2XVTA

Structure of the extracellular domain of human ramp2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
VKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR ACTIVITY-MODIFYING PROTEIN 2
publication title Structure of the Extracellular Domain of Human Ramp2
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 28
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2xvtA00
3AQFA 3N7SC 3N7RC 3N7PD 2YX8A 2XVTA 3AQEA
chains in the Genus database with same CATH superfamily
3NVZA 4BDPA 4P4MA 5DB6A 2PMZF 1JXEA 4BWMA 4X5VA 3LWLA 2R8KA 1LKYB 3NUQA 3OHBA 4RT3A 2KOBA 4EYIB 5KFDA 1U48A 4QW8A 1KRPA 3RR7A 4KLUA 4J9LA 2DF4B 5ALOA 8ICCA 1COKA 2E3TA 4F91B 5BOMA 2G5HB 3LDAA 1RQLA 7ICEA 2W55A 4MFAA 1Z4NA 3UXNA 4I2GA 4GXIA 4F4YA 3BQ7A 4JV0A 3PX6A 3C1ZA 4E0DA 4RQMA 2J6SA 8ICXA 1NZPA 3PW7A 2ZXIA 3LWMA 2XICA 2ZIUB 1ZOLA 5KFFA 5L1KA 4UAUA 3M9OB 4KLOA 2MAXA 2C2EA 3PX0A 2IHNA 2D3DA 1WWVA 3V72A 3E2EA 4Y2QA 3H8MA 1EXNA 2AGPA 1ZQXA 1Q8KA 2YMQA 1T94A 1SXEA 4UAWA 2AU0A 8ICMA 2MUTA 1L3VA 3RH6A 2LM4A 3WK7A 2G5IB 2H3ZA 5KFQA 3KFUF 5F3XB 2QB1A 8ICEA 4CNQA 2F77X 1Z19A 1JX4A 4Q8FA 1KKXA 3S6JA 5J2FA 1D9FA 1A76A 4R65A 5AI9A 5J8YC 1SV0C 3WKAA 4KTQA 4O3SA 4I2DA 5ALKA 3QZ7A 1PVPA 4M0AA 3R9KA 1UHUA 1BPDA 2JZBA 5IINA 4IL6U 1NZBA 3ISBA 3FC4A 3ONNA 2ES6A 3QUBA 3WKEA 4QZ9A 2ZIXB 2OWOA 9ICEA 2IBKA 1C20A 4PHDA 3AUOA 3RFAA 1COOA 3I1YA 5J0TA 1K5OA 1SZHA 5KFUA 2C22A 3F53A 3QU7A 4LZGA 4DOAA 1XNSA 2DKZA 4PJ0U 3V6JA 2YY6A 2WFAA 3NTUA 4DL2A 5H2FU 5J0QA 1ZQPA 3K75D 5KFPA 5ALDA 5J2EA 4M47A 4KN7A 2HVHA 2NV3A 3THVA 3OGUA 4ACOA 1DXSA 4TUSA 4FZMA 4C7ZA 1L6NA 3F5EA 4RQ6A 5KFAA 3WKBA 2C28A 4RT2A 2R8JA 2DBYA 2YB4A 2DL0A 3ICXA 4DFDA 3KHGA 4FS2A 4PZOA 4Z6EA 3KBBA 4Y2YA 4EX6A 4MFFA 4RNNA 3RF9A 2W7PA 4NWIA 4QWEA 4IRCA 1V85A 4DF8A 2JEGA 2A1JA 4Y2UA 3NVYA 1XU4A 2BCQA 1V38A 5ALJA 4NLBA 3J81j 3ZDDA 2JH7A 3WU2U 5AI6A 3JPNA 4JV1A 4Q43A 5DKWA 2ZUDA 4PZNA 2W8KA 4TQRA 9ICRA 5DQHA 1ZQHA 2XGQA 4R63A 4F5RA 1FO4A 1NOMA 2B0CA 4DOCA 1U4BA 4ECQA 4B9LA 2MUTB 3B9JA 2HW3A 2EH9A 3L5KA 3H4BA 4G9BA 3PVXA 1ZRMA 5HHIA 4F4KA 9ICFA 2VANA 3QU2A 1S0NA 4CF4A 2IHMA 4XUSA 3NVWA 2JMGA 2FJ6A 4QNLA 5AM4A 4I2CA 4OJPA 5ALQA 1ZQLA 2W3RA 2HHSA 1CI4A 2Z7JA 4DSJA 4F5PA 2EZXA 3C5FA 3ZDAA 2OM6A 2BPCA 2FI1A 5AK4A 3WKDA 4EX7A 5J2GA 1LVHA 1QLNA 2F76X 3TFRA 2PI5A 2BCSA 2Y1JA 5DLGA 1JALA 4M04A 2HHUA 1L3UA 2JZBB 5KFNA 2JXJA 4NY8A 1NK7A 4UB8U 5AKHA 4I28A 1KN5A 1N60A 4UB4A 4DL3A 3Q8QB 2PFNA 4KX5A 3T5KA 5EOZA 5AKXA 3RBDA 4CCHA 5IIKA 9ICCA 3EYZA 3OPXA 1ZQZA 1HIWA 3SR6A 4R8UA 3TANA 3QUCA 2DGZA 2KJ5A 2KTQA 3JPQA 4YXJA 4O5CA 1KQQA 4EENA 4Y2PA 2DKXA 2XCPA 1BPEA 1S97A 2K8AA 4RPYA 1BPZA 4ECUA 4RUAA 2ASJA 9ICBA 2GH1A 4MEXA 2WF5A 3PR4A 4NL9C 3U26A 4QZ8A 2F2AB 2R8IA 4P0PA 2K4EA 3NRWA 4NXZA 5ALNA 4UAZA 2BDUA 4C8LA 3RTVA 2H3IA 1YZ7A 2A1JB 9ICNA 5AM0A 3ZDEA 2JH1A 4DSEA 1IM4A 1K1SA 2KZ3A 1PK1A 1U9LA 9ICOA 4UAVA 2F44A 5KT3A 2QB0A 4IC9A 3H8SA 5AKLA 3GIKA 3L4PA 3M9NB 2KKVA 2KSOA 3QEAZ 3QZ8A 3GZFA 1YT3A 4P4OA 5ALRA 3SAFA 1ZQCA 4K4HA 4A8EA 1KDHA 7ICIA 3UMCA 4DL5A 2MA1A 5J2HA 3C29A 4HAIA 2HOQA 3KTQA 2KV2A 4DQPA 2RHFA 2LYBA 1SB3C 2BPFA 3LVVA 4DL6A 4K4GA 3M6ZA 1PUZA 4QJFB 5E79U 3KKAC 5AKEA 3HRDD 5L1IA 5KFOA 2HI0A 5IIOA 4ED0A 5IIIA 1Z4OA 1NI3A 3QUQA 2LPEA 5KL8B 4JB3A 2QARA 2NRWA 4KLLA 8ICBA 4EBDA 1LV5A 3EUB2 3KZIU 4PGXA 4NLZA 1HEKA 1MN8A 1V97A 3Q8KA 4M9NA 1KEJA 2AQ0A 1RXWA 4UATA 2K60A 4KX3A 7ICQA 3H0LB 3NASA 5KFYA 5IIJA 1TK5A 3HJEA 4F4WA 1DK2A 2H5XA 2IMWP 2HHWA 2JRZA 4B9VA 4I2BA 3MC1A 4RQ7A 7ICPA 2LKYA 2LMRA 2HOFA 1T7PA 3HPOA 5ALEA 4LZDA 3A0HU 1N48A 2WB1C 5DB8A 7ICOA 5KG7A 1SL2A 2F8KA 5AKYA 4R8UB 4DSKA 2FLNA 5KT6A 4DLEA 1JIHA 5B66U 4EEYA 4UW9A 8ICGA 4QWCA 1S0OA 2KHVA 3KHLA 2ZG6A 3PSFA 2B21A 4Y2TA 3JPOA 4C8MA 4QW9A 2CPRA 3ZI4A 1ZQUA 3MGVA 2VA2A 3H4DA 1JMSA 2VJ5A 3RRHA 1TE2A 4YN4A 3RRGA 1J2MA 2ESEA 4P0PB 5AIAA 2BCVA 4NM2A 1NJWA 2WAQC 2W7OA 2DPJA 3MR3A 4FBUA 1T3NA 2WF7A 3V7LA 4F4XA 4ELTA 4KLIA 3KD3A 3K1RB 4US9A 1ZQEA 4I2IA 1TAUA 1PK1B 4C8NA 3BDPA 4XRHA 5EE3A 2HHXA 4UB2A 4GXJA 3TKAA 4BXOA 1NKBA 2KMDA 1XSPA 2QB0B 5L1MA 3BJYA 1U45A 3BS5A 2KSOB 9ICMA 4FFDA 1JN3A 9ICXA 5EWEA 1ZQSA 1ZQFA 5CJ7A 2E8NA 4RPZA 5AI5A 5AKZA 9ICIA 1RYRA 3ZD8A 2I9GA 5F9LA 5BOLA 5C5JA 3AM9A 2HVIA 2KG5A 4YR0A 4QZDA 2XVTA 4IQVA 2AHOB 4YCXA 4YD2A 2ALZA 1IIPA 3ALRA 2A3VA 3SMVA 3RJGA 2NRZA 4M9LA 4KLFA 4KLDA 3BZKA 1MQ2A 4YG2A 3UMBA 4QIWC 2QARB 3WKCA 1X9MA 3D6JA 4UAYA 3IG5A 3IN5A 1TKDA 5ALPA 7ICMA 4B9UA 1NKEA 2JEIA 4YR2A 4KLGA 1KSPA 5DBAA 4RZRA 2ZXHA 5CB1A 1KW4A 2IOFA 2JR5A 2FPKA 3DEEA 4IS7A 2HSZA 1OW5A 2ATLA 2Y9TA 3UXOA 4U6PA 3M9MB 1D8BA 1VJ5A 4RPXA 3EWAA 5KL1B 1L8OA 5J2IA 1NKCA 5AIBA 2OYYA 3IP4B 3N28A 2DPIA 8ICPA 4Y2XA 5DDYA 4QZHA 1B4FA 4KITB 1ZQAA 4EBCA 2W3SA 2FDRA 5AM1A 4I2EA 7ICGA 1Z3EB 2KZMA 1Z1VA 4JMUA 1ZQ1C 4CE6A 2LM1A 4RQ5A 1ZQGA 3GDXA 3RBEA 5KFJA 3Q8SB 1UT8A 2LBOA 3SD7A 3RAQA 3I28A 3B0XA 1ZETA 5ALSA 2I1QA 5AI4A 4YQWA 2K8BB 2PI4A 4DO9A 3ISCA 3N7PD 3ETLA 2XY5A 3CP8A 1CEZA 3RH4A 4QZFA 4GFJA 2Q0ZX 1VLBA 4BXOB 2RDIA 1SL0A 1TAMA 1GO3F 4C4TA 3MABA 4KMUA 4OCZA 1L3SA 4Z6CA 3BS5B 3T5HA 5J0OA 3C28A 1RZTA 4RNMA 3HKZC 1TFRA 3TADA 4F50A 1B0XA 2W11A 3M8RA 3AMZA 2VA3A 1RDFA 1ZRNA 2G0AA 5B5EU 3SV4A 1KLNA 1MQ3A 3HILA 2IA6A 3H40A 2BPGA 4P4PA 5HP4A 2ZTCA 2E1FA 3QU5A 4QWBA 5DGAA 4NLNA 2K4HA 5J0YA 4YFKA 5DQIA 1PVRA 5J2JA 4F2SA 5A0LA 2Y0SC 5DB9A 5GTIU 3MBYA 2KKPA 1N63A 2UVUA 4M9GA 4ECZA 2KHQA 5CHGA 4F92B 3EPIA 4ED2A 2JEFA 3IM1A 4YMNA 1XO1A 2VKQA 3WK4A 2KIVA 3PSTA 4C7YA 4MF2A 4EELA 4J9MA 1A77A 1X6IA 1O03A 2W9AA 2F1IA 5KFMA 2OH2A 3LK9A 1FEZA 3JPRA 5CR0A 1BPYA 1CRXA 3SEIA 2I6XA 3QXGA 2OHFA 3SQIA 2XGPA 3L3FX 3I76A 3WK5A 2D8CA 4QWDA 1ZQRA 8ICSA 1RXVA 1DK3A 2EZZA 1ZQDA 9ICWA 3TACB 2ZIWA 3RB0A 2G06A 4AP9A 1PZNA 2DQNB 1YZ6A 4DF4A 4DSFA 4IRDA 3FM9A 5TISU 3TAQA 1L7NA 1N56A 1F44A 1SKSA 2R8HA 2XY6A 4Z6FA 2OCEA 3QE9Y 3ZDBA 3PO4A 3RJKA 2WF9A 4DSIA 2ZUCA 5DBBA 3IG8A 2OEHA 5EE9A 8ICJA 4I29A 1TV9A 4F5QA 2VJ4A 3PMNA 4B9SA 4DWIA 1AROP 4QWAA 2C2DA 1WCNA 4DCCA 2RRDA 3PW5A 2XI9A 1ZYQA 3V6HA 3WK8A 3D2NA 2L5YA 4B6JA 4M9JA 5KFHA 2BHNA 4YP3A 1S5LU 4CDGA 4NLKA 2YN4A 1NNLA 4UB3A 3M1YA 5J2BA 1HUOA 8ICYA 5J0SA 2ZJAA 4YMMA 5AK3A 1PVQA 2WTFA 3C5GA 1JXLA 4USAA 1BVSA 4ECRA 1KFTA 4I2JA 5KG2A 3H8JA 1OXJA 4F8RA 1T8EA 1TK0A 4ECWA 5AICA 3MDAA 4EBEA 1QQ5A 4PL2A 1NK6A 4HYKA 3IRUA 3PZPA 4ED1A 2W03A 4ZOHC 4P0QA 4M2YA 1ZQQA 1A0PA 8ICOA 3CNHA 3VC8A 9ICUA 4P2HA 1ZQVA 5AK6A 4MFCA 2EAMA 2W9BA 1FFVA 4B9TA 5J29A 2ZJ5A 2W04A 4KLJA 2PKEA 1D8YA 1L3TA 5ALMA 3MGHA 2ZJ8A 5AKKA 4UQGA 1S8OA 3RB4A 5ALFA 2KZZA 2W43A 1FFUA 1J2NA 5KFZA 2HDOA 2VIXA 4CF5A 3PO5A 2NYVA 4ELVA 4F72A 5CP2A 2BR0A 2ASLA 1UPHA 2KD1A 3T3FA 4TURA 4O5KA 1QSSA 1ZD3A 1ZQIA 3M8SA 3SZ2A 2HHQA 1SWVA 2ZIWB 4MHVA 3N4MB 2W8LA 3RH5A 3RB6A 4GLXA 1ZQNA 4FE3A 5KG4A 4DS5A 1NK9A 3RJJA 3F2DA 4IQTA 3KOOA 4BUGA 3TAPA 1X66A 5AKJA 5KFVA 3ZD9A 5AM3A 4GC7A 1V9PA 4NJ8A 1Z00A 5JUMA 2H3FA 4EZ9A 3QX7A 1RPLA 2WB1F 2KFNA 8ICWA 1TVAA 4BJQA 1WWUA 1O08A 1SL1A 3C1YA 5AI8A 2BQRA 2HBJA 5ALGA 1K1QA 2EQYA 3F2CA 4LVSA 4QZAA 3LYSA 4YR3A 4KLSA 4R66A 1L8LA 2FE9A 3D2QA 4G3IA 3CYMA 4DLGA 4ED8A 2LHTA 4YD1A 2I5HA 4FS1A 1S0MA 3K1ZA 3BQ1A 1ZQKA 3K4GA 3GIIA 2WAQF 5KAFU 1B22A 3SAHA 3QUTA 5J0XA 9ICHA 4TUPA 2K89A 1IG6A 1TAQA 2VA8A 4UB5A 1UT5A 4J9NA 1XC9A 5EWGA 1DOQA 1ZQWA 3H8WA 4I2FA 3AU6A 4JWMA 1ZQMA 3AL0B 1UA0A 1A6SA 5ALUA 9ICSA 4P0QB 4PHEA 3NGDA 2ZIUA 1RYUA 2GLEA 1SV4A 1H38A 5J0UA 2G09A 2HCFA 4RU9A 4CGZA 4BGDA 2BKEA 5K4LA 1SZPA 4PHPA 3GV8B 2ZTEA 4ZH4A 5G5GA 3D2SA 4RQ4A 3OJUA 4R64A 2RQ5A 3DDHA 1NJZA 7ICUA 2ZUBA 3GQCA 2YX8A 4DFJA 4AYBC 2E5SA 5JU5A 4DL7A 3RAXA 1RG6A 2W9CA 5J0WA 3M6KA 4QIWF 3UQ0A 4KLHA 2BDPA 4CRXA 4TUQA 3NRZA 8ICLA 1S9FA 7ICSA 5KFEA 2HBKA 3TADC 3AQEA 2V4QA 5DBCA 2KVSA 3C21A 2ISOA 2HMXA 3FYHA 5KFXA 5J2AA 4ED3A 3ORYA 4GC6A 7ICVA 1F5SA 1ZD4A 1KTQA 4TQSA 1KFDA 1L7OA 3JPTA 2EZYA 1BPXA 3V7JA 2FPLA 1JROA 3PV8A 3HW8A 1Z1BA 2J6TA 1N2XA 1Z00B 4GXKA 2H3QA 5JRTA 4PH5A 4MEYA 1NK0A 2ZIXA 3AEVA 2A19A 1IXRA 4EYHB 4F3OA 1Y88A 2PFPA 2F8LA 5HMMA 2J6UA 3OJSA 2UVRA 1NJYA 1KFSA 4IRKA 5BPCA 2M0NA 3PW0A 2PXIA 2BZFA 1J97A 3EZ5A 3C23A 3C2KA 4O3RA 4FO6A 3NS1A 4Q8EA 2V9WA 2KICA 2KE7A 5J0PA 2BCUA 2EANA 4OJOA 5HHHA 3KKAA 4EZ6A 4ECYA 4F71A 4OJ5A 2CRXA 2FMPA 2HBLA 5AKIA 3UXPA 1XSLA 1Q3UA 9ICJA 3FAHA 3HX0A 4B9NA 5D46A 2HHVA 1JI7A 2QKQA 3B0YA 4YMOA 3BQTA 4C0ZA 1JUDA 9ICGA 5J2CA 1UQVA 8ICFA 4BX9C 4I2HA 5D4BA 3ETRA 1F0MA 2XO7A 8ICKA 3EW9A 3MFHA 5AM2A 5G5HA 5ALTA 2FMQA 3QU4A 3T5LA 4C8KA 1SXDA 3HKZF 5ALYA 4O3NA 1JRPA 1X42A 3MR5A 3OSPA 1L5UA 2BGWA 4B9MA 4NLCA 1CUKA 4DFMA 2PMZC 5KT2A 5KFBA 4J03A 3JPSA 5KFWA 2AGQA 2ZTDA 5HNKA 3PMLA 7ICLA 2KFZA 4KN4A 2E8OA 5DQGA 4KLEA 1DRGA 2G07A 1XS9D 2YQEA 2NRVA 1NK5A 4ICAA 2W9CB 4JUZA 4RQ3A 2F1HA 2K4IA 5DG7A 2Y0SF 4K4IA 7ICHA 1RQNA 4JV2A 2JEJA 3AN1A 9ICAA 1WG8A 4J9RA 1PK3A 2P35A 3RB3A 4IQUA 4PPXA 3PW4A 2ASDA 2NO4A 1KBUA 3G6XA 4BWJA 1X9WA 1QH9A 3PSIA 4O9MA 4F93B 5JTIA 4C8OA 4ED7A 2UVWA 3MDCA 3N97B 2LYAA 1QSYA 4UASA 2WF6A 4RQ8A 7ICTA 2XY7A 1XSNA 1HJPA 2YTUA 5KFGA 3C2LA 3TARA 1OUQA 2P6UA 3G6YA 5L1LA 4I2AA 4M9HA 2E8MA 1NK4A 3TI0A 1DGSA 1T4GA 4PL1A 4UBBA 3A0BU 2RLTA 5EE1A 1N5XA 5GTHU 3H7IA 1N5WA 3G6VA 4JWNA 3JPPA 3KZXA 4FZNA 1N61A 3IV6A 3SENA 4JK1A 5CWRA 1WYGA 4DQSA 2D6FC 2FLLA 3SV3A 2E1EA 1SGGA 2P6RA 2QLTA 4Y2JA 1S0VA 4DQIA 3DV9A 2A1AA 2KIWA 3RJFA 5HR7A 4J9SA 2M9NA 5KG3A 3WK9A 3GV5B 4O3MA 4QZBA 1N62A 1U49A 4DOBA 4ELUA 8ICRA 5ALXA 5KFSA 3H0MB 2DWQA 5CRXA 2YB1A 1KL9A 1T3QA 3Q8LA 2F1JA 5KT4A 1XO0A 3GU3A 3PR5B 4EEKA 1ZD2P 3AQFA 3RJHA 3Q8RB 4M6WA 2ODGA 1ED1A 1QQ7A 1B43A 4F2RA 1SKRA 5J2DA 3ED5A 5KTQA 3VCBA 5KT7A 5C0YA 4Q45A 5AKGA 3TFSA 4C4SA 3KHRA 4ECXA 2FPMA 5KG1A 5DGBA 8ICQA 3RJIA 3QNMA 2DUYA 1X2IA 4J9OA 2GOLA 1ZD5A 5KFIA 3SYZA 4Y2SA 4NLGA 5ALHA 2BCRA 5KFTA 1XWLA 3GILA 2C2RA 2WHEA 2WF8A 3PW2A 1ZQYA 1L7MA 5HR6A 3SAGA 1QSLA 2F3NA 4RUCA 4DFKA 3UPQA 4IQWA 3V6KA 4LJXA 3WK6A 1L7PA 2IOFK 2BQ3A 2NRTA 3TQ1A 2KJ8A 3BS7A 2FMSA 4YXMA 5KFCA 2MSNA 1ZJNA 2DFLA 5KT5A 1RM6C 3QU9A 3GIJA 4PGQA 1S76D 2W9MA 3T79A 9ICTA 1Q46A 3HWTA 1X9SA 1AQ6A 5J8YA 1SV0A 4RQ2A 3BQ2A 4ECTA 5F9NA 3SI8A 4OJLA 3MFIA 9ICVA 5KFLA 4F5NA 8ICAA 9ICPA 4UB1A 5KG6A 7ICNA 4C80A 5D49A 4J9PA 2CXYA 2Y1IA 1SWWA 5ALLA 2ZIVA 3LVWA 5ALZA 4XA5A 1X6JA 1LB2B 3GV7B 5IIMA 3PSPA 3RR8A 1X40A 4QZCA 1ZJMA 5DDMA 3UQ2A 4PGYA 2RP5A 2BQUA 3BQ0A 3N7RC 4DFPA 4U7CA 1S10A 2MU2A 2FLPA 2GWSA 3O0FA 3N7SC 4RQNA 3M7DA 4CF3A 4WJ3B 1C7YA 3V7KA 4PHAA 4J9KA 5J0RA 2XCAA 2KJ9A 4Q44A 2V4RA 5KG0A 1Q3VA 1U47A 7ICKA 2Q4TA 2G08A 2AXTU 5DG8A 9ICLA 4OJ6A 4QZGA 2E8PA 1BNPA 3OSNA 4QZEA 1ZQJA 4O0IA 2YMLA 3IDWA 4O5EA 5DLFA 8ICUA 4KLTA 2KN7A 3PY8A 2O6KA 4NM1A 4M6WB 1MC8A 5AM5A 2KP7A 2HOIA 1URJA 2YMMA 3E0FA 3IHQB 3PX4A 3UMGA 1DGJA 3MR2A 5HMLA 5ALWA 1WUDA 2R18A 4XQ8A 2R8GA 1SIJA 4KLMA 5DG9A 8ICHA 4ED6A 2LI6A 8ICVA 5AK5A 5EE0A 4FBTA 1NK8A 5ALVA 2PFOA 5AHXA 3MGIA 4RQ1A 8ICZA 2JGAA 3RJEA 4DQQA 1UCVA 2AH5A 3HT3A 5KFRA 5KG5A 3E58A 5J2KA 5FP0A 1IV8A 3NVVA 4O3OA 3PNCA 4OO1J 1FIQA 2CN1A 4O3QA 4GIBA 4UB6U 5AI0A 8ICTA 2B6GA 5KNIA 2EAOA 4I27A 1ZQOA 3ZDCA 1LKYA 1ZXIA 4DS4A 2HBMA 1NJXA 2LYHA 4AYBF 4IR9A 8ICIA 3QYPA 2W54A 1ECWA 1S77D 4Y2VA 1P7DA 1ZQTA 2PFQA 3MR6A 1UA1A 1QTMA 3KHHA 2IOHA 2AGOA 1BNOA 2K8CB 5CA7A 4DQRA 3OHAA 4O3PA 2ISPA 2JV3A 2NRXA 8ICNA 1D9DA 2JHDA 3EPGA 9ICQA 4OD0A 4DL4A 2HHTA 2YMPA 2EAPA 3HP6A 4J9QA 4IR1A 5L9XA 2N1RA 1HUZA 4QZIA 1BPBA 3F5AA 2ZIVB 3BZCA 1D8LA 7ICJA 3T5JA 2W9BB 4Z6DA 3QEBZ 2UVVA 4US8A 9ICKA 3H0RB 2GO7A 1RYSA 2EDUA 4RNOA 3C2MA 2KK0A 4Y2RA 2RDJA 2P66A 5CEHA 4ECVA 1WCLA 3ISDA 4ECSA 2KNJA 4KMOB 5L1JA 5DB7A 2KVCA 2OXOA 1X9XA 1ZQBA 2AQ4A 4C4RA 3GFKB 2NO5A 1MA7A 3F2BA 3CW2C 1MSWD 4YVZA 2H3VA 4NL9A 3AU2A 3Q8PB 4FZLA 2MRLA 1SKWA 5ALIA 4DEZA 3Q8MA 4NV0A 7ICRA 4F4ZA 2K4PA 2Y9UA 1VDVA 4UARA 4RQ0A 3FDSA 2KEYA 5KAIU 4DSLA 5EWFA 5T14A 2XC9A 3UM9A 5TZVA 4UBCA 1M6YA 2AJQA 1QCKA 3CRXA 3OTQA 1TK8A 5IILA 4F5OA 1BGXT 1QQ6A 7ICFA 2XIDA 3GIMA 4MF8A 5KFKA 4KLQA
chains in the Genus database with same CATH topology
2GOLA 4BUGA 2DGZA 2YX8A 2HBLA 4NLBA 1OUQA 2KJ5A 4OJ6A 2VKQA 1Q3UA 3PSTA 4AYBC 4JMUA 1ZQ1C 2JH7A 5C0YA 2E5SA 2H3FA 2N1RA 2PMZF 1HEKA 2WB1F 3F5AA 1PVQA 4BJQA 2ZIVB 3M6KA 5HR6A 3SAGA 4QIWF 4C0ZA 2K8AA 4PL1A 3NUQA 4BX9C 1PVPA 2KOBA 4KX3A 2OH2A 3H0LB 2HBJA 2HOIA 4CRXA 1URJA 3E0FA 2LBOA 1NZBA 2KJ8A 2DF4B 3F2CA 1CRXA 2GH1A 1WUDA 4PL2A 2HBKA 3KZXA 3ONNA 4FZNA 3SQIA 3H0RB 3LYSA 2XVTA 2R18A 2ZIXB 3AQEA 3L3FX 3PZPA 2F2AB 1IIPA 2K8BB 3ALRA 2A3VA 4P0PA 3D2QA 3HKZF 2K4EA 2D6FC 2W03A 3SMVA 2G5HB 3N7PD 3CYMA 2E1EA 3NRWA 4OJ5A 4P0QA 3RFAA 2LKYA 2HMXA 2HOFA 1A0PA 4NLCA 2LHTA 2PMZC 2BDUA 2WB1C 1SZHA 3CP8A 3T79A 3F53A 4QIWC 2H3IA 2JMGA 2JGAA 2KNJA 4GFJA 4QNLA 4KMOB 2KIWA 3VC8A 1XNSA 2JH1A 2ZIWA 5HR7A 4OJPA 2G06A 2KVCA 2OXOA 2DQNB 4O3MA 1TAMA 4OJLA 3K1ZA 1Z1BA 2Z7JA 1GO3F 3IG5A 2ZXIA 3IN5A 1DRGA 2W04A 2G07A 2WAQF 2XICA 2H3QA 2ZIUB 1MA7A 3F2BA 4ICAA 2OM6A 3H0MB 5CRXA 3C28A 2ZIXA 4OO1J 2YB1A 3SAHA 2CN1A 4IC9A 3HKZC 2KHVA 2ZG6A 3PSFA 2H3VA 2F76X 2K4IA 2K89A 2ZXHA 2NV3A 2KKVA 4FZLA 1XO0A 2Y0SF 3GU3A 2CPRA 2G0AA 4ACOA 1F44A 2MRLA 2F8LA 3GZFA 3MGVA 1YT3A 2ZIVA 3LVWA 3SAFA 4FZMA 2VJ5A 3AQFA 4A8EA 2VIXA 3DEEA 1L6NA 3F5EA 4NV0A 3AL0B 1A6SA 2HBMA 1ED1A 2MA1A 4P0PB 2E1FA 2M0NA 3IG8A 3PSPA 3C29A 2HOQA 4AYBF 4P0QB 2VJ4A 1T94A 2KV2A 4U6PA 2WAQC 2W7OA 1D8BA 2ZIUA 2KEYA 2YB4A 1UPHA 2RHFA 2K4HA 2RP5A 1KBUA 1ECWA 3N7RC 3VCBA 2KD1A 2LYBA 5T14A 4U7CA 3ICXA 1PVRA 3PSIA 5KL1B 2KICA 1P7DA 2CRXA 2OYYA 3IP4B 3LVVA 2RRDA 2G09A 2XI9A 3M6ZA 3O0FA 3N7SC 4KX5A 4CGZA 2ZIWB 3CRXA 4QJFB 5A0LA 2K8CB 3M7DA 2Y0SC 2G5IB 2H3ZA 3D2NA 3RF9A 2W7PA 4WJ3B 3KFUF 4NWIA 2KKPA 3OPXA 2XIDA 4FE3A 4OJOA 3D2SA 1HIWA 2JHDA 2KJ9A 2KHQA 2LYAA 2F77X 3F2DA 1Z19A 1Q3VA 4CDGA 5KL8B 2Q4TA 2G08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQF A;  3N7S C;  3N7R C;  3N7P D;  2YX8 A;  2XVT A;  3AQE A; 
#chains in the Genus database with same CATH topology
 3NVZ A;  4BDP A;  4P4M A;  5DB6 A;  2PMZ F;  1JXE A;  4BWM A;  4X5V A;  3LWL A;  2R8K A;  1LKY B;  3NUQ A;  3OHB A;  4RT3 A;  2KOB A;  4EYI B;  5KFD A;  1U48 A;  4QW8 A;  1KRP A;  3RR7 A;  4KLU A;  4J9L A;  2DF4 B;  5ALO A;  8ICC A;  1COK A;  2E3T A;  4F91 B;  5BOM A;  2G5H B;  3LDA A;  1RQL A;  7ICE A;  2W55 A;  4MFA A;  1Z4N A;  3UXN A;  4I2G A;  4GXI A;  4F4Y A;  3BQ7 A;  4JV0 A;  3PX6 A;  3C1Z A;  4E0D A;  4RQM A;  2J6S A;  8ICX A;  1NZP A;  3PW7 A;  2ZXI A;  3LWM A;  2XIC A;  2ZIU B;  1ZOL A;  5KFF A;  5L1K A;  4UAU A;  3M9O B;  4KLO A;  2MAX A;  2C2E A;  3PX0 A;  2IHN A;  2D3D A;  1WWV A;  3V72 A;  3E2E A;  4Y2Q A;  3H8M A;  1EXN A;  2AGP A;  1ZQX A;  1Q8K A;  2YMQ A;  1T94 A;  1SXE A;  4UAW A;  2AU0 A;  8ICM A;  2MUT A;  1L3V A;  3RH6 A;  2LM4 A;  3WK7 A;  2G5I B;  2H3Z A;  5KFQ A;  3KFU F;  5F3X B;  2QB1 A;  8ICE A;  4CNQ A;  2F77 X;  1Z19 A;  1JX4 A;  4Q8F A;  1KKX A;  3S6J A;  5J2F A;  1D9F A;  1A76 A;  4R65 A;  5AI9 A;  5J8Y C;  1SV0 C;  3WKA A;  4KTQ A;  4O3S A;  4I2D A;  5ALK A;  3QZ7 A;  1PVP A;  4M0A A;  3R9K A;  1UHU A;  1BPD A;  2JZB A;  5IIN A;  4IL6 U;  1NZB A;  3ISB A;  3FC4 A;  3ONN A;  2ES6 A;  3QUB A;  3WKE A;  4QZ9 A;  2ZIX B;  2OWO A;  9ICE A;  2IBK A;  1C20 A;  4PHD A;  3AUO A;  3RFA A;  1COO A;  3I1Y A;  5J0T A;  1K5O A;  1SZH A;  5KFU A;  2C22 A;  3F53 A;  3QU7 A;  4LZG A;  4DOA A;  1XNS A;  2DKZ A;  4PJ0 U;  3V6J A;  2YY6 A;  2WFA A;  3NTU A;  4DL2 A;  5H2F U;  5J0Q A;  1ZQP A;  3K75 D;  5KFP A;  5ALD A;  5J2E A;  4M47 A;  4KN7 A;  2HVH A;  2NV3 A;  3THV A;  3OGU A;  4ACO A;  1DXS A;  4TUS A;  4FZM A;  4C7Z A;  1L6N A;  3F5E A;  4RQ6 A;  5KFA A;  3WKB A;  2C28 A;  4RT2 A;  2R8J A;  2DBY A;  2YB4 A;  2DL0 A;  3ICX A;  4DFD A;  3KHG A;  4FS2 A;  4PZO A;  4Z6E A;  3KBB A;  4Y2Y A;  4EX6 A;  4MFF A;  4RNN A;  3RF9 A;  2W7P A;  4NWI A;  4QWE A;  4IRC A;  1V85 A;  4DF8 A;  2JEG A;  2A1J A;  4Y2U A;  3NVY A;  1XU4 A;  2BCQ A;  1V38 A;  5ALJ A;  4NLB A;  3J81 j;  3ZDD A;  2JH7 A;  3WU2 U;  5AI6 A;  3JPN A;  4JV1 A;  4Q43 A;  5DKW A;  2ZUD A;  4PZN A;  2W8K A;  4TQR A;  9ICR A;  5DQH A;  1ZQH A;  2XGQ A;  4R63 A;  4F5R A;  1FO4 A;  1NOM A;  2B0C A;  4DOC A;  1U4B A;  4ECQ A;  4B9L A;  2MUT B;  3B9J A;  2HW3 A;  2EH9 A;  3L5K A;  3H4B A;  4G9B A;  3PVX A;  1ZRM A;  5HHI A;  4F4K A;  9ICF A;  2VAN A;  3QU2 A;  1S0N A;  4CF4 A;  2IHM A;  4XUS A;  3NVW A;  2JMG A;  2FJ6 A;  4QNL A;  5AM4 A;  4I2C A;  4OJP A;  5ALQ A;  1ZQL A;  2W3R A;  2HHS A;  1CI4 A;  2Z7J A;  4DSJ A;  4F5P A;  2EZX A;  3C5F A;  3ZDA A;  2OM6 A;  2BPC A;  2FI1 A;  5AK4 A;  3WKD A;  4EX7 A;  5J2G A;  1LVH A;  1QLN A;  2F76 X;  3TFR A;  2PI5 A;  2BCS A;  2Y1J A;  5DLG A;  1JAL A;  4M04 A;  2HHU A;  1L3U A;  2JZB B;  5KFN A;  2JXJ A;  4NY8 A;  1NK7 A;  4UB8 U;  5AKH A;  4I28 A;  1KN5 A;  1N60 A;  4UB4 A;  4DL3 A;  3Q8Q B;  2PFN A;  4KX5 A;  3T5K A;  5EOZ A;  5AKX A;  3RBD A;  4CCH A;  5IIK A;  9ICC A;  3EYZ A;  3OPX A;  1ZQZ A;  1HIW A;  3SR6 A;  4R8U A;  3TAN A;  3QUC A;  2DGZ A;  2KJ5 A;  2KTQ A;  3JPQ A;  4YXJ A;  4O5C A;  1KQQ A;  4EEN A;  4Y2P A;  2DKX A;  2XCP A;  1BPE A;  1S97 A;  2K8A A;  4RPY A;  1BPZ A;  4ECU A;  4RUA A;  2ASJ A;  9ICB A;  2GH1 A;  4MEX A;  2WF5 A;  3PR4 A;  4NL9 C;  3U26 A;  4QZ8 A;  2F2A B;  2R8I A;  4P0P A;  2K4E A;  3NRW A;  4NXZ A;  5ALN A;  4UAZ A;  2BDU A;  4C8L A;  3RTV A;  2H3I A;  1YZ7 A;  2A1J B;  9ICN A;  5AM0 A;  3ZDE A;  2JH1 A;  4DSE A;  1IM4 A;  1K1S A;  2KZ3 A;  1PK1 A;  1U9L A;  9ICO A;  4UAV A;  2F44 A;  5KT3 A;  2QB0 A;  4IC9 A;  3H8S A;  5AKL A;  3GIK A;  3L4P A;  3M9N B;  2KKV A;  2KSO A;  3QEA Z;  3QZ8 A;  3GZF A;  1YT3 A;  4P4O A;  5ALR A;  3SAF A;  1ZQC A;  4K4H A;  4A8E A;  1KDH A;  7ICI A;  3UMC A;  4DL5 A;  2MA1 A;  5J2H A;  3C29 A;  4HAI A;  2HOQ A;  3KTQ A;  2KV2 A;  4DQP A;  2RHF A;  2LYB A;  1SB3 C;  2BPF A;  3LVV A;  4DL6 A;  4K4G A;  3M6Z A;  1PUZ A;  4QJF B;  5E79 U;  3KKA C;  5AKE A;  3HRD D;  5L1I A;  5KFO A;  2HI0 A;  5IIO A;  4ED0 A;  5III A;  1Z4O A;  1NI3 A;  3QUQ A;  2LPE A;  5KL8 B;  4JB3 A;  2QAR A;  2NRW A;  4KLL A;  8ICB A;  4EBD A;  1LV5 A;  3EUB 2;  3KZI U;  4PGX A;  4NLZ A;  1HEK A;  1MN8 A;  1V97 A;  3Q8K A;  4M9N A;  1KEJ A;  2AQ0 A;  1RXW A;  4UAT A;  2K60 A;  4KX3 A;  7ICQ A;  3H0L B;  3NAS A;  5KFY A;  5IIJ A;  1TK5 A;  3HJE A;  4F4W A;  1DK2 A;  2H5X A;  2IMW P;  2HHW A;  2JRZ A;  4B9V A;  4I2B A;  3MC1 A;  4RQ7 A;  7ICP A;  2LKY A;  2LMR A;  2HOF A;  1T7P A;  3HPO A;  5ALE A;  4LZD A;  3A0H U;  1N48 A;  2WB1 C;  5DB8 A;  7ICO A;  5KG7 A;  1SL2 A;  2F8K A;  5AKY A;  4R8U B;  4DSK A;  2FLN A;  5KT6 A;  4DLE A;  1JIH A;  5B66 U;  4EEY A;  4UW9 A;  8ICG A;  4QWC A;  1S0O A;  2KHV A;  3KHL A;  2ZG6 A;  3PSF A;  2B21 A;  4Y2T A;  3JPO A;  4C8M A;  4QW9 A;  2CPR A;  3ZI4 A;  1ZQU A;  3MGV A;  2VA2 A;  3H4D A;  1JMS A;  2VJ5 A;  3RRH A;  1TE2 A;  4YN4 A;  3RRG A;  1J2M A;  2ESE A;  4P0P B;  5AIA A;  2BCV A;  4NM2 A;  1NJW A;  2WAQ C;  2W7O A;  2DPJ A;  3MR3 A;  4FBU A;  1T3N A;  2WF7 A;  3V7L A;  4F4X A;  4ELT A;  4KLI A;  3KD3 A;  3K1R B;  4US9 A;  1ZQE A;  4I2I A;  1TAU A;  1PK1 B;  4C8N A;  3BDP A;  4XRH A;  5EE3 A;  2HHX A;  4UB2 A;  4GXJ A;  3TKA A;  4BXO A;  1NKB A;  2KMD A;  1XSP A;  2QB0 B;  5L1M A;  3BJY A;  1U45 A;  3BS5 A;  2KSO B;  9ICM A;  4FFD A;  1JN3 A;  9ICX A;  5EWE A;  1ZQS A;  1ZQF A;  5CJ7 A;  2E8N A;  4RPZ A;  5AI5 A;  5AKZ A;  9ICI A;  1RYR A;  3ZD8 A;  2I9G A;  5F9L A;  5BOL A;  5C5J A;  3AM9 A;  2HVI A;  2KG5 A;  4YR0 A;  4QZD A;  2XVT A;  4IQV A;  2AHO B;  4YCX A;  4YD2 A;  2ALZ A;  1IIP A;  3ALR A;  2A3V A;  3SMV A;  3RJG A;  2NRZ A;  4M9L A;  4KLF A;  4KLD A;  3BZK A;  1MQ2 A;  4YG2 A;  3UMB A;  4QIW C;  2QAR B;  3WKC A;  1X9M A;  3D6J A;  4UAY A;  3IG5 A;  3IN5 A;  1TKD A;  5ALP A;  7ICM A;  4B9U A;  1NKE A;  2JEI A;  4YR2 A;  4KLG A;  1KSP A;  5DBA A;  4RZR A;  2ZXH A;  5CB1 A;  1KW4 A;  2IOF A;  2JR5 A;  2FPK A;  3DEE A;  4IS7 A;  2HSZ A;  1OW5 A;  2ATL A;  2Y9T A;  3UXO A;  4U6P A;  3M9M B;  1D8B A;  1VJ5 A;  4RPX A;  3EWA A;  5KL1 B;  1L8O A;  5J2I A;  1NKC A;  5AIB A;  2OYY A;  3IP4 B;  3N28 A;  2DPI A;  8ICP A;  4Y2X A;  5DDY A;  4QZH A;  1B4F A;  4KIT B;  1ZQA A;  4EBC A;  2W3S A;  2FDR A;  5AM1 A;  4I2E A;  7ICG A;  1Z3E B;  2KZM A;  1Z1V A;  4JMU A;  1ZQ1 C;  4CE6 A;  2LM1 A;  4RQ5 A;  1ZQG A;  3GDX A;  3RBE A;  5KFJ A;  3Q8S B;  1UT8 A;  2LBO A;  3SD7 A;  3RAQ A;  3I28 A;  3B0X A;  1ZET A;  5ALS A;  2I1Q A;  5AI4 A;  4YQW A;  2K8B B;  2PI4 A;  4DO9 A;  3ISC A;  3N7P D;  3ETL A;  2XY5 A;  3CP8 A;  1CEZ A;  3RH4 A;  4QZF A;  4GFJ A;  2Q0Z X;  1VLB A;  4BXO B;  2RDI A;  1SL0 A;  1TAM A;  1GO3 F;  4C4T A;  3MAB A;  4KMU A;  4OCZ A;  1L3S A;  4Z6C A;  3BS5 B;  3T5H A;  5J0O A;  3C28 A;  1RZT A;  4RNM A;  3HKZ C;  1TFR A;  3TAD A;  4F50 A;  1B0X A;  2W11 A;  3M8R A;  3AMZ A;  2VA3 A;  1RDF A;  1ZRN A;  2G0A A;  5B5E U;  3SV4 A;  1KLN A;  1MQ3 A;  3HIL A;  2IA6 A;  3H40 A;  2BPG A;  4P4P A;  5HP4 A;  2ZTC A;  2E1F A;  3QU5 A;  4QWB A;  5DGA A;  4NLN A;  2K4H A;  5J0Y A;  4YFK A;  5DQI A;  1PVR A;  5J2J A;  4F2S A;  5A0L A;  2Y0S C;  5DB9 A;  5GTI U;  3MBY A;  2KKP A;  1N63 A;  2UVU A;  4M9G A;  4ECZ A;  2KHQ A;  5CHG A;  4F92 B;  3EPI A;  4ED2 A;  2JEF A;  3IM1 A;  4YMN A;  1XO1 A;  2VKQ A;  3WK4 A;  2KIV A;  3PST A;  4C7Y A;  4MF2 A;  4EEL A;  4J9M A;  1A77 A;  1X6I A;  1O03 A;  2W9A A;  2F1I A;  5KFM A;  2OH2 A;  3LK9 A;  1FEZ A;  3JPR A;  5CR0 A;  1BPY A;  1CRX A;  3SEI A;  2I6X A;  3QXG A;  2OHF A;  3SQI A;  2XGP A;  3L3F X;  3I76 A;  3WK5 A;  2D8C A;  4QWD A;  1ZQR A;  8ICS A;  1RXV A;  1DK3 A;  2EZZ A;  1ZQD A;  9ICW A;  3TAC B;  2ZIW A;  3RB0 A;  2G06 A;  4AP9 A;  1PZN A;  2DQN B;  1YZ6 A;  4DF4 A;  4DSF A;  4IRD A;  3FM9 A;  5TIS U;  3TAQ A;  1L7N A;  1N56 A;  1F44 A;  1SKS A;  2R8H A;  2XY6 A;  4Z6F A;  2OCE A;  3QE9 Y;  3ZDB A;  3PO4 A;  3RJK A;  2WF9 A;  4DSI A;  2ZUC A;  5DBB A;  3IG8 A;  2OEH A;  5EE9 A;  8ICJ A;  4I29 A;  1TV9 A;  4F5Q A;  2VJ4 A;  3PMN A;  4B9S A;  4DWI A;  1ARO P;  4QWA A;  2C2D A;  1WCN A;  4DCC A;  2RRD A;  3PW5 A;  2XI9 A;  1ZYQ A;  3V6H A;  3WK8 A;  3D2N A;  2L5Y A;  4B6J A;  4M9J A;  5KFH A;  2BHN A;  4YP3 A;  1S5L U;  4CDG A;  4NLK A;  2YN4 A;  1NNL A;  4UB3 A;  3M1Y A;  5J2B A;  1HUO A;  8ICY A;  5J0S A;  2ZJA A;  4YMM A;  5AK3 A;  1PVQ A;  2WTF A;  3C5G A;  1JXL A;  4USA A;  1BVS A;  4ECR A;  1KFT A;  4I2J A;  5KG2 A;  3H8J A;  1OXJ A;  4F8R A;  1T8E A;  1TK0 A;  4ECW A;  5AIC A;  3MDA A;  4EBE A;  1QQ5 A;  4PL2 A;  1NK6 A;  4HYK A;  3IRU A;  3PZP A;  4ED1 A;  2W03 A;  4ZOH C;  4P0Q A;  4M2Y A;  1ZQQ A;  1A0P A;  8ICO A;  3CNH A;  3VC8 A;  9ICU A;  4P2H A;  1ZQV A;  5AK6 A;  4MFC A;  2EAM A;  2W9B A;  1FFV A;  4B9T A;  5J29 A;  2ZJ5 A;  2W04 A;  4KLJ A;  2PKE A;  1D8Y A;  1L3T A;  5ALM A;  3MGH A;  2ZJ8 A;  5AKK A;  4UQG A;  1S8O A;  3RB4 A;  5ALF A;  2KZZ A;  2W43 A;  1FFU A;  1J2N A;  5KFZ A;  2HDO A;  2VIX A;  4CF5 A;  3PO5 A;  2NYV A;  4ELV A;  4F72 A;  5CP2 A;  2BR0 A;  2ASL A;  1UPH A;  2KD1 A;  3T3F A;  4TUR A;  4O5K A;  1QSS A;  1ZD3 A;  1ZQI A;  3M8S A;  3SZ2 A;  2HHQ A;  1SWV A;  2ZIW B;  4MHV A;  3N4M B;  2W8L A;  3RH5 A;  3RB6 A;  4GLX A;  1ZQN A;  4FE3 A;  5KG4 A;  4DS5 A;  1NK9 A;  3RJJ A;  3F2D A;  4IQT A;  3KOO A;  4BUG A;  3TAP A;  1X66 A;  5AKJ A;  5KFV A;  3ZD9 A;  5AM3 A;  4GC7 A;  1V9P A;  4NJ8 A;  1Z00 A;  5JUM A;  2H3F A;  4EZ9 A;  3QX7 A;  1RPL A;  2WB1 F;  2KFN A;  8ICW A;  1TVA A;  4BJQ A;  1WWU A;  1O08 A;  1SL1 A;  3C1Y A;  5AI8 A;  2BQR A;  2HBJ A;  5ALG A;  1K1Q A;  2EQY A;  3F2C A;  4LVS A;  4QZA A;  3LYS A;  4YR3 A;  4KLS A;  4R66 A;  1L8L A;  2FE9 A;  3D2Q A;  4G3I A;  3CYM A;  4DLG A;  4ED8 A;  2LHT A;  4YD1 A;  2I5H A;  4FS1 A;  1S0M A;  3K1Z A;  3BQ1 A;  1ZQK A;  3K4G A;  3GII A;  2WAQ F;  5KAF U;  1B22 A;  3SAH A;  3QUT A;  5J0X A;  9ICH A;  4TUP A;  2K89 A;  1IG6 A;  1TAQ A;  2VA8 A;  4UB5 A;  1UT5 A;  4J9N A;  1XC9 A;  5EWG A;  1DOQ A;  1ZQW A;  3H8W A;  4I2F A;  3AU6 A;  4JWM A;  1ZQM A;  3AL0 B;  1UA0 A;  1A6S A;  5ALU A;  9ICS A;  4P0Q B;  4PHE A;  3NGD A;  2ZIU A;  1RYU A;  2GLE A;  1SV4 A;  1H38 A;  5J0U A;  2G09 A;  2HCF A;  4RU9 A;  4CGZ A;  4BGD A;  2BKE A;  5K4L A;  1SZP A;  4PHP A;  3GV8 B;  2ZTE A;  4ZH4 A;  5G5G A;  3D2S A;  4RQ4 A;  3OJU A;  4R64 A;  2RQ5 A;  3DDH A;  1NJZ A;  7ICU A;  2ZUB A;  3GQC A;  2YX8 A;  4DFJ A;  4AYB C;  2E5S A;  5JU5 A;  4DL7 A;  3RAX A;  1RG6 A;  2W9C A;  5J0W A;  3M6K A;  4QIW F;  3UQ0 A;  4KLH A;  2BDP A;  4CRX A;  4TUQ A;  3NRZ A;  8ICL A;  1S9F A;  7ICS A;  5KFE A;  2HBK A;  3TAD C;  3AQE A;  2V4Q A;  5DBC A;  2KVS A;  3C21 A;  2ISO A;  2HMX A;  3FYH A;  5KFX A;  5J2A A;  4ED3 A;  3ORY A;  4GC6 A;  7ICV A;  1F5S A;  1ZD4 A;  1KTQ A;  4TQS A;  1KFD A;  1L7O A;  3JPT A;  2EZY A;  1BPX A;  3V7J A;  2FPL A;  1JRO A;  3PV8 A;  3HW8 A;  1Z1B A;  2J6T A;  1N2X A;  1Z00 B;  4GXK A;  2H3Q A;  5JRT A;  4PH5 A;  4MEY A;  1NK0 A;  2ZIX A;  3AEV A;  2A19 A;  1IXR A;  4EYH B;  4F3O A;  1Y88 A;  2PFP A;  2F8L A;  5HMM A;  2J6U A;  3OJS A;  2UVR A;  1NJY A;  1KFS A;  4IRK A;  5BPC A;  2M0N A;  3PW0 A;  2PXI A;  2BZF A;  1J97 A;  3EZ5 A;  3C23 A;  3C2K A;  4O3R A;  4FO6 A;  3NS1 A;  4Q8E A;  2V9W A;  2KIC A;  2KE7 A;  5J0P A;  2BCU A;  2EAN A;  4OJO A;  5HHH A;  3KKA A;  4EZ6 A;  4ECY A;  4F71 A;  4OJ5 A;  2CRX A;  2FMP A;  2HBL A;  5AKI A;  3UXP A;  1XSL A;  1Q3U A;  9ICJ A;  3FAH A;  3HX0 A;  4B9N A;  5D46 A;  2HHV A;  1JI7 A;  2QKQ A;  3B0Y A;  4YMO A;  3BQT A;  4C0Z A;  1JUD A;  9ICG A;  5J2C A;  1UQV A;  8ICF A;  4BX9 C;  4I2H A;  5D4B A;  3ETR A;  1F0M A;  2XO7 A;  8ICK A;  3EW9 A;  3MFH A;  5AM2 A;  5G5H A;  5ALT A;  2FMQ A;  3QU4 A;  3T5L A;  4C8K A;  1SXD A;  3HKZ F;  5ALY A;  4O3N A;  1JRP A;  1X42 A;  3MR5 A;  3OSP A;  1L5U A;  2BGW A;  4B9M A;  4NLC A;  1CUK A;  4DFM A;  2PMZ C;  5KT2 A;  5KFB A;  4J03 A;  3JPS A;  5KFW A;  2AGQ A;  2ZTD A;  5HNK A;  3PML A;  7ICL A;  2KFZ A;  4KN4 A;  2E8O A;  5DQG A;  4KLE A;  1DRG A;  2G07 A;  1XS9 D;  2YQE A;  2NRV A;  1NK5 A;  4ICA A;  2W9C B;  4JUZ A;  4RQ3 A;  2F1H A;  2K4I A;  5DG7 A;  2Y0S F;  4K4I A;  7ICH A;  1RQN A;  4JV2 A;  2JEJ A;  3AN1 A;  9ICA A;  1WG8 A;  4J9R A;  1PK3 A;  2P35 A;  3RB3 A;  4IQU A;  4PPX A;  3PW4 A;  2ASD A;  2NO4 A;  1KBU A;  3G6X A;  4BWJ A;  1X9W A;  1QH9 A;  3PSI A;  4O9M A;  4F93 B;  5JTI A;  4C8O A;  4ED7 A;  2UVW A;  3MDC A;  3N97 B;  2LYA A;  1QSY A;  4UAS A;  2WF6 A;  4RQ8 A;  7ICT A;  2XY7 A;  1XSN A;  1HJP A;  2YTU A;  5KFG A;  3C2L A;  3TAR A;  1OUQ A;  2P6U A;  3G6Y A;  5L1L A;  4I2A A;  4M9H A;  2E8M A;  1NK4 A;  3TI0 A;  1DGS A;  1T4G A;  4PL1 A;  4UBB A;  3A0B U;  2RLT A;  5EE1 A;  1N5X A;  5GTH U;  3H7I A;  1N5W A;  3G6V A;  4JWN A;  3JPP A;  3KZX A;  4FZN A;  1N61 A;  3IV6 A;  3SEN A;  4JK1 A;  5CWR A;  1WYG A;  4DQS A;  2D6F C;  2FLL A;  3SV3 A;  2E1E A;  1SGG A;  2P6R A;  2QLT A;  4Y2J A;  1S0V A;  4DQI A;  3DV9 A;  2A1A A;  2KIW A;  3RJF A;  5HR7 A;  4J9S A;  2M9N A;  5KG3 A;  3WK9 A;  3GV5 B;  4O3M A;  4QZB A;  1N62 A;  1U49 A;  4DOB A;  4ELU A;  8ICR A;  5ALX A;  5KFS A;  3H0M B;  2DWQ A;  5CRX A;  2YB1 A;  1KL9 A;  1T3Q A;  3Q8L A;  2F1J A;  5KT4 A;  1XO0 A;  3GU3 A;  3PR5 B;  4EEK A;  1ZD2 P;  3AQF A;  3RJH A;  3Q8R B;  4M6W A;  2ODG A;  1ED1 A;  1QQ7 A;  1B43 A;  4F2R A;  1SKR A;  5J2D A;  3ED5 A;  5KTQ A;  3VCB A;  5KT7 A;  5C0Y A;  4Q45 A;  5AKG A;  3TFS A;  4C4S A;  3KHR A;  4ECX A;  2FPM A;  5KG1 A;  5DGB A;  8ICQ A;  3RJI A;  3QNM A;  2DUY A;  1X2I A;  4J9O A;  2GOL A;  1ZD5 A;  5KFI A;  3SYZ A;  4Y2S A;  4NLG A;  5ALH A;  2BCR A;  5KFT A;  1XWL A;  3GIL A;  2C2R A;  2WHE A;  2WF8 A;  3PW2 A;  1ZQY A;  1L7M A;  5HR6 A;  3SAG A;  1QSL A;  2F3N A;  4RUC A;  4DFK A;  3UPQ A;  4IQW A;  3V6K A;  4LJX A;  3WK6 A;  1L7P A;  2IOF K;  2BQ3 A;  2NRT A;  3TQ1 A;  2KJ8 A;  3BS7 A;  2FMS A;  4YXM A;  5KFC A;  2MSN A;  1ZJN A;  2DFL A;  5KT5 A;  1RM6 C;  3QU9 A;  3GIJ A;  4PGQ A;  1S76 D;  2W9M A;  3T79 A;  9ICT A;  1Q46 A;  3HWT A;  1X9S A;  1AQ6 A;  5J8Y A;  1SV0 A;  4RQ2 A;  3BQ2 A;  4ECT A;  5F9N A;  3SI8 A;  4OJL A;  3MFI A;  9ICV A;  5KFL A;  4F5N A;  8ICA A;  9ICP A;  4UB1 A;  5KG6 A;  7ICN A;  4C80 A;  5D49 A;  4J9P A;  2CXY A;  2Y1I A;  1SWW A;  5ALL A;  2ZIV A;  3LVW A;  5ALZ A;  4XA5 A;  1X6J A;  1LB2 B;  3GV7 B;  5IIM A;  3PSP A;  3RR8 A;  1X40 A;  4QZC A;  1ZJM A;  5DDM A;  3UQ2 A;  4PGY A;  2RP5 A;  2BQU A;  3BQ0 A;  3N7R C;  4DFP A;  4U7C A;  1S10 A;  2MU2 A;  2FLP A;  2GWS A;  3O0F A;  3N7S C;  4RQN A;  3M7D A;  4CF3 A;  4WJ3 B;  1C7Y A;  3V7K A;  4PHA A;  4J9K A;  5J0R A;  2XCA A;  2KJ9 A;  4Q44 A;  2V4R A;  5KG0 A;  1Q3V A;  1U47 A;  7ICK A;  2Q4T A;  2G08 A;  2AXT U;  5DG8 A;  9ICL A;  4OJ6 A;  4QZG A;  2E8P A;  1BNP A;  3OSN A;  4QZE A;  1ZQJ A;  4O0I A;  2YML A;  3IDW A;  4O5E A;  5DLF A;  8ICU A;  4KLT A;  2KN7 A;  3PY8 A;  2O6K A;  4NM1 A;  4M6W B;  1MC8 A;  5AM5 A;  2KP7 A;  2HOI A;  1URJ A;  2YMM A;  3E0F A;  3IHQ B;  3PX4 A;  3UMG A;  1DGJ A;  3MR2 A;  5HML A;  5ALW A;  1WUD A;  2R18 A;  4XQ8 A;  2R8G A;  1SIJ A;  4KLM A;  5DG9 A;  8ICH A;  4ED6 A;  2LI6 A;  8ICV A;  5AK5 A;  5EE0 A;  4FBT A;  1NK8 A;  5ALV A;  2PFO A;  5AHX A;  3MGI A;  4RQ1 A;  8ICZ A;  2JGA A;  3RJE A;  4DQQ A;  1UCV A;  2AH5 A;  3HT3 A;  5KFR A;  5KG5 A;  3E58 A;  5J2K A;  5FP0 A;  1IV8 A;  3NVV A;  4O3O A;  3PNC A;  4OO1 J;  1FIQ A;  2CN1 A;  4O3Q A;  4GIB A;  4UB6 U;  5AI0 A;  8ICT A;  2B6G A;  5KNI A;  2EAO A;  4I27 A;  1ZQO A;  3ZDC A;  1LKY A;  1ZXI A;  4DS4 A;  2HBM A;  1NJX A;  2LYH A;  4AYB F;  4IR9 A;  8ICI A;  3QYP A;  2W54 A;  1ECW A;  1S77 D;  4Y2V A;  1P7D A;  1ZQT A;  2PFQ A;  3MR6 A;  1UA1 A;  1QTM A;  3KHH A;  2IOH A;  2AGO A;  1BNO A;  2K8C B;  5CA7 A;  4DQR A;  3OHA A;  4O3P A;  2ISP A;  2JV3 A;  2NRX A;  8ICN A;  1D9D A;  2JHD A;  3EPG A;  9ICQ A;  4OD0 A;  4DL4 A;  2HHT A;  2YMP A;  2EAP A;  3HP6 A;  4J9Q A;  4IR1 A;  5L9X A;  2N1R A;  1HUZ A;  4QZI A;  1BPB A;  3F5A A;  2ZIV B;  3BZC A;  1D8L A;  7ICJ A;  3T5J A;  2W9B B;  4Z6D A;  3QEB Z;  2UVV A;  4US8 A;  9ICK A;  3H0R B;  2GO7 A;  1RYS A;  2EDU A;  4RNO A;  3C2M A;  2KK0 A;  4Y2R A;  2RDJ A;  2P66 A;  5CEH A;  4ECV A;  1WCL A;  3ISD A;  4ECS A;  2KNJ A;  4KMO B;  5L1J A;  5DB7 A;  2KVC A;  2OXO A;  1X9X A;  1ZQB A;  2AQ4 A;  4C4R A;  3GFK B;  2NO5 A;  1MA7 A;  3F2B A;  3CW2 C;  1MSW D;  4YVZ A;  2H3V A;  4NL9 A;  3AU2 A;  3Q8P B;  4FZL A;  2MRL A;  1SKW A;  5ALI A;  4DEZ A;  3Q8M A;  4NV0 A;  7ICR A;  4F4Z A;  2K4P A;  2Y9U A;  1VDV A;  4UAR A;  4RQ0 A;  3FDS A;  2KEY A;  5KAI U;  4DSL A;  5EWF A;  5T14 A;  2XC9 A;  3UM9 A;  5TZV A;  4UBC A;  1M6Y A;  2AJQ A;  1QCK A;  3CRX A;  3OTQ A;  1TK8 A;  5IIL A;  4F5O A;  1BGX T;  1QQ6 A;  7ICF A;  2XID A;  3GIM A;  4MF8 A;  5KFK A;  4KLQ A; 
#chains in the Genus database with same CATH homology
 2GOL A;  4BUG A;  2DGZ A;  2YX8 A;  2HBL A;  4NLB A;  1OUQ A;  2KJ5 A;  4OJ6 A;  2VKQ A;  1Q3U A;  3PST A;  4AYB C;  4JMU A;  1ZQ1 C;  2JH7 A;  5C0Y A;  2E5S A;  2H3F A;  2N1R A;  2PMZ F;  1HEK A;  2WB1 F;  3F5A A;  1PVQ A;  4BJQ A;  2ZIV B;  3M6K A;  5HR6 A;  3SAG A;  4QIW F;  4C0Z A;  2K8A A;  4PL1 A;  3NUQ A;  4BX9 C;  1PVP A;  2KOB A;  4KX3 A;  2OH2 A;  3H0L B;  2HBJ A;  2HOI A;  4CRX A;  1URJ A;  3E0F A;  2LBO A;  1NZB A;  2KJ8 A;  2DF4 B;  3F2C A;  1CRX A;  2GH1 A;  1WUD A;  4PL2 A;  2HBK A;  3KZX A;  3ONN A;  4FZN A;  3SQI A;  3H0R B;  3LYS A;  2XVT A;  2R18 A;  2ZIX B;  3AQE A;  3L3F X;  3PZP A;  2F2A B;  1IIP A;  2K8B B;  3ALR A;  2A3V A;  4P0P A;  3D2Q A;  3HKZ F;  2K4E A;  2D6F C;  2W03 A;  3SMV A;  2G5H B;  3N7P D;  3CYM A;  2E1E A;  3NRW A;  4OJ5 A;  4P0Q A;  3RFA A;  2LKY A;  2HMX A;  2HOF A;  1A0P A;  4NLC A;  2LHT A;  2PMZ C;  2BDU A;  2WB1 C;  1SZH A;  3CP8 A;  3T79 A;  3F53 A;  4QIW C;  2H3I A;  2JMG A;  2JGA A;  2KNJ A;  4GFJ A;  4QNL A;  4KMO B;  2KIW A;  3VC8 A;  1XNS A;  2JH1 A;  2ZIW A;  5HR7 A;  4OJP A;  2G06 A;  2KVC A;  2OXO A;  2DQN B;  4O3M A;  1TAM A;  4OJL A;  3K1Z A;  1Z1B A;  2Z7J A;  1GO3 F;  3IG5 A;  2ZXI A;  3IN5 A;  1DRG A;  2W04 A;  2G07 A;  2WAQ F;  2XIC A;  2H3Q A;  2ZIU B;  1MA7 A;  3F2B A;  4ICA A;  2OM6 A;  3H0M B;  5CRX A;  3C28 A;  2ZIX A;  4OO1 J;  2YB1 A;  3SAH A;  2CN1 A;  4IC9 A;  3HKZ C;  2KHV A;  2ZG6 A;  3PSF A;  2H3V A;  2F76 X;  2K4I A;  2K89 A;  2ZXH A;  2NV3 A;  2KKV A;  4FZL A;  1XO0 A;  2Y0S F;  3GU3 A;  2CPR A;  2G0A A;  4ACO A;  1F44 A;  2MRL A;  2F8L A;  3GZF A;  3MGV A;  1YT3 A;  2ZIV A;  3LVW A;  3SAF A;  4FZM A;  2VJ5 A;  3AQF A;  4A8E A;  2VIX A;  3DEE A;  1L6N A;  3F5E A;  4NV0 A;  3AL0 B;  1A6S A;  2HBM A;  1ED1 A;  2MA1 A;  4P0P B;  2E1F A;  2M0N A;  3IG8 A;  3PSP A;  3C29 A;  2HOQ A;  4AYB F;  4P0Q B;  2VJ4 A;  1T94 A;  2KV2 A;  4U6P A;  2WAQ C;  2W7O A;  1D8B A;  2ZIU A;  2KEY A;  2YB4 A;  1UPH A;  2RHF A;  2K4H A;  2RP5 A;  1KBU A;  1ECW A;  3N7R C;  3VCB A;  2KD1 A;  2LYB A;  5T14 A;  4U7C A;  3ICX A;  1PVR A;  3PSI A;  5KL1 B;  2KIC A;  1P7D A;  2CRX A;  2OYY A;  3IP4 B;  3LVV A;  2RRD A;  2G09 A;  2XI9 A;  3M6Z A;  3O0F A;  3N7S C;  4KX5 A;  4CGZ A;  2ZIW B;  3CRX A;  4QJF B;  5A0L A;  2K8C B;  3M7D A;  2Y0S C;  2G5I B;  2H3Z A;  3D2N A;  3RF9 A;  2W7P A;  4WJ3 B;  3KFU F;  4NWI A;  2KKP A;  3OPX A;  2XID A;  4FE3 A;  4OJO A;  3D2S A;  1HIW A;  2JHD A;  2KJ9 A;  2KHQ A;  2LYA A;  2F77 X;  3F2D A;  1Z19 A;  1Q3V A;  4CDG A;  5KL8 B;  2Q4T A;  2G08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...