5L1MA

Caskin2 sam domain tandem
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
140
structure length
140
Chain Sequence
GKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKKIASEIAQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQKKLMLGVKRLAELRRGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new mode of SAM domain mediated oligomerization observed in the CASKIN2 neuronal scaffolding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Caskin-2
total genus 43
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5l1mA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5l1mA01
2ESEA 5J8YA 3IDWA 2KG5A 3K1RB 2DKZA 5JU5A 2EAMA 1OXJA 3BS5B 2JV3A 2KMDA 2E8MA 3H8MA 4PZOA 4NL9C 5F3XB 3TADC 2KE7A 2F3NA 1UCVA 5L1MA 3BQ7A 5JRTA 5JTIA 1LKYB 4NL9A 1WWUA 2L5YA 2QARA 1DXSA 1WWVA 1SXEA 2YTUA 1SV0A 2F44A 2K60A 2ES6A 1OW5A 4PZNA 4IS7A 1V85A 2D8CA 3SEIA 1SV0C 2GLEA 1SV4A 1X9XA 2F8KA 2KIVA 1V38A 2D3DA 2KSOA 1F0MA 2DL0A 1X40A 2EAPA 2DKXA 3TACB 3BS7A 1RG6A 1SGGA 4MHVA 3KKAA 3BS5A 1B0XA 1UQVA 2EANA 5J8YC 2KSOB 2QKQA 2E8NA 3KKAC 2E8OA 1JI7A 1PK3A 4RQMA 2Y9TA 1PK1B 2K4PA 2EAOA 2B6GA 2LPEA 1COKA 1KW4A 1PK1A 2QB1A 1X66A 2QB0B 4RQNA 1LKYA 1B4FA 5KNIA 3HILA 2QB0A 2QARB 2E8PA 2Y9UA 2FE9A 3TADA 1Z1VA 3SENA 2LMRA 4NJ8A 1SXDA
chains in the Genus database with same CATH superfamily
5ALPA 4OD0A 4DWIA 1GO3F 3OJSA 4MFAA 5JUMA 5CB1A 1ZQLA 4M04A 2NRXA 3NASA 2E8MA 1UCVA 3BQ7A 4I2BA 8ICFA 2EQYA 3HKZF 4ED6A 4DL3A 2OCEA 2KD1A 2DUYA 4IR1A 1SXEA 2WAQC 2LI6A 3NS1A 4J9RA 1YZ7A 4O3OA 4ECTA 2ASJA 2Y1IA 1ZRNA 2AXTU 4FZLA 2DGZA 5FP0A 4R8UA 3AUOA 3NVYA 3TI0A 5J0RA 4NXZA 9ICOA 3BS5A 2FI1A 4BUGA 2KIWA 3M6KA 1B0XA 2EANA 2LBOA 1LV5A 1DRGA 3T5KA 5DB7A 2KSOB 3RFAA 1H38A 5D46A 2K4EA 3C1YA 3WK4A 4M9NA 9ICBA 3AL0B 2FLNA 4JV1A 4Y2RA 3NVWA 2FPLA 4RQ4A 4IRDA 4KN7A 2LPEA 3WK6A 3N7SC 3M9OB 2XY6A 3V7JA 1N48A 9ICCA 3HRDD 3E0FA 2HBLA 4NLZA 3Q8MA 1T94A 4BWJA 1N62A 1TV9A 2JR5A 8ICJA 2BGWA 3PR5B 2ODGA 2FE9A 2JZBA 1Z1VA 1ZQXA 1QSSA 4Q45A 4ED3A 4XUSA 1JXEA 3UPQA 2LYBA 4OJ6A 1ZQBA 2KICA 3GQCA 4IC9A 3TANA 3WKEA 3H4BA 5JU5A 1FFUA 1IV8A 1X2IA 2W3SA 4I28A 3UQ2A 2AQ4A 5KFJA 5AKXA 2NRTA 4QWBA 2YN4A 2HOIA 2ISOA 4EX7A 2ZUBA 1DXSA 3PZPA 1S97A 2FPKA 4QWAA 1BPEA 4Z6EA 3AEVA 5KFPA 1X9MA 3PV8A 1JIHA 5J2EA 5KFBA 4CF3A 9ICGA 2W03A 4Y2UA 3PVXA 3F2DA 4NLKA 3LK9A 1K1QA 3H4DA 1UA1A 9ICVA 2BCSA 2GWSA 4RNMA 3KKAA 4ECYA 2MSNA 3FYHA 1X9SA 3PO4A 2JH7A 1Z00A 4NV0A 5AKGA 4TUSA 1NJYA 1BPXA 1QTMA 2XGQA 2GOLA 4QZ8A 3UM9A 5KFSA 2E8NA 4US9A 5KT5A 2QLTA 9ICPA 1XO0A 3H40A 4UW9A 4GXKA 2K4PA 4ED7A 1RYRA 3KD3A 1BPBA 5J0SA 1COKA 2C28A 1DK2A 5ALUA 3WKCA 3K1ZA 4PGYA 2FLLA 4TQRA 5AK5A 5AM0A 5GTIU 4LJXA 2R8GA 4XA5A 5ALDA 2M9NA 1AQ6A 4ECRA 1MSWD 4BXOB 4F3OA 3GV8B 4C7ZA 2HOFA 2RDIA 4NJ8A 2HVIA 3A0BU 5J2DA 1SXDA 3AQEA 1RXWA 1J2MA 2R8IA 5HHIA 1VJ5A 1CEZA 2KG5A 4USAA 9ICKA 2KKVA 3L5KA 1QCKA 4KLHA 1S0NA 1Y88A 2C22A 4J9PA 3C2KA 2G08A 3SAFA 2OYYA 4GXJA 2KZZA 3ONNA 2I1QA 8ICTA 2ES6A 2HBKA 1OW5A 1NK6A 5EWFA 4OJOA 1IIPA 4J9SA 3SEIA 4F2RA 1X9XA 9ICJA 2XC9A 1AROP 2D3DA 2JEGA 1RG6A 4MHVA 3HPOA 2YMMA 4DFJA 3GDXA 3EZ5A 1ZQGA 2RRDA 3TAQA 5D4BA 8ICWA 1ZQNA 4DL7A 5K4LA 2A1AA 2XY7A 4Z6DA 3KTQA 5KFEA 1ZQYA 5J0TA 1T8EA 5AKYA 4O5KA 2KTQA 2XIDA 2Y0SC 5CEHA 3GIIA 4K4GA 4R66A 4JV2A 2Y9UA 2ZIVA 4F71A 4Y2QA 1RYSA 4O5EA 4F91B 1Q8KA 4GIBA 7ICLA 3PSFA 1KKXA 4O3NA 4US8A 2K89A 5AI5A 3JPQA 1PZNA 1ZQ1C 1D8YA 5L9XA 1HJPA 1Z3EB 2KJ8A 3AMZA 3V6HA 2FMPA 2EAMA 2ZUDA 4I27A 4IR9A 5AIAA 3H8WA 3M8RA 2PFOA 5ALGA 2IHNA 3RJJA 2DFLA 4RZRA 1MA7A 3IHQB 3MGHA 4KLFA 4OCZA 2ZIUB 4KLEA 2ZTCA 5CHGA 1WCNA 4ECXA 2BHNA 2MUTA 4IRKA 7ICUA 1ZQOA 4F92B 1YT3A 3BJYA 3R9KA 4IS7A 1X9WA 4RPXA 2D8CA 2BR0A 3RBDA 1RZTA 1Q3VA 4IQUA 4DSJA 1V38A 1QQ6A 3BQTA 3HT3A 1BPDA 2W7PA 5KAFU 1KEJA 4DFKA 1U4BA 5J0PA 4CGZA 2KNJA 2V4RA 4I2CA 4F2SA 4F8RA 4F5PA 4C7YA 2KFZA 5KL1B 2YY6A 4ECUA 7ICGA 1JI7A 2D6FC 2PKEA 3C29A 4BWMA 1SKSA 4RQ2A 4HYKA 4UATA 2KOBA 1X42A 3F53A 3SAHA 1NK7A 2LM1A 1X66A 2AHOB 1DOQA 5AI8A 3TARA 2JXJA 4EZ6A 4RQ6A 1QQ7A 2VA8A 3QNMA 3L3FX 3C5FA 1L3SA 4UAZA 4CF4A 5DKWA 1URJA 2ZIVB 2ZIWA 4B9TA 3AU6A 4B6JA 4F5QA 2P6RA 2W9CB 3SV4A 2JRZA 1DGSA 5ALOA 4JWMA 5ALQA 2HHTA 1RQLA 5KFFA 5EE1A 4P0QB 2J6TA 2BCUA 4QZAA 4UAVA 2W9CA 1LKYB 2KEYA 4UB3A 5J0OA 1N5XA 2ZIXB 3C5GA 4DQQA 2HVHA 3RAXA 1UT5A 3C28A 1SWWA 5ALTA 1XSPA 4M9HA 4IQWA 3F2CA 4M9GA 8ICHA 1WYGA 2WF9A 3AU2A 3PMNA 4C4TA 4O3SA 2O6KA 3RJFA 2F8KA 4DEZA 4I2GA 4Y2VA 2KSOA 5J0YA 5J0QA 5KFUA 2R8HA 4DS5A 1QLNA 2ATLA 1PVPA 3B0XA 4OJPA 3AQFA 2HDOA 5AI0A 4YG2A 1DK3A 3U26A 5J2KA 4KLSA 3UXOA 2VKQA 4RQ0A 1JRPA 4EBCA 3Q8LA 2KHVA 1ZQVA 4UB1A 5ALFA 1S8OA 3F5AA 3H0RB 2YMQA 1N60A 5KG2A 5KFKA 2B6GA 3RF9A 3MBYA 1ZD3A 2FDRA 4IQVA 3I28A 4QZBA 4YQWA 2QB1A 2QB0B 1UT8A 4YXMA 1ZQPA 3IG5A 1ZQRA 4B9VA 1SB3C 3DDHA 7ICEA 3SENA 1L5UA 5HR6A 2XO7A 1XNSA 4GXIA 4UAUA 4DCCA 8ICIA 2LYAA 3PW4A 5ALMA 3O0FA 3KZXA 2F1IA 3JPRA 3JPNA 5F3XB 4PZOA 1X6JA 4DLGA 7ICFA 4QWCA 3TKAA 1N61A 2DQNB 1U9LA 2Z7JA 5AM1A 8ICCA 1D8BA 2KVSA 3GILA 2E1EA 1WWVA 2F8LA 4C0ZA 2YTUA 4QNLA 2HHWA 3QYPA 2E3TA 2W9MA 4O3RA 3BZCA 1FIQA 3H8JA 4KLMA 3UMBA 3SYZA 5EOZA 3WK5A 4EZ9A 1BGXT 2DKXA 1RXVA 4ELUA 1XWLA 8ICPA 1SGGA 3KHRA 4YD2A 4P0QA 5DG9A 4DSIA 5AKLA 1Z4OA 3UQ0A 4R8UB 3QUCA 2LM4A 7ICTA 4CRXA 1Z4NA 4ZOHC 2B21A 4UBBA 2PFQA 1EXNA 1KL9A 4ZH4A 5DB8A 4ED0A 4DFDA 4C8MA 4UAWA 1TAUA 1TK8A 5DLGA 3DV9A 3JPTA 5AI6A 5J2JA 1VDVA 3EW9A 4I2AA 4AYBC 3CW2C 3BQ0A 4QJFB 5AIBA 2BKEA 1ZQUA 5KFRA 2LKYA 1CI4A 2FLPA 5AICA 4TQSA 2MUTB 5DGBA 4DQPA 2DPIA 3QZ7A 2MRLA 2WF6A 2AH5A 5DQHA 5KL8B 2W9AA 1NKBA 2JEFA 1SL1A 1WUDA 5J8YA 3MR6A 4DQRA 4YFKA 2ALZA 2HOQA 3RAQA 4BJQA 2KMDA 1N63A 2WFAA 1D8LA 5JRTA 4YMMA 3CRXA 1TAMA 3RB6A 1L7PA 7ICRA 3QU5A 1XO1A 3G6VA 2K60A 2ZJAA 2HI0A 4PHEA 2DWQA 3QXGA 1PUZA 2H3ZA 5KG0A 5H2FU 5KFDA 1NZBA 3WK8A 2DF4B 1D9FA 2IA6A 3KOOA 4Y2PA 3RJEA 4DSLA 4ELTA 1PVRA 2IOFA 3QU2A 5DLFA 3QUBA 2EZZA 5T14A 3JPPA 5ALEA 1WCLA 1ZQWA 3FM9A 3UMGA 2RDJA 5C0YA 9ICTA 3Q8QB 1K1SA 4DL5A 3RB4A 1SL2A 2OEHA 5KTQA 1M6YA 2ZIUA 2K8CB 3GV5B 4Y2YA 5J2FA 3K4GA 1NOMA 5B5EU 5J2HA 4RQNA 3OGUA 1S77D 3T5LA 4DFMA 3KHGA 1ZQSA 1ZXIA 2MAXA 7ICPA 8ICQA 3KHHA 1RQNA 1D9DA 2K8AA 4EBDA 9ICIA 2UVWA 4M9LA 2H5XA 3HX0A 4NLNA 1IM4A 4RQ8A 2W8LA 4XRHA 1NK4A 9ICAA 8ICVA 4EEYA 4YMOA 2WB1F 2Y0SF 2BQUA 3ORYA 4LZGA 2KE7A 3MABA 2ASDA 2BDPA 2H3VA 4F5RA 5L1JA 2OWOA 9ICUA 3PX0A 4UASA 3RB0A 1FEZA 1V97A 1UA0A 3SAGA 3PW2A 5L1LA 4NM2A 4I2IA 2AGOA 4MF8A 4GFJA 4Q44A 5AI4A 4JV0A 3WKDA 8ICMA 2PMZC 2KIVA 3VCBA 4OJLA 5KFAA 2WF8A 3PY8A 1RPLA 4RT3A 3RH6A 3QEBZ 8ICBA 1LVHA 4YR2A 5KG3A 4GC7A 1KFTA 4ECZA 1UQVA 2J6SA 4QZIA 4K4HA 4M6WA 4QZGA 4YR0A 2G5HB 4P4MA 5KG6A 4BDPA 2E8OA 2IOHA 2FJ6A 4QZEA 4KX3A 4B9UA 3ZDAA 4UQGA 4RQMA 4YCXA 2EAOA 3MFHA 2JZBB 8ICXA 5DDMA 4KLTA 2H3FA 1J97A 1KN5A 4KLQA 5HHHA 1SKWA 5A0LA 3B0YA 4PJ0U 5IIIA 4TUQA 3QU7A 8ICAA 1ZJNA 1ECWA 5KFIA 1S76D 1MC8A 3TAPA 3N7RC 1KQQA 1YZ6A 2A1JA 3KFUF 5DQIA 1O08A 4JWNA 1V9PA 2FMQA 1SWVA 2Q4TA 4F5OA 2HHUA 1KFDA 3LDAA 5AHXA 5KT6A 3GZFA 5EE9A 3UMCA 9ICNA 4Y2JA 3ETLA 2CRXA 9ICSA 4JUZA 3RJGA 3CNHA 3PO5A 1TAQA 2W55A 3PW5A 4U6PA 4TUPA 2I9GA 2R18A 9ICLA 5L1KA 1Q3UA 8ICKA 3ICXA 5KFQA 4DOAA 4I2FA 2A3VA 3T5HA 4QW8A 4QIWC 5KFOA 1C7YA 2W3RA 2NYVA 2AGQA 2VA3A 3D2SA 3ED5A 4RQ7A 3V7LA 4BX9C 1RYUA 2HSZA 2HHXA 4F4WA 2XGPA 1F44A 3L4PA 4O3QA 2OM6A 4ED1A 5ALSA 8ICOA 1ZQMA 3UXPA 1T3QA 1O03A 4PL1A 4DOBA 1WG8A 5AKHA 5KFVA 4NY8A 2H3QA 1ZQFA 4DQSA 1TFRA 4YN4A 5AKIA 5ALKA 3H0LB 4UAYA 2DBYA 5DB6A 5KFNA 3ETRA 3D2NA 3MR5A 2BCVA 2F1JA 1B22A 1HUOA 2VJ4A 1SIJA 2KV2A 1JX4A 3OSPA 3MDCA 2YMLA 5IIOA 5AK4A 3LVVA 5ALXA 3Q8PB 3PSPA 3F5EA 2YX8A 1CUKA 3SD7A 1NJZA 4B9MA 4PGQA 1TVAA 2HBJA 2PXIA 4F93B 2XVTA 1OXJA 3V6KA 3NTUA 3EPGA 2EH9A 1ZQDA 5ALYA 1B43A 1BVSA 5KT4A 5AKEA 4C8LA 5DQGA 1U48A 3IN5A 3AM9A 1MQ3A 1RDFA 1KRPA 3QX7A 2M0NA 5BOMA 4I29A 4FS1A 2F77X 1JROA 4PGXA 1V85A 2Q0ZX 4JMUA 2GLEA 1KTQA 4ECQA 4KLGA 1F0MA 2F1HA 1P7DA 1C20A 4OO1J 2CPRA 2KP7A 5AM3A 7ICKA 9ICEA 5J0XA 1J2NA 2BCQA 2P66A 4YMNA 1L7NA 3ISBA 1BNOA 3OSNA 3LVWA 4ECVA 1SZPA 3MR2A 2H3IA 4C8KA 5KG1A 4QWEA 1XSLA 4RNOA 4M47A 3MC1A 4F5NA 2K4HA 2W54A 3GIJA 5KFMA 4DL6A 1S0MA 1TE2A 4JB3A 4A8EA 4RUCA 4UB6U 2C2RA 1NKEA 5J2AA 3D6JA 3QEAZ 1ZQAA 3EPIA 2EZYA 4ACOA 3FDSA 2E5SA 2ZIXA 4EYIB 3M1YA 1S9FA 3M9MB 1A77A 2NO4A 4CDGA 4C8NA 3NRZA 1NK0A 3AN1A 4O0IA 3EUB2 4DS4A 4K4IA 3IRUA 1L3VA 4GC6A 4YXJA 5KG7A 4RQ3A 3MR3A 1Z1BA 3K1RB 4AYBF 2NRZA 2DKZA 1NZPA 2JV3A 4Y2TA 4PHDA 1COOA 5F9LA 9ICFA 2EZXA 4C80A 4EX6A 2BPFA 3THVA 4KLLA 4Q43A 1ZJMA 3WU2U 5IIKA 3MFIA 3TFSA 4CE6A 8ICGA 2F2AB 3ISCA 3ZDDA 3VC8A 4Q8FA 2KFNA 5AK6A 9ICQA 5AM5A 2RLTA 4KITB 4P0PB 4QW9A 4MF2A 4M9JA 4C4SA 4LVSA 2LYHA 2JMGA 2NV3A 3Q8SB 4I2EA 3SR6A 3ZDBA 5J8YC 3SMVA 4B9SA 3PSTA 3KKAC 4B9NA 1UHUA 3EWAA 3QUTA 5HMLA 5KG5A 2EDUA 1PK3A 2CXYA 1Z00B 2YQEA 3NVVA 1MQ2A 2ZTEA 1FO4A 4UARA 7ICQA 4KTQA 1LKYA 5DBCA 4Y2SA 3S6JA 3RB3A 4DSFA 5KFLA 4QZFA 1L3UA 8ICYA 4DQIA 3TADA 8ICLA 5J29A 1QSLA 3TFRA 3BZKA 4F50A 5CJ7A 2KN7A 2OH2A 2P6UA 4UBCA 3PMLA 2ZXHA 3QU9A 3RTVA 1U45A 7ICJA 2XI9A 1K5OA 8ICEA 1ZQIA 5AKKA 4PHAA 5KFTA 4ED8A 5J2BA 2UVRA 2R8KA 2XCPA 4J9OA 2K4IA 2G0AA 3J81j 4YVZA 8ICSA 3K75D 3G6YA 3GFKB 5L1MA 3ALRA 4BGDA 1KDHA 2HHSA 4NLBA 2AGPA 2MA1A 4U7CA 1TK0A 4UB4A 2G07A 1WWUA 3MGVA 2QARA 1A0PA 1N56A 3M9NB 3QE9Y 1KFSA 4PHPA 4PZNA 2OXOA 2RP5A 3A0HU 3N4MB 2JEIA 2KK0A 4P4OA 5AM2A 4KLJA 4FFDA 4IQTA 9ICRA 2IHMA 3TACB 5CP2A 4F4XA 5BPCA 5KFYA 5AK3A 4E0DA 2VA2A 3B9JA 1L3TA 5D49A 3PR4A 2NRVA 2G5IB 2FPMA 2I6XA 4QWDA 3ZDEA 1NJWA 1ZD2P 8ICZA 5KT2A 4G9BA 9ICMA 4P2HA 2W11A 2ZXIA 7ICOA 1ZD5A 4X5VA 5ALIA 5G5HA 1HIWA 2MU2A 2CN1A 2V4QA 3V6JA 2HMXA 4FZMA 1PK1A 4DOCA 2PFPA 4PH5A 1NK5A 5KNIA 5KT7A 3NGDA 4NWIA 5ALWA 4R65A 2PI4A 2PMZF 5G5GA 3QUQA 1PVQA 1IXRA 2V9WA 3E2EA 2RQ5A 2KJ5A 3ISDA 1T4GA 2LMRA 2XCAA 1ZETA 2F76X 3PSIA 2RHFA 4QZCA 3QZ8A 1NK8A 5ALZA 1JMSA 1NK9A 9ICHA 5KG4A 2ESEA 4Q8EA 3IDWA 3ZDCA 5HP4A 5DBBA 3BQ2A 5AI9A 4LZDA 4C4RA 1F5SA 1JN3A 1ZQCA 2KZMA 4NL9C 2E1FA 2AJQA 5DB9A 3RH5A 4IRCA 3V7KA 2KVCA 2IMWP 4NL9A 1BNPA 7ICVA 4O3PA 1KSPA 3M6ZA 5C5JA 4KX5A 4Y2XA 4ELVA 4KLIA 1SV0A 1ZOLA 5KFCA 4UB5A 5CR0A 1OUQA 4FZNA 2G09A 2WB1C 2XICA 1SV0C 4QIWF 2J6UA 3T3FA 5J0UA 3H7IA 2DL0A 4O9MA 5CWRA 5L1IA 1X40A 4IL6U 3BS7A 4YP3A 4ECSA 2ZG6A 2ZIWB 4WJ3B 2OHFA 3OTQA 1TK5A 1JXLA 3I1YA 3E58A 4NLCA 3KBBA 4R63A 4QZHA 1U47A 2ZUCA 1S10A 4F4YA 1L7MA 3IM1A 2Y9TA 4M0AA 5ALNA 4TURA 3DEEA 4EYHB 4DL4A 2C2EA 2KHQA 3D2QA 4MFFA 2I5HA 3SI8A 4G3IA 5DG8A 2BQRA 2K8BB 1XU4A 5ALHA 4EBEA 4J03A 3CP8A 5ALLA 4M6WB 3M7DA 5DG7A 3HP6A 4EEKA 3OHBA 3LWLA 5KFZA 3CYMA 3N28A 1N5WA 3IP4B 3OJUA 1X6IA 3JPOA 3N97B 3RJIA 1TKDA 2LHTA 3JPSA 4O3MA 3MDAA 3PW7A 2PI5A 2L5YA 5J0WA 4ECWA 3HJEA 3OHAA 2B0CA 2UVVA 3RH4A 2WF5A 2A1JB 4HAIA 4J9QA 5HNKA 2ASLA 2WAQF 3EYZA 1HEKA 1L8LA 4PL2A 3C1ZA 1L7OA 4RPYA 3V72A 4MEYA 4RU9A 4J9NA 4DSEA 5E79U 2ISPA 3BQ1A 1CRXA 5J2CA 2EAPA 4YR3A 5TZVA 3SV3A 2W43A 3RBEA 3GIMA 3OPXA 4CCHA 1SKRA 3ZI4A 5J2IA 3SZ2A 3UXNA 4KLUA 5EWGA 2WTFA 3C2LA 8ICUA 2NO5A 2BQ3A 1PK1B 4KLOA 5J2GA 3NVZA 3WKAA 3WK9A 1KW4A 3IV6A 4ICAA 3MGIA 3LWMA 3RR8A 4CNQA 3Q8KA 4XQ8A 3QU4A 1HUZA 3SQIA 2W04A 2ZJ8A 4C8OA 3C23A 4DF8A 3HWTA 7ICHA 1NJXA 5DDYA 2C2DA 4J9MA 1NNLA 8ICRA 4F72A 5GTHU 3LYSA 4FE3A 1ZQQA 3KHLA 7ICIA 5KAIU 4EELA 2BZFA 4I2JA 3F2BA 4RQ1A 1U49A 2KKPA 4RNNA 5AKZA 2BPCA 3RRHA 1NKCA 3PNCA 3N7PD 5IIJA 5IIMA 1SZHA 2GO7A 2KJ9A 4MEXA 3TQ1A 4F4ZA 3H8SA 4EENA 3RJHA 3ZD9A 1BPYA 5KFWA 2F44A 5EE3A 1VLBA 2R8JA 4BXOA 4DO9A 1T3NA 4DLEA 3M8SA 4PPXA 2HW3A 1A6SA 3HW8A 1JUDA 1DGJA 3RRGA 4FO6A 4I2HA 2HCFA 4RPZA 3RJKA 4FBTA 3G6XA 3KZIU 1KBUA 1NI3A 3FC4A 1JALA 4P0PA 1ZQTA 2VJ5A 1ZQKA 3PX6A 2JH1A 9ICWA 3HKZC 5TISU 2JHDA 4RT2A 2AQ0A 5HMMA 2UVUA 3C2MA 5AM4A 2IBKA 3PW0A 4KMOB 1B4FA 4QZDA 3HILA 2QB0A 3T5JA 5KFHA 5BOLA 7ICNA 3I76A 4P4PA 2HBMA 2QARB 1SL0A 2E8PA 5EE0A 2VIXA 5EWEA 1LB2B 2XY5A 4CF5A 2JGAA 4KN4A 2WF7A 1ZQJA 3PX4A 2PFNA 4R64A 1RM6C 1Z19A 2N1RA 2W9BA 4JK1A 5KFXA 3C21A 3GIKA 2HHVA 2YMPA 3BS5B 3H8MA 3TADC 5KT3A 3RR7A 2F3NA 2FMSA 2DPJA 1ZRMA 5JTIA 5ALJA 1IG6A 3Q8RB 2BPGA 3WKBA 5B66U 3WK7A 1ZYQA 1S0VA 2A19A 3GU3A 1S0OA 4RQ5A 4OJ5A 4RUAA 1XSNA 4NLGA 5F9NA 5ALVA 1ZQHA 1ZQZA 1SV4A 2GH1A 1FFVA 1L8OA 4AP9A 8ICNA 4I2DA 4DL2A 1XC9A 1Q46A 5DGAA 1ED1A 4DF4A 4B9LA 3NRWA 1QSYA 2G06A 4DFPA 1N2XA 2BCRA 1A76A 2AU0A 1S5LU 3H0MB 5ALRA 2W9BB 2W7OA 7ICMA 2ZTDA 4FS2A 5HR7A 4DSKA 2QKQA 1MN8A 2YB1A 4Z6CA 4O5CA 2BDUA 4KMUA 4QZ9A 5KFGA 4Z6FA 3ZD8A 4ED2A 2W8KA 1QQ5A 1ZQEA 5DBAA 2Y1JA 1ZD4A 4UB8U 1KLNA 5CRXA 1QH9A 2NRWA 2KZ3A 4UB2A 4J9LA 3GV7B 2WHEA 4NM1A 2HHQA 4GLXA 3T79A 1BPZA 1UPHA 3FAHA 2VANA 2ZJ5A 2JEJA 5AKJA 1XS9D 1L6NA 5IILA 3IG8A 2IOFK 4FBUA 4YD1A 4KLDA 5CA7A 1T7PA 9ICXA 2YB4A 4F4KA 4J9KA 7ICSA 2P35A 5IINA 3NUQA 3BDPA 4MFCA 4M2YA
chains in the Genus database with same CATH topology
2ESEA 5J8YA 3IDWA 2KG5A 3K1RB 2DKZA 5JU5A 2EAMA 1OXJA 3BS5B 2JV3A 2KMDA 2E8MA 3H8MA 4PZOA 4NL9C 5F3XB 3TADC 2KE7A 2F3NA 1UCVA 5L1MA 3BQ7A 5JRTA 5JTIA 1LKYB 4NL9A 1WWUA 2L5YA 2QARA 1DXSA 1WWVA 1SXEA 2YTUA 1SV0A 2F44A 2K60A 2ES6A 1OW5A 4PZNA 4IS7A 1V85A 2D8CA 3SEIA 1SV0C 2GLEA 1SV4A 1X9XA 2F8KA 2KIVA 1V38A 2D3DA 2KSOA 1F0MA 2DL0A 1X40A 2EAPA 2DKXA 3TACB 3BS7A 1RG6A 1SGGA 4MHVA 3KKAA 3BS5A 1B0XA 1UQVA 2EANA 5J8YC 2KSOB 2QKQA 2E8NA 3KKAC 2E8OA 1JI7A 1PK3A 4RQMA 2Y9TA 1PK1B 2K4PA 2EAOA 2B6GA 2LPEA 1COKA 1KW4A 1PK1A 2QB1A 1X66A 2QB0B 4RQNA 1LKYA 1B4FA 5KNIA 3HILA 2QB0A 2QARB 2E8PA 2Y9UA 2FE9A 3TADA 1Z1VA 3SENA 2LMRA 4NJ8A 1SXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESE A;  5J8Y A;  3IDW A;  2KG5 A;  3K1R B;  2DKZ A;  5JU5 A;  2EAM A;  1OXJ A;  3BS5 B;  2JV3 A;  2KMD A;  2E8M A;  3H8M A;  4PZO A;  4NL9 C;  5F3X B;  3TAD C;  2KE7 A;  2F3N A;  1UCV A;  5L1M A;  3BQ7 A;  5JRT A;  5JTI A;  1LKY B;  4NL9 A;  1WWU A;  2L5Y A;  2QAR A;  1DXS A;  1WWV A;  1SXE A;  2YTU A;  1SV0 A;  2F44 A;  2K60 A;  2ES6 A;  1OW5 A;  4PZN A;  4IS7 A;  1V85 A;  2D8C A;  3SEI A;  1SV0 C;  2GLE A;  1SV4 A;  1X9X A;  2F8K A;  2KIV A;  1V38 A;  2D3D A;  2KSO A;  1F0M A;  2DL0 A;  1X40 A;  2EAP A;  2DKX A;  3TAC B;  3BS7 A;  1RG6 A;  1SGG A;  4MHV A;  3KKA A;  3BS5 A;  1B0X A;  1UQV A;  2EAN A;  5J8Y C;  2KSO B;  2QKQ A;  2E8N A;  3KKA C;  2E8O A;  1JI7 A;  1PK3 A;  4RQM A;  2Y9T A;  1PK1 B;  2K4P A;  2EAO A;  2B6G A;  2LPE A;  1COK A;  1KW4 A;  1PK1 A;  2QB1 A;  1X66 A;  2QB0 B;  4RQN A;  1LKY A;  1B4F A;  5KNI A;  3HIL A;  2QB0 A;  2QAR B;  2E8P A;  2Y9U A;  2FE9 A;  3TAD A;  1Z1V A;  3SEN A;  2LMR A;  4NJ8 A;  1SXD A; 
#chains in the Genus database with same CATH topology
 5ALP A;  4OD0 A;  4DWI A;  1GO3 F;  3OJS A;  4MFA A;  5JUM A;  5CB1 A;  1ZQL A;  4M04 A;  2NRX A;  3NAS A;  2E8M A;  1UCV A;  3BQ7 A;  4I2B A;  8ICF A;  2EQY A;  3HKZ F;  4ED6 A;  4DL3 A;  2OCE A;  2KD1 A;  2DUY A;  4IR1 A;  1SXE A;  2WAQ C;  2LI6 A;  3NS1 A;  4J9R A;  1YZ7 A;  4O3O A;  4ECT A;  2ASJ A;  2Y1I A;  1ZRN A;  2AXT U;  4FZL A;  2DGZ A;  5FP0 A;  4R8U A;  3AUO A;  3NVY A;  3TI0 A;  5J0R A;  4NXZ A;  9ICO A;  3BS5 A;  2FI1 A;  4BUG A;  2KIW A;  3M6K A;  1B0X A;  2EAN A;  2LBO A;  1LV5 A;  1DRG A;  3T5K A;  5DB7 A;  2KSO B;  3RFA A;  1H38 A;  5D46 A;  2K4E A;  3C1Y A;  3WK4 A;  4M9N A;  9ICB A;  3AL0 B;  2FLN A;  4JV1 A;  4Y2R A;  3NVW A;  2FPL A;  4RQ4 A;  4IRD A;  4KN7 A;  2LPE A;  3WK6 A;  3N7S C;  3M9O B;  2XY6 A;  3V7J A;  1N48 A;  9ICC A;  3HRD D;  3E0F A;  2HBL A;  4NLZ A;  3Q8M A;  1T94 A;  4BWJ A;  1N62 A;  1TV9 A;  2JR5 A;  8ICJ A;  2BGW A;  3PR5 B;  2ODG A;  2FE9 A;  2JZB A;  1Z1V A;  1ZQX A;  1QSS A;  4Q45 A;  4ED3 A;  4XUS A;  1JXE A;  3UPQ A;  2LYB A;  4OJ6 A;  1ZQB A;  2KIC A;  3GQC A;  4IC9 A;  3TAN A;  3WKE A;  3H4B A;  5JU5 A;  1FFU A;  1IV8 A;  1X2I A;  2W3S A;  4I28 A;  3UQ2 A;  2AQ4 A;  5KFJ A;  5AKX A;  2NRT A;  4QWB A;  2YN4 A;  2HOI A;  2ISO A;  4EX7 A;  2ZUB A;  1DXS A;  3PZP A;  1S97 A;  2FPK A;  4QWA A;  1BPE A;  4Z6E A;  3AEV A;  5KFP A;  1X9M A;  3PV8 A;  1JIH A;  5J2E A;  5KFB A;  4CF3 A;  9ICG A;  2W03 A;  4Y2U A;  3PVX A;  3F2D A;  4NLK A;  3LK9 A;  1K1Q A;  3H4D A;  1UA1 A;  9ICV A;  2BCS A;  2GWS A;  4RNM A;  3KKA A;  4ECY A;  2MSN A;  3FYH A;  1X9S A;  3PO4 A;  2JH7 A;  1Z00 A;  4NV0 A;  5AKG A;  4TUS A;  1NJY A;  1BPX A;  1QTM A;  2XGQ A;  2GOL A;  4QZ8 A;  3UM9 A;  5KFS A;  2E8N A;  4US9 A;  5KT5 A;  2QLT A;  9ICP A;  1XO0 A;  3H40 A;  4UW9 A;  4GXK A;  2K4P A;  4ED7 A;  1RYR A;  3KD3 A;  1BPB A;  5J0S A;  1COK A;  2C28 A;  1DK2 A;  5ALU A;  3WKC A;  3K1Z A;  4PGY A;  2FLL A;  4TQR A;  5AK5 A;  5AM0 A;  5GTI U;  4LJX A;  2R8G A;  4XA5 A;  5ALD A;  2M9N A;  1AQ6 A;  4ECR A;  1MSW D;  4BXO B;  4F3O A;  3GV8 B;  4C7Z A;  2HOF A;  2RDI A;  4NJ8 A;  2HVI A;  3A0B U;  5J2D A;  1SXD A;  3AQE A;  1RXW A;  1J2M A;  2R8I A;  5HHI A;  1VJ5 A;  1CEZ A;  2KG5 A;  4USA A;  9ICK A;  2KKV A;  3L5K A;  1QCK A;  4KLH A;  1S0N A;  1Y88 A;  2C22 A;  4J9P A;  3C2K A;  2G08 A;  3SAF A;  2OYY A;  4GXJ A;  2KZZ A;  3ONN A;  2I1Q A;  8ICT A;  2ES6 A;  2HBK A;  1OW5 A;  1NK6 A;  5EWF A;  4OJO A;  1IIP A;  4J9S A;  3SEI A;  4F2R A;  1X9X A;  9ICJ A;  2XC9 A;  1ARO P;  2D3D A;  2JEG A;  1RG6 A;  4MHV A;  3HPO A;  2YMM A;  4DFJ A;  3GDX A;  3EZ5 A;  1ZQG A;  2RRD A;  3TAQ A;  5D4B A;  8ICW A;  1ZQN A;  4DL7 A;  5K4L A;  2A1A A;  2XY7 A;  4Z6D A;  3KTQ A;  5KFE A;  1ZQY A;  5J0T A;  1T8E A;  5AKY A;  4O5K A;  2KTQ A;  2XID A;  2Y0S C;  5CEH A;  3GII A;  4K4G A;  4R66 A;  4JV2 A;  2Y9U A;  2ZIV A;  4F71 A;  4Y2Q A;  1RYS A;  4O5E A;  4F91 B;  1Q8K A;  4GIB A;  7ICL A;  3PSF A;  1KKX A;  4O3N A;  4US8 A;  2K89 A;  5AI5 A;  3JPQ A;  1PZN A;  1ZQ1 C;  1D8Y A;  5L9X A;  1HJP A;  1Z3E B;  2KJ8 A;  3AMZ A;  3V6H A;  2FMP A;  2EAM A;  2ZUD A;  4I27 A;  4IR9 A;  5AIA A;  3H8W A;  3M8R A;  2PFO A;  5ALG A;  2IHN A;  3RJJ A;  2DFL A;  4RZR A;  1MA7 A;  3IHQ B;  3MGH A;  4KLF A;  4OCZ A;  2ZIU B;  4KLE A;  2ZTC A;  5CHG A;  1WCN A;  4ECX A;  2BHN A;  2MUT A;  4IRK A;  7ICU A;  1ZQO A;  4F92 B;  1YT3 A;  3BJY A;  3R9K A;  4IS7 A;  1X9W A;  4RPX A;  2D8C A;  2BR0 A;  3RBD A;  1RZT A;  1Q3V A;  4IQU A;  4DSJ A;  1V38 A;  1QQ6 A;  3BQT A;  3HT3 A;  1BPD A;  2W7P A;  5KAF U;  1KEJ A;  4DFK A;  1U4B A;  5J0P A;  4CGZ A;  2KNJ A;  2V4R A;  4I2C A;  4F2S A;  4F8R A;  4F5P A;  4C7Y A;  2KFZ A;  5KL1 B;  2YY6 A;  4ECU A;  7ICG A;  1JI7 A;  2D6F C;  2PKE A;  3C29 A;  4BWM A;  1SKS A;  4RQ2 A;  4HYK A;  4UAT A;  2KOB A;  1X42 A;  3F53 A;  3SAH A;  1NK7 A;  2LM1 A;  1X66 A;  2AHO B;  1DOQ A;  5AI8 A;  3TAR A;  2JXJ A;  4EZ6 A;  4RQ6 A;  1QQ7 A;  2VA8 A;  3QNM A;  3L3F X;  3C5F A;  1L3S A;  4UAZ A;  4CF4 A;  5DKW A;  1URJ A;  2ZIV B;  2ZIW A;  4B9T A;  3AU6 A;  4B6J A;  4F5Q A;  2P6R A;  2W9C B;  3SV4 A;  2JRZ A;  1DGS A;  5ALO A;  4JWM A;  5ALQ A;  2HHT A;  1RQL A;  5KFF A;  5EE1 A;  4P0Q B;  2J6T A;  2BCU A;  4QZA A;  4UAV A;  2W9C A;  1LKY B;  2KEY A;  4UB3 A;  5J0O A;  1N5X A;  2ZIX B;  3C5G A;  4DQQ A;  2HVH A;  3RAX A;  1UT5 A;  3C28 A;  1SWW A;  5ALT A;  1XSP A;  4M9H A;  4IQW A;  3F2C A;  4M9G A;  8ICH A;  1WYG A;  2WF9 A;  3AU2 A;  3PMN A;  4C4T A;  4O3S A;  2O6K A;  3RJF A;  2F8K A;  4DEZ A;  4I2G A;  4Y2V A;  2KSO A;  5J0Y A;  5J0Q A;  5KFU A;  2R8H A;  4DS5 A;  1QLN A;  2ATL A;  1PVP A;  3B0X A;  4OJP A;  3AQF A;  2HDO A;  5AI0 A;  4YG2 A;  1DK3 A;  3U26 A;  5J2K A;  4KLS A;  3UXO A;  2VKQ A;  4RQ0 A;  1JRP A;  4EBC A;  3Q8L A;  2KHV A;  1ZQV A;  4UB1 A;  5ALF A;  1S8O A;  3F5A A;  3H0R B;  2YMQ A;  1N60 A;  5KG2 A;  5KFK A;  2B6G A;  3RF9 A;  3MBY A;  1ZD3 A;  2FDR A;  4IQV A;  3I28 A;  4QZB A;  4YQW A;  2QB1 A;  2QB0 B;  1UT8 A;  4YXM A;  1ZQP A;  3IG5 A;  1ZQR A;  4B9V A;  1SB3 C;  3DDH A;  7ICE A;  3SEN A;  1L5U A;  5HR6 A;  2XO7 A;  1XNS A;  4GXI A;  4UAU A;  4DCC A;  8ICI A;  2LYA A;  3PW4 A;  5ALM A;  3O0F A;  3KZX A;  2F1I A;  3JPR A;  3JPN A;  5F3X B;  4PZO A;  1X6J A;  4DLG A;  7ICF A;  4QWC A;  3TKA A;  1N61 A;  2DQN B;  1U9L A;  2Z7J A;  5AM1 A;  8ICC A;  1D8B A;  2KVS A;  3GIL A;  2E1E A;  1WWV A;  2F8L A;  4C0Z A;  2YTU A;  4QNL A;  2HHW A;  3QYP A;  2E3T A;  2W9M A;  4O3R A;  3BZC A;  1FIQ A;  3H8J A;  4KLM A;  3UMB A;  3SYZ A;  5EOZ A;  3WK5 A;  4EZ9 A;  1BGX T;  2DKX A;  1RXV A;  4ELU A;  1XWL A;  8ICP A;  1SGG A;  3KHR A;  4YD2 A;  4P0Q A;  5DG9 A;  4DSI A;  5AKL A;  1Z4O A;  3UQ0 A;  4R8U B;  3QUC A;  2LM4 A;  7ICT A;  4CRX A;  1Z4N A;  4ZOH C;  2B21 A;  4UBB A;  2PFQ A;  1EXN A;  1KL9 A;  4ZH4 A;  5DB8 A;  4ED0 A;  4DFD A;  4C8M A;  4UAW A;  1TAU A;  1TK8 A;  5DLG A;  3DV9 A;  3JPT A;  5AI6 A;  5J2J A;  1VDV A;  3EW9 A;  4I2A A;  4AYB C;  3CW2 C;  3BQ0 A;  4QJF B;  5AIB A;  2BKE A;  1ZQU A;  5KFR A;  2LKY A;  1CI4 A;  2FLP A;  5AIC A;  4TQS A;  2MUT B;  5DGB A;  4DQP A;  2DPI A;  3QZ7 A;  2MRL A;  2WF6 A;  2AH5 A;  5DQH A;  5KL8 B;  2W9A A;  1NKB A;  2JEF A;  1SL1 A;  1WUD A;  5J8Y A;  3MR6 A;  4DQR A;  4YFK A;  2ALZ A;  2HOQ A;  3RAQ A;  4BJQ A;  2KMD A;  1N63 A;  2WFA A;  1D8L A;  5JRT A;  4YMM A;  3CRX A;  1TAM A;  3RB6 A;  1L7P A;  7ICR A;  3QU5 A;  1XO1 A;  3G6V A;  2K60 A;  2ZJA A;  2HI0 A;  4PHE A;  2DWQ A;  3QXG A;  1PUZ A;  2H3Z A;  5KG0 A;  5H2F U;  5KFD A;  1NZB A;  3WK8 A;  2DF4 B;  1D9F A;  2IA6 A;  3KOO A;  4Y2P A;  3RJE A;  4DSL A;  4ELT A;  1PVR A;  2IOF A;  3QU2 A;  5DLF A;  3QUB A;  2EZZ A;  5T14 A;  3JPP A;  5ALE A;  1WCL A;  1ZQW A;  3FM9 A;  3UMG A;  2RDJ A;  5C0Y A;  9ICT A;  3Q8Q B;  1K1S A;  4DL5 A;  3RB4 A;  1SL2 A;  2OEH A;  5KTQ A;  1M6Y A;  2ZIU A;  2K8C B;  3GV5 B;  4Y2Y A;  5J2F A;  3K4G A;  1NOM A;  5B5E U;  5J2H A;  4RQN A;  3OGU A;  1S77 D;  3T5L A;  4DFM A;  3KHG A;  1ZQS A;  1ZXI A;  2MAX A;  7ICP A;  8ICQ A;  3KHH A;  1RQN A;  1D9D A;  2K8A A;  4EBD A;  9ICI A;  2UVW A;  4M9L A;  2H5X A;  3HX0 A;  4NLN A;  1IM4 A;  4RQ8 A;  2W8L A;  4XRH A;  1NK4 A;  9ICA A;  8ICV A;  4EEY A;  4YMO A;  2WB1 F;  2Y0S F;  2BQU A;  3ORY A;  4LZG A;  2KE7 A;  3MAB A;  2ASD A;  2BDP A;  2H3V A;  4F5R A;  5L1J A;  2OWO A;  9ICU A;  3PX0 A;  4UAS A;  3RB0 A;  1FEZ A;  1V97 A;  1UA0 A;  3SAG A;  3PW2 A;  5L1L A;  4NM2 A;  4I2I A;  2AGO A;  4MF8 A;  4GFJ A;  4Q44 A;  5AI4 A;  4JV0 A;  3WKD A;  8ICM A;  2PMZ C;  2KIV A;  3VCB A;  4OJL A;  5KFA A;  2WF8 A;  3PY8 A;  1RPL A;  4RT3 A;  3RH6 A;  3QEB Z;  8ICB A;  1LVH A;  4YR2 A;  5KG3 A;  4GC7 A;  1KFT A;  4ECZ A;  1UQV A;  2J6S A;  4QZI A;  4K4H A;  4M6W A;  4QZG A;  4YR0 A;  2G5H B;  4P4M A;  5KG6 A;  4BDP A;  2E8O A;  2IOH A;  2FJ6 A;  4QZE A;  4KX3 A;  4B9U A;  3ZDA A;  4UQG A;  4RQM A;  4YCX A;  2EAO A;  3MFH A;  2JZB B;  8ICX A;  5DDM A;  4KLT A;  2H3F A;  1J97 A;  1KN5 A;  4KLQ A;  5HHH A;  1SKW A;  5A0L A;  3B0Y A;  4PJ0 U;  5III A;  4TUQ A;  3QU7 A;  8ICA A;  1ZJN A;  1ECW A;  5KFI A;  1S76 D;  1MC8 A;  3TAP A;  3N7R C;  1KQQ A;  1YZ6 A;  2A1J A;  3KFU F;  5DQI A;  1O08 A;  4JWN A;  1V9P A;  2FMQ A;  1SWV A;  2Q4T A;  4F5O A;  2HHU A;  1KFD A;  3LDA A;  5AHX A;  5KT6 A;  3GZF A;  5EE9 A;  3UMC A;  9ICN A;  4Y2J A;  3ETL A;  2CRX A;  9ICS A;  4JUZ A;  3RJG A;  3CNH A;  3PO5 A;  1TAQ A;  2W55 A;  3PW5 A;  4U6P A;  4TUP A;  2I9G A;  2R18 A;  9ICL A;  5L1K A;  1Q3U A;  8ICK A;  3ICX A;  5KFQ A;  4DOA A;  4I2F A;  2A3V A;  3T5H A;  4QW8 A;  4QIW C;  5KFO A;  1C7Y A;  2W3R A;  2NYV A;  2AGQ A;  2VA3 A;  3D2S A;  3ED5 A;  4RQ7 A;  3V7L A;  4BX9 C;  1RYU A;  2HSZ A;  2HHX A;  4F4W A;  2XGP A;  1F44 A;  3L4P A;  4O3Q A;  2OM6 A;  4ED1 A;  5ALS A;  8ICO A;  1ZQM A;  3UXP A;  1T3Q A;  1O03 A;  4PL1 A;  4DOB A;  1WG8 A;  5AKH A;  5KFV A;  4NY8 A;  2H3Q A;  1ZQF A;  4DQS A;  1TFR A;  4YN4 A;  5AKI A;  5ALK A;  3H0L B;  4UAY A;  2DBY A;  5DB6 A;  5KFN A;  3ETR A;  3D2N A;  3MR5 A;  2BCV A;  2F1J A;  1B22 A;  1HUO A;  2VJ4 A;  1SIJ A;  2KV2 A;  1JX4 A;  3OSP A;  3MDC A;  2YML A;  5IIO A;  5AK4 A;  3LVV A;  5ALX A;  3Q8P B;  3PSP A;  3F5E A;  2YX8 A;  1CUK A;  3SD7 A;  1NJZ A;  4B9M A;  4PGQ A;  1TVA A;  2HBJ A;  2PXI A;  4F93 B;  2XVT A;  1OXJ A;  3V6K A;  3NTU A;  3EPG A;  2EH9 A;  1ZQD A;  5ALY A;  1B43 A;  1BVS A;  5KT4 A;  5AKE A;  4C8L A;  5DQG A;  1U48 A;  3IN5 A;  3AM9 A;  1MQ3 A;  1RDF A;  1KRP A;  3QX7 A;  2M0N A;  5BOM A;  4I29 A;  4FS1 A;  2F77 X;  1JRO A;  4PGX A;  1V85 A;  2Q0Z X;  4JMU A;  2GLE A;  1KTQ A;  4ECQ A;  4KLG A;  1F0M A;  2F1H A;  1P7D A;  1C20 A;  4OO1 J;  2CPR A;  2KP7 A;  5AM3 A;  7ICK A;  9ICE A;  5J0X A;  1J2N A;  2BCQ A;  2P66 A;  4YMN A;  1L7N A;  3ISB A;  1BNO A;  3OSN A;  3LVW A;  4ECV A;  1SZP A;  3MR2 A;  2H3I A;  4C8K A;  5KG1 A;  4QWE A;  1XSL A;  4RNO A;  4M47 A;  3MC1 A;  4F5N A;  2K4H A;  2W54 A;  3GIJ A;  5KFM A;  4DL6 A;  1S0M A;  1TE2 A;  4JB3 A;  4A8E A;  4RUC A;  4UB6 U;  2C2R A;  1NKE A;  5J2A A;  3D6J A;  3QEA Z;  1ZQA A;  3EPI A;  2EZY A;  4ACO A;  3FDS A;  2E5S A;  2ZIX A;  4EYI B;  3M1Y A;  1S9F A;  3M9M B;  1A77 A;  2NO4 A;  4CDG A;  4C8N A;  3NRZ A;  1NK0 A;  3AN1 A;  4O0I A;  3EUB 2;  4DS4 A;  4K4I A;  3IRU A;  1L3V A;  4GC6 A;  4YXJ A;  5KG7 A;  4RQ3 A;  3MR3 A;  1Z1B A;  3K1R B;  4AYB F;  2NRZ A;  2DKZ A;  1NZP A;  2JV3 A;  4Y2T A;  4PHD A;  1COO A;  5F9L A;  9ICF A;  2EZX A;  4C80 A;  4EX6 A;  2BPF A;  3THV A;  4KLL A;  4Q43 A;  1ZJM A;  3WU2 U;  5IIK A;  3MFI A;  3TFS A;  4CE6 A;  8ICG A;  2F2A B;  3ISC A;  3ZDD A;  3VC8 A;  4Q8F A;  2KFN A;  5AK6 A;  9ICQ A;  5AM5 A;  2RLT A;  4KIT B;  4P0P B;  4QW9 A;  4MF2 A;  4M9J A;  4C4S A;  4LVS A;  2LYH A;  2JMG A;  2NV3 A;  3Q8S B;  4I2E A;  3SR6 A;  3ZDB A;  5J8Y C;  3SMV A;  4B9S A;  3PST A;  3KKA C;  4B9N A;  1UHU A;  3EWA A;  3QUT A;  5HML A;  5KG5 A;  2EDU A;  1PK3 A;  2CXY A;  1Z00 B;  2YQE A;  3NVV A;  1MQ2 A;  2ZTE A;  1FO4 A;  4UAR A;  7ICQ A;  4KTQ A;  1LKY A;  5DBC A;  4Y2S A;  3S6J A;  3RB3 A;  4DSF A;  5KFL A;  4QZF A;  1L3U A;  8ICY A;  4DQI A;  3TAD A;  8ICL A;  5J29 A;  1QSL A;  3TFR A;  3BZK A;  4F50 A;  5CJ7 A;  2KN7 A;  2OH2 A;  2P6U A;  4UBC A;  3PML A;  2ZXH A;  3QU9 A;  3RTV A;  1U45 A;  7ICJ A;  2XI9 A;  1K5O A;  8ICE A;  1ZQI A;  5AKK A;  4PHA A;  5KFT A;  4ED8 A;  5J2B A;  2UVR A;  2R8K A;  2XCP A;  4J9O A;  2K4I A;  2G0A A;  3J81 j;  4YVZ A;  8ICS A;  3K75 D;  3G6Y A;  3GFK B;  5L1M A;  3ALR A;  4BGD A;  1KDH A;  2HHS A;  4NLB A;  2AGP A;  2MA1 A;  4U7C A;  1TK0 A;  4UB4 A;  2G07 A;  1WWU A;  3MGV A;  2QAR A;  1A0P A;  1N56 A;  3M9N B;  3QE9 Y;  1KFS A;  4PHP A;  4PZN A;  2OXO A;  2RP5 A;  3A0H U;  3N4M B;  2JEI A;  2KK0 A;  4P4O A;  5AM2 A;  4KLJ A;  4FFD A;  4IQT A;  9ICR A;  2IHM A;  3TAC B;  5CP2 A;  4F4X A;  5BPC A;  5KFY A;  5AK3 A;  4E0D A;  2VA2 A;  3B9J A;  1L3T A;  5D49 A;  3PR4 A;  2NRV A;  2G5I B;  2FPM A;  2I6X A;  4QWD A;  3ZDE A;  1NJW A;  1ZD2 P;  8ICZ A;  5KT2 A;  4G9B A;  9ICM A;  4P2H A;  2W11 A;  2ZXI A;  7ICO A;  1ZD5 A;  4X5V A;  5ALI A;  5G5H A;  1HIW A;  2MU2 A;  2CN1 A;  2V4Q A;  3V6J A;  2HMX A;  4FZM A;  1PK1 A;  4DOC A;  2PFP A;  4PH5 A;  1NK5 A;  5KNI A;  5KT7 A;  3NGD A;  4NWI A;  5ALW A;  4R65 A;  2PI4 A;  2PMZ F;  5G5G A;  3QUQ A;  1PVQ A;  1IXR A;  2V9W A;  3E2E A;  2RQ5 A;  2KJ5 A;  3ISD A;  1T4G A;  2LMR A;  2XCA A;  1ZET A;  2F76 X;  3PSI A;  2RHF A;  4QZC A;  3QZ8 A;  1NK8 A;  5ALZ A;  1JMS A;  1NK9 A;  9ICH A;  5KG4 A;  2ESE A;  4Q8E A;  3IDW A;  3ZDC A;  5HP4 A;  5DBB A;  3BQ2 A;  5AI9 A;  4LZD A;  4C4R A;  1F5S A;  1JN3 A;  1ZQC A;  2KZM A;  4NL9 C;  2E1F A;  2AJQ A;  5DB9 A;  3RH5 A;  4IRC A;  3V7K A;  2KVC A;  2IMW P;  4NL9 A;  1BNP A;  7ICV A;  4O3P A;  1KSP A;  3M6Z A;  5C5J A;  4KX5 A;  4Y2X A;  4ELV A;  4KLI A;  1SV0 A;  1ZOL A;  5KFC A;  4UB5 A;  5CR0 A;  1OUQ A;  4FZN A;  2G09 A;  2WB1 C;  2XIC A;  1SV0 C;  4QIW F;  2J6U A;  3T3F A;  5J0U A;  3H7I A;  2DL0 A;  4O9M A;  5CWR A;  5L1I A;  1X40 A;  4IL6 U;  3BS7 A;  4YP3 A;  4ECS A;  2ZG6 A;  2ZIW B;  4WJ3 B;  2OHF A;  3OTQ A;  1TK5 A;  1JXL A;  3I1Y A;  3E58 A;  4NLC A;  3KBB A;  4R63 A;  4QZH A;  1U47 A;  2ZUC A;  1S10 A;  4F4Y A;  1L7M A;  3IM1 A;  2Y9T A;  4M0A A;  5ALN A;  4TUR A;  3DEE A;  4EYH B;  4DL4 A;  2C2E A;  2KHQ A;  3D2Q A;  4MFF A;  2I5H A;  3SI8 A;  4G3I A;  5DG8 A;  2BQR A;  2K8B B;  1XU4 A;  5ALH A;  4EBE A;  4J03 A;  3CP8 A;  5ALL A;  4M6W B;  3M7D A;  5DG7 A;  3HP6 A;  4EEK A;  3OHB A;  3LWL A;  5KFZ A;  3CYM A;  3N28 A;  1N5W A;  3IP4 B;  3OJU A;  1X6I A;  3JPO A;  3N97 B;  3RJI A;  1TKD A;  2LHT A;  3JPS A;  4O3M A;  3MDA A;  3PW7 A;  2PI5 A;  2L5Y A;  5J0W A;  4ECW A;  3HJE A;  3OHA A;  2B0C A;  2UVV A;  3RH4 A;  2WF5 A;  2A1J B;  4HAI A;  4J9Q A;  5HNK A;  2ASL A;  2WAQ F;  3EYZ A;  1HEK A;  1L8L A;  4PL2 A;  3C1Z A;  1L7O A;  4RPY A;  3V72 A;  4MEY A;  4RU9 A;  4J9N A;  4DSE A;  5E79 U;  2ISP A;  3BQ1 A;  1CRX A;  5J2C A;  2EAP A;  4YR3 A;  5TZV A;  3SV3 A;  2W43 A;  3RBE A;  3GIM A;  3OPX A;  4CCH A;  1SKR A;  3ZI4 A;  5J2I A;  3SZ2 A;  3UXN A;  4KLU A;  5EWG A;  2WTF A;  3C2L A;  8ICU A;  2NO5 A;  2BQ3 A;  1PK1 B;  4KLO A;  5J2G A;  3NVZ A;  3WKA A;  3WK9 A;  1KW4 A;  3IV6 A;  4ICA A;  3MGI A;  3LWM A;  3RR8 A;  4CNQ A;  3Q8K A;  4XQ8 A;  3QU4 A;  1HUZ A;  3SQI A;  2W04 A;  2ZJ8 A;  4C8O A;  3C23 A;  4DF8 A;  3HWT A;  7ICH A;  1NJX A;  5DDY A;  2C2D A;  4J9M A;  1NNL A;  8ICR A;  4F72 A;  5GTH U;  3LYS A;  4FE3 A;  1ZQQ A;  3KHL A;  7ICI A;  5KAI U;  4EEL A;  2BZF A;  4I2J A;  3F2B A;  4RQ1 A;  1U49 A;  2KKP A;  4RNN A;  5AKZ A;  2BPC A;  3RRH A;  1NKC A;  3PNC A;  3N7P D;  5IIJ A;  5IIM A;  1SZH A;  2GO7 A;  2KJ9 A;  4MEX A;  3TQ1 A;  4F4Z A;  3H8S A;  4EEN A;  3RJH A;  3ZD9 A;  1BPY A;  5KFW A;  2F44 A;  5EE3 A;  1VLB A;  2R8J A;  4BXO A;  4DO9 A;  1T3N A;  4DLE A;  3M8S A;  4PPX A;  2HW3 A;  1A6S A;  3HW8 A;  1JUD A;  1DGJ A;  3RRG A;  4FO6 A;  4I2H A;  2HCF A;  4RPZ A;  3RJK A;  4FBT A;  3G6X A;  3KZI U;  1KBU A;  1NI3 A;  3FC4 A;  1JAL A;  4P0P A;  1ZQT A;  2VJ5 A;  1ZQK A;  3PX6 A;  2JH1 A;  9ICW A;  3HKZ C;  5TIS U;  2JHD A;  4RT2 A;  2AQ0 A;  5HMM A;  2UVU A;  3C2M A;  5AM4 A;  2IBK A;  3PW0 A;  4KMO B;  1B4F A;  4QZD A;  3HIL A;  2QB0 A;  3T5J A;  5KFH A;  5BOL A;  7ICN A;  3I76 A;  4P4P A;  2HBM A;  2QAR B;  1SL0 A;  2E8P A;  5EE0 A;  2VIX A;  5EWE A;  1LB2 B;  2XY5 A;  4CF5 A;  2JGA A;  4KN4 A;  2WF7 A;  1ZQJ A;  3PX4 A;  2PFN A;  4R64 A;  1RM6 C;  1Z19 A;  2N1R A;  2W9B A;  4JK1 A;  5KFX A;  3C21 A;  3GIK A;  2HHV A;  2YMP A;  3BS5 B;  3H8M A;  3TAD C;  5KT3 A;  3RR7 A;  2F3N A;  2FMS A;  2DPJ A;  1ZRM A;  5JTI A;  5ALJ A;  1IG6 A;  3Q8R B;  2BPG A;  3WKB A;  5B66 U;  3WK7 A;  1ZYQ A;  1S0V A;  2A19 A;  3GU3 A;  1S0O A;  4RQ5 A;  4OJ5 A;  4RUA A;  1XSN A;  4NLG A;  5F9N A;  5ALV A;  1ZQH A;  1ZQZ A;  1SV4 A;  2GH1 A;  1FFV A;  1L8O A;  4AP9 A;  8ICN A;  4I2D A;  4DL2 A;  1XC9 A;  1Q46 A;  5DGA A;  1ED1 A;  4DF4 A;  4B9L A;  3NRW A;  1QSY A;  2G06 A;  4DFP A;  1N2X A;  2BCR A;  1A76 A;  2AU0 A;  1S5L U;  3H0M B;  5ALR A;  2W9B B;  2W7O A;  7ICM A;  2ZTD A;  4FS2 A;  5HR7 A;  4DSK A;  2QKQ A;  1MN8 A;  2YB1 A;  4Z6C A;  4O5C A;  2BDU A;  4KMU A;  4QZ9 A;  5KFG A;  4Z6F A;  3ZD8 A;  4ED2 A;  2W8K A;  1QQ5 A;  1ZQE A;  5DBA A;  2Y1J A;  1ZD4 A;  4UB8 U;  1KLN A;  5CRX A;  1QH9 A;  2NRW A;  2KZ3 A;  4UB2 A;  4J9L A;  3GV7 B;  2WHE A;  4NM1 A;  2HHQ A;  4GLX A;  3T79 A;  1BPZ A;  1UPH A;  3FAH A;  2VAN A;  2ZJ5 A;  2JEJ A;  5AKJ A;  1XS9 D;  1L6N A;  5IIL A;  3IG8 A;  2IOF K;  4FBU A;  4YD1 A;  4KLD A;  5CA7 A;  1T7P A;  9ICX A;  2YB4 A;  4F4K A;  4J9K A;  7ICS A;  2P35 A;  5IIN A;  3NUQ A;  3BDP A;  4MFC A;  4M2Y A; 
#chains in the Genus database with same CATH homology
 2ESE A;  5J8Y A;  3IDW A;  2KG5 A;  3K1R B;  2DKZ A;  5JU5 A;  2EAM A;  1OXJ A;  3BS5 B;  2JV3 A;  2KMD A;  2E8M A;  3H8M A;  4PZO A;  4NL9 C;  5F3X B;  3TAD C;  2KE7 A;  2F3N A;  1UCV A;  5L1M A;  3BQ7 A;  5JRT A;  5JTI A;  1LKY B;  4NL9 A;  1WWU A;  2L5Y A;  2QAR A;  1DXS A;  1WWV A;  1SXE A;  2YTU A;  1SV0 A;  2F44 A;  2K60 A;  2ES6 A;  1OW5 A;  4PZN A;  4IS7 A;  1V85 A;  2D8C A;  3SEI A;  1SV0 C;  2GLE A;  1SV4 A;  1X9X A;  2F8K A;  2KIV A;  1V38 A;  2D3D A;  2KSO A;  1F0M A;  2DL0 A;  1X40 A;  2EAP A;  2DKX A;  3TAC B;  3BS7 A;  1RG6 A;  1SGG A;  4MHV A;  3KKA A;  3BS5 A;  1B0X A;  1UQV A;  2EAN A;  5J8Y C;  2KSO B;  2QKQ A;  2E8N A;  3KKA C;  2E8O A;  1JI7 A;  1PK3 A;  4RQM A;  2Y9T A;  1PK1 B;  2K4P A;  2EAO A;  2B6G A;  2LPE A;  1COK A;  1KW4 A;  1PK1 A;  2QB1 A;  1X66 A;  2QB0 B;  4RQN A;  1LKY A;  1B4F A;  5KNI A;  3HIL A;  2QB0 A;  2QAR B;  2E8P A;  2Y9U A;  2FE9 A;  3TAD A;  1Z1V A;  3SEN A;  2LMR A;  4NJ8 A;  1SXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...