4C4SA

Structure of beta-phosphoglucomutase in complex with an alpha- fluorophosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
215
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 76
structure length 215
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4sA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4sA01
3WKBA 3E84A 5ALHA 3SF0A 3M9LA 2CFRA 2EAUA 1Z4LA 4IFTA 4HYTA 5AW3A 1Z88A 5AKEA 3R4CA 3ZU6A 3I76A 1Z4IA 5ALPA 3WGVA 2MU2A 4Y3UA 4BKMA 3ESQA 1Z4OA 2C8LA 5AESA 3OCWA 4UASA 3SMVA 2HDOA 3KOOA 3ESRA 5AK4A 5AVXA 1JUDA 4H1WA 2G07A 3QGMA 2Q4TA 3KC2A 2RB5A 3ZVMA 4F72A 5AVUA 2WHEA 3UMCA 3NUQA 3U7HB 1QH9A 3A3YA 1S8OA 4G9BA 1Z4PX 2OM6A 2CN1A 2I54A 4Y2PA 1EK1A 4ZEXA 3QUQA 4BBJA 4UM5A 2FUCA 1TJ5A 4UW9A 5AM3A 4AS2A 4XQ0A 3FPBA 3QU2A 3QXGA 4KNWA 5IS2A 2FDRA 4BX0A 4RESA 4YCMA 3BWVA 3W5BA 3IB6A 3WKDA 2YY6A 3NALA 2P11A 4BNDA 4L6AA 4Y2YA 1L6RA 3OCVA 4BEWA 2B1QA 4NFLA 5ALFA 1YMQA 4G63A 5ALSA 5AI9A 3B8EA 1ZJJA 3VAYA 2Q5EA 3SKYA 4YIKA 2YN4A 3QU5A 5AKLA 3R09A 3U19A 1LTQA 1WVIA 1QYIA 2EARA 3MPOA 4ZEVA 3WKCA 3ET5A 4I9GA 2ZOSA 2VKQA 5ALGA 3EPRA 2GHTA 2BY4A 3L1UA 2G1AA 3PCTA 1TE2A 3L0BA 1QQ5A 3QNMA 1AQ6A 3L8GA 3W5AA 1TA0A 4HGPA 1WPGA 3N07A 1XP5A 4O8CA 3NRJA 3RF6A 3MC1A 2FEAA 2NO5A 2AH5A 5ALMA 3S6JA 1XVIA 2CFTA 4UARA 4CF5A 2R8EA 2HEGA 2YJ3A 4UM7A 2WF6A 5ALRA 3SHQA 4JB3A 2OBBA 1SU4A 3SD7A 2ZBDA 3AR9A 3EF0A 2B8EA 3WKAA 3NIWA 5ALNA 3ET4A 3DDHA 4NABA 4CE6A 3ONNA 1Z4KA 4C4RA 4EX6A 4KYTA 4YCLA 5AVZA 3I6BA 3ZTWA 2WF8A 2HO4A 1L8OA 3QU9A 5AHXA 4UU0A 4IG4A 3N8GA 5ALXA 2FPRA 1YDFA 3KD3A 3PDWA 2NO4A 4UMEA 5AVSA 5AKHA 4AS3A 2WF5A 3HYCA 1K1EA 1ZRNA 1Z4NA 3ZVNA 4BYGA 1S2OA 3L8EA 3KBBA 4FFDA 3QUTA 4KNVA 1L7PA 1RLOA 2GFHA 2HHLA 1RKQA 3P96A 2RBKA 4XE5A 5E0OA 1RQLA 2GO7A 2WM8A 1N9KA 2OYCA 1Z5GA 1RC8A 3WK5A 3M1YA 4HAIA 1WZCA 3BA6A 3NANA 1T5SA 3SKXA 5AKKA 2PR7A 3AR7A 3WK6A 2B8JA 3WGUA 1N8NA 3ZTYA 3PGLA 1Y8AA 2WF7A 5AK5A 1RRCA 3ZWKA 2FUEA 4Y2QA 2ZG6A 5AK3A 2G0AA 2IOHA 4DWOA 2ZBGA 4YCNA 5AM0A 2MU1A 3EF1A 5A3QA 1U7PA 2GMWA 2FPUA 1U7OA 3ZWDA 1LVHA 4HGRA 5AW2A 5T41A 5AI5A 4UU1A 1O03A 3OCZA 3DNPA 4MWOA 5AIBA 2FI1A 1VJ5A 1NF2A 1RLTA 1RPZA 3FPSA 3ZI4A 5ALEA 5AW9A 5AW8A 2B30A 2C9MA 4NAVA 1F5SA 4AP9A 3WK9A 4UAVA 3AR3A 5AK6A 4CNQA 1Z5UA 2HSZA 1U02A 2RAVA 1ZOLA 1O08A 2AMYA 5ALVA 1T5TA 4DW8A 5AVWA 1L7OA 1EK2A 5AIAA 1ZD4A 5ALKA 3WK7A 3FM9A 4YIHA 3FVVA 3ZVLA 3WK8A 3UMBA 5AKGA 4J03A 1TJ3A 4HGQA 1RMYA 5ALIA 3W5CA 1NNLA 1VJRA 1RMTA 4QQFA 1CQZA 1U2TA 3AR6A 2WFAA 4I9FA 3OPXA 1RKVA 1QQ7A 4NWIA 4OFZA 3E81A 1Z4JA 2I33A 3OTQA 2W4MA 2G80A 5ALDA 2OA0A 3WKEA 5ALLA 2YJ6A 3DAOA 3QLEA 4B6JA 3QUCA 2PQ0A 5AI4A 4UMVA 4PNHA 3U26A 3KZXA 3OCXA 3IRUA 1YNSA 1ZRMA 3GYGA 5AW0A 4BEVA 4UMFA 4J2TA 5IT4A 5AICA 4ZEWA 2PKEA 5AW5A 5AVQA 3ZUPA 5A3RA 3ED5A 4L6CA 3QYPA 2B0CA 1PW5A 3D6JA 3KDPA 3QX7A 1RQNA 3L7YA 3L8FA 2YMPA 1Q92A 2I34A 2HF7A 5AW4A 3QUBA 2MSNA 1VFPA 5AVTA 2JGAA 4FE3A 5ALOA 5AVYA 2ZBFA 4EELA 3CNHA 3AR5A 1RKUA 5AKZA 4UMDA 4OD0A 2JAUA 5AKJA 2YJ5A 5ALTA 2YMQA 5AKIA 2RARA 1CR6A 2O9JA 2FPXA 2BDEA 4Y2VA 1IWOA 4OCZA 1XPJA 5AKXA 4YGYA 3AR4A 3OCUA 2CFSA 1RLMA 3L0CA 3N5KA 2P69A 3U7EB 2G09A 2IOFK 4YH1A 4QJBA 1SWVA 4Y2SA 4GIBA 2G06A 4EEKA 2R8XA 3UMGA 2BDUA 1SWWA 2C4NA 2C8KA 2ZXEA 4MUMA 3R9KA 3TLMA 1YS9A 2R8YA 3L8HA 2WF9A 3B9BA 4Y2JA 3J7TA 3U7GA 4KX5A 3I28A 3OCYA 2B1RA 2W43A 3QU4A 4L57A 3W5DA 2C88A 2I55A 3L0YA 2YMMA 5ALYA 4DCCA 3FZQA 3IJ5A 2G08A 4BX2A 1ZD2P 3E58A 2X4DA 5A3SA 1U2SA 2AGVA 2I6XA 3L1VA 1L8LA 3HLTA 5ALZA 5IT0A 2HX1A 3U7FB 1X42A 4KX3A 5AM4A 3ZW7A 4XPZA 5ALJA 3N1UA 5AM1A 4CF3A 4OHFA 2D2VA 3PGVA 4DFDA 2HI0A 2ODAA 4Y2XA 4F71A 2GHQA 3U13A 2FPSA 1J97A 3K1ZA 4HGNA 4C4TA 2P27A 2B82A 3A1EA 3ZX5A 1ZD5A 1Z4QA 2YJ4A 1Q91A 4CF4A 2Q4RA 5AW6A 5AM5A 3EWIA 2R8ZA 1TJ4A 3F9RA 3NASA 5AVRA 1MH9A 2HCFA 2HF2A 5ALWA 2YBDA 2JAWA 5AI8A 2YMLA 3B9RA 2FPWA 3MMZA 3A1DA 4Y2RA 4KN8A 4EZEA 3WK4A 3CZ4A 4UAUA 2JAOA 4HGOA 1T9ZA 1RMQA 4RETA 1RDFA 3NAMA 4FYPA 5ALUA 4UATA 5ALQA 1ZS9A 1J8DA 4Y2TA 3ZX4A 3A1CA 3N28A 4E88A 2IYEA 5AVVA 4Y2UA 4GXTA 2QLTA 1ZD3A 5AI0A 2W11A 4JDPA 1L7MA 4BNDB 3MN1A 5JJBA 2HOQA 2QYHA 2DQSA 2NYVA 5AI6A 3SLRA 3RFUA 1WR8A 1KYTA 3E8MA 1FEZA 2O2XA 1YV9A 2AUTA 1YJ5A 2JARA 2IA5A 3UM9A 2IOFA 4EENA 3L5KA 5AM2A 4NV0A 2EATA 5FP0A 1Z4MA 5AKYA 1L7NA 1NRWA 2YFYA 2P9JA 4XOUA 4BX3A 3DV9A 3AR2A 5AW7A 3FGOA 1QQ6A 3I1YA 5AW1A 2I7DA 3QU7A 4EX7A 4C4SA 3AR8A 2ZBEA
chains in the Genus database with same CATH superfamily
1JMVA 4TT3A 5ALHA 4L07A 5KFBA 4RSMA 3R77A 3IBYA 1GN9A 1UQTA 3WYFA 3JPTA 3EAQA 3KQVA 4CUZA 1I01A 2ZBPA 4HWSA 3PXAA 5IAAA 4LNHA 2HW3A 4IFTA 1WDLA 3UWOA 2IELA 2RGDA 1Z36A 2NG1A 3D6UA 1JX6A 3IP9A 4DCSA 4EI2A 3JQ6A 3NDJA 1CNEA 4YRJA 1I1OA 3CHYA 3PHHA 2ISOA 3BXEA 4IIJF 2PH1A 1BE8A 1C3OB 1JLLA 1U4NA 2WFLB 3OZFA 4UTZA 2AQHA 5FD8A 5U9CA 3H9GA 5ERYA 3EIHA 4KXXA 2PD4A 4H7EA 2OKCA 4DMKA 2QTNA 4GZ6A 1YVDA 3D4OA 1R6BX 3CFYA 4XW2A 4YPFA 3M3DA 2O5EA 3ZLTA 4RVSA 3F2CA 4C5CA 3N2ZB 4ZAZA 3RJ5A 1FPMA 1T1IA 4E14A 5B1YA 1YL5A 3OQJA 4TMTA 1ANKA 1ZEMA 4KUEA 4S2UA 3PUZA 4NU0A 2XMCA 4BNVA 4RJ2A 2PGIA 1XD8A 1AO0A 1C7RA 3B7WA 3F6BX 2WHEA 3RO7A 3T41A 1RYBA 2O4CA 2P9HA 3EDOA 1W0CA 5DEIA 5IC6A 3W8NA 2ZBRA 4YMNA 3A7DA 1IE3A 3TW6A 1QH9A 3LYUA 4BNUA 3GNQA 2Y0BA 3TWOA 2X6TA 3E2EA 4IUYA 5DHQA 5B37A 3ICXA 1G8GA 2CB9A 2HJVA 3FUUA 5DYIA 4FKMA 3IHTA 4INOA 1QGDA 2QY6A 1KVQA 3MOGA 4D8XA 1WSBA 1QC5B 3AU2A 2XDAA 1E2EA 3AONB 3E7FA 4HH4A 3V4RA 3A4NA 4DSUA 3L8YA 4HQRA 3HM2A 2IPOA 1TJ5A 1WEHA 4PNZA 5K1ZA 3OKAA 1N6KA 1A5SB 2DPJA 4ECWA 4RXUA 1QSSA 4U2FA 2QZ9A 4DEXA 1AQJA 2B61A 3THWB 4E30A 2HXGA 3KUXA 3LLMA 2OBYA 4QRDA 3RVNA 1W1WA 2E5WA 8ICTA 5DASA 3PCRB 1RLUA 4E12A 1I1QB 5KG6A 1JKMA 3KR1A 4IKOA 4NU8X 1V2HE 4GVXA 2VXOA 5D5HA 2QX8A 5DNWA 2PRZA 3D3WB 2ZZNA 1WDKA 1CUUA 5BOSA 1OBCA 4DT1B 3VHQA 3ZY4A 4H1TA 4D44A 4EF5A 3JPPA 3VAYA 4LHXA 1OB2A 4FCVA 1PQ4A 5FFFA 3C1YA 1L5UA 4DUZB 2OHXA 3ZKAA 4TYMA 4B3BA 2EARA 2COEA 1I36A 1YS2X 3DBLB 1W0KD 3NIFB 1IHYA 4DMRA 1FQKA 3W8EA 1WMSA 1RYRA 4FIZA 2FR8A 3R23A 1V3TA 4JWKA 1Z37A 2HBLA 2DJ5A 4NYMR 5IZ4A 3L1UA 2WU0A 2E85A 3IVAA 4JI3B 5KHLB 1QQ5A 1C1XB 1SXPA 5AUPB 4AKIA 2FOLA 1GNTA 4M9RA 4B81A 2E6KA 5HZHA 2HA7A 1MOPA 1OYYA 4E5KA 3NUZA 4FMCB 4R1LA 1OXXK 3COVA 1SBQA 2VCYA 4JYPA 5JCJA 5JZBA 3AN1A 1A5ZA 1JIIA 3SJ7A 3X43A 1KOGA 1EFVB 2RAUA 3OHSX 4NXMB 2L18A 4A8HA 1PVPA 5JNRA 1QO0D 1QVRA 2O3SA 2QMEA 3BZUA 3EXIA 3QXJA 4EYEA 1KYVA 3NGDA 4DQPA 3CPSA 2AOXA 4OQPA 3ZV3A 1CDOA 4G24A 3K4GA 2A4KA 3GQBA 4US8A 1O54A 2KJ9A 1OGIA 2HQRA 1KR5A 2QSUA 5T4FA 1E7QA 3VNSA 1KF0A 4KN7A 3GVIA 3PSHA 3MR3A 3SJCA 4U2BA 2E18A 3RYTC 1DX9A 1TCUA 3UWDA 1LWOA 1KQPA 4AU1A 2H16A 4ZN6A 2O1EA 1RAGA 3QBEA 4QZHA 1Q21A 4CKXA 2AMLA 4RJJA 4CU2A 1RCFA 3O0FA 1GAQA 2D0OB 3AJ8A 4P33A 2DR3A 3A1TA 2OGWA 3GT4A 4RYDA 5AJTA 3RAPR 4B8WA 1XSEA 5E6SA 2AJTA 1GAXA 4Q7MB 2K5UA 3L0IB 4PQRA 1E1RD 3HP1A 1N48A 2E49A 3ABZA 5EAIA 4RCVA 2BMJA 1KQ3A 2YASA 4X44A 5A2GA 1R37A 1VXRA 5LP6F 1H1DA 4IJMA 1DUIA 1OC2A 2NO4A 1XVUA 4TKVB 4Z51A 3I0NA 2CV0A 2WJIA 4ENUA 3BFPA 3JQEA 3H4DA 2HHHB 5EP3A 4FUQA 1PT5A 4EATA 1NJ6A 3UMMA 2RC5A 1NN3A 1EG2A 3K72B 4M1EA 3OOJA 1V71A 4CQLA 1G2OA 3GIMA 1I4TD 4BXOA 1IBCA 5HVNA 4IIHA 3IL2A 5G0WA 3RU3A 4BMYA 4X6LA 5HS4A 5IKOA 1FNDA 1G55A 1XQ1A 1DIGA 2Q2VA 4MRMA 4P38A 5KCZA 5D46A 3QLJA 3PWSA 4Y8VA 3E7WA 5INTA 3D8SA 3WLHA 8ICGA 1VMDA 4FHGA 5GV7A 5E1BA 3G0IA 2ETXA 2R7NA 3PRJA 3TLKA 4JL8A 2CUKA 3A2LA 4D8YA 1Q44A 1QHHB 2DFDA 2GWRA 4YHHB 4C4XA 3A4MA 3IE2A 5B30A 1NC1A 4EQ6A 3EGIA 1JSLA 4DG5A 5E2IA 4AUMA 2QR5A 3IDOA 4BFVA 5LZ4A 3RRBA 2VTDA 4FJ1A 4INPA 4D6PA 2WQZA 3KQPA 3IP5A 1HUQA 1LA2A 2CHQA 3LUDA 3PEUA 1GL7A 1RHKA 3ZV5A 5E6UA 1K7CA 3MW8A 2M0NA 3S2UA 2FUEA 3T4PA 4E7PA 1SPBS 2G0AA 2EZYA 1VMAA 4DNOA 3RFFA 4ZYWA 1XS9D 3K15A 4I5FA 1J5XA 2E4XA 5A3QA 5DI3B 2VPIA 1ECBA 2VPZA 3C7TA 1RE0A 2ZANA 2X0FA 1PJ4A 1R50A 1TVCA 2LNDA 1H2RS 4GZLA 5AI5A 1YVRA 3A3PA 3E03A 3OZIA 3DVLA 1K66A 3GB9A 3TTXA 1YB6A 4GPBA 4W1PA 1DFIA 3PJRA 3E7PA 5FUYA 1KI9A 3F9CA 2ZTDA 3H5OA 3RRNA 1B14A 1ONOA 2HYDA 1OKKD 5J2AA 3Q6MA 5MHTA 5K3BA 4I0WB 1YAJA 4F96A 4LSMA 1CP3A 2YV4A 5DLEA 4RZRA 2Z1DA 2R1ZA 4DQUA 2Q1YA 2J3DA 2FW7A 4MF8A 2P9ZA 4X9XA 4Q7JB 3QFFA 4EJ6A 5KTYA 4FQ5A 4GM4A 1GGKA 5JW6A 3ZXUB 2HT1A 1ZOLA 1U9YA 2VDMB 4DSAA 5E6RB 2Q2OA 2R4QA 2HDHA 5JJ5A 2OEPA 1BGVA 3IAS6 2PZJA 1L7XA 4EAQA 1L3UA 5T7BA 1Q74A 1S2GA 5D85A 3VO1A 1N5JA 7ICRA 4LTDA 1U7DA 3PVXA 4GHWA 1T35A 2O6LA 1Z6XA 1A9QA 3AF4A 4A10A 4KKVA 3FVVA 3UJCA 4WDQA 2D1QA 1MA0A 3QEOA 4D42A 3EX7C 1XTSA 1PK1B 3PC2A 4ZT5A 4CQMB 1YC5A 4XGIA 1SL0A 3H5RA 4M3NA 2HWUA 2FUG6 3LE8A 2Q7DA 2O2EA 4QG3A 2FVXA 1WUJS 2OWOA 1JSZA 2D5AA 3CGWA 3CB4A 3OPXA 1ODSA 1C4WA 1NW3A 2G8NA 1EP3B 2DT8A 1EE2A 3HUEA 3M5CA 3MYRA 3OX1A 2IKSA 4OFZA 3OTQA 5DMHA 2O3UA 4KQIA 3FDJA 5LQSA 2G80A 4DLKA 2XX3A 3P8ZA 4QAJA 3WQHA 2QYTA 3BBPA 5EIBC 5G41A 1YXMA 3H9BA 1AKYA 1T3NA 4QJ4A 4CM1A 3R7WA 3IQWA 1E3QA 4M89A 3BS4A 4P7GA 3VC8A 3D1VA 4XWKA 4KLMA 3CISA 1JXQA 4OHUA 4YUVA 1A82A 1BPZA 2LIVA 4MW9A 5CR9A 5T4BA 3BRQA 4BAZA 3GZNB 1WMBA 3LCCA 1TZMA 4LQCA 3I6ZA 3S2ZA 4DXDA 3CRXA 3EC1A 2ZI3A 3WWCA 4A8TA 4L2IB 5JDCC 2F9LA 5DHAA 3ASZA 4YYZA 4B74A 1T91A 2D74A 3DFFA 4LDQA 5F4BA 8ICKA 1E9CA 2FSFA 4OA8A 4UB3A 4BAUA 4PN7A 1KI1A 2R11A 2ZJBA 4OXIA 1ZISA 4ER0A 1ETHA 3WQRA 1U2GA 2NZUG 1GUYA 3AY6A 2WJ6A 3SZGA 3DBVO 4GOND 4OATA 1PJZA 3D7SA 4JU9A 5I7EA 3NHMA 1GFZA 3AP3A 4DDTA 1S1CA 3CINA 3EXFB 1ZLXA 4PWZA 5LB2A 1FLDA 1PQYA 3DM5A 1R5BA 1ISPA 5AR1A 3D4PA 2YN0A 4MW0A 3W5IA 4H9GA 3EF3A 4MUXA 1NBMD 2VDNB 3I58A 3SIWA 5KMGA 1FRFS 1JQJC 1EDZA 2VQEB 5LFAA 1GUAA 2JH3A 4XQCA 2Y1JA 4P4SB 4ZO6A 4FFVA 5AVYA 1NJWA 3H8JA 2ZBFA 4O4LB 3ZI0A 3QWHA 2GEDA 4P84A 4U02A 4BWYA 2WAXA 1JHOA 1YRBA 2KMLA 4G9EA 1XG5A 4PRLA 2W0SA 1FXUA 1VHDA 4RT2A 3E70C 1PTKA 3P2JA 3QFHA 4UBOA 4YA6A 5EIOA 3RU7A 2JJMA 5L3QB 4EZ9A 1MMFB 4J9OA 4DQXA 5HKKA 3RQSA 4Q7QA 5IYZA 1B8NA 5FKJA 2ZAOA 1C4KA 5DHPA 5K4HA 3FMOB 1I32A 1RI2A 1IHPA 2VAMA 1CNFA 3GJ4A 1H4SA 3FLAA 5JEEA 1N6OA 4TYYA 2AK3A 4YMTA 2O59A 1SULA 4L08A 4MVJG 3D0RA 4JI2B 1KN5A 2A1JA 1DV1A 1PWHA 3BE8A 2W55A 3P4XA 1KO4A 2WI8A 3CUEF 4MOWA 5AJWA 1Y6JA 2PGLA 4TT8A 5EMLA 2ZXIA 3LBFA 3ZHXA 4Y2SA 2PM8A 2PSDA 2VF7A 1Y3DE 1Z6GA 4RK1A 1V2GA 5J63A 2QRGA 4V38A 5U4XA 4AT1A 1V39A 2ZXEA 2BOVA 5IZCA 3BRWD 4XJSA 4ED8A 1SCUA 3KKNA 4WNYA 4A92A 2ZJOA 1VGRA 1R8SA 4HN4B 4I2EA 2EWMA 3F5AA 1LQ2A 1MEJA 1NKEA 2HV8A 2VVTA 3EGDA 3KTOA 3QOYA 4HXYA 4RS4A 1U0OC 3GNSA 3NOVA 4K9RA 5I9TA 3S99A 2G70A 1NTOA 1DXSA 2IYRA 2IL1A 4C8NA 5D3QA 4PPYA 3FTQA 3ZD6A 1SQSA 2YXPX 1HC7A 3QENA 3FWNA 4WJLA 2NTVA 4RNOA 2HRZA 1U3FA 1QAMA 1PBNA 2EKQA 3L1VA 1CZHA 1X2IA 3CPHA 1QOZA 2ZW9A 1ARZA 5IANA 2OCKA 2Y0CA 3GG2A 4CIXA 3VO8A 4CHTA 4CKZA 5A62A 1ZI9A 2V5UA 3SQOA 1DCFA 1XE3A 2JAPA 3WL7A 3B6EA 1P1IA 2PMCA 4IH9A 4KPEC 2OESA 2JNWA 2B4AA 1MQ8B 3P9ZA 1KL9A 3HA2A 1GXSA 4XYLA 1DAFA 2C1ZA 2FMKA 1ZQQA 2HI0A 4GP7A 1LVGA 9ICTA 4Z6DA 3IXMA 4OU4A 4LISA 2FPSA 1XJ5A 4BFWA 1RWNA 3BFKA 3GJ0A 1JTVA 3K35A 3VC7A 4RFLA 2ZXUA 4UCQA 2OOSA 2AN9A 4YROA 3T5HA 1Z4QA 5A3VA 2BMEA 3M5WA 1IZ7A 5D84A 4L8WB 3MWEB 1L1EA 2NAPA 3T3NA 2GAAA 2IQ5A 1T5LA 4ELTA 3F9RA 3PXBA 4MR9B 5CT8A 4K9DA 4KGXA 4R4JA 4FSXA 4R2LA 1VDZA 5IUNC 4QWMA 1ZGAA 1L3SA 3RHSA 5C4IA 3AHIA 8ICZA 4XQ9A 3D2NA 4QVKA 4X64B 4ARIA 5TSDA 2FPWA 1AO3A 1GCUA 5CXSA 3NIGB 4BCBA 3QBDA 3DEHA 1X13A 4MVJI 2BBOA 4IQ0A 2NV0A 1O0CA 4JJFA 5BO5A 1KXZA 3GROA 3OX3A 3WGJA 4OU5A 4NEQA 2JD1A 4RPJA 1JI3A 1KK0A 1TQ8A 2Q2WA 2V03A 5TS2A 2NU8A 3RUHA 5L40A 5L4LA 4QQKA 5CVUA 1ZX1A 1GXSB 3QIVA 1OTYA 1MIOB 4O0LA 2DLDA 2HXYA 2X40A 3ZX4A 1W94A 3EMDA 3BG5A 1DAGA 1K5DA 1BO6A 2DOKA 1FF9A 1TJNA 2AZ4A 2EKDA 2AQKA 2JCSA 3JWPA 4Q9AA 1X7YB 3B2EA 4M1TA 4E88A 5IKEA 3U44B 4LRYA 2CDBA 1UXHA 4BFCA 3BK2A 1JU4A 4LZWA 2A1JB 2VF4X 4EZBA 5DLFA 4XEHA 4BNDB 3JYPA 3OJEA 3RODA 1GPMA 2NYVA 3MS4A 1Y7TA 3LOUA 1NG9A 3A6ZA 3P27A 4LCBA 3AFIA 2ZTUA 1XDSA 3KPWA 3WMWA 7ICHA 5HUQA 3U3OA 4WGGA 2PQ6A 4UB4A 1T1SA 3A1UA 2VHTA 2B4YA 5B6PA 3EIUA 5CLQA 2X3YA 1D2CA 1GPWB 3PR5B 1Z8NA 3F4KA 1XKLA 3G2LA 4FE4A 4UEJA 4IGAA 4CM7A 4G37A 4O59O 2C29D 2PYDA 1E60A 4IHAA 1AKVA 3ONEA 3I0ZA 3A6EA 1IWBB 3NPMA 3RVBA 4DDUA 3C3BA 1RPTA 3UVEA 4YMGA 3OQMA 5C1IA 2VUUA 3I6IA 3R0XA 2XSZD 6ADHA 3OT1B 4N9QA 4XLZA 1NQ5A 1R0SA 5LLDA 3W6OA 2ZK7A 2I7DA 3H8WA 1IZ0A 1H8HD 1J99A 3PC3A 4MO2A 1NWCA 2O05A 3D8UA 5IF9A 2M1XA 3EDQA 1C9DB 4EFMA 3LFHA 1H4VB 2PGOA 1R5OA 1TYEB 4M0KA 2L42A 2WTEA 3CTMA 4KXNA 4DIEA 1QB8A 4GLFA 4CL8A 3EEQA 3LHKA 1W29A 4GI7A 1POXA 5JMOA 1WY7A 2NTEA 2FPGB 3GN2A 3HNRA 4L8LA 4QTTB 2B25A 4X0EA 2EHJA 2HHUA 5JSKA 1ED1A 1KEVA 4I2DA 3E2IA 3Q3CA 2RGUA 4MIEA 4PHFA 4D8VA 2PMFA 4JGGA 2YRXA 2WJ4A 4B3IA 4MW5A 3U6KA 5T6BA 2PO5A 4I81A 2OAP1 2AZTA 2PZBA 2WB1F 1L4YA 4FONA 3KALA 4PYMA 1P0QA 3HWTA 1MHTA 1KZ1A 1YCDA 3QG1A 4R8UA 2FE4A 4CWAA 4PFSA 2BYTA 1B6RA 1NX9A 2HPAA 16PKA 1GGHA 2WM3A 2ZIAA 2Z08A 1KO8A 8ICCA 2AG5A 2PT6A 2H4FA 4BUJA 5JS6A 1M34E 1JX4A 2ZJ3A 4YJ3B 3EWAA 5CWRA 4DQSA 3MRVA 3T54A 2PL9A 4CETA 5JJCA 3HPQA 1T6XA 5JDIA 1B6SA 1Y7IA 4P5DA 2D5IA 4Q82A 3DF7A 3N0TA 5AOBA 1VLHA 4B7AA 3AIKA 3EVEA 5DO9A 1QV9A 5AJUA 3T1VA 1SK9A 5G0UA 2Q4DA 1MORA 3PPIA 2JJYA 4LF4B 5IP5A 2VUSA 2AXQA 3GUVA 4E5VA 2B8NA 3UJDA 2CN1A 1KKXA 2I99A 1R6VA 4RX1A 3DJFA 4N1AA 4MUGA 1S5PA 1N57A 3GEDA 4RQ4A 4MUIA 3MHTA 2YY7A 3V7WA 2RHGB 4UM5A 1XZJA 1W44A 5ESXA 5IN5A 3KEQA 4KTVE 3KT3A 4EO7A 1PJ3A 2IZ6A 3AG6A 5JAOA 1G8JA 4J7UA 3RF9A 5TGZA 1P74A 1QKKA 4HKTA 3PSAA 3RYHB 3TRFA 3TW0A 3T3EA 4BMZA 2NO7A 3E9QA 5GTDA 3C41J 1N56A 3IB6A 1RPLA 2YY6A 5ITWA 1A4XA 4ZCIA 1PKXA 1SL1A 3JQQA 1CF2O 4C1BA 3S81A 2A9VA 1DC4A 1LDGA 1LPNA 1NN1A 1DIOB 3L05A 4OHZA 4MIYA 4S1TA 3VH1A 1O97D 1M1UA 1PS9A 1R4NB 2QD2A 4NLNA 3IT3A 3R41A 1L0BA 4GKAA 4OHWA 4WAUA 1UBSB 1RWKA 1XSPA 1JVNA 1K8RA 2B99A 2Z4RA 3AI1A 3HJTA 4PO1A 5HMLA 4AQDA 3MLEA 4DDHA 3A4VA 3C3PA 1I0ZA 2OO7A 1COOA 3CLRC 1QXSA 2QTVB 4M7PA 3GF4A 3TQ1A 3WGHA 3IJRA 1B8UA 3WKCA 1OI4A 2C4UA 3HVRA 3JAWA 3FJOA 4EI8A 2Q6TA 3WP1B 4R8RA 2MOKA 3PC8C 3PCTA 5FOXA 4R8MA 1G7CA 4JR1A 3EQ7A 1ZVVA 2C5LA 3FETA 2ILTA 3NHPA 1XO1A 5F3XB 1GPAA 4UAZA 4WEQA 5AK0A 2EX4A 3W79A 5HIJA 3WO1A 1KQFA 1ECWA 1STOA 2Z43A 2VBCA 1XP5A 3FBTA 3GMIA 3LPMA 4QGAA 3PQ7A 5EQJB 3VYTB 4CT0A 4D9FA 3ZK8A 4CV2A 1V11A 4B6PA 4DA0A 2WNHA 4R3UC 3VYSB 3CN9A 4B44A 4DIOA 2O2GA 1JZSA 1JR4A 1KNXA 2V6MA 1FUIA 2YTZA 3L6BA 2F2AB 3QX9A 3W2GA 5KTNA 4EIWA 2ADMA 2HCBA 2O5CA 1ZPDA 2AI3A 2C5AA 4UE2A 4EQ6B 3I39X 4KGDA 5IJ9A 4LCJA 3DMHA 4J76A 5D7BA 1QSGA 3C8ZA 1Y8CA 2G1KA 3KBOA 1E7WA 2OR3A 4HDMB 4Y0AA 1DTWA 1ECLA 1SU4A 2ZBDA 3D8NA 5CFPA 1J4AA 3AR9A 3VGJA 2H7CA 4LWZA 1OZHA 2FU5C 4QATA 3WKAA 3NIWA 4YMIA 3RU9A 4CT4B 721PA 3DBOB 5H3HA 4JV2A 2XPCA 1XWLA 4FYYA 5AXDA 3AL3A 4BJHB 4BQIA 1Z4KA 2C28A 1D7AA 2KD1A 4US9A 5AVZA 1C7ZA 4YMUA 4U3JB 4F4IA 3RJHA 5J0TA 5K3CA 1XTBA 1CY1A 4RE6A 1L8OA 3R7WB 5J2TB 2A4MA 2KVSA 1Z07A 4UQLA 2Q9BA 2K4MA 1NLYA 3MQ4A 1DLIA 3F6EX 3DO6A 3SQXA 1NYQA 2QTFA 5LSAA 3CVUA 5DQHA 1JRLA 1YFKA 4GOMD 4NFSA 2NQ2C 1EUCA 4ND7A 1G8SA 4RJLA 4ZU3A 4Q3NA 5I9IA 1AKRA 1AK9A 1LPPA 4FDMA 4KQMA 5BWNA 3RSLA 2EKZA 1P4GA 3HCAA 1S7GA 1ZQTA 2QUAA 3IOMA 3LYAA 2Y68A 2OVBA 2Q6OA 4U6NA 3MR6A 1DJQA 2LWIA 1J0AA 3E48A 3ILYA 2K8BB 3K92A 4AZVA 4UNIA 4FCTA 4XE5A 3PITA 4ECAA 3CLSD 5CLLA 3NOQA 4MEJA 1ODJA 1PCXA 3DD1A 1O8CA 4E5DA 3T4XA 2O6KA 1OBOA 2WM8A 1QCZA 4IDOA 4RHXA 4L72A 3U7QA 4AZWA 3GLTA 2W7PA 4EPVA 2ATEA 3M1YA 3FWZA 3N8DA 3BA6A 4FGWA 4HB2A 2UVRA 1GARA 2ZIFA 2X7XA 3JATB 1E9SA 3LO8A 3PGA1 3KSDO 3T9DA 1YZQA 4J9MA 1DMSA 4QYIB 2K89A 2IC5A 2FR1A 1A7JA 3VHXB 1E1NA 3B85A 1RAAA 3D2LA 1JA9A 1QWSA 1WEKA 2OKGA 4FPXA 4IW3B 3ZGXA 2NAFA 4OJTA 5LUBA 4RLSA 4B87A 5BQ3A 7ICOA 4HGYA 2JIZA 4QIWF 5BW6B 1A8UA 1WOMA 3LF2A 1AN9A 3CNLA 5I9SA 4DGQA 3P2EA 3PUJA 4UFOA 3JQBA 5EKXA 4KHPB 3SVZA 1E8NA 4MUEA 4EVSA 5J29A 4Y1FA 4D81A 1JPJA 4K26A 1SC9A 5A5GA 2PFKA 4BWGA 3VJRA 2DEUA 1FMLA 5G5GA 3RS9A 3TB4A 1YR8A 5A4IS 4WESA 3RGGA 1FFWA 3JYNA 2P1RA 5J0QA 2SECE 4KAAA 1ZXBA 5I6DA 2OUIA 3ZWAA 2ID7A 5CFMA 2H3IA 4ILEA 1VHJA 2C2HA 4XASA 5K0TA 1VIAA 1L5KA 1QS0B 2PI5A 2V3CC 4RIFA 3KU1A 2ZAIA 2UZ1B 1EK5A 4HDKB 4EECA 3DE1X 4H7KA 4TQSA 4DSTA 4F5OA 2FAXA 4OXQA 1VMIA 3CLTC 2C22A 3COWA 3M1IA 2J6TA 2OXFA 4MI1A 4W8OA 1F2DA 1D5WA 1JFFA 4P2GA 4OIFA 4MS1B 5JPIA 2NUAB 3IAM1 5ALVA 4IDPA 4COOA 5K6AC 2FLPA 5EJEA 1KWKA 1UFRA 3PW0A 1V6CA 1X6VA 3A32A 3PFBA 1JKIA 1E1DA 1NBME 4FX5A 2NP7A 2IYLD 3K1TA 4FS8A 4RJKA 4TTQA 2FFJA 4UHFA 2HXSA 4Y6QA 1QF9A 5TQJA 4EB6B 3EZNA 5KHOC 2J48A 4JJAA 1K88A 2YL2A 1VRWA 4QG7A 1ZYUA 2NU7B 3ZVLA 1T1RA 1R8XA 2VOEA 2NZXA 1N6NA 3RB6A 3IQIX 1HZZC 1SQFA 3RV3A 3UK7A 2XGSA 4Z53A 3QVKA 5F51A 1JN0A 4Y6GB 3ANTA 1XMIA 5B7PA 4QQFA 2YHSA 5JH7A 2A92A 3EUB2 1TAMA 3VPBA 2FOIA 3GA5A 4HRXA 4YRPA 1BRMA 2H1CA 3K8YA 2G7MC 3TOCA 3WWDA 4A0FA 3OOEA 3D3WA 4BZWA 1Z0FA 2X8JB 1Z17A 3LLCA 4LOLA 4EFDA 2GHIA 4ESVA 4L4SA 1HOXA 1SXQA 3RJKA 1T2AA 2ZTVA 3KUKA 1ZESA 3LYHA 1NMQA 4G1UC 2OXTA 3UTDA 5CNJA 4D9IA 1I6WA 1N2EA 4M7RA 4JJIA 2YNMC 3LKVA 3G89A 4KVAA 1YU6A 3OPYB 3QLEA 4KRGA 3WWEA 3ETDA 1WNTA 3DAFA 1S7CA 3WL5A 2VOJA 4J9QA 1TVKB 5KYGA 4QPCA 2JK0A 1VBFA 1D03A 4KO2S 1WKCA 2PUWA 3AFNA 1NONA 2OBNA 3LPDA 2GUWA 4X54A 3VXKA 3CJQA 1Q0ZA 3OC6A 4JKIA 1LFDB 3RH4A 2DP4E 2ZTEA 5DTRA 2YC2C 5FLYA 3IYLW 4E31A 4F3RA 1TM5E 2B1IA 4DCVA 1E69A 3FHLA 5JXJA 2I6GA 3B1YA 2J3IA 4O08A 3EPGA 2H29A 1QMPA 2Q6KA 1XRRA 3CXUA 4I55F 5F2EA 1JQBA 5AW5A 3W2FA 2WK1A 4MIOA 3PZBA 4UB2A 1M6EX 3L84A 1SVLA 5HK8A 5C7LO 4IMJB 2AYYA 2G77B 3SV3A 4OK6A 5CEFA 5SY9A 3GOQA 4GLXA 3T6KA 2ACKA 4MPPA 4COKA 2QI9C 1XEFA 1ZUWA 4G0QA 2QRPA 4GL2A 2VDPB 4LBWA 1YBAA 1RQNA 2MINA 2PPLA 3UUFA 5DSTA 4AY3A 3AM5A 2ZULA 2FMHA 3ANLA 5JEDA 2X6RA 1UT6A 2BRUC 2EFDB 3DEJA 1B16A 3JASB 1IIPA 3UMFA 2AKYA 1THZA 1S02A 3PNVA 8ICVA 4AO8A 4C05A 3KZKA 3OTGA 5DX0A 1OY1A 2FE9A 3MGIA 2H7YA 2VH1A 4TTRA 4UD2A 1RKUA 4E70A 3AEQB 5LNK6 1FSPA 4JJ7A 4OD0A 3V1KA 1G7RA 5F21A 3IEVA 3DDZX 4JSRA 3O9MA 2GXSA 3O83A 1M8FA 4NCNA 1C30B 3OM1A 4ECSA 2OV1A 4GL4A 2PDAA 2VDKB 1NBAA 6Q21A 1F9AA 3ONVA 5KSOA 2EBUA 5KQRA 4KHZA 2VRCA 5B1DA 4CQMD 1NVAA 3HEAA 2ZTLA 4L0DA 1E7SA 1B1AA 1XL1A 1F51E 2OD2A 1JI0A 1H8EA 3EVGA 4QXMA 4X8HA 3Q7PA 5EA2A 3GJXC 1VHQA 1JHVA 2DETA 3RBDA 3G2HA 2WHPA 3KWFA 4Q0MA 2WABA 1Y1RA 4L7QA 3IJEB 1IYZA 4QDJA 3EGOA 4GIBA 3JD1A 4C8LA 2W7OA 1T24A 4DQIA 1UMCA 3D8RA 2V7BA 3G8CA 4H27A 2OGSA 4IM7A 3H0EA 4WCFB 1SRQA 4XD7A 3R9KA 1O5OA 4M49A 3GMSA 3J7TA 4J0DA 1AY0A 4EEZA 2ZYAA 4C8OA 1CK4A 1SXGA 2H7XA 1ESCA 2WJJA 2ZRGA 1RCTE 3IBCA 4YVFA 3R20A 2FLVA 2HHTA 2B1RA 5I4KA 1AB6A 2HRDA 3DFIA 3W5DA 4IG9A 1IM2A 5B66U 2H7VA 2ZRKA 3PC8A 3IN5A 3QEJA 4FMBB 3ND6A 2XF8A 4F5ZA 6AT1A 3AF6A 3SSOA 1FSGA 4V0ME 1YZFA 3MR2A 1DKNA 1GKLA 4WXHA 2X4DA 4G0YA 5JHHB 1I7SB 5IULC 2GBLC 1PTJA 2OENG 4LY0A 2JGIA 3RUEA 4AUKA 3WLLA 5I3ZA 1WCWA 4PYNA 1JDNA 3H6HA 4DIFA 7AT1A 2AG8A 2NSJA 3U7FB 3TNLA 1PNVA 1YULA 4OFWA 3T5BA 3H0CA 4F11A 1P7WA 3HKZC 6LDHA 2NU6B 3KEMA 1ESEA 2POCA 4WCVA 4HEA6 1LSJA 5E4TA 4BJ5A 4E2ZA 2W2QA 3SF8A 3T7AA 3RC3A 2GJ4A 1QOPB 2YB1A 3OKPA 2Q3JA 3Q9NA 1N9GB 3AEUA 4GI1A 4RKWA 5L1MA 2OORC 7ICNA 4RANA 1XRNA 2Y1WA 2RG1A 1YA4A 3VDMA 4MQEA 4ARAA 5BNIA 1NPDA 1ZD5A 1Q1GA 2YJ4A 4KLCA 4MCIA 4P7KA 9ICPA 5EJAA 4AIIA 5A9SB 1J8YF 2WJGA 3ZBPA 5E7QA 2XQGA 2IS2A 3LIPA 1V1RB 1GSAA 3W3ZB 2DTXA 3BXZA 1ADFA 1U0NA 4PHAA 2IUTA 4FCCA 4XJXA 4AK9A 1U9ZA 1WCXA 1BJKA 2C3UA 4EPTA 4FZMA 1Q3HA 2UZ1A 3HNOA 2W8BB 3R9XA 3A6GA 3P9XA 3D2AA 1OLUB 2A7QA 2YHIB 4RDIA 4E51A 1ZITA 4XVUA 4OEHA 3CG0A 2DWOA 1NJ5A 4JI8B 4NZ9A 2HMWA 4HLDA 2FN4A 1UFQA 3DZGA 3RAXA 4JL5A 3GJ6A 4J0IA 3PRYA 3RC2A 3UAWA 1O0BA 2IF2A 3ZNOA 4IHKA 1SUDA 4HY3A 4A5OA 4XQEA 1KEWA 1F0PA 3GJ8A 1AS0A 2OLEA 2PFGA 2ZRAA 5ALUA 1WHSB 2BFFB 2O8VA 1BU5A 3H5WA 1TGYA 3Q72A 2I4OA 1I8TA 5FI5A 3WLNA 1ZS9A 3M9MB 2A57A 5J23A 4RQ0A 4YXJA 1H8ED 2PGJA 4Y2TA 4ED0A 2ZWMA 1UDCA 3BL5A 1F0YA 3L0SA 4DF3A 1RXWA 4F2PA 1Z68A 2IY8A 5DXJA 2DF4B 3CLVA 1Q77A 2XQVA 3KAQA 3QKSA 1E3TA 3FCSB 1VMKA 4JCCA 3IUEA 4QWCA 4OAPA 3UJHA 5K45A 2FP3A 4IGIA 1DBQA 1UQRA 2H06A 2YXLA 4U2KA 3L46A 4NENB 4WN9A 4EAAA 5CTJA 2WSBA 1NV9A 1VLBA 1E61A 1C8VB 2RLTA 1LBHA 2BR5A 3GAAA 1IJBA 1O5IA 4GI2A 3JATA 4KDRA 2BDTA 2PGXA 5COAA 1KHHA 1OLSB 3DOEA 1QH8A 2EX0A 3L0OA 5DBIA 2A67A 2I1LA 2VJOA 2DPIA 4OQYA 3A9WA 1TZBA 1L4EA 1KNQA 1ZKDA 3PR4A 1PSDA 1AK1A 4MYDA 5EQTA 2CMFA 1V85A 1QIGA 3MMPA 5DG9A 4V3CA 4EYSA 2V3WA 3HCBA 3ROGA 2OZLB 3F5FA 2GLXA 1U2EA 1W0JD 3COPA 2D3DA 3IOEA 1WB4A 3L7AA 5KU1A 5L3SB 3MFQA 3QVMA 4MDFA 1PJQA 2MAXA 4QWDA 2BGUA 3FPFA 2KJ5A 2ZE8A 4NBVA 1XZHA 2PUGA 4PSCA 4PS1A 2PWZA 3EH2A 1M5TA 1P81A 4DA7A 1SXJA 4DTCA 4YT4A 3KSZO 2RHHA 4ZK2A 3IEMA 2O8CB 2JAHA 1BN6A 3WYNA 1JPVA 1LJ8A 4BMCA 5KEIA 5J2GA 2FEXA 2O48X 3JPQA 1L8XA 2ZBEA 3AR8A 3O2SB 3CRMA 3H7AA 4IDGA 1UMDB 3O90A 3V2GA 1HFJA 2RMKA 4UTXA 4K81B 2BMVA 1XNRB 2GPYA 3H2GA 3ROMA 1JT2A 2P2DA 3AXTA 3MWDB 1Y1PA 4U3JA 1OH7A 5FPHA 2OFFA 5DCUA 1YKFA 2JJQA 2G7ZA 1WD7A 1V1RA 2JFGA 4ECQA 1Z2OX 3GUYA 3HKCA 1D9FA 3ORSA 1E0JA 1SMKA 5CPFA 3N0VA 1G2PA 4WLFA 2ZIWB 1CY6A 4CM4B 3U09A 5FBZA 3NJ4A 3IBFA 8ICQA 2C2XA 3E3MA 4U1RA 3T1TA 2O8EA 2R1TB 5JMWA 4PR3A 4N6OA 2FK8A 4KMUA 1SZHA 1A8SA 4PHTA 4I5IA 1P77A 4YAKA 2XD4A 3NT4A 3QVGB 5FPSA 4BHTA 2RHWA 1I7QB 1DJLA 5KX5A 3NW9A 1A97A 1HG1A 5AVXA 4ZOLA 2B3DA 3JZFA 4YAUA 2AYZA 3RH0A 1HL3A 2Q4TA 1NBHA 2C9ZA 3PLAE 4G8DA 5JT1A 2VP5A 5KOHA 1C9EA 2FP4B 1HYBA 1XRSB 1E2PA 1AD2A 3QPVA 3MFHA 1W8IA 3D7NA 3W5HA 1S8FA 4X20A 3ZZNA 2QTHA 3CF2A 2JLXA 3U3KA 4NM1A 2MMGA 3AHDA 4IQ4A 1P29A 3LS2A 3OJXA 4LJYA 4W8HA 4C88A 5JALA 2IBSA 4ARCA 1A04A 5F78A 5FWAA 3RLIA 5J5CA 3PFNA 2ZUBA 1CQIA 1FTGA 2FN9A 2I54A 3HBJA 3QUQA 3ISVA 2NX2A 1LW7A 5KFCA 7ICEA 1WZUA 1ZCAA 5EPOA 1BE0A 1II0A 3V1NA 1F20A 3RC7A 4XWYA 4RMJA 4A8JA 1Q1NA 3BRSA 2OCXA 4N8DA 3MJVA 1S3IA 2Z8YA 1Y5IA 4PHGA 4P2HA 1A72A 4PSKA 2FEOA 1V8FA 4NK4A 4UBCA 1KBOA 2I9PA 1ISHA 1KI7A 3DQPA 1T0PA 3T1QA 2PWYA 4CTKA 4DMLA 3B1FA 1QV7A 2A30A 2JHCA 3M4NA 1G3UA 4GWKA 3ZZUA 3KAPA 1C0LA 2ZRFA 1PK3A 1L3TA 3LHFA 4RKEA 2G1PA 1USGA 2AXPA 2CVFA 4N54A 4AJOA 4DLTA 1BXGB 4RTKA 5IVHA 1C9KA 3SKYA 1DV2A 3MAAC 1LTHR 4YIKA 5F73A 2O6HA 2AOTB 1H3FA 3SX2A 2VA9A 3MJHA 4AKTA 4NZZA 1DRVA 3RC1A 5ADHA 5LYJF 2HAEA 4P4UA 2IYPA 5KSPA 5L6LB 3ZBQA 4L95C 2B4TO 2ZB8A 4FFMA 5E4FA 4J0HA 1FQJA 1R0YA 4LZLA 3V8QA 4MHTA 1K1SA 1MGOA 2B2XA 2V8OA 1J8MF 3KB8A 3VJLA 2W6JA 2KHVA 5HFNA 2HA3A 3WZMA 4IMRA 1SXJE 5CAEB 1AQ6A 1CUWA 2ZI7A 3HJGA 1E3MA 3H83A 4M4SA 2ZUSA 3A26A 5I7VA 1D8BA 2XO7A 2IIQA 1XA0A 4MKGA 5K51A 5TB5A 2FEKA 3DB2A 2BEWA 3ANNA 3MTEA 3WWOA 2OQ2A 2RDJA 2X9GA 3A9RA 3CONA 1F38A 1Z83A 4ZQFA 2AH5A 2JKYA 1PR2A 3FUCA 4FZNA 4P31A 2A0XA 4NQZA 5AWFC 1N5MA 3BDPA 1YQDA 4C7BA 1PIWA 1A3CA 2A6PA 2WTMA 4WLNA 3ZGNA 1KERA 3BJMA 3QVTA 5FBRB 5IXYA 1R4MB 4IDNA 5JFOA 5B55A 5IKPA 4NBRA 1OPRA 1Y8ZA 3WLIA 3GAFA 2XY4A 2QN9A 1ZJMA 4MCHA 2HCTA 4NABA 4X66B 1IULA 1NPTO 3FKQA 3MUNA 4X7BA 4DLGA 4LVSA 1LRJA 1UJMA 2QMQA 3CX7A 3WDSA 4D3ZA 4EHHA 4RLHA 1VLQA 2B35A 2P62A 2EJWA 3DWFA 5CX1B 5F33A 3O8RA 2C3OA 4NI5A 2JIQA 4UUPA 3CMMA 3NRCA 3OJSA 3OZBA 1T9AA 2NV3A 1OXUA 2Z3VA 4KR7A 1TOAA 1AQYA 1TKDA 4FS2A 2YYSA 5ALXA 5C3UA 3ZY2A 1NQTA 1YDFA 4GQAA 4NLLA 2I2CA 1KSFX 2DE0X 2P3QA 1V7QA 3KKAA 4A0RA 4R51A 3TE7A 4BVEA 5FBVB 1UBGA 1UPUA 2R00C 2X2PA 4RCZA 4DMMA 3REGA 1VSVA 3NEPX 1NC3A 3VR1A 4E5PA 1F2TA 2BKAA 1JHQA 2W2KB 1Z4NA 1HFKA 4V1CA 1V7CA 2V6JA 3D59A 3EJ6A 1ZNQO 3KBBA 1DT5A 2QYOA 2JJ1A 3AFGA 3F9IA 3H6GA 1L7PA 9ICLA 3U6BA 4J43A 2F44A 1E0KA 2AJLI 5CXUA 3TN7A 4WCFA 5JECA 3UFXA 1EXMA 2P65A 1K5OA 4TL7A 1ATIA 3SYMA 1RFGE 3LQQA 3NANA 5GWXA 2EFGA 3B5JA 1C9YA 1VKRA 2AKEA 1TC2A 4MQ4A 2G25A 4ARUA 3EZ5A 1GCIA 3LP5A 4DWJA 5EWFA 1XTRA 3ENWA 3G1TA 3HYNA 3F2BA 1KZ9A 4MW1A 4P83A 5K8IA 2AT1A 3RE1A 3NNDA 2PY6A 3PIDA 2BWJA 5HJ5A 4Z4EA 3AOGA 1CEZA 1NY5A 4ZEMA 3P0RA 2RE8A 1XU9A 2F1OA 4O0IA 5AM0A 8ICRA 1BS2A 4NZNA 4WPGA 4EUEA 5KDOA 3UV7A 3AM9A 3NIBA 2RDIA 4GYWA 2QBYA 4EVIA 1PEYA 3QH4A 4GWGA 4G0XA 3UGKA 5JC8A 1HNXB 4GNKA 4CM8B 1DJPA 2OCDA 2FSVC 3RADC 2XMBA 2YWRA 5EMNA 1CC1S 3DL2A 4HLUA 4HO1X 3Q5DA 2HA5A 2AZXA 2DCMA 4CM9A 1RI4A 1SHUX 2WSSA 4AJKA 5IUJC 5JV5A 4QTXA 4L74A 3GAZA 3D6MA 2IYVA 4QUGA 4C4OA 3QW4B 1OX5A 3ZCPA 1CD5A 1UMKA 3FDZA 1V5IA 3RSSA 5J2TF 3S2IA 5F3DA 3RPEA 1QGYA 3HPOA 2RH8A 3RKSA 3UW3A 1LQTA 1I6LA 1XCPA 2HRCA 3BWBA 4EHIA 4AX4A 4L3OA 3SE7A 3OLZA 1JG6A 4OQFA 2WUGA 3RVPA 5L45A 1RG6A 1ORHA 4PQYA 2ONZA 1AVTA 1O08A 1X1AA 3BORA 3FGZA 4AW9A 4DW8A 1NVXQ 3EQ8A 3ZD8A 4M1ZA 1L7OA 2FJPA 3ETRA 2HUPA 2JVJA 2WICA 4HAWA 3BWEA 4LRSB 1JQAA 4M7OA 1VFNA 3DMRA 2ID8A 3JAKB 2A3VA 1W87A 2BJWA 1ZK0A 3U49A 4NTZA 4D25A 4GX0A 5A6SA 2HL6A 2R8OA 3G1WA 2ZUVA 1DAEA 4YG2A 1WSAA 3GFSA 2UKDA 2IW3A 3G5AA 3NTXA 3D5TA 3IUQA 4G23A 1RMYA 1FTQA 2GN0A 4QBFA 1ZJZA 4DB4A 3K4HA 1QIMA 1TI7A 2CMHA 5K7SA 3AVYA 2C7PA 1RP1A 1RFLA 2KKVA 1ENYA 2ALJA 2PGNA 3ME5A 3OPYA 3CIOA 4FGUA 4G1MB 4HX9A 4ELVA 4JEMA 2GN4A 1N25A 5TF4A 1X9WA 2VUHB 9ICNA 5JYEA 2CLIB 4G0UA 1SIUA 3HXQA 3CURA 3O31A 4HH1A 3UCXA 3CEPB 1U8YA 1ZO8A 1DRKA 3M81A 3VHXA 3WQQA 1LI7A 1M10A 3VU8A 1UJ5A 2EWWA 1UMBA 2GPWA 2ZS8A 4FGLA 4OKIA 2AWOA 4RHCA 4XB6B 4KYVA 1D1SA 4XIIA 1LJUA 5FNVF 3V4VB 4EVRA 5C5EA 1K0FA 3R6DA 2PS3A 5AI4A 2ZYWX 3KQUA 1RC1A 5DNEA 4BS9A 4TKUA 1O57A 5BN5A 1DC7A 2EZTA 4M37A 4Q9IA 4OQLA 2JCGA 2Q1WA 4KO3S 4WL0A 2H92A 4RHTA 3F74A 3CH7A 4GD3Q 3GH3A 1Y6GA 4ZJUA 4RF4A 2Q5HA 1SB3C 4LV8B 3ETCA 3K4QA 3DTNA 2IH4A 2H4ZA 1TADA 4RACA 4C2UA 2DG2A 1Y1LA 3VI3B 5HHIA 2OV4A 3V00A 4Q45A 3E0QA 1ZD1A 4XRHA 4RY9A 2VAPA 2PMDA 3ENKA 1SVOA 1GZ7A 4RPLA 4GC6A 1IWPB 3AY7A 4H3KB 3OAAD 2QM3A 3KDPA 4XRRA 3X1KA 3E8SA 4C04A 5IW8A 4CCWA 2D5BA 2QPLA 4W8GA 5AT1A 1K75A 4B43A 3CZRA 3HR7A 1Z8DA 3WLQA 4B2PA 2JLZA 1DOZA 4IS2A 5AVTA 2J0EA 2XV1A 4H7JA 1ODFA 1W5SA 2V6IA 1RXEA 2HLDD 3CO0S 4GX1A 1G20E 4NDZA 6CHYA 1QP7A 3VKWA 2EVWX 3TNJA 1M8KA 3D3KA 4FEGA 1T6ZA 4M0AA 4C21A 1ZQSA 4J29A 1UAGA 4X41A 5A02A 5B3JC 2ZYDA 3AEXA 3UEOA 2A1UB 1W76A 1VXOA 2VJMA 3MA0A 1JROA 2PIAA 2YVKA 3Q3VA 5EPEA 4AJEA 4CI0B 1D0IA 4OSOA 3TOVA 5B6JA 4B3GA 4OJNA 2EF0A 3HCPA 1R00A 5CU7A 4Q66C 2GKGA 1EUCB 1V5GA 1FP2A 4PPNA 4YRQA 2JKZA 1TM1E 4KE7A 3PQ5A 4I3GA 3T7IA 4EGAA 2P69A 5KVSA 3QW2A 1Y4UA 2OHOA 2BZ0A 4WV3A 5C3MA 4WI1A 1JMKC 4RQ1A 3KHTA 2IH5A 4IYJA 2G3YA 3RUDA 4C0XA 2AUNA 1XNQB 5IDYA 4MUMA 4NV1A 4HS4A 3KLMX 4YJ3F 5DTIA 1TEZA 2R6FA 3KOZA 1X1EA 1BS1A 4GXKA 1LUAA 3DR5A 3SC6A 4F5DA 4N49A 2WMYA 5IH3A 2PKCA 1HTWA 1KJZA 4V0MA 4RTQA 2B9EA 5HS6A 4ACBA 3K5WA 4CR8A 3OD1A 3SMQA 1W5FA 3L0YA 4EKGA 1GZSA 3AHJA 1OZAA 3SC4A 2DTEA 1X9MA 2ZRLA 1FW6A 1NVTA 3QFSA 3SP1A 5LMNB 1GEEA 1A8PA 1Y5NA 3EH1A 1JILA 1QBKC 4PGXA 2F3RA 1XSLA 1XELA 2DY0A 5KNIA 2MWMA 4MI3A 1W4CA 3H5NA 3QUAA 1QZ3A 5B1HA 1Z0KA 3VVLA 3ORFA 4EG6A 1YMUA 1DG9A 4MGYR 3ZZ1A 1RCUA 2CUZA 4WBNB 1RT9A 5C8XA 2Q5FA 3DZKA 2P9CA 4IXMA 4ZCMA 1OSNA 4YONB 2ZVDA 1DEHA 5KKCA 1IPEA 3TANA 2OXCA 4QODA 5IH7A 1IK4A 5K01A 2MYUA 5LMUB 4DQLA 1GDHA 2ZAGA 3DE5X 1IBLB 2AXEA 2FSGA 2PXXA 2QQ0A 4X97A 1K4YA 4ND8A 2AS0A 3F96A 3A1EA 4KQJA 5IDVA 2UVVA 1RD4A 2ID4A 4DLYA 3IPXA 2A19A 5AM5A 4GRAA 4CLOA 5KNBH 5D8DA 2GCNA 1KO7A 5H82A 3WL4A 2C57A 4QXQA 1G17A 3SM9A 2IBTA 5AVRA 5G1NA 5L1LA 1NRJB 4BKPA 1G8KA 4K6GA 1LNQA 3G8BA 1VPWA 3FCYA 1E4OA 4MH0R 2YBDA 3VR4A 4RQUA 4B9SA 2VLIA 2VDQB 5FHQA 3L7IA 2DHRA 2YMLA 3C7DB 2PEZA 3L4SO 3B9RA 5GM1A 3TSZA 1F0KA 4A73A 4MQFB 4PSUA 1HYHA 2W22A 4NU6A 1TCBA 4OI2A 2QMZA 5J58A 2TECE 2XVXA 1Y0BA 2I6FA 1WPXA 3VFDA 1TVAA 3UW1A 1PV4A 4KLFA 3FFAA 3HEMA 2VP0A 3M8KA 4JBGA 1RDFA 1SZCA 3AHGA 1Q95A 4RKQA 3RU2A 2LMRA 3QKUA 4CIDA 5IHXA 4ZHSA 4UATA 1UPAA 3OMWA 2B4KA 3VR0A 3EG5A 1YQUA 4CDGA 3E22A 1EEXB 2D5LA 3WGGA 5CDFA 1EVZA 3AUXA 4R3NA 2BH2A 1EFRA 1P6UA 3L7JA 3H0LB 4OA5A 5DCYA 1YB4A 3N2KB 2FJUA 1N5KA 3A6JA 3DC2A 1TYCA 4M8SA 5TNXA 3D54D 2Q3BA 4JI1B 5ICFA 2JR5A 1NF3A 2GCEA 4KOAA 4G2TA 5JADA 3RYCB 5F3WB 4F4YA 5KHAA 2Y66A 1HLFA 3AKDA 3TKAA 1NVUQ 3EGVA 3KCQA 2JH9A 3JZAA 2V55B 4BFYA 4I4LA 1Y6QA 3HGMA 3O8OB 3DBHB 2AZDA 3R2JA 3ZDEA 3E9RA 5MN5A 5JI3E 2O2XA 1XF1A 5CH3A 3K2QA 2BM0A 3IULA 3L04A 4GVLA 5DK4A 3NXSA 4Q3CA 3R9WA 1UKVY 1NGSA 1VG8A 4PPFA 3GV0A 1M2EA 5I7RA 2CJYA 5JD5A 3G9XA 3WJAA 1DT3A 3GLHE 5FORA 5KB3A 1N4DA 1L7NA 9ICBA 3P32A 1JFLA 3N4MB 2Q6LA 1NYRA 4NL9C 4GPZA 4MYRA 3A0HU 4AY6A 4DSIA 4Q18A 1RLIA 2ZI9A 3ELDA 3AUKA 2PZ8A 1FU7A 1N3YA 1P7DA 2E8OA 3FDFA 1Z0ZA 4FGZA 1X19A 4QOEA 5DYYA 1NW7A 4N39A 4MB2A 2BDPA 1F12A 1RHRA 4GEGA 4YR9A 2CD9A 3IC5A 3LSYA 1E7MA 2DPGA 4ATNA 3KT0A 1U28C 1ONNA 4PBRA 4ZC8A 5ICGA 4HSGA 4YQYA 4ZRDA 2CL0X 2DGDA 5CH8A 5KYTA 4URUR 3TL3A 1SCJA 1IAQA 1GRRA 1XB2A 1X87A 1G8AA 2C00A 2OAEA 1SVMA 8ICXA 1VL8A 2W00A 2VDLB 1Z4IA 2JGDB 4M1WA 4G0NA 3TR0A 2PH5A 3SDSA 5JCJD 1ESMA 3GFFA 4EJSA 3DHVA 5L1JA 4HDMA 1ZVMA 4PO3X 4UQOA 5CK5A 1MQ3A 3T38A 3G2PA 1S2NA 4L9WA 4C6TA 4CR7A 1EDOA 4LKOA 3MFIA 4HDRB 4O4JB 4DLAA 4JJZA 2W9CB 2W6CX 3WX0A 2IYTA 1LBQA 2ACEA 1YASA 5K8JB 1SXJD 1WOYA 3P9IA 4O4HB 4BFZA 2VPWA 4BVFA 8ADHA 2Q9AA 2ZTMA 4FYHA 4R31A 1PFVA 4A8EA 1KSPA 2I5PO 5LOVA 3EK2A 2Y9PB 2A5LA 1FL9A 3FHJA 4J7XA 4XIFA 3WIUA 3N7RC 3COYA 1T9BA 7REQA 3GEGA 4U2EA 4Q44A 4B31A 3Q6NA 2JRZA 3MBIA 4YQWA 3RC9A 5FTWA 2PJUA 4BV8A 4R05A 5B6IA 1BYIA 3H1GA 2PYIA 5CJ2A 3ZXIA 3MRSA 2I4LA 4DG9A 3HXKA 5AH0A 1TC1A 5KS2A 5FCDA 2J6UA 2WKSA 3VKUA 1ISGA 1HFWA 4G56A 1CETA 2YWJA 3KFVA 1THMA 4FYJA 4M47A 5TJHA 2BSQA 1VLJA 3LBAA 4I1PA 4RYLA 4D3XA 1AT1A 1RBQA 3RT9A 5KWSA 5KYKA 1E2MA 2F1IA 2BC9A 3E22B 2QUHA 4Q48A 5DBHX 4NJEB 4HC4A 1IBSA 4FN4A 2XA9A 5I9BA 3NBMA 4Q1EA 2F4NA 1OUQA 2C78A 4BRSA 4HRAA 1TPYA 1IXKA 4C06A 2BKEA 3UOAB 2BE7A 3I9V6 4LYEA 4FEEA 4LXYA 3A58B 4OK5A 3AUTA 1P9LA 2CVZA 3NBAA 1UJ6A 2V65A 4KI7A 4P36A 4XM1A 2O1WA 5BWBA 5IK2D 3KE9A 1DGJA 1H6CA 2JZBB 2QD4A 3BMCB 3TDMA 4BBZA 4DL7A 1NJGA 4B48A 1ULZA 1USKA 4BEWA 1ISJA 1M83A 4TRNA 2BPOA 2ZDHA 4TZ0A 3B8EA 1HRKA 1PAUA 1D1PA 1R74A 4GC7A 1II8B 1XL0A 1GITA 2ID9A 1T2EA 4UAJA 2WAOA 3I04A 1FDTA 1HKHA 1NLMA 4R66A 1K5GA 4GM1A 3AV3A 4CLOB 3BKXA 5IS2A 2FWRA 1RKBA 1Z2PX 1J8QA 4FNMA 3SK0A 2YZMA 3NX4A 2QSJA 2CB0A 4BDPA 1JR6A 2LYAA 2EKPA 3CZQA 3WYAA 4D98A 1E8MA 1RXCA 5DYGA 2X0DA 3K2BA 5TX7A 5M7EA 2QYSA 2RD2A 1DBVO 4B0PA 2PGDA 5I4CA 4TSFD 1G7TA 4HGPA 3TVDA 5IARA 3KK0A 3PVSA 1V4NA 5DNYB 1DHTA 1FJ2A 2D06A 4NU5A 1C80A 4B83A 1DEOA 3VBCA 3BZWA 3E1SA 4ZOEA 1OT3A 1PYGA 3BWXA 4GYKA 1QZXA 1C1DB 4UARA 1KDPA 1I2ZA 2NXWA 2XLCA 3FLBA 3KX2A 4KQXA 3Q7TA 4U00A 2V7EA 1E9DA 3W2TA 1NDQA 1N2HA 3I73A 4UBKA 2DBVO 5JD6A 1K86A 1XDZA 5ALRA 1S9DA 3ROFA 3NVDA 4BL5A 3BH0A 4Z4HA 4AIRA 4Y2GA 4UEKA 2PUJA 3DH0A 4CZ2A 3N7UA 5TRTA 2DC1A 3N86A 221PA 2WWGA 5JUMA 3FCOA 3H2IA 1VJDA 2JD0A 4EVQA 4G4GA 4I1SA 1YZKA 4DIKA 1Z0SA 1N0UA 4CE6A 3KHHA 1Z47A 1N75A 4IMIB 3HV2A 4V0SA 4YRZA 3AVXA 5ES4B 5C5IA 3O84A 4HQOA 2WKWA 1NZBA 3SENA 4C0JA 3WQSB 4CEHA 1U7HA 4LE0A 3OFNA 2PZGA 2R5WA 4QZAA 2PZLA 4GE3A 1OASA 2DPYA 3AP2A 3Q7RA 4UMEA 5AOCA 2B4RO 3QA3E 4JOQA 4QPPA 1ZRNA 1Z2DA 2MUTB 3FF4A 4DFPA 1S9FA 2IXDA 2XZTA 3GMDA 3C48A 3LAWA 3P9SA 3BJIC 3OJOA 5REQA 4F8JA 5JBQA 1RWQA 1W88B 4BEBA 3V55A 2I03A 1JVSA 3F6PA 3H1PA 4BZPA 1BMFD 4YP0A 3B6JA 1DC8A 3IO3A 1POWA 3S68A 3ZDBA 4TS9A 5JC1A 1SKBA 1EEHA 3E3OA 1PJCA 2CNWD 3O9ZA 5FOWA 1AMUA 3BCSA 1VE5A 1RJEA 2DPHA 2P3LA 3N87A 3L8CA 4XM0A 3AW8A 5GY7A 1NMYA 3WFJA 1OC4A 1SFRA 4ECEA 1JPNA 5K3SA 3WJ1A 1EHIA 4RPKA 3NHWA 3VV2A 2DB3A 1KMMA 2B8JA 2P4QA 1MVNA 3IGFA 5I47A 1UWLA 4KSBA 1Z2AA 4EA6A 1DUSA 5KVCA 2O2DA 1EXNA 1Y9DA 2V7QA 2RGRA 4M9NA 4FWTA 4ZT4A 2PLNA 1Y8AA 1VBNA 4L50A 4KWTA 3E2MA 4ODIA 3DL4A 3AETB 2JV3A 3P4YA 4I2VA 4ZQGA 5D2CA 5BSFA 3VKHA 1TMGE 2HMUA 2NM0A 4I1YA 1KFTA 1EVKA 3BTSA 1Z26A 3EXHC 1N5OX 3D3NA 4JUDX 4AG6A 1UBJS 5H83A 4CMIA 2BKVA 5CIQA 5BUCA 1AGXA 4GU5A 4MVWA 5GP1A 1G3RA 4DRXA 1QGZA 1KJ9A 1YRAA 2GZ2A 4LXUA 4O4LA 3EVTA 3TDKA 3HVKA 1T4CA 2IYAA 3J81A 1QH1B 3PUIA 4F4CA 5EVCA 2WHXA 4BRZA 3D9QX 3VC3A 3H2ZA 3F2DA 1JSCA 2F3PA 5AW9A 2NRZA 1J2TA 1TQ6A 1YR3A 3IXQA 3GDOA 4QJ3A 3HUDA 4CKCB 3EFOA 1CDZA 3F73A 3OIYA 2HJWA 2OB1A 4JVOA 2QTAA 4OBEA 1S4QA 3Q8LA 1ZM2A 1PZEA 4OYRA 4PLCA 4TRJA 5AOVA 3OHAA 1OXJA 1TAUA 2QP4A 3KYDB 1B0AA 1U02A 4J9RA 5HRAA 1IY1A 2BBWA 3HWRA 3LLUA 2KZ3A 3D81A 1QHXA 2BGTA 2W83A 4LAFA 1VE7A 1N1EA 7ICPA 2PJDA 3RJJA 2UV8A 1MIHA 3C6MA 4FXPA 1ORRA 1I4EB 2GA8A 2AF4C 1MJHA 4KYIB 3V7YA 3G7SA 1V16A 4Z6CA 4QZVA 4TXNA 2PJZA 2B21A 1JDTA 2WC1A 3E7DA 3W1WA 1QSYA 5KTRA 1QFMA 3U3RA 4LK3A 2IVZA 1K27A 2LM1A 4FDUA 5AKGA 1RWPA 3C3EA 3O8BA 1MX1A 4HGQA 5C2JB 4HYKA 4WZZA 3HR4A 5CVVA 4L76A 3W5CA 4IL6U 1NNLA 1DO0A 4C0WA 4MDHA 1F8FA 4GKBA 1A9OA 1W5TA 4OK3A 1OU4A 9GPBA 3QF4B 4DJDC 3ZWOA 4OLJA 3KHRA 2W4MA 1P5JA 1JLHA 1C0KA 5T6MA 4EUHA 3FOZA 2H9AA 3NVAA 3NONA 3D6HA 3RKUA 1XTQA 3KSUA 3R3SA 4RPZA 1M2OB 4M98A 4IDCA 2A9KA 4KXVA 3H3JA 1VHLA 1OH8A 3STYA 4NEGA 3VX4A 2ONJA 3PVCA 3D43A 1EJ6A 2BM1A 3M1LA 3QQ5A 5ARCA 1OFUA 3OJFA 4I4TA 3U26A 4J75A 4MIKA 3EEFA 1JR2A 1P4RA 1YT5A 5D49A 1MX5A 4Q4DA 4FWIB 5FL7A 1ZRMA 1BU8A 4HAXA 4HZUB 1DC6A 4CL0A 1PT6A 1ZQRA 3VYWA 1GYQA 4HDQB 2KSQA 1JS1X 3V1YA 2PUEA 2VK2A 2R18A 1D04A 3RK1A 4B4KA 1OIVA 1UAAA 5LD2B 1FS6A 4MQBA 4HV4A 4ZV7A 2JGFA 2QNBA 3K0CC 5EIHA 4QDUA 3OPQA 2F48A 4IZOA 1JXLA 3IBTA 3S7TA 3UXMA 3ZUPA 4EF4A 8LDHA 3V42A 3TW8A 3DCNA 2E87A 3MJCA 3JY6A 2ZUTA 4AJPA 2P40A 3GGDA 4O4IF 3ED5A 5A71A 3WNZA 4C2AA 3BMOB 1FFUA 3CW9A 3L06A 2L0XA 4I2JA 3C5FA 1CUBA 2WT4A 1C8KA 2XE6A 3LXXA 2E1RA 5JIBA 1EX7A 4F93B 4REMA 5DMXA 5JS1A 1R0ZA 2R62A 3VR3D 1P61B 5ALOA 3GDGA 4JS0A 1D9DA 8ICIA 3DPUA 3OT4A 4QDOA 4WKOA 3RRZA 3SBEA 3TXAA 4EA8A 2WB4A 3ZHYA 1OYOA 3UFBA 3I37X 2RSLA 3SIPA 5LXTB 2SCUB 1QFSA 1D9XA 2QN3A 4YLEA 5EWMB 1OFUX 4EB8A 2FGKA 2MYNA 1Y63A 3G6VA 3RB0A 2Q0XA 1ESZA 2R2AA 1Q1ZA 2AK2A 2F7SA 3THVA 4G4SO 2HLNA 4KB5A 1RAHA 1G8PA 2FPXA 2VNAA 5J0XA 2JJ8A 1ZQVA 2RKBA 4PLTA 3HB0A 2Q3HA 2BQUA 1Q7CA 2OO5A 2ZS9A 3A9UA 3EMKA 3FBWA 1VE9A 4FLFA 4HN9A 4YJ2F 1GDDA 3U3ZA 4DS3A 3WWZA 2IXTA 1ZQFA 3SSNA 2WWRA 3NYWA 4FDVA 4G0OA 4EG3A 2E1FA 5DCLA 2ESRA 3DG9A 1H9AA 1ZXXA 4MCJA 3ZE0B 3HXTA 5THXA 3VNQA 5BWOA 1RXIA 2DH6A 3P9RA 4NCKA 5I48A 3MDAA 3LUAA 1CUXA 1N7HA 4CHGA 4U5QA 3AILA 4BQNA 3TIVA 2UXCB 1VLMA 2OHFA 3N6VA 4YJDA 2I3AA 3PMNA 1S9HA 2CZCA 2C8KA 3EMBA 1T8WA 1TAGA 2OXRA 2JATA 2ATIA 3L8HA 5IJ0B 5LOVF 2K6GA 2RH4A 2OC9A 4KR9A 4Z5XA 2W7TA 5C5DA 1MNAA 3K1AA 1EHYA 4MA5A 1QHYA 3W05A 4DCGA 1DHRA 2W43A 4RNCA 1T4DA 4IXWA 3ZE9A 3KL2A 1WVMA 4YO7A 1W9HA 4RK4A 1MO2A 2AE1A 4EHFA 3EZGA 4J0QA 1RSZA 4PC1A 2XT9A 2GSDA 2W0MA 2FW0A 3H0MB 1B2RA 2WHRA 2AI1A 1Y3HA 3H1TA 3KJEA 3LK6A 4NENA 4QO7A 4TMKA 4WN9B 4EMSA 4CDRA 3NHSA 2MJLA 2H07A 2KSOA 4MEYA 3JAMA 3GEIA 1C3XA 3UXEA 2CJFA 3MGVA 1YZNA 2YOFA 2ZIEA 3OSUA 2JFHA 3NYIA 1BVUA 4M0MA 4QQ8A 1ST3A 3WGYA 4D97A 4C7MA 3KFUF 3AOEA 1SCIA 1DKQA 3DA8A 3PEFA 4MAAA 3VVMA 4YRAA 5BOLA 4QOIA 5JQGB 3U5ZB 3HXMA 4C2TA 1YQQA 3D8BA 3S7ZA 4F8EA 4HDRA 4KODA 4KH0A 5CAEA 3LWZA 1N7JA 4UKDA 3LD9A 5EXPA 1Z1VA 4QZ8A 1FFSA 2M9NA 2GHQA 2BQRA 2QM8A 3OZ7A 3SEIA 1O8BA 4NBNA 1JHXA 2JS7A 4LGYA 5EJGA 3WIOA 1TLTA 3ZCUA 4BNTA 1HGXA 2BSAA 2GJAA 1VI6A 4BB0A 2C5BA 4ITRC 1UC4B 3R0JA 1A2BA 1Q91A 1WCIB 2Q4RA 3QPAA 3ITEA 5FFMA 1FIUA 1PR3A 2ZIZA 4LZNA 1I3MA 1GT91 4DLRA 2EL9A 2NNLD 4ELUA 2QTZA 5ESWA 3TBFA 3V8VA 3RTGA 3A9TA 4DIDA 4E46A 1XMOB 3QKIA 2Y1LA 4Y2HA 3K0BA 3HZHA 4FI3F 2WU1A 3IEUA 4BMPB 4D9JA 4F5WA 2F55A 1ID1A 3Q3IA 1GU0A 4RLFA 4CDMA 2BMWA 4LJ6A 3MMZA 4URXR 2LYBA 2AI2A 3HCDA 1EVYA 3HCEA 4MUNA 1LRLA 1YCFA 5HRUA 3K70B 5TLSA 5FX2A 1ZN7A 3PL5A 2P4UA 3IESA 5KIAA 2LVBA 1GNVA 4HTFB 1P72A 2OQIA 1CULC 4HGOA 5B1SA 1JI7A 2J5QA 2YINC 3I83A 5LU8A 5JRTA 5AFSA 2HV9A 4MJXA 4LF6B 1GRQA 4XYGA 3T5CA 5JAMA 1OX4B 3R5HA 4X62B 1SUBA 4LMRA 1ZZGA 1RAIA 2VJPA 5LLSA 5LP6A 4KLHA 2TMKA 4K05A 5SICE 3V2IA 3CUTA 1JXOA 1TVKA 1Z73A 2WAYA 1K5HA 2V9PA 5DLYA 2PUDA 3DZ8A 2IV7A 3I34X 3RC8A 2WW8A 3PKZA 4V03A 2BR0A 1Y9JA 3F4LA 1KH3A 1CZRA 3C3AA 2VDWA 1G5PA 1YI1A 3KT6A 3P9PA 1GHTA 4JJKA 1EWRA 1U3GA 1IG0A 1FLAA 2YFHA 1KAOA 3GUHA 4Q7LA 2JI7A 2NRVA 4TPKA 3VQTA 3ZD7A 2REBA 4LYYA 3S2EA 1PX2A 2GS9A 3PFKA 3PXXA 4GO1A 5AI6A 4BB6A 3RJFA 4OQZA 5DKFA 1I2AA 2CJWA 2OY0A 3GOHA 4ZAXA 2LZ0A 3LPCA 3E8MA 3K6JA 1R2QA 5ENVA 3W3AH 3LNCA 2OZKA 4ESHA 1YT3A 1MAAA 1NM5C 1NI4B 1XD9A 1ITZA 3NT2A 3I9FA 3HG7A 2X42A 2VHUA 4G8BA 4D0GA 3KQMA 1XMQB 4OX9Y 4QXPA 2HHWA 2R7AA 3Q4GA 1NW5A 1NR1A 1SBNE 3BTOA 4PU0A 1PJTA 4IIFA 3ZCSA 4F85A 1K7XB 1QHGA 3ADKA 3QMPA 4JLPA 4FK8A 4Y1GA 3U5TA 5ITZA 5LWQA 2OCAA 1JLLB 4UAGA 4XAQA 2IS6A 2GZRA 4XTCS 1T9KA 3NKFA 1H69A 4RGYA 4R9NA 2ZIVB 2G76A 2V1UA 4K9QA 3LQYA 4PFKA 4B71A 4NY8A 1ZK4A 1U1CA 5H7XA 1VKZA 3GJYA 4A4DA 4P86A 1XQ6A 1EKXA 1DEAA 2WU3A 3Q8XB 4GLJA 5K0ZA 3A2MA 4ZFNA 3EC7A 3F7OA 1YR2A 2P79A 3FI9A 4Y9TA 5J5VA 4MQLA 3RS0A 4IMPA 4DBVO 2ZYRA 4QSHA 1MC4A 3AB7A 4WGFA 4D8WA 4HDKA 1Z75A 5DN6A 3FZNA 3OTOB 1Z74A 1F6WA 3MG9A 3MWEA 4FZRA 2XRMA 1HBJA 2ZJFA 3HYLA 4NRDA 4EA7A 1GOTA 3T5JA 3HSYA 5EE0A 2WG1A 3GQCA 1KEZA 3K7EA 4KK3A 4RVCA 5DKWA 3AQFA 2WYVA 2HC9A 2R8PA 2OBXA 3V48A 2XOKD 2WDZA 4UASA 3SMVA 2VZ0A 3EUAA 4IXNA 5C8YF 4HXEB 5MGBA 4LHZA 1W36D 3ZU5A 3RWMB 4RE5A 4Q9KA 1Z08A 3KZNA 5EESA 5L3VA 1YIOA 1T1JA 3B89A 3P0HA 3GBVA 3D7KA 3V8BA 3O3MB 2ZYSA 5JAIA 5AK4A 2PR2A 4H1WA 1A98A 3PI7A 4JLKA 1JDJA 4PQGA 3LH5A 3KKAC 3GLHB 4L9AA 4Q47A 1N2SA 3Q8QB 1AK2A 4PZAA 5L3ZA 2O2SA 1UKZA 4JLWA 5TEWA 1TMOA 1YJAA 4BPRA 5F7XA 3KJQA 4M38A 4TYPA 1C9JA 3SS8A 1ICEA 3KVVA 4OXNA 4YPOA 1PFGA 3L49A 1ZN2A 2XA2A 2PKYX 2ZPTX 3KQOA 4MA4A 1RIFA 2BMAA 1X86B 1H85A 1GNPA 4M8NE 4U4AA 3RS2A 4LOKA 1EK1A 1YCHA 3VR6A 4AZSA 3ESCA 5H5JA 5FWYA 4H7FA 1MO4A 3TQIA 4JYZA 3FH0A 4FOLA 1C9MA 1N2OA 4M21A 1PYDA 1LK0A 2XHEA 2YX8A 4UW9A 1KYZA 2PS0A 3HB1A 3VSCA 3UUGA 1C7JA 4C30A 2V5AA 3KHGA 2A9PA 4GYYA 4F0JA 3QG5A 3X44A 1AZWA 1II8A 5C4GB 4GS5A 4YWHA 2Y1DA 5TV2A 5I8PA 1PR1A 4ED1A 3V8MA 2B1JA 4QEZA 2LCQA 2XXAB 3DDNA 3SNHA 4E1VA 2Y1XA 4AVYA 1F9EA 4KL8S 3RJIA 3N8HA 4Z4IA 4NFLA 1DKOA 3TSAA 4BGDA 1A9TA 2X19A 4LBYA 3VZCA 1DJMA 4M53A 4BY9E 5EWJB 4KOEC 1ZQ9A 1MT0A 2EZZA 2FSVA 4F6RB 2Q5EA 3DYBA 1QM5A 4IEEA 3ESYA 4AYTA 4G3IA 3ERCA 5CCBA 3NS1A 1KTVA 2BFEA 2CXTA 4HLUC 3MBYA 1QYIA 4NJEA 4BO1A 2X8LA 1GQ2A 5F7OA 1G6KA 2BTOA 1SELA 5CFOA 1MABA 5EWMA 2LDBA 1PJBA 3FVTA 2O7NA 4BATA 5KNCD 2EG5A 2GHTA 2OPBA 3ADPA 2Y9UA 2FSIA 3LWMA 2QG9A 1NP6A 4EG1A 3KB1A 3V4FA 1U9LA 3QNMA 3CT6A 1XZIA 3L8GA 3IIKA 3W5UA 2IQIA 2P78A 4ZDWA 4ND3A 3T1OA 5BOVA 3TAPA 3LZDA 4DS5A 1ILWA 1P6XA 4GE0A 3WXMA 1AKNA 2HIMA 1Y42X 4P54A 1XN1A 2IXFA 2B9VA 5K6RA 1JR3E 4WUVA 1EM8A 2IYFA 2QTMA 5KBYA 2F77X 3C1UA 3AEYA 3TZKA 2ZRDA 4AZ0A 4UHJA 5JNLA 3DKKA 1Z5NA 1SVNA 4Y9UA 3RTVA 5JQGF 3QJ5A 5D00A 3AVOA 4M99A 4BBPA 5GONA 4BX8A 2V59A 1QG2A 3FIJA 1A8HA 2D1FA 4MQ6A 4QGHA 1HORA 1MX9A 2OYSA 4YC7A 4R1SA 2PBFA 4K86A 4LC9A 4UU7A 3GCZA 3OPVA 2RGYA 2X9NA 4OH7A 3UC5A 2O2HA 4EFKA 2G9UA 4C4RA 9ICOA 2CE7A 3L1JA 2XUDA 1MPXA 3MERA 3MD0A 4PYIA 4TKZA 1EXVA 4EZ6A 1A95A 4FGKA 3VR5A 4B6EA 4DLSA 3IHLA 2C4KA 4NVRA 3ZTWA 5KFGA 1RRMA 5KG5A 1M2OA 4L75A 3ZUGA 1JA0A 3AINA 4PS0A 1IJKA 1ZQLA 5EP1A 3HU5A 4OYLA 1J0BA 2C2OA 4EKDA 2LHTA 2XMGA 4AZ3B 4IQWA 3R6TA 1LBSA 1RJFA 1BXKA 1PLKA 1NMXA 4KQKA 4MKFA 4Q1VA 2F8LA 1NQWA 1RM0A 3EAGA 3G6KA 4J3NA 1B4FA 3SR6A 2EYUA 3MCAA 4NESA 1U0TA 4YMHA 3B6KA 3GMTA 3H9JA 3MLBA 1MAVA 1KJIA 1IIBA 1VLZA 4UM9D 3RSQA 2YWXA 3ZY5A 2XCTB 4I1RA 2XCSB 2C7GA 1NK8A 4LNUB 1X7WB 2A1IA 2JHPA 4MRRA 3I32A 2YQ4A 4EDFA 2HLDA 1KZ7B 1NASA 2GFHA 1QSLA 3IHKA 2DBZA 3IE0A 3P96A 4ZRNA 5LB4A 2FMSA 5EXXA 1SQ5A 1D6JA 1NNSA 2GVDC 3TW4A 4F56A 5K6TA 3PWZA 4U7JA 5ETJA 4I6EA 2IIBA 4HS9A 3MMSA 4G9GA 4ZOBA 2FPKA 1ISFA 2RKOA 5D3MA 3R7FA 4CQLB 2QORA 5FAKA 4LXXA 3AHCA 3R7BA 1E94E 1GYRA 1Q0LA 1DINA 2BKUA 2OMEA 2AW3A 4W7SA 4EY6A 3VR2D 4H7DA 4NLGA 3FIUA 4ZIRA 2OGUA 4Y18A 3ZNNA 3CX4A 5DJ5A 1A9SA 4F1JA 3B70A 4CTMA 4CMJA 3FFTA 3R9XB 5A4DA 3OIVA 1U4BA 3L7KA 1TK0A 2Y92A 4OBXA 1JIQA 1A4UA 2IPMA 2R60A 1RRGA 3FZEA 2E4VA 2GDZA 2O0LA 3B1KA 1T6YA 4N12A 3CR3C 2ZG6A 3IA2A 4QHTA 2JH7A 7ICUA 3DEZA 2AJDA 1TYAE 5C37A 3LCUA 1KE2A 3RS4A 2XKKA 3OKCA 1EVEA 2OZVA 4FS3A 4B3SB 2GT1A 3E27A 2OWEA 4TSFA 1OROA 1Y3BE 3I2HA 2UXDB 3LUKA 4BAGA 1MRSA 4H1HA 4HFRA 4MRNA 2VQSA 3QVLA 2M9MA 2J09A 2XZPA 3ILHA 3Q9SA 4IILA 1KDZA 1P17A 1X14A 3HZOA 3LFTA 4OQNA 1HTBA 3U4CA 1SVIA 1N2CE 1EQ2A 1P2FA 4MEBA 2C4WA 4BGVA 3FCUB 1X9IA 1ZQJA 1HOTA 3TBHA 4NAVA 3HA3A 1KRPA 1NRXA 2JFPA 2Y4OA 3DFMA 4IH1A 4EW3A 4F9GA 2Y1KA 4DCNA 3TM5A 2FZ4A 2O07A 1N7GA 3N5CA 3QLVA 3IO5A 3MAGA 1HSZA 1MNQA 3V4PB 4ZWNA 3GBSA 1T4MA 4E4TA 1YD7A 3JX9A 3VPCA 2JHAA 3HO8A 3CYFA 3N53A 1BS9A 3G5TA 5FUXA 4GGMX 3E82A 2V97A 4N6GA 4BDSA 5L4SA 1IDOA 2HTFA 4OQXA 3LDGA 4JR0A 2VN8A 1T43A 4QU5A 1KMQA 1LVUA 2V4UA 3EZLA 3UT0A 5BR4A 3LQRA 3RHZA 4J1TC 2H4HA 3JPNA 2ZSAA 4MRVA 4NNPA 4RC9A 4DSOA 4MS4A 5B57C 4RIIA 4UCXA 4JUBA 2HA6A 5IBRA 2BFBA 1P2VA 1LB2B 3P26A 1FFAA 4LOJA 3UMBA 1Q7EA 4G6ZA 3BCRA 3TQFA 1TJ3A 1K6JA 1WP4A 3QMMA 3QX3A 4BQQA 2YS7A 4RLQA 3E3AA 5K05A 5DEOA 5HSGA 2YJNA 2Z3ZA