3GIMA 5EPUA 3MGHA 3UATA 4OL0A 5BSMA 4GP7A 3OC0A 3WRXA 1OLUA 1WUKS 1K89A 3OX2A 4P36A 4YJ3B 2HV9A 5AM2A 4CGYA 3FE2A 3PV8A 1ZUD1 2JVIA 3DEJA 3FB1A 2VSNA 2E6KA 3IUYA 5JIBA 4OI1A 2EATA 1XTTA 2ZSAA 3HL4A 5K8IA 1HYBA 2WJPA 1E2PA 4I2FA 1IHUA 4C0ZA 1FFGA 1YZ6A 2CDAA 1M1YA 2UYOA 1UEIA 1AK2A 2A1TS 2YQ5A 3AYZB 5DZSA 4BHTA 4X95A 5A1JA 2MU2A 2Y0PA 1S89A 5EWGA 5DDMA 1JHXA 3CR7A 3SC2B 4KPEC 4FGWA 5EXDA 4IDHA 3V7UA 1QAMA 4DILA 1VLMA 2AS0A 3Q41A 2JIZD 4DR3B 3MR3A 1GG2A 4CV0A 1SU8A 4EH1A 2YZMA 3NFRA 4F3OA 1F6BA 3W5BA 3IAXA 3HWWA 4JOQA 2OPHA 1U7XA 1KE2A 3AUAA 1M1XB 2WFZA 5JXJA 4XEUA 3QVSA 3I8XA 5FUBA 1SKSA 1E6MA 2QTLA 4IOKA 1A7KA 1Z5OA 5K4LA 2MYPA 3NU1A 1HUOA 1JG7A 1TLTA 1T36B 3B5JA 2NRZA 4KU4A 2EZTA 1FYEA 3E3NA 2J3QA 3CLTD 1UAGA 1VP3A 2YYSA 1Z00B 1QFXA 2ZAOA 4LJXA 1EGVB 2BQUA 5CM2Z 3QBJA 4GXNA 3DE3X 4WBXC 2XVMA 5KQGA 1Z36A 2Q28A 1PUIA 5FNVB 4R3WA 3DFIA 1JLMA 1NPYA 4X94A 5REQB 1I30A 2PT6A 4XM0A 3QKTA 2NSHA 3E9QA 3JQ7B 4F1KA 1V45E 4D9KA 3NHLA 1ZPDA 821PA 5AJXA 4BX3A 3KDAA 4HFJA 3N7TA 3GLHE 3LKZA 3ZV7A 3J80A 3RUCA 3NPMA 1TPZA 5JECA 1MABB 2ZWOA 1XMVA 1XL0A 4QAQA 1TD9A 3EMKA 3V8NA 8ICYA 1EP2B 5CJ2A 2A35A 5I8WA 5JV5A 3KALA 3TFRA 3W5SA 7MDHA 1G20A 1PWHA 4L4SA 4BMPB 1EKXA 2CWDA 1F9AA 5AW6A 5GZ1A 1MD9A 2XIDA 3FDXA 3MXOA 4IHJA 2EL7A 2UYYA 4OM7A 5KSYA 4GRAA 2WJZB 1PZGA 2R4UA 3DDWA 4UZFA 2R8ZA 1DWPA 2OWDA 2ZEJA 1JAXA 1RBZA 2BHTA 5ITVA 4QUHA 3LT1A 1ZW6A 3OT1A 4TTAA 5KNBH 2OK8A 1VXOA 3VHXA 2QUHA 4F9EA 2O5CA 4DLTA 3AF5A 3GIDA 5FL7D 2FZWA 1H0SA 2QXYA 4CKBA 1ZISA 3E1GA 5HCNA 4KX5A 3FFWA 4HEA1 1UMCB 4LZJA 5FPPA 3SS7X 4DJTA 4QKQA 1BWSA 1Z34A 1UKVY 2Q27A 4ZOLF 4HS9A 2G9VA 4GNRA 3LTNC 1L7MA 2O2EA 2PD3A 4B7UA 3EEOA 3T5TA 1T91A 3OZAA 3PFNA 3BZUA 3G0IA 1Y42X 4HNQA 4RD2A 1OPXA 4UJ3A 1I32A 4RTKA 2EU8A 1MQ3A 3LPLA 4UVEA 2J4CA 1V8DA 3AESA 2NPOA 1NQVA 1U1EA 1HE8B 2ZIWA 2JD1A 1XZMA 2QI9C 3DXZA 3F4KA 3IAS6 2VLBA 2GN2A 4KLNA 4LRWA 2UVWA 3Q40A 4KRXA 1Z5ZA 3E1SA 2OKCA 4HLUC 4XA8A 5D3MA 2H1RA 3ZDEA 4M9LA 1CZHA 2HIMA 3F49S 3ICWA 2FSIA 1L3TA 3GV8B 3WK5A 2OZEA 2P9EA 2RSLA 3PI6A 1XKTA 4PU0A 3KYCB 4QRIA 1PJSA 1QHSA 1GA4A 2WSYB 3O9MA 2NU9A 4YJGB 5F9LA 1C3EA 1MVLA 1OOEA 5JAIA 4XD2A 5KFEA 3JASA 2GESA 4NENB 2YTUA 4A15A 3K4HA 3M4XA 4DL5A 2EW2A 3H65A 4B6FA 5FLXA 4ZODA 8ICXA 3ZNPA 1GTRA 1ORIA 3T3MB 5BUZA 2ZXHA 1AZSC 3CU5A 3STVA 2O2HA 3OMLA 4ZALA 1GDDA 5KBYA 4MW6A 3NHMA 3N3AC 1V47A 4BGUA 5J2JA 2M1XA 3LC7O 2XMGA 1RKUA 4Z9BA 4W82A 4NSNA 2MINA 1TJ5A 4IQ4A 4PCUA 1HQDA 4NLNA 2ANCA 4F2PA 2WHXA 4G8JA 1DWUA 4TZTA 1OU4A 4BO6A 1NJGA 4M8SA 1J56A 1P5JA 2Q4OA 4FNGA 1M2VB 2YYYA 4PLFA 2KM1A 3AVVA 3FJ1A 1U9ZA 5H80A 4JI5B 3HVKA 3NJ8A 2H4XA 4DF8A 2Q3CA 3AFIA 1FXSA 1Z47A 4Y98A 4KN6A 1YR2A 4HB0A 2RHDA 1YH3A 2D06A 3TL2A 1HGXA 2B8JA 1ZONA 2Q1SA 1PQ4A 2ZT6A 2WT4A 3CLVA 4WAUA 3WMGA 5BURA 5ICFA 1C29B 2DR2A 4IW3B 1NBEA 2R60A 3GZTB 4NJMA 3TZCA 5I6DA 4PSVA 5IM4A 1M3SA 2E2WA 4QULA 2N1BA 2WWGA 4IS7A 3FOBA 4U1RA 2CDNA 5EUCA 2FUG1 3E3AA 1NYLA 1PTJC 3DDSA 1ADGA 4RLSA 5HMLA 3PSTA 1QH8B 2D0PB 4OYLA 2XT9A 2WTNA 3OMWA 5TR9A 1ZAYA 4QO7A 4QSHA 2INGX 5FL7A 2ZSBA 5TVKA 1QV9A 4W8GA 5LXTF 4L0CA 3H4TA 2QW1A 2GZHA 3KUCA 4NX2A 5T8KC 1DG9A 3CZQA 3H8VA 4C6SA 3NBKA 4CLEA 5DMHA 4H3VA 5ALUA 4L1KA 4JEUA 4ZCIA 2GYUA 3ZGOA 3DDNA 1JTVA 1NI3A 4FYVA 4OMUA 5FUVA 5KTSA 1EK5A 4TQSA 1RYRA 4ZVOA 1UDXA 2H5IA 3KHHA 5KHLB 3M7DA 3N53A 5JZMA 1CJTC 3NEYA 1YS6A 1V3QE 1PEYA 1FTSA 1HNNA 1O77A 1TJNA 1J00A 1R0BA 2AK3A 4QZCA 2OAP1 2WW8A 5B6IA 3GD5A 2R8HA 4ZREA 1Q17A 2PSJA 1B93A 3GLFB 1ZVVA 4KR9A 2PUHA 4I55B 4HVTA 2WQ6A 1G9XA 4F4KA 3CBQA 1Z15A 3KFXA 3NONA 2UYHA 1W87A 1K5PA 5E9WA 4YRFA 1VLQA 3BZWA 2DFNA 4OJYA 1DBVO 3O7MA 4PGAA 4WXMA 5LBTA 2C22A 5D00A 4EMBA 1ZC3A 2PS9A 1HQCA 2FSVC 2A59A 1ZIXA 4XR9A 2H3VA 2I6QA 5CWRA 2XCPA 1R6BX 2OB1A 3SE0A 2W2MA 4C0BA 3P97A 2X1LA 4V03A 2PHZA 4DMFA 5JNTA 2QNBA 5CB4A 3R9XB 5L1JA 5BPCA 1SHKA 4CUZA 1ZQYA 2OCXA 3HUEA 4JVSB 2R8IA 2ZLBA 4GLJA 4IDQA 4QU0A 3FKQA 4F8EA 3PE6A 1MW8X 2OR3A 3BKXA 3R8FA 3B6KA 1FFSA 4D9EA 4DLVA 5THXA 5EZYA 1OT5A 3L0CA 4WNIA 1GPKA 1DC7A 1RHKA 1DNPA 2ZP1A 3ED1A 5EZ5A 4QWEA 3KHLA 2JFQA 1XNQB 1NVDA 1JSRA 3EEYA 2E8MA 1SCDA 1QGZA 3X44A 1U4OA 4MAMA 1BJTA 2EAUA 5L9AA 2FWJA 4Q39A 4DF4A 2VPPA 5DTEA 4E09A 4DXHA 3DM9B 1JVSA 3PA6A 5EMNA 4N6OA 2XUAA 3TINA 2RGXA 3TDNA 2CMKA 3PDUA 5BQ3A 3RRJA 3K4GA 2REXB 3KDPA 3I4FA 1GSOA 1SVLA 4UDNA 4BFZA 3PXBA 2WMYA 2MMCA 1G5PA 3ZLVA 3OZIA 1E92A 1X7HA 2G0TA 2OCAA 3FVRA 3IMGA 3JTMA 4FDAA 5D5HA 3QUQA 1MRNA 2XUGA 3KQQA 4M9SA 4URZR 1S3SA 1KOGA 4J9KA 2B5VA 2D4HA 2Z6AA 3QE4A 2X15A 3H4BA 4WOKA 3E58A 1PL8A 1T35A 2E49A 3HUTA 3W04A 2CW5A 3ZKWB 2IOYA 4D7AA 4C07A 2PUEA 1FMCA 3DOEA 4FKBA 3CMCO 3U7JA 4F4IA 3WA7A 1J97A 1M83A 3HYTA 5AVVA 3G6KA 2IH4A 4OI0A 4HUTA 8ICKA 4Q1BA 4AJOA 3RK1A 3GGJA 3GJ3A 3AOEA 3KQSA 5G1PA 5JRDS 4P58A 4C29A 3ZIAD 2GQ0A 2YY7A 2G70A 3ZHSA 3SSNA 1K6EA 2Z4SA 2O2YA 3A25A 5GM2A 3W78A 3HK2A 4MGIR 2PJRA 3K2BA 3SZOA 1SIJA 2C7VA 4NEGA 3ZZUA 2Z6QA 3JQ9A 2O2JA 1WZCA 1PJLA 3A37A 5F3RA 3R0QA 4PO1A 4JBNA 1I3OA 3G0GA 2I3GA 1VBFA 1E2UA 1AS3A 2FSSA 2D1RA 4RXMA 5KG1A 1ND5A 3EF0A 5FR1A 6PFKA 2QB5A 2R3SA 3C5VA 1N8TA 3S3TA 2FEKA 1JFSA 1QP0A 1L7NA 1GZUA 4MFAA 1IOZA 2FX2A 1GFZA 3LTEA 3FN4A 2OB2A 3H8SA 1X74A 3BL6A 3HACA 4DIUA 2YV4A 3IDOA 1BH2A 2NTNA 3EIQA 4ACBA 3SC2A 2MT9A 5B7QA 2LBOA 3E6AA 3F3SA 1BXZA 4ZIRB 4CBVA 4AVYA 1N2CE 3L0YA 1V5IA