5L1MA

Caskin2 sam domain tandem
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
140
structure length
140
Chain Sequence
GKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKKIASEIAQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQKKLMLGVKRLAELRRGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caskin-2
publication title A new mode of SAM domain mediated oligomerization observed in the CASKIN2 neuronal scaffolding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 43
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5l1mA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5l1mA01
3H8MA 3TADC 5JU5A 1V38A 3BS5B 1SXEA 2KG5A 1WWVA 1COKA 5KNIA 2QB0A 2DKXA 1OW5A 1LKYA 1SXDA 2EAOA 3BQ7A 1RG6A 1PK1B 2EAPA 2QARB 1KW4A 2DL0A 2L5YA 1Z1VA 4NJ8A 5J8YC 2JV3A 1WWUA 1X9XA 1F0MA 1SV0C 3KKAC 4NL9C 2YTUA 2KMDA 3IDWA 2K4PA 3K1RB 1SV4A 2QB1A 4RQMA 1DXSA 5F3XB 2E8PA 2DKZA 2B6GA 3SENA 2QB0B 1LKYB 2E8OA 5L1MA 4MHVA 2GLEA 1PK3A 2KIVA 4RQNA 2KE7A 2KSOA 1X66A 3TACB 2D8CA 4IS7A 4PZNA 1X40A 3TADA 2D3DA 4PZOA 2E8MA 2Y9TA 5JTIA 2E8NA 2K60A 3SEIA 1B0XA 2FE9A 2EAMA 2Y9UA 1B4FA 2F8KA 1JI7A 3BS5A 2KSOB 1OXJA 2LPEA 5J8YA 3BS7A 1UQVA 1SGGA 2ESEA 2QKQA 2ES6A 1SV0A 3HILA 3KKAA 4NL9A 2EANA 1UCVA 2F44A 1PK1A 2QARA 2F3NA 1V85A 5JRTA 2LMRA
chains in the Genus database with same CATH superfamily
1ZETA 4ED1A 2EZYA 4EBDA 8ICBA 5JU5A 1SKRA 4J03A 3H8SA 2ZTCA 4Y2VA 1XSNA 4EX6A 3JPTA 3AM9A 3C5FA 5J2DA 4C7ZA 1XO0A 5KFYA 5ALJA 5ALPA 1A77A 4IRDA 1JN3A 3IG8A 3C29A 3PW5A 4P0QA 2EAPA 4F2RA 3MR5A 2XY7A 4JMUA 8ICAA 3T5JA 2BQUA 1NK6A 2DF4B 4QZ8A 2GOLA 4RQMA 1DXSA 3V6KA 3FDSA 2DKZA 2B6GA 3SENA 4QWCA 2R8IA 4DQPA 4I2HA 2GO7A 3QUBA 4YCXA 2DBYA 4DFKA 5EE0A 3PMLA 5EOZA 5ALYA 1U9LA 4KN7A 1BGXT 4MFAA 5KFTA 5J0WA 2W11A 1L3VA 2PKEA 3HT3A 4RQ7A 4OJ5A 2PFQA 5AKKA 3HPOA 2RDJA 1FEZA 1Q46A 3H0MB 3IM1A 5AICA 1ZQOA 2IHMA 3T5HA 2HBJA 3KTQA 3M6KA 5EWEA 3ISCA 3TQ1A 4PGXA 7ICSA 3ETRA 4BUGA 3EPIA 3HILA 5J0UA 1TK5A 2EANA 4FFDA 1KDHA 4RNOA 1RQLA 2W04A 4ED8A 1QSYA 5CA7A 1WG8A 4F5OA 1RYUA 3D2SA 3PSPA 1D9DA 5GTHU 4QZCA 7ICMA 3ICXA 1NK8A 2IOFA 4YXJA 4RPYA 4AYBC 2KG5A 5KNIA 5F9NA 3LWMA 2BDUA 5DBCA 2ISOA 3H8WA 3BQ7A 1VJ5A 3QU5A 4AP9A 1ZQCA 4IQTA 2RHFA 2YTUA 2HHTA 1ZQYA 3IDWA 1L5UA 3RJKA 3OHAA 1SV4A 5F3XB 1NK5A 4UB5A 3N7RC 2KJ9A 3QU2A 4CF3A 4F92B 3QEAZ 1S77D 5G5HA 4JV1A 4DF4A 3UMBA 2AGOA 5KFHA 2BPGA 4TUPA 3OJSA 5IIOA 3ISDA 3PX0A 2JH7A 2BZFA 4ECWA 2R8KA 5H2FU 2BCRA 4B9SA 4QZGA 4UARA 2BKEA 1HUZA 2ZXIA 2JEFA 1BNOA 3LVWA 4X5VA 2Y9TA 5JTIA 4NM2A 8ICWA 5KFCA 2VJ4A 3QNMA 4TQSA 1L7OA 2Y9UA 3WU2U 4YG2A 2JGAA 4M9HA 1UQVA 2AQ0A 4FZNA 4PHDA 1NJWA 7ICTA 2UVVA 4P0PB 5ALEA 3QXGA 2JXJA 4RZRA 1BVSA 5AKEA 4Z6DA 4RQ0A 4ICAA 2YQEA 1D8YA 1BPZA 5ALVA 1RYRA 1NK9A 2Y0SF 5AM5A 1SXEA 5DGAA 5AKXA 4Q8FA 2I5HA 9ICTA 2WF7A 3AN1A 5J0TA 5ALIA 4LJXA 2Y1JA 2I6XA 3FAHA 2UVWA 4IQVA 1H38A 1PVPA 1TVAA 4UQGA 2XY6A 2W3SA 5ALWA 1SL0A 2A1JA 3WK4A 5B5EU 4QWAA 3JPRA 3EUB2 2OEHA 1COOA 2AHOB 2ZG6A 5CP2A 3G6YA 4QZBA 5CB1A 3MGHA 4P2HA 1FIQA 3GIJA 1S5LU 2LYAA 5A0LA 9ICKA 4Y2PA 4CF5A 5ALDA 5JUMA 1CI4A 3PSFA 4P4MA 2XCAA 2XIDA 4M9JA 8ICGA 4O5CA 2BDPA 3Q8QB 3MDAA 2R8JA 2YMLA 2PMZC 3RJIA 1LV5A 3PZPA 1Q8KA 2Q0ZX 1S0NA 1O08A 4YR0A 4YQWA 4O5KA 4Y2JA 2KP7A 8ICVA 2HHVA 2F8KA 2KZMA 5AI4A 1OXJA 4DL3A 1KLNA 4EBEA 8ICPA 2G5IB 2ESEA 1SV0A 4F5RA 4NL9A 3IN5A 4GC7A 4PHPA 1X9MA 2W9BA 1JALA 4PL1A 4NLBA 4DOAA 1ZQSA 2KK0A 1M6YA 2P6RA 7ICEA 5DQGA 7ICPA 4JK1A 1QSLA 5BOMA 3QYPA 2KD1A 4J9PA 2XI9A 5ALTA 3KBBA 1WWVA 9ICMA 3D2NA 4UASA 3J81j 4C0ZA 2ALZA 1BPXA 3L4PA 3EZ5A 2JRZA 1HEKA 4DQRA 4M9GA 5IIIA 4NJ8A 4RQ1A 1ZJNA 3M1YA 4FS2A 1ZQPA 2ZTEA 4FZLA 1FFVA 1F0MA 1QQ5A 3V6JA 4Z6CA 5AI6A 3RH4A 2FMQA 3NGDA 5J2KA 2J6UA 3CRXA 5KT5A 1DGSA 1ZQTA 2MU2A 4O9MA 1JMSA 3C1ZA 3THVA 4IQUA 4B9LA 5KG6A 2JH1A 4Q45A 2OYYA 4GC6A 3FM9A 3GU3A 1XS9D 4RQNA 2YX8A 3PW2A 9ICVA 4M0AA 4QNLA 1SZHA 5DB6A 3JPOA 2YMMA 3MFIA 2XC9A 3ED5A 1XO1A 3PR4A 9ICUA 2E8NA 1Z19A 1B43A 4UAYA 1KSPA 2ZIUB 3C28A 3DV9A 5K4LA 2EAMA 4DSIA 1B4FA 3M8SA 8ICYA 5KFFA 4FBTA 2JHDA 5KFIA 2KSOB 2VA8A 3NVYA 4RQ8A 4M6WA 1ZQLA 3OPXA 4F93B 1UCVA 1F5SA 2A19A 1T3NA 1A76A 5AM3A 5KTQA 1HJPA 2AGPA 1ZQDA 5KFEA 3WK7A 3SV3A 1IM4A 3ZDBA 3H0LB 2H3FA 4I2IA 5AKGA 3NRWA 1S0MA 2H3IA 5IINA 2XGPA 2F2AB 2FMPA 4UBBA 3SD7A 5T14A 2WAQC 2GWSA 2DUYA 4IR1A 4J9OA 1ZQXA 3ZD9A 5ALSA 2OCEA 5J0PA 4F4WA 1U48A 4B9NA 4IR9A 5DG8A 4TUQA 2F76X 1SKSA 1RQNA 4OO1J 2H3ZA 3T3FA 3IP4B 5G5GA 3PV8A 5J0QA 3OHBA 7ICNA 2E8OA 3V7JA 3C21A 4DFDA 5KFUA 4R65A 3G6VA 2MA1A 4NLGA 3GDXA 1A0PA 3WKDA 5J2FA 3QUQA 4F5QA 4DSFA 4KLFA 1EXNA 2K89A 4DOCA 2K8BB 3U26A 1S0OA 3PY8A 3NS1A 1S8OA 5DGBA 3BQ1A 4CRXA 4DEZA 1TAMA 4PZNA 4F91B 2ZJAA 3F5AA 2CRXA 5J2IA 3WK5A 5KFPA 4O3RA 3C2LA 1ZQQA 4FS1A 3A0HU 4UATA 5ALNA 2DPJA 1Z4NA 4ECZA 3Q8RB 4F5PA 4NLZA 5KFAA 4DL2A 1SWVA 4FBUA 2BCQA 3QZ8A 3Q8SB 3AMZA 3BZKA 2LPEA 3E0FA 4JB3A 5AK6A 2JZBB 5KFLA 2ES6A 3RBEA 4J9LA 3V7LA 4O0IA 5EE3A 1FO4A 1PK1A 4O3SA 2OM6A 3MR6A 1NZPA 1QQ6A 3I76A 4GFJA 4F4ZA 2LMRA 4EYIB 1ZJMA 1SWWA 1T94A 3AEVA 5AI8A 1KL9A 5ALOA 3RJFA 4M47A 5DQIA 3MDCA 4OJPA 2UVUA 1Z1VA 2ZXHA 4P4PA 3H0RB 4MEYA 1SV0C 2JEGA 2QLTA 5AI9A 2K4HA 1HIWA 4NL9C 3RJGA 1QH9A 4ZOHC 4RQ5A 1KFTA 3OSNA 1S76D 5HMLA 1SB3C 1ZQJA 3Q8KA 9ICLA 1RZTA 1Z00A 3SAGA 4P0QB 1X9WA 2AXTU 3ZDAA 1L7PA 2C28A 1ZQKA 2EDUA 3ETLA 4ECYA 3ZDCA 5D4BA 4KLQA 3TADA 4MFCA 3EW9A 3HP6A 3RJEA 2AJQA 2F8LA 4R64A 3RR7A 2K8CB 2ASDA 5J2EA 2BQRA 2HVIA 8ICZA 4YVZA 3K75D 3QEBZ 5KFOA 3Q8MA 2K8AA 1XSLA 4Z6FA 4EYHB 3F53A 4RUAA 3KKAA 3LK9A 3M7DA 2MAXA 2BCSA 1KEJA 9ICJA 4UAWA 1DRGA 2PXIA 1CUKA 8ICJA 2VA3A 5J2HA 1ZQGA 3GQCA 2J6TA 3HRDD 1ED1A 1NK0A 5KFNA 3E58A 3T5KA 1U4BA 2OXOA 2PFPA 4YXMA 9ICIA 2NRXA 2ZIWA 4G3IA 9ICQA 8ICIA 2KMDA 3A0BU 4KMUA 4Y2UA 3EYZA 3G6XA 5CJ7A 3RRGA 2W9CA 3SMVA 3TARA 1RYSA 4F4XA 7ICVA 1O03A 2HW3A 4PH5A 2IHNA 1HUOA 8ICSA 3M9MB 3N28A 2RQ5A 4WJ3B 3KHRA 4M04A 3FYHA 1N60A 2W03A 4KLGA 2PFNA 5ALLA 3GILA 1KQQA 2MRLA 1NK7A 5DB8A 1J2MA 5DLGA 1K1QA 5CR0A 3BZCA 5J2BA 2WHEA 5KFKA 3WKBA 7ICFA 3SYZA 4RT3A 1JROA 2D6FC 7ICOA 4JUZA 4PHAA 4Y2XA 4EELA 1SZPA 3OSPA 2Y0SC 4UAVA 1NNLA 2BQ3A 4AYBF 5KFSA 4DFJA 4RNNA 3MGVA 4R8UA 4Q8EA 2W9MA 2HOIA 4CCHA 5DKWA 2ZJ8A 3H8MA 4TQRA 2C2RA 3FC4A 9ICAA 3AU2A 2HHSA 2CXYA 1NK4A 2YB4A 2NO5A 2FPKA 2VANA 2G5HB 4F2SA 1RXVA 3UQ2A 8ICNA 3H4BA 4F4KA 5HHHA 3GFKB 2F77X 7ICKA 8ICTA 2ZIVB 2ZIVA 7ICLA 4R63A 1KRPA 1PZNA 4J9SA 1ZQBA 2IBKA 5AI0A 2O6KA 1X9XA 4PPXA 2M9NA 4UB6U 4IRCA 1ZOLA 2CN1A 4KTQA 1QTMA 3IHQB 5AKJA 2MUTA 1RM6C 4I2DA 3PX6A 3F2BA 3KFUF 2LYBA 5EWGA 5DBBA 2WTFA 4MHVA 2R8GA 5KFBA 1JUDA 1KTQA 1IV8A 4F4YA 4I27A 2RLTA 3N7SC 1N5XA 2A1JB 1LB2B 2KTQA 2OH2A 4LZDA 3AQFA 3RTVA 2LM1A 3QUCA 4OJOA 2IOFK 1NKCA 2K60A 2RRDA 3SZ2A 3WKCA 1DGJA 4DSLA 2MSNA 4QJFB 3H7IA 1N56A 8ICRA 2HHWA 5HR6A 3DEEA 3TAQA 4EBCA 2AGQA 5KAIU 1D8BA 3PO5A 2VKQA 2ASJA 1ZQHA 2E5SA 2HHXA 1TK0A 5L1KA 5DDYA 4YR3A 2F44A 1N2XA 9ICBA 2YB1A 3IV6A 5B66U 3V7KA 3HX0A 1UA1A 3GIKA 3ZDDA 2BPCA 3RRHA 2V9WA 4KMOB 3TADC 5ALQA 4JWNA 1TE2A 5KFJA 3SQIA 3RAQA 4OCZA 2AQ4A 2KZ3A 3ONNA 4JV0A 2QB0A 1OW5A 1LKYA 3CP8A 1S97A 8ICXA 4BWJA 2W9BB 2RP5A 8ICQA 2DQNB 3OJUA 4EZ6A 2ZUBA 2FMSA 4KN4A 1BPBA 4NY8A 4ED0A 2EZXA 5KG7A 5C5JA 3KKAC 4NLCA 3K1RB 3QU9A 1IG6A 3O0FA 4J9NA 2NRZA 5CWRA 3H40A 1SL1A 1N63A 4GXJA 3C23A 4QWDA 5AK5A 4YR2A 1AROP 1ZQAA 3M9NB 2DFLA 2BGWA 2W8KA 2C2DA 1XC9A 2W9AA 2KVCA 4ECSA 4K4GA 4UW9A 2KJ8A 2PMZF 1PK3A 4BWMA 1T8EA 2PFOA 2GH1A 2A1AA 4KLSA 1AQ6A 3HKZC 2BCVA 3ZDEA 1MQ3A 2KKPA 4QZFA 3OTQA 3ALRA 1KKXA 4CGZA 4QZHA 1S9FA 1B22A 3IRUA 2E8MA 3KOOA 2EQYA 4QIWF 2W3RA 5KFMA 1T7PA 3M9OB 2ZIXA 5KG5A 2KOBA 1UA0A 3BS5A 2XY5A 4MF2A 4I2JA 2HMXA 1JXEA 4C4TA 1Y88A 4C7YA 1BPEA 5EE9A 4EEKA 5KL8B 3MGIA 3GV7B 2FPLA 9ICHA 3KZIU 1S0VA 4MF8A 2WB1F 5ALXA 1BNPA 3F5EA 3S6JA 5DBAA 3GZFA 2G06A 5AIBA 4BX9C 1J97A 4NM1A 4C4RA 2LI6A 2OHFA 5C0YA 4M9NA 4M6WB 2BR0A 1RXWA 3JPSA 3Q8LA 2PI4A 4UB4A 1NJZA 5ALUA 3DDHA 1VDVA 5CEHA 3K1ZA 1KBUA 2DPIA 1C7YA 3C5GA 3QU4A 4DLEA 2K4PA 4NWIA 5KT3A 1BPDA 2KIWA 1D8LA 2NRWA 5L1JA 2R18A 5J2AA 4ED7A 3PO4A 5IILA 3QUTA 4QW9A 1K5OA 3ISBA 1WUDA 4P4OA 3KD3A 3M6ZA 2H5XA 1TK8A 4DLGA 3PW4A 1VLBA 4RQ2A 2GLEA 3E2EA 3SR6A 3TFRA 4I2GA 2C22A 4F72A 9ICRA 3KHGA 4K4HA 3PX4A 4O3QA 5DG7A 1QCKA 2FDRA 4IS7A 2VA2A 2KJ5A 1WYGA 4YMMA 4I2AA 2Q4TA 4RPZA 1KFDA 2BCUA 4DQSA 4ACOA 2ISPA 1JX4A 4Y2YA 4BXOA 1KN5A 1BPYA 4ELTA 3CYMA 4RU9A 4B6JA 5DB7A 5J8YA 2LBOA 1LVHA 2ZJ5A 3PVXA 3UQ0A 2FLLA 1T4GA 3AU6A 1Z3EB 4Z6EA 4U6PA 1SIJA 4GXKA 4R66A 2QARA 2FJ6A 4QZDA 3N4MB 1ZQIA 5HNKA 3RR8A 5KFXA 4O3MA 1PVRA 3AQEA 1TAQA 5KG3A 2C2EA 5BOLA 2WAQF 1V38A 3QZ7A 4DS5A 2HSZA 2F1HA 2JMGA 2I1QA 2KHVA 4DOBA 5ALRA 4YP3A 2AU0A 4ECRA 4Y2TA 3SAHA 2UVRA 4I2BA 1ZQFA 5EWFA 1MQ2A 1NJYA 1PK1B 3RJHA 1KW4A 4DFMA 4ECXA 3B0XA 3PW0A 3RAXA 2HHUA 3V72A 2YY6A 3UMGA 2XVTA 3KHHA 3QU7A 1TV9A 1RDFA 3NVZA 1WCNA 2R8HA 9ICNA 3QX7A 5AHXA 3MR2A 3LWLA 2KV2A 5AI5A 5KG4A 2E1FA 3IG5A 2J6SA 2H3VA 2NRTA 1ZRNA 3NASA 2B0CA 2XO7A 1NKEA 3NTUA 5DQHA 1NOMA 5J0XA 4KLMA 3JPNA 5KL1B 1Z00B 1N5WA 4EEYA 1B0XA 3GIMA 4ELVA 3RB4A 1XWLA 5DLFA 4BDPA 9ICOA 4F50A 3UPQA 4XA5A 3RB6A 1C20A 4JV2A 2F1IA 1UPHA 2HBKA 8ICKA 3BS7A 1L7NA 4ECQA 1QLNA 2QKQA 4B9VA 1SL2A 4UBCA 3JPPA 4C8LA 4NV0A 5AM2A 5AM1A 3PNCA 9ICFA 5HMMA 3AL0B 5KT7A 4O5EA 5KG1A 2HDOA 1NKBA 2KNJA 3BJYA 1OUQA 2H3QA 1ZQWA 5KFVA 3VC8A 2LHTA 3AUOA 1ZQ1C 4F5NA 5AK3A 4RUCA 2P35A 2W43A 2I9GA 3RF9A 3UMCA 5AM4A 2WF8A 2W8LA 4BGDA 1WWUA 1MSWD 4QZIA 4DO9A 3B9JA 1Z4OA 2WF9A 2RDIA 5HR7A 1U45A 3RH6A 4KX3A 3C2KA 5DDMA 1Z1BA 4UAUA 1ZQEA 3UXOA 5AKIA 8ICLA 5L1IA 4DSEA 5KFWA 7ICGA 4ED2A 9ICEA 3T5LA 4IC9A 4ELUA 2KIVA 2ZIWB 5J0RA 1MA7A 4RNMA 4F8RA 2ODGA 2YMPA 4KLDA 1X66A 2D8CA 4B9TA 5AKZA 4M9LA 5AM0A 4PGQA 2W9CB 3SI8A 1JIHA 5J2JA 3N97B 4K4IA 3WKAA 2E3TA 1JXLA 3UXNA 4CDGA 5D49A 2KFZA 2FLNA 3MBYA 4C8NA 4XQ8A 4OJLA 2W7OA 4TURA 4KLIA 2FE9A 2PI5A 5BPCA 2FLPA 3PW7A 4C8OA 1YZ6A 4ECTA 4YFKA 4YD2A 4ECUA 5DG9A 1U49A 4O3OA 5F9LA 7ICQA 3L3FX 4LVSA 3BQ0A 3OGUA 2F3NA 1V85A 3MC1A 3R9KA 2ATLA 5KFQA 4DCCA 2M0NA 3K4GA 1NI3A 9ICCA 4DSJA 1COKA 2DKXA 2KICA 4FO6A 3EPGA 1PUZA 3UM9A 3BDPA 4GIBA 4RT2A 4Q44A 5J8YC 8ICHA 2WFAA 1X9SA 1L3TA 3H4DA 1F44A 4YD1A 4R8UB 2P66A 1ZQMA 7ICJA 5KAFU 5AK4A 5KG0A 1IXRA 8ICCA 4UB1A 4J9RA 4KX5A 5GTIU 2Y1IA 3NUQA 7ICIA 4IRKA 4NXZA 1QSSA 1L6NA 1N62A 1JRPA 8ICMA 2G09A 4B9UA 2MUTB 3LYSA 2D3DA 2EH9A 3MABA 4UB8U 2LKYA 4P0PA 2IA6A 4LZGA 2BPFA 1XNSA 3KZXA 2ZUCA 1N61A 2Z7JA 2CPRA 4KLJA 1T3QA 9ICSA 1JI7A 1ZRMA 4NLKA 1Q3UA 1DK3A 1IIPA 4UB2A 3WKEA 5HP4A 1UT8A 4C4SA 3I1YA 3ORYA 3C1YA 2HOQA 4ECVA 4U7CA 5DB9A 4QZAA 3RB3A 1DOQA 4JWMA 5KFZA 3BQTA 2ZUDA 3RFAA 5TZVA 4J9QA 3LVVA 1ZQVA 4CE6A 3HWTA 5J2CA 1TFRA 5J0OA 2YN4A 1SXDA 1MN8A 7ICUA 4C80A 1RG6A 1U47A 5IIKA 1L3UA 3V6HA 2JV3A 1ZD4A 2BHNA 1ZYQA 4FE3A 1ZQUA 3NVVA 1A6SA 4DWIA 4UB3A 2E8PA 4QZ9A 2QB0B 1LKYB 4KLEA 2YMQA 4F71A 3GIIA 4DL4A 4YMNA 5ALZA 1ZD5A 4I2FA 5J0SA 2KHQA 2KE7A 4QWBA 1Q3VA 1YT3A 4QIWC 4EX7A 5IIMA 2FI1A 3TACB 2VJ5A 8ICUA 2XICA 2OWOA 2NO4A 8ICOA 3RBDA 1XU4A 4TUSA 1ZXIA 4E0DA 1P7DA 2KKVA 4J9MA 3SEIA 4DS4A 1K1SA 3I28A 1GO3F 2LM4A 2XGQA 4Y2QA 5J2GA 1S10A 4ZH4A 1UT5A 4Y2RA 2WB1C 1FFUA 1SGGA 2F1JA 3M8RA 4RQ3A 2W54A 3RH5A 4DQIA 3GV5B 5L9XA 3TANA 3KHLA 2HVHA 3D6JA 1L7MA 3SAFA 5KG2A 9ICWA 4QW8A 4YMOA 3EWAA 1SKWA 5JRTA 4KLLA 1TKDA 2ZIXB 2JEIA 1DK2A 2KFNA 3C2MA 3BS5B 4O3PA 3TKAA 4RQ6A 3ZD8A 4EENA 4DF8A 4G9BA 5KFDA 1V9PA 4J9KA 2KVSA 2B21A 4KITB 2G08A 3ZI4A 1ZQZA 3VCBA 3NRZA 5HHIA 2NRVA 1L8LA 2NYVA 4GLXA 4I2CA 1KFSA 1ZQRA 5AKLA 3CNHA 4O3NA 3SV4A 3PR5B 2IOHA 2QB1A 3RB0A 3WK8A 4RPXA 2XCPA 7ICRA 4DL6A 2WF5A 5KFRA 4YN4A 2W7PA 1J2NA 4CNQA 5J0YA 2KZZA 2ZIUA 2HBLA 3HKZF 5KT6A 5CRXA 9ICXA 2K4IA 3TFSA 2JR5A 4IQWA 2KSOA 1QQ7A 1L8OA 1MC8A 1RPLA 2KN7A 2DGZA 4QWEA 1X40A 1X6JA 2NV3A 4HAIA 4I2EA 3PSIA 5E79U 2HBMA 2K4EA 4KLTA 4MFFA 1XSPA 4HYKA 5L1LA 5FP0A 3Q8PB 1PVQA 2HCFA 4PHEA 4KLHA 3UXPA 8ICEA 9ICGA 2G07A 4DQQA 3MFHA 3CW2C 5KFGA 4US9A 3L5KA 3N7PD 5ALGA 5KT2A 4PJ0U 4Y2SA 1V97A 2WF6A 3QE9Y 1UHUA 4DFPA 4BXOB 4ED6A 1NJXA 5CHGA 2V4RA 1WCLA 2G0AA 4BJQA 3NVWA 3F2CA 4FZMA 4Q43A 3T79A 2DWQA 5KT4A 2A3VA 3PMNA 3MR3A 1ECWA 2FPMA 1X42A 2EAOA 2W55A 2QARB 2DL0A 2L5YA 4DL7A 5EE1A 2ASLA 4I28A 4I29A 3WK6A 5D46A 4PGYA 3PSTA 3HW8A 2KEYA 4MEXA 4EZ9A 4GXIA 2AH5A 3HJEA 4C8MA 2V4QA 2HHQA 3TAPA 1X6IA 1CRXA 4NLNA 5ALHA 3TI0A 1N48A 5AKYA 4XRHA 2E1EA 1L3SA 3H8JA 3D2QA 5L1MA 4F3OA 1X2IA 4KLOA 4ED3A 1ZQNA 4KLUA 4USAA 3BQ2A 5ALMA 3GV8B 9ICPA 2P6UA 2HI0A 2JZBA 1YZ7A 7ICHA 5J29A 4PL2A 4CF4A 3F2DA 5AIAA 1ZD2P 2ZTDA 4PZOA 4B9MA 3LDAA 2EZZA 3WK9A 1ZD3A 4QZEA 1D9FA 4DSKA 2HOFA 4DL5A 4RQ4A 4OD0A 2N1RA 2IMWP 4A8EA 4US8A 3RJJA 4IL6U 4XUSA 1URJA 3JPQA 4C8KA 2VIXA 5ALFA 5TISU 3B0YA 1NZBA 4UAZA 4M2YA 1TAUA 5AKHA 2JEJA 2LYHA 5IIJA 8ICFA 4OJ6A 1CEZA 5ALKA
chains in the Genus database with same CATH topology
3H8MA 3TADC 5JU5A 1V38A 3BS5B 1SXEA 2KG5A 1WWVA 1COKA 5KNIA 2QB0A 2DKXA 1OW5A 1LKYA 1SXDA 2EAOA 3BQ7A 1RG6A 1PK1B 2EAPA 2QARB 1KW4A 2DL0A 2L5YA 1Z1VA 4NJ8A 5J8YC 2JV3A 1WWUA 1X9XA 1F0MA 1SV0C 3KKAC 4NL9C 2YTUA 2KMDA 3IDWA 2K4PA 3K1RB 1SV4A 2QB1A 4RQMA 1DXSA 5F3XB 2E8PA 2DKZA 2B6GA 3SENA 2QB0B 1LKYB 2E8OA 5L1MA 4MHVA 2GLEA 1PK3A 2KIVA 4RQNA 2KE7A 2KSOA 1X66A 3TACB 2D8CA 4IS7A 4PZNA 1X40A 3TADA 2D3DA 4PZOA 2E8MA 2Y9TA 5JTIA 2E8NA 2K60A 3SEIA 1B0XA 2FE9A 2EAMA 2Y9UA 1B4FA 2F8KA 1JI7A 3BS5A 2KSOB 1OXJA 2LPEA 5J8YA 3BS7A 1UQVA 1SGGA 2ESEA 2QKQA 2ES6A 1SV0A 3HILA 3KKAA 4NL9A 2EANA 1UCVA 2F44A 1PK1A 2QARA 2F3NA 1V85A 5JRTA 2LMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8M A;  3TAD C;  5JU5 A;  1V38 A;  3BS5 B;  1SXE A;  2KG5 A;  1WWV A;  1COK A;  5KNI A;  2QB0 A;  2DKX A;  1OW5 A;  1LKY A;  1SXD A;  2EAO A;  3BQ7 A;  1RG6 A;  1PK1 B;  2EAP A;  2QAR B;  1KW4 A;  2DL0 A;  2L5Y A;  1Z1V A;  4NJ8 A;  5J8Y C;  2JV3 A;  1WWU A;  1X9X A;  1F0M A;  1SV0 C;  3KKA C;  4NL9 C;  2YTU A;  2KMD A;  3IDW A;  2K4P A;  3K1R B;  1SV4 A;  2QB1 A;  4RQM A;  1DXS A;  5F3X B;  2E8P A;  2DKZ A;  2B6G A;  3SEN A;  2QB0 B;  1LKY B;  2E8O A;  5L1M A;  4MHV A;  2GLE A;  1PK3 A;  2KIV A;  4RQN A;  2KE7 A;  2KSO A;  1X66 A;  3TAC B;  2D8C A;  4IS7 A;  4PZN A;  1X40 A;  3TAD A;  2D3D A;  4PZO A;  2E8M A;  2Y9T A;  5JTI A;  2E8N A;  2K60 A;  3SEI A;  1B0X A;  2FE9 A;  2EAM A;  2Y9U A;  1B4F A;  2F8K A;  1JI7 A;  3BS5 A;  2KSO B;  1OXJ A;  2LPE A;  5J8Y A;  3BS7 A;  1UQV A;  1SGG A;  2ESE A;  2QKQ A;  2ES6 A;  1SV0 A;  3HIL A;  3KKA A;  4NL9 A;  2EAN A;  1UCV A;  2F44 A;  1PK1 A;  2QAR A;  2F3N A;  1V85 A;  5JRT A;  2LMR A; 
#chains in the Genus database with same CATH topology
 1ZET A;  4ED1 A;  2EZY A;  4EBD A;  8ICB A;  5JU5 A;  1SKR A;  4J03 A;  3H8S A;  2ZTC A;  4Y2V A;  1XSN A;  4EX6 A;  3JPT A;  3AM9 A;  3C5F A;  5J2D A;  4C7Z A;  1XO0 A;  5KFY A;  5ALJ A;  5ALP A;  1A77 A;  4IRD A;  1JN3 A;  3IG8 A;  3C29 A;  3PW5 A;  4P0Q A;  2EAP A;  4F2R A;  3MR5 A;  2XY7 A;  4JMU A;  8ICA A;  3T5J A;  2BQU A;  1NK6 A;  2DF4 B;  4QZ8 A;  2GOL A;  4RQM A;  1DXS A;  3V6K A;  3FDS A;  2DKZ A;  2B6G A;  3SEN A;  4QWC A;  2R8I A;  4DQP A;  4I2H A;  2GO7 A;  3QUB A;  4YCX A;  2DBY A;  4DFK A;  5EE0 A;  3PML A;  5EOZ A;  5ALY A;  1U9L A;  4KN7 A;  1BGX T;  4MFA A;  5KFT A;  5J0W A;  2W11 A;  1L3V A;  2PKE A;  3HT3 A;  4RQ7 A;  4OJ5 A;  2PFQ A;  5AKK A;  3HPO A;  2RDJ A;  1FEZ A;  1Q46 A;  3H0M B;  3IM1 A;  5AIC A;  1ZQO A;  2IHM A;  3T5H A;  2HBJ A;  3KTQ A;  3M6K A;  5EWE A;  3ISC A;  3TQ1 A;  4PGX A;  7ICS A;  3ETR A;  4BUG A;  3EPI A;  3HIL A;  5J0U A;  1TK5 A;  2EAN A;  4FFD A;  1KDH A;  4RNO A;  1RQL A;  2W04 A;  4ED8 A;  1QSY A;  5CA7 A;  1WG8 A;  4F5O A;  1RYU A;  3D2S A;  3PSP A;  1D9D A;  5GTH U;  4QZC A;  7ICM A;  3ICX A;  1NK8 A;  2IOF A;  4YXJ A;  4RPY A;  4AYB C;  2KG5 A;  5KNI A;  5F9N A;  3LWM A;  2BDU A;  5DBC A;  2ISO A;  3H8W A;  3BQ7 A;  1VJ5 A;  3QU5 A;  4AP9 A;  1ZQC A;  4IQT A;  2RHF A;  2YTU A;  2HHT A;  1ZQY A;  3IDW A;  1L5U A;  3RJK A;  3OHA A;  1SV4 A;  5F3X B;  1NK5 A;  4UB5 A;  3N7R C;  2KJ9 A;  3QU2 A;  4CF3 A;  4F92 B;  3QEA Z;  1S77 D;  5G5H A;  4JV1 A;  4DF4 A;  3UMB A;  2AGO A;  5KFH A;  2BPG A;  4TUP A;  3OJS A;  5IIO A;  3ISD A;  3PX0 A;  2JH7 A;  2BZF A;  4ECW A;  2R8K A;  5H2F U;  2BCR A;  4B9S A;  4QZG A;  4UAR A;  2BKE A;  1HUZ A;  2ZXI A;  2JEF A;  1BNO A;  3LVW A;  4X5V A;  2Y9T A;  5JTI A;  4NM2 A;  8ICW A;  5KFC A;  2VJ4 A;  3QNM A;  4TQS A;  1L7O A;  2Y9U A;  3WU2 U;  4YG2 A;  2JGA A;  4M9H A;  1UQV A;  2AQ0 A;  4FZN A;  4PHD A;  1NJW A;  7ICT A;  2UVV A;  4P0P B;  5ALE A;  3QXG A;  2JXJ A;  4RZR A;  1BVS A;  5AKE A;  4Z6D A;  4RQ0 A;  4ICA A;  2YQE A;  1D8Y A;  1BPZ A;  5ALV A;  1RYR A;  1NK9 A;  2Y0S F;  5AM5 A;  1SXE A;  5DGA A;  5AKX A;  4Q8F A;  2I5H A;  9ICT A;  2WF7 A;  3AN1 A;  5J0T A;  5ALI A;  4LJX A;  2Y1J A;  2I6X A;  3FAH A;  2UVW A;  4IQV A;  1H38 A;  1PVP A;  1TVA A;  4UQG A;  2XY6 A;  2W3S A;  5ALW A;  1SL0 A;  2A1J A;  3WK4 A;  5B5E U;  4QWA A;  3JPR A;  3EUB 2;  2OEH A;  1COO A;  2AHO B;  2ZG6 A;  5CP2 A;  3G6Y A;  4QZB A;  5CB1 A;  3MGH A;  4P2H A;  1FIQ A;  3GIJ A;  1S5L U;  2LYA A;  5A0L A;  9ICK A;  4Y2P A;  4CF5 A;  5ALD A;  5JUM A;  1CI4 A;  3PSF A;  4P4M A;  2XCA A;  2XID A;  4M9J A;  8ICG A;  4O5C A;  2BDP A;  3Q8Q B;  3MDA A;  2R8J A;  2YML A;  2PMZ C;  3RJI A;  1LV5 A;  3PZP A;  1Q8K A;  2Q0Z X;  1S0N A;  1O08 A;  4YR0 A;  4YQW A;  4O5K A;  4Y2J A;  2KP7 A;  8ICV A;  2HHV A;  2F8K A;  2KZM A;  5AI4 A;  1OXJ A;  4DL3 A;  1KLN A;  4EBE A;  8ICP A;  2G5I B;  2ESE A;  1SV0 A;  4F5R A;  4NL9 A;  3IN5 A;  4GC7 A;  4PHP A;  1X9M A;  2W9B A;  1JAL A;  4PL1 A;  4NLB A;  4DOA A;  1ZQS A;  2KK0 A;  1M6Y A;  2P6R A;  7ICE A;  5DQG A;  7ICP A;  4JK1 A;  1QSL A;  5BOM A;  3QYP A;  2KD1 A;  4J9P A;  2XI9 A;  5ALT A;  3KBB A;  1WWV A;  9ICM A;  3D2N A;  4UAS A;  3J81 j;  4C0Z A;  2ALZ A;  1BPX A;  3L4P A;  3EZ5 A;  2JRZ A;  1HEK A;  4DQR A;  4M9G A;  5III A;  4NJ8 A;  4RQ1 A;  1ZJN A;  3M1Y A;  4FS2 A;  1ZQP A;  2ZTE A;  4FZL A;  1FFV A;  1F0M A;  1QQ5 A;  3V6J A;  4Z6C A;  5AI6 A;  3RH4 A;  2FMQ A;  3NGD A;  5J2K A;  2J6U A;  3CRX A;  5KT5 A;  1DGS A;  1ZQT A;  2MU2 A;  4O9M A;  1JMS A;  3C1Z A;  3THV A;  4IQU A;  4B9L A;  5KG6 A;  2JH1 A;  4Q45 A;  2OYY A;  4GC6 A;  3FM9 A;  3GU3 A;  1XS9 D;  4RQN A;  2YX8 A;  3PW2 A;  9ICV A;  4M0A A;  4QNL A;  1SZH A;  5DB6 A;  3JPO A;  2YMM A;  3MFI A;  2XC9 A;  3ED5 A;  1XO1 A;  3PR4 A;  9ICU A;  2E8N A;  1Z19 A;  1B43 A;  4UAY A;  1KSP A;  2ZIU B;  3C28 A;  3DV9 A;  5K4L A;  2EAM A;  4DSI A;  1B4F A;  3M8S A;  8ICY A;  5KFF A;  4FBT A;  2JHD A;  5KFI A;  2KSO B;  2VA8 A;  3NVY A;  4RQ8 A;  4M6W A;  1ZQL A;  3OPX A;  4F93 B;  1UCV A;  1F5S A;  2A19 A;  1T3N A;  1A76 A;  5AM3 A;  5KTQ A;  1HJP A;  2AGP A;  1ZQD A;  5KFE A;  3WK7 A;  3SV3 A;  1IM4 A;  3ZDB A;  3H0L B;  2H3F A;  4I2I A;  5AKG A;  3NRW A;  1S0M A;  2H3I A;  5IIN A;  2XGP A;  2F2A B;  2FMP A;  4UBB A;  3SD7 A;  5T14 A;  2WAQ C;  2GWS A;  2DUY A;  4IR1 A;  4J9O A;  1ZQX A;  3ZD9 A;  5ALS A;  2OCE A;  5J0P A;  4F4W A;  1U48 A;  4B9N A;  4IR9 A;  5DG8 A;  4TUQ A;  2F76 X;  1SKS A;  1RQN A;  4OO1 J;  2H3Z A;  3T3F A;  3IP4 B;  5G5G A;  3PV8 A;  5J0Q A;  3OHB A;  7ICN A;  2E8O A;  3V7J A;  3C21 A;  4DFD A;  5KFU A;  4R65 A;  3G6V A;  2MA1 A;  4NLG A;  3GDX A;  1A0P A;  3WKD A;  5J2F A;  3QUQ A;  4F5Q A;  4DSF A;  4KLF A;  1EXN A;  2K89 A;  4DOC A;  2K8B B;  3U26 A;  1S0O A;  3PY8 A;  3NS1 A;  1S8O A;  5DGB A;  3BQ1 A;  4CRX A;  4DEZ A;  1TAM A;  4PZN A;  4F91 B;  2ZJA A;  3F5A A;  2CRX A;  5J2I A;  3WK5 A;  5KFP A;  4O3R A;  3C2L A;  1ZQQ A;  4FS1 A;  3A0H U;  4UAT A;  5ALN A;  2DPJ A;  1Z4N A;  4ECZ A;  3Q8R B;  4F5P A;  4NLZ A;  5KFA A;  4DL2 A;  1SWV A;  4FBU A;  2BCQ A;  3QZ8 A;  3Q8S B;  3AMZ A;  3BZK A;  2LPE A;  3E0F A;  4JB3 A;  5AK6 A;  2JZB B;  5KFL A;  2ES6 A;  3RBE A;  4J9L A;  3V7L A;  4O0I A;  5EE3 A;  1FO4 A;  1PK1 A;  4O3S A;  2OM6 A;  3MR6 A;  1NZP A;  1QQ6 A;  3I76 A;  4GFJ A;  4F4Z A;  2LMR A;  4EYI B;  1ZJM A;  1SWW A;  1T94 A;  3AEV A;  5AI8 A;  1KL9 A;  5ALO A;  3RJF A;  4M47 A;  5DQI A;  3MDC A;  4OJP A;  2UVU A;  1Z1V A;  2ZXH A;  4P4P A;  3H0R B;  4MEY A;  1SV0 C;  2JEG A;  2QLT A;  5AI9 A;  2K4H A;  1HIW A;  4NL9 C;  3RJG A;  1QH9 A;  4ZOH C;  4RQ5 A;  1KFT A;  3OSN A;  1S76 D;  5HML A;  1SB3 C;  1ZQJ A;  3Q8K A;  9ICL A;  1RZT A;  1Z00 A;  3SAG A;  4P0Q B;  1X9W A;  2AXT U;  3ZDA A;  1L7P A;  2C28 A;  1ZQK A;  2EDU A;  3ETL A;  4ECY A;  3ZDC A;  5D4B A;  4KLQ A;  3TAD A;  4MFC A;  3EW9 A;  3HP6 A;  3RJE A;  2AJQ A;  2F8L A;  4R64 A;  3RR7 A;  2K8C B;  2ASD A;  5J2E A;  2BQR A;  2HVI A;  8ICZ A;  4YVZ A;  3K75 D;  3QEB Z;  5KFO A;  3Q8M A;  2K8A A;  1XSL A;  4Z6F A;  4EYH B;  3F53 A;  4RUA A;  3KKA A;  3LK9 A;  3M7D A;  2MAX A;  2BCS A;  1KEJ A;  9ICJ A;  4UAW A;  1DRG A;  2PXI A;  1CUK A;  8ICJ A;  2VA3 A;  5J2H A;  1ZQG A;  3GQC A;  2J6T A;  3HRD D;  1ED1 A;  1NK0 A;  5KFN A;  3E58 A;  3T5K A;  1U4B A;  2OXO A;  2PFP A;  4YXM A;  9ICI A;  2NRX A;  2ZIW A;  4G3I A;  9ICQ A;  8ICI A;  2KMD A;  3A0B U;  4KMU A;  4Y2U A;  3EYZ A;  3G6X A;  5CJ7 A;  3RRG A;  2W9C A;  3SMV A;  3TAR A;  1RYS A;  4F4X A;  7ICV A;  1O03 A;  2HW3 A;  4PH5 A;  2IHN A;  1HUO A;  8ICS A;  3M9M B;  3N28 A;  2RQ5 A;  4WJ3 B;  3KHR A;  4M04 A;  3FYH A;  1N60 A;  2W03 A;  4KLG A;  2PFN A;  5ALL A;  3GIL A;  1KQQ A;  2MRL A;  1NK7 A;  5DB8 A;  1J2M A;  5DLG A;  1K1Q A;  5CR0 A;  3BZC A;  5J2B A;  2WHE A;  5KFK A;  3WKB A;  7ICF A;  3SYZ A;  4RT3 A;  1JRO A;  2D6F C;  7ICO A;  4JUZ A;  4PHA A;  4Y2X A;  4EEL A;  1SZP A;  3OSP A;  2Y0S C;  4UAV A;  1NNL A;  2BQ3 A;  4AYB F;  5KFS A;  4DFJ A;  4RNN A;  3MGV A;  4R8U A;  4Q8E A;  2W9M A;  2HOI A;  4CCH A;  5DKW A;  2ZJ8 A;  3H8M A;  4TQR A;  2C2R A;  3FC4 A;  9ICA A;  3AU2 A;  2HHS A;  2CXY A;  1NK4 A;  2YB4 A;  2NO5 A;  2FPK A;  2VAN A;  2G5H B;  4F2S A;  1RXV A;  3UQ2 A;  8ICN A;  3H4B A;  4F4K A;  5HHH A;  3GFK B;  2F77 X;  7ICK A;  8ICT A;  2ZIV B;  2ZIV A;  7ICL A;  4R63 A;  1KRP A;  1PZN A;  4J9S A;  1ZQB A;  2IBK A;  5AI0 A;  2O6K A;  1X9X A;  4PPX A;  2M9N A;  4UB6 U;  4IRC A;  1ZOL A;  2CN1 A;  4KTQ A;  1QTM A;  3IHQ B;  5AKJ A;  2MUT A;  1RM6 C;  4I2D A;  3PX6 A;  3F2B A;  3KFU F;  2LYB A;  5EWG A;  5DBB A;  2WTF A;  4MHV A;  2R8G A;  5KFB A;  1JUD A;  1KTQ A;  1IV8 A;  4F4Y A;  4I27 A;  2RLT A;  3N7S C;  1N5X A;  2A1J B;  1LB2 B;  2KTQ A;  2OH2 A;  4LZD A;  3AQF A;  3RTV A;  2LM1 A;  3QUC A;  4OJO A;  2IOF K;  1NKC A;  2K60 A;  2RRD A;  3SZ2 A;  3WKC A;  1DGJ A;  4DSL A;  2MSN A;  4QJF B;  3H7I A;  1N56 A;  8ICR A;  2HHW A;  5HR6 A;  3DEE A;  3TAQ A;  4EBC A;  2AGQ A;  5KAI U;  1D8B A;  3PO5 A;  2VKQ A;  2ASJ A;  1ZQH A;  2E5S A;  2HHX A;  1TK0 A;  5L1K A;  5DDY A;  4YR3 A;  2F44 A;  1N2X A;  9ICB A;  2YB1 A;  3IV6 A;  5B66 U;  3V7K A;  3HX0 A;  1UA1 A;  3GIK A;  3ZDD A;  2BPC A;  3RRH A;  2V9W A;  4KMO B;  3TAD C;  5ALQ A;  4JWN A;  1TE2 A;  5KFJ A;  3SQI A;  3RAQ A;  4OCZ A;  2AQ4 A;  2KZ3 A;  3ONN A;  4JV0 A;  2QB0 A;  1OW5 A;  1LKY A;  3CP8 A;  1S97 A;  8ICX A;  4BWJ A;  2W9B B;  2RP5 A;  8ICQ A;  2DQN B;  3OJU A;  4EZ6 A;  2ZUB A;  2FMS A;  4KN4 A;  1BPB A;  4NY8 A;  4ED0 A;  2EZX A;  5KG7 A;  5C5J A;  3KKA C;  4NLC A;  3K1R B;  3QU9 A;  1IG6 A;  3O0F A;  4J9N A;  2NRZ A;  5CWR A;  3H40 A;  1SL1 A;  1N63 A;  4GXJ A;  3C23 A;  4QWD A;  5AK5 A;  4YR2 A;  1ARO P;  1ZQA A;  3M9N B;  2DFL A;  2BGW A;  2W8K A;  2C2D A;  1XC9 A;  2W9A A;  2KVC A;  4ECS A;  4K4G A;  4UW9 A;  2KJ8 A;  2PMZ F;  1PK3 A;  4BWM A;  1T8E A;  2PFO A;  2GH1 A;  2A1A A;  4KLS A;  1AQ6 A;  3HKZ C;  2BCV A;  3ZDE A;  1MQ3 A;  2KKP A;  4QZF A;  3OTQ A;  3ALR A;  1KKX A;  4CGZ A;  4QZH A;  1S9F A;  1B22 A;  3IRU A;  2E8M A;  3KOO A;  2EQY A;  4QIW F;  2W3R A;  5KFM A;  1T7P A;  3M9O B;  2ZIX A;  5KG5 A;  2KOB A;  1UA0 A;  3BS5 A;  2XY5 A;  4MF2 A;  4I2J A;  2HMX A;  1JXE A;  4C4T A;  1Y88 A;  4C7Y A;  1BPE A;  5EE9 A;  4EEK A;  5KL8 B;  3MGI A;  3GV7 B;  2FPL A;  9ICH A;  3KZI U;  1S0V A;  4MF8 A;  2WB1 F;  5ALX A;  1BNP A;  3F5E A;  3S6J A;  5DBA A;  3GZF A;  2G06 A;  5AIB A;  4BX9 C;  1J97 A;  4NM1 A;  4C4R A;  2LI6 A;  2OHF A;  5C0Y A;  4M9N A;  4M6W B;  2BR0 A;  1RXW A;  3JPS A;  3Q8L A;  2PI4 A;  4UB4 A;  1NJZ A;  5ALU A;  3DDH A;  1VDV A;  5CEH A;  3K1Z A;  1KBU A;  2DPI A;  1C7Y A;  3C5G A;  3QU4 A;  4DLE A;  2K4P A;  4NWI A;  5KT3 A;  1BPD A;  2KIW A;  1D8L A;  2NRW A;  5L1J A;  2R18 A;  5J2A A;  4ED7 A;  3PO4 A;  5IIL A;  3QUT A;  4QW9 A;  1K5O A;  3ISB A;  1WUD A;  4P4O A;  3KD3 A;  3M6Z A;  2H5X A;  1TK8 A;  4DLG A;  3PW4 A;  1VLB A;  4RQ2 A;  2GLE A;  3E2E A;  3SR6 A;  3TFR A;  4I2G A;  2C22 A;  4F72 A;  9ICR A;  3KHG A;  4K4H A;  3PX4 A;  4O3Q A;  5DG7 A;  1QCK A;  2FDR A;  4IS7 A;  2VA2 A;  2KJ5 A;  1WYG A;  4YMM A;  4I2A A;  2Q4T A;  4RPZ A;  1KFD A;  2BCU A;  4DQS A;  4ACO A;  2ISP A;  1JX4 A;  4Y2Y A;  4BXO A;  1KN5 A;  1BPY A;  4ELT A;  3CYM A;  4RU9 A;  4B6J A;  5DB7 A;  5J8Y A;  2LBO A;  1LVH A;  2ZJ5 A;  3PVX A;  3UQ0 A;  2FLL A;  1T4G A;  3AU6 A;  1Z3E B;  4Z6E A;  4U6P A;  1SIJ A;  4GXK A;  4R66 A;  2QAR A;  2FJ6 A;  4QZD A;  3N4M B;  1ZQI A;  5HNK A;  3RR8 A;  5KFX A;  4O3M A;  1PVR A;  3AQE A;  1TAQ A;  5KG3 A;  2C2E A;  5BOL A;  2WAQ F;  1V38 A;  3QZ7 A;  4DS5 A;  2HSZ A;  2F1H A;  2JMG A;  2I1Q A;  2KHV A;  4DOB A;  5ALR A;  4YP3 A;  2AU0 A;  4ECR A;  4Y2T A;  3SAH A;  2UVR A;  4I2B A;  1ZQF A;  5EWF A;  1MQ2 A;  1NJY A;  1PK1 B;  3RJH A;  1KW4 A;  4DFM A;  4ECX A;  3B0X A;  3PW0 A;  3RAX A;  2HHU A;  3V72 A;  2YY6 A;  3UMG A;  2XVT A;  3KHH A;  3QU7 A;  1TV9 A;  1RDF A;  3NVZ A;  1WCN A;  2R8H A;  9ICN A;  3QX7 A;  5AHX A;  3MR2 A;  3LWL A;  2KV2 A;  5AI5 A;  5KG4 A;  2E1F A;  3IG5 A;  2J6S A;  2H3V A;  2NRT A;  1ZRN A;  3NAS A;  2B0C A;  2XO7 A;  1NKE A;  3NTU A;  5DQH A;  1NOM A;  5J0X A;  4KLM A;  3JPN A;  5KL1 B;  1Z00 B;  1N5W A;  4EEY A;  1B0X A;  3GIM A;  4ELV A;  3RB4 A;  1XWL A;  5DLF A;  4BDP A;  9ICO A;  4F50 A;  3UPQ A;  4XA5 A;  3RB6 A;  1C20 A;  4JV2 A;  2F1I A;  1UPH A;  2HBK A;  8ICK A;  3BS7 A;  1L7N A;  4ECQ A;  1QLN A;  2QKQ A;  4B9V A;  1SL2 A;  4UBC A;  3JPP A;  4C8L A;  4NV0 A;  5AM2 A;  5AM1 A;  3PNC A;  9ICF A;  5HMM A;  3AL0 B;  5KT7 A;  4O5E A;  5KG1 A;  2HDO A;  1NKB A;  2KNJ A;  3BJY A;  1OUQ A;  2H3Q A;  1ZQW A;  5KFV A;  3VC8 A;  2LHT A;  3AUO A;  1ZQ1 C;  4F5N A;  5AK3 A;  4RUC A;  2P35 A;  2W43 A;  2I9G A;  3RF9 A;  3UMC A;  5AM4 A;  2WF8 A;  2W8L A;  4BGD A;  1WWU A;  1MSW D;  4QZI A;  4DO9 A;  3B9J A;  1Z4O A;  2WF9 A;  2RDI A;  5HR7 A;  1U45 A;  3RH6 A;  4KX3 A;  3C2K A;  5DDM A;  1Z1B A;  4UAU A;  1ZQE A;  3UXO A;  5AKI A;  8ICL A;  5L1I A;  4DSE A;  5KFW A;  7ICG A;  4ED2 A;  9ICE A;  3T5L A;  4IC9 A;  4ELU A;  2KIV A;  2ZIW B;  5J0R A;  1MA7 A;  4RNM A;  4F8R A;  2ODG A;  2YMP A;  4KLD A;  1X66 A;  2D8C A;  4B9T A;  5AKZ A;  4M9L A;  5AM0 A;  4PGQ A;  2W9C B;  3SI8 A;  1JIH A;  5J2J A;  3N97 B;  4K4I A;  3WKA A;  2E3T A;  1JXL A;  3UXN A;  4CDG A;  5D49 A;  2KFZ A;  2FLN A;  3MBY A;  4C8N A;  4XQ8 A;  4OJL A;  2W7O A;  4TUR A;  4KLI A;  2FE9 A;  2PI5 A;  5BPC A;  2FLP A;  3PW7 A;  4C8O A;  1YZ6 A;  4ECT A;  4YFK A;  4YD2 A;  4ECU A;  5DG9 A;  1U49 A;  4O3O A;  5F9L A;  7ICQ A;  3L3F X;  4LVS A;  3BQ0 A;  3OGU A;  2F3N A;  1V85 A;  3MC1 A;  3R9K A;  2ATL A;  5KFQ A;  4DCC A;  2M0N A;  3K4G A;  1NI3 A;  9ICC A;  4DSJ A;  1COK A;  2DKX A;  2KIC A;  4FO6 A;  3EPG A;  1PUZ A;  3UM9 A;  3BDP A;  4GIB A;  4RT2 A;  4Q44 A;  5J8Y C;  8ICH A;  2WFA A;  1X9S A;  1L3T A;  3H4D A;  1F44 A;  4YD1 A;  4R8U B;  2P66 A;  1ZQM A;  7ICJ A;  5KAF U;  5AK4 A;  5KG0 A;  1IXR A;  8ICC A;  4UB1 A;  4J9R A;  4KX5 A;  5GTI U;  2Y1I A;  3NUQ A;  7ICI A;  4IRK A;  4NXZ A;  1QSS A;  1L6N A;  1N62 A;  1JRP A;  8ICM A;  2G09 A;  4B9U A;  2MUT B;  3LYS A;  2D3D A;  2EH9 A;  3MAB A;  4UB8 U;  2LKY A;  4P0P A;  2IA6 A;  4LZG A;  2BPF A;  1XNS A;  3KZX A;  2ZUC A;  1N61 A;  2Z7J A;  2CPR A;  4KLJ A;  1T3Q A;  9ICS A;  1JI7 A;  1ZRM A;  4NLK A;  1Q3U A;  1DK3 A;  1IIP A;  4UB2 A;  3WKE A;  5HP4 A;  1UT8 A;  4C4S A;  3I1Y A;  3ORY A;  3C1Y A;  2HOQ A;  4ECV A;  4U7C A;  5DB9 A;  4QZA A;  3RB3 A;  1DOQ A;  4JWM A;  5KFZ A;  3BQT A;  2ZUD A;  3RFA A;  5TZV A;  4J9Q A;  3LVV A;  1ZQV A;  4CE6 A;  3HWT A;  5J2C A;  1TFR A;  5J0O A;  2YN4 A;  1SXD A;  1MN8 A;  7ICU A;  4C80 A;  1RG6 A;  1U47 A;  5IIK A;  1L3U A;  3V6H A;  2JV3 A;  1ZD4 A;  2BHN A;  1ZYQ A;  4FE3 A;  1ZQU A;  3NVV A;  1A6S A;  4DWI A;  4UB3 A;  2E8P A;  4QZ9 A;  2QB0 B;  1LKY B;  4KLE A;  2YMQ A;  4F71 A;  3GII A;  4DL4 A;  4YMN A;  5ALZ A;  1ZD5 A;  4I2F A;  5J0S A;  2KHQ A;  2KE7 A;  4QWB A;  1Q3V A;  1YT3 A;  4QIW C;  4EX7 A;  5IIM A;  2FI1 A;  3TAC B;  2VJ5 A;  8ICU A;  2XIC A;  2OWO A;  2NO4 A;  8ICO A;  3RBD A;  1XU4 A;  4TUS A;  1ZXI A;  4E0D A;  1P7D A;  2KKV A;  4J9M A;  3SEI A;  4DS4 A;  1K1S A;  3I28 A;  1GO3 F;  2LM4 A;  2XGQ A;  4Y2Q A;  5J2G A;  1S10 A;  4ZH4 A;  1UT5 A;  4Y2R A;  2WB1 C;  1FFU A;  1SGG A;  2F1J A;  3M8R A;  4RQ3 A;  2W54 A;  3RH5 A;  4DQI A;  3GV5 B;  5L9X A;  3TAN A;  3KHL A;  2HVH A;  3D6J A;  1L7M A;  3SAF A;  5KG2 A;  9ICW A;  4QW8 A;  4YMO A;  3EWA A;  1SKW A;  5JRT A;  4KLL A;  1TKD A;  2ZIX B;  2JEI A;  1DK2 A;  2KFN A;  3C2M A;  3BS5 B;  4O3P A;  3TKA A;  4RQ6 A;  3ZD8 A;  4EEN A;  4DF8 A;  4G9B A;  5KFD A;  1V9P A;  4J9K A;  2KVS A;  2B21 A;  4KIT B;  2G08 A;  3ZI4 A;  1ZQZ A;  3VCB A;  3NRZ A;  5HHI A;  2NRV A;  1L8L A;  2NYV A;  4GLX A;  4I2C A;  1KFS A;  1ZQR A;  5AKL A;  3CNH A;  4O3N A;  3SV4 A;  3PR5 B;  2IOH A;  2QB1 A;  3RB0 A;  3WK8 A;  4RPX A;  2XCP A;  7ICR A;  4DL6 A;  2WF5 A;  5KFR A;  4YN4 A;  2W7P A;  1J2N A;  4CNQ A;  5J0Y A;  2KZZ A;  2ZIU A;  2HBL A;  3HKZ F;  5KT6 A;  5CRX A;  9ICX A;  2K4I A;  3TFS A;  2JR5 A;  4IQW A;  2KSO A;  1QQ7 A;  1L8O A;  1MC8 A;  1RPL A;  2KN7 A;  2DGZ A;  4QWE A;  1X40 A;  1X6J A;  2NV3 A;  4HAI A;  4I2E A;  3PSI A;  5E79 U;  2HBM A;  2K4E A;  4KLT A;  4MFF A;  1XSP A;  4HYK A;  5L1L A;  5FP0 A;  3Q8P B;  1PVQ A;  2HCF A;  4PHE A;  4KLH A;  3UXP A;  8ICE A;  9ICG A;  2G07 A;  4DQQ A;  3MFH A;  3CW2 C;  5KFG A;  4US9 A;  3L5K A;  3N7P D;  5ALG A;  5KT2 A;  4PJ0 U;  4Y2S A;  1V97 A;  2WF6 A;  3QE9 Y;  1UHU A;  4DFP A;  4BXO B;  4ED6 A;  1NJX A;  5CHG A;  2V4R A;  1WCL A;  2G0A A;  4BJQ A;  3NVW A;  3F2C A;  4FZM A;  4Q43 A;  3T79 A;  2DWQ A;  5KT4 A;  2A3V A;  3PMN A;  3MR3 A;  1ECW A;  2FPM A;  1X42 A;  2EAO A;  2W55 A;  2QAR B;  2DL0 A;  2L5Y A;  4DL7 A;  5EE1 A;  2ASL A;  4I28 A;  4I29 A;  3WK6 A;  5D46 A;  4PGY A;  3PST A;  3HW8 A;  2KEY A;  4MEX A;  4EZ9 A;  4GXI A;  2AH5 A;  3HJE A;  4C8M A;  2V4Q A;  2HHQ A;  3TAP A;  1X6I A;  1CRX A;  4NLN A;  5ALH A;  3TI0 A;  1N48 A;  5AKY A;  4XRH A;  2E1E A;  1L3S A;  3H8J A;  3D2Q A;  5L1M A;  4F3O A;  1X2I A;  4KLO A;  4ED3 A;  1ZQN A;  4KLU A;  4USA A;  3BQ2 A;  5ALM A;  3GV8 B;  9ICP A;  2P6U A;  2HI0 A;  2JZB A;  1YZ7 A;  7ICH A;  5J29 A;  4PL2 A;  4CF4 A;  3F2D A;  5AIA A;  1ZD2 P;  2ZTD A;  4PZO A;  4B9M A;  3LDA A;  2EZZ A;  3WK9 A;  1ZD3 A;  4QZE A;  1D9F A;  4DSK A;  2HOF A;  4DL5 A;  4RQ4 A;  4OD0 A;  2N1R A;  2IMW P;  4A8E A;  4US8 A;  3RJJ A;  4IL6 U;  4XUS A;  1URJ A;  3JPQ A;  4C8K A;  2VIX A;  5ALF A;  5TIS U;  3B0Y A;  1NZB A;  4UAZ A;  4M2Y A;  1TAU A;  5AKH A;  2JEJ A;  2LYH A;  5IIJ A;  8ICF A;  4OJ6 A;  1CEZ A;  5ALK A; 
#chains in the Genus database with same CATH homology
 3H8M A;  3TAD C;  5JU5 A;  1V38 A;  3BS5 B;  1SXE A;  2KG5 A;  1WWV A;  1COK A;  5KNI A;  2QB0 A;  2DKX A;  1OW5 A;  1LKY A;  1SXD A;  2EAO A;  3BQ7 A;  1RG6 A;  1PK1 B;  2EAP A;  2QAR B;  1KW4 A;  2DL0 A;  2L5Y A;  1Z1V A;  4NJ8 A;  5J8Y C;  2JV3 A;  1WWU A;  1X9X A;  1F0M A;  1SV0 C;  3KKA C;  4NL9 C;  2YTU A;  2KMD A;  3IDW A;  2K4P A;  3K1R B;  1SV4 A;  2QB1 A;  4RQM A;  1DXS A;  5F3X B;  2E8P A;  2DKZ A;  2B6G A;  3SEN A;  2QB0 B;  1LKY B;  2E8O A;  5L1M A;  4MHV A;  2GLE A;  1PK3 A;  2KIV A;  4RQN A;  2KE7 A;  2KSO A;  1X66 A;  3TAC B;  2D8C A;  4IS7 A;  4PZN A;  1X40 A;  3TAD A;  2D3D A;  4PZO A;  2E8M A;  2Y9T A;  5JTI A;  2E8N A;  2K60 A;  3SEI A;  1B0X A;  2FE9 A;  2EAM A;  2Y9U A;  1B4F A;  2F8K A;  1JI7 A;  3BS5 A;  2KSO B;  1OXJ A;  2LPE A;  5J8Y A;  3BS7 A;  1UQV A;  1SGG A;  2ESE A;  2QKQ A;  2ES6 A;  1SV0 A;  3HIL A;  3KKA A;  4NL9 A;  2EAN A;  1UCV A;  2F44 A;  1PK1 A;  2QAR A;  2F3N A;  1V85 A;  5JRT A;  2LMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...