5L1MA

Caskin2 sam domain tandem
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
140
structure length
140
Chain Sequence
b'GKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKKIASEIAQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQKKLMLGVKRLAELRRGLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caskin-2
publication title A new mode of SAM domain mediated oligomerization observed in the CASKIN2 neuronal scaffolding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 43
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5l1mA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5l1mA01
1PK3A 1V38A 2LPEA 4MHVA 5JU5A 2EANA 2DKXA 2D8CA 1COKA 1RG6A 3SENA 2KG5A 2QKQA 2DKZA 1SV4A 3TADA 3BS7A 4RQMA 1JI7A 2YTUA 4NL9A 1X40A 2QB1A 1SGGA 2D3DA 3H8MA 5F3XB 3SEIA 2KMDA 2B6GA 1WWVA 1OW5A 4RQNA 1SV0A 3TACB 1B4FA 1SXDA 3BS5A 1LKYB 4IS7A 2K4PA 3KKAA 2FE9A 1OXJA 1SXEA 2F8KA 1PK1B 5J8YA 2K60A 1UQVA 3K1RB 2JV3A 2DL0A 1LKYA 2E8NA 2L5YA 2Y9UA 1WWUA 2F3NA 2KSOB 1F0MA 3HILA 1X66A 4PZOA 2F44A 1X9XA 5JTIA 5JRTA 2EAOA 3BQ7A 1SV0C 2E8OA 4NJ8A 2KIVA 3KKAC 5J8YC 3TADC 2ESEA 4NL9C 1PK1A 2QB0B 2E8MA 1UCVA 4PZNA 2Y9TA 1Z1VA 2KSOA 3IDWA 2QARB 2LMRA 2ES6A 2QB0A 2GLEA 3BS5B 1KW4A 2EAPA 1B0XA 5KNIA 1DXSA 2EAMA 1V85A 2E8PA 2KE7A 2QARA 5L1MA
chains in the Genus database with same CATH superfamily
3AU6A 3OJUA 1WCLA 8ICMA 3QU7A 4KLSA 2WAQF 3AN1A 2D8CA 4C0ZA 3HRDD 1NK5A 2V9WA 5KFTA 1SV4A 2YN4A 3WK8A 4U6PA 5J29A 2KOBA 3DV9A 4O3RA 4KX5A 3FAHA 1S0NA 4GXKA 1DOQA 5ALHA 4DFKA 5ALIA 5HHIA 4UB4A 4DQSA 1Z3EB 3BS5A 1KBUA 2ZTCA 1QSYA 2YB4A 7ICLA 2YMMA 1T94A 2DF4B 2K60A 1RXVA 1TE2A 4O3OA 5J2KA 2IOFA 3RAQA 1MQ3A 5AIBA 2FPKA 5CWRA 3QU9A 2EZYA 2GO7A 2RHFA 2K8CB 1CI4A 5G5GA 5JRTA 2WHEA 3WK6A 1SV0C 5H2FU 5J0WA 1HUZA 3ZD8A 4M6WB 3QEAZ 4DEZA 1TVAA 3RB4A 5KT6A 3Q8RB 1JX4A 4RNMA 2WAQC 5BOMA 3RRHA 3K4GA 5J0YA 2IHNA 2ZXHA 1C7YA 5J2JA 1PZNA 4YXJA 3E2EA 4KLFA 4DCCA 2LMRA 5J2CA 5ALVA 2QB0A 1QQ6A 1KRPA 4F5QA 2FLPA 4DF8A 4KLQA 8ICCA 5J2FA 4AP9A 5J0SA 4ECWA 4UAYA 1PVPA 4KX3A 2LPEA 1NK4A 1CEZA 5AKHA 3ETRA 9ICXA 4E0DA 5AM0A 2ISOA 2BPCA 2A1JB 8ICZA 4UBBA 2YY6A 2A19A 5KG3A 9ICQA 3AEVA 4R65A 5J0OA 1QLNA 2KTQA 2PXIA 4XRHA 4J9OA 5HP4A 7ICOA 3T79A 5A0LA 1ZD2P 2KVSA 1L7MA 4Z6DA 1DK3A 3PO5A 4G9BA 3QUBA 4I2AA 2XCPA 3QE9Y 3TAQA 1RQNA 3BZCA 1TFRA 5AI8A 3AM9A 3EUB2 1X9WA 2DUYA 4KLMA 4USAA 3EPIA 5AM3A 4C7ZA 3D2QA 4BUGA 4ECRA 2ZIUB 3Q8SB 3JPQA 1KTQA 4RPXA 1IM4A 2XIDA 4OD0A 4PPXA 3LDAA 5J0QA 1KEJA 4EX6A 2MAXA 1FFUA 2K4IA 5B66U 1TK5A 3WKDA 3MGIA 4KLIA 3GFKB 2NO4A 3KKAC 5CP2A 3RH5A 4ED3A 3BDPA 5KFMA 1VJ5A 3WKEA 3H4DA 2PFOA 5L9XA 1PK1A 3CP8A 3VC8A 4YR3A 4PZNA 2HOIA 2W7PA 2G06A 1A6SA 1ZRMA 1NI3A 3OHAA 5KAFU 4PGQA 3C28A 1T8EA 1D8BA 4Y2YA 2K8BB 2I9GA 2Y0SF 2F1HA 3UXNA 4UB5A 5L1MA 1KFDA 2ODGA 5EE0A 1X9SA 4C8MA 3RFAA 2HDOA 2M9NA 2W11A 2R8HA 5KFXA 4DSKA 8ICLA 3MR2A 3QU5A 4DFDA 1BPEA 1GO3F 5KFHA 4QZIA 3M8SA 3JPOA 2BR0A 2E1EA 4NL9A 7ICGA 4YP3A 1N5WA 2H3VA 5DLGA 3L3FX 4IC9A 1NOMA 3ED5A 2ZUDA 3LWLA 4RQ8A 3I28A 3PSIA 4C7YA 1ZQDA 3PVXA 1LKYB 5AKXA 4QZEA 2XCAA 4YQWA 4NLCA 2PFNA 3U26A 1L6NA 5DBBA 5AK4A 2QLTA 1ZQNA 4RT2A 2BKEA 4I27A 3UPQA 7ICHA 4ED8A 3M9NB 2XC9A 2AGQA 1ZETA 1X66A 5DLFA 1X6JA 1QSSA 5EE1A 4PHPA 3KTQA 2H3ZA 8ICPA 3JPSA 5D46A 3A0HU 5KFCA 2F1IA 2FPLA 2EH9A 4NJ8A 3V7JA 1NKCA 4O3PA 3KZXA 5KFAA 1M6YA 4BWMA 3M9OB 1TAUA 2BCRA 1KDHA 4X5VA 3F5AA 1S0VA 2OH2A 9ICCA 5EWEA 1X2IA 3HKZF 2BPGA 3QU4A 4F72A 4R64A 3IRUA 2NV3A 3RJGA 4C80A 2XY6A 3N4MB 3H0RB 4DWIA 1U49A 4O9MA 2HVIA 3ICXA 4TUPA 2WF6A 4RPYA 2F1JA 1L3SA 4PHDA 5HMMA 2E3TA 4M6WA 4C4RA 4CGZA 3SQIA 2OCEA 1DRGA 8ICNA 1NZBA 4I2BA 1UT5A 1F5SA 2H3FA 4DL7A 2B0CA 4YMMA 3UQ0A 5AK6A 5F3XB 5KFUA 4Y2SA 2KNJA 3SEIA 4RQNA 4QIWF 1SV0A 4IRDA 4NV0A 3ISBA 4F92B 2BDPA 5K4LA 4B9NA 3UXOA 4GLXA 3E58A 2CPRA 2F8KA 5KTQA 4K4HA 4P4OA 3RH4A 4B9VA 1SL2A 2CRXA 8ICOA 1Q46A 4RT3A 4MEXA 2E8NA 4YMNA 1S9FA 1ZOLA 2A1JA 5J0RA 4FFDA 9ICTA 2KV2A 1X9XA 3BQ0A 5CR0A 4IR9A 3CRXA 9ICAA 3BQ7A 2F2AB 2E8OA 5AM1A 4Y2QA 5HR6A 3H0LB 3PY8A 2VIXA 3PSPA 4JMUA 4U7CA 1SZPA 3RJFA 8ICGA 2W9CB 1NJWA 5KG7A 1ZQXA 3V6JA 4UAWA 2QB0B 1HUOA 5KL8B 2BHNA 1AROP 2JZBA 5E79U 4DFPA 2P35A 5EWGA 2ZIUA 3TAPA 3RR7A 3WKAA 1T3NA 9ICMA 2CN1A 1XU4A 2NO5A 2HBMA 2CXYA 4RZRA 1V9PA 5J0TA 8ICTA 3H7IA 2W9MA 5J2HA 4TQSA 4DSFA 3RH6A 5G5HA 3OHBA 4M0AA 8ICBA 5IIMA 3GIJA 5AI4A 2G07A 4DSIA 5ALZA 3PR5B 2LHTA 1ZRNA 1Z4NA 3QNMA 3GV8B 1NK9A 5DGBA 3TQ1A 2F76X 4M47A 1TAMA 5L1IA 3IN5A 4PH5A 2UVRA 4O3QA 8ICRA 4DL6A 3H8SA 4IQTA 4MF8A 2K4PA 3KKAA 2FE9A 4IRCA 4OCZA 3Q8PB 4C8KA 2G0AA 2MSNA 3PW7A 2ASJA 1KSPA 2RLTA 4F93B 1BNOA 5KL1B 3ZDEA 2KHQA 4M04A 3HILA 8ICIA 2RP5A 3QZ7A 4NLBA 5DBCA 3RR8A 2IOFK 3BQ1A 2W43A 4P4MA 3MBYA 2G5IB 4UASA 1L3TA 4ECYA 2DPIA 2AGPA 3EW9A 1YZ7A 4TUQA 2ZG6A 5J8YC 4BJQA 4NL9C 2VJ4A 3K75D 4CF4A 1J97A 3AUOA 1ZQ1C 2HMXA 5AHXA 5EE9A 2EZZA 4MEYA 5ALRA 4ECSA 3HWTA 3PW2A 3IDWA 4C8NA 2FMSA 3ZDCA 1DGSA 3SV4A 1JUDA 1ZQZA 1K1QA 1QQ7A 2FLLA 3SI8A 4GIBA 5IIKA 4QW8A 1KFSA 1SWWA 5ALYA 3RRGA 4DLEA 1MSWD 3NS1A 4CF5A 2DKXA 4OJPA 4Y2PA 2O6KA 5KFQA 2VA2A 2UVWA 4RQ5A 2YTUA 2P66A 1RYSA 1BPZA 3D2SA 2K4HA 3NRWA 5DQIA 1JXEA 4UB8U 2RDIA 5AKLA 4EBDA 9ICVA 2VKQA 1L8OA 1OW5A 4KLUA 4Z6CA 4QWBA 3QUQA 2AU0A 4KLJA 1NK0A 4OJLA 3TI0A 1COOA 8ICXA 4EEKA 3ETLA 3HW8A 3C21A 4MF2A 3V7KA 5HNKA 7ICJA 4ZH4A 3SYZA 1ZQOA 3Q8QB 4F4YA 4DL4A 2HSZA 5KT2A 3ALRA 2EAOA 5ALFA 4HAIA 4FS1A 1ZJNA 4B9UA 2KIWA 5AIAA 1PUZA 1T3QA 3FYHA 4JK1A 4KMOB 1X42A 4I2CA 4M9HA 5HR7A 4F50A 2EDUA 2W8KA 4B9TA 4R63A 3AL0B 5L1JA 2HBJA 3NVZA 2JEFA 5IILA 5AKEA 4J9QA 3SAGA 4O5CA 2HHVA 4FE3A 5GTHU 2K4EA 2R8GA 3C29A 3RJHA 1SWVA 5GTIU 1FO4A 1IIPA 3DDHA 1SKWA 2KD1A 4IRKA 2JEIA 1A77A 4Y2TA 3G6YA 1BPDA 1L3VA 1PK3A 4UQGA 2UVUA 2R8JA 4F91B 1SIJA 1Z4OA 4M9NA 2QKQA 3TADA 5KFKA 2W9CA 2HHTA 2H5XA 1X40A 4ELVA 2QB1A 1SGGA 3RB6A 3H8MA 4C4SA 1XS9D 3HPOA 3SAFA 2HI0A 3T3FA 4ECTA 3MGHA 4C8LA 1HEKA 4F5PA 7ICKA 4Y2UA 2HHSA 5DG7A 4UB6U 2FMPA 2KHVA 3MGVA 5C0YA 4P0PB 5CJ7A 5HHHA 4B6JA 4F5RA 3RJJA 2DBYA 5J2BA 2R8KA 2JV3A 4YN4A 2Y1IA 4I2GA 8ICSA 3GIMA 1RM6C 3C2MA 3H4BA 4F3OA 4R66A 4RU9A 4DF4A 4LZDA 5EWFA 3QZ8A 5AKGA 1UT8A 4EELA 5T14A 4OJOA 4O3MA 9ICFA 1ZQYA 2JZBB 3GU3A 1ZQLA 5KG4A 2BQUA 3RBEA 1RXWA 5ALKA 1NK6A 2HHXA 2Z7JA 3MR3A 2IA6A 2AQ4A 3AQFA 5AI5A 3IHQB 2KN7A 3ZDBA 5D49A 3LWMA 3CYMA 4KMUA 5KFOA 3KFUF 3PW0A 1NJXA 1H38A 5DQGA 2JGAA 5D4BA 2ISPA 2IMWP 3ONNA 2EAMA 2JHDA 5KFWA 1LV5A 4EZ6A 4YG2A 4MHVA 5DBAA 4DOBA 5KAIU 5KT5A 1AQ6A 1COKA 1MC8A 4NY8A 4M9GA 4YFKA 2JMGA 4DS5A 4RQ4A 1MA7A 2W7OA 1S0OA 4KN7A 2I6XA 1SXDA 3IP4B 4GFJA 4UW9A 2ZIVA 1XSLA 4B9MA 5AICA 5DB8A 5J8YA 2FPMA 4QWCA 2ALZA 5ALSA 2BZFA 5CRXA 1NJYA 4ELUA 3M9MB 2LYAA 3C5GA 9ICSA 4FZMA 2F44A 4I2IA 1TK8A 5JTIA 1NZPA 3T5KA 3SD7A 5ALUA 1ZQIA 1XWLA 4ICAA 4P4PA 4YD2A 9ICKA 1U45A 5HMLA 1J2NA 4BDPA 3OJSA 3GIIA 1ZQPA 1MN8A 3PMNA 3G6XA 4I2HA 2AXTU 2HBLA 4JV2A 4NLNA 5KG1A 4IR1A 5B5EU 1ZD4A 2Y9TA 5ALNA 9ICHA 3KBBA 9ICBA 2HHUA 5AI6A 3EZ5A 2M0NA 3JPPA 2YMPA 2GLEA 2XGPA 3H8WA 1URJA 5BOLA 3E0FA 2WFAA 2Y0SC 4RUCA 4GXJA 5J2DA 3PV8A 1YZ6A 4EENA 4M9LA 2G5HB 4RNOA 3ZD9A 3M7DA 2G09A 8ICJA 4NM1A 4M9JA 2FJ6A 4QZAA 2KFZA 5J2IA 5JU5A 4QZCA 3HJEA 2DGZA 3C1ZA 5TISU 5DQHA 4RQMA 4Y2VA 3QU2A 7ICSA 3RAXA 1KKXA 2ASDA 4DQPA 3B0XA 4CRXA 2F8LA 4TUSA 3MABA 4WJ3B 5AK3A 1A76A 5KFPA 8ICYA 4XUSA 4B9SA 1XSPA 3ZDDA 9ICWA 1MQ2A 4OJ5A 2AHOB 1QH9A 5CEHA 1JN3A 2EZXA 3EPGA 3F2DA 3F53A 3H0MB 3RB3A 4J03A 5IIIA 8ICHA 8ICKA 3WU2U 4DL5A 4IQWA 2XI9A 4KLDA 1SZHA 4EX7A 4G3IA 2DFLA 1B22A 4JWMA 3QXGA 2C28A 3MFIA 1ZQKA 3GV7B 3A0BU 7ICFA 4DQQA 4F5OA 3HX0A 2XY7A 4ECUA 4RQ1A 2ASLA 2BCVA 2B21A 1S10A 3TADC 4ED1A 4P0PA 4ED7A 3F2BA 3FC4A 4UB3A 3HKZC 2JH7A 3F5EA 2KFNA 1ED1A 2YMQA 3V6HA 4PHEA 2ES6A 4DSEA 9ICJA 5AM2A 2PMZF 2KZZA 3BZKA 7ICTA 1UA0A 2W9BB 1PVQA 1JROA 1N2XA 3UMGA 5IIJA 4K4IA 2C2RA 2IHMA 2DKZA 5J0PA 3S6JA 2C2DA 1QQ5A 4EEYA 2WB1F 1SKRA 3GQCA 4QWDA 2JH1A 4YR0A 4QIWC 3V7LA 1N5XA 1HIWA 1ZQAA 2HVHA 3N7PD 4TQRA 3Q8MA 3HT3A 1TV9A 4AYBF 1Q3UA 4IS7A 4UAVA 4Y2RA 5DG8A 4QZBA 4DSLA 3TKAA 3LVWA 2K89A 1WUDA 2ZJ5A 1F0MA 2BQRA 3GV5B 4PL1A 4P2HA 5F9LA 1S0MA 4Q8FA 1ZQCA 3M1YA 7ICEA 4B9LA 1Q8KA 5C5JA 3TFRA 3ZI4A 4QZHA 2KEYA 4KITB 4F2RA 2AJQA 2J6TA 1RPLA 2FI1A 4FZLA 1Z00B 4Z6FA 2F77X 4Q8EA 3NRZA 4US8A 4Z6EA 3K1ZA 2JXJA 2XGQA 1Z1VA 5KT4A 5AK5A 5KFLA 5ALGA 7ICMA 4MFAA 3HP6A 2WB1C 4DQIA 3CNHA 5KG5A 4ECQA 5BPCA 3NVYA 2OM6A 4P0QA 4QWEA 1B0XA 1ZXIA 2ZTDA 2HBKA 2W04A 2KE7A 5AI9A 2KJ9A 4AYBC 2P6RA 2W3RA 4F2SA 8ICFA 1NK7A 3VCBA 3L4PA 1XO1A 1Z19A 1D8YA 5AI0A 3SV3A 3AU2A 2LM4A 1P7DA 2OHFA 2Y1JA 5AKIA 2JRZA 2UVVA 2BQ3A 1BPYA 3T5LA 5AKZA 1HJPA 4O0IA 5F9NA 2ZIVB 9ICIA 2ZIXB 1KN5A 1CUKA 2JEJA 4F4ZA 4ED6A 1ZJMA 3TACB 2KKPA 1U9LA 1U4BA 1CRXA 2WTFA 2A3VA 3Q8KA 5J2AA 4O5KA 8ICVA 3UQ2A 1QTMA 4Q43A 7ICRA 4DOCA 4MFCA 2KJ5A 2J6UA 4IQUA 2Y9UA 1FEZA 1UHUA 3TFSA 5JUMA 5KFGA 2WF8A 2ZUCA 3KHGA 4C8OA 1TKDA 7ICIA 4XQ8A 1JXLA 2OYYA 1KFTA 3RB0A 3KHHA 4RQ0A 1OUQA 4ELTA 2MU2A 1D8LA 2MRLA 4RQ2A 1JIHA 4I29A 5J0XA 5AKYA 2ESEA 3RJKA 1KL9A 7ICQA 3NVWA 1V97A 3D2NA 1ZQTA 1UCVA 4QWAA 1ZQWA 4F8RA 2RRDA 4NXZA 4IQVA 4J9RA 2ZUBA 1ZQJA 4LJXA 3I1YA 2FLNA 2HHQA 1KW4A 2OEHA 3Q8LA 1V85A 3DEEA 3KHLA 3GIKA 3UMBA 1V38A 2IOHA 3QYPA 4JV0A 5FP0A 3MFHA 1N62A 1S5LU 4DSJA 3EWAA 3QUCA 2ZIWB 3H40A 1SB3C 4DOAA 4KLOA 8ICQA 1S97A 4J9SA 1Y88A 5J2GA 3NASA 3TANA 2WF9A 4GC6A 3C2KA 4CE6A 1RQLA 2NRXA 2KMDA 2FDRA 3QUTA 2VJ5A 3IM1A 2W54A 4QJFB 4QZ8A 2BGWA 1ZQQA 2BPFA 1U48A 9ICOA 3OSNA 1OXJA 1SXEA 2KZ3A 4KLEA 1ZQSA 4UBCA 4PGYA 2W9BA 3C5FA 1RZTA 7ICUA 5DGAA 5J2EA 1WWUA 3C23A 4DS4A 2HCFA 5ALEA 4J9KA 2YMLA 4DL2A 3OGUA 5AM5A 1ECWA 5ALDA 4KLGA 3CW2C 1ZQBA 2EQYA 3FDSA 5ALMA 5AKJA 4YMOA 4DL3A 2HOFA 2W55A 2XICA 4QZ9A 4DLGA 1IG6A 1FIQA 1PVRA 2P6UA 4YCXA 4BXOB 2E8MA 3WKBA 4ECZA 5DB6A 1UA1A 4NLKA 4NM2A 3N97B 4PHAA 1FFVA 1SKSA 5ALXA 3B9JA 4MFFA 3T5HA 5KFJA 3PNCA 2QARA 2V4RA 1WG8A 4RNNA 3C1YA 2NRVA 3PSFA 1T7PA 5ALWA 3TARA 1JALA 2W9AA 1Z00A 1RG6A 3WK9A 4Q44A 3SENA 3RJEA 2RDJA 4C4TA 3FM9A 3B0YA 4OJ6A 3SZ2A 3QX7A 3PMLA 1K5OA 1RDFA 4RPZA 3OSPA 3JPRA 1ZD3A 5KFDA 3ISDA 4US9A 3NTUA 3MC1A 2R18A 3UM9A 3MR5A 5KFEA 2YB1A 5TZVA 4F5NA 3QEBZ 3PW4A 4K4GA 4RQ7A 2LBOA 4PGXA 2J6SA 2MA1A 8ICUA 4Q45A 2YX8A 4HYKA 4QZGA 3RBDA 2KICA 1QCKA 4KTQA 4I2EA 2Q0ZX 4FZNA 3M6ZA 2KK0A 4UAUA 1L7PA 2F3NA 3MR6A 2KSOB 1T4GA 4DFJA 1F44A 3ZDAA 4YXMA 1J2MA 2KVCA 7ICVA 4NLZA 3AMZA 4Y2JA 3M8RA 2ZIXA 4FO6A 2I5HA 1WCNA 4KLHA 2V4QA 7ICPA 2ZJAA 2VANA 1A0PA 3V72A 2K8AA 2Q4TA 3BQTA 1TK0A 2ZTEA 1N48A 5ALQA 2ZXIA 4R8UB 4I28A 4P0QB 4EBCA 9ICEA 4NWIA 1WYGA 2OWOA 9ICLA 4DO9A 1ZQGA 4Y2XA 3BQ2A 3SMVA 3RTVA 3KHRA 4LVSA 5J0UA 1S76D 4PL2A 2HOQA 5KT7A 2D6FC 2N1RA 8ICWA 2C2EA 2MUTA 5DG9A 2AGOA 3KOOA 1Q3VA 2KJ8A 2GH1A 2KG5A 3BJYA 1Z1BA 4A8EA 1L5UA 5AM4A 3ORYA 2NYVA 5KFFA 2D3DA 1ZYQA 4EBEA 4YVZA 3OTQA 1SL0A 1WWVA 5CB1A 1L7OA 2PI5A 2H3QA 1RYUA 5ALTA 2KP7A 4UB2A 3KD3A 4J9PA 2VA8A 4ED0A 5ALPA 4CDGA 4NLGA 5DB9A 1XNSA 3H8JA 4EZ9A 2E1FA 3K1RB 2NRTA 4YD1A 1BNPA 4PJ0U 2L5YA 5KG6A 3T5JA 2ZIWA 4KLLA 3WKCA 5IINA 4CNQA 4PZOA 5KG0A 4FBUA 1N63A 2WF7A 5KFYA 3MDCA 2KIVA 1ZQVA 3OPXA 2PFPA 9ICNA 4QZDA 2ATLA 5KFNA 2R8IA 2GOLA 3G6VA 1L8LA 3PX0A 5KT3A 1TAQA 1UPHA 5CA7A 4M2YA 3F2CA 1DGJA 2XVTA 9ICGA 9ICRA 2W3SA 3SAHA 3BS5B 4ZOHC 4JB3A 1NKBA 2FMQA 1DXSA 2E8PA 4RQ6A 1XSNA 4KN4A 3JPNA 2BCUA 2GWSA 2HW3A 4O5EA 3GDXA 1X9MA 2EANA 1IV8A 4UARA 4UAZA 4F4XA 5EOZA 2BDUA 3EYZA 1SL1A 4BWJA 3WK4A 4BXOA 1X6IA 4J9LA 2WF5A 1U47A 3O0FA 4ACOA 4GC7A 1RYRA 1ZQHA 2B6GA 2W8LA 4BGDA 3GZFA 1B4FA 2AQ0A 2BCSA 5KFRA 8ICEA 2RQ5A 4XA5A 4J9MA 4ECVA 3D6JA 2OXOA 3RJIA 2IBKA 3NGDA 4IL6U 5KFIA 2W03A 4QNLA 1O08A 5DB7A 1QSLA 3NUQA 3N7SC 1LVHA 2DPJA 1N60A 3PZPA 4UB1A 5KFSA 2ZJ8A 1D9FA 2G08A 4JV1A 2NRWA 5KFBA 1S8OA 3SR6A 2PKEA 3GILA 5ALLA 5ALOA 3UXPA 3MDAA 4UATA 1ZQFA 5KG2A 4GXIA 1L7NA 2KSOA 4YR2A 2QARB 2I1QA 4I2DA 5DKWA 3JPTA 2LI6A 5DDYA 3N7RC 2EAPA 2PMZC 4F4WA 4ED2A 5KNIA 1NJZA 3AQEA 2XY5A 3PX4A 3RF9A 3PR4A 1KLNA 7ICNA 1BPBA 2DQNB 4QZFA 3V6KA 3N28A 4JUZA 4EYHB 1BPXA 4JWNA 3ISCA 3LK9A 5CHGA 1ZQEA 4I2JA 3IV6A 3BS7A 1ZQMA 2JR5A 1JI7A 4F4KA 4BX9C 1KQQA 9ICUA 1ZQRA 5L1KA 2H3IA 1BVSA 3PSTA 4R8UA 4TURA 3C2LA 2DWQA 1NKEA 9ICPA 3I76A 1B43A 1YT3A 2VA3A 2JEGA 1XC9A 4F71A 4FS2A 2KKVA 2BCQA 1D9DA 1BGXT 5KFVA 4DQRA 1PK1B 1L3UA 3L5KA 1UQVA 3J81j 1LB2B 1NK8A 1JMSA 2DL0A 2E5SA 1LKYA 1VLBA 4J9NA 5KFZA 2PI4A 4RQ3A 4CCHA 4OO1J 2HHWA 1O03A 2NRZA 2LYHA 3PO4A 2PFQA 4QW9A 3M6KA 4ECXA 4EYIB 3WK5A 1XO0A 3NVVA 1K1SA 8ICAA 1EXNA 5L1LA 2A1AA 1JRPA 2YQEA 1ZD5A 4LZGA 5AKKA 1VDVA 3PX6A 2LM1A 2LKYA 3KZIU 3WK7A 1IXRA 3PW5A 1NNLA 3IG8A 1N61A 4KLTA 4CF3A 4DFMA 1DK2A 1C20A 3LYSA 5IIOA 2AH5A 4I2FA 1ZQUA 3IG5A 4RUAA 4O3SA 2MUTB 1N56A 5EE3A 2C22A 3R9KA 5ALJA 3THVA 4FBTA 1S77D 4O3NA 2KZMA 5DDMA 3LVVA 2LYBA 2XO7A 3UMCA
chains in the Genus database with same CATH topology
1PK3A 1V38A 2LPEA 4MHVA 5JU5A 2EANA 2DKXA 2D8CA 1COKA 1RG6A 3SENA 2KG5A 2QKQA 2DKZA 1SV4A 3TADA 3BS7A 4RQMA 1JI7A 2YTUA 4NL9A 1X40A 2QB1A 1SGGA 2D3DA 3H8MA 5F3XB 3SEIA 2KMDA 2B6GA 1WWVA 1OW5A 4RQNA 1SV0A 3TACB 1B4FA 1SXDA 3BS5A 1LKYB 4IS7A 2K4PA 3KKAA 2FE9A 1OXJA 1SXEA 2F8KA 1PK1B 5J8YA 2K60A 1UQVA 3K1RB 2JV3A 2DL0A 1LKYA 2E8NA 2L5YA 2Y9UA 1WWUA 2F3NA 2KSOB 1F0MA 3HILA 1X66A 4PZOA 2F44A 1X9XA 5JTIA 5JRTA 2EAOA 3BQ7A 1SV0C 2E8OA 4NJ8A 2KIVA 3KKAC 5J8YC 3TADC 2ESEA 4NL9C 1PK1A 2QB0B 2E8MA 1UCVA 4PZNA 2Y9TA 1Z1VA 2KSOA 3IDWA 2QARB 2LMRA 2ES6A 2QB0A 2GLEA 3BS5B 1KW4A 2EAPA 1B0XA 5KNIA 1DXSA 2EAMA 1V85A 2E8PA 2KE7A 2QARA 5L1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PK3 A;  1V38 A;  2LPE A;  4MHV A;  5JU5 A;  2EAN A;  2DKX A;  2D8C A;  1COK A;  1RG6 A;  3SEN A;  2KG5 A;  2QKQ A;  2DKZ A;  1SV4 A;  3TAD A;  3BS7 A;  4RQM A;  1JI7 A;  2YTU A;  4NL9 A;  1X40 A;  2QB1 A;  1SGG A;  2D3D A;  3H8M A;  5F3X B;  3SEI A;  2KMD A;  2B6G A;  1WWV A;  1OW5 A;  4RQN A;  1SV0 A;  3TAC B;  1B4F A;  1SXD A;  3BS5 A;  1LKY B;  4IS7 A;  2K4P A;  3KKA A;  2FE9 A;  1OXJ A;  1SXE A;  2F8K A;  1PK1 B;  5J8Y A;  2K60 A;  1UQV A;  3K1R B;  2JV3 A;  2DL0 A;  1LKY A;  2E8N A;  2L5Y A;  2Y9U A;  1WWU A;  2F3N A;  2KSO B;  1F0M A;  3HIL A;  1X66 A;  4PZO A;  2F44 A;  1X9X A;  5JTI A;  5JRT A;  2EAO A;  3BQ7 A;  1SV0 C;  2E8O A;  4NJ8 A;  2KIV A;  3KKA C;  5J8Y C;  3TAD C;  2ESE A;  4NL9 C;  1PK1 A;  2QB0 B;  2E8M A;  1UCV A;  4PZN A;  2Y9T A;  1Z1V A;  2KSO A;  3IDW A;  2QAR B;  2LMR A;  2ES6 A;  2QB0 A;  2GLE A;  3BS5 B;  1KW4 A;  2EAP A;  1B0X A;  5KNI A;  1DXS A;  2EAM A;  1V85 A;  2E8P A;  2KE7 A;  2QAR A;  5L1M A; 
#chains in the Genus database with same CATH topology
 3AU6 A;  3OJU A;  1WCL A;  8ICM A;  3QU7 A;  4KLS A;  2WAQ F;  3AN1 A;  2D8C A;  4C0Z A;  3HRD D;  1NK5 A;  2V9W A;  5KFT A;  1SV4 A;  2YN4 A;  3WK8 A;  4U6P A;  5J29 A;  2KOB A;  3DV9 A;  4O3R A;  4KX5 A;  3FAH A;  1S0N A;  4GXK A;  1DOQ A;  5ALH A;  4DFK A;  5ALI A;  5HHI A;  4UB4 A;  4DQS A;  1Z3E B;  3BS5 A;  1KBU A;  2ZTC A;  1QSY A;  2YB4 A;  7ICL A;  2YMM A;  1T94 A;  2DF4 B;  2K60 A;  1RXV A;  1TE2 A;  4O3O A;  5J2K A;  2IOF A;  3RAQ A;  1MQ3 A;  5AIB A;  2FPK A;  5CWR A;  3QU9 A;  2EZY A;  2GO7 A;  2RHF A;  2K8C B;  1CI4 A;  5G5G A;  5JRT A;  2WHE A;  3WK6 A;  1SV0 C;  5H2F U;  5J0W A;  1HUZ A;  3ZD8 A;  4M6W B;  3QEA Z;  4DEZ A;  1TVA A;  3RB4 A;  5KT6 A;  3Q8R B;  1JX4 A;  4RNM A;  2WAQ C;  5BOM A;  3RRH A;  3K4G A;  5J0Y A;  2IHN A;  2ZXH A;  1C7Y A;  5J2J A;  1PZN A;  4YXJ A;  3E2E A;  4KLF A;  4DCC A;  2LMR A;  5J2C A;  5ALV A;  2QB0 A;  1QQ6 A;  1KRP A;  4F5Q A;  2FLP A;  4DF8 A;  4KLQ A;  8ICC A;  5J2F A;  4AP9 A;  5J0S A;  4ECW A;  4UAY A;  1PVP A;  4KX3 A;  2LPE A;  1NK4 A;  1CEZ A;  5AKH A;  3ETR A;  9ICX A;  4E0D A;  5AM0 A;  2ISO A;  2BPC A;  2A1J B;  8ICZ A;  4UBB A;  2YY6 A;  2A19 A;  5KG3 A;  9ICQ A;  3AEV A;  4R65 A;  5J0O A;  1QLN A;  2KTQ A;  2PXI A;  4XRH A;  4J9O A;  5HP4 A;  7ICO A;  3T79 A;  5A0L A;  1ZD2 P;  2KVS A;  1L7M A;  4Z6D A;  1DK3 A;  3PO5 A;  4G9B A;  3QUB A;  4I2A A;  2XCP A;  3QE9 Y;  3TAQ A;  1RQN A;  3BZC A;  1TFR A;  5AI8 A;  3AM9 A;  3EUB 2;  1X9W A;  2DUY A;  4KLM A;  4USA A;  3EPI A;  5AM3 A;  4C7Z A;  3D2Q A;  4BUG A;  4ECR A;  2ZIU B;  3Q8S B;  3JPQ A;  1KTQ A;  4RPX A;  1IM4 A;  2XID A;  4OD0 A;  4PPX A;  3LDA A;  5J0Q A;  1KEJ A;  4EX6 A;  2MAX A;  1FFU A;  2K4I A;  5B66 U;  1TK5 A;  3WKD A;  3MGI A;  4KLI A;  3GFK B;  2NO4 A;  3KKA C;  5CP2 A;  3RH5 A;  4ED3 A;  3BDP A;  5KFM A;  1VJ5 A;  3WKE A;  3H4D A;  2PFO A;  5L9X A;  1PK1 A;  3CP8 A;  3VC8 A;  4YR3 A;  4PZN A;  2HOI A;  2W7P A;  2G06 A;  1A6S A;  1ZRM A;  1NI3 A;  3OHA A;  5KAF U;  4PGQ A;  3C28 A;  1T8E A;  1D8B A;  4Y2Y A;  2K8B B;  2I9G A;  2Y0S F;  2F1H A;  3UXN A;  4UB5 A;  5L1M A;  1KFD A;  2ODG A;  5EE0 A;  1X9S A;  4C8M A;  3RFA A;  2HDO A;  2M9N A;  2W11 A;  2R8H A;  5KFX A;  4DSK A;  8ICL A;  3MR2 A;  3QU5 A;  4DFD A;  1BPE A;  1GO3 F;  5KFH A;  4QZI A;  3M8S A;  3JPO A;  2BR0 A;  2E1E A;  4NL9 A;  7ICG A;  4YP3 A;  1N5W A;  2H3V A;  5DLG A;  3L3F X;  4IC9 A;  1NOM A;  3ED5 A;  2ZUD A;  3LWL A;  4RQ8 A;  3I28 A;  3PSI A;  4C7Y A;  1ZQD A;  3PVX A;  1LKY B;  5AKX A;  4QZE A;  2XCA A;  4YQW A;  4NLC A;  2PFN A;  3U26 A;  1L6N A;  5DBB A;  5AK4 A;  2QLT A;  1ZQN A;  4RT2 A;  2BKE A;  4I27 A;  3UPQ A;  7ICH A;  4ED8 A;  3M9N B;  2XC9 A;  2AGQ A;  1ZET A;  1X66 A;  5DLF A;  1X6J A;  1QSS A;  5EE1 A;  4PHP A;  3KTQ A;  2H3Z A;  8ICP A;  3JPS A;  5D46 A;  3A0H U;  5KFC A;  2F1I A;  2FPL A;  2EH9 A;  4NJ8 A;  3V7J A;  1NKC A;  4O3P A;  3KZX A;  5KFA A;  1M6Y A;  4BWM A;  3M9O B;  1TAU A;  2BCR A;  1KDH A;  4X5V A;  3F5A A;  1S0V A;  2OH2 A;  9ICC A;  5EWE A;  1X2I A;  3HKZ F;  2BPG A;  3QU4 A;  4F72 A;  4R64 A;  3IRU A;  2NV3 A;  3RJG A;  4C80 A;  2XY6 A;  3N4M B;  3H0R B;  4DWI A;  1U49 A;  4O9M A;  2HVI A;  3ICX A;  4TUP A;  2WF6 A;  4RPY A;  2F1J A;  1L3S A;  4PHD A;  5HMM A;  2E3T A;  4M6W A;  4C4R A;  4CGZ A;  3SQI A;  2OCE A;  1DRG A;  8ICN A;  1NZB A;  4I2B A;  1UT5 A;  1F5S A;  2H3F A;  4DL7 A;  2B0C A;  4YMM A;  3UQ0 A;  5AK6 A;  5F3X B;  5KFU A;  4Y2S A;  2KNJ A;  3SEI A;  4RQN A;  4QIW F;  1SV0 A;  4IRD A;  4NV0 A;  3ISB A;  4F92 B;  2BDP A;  5K4L A;  4B9N A;  3UXO A;  4GLX A;  3E58 A;  2CPR A;  2F8K A;  5KTQ A;  4K4H A;  4P4O A;  3RH4 A;  4B9V A;  1SL2 A;  2CRX A;  8ICO A;  1Q46 A;  4RT3 A;  4MEX A;  2E8N A;  4YMN A;  1S9F A;  1ZOL A;  2A1J A;  5J0R A;  4FFD A;  9ICT A;  2KV2 A;  1X9X A;  3BQ0 A;  5CR0 A;  4IR9 A;  3CRX A;  9ICA A;  3BQ7 A;  2F2A B;  2E8O A;  5AM1 A;  4Y2Q A;  5HR6 A;  3H0L B;  3PY8 A;  2VIX A;  3PSP A;  4JMU A;  4U7C A;  1SZP A;  3RJF A;  8ICG A;  2W9C B;  1NJW A;  5KG7 A;  1ZQX A;  3V6J A;  4UAW A;  2QB0 B;  1HUO A;  5KL8 B;  2BHN A;  1ARO P;  2JZB A;  5E79 U;  4DFP A;  2P35 A;  5EWG A;  2ZIU A;  3TAP A;  3RR7 A;  3WKA A;  1T3N A;  9ICM A;  2CN1 A;  1XU4 A;  2NO5 A;  2HBM A;  2CXY A;  4RZR A;  1V9P A;  5J0T A;  8ICT A;  3H7I A;  2W9M A;  5J2H A;  4TQS A;  4DSF A;  3RH6 A;  5G5H A;  3OHB A;  4M0A A;  8ICB A;  5IIM A;  3GIJ A;  5AI4 A;  2G07 A;  4DSI A;  5ALZ A;  3PR5 B;  2LHT A;  1ZRN A;  1Z4N A;  3QNM A;  3GV8 B;  1NK9 A;  5DGB A;  3TQ1 A;  2F76 X;  4M47 A;  1TAM A;  5L1I A;  3IN5 A;  4PH5 A;  2UVR A;  4O3Q A;  8ICR A;  4DL6 A;  3H8S A;  4IQT A;  4MF8 A;  2K4P A;  3KKA A;  2FE9 A;  4IRC A;  4OCZ A;  3Q8P B;  4C8K A;  2G0A A;  2MSN A;  3PW7 A;  2ASJ A;  1KSP A;  2RLT A;  4F93 B;  1BNO A;  5KL1 B;  3ZDE A;  2KHQ A;  4M04 A;  3HIL A;  8ICI A;  2RP5 A;  3QZ7 A;  4NLB A;  5DBC A;  3RR8 A;  2IOF K;  3BQ1 A;  2W43 A;  4P4M A;  3MBY A;  2G5I B;  4UAS A;  1L3T A;  4ECY A;  2DPI A;  2AGP A;  3EW9 A;  1YZ7 A;  4TUQ A;  2ZG6 A;  5J8Y C;  4BJQ A;  4NL9 C;  2VJ4 A;  3K75 D;  4CF4 A;  1J97 A;  3AUO A;  1ZQ1 C;  2HMX A;  5AHX A;  5EE9 A;  2EZZ A;  4MEY A;  5ALR A;  4ECS A;  3HWT A;  3PW2 A;  3IDW A;  4C8N A;  2FMS A;  3ZDC A;  1DGS A;  3SV4 A;  1JUD A;  1ZQZ A;  1K1Q A;  1QQ7 A;  2FLL A;  3SI8 A;  4GIB A;  5IIK A;  4QW8 A;  1KFS A;  1SWW A;  5ALY A;  3RRG A;  4DLE A;  1MSW D;  3NS1 A;  4CF5 A;  2DKX A;  4OJP A;  4Y2P A;  2O6K A;  5KFQ A;  2VA2 A;  2UVW A;  4RQ5 A;  2YTU A;  2P66 A;  1RYS A;  1BPZ A;  3D2S A;  2K4H A;  3NRW A;  5DQI A;  1JXE A;  4UB8 U;  2RDI A;  5AKL A;  4EBD A;  9ICV A;  2VKQ A;  1L8O A;  1OW5 A;  4KLU A;  4Z6C A;  4QWB A;  3QUQ A;  2AU0 A;  4KLJ A;  1NK0 A;  4OJL A;  3TI0 A;  1COO A;  8ICX A;  4EEK A;  3ETL A;  3HW8 A;  3C21 A;  4MF2 A;  3V7K A;  5HNK A;  7ICJ A;  4ZH4 A;  3SYZ A;  1ZQO A;  3Q8Q B;  4F4Y A;  4DL4 A;  2HSZ A;  5KT2 A;  3ALR A;  2EAO A;  5ALF A;  4HAI A;  4FS1 A;  1ZJN A;  4B9U A;  2KIW A;  5AIA A;  1PUZ A;  1T3Q A;  3FYH A;  4JK1 A;  4KMO B;  1X42 A;  4I2C A;  4M9H A;  5HR7 A;  4F50 A;  2EDU A;  2W8K A;  4B9T A;  4R63 A;  3AL0 B;  5L1J A;  2HBJ A;  3NVZ A;  2JEF A;  5IIL A;  5AKE A;  4J9Q A;  3SAG A;  4O5C A;  2HHV A;  4FE3 A;  5GTH U;  2K4E A;  2R8G A;  3C29 A;  3RJH A;  1SWV A;  5GTI U;  1FO4 A;  1IIP A;  3DDH A;  1SKW A;  2KD1 A;  4IRK A;  2JEI A;  1A77 A;  4Y2T A;  3G6Y A;  1BPD A;  1L3V A;  1PK3 A;  4UQG A;  2UVU A;  2R8J A;  4F91 B;  1SIJ A;  1Z4O A;  4M9N A;  2QKQ A;  3TAD A;  5KFK A;  2W9C A;  2HHT A;  2H5X A;  1X40 A;  4ELV A;  2QB1 A;  1SGG A;  3RB6 A;  3H8M A;  4C4S A;  1XS9 D;  3HPO A;  3SAF A;  2HI0 A;  3T3F A;  4ECT A;  3MGH A;  4C8L A;  1HEK A;  4F5P A;  7ICK A;  4Y2U A;  2HHS A;  5DG7 A;  4UB6 U;  2FMP A;  2KHV A;  3MGV A;  5C0Y A;  4P0P B;  5CJ7 A;  5HHH A;  4B6J A;  4F5R A;  3RJJ A;  2DBY A;  5J2B A;  2R8K A;  2JV3 A;  4YN4 A;  2Y1I A;  4I2G A;  8ICS A;  3GIM A;  1RM6 C;  3C2M A;  3H4B A;  4F3O A;  4R66 A;  4RU9 A;  4DF4 A;  4LZD A;  5EWF A;  3QZ8 A;  5AKG A;  1UT8 A;  4EEL A;  5T14 A;  4OJO A;  4O3M A;  9ICF A;  1ZQY A;  2JZB B;  3GU3 A;  1ZQL A;  5KG4 A;  2BQU A;  3RBE A;  1RXW A;  5ALK A;  1NK6 A;  2HHX A;  2Z7J A;  3MR3 A;  2IA6 A;  2AQ4 A;  3AQF A;  5AI5 A;  3IHQ B;  2KN7 A;  3ZDB A;  5D49 A;  3LWM A;  3CYM A;  4KMU A;  5KFO A;  3KFU F;  3PW0 A;  1NJX A;  1H38 A;  5DQG A;  2JGA A;  5D4B A;  2ISP A;  2IMW P;  3ONN A;  2EAM A;  2JHD A;  5KFW A;  1LV5 A;  4EZ6 A;  4YG2 A;  4MHV A;  5DBA A;  4DOB A;  5KAI U;  5KT5 A;  1AQ6 A;  1COK A;  1MC8 A;  4NY8 A;  4M9G A;  4YFK A;  2JMG A;  4DS5 A;  4RQ4 A;  1MA7 A;  2W7O A;  1S0O A;  4KN7 A;  2I6X A;  1SXD A;  3IP4 B;  4GFJ A;  4UW9 A;  2ZIV A;  1XSL A;  4B9M A;  5AIC A;  5DB8 A;  5J8Y A;  2FPM A;  4QWC A;  2ALZ A;  5ALS A;  2BZF A;  5CRX A;  1NJY A;  4ELU A;  3M9M B;  2LYA A;  3C5G A;  9ICS A;  4FZM A;  2F44 A;  4I2I A;  1TK8 A;  5JTI A;  1NZP A;  3T5K A;  3SD7 A;  5ALU A;  1ZQI A;  1XWL A;  4ICA A;  4P4P A;  4YD2 A;  9ICK A;  1U45 A;  5HML A;  1J2N A;  4BDP A;  3OJS A;  3GII A;  1ZQP A;  1MN8 A;  3PMN A;  3G6X A;  4I2H A;  2AXT U;  2HBL A;  4JV2 A;  4NLN A;  5KG1 A;  4IR1 A;  5B5E U;  1ZD4 A;  2Y9T A;  5ALN A;  9ICH A;  3KBB A;  9ICB A;  2HHU A;  5AI6 A;  3EZ5 A;  2M0N A;  3JPP A;  2YMP A;  2GLE A;  2XGP A;  3H8W A;  1URJ A;  5BOL A;  3E0F A;  2WFA A;  2Y0S C;  4RUC A;  4GXJ A;  5J2D A;  3PV8 A;  1YZ6 A;  4EEN A;  4M9L A;  2G5H B;  4RNO A;  3ZD9 A;  3M7D A;  2G09 A;  8ICJ A;  4NM1 A;  4M9J A;  2FJ6 A;  4QZA A;  2KFZ A;  5J2I A;  5JU5 A;  4QZC A;  3HJE A;  2DGZ A;  3C1Z A;  5TIS U;  5DQH A;  4RQM A;  4Y2V A;  3QU2 A;  7ICS A;  3RAX A;  1KKX A;  2ASD A;  4DQP A;  3B0X A;  4CRX A;  2F8L A;  4TUS A;  3MAB A;  4WJ3 B;  5AK3 A;  1A76 A;  5KFP A;  8ICY A;  4XUS A;  4B9S A;  1XSP A;  3ZDD A;  9ICW A;  1MQ2 A;  4OJ5 A;  2AHO B;  1QH9 A;  5CEH A;  1JN3 A;  2EZX A;  3EPG A;  3F2D A;  3F53 A;  3H0M B;  3RB3 A;  4J03 A;  5III A;  8ICH A;  8ICK A;  3WU2 U;  4DL5 A;  4IQW A;  2XI9 A;  4KLD A;  1SZH A;  4EX7 A;  4G3I A;  2DFL A;  1B22 A;  4JWM A;  3QXG A;  2C28 A;  3MFI A;  1ZQK A;  3GV7 B;  3A0B U;  7ICF A;  4DQQ A;  4F5O A;  3HX0 A;  2XY7 A;  4ECU A;  4RQ1 A;  2ASL A;  2BCV A;  2B21 A;  1S10 A;  3TAD C;  4ED1 A;  4P0P A;  4ED7 A;  3F2B A;  3FC4 A;  4UB3 A;  3HKZ C;  2JH7 A;  3F5E A;  2KFN A;  1ED1 A;  2YMQ A;  3V6H A;  4PHE A;  2ES6 A;  4DSE A;  9ICJ A;  5AM2 A;  2PMZ F;  2KZZ A;  3BZK A;  7ICT A;  1UA0 A;  2W9B B;  1PVQ A;  1JRO A;  1N2X A;  3UMG A;  5IIJ A;  4K4I A;  2C2R A;  2IHM A;  2DKZ A;  5J0P A;  3S6J A;  2C2D A;  1QQ5 A;  4EEY A;  2WB1 F;  1SKR A;  3GQC A;  4QWD A;  2JH1 A;  4YR0 A;  4QIW C;  3V7L A;  1N5X A;  1HIW A;  1ZQA A;  2HVH A;  3N7P D;  4TQR A;  3Q8M A;  3HT3 A;  1TV9 A;  4AYB F;  1Q3U A;  4IS7 A;  4UAV A;  4Y2R A;  5DG8 A;  4QZB A;  4DSL A;  3TKA A;  3LVW A;  2K89 A;  1WUD A;  2ZJ5 A;  1F0M A;  2BQR A;  3GV5 B;  4PL1 A;  4P2H A;  5F9L A;  1S0M A;  4Q8F A;  1ZQC A;  3M1Y A;  7ICE A;  4B9L A;  1Q8K A;  5C5J A;  3TFR A;  3ZI4 A;  4QZH A;  2KEY A;  4KIT B;  4F2R A;  2AJQ A;  2J6T A;  1RPL A;  2FI1 A;  4FZL A;  1Z00 B;  4Z6F A;  2F77 X;  4Q8E A;  3NRZ A;  4US8 A;  4Z6E A;  3K1Z A;  2JXJ A;  2XGQ A;  1Z1V A;  5KT4 A;  5AK5 A;  5KFL A;  5ALG A;  7ICM A;  4MFA A;  3HP6 A;  2WB1 C;  4DQI A;  3CNH A;  5KG5 A;  4ECQ A;  5BPC A;  3NVY A;  2OM6 A;  4P0Q A;  4QWE A;  1B0X A;  1ZXI A;  2ZTD A;  2HBK A;  2W04 A;  2KE7 A;  5AI9 A;  2KJ9 A;  4AYB C;  2P6R A;  2W3R A;  4F2S A;  8ICF A;  1NK7 A;  3VCB A;  3L4P A;  1XO1 A;  1Z19 A;  1D8Y A;  5AI0 A;  3SV3 A;  3AU2 A;  2LM4 A;  1P7D A;  2OHF A;  2Y1J A;  5AKI A;  2JRZ A;  2UVV A;  2BQ3 A;  1BPY A;  3T5L A;  5AKZ A;  1HJP A;  4O0I A;  5F9N A;  2ZIV B;  9ICI A;  2ZIX B;  1KN5 A;  1CUK A;  2JEJ A;  4F4Z A;  4ED6 A;  1ZJM A;  3TAC B;  2KKP A;  1U9L A;  1U4B A;  1CRX A;  2WTF A;  2A3V A;  3Q8K A;  5J2A A;  4O5K A;  8ICV A;  3UQ2 A;  1QTM A;  4Q43 A;  7ICR A;  4DOC A;  4MFC A;  2KJ5 A;  2J6U A;  4IQU A;  2Y9U A;  1FEZ A;  1UHU A;  3TFS A;  5JUM A;  5KFG A;  2WF8 A;  2ZUC A;  3KHG A;  4C8O A;  1TKD A;  7ICI A;  4XQ8 A;  1JXL A;  2OYY A;  1KFT A;  3RB0 A;  3KHH A;  4RQ0 A;  1OUQ A;  4ELT A;  2MU2 A;  1D8L A;  2MRL A;  4RQ2 A;  1JIH A;  4I29 A;  5J0X A;  5AKY A;  2ESE A;  3RJK A;  1KL9 A;  7ICQ A;  3NVW A;  1V97 A;  3D2N A;  1ZQT A;  1UCV A;  4QWA A;  1ZQW A;  4F8R A;  2RRD A;  4NXZ A;  4IQV A;  4J9R A;  2ZUB A;  1ZQJ A;  4LJX A;  3I1Y A;  2FLN A;  2HHQ A;  1KW4 A;  2OEH A;  3Q8L A;  1V85 A;  3DEE A;  3KHL A;  3GIK A;  3UMB A;  1V38 A;  2IOH A;  3QYP A;  4JV0 A;  5FP0 A;  3MFH A;  1N62 A;  1S5L U;  4DSJ A;  3EWA A;  3QUC A;  2ZIW B;  3H40 A;  1SB3 C;  4DOA A;  4KLO A;  8ICQ A;  1S97 A;  4J9S A;  1Y88 A;  5J2G A;  3NAS A;  3TAN A;  2WF9 A;  4GC6 A;  3C2K A;  4CE6 A;  1RQL A;  2NRX A;  2KMD A;  2FDR A;  3QUT A;  2VJ5 A;  3IM1 A;  2W54 A;  4QJF B;  4QZ8 A;  2BGW A;  1ZQQ A;  2BPF A;  1U48 A;  9ICO A;  3OSN A;  1OXJ A;  1SXE A;  2KZ3 A;  4KLE A;  1ZQS A;  4UBC A;  4PGY A;  2W9B A;  3C5F A;  1RZT A;  7ICU A;  5DGA A;  5J2E A;  1WWU A;  3C23 A;  4DS4 A;  2HCF A;  5ALE A;  4J9K A;  2YML A;  4DL2 A;  3OGU A;  5AM5 A;  1ECW A;  5ALD A;  4KLG A;  3CW2 C;  1ZQB A;  2EQY A;  3FDS A;  5ALM A;  5AKJ A;  4YMO A;  4DL3 A;  2HOF A;  2W55 A;  2XIC A;  4QZ9 A;  4DLG A;  1IG6 A;  1FIQ A;  1PVR A;  2P6U A;  4YCX A;  4BXO B;  2E8M A;  3WKB A;  4ECZ A;  5DB6 A;  1UA1 A;  4NLK A;  4NM2 A;  3N97 B;  4PHA A;  1FFV A;  1SKS A;  5ALX A;  3B9J A;  4MFF A;  3T5H A;  5KFJ A;  3PNC A;  2QAR A;  2V4R A;  1WG8 A;  4RNN A;  3C1Y A;  2NRV A;  3PSF A;  1T7P A;  5ALW A;  3TAR A;  1JAL A;  2W9A A;  1Z00 A;  1RG6 A;  3WK9 A;  4Q44 A;  3SEN A;  3RJE A;  2RDJ A;  4C4T A;  3FM9 A;  3B0Y A;  4OJ6 A;  3SZ2 A;  3QX7 A;  3PML A;  1K5O A;  1RDF A;  4RPZ A;  3OSP A;  3JPR A;  1ZD3 A;  5KFD A;  3ISD A;  4US9 A;  3NTU A;  3MC1 A;  2R18 A;  3UM9 A;  3MR5 A;  5KFE A;  2YB1 A;  5TZV A;  4F5N A;  3QEB Z;  3PW4 A;  4K4G A;  4RQ7 A;  2LBO A;  4PGX A;  2J6S A;  2MA1 A;  8ICU A;  4Q45 A;  2YX8 A;  4HYK A;  4QZG A;  3RBD A;  2KIC A;  1QCK A;  4KTQ A;  4I2E A;  2Q0Z X;  4FZN A;  3M6Z A;  2KK0 A;  4UAU A;  1L7P A;  2F3N A;  3MR6 A;  2KSO B;  1T4G A;  4DFJ A;  1F44 A;  3ZDA A;  4YXM A;  1J2M A;  2KVC A;  7ICV A;  4NLZ A;  3AMZ A;  4Y2J A;  3M8R A;  2ZIX A;  4FO6 A;  2I5H A;  1WCN A;  4KLH A;  2V4Q A;  7ICP A;  2ZJA A;  2VAN A;  1A0P A;  3V72 A;  2K8A A;  2Q4T A;  3BQT A;  1TK0 A;  2ZTE A;  1N48 A;  5ALQ A;  2ZXI A;  4R8U B;  4I28 A;  4P0Q B;  4EBC A;  9ICE A;  4NWI A;  1WYG A;  2OWO A;  9ICL A;  4DO9 A;  1ZQG A;  4Y2X A;  3BQ2 A;  3SMV A;  3RTV A;  3KHR A;  4LVS A;  5J0U A;  1S76 D;  4PL2 A;  2HOQ A;  5KT7 A;  2D6F C;  2N1R A;  8ICW A;  2C2E A;  2MUT A;  5DG9 A;  2AGO A;  3KOO A;  1Q3V A;  2KJ8 A;  2GH1 A;  2KG5 A;  3BJY A;  1Z1B A;  4A8E A;  1L5U A;  5AM4 A;  3ORY A;  2NYV A;  5KFF A;  2D3D A;  1ZYQ A;  4EBE A;  4YVZ A;  3OTQ A;  1SL0 A;  1WWV A;  5CB1 A;  1L7O A;  2PI5 A;  2H3Q A;  1RYU A;  5ALT A;  2KP7 A;  4UB2 A;  3KD3 A;  4J9P A;  2VA8 A;  4ED0 A;  5ALP A;  4CDG A;  4NLG A;  5DB9 A;  1XNS A;  3H8J A;  4EZ9 A;  2E1F A;  3K1R B;  2NRT A;  4YD1 A;  1BNP A;  4PJ0 U;  2L5Y A;  5KG6 A;  3T5J A;  2ZIW A;  4KLL A;  3WKC A;  5IIN A;  4CNQ A;  4PZO A;  5KG0 A;  4FBU A;  1N63 A;  2WF7 A;  5KFY A;  3MDC A;  2KIV A;  1ZQV A;  3OPX A;  2PFP A;  9ICN A;  4QZD A;  2ATL A;  5KFN A;  2R8I A;  2GOL A;  3G6V A;  1L8L A;  3PX0 A;  5KT3 A;  1TAQ A;  1UPH A;  5CA7 A;  4M2Y A;  3F2C A;  1DGJ A;  2XVT A;  9ICG A;  9ICR A;  2W3S A;  3SAH A;  3BS5 B;  4ZOH C;  4JB3 A;  1NKB A;  2FMQ A;  1DXS A;  2E8P A;  4RQ6 A;  1XSN A;  4KN4 A;  3JPN A;  2BCU A;  2GWS A;  2HW3 A;  4O5E A;  3GDX A;  1X9M A;  2EAN A;  1IV8 A;  4UAR A;  4UAZ A;  4F4X A;  5EOZ A;  2BDU A;  3EYZ A;  1SL1 A;  4BWJ A;  3WK4 A;  4BXO A;  1X6I A;  4J9L A;  2WF5 A;  1U47 A;  3O0F A;  4ACO A;  4GC7 A;  1RYR A;  1ZQH A;  2B6G A;  2W8L A;  4BGD A;  3GZF A;  1B4F A;  2AQ0 A;  2BCS A;  5KFR A;  8ICE A;  2RQ5 A;  4XA5 A;  4J9M A;  4ECV A;  3D6J A;  2OXO A;  3RJI A;  2IBK A;  3NGD A;  4IL6 U;  5KFI A;  2W03 A;  4QNL A;  1O08 A;  5DB7 A;  1QSL A;  3NUQ A;  3N7S C;  1LVH A;  2DPJ A;  1N60 A;  3PZP A;  4UB1 A;  5KFS A;  2ZJ8 A;  1D9F A;  2G08 A;  4JV1 A;  2NRW A;  5KFB A;  1S8O A;  3SR6 A;  2PKE A;  3GIL A;  5ALL A;  5ALO A;  3UXP A;  3MDA A;  4UAT A;  1ZQF A;  5KG2 A;  4GXI A;  1L7N A;  2KSO A;  4YR2 A;  2QAR B;  2I1Q A;  4I2D A;  5DKW A;  3JPT A;  2LI6 A;  5DDY A;  3N7R C;  2EAP A;  2PMZ C;  4F4W A;  4ED2 A;  5KNI A;  1NJZ A;  3AQE A;  2XY5 A;  3PX4 A;  3RF9 A;  3PR4 A;  1KLN A;  7ICN A;  1BPB A;  2DQN B;  4QZF A;  3V6K A;  3N28 A;  4JUZ A;  4EYH B;  1BPX A;  4JWN A;  3ISC A;  3LK9 A;  5CHG A;  1ZQE A;  4I2J A;  3IV6 A;  3BS7 A;  1ZQM A;  2JR5 A;  1JI7 A;  4F4K A;  4BX9 C;  1KQQ A;  9ICU A;  1ZQR A;  5L1K A;  2H3I A;  1BVS A;  3PST A;  4R8U A;  4TUR A;  3C2L A;  2DWQ A;  1NKE A;  9ICP A;  3I76 A;  1B43 A;  1YT3 A;  2VA3 A;  2JEG A;  1XC9 A;  4F71 A;  4FS2 A;  2KKV A;  2BCQ A;  1D9D A;  1BGX T;  5KFV A;  4DQR A;  1PK1 B;  1L3U A;  3L5K A;  1UQV A;  3J81 j;  1LB2 B;  1NK8 A;  1JMS A;  2DL0 A;  2E5S A;  1LKY A;  1VLB A;  4J9N A;  5KFZ A;  2PI4 A;  4RQ3 A;  4CCH A;  4OO1 J;  2HHW A;  1O03 A;  2NRZ A;  2LYH A;  3PO4 A;  2PFQ A;  4QW9 A;  3M6K A;  4ECX A;  4EYI B;  3WK5 A;  1XO0 A;  3NVV A;  1K1S A;  8ICA A;  1EXN A;  5L1L A;  2A1A A;  1JRP A;  2YQE A;  1ZD5 A;  4LZG A;  5AKK A;  1VDV A;  3PX6 A;  2LM1 A;  2LKY A;  3KZI U;  3WK7 A;  1IXR A;  3PW5 A;  1NNL A;  3IG8 A;  1N61 A;  4KLT A;  4CF3 A;  4DFM A;  1DK2 A;  1C20 A;  3LYS A;  5IIO A;  2AH5 A;  4I2F A;  1ZQU A;  3IG5 A;  4RUA A;  4O3S A;  2MUT B;  1N56 A;  5EE3 A;  2C22 A;  3R9K A;  5ALJ A;  3THV A;  4FBT A;  1S77 D;  4O3N A;  2KZM A;  5DDM A;  3LVV A;  2LYB A;  2XO7 A;  3UMC A; 
#chains in the Genus database with same CATH homology
 1PK3 A;  1V38 A;  2LPE A;  4MHV A;  5JU5 A;  2EAN A;  2DKX A;  2D8C A;  1COK A;  1RG6 A;  3SEN A;  2KG5 A;  2QKQ A;  2DKZ A;  1SV4 A;  3TAD A;  3BS7 A;  4RQM A;  1JI7 A;  2YTU A;  4NL9 A;  1X40 A;  2QB1 A;  1SGG A;  2D3D A;  3H8M A;  5F3X B;  3SEI A;  2KMD A;  2B6G A;  1WWV A;  1OW5 A;  4RQN A;  1SV0 A;  3TAC B;  1B4F A;  1SXD A;  3BS5 A;  1LKY B;  4IS7 A;  2K4P A;  3KKA A;  2FE9 A;  1OXJ A;  1SXE A;  2F8K A;  1PK1 B;  5J8Y A;  2K60 A;  1UQV A;  3K1R B;  2JV3 A;  2DL0 A;  1LKY A;  2E8N A;  2L5Y A;  2Y9U A;  1WWU A;  2F3N A;  2KSO B;  1F0M A;  3HIL A;  1X66 A;  4PZO A;  2F44 A;  1X9X A;  5JTI A;  5JRT A;  2EAO A;  3BQ7 A;  1SV0 C;  2E8O A;  4NJ8 A;  2KIV A;  3KKA C;  5J8Y C;  3TAD C;  2ESE A;  4NL9 C;  1PK1 A;  2QB0 B;  2E8M A;  1UCV A;  4PZN A;  2Y9T A;  1Z1V A;  2KSO A;  3IDW A;  2QAR B;  2LMR A;  2ES6 A;  2QB0 A;  2GLE A;  3BS5 B;  1KW4 A;  2EAP A;  1B0X A;  5KNI A;  1DXS A;  2EAM A;  1V85 A;  2E8P A;  2KE7 A;  2QAR A;  5L1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...