5L1MA

Caskin2 sam domain tandem
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
140
structure length
140
Chain Sequence
GKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKKIASEIAQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQKKLMLGVKRLAELRRGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new mode of SAM domain mediated oligomerization observed in the CASKIN2 neuronal scaffolding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Caskin-2
total genus 43
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5l1mA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5l1mA01
3BQ7A 3K1RB 1X66A 2F3NA 5J8YC 4PZNA 3TACB 1COKA 1V38A 2Y9UA 2KSOA 5JRTA 2KE7A 3H8MA 2LPEA 1SXEA 1B0XA 1F0MA 4NJ8A 1SXDA 5JTIA 1WWUA 2B6GA 2EAOA 2JV3A 3TADC 2KIVA 1PK1B 5KNIA 1PK1A 2KG5A 1RG6A 4RQMA 1OXJA 1Z1VA 2DKZA 2D8CA 3SENA 1KW4A 1V85A 1OW5A 2E8PA 2K60A 2L5YA 2D3DA 2E8MA 1B4FA 2YTUA 2ESEA 4MHVA 3TADA 2DKXA 4NL9A 3KKAC 4NL9C 2K4PA 2QB1A 2QB0A 2F44A 2QKQA 3BS5B 2EANA 2QARB 5L1MA 2QARA 5J8YA 1SGGA 3SEIA 1SV4A 2DL0A 2F8KA 1UCVA 2QB0B 3HILA 3IDWA 4IS7A 1DXSA 1X40A 1SV0C 1SV0A 2Y9TA 4RQNA 5F3XB 1X9XA 2KSOB 1JI7A 2FE9A 1PK3A 3KKAA 3BS5A 1WWVA 1UQVA 1LKYA 1LKYB 2E8NA 2E8OA 2ES6A 2GLEA 2EAMA 5JU5A 4PZOA 2EAPA 2KMDA 2LMRA 3BS7A
chains in the Genus database with same CATH superfamily
4Y2QA 1SL1A 2I6XA 2A19A 5TZVA 4PPXA 1COKA 8ICZA 4DSEA 1O08A 2BCQA 2VA2A 2FJ6A 3Q8MA 3NRWA 4P0QA 2G06A 5KG6A 1RZTA 1KDHA 3SAFA 4F50A 1NK7A 3V72A 2KIVA 1Z4OA 5DLFA 5J0PA 3ALRA 4RUCA 1KSPA 4RNOA 1TK5A 4JMUA 2H3IA 3SENA 1KW4A 1XNSA 4NM1A 1OW5A 1XS9D 4CF3A 3T5LA 1B43A 2OH2A 2FPMA 2VIXA 1B4FA 3ICXA 4CE6A 1SZPA 8ICMA 1ZXIA 2HI0A 3ETRA 7ICQA 3RAQA 4ECTA 4P0QB 1P7DA 3N7SC 9ICNA 2E1FA 2AGQA 4UB3A 1Z3EB 1ZJNA 2DL0A 4Q45A 4FO6A 3MFIA 4R8UA 4ECRA 2PMZC 3C5GA 3RJEA 4Y2RA 3BQ0A 3NS1A 2YN4A 1SV0C 3N97B 1NKEA 3M1YA 2OCEA 3NVWA 4YXJA 1N2XA 4B9SA 9ICEA 4P2HA 3A0HU 4KLLA 4B9NA 3RJFA 1AQ6A 2K8BB 1RYSA 4C0ZA 2JR5A 4EELA 5J0SA 4JV2A 5AKIA 1RDFA 1QLNA 1V38A 1FIQA 3PSFA 5ALJA 4M9NA 2Y9UA 2KTQA 5JRTA 2NRVA 1J2MA 1UPHA 4KITB 4DFKA 4DOAA 4Y2JA 4TUPA 5AM2A 1B22A 1RYRA 3Q8PB 1MC8A 2AXTU 5EE0A 3WKEA 2EAOA 2JV3A 2BQUA 2EQYA 1ZQOA 4I2BA 2WFAA 1KFDA 3PR4A 1S97A 2FDRA 3H8JA 3BZKA 1PZNA 3FM9A 2HOQA 4I2EA 2E5SA 1A77A 2HBKA 1Q46A 3EYZA 4NL9C 4P4OA 4C8NA 3PNCA 3SZ2A 4C8KA 4KLFA 4BGDA 3QEBZ 5CA7A 5CEHA 1RQNA 2PFNA 2DFLA 3WKBA 2EANA 2CPRA 4K4IA 7ICFA 4MF2A 3MDAA 1TAMA 3PX6A 4RQ5A 5AKLA 2I9GA 4UB5A 8ICFA 4LJXA 2JGAA 2OM6A 5KFMA 4R64A 1UCVA 4GXJA 1L8OA 1U45A 1CI4A 5J0YA 3RB3A 4RQ1A 2W3RA 1KQQA 2FE9A 4DWIA 1PK3A 3SYZA 3BS5A 4O3QA 3RF9A 3QUCA 2C2RA 5AI9A 5GTIU 1CRXA 2VJ5A 2ZIUB 5KFWA 2LM4A 2E8OA 5JU5A 5KFAA 5J2JA 3F2BA 2AGPA 1UHUA 4CNQA 4LZGA 4CGZA 2OWOA 2NRTA 3C21A 2JZBA 4YP3A 4Q44A 4GXKA 2WF7A 3AUOA 4F4WA 4UQGA 3PR5B 2BCUA 3E2EA 2KP7A 1ZQIA 3KOOA 4EBCA 1LV5A 1L3UA 1JIHA 3WK8A 1VJ5A 4QZGA 2W9BB 2IOFK 1L3SA 4U6PA 2DKZA 5HR6A 1KTQA 2WB1F 4IR1A 4DQQA 4IRDA 4PL1A 2XO7A 2XY7A 5J2BA 3RBEA 2ZG6A 1UA0A 4DF8A 3QU2A 4B9VA 3DEEA 5D46A 3WKAA 3CNHA 3N28A 4R8UB 1QSLA 5AK4A 3ONNA 2W8KA 4TQSA 1S77D 2JZBB 5ALPA 4ED2A 5KFIA 2B21A 3H40A 3WKCA 5KG7A 4QW8A 3AM9A 2OXOA 2XIDA 3S6JA 1SGGA 4Y2TA 4I2GA 2CN1A 3ZD8A 4F93B 3PZPA 4I27A 5J2AA 3MDCA 4ECUA 2AU0A 2KVCA 5T14A 1ZRNA 4UB8U 5J2KA 3MR3A 4KX3A 3F2CA 4M6WA 4BJQA 4J9LA 4F5QA 4YMOA 5KT4A 4QIWC 4OO1J 5DBBA 3QU9A 2HVHA 3PSPA 8ICYA 2DQNB 5J2CA 2FPLA 2DF4B 3ZDDA 5HMLA 4ED8A 4P4MA 5C0YA 1JUDA 2HHWA 2EZYA 4NLNA 3RR8A 3RTVA 3UMGA 2XI9A 1JXEA 1XU4A 4KMOB 5EE1A 5J2IA 1X6JA 3F2DA 2MSNA 4QZDA 3HRDD 2F1JA 3RRHA 1HEKA 4RQ2A 4UAWA 5ALGA 5DB9A 3QUQA 3TI0A 4DL6A 2W03A 3L5KA 4MFAA 1ZD3A 7ICKA 4C4RA 3T79A 3H0RB 3GIJA 3ZDAA 4UAZA 2WAQF 4BX9C 2ASLA 4DSKA 3V7LA 2H5XA 4Y2YA 5ALHA 2K4PA 4I2AA 5KFNA 1X9WA 4P0PB 4MFFA 1MSWD 1PVPA 2W9AA 3B0XA 2A1AA 3CW2C 1GO3F 9ICJA 2A3VA 1SV4A 3AMZA 2H3FA 4DCCA 1K1QA 1NI3A 3FYHA 2BR0A 4LZDA 5IIIA 1X9XA 5HP4A 2BCVA 2VJ4A 2R18A 3WK4A 4C8MA 1N48A 1LKYB 4IRKA 4DFJA 9ICFA 3QNMA 4EEYA 4QWBA 4RQ7A 3KTQA 2GLEA 2EAMA 2P66A 3QZ7A 1L3VA 2MU2A 2ASJA 3HW8A 4NLBA 2G5HB 4UB1A 3TAPA 2ZXHA 1JALA 2O6KA 3CYMA 3NVZA 2GO7A 1FO4A 2AJQA 4FFDA 5J2EA 2DPJA 2F2AB 4DSJA 1TK0A 2LM1A 2FMSA 4O3PA 5KFFA 5KFKA 2V9WA 3ISBA 5H2FU 5D49A 4YR0A 1U47A 4GIBA 4EX7A 3DV9A 3TADC 4RQ6A 1S0OA 3CRXA 4Y2SA 2K4EA 1L3TA 1WUDA 2ZJ5A 1NK8A 2ZIVA 3UXNA 2W43A 3LVVA 2K60A 4KLQA 4DFDA 5BOMA 2KOBA 1D8LA 3SV4A 1NZPA 1KRPA 1S0MA 2HW3A 1L6NA 4CCHA 3TADA 2JHDA 3D2QA 1XSPA 3KKAC 1IM4A 4O3RA 3QUTA 4F5NA 4RT3A 3GZFA 4OJ6A 4IQWA 5ALKA 4NLKA 2H3VA 5L1MA 4JWMA 4I28A 8ICIA 7ICRA 5J0OA 4UASA 5IINA 1TE2A 3KD3A 2HHTA 8ICBA 2WF8A 4YN4A 5AI5A 1RM6C 5IIOA 5DQHA 4F8RA 2CRXA 4DQSA 2KSOB 5G5HA 4JWNA 4J9MA 2PI5A 1NOMA 2AH5A 4F5RA 4DLEA 2VANA 2LYAA 4GLXA 2KJ5A 4YXMA 2EAPA 4DEZA 4QZCA 1Y88A 2Y1IA 4YR2A 1VDVA 4Q8EA 2YX8A 5KFOA 1T94A 3KZXA 3JPPA 2C28A 8ICJA 1SIJA 5J0WA 2HHQA 5AKGA 3L3FX 4O5EA 4DFMA 4RT2A 5KG3A 3SAGA 1T3NA 2HMXA 2LYHA 3E58A 5KFGA 4CDGA 1MQ3A 1RYUA 4KLEA 5J0UA 4JUZA 3H7IA 3KHRA 7ICLA 5DB8A 2HDOA 4Z6CA 1ED1A 1Z1BA 2XGQA 2ALZA 1KFTA 2D8CA 3V6JA 4F4XA 4DL3A 5AKKA 5ALNA 4HAIA 2IMWP 4KLTA 4I2JA 1NJYA 2XGPA 2NO4A 2E8MA 3RR7A 2HBLA 4ZH4A 5KFLA 3LWLA 3C2LA 3Q8KA 1WYGA 2BQ3A 1HIWA 4DOCA 1NNLA 3H0LB 4O3MA 5ALUA 5HMMA 3V6HA 2KZMA 4OJPA 1ZOLA 4USAA 1X2IA 3BQ1A 2F76X 3PW7A 5ALWA 2JH7A 4J9NA 2LYBA 2IOHA 1IIPA 2QB0B 1M6YA 3OGUA 8ICTA 4I2DA 9ICIA 5L9XA 2KFNA 1X40A 4GC7A 4KLOA 3TFRA 2GOLA 2W3SA 4M6WB 2PFPA 1SV0A 4GFJA 3GV5B 4EZ6A 4PGYA 5KFXA 4M9GA 4DL7A 3NTUA 4ED1A 3RJHA 1KEJA 2FI1A 1JMSA 2G07A 5KT6A 4C80A 4ELUA 3TFSA 2CXYA 5AKZA 1N62A 2PMZF 4QWAA 1XC9A 4RUAA 2P6RA 8ICOA 2KZZA 4IC9A 5J8YC 4PZNA 3RB4A 4TUSA 3K4GA 3M6ZA 3RJIA 4UB2A 4DQRA 2R8KA 4QJFB 1ZQRA 2ATLA 1BPEA 1QSYA 2JRZA 3IM1A 2EZZA 4FBUA 1RPLA 4CRXA 1SKRA 5A0LA 3C2MA 3J81j 2VKQA 1BPXA 1DRGA 1BPZA 4JK1A 4F5OA 3MR5A 1V85A 2I5HA 4KMUA 5ALVA 4FZNA 8ICWA 1V9PA 5JUMA 2RRDA 4QZHA 2BGWA 4M9JA 5B5EU 1BNPA 3PX4A 4C7YA 9ICQA 3KHGA 4Z6DA 2NRZA 4FS1A 2J6UA 4YR3A 2ZUDA 1MN8A 3RJGA 3GQCA 9ICLA 5FP0A 5DG8A 3PW5A 3ZDCA 5DKWA 3IDWA 2YB4A 4O3SA 3MFHA 1L7NA 1JX4A 3I28A 2Y9TA 4RQNA 5J2FA 3RBDA 4R66A 2BPGA 2HOFA 2K89A 4BXOB 1BVSA 1ECWA 2RQ5A 2Z7JA 5EE9A 5J29A 8ICGA 3D6JA 2ISPA 5EWFA 1UQVA 2GWSA 5EE3A 4J9KA 3M9OB 2W7OA 2E3TA 1U9LA 4K4HA 2YQEA 3OHAA 5ALSA 1JRPA 4Y2UA 3FC4A 5AK6A 5J0XA 4F4KA 2G5IB 2YMLA 4ELVA 7ICSA 4J9SA 1U48A 2MUTA 4OJOA 1LVHA 3UM9A 1URJA 4R63A 3H8MA 5AHXA 2KK0A 4YFKA 2M9NA 3AU2A 3QXGA 5KFCA 4F2RA 4DFPA 4KN7A 4QZAA 1N5WA 7ICTA 2IOFA 8ICUA 1D8BA 9ICSA 2Y0SF 3RAXA 1L8LA 1QH9A 1ZRMA 1UT5A 4NV0A 2W8LA 4FBTA 2R8IA 1KKXA 4F72A 3AQFA 2MAXA 9ICWA 5KFZA 2PXIA 2WHEA 5KFHA 5BOLA 5TISU 2XVTA 3HPOA 2HHUA 5CP2A 4CF5A 3M7DA 3WK6A 1S8OA 2KFZA 3ZDBA 4MEYA 4DF4A 3GFKB 2W9BA 8ICRA 5IIKA 1ZQFA 4RQ0A 3QU7A 8ICLA 3MGHA 3IN5A 4YCXA 4DSLA 4EZ9A 3QUBA 4GC6A 4F91B 4ED0A 2KKVA 5DGBA 1C7YA 2VA8A 3UXOA 2E8NA 4YQWA 1KN5A 3C28A 2ISOA 3LWMA 3ISDA 3MABA 5AIBA 1TFRA 4KX5A 1ZQAA 2JH1A 4Q8FA 2KIWA 7ICHA 9ICUA 3H4BA 2KE7A 4UAUA 2K4HA 1B0XA 4TUQA 5HHIA 3PW0A 5AK3A 4YMMA 3JPOA 1BNOA 3Q8QB 4J9OA 1PK1A 3FDSA 5J0RA 1Z1VA 1SL2A 3R9KA 4G3IA 5ALXA 1IV8A 4QZEA 2KHVA 5KFQA 1PVRA 3RRGA 2F77X 1A76A 3GDXA 1ZQBA 2R8JA 2IA6A 4M9LA 1C20A 2YTUA 2ESEA 2DWQA 1QTMA 2HHVA 1FFVA 3QX7A 3OJUA 4EBEA 1SZHA 4RNNA 1ZQHA 1NK6A 4QWDA 2F1IA 7ICOA 3M9NB 5KFYA 2F8LA 1SKWA 4Z6EA 5ALEA 4C4SA 4OJ5A 4M47A 3WKDA 3MGVA 2MUTB 3EPGA 2H3QA 4M0AA 2ZIXA 3A0BU 1KBUA 1XO0A 8ICPA 3UMCA 3I76A 3SV3A 5G5GA 1J97A 4UAYA 4X5VA 1BGXT 3KKAA 2BKEA 5ALDA 4QZBA 8ICXA 3JPNA 3KBBA 2HSZA 2ZIUA 2ZTCA 2ES6A 1Z4NA 3T3FA 2KZ3A 3MBYA 3LVWA 3MR2A 2WF6A 5DBCA 4U7CA 7ICGA 3C29A 8ICEA 5AKHA 4A8EA 4YG2A 2W9CB 3G6VA 4ACOA 1EXNA 3H8SA 1SXEA 2ZIXB 5HR7A 4ECSA 3K75D 3M8RA 4O5KA 5ALRA 5KFUA 4I29A 4IRCA 1S5LU 5HNKA 3JPSA 3Q8RB 1IG6A 2IBKA 3SAHA 1S0NA 3ISCA 3AEVA 2V4RA 2QLTA 2ASDA 3JPTA 2PKEA 1L5UA 7ICVA 4QZIA 2AHOB 4XA5A 3THVA 2BCSA 5J2DA 2XCPA 4KLGA 4AYBF 2W9MA 4KTQA 1ZD4A 2DBYA 5KFSA 1KFSA 3BS5B 5DB6A 2WTFA 3PX0A 3EUB2 2ZIVB 4Y2PA 2OEHA 4UATA 2BHNA 2QARA 1NKCA 5DG9A 3G6XA 3M9MB 2J6SA 1QCKA 5AIAA 4RPYA 1ZQGA 1NJWA 1SL0A 3HILA 2KICA 4UARA 5KFDA 2KJ9A 3TAQA 3OSNA 2R8HA 9ICTA 4M04A 4PGXA 5ALIA 1BPDA 1CEZA 1WWVA 2I1QA 1DK2A 4JV0A 4J9RA 1QQ5A 3OTQA 2JEFA 4Y2VA 3NGDA 3OHBA 1SKSA 4MF8A 2NO5A 3GU3A 4F71A 7ICEA 2ZJ8A 1ZQ1C 4B9LA 5AK5A 2R8GA 3TACB 5KFEA 5KG2A 4Q43A 5AI6A 3C2KA 1TK8A 1VLBA 4EYHB 2LPEA 4XQ8A 2A1JA 3RH6A 1KL9A 5IIJA 3EW9A 2KN7A 5ALZA 4C8OA 1WWUA 1A6SA 3C1ZA 5KG5A 4RU9A 4CF4A 3AL0B 1PK1B 9ICCA 1KLNA 1HJPA 1N61A 2RDIA 4ED3A 3TANA 3TARA 3TQ1A 2L5YA 1TAUA 5ALYA 3V7JA 2Y0SC 3G6YA 2P6UA 1YT3A 1A0PA 3PO5A 1IXRA 2HHXA 5KG4A 3H0MB 2F44A 2RHFA 3PMNA 2ZTEA 5L1LA 1T3QA 2LI6A 2EZXA 3F5AA 2EH9A 1V97A 3SEIA 4QWCA 1T4GA 1H38A 2PFOA 2LHTA 9ICOA 2HBMA 4G9BA 8ICCA 4C4TA 3WK7A 4YD2A 1S10A 3HP6A 1CUKA 4GXIA 2UVVA 1COOA 1D8YA 2Q0ZX 2LKYA 9ICAA 2ZTDA 1TAQA 2ZUCA 2W55A 2VA3A 2KHQA 5J0QA 2M0NA 3RFAA 7ICIA 4F3OA 1L7PA 2FLLA 3T5JA 4RPZA 5KFVA 5HHHA 1NJZA 3NUQA 2JXJA 4RNMA 1XWLA 1QQ6A 1ZQMA 4B9UA 2PI4A 3K1RB 3ZI4A 5KAIU 2XY5A 3VC8A 1ZYQA 4ECVA 1L7OA 8ICNA 4J9PA 2YMQA 2KJ8A 1MQ2A 4ZOHC 4LVSA 1HUZA 1SXDA 5JTIA 3Q8SB 2N1RA 3WK5A 4EBDA 4P4PA 1ZQKA 5DBAA 3LK9A 3GIIA 5KG0A 3ZDEA 1RXWA 4YVZA 3KZIU 1YZ6A 4DL4A 4RQMA 1OXJA 3UMBA 2FMPA 3AQEA 4QZFA 5L1IA 1ZETA 3RJKA 3RJJA 4O3NA 9ICPA 3PMLA 2RDJA 2D3DA 2W7PA 5ALOA 3KHHA 1XSNA 1ZQNA 3BQ2A 4NL9A 2HBJA 3ZD9A 3SD7A 4IL6U 4PHEA 1NJXA 2XC9A 1TV9A 2QB0A 3KHLA 2RP5A 5F9LA 1ZQEA 1ZQUA 5AI0A 2QARB 3NVVA 3SR6A 1F5SA 8ICSA 1WG8A 3N4MB 2BDPA 1Z19A 3QYPA 3SI8A 1K5OA 4EYIB 2KV2A 3IRUA 4IS7A 4ECQA 1F44A 3PSTA 1DXSA 3I1YA 3WU2U 5KFTA 4IR9A 5F9NA 4KLHA 1JI7A 4QW9A 4PHAA 2YB1A 3HKZC 4M9HA 4DOBA 4F2SA 4O3OA 1QSSA 3NRZA 2G0AA 4F92B 3E0FA 5KFRA 2F1HA 2D6FC 2KMDA 2HCFA 2K8CB 3MR6A 1NK4A 2BPFA 3UPQA 1X66A 1SWWA 3EZ5A 5DGAA 5CWRA 3K1ZA 5KT2A 3IV6A 2G09A 4ED7A 1PVQA 3ORYA 1F0MA 2EDUA 2W11A 4IQUA 4PGQA 3T5HA 4FE3A 2B6GA 3M6KA 5DQGA 1RG6A 4KLJA 4KLSA 2RLTA 4ECZA 5AKYA 4DQPA 3QEAZ 4NY8A 3ETLA 1S76D 2UVUA 3AU6A 4B9MA 4ED6A 4UB6U 2UVRA 7ICNA 3F5EA 1RXVA 1BPYA 4IQTA 2IHNA 1RQLA 4MHVA 4ECWA 3BZCA 1ZJMA 1TKDA 2LBOA 9ICGA 3GILA 8ICVA 2HVIA 1NK5A 2ZXIA 5DDMA 4PHPA 1JXLA 4KLDA 5EWGA 1Q3VA 1ZQXA 3VCBA 7ICUA 5EWEA 3H8WA 5ALMA 1XSLA 5J8YA 3GIMA 4XRHA 3JPQA 1ZQYA 1X9SA 3C23A 4I2IA 2MRLA 8ICKA 1OUQA 3QZ8A 3OPXA 4B6JA 2YMPA 3F53A 4KN4A 3BDPA 2WAQC 3CP8A 3IP4B 3HWTA 3PSIA 2KNJA 2FLPA 3HKZF 1ZQTA 2HHSA 3DDHA 1HUOA 2KEYA 4BWJA 4QZ9A 2F3NA 5AKJA 2C2EA 5KL8B 1J2NA 2KSOA 2Y1JA 4EENA 4O9MA 2JEGA 4MFCA 5KT5A 5AI4A 1D9FA 2ZIWB 9ICHA 5AM3A 4OJLA 3SQIA 3QU4A 1Z00B 5ALFA 4ELTA 5K4LA 1QQ7A 4RPXA 1NKBA 2KG5A 4DS5A 5DQIA 1UA1A 2NRWA 5D4BA 2K4IA 2E8PA 3PVXA 4MEXA 2NV3A 4QIWF 1WCLA 4TQRA 4PH5A 5DG7A 4JB3A 4RQ3A 5DB7A 1DOQA 2DKXA 1JN3A 5B66U 4O0IA 3EWAA 4BDPA 4US9A 2QB1A 5KFBA 9ICXA 3M8SA 3HT3A 4AYBC 4K4GA 4DS4A 3IG8A 1ZQJA 4KLIA 2JEJA 3UQ0A 4EEKA 3OJSA 5J2GA 4AP9A 4QZ8A 4P0PA 4RZRA 3PV8A 5GTHU 4KLUA 3LYSA 4B9TA 2NRXA 4F4YA 5J0TA 1O03A 2WF5A 2WB1C 9ICKA 9ICMA 1X9MA 2KVSA 4DSFA 2KKPA 1ZQZA 4J03A 5KT7A 3AN1A 5KL1B 1MA7A 2DUYA 3C5FA 5ALTA 2BDUA 3RB6A 4BUGA 2K8AA 5KG1A 7ICPA 2BCRA 4E0DA 1NK0A 4ECYA 1ZQDA 3JPRA 1T8EA 3FAHA 1ZQVA 7ICMA 3U26A 2IHMA 3LDAA 5ALQA 1U49A 4DL5A 2XY6A 1Z00A 4NLGA 3BJYA 5J2HA 3V7KA 2OYYA 2PFQA 4TURA 5KNIA 4DQIA 2YMMA 2AQ4A 3O0FA 4FZMA 1AROP 8ICAA 1JROA 3PY8A 1UT8A 3T5KA 4NWIA 4RQ8A 3ED5A 4C7ZA 4FZLA 3SMVA 5CHGA 3RB0A 3B0YA 3NASA 3UXPA 3UQ2A 1YZ7A 1Q3UA 1K1SA 2MA1A 5AICA 4BXOA 4KLMA 1ZQPA 2BPCA 1NK9A 2H3ZA 1X42A 3N7RC 3RH5A 1BPBA 2DPIA 5KFJA 2V4QA 4DO9A 4DLGA 3MGIA 2NYVA 7ICJA 4OD0A 2E1EA 4Y2XA 2OHFA 4UW9A 1NZBA 1WCNA 1X6IA 4QWEA 5L1KA 5IIMA 1ZQSA 3N7PD 5CR0A 1PUZA 2HOIA 3QU5A 2ZJAA 2P35A 5AI8A 2DGZA 5F3XB 4WJ3B 5AM4A 3PO4A 4NLZA 4HYKA 2BZFA 4I2FA 3C1YA 2UVWA 2AGOA 4UAVA 3EPIA 1Q8KA 3MC1A 4UBCA 3B9JA 4C8LA 4Z6FA 5AKEA 4J9QA 2W9CA 1LB2B 4PHDA 3H4DA 4PZOA 5CRXA 2LMRA 4QNLA 3BS7A 3BQ7A 1ZQWA 3OSPA 1ZQLA 4EX6A 2YY6A 2J6TA 5CJ7A 2WF9A 4F4ZA 3WK9A 2C2DA 1XO1A 4FS2A 1N60A 1N56A 4JV1A 8ICHA 5ALLA 1ZQQA 2ZUBA 3PW4A 4XUSA 4DL2A 4NJ8A 4NM2A 4I2HA 4I2CA 5KFPA 4F5PA 5C5JA 4RQ4A 1S9FA 1N5XA 1FEZA 2Q4TA 5AM5A 4PJ0U 9ICRA 4NLCA 3D2NA 1DGSA 4YD1A 3TKAA 1N63A 3KFUF 8ICQA 2XCAA 5AM1A 4R65A 1SB3C 2ZIWA 5AKXA 3Q8LA 5DLGA 2KD1A 2FMQA 2FLNA 1FFUA 4UB4A 3HX0A 3QE9Y 4ECXA 3IG5A 2JEIA 4BWMA 5CB1A 5BPCA 5DDYA 9ICBA 1ZD5A 2QKQA 3BQTA 4PL2A 2ODGA 1U4BA 1L7MA 4IQVA 4US8A 3PW2A 3HJEA 1DGJA 2XICA 5AM0A 3IHQB 3RH4A 1ZQCA 9ICVA 4M2YA 5E79U 2W04A 1SWVA 2FPKA 3GIKA 3V6KA 5KAFU 4DSIA 5KT3A 1DK3A 2A1JB 2B0CA 4YMNA 2G08A 1D9DA 3GV8B 1ZD2P 4ICAA 4NXZA 4O5CA 3NVYA 3GV7B 1T7PA 2AQ0A 5KTQA 4UBBA 1LKYA 5EOZA 3D2SA 2BQRA 5IILA 2GH1A 2C22A 2W54A 5L1JA 4OCZA 2JMGA 1TVAA 1S0VA 3L4PA 2F8KA
chains in the Genus database with same CATH topology
3BQ7A 3K1RB 1X66A 2F3NA 5J8YC 4PZNA 3TACB 1COKA 1V38A 2Y9UA 2KSOA 5JRTA 2KE7A 3H8MA 2LPEA 1SXEA 1B0XA 1F0MA 4NJ8A 1SXDA 5JTIA 1WWUA 2B6GA 2EAOA 2JV3A 3TADC 2KIVA 1PK1B 5KNIA 1PK1A 2KG5A 1RG6A 4RQMA 1OXJA 1Z1VA 2DKZA 2D8CA 3SENA 1KW4A 1V85A 1OW5A 2E8PA 2K60A 2L5YA 2D3DA 2E8MA 1B4FA 2YTUA 2ESEA 4MHVA 3TADA 2DKXA 4NL9A 3KKAC 4NL9C 2K4PA 2QB1A 2QB0A 2F44A 2QKQA 3BS5B 2EANA 2QARB 5L1MA 2QARA 5J8YA 1SGGA 3SEIA 1SV4A 2DL0A 2F8KA 1UCVA 2QB0B 3HILA 3IDWA 4IS7A 1DXSA 1X40A 1SV0C 1SV0A 2Y9TA 4RQNA 5F3XB 1X9XA 2KSOB 1JI7A 2FE9A 1PK3A 3KKAA 3BS5A 1WWVA 1UQVA 1LKYA 1LKYB 2E8NA 2E8OA 2ES6A 2GLEA 2EAMA 5JU5A 4PZOA 2EAPA 2KMDA 2LMRA 3BS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQ7 A;  3K1R B;  1X66 A;  2F3N A;  5J8Y C;  4PZN A;  3TAC B;  1COK A;  1V38 A;  2Y9U A;  2KSO A;  5JRT A;  2KE7 A;  3H8M A;  2LPE A;  1SXE A;  1B0X A;  1F0M A;  4NJ8 A;  1SXD A;  5JTI A;  1WWU A;  2B6G A;  2EAO A;  2JV3 A;  3TAD C;  2KIV A;  1PK1 B;  5KNI A;  1PK1 A;  2KG5 A;  1RG6 A;  4RQM A;  1OXJ A;  1Z1V A;  2DKZ A;  2D8C A;  3SEN A;  1KW4 A;  1V85 A;  1OW5 A;  2E8P A;  2K60 A;  2L5Y A;  2D3D A;  2E8M A;  1B4F A;  2YTU A;  2ESE A;  4MHV A;  3TAD A;  2DKX A;  4NL9 A;  3KKA C;  4NL9 C;  2K4P A;  2QB1 A;  2QB0 A;  2F44 A;  2QKQ A;  3BS5 B;  2EAN A;  2QAR B;  5L1M A;  2QAR A;  5J8Y A;  1SGG A;  3SEI A;  1SV4 A;  2DL0 A;  2F8K A;  1UCV A;  2QB0 B;  3HIL A;  3IDW A;  4IS7 A;  1DXS A;  1X40 A;  1SV0 C;  1SV0 A;  2Y9T A;  4RQN A;  5F3X B;  1X9X A;  2KSO B;  1JI7 A;  2FE9 A;  1PK3 A;  3KKA A;  3BS5 A;  1WWV A;  1UQV A;  1LKY A;  1LKY B;  2E8N A;  2E8O A;  2ES6 A;  2GLE A;  2EAM A;  5JU5 A;  4PZO A;  2EAP A;  2KMD A;  2LMR A;  3BS7 A; 
#chains in the Genus database with same CATH topology
 4Y2Q A;  1SL1 A;  2I6X A;  2A19 A;  5TZV A;  4PPX A;  1COK A;  8ICZ A;  4DSE A;  1O08 A;  2BCQ A;  2VA2 A;  2FJ6 A;  3Q8M A;  3NRW A;  4P0Q A;  2G06 A;  5KG6 A;  1RZT A;  1KDH A;  3SAF A;  4F50 A;  1NK7 A;  3V72 A;  2KIV A;  1Z4O A;  5DLF A;  5J0P A;  3ALR A;  4RUC A;  1KSP A;  4RNO A;  1TK5 A;  4JMU A;  2H3I A;  3SEN A;  1KW4 A;  1XNS A;  4NM1 A;  1OW5 A;  1XS9 D;  4CF3 A;  3T5L A;  1B43 A;  2OH2 A;  2FPM A;  2VIX A;  1B4F A;  3ICX A;  4CE6 A;  1SZP A;  8ICM A;  1ZXI A;  2HI0 A;  3ETR A;  7ICQ A;  3RAQ A;  4ECT A;  4P0Q B;  1P7D A;  3N7S C;  9ICN A;  2E1F A;  2AGQ A;  4UB3 A;  1Z3E B;  1ZJN A;  2DL0 A;  4Q45 A;  4FO6 A;  3MFI A;  4R8U A;  4ECR A;  2PMZ C;  3C5G A;  3RJE A;  4Y2R A;  3BQ0 A;  3NS1 A;  2YN4 A;  1SV0 C;  3N97 B;  1NKE A;  3M1Y A;  2OCE A;  3NVW A;  4YXJ A;  1N2X A;  4B9S A;  9ICE A;  4P2H A;  3A0H U;  4KLL A;  4B9N A;  3RJF A;  1AQ6 A;  2K8B B;  1RYS A;  4C0Z A;  2JR5 A;  4EEL A;  5J0S A;  4JV2 A;  5AKI A;  1RDF A;  1QLN A;  1V38 A;  1FIQ A;  3PSF A;  5ALJ A;  4M9N A;  2Y9U A;  2KTQ A;  5JRT A;  2NRV A;  1J2M A;  1UPH A;  4KIT B;  4DFK A;  4DOA A;  4Y2J A;  4TUP A;  5AM2 A;  1B22 A;  1RYR A;  3Q8P B;  1MC8 A;  2AXT U;  5EE0 A;  3WKE A;  2EAO A;  2JV3 A;  2BQU A;  2EQY A;  1ZQO A;  4I2B A;  2WFA A;  1KFD A;  3PR4 A;  1S97 A;  2FDR A;  3H8J A;  3BZK A;  1PZN A;  3FM9 A;  2HOQ A;  4I2E A;  2E5S A;  1A77 A;  2HBK A;  1Q46 A;  3EYZ A;  4NL9 C;  4P4O A;  4C8N A;  3PNC A;  3SZ2 A;  4C8K A;  4KLF A;  4BGD A;  3QEB Z;  5CA7 A;  5CEH A;  1RQN A;  2PFN A;  2DFL A;  3WKB A;  2EAN A;  2CPR A;  4K4I A;  7ICF A;  4MF2 A;  3MDA A;  1TAM A;  3PX6 A;  4RQ5 A;  5AKL A;  2I9G A;  4UB5 A;  8ICF A;  4LJX A;  2JGA A;  2OM6 A;  5KFM A;  4R64 A;  1UCV A;  4GXJ A;  1L8O A;  1U45 A;  1CI4 A;  5J0Y A;  3RB3 A;  4RQ1 A;  2W3R A;  1KQQ A;  2FE9 A;  4DWI A;  1PK3 A;  3SYZ A;  3BS5 A;  4O3Q A;  3RF9 A;  3QUC A;  2C2R A;  5AI9 A;  5GTI U;  1CRX A;  2VJ5 A;  2ZIU B;  5KFW A;  2LM4 A;  2E8O A;  5JU5 A;  5KFA A;  5J2J A;  3F2B A;  2AGP A;  1UHU A;  4CNQ A;  4LZG A;  4CGZ A;  2OWO A;  2NRT A;  3C21 A;  2JZB A;  4YP3 A;  4Q44 A;  4GXK A;  2WF7 A;  3AUO A;  4F4W A;  4UQG A;  3PR5 B;  2BCU A;  3E2E A;  2KP7 A;  1ZQI A;  3KOO A;  4EBC A;  1LV5 A;  1L3U A;  1JIH A;  3WK8 A;  1VJ5 A;  4QZG A;  2W9B B;  2IOF K;  1L3S A;  4U6P A;  2DKZ A;  5HR6 A;  1KTQ A;  2WB1 F;  4IR1 A;  4DQQ A;  4IRD A;  4PL1 A;  2XO7 A;  2XY7 A;  5J2B A;  3RBE A;  2ZG6 A;  1UA0 A;  4DF8 A;  3QU2 A;  4B9V A;  3DEE A;  5D46 A;  3WKA A;  3CNH A;  3N28 A;  4R8U B;  1QSL A;  5AK4 A;  3ONN A;  2W8K A;  4TQS A;  1S77 D;  2JZB B;  5ALP A;  4ED2 A;  5KFI A;  2B21 A;  3H40 A;  3WKC A;  5KG7 A;  4QW8 A;  3AM9 A;  2OXO A;  2XID A;  3S6J A;  1SGG A;  4Y2T A;  4I2G A;  2CN1 A;  3ZD8 A;  4F93 B;  3PZP A;  4I27 A;  5J2A A;  3MDC A;  4ECU A;  2AU0 A;  2KVC A;  5T14 A;  1ZRN A;  4UB8 U;  5J2K A;  3MR3 A;  4KX3 A;  3F2C A;  4M6W A;  4BJQ A;  4J9L A;  4F5Q A;  4YMO A;  5KT4 A;  4QIW C;  4OO1 J;  5DBB A;  3QU9 A;  2HVH A;  3PSP A;  8ICY A;  2DQN B;  5J2C A;  2FPL A;  2DF4 B;  3ZDD A;  5HML A;  4ED8 A;  4P4M A;  5C0Y A;  1JUD A;  2HHW A;  2EZY A;  4NLN A;  3RR8 A;  3RTV A;  3UMG A;  2XI9 A;  1JXE A;  1XU4 A;  4KMO B;  5EE1 A;  5J2I A;  1X6J A;  3F2D A;  2MSN A;  4QZD A;  3HRD D;  2F1J A;  3RRH A;  1HEK A;  4RQ2 A;  4UAW A;  5ALG A;  5DB9 A;  3QUQ A;  3TI0 A;  4DL6 A;  2W03 A;  3L5K A;  4MFA A;  1ZD3 A;  7ICK A;  4C4R A;  3T79 A;  3H0R B;  3GIJ A;  3ZDA A;  4UAZ A;  2WAQ F;  4BX9 C;  2ASL A;  4DSK A;  3V7L A;  2H5X A;  4Y2Y A;  5ALH A;  2K4P A;  4I2A A;  5KFN A;  1X9W A;  4P0P B;  4MFF A;  1MSW D;  1PVP A;  2W9A A;  3B0X A;  2A1A A;  3CW2 C;  1GO3 F;  9ICJ A;  2A3V A;  1SV4 A;  3AMZ A;  2H3F A;  4DCC A;  1K1Q A;  1NI3 A;  3FYH A;  2BR0 A;  4LZD A;  5III A;  1X9X A;  5HP4 A;  2BCV A;  2VJ4 A;  2R18 A;  3WK4 A;  4C8M A;  1N48 A;  1LKY B;  4IRK A;  4DFJ A;  9ICF A;  3QNM A;  4EEY A;  4QWB A;  4RQ7 A;  3KTQ A;  2GLE A;  2EAM A;  2P66 A;  3QZ7 A;  1L3V A;  2MU2 A;  2ASJ A;  3HW8 A;  4NLB A;  2G5H B;  4UB1 A;  3TAP A;  2ZXH A;  1JAL A;  2O6K A;  3CYM A;  3NVZ A;  2GO7 A;  1FO4 A;  2AJQ A;  4FFD A;  5J2E A;  2DPJ A;  2F2A B;  4DSJ A;  1TK0 A;  2LM1 A;  2FMS A;  4O3P A;  5KFF A;  5KFK A;  2V9W A;  3ISB A;  5H2F U;  5D49 A;  4YR0 A;  1U47 A;  4GIB A;  4EX7 A;  3DV9 A;  3TAD C;  4RQ6 A;  1S0O A;  3CRX A;  4Y2S A;  2K4E A;  1L3T A;  1WUD A;  2ZJ5 A;  1NK8 A;  2ZIV A;  3UXN A;  2W43 A;  3LVV A;  2K60 A;  4KLQ A;  4DFD A;  5BOM A;  2KOB A;  1D8L A;  3SV4 A;  1NZP A;  1KRP A;  1S0M A;  2HW3 A;  1L6N A;  4CCH A;  3TAD A;  2JHD A;  3D2Q A;  1XSP A;  3KKA C;  1IM4 A;  4O3R A;  3QUT A;  4F5N A;  4RT3 A;  3GZF A;  4OJ6 A;  4IQW A;  5ALK A;  4NLK A;  2H3V A;  5L1M A;  4JWM A;  4I28 A;  8ICI A;  7ICR A;  5J0O A;  4UAS A;  5IIN A;  1TE2 A;  3KD3 A;  2HHT A;  8ICB A;  2WF8 A;  4YN4 A;  5AI5 A;  1RM6 C;  5IIO A;  5DQH A;  4F8R A;  2CRX A;  4DQS A;  2KSO B;  5G5H A;  4JWN A;  4J9M A;  2PI5 A;  1NOM A;  2AH5 A;  4F5R A;  4DLE A;  2VAN A;  2LYA A;  4GLX A;  2KJ5 A;  4YXM A;  2EAP A;  4DEZ A;  4QZC A;  1Y88 A;  2Y1I A;  4YR2 A;  1VDV A;  4Q8E A;  2YX8 A;  5KFO A;  1T94 A;  3KZX A;  3JPP A;  2C28 A;  8ICJ A;  1SIJ A;  5J0W A;  2HHQ A;  5AKG A;  3L3F X;  4O5E A;  4DFM A;  4RT2 A;  5KG3 A;  3SAG A;  1T3N A;  2HMX A;  2LYH A;  3E58 A;  5KFG A;  4CDG A;  1MQ3 A;  1RYU A;  4KLE A;  5J0U A;  4JUZ A;  3H7I A;  3KHR A;  7ICL A;  5DB8 A;  2HDO A;  4Z6C A;  1ED1 A;  1Z1B A;  2XGQ A;  2ALZ A;  1KFT A;  2D8C A;  3V6J A;  4F4X A;  4DL3 A;  5AKK A;  5ALN A;  4HAI A;  2IMW P;  4KLT A;  4I2J A;  1NJY A;  2XGP A;  2NO4 A;  2E8M A;  3RR7 A;  2HBL A;  4ZH4 A;  5KFL A;  3LWL A;  3C2L A;  3Q8K A;  1WYG A;  2BQ3 A;  1HIW A;  4DOC A;  1NNL A;  3H0L B;  4O3M A;  5ALU A;  5HMM A;  3V6H A;  2KZM A;  4OJP A;  1ZOL A;  4USA A;  1X2I A;  3BQ1 A;  2F76 X;  3PW7 A;  5ALW A;  2JH7 A;  4J9N A;  2LYB A;  2IOH A;  1IIP A;  2QB0 B;  1M6Y A;  3OGU A;  8ICT A;  4I2D A;  9ICI A;  5L9X A;  2KFN A;  1X40 A;  4GC7 A;  4KLO A;  3TFR A;  2GOL A;  2W3S A;  4M6W B;  2PFP A;  1SV0 A;  4GFJ A;  3GV5 B;  4EZ6 A;  4PGY A;  5KFX A;  4M9G A;  4DL7 A;  3NTU A;  4ED1 A;  3RJH A;  1KEJ A;  2FI1 A;  1JMS A;  2G07 A;  5KT6 A;  4C80 A;  4ELU A;  3TFS A;  2CXY A;  5AKZ A;  1N62 A;  2PMZ F;  4QWA A;  1XC9 A;  4RUA A;  2P6R A;  8ICO A;  2KZZ A;  4IC9 A;  5J8Y C;  4PZN A;  3RB4 A;  4TUS A;  3K4G A;  3M6Z A;  3RJI A;  4UB2 A;  4DQR A;  2R8K A;  4QJF B;  1ZQR A;  2ATL A;  1BPE A;  1QSY A;  2JRZ A;  3IM1 A;  2EZZ A;  4FBU A;  1RPL A;  4CRX A;  1SKR A;  5A0L A;  3C2M A;  3J81 j;  2VKQ A;  1BPX A;  1DRG A;  1BPZ A;  4JK1 A;  4F5O A;  3MR5 A;  1V85 A;  2I5H A;  4KMU A;  5ALV A;  4FZN A;  8ICW A;  1V9P A;  5JUM A;  2RRD A;  4QZH A;  2BGW A;  4M9J A;  5B5E U;  1BNP A;  3PX4 A;  4C7Y A;  9ICQ A;  3KHG A;  4Z6D A;  2NRZ A;  4FS1 A;  2J6U A;  4YR3 A;  2ZUD A;  1MN8 A;  3RJG A;  3GQC A;  9ICL A;  5FP0 A;  5DG8 A;  3PW5 A;  3ZDC A;  5DKW A;  3IDW A;  2YB4 A;  4O3S A;  3MFH A;  1L7N A;  1JX4 A;  3I28 A;  2Y9T A;  4RQN A;  5J2F A;  3RBD A;  4R66 A;  2BPG A;  2HOF A;  2K89 A;  4BXO B;  1BVS A;  1ECW A;  2RQ5 A;  2Z7J A;  5EE9 A;  5J29 A;  8ICG A;  3D6J A;  2ISP A;  5EWF A;  1UQV A;  2GWS A;  5EE3 A;  4J9K A;  3M9O B;  2W7O A;  2E3T A;  1U9L A;  4K4H A;  2YQE A;  3OHA A;  5ALS A;  1JRP A;  4Y2U A;  3FC4 A;  5AK6 A;  5J0X A;  4F4K A;  2G5I B;  2YML A;  4ELV A;  7ICS A;  4J9S A;  1U48 A;  2MUT A;  4OJO A;  1LVH A;  3UM9 A;  1URJ A;  4R63 A;  3H8M A;  5AHX A;  2KK0 A;  4YFK A;  2M9N A;  3AU2 A;  3QXG A;  5KFC A;  4F2R A;  4DFP A;  4KN7 A;  4QZA A;  1N5W A;  7ICT A;  2IOF A;  8ICU A;  1D8B A;  9ICS A;  2Y0S F;  3RAX A;  1L8L A;  1QH9 A;  1ZRM A;  1UT5 A;  4NV0 A;  2W8L A;  4FBT A;  2R8I A;  1KKX A;  4F72 A;  3AQF A;  2MAX A;  9ICW A;  5KFZ A;  2PXI A;  2WHE A;  5KFH A;  5BOL A;  5TIS U;  2XVT A;  3HPO A;  2HHU A;  5CP2 A;  4CF5 A;  3M7D A;  3WK6 A;  1S8O A;  2KFZ A;  3ZDB A;  4MEY A;  4DF4 A;  3GFK B;  2W9B A;  8ICR A;  5IIK A;  1ZQF A;  4RQ0 A;  3QU7 A;  8ICL A;  3MGH A;  3IN5 A;  4YCX A;  4DSL A;  4EZ9 A;  3QUB A;  4GC6 A;  4F91 B;  4ED0 A;  2KKV A;  5DGB A;  1C7Y A;  2VA8 A;  3UXO A;  2E8N A;  4YQW A;  1KN5 A;  3C28 A;  2ISO A;  3LWM A;  3ISD A;  3MAB A;  5AIB A;  1TFR A;  4KX5 A;  1ZQA A;  2JH1 A;  4Q8F A;  2KIW A;  7ICH A;  9ICU A;  3H4B A;  2KE7 A;  4UAU A;  2K4H A;  1B0X A;  4TUQ A;  5HHI A;  3PW0 A;  5AK3 A;  4YMM A;  3JPO A;  1BNO A;  3Q8Q B;  4J9O A;  1PK1 A;  3FDS A;  5J0R A;  1Z1V A;  1SL2 A;  3R9K A;  4G3I A;  5ALX A;  1IV8 A;  4QZE A;  2KHV A;  5KFQ A;  1PVR A;  3RRG A;  2F77 X;  1A76 A;  3GDX A;  1ZQB A;  2R8J A;  2IA6 A;  4M9L A;  1C20 A;  2YTU A;  2ESE A;  2DWQ A;  1QTM A;  2HHV A;  1FFV A;  3QX7 A;  3OJU A;  4EBE A;  1SZH A;  4RNN A;  1ZQH A;  1NK6 A;  4QWD A;  2F1I A;  7ICO A;  3M9N B;  5KFY A;  2F8L A;  1SKW A;  4Z6E A;  5ALE A;  4C4S A;  4OJ5 A;  4M47 A;  3WKD A;  3MGV A;  2MUT B;  3EPG A;  2H3Q A;  4M0A A;  2ZIX A;  3A0B U;  1KBU A;  1XO0 A;  8ICP A;  3UMC A;  3I76 A;  3SV3 A;  5G5G A;  1J97 A;  4UAY A;  4X5V A;  1BGX T;  3KKA A;  2BKE A;  5ALD A;  4QZB A;  8ICX A;  3JPN A;  3KBB A;  2HSZ A;  2ZIU A;  2ZTC A;  2ES6 A;  1Z4N A;  3T3F A;  2KZ3 A;  3MBY A;  3LVW A;  3MR2 A;  2WF6 A;  5DBC A;  4U7C A;  7ICG A;  3C29 A;  8ICE A;  5AKH A;  4A8E A;  4YG2 A;  2W9C B;  3G6V A;  4ACO A;  1EXN A;  3H8S A;  1SXE A;  2ZIX B;  5HR7 A;  4ECS A;  3K75 D;  3M8R A;  4O5K A;  5ALR A;  5KFU A;  4I29 A;  4IRC A;  1S5L U;  5HNK A;  3JPS A;  3Q8R B;  1IG6 A;  2IBK A;  3SAH A;  1S0N A;  3ISC A;  3AEV A;  2V4R A;  2QLT A;  2ASD A;  3JPT A;  2PKE A;  1L5U A;  7ICV A;  4QZI A;  2AHO B;  4XA5 A;  3THV A;  2BCS A;  5J2D A;  2XCP A;  4KLG A;  4AYB F;  2W9M A;  4KTQ A;  1ZD4 A;  2DBY A;  5KFS A;  1KFS A;  3BS5 B;  5DB6 A;  2WTF A;  3PX0 A;  3EUB 2;  2ZIV B;  4Y2P A;  2OEH A;  4UAT A;  2BHN A;  2QAR A;  1NKC A;  5DG9 A;  3G6X A;  3M9M B;  2J6S A;  1QCK A;  5AIA A;  4RPY A;  1ZQG A;  1NJW A;  1SL0 A;  3HIL A;  2KIC A;  4UAR A;  5KFD A;  2KJ9 A;  3TAQ A;  3OSN A;  2R8H A;  9ICT A;  4M04 A;  4PGX A;  5ALI A;  1BPD A;  1CEZ A;  1WWV A;  2I1Q A;  1DK2 A;  4JV0 A;  4J9R A;  1QQ5 A;  3OTQ A;  2JEF A;  4Y2V A;  3NGD A;  3OHB A;  1SKS A;  4MF8 A;  2NO5 A;  3GU3 A;  4F71 A;  7ICE A;  2ZJ8 A;  1ZQ1 C;  4B9L A;  5AK5 A;  2R8G A;  3TAC B;  5KFE A;  5KG2 A;  4Q43 A;  5AI6 A;  3C2K A;  1TK8 A;  1VLB A;  4EYH B;  2LPE A;  4XQ8 A;  2A1J A;  3RH6 A;  1KL9 A;  5IIJ A;  3EW9 A;  2KN7 A;  5ALZ A;  4C8O A;  1WWU A;  1A6S A;  3C1Z A;  5KG5 A;  4RU9 A;  4CF4 A;  3AL0 B;  1PK1 B;  9ICC A;  1KLN A;  1HJP A;  1N61 A;  2RDI A;  4ED3 A;  3TAN A;  3TAR A;  3TQ1 A;  2L5Y A;  1TAU A;  5ALY A;  3V7J A;  2Y0S C;  3G6Y A;  2P6U A;  1YT3 A;  1A0P A;  3PO5 A;  1IXR A;  2HHX A;  5KG4 A;  3H0M B;  2F44 A;  2RHF A;  3PMN A;  2ZTE A;  5L1L A;  1T3Q A;  2LI6 A;  2EZX A;  3F5A A;  2EH9 A;  1V97 A;  3SEI A;  4QWC A;  1T4G A;  1H38 A;  2PFO A;  2LHT A;  9ICO A;  2HBM A;  4G9B A;  8ICC A;  4C4T A;  3WK7 A;  4YD2 A;  1S10 A;  3HP6 A;  1CUK A;  4GXI A;  2UVV A;  1COO A;  1D8Y A;  2Q0Z X;  2LKY A;  9ICA A;  2ZTD A;  1TAQ A;  2ZUC A;  2W55 A;  2VA3 A;  2KHQ A;  5J0Q A;  2M0N A;  3RFA A;  7ICI A;  4F3O A;  1L7P A;  2FLL A;  3T5J A;  4RPZ A;  5KFV A;  5HHH A;  1NJZ A;  3NUQ A;  2JXJ A;  4RNM A;  1XWL A;  1QQ6 A;  1ZQM A;  4B9U A;  2PI4 A;  3K1R B;  3ZI4 A;  5KAI U;  2XY5 A;  3VC8 A;  1ZYQ A;  4ECV A;  1L7O A;  8ICN A;  4J9P A;  2YMQ A;  2KJ8 A;  1MQ2 A;  4ZOH C;  4LVS A;  1HUZ A;  1SXD A;  5JTI A;  3Q8S B;  2N1R A;  3WK5 A;  4EBD A;  4P4P A;  1ZQK A;  5DBA A;  3LK9 A;  3GII A;  5KG0 A;  3ZDE A;  1RXW A;  4YVZ A;  3KZI U;  1YZ6 A;  4DL4 A;  4RQM A;  1OXJ A;  3UMB A;  2FMP A;  3AQE A;  4QZF A;  5L1I A;  1ZET A;  3RJK A;  3RJJ A;  4O3N A;  9ICP A;  3PML A;  2RDJ A;  2D3D A;  2W7P A;  5ALO A;  3KHH A;  1XSN A;  1ZQN A;  3BQ2 A;  4NL9 A;  2HBJ A;  3ZD9 A;  3SD7 A;  4IL6 U;  4PHE A;  1NJX A;  2XC9 A;  1TV9 A;  2QB0 A;  3KHL A;  2RP5 A;  5F9L A;  1ZQE A;  1ZQU A;  5AI0 A;  2QAR B;  3NVV A;  3SR6 A;  1F5S A;  8ICS A;  1WG8 A;  3N4M B;  2BDP A;  1Z19 A;  3QYP A;  3SI8 A;  1K5O A;  4EYI B;  2KV2 A;  3IRU A;  4IS7 A;  4ECQ A;  1F44 A;  3PST A;  1DXS A;  3I1Y A;  3WU2 U;  5KFT A;  4IR9 A;  5F9N A;  4KLH A;  1JI7 A;  4QW9 A;  4PHA A;  2YB1 A;  3HKZ C;  4M9H A;  4DOB A;  4F2S A;  4O3O A;  1QSS A;  3NRZ A;  2G0A A;  4F92 B;  3E0F A;  5KFR A;  2F1H A;  2D6F C;  2KMD A;  2HCF A;  2K8C B;  3MR6 A;  1NK4 A;  2BPF A;  3UPQ A;  1X66 A;  1SWW A;  3EZ5 A;  5DGA A;  5CWR A;  3K1Z A;  5KT2 A;  3IV6 A;  2G09 A;  4ED7 A;  1PVQ A;  3ORY A;  1F0M A;  2EDU A;  2W11 A;  4IQU A;  4PGQ A;  3T5H A;  4FE3 A;  2B6G A;  3M6K A;  5DQG A;  1RG6 A;  4KLJ A;  4KLS A;  2RLT A;  4ECZ A;  5AKY A;  4DQP A;  3QEA Z;  4NY8 A;  3ETL A;  1S76 D;  2UVU A;  3AU6 A;  4B9M A;  4ED6 A;  4UB6 U;  2UVR A;  7ICN A;  3F5E A;  1RXV A;  1BPY A;  4IQT A;  2IHN A;  1RQL A;  4MHV A;  4ECW A;  3BZC A;  1ZJM A;  1TKD A;  2LBO A;  9ICG A;  3GIL A;  8ICV A;  2HVI A;  1NK5 A;  2ZXI A;  5DDM A;  4PHP A;  1JXL A;  4KLD A;  5EWG A;  1Q3V A;  1ZQX A;  3VCB A;  7ICU A;  5EWE A;  3H8W A;  5ALM A;  1XSL A;  5J8Y A;  3GIM A;  4XRH A;  3JPQ A;  1ZQY A;  1X9S A;  3C23 A;  4I2I A;  2MRL A;  8ICK A;  1OUQ A;  3QZ8 A;  3OPX A;  4B6J A;  2YMP A;  3F53 A;  4KN4 A;  3BDP A;  2WAQ C;  3CP8 A;  3IP4 B;  3HWT A;  3PSI A;  2KNJ A;  2FLP A;  3HKZ F;  1ZQT A;  2HHS A;  3DDH A;  1HUO A;  2KEY A;  4BWJ A;  4QZ9 A;  2F3N A;  5AKJ A;  2C2E A;  5KL8 B;  1J2N A;  2KSO A;  2Y1J A;  4EEN A;  4O9M A;  2JEG A;  4MFC A;  5KT5 A;  5AI4 A;  1D9F A;  2ZIW B;  9ICH A;  5AM3 A;  4OJL A;  3SQI A;  3QU4 A;  1Z00 B;  5ALF A;  4ELT A;  5K4L A;  1QQ7 A;  4RPX A;  1NKB A;  2KG5 A;  4DS5 A;  5DQI A;  1UA1 A;  2NRW A;  5D4B A;  2K4I A;  2E8P A;  3PVX A;  4MEX A;  2NV3 A;  4QIW F;  1WCL A;  4TQR A;  4PH5 A;  5DG7 A;  4JB3 A;  4RQ3 A;  5DB7 A;  1DOQ A;  2DKX A;  1JN3 A;  5B66 U;  4O0I A;  3EWA A;  4BDP A;  4US9 A;  2QB1 A;  5KFB A;  9ICX A;  3M8S A;  3HT3 A;  4AYB C;  4K4G A;  4DS4 A;  3IG8 A;  1ZQJ A;  4KLI A;  2JEJ A;  3UQ0 A;  4EEK A;  3OJS A;  5J2G A;  4AP9 A;  4QZ8 A;  4P0P A;  4RZR A;  3PV8 A;  5GTH U;  4KLU A;  3LYS A;  4B9T A;  2NRX A;  4F4Y A;  5J0T A;  1O03 A;  2WF5 A;  2WB1 C;  9ICK A;  9ICM A;  1X9M A;  2KVS A;  4DSF A;  2KKP A;  1ZQZ A;  4J03 A;  5KT7 A;  3AN1 A;  5KL1 B;  1MA7 A;  2DUY A;  3C5F A;  5ALT A;  2BDU A;  3RB6 A;  4BUG A;  2K8A A;  5KG1 A;  7ICP A;  2BCR A;  4E0D A;  1NK0 A;  4ECY A;  1ZQD A;  3JPR A;  1T8E A;  3FAH A;  1ZQV A;  7ICM A;  3U26 A;  2IHM A;  3LDA A;  5ALQ A;  1U49 A;  4DL5 A;  2XY6 A;  1Z00 A;  4NLG A;  3BJY A;  5J2H A;  3V7K A;  2OYY A;  2PFQ A;  4TUR A;  5KNI A;  4DQI A;  2YMM A;  2AQ4 A;  3O0F A;  4FZM A;  1ARO P;  8ICA A;  1JRO A;  3PY8 A;  1UT8 A;  3T5K A;  4NWI A;  4RQ8 A;  3ED5 A;  4C7Z A;  4FZL A;  3SMV A;  5CHG A;  3RB0 A;  3B0Y A;  3NAS A;  3UXP A;  3UQ2 A;  1YZ7 A;  1Q3U A;  1K1S A;  2MA1 A;  5AIC A;  4BXO A;  4KLM A;  1ZQP A;  2BPC A;  1NK9 A;  2H3Z A;  1X42 A;  3N7R C;  3RH5 A;  1BPB A;  2DPI A;  5KFJ A;  2V4Q A;  4DO9 A;  4DLG A;  3MGI A;  2NYV A;  7ICJ A;  4OD0 A;  2E1E A;  4Y2X A;  2OHF A;  4UW9 A;  1NZB A;  1WCN A;  1X6I A;  4QWE A;  5L1K A;  5IIM A;  1ZQS A;  3N7P D;  5CR0 A;  1PUZ A;  2HOI A;  3QU5 A;  2ZJA A;  2P35 A;  5AI8 A;  2DGZ A;  5F3X B;  4WJ3 B;  5AM4 A;  3PO4 A;  4NLZ A;  4HYK A;  2BZF A;  4I2F A;  3C1Y A;  2UVW A;  2AGO A;  4UAV A;  3EPI A;  1Q8K A;  3MC1 A;  4UBC A;  3B9J A;  4C8L A;  4Z6F A;  5AKE A;  4J9Q A;  2W9C A;  1LB2 B;  4PHD A;  3H4D A;  4PZO A;  5CRX A;  2LMR A;  4QNL A;  3BS7 A;  3BQ7 A;  1ZQW A;  3OSP A;  1ZQL A;  4EX6 A;  2YY6 A;  2J6T A;  5CJ7 A;  2WF9 A;  4F4Z A;  3WK9 A;  2C2D A;  1XO1 A;  4FS2 A;  1N60 A;  1N56 A;  4JV1 A;  8ICH A;  5ALL A;  1ZQQ A;  2ZUB A;  3PW4 A;  4XUS A;  4DL2 A;  4NJ8 A;  4NM2 A;  4I2H A;  4I2C A;  5KFP A;  4F5P A;  5C5J A;  4RQ4 A;  1S9F A;  1N5X A;  1FEZ A;  2Q4T A;  5AM5 A;  4PJ0 U;  9ICR A;  4NLC A;  3D2N A;  1DGS A;  4YD1 A;  3TKA A;  1N63 A;  3KFU F;  8ICQ A;  2XCA A;  5AM1 A;  4R65 A;  1SB3 C;  2ZIW A;  5AKX A;  3Q8L A;  5DLG A;  2KD1 A;  2FMQ A;  2FLN A;  1FFU A;  4UB4 A;  3HX0 A;  3QE9 Y;  4ECX A;  3IG5 A;  2JEI A;  4BWM A;  5CB1 A;  5BPC A;  5DDY A;  9ICB A;  1ZD5 A;  2QKQ A;  3BQT A;  4PL2 A;  2ODG A;  1U4B A;  1L7M A;  4IQV A;  4US8 A;  3PW2 A;  3HJE A;  1DGJ A;  2XIC A;  5AM0 A;  3IHQ B;  3RH4 A;  1ZQC A;  9ICV A;  4M2Y A;  5E79 U;  2W04 A;  1SWV A;  2FPK A;  3GIK A;  3V6K A;  5KAF U;  4DSI A;  5KT3 A;  1DK3 A;  2A1J B;  2B0C A;  4YMN A;  2G08 A;  1D9D A;  3GV8 B;  1ZD2 P;  4ICA A;  4NXZ A;  4O5C A;  3NVY A;  3GV7 B;  1T7P A;  2AQ0 A;  5KTQ A;  4UBB A;  1LKY A;  5EOZ A;  3D2S A;  2BQR A;  5IIL A;  2GH1 A;  2C22 A;  2W54 A;  5L1J A;  4OCZ A;  2JMG A;  1TVA A;  1S0V A;  3L4P A;  2F8K A; 
#chains in the Genus database with same CATH homology
 3BQ7 A;  3K1R B;  1X66 A;  2F3N A;  5J8Y C;  4PZN A;  3TAC B;  1COK A;  1V38 A;  2Y9U A;  2KSO A;  5JRT A;  2KE7 A;  3H8M A;  2LPE A;  1SXE A;  1B0X A;  1F0M A;  4NJ8 A;  1SXD A;  5JTI A;  1WWU A;  2B6G A;  2EAO A;  2JV3 A;  3TAD C;  2KIV A;  1PK1 B;  5KNI A;  1PK1 A;  2KG5 A;  1RG6 A;  4RQM A;  1OXJ A;  1Z1V A;  2DKZ A;  2D8C A;  3SEN A;  1KW4 A;  1V85 A;  1OW5 A;  2E8P A;  2K60 A;  2L5Y A;  2D3D A;  2E8M A;  1B4F A;  2YTU A;  2ESE A;  4MHV A;  3TAD A;  2DKX A;  4NL9 A;  3KKA C;  4NL9 C;  2K4P A;  2QB1 A;  2QB0 A;  2F44 A;  2QKQ A;  3BS5 B;  2EAN A;  2QAR B;  5L1M A;  2QAR A;  5J8Y A;  1SGG A;  3SEI A;  1SV4 A;  2DL0 A;  2F8K A;  1UCV A;  2QB0 B;  3HIL A;  3IDW A;  4IS7 A;  1DXS A;  1X40 A;  1SV0 C;  1SV0 A;  2Y9T A;  4RQN A;  5F3X B;  1X9X A;  2KSO B;  1JI7 A;  2FE9 A;  1PK3 A;  3KKA A;  3BS5 A;  1WWV A;  1UQV A;  1LKY A;  1LKY B;  2E8N A;  2E8O A;  2ES6 A;  2GLE A;  2EAM A;  5JU5 A;  4PZO A;  2EAP A;  2KMD A;  2LMR A;  3BS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...