2XVTA

Structure of the extracellular domain of human ramp2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
VKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Extracellular Domain of Human Ramp2
rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords RECEPTOR ACTIVITY-MODIFYING PROTEIN 2
total genus 28
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2xvtA00
3N7PD 3N7SC 3AQFA 2YX8A 2XVTA 3N7RC 3AQEA
chains in the Genus database with same CATH superfamily
1IV8A 4QWCA 3ISCA 3WK7A 2HVIA 2KN7A 5KT6A 2FLPA 8ICYA 3PW4A 1KL9A 1NZPA 1ZQIA 2NV3A 5J29A 2RP5A 4C8OA 3MGIA 3N97B 4Q44A 5ALXA 2IHNA 5DQGA 4RQ4A 3GIKA 3H8JA 3MR3A 3TACB 1UCVA 5J2IA 4AYBC 3F5AA 1ZQTA 2BPCA 3ZDEA 2B0CA 1SV4A 4EELA 3PX6A 4J9QA 4EBDA 3Q8KA 1TAUA 1KEJA 2VKQA 5J0YA 3IP4B 4QZFA 1RQLA 3SD7A 1JN3A 3QU9A 2ESEA 5EE9A 3K75D 4CNQA 4CE6A 3NASA 1T7PA 1N5WA 1V38A 2ZIVB 2YB4A 1V9PA 2AXTU 1QCKA 3TADA 4OJLA 5ALEA 4O5EA 5HHHA 2C22A 2R18A 5JUMA 1TAQA 1L7MA 3N7PD 4M6WB 3UQ0A 4G9BA 1X9WA 5G5HA 3OJUA 4NM1A 3PNCA 2JEFA 2UVUA 2KHVA 4RQ1A 4FZMA 5KFSA 5AK4A 3GV8B 3K1RB 4NXZA 5CR0A 5B5EU 3PW5A 3GZFA 2F44A 4PHAA 4KLHA 4EZ9A 2LYAA 2BZFA 1L8OA 4FZLA 5GTHU 3NGDA 4F71A 1QTMA 1X2IA 9ICXA 5BPCA 4Y2TA 4ICAA 3UXNA 5ALSA 2ATLA 2ASJA 3HT3A 4QZEA 1FFUA 3JPNA 3DV9A 4RQ5A 4O3SA 2EAMA 4BXOB 2RHFA 5KFWA 3D2SA 9ICHA 1PUZA 4UAYA 2WF6A 5ALMA 3V6HA 4NLZA 1ZRNA 3H4BA 8ICVA 2MRLA 2HMXA 5KG5A 1ZQBA 1VDVA 4CDGA 5BOLA 2K89A 2KFNA 8ICIA 1QQ5A 2D6FC 9ICGA 2JR5A 1X9MA 2NRVA 2UVRA 4O9MA 3AMZA 4GXIA 1SL0A 2VA8A 2BPGA 2NYVA 1FFVA 2YMPA 2IOHA 4RQ2A 1S8OA 1VLBA 1ZD4A 4FFDA 4IR1A 1T3QA 3U26A 2Y9TA 5KFUA 4NL9A 4NLBA 3RAXA 2F1IA 2D3DA 5ALVA 1FO4A 2E1FA 4USAA 3HW8A 4UQGA 1KFSA 2FMPA 2ASLA 2K60A 4RQ8A 2F1JA 1XU4A 2JGAA 1NJYA 2KNJA 7ICGA 3BS5B 5E79U 4KLLA 3RH6A 1NKEA 4KLUA 3LDAA 2Y0SC 5ALKA 4RUCA 4M0AA 1TK8A 5BOMA 4F4KA 4DLEA 1ZETA 5AKZA 1TKDA 1M6YA 2BPFA 1MN8A 3VC8A 2OHFA 2J6UA 5CP2A 3WK5A 4F4XA 5IINA 2PXIA 1DXSA 5J0TA 1Y88A 2HHSA 3MFHA 9ICUA 1XO0A 2JH7A 5KNIA 4FBTA 3L3FX 4I2GA 4P2HA 4QWBA 2K4IA 2FLNA 4QZBA 4YCXA 4UB8U 2KKPA 4BJQA 3MC1A 1SWWA 5HP4A 1ED1A 1SZPA 4OJ5A 1DK2A 9ICNA 2ZJAA 5KFRA 4YP3A 2IA6A 7ICUA 5AI4A 3RJIA 4XRHA 4PGQA 4YMMA 4RUAA 2LYHA 1TV9A 3PX4A 2ZXIA 4Y2UA 5L1KA 4X5VA 3A0HU 4BXOA 1RZTA 4UBBA 4EBEA 4YXMA 4RQ7A 5KFKA 1KN5A 3TFRA 1XSLA 2IMWP 4RQ0A 3F53A 1DRGA 1KFTA 5KFLA 2DPIA 1TAMA 1RPLA 3L4PA 3IRUA 3QUCA 5J0XA 4F2RA 1SL1A 2W11A 4O3OA 2QB1A 2K4EA 4ECYA 3OSNA 5J2AA 4EEKA 4MHVA 2Y1JA 4QZDA 8ICUA 2FJ6A 4F5NA 5ALTA 7ICRA 4TQSA 3LYSA 3T5JA 8ICBA 4EBCA 3M7DA 4R8UB 5ALOA 5KT2A 3MFIA 1NK4A 1X6IA 3UPQA 1WUDA 3RR7A 1YZ6A 2XCPA 3NTUA 4GXJA 1NJWA 3SAFA 1C7YA 3V7JA 4XA5A 4YR3A 4UAZA 3GQCA 1ZOLA 3N7SC 1OW5A 3UXOA 2OEHA 3MABA 1RXWA 2KJ9A 5A0LA 7ICNA 3SR6A 2Y9UA 4DS4A 3PR5B 1DK3A 5HR6A 2FLLA 4YR0A 2IHMA 4DFMA 1TVAA 3RB4A 5KFGA 3MR5A 1X9XA 3QUTA 2BHNA 2GOLA 5ALIA 3GIMA 3H40A 3V6JA 4DOCA 3UMCA 5KL8B 3JPSA 4BWJA 4IQWA 3C21A 4KMUA 4QWDA 2KVSA 5ALLA 5D46A 2W9BA 2BCUA 4DQSA 1Q3UA 4KLQA 2WAQF 4UAUA 1U45A 3C5GA 2F76X 4G3IA 4DS5A 8ICHA 1IXRA 5J2DA 1VJ5A 4UB2A 5AKXA 3QUBA 5AKHA 4Y2RA 4OCZA 1L7OA 3L5KA 3F2BA 5KG2A 4FS2A 8ICJA 4KLMA 2ALZA 1ZQUA 2AU0A 3HRDD 4JWMA 2R8GA 1F5SA 5ALPA 1K1QA 3I76A 3WK9A 4LZGA 8ICOA 1DGSA 5DG7A 5AK3A 1HUZA 1ZQVA 1B4FA 4DSEA 2QB0A 3WKBA 4P4MA 4I2CA 2IOFA 3RR8A 4RU9A 2PI5A 1DOQA 4PL2A 2XC9A 5J0WA 4QWEA 4EENA 2I1QA 4NWIA 4F72A 2K4PA 3F2CA 1ZQNA 2W3RA 4ED2A 1FEZA 2PMZC 3PV8A 3SQIA 1PVQA 3KHHA 4GC6A 4RT3A 2P6RA 4CCHA 1TE2A 7ICQA 4IS7A 2XY5A 5KFOA 9ICFA 4F91B 1QSLA 4OJ6A 4C8MA 2OM6A 1N2XA 5ALHA 4FE3A 2E5SA 4MFAA 1RYRA 2ZIUB 5AIBA 2W03A 4DL3A 2NO5A 2W54A 1ZQOA 9ICRA 3JPRA 2W43A 2P66A 1U49A 4EEYA 2PI4A 2W8LA 1PK1B 1XNSA 5ALYA 4PHDA 4QIWF 2HBLA 5C5JA 2KIWA 4BDPA 4I29A 1D8BA 2AHOB 9ICLA 2W7OA 3QEAZ 2YX8A 4KTQA 3AEVA 4DL2A 5DDYA 1CEZA 1T4GA 1UA1A 4AYBF 2RDIA 1S76D 1U47A 3KD3A 4OJOA 1L7PA 1JIHA 5KL1B 5CEHA 3RJJA 3Q8MA 9ICWA 1NK6A 5IIJA 2XI9A 4U6PA 4Q8EA 1EXNA 4C8NA 4KN4A 4KLSA 2Q4TA 5KFQA 3I28A 5DQHA 4C8KA 4J9RA 3RJKA 4RNNA 4KLOA 2G0AA 5KT3A 2LHTA 2A19A 4YFKA 3HKZC 9ICTA 2E8MA 4XQ8A 1SGGA 2ISOA 3ETRA 2KZZA 4UASA 3H0LB 2HSZA 3TKAA 2KZMA 1SXEA 3QZ8A 2W04A 5DB9A 1ZQRA 2Y0SF 1SKRA 2HDOA 3HJEA 4B9MA 1RYUA 2GH1A 3M9OB 1B0XA 2ZIWB 5AI0A 3T79A 4C0ZA 2EDUA 4UB4A 4ECRA 2LMRA 1KRPA 3D2NA 3RJHA 1ZD3A 4ECZA 4DOAA 5HMMA 4J9NA 2ZJ5A 4FO6A 3B0YA 5KTQA 3LVVA 3WK8A 9ICAA 2DGZA 2W8KA 1JALA 2I5HA 7ICFA 3D2QA 2GO7A 2CRXA 1KKXA 2HBJA 3LVWA 4GFJA 3H8WA 2F3NA 3EW9A 5KG0A 2Y1IA 4CF5A 1ZQHA 5KFEA 2G08A 1JROA 2XY6A 4IL6U 2DL0A 4YMOA 2H3FA 4CF3A 3UM9A 4PZNA 4BWMA 3EPIA 3FYHA 5DBBA 2HI0A 4QZHA 5DG8A 4QZGA 1ZQZA 1V85A 2CPRA 2QARB 3CRXA 1KW4A 3WU2U 5FP0A 4PZOA 4M9HA 1SXDA 5L1JA 1Q3VA 3QU2A 2YMQA 5L1IA 2NRZA 2AQ0A 3CW2C 1CUKA 1B43A 3PSIA 4MFFA 1WCLA 1BPEA 1ZQFA 1N60A 3E0FA 3SMVA 4C4TA 1S5LU 5ALUA 1RDFA 4QZAA 2F1HA 2KIVA 1IIPA 2JZBB 1ZD2P 4DSKA 4M2YA 4P0QA 2KKVA 1Z4NA 4IQVA 1QH9A 1KDHA 3KZXA 1QQ7A 1NZBA 2ZXHA 5KFBA 2Q0ZX 2E3TA 2NO4A 2MUTA 3QU5A 5KFDA 2W7PA 5AICA 4B6JA 4RPYA 1QLNA 4ACOA 2VA2A 2M0NA 4P0PA 1JUDA 4US8A 3QXGA 4ED7A 3M1YA 5L9XA 4NV0A 1XSNA 3IG5A 7ICKA 2KICA 2ZIXA 4F5RA 3PX0A 3T3FA 3HP6A 4ED0A 4AP9A 4RT2A 1UHUA 2FPKA 4P0QB 1ECWA 2J6TA 4Q43A 3RH5A 5HR7A 3EWAA 2H3VA 3GIIA 4JV1A 3LK9A 2P35A 4QW9A 2JZBA 4KLJA 1MQ3A 2EQYA 2K8BB 3UXPA 1N56A 5AI9A 4C8LA 2EZXA 5J8YC 3AM9A 3PMLA 1ZXIA 3QEBZ 4KLIA 4RNMA 3TADC 9ICBA 3C29A 1H38A 1RYSA 4RNOA 3TAPA 2XVTA 1NJXA 2BCSA 2ZUCA 3RB0A 3N28A 5AIAA 4M04A 2MSNA 3NVVA 8ICPA 2QARA 4DFPA 4I27A 3RBDA 1S9FA 5IIIA 9ICQA 1KQQA 3SZ2A 4DFKA 2OYYA 3OHAA 2E8NA 9ICJA 2XICA 1L8LA 3FM9A 1N63A 3JPPA 1LB2B 1NK5A 2N1RA 3F5EA 3C23A 2K8AA 1RG6A 9ICOA 3C2KA 2PFQA 4K4GA 2H3ZA 2BCVA 4HYKA 4B9TA 2KSOA 3BQ0A 4ECUA 1BPBA 2LI6A 2ZTEA 3TI0A 1ZRMA 3MDCA 5KG1A 5CB1A 4FBUA 3JPOA 3NVYA 3ZD9A 2KJ5A 2H3IA 4F92B 4QZ9A 5J2FA 1MQ2A 4C4SA 5KAFU 2VIXA 3M8SA 3OHBA 4R64A 2VJ4A 2VA3A 4F93B 1Z00A 2LBOA 3IN5A 2R8JA 5CWRA 2ZIXB 1BPYA 4KLEA 2JV3A 1SV0C 3OJSA 4IQUA 2R8HA 4ECTA 1K1SA 5KFMA 1WWVA 8ICGA 4MEYA 1O03A 1N62A 3PZPA 5DG9A 2J6SA 3Q8PB 1WWUA 2WF9A 2JEJA 2ZJ8A 3IM1A 4IRDA 4O5KA 2YY6A 3Q8SB 1UT8A 2FPLA 3BQ2A 4I2EA 4I2HA 2O6KA 4CF4A 4UAWA 3KTQA 1BPDA 1URJA 2HOFA 2KP7A 7ICTA 2E8PA 7ICOA 2JXJA 3PR4A 4YR2A 3DEEA 2B21A 4R66A 5TISU 1HIWA 2V9WA 1ZQEA 3T5KA 4I28A 1ZJNA 7ICLA 1LVHA 3KHRA 4F2SA 7ICIA 3FAHA 2M9NA 3MDAA 4RQ3A 3K4GA 4GIBA 5HMLA 3HWTA 4DSFA 4US9A 4O3NA 4UB6U 2DFLA 3EPGA 1PK3A 1Z3EB 5AKJA 4B9UA 3NUQA 3H4DA 3B9JA 3C2LA 4UB5A 2OXOA 2YN4A 4ECQA 1O08A 2W9CB 5AM3A 2DQNB 4ED8A 4DCCA 5KFTA 1LKYA 2EANA 3ZDDA 2CN1A 2ZUDA 3ONNA 2HHTA 5JTIA 1L5UA 3QZ7A 8ICAA 1SV0A 4QW8A 5KG6A 3OSPA 4C7ZA 4DQQA 1S77D 1BNOA 5B66U 4TUPA 4UAVA 2AGOA 4KLFA 1AROP 2KTQA 3PO4A 2NRWA 2RDJA 4ECVA 4B9VA 1XO1A 2K8CB 1NK7A 4Z6FA 5AK6A 4CRXA 4PGYA 4R65A 4DO9A 1OXJA 4NLGA 2HOQA 4Y2QA 3BQ1A 2I9GA 4JV0A 5IIMA 4WJ3B 1NNLA 3S6JA 3HKZF 3PW7A 4DEZA 1ZJMA 2KFZA 3THVA 5KFJA 5KFHA 5ALRA 1MA7A 3CNHA 4F4YA 3KFUF 4NLKA 5F9LA 2MUTB 3RH4A 4KLDA 4DLGA 5ALQA 3ETLA 2QB0B 8ICTA 2WTFA 2LKYA 2KK0A 5KFIA 1JXEA 4UBCA 1ZQSA 1Z1BA 3GV7B 4KITB 2BCQA 5IILA 2OWOA 4I2DA 3F2DA 5L1LA 2L5YA 4KX5A 4J9OA 1UA0A 1NKCA 3AN1A 4NL9C 1BGXT 2FE9A 5EWGA 3CP8A 1B22A 4MEXA 2W9CA 4YMNA 1JRPA 5KT7A 4ECWA 4J9LA 3MGVA 2MA1A 3OGUA 3V72A 2KG5A 5AKKA 5ALDA 5AM1A 3RBEA 2AJQA 2LPEA 5KFZA 4BX9C 1U48A 4O3PA 5D4BA 2YMMA 4UB1A 4I2JA 4I2FA 5J0OA 2C2EA 2F2AB 4TUQA 4RQMA 4I2IA 2EAPA 4ECSA 1XC9A 1ZQXA 1Z1VA 3RAQA 1ZQPA 8ICCA 1ZQCA 4Y2SA 5AHXA 4YVZA 1ZQKA 3AL0B 3BQ7A 3SV4A 1NK0A 3JPQA 2KE7A 4Y2XA 1L7NA 5EOZA 2BCRA 4UW9A 3GU3A 3QUQA 1TK5A 1V97A 4JUZA 5J0RA 4O0IA 1Q46A 8ICZA 1XS9D 2AGQA 3AQFA 2KV2A 4F8RA 1PZNA 3T5LA 3QE9Y 4ED3A 2ZTCA 3C1YA 3PW2A 4EYHB 4RPZA 2RRDA 4DQIA 3KHLA 4DOBA 5KT5A 5J2JA 2ZUBA 2OCEA 3SEIA 5DLFA 3LWLA 2FMSA 5J2BA 2XIDA 3FDSA 5DB8A 9ICSA 4F5OA 3WKAA 9ICEA 5KFPA 9ICIA 4M9JA 1YT3A 2G06A 3IG8A 5J2CA 8ICFA 3QX7A 2JH1A 4OD0A 2NRTA 5F9NA 4TURA 4DQRA 2ZIVA 5DB7A 4CGZA 1COOA 1ZQ1C 2WF8A 5KAIU 2K4HA 3V7KA 4ED1A 2VJ5A 2DKXA 3KOOA 1X9SA 1WYGA 3BS5A 2PKEA 1HJPA 3H0MB 1U4BA 4EZ6A 3GFKB 2DBYA 1T94A 4BUGA 2HOIA 4QWAA 3M9MB 3BS7A 2DPJA 2WHEA 2UVWA 5GTIU 5C0YA 5L1MA 4KLTA 1J97A 2W9AA 2H5XA 1COKA 2F8LA 1S0OA 2ZTDA 3QU4A 4F4WA 3G6YA 4O3RA 1S0NA 4J9MA 3SENA 4J9KA 2FI1A 3AQEA 3V6KA 2YQEA 2WB1F 2C28A 2QKQA 4YN4A 4B9LA 3BZCA 2W9BB 4DSIA 2YMLA 1BPZA 4EX7A 4M47A 8ICLA 2HHVA 5AI5A 4M6WA 8ICRA 2NRXA 7ICVA 4DL6A 4KX3A 1CRXA 2HHWA 3RF9A 8ICSA 1K5OA 3PW0A 1L3TA 2KHQA 4PH5A 4P4PA 2BR0A 1SIJA 2EZZA 3SAGA 1ZQLA 1NI3A 1F0MA 2PMZF 4OO1J 3Q8RB 2XGQA 2RQ5A 5AI6A 1ZQWA 4DL5A 3E2EA 2GLEA 1KBUA 4ECXA 1T8EA 3ZDAA 1ZD5A 4U7CA 5J2EA 4PHEA 4DF4A 5AKYA 3WK6A 3HPOA 9ICPA 4MF2A 3GDXA 5EE3A 3BDPA 2BQRA 1NK9A 3PSFA 3PSPA 4FZNA 4F5QA 4KLGA 4YG2A 5AK5A 4DQPA 5ALZA 4UARA 5JU5A 2HBMA 1NOMA 2E8OA 1BVSA 2ZG6A 3N4MB 1N48A 2KMDA 1WCNA 3Q8LA 2E1EA 5J2GA 2V4RA 4ZH4A 5AM0A 4IQTA 1C20A 3RJEA 5AKGA 8ICMA 1A77A 1D9FA 4C4RA 2G07A 1DGJA 4Q8FA 4E0DA 5DQIA 3C1ZA 5CA7A 2BDUA 4RQ6A 4J03A 1X6JA 3G6VA 2W9MA 1KLNA 4LZDA 4QNLA 5KG7A 3H7IA 4R8UA 4QZCA 4K4IA 2B6GA 3RRHA 7ICHA 2R8IA 2BQUA 8ICWA 5CJ7A 5DB6A 5KFFA 2I6XA 3UQ2A 2LYBA 4QIWC 1Z4OA 1J2NA 3JPTA 3WK4A 3RJGA 3RFAA 3LWMA 5J2KA 1ZQYA 5J8YA 5J0QA 2BKEA 3SYZA 3H8SA 3WKDA 2RLTA 5J2HA 5ALGA 4PGXA 1L6NA 4YXJA 1S97A 1RXVA 2UVVA 3E58A 3ISDA 2W55A 4TQRA 1GO3F 4Z6CA 1X66A 4F4ZA 1S0MA 3ICXA 4ZOHC 5KFAA 4HAIA 3WKEA 5AKLA 1D8YA 5KG3A 2HHQA 3VCBA 8ICNA 3OPXA 3BZKA 2JHDA 5IIOA 3UMBA 5ALNA 1OUQA 4DWIA 4M9LA 3ORYA 3EUB2 2JEGA 4ELTA 2KSOB 3CYMA 2BQ3A 4F5PA 2KJ8A 2XCAA 3TANA 3B0XA 5D49A 1QSYA 1MC8A 2W3SA 1Z00B 2JEIA 5ALWA 4DL4A 4YD1A 2KD1A 2ZIWA 2DUYA 5EWEA 2JRZA 2FDRA 1IM4A 2C2DA 2KZ3A 4PL1A 7ICEA 1S0VA 4PHPA 4BGDA 2HVHA 1P7DA 4KMOB 2WFAA 3ALRA 2EZYA 1XSPA 4DFJA 1ZQGA 2KOBA 3OTQA 3DDHA 3IHQB 9ICKA 3N7RC 3NVZA 1JX4A 3EYZA 3R9KA 9ICVA 7ICPA 3HILA 9ICCA 1YZ7A 1L3VA 1IG6A 5EE1A 5HHIA 5KFCA 4I2BA 1A6SA 2AH5A 1BPXA 3I1YA 2D8CA 2G5HB 5DLGA 3QYPA 4RQNA 2G09A 1JMSA 3H0RB 2EAOA 4PPXA 4Z6DA 4Y2JA 4O3MA 2WB1C 1Q8KA 1N61A 5J0SA 4Y2VA 4NJ8A 4P0PB 3TAQA 1WG8A 5HNKA 1PK1A 2XO7A 3A0BU 4J9PA 3AUOA 2P6UA 1MSWD 4FS1A 3MR6A 4GLXA 1UPHA 5JRTA 2DKZA 3QU7A 1ZQDA 4QZIA 1SWVA 2DF4B 3MGHA 5KFVA 3PO5A 3KZIU 3M9NB 2ODGA 2HHXA 5DDMA 2LM1A 2GWSA 4B9SA 4JB3A 4GXKA 2DWQA 2A1JA 4DF8A 5F3XB 1SB3C 1SL2A 2EH9A 2IBKA 3H8MA 2ISPA 4A8EA 2YB1A 1T3NA 2MU2A 5AM2A 5AM5A 2AQ4A 1N5XA 5AI8A 1J2MA 1QQ6A 5DGBA 3HX0A 2BGWA 2HCFA 5T14A 7ICJA 2IOFK 3C2MA 3FC4A 1ZYQA 1A0PA 1CI4A 1NKBA 8ICQA 4MF8A 1TFRA 3GIJA 1NK8A 1AQ6A 2AGPA 1X42A 2Z7JA 2WAQC 3ZI4A 3TARA 1F44A 3C5FA 3GV5B 2A1JB 4QZ8A 4NM2A 5J0UA 4C80A 3SV3A 4YQWA 3IDWA 5ALJA 3TQ1A 4UB3A 1HUOA 1D9DA 2BDPA 3NRZA 3K1ZA 5KFNA 4RPXA 4F50A 2HHUA 3T5HA 2HBKA 1LKYB 5IIKA 3ED5A 9ICMA 8ICXA 3Q8QB 4NY8A 3KKAC 1RM6C 4MFCA 4UATA 5KFYA 4C7YA 3MBYA 1KTQA 1X40A 4J9SA 1QSSA 3PY8A 3NVWA 1UT5A 5KT4A 5ALFA 3AU6A 4EX6A 3SI8A 4LJXA 4ELVA 3RTVA 2PFOA 4JWNA 3ZDCA 1KSPA 3GILA 1BNPA 5KFXA 4Q45A 3NS1A 4JMUA 4R63A 4IR9A 4JV2A 4YD2A 4DL7A 1SKSA 1XWLA 3NRWA 1ZQAA 2F77X 2C2RA 1PVPA 4M9NA 3O0FA 2OH2A 5EE0A 5KG4A 2JMGA 2KEYA 3C28A 1ZQMA 2CXYA 1A76A 2PFNA 4RZRA 1ZQJA 7ICSA 4DSJA 8ICKA 5AM4A 3M6KA 3RJFA 2G5IB 1SKWA 3RB6A 1HEKA 1Z19A 2FMQA 1SZHA 3MR2A 4IRKA 8ICEA 4IRCA 3KHGA 2XY7A 1RQNA 2ES6A 4NLCA 2WF5A 4EYIB 5CRXA 2QLTA 1JXLA 3SAHA 3KKAA 4M9GA 3V7LA 5AKIA 4QJFB 4K4HA 1PVRA 4JK1A 5K4LA 5EWFA 4TUSA 2ASDA 2H3QA 4O5CA 2ZIUA 3M6ZA 1LV5A 1S10A 3UMGA 1TK0A 5DBCA 3RRGA 2F8KA 4ELUA 4OJPA 4NLNA 2HW3A 3PMNA 2LM4A 3G6XA 1UQVA 3AU2A 1U9LA 4IC9A 5G5GA 3D6JA 4F3OA 4P4OA 3RB3A 5DGAA 1ZQQA 4PJ0U 3TFSA 2FPMA 4KN7A 3QNMA 5H2FU 4DFDA 1NJZA 5J0PA 5TZVA 3PVXA 5DBAA 2KVCA 3J81j 2YTUA 4GC7A 4I2AA 2PFPA 2A1AA 3M8RA 3WKCA 5CHGA 1L3SA 2R8KA 1FIQA 4Y2YA 5AKEA 3IV6A 4LVSA 3ZDBA 3BJYA 1D8LA 3PSTA 4B9NA 5DKWA 2XGPA 4DSLA 4O3QA 2MAXA 1KFDA 2VANA 2WF7A 3KBBA 3ZD8A 4XUSA 2V4QA 4Y2PA 4Z6EA 4ED6A 1JI7A 2A3VA 7ICMA 3BQTA 3ISBA 1L3UA 3EZ5A
chains in the Genus database with same CATH topology
2G5IB 3KFUF 2RRDA 2Z7JA 2G5HB 1HIWA 4ICAA 1HEKA 1Z19A 2WAQC 1SZHA 2G09A 2PMZC 3E0FA 3SQIA 1F44A 3SMVA 3SAFA 3H0RB 1PVQA 3H0LB 2NV3A 1L6NA 1XO0A 2RP5A 1KBUA 1GO3F 2JH7A 2LKYA 3L3FX 4NLCA 2XIDA 4O3MA 2WB1C 3N7SC 5CRXA 2K4IA 1IIPA 2KJ9A 2W04A 2RHFA 3ICXA 4U7CA 5A0LA 3SAHA 4P0PB 2OYYA 2Y0SF 3D2SA 1Z1BA 2KKPA 4QJFB 1PVRA 3VCBA 4BJQA 4OJ6A 1YT3A 3K1ZA 2G06A 2XICA 3OPXA 3F2DA 5HR6A 2OM6A 1UPHA 1ED1A 3NUQA 3IG8A 3PSPA 3PSFA 4FZNA 4KX5A 4OJ5A 4P0QA 2KKVA 2JHDA 2GH1A 2HBKA 2N1RA 3F5EA 3F5AA 4AYBC 2OXOA 2H3QA 2K8AA 2ZIWB 2ZIUA 3M6ZA 4FE3A 2JH1A 2E5SA 1OUQA 2GOLA 4C0ZA 3T79A 2DF4B 2HMXA 2H3ZA 2MRLA 3D2NA 3KZXA 2HBMA 3CP8A 2ZIUB 1NZBA 2ZXHA 2W03A 4OJPA 2DQNB 4CDGA 2ZG6A 2ZIVA 5KL8B 4CGZA 1ZQ1C 2VKQA 2W7PA 2K4HA 3CYMA 3IP4B 2K89A 2E1EA 3MGVA 2D6FC 2KJ8A 2MA1A 2VJ5A 2ZXIA 4ACOA 4IC9A 2M0NA 1Q3UA 2CN1A 3ONNA 4P0PA 2WAQF 3H0MB 1XNSA 3LVVA 2DGZA 4NV0A 2KJ5A 1T94A 4BX9C 4BUGA 3IG5A 2H3IA 2HOIA 2KICA 2F76X 2ZIXA 4QIWF 2HBLA 2ZIVB 2YB4A 2KIWA 3D2QA 2VIXA 2KD1A 5C0YA 1D8BA 2F2AB 2ZIWA 2CRXA 2W7OA 2F8LA 2G07A 2HBJA 2VJ4A 4OJLA 2YX8A 4P0QB 1ECWA 2KVCA 3LVWA 3F53A 1DRGA 4GFJA 5HR7A 4JMUA 2LBOA 2BDUA 4PL1A 2YB1A 4NLBA 4A8EA 3IN5A 2H3VA 1TAMA 2R18A 2ZIXB 3F2BA 4AYBF 2K8CB 3AQEA 3N7PD 2G08A 1P7DA 4KMOB 2E1FA 4CRXA 3ALRA 2WB1F 2K4EA 3NRWA 4QNLA 3AL0B 2F77X 4OJOA 5KL1B 1PVPA 2K8BB 3O0FA 5T14A 3PZPA 2OH2A 2JGAA 3GU3A 3PSTA 2KHVA 2H3FA 2KNJA 2HOQA 2XI9A 2KOBA 4FZMA 4U6PA 1A0PA 3RFAA 2Y0SC 3GZFA 3N7RC 2LYBA 3C29A 2Q4TA 4KX3A 2JMGA 3LYSA 1CRXA 4WJ3B 2KEYA 3RF9A 3C28A 2LYAA 3HKZF 3M7DA 3AQFA 2CPRA 3CRXA 4PL2A 2KV2A 4QIWC 2G0AA 2XVTA 1URJA 2LHTA 2KHQA 2A3VA 4FZLA 2HOFA 3SAGA 1Q3VA 3HKZC 2PMZF 1WUDA 1A6SA 4NWIA 3M6KA 3DEEA 1MA7A 3VC8A 3PSIA 4OO1J 3F2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7P D;  3N7S C;  3AQF A;  2YX8 A;  2XVT A;  3N7R C;  3AQE A; 
#chains in the Genus database with same CATH topology
 1IV8 A;  4QWC A;  3ISC A;  3WK7 A;  2HVI A;  2KN7 A;  5KT6 A;  2FLP A;  8ICY A;  3PW4 A;  1KL9 A;  1NZP A;  1ZQI A;  2NV3 A;  5J29 A;  2RP5 A;  4C8O A;  3MGI A;  3N97 B;  4Q44 A;  5ALX A;  2IHN A;  5DQG A;  4RQ4 A;  3GIK A;  3H8J A;  3MR3 A;  3TAC B;  1UCV A;  5J2I A;  4AYB C;  3F5A A;  1ZQT A;  2BPC A;  3ZDE A;  2B0C A;  1SV4 A;  4EEL A;  3PX6 A;  4J9Q A;  4EBD A;  3Q8K A;  1TAU A;  1KEJ A;  2VKQ A;  5J0Y A;  3IP4 B;  4QZF A;  1RQL A;  3SD7 A;  1JN3 A;  3QU9 A;  2ESE A;  5EE9 A;  3K75 D;  4CNQ A;  4CE6 A;  3NAS A;  1T7P A;  1N5W A;  1V38 A;  2ZIV B;  2YB4 A;  1V9P A;  2AXT U;  1QCK A;  3TAD A;  4OJL A;  5ALE A;  4O5E A;  5HHH A;  2C22 A;  2R18 A;  5JUM A;  1TAQ A;  1L7M A;  3N7P D;  4M6W B;  3UQ0 A;  4G9B A;  1X9W A;  5G5H A;  3OJU A;  4NM1 A;  3PNC A;  2JEF A;  2UVU A;  2KHV A;  4RQ1 A;  4FZM A;  5KFS A;  5AK4 A;  3GV8 B;  3K1R B;  4NXZ A;  5CR0 A;  5B5E U;  3PW5 A;  3GZF A;  2F44 A;  4PHA A;  4KLH A;  4EZ9 A;  2LYA A;  2BZF A;  1L8O A;  4FZL A;  5GTH U;  3NGD A;  4F71 A;  1QTM A;  1X2I A;  9ICX A;  5BPC A;  4Y2T A;  4ICA A;  3UXN A;  5ALS A;  2ATL A;  2ASJ A;  3HT3 A;  4QZE A;  1FFU A;  3JPN A;  3DV9 A;  4RQ5 A;  4O3S A;  2EAM A;  4BXO B;  2RHF A;  5KFW A;  3D2S A;  9ICH A;  1PUZ A;  4UAY A;  2WF6 A;  5ALM A;  3V6H A;  4NLZ A;  1ZRN A;  3H4B A;  8ICV A;  2MRL A;  2HMX A;  5KG5 A;  1ZQB A;  1VDV A;  4CDG A;  5BOL A;  2K89 A;  2KFN A;  8ICI A;  1QQ5 A;  2D6F C;  9ICG A;  2JR5 A;  1X9M A;  2NRV A;  2UVR A;  4O9M A;  3AMZ A;  4GXI A;  1SL0 A;  2VA8 A;  2BPG A;  2NYV A;  1FFV A;  2YMP A;  2IOH A;  4RQ2 A;  1S8O A;  1VLB A;  1ZD4 A;  4FFD A;  4IR1 A;  1T3Q A;  3U26 A;  2Y9T A;  5KFU A;  4NL9 A;  4NLB A;  3RAX A;  2F1I A;  2D3D A;  5ALV A;  1FO4 A;  2E1F A;  4USA A;  3HW8 A;  4UQG A;  1KFS A;  2FMP A;  2ASL A;  2K60 A;  4RQ8 A;  2F1J A;  1XU4 A;  2JGA A;  1NJY A;  2KNJ A;  7ICG A;  3BS5 B;  5E79 U;  4KLL A;  3RH6 A;  1NKE A;  4KLU A;  3LDA A;  2Y0S C;  5ALK A;  4RUC A;  4M0A A;  1TK8 A;  5BOM A;  4F4K A;  4DLE A;  1ZET A;  5AKZ A;  1TKD A;  1M6Y A;  2BPF A;  1MN8 A;  3VC8 A;  2OHF A;  2J6U A;  5CP2 A;  3WK5 A;  4F4X A;  5IIN A;  2PXI A;  1DXS A;  5J0T A;  1Y88 A;  2HHS A;  3MFH A;  9ICU A;  1XO0 A;  2JH7 A;  5KNI A;  4FBT A;  3L3F X;  4I2G A;  4P2H A;  4QWB A;  2K4I A;  2FLN A;  4QZB A;  4YCX A;  4UB8 U;  2KKP A;  4BJQ A;  3MC1 A;  1SWW A;  5HP4 A;  1ED1 A;  1SZP A;  4OJ5 A;  1DK2 A;  9ICN A;  2ZJA A;  5KFR A;  4YP3 A;  2IA6 A;  7ICU A;  5AI4 A;  3RJI A;  4XRH A;  4PGQ A;  4YMM A;  4RUA A;  2LYH A;  1TV9 A;  3PX4 A;  2ZXI A;  4Y2U A;  5L1K A;  4X5V A;  3A0H U;  4BXO A;  1RZT A;  4UBB A;  4EBE A;  4YXM A;  4RQ7 A;  5KFK A;  1KN5 A;  3TFR A;  1XSL A;  2IMW P;  4RQ0 A;  3F53 A;  1DRG A;  1KFT A;  5KFL A;  2DPI A;  1TAM A;  1RPL A;  3L4P A;  3IRU A;  3QUC A;  5J0X A;  4F2R A;  1SL1 A;  2W11 A;  4O3O A;  2QB1 A;  2K4E A;  4ECY A;  3OSN A;  5J2A A;  4EEK A;  4MHV A;  2Y1J A;  4QZD A;  8ICU A;  2FJ6 A;  4F5N A;  5ALT A;  7ICR A;  4TQS A;  3LYS A;  3T5J A;  8ICB A;  4EBC A;  3M7D A;  4R8U B;  5ALO A;  5KT2 A;  3MFI A;  1NK4 A;  1X6I A;  3UPQ A;  1WUD A;  3RR7 A;  1YZ6 A;  2XCP A;  3NTU A;  4GXJ A;  1NJW A;  3SAF A;  1C7Y A;  3V7J A;  4XA5 A;  4YR3 A;  4UAZ A;  3GQC A;  1ZOL A;  3N7S C;  1OW5 A;  3UXO A;  2OEH A;  3MAB A;  1RXW A;  2KJ9 A;  5A0L A;  7ICN A;  3SR6 A;  2Y9U A;  4DS4 A;  3PR5 B;  1DK3 A;  5HR6 A;  2FLL A;  4YR0 A;  2IHM A;  4DFM A;  1TVA A;  3RB4 A;  5KFG A;  3MR5 A;  1X9X A;  3QUT A;  2BHN A;  2GOL A;  5ALI A;  3GIM A;  3H40 A;  3V6J A;  4DOC A;  3UMC A;  5KL8 B;  3JPS A;  4BWJ A;  4IQW A;  3C21 A;  4KMU A;  4QWD A;  2KVS A;  5ALL A;  5D46 A;  2W9B A;  2BCU A;  4DQS A;  1Q3U A;  4KLQ A;  2WAQ F;  4UAU A;  1U45 A;  3C5G A;  2F76 X;  4G3I A;  4DS5 A;  8ICH A;  1IXR A;  5J2D A;  1VJ5 A;  4UB2 A;  5AKX A;  3QUB A;  5AKH A;  4Y2R A;  4OCZ A;  1L7O A;  3L5K A;  3F2B A;  5KG2 A;  4FS2 A;  8ICJ A;  4KLM A;  2ALZ A;  1ZQU A;  2AU0 A;  3HRD D;  4JWM A;  2R8G A;  1F5S A;  5ALP A;  1K1Q A;  3I76 A;  3WK9 A;  4LZG A;  8ICO A;  1DGS A;  5DG7 A;  5AK3 A;  1HUZ A;  1ZQV A;  1B4F A;  4DSE A;  2QB0 A;  3WKB A;  4P4M A;  4I2C A;  2IOF A;  3RR8 A;  4RU9 A;  2PI5 A;  1DOQ A;  4PL2 A;  2XC9 A;  5J0W A;  4QWE A;  4EEN A;  2I1Q A;  4NWI A;  4F72 A;  2K4P A;  3F2C A;  1ZQN A;  2W3R A;  4ED2 A;  1FEZ A;  2PMZ C;  3PV8 A;  3SQI A;  1PVQ A;  3KHH A;  4GC6 A;  4RT3 A;  2P6R A;  4CCH A;  1TE2 A;  7ICQ A;  4IS7 A;  2XY5 A;  5KFO A;  9ICF A;  4F91 B;  1QSL A;  4OJ6 A;  4C8M A;  2OM6 A;  1N2X A;  5ALH A;  4FE3 A;  2E5S A;  4MFA A;  1RYR A;  2ZIU B;  5AIB A;  2W03 A;  4DL3 A;  2NO5 A;  2W54 A;  1ZQO A;  9ICR A;  3JPR A;  2W43 A;  2P66 A;  1U49 A;  4EEY A;  2PI4 A;  2W8L A;  1PK1 B;  1XNS A;  5ALY A;  4PHD A;  4QIW F;  2HBL A;  5C5J A;  2KIW A;  4BDP A;  4I29 A;  1D8B A;  2AHO B;  9ICL A;  2W7O A;  3QEA Z;  2YX8 A;  4KTQ A;  3AEV A;  4DL2 A;  5DDY A;  1CEZ A;  1T4G A;  1UA1 A;  4AYB F;  2RDI A;  1S76 D;  1U47 A;  3KD3 A;  4OJO A;  1L7P A;  1JIH A;  5KL1 B;  5CEH A;  3RJJ A;  3Q8M A;  9ICW A;  1NK6 A;  5IIJ A;  2XI9 A;  4U6P A;  4Q8E A;  1EXN A;  4C8N A;  4KN4 A;  4KLS A;  2Q4T A;  5KFQ A;  3I28 A;  5DQH A;  4C8K A;  4J9R A;  3RJK A;  4RNN A;  4KLO A;  2G0A A;  5KT3 A;  2LHT A;  2A19 A;  4YFK A;  3HKZ C;  9ICT A;  2E8M A;  4XQ8 A;  1SGG A;  2ISO A;  3ETR A;  2KZZ A;  4UAS A;  3H0L B;  2HSZ A;  3TKA A;  2KZM A;  1SXE A;  3QZ8 A;  2W04 A;  5DB9 A;  1ZQR A;  2Y0S F;  1SKR A;  2HDO A;  3HJE A;  4B9M A;  1RYU A;  2GH1 A;  3M9O B;  1B0X A;  2ZIW B;  5AI0 A;  3T79 A;  4C0Z A;  2EDU A;  4UB4 A;  4ECR A;  2LMR A;  1KRP A;  3D2N A;  3RJH A;  1ZD3 A;  4ECZ A;  4DOA A;  5HMM A;  4J9N A;  2ZJ5 A;  4FO6 A;  3B0Y A;  5KTQ A;  3LVV A;  3WK8 A;  9ICA A;  2DGZ A;  2W8K A;  1JAL A;  2I5H A;  7ICF A;  3D2Q A;  2GO7 A;  2CRX A;  1KKX A;  2HBJ A;  3LVW A;  4GFJ A;  3H8W A;  2F3N A;  3EW9 A;  5KG0 A;  2Y1I A;  4CF5 A;  1ZQH A;  5KFE A;  2G08 A;  1JRO A;  2XY6 A;  4IL6 U;  2DL0 A;  4YMO A;  2H3F A;  4CF3 A;  3UM9 A;  4PZN A;  4BWM A;  3EPI A;  3FYH A;  5DBB A;  2HI0 A;  4QZH A;  5DG8 A;  4QZG A;  1ZQZ A;  1V85 A;  2CPR A;  2QAR B;  3CRX A;  1KW4 A;  3WU2 U;  5FP0 A;  4PZO A;  4M9H A;  1SXD A;  5L1J A;  1Q3V A;  3QU2 A;  2YMQ A;  5L1I A;  2NRZ A;  2AQ0 A;  3CW2 C;  1CUK A;  1B43 A;  3PSI A;  4MFF A;  1WCL A;  1BPE A;  1ZQF A;  1N60 A;  3E0F A;  3SMV A;  4C4T A;  1S5L U;  5ALU A;  1RDF A;  4QZA A;  2F1H A;  2KIV A;  1IIP A;  2JZB B;  1ZD2 P;  4DSK A;  4M2Y A;  4P0Q A;  2KKV A;  1Z4N A;  4IQV A;  1QH9 A;  1KDH A;  3KZX A;  1QQ7 A;  1NZB A;  2ZXH A;  5KFB A;  2Q0Z X;  2E3T A;  2NO4 A;  2MUT A;  3QU5 A;  5KFD A;  2W7P A;  5AIC A;  4B6J A;  4RPY A;  1QLN A;  4ACO A;  2VA2 A;  2M0N A;  4P0P A;  1JUD A;  4US8 A;  3QXG A;  4ED7 A;  3M1Y A;  5L9X A;  4NV0 A;  1XSN A;  3IG5 A;  7ICK A;  2KIC A;  2ZIX A;  4F5R A;  3PX0 A;  3T3F A;  3HP6 A;  4ED0 A;  4AP9 A;  4RT2 A;  1UHU A;  2FPK A;  4P0Q B;  1ECW A;  2J6T A;  4Q43 A;  3RH5 A;  5HR7 A;  3EWA A;  2H3V A;  3GII A;  4JV1 A;  3LK9 A;  2P35 A;  4QW9 A;  2JZB A;  4KLJ A;  1MQ3 A;  2EQY A;  2K8B B;  3UXP A;  1N56 A;  5AI9 A;  4C8L A;  2EZX A;  5J8Y C;  3AM9 A;  3PML A;  1ZXI A;  3QEB Z;  4KLI A;  4RNM A;  3TAD C;  9ICB A;  3C29 A;  1H38 A;  1RYS A;  4RNO A;  3TAP A;  2XVT A;  1NJX A;  2BCS A;  2ZUC A;  3RB0 A;  3N28 A;  5AIA A;  4M04 A;  2MSN A;  3NVV A;  8ICP A;  2QAR A;  4DFP A;  4I27 A;  3RBD A;  1S9F A;  5III A;  9ICQ A;  1KQQ A;  3SZ2 A;  4DFK A;  2OYY A;  3OHA A;  2E8N A;  9ICJ A;  2XIC A;  1L8L A;  3FM9 A;  1N63 A;  3JPP A;  1LB2 B;  1NK5 A;  2N1R A;  3F5E A;  3C23 A;  2K8A A;  1RG6 A;  9ICO A;  3C2K A;  2PFQ A;  4K4G A;  2H3Z A;  2BCV A;  4HYK A;  4B9T A;  2KSO A;  3BQ0 A;  4ECU A;  1BPB A;  2LI6 A;  2ZTE A;  3TI0 A;  1ZRM A;  3MDC A;  5KG1 A;  5CB1 A;  4FBU A;  3JPO A;  3NVY A;  3ZD9 A;  2KJ5 A;  2H3I A;  4F92 B;  4QZ9 A;  5J2F A;  1MQ2 A;  4C4S A;  5KAF U;  2VIX A;  3M8S A;  3OHB A;  4R64 A;  2VJ4 A;  2VA3 A;  4F93 B;  1Z00 A;  2LBO A;  3IN5 A;  2R8J A;  5CWR A;  2ZIX B;  1BPY A;  4KLE A;  2JV3 A;  1SV0 C;  3OJS A;  4IQU A;  2R8H A;  4ECT A;  1K1S A;  5KFM A;  1WWV A;  8ICG A;  4MEY A;  1O03 A;  1N62 A;  3PZP A;  5DG9 A;  2J6S A;  3Q8P B;  1WWU A;  2WF9 A;  2JEJ A;  2ZJ8 A;  3IM1 A;  4IRD A;  4O5K A;  2YY6 A;  3Q8S B;  1UT8 A;  2FPL A;  3BQ2 A;  4I2E A;  4I2H A;  2O6K A;  4CF4 A;  4UAW A;  3KTQ A;  1BPD A;  1URJ A;  2HOF A;  2KP7 A;  7ICT A;  2E8P A;  7ICO A;  2JXJ A;  3PR4 A;  4YR2 A;  3DEE A;  2B21 A;  4R66 A;  5TIS U;  1HIW A;  2V9W A;  1ZQE A;  3T5K A;  4I28 A;  1ZJN A;  7ICL A;  1LVH A;  3KHR A;  4F2S A;  7ICI A;  3FAH A;  2M9N A;  3MDA A;  4RQ3 A;  3K4G A;  4GIB A;  5HML A;  3HWT A;  4DSF A;  4US9 A;  4O3N A;  4UB6 U;  2DFL A;  3EPG A;  1PK3 A;  1Z3E B;  5AKJ A;  4B9U A;  3NUQ A;  3H4D A;  3B9J A;  3C2L A;  4UB5 A;  2OXO A;  2YN4 A;  4ECQ A;  1O08 A;  2W9C B;  5AM3 A;  2DQN B;  4ED8 A;  4DCC A;  5KFT A;  1LKY A;  2EAN A;  3ZDD A;  2CN1 A;  2ZUD A;  3ONN A;  2HHT A;  5JTI A;  1L5U A;  3QZ7 A;  8ICA A;  1SV0 A;  4QW8 A;  5KG6 A;  3OSP A;  4C7Z A;  4DQQ A;  1S77 D;  1BNO A;  5B66 U;  4TUP A;  4UAV A;  2AGO A;  4KLF A;  1ARO P;  2KTQ A;  3PO4 A;  2NRW A;  2RDJ A;  4ECV A;  4B9V A;  1XO1 A;  2K8C B;  1NK7 A;  4Z6F A;  5AK6 A;  4CRX A;  4PGY A;  4R65 A;  4DO9 A;  1OXJ A;  4NLG A;  2HOQ A;  4Y2Q A;  3BQ1 A;  2I9G A;  4JV0 A;  5IIM A;  4WJ3 B;  1NNL A;  3S6J A;  3HKZ F;  3PW7 A;  4DEZ A;  1ZJM A;  2KFZ A;  3THV A;  5KFJ A;  5KFH A;  5ALR A;  1MA7 A;  3CNH A;  4F4Y A;  3KFU F;  4NLK A;  5F9L A;  2MUT B;  3RH4 A;  4KLD A;  4DLG A;  5ALQ A;  3ETL A;  2QB0 B;  8ICT A;  2WTF A;  2LKY A;  2KK0 A;  5KFI A;  1JXE A;  4UBC A;  1ZQS A;  1Z1B A;  3GV7 B;  4KIT B;  2BCQ A;  5IIL A;  2OWO A;  4I2D A;  3F2D A;  5L1L A;  2L5Y A;  4KX5 A;  4J9O A;  1UA0 A;  1NKC A;  3AN1 A;  4NL9 C;  1BGX T;  2FE9 A;  5EWG A;  3CP8 A;  1B22 A;  4MEX A;  2W9C A;  4YMN A;  1JRP A;  5KT7 A;  4ECW A;  4J9L A;  3MGV A;  2MA1 A;  3OGU A;  3V72 A;  2KG5 A;  5AKK A;  5ALD A;  5AM1 A;  3RBE A;  2AJQ A;  2LPE A;  5KFZ A;  4BX9 C;  1U48 A;  4O3P A;  5D4B A;  2YMM A;  4UB1 A;  4I2J A;  4I2F A;  5J0O A;  2C2E A;  2F2A B;  4TUQ A;  4RQM A;  4I2I A;  2EAP A;  4ECS A;  1XC9 A;  1ZQX A;  1Z1V A;  3RAQ A;  1ZQP A;  8ICC A;  1ZQC A;  4Y2S A;  5AHX A;  4YVZ A;  1ZQK A;  3AL0 B;  3BQ7 A;  3SV4 A;  1NK0 A;  3JPQ A;  2KE7 A;  4Y2X A;  1L7N A;  5EOZ A;  2BCR A;  4UW9 A;  3GU3 A;  3QUQ A;  1TK5 A;  1V97 A;  4JUZ A;  5J0R A;  4O0I A;  1Q46 A;  8ICZ A;  1XS9 D;  2AGQ A;  3AQF A;  2KV2 A;  4F8R A;  1PZN A;  3T5L A;  3QE9 Y;  4ED3 A;  2ZTC A;  3C1Y A;  3PW2 A;  4EYH B;  4RPZ A;  2RRD A;  4DQI A;  3KHL A;  4DOB A;  5KT5 A;  5J2J A;  2ZUB A;  2OCE A;  3SEI A;  5DLF A;  3LWL A;  2FMS A;  5J2B A;  2XID A;  3FDS A;  5DB8 A;  9ICS A;  4F5O A;  3WKA A;  9ICE A;  5KFP A;  9ICI A;  4M9J A;  1YT3 A;  2G06 A;  3IG8 A;  5J2C A;  8ICF A;  3QX7 A;  2JH1 A;  4OD0 A;  2NRT A;  5F9N A;  4TUR A;  4DQR A;  2ZIV A;  5DB7 A;  4CGZ A;  1COO A;  1ZQ1 C;  2WF8 A;  5KAI U;  2K4H A;  3V7K A;  4ED1 A;  2VJ5 A;  2DKX A;  3KOO A;  1X9S A;  1WYG A;  3BS5 A;  2PKE A;  1HJP A;  3H0M B;  1U4B A;  4EZ6 A;  3GFK B;  2DBY A;  1T94 A;  4BUG A;  2HOI A;  4QWA A;  3M9M B;  3BS7 A;  2DPJ A;  2WHE A;  2UVW A;  5GTI U;  5C0Y A;  5L1M A;  4KLT A;  1J97 A;  2W9A A;  2H5X A;  1COK A;  2F8L A;  1S0O A;  2ZTD A;  3QU4 A;  4F4W A;  3G6Y A;  4O3R A;  1S0N A;  4J9M A;  3SEN A;  4J9K A;  2FI1 A;  3AQE A;  3V6K A;  2YQE A;  2WB1 F;  2C28 A;  2QKQ A;  4YN4 A;  4B9L A;  3BZC A;  2W9B B;  4DSI A;  2YML A;  1BPZ A;  4EX7 A;  4M47 A;  8ICL A;  2HHV A;  5AI5 A;  4M6W A;  8ICR A;  2NRX A;  7ICV A;  4DL6 A;  4KX3 A;  1CRX A;  2HHW A;  3RF9 A;  8ICS A;  1K5O A;  3PW0 A;  1L3T A;  2KHQ A;  4PH5 A;  4P4P A;  2BR0 A;  1SIJ A;  2EZZ A;  3SAG A;  1ZQL A;  1NI3 A;  1F0M A;  2PMZ F;  4OO1 J;  3Q8R B;  2XGQ A;  2RQ5 A;  5AI6 A;  1ZQW A;  4DL5 A;  3E2E A;  2GLE A;  1KBU A;  4ECX A;  1T8E A;  3ZDA A;  1ZD5 A;  4U7C A;  5J2E A;  4PHE A;  4DF4 A;  5AKY A;  3WK6 A;  3HPO A;  9ICP A;  4MF2 A;  3GDX A;  5EE3 A;  3BDP A;  2BQR A;  1NK9 A;  3PSF A;  3PSP A;  4FZN A;  4F5Q A;  4KLG A;  4YG2 A;  5AK5 A;  4DQP A;  5ALZ A;  4UAR A;  5JU5 A;  2HBM A;  1NOM A;  2E8O A;  1BVS A;  2ZG6 A;  3N4M B;  1N48 A;  2KMD A;  1WCN A;  3Q8L A;  2E1E A;  5J2G A;  2V4R A;  4ZH4 A;  5AM0 A;  4IQT A;  1C20 A;  3RJE A;  5AKG A;  8ICM A;  1A77 A;  1D9F A;  4C4R A;  2G07 A;  1DGJ A;  4Q8F A;  4E0D A;  5DQI A;  3C1Z A;  5CA7 A;  2BDU A;  4RQ6 A;  4J03 A;  1X6J A;  3G6V A;  2W9M A;  1KLN A;  4LZD A;  4QNL A;  5KG7 A;  3H7I A;  4R8U A;  4QZC A;  4K4I A;  2B6G A;  3RRH A;  7ICH A;  2R8I A;  2BQU A;  8ICW A;  5CJ7 A;  5DB6 A;  5KFF A;  2I6X A;  3UQ2 A;  2LYB A;  4QIW C;  1Z4O A;  1J2N A;  3JPT A;  3WK4 A;  3RJG A;  3RFA A;  3LWM A;  5J2K A;  1ZQY A;  5J8Y A;  5J0Q A;  2BKE A;  3SYZ A;  3H8S A;  3WKD A;  2RLT A;  5J2H A;  5ALG A;  4PGX A;  1L6N A;  4YXJ A;  1S97 A;  1RXV A;  2UVV A;  3E58 A;  3ISD A;  2W55 A;  4TQR A;  1GO3 F;  4Z6C A;  1X66 A;  4F4Z A;  1S0M A;  3ICX A;  4ZOH C;  5KFA A;  4HAI A;  3WKE A;  5AKL A;  1D8Y A;  5KG3 A;  2HHQ A;  3VCB A;  8ICN A;  3OPX A;  3BZK A;  2JHD A;  5IIO A;  3UMB A;  5ALN A;  1OUQ A;  4DWI A;  4M9L A;  3ORY A;  3EUB 2;  2JEG A;  4ELT A;  2KSO B;  3CYM A;  2BQ3 A;  4F5P A;  2KJ8 A;  2XCA A;  3TAN A;  3B0X A;  5D49 A;  1QSY A;  1MC8 A;  2W3S A;  1Z00 B;  2JEI A;  5ALW A;  4DL4 A;  4YD1 A;  2KD1 A;  2ZIW A;  2DUY A;  5EWE A;  2JRZ A;  2FDR A;  1IM4 A;  2C2D A;  2KZ3 A;  4PL1 A;  7ICE A;  1S0V A;  4PHP A;  4BGD A;  2HVH A;  1P7D A;  4KMO B;  2WFA A;  3ALR A;  2EZY A;  1XSP A;  4DFJ A;  1ZQG A;  2KOB A;  3OTQ A;  3DDH A;  3IHQ B;  9ICK A;  3N7R C;  3NVZ A;  1JX4 A;  3EYZ A;  3R9K A;  9ICV A;  7ICP A;  3HIL A;  9ICC A;  1YZ7 A;  1L3V A;  1IG6 A;  5EE1 A;  5HHI A;  5KFC A;  4I2B A;  1A6S A;  2AH5 A;  1BPX A;  3I1Y A;  2D8C A;  2G5H B;  5DLG A;  3QYP A;  4RQN A;  2G09 A;  1JMS A;  3H0R B;  2EAO A;  4PPX A;  4Z6D A;  4Y2J A;  4O3M A;  2WB1 C;  1Q8K A;  1N61 A;  5J0S A;  4Y2V A;  4NJ8 A;  4P0P B;  3TAQ A;  1WG8 A;  5HNK A;  1PK1 A;  2XO7 A;  3A0B U;  4J9P A;  3AUO A;  2P6U A;  1MSW D;  4FS1 A;  3MR6 A;  4GLX A;  1UPH A;  5JRT A;  2DKZ A;  3QU7 A;  1ZQD A;  4QZI A;  1SWV A;  2DF4 B;  3MGH A;  5KFV A;  3PO5 A;  3KZI U;  3M9N B;  2ODG A;  2HHX A;  5DDM A;  2LM1 A;  2GWS A;  4B9S A;  4JB3 A;  4GXK A;  2DWQ A;  2A1J A;  4DF8 A;  5F3X B;  1SB3 C;  1SL2 A;  2EH9 A;  2IBK A;  3H8M A;  2ISP A;  4A8E A;  2YB1 A;  1T3N A;  2MU2 A;  5AM2 A;  5AM5 A;  2AQ4 A;  1N5X A;  5AI8 A;  1J2M A;  1QQ6 A;  5DGB A;  3HX0 A;  2BGW A;  2HCF A;  5T14 A;  7ICJ A;  2IOF K;  3C2M A;  3FC4 A;  1ZYQ A;  1A0P A;  1CI4 A;  1NKB A;  8ICQ A;  4MF8 A;  1TFR A;  3GIJ A;  1NK8 A;  1AQ6 A;  2AGP A;  1X42 A;  2Z7J A;  2WAQ C;  3ZI4 A;  3TAR A;  1F44 A;  3C5F A;  3GV5 B;  2A1J B;  4QZ8 A;  4NM2 A;  5J0U A;  4C80 A;  3SV3 A;  4YQW A;  3IDW A;  5ALJ A;  3TQ1 A;  4UB3 A;  1HUO A;  1D9D A;  2BDP A;  3NRZ A;  3K1Z A;  5KFN A;  4RPX A;  4F50 A;  2HHU A;  3T5H A;  2HBK A;  1LKY B;  5IIK A;  3ED5 A;  9ICM A;  8ICX A;  3Q8Q B;  4NY8 A;  3KKA C;  1RM6 C;  4MFC A;  4UAT A;  5KFY A;  4C7Y A;  3MBY A;  1KTQ A;  1X40 A;  4J9S A;  1QSS A;  3PY8 A;  3NVW A;  1UT5 A;  5KT4 A;  5ALF A;  3AU6 A;  4EX6 A;  3SI8 A;  4LJX A;  4ELV A;  3RTV A;  2PFO A;  4JWN A;  3ZDC A;  1KSP A;  3GIL A;  1BNP A;  5KFX A;  4Q45 A;  3NS1 A;  4JMU A;  4R63 A;  4IR9 A;  4JV2 A;  4YD2 A;  4DL7 A;  1SKS A;  1XWL A;  3NRW A;  1ZQA A;  2F77 X;  2C2R A;  1PVP A;  4M9N A;  3O0F A;  2OH2 A;  5EE0 A;  5KG4 A;  2JMG A;  2KEY A;  3C28 A;  1ZQM A;  2CXY A;  1A76 A;  2PFN A;  4RZR A;  1ZQJ A;  7ICS A;  4DSJ A;  8ICK A;  5AM4 A;  3M6K A;  3RJF A;  2G5I B;  1SKW A;  3RB6 A;  1HEK A;  1Z19 A;  2FMQ A;  1SZH A;  3MR2 A;  4IRK A;  8ICE A;  4IRC A;  3KHG A;  2XY7 A;  1RQN A;  2ES6 A;  4NLC A;  2WF5 A;  4EYI B;  5CRX A;  2QLT A;  1JXL A;  3SAH A;  3KKA A;  4M9G A;  3V7L A;  5AKI A;  4QJF B;  4K4H A;  1PVR A;  4JK1 A;  5K4L A;  5EWF A;  4TUS A;  2ASD A;  2H3Q A;  4O5C A;  2ZIU A;  3M6Z A;  1LV5 A;  1S10 A;  3UMG A;  1TK0 A;  5DBC A;  3RRG A;  2F8K A;  4ELU A;  4OJP A;  4NLN A;  2HW3 A;  3PMN A;  2LM4 A;  3G6X A;  1UQV A;  3AU2 A;  1U9L A;  4IC9 A;  5G5G A;  3D6J A;  4F3O A;  4P4O A;  3RB3 A;  5DGA A;  1ZQQ A;  4PJ0 U;  3TFS A;  2FPM A;  4KN7 A;  3QNM A;  5H2F U;  4DFD A;  1NJZ A;  5J0P A;  5TZV A;  3PVX A;  5DBA A;  2KVC A;  3J81 j;  2YTU A;  4GC7 A;  4I2A A;  2PFP A;  2A1A A;  3M8R A;  3WKC A;  5CHG A;  1L3S A;  2R8K A;  1FIQ A;  4Y2Y A;  5AKE A;  3IV6 A;  4LVS A;  3ZDB A;  3BJY A;  1D8L A;  3PST A;  4B9N A;  5DKW A;  2XGP A;  4DSL A;  4O3Q A;  2MAX A;  1KFD A;  2VAN A;  2WF7 A;  3KBB A;  3ZD8 A;  4XUS A;  2V4Q A;  4Y2P A;  4Z6E A;  4ED6 A;  1JI7 A;  2A3V A;  7ICM A;  3BQT A;  3ISB A;  1L3U A;  3EZ5 A; 
#chains in the Genus database with same CATH homology
 2G5I B;  3KFU F;  2RRD A;  2Z7J A;  2G5H B;  1HIW A;  4ICA A;  1HEK A;  1Z19 A;  2WAQ C;  1SZH A;  2G09 A;  2PMZ C;  3E0F A;  3SQI A;  1F44 A;  3SMV A;  3SAF A;  3H0R B;  1PVQ A;  3H0L B;  2NV3 A;  1L6N A;  1XO0 A;  2RP5 A;  1KBU A;  1GO3 F;  2JH7 A;  2LKY A;  3L3F X;  4NLC A;  2XID A;  4O3M A;  2WB1 C;  3N7S C;  5CRX A;  2K4I A;  1IIP A;  2KJ9 A;  2W04 A;  2RHF A;  3ICX A;  4U7C A;  5A0L A;  3SAH A;  4P0P B;  2OYY A;  2Y0S F;  3D2S A;  1Z1B A;  2KKP A;  4QJF B;  1PVR A;  3VCB A;  4BJQ A;  4OJ6 A;  1YT3 A;  3K1Z A;  2G06 A;  2XIC A;  3OPX A;  3F2D A;  5HR6 A;  2OM6 A;  1UPH A;  1ED1 A;  3NUQ A;  3IG8 A;  3PSP A;  3PSF A;  4FZN A;  4KX5 A;  4OJ5 A;  4P0Q A;  2KKV A;  2JHD A;  2GH1 A;  2HBK A;  2N1R A;  3F5E A;  3F5A A;  4AYB C;  2OXO A;  2H3Q A;  2K8A A;  2ZIW B;  2ZIU A;  3M6Z A;  4FE3 A;  2JH1 A;  2E5S A;  1OUQ A;  2GOL A;  4C0Z A;  3T79 A;  2DF4 B;  2HMX A;  2H3Z A;  2MRL A;  3D2N A;  3KZX A;  2HBM A;  3CP8 A;  2ZIU B;  1NZB A;  2ZXH A;  2W03 A;  4OJP A;  2DQN B;  4CDG A;  2ZG6 A;  2ZIV A;  5KL8 B;  4CGZ A;  1ZQ1 C;  2VKQ A;  2W7P A;  2K4H A;  3CYM A;  3IP4 B;  2K89 A;  2E1E A;  3MGV A;  2D6F C;  2KJ8 A;  2MA1 A;  2VJ5 A;  2ZXI A;  4ACO A;  4IC9 A;  2M0N A;  1Q3U A;  2CN1 A;  3ONN A;  4P0P A;  2WAQ F;  3H0M B;  1XNS A;  3LVV A;  2DGZ A;  4NV0 A;  2KJ5 A;  1T94 A;  4BX9 C;  4BUG A;  3IG5 A;  2H3I A;  2HOI A;  2KIC A;  2F76 X;  2ZIX A;  4QIW F;  2HBL A;  2ZIV B;  2YB4 A;  2KIW A;  3D2Q A;  2VIX A;  2KD1 A;  5C0Y A;  1D8B A;  2F2A B;  2ZIW A;  2CRX A;  2W7O A;  2F8L A;  2G07 A;  2HBJ A;  2VJ4 A;  4OJL A;  2YX8 A;  4P0Q B;  1ECW A;  2KVC A;  3LVW A;  3F53 A;  1DRG A;  4GFJ A;  5HR7 A;  4JMU A;  2LBO A;  2BDU A;  4PL1 A;  2YB1 A;  4NLB A;  4A8E A;  3IN5 A;  2H3V A;  1TAM A;  2R18 A;  2ZIX B;  3F2B A;  4AYB F;  2K8C B;  3AQE A;  3N7P D;  2G08 A;  1P7D A;  4KMO B;  2E1F A;  4CRX A;  3ALR A;  2WB1 F;  2K4E A;  3NRW A;  4QNL A;  3AL0 B;  2F77 X;  4OJO A;  5KL1 B;  1PVP A;  2K8B B;  3O0F A;  5T14 A;  3PZP A;  2OH2 A;  2JGA A;  3GU3 A;  3PST A;  2KHV A;  2H3F A;  2KNJ A;  2HOQ A;  2XI9 A;  2KOB A;  4FZM A;  4U6P A;  1A0P A;  3RFA A;  2Y0S C;  3GZF A;  3N7R C;  2LYB A;  3C29 A;  2Q4T A;  4KX3 A;  2JMG A;  3LYS A;  1CRX A;  4WJ3 B;  2KEY A;  3RF9 A;  3C28 A;  2LYA A;  3HKZ F;  3M7D A;  3AQF A;  2CPR A;  3CRX A;  4PL2 A;  2KV2 A;  4QIW C;  2G0A A;  2XVT A;  1URJ A;  2LHT A;  2KHQ A;  2A3V A;  4FZL A;  2HOF A;  3SAG A;  1Q3V A;  3HKZ C;  2PMZ F;  1WUD A;  1A6S A;  4NWI A;  3M6K A;  3DEE A;  1MA7 A;  3VC8 A;  3PSI A;  4OO1 J;  3F2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...