1PK1B

Hetero sam domain structure of ph and scm.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
RSQPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLRLNSERMMKYMGLKLGPALKICNLVNKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription repression
molecule keywords Polyhomeotic-proximal chromatin protein
publication title Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 23
structure length 70
sequence length 70
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1pk1B00
1DXSA 5J8YA 2KIVA 1LKYB 2DL0A 3IDWA 1PK3A 2E8OA 2D3DA 3H8MA 2K60A 1B4FA 1UCVA 1LKYA 4RQNA 1JI7A 5F3XB 2QKQA 3BS7A 5L1MA 1OW5A 4NJ8A 1PK1B 1SXDA 3TADA 2EAOA 2KSOB 1V85A 2KG5A 2QB1A 4NL9A 2B6GA 2FE9A 1SXEA 2EANA 5KNIA 1X40A 3KKAA 1SV4A 2KSOA 2K4PA 2ES6A 1SGGA 2F3NA 3K1RB 4MHVA 2GLEA 2EAPA 1F0MA 1Z1VA 2QARB 5J8YC 2DKZA 5JTIA 1X66A 2E8PA 2E8NA 2JV3A 1PK1A 2KMDA 2L5YA 2QARA 2QB0B 2YTUA 2EAMA 1COKA 1X9XA 1SV0C 1OXJA 3BS5B 1UQVA 3SEIA 2F8KA 2Y9TA 2E8MA 2DKXA 1B0XA 2F44A 2LPEA 2QB0A 2LMRA 1RG6A 2KE7A 3SENA 3TADC 1KW4A 4RQMA 5JRTA 2Y9UA 3BS5A 4IS7A 3HILA 1WWUA 2ESEA 4NL9C 3BQ7A 5JU5A 4PZOA 1SV0A 4PZNA 1V38A 1WWVA 3KKAC 2D8CA 3TACB
chains in the Genus database with same CATH superfamily
3T5JA 1BNOA 1Z00B 3RH4A 2XY7A 2DF4B 4RU9A 2Z7JA 4PPXA 4EZ9A 2AJQA 1MQ3A 5KFEA 3G6XA 4ACOA 8ICNA 3F5AA 3QU4A 3GIJA 1NK6A 3TANA 3F2BA 5J0QA 4M9NA 5AM1A 2W9BA 5EE9A 3N97B 2XVTA 1ZQHA 2JZBA 1ZJMA 4FE3A 5KFMA 3QNMA 3QEBZ 1VDVA 3M7DA 4EELA 4NWIA 7ICPA 1ECWA 3PW7A 2JH1A 2W9CA 1TV9A 1L7NA 5DDMA 2WHEA 4I2DA 5ALLA 4Y2SA 4F4WA 1F0MA 3NRZA 3JPQA 2HI0A 1NI3A 1SB3C 1NKCA 3WK6A 4JV1A 1Q46A 2ISPA 4QZDA 3WK9A 3S6JA 1X6JA 1A77A 5AKLA 4UB5A 2XC9A 3BQ0A 2BGWA 1S0VA 1UQVA 4RNNA 5KT6A 1RYSA 5J0RA 1T3QA 2DKXA 2KKPA 1B0XA 4DFDA 1IG6A 1L7MA 1RXVA 2WAQC 3TFRA 2KTQA 3B9JA 2OH2A 1Y88A 5CRXA 1BVSA 3GZFA 3ZI4A 5DQGA 4Z6CA 1S0OA 3T5HA 3DV9A 5ALNA 4R63A 4JMUA 1ZQNA 4O3RA 4Y2RA 5KG6A 2DPIA 2AH5A 4CDGA 4QWDA 4ELTA 4YMOA 2ZUBA 4UB6U 4JK1A 3AQFA 4US8A 3MGHA 2RQ5A 4DOBA 1SKWA 2A3VA 4NXZA 1ZQKA 4ED3A 4K4IA 2MUTB 1L3UA 1COOA 4QNLA 5D4BA 5HHHA 2MRLA 5KFQA 2HHQA 1BPXA 4YN4A 1D9FA 4F92B 1ZJNA 3HP6A 2KSOB 3FYHA 3MGVA 4O9MA 2QB1A 3Q8SB 3CNHA 4US9A 2DPJA 2JHDA 1KKXA 1L3SA 1X9SA 4I2CA 1ZQGA 4O3NA 1KFSA 4IRCA 4UB1A 9ICCA 3M9MB 2WB1F 4Z6EA 1S8OA 4CCHA 4RQ0A 1JALA 1L7OA 1C20A 4F50A 4GC7A 3RTVA 2I9GA 4QZGA 3UMGA 4M6WA 2KVCA 2W3RA 5F9NA 2LYBA 5J2BA 8ICWA 8ICTA 4PJ0U 5IINA 4ECWA 7ICGA 2ZJ5A 1TAQA 3E0FA 4QZAA 4PHDA 5DBAA 4KLMA 3A0BU 1O03A 8ICSA 3I76A 2MA1A 3PMLA 4IRDA 8ICIA 3HPOA 2F8LA 5IIJA 4DSLA 1TKDA 2KN7A 5AKEA 5AM4A 2AGPA 5ALPA 4B6JA 8ICGA 4F91B 1FIQA 1RPLA 2RHFA 3GV7B 1ED1A 3HKZC 1X42A 3RAXA 4M47A 1PUZA 5AM0A 1V38A 3FM9A 2KOBA 4O3PA 8ICRA 2FLPA 2D8CA 3TACB 2P6RA 2YN4A 4PGXA 1NZBA 3ZD8A 4O3SA 2NRTA 2Q4TA 5KG4A 5J8YA 3O0FA 3TKAA 3L4PA 2HW3A 4R65A 4CRXA 5AKZA 2VKQA 2E8OA 1AROP 2D3DA 7ICLA 3UXNA 4R8UB 5ALGA 2I5HA 5KFPA 2ZIWA 3OSNA 2WFAA 5GTIU 2FMSA 2HVHA 2M9NA 4EBCA 3IP4B 1N5XA 3HX0A 2HBLA 8ICXA 5ALYA 4TQSA 3TADA 4QZCA 3M9OB 4CE6A 1L3TA 4IQTA 2FMQA 3L5KA 5EE3A 3AN1A 1MC8A 3MR6A 1IIPA 2ZIVA 3V6KA 2H3QA 2OYYA 1KBUA 2KKVA 5DQHA 2HMXA 1K1QA 1SGGA 2V4RA 3IHQB 4RQ5A 3I1YA 1CUKA 2ZTDA 2Y1JA 4Z6FA 1A76A 3SMVA 4RQ6A 3V7JA 1X9MA 1JRPA 5AKXA 5TZVA 5HNKA 1RYUA 1Z3EB 4ECZA 3LVVA 4UW9A 5J0OA 5EE0A 4YR0A 3PW2A 2N1RA 5J2IA 2F8KA 2Y9TA 5CWRA 3WKCA 1D8LA 1RG6A 3MFHA 1SL1A 2DWQA 3EW9A 2GOLA 1C7YA 3KHGA 3EUB2 5AI0A 4P4OA 2A1AA 4IS7A 2XCAA 1QTMA 5DBCA 3OSPA 3JPNA 1BPYA 4XUSA 2PFPA 4GXJA 4IQUA 5KFTA 2EDUA 2JH7A 9ICJA 3EZ5A 4F4ZA 5KFIA 1JXLA 2HOQA 5ALXA 4PHEA 4I27A 2W03A 1QH9A 1ZD3A 7ICMA 2W8KA 1L6NA 1T4GA 4K4GA 5J2GA 4MF8A 1KL9A 2DQNB 3ZDBA 4U7CA 1NJWA 1GO3F 4EX6A 5HR7A 3RRHA 4QZ9A 4CF5A 1A0PA 1ZD4A 4G9BA 3AMZA 3M6KA 1ZQDA 5AKHA 2HHUA 3SQIA 1N63A 1RM6C 1L8OA 1QSYA 3QUBA 2R18A 5AM3A 2BCSA 4RT2A 1UA1A 8ICEA 3V6JA 4J9SA 2YMPA 3D2QA 2R8JA 5CR0A 4B9VA 4I2JA 1BPDA 5AI4A 3WK7A 1UA0A 3H7IA 2GLEA 3RRGA 2P66A 2Y0SC 7ICVA 2IMWP 1QCKA 3LYSA 3MC1A 2YY6A 4UAUA 2E8NA 8ICQA 3HRDD 5AKYA 2L5YA 2QARA 3PW5A 1XSNA 1NK0A 5C5JA 4BXOA 1ZQWA 5ALJA 4BJQA 4DFPA 2PFQA 4M9GA 2HDOA 9ICNA 4RQ1A 3VCBA 4ECSA 4F4KA 9ICFA 3ZDEA 3RR7A 4RPYA 4C8OA 1ZQMA 4PL1A 3MGIA 4CGZA 5AKGA 1KQQA 8ICAA 3EPIA 3TI0A 2W11A 2FLLA 3C28A 3UXPA 5DDYA 3ZD9A 1PK3A 2K60A 2PKEA 1BGXT 2KNJA 4E0DA 1ZQTA 4R64A 5KFDA 2XCPA 1LKYA 3Q8QB 3N7SC 4YP3A 2BKEA 4P2HA 1UPHA 9ICHA 3DDHA 4QZEA 3H4BA 2NRVA 5DBBA 4NM2A 4RQ7A 8ICOA 2HBMA 1N60A 4J9QA 1KDHA 2JRZA 2HHVA 3PSFA 5ALTA 3H8JA 5HMLA 4P0PA 2ES6A 2HHSA 2F3NA 2H3IA 4OJ5A 5EOZA 4C7ZA 7ICHA 2A1JB 4Q44A 3NS1A 2CN1A 3BZKA 4I2FA 2LYAA 2EZZA 3C29A 1FFVA 2FJ6A 2V9WA 3PR4A 2W7PA 8ICUA 8ICHA 3AEVA 2HBJA 1NKEA 4YR2A 4UQGA 5KFZA 4YG2A 2ISOA 3T5LA 4C4SA 4FZLA 1DOQA 2VA3A 4IQVA 5J0WA 4EBEA 1SV0A 1S97A 3QX7A 4XQ8A 4F71A 1WWVA 5ALMA 3NRWA 3H0MB 3UM9A 4GXIA 5KT2A 3C23A 1JROA 2EZXA 5H2FU 3D2SA 2XICA 1CI4A 5AKKA 4O3QA 4RQ4A 3SI8A 3OHAA 3WKBA 4IL6U 4DSFA 1B4FA 2HSZA 1IXRA 5IIKA 1X6IA 1TFRA 4TURA 2E5SA 2ZIUA 8ICBA 2ZUCA 3WK8A 3GU3A 5KFNA 2ATLA 4AYBF 1QLNA 2H3FA 4IQWA 1UHUA 4KN4A 5K4LA 3QUTA 3FDSA 2GWSA 3RJJA 2ODGA 4EEYA 2C22A 1V97A 2KP7A 3ISBA 1O08A 1T3NA 3J81j 2HHTA 4JV0A 2AQ4A 2JXJA 4MFFA 2K4PA 5J2KA 2IA6A 3RR8A 1Z19A 2G5IB 4KITB 4GIBA 4BWJA 4O5EA 3L3FX 2WB1C 4YQWA 3GILA 2JR5A 2WF8A 1PK1A 2F77X 4FS1A 3TQ1A 2QB0B 3RBDA 2K4IA 4IC9A 3SYZA 4M04A 5KG2A 1ZQOA 1U45A 4YVZA 4Y2XA 4KTQA 4C8NA 1U48A 8ICJA 2KFZA 1K5OA 3SZ2A 1NZPA 1SKRA 4IR9A 4TUQA 8ICYA 1N48A 2JMGA 5F9LA 5AK5A 1ZQRA 1QQ7A 3Q8PB 1SZPA 4Q43A 1T8EA 3MDAA 2OEHA 5HMMA 5L1LA 1ZQIA 2Q0ZX 4I29A 4F8RA 2BCVA 2DL0A 2YMMA 2J6SA 1ZQSA 2YQEA 7ICRA 1BPZA 2XGQA 5KFWA 3RB4A 8ICLA 4QWEA 4C8KA 2FPKA 1KSPA 5J29A 4TUSA 4O5KA 2HHXA 3HT3A 3OHBA 2PXIA 3UMBA 3LDAA 5KG3A 1S9FA 5AK6A 5D46A 3WKAA 1P7DA 5J0XA 4XRHA 3CW2C 3T79A 1SXEA 9ICUA 1ZOLA 4BWMA 3HWTA 2BDPA 2IBKA 4B9LA 4OJOA 2RDJA 4I2BA 4J9RA 5CHGA 5IIMA 1NOMA 3BQ1A 9ICIA 4ECQA 4X5VA 5KFAA 3TFSA 2P35A 4NLGA 1Q3UA 4UB2A 2PFOA 2F1JA 2F76X 4JWNA 2W3SA 3BQTA 2K8AA 1S76D 1VLBA 4FBTA 4BUGA 9ICLA 1J97A 2G0AA 1X9XA 4O3OA 2I6XA 2G5HB 2VJ4A 3HW8A 2AHOB 3D2NA 4B9SA 3EPGA 1KEJA 1KW4A 2KZMA 3QUQA 4J9PA 4Q45A 4DFMA 1JUDA 4LZGA 4UASA 3PO5A 3ALRA 4M0AA 2CXYA 3F2DA 2NO5A 7ICJA 3KHLA 2F1HA 5IIIA 2W55A 4P4MA 3GIMA 2IOFA 2VANA 3C2KA 1MA7A 4J9NA 2D6FC 5J2JA 4CNQA 4YXMA 3H8MA 2RP5A 3GFKB 2FLNA 3MFIA 2LKYA 2KJ5A 3RB3A 1BPEA 4EYHB 1JXEA 1QSLA 1ZQUA 3BS7A 2HOFA 4Y2VA 5L1MA 4O0IA 1IV8A 3SAHA 3QZ8A 4Z6DA 2PI5A 2FPMA 2HHWA 3HJEA 4NLZA 2KZ3A 5DGAA 4WJ3B 5ALQA 3CP8A 2EANA 2J6UA 5KNIA 3NASA 4M9HA 2C28A 1U4BA 1XWLA 4EYIB 2BCQA 2W8LA 7ICOA 1Q3VA 2OXOA 4KLOA 4JUZA 5J2CA 2W54A 2G08A 1NNLA 4FZNA 4DQIA 1CEZA 1X66A 4J9OA 4MFCA 2BPGA 5C0YA 2EQYA 5KAFU 3SV3A 4TQRA 1SV0C 4QZBA 2W9AA 1HEKA 5KT3A 4DL5A 3PVXA 2RLTA 1SL2A 5A0LA 2BHNA 2KJ9A 2Y9UA 3BS5A 1H38A 3PSTA 2FI1A 1JMSA 1XO0A 1BNPA 9ICQA 1J2MA 4PZNA 4YCXA 3KKAC 2BCRA 2W9MA 2F1IA 4OJ6A 3EYZA 1NJXA 2YB1A 4DS4A 3I28A 2ZIXA 9ICTA 5ALWA 3OGUA 1NJYA 4ZH4A 3UPQA 2H3ZA 5J0YA 1ZQVA 1TAMA 2DUYA 1Z00A 3C2LA 2W9BB 2JZBB 4KLUA 4QIWF 2KHQA 4NLKA 4CF3A 2ZTCA 1WG8A 4QWBA 4A8EA 1OW5A 2W9CB 1M6YA 1XO1A 1PK1B 3H0RB 4UARA 3AU2A 2K8BB 1YZ6A 2OWOA 4ED2A 2G09A 2AQ0A 5ALDA 3Q8LA 3RH6A 4YR3A 2NV3A 3RJFA 8ICZA 5AKIA 3H40A 4Y2JA 1S10A 4ECYA 1SV4A 3IG5A 1PVRA 2BZFA 2IOHA 2FPLA 3OJSA 3SD7A 2FDRA 4Y2QA 3Q8RB 3RJHA 4TUPA 3C5GA 1MN8A 1RYRA 3QU5A 4KLSA 4DWIA 5HR6A 4C8MA 5ALRA 4F2RA 5E79U 5AI9A 3AUOA 2VA8A 4DQRA 1ZETA 4O3MA 4PH5A 3E58A 1OXJA 1LV5A 4I2AA 1WCNA 1HJPA 5CP2A 2IHMA 4B9TA 3QUCA 5KFKA 2KE7A 5KAIU 4RQ3A 3QZ7A 4DFKA 1XNSA 2HBKA 2W7OA 2BCUA 8ICCA 4XA5A 1Z1BA 5AI5A 3WK4A 4ZOHC 4Y2PA 4UBBA 7ICSA 2I1QA 3ETLA 5DLGA 1YT3A 4DOAA 2KIVA 1ZQCA 2PMZC 1F5SA 2YMQA 4Q8EA 5DKWA 5ALEA 4KMUA 1S0MA 3IRUA 5IILA 8ICFA 1EXNA 2WF9A 4UAVA 5KFSA 2WTFA 4KX3A 2A19A 3ORYA 4RQNA 1ZD5A 2ZTEA 2QKQA 3IN5A 2HCFA 3RH5A 4F2SA 1TVAA 1Q8KA 3C1YA 3T5KA 1KFTA 2MUTA 3EWAA 5AIAA 5KFJA 3MR2A 3LVWA 2EAOA 2KG5A 3H8WA 2AU0A 4I28A 2OHFA 1ZQZA 4AYBC 3V6HA 1RZTA 1PZNA 4MFAA 4BDPA 2KSOA 3MR3A 4DCCA 3PW4A 2KVSA 4M6WB 4F4YA 1WCLA 1DK3A 2XGPA 5J0TA 1B22A 3QU2A 4JV2A 1SWWA 2M0NA 4PHPA 4C7YA 4O5CA 3KZXA 4LZDA 5JTIA 9ICGA 1RQNA 2E8PA 5HHIA 5L9XA 5CEHA 4ED0A 2K4EA 4DSJA 1ZYQA 5KG7A 3ICXA 2EH9A 1JN3A 5EWEA 2LYHA 3K4GA 2LBOA 3SENA 9ICKA 4DLEA 1KTQA 2YB4A 3IM1A 4RQMA 4C0ZA 4J9LA 4HYKA 4OJPA 2C2DA 1WWUA 2ZJ8A 3ISCA 2LHTA 5KG5A 2MU2A 5KL8B 1ZQEA 5AIBA 4KLTA 4KX5A 4RUAA 4UB4A 1DRGA 9ICXA 2ZIWB 2XI9A 4YD2A 1TAUA 3PR5B 1UCVA 3WKDA 5L1JA 3JPOA 3FAHA 3PO4A 2W43A 1BPBA 5KFRA 3KFUF 4IRKA 3PX4A 2HVIA 4NJ8A 4R8UA 4DSKA 3THVA 2QLTA 1SXDA 3RJGA 3V7KA 2ZIVB 3LWLA 2B21A 2NYVA 1U49A 2RDIA 1NK7A 5BOLA 3OJUA 4DL2A 5J2HA 4PGQA 2W04A 4ECXA 4I2HA 5L1KA 5J2FA 4IR1A 4KLDA 1ZQPA 1X40A 4RZRA 3KKAA 2IOFK 3V7LA 4DL7A 1NK5A 4QW8A 4FZMA 4UB8U 4B9NA 3KHRA 2PFNA 2R8KA 2EAPA 3NVWA 1MSWD 9ICEA 2O6KA 4CF4A 4KLIA 3BDPA 4DSEA 2ZIXB 1KFDA 3PX0A 3Q8MA 4R66A 4ELVA 2EAMA 1F44A 3SAGA 9ICAA 3M6ZA 3SAFA 4OO1J 2K4HA 4HAIA 1DK2A 1D8BA 1PVPA 1N2XA 1NJZA 3KTQA 3PMNA 2OM6A 2KD1A 2ALZA 3PSPA 3CRXA 3AQEA 1UT8A 4KLLA 4FO6A 4QWCA 5BOMA 4ECTA 4MEXA 9ICMA 4J9MA 5CA7A 3QE9Y 1URJA 2ASLA 5KFCA 1DXSA 1S0NA 2YMLA 3QU9A 1SL0A 4EZ6A 4UAYA 5KT7A 1L5UA 2VA2A 3TARA 2LI6A 4DF8A 2G07A 4C80A 4BGDA 4F5PA 3KD3A 4M9LA 4KLHA 4DO9A 4QZ8A 4PL2A 2G06A 3DEEA 5B66U 4QZFA 2R8GA 3UQ0A 1V9PA 4F5QA 2IHNA 1JIHA 3QU7A 5AK3A 2ASDA 5KT5A 2LM1A 2E1FA 1DGSA 4RT3A 1XSLA 2HOIA 4RUCA 3NVYA 4OJLA 3NGDA 1D9DA 3C21A 2BDUA 2DFLA 5DQIA 4M2YA 9ICSA 2QARB 4BXOB 1HIWA 3BZCA 2H5XA 2WF6A 3F5EA 1QQ6A 4F93B 5DG8A 7ICUA 5ALZA 3MBYA 1ZQLA 7ICKA 2E8MA 3WK5A 2VIXA 2LPEA 2AGQA 4B9UA 2LMRA 4QW9A 4B9MA 2KK0A 5B5EU 1L8LA 5DLFA 2C2RA 3PV8A 3ZDDA 5JRTA 5AM5A 2ESEA 3BQ7A 4DLGA 1NK4A 5AK4A 1YZ7A 4USAA 3TAPA 1WUDA 3ISDA 5ALSA 5AM2A 2JEFA 5KFGA 5KFOA 3OTQA 1LKYB 3GV8B 1X2IA 2FMPA 1CRXA 3M1YA 4RNMA 3PZPA 3T3FA 3K1ZA 4KLJA 3FC4A 4M9JA 3RJKA 5F3XB 4DQPA 3RAQA 4F5NA 4ECVA 4QJFB 4ECUA 3VC8A 3NVZA 1ZXIA 4QIWC 5KG1A 1X9WA 4GC6A 4P0QA 3GQCA 2ASJA 4NY8A 2XIDA 5ALIA 4P0PB 2ZXHA 5DG9A 2WF7A 4DQSA 1NKBA 4EENA 2FE9A 3N7RC 5KFYA 5J2DA 4P4PA 3N28A 4NLBA 9ICPA 1RXWA 2BPFA 2KEYA 5KT4A 5G5GA 2EZYA 2VJ5A 4C4RA 1XC9A 2V4QA 4Q8FA 2F2AB 2BPCA 1ZQ1C 4DSIA 3JPRA 4UB3A 1UT5A 2KFNA 1QQ5A 1J2NA 2JV3A 2XO7A 3M8SA 2B0CA 3UMCA 3F2CA 2WAQF 4LJXA 1HUZA 4RPXA 2A1JA 4RQ2A 4F72A 3MABA 2BQ3A 5EWGA 1Z4OA 2XY6A 4GXKA 5HP4A 4FS2A 1WYGA 5JUMA 3K75D 1ZQFA 3JPPA 3SV4A 4DL3A 2GH1A 1SIJA 4NLNA 3HILA 4GLXA 3RJIA 1XS9D 4NL9C 3UQ2A 1ZQQA 4DQQA 3ZDAA 3GV5B 3BQ2A 7ICNA 4UAWA 4KLGA 3ED5A 2ZUDA 3JPTA 4NV0A 4UATA 4F5RA 2ZIUB 2KV2A 3RB0A 4Y2TA 4UAZA 4G3IA 5T14A 1KRPA 4JB3A 1HUOA 1ZRMA 4JWMA 4YXJA 3ETRA 1Z4NA 1JI7A 4I2IA 5L1IA 4ED7A 3QXGA 1N56A 2NRXA 1S5LU 8ICPA 2BQUA 1PVQA 2JEJA 5KFVA 1V85A 2NRWA 4PGYA 8ICMA 3V72A 5KFHA 5DGBA 4Y2YA 1NK9A 7ICQA 2AXTU 4DOCA 1B43A 4C4TA 3PX6A 3JPSA 3IV6A 4MHVA 1N61A 4AP9A 1XSPA 1Z1VA 4FBUA 1KN5A 4DFJA 3N4MB 4U6PA 1FEZA 4F5OA 1ZQBA 4EEKA 5TISU 1S77D 5IIOA 5J2EA 2E1EA 2BQRA 4J03A 5AKJA 4I2EA 4KLFA 9ICRA 3KOOA 9ICOA 5KFLA 1ZQAA 3UXOA 2YX8A 1D8YA 3LK9A 1SWVA 3HKZF 3E2EA 2QB0A 1MQ2A 5CB1A 3TAQA 2ZJAA 7ICFA 5ALKA 4F3OA 1N62A 2UVRA 3RF9A 5ALHA 5G5HA 5KFXA 3RFAA 2R8IA 5BPCA 4I2GA 9ICWA 2H3VA 3R9KA 3MR5A 4KMOB 5D49A 3M8RA 1FO4A 2CPRA 5KFFA 9ICVA 1FFUA 3GDXA 4QZIA 2DBYA 2KICA 3OPXA 4EBDA 3GIKA 1QSSA 1N5WA 4ED1A 5CJ7A 1XU4A 4ELUA 2AGOA 1IM4A 4J9KA 4DL4A 2ZXIA 3ONNA 3CYMA 3KBBA 1U47A 4ICAA 2XY5A 4RPZA 2B6GA 5AICA 2KHVA 4YFKA 5ALVA 3G6YA 1L3VA 2KIWA 1TE2A 3SR6A 2E3TA 4QZHA 1TK8A 3A0HU 4OCZA 3C5FA 4EX7A 2ZG6A 3ZDCA 3B0XA 2KJ8A 5GTHU 4DF4A 5AI8A 2DKZA 4F4XA 3RJEA 4YMMA 7ICIA 1TK5A 1LVHA 3PY8A 1ZD2P 3C2MA 1ZRNA 4GFJA 3WU2U 3SEIA 4ECRA 4Y2UA 2F44A 1U9LA 2WF5A 3IG8A 3MDCA 3N7PD 3M9NB 1L7PA 5J0PA 4MF2A 5KTQA 5KG0A 1ZQXA 3QYPA 4PZOA 5EWFA 7ICTA 4FFDA 3H0LB 4P0QB 3F53A 2JEIA 5ALOA 2MAXA 2K8CB 1A6SA 5KL1B 2R8HA 2CRXA 2PI4A 4QWAA 5KFUA 4MEYA 3AM9A 3AU6A 3IDWA 5DB8A 3NUQA 5EE1A 1SZHA 5DB6A 3QEAZ 2DGZA 2C2EA 2UVUA 5DB7A 4K4HA 2K89A 8ICVA 3NVVA 1K1SA 5DG7A 3KZIU 2BR0A 2J6TA 4DS5A 1DGJA 4ED8A 1KLNA 5AHXA 4OD0A 1VJ5A 9ICBA 3RB6A 5AI6A 3PW0A 1T94A 2LM4A 4DEZA 4ED6A 7ICEA 2UVWA 3B0YA 1NK8A 2Y1IA 1ZQJA 5J0SA 2NO4A 5DB9A 4NL9A 3LWMA 5KFBA 4PHAA 2P6UA 1LB2B 4C8LA 2Y0SF 1T7PA 2JEGA 1ZQYA 3BJYA 3PNCA 4NM1A 4NLCA 4UBCA 4YMNA 3WKEA 3K1RB 1RDFA 2MSNA 1JX4A 1TK0A 8ICKA 4DL6A 5J0UA 4LVSA 1RQLA 1SKSA 3D6JA 5J8YC 3G6VA 2OCEA 5J2AA 3H8SA 2PMZF 2KMDA 4YD1A 4KLQA 2YTUA 2GO7A 1COKA 2NRZA 3NTUA 3BS5B 3GIIA 3PSIA 4RQ8A 3Q8KA 3RBEA 4BX9C 5FP0A 4KLEA 3TADC 3C1ZA 3H4DA 4KN7A 2KZZA 1OUQA 5ALUA 5JU5A 3U26A 2JGAA 2UVVA 2RRDA 5ALFA 3KHHA 4RNOA 3AL0B 1AQ6A
chains in the Genus database with same CATH topology
1DXSA 5J8YA 2KIVA 1LKYB 2DL0A 3IDWA 1PK3A 2E8OA 2D3DA 3H8MA 2K60A 1B4FA 1UCVA 1LKYA 4RQNA 1JI7A 5F3XB 2QKQA 3BS7A 5L1MA 1OW5A 4NJ8A 1PK1B 1SXDA 3TADA 2EAOA 2KSOB 1V85A 2KG5A 2QB1A 4NL9A 2B6GA 2FE9A 1SXEA 2EANA 5KNIA 1X40A 3KKAA 1SV4A 2KSOA 2K4PA 2ES6A 1SGGA 2F3NA 3K1RB 4MHVA 2GLEA 2EAPA 1F0MA 1Z1VA 2QARB 5J8YC 2DKZA 5JTIA 1X66A 2E8PA 2E8NA 2JV3A 1PK1A 2KMDA 2L5YA 2QARA 2QB0B 2YTUA 2EAMA 1COKA 1X9XA 1SV0C 1OXJA 3BS5B 1UQVA 3SEIA 2F8KA 2Y9TA 2E8MA 2DKXA 1B0XA 2F44A 2LPEA 2QB0A 2LMRA 1RG6A 2KE7A 3SENA 3TADC 1KW4A 4RQMA 5JRTA 2Y9UA 3BS5A 4IS7A 3HILA 1WWUA 2ESEA 4NL9C 3BQ7A 5JU5A 4PZOA 1SV0A 4PZNA 1V38A 1WWVA 3KKAC 2D8CA 3TACB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DXS A;  5J8Y A;  2KIV A;  1LKY B;  2DL0 A;  3IDW A;  1PK3 A;  2E8O A;  2D3D A;  3H8M A;  2K60 A;  1B4F A;  1UCV A;  1LKY A;  4RQN A;  1JI7 A;  5F3X B;  2QKQ A;  3BS7 A;  5L1M A;  1OW5 A;  4NJ8 A;  1PK1 B;  1SXD A;  3TAD A;  2EAO A;  2KSO B;  1V85 A;  2KG5 A;  2QB1 A;  4NL9 A;  2B6G A;  2FE9 A;  1SXE A;  2EAN A;  5KNI A;  1X40 A;  3KKA A;  1SV4 A;  2KSO A;  2K4P A;  2ES6 A;  1SGG A;  2F3N A;  3K1R B;  4MHV A;  2GLE A;  2EAP A;  1F0M A;  1Z1V A;  2QAR B;  5J8Y C;  2DKZ A;  5JTI A;  1X66 A;  2E8P A;  2E8N A;  2JV3 A;  1PK1 A;  2KMD A;  2L5Y A;  2QAR A;  2QB0 B;  2YTU A;  2EAM A;  1COK A;  1X9X A;  1SV0 C;  1OXJ A;  3BS5 B;  1UQV A;  3SEI A;  2F8K A;  2Y9T A;  2E8M A;  2DKX A;  1B0X A;  2F44 A;  2LPE A;  2QB0 A;  2LMR A;  1RG6 A;  2KE7 A;  3SEN A;  3TAD C;  1KW4 A;  4RQM A;  5JRT A;  2Y9U A;  3BS5 A;  4IS7 A;  3HIL A;  1WWU A;  2ESE A;  4NL9 C;  3BQ7 A;  5JU5 A;  4PZO A;  1SV0 A;  4PZN A;  1V38 A;  1WWV A;  3KKA C;  2D8C A;  3TAC B; 
#chains in the Genus database with same CATH topology
 3T5J A;  1BNO A;  1Z00 B;  3RH4 A;  2XY7 A;  2DF4 B;  4RU9 A;  2Z7J A;  4PPX A;  4EZ9 A;  2AJQ A;  1MQ3 A;  5KFE A;  3G6X A;  4ACO A;  8ICN A;  3F5A A;  3QU4 A;  3GIJ A;  1NK6 A;  3TAN A;  3F2B A;  5J0Q A;  4M9N A;  5AM1 A;  2W9B A;  5EE9 A;  3N97 B;  2XVT A;  1ZQH A;  2JZB A;  1ZJM A;  4FE3 A;  5KFM A;  3QNM A;  3QEB Z;  1VDV A;  3M7D A;  4EEL A;  4NWI A;  7ICP A;  1ECW A;  3PW7 A;  2JH1 A;  2W9C A;  1TV9 A;  1L7N A;  5DDM A;  2WHE A;  4I2D A;  5ALL A;  4Y2S A;  4F4W A;  1F0M A;  3NRZ A;  3JPQ A;  2HI0 A;  1NI3 A;  1SB3 C;  1NKC A;  3WK6 A;  4JV1 A;  1Q46 A;  2ISP A;  4QZD A;  3WK9 A;  3S6J A;  1X6J A;  1A77 A;  5AKL A;  4UB5 A;  2XC9 A;  3BQ0 A;  2BGW A;  1S0V A;  1UQV A;  4RNN A;  5KT6 A;  1RYS A;  5J0R A;  1T3Q A;  2DKX A;  2KKP A;  1B0X A;  4DFD A;  1IG6 A;  1L7M A;  1RXV A;  2WAQ C;  3TFR A;  2KTQ A;  3B9J A;  2OH2 A;  1Y88 A;  5CRX A;  1BVS A;  3GZF A;  3ZI4 A;  5DQG A;  4Z6C A;  1S0O A;  3T5H A;  3DV9 A;  5ALN A;  4R63 A;  4JMU A;  1ZQN A;  4O3R A;  4Y2R A;  5KG6 A;  2DPI A;  2AH5 A;  4CDG A;  4QWD A;  4ELT A;  4YMO A;  2ZUB A;  4UB6 U;  4JK1 A;  3AQF A;  4US8 A;  3MGH A;  2RQ5 A;  4DOB A;  1SKW A;  2A3V A;  4NXZ A;  1ZQK A;  4ED3 A;  4K4I A;  2MUT B;  1L3U A;  1COO A;  4QNL A;  5D4B A;  5HHH A;  2MRL A;  5KFQ A;  2HHQ A;  1BPX A;  4YN4 A;  1D9F A;  4F92 B;  1ZJN A;  3HP6 A;  2KSO B;  3FYH A;  3MGV A;  4O9M A;  2QB1 A;  3Q8S B;  3CNH A;  4US9 A;  2DPJ A;  2JHD A;  1KKX A;  1L3S A;  1X9S A;  4I2C A;  1ZQG A;  4O3N A;  1KFS A;  4IRC A;  4UB1 A;  9ICC A;  3M9M B;  2WB1 F;  4Z6E A;  1S8O A;  4CCH A;  4RQ0 A;  1JAL A;  1L7O A;  1C20 A;  4F50 A;  4GC7 A;  3RTV A;  2I9G A;  4QZG A;  3UMG A;  4M6W A;  2KVC A;  2W3R A;  5F9N A;  2LYB A;  5J2B A;  8ICW A;  8ICT A;  4PJ0 U;  5IIN A;  4ECW A;  7ICG A;  2ZJ5 A;  1TAQ A;  3E0F A;  4QZA A;  4PHD A;  5DBA A;  4KLM A;  3A0B U;  1O03 A;  8ICS A;  3I76 A;  2MA1 A;  3PML A;  4IRD A;  8ICI A;  3HPO A;  2F8L A;  5IIJ A;  4DSL A;  1TKD A;  2KN7 A;  5AKE A;  5AM4 A;  2AGP A;  5ALP A;  4B6J A;  8ICG A;  4F91 B;  1FIQ A;  1RPL A;  2RHF A;  3GV7 B;  1ED1 A;  3HKZ C;  1X42 A;  3RAX A;  4M47 A;  1PUZ A;  5AM0 A;  1V38 A;  3FM9 A;  2KOB A;  4O3P A;  8ICR A;  2FLP A;  2D8C A;  3TAC B;  2P6R A;  2YN4 A;  4PGX A;  1NZB A;  3ZD8 A;  4O3S A;  2NRT A;  2Q4T A;  5KG4 A;  5J8Y A;  3O0F A;  3TKA A;  3L4P A;  2HW3 A;  4R65 A;  4CRX A;  5AKZ A;  2VKQ A;  2E8O A;  1ARO P;  2D3D A;  7ICL A;  3UXN A;  4R8U B;  5ALG A;  2I5H A;  5KFP A;  2ZIW A;  3OSN A;  2WFA A;  5GTI U;  2FMS A;  2HVH A;  2M9N A;  4EBC A;  3IP4 B;  1N5X A;  3HX0 A;  2HBL A;  8ICX A;  5ALY A;  4TQS A;  3TAD A;  4QZC A;  3M9O B;  4CE6 A;  1L3T A;  4IQT A;  2FMQ A;  3L5K A;  5EE3 A;  3AN1 A;  1MC8 A;  3MR6 A;  1IIP A;  2ZIV A;  3V6K A;  2H3Q A;  2OYY A;  1KBU A;  2KKV A;  5DQH A;  2HMX A;  1K1Q A;  1SGG A;  2V4R A;  3IHQ B;  4RQ5 A;  3I1Y A;  1CUK A;  2ZTD A;  2Y1J A;  4Z6F A;  1A76 A;  3SMV A;  4RQ6 A;  3V7J A;  1X9M A;  1JRP A;  5AKX A;  5TZV A;  5HNK A;  1RYU A;  1Z3E B;  4ECZ A;  3LVV A;  4UW9 A;  5J0O A;  5EE0 A;  4YR0 A;  3PW2 A;  2N1R A;  5J2I A;  2F8K A;  2Y9T A;  5CWR A;  3WKC A;  1D8L A;  1RG6 A;  3MFH A;  1SL1 A;  2DWQ A;  3EW9 A;  2GOL A;  1C7Y A;  3KHG A;  3EUB 2;  5AI0 A;  4P4O A;  2A1A A;  4IS7 A;  2XCA A;  1QTM A;  5DBC A;  3OSP A;  3JPN A;  1BPY A;  4XUS A;  2PFP A;  4GXJ A;  4IQU A;  5KFT A;  2EDU A;  2JH7 A;  9ICJ A;  3EZ5 A;  4F4Z A;  5KFI A;  1JXL A;  2HOQ A;  5ALX A;  4PHE A;  4I27 A;  2W03 A;  1QH9 A;  1ZD3 A;  7ICM A;  2W8K A;  1L6N A;  1T4G A;  4K4G A;  5J2G A;  4MF8 A;  1KL9 A;  2DQN B;  3ZDB A;  4U7C A;  1NJW A;  1GO3 F;  4EX6 A;  5HR7 A;  3RRH A;  4QZ9 A;  4CF5 A;  1A0P A;  1ZD4 A;  4G9B A;  3AMZ A;  3M6K A;  1ZQD A;  5AKH A;  2HHU A;  3SQI A;  1N63 A;  1RM6 C;  1L8O A;  1QSY A;  3QUB A;  2R18 A;  5AM3 A;  2BCS A;  4RT2 A;  1UA1 A;  8ICE A;  3V6J A;  4J9S A;  2YMP A;  3D2Q A;  2R8J A;  5CR0 A;  4B9V A;  4I2J A;  1BPD A;  5AI4 A;  3WK7 A;  1UA0 A;  3H7I A;  2GLE A;  3RRG A;  2P66 A;  2Y0S C;  7ICV A;  2IMW P;  1QCK A;  3LYS A;  3MC1 A;  2YY6 A;  4UAU A;  2E8N A;  8ICQ A;  3HRD D;  5AKY A;  2L5Y A;  2QAR A;  3PW5 A;  1XSN A;  1NK0 A;  5C5J A;  4BXO A;  1ZQW A;  5ALJ A;  4BJQ A;  4DFP A;  2PFQ A;  4M9G A;  2HDO A;  9ICN A;  4RQ1 A;  3VCB A;  4ECS A;  4F4K A;  9ICF A;  3ZDE A;  3RR7 A;  4RPY A;  4C8O A;  1ZQM A;  4PL1 A;  3MGI A;  4CGZ A;  5AKG A;  1KQQ A;  8ICA A;  3EPI A;  3TI0 A;  2W11 A;  2FLL A;  3C28 A;  3UXP A;  5DDY A;  3ZD9 A;  1PK3 A;  2K60 A;  2PKE A;  1BGX T;  2KNJ A;  4E0D A;  1ZQT A;  4R64 A;  5KFD A;  2XCP A;  1LKY A;  3Q8Q B;  3N7S C;  4YP3 A;  2BKE A;  4P2H A;  1UPH A;  9ICH A;  3DDH A;  4QZE A;  3H4B A;  2NRV A;  5DBB A;  4NM2 A;  4RQ7 A;  8ICO A;  2HBM A;  1N60 A;  4J9Q A;  1KDH A;  2JRZ A;  2HHV A;  3PSF A;  5ALT A;  3H8J A;  5HML A;  4P0P A;  2ES6 A;  2HHS A;  2F3N A;  2H3I A;  4OJ5 A;  5EOZ A;  4C7Z A;  7ICH A;  2A1J B;  4Q44 A;  3NS1 A;  2CN1 A;  3BZK A;  4I2F A;  2LYA A;  2EZZ A;  3C29 A;  1FFV A;  2FJ6 A;  2V9W A;  3PR4 A;  2W7P A;  8ICU A;  8ICH A;  3AEV A;  2HBJ A;  1NKE A;  4YR2 A;  4UQG A;  5KFZ A;  4YG2 A;  2ISO A;  3T5L A;  4C4S A;  4FZL A;  1DOQ A;  2VA3 A;  4IQV A;  5J0W A;  4EBE A;  1SV0 A;  1S97 A;  3QX7 A;  4XQ8 A;  4F71 A;  1WWV A;  5ALM A;  3NRW A;  3H0M B;  3UM9 A;  4GXI A;  5KT2 A;  3C23 A;  1JRO A;  2EZX A;  5H2F U;  3D2S A;  2XIC A;  1CI4 A;  5AKK A;  4O3Q A;  4RQ4 A;  3SI8 A;  3OHA A;  3WKB A;  4IL6 U;  4DSF A;  1B4F A;  2HSZ A;  1IXR A;  5IIK A;  1X6I A;  1TFR A;  4TUR A;  2E5S A;  2ZIU A;  8ICB A;  2ZUC A;  3WK8 A;  3GU3 A;  5KFN A;  2ATL A;  4AYB F;  1QLN A;  2H3F A;  4IQW A;  1UHU A;  4KN4 A;  5K4L A;  3QUT A;  3FDS A;  2GWS A;  3RJJ A;  2ODG A;  4EEY A;  2C22 A;  1V97 A;  2KP7 A;  3ISB A;  1O08 A;  1T3N A;  3J81 j;  2HHT A;  4JV0 A;  2AQ4 A;  2JXJ A;  4MFF A;  2K4P A;  5J2K A;  2IA6 A;  3RR8 A;  1Z19 A;  2G5I B;  4KIT B;  4GIB A;  4BWJ A;  4O5E A;  3L3F X;  2WB1 C;  4YQW A;  3GIL A;  2JR5 A;  2WF8 A;  1PK1 A;  2F77 X;  4FS1 A;  3TQ1 A;  2QB0 B;  3RBD A;  2K4I A;  4IC9 A;  3SYZ A;  4M04 A;  5KG2 A;  1ZQO A;  1U45 A;  4YVZ A;  4Y2X A;  4KTQ A;  4C8N A;  1U48 A;  8ICJ A;  2KFZ A;  1K5O A;  3SZ2 A;  1NZP A;  1SKR A;  4IR9 A;  4TUQ A;  8ICY A;  1N48 A;  2JMG A;  5F9L A;  5AK5 A;  1ZQR A;  1QQ7 A;  3Q8P B;  1SZP A;  4Q43 A;  1T8E A;  3MDA A;  2OEH A;  5HMM A;  5L1L A;  1ZQI A;  2Q0Z X;  4I29 A;  4F8R A;  2BCV A;  2DL0 A;  2YMM A;  2J6S A;  1ZQS A;  2YQE A;  7ICR A;  1BPZ A;  2XGQ A;  5KFW A;  3RB4 A;  8ICL A;  4QWE A;  4C8K A;  2FPK A;  1KSP A;  5J29 A;  4TUS A;  4O5K A;  2HHX A;  3HT3 A;  3OHB A;  2PXI A;  3UMB A;  3LDA A;  5KG3 A;  1S9F A;  5AK6 A;  5D46 A;  3WKA A;  1P7D A;  5J0X A;  4XRH A;  3CW2 C;  3T79 A;  1SXE A;  9ICU A;  1ZOL A;  4BWM A;  3HWT A;  2BDP A;  2IBK A;  4B9L A;  4OJO A;  2RDJ A;  4I2B A;  4J9R A;  5CHG A;  5IIM A;  1NOM A;  3BQ1 A;  9ICI A;  4ECQ A;  4X5V A;  5KFA A;  3TFS A;  2P35 A;  4NLG A;  1Q3U A;  4UB2 A;  2PFO A;  2F1J A;  2F76 X;  4JWN A;  2W3S A;  3BQT A;  2K8A A;  1S76 D;  1VLB A;  4FBT A;  4BUG A;  9ICL A;  1J97 A;  2G0A A;  1X9X A;  4O3O A;  2I6X A;  2G5H B;  2VJ4 A;  3HW8 A;  2AHO B;  3D2N A;  4B9S A;  3EPG A;  1KEJ A;  1KW4 A;  2KZM A;  3QUQ A;  4J9P A;  4Q45 A;  4DFM A;  1JUD A;  4LZG A;  4UAS A;  3PO5 A;  3ALR A;  4M0A A;  2CXY A;  3F2D A;  2NO5 A;  7ICJ A;  3KHL A;  2F1H A;  5III A;  2W55 A;  4P4M A;  3GIM A;  2IOF A;  2VAN A;  3C2K A;  1MA7 A;  4J9N A;  2D6F C;  5J2J A;  4CNQ A;  4YXM A;  3H8M A;  2RP5 A;  3GFK B;  2FLN A;  3MFI A;  2LKY A;  2KJ5 A;  3RB3 A;  1BPE A;  4EYH B;  1JXE A;  1QSL A;  1ZQU A;  3BS7 A;  2HOF A;  4Y2V A;  5L1M A;  4O0I A;  1IV8 A;  3SAH A;  3QZ8 A;  4Z6D A;  2PI5 A;  2FPM A;  2HHW A;  3HJE A;  4NLZ A;  2KZ3 A;  5DGA A;  4WJ3 B;  5ALQ A;  3CP8 A;  2EAN A;  2J6U A;  5KNI A;  3NAS A;  4M9H A;  2C28 A;  1U4B A;  1XWL A;  4EYI B;  2BCQ A;  2W8L A;  7ICO A;  1Q3V A;  2OXO A;  4KLO A;  4JUZ A;  5J2C A;  2W54 A;  2G08 A;  1NNL A;  4FZN A;  4DQI A;  1CEZ A;  1X66 A;  4J9O A;  4MFC A;  2BPG A;  5C0Y A;  2EQY A;  5KAF U;  3SV3 A;  4TQR A;  1SV0 C;  4QZB A;  2W9A A;  1HEK A;  5KT3 A;  4DL5 A;  3PVX A;  2RLT A;  1SL2 A;  5A0L A;  2BHN A;  2KJ9 A;  2Y9U A;  3BS5 A;  1H38 A;  3PST A;  2FI1 A;  1JMS A;  1XO0 A;  1BNP A;  9ICQ A;  1J2M A;  4PZN A;  4YCX A;  3KKA C;  2BCR A;  2W9M A;  2F1I A;  4OJ6 A;  3EYZ A;  1NJX A;  2YB1 A;  4DS4 A;  3I28 A;  2ZIX A;  9ICT A;  5ALW A;  3OGU A;  1NJY A;  4ZH4 A;  3UPQ A;  2H3Z A;  5J0Y A;  1ZQV A;  1TAM A;  2DUY A;  1Z00 A;  3C2L A;  2W9B B;  2JZB B;  4KLU A;  4QIW F;  2KHQ A;  4NLK A;  4CF3 A;  2ZTC A;  1WG8 A;  4QWB A;  4A8E A;  1OW5 A;  2W9C B;  1M6Y A;  1XO1 A;  1PK1 B;  3H0R B;  4UAR A;  3AU2 A;  2K8B B;  1YZ6 A;  2OWO A;  4ED2 A;  2G09 A;  2AQ0 A;  5ALD A;  3Q8L A;  3RH6 A;  4YR3 A;  2NV3 A;  3RJF A;  8ICZ A;  5AKI A;  3H40 A;  4Y2J A;  1S10 A;  4ECY A;  1SV4 A;  3IG5 A;  1PVR A;  2BZF A;  2IOH A;  2FPL A;  3OJS A;  3SD7 A;  2FDR A;  4Y2Q A;  3Q8R B;  3RJH A;  4TUP A;  3C5G A;  1MN8 A;  1RYR A;  3QU5 A;  4KLS A;  4DWI A;  5HR6 A;  4C8M A;  5ALR A;  4F2R A;  5E79 U;  5AI9 A;  3AUO A;  2VA8 A;  4DQR A;  1ZET A;  4O3M A;  4PH5 A;  3E58 A;  1OXJ A;  1LV5 A;  4I2A A;  1WCN A;  1HJP A;  5CP2 A;  2IHM A;  4B9T A;  3QUC A;  5KFK A;  2KE7 A;  5KAI U;  4RQ3 A;  3QZ7 A;  4DFK A;  1XNS A;  2HBK A;  2W7O A;  2BCU A;  8ICC A;  4XA5 A;  1Z1B A;  5AI5 A;  3WK4 A;  4ZOH C;  4Y2P A;  4UBB A;  7ICS A;  2I1Q A;  3ETL A;  5DLG A;  1YT3 A;  4DOA A;  2KIV A;  1ZQC A;  2PMZ C;  1F5S A;  2YMQ A;  4Q8E A;  5DKW A;  5ALE A;  4KMU A;  1S0M A;  3IRU A;  5IIL A;  8ICF A;  1EXN A;  2WF9 A;  4UAV A;  5KFS A;  2WTF A;  4KX3 A;  2A19 A;  3ORY A;  4RQN A;  1ZD5 A;  2ZTE A;  2QKQ A;  3IN5 A;  2HCF A;  3RH5 A;  4F2S A;  1TVA A;  1Q8K A;  3C1Y A;  3T5K A;  1KFT A;  2MUT A;  3EWA A;  5AIA A;  5KFJ A;  3MR2 A;  3LVW A;  2EAO A;  2KG5 A;  3H8W A;  2AU0 A;  4I28 A;  2OHF A;  1ZQZ A;  4AYB C;  3V6H A;  1RZT A;  1PZN A;  4MFA A;  4BDP A;  2KSO A;  3MR3 A;  4DCC A;  3PW4 A;  2KVS A;  4M6W B;  4F4Y A;  1WCL A;  1DK3 A;  2XGP A;  5J0T A;  1B22 A;  3QU2 A;  4JV2 A;  1SWW A;  2M0N A;  4PHP A;  4C7Y A;  4O5C A;  3KZX A;  4LZD A;  5JTI A;  9ICG A;  1RQN A;  2E8P A;  5HHI A;  5L9X A;  5CEH A;  4ED0 A;  2K4E A;  4DSJ A;  1ZYQ A;  5KG7 A;  3ICX A;  2EH9 A;  1JN3 A;  5EWE A;  2LYH A;  3K4G A;  2LBO A;  3SEN A;  9ICK A;  4DLE A;  1KTQ A;  2YB4 A;  3IM1 A;  4RQM A;  4C0Z A;  4J9L A;  4HYK A;  4OJP A;  2C2D A;  1WWU A;  2ZJ8 A;  3ISC A;  2LHT A;  5KG5 A;  2MU2 A;  5KL8 B;  1ZQE A;  5AIB A;  4KLT A;  4KX5 A;  4RUA A;  4UB4 A;  1DRG A;  9ICX A;  2ZIW B;  2XI9 A;  4YD2 A;  1TAU A;  3PR5 B;  1UCV A;  3WKD A;  5L1J A;  3JPO A;  3FAH A;  3PO4 A;  2W43 A;  1BPB A;  5KFR A;  3KFU F;  4IRK A;  3PX4 A;  2HVI A;  4NJ8 A;  4R8U A;  4DSK A;  3THV A;  2QLT A;  1SXD A;  3RJG A;  3V7K A;  2ZIV B;  3LWL A;  2B21 A;  2NYV A;  1U49 A;  2RDI A;  1NK7 A;  5BOL A;  3OJU A;  4DL2 A;  5J2H A;  4PGQ A;  2W04 A;  4ECX A;  4I2H A;  5L1K A;  5J2F A;  4IR1 A;  4KLD A;  1ZQP A;  1X40 A;  4RZR A;  3KKA A;  2IOF K;  3V7L A;  4DL7 A;  1NK5 A;  4QW8 A;  4FZM A;  4UB8 U;  4B9N A;  3KHR A;  2PFN A;  2R8K A;  2EAP A;  3NVW A;  1MSW D;  9ICE A;  2O6K A;  4CF4 A;  4KLI A;  3BDP A;  4DSE A;  2ZIX B;  1KFD A;  3PX0 A;  3Q8M A;  4R66 A;  4ELV A;  2EAM A;  1F44 A;  3SAG A;  9ICA A;  3M6Z A;  3SAF A;  4OO1 J;  2K4H A;  4HAI A;  1DK2 A;  1D8B A;  1PVP A;  1N2X A;  1NJZ A;  3KTQ A;  3PMN A;  2OM6 A;  2KD1 A;  2ALZ A;  3PSP A;  3CRX A;  3AQE A;  1UT8 A;  4KLL A;  4FO6 A;  4QWC A;  5BOM A;  4ECT A;  4MEX A;  9ICM A;  4J9M A;  5CA7 A;  3QE9 Y;  1URJ A;  2ASL A;  5KFC A;  1DXS A;  1S0N A;  2YML A;  3QU9 A;  1SL0 A;  4EZ6 A;  4UAY A;  5KT7 A;  1L5U A;  2VA2 A;  3TAR A;  2LI6 A;  4DF8 A;  2G07 A;  4C80 A;  4BGD A;  4F5P A;  3KD3 A;  4M9L A;  4KLH A;  4DO9 A;  4QZ8 A;  4PL2 A;  2G06 A;  3DEE A;  5B66 U;  4QZF A;  2R8G A;  3UQ0 A;  1V9P A;  4F5Q A;  2IHN A;  1JIH A;  3QU7 A;  5AK3 A;  2ASD A;  5KT5 A;  2LM1 A;  2E1F A;  1DGS A;  4RT3 A;  1XSL A;  2HOI A;  4RUC A;  3NVY A;  4OJL A;  3NGD A;  1D9D A;  3C21 A;  2BDU A;  2DFL A;  5DQI A;  4M2Y A;  9ICS A;  2QAR B;  4BXO B;  1HIW A;  3BZC A;  2H5X A;  2WF6 A;  3F5E A;  1QQ6 A;  4F93 B;  5DG8 A;  7ICU A;  5ALZ A;  3MBY A;  1ZQL A;  7ICK A;  2E8M A;  3WK5 A;  2VIX A;  2LPE A;  2AGQ A;  4B9U A;  2LMR A;  4QW9 A;  4B9M A;  2KK0 A;  5B5E U;  1L8L A;  5DLF A;  2C2R A;  3PV8 A;  3ZDD A;  5JRT A;  5AM5 A;  2ESE A;  3BQ7 A;  4DLG A;  1NK4 A;  5AK4 A;  1YZ7 A;  4USA A;  3TAP A;  1WUD A;  3ISD A;  5ALS A;  5AM2 A;  2JEF A;  5KFG A;  5KFO A;  3OTQ A;  1LKY B;  3GV8 B;  1X2I A;  2FMP A;  1CRX A;  3M1Y A;  4RNM A;  3PZP A;  3T3F A;  3K1Z A;  4KLJ A;  3FC4 A;  4M9J A;  3RJK A;  5F3X B;  4DQP A;  3RAQ A;  4F5N A;  4ECV A;  4QJF B;  4ECU A;  3VC8 A;  3NVZ A;  1ZXI A;  4QIW C;  5KG1 A;  1X9W A;  4GC6 A;  4P0Q A;  3GQC A;  2ASJ A;  4NY8 A;  2XID A;  5ALI A;  4P0P B;  2ZXH A;  5DG9 A;  2WF7 A;  4DQS A;  1NKB A;  4EEN A;  2FE9 A;  3N7R C;  5KFY A;  5J2D A;  4P4P A;  3N28 A;  4NLB A;  9ICP A;  1RXW A;  2BPF A;  2KEY A;  5KT4 A;  5G5G A;  2EZY A;  2VJ5 A;  4C4R A;  1XC9 A;  2V4Q A;  4Q8F A;  2F2A B;  2BPC A;  1ZQ1 C;  4DSI A;  3JPR A;  4UB3 A;  1UT5 A;  2KFN A;  1QQ5 A;  1J2N A;  2JV3 A;  2XO7 A;  3M8S A;  2B0C A;  3UMC A;  3F2C A;  2WAQ F;  4LJX A;  1HUZ A;  4RPX A;  2A1J A;  4RQ2 A;  4F72 A;  3MAB A;  2BQ3 A;  5EWG A;  1Z4O A;  2XY6 A;  4GXK A;  5HP4 A;  4FS2 A;  1WYG A;  5JUM A;  3K75 D;  1ZQF A;  3JPP A;  3SV4 A;  4DL3 A;  2GH1 A;  1SIJ A;  4NLN A;  3HIL A;  4GLX A;  3RJI A;  1XS9 D;  4NL9 C;  3UQ2 A;  1ZQQ A;  4DQQ A;  3ZDA A;  3GV5 B;  3BQ2 A;  7ICN A;  4UAW A;  4KLG A;  3ED5 A;  2ZUD A;  3JPT A;  4NV0 A;  4UAT A;  4F5R A;  2ZIU B;  2KV2 A;  3RB0 A;  4Y2T A;  4UAZ A;  4G3I A;  5T14 A;  1KRP A;  4JB3 A;  1HUO A;  1ZRM A;  4JWM A;  4YXJ A;  3ETR A;  1Z4N A;  1JI7 A;  4I2I A;  5L1I A;  4ED7 A;  3QXG A;  1N56 A;  2NRX A;  1S5L U;  8ICP A;  2BQU A;  1PVQ A;  2JEJ A;  5KFV A;  1V85 A;  2NRW A;  4PGY A;  8ICM A;  3V72 A;  5KFH A;  5DGB A;  4Y2Y A;  1NK9 A;  7ICQ A;  2AXT U;  4DOC A;  1B43 A;  4C4T A;  3PX6 A;  3JPS A;  3IV6 A;  4MHV A;  1N61 A;  4AP9 A;  1XSP A;  1Z1V A;  4FBU A;  1KN5 A;  4DFJ A;  3N4M B;  4U6P A;  1FEZ A;  4F5O A;  1ZQB A;  4EEK A;  5TIS U;  1S77 D;  5IIO A;  5J2E A;  2E1E A;  2BQR A;  4J03 A;  5AKJ A;  4I2E A;  4KLF A;  9ICR A;  3KOO A;  9ICO A;  5KFL A;  1ZQA A;  3UXO A;  2YX8 A;  1D8Y A;  3LK9 A;  1SWV A;  3HKZ F;  3E2E A;  2QB0 A;  1MQ2 A;  5CB1 A;  3TAQ A;  2ZJA A;  7ICF A;  5ALK A;  4F3O A;  1N62 A;  2UVR A;  3RF9 A;  5ALH A;  5G5H A;  5KFX A;  3RFA A;  2R8I A;  5BPC A;  4I2G A;  9ICW A;  2H3V A;  3R9K A;  3MR5 A;  4KMO B;  5D49 A;  3M8R A;  1FO4 A;  2CPR A;  5KFF A;  9ICV A;  1FFU A;  3GDX A;  4QZI A;  2DBY A;  2KIC A;  3OPX A;  4EBD A;  3GIK A;  1QSS A;  1N5W A;  4ED1 A;  5CJ7 A;  1XU4 A;  4ELU A;  2AGO A;  1IM4 A;  4J9K A;  4DL4 A;  2ZXI A;  3ONN A;  3CYM A;  3KBB A;  1U47 A;  4ICA A;  2XY5 A;  4RPZ A;  2B6G A;  5AIC A;  2KHV A;  4YFK A;  5ALV A;  3G6Y A;  1L3V A;  2KIW A;  1TE2 A;  3SR6 A;  2E3T A;  4QZH A;  1TK8 A;  3A0H U;  4OCZ A;  3C5F A;  4EX7 A;  2ZG6 A;  3ZDC A;  3B0X A;  2KJ8 A;  5GTH U;  4DF4 A;  5AI8 A;  2DKZ A;  4F4X A;  3RJE A;  4YMM A;  7ICI A;  1TK5 A;  1LVH A;  3PY8 A;  1ZD2 P;  3C2M A;  1ZRN A;  4GFJ A;  3WU2 U;  3SEI A;  4ECR A;  4Y2U A;  2F44 A;  1U9L A;  2WF5 A;  3IG8 A;  3MDC A;  3N7P D;  3M9N B;  1L7P A;  5J0P A;  4MF2 A;  5KTQ A;  5KG0 A;  1ZQX A;  3QYP A;  4PZO A;  5EWF A;  7ICT A;  4FFD A;  3H0L B;  4P0Q B;  3F53 A;  2JEI A;  5ALO A;  2MAX A;  2K8C B;  1A6S A;  5KL1 B;  2R8H A;  2CRX A;  2PI4 A;  4QWA A;  5KFU A;  4MEY A;  3AM9 A;  3AU6 A;  3IDW A;  5DB8 A;  3NUQ A;  5EE1 A;  1SZH A;  5DB6 A;  3QEA Z;  2DGZ A;  2C2E A;  2UVU A;  5DB7 A;  4K4H A;  2K89 A;  8ICV A;  3NVV A;  1K1S A;  5DG7 A;  3KZI U;  2BR0 A;  2J6T A;  4DS5 A;  1DGJ A;  4ED8 A;  1KLN A;  5AHX A;  4OD0 A;  1VJ5 A;  9ICB A;  3RB6 A;  5AI6 A;  3PW0 A;  1T94 A;  2LM4 A;  4DEZ A;  4ED6 A;  7ICE A;  2UVW A;  3B0Y A;  1NK8 A;  2Y1I A;  1ZQJ A;  5J0S A;  2NO4 A;  5DB9 A;  4NL9 A;  3LWM A;  5KFB A;  4PHA A;  2P6U A;  1LB2 B;  4C8L A;  2Y0S F;  1T7P A;  2JEG A;  1ZQY A;  3BJY A;  3PNC A;  4NM1 A;  4NLC A;  4UBC A;  4YMN A;  3WKE A;  3K1R B;  1RDF A;  2MSN A;  1JX4 A;  1TK0 A;  8ICK A;  4DL6 A;  5J0U A;  4LVS A;  1RQL A;  1SKS A;  3D6J A;  5J8Y C;  3G6V A;  2OCE A;  5J2A A;  3H8S A;  2PMZ F;  2KMD A;  4YD1 A;  4KLQ A;  2YTU A;  2GO7 A;  1COK A;  2NRZ A;  3NTU A;  3BS5 B;  3GII A;  3PSI A;  4RQ8 A;  3Q8K A;  3RBE A;  4BX9 C;  5FP0 A;  4KLE A;  3TAD C;  3C1Z A;  3H4D A;  4KN7 A;  2KZZ A;  1OUQ A;  5ALU A;  5JU5 A;  3U26 A;  2JGA A;  2UVV A;  2RRD A;  5ALF A;  3KHH A;  4RNO A;  3AL0 B;  1AQ6 A; 
#chains in the Genus database with same CATH homology
 1DXS A;  5J8Y A;  2KIV A;  1LKY B;  2DL0 A;  3IDW A;  1PK3 A;  2E8O A;  2D3D A;  3H8M A;  2K60 A;  1B4F A;  1UCV A;  1LKY A;  4RQN A;  1JI7 A;  5F3X B;  2QKQ A;  3BS7 A;  5L1M A;  1OW5 A;  4NJ8 A;  1PK1 B;  1SXD A;  3TAD A;  2EAO A;  2KSO B;  1V85 A;  2KG5 A;  2QB1 A;  4NL9 A;  2B6G A;  2FE9 A;  1SXE A;  2EAN A;  5KNI A;  1X40 A;  3KKA A;  1SV4 A;  2KSO A;  2K4P A;  2ES6 A;  1SGG A;  2F3N A;  3K1R B;  4MHV A;  2GLE A;  2EAP A;  1F0M A;  1Z1V A;  2QAR B;  5J8Y C;  2DKZ A;  5JTI A;  1X66 A;  2E8P A;  2E8N A;  2JV3 A;  1PK1 A;  2KMD A;  2L5Y A;  2QAR A;  2QB0 B;  2YTU A;  2EAM A;  1COK A;  1X9X A;  1SV0 C;  1OXJ A;  3BS5 B;  1UQV A;  3SEI A;  2F8K A;  2Y9T A;  2E8M A;  2DKX A;  1B0X A;  2F44 A;  2LPE A;  2QB0 A;  2LMR A;  1RG6 A;  2KE7 A;  3SEN A;  3TAD C;  1KW4 A;  4RQM A;  5JRT A;  2Y9U A;  3BS5 A;  4IS7 A;  3HIL A;  1WWU A;  2ESE A;  4NL9 C;  3BQ7 A;  5JU5 A;  4PZO A;  1SV0 A;  4PZN A;  1V38 A;  1WWV A;  3KKA C;  2D8C A;  3TAC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...