1PK1B

Hetero sam domain structure of ph and scm.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
RSQPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLRLNSERMMKYMGLKLGPALKICNLVNKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyhomeotic-proximal chromatin protein
publication title Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repression
total genus 23
structure length 70
sequence length 70
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1pk1B00
1SV0C 3IDWA 5L1MA 1COKA 5J8YA 2DKZA 2KSOB 2EAPA 2D3DA 2KSOA 5KNIA 2DKXA 5F3XB 2QARA 2FE9A 1B0XA 1LKYB 2KE7A 2GLEA 3KKAA 1DXSA 1SXEA 1PK1B 1V85A 2Y9TA 2KG5A 2JV3A 4NJ8A 4RQMA 3TADC 1OXJA 1KW4A 3K1RB 5JRTA 1B4FA 2QB1A 3TACB 2E8PA 1V38A 2YTUA 1LKYA 2DL0A 2F3NA 2D8CA 1PK1A 1JI7A 4NL9C 1WWUA 2EAMA 1SGGA 3H8MA 2LMRA 2E8NA 2KMDA 4RQNA 3KKAC 1F0MA 2B6GA 1SV0A 1UQVA 2F44A 1WWVA 2ES6A 2EANA 1X40A 3TADA 2KIVA 4IS7A 1PK3A 2EAOA 2E8OA 3SENA 1RG6A 3BS5B 2QB0B 4PZOA 5J8YC 2QB0A 1X66A 3SEIA 2ESEA 2Y9UA 1SXDA 3HILA 4PZNA 2L5YA 2LPEA 5JTIA 5JU5A 2F8KA 2E8MA 1Z1VA 2QKQA 2K60A 2QARB 4NL9A 1SV4A 3BQ7A 2K4PA 3BS7A 1OW5A 1UCVA 1X9XA 3BS5A 4MHVA
chains in the Genus database with same CATH superfamily
3MR5A 2C2DA 4B9MA 4DL3A 5DGBA 2LHTA 4F2RA 2J6UA 5KG5A 2RRDA 3AU6A 3F5AA 7ICTA 2XGPA 2BPGA 3V6HA 1L3TA 1B0XA 4C4RA 5BPCA 3OJSA 3M9NB 3KTQA 1DXSA 1TKDA 4PHAA 1SXEA 1PK1B 3THVA 2IHNA 1N56A 4B9LA 4QZCA 4KLTA 1TK0A 8ICOA 3TADC 3UM9A 4PJ0U 4F5QA 3K1RB 2QB1A 4F4ZA 2Z7JA 3NS1A 2DUYA 5J0WA 3Q8PB 3RAXA 4DQQA 8ICQA 2KTQA 3NRWA 3TARA 1X9SA 1WG8A 1GO3F 1MN8A 2EDUA 3BJYA 3QX7A 2BHNA 9ICNA 3AQEA 4UAYA 1SV0A 2KK0A 9ICHA 1TAMA 3QUCA 4ACOA 4C80A 4QW9A 2KIVA 4FZLA 2AU0A 2I6XA 1U49A 2KJ9A 2HHTA 4ECWA 4DFJA 3JPTA 1SXDA 2G5IB 3FDSA 1V97A 4X5VA 1NK6A 2RDIA 2W43A 5ALRA 4LJXA 2ZIWA 2W9BB 1Z1VA 3EYZA 5G5HA 1QSLA 4O5EA 2JGAA 4GXIA 2PI5A 2W9CA 4GIBA 2PKEA 3M9OB 3BQ0A 4ECXA 1RM6C 4FO6A 3BZCA 1D8BA 2W04A 4YMMA 4QW8A 4RUCA 5KFQA 4I28A 4M6WA 3HX0A 4IQVA 1ZRNA 2XCPA 1QQ5A 3SZ2A 4P0QA 3C28A 4LZGA 3C23A 3ISBA 2BGWA 2JZBB 3NASA 2NRVA 2EZXA 2F77X 4EX7A 3IHQB 2WTFA 4AP9A 3RJJA 3V7LA 3QNMA 3F5EA 4M2YA 1KW4A 5DBCA 2JEGA 3SR6A 3AN1A 1RDFA 9ICKA 9ICAA 4DOCA 1NJYA 5J2BA 1KSPA 2ASJA 4OJ5A 4B6JA 4JUZA 5J2AA 2F3NA 2JEIA 7ICGA 1JI7A 5ALWA 3RTVA 3NVVA 2WAQC 4NL9C 4Q8FA 3AU2A 9ICUA 1WCLA 2FMPA 2KMDA 1NJZA 3LVWA 1A0PA 1NZPA 3LK9A 4OJOA 1NK5A 4R8UA 4KLOA 5L9XA 1L7OA 7ICKA 2KIWA 1MQ2A 4I2JA 2D6FC 4UB8U 2CN1A 4RZRA 5B66U 3SYZA 4QWAA 3E0FA 4ED1A 3BZKA 2BCRA 1OUQA 2W3SA 4ECVA 2WB1C 3SV4A 4UW9A 4JMUA 4US9A 5KFKA 3SMVA 2W9CB 2BQ3A 1FEZA 4YFKA 3HRDD 2W54A 8ICGA 2VJ4A 9ICIA 5J0TA 5DG7A 2P35A 1ZQVA 2AH5A 4M6WB 3QYPA 4IR1A 4O3SA 4O3QA 4GC7A 4KLFA 3ED5A 4P0QB 4DSEA 5J0RA 3RRGA 4KMUA 3KKAA 4TUQA 1Z3EB 2YY6A 5KT5A 3F53A 5AM0A 5HHHA 3AQFA 2JV3A 2FLNA 4NJ8A 2JMGA 3F2BA 2MA1A 1ZQAA 4UBBA 1JXLA 5DDMA 1ZJNA 3A0BU 3T79A 2KFNA 1NJWA 1D9DA 2M0NA 4DFDA 5J2IA 5KFAA 1U47A 4BX9C 3PR5B 2UVUA 3IRUA 3EPIA 3QU5A 4Z6FA 5KG0A 1ZQCA 1MC8A 5AKIA 4KLGA 3RF9A 3C2LA 2B6GA 5CWRA 5DGAA 5H2FU 5KFTA 3MBYA 2E8OA 4F50A 1ZETA 4B9SA 1XSLA 5J2JA 1B43A 5AHXA 3PX6A 4PGQA 3PSTA 3QU4A 3LVVA 2HHQA 4MFFA 3BDPA 4ED3A 5ALXA 5IIIA 4I2EA 3HILA 7ICLA 1K1QA 8ICMA 1KFSA 4F8RA 1S97A 2LYHA 7ICSA 3N28A 4RQ4A 3R9KA 2QKQA 4EX6A 3IN5A 1XNSA 3ZD8A 3ZDBA 2WF5A 5HR7A 4JWMA 3N97B 1YZ6A 2BCUA 1LVHA 1NK9A 3QEBZ 5J29A 5IIMA 3GV5B 2KICA 2Y0SF 5AKYA 1UT8A 2FJ6A 5IILA 5DLGA 1ZXIA 4WJ3B 3GDXA 1HJPA 2ZJ5A 1U9LA 1D9FA 1RQLA 1ZQIA 4J9OA 3KOOA 8ICUA 5ALEA 3KBBA 2YB4A 1CEZA 5ALJA 3BQTA 9ICPA 2PI4A 2NRXA 2HOFA 5KG7A 1QQ6A 2BCVA 3RJGA 2H3FA 3HW8A 9ICFA 4QZEA 1X42A 4O3PA 2VANA 2AGPA 2KJ8A 4I2IA 3GIJA 5ALPA 2AXTU 4QWEA 1QSSA 2HOIA 4F92B 3LWLA 4J9RA 2HI0A 2E3TA 5AKGA 1F5SA 1ZQZA 2YMQA 4J9NA 4BXOB 3TADA 3HKZC 1ZQOA 4OCZA 3UMBA 2XIDA 4PZOA 1QH9A 2NO5A 5DQGA 1MSWD 3SAHA 4MFAA 1Z19A 5HR6A 5KT4A 1PZNA 4Q45A 3VCBA 4Z6CA 4CNQA 1O08A 2ZIUB 1BPDA 2E8MA 1XU4A 4RT3A 4Z6EA 4TQSA 2R8JA 3B0XA 2HBLA 4YR3A 2FMSA 4IRKA 3V7KA 3GQCA 1DK3A 1NK7A 2MAXA 4F93B 5J0OA 1JXEA 2I9GA 3L5KA 5KFXA 8ICPA 4MEXA 2AGOA 3RRHA 2OWOA 2G09A 3SAGA 4F5PA 1ZQYA 4C8MA 4QZFA 4FS1A 3PW2A 3LWMA 3RB4A 4XRHA 4KN7A 2LBOA 3BQ1A 3RBDA 2W8KA 1L3VA 2ZTEA 3H0MB 3ETRA 5AM2A 3Q8SB 3GIIA 3C2MA 3H8WA 4Y2RA 5F9LA 3MGIA 1JX4A 5JRTA 2YN4A 4DL2A 4FZNA 1T8EA 5AKXA 5KFVA 5BOLA 4EZ9A 9ICSA 4YG2A 4C7YA 1N5WA 4QZHA 2OH2A 2NRTA 3UQ0A 4DQSA 3QE9Y 1PK1A 4KTQA 3ZD9A 2HCFA 4P4OA 3H8MA 3F2CA 2PFPA 1BPYA 4UATA 3Q8LA 2F44A 3ALRA 4KLUA 4MF8A 5HHIA 4UAZA 2YB1A 2KD1A 5B5EU 5D49A 3C2KA 2P6RA 3QU9A 8ICHA 4Q44A 3OPXA 7ICFA 1SIJA 2W03A 5AM5A 1T7PA 1TAUA 5JU5A 4ELUA 3AMZA 4C8LA 4NL9A 5ALNA 5KTQA 2NRWA 2W3RA 2UVVA 4HAIA 3RFAA 4DFPA 3E2EA 4EBCA 1UCVA 4CF4A 2K4EA 2OM6A 4DEZA 5ALDA 1BPBA 1SL1A 1SKRA 4B9TA 1COKA 4BWJA 3QUBA 3MR2A 1A76A 2KSOA 3RBEA 5DB9A 5AK4A 4UB5A 3OSNA 1NKCA 2W9BA 3PSFA 4G3IA 9ICLA 4NV0A 4DF4A 7ICEA 4DWIA 3T5LA 2PFOA 4P0PB 1V85A 3IG5A 1LB2B 3OSPA 4RQMA 1OXJA 3BQ2A 2JXJA 2E5SA 3PMNA 3OHAA 4QZ8A 5L1LA 4ICAA 4DCCA 5KFOA 3ONNA 4DFKA 2NO4A 2V9WA 5L1JA 2W7OA 5ALSA 2P66A 4I2GA 2JZBA 4EEYA 1BNPA 3VC8A 2NV3A 2BDUA 4FZMA 1J97A 1SL0A 4DOBA 3FAHA 1NJXA 1DK2A 1XO1A 5J2GA 1ZQNA 3UMGA 3UXOA 3Q8RB 3LDAA 2ES6A 2FLPA 2W8LA 3NVZA 4Q43A 1ZD5A 4QJFB 3PSIA 1TFRA 1PVRA 2ISOA 1X66A 5T14A 4P4MA 4USAA 1XO0A 2NRZA 1ZD4A 3IG8A 4FS2A 4DSFA 4PZNA 2IMWP 2AJQA 3RJKA 5KT6A 1N62A 2G08A 4UARA 4B9NA 2WF9A 4J03A 4NXZA 1UT5A 1MA7A 1M6YA 5ALLA 1BPXA 3HP6A 5KFHA 4RPYA 1L6NA 1NI3A 2R8GA 3N7SC 5TZVA 2UVRA 2PFQA 5CEHA 1QCKA 4JB3A 4XUSA 1ZQMA 2G0AA 3PZPA 2AQ0A 3TI0A 4EELA 2KSOB 2HW3A 3NVYA 2AHOB 4DO9A 4G9BA 3NUQA 3V6KA 4P2HA 4DOAA 1JUDA 5J0QA 4UB4A 3CNHA 4NWIA 2WHEA 5KFZA 3WKEA 4R66A 5KFMA 4FE3A 7ICVA 4PGYA 2K89A 3SQIA 5AI5A 4OD0A 4YD1A 1ZQDA 4EENA 2W7PA 3NTUA 2KHQA 2Y1JA 3N7RC 1NK8A 2WAQF 5J0XA 2ZTCA 4LZDA 8ICNA 1WWUA 1JN3A 5G5GA 4J9LA 2LMRA 2E8NA 3IP4B 1U45A 4O9MA 2EQYA 8ICKA 5AK5A 3F2DA 1KDHA 1PUZA 4KLMA 8ICSA 1L8OA 3PSPA 3TAQA 2KVSA 1PK3A 2EAOA 2NYVA 3PW4A 3H4BA 4UAWA 4F5OA 2WB1F 3QU7A 4UQGA 1KBUA 4PL2A 3OGUA 5JTIA 1RXVA 8ICWA 2R8IA 7ICUA 1VJ5A 3PNCA 2VIXA 2YX8A 5DG9A 4YQWA 2F1JA 1KLNA 4JWNA 5KT3A 3OHBA 4EBDA 1ZQSA 4OJ6A 3MGHA 4M0AA 4I2FA 4F71A 1NOMA 2YMPA 2DKZA 3PX0A 2Q4TA 5CHGA 1T3QA 1ZQTA 5ALVA 4DQRA 4RQ0A 8ICXA 2K8CB 2C2RA 5ALKA 4M04A 1FFUA 3OJUA 2KEYA 5KFIA 1COOA 1XC9A 2XICA 3Q8MA 4QZIA 1X9WA 4QWCA 1WCNA 2ZIVB 3EPGA 1Q3UA 3MR3A 4RQ7A 3KZIU 4MEYA 2QLTA 5C5JA 9ICTA 1AQ6A 2BCSA 5KG3A 1J2MA 2HHSA 2VJ5A 2DL0A 5KFRA 4R65A 4DS5A 3PX4A 4O3MA 5JUMA 1NZBA 4C0ZA 1DRGA 1KFTA 2F1IA 4JV1A 4RPZA 3WKDA 2HMXA 4PGXA 1ZQLA 3EWAA 2JEFA 4M9LA 5HNKA 3AUOA 2ISPA 3QZ8A 5EE9A 1ZQEA 2JR5A 5J0PA 1HUZA 1ZD2P 3ISDA 2LKYA 4KMOB 5ALQA 4BXOA 2A19A 4ELVA 4RQ2A 3WK7A 3C29A 2GH1A 4C8NA 4J9PA 2MUTA 1SV0C 5KFEA 3QEAZ 1SWWA 4EYHB 4QIWC 4DL6A 1KQQA 4YD2A 2ZIUA 3SI8A 5ALZA 3M8RA 4NM2A 3AEVA 4DLEA 2K8AA 2FI1A 4PHPA 5AIBA 3D2NA 3A0HU 3WKCA 1ZQGA 4C4SA 2ASLA 5ALUA 2HHXA 5HP4A 5AKHA 4M9HA 3K4GA 1YT3A 1ZQHA 2LI6A 2VKQA 1KFDA 1ZQKA 4IRCA 5HMMA 3TFSA 1N2XA 2B21A 4RNMA 9ICCA 4ED8A 1DGSA 4QWDA 1N60A 4ED6A 5DB6A 4F91B 2A1JA 4EYIB 4IRDA 4R63A 2YMMA 2AQ4A 2EAMA 2V4QA 5CB1A 4M9GA 1BPEA 3HKZF 7ICJA 5KG1A 2O6KA 9ICJA 4DF8A 3JPQA 1Q3VA 4BDPA 2I5HA 1TK5A 4P4PA 4I2BA 3RB6A 3PY8A 2VA8A 1X6IA 2JHDA 1RG6A 3KFUF 4DQIA 2YMLA 2DQNB 5ALYA 4BJQA 2ESEA 2Y9UA 4F3OA 1S8OA 2OYYA 2C28A 2VA2A 4NLNA 2KOBA 4ECQA 5KFPA 9ICXA 4J9KA 4Y2VA 5AIAA 1RZTA 1Z00B 2H3QA 2FPKA 1WUDA 4NLBA 4I2AA 4KLLA 3PO5A 1F44A 8ICZA 9ICRA 4J9MA 3UQ2A 4GFJA 3M6KA 7ICHA 2MUTB 4DL5A 2DFLA 2OEHA 4OJPA 1DOQA 1NKBA 8ICCA 4ECYA 4I2CA 1ZD3A 4HYKA 3K1ZA 4Y2JA 3CRXA 4JV0A 2B0CA 4U6PA 4UB3A 5KG2A 1L7NA 3KZXA 5DBBA 1SB3C 1S77D 1Z4OA 2HVHA 2IBKA 5J0UA 1K5OA 2YQEA 5TISU 1D8YA 5J0YA 2AGQA 1NK4A 3Q8QB 2HSZA 3V6JA 4XQ8A 4RQ6A 5CR0A 4KLDA 3TFRA 1X9MA 4B9UA 3ZDDA 8ICAA 1B4FA 3JPRA 5AI9A 5EWEA 4F4WA 5KFSA 2E8PA 1A77A 4KLSA 4TUPA 5D46A 3D6JA 3M1YA 1L8LA 1ZOLA 2ZIXB 2A1JB 4GLXA 4P0PA 3RR8A 3B9JA 5AKZA 3GU3A 2H3IA 5AKEA 4C8KA 4TUSA 1FIQA 3KKAC 5K4LA 1ZQWA 4JK1A 4Z6DA 2A3VA 3TQ1A 1X40A 1CRXA 1A6SA 2XY5A 1N61A 4I2DA 3QUTA 9ICGA 1N48A 1S9FA 2LYAA 3SV3A 2QB0A 4ED0A 3DDHA 2Q0ZX 4TURA 4KITB 8ICLA 4KX5A 4ED7A 3KHHA 2DPJA 5KG4A 4YP3A 4KX3A 5GTIU 2GO7A 5KFCA 2F76X 1TAQA 2BDPA 2K4PA 5AM4A 5J2KA 3QXGA 2PMZF 2WF7A 5CA7A 3QU2A 2DPIA 4R64A 4MFCA 1ZQXA 2FLLA 4RT2A 4F5RA 1ZQUA 5EWFA 2KZ3A 2HHUA 1SZPA 2ASDA 3PVXA 1UA1A 5KFGA 4OO1J 2KKVA 3KHGA 2G5HB 4F5NA 2KZMA 2KVCA 1U48A 1UHUA 4KN4A 3U26A 3T5JA 4ZOHC 5AI6A 7ICOA 2PMZC 2DGZA 2J6TA 3S6JA 3M8SA 5C0YA 3M6ZA 4KLIA 5IINA 4PL1A 2EH9A 2OCEA 3UXPA 1H38A 3MFHA 3WU2U 4UASA 5AKJA 4RPXA 1C20A 2M9NA 5BOMA 5DDYA 3RH4A 2WF6A 2BZFA 5EE0A 2DBYA 5AI8A 3TKAA 2BCQA 1X2IA 1ED1A 2K4IA 1FO4A 5KFDA 2D8CA 4EEKA 4OJLA 4YN4A 1D8LA 4M47A 2A1AA 5L1KA 1UQVA 1WWVA 1ZJMA 5DQIA 4YR2A 3CW2C 2R8KA 4IS7A 3AL0B 2E1FA 3T5HA 1JROA 1S5LU 1IIPA 5AI0A 2QB0B 3RH5A 5J8YC 3T3FA 3GIMA 2J6SA 5KAIU 3SEIA 2EZYA 3ICXA 1Z4NA 3M7DA 2HOQA 4JV2A 3PV8A 4CGZA 2HVIA 2F8KA 3MGVA 3LYSA 3OTQA 2QARB 1FFVA 3TANA 4ECSA 1BPZA 4UB2A 2BPFA 2RHFA 5ALOA 3NRZA 2PFNA 5IIOA 4YXJA 4FFDA 2WFAA 3FYHA 3ORYA 1IM4A 1L3UA 2IA6A 1S0VA 1RYRA 4C8OA 2KHVA 4PHDA 4BWMA 2ZJAA 7ICNA 1LKYB 2GLEA 5J2EA 3EZ5A 1J2NA 2ZUCA 2FMQA 2KZZA 3QUQA 3C5FA 4DQPA 4K4IA 3CP8A 3RJIA 2ZTDA 5J2DA 5AM1A 8ICIA 1V9PA 5KFJA 1SKWA 1HEKA 4RQ1A 1XWLA 3WK5A 4IQUA 4NM1A 1S10A 2HBJA 4NY8A 2JRZA 2KV2A 4E0DA 4F4XA 2KKPA 4YR0A 2VA3A 3N4MB 2MU2A 3H40A 1L3SA 2H3ZA 3RH6A 3B0YA 5CP2A 3E58A 1VDVA 1ZQRA 2ZIVA 1ZQ1C 3SD7A 3SENA 3BS5B 8ICTA 2HHWA 2C22A 1AROP 2ZXHA 1JRPA 1IXRA 1T4GA 4C4TA 2ZG6A 1T94A 1QLNA 1S0OA 2L5YA 2LPEA 9ICOA 1BGXT 3H4DA 4K4GA 4UAUA 1WYGA 4ECRA 4KLEA 2OHFA 5EOZA 5DB8A 3GILA 3MFIA 4M9NA 8ICFA 4QWBA 3V72A 1OW5A 9ICBA 4KLJA 1L7MA 3MABA 1ZQFA 2W55A 4MHVA 5GTHU 2ZUDA 4IL6U 3DEEA 3WK8A 3WKAA 4US8A 3J81j 1RPLA 3WK6A 4O5CA 3H8JA 2MRLA 8ICVA 4YVZA 5L1IA 4F4YA 4F72A 8ICBA 4NLZA 4O3RA 5ALTA 1JIHA 1KEJA 7ICQA 1SL2A 1Y88A 4CF5A 5J0SA 3WK4A 2CXYA 2F8LA 3H0LB 5KT7A 1JALA 1DGJA 1CUKA 2XY6A 2GWSA 1JMSA 4CRXA 2ATLA 3IV6A 2W11A 4KLHA 2XO7A 2LM1A 3ZDEA 4ELTA 7ICRA 3HJEA 2K4HA 3I28A 4UAVA 5DBAA 5AM3A 3PW0A 3GV7B 4DSJA 1ZRMA 3G6YA 3QZ7A 4O0IA 2LYBA 3H0RB 1ZQPA 5KFNA 2RLTA 5ALHA 5ALFA 2IOFA 1ECWA 5HMLA 2ZIWB 1NNLA 2OXOA 1F0MA 2FPMA 9ICWA 3I76A 5J2FA 3SAFA 5DKWA 7ICPA 3KD3A 1PVQA 1HIWA 4CF3A 5KT2A 2RP5A 4J9SA 3MDAA 4IR9A 1XS9D 1IV8A 4UB1A 3UPQA 2G06A 1SZHA 1SV4A 4QZ9A 1MQ3A 2MSNA 3M9MB 4AYBF 1L7PA 2BKEA 1BNOA 4PHEA 3JPNA 3JPOA 4QIWF 3FC4A 4IQWA 2KNJA 4QZBA 3IDWA 4NLCA 1C7YA 4QNLA 1KL9A 3RJFA 2D3DA 3ZDAA 3HPOA 5IIJA 2PXIA 2DKXA 5F3XB 2FE9A 4QZAA 5CRXA 1CI4A 1Z00A 4U7CA 1KKXA 2XGQA 2JH7A 2KP7A 5EE1A 3DV9A 3I1YA 2Y9TA 1P7DA 4AYBC 3C1ZA 1T3NA 2LM4A 5KL8B 3HT3A 8ICJA 4R8UB 3NVWA 4ECTA 5ALGA 1N63A 2K8BB 2KFZA 5J2CA 2G07A 5E79U 2YTUA 5FP0A 9ICVA 4RQ5A 2KJ5A 4TQRA 2HBKA 3EW9A 1IG6A 3L3FX 4DSKA 3GV8B 3C1YA 4UBCA 2XI9A 1O03A 4BUGA 4DL4A 4RQNA 4ED2A 3D2QA 2FDRA 1ZQQA 3JPSA 1ZQJA 4NLKA 1RYUA 5KFFA 5F9NA 1Q8KA 2DWQA 5KFYA 4GXKA 1N5XA 1SWVA 2XCAA 1U4BA 5KFLA 4Y2PA 2DF4B 2ZIXA 1RXWA 9ICEA 3AM9A 3UMCA 2C2EA 5KG6A 9ICMA 1EXNA 3PW5A 3T5KA 2H5XA 4QZDA 1XSNA 3C21A 2BR0A 3RJEA 4B9VA 5KFWA 2R18A 3BQ7A 3PMLA 2HDOA 4ECZA 4DSLA 2V4RA 3FM9A 5DLFA 3WKBA 2IOHA 1TE2A 7ICMA 2JEJA 2IHMA 2JH1A 1VLBA 5L1MA 5AK3A 5J8YA 5EWGA 4Y2YA 3RR7A 2F1HA 5KNIA 8ICEA 1ZQBA 4DS4A 4XA5A 4YMNA 4DL7A 2Y0SC 4NLGA 1QTMA 3RAQA 2KE7A 4Y2TA 2XC9A 5AKKA 2BQRA 5DQHA 2ZXIA 2F2AB 4RU9A 3ISCA 4CDGA 4EZ6A 3D2SA 4CCHA 5CJ7A 3GIKA 3ETLA 2KN7A 3H7IA 3G6VA 1QSYA 4M9JA 4F4KA 4PH5A 8ICRA 4Y2XA 1V38A 5KAFU 4IC9A 5KFBA 4Q8EA 1RQNA 3H8SA 4I2HA 5KL1B 4J9QA 2P6UA 3RB3A 4Y2QA 3ZI4A 4FBTA 1XSPA 3MR6A 3KHLA 1Q46A 3EUB2 4K4HA 1K1SA 2ODGA 3ZDCA 9ICQA 1PVPA 2IOFK 3CYMA 2HBMA 4YCXA 3MDCA 4I29A 2EANA 5AI4A 4O3OA 2HHVA 3RJHA 2UVWA 2I1QA 2N1RA 4KLQA 5DB7A 1LV5A 3UXNA 2WF8A 4YXMA 1TV9A 1X6JA 3GZFA 1KN5A 2W9MA 3JPPA 2K60A 2EZZA 4I27A 1QQ7A 4CE6A 1NK0A 2RDJA 2ZUBA 4Y2SA 4GC6A 1X9XA 3O0FA 2XY7A 4Y2UA 4ECUA 2ALZA 1URJA 4DSIA 3PR4A 1S0MA 1HUOA 5AICA 1UPHA 5J2HA 3KHRA 1KRPA 2EAPA 5EE3A 5AKLA 5ALIA 5DG8A 1TVAA 2XVTA 2QARA 4RQ8A 4RUAA 1UA0A 2E1EA 3G6XA 3HWTA 4PPXA 4YMOA 2KG5A 5AK6A 2GOLA 3NGDA 5ALMA 3V7JA 3MC1A 3TAPA 3C5GA 4O5KA 1Z1BA 3TACB 2BQUA 2FPLA 4C7ZA 5A0LA 1LKYA 1S76D 3GFKB 4MF2A 3RB0A 4O3NA 3PW7A 2H3VA 1SGGA 1RYSA 4EBEA 4DFMA 4RQ3A 4GXJA 4FBUA 3WK9A 4BGDA 3PO4A 3IM1A 5KFUA 2RQ5A 1B22A 4QZGA 4LVSA 4UB6U 2Y1IA 4F2SA 5D4BA 1SKSA 5IIKA 4IQTA 3Q8KA 8ICYA 2CPRA 3K75D 4ZH4A 1ZYQA 7ICIA 4DLGA 2BPCA 2W9AA 1BVSA 1NKEA 1L5UA 2CRXA 3L4PA 1S0NA 4RNNA 2R8HA 3BS7A 1KTQA 1YZ7A 3N7PD 4RNOA 4A8EA 2ZJ8A 3BS5A 1TK8A
chains in the Genus database with same CATH topology
1SV0C 3IDWA 5L1MA 1COKA 5J8YA 2DKZA 2KSOB 2EAPA 2D3DA 2KSOA 5KNIA 2DKXA 5F3XB 2QARA 2FE9A 1B0XA 1LKYB 2KE7A 2GLEA 3KKAA 1DXSA 1SXEA 1PK1B 1V85A 2Y9TA 2KG5A 2JV3A 4NJ8A 4RQMA 3TADC 1OXJA 1KW4A 3K1RB 5JRTA 1B4FA 2QB1A 3TACB 2E8PA 1V38A 2YTUA 1LKYA 2DL0A 2F3NA 2D8CA 1PK1A 1JI7A 4NL9C 1WWUA 2EAMA 1SGGA 3H8MA 2LMRA 2E8NA 2KMDA 4RQNA 3KKAC 1F0MA 2B6GA 1SV0A 1UQVA 2F44A 1WWVA 2ES6A 2EANA 1X40A 3TADA 2KIVA 4IS7A 1PK3A 2EAOA 2E8OA 3SENA 1RG6A 3BS5B 2QB0B 4PZOA 5J8YC 2QB0A 1X66A 3SEIA 2ESEA 2Y9UA 1SXDA 3HILA 4PZNA 2L5YA 2LPEA 5JTIA 5JU5A 2F8KA 2E8MA 1Z1VA 2QKQA 2K60A 2QARB 4NL9A 1SV4A 3BQ7A 2K4PA 3BS7A 1OW5A 1UCVA 1X9XA 3BS5A 4MHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV0 C;  3IDW A;  5L1M A;  1COK A;  5J8Y A;  2DKZ A;  2KSO B;  2EAP A;  2D3D A;  2KSO A;  5KNI A;  2DKX A;  5F3X B;  2QAR A;  2FE9 A;  1B0X A;  1LKY B;  2KE7 A;  2GLE A;  3KKA A;  1DXS A;  1SXE A;  1PK1 B;  1V85 A;  2Y9T A;  2KG5 A;  2JV3 A;  4NJ8 A;  4RQM A;  3TAD C;  1OXJ A;  1KW4 A;  3K1R B;  5JRT A;  1B4F A;  2QB1 A;  3TAC B;  2E8P A;  1V38 A;  2YTU A;  1LKY A;  2DL0 A;  2F3N A;  2D8C A;  1PK1 A;  1JI7 A;  4NL9 C;  1WWU A;  2EAM A;  1SGG A;  3H8M A;  2LMR A;  2E8N A;  2KMD A;  4RQN A;  3KKA C;  1F0M A;  2B6G A;  1SV0 A;  1UQV A;  2F44 A;  1WWV A;  2ES6 A;  2EAN A;  1X40 A;  3TAD A;  2KIV A;  4IS7 A;  1PK3 A;  2EAO A;  2E8O A;  3SEN A;  1RG6 A;  3BS5 B;  2QB0 B;  4PZO A;  5J8Y C;  2QB0 A;  1X66 A;  3SEI A;  2ESE A;  2Y9U A;  1SXD A;  3HIL A;  4PZN A;  2L5Y A;  2LPE A;  5JTI A;  5JU5 A;  2F8K A;  2E8M A;  1Z1V A;  2QKQ A;  2K60 A;  2QAR B;  4NL9 A;  1SV4 A;  3BQ7 A;  2K4P A;  3BS7 A;  1OW5 A;  1UCV A;  1X9X A;  3BS5 A;  4MHV A; 
#chains in the Genus database with same CATH topology
 3MR5 A;  2C2D A;  4B9M A;  4DL3 A;  5DGB A;  2LHT A;  4F2R A;  2J6U A;  5KG5 A;  2RRD A;  3AU6 A;  3F5A A;  7ICT A;  2XGP A;  2BPG A;  3V6H A;  1L3T A;  1B0X A;  4C4R A;  5BPC A;  3OJS A;  3M9N B;  3KTQ A;  1DXS A;  1TKD A;  4PHA A;  1SXE A;  1PK1 B;  3THV A;  2IHN A;  1N56 A;  4B9L A;  4QZC A;  4KLT A;  1TK0 A;  8ICO A;  3TAD C;  3UM9 A;  4PJ0 U;  4F5Q A;  3K1R B;  2QB1 A;  4F4Z A;  2Z7J A;  3NS1 A;  2DUY A;  5J0W A;  3Q8P B;  3RAX A;  4DQQ A;  8ICQ A;  2KTQ A;  3NRW A;  3TAR A;  1X9S A;  1WG8 A;  1GO3 F;  1MN8 A;  2EDU A;  3BJY A;  3QX7 A;  2BHN A;  9ICN A;  3AQE A;  4UAY A;  1SV0 A;  2KK0 A;  9ICH A;  1TAM A;  3QUC A;  4ACO A;  4C80 A;  4QW9 A;  2KIV A;  4FZL A;  2AU0 A;  2I6X A;  1U49 A;  2KJ9 A;  2HHT A;  4ECW A;  4DFJ A;  3JPT A;  1SXD A;  2G5I B;  3FDS A;  1V97 A;  4X5V A;  1NK6 A;  2RDI A;  2W43 A;  5ALR A;  4LJX A;  2ZIW A;  2W9B B;  1Z1V A;  3EYZ A;  5G5H A;  1QSL A;  4O5E A;  2JGA A;  4GXI A;  2PI5 A;  2W9C A;  4GIB A;  2PKE A;  3M9O B;  3BQ0 A;  4ECX A;  1RM6 C;  4FO6 A;  3BZC A;  1D8B A;  2W04 A;  4YMM A;  4QW8 A;  4RUC A;  5KFQ A;  4I28 A;  4M6W A;  3HX0 A;  4IQV A;  1ZRN A;  2XCP A;  1QQ5 A;  3SZ2 A;  4P0Q A;  3C28 A;  4LZG A;  3C23 A;  3ISB A;  2BGW A;  2JZB B;  3NAS A;  2NRV A;  2EZX A;  2F77 X;  4EX7 A;  3IHQ B;  2WTF A;  4AP9 A;  3RJJ A;  3V7L A;  3QNM A;  3F5E A;  4M2Y A;  1KW4 A;  5DBC A;  2JEG A;  3SR6 A;  3AN1 A;  1RDF A;  9ICK A;  9ICA A;  4DOC A;  1NJY A;  5J2B A;  1KSP A;  2ASJ A;  4OJ5 A;  4B6J A;  4JUZ A;  5J2A A;  2F3N A;  2JEI A;  7ICG A;  1JI7 A;  5ALW A;  3RTV A;  3NVV A;  2WAQ C;  4NL9 C;  4Q8F A;  3AU2 A;  9ICU A;  1WCL A;  2FMP A;  2KMD A;  1NJZ A;  3LVW A;  1A0P A;  1NZP A;  3LK9 A;  4OJO A;  1NK5 A;  4R8U A;  4KLO A;  5L9X A;  1L7O A;  7ICK A;  2KIW A;  1MQ2 A;  4I2J A;  2D6F C;  4UB8 U;  2CN1 A;  4RZR A;  5B66 U;  3SYZ A;  4QWA A;  3E0F A;  4ED1 A;  3BZK A;  2BCR A;  1OUQ A;  2W3S A;  4ECV A;  2WB1 C;  3SV4 A;  4UW9 A;  4JMU A;  4US9 A;  5KFK A;  3SMV A;  2W9C B;  2BQ3 A;  1FEZ A;  4YFK A;  3HRD D;  2W54 A;  8ICG A;  2VJ4 A;  9ICI A;  5J0T A;  5DG7 A;  2P35 A;  1ZQV A;  2AH5 A;  4M6W B;  3QYP A;  4IR1 A;  4O3S A;  4O3Q A;  4GC7 A;  4KLF A;  3ED5 A;  4P0Q B;  4DSE A;  5J0R A;  3RRG A;  4KMU A;  3KKA A;  4TUQ A;  1Z3E B;  2YY6 A;  5KT5 A;  3F53 A;  5AM0 A;  5HHH A;  3AQF A;  2JV3 A;  2FLN A;  4NJ8 A;  2JMG A;  3F2B A;  2MA1 A;  1ZQA A;  4UBB A;  1JXL A;  5DDM A;  1ZJN A;  3A0B U;  3T79 A;  2KFN A;  1NJW A;  1D9D A;  2M0N A;  4DFD A;  5J2I A;  5KFA A;  1U47 A;  4BX9 C;  3PR5 B;  2UVU A;  3IRU A;  3EPI A;  3QU5 A;  4Z6F A;  5KG0 A;  1ZQC A;  1MC8 A;  5AKI A;  4KLG A;  3RF9 A;  3C2L A;  2B6G A;  5CWR A;  5DGA A;  5H2F U;  5KFT A;  3MBY A;  2E8O A;  4F50 A;  1ZET A;  4B9S A;  1XSL A;  5J2J A;  1B43 A;  5AHX A;  3PX6 A;  4PGQ A;  3PST A;  3QU4 A;  3LVV A;  2HHQ A;  4MFF A;  3BDP A;  4ED3 A;  5ALX A;  5III A;  4I2E A;  3HIL A;  7ICL A;  1K1Q A;  8ICM A;  1KFS A;  4F8R A;  1S97 A;  2LYH A;  7ICS A;  3N28 A;  4RQ4 A;  3R9K A;  2QKQ A;  4EX6 A;  3IN5 A;  1XNS A;  3ZD8 A;  3ZDB A;  2WF5 A;  5HR7 A;  4JWM A;  3N97 B;  1YZ6 A;  2BCU A;  1LVH A;  1NK9 A;  3QEB Z;  5J29 A;  5IIM A;  3GV5 B;  2KIC A;  2Y0S F;  5AKY A;  1UT8 A;  2FJ6 A;  5IIL A;  5DLG A;  1ZXI A;  4WJ3 B;  3GDX A;  1HJP A;  2ZJ5 A;  1U9L A;  1D9F A;  1RQL A;  1ZQI A;  4J9O A;  3KOO A;  8ICU A;  5ALE A;  3KBB A;  2YB4 A;  1CEZ A;  5ALJ A;  3BQT A;  9ICP A;  2PI4 A;  2NRX A;  2HOF A;  5KG7 A;  1QQ6 A;  2BCV A;  3RJG A;  2H3F A;  3HW8 A;  9ICF A;  4QZE A;  1X42 A;  4O3P A;  2VAN A;  2AGP A;  2KJ8 A;  4I2I A;  3GIJ A;  5ALP A;  2AXT U;  4QWE A;  1QSS A;  2HOI A;  4F92 B;  3LWL A;  4J9R A;  2HI0 A;  2E3T A;  5AKG A;  1F5S A;  1ZQZ A;  2YMQ A;  4J9N A;  4BXO B;  3TAD A;  3HKZ C;  1ZQO A;  4OCZ A;  3UMB A;  2XID A;  4PZO A;  1QH9 A;  2NO5 A;  5DQG A;  1MSW D;  3SAH A;  4MFA A;  1Z19 A;  5HR6 A;  5KT4 A;  1PZN A;  4Q45 A;  3VCB A;  4Z6C A;  4CNQ A;  1O08 A;  2ZIU B;  1BPD A;  2E8M A;  1XU4 A;  4RT3 A;  4Z6E A;  4TQS A;  2R8J A;  3B0X A;  2HBL A;  4YR3 A;  2FMS A;  4IRK A;  3V7K A;  3GQC A;  1DK3 A;  1NK7 A;  2MAX A;  4F93 B;  5J0O A;  1JXE A;  2I9G A;  3L5K A;  5KFX A;  8ICP A;  4MEX A;  2AGO A;  3RRH A;  2OWO A;  2G09 A;  3SAG A;  4F5P A;  1ZQY A;  4C8M A;  4QZF A;  4FS1 A;  3PW2 A;  3LWM A;  3RB4 A;  4XRH A;  4KN7 A;  2LBO A;  3BQ1 A;  3RBD A;  2W8K A;  1L3V A;  2ZTE A;  3H0M B;  3ETR A;  5AM2 A;  3Q8S B;  3GII A;  3C2M A;  3H8W A;  4Y2R A;  5F9L A;  3MGI A;  1JX4 A;  5JRT A;  2YN4 A;  4DL2 A;  4FZN A;  1T8E A;  5AKX A;  5KFV A;  5BOL A;  4EZ9 A;  9ICS A;  4YG2 A;  4C7Y A;  1N5W A;  4QZH A;  2OH2 A;  2NRT A;  3UQ0 A;  4DQS A;  3QE9 Y;  1PK1 A;  4KTQ A;  3ZD9 A;  2HCF A;  4P4O A;  3H8M A;  3F2C A;  2PFP A;  1BPY A;  4UAT A;  3Q8L A;  2F44 A;  3ALR A;  4KLU A;  4MF8 A;  5HHI A;  4UAZ A;  2YB1 A;  2KD1 A;  5B5E U;  5D49 A;  3C2K A;  2P6R A;  3QU9 A;  8ICH A;  4Q44 A;  3OPX A;  7ICF A;  1SIJ A;  2W03 A;  5AM5 A;  1T7P A;  1TAU A;  5JU5 A;  4ELU A;  3AMZ A;  4C8L A;  4NL9 A;  5ALN A;  5KTQ A;  2NRW A;  2W3R A;  2UVV A;  4HAI A;  3RFA A;  4DFP A;  3E2E A;  4EBC A;  1UCV A;  4CF4 A;  2K4E A;  2OM6 A;  4DEZ A;  5ALD A;  1BPB A;  1SL1 A;  1SKR A;  4B9T A;  1COK A;  4BWJ A;  3QUB A;  3MR2 A;  1A76 A;  2KSO A;  3RBE A;  5DB9 A;  5AK4 A;  4UB5 A;  3OSN A;  1NKC A;  2W9B A;  3PSF A;  4G3I A;  9ICL A;  4NV0 A;  4DF4 A;  7ICE A;  4DWI A;  3T5L A;  2PFO A;  4P0P B;  1V85 A;  3IG5 A;  1LB2 B;  3OSP A;  4RQM A;  1OXJ A;  3BQ2 A;  2JXJ A;  2E5S A;  3PMN A;  3OHA A;  4QZ8 A;  5L1L A;  4ICA A;  4DCC A;  5KFO A;  3ONN A;  4DFK A;  2NO4 A;  2V9W A;  5L1J A;  2W7O A;  5ALS A;  2P66 A;  4I2G A;  2JZB A;  4EEY A;  1BNP A;  3VC8 A;  2NV3 A;  2BDU A;  4FZM A;  1J97 A;  1SL0 A;  4DOB A;  3FAH A;  1NJX A;  1DK2 A;  1XO1 A;  5J2G A;  1ZQN A;  3UMG A;  3UXO A;  3Q8R B;  3LDA A;  2ES6 A;  2FLP A;  2W8L A;  3NVZ A;  4Q43 A;  1ZD5 A;  4QJF B;  3PSI A;  1TFR A;  1PVR A;  2ISO A;  1X66 A;  5T14 A;  4P4M A;  4USA A;  1XO0 A;  2NRZ A;  1ZD4 A;  3IG8 A;  4FS2 A;  4DSF A;  4PZN A;  2IMW P;  2AJQ A;  3RJK A;  5KT6 A;  1N62 A;  2G08 A;  4UAR A;  4B9N A;  2WF9 A;  4J03 A;  4NXZ A;  1UT5 A;  1MA7 A;  1M6Y A;  5ALL A;  1BPX A;  3HP6 A;  5KFH A;  4RPY A;  1L6N A;  1NI3 A;  2R8G A;  3N7S C;  5TZV A;  2UVR A;  2PFQ A;  5CEH A;  1QCK A;  4JB3 A;  4XUS A;  1ZQM A;  2G0A A;  3PZP A;  2AQ0 A;  3TI0 A;  4EEL A;  2KSO B;  2HW3 A;  3NVY A;  2AHO B;  4DO9 A;  4G9B A;  3NUQ A;  3V6K A;  4P2H A;  4DOA A;  1JUD A;  5J0Q A;  4UB4 A;  3CNH A;  4NWI A;  2WHE A;  5KFZ A;  3WKE A;  4R66 A;  5KFM A;  4FE3 A;  7ICV A;  4PGY A;  2K89 A;  3SQI A;  5AI5 A;  4OD0 A;  4YD1 A;  1ZQD A;  4EEN A;  2W7P A;  3NTU A;  2KHQ A;  2Y1J A;  3N7R C;  1NK8 A;  2WAQ F;  5J0X A;  2ZTC A;  4LZD A;  8ICN A;  1WWU A;  1JN3 A;  5G5G A;  4J9L A;  2LMR A;  2E8N A;  3IP4 B;  1U45 A;  4O9M A;  2EQY A;  8ICK A;  5AK5 A;  3F2D A;  1KDH A;  1PUZ A;  4KLM A;  8ICS A;  1L8O A;  3PSP A;  3TAQ A;  2KVS A;  1PK3 A;  2EAO A;  2NYV A;  3PW4 A;  3H4B A;  4UAW A;  4F5O A;  2WB1 F;  3QU7 A;  4UQG A;  1KBU A;  4PL2 A;  3OGU A;  5JTI A;  1RXV A;  8ICW A;  2R8I A;  7ICU A;  1VJ5 A;  3PNC A;  2VIX A;  2YX8 A;  5DG9 A;  4YQW A;  2F1J A;  1KLN A;  4JWN A;  5KT3 A;  3OHB A;  4EBD A;  1ZQS A;  4OJ6 A;  3MGH A;  4M0A A;  4I2F A;  4F71 A;  1NOM A;  2YMP A;  2DKZ A;  3PX0 A;  2Q4T A;  5CHG A;  1T3Q A;  1ZQT A;  5ALV A;  4DQR A;  4RQ0 A;  8ICX A;  2K8C B;  2C2R A;  5ALK A;  4M04 A;  1FFU A;  3OJU A;  2KEY A;  5KFI A;  1COO A;  1XC9 A;  2XIC A;  3Q8M A;  4QZI A;  1X9W A;  4QWC A;  1WCN A;  2ZIV B;  3EPG A;  1Q3U A;  3MR3 A;  4RQ7 A;  3KZI U;  4MEY A;  2QLT A;  5C5J A;  9ICT A;  1AQ6 A;  2BCS A;  5KG3 A;  1J2M A;  2HHS A;  2VJ5 A;  2DL0 A;  5KFR A;  4R65 A;  4DS5 A;  3PX4 A;  4O3M A;  5JUM A;  1NZB A;  4C0Z A;  1DRG A;  1KFT A;  2F1I A;  4JV1 A;  4RPZ A;  3WKD A;  2HMX A;  4PGX A;  1ZQL A;  3EWA A;  2JEF A;  4M9L A;  5HNK A;  3AUO A;  2ISP A;  3QZ8 A;  5EE9 A;  1ZQE A;  2JR5 A;  5J0P A;  1HUZ A;  1ZD2 P;  3ISD A;  2LKY A;  4KMO B;  5ALQ A;  4BXO A;  2A19 A;  4ELV A;  4RQ2 A;  3WK7 A;  3C29 A;  2GH1 A;  4C8N A;  4J9P A;  2MUT A;  1SV0 C;  5KFE A;  3QEA Z;  1SWW A;  4EYH B;  4QIW C;  4DL6 A;  1KQQ A;  4YD2 A;  2ZIU A;  3SI8 A;  5ALZ A;  3M8R A;  4NM2 A;  3AEV A;  4DLE A;  2K8A A;  2FI1 A;  4PHP A;  5AIB A;  3D2N A;  3A0H U;  3WKC A;  1ZQG A;  4C4S A;  2ASL A;  5ALU A;  2HHX A;  5HP4 A;  5AKH A;  4M9H A;  3K4G A;  1YT3 A;  1ZQH A;  2LI6 A;  2VKQ A;  1KFD A;  1ZQK A;  4IRC A;  5HMM A;  3TFS A;  1N2X A;  2B21 A;  4RNM A;  9ICC A;  4ED8 A;  1DGS A;  4QWD A;  1N60 A;  4ED6 A;  5DB6 A;  4F91 B;  2A1J A;  4EYI B;  4IRD A;  4R63 A;  2YMM A;  2AQ4 A;  2EAM A;  2V4Q A;  5CB1 A;  4M9G A;  1BPE A;  3HKZ F;  7ICJ A;  5KG1 A;  2O6K A;  9ICJ A;  4DF8 A;  3JPQ A;  1Q3V A;  4BDP A;  2I5H A;  1TK5 A;  4P4P A;  4I2B A;  3RB6 A;  3PY8 A;  2VA8 A;  1X6I A;  2JHD A;  1RG6 A;  3KFU F;  4DQI A;  2YML A;  2DQN B;  5ALY A;  4BJQ A;  2ESE A;  2Y9U A;  4F3O A;  1S8O A;  2OYY A;  2C28 A;  2VA2 A;  4NLN A;  2KOB A;  4ECQ A;  5KFP A;  9ICX A;  4J9K A;  4Y2V A;  5AIA A;  1RZT A;  1Z00 B;  2H3Q A;  2FPK A;  1WUD A;  4NLB A;  4I2A A;  4KLL A;  3PO5 A;  1F44 A;  8ICZ A;  9ICR A;  4J9M A;  3UQ2 A;  4GFJ A;  3M6K A;  7ICH A;  2MUT B;  4DL5 A;  2DFL A;  2OEH A;  4OJP A;  1DOQ A;  1NKB A;  8ICC A;  4ECY A;  4I2C A;  1ZD3 A;  4HYK A;  3K1Z A;  4Y2J A;  3CRX A;  4JV0 A;  2B0C A;  4U6P A;  4UB3 A;  5KG2 A;  1L7N A;  3KZX A;  5DBB A;  1SB3 C;  1S77 D;  1Z4O A;  2HVH A;  2IBK A;  5J0U A;  1K5O A;  2YQE A;  5TIS U;  1D8Y A;  5J0Y A;  2AGQ A;  1NK4 A;  3Q8Q B;  2HSZ A;  3V6J A;  4XQ8 A;  4RQ6 A;  5CR0 A;  4KLD A;  3TFR A;  1X9M A;  4B9U A;  3ZDD A;  8ICA A;  1B4F A;  3JPR A;  5AI9 A;  5EWE A;  4F4W A;  5KFS A;  2E8P A;  1A77 A;  4KLS A;  4TUP A;  5D46 A;  3D6J A;  3M1Y A;  1L8L A;  1ZOL A;  2ZIX B;  2A1J B;  4GLX A;  4P0P A;  3RR8 A;  3B9J A;  5AKZ A;  3GU3 A;  2H3I A;  5AKE A;  4C8K A;  4TUS A;  1FIQ A;  3KKA C;  5K4L A;  1ZQW A;  4JK1 A;  4Z6D A;  2A3V A;  3TQ1 A;  1X40 A;  1CRX A;  1A6S A;  2XY5 A;  1N61 A;  4I2D A;  3QUT A;  9ICG A;  1N48 A;  1S9F A;  2LYA A;  3SV3 A;  2QB0 A;  4ED0 A;  3DDH A;  2Q0Z X;  4TUR A;  4KIT B;  8ICL A;  4KX5 A;  4ED7 A;  3KHH A;  2DPJ A;  5KG4 A;  4YP3 A;  4KX3 A;  5GTI U;  2GO7 A;  5KFC A;  2F76 X;  1TAQ A;  2BDP A;  2K4P A;  5AM4 A;  5J2K A;  3QXG A;  2PMZ F;  2WF7 A;  5CA7 A;  3QU2 A;  2DPI A;  4R64 A;  4MFC A;  1ZQX A;  2FLL A;  4RT2 A;  4F5R A;  1ZQU A;  5EWF A;  2KZ3 A;  2HHU A;  1SZP A;  2ASD A;  3PVX A;  1UA1 A;  5KFG A;  4OO1 J;  2KKV A;  3KHG A;  2G5H B;  4F5N A;  2KZM A;  2KVC A;  1U48 A;  1UHU A;  4KN4 A;  3U26 A;  3T5J A;  4ZOH C;  5AI6 A;  7ICO A;  2PMZ C;  2DGZ A;  2J6T A;  3S6J A;  3M8S A;  5C0Y A;  3M6Z A;  4KLI A;  5IIN A;  4PL1 A;  2EH9 A;  2OCE A;  3UXP A;  1H38 A;  3MFH A;  3WU2 U;  4UAS A;  5AKJ A;  4RPX A;  1C20 A;  2M9N A;  5BOM A;  5DDY A;  3RH4 A;  2WF6 A;  2BZF A;  5EE0 A;  2DBY A;  5AI8 A;  3TKA A;  2BCQ A;  1X2I A;  1ED1 A;  2K4I A;  1FO4 A;  5KFD A;  2D8C A;  4EEK A;  4OJL A;  4YN4 A;  1D8L A;  4M47 A;  2A1A A;  5L1K A;  1UQV A;  1WWV A;  1ZJM A;  5DQI A;  4YR2 A;  3CW2 C;  2R8K A;  4IS7 A;  3AL0 B;  2E1F A;  3T5H A;  1JRO A;  1S5L U;  1IIP A;  5AI0 A;  2QB0 B;  3RH5 A;  5J8Y C;  3T3F A;  3GIM A;  2J6S A;  5KAI U;  3SEI A;  2EZY A;  3ICX A;  1Z4N A;  3M7D A;  2HOQ A;  4JV2 A;  3PV8 A;  4CGZ A;  2HVI A;  2F8K A;  3MGV A;  3LYS A;  3OTQ A;  2QAR B;  1FFV A;  3TAN A;  4ECS A;  1BPZ A;  4UB2 A;  2BPF A;  2RHF A;  5ALO A;  3NRZ A;  2PFN A;  5IIO A;  4YXJ A;  4FFD A;  2WFA A;  3FYH A;  3ORY A;  1IM4 A;  1L3U A;  2IA6 A;  1S0V A;  1RYR A;  4C8O A;  2KHV A;  4PHD A;  4BWM A;  2ZJA A;  7ICN A;  1LKY B;  2GLE A;  5J2E A;  3EZ5 A;  1J2N A;  2ZUC A;  2FMQ A;  2KZZ A;  3QUQ A;  3C5F A;  4DQP A;  4K4I A;  3CP8 A;  3RJI A;  2ZTD A;  5J2D A;  5AM1 A;  8ICI A;  1V9P A;  5KFJ A;  1SKW A;  1HEK A;  4RQ1 A;  1XWL A;  3WK5 A;  4IQU A;  4NM1 A;  1S10 A;  2HBJ A;  4NY8 A;  2JRZ A;  2KV2 A;  4E0D A;  4F4X A;  2KKP A;  4YR0 A;  2VA3 A;  3N4M B;  2MU2 A;  3H40 A;  1L3S A;  2H3Z A;  3RH6 A;  3B0Y A;  5CP2 A;  3E58 A;  1VDV A;  1ZQR A;  2ZIV A;  1ZQ1 C;  3SD7 A;  3SEN A;  3BS5 B;  8ICT A;  2HHW A;  2C22 A;  1ARO P;  2ZXH A;  1JRP A;  1IXR A;  1T4G A;  4C4T A;  2ZG6 A;  1T94 A;  1QLN A;  1S0O A;  2L5Y A;  2LPE A;  9ICO A;  1BGX T;  3H4D A;  4K4G A;  4UAU A;  1WYG A;  4ECR A;  4KLE A;  2OHF A;  5EOZ A;  5DB8 A;  3GIL A;  3MFI A;  4M9N A;  8ICF A;  4QWB A;  3V72 A;  1OW5 A;  9ICB A;  4KLJ A;  1L7M A;  3MAB A;  1ZQF A;  2W55 A;  4MHV A;  5GTH U;  2ZUD A;  4IL6 U;  3DEE A;  3WK8 A;  3WKA A;  4US8 A;  3J81 j;  1RPL A;  3WK6 A;  4O5C A;  3H8J A;  2MRL A;  8ICV A;  4YVZ A;  5L1I A;  4F4Y A;  4F72 A;  8ICB A;  4NLZ A;  4O3R A;  5ALT A;  1JIH A;  1KEJ A;  7ICQ A;  1SL2 A;  1Y88 A;  4CF5 A;  5J0S A;  3WK4 A;  2CXY A;  2F8L A;  3H0L B;  5KT7 A;  1JAL A;  1DGJ A;  1CUK A;  2XY6 A;  2GWS A;  1JMS A;  4CRX A;  2ATL A;  3IV6 A;  2W11 A;  4KLH A;  2XO7 A;  2LM1 A;  3ZDE A;  4ELT A;  7ICR A;  3HJE A;  2K4H A;  3I28 A;  4UAV A;  5DBA A;  5AM3 A;  3PW0 A;  3GV7 B;  4DSJ A;  1ZRM A;  3G6Y A;  3QZ7 A;  4O0I A;  2LYB A;  3H0R B;  1ZQP A;  5KFN A;  2RLT A;  5ALH A;  5ALF A;  2IOF A;  1ECW A;  5HML A;  2ZIW B;  1NNL A;  2OXO A;  1F0M A;  2FPM A;  9ICW A;  3I76 A;  5J2F A;  3SAF A;  5DKW A;  7ICP A;  3KD3 A;  1PVQ A;  1HIW A;  4CF3 A;  5KT2 A;  2RP5 A;  4J9S A;  3MDA A;  4IR9 A;  1XS9 D;  1IV8 A;  4UB1 A;  3UPQ A;  2G06 A;  1SZH A;  1SV4 A;  4QZ9 A;  1MQ3 A;  2MSN A;  3M9M B;  4AYB F;  1L7P A;  2BKE A;  1BNO A;  4PHE A;  3JPN A;  3JPO A;  4QIW F;  3FC4 A;  4IQW A;  2KNJ A;  4QZB A;  3IDW A;  4NLC A;  1C7Y A;  4QNL A;  1KL9 A;  3RJF A;  2D3D A;  3ZDA A;  3HPO A;  5IIJ A;  2PXI A;  2DKX A;  5F3X B;  2FE9 A;  4QZA A;  5CRX A;  1CI4 A;  1Z00 A;  4U7C A;  1KKX A;  2XGQ A;  2JH7 A;  2KP7 A;  5EE1 A;  3DV9 A;  3I1Y A;  2Y9T A;  1P7D A;  4AYB C;  3C1Z A;  1T3N A;  2LM4 A;  5KL8 B;  3HT3 A;  8ICJ A;  4R8U B;  3NVW A;  4ECT A;  5ALG A;  1N63 A;  2K8B B;  2KFZ A;  5J2C A;  2G07 A;  5E79 U;  2YTU A;  5FP0 A;  9ICV A;  4RQ5 A;  2KJ5 A;  4TQR A;  2HBK A;  3EW9 A;  1IG6 A;  3L3F X;  4DSK A;  3GV8 B;  3C1Y A;  4UBC A;  2XI9 A;  1O03 A;  4BUG A;  4DL4 A;  4RQN A;  4ED2 A;  3D2Q A;  2FDR A;  1ZQQ A;  3JPS A;  1ZQJ A;  4NLK A;  1RYU A;  5KFF A;  5F9N A;  1Q8K A;  2DWQ A;  5KFY A;  4GXK A;  1N5X A;  1SWV A;  2XCA A;  1U4B A;  5KFL A;  4Y2P A;  2DF4 B;  2ZIX A;  1RXW A;  9ICE A;  3AM9 A;  3UMC A;  2C2E A;  5KG6 A;  9ICM A;  1EXN A;  3PW5 A;  3T5K A;  2H5X A;  4QZD A;  1XSN A;  3C21 A;  2BR0 A;  3RJE A;  4B9V A;  5KFW A;  2R18 A;  3BQ7 A;  3PML A;  2HDO A;  4ECZ A;  4DSL A;  2V4R A;  3FM9 A;  5DLF A;  3WKB A;  2IOH A;  1TE2 A;  7ICM A;  2JEJ A;  2IHM A;  2JH1 A;  1VLB A;  5L1M A;  5AK3 A;  5J8Y A;  5EWG A;  4Y2Y A;  3RR7 A;  2F1H A;  5KNI A;  8ICE A;  1ZQB A;  4DS4 A;  4XA5 A;  4YMN A;  4DL7 A;  2Y0S C;  4NLG A;  1QTM A;  3RAQ A;  2KE7 A;  4Y2T A;  2XC9 A;  5AKK A;  2BQR A;  5DQH A;  2ZXI A;  2F2A B;  4RU9 A;  3ISC A;  4CDG A;  4EZ6 A;  3D2S A;  4CCH A;  5CJ7 A;  3GIK A;  3ETL A;  2KN7 A;  3H7I A;  3G6V A;  1QSY A;  4M9J A;  4F4K A;  4PH5 A;  8ICR A;  4Y2X A;  1V38 A;  5KAF U;  4IC9 A;  5KFB A;  4Q8E A;  1RQN A;  3H8S A;  4I2H A;  5KL1 B;  4J9Q A;  2P6U A;  3RB3 A;  4Y2Q A;  3ZI4 A;  4FBT A;  1XSP A;  3MR6 A;  3KHL A;  1Q46 A;  3EUB 2;  4K4H A;  1K1S A;  2ODG A;  3ZDC A;  9ICQ A;  1PVP A;  2IOF K;  3CYM A;  2HBM A;  4YCX A;  3MDC A;  4I29 A;  2EAN A;  5AI4 A;  4O3O A;  2HHV A;  3RJH A;  2UVW A;  2I1Q A;  2N1R A;  4KLQ A;  5DB7 A;  1LV5 A;  3UXN A;  2WF8 A;  4YXM A;  1TV9 A;  1X6J A;  3GZF A;  1KN5 A;  2W9M A;  3JPP A;  2K60 A;  2EZZ A;  4I27 A;  1QQ7 A;  4CE6 A;  1NK0 A;  2RDJ A;  2ZUB A;  4Y2S A;  4GC6 A;  1X9X A;  3O0F A;  2XY7 A;  4Y2U A;  4ECU A;  2ALZ A;  1URJ A;  4DSI A;  3PR4 A;  1S0M A;  1HUO A;  5AIC A;  1UPH A;  5J2H A;  3KHR A;  1KRP A;  2EAP A;  5EE3 A;  5AKL A;  5ALI A;  5DG8 A;  1TVA A;  2XVT A;  2QAR A;  4RQ8 A;  4RUA A;  1UA0 A;  2E1E A;  3G6X A;  3HWT A;  4PPX A;  4YMO A;  2KG5 A;  5AK6 A;  2GOL A;  3NGD A;  5ALM A;  3V7J A;  3MC1 A;  3TAP A;  3C5G A;  4O5K A;  1Z1B A;  3TAC B;  2BQU A;  2FPL A;  4C7Z A;  5A0L A;  1LKY A;  1S76 D;  3GFK B;  4MF2 A;  3RB0 A;  4O3N A;  3PW7 A;  2H3V A;  1SGG A;  1RYS A;  4EBE A;  4DFM A;  4RQ3 A;  4GXJ A;  4FBU A;  3WK9 A;  4BGD A;  3PO4 A;  3IM1 A;  5KFU A;  2RQ5 A;  1B22 A;  4QZG A;  4LVS A;  4UB6 U;  2Y1I A;  4F2S A;  5D4B A;  1SKS A;  5IIK A;  4IQT A;  3Q8K A;  8ICY A;  2CPR A;  3K75 D;  4ZH4 A;  1ZYQ A;  7ICI A;  4DLG A;  2BPC A;  2W9A A;  1BVS A;  1NKE A;  1L5U A;  2CRX A;  3L4P A;  1S0N A;  4RNN A;  2R8H A;  3BS7 A;  1KTQ A;  1YZ7 A;  3N7P D;  4RNO A;  4A8E A;  2ZJ8 A;  3BS5 A;  1TK8 A; 
#chains in the Genus database with same CATH homology
 1SV0 C;  3IDW A;  5L1M A;  1COK A;  5J8Y A;  2DKZ A;  2KSO B;  2EAP A;  2D3D A;  2KSO A;  5KNI A;  2DKX A;  5F3X B;  2QAR A;  2FE9 A;  1B0X A;  1LKY B;  2KE7 A;  2GLE A;  3KKA A;  1DXS A;  1SXE A;  1PK1 B;  1V85 A;  2Y9T A;  2KG5 A;  2JV3 A;  4NJ8 A;  4RQM A;  3TAD C;  1OXJ A;  1KW4 A;  3K1R B;  5JRT A;  1B4F A;  2QB1 A;  3TAC B;  2E8P A;  1V38 A;  2YTU A;  1LKY A;  2DL0 A;  2F3N A;  2D8C A;  1PK1 A;  1JI7 A;  4NL9 C;  1WWU A;  2EAM A;  1SGG A;  3H8M A;  2LMR A;  2E8N A;  2KMD A;  4RQN A;  3KKA C;  1F0M A;  2B6G A;  1SV0 A;  1UQV A;  2F44 A;  1WWV A;  2ES6 A;  2EAN A;  1X40 A;  3TAD A;  2KIV A;  4IS7 A;  1PK3 A;  2EAO A;  2E8O A;  3SEN A;  1RG6 A;  3BS5 B;  2QB0 B;  4PZO A;  5J8Y C;  2QB0 A;  1X66 A;  3SEI A;  2ESE A;  2Y9U A;  1SXD A;  3HIL A;  4PZN A;  2L5Y A;  2LPE A;  5JTI A;  5JU5 A;  2F8K A;  2E8M A;  1Z1V A;  2QKQ A;  2K60 A;  2QAR B;  4NL9 A;  1SV4 A;  3BQ7 A;  2K4P A;  3BS7 A;  1OW5 A;  1UCV A;  1X9X A;  3BS5 A;  4MHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...