5L1MA

Caskin2 sam domain tandem
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
140
structure length
140
Chain Sequence
GKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKKIASEIAQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQKKLMLGVKRLAELRRGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Caskin-2
publication title A new mode of SAM domain mediated oligomerization observed in the CASKIN2 neuronal scaffolding protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5l1mA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5l1mA01
3K1RB 2DKZA 1SXEA 1Z1VA 1COKA 2K60A 1KW4A 2ESEA 4RQNA 2KE7A 1SXDA 2QB0B 4NL9C 4PZOA 1V38A 2QKQA 4NJ8A 2E8MA 1X40A 1X9XA 5L1MA 1PK1B 1PK3A 3TADC 2F8KA 2EANA 2EAMA 2D3DA 2DKXA 2ES6A 2F44A 2K4PA 1SV0A 1B0XA 2D8CA 2QB1A 3TADA 4RQMA 2EAPA 3KKAA 5JTIA 2QB0A 3SEIA 1RG6A 1SV4A 1V85A 3BS5B 2KSOB 3SENA 2LPEA 1SV0C 3BS5A 3IDWA 4PZNA 3BQ7A 2F3NA 1OW5A 1PK1A 2E8NA 2QARB 3KKAC 2JV3A 1UQVA 1LKYB 2QARA 2EAOA 3H8MA 1OXJA 1JI7A 2B6GA 3TACB 1LKYA 5J8YA 5JU5A 1X66A 5KNIA 2KG5A 2LMRA 1WWVA 2E8OA 2L5YA 4MHVA 2KSOA 2DL0A 2FE9A 2YTUA 1SGGA 5J8YC 1F0MA 2KMDA 3BS7A 2GLEA 2Y9TA 1WWUA 4IS7A 2E8PA 2KIVA 1B4FA 3HILA 4NL9A 1UCVA 5F3XB 1DXSA 2Y9UA 5JRTA
chains in the Genus database with same CATH superfamily
2P6RA 3AUOA 1ZQUA 3MR6A 4LJXA 2KE7A 3QEAZ 2W8KA 3WKEA 1TAUA 4DFPA 2H3VA 4RQ4A 5KFQA 1ZQXA 4YN4A 3AN1A 3PW4A 3UXPA 2YMPA 2C2DA 9ICAA 3DEEA 8ICLA 7ICTA 2JEGA 3N28A 4KLGA 3C29A 3AU6A 1TV9A 4Q43A 2MA1A 3F5AA 4JMUA 4ECXA 2ZXIA 5KFWA 5EE0A 4EZ9A 2MSNA 2EAPA 5L9XA 4RQ3A 4DQPA 4QW8A 3CNHA 5KT7A 1KL9A 4UW9A 2HHUA 3SENA 4O9MA 1QCKA 5FP0A 4MF8A 3BS5A 3H7IA 5KL8B 2FDRA 7ICUA 5DGAA 1WYGA 8ICEA 5DDMA 1YZ7A 5DGBA 4QWEA 4DF4A 4NWIA 1PVRA 3QZ8A 5J0XA 5IILA 2W7PA 3MFIA 3NVYA 3PW2A 2AJQA 4CRXA 1SIJA 3THVA 1CI4A 1N63A 1D9FA 2YMMA 2J6SA 5AKHA 4ECQA 5EWGA 3LVVA 5KFSA 1NK6A 2FPMA 3A0BU 1ZRMA 2H3ZA 5DBAA 5AKEA 5EE9A 2GLEA 3GIKA 3F53A 2W3RA 5KFAA 5DKWA 1XS9D 4OJOA 2HSZA 4KMUA 3JPPA 3F2BA 4FZLA 3IHQB 2KEYA 3UPQA 4JUZA 1D8LA 2KICA 1J2NA 4ED6A 3BDPA 2HHTA 5ALKA 2KV2A 2UVRA 3SAFA 1ZQYA 1RYUA 1JMSA 4Y2SA 3G6YA 4MEYA 4G9BA 2HCFA 3C1YA 5IIIA 3M9MB 1KDHA 2KJ5A 2YN4A 1NKCA 2W03A 2LYAA 3OJSA 4UB5A 5ALMA 3IRUA 4O3PA 3SQIA 3D2NA 4CNQA 5AKYA 1SV0A 2PFOA 1NI3A 2NYVA 1S97A 1DK2A 1Z4NA 5L1IA 4RQ0A 3U26A 2JZBA 3KHRA 4DLGA 5KFPA 7ICOA 3QX7A 3QXGA 1RM6C 3EW9A 2AQ0A 3GIIA 4I2GA 3K75D 1DRGA 4NV0A 2HI0A 1PK1A 4BWMA 2QARA 2PFQA 4EEYA 1L3SA 2KNJA 1KEJA 3WU2U 5KFCA 4I2IA 4O5EA 5DG7A 3Q8KA 4P0PA 3C2MA 3RJKA 2DFLA 3J81j 1XSPA 1UT8A 2ZIWB 5CJ7A 3ZD8A 2A1AA 5AKJA 1SKWA 1Q8KA 5DLFA 2PFPA 3N7PD 1UPHA 3N7RC 3SAGA 1XO0A 2XIDA 4NLBA 1KSPA 3LWMA 4F3OA 3AQEA 4I2DA 7ICLA 1B4FA 4CGZA 1N60A 1X42A 1J97A 2OCEA 4NLGA 1NOMA 4BWJA 1XSNA 1NK5A 3ZDBA 4XUSA 2IMWP 3N7SC 1OUQA 1V38A 9ICHA 1U45A 3KZXA 4DFDA 1X9XA 1JN3A 4RZRA 5L1MA 2O6KA 1J2MA 2XGPA 3ZI4A 4NLZA 5HMLA 3PSPA 1A77A 2F8KA 1N5XA 4JK1A 2ES6A 1NKBA 4KN7A 3KOOA 4IQUA 4DSIA 2NRXA 1P7DA 2JR5A 1L7OA 1O08A 1S0VA 4A8EA 3AL0B 4KN4A 1NJXA 2NRTA 4DFKA 1SV0C 2DPIA 4KLFA 3NTUA 3TAPA 2WB1C 4RPYA 1VDVA 1ZQVA 4EZ6A 5ALLA 4Y2VA 1BNPA 1KQQA 2RRDA 2BDPA 1JIHA 3SV4A 4P2HA 2UVVA 2LMRA 4DF8A 4JV2A 3ETRA 2W8LA 5C0YA 3Q8QB 2FE9A 5KFRA 8ICPA 3PNCA 4ED0A 4YP3A 4AYBC 4M9HA 4BXOA 4IS7A 2FJ6A 2FPLA 4US9A 5ALNA 8ICNA 2KZ3A 1NJYA 3HPOA 1BPDA 3NGDA 4P4PA 4DCCA 2VA2A 2LBOA 1XO1A 9ICUA 5HHIA 4C7YA 5J2FA 4GC7A 4F72A 2P66A 3PX0A 1Y88A 2WF5A 4QZ9A 2W55A 3GIJA 4ECRA 2ZXHA 4DWIA 4PJ0U 1L6NA 5AIAA 2XY5A 2BQ3A 2JMGA 4UB1A 3MBYA 4C8OA 1XSLA 7ICNA 5CEHA 1ZQFA 4UAVA 4BJQA 4RNMA 1SV4A 4I2AA 2ZJ8A 3OJUA 2CXYA 1TK5A 5AK4A 4R64A 3SMVA 3PR4A 4QZCA 2NRWA 3PSTA 2WHEA 1TAQA 4QZDA 3LK9A 3AQFA 3RB0A 2HHVA 3WKBA 4DSJA 2GWSA 1CEZA 3KTQA 2BGWA 4EBEA 1ZQDA 2KSOA 9ICOA 4RT3A 1D8BA 4F5RA 2HBMA 2AGOA 4DQQA 1ZQBA 4UB2A 5J29A 1ZQSA 5F9LA 2E8PA 3BZCA 5KT6A 3TKAA 3RJEA 2JGAA 4FS1A 2YQEA 2A1JB 3QU5A 3SR6A 1U48A 9ICWA 1NJWA 8ICOA 3O0FA 3K1RB 4UBBA 9ICMA 2ESEA 4B6JA 1X9WA 9ICFA 5ALQA 3WK6A 4G3IA 7ICJA 1F5SA 2G08A 4I2HA 4F5QA 1KBUA 2G0AA 2KN7A 2ZIUB 2W9BA 1YZ6A 1JX4A 3ZD9A 4GLXA 1ZQTA 4ECVA 1L3UA 4C4RA 3I76A 3QYPA 2W9CA 2EAMA 2BCQA 4MFCA 2D3DA 8ICZA 4F91B 5KFZA 1B0XA 2IOHA 2CPRA 2HMXA 4ED1A 3GDXA 5KT2A 3UQ0A 1RG6A 3PW0A 3OHAA 4FO6A 2HDOA 4PGQA 4EBDA 1SZHA 4IQTA 3UMCA 2LPEA 4M47A 2ZTCA 1BPBA 4QZEA 3V7KA 4GC6A 4B9UA 2BZFA 5AKIA 3ORYA 4GIBA 3V7JA 3PO5A 5KFTA 4RU9A 5J0RA 4J9OA 3HKZF 3R9KA 5J0UA 4J9PA 3ALRA 5J8YA 3LYSA 4ED2A 2KG5A 2WF7A 5J2BA 1WWVA 3RRGA 3UQ2A 1NK9A 3BQTA 3I1YA 4UB6U 4M6WA 4KLJA 2BDUA 1S0NA 1U9LA 1F0MA 3SD7A 2BPCA 3LDAA 1YT3A 2YY6A 2KIVA 2WAQC 2BCVA 4XA5A 4QIWF 2OHFA 4UB8U 5KG7A 2EH9A 5KFVA 3RH4A 5HR7A 3ICXA 4XRHA 1SXEA 3IG8A 4RT2A 4DSLA 4OJLA 4FBTA 3FAHA 5ALTA 2PI5A 5ALFA 5HNKA 7ICMA 4PPXA 4YD2A 4RUAA 3MGVA 2F2AB 3T3FA 3GV5B 4R8UA 8ICWA 2GO7A 3C1ZA 2PMZC 1XWLA 2E8MA 5HP4A 1DK3A 3M9OB 5KG1A 1FO4A 2E5SA 4QZFA 5KFBA 2ASLA 4PHAA 1RQNA 1QQ5A 4Q8EA 3TADC 3HJEA 1S0OA 5DG8A 4U6PA 5KAFU 3E2EA 3PW5A 2Y1IA 2PKEA 4QIWC 2I9GA 1BPZA 2OH2A 1N5WA 1ZQZA 2ZIXB 4YR0A 3FYHA 3RAXA 2QB0A 4EX7A 4DS5A 2DUYA 4ELVA 3OPXA 3N4MB 3IP4B 1ECWA 4K4HA 1RYSA 5J2CA 1IXRA 4CCHA 1ZQWA 1X6IA 2DPJA 4OD0A 2ZJ5A 3H0RB 1SL2A 1LKYB 4DQIA 9ICEA 3HP6A 8ICUA 2IHMA 1ZOLA 3DV9A 3UXNA 3WK7A 3PMNA 4USAA 2BHNA 1DOQA 5DDYA 4F71A 5AI9A 2BPFA 4DL7A 1KTQA 3T5LA 2HHWA 2G06A 4PH5A 5J8YC 4Z6EA 3L4PA 2UVWA 2G09A 1DGSA 3K4GA 3GZFA 3RAQA 5KG2A 4QW9A 7ICEA 3V72A 3EPGA 1BGXT 3PW7A 2H3FA 1Z3EB 1AROP 3MC1A 2R18A 4DL2A 4BUGA 2KFNA 2ASJA 5KG0A 4ECZA 4DOCA 4P0QA 5IIKA 1LV5A 2JEIA 4NXZA 4NM2A 2ATLA 4EELA 4DQRA 4UAZA 2HOFA 2G5HB 3OHBA 1NK8A 1GO3F 3H40A 2RHFA 1SKSA 1X9MA 3CW2C 3GV7B 4DEZA 2MU2A 3RB6A 7ICPA 1A6SA 3KKAA 3HRDD 2LM1A 1XU4A 1MC8A 5D46A 3VC8A 2ZIVB 2Y0SF 2R8IA 3WKCA 2FI1A 5DB9A 2YB4A 2ZUBA 3ED5A 1QH9A 3H0MB 5J0YA 9ICVA 1MQ2A 2E8NA 1WCLA 4ECYA 2FLNA 1UQVA 5CB1A 5ALSA 4DL3A 1JI7A 4IRCA 3TACB 1Z1BA 2H3QA 4I29A 3DDHA 3T5HA 4KLIA 2RQ5A 1JALA 5KG4A 1K5OA 1NZPA 5KFGA 3QEBZ 5AICA 1QSLA 4Y2QA 5ALVA 5AM3A 7ICRA 3C5FA 7ICIA 5EE1A 2A3VA 4M9JA 5ALDA 5ALXA 9ICKA 1PVPA 3BS7A 2Y9TA 2Y0SC 5KFKA 5H2FU 1S0MA 3OGUA 3UMGA 1X2IA 2IOFA 4DSEA 1H38A 4F5NA 3JPNA 1Z1VA 2K60A 5KFFA 3QZ7A 3QUBA 2HOQA 4UAYA 2ZUDA 1N56A 3B0YA 2GH1A 4YXMA 1SB3C 3HWTA 3PMLA 3RB4A 2DWQA 5KFNA 9ICTA 4C8NA 5EOZA 1C20A 4CDGA 4J9NA 5AM0A 4QZAA 2C2RA 2E1EA 4KLSA 3V6JA 5KAIU 2BCUA 3C21A 4QZGA 4Q45A 1O03A 1IIPA 2HBKA 3PVXA 5EWEA 1JUDA 1ZQPA 1AQ6A 1X6JA 2IBKA 4TUQA 2WB1F 4F4YA 4C4SA 4Q8FA 4Y2TA 3KHLA 3OSNA 4DOAA 2I5HA 1SKRA 1N2XA 3EYZA 3AMZA 2VANA 1L7PA 1A76A 4M9NA 1JXEA 5J2JA 2R8HA 1TKDA 3KKAC 4MFFA 2JV3A 5B66U 4QZ8A 3HX0A 3QUQA 2F76X 4OCZA 2B21A 1OXJA 1ZD5A 3H8MA 4F2SA 4QZHA 4Y2RA 3QU7A 2CN1A 4AYBF 3IV6A 4B9TA 4F4XA 1URJA 1L8OA 2JHDA 2R8KA 2ASDA 2YTUA 1D9DA 5KTQA 1HUOA 2LM4A 2VA8A 4UARA 3C23A 4NL9A 5J2AA 2WF8A 4O3MA 5ALZA 4I2BA 2YX8A 3JPTA 1BNOA 4ELUA 2A1JA 2DKZA 4F4ZA 3IN5A 4OO1J 2JZBB 5AKGA 3WKDA 4LZDA 5DBCA 3TQ1A 2BKEA 1C7YA 3M7DA 1MN8A 2FMPA 1SWWA 1SL1A 1UHUA 2ISPA 3EWAA 5ALHA 5ALPA 1NZBA 5KFEA 4C8LA 3OTQA 4MFAA 5AI8A 4Q44A 1XNSA 2HVHA 1PK1B 1ZD3A 1PK3A 2KD1A 4JWMA 2K4EA 2EZXA 5AI5A 3B9JA 3NVZA 4Y2XA 1JRPA 4ICAA 1ZQKA 5J2KA 2R8JA 4TUSA 4P0PB 8ICCA 4RQMA 1MA7A 8ICBA 7ICQA 4QJFB 3WK8A 3MGIA 4OJ6A 2H3IA 5AKLA 4M04A 3WK5A 5KFJA 5KFIA 5J0OA 3SAHA 4QZIA 3NRZA 4LVSA 1TE2A 4NY8A 4ZOHC 5DQGA 1RPLA 1TVAA 1K1SA 3D2SA 1XC9A 3M6KA 4UAUA 4Z6CA 5DLGA 4JV1A 1COOA 5TISU 3RF9A 1IG6A 1Z00B 1N62A 3RJHA 4B9SA 2XI9A 4QWDA 3M9NB 4M9GA 1QLNA 3MR2A 5CRXA 5DQIA 4PHDA 9ICGA 7ICHA 1M6YA 3SV3A 3BQ0A 2FMQA 1B22A 5DB6A 2NRVA 4UAWA 2WFAA 4OJPA 3Q8SB 3GILA 1DXSA 2J6UA 3CRXA 3ETLA 2F1HA 2W9AA 4IQVA 5KG6A 5BPCA 4C4TA 3HW8A 4NL9C 4IL6U 5L1KA 2BPGA 4RQ6A 3ONNA 3QUTA 2K8BB 1ZQMA 2AU0A 3NUQA 3IG5A 4J9MA 1S77D 2F77X 4ECWA 3TI0A 4YCXA 1NJZA 4ELTA 3D6JA 4BDPA 5ALGA 2HOIA 5J0WA 4J03A 5HMMA 3GV8B 2D8CA 1S10A 4I2CA 2H5XA 2KJ8A 2P6UA 3TADA 3ISCA 3RB3A 2Q4TA 2JRZA 8ICRA 2KK0A 5JTIA 3GU3A 2ZIXA 2VIXA 4Y2JA 3H4DA 4E0DA 1S8OA 4ECUA 2QLTA 1S5LU 8ICTA 2K8CB 4J9SA 1V9PA 3AM9A 4PL1A 5GTHU 1SZPA 4HAIA 2E3TA 2DQNB 3H4BA 1ZQ1C 4KLUA 3LVWA 1LKYA 2MAXA 4UATA 3JPOA 4KITB 1FFVA 5AI0A 4GXIA 2K8AA 3TFSA 2E8OA 3RJIA 1Z19A 2WTFA 2B0CA 4B9NA 5DBBA 3GIMA 5ALUA 2WAQF 4P4OA 4DSKA 4TUPA 4YD1A 3CP8A 2BQUA 3NRWA 3EZ5A 1VJ5A 4CE6A 5KFHA 1PVQA 3TARA 1HIWA 1WWUA 4KLTA 3QNMA 4ZH4A 1V97A 4QWBA 4CF4A 4RPXA 2W3SA 2M0NA 1VLBA 1T7PA 4XQ8A 4FZMA 3JPQA 5JRTA 5AIBA 3L5KA 2PMZF 2OEHA 4F4KA 3D2QA 5CA7A 2V9WA 2A19A 4RQNA 4B9VA 5JUMA 4RUCA 5ALYA 2KFZA 9ICJA 5J2EA 3IM1A 2KJ9A 4FZNA 2YMQA 2RDJA 8ICSA 5CP2A 3K1ZA 2ZTEA 2N1RA 4IR9A 1T94A 2EDUA 4YG2A 1T4GA 2AQ4A 5G5HA 4YMOA 1ZXIA 1QQ6A 2NO5A 5AKZA 1T3NA 1KLNA 4O3QA 1ED1A 4J9LA 2W54A 2YMLA 4RNNA 8ICQA 2KHVA 1V85A 1KFSA 2F1JA 5J2IA 2KSOB 8ICXA 3PSIA 1U49A 2RLTA 2ZIVA 4RNOA 3UM9A 4CF5A 4PZNA 2OM6A 5KFDA 3S6JA 1QSSA 4O5CA 4O3RA 1NK0A 5AM5A 1DGJA 3V7LA 3RR8A 4UQGA 5J2HA 4ED8A 2B6GA 3RBDA 1Q46A 4IR1A 5IIJA 3WK9A 5KNIA 5HHHA 5KG3A 4J9KA 5J2GA 5E79U 3ISBA 9ICNA 4WJ3B 5IINA 4DS4A 2XO7A 2KMDA 5C5JA 3V6HA 5AM2A 3PR5B 4RQ2A 2W9BB 1WUDA 2D6FC 2AH5A 2G5IB 2V4RA 2Q0ZX 2MUTB 2W9CB 3RJJA 4I2EA 4DSFA 2KTQA 4C0ZA 5KFUA 3FC4A 5A0LA 4EYHB 2XC9A 5J2DA 2ODGA 2C28A 2JEFA 3EUB2 3QU4A 3N97B 2ZIWA 1SXDA 1TK0A 3MFHA 4DL4A 4PGYA 4KLMA 3PY8A 1LVHA 1IV8A 5IIMA 3AU2A 1T8EA 4I2FA 4UB3A 2C2EA 1X9SA 9ICPA 3QE9Y 3KHHA 5DB8A 4EYIB 1L3VA 2K4PA 2YB1A 3MR5A 5T14A 2DGZA 5BOLA 2LYBA 1BPEA 2JXJA 4KLHA 1CUKA 4JV0A 3PV8A 1KKXA 2PI4A 1KFTA 4M6WB 1ZQAA 2DF4B 2GOLA 5L1JA 3Q8PB 2F3NA 3PX4A 4B9MA 3C28A 5GTIU 1ZQOA 1F44A 4DLEA 4QZBA 1QSYA 3MABA 3SZ2A 2F1IA 4LZGA 4Z6DA 2I1QA 3TAQA 1RYRA 3MR3A 2JH1A 1NK4A 1SWVA 2WF9A 2XY6A 1Z4OA 3Q8RB 2LKYA 5KFLA 4KLOA 1ZRNA 3BJYA 5AHXA 4ED7A 3Q8LA 1HEKA 4YVZA 4R8UB 3RFAA 4C8KA 4O5KA 2IA6A 5KFXA 3HT3A 2BCSA 5F3XB 4YQWA 2AGQA 3UMBA 1KFDA 2ZJAA 4MF2A 4B9LA 2Y1JA 8ICHA 3QU2A 3I28A 3G6VA 3FM9A 2MRLA 5BOMA 4JB3A 1KW4A 4AP9A 3RTVA 2XGQA 1L7MA 2QB0B 4PGXA 4PZOA 2ZG6A 4KLLA 4NLCA 3H0LB 5ALEA 1UA0A 4IC9A 1ZQJA 9ICLA 1N61A 1UT5A 2W7OA 2FPKA 3L3FX 3FDSA 4UB4A 1TFRA 4DFMA 2PXIA 1CRXA 4IQWA 2RDIA 3V6KA 3NS1A 2VJ4A 2IHNA 2DKXA 1ZQCA 4M9LA 1KN5A 2R8GA 2QB1A 5F9NA 2KVCA 1ZJMA 3JPRA 4GFJA 4Z6FA 4US8A 3NVWA 3SEIA 2JEJA 4KLDA 2W04A 2KKVA 1FIQA 3BS5B 3GQCA 5KL1B 5HR6A 4P4MA 3CYMA 2HHQA 4R66A 3EPIA 5D49A 3PZPA 5J0TA 4UBCA 4Y2YA 3F2CA 2EAOA 4YMNA 3B0XA 3PX6A 3M8SA 3WK4A 3C2KA 3RR7A 7ICKA 1HUZA 1RDFA 1S76D 2ISOA 7ICVA 1Z00A 4C7ZA 4FBUA 5CHGA 2HBJA 5KT4A 9ICCA 4I28A 5DQHA 9ICQA 3ZDDA 4NLKA 4YR2A 2HHSA 1WG8A 1SGGA 2VKQA 3OSPA 1ZETA 4DQSA 4P0QB 4QWAA 8ICKA 5KFOA 1ZD4A 3E0FA 4KLQA 2W11A 8ICGA 4GXJA 1EXNA 1QTMA 1ZJNA 4FE3A 1RQLA 4Y2PA 5L1LA 8ICJA 4KTQA 3TANA 4Y2UA 1ZYQA 3SI8A 3RJGA 4O3NA 2AHOB 1L5UA 5K4LA 4F5PA 9ICIA 3M6ZA 5D4BA 4EEKA 4DFJA 2HVIA 1S9FA 4DL6A 4QNLA 5AK6A 4JWNA 4YR3A 4TQSA 2EANA 3T5KA 1L3TA 3KHGA 2RP5A 4F2RA 1D8YA 5ALJA 5ALRA 4O3SA 2XVTA 2KZMA 5G5GA 2NO4A 3ZDAA 2KOBA 3MDAA 4ACOA 4MEXA 2V4QA 4J9RA 3JPSA 2XY7A 5J0SA 1HJPA 2ZIUA 3C5GA 3IDWA 2HBLA 1OW5A 3ZDEA 1B43A 2QARB 7ICFA 3KZIU 2ZUCA 1LB2B 1MSWD 4K4IA 5AM1A 4KLEA 2W9MA 2AGPA 2BR0A 2CRXA 3M8RA 7ICSA 4EENA 4MHVA 2IOFK 1SL0A 2DBYA 1JXLA 4YXJA 4KX5A 1RXWA 3T5JA 2HW3A 8ICFA 1QQ7A 5AM4A 4C80A 4M0AA 5J0QA 4FS2A 5DG9A 4J9QA 2ALZA 9ICXA 4PHEA 3KBBA 5ALIA 2UVUA 1A0PA 4BX9C 1FEZA 4YMMA 1KRPA 1COKA 1ZQLA 2AXTU 3KFUF 1JROA 3NVVA 4NJ8A 3RRHA 3MGHA 8ICMA 2EZZA 3MDCA 5AK3A 1X40A 1ZQNA 4IRDA 2KVSA 2FLLA 1NNLA 8ICYA 5KT3A 4CF3A 4KMOB 2VJ5A 3BQ1A 5AI4A 5AKXA 5KFMA 2OWOA 1IM4A 2LYHA 4YFKA 2NRZA 4F4WA 1ZQIA 5ALWA 1TAMA 4F5OA 3QU9A 1RXVA 4IRKA 1U4BA 3WKAA 3F5EA 5EWFA 2LHTA 4RQ5A 1ZQEA 3AEVA 1ZQRA 4RPZA 3H8JA 3BQ7A 5AI6A 3TFRA 4ED3A 5J0PA 2ZTDA 3SYZA 2PFNA 3ISDA 3C2LA 2KP7A 5TZVA 1X66A 3BQ2A 2OXOA 9ICRA 4C8MA 3RBEA 2G07A 2LI6A 1Q3UA 8ICIA 4OJ5A 2L5YA 4NM1A 4DO9A 4BGDA 1WCNA 5ALOA 4R63A 1BPYA 4HYKA 2DL0A 4O0IA 2JH7A 4TURA 3PSFA 3LWLA 4DL5A 1NK7A 4BXOB 5CR0A 4F92B 2KHQA 2E1FA 2XICA 4EBCA 5IIOA 2XCPA 4R65A 3VCBA 2J6TA 3HILA 1UCVA 2K4HA 1U47A 3ZDCA 5KFYA 5CWRA 1RZTA 2KZZA 2P35A 3RH6A 2FLPA 4GXKA 5AK5A 2MUTA 2I6XA 4FFDA 1TK8A 1L8LA 3NASA 4X5VA 1T3QA 3H8WA 8ICVA 2QKQA 4RQ7A 1BPXA 9ICSA 3E58A 3Q8MA 1ZD2P 4EX6A 3T79A 2BQRA 1BVSA 3A0HU 4M2YA 1MQ3A 1PZNA 3QUCA 1N48A 2F44A 3F2DA 2EQYA 4U7CA 1PUZA 2NV3A 2M9NA 3KD3A 3PO4A 1UA1A 2K89A 4PL2A 2W43A 4PHPA 8ICAA 1K1QA 2BCRA 1FFUA 4ECTA 5KT5A 9ICBA 3BZKA 2HHXA 2F8LA 1ZQQA 1L7NA 3UXOA 2KKPA 4RQ8A 4K4GA 4F8RA 1ZQHA 1NKEA 5JU5A 1ZQGA 5DB7A 4NLNA 3M1YA 3H8SA 4O3OA 5B5EU 3RH5A 5AKKA 4F93B 4I2JA 3HKZC 2VA3A 2OYYA 2Z7JA 3G6XA 2C22A 4RQ1A 1Q3VA 7ICGA 2KIWA 4ECSA 2K4IA 2EZYA 3GFKB 4QWCA 2FMSA 2XCAA 4DOBA 5EE3A 4TQRA 4I27A 2WF6A 4KX3A 5KG5A 4UASA 4F50A 2Y9UA 3RJFA
chains in the Genus database with same CATH topology
3K1RB 2DKZA 1SXEA 1Z1VA 1COKA 2K60A 1KW4A 2ESEA 4RQNA 2KE7A 1SXDA 2QB0B 4NL9C 4PZOA 1V38A 2QKQA 4NJ8A 2E8MA 1X40A 1X9XA 5L1MA 1PK1B 1PK3A 3TADC 2F8KA 2EANA 2EAMA 2D3DA 2DKXA 2ES6A 2F44A 2K4PA 1SV0A 1B0XA 2D8CA 2QB1A 3TADA 4RQMA 2EAPA 3KKAA 5JTIA 2QB0A 3SEIA 1RG6A 1SV4A 1V85A 3BS5B 2KSOB 3SENA 2LPEA 1SV0C 3BS5A 3IDWA 4PZNA 3BQ7A 2F3NA 1OW5A 1PK1A 2E8NA 2QARB 3KKAC 2JV3A 1UQVA 1LKYB 2QARA 2EAOA 3H8MA 1OXJA 1JI7A 2B6GA 3TACB 1LKYA 5J8YA 5JU5A 1X66A 5KNIA 2KG5A 2LMRA 1WWVA 2E8OA 2L5YA 4MHVA 2KSOA 2DL0A 2FE9A 2YTUA 1SGGA 5J8YC 1F0MA 2KMDA 3BS7A 2GLEA 2Y9TA 1WWUA 4IS7A 2E8PA 2KIVA 1B4FA 3HILA 4NL9A 1UCVA 5F3XB 1DXSA 2Y9UA 5JRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1R B;  2DKZ A;  1SXE A;  1Z1V A;  1COK A;  2K60 A;  1KW4 A;  2ESE A;  4RQN A;  2KE7 A;  1SXD A;  2QB0 B;  4NL9 C;  4PZO A;  1V38 A;  2QKQ A;  4NJ8 A;  2E8M A;  1X40 A;  1X9X A;  5L1M A;  1PK1 B;  1PK3 A;  3TAD C;  2F8K A;  2EAN A;  2EAM A;  2D3D A;  2DKX A;  2ES6 A;  2F44 A;  2K4P A;  1SV0 A;  1B0X A;  2D8C A;  2QB1 A;  3TAD A;  4RQM A;  2EAP A;  3KKA A;  5JTI A;  2QB0 A;  3SEI A;  1RG6 A;  1SV4 A;  1V85 A;  3BS5 B;  2KSO B;  3SEN A;  2LPE A;  1SV0 C;  3BS5 A;  3IDW A;  4PZN A;  3BQ7 A;  2F3N A;  1OW5 A;  1PK1 A;  2E8N A;  2QAR B;  3KKA C;  2JV3 A;  1UQV A;  1LKY B;  2QAR A;  2EAO A;  3H8M A;  1OXJ A;  1JI7 A;  2B6G A;  3TAC B;  1LKY A;  5J8Y A;  5JU5 A;  1X66 A;  5KNI A;  2KG5 A;  2LMR A;  1WWV A;  2E8O A;  2L5Y A;  4MHV A;  2KSO A;  2DL0 A;  2FE9 A;  2YTU A;  1SGG A;  5J8Y C;  1F0M A;  2KMD A;  3BS7 A;  2GLE A;  2Y9T A;  1WWU A;  4IS7 A;  2E8P A;  2KIV A;  1B4F A;  3HIL A;  4NL9 A;  1UCV A;  5F3X B;  1DXS A;  2Y9U A;  5JRT A; 
#chains in the Genus database with same CATH topology
 2P6R A;  3AUO A;  1ZQU A;  3MR6 A;  4LJX A;  2KE7 A;  3QEA Z;  2W8K A;  3WKE A;  1TAU A;  4DFP A;  2H3V A;  4RQ4 A;  5KFQ A;  1ZQX A;  4YN4 A;  3AN1 A;  3PW4 A;  3UXP A;  2YMP A;  2C2D A;  9ICA A;  3DEE A;  8ICL A;  7ICT A;  2JEG A;  3N28 A;  4KLG A;  3C29 A;  3AU6 A;  1TV9 A;  4Q43 A;  2MA1 A;  3F5A A;  4JMU A;  4ECX A;  2ZXI A;  5KFW A;  5EE0 A;  4EZ9 A;  2MSN A;  2EAP A;  5L9X A;  4RQ3 A;  4DQP A;  4QW8 A;  3CNH A;  5KT7 A;  1KL9 A;  4UW9 A;  2HHU A;  3SEN A;  4O9M A;  1QCK A;  5FP0 A;  4MF8 A;  3BS5 A;  3H7I A;  5KL8 B;  2FDR A;  7ICU A;  5DGA A;  1WYG A;  8ICE A;  5DDM A;  1YZ7 A;  5DGB A;  4QWE A;  4DF4 A;  4NWI A;  1PVR A;  3QZ8 A;  5J0X A;  5IIL A;  2W7P A;  3MFI A;  3NVY A;  3PW2 A;  2AJQ A;  4CRX A;  1SIJ A;  3THV A;  1CI4 A;  1N63 A;  1D9F A;  2YMM A;  2J6S A;  5AKH A;  4ECQ A;  5EWG A;  3LVV A;  5KFS A;  1NK6 A;  2FPM A;  3A0B U;  1ZRM A;  2H3Z A;  5DBA A;  5AKE A;  5EE9 A;  2GLE A;  3GIK A;  3F53 A;  2W3R A;  5KFA A;  5DKW A;  1XS9 D;  4OJO A;  2HSZ A;  4KMU A;  3JPP A;  3F2B A;  4FZL A;  3IHQ B;  2KEY A;  3UPQ A;  4JUZ A;  1D8L A;  2KIC A;  1J2N A;  4ED6 A;  3BDP A;  2HHT A;  5ALK A;  2KV2 A;  2UVR A;  3SAF A;  1ZQY A;  1RYU A;  1JMS A;  4Y2S A;  3G6Y A;  4MEY A;  4G9B A;  2HCF A;  3C1Y A;  5III A;  3M9M B;  1KDH A;  2KJ5 A;  2YN4 A;  1NKC A;  2W03 A;  2LYA A;  3OJS A;  4UB5 A;  5ALM A;  3IRU A;  4O3P A;  3SQI A;  3D2N A;  4CNQ A;  5AKY A;  1SV0 A;  2PFO A;  1NI3 A;  2NYV A;  1S97 A;  1DK2 A;  1Z4N A;  5L1I A;  4RQ0 A;  3U26 A;  2JZB A;  3KHR A;  4DLG A;  5KFP A;  7ICO A;  3QX7 A;  3QXG A;  1RM6 C;  3EW9 A;  2AQ0 A;  3GII A;  4I2G A;  3K75 D;  1DRG A;  4NV0 A;  2HI0 A;  1PK1 A;  4BWM A;  2QAR A;  2PFQ A;  4EEY A;  1L3S A;  2KNJ A;  1KEJ A;  3WU2 U;  5KFC A;  4I2I A;  4O5E A;  5DG7 A;  3Q8K A;  4P0P A;  3C2M A;  3RJK A;  2DFL A;  3J81 j;  1XSP A;  1UT8 A;  2ZIW B;  5CJ7 A;  3ZD8 A;  2A1A A;  5AKJ A;  1SKW A;  1Q8K A;  5DLF A;  2PFP A;  3N7P D;  1UPH A;  3N7R C;  3SAG A;  1XO0 A;  2XID A;  4NLB A;  1KSP A;  3LWM A;  4F3O A;  3AQE A;  4I2D A;  7ICL A;  1B4F A;  4CGZ A;  1N60 A;  1X42 A;  1J97 A;  2OCE A;  4NLG A;  1NOM A;  4BWJ A;  1XSN A;  1NK5 A;  3ZDB A;  4XUS A;  2IMW P;  3N7S C;  1OUQ A;  1V38 A;  9ICH A;  1U45 A;  3KZX A;  4DFD A;  1X9X A;  1JN3 A;  4RZR A;  5L1M A;  2O6K A;  1J2M A;  2XGP A;  3ZI4 A;  4NLZ A;  5HML A;  3PSP A;  1A77 A;  2F8K A;  1N5X A;  4JK1 A;  2ES6 A;  1NKB A;  4KN7 A;  3KOO A;  4IQU A;  4DSI A;  2NRX A;  1P7D A;  2JR5 A;  1L7O A;  1O08 A;  1S0V A;  4A8E A;  3AL0 B;  4KN4 A;  1NJX A;  2NRT A;  4DFK A;  1SV0 C;  2DPI A;  4KLF A;  3NTU A;  3TAP A;  2WB1 C;  4RPY A;  1VDV A;  1ZQV A;  4EZ6 A;  5ALL A;  4Y2V A;  1BNP A;  1KQQ A;  2RRD A;  2BDP A;  1JIH A;  3SV4 A;  4P2H A;  2UVV A;  2LMR A;  4DF8 A;  4JV2 A;  3ETR A;  2W8L A;  5C0Y A;  3Q8Q B;  2FE9 A;  5KFR A;  8ICP A;  3PNC A;  4ED0 A;  4YP3 A;  4AYB C;  4M9H A;  4BXO A;  4IS7 A;  2FJ6 A;  2FPL A;  4US9 A;  5ALN A;  8ICN A;  2KZ3 A;  1NJY A;  3HPO A;  1BPD A;  3NGD A;  4P4P A;  4DCC A;  2VA2 A;  2LBO A;  1XO1 A;  9ICU A;  5HHI A;  4C7Y A;  5J2F A;  4GC7 A;  4F72 A;  2P66 A;  3PX0 A;  1Y88 A;  2WF5 A;  4QZ9 A;  2W55 A;  3GIJ A;  4ECR A;  2ZXH A;  4DWI A;  4PJ0 U;  1L6N A;  5AIA A;  2XY5 A;  2BQ3 A;  2JMG A;  4UB1 A;  3MBY A;  4C8O A;  1XSL A;  7ICN A;  5CEH A;  1ZQF A;  4UAV A;  4BJQ A;  4RNM A;  1SV4 A;  4I2A A;  2ZJ8 A;  3OJU A;  2CXY A;  1TK5 A;  5AK4 A;  4R64 A;  3SMV A;  3PR4 A;  4QZC A;  2NRW A;  3PST A;  2WHE A;  1TAQ A;  4QZD A;  3LK9 A;  3AQF A;  3RB0 A;  2HHV A;  3WKB A;  4DSJ A;  2GWS A;  1CEZ A;  3KTQ A;  2BGW A;  4EBE A;  1ZQD A;  2KSO A;  9ICO A;  4RT3 A;  1D8B A;  4F5R A;  2HBM A;  2AGO A;  4DQQ A;  1ZQB A;  4UB2 A;  5J29 A;  1ZQS A;  5F9L A;  2E8P A;  3BZC A;  5KT6 A;  3TKA A;  3RJE A;  2JGA A;  4FS1 A;  2YQE A;  2A1J B;  3QU5 A;  3SR6 A;  1U48 A;  9ICW A;  1NJW A;  8ICO A;  3O0F A;  3K1R B;  4UBB A;  9ICM A;  2ESE A;  4B6J A;  1X9W A;  9ICF A;  5ALQ A;  3WK6 A;  4G3I A;  7ICJ A;  1F5S A;  2G08 A;  4I2H A;  4F5Q A;  1KBU A;  2G0A A;  2KN7 A;  2ZIU B;  2W9B A;  1YZ6 A;  1JX4 A;  3ZD9 A;  4GLX A;  1ZQT A;  4ECV A;  1L3U A;  4C4R A;  3I76 A;  3QYP A;  2W9C A;  2EAM A;  2BCQ A;  4MFC A;  2D3D A;  8ICZ A;  4F91 B;  5KFZ A;  1B0X A;  2IOH A;  2CPR A;  2HMX A;  4ED1 A;  3GDX A;  5KT2 A;  3UQ0 A;  1RG6 A;  3PW0 A;  3OHA A;  4FO6 A;  2HDO A;  4PGQ A;  4EBD A;  1SZH A;  4IQT A;  3UMC A;  2LPE A;  4M47 A;  2ZTC A;  1BPB A;  4QZE A;  3V7K A;  4GC6 A;  4B9U A;  2BZF A;  5AKI A;  3ORY A;  4GIB A;  3V7J A;  3PO5 A;  5KFT A;  4RU9 A;  5J0R A;  4J9O A;  3HKZ F;  3R9K A;  5J0U A;  4J9P A;  3ALR A;  5J8Y A;  3LYS A;  4ED2 A;  2KG5 A;  2WF7 A;  5J2B A;  1WWV A;  3RRG A;  3UQ2 A;  1NK9 A;  3BQT A;  3I1Y A;  4UB6 U;  4M6W A;  4KLJ A;  2BDU A;  1S0N A;  1U9L A;  1F0M A;  3SD7 A;  2BPC A;  3LDA A;  1YT3 A;  2YY6 A;  2KIV A;  2WAQ C;  2BCV A;  4XA5 A;  4QIW F;  2OHF A;  4UB8 U;  5KG7 A;  2EH9 A;  5KFV A;  3RH4 A;  5HR7 A;  3ICX A;  4XRH A;  1SXE A;  3IG8 A;  4RT2 A;  4DSL A;  4OJL A;  4FBT A;  3FAH A;  5ALT A;  2PI5 A;  5ALF A;  5HNK A;  7ICM A;  4PPX A;  4YD2 A;  4RUA A;  3MGV A;  2F2A B;  3T3F A;  3GV5 B;  4R8U A;  8ICW A;  2GO7 A;  3C1Z A;  2PMZ C;  1XWL A;  2E8M A;  5HP4 A;  1DK3 A;  3M9O B;  5KG1 A;  1FO4 A;  2E5S A;  4QZF A;  5KFB A;  2ASL A;  4PHA A;  1RQN A;  1QQ5 A;  4Q8E A;  3TAD C;  3HJE A;  1S0O A;  5DG8 A;  4U6P A;  5KAF U;  3E2E A;  3PW5 A;  2Y1I A;  2PKE A;  4QIW C;  2I9G A;  1BPZ A;  2OH2 A;  1N5W A;  1ZQZ A;  2ZIX B;  4YR0 A;  3FYH A;  3RAX A;  2QB0 A;  4EX7 A;  4DS5 A;  2DUY A;  4ELV A;  3OPX A;  3N4M B;  3IP4 B;  1ECW A;  4K4H A;  1RYS A;  5J2C A;  1IXR A;  4CCH A;  1ZQW A;  1X6I A;  2DPJ A;  4OD0 A;  2ZJ5 A;  3H0R B;  1SL2 A;  1LKY B;  4DQI A;  9ICE A;  3HP6 A;  8ICU A;  2IHM A;  1ZOL A;  3DV9 A;  3UXN A;  3WK7 A;  3PMN A;  4USA A;  2BHN A;  1DOQ A;  5DDY A;  4F71 A;  5AI9 A;  2BPF A;  4DL7 A;  1KTQ A;  3T5L A;  2HHW A;  2G06 A;  4PH5 A;  5J8Y C;  4Z6E A;  3L4P A;  2UVW A;  2G09 A;  1DGS A;  3K4G A;  3GZF A;  3RAQ A;  5KG2 A;  4QW9 A;  7ICE A;  3V72 A;  3EPG A;  1BGX T;  3PW7 A;  2H3F A;  1Z3E B;  1ARO P;  3MC1 A;  2R18 A;  4DL2 A;  4BUG A;  2KFN A;  2ASJ A;  5KG0 A;  4ECZ A;  4DOC A;  4P0Q A;  5IIK A;  1LV5 A;  2JEI A;  4NXZ A;  4NM2 A;  2ATL A;  4EEL A;  4DQR A;  4UAZ A;  2HOF A;  2G5H B;  3OHB A;  1NK8 A;  1GO3 F;  3H40 A;  2RHF A;  1SKS A;  1X9M A;  3CW2 C;  3GV7 B;  4DEZ A;  2MU2 A;  3RB6 A;  7ICP A;  1A6S A;  3KKA A;  3HRD D;  2LM1 A;  1XU4 A;  1MC8 A;  5D46 A;  3VC8 A;  2ZIV B;  2Y0S F;  2R8I A;  3WKC A;  2FI1 A;  5DB9 A;  2YB4 A;  2ZUB A;  3ED5 A;  1QH9 A;  3H0M B;  5J0Y A;  9ICV A;  1MQ2 A;  2E8N A;  1WCL A;  4ECY A;  2FLN A;  1UQV A;  5CB1 A;  5ALS A;  4DL3 A;  1JI7 A;  4IRC A;  3TAC B;  1Z1B A;  2H3Q A;  4I29 A;  3DDH A;  3T5H A;  4KLI A;  2RQ5 A;  1JAL A;  5KG4 A;  1K5O A;  1NZP A;  5KFG A;  3QEB Z;  5AIC A;  1QSL A;  4Y2Q A;  5ALV A;  5AM3 A;  7ICR A;  3C5F A;  7ICI A;  5EE1 A;  2A3V A;  4M9J A;  5ALD A;  5ALX A;  9ICK A;  1PVP A;  3BS7 A;  2Y9T A;  2Y0S C;  5KFK A;  5H2F U;  1S0M A;  3OGU A;  3UMG A;  1X2I A;  2IOF A;  4DSE A;  1H38 A;  4F5N A;  3JPN A;  1Z1V A;  2K60 A;  5KFF A;  3QZ7 A;  3QUB A;  2HOQ A;  4UAY A;  2ZUD A;  1N56 A;  3B0Y A;  2GH1 A;  4YXM A;  1SB3 C;  3HWT A;  3PML A;  3RB4 A;  2DWQ A;  5KFN A;  9ICT A;  4C8N A;  5EOZ A;  1C20 A;  4CDG A;  4J9N A;  5AM0 A;  4QZA A;  2C2R A;  2E1E A;  4KLS A;  3V6J A;  5KAI U;  2BCU A;  3C21 A;  4QZG A;  4Q45 A;  1O03 A;  1IIP A;  2HBK A;  3PVX A;  5EWE A;  1JUD A;  1ZQP A;  1AQ6 A;  1X6J A;  2IBK A;  4TUQ A;  2WB1 F;  4F4Y A;  4C4S A;  4Q8F A;  4Y2T A;  3KHL A;  3OSN A;  4DOA A;  2I5H A;  1SKR A;  1N2X A;  3EYZ A;  3AMZ A;  2VAN A;  1L7P A;  1A76 A;  4M9N A;  1JXE A;  5J2J A;  2R8H A;  1TKD A;  3KKA C;  4MFF A;  2JV3 A;  5B66 U;  4QZ8 A;  3HX0 A;  3QUQ A;  2F76 X;  4OCZ A;  2B21 A;  1OXJ A;  1ZD5 A;  3H8M A;  4F2S A;  4QZH A;  4Y2R A;  3QU7 A;  2CN1 A;  4AYB F;  3IV6 A;  4B9T A;  4F4X A;  1URJ A;  1L8O A;  2JHD A;  2R8K A;  2ASD A;  2YTU A;  1D9D A;  5KTQ A;  1HUO A;  2LM4 A;  2VA8 A;  4UAR A;  3C23 A;  4NL9 A;  5J2A A;  2WF8 A;  4O3M A;  5ALZ A;  4I2B A;  2YX8 A;  3JPT A;  1BNO A;  4ELU A;  2A1J A;  2DKZ A;  4F4Z A;  3IN5 A;  4OO1 J;  2JZB B;  5AKG A;  3WKD A;  4LZD A;  5DBC A;  3TQ1 A;  2BKE A;  1C7Y A;  3M7D A;  1MN8 A;  2FMP A;  1SWW A;  1SL1 A;  1UHU A;  2ISP A;  3EWA A;  5ALH A;  5ALP A;  1NZB A;  5KFE A;  4C8L A;  3OTQ A;  4MFA A;  5AI8 A;  4Q44 A;  1XNS A;  2HVH A;  1PK1 B;  1ZD3 A;  1PK3 A;  2KD1 A;  4JWM A;  2K4E A;  2EZX A;  5AI5 A;  3B9J A;  3NVZ A;  4Y2X A;  1JRP A;  4ICA A;  1ZQK A;  5J2K A;  2R8J A;  4TUS A;  4P0P B;  8ICC A;  4RQM A;  1MA7 A;  8ICB A;  7ICQ A;  4QJF B;  3WK8 A;  3MGI A;  4OJ6 A;  2H3I A;  5AKL A;  4M04 A;  3WK5 A;  5KFJ A;  5KFI A;  5J0O A;  3SAH A;  4QZI A;  3NRZ A;  4LVS A;  1TE2 A;  4NY8 A;  4ZOH C;  5DQG A;  1RPL A;  1TVA A;  1K1S A;  3D2S A;  1XC9 A;  3M6K A;  4UAU A;  4Z6C A;  5DLG A;  4JV1 A;  1COO A;  5TIS U;  3RF9 A;  1IG6 A;  1Z00 B;  1N62 A;  3RJH A;  4B9S A;  2XI9 A;  4QWD A;  3M9N B;  4M9G A;  1QLN A;  3MR2 A;  5CRX A;  5DQI A;  4PHD A;  9ICG A;  7ICH A;  1M6Y A;  3SV3 A;  3BQ0 A;  2FMQ A;  1B22 A;  5DB6 A;  2NRV A;  4UAW A;  2WFA A;  4OJP A;  3Q8S B;  3GIL A;  1DXS A;  2J6U A;  3CRX A;  3ETL A;  2F1H A;  2W9A A;  4IQV A;  5KG6 A;  5BPC A;  4C4T A;  3HW8 A;  4NL9 C;  4IL6 U;  5L1K A;  2BPG A;  4RQ6 A;  3ONN A;  3QUT A;  2K8B B;  1ZQM A;  2AU0 A;  3NUQ A;  3IG5 A;  4J9M A;  1S77 D;  2F77 X;  4ECW A;  3TI0 A;  4YCX A;  1NJZ A;  4ELT A;  3D6J A;  4BDP A;  5ALG A;  2HOI A;  5J0W A;  4J03 A;  5HMM A;  3GV8 B;  2D8C A;  1S10 A;  4I2C A;  2H5X A;  2KJ8 A;  2P6U A;  3TAD A;  3ISC A;  3RB3 A;  2Q4T A;  2JRZ A;  8ICR A;  2KK0 A;  5JTI A;  3GU3 A;  2ZIX A;  2VIX A;  4Y2J A;  3H4D A;  4E0D A;  1S8O A;  4ECU A;  2QLT A;  1S5L U;  8ICT A;  2K8C B;  4J9S A;  1V9P A;  3AM9 A;  4PL1 A;  5GTH U;  1SZP A;  4HAI A;  2E3T A;  2DQN B;  3H4B A;  1ZQ1 C;  4KLU A;  3LVW A;  1LKY A;  2MAX A;  4UAT A;  3JPO A;  4KIT B;  1FFV A;  5AI0 A;  4GXI A;  2K8A A;  3TFS A;  2E8O A;  3RJI A;  1Z19 A;  2WTF A;  2B0C A;  4B9N A;  5DBB A;  3GIM A;  5ALU A;  2WAQ F;  4P4O A;  4DSK A;  4TUP A;  4YD1 A;  3CP8 A;  2BQU A;  3NRW A;  3EZ5 A;  1VJ5 A;  4CE6 A;  5KFH A;  1PVQ A;  3TAR A;  1HIW A;  1WWU A;  4KLT A;  3QNM A;  4ZH4 A;  1V97 A;  4QWB A;  4CF4 A;  4RPX A;  2W3S A;  2M0N A;  1VLB A;  1T7P A;  4XQ8 A;  4FZM A;  3JPQ A;  5JRT A;  5AIB A;  3L5K A;  2PMZ F;  2OEH A;  4F4K A;  3D2Q A;  5CA7 A;  2V9W A;  2A19 A;  4RQN A;  4B9V A;  5JUM A;  4RUC A;  5ALY A;  2KFZ A;  9ICJ A;  5J2E A;  3IM1 A;  2KJ9 A;  4FZN A;  2YMQ A;  2RDJ A;  8ICS A;  5CP2 A;  3K1Z A;  2ZTE A;  2N1R A;  4IR9 A;  1T94 A;  2EDU A;  4YG2 A;  1T4G A;  2AQ4 A;  5G5H A;  4YMO A;  1ZXI A;  1QQ6 A;  2NO5 A;  5AKZ A;  1T3N A;  1KLN A;  4O3Q A;  1ED1 A;  4J9L A;  2W54 A;  2YML A;  4RNN A;  8ICQ A;  2KHV A;  1V85 A;  1KFS A;  2F1J A;  5J2I A;  2KSO B;  8ICX A;  3PSI A;  1U49 A;  2RLT A;  2ZIV A;  4RNO A;  3UM9 A;  4CF5 A;  4PZN A;  2OM6 A;  5KFD A;  3S6J A;  1QSS A;  4O5C A;  4O3R A;  1NK0 A;  5AM5 A;  1DGJ A;  3V7L A;  3RR8 A;  4UQG A;  5J2H A;  4ED8 A;  2B6G A;  3RBD A;  1Q46 A;  4IR1 A;  5IIJ A;  3WK9 A;  5KNI A;  5HHH A;  5KG3 A;  4J9K A;  5J2G A;  5E79 U;  3ISB A;  9ICN A;  4WJ3 B;  5IIN A;  4DS4 A;  2XO7 A;  2KMD A;  5C5J A;  3V6H A;  5AM2 A;  3PR5 B;  4RQ2 A;  2W9B B;  1WUD A;  2D6F C;  2AH5 A;  2G5I B;  2V4R A;  2Q0Z X;  2MUT B;  2W9C B;  3RJJ A;  4I2E A;  4DSF A;  2KTQ A;  4C0Z A;  5KFU A;  3FC4 A;  5A0L A;  4EYH B;  2XC9 A;  5J2D A;  2ODG A;  2C28 A;  2JEF A;  3EUB 2;  3QU4 A;  3N97 B;  2ZIW A;  1SXD A;  1TK0 A;  3MFH A;  4DL4 A;  4PGY A;  4KLM A;  3PY8 A;  1LVH A;  1IV8 A;  5IIM A;  3AU2 A;  1T8E A;  4I2F A;  4UB3 A;  2C2E A;  1X9S A;  9ICP A;  3QE9 Y;  3KHH A;  5DB8 A;  4EYI B;  1L3V A;  2K4P A;  2YB1 A;  3MR5 A;  5T14 A;  2DGZ A;  5BOL A;  2LYB A;  1BPE A;  2JXJ A;  4KLH A;  1CUK A;  4JV0 A;  3PV8 A;  1KKX A;  2PI4 A;  1KFT A;  4M6W B;  1ZQA A;  2DF4 B;  2GOL A;  5L1J A;  3Q8P B;  2F3N A;  3PX4 A;  4B9M A;  3C28 A;  5GTI U;  1ZQO A;  1F44 A;  4DLE A;  4QZB A;  1QSY A;  3MAB A;  3SZ2 A;  2F1I A;  4LZG A;  4Z6D A;  2I1Q A;  3TAQ A;  1RYR A;  3MR3 A;  2JH1 A;  1NK4 A;  1SWV A;  2WF9 A;  2XY6 A;  1Z4O A;  3Q8R B;  2LKY A;  5KFL A;  4KLO A;  1ZRN A;  3BJY A;  5AHX A;  4ED7 A;  3Q8L A;  1HEK A;  4YVZ A;  4R8U B;  3RFA A;  4C8K A;  4O5K A;  2IA6 A;  5KFX A;  3HT3 A;  2BCS A;  5F3X B;  4YQW A;  2AGQ A;  3UMB A;  1KFD A;  2ZJA A;  4MF2 A;  4B9L A;  2Y1J A;  8ICH A;  3QU2 A;  3I28 A;  3G6V A;  3FM9 A;  2MRL A;  5BOM A;  4JB3 A;  1KW4 A;  4AP9 A;  3RTV A;  2XGQ A;  1L7M A;  2QB0 B;  4PGX A;  4PZO A;  2ZG6 A;  4KLL A;  4NLC A;  3H0L B;  5ALE A;  1UA0 A;  4IC9 A;  1ZQJ A;  9ICL A;  1N61 A;  1UT5 A;  2W7O A;  2FPK A;  3L3F X;  3FDS A;  4UB4 A;  1TFR A;  4DFM A;  2PXI A;  1CRX A;  4IQW A;  2RDI A;  3V6K A;  3NS1 A;  2VJ4 A;  2IHN A;  2DKX A;  1ZQC A;  4M9L A;  1KN5 A;  2R8G A;  2QB1 A;  5F9N A;  2KVC A;  1ZJM A;  3JPR A;  4GFJ A;  4Z6F A;  4US8 A;  3NVW A;  3SEI A;  2JEJ A;  4KLD A;  2W04 A;  2KKV A;  1FIQ A;  3BS5 B;  3GQC A;  5KL1 B;  5HR6 A;  4P4M A;  3CYM A;  2HHQ A;  4R66 A;  3EPI A;  5D49 A;  3PZP A;  5J0T A;  4UBC A;  4Y2Y A;  3F2C A;  2EAO A;  4YMN A;  3B0X A;  3PX6 A;  3M8S A;  3WK4 A;  3C2K A;  3RR7 A;  7ICK A;  1HUZ A;  1RDF A;  1S76 D;  2ISO A;  7ICV A;  1Z00 A;  4C7Z A;  4FBU A;  5CHG A;  2HBJ A;  5KT4 A;  9ICC A;  4I28 A;  5DQH A;  9ICQ A;  3ZDD A;  4NLK A;  4YR2 A;  2HHS A;  1WG8 A;  1SGG A;  2VKQ A;  3OSP A;  1ZET A;  4DQS A;  4P0Q B;  4QWA A;  8ICK A;  5KFO A;  1ZD4 A;  3E0F A;  4KLQ A;  2W11 A;  8ICG A;  4GXJ A;  1EXN A;  1QTM A;  1ZJN A;  4FE3 A;  1RQL A;  4Y2P A;  5L1L A;  8ICJ A;  4KTQ A;  3TAN A;  4Y2U A;  1ZYQ A;  3SI8 A;  3RJG A;  4O3N A;  2AHO B;  1L5U A;  5K4L A;  4F5P A;  9ICI A;  3M6Z A;  5D4B A;  4EEK A;  4DFJ A;  2HVI A;  1S9F A;  4DL6 A;  4QNL A;  5AK6 A;  4JWN A;  4YR3 A;  4TQS A;  2EAN A;  3T5K A;  1L3T A;  3KHG A;  2RP5 A;  4F2R A;  1D8Y A;  5ALJ A;  5ALR A;  4O3S A;  2XVT A;  2KZM A;  5G5G A;  2NO4 A;  3ZDA A;  2KOB A;  3MDA A;  4ACO A;  4MEX A;  2V4Q A;  4J9R A;  3JPS A;  2XY7 A;  5J0S A;  1HJP A;  2ZIU A;  3C5G A;  3IDW A;  2HBL A;  1OW5 A;  3ZDE A;  1B43 A;  2QAR B;  7ICF A;  3KZI U;  2ZUC A;  1LB2 B;  1MSW D;  4K4I A;  5AM1 A;  4KLE A;  2W9M A;  2AGP A;  2BR0 A;  2CRX A;  3M8R A;  7ICS A;  4EEN A;  4MHV A;  2IOF K;  1SL0 A;  2DBY A;  1JXL A;  4YXJ A;  4KX5 A;  1RXW A;  3T5J A;  2HW3 A;  8ICF A;  1QQ7 A;  5AM4 A;  4C80 A;  4M0A A;  5J0Q A;  4FS2 A;  5DG9 A;  4J9Q A;  2ALZ A;  9ICX A;  4PHE A;  3KBB A;  5ALI A;  2UVU A;  1A0P A;  4BX9 C;  1FEZ A;  4YMM A;  1KRP A;  1COK A;  1ZQL A;  2AXT U;  3KFU F;  1JRO A;  3NVV A;  4NJ8 A;  3RRH A;  3MGH A;  8ICM A;  2EZZ A;  3MDC A;  5AK3 A;  1X40 A;  1ZQN A;  4IRD A;  2KVS A;  2FLL A;  1NNL A;  8ICY A;  5KT3 A;  4CF3 A;  4KMO B;  2VJ5 A;  3BQ1 A;  5AI4 A;  5AKX A;  5KFM A;  2OWO A;  1IM4 A;  2LYH A;  4YFK A;  2NRZ A;  4F4W A;  1ZQI A;  5ALW A;  1TAM A;  4F5O A;  3QU9 A;  1RXV A;  4IRK A;  1U4B A;  3WKA A;  3F5E A;  5EWF A;  2LHT A;  4RQ5 A;  1ZQE A;  3AEV A;  1ZQR A;  4RPZ A;  3H8J A;  3BQ7 A;  5AI6 A;  3TFR A;  4ED3 A;  5J0P A;  2ZTD A;  3SYZ A;  2PFN A;  3ISD A;  3C2L A;  2KP7 A;  5TZV A;  1X66 A;  3BQ2 A;  2OXO A;  9ICR A;  4C8M A;  3RBE A;  2G07 A;  2LI6 A;  1Q3U A;  8ICI A;  4OJ5 A;  2L5Y A;  4NM1 A;  4DO9 A;  4BGD A;  1WCN A;  5ALO A;  4R63 A;  1BPY A;  4HYK A;  2DL0 A;  4O0I A;  2JH7 A;  4TUR A;  3PSF A;  3LWL A;  4DL5 A;  1NK7 A;  4BXO B;  5CR0 A;  4F92 B;  2KHQ A;  2E1F A;  2XIC A;  4EBC A;  5IIO A;  2XCP A;  4R65 A;  3VCB A;  2J6T A;  3HIL A;  1UCV A;  2K4H A;  1U47 A;  3ZDC A;  5KFY A;  5CWR A;  1RZT A;  2KZZ A;  2P35 A;  3RH6 A;  2FLP A;  4GXK A;  5AK5 A;  2MUT A;  2I6X A;  4FFD A;  1TK8 A;  1L8L A;  3NAS A;  4X5V A;  1T3Q A;  3H8W A;  8ICV A;  2QKQ A;  4RQ7 A;  1BPX A;  9ICS A;  3E58 A;  3Q8M A;  1ZD2 P;  4EX6 A;  3T79 A;  2BQR A;  1BVS A;  3A0H U;  4M2Y A;  1MQ3 A;  1PZN A;  3QUC A;  1N48 A;  2F44 A;  3F2D A;  2EQY A;  4U7C A;  1PUZ A;  2NV3 A;  2M9N A;  3KD3 A;  3PO4 A;  1UA1 A;  2K89 A;  4PL2 A;  2W43 A;  4PHP A;  8ICA A;  1K1Q A;  2BCR A;  1FFU A;  4ECT A;  5KT5 A;  9ICB A;  3BZK A;  2HHX A;  2F8L A;  1ZQQ A;  1L7N A;  3UXO A;  2KKP A;  4RQ8 A;  4K4G A;  4F8R A;  1ZQH A;  1NKE A;  5JU5 A;  1ZQG A;  5DB7 A;  4NLN A;  3M1Y A;  3H8S A;  4O3O A;  5B5E U;  3RH5 A;  5AKK A;  4F93 B;  4I2J A;  3HKZ C;  2VA3 A;  2OYY A;  2Z7J A;  3G6X A;  2C22 A;  4RQ1 A;  1Q3V A;  7ICG A;  2KIW A;  4ECS A;  2K4I A;  2EZY A;  3GFK B;  4QWC A;  2FMS A;  2XCA A;  4DOB A;  5EE3 A;  4TQR A;  4I27 A;  2WF6 A;  4KX3 A;  5KG5 A;  4UAS A;  4F50 A;  2Y9U A;  3RJF A; 
#chains in the Genus database with same CATH homology
 3K1R B;  2DKZ A;  1SXE A;  1Z1V A;  1COK A;  2K60 A;  1KW4 A;  2ESE A;  4RQN A;  2KE7 A;  1SXD A;  2QB0 B;  4NL9 C;  4PZO A;  1V38 A;  2QKQ A;  4NJ8 A;  2E8M A;  1X40 A;  1X9X A;  5L1M A;  1PK1 B;  1PK3 A;  3TAD C;  2F8K A;  2EAN A;  2EAM A;  2D3D A;  2DKX A;  2ES6 A;  2F44 A;  2K4P A;  1SV0 A;  1B0X A;  2D8C A;  2QB1 A;  3TAD A;  4RQM A;  2EAP A;  3KKA A;  5JTI A;  2QB0 A;  3SEI A;  1RG6 A;  1SV4 A;  1V85 A;  3BS5 B;  2KSO B;  3SEN A;  2LPE A;  1SV0 C;  3BS5 A;  3IDW A;  4PZN A;  3BQ7 A;  2F3N A;  1OW5 A;  1PK1 A;  2E8N A;  2QAR B;  3KKA C;  2JV3 A;  1UQV A;  1LKY B;  2QAR A;  2EAO A;  3H8M A;  1OXJ A;  1JI7 A;  2B6G A;  3TAC B;  1LKY A;  5J8Y A;  5JU5 A;  1X66 A;  5KNI A;  2KG5 A;  2LMR A;  1WWV A;  2E8O A;  2L5Y A;  4MHV A;  2KSO A;  2DL0 A;  2FE9 A;  2YTU A;  1SGG A;  5J8Y C;  1F0M A;  2KMD A;  3BS7 A;  2GLE A;  2Y9T A;  1WWU A;  4IS7 A;  2E8P A;  2KIV A;  1B4F A;  3HIL A;  4NL9 A;  1UCV A;  5F3X B;  1DXS A;  2Y9U A;  5JRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...