2XVTA

Structure of the extracellular domain of human ramp2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
b'VKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR ACTIVITY-MODIFYING PROTEIN 2
publication title Structure of the Extracellular Domain of Human Ramp2
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 28
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2xvtA00
3AQFA 3N7RC 3N7PD 3N7SC 2YX8A 2XVTA 3AQEA
chains in the Genus database with same CATH superfamily
4EENA 2IMWP 5KFOA 2YB4A 4UBCA 4Y2JA 4EBEA 5DLGA 2HHVA 5CA7A 4O5KA 2A1JA 3I1YA 2F76X 5ALEA 3C2MA 1ZD5A 1ZOLA 2BHNA 1BPYA 8ICKA 4ED7A 5CEHA 3C2KA 4NV0A 9ICSA 3MR3A 3UQ2A 3KHGA 8ICJA 5AKJA 5DGAA 3U26A 8ICPA 4EEKA 1WYGA 2Y0SC 1ZQLA 4I2JA 3M8RA 4MEXA 1S97A 3GIJA 1NK9A 4PHDA 1MQ2A 5ALLA 3IM1A 1A77A 3PW4A 2YTUA 2FJ6A 4UB8U 9ICOA 1Z4OA 3RRGA 5KFLA 4F4ZA 1ZQZA 2JH1A 4P4OA 2G08A 5AM4A 1XC9A 2IHNA 4IS7A 2F2AB 4RNNA 3I28A 5KTQA 2VJ5A 3TI0A 1EXNA 2MUTB 4DSKA 1BPEA 4AYBF 8ICAA 7ICOA 3PW2A 3RR7A 4JWMA 2ESEA 4RT3A 3QE9Y 4PZNA 4NLKA 2KZZA 2KJ8A 9ICAA 1L3TA 1SIJA 3QU5A 5BPCA 4ECXA 4ECRA 2XO7A 2W9AA 3T5LA 4KLUA 3D2QA 2LM1A 4KMUA 3BDPA 4BWJA 2XGQA 4UB1A 5DG7A 4Y2PA 1X66A 4NY8A 1VJ5A 3OTQA 4QW8A 4DS4A 1ZQAA 4US9A 2HW3A 1B0XA 2RLTA 3UMCA 1U48A 3N4MB 2BCQA 1DOQA 2W04A 4UB5A 1ZQ1C 5ALUA 4X5VA 3L3FX 4RPZA 2J6TA 4FBTA 3ZDCA 4KX5A 3NVZA 2JEJA 2DGZA 7ICMA 2VANA 4NL9A 1KEJA 3R9KA 4ZH4A 3V7KA 3MR6A 1QH9A 2ZIXB 1D9FA 4I2BA 2JXJA 1RQNA 3KHLA 3RJKA 2HHTA 3QX7A 3AQFA 2ZTCA 2P6UA 1Z4NA 5KFGA 2DL0A 1A6SA 4ELTA 4BX9C 1SXDA 1U9LA 5DB6A 4RQ5A 1CEZA 3QNMA 1LVHA 4K4GA 1YT3A 4TQRA 5CHGA 3H4BA 1F0MA 1PZNA 4BJQA 4QJFB 8ICFA 4U7CA 2KN7A 4TQSA 4B9TA 3TANA 5J0WA 1AQ6A 5J2DA 3F53A 3VC8A 3GZFA 3PV8A 1Q8KA 1KN5A 3B0YA 2H3FA 1N5XA 4RQ7A 1COOA 3TARA 1X9SA 4DSJA 1UPHA 5ALPA 4CF3A 4I29A 3TADA 1TAUA 2DPJA 2C2DA 4TURA 3EPGA 5IIMA 5ALDA 1TFRA 4K4IA 4QZGA 2DWQA 2KKVA 3HJEA 2F1IA 5KG3A 4M9HA 2ZUDA 4ICAA 5KFSA 3WKEA 8ICIA 3RJFA 5JUMA 7ICNA 2G5HB 4I2GA 5C0YA 2HOFA 5DLFA 3QXGA 7ICPA 1K5OA 2ASLA 5KT7A 3M9MB 1U49A 3H8MA 4DEZA 3Q8SB 5KFPA 3A0BU 2ZIXA 4JK1A 4M9JA 1NJYA 3MGVA 3SAGA 2FI1A 4FO6A 4QWEA 4P2HA 3ISCA 3E58A 4OD0A 1S77D 3KKAA 1ZQWA 1XSLA 3ICXA 2EAOA 3QEBZ 5HMMA 3IRUA 2IOHA 1TV9A 2HOIA 2LYHA 1K1SA 4ED1A 7ICGA 5AM3A 3C28A 2R8HA 2YMQA 1QQ5A 4YR3A 3MBYA 1TK0A 3L5KA 2Q0ZX 2FMQA 4KLMA 3IN5A 2L5YA 5AKGA 2KFZA 2KKPA 3ZDDA 5HMLA 4PHEA 1A76A 2KSOB 4UAYA 5F9LA 3HWTA 1SWVA 1Z1BA 1KLNA 4ELVA 2WB1C 4J03A 4C4SA 4KITB 4EZ9A 2R18A 3RTVA 2OXOA 4KMOB 1IG6A 5EWGA 2PFOA 2W9MA 1FIQA 1QSYA 3DV9A 3AQEA 3AUOA 3V6HA 4M6WB 3WKAA 4YD1A 5KG0A 4Q45A 4YQWA 2ZJ8A 3M1YA 1SL0A 2HI0A 2V4QA 1ZQFA 5J0SA 2J6SA 2VA3A 1URJA 5D46A 3RB3A 2EZXA 3GIMA 1CRXA 1IXRA 2NV3A 1J2MA 4P4MA 3MR5A 1S0MA 5KNIA 1QQ6A 2CPRA 3SR6A 3ISDA 2AQ0A 2OH2A 1OXJA 5DDMA 5ALOA 4DFPA 2GOLA 4RQ3A 4ED8A 2KOBA 1KFDA 4EX7A 4B9MA 5KFIA 2AHOB 5EE0A 4B6JA 2LHTA 3FAHA 4LZDA 1T3QA 5J0RA 3CRXA 4RT2A 9ICEA 1SXEA 3RAXA 4UQGA 2LYAA 2BQRA 7ICIA 2D6FC 5ALZA 2F8LA 1X9MA 4GXJA 2ZUCA 2LPEA 3K1ZA 4RUAA 1TK8A 4YP3A 4OCZA 2B6GA 1WCLA 2MSNA 5J0OA 3NTUA 2ZG6A 1RG6A 3RAQA 1DGJA 5AKYA 5ALIA 4M6WA 2W7OA 1ZQNA 5AM2A 2AH5A 4UAWA 1ZD2P 3MC1A 2PFNA 4XA5A 5EWEA 5HR6A 2RDIA 5KAFU 2QB1A 4FZLA 5H2FU 4C0ZA 4NXZA 3MFHA 4MFAA 3PY8A 4F2SA 1KW4A 5IIIA 4J9OA 2R8JA 4ELUA 8ICUA 2JZBB 4Y2TA 4QZAA 2Y1IA 3BQ7A 4ACOA 2QB0B 5J0YA 8ICOA 2HOQA 1ZD3A 3AU6A 5KFRA 2RQ5A 2G07A 3EZ5A 3RJJA 2KV2A 1N60A 4PPXA 1JXEA 2VJ4A 5DQIA 4Y2YA 5JRTA 2PMZC 2YQEA 4FE3A 1GO3F 1TVAA 1MQ3A 5AKIA 2W9CB 1FFVA 3OJUA 1KKXA 3NVYA 1SB3C 1ZQIA 2A1JB 5CR0A 4IRCA 4IRKA 2HBJA 1KL9A 5DB8A 2W8KA 1S5LU 1QTMA 9ICKA 3WK4A 2BR0A 4DOCA 3GIIA 4F93B 4FS2A 3H8WA 4ECZA 4R63A 1BNOA 4DLGA 2OCEA 7ICJA 5ALWA 5KT4A 2Y9TA 5KFZA 2I9GA 3KOOA 1B22A 2LKYA 3THVA 2E5SA 4G9BA 2JZBA 4F8RA 4KLLA 2QB0A 4UATA 4YMNA 1V85A 2JEGA 4BXOA 4P0QB 1UT8A 3PW5A 2BCSA 1A0PA 4KLOA 3NUQA 5KFQA 1NZPA 4GC7A 1WUDA 2G09A 3JPPA 5AI9A 5J2IA 3GV5B 4Y2UA 2ODGA 2XVTA 2F8KA 4KLEA 3H0MB 4QWCA 2QLTA 2LBOA 2B21A 1D8YA 1VDVA 2W9CA 2I1QA 1KSPA 5AHXA 4B9NA 3V72A 4NLNA 4DQQA 4ECUA 2F3NA 3PR5B 4B9LA 3ETRA 1HJPA 3RF9A 4J9SA 3RH5A 1F5SA 7ICTA 4NWIA 3RJHA 5KFDA 4GIBA 4KLDA 2HMXA 3MGHA 3K1RB 5J2CA 2P6RA 3E0FA 1NOMA 1ZQPA 1ED1A 3F2BA 2H3IA 3N97B 4IQTA 5EE1A 1V9PA 3NGDA 2ATLA 1S9FA 8ICNA 2AJQA 1TK5A 4CDGA 4QIWC 5HP4A 1N61A 2YB1A 2LMRA 1HUOA 3ONNA 3AU2A 2WAQF 2FPKA 5AI5A 2HCFA 2DBYA 3QU4A 4P0QA 4YG2A 4M04A 1QSSA 2FPLA 5KT6A 5L1KA 4AYBC 5DG9A 3QU2A 4ECSA 5DQGA 4UB3A 2JRZA 2KZMA 5CWRA 1XSNA 4QZFA 1ZQRA 5KT5A 2E8NA 5AI0A 4DSEA 1ZQYA 3LVVA 2NRTA 3HPOA 5J0XA 2E3TA 5ALSA 5AKLA 8ICWA 4YMOA 3TADC 3ZDBA 4DSIA 3TAPA 4DL3A 8ICLA 4OJ6A 2BZFA 2W11A 3PZPA 3GDXA 2KIVA 2RDJA 1PK1B 4M0AA 4K4HA 1NI3A 3F2DA 3G6XA 3KBBA 4UAZA 1QQ7A 5KFXA 1JIHA 3BS5B 2JEIA 2I5HA 4MFCA 3NRZA 7ICVA 5KFVA 4EEYA 1JX4A 9ICUA 4DL7A 4KLIA 4GC6A 9ICXA 2YMPA 3SEIA 2KNJA 3PO5A 3GV7B 2E8OA 3KTQA 2ZIUB 3VCBA 3PSFA 2XICA 4DCCA 5AI4A 8ICVA 2GLEA 1XO1A 2GO7A 4O0IA 4UB2A 1N48A 2KJ9A 2K89A 2P66A 3HRDD 3K75D 3BQ2A 1UA1A 4DSFA 1ZQJA 3T5HA 2ZTDA 1SV0C 1ZQEA 1Q3UA 5AKKA 2E1EA 1ZQTA 4IL6U 5KFJA 4O3RA 1L8OA 1ZYQA 2A19A 5ALRA 4DLEA 3TKAA 5ALNA 2XI9A 3CP8A 1L6NA 1ZQKA 5KFTA 3UMBA 3ISBA 4FFDA 2D3DA 1Z3EB 1DRGA 5DBCA 4O3QA 4BWMA 4O3OA 3TFSA 1YZ7A 2FLNA 1JRPA 2O6KA 4CRXA 4USAA 1XS9D 2HHSA 1JMSA 4NLGA 1JN3A 1SL1A 2BCUA 2XCAA 3N7PD 4ECVA 1D9DA 4QNLA 2ZIVA 4I2IA 5KG5A 1PK1A 4TUPA 4NLBA 1TKDA 1U45A 1BPDA 3I76A 4O3PA 1B4FA 1WG8A 3HW8A 5J0TA 2NRZA 3BS5A 3JPSA 2C2RA 1RM6C 5AKXA 4DQRA 1U47A 1P7DA 2W3SA 3LK9A 3CNHA 4F92B 4C7YA 3FM9A 2IA6A 1TAMA 4PHPA 4YFKA 7ICLA 2ZIUA 2EANA 5ALVA 1X9XA 5KG6A 1XSPA 2WF5A 5AICA 3WKCA 2V4RA 3ZDAA 3QZ8A 2M0NA 1NK7A 4FZMA 3PSTA 4ECTA 3RJGA 2DQNB 4Q8FA 2M9NA 1S0NA 3FDSA 2FLPA 5TZVA 1ZQDA 4GXKA 2PKEA 1L8LA 3Q8LA 2ASJA 3RBEA 3AM9A 5J2HA 5AI6A 4ED0A 1Q46A 1ZQGA 2KEYA 1ZXIA 3WK9A 2JR5A 2ZXIA 3ETLA 9ICBA 3PSPA 4R66A 8ICSA 4KN7A 2R8KA 2G06A 4RQ8A 1FEZA 5AK3A 4DL5A 3C23A 3Q8PB 2OHFA 1MSWD 4QWBA 3EYZA 1F44A 3PO4A 2F1JA 4YXMA 4RPXA 5AI8A 2EQYA 3TACB 2HVIA 5C5JA 3OHAA 2HBLA 1UHUA 4JB3A 3Q8QB 1QCKA 2WTFA 2B0CA 3IHQB 4IRDA 2BQ3A 1N62A 1L5UA 1ZQSA 4PL2A 4I2DA 1SZPA 1L7NA 1IM4A 4UASA 3FYHA 5KFKA 2K60A 3QUQA 4GFJA 4O5EA 2QKQA 1JROA 5ALTA 4KLGA 1TAQA 3ZD8A 4DL6A 1UCVA 1Z00B 2VA2A 4G3IA 4Q8EA 4CE6A 3PVXA 3SZ2A 3KFUF 4J9RA 4DL4A 4MEYA 3TQ1A 3C5GA 4YVZA 5TISU 5KFUA 1Y88A 2YMLA 1S76D 1NKCA 4JV0A 5HR7A 2YN4A 5F9NA 1S10A 3M6KA 3H8SA 2LYBA 4RQ6A 4KLHA 1DK3A 2BPGA 3SD7A 4DWIA 1XWLA 5DDYA 2WFAA 2FE9A 3SI8A 4OJPA 1SL2A 1T4GA 2MRLA 8ICTA 3ORYA 4AP9A 1IIPA 2KTQA 5BOMA 5JU5A 2BKEA 4ED6A 3V6JA 4QZ8A 9ICHA 4O3NA 2BPFA 2PFQA 4F2RA 1D8BA 5AM1A 4M47A 4EELA 4Q44A 3C29A 1L7OA 3H4DA 3JPNA 1N5WA 2OYYA 4Z6DA 4YXJA 3JPRA 3LYSA 4NLZA 8ICYA 2BCVA 2CN1A 3LVWA 1Z00A 1PUZA 2PXIA 3LWLA 2J6UA 1NK4A 1ZJNA 3GV8B 3ALRA 1NK0A 4IR1A 1V97A 4QZ9A 4ZOHC 2HDOA 2E8PA 2JGAA 3M9NB 4DFMA 2UVVA 4BXOB 5KFMA 3MGIA 3OSNA 9ICGA 4KLQA 3CYMA 1ZD4A 1SKWA 3NVWA 2BCRA 4CNQA 2W03A 2NRWA 2KP7A 1PVPA 3ZDEA 2BPCA 1X6IA 2EAPA 2DUYA 2RRDA 3D2SA 3BQTA 2GH1A 4F5PA 5L9XA 4Y2XA 4MF2A 4QZHA 4DQSA 2JEFA 4TUQA 5J2BA 2AGOA 3KHHA 4RNMA 2FLLA 4QZCA 3WK5A 4TUSA 1DK2A 4DQPA 4RQ2A 1T94A 1S0OA 2NO4A 9ICJA 3NVVA 3MABA 3F5EA 1KDHA 5EE3A 5GTIU 5ALKA 3QZ7A 2KMDA 3H0LB 4CF4A 5J8YA 1BPZA 5L1JA 3HT3A 4C80A 4UARA 2HVHA 3OJSA 2ZUBA 3SMVA 3B0XA 3FC4A 4F4KA 1RYSA 2W8LA 5ALXA 1L7PA 5KFYA 3PW0A 4B9UA 5KT3A 1JI7A 2K4IA 4RQMA 1V38A 3RB4A 2NO5A 1BNPA 4DF8A 4C8OA 3MDCA 4BGDA 9ICLA 1BPBA 2LM4A 2YMMA 3SAHA 4QWDA 4Z6CA 1Q3VA 3SV3A 2DKZA 2XGPA 5T14A 3HKZF 3OGUA 1NNLA 3RH4A 5G5GA 3OHBA 3QU9A 1LKYB 5DB7A 4RNOA 4GXIA 2F77X 3Q8KA 3S6JA 2JV3A 4HYKA 1ZQMA 5ALGA 4RQ1A 3RB6A 5IIJA 5K4LA 2YX8A 4MHVA 2K8BB 2UVUA 3KZIU 5DBBA 4O3SA 2AGPA 5KFBA 1ZRNA 4F5QA 2AXTU 2ZJ5A 1H38A 9ICMA 2K8AA 9ICIA 4YN4A 1SWWA 2AU0A 8ICGA 1KRPA 3GFKB 4YCXA 3T79A 2EZZA 2HHQA 4NM1A 1NKEA 2JH7A 2G5IB 5KFHA 4I28A 3NS1A 1DXSA 1SV4A 5J2FA 4M2YA 2H3ZA 4QZEA 5KFWA 2H3VA 4I2EA 1MA7A 5ALHA 1UQVA 5ALFA 4YD2A 2K8CB 5ALJA 3SAFA 4EBDA 4P0PA 5L1IA 8ICCA 3K4GA 5EWFA 2LI6A 4NL9C 5DGBA 2WAQC 1HIWA 4UW9A 4BDPA 5E79U 3BJYA 1FFUA 2D8CA 3JPQA 3NRWA 4C8NA 4HAIA 4YR0A 5J2JA 3T3FA 3MDAA 4R8UB 7ICRA 3KHRA 4U6PA 3RBDA 4O9MA 5ALMA 2KVSA 5J0PA 1BPXA 1N56A 2H5XA 5ALQA 4UB4A 3H7IA 4YR2A 1NJZA 4O5CA 1LKYA 1UT5A 1CUKA 3D6JA 2ASDA 1COKA 4DQIA 4JWNA 2C2EA 1MC8A 1WWUA 4QIWF 5KFEA 3WK7A 2Y0SF 4PJ0U 2ISPA 1J97A 5IINA 3C5FA 1KTQA 5F3XB 2ZTEA 7ICFA 9ICFA 7ICEA 3UQ0A 4PGYA 2KHVA 2H3QA 3UPQA 4QZDA 2ZIWB 1T8EA 5J2EA 1OW5A 5GTHU 5KL1B 5KG4A 2ZIVB 3BQ0A 5IIOA 4RPYA 3OSPA 1PVQA 1IV8A 4PGQA 3GIKA 2R8IA 7ICSA 5CP2A 4YMMA 2MU2A 5L1MA 1K1QA 1BVSA 2YY6A 3HILA 1N63A 4Y2VA 2K4EA 4Y2SA 1VLBA 1T3NA 1JXLA 2KD1A 4J9NA 5AKEA 3QUTA 2I6XA 1JALA 5J29A 3RRHA 3KZXA 4F5RA 4DOBA 1X42A 4UB6U 5ALYA 2FMPA 4R8UA 3EUB2 4I2CA 3MFIA 3KKAC 5L1LA 5CRXA 2MA1A 2KG5A 5KFNA 2PFPA 1ZQBA 4MFFA 2BQUA 3M8SA 2DPIA 3L4PA 4J9KA 3C1YA 4WJ3B 1XU4A 2W54A 3AEVA 4F72A 4IQWA 1N2XA 2W43A 3PW7A 1J2NA 1SGGA 3IV6A 3EW9A 2C28A 2HHUA 3TFRA 4QZIA 3ED5A 5AK4A 1ECWA 3PNCA 5CJ7A 2KIWA 4UAUA 1SZHA 4RQ0A 4DL2A 1WCNA 3HP6A 2MUTA 2BDUA 2CXYA 3PX6A 4JV2A 2F44A 3RJEA 3DDHA 2A3VA 4C8LA 2Q4TA 2ZIWA 4KLTA 1YZ6A 1MN8A 4PL1A 3PR4A 1NJXA 2HBKA 2OEHA 2KICA 3GU3A 3SQIA 1X6JA 5AM0A 3WK8A 3M9OB 5J2KA 2KE7A 1X40A 4Y2RA 4FS1A 2PI4A 4DSLA 3GILA 2UVWA 5B66U 8ICXA 3QUCA 3MR2A 5DB9A 1NK8A 2QARB 1JUDA 2G0AA 3LDAA 3QUBA 3RFAA 4M9GA 1ZQHA 3V7LA 9ICCA 3J81j 2ZJAA 4KLSA 2WF6A 2AGQA 5IILA 4OO1J 2WF9A 5AM5A 3BQ1A 5AIBA 4DOAA 4KTQA 1L3VA 2Y1JA 2EH9A 5KL8B 5KFFA 1RQLA 3N7RC 4O3MA 1SKSA 2VIXA 2OM6A 3V6KA 1B43A 5CB1A 1Z1VA 3WK6A 4FZNA 2ZXHA 1ZQQA 4IQUA 4QWAA 2BGWA 5D49A 4UBBA 5B5EU 4C7ZA 8ICBA 4I2AA 4LZGA 2IHMA 3IDWA 2XIDA 3PX4A 2FPMA 2FDRA 1ZQCA 2BDPA 5A0LA 2GWSA 3RB0A 4PZOA 3BZKA 4F4XA 5BOLA 1KFSA 5J2AA 4ED3A 1SV0A 2DF4B 2DKXA 3C2LA 3DEEA 1L3UA 3PX0A 2KHQA 2W9BB 2K4HA 3H8JA 4ECWA 4E0DA 2WF7A 2JHDA 1NKBA 2R8GA 2KVCA 2V9WA 3D2NA 4F71A 4B9VA 5KFAA 1OUQA 1LB2B 3GQCA 4Y2QA 1ZQXA 2EDUA 4R65A 3B9JA 3SV4A 2KJ5A 2KZ3A 2NRXA 9ICPA 1CI4A 2WB1F 4EBCA 2QARA 9ICTA 4I2HA 4F5OA 2W55A 4CF5A 4IR9A 1Z19A 2CRXA 5AK6A 4J9LA 1ZQOA 5FP0A 4DS5A 4DFKA 1RXVA 4NJ8A 4CCHA 5AKZA 3T5JA 5AK5A 1C7YA 3ZI4A 4I2FA 3BZCA 4XUSA 2XC9A 3N28A 2Y9UA 1C20A 1DGSA 3RH6A 1RXWA 3M6ZA 3G6VA 2XY5A 4DF4A 3WKBA 2ES6A 4LVSA 3BS7A 2JMGA 4DFDA 4FBUA 1X2IA 1ZQUA 3M7DA 3AN1A 5AIAA 4LJXA 9ICRA 2VKQA 5HHIA 4JMUA 2W9BA 3PMLA 1L7MA 1X9WA 4EYHB 4KLJA 8ICEA 2XY6A 4RQ4A 3Q8MA 1FO4A 2KSOA 4PGXA 4DFJA 4F4WA 5J8YC 4UAVA 2IOFK 2RP5A 4IC9A 7ICUA 4NM2A 2ISOA 7ICKA 3C21A 4F4YA 3PSIA 5EOZA 1RYUA 4OJ5A 2VA8A 4M9LA 4A8EA 2F1HA 8ICQA 2IBKA 4XQ8A 4F3OA 1O03A 4J9MA 3IG8A 1UA0A 3UXOA 4Z6FA 4ECQA 3IP4B 1QLNA 4NLCA 3CW2C 1ZETA 4J9PA 5KG1A 3WKDA 2OWOA 1NK5A 1TE2A 1S8OA 1QSLA 4OJOA 4KX3A 2AQ4A 3QYPA 1BGXT 4JUZA 4F91B 2A1AA 5J0UA 4OJLA 7ICQA 9ICQA 4KN4A 3O0FA 2NYVA 3T5KA 1HUZA 4KLFA 4RZRA 1XNSA 4F50A 3F5AA 2MAXA 4C4TA 1NZBA 4RQNA 1RYRA 4C4RA 5DG8A 8ICRA 5KAIU 3N7SC 4M9NA 4ECYA 4US8A 3H0RB 2EZYA 9ICWA 1PK3A 3SENA 3SYZA 3IG5A 3C1ZA 5KT2A 3UM9A 2HSZA 4BUGA 3EPIA 2UVRA 4J9QA 1ZRMA 3JPOA 1ZQVA 2FMSA 3F2CA 2C22A 5J0QA 1HEKA 4C8KA 4QW9A 2PMZF 3JPTA 1SKRA 3RR8A 2N1RA 3UXPA 3HX0A 2DFLA 1NJWA 3TAQA 2WHEA 3H40A 9ICNA 2XCPA 4R64A 2E8MA 4CGZA 2XY7A 4IQVA 3UXNA 4P0PB 4C8MA 4MF8A 4EZ6A 1M6YA 2PI5A 3QU7A 3AMZA 5IIKA 4PHAA 2KFNA 3ZD9A 4B9SA 5DQHA 4F5NA 9ICVA 1KBUA 3KD3A 2HHXA 4I27A 1NK6A 2P35A 5HNKA 5KG7A 3HKZC 7ICHA 3V7JA 1KFTA 3QEAZ 8ICZA 4XRHA 1RZTA 4JV1A 1WWVA 5JTIA 4Q43A 2HHWA 2KK0A 4Z6EA 3RJIA 5KG2A 2IOFA 1AROP 2ALZA 4EYIB 5G5HA 4P4PA 2K4PA 1KQQA 3NASA 2WF8A 1XO0A 5DKWA 2NRVA 2Z7JA 3UMGA 1ZJMA 3PMNA 3Q8RB 2RHFA 1RDFA 4GLXA 3A0HU 2W7PA 4ED2A 1L3SA 1U4BA 5D4BA 3AL0B 3LWMA 4RUCA 2W3RA 5HHHA 4PH5A 1LV5A 4DO9A 3OPXA 3E2EA 5EE9A 2EAMA 8ICMA 1S0VA 2E1FA 1PVRA 4EX6A 3G6YA 5AKHA 4RU9A 3WU2U 5J2GA 5DBAA 1T7PA 1O08A 8ICHA 3EWAA 2HBMA 5KFCA 1RPLA 1D8LA 4QZBA
chains in the Genus database with same CATH topology
2JMGA 2HOQA 2HBLA 1DRGA 3C29A 2HOFA 3NUQA 1URJA 3M7DA 2G07A 2YB4A 4U6PA 2K4IA 1WUDA 3F2CA 2G09A 1HEKA 2W04A 2PMZF 4PL2A 3LVVA 4CRXA 2N1RA 4WJ3B 2OYYA 2VKQA 4JMUA 1ZQ1C 5A0LA 3LYSA 2KV2A 1CRXA 3L3FX 2CN1A 2F76X 3LVWA 2NV3A 2VJ4A 3N7PD 4KX5A 2XVTA 4QNLA 2ZIVA 3SAHA 2ZIXA 3H0MB 4CGZA 2CPRA 2DGZA 3ALRA 3MGVA 3SAGA 1Q3VA 2DF4B 2LBOA 3DEEA 4GFJA 4NLBA 2OH2A 4P0PB 2PMZC 1ECWA 2KHQA 4QIWF 2RP5A 5T14A 2KIWA 4NV0A 2GOLA 3HKZF 1SZHA 2JGAA 2K4HA 4FE3A 2Y0SF 4IC9A 4OJ6A 3PSIA 1GO3F 2KOBA 3ICXA 2ZIXB 2JHDA 3PZPA 2BDUA 3KFUF 2F77X 2LHTA 4OJ5A 1KBUA 3RF9A 2HOIA 2A3VA 2KVCA 1P7DA 3D2NA 4A8EA 2Q4TA 2ZIWA 3CYMA 3F2DA 4NWIA 2YX8A 3HKZC 3CRXA 2K8BB 4PL1A 1OUQA 2Y0SC 2W03A 2HBKA 3C28A 2LYAA 3AQFA 1TAMA 2KICA 3IG8A 2KHVA 2HMXA 3GU3A 2H3QA 3SQIA 1PVPA 3E0FA 2D6FC 2ZIUA 1ED1A 5HR7A 2F8LA 2KJ5A 3IN5A 3IP4B 4NLCA 3F2BA 1A6SA 2WB1F 2K8AA 2ZIWB 4BX9C 2H3IA 2HBJA 2RRDA 3D2SA 3K1ZA 5KL1B 2M0NA 2GH1A 4FZMA 3PSTA 2ZIVB 2KKPA 3M6KA 2DQNB 2KNJA 1YT3A 1XO0A 2LYBA 1Z19A 1PVQA 2CRXA 2JH1A 3T79A 2ZIUB 2G08A 2ZG6A 4OJOA 3VCBA 3PSFA 2Z7JA 2F2AB 4BJQA 4KX3A 2JH7A 4QJFB 4CDGA 4QIWC 2G5IB 2XICA 4U7CA 1Z1BA 2VJ5A 2WB1C 3F53A 2YB1A 3VC8A 3GZFA 2RHFA 2W7OA 3ONNA 4OJLA 2WAQF 2G0AA 2R18A 3RFAA 4AYBF 2K4EA 2W7PA 2OXOA 2KJ9A 1T94A 2H3FA 4KMOB 2KEYA 2H3ZA 3O0FA 2K89A 3AL0B 2KD1A 2LKYA 2ZXIA 2E5SA 2H3VA 4OO1J 5HR6A 1UPHA 1MA7A 4OJPA 3PSPA 4FZLA 4P0QA 1XNSA 3F5AA 3AQEA 3OPXA 2G06A 2K8CB 2KJ8A 2MRLA 3SAFA 3F5EA 1NZBA 4C0ZA 5KL8B 4P0PA 4O3MA 1IIPA 3N7RC 3N7SC 2E1FA 2VIXA 1Q3UA 1PVRA 3KZXA 2OM6A 3H0LB 2WAQC 3H0RB 1HIWA 2E1EA 4AYBC 4FZNA 2ZXHA 3D2QA 2KKVA 3M6ZA 1F44A 4P0QB 5CRXA 3IG5A 2MA1A 2XI9A 3CP8A 4ICAA 1L6NA 4ACOA 2HBMA 3SMVA 4BUGA 3NRWA 1D8BA 2XIDA 2G5HB 1A0PA 5C0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQF A;  3N7R C;  3N7P D;  3N7S C;  2YX8 A;  2XVT A;  3AQE A; 
#chains in the Genus database with same CATH topology
 4EEN A;  2IMW P;  5KFO A;  2YB4 A;  4UBC A;  4Y2J A;  4EBE A;  5DLG A;  2HHV A;  5CA7 A;  4O5K A;  2A1J A;  3I1Y A;  2F76 X;  5ALE A;  3C2M A;  1ZD5 A;  1ZOL A;  2BHN A;  1BPY A;  8ICK A;  4ED7 A;  5CEH A;  3C2K A;  4NV0 A;  9ICS A;  3MR3 A;  3UQ2 A;  3KHG A;  8ICJ A;  5AKJ A;  5DGA A;  3U26 A;  8ICP A;  4EEK A;  1WYG A;  2Y0S C;  1ZQL A;  4I2J A;  3M8R A;  4MEX A;  1S97 A;  3GIJ A;  1NK9 A;  4PHD A;  1MQ2 A;  5ALL A;  3IM1 A;  1A77 A;  3PW4 A;  2YTU A;  2FJ6 A;  4UB8 U;  9ICO A;  1Z4O A;  3RRG A;  5KFL A;  4F4Z A;  1ZQZ A;  2JH1 A;  4P4O A;  2G08 A;  5AM4 A;  1XC9 A;  2IHN A;  4IS7 A;  2F2A B;  4RNN A;  3I28 A;  5KTQ A;  2VJ5 A;  3TI0 A;  1EXN A;  2MUT B;  4DSK A;  1BPE A;  4AYB F;  8ICA A;  7ICO A;  3PW2 A;  3RR7 A;  4JWM A;  2ESE A;  4RT3 A;  3QE9 Y;  4PZN A;  4NLK A;  2KZZ A;  2KJ8 A;  9ICA A;  1L3T A;  1SIJ A;  3QU5 A;  5BPC A;  4ECX A;  4ECR A;  2XO7 A;  2W9A A;  3T5L A;  4KLU A;  3D2Q A;  2LM1 A;  4KMU A;  3BDP A;  4BWJ A;  2XGQ A;  4UB1 A;  5DG7 A;  4Y2P A;  1X66 A;  4NY8 A;  1VJ5 A;  3OTQ A;  4QW8 A;  4DS4 A;  1ZQA A;  4US9 A;  2HW3 A;  1B0X A;  2RLT A;  3UMC A;  1U48 A;  3N4M B;  2BCQ A;  1DOQ A;  2W04 A;  4UB5 A;  1ZQ1 C;  5ALU A;  4X5V A;  3L3F X;  4RPZ A;  2J6T A;  4FBT A;  3ZDC A;  4KX5 A;  3NVZ A;  2JEJ A;  2DGZ A;  7ICM A;  2VAN A;  4NL9 A;  1KEJ A;  3R9K A;  4ZH4 A;  3V7K A;  3MR6 A;  1QH9 A;  2ZIX B;  1D9F A;  4I2B A;  2JXJ A;  1RQN A;  3KHL A;  3RJK A;  2HHT A;  3QX7 A;  3AQF A;  2ZTC A;  2P6U A;  1Z4N A;  5KFG A;  2DL0 A;  1A6S A;  4ELT A;  4BX9 C;  1SXD A;  1U9L A;  5DB6 A;  4RQ5 A;  1CEZ A;  3QNM A;  1LVH A;  4K4G A;  1YT3 A;  4TQR A;  5CHG A;  3H4B A;  1F0M A;  1PZN A;  4BJQ A;  4QJF B;  8ICF A;  4U7C A;  2KN7 A;  4TQS A;  4B9T A;  3TAN A;  5J0W A;  1AQ6 A;  5J2D A;  3F53 A;  3VC8 A;  3GZF A;  3PV8 A;  1Q8K A;  1KN5 A;  3B0Y A;  2H3F A;  1N5X A;  4RQ7 A;  1COO A;  3TAR A;  1X9S A;  4DSJ A;  1UPH A;  5ALP A;  4CF3 A;  4I29 A;  3TAD A;  1TAU A;  2DPJ A;  2C2D A;  4TUR A;  3EPG A;  5IIM A;  5ALD A;  1TFR A;  4K4I A;  4QZG A;  2DWQ A;  2KKV A;  3HJE A;  2F1I A;  5KG3 A;  4M9H A;  2ZUD A;  4ICA A;  5KFS A;  3WKE A;  8ICI A;  3RJF A;  5JUM A;  7ICN A;  2G5H B;  4I2G A;  5C0Y A;  2HOF A;  5DLF A;  3QXG A;  7ICP A;  1K5O A;  2ASL A;  5KT7 A;  3M9M B;  1U49 A;  3H8M A;  4DEZ A;  3Q8S B;  5KFP A;  3A0B U;  2ZIX A;  4JK1 A;  4M9J A;  1NJY A;  3MGV A;  3SAG A;  2FI1 A;  4FO6 A;  4QWE A;  4P2H A;  3ISC A;  3E58 A;  4OD0 A;  1S77 D;  3KKA A;  1ZQW A;  1XSL A;  3ICX A;  2EAO A;  3QEB Z;  5HMM A;  3IRU A;  2IOH A;  1TV9 A;  2HOI A;  2LYH A;  1K1S A;  4ED1 A;  7ICG A;  5AM3 A;  3C28 A;  2R8H A;  2YMQ A;  1QQ5 A;  4YR3 A;  3MBY A;  1TK0 A;  3L5K A;  2Q0Z X;  2FMQ A;  4KLM A;  3IN5 A;  2L5Y A;  5AKG A;  2KFZ A;  2KKP A;  3ZDD A;  5HML A;  4PHE A;  1A76 A;  2KSO B;  4UAY A;  5F9L A;  3HWT A;  1SWV A;  1Z1B A;  1KLN A;  4ELV A;  2WB1 C;  4J03 A;  4C4S A;  4KIT B;  4EZ9 A;  2R18 A;  3RTV A;  2OXO A;  4KMO B;  1IG6 A;  5EWG A;  2PFO A;  2W9M A;  1FIQ A;  1QSY A;  3DV9 A;  3AQE A;  3AUO A;  3V6H A;  4M6W B;  3WKA A;  4YD1 A;  5KG0 A;  4Q45 A;  4YQW A;  2ZJ8 A;  3M1Y A;  1SL0 A;  2HI0 A;  2V4Q A;  1ZQF A;  5J0S A;  2J6S A;  2VA3 A;  1URJ A;  5D46 A;  3RB3 A;  2EZX A;  3GIM A;  1CRX A;  1IXR A;  2NV3 A;  1J2M A;  4P4M A;  3MR5 A;  1S0M A;  5KNI A;  1QQ6 A;  2CPR A;  3SR6 A;  3ISD A;  2AQ0 A;  2OH2 A;  1OXJ A;  5DDM A;  5ALO A;  4DFP A;  2GOL A;  4RQ3 A;  4ED8 A;  2KOB A;  1KFD A;  4EX7 A;  4B9M A;  5KFI A;  2AHO B;  5EE0 A;  4B6J A;  2LHT A;  3FAH A;  4LZD A;  1T3Q A;  5J0R A;  3CRX A;  4RT2 A;  9ICE A;  1SXE A;  3RAX A;  4UQG A;  2LYA A;  2BQR A;  7ICI A;  2D6F C;  5ALZ A;  2F8L A;  1X9M A;  4GXJ A;  2ZUC A;  2LPE A;  3K1Z A;  4RUA A;  1TK8 A;  4YP3 A;  4OCZ A;  2B6G A;  1WCL A;  2MSN A;  5J0O A;  3NTU A;  2ZG6 A;  1RG6 A;  3RAQ A;  1DGJ A;  5AKY A;  5ALI A;  4M6W A;  2W7O A;  1ZQN A;  5AM2 A;  2AH5 A;  4UAW A;  1ZD2 P;  3MC1 A;  2PFN A;  4XA5 A;  5EWE A;  5HR6 A;  2RDI A;  5KAF U;  2QB1 A;  4FZL A;  5H2F U;  4C0Z A;  4NXZ A;  3MFH A;  4MFA A;  3PY8 A;  4F2S A;  1KW4 A;  5III A;  4J9O A;  2R8J A;  4ELU A;  8ICU A;  2JZB B;  4Y2T A;  4QZA A;  2Y1I A;  3BQ7 A;  4ACO A;  2QB0 B;  5J0Y A;  8ICO A;  2HOQ A;  1ZD3 A;  3AU6 A;  5KFR A;  2RQ5 A;  2G07 A;  3EZ5 A;  3RJJ A;  2KV2 A;  1N60 A;  4PPX A;  1JXE A;  2VJ4 A;  5DQI A;  4Y2Y A;  5JRT A;  2PMZ C;  2YQE A;  4FE3 A;  1GO3 F;  1TVA A;  1MQ3 A;  5AKI A;  2W9C B;  1FFV A;  3OJU A;  1KKX A;  3NVY A;  1SB3 C;  1ZQI A;  2A1J B;  5CR0 A;  4IRC A;  4IRK A;  2HBJ A;  1KL9 A;  5DB8 A;  2W8K A;  1S5L U;  1QTM A;  9ICK A;  3WK4 A;  2BR0 A;  4DOC A;  3GII A;  4F93 B;  4FS2 A;  3H8W A;  4ECZ A;  4R63 A;  1BNO A;  4DLG A;  2OCE A;  7ICJ A;  5ALW A;  5KT4 A;  2Y9T A;  5KFZ A;  2I9G A;  3KOO A;  1B22 A;  2LKY A;  3THV A;  2E5S A;  4G9B A;  2JZB A;  4F8R A;  4KLL A;  2QB0 A;  4UAT A;  4YMN A;  1V85 A;  2JEG A;  4BXO A;  4P0Q B;  1UT8 A;  3PW5 A;  2BCS A;  1A0P A;  4KLO A;  3NUQ A;  5KFQ A;  1NZP A;  4GC7 A;  1WUD A;  2G09 A;  3JPP A;  5AI9 A;  5J2I A;  3GV5 B;  4Y2U A;  2ODG A;  2XVT A;  2F8K A;  4KLE A;  3H0M B;  4QWC A;  2QLT A;  2LBO A;  2B21 A;  1D8Y A;  1VDV A;  2W9C A;  2I1Q A;  1KSP A;  5AHX A;  4B9N A;  3V72 A;  4NLN A;  4DQQ A;  4ECU A;  2F3N A;  3PR5 B;  4B9L A;  3ETR A;  1HJP A;  3RF9 A;  4J9S A;  3RH5 A;  1F5S A;  7ICT A;  4NWI A;  3RJH A;  5KFD A;  4GIB A;  4KLD A;  2HMX A;  3MGH A;  3K1R B;  5J2C A;  2P6R A;  3E0F A;  1NOM A;  1ZQP A;  1ED1 A;  3F2B A;  2H3I A;  3N97 B;  4IQT A;  5EE1 A;  1V9P A;  3NGD A;  2ATL A;  1S9F A;  8ICN A;  2AJQ A;  1TK5 A;  4CDG A;  4QIW C;  5HP4 A;  1N61 A;  2YB1 A;  2LMR A;  1HUO A;  3ONN A;  3AU2 A;  2WAQ F;  2FPK A;  5AI5 A;  2HCF A;  2DBY A;  3QU4 A;  4P0Q A;  4YG2 A;  4M04 A;  1QSS A;  2FPL A;  5KT6 A;  5L1K A;  4AYB C;  5DG9 A;  3QU2 A;  4ECS A;  5DQG A;  4UB3 A;  2JRZ A;  2KZM A;  5CWR A;  1XSN A;  4QZF A;  1ZQR A;  5KT5 A;  2E8N A;  5AI0 A;  4DSE A;  1ZQY A;  3LVV A;  2NRT A;  3HPO A;  5J0X A;  2E3T A;  5ALS A;  5AKL A;  8ICW A;  4YMO A;  3TAD C;  3ZDB A;  4DSI A;  3TAP A;  4DL3 A;  8ICL A;  4OJ6 A;  2BZF A;  2W11 A;  3PZP A;  3GDX A;  2KIV A;  2RDJ A;  1PK1 B;  4M0A A;  4K4H A;  1NI3 A;  3F2D A;  3G6X A;  3KBB A;  4UAZ A;  1QQ7 A;  5KFX A;  1JIH A;  3BS5 B;  2JEI A;  2I5H A;  4MFC A;  3NRZ A;  7ICV A;  5KFV A;  4EEY A;  1JX4 A;  9ICU A;  4DL7 A;  4KLI A;  4GC6 A;  9ICX A;  2YMP A;  3SEI A;  2KNJ A;  3PO5 A;  3GV7 B;  2E8O A;  3KTQ A;  2ZIU B;  3VCB A;  3PSF A;  2XIC A;  4DCC A;  5AI4 A;  8ICV A;  2GLE A;  1XO1 A;  2GO7 A;  4O0I A;  4UB2 A;  1N48 A;  2KJ9 A;  2K89 A;  2P66 A;  3HRD D;  3K75 D;  3BQ2 A;  1UA1 A;  4DSF A;  1ZQJ A;  3T5H A;  2ZTD A;  1SV0 C;  1ZQE A;  1Q3U A;  5AKK A;  2E1E A;  1ZQT A;  4IL6 U;  5KFJ A;  4O3R A;  1L8O A;  1ZYQ A;  2A19 A;  5ALR A;  4DLE A;  3TKA A;  5ALN A;  2XI9 A;  3CP8 A;  1L6N A;  1ZQK A;  5KFT A;  3UMB A;  3ISB A;  4FFD A;  2D3D A;  1Z3E B;  1DRG A;  5DBC A;  4O3Q A;  4BWM A;  4O3O A;  3TFS A;  1YZ7 A;  2FLN A;  1JRP A;  2O6K A;  4CRX A;  4USA A;  1XS9 D;  2HHS A;  1JMS A;  4NLG A;  1JN3 A;  1SL1 A;  2BCU A;  2XCA A;  3N7P D;  4ECV A;  1D9D A;  4QNL A;  2ZIV A;  4I2I A;  5KG5 A;  1PK1 A;  4TUP A;  4NLB A;  1TKD A;  1U45 A;  1BPD A;  3I76 A;  4O3P A;  1B4F A;  1WG8 A;  3HW8 A;  5J0T A;  2NRZ A;  3BS5 A;  3JPS A;  2C2R A;  1RM6 C;  5AKX A;  4DQR A;  1U47 A;  1P7D A;  2W3S A;  3LK9 A;  3CNH A;  4F92 B;  4C7Y A;  3FM9 A;  2IA6 A;  1TAM A;  4PHP A;  4YFK A;  7ICL A;  2ZIU A;  2EAN A;  5ALV A;  1X9X A;  5KG6 A;  1XSP A;  2WF5 A;  5AIC A;  3WKC A;  2V4R A;  3ZDA A;  3QZ8 A;  2M0N A;  1NK7 A;  4FZM A;  3PST A;  4ECT A;  3RJG A;  2DQN B;  4Q8F A;  2M9N A;  1S0N A;  3FDS A;  2FLP A;  5TZV A;  1ZQD A;  4GXK A;  2PKE A;  1L8L A;  3Q8L A;  2ASJ A;  3RBE A;  3AM9 A;  5J2H A;  5AI6 A;  4ED0 A;  1Q46 A;  1ZQG A;  2KEY A;  1ZXI A;  3WK9 A;  2JR5 A;  2ZXI A;  3ETL A;  9ICB A;  3PSP A;  4R66 A;  8ICS A;  4KN7 A;  2R8K A;  2G06 A;  4RQ8 A;  1FEZ A;  5AK3 A;  4DL5 A;  3C23 A;  3Q8P B;  2OHF A;  1MSW D;  4QWB A;  3EYZ A;  1F44 A;  3PO4 A;  2F1J A;  4YXM A;  4RPX A;  5AI8 A;  2EQY A;  3TAC B;  2HVI A;  5C5J A;  3OHA A;  2HBL A;  1UHU A;  4JB3 A;  3Q8Q B;  1QCK A;  2WTF A;  2B0C A;  3IHQ B;  4IRD A;  2BQ3 A;  1N62 A;  1L5U A;  1ZQS A;  4PL2 A;  4I2D A;  1SZP A;  1L7N A;  1IM4 A;  4UAS A;  3FYH A;  5KFK A;  2K60 A;  3QUQ A;  4GFJ A;  4O5E A;  2QKQ A;  1JRO A;  5ALT A;  4KLG A;  1TAQ A;  3ZD8 A;  4DL6 A;  1UCV A;  1Z00 B;  2VA2 A;  4G3I A;  4Q8E A;  4CE6 A;  3PVX A;  3SZ2 A;  3KFU F;  4J9R A;  4DL4 A;  4MEY A;  3TQ1 A;  3C5G A;  4YVZ A;  5TIS U;  5KFU A;  1Y88 A;  2YML A;  1S76 D;  1NKC A;  4JV0 A;  5HR7 A;  2YN4 A;  5F9N A;  1S10 A;  3M6K A;  3H8S A;  2LYB A;  4RQ6 A;  4KLH A;  1DK3 A;  2BPG A;  3SD7 A;  4DWI A;  1XWL A;  5DDY A;  2WFA A;  2FE9 A;  3SI8 A;  4OJP A;  1SL2 A;  1T4G A;  2MRL A;  8ICT A;  3ORY A;  4AP9 A;  1IIP A;  2KTQ A;  5BOM A;  5JU5 A;  2BKE A;  4ED6 A;  3V6J A;  4QZ8 A;  9ICH A;  4O3N A;  2BPF A;  2PFQ A;  4F2R A;  1D8B A;  5AM1 A;  4M47 A;  4EEL A;  4Q44 A;  3C29 A;  1L7O A;  3H4D A;  3JPN A;  1N5W A;  2OYY A;  4Z6D A;  4YXJ A;  3JPR A;  3LYS A;  4NLZ A;  8ICY A;  2BCV A;  2CN1 A;  3LVW A;  1Z00 A;  1PUZ A;  2PXI A;  3LWL A;  2J6U A;  1NK4 A;  1ZJN A;  3GV8 B;  3ALR A;  1NK0 A;  4IR1 A;  1V97 A;  4QZ9 A;  4ZOH C;  2HDO A;  2E8P A;  2JGA A;  3M9N B;  4DFM A;  2UVV A;  4BXO B;  5KFM A;  3MGI A;  3OSN A;  9ICG A;  4KLQ A;  3CYM A;  1ZD4 A;  1SKW A;  3NVW A;  2BCR A;  4CNQ A;  2W03 A;  2NRW A;  2KP7 A;  1PVP A;  3ZDE A;  2BPC A;  1X6I A;  2EAP A;  2DUY A;  2RRD A;  3D2S A;  3BQT A;  2GH1 A;  4F5P A;  5L9X A;  4Y2X A;  4MF2 A;  4QZH A;  4DQS A;  2JEF A;  4TUQ A;  5J2B A;  2AGO A;  3KHH A;  4RNM A;  2FLL A;  4QZC A;  3WK5 A;  4TUS A;  1DK2 A;  4DQP A;  4RQ2 A;  1T94 A;  1S0O A;  2NO4 A;  9ICJ A;  3NVV A;  3MAB A;  3F5E A;  1KDH A;  5EE3 A;  5GTI U;  5ALK A;  3QZ7 A;  2KMD A;  3H0L B;  4CF4 A;  5J8Y A;  1BPZ A;  5L1J A;  3HT3 A;  4C80 A;  4UAR A;  2HVH A;  3OJS A;  2ZUB A;  3SMV A;  3B0X A;  3FC4 A;  4F4K A;  1RYS A;  2W8L A;  5ALX A;  1L7P A;  5KFY A;  3PW0 A;  4B9U A;  5KT3 A;  1JI7 A;  2K4I A;  4RQM A;  1V38 A;  3RB4 A;  2NO5 A;  1BNP A;  4DF8 A;  4C8O A;  3MDC A;  4BGD A;  9ICL A;  1BPB A;  2LM4 A;  2YMM A;  3SAH A;  4QWD A;  4Z6C A;  1Q3V A;  3SV3 A;  2DKZ A;  2XGP A;  5T14 A;  3HKZ F;  3OGU A;  1NNL A;  3RH4 A;  5G5G A;  3OHB A;  3QU9 A;  1LKY B;  5DB7 A;  4RNO A;  4GXI A;  2F77 X;  3Q8K A;  3S6J A;  2JV3 A;  4HYK A;  1ZQM A;  5ALG A;  4RQ1 A;  3RB6 A;  5IIJ A;  5K4L A;  2YX8 A;  4MHV A;  2K8B B;  2UVU A;  3KZI U;  5DBB A;  4O3S A;  2AGP A;  5KFB A;  1ZRN A;  4F5Q A;  2AXT U;  2ZJ5 A;  1H38 A;  9ICM A;  2K8A A;  9ICI A;  4YN4 A;  1SWW A;  2AU0 A;  8ICG A;  1KRP A;  3GFK B;  4YCX A;  3T79 A;  2EZZ A;  2HHQ A;  4NM1 A;  1NKE A;  2JH7 A;  2G5I B;  5KFH A;  4I28 A;  3NS1 A;  1DXS A;  1SV4 A;  5J2F A;  4M2Y A;  2H3Z A;  4QZE A;  5KFW A;  2H3V A;  4I2E A;  1MA7 A;  5ALH A;  1UQV A;  5ALF A;  4YD2 A;  2K8C B;  5ALJ A;  3SAF A;  4EBD A;  4P0P A;  5L1I A;  8ICC A;  3K4G A;  5EWF A;  2LI6 A;  4NL9 C;  5DGB A;  2WAQ C;  1HIW A;  4UW9 A;  4BDP A;  5E79 U;  3BJY A;  1FFU A;  2D8C A;  3JPQ A;  3NRW A;  4C8N A;  4HAI A;  4YR0 A;  5J2J A;  3T3F A;  3MDA A;  4R8U B;  7ICR A;  3KHR A;  4U6P A;  3RBD A;  4O9M A;  5ALM A;  2KVS A;  5J0P A;  1BPX A;  1N56 A;  2H5X A;  5ALQ A;  4UB4 A;  3H7I A;  4YR2 A;  1NJZ A;  4O5C A;  1LKY A;  1UT5 A;  1CUK A;  3D6J A;  2ASD A;  1COK A;  4DQI A;  4JWN A;  2C2E A;  1MC8 A;  1WWU A;  4QIW F;  5KFE A;  3WK7 A;  2Y0S F;  4PJ0 U;  2ISP A;  1J97 A;  5IIN A;  3C5F A;  1KTQ A;  5F3X B;  2ZTE A;  7ICF A;  9ICF A;  7ICE A;  3UQ0 A;  4PGY A;  2KHV A;  2H3Q A;  3UPQ A;  4QZD A;  2ZIW B;  1T8E A;  5J2E A;  1OW5 A;  5GTH U;  5KL1 B;  5KG4 A;  2ZIV B;  3BQ0 A;  5IIO A;  4RPY A;  3OSP A;  1PVQ A;  1IV8 A;  4PGQ A;  3GIK A;  2R8I A;  7ICS A;  5CP2 A;  4YMM A;  2MU2 A;  5L1M A;  1K1Q A;  1BVS A;  2YY6 A;  3HIL A;  1N63 A;  4Y2V A;  2K4E A;  4Y2S A;  1VLB A;  1T3N A;  1JXL A;  2KD1 A;  4J9N A;  5AKE A;  3QUT A;  2I6X A;  1JAL A;  5J29 A;  3RRH A;  3KZX A;  4F5R A;  4DOB A;  1X42 A;  4UB6 U;  5ALY A;  2FMP A;  4R8U A;  3EUB 2;  4I2C A;  3MFI A;  3KKA C;  5L1L A;  5CRX A;  2MA1 A;  2KG5 A;  5KFN A;  2PFP A;  1ZQB A;  4MFF A;  2BQU A;  3M8S A;  2DPI A;  3L4P A;  4J9K A;  3C1Y A;  4WJ3 B;  1XU4 A;  2W54 A;  3AEV A;  4F72 A;  4IQW A;  1N2X A;  2W43 A;  3PW7 A;  1J2N A;  1SGG A;  3IV6 A;  3EW9 A;  2C28 A;  2HHU A;  3TFR A;  4QZI A;  3ED5 A;  5AK4 A;  1ECW A;  3PNC A;  5CJ7 A;  2KIW A;  4UAU A;  1SZH A;  4RQ0 A;  4DL2 A;  1WCN A;  3HP6 A;  2MUT A;  2BDU A;  2CXY A;  3PX6 A;  4JV2 A;  2F44 A;  3RJE A;  3DDH A;  2A3V A;  4C8L A;  2Q4T A;  2ZIW A;  4KLT A;  1YZ6 A;  1MN8 A;  4PL1 A;  3PR4 A;  1NJX A;  2HBK A;  2OEH A;  2KIC A;  3GU3 A;  3SQI A;  1X6J A;  5AM0 A;  3WK8 A;  3M9O B;  5J2K A;  2KE7 A;  1X40 A;  4Y2R A;  4FS1 A;  2PI4 A;  4DSL A;  3GIL A;  2UVW A;  5B66 U;  8ICX A;  3QUC A;  3MR2 A;  5DB9 A;  1NK8 A;  2QAR B;  1JUD A;  2G0A A;  3LDA A;  3QUB A;  3RFA A;  4M9G A;  1ZQH A;  3V7L A;  9ICC A;  3J81 j;  2ZJA A;  4KLS A;  2WF6 A;  2AGQ A;  5IIL A;  4OO1 J;  2WF9 A;  5AM5 A;  3BQ1 A;  5AIB A;  4DOA A;  4KTQ A;  1L3V A;  2Y1J A;  2EH9 A;  5KL8 B;  5KFF A;  1RQL A;  3N7R C;  4O3M A;  1SKS A;  2VIX A;  2OM6 A;  3V6K A;  1B43 A;  5CB1 A;  1Z1V A;  3WK6 A;  4FZN A;  2ZXH A;  1ZQQ A;  4IQU A;  4QWA A;  2BGW A;  5D49 A;  4UBB A;  5B5E U;  4C7Z A;  8ICB A;  4I2A A;  4LZG A;  2IHM A;  3IDW A;  2XID A;  3PX4 A;  2FPM A;  2FDR A;  1ZQC A;  2BDP A;  5A0L A;  2GWS A;  3RB0 A;  4PZO A;  3BZK A;  4F4X A;  5BOL A;  1KFS A;  5J2A A;  4ED3 A;  1SV0 A;  2DF4 B;  2DKX A;  3C2L A;  3DEE A;  1L3U A;  3PX0 A;  2KHQ A;  2W9B B;  2K4H A;  3H8J A;  4ECW A;  4E0D A;  2WF7 A;  2JHD A;  1NKB A;  2R8G A;  2KVC A;  2V9W A;  3D2N A;  4F71 A;  4B9V A;  5KFA A;  1OUQ A;  1LB2 B;  3GQC A;  4Y2Q A;  1ZQX A;  2EDU A;  4R65 A;  3B9J A;  3SV4 A;  2KJ5 A;  2KZ3 A;  2NRX A;  9ICP A;  1CI4 A;  2WB1 F;  4EBC A;  2QAR A;  9ICT A;  4I2H A;  4F5O A;  2W55 A;  4CF5 A;  4IR9 A;  1Z19 A;  2CRX A;  5AK6 A;  4J9L A;  1ZQO A;  5FP0 A;  4DS5 A;  4DFK A;  1RXV A;  4NJ8 A;  4CCH A;  5AKZ A;  3T5J A;  5AK5 A;  1C7Y A;  3ZI4 A;  4I2F A;  3BZC A;  4XUS A;  2XC9 A;  3N28 A;  2Y9U A;  1C20 A;  1DGS A;  3RH6 A;  1RXW A;  3M6Z A;  3G6V A;  2XY5 A;  4DF4 A;  3WKB A;  2ES6 A;  4LVS A;  3BS7 A;  2JMG A;  4DFD A;  4FBU A;  1X2I A;  1ZQU A;  3M7D A;  3AN1 A;  5AIA A;  4LJX A;  9ICR A;  2VKQ A;  5HHI A;  4JMU A;  2W9B A;  3PML A;  1L7M A;  1X9W A;  4EYH B;  4KLJ A;  8ICE A;  2XY6 A;  4RQ4 A;  3Q8M A;  1FO4 A;  2KSO A;  4PGX A;  4DFJ A;  4F4W A;  5J8Y C;  4UAV A;  2IOF K;  2RP5 A;  4IC9 A;  7ICU A;  4NM2 A;  2ISO A;  7ICK A;  3C21 A;  4F4Y A;  3PSI A;  5EOZ A;  1RYU A;  4OJ5 A;  2VA8 A;  4M9L A;  4A8E A;  2F1H A;  8ICQ A;  2IBK A;  4XQ8 A;  4F3O A;  1O03 A;  4J9M A;  3IG8 A;  1UA0 A;  3UXO A;  4Z6F A;  4ECQ A;  3IP4 B;  1QLN A;  4NLC A;  3CW2 C;  1ZET A;  4J9P A;  5KG1 A;  3WKD A;  2OWO A;  1NK5 A;  1TE2 A;  1S8O A;  1QSL A;  4OJO A;  4KX3 A;  2AQ4 A;  3QYP A;  1BGX T;  4JUZ A;  4F91 B;  2A1A A;  5J0U A;  4OJL A;  7ICQ A;  9ICQ A;  4KN4 A;  3O0F A;  2NYV A;  3T5K A;  1HUZ A;  4KLF A;  4RZR A;  1XNS A;  4F50 A;  3F5A A;  2MAX A;  4C4T A;  1NZB A;  4RQN A;  1RYR A;  4C4R A;  5DG8 A;  8ICR A;  5KAI U;  3N7S C;  4M9N A;  4ECY A;  4US8 A;  3H0R B;  2EZY A;  9ICW A;  1PK3 A;  3SEN A;  3SYZ A;  3IG5 A;  3C1Z A;  5KT2 A;  3UM9 A;  2HSZ A;  4BUG A;  3EPI A;  2UVR A;  4J9Q A;  1ZRM A;  3JPO A;  1ZQV A;  2FMS A;  3F2C A;  2C22 A;  5J0Q A;  1HEK A;  4C8K A;  4QW9 A;  2PMZ F;  3JPT A;  1SKR A;  3RR8 A;  2N1R A;  3UXP A;  3HX0 A;  2DFL A;  1NJW A;  3TAQ A;  2WHE A;  3H40 A;  9ICN A;  2XCP A;  4R64 A;  2E8M A;  4CGZ A;  2XY7 A;  4IQV A;  3UXN A;  4P0P B;  4C8M A;  4MF8 A;  4EZ6 A;  1M6Y A;  2PI5 A;  3QU7 A;  3AMZ A;  5IIK A;  4PHA A;  2KFN A;  3ZD9 A;  4B9S A;  5DQH A;  4F5N A;  9ICV A;  1KBU A;  3KD3 A;  2HHX A;  4I27 A;  1NK6 A;  2P35 A;  5HNK A;  5KG7 A;  3HKZ C;  7ICH A;  3V7J A;  1KFT A;  3QEA Z;  8ICZ A;  4XRH A;  1RZT A;  4JV1 A;  1WWV A;  5JTI A;  4Q43 A;  2HHW A;  2KK0 A;  4Z6E A;  3RJI A;  5KG2 A;  2IOF A;  1ARO P;  2ALZ A;  4EYI B;  5G5H A;  4P4P A;  2K4P A;  1KQQ A;  3NAS A;  2WF8 A;  1XO0 A;  5DKW A;  2NRV A;  2Z7J A;  3UMG A;  1ZJM A;  3PMN A;  3Q8R B;  2RHF A;  1RDF A;  4GLX A;  3A0H U;  2W7P A;  4ED2 A;  1L3S A;  1U4B A;  5D4B A;  3AL0 B;  3LWM A;  4RUC A;  2W3R A;  5HHH A;  4PH5 A;  1LV5 A;  4DO9 A;  3OPX A;  3E2E A;  5EE9 A;  2EAM A;  8ICM A;  1S0V A;  2E1F A;  1PVR A;  4EX6 A;  3G6Y A;  5AKH A;  4RU9 A;  3WU2 U;  5J2G A;  5DBA A;  1T7P A;  1O08 A;  8ICH A;  3EWA A;  2HBM A;  5KFC A;  1RPL A;  1D8L A;  4QZB A; 
#chains in the Genus database with same CATH homology
 2JMG A;  2HOQ A;  2HBL A;  1DRG A;  3C29 A;  2HOF A;  3NUQ A;  1URJ A;  3M7D A;  2G07 A;  2YB4 A;  4U6P A;  2K4I A;  1WUD A;  3F2C A;  2G09 A;  1HEK A;  2W04 A;  2PMZ F;  4PL2 A;  3LVV A;  4CRX A;  2N1R A;  4WJ3 B;  2OYY A;  2VKQ A;  4JMU A;  1ZQ1 C;  5A0L A;  3LYS A;  2KV2 A;  1CRX A;  3L3F X;  2CN1 A;  2F76 X;  3LVW A;  2NV3 A;  2VJ4 A;  3N7P D;  4KX5 A;  2XVT A;  4QNL A;  2ZIV A;  3SAH A;  2ZIX A;  3H0M B;  4CGZ A;  2CPR A;  2DGZ A;  3ALR A;  3MGV A;  3SAG A;  1Q3V A;  2DF4 B;  2LBO A;  3DEE A;  4GFJ A;  4NLB A;  2OH2 A;  4P0P B;  2PMZ C;  1ECW A;  2KHQ A;  4QIW F;  2RP5 A;  5T14 A;  2KIW A;  4NV0 A;  2GOL A;  3HKZ F;  1SZH A;  2JGA A;  2K4H A;  4FE3 A;  2Y0S F;  4IC9 A;  4OJ6 A;  3PSI A;  1GO3 F;  2KOB A;  3ICX A;  2ZIX B;  2JHD A;  3PZP A;  2BDU A;  3KFU F;  2F77 X;  2LHT A;  4OJ5 A;  1KBU A;  3RF9 A;  2HOI A;  2A3V A;  2KVC A;  1P7D A;  3D2N A;  4A8E A;  2Q4T A;  2ZIW A;  3CYM A;  3F2D A;  4NWI A;  2YX8 A;  3HKZ C;  3CRX A;  2K8B B;  4PL1 A;  1OUQ A;  2Y0S C;  2W03 A;  2HBK A;  3C28 A;  2LYA A;  3AQF A;  1TAM A;  2KIC A;  3IG8 A;  2KHV A;  2HMX A;  3GU3 A;  2H3Q A;  3SQI A;  1PVP A;  3E0F A;  2D6F C;  2ZIU A;  1ED1 A;  5HR7 A;  2F8L A;  2KJ5 A;  3IN5 A;  3IP4 B;  4NLC A;  3F2B A;  1A6S A;  2WB1 F;  2K8A A;  2ZIW B;  4BX9 C;  2H3I A;  2HBJ A;  2RRD A;  3D2S A;  3K1Z A;  5KL1 B;  2M0N A;  2GH1 A;  4FZM A;  3PST A;  2ZIV B;  2KKP A;  3M6K A;  2DQN B;  2KNJ A;  1YT3 A;  1XO0 A;  2LYB A;  1Z19 A;  1PVQ A;  2CRX A;  2JH1 A;  3T79 A;  2ZIU B;  2G08 A;  2ZG6 A;  4OJO A;  3VCB A;  3PSF A;  2Z7J A;  2F2A B;  4BJQ A;  4KX3 A;  2JH7 A;  4QJF B;  4CDG A;  4QIW C;  2G5I B;  2XIC A;  4U7C A;  1Z1B A;  2VJ5 A;  2WB1 C;  3F53 A;  2YB1 A;  3VC8 A;  3GZF A;  2RHF A;  2W7O A;  3ONN A;  4OJL A;  2WAQ F;  2G0A A;  2R18 A;  3RFA A;  4AYB F;  2K4E A;  2W7P A;  2OXO A;  2KJ9 A;  1T94 A;  2H3F A;  4KMO B;  2KEY A;  2H3Z A;  3O0F A;  2K89 A;  3AL0 B;  2KD1 A;  2LKY A;  2ZXI A;  2E5S A;  2H3V A;  4OO1 J;  5HR6 A;  1UPH A;  1MA7 A;  4OJP A;  3PSP A;  4FZL A;  4P0Q A;  1XNS A;  3F5A A;  3AQE A;  3OPX A;  2G06 A;  2K8C B;  2KJ8 A;  2MRL A;  3SAF A;  3F5E A;  1NZB A;  4C0Z A;  5KL8 B;  4P0P A;  4O3M A;  1IIP A;  3N7R C;  3N7S C;  2E1F A;  2VIX A;  1Q3U A;  1PVR A;  3KZX A;  2OM6 A;  3H0L B;  2WAQ C;  3H0R B;  1HIW A;  2E1E A;  4AYB C;  4FZN A;  2ZXH A;  3D2Q A;  2KKV A;  3M6Z A;  1F44 A;  4P0Q B;  5CRX A;  3IG5 A;  2MA1 A;  2XI9 A;  3CP8 A;  4ICA A;  1L6N A;  4ACO A;  2HBM A;  3SMV A;  4BUG A;  3NRW A;  1D8B A;  2XID A;  2G5H B;  1A0P A;  5C0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...