2HHXA

O6-methyl-guanine in the polymerase template preinsertion site
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
579
structure length
574
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 205
structure length 574
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhxA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhxA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhxA01
1NKCA 5KFUA 2DFFA 3RB0A 1ZQPA 3OGUA 2M9NA 1X9WA 3NF8A 3PW5A 3MABA 2BGWA 4LH4A 3AVGA 1I3AA 2G8KA 4P4PA 1UT5A 1RYRA 4HCBA 3OYKA 4J9PA 2GWSA 1IKVA 2JEIA 2QXFA 3EZ5A 3PO4A 1TV9A 3U6FA 8ICPA 2BHNA 2XO7A 4DL3A 4YXJA 4YXMA 1KDHA 1CXQA 1Q9YA 4PGYA 1UAXA 1BGXT 3THVA 5FROA 3V9ZA 5KFLA 1KEJA 2XCAA 1EXNA 7ICMA 7ICLA 3NF9A 3TAQA 1CZBA 2HVIA 3NF6A 4F8RA 3NBPA 4KLTA 1QS4A 4FCYA 1RT1A 4KLSA 5SWMA 5KFAA 1WSJA 2PFPA 5J0TA 3LZJA 5F9NA 4OVLA 8ICRA 1BQMA 3PNCA 3AVMA 4CK1A 5JS1A 4UAWA 4KHSA 4DL6A 3AVKA 4FW1A 3MR5A 5SZTA 5HHHA 3SZ2A 4FLXA 2RF2A 4QW9A 1XU4A 5CR0A 4F91B 1TV6A 4RQ7A 2Q3SA 4FJGA 1XI1A 4B3OA 3PW4A 5J2HA 3JPNA 1QTMA 1JL1A 4M9JA 2E4LA 3HVTA 4EBCA 3OYGA 3AU2A 1ZQMA 1NK6A 4KKOA 3LP2A 1BCMA 1LWFA 1S5JA 3TQ1A 1WSIA 1LWEA 9ICCA 4W5QA 2W9CB 3QINA 4FJKA 4PPXA 4CFCA 3ZSOA 3C6TA 4QWEA 3QERA 5D49A 3DRRA 2AQ4A 1IO2A 3IS9A 3V4IA 3VQ6A 1RDCA 4QZHA 4CJKA 3DI6A 3T5LA 1MQ2A 9ICBA 1WN7A 1RILA 1LB2B 2BGGA 4TQRA 9ICEA 3PX4A 4DTMA 5D4BA 3PW7A 1SL2A 3KIOA 3VA3A 3K2PA 4F3OA 1O1WA 3RTVA 1BVSA 3KLHA 4CGFA 3NF7A 4RUAA 4O5CA 2J6UA 4RW4A 2RDJA 4ECRA 1ZQFA 2Z1IA 3NGDA 4P4OA 1HNVA 4GC6A 2OZSA 2HVHA 4UB4A 4B8CA 1RXWA 4ECUA 4M3RA 4Z6DA 1T03A 4CEEA 4CJUA 1D8YA 4QCLA 3P5JA 1RXVA 2ZD1A 3CFOA 3RMDA 1PZNA 4FVMA 5IIMA 3TAEA 5HP1A 4R5PA 3B0YA 4IKFA 4RQ3A 3NH1A 4CGDA 1L3SA 1YVUA 3JSMA 3T5JA 3AVAA 3PVXA 3AVNA 5EU7A 4F50A 1RT6A 3LAKA 2R8KA 4DU4A 3UXPA 2D5RA 3GIJA 3BDPA 3E2EA 4RQ5A 4TUQA 3L3UA 3TI0A 3MGHA 2A1SA 3V1OA 1I39A 4IG3A 1SL0A 4M3TA 4FZYA 4EZ9A 4UB3A 1X9SA 2JLEA 4N76A 4RNMA 4FXDA 2UVWA 3K59A 4ELVA 4KLUA 3LPUA 4DTXA 4QWBA 4K4IA 2FPKA 9ICAA 4FZZA 4B8AB 3B6PA 4B08A 1NJYA 3KJVA 2XC9A 2HHXA 4IQTA 1ZQXA 3KLGA 2PYLA 3ZSWA 3OS1A 4OLAA 3KHHA 3HXMA 4FS1A 3OYNA 1MU2A 1S1UA 2JZBB 2YKNA 1FK9A 1WSEA 4F4ZA 3QNOA 1S0OA 5KFXA 5J2GA 1WNSA 3C2KA 2R8IA 1HMVA 9ICGA 2I9GA 5DG8A 3PX0A 3L2QA 4FJLA 1JXBA 5IILA 4IG0A 8ICLA 3MBYA 1KLMA 4KLGA 4M6WA 3AU6A 2HB5A 3OVNA 1Q9XA 3H8SA 3MEDA 3QZ7A 3BJYA 3OYCA 4GVMA 2FPLA 2HHUA 3ISBA 3PR4A 2JEJA 4DL2A 5KFFA 3JYTA 1ASWA 4O0JA 4I2FA 4TUPA 1BI4B 4KPYA 3NH2A 4ED0A 2B21A 3H08A 3V6DA 2FLLA 3JPQA 3MDAA 4QZAA 3DM2A 1ZQGA 5C42A 1DLOA 1Z3EB 4BXOB 1VSIA 4IQUA 4JWMA 4QZ9A 2ISPA 4QZGA 4J9SA 4LY7A 4LSNA 3SQ1A 3IAYA 1RDAA 2ITGA 5EOZA 3SQ2A 5DK5A 5DLGA 5C5JA 2FMQA 2NRVA 4OKJA 2HNDA 3OYIA 1RTDA 3TARA 1ZBLA 1KFDA 3S3MA 1FKPA 1RDBA 4J2EA 5D46A 5DGBA 5BOMA 2Q0ZX 1TK8A 1LW0A 4O4GA 4CGHA 4I7FA 2O4GA 1ZQJA 3LP1A 3CFPA 3QO9A 2A1JB 3H7IA 3V6KA 3SPYA 4F5OA 4IDKA 5J2EA 1XHZA 1GOCA 3RJHA 3ISNC 4O3NA 2BCVA 3OYLA 2R8GA 1ZBUA 4ECSA 4PWDA 4HTUA 3MR6A 1TKTA 4QZCA 5KFYA 4DFPA 1J53A 1NJZA 4RQ1A 4CESA 4B9NA 4Z4FA 2W8KA 4CJEA 1S9EA 2KFZA 4YP3A 4YR3A 3RAXA 4MFBA 4Y1CA 4W5TA 4DTJA 5DKWA 1RTJA 3DOLA 5J1EA 4J9LA 1D9FA 1N6QA 8ICUA 4GXKA 3C95A 1QE1A 1X2IA 9ICTA 5J0UA 4RU9A 4E0DA 5KFGA 4KREA 3NHGA 2IGIA 4ICLA 4JV2A 4H4MA 3N97B 4CHNA 4CJ5A 4KLMA 4RT3A 4YQWA 4E19A 4BE0A 2OPPA 3E01A 1YTUA 4F4WA 3V72A 1RT7A 4M9NA 3LDSA 2KTQA 5CY4A 4K8XA 4KFBA 2ETJA 4CHZA 4KHYA 4Z6FA 2YV0X 2RPIA 4KB0A 1ZJNA 5HLFA 4DO9A 3NE6A 2OA8A 5I42A 2ZUDA 3CG7A 3KK1A 3HT3A 4DFMA 4I2IA 4QZDA 4Q8FA 4RPYA 1RT4A 5FDLA 4OGEA 4I2EA 3AO3A 3G6VA 3KK2A 2OYQA 2VA2A 1ZQEA 3HK2A 4O3OA 3MXMA 4E89A 1VRTA 4GXIA 4DSEA 3TANA 1BPYA 3C94A 1C1AA 1IXRA 4CJ3A 2NRWA 3KLIA 2BCSA 4O3QA 3QETA 4UB5A 4O3PA 2W42A 1N56A 5KFBA 4DS5A 5KFHA 5DG7A 4F93B 3LWLA 4F5NA 1LAVA 3TR8A 4YMNA 1W0HA 3MEGA 4CFBA 4J2BA 1Z00B 2C2DA 5K14A 4IQWA 3O3FA 5CB1A 3RJEA 1S6QA 3OYDA 4TQSA 4OKKA 5EWFA 3ETLA 4AHUA 3BQ1A 4O5EA 4CHOA 4ECTA 4FK0A 4KTZA 5J0OA 4YFKA 3V1QA 4DSJA 1RNHA 4E1MA 4I9QA 3AVCA 1WCNA 3H8WA 3OS0A 2BDPA 5J0YA 2IS3A 1BIZA 1KCFA 4KLIA 2QKKA 3EWAA 3ZDDA 2XY7A 3AA4A 4Q0BA 1TVRA 1CZ9A 4O44A 1SZPA 4M9LA 9ICNA 2YNFA 3K58A 1K1QA 5CA7A 3RMCA 2E6MA 4RNOA 2B4JA 4F2SA 2DFHA 1ZQBA 4FLVA 1DGSA 1RTHA 3NGIA 4C8KA 1JLAA 4CJRA 5KFCA 1A5VA 1YT3A 3A2FA 3DRSA 4M42A 5F9LA 3TFSA 3VQDA 4HYKA 4CIEA 2F8TA 3AO4A 1HRHA 3MR3A 1WAJA 2MUTA 5KFIA 4PHEA 3OYFA 1C1BA 4F3TA 3RB6A 4CIGA 3I8DA 3AVLA 1XWLA 5J0PA 4J9MA 2VWJA 4DTOA 1RCHA 4CF8A 4R63A 2GUIA 4QZBA 1IM4A 9ICSA 4PHPA 4OJRA 4LZGA 2X78A 4MFFA 1B92A 8ICXA 1LWCA 4AHCA 3SI8A 4JK1A 2DFEA 1BIUA 4CEBA 1ZQTA 4DOBA 2P6RA 4I2JA 4XA5A 3VQQA 2ZJ5A 4MEYA 2ZJAA 5KFTA 2YNHA 1ZQLA 3RJJA 1JLEA 4DTSA 7ICRA 4DQSA 4YMOA 4DF4A 1S77D 3HSTB 3D45A 3RJGA 4RPZA 2VG7A 4W5RA 1MC8A 5JS2A 1KRPA 3MEEA 3HPOA 2P51A 3ISDA 5J2IA 4XQ8A 2ZUCA 2FC0A 4YN4A 8ICMA 4PGXA 2OWOA 3T1AA 3KLFA 5DB6A 4CEDA 4IR1A 4ID5A 1WAFA 3F73A 4EYIB 2WONA 5C25A 3V9XA 4B9TA 5KT7A 4DOAA 3AO2A 4HVJA 2W9BA 4UBBA 4RQ6A 4R8UA 4RT2A 3T5HA 5KFZA 4PGQA 1B9FA 5DB9A 5DBBA 4M3YA 3NGYA 3H4BA 2OPRA 2RN2A 4DL5A 4FBUA 4NLNA 5KFMA 3JPTA 2IHMA 4JV1A 2FMSA 4O5KA 7ICEA 1T05A 2JEGA 3HX0A 3L8BA 4E7LA 4Z0UA 4E3SA 2DFLA 4KN4A 7ICTA 3V1RA 3SYZA 5KG4A 2BKEA 3QNNA 4NYNA 3VQ4A 4F5QA 5J2NA 4NM2A 2VG5A 1VSHA 3PMLA 1UA0A 2HW3A 4OGCA 3QEVA 4M9HA 1N48A 5HROA 1BCOA 4KV8A 3QEWA 7ICQA 1NJXA 5KG1A 4CFDA 3FYHA 1HPZA 2BR0A 2BQRA 3V7KA 5IINA 4CF1A 4MFAA 3K5NA 1IH7A 3FFIA 1S1WA 3LPTA 3DMJA 2VA3A 3VA0A 1ZBIA 1BPDA 1GOAA 3G10A 1BL3A 5J29A 4RW9A 5KT3A 4FLZA 2IHNA 8ICHA 9ICWA 4RUCA 9ICVA 4DSFA 3G0ZA 3TWHA 4M47A 1Q8IA 1ZBHA 3PV8A 4N5SA 3OYHA 4H4OA 3HYFA 3SCXA 3SPZA 4TSXA 4HCCA 1L3UA 3ZD8A 3T5KA 9ICLA 1S1VA 5J2AA 1J5OA 5KG7A 4B9MA 9ICXA 4HUFA 3RBDA 1FKOA 4FK4A 4CECA 4QWDA 1NK9A 4NCBA 3U3GA 3DLBA 5L9XA 4FBTA 1QSYA 1WSFA 4MQ3A 1L5UA 3ASMA 4L8RB 2NRZA 4I2CA 7ICGA 4EP5A 2R7YA 3UXOA 3OSPA 2G8VA 1JMSA 9ICUA 4PH5A 5KGXA 4FJ8A 4YG2A 2V9WA 1TAQA 1G15A 4UQGA 4LZDA 2G8IA 3Q8SB 1EX4A 3AO1A 5HRRA 4CF0A 1RT5A 5HRNA 3HVRA 4ID1A 3LZIA 2BQ3A 1UT8A 3EY1A 3EW9A 4I2AA 1Y97A 4LD0A 4CHPA 2IBKA 4KLJA 5DB8A 1CEZA 7ICJA 4IR9A 1SKRA 4GMJB 1BPEA 4Q44A 5L1JA 4CERA 1VSEA 3U3YA 5J0RA 5J2DA 3L2UA 2UVVA 3KHGA 8ICZA 4M6WB 1T3NA 4HUEA 4YR2A 4X5VA 1SL1A 4E7JA 4Q8EA 3M8QA 4CCHA 2BPGA 1MSWD 4ELTA 3MFHA 1T8EA 3AA2A 9ICMA 4F4XA 4FLWA 1HYSA 3ZSXA 4I2BA 3V7LA 1MQ3A 4CGJA 4DU3A 4ECZA 4FJ9A 1ZQVA 5HNKA 4CFAA 1CXUA 4GLXA 3BQTA 4W5OA 4PA1A 2IC3A 4Q45A 3GV7B 1LV5A 1BISA 5CYQA 3SUOA 4IQVA 3KTQA 4M04A 1JL2A 4O3SA 3JPRA 2BCUA 3M9MB 4I29A 4FJIA 3QEBZ 1IKXA 2Y1JA 3ISCA 1BPXA 3ZT3A 3KKSA 3TABA 4XRHA 1B43A 1VRUA 4CGGA 2X74A 3I0SA 4AHSA 4ED2A 4FJJA 5TZVA 1ZETA 4IRDA 3DYAA 4Z6EA 1QLNA 3PW0A 3K57A 5KFEA 3VQ7A 3UQ2A 5KT2A 3QZ8A 4CJPA 3DRPA 2C2RA 4YCXA 3GV5B 2BE2A 4R64A 4FLUA 3OHAA 4DFJA 4NCAA 3CQ8A 3TAGA 5KFWA 4NM1A 2G8UA 3SNNA 1HYZA 2ALZA 4J2AA 1SKSA 3HP6A 1K6YA 4FYDA 4F2RA 4BWJA 3HPHA 3P83D 3HM9A 3S3NA 4NLKA 5IIOA 3AA3A 2D0CA 3EPGA 4QOZB 1VSKA 2J6TA 5DDMA 5J2BA 2DY4A 2OPQA 1ZQKA 9ICJA 4ED3A 1HUOA 4AHVA 3QE9Y 1QQCA 2VA8A 4RW7A 5L1IA 1V9PA 1HJRA 3C6UA 1XC9A 1A5WA 1HQUA 4M41A 4ECXA 4GXJA 3TAMA 1B22A 3RH5A 4JRPA 4KITB 2IAJA 4EYHB 2UVUA 2BPFA 3ZDAA 1JLFA 5CHGA 4M9GA 2MAXA 4GW6A 3VQ8A 1JX4A 4Q43A 4KLOA 4QWAA 3ZD9A 2VG6A 1JKHA 4DF8A 1U04A 2AU0A 3ZT0A 1QSLA 2NRTA 4F5RA 4O5BA 3K75D 3SQ4A 3VQ9A 3ZDBA 4CJ4A 2F1IA 5IIKA 5C24A 9ICPA 3O4NA 4QZIA 5KFJA 5DQHA 4ZTJA 2WTFA 3RJKA 4K8ZA 1TKXA 4QAGA 7ICUA 1TFRA 3C1YA 1XHXA 4XUSA 4UAZA 1VSDA 1ZQQA 1JLGA 3S3OA 4PHDA 3Q8KA 1QHTA 4Z4GA 4ECQA 2PY5A 1XS9D 8ICWA 4N56A 2G8HA 3H4DA 5J0SA 3OSNA 4CJVA 1C1CA 4DOCA 4O0IA 3SUPA 4YD2A 4BGDA 5KT6A 2PFNA 3QIOA 3CFRA 5KFDA 1Y88A 3MXIA 4LH5A 3Q8RB 3IM1A 4NYFA 4RW8A 3K5MA 5DBAA 4QZ8A 2KQ2A 4E7KA 3P1GA 1KLNA 4J9NA 9ICOA 5J2PA 4RQ0A 4I2DA 5DQGA 1FXXA 2IOCA 4Z4IA 3FDSA 4EBDA 1BPBA 3EPIA 1ZQSA 4B9LA 4FZXC 4CF9A 2AGQA 1B9DA 2V4RA 2FLPA 3Q8MA 2LSNA 8ICBA 1EP4A 1ZQWA 1HQEA 1RBVA 4BACA 3TAPA 1N5YA 1RBTA 2HHSA 4CIFA 4UAYA 4EEYA 5HRPA 4I28A 3DLKA 5CP2A 4KHNA 3JPOA 1XSPA 4CEOA 3PX6A 3CM5A 3ZDEA 3GQCA 2PI5A 3RB4A 4GC7A 1S9GA 2P66A 3KHRA 2QK9A 4Z4HA 5KGWA 3NDKA 1W9HA 2YNGA 4KLHA 3OYEA 2HMIA 8ICJA 5DBCA 1Z25A 3K4GA 2C28A 4BDPA 2KFNA 4KHWA 1EXQA 3T19A 2HHQA 4CGIA 3BGRA 1S1XA 2X6NA 4K4HA 4DTUA 5CZ2A 4KHQA 2FBTA 4LVSA 4IRKA 3JPSA 4NY8A 4MFCA 4CE9A 5KFSA 4F5PA 2R8HA 3PW2A 1U45A 4P2HA 4ZTFA 3B0XA 4CEFA 3G6YA 4FJ7A 3C2LA 3C21A 4EZ6A 2MUTB 3DLGA 5KFQA 1KVBA 4O55A 5KG0A 2W8LA 1VK0A 5J2KA 5J0QA 1TKZA 5HMMA 2NUBA 4DFKA 3HO1A 4B9UA 4IFYA 8ICCA 4DL4A 4DTPA 2DPJA 2B6AA 4OLBA 4J9OA 4FM2A 1ZQOA 4KLLA 3SV4A 4DWIA 2I5JA 4M45A 2PXIA 4DSKA 4CEAA 4ED7A 4KO0A 2FPMA 5DDYA 2AGPA 2AJQA 4NLZA 2RKIA 4FJHA 9ICIA 4HHTA 2Z1JA 2XY6A 2IMWP 4PUOA 1XO1A 4FLYA 3RBEA 1VSMA 2BANA 2KZMA 4ECYA 2H5XA 5KG2A 1D9DA 4DG1A 5L1KA 2GBZA 1JLQA 5HBMA 3WNHA 5JUMA 1C0MA 3M9OB 1UA1A 3T3FA 5EWGA 1C7YA 1L3TA 8ICOA 1WLJA 2F96A 2XY8A 3WNFA 5KFVA 3L3VA 1UWBA 3AA5X 3C5FA 3KD1E 4FJNA 3PY8A 3RMAA 5DG9A 2KZ3A 3AO5A 3AUOA 4W5NA 5KFPA 4J9KA 1RZTA 4AHRA 3LP0A 1NOYA 5DQIA 4CF2A 1TVAA 4E1NA 5J2QA 2ASDA 2W9BB 4Z6CA 5CJ7A 2KN7A 3MR2A 4JUZA 4R8UB 5DLFA 1KFSA 3H8JA 1NK0A 4KI4A 4JV0A 4AHTA 2W9MA 1EETA 1RPLA 3UPQA 5J2CA 4KMUA 3LWMA 3RJFA 4CEQA 5HP4A 2VWKA 4DL7A 3F9KA 2HHWA 3K5LA 1AROP 3WNGA 3NFAA 2XCPA 4N41A 4CJFA 3ZSRA 2G8FA 3GIKA 2R8JA 4NCGA 3K5OA 2F1JA 3D0PA 5FRNA 3EYZA 3AVFA 4M2YA 3AVBA 1JIHA 1COOA 5KG6A 4ED8A 2HHVA 4JLHA 1KTQA 1ZQCA 2F1HA 1RYSA 7ICOA 3L2RA 7ICKA 4CHYA 4M0AA 4FLTA 5HRSA 1ZQZA 3SV3A 8ICAA 3L2WA 4RQ2A 3UQ0A 4RNNA 2X6SA 1JLBA 3QESA 4FM0A 2ASLA 1VSFA 4I2QA 4HUGA 3ZSZA 1WCLA 2Y1IA 3QEXA 1TK0A 4KLFA 3Q8LA 3CM6A 2GV9A 2FBVA 4I2HA 4G3IA 1BQNA 3PR5B 4KTWA 4ZHRA 5KI6A 4JRQA 7ICHA 1KVCA 3SJJA 3MFIA 3KHLA 2P1JA 2YHAA 4H8KA 2ASJA 3V9UA 5HHIA 2PFOA 3VN5A 8ICQA 1K1SA 1RBUA 2RDIA 3RMBA 1S0VA 5L1LA 2FLNA 1ZJMA 4O9MA 9ICFA 3N4MB 2W9CA 2BCRA 5T7BA 3VQCA 4DQRA 1RDDA 5DB7A 3DLEA 1ASVA 3ORYA 1TAUA 2KW4A 1J54A 3OYMA 3HWTA 3QIPA 5D3GA 1C0UA 4XIUA 7ICFA 2P6UA 4BDYA 4DMNA 4B9VA 2JGUA 3I0RA 3ZT4A 4RG8A 1S0MA 3ZSVA 2ATLA 5KFNA 4KB1A 1L3VA 4EBEA 4M3XA 3VQ5A 1LW2A 1JXEA 2DPIA 3ZT1A 5EWEA 1HJPA 2P5OA 4Z4EA 2YKMA 4J2DA 4J9RA 3PUFA 7ICPA 3HP9A 2F8SA 8ICYA 3C2MA 2ZQBA 3ITHA 4NXZA 4DLEA 1R0AA 4Q5VA 1SKWA 4CEZA 4CK3A 4J9QA 4BWMA 1X9MA 4JS4A 4Y1DA 8ICKA 4OKEA 2ZJ8A 2KZZA 4WE1A 3IHQB 3PO5A 2G8WA 4MF8A 1S0NA 4R66A 4RQ4A 1H38A 5J0XA 1LAWA 3AVJA 4MEXA 1NKBA 1RBRA 4OPKA 2A1RA 9ICKA 4DS4A 7ICIA 1NOZA 4I2GA 4FM1A 4UB2A 4KLDA 1S97A 3ZSQA 1HYVA 1KSPA 3UXNA 4FJMA 4M3UA 1A5XA 4YR0A 4KN7A 5E41A 3VQEA 1KFTA 5CWRA 4CJQA 2PI4A 4CJWA 2O4IA 3V9SA 4FO6A 7ICNA 4DU1A 4ECWA 3IG1A 4FJ5A 4QWCA 3HPGA 3OJUA 1ZQHA 3RRGA 3IRXA 2PZSA 2D0BA 3MXJA 3SUQA 2FBXA 3OYJA 5KG3A 1NK8A 4KAZA 2XGQA 1NJWA 3RR8A 4KHUA 1D8LA 2NRXA 4DTRA 4K4GA 1REVA 4DTNA 4R65A 1NK5A 1X1PA 3OY9A 2UVRA 1S1TA 3NCIA 3O4QA 1ZYQA 1A77A 4N47A 2E6LA 5J2JA 1VSLA 2AGOA 4DEZA 3OS2A 3HL8A 3TAFA 1TL3A 2JZBA 2HNZA 1Z26A 2BPCA 4F4YA 1D5AA 1KVAA 3DLHA 3ALYA 4PQUA 4M3ZA 3KD5E 4QZEA 4JWNA 1T4GA 4I2PA 2C2EA 3NGZA 1S6PA 4BE1A 5J0WA 1BHLA 2PFQA 2ZE2A 4IRCA 3PMNA 1JN3A 1NOMA 3OYBA 2JEFA 2I1QA 1RBSA 1IKYA 3ULDA 1HUZA 2FBYA 2IDOA 1JLCA 5HMLA 2HHTA 4F4KA 3WNEA 5KFKA 1NK4A 5J2MA 5KT4A 4UBCA 3HW8A 4KLEA 1BI4A 1ZQAA 4E7HA 7ICSA 1NKEA 1IG9A 4YVZA 5DGAA 1ITGA 1ZQRA 3VQPA 4DQQA 3MAQA 2QKBA 2OZMA 8ICSA 5CYMA 3OYAA 4BXOA 3RH4A 1SV5A 3QEIA 5IIJA 1RT2A 3MGIA 3ZSYA 4I9LA 4BE2A 3Q8PB 4B9SA 3V81A 3NAEA 1ASUA 1ZQIA 2BCQA 1ZQYA 5KFRA 2BQUA 5CZ1A 3RR7A 3LP3A 1CLQA 4P4MA 2AQ0A 1QSSA 2EX3A 3ZCMA 2A1JA 4ED6A 1HNIA 3O3HA 3GILA 9ICHA 3B6OA 3V7JA 2Z1HA 3AV9A 1VSJA 3NH0A 3RWUA 3ZDCA 1ZQNA 3G6XA 3TFRA 1U47A 4OPJA 4IBNA 1F21A 3GV8B 3DLRA 3C5GA 3BQ0A 1DTQA 2J6SA 5KRTA 2XGPA 8ICNA 2W9AA 1YTAA 4JS5A 4ZH4A 4KLQA 4G1QA 1U48A 5KG5A 2YHBA 4FK2A 5FRMA 4YNQA 3S9HA 3NTUA 3LK9A 2XY5A 2XRIA 4DSLA 4RQ8A 2ZTEA 4FS2A 4ELUA 3L2VA 4AILC 4DSIA 3M8RA 3SI6A 2ISOA 4RZRA 1J9AA 3RB3A 2P5GA 3MECA 1S9FA 1BPZA 8ICEA 4QZFA 4DQPA 4M3WA 4F92B 3BQ2A 3RRHA 2OPSA 3V9WA 8ICIA 1XSNA 3ZT2A 4IFVA 4TURA 3M8SA 3CYMA 3KLEA 4Z4CA 1A76A 9ICRA 1SUQA 1RTIA 3V6HA 1U4BA 3GIIA 3RAQA 3LALA 2C22A 3C1ZA 1NK7A 4E7IA 2ZUBA 9ICQA 4RW6A 4QW8A 3KKRA 3LANA 4UB1A 4ED1A 2FMPA 1T7PA 5KFOA 5I3UA 4YMMA 4DQIA 3V6JA 1WSGA 2VANA 2B5JA 3GDXA 4PHAA 3QEPA 1ZBFA 3Q8QB 1GOBA 4O3RA 4CJLA 4YFUA 3MDCA 1C0TA 5KTQA 3AVHA 3SQ0A 4LSLA 1S76D 1JXLA 2IA6A 3VQAA 3RJIA 2ZTDA 3QLHA 3UIQA 2DTUA 3LAMA 4C8LA 1XSLA 3SUNA 5KRSA 2YNIA 1U9LA 4I27A 5J2FA 4MF2A 8ICTA 1Z00A 4RPXA 4BDZA 2ZTCA 3HJFA 4DLGA 4FJXA 1TK5A 3M8PA 1IKWA 4CK2A 4C8NA 8ICGA 1TGOA 2ATQA 4C8MA 4YD1A 3GIMA 5DMRA 3GFKB 2XHBA 4PY5A 4CHQA 1EKEA 3C23A 3AVIA 1TL1A 1ZQUA 1RT3A 1S10A 4AH9A 1U49A 1DOQA 2LYHA 8ICFA 2V4QA 3QEAZ 4KTQA 2HNYA 1TKDA 5BOLA 5IIIA 3RH6A 2D0AA 2WOMA 1C6VA 5KT5A 3H40A 4C8OA 4ECVA 3KK3A 3OHBA 4TUSA 4NLGA 1ZQDA 2EHGA 4KRFA 3LDAA 3O3GA 3M9NB 1CUKA 2Z1GA 3DOKA 3OJSA 3JPPA 4KI6A 1UOCA 2PYJA 4CJSA 1DTTA 3VQBA 4CJTA 4EP4A 7ICVA 1WSHA 5BPCA 8ICVA 4FW2A
chains in the Genus database with same CATH superfamily
2QWRA 2DNNA 3LM2A 1ZQPA 2R3VA 2BGWA 4LH4A 5D0RA 3DOMB 1I3AA 1WKJA 2G8KA 2G2OA 5AKKA 3OLAA 5FPEA 5AICA 3HHLD 5EOYA 1EETB 2JEIA 4CRJA 3AMZA 2CUYA 1FJGF 2CQDA 2XO7A 4YXJA 4IWVA 4DR2J 1CXQA 2KXFA 2W7PA 4FWSA 3VETA 4RBTA 4NCGB 2DNKA 5KFLA 1KEJA 2FHKA 1CZBA 4C7ZA 3PACA 1A0PA 5AQZA 1KXPA 3FE1A 3NF6A 3NBPA 1FFWB 4KLTA 2GHWA 4FCYA 3PTWA 5SWMA 3UR0A 3NNCA 2PFPA 1NGHA 5F9NA 1AUDA 1BQMA 1ZZNA 3AVMA 1YRXA 2EBEA 4M5GA 4F71A 1E4GT 3O6WA 5EX3A 1JLBB 1SH2A 3SZ2A 2E5LK 3ET6A 2HPUA 4I2QB 5L9NA 2K89A 2X3DA 3CD0A 3JB9k 1UJ4A 3OT9A 3PW4A 3QUQA 5J2HA 4OZ0A 3VESA 4IH6A 2E1CA 4EBCA 4KBOA 1S5JA 3J81U 1WOSA 1WSIA 2NPIA 2HHHJ 2GJ2A 4OJHA 2DR7A 4OYMA 2W9CB 2I5HA 4I1TA 3I56N 4PPXA 4CFCA 3FRZA 3ZX2A 5A0LA 2QARB 2IY5B 4C7YA 3DRRA 2GH1A 1BOTO 1F60B 3VQ6A 3CO0P 4OHXA 1C20A 1B0PA 5HVGA 9ICBA 1LB2B 4TQRA 3I0RB 9ICEA 1WJ9A 1Q4RA 3PX4A 1WTBA 1SL2A 2UUBF 2LI6A 3D2NA 2V7YA 4NLSA 3AFGA 3K2PA 2UUCF 5K5MA 3NF7A 3B4DA 4O5CA 4RW4A 2RS2A 4ES1A 3O08A 2Z1IA 3M2RB 3NGDA 1HNVA 3E66A 2CQPA 5B66U 4LMZA 4UATA 1S72S 4GNIA 3E58A 3TX0A 1WC6A 1FKAF 3D1OA 2D8CA 1Q46A 5J1NA 4FVMA 3S41A 4IOCL 4LIRA 1LWXA 3B0YA 4FZLA 2HK3A 4FFDA 1UPHA 4ATNA 2HWTA 2NLXA 2C2NA 3F0NA 4O5FA 3PVXA 3AVNA 2XBPA 1RBAA 4DX6A 4OYWA 2F4VJ 1XR6A 3C28A 4LF9K 3MGHA 2YHXA 5IT4A 3V1OA 4X4VA 5LMUF 3H2LA 4FZYA 3HHNB 4CLPA 4EZ9A 2AIRB 4CBWA 1X9SA 4A46A 1QVFR 3CMAN 4N76A 2KK0A 1JNRB 3FEZA 1P90A 1Y11A 3JTOA 2HYIB 3QT6A 1DGKN 5AKGA 2W40A 1L3KA 4DTXA 4FKXA 4LFCK 3MMCA 9ICAA 4B8AB 2RQ4A 1QVFM 1FFGB 4KHPF 2XC9A 3N5BA 3HHLB 3S6JA 1KL9A 2IBOA 3TTDA 4U7CA 3R2CJ 5AHXA 3TJAA 3OS1A 1B0VA 4P2FA 1U2VB 5CHIA 2Y0SD 1QZ6A 3KHHA 2BJ8A 3QRRA 1HNXK 3MPVA 1FTCA 4RQNA 2JZBB 3SR6A 2HNZB 2YKNA 2ZH6A 2P9NA 2HQCA 3QNOA 2FVPA 3NCQA 3OFGA 4ZPBA 3H0MB 1QAXA 3X3UA 5J2GA 3C2KA 2O8BB 3MGVA 2I0XA 5LJ5Y 3PX0A 1S79A 3D7EO 3FZHA 2XICA 1YJ7A 3KBBA 4KPCA 4NLBA 4F9OA 1IKYB 1Y00A 5MLCQ 2ABYA 4GIBA 3QJPA 1FD2A 4NL9A 4AL7A 3F53A 4ZCIA 4DL2A 1HKGA 4H5TA 4O0JA 4Y2UA 4KPYA 1BI4B 4K43A 1JUDA 4CH0S 3V6DA 2FLLA 2QW9A 2M2BA 4LT6A 3JPQA 4CLWA 1ZD4A 3TA1A 1K47A 4QZAA 1BG3A 1R0BG 4F67A 4IQUA 1VQ8S 7FD1A 1K73T 2BUNA 2DNLA 3VAMA 3GDQA 1FEHA 1RT2B 2IM0A 4PKHA 3PCOB 3LGHA 5EOZA 4WYWA 5DK5A 3SQ2A 3PSPA 2QWOA 1P1LA 1PSDA 2YWGA 1U25A 3RUBL 1FJGJ 1OS5A 4JI1F 1FJCA 3TARA 3BPSP 1A0OB 4MAKA 3F5EA 1ZBLA 1OYDA 3AL0B 3AAWB 1RDBA 3J80Y 2XVTA 5AKIA 4RJVA 5A0YB 4QYRA 5BOMA 2Q0ZX 1VQYA 2J5AA 2O4GA 2HAIA 3QO9A 2A1JB 2M8HA 3W3DA 4UTGA 2PO4A 4CLZA 1T3QA 2BCVA 3HULA 2HG4A 4QPTA 3RFAA 4TXSA 1ZBUA 5ETOA 4ECSA 1TKTA 3BSOA 2E7VA 4DFPA 1X9JA 3MUVP 4CESA 2LA6A 4Z4FA 4YB6A 5LT5A 1S9EA 2LYVA 1DTQB 1G99A 4CZHA 4YR3A 3RAXA 1W2IA 5FLXY 5DKWA 3DOLA 2KHCA 4JKGA 1GLLO 1N6QA 1NLKL 2K1RB 2KJ8A 1QE1A 2XI2A 3IAS9 4E0DA 3DXMA 5ALIA 5KFGA 4OI6A 2WSCC 1FESA 2IOFK 5C10A 4MLEA 3UW1A 4Z7YA 4WKRA 1RB0A 4YQWA 1PAUB 2EC0A 1MLAA 5AQMA 1CJUB 2A6AA 3E01A 5M1QA 3V72A 2MKCA 2E5HA 1FDAA 3BO2A 2PBDA 3OR2A 3ENQA 4KFBA 2UUBJ 2ETJA 2QEXS 1E6VB 2E8PA 2L41A 1CQMA 4CHZA 4Z6FA 2DT9A 2RU9A 2UUCJ 5KL1B 4DO9A 2JNJA 3DAWA 3T7ZA 3CDWA 2F8LA 4OL8A 4FWRA 1VDHA 4KH1B 3B54A 1RT4A 5FDLA 4DN0A 1QQ5A 2DIVA 3GE9A 4I2EA 4A8MP 4DUYK 2OYQA 1ZQEA 4N77A 3THXB 2EFVA 3PFEA 2W11A 1O03A 1VRTA 4Z2XA 2FJAB 3QFUA 1IXRA 5KNIA 2BCSA 3QETA 4I6MA 2V2QA 1N56A 5KFBA 3LWLA 5A2QO 1N4LA 4F5NA 2DGXA 1WC4A 3MEGA 2WB1C 2C2DA 5CB1A 1S6QA 1KWMA 4J9UE 4ZN1A 3M8PB 2FJ6A 3KDNA 3QMLA 3W9HA 3DLGB 5EWFA 3BQ1A 5EDWA 2OM6A 2KI2A 1Q3UA 3QQCD 1NHVA 2DVIA 2LVWA 4JYAK 1REGX 1U2RA 4PXEA 3KYLA 4KTZA 5BR9A 4JI2F 5J0OA 2BDPA 2HNYB 2QMXA 4RWTA 4KHPJ 1VOMA 4HACA 4OI2A 2WOMB 4OX9K 3EWAA 3VHQA 2QTWA 3AA4A 3KK3B 1QM9A 1CZ9A 1U8WA 2BM0A 4O44A 3UCGA 3LDOA 3VR1A 4X62F 3G8QA 1Q5YA 5AKJA 1H0HB 5JXSA 2DXDA 4RNOA 1QQNA 4ZCMA 2ZEJA 2D9PA 1ZQBA 4FLVA 1SXEA 4FXWA 1WEZA 4CJRA 2Z4PA 3EGNA 5KFCA 1A5VA 1YT3A 3VF4A 1YHQS 4AYBC 1I3OB 5F9LA 1ZM4A 3HZEA 1FXRA 4XDCA 2HQ3A 4HYKA 2F8TA 4KH4A 3D3BJ 4NYPA 3MR3A 3UFCX 5KFIA 4MIBA 3VGUA 5B0GA 4JB8B 3WC0A 4YDUC 3CNHA 4F3TA 1RK8A 3HSDA 3L95X 1DAXA 3I8DA 1NNDA 5J0PA 4J9MA 4DTOA 1KOHA 3UVJB 4R63A 5AZIA 4O4RA 4QZBA 2W3RA 4BROA 3T1YK 2WK4A 2C2KB 4PHPA 3I1YA 4LZGA 4Y65A 5A2QU 4MFFA 3MPWA 8ICXA 3W7BA 5EHHA 1LWCA 4AHCA 3MDQA 3SI8A 4HTIA 2O66A 4M5KA 3C3LA 1BDGA 2YHYA 3JSRA 1BIUA 3CJ9A 3WQTA 3OXFA 4XA5A 3VQQA 1TUYA 5ALPA 1QY7A 1L6NA 2DYAA 1DXSA 2NREA 1ZQLA 7ICRA 1OJ4A 4YMOA 2YQ0A 1S77D 1Q79A 1FERA 1HBUA 1KC8T 1ZOTA 1KW4A 3DJCA 2DWQA 3VEWA 2VIHA 3HPOA 2RF2B 2P51A 2M4MA 1TV6B 2EBGA 2NXEA 2OANA 1J97A 3LH2S 4FWLA 3C15A 5ALXA 5BPLA 1C2PA 2AKWB 3ZZRA 4KKOB 3LP2B 1D9AA 3GCXP 3OTBA 2OEMA 5AQQA 4BR4A 1Y3KA 1MWYA 5GVQA 5C25A 5AKEA 3DXBA 4LFBF 2ZWOA 1A6SA 1QH9A 5DB9A 4IUFA 1MW7A 2G0IA 3NGYA 2FSNA 3V4IB 4FBUA 3A5NC 2O8DA 3J7ZO 4EU0A 3FZ2A 4JV1A 3WK5A 4O5KA 3EE8A 1V6HA 4MIWA 1T05A 3HX0A 3L8BA 3BF1A 2PC6A 4KN4A 2CVEA 3ETRA 4EI2A 1NGGA 3K8VA 2OEHA 1R8HA 5F41A 4F5QA 1Q0NA 1VSHA 1BCOA 1VBZA 3EE9A 7ICQA 2YJEA 2ZD1B 2BR0A 4CIOA 3C46A 3PSTA 3KD3A 1QAIA 2IM1A 5HI7A 1FFSB 2HKEA 4MHVA 3LPTA 2VA3A 3WZ0A 3D6MB 1YJTA 4HH0A 3G10A 5IV3A 4IC9A 1RT6B 4JYAF 1D0EA 3CJ4A 3TWHA 3HTVA 1I5OB 3PV8A 2JRSA 1N54B 2LXUA 5CE3A 3SCXA 4ILMA 2IIRA 5AI8A 3T5KA 5H1SQ 1J5OA 3ULEB 1UFWA 2AYMA 1ZXIA 2KRRA 3W64A 3MOJB 4FPAA 1M1KT 3T6BA 3D7SB 4CECA 1NK9A 4DN9A 2BJ7A 4FBTA 1AYEA 1WI8A 2FVQA 4H0XB 1L5UA 4L8RB 4ANEA 2NRZA 5F8HA 6FDRA 3B8HA 2G8VA 2YY6A 1JMSA 2A40A 5KGXA 3SQIA 3MCNA 1XN9A 2KLAA 3QYPA 5K4LA 1EX4A 3AO1A 2RAQA 5HRRA 2ZH7A 3R27A 4ID1A 3R5DA 1IXKA 2BQ3A 1UT8A 4NLDA 3EW9A 5ETLA 2K8GA 1S1UB 2CPIA 5JRTA 3OTOK 3UD4P 4GMJB 1JROA 1E6YB 2VJ5A 4JI2J 3EDQB 3LF0A 4RTFD 4BHQA 1VSEA 5FPDA 4XDDA 5J0RA 3VGTA 1E4FT 2P9IB 3D6RA 3NS6A 3N6NA 1T3NA 4RPFA 2OTJS 2IVOA 3IWXA 3TA2A 1H74A 5HJXA 1SL1A 3MMBB 1RGIA 3HT0A 4NO7A 2R42A 4X62J 3JYTB 4F04B 4F4XA 2HK2A 4FLWA 1RDRA 3GE1A 4CGJA 4F7VA 2P9SB 3SENA 4C98A 5HNKA 4GLXA 4TN2A 3CCES 2EG2A 5AM0A 4Q45A 3GV7B 4URSA 3HFKA 2EWHA 1VBKA 3SUOA 2DITA 4OJ1A 2HQGA 2ZOMA 3OHRA 3U7JA 2BCUA 4ANDA 4JI6F 3MM5B 3UNGC 1IKXA 2WVCA 3ISCA 1BPXA 3ZT3A 2CQ2A 3TABA 3PIOQ 4YOTA 5CEHA 4XRHA 4H0TB 1AUSL 1RTDB 4MYTA 1OH8A 3DYAA 5GAEP 4PABA 1QLNA 3PW0A 3K57A 1X8DA 5HQMA 3UQ2A 1SIWB 3QZ8A 4Y2CA 3DRPA 3M5RA 3B8AX 1WUDA 3HZ6A 4O4GB 1N36K 1VJWA 5KFWA 4NM1A 1UEUA 2ALZA 3HP6A 1K6YA 2DRAA 4IDKB 2JLFA 1LCUA 5IIOA 5M1FA 3VGLA 1IV8A 2KT2A 2PSZA 5IT9Y 3AA3A 3EPGA 2AX1A 4QOZB 3E9PA 4CO2A 1YTYA 2J6TA 2KHOA 5J2BA 3N01A 4PWDB 4I68A 3CD6N 1ZQKA 2O6KA 3W63A 2XIDA 4ED3A 4YUDA 1S99A 2HBLA 4JI5F 2LXIA 3F5TA 4JBCA 2AWZA 2N4CA 3A3NB 3U8XA 2DBYA 4X64K 1HQUA 4ECXA 4M5DB 1B22A 4L72B 3FZMA 1CJTB 2IAJA 1RTJB 2HF3A 3Q0AA 3NG8A 2GIFA 2ZHAA 1LOTB 4CJ7A 2W4DA 2BPFA 3ZDAA 3VERA 4OYZA 3TJ8A 3IGVA 2KP7A 4LFBJ 2D3O1 2CPRA 4Q43A 2MKJA 3HHKA 4YOVA 2VG6A 4K25A 2R7XA 4USJC 3VCBA 4QBUA 1N8RO 1T6CA 1VQNN 4DBQA 3VQ9A 2RNEA 3ZDBA 2IRUA 5IIKA 4FE3A 3BYRA 3TVYA 5DQHA 3P5TL 3I76A 3B78A 1X42A 4K8ZA 1TKXA 4QAGA 3C1YA 4OI4A 1QHTA 3Q8KA 2NUHA 4ECQA 1RHMB 3CTRA 1WHXA 2G8HA 2CDRB 1B0TA 3OPKA 2GQ2A 4LVOP 3H4DA 5J0SA 3OSNA 1IQZA 2OXOA 2WVEA 3HJVA 1JCFA 4GV9A 2GVZA 1RTIB 2CG4A 3F2KA 4O0IA 2ALYB 3SUPA 4YD2A 2O8EB 4Z94A 3NNAA 4K4WA 2PFNA 2K1RA 3I5BA 2MSTA 1X5SA 4CZJA 1IBLK 3Q8RB 4NYFA 1CG2A 3PJ9A 1NZBA 5DBAA 1WF1A 2A2CA 3KLIB 3GR0A 3KUGA 3P4IA 1LFWA 1OH6A 2DGUA 3ZC4A 9ICOA 4WIIA 4MKYA 4RQ0A 5DQGA 4CD1A 4Z4IA 2IOCA 1ZQSA 4CW7B 1RYUA 5AQLA 1N5YA 1HQ2A 3SCIE 1U26A 4UAYA 3I56S 2W7AA 5CP2A 1NGEA 2EC2A 2HOEA 4CEOA 1BY9A 3ZDEA 2PI5A 4ZP7A 2Y9HA 2GV1A 1ZXOA 1S7IA 1VBXA 1RDFA 2MSNA 3DGVA 2G5HB 3W9IA 4Z4HA 2YPYA 2YNGA 4KLHA 4LC9B 3FGVA 8ICJA 2C28A 1RKIA 2IVPA 4Q0BB 4KGMA 3CCLS 2IYIA 2EW9A 4MIAA 3P45B 1M90O 5LSOA 4CGIA 3O1BA 1S1XA 5ELZA 2E88A 3KDOA 1RP5A 1Q86T 4DTUA 5CZ2A 1U1PA 1RTHB 2FQQB 3IR7B 5FPNA 3AXKA 1YBUA 4QYZK 4FF3A 4CH7A 3AD7C 2DHGA 4KE5A 1ZOLA 4P2HA 1VHIA 3OVBA 4DV6F 1U24A 2E8OA 1HLUA 3I4PA 4CEFA 3OXGA 2A6OA 4FJ7A 2XMJA 2ZWPA 2M70A 3CT9A 3DLGA 4A8FA 3O5TB 3PEJA 5KQ8A 4O55A 4DV2K 5KG0A 2EXUA 1VK0A 3AA9A 5J0QA 5HMMA 4WP8A 4DFKA 2KKZA 2KN4A 3W62A 4DTPA 2B6AA 3NEKA 4WFYA 1IQTA 3VGSA 4FM2A 1ZQOA 4DCOB 1JALA 4MKAA 5CZXA 1DK3A 1SZHA 4M45A 3G2XA 3VAFA 3CMAS 4CEAA 3MMAA 4IOAQ 2FPMA 1NCLA 2JSXA 4JI8K 9ICIA 2ZWHA 2F3NA 4UQTA 4JI6J 1RAGB 2QB1A 1XO1A 4B1VA 3RBEA 5HR7A 1JLEB 4US9A 1S6OA 5AE2A 1BUPA 3T1HF 2BANA 2L08A 2AYEA 1HBMB 4E1JA 1Y5LB 5AI9A 4LF8K 3R7NB 1P7DA 2A6MA 1UA1A 1KQQA 2F44A 5J1PA 3KLVA 1H7WA 2Y0BB 4BRNA 1WLJA 2F96A 2XY8A 1ED1A 5KFVA 5GINA 3MTKA 2JRZA 3RMAA 2DH8A 2X1FA 1S4FA 1XJWB 5HMYA 3UVJA 4YHHK 3AUOA 4W5NA 2V63A 3HD1A 4J9KA 1RZTA 2WONB 2J0SD 3FK4A 1AT1B 3BGOP 2ASPA 2ASDA 1SC3B 5CXTA 2I1RA 2W9BB 5E5NA 1HWLA 4RKUC 3A4TA 4PHTX 4JUZA 4GFJA 3H8JA 1NK0A 1G2EA 3KKAA 4JV0A 4BS2A 3K1ZA 2LKZA 1RPLA 5J2CA 4JI5J 2N3LA 4LR8A 3L6QA 3KUEA 4CEQA 4RUBA 4ZVPB 3CIZA 4N41A 1FJ7A 5IT0A 3J7YU 1IBLF 2P9LA 5FRNA 3G9CA 3EYZA 2YX4A 1DEJA 4IO9L 2BM1A 3ENVA 4PL8A 4ES3A 5J2NB 2VG5B 1SZ2A 3AVBA 5KG6A 3W65A 2HHVA 2WRMA 4DR3K 1KTQA 2YX8A 3HHDA 4BRPA 7ICOA 7ICKA 2NLWA 2K8BB 4M0AA 2F77X 2MJUA 1ZQZA 3GOIA 4LRAA 5AM2A 3N7SC 1WKLA 1IBMK 4UY8T 3TR5A 3ZSZA 1S1WB 3QEXA 2ZJPQ 3C29A 1XNRF 4G3IA 1BQNA 3MOZA 1T03B 1RHKB 1RDWX 4M94A 4ZPAA 3KHLA 2P1JA 4FYVB 3QU9A 2XMMA 3L3CA 4HEA9 1NDPA 8ICQA 5IXUA 1S0VA 2LQ9A 1OXJA 4O9MA 9ICFA 3L0QA 1HA1A 2AJFE 1X31C 3UD5A 2YB1A 2KFYA 2BX6A 3WKEA 4DQRA 5H9FK 5EE0A 2OP5A 3ORYA 5AQOA 1WHVA 1VLBA 3HWTA 3QIPA 4Y28C 7ICFA 1C0UA 2NUUG 4B9VA 2JGUA 3L7UA 2P6SA 3RYLA 1VMBA 4USHA 3WXJA 3S01A 1PK3A 4EBEA 2UU9F 5AM5A 3GSDA 2VGNA 2ZBCA 2DPIA 2P5OA 3ENWA 1U0HB 4WJBA 1X4EA 3GZFA 2EH9A 3OLBA 1UP1A 3H5YA 4DV4J 3DGPA 3FBBA 2RRNA 4BRMA 5JLFA 3RW6A 2GOLA 2DQNB 3V5RA 5DDPC 4Y1DA 2VJUA 2ZXIA 2ZJ8A 4K4XA 3PO5A 2NV3A 4MF8A 1BA0A 2QIFA 4RQ4A 1H38A 5J0XA 3M32B 5AE3A 2KB2A 3BY5A 2HOFA 1GFWB 4OPKA 3K2YA 1T0TV 7ICIA 2ZDOA 2D1KA 4KLDA 3ZSQA 1KSPA 4CDGA 4FJMA 4M3UA 4YR0A 1KHVA 2XWXA 3CO9A 3R1XA 2O4IA 3V9SA 1S6UA 3H1QA 3PLAA 2O8FB 3M8QB 1M5OC 1QQMA 3QFHA 4DU1A 3M05A 1KONA 3IG1A 2A41A 1WHWA 1HYSB 1ZQHA 1RWUA 1VCTA 1JJ2R 4PYAA 3MZIA 2ZBQA 2CZVC 2FBXA 1BXNA 2GGPA 3UR3C 4B1WB 1XEZA 1NDLA 1V4TA 2IC3B 3W9JA 4LSZB 5CYQB 5F3TA 4Y2AA 1T3VA 2BW2A 4DV6J 3CJ2A 5B0FA 1NJWA 5LL6Z 2GZOA 1SXDA 4CNZA 4I67A 4DTRA 1KAYA 3VVTA 1REVA 3RZAA 3IP0A 3O8WA 3S8SA 2UVRA 4M5HA 1A77A 2AGOA 3PKYA 2RVJA 3OS2A 2BE7D 3A3OB 4WFZA 1LK5A 4ZVRB 4CZKA 2GC8A 4HTJA 2WBRA 3A5MC 2CG8A 4YOXA 1RM6C 1YZ7A 3MMBA 2W2MP 5CD4H 4QZEA 5DRKA 4I2PA 1WC1A 4BE1A 2DNMA 3QUBA 2GS8A 5J8YA 3ZZOA 1PIEA 1JRPA 4IRCA 4FWMA 1JN3A 1HWJA 2JEFA 3T1HJ 2I1QA 5IM0B 4CLFA 2P9PB 1N5WA 4P0QB 5E79U 4U7BA 1FF2A 2A1AA 2OPQB 2FBYA 4GKJF 5HMLA 2LLZA 1NK4A 2HQFA 4FF1A 5JMVA 5BRFA 3KFUF 7ICSA 3TAMB 3G6EN 1M5SA 1XR5A 1JI7A 3ONQA 2XEXA 3MM8B 4NOHA 3BUZB 4U7UK 5CYMA 5AI0A 1FNXH 5LXYA 4BXOA 2RSQA 3WIUA 1SV5A 1DZ5A 3D6TB 3DC2A 3W1YC 3O4WA 2IRYA 8RUCA 3Q8PB 1K73O 2I2YA 4B9SA 3V81A 2FIUA 3SMVA 4NLTA 1ASUA 1ZQIA 4WYLA 3VEOA 1PG5B 3CF5Q 1RSCA 3LP3A 2KG5A 3NRZA 5ALJA 2B43A 1JLGB 4V19S 1CC7A 2EX3A 1P8ZA 2UUAK 4HHHA 9RUBA 4PPDA 4PYDA 1V5IB 4ZVQB 1EKRA 1VSJA 3WK9A 3CJ1A 3H98A 2A2DA 3LDNA 3B9JA 4XPEA 3BQ7A 3BQ0A 1XNRJ 2J6SA 3QJJA 1CS4A 5M1PA 2BJDA 1P9QC 2EK1A 4KLQA 4JI3F 1U48A 4M1KA 4FK2A 5ALEA 2MZJA 2QA4N 4ER8A 3S9HA 3WXIA 3NTUA 3C65A 3CCUS 1NO8A 4B1XB 3QWPA 4DSLA 4US8A 4ELUA 2RRBA 1N33K 3L2VA 2QXLA 3FEYB 3SI6A 4ENOA 2ISOA 5CCLA 4LBHA 3HKZC 4WU3A 4OZ1A 3RB3A 2P5GA 3VGMA 2Q6CA 3NOGA 3MN5A 2E3TA 1S9FA 2PDAA 2PD1A 1MMNA 1VHXA 3KWIA 2OPSA 2GHVC 3V9WA 8ICIA 1XSNA 3VOVA 4IFVA 4TURA 3CYMA 3AAQA 3KLEA 4TYAA 2X1GA 4WXWA 2UU9J 1VQKN 1SUQA 1RTIA 3GIIA 2HMIB 3DDKA 3WEEB 1FI4A 5B8HA 1UVKA 2HVDA 2OLWA 3GZ7A 1OIAA 3QMQA 3UKRB 4C0ZA 5T7LB 2CN1A 3V6JA 2W6LA 5F8IA 3FC9A 2HFVA 2E8NA 4RLEA 1V9OA 5D4OA 2PFUA 3AVHA 3SQ0A 1S76D 2IA6A 3U9DA 3RJIA 1IIPA 2ZTDA 3ISZA 3QLHA 2M8DB 2IM2A 3GL1A 3AOAA 2DTUA 3LAMA 2B51A 4A8WA 4ZCKA 2DNRA 2QT7A 1XSLA 3MM9A 3EO3A 2JXJA 2GIQA 4K50A 4JD2B 1TKZB 1O8BA 4UT4A 3EKSA 4JI4K 2AT1B 4MF2A 2GQCA 5CABA 1DQ8A 4BDZA 2YWFA 4LFAK 2X3GA 4CBUA 1MMLA 3FJ2A 1TK5A 1FNMA 3FEXB 3JQJA 4C8NA 8ICGA 1TGOA 3H8MA 1SV0A 5IOLA 3GFKB 4GO5X 2XHBA 5DS7A 1EKEA 3C23A 1UVNA 4UB6U 4ZOSA 1TL1A 1RT3A 3HFVA 4PAAA 2OTLN 1RWPB 3POTA 2LYHA 3MGJA 1JMTA 4P10A 2IVFB 1LXJA 2NO5A 4KTQA 1MMDA 1H73A 2P9KA 1IG6A 2D0AA 2MTLA 2H4WB 3H40A 1N0VC 4NRTA 1XMQJ 4DG1B 4TUSA 1JLQB 3ELHA 5ALZA 4ZOHC 2JOQA 4MH8A 4LF5F 4EGLA 2R9LA 3LDAA 5U47A 4ZVOB 4CZLA 2D4WA 2Z1GA 3DOKA 4RL1A 5AKZA 4CJSA 4EP4A 7ICVA 3M30A 5BPCA 2ZGZA 4CNQA 2HS3A 3LDQA 5D78A 2GMHA 5JVHL 1UQVA 4JB3A 3I5AA 1X9WA 3NF8A 3PW5A 2HURA 3AVGA 3MN6A 1H7XA 5JVGQ 1ZAXA 4P4PA 2XTJP 3D2FB 1R7IA 1NZPA 1RYRA 2R7TA 4M63A 2VL1A 2RHKA 4HCBA 4J9PA 4K0KF 3EZ5A 1TV9A 5MAOA 2YWKA 2K8CB 3TZWA 3U6FA 2BHNA 4DU8A 4OPHA 3M1FA 2P9UB 1Q9YA 4ZPTR 2HFZA 5FROA 3V9ZA 2XCAA 4CTAA 7ICMA 3NF9A 4H03B 1LQ9A 1RAJA 4F8RA 3VMFB 2DCUB 2HMXA 1R6VA 3HSCA 2DY9A 2UXCK 5KFAA 2OMLA 5MLCV 3LZJA 8ICRA 3PNCA 1YZ6A 1WACA 2OHDA 2JWKA 5JS1A 3A3PB 3D0IE 4DL6A 2FZGB 2CADA 1XK8A 2MYFA 2I38A 4QW9A 1KC8O 4RQ7A 1XI1A 1DK2A 4I6AA 1OMSA 3R1LA 2GMJA 5FD1A 4NZ6A 1M5VC 5I3QA 3NGSA 4WXOA 1YQHA 3FLCO 4M9JA 3AU2A 1ZQMA 1X0FA 2CQ0A 1LWFA 3FAHA 2QWPA 5AJ3K 5EVZA 2BJEA 3MCAB 3HILA 4FJKA 2LP4A 1MWMA 3ZSOA 3C6TA 1YXQA 3QERA 3OR1A 3DLEB 5F3XB 5HO4A 4USIA 1IO2A 3IS9A 2KKHA 3L7PA 4LR7A 2UXDK 3T5LA 1WN7A 4QPXA 3UKUB 2UXBF 1X5TA 4Y2YA 1X66A 2F2AB 5D4BA 1IJEB 4KY3A 4JI3J 3CB4A 2O8CB 5E84A 3WUHA 5HATA 4CGFA 1NPPA 2FVSA 3BDEA 2UZAA 1S49A 1CQNA 2QFIA 2HVHA 4UAVA 2MQ8A 4B8CA 4Z6DA 1G7CB 1T03A 2DCLA 5CD4A 3QT8A 3CJ8A 4OI1A 3P5JA 3CFOA 1YIJN 4WE1B 3RMDA 1PZNA 4LFAF 5IIMA 1TL5A 3TAEA 3DLLQ 5LXRA 4Y2PA 1YVFA 4I0WA 4IKFA 1PC5A 1WF0A 5HOOA 2QMUB 4O3MA 1B64A 3EGWB 1L3SA 2H5JB 2H4YB 3AVAA 5EU7A 3LAKA 2QZ8A 3M8ZA 3UXPA 4BY9C 1TQLA 1S8OA 3GIJA 1D09B 5GADU 3UDCA 4B3SF 3CCZA 1G4CA 1FO1A 4X65F 1U1OA 4WYBA 1I39A 1NMEB 4IG3A 1GEHA 2ZC4A 4M3TA 1H2VZ 2FJBB 4UB3A 3QU4A 2JLEA 5L8RC 4DUZF 3Q8VA 1UPMB 1GQEA 2QMWA 4RNMA 3AD9C 3QYYA 1U0HA 1N88A 3WDOA 2OJ3A 1WWHA 1M1KO 1AQ6A 4P0PA 4RUHA 1FEEA 4QWBA 1Q82T 2GHPA 4OZ3A 4B08A 1NJYA 1WG5A 4ID8A 4IQTA 3KLGA 1WOQA 3I33A 1S1TB 2H51B 2GW8A 2MZRA 3K5PA 2WAQC 3FMWA 1AXQA 5AZJA 3D9BA 3MM6B 5FPMA 2DNHA 1EZZB 2E2OA 3OYNA 1MU2A 2ZJQL 3O9RA 1FK9A 2GCFA 4IQMA 1IG8A 4PWWA 4PQUB 1Y5IB 2E1YA 1HMVA 2O8FA 2XHWA 5A8WB 5DG8A 5A8RA 1S6PB 4FJLA 1JXBA 4IG0A 4DR4J 2BOPA 3HOSA 2ZE2B 1EX8A 3MBYA 2AJ0A 1KLMA 4KLGA 2HB5A 1Q9XA 3ILOA 3H8SA 3MEDA 2KJ5A 4U8VA 1SBRA 1FIQA 2V8DA 2HHUA 5JJBA 2JEJA 4LF5J 5A8KA 2ZH3A 2XI3A 4FF4A 2DEJA 3H8YA 3NH2A 2B21A 3PJWA 1UL3A 2C3UA 2KSOA 2CGJA 2QYCA 1ZQGA 4MTPA 3CRXA 5C42A 5AQHA 1DLOA 5B0BA 5JVGL 4EFHA 1Z3EB 3ALRA 1VSIA 5K20B 4USTA 4JWMA 1BE4A 4QZGA 4W4MA 5IV4A 4LY7A 4QIVA 3SFGA 2LEBA 1KAZA 1QAYA 3IAYA 1RDAA 5E3QA 3ZZZA 2ITGA 2E5IA 4K0KJ 3QNWB 1HBOB 2KKVA 3IG8A 2FSKA 2B6GA 3W5XA 4JHDB 2MGZB 1IR2A 3GFXA 2NRVA 2HNDA 2WBNA 3WKBA 1EIYB 3OYIA 3OTCA 3IP4B 3TACB 3IBWA 3D28A 4LBIA 1F0XA 1FKPA 3BSAA 3NS7B 3US5A 2V9KA 1TK8A 4JKCA 2DGZA 5L1MA 3LP1A 3CFPA 1Q3VA 4C3KA 1J27A 1HNIB 4F0HA 3B4MA 5C2GA 3R97A 2E8AA 3RJHA 4B3TF 3ISNC 5HMZA 4O3NA 3L4IA 3M6KA 5AIAA 3OYLA 2R8GA 4C8ZA 4KGVB 2GA7A 4F36A 4OYPA 1J53A 2W8KA 2QG9B 1U1QA 4X2BA 4DUYJ 4Y0WA 2RU3A 3TPQA 4YP3A 4MFBA 3NL0A 2HRTA 4DTJA 4EAHD 3AB4B 4OMFG 5AKLA 2CPEA 4GXKA 3EXCX 3QWUA 2E20A 1GMUA 2HVZA 3GJRB 3HLUA 1X2IA 9ICTA 4KREA 2IGIA 4JV2A 4CJ5A 4LVNP 4DV3K 1AW0A 1WC5A 3OD2A 4NX9A 3MECB 1HIYA 3OFFA 4WTOB 3SLCA 4TNOA 2KD1A 3J7YI 3J80O 2UXBJ 2ASYA 4K8XA 2GELA 5H9EK 1QQ7A 2FHJD 2CAJA 4NI2A 4KHYA 3UN3A 2RPIA 1AA1B 2O1PA 1UVJA 4C4TA 5HLFA 3NE6A 1YVNA 4X4SA 3CG7A 2ZKUA 1RHJB 2ZHOA 1HW8A 1U1NA 1FRMA 1S57A 3HT3A 4RW6B 3EL2A 5I3UB 4YY3F 5IWAF 4KB7A 2XS7A 3G6VA 3M6VA 2QSWA 4EK2A 3KK2A 2VA2A 2DHAA 2A3VA 1T11A 3KZXA 3KWMA 3MXMA 1C0TB 3BS5A 4OZLA 1X40A 2NRWA 4CZCA 4UB5A 4A8KA 1GLJO 3J81Y 2P2CB 2B7BB 1LKYB 2XSJA 5DG7A 2MPUA 2YNIB 3OL7A 2AH5A 2ZBRA 3IBFB 4ZVSB 3TR8A 4URQU 1L7OA 4X65J 3CMEN 4J2BA 1Z00B 1FRIA 3IR6B 2LFVA 4RX6A 4IQWA 5K14A 3RJEA 1C4CA 2EI5A 1N5VA 3R7SB 4DUZJ 2JV3A 4OKKA 2Z30B 4JOUA 4AHUA 4DPYA 1DGJA 2YN4A 4FYWB 2JX2A 4QQBA 4CHOA 5C7PA 1A7GE 3D6FB 2DBBA 1EJ7L 4FK0A 2C42A 4B3MK 2DGQA 4DSJA 1RNHA 4E1MA 2H5EA 4I9QA 3AVCA 3HRDD 5CQGA 1EAYC 1HNWF 4IH7A 3ZZPA 2IS3A 2E1FA 5CRXA 2IMOA 3P4UB 5GTIU 2LEPA 4DV7F 2FSJA 3ZDDA 2XY7A 2K7JA 4IYQA 3J80U 3VPZA 4BR5A 4M9LA 9ICNA 2YNFA 3K58A 5EN1A 3RMCA 4ZVUB 3CEDA 2HLUA 3I5CA 3AHPA 3RRKA 4RBUA 3R3LA 3QUCA 2VONA 3UCUP 2BH1A 2BACA 3NGIA 4C8KA 4W98A 2QL7B 4ZLJA 1OSCA 3A2FA 3DRSA 2IVMA 2BABA 3HHLC 2WTUA 4CIEA 1O6XA 1HRHA 4DL0C 2MUTA 1ATNA 4P73A 3JXOA 4J37A 3CVKA 1TU0B 5AFUH 2GUIA 2Q4TA 3R5BA 1S5ZA 2NYVA 3CJKA 1VQLN 3UPFA 2X78A 2N4DA 1DY3A 1B92A 3AXMA 4FVCA 4DZDA 3JAMO 4FPRA 1ZQTA 1N32F 3NBPB 2QKQA 2CJAA 4IO1A 2ZJAA 2YNHA 4DTSA 4DF4A 1BQMB 2FJEB 4PKDB 3D45A 4WQ5A 5AQIA 2VG7A 3D5MA 2XO6A 2DY1A 1UEVA 4ED5A 4CDIA 3ET6B 3MEEA 3AOCA 2IFXA 1MROA 1CBKA 3RJMB 2NPFA 4DR5F 4YN4A 8ICMA 4V1Ak 3R6MA 1Q7LB 5DB6A 2NYIA 4CEDA 3M6XA 4IR1A 5AXKA 2POKA 4ID5A 1TMJA 2VC1A 3H2UB 4KSEB 3F73A 1RDUA 3AGKA 2PE8A 3V9XA 1GX6A 4DOAA 3AO2A 3R5JB 4B3TJ 2QB0A 4HVJA 1VQ7N 1HR0F 3TO8A 4UBBA 3TADA 3KNGA 4RT2A 3T5HA 5KFZA 4PGQA 1VQ9S 2J0XA 3DRRB 2ZZNA 4DPWA 2RHSB 1S3XA 3H4BA 2OPRA 4FN5A 2RN2A 4DL5A 4NLNA 4AFFA 2C3MA 3P3DA 5KFMA 4QIFA 2IHMA 4I56A 2FMSA 4WP3A 5AKHA 4KJIA 2Q1LA 2G1DA 3I4HX 4E7LA 3CJSA 4U8YA 4E3SA 2DFLA 1WUUA 2QYGA 7ICTA 5KG4A 4K42A 3G6ES 4C6AA 4G65A 4DR2K 4QIGA 4ERDA 5DETA 4RW4B 2HLTA 4USWA 2XS5A 2Q31A 3PMLA 1HNVB 4YOWA 3QEVA 3WK7A 1N48A 4KV8A 4TYBA 1PJ6A 1X0PA 3JAMU 3VV2B 2GJFA 3WC2A 4ZJOA 3V7KA 1V3RA 2Q36A 4P71A 4CF1A 1RGVA 1IH7A 3TZYA 3ATUA 1NZAA 3GIRA 3QATA 3DRXA 3AM9A 1YJ9N 2ERRA 3DMJA 3UI3A 4UY8O 3R9KA 1QUVA 3VA0A 4EIAA 4LJMA 2IHNA 4DV5F 3G0ZA 3O1WA 1ZBHA 4N5SA 4LRCA 4H4OA 5ALMA 9ATCB 1YJWS 3MD1A 2HWIA 5IWAJ 1AFJA 3VEYA 1S1VA 4GKKF 2WVDA 2V94A 5KG7A 9ICXA 4EFAC 4A2BA 2HHHK 5ETMA 5HVHA 5AQPA 2PMZF 1FKOA 3U4LA 3GJSB 4MJKA 4EX6A 4NCBA 3D2WA 5F2RA 1QSYA 1NHKL 4MQ3A 4P2SA 2RLTA 1DQ9A 3J8AA 1V3SA 1WEXA 2E1ZA 2R7YA 3UXOA 1RHQB 3MMCB 2Y0SC 1VHFA 2N82B 4FJ8A 2E2QA 3MXHP 4YG2A 3MUTP 1G15A 4LZDA 4NLWA 3CI5A 2B9XA 2G2YA 1ZTTA 2FD2A 4BRFA 3LZIA 1N62A 1OY6A 2A3JA 2YKNB 2P9NB 2L9NA 2IBKA 1CEZA 7ICJA 3NWRA 1SKRA 1ZBTA 4D3GA 3ZI4A 4CERA 5J2DA 2K4PA 2DGOA 4BUGA 4XK8C 3L2UA 3CDAA 8ICZA 2VU5A 4DV7J 1HUXA 1X3NA 4C23A 3R2DJ 4Q8EA 2PAVA 2BPGA 3K9KA 2ZIWA 3MAAA 3MFHA 3O5BA 2F4VK 9ICMA 1KNZA 3Q24A 4TU9A 3MCSA 2QGFB 2D9OA 1MQ3A 4DU3A 3V6DB 3CE8A 4FJ9A 3IC1A 2VOPA 3PHEA 4XEIA 4PXCA 2JC0A 4X64J 2ZJRL 4L3KA 1IJJA 4IQVA 2WSFC 4IL6U 2MKSA 2RE1A 3NRWA 2NSBA 3BGLA 4M04A 2LDIA 4O3SA 5LMNF 3JPRA 4DU7A 5FP0A 5IC4B 3M9MB 3M1YA 2FC8A 2CH6A 2AD9A 2WF7A 4FOEA 3UO0A 4CGGA 2ROPA 3I0SA 4ED2A 4FJJA 1HX1A 1ZETA 2FJWA 1GMWA 3PYEA 4OLPA 3ZZUA 5KFEA 3FZFA 3HD2A 4EO6A 3QBXA 1RWOB 3FRYA 4CYUA 4CJPA 1YF5L 2C2RA 2P9EA 3GV5B 2BE2A 4R64A 3IFEA 2JVRA 2FVRA 4DFJA 4N7TA 4NCAA 2VPYB 4DX5A 3SQOP 1IBKF 4H5WA 3QO9B 1HYZA 1N32J 2OTLS 4FYDA 2I7NA 4F2RA 4BWJA 2YB4A 1SKUB 3HPHA 2VQFK 3O2IA 5KOXA 4E98A 1TKTB 2Y1LB 2GMLA 4AXJA 4MO4A 1QQCA 1UFKA 1S9EB 4GV3A 2VA8A 3EZWA 4DR5J 5L1IA 1V9PA 1HJRA 4A8QA 4ZS6A 2YTCA 4X4QA 3CCQN 4GXJA 2MA1A 5D0GA 2PFDA 4KITB 3HDSA 3DOLB 4JKGB 4F0KA 4UW9A 1N6QB 1WD6A 3BP8A 4M9GA 5F1XA 1QE1B 4GW6A 3DXMB 2D1CA 1Z1ZA 5ALUA 1HR0J 3A5OC 2Z2YB 5LM7E 1QSLA 2LQ5A 4A8EA 2R7OA 3L7OA 2NRTA 3PEHA 3E01B 1O51A 2ZFHA 3K75D 4JP8A 1RWKB 3N6MA 4QJVA 3U1NA 4JK9A 2BMBA 5A2QY 3P39A 2F1IA 1SAZA 3OR2B 4KFBB 5CYJA 5KFJA 4ZTJA 2WTFA 4Q7AA 1RHUB 4RQMA 2W54A 1FJGK 1TFRA 1XHXA 3GB0A 4ZJLA 3S3OA 1U09A 3PSFA 4M95A 4Z4GA 2P35A 1VIXA 8ICWA 4HKQA 1RT4B 3A0IX 1RISA 3F2CA 4P75A 5FDLB 1C1CA 4DOCA 2ZUGA 1P8GA 4L74A 1UVMA 2KIWA 1WNEA 3CMQA 2BE9B 1WEYA 3HRGA 3CFRA 3H5XA 3FSXA 1Y88A 5E3RA 1VRTB 3IN5A 5AQUA 4QYZJ 4E7KA 2HZVA 4I6MB 3L4PA 4J9NA 3OFHA 4DV5J 1RU1A 1UZDA 5AFUA 3TUPA 2KHQA 3NVMA 4EBDA 2VKQA 3MEGB 5GAGP 3PIPL 4DV2J 4NMLA 4MMOA 2QA1A 4GKKJ 1S6QB 4BACA 1ZQWA 4IOCQ 3TAPA 1CJKA 1PYTA 3VAHA 4WQ4A 4OPAA 4CIFA 3NVZA 4X66F 3SXLA 3CPEA 2G5IB 3DLKA 2CQCA 2F4VF 1XSPA 3PX6A 1P27B 3CM5A 2ADBA 2HSZA 1ATSA 1Q1KA 4A2AA 1S9GA 3Q8YA 2GAGC 2QK9A 2V0NA 1SVDA 3OYEA 2M7SA 4IXCA 4LF2A 1RZMA 4FYYB 4TKTA 4HACB 4CO5A 3BR8A 4GY2B 2UUBK 1DKGD 4O44B 3T19A 2UUCK 5GAHP 3SBGA 1M1GA 2OSRA 3FCVA 4ZA1A 2X6NA 4CLKA 2VF3A 3EUNA 5M1KA 4FO0A 3TA0A 4KHQA 3DLJA 4IRKA 1SB3C 4YB1P 4MFCA 4CE9A 4F5PA 2H1YA 2R8HA 3PW2A 1U45A 2BEFA 2VFTA 4U96A 1WUAA 1YITN 5GADI 4NRUA 3C2LA 2DTJA 1KVBA 4H4KA 4UOFA 2E9ZA 3WKDA 1LKZA 5J2KA 1XBWA 2NUBA 1JCEA 5AZIB 2NO4A 3O44A 1KOOA 4DL4A 4NLCA 2W2OP 2DPJA 4AQYF 2ZIXA 2BRLA 4W92B 2OSQA 2VC0A 3J7AP 4DWIA 1BO5O 1LWCB 5LMUK 2I5JA 4B9QA 3R1HA 2PXIA 4LF4J 4DSKA 2Q0RA 3HKZF 1V38A 5DDYA 2AGPA 3RSEA 4NLZA 5AI5A 2RKIA 4FJHA 2B3TB 5LMNJ 1FFUA 2XY6A 5G0RA 1VSMA 4PEOA 5C15A 2H5XA 1HBUB 2ZZMA 1KKHA 5L1KA 4B3RF 5J8YC 4NA2A 3WNHA 4BRKA 5IQ6A 1C0MA 3M9OB 2YTUA 2ZNYA 4KHPK 1CVJA 1FFVA 5EWGA 2NXNA 4DPOA 3TRGA 1DARA 1TL4A 4Y2VA 8ICOA 4K5SA 4IO8A 3WNFA 1WI6A 4FF2A 4CZIA 3L3VA 3C15B 3AA5X 3C5FA 3KD1E 4C4RA 2R2TA 3PY8A 2MKHA 3QU5A 1IBKJ 2DNZA 1FWPA 1ESVA 3TEHB 2W3SA 4AHRA 3LP0A 4PQAA 5C25B 3LOUA 4CF2A 5J2QA 1QUPA 4Y2JA 1F3FA 2M52A 5IZHA 2WSEC 5CJ7A 1X5OA 3D68A 1KFSA 1KN6A 3I9V9 1RAIB 4PKGA 3TKAA 4JKHA 4AHTA 2W9MA 2D7SA 2IDLA 2DNPA 4JI7F 3UPQA 1RBLA 2O8DB 2VASA 3RJFA 4A8SA 2NYHA 1T05B 1AROP 2XCPA 4CJFA 5BR8F 3ZTQA 2QV6A 2R8JA 4UZCA 1Z4OA 2IJFA 2F1JA 3D0PA 4Y34A 3CDEA 5ETKA 4C2MA 3DI6B 2PMZD 1JIHA 2FHJA 3KG4A 4ED8A 2AJ4A 3N6LA 1BMQB 1EARA 5CAAA 1PYSB 1XR7A 1T3OA 3L2RA 4CHYA 1NPKA 1GLDG 5HRSA 4WK3A 3I9ZA 3SV3A 3CCMS 3A1YG 3DKDA 3L2WA 4RQ2A 3LO3A 4CNYA 2X6SA 4OI3A 4DMZA 2HHPA 2QA2A 4KT0C 1EKSA 3CJ3A 4M5LA 4AL6A 1WCLA 1VQ5N 3E0FA 3PNIA 5KI6A 4TY9A 1ZBSA 4JI1K 3W2VB 7ICHA 2IYGA 2KH9A 4X84A 3V9UA 2DGWA 5KOWA 3VN5A 3HKWA 4OJ3A 3R6GB 5HP1B 1K1SA 2IJNA 1S22A 3RMBA 2K4HA 2LPEA 5L1LA 2ZOGA 3W66A 3RU0A 2ZF5O 2PT0A 4O23A 2V8HA 1J5OB 3EDRB 5HR6A 2UV8G 1JJCB 5HMWA 2NRRA 2MZTA 2GO8A 3CJTA 3HI9A 2D0PA 3QBCA 3T9ZA 2P6UA 3NGKA 4DMNA 4JI0F 3ZT4A 4RG8A 2HWHA 1VQSA 3VCDA 1L3VA 2WHOA 2OKQA 3SQGA 1ATRA 3T9NA 3WXMB 4M3XA 4BGAA 1LW2A 4NLRA 2E2PA 5AI4A 1UFLA 3GMGA 2YKMA 1TTHB 3PYGA 2IOFA 1NSPA 3NMUA 7ICPA 3SJHA 2GVDA 3HP9A 4RWWA 3ITHA 2BRKA 1R0AA 4EEKA 1SKWA 1WOOA 1D8ZA 2G0CA 4CK3A 1KEKA 2J9DE 1G1XA 4X66J 3SMZA 8ICKA 2KZZA 3IHQB 2G8WA 3K9JA 4ILLA 4PWUA 1LAWA 4MEXA 1RBRA 4DS4A 5HAOA 1U6FA 1NGFA 1S97A 1HYVA 3JS9A 1KTVA 3PRVA 2EEYA 4KN7A 1HI0P 4QOTA 1YJNN 2DNYA 1TFYA 4CJQA 2LECA 1X6IA 4FYXB 4CM2A 1WG8A 3WX4A 3D0GE 2L3MA 4C0BA 5AKXA 1SQEA 1ZD2P 4QWCA 1A9NB 3OJUA 3IRXA 2Y3YA 3SUQA 2JR5A 2PEHA 3CJ7A 2F7VA 3GLJA 2W03A 4ILHA 4NA1A 3OYJA 1J2NA 5KG3A 4KH6A 1VLYA 3W8GA 3WQUA 1W7WA 2MQNA 1IKXB 1GLFO 1FW6A 3H5SA 1WC3A 2CVIA 1NK5A 1X1PA 3N9UC 1Q82O 3BKUA 1APSA 2VQEF 4YDUA 2KHVA 3DYAB 2E6LA 3H7HB 1B70B 3CMES 4AQYJ 4DEZA 1NSQA 1RAHB 3DRPB 1TL3A 2BPCA 4F4YA 1X4FA 3DLHA 4C3MA 4M3ZA 1SQKA 3KD5E 4H0OA 2V67A 4UZBA 1F5BA 1RWVB 1T4GA 2QE5A 5GAEU 3NGZA 1N34F 1BQXA 1VJ5A 3MHYA 1ZM3A 3Q86A 4KGZB 1VAZA 3SCJE 3QGPA 3D2EA 4BRQA 1NOMA 3GYXB 4JI2K 4L3QA 4USVA 3OXLA 3ULDA 4B3RJ 4B1ZA 4K4TA 1JLCA 2GWJA 4LBPA 5CHCB 3CIPA 4JKBA 2ZH8A 5J2MA 4OX6A 4PR6A 1X4DA 4I4BA 3CUNA 3QAUA 4M63C 1HQUB 4WF9L 5HVFA 4X62K 2IAJB 2AF6A 5ALSA 4K4VA 4DQ8A 5F3ZA 4QS8A 3U1LA 1HARA 3W3SA 3G25A 1Q81T 4BRIA 1F3VA 1NSAA 3NAHA 4BR2A 1T6DA 2VG6B 4I9LA 4DPXA 1RFQA 4BE2A 1ZA1B 3U1MA 2ZIVA 3R9LA 4WJ3B 1UPPA 2YWEA 3HX9A 4JI7J 4DKWA 2ZKTA 3NAEA 2ZM6F 2JH7A 2WAQF 2BCQA 1ZQYA 5KFRA 3MPUB 2BQUA 4DUTA 5BR8J 1CLQA 1TKXB 2I9SA 4P4MA 1SH0A 2AQ0A 2NZCA 1X60A 2DR8A 2QWNA 1L7NA 3EX7B 2JZ5A 3GU3A 1VC6A 4L6V3 3ZCMA 2B8QA 3KZIU 3HSGA 2E7XA 5JLHA 4ED6A 1RU2A 3GILA 1ELOA 1MG7A 4ZK7M 2ZGYA 3V7JA 4CI0B 2MQOA 2D3ZA 1WORA 2GVZB 3NH0A 2J8SA 4ZVHA 1ZQNA 1LK7A 1U47A 3NCPA 1F21A 3BR9A 2ZH9A 2Q2RA 2IDEA 4PL1A 2XGPA 2MQMA 3GU0A 1YTAA 4G1QA 2MHEA 2YHBA 1R8PA 4UASA 1SH3A 4YNQA 4K7QA 1WG1A 1PILA 1UW9A 5KL8B 5AQFA 4BC5A 2XY5A 3IGNA 1U8SA 4C1NI 3SCLE 4QIWC 3KOOA 2CJ9A 4AD6A 4DSIA 3IDWA 1N5YB 1NZ8A 1TUVA 4LFBK 1BWVA 2HAFA 8ICEA 4QZFA 4N8OA 3OW2R 5HQ8A 3GG4A 2AZ3A 4JI0J 3D6HB 1TUGB 4IFEA 1J5EF 4A5AA 2APOA 4NLVA 5D4PA 3FC4A 2YHWA 2YNGB 2DNGA 2KT3A 1ZC6A 2RMLA 2O3DA 3H0RB 4QJFB 3A5LC 1KHWA 2CQIA 2X1AA 2C22A 3O8MA 1NK7A 4E7IA 2ZUBA 1R89A 2CKWA 3NVKA 3OL6A 4QW8A 1S1XB 3NGRA 3LANA 4WKYA 3KKRA 4ED1A 3HKZD 3THPA 3RBXA 4DQIA 3SSSA 3O6QA 3NVWA 2B5JA 3OQ2A 7AT1B 3LTOA 2KU7A 1ZBFA 2K3KA 3Q8QB 1DFDA 5BPMA 3NRBA 2DXEA 4OYIA 2KYZA 3DWLA 3HCXA 3ZZYA 2Z2LA 4ILJA 3IG5A 5KTQA 1JXLA 3Q7BA 1VC5A 3P38A 3MAHA 2QX0A 3UIQA 3THYA 2DKXA 1T9TA 2E9TA 4C8LA 4ZJQA 1BA1A 1XO0A 3SUNA 2ILYA 2OH2A 1U9LA 3VENA 1Q16B 1Z05A 1KD1T 1VQ8N 1XC3A 5KAFU 8ICTA 3GBTA 4OHVA 1ECWA 3TUJC 3PZPA 2ZTCA 2W2PP 3C66A 3IDHA 4FJXA 2ASMA 2B6AB 4DV1F 5E26A 1IKWA 3PYFA 4PCQA 4PY5A 3MCMA 1ZQUA 2HBJA 3MMAB 4TVAB 4C0HA 4AH9A 2E9RX 1U49A 3LVWA 8ICFA 1RG6A 2J8AA 2AXTU 2ZNZA 5BOLA 3MWPA 1RA6A 3RH6A 2BANB 3A8IA 1NGAA 4N8NA 1C6VA 4C8OA 4ECVA 1ZRNA 2K4IA 3BF3A 1ZQDA 5F0UA 2VQEJ 4LF7F 3H25A 1H98A 1WHYA 3QICA 2EHGA 4M7XA 1T02A 3VF2A 1KDNA 1XQIA 2KKPA 3VC8A 4A59A 4D3HA 3C7NA 3OJSA 2B8PA 1DTTA 3VQBA 4DR7J 8ICVA 1N34J 3HM8A 1NKCA 1Q78A 2DFFA 3RB0A 1VS3A 3KXDA 3Q23A 3MABA 1VGYA 2CNOB 2BBEA 1RHRB 3JS6A 1XQSC 4C0OC 2MB0B 2YX7A 4A8OA 3CSKA 2GWSA 1IKVA 3CC2N 4BC7A 3WKCA 3PRBA 1Z19A 1CZAN 4YOUA 1NNEA 4XH5A 4F0MA 4U67L 4YXMA 3EJMA 1X6JA 2Z2MA 1SCJB 4PXBA 2HBZB 4DR6F 2OO4A 1F9HA 1BGXT 3THVA 2P9LB 3IBCB 4P2XA 3W2WA 1EXNA 7ICLA 6FD1A 4USUA 3TAQA 4OYAA 1S12A 4HDGA 4IQXA 1QQ6A 2QEXN 3SMPA 3PRDA 2L9WA 3PHTA 1QS4A 3QT5A 1RT1A 2DGVA 2Y8YA 3LDPA 2FLOA 1W2BR 1WSJA 2YMQA 1K8KA 4TY8B 2NSCA 4HAIA 4OVLA 4FKYA 2FYXA 4CK1A 4PZNA 1RBOB 4JI6K 2ZHBA 3AVKA 1FRJA 3SAGA 5SZTA 2ZM6J 2RQCA 5CR0A 4F91B 4KQZA 4ZCLA 1NH8A 3G86A 2Q3SA 4MK8A 1BQNB 1W2BM 2MKYA 2QL9B 3ICXA 2QWMA 2AEJA 4W90B 2VPXB 3HVTA 1HPZB 3C6HA 2KJWA 4WBFA 2AP1A 1BCMA 3TOQA 3TQ1A 1DRZA 1LWEA 2LCWA 2LMIA 2ITMA 4KIAA 3Q7CA 3ENBA 2KXNB 1SC1B 2EAOA 4CF3A 1SJQA 3KJNB 2RILA 2G08A 5D49A 2AQ4A 4K4UA 1VC0A 2Y9UA 4F02A 4OV6A 1RDCA 4QZHA 1N52B 4QZVB 3QIPB 3DI6A 1C0UB 1MQ2A 2WF6A 2CGLA 2UUTA 3CCJS 5HQLA 2H5IB 2W55A 2HZAA 3MPYA 1T44A 4DTMA 4G9ZA 3KIOA 2QLBB 4P6QA 4F3OA 1O1WA 4JI5K 3RTVA 3KLHA 1YX2A 1M6YA 4RUAA 4OFZA 3O9QA 3GG1A 5A6WA 2R7WA 1GLBG 1FA0A 4WFBL 4IOBA 4C80A 4P4OA 3IUCA 5ALHA 4Y2TA 3DGPB 1RXWA 4ECUA 3EN9A 4M3RA 3G4SS 1UKUA 1Z1VA 3OBYA 3W2VA 4JKFA 1D8YA 1FXLA 3SCKE 3GR1A 2RH3A 3SBMA 5HP1A 2G07A 3SSQA 4R5PA 2MLYA 2PGCA 1RT5B 2VBZA 3MMJA 4RQ3A 3NH1A 4HLBA 1NU4A 2OUGA 3N7RC 1U2CA 4CGDA 4DCCA 3AA8A 1J5EJ 4HI1A 3JSMA 4KHMA 2QLWA 2RE2A 3HSJA 3AQOA 2GO7A 2R8KA 1T95A 1MN9A 2ZIUA 3E2EA 3TI0A 2YXLA 3FCHA 3DDHA 4IH5A 1YI2N 2AX0A 3IG1B 4UOGA 1SL0A 4JKAA 2BJ3A 3G87A 2GGPB 4C1NK 2RB7A 1QZ5A 1I94J 4BG8A 2CIMA 2MQLA 3B82A 3ZXWA 4KGXB 3K59A 1MN8A 2RJZA 3D1HA 3H46O 2IVNA 2V5HG 3L9ZA 4KLUA 3LPUA 1TMMA 3R9PA 2JHEA 2R2UA 1OVYA 4K4IA 2FPKA 4YEAA 4FZZA 2FB0A 3VEZA 2U2FA 1REVB 4QR0A 4XAKA 2LBOA 1ZQXA 2WB4A 2NRHA 1Z2LA 3ZSWA 2M0NA 4LQ3A 4FSVA 2WF9A 5DO2A 5AM4A 2FVCA 4OLAA 1MDUB 1RCOB 5L39A 4DV1J 4CBXA 4HHJA 1WSEA 4F4ZA 2BVZA 4LQ9A 4M7YA 2MY8A 3THTA 1JJ4A 1WNSA 3TWZA 1MN7A 3EEQA 5B08A 9ICGA 2VJVA 3BH7B 4I2PB 1EB0A 2DR6A 4GV6A 3L2QA 3BEGB 3U02A 4BCAA 1W26A 2LXFA 2VPZB 8ICLA 3K7RA 1QCKA 4DCHA 3CJCA 4M6WA 3AU6A 3BO4A 2V52B 2WAQD 3OVNA 3ULHA 5HL7L 2GX8A 2GIRA 3OYCA 4LF7J 3ISBA 1ASWA 4I2FA 2YMPA 3SBTA 3ZTOA 4ED0A 1Q8KA 2BKPA 4ZPDA 2G1HA 4P52A 3DM2A 3ILIA 2XG8A 3BEXA 1HBNA 3CJ0A 3KK7A 1RTZA 1U6BA 5CYMB 4DR1F 1OY9A 5I4MA 2MQPA 4BXOB 5AQYA 3FQKA 4HHUA 2Z7JA 1SV5B 1HKAA 2ISPA 2FZCB 4J9SA 3KJFB 1HW9A 4LSNA 1RE1B 1HFEL 4DV6K 3P5BP 4Q2MA 1FRKA 1Y64A