4C4SA

Structure of beta-phosphoglucomutase in complex with an alpha- fluorophosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
215
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 76
structure length 215
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4sA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4sA01
2B1QA 5A3QA 2I55A 3IJ5A 4DW8A 4YIKA 4CNQA 2R8ZA 3SKXA 3ZX4A 3U26A 5AVZA 1Z4MA 3R09A 4UU0A 2CFTA 3WKAA 2WHEA 4IFTA 4BX3A 4BEVA 5AVSA 2YFYA 3EWIA 1TE2A 5AK4A 1SWVA 2FPWA 5FP0A 3WK7A 3ZW7A 5AW5A 3E81A 2FUEA 5AVYA 3L0CA 2EARA 5A3SA 4YIHA 3QU4A 2ODAA 2BDEA 1QQ6A 4HGPA 2MSNA 5ALXA 3R4CA 2HSZA 5E0OA 3DV9A 2NYVA 1Z5UA 3ZTYA 1Z4IA 2FPUA 1X42A 4FFDA 4YCMA 1U7OA 2X4DA 5AK6A 3NASA 5ALKA 5AVWA 3MN1A 4YGYA 2RAVA 2AUTA 1RLMA 4Y2VA 2JAOA 4J2TA 1Z4KA 2O2XA 3B9RA 5AKIA 1Z4PX 4HAIA 2ZBFA 3I76A 3RF6A 4BKMA 4O8CA 3A1EA 3HLTA 5AESA 2WM8A 4C4SA 4CE6A 2I6XA 4Y2XA 5AI5A 3MC1A 4FE3A 2RBKA 5AVRA 3AR7A 3SMVA 3EF1A 2IYEA 4UM7A 2R8EA 1ZD4A 2GHTA 2B1RA 3N1UA 4Y2YA 5ALRA 3MPOA 4AS3A 4EELA 4Y2RA 2IA5A 5AW6A 3U13A 3DDHA 2I34A 5A3RA 5AW2A 5AVVA 3NRJA 4Y2PA 1IWOA 3W5DA 2HO4A 3A1CA 5AM1A 2Q4RA 4JDPA 4KX5A 4PNHA 5AW3A 2B30A 3QYPA 3QGMA 2W43A 1XVIA 5ALPA 2FEAA 3OCWA 1N8NA 1ZS9A 2O9JA 3OCZA 1TJ5A 2BY4A 3ZUPA 2FPSA 3FM9A 3OCYA 4UMFA 4EEKA 3L8HA 1TJ4A 3S6JA 2GO7A 4DWOA 3U7EB 2YMMA 1RQLA 2CN1A 2ZBGA 4UMDA 3W5AA 1L8LA 5ALTA 3PDWA 4EZEA 2HX1A 3NANA 1ZRNA 3CNHA 3ZU6A 2HF7A 2C9MA 2W4MA 2YMQA 5AK3A 3AR4A 3EPRA 4BEWA 1YS9A 2VKQA 1U02A 1PW5A 2RB5A 4NAVA 1ZD2P 5AIAA 3QU9A 4GXTA 4YCNA 3ZI4A 2JAUA 2MU2A 3WK4A 3OCUA 3I1YA 2HEGA 2G07A 3ED5A 5ALYA 2G80A 1YDFA 3WKCA 4OFZA 1XPJA 3ESQA 3GYGA 2FUCA 3L8EA 2HDOA 5AM0A 2WFAA 5ALJA 5ALQA 5AVUA 1EK1A 5ALNA 4KYTA 2OBBA 5AW8A 5AKLA 5AW1A 1Z4OA 4G9BA 3UMBA 1K1EA 2QLTA 3IB6A 4E88A 1YJ5A 1U7PA 2HOQA 1TJ3A 3QNMA 3E8MA 3I6BA 4QJBA 3B9BA 5AI6A 3TLMA 2FI1A 3M9LA 1CR6A 2OA0A 1RMYA 2G1AA 1RKQA 5AKXA 5AI0A 4XPZA 3DNPA 1RQNA 1QH9A 5AW9A 3AR8A 2YY6A 1RKVA 2G08A 3W5CA 4UW9A 5ALFA 1RMQA 2I54A 3NALA 5AICA 1LVHA 2WF9A 1ZRMA 4MUMA 4HGRA 4OHFA 2ZBEA 5AI9A 2B0CA 3OTQA 4BNDB 1AQ6A 2HF2A 5IT4A 3R9KA 1O08A 3D6JA 2BDUA 2PQ0A 4L57A 3U7HB 4Y3UA 3RFUA 3DAOA 4AS2A 3SF0A 3SKYA 1ZD3A 4UU1A 3WKEA 1WZCA 4UARA 5ALOA 1WR8A 3L1VA 1RKUA 3ZTWA 3KDPA 5AM4A 4XQ0A 4C4TA 5ALVA 2FPRA 3B8EA 5AHXA 4EENA 2GFHA 4DFDA 3U7GA 3QUTA 4OCZA 1CQZA 2IOHA 3FGOA 2YJ3A 2P69A 3KOOA 1T9ZA 2Q4TA 2CFSA 2B8EA 2ZG6A 5AW7A 3AR2A 4QQFA 4DCCA 5AK5A 5AM5A 3KC2A 4ZEVA 3KD3A 4BX0A 4CF5A 2B8JA 1ZD5A 1EK2A 3QUQA 4UMVA 4CF4A 2C4NA 5AI8A 4BYGA 3UM9A 3QU5A 4NWIA 3QXGA 2AH5A 3J7TA 1Z4NA 4UMEA 5ALZA 2YJ6A 2JGAA 2YMPA 1L7OA 4XOUA 2HHLA 3N07A 2WF8A 1Q91A 2WF7A 3QUCA 4KNVA 2P9JA 3SD7A 2RARA 4HGOA 3OPXA 1YMQA 3QU7A 2YJ5A 2OYCA 1ZJJA 5ALHA 3A3YA 3OCVA 3ONNA 4NV0A 4NABA 3EF0A 3PGLA 3QUBA 5ALUA 2I7DA 3I28A 5ALIA 1ZOLA 3WGUA 5ALDA 4L6AA 1MH9A 2C88A 3M1YA 1YNSA 1J97A 3KZXA 3L0BA 2GMWA 1Z4LA 4XE5A 2R8XA 4GIBA 5JJBA 5AM3A 4UATA 1QQ7A 4UAVA 3NAMA 3AR5A 2CFRA 1L7MA 4RESA 1YV9A 4L6CA 4I9FA 3AR9A 2P27A 4OD0A 2ZBDA 1KYTA 5IS2A 5AW4A 2YN4A 4Y2QA 1S2OA 3ET5A 2QYHA 3L1UA 1T5TA 1L7PA 3ZWDA 3L8FA 4H1WA 1VJRA 2Q5EA 3WK8A 1TA0A 4F71A 3AR3A 5AVQA 3HYCA 2PKEA 1Z4QA 2I33A 4MWOA 1NF2A 3F9RA 4RETA 3QX7A 1L8OA 4YH1A 1NNLA 1SU4A 3WKBA 2DQSA 2OM6A 3BWVA 4NFLA 1WVIA 3W5BA 5AVTA 1QYIA 1T5SA 3KBBA 3FVVA 1LTQA 1VJ5A 4UASA 4BNDA 2YJ4A 2JAWA 4KX3A 1RPZA 4HGNA 1L6RA 3L7YA 3N8GA 2YBDA 4Y2JA 3A1DA 3MMZA 1L7NA 3NUQA 1VFPA 4B6JA 5AKZA 3N5KA 2C8KA 2FDRA 3WK6A 2PR7A 3ET4A 3U19A 1RLOA 4I9GA 5ALWA 1RRCA 3L0YA 3VAYA 2HCFA 1WPGA 3BA6A 4HYTA 2NO4A 3FPSA 3N28A 4G63A 1SWWA 3WGVA 1Z5GA 2ZXEA 1QQ5A 4UAUA 1RDFA 3ZVMA 5AIBA 2G06A 1XP5A 3SHQA 3L5KA 3IRUA 4HGQA 3QU2A 4EX7A 1N9KA 3UMGA 2AGVA 3ZWKA 2WF6A 3WKDA 5AKEA 1J8DA 2JARA 2AMYA 2B82A 3FPBA 3ZVNA 3WK5A 1RMTA 4KNWA 2G09A 5AI4A 3AR6A 3U7FB 4AP9A 3SLRA 1JUDA 5AKHA 3QLEA 2IOFA 2NO5A 4ZEWA 1Z4JA 4KN8A 1RC8A 5ALEA 4BBJA 2EAUA 2P11A 2MU1A 3ZVLA 3OCXA 2C8LA 3WK9A 5ALSA 4JB3A 2EATA 4EX6A 5ALLA 1S8OA 4CF3A 5T41A 3UMCA 1Y8AA 5AKKA 3L8GA 1Q92A 5ALMA 4C4RA 3NIWA 2FPXA 3CZ4A 1FEZA 1NRWA 1U2TA 2IOFK 2W11A 2GHQA 5AVXA 2HI0A 2WF5A 2D2VA 1Z88A 3ESRA 4ZEXA 4YCLA 5AM2A 5AW0A 5ALGA 3P96A 5IT0A 4F72A 4Y2SA 2YMLA 3E84A 4IG4A 4BX2A 1U2SA 2ZOSA 1O03A 4Y2TA 2G0AA 4Y2UA 5AKYA 3FZQA 3ZX5A 5AKJA 4FYPA 1F5SA 2R8YA 3K1ZA 5AKGA 3PGVA 4J03A 4UM5A 3E58A 3PCTA 1RLTA
chains in the Genus database with same CATH superfamily
3QELB 5K0NA 5I9MA 2NQ2C 3G0BA 3NHKA 1DKOA 4QODA 1AS0A 1IXSB 1CB0A 3VGPA 4MI1A 1PR1A 4KI7A 2Y76A 3EIOA 2Z95A 5KFQA 4TKVA 2DWOA 2GRUA 2WTAA 1DAFA 1TL7C 5BNIA 3EDRA 1NL3A 2PZAA 2XV1A 3KB1A 4EKIA 4G1UC 1EE1A 2ZB4A 3AVUA 3P9ZA 5L6MB 4P08A 1RXCA 2G5GX 1DVRA 1Q0QA 3N8DA 2IY8A 4IS2A 4G81A 3ZPXA 5AESA 3I6IA 4BP9A 4EEXA 3G5TA 2ZBUA 4DVGA 3C5VA 3N70A 1I5EA 3B2EA 1SPXA 3G82C 1OBFO 4QXOA 5CK4A 1D2GA 2FMTA 4O0LA 1EA5A 3EVAA 2AG6A 1Z0JA 1I32A 3ORRA 2OCDA 3NRJA 4PO8A 3TEJA 4P4PA 1SUSA 3GLFB 1HE2A 1XROA 4HR7A 3EUEA 5KTRA 4BGDA 3FR7A 5FBLB 3O21A 4HWRA 3C21A 2QJOA 4JOBA 3ZQ6A 5ICFA 4YVZA 1P77A 4ARZB 1YAJA 1S5PA 1YJQA 2X5KO 1X38A 5J47A 4CIYA 2PQ6A 7ABPA 1WBBA 2YWJA 2G1JA 4DA6A 5IF3A 2PXHA 4FNMA 4E32A 4FYVA 4X8OA 3KQSA 3CH6A 5J58A 2WYUA 2G8LA 3UV7A 4MRSA 5A0TA 3C39A 1PK7A 3LX8A 1NF9A 4ID9A 4BNVA 2Z6AA 1HOXA 1OAAA 3I2HA 4AZWA 5KDDA 3VX3A 4BNZA 3O7MA 1N6HA 2LV8A 2JJ2D 4MGIR 3BTOA 3C7KA 2WKSA 4RZ3A 4FNAA 4LBWA 2VAVA 4US9A 2O2ZA 2LR0A 2O0MA 1CQZA 1TF5A 3BFXA 2Q6OA 4QEKA 3IT1A 3HCWA 2WWYA 1GGEA 3DBOB 4JFRA 3KC2A 2WD7A 1ZQ9A 3OIGA 1N0UA 1T8PA 1U7HA 1TECE 4N7MA 1SC6A 3WQHA 4MSUA 4PGYA 1P5JA 2J0QA 5EAIA 2BZ1A 4DUPA 4WCFB 1U6KA 2Z2YA 3GFSA 3P0FA 3FHOA 2IHNA 3GLKA 1IVYA 4GC6A 4LE2A 1Y5RA 4YT2A 4GNKA 1Q12A 2FZCA 5EINA 4BV3A 6AT1A 1TT5B 4G8BA 5AO9A 4TN5A 5KNLA 3K8OE 1QGDA 4GL4A 1IN4A 4R9VA 1Z8FA 1ZZGA 1AGRA 4XI9A 3BMOB 4JIMA 3UFXB 4JITA 3QK7A 4RD3A 1NF2A 1XZJA 2X77A 3JATB 4M21A 3EUWA 1QYIA 5FQNA 1VGRA 1EM8B 4BP1A 4ZYLA 4TKLA 3ZCQA 3BHMA 1KI6B 4ZEMA 1E94E 4Y1GA 2VDMB 3FSGD 2YFKA 1DELA 2DBYA 1UBNA 1V97A 3U19A 4BMZA 4DMKA 3EXIA 4HGYA 1KZ6A 4K0RA 3RAXA 2M32A 1G59A 3ZDYB 1TAUA 4TWRA 3K5WA 2WFLB 4HDAA 4TMVA 2C07A 1XPUA 1CUBA 4LDZA 1HUQA 2XUGA 2ATLA 4HNAB 5FADA 2O7VA 2OORC 2R6ZA 2VDRB 3S2ZA 2IZ1A 3ZD8A 5IARA 1LH0A 5KVSA 2HSDA 4KO3S 3LXMA 2FKAA 3K70B 4PS1A 2RH9B 1T3ZA 4C4YA 3OU7A 4PLPA 3L9WA 1GQYA 3C23A 2ASVA 4INPA 3EXAA 1ORIA 1PT8A 5KUTA 5DTJA 4PGFA 4D6XA 2JFOA 2X9VA 5ENDA 4MPTA 4C7KA 3GDGA 3VR3A 1Z3IX 3I9MA 2HRDA 1J5XA 1N8KA 3CSSA 1YCHA 4EG1A 1EWVA 4BCBA 3COZA 2OFXA 1RQPA 3AU8A 4ZV7A 2BZ0A 2A9RA 4P6VF 4J0IA 4WSOA 3TZHA 1SOAA 3NOOA 2ACVA 1W29A 1E5TA 4RPXA 1L7QA 4IL5A 4M9UA 2A3RA 1Z4PX 2FMKA 3C8UA 3KE8A 3LY5A 2KZZA 3IUYA 1ISRA 2EP8A 5KT3A 4QT0A 1HWYA 4PZAA 3OETA 1ZQQA 2VSNA 2LPMA 1HE1C 1L7BA 3O8OA 4LDRA 2G1UA 3DR3A 4B9VA 3QWHA 4JVSB 3IM1A 3ZHOA 2NNWB 3AUXA 1TT7A 1I10A 3OWOA 3HXMA 1PUJA 1ISGA 2QN8A 5MN6A 2WUGA 1KIAA 1IHUA 1CT9A 1GNSA 2HHAA 1XVIA 2D13A 3WGQA 4DZZA 3AB7A 5FBVB 4AQ7A 3GCGA 5K0LA 2O07A 5BWMA 2Q7DA 4GPIB 1S2IA 2JFFA 4JBXA 3RVDA 1KMCA 5ABPA 1LDYA 3BB4A 3R3WA 1H5QA 1ODSA 2CHVA 1YVUA 2HMYB 4L0CA 3QSYA 1EXVA 3FKQA 1IJKA 4DXDA 4ETWA 5EPEA 4RNDB 1PK9A 2WB4A 2HPAA 4FN4A 2B78A 2BPFA 1J24A 3C3JA 4LZGA 3NONA 1E98A 3VYWA 4QE3A 1RZVA 3NVZA 4QD3A 2NP6A 3K96A 3ZOKA 1XKTA 3STTA 2ISOA 1PR3A 1DPGA 3R5TA 1PFQA 4QWBA 2VK4A 3KB8A 1MTOA 1MENA 1VHQA 1R8QA 4DSEA 2ZM5A 1CUSA 2ISPA 3IC5A 4BUZA 3ICOA 1TVEA 3VQTA 3ILYA 4J9RA 4LEIA 3FCUB 1HC7A 1HT1E 4PAGA 1Y1TA 4H7EA 2XMSA 4BKQA 2Q2WA 5EHZA 4KXFB 3K32A 3HBMA 3UOWA 2EJCA 2DVMA 4RFSA 1QV7A 3KQVA 1NVBA 3E7DA 5IJ9B 5A5FA 4TX1A 2JEYA 1Z9BA 4J16C 1MZPA 4ASUD 1R5BA 1GQQA 2IV7A 4JLPA 4PR0A 2IU4A 3MJFA 3H5VA 2C3OA 1DOHA 4KRGA 1N7IA 1DL5A 5C7YA 1EGQA 1RRVA 3L4PA 1Z7YA 4ARVA 3CF4A 3CJRA 2WB1C 1MH9A 3N6XA 3KKOA 3CINA 3W3AH 2PSJA 6CHYA 1M2EA 4JYMA 5JJBA 3LWZA 4Q44A 3EAFA 3BMNB 3NPMA 1ECJA 3H4MA 3DDCA 1X70A 3SYKA 5ITZA 3L46A 4QXQA 1ZVQA 5P8WA 2G40A 1L8OA 4RACA 3IX7A 2XY7A 1XQ9A 1R6DA 2Y0CA 3ZGNA 3UHPA 4Z1MA 3LLUA 4HVTA 5BWOA 2RGRA 1Y8RA 3AYXB 1L7NA 4TL6A 2I65A 3VUEA 4AJKA 3WO1A 1SZJG 1UCVA 2JIQA 2W93A 3CJTA 2H31A 2FSVC 3LK6A 4PTLA 4BECA 4HSGA 3KEQA 2YVKA 3RASA 2XC9A 4MS1A 1I3LA 1C1XB 3U3KA 1QTQA 4AQDA 2ZB2A 5EJ5A 2JBAB 4L4UA 4RJJA 2BMAA 4I28A 1AU9A 1D4ZA 1OFHA 4GYWA 3SY8A 5AJUA 4XPIB 4BFWA 4BQQA 2HK7A 2FQYA 3FWHA 1N6IA 3LYLA 2FZVA 2QRKA 2MU1A 4MV5A 1ZQNA 1XMIA 5U4XA 4E2FA 2P2DA 4M0KA 3G02A 4R8UB 1UDCA 1NOJA 2QY9A 2UU9B 1BX0A 1GCGA 1X9XA 1ODJA 5BMVB 2HA0A 2R2GA 2X0FA 3FJOA 2NU6B 2ZT5A 1UMDB 4YJHB 2UVQA 4NCNA 3ORYA 5B1EA 2OWEA 4C5CA 2CV0A 4ZQIA 4YR2A 3QKRB 2HW3A 3ABZA 1EUCB 1RJ9B 1FRFS 2MT9A 4EW1A 1ZBQA 3PSAA 3USES 2PX5A 2I55A 2EQ5A 5DGXA 1TW3A 1NJ8A 4OA5A 3RC8A 3TMAA 3WMWA 3EWIA 1JHYA 4I2DA 5LQDA 2B4TO 2VP6A 1KTIA 1O6FA 5BO5A 2FUEA 3G9QA 4HUQB 4B3RB 2E8OA 5LP6F 1M2JA 1U3TA 4KQHA 4MPJA 2TRSB 1A8HA 3DV9A 3SLKA 4B48A 3GCXA 5H2FU 3AMZA 1GVNB 4P84A 1Z4KA 3QPWA 1I4DD 3NP7A 1GP2A 3J7AC 1TZ2A 3QXCA 4J7CA 5IINA 4YT4A 1ZJZA 3LUPA 3B13B 2PKQP 4OK3A 2IWHA 4FCVA 1P18A 4PNZA 3EDQA 4PIMA 4M7RA 4C5AA 3MFQA 2QBYB 2M6RA 2FMIA 5CLLA 3D8NA 4ZYYA 3OHMA 4ICIA 1XJ0A 3LNTA 2WZBA 4UAZA 2Q0SA 3L8YA 3V4ZA 3UHFA 1BJRE 3OZXA 4JGIA 1Y9DA 4X5VA 4FQ7A 1U45A 4WW0A 1KOFA 1D9XA 2KHQA 2QTFA 3MGGA 3GAFA 1T8WA 4MI3A 4AO7A 3EPRA 3L0OA 2YUTA 2HLDA 1GT6A 2Y99A 4ND4A 1L3VA 1QX3A 1SKMA 3LWMA 3VU9B 3TI7A 4LYYA 3ZBUA 5KTNA 4RZ2A 4WK4B 1OKKA 2OBBA 5AKLA 3B89A 2BFFA 2Q62A 4Y9DA 4HEA1 4YPVA 3LK7A 3MM4A 1Q83A 4XPZA 3G9XA 2Y93A 1Q2UA 4HDSA 4RQAA 5SY4A 1FQJA 1UH5A 1JT2A 1Y8CA 3DG9A 1FPQA 4MCAA 1YASA 3EBLA 4AJIA 2DTEA 3PC6A 4PLVA 1YR6A 1GA1A 3LSYA 4WZ6A 1EINA 1HF3A 5JCJD 3H6KA 3FYUA 3WGIA 4CTJA 4EG4A 1FL9A 4WOKA 4LHXA 1Z06A 4WH0A 2O5RA 2ZXFA 5FUWA 2DBZA 4E7PA 3KUCA 2JV3A 4D25A 2CV2A 2GM5A 4UM9B 1O97C 2PTHA 1UZAA 3VFDA 4KMUA 3OOJA 4F9TA 4DQ0A 5CITA 2EYQA 4EY4A 4KQMA 4B8YA 3M4ZA 4DM7A 7ICOA 3G6YA 2Q9CA 4MYTA 3PSIA 7ICLA 2B21A 4CIWA 2Z56A 1J97A 1BX1A 3U7QB 4R8RA 1GSOA 2WE8A 5G0WA 3FOWA 4J7UA 2OV1A 4UATA 1QE5A 3UCEA 3MUEA 4I55F 4GI7A 4X8HA 3UJNA 4LV5B 4LZWA 2PD6A 1VHDA 4Q8FA 4HB2A 4L6CA 3W4KA 4ZOLF 3P0JA 3U49A 4MUBA 2DR0A 2OT3B 1CQWA 3FNIA 3IQEA 3K9GA 2WHYA 8ICMA 3ZIAD 2CUTA 4GBJA 4RHFA 2XTMA 5DHRA 3Q8WA 4PGGA 3U81A 4XJTA 1SQFA 1T6XA 3ESBA 2G17A 4DMHA 3EZ7A 3UUWA 1JN0A 3U44A 2GZHA 5ALWA 4KQ9A 3L0YA 1WPGA 5KFUA 3ZDQA 2VEDA 3EZNA 2JH3A 3LQKA 1MB2A 3OURA 5SY6A 4DZRA 4V0LA 5AJVB 5AD1A 1JRPA 3IV6A 2EF0A 1MLDA 1UCFA 4DR3B 1O58A 3GU3A 4Q39A 4KXVA 4BLWA 2I78A 5B66U 2GM3A 5E8JA 4X65B 2ETXA 3GP3A 2AEMA 1LTKA 4GOKA 3SI7A 4G3IA 5F3DA 3AETB 1PYDA 3JQGA 3FPAA 3BK7A 4HDNA 4LFBB 1VLJA 3DZBA 1OAOA 3SEIA 4U7JA 1PUZA 1T35A 2LDXA 5IYZF 1DFHA 2IA6A 5J2HA 5AKJA 1JFFA 3PT9A 2VI5A 3BD8A 3HY6A 1YDMA 3IIMA 3ZW8A 2AXEA 1E2JA 2QU7A 1CW2B 3F5MA 1E7YA 4DUGA 5KFNA 3GLIB 2GEJA 4IRDA 4BN4A 1TM3E 3STXA 5I9IA 2YW9A 4Z54A 5JHGB 2J1LA 5A2GA 4HNGA 1PR2A 1U7WA 3WISA 4DT1B 1BMTA 3NQ41 4E0BA 4OQQA 1ESZA 1KO7A 5FA8A 3GVCA 3MCWA 4ACBA 2VP2A 4UHEA 4ZRNA 1ZQDA 3M8KA 4XCQA 4KREA 1MDFA 3LCJA 3RRZA 5LUAA 1KNQA 4CKCA 4CTNA 4NICA 2QLNA 3TIVA 2CFOA 1DWOA 1OYWA 1THGA 2JFVA 2VNIA 1SK9A 2XTNA 3W79A 4R98A 1W25A 4BXOB 3ZDDA 2DWQA 4KR9A 1KZ4A 5A7HA 2ZAOA 2PZGA 3EXG2 2LIVA 2NUPB 3HWRA 1I14A 4PO3X 2Z43A 1TDJA 4ZCMA 1H93A 1OROA 4FN5A 1EVKA 1PLKA 4NVRA 1A8UA 4P0TA 4RZUA 3MQ2A 2JA1A 1UBSB 3U1TA 1DBVO 4GXTA 1Y88A 5IUKC 5HW0A 4WXEA 1YDFA 2OECA 2WU1A 4DWJA 2QROA 1K92A 3SOPA 3O0TA 3IMCA 1GL3A 2Y1KA 5BOSA 3NRWA 1RT9A 4HTFA 4D5EA 4Q1VA 3DNPA 4FFBB 3HCOA 3WB2A 4DLSA 3SVLA 4J90A 1FW8A 3SV4A 3P9CA 5DTMA 4M8NE 4ZVNA 1DQYA 5ALOA 4WZZA 1L5KA 4QNNA 4UVEA 1JU3A 3SZOA 2Q29A 3ZOZA 2ZIVA 2QN1A 2H7CA 4NCKA 4PL2A 1T9ZA 3RV4A 5IXJA 3CONA 4ZXFA 3GJZA 2VZ8A 4REMA 4RD1A 3A3PA 3E0QA 3UM9A 3BEOA 3I72A 2QA5A 1IHXA 2XNHA 2WIAA 1UBHS 4ZDJA 3VOBA 2ZS8A 2AN1A 2WG0A 4E09A 5CXUA 3OIFA 1U47A 3EHDA 2C4KA 4FDTA 2ZB7A 4QUJA 5ICCA 2VTKA 1OV6A 1LDGA 5ALIA 3FXAA 5B7GA 4JLAA 1Q44A 4YK7A 1RXEA 2BKVA 3P1JA 4FEAA 3DOEA 1GPJA 1SVIA 2X0KA 2ZI5A 1VCMA 3A28A 1RACA 4GRDA 2YX1A 3AKDA 1KBUA 3PQ7A 1PR0A 1M75A 2Q9UA 3RRMA 4U39A 2P6UA 5T67A 3RARA 4R9SA 1PYOA 3RHZA 2X8AA 2KSOA 2RP5A 1T2NA 4QT4A 4PSVA 4GH5A 3SBEA 4JBHA 3MT7A 2AS0A 1DRKA 5J2UA 2AI2A 4WFQA 1E2EA 2PBZA 4FNOA 2DPJA 4JMUA 5GMOA 3S7ZA 1ZMTA 3IP6A 2IS4A 1YCGA 4M83A 2ECPA 3PHIA 3T3FA 2V7EA 3I9FA 1AZSC 2GNAA 4DREA 1CR4A 1M5UA 1UKYA 4UQGA 4JB3A 4K86A 5J0TA 1TYDE 1ICEA 3QPAA 2G5PA 4XWYA 3KO8A 3KTAA 1ZUD1 4CM3A 4LC1A 2VSXA 2C95A 4KLIA 5L8VA 2XOXA 1Z83A 5JAMA 1CYDA 1J22A 3EZXA 3GFQA 3CIFA 1SC1A 2HVIA 3NBFA 4EYQA 1GM5A 5GJCA 1QB8A 1I5RA 3B78A 1DMRA 1N6RA 1G8SA 3WLPA 2QD4A 2VJMB 4E70A 2J33A 3CHYA 4EYKA 4Q12A 3DQZA 3MWKA 2PFKA 2C3YA 4IOJA 5HA5A 3WK7A 2NQ8A 8ICEA 4HEQA 1L7VC 5LXTA 3QU4A 1VJ0A 4UNSA 3M1AA 2DETA 5FNZA 8ICXA 2PPLA 4NATA 3JPOA 2JHDA 2Z9DA 4M49A 3HEAA 3ACDA 2C7OA 1GTMA 3E9CA 2AGPA 2VDKB 4B74A 4GLFA 4P92A 4Q4CA 2CL5A 3PYLA 1MQSA 5JXJA 3KD2A 4OU5A 3RF6A 2QOEA 1T8RA 1GITA 2E48A 4OJ6A 1QSGA 1QRAA 1SKAA 1IZ9A 1FS6A 2RBKA 3HSYA 4DARA 2FPPA 3O5AA 5L51A 1P33A 3CH4B 1S02A 1PG2A 1FRNA 2PM8A 4YCBA 2CUNA 2KE7A 3L6CA 4HNSA 2X7HA 3FNHA 3TSAA 3UXHA 4RPGA 2FR8A 3WWYA 3HPOA 1G20E 4K26A 1ZQGA 3OCWA 3FOFC 4HS9A 1TO1E 4AKSA 3KPJA 5K6RA 5JEEA 4RT2A 2EP5A 4KYVA 2Y6VA 2WPDA 2BGLA 1A8SA 4RORA 3V8NA 5JJCA 5KYYA 3MTQA 1DZ3A 4AUKA 5B57C 1E0SA 5DMHA 1ANKA 4PG5A 2HW8A 3ICQB 3RANA 5DO9A 2BE7A 3GEGA 1SHLA 2P4EA 4LX8A 5DI9A 5AXDA 2D1TA 2VIIA 1WMSA 1O0CA 1Q3TA 1Z33A 3LPLA 4NU0A 4J1TC 2VWHA 4DE5A 3NTXA 1ZXIA 3RW9A 1LEHA 3JALA 1TQ4A 3WBBA 1LRLA 3UT5A 2JI4A 3H5IA 2WKRA 1NQUA 5ELLA 3L0IB 4L5YA 2V96A 4HLNA 1TU4A 4UNRA 3II6X 4DBVO 3UHJA 1RKQA 3JV7A 3BD6A 3QFSA 3TRIA 1V5FA 2OCYC 1ILWA 4JOCA 5KBYA 3LT1A 2W2QA 1N3YA 1DKQA 1OJLA 5DKFA 3M6ZA 1ZQEA 3V1TC 9ICXA 2FK7A 3DC2A 3BE4A 1QU2A 4MW5A 4AZ3B 4EW6A 1XAGA 1IBCA 2P69A 2WWHA 4OH1A 4R2LA 3HGMA 5K4HA 2W9XA 4J9UE 4MA5A 1MABA 2Z3VA 4I50A 1V3QE 2HHHB 4FYXA 4IR1A 4PRKA 5GONA 1ZSVA 1NURA 4GC9A 2IDZA 4Z3KA 1C30A 5HGJA 1UXOA 4F46A 1G8YA 3M5CA 3P2MA 3PZPA 1FDRA 3OP4A 1B41A 2BELA 3AY6A 3GN1A 4RH0A 3KCQA 6REQB 3CLTC 1ID8A 4FJ0A 2DT5A 3IT3A 1DIHA 4Q01A 2B5OA 2FSHA 1GZVA 1IBKB 2GN0A 3DBIA 2O0LA 2C2ZA 4M98A 3EQ9A 1UK8A 1YV9A 3IDSA 4X00A 1KYTA 3ET5A 4GPBA 3WQQA 1Q0HA 1KARA 1QANA 4QZAA 3BWVA 4BJQA 2IUFA 3DL4A 2C57A 4XGNA 4LC0A 3B9PA 1W4LA 5AOVA 4UXIA 4Z7JA 1BS9A 5T4HA 1WMAA 2E21A 2VWQA 3A9UA 1X2EA 4EUKA 1L5UA 4H77A 4CRXA 1U28C 4D0RA 1CJMA 2H1OA 4ZT7A 3OIDA 4HGQA 3MMNA 2OHJA 2OAQ1 1IVNA 4G0VA 3NRZA 1B22A 4URUR 4WJKB 4O4IF 4G24A 2I7VA 1Y9AA 2GKSA 3JQAB 3MGCA 3QLEA 2Q3BA 1RWMA 1CPYA 2JVIA 1I3KA 3P4YA 4DS4A 3BL6A 1BTOA 4ND8A 1A7AA 4G86A 2BHTA 3T34A 1EWRA 2GF2A 3ESZA 2XNDA 5CEJA 2LWIA 5F5NA 3MRTA 5AVXA 2UZ3A 2F77X 4KQJA 3FYTA 3OIUA 4BIMA 1GPKA 2PT7A 3P96A 2HU5A 3B6KA 4G56A 3QLUA 2DWUA 1XWIA 2A5JA 4P38A 4GI2A 4P53A 4CM8B 1D6NA 1KO1A 2HMWA 4OGLA 3PQ2A 3AT1A 3O26A 2NT4A 1JR3E 4X7RA 5F2KA 1GZ5A 5LD2B 3OFND 4LJLA 5E1BA 5TQ0A 2I5PO 4BEVA 4CKBA 1WVMA 3F7MA 2NO1A 5TDHA 1Z25A 3TXAA 4LXTA 4H08A 2W9AA 2GN8A 4EI2A 2XTZA 1H9AA 4TXNA 1XF9A 4H7IA 3JX9A 5DG8A 4P32A 3A4MA 5K20A 2WA2A 1E4EA 2Y1LA 1IJEA 2DHRA 3PF9A 3R6WA 4RU9A 2CHQA 3ZDZB 3RFFA 3PYMA 1Z00B 3GT0A 3BL8A 2QTCA 2RHFA 1Z0AA 2BFNA 4D9NA 1S89A 1OBCA 1YU6A 1D2AA 5DZSA 1QC5B 4IIHA 2GLXA 3PDCA 3KVVA 4DFMA 4GE3A 2XCQA 2FZ4A 1KRXA 2AQ8A 3KEGA 1VG9B 2Q0ZX 3C85A 3PR1A 2YH2A 4GI5A 3ORQA 3L8CA 1TFUA 2JLYA 4DQQA 3PENA 1DTSA 4RHYA 1XDZA 4EEKA 4IH4A 4BFVA 1JHRA 1CUDA 3PMNA 1Y1RA 4ECRA 3BGVA 3M7IA 3RTBA 4X94A 5HQJA 2WIFA 4XLTA 1ZRNA 4M89A 2E85A 2INGX 1KDPA 5IULC 3ENVA 1LPSA 1N5XA 3HVIA 4DF8A 1M10A 1T9KA 2HIMA 5BVGB 4KMOB 4TZKA 2TMDA 4HLUA 4EPXA 1KQOA 5AM0A 1XWWA 3OH8A 4R51A 3O8BA 1EG2A 1K1EA 3SEQA 4TTQA 3SSNA 1LU9A 2P9ZA 2DUMA 2XF2A 3EEFA 1CQIA 3D3EA 2QQGA 5LQUA 3QZ8A 3TM5A 2AT1A 4UW9A 3VHLB 1KSPA 1QDEA 4L8FA 1J2UA 4RKRA 3MFHA 3AOEA 3ISJA 5I8WA 2ZUCA 4G89A 2IZOA 3NGDA 3NS1A 5TPZD 2BFOA 3RTGA 1M67A 5K3FB 2CNDA 1E0KA 5AM5A 3OE7D 4DCMA 4BLPA 5HWSA 2LVBA 3HGQA 1YFJA 4FP9A 2QTNA 3C5WP 1MA7A 2CYCA 4QFDA 3GLFE 3ZEAA 7ICSA 2Q5CA 2QTLA 3E3MA 3TKAA 4L3OA 1ECPA 1H3FA 1QHIA 3BGIA 4TV9A 2N46A 1WCIA 2DB3A 1XTTA 1CJTC 2BCRA 1P1HA 3A1FA 2ZYGA 4OBWA 1WBJB 2HCBA 1O5OA 5P21A 4BVBA 2DUYA 2JR5A 2FZ5A 5A4IS 1BQ4A 5AHWA 4L50A 2X4GA 3LUHA 1TMGE 1DAHA 1VIVA 5CGZA 2QAIA 3UG7A 3KVYA 1JWBB 2VCHA 2FWMX 2ZRBA 1QO7A 1H4SA 3U4HA 4A1FA 1KTVA 3KBBA 1SL0A 3SDSA 1NUQA 3M8RA 4KBFA 3HDTA 1P2UA 1U1IA 1H8HD 3DKRA 2X9QA 1KZ9A 2P91A 3ETCA 4EHAA 4P3KA 1ESMA 1BMQA 3OPYB 4ZIRB 2GZ3A 3U4IA 4PX3A 4PC6A 3TBHA 2NRTA 4FB4A 2R97A 4ESEA 4O3NA 3GV5B 3S99A 2UYQA 2DUNA 1DOQA 5IPFA 2H29A 1ESDA 3PQ5A 4UBJA 3K7EA 3PO5A 3PXGA 2I99A 4UHKA 5AI4A 1C1DB 2R6HA 4YQZA 3D4OA 2ZJ0A 3TI0A 2GBCA 1CCWA 2F43A 3NWJA 4ZOHC 4B7UA 5IN5A 5C3MA 4UUPA 4JBWA 1MJ5A 2Q0QA 3ETDA 1NUSA 2HQ1A 2FZWA 2P0YA 1WCNA 1T10A 1XRRA 3T5PA 3EMDA 4CMHA 4HCJA 4BPRA 2V6MA 2WIKA 5ADWA 4RA6B 3I12A 5KNCD 1XTPA 2ZVDA 4DQUA 5JXGA 5HBRA 4PHCA 4MUNA 1Q3UA 2KBEA 4LJ4A 4IRUB 4DLBA 3SR6A 1Q1AA 2KYRA 4TUQA 4IFTA 5TR9A 1H6BA 2W6ID 5I7HA 1XMQB 1UT8A 3UA3A 3B52X 1OYYA 1SA0A 4NENA 4QOFA 1K7FB 4JJ7A 2HSZA 3JWIA 4Y6GB 4G9EA 4DPMA 4R1UA 3FR8A 4J0QA 4Y2GA 2NPFA 3NKVA 1EXNA 1XYGA 1O94A 1F12A 2VJ4A 1EXDA 3B9RA 1EGMB 5JQGF 1BWRA 2G9VA 4Y2XA 2ID8A 4GRAA 5LOVB 4M9NA 1BRTA 1ZQUA 4NY8A 4A23A 4UUQA 5TC4A 3N58A 4UVDA 1EX6A 1NM5A 3UBTA 2GTHA 4PPYA 4AZ0B 2H9AA 4U4AA 2YIJA 3BK2A 5HQ3A 4JSTA 2A2ZA 4QLBA 3TW4A 2FR1A 4TL7A 3L41A 3M3DA 4C88A 1MB0A 4G41A 3GV7B 3RADC 1TUBB 4I0WB 1H2YA 1IPHA 4C20A 5T14A 1KSFX 1Y9EA 5JS1A 3WWEA 1IUNA 1UADA 4Q03A 2Y9MB 2B4QA 3W7AA 4JLJA 4RKYA 1Y1LA 2VNKA 3GEEA 1PNQA 2IXEA 5JC8A 5HG0A 1HG1A 2J31A 4GKKB 1JFVA 4GMKA 4U2EA 2Q6KA 2I1VB 3SAGA 3BWMA 1RXSA 1GPDG 2CJFA 5HKBA 4FO6A 4G3XA 5IABA 2B94A 5CG2A 2XJ9A 5LP6C 2RH5A 4KLCA 3HVHA 4ND3A 4QYIA 1FFAA 3OQMA 1SEVA 3DTVA 1SL1A 3DVRX 2I91A 1TC2A 2B0JA 1MPXA 2GSWA 5SZKB 4QM7A 4PGAA 2VRCA 2Y2UA 1OLXA 2CCGA 3ABQB 4OKNA 2PG3A 4BQFA 4KXQA 1HZJA 3D64A 2IPLA 3V1UA 4DEXA 2ZWIA 3L1IA 5L1IA 4S05A 4ITUA 4OXKA 4GPAA 3SYRA 2CZGA 1JI0A 5CUQA 2ZUUA 4BLRA 5FH9A 5ALZA 3L18A 5YASA 2IITA 2PI4A 1D1TA 2L2QA 1P0MA 3EAGA 4KMMA 4A2WA 1JXEA 2FX2A 3TAUA 2VH5R 3D0QA 3WGNA 5JYEA 3IMFA 1Y6RA 1NI5A 2AG0A 3C4JA 4DHWA 1G8KA 5IBCA 2BGRA 3CH7A 4WECA 4IFIA 4HWSA 1KR5A 2P6MA 1KP3A 1BGVA 1EZ4A 5F76A 4HXYA 1MRNA 4ZYUA 1NR1A 5JO9A 3E7XA 1BPEA 5J0XA 3TTTA 1T5TA 1D3AA 1EG7A 2CUKA 1MJFA 2G5IB 5FPSA 2PO5A 9ICIA 3ZQ4A 4PZCA 5IAOA 1I2DA 3TSZA 4RNOA 4BWMA 2JGMA 3KP1A 1U2DA 3ZDBA 1BROA 5JAQA 3VKFA 3VAYA 2BGGA 4OY3A 1C81A 4IYRA 2PYDA 3OQBA 5HDQA 2H2DA 3CBGA 1YQEA 3PUKA 3NHPA 3RTAA 3U7FB 3DO8A 3OMWA 4CDRA 1JFLA 4KTVE 2GB4A 3PSTA 4C3ZA 1JU9A 1DWUA 1GG2A 3ACBA 2C2YA 3JYNA 3WLOA 1XRPA 4KDEA 2BR3A 3IEVA 1TCVA 3AH8A 3ZGYA 1PX0A 1XTSA 1OLSB 1QTMA 3TKYA 2O05A 5I45A 4CBVA 4GWLA 3IDOA 4DM4A 3O4VA 3AV3A 4B9EA 3UY4A 1FYFA 4UB5A 4TUPA 1IG3A 3ZQUA 1N3IA 4P5PA 1T4MA 4R8VA 10MHA 4Z0TA 4HNVA 1FMJA 4J7XA 1FC0A 3ODPA 3RYHB 2CMGA 4IHKA 4LF8B 2ZRPA 3T1YB 1DMSA 3DE2X 5KOHA 1OHHD 5DX1A 3C2KA 1K4KA 2H4ZA 4RKEA 1QO9A 4DMRA 1SVWA 2QTAA 5DX0A 1F1BA 1QJ4A 3D7LA 2VDLB 2CL7X 1HZZA 4HAIA 1ELOA 3SHFA 1ACLA 3CLRC 1AQJA 2WJZB 1PJBA 1E6CA 4GPEA 3IVXA 1HE3A 4MUJA 3MF4A 4C4ZA 5J43A 1X80A 4GU5A 4FE7A 3RBZA 2I03A 5JZBA 4LGCA 4CG2A 4EGFA 1U11A 2GERA 3FYDA 3GPLA 3HU3A 4Z6CA 2WMDA 3ZU4A 3PDIB 5GM2A 1M2FA 3ITNA 3QYPA 3OIVA 1M2KA 1ZEMA 2V03A 4GMXA 2GBFA 3U60B 2ES6A 5KWVA 1YVRA 3D1JA 2VDPB 1SVKA 1KQQA 1CF2O 4YJGB 1H4VB 3UICA 2HWKA 4QJ3A 1JIIA 3OVMA 5IC5A 4FBTA 1WU7A 3GLHB 1ADFA 2H5XA 3TZKA 3AL2A 1C2YA 1N7JA 2R11A 2WJWA 3T3DA 5HMMA 4O2AA 5E6UA 1EHYA 5I51A 3M4JA 3TADC 2IS1A 1YVPA 4X41A 5TVGA 2OZPA 4KYTA 5AW8A 1X7YB 1NBEA 2CSXA 4OHZA 5HJEA 4F8EA 2DY0A 3PVCA 5FLYA 1I6MA 4E30A 1FYDA 2W6NA 3FB1A 2ZYSA 3NHWA 9ICGA 4LWOA 5BV7A 3VVMA 8ICRA 4O4HA 2D74A 4UU1A 3LBYA 3QOXA 1YD7A 1CE8A 1GQFA 4GD3Q 5IC6A 1X7ZA 2PUEA 1NK9A 2DPLA 2P3LA 1KKMA 1RNLA 3FNRA 4NCAA 3SF8B 4M9ZA 4JL8A 3KOOA 2MYNA 1DXSA 1GKYA 1LWNA 1ZESA 3P4XA 2XYGA 2E89A 5JG7A 1CUCA 4G5XA 2HDHA 4UTOA 1WJGA 2KTQA 3EARA 5HKAA 8ABPA 1IUPA 2QN7A 3FCYA 3UUGA 4W8GA 4UBOA 1DU4A 1PD1A 2XT0A 3S2UA 3TAHA 1IM8A 4N3AA 1XE3A 1WSWA 2WF8A 4BMXA 3L0SA 2JGIA 3OOYA 3RVLA 2YJ5A 4PIPA 4M0AA 2JANA 1Q1GA 3DTYA 3ZZ1A 2GBGA 2JBHA 2BMDA 2ZRAA 1TZBA 4BWJA 4AG5A 2KBFA 5B5EU 3TO5A 3KXKA 4LBVA 1JHQA 1F0KA 5KX5A 5I7UA 4KQCA 1G1AA 3UV6A 1A95A 3EZ5A 3AHHA 2LIPA 3X1JA 4RIFA 4CLHA 1IRIA 3T9DA 1KWKA 4EBBA 1G3RA 2P66A 3PVXA 1LTQA 1MAVA 1U3DA 1VXOA 2RB4A 3DBRB 3UJBA 3A1DA 4QZVA 4B6JA 4PANA 2FJUA 1M1ZA 2YV3A 2W6MA 2QE7A 5BRNA 1KBQA 3Q8MA 3C2MA 4HSEA 1J0DA 1XU9A 4FGSA 2B7BA 3DLPX 1UIMA 4NJOA 2XOKA 2GYWA 4QSMA 1FLDA 7AT1A 2Z57A 4PAWA 3FIJA 2IC5A 1U4BA 1G7CA 2Q28A 3NVAA 4JT8A 1QO0A 3AF6A 1HTWA 8ICVA 1W5TA 1I4OA 1J2EA 4NCJA 3VISA 4LTDA 3C8DA 2YJTD 1W94A 1Y1PA 3KU4A 3UBMA 3N3BC 1IOLA 1GCOA 1KI2A 4U0JA 2Y4OA 5B1DA 2H1CA 5G4LA 3Q98A 1JR6A 4Q7KA 1M6VB 2QSYA 2VSQA 3OZDA 4CEHB 1IOWA 1RIFA 4F3TA 2YY5A 5ETJA 1L4FA 3QTBA 4KL8S 5FPTA 5A3QA 1K89A 1TMKA 3CRQA 4IEIA 3RNLA 4LMAA 1CY7A 1QTIA 4C78A 4ITRC 4YQFA 2YN2A 1JHAA 4LXXA 2Z6QA 1IB6A 4BVEA 3OZRA 3PITA 1KC1A 3H0KA 1NZDA 2ZQYA 1UKAA 3EQZA 1L3TA 3IB3A 5C8XA 1CDZA 2JDID 4QUGA 3MPUA 3U4CA 1H85A 2PX2A 2ARKA 3RJJA 3H5AA 3HO1A 5KNBH 3KR1A 4HGZA 3W9BA 2R1UA 3V7NA 2ZXIA 4IXNA 2CYBA 5IJXA 2DLNA 4Q82A 1CI4A 5AJYA 1T4DA 2PLRA 4N0PA 4JJZA 4DRXA 3HFJA 5JI2E 4KQ6A 4KUHA 1RJWA 4PVDA 4FUTA 4MYUA 5AW2A 5DMXA 1KIFA 2HIHA 3K30A 3MR2A 2PO7A 2KLBA 5IFKA 4F91B 4OQXA 5G0UA 1WKBA 1N60A 5CFLA 1I4EB 3G23A 1CQJB 4XR9A 1HEKA 1T0IA 3A2NA 2G9ZA 3K31A 4C1BA 4TT3A 5G02A 2O19A 3PVZA 1IDN1 1IHYA 2KKVA 3ODGA 4OJLA 2ORED 2R6DA 3F74A 4MO2A 1DWQA 4F92B 4Z6KA 2CE2X 2WIJA 4RDCA 4PYQA 1VKNA 3T41A 5ADUS 5BNZA 4MV7A 3RJ9A 4AJ9A 2QI9C 3BERA 4UKDA 3VOTA 1JQAA 2VJAA 2WJ6A 3RFXA 5BUZA 2FSUA 3MD0A 3WZ2A 5AW1A 4PGQA 3AEZA 2WW8A 3GLIE 3WSVA 3CEHA 3SR3A 3IQFA 4MICA 5AKXA 1T3SA 2GKOA 2TECE 1HT3A 4TRJA 5C7IO 4NZNA 2ENWA 1YK1A 4LSGA 5CDFE 4ZDIA 5CH8A 3TOZA 1ZRSA 1C50A 1ESCA 3KSUA 2E9SA 3G8BA 4RH3A 3SF0A 1H2ZA 1RADA 5KNDH 3MGAA 2NAPA 1GT91 5DK6A 3P32A 4V0NA 4V1CB 4G2TA 1V7PC 4B6RA 2H8KA 3WIEA 2FUG1 1LKYB 3PCRB 1EBBA 3D1LA 1ZI9A 2PS9A 2JJ8A 3RB4A 4AECA 1U2RA 3SZ2A 5B5SA 1SVLA 1I1HA 4UTRA 4ED3A 5B7NA 3U0VA 2Z8YM 5JWOA 4Y9TA 2ESRA 4YP9A 4ND2A 1GR1A 2BUBA 2OO5A 1V5IA 3RABA 3EBPA 4EUNA 2JHCA 2YWCA 3IUMA 2MYTA 3E15A 3CSUA 1ZH8A 3NM6B 2HBZA 4LF6B 3H5RA 3A6EA 4H7KA 2B7LA 2BH2A 2YZKA 1YKSA 1ZQTA 2Q6VA 2H0AA 1W75A 4RD4A 3E7FA 1PR4A 2PKEA 5KDOA 5DBEX 5KINB 5CNKA 4UNIA 3IALA 1FDUA 3N8KA 4A91A 3NHYA 1UHUA 4DSJA 3ZR4B 4AG6A 1R15A 2P8JA 5LQSA 3IBFA 1D2EA 1PRYA 1NQAO 5C8YA 4REQA 3HXOA 3CRVA 2PA3A 5TJHA 4ZVRA 1PBNA 4UUMA 3UN1A 4A26A 5CYFA 2GARA 4Z4GA 2NP7A 3PQEA 5CFRA 3UMYA 2WTBA 4BS9A 2BI7A 3T52A 2D5BA 3X3HA 4A0SA 4M1TA 3T7SA 2WSBA 2YINC 2NZ2A 1EAMA 3E8XA 3MWGA 2VPTA 1K98A 5SYMA 3WB1A 5JSKA 3BCHA 4YMHA 1NI3A 1ORDA 4GKAA 1FF9A 3EE6A 5L95A 4P3NA 3EOBI 2C9OA 1N2ZA 1RLIA 3A8TA 5TGTA 3OFSA 1PFWA 5BOVA 4KPFC 3NORA 3VO1A 4GDMA 1JEYB 3G2JA 2AQ0A 1S77D 4IIJF 4WBXC 5EHXA 4MX8A 3I0MA 4F3YA 4F6RB 3R09A 4OMFG 4TQ9A 5GTIU 1FQKA 3K05A 4BX3A 3K1YA 1R0SA 4ZTZB 4RE5A 1UBFA 2P75A 5KG4A 1UKZA 4ZD6A 5FPPA 4CPDA 2RDJA 5KTMA 4OJQA 2AXPA 4JJ6A 3BIJA 3GJ4A 4V2UA 2QLFA 4F86A 1Q7CA 2H4FA 1M54A 3R9XB 1ETUA 5CDSA 1U4NA 3QX8A 1G63A 2ZT6A 4G36A 3GJ0A 3KB2A 4NR0A 3FPJA 9ATCA 2XYPA 4EVRA 1NYTA 1Y4SA 2BEUA 4ES6A 5C35A 1Z6QA 3BAZA 2TMGA 3TLCA 3IBCA 2JJYA 4RQ4A 2A0UA 5FWXB 3HKEB 1UL1X 1TB4A 3QKUA 4WA7A 4MJXA 2J46A 3AZPA 5JE8A 5IMSA 2H1VA 1QB7A 1LDNA 3HB4X 1N6PA 2GZSA 5B1HA 1T15A 2X42A 5EUQB 4I6EA 3U16A 2ZVJA 3AC0A 3SV3A 3ROMA 2C29D 1B14A 4HPXB 4YCNA 2JH9A 4JS0A 1TYEB 2BMFA 3PU6A 5AVKA 3BH7A 4P4TA 5M34A 4UB4A 3AEQA 3UK2A 4Q4JA 2YXEA 2WJ3A 2I6GA 5FUXA 4CI9A 1LK0A 4ZVVA 4UBCA 4OGGA 5HFJA 3NRCA 2BR0A 2BGUA 2H4XA 4U3JB 1LVHA 5KIAA 2ODGA 2Z04A 2ZBEA 2ECFA 4GXQA 2ZJ3A 2JATA 4RMJA 1PK3A 2CJXA 4ISBA 2Z4SA 2X8JA 4FOLA 2Z30A 4P2HA 2ZIEA 3LRPA 3UGQA 4M8LA 2ID7A 3I9NA 1YONA 4WE3A 2ORYA 2Q4EA 1KETA 4JEUA 2ASJA 1Z5NA 4ALJA 4V0OA 1OD6A 4E15A 2E5LB 3MWDB 1ADBA 5BOLA 4FHEA 3IV7A 3VGJA 2JJ1A 4GR5A 2UVUA 5K2MA 3KOYA 4KPGA 1FZTA 2IYOA 4KNVA 3THSA 4P83A 3QFRA 4OQNA 5EERA 1G6KA 2JEIA 4RK6A 2ZTMA 2CVOA 3LOPA 3M4YA 2GMWA 3E1SA 2BUCA 4XIIA 4UZFA 5LBIA 3DT6A 3MJ4A 3W3AA 3GRYA 1HDYA 3HKCB 4Q47A 2CEKA 3TFRA 3SM9A 2AOTA 3RVRA 2O2IA 3LW7A 1N2IA 2H2AA 3K6KA 3C6BA 4QPNA 2F3QA 3WYEA 3WK8A 5CB4A 3N2GB 1Q77A 1OTXA 5E3IA 5KNIA 3FG9A 1U1FA 5DCYA 4EFLA 3IRVA 4UULA 3KTDA 3MAAC 2CXNA 2YJGA 1L6RA 4YVFA 3ZJYA 3C1YA 1BHJA 2ASEA 4KAFA 2G04A 4BNKA 4JB0A 4LISA 2NO4A 5LIPA 2AR9A 3OQIB 2HPHA 2P2YA 4JUZA 4XB2A 4JR0A 4DLPA 2BFMA 3V42A 3E23A 1EP2B 1CY4A 4MYSA 2PFGA 5TZVA 4MFFA 4E2WA 5ALEA 7ICFA 3V7JA 4RHCA 1MG0A 2Q99A 4FDLA 1OB2A 3UKDA 2HU2A 1IL0A 1UK9A 4F5NA 2W2MA 2X19A 1TU3A 5ESXA 1DEKA 2JAPA 5DLPA 4M87A 4TSFA 2OKGA 1ZJ5A 4V0KA 2XVYA 1P3DA 1V8OA 1SUPA 1MVNA 4ZARA 1YDEA 3GVPA 3CEAA 3WI7A 1BHQ1 3IN5A 5I47A 5AT1A 1PNRA 2FEOA 2POCA 3CVJA 1Y6GA 1H2EA 3TGPA 3L07A 4MQFA 4U2CA 4GR4A 4XX0B 4U9UA 5FPQA 3SKXA 2PANA 4J7AA 4KLTA 2R7LA 3SEZA 3LE8A 4UVHA 4ZVUA 2H16A 2WIGA 4KH1A 5LYJB 2QV7A 4EP1A 1T3NA 2V7WA 4EMSA 5JVDF 1NBMD 2J9ZB 5ERXA 1B8PA 2VJPA 3LT0A 5IKPA 1AKWA 1Y5NA 3OSUA 5IJWA 2WJVA 4DSFA 5FI0B 2OVFA 3TQTA 2AUTA 3A4IA 4DNFA 5CVTA 4ZU6X 1A4UA 3FBWA 5M5BA 2PLWA 4Q5IA 2GH1A 2ZBFA 3ZHXA 1OASA 3COWA 4N3BA 1FNDA 2N47A 5LDGA 4J8PA 2IHMA 1E79D 4W5HA 3LVQE 4IFBA 3L92A 5KQRA 3WYBA 2NUTB 4HTAA 5A3RA 3I0ZA 1U1GA 5KAMA 2JZCA 3VR4A 3SE0A 2B30A 1QV9A 4QLAA 1N5DA 4LVSA 4U02A 5F1KA 4E2XA 1CY0A 1CR2A 1O6BA 1JJBA 2NU9A 3BKXA 5I4KA 4WASA 3VNQA 4RGVA 4ZC1A 1ADGA 5BSEA 2H2IA 1VC2A 2AQKA 4FHDA 2OZLB 1FDSA 3KX2A 4NZ9A 4KVGA 2Z1NA 2REQB 1SCUA 7REQB 2NMVA 5FEUA 4WNCA 2QSZA 5F21A 1M34A 2JLRA 2VBGA 3EGEA 2A0KA 3AHCA 1ZH0A 2DBQA 3BXGA 1VHJA 4H6XA 2QGZA 1W88A 4NS4A 5HVNA 3L8EA 3UMRA 1RAGA 1THZA 4W9MC 4I4TB 2B8TA 1PL6A 1I1OA 2FLWA 5HHHA 2MSWA 2KVCA 1LC3A 3MSXA 2OWDA 4JFAA 3HN7A 4LPKA 2OA0A 1QMGA 3HZZA 2KG5A 4DEYA 1JLLA 5F7OA 2ZS7A 4O4JB 2PIAA 3MFYA 4L5JA 4LYHA 1U9IA 2A4MA 1I3OA 2WJIA 3PFCA 2O6LA 2QMUA 1RI5A 5CLJA 4LWPA 4DQDA 3H0LB 3SKYA 3VHRA 3Q8RB 3FTEA 1VDMA 3ZTWA 3KALA 1ZK4A 4XQCA 4RZSA 4MDYA 2IQIA 3FGOA 4HD8A 1ULUA 4LCJA 3TOXA 2WE7A 2P7HA 4LHEA 1VL1A 2G0NA 4KLJA 1L8AA 1EK2A 4ZHQF 3BMCB 3WR5A 4NFHA 1LBHA 1GDDA 3OZCA 4QECA 2CD7A 2V4MA 1XRNA 2HBMA 1JGTA 1MAAA 1OH7A 1YCFA 2V6FA 2VUIB 1G3IA 1C1HA 2XB4A 4HH3C 1OI2A 4MV0A 3KQWA 3TNFA 5GWXA 2ZU0C 4BO8A 2RHDA 4NDAA 2F8MA 4AJEA 3UKJA 3AVYA 2QI9F 1EVZA 2D8MA 4K6OA 3LYSA 4GIBA 1ZWKA 2HBQA 4ROTA 4AAYA 4PBTA 1E1NA 1CY6A 1AO0A 4WA8A 4KOAA 2A94A 3DH0A 4ABYA 1P4AA 3IQDB 2L0XA 2K4MA 3INRA 1BJTA 3JRWA 3USCS 3HDQA 3F96A 1X1DA 2ZAGA 1IV8A 4RJ2A 1GPLA 2VG8A 3LQ2A 1IXRC 3V4OA 4DG8A 1LVUA 5CMLA 1NJXA 1DE0A 3KAPA 5IH7A 2WSIA 3T4PA 3G9UA 2O8CA 4NPCA 2BC9A 1ZM3A 2OZKA 4JL6A 4G63A 4CEIA 2VBCA 3DNFA 2I4RA 2BBOA 1U5CA 3TLXA 1IY9A 1RWBA 2G09A 2YYAA 1QQTA 4M0MA 3WX0A 2A5FA 1OREA 2Q1UA 3PC3A 3CR8A 3OQ1A 2I4TA 2EQBA 5BWNA 7ICNA 3AFOA 4D3XA 1A4RA 2EZ4A 4XARA 5ALLA 4C2TA 1G0OA 3IT0A 4DFKA 2Q8PA 5JC1A 3IHKA 2D2VA 4DYHA 3W2IA 3F53A 3UAYA 4MUKA 1V95A 3SXUB 3DA8A 3UAXA 1DRGA 3STVA 3PEUA 4TV8F 2D2IA 4DQSA 1TM4E 4Y2UA 4I8IA 3W0LB 3S44A 4FDVA 1UEXC 2VYNA 1FNBA 3GLUA 4OREX 1H05A 2UYOA 3DVAA 5GAJA 4NDNE 2RK3A 2F64A 3HUEA 4RK4A 4M46A 2RGGA 2YFYA 4M2YA 2LI6A 1ML3A 2XLCA 1Z1BA 1RM3A 3C3EA 5IM4F 4BTLA 4X3CA 2EX1A 3ANTA 4YJ2B 1VMDA 1L5ZA 3OZUA 4A9AA 1L1RA 1KAMA 4L9SA 3K6JA 5CFZA 4IS7A 4IVRA 1CZNA 2B4YA 1YRHA 1COOA 4E1VA 9LDTA 3OE4A 2DKXA 1KERA 1USKA 3OKAA 5IVPA 4J0HA 5AWFC 5KT7A 2CLCX 4LW8A 4AY4A 1GAQA 3QPDA 3JWHA 2G25A 3W5DA 1I2MA 2EKPA 3AZQA 4LHZA 4MVJI 5THKA 3QMPA 4UB8U 1RM6C 2VPZA 1TJ5A 1V2GA 4NY1A 2VHCA 3HL0A 1LLUA 1IZYA 4IIGA 3M8SA 4HH0A 5AUPB 1M1YA 4G07A 3ESAA 5EI5A 1T4CA 4WKBA 1ZK0A 3ZCSA 2WYWA 1NPDA 3HUUA 3UXNA 1ZJNA 2BJWA 3LKBA 2ZIUA 2A6PA 5EQDA 2VKQA 1B7GO 2BFBB 1IK4A 3UOGA 1G4AE 3JR3A 2YQZA 2YTZA 1F0NA 2XCAA 2ZUEA 3ED5A 2HSGA 1VL0A 3RT1A 4OFZA 3V6HA 1EK1A 1VBMA 5LQCA 2R6GA 2VXOA 4HHEA 1XTIA 3TFQA 3M9LA 4Q4DA 3WNZA 2L19A 3IMGA 3D54D 2BGWA 3A2KA 3DKPA 5LU9A 3H1AA 4C6TA 2ZR0A 1SXJD 1MX9A 2BF4A 4H0CA 5K4AA 5A7GA 5I7RA 3RU9A 2GDJA 3LP6A 2H1SA 4IM7A 1MB9A 5L9AA 3O0DA 3R7BA 4RQ2A 1QCYA 4I5DA 3UJ7A 5BV8A 2QS9A 4IS3A 4GUAA 1OFGA 4DIKA 2OCKA 1BAPA 3EWNA 4QIHA 3R40A 1R0CA 1DQZA 1F2DA 2DKOA 4WFJA 3MCUA 1DKPA 3EW7A 3DUFB 4G1VA 5J2EA 4F56A 3VNUA 1N4AA 1SBYA 1XPOA 1U8CB 3SK0A 1Y7LA 1X8LA 2Q2NA 1DX4A 1OIVA 3DKKA 2AN9A 1C7FA 2W7OA 2ZI4A 4PZOA 3RC7A 4DUZB 1K7YA 4UE3S 2OGTA 2QM0A 4RENA 1EWQA 2B1IA 4BGUA 4YRMA 1JPJA 4CCYB 2QE6A 3IP8A 1KH3A 8ICOA 4ABTA 1SHKA 1SKRA 2GA9A 2ZBDA 3KUXA 4EY7A 4JAVC 2FPGA 2R00A 3K6SB 2AG8A 1TD1A 2GYUA 1E2FA 3NMUF 1JS1X 1URJA 4I1IA 1DGSA 1UPUA 5MFPA 3NVMB 3WYAA 1J09A 2Z4RA 3AVQA 2GJ8A 5J4HA 3I09A 4Y2JA 1P2TA 3TBFA 4O2BB 5K09A 2GN9A 4HYQA 1ECWA 1BA2A 3URKA 2ZTHA 3SJAA 5DM4A 1NP6A 3NAGA 3GCZA 3ESCA 3B5JA 1RDFA 1OZAA 3ZVMA 4Q43A 4BB6A 3NNSA 5LCXA 1JG2A 4YAKA 1PHPA 1DJOA 3AM5A 4J4HA 2Y27A 3GEIA 1Z0FA 1XQXA 3PEFA 1O77A 4DJDC 3GZJA 2VJKA 3AR6A 1EFCA 4EZ6A 2QRVA 1SK8A 4H27A 4ZI2A 1JG7A 4UHJA 1T1GA 2VTEA 1TD9A 3OCXA 1N0WA 1CUHA 2AJLI 4EITA 3GX1A 4TOIA 3PXBA 2P5YA 1FOEB 4RUKA 2NVBA 3PLAE 2IOFK 1K6IA 3F0TA 4L07A 4LX0A 1EFDN 1N6LA 3H83A 1OGJA 3QIVA 3PC8C 1M6YA 1PFKA 1SQSA 2QL6A 1LD3A 1OV4A 4V02A 1NX6A 4GXNA 3B1WA 4RMNA 4GPTA 5ILQA 3GMSA 2GHRA 2Q7XA 4DFJA 5EZYF 3LLMA 3KOUA 4EA8A 2JVJA 4IDNA 4GQIA 5ICEA 5JR3A 2BMJA 3FUTA 2ADOA 4EDFA 3AFGA 3WV5A 3GDOA 2QRZA 4FZJA 3MB5A 1A5TA 3OF3A 2F90A 2IBMA 1Z5UA 3O1IC 1P2SA 4DC1A 1MBZA 1Q21A 1PEAA 3OZVA 1YK0A 4CQJA 5JAHA 2ZETA 3IBSA 1FYEA 4L4RA 3ZE8A 1A9YA 4FYHA 1DX9A 1QS0B 3W6OA 4YP3A 4KKVA 1N0VC 4L1KA 3LBAA 4QUHA 2FQQA 1JL3A 4O3FA 3EUB2 5BURA 1SBNE 3QWBA 3LQ1A 3G0DA 4MROA 1C14A 3RB0A 4R8LA 2CK3D 5IUNC 4YRLA 4LF9B 4UPEA 5LQAA 1N8TA 2M9MA 1VYVA 1NJGA 4ZYXA 1NMEA 3OEWA 4RHTA 1YS2X 3M9WA 3QG1A 1RZ3A 4ZT5A 2PEZA 1INLA 1B8VA 1SCQA 1S7CA 4P4LA 2QVLA 4HRVA 2XICA 4M3NA 4MRMA 1V1MB 2NVUB 1O5TA 1A8QA 2I29A 3AERA 5HGXA 3BZCA 5AJZA 2QLBA 1GN9A 3UJPA 3PB3A 3IV9A 2EKDA 5ESWA 2BQUA 3CX6A 1KJJA 5E7QA 4E07A 1U0RA 3SSMA 3GYGA 1A9XB 3U48A 3BQ2A 2QPLA 4JP8A 4QXRA 2WNSA 4P82A 4J3FA 3A3KA 3VHQA 3B3FA 4BX9C 2JAXA 5FWYA 2ERYA 1VIMA 3GLSA 3PR5B 2KEYA 3D7NA 3P0RA 4RDHA 4IIEA 5DM60 5FTLA 3SZ3A 3BORA 4Y6RA 1RD4A 1T4BA 1VRVA 3GRCA 4HDMA 3H84A 2O59A 5AI9A 2HJGA 3IEXA 2GPAA 3A6JA 3IE2A 4UNPA 1RG6A 4B44A 2GXAA 5KYTA 5JU5A 2N0SA 4H17A 2GCEA 4LMRA 3LC7O 2C5BA 2X1MA 1H0SA 1AHIA 2QB1A 3L1VA 3OUUA 4WK2B 1QKJA 4DV4B 1TYBE 3HEMA 1P44A 3ZV6A 3P9XA 3PHCA 3I5UA 3SOZA 1TADA 2CFSA 5A0LA 4AVYA 1WVGA 3E5HA 3QBJA 3GG2A 1T1RA 3QW4B 4NV3A 1VE9A 4LJSA 4RS3A 5F2EA 2MWMA 4US0R 4BMPB 2BSQA 3Q6NA 3D3NA 4CFSA 5C80A 1KAGA 3GQBB 4DEZA 4JUFA 3M89A 4F5YA 4YP7A 1VHTA 3AIOA 4O5OA 2W2OA 3A36A 1MGPA 1XZIA 3Q4GA 1U94A 1ZETA 1JBKA 2CLEB 5AOAA 2WWIA 1N61A 1Y3BE 1G2QA 2YVQA 3R6DA 3GLHE 3GBPA 5H68A 1JQBA 3PTZA 5EMHA 4GZMA 1I1QB 2GCIA 1QVAA 1EDEA 3P2EA 2A57A 2DF8A 5CFNA 3L7IA 1AX9A 4N54A 2DR3A 5EQFA 1QK4A 3SBOA 1QH1B 1ZQJA 1J8YF 3EYZA 1P9NA 3V7UA 1I7QB 2OCEA 4DLXA 3ZJ4A 4HFNA 1KF0A 1P1CA 4BP8A 5A62A 4DXAA 3NIDB 2FEWB 1RPJA 2EQYA 3LVWA 4ZZ2A 5IYZA 5CA0B 4ZODA 4F3NA 4TUYF 4ZH4A 3IXQA 4QOEA 1X7XA 3EVGA 4B85A 4FS8A 3TOCA 4YCJA 1KVRA 2RIRA 4X24A 5DGBA 3AHJA 2BWJA 2VFAA 2H48A 2D8AA 4IHJB 1QCDA 3Q10A 1E3WA 9ABPA 3F3YA 2VF5X 3JQ9C 2C8LA 2PVSA 3CZAA 4KN4A 1WCYA 5HNKA 3B1KA 5JTUA 1L4GA 3NS7A 3DHYA 4LN1A 2X23A 4AU1A 2I9GA 3JQ8B 1L7RA 1L5QA 1G38A 3QI7A 1KC3A 4AJNA 1UC8A 1M76A 2P9QA 1CD5A 2EWWA 1L1QA 2JXJA 1E9EA 3WGOA 3EQ6A 2A4KA 1NYRA 2I76A 2WFMA 3LBIA 4A10A 4NJEA 2QT9A 1K3TA 1P1KA 4F11A 4B3FX 5DOZA 1HORA 4WLVA 3R20A 5H83A 5BUSA 4F4IA 2E37A 2KP7A 2BUAA 3ISCA 1ZSNA 1ULHA 1ZHHA 1Q3HA 1N6NA 3M34A 2C2HA 2MSNA 2IUTA 2OORA 3MRXA 3R3HA 1DQPA 3SJUA 2DOKA 2DPGA 4TLEA 4ARBA 1XNQB 2HHSA 4OHRA 1X9HA 3E2PA 3HX0A 3PNLA 4EO7A 3W2FA 3GI1A 1YR3A 1Z17A 3DBHB 2VPWA 1YB2A 5D51S 4HDRA 1A5AB 1BEZA 3A1TA 3OPMA 2ZYVX 3WLLA 3MIZA 1ZVVA 3UH0A 3BHJA 3E2EA 4C4XA 4RQBA 3TXXA 1UBEA 1SVMA 5T3YA 3NPAA 4PNHA 5GTDA 2YRFA 3WVNA 1EP9A 5EJ7A 3LUJA 3ZJTA 4D9GA 2XQFA 1GZ4A 4UOEA 721PA 4LRTB 3E0XA 1X6VA 1SU8A 1LBTA 2VO1A 4S2UA 3JAMA 1IEXA 2WB2A 1M0SA 1XNRB 3HCAA 3TMKA 4FFLA 1HRDA 2XZDA 1U02A 1UZLA 2W3RA 4O4LB 4E33A 3TBKA 2O4UX 2HMUA 1N62A 2J5QA 5B58T 2NV6A 3PUZA 2BKAA 3V34A 3OLVA 3UYKA 3AUYA 1PJAA 4F4WA 2QT1A 3WGLA 2XBUA 4Y1FA 3QP9A 3DE7X 4BNXA 5J2TA 3IUNA 1RQNA 2C94A 3TIFA 3F49S 1CUAA 1JPVA 1CUVA 3LMKA 4MIKA 4E1BA 3R7LA 5EUBA 2AJBA 3DE3X 3L8MA 2JFZA 1PQPA 4FCCA 2DHEA 1NUHA 4JVLA 4R16A 1PJ8A 3M6IA 1GG5A 3WGJA 1GG8A 1UJ6A 5AHXA 3HHPA 4RY8A 1EUDB 2PZJA 3QUAA 3RHTA 3SYMA 3O4RA 4J2HA 2J3QA 1W0JA 1N5WA 4QFMA 3VZRA 3HKZC 5J0QA 4LZZA 3OQVA 5GADl 1SBHA 1GHTA 1XXLA 4PO9A 3IFSA 2J85A 2BOVA 1D4OA 2C4UA 2H65A 2B9EA 1Z6XA 1W0CA 2MSLA 3SD7A 4YMLA 4UJ5A 3FMVA 3BIWA 3DCJA 1J2RA 4M8SA 2WYIA 4OXQA 5LZ2A 4YJ3B 2DG2A 3NM4A 4MR7B 1U4SA 3DLCA 3N0VA 3QVGB 2QJRA 4ZI3A 2WILA 1BMFA 2R79A 1SOWA 2PBFA 1Y3DE 4WNYA 4EHHA 4P7JA 4P4UA 4QGBA 3S29A 2IEBA 2AD5A 5CCDA 9ICWA 3QX7A 4DV2B 2EFCB 1E3SA 4YH1A 2FP4A 2R751 1IY2A 1G64A 3HA2A 3KL2A 2WTEA 2YJ4A 3MA0A 4JNCA 3RWMB 3SC2A 5A4MS 5TMPA 1CUKA 2KJ9A 3VR6H 4GYJA 3UGJA 1ONNA 3LVBA 1HUOA 3UJ9A 4N5IX 2GJ4A 2V7VA 1V8PA 5DXFA 4CR8A 3KUUA 1U04A 4LKOA 1HSOA 5BN5B 4YRJA 3A6KA 1NNEA 5AKHA 3PNPA 2F3RA 5K3BA 2ZJ6A 2VF8A 1K5HA 2D5CA 2KPOA 2UXBB 1S9HA 3H1GA 3LIPA 3B82A 1O3YA 4B7CA 1ATIA 3DKIA 2O7SA 2GHQA 1AK2A 1BVRA 2CNBA 5JNRA 3CEJA 2FSVA 4QGHA 3F2VA 2IPAB 4TL9A 2JI7A 3RV3A 4S04A 4IG4A 1X15A 2YDYA 4CETA 4ID3A 4HWGA 1GADO 2J5BA 2I22A 4J75A 4RPHA 2GI4A 3RWOA 1M73E 2B1GA 2FW8A 5LA6A 3Q7SA 1EVIA 1FXWA 1XWFA 2VHZA 4S1VA 4RFLA 3EPIA 1YVEI 3ZCTA 2WUFA 1PEYA 4FOTA 5IANA 3JARA 1SC9A 1W73A 4WOJA 4INJA 3I37X 3WFIA 4B6FA 1ZQ1C 4Z4IA 2NRVA 1XDDA 3TXYA 1A69A 4K2HA 4JYPA 4B6EA 1C7YA 2R8GA 1VKHA 4A1OA 5AUQA 2YIDA 4FE3A 4WLFA 2ASLA 4OKSA 1P4GA 3DOHA 2R8EA 3V2GA 3ZVKA 5DP2A 2IIQA 4LY3A 3WBKA 1RCFA 3UENA 1OVGA 1XHEA 1VE7A 5JW6A 3JQRA 3QVUA 2HK9A 4EZBA 1SHUX 3PFKA 1NQ5A 4OBXA 4MF2A 2UYHA 3ROFA 3GYBA 1XKQA 1Y82A 3S1LA 5DBIA 1T0HB 2Q6LA 3L8HA 5DNUA 2XZOA 1NJYA 5DHFA 3ZTTA 4IICA 3ES9A 1DEOA 1L7DA 1XTJA 4DNXA 4DMCA 3VSAA 4E4YA 1PJQA 2HEGA 2RK6A 4EGSA 2Z0MA 2BHNA 1H3NA 2O52A 2C2KA 4OM8A 3PI7A 1AK1A 4QJBA 3HRKA 2PCJA 2P1ZA 1DKUA 3VUFA 1C8KA 3I2FA 1W19A 3H19A 2OG1A 3O1JC 1HX7A 4B47A 1HA3A 2O5EA 4Y3UA 3KFXA 5ECDA 3V00A 1M2OB 1VI5A 2COUA 3HACA 3IP9A 4UARA 3K8QA 3V1MA 3T7CA 1NK4A 3DV2A 5EIBD 1KOJA 3EXIB 3DTTA 3ZLJA 1U5BB 5EQTA 1M8KA 3FVRA 1YHZA 1EBUA 3MERA 1JKIA 3D5TA 2F8KA 3GJQA 4OATA 3EC1A 1ORWA 2EWMA 1NMXA 3P2KA 4IPTA 4CQMD 4CTMA 1QIKA 1LW6E 3LLCA 2VUUA 2QVXX 4OHYA 3CWQA 2KHVA 4RTQA 1HE4A 5ED0A 1KI3A 2RGYA 3HZOA 1YRQA 1K9VF 2AFIA 4FYIA 1OI4A 1DAPA 4M1SA 1TO2E 5ITSA 4KR0A 3DMYA 4XVUA 4I1SA 1PZFA 2PIDA 4BHTA 5ECYA 2ZRGA 3CTPA 4F6LA 4HFMA 3ZWDA 4YR3A 4O4IA 3HYCA 3OQ6A 4OHKA 1OTHA 2J3HA 4RZIA 3JZFA 2B9VA 2O4CA 1TMYA 1T94A 2K4IA 1DJLA 1MPTA 2RI0A 1HNWB 5BW8A 4IDAA 1RFGE 3LDAA 4OP1A 1I2CA 3SFTA 3BSSA 5H5JA 4TT8A 2EP7A 4HWTA 3SENA 3WOHA 1L5YA 5LUBA 1O0SA 3LC0A 4ZC8A 3OHSX 4IZIA 1X0VA 2O2DA 4Q1DA 4F04A 1JAHA 4NX2A 5DN6D 3ISTA 5JFTA 3O8OB 3F4BA 1QSSA 1GUFA 3OO0A 1RABA 2YQ4A 2WSMA 4DPLA 3M6MD 4QARA 5E7MA 2I9KA 1BVYF 1WF6A 4GXIA 2D00A 4X1IA 2F1HA 1NU6A 3X2EA 5HF9A 3ZJ5A 3ZHSA 4M1OA 3BS7A 1U1CA 4H2DA 8OHMA 5LZ5A 4HEHA 4L02A 3DXYA 3ZLUA 4HRYA 1WMBA 4ZAYA 2QRHA 2KIVA 3BXXA 3KR0A 4UXHA 2WWVD 4BVKA 3WMGA 3PW5A 5DASA 4BUCA 2C9CA 3RF9A 1UBRS 3HXKA 3PFBA 4R81A 4EW2A 4QGSA 2RCYA 4DOAA 1WWUA 1E1RD 2HMVA 1Z63A 3L9XA 4RQTA 2CY0A 4I9NA 1OF1A 1QHGA 3AJDA 1VCHA 4NONA 4DVJA 3GP8A 1TGYA 1UAYA 4K9PA 3SXJA 5CTAA 4J9MA 4D3SA 4PCVA 3HABA 1Z2AA 3O9MA 2YV4A 3AQ4A 3S5UA 2XMZA 4X93A 5CG1A 1KJZA 3IDAA 3K6RA 5CIQA 4TLAA 1I9CA 3FFWA 4KSBA 2X3YA 2OZVA 5CCBA 2V8OA 2HQBA 3I3SR 4OHXA 4R2WA 3IQIX 4YI5A 2C00A 1QHNA 1NK7A 3AHEA 1TUGA 4UPVA 1SCKA 2FEAA 3OC6A 4CCHA 2Y9PB 2XJ4A 3QVMA 4MHVA 3THWA 4NBRA 3ADKA 2J6TA 2ACWA 5EE3A 2YWRA 4RLSA 1OH8A 1M2VB 1JBEA 3UIEA 2XZLA 4IMJB 1C0EA 4B87A 1B26A 1SN7A 4BKOA 1ZYQA 1J9ZA 5EMJA 4PN7A 3WGTA 5F1YA 1S3FA 2FLKA 2HK6A 5FUMA 1SAYA 2WJAA 2Q6IA 5FXMA 2PU7A 4IKPA 2ONCA 1VSTA 3BC1A 5F7XA 4MS4B 2PS0A 4J9PA 2ZIGA 4D0LB 4DFPA 1R8SA 3S2YA 3GFOA 4X63A 1M5TA 2ZTLA 2K6GA 1ACMA 5KYNA 5ITZB 3ZKWA 1BDHA 2AL7A 3FBGA 1QIIA 3COVA 5FTJA 2FMSA 1OZFA 2GOLA 5FFMA 4EFMA 4WL0A 1ONSA 2PKWA 2LDBA 2DUJA 2QX4A 4JCOA 5KAFU 1ZQCA 2GAFA 1BNOA 3VU3A 3K1JA 3QFTA 2A5YB 4LI0A 1QP4A 1ZUNA 2WMNB 4EPRA 4RNMA 1NQVA 3P0HA 3TFSA 3K71B 3UAWA 3OQHA 2DQNB 5FI3A 4U9IS 3R7WA 3B9QA 2JCYA 1ZCZA 3VX4A 2B6GA 4U8GA 5CDTA 4J0EA 2ZLBA 1LLDA 3ELDA 3ESYA 4L0MA 1D5WA 2DSNA 1L7XA 1JEJA 2DQKA 4XA8A 3ASVA 4JYAB 1Z4LA 5LMUB 1Q19A 2JHGA 2BM0A 5D86A 4R64A 3OFKA 2BCJQ 2JCVA 1QKIA 2Q5EA 3DWIA 2PT6A 4ACAA 3MXOA 1RPZA 5K0BA 1VLZA 4KR6A 3QNWA 4GKJB 1RKBA 2FOIA 3AU9A 4Q3LA 3NBQA 4HUTA 4F4JA 4DF4A 3EFHA 1Q0PA 3TAPA 1NRXA 3QLVC 1FSSA 3G88A 2A88A 5FNVA 1U2PA 1BPYA 2P2GA 1N2JA 3BHIA 5CDUA 3KQKA 1U7UA 1XNHA 2ZSAA 5EKTA 5BYBA 3PGKA 3HKZF 4IH1A 4IW3B 4D74A 2V65A 4PZZA 2K2QB 4B3XA 1CVRA 2PFPA 5K3EA 2YHUA 3IEIA 4DJAA 4CFZA 1Q0LA 1EFHA 1HNXB 1M8PA 4F8JA 3N7AA 2DPMA 3I4FA 4X7MA 3ILXA 1EE9A 1PGPA 2EBWA 1ZH2A 2ZOSA 2AFHE 2DPXA 3NT5A 2VUSA 3RK1A 5JQGA 3J81k 1EM6A 3DHEA 1DADA 2DY1A 3TLBA 5K8LA 2IW3A 1F8YA 1XZLA 4A5SA 5BUQA 2P90A 1RC1A 1KQGA 2PUDA 3T9CA 1QHEA 1MHPA 4HQ6A 4AP6A 3R7SA 4BNJA 1A50B 1K5GA 4N5MA 4JI1B 2QTHA 2CLOB 2QGNA 3GUHA 2QD1A 5K8TA 3MDAA 4DGQA 4DDVA 4B83A 4YQWA 2HBJA 1NQWA 3RR2A 3PPVA 3LGXA 3NAZA 4MGZR 5CW2A 5KNBA 1WQ3A 2XUQA 2BDTA 4BKRA 5JMWA 1D4AA 4AQYB 3Q7EA 3D2BA 1E1LA 3KQPA 4IUDS 3ME5A 4RVUA 2YZGA 2R60A 3A1VA 3H3XA 4H31A 3FYUB 2JW5A 3IODA 3FPEA 2AW3A 3ZD6A 5HHIA 3X1XA 1A82A 5DHUA 5KFFA 2CMFA 5D85A 1GQ2A 4KR2A 5CURA 2YWEA 2BP7A 2W6JA 1SHTX 1GV0A 3AF4A 3WZMA 3OQJA 1GZDA 4GFDA 1RQRA 5JFOA 4PLWA 2GJAA 4DR2B 5ED4A 4V0QA 3JYLA 2M6LA 5CAEA 2P4UA 2EZXA 3P9QA 1JMKC 3ONWA 2JCXA 3OCUA 2XCOA 4UBMA 4MVJM 4WN9A 3WKCA 4EB6A 1IBLB 4QDOA 2EKBA 3CCFA 1V4VA 3ZBPA 5BW6B 1ZQWA 5EXPA 4LOAA 1XNSA 1P31A 4DLYA 1R5OA 4BBPA 5I5GA 2JIBA 1GCIA 4MFAA 4ED8A 5GGXA 3S28A 3W8NA 5HRAA 5KSPA 5IDVA 2ZSJA 5KQMA 3U44B 2G4LA 4ZO9A 1O95D 4NBVA 3ZVRA 2XUOA 5KNDA 4EY8A 4ARUA 3GCWA 2ZTCA 3CZMA 1CQPA 1QPZA 1LF5A 4I6GA 4J1TA 4EYOA 2V4UA 1A7KA 4XEHA 1FUUA 3LG2A 3QNUA 3VYTB 5GGYA 1MP0A 4XGIA 3JQQA 2BQRA 4O02B 4MQ6A 4D4GA 4DRYA 3ND7A 3ND9A 3MYYA 1LLFA 4KGVA 1PT7A 3PXAA 5TMDA 4GM1A 3GJ5A 3JQGB 4XIYA 3HWX1 3MUOA 4DDKA 3TUIC 4HDNB 1Q91A 3RM3A 3ISBA 2A1TS 5ITVA 3BJYA 4MV6A 5EJ6A 5DBOA 3OU2A 1ED1A 2VRNA 5FUYA 2HA7A 3DB2A 2ZWMA 1D6SA 1YQTA 3V1NA 3QVJA 2JEOA 1YF3A 2XD4A 5DLEA 1QCKA 3UPTA 1QGED 4LK3A 3R8FA 3NTOA 3FHCB 1P3Y1 2R8PA 3K53A 5FULA 2QUZA 4QXMA 4DQIA 2VC2B 3WKBA 4R65A 5FA5A 3CZCA 4FMCB 1KAQA 5I9BA 2IY7A 2R8BA 4WBSA 5H80A 5I7AA 2LBOA 3VDNB 2BR5A 3VM6A 3Q5DA 5EP3A 2YQEA 3E2IA 1O2DA 5B4TA 1PR5A 4QBGB 3Q8LA 621PA 3TOSA 3OM0A 2O8EA 1IN1A 4LZPA 3QENA 4MPRA 1HT2E 3WKDA 4P86A 2JFWA 4RVCA 3A0HU 2J0EA 4WXHA 3F5DA 1VPLA 2BDPA 4E5VA 5C37A 3MBKA 2XDWA 4N7BA 1X7WA 4Q1BA 5TMBA 2GHIA 2CLHB 1RQGA 2FW1A 5E9QA 3I2IA 2C7RA 1O5IA 4P31A 2A1UA 2N1BA 3I58A 1PNTA 1PK8A 1AB6A 4LBYA 1J33A 3Q1KA 3SN6A 3A10A 1T8EA 3PWKA 1E2DA 3QXSA 4IOLA 1MJHA 5HM8A 4INAA 4FDUA 3UQYS 4JT2A 3P97A 3C3DA 2Y1FA 1ZR4A 3P45A 3VKUA 1OX6A 4ZQEA 3PR4A 1W35A 4OLBA 5KG6A 2B3DA 3WYFA 3IXMA 2G70A 2CMHA 3SG0A 1CUEA 2K4EA 1CRQA 4KQ2A 1KORA 3DAHA 1R6UA 3ESXA 2E4ZA 1YQQA 1EI9A 5LQNA 3C70A 3EWSA 1KDRA 5BOSB 1JKMA 4HTFB 1Z4IA 3PCXA 4NBUA 1B6TA 3F47A 2K7ZA 1VL2A 3MN1A 5LMZA 4W5JA 2JAOA 2KLHA 1D03A 1E5XA 5BSKA 3OECA 4KN5A 3ZK7A 5IZ4A 3JAKB 3WFZA 4F38A 1LBIA 3X2SA 2HDNB 4AS3A 1E6EA 3HP1A 2W2TA 4NE2A 2ZIVB 4DIEA 4CMIA 2F17A 4Q45A 2LCIA 4B17A 1HT0A 1DZIA 3GJTA 4YT8A 3H9CA 1N6OA 3AB8A 1XMPA 4LE0A 2ZB8A 1J0XO 4RKWA 4ZVSA 5C32A 1II8A 5KQLA 1MA0A 5CM8B 3KVNA 4BDPA 2WWGA 3EJ6A 3ER6A 5BORA 1IEQA 3H6GA 4BIIA 3NVKI 1UJCA 5BQXA 1P60A 2QTRA 2X40A 3T3GA 4DC0A 2R84A 1NZBA 3J81j 3AEXA 1PEDA 2AFHB 1KOLA 4NAUA 1W8IA 5H7XA 4OJTA 3QA9A 4RK0A 4PX5A 1AS2A 1I33A 3V1YA 3C48A 3O82A 7MDHA 3M3PA 4QWMA 3T7AA 3KQTA 1XEAA 2E1EA 1A5BB 1DBRA 4GYKA 2Y6UA 2KX7A 5IZCC 3EPKA 3O0FA 2MMGA 4A0RA 3RRBA 5A5VA 3FMOB 4U2FA 1ZRMA 4DLEA 1JLHA 4A8HA 2YWXA 3A0UA 1PW7A 2KSOB 3R9KA 1MO2A 3U7HB 2BBSA 3K75D 1UMCA 2Y92A 3OT5A 3TF5A 2WV7A 1FFHA 1QFZA 2Z4TA 3PLRA 1SM4A 2AMFA 3IVGA 5LZ4A 2AOXA 5J2UB 3F6CA 4MMYB 4LGYA 4EB8A 2W6ZA 4R8MA 5CPFA 5IDQA 5E3HA 3QMVA 3F6SA 3IDZA 2FG6C 4MP8A 1PZMA 3RJTA 2B6NA 4UMVA 4C2BA 3U5ZB 4F7DA 5ILGA 3P2YA 3A04A 4OI0A 4TXJA 1AO3A 1U90A 3I04A 3KLBA 2FWNA 2RGUA 3D2AA 5EOZA 4AY2A 1VP3A 2BPOA