2HHXA

O6-methyl-guanine in the polymerase template preinsertion site
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
579
structure length
574
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 205
structure length 574
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhxA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhxA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhxA01
4YD1A 1WN7A 4TQSA 2ASJA 1X9SA 4BXOB 3C95A 4F5RA 1ZQMA 4KREA 2FMQA 1SKWA 5KRTA 2YNIA 4CJSA 5KFFA 4F4YA 4M0AA 3V1RA 3PR4A 2D0CA 2XY7A 3LWMA 3NF6A 4Y1DA 2BQRA 9ICFA 3VQ8A 1LWEA 4E7IA 4EBCA 4NLGA 4QWDA 1LWCA 3TANA 2QKBA 4M6WB 4FLYA 3RBDA 1L3SA 9ICQA 2W9CA 4RW8A 4IRCA 4CF8A 2P1JA 4AHSA 3M8QA 3EYZA 4O3PA 4AHTA 5DB8A 2ATQA 8ICCA 3LP0A 4Z4FA 5KT3A 3V72A 4GC7A 4M2YA 1RBRA 2FBVA 3DLHA 4KTQA 3SV3A 2IMWP 2A1SA 3L3VA 3AO3A 4H4OA 5J0YA 3ZT4A 4B9UA 4Z4IA 7ICFA 1VSFA 3HM9A 3AVKA 3QNOA 2W9BB 1ZQRA 7ICRA 5F9LA 3NF8A 2OPQA 3IG1A 2NRXA 3QO9A 3C5FA 4DL7A 5IIMA 4FLVA 4RQ4A 5HBMA 1ZQTA 2XO7A 4J2AA 5SZTA 1O1WA 2PY5A 3QEAZ 2IHMA 1X2IA 5KFXA 4DMNA 4N76A 4I7FA 4KLEA 7ICLA 3RJGA 1X9MA 4CHNA 1S1WA 3ULDA 4QZHA 2C2RA 4NLKA 4FJXA 3VQ5A 2V4QA 3KK1A 2AU0A 1UT8A 4KB1A 4EP5A 4JWMA 3MGIA 4KLDA 3QNNA 3SZ2A 2XCPA 2RPIA 3BQ0A 5J2BA 4KHUA 4DTUA 2ZTCA 2YNGA 3OGUA 1NKCA 4DU3A 4RQ3A 4O4GA 4NYNA 3PW2A 1QLNA 1U9LA 2BGWA 1TL3A 7ICHA 4CGGA 2FBTA 3EW9A 5KG1A 4YFKA 1LV5A 1BPZA 5KT2A 3B6PA 3K75D 1HJPA 1ZQIA 3S3OA 3Q8LA 4E0DA 5L1JA 4DQIA 3Q8SB 4CJ3A 1ZQYA 2WOMA 2XGQA 1RBUA 1S77D 8ICAA 4L8RB 2VG6A 4FJLA 3C2KA 5F9NA 5D3GA 4LH5A 3SPZA 4DTSA 2IA6A 5C5JA 1MU2A 2PFPA 4FLZA 8ICNA 2KZMA 1PZNA 3SUQA 1NKBA 5KGWA 3SQ0A 1MQ3A 4QZEA 4DL2A 5KFHA 4R66A 3OHAA 4J9PA 1RTDA 4OPKA 2FBYA 1JLFA 9ICPA 3NGIA 4CGDA 5DDYA 4DF4A 1KVBA 4GLXA 1QSSA 2XRIA 4EZ6A 4CJFA 5D46A 4QZ8A 1RNHA 1DGSA 4QZFA 4ECRA 3DLKA 3UXPA 2O4IA 4P2HA 9ICOA 3QLHA 1KRPA 4DOCA 3RJJA 1U47A 3DI6A 1RILA 4FW1A 4I2BA 4O3NA 3OS2A 4J9OA 7ICTA 1C0TA 5J0SA 4YXMA 3DOLA 4QOZB 5J0RA 3KK2A 1KLMA 1BISA 4E1NA 2HHTA 4CEQA 3DOKA 1BPYA 1REVA 3VQPA 3HPGA 5J2EA 4P4OA 3OYJA 1TK8A 4FCYA 4M3XA 4DTOA 2NRZA 4PGXA 2F1JA 3RB3A 4E7JA 2AJQA 3B0XA 3AVFA 3WNGA 3KHRA 4C8OA 5L1KA 2FMPA 4BGDA 3ZSYA 5HHIA 4QZIA 2IGIA 5JS1A 4AHRA 4M47A 3AO5A 4DS4A 4YMOA 4I2QA 3QINA 1JN3A 4MFAA 4RNNA 4DSLA 4Z6DA 4BDZA 4KLHA 9ICSA 4BXOA 1HQUA 3MR2A 1Y97A 3OYKA 5KFZA 1WSEA 3OS0A 3PMLA 1NK0A 7ICPA 3GIJA 3IAYA 3RMDA 3JSMA 5D4BA 2W8KA 4CJPA 1WAJA 3OJUA 1TKZA 4CEDA 4Q5VA 5EWGA 1C6VA 2YKMA 4EZ9A 3LP2A 3SQ4A 4KFBA 1XHZA 3WNEA 4XUSA 5HRSA 2G8KA 1RT3A 2P51A 3RRHA 1ZYQA 4KAZA 1B43A 3V9UA 4C8KA 2HHSA 1WSJA 1VSKA 3TAQA 4UB2A 1RTHA 8ICVA 4CEAA 1KTQA 3H08A 1TV9A 3KKRA 1KVCA 3ZDDA 2IOCA 4YCXA 1SKRA 1J54A 1RYSA 1C1BA 4FS1A 4K8ZA 3PV8A 4BDPA 1EKEA 1J9AA 1FXXA 3CM6A 3F73A 5DG7A 4CGFA 4CJUA 2D5RA 1T05A 3LAMA 3ZT0A 3HJFA 5CYMA 1Q9XA 5CJ7A 4CJVA 1W0HA 2PI4A 2B4JA 5KT4A 3MBYA 2XGPA 3GQCA 1CUKA 2W9CB 4RNOA 4R64A 3NF9A 2JGUA 1ZQXA 3JPPA 3GV8B 3V9ZA 2P5GA 2ALZA 3LP3A 2P6UA 2PXIA 2BR0A 2HVHA 1TGOA 3G6XA 1F21A 5J2JA 4BE1A 4ELVA 3K4GA 4KLOA 1LWFA 3KKSA 4BE0A 4E1MA 3OYNA 3DLEA 1DOQA 1VRUA 4YFUA 2HMIA 3MEEA 3ZT1A 4R5PA 4EP4A 3SUPA 3HT3A 4W5QA 1WSFA 2BCQA 1AROP 4QW9A 2NRWA 4OLBA 2FMSA 4CF9A 7ICSA 2XC9A 4KLJA 3CYMA 4M04A 5TZVA 9ICUA 5DG8A 2J6TA 2P6RA 4MQ3A 3HP6A 5C24A 3AA4A 4DO9A 3QEXA 4QWBA 4R8UB 2OPSA 4O5CA 2DPIA 3DM2A 4K8XA 2YNHA 3AO2A 5J0UA 3MABA 2GBZA 1JL2A 4M9HA 4OVLA 5KFAA 5KT7A 5EWFA 3KLIA 4KN7A 4X5VA 4FJGA 3MAQA 5DBCA 3DYAA 1C1AA 3TAPA 4RZRA 1TKTA 4FJMA 3D45A 4CHOA 1S1XA 1IH7A 5DK5A 3NDKA 4MF2A 1V9PA 3GV7B 4MEYA 4HYKA 4CERA 9ICMA 8ICZA 4NCAA 4JV2A 1TVRA 1DLOA 1BHLA 3NGYA 1ZQGA 2ZUDA 5KFCA 5KFBA 2ZUCA 4O55A 1WSIA 5KG4A 4KB0A 1U48A 2NRTA 1S6QA 3C94A 1UAXA 3ZSRA 4KI4A 8ICWA 4Y1CA 4F8RA 4B8CA 3K5OA 1HUZA 3NGDA 3AVJA 4HUGA 2ASLA 3EWAA 1FKOA 3BQ2A 2PFQA 4O3SA 3OYBA 2W8LA 1TFRA 2P5OA 4RU9A 4I2GA 8ICFA 1RBVA 4RW9A 1LW0A 4KHQA 4KLFA 1C0UA 3ASMA 1VSMA 3AVAA 8ICPA 4GMJB 2BHNA 4JS4A 2V9WA 8ICGA 4UB3A 1KSPA 3SI8A 4NLZA 5KFVA 2Z1GA 3TFSA 4RW4A 2BANA 3RJIA 3VQ4A 3MFIA 4JLHA 1RT2A 3RH5A 1S9FA 4QWAA 4ID1A 1WLJA 4RUCA 2KFNA 4B08A 3AVBA 1NOYA 1ZQSA 5HP4A 2IBKA 1WSGA 5J0OA 4MFCA 5L9XA 2XHBA 1SKSA 1D8LA 8ICSA 9ICRA 4M3UA 4I2CA 2X6NA 3VQAA 2PFOA 1LB2B 1ZQUA 4MFFA 2ASDA 5JS2A 4W5RA 3PNCA 1WSHA 3AVLA 3S3MA 5KT6A 3V9XA 5DQHA 4R65A 9ICAA 3JPNA 3RRGA 4M41A 4YVZA 4P4PA 3PY8A 1RDAA 1IKYA 4CCHA 9ICVA 4YN4A 2RKIA 4CIFA 4UQGA 2BPGA 3AA3A 4I9QA 5BOMA 1KLNA 4RT2A 3ISBA 3VQDA 4K4HA 1DTTA 2G8UA 2BE2A 3RH4A 5J2FA 4E89A 4RQ8A 4F5NA 4QZ9A 3BGRA 3MR5A 4I2IA 1NK7A 1BCMA 2XCAA 4RT3A 4YXJA 3FFIA 3NH2A 2C2EA 4CHQA 4AHCA 4EYHB 3PX4A 1BI4A 3O3HA 5EU7A 2IAJA 1JLCA 4BWMA 3U3YA 4GXKA 5J0WA 4CEZA 2FPKA 7ICVA 8ICEA 1HYVA 3NTUA 4PGYA 4ECXA 2KW4A 1VSEA 3QIPA 8ICLA 2HW3A 4KKOA 4CFDA 3V7LA 4PQUA 3NH1A 1TVAA 1KVAA 4Z6EA 4PH5A 4QWCA 4GXIA 1S1UA 3KJVA 4IRDA 3OYMA 3C21A 1XHXA 3HXMA 1WAFA 5FDLA 2FLPA 3UQ0A 3MGHA 5J0TA 4TURA 1RXWA 4CFAA 1S0MA 1TK0A 4F3OA 1ZQPA 1KDHA 3T5LA 1CXQA 5KFYA 4ECUA 2ZE2A 7ICMA 2XY5A 3AO4A 1ZQLA 9ICGA 1WNSA 4DL3A 1RT1A 2JEFA 2OA8A 1ZBUA 4PWDA 3NHGA 3ISNC 1LW2A 9ICJA 3GDXA 3OYLA 5HP1A 3K5MA 2R8JA 1FK9A 4FZYA 3C23A 4FO6A 1ZQJA 1L3VA 2F1IA 3THVA 3PO4A 5CYQA 3QESA 1NK4A 3AVCA 4K4IA 4F2SA 4DL4A 4R8UA 2B6AA 7ICOA 9ICWA 2JEJA 5KG5A 1BPEA 1CZ9A 2YV0X 5DGBA 2C2DA 1SZPA 4J9MA 1VSDA 2R8HA 4DTNA 4UB1A 3WNHA 3AVGA 3O4NA 4ED1A 2VANA 2Z1JA 4RW7A 4J9QA 4F3TA 2ZTDA 2XY6A 3AU6A 1KFTA 1JXEA 4I2JA 4KHNA 4CIGA 4F50A 4J2BA 4M3TA 4KMUA 4KLLA 1KFSA 3HPHA 5KG0A 4HUFA 3TR8A 2OPPA 3MFHA 4FM0A 3PX0A 2HHXA 5L1LA 3NCIA 1C0MA 3SCXA 4CEFA 5CZ1A 4FS2A 4CJQA 1HJRA 4CE9A 1RPLA 2HB5A 4YR0A 1GOCA 5HRNA 5KFNA 4CIEA 4MFBA 5CWRA 1K1SA 4M9JA 3OSNA 3IHQB 3D0PA 3PMNA 4ED8A 3RB4A 3OJSA 5KFUA 1N48A 3C2MA 1RTIA 3QETA 1HMVA 3NFAA 1XSNA 2C22A 4KO0A 2KZZA 1S0OA 4NCBA 2E4LA 2IHNA 4QW8A 4MF8A 5KFKA 1S76D 1ZJNA 4YMMA 3RMAA 4J2DA 2V4RA 3H4DA 3VQEA 2E6MA 2A1RA 1BPBA 7ICIA 3OHBA 4RPYA 3TI0A 3AUOA 2R8KA 2BKEA 3OY9A 1RDDA 4FJNA 1EXNA 3ZSZA 3EPGA 4FJ9A 1NKEA 8ICKA 8ICIA 1Q8IA 1UA0A 3FDSA 3ORYA 1BIZA 8ICJA 3AA2A 1BIUA 1D9FA 9ICKA 4B9SA 3TABA 4HTUA 1TKDA 5HMMA 2HHUA 5I3UA 5KFMA 3MXJA 4EEYA 5J0PA 4O5BA 4UBCA 1KEJA 1QSLA 1X1PA 2G8IA 1KFDA 3VQ7A 3VQCA 4C8MA 4F5QA 3ISCA 1I3AA 1YVUA 3ALYA 1NK9A 2DPJA 4I2FA 4AH9A 5KFQA 3DLBA 3HL8A 2W9MA 3V1QA 4FYDA 3NH0A 2R8GA 4CF1A 5DDMA 4CEEA 4IG3A 1S97A 5J2MA 3GFKB 4OLAA 4DFKA 4QZDA 2ZUBA 4DFMA 4RW6A 2IC3A 4YNQA 4QZAA 3OYCA 4M3WA 9ICHA 3M8RA 9ICNA 3AV9A 3SNNA 3SV4A 1D9DA 2Z1HA 3Q8PB 3EZ5A 1XSPA 3LDAA 3F9KA 7ICGA 2FC0A 4I9LA 3AO1A 1U49A 4DQQA 4B9MA 3OYHA 4XIUA 1L5UA 5CA7A 4HVJA 4IQUA 4RQ6A 4DL6A 2XY8A 4JWNA 8ICTA 4ECZA 4IQTA 3UPQA 3SQ2A 4TSXA 4OGCA 1C1CA 2DFEA 3RTVA 4UB5A 4YMNA 2KFZA 3O4QA 2AQ0A 5EWEA 4N41A 4J9RA 1XS9D 5IILA 1XWLA 4I2AA 3M9NB 2BCSA 4CK1A 3QEWA 5DLFA 1TAQA 3M8SA 4CGHA 3H8WA 2I9GA 1IM4A 3L3UA 4Z4HA 1ZBHA 2AGPA 4ECQA 1SV5A 4KTZA 4F4KA 3MR6A 2QXFA 4TQRA 4FBUA 1BI4B 1TKXA 2BQUA 4O5KA 2FLNA 3OVNA 4RNMA 3ZDAA 1HQEA 2FPMA 4ID5A 4Q8EA 4CESA 4JRPA 3FYHA 3AU2A 4ECTA 2YHAA 4LZGA 2VA8A 4ZTJA 1JL1A 4KHYA 4PHDA 4KV8A 1RZTA 4RQ0A 2WONA 1N6QA 4FZXC 1T3NA 1JLEA 3TAGA 1NJWA 1UWBA 3HO1A 1B9FA 5KG7A 1XC9A 4ECYA 4HHTA 4CEBA 3I8DA 9ICIA 4C8LA 1EP4A 4LY7A 5DKWA 4IKFA 5I42A 9ICCA 3TAMA 1JLGA 4DS5A 3QIOA 1GOAA 2GV9A 4G1QA 3QERA 4DFJA 4UAYA 2ETJA 4GXJA 2G8VA 3K58A 1GOBA 5J2HA 3QEIA 4LSLA 2Y1IA 2R8IA 4RUAA 1LAWA 3MEDA 4KPYA 4IDKA 1S9GA 1UOCA 2F1HA 2HHQA 3C1YA 5L1IA 5CP2A 4FLXA 4Q8FA 4FJ7A 1ZQEA 3ZCMA 1CXUA 5D49A 3EPIA 3OYFA 3KLFA 3RBEA 8ICYA 8ICXA 4NXZA 4XQ8A 3K57A 4B9LA 4DSKA 5DLGA 3L2WA 2DTUA 3RR8A 3V9WA 4E7LA 1SUQA 3E2EA 2OZMA 2PFNA 9ICBA 3PR5B 4XRHA 4BDYA 2FBXA 3ETLA 2OYQA 4Z4GA 2BCUA 4JRQA 4ZH4A 2VG7A 4QZBA 4JS5A 1IG9A 3SJJA 4KN4A 3RB6A 1NK5A 4YG2A 4PHPA 1ZJMA 4IFVA 3RJEA 1TL1A 5CB1A 3MDAA 2Y1JA 3TWHA 2GUIA 2PI5A 4YR2A 5IINA 4IQWA 2WTFA 3MECA 3LZIA 4DG1A 1S0NA 4UAWA 3VN5A 3G6VA 1JLAA 4DFPA 1EXQA 5J29A 1CLQA 4KLUA 3O3GA 7ICJA 4ED0A 5KFLA 4F4XA 5J2DA 3NGZA 4EBEA 1IKXA 4BE2A 3CM5A 4CJWA 3KD1E 1SL0A 2LSNA 3SYZA 7ICKA 2DFFA 1VSLA 1ZQZA 3UXNA 3DRRA 3PW0A 1HPZA 2ISOA 4GC6A 3HK2A 3HWTA 1VK0A 1Z3EB 4I28A 3PW5A 1T8EA 5C25A 4M9LA 3PVXA 5KG3A 1JKHA 4C8NA 4NM2A 3BQTA 4PPXA 4OJRA 3V1OA 1J5OA 4CFCA 4RQ2A 1RT7A 3ZSXA 1WCNA 2X74A 4I29A 7ICNA 4ICLA 1NK6A 1JMSA 1TV6A 4KLSA 1YTAA 4FLTA 4O0JA 5E41A 4MEXA 3V7KA 3H8SA 4TUQA 3VQ6A 4K4GA 3Q8RB 4Q43A 2O4GA 2B21A 5J0XA 2D0AA 4FLWA 3RB0A 2FLLA 5KFJA 3HPOA 1EX4A 3LANA 2M9NA 4ED3A 3JPQA 4N56A 4OKEA 2HHWA 5J2QA 3P83D 5HHHA 2UVUA 8ICMA 4LD0A 9ICLA 3ISDA 3IS9A 4FVMA 2A1JA 1RDCA 4DTJA 8ICRA 3VQ9A 3BDPA 1IKWA 4H4MA 3IM1A 1KCFA 1Q9YA 3SPYA 3WNFA 5BOLA 5J2PA 1ZQWA 4RPZA 2DFLA 4DU1A 1JX4A 5J2CA 1CEZA 2FPLA 5KFDA 2HNDA 2ATLA 2MAXA 4DOBA 2KTQA 4HCCA 3H40A 2RDIA 4DSJA 2IDOA 4PHEA 4FJHA 2YHBA 2HVIA 3RAQA 5KTQA 3OSPA 3QEPA 1RT4A 1Z00A 1B9DA 2JZBA 5J0QA 7ICUA 2KZ3A 4CJKA 3L2VA 4F91B 1ZQFA 1NOZA 3KLGA 4DQPA 1CZBA 4QWEA 3L8BA 4RPXA 5HLFA 2VA2A 4ED2A 3CFPA 4NM1A 5KFEA 2Z1IA 4B9VA 1Z26A 1COOA 4DSEA 2UVRA 2OZSA 3DLRA 3E01A 5K14A 5DG9A 1N5YA 4ED7A 4FZZA 2PYJA 4QAGA 2C28A 3OYGA 5KFTA 1HNVA 1T03A 3TAEA 2BGGA 3T3FA 3RR7A 4M45A 5CY4A 3AVHA 3S3NA 3PO5A 4Z6CA 1A5XA 1A76A 4DL5A 1XSLA 3C6UA 1ASWA 4F93B 3M9MB 3LP1A 3RJHA 5KT5A 4I27A 4YQWA 4FK2A 5DB9A 3V6KA 2BCRA 1A5WA 4TUPA 3HVRA 3Q8MA 1IO2A 3NAEA 5HROA 2F8SA 3G0ZA 3OYIA 2BQ3A 1BQMA 4I2EA 1ZQDA 5BPCA 4G3IA 1RYRA 1B22A 3T1AA 5KFIA 4QZCA 4J9SA 1QHTA 2Q0ZX 4UBBA 3B6OA 3AA5X 2NUBA 4IG0A 1L3TA 3DRPA 4B9TA 2JLEA 1U4BA 3N97B 4O9MA 4CJ5A 5CHGA 2VG5A 3BQ1A 1S1VA 1BPDA 4WE1A 5HRPA 3OYDA 4RQ7A 3A2FA 5FRNA 1S1TA 5J2IA 2IS3A 5J1EA 4BWJA 3V4IA 1ASUA 3OYEA 4CHYA 4FJKA 4DSFA 1ZQCA 1BVSA 3LAKA 1I39A 4IFYA 2YNFA 2BPCA 4DTRA 4O3QA 4O5EA 2F96A 4DQSA 3OYAA 1EETA 8ICBA 3MEGA 1ZQNA 3V7JA 3JPSA 3K59A 3TAFA 4M3ZA 1ZQAA 2ZJAA 4N5SA 1NJYA 3BJYA 3SUOA 3V6HA 3RAXA 4KRFA 5SWMA 5J2GA 2EX3A 5EOZA 4TUSA 4UAZA 3H7IA 2ZJ5A 4OKJA 1BGXT 4J9KA 4KLGA 4CEOA 3VA3A 3ZD8A 4Z0UA 5KFPA 1HRHA 2KQ2A 4ECVA 3ZD9A 4FJ5A 3K2PA 1RT6A 4KTWA 3U3GA 2X78A 2W42A 4DLGA 2ZJ8A 1U45A 2AGOA 2ZTEA 3KHGA 5DB6A 2G8HA 4PGQA 4ZTFA 2ITGA 2ZQBA 3KHLA 4NYFA 3RMCA 1A77A 2YKNA 1QTMA 3DRSA 3S9HA 1S5JA 1ZBLA 4KITB 3K5NA 2PYLA 1DTQA 5KRSA 2F8TA 3ZDCA 4W5TA 3PX6A 1Y88A 4FM2A 4M3RA 9ICEA 3DLGA 1TAUA 4PY5A 2BCVA 3P5JA 4KLIA 4PHAA 2MUTA 4FW2A 3GILA 5IIIA 2QKKA 5KFGA 4IR9A 1ITGA 4DU4A 1BL3A 1ZQBA 2ZD1A 2QK9A 3JPTA 2Q3SA 5KG2A 1K6YA 3C1ZA 3HP9A 1ZQHA 3CQ8A 3OS1A 4FJJA 3MXMA 3SI6A 1RBSA 2RN2A 3CFRA 3MXIA 2D0BA 3RJFA 2R7YA 3B0YA 4XA5A 4FM1A 4LSNA 4Q0BA 3IRXA 3LPTA 3NE6A 3ZSWA 1RBTA 4CF2A 1YT3A 4FJ8A 1WCLA 3KK3A 5KI6A 2UVVA 3Q8KA 7ICQA 4M9NA 3ZSQA 3ZT3A 2I1QA 1ZQKA 3QEVA 1IKVA 4CJ4A 1VRTA 4FK0A 8ICUA 4F4ZA 4FJIA 2HNZA 3H8JA 4R63A 1VSHA 2EHGA 1ZQOA 2A1JB 3KHHA 4HCBA 4I2PA 4E7HA 4DTXA 1QQCA 1L3UA 3QZ8A 4JUZA 1RT5A 2VWJA 4I2DA 4ECWA 4O3RA 4CK2A 3RMBA 5DMRA 3N4MB 2DY4A 4Q45A 3LWLA 3MR3A 1XU4A 4CFBA 5KFRA 3KLHA 4IR1A 2G8FA 1T4GA 3ZDBA 3LALA 5IIOA 3L2QA 3TFRA 2HHVA 1A5VA 2DFHA 4M6WA 4B9NA 4F4WA 2RDJA 4J9NA 1Z00B 4F92B 3LPUA 3P1GA 4JV1A 2ISPA 4NY8A 2JZBB 4DTPA 1QE1A 4F2RA 8ICOA 4E3SA 5C42A 1NK8A 5J2AA 3UQ2A 3HW8A 4ELUA 4YP3A 4PA1A 1ZBFA 1RXVA 5J2KA 5KGXA 4FXDA 3RWUA 4CJRA 4Z6FA 4RG8A 4J2EA 9ICXA 4W5OA 4W5NA 1K1QA 1HUOA 3C2LA 2W9BA 1VSJA 3ZDEA 4JV0A 3HVTA 4ED6A 2BDPA 3TQ1A 4HUEA 1ZETA 4I2HA 4ELTA 1BPXA 3O3FA 5HNKA 3V81A 2AQ4A 1NOMA 1QS4A 1B92A 4LH4A 3UIQA 4M3YA 4DLEA 3V6DA 5J2NA 4FK4A 3MDCA 4PUOA 4EBDA 3HSTB 2JEGA 4DEZA 5CR0A 4B8AB 4CGJA 5IIJA 1X9WA 3RH6A 4AHUA 2UVWA 3KD5E 4GW6A 2NRVA 3T5KA 4GVMA 5HMLA 2PZSA 4DF8A 4N47A 1BCOA 3V9SA 4CF0A 4IBNA 4M42A 3GIKA 4O3OA 3M8PA 5DQGA 4QCLA 1RTJA 5KFWA 3VA0A 4F5OA 4KHSA 1JLBA 3KTQA 5CZ2A 1MQ2A 4DQRA 1MC8A 1UA1A 5DQIA 5DBAA 4DTMA 1XI1A 5KFOA 5DGAA 2B5JA 3RJKA 4M9GA 1SL1A 4Q44A 8ICHA 5HRRA 1S9EA 3LDSA 4P4MA 4DWIA 2I5JA 4EYIB 2VA3A 1SL2A 4UB4A 3G10A 1HNIA 3V6JA 1JXLA 3ITHA 3C6TA 4OGEA 5IIKA 3SQ1A 3PUFA 5JUMA 1JIHA 4F5PA 4NLNA 3C5GA 4DOAA 4ZHRA 8ICQA 3T5JA 1TK5A 3JYTA 4J9LA 2BPFA 4JK1A 4O0IA 1G15A 4DSIA 1NJXA 4FLUA 4IQVA 1S6PA 4AHVA 4KHWA 1S0VA 1XO1A 4CHPA 2W9AA 3Q8QB 1RDBA 3GIIA 3GV5B 3I0SA 1C7YA 3ZSVA 3T5HA 1JLQA 3GIMA 2RF2A 5DBBA 2VWKA 3ZT2A 1MSWD 4OPJA 3HYFA 5T7BA 4NCGA 4B3OA 1HYSA 1W9HA 2J6SA 1D8YA 3AVIA 3JPRA 3UXOA 1R0AA 3DMJA 3L2UA 3TARA 3M9OB 2E6LA 4AILC 3EY1A 2J6UA 4KI6A 4YD2A 1Z25A 5KFSA 2H5XA 3CFOA 4O44A 3QEBZ 3PW4A 1N56A 1S10A 3L2RA 4FBTA 1ZBIA 1QSYA 1FKPA 4KLQA 5KG6A 4KLMA 3VQQA 3U6FA 1ZQVA 4KLTA 2OWOA 3I0RA 5DB7A 2KN7A 4CJTA 3LZJA 2P66A 1ASVA 3H4BA 1H38A 7ICEA 3NBPA 2MUTB 1NJZA 4IRKA 3T19A 4H8KA 5FRMA 4LZDA 4CGIA 3ZSOA 4RQ1A 3VQBA 1HYZA 4LVSA 9ICTA 2AGQA 4E7KA 4E19A 3NF7A 2GWSA 4Z4CA 2X6SA 3SUNA 3HX0A 1BQNA 3KIOA 3LK9A 1ZQQA 4CK3A 1LAVA 4CJEA 5FROA 1U04A 2HNYA 2LYHA 4ECSA 1JXBA 1RCHA 3QZ7A 3CG7A 4Z4EA 3JPOA 3PW7A 3KLEA 1IXRA 3QE9Y 4YR3A 1VSIA 1J53A 1YTUA 3AVMA 2JEIA 4CECA 2G8WA 4QZGA 4CJLA 1D5AA 3AVNA 4OKKA 4CHZA 3G6YA 1T7PA 2OPRA 4RQ5A 4BACA 1UT5A 3K5LA
chains in the Genus database with same CATH superfamily
4LR8A 3D7EO 2FHKA 1V3ZA 3W2WB 1ZQMA 4KREA 1SKWA 2G0JA 5KRTA 3I32A 3J7ZT 3QBCA 3TNVA 4OI2A 1JROA 3ZO7A 1AFJA 3KLHB 1N0VC 1FXLA 9ICFA 3VQ8A 4NL5A 2KB2A 3NASA 1WKJA 3MAAB 1LWCA 1HBOA 4J90A 2QKBA 2GX8A 2E5LJ 4IRCA 2P1JA 5BPNA 5J8YA 4ANDA 4OPAA 2ATQA 1U0SA 2B4OA 1FJCA 3AH6A 1VQOS 5I3PA 1I6JA 1HI0P 4K43A 2LECA 3VCDA 3V72A 1O0PA 2UV8G 2E1AA 2E1FA 3SV3A 2GH1A 4URQU 2E8PA 3EGWB 4H4OA 3UDLA 2F9TA 1SC3B 4B9UA 4FPIA 4Z4IA 5E3QA 3HD1A 3FSIA 1T05B 3QUCA 1ZQRA 1PAEX 4PJ0U 1X8DA 5F9LA 2JHEA 4ICAA 2GW8A 4ISGA 2NRXA 3I55S 3QO9A 1FFSB 1KOOA 5IIMA 3VGTA 3GYGA 2YN4A 3JXOA 2XO7A 5IT9O 2GWJA 2E7VA 5IQ6A 5GMKa 4B3MJ 3QXGA 4FP9A 5H9FJ 2IHMA 4OL8A 4M7YA 5ELZA 3CJ2A 2D3OR 1QJHA 4CO2A 1KW4A 1RHJB 3CERA 3VQSA 4A57A 4X64K 2AU0A 3QNWB 4ZPTR 2MHNA 2E5JA 4A8XA 4BRDA 1DQAA 2B9WA 2IA0A 4HLBA 2MKCA 5J2BA 4KHUA 2DRBA 2XSFA 5AKYA 2Z56B 3OGUA 3C65A 1S3XA 1Q5YA 4Q7AA 3VF0B 2BGWA 2X1AA 4GY2B 1H2VZ 4CGGA 4U8VA 5LJVA 2OTJN 3ZNUA 3H3NO 3LH2S 4IO9Q 4M5DA 1VQ5N 3ILJA 1KVKA 1LV5A 3MTJA 3OVAA 5KT2A 4U7UK 3B6PA 2QL7B 3WKEA 1HJPA 4KE5A 3NAHA 2W7OA 3Q8SB 5KNIA 3QFUA 1S77D 2JC1A 3DNCA 8ICAA 1F60B 1C2PA 5ALIA 5D3GA 3SPZA 5C5JA 2VBWA 2KZMA 2NSBA 5KGWA 1FX2A 3SQ0A 3AY0A 3FZHA 1MQ3A 2OD6A 4Y2RA 5FLXO 5KFHA 4R66A 4J9PA 2F1FA 2FBYA 1JLFA 9ICPA 2ZIVB 3C6TB 3L7OA 2R7VA 4YMEA 1T02A 3NGIA 1U1LA 3UE2A 4DF4A 5AZJA 1B70B 5A8RA 4ZHRB 4GLXA 4MO4A 4EZ6A 1A6SA 2JFDA 3H0LB 4QZFA 4ECRA 2KJ9A 1UVMA 3D4JA 3DLKA 3UXPA 2O4IA 4CO1A 3VCBA 1R59O 1S6PB 1VLYA 2EKNA 4WU3A 4DOCA 2EW9A 1U47A 3DI6A 4IOCL 4CGZA 1RILA 4AXIA 1WG5A 2DHAA 1JLQB 1C0TA 7ICTA 5B66U 4I4BA 4OI4A 5H1SV 4NJ8A 3IAM9 3D7SB 4NCGB 4EUVA 1YJNS 4NEZA 5LSLA 4LFCK 2JVRA 2Y9UA 3IUCA 4ID8A 1YI2N 1Q8BA 1BISA 4E1NA 3DEEA 1FXRA 2P9PA 3CCQN 3DOKA 1BPYA 3CJ1A 2E5LK 4C8ZA 4JKGA 1Q8LA 2JXJA 4CYUA 4LF6F 4M3XA 1RWVB 2DHGA 2DO0A 4USHA 3IMXA 2J5AA 1L8LA 2LEBA 1NJIT 2AJQA 2GO7A 3KHRA 3M8WA 5L1KA 3I0RB 2ZH5A 3U1NA 3ZSYA 2NLWA 2ZKUA 4Y2KA 1ZZFA 1T6DA 4FNHA 1H7XA 3LDNA 3QINA 3M6ZA 3QIDA 4UUWA 4RNNA 4DSLA 1WUAA 1ACMB 2LLZA 3I9V9 4KLHA 4R0EA 4M63C 3H25A 5AM1A 4PG8A 5AM0A 3OYKA 3BR8A 5KFZA 4JKBA 4HR2A 1NK0A 4JI1F 1QY7A 5F1XA 3IAYA 5D4BA 5AQRA 1BQNB 2LU2A 5DETA 1NEEA 5K9FA 3OJUA 5H9FK 3KHYA 2MYFA 2YKMA 1F5CA 3CCTA 3LP2A 3SQ4A 4KFBA 2R3VA 3KLEB 4DR7F 4DV7F 2KYXA 1V3RA 2K06A 2V7ZA 3O2IA 4KAZA 4EEKA 3V9UA 1VSKA 4UB2A 4NRTA 1TV9A 3KKRA 4C80A 1SQFA 3ZDDA 1KVCA 3VALA 1KC8T 6AT1B 1EKRA 2XULA 3W61A 1SKRA 3CJRA 1P9QC 2VD3A 1C1BA 5HSPA 5ALDA 2NV3A 3PV8A 3SCLE 2YNIB 2IAJB 1CJTA 3CM6A 3F73A 3R8EA 1VQLN 2D5RA 3D6MB 2ZIUB 3JQJA 5A8KA 3RJMB 3GZFA 4CJVA 4HL9A 1K9MT 2PI4A 5KT4A 3MBYA 4P6QA 3KZBA 2XGPA 4BGBA 5AQYA 3M4XA 2HF3A 2W9CB 1TL4A 4RW8B 1Y5NB 3R5DA 4XPCA 4Z7CA 1HFEL 2FSKA 2IOFK 2CQ3A 1YQHA 3BP8A 1YHQN 5GVQA 1B7FA 4F3QA 3BSAA 5IV3A 2PXIA 2HVHA 4BRAA 2HMPA 1W2BR 1DJ0A 1XMOF 1JCFA 3DLEA 4JOUA 4USVA 4YFUA 1RWWB 1JI7A 3MEEA 2I6WA 2YWFA 1N4LA 4BVPA 2A6OA 4P0PB 5I9EB 2IM2A 4IDHA 4KLJA 5IXUA 2OPQB 2J6TA 2P6RA 3R1XA 1UPMB 2NZCA 2AX1A 5C24A 1XEZA 3KFWX 5HBMB 4QWBA 3R7SB 2B0CA 2B6AB 3I9ZA 4PG4A 2CG4A 3NGTA 2CGLA 3R1HA 1LK5A 3EMTA 3QICA 1VIXA 2FE9A 4A8OA 3DLLQ 3O9TA 1VQ8S 1HW8A 2KLAA 5EWFA 2PT0A 5CCMA 2W2PP 3MAQA 3CJ5A 3TAPA 4RZRA 4A8EA 4OYZA 4PL8A 2YNGB 1KBUA 4Q2MA 2IIRA 4UAUA 3R5JB 1KQSR 3D45A 2GGPA 1UZDA 4BBYA 1M1GA 1QVFM 1S1XA 1IH7A 4NZ0A 3NDKA 2LYAA 2R7XA 3WU2U 3GV7B 9ICMA 4DN9A 3OVSA 1TVRA 2ROEA 1BHLA 2M4MA 4O4RA 3A3OB 2ZUDA 3ALRA 1XBWA 1HUXA 4Y0FA 1FJGF 4O55A 2EH9A 5KG4A 4KB0A 1U48A 2DXDA 2NRTA 4QIWD 4CZGA 1S6QA 1YRUA 2H3GX 3SAFA 4KI4A 1T9XA 1FFVA 2VODA 3A13A 5E2QA 1Q16B 2Q3PA 2ILYA 1HNWF 4FOIA 3GLJA 2OFHX 5KPTA 3OTEA 2BRLA 2LEAA 2PFQA 4I2GA 2AW0A 4I69A 5HMWA 1RBVA 3A3NB 1LW0A 3KG4A 1NPKA 2HQCA 3G4SS 4OZ5A 5JJBA 1VSMA 3R5AA 5HAOA 4JKFA 1UCNA 3UM9A 4GMJB 1OY9A 1WDDA 2IVYA 3M32A 1OQ6A 1RE1B 3QLHB 2BJ7A 2Z1GA 3ATVA 3TFSA 4RW4A 2BANA 5AM3A 3MFIA 4BC2A 3HSZA 3RH5A 4KH4A 4R25A 4LF8F 4J9VA 4ID1A 1TAMA 1WLJA 4B08A 3W8PA 1X4HA 5IS2A 4C9DA 1N36K 2XHBA 1SKSA 1MMNA 2N3LA 8ICSA 4M3UA 3VQAA 4CZMA 5E3CA 3ZZPA 2FSNA 4MFFA 1N60A 2OEMA 5DQHA 2R7UA 4OJ6A 4M41A 4ZJQA 3CCSN 4P4PA 3PY8A 1RDAA 1IKYA 1U6ZA 4IOAL 2HHPA 5E84A 3DXSX 4MLEA 3AA3A 1ED1A 1G7CB 4JI1J 4BRHA 3T9ZA 2F5GA 2JC0A 1NMDA 5J1PA 3ISBA 3KK7A 2K4PA 2G8UA 1Q3VA 2C1EB 2QL9B 2GO9A 2KJWA 4TU9A 4ZCKA 2HDOA 3K0SA 4FXVA 3NH2A 2C2EA 3K7RA 1HQUB 3IBPA 3FVYA 5AKZA 1QVGR 1BI4A 3O3HA 5EU7A 4K8RA 4DV7J 4OV6A 4X2BA 3D6JA 1EIYB 7ICVA 8ICEA 4YDUA 1EZZB 2JHDA 3UDCA 3M6WA 5AQKA 4PQUA 3O8WA 3ULEA 3KG1A 2CPFA 1A7GE 2GA7A 3CJAA 3KJVA 4IRDA 3AGRA 3U4LA 2FLPA 1RT3B 2FD2A 2HAFA 3MHYA 5GAHI 4AL5A 4XDCA 4R0JA 3D0HE 1S0MA 1ZXOA 1ZQPA 1I94F 5K20B 3QUQA 4QR0A 2ZE2A 5KAFU 7ICMA 2XY5A 3M6VA 2OKQA 9ICGA 4WWSA 5AXKA 2H54B 4UOGA 3DGVA 1KAZA 2EK6A 1UHUA 1FWPA 2YPYA 3FSXA 3PSFA 2DBBA 2RU3A 3MMJA 3ZZUA 3CC7S 2DNPA 2ASPA 1AB8A 5HQLA 4ZMMA 3THVA 3NNHA 3PO4A 5CYQA 2OMLA 3QESA 4RL1A 4H5TA 4K4IA 4C7ZA 4DL4A 2BOPA 1RU2A 2MLXA 3QU2A 2K60A 1PYTA 1BPEA 3AFGA 1CZ9A 3VESA 5B0DA 2C2DA 2HHHJ 3IWXA 2CRXA 3VAKA 1WI8A 2HGMA 2YB4A 3ENQA 2F77X 2HS4A 1O08A 1WWVA 5AK3A 4F3TA 2FZKB 1JXEA 4I2JA 4CIGA 2HMIB 1Z1BA 4M3TA 1Q86O 2H3QA 4KMUA 4KLLA 2KVIA 1X4CA 4FSVA 1R6YA 3CHWA 5A2QU 5ALYA 1G2EA 1G99A 2KN4A 4GFJA 4OI1A 3O8MA 5L1LA 4M94A 4CEFA 4CJQA 4FS2A 1HJRA 3ZTPA 3DM2B 4PEOA 4DR5J 2OH2A 2YTUA 1X42A 3CDBA 3QGPA 3RB4A 1N48A 3C2MA 5A0LA 1RTIA 2EC0A 3CMAS 4KO0A 2RNEA 3GCWP 2KZZA 1ULRA 4RU2A 2P9EA 2W2QP 2E4LA 2HRTA 4QW8A 1KONA 2EPIA 2M52A 1ZPVA 2KG1A 3TQEA 3WKAA 4YMMA 3QMQA 3FEZA 4BR5A 3NOGA 3VQEA 1QQ5A 2E6MA 2A1RA 2X3GA 1BPBA 5CHCB 3OHBA 3MN7A 3TI0A 1GTHA 3AUOA 3MR7A 1OW5A 3HJVA 4ALZA 1RDDA 3BN4A 2I8EA 2E1CA 4MT1A 1EXNA 3ZSZA 3BGFA 1DKGD 3LQVA 3E3XA 2KL8A 3J7AP 1F3FA 3ORYA 2ZEJA 4IOCQ 4KAIA 2LQ5A 4G9BA 1D9FA 1SXEA 2YMPA 4QYZK 5HMMA 1VK3A 5I3UA 5KFMA 4EEYA 4CLLA 3M1VA 3MM9A 2HCFA 3ID6A 5CABA 8ATCB 3I4HX 1PSDA 4RTFD 4A8KA 2HQIA 3WK5A 5E33A 5KFQA 4KR0B 4NXMK 2W9MA 3G8SA 4PWWA 5M1KA 2ZWHA 5J2MA 5AQJA 2N7YA 2R4FA 2ZF5O 3AQFA 4DFKA 2ZUBA 1U26A 2HBQB 4C97A 2IC3A 4JKEA 1FFWB 3TU5A 4QZAA 5T41A 4M3WA 2MDAA 9ICNA 4QJVA 3W3SA 3LO3A 3V2UC 3WT0A 3LDAA 3IWNC 3SLCA 3CCRS 2X1GA 3D2QA 2A5XA 2NS1B 4ZVFA 2HHHK 1YGYA 1HI8A 1M5SA 4L3KA 4NLPA 1VMBA 3UPQA 5M2PA 4LFBJ 3MN6A 4RLEA 5HMYA 5DZ6A 3C46A 4YMNA 4EGLA 2KFZA 4TY8B 3EUNA 2AQ0A 5EWEA 5IILA 2KJVA 3G87A 3H1QA 4H5RA 4CK1A 2C42A 3TACB 3PFOA 4LFCF 4PL1A 3CUNA 4J9UE 2ASOA 3BGRB 3EXCX 3WX8A 4QIWF 4FOEA 2QXFA 3I31A 1TKXA 4OX6A 2FLNA 5HLFB 4WK1A 2B9EA 3OVNA 1HQEA 1S5LU 3QT8A 5AXLA 4ID5A 3P4IA 1I94J 4A8MP 5GINA 4ZPWR 5IZHA 4JI2J 5D0HA 4LF2A 1JMTA 3US5A 2G4BA 4DR5K 2OJ3A 1ZTWA 2ATCB 3L95X 4UATA 1Q81T 4KHYA 1VQ4S 4X66K 5FDLB 2CVIA 1RZTA 4TXSA 1NGCA 1QQNA 1TL7B 1N6QA 5AICA 4FZXC 1T3NA 1NBEB 1UWBA 1U09A 3ZETA 1B9FA 2DNRA 4USTA 4HHTA 4ECYA 4MK9A 1U2CA 1ATSA 2VKRA 1F5BA 1RT1B 4LY7A 3BPSP 2WW4A 1NXIA 3TAMA 4DS5A 4KBIA 1LEOA 1SS6A 3QERA 1LKYA 3NY0A 4ZJOA 3D0GE 2RD5C 2XZDB 1ZM3A 4B1ZA 1LAWA 1AA1B 4KPYA 2ZH1A 1UOCA 4A8YA 2VOOA 3I5BA 1K73T 2OO4A 4GKJJ 2QB1A 1LOTB 5D49A 3BDEA 3KLFA 2UUBK 2HS3A 4B9LA 5DLGA 3L2WA 4L3NA 4BRGA 3CCJN 3W9HA 3V9WA 2CDQA 2PFNA 1EKSA 1KXPA 5B0FA 5BRHA 9ICBA 2IYIA 4XRHA 2VG5B 1B0PA 3EZWA 1ZRMA 1B4FA 3TSUA 2GS8A 2GIFA 4QZBA 5EX0A 1U7LA 3EICA 3OXFA 4O0NA 2AYBA 1S49A 1JJ4A 1T3VA 3DC2A 1TL1A 4LREA 2OPPB 2WTFA 1UQVA 3GTYX 4C2MA 4NASA 1HKGA 2MZJA 2G06A 2A6MA 3IGNA 1EXQA 4YOUA 5J29A 4C1NK 2RB7A 4HI1A 3PG9A 4ED0A 1UEVA 4F4XA 4OYMA 1ZD3A 3FEXB 4EBEA 1FF2A 3KD1E 1XMBA 3ZI4A 2DFFA 1RDUA 5EHHA 2ISOA 1S4EA 4US9A 4CLYA 4NZ7A 4BRQA 2V4JA 3A8KA 5JRTA 1RDWX 1Z3EB 1GT8A 2GQCA 1ZS6A 1XUPO 2YX4A 4Y34A 4OI6A 3E66A 4DU7A 4NM2A 1Q82O 5GADU 1U8SA 4PPXA 4RQ2A 3VC8A 3ZSXA 1DXSA 4I29A 2X74A 4LFAJ 1RJJA 4KH1B 2DR5A 2MKIA 1X4FA 3CETA 4ZPVR 4FVUA 4I6YA 2HBMA 4CH1A 3UWTA 5J0XA 4AL7A 2OFGX 2GQQA 2FLLA 1H3DA 5KFJA 1O03A 1IG6A 5M1PA 3LANA 2Z2LA 3DLGB 4JB8B 1NG9A 1NHKL 3LVVA 5E26A 1WB9A 3JPQA 4IH7A 3FBCA 1YJWS 2FJDB 3LL3A 4CNYA 2UVUA 3ISDA 3TX0A 1VBXA 1VGYA 4DTJA 3VQ9A 2BZFA 3IM1A 1Q9YA 1HWIA 2QM1A 3Q8VA 2M7SA 2WB1D 1CEZA 5BN9A 1KD1T 5KFDA 2JDJA 3C28A 3U7JA 1FKAF 5EUHA 3MX2A 2KTQA 4HCCA 4LVNP 4DSJA 1M1KO 4NLDA 2XMVA 1MWMA 1MMLA 3P38A 4A48A 4F7VA 2NQPA 3TVZA 3GIRA 2QWMA 2JZBA 2ZNYA 7ICUA 4RW6B 2KZ3A 4CJ7A 3J7YU 1ZQFA 1RAHB 2F3NA 3KLGA 1CZBA 1DQ8A 2CJXB 5CE3A 3L8BA 2LU1A 2W4DA 1GFWB 1X5SA 4ED2A 4C0BA 4NM1A 2HG4A 2UXBF 1RU1A 3ET6B 4B9VA 4LRAA 4TY9A 2I0XA 1MW7A 3DLRA 4N8NA 5K14A 1X40A 4GKKK 2PYJA 4DV2K 3LYSA 3I82A 2C28A 3OYGA 3IGVA 2ZOFA 1KQKA 2LHTA 3EDRB 3V5RA 2ZNZA 2P35A 3DHWC 3T3FA 3AVHA 1PBUA 1J97A 1N36F 2DNOA 3BZCA 2R7RA 3S7RA 1WBDA 3UMGA 3W9JA 2E7XA 2VIXA 5BRFA 4KGMA 4CNQA 3JTPA 1OO0B 1UWAA 4DXLA 3HVRA 3R6MA 1GMUA 5HROA 2F8SA 3SMSA 2MY8A 1C20A 4DPOA 4QR2A 1K8AT 2GAGC 1H98A 4PWUA 4OJGA 2GWKA 3M30A 1R27B 2ZH6A 5F8NA 1OYDA 2BX6A 3DRPA 4XTTA 2JLEA 4WFXA 4B1YB 3VGSA 4F4AA 2A6AA 3SR6A 2G2OA 2X3DA 1SJ3P 4O9MA 1JLEB 1R6VA 1PVQA 2L9WA 2VFTA 2RRNA 3KYLA 1OUQA 3BQ1A 3CE8A 1S1VA 4WE1A 3ZZTA 5HRPA 2UU9K 2A3ZA 2EFVA 3A2FA 2RIJA 3QMLA 1JLGB 3PSIA 2KV2A 3OBYA 3WXKA 4O23A 2O66A 1ASUA 4CHYA 3PJ9A 4WXOA 1I39A 5AQFA 3DAWA 4YY3F 4O3QA 1S9GB 1AYEA 1IXKA 1F3VA 1WOOA 2YTCA 1EETA 3JPSA 4M3ZA 3R27A 2R42A 3MM6B 5IM0A 4N5SA 1NJYA 3NGKA 3V6HA 3GWCA 2NUHA 1J2MA 3CC2S 1ZAXA 4LF9J 1RTJB 5EOZA 4NV0A 3PRBA 1W26A 2QWOA 1IWAA 1BGXT 4J9KA 3TKAA 2VJVA 3GR1A 2HSEB 2RHQB 4X62K 4F0KA 3VA3A 3J81j 4ETXA 2B5JB 1RWXB 4ECVA 4C3KA 2DGVA 3OFFA 3K2PA 2W01A 4DLGA 2HYIB 3MPYA 3KHGA 2LQBA 3D3BJ 5BR8F 2AYEA 1PJ5A 4GVBA 2G8HA 1S12A 1SKUB 2ZH7A 1T95A 4KJIA 2ITGA 1JNZB 2NYHA 4BC4A 2VZ9A 4HDHA 1UFWA 2O8BA 1FRIA 4KITB 1CLFA 4BY9C 4PG5A 2PYLA 2DNYA 5KRSA 3D6HB 4W5TA 1P27B 1IKXB 4LF5J 4Y2YA 2LPEA 5ALUA 3PM9A 3M2RB 1W7AA 2GC8A 2HF4A 2RILA 4K4XA 4QJFB 2R2SA 3O9UA 1XTZA 3I0SB 1RA7A 2QKKA 3PHTA 4IR9A 2BXJA 3FE1A 2QK9A 1UKUA 3JPTA 4DX8H 2Z4PA 1L7NA 5KG2A 1K6YA 3C1ZA 5HL7L 4DR3F 1NSKL 4ITSA 2CIMA 2RN2A 3MXIA 1UAWA 4OIXA 2R7YA 4LSNA 4CRXA 3Q22A 3GG4A 1TL5A 4CF2A 3PIPL 1T0TV 5KI6A 2JMGA 1Y3JA 4HACA 3IR5B 2W54A 7ICQA 4DUYK 1L3KA 3ZSQA 3ZT3A 3QEVA 2VQEJ 2D3O1 1ECWA 1IKVA 3OXGA 3NVMA 2BW2A 1VRTA 4F4ZA 3ZZ0A 2K89A 2HNZA 4WZQA 3HHLC 1SAZA 3NBPB 5DJBA 1E4GT 5M2RA 1ZQOA 1PYSB 2PMHA 2JJ4D 3IR6B 4DTXA 4IWVA 3KD3A 1L3UA 3BYPA 4LJXA 2MA1A 4M5MA 4FWNA 3NEKA 3R5BA 4UY8O 4IUFA 2DY4A 5BYRA 2J7WA 4OI0A 2B3TB 3GP9A 3KLHA 3DKDA 1KWMA 1JJHA 4KH6A 2EZZA 3O1LA 5IIOA 2DFHA 2GJIA 2RDJA 4OYAA 1Z00B 2G08A 3E58A 2P6SA 3PRDA 3LPUA 4EU0A 1NDKA 3P45B 4DTPA 4DFDA 5M1QA 4LF1A 1FDAA 3TO8A 3W2VB 1S72N 2Z30B 5A6PA 2XMUA 3GOIA 2CWKA 2F9JA 3UVJB 4A8SA 2M8DB 3R97A 4GRSA 4DX5A 2Z2MA 3M6KA 5J2KA 1WOPA 4NXMF 4EK2A 2DL0A 1X6IA 2W55A 9ICXA 3CEDA 4LJMA 4DB3A 4W5NA 1HUOA 3C2LA 1HNVB 2OELA 2DNGA 2B6GA 2DUYA 2V63A 3W62A 2BDPA 1ZETA 4I2HA 2KG5A 4ELTA 1LWCB 2XI9A 3O3FA 3V81A 5KPRA 5J1NA 5ETMA 4XH5A 2DGXA 1RAEB 1DEJA 4FWQA 4EBDA 1XR5A 2ZOGA 3QRQA 1P8GA 2AYMA 3KUHA 4YUDA 5CR0A 2VCPA 3HKZF 2PA8D 1X9WA 3DCAA 4AHUA 3MPWA 2UVWA 3KD5E 1V3SA 1SV0C 1BWVA 3MOZA 3D68A 4WF9Q 2QC3A 4CF0A 1K44A 4WCEL 4M42A 5ALKA 4IG0B 5DQGA 3L5KA 3CCMS 2RLTA 3KTQA 2F8EX 4ZA1A 3GE1A 1MC8A 1JQGA 3KZIU 5DQIA 5DBAA 4YY3J 1KKHA 2NSCA 5DGAA 2HWTA 4WFAL 4GV9A 3RJKA 3VZHA 2YCHA 2FHJA 5HRRA 2CQBA 4P74A 1SQGA 4P4MA 4M5GA 4F0HA 2UUAK 2EVZA 3L7UA 2GLEA 4URGA 1SL2A 3SDEB 3G10A 1R8HA 5AE3A 3H98A 4L76A 4H4KA 1SC1B 1D3WA 1B99A 2YNFB 1OH5A 3V6JA 1JXLA 1IQZA 4X66F 1NO8A 3C6TA 1AUDA 2A0FB 3PUFA 1TFYA 3ILLA 4F5PA 3C7NB 3C5GA 4DOAA 4ZHRA 1YJ9N 1E3MA 3H59A 2D7SA 3M1YA 3MMCB 1QHAA 2K7JA 5M2UA 1U2VA 2FJBB 5LMUK 1NJXA 4IQVA 1S6PA 2EANA 1Q7YT 1WUUA 2JRSA 4M5DB 2FY8A 2HIYA 1IBLJ 2QFIA 3G71S 3ENWA 5D0GA 3T5HA 1JLQA 3LGMA 3NS6A 2VWKA 3ZT2A 3BF4A 3D6RA 1YLXA 4NCGA 1N5SA 2AZ1A 4BROA 1HNZJ 1FWLA 3CQXA 1R0AA 4HH1A 5AJ3K 3PACA 1VR6A 3TARA 5DO2A 4NL9A 3EY1A 4RWWA 2J6UA 1X7VA 3E9PA 4YD2A 2ADBA 1WG8A 1VC5A 2H5XA 3CFOA 4KHPJ 3QEBZ 1S10A 3DRSB 1D9AA 3L2RA 3RU0A 1QSYA 2A2DA 2O8CB 4URSA 3U6FA 5EX3A 1ZQVA 1NZ8A 2OWOA 3DLKB 3G86A 3I0RA 4AYBD 4BC9A 4DR3J 2XMMA 1NNEA 2YQ0A 2Q43A 1VBYA 2HEKA 4AP9A 1Q5VA 1YJRA 4WKYA 3VENA 5G0RB 2XHCA 2P9UB 5FRMA 3ZSOA 3VQBA 1MWQA 3OR2B 4BRMA 1O8BA 1HYZA 4A5BA 2FJEB 9ICTA 3T41A 2KJ5A 2MLZA 2AGQA 1VQ6S 1KN5A 4I6AA 2HWIA 4E19A 3NF7A 1K8KB 3HFKA 4W90B 1BQNA 4JKGB 3LK9A 3IRXB 2DEIA 5ETRA 4CYUB 2DR8A 5HR6A 2B4PA 2MY7A 3KK3B 1LWXA 4LRFA 5FROA 5IT9U 2HNYA 3AJDA 3QZ7A 2DKXA 3KLEA 2R7QA 1IXRA 3QE9Y 2DGTA 2G8WA 5DDPC 4KB7A 1D5AA 4CHZA 2VFSA 4BRPA 4RQ5A 4BACA 2MMYA 3BO3A 5AFUH 4MMOA 3K5LA 3KWGA 3OFEA 1FD8A 1WN7A 3EWGA 3SMZA 3WIVA 3TR5A 4DR1K 2I6XA 2IRUA 3CNHA 3CIMA 2D1CA 3C95A 4F5RA 1R0BG 1G4CA 3MCNA 4DX6A 2YNIA 1OJ4A 1RAOA 2VPYB 1PG5B 4M0AA 4N77A 4YB7A 2CPYA 3ICLA 3Q23A 2BQRA 1UFKA 3AB4B 3FEYB 3BKFA 3KWMA 2C2MB 4OJOA 1SJ4P 4KFBB 2W9CA 4RW8A 4CD1A 2DR9A 4O3PA 4DU8A 3W3DA 3AHPA 2J0QD 5KT3A 2DF4B 5ALRA 7FD1A 2VUGA 4GC7A 4M2YA 5FLXU 1RBRA 2FBVA 2K8BB 2JX2A 3DLHA 2VBXA 2ZKTA 4KTQA 2IMWP 2A1SA 2YXLA 2CQIA 3MD3A 5K8PA 1V85A 5J0YA 1WSVA 1N8RO 7ICFA 3NVZA 1VSFA 3HM9A 4JI7J 3AVKA 1VISA 1DT9A 2OPQA 1TUWA 2VPXB 3C5FA 2F76X 4XEIA 4FWMA 4NPOA 4FLVA 5HBMA 4CZCA 4J2AA 5SZTA 3W8GA 2J8AA 2PY5A 4JV5J 4WZMA 1X2IA 4DMNA 4KLEA 3G96A 2BE9B 1X9MA 4CHNA 1IVZA 4QZHA 3LPYA 2V4QA 4GKKF 1NUEA 4KB1A 3VGKA 4JWMA 5GMEA 4KLDA 2BH1A 3SZ2A 2RPIA 1F1BB 3L0QA 1EHWA 3A1YG 1ZM2A 3BQ0A 1OQ3A 5ALZA 3ETMA 3EGVA 2ZGZA 4IYQA 2YNGA 2QWPA 4RQ3A 2V8PA 2Q1LA 1U9LA 1UVNA 1DRGA 3FMWA 3H20A 3THXB 1Z2ZA 1RAJA 4JI8K 3IRWP 2FBTA 2IIHA 2IVNA 1WBBA 1MNEA 3TADA 4Q2LA 2HPUA 5H9EK 2VH7A 3QGGA 3K75D 2XMTA 3UKUB 1ZQIA 2ZBRA 2IOHA 5L1JA 2HZAA 3AARA 2MQ8A 1VDVA 3J80Y 2XGQA 2E8NA 2QA2A 4DCOB 4L8RB 1J5EJ 1LNQA 3NCQA 2HGLA 2I5JB 4BC7A 8ICNA 2CQ0A 2RUSA 1TUYA 4JKAA 2UUCK 2G2YA 4KH0B 5GTHU 1RTDA 1EO1A 3ITHB 2GVDA 3WKCA 3J7ZO 4CGDA 5DDYA 3IN5A 3T6JA 2DIVA 3Q7BA 4DPXA 2GGPB 1IBMF 1RNHA 1DGSA 2ZC4A 4NLRA 2UU9F 2NYVA 9ICOA 3QLHA 4QIWC 1KRPA 1TVRB 1MMDA 2QO3A 3BF1A 2OTLN 4FW1A 1UPHA 2QLWA 1LXNA 3A0BU 5AKEA 1UFLA 5IWAJ 4YXMA 2JSXA 1H6KX 4KY3A 4B3OB 1FFUA 4QOZB 1BA1A 5DDQC 2HHTA 4CEQA 1REVA 1Q53A 2IPOB 5ALTA 5J2EA 4P4OA 4ED4A 3IA0A 4DTOA 5HL7Q 2Q4TA 3QSIA 4PYDA 2C3PA 4X65F 1HR0K 3RB3A 3NGSA 1MG7A 1GMWA 3D2SA 1NSPA 4DR4K 3WNGA 4X62F 4BGDA 3HCXA 3AXMA 5JS1A 3HI0A 4MO5A 4AHRA 3F2DA 3E9LA 3PIPQ 4M47A 4PCQA 3WBZA 1VQPS 4CO5A 1VQ9N 4YMOA 1XIQA 4MFAA 4MJKA 1Y7PA 4RPFA 2ERRA 1RWNB 4NLBA 4CLTA 1PC5A 4RUHA 3W5XA 4YDDB 3VPZA 4BXOA 1HQUA 4C48A 4P0QA 3OS0A 3RSEB 3SQGA 3WXJA 2AA4A 4C0ZA 4CJPA 2C3OA 3LOUA 1WAJA 3FRYA 4JV5K 3T1YJ 1ZOLA 3QJJA 3MM7B 2AJ2A 1ZAVA 1TKZA 4CEDA 1QD1A 3LA0A 1WG4A 4B6JA 1SIJA 2J9CA 2AIRB 2ZBCA 4NOHA 3WNEA 4J8FA 2KYZA 2G8KA 1RT3A 2P51A 3ATUA 1FNMA 4MK7A 4O3MA 1FERA 3MUMP 1Y11A 3TAQA 5G5HA 4F04B 4H0XB 8ICVA 4P9SA 1GLCG 4CEAA 2UUTA 3LW5C 4ISFA 2HFSA 3VAGA 1R3NA 1KNZA 5D0RA 3SEIA 3ZZRA 1RYSA 4MAKA 4FS1A 3N5FA 4BDPA 4ZLJA 4DL0C 1J9AA 1FXXA 4TLQA 2BDUA 4DPTA 2FDRA 3ZT0A 3I56S 4DUYF 1Q9XA 4FPAA 5CJ7A 1UEUA 1W0HA 4LF7K 1C0GA 4PQUB 1M1HA 3GQCA 2OTJS 1CUKA 3MXHP 1C0FA 3D28A 4AQYK 3KJVB 1XNQK 3TJAA 4R64A 3M8QB 3GV8B 4I0WA 4JEPA 3AT1B 2IJRA 2ALZA 4C0OC 1NPPA 2FPHX 2BR0A 1F21A 5AT1B 5T14A 3KKSA 4E1MA 3VAMA 1DOQA 1GH8A 3D1OA 4DPUA 3ISZA 2HMIA 3WDOA 1NMNA 1Q46A 5HVHA 4JD2A 4EP4A 4C8YA 1MN9A 2MXYA 1TFWA 1AROP 2E88A 1FI4A 2NRWA 3T6BA 4YHHK 4CF9A 3T79A 7ICSA 3VGUA 4P52A 1W25A 5TZVA 9ICUA 3IG5A 3B4MA 3D2WA 4ZP8A 4DR6F 3HP6A 3CMQA 4WCEQ 3CJSA 2WTUA 4F25A 3QEXA 4TYBA 1TMJA 4DV6F 3DM2A 4K8XA 4PXBA 5FIIA 2YNHA 3IXQA 4P73A 4DKWA 2K3IA 1ZAWA 1H72C 3VWSA 4M9HA 1PILA 5KFAA 3GZ7A 3X1LB 4WFAQ 4MYUA 4KN7A 1YI2S 2UXCK 4FJGA 2KJ8A 5L46A 4ZP9A 1OY8A 3MMAB 1HWJA 4RQMA 1TKTA 1SZ2A 2V2QA 4NX9A 4CHOA 2CJQA 2YHWA 3LDLA 1YZ6A 1HIYA 3I55N 2IRYA 2L41A 3OW2R 1L7PA 8ICZA 1PCAA 4NCAA 1ZQGA 1UJ5A 4ES1A 4M63A 5KFCA 1SC4B 2OGUA 1WEYA 3AJ1A 3FBFA 4PXEA 4CZJA 3OTOJ 2WOMB 3ZSRA 1WC3A 1P7DA 1UCVA 4A4JA 2Y0SD 2ZJPL 1BWFO 1KC8O 2ASLA 5B0CA 1CPZA 4O3SA 3OYBA 1VFJA 2EWHA 4RU9A 3WXLA 8ICFA 5HK4A 3N6LA 3RGIA 2KXHA 4NRUA 2P9CA 4CT8A 1URRA 4H0VB 3AVAA 8ICPA 4XH4A 1QCKA 5AQOA 4UB3A 1KSPA 1K9MO 3SSSA 2KNJA 3C0BA 1SCJB 3RJIA 3OTDA 3Q2TC 4FL9A 1NHUA 1NGDA 4RUCA 3RG6A 4X65J 2E2OA 4OD0A 5J0OA 5GADI 4H0TB 2KSOB 2ZXIA 3KK2B 1FESA 2J8SA 2OCEA 1LB2B 1BO5O 5I3UB 2W2MP 3M1VB 3AVLA 5KT6A 3V9XA 9ICAA 1CULB 5LMUF 1ELOA 3U26A 1YK9A 3G8QA 2KIVA 4YVZA 4UAVA 2DR6A 3ENHA 4YN4A 4CIFA 4UQGA 5A76A 4I9QA 3R2DJ 4TY8A 1U1KA 1K0VA 4B1VA 4FYYB 2FTRA 2BE2A 5J2FA 3KMSA 4E89A 5F0XA 4F5NA 4QZ9A 3BGRA 3MR5A 4I2IA 5AJ3F 4ZK7M 4PYAA 1Z19A 3Q8UA 2ZM6J 2GVZB 3MMVA 2CPHA 2ZGYA 4EYHB 3PX4A 3W9IA 3UMCA 5TISU 4LR9A 3U3YA 2ZHOA 4GXKA 2OP5A 1HYVA 4XO0A 3KOOA 2JH1A 3JSMB 4ECXA 5HOOA 1VSEA 8ICLA 2HW3A 5AQSA 2F4VK 4QU6A 1TVAA 1KVAA 4PH5A 2W3RA 2E2NA 2XWYA 4CTAB 5EE3A 3EE8A 3IDHA 1RZMA 3J7YI 5FDLA 4JYAF 2A40A 1NGBA 3THWB 3MGHA 2BKPA 1RXWA 2MZRA 2DNKA 1KDHA 1TUUA 1RTHB 5KFYA 1CXQA 5GMDA 4WFNQ 1YJUA 1D09B 4ZIVA 5EDWA 4FWKA 4DL3A 1GNKA 1RT1A 2OA8A 3NL0A 2YMQA 1BQXA 9ICJA 3GDXA 4RWTA 3OYLA 3QFPA 3K5MA 1HQEB 3L4IA 5I4MA 4ID5B 1J2VA 3C23A 2MZSA 5CYMB 4NXNF 1L3VA 3B4DA 2F1IA 3O5BA 5AM2A 3A8YA 2MJUA 5KOXA 3M5RA 1NK4A 1S6UA 3OTQA 4FPBA 4BRLA 4R8UA 1R8PA 2WAQD 3GB0A 4I64A 4OJ5A 4USJC 5KG5A 2BV3A 3ZZZA 4UB1A 1WTBA 1N6QB 4DR1F 3O4NA 3QWPA 3DXKA 4IQXA 4J9QA 1LWFB 2DITA 2V9KA 2BKNA 5LJ5Y 1JXVA 1VRUB 3RW6A 1VOMA 3VAJA 3BGUA 2WBNA 1LKYB 1SJRA 3HPHA 4HUFA 2Y1LB 2OPPA 3J7A1 2O1PA 1OPIA 3I5CA 2XVTA 4BUGA 4BVOA 1K47A 4WP3A 4BX9C 2HHXA 2OMOA 4DV5J 3KLFB 2YWWA 3WK8A 4IXCA 2OPSB 2RE2A 4QOTA 1RWKB 2HB5A 1GOCA 4G65A 4MFBA 2V8GA 4PG6A 4PKHA 3D0PA 3PMNA 1X0PA 2HFZA 3OJSA 1X6JA 3HRGA 4PKGA 4JBCA 3QETA 3UE5A 5LMNK 4Y2JA 3N6MA 3MUTP 1Z1VA 5KFKA 5AFUA 3PIOL 2MSTA 3CCSS 2BYCA 2ZBIA 1N32J 4J2DA 2V4RA 2QB0B 4QIVA 3HTVA 3Q8YA 4USIA 2D74B 1MWKA 4RPYA 1I5OB 5LL6d 2BKEA 1VIOA 2LMIA 3OY9A 1O5JA 4OLOA 3MWPA 2CPRA 4FJ9A 4BRIA 1Q8IA 1FCAA 3EVWA 2VWBA 1VQ8N 1RAAB 5HATA 1BIZA 4LF4K 2HGNA 5AQUA 5AI9A 3UR0A 3AA2A 2JLFA 3L3FX 1FKOB 2BEFA 2X1FA 2HHUA 4CM0A 4O5BA 4LUBA 3CPWR 4RW9B 1CC7A 4JI8F 4HHHA 2WCXA 3AM9A 4F5QA 3ISCA 1YVUA 3ALYA 1NK9A 2DPJA 4AH9A 4YOWA 1ROFA 2ZIWA 5AQHA 4OQJA 4X4PA 2VC0A 2BA9A 2DNMA 2CFXA 4F36A 2ZG6A 3GFKB 3FGUA 2NXNA 5GTIU 4QZDA 3M3ZA 2E1EA 2BJ1A 5LOQA 3A0IX 4DFMA 4RW6A 3OL9A 1MN7A 1GX5A 2UUCF 4WFBL 2HBYB 4GV3A 4IEIA 2FC8A 3M8RA 4WTYA 3VOVA 2B9YA 1D9DA 2Z1HA 3ET6A 3EZ5A 4MDBA 1YBUA 2WB1C 3G4SN 2XG8A 1U49A 2C2NA 4XIUA 1L5UA 4DV4K 4ZVGA 2DCUB 2IJFA 4DUZJ 2LVWA 3FCVA 3SQ2A 1ZQ1C 5CR4A 1U1RA 2XLKA 3O4QA 2H5IB 3OLAA 4J9RA 1XS9D 1XWLA 4CI6A 2FHMA 5LM7E 2BCSA 1TAQA 3CXCR 2Q0RA 4CGHA 3J81O 2I9GA 4E98A 3L3UA 4Y2MA 4WTOB 2AGPA 2HSZA 1B0VA 4MK8A 4KTZA 3FFIB 3EO3A 2AEJA 3QFHA 3KLGB 4I6MA 1JLCB 4O5KA 4RNMA 2Y0SF 3ZDAA 1HR0F 4DV5K 3VAFA 4H5WA 3W65A 4DR4F 2HZCA 2G5IB 1IBKK 2E66A 4KKOB 2DB1A 2E44A 3UN3A 3EGZA 1SZHA 4KGVB 5K14B 2YJFA 3HVAA 4ECTA 1S1UB 2YHAA 4G6VB 4U67L 3TZXA 1OMSA 4HDGA 2LXFA 4RQ0A 3HX9A 2DHSA 4DMZA 1XMQJ 1HEKA 3CSKA 4ZCMA 1JLEA 1NAQA 2IMOA 2WF6A 3CJ8A 4DDFA 1OH6A 4BQLA 4TNOA 3I8DA 4FZLA 1N34K 4PZVA 5DKWA 2V94A 2DGUA 4PWDB 1F44A 1JLGA 1GOAA 3SBGA 4EO8A 3D1HA 4GXJA 5HROB 2QMUB 3KNAA 1FK9B 3R7BB 2W03A 3FC9A 3MN9A 4X4NA 4ZCLA 1S9GA 2F1HA 1RP5A 5ALXA 1CXUA 3MM6A 2V68A 8ICXA 2XSJB 4JI0J 1E6YA 2FB0A 4U96A 2XICA 3E2EA 1SBRA 2V7YA 4CIOA 1WUDA 2F44A 2FY1A 4IKAA 4RW7B 4BDYA 4UASA 4WE1B 2FBXA 2LM4A 2D0PA 4Z4GA 4PAAA 4JI6J 4ZH4A 2D9OA 5HI7A 2CPZA 2QX0A 4BR7A 4KN4A 3CC7N 1Q79A 2D0OA 3IM8A 1NK5A 4YG2A 1NGGA 1WC0A 4C3MA 3SBTA 3RJEA 5CB1A 5ALPA 1FA0A 4O8UA 2PI5A 3QU9A 3VGLA 5IINA 2QSFA 1JJCB 1XNQF 2XMJA 2DISA 3G8TA 1S0NA 1R0CB 3BBBA 2YWEA 5ALGA 3IBCB 4FWOA 3BF3A 3O3GA 2LQ8A 2ZHAA 4AXJA 5KFLA 1IKXA 2UXDK 1Z05A 1IJFB 3M2RA 3D3CJ 3F5AA 7ICKA 5AI8A 2YBVA 2MTLA 1JJ2M 3NWRA 2PMZF 3QBXA 1H7WA 3CDUA 3HK2A 5GAEP 3HWTA 1HMVB 4YHHF 3FKBA 3QU7A 2UYTA 5KG3A 3T9NA 3BQTA 4YB5A 3GE9A 1TQLA 2XNRA 1GLFO 1J5OA 2KHOA 3V1OA 4ERDA 2ZJPQ 4CFCA 2P9LB 2MKSA 3WQTA 3EZOA 3MPVA 2I38A 1JMSA 2WBRA 3UW1A 1NDPA 4C11A 3TUZC 4V1Ak 3M2VA 4ANEA 1VQNS 4MEXA 1HW9A 2CPDA 2W43A 1S6OA 2K8CB 4K4GA 3Q8RB 4Q43A 3VQ6A 4JI5J 4JMUA 2GZOA 4L3QA 4FLWA 3RB0A 4B9QA 4K0KF 4CWBA 4B3SK 4CBUA 1S48A 3TA0A 2HHWA 3L3CA 3CF5L 3EE3A 1SWWA 4UZBA 3WKDA 2LXUA 4PL2A 2CQ4A 4EX6A 3CDAA 4FVMA 2BE7D 3GFYA 4DR2F 3BDPA 1TELA 2Q97A 1KCFA 3N7PD 1S22A 3SPYA 3WNFA 5BOLA 2XB2D 1ZQWA 4P2FA 2DFLA 1JX4A 2FPLA 5AHXA 4DJBA 4FZMA 4GV6A 2HNDA 1N5VA 1ZTTA 2MAXA 4DOBA 1HNXJ 4CZLA 3P6YC 2E7WA 2NXJA 4PHEA 2IDOA 1NGAA 3R3LA 4FJHA 2W3SA 2YHBA 3RAQA 3BZQA 2DVIA 3QEPA 4HACB 1Z00A 4OZLA 1V9OA 2QYGA 3JAMO 3KLVA 1V4TA 1U1MA 3L2VA 3HBTA 4DQPA 4QWEA 5AM5A 4LIRA 5ALQA 2HNZB 4ZVEA 1YITS 3OBIA 5KFEA 3SFGA 4OJHA 4DSEA 2UVRA 3K17A 1FHTA 3SCJE 1CJVB 2WUSA 1W97L 5T7LB 2QARB 2EFNA 1HNVA 1VQYA 3TAEA 3HVWA 1Y5LB 3UNYA 4M45A 3CJ4A 2B7CB 3S3NA 4Y0WA 2IRXA 1A5XA 4I1TA 3MWBA 1EQYA 1ASWA 3GPAA 8AT1B 5E3RA 2DNHA 2Q79A 3RJHA 5AE2A 5KT5A 4I27A 2J0XA 4OX9F 5DB9A 4K4TA 3MCOA 1IO2A 4GO7X 3W7BA 3H8YA 3LDOA 4OZNA 4G3IA 2LM1A 3UKRB 5F41A 1RYRA 4DPYA 1B22A 3T1AA 5KFIA 3GMGA 4QZCA 4BR0A 5AK6A 2HK3A 4UBBA 1ZA1B 2J0SD 3AA5X 3W5ZA 4Z37A 2D4WA 5BXIA 1D0EA 3B54A 3I6PA 3K1ZA 4IG0A 4B9TA 1GLLO 1U4BA 3IO1A 5CHGA 3V81B 3VHQA 2CRLA 3WK6A 4C1NI 5I42B 2I2YA 5FRNA 4JI3K 2HFOA 3DU5A 4UTGA 4G1QB 2IS3A 1X9JA 1PVRA 3CJ0A 4DV1K 2F4VF 3M7VA 3SDEA 3OYEA 4FJKA 4IH6A 5L1MA 3O44A 2YNFA 2G9OA 2BPCA 4IDKB 2UUWA 2F96A 2R7TA 3I28A 4Z94A 1KD1O 3K59A 3C7NA 1VQ4N 2ZJAA 3QWUA 1PGZA 3HSCA 2H9ZA 1WYGA 1VS3A 2XYGB 5SWMA 1DARA 3MMCA 5B5EU 4TUSA 1SUQB 3U9DA 4OKJA 3BSNA 3TZYA 4CEOA 2BUPA 2CYYA 4CQ1A 3ZD8A 4Z0UA 4NLYA 4Y2CA 2CQ2A 2MQMA 1M5PC 3QX7A 1ZH5A 1HRHA 2KQ2A 2QL5B 1J27A 3ZD9A 4EMDA 1HNXK 1DY3A 1HKCA 1U45A 1B3TA 2AGOA 4LRDA 4IFVB 3KZXA 4HTLA 4DG1B 4J7CA 3KHLA 3D54A 1JLAB 3GU0A 3WXMB 3RMCA 4O8KA 2ITMA 2AEFA 4A8QA 3DRSA 3S9HA 2CPIA 1CSJA 4CLKA 3ZDCA 3MURP 1JCEA 2O8CA 4B3TJ 2DRDA 1U2VB 4X4RA 2RH3A 2HLUA 3ETOA 3LGNA 3MC1A 1TAUA 3DRRB 2BTFA 2BBEA 1HPZB 2VKQA 4CZHA 2NR0A 5G0RA 4PHAA 1SIZA 2L48A 1N33J 2IDEA 2P9UA 4USWA 3T1HJ 1CG2A 3CQYA 1ITGA 3OR2A 2AKWB 4DU4A 1JKHB 3SXLA 1K8AO 1ZQHA 3CQ8A 1R0AB 5CD4H 1DGKN 4ICLB 1K8KA 4DCJB 3NS5A 3SAHA 3CFRA 1QUVA 1TV6B 2D0BA 3VGMA 1Y9OA 3RJFA 4XA5A 4FM1A 1DFDA 5A2QY 1WWUA 3IRXA 3TWZA 3LPTA 2Z58B 4AYBC 1QZ5A 3ZSWA 2EAMA 1RBTA 2MEWA 1WCLA 1NM2A 1IG8A 3KK3A 4DCCA 5ALHA 3CC4N 2CQ1A 4AUKA 1B64A 3OQ2A 2D69A 1TUVA 1ZQKA 4CJ4A 2YKQA 5LMNF 4FK0A 3C6AA 1H73A 4FJIA 2EG1A 3AAWB 1GLDG 3H8JA 2CG8A 4R63A 1G3OA 3ZZOA 2I1RA 3IP0A 3IS9B 2A1JB 1IR1A 3KHHA 2K7KA 2DHHA 1B0XA 2W1BA 2KG0A 4B3RJ 4E7HA 2H3VA 4H4MB 4TYAA 3CIZA 4JI4J 4WFBQ 3NG8A 4ECWA 5BYQA 4CK2A 3HSDA 2NO4A 2H3EB 3N4MB 3BS9A 4CFBA 4IR1A 4B3MK 3BSOA 2FUG9 4H5VA 2VQFF 2JL9A 4BGAA 4LF4F 1N2XA 4F4WA 2MB0B 5JVHL 2XNQA 1RT4B 2HNYB 3F2CA 4F92B 4BR4A 4PHTX 4JV1A 4RBUA 1WNEA 2ISPA 4ZVUB 4L72B 1IV0A 2WVFA 5D4LA 3GBTA 1XNSA 3CWJA 8ICOA 4E3SA 1Q82T 4ZIWA 2M3DA 1ZBFA 1B0TA 2EC2A 1U0HA 1RG6A 4C0HA 1DURA 4CJRA 1HKBA 3QRRA 4OX9J 1XNRF 1URJA 1EQMA 5AIBA 1K1QA 1R31A 1RUSA 2KFYA 5ETTA 1SH0A 1HBMA 3NP5A 1T03B 3ZDEA 4A47A 3OV7A 4JV0A 2H4WB 1MWZA 1SI9A 3H0MB 1KEKA 4G9ZA 1PVPA 4M5NA 3SJHA 3HZEA 3DXBA 5FPDA 4KPCA 5ALVA 4KH5A 1WC6A 2PN6A 4OHZA 3C6UB 2DPNA 1GEHA 1B92A 4OCZA 4LH4A 3UIQA 1WSRA 4DLEA 3KXDA 3LP1B 1W2BM 3UD5A 3OL8A 2QJ3A 1JALA 2MQLA 3I4PA 4DEZA 1WHYA 2P9GA 3OL6A 4DV4F 2ZVSA 2QA4S 1ICEB 2J7KA 2H5EA 4UOFA 5AQGA 3VMFB 3T5KA 2BRKA 5B09A 3V9SA 3CCEN 4DV0F 1V5VA 3KUGA 1BUPA 1H74A 1NB2A 1M1KT 2HURA 2M5YA 3THXA 5B0EA 4OX7A 4OHWA 4KHSA 3T1HK 3TW0A 3TJ8A 4QU7A 2J9DE 1NNLA 5AQWA 3MOJB 1UA1A 1XI1A 4AE5A 3LM2A 3F0NA 3TUJC 3UKUA 2Z0GA 4M9GA 1BWEA 4Q44A 3LDSA 1S1TB 3CMEN 5B0BA 3VETA 1IBKF 2QYCA 4K50A 1RLCL 2I5JA 4EYIB 1TYQA 5J1EB 2VA3A 2H3IA 1P9YA 4YORA 2ZH8A 5D15A 4BREA 1KQSM 1O51A 2BMBA 2NCKL 5M1FA 3ITHA 5MLCV 1IN0A 1X4EA 5IIKA 3MEGB 5JUMA 2MKKA 1JIHA 4EFHA 5ETNA 3T5JA 3JYTA 4FXWA 2PIIA 4A62A 2E5GA 2BPFA 2CJ9A 4O0IA 1G15A 2EI5A 2GJFA 1QQ6A 2H48B 4EFAC 1N34F 2G1DA 2HVZA 3HHLA 3CD0A 1S0VA 3MK6A 1XO1A 3Q8QB 1DRZA 4CLUA 3BQ7A 4P71A 1CJUA 4P10A 3ZSVA 1QAJA 2HS0A 2V69A 1RT6B 4B3OA 1BE4A 2J6SA 1D8YA 3AVIA 2JWNA 5EXWA 3JPRA 3ZX0A 3RF9A 4I6WA 4D3GA 3M9OB 5U47A 2M0GB 4AILC 4KMOB 1YUWA 1Z25A 5KFSA 1HHSA 2NXCA 2ROGA 1RTDB 4P2SA 2GVDB 2KMDA 5K8NA 3CC2N 4B02A 2YKNB 1ZBIA 4ZPAA 1WC5A 4WYWA 2LYBA 3VQQA 3H42A 4FWPA 4ZVTB 1FVSA 2KN7A 2P66A 3DV9A 2DH7A 4ETZA 2MUTB 4L6V3 5AE1A 4LF6J 1QTNB 4W98A 1RFQA 3H45C 4YEAA 3C16B 2XWXA 2ZD1B 1RDFA 3O9RA 4Y2IA 2G09A 1SC6A 3CF5Q 3RSEA 4E7KA 3OBWA 2X6SA 3SUNA 4NMLA 3SSRA 2YMLA 3DFEA 1IJEB 1REVB 1OVQA 3H2UB 2N1RA 3KIOA 3IFEA 3MM7A 5KQDA 2JNJA 2KKZA 2QEXN 2VC1A 1U04A 1RABB 2GHVC 2G0IA 1MA7A 4TKTA 1PJ7A 3Q24A 3MPUB 5AQNA 2GX9A 6FDRA 4YR3A 1T6CA 1YTUA 3L6QA 3AVMA 4QZGA 4QS9A 2HBZB 1VK8A 1HWUA 5D4OA 1QVGM 3G6YA 1T7PA 2VQFJ 1UT5A 2DGOA 1KBRA 2FC9A 4YD1A 2QG9B 2ASJA 2CQGA 3NGUA 2FJXA 4ZKAA 3SQIA 3D2NA 4BXOB 2LQ9A 4J5OA 3BKTA 1DZ5A 2FMQA 4JP8A 4P0QB 3E0FA 4CJSA 4DR7J 5KFFA 2RQCA 1CBKA 3V1RA 3SQGB 4ANCA 4QBUA 2QLJB 4ES3A 3PR4A 5AM4A 2P9NB 5B0AA 2XY7A 3LWMA 3C29A 3NF6A 1BA0A 4LRBA 2N82B 4E7IA 4EBCA 4QWDA 1TKZB 2ZDPA 5F0WA 1HJOA 4H03B 3TANA 4B3SF 4M6WB 2UZAA 4FLYA 3EJMA 9ICQA 4DHYA 4CF8A 3MCPA 1WC4A 1XNRJ 2C2KB 3M8QA 3C66A 2LQJA 4AHTA 2CJYB 2DO4A 3ZTQA 8ICCA 1Y3KA 3MCSA 3M6UA 1WEXA 3VR1A 4WFZA 4Z4FA 2DNLA 1P8ZA 4I67A 2E1ZA 3Q0AA 3U02A 3ZLJA 3H7HB 2J4RA 3O3LA 2PSZA 3QUBA 3ICXA 3OL7A 3L3VA 3ZFVA 3ZT4A 4NA2A 3TUPA 2N4CA 1TTHB 3BO4A 4BRNA 2QMXA 2GQ2A 3CJCA 1FFGB 2V8HA 3CDWA 4DL7A 1XMOJ 1JRPA 5LJWA 5AQVA 1U8WA 3FAHA 1KL9A 4RQ4A 3IWLA 1H2TZ 4OJ3A 5AQTA 3V6DB 3QEAZ 2BJ8A 4DV0J 4DV3F 5J2NB 5KFXA 1M0SA 3CJKB 4N76A 2LKYA 7ICLA 1QZ6A 1KDNA 2CH6A 3ULDA 2C2RA 1A0OB 4NLKA 1WHWA 3VQ5A 1TE2A 1YKWA 3D2EB 3R5GA 4X4OA 3TJ9A 4FVCA 3I5AA 3MGIA 5ETKA 3R9KA 3QB0A 3QNNA 1WDTA 3GL1A 4ER8A 4M5LA 3TA1A 3MMAA 4IO9L 4DTUA 5BREA 2ZTCA 4ZVQB 1EB0A 4JD2B 1K5OA 3PW2A 4RWXA 2CQDA 1TL3A 7ICHA 4LF6K 3I1YA 1JLBB 4KIAA 1ATNA 2KU7A 5EN1A 3GCXP 4YFKA 3VAHA 1BPZA 1HBUB 5H2FU 3L4PA 2M8HA 2WVDA 1N5XA 1IUJA 2OI2A 1IQTA 5IOLA 3S3OA 2CNOB 4ZVHA 3HFVA 4DQIA 1ZQYA 3SD7A 2RRDA 2WOMA 2QT7A 4F02A 4CZIA 2YNHB 2Q0UA 3C2KA 5F9NA 5AKLA 5BN8A 2CVEA 2MRLA 2IA6A 4FLZA 2PFPA 3PHEA 5DS7A 1NKBA 2OUGA 4QZEA 4DL2A 3VERA 4UOCA 3OHAA 4OPKA 3AMZA 1FJGJ 4JI1K 2GTDA 1TKTB 5AZIB 1QSSA 2XRIA 3T69A 1BXNA 5C15A 3G2XA 3BPDA 1VJQA 2Y3YA 1YTYA 1L7MA 1QH9A 1VQMN 2R18A 2IDLA 3HF5A 4GIBA 4P2HA 5AQXA 1FEHA 1Z2LA 2ZC3A 1HNWJ 3GSDA 2RRBA 3G82A 4NLOA 1SV4A 3RJJA 1XC3A 2EFPA 1RWOB 1GLEG 4DV1F 1GTEA 3N5BA 3TZZA 4ZPCA 2Y0SC 4DV7K 3CNQP 4K25A 4O3NA 3J8AA 4X64F 4J9OA 5J0SA 2DRAA 3VTIA 4NO7A 4IZ9A 2KSOA 2VJUA 3TRGA 5LSOA 3KK2A 1IM6A 2O67A 5GAGP 3CI5A 1FE4A 4MIBA 3DMJB 3GG0A 4QPXA 4C98A 1Y00A 1B4SA 1TK8A 4FCYA 4LF8J 1CULA 1VQKS 2PFFB 3TOQA 4PGXA 2F1JA 5LY3A 3VQTA 4E7JA 1R89A 4M5KA 3UR3C 4CNZA 2CZVC 2VU5A 5CH7B 4QZIA 3G71N 4YOYA 3OTCA 2IGIA 2D3DA 3FZMA 5E3PA 2KH9A 2RQKA 1NBWA 3AO5A 1JN3A 5M1OA 3K9JA 5EY4A 2CPJA 3CCWA 4Z6DA 4BDZA 2F4FA 5EOYA 1FO4A 1X66A 4GMKA 2GVZA 3MR2A 1OXJA 4AM6A 3M6GA 4Y2AA 3PMLA 1XMOK 4IS7A 4WBFA 3E1YA 4YB1P 3D1QA 7ICPA 3JSMA 2W8KA 2HI0A 2B4UA 1U2FA 1NGFA 1VYAA 1VAZA 4Q5VA 5EWGA 2YJEA 1C6VA 3R6LB 5CEHA 7AT1B 1QM9A 4CTAA 4K4SA 1XHZA 4K2XA 5HRSA 2FGOA 2QXLA 1Y4ZB 4LSZB 2WC9A 3THWA 3RRHA 1ZYQA 1B43A 3DDNA 4C8KA 2HHSA 1WSJA 4TU8A 1RTHA 2WVCA 2HQ3A 2BE2B 3CB4A 2KT5A 2F8LA 2IOCA 2W4PA 1SH3A 2E5LF 2FVCA 4L73A 3UO0A 4QNLA 1PYOB 4Y2VA 2D41A 4E8UA 1NRKA 4CJUA 2V2ZA 1SJQA 3TTDA 2XBPA 3I87A 1CZAN 5CYMA 1LWEB 4BC5A 1G6BA 3H1VX 5KPZA 2KXFA 4K4WA 4RNOA 3TP2A 2JGUA 1ZQXA 3JPPA 2MJNA 2KIWA 3BYRA 4PPZA 3BEXA 4Y6IA 5AXNA 3BB5A 3KOAA 2P6UA 3LP0B 1TGOA 1FJGK 5AI4A 5J2JA 1ILYA 3AA9A 4BE1A 3ETRA <