2XVTA

Structure of the extracellular domain of human ramp2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
VKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords RECEPTOR ACTIVITY-MODIFYING PROTEIN 2
publication title Structure of the Extracellular Domain of Human Ramp2
rcsb
source organism Homo sapiens
total genus 28
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2xvtA00
3N7SC 3AQEA 3AQFA 3N7PD 3N7RC 2XVTA 2YX8A
chains in the Genus database with same CATH superfamily
1S5LU 1YZ6A 7ICKA 1B0XA 3GIIA 2HHXA 4MF2A 3OHAA 4JK1A 5AKYA 2HSZA 4R8UB 3LVWA 2KZZA 2KIVA 2RLTA 9ICBA 1S10A 4KMOB 5J2DA 2HOIA 2PKEA 3QEBZ 2NO4A 2E1FA 4IRCA 8ICOA 3GFKB 1TE2A 2XICA 1PK3A 3M8RA 4IQUA 5ALSA 5A0LA 2PXIA 2W9MA 1L6NA 2OH2A 3NRWA 4HAIA 3QZ8A 1D8BA 4J9OA 1CEZA 1Z3EB 3JPOA 4FFDA 5HR7A 1XO0A 3WU2U 2HVIA 3BDPA 9ICMA 1O03A 2XCPA 5KT6A 1ZQQA 2JEGA 2Q0ZX 3C21A 7ICJA 2R8IA 3PW4A 4PHPA 4YR2A 4QZDA 3M6ZA 1ZQTA 3AN1A 2W03A 1X9SA 3IG5A 2ASJA 4DS5A 4ECVA 4YXJA 3BQ0A 4JB3A 1Q8KA 2KZMA 3EPGA 2YMLA 2CRXA 8ICTA 3T5HA 5AM3A 2R8HA 8ICJA 5IILA 2AQ4A 5KFUA 5KT2A 3C1YA 3RH6A 5KFGA 1NNLA 4ECTA 4RQ4A 1FO4A 4JWNA 3C5FA 2BQ3A 4Q45A 2OCEA 2WF8A 2EZZA 4KLOA 1ZQGA 1ZQJA 4RPXA 2PFPA 3PY8A 4FZLA 4X5VA 2E8MA 2V4RA 5KFFA 1P7DA 3EW9A 4YFKA 5KG2A 4DEZA 4QWEA 4U6PA 1NK0A 3KTQA 3TQ1A 2ASLA 3MDCA 3PR5B 2GLEA 3MR5A 2W11A 3MGHA 3K4GA 1JXLA 4P0QA 2H3QA 3IM1A 2ALZA 9ICXA 2AGPA 3GQCA 3RH5A 7ICOA 1U49A 3HX0A 2R18A 2MUTA 4DOAA 3RJFA 2PFQA 3WKBA 4KLHA 1KFDA 3CRXA 4RZRA 3K1RB 2KTQA 3RB6A 3JPRA 3SR6A 5TISU 2ZUDA 3Q8RB 1L3SA 4DSKA 4GLXA 1PUZA 1SV4A 4YQWA 4M2YA 5ALLA 3QX7A 2BKEA 5ALWA 4KLQA 3GIKA 4Z6FA 8ICGA 3TFRA 4MEXA 1KFTA 1NK7A 4OJPA 4KLLA 1A0PA 3E0FA 2BDUA 3BJYA 4GXIA 2K8CB 7ICQA 4O3SA 5DLFA 4RQNA 3FAHA 3ONNA 4DSIA 1LKYA 3PSPA 1SB3C 4BWMA 4AP9A 4ECQA 4DL4A 2QARB 2LKYA 3UMGA 3G6VA 1DOQA 3DV9A 1B43A 1V85A 1H38A 1MN8A 1ZD4A 4Z6EA 4JV2A 2KJ9A 2K8AA 4FE3A 4KLUA 1U4BA 5CA7A 4ED8A 3QU5A 3M9NB 9ICJA 3MBYA 3SV4A 4IR9A 1M6YA 3FDSA 5J2IA 2K8BB 2KFNA 2Z7JA 5D4BA 2C22A 1BGXT 5AIBA 1HEKA 1NK8A 1ECWA 2JR5A 4F91B 2LYBA 4AYBF 4R66A 2GOLA 1DGJA 5J0XA 4QZFA 1YZ7A 4UB4A 4FBUA 4RQ7A 3KHRA 3V7JA 1T94A 3UMBA 3ZDEA 4UQGA 3WK8A 3TI0A 4UB6U 4RNOA 2UVRA 1UHUA 5B66U 4K4GA 5J0UA 3D2NA 5ALEA 3FYHA 2ZXHA 3VCBA 2MA1A 4BGDA 3EZ5A 4MHVA 1FEZA 2HBJA 2LMRA 5HMLA 4RQ5A 3MR6A 4OJ6A 2ISOA 5BOLA 4J9KA 2H3FA 2UVUA 3ALRA 4Q8EA 4P0QB 4C8OA 2KIWA 5ALUA 4O3NA 4DL5A 5J29A 2MUTB 4FS2A 3LK9A 1V38A 2I9GA 4PHEA 2AU0A 2FPLA 1XC9A 2RDJA 4FZNA 1COOA 1Q3VA 4G9BA 2R8GA 1IM4A 4DQSA 5J2CA 7ICHA 1K5OA 1ZRNA 8ICSA 3D2QA 4KLIA 2ZIVA 2JV3A 3UQ2A 1J2NA 3AU2A 1Q3UA 1WUDA 2AXTU 5L1IA 4C4SA 4F5OA 2RQ5A 2XY6A 5CR0A 4FZMA 1SIJA 4RUCA 4E0DA 3KD3A 5J8YA 4GC6A 2FJ6A 4DOBA 1D8LA 5EE1A 4C7YA 5DBCA 2ZTCA 2E8OA 4DFMA 3H0RB 4CF3A 4F4XA 4I2DA 3RF9A 1UT8A 4EYHB 3AQFA 4RQ6A 1LKYB 2HBLA 1ZQBA 2UVVA 3TAQA 1TK5A 2LYAA 4I2BA 4ED0A 2A19A 4KN4A 2FI1A 3CYMA 3WKDA 5DKWA 3HJEA 2I5HA 3SQIA 4F5RA 3V7LA 2FE9A 3RRGA 3SZ2A 2W04A 5KT7A 2BQRA 3QYPA 3H8SA 2F2AB 3PSIA 5GTIU 3D2SA 5AI5A 5AKLA 1IXRA 3OTQA 1OW5A 1V9PA 1ZQ1C 3GU3A 3SV3A 3THVA 5IIIA 1XNSA 2YMPA 1X40A 2F3NA 9ICCA 1ZQZA 3ICXA 2A1JA 3RJKA 4NL9A 2DPIA 4JMUA 2J6TA 2R8KA 4P4MA 2ZTEA 8ICLA 2XY7A 4PZOA 5L1MA 4P4PA 2NYVA 3F2BA 3RR8A 2G09A 1VDVA 2W7PA 2HOQA 5BOMA 5KT3A 3C29A 2KHVA 3H8MA 2JRZA 2BHNA 4XQ8A 4QZ8A 1D9FA 5KT5A 2JZBB 4Y2UA 5JUMA 3UQ0A 4NLCA 4LVSA 3QU7A 4P4OA 3RJIA 3KZXA 1QQ5A 5AKGA 1QTMA 2ZIXA 2BR0A 4DQQA 1S9FA 2KN7A 2BCSA 3N4MB 5J0YA 1SV0C 5AM1A 3UMCA 1JN3A 3G6XA 3LWMA 1EXNA 3CP8A 2BPFA 2F8KA 1JIHA 2BCRA 5KFXA 2V9WA 4M9JA 2RRDA 3QXGA 4R65A 2NO5A 4CDGA 2D8CA 2FPMA 8ICAA 5J8YC 5CP2A 4ZH4A 1O08A 2ZIVB 2VA8A 3I28A 1NI3A 2PI4A 2QB0A 4F8RA 2BPGA 2EDUA 3JPPA 2XGQA 5KFRA 5CB1A 5ALRA 5AKHA 4ED3A 2QKQA 2WAQF 4DQRA 2W8LA 1TAQA 5KFLA 4O3QA 2YTUA 4DSJA 1BPEA 9ICIA 4IS7A 1NK4A 5CHGA 5KAIU 1X42A 3H4DA 3D6JA 5J0WA 4I29A 4EX6A 1WCLA 2KKPA 3NVWA 2HDOA 5DQIA 1JI7A 3LDAA 3M1YA 5AKJA 1L7NA 3MGIA 4KLEA 2HHVA 2W3RA 3F5EA 4GFJA 3HPOA 2YQEA 2JH1A 1S0MA 2EQYA 1CI4A 4NL9C 7ICPA 4RQ1A 4C4TA 4KLMA 3SYZA 2HVHA 3SAFA 5DB6A 3PW2A 5J0PA 4EZ6A 2IHMA 2YMQA 3RB3A 1TFRA 2MAXA 4ED6A 5ALHA 4TUSA 5KL8B 3R9KA 1ZQKA 2ESEA 5J2JA 4KTQA 4XRHA 2KICA 2KD1A 3ZD9A 2AGQA 1RYRA 4DQPA 1N62A 1MQ3A 4IRKA 4DFDA 8ICEA 2CPRA 2HHWA 3B0YA 4F93B 2W9CA 1NKBA 2A3VA 3BQ7A 1COKA 3LYSA 2JEIA 3MR2A 3PR4A 5AK3A 3WK9A 1SL2A 3C2KA 1D8YA 4AYBC 9ICRA 3H4BA 1TKDA 4USAA 4JV1A 1ZETA 2ZIXB 5J0OA 3WKAA 4M9LA 1Z00A 7ICRA 4O3PA 2BGWA 4I28A 5AI0A 4Y2YA 4Q44A 8ICZA 2OHFA 4PGQA 3C5GA 5J2KA 1ZQVA 2XY5A 3ZDCA 1QSYA 2PFNA 4IL6U 2HHSA 2G5HB 4TURA 2O6KA 9ICLA 5T14A 4QIWC 2YY6A 4IQWA 4F5NA 1ZQAA 7ICIA 3AM9A 3SD7A 4JUZA 2YB1A 2KV2A 2ZIWB 4J9NA 3TACB 3HKZF 7ICEA 2G08A 3UM9A 3UXNA 3NASA 4EENA 3UXPA 4DL7A 1J97A 3EYZA 4C8KA 1ZD5A 2WFAA 2AH5A 2KJ5A 3NVZA 4NLKA 2KSOB 5AI9A 2NRVA 4QWCA 3I76A 1ZOLA 1S8OA 4KITB 4YR3A 2AHOB 3E2EA 3F2CA 1NK9A 5D49A 4QZGA 1KKXA 1N2XA 5KFWA 1LV5A 9ICUA 1NJZA 1SZHA 4C4RA 3TAPA 5DLGA 3PO5A 2E5SA 4NXZA 5KFIA 3AQEA 3F5AA 8ICKA 1ZQOA 2K4EA 4KLDA 1WYGA 1JRPA 3N7SC 3TADA 1DK3A 3H40A 2H5XA 3JPNA 8ICIA 5HHIA 2BCUA 4K4IA 3SEIA 3G6YA 5EE0A 2YB4A 4DFJA 1C20A 3OGUA 4DLEA 1ZQXA 4Y2PA 5EWEA 2HBKA 1JX4A 4Q8FA 1NK6A 4PJ0U 3RB4A 3V7KA 3C1ZA 5DDMA 4CF4A 2W7OA 5DGAA 5C5JA 1ZRMA 2LHTA 3UPQA 2MU2A 3ED5A 1FFUA 4DWIA 2IOFK 3Q8PB 2PFOA 2WF6A 3LVVA 2DPJA 4YMOA 1RXWA 1X9MA 4J03A 4OJLA 2AQ0A 3RRHA 4CCHA 4I2FA 4IQVA 3PZPA 1Z19A 2HW3A 5IIOA 3RR7A 7ICNA 1Z00B 2JXJA 1WWVA 4ICAA 5HNKA 4KMUA 4JWMA 1WG8A 4QWDA 2BDPA 1LB2B 2W54A 3QUTA 3H0LB 3HW8A 1QSLA 1KN5A 5IIKA 4DL6A 2VKQA 5L1JA 5CJ7A 2WF7A 4KN7A 5ALNA 5KG7A 7ICGA 3WK4A 4XUSA 4F92B 4RPZA 1Q46A 2N1RA 3NTUA 1OXJA 1TK8A 1KTQA 4R63A 1ZJMA 1NJYA 2K4HA 3TKAA 1BPXA 2DBYA 2QB1A 5KFTA 5KAFU 1GO3F 5HHHA 4NY8A 3AEVA 4UATA 2V4QA 3RJJA 5AK5A 1KSPA 2ZUBA 4J9LA 5KFDA 1AROP 2XO7A 1NZBA 5DG8A 4QIWF 2ATLA 5AI6A 1ZQPA 2NRXA 3TADC 2XGPA 4PHDA 1OUQA 4TQRA 1IIPA 3NVYA 3C28A 4UB8U 2NRTA 3NRZA 4BWJA 4UB3A 3GV7B 1SL0A 4NLGA 3PVXA 1UPHA 4UW9A 2KJ8A 3M9MB 2WAQC 5AICA 3ETRA 2IMWP 1SWVA 5EWGA 3B0XA 1PVPA 2Y0SF 1T3QA 2EAOA 1F0MA 4DQIA 4KX3A 2CXYA 1F5SA 4WJ3B 1PK1A 3EPIA 4P2HA 1A76A 4QZAA 5J0QA 4NM1A 4EBDA 3ZI4A 1SV0A 1UCVA 5ALKA 4YMNA 2DFLA 2H3ZA 8ICNA 5KFHA 4EX7A 2YMMA 1FFVA 2K4IA 5DBAA 4ELVA 5H2FU 5KG0A 2D3DA 1SXDA 3KHGA 3NVVA 5JU5A 1QLNA 1SZPA 4ED2A 3KFUF 4ECXA 5L9XA 3MFHA 2G07A 3JPTA 5DB9A 3BS5A 1HUOA 2K89A 2WHEA 4M9NA 4OO1J 3DDHA 1TAMA 2OEHA 1X2IA 4O5EA 3NUQA 2NV3A 4PZNA 3PX6A 4US8A 4NJ8A 2F77X 4ECUA 2AGOA 4DO9A 7ICTA 1ZQMA 5AM4A 2VIXA 1SKRA 9ICHA 2VJ5A 3WK7A 4ECWA 4I2GA 4US9A 3Q8KA 4MFFA 5DQHA 4BJQA 1BNPA 2L5YA 3Q8SB 2F8LA 2D6FC 4DFPA 2EZYA 3MGVA 3PNCA 1L3VA 2M0NA 1BPDA 9ICTA 4PL1A 4J9RA 3T5JA 4NLZA 2KEYA 3DEEA 3OJUA 5EWFA 3F53A 3M9OB 1YT3A 8ICVA 4OJOA 2ODGA 2P6UA 4QWBA 2FPKA 1ZQEA 8ICPA 1T8EA 1S97A 5AKEA 4FS1A 1ZJNA 1ZYQA 1QCKA 4YD1A 5AM2A 1BPZA 2FMQA 3KHLA 2HI0A 4C8MA 5C0YA 2WB1C 5K4LA 1JROA 1MQ2A 4YR0A 5JRTA 3GDXA 2DWQA 2Y9UA 4DL3A 3IN5A 1NK5A 9ICOA 4TQSA 1RYUA 2MRLA 3MABA 4PGXA 9ICPA 5AK4A 2PMZF 3WK6A 1T7PA 1TV9A 3C2LA 5KG1A 3UXOA 3RTVA 4EELA 4F4YA 3HKZC 4B6JA 3F2DA 4M04A 2KVCA 5ALPA 4Y2QA 1L5UA 1MA7A 1RZTA 3HT3A 8ICHA 1Z4OA 4Z6DA 3OJSA 5KNIA 4YG2A 5L1KA 1WWUA 3GZFA 4J9QA 4NLNA 4MFAA 3BZCA 3PW0A 1NJXA 3MC1A 1IG6A 1PZNA 1XWLA 2ZJAA 3IP4B 4O0IA 5ALXA 2OM6A 2XC9A 2JEJA 1N56A 1PK1B 1N5WA 5J0RA 2F44A 4B9NA 2P66A 5KTQA 4ED1A 4EYIB 2ZIUA 2W8KA 7ICUA 5AIAA 3TANA 5F3XB 4QZBA 2CN1A 2ZG6A 5KFNA 3OHBA 2JHDA 3QEAZ 4DOCA 5AI8A 8ICYA 3NGDA 3IV6A 1X66A 4DSEA 1NOMA 4PGYA 5KFYA 9ICQA 4KX5A 4UB2A 3MDAA 3GIMA 4ECZA 4F50A 2IOFA 3BS5B 5HP4A 2VA2A 5EE3A 4RT2A 3V6KA 2EH9A 4BX9C 1L3TA 2EAMA 2DGZA 3MR3A 3WKCA 5KG5A 4MEYA 4C8NA 2F1IA 4OJ5A 3V6JA 1B22A 2W55A 4LZDA 3J81j 2HHQA 4M47A 1BNOA 4IQTA 5HR6A 2W9BA 3NS1A 2W3SA 4FO6A 3T5LA 3SMVA 3FM9A 1SKWA 3RJHA 5KFSA 3AL0B 5BPCA 1X9WA 1X6IA 4UASA 4QZIA 3BQ1A 5ALJA 1ED1A 4JV0A 1N48A 3H0MB 3PX4A 2HMXA 4QZHA 4UAZA 4O3RA 5ALYA 1XU4A 1N63A 3BS7A 3Q8LA 3RBDA 4O5CA 4B9LA 7ICMA 1UA1A 2IBKA 3GV8B 1TK0A 2AJQA 1ZQSA 3RH4A 3VC8A 1RG6A 2RP5A 4ELUA 3KOOA 1DRGA 8ICFA 3N7PD 2DL0A 4J9PA 4F71A 2A1JB 1SKSA 1IV8A 2DUYA 2G5IB 3QUCA 2EZXA 2G06A 5AKXA 1HJPA 4IC9A 3QZ7A 1NKCA 2H3IA 3EWAA 3E58A 4GC7A 1K1SA 1SGGA 1RYSA 3CW2C 4TUQA 1TVAA 1CRXA 4KLTA 2Y9TA 3BQTA 4DCCA 1L7MA 3K1ZA 1URJA 1KLNA 4LZGA 1L7OA 5KG4A 7ICSA 2FMPA 1RPLA 5F9NA 3ETLA 4R64A 4EEYA 1KL9A 2KVSA 1A77A 1AQ6A 2ZUCA 3IRUA 3RFAA 1Y88A 5TZVA 7ICFA 2YX8A 1ZQCA 2GH1A 4MF8A 1JUDA 4DLGA 2GWSA 2WB1F 3OPXA 5L1LA 2JEFA 1VJ5A 8ICXA 2QARA 2ZIUB 1N5XA 4F4ZA 4Q43A 3EUB2 8ICRA 1S0VA 3Q8QB 4M9HA 3PX0A 2P6RA 3HILA 3MFIA 2HHTA 5DB7A 4Y2JA 2QB0B 1ZD2P 1L8OA 4F2RA 3SAHA 3L5KA 4C0ZA 4RT3A 4M9GA 1ZQFA 4OCZA 4ED7A 2KE7A 2Y0SC 4KLGA 4DS4A 1U9LA 4F4WA 3QUQA 5CRXA 9ICVA 4B9UA 4CNQA 1RDFA 1NKEA 2NRZA 2XCAA 3L3FX 5KFZA 2W9BB 5ALGA 2ASDA 2EAPA 3H8WA 2E8NA 4QZEA 3TARA 1SWWA 2DKXA 3ISCA 1RM6C 3ZD8A 4DSFA 2BCVA 3N28A 4Y2RA 1HIWA 5KG3A 7ICVA 3V72A 4NLBA 5DGBA 5G5HA 4YN4A 5ALZA 1QQ7A 1KQQA 1PVQA 1F44A 5KG6A 2ZTDA 2ZXIA 2KHQA 2E3TA 3B9JA 5IINA 9ICKA 2C2EA 3H8JA 4I2JA 3T3FA 4HYKA 1QH9A 1S77D 2FLLA 1XSNA 3PSFA 5D46A 2VANA 9ICFA 5DB8A 2XIDA 1A6SA 1RQNA 1UA0A 2C28A 2RHFA 4QW8A 4RQ2A 2W9CB 3M8SA 3BZKA 3A0HU 2ZJ8A 4PPXA 3RBEA 4F2SA 1K1QA 4YCXA 1FIQA 2ISPA 4I2AA 3L4PA 3SAGA 2KK0A 3RAQA 4DFKA 3QE9Y 4CE6A 4Y2SA 5KFMA 4C7ZA 1XS9D 2KNJA 3WK5A 4Y2XA 5J2BA 4ECYA 1LVHA 4BXOA 2B0CA 5DBBA 4B9SA 2VA3A 3QU2A 4GIBA 2K4PA 1SXEA 3M7DA 3AMZA 5EE9A 2C2RA 5KFQA 1T4GA 4I27A 8ICCA 4G3IA 3AUOA 4BUGA 2DF4B 1L3UA 2PMZC 3PW7A 8ICUA 2I6XA 5ALMA 4Y2TA 3GIJA 4UB1A 4UARA 5AKKA 5FP0A 5AM5A 2KFZA 4ELTA 1XSPA 3OSPA 1JXEA 4RQ3A 5KFPA 2WTFA 2JH7A 4GXJA 2J6UA 4B9MA 1T3NA 2KKVA 2PI5A 1MC8A 4NWIA 1RQLA 2W43A 4O3OA 2FLNA 2ES6A 2KMDA 1KW4A 5E79U 4M6WA 2MSNA 2LBOA 1S0OA 3C2MA 2YN4A 2IHNA 2UVWA 4GXKA 4OD0A 9ICSA 1X9XA 3O0FA 4XA5A 4UBBA 5ALIA 4EZ9A 4DSLA 3IG8A 1B4FA 3ZDBA 1PVRA 4F72A 5G5GA 2C2DA 2LM1A 4DF4A 2DKZA 5J2FA 4RNNA 3PW5A 5ALQA 5KFJA 3T79A 3RAXA 4B9TA 3KHHA 1ZQIA 1QQ6A 2XI9A 3WKEA 5CEHA 3Q8MA 2JZBA 1ZQLA 3KKAA 5GTHU 4PHAA 2E1EA 2H3VA 5DQGA 4RU9A 1U48A 2HOFA 4M0AA 2FMSA 3PO4A 3QUBA 1XO1A 4J9SA 4NV0A 3HWTA 4Y2VA 4RUAA 4I2HA 2FLPA 4O9MA 3AU6A 2B21A 2VJ4A 5J2HA 1BPYA 2KP7A 2BCQA 1XSLA 8ICBA 4RNMA 4UBCA 1KEJA 2LYHA 4A8EA 5AK6A 5KT4A 2FDRA 3SI8A 4QNLA 4C8LA 1BVSA 2WF5A 3ORYA 1KDHA 3N97B 3ISDA 4QW9A 1DXSA 4CRXA 2Y1IA 1U45A 3IDWA 3BQ2A 3N7RC 4Z6CA 4I2IA 4IR1A 2Q4TA 4F5PA 4TUPA 1SL1A 4EBEA 5ALDA 4QJFB 3RJEA 4YMMA 3GV5B 5AKZA 2NRWA 4QZCA 9ICNA 1Z1BA 4BXOB 4J9MA 1DK2A 2K60A 3SENA 4ECRA 3HRDD 2KG5A 2BPCA 4DF8A 5AM0A 4EEKA 1J2MA 1ZXIA 1UQVA 2XVTA 8ICWA 3KZIU 4P0PA 4YVZA 1JALA 2G0AA 1L7PA 3M6KA 2HBMA 9ICGA 1ZQRA 3OSNA 4RQ8A 3S6JA 2IOHA 5KFAA 3H7IA 1DGSA 5ALVA 4F5QA 1ZQDA 4ECSA 2WF9A 4F4KA 1X6JA 1KBUA 1NZPA 5F9LA 4YXMA 3HP6A 5HMMA 1Z1VA 5IIJA 4M6WB 1V97A 5AKIA 2EANA 2R8JA 3RJGA 5ALFA 1WCNA 1L8LA 2DQNB 4R8UA 1S76D 2M9NA 7ICLA 4RQMA 1C7YA 3ZDAA 3PV8A 5DG9A 3QU9A 5KFEA 5J2EA 5KFVA 2IA6A 2P35A 3LWLA 4BDPA 1ZQWA 3KKAC 2JMGA 5ALTA 3V6HA 2LM4A 2KOBA 2LI6A 5J2AA 4ZOHC 1KFSA 3KBBA 4I2CA 4KLFA 3A0BU 2BZFA 4QZ9A 2JGAA 5IIMA 8ICQA 4K4HA 3RB0A 2OYYA 1KRPA 4EBCA 4U7CA 1QSSA 1BPBA 5KFOA 2J6SA 4B9VA 4O3MA 3QNMA 2HHUA 5B5EU 5JTIA 2W9AA 2BQUA 2QLTA 3IHQB 3PMLA 3U26A 4UAWA 4CF5A 4PH5A 4LJXA 3K75D 5DG7A 4KLSA 4UAVA 2I1QA 5DDYA 5KFKA 1S0NA 4RQ0A 4MFCA 5KFCA 2HCFA 4O5KA 1ZQUA 1D9DA 8ICMA 3GILA 2E8PA 5AHXA 1UT5A 4UAUA 3ISBA 4FBTA 2OWOA 2RDIA 5KL1B 4YD2A 4QWAA 2ZIWA 5J0TA 2KZ3A 3CNHA 3TFSA 2F76X 4UAYA 1MSWD 1NJWA 4NM2A 3C23A 2B6GA 4KLJA 1ZQYA 3QU4A 4ACOA 4I2EA 1N61A 3JPSA 5KFBA 4F3OA 2OXOA 1CUKA 5J0SA 2KSOA 4CGZA 5CWRA 1N60A 4RPYA 5J2GA 1Z4NA 4PL2A 4DL2A 9ICWA 4P0PB 5ALOA 3FC4A 3PMNA 1U47A 2LPEA 5AI4A 3ZDDA 4UB5A 3JPQA 1ZQHA 2ZJ5A 3T5KA 1ZD3A 1HUZA 1ZQNA 3I1YA 2GO7A 4C80A 1TAUA 9ICEA 5EOZA 4YP3A 1VLBA 2A1AA 2F1HA 3PSTA 4IRDA 2Y1JA 2F1JA 9ICAA 1RXVA 1JMSA
chains in the Genus database with same CATH topology
2KKVA 4JMUA 4PL1A 2G5HB 3PSPA 4NWIA 4QJFB 4KX5A 2OYYA 1OUQA 5T14A 1IIPA 2KKPA 4QIWC 4U7CA 1PVQA 1F44A 3C28A 2ZXIA 2LKYA 2W7OA 4O3MA 1Z1BA 2KEYA 2KHQA 2LHTA 2LBOA 3DEEA 3F2BA 2G09A 1UPHA 4BX9C 2W7PA 2DGZA 2KJ8A 4FZNA 4FZLA 3RFAA 2HOQA 1Q3VA 1NZBA 3C29A 2KHVA 2YB1A 3LVWA 2KJ9A 2YX8A 3F53A 2K8AA 2GH1A 2KV2A 2WAQC 1YT3A 2ZIWB 4FE3A 4OJ5A 1P7DA 3D2QA 4KMOB 1PVPA 2ZIVA 4OJOA 2HOIA 3F5EA 3LVVA 2Y0SF 3HKZF 3O0FA 2XVTA 3PSFA 2G08A 2E1FA 4GFJA 4P0PA 4KX3A 1Q3UA 1WUDA 2G0AA 2WB1F 2JH1A 2XICA 3IG8A 3OPXA 2XIDA 4OJLA 4WJ3B 1A6SA 3M6KA 4NLCA 2HBMA 4U6PA 3PZPA 1Z19A 4FZMA 2K8BB 3SMVA 3KZXA 5A0LA 1PVRA 2RHFA 2ZIUB 2Z7JA 2WB1C 4ICAA 5C0YA 1L6NA 2ZIXA 2OH2A 3NRWA 3SAFA 2KJ5A 1HEKA 1ECWA 3AL0B 2H3ZA 2LYBA 4AYBF 1D8BA 3IN5A 3T79A 2K4IA 3H0RB 3H0LB 5KL1B 2MRLA 4P0QA 2GOLA 1ED1A 2H3QA 5KL8B 5HR7A 2XI9A 2ZIWA 3H0MB 3RF9A 1XO0A 2PMZF 3AQFA 2HMXA 3F2CA 2F76X 3SAGA 2KICA 2VKQA 3SAHA 2HBLA 4C0ZA 2KD1A 2R18A 3CP8A 1KBUA 3KFUF 1T94A 2E1EA 2H3VA 2CPRA 2KNJA 2Y0SC 2HOFA 2G07A 1SZHA 3HKZC 3CRXA 2LYAA 3F2DA 2KVCA 2A3VA 2RRDA 3VC8A 4ACOA 1MA7A 2K89A 2RP5A 2E5SA 3CYMA 5CRXA 3LYSA 4CDGA 3GZFA 2OXOA 4NV0A 4OO1J 2DQNB 1DRGA 3AQEA 3F5AA 4CGZA 3SQIA 3M6ZA 2N1RA 3M7DA 1TAMA 3N7PD 2VJ4A 2W03A 3D2NA 4PL2A 2K4EA 2ZIVB 3IG5A 2W04A 2ZXHA 3IP4B 2NV3A 3N7SC 3NUQA 3VCBA 3L3FX 5HR6A 2F77X 2OM6A 2MA1A 4A8EA 4AYBC 4P0PB 2G5IB 2G06A 2VIXA 2DF4B 2HBJA 4BUGA 2F2AB 3PSIA 4QNLA 2VJ5A 2CRXA 3D2SA 2PMZC 2K4HA 4IC9A 2JMGA 2H3IA 2ZIXB 4OJPA 1A0PA 2KOBA 2BDUA 2WAQF 3E0FA 1ZQ1C 2ZIUA 3GU3A 4OJ6A 2YB4A 4CRXA 2H3FA 4BJQA 1GO3F 2F8LA 2D6FC 3ALRA 1XNSA 1CRXA 2CN1A 3N7RC 2K8CB 3MGVA 4P0QB 2ZG6A 2KIWA 3K1ZA 1HIWA 3PSTA 1URJA 2JHDA 2HBKA 2M0NA 2JH7A 4NLBA 3ICXA 2Q4TA 3ONNA 2JGAA 4QIWF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7S C;  3AQE A;  3AQF A;  3N7P D;  3N7R C;  2XVT A;  2YX8 A; 
#chains in the Genus database with same CATH topology
 1S5L U;  1YZ6 A;  7ICK A;  1B0X A;  3GII A;  2HHX A;  4MF2 A;  3OHA A;  4JK1 A;  5AKY A;  2HSZ A;  4R8U B;  3LVW A;  2KZZ A;  2KIV A;  2RLT A;  9ICB A;  1S10 A;  4KMO B;  5J2D A;  2HOI A;  2PKE A;  3QEB Z;  2NO4 A;  2E1F A;  4IRC A;  8ICO A;  3GFK B;  1TE2 A;  2XIC A;  1PK3 A;  3M8R A;  4IQU A;  5ALS A;  5A0L A;  2PXI A;  2W9M A;  1L6N A;  2OH2 A;  3NRW A;  4HAI A;  3QZ8 A;  1D8B A;  4J9O A;  1CEZ A;  1Z3E B;  3JPO A;  4FFD A;  5HR7 A;  1XO0 A;  3WU2 U;  2HVI A;  3BDP A;  9ICM A;  1O03 A;  2XCP A;  5KT6 A;  1ZQQ A;  2JEG A;  2Q0Z X;  3C21 A;  7ICJ A;  2R8I A;  3PW4 A;  4PHP A;  4YR2 A;  4QZD A;  3M6Z A;  1ZQT A;  3AN1 A;  2W03 A;  1X9S A;  3IG5 A;  2ASJ A;  4DS5 A;  4ECV A;  4YXJ A;  3BQ0 A;  4JB3 A;  1Q8K A;  2KZM A;  3EPG A;  2YML A;  2CRX A;  8ICT A;  3T5H A;  5AM3 A;  2R8H A;  8ICJ A;  5IIL A;  2AQ4 A;  5KFU A;  5KT2 A;  3C1Y A;  3RH6 A;  5KFG A;  1NNL A;  4ECT A;  4RQ4 A;  1FO4 A;  4JWN A;  3C5F A;  2BQ3 A;  4Q45 A;  2OCE A;  2WF8 A;  2EZZ A;  4KLO A;  1ZQG A;  1ZQJ A;  4RPX A;  2PFP A;  3PY8 A;  4FZL A;  4X5V A;  2E8M A;  2V4R A;  5KFF A;  1P7D A;  3EW9 A;  4YFK A;  5KG2 A;  4DEZ A;  4QWE A;  4U6P A;  1NK0 A;  3KTQ A;  3TQ1 A;  2ASL A;  3MDC A;  3PR5 B;  2GLE A;  3MR5 A;  2W11 A;  3MGH A;  3K4G A;  1JXL A;  4P0Q A;  2H3Q A;  3IM1 A;  2ALZ A;  9ICX A;  2AGP A;  3GQC A;  3RH5 A;  7ICO A;  1U49 A;  3HX0 A;  2R18 A;  2MUT A;  4DOA A;  3RJF A;  2PFQ A;  3WKB A;  4KLH A;  1KFD A;  3CRX A;  4RZR A;  3K1R B;  2KTQ A;  3RB6 A;  3JPR A;  3SR6 A;  5TIS U;  2ZUD A;  3Q8R B;  1L3S A;  4DSK A;  4GLX A;  1PUZ A;  1SV4 A;  4YQW A;  4M2Y A;  5ALL A;  3QX7 A;  2BKE A;  5ALW A;  4KLQ A;  3GIK A;  4Z6F A;  8ICG A;  3TFR A;  4MEX A;  1KFT A;  1NK7 A;  4OJP A;  4KLL A;  1A0P A;  3E0F A;  2BDU A;  3BJY A;  4GXI A;  2K8C B;  7ICQ A;  4O3S A;  5DLF A;  4RQN A;  3FAH A;  3ONN A;  4DSI A;  1LKY A;  3PSP A;  1SB3 C;  4BWM A;  4AP9 A;  4ECQ A;  4DL4 A;  2QAR B;  2LKY A;  3UMG A;  3G6V A;  1DOQ A;  3DV9 A;  1B43 A;  1V85 A;  1H38 A;  1MN8 A;  1ZD4 A;  4Z6E A;  4JV2 A;  2KJ9 A;  2K8A A;  4FE3 A;  4KLU A;  1U4B A;  5CA7 A;  4ED8 A;  3QU5 A;  3M9N B;  9ICJ A;  3MBY A;  3SV4 A;  4IR9 A;  1M6Y A;  3FDS A;  5J2I A;  2K8B B;  2KFN A;  2Z7J A;  5D4B A;  2C22 A;  1BGX T;  5AIB A;  1HEK A;  1NK8 A;  1ECW A;  2JR5 A;  4F91 B;  2LYB A;  4AYB F;  4R66 A;  2GOL A;  1DGJ A;  5J0X A;  4QZF A;  1YZ7 A;  4UB4 A;  4FBU A;  4RQ7 A;  3KHR A;  3V7J A;  1T94 A;  3UMB A;  3ZDE A;  4UQG A;  3WK8 A;  3TI0 A;  4UB6 U;  4RNO A;  2UVR A;  1UHU A;  5B66 U;  4K4G A;  5J0U A;  3D2N A;  5ALE A;  3FYH A;  2ZXH A;  3VCB A;  2MA1 A;  4BGD A;  3EZ5 A;  4MHV A;  1FEZ A;  2HBJ A;  2LMR A;  5HML A;  4RQ5 A;  3MR6 A;  4OJ6 A;  2ISO A;  5BOL A;  4J9K A;  2H3F A;  2UVU A;  3ALR A;  4Q8E A;  4P0Q B;  4C8O A;  2KIW A;  5ALU A;  4O3N A;  4DL5 A;  5J29 A;  2MUT B;  4FS2 A;  3LK9 A;  1V38 A;  2I9G A;  4PHE A;  2AU0 A;  2FPL A;  1XC9 A;  2RDJ A;  4FZN A;  1COO A;  1Q3V A;  4G9B A;  2R8G A;  1IM4 A;  4DQS A;  5J2C A;  7ICH A;  1K5O A;  1ZRN A;  8ICS A;  3D2Q A;  4KLI A;  2ZIV A;  2JV3 A;  3UQ2 A;  1J2N A;  3AU2 A;  1Q3U A;  1WUD A;  2AXT U;  5L1I A;  4C4S A;  4F5O A;  2RQ5 A;  2XY6 A;  5CR0 A;  4FZM A;  1SIJ A;  4RUC A;  4E0D A;  3KD3 A;  5J8Y A;  4GC6 A;  2FJ6 A;  4DOB A;  1D8L A;  5EE1 A;  4C7Y A;  5DBC A;  2ZTC A;  2E8O A;  4DFM A;  3H0R B;  4CF3 A;  4F4X A;  4I2D A;  3RF9 A;  1UT8 A;  4EYH B;  3AQF A;  4RQ6 A;  1LKY B;  2HBL A;  1ZQB A;  2UVV A;  3TAQ A;  1TK5 A;  2LYA A;  4I2B A;  4ED0 A;  2A19 A;  4KN4 A;  2FI1 A;  3CYM A;  3WKD A;  5DKW A;  3HJE A;  2I5H A;  3SQI A;  4F5R A;  3V7L A;  2FE9 A;  3RRG A;  3SZ2 A;  2W04 A;  5KT7 A;  2BQR A;  3QYP A;  3H8S A;  2F2A B;  3PSI A;  5GTI U;  3D2S A;  5AI5 A;  5AKL A;  1IXR A;  3OTQ A;  1OW5 A;  1V9P A;  1ZQ1 C;  3GU3 A;  3SV3 A;  3THV A;  5III A;  1XNS A;  2YMP A;  1X40 A;  2F3N A;  9ICC A;  1ZQZ A;  3ICX A;  2A1J A;  3RJK A;  4NL9 A;  2DPI A;  4JMU A;  2J6T A;  2R8K A;  4P4M A;  2ZTE A;  8ICL A;  2XY7 A;  4PZO A;  5L1M A;  4P4P A;  2NYV A;  3F2B A;  3RR8 A;  2G09 A;  1VDV A;  2W7P A;  2HOQ A;  5BOM A;  5KT3 A;  3C29 A;  2KHV A;  3H8M A;  2JRZ A;  2BHN A;  4XQ8 A;  4QZ8 A;  1D9F A;  5KT5 A;  2JZB B;  4Y2U A;  5JUM A;  3UQ0 A;  4NLC A;  4LVS A;  3QU7 A;  4P4O A;  3RJI A;  3KZX A;  1QQ5 A;  5AKG A;  1QTM A;  2ZIX A;  2BR0 A;  4DQQ A;  1S9F A;  2KN7 A;  2BCS A;  3N4M B;  5J0Y A;  1SV0 C;  5AM1 A;  3UMC A;  1JN3 A;  3G6X A;  3LWM A;  1EXN A;  3CP8 A;  2BPF A;  2F8K A;  1JIH A;  2BCR A;  5KFX A;  2V9W A;  4M9J A;  2RRD A;  3QXG A;  4R65 A;  2NO5 A;  4CDG A;  2D8C A;  2FPM A;  8ICA A;  5J8Y C;  5CP2 A;  4ZH4 A;  1O08 A;  2ZIV B;  2VA8 A;  3I28 A;  1NI3 A;  2PI4 A;  2QB0 A;  4F8R A;  2BPG A;  2EDU A;  3JPP A;  2XGQ A;  5KFR A;  5CB1 A;  5ALR A;  5AKH A;  4ED3 A;  2QKQ A;  2WAQ F;  4DQR A;  2W8L A;  1TAQ A;  5KFL A;  4O3Q A;  2YTU A;  4DSJ A;  1BPE A;  9ICI A;  4IS7 A;  1NK4 A;  5CHG A;  5KAI U;  1X42 A;  3H4D A;  3D6J A;  5J0W A;  4I29 A;  4EX6 A;  1WCL A;  2KKP A;  3NVW A;  2HDO A;  5DQI A;  1JI7 A;  3LDA A;  3M1Y A;  5AKJ A;  1L7N A;  3MGI A;  4KLE A;  2HHV A;  2W3R A;  3F5E A;  4GFJ A;  3HPO A;  2YQE A;  2JH1 A;  1S0M A;  2EQY A;  1CI4 A;  4NL9 C;  7ICP A;  4RQ1 A;  4C4T A;  4KLM A;  3SYZ A;  2HVH A;  3SAF A;  5DB6 A;  3PW2 A;  5J0P A;  4EZ6 A;  2IHM A;  2YMQ A;  3RB3 A;  1TFR A;  2MAX A;  4ED6 A;  5ALH A;  4TUS A;  5KL8 B;  3R9K A;  1ZQK A;  2ESE A;  5J2J A;  4KTQ A;  4XRH A;  2KIC A;  2KD1 A;  3ZD9 A;  2AGQ A;  1RYR A;  4DQP A;  1N62 A;  1MQ3 A;  4IRK A;  4DFD A;  8ICE A;  2CPR A;  2HHW A;  3B0Y A;  4F93 B;  2W9C A;  1NKB A;  2A3V A;  3BQ7 A;  1COK A;  3LYS A;  2JEI A;  3MR2 A;  3PR4 A;  5AK3 A;  3WK9 A;  1SL2 A;  3C2K A;  1D8Y A;  4AYB C;  9ICR A;  3H4B A;  1TKD A;  4USA A;  4JV1 A;  1ZET A;  2ZIX B;  5J0O A;  3WKA A;  4M9L A;  1Z00 A;  7ICR A;  4O3P A;  2BGW A;  4I28 A;  5AI0 A;  4Y2Y A;  4Q44 A;  8ICZ A;  2OHF A;  4PGQ A;  3C5G A;  5J2K A;  1ZQV A;  2XY5 A;  3ZDC A;  1QSY A;  2PFN A;  4IL6 U;  2HHS A;  2G5H B;  4TUR A;  2O6K A;  9ICL A;  5T14 A;  4QIW C;  2YY6 A;  4IQW A;  4F5N A;  1ZQA A;  7ICI A;  3AM9 A;  3SD7 A;  4JUZ A;  2YB1 A;  2KV2 A;  2ZIW B;  4J9N A;  3TAC B;  3HKZ F;  7ICE A;  2G08 A;  3UM9 A;  3UXN A;  3NAS A;  4EEN A;  3UXP A;  4DL7 A;  1J97 A;  3EYZ A;  4C8K A;  1ZD5 A;  2WFA A;  2AH5 A;  2KJ5 A;  3NVZ A;  4NLK A;  2KSO B;  5AI9 A;  2NRV A;  4QWC A;  3I76 A;  1ZOL A;  1S8O A;  4KIT B;  4YR3 A;  2AHO B;  3E2E A;  3F2C A;  1NK9 A;  5D49 A;  4QZG A;  1KKX A;  1N2X A;  5KFW A;  1LV5 A;  9ICU A;  1NJZ A;  1SZH A;  4C4R A;  3TAP A;  5DLG A;  3PO5 A;  2E5S A;  4NXZ A;  5KFI A;  3AQE A;  3F5A A;  8ICK A;  1ZQO A;  2K4E A;  4KLD A;  1WYG A;  1JRP A;  3N7S C;  3TAD A;  1DK3 A;  3H40 A;  2H5X A;  3JPN A;  8ICI A;  5HHI A;  2BCU A;  4K4I A;  3SEI A;  3G6Y A;  5EE0 A;  2YB4 A;  4DFJ A;  1C20 A;  3OGU A;  4DLE A;  1ZQX A;  4Y2P A;  5EWE A;  2HBK A;  1JX4 A;  4Q8F A;  1NK6 A;  4PJ0 U;  3RB4 A;  3V7K A;  3C1Z A;  5DDM A;  4CF4 A;  2W7O A;  5DGA A;  5C5J A;  1ZRM A;  2LHT A;  3UPQ A;  2MU2 A;  3ED5 A;  1FFU A;  4DWI A;  2IOF K;  3Q8P B;  2PFO A;  2WF6 A;  3LVV A;  2DPJ A;  4YMO A;  1RXW A;  1X9M A;  4J03 A;  4OJL A;  2AQ0 A;  3RRH A;  4CCH A;  4I2F A;  4IQV A;  3PZP A;  1Z19 A;  2HW3 A;  5IIO A;  3RR7 A;  7ICN A;  1Z00 B;  2JXJ A;  1WWV A;  4ICA A;  5HNK A;  4KMU A;  4JWM A;  1WG8 A;  4QWD A;  2BDP A;  1LB2 B;  2W54 A;  3QUT A;  3H0L B;  3HW8 A;  1QSL A;  1KN5 A;  5IIK A;  4DL6 A;  2VKQ A;  5L1J A;  5CJ7 A;  2WF7 A;  4KN7 A;  5ALN A;  5KG7 A;  7ICG A;  3WK4 A;  4XUS A;  4F92 B;  4RPZ A;  1Q46 A;  2N1R A;  3NTU A;  1OXJ A;  1TK8 A;  1KTQ A;  4R63 A;  1ZJM A;  1NJY A;  2K4H A;  3TKA A;  1BPX A;  2DBY A;  2QB1 A;  5KFT A;  5KAF U;  1GO3 F;  5HHH A;  4NY8 A;  3AEV A;  4UAT A;  2V4Q A;  3RJJ A;  5AK5 A;  1KSP A;  2ZUB A;  4J9L A;  5KFD A;  1ARO P;  2XO7 A;  1NZB A;  5DG8 A;  4QIW F;  2ATL A;  5AI6 A;  1ZQP A;  2NRX A;  3TAD C;  2XGP A;  4PHD A;  1OUQ A;  4TQR A;  1IIP A;  3NVY A;  3C28 A;  4UB8 U;  2NRT A;  3NRZ A;  4BWJ A;  4UB3 A;  3GV7 B;  1SL0 A;  4NLG A;  3PVX A;  1UPH A;  4UW9 A;  2KJ8 A;  3M9M B;  2WAQ C;  5AIC A;  3ETR A;  2IMW P;  1SWV A;  5EWG A;  3B0X A;  1PVP A;  2Y0S F;  1T3Q A;  2EAO A;  1F0M A;  4DQI A;  4KX3 A;  2CXY A;  1F5S A;  4WJ3 B;  1PK1 A;  3EPI A;  4P2H A;  1A76 A;  4QZA A;  5J0Q A;  4NM1 A;  4EBD A;  3ZI4 A;  1SV0 A;  1UCV A;  5ALK A;  4YMN A;  2DFL A;  2H3Z A;  8ICN A;  5KFH A;  4EX7 A;  2YMM A;  1FFV A;  2K4I A;  5DBA A;  4ELV A;  5H2F U;  5KG0 A;  2D3D A;  1SXD A;  3KHG A;  3NVV A;  5JU5 A;  1QLN A;  1SZP A;  4ED2 A;  3KFU F;  4ECX A;  5L9X A;  3MFH A;  2G07 A;  3JPT A;  5DB9 A;  3BS5 A;  1HUO A;  2K89 A;  2WHE A;  4M9N A;  4OO1 J;  3DDH A;  1TAM A;  2OEH A;  1X2I A;  4O5E A;  3NUQ A;  2NV3 A;  4PZN A;  3PX6 A;  4US8 A;  4NJ8 A;  2F77 X;  4ECU A;  2AGO A;  4DO9 A;  7ICT A;  1ZQM A;  5AM4 A;  2VIX A;  1SKR A;  9ICH A;  2VJ5 A;  3WK7 A;  4ECW A;  4I2G A;  4US9 A;  3Q8K A;  4MFF A;  5DQH A;  4BJQ A;  1BNP A;  2L5Y A;  3Q8S B;  2F8L A;  2D6F C;  4DFP A;  2EZY A;  3MGV A;  3PNC A;  1L3V A;  2M0N A;  1BPD A;  9ICT A;  4PL1 A;  4J9R A;  3T5J A;  4NLZ A;  2KEY A;  3DEE A;  3OJU A;  5EWF A;  3F53 A;  3M9O B;  1YT3 A;  8ICV A;  4OJO A;  2ODG A;  2P6U A;  4QWB A;  2FPK A;  1ZQE A;  8ICP A;  1T8E A;  1S97 A;  5AKE A;  4FS1 A;  1ZJN A;  1ZYQ A;  1QCK A;  4YD1 A;  5AM2 A;  1BPZ A;  2FMQ A;  3KHL A;  2HI0 A;  4C8M A;  5C0Y A;  2WB1 C;  5K4L A;  1JRO A;  1MQ2 A;  4YR0 A;  5JRT A;  3GDX A;  2DWQ A;  2Y9U A;  4DL3 A;  3IN5 A;  1NK5 A;  9ICO A;  4TQS A;  1RYU A;  2MRL A;  3MAB A;  4PGX A;  9ICP A;  5AK4 A;  2PMZ F;  3WK6 A;  1T7P A;  1TV9 A;  3C2L A;  5KG1 A;  3UXO A;  3RTV A;  4EEL A;  4F4Y A;  3HKZ C;  4B6J A;  3F2D A;  4M04 A;  2KVC A;  5ALP A;  4Y2Q A;  1L5U A;  1MA7 A;  1RZT A;  3HT3 A;  8ICH A;  1Z4O A;  4Z6D A;  3OJS A;  5KNI A;  4YG2 A;  5L1K A;  1WWU A;  3GZF A;  4J9Q A;  4NLN A;  4MFA A;  3BZC A;  3PW0 A;  1NJX A;  3MC1 A;  1IG6 A;  1PZN A;  1XWL A;  2ZJA A;  3IP4 B;  4O0I A;  5ALX A;  2OM6 A;  2XC9 A;  2JEJ A;  1N56 A;  1PK1 B;  1N5W A;  5J0R A;  2F44 A;  4B9N A;  2P66 A;  5KTQ A;  4ED1 A;  4EYI B;  2ZIU A;  2W8K A;  7ICU A;  5AIA A;  3TAN A;  5F3X B;  4QZB A;  2CN1 A;  2ZG6 A;  5KFN A;  3OHB A;  2JHD A;  3QEA Z;  4DOC A;  5AI8 A;  8ICY A;  3NGD A;  3IV6 A;  1X66 A;  4DSE A;  1NOM A;  4PGY A;  5KFY A;  9ICQ A;  4KX5 A;  4UB2 A;  3MDA A;  3GIM A;  4ECZ A;  4F50 A;  2IOF A;  3BS5 B;  5HP4 A;  2VA2 A;  5EE3 A;  4RT2 A;  3V6K A;  2EH9 A;  4BX9 C;  1L3T A;  2EAM A;  2DGZ A;  3MR3 A;  3WKC A;  5KG5 A;  4MEY A;  4C8N A;  2F1I A;  4OJ5 A;  3V6J A;  1B22 A;  2W55 A;  4LZD A;  3J81 j;  2HHQ A;  4M47 A;  1BNO A;  4IQT A;  5HR6 A;  2W9B A;  3NS1 A;  2W3S A;  4FO6 A;  3T5L A;  3SMV A;  3FM9 A;  1SKW A;  3RJH A;  5KFS A;  3AL0 B;  5BPC A;  1X9W A;  1X6I A;  4UAS A;  4QZI A;  3BQ1 A;  5ALJ A;  1ED1 A;  4JV0 A;  1N48 A;  3H0M B;  3PX4 A;  2HMX A;  4QZH A;  4UAZ A;  4O3R A;  5ALY A;  1XU4 A;  1N63 A;  3BS7 A;  3Q8L A;  3RBD A;  4O5C A;  4B9L A;  7ICM A;  1UA1 A;  2IBK A;  3GV8 B;  1TK0 A;  2AJQ A;  1ZQS A;  3RH4 A;  3VC8 A;  1RG6 A;  2RP5 A;  4ELU A;  3KOO A;  1DRG A;  8ICF A;  3N7P D;  2DL0 A;  4J9P A;  4F71 A;  2A1J B;  1SKS A;  1IV8 A;  2DUY A;  2G5I B;  3QUC A;  2EZX A;  2G06 A;  5AKX A;  1HJP A;  4IC9 A;  3QZ7 A;  1NKC A;  2H3I A;  3EWA A;  3E58 A;  4GC7 A;  1K1S A;  1SGG A;  1RYS A;  3CW2 C;  4TUQ A;  1TVA A;  1CRX A;  4KLT A;  2Y9T A;  3BQT A;  4DCC A;  1L7M A;  3K1Z A;  1URJ A;  1KLN A;  4LZG A;  1L7O A;  5KG4 A;  7ICS A;  2FMP A;  1RPL A;  5F9N A;  3ETL A;  4R64 A;  4EEY A;  1KL9 A;  2KVS A;  1A77 A;  1AQ6 A;  2ZUC A;  3IRU A;  3RFA A;  1Y88 A;  5TZV A;  7ICF A;  2YX8 A;  1ZQC A;  2GH1 A;  4MF8 A;  1JUD A;  4DLG A;  2GWS A;  2WB1 F;  3OPX A;  5L1L A;  2JEF A;  1VJ5 A;  8ICX A;  2QAR A;  2ZIU B;  1N5X A;  4F4Z A;  4Q43 A;  3EUB 2;  8ICR A;  1S0V A;  3Q8Q B;  4M9H A;  3PX0 A;  2P6R A;  3HIL A;  3MFI A;  2HHT A;  5DB7 A;  4Y2J A;  2QB0 B;  1ZD2 P;  1L8O A;  4F2R A;  3SAH A;  3L5K A;  4C0Z A;  4RT3 A;  4M9G A;  1ZQF A;  4OCZ A;  4ED7 A;  2KE7 A;  2Y0S C;  4KLG A;  4DS4 A;  1U9L A;  4F4W A;  3QUQ A;  5CRX A;  9ICV A;  4B9U A;  4CNQ A;  1RDF A;  1NKE A;  2NRZ A;  2XCA A;  3L3F X;  5KFZ A;  2W9B B;  5ALG A;  2ASD A;  2EAP A;  3H8W A;  2E8N A;  4QZE A;  3TAR A;  1SWW A;  2DKX A;  3ISC A;  1RM6 C;  3ZD8 A;  4DSF A;  2BCV A;  3N28 A;  4Y2R A;  1HIW A;  5KG3 A;  7ICV A;  3V72 A;  4NLB A;  5DGB A;  5G5H A;  4YN4 A;  5ALZ A;  1QQ7 A;  1KQQ A;  1PVQ A;  1F44 A;  5KG6 A;  2ZTD A;  2ZXI A;  2KHQ A;  2E3T A;  3B9J A;  5IIN A;  9ICK A;  2C2E A;  3H8J A;  4I2J A;  3T3F A;  4HYK A;  1QH9 A;  1S77 D;  2FLL A;  1XSN A;  3PSF A;  5D46 A;  2VAN A;  9ICF A;  5DB8 A;  2XID A;  1A6S A;  1RQN A;  1UA0 A;  2C28 A;  2RHF A;  4QW8 A;  4RQ2 A;  2W9C B;  3M8S A;  3BZK A;  3A0H U;  2ZJ8 A;  4PPX A;  3RBE A;  4F2S A;  1K1Q A;  4YCX A;  1FIQ A;  2ISP A;  4I2A A;  3L4P A;  3SAG A;  2KK0 A;  3RAQ A;  4DFK A;  3QE9 Y;  4CE6 A;  4Y2S A;  5KFM A;  4C7Z A;  1XS9 D;  2KNJ A;  3WK5 A;  4Y2X A;  5J2B A;  4ECY A;  1LVH A;  4BXO A;  2B0C A;  5DBB A;  4B9S A;  2VA3 A;  3QU2 A;  4GIB A;  2K4P A;  1SXE A;  3M7D A;  3AMZ A;  5EE9 A;  2C2R A;  5KFQ A;  1T4G A;  4I27 A;  8ICC A;  4G3I A;  3AUO A;  4BUG A;  2DF4 B;  1L3U A;  2PMZ C;  3PW7 A;  8ICU A;  2I6X A;  5ALM A;  4Y2T A;  3GIJ A;  4UB1 A;  4UAR A;  5AKK A;  5FP0 A;  5AM5 A;  2KFZ A;  4ELT A;  1XSP A;  3OSP A;  1JXE A;  4RQ3 A;  5KFP A;  2WTF A;  2JH7 A;  4GXJ A;  2J6U A;  4B9M A;  1T3N A;  2KKV A;  2PI5 A;  1MC8 A;  4NWI A;  1RQL A;  2W43 A;  4O3O A;  2FLN A;  2ES6 A;  2KMD A;  1KW4 A;  5E79 U;  4M6W A;  2MSN A;  2LBO A;  1S0O A;  3C2M A;  2YN4 A;  2IHN A;  2UVW A;  4GXK A;  4OD0 A;  9ICS A;  1X9X A;  3O0F A;  4XA5 A;  4UBB A;  5ALI A;  4EZ9 A;  4DSL A;  3IG8 A;  1B4F A;  3ZDB A;  1PVR A;  4F72 A;  5G5G A;  2C2D A;  2LM1 A;  4DF4 A;  2DKZ A;  5J2F A;  4RNN A;  3PW5 A;  5ALQ A;  5KFJ A;  3T79 A;  3RAX A;  4B9T A;  3KHH A;  1ZQI A;  1QQ6 A;  2XI9 A;  3WKE A;  5CEH A;  3Q8M A;  2JZB A;  1ZQL A;  3KKA A;  5GTH U;  4PHA A;  2E1E A;  2H3V A;  5DQG A;  4RU9 A;  1U48 A;  2HOF A;  4M0A A;  2FMS A;  3PO4 A;  3QUB A;  1XO1 A;  4J9S A;  4NV0 A;  3HWT A;  4Y2V A;  4RUA A;  4I2H A;  2FLP A;  4O9M A;  3AU6 A;  2B21 A;  2VJ4 A;  5J2H A;  1BPY A;  2KP7 A;  2BCQ A;  1XSL A;  8ICB A;  4RNM A;  4UBC A;  1KEJ A;  2LYH A;  4A8E A;  5AK6 A;  5KT4 A;  2FDR A;  3SI8 A;  4QNL A;  4C8L A;  1BVS A;  2WF5 A;  3ORY A;  1KDH A;  3N97 B;  3ISD A;  4QW9 A;  1DXS A;  4CRX A;  2Y1I A;  1U45 A;  3IDW A;  3BQ2 A;  3N7R C;  4Z6C A;  4I2I A;  4IR1 A;  2Q4T A;  4F5P A;  4TUP A;  1SL1 A;  4EBE A;  5ALD A;  4QJF B;  3RJE A;  4YMM A;  3GV5 B;  5AKZ A;  2NRW A;  4QZC A;  9ICN A;  1Z1B A;  4BXO B;  4J9M A;  1DK2 A;  2K60 A;  3SEN A;  4ECR A;  3HRD D;  2KG5 A;  2BPC A;  4DF8 A;  5AM0 A;  4EEK A;  1J2M A;  1ZXI A;  1UQV A;  2XVT A;  8ICW A;  3KZI U;  4P0P A;  4YVZ A;  1JAL A;  2G0A A;  1L7P A;  3M6K A;  2HBM A;  9ICG A;  1ZQR A;  3OSN A;  4RQ8 A;  3S6J A;  2IOH A;  5KFA A;  3H7I A;  1DGS A;  5ALV A;  4F5Q A;  1ZQD A;  4ECS A;  2WF9 A;  4F4K A;  1X6J A;  1KBU A;  1NZP A;  5F9L A;  4YXM A;  3HP6 A;  5HMM A;  1Z1V A;  5IIJ A;  4M6W B;  1V97 A;  5AKI A;  2EAN A;  2R8J A;  3RJG A;  5ALF A;  1WCN A;  1L8L A;  2DQN B;  4R8U A;  1S76 D;  2M9N A;  7ICL A;  4RQM A;  1C7Y A;  3ZDA A;  3PV8 A;  5DG9 A;  3QU9 A;  5KFE A;  5J2E A;  5KFV A;  2IA6 A;  2P35 A;  3LWL A;  4BDP A;  1ZQW A;  3KKA C;  2JMG A;  5ALT A;  3V6H A;  2LM4 A;  2KOB A;  2LI6 A;  5J2A A;  4ZOH C;  1KFS A;  3KBB A;  4I2C A;  4KLF A;  3A0B U;  2BZF A;  4QZ9 A;  2JGA A;  5IIM A;  8ICQ A;  4K4H A;  3RB0 A;  2OYY A;  1KRP A;  4EBC A;  4U7C A;  1QSS A;  1BPB A;  5KFO A;  2J6S A;  4B9V A;  4O3M A;  3QNM A;  2HHU A;  5B5E U;  5JTI A;  2W9A A;  2BQU A;  2QLT A;  3IHQ B;  3PML A;  3U26 A;  4UAW A;  4CF5 A;  4PH5 A;  4LJX A;  3K75 D;  5DG7 A;  4KLS A;  4UAV A;  2I1Q A;  5DDY A;  5KFK A;  1S0N A;  4RQ0 A;  4MFC A;  5KFC A;  2HCF A;  4O5K A;  1ZQU A;  1D9D A;  8ICM A;  3GIL A;  2E8P A;  5AHX A;  1UT5 A;  4UAU A;  3ISB A;  4FBT A;  2OWO A;  2RDI A;  5KL1 B;  4YD2 A;  4QWA A;  2ZIW A;  5J0T A;  2KZ3 A;  3CNH A;  3TFS A;  2F76 X;  4UAY A;  1MSW D;  1NJW A;  4NM2 A;  3C23 A;  2B6G A;  4KLJ A;  1ZQY A;  3QU4 A;  4ACO A;  4I2E A;  1N61 A;  3JPS A;  5KFB A;  4F3O A;  2OXO A;  1CUK A;  5J0S A;  2KSO A;  4CGZ A;  5CWR A;  1N60 A;  4RPY A;  5J2G A;  1Z4N A;  4PL2 A;  4DL2 A;  9ICW A;  4P0P B;  5ALO A;  3FC4 A;  3PMN A;  1U47 A;  2LPE A;  5AI4 A;  3ZDD A;  4UB5 A;  3JPQ A;  1ZQH A;  2ZJ5 A;  3T5K A;  1ZD3 A;  1HUZ A;  1ZQN A;  3I1Y A;  2GO7 A;  4C80 A;  1TAU A;  9ICE A;  5EOZ A;  4YP3 A;  1VLB A;  2A1A A;  2F1H A;  3PST A;  4IRD A;  2Y1J A;  2F1J A;  9ICA A;  1RXV A;  1JMS A; 
#chains in the Genus database with same CATH homology
 2KKV A;  4JMU A;  4PL1 A;  2G5H B;  3PSP A;  4NWI A;  4QJF B;  4KX5 A;  2OYY A;  1OUQ A;  5T14 A;  1IIP A;  2KKP A;  4QIW C;  4U7C A;  1PVQ A;  1F44 A;  3C28 A;  2ZXI A;  2LKY A;  2W7O A;  4O3M A;  1Z1B A;  2KEY A;  2KHQ A;  2LHT A;  2LBO A;  3DEE A;  3F2B A;  2G09 A;  1UPH A;  4BX9 C;  2W7P A;  2DGZ A;  2KJ8 A;  4FZN A;  4FZL A;  3RFA A;  2HOQ A;  1Q3V A;  1NZB A;  3C29 A;  2KHV A;  2YB1 A;  3LVW A;  2KJ9 A;  2YX8 A;  3F53 A;  2K8A A;  2GH1 A;  2KV2 A;  2WAQ C;  1YT3 A;  2ZIW B;  4FE3 A;  4OJ5 A;  1P7D A;  3D2Q A;  4KMO B;  1PVP A;  2ZIV A;  4OJO A;  2HOI A;  3F5E A;  3LVV A;  2Y0S F;  3HKZ F;  3O0F A;  2XVT A;  3PSF A;  2G08 A;  2E1F A;  4GFJ A;  4P0P A;  4KX3 A;  1Q3U A;  1WUD A;  2G0A A;  2WB1 F;  2JH1 A;  2XIC A;  3IG8 A;  3OPX A;  2XID A;  4OJL A;  4WJ3 B;  1A6S A;  3M6K A;  4NLC A;  2HBM A;  4U6P A;  3PZP A;  1Z19 A;  4FZM A;  2K8B B;  3SMV A;  3KZX A;  5A0L A;  1PVR A;  2RHF A;  2ZIU B;  2Z7J A;  2WB1 C;  4ICA A;  5C0Y A;  1L6N A;  2ZIX A;  2OH2 A;  3NRW A;  3SAF A;  2KJ5 A;  1HEK A;  1ECW A;  3AL0 B;  2H3Z A;  2LYB A;  4AYB F;  1D8B A;  3IN5 A;  3T79 A;  2K4I A;  3H0R B;  3H0L B;  5KL1 B;  2MRL A;  4P0Q A;  2GOL A;  1ED1 A;  2H3Q A;  5KL8 B;  5HR7 A;  2XI9 A;  2ZIW A;  3H0M B;  3RF9 A;  1XO0 A;  2PMZ F;  3AQF A;  2HMX A;  3F2C A;  2F76 X;  3SAG A;  2KIC A;  2VKQ A;  3SAH A;  2HBL A;  4C0Z A;  2KD1 A;  2R18 A;  3CP8 A;  1KBU A;  3KFU F;  1T94 A;  2E1E A;  2H3V A;  2CPR A;  2KNJ A;  2Y0S C;  2HOF A;  2G07 A;  1SZH A;  3HKZ C;  3CRX A;  2LYA A;  3F2D A;  2KVC A;  2A3V A;  2RRD A;  3VC8 A;  4ACO A;  1MA7 A;  2K89 A;  2RP5 A;  2E5S A;  3CYM A;  5CRX A;  3LYS A;  4CDG A;  3GZF A;  2OXO A;  4NV0 A;  4OO1 J;  2DQN B;  1DRG A;  3AQE A;  3F5A A;  4CGZ A;  3SQI A;  3M6Z A;  2N1R A;  3M7D A;  1TAM A;  3N7P D;  2VJ4 A;  2W03 A;  3D2N A;  4PL2 A;  2K4E A;  2ZIV B;  3IG5 A;  2W04 A;  2ZXH A;  3IP4 B;  2NV3 A;  3N7S C;  3NUQ A;  3VCB A;  3L3F X;  5HR6 A;  2F77 X;  2OM6 A;  2MA1 A;  4A8E A;  4AYB C;  4P0P B;  2G5I B;  2G06 A;  2VIX A;  2DF4 B;  2HBJ A;  4BUG A;  2F2A B;  3PSI A;  4QNL A;  2VJ5 A;  2CRX A;  3D2S A;  2PMZ C;  2K4H A;  4IC9 A;  2JMG A;  2H3I A;  2ZIX B;  4OJP A;  1A0P A;  2KOB A;  2BDU A;  2WAQ F;  3E0F A;  1ZQ1 C;  2ZIU A;  3GU3 A;  4OJ6 A;  2YB4 A;  4CRX A;  2H3F A;  4BJQ A;  1GO3 F;  2F8L A;  2D6F C;  3ALR A;  1XNS A;  1CRX A;  2CN1 A;  3N7R C;  2K8C B;  3MGV A;  4P0Q B;  2ZG6 A;  2KIW A;  3K1Z A;  1HIW A;  3PST A;  1URJ A;  2JHD A;  2HBK A;  2M0N A;  2JH7 A;  4NLB A;  3ICX A;  2Q4T A;  3ONN A;  2JGA A;  4QIW F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...