1PK1B

Hetero sam domain structure of ph and scm.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
b'RSQPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLRLNSERMMKYMGLKLGPALKICNLVNKVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyhomeotic-proximal chromatin protein
publication title Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repression
total genus 23
structure length 70
sequence length 70
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1pk1B00
1UCVA 2DKZA 3TADA 1COKA 2E8MA 3IDWA 5JU5A 1SXDA 2DL0A 2EANA 1X9XA 1OW5A 2QARB 5JTIA 1SXEA 1WWUA 2L5YA 3BS5B 2Y9UA 3HILA 2ESEA 2QB1A 3SEIA 1B0XA 2QB0A 1SV0A 4MHVA 2KG5A 2KMDA 2F8KA 3KKAA 3K1RB 2QARA 1PK1B 4IS7A 3H8MA 1DXSA 1SV4A 1LKYB 4PZOA 2D3DA 3BS5A 2DKXA 3TADC 2EAOA 2F3NA 2KIVA 2LPEA 1KW4A 5J8YA 1PK1A 2F44A 1F0MA 1SGGA 2B6GA 4PZNA 2KSOB 1B4FA 2E8PA 4NL9C 4NJ8A 5KNIA 5JRTA 1X40A 1X66A 5L1MA 2KSOA 3KKAC 2K4PA 2E8OA 1RG6A 3BS7A 1PK3A 2Y9TA 4RQNA 1WWVA 2KE7A 2LMRA 4RQMA 1V85A 3SENA 1UQVA 2EAMA 1LKYA 2QB0B 1V38A 2FE9A 2QKQA 3TACB 2K60A 1OXJA 5J8YC 2YTUA 4NL9A 2EAPA 3BQ7A 1SV0C 5F3XB 2GLEA 2JV3A 2D8CA 1JI7A 2ES6A 1Z1VA 2E8NA
chains in the Genus database with same CATH superfamily
1WCLA 1UCVA 5AI0A 2EZXA 3GZFA 2DF4B 8ICVA 4ED1A 5TZVA 3HP6A 1JMSA 1ZOLA 1TAMA 2RDIA 2QARB 4BJQA 3UMGA 4R63A 1N5WA 3PW0A 5IINA 4F92B 2H5XA 2BHNA 4QZ9A 4RPZA 2QB1A 4QZ8A 5KT4A 5KT7A 1ZQFA 3IN5A 3KZXA 9ICTA 4DSLA 5ALYA 2DUYA 1BPEA 3PR4A 2BQUA 2OH2A 4YP3A 4RNNA 4X5VA 4OJLA 2XICA 3RB0A 1JX4A 1CUKA 5IIIA 5HMLA 3UXOA 1SKWA 4YQWA 1ZQNA 1B4FA 3THVA 4UW9A 9ICFA 1ZD4A 1ZQJA 2DPIA 4O3MA 4O3PA 4M9LA 3C28A 1SL1A 1X6IA 5AKJA 5KFOA 3JPTA 2AXTU 2CPRA 4EZ9A 2ASDA 4ECQA 2XY7A 9ICAA 4DL4A 2KHVA 3PY8A 2JRZA 5C0YA 5L1MA 3QUQA 5AI4A 4YD2A 5KFRA 4JMUA 8ICAA 1RG6A 4BDPA 1ZQSA 4RUCA 2KE7A 4O5EA 2PMZC 2W9MA 3WKCA 1LKYA 4DFMA 1NK5A 5DLGA 3H8JA 4I2EA 1ZRNA 3D2SA 2BPFA 2W8LA 4NLCA 9ICEA 3UMBA 4J9OA 1ZQBA 4G3IA 3GV8B 1NJZA 3FYHA 2IHNA 3AEVA 1XO0A 4F91B 2JZBB 1DGJA 4M9GA 3TADA 4J9MA 4C8LA 5HNKA 3C21A 4F2SA 2G07A 3QEBZ 2RHFA 3OJSA 2GOLA 1ZQMA 5KFBA 2W03A 1B43A 3LYSA 2JXJA 1S0OA 2O6KA 4F4WA 1ZYQA 1HEKA 2JEGA 4BUGA 2PFQA 4P0PA 1D8YA 4O3SA 4IRDA 5J2AA 9ICLA 3RBEA 3QE9Y 2IOFK 1PVRA 4NXZA 3SAHA 5EWEA 2AH5A 2EQYA 2PKEA 4TUQA 1ZJMA 2V9WA 4DSIA 2YB4A 2NO5A 9ICXA 5KG4A 2ZIWA 2KJ5A 3HX0A 3T79A 4RQ0A 1ZQLA 2KN7A 5BPCA 1V9PA 1RYRA 4NLNA 1S76D 3ZDBA 4PHDA 4RQ6A 1U45A 2BDPA 9ICUA 2KFZA 2WB1F 4UAYA 1RXWA 4UB6U 2C2RA 2KJ9A 3ZD9A 1RPLA 4UB4A 7ICTA 1KRPA 5DQIA 1BPZA 1L7OA 8ICWA 1L7MA 5DBAA 4A8EA 2PFOA 8ICHA 7ICEA 5CA7A 2XY6A 2BPGA 2B0CA 1L7NA 5BOMA 8ICXA 2HW3A 4NL9A 4F8RA 3GIIA 4KTQA 2F1IA 2KV2A 3QUBA 3PO5A 1DK3A 2E8NA 3DV9A 1A77A 5EE0A 2M9NA 3ZDDA 3PZPA 4EEKA 3IDWA 2F8LA 3LK9A 4CF3A 4YCXA 2JH1A 2H3ZA 2P6RA 5CWRA 2R8HA 4RZRA 1A6SA 5KFNA 2FPLA 2HHVA 5ALWA 5AM5A 3EPGA 3LWMA 4DF4A 3TQ1A 1TK0A 5AK3A 1RXVA 2QARA 1PZNA 4U7CA 8ICOA 3ETRA 3H8MA 4YXJA 2VA8A 4Y2YA 4XUSA 5ALKA 4F4YA 1Q46A 4C8KA 4ECWA 5J8YA 3J81j 4QZIA 1SIJA 4R66A 2HHUA 3T5HA 4XRHA 4KX5A 3E2EA 5DDMA 4YXMA 4NL9C 4AYBC 1V97A 2HHWA 2RLTA 3PSTA 2HHSA 2FMPA 4CGZA 2DGZA 4F3OA 3M1YA 2F1HA 4ED0A 8ICYA 1S9FA 4RNOA 4UATA 4F72A 3WK7A 1D8LA 9ICWA 4YMOA 2P66A 3Q8QB 1ZQWA 3UXPA 1ZRMA 2KZ3A 3RB6A 4UB1A 3TKAA 3ORYA 3TAQA 2WFAA 5L1IA 1D9FA 4C8NA 1KKXA 2HVHA 3MFHA 3SR6A 4M0AA 2AQ0A 2KTQA 4PL2A 3ZDEA 4P4OA 3ALRA 2GO7A 4P4MA 1T4GA 2A1AA 5GTIU 1SZHA 1S97A 3B0XA 4LZDA 4DSJA 2EANA 4QIWC 1ZQYA 2P6UA 4QZCA 2JZBA 1N2XA 5AKLA 5CRXA 3HRDD 4DL3A 1ZD3A 1BPDA 3L4PA 3V6KA 1QQ7A 3OPXA 1UT8A 8ICFA 4PL1A 4DFJA 4QWDA 3MR5A 3H40A 1CEZA 4PHEA 4DQRA 3IM1A 4I2GA 3I76A 1T3QA 2KG5A 2ZXIA 4JV1A 4Q44A 4OJOA 4F5PA 5DG8A 4AP9A 2H3FA 3GIMA 1BNOA 1JXEA 5IILA 2C22A 4MFFA 8ICJA 3TANA 2KOBA 1Q3VA 3F5AA 4JK1A 5KFSA 2IOHA 5DQGA 4US9A 4CCHA 5ALOA 4LZGA 5HHIA 2WHEA 5J2CA 5KG5A 2YY6A 5H2FU 3BJYA 2FLNA 3PSIA 2Z7JA 3ISCA 1WWVA 2HI0A 4ECVA 5KFGA 1KTQA 3AMZA 2KK0A 4KLOA 4IQVA 2BCRA 2YX8A 4QWBA 5B5EU 5DB9A 2R8JA 3R9KA 4J9QA 5KFZA 3ICXA 1ED1A 3C1ZA 2W3RA 2MSNA 4KLDA 1BPBA 5EWFA 2KKVA 5AM3A 4C4RA 5AKGA 3E58A 2PMZF 4M9HA 4M04A 3MDCA 3QZ8A 4RQ4A 2K8CB 3RR8A 4ECZA 2L5YA 5KFWA 4KLGA 2YMPA 1UT5A 4UARA 1SWWA 3SI8A 3HILA 1B0XA 5G5HA 1SV0A 4MHVA 3PSPA 3C23A 3EWAA 4YMMA 1S0NA 3KKAA 2PXIA 5AKIA 4ECXA 5ALUA 4DS4A 1BVSA 3ISDA 4F2RA 1ZQZA 3DDHA 8ICEA 4C7YA 4QZBA 4EZ6A 5KAFU 3GV7B 3NVWA 3WK4A 4TUSA 4HYKA 4OJ6A 1P7DA 4DSEA 2WAQF 3QEAZ 1X6JA 2AJQA 2G06A 5IIJA 5KFPA 5AK6A 4QWAA 1D8BA 2HSZA 3MR2A 3C2KA 2J6SA 4KLLA 4GFJA 5J0XA 1MA7A 5ALIA 4EBCA 3G6VA 4MEYA 4USAA 1MQ2A 1HIWA 1J2MA 1MN8A 2OYYA 1V38A 3TI0A 3MFIA 5F9NA 1ZQDA 1ZQIA 1ZQPA 1YZ6A 1ZD5A 3L5KA 3M8RA 3F2DA 4J9SA 1MQ3A 4ECRA 3RRHA 4M2YA 1SV0C 2V4RA 2DBYA 1TKDA 1QSYA 2CN1A 4Q45A 3HW8A 3MGVA 5BOLA 5L1KA 3LDAA 1SL2A 4DLEA 2E8MA 1SB3C 8ICBA 4J9KA 4JV2A 1SZPA 1ZQCA 4KITB 4P0QB 3CNHA 3FAHA 2XGQA 2A3VA 2IBKA 1Z1BA 4F4ZA 4TQRA 4QWCA 1KEJA 3JPPA 4KLHA 3Q8MA 4J9RA 3QUTA 1NJWA 4DCCA 2F8KA 1PK1B 2ZTCA 4IS7A 3U26A 5HHHA 1UHUA 5ALPA 2IOFA 4B9TA 1B22A 1QH9A 3UQ2A 1O08A 2F3NA 3V7KA 1T7PA 1Z00B 4YMNA 2EDUA 4Q43A 2W11A 3PVXA 5L1LA 4RQ8A 3WKBA 3C2MA 1D9DA 3KTQA 4KLEA 4I2DA 4JV0A 4Y2UA 1KFTA 1GO3F 2YMLA 3OTQA 5IIMA 1X9SA 4NLKA 2JEJA 2W9BA 5E79U 5KNIA 2P35A 4YVZA 5KFTA 4CF5A 4Y2PA 9ICPA 5DB8A 2AU0A 2ISPA 2ZUCA 3UPQA 2R18A 4MF2A 2NV3A 4O3QA 1FEZA 4O5KA 4RQMA 2I9GA 2EAMA 2G09A 2QB0B 2KD1A 2K60A 7ICUA 1FFVA 1ZQHA 4AYBF 3GILA 2AHOB 4QZHA 1S5LU 1N48A 2KZMA 4YD1A 2HMXA 4PGQA 5F3XB 3H4DA 1UPHA 4KLSA 2WF7A 1TVAA 7ICKA 4Y2VA 4Z6DA 4FZLA 5AKZA 4CRXA 1X9WA 3RJIA 3RAQA 3AL0B 1XO1A 9ICBA 4PHAA 2KP7A 2EZYA 1OW5A 4DL7A 5DKWA 1ZETA 1XNSA 2BCQA 2Y1JA 5ALLA 3PX6A 9ICVA 2C28A 1IIPA 4B9SA 3M9OB 3QU2A 2Y9UA 3HWTA 9ICOA 5ALGA 3H8WA 3KBBA 5ALDA 3Q8SB 3JPQA 2LHTA 1H38A 5KG3A 5KL8B 2C2EA 4DFKA 4OD0A 2W43A 3C1YA 4QIWF 1QQ6A 4MF8A 2KIVA 8ICTA 4JWNA 3OHBA 5J0YA 5AI5A 4CE6A 4DL5A 4IR9A 1Y88A 4G9BA 2KSOB 4PZNA 4NLGA 4KLUA 5AHXA 2VA3A 5ALFA 3NUQA 1WUDA 3HJEA 2ZTDA 3NVYA 4NM2A 3IHQB 1J2NA 2NRTA 2BZFA 5KFAA 3V7LA 4MFCA 2K8AA 2WF8A 3Q8PB 5KT5A 2KEYA 4YR2A 5ALTA 4BX9C 4RT2A 2LYBA 2J6UA 4QZDA 2HHXA 3TFSA 2HBLA 1NK0A 2KZZA 3SV3A 3GQCA 3SYZA 1ZQUA 4KLFA 2HCFA 2YTUA 4M9NA 4FFDA 9ICJA 1L6NA 5AM0A 2YMQA 5KFXA 2RQ5A 4C0ZA 4DSKA 5IIOA 5HR6A 5KG0A 4R8UB 3TAPA 2MUTB 4UAZA 2DKZA 1QTMA 1ZQ1C 2K4HA 1Z4OA 1M6YA 4YR0A 5KFLA 5AKHA 1SXDA 3SV4A 2VA2A 2KVSA 3M8SA 1PVPA 1ZQQA 3B0YA 1SXEA 3HKZC 2D6FC 3D2QA 4I2AA 2ESEA 2OWOA 2E3TA 4DQPA 3RJFA 2JMGA 1L8OA 4B9MA 4ED7A 4K4HA 1XSNA 2NYVA 3IG8A 2RDJA 1JROA 4UBCA 4GXKA 2HOIA 5KFYA 5D46A 8ICPA 4DSFA 1PK1A 1AROP 4RT3A 1U9LA 4C4TA 1QCKA 2B6GA 4ED8A 1XSPA 4LJXA 2F77X 3QUCA 1X42A 3IP4B 3NRWA 3MGIA 1Z00A 1S0VA 3RBDA 4ED2A 4EEYA 3LVWA 1KL9A 5KFUA 5TISU 3GU3A 2EH9A 2E8OA 2BDUA 1A76A 2NO4A 5ALMA 2R8KA 3KOOA 5KT3A 2HBKA 1BGXT 4RQNA 2ASLA 1F44A 2KNJA 4FO6A 3TACB 5J0PA 3AN1A 3K75D 3RFAA 8ICNA 5KT2A 3WK9A 5A0LA 1LB2B 4BXOB 4C8MA 1UA0A 2JV3A 3GV5B 3WKAA 3CP8A 3IG5A 2WF5A 4XQ8A 4I29A 3FM9A 2G5IB 1L7PA 1Z19A 2H3IA 4QZEA 2MA1A 4YFKA 5AKYA 5AK5A 1NNLA 3LWLA 4DS5A 1K5OA 2NRWA 2VIXA 1TE2A 5ALVA 1EXNA 8ICSA 4Z6FA 3BS5B 1T8EA 2ASJA 2MAXA 3IRUA 4EBEA 3IV6A 3K1RB 3PX4A 4FE3A 2DPJA 2BKEA 3AU2A 1YT3A 5AK4A 4J03A 1XSLA 4P4PA 3T5JA 5DB7A 5AKEA 5KFCA 7ICVA 1KLNA 1A0PA 5KFEA 2W9AA 4ELUA 5DBBA 2ZUDA 1CI4A 1RZTA 5KFHA 1L3VA 2W7PA 3RJJA 5KAIU 1IV8A 1WYGA 2HBMA 3JPNA 2FLLA 1CRXA 7ICSA 5CR0A 4MEXA 1IG6A 3G6YA 1X66A 9ICGA 1JN3A 2KJ8A 2KSOA 4BWMA 4EBDA 2FPMA 1X9MA 2Y0SC 1Q8KA 3ISBA 5J2BA 4F4XA 1JUDA 2JEIA 5HMMA 1UQVA 5KG2A 4DFPA 4O9MA 2W55A 2YQEA 5KG1A 2FE9A 4TQSA 1DRGA 3O0FA 5EE3A 5AM4A 1VJ5A 3PNCA 1S0MA 2LYAA 4I2HA 2HOFA 5IIKA 2W9CB 8ICRA 5KFKA 4QZFA 4I2JA 4RQ5A 1JXLA 3BZCA 3H7IA 2JH7A 3PW2A 3AQEA 2M0NA 5AI8A 4C7ZA 3OJUA 2BR0A 9ICQA 1COKA 1NOMA 8ICKA 2G0AA 3HT3A 1OUQA 1X9XA 9ICNA 3VC8A 4DL6A 4KLMA 2AGQA 3BZKA 1NZPA 5KFQA 4J9NA 2W7OA 4DFDA 2K8BB 4ED6A 3KHHA 3HPOA 2UVUA 2JHDA 3QU7A 3VCBA 3PW5A 1JIHA 3MR3A 2B21A 2GH1A 3OSPA 3QU4A 2N1RA 1SV4A 1LKYB 4DOBA 4F93B 3QYPA 1DGSA 3JPOA 1KDHA 3NGDA 4KX3A 3M7DA 2E8PA 3EYZA 4ELVA 5ALXA 4QZGA 3AU6A 2BGWA 1L3UA 2JEFA 3PV8A 4FBUA 2ZG6A 1NKBA 3N7RC 2YB1A 4YG2A 3JPRA 3SZ2A 3RB4A 2JGAA 1J97A 7ICOA 2KVCA 2LYHA 2XC9A 3AUOA 4IQWA 4PGXA 3SD7A 2NRVA 1NJYA 1O03A 5ALZA 4JUZA 5J0WA 4Y2RA 3RB3A 2KFNA 5J0OA 3ZI4A 4RQ2A 5L9XA 2R8GA 4I2CA 8ICMA 4O5CA 4RPXA 3M9NB 2QLTA 1ZQRA 3M9MB 2ALZA 3H4BA 4BXOA 5KL1B 2LM4A 7ICPA 2FJ6A 3N28A 4OJ5A 3RJKA 3CW2C 4OO1J 4PGYA 2BCVA 3SEIA 1BNPA 1SKRA 3ZDCA 3NS1A 1NKEA 2C2DA 5ALNA 4KLJA 3MDAA 5ALSA 5J2KA 2H3QA 3FC4A 2V4QA 5AM1A 2BQ3A 3WKDA 3GIKA 2ATLA 1S10A 1IM4A 3BS5A 2XY5A 2EAOA 4GXJA 4UAUA 5DGAA 1ZQVA 3HKZF 2W04A 2XVTA 2E1EA 2AGOA 3EW9A 4QWEA 4CDGA 3MC1A 1ZQEA 4BWJA 2DQNB 4Q8EA 5JRTA 3MR6A 3BDPA 3FDSA 3WKEA 3V7JA 1L3SA 5DDYA 4IR1A 1Z4NA 3TFRA 1ZQOA 3ZDAA 4US8A 4I2FA 4I27A 1NK9A 2K4IA 1JRPA 2Y9TA 4RPYA 3N4MB 8ICIA 3TARA 7ICQA 5J2JA 2PI5A 5J2FA 5FP0A 2ZIXB 4IQUA 4KLQA 3WK5A 1NK6A 4I28A 4F5OA 2MRLA 2I5HA 3C5FA 3KHGA 5J2EA 2I1QA 4ACOA 1KFDA 2FDRA 4M6WB 3K4GA 5J0RA 5T14A 3EZ5A 4F5QA 9ICCA 4R65A 4NV0A 2W9CA 1TK5A 2KICA 4GXIA 5JTIA 5DLFA 4RQ7A 2A1JB 4K4GA 3RR7A 3V72A 1RM6C 4Y2QA 1QLNA 4UASA 5DBCA 3C2LA 4UB2A 1TV9A 4GLXA 4ELTA 1JALA 1N60A 4JWMA 4YN4A 1SWVA 3CRXA 3T3FA 1KFSA 3AM9A 3A0BU 2Q0ZX 2DKXA 2HOQA 1ZQKA 3DEEA 4TURA 3ETLA 4QNLA 3M6KA 3RJHA 4Y2TA 4F4KA 3E0FA 3ONNA 3ZD8A 2HHQA 4Y2XA 1NK8A 2OCEA 4DEZA 5JUMA 4NJ8A 5ALHA 7ICMA 4IRCA 1MSWD 3D2NA 4CF4A 3LVVA 2CRXA 1WG8A 1LVHA 1UA1A 2FI1A 3PR5B 5J2GA 3C29A 2IA6A 3PO4A 4NY8A 5AI6A 2BCUA 2ZIVB 5ALRA 1PK3A 5ALEA 5CB1A 3K1ZA 1N61A 3SENA 3RH6A 2ODGA 3S6JA 3BQ2A 3G6XA 2LM1A 5KT6A 5HR7A 3QU5A 3RH5A 8ICCA 3ED5A 4UB8U 2HVIA 4DOCA 4ZH4A 4UBBA 5AICA 2H3VA 2WAQC 4QZAA 4UAVA 2W54A 1T3NA 1L8LA 4EYIB 4EX6A 3H0MB 4F50A 5D49A 1KN5A 1K1SA 4B9UA 7ICRA 2Y0SF 1KSPA 4HAIA 5JU5A 1NJXA 2XO7A 5EWGA 2ZJ5A 9ICKA 4F5NA 4O3NA 2W8KA 1Q3UA 2F1JA 3Q8RB 4O0IA 1ZQGA 1TAQA 2VJ4A 2FPKA 9ICHA 1NKCA 2W3SA 4QW9A 2ZJ8A 5KFIA 5DB6A 3H0RB 2KKPA 3OSNA 1NI3A 4QW8A 5D4BA 7ICHA 1DXSA 4B9VA 2HBJA 5DG7A 4EX7A 3TADC 3SAGA 4I2BA 2VANA 2KHQA 1HUZA 4ECUA 2I6XA 4NLBA 4BGDA 3WK8A 4EYHB 2DWQA 3WK6A 1SGGA 1HUOA 5AKKA 4P0QA 2HDOA 2EZZA 3KHLA 2PFNA 3EUB2 1T94A 3PMNA 4B6JA 1XC9A 1NK4A 4B9NA 2IMWP 3V6HA 4J9PA 2LI6A 1RDFA 4RNMA 1KBUA 2F2AB 8ICQA 2FMQA 2DFLA 3KD3A 4DOAA 4B9LA 4E0DA 4GIBA 5AM2A 2YN4A 3UXNA 2WF9A 2ISOA 1V85A 5KFJA 1N56A 1ZQXA 2FMSA 4KN7A 5AKXA 5KFMA 5DQHA 4F5RA 2OHFA 3B9JA 5J0QA 3NVZA 1JI7A 2ES6A 1L3TA 1Z1VA 2WF6A 2OXOA 4OJPA 4WJ3B 4MFAA 2ZIXA 4DLGA 2E5SA 5ALJA 5J0UA 3UQ0A 4RUAA 3C5GA 4FS1A 1RQLA 4DQSA 4IQTA 1BPYA 4F71A 1RYUA 4RQ1A 5J0SA 5EOZA 4M6WA 3MABA 7ICJA 1IXRA 4J9LA 4KMOB 2ZIUB 5C5JA 3JPSA 7ICNA 3QZ7A 2QB0A 2IHMA 5F9LA 1U49A 2KMDA 4KLIA 5EE1A 1TFRA 2A1JA 1VDVA 4ZOHC 1PVQA 5G5GA 3KFUF 4TUPA 4XA5A 2K89A 9ICMA 3RF9A 1XWLA 4C4SA 4KMUA 2LPEA 4LVSA 1KW4A 2UVVA 1ZD2P 4QJFB 4O3OA 1XU4A 1C20A 3N7PD 8ICGA 4M47A 3OGUA 2LKYA 4YR3A 2HHTA 1FO4A 2F76X 9ICIA 4NWIA 3OHAA 4Y2JA 1DK2A 3GFKB 4UB3A 3SMVA 1TAUA 2E1FA 5J2HA 2BPCA 2K4EA 2ZTEA 2ZJAA 1DOQA 5L1JA 3H0LB 2NRZA 4M9JA 2JR5A 1U48A 4Z6CA 1OXJA 4U6PA 2A19A 5J8YC 1YZ7A 7ICGA 2Y1IA 2ZIVA 2VJ5A 5ALQA 2LBOA 3BQ7A 1S8OA 4FZMA 3V6JA 3BQTA 5J29A 1FFUA 3KZIU 1NK7A 4ECTA 4UAWA 1RYSA 1MC8A 4IC9A 4PJ0U 3WU2U 4EELA 3NRZA 3BQ0A 4PHPA 4C80A 4JB3A 2ZUBA 3QNMA 3QU9A 2W9BB 4GC6A 4PH5A 4ED3A 4FS2A 3CYMA 3T5LA 3Q8KA 2XCAA 3NTUA 2WB1C 3F2BA 3RJEA 9ICRA 2ZXHA 3MBYA 1ZQTA 3EPIA 4K4IA 3PSFA 7ICIA 1U47A 1RQNA 2D3DA 3M6ZA 8ICUA 3T5KA 4R8UA 2MUTA 3RAXA 2VKQA 5KG7A 3GDXA 4GC7A 1LV5A 4R64A 5DG9A 3GIJA 1F0MA 5CJ7A 4DL2A 4PPXA 5AIAA 1ECWA 2J6TA 3I1YA 3N7SC 1ZJNA 3SQIA 4CNQA 2G08A 1QSSA 3PW4A 4C8OA 4NM1A 1X40A 3PX0A 3QXGA 4DQQA 9ICSA 5GTHU 2Q4TA 1N63A 3BS7A 2R8IA 2BQRA 8ICLA 1N5XA 5J0TA 3RJGA 1ZQAA 4DQIA 2RRDA 3QX7A 3UM9A 2EAPA 5KFFA 3RTVA 4FBTA 2G5HB 2D8CA 5DGBA 4KN4A 2XCPA 2WTFA 4UQGA 5HP4A 5K4LA 4IL6U 3F5EA 5CHGA 4P0PB 1HJPA 2RP5A 2DL0A 3L3FX 2NRXA 2OM6A 1Z3EB 4DWIA 1SL0A 1WWUA 3MGHA 2PFPA 5J2IA 1F5SA 3PMLA 3F53A 5CEHA 2ZIWB 4Y2SA 4O3RA 4Z6EA 1N62A 8ICZA 1K1QA 2XI9A 5KTQA 5B66U 1URJA 3BQ1A 4EENA 2MU2A 5AIBA 4OCZA 1AQ6A 4ICAA 3NVVA 1U4BA 4UB5A 3RRGA 2OEHA 4PZOA 2UVWA 1C7YA 5KFDA 4NLZA 2ZIUA 2CXYA 2GWSA 1NZBA 3UMCA 3SAFA 2PI4A 4KLTA 5EE9A 2F44A 3D6JA 4IRKA 5KG6A 3A0HU 5KFVA 2XGPA 5CP2A 1COOA 3KHRA 4DO9A 4I2IA 1QSLA 7ICFA 3N97B 1L5UA 3KKAC 2K4PA 5AI9A 4Q8FA 3I28A 1PUZA 1ZXIA 2BCSA 1SKSA 1QQ5A 4FZNA 3RH4A 4ECYA 3Q8LA 1S77D 4P2HA 1VLBA 3F2CA 2LMRA 4RQ3A 4RU9A 2KIWA 1XS9D 3PW7A 2QKQA 5J2DA 7ICLA 2AQ4A 4ECSA 2UVRA 2AGPA 1KQQA 3NASA 2FLPA 3H8SA 1BPXA 2XIDA 1X2IA 1FIQA 2YMMA 2GLEA 4DF8A 3AQFA 1WCNA 1TK8A
chains in the Genus database with same CATH topology
1UCVA 2DKZA 3TADA 1COKA 2E8MA 3IDWA 5JU5A 1SXDA 2DL0A 2EANA 1X9XA 1OW5A 2QARB 5JTIA 1SXEA 1WWUA 2L5YA 3BS5B 2Y9UA 3HILA 2ESEA 2QB1A 3SEIA 1B0XA 2QB0A 1SV0A 4MHVA 2KG5A 2KMDA 2F8KA 3KKAA 3K1RB 2QARA 1PK1B 4IS7A 3H8MA 1DXSA 1SV4A 1LKYB 4PZOA 2D3DA 3BS5A 2DKXA 3TADC 2EAOA 2F3NA 2KIVA 2LPEA 1KW4A 5J8YA 1PK1A 2F44A 1F0MA 1SGGA 2B6GA 4PZNA 2KSOB 1B4FA 2E8PA 4NL9C 4NJ8A 5KNIA 5JRTA 1X40A 1X66A 5L1MA 2KSOA 3KKAC 2K4PA 2E8OA 1RG6A 3BS7A 1PK3A 2Y9TA 4RQNA 1WWVA 2KE7A 2LMRA 4RQMA 1V85A 3SENA 1UQVA 2EAMA 1LKYA 2QB0B 1V38A 2FE9A 2QKQA 3TACB 2K60A 1OXJA 5J8YC 2YTUA 4NL9A 2EAPA 3BQ7A 1SV0C 5F3XB 2GLEA 2JV3A 2D8CA 1JI7A 2ES6A 1Z1VA 2E8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCV A;  2DKZ A;  3TAD A;  1COK A;  2E8M A;  3IDW A;  5JU5 A;  1SXD A;  2DL0 A;  2EAN A;  1X9X A;  1OW5 A;  2QAR B;  5JTI A;  1SXE A;  1WWU A;  2L5Y A;  3BS5 B;  2Y9U A;  3HIL A;  2ESE A;  2QB1 A;  3SEI A;  1B0X A;  2QB0 A;  1SV0 A;  4MHV A;  2KG5 A;  2KMD A;  2F8K A;  3KKA A;  3K1R B;  2QAR A;  1PK1 B;  4IS7 A;  3H8M A;  1DXS A;  1SV4 A;  1LKY B;  4PZO A;  2D3D A;  3BS5 A;  2DKX A;  3TAD C;  2EAO A;  2F3N A;  2KIV A;  2LPE A;  1KW4 A;  5J8Y A;  1PK1 A;  2F44 A;  1F0M A;  1SGG A;  2B6G A;  4PZN A;  2KSO B;  1B4F A;  2E8P A;  4NL9 C;  4NJ8 A;  5KNI A;  5JRT A;  1X40 A;  1X66 A;  5L1M A;  2KSO A;  3KKA C;  2K4P A;  2E8O A;  1RG6 A;  3BS7 A;  1PK3 A;  2Y9T A;  4RQN A;  1WWV A;  2KE7 A;  2LMR A;  4RQM A;  1V85 A;  3SEN A;  1UQV A;  2EAM A;  1LKY A;  2QB0 B;  1V38 A;  2FE9 A;  2QKQ A;  3TAC B;  2K60 A;  1OXJ A;  5J8Y C;  2YTU A;  4NL9 A;  2EAP A;  3BQ7 A;  1SV0 C;  5F3X B;  2GLE A;  2JV3 A;  2D8C A;  1JI7 A;  2ES6 A;  1Z1V A;  2E8N A; 
#chains in the Genus database with same CATH topology
 1WCL A;  1UCV A;  5AI0 A;  2EZX A;  3GZF A;  2DF4 B;  8ICV A;  4ED1 A;  5TZV A;  3HP6 A;  1JMS A;  1ZOL A;  1TAM A;  2RDI A;  2QAR B;  4BJQ A;  3UMG A;  4R63 A;  1N5W A;  3PW0 A;  5IIN A;  4F92 B;  2H5X A;  2BHN A;  4QZ9 A;  4RPZ A;  2QB1 A;  4QZ8 A;  5KT4 A;  5KT7 A;  1ZQF A;  3IN5 A;  3KZX A;  9ICT A;  4DSL A;  5ALY A;  2DUY A;  1BPE A;  3PR4 A;  2BQU A;  2OH2 A;  4YP3 A;  4RNN A;  4X5V A;  4OJL A;  2XIC A;  3RB0 A;  1JX4 A;  1CUK A;  5III A;  5HML A;  3UXO A;  1SKW A;  4YQW A;  1ZQN A;  1B4F A;  3THV A;  4UW9 A;  9ICF A;  1ZD4 A;  1ZQJ A;  2DPI A;  4O3M A;  4O3P A;  4M9L A;  3C28 A;  1SL1 A;  1X6I A;  5AKJ A;  5KFO A;  3JPT A;  2AXT U;  2CPR A;  4EZ9 A;  2ASD A;  4ECQ A;  2XY7 A;  9ICA A;  4DL4 A;  2KHV A;  3PY8 A;  2JRZ A;  5C0Y A;  5L1M A;  3QUQ A;  5AI4 A;  4YD2 A;  5KFR A;  4JMU A;  8ICA A;  1RG6 A;  4BDP A;  1ZQS A;  4RUC A;  2KE7 A;  4O5E A;  2PMZ C;  2W9M A;  3WKC A;  1LKY A;  4DFM A;  1NK5 A;  5DLG A;  3H8J A;  4I2E A;  1ZRN A;  3D2S A;  2BPF A;  2W8L A;  4NLC A;  9ICE A;  3UMB A;  4J9O A;  1ZQB A;  4G3I A;  3GV8 B;  1NJZ A;  3FYH A;  2IHN A;  3AEV A;  1XO0 A;  4F91 B;  2JZB B;  1DGJ A;  4M9G A;  3TAD A;  4J9M A;  4C8L A;  5HNK A;  3C21 A;  4F2S A;  2G07 A;  3QEB Z;  2RHF A;  3OJS A;  2GOL A;  1ZQM A;  5KFB A;  2W03 A;  1B43 A;  3LYS A;  2JXJ A;  1S0O A;  2O6K A;  4F4W A;  1ZYQ A;  1HEK A;  2JEG A;  4BUG A;  2PFQ A;  4P0P A;  1D8Y A;  4O3S A;  4IRD A;  5J2A A;  9ICL A;  3RBE A;  3QE9 Y;  2IOF K;  1PVR A;  4NXZ A;  3SAH A;  5EWE A;  2AH5 A;  2EQY A;  2PKE A;  4TUQ A;  1ZJM A;  2V9W A;  4DSI A;  2YB4 A;  2NO5 A;  9ICX A;  5KG4 A;  2ZIW A;  2KJ5 A;  3HX0 A;  3T79 A;  4RQ0 A;  1ZQL A;  2KN7 A;  5BPC A;  1V9P A;  1RYR A;  4NLN A;  1S76 D;  3ZDB A;  4PHD A;  4RQ6 A;  1U45 A;  2BDP A;  9ICU A;  2KFZ A;  2WB1 F;  4UAY A;  1RXW A;  4UB6 U;  2C2R A;  2KJ9 A;  3ZD9 A;  1RPL A;  4UB4 A;  7ICT A;  1KRP A;  5DQI A;  1BPZ A;  1L7O A;  8ICW A;  1L7M A;  5DBA A;  4A8E A;  2PFO A;  8ICH A;  7ICE A;  5CA7 A;  2XY6 A;  2BPG A;  2B0C A;  1L7N A;  5BOM A;  8ICX A;  2HW3 A;  4NL9 A;  4F8R A;  3GII A;  4KTQ A;  2F1I A;  2KV2 A;  3QUB A;  3PO5 A;  1DK3 A;  2E8N A;  3DV9 A;  1A77 A;  5EE0 A;  2M9N A;  3ZDD A;  3PZP A;  4EEK A;  3IDW A;  2F8L A;  3LK9 A;  4CF3 A;  4YCX A;  2JH1 A;  2H3Z A;  2P6R A;  5CWR A;  2R8H A;  4RZR A;  1A6S A;  5KFN A;  2FPL A;  2HHV A;  5ALW A;  5AM5 A;  3EPG A;  3LWM A;  4DF4 A;  3TQ1 A;  1TK0 A;  5AK3 A;  1RXV A;  2QAR A;  1PZN A;  4U7C A;  8ICO A;  3ETR A;  3H8M A;  4YXJ A;  2VA8 A;  4Y2Y A;  4XUS A;  5ALK A;  4F4Y A;  1Q46 A;  4C8K A;  4ECW A;  5J8Y A;  3J81 j;  4QZI A;  1SIJ A;  4R66 A;  2HHU A;  3T5H A;  4XRH A;  4KX5 A;  3E2E A;  5DDM A;  4YXM A;  4NL9 C;  4AYB C;  1V97 A;  2HHW A;  2RLT A;  3PST A;  2HHS A;  2FMP A;  4CGZ A;  2DGZ A;  4F3O A;  3M1Y A;  2F1H A;  4ED0 A;  8ICY A;  1S9F A;  4RNO A;  4UAT A;  4F72 A;  3WK7 A;  1D8L A;  9ICW A;  4YMO A;  2P66 A;  3Q8Q B;  1ZQW A;  3UXP A;  1ZRM A;  2KZ3 A;  3RB6 A;  4UB1 A;  3TKA A;  3ORY A;  3TAQ A;  2WFA A;  5L1I A;  1D9F A;  4C8N A;  1KKX A;  2HVH A;  3MFH A;  3SR6 A;  4M0A A;  2AQ0 A;  2KTQ A;  4PL2 A;  3ZDE A;  4P4O A;  3ALR A;  2GO7 A;  4P4M A;  1T4G A;  2A1A A;  5GTI U;  1SZH A;  1S97 A;  3B0X A;  4LZD A;  4DSJ A;  2EAN A;  4QIW C;  1ZQY A;  2P6U A;  4QZC A;  2JZB A;  1N2X A;  5AKL A;  5CRX A;  3HRD D;  4DL3 A;  1ZD3 A;  1BPD A;  3L4P A;  3V6K A;  1QQ7 A;  3OPX A;  1UT8 A;  8ICF A;  4PL1 A;  4DFJ A;  4QWD A;  3MR5 A;  3H40 A;  1CEZ A;  4PHE A;  4DQR A;  3IM1 A;  4I2G A;  3I76 A;  1T3Q A;  2KG5 A;  2ZXI A;  4JV1 A;  4Q44 A;  4OJO A;  4F5P A;  5DG8 A;  4AP9 A;  2H3F A;  3GIM A;  1BNO A;  1JXE A;  5IIL A;  2C22 A;  4MFF A;  8ICJ A;  3TAN A;  2KOB A;  1Q3V A;  3F5A A;  4JK1 A;  5KFS A;  2IOH A;  5DQG A;  4US9 A;  4CCH A;  5ALO A;  4LZG A;  5HHI A;  2WHE A;  5J2C A;  5KG5 A;  2YY6 A;  5H2F U;  3BJY A;  2FLN A;  3PSI A;  2Z7J A;  3ISC A;  1WWV A;  2HI0 A;  4ECV A;  5KFG A;  1KTQ A;  3AMZ A;  2KK0 A;  4KLO A;  4IQV A;  2BCR A;  2YX8 A;  4QWB A;  5B5E U;  5DB9 A;  2R8J A;  3R9K A;  4J9Q A;  5KFZ A;  3ICX A;  1ED1 A;  3C1Z A;  2W3R A;  2MSN A;  4KLD A;  1BPB A;  5EWF A;  2KKV A;  5AM3 A;  4C4R A;  5AKG A;  3E58 A;  2PMZ F;  4M9H A;  4M04 A;  3MDC A;  3QZ8 A;  4RQ4 A;  2K8C B;  3RR8 A;  4ECZ A;  2L5Y A;  5KFW A;  4KLG A;  2YMP A;  1UT5 A;  4UAR A;  1SWW A;  3SI8 A;  3HIL A;  1B0X A;  5G5H A;  1SV0 A;  4MHV A;  3PSP A;  3C23 A;  3EWA A;  4YMM A;  1S0N A;  3KKA A;  2PXI A;  5AKI A;  4ECX A;  5ALU A;  4DS4 A;  1BVS A;  3ISD A;  4F2R A;  1ZQZ A;  3DDH A;  8ICE A;  4C7Y A;  4QZB A;  4EZ6 A;  5KAF U;  3GV7 B;  3NVW A;  3WK4 A;  4TUS A;  4HYK A;  4OJ6 A;  1P7D A;  4DSE A;  2WAQ F;  3QEA Z;  1X6J A;  2AJQ A;  2G06 A;  5IIJ A;  5KFP A;  5AK6 A;  4QWA A;  1D8B A;  2HSZ A;  3MR2 A;  3C2K A;  2J6S A;  4KLL A;  4GFJ A;  5J0X A;  1MA7 A;  5ALI A;  4EBC A;  3G6V A;  4MEY A;  4USA A;  1MQ2 A;  1HIW A;  1J2M A;  1MN8 A;  2OYY A;  1V38 A;  3TI0 A;  3MFI A;  5F9N A;  1ZQD A;  1ZQI A;  1ZQP A;  1YZ6 A;  1ZD5 A;  3L5K A;  3M8R A;  3F2D A;  4J9S A;  1MQ3 A;  4ECR A;  3RRH A;  4M2Y A;  1SV0 C;  2V4R A;  2DBY A;  1TKD A;  1QSY A;  2CN1 A;  4Q45 A;  3HW8 A;  3MGV A;  5BOL A;  5L1K A;  3LDA A;  1SL2 A;  4DLE A;  2E8M A;  1SB3 C;  8ICB A;  4J9K A;  4JV2 A;  1SZP A;  1ZQC A;  4KIT B;  4P0Q B;  3CNH A;  3FAH A;  2XGQ A;  2A3V A;  2IBK A;  1Z1B A;  4F4Z A;  4TQR A;  4QWC A;  1KEJ A;  3JPP A;  4KLH A;  3Q8M A;  4J9R A;  3QUT A;  1NJW A;  4DCC A;  2F8K A;  1PK1 B;  2ZTC A;  4IS7 A;  3U26 A;  5HHH A;  1UHU A;  5ALP A;  2IOF A;  4B9T A;  1B22 A;  1QH9 A;  3UQ2 A;  1O08 A;  2F3N A;  3V7K A;  1T7P A;  1Z00 B;  4YMN A;  2EDU A;  4Q43 A;  2W11 A;  3PVX A;  5L1L A;  4RQ8 A;  3WKB A;  3C2M A;  1D9D A;  3KTQ A;  4KLE A;  4I2D A;  4JV0 A;  4Y2U A;  1KFT A;  1GO3 F;  2YML A;  3OTQ A;  5IIM A;  1X9S A;  4NLK A;  2JEJ A;  2W9B A;  5E79 U;  5KNI A;  2P35 A;  4YVZ A;  5KFT A;  4CF5 A;  4Y2P A;  9ICP A;  5DB8 A;  2AU0 A;  2ISP A;  2ZUC A;  3UPQ A;  2R18 A;  4MF2 A;  2NV3 A;  4O3Q A;  1FEZ A;  4O5K A;  4RQM A;  2I9G A;  2EAM A;  2G09 A;  2QB0 B;  2KD1 A;  2K60 A;  7ICU A;  1FFV A;  1ZQH A;  4AYB F;  3GIL A;  2AHO B;  4QZH A;  1S5L U;  1N48 A;  2KZM A;  4YD1 A;  2HMX A;  4PGQ A;  5F3X B;  3H4D A;  1UPH A;  4KLS A;  2WF7 A;  1TVA A;  7ICK A;  4Y2V A;  4Z6D A;  4FZL A;  5AKZ A;  4CRX A;  1X9W A;  3RJI A;  3RAQ A;  3AL0 B;  1XO1 A;  9ICB A;  4PHA A;  2KP7 A;  2EZY A;  1OW5 A;  4DL7 A;  5DKW A;  1ZET A;  1XNS A;  2BCQ A;  2Y1J A;  5ALL A;  3PX6 A;  9ICV A;  2C28 A;  1IIP A;  4B9S A;  3M9O B;  3QU2 A;  2Y9U A;  3HWT A;  9ICO A;  5ALG A;  3H8W A;  3KBB A;  5ALD A;  3Q8S B;  3JPQ A;  2LHT A;  1H38 A;  5KG3 A;  5KL8 B;  2C2E A;  4DFK A;  4OD0 A;  2W43 A;  3C1Y A;  4QIW F;  1QQ6 A;  4MF8 A;  2KIV A;  8ICT A;  4JWN A;  3OHB A;  5J0Y A;  5AI5 A;  4CE6 A;  4DL5 A;  4IR9 A;  1Y88 A;  4G9B A;  2KSO B;  4PZN A;  4NLG A;  4KLU A;  5AHX A;  2VA3 A;  5ALF A;  3NUQ A;  1WUD A;  3HJE A;  2ZTD A;  3NVY A;  4NM2 A;  3IHQ B;  1J2N A;  2NRT A;  2BZF A;  5KFA A;  3V7L A;  4MFC A;  2K8A A;  2WF8 A;  3Q8P B;  5KT5 A;  2KEY A;  4YR2 A;  5ALT A;  4BX9 C;  4RT2 A;  2LYB A;  2J6U A;  4QZD A;  2HHX A;  3TFS A;  2HBL A;  1NK0 A;  2KZZ A;  3SV3 A;  3GQC A;  3SYZ A;  1ZQU A;  4KLF A;  2HCF A;  2YTU A;  4M9N A;  4FFD A;  9ICJ A;  1L6N A;  5AM0 A;  2YMQ A;  5KFX A;  2RQ5 A;  4C0Z A;  4DSK A;  5IIO A;  5HR6 A;  5KG0 A;  4R8U B;  3TAP A;  2MUT B;  4UAZ A;  2DKZ A;  1QTM A;  1ZQ1 C;  2K4H A;  1Z4O A;  1M6Y A;  4YR0 A;  5KFL A;  5AKH A;  1SXD A;  3SV4 A;  2VA2 A;  2KVS A;  3M8S A;  1PVP A;  1ZQQ A;  3B0Y A;  1SXE A;  3HKZ C;  2D6F C;  3D2Q A;  4I2A A;  2ESE A;  2OWO A;  2E3T A;  4DQP A;  3RJF A;  2JMG A;  1L8O A;  4B9M A;  4ED7 A;  4K4H A;  1XSN A;  2NYV A;  3IG8 A;  2RDJ A;  1JRO A;  4UBC A;  4GXK A;  2HOI A;  5KFY A;  5D46 A;  8ICP A;  4DSF A;  1PK1 A;  1ARO P;  4RT3 A;  1U9L A;  4C4T A;  1QCK A;  2B6G A;  4ED8 A;  1XSP A;  4LJX A;  2F77 X;  3QUC A;  1X42 A;  3IP4 B;  3NRW A;  3MGI A;  1Z00 A;  1S0V A;  3RBD A;  4ED2 A;  4EEY A;  3LVW A;  1KL9 A;  5KFU A;  5TIS U;  3GU3 A;  2EH9 A;  2E8O A;  2BDU A;  1A76 A;  2NO4 A;  5ALM A;  2R8K A;  3KOO A;  5KT3 A;  2HBK A;  1BGX T;  4RQN A;  2ASL A;  1F44 A;  2KNJ A;  4FO6 A;  3TAC B;  5J0P A;  3AN1 A;  3K75 D;  3RFA A;  8ICN A;  5KT2 A;  3WK9 A;  5A0L A;  1LB2 B;  4BXO B;  4C8M A;  1UA0 A;  2JV3 A;  3GV5 B;  3WKA A;  3CP8 A;  3IG5 A;  2WF5 A;  4XQ8 A;  4I29 A;  3FM9 A;  2G5I B;  1L7P A;  1Z19 A;  2H3I A;  4QZE A;  2MA1 A;  4YFK A;  5AKY A;  5AK5 A;  1NNL A;  3LWL A;  4DS5 A;  1K5O A;  2NRW A;  2VIX A;  1TE2 A;  5ALV A;  1EXN A;  8ICS A;  4Z6F A;  3BS5 B;  1T8E A;  2ASJ A;  2MAX A;  3IRU A;  4EBE A;  3IV6 A;  3K1R B;  3PX4 A;  4FE3 A;  2DPJ A;  2BKE A;  3AU2 A;  1YT3 A;  5AK4 A;  4J03 A;  1XSL A;  4P4P A;  3T5J A;  5DB7 A;  5AKE A;  5KFC A;  7ICV A;  1KLN A;  1A0P A;  5KFE A;  2W9A A;  4ELU A;  5DBB A;  2ZUD A;  1CI4 A;  1RZT A;  5KFH A;  1L3V A;  2W7P A;  3RJJ A;  5KAI U;  1IV8 A;  1WYG A;  2HBM A;  3JPN A;  2FLL A;  1CRX A;  7ICS A;  5CR0 A;  4MEX A;  1IG6 A;  3G6Y A;  1X66 A;  9ICG A;  1JN3 A;  2KJ8 A;  2KSO A;  4BWM A;  4EBD A;  2FPM A;  1X9M A;  2Y0S C;  1Q8K A;  3ISB A;  5J2B A;  4F4X A;  1JUD A;  2JEI A;  5HMM A;  1UQV A;  5KG2 A;  4DFP A;  4O9M A;  2W55 A;  2YQE A;  5KG1 A;  2FE9 A;  4TQS A;  1DRG A;  3O0F A;  5EE3 A;  5AM4 A;  1VJ5 A;  3PNC A;  1S0M A;  2LYA A;  4I2H A;  2HOF A;  5IIK A;  2W9C B;  8ICR A;  5KFK A;  4QZF A;  4I2J A;  4RQ5 A;  1JXL A;  3BZC A;  3H7I A;  2JH7 A;  3PW2 A;  3AQE A;  2M0N A;  5AI8 A;  4C7Z A;  3OJU A;  2BR0 A;  9ICQ A;  1COK A;  1NOM A;  8ICK A;  2G0A A;  3HT3 A;  1OUQ A;  1X9X A;  9ICN A;  3VC8 A;  4DL6 A;  4KLM A;  2AGQ A;  3BZK A;  1NZP A;  5KFQ A;  4J9N A;  2W7O A;  4DFD A;  2K8B B;  4ED6 A;  3KHH A;  3HPO A;  2UVU A;  2JHD A;  3QU7 A;  3VCB A;  3PW5 A;  1JIH A;  3MR3 A;  2B21 A;  2GH1 A;  3OSP A;  3QU4 A;  2N1R A;  1SV4 A;  1LKY B;  4DOB A;  4F93 B;  3QYP A;  1DGS A;  3JPO A;  1KDH A;  3NGD A;  4KX3 A;  3M7D A;  2E8P A;  3EYZ A;  4ELV A;  5ALX A;  4QZG A;  3AU6 A;  2BGW A;  1L3U A;  2JEF A;  3PV8 A;  4FBU A;  2ZG6 A;  1NKB A;  3N7R C;  2YB1 A;  4YG2 A;  3JPR A;  3SZ2 A;  3RB4 A;  2JGA A;  1J97 A;  7ICO A;  2KVC A;  2LYH A;  2XC9 A;  3AUO A;  4IQW A;  4PGX A;  3SD7 A;  2NRV A;  1NJY A;  1O03 A;  5ALZ A;  4JUZ A;  5J0W A;  4Y2R A;  3RB3 A;  2KFN A;  5J0O A;  3ZI4 A;  4RQ2 A;  5L9X A;  2R8G A;  4I2C A;  8ICM A;  4O5C A;  4RPX A;  3M9N B;  2QLT A;  1ZQR A;  3M9M B;  2ALZ A;  3H4B A;  4BXO A;  5KL1 B;  2LM4 A;  7ICP A;  2FJ6 A;  3N28 A;  4OJ5 A;  3RJK A;  3CW2 C;  4OO1 J;  4PGY A;  2BCV A;  3SEI A;  1BNP A;  1SKR A;  3ZDC A;  3NS1 A;  1NKE A;  2C2D A;  5ALN A;  4KLJ A;  3MDA A;  5ALS A;  5J2K A;  2H3Q A;  3FC4 A;  2V4Q A;  5AM1 A;  2BQ3 A;  3WKD A;  3GIK A;  2ATL A;  1S10 A;  1IM4 A;  3BS5 A;  2XY5 A;  2EAO A;  4GXJ A;  4UAU A;  5DGA A;  1ZQV A;  3HKZ F;  2W04 A;  2XVT A;  2E1E A;  2AGO A;  3EW9 A;  4QWE A;  4CDG A;  3MC1 A;  1ZQE A;  4BWJ A;  2DQN B;  4Q8E A;  5JRT A;  3MR6 A;  3BDP A;  3FDS A;  3WKE A;  3V7J A;  1L3S A;  5DDY A;  4IR1 A;  1Z4N A;  3TFR A;  1ZQO A;  3ZDA A;  4US8 A;  4I2F A;  4I27 A;  1NK9 A;  2K4I A;  1JRP A;  2Y9T A;  4RPY A;  3N4M B;  8ICI A;  3TAR A;  7ICQ A;  5J2J A;  2PI5 A;  5J2F A;  5FP0 A;  2ZIX B;  4IQU A;  4KLQ A;  3WK5 A;  1NK6 A;  4I28 A;  4F5O A;  2MRL A;  2I5H A;  3C5F A;  3KHG A;  5J2E A;  2I1Q A;  4ACO A;  1KFD A;  2FDR A;  4M6W B;  3K4G A;  5J0R A;  5T14 A;  3EZ5 A;  4F5Q A;  9ICC A;  4R65 A;  4NV0 A;  2W9C A;  1TK5 A;  2KIC A;  4GXI A;  5JTI A;  5DLF A;  4RQ7 A;  2A1J B;  4K4G A;  3RR7 A;  3V72 A;  1RM6 C;  4Y2Q A;  1QLN A;  4UAS A;  5DBC A;  3C2L A;  4UB2 A;  1TV9 A;  4GLX A;  4ELT A;  1JAL A;  1N60 A;  4JWM A;  4YN4 A;  1SWV A;  3CRX A;  3T3F A;  1KFS A;  3AM9 A;  3A0B U;  2Q0Z X;  2DKX A;  2HOQ A;  1ZQK A;  3DEE A;  4TUR A;  3ETL A;  4QNL A;  3M6K A;  3RJH A;  4Y2T A;  4F4K A;  3E0F A;  3ONN A;  3ZD8 A;  2HHQ A;  4Y2X A;  1NK8 A;  2OCE A;  4DEZ A;  5JUM A;  4NJ8 A;  5ALH A;  7ICM A;  4IRC A;  1MSW D;  3D2N A;  4CF4 A;  3LVV A;  2CRX A;  1WG8 A;  1LVH A;  1UA1 A;  2FI1 A;  3PR5 B;  5J2G A;  3C29 A;  2IA6 A;  3PO4 A;  4NY8 A;  5AI6 A;  2BCU A;  2ZIV B;  5ALR A;  1PK3 A;  5ALE A;  5CB1 A;  3K1Z A;  1N61 A;  3SEN A;  3RH6 A;  2ODG A;  3S6J A;  3BQ2 A;  3G6X A;  2LM1 A;  5KT6 A;  5HR7 A;  3QU5 A;  3RH5 A;  8ICC A;  3ED5 A;  4UB8 U;  2HVI A;  4DOC A;  4ZH4 A;  4UBB A;  5AIC A;  2H3V A;  2WAQ C;  4QZA A;  4UAV A;  2W54 A;  1T3N A;  1L8L A;  4EYI B;  4EX6 A;  3H0M B;  4F50 A;  5D49 A;  1KN5 A;  1K1S A;  4B9U A;  7ICR A;  2Y0S F;  1KSP A;  4HAI A;  5JU5 A;  1NJX A;  2XO7 A;  5EWG A;  2ZJ5 A;  9ICK A;  4F5N A;  4O3N A;  2W8K A;  1Q3U A;  2F1J A;  3Q8R B;  4O0I A;  1ZQG A;  1TAQ A;  2VJ4 A;  2FPK A;  9ICH A;  1NKC A;  2W3S A;  4QW9 A;  2ZJ8 A;  5KFI A;  5DB6 A;  3H0R B;  2KKP A;  3OSN A;  1NI3 A;  4QW8 A;  5D4B A;  7ICH A;  1DXS A;  4B9V A;  2HBJ A;  5DG7 A;  4EX7 A;  3TAD C;  3SAG A;  4I2B A;  2VAN A;  2KHQ A;  1HUZ A;  4ECU A;  2I6X A;  4NLB A;  4BGD A;  3WK8 A;  4EYH B;  2DWQ A;  3WK6 A;  1SGG A;  1HUO A;  5AKK A;  4P0Q A;  2HDO A;  2EZZ A;  3KHL A;  2PFN A;  3EUB 2;  1T94 A;  3PMN A;  4B6J A;  1XC9 A;  1NK4 A;  4B9N A;  2IMW P;  3V6H A;  4J9P A;  2LI6 A;  1RDF A;  4RNM A;  1KBU A;  2F2A B;  8ICQ A;  2FMQ A;  2DFL A;  3KD3 A;  4DOA A;  4B9L A;  4E0D A;  4GIB A;  5AM2 A;  2YN4 A;  3UXN A;  2WF9 A;  2ISO A;  1V85 A;  5KFJ A;  1N56 A;  1ZQX A;  2FMS A;  4KN7 A;  5AKX A;  5KFM A;  5DQH A;  4F5R A;  2OHF A;  3B9J A;  5J0Q A;  3NVZ A;  1JI7 A;  2ES6 A;  1L3T A;  1Z1V A;  2WF6 A;  2OXO A;  4OJP A;  4WJ3 B;  4MFA A;  2ZIX A;  4DLG A;  2E5S A;  5ALJ A;  5J0U A;  3UQ0 A;  4RUA A;  3C5G A;  4FS1 A;  1RQL A;  4DQS A;  4IQT A;  1BPY A;  4F71 A;  1RYU A;  4RQ1 A;  5J0S A;  5EOZ A;  4M6W A;  3MAB A;  7ICJ A;  1IXR A;  4J9L A;  4KMO B;  2ZIU B;  5C5J A;  3JPS A;  7ICN A;  3QZ7 A;  2QB0 A;  2IHM A;  5F9L A;  1U49 A;  2KMD A;  4KLI A;  5EE1 A;  1TFR A;  2A1J A;  1VDV A;  4ZOH C;  1PVQ A;  5G5G A;  3KFU F;  4TUP A;  4XA5 A;  2K89 A;  9ICM A;  3RF9 A;  1XWL A;  4C4S A;  4KMU A;  2LPE A;  4LVS A;  1KW4 A;  2UVV A;  1ZD2 P;  4QJF B;  4O3O A;  1XU4 A;  1C20 A;  3N7P D;  8ICG A;  4M47 A;  3OGU A;  2LKY A;  4YR3 A;  2HHT A;  1FO4 A;  2F76 X;  9ICI A;  4NWI A;  3OHA A;  4Y2J A;  1DK2 A;  3GFK B;  4UB3 A;  3SMV A;  1TAU A;  2E1F A;  5J2H A;  2BPC A;  2K4E A;  2ZTE A;  2ZJA A;  1DOQ A;  5L1J A;  3H0L B;  2NRZ A;  4M9J A;  2JR5 A;  1U48 A;  4Z6C A;  1OXJ A;  4U6P A;  2A19 A;  5J8Y C;  1YZ7 A;  7ICG A;  2Y1I A;  2ZIV A;  2VJ5 A;  5ALQ A;  2LBO A;  3BQ7 A;  1S8O A;  4FZM A;  3V6J A;  3BQT A;  5J29 A;  1FFU A;  3KZI U;  1NK7 A;  4ECT A;  4UAW A;  1RYS A;  1MC8 A;  4IC9 A;  4PJ0 U;  3WU2 U;  4EEL A;  3NRZ A;  3BQ0 A;  4PHP A;  4C80 A;  4JB3 A;  2ZUB A;  3QNM A;  3QU9 A;  2W9B B;  4GC6 A;  4PH5 A;  4ED3 A;  4FS2 A;  3CYM A;  3T5L A;  3Q8K A;  2XCA A;  3NTU A;  2WB1 C;  3F2B A;  3RJE A;  9ICR A;  2ZXH A;  3MBY A;  1ZQT A;  3EPI A;  4K4I A;  3PSF A;  7ICI A;  1U47 A;  1RQN A;  2D3D A;  3M6Z A;  8ICU A;  3T5K A;  4R8U A;  2MUT A;  3RAX A;  2VKQ A;  5KG7 A;  3GDX A;  4GC7 A;  1LV5 A;  4R64 A;  5DG9 A;  3GIJ A;  1F0M A;  5CJ7 A;  4DL2 A;  4PPX A;  5AIA A;  1ECW A;  2J6T A;  3I1Y A;  3N7S C;  1ZJN A;  3SQI A;  4CNQ A;  2G08 A;  1QSS A;  3PW4 A;  4C8O A;  4NM1 A;  1X40 A;  3PX0 A;  3QXG A;  4DQQ A;  9ICS A;  5GTH U;  2Q4T A;  1N63 A;  3BS7 A;  2R8I A;  2BQR A;  8ICL A;  1N5X A;  5J0T A;  3RJG A;  1ZQA A;  4DQI A;  2RRD A;  3QX7 A;  3UM9 A;  2EAP A;  5KFF A;  3RTV A;  4FBT A;  2G5H B;  2D8C A;  5DGB A;  4KN4 A;  2XCP A;  2WTF A;  4UQG A;  5HP4 A;  5K4L A;  4IL6 U;  3F5E A;  5CHG A;  4P0P B;  1HJP A;  2RP5 A;  2DL0 A;  3L3F X;  2NRX A;  2OM6 A;  1Z3E B;  4DWI A;  1SL0 A;  1WWU A;  3MGH A;  2PFP A;  5J2I A;  1F5S A;  3PML A;  3F53 A;  5CEH A;  2ZIW B;  4Y2S A;  4O3R A;  4Z6E A;  1N62 A;  8ICZ A;  1K1Q A;  2XI9 A;  5KTQ A;  5B66 U;  1URJ A;  3BQ1 A;  4EEN A;  2MU2 A;  5AIB A;  4OCZ A;  1AQ6 A;  4ICA A;  3NVV A;  1U4B A;  4UB5 A;  3RRG A;  2OEH A;  4PZO A;  2UVW A;  1C7Y A;  5KFD A;  4NLZ A;  2ZIU A;  2CXY A;  2GWS A;  1NZB A;  3UMC A;  3SAF A;  2PI4 A;  4KLT A;  5EE9 A;  2F44 A;  3D6J A;  4IRK A;  5KG6 A;  3A0H U;  5KFV A;  2XGP A;  5CP2 A;  1COO A;  3KHR A;  4DO9 A;  4I2I A;  1QSL A;  7ICF A;  3N97 B;  1L5U A;  3KKA C;  2K4P A;  5AI9 A;  4Q8F A;  3I28 A;  1PUZ A;  1ZXI A;  2BCS A;  1SKS A;  1QQ5 A;  4FZN A;  3RH4 A;  4ECY A;  3Q8L A;  1S77 D;  4P2H A;  1VLB A;  3F2C A;  2LMR A;  4RQ3 A;  4RU9 A;  2KIW A;  1XS9 D;  3PW7 A;  2QKQ A;  5J2D A;  7ICL A;  2AQ4 A;  4ECS A;  2UVR A;  2AGP A;  1KQQ A;  3NAS A;  2FLP A;  3H8S A;  1BPX A;  2XID A;  1X2I A;  1FIQ A;  2YMM A;  2GLE A;  4DF8 A;  3AQF A;  1WCN A;  1TK8 A; 
#chains in the Genus database with same CATH homology
 1UCV A;  2DKZ A;  3TAD A;  1COK A;  2E8M A;  3IDW A;  5JU5 A;  1SXD A;  2DL0 A;  2EAN A;  1X9X A;  1OW5 A;  2QAR B;  5JTI A;  1SXE A;  1WWU A;  2L5Y A;  3BS5 B;  2Y9U A;  3HIL A;  2ESE A;  2QB1 A;  3SEI A;  1B0X A;  2QB0 A;  1SV0 A;  4MHV A;  2KG5 A;  2KMD A;  2F8K A;  3KKA A;  3K1R B;  2QAR A;  1PK1 B;  4IS7 A;  3H8M A;  1DXS A;  1SV4 A;  1LKY B;  4PZO A;  2D3D A;  3BS5 A;  2DKX A;  3TAD C;  2EAO A;  2F3N A;  2KIV A;  2LPE A;  1KW4 A;  5J8Y A;  1PK1 A;  2F44 A;  1F0M A;  1SGG A;  2B6G A;  4PZN A;  2KSO B;  1B4F A;  2E8P A;  4NL9 C;  4NJ8 A;  5KNI A;  5JRT A;  1X40 A;  1X66 A;  5L1M A;  2KSO A;  3KKA C;  2K4P A;  2E8O A;  1RG6 A;  3BS7 A;  1PK3 A;  2Y9T A;  4RQN A;  1WWV A;  2KE7 A;  2LMR A;  4RQM A;  1V85 A;  3SEN A;  1UQV A;  2EAM A;  1LKY A;  2QB0 B;  1V38 A;  2FE9 A;  2QKQ A;  3TAC B;  2K60 A;  1OXJ A;  5J8Y C;  2YTU A;  4NL9 A;  2EAP A;  3BQ7 A;  1SV0 C;  5F3X B;  2GLE A;  2JV3 A;  2D8C A;  1JI7 A;  2ES6 A;  1Z1V A;  2E8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...