5L1MA

Caskin2 sam domain tandem
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
140
structure length
140
Chain Sequence
GKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKKIASEIAQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQKKLMLGVKRLAELRRGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caskin-2
publication title A new mode of SAM domain mediated oligomerization observed in the CASKIN2 neuronal scaffolding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 43
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5l1mA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5l1mA01
5L1MA 1X40A 3H8MA 3KKAA 1F0MA 2E8OA 1JI7A 1X66A 5JU5A 2FE9A 1V85A 1KW4A 2KG5A 2EAOA 2Y9TA 2LPEA 2D3DA 3BS5B 2F3NA 3HILA 4RQMA 2DKXA 2KIVA 2QARB 2EANA 1LKYB 2QB0B 5JRTA 5JTIA 4NL9A 1DXSA 2DKZA 5J8YA 2DL0A 3BS5A 1X9XA 3BQ7A 2GLEA 3BS7A 2K60A 2F44A 1V38A 1SGGA 2QARA 2LMRA 2QKQA 4PZNA 2E8MA 1WWVA 1LKYA 3SENA 2QB0A 1SV4A 4RQNA 4NJ8A 2YTUA 2D8CA 2L5YA 3SEIA 2ES6A 1SV0C 2KSOB 1SXDA 3TADC 1COKA 2EAPA 2B6GA 1Z1VA 1B4FA 4MHVA 2K4PA 1WWUA 2JV3A 1UCVA 3IDWA 1PK1B 1B0XA 4PZOA 1UQVA 2ESEA 2KMDA 2E8NA 5F3XB 2E8PA 2F8KA 2EAMA 1RG6A 1OXJA 2KSOA 4IS7A 1PK3A 2QB1A 3TACB 1PK1A 1OW5A 4NL9C 3KKAC 1SXEA 2KE7A 5J8YC 1SV0A 3K1RB 5KNIA 2Y9UA 3TADA
chains in the Genus database with same CATH superfamily
5EE1A 3THVA 4B9VA 5AKXA 1A76A 1XU4A 3F2BA 1JI7A 5J2HA 2FE9A 1ZQGA 1FEZA 4RQ3A 2HW3A 3RB4A 4B6JA 5T14A 4P0PB 2F76X 1B22A 3G6XA 3PW5A 3AL0B 3LWMA 1N5WA 1PVPA 3L3FX 4O9MA 4KX5A 3C2MA 5KAFU 3L5KA 3WK8A 1L3VA 4Z6CA 4PGXA 3TFSA 5KT2A 1Z19A 4C4TA 8ICCA 1U9LA 4EBDA 1ZQEA 4MEXA 1PZNA 1DGSA 4QZCA 4RPYA 4ED0A 1UT5A 1CI4A 4UARA 1M6YA 2HHUA 1XO1A 2H3FA 4AP9A 7ICQA 4EBCA 2J6SA 2C28A 2YB4A 4FBTA 3RJIA 2J6UA 2WAQC 1SL2A 2BGWA 2ZJ8A 1JRPA 2BDUA 3D6JA 4RNOA 1CEZA 3H0RB 1Z00B 1S0NA 4RNMA 4PL2A 2P66A 2I9GA 2F77X 4ZOHC 4KLOA 5J0YA 1COOA 3C29A 3MR3A 4DOBA 5D49A 2M9NA 8ICAA 3QUBA 3JPNA 4QIWF 5HP4A 2NRZA 5AM0A 3T5LA 9ICHA 2GOLA 3NS1A 2KE7A 5J8YC 5ALKA 1S97A 3TADA 2W8KA 1GO3F 1MN8A 3PW7A 1KRPA 2Q4TA 1HIWA 2E1FA 4Y2TA 1F0MA 2HHXA 4DL2A 3NUQA 3J81j 5ALIA 5ALXA 3MGIA 7ICNA 2LPEA 1TK8A 4F2SA 5KFUA 5AI0A 1L3UA 4RQ7A 2LYAA 4P0QA 4DL3A 4O3MA 5KFIA 9ICCA 5EE0A 2YMPA 1ZQXA 1U49A 3QU4A 2W3SA 4NL9A 4ED1A 1HEKA 3ETRA 4Y2UA 4U7CA 4C4SA 5KL8B 1UA1A 1AQ6A 3S6JA 2BKEA 4NLZA 5J0OA 3H0LB 2B21A 2HDOA 4J9SA 4RQNA 4EX7A 1KN5A 4BXOA 3Q8SB 1FFVA 3BZKA 4M9NA 9ICTA 4J9LA 3MABA 1RYUA 1KL9A 1B4FA 1L6NA 2K4PA 3CRXA 2JZBB 3IDWA 1PK1B 4F5OA 3OPXA 1MQ2A 4PZOA 4O3NA 4MFFA 3GDXA 5KFFA 2PFQA 4UB6U 4EX6A 2F8KA 1ZQRA 5AKJA 4QZAA 4DL7A 4NLKA 5DBBA 4C0ZA 1ZQQA 4FBUA 5DKWA 5J0QA 4C8NA 1O08A 3EZ5A 2XC9A 4F71A 1DK3A 4ECTA 1NI3A 3ZDCA 4JWMA 5CB1A 3ZDDA 9ICMA 3UXOA 1NK8A 1N61A 3CNHA 1OUQA 5KFLA 5J0TA 5KFPA 4TUQA 4M6WA 2F1IA 3Q8RB 5ALTA 7ICHA 4YR2A 1KFSA 5ALOA 2BQUA 2F3NA 3H0MB 3RRGA 1RQLA 3UXPA 5C0YA 5AKHA 2R8IA 2ZIXA 4J9QA 3ISDA 3AU2A 3SD7A 3QEBZ 5KFBA 4EENA 2N1RA 4KLQA 5J8YA 4B9TA 2KZ3A 3KHRA 2XGQA 5BPCA 3OSPA 1J97A 2W43A 3RAXA 2UVRA 2QB0A 4NLBA 5AKIA 8ICYA 3OJUA 3LVVA 2FMQA 4NM1A 2IA6A 4AYBF 2G07A 3SQIA 5B5EU 4I2GA 2JXJA 3BJYA 4F5QA 5KL1B 1ZJMA 2XCPA 9ICGA 2R8KA 2H3VA 3HW8A 1NJWA 4I2IA 3PY8A 5KTQA 7ICLA 1A6SA 2AU0A 1RG6A 1QLNA 8ICNA 2KSOA 2K8AA 7ICEA 5KFCA 1KFDA 1ZQYA 1V97A 2EZXA 2KD1A 2K4HA 3V6HA 3G6YA 2C2DA 4UAUA 4UAWA 5KT3A 2KFNA 3BQ1A 3IN5A 3RH5A 2G06A 3RBEA 3LVWA 3M6ZA 4FZMA 4OCZA 2KJ5A 5L1JA 3TANA 1N62A 2ZTEA 3HJEA 8ICOA 4UB5A 2BCUA 4UB2A 2PI4A 3N4MB 4C8LA 1T4GA 2OHFA 1Q3UA 1XO0A 4Q45A 4HYKA 4DQSA 2AGPA 2BCRA 4IQTA 2K8CB 3RF9A 4F50A 2AJQA 2KEYA 5DG9A 5J2KA 5CHGA 4YR3A 5J0WA 2QARB 3GQCA 2HI0A 2P35A 1TK0A 2BR0A 5KG4A 2VIXA 4F3OA 4K4HA 3ICXA 5ALGA 3WK9A 4ECVA 2GO7A 2GH1A 2HHTA 1DXSA 1SKWA 2BPCA 5J2BA 5KT6A 4Z6EA 1QH9A 1LKYA 3T5JA 2Y0SF 2ODGA 3Q8MA 4C8MA 4DSEA 4WJ3B 2RHFA 1XC9A 4DF8A 4QZ8A 2KNJA 4IL6U 1UT8A 3V7KA 2BQ3A 4M0AA 1XSLA 4DQQA 2HHQA 3QYPA 1YZ7A 3SR6A 1NZPA 2WB1F 1MQ3A 1ZOLA 3PMLA 3V6KA 2ESEA 3IG5A 2BZFA 5F3XB 2NRTA 2W54A 1NNLA 5DQGA 2KHVA 1KEJA 3M6KA 4C7ZA 4FZLA 5DDMA 3MR6A 4DCCA 2MUTA 5KG2A 5HMLA 5KFTA 3HRDD 3HKZC 2OH2A 4ICAA 5J0SA 1ZQNA 2JGAA 3N7SC 1RPLA 2ZUCA 2JR5A 2HSZA 3FYHA 3Q8KA 4DQPA 2MRLA 5DLGA 4ELVA 4M47A 4FZNA 4EBEA 3IP4B 4LZGA 4P0PA 5AI9A 4ECUA 5KFQA 2ZIUA 4NLCA 1UHUA 4RQ5A 1XS9D 2Y9TA 5AKLA 2W9AA 3HILA 4EZ6A 3EUB2 3R9KA 4JK1A 5AKGA 3TFRA 3NVZA 1J2MA 2KIWA 5ALMA 3H4BA 5IIMA 3ORYA 4CE6A 2NO4A 3FDSA 4OD0A 4O3OA 4R66A 5KFAA 2AGOA 4JB3A 3PW2A 7ICRA 5L1KA 1TKDA 2A1AA 4DFPA 4RQ6A 2E5SA 2GLEA 3K1ZA 1HJPA 4QZIA 3ZI4A 9ICSA 1RM6C 3PW4A 3C2LA 5FP0A 5KT4A 3LDAA 1BPYA 5DLFA 4PHEA 4IQUA 2ZIWB 5D46A 5EWEA 4R8UB 4QZGA 5CRXA 5AK4A 1JALA 1AROP 4XRHA 9ICKA 1RQNA 5JUMA 1L7OA 5HNKA 4RNNA 1D8YA 1ZQTA 4B9UA 3BDPA 3WKBA 1X6JA 5K4LA 4YMMA 3C5GA 4RQ0A 5EWFA 4RT3A 5DBCA 1O03A 4Q44A 1D8BA 3QU7A 5J0RA 2ZUDA 4RUCA 4KLMA 3RR7A 1Y88A 2GWSA 2R8GA 4RQ2A 1NKBA 2V9WA 2Y1IA 1OW5A 3D2NA 3PX6A 2JEFA 5KFGA 3TQ1A 5AK5A 4DSFA 2F8LA 2XGPA 5AI6A 2DBYA 2W11A 5L1MA 4QZHA 3RB3A 4OO1J 9ICWA 4DQIA 8ICSA 3SAFA 3PO4A 5KFSA 2E8OA 1XSNA 3OHAA 4X5VA 1P7DA 5G5GA 3LWLA 4JV2A 4DSJA 3MC1A 1KW4A 9ICEA 2DPIA 2P6UA 3BS5B 4YD1A 4IR9A 2WFAA 3FM9A 4YXJA 1C20A 2BQRA 3M1YA 3QU5A 2HBLA 4O3RA 5KFRA 1JXEA 4P4OA 2I6XA 4GC7A 2WF8A 2F1JA 5CWRA 5HR6A 4EEYA 3I1YA 4QZ9A 3U26A 1WG8A 3RRHA 4KLFA 1X9XA 3BS7A 1KKXA 4YN4A 2UVWA 5KFMA 3ZDEA 1ZQCA 1V38A 1K5OA 1ZETA 2PMZC 1WWVA 5BOLA 4UATA 1RDFA 1N5XA 4O5EA 5ALZA 1SV0C 1SXDA 4LVSA 2HHVA 1S0MA 2JZBA 2WF9A 8ICUA 2W9CA 3H8SA 4KITB 2AGQA 5EWGA 1DGJA 2KN7A 2LHTA 2E8NA 5GTHU 5AM1A 4KLGA 8ICEA 2YY6A 4M04A 5AM2A 1PK3A 4OJPA 3C28A 3V72A 3GV7B 3CW2C 1D9DA 1Z3EB 4M9LA 3KHGA 4KLLA 2IOFA 3H7IA 3MFIA 2JRZA 3JPTA 5KNIA 2LBOA 1KFTA 3MGVA 3H8MA 1ZQJA 2OWOA 9ICUA 1IV8A 1ZD5A 1N2XA 2KTQA 4F93B 1SKSA 1Z1BA 3QNMA 3PX4A 2KFZA 1KTQA 1S0VA 4RQMA 5L1IA 2DKXA 3RJGA 1NK6A 2HBJA 2EZYA 2W55A 1F5SA 4NM2A 1YZ6A 2ZUBA 2JH7A 4Y2JA 3WK6A 1ZQUA 2RP5A 7ICIA 2ATLA 2KV2A 4DWIA 2LYBA 2VANA 1UA0A 2MSNA 4CF3A 1IM4A 3PSFA 2LMRA 3T3FA 4KN7A 1NJYA 2HHWA 3OTQA 4ED8A 2L5YA 2BDPA 4NWIA 2KZMA 4KN4A 4Y2YA 1TVAA 4R63A 3Q8LA 4QJFB 3DEEA 2W7PA 4J9MA 1JX4A 1ZRMA 1TAQA 3V7JA 2HBKA 2KJ9A 4EYIB 3Q8PB 2DPJA 5AM4A 4IQVA 2E8PA 4O3QA 4UB3A 4J9KA 4F92B 4IR1A 2W03A 5AHXA 2XI9A 3MDAA 4ECWA 5AICA 3KBBA 1D8LA 2IBKA 4ECXA 5DDYA 3QUQA 4Y2SA 4YMOA 1Z4NA 2OEHA 5CR0A 7ICTA 5DQHA 5TZVA 2YMQA 4KMOB 3I28A 2E1EA 1VLBA 5AI4A 1SV0A 1QTMA 4OJ5A 2ZJAA 4KLDA 1N56A 4I2HA 1BPZA 3OGUA 1X40A 4F91B 8ICGA 1ZQFA 5IIKA 1NK0A 1S8OA 4Y2PA 8ICMA 4PHAA 3PO5A 1QQ7A 1J2NA 4B9SA 4UB4A 2XIDA 8ICZA 2EANA 4XUSA 2XO7A 2W7OA 1SWVA 1MC8A 1DOQA 5IIOA 4Y2RA 3RJJA 4CNQA 1Q46A 7ICPA 1RXVA 1JUDA 3M9NB 3NVVA 3MBYA 3JPQA 3RJFA 3PSIA 1SZHA 3NVWA 2PKEA 4C8OA 2DF4B 3C21A 4YXMA 3EPIA 4IRCA 5B66U 1TE2A 4R65A 4MHVA 4YG2A 2WF6A 3IM1A 1ZQZA 4BWJA 5KFWA 4GXJA 3HWTA 5ALHA 3KZIU 3H8JA 1JIHA 4A8EA 3NRWA 4IRDA 3B0XA 3C1YA 5DQIA 1SZPA 2F2AB 2ZIVB 1JMSA 4KX3A 3GV5B 3OJSA 4Z6DA 2ASJA 8ICRA 4DQRA 4BJQA 4QNLA 2W8LA 4YCXA 2C22A 4F8RA 2CPRA 3L4PA 4US8A 5KFVA 5KG5A 2KVCA 2HOIA 1ZQOA 5EOZA 4Q8EA 3N28A 4UAZA 1TAMA 3F5AA 4JV0A 4P0QB 2C2EA 1X66A 4ACOA 3HKZF 2H3ZA 5AKEA 2AQ0A 9ICNA 2LYHA 4F5PA 4EEKA 3MFHA 1JN3A 2G0AA 3QEAZ 3RR8A 3RAQA 2FMPA 4E0DA 5KFXA 4KLIA 4OJ6A 2W04A 3RBDA 3NRZA 8ICJA 2KOBA 4QWEA 3PNCA 1LVHA 2K8BB 4TQSA 4XQ8A 1T94A 3T5KA 2FLNA 3PZPA 3TAQA 4Y2XA 3QUCA 4YP3A 5CJ7A 3D2SA 1WUDA 2ISPA 2ZIWA 2YTUA 1Z4OA 2D8CA 2HOFA 1QCKA 5AIBA 3PX0A 5KG1A 3FAHA 1WWUA 5J0UA 4CGZA 3M8SA 3MR5A 4P2HA 4GIBA 2PI5A 3E2EA 2W9BB 2ALZA 3GILA 4TQRA 4DSKA 3GIKA 1L8OA 5J2IA 2H5XA 1T3NA 5IIJA 2BCSA 5CP2A 2PFPA 4M6WB 2O6KA 5C5JA 5F9LA 4DLEA 2K89A 5J2CA 5AKKA 2PFNA 2G08A 2ZXIA 5KG7A 7ICVA 5KFDA 5G5HA 3CYMA 4Y2VA 1U47A 2ISOA 5KFNA 3T5HA 4DFJA 2YX8A 5J29A 2NRVA 1KSPA 4JV1A 2ZIXB 2Y1JA 1QQ5A 1XWLA 4J9RA 4KLSA 4K4GA 3JPPA 5ALLA 4DLGA 2UVUA 2BPGA 2KVSA 1PUZA 3RJEA 3SAHA 2I5HA 2R8JA 2KIVA 7ICMA 4YVZA 3V7LA 4C80A 2JH1A 4IQWA 4DFMA 4F4YA 2QB0B 8ICBA 1K1SA 4R64A 3SI8A 5JTIA 3AUOA 2VKQA 4RPZA 2HOQA 4CF4A 4I27A 4GXKA 2DGZA 3QE9Y 1RYRA 1RXWA 1QSLA 4RUAA 2ZTCA 4QWCA 3JPRA 2KSOB 2FLLA 1V9PA 3PR5B 3F53A 5CA7A 3NGDA 5H2FU 2YB1A 4ECQA 2JMGA 4GFJA 5GTIU 4UAYA 2K4EA 2WF7A 3DV9A 2YQEA 4GC6A 3M7DA 4BWMA 1FO4A 1MSWD 1B0XA 1WCLA 1L7PA 4I2JA 2EAMA 5AKZA 1CUKA 4F4XA 2XICA 1K1QA 1MA7A 1NK5A 5J0PA 3CP8A 3MGHA 4G9BA 3TI0A 2XY5A 2A3VA 4PL1A 4UB8U 3GIMA 2V4RA 2Q0ZX 4BGDA 3PMNA 2DFLA 1Z00A 4C7YA 1ZQVA 5AM5A 3C2KA 1YT3A 2G5IB 5ALVA 1SB3C 9ICQA 1WYGA 4M9JA 5AIAA 5JU5A 3ZD8A 1PVRA 4QZDA 4Y2QA 3BQ0A 4FFDA 2EDUA 3ZD9A 4MF2A 4NLGA 2EAOA 3LYSA 2PXIA 2K4IA 5AKYA 4NXZA 3ISCA 3QU9A 4EZ9A 2WAQF 1S10A 3H8WA 3TKAA 4ECRA 3E0FA 1ZQSA 2LM4A 1TAUA 1LKYB 2CN1A 3QZ7A 4Z6FA 1X2IA 3EWAA 4BUGA 2DL0A 1RZTA 2F44A 1U48A 3K4GA 2J6TA 4JMUA 4O5KA 4PPXA 3N97B 2OYYA 3QUTA 3RFAA 2FPLA 1PVQA 2HHSA 5ALNA 5J2JA 3PR4A 5KT5A 4DFKA 5DG7A 2B6GA 9ICXA 1Z1VA 4I28A 2JHDA 4PHDA 1ZXIA 1NKCA 4I2DA 2NO5A 4DOAA 4RU9A 4O5CA 2MA1A 3F2CA 5DGBA 2A1JB 3RJKA 3KZXA 4P4MA 2AQ4A 3RH6A 1L8LA 3RH4A 1ZQBA 5EE3A 3TACB 4EYHB 2WF5A 4US9A 4C4RA 1PK1A 2UVVA 2ZIUB 1ZQKA 5A0LA 2Y9UA 1ZQIA 1XSPA 5J2GA 5IILA 2VJ4A 2BCVA 2VJ5A 3QU2A 2B0CA 2FI1A 1V85A 4CDGA 1KDHA 4YFKA 3F5EA 4J03A 9ICPA 4UBCA 2XY6A 3H40A 2CXYA 1QQ6A 2VA3A 8ICXA 4MEYA 2PFOA 4NLNA 1EXNA 3IHQB 3E58A 1F44A 5AM3A 4K4IA 2ASDA 1UPHA 3QZ8A 5TISU 4YMNA 1L7NA 2K60A 8ICWA 4B9NA 2JEIA 3BQTA 7ICGA 1T8EA 3GU3A 4I2FA 4DL4A 1S76D 1ZQHA 3SEIA 5DG8A 5HMMA 3EPGA 4USAA 2FLPA 5KG0A 1COKA 3M9MB 2ZTDA 3WK4A 5J2FA 3GV8B 2E3TA 1Q3VA 3N7PD 2ZJ5A 2NYVA 4JWNA 1S77D 5DB8A 4KLHA 1UQVA 5KFEA 3ONNA 4GXIA 9ICFA 3ISBA 4Q8FA 1OXJA 4ZH4A 4FO6A 2ZIVA 4F5NA 2KICA 5KAIU 4I2BA 7ICKA 3IG8A 4DF4A 4F4ZA 1ECWA 5KFZA 1BPDA 2QB1A 4O0IA 4JUZA 1WCNA 3ED5A 2KKPA 2NRWA 4PHPA 1VJ5A 5KFHA 1NK7A 7ICUA 4KTQA 4QW9A 2HBMA 4FS2A 4PGQA 7ICJA 2R18A 3KKAA 9ICAA 4F5RA 4QZBA 3TARA 2FMSA 2EZZA 5DBAA 4I2CA 5AK6A 3C5FA 4I29A 3AU6A 3WK7A 4OJOA 1QSYA 2H3IA 1C7YA 1U4BA 1ED1A 1S0OA 4NV0A 3AM9A 4KLEA 3M8RA 3PV8A 2QARA 2W9CB 2KZZA 2QKQA 2VA2A 3AMZA 1SV4A 1LV5A 1ZQDA 5IINA 4TURA 4QWDA 4RQ4A 2RDIA 2AXTU 4QIWC 3QXGA 4GLXA 1CRXA 2IMWP 3B0YA 3I76A 2FJ6A 9ICBA 2MU2A 4M2YA 1ZJNA 5ALRA 4YD2A 2W9BA 1NK4A 4QW8A 5KFYA 2HCFA 2KMDA 2OM6A 3KHHA 3HP6A 3LK9A 3UMCA 3O0FA 5DGAA 5ALJA 3OHBA 4PH5A 2C2RA 1ZQLA 4ED2A 5KG3A 1D9FA 8ICQA 4U6PA 4ECYA 1IXRA 2IOFK 4LZDA 9ICIA 1X9SA 1NJXA 3TAPA 1KBUA 4C8KA 3N7RC 1SWWA 3MDCA 2OXOA 4MF8A 1ZQAA 4CF5A 1VDVA 2BPFA 3H4DA 2LKYA 1ZQWA 2RRDA 2LM1A 3K1RB 3WKEA 2DUYA 2EH9A 1L7MA 1NK9A 1NJZA 8ICTA 4MFAA 1IIPA 3PSPA 5J2EA 4ED7A 4ED6A 3IRUA 1RYSA 3ETLA 4QWBA 2AHOB 2D6FC 2RDJA 2BCQA 2IHMA 3BQ2A 5IIIA 4FS1A 4KLTA 1TK5A 4ECZA 1HUOA 5AI8A 4G3IA 1L5UA 3HX0A 1SL0A 4NY8A 3GZFA 4FE3A 3PSTA 4RT2A 3V6JA 1QSSA 3M9OB 2BHNA 3UPQA 3KOOA 3A0BU 4DEZA 1SKRA 1SIJA 3NTUA 1X9MA 8ICHA 4BDPA 2KK0A 5ALDA 4PZNA 3JPOA 2H3QA 5ALPA 4M9GA 3AEVA 4O3PA 4DL6A 2MAXA 2ES6A 4BXOB 4DSLA 7ICOA 4DOCA 2WTFA 4UAVA 5KFOA 2EAPA 2KP7A 4YR0A 2W3RA 4TUPA 1KQQA 3C1ZA 3GFKB 3AQEA 3HPOA 1UCVA 2HVHA 4XA5A 3GIJA 4PGYA 2FPKA 3OSNA 2KJ8A 5ALSA 4IRKA 8ICIA 4RZRA 3EYZA 5ALQA 4R8UA 2R8HA 2EQYA 1BVSA 3F2DA 3HT3A 4RPXA 5DB9A 4DS5A 7ICSA 3AN1A 2QLTA 3SMVA 4BX9C 3SYZA 4OJLA 3VC8A 4EELA 3KTQA 3MR2A 2JEJA 3ZDBA 5BOMA 2VA8A 5AK3A 4ECSA 3Q8QB 5AI5A 1DK2A 5ALYA 2KG5A 1S9FA 2D3DA 3ZDAA 2V4QA 3A0HU 3FC4A 3PVXA 3B9JA 1KLNA 4O3SA 3NASA 2I1QA 5HR7A 5HHHA 8ICFA 5J2DA 3RB0A 4KLJA 3WKAA 1SL1A 4AYBC 3KHLA 5JRTA 1ZD2P 3UMGA 7ICFA 3VCBA 2F1HA 5DB7A 9ICLA 4F2RA 3BS5A 4UB1A 3BQ7A 1JXLA 4B9MA 3WKDA 1BPBA 5KFJA 4F4WA 1X42A 8ICLA 3SV4A 2HMXA 2E8MA 2G09A 4UW9A 1LB2B 3SENA 4KLUA 9ICOA 1ZD3A 2CRXA 9ICVA 1TFRA 2A19A 2RLTA 2P6RA 3G6VA 1NKEA 1BNPA 4J9PA 5L1LA 1ZYQA 4QZEA 5HHIA 2Z7JA 4PJ0U 2HVIA 2DWQA 3K75D 4UASA 1JROA 4ELTA 2JV3A 2YMLA 2XVTA 2ZG6A 1NZBA 4I2AA 2W9MA 4CRXA 5ALFA 9ICRA 2A1JA 3SV3A 1T7PA 3IV6A 3UQ2A 4IS7A 4I2EA 2FPMA 1L3TA 4DO9A 4F4KA 1N63A 4YQWA 9ICJA 4ELUA 1ZQ1C 2FDRA 5E79U 3UM9A 4CCHA 2LI6A 4HAIA 2IHNA 5L9XA 1N48A 3RJHA 3ALRA 4Q43A 4RQ1A 4UBBA 8ICKA 2PMZF 3SZ2A 1NOMA 4IC9A 3UXNA 2YMMA 5D4BA 5KFKA 5ALUA 4UQGA 2WHEA 1ZQMA 1H38A 2ASLA 3KFUF 1X9WA 5KT7A 1XNSA 3EW9A 2DQNB 3UQ0A 5CEHA 3RTVA 8ICVA 1ZQPA 5J0XA 2NV3A 1HUZA 2Y0SC 4LJXA 4TUSA 2M0NA 4DS4A 1BGXT 1A0PA 4P4PA 1N60A 1S5LU 1T3QA 2JEGA 1BPEA 1DRGA 2DKZA 4QZFA 1TV9A 1B43A 3WKCA 4MFCA 4DSIA 2RQ5A 2IOHA 2WB1C 2G5HB 4DL5A 1SGGA 5DB6A 8ICPA 4B9LA 1BNOA 3NVYA 4DFDA 4RQ8A 4M9HA 2XY7A 4NJ8A 1X6IA 4J9NA 2YN4A 2AH5A 1ZRNA 1IG6A 3SAGA 4ED3A 3RB6A 3T79A 4KMUA 3AQFA 3TADC 4F72A 4QWAA 1FFUA 3JPSA 3GIIA 5EE9A 3C23A 2OCEA 1L3SA 3WU2U 3KD3A 2NRXA 1URJA 1ZD4A 3WK5A 1BPXA 3D2QA 1U45A 2KHQA 1Q8KA 4J9OA 1A77A 3QX7A 5KG6A 2KKVA 2MUTB 3BZCA 2ZXHA 5ALEA 5J2AA 1FIQA 3PW0A 2XCAA 4NL9C 3UMBA 3KKAC 1SXEA 3DDHA 5F9NA 5ALWA
chains in the Genus database with same CATH topology
5L1MA 1X40A 3H8MA 3KKAA 1F0MA 2E8OA 1JI7A 1X66A 5JU5A 2FE9A 1V85A 1KW4A 2KG5A 2EAOA 2Y9TA 2LPEA 2D3DA 3BS5B 2F3NA 3HILA 4RQMA 2DKXA 2KIVA 2QARB 2EANA 1LKYB 2QB0B 5JRTA 5JTIA 4NL9A 1DXSA 2DKZA 5J8YA 2DL0A 3BS5A 1X9XA 3BQ7A 2GLEA 3BS7A 2K60A 2F44A 1V38A 1SGGA 2QARA 2LMRA 2QKQA 4PZNA 2E8MA 1WWVA 1LKYA 3SENA 2QB0A 1SV4A 4RQNA 4NJ8A 2YTUA 2D8CA 2L5YA 3SEIA 2ES6A 1SV0C 2KSOB 1SXDA 3TADC 1COKA 2EAPA 2B6GA 1Z1VA 1B4FA 4MHVA 2K4PA 1WWUA 2JV3A 1UCVA 3IDWA 1PK1B 1B0XA 4PZOA 1UQVA 2ESEA 2KMDA 2E8NA 5F3XB 2E8PA 2F8KA 2EAMA 1RG6A 1OXJA 2KSOA 4IS7A 1PK3A 2QB1A 3TACB 1PK1A 1OW5A 4NL9C 3KKAC 1SXEA 2KE7A 5J8YC 1SV0A 3K1RB 5KNIA 2Y9UA 3TADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L1M A;  1X40 A;  3H8M A;  3KKA A;  1F0M A;  2E8O A;  1JI7 A;  1X66 A;  5JU5 A;  2FE9 A;  1V85 A;  1KW4 A;  2KG5 A;  2EAO A;  2Y9T A;  2LPE A;  2D3D A;  3BS5 B;  2F3N A;  3HIL A;  4RQM A;  2DKX A;  2KIV A;  2QAR B;  2EAN A;  1LKY B;  2QB0 B;  5JRT A;  5JTI A;  4NL9 A;  1DXS A;  2DKZ A;  5J8Y A;  2DL0 A;  3BS5 A;  1X9X A;  3BQ7 A;  2GLE A;  3BS7 A;  2K60 A;  2F44 A;  1V38 A;  1SGG A;  2QAR A;  2LMR A;  2QKQ A;  4PZN A;  2E8M A;  1WWV A;  1LKY A;  3SEN A;  2QB0 A;  1SV4 A;  4RQN A;  4NJ8 A;  2YTU A;  2D8C A;  2L5Y A;  3SEI A;  2ES6 A;  1SV0 C;  2KSO B;  1SXD A;  3TAD C;  1COK A;  2EAP A;  2B6G A;  1Z1V A;  1B4F A;  4MHV A;  2K4P A;  1WWU A;  2JV3 A;  1UCV A;  3IDW A;  1PK1 B;  1B0X A;  4PZO A;  1UQV A;  2ESE A;  2KMD A;  2E8N A;  5F3X B;  2E8P A;  2F8K A;  2EAM A;  1RG6 A;  1OXJ A;  2KSO A;  4IS7 A;  1PK3 A;  2QB1 A;  3TAC B;  1PK1 A;  1OW5 A;  4NL9 C;  3KKA C;  1SXE A;  2KE7 A;  5J8Y C;  1SV0 A;  3K1R B;  5KNI A;  2Y9U A;  3TAD A; 
#chains in the Genus database with same CATH topology
 5EE1 A;  3THV A;  4B9V A;  5AKX A;  1A76 A;  1XU4 A;  3F2B A;  1JI7 A;  5J2H A;  2FE9 A;  1ZQG A;  1FEZ A;  4RQ3 A;  2HW3 A;  3RB4 A;  4B6J A;  5T14 A;  4P0P B;  2F76 X;  1B22 A;  3G6X A;  3PW5 A;  3AL0 B;  3LWM A;  1N5W A;  1PVP A;  3L3F X;  4O9M A;  4KX5 A;  3C2M A;  5KAF U;  3L5K A;  3WK8 A;  1L3V A;  4Z6C A;  4PGX A;  3TFS A;  5KT2 A;  1Z19 A;  4C4T A;  8ICC A;  1U9L A;  4EBD A;  1ZQE A;  4MEX A;  1PZN A;  1DGS A;  4QZC A;  4RPY A;  4ED0 A;  1UT5 A;  1CI4 A;  4UAR A;  1M6Y A;  2HHU A;  1XO1 A;  2H3F A;  4AP9 A;  7ICQ A;  4EBC A;  2J6S A;  2C28 A;  2YB4 A;  4FBT A;  3RJI A;  2J6U A;  2WAQ C;  1SL2 A;  2BGW A;  2ZJ8 A;  1JRP A;  2BDU A;  3D6J A;  4RNO A;  1CEZ A;  3H0R B;  1Z00 B;  1S0N A;  4RNM A;  4PL2 A;  2P66 A;  2I9G A;  2F77 X;  4ZOH C;  4KLO A;  5J0Y A;  1COO A;  3C29 A;  3MR3 A;  4DOB A;  5D49 A;  2M9N A;  8ICA A;  3QUB A;  3JPN A;  4QIW F;  5HP4 A;  2NRZ A;  5AM0 A;  3T5L A;  9ICH A;  2GOL A;  3NS1 A;  2KE7 A;  5J8Y C;  5ALK A;  1S97 A;  3TAD A;  2W8K A;  1GO3 F;  1MN8 A;  3PW7 A;  1KRP A;  2Q4T A;  1HIW A;  2E1F A;  4Y2T A;  1F0M A;  2HHX A;  4DL2 A;  3NUQ A;  3J81 j;  5ALI A;  5ALX A;  3MGI A;  7ICN A;  2LPE A;  1TK8 A;  4F2S A;  5KFU A;  5AI0 A;  1L3U A;  4RQ7 A;  2LYA A;  4P0Q A;  4DL3 A;  4O3M A;  5KFI A;  9ICC A;  5EE0 A;  2YMP A;  1ZQX A;  1U49 A;  3QU4 A;  2W3S A;  4NL9 A;  4ED1 A;  1HEK A;  3ETR A;  4Y2U A;  4U7C A;  4C4S A;  5KL8 B;  1UA1 A;  1AQ6 A;  3S6J A;  2BKE A;  4NLZ A;  5J0O A;  3H0L B;  2B21 A;  2HDO A;  4J9S A;  4RQN A;  4EX7 A;  1KN5 A;  4BXO A;  3Q8S B;  1FFV A;  3BZK A;  4M9N A;  9ICT A;  4J9L A;  3MAB A;  1RYU A;  1KL9 A;  1B4F A;  1L6N A;  2K4P A;  3CRX A;  2JZB B;  3IDW A;  1PK1 B;  4F5O A;  3OPX A;  1MQ2 A;  4PZO A;  4O3N A;  4MFF A;  3GDX A;  5KFF A;  2PFQ A;  4UB6 U;  4EX6 A;  2F8K A;  1ZQR A;  5AKJ A;  4QZA A;  4DL7 A;  4NLK A;  5DBB A;  4C0Z A;  1ZQQ A;  4FBU A;  5DKW A;  5J0Q A;  4C8N A;  1O08 A;  3EZ5 A;  2XC9 A;  4F71 A;  1DK3 A;  4ECT A;  1NI3 A;  3ZDC A;  4JWM A;  5CB1 A;  3ZDD A;  9ICM A;  3UXO A;  1NK8 A;  1N61 A;  3CNH A;  1OUQ A;  5KFL A;  5J0T A;  5KFP A;  4TUQ A;  4M6W A;  2F1I A;  3Q8R B;  5ALT A;  7ICH A;  4YR2 A;  1KFS A;  5ALO A;  2BQU A;  2F3N A;  3H0M B;  3RRG A;  1RQL A;  3UXP A;  5C0Y A;  5AKH A;  2R8I A;  2ZIX A;  4J9Q A;  3ISD A;  3AU2 A;  3SD7 A;  3QEB Z;  5KFB A;  4EEN A;  2N1R A;  4KLQ A;  5J8Y A;  4B9T A;  2KZ3 A;  3KHR A;  2XGQ A;  5BPC A;  3OSP A;  1J97 A;  2W43 A;  3RAX A;  2UVR A;  2QB0 A;  4NLB A;  5AKI A;  8ICY A;  3OJU A;  3LVV A;  2FMQ A;  4NM1 A;  2IA6 A;  4AYB F;  2G07 A;  3SQI A;  5B5E U;  4I2G A;  2JXJ A;  3BJY A;  4F5Q A;  5KL1 B;  1ZJM A;  2XCP A;  9ICG A;  2R8K A;  2H3V A;  3HW8 A;  1NJW A;  4I2I A;  3PY8 A;  5KTQ A;  7ICL A;  1A6S A;  2AU0 A;  1RG6 A;  1QLN A;  8ICN A;  2KSO A;  2K8A A;  7ICE A;  5KFC A;  1KFD A;  1ZQY A;  1V97 A;  2EZX A;  2KD1 A;  2K4H A;  3V6H A;  3G6Y A;  2C2D A;  4UAU A;  4UAW A;  5KT3 A;  2KFN A;  3BQ1 A;  3IN5 A;  3RH5 A;  2G06 A;  3RBE A;  3LVW A;  3M6Z A;  4FZM A;  4OCZ A;  2KJ5 A;  5L1J A;  3TAN A;  1N62 A;  2ZTE A;  3HJE A;  8ICO A;  4UB5 A;  2BCU A;  4UB2 A;  2PI4 A;  3N4M B;  4C8L A;  1T4G A;  2OHF A;  1Q3U A;  1XO0 A;  4Q45 A;  4HYK A;  4DQS A;  2AGP A;  2BCR A;  4IQT A;  2K8C B;  3RF9 A;  4F50 A;  2AJQ A;  2KEY A;  5DG9 A;  5J2K A;  5CHG A;  4YR3 A;  5J0W A;  2QAR B;  3GQC A;  2HI0 A;  2P35 A;  1TK0 A;  2BR0 A;  5KG4 A;  2VIX A;  4F3O A;  4K4H A;  3ICX A;  5ALG A;  3WK9 A;  4ECV A;  2GO7 A;  2GH1 A;  2HHT A;  1DXS A;  1SKW A;  2BPC A;  5J2B A;  5KT6 A;  4Z6E A;  1QH9 A;  1LKY A;  3T5J A;  2Y0S F;  2ODG A;  3Q8M A;  4C8M A;  4DSE A;  4WJ3 B;  2RHF A;  1XC9 A;  4DF8 A;  4QZ8 A;  2KNJ A;  4IL6 U;  1UT8 A;  3V7K A;  2BQ3 A;  4M0A A;  1XSL A;  4DQQ A;  2HHQ A;  3QYP A;  1YZ7 A;  3SR6 A;  1NZP A;  2WB1 F;  1MQ3 A;  1ZOL A;  3PML A;  3V6K A;  2ESE A;  3IG5 A;  2BZF A;  5F3X B;  2NRT A;  2W54 A;  1NNL A;  5DQG A;  2KHV A;  1KEJ A;  3M6K A;  4C7Z A;  4FZL A;  5DDM A;  3MR6 A;  4DCC A;  2MUT A;  5KG2 A;  5HML A;  5KFT A;  3HRD D;  3HKZ C;  2OH2 A;  4ICA A;  5J0S A;  1ZQN A;  2JGA A;  3N7S C;  1RPL A;  2ZUC A;  2JR5 A;  2HSZ A;  3FYH A;  3Q8K A;  4DQP A;  2MRL A;  5DLG A;  4ELV A;  4M47 A;  4FZN A;  4EBE A;  3IP4 B;  4LZG A;  4P0P A;  5AI9 A;  4ECU A;  5KFQ A;  2ZIU A;  4NLC A;  1UHU A;  4RQ5 A;  1XS9 D;  2Y9T A;  5AKL A;  2W9A A;  3HIL A;  4EZ6 A;  3EUB 2;  3R9K A;  4JK1 A;  5AKG A;  3TFR A;  3NVZ A;  1J2M A;  2KIW A;  5ALM A;  3H4B A;  5IIM A;  3ORY A;  4CE6 A;  2NO4 A;  3FDS A;  4OD0 A;  4O3O A;  4R66 A;  5KFA A;  2AGO A;  4JB3 A;  3PW2 A;  7ICR A;  5L1K A;  1TKD A;  2A1A A;  4DFP A;  4RQ6 A;  2E5S A;  2GLE A;  3K1Z A;  1HJP A;  4QZI A;  3ZI4 A;  9ICS A;  1RM6 C;  3PW4 A;  3C2L A;  5FP0 A;  5KT4 A;  3LDA A;  1BPY A;  5DLF A;  4PHE A;  4IQU A;  2ZIW B;  5D46 A;  5EWE A;  4R8U B;  4QZG A;  5CRX A;  5AK4 A;  1JAL A;  1ARO P;  4XRH A;  9ICK A;  1RQN A;  5JUM A;  1L7O A;  5HNK A;  4RNN A;  1D8Y A;  1ZQT A;  4B9U A;  3BDP A;  3WKB A;  1X6J A;  5K4L A;  4YMM A;  3C5G A;  4RQ0 A;  5EWF A;  4RT3 A;  5DBC A;  1O03 A;  4Q44 A;  1D8B A;  3QU7 A;  5J0R A;  2ZUD A;  4RUC A;  4KLM A;  3RR7 A;  1Y88 A;  2GWS A;  2R8G A;  4RQ2 A;  1NKB A;  2V9W A;  2Y1I A;  1OW5 A;  3D2N A;  3PX6 A;  2JEF A;  5KFG A;  3TQ1 A;  5AK5 A;  4DSF A;  2F8L A;  2XGP A;  5AI6 A;  2DBY A;  2W11 A;  5L1M A;  4QZH A;  3RB3 A;  4OO1 J;  9ICW A;  4DQI A;  8ICS A;  3SAF A;  3PO4 A;  5KFS A;  2E8O A;  1XSN A;  3OHA A;  4X5V A;  1P7D A;  5G5G A;  3LWL A;  4JV2 A;  4DSJ A;  3MC1 A;  1KW4 A;  9ICE A;  2DPI A;  2P6U A;  3BS5 B;  4YD1 A;  4IR9 A;  2WFA A;  3FM9 A;  4YXJ A;  1C20 A;  2BQR A;  3M1Y A;  3QU5 A;  2HBL A;  4O3R A;  5KFR A;  1JXE A;  4P4O A;  2I6X A;  4GC7 A;  2WF8 A;  2F1J A;  5CWR A;  5HR6 A;  4EEY A;  3I1Y A;  4QZ9 A;  3U26 A;  1WG8 A;  3RRH A;  4KLF A;  1X9X A;  3BS7 A;  1KKX A;  4YN4 A;  2UVW A;  5KFM A;  3ZDE A;  1ZQC A;  1V38 A;  1K5O A;  1ZET A;  2PMZ C;  1WWV A;  5BOL A;  4UAT A;  1RDF A;  1N5X A;  4O5E A;  5ALZ A;  1SV0 C;  1SXD A;  4LVS A;  2HHV A;  1S0M A;  2JZB A;  2WF9 A;  8ICU A;  2W9C A;  3H8S A;  4KIT B;  2AGQ A;  5EWG A;  1DGJ A;  2KN7 A;  2LHT A;  2E8N A;  5GTH U;  5AM1 A;  4KLG A;  8ICE A;  2YY6 A;  4M04 A;  5AM2 A;  1PK3 A;  4OJP A;  3C28 A;  3V72 A;  3GV7 B;  3CW2 C;  1D9D A;  1Z3E B;  4M9L A;  3KHG A;  4KLL A;  2IOF A;  3H7I A;  3MFI A;  2JRZ A;  3JPT A;  5KNI A;  2LBO A;  1KFT A;  3MGV A;  3H8M A;  1ZQJ A;  2OWO A;  9ICU A;  1IV8 A;  1ZD5 A;  1N2X A;  2KTQ A;  4F93 B;  1SKS A;  1Z1B A;  3QNM A;  3PX4 A;  2KFZ A;  1KTQ A;  1S0V A;  4RQM A;  5L1I A;  2DKX A;  3RJG A;  1NK6 A;  2HBJ A;  2EZY A;  2W55 A;  1F5S A;  4NM2 A;  1YZ6 A;  2ZUB A;  2JH7 A;  4Y2J A;  3WK6 A;  1ZQU A;  2RP5 A;  7ICI A;  2ATL A;  2KV2 A;  4DWI A;  2LYB A;  2VAN A;  1UA0 A;  2MSN A;  4CF3 A;  1IM4 A;  3PSF A;  2LMR A;  3T3F A;  4KN7 A;  1NJY A;  2HHW A;  3OTQ A;  4ED8 A;  2L5Y A;  2BDP A;  4NWI A;  2KZM A;  4KN4 A;  4Y2Y A;  1TVA A;  4R63 A;  3Q8L A;  4QJF B;  3DEE A;  2W7P A;  4J9M A;  1JX4 A;  1ZRM A;  1TAQ A;  3V7J A;  2HBK A;  2KJ9 A;  4EYI B;  3Q8P B;  2DPJ A;  5AM4 A;  4IQV A;  2E8P A;  4O3Q A;  4UB3 A;  4J9K A;  4F92 B;  4IR1 A;  2W03 A;  5AHX A;  2XI9 A;  3MDA A;  4ECW A;  5AIC A;  3KBB A;  1D8L A;  2IBK A;  4ECX A;  5DDY A;  3QUQ A;  4Y2S A;  4YMO A;  1Z4N A;  2OEH A;  5CR0 A;  7ICT A;  5DQH A;  5TZV A;  2YMQ A;  4KMO B;  3I28 A;  2E1E A;  1VLB A;  5AI4 A;  1SV0 A;  1QTM A;  4OJ5 A;  2ZJA A;  4KLD A;  1N56 A;  4I2H A;  1BPZ A;  3OGU A;  1X40 A;  4F91 B;  8ICG A;  1ZQF A;  5IIK A;  1NK0 A;  1S8O A;  4Y2P A;  8ICM A;  4PHA A;  3PO5 A;  1QQ7 A;  1J2N A;  4B9S A;  4UB4 A;  2XID A;  8ICZ A;  2EAN A;  4XUS A;  2XO7 A;  2W7O A;  1SWV A;  1MC8 A;  1DOQ A;  5IIO A;  4Y2R A;  3RJJ A;  4CNQ A;  1Q46 A;  7ICP A;  1RXV A;  1JUD A;  3M9N B;  3NVV A;  3MBY A;  3JPQ A;  3RJF A;  3PSI A;  1SZH A;  3NVW A;  2PKE A;  4C8O A;  2DF4 B;  3C21 A;  4YXM A;  3EPI A;  4IRC A;  5B66 U;  1TE2 A;  4R65 A;  4MHV A;  4YG2 A;  2WF6 A;  3IM1 A;  1ZQZ A;  4BWJ A;  5KFW A;  4GXJ A;  3HWT A;  5ALH A;  3KZI U;  3H8J A;  1JIH A;  4A8E A;  3NRW A;  4IRD A;  3B0X A;  3C1Y A;  5DQI A;  1SZP A;  2F2A B;  2ZIV B;  1JMS A;  4KX3 A;  3GV5 B;  3OJS A;  4Z6D A;  2ASJ A;  8ICR A;  4DQR A;  4BJQ A;  4QNL A;  2W8L A;  4YCX A;  2C22 A;  4F8R A;  2CPR A;  3L4P A;  4US8 A;  5KFV A;  5KG5 A;  2KVC A;  2HOI A;  1ZQO A;  5EOZ A;  4Q8E A;  3N28 A;  4UAZ A;  1TAM A;  3F5A A;  4JV0 A;  4P0Q B;  2C2E A;  1X66 A;  4ACO A;  3HKZ F;  2H3Z A;  5AKE A;  2AQ0 A;  9ICN A;  2LYH A;  4F5P A;  4EEK A;  3MFH A;  1JN3 A;  2G0A A;  3QEA Z;  3RR8 A;  3RAQ A;  2FMP A;  4E0D A;  5KFX A;  4KLI A;  4OJ6 A;  2W04 A;  3RBD A;  3NRZ A;  8ICJ A;  2KOB A;  4QWE A;  3PNC A;  1LVH A;  2K8B B;  4TQS A;  4XQ8 A;  1T94 A;  3T5K A;  2FLN A;  3PZP A;  3TAQ A;  4Y2X A;  3QUC A;  4YP3 A;  5CJ7 A;  3D2S A;  1WUD A;  2ISP A;  2ZIW A;  2YTU A;  1Z4O A;  2D8C A;  2HOF A;  1QCK A;  5AIB A;  3PX0 A;  5KG1 A;  3FAH A;  1WWU A;  5J0U A;  4CGZ A;  3M8S A;  3MR5 A;  4P2H A;  4GIB A;  2PI5 A;  3E2E A;  2W9B B;  2ALZ A;  3GIL A;  4TQR A;  4DSK A;  3GIK A;  1L8O A;  5J2I A;  2H5X A;  1T3N A;  5IIJ A;  2BCS A;  5CP2 A;  2PFP A;  4M6W B;  2O6K A;  5C5J A;  5F9L A;  4DLE A;  2K89 A;  5J2C A;  5AKK A;  2PFN A;  2G08 A;  2ZXI A;  5KG7 A;  7ICV A;  5KFD A;  5G5H A;  3CYM A;  4Y2V A;  1U47 A;  2ISO A;  5KFN A;  3T5H A;  4DFJ A;  2YX8 A;  5J29 A;  2NRV A;  1KSP A;  4JV1 A;  2ZIX B;  2Y1J A;  1QQ5 A;  1XWL A;  4J9R A;  4KLS A;  4K4G A;  3JPP A;  5ALL A;  4DLG A;  2UVU A;  2BPG A;  2KVS A;  1PUZ A;  3RJE A;  3SAH A;  2I5H A;  2R8J A;  2KIV A;  7ICM A;  4YVZ A;  3V7L A;  4C80 A;  2JH1 A;  4IQW A;  4DFM A;  4F4Y A;  2QB0 B;  8ICB A;  1K1S A;  4R64 A;  3SI8 A;  5JTI A;  3AUO A;  2VKQ A;  4RPZ A;  2HOQ A;  4CF4 A;  4I27 A;  4GXK A;  2DGZ A;  3QE9 Y;  1RYR A;  1RXW A;  1QSL A;  4RUA A;  2ZTC A;  4QWC A;  3JPR A;  2KSO B;  2FLL A;  1V9P A;  3PR5 B;  3F53 A;  5CA7 A;  3NGD A;  5H2F U;  2YB1 A;  4ECQ A;  2JMG A;  4GFJ A;  5GTI U;  4UAY A;  2K4E A;  2WF7 A;  3DV9 A;  2YQE A;  4GC6 A;  3M7D A;  4BWM A;  1FO4 A;  1MSW D;  1B0X A;  1WCL A;  1L7P A;  4I2J A;  2EAM A;  5AKZ A;  1CUK A;  4F4X A;  2XIC A;  1K1Q A;  1MA7 A;  1NK5 A;  5J0P A;  3CP8 A;  3MGH A;  4G9B A;  3TI0 A;  2XY5 A;  2A3V A;  4PL1 A;  4UB8 U;  3GIM A;  2V4R A;  2Q0Z X;  4BGD A;  3PMN A;  2DFL A;  1Z00 A;  4C7Y A;  1ZQV A;  5AM5 A;  3C2K A;  1YT3 A;  2G5I B;  5ALV A;  1SB3 C;  9ICQ A;  1WYG A;  4M9J A;  5AIA A;  5JU5 A;  3ZD8 A;  1PVR A;  4QZD A;  4Y2Q A;  3BQ0 A;  4FFD A;  2EDU A;  3ZD9 A;  4MF2 A;  4NLG A;  2EAO A;  3LYS A;  2PXI A;  2K4I A;  5AKY A;  4NXZ A;  3ISC A;  3QU9 A;  4EZ9 A;  2WAQ F;  1S10 A;  3H8W A;  3TKA A;  4ECR A;  3E0F A;  1ZQS A;  2LM4 A;  1TAU A;  1LKY B;  2CN1 A;  3QZ7 A;  4Z6F A;  1X2I A;  3EWA A;  4BUG A;  2DL0 A;  1RZT A;  2F44 A;  1U48 A;  3K4G A;  2J6T A;  4JMU A;  4O5K A;  4PPX A;  3N97 B;  2OYY A;  3QUT A;  3RFA A;  2FPL A;  1PVQ A;  2HHS A;  5ALN A;  5J2J A;  3PR4 A;  5KT5 A;  4DFK A;  5DG7 A;  2B6G A;  9ICX A;  1Z1V A;  4I28 A;  2JHD A;  4PHD A;  1ZXI A;  1NKC A;  4I2D A;  2NO5 A;  4DOA A;  4RU9 A;  4O5C A;  2MA1 A;  3F2C A;  5DGB A;  2A1J B;  3RJK A;  3KZX A;  4P4M A;  2AQ4 A;  3RH6 A;  1L8L A;  3RH4 A;  1ZQB A;  5EE3 A;  3TAC B;  4EYH B;  2WF5 A;  4US9 A;  4C4R A;  1PK1 A;  2UVV A;  2ZIU B;  1ZQK A;  5A0L A;  2Y9U A;  1ZQI A;  1XSP A;  5J2G A;  5IIL A;  2VJ4 A;  2BCV A;  2VJ5 A;  3QU2 A;  2B0C A;  2FI1 A;  1V85 A;  4CDG A;  1KDH A;  4YFK A;  3F5E A;  4J03 A;  9ICP A;  4UBC A;  2XY6 A;  3H40 A;  2CXY A;  1QQ6 A;  2VA3 A;  8ICX A;  4MEY A;  2PFO A;  4NLN A;  1EXN A;  3IHQ B;  3E58 A;  1F44 A;  5AM3 A;  4K4I A;  2ASD A;  1UPH A;  3QZ8 A;  5TIS U;  4YMN A;  1L7N A;  2K60 A;  8ICW A;  4B9N A;  2JEI A;  3BQT A;  7ICG A;  1T8E A;  3GU3 A;  4I2F A;  4DL4 A;  1S76 D;  1ZQH A;  3SEI A;  5DG8 A;  5HMM A;  3EPG A;  4USA A;  2FLP A;  5KG0 A;  1COK A;  3M9M B;  2ZTD A;  3WK4 A;  5J2F A;  3GV8 B;  2E3T A;  1Q3V A;  3N7P D;  2ZJ5 A;  2NYV A;  4JWN A;  1S77 D;  5DB8 A;  4KLH A;  1UQV A;  5KFE A;  3ONN A;  4GXI A;  9ICF A;  3ISB A;  4Q8F A;  1OXJ A;  4ZH4 A;  4FO6 A;  2ZIV A;  4F5N A;  2KIC A;  5KAI U;  4I2B A;  7ICK A;  3IG8 A;  4DF4 A;  4F4Z A;  1ECW A;  5KFZ A;  1BPD A;  2QB1 A;  4O0I A;  4JUZ A;  1WCN A;  3ED5 A;  2KKP A;  2NRW A;  4PHP A;  1VJ5 A;  5KFH A;  1NK7 A;  7ICU A;  4KTQ A;  4QW9 A;  2HBM A;  4FS2 A;  4PGQ A;  7ICJ A;  2R18 A;  3KKA A;  9ICA A;  4F5R A;  4QZB A;  3TAR A;  2FMS A;  2EZZ A;  5DBA A;  4I2C A;  5AK6 A;  3C5F A;  4I29 A;  3AU6 A;  3WK7 A;  4OJO A;  1QSY A;  2H3I A;  1C7Y A;  1U4B A;  1ED1 A;  1S0O A;  4NV0 A;  3AM9 A;  4KLE A;  3M8R A;  3PV8 A;  2QAR A;  2W9C B;  2KZZ A;  2QKQ A;  2VA2 A;  3AMZ A;  1SV4 A;  1LV5 A;  1ZQD A;  5IIN A;  4TUR A;  4QWD A;  4RQ4 A;  2RDI A;  2AXT U;  4QIW C;  3QXG A;  4GLX A;  1CRX A;  2IMW P;  3B0Y A;  3I76 A;  2FJ6 A;  9ICB A;  2MU2 A;  4M2Y A;  1ZJN A;  5ALR A;  4YD2 A;  2W9B A;  1NK4 A;  4QW8 A;  5KFY A;  2HCF A;  2KMD A;  2OM6 A;  3KHH A;  3HP6 A;  3LK9 A;  3UMC A;  3O0F A;  5DGA A;  5ALJ A;  3OHB A;  4PH5 A;  2C2R A;  1ZQL A;  4ED2 A;  5KG3 A;  1D9F A;  8ICQ A;  4U6P A;  4ECY A;  1IXR A;  2IOF K;  4LZD A;  9ICI A;  1X9S A;  1NJX A;  3TAP A;  1KBU A;  4C8K A;  3N7R C;  1SWW A;  3MDC A;  2OXO A;  4MF8 A;  1ZQA A;  4CF5 A;  1VDV A;  2BPF A;  3H4D A;  2LKY A;  1ZQW A;  2RRD A;  2LM1 A;  3K1R B;  3WKE A;  2DUY A;  2EH9 A;  1L7M A;  1NK9 A;  1NJZ A;  8ICT A;  4MFA A;  1IIP A;  3PSP A;  5J2E A;  4ED7 A;  4ED6 A;  3IRU A;  1RYS A;  3ETL A;  4QWB A;  2AHO B;  2D6F C;  2RDJ A;  2BCQ A;  2IHM A;  3BQ2 A;  5III A;  4FS1 A;  4KLT A;  1TK5 A;  4ECZ A;  1HUO A;  5AI8 A;  4G3I A;  1L5U A;  3HX0 A;  1SL0 A;  4NY8 A;  3GZF A;  4FE3 A;  3PST A;  4RT2 A;  3V6J A;  1QSS A;  3M9O B;  2BHN A;  3UPQ A;  3KOO A;  3A0B U;  4DEZ A;  1SKR A;  1SIJ A;  3NTU A;  1X9M A;  8ICH A;  4BDP A;  2KK0 A;  5ALD A;  4PZN A;  3JPO A;  2H3Q A;  5ALP A;  4M9G A;  3AEV A;  4O3P A;  4DL6 A;  2MAX A;  2ES6 A;  4BXO B;  4DSL A;  7ICO A;  4DOC A;  2WTF A;  4UAV A;  5KFO A;  2EAP A;  2KP7 A;  4YR0 A;  2W3R A;  4TUP A;  1KQQ A;  3C1Z A;  3GFK B;  3AQE A;  3HPO A;  1UCV A;  2HVH A;  4XA5 A;  3GIJ A;  4PGY A;  2FPK A;  3OSN A;  2KJ8 A;  5ALS A;  4IRK A;  8ICI A;  4RZR A;  3EYZ A;  5ALQ A;  4R8U A;  2R8H A;  2EQY A;  1BVS A;  3F2D A;  3HT3 A;  4RPX A;  5DB9 A;  4DS5 A;  7ICS A;  3AN1 A;  2QLT A;  3SMV A;  4BX9 C;  3SYZ A;  4OJL A;  3VC8 A;  4EEL A;  3KTQ A;  3MR2 A;  2JEJ A;  3ZDB A;  5BOM A;  2VA8 A;  5AK3 A;  4ECS A;  3Q8Q B;  5AI5 A;  1DK2 A;  5ALY A;  2KG5 A;  1S9F A;  2D3D A;  3ZDA A;  2V4Q A;  3A0H U;  3FC4 A;  3PVX A;  3B9J A;  1KLN A;  4O3S A;  3NAS A;  2I1Q A;  5HR7 A;  5HHH A;  8ICF A;  5J2D A;  3RB0 A;  4KLJ A;  3WKA A;  1SL1 A;  4AYB C;  3KHL A;  5JRT A;  1ZD2 P;  3UMG A;  7ICF A;  3VCB A;  2F1H A;  5DB7 A;  9ICL A;  4F2R A;  3BS5 A;  4UB1 A;  3BQ7 A;  1JXL A;  4B9M A;  3WKD A;  1BPB A;  5KFJ A;  4F4W A;  1X42 A;  8ICL A;  3SV4 A;  2HMX A;  2E8M A;  2G09 A;  4UW9 A;  1LB2 B;  3SEN A;  4KLU A;  9ICO A;  1ZD3 A;  2CRX A;  9ICV A;  1TFR A;  2A19 A;  2RLT A;  2P6R A;  3G6V A;  1NKE A;  1BNP A;  4J9P A;  5L1L A;  1ZYQ A;  4QZE A;  5HHI A;  2Z7J A;  4PJ0 U;  2HVI A;  2DWQ A;  3K75 D;  4UAS A;  1JRO A;  4ELT A;  2JV3 A;  2YML A;  2XVT A;  2ZG6 A;  1NZB A;  4I2A A;  2W9M A;  4CRX A;  5ALF A;  9ICR A;  2A1J A;  3SV3 A;  1T7P A;  3IV6 A;  3UQ2 A;  4IS7 A;  4I2E A;  2FPM A;  1L3T A;  4DO9 A;  4F4K A;  1N63 A;  4YQW A;  9ICJ A;  4ELU A;  1ZQ1 C;  2FDR A;  5E79 U;  3UM9 A;  4CCH A;  2LI6 A;  4HAI A;  2IHN A;  5L9X A;  1N48 A;  3RJH A;  3ALR A;  4Q43 A;  4RQ1 A;  4UBB A;  8ICK A;  2PMZ F;  3SZ2 A;  1NOM A;  4IC9 A;  3UXN A;  2YMM A;  5D4B A;  5KFK A;  5ALU A;  4UQG A;  2WHE A;  1ZQM A;  1H38 A;  2ASL A;  3KFU F;  1X9W A;  5KT7 A;  1XNS A;  3EW9 A;  2DQN B;  3UQ0 A;  5CEH A;  3RTV A;  8ICV A;  1ZQP A;  5J0X A;  2NV3 A;  1HUZ A;  2Y0S C;  4LJX A;  4TUS A;  2M0N A;  4DS4 A;  1BGX T;  1A0P A;  4P4P A;  1N60 A;  1S5L U;  1T3Q A;  2JEG A;  1BPE A;  1DRG A;  2DKZ A;  4QZF A;  1TV9 A;  1B43 A;  3WKC A;  4MFC A;  4DSI A;  2RQ5 A;  2IOH A;  2WB1 C;  2G5H B;  4DL5 A;  1SGG A;  5DB6 A;  8ICP A;  4B9L A;  1BNO A;  3NVY A;  4DFD A;  4RQ8 A;  4M9H A;  2XY7 A;  4NJ8 A;  1X6I A;  4J9N A;  2YN4 A;  2AH5 A;  1ZRN A;  1IG6 A;  3SAG A;  4ED3 A;  3RB6 A;  3T79 A;  4KMU A;  3AQF A;  3TAD C;  4F72 A;  4QWA A;  1FFU A;  3JPS A;  3GII A;  5EE9 A;  3C23 A;  2OCE A;  1L3S A;  3WU2 U;  3KD3 A;  2NRX A;  1URJ A;  1ZD4 A;  3WK5 A;  1BPX A;  3D2Q A;  1U45 A;  2KHQ A;  1Q8K A;  4J9O A;  1A77 A;  3QX7 A;  5KG6 A;  2KKV A;  2MUT B;  3BZC A;  2ZXH A;  5ALE A;  5J2A A;  1FIQ A;  3PW0 A;  2XCA A;  4NL9 C;  3UMB A;  3KKA C;  1SXE A;  3DDH A;  5F9N A;  5ALW A; 
#chains in the Genus database with same CATH homology
 5L1M A;  1X40 A;  3H8M A;  3KKA A;  1F0M A;  2E8O A;  1JI7 A;  1X66 A;  5JU5 A;  2FE9 A;  1V85 A;  1KW4 A;  2KG5 A;  2EAO A;  2Y9T A;  2LPE A;  2D3D A;  3BS5 B;  2F3N A;  3HIL A;  4RQM A;  2DKX A;  2KIV A;  2QAR B;  2EAN A;  1LKY B;  2QB0 B;  5JRT A;  5JTI A;  4NL9 A;  1DXS A;  2DKZ A;  5J8Y A;  2DL0 A;  3BS5 A;  1X9X A;  3BQ7 A;  2GLE A;  3BS7 A;  2K60 A;  2F44 A;  1V38 A;  1SGG A;  2QAR A;  2LMR A;  2QKQ A;  4PZN A;  2E8M A;  1WWV A;  1LKY A;  3SEN A;  2QB0 A;  1SV4 A;  4RQN A;  4NJ8 A;  2YTU A;  2D8C A;  2L5Y A;  3SEI A;  2ES6 A;  1SV0 C;  2KSO B;  1SXD A;  3TAD C;  1COK A;  2EAP A;  2B6G A;  1Z1V A;  1B4F A;  4MHV A;  2K4P A;  1WWU A;  2JV3 A;  1UCV A;  3IDW A;  1PK1 B;  1B0X A;  4PZO A;  1UQV A;  2ESE A;  2KMD A;  2E8N A;  5F3X B;  2E8P A;  2F8K A;  2EAM A;  1RG6 A;  1OXJ A;  2KSO A;  4IS7 A;  1PK3 A;  2QB1 A;  3TAC B;  1PK1 A;  1OW5 A;  4NL9 C;  3KKA C;  1SXE A;  2KE7 A;  5J8Y C;  1SV0 A;  3K1R B;  5KNI A;  2Y9U A;  3TAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...