2HHXA

O6-methyl-guanine in the polymerase template preinsertion site
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
579
structure length
574
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 205
structure length 574
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhxA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhxA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhxA01
5J2QA 3KTQA 4DTPA 4M3WA 3AU2A 1NK4A 4CF8A 4KLOA 5D49A 2XRIA 4DTXA 4IRKA 2C2RA 4IRDA 4MQ3A 5KG5A 4PHAA 4E1MA 2R8JA 9ICMA 3PW5A 1CZ9A 3OJUA 4DTMA 5KFXA 1WSHA 5CHGA 3MAQA 4DEZA 2ZUDA 4KHUA 4EBEA 5KFCA 1IH7A 2IAJA 1ZBIA 3ZT2A 2W8LA 3AU6A 1J54A 2B4JA 4KN7A 2W9MA 4IQVA 3MEEA 4QWBA 3NFAA 2DPIA 1HRHA 5KFTA 4H8KA 2KFNA 9ICWA 3NBPA 4YR0A 2I9GA 3P1GA 4CJQA 1BCOA 2ZUBA 4RUCA 3BQ0A 1KVBA 1QSSA 4OPKA 4R66A 4F5PA 4XIUA 3T3FA 4M9NA 2G8FA 5HP1A 4HCCA 4NXZA 2KQ2A 5DBAA 3HVRA 3AA2A 3AO3A 4I9LA 1BPEA 1CZBA 5CWRA 2Q3SA 4CJWA 3NF6A 2E6LA 4KMUA 4L8RB 5HLFA 1T7PA 3L2QA 4QWCA 1R0AA 4KLJA 4TUSA 1CXQA 3KHRA 2F8SA 2F1IA 2MUTB 1SL0A 4RPYA 1U48A 3MFHA 3MXMA 3QIPA 1T3NA 4O5EA 2IA6A 2AGOA 1BPYA 7ICMA 3L8BA 1KFDA 4EEYA 1RTJA 3SI6A 3JPQA 3ZSOA 3PNCA 3MECA 1RT1A 5J2FA 1JLQA 1KDHA 3N97B 9ICVA 4RQ3A 7ICJA 5CYMA 1S0NA 8ICJA 7ICFA 5J2MA 2AU0A 1IM4A 3ZCMA 3KJVA 3TANA 7ICRA 4C8LA 1ZJMA 4GLXA 2IOCA 2HW3A 4CHQA 3LP0A 4DL5A 2DY4A 3QEIA 2KFZA 3E01A 4J9SA 1MQ3A 3V6JA 8ICTA 4CGHA 2LYHA 3PO4A 5KRSA 4QWDA 3C23A 5HP4A 4FJXA 5FDLA 5DG9A 3PW7A 8ICMA 1SL2A 1NK6A 4J9OA 3OYBA 4Z4HA 1ZQFA 4GC7A 1EETA 1EKEA 1RCHA 4E89A 3ZSXA 1WSIA 4PWDA 2DTUA 3M9NB 4O44A 2P6UA 1QTMA 1DTQA 3ZSYA 4CJTA 4RZRA 3RB0A 4RUAA 8ICLA 4QZ8A 1B43A 4KLIA 2A1SA 2BDPA 3NGYA 4ID1A 5FRNA 4QZFA 3KD5E 2Z1HA 4DF4A 3VQAA 4YMMA 4FJHA 1U47A 3HX0A 4DMNA 4PH5A 1NK7A 4CIEA 2B5JA 4M42A 4I2AA 2AJQA 1S1XA 3LDSA 4CF9A 1SZPA 4PGXA 5KFMA 3OGUA 1U9LA 5EOZA 9ICQA 4BDYA 4KHNA 4RQ1A 4N5SA 3SYZA 3SQ2A 4YVZA 4CJSA 1JX4A 4DTNA 2ZTCA 3OVNA 4JRQA 1XU4A 4GXKA 5DB6A 3RAXA 2G8KA 3QINA 1D8LA 3AVMA 4ECXA 1XWLA 4I2HA 1HJRA 1D5AA 4ED7A 3RH5A 3MABA 1ZETA 3TQ1A 3OSNA 4EZ6A 2DFHA 4M3RA 1TL3A 2PYJA 3HP9A 1UWBA 9ICTA 3H08A 4ED8A 1ZBLA 3ULDA 3K58A 2JLEA 2XHBA 4DQPA 1Z00A 4CGIA 4N41A 3TFRA 4XUSA 5KRTA 4DTRA 1X9SA 3MDAA 3O4NA 4AHSA 3GV7B 3KLIA 5BOMA 3VN5A 4IG3A 1QE1A 4M45A 4I2EA 4KTQA 3S3NA 3MR6A 4M9GA 3HPGA 1KRPA 3Q8QB 4I2CA 1S0MA 4TUPA 4CEQA 2VWKA 2DFLA 3DI6A 2HNZA 2VANA 3PX6A 8ICBA 2FBVA 1HPZA 1WCNA 2PI5A 3OHBA 2X78A 5CYQA 2P6RA 4CEAA 5HNKA 4KPYA 3ZDEA 5KFYA 4KV8A 2ZJ8A 1C1AA 3SQ4A 1AROP 4J9QA 3GQCA 1HNIA 1LWCA 5J2DA 9ICEA 1WNSA 4FLYA 1RDBA 4CHYA 3JSMA 4QOZB 4FCYA 4ZTFA 4IQTA 8ICGA 1K1QA 9ICIA 3ZDDA 1MSWD 1U04A 4OVLA 3THVA 3F73A 1KTQA 3VQ6A 3RH4A 2PYLA 3OYMA 4RQ2A 4I27A 5EWEA 2IC3A 4NCBA 4QZGA 4F4ZA 4Q45A 5C5JA 2C2EA 2ZE2A 3RRHA 1S1TA 1U45A 5IIMA 2ZUCA 7ICTA 2J6SA 5DG7A 8ICHA 3AA3A 3AVBA 5J0TA 4W5TA 1D8YA 3Q8SB 2IHNA 3MBYA 3EPIA 4EYIB 4CERA 2BR0A 5KG1A 1YT3A 4DTOA 3EZ5A 4O3QA 4KRFA 3S3OA 2Z1JA 4CK1A 3Q8MA 4G1QA 4FVMA 5KGXA 4Q8FA 4EP4A 4DQIA 3ZDCA 2FPMA 3H8SA 8ICZA 4CFBA 2UVVA 2PFOA 4Z6EA 2BANA 2XY6A 2ZJ5A 5BPCA 5KFPA 4E3SA 4JRPA 4FLWA 4DG1A 1A5WA 5EWGA 4E0DA 3VQPA 2QKBA 5F9NA 3KKSA 1WSGA 4Z6CA 4ID5A 3DYAA 3HT3A 2RDIA 5IILA 5BOLA 4DLGA 4C8OA 4CJLA 3DLKA 1ZYQA 5KTQA 3OJSA 2KW4A 3MR3A 4ELUA 5HBMA 2ASJA 2F96A 4FLUA 1C0UA 5KFZA 2XC9A 1I3AA 4DU4A 4CFAA 2HHXA 1XSPA 4O3OA 4DTJA 4OGEA 3IS9A 5JS1A 3ETLA 3G6XA 4FJMA 3LALA 4ECUA 4F8RA 4KITB 3AVGA 4O0IA 4F4KA 3HPHA 5KFQA 1IKWA 4KLHA 1L3TA 1C1BA 1TKDA 3PX4A 1KVAA 2G8IA 3M8SA 3VQQA 3QLHA 3V9ZA 5K14A 3ALYA 2Z1GA 3ZSVA 4DSIA 3JPRA 2MUTA 4Z4GA 4W5OA 4N47A 5DGBA 5CJ7A 1JMSA 4FZXC 3K59A 2H5XA 4UAWA 3O4QA 3DOKA 3QEWA 4M9JA 4JK1A 5DLGA 3G6VA 4B8CA 1GOAA 3I8DA 9ICKA 4FLXA 2XCAA 1Z00B 4LSNA 4O5BA 4AHCA 1FKOA 2M9NA 3TAPA 2HNYA 4JV0A 1X2IA 4QW9A 3LWMA 4DSFA 3Q8LA 4JS5A 1Z3EB 1ZJNA 1RPLA 4RW9A 1B9FA 1BISA 3LZIA 4FJGA 2YHAA 4KFBA 5CZ2A 1S0OA 1KLMA 1VSDA 4ECQA 4LZDA 2JEJA 3OYFA 5KT2A 1TVRA 3O3HA 4FYDA 4I2QA 4LH4A 3RB4A 2Q0ZX 1JLGA 3LAKA 1JKHA 4F3OA 4RW8A 4FJ7A 3K4GA 3NH1A 3K5LA 5HMMA 2IBKA 5DDYA 2FMQA 4DO9A 1ZQDA 1RTIA 4CEBA 1ZBHA 4F3TA 1TVAA 3KLHA 4YD1A 1JL2A 2BQUA 4YR3A 3MR5A 2ZTDA 2XCPA 4KLDA 1YVUA 3V9XA 2GUIA 2HB5A 1XSNA 3TWHA 3ZSWA 4JS4A 2BQ3A 1NOZA 1ZQGA 2WONA 4R63A 4M3TA 3SZ2A 2G8VA 2YV0X 2HHQA 1LAWA 2C28A 1WAJA 4FZYA 4FS1A 4KLTA 3GIMA 3DRRA 3P5JA 8ICAA 3RMCA 2OA8A 2YNGA 3MEDA 1IO2A 1BIZA 4RW4A 7ICPA 1N48A 3AVFA 3OYNA 4AHVA 2YNIA 1LW0A 4CHPA 3SUOA 3AV9A 4KLQA 2NRZA 1ASUA 4P4PA 2EX3A 5KFGA 4QAGA 4FBUA 1ZQPA 3C2KA 2BCVA 4I2GA 4W5NA 3BGRA 3PW4A 3HW8A 2ALZA 2I1QA 5DLFA 2E6MA 4IFYA 4WE1A 1ZBUA 5J2IA 3TAFA 1K1SA 3QEAZ 4FJNA 3KHGA 1TV9A 5I3UA 1S5JA 1Y88A 1X1PA 4KLFA 1GOBA 4FZZA 3RR8A 3T5JA 4RW7A 4RNOA 1HUZA 9ICFA 3HVTA 4DL6A 1J5OA 3DM2A 3RB6A 1J53A 4ECYA 3AO2A 2R8GA 1TGOA 3WNGA 2VG7A 2VG6A 7ICEA 3RJJA 5J2KA 8ICKA 1ZQXA 4BXOA 5KT3A 3UPQA 1MQ2A 4KKOA 2YKMA 4NLGA 1JXBA 4KLSA 4RQ6A 4JLHA 2FLNA 3AVLA 1IKYA 9ICCA 3C21A 4R8UA 4N76A 3CFRA 2BCUA 4XQ8A 4DL4A 3RJGA 2NRTA 1CXUA 3M8PA 1N56A 4O55A 3OYLA 4ED3A 1TAUA 4CGDA 4TQRA 4KLUA 4ECTA 1ZQIA 4O0JA 4FO6A 9ICOA 5J2GA 1NJWA 1FK9A 2FPLA 2RKIA 5EU7A 3KHLA 9ICNA 4F93B 2ATLA 1RDCA 3MFIA 3G6YA 3LK9A 2OPRA 4P4MA 4MFCA 4DFJA 3OYCA 4PUOA 3QNOA 3AA5X 3M9OB 2BCRA 1WN7A 4F5NA 2HHVA 5J2JA 1XC9A 1L3VA 2YNHA 3K5MA 3ZT4A 3FFIA 1JIHA 5KFSA 3IM1A 4DU1A 2XGQA 1A77A 3BQ1A 2P1JA 1MU2A 4F5RA 2J6TA 4O5KA 4E7JA 1BQNA 1N6QA 3V7LA 2QK9A 5L9XA 1BGXT 5J29A 3V6KA 4DQQA 8ICFA 4B9MA 1JLEA 2ZD1A 1QHTA 1TFRA 4IBNA 1ZQYA 4IQWA 5C42A 3E2EA 4GVMA 4CHOA 4M2YA 3LZJA 3CG7A 3TR8A 4KTWA 4F4YA 2J6UA 3K2PA 1RT5A 1BI4A 3BQ2A 9ICSA 5DB9A 3PV8A 4UB5A 3GIIA 3NE6A 4B08A 1HUOA 4EBCA 5KFLA 3NHGA 4KI4A 4HCBA 2WOMA 4KLMA 1REVA 4DF8A 4YG2A 4OKKA 2AGQA 1ZQNA 3C5FA 4LY7A 2VWJA 2JEIA 4M6WA 5J2HA 3LAMA 1JLFA 3L2UA 5KFWA 1WSEA 5SWMA 1U49A 5HRNA 1BL3A 4KLLA 1C0TA 3LPUA 1Q9XA 4KAZA 1D9DA 3RB3A 4CE9A 1VRUA 3C6TA 3OYJA 4FJLA 1QS4A 5D46A 3NH2A 2BGWA 1WAFA 2ZTEA 5KFOA 5KG0A 3UXPA 1RTHA 4Y1DA 3DLGA 1Q9YA 2BPCA 7ICKA 4BE1A 2OZMA 1V9PA 1ZQMA 1S9GA 7ICHA 4CJEA 1NKEA 3L3UA 5F9LA 3ISCA 1XHZA 3MXJA 3OYGA 5E41A 3QETA 1MC8A 4CGFA 4BDZA 3QZ7A 4W5QA 2YHBA 3H40A 2R7YA 1DOQA 9ICHA 3TAEA 7ICSA 8ICEA 3B6OA 2NRWA 1S10A 3HK2A 2VA3A 1T4GA 3EWAA 2QKKA 4CK3A 3V6DA 4AHRA 4YN4A 1S1VA 5IIJA 3NH0A 1K6YA 1A5XA 2BQRA 1NKCA 4CIGA 1UOCA 1S9FA 3HWTA 5L1LA 3HYFA 4CJVA 3AO4A 4AH9A 1JLBA 4B9TA 1ZQQA 4O3RA 2VA2A 4CFCA 4ECVA 1IKVA 3OYAA 4KLEA 5DQGA 3ZDBA 3K5OA 1UAXA 4E7LA 4CGJA 4IQUA 3ZSQA 2ASLA 5HRSA 2HHTA 4NLZA 1RTDA 5KFHA 4ZHRA 3N4MB 4R64A 3EY1A 4CJ3A 4QWEA 1XO1A 3P83D 4UBBA 1RBSA 4KB0A 4BXOB 4E1NA 3EPGA 3ISNC 4JV1A 1NJZA 8ICPA 4BE0A 4R8UB 2HHUA 3CFPA 4K8XA 3AVIA 3NF7A 4BE2A 3EW9A 3HM9A 3M9MB 1QSYA 5L1KA 5J0UA 4ECZA 4O5CA 2HNDA 4Z6FA 4P2HA 4ECWA 1IKXA 4MFBA 2JZBA 1IXRA 4DWIA 4QZIA 4FJ9A 3I0SA 8ICOA 9ICLA 3RJEA 4FM1A 4GMJB 1ITGA 1HQEA 4RQ0A 1DLOA 5DQHA 1J9AA 4BDPA 4KHWA 4RW6A 4CGGA 3OYHA 4YR2A 1WCLA 4RQ5A 3C94A 3KK3A 3C1ZA 1X9WA 2PI4A 4TQSA 4QZEA 5D3GA 1SUQA 2ISOA 3HP6A 1UT5A 5FRMA 3VQ8A 5KFBA 4KI6A 9ICAA 4ZTJA 3V9SA 4CHNA 1B22A 3ISDA 8ICXA 3QEVA 4M0AA 1T03A 3TAMA 3QESA 2ITGA 4PY5A 8ICQA 3SUPA 1EP4A 3V6HA 1VSIA 3CYMA 4CCHA 4KHQA 2R8IA 1XHXA 2IDOA 3NF9A 1BI4B 4UB3A 4KREA 2HVIA 1N5YA 3RBEA 4EP5A 1NOMA 1JN3A 4MEXA 1LB2B 1RZTA 5I42A 3ZDAA 5IIKA 2F1HA 4CF2A 2A1JB 4CJ5A 1QSLA 4M6WB 3OYKA 5J2BA 5KT6A 3OHAA 4LH5A 4Z4EA 2Z1IA 3V1OA 2F1JA 1ZQZA 4YXMA 1RXWA 2MAXA 4RPZA 1VSLA 4CJKA 5DBCA 3RMBA 3QEPA 1XS9D 3LP2A 3AVCA 4F2RA 1HMVA 3HPOA 1RBRA 1NJXA 3WNFA 4Z6DA 2XO7A 1KFSA 4I2JA 5J2AA 3H4DA 3ZD9A 9ICBA 5C25A 1ZQSA 2XY8A 4UAYA 1B9DA 1LAVA 1S77D 4QZDA 3BJYA 1DTTA 5DGAA 4NLKA 3SV3A 4M04A 1LWEA 3RJHA 1DGSA 5J0RA 5KFJA 1A76A 2KZMA 2X6SA 4FJ5A 4B9VA 2OPSA 4IKFA 3DOLA 1YTUA 2IS3A 4FK2A 4AILC 1RT3A 5CB1A 5J1EA 1JXLA 9ICPA 5KFEA 5KFRA 3TFSA 1C7YA 3RJFA 3C5GA 3NGDA 1FKPA 4OGCA 4RQ4A 4B8AB 1JXEA 4EZ9A 5KI6A 4QZHA 3TARA 3AVNA 4CF0A 4H4OA 4CECA 1TKZA 2PZSA 3AO5A 8ICYA 2D0CA 4UAZA 2C22A 4J9RA 4C8NA 4XA5A 4LZGA 3GFKB 3H8WA 1RDDA 2V9WA 3QEXA 5DK5A 3KHHA 3VQEA 1UA0A 3ZSZA 4RNNA 4W5RA 3SCXA 3KD1E 2FMPA 3NDKA 4QZAA 4NYNA 1CUKA 3NCIA 4DSLA 4I29A 3RWUA 4FJIA 4YFKA 4PHDA 4DQRA 3VA0A 1NK9A 7ICOA 1RNHA 4UB4A 1ASWA 1S0VA 3SQ0A 4Q44A 4I2IA 3SJJA 4HYKA 1VSFA 5J2NA 3ZD8A 3PUFA 3O3FA 3U3GA 1KEJA 4Y1CA 3Q8PB 2Y1JA 1RYSA 4DTUA 4EYHB 2X6NA 2OPQA 3G10A 4FW1A 4CEDA 4OLAA 4KO0A 4LD0A 4ED1A 4B9UA 4DFMA 2JZBB 4M41A 5TZVA 4O3SA 2NUBA 3DMJA 1RYRA 3PX0A 1HYZA 1U4BA 3OY9A 2VA8A 5CY4A 4F50A 4ICLA 4ED0A 4FK0A 1BPXA 3VQ9A 2RPIA 3OS2A 4DL2A 4KHSA 4O9MA 1D9FA 4OJRA 4TSXA 3LDAA 9ICUA 2DFEA 2FLPA 4QW8A 4JWNA 1KCFA 3TAGA 3PY8A 4H4MA 2FPKA 4MF8A 4AHTA 4CEFA 4NCAA 4M47A 1S97A 1XSLA 4M3ZA 2G8WA 5J0QA 1S76D 1EXNA 4QWAA 4UB2A 3IG1A 4B9LA 3S3MA 4YNQA 2KZ3A 3WNHA 4MFAA 1JL1A 2PY5A 5IIIA 8ICRA 3VA3A 3DRPA 4BACA 4C8KA 4BWMA 3BQTA 4DSEA 7ICGA 1ZQBA 1BIUA 5DBBA 1TKTA 9ICXA 4ECRA 2ZQBA 4DS4A 3PR4A 4M9LA 5KG6A 2QXFA 3AUOA 5HMLA 1ASVA 2BKEA 5L1IA 2LSNA 1BQMA 1RBVA 3ZT1A 8ICUA 5KFVA 4AHUA 5T7BA 3MGIA 1KSPA 5CR0A 1RT7A 3TI0A 4I2FA 1ZQEA 4PHEA 3QZ8A 3RJIA 4HUGA 4I2DA 3QIOA 4E7HA 4HTUA 4J2EA 1NK5A 2FMSA 3NTUA 3ASMA 1TAQA 3MXIA 4DFPA 5JS2A 1S1WA 4CJPA 3V9UA 4I9QA 1BPZA 3HSTB 1LWFA 5HRPA 4KB1A 3CFOA 4PHPA 1LW2A 5J0YA 3C6UA 3RH6A 2BPFA 1TK0A 2HHWA 3LP3A 3AVHA 1X9MA 4I2PA 4I2BA 5J2PA 2W9CA 3LANA 1I39A 4KHYA 4KLGA 4PA1A 4F91B 4F5QA 5J0SA 3GIJA 4M3UA 3U3YA 3ZT3A 3S9HA 4GC6A 3RMDA 5KGWA 5DB8A 4ELVA 1SL1A 5KFUA 2FBYA 4B3OA 4Z4CA 3GV5B 3L3VA 4IFVA 1ZQLA 4FJ8A 3C2MA 1XI1A 4F92B 3BDPA 4B9NA 2KN7A 1SKWA 1KLNA 4FXDA 4B9SA 1VK0A 3CM6A 2FBTA 1BPBA 2BE2A 3VQ7A 4RU9A 4J9NA 1NKBA 3V4IA 4QCLA 4MF2A 4P4OA 2AQ0A 3V7JA 1RT4A 4YMOA 2D0BA 1SKSA 1T05A 5KFAA 1ZQWA 4PGQA 3MDCA 1SKRA 1ZQHA 2D5RA 3GV8B 3OYEA 2BCSA 4J2BA 2A1JA 5IINA 1VSKA 4FK4A 1W9HA 4DSJA 1S1UA 2PFQA 3QE9Y 3V9WA 3SUNA 9ICRA 1QLNA 5HRRA 4FJJA 2RF2A 1GOCA 1A5VA 4QZCA 3TAQA 3KLEA 1RT2A 1IG9A 3TABA 4F4WA 3SQ1A 3UQ0A 4Q0BA 5DG8A 5KFIA 4E19A 3A2FA 7ICVA 4DQSA 1TL1A 4FBTA 4N56A 4M3YA 1VSJA 4K4IA 3RRGA 4RT3A 4OKEA 1G15A 3VQ4A 3I0RA 4E7KA 1Q8IA 4FM0A 2HMIA 3GDXA 4CJ4A 2G8HA 4J2AA 1W0HA 4PGYA 4K8ZA 3OS0A 3PW0A 1ZQRA 4Q5VA 1T8EA 4FW2A 1UA1A 4YCXA 3JPOA 3B0YA 3ZT0A 1PZNA 5C24A 1KVCA 5DKWA 4GXJA 4M9HA 2W9BB 2I5JA 4G3IA 1ZQJA 3WNEA 3LPTA 4DOCA 2OYQA 3JPTA 2AGPA 4RT2A 3K75D 4ZH4A 4RG8A 2ETJA 4NCGA 2R8KA 1C0MA 3FYHA 3UIQA 1QQCA 1Z25A 3FDSA 2P66A 1UT8A 4FJKA 4RNMA 4R5PA 4HHTA 3T5LA 1O1WA 2BCQA 3V1QA 3IHQB 3T5HA 5FROA 3KLGA 4CEZA 5CP2A 3OSPA 1ZBFA 3HL8A 5CZ1A 3VQ5A 4BWJA 3JPSA 1ZQKA 2PFNA 3GILA 3ZSRA 3MEGA 3G0ZA 8ICWA 1RBTA 4KN4A 3MR2A 5IIOA 3H8JA 4CHZA 4FM2A 5HROA 2UVWA 3AVKA 2B21A 4O3PA 2EHGA 2C2DA 4UB1A 1S6PA 4Z0UA 4I28A 4PQUA 3PW2A 8ICNA 4F4XA 1F21A 1ZQCA 3SPZA 3JYTA 5JUMA 5KT4A 4ECSA 2JEFA 4RQ7A 1WLJA 5CA7A 3UQ2A 1JLCA 2P51A 2NRVA 2W9CB 4OKJA 2D0AA 3CM5A 3EYZA 2XY7A 2V4RA 1S6QA 2XY5A 3NAEA 1C6VA 1BHLA 4IR1A 3AVJA 4DLEA 4QZBA 4K4HA 1HNVA 1ZQTA 4DL3A 4F2SA 4O4GA 3C2LA 2W8KA 4F5OA 1YTAA 3KK1A 4LSLA 2ATQA 3HXMA 2DPJA 4UBCA 1NK8A 5HHIA 3VQDA 4CEOA 3PMNA 4J9LA 3JPNA 2O4IA 4LVSA 1H38A 1TK8A 1C1CA 4UQGA 3QO9A 3RAQA 4YP3A 4MEYA 1EX4A 5DQIA 2W42A 9ICGA 3IAYA 1HYVA 2VG5A 3M8QA 3ORYA 3KLFA 2JGUA 2AQ4A 2PXIA 1ZQAA 1TKXA 2UVUA 1RT6A 3LWLA 3D0PA 2PFPA 3NGZA 5J0WA 4JUZA 4NLNA 4I7FA 3V81A 4FLZA 4BGDA 3KKRA 2GWSA 2XGPA 2DFFA 4DOAA 4HVJA 4CEEA 4C8MA 3QEBZ 4KTZA 4CFDA 8ICVA 3T5KA 1WSJA 4DOBA 1L3SA 1BPDA 2ZJAA 5HHHA 3MGHA 2V4QA 4CK2A 4O3NA 3JPPA 3HJFA 1RILA 4FLTA 2FBXA 1HQUA 3M8RA 3RBDA 3QNNA 1NJYA 4IR9A 3PVXA 1L3UA 2NRXA 1RXVA 4CF1A 5EWFA 4CJFA 2RN2A 4FLVA 1CLQA 2BHNA 2YNFA 4NM1A 3DLRA 2G8UA 4CIFA 3SUQA 3HO1A 1BVSA 4GW6A 5J0PA 3ISBA 1L5UA 3RTVA 4Q8EA 4DL7A 1VSMA 3NF8A 3T19A 2F8TA 1NOYA 4J9PA 4YQWA 2BPGA 4Z4IA 2W9AA 2FC0A 4NY8A 2KZZA 2HVHA 3QERA 1ZQUA 5KG3A 1ZQOA 1CEZA 3SI8A 3Q8RB 4XRHA 4EBDA 3IRXA 1S9EA 1HJPA 4ED2A 3RJKA 4JV2A 5KFDA 4YXJA 4M3XA 4OPJA 3H7IA 2OWOA 3L2RA 5DB7A 4TUQA 1RDAA 3V7KA 3PMLA 4NM2A 4OLBA 3SNNA 4ELTA 4GXIA 5KG7A 3DLBA 1BCMA 4PPXA 4K4GA 3OS1A 5D4BA 2ISPA 4DU3A 1ZQVA 5KFNA 1NK0A 3KK2A 1EXQA 2IHMA 1Z26A 4E7IA 8ICIA 1B92A 7ICNA 1VRTA 4JWMA 4Z4FA 7ICUA 4DS5A 3GIKA 1COOA 4YD2A 5KT5A 4ED6A 3VQCA 3OYDA 3UXNA 1VSHA 4CJUA 4IG0A 4HUEA 1TK5A 3U6FA 5J2CA 4X5VA 3VQBA 2O4GA 2HHSA 4NYFA 3O3GA 2JEGA 2FLLA 4TURA 3L2VA 2WTFA 1KFTA 4CJRA 3ITHA 4CESA 2KTQA 4J9KA 7ICIA 2GV9A 2IMWP 2B6AA 5L1JA 3T1AA 2X74A 5J2EA 8ICSA 5DMRA 3V1RA 2OPPA 2YKNA 8ICCA 4HUFA 3K57A 4J2DA 3RMAA 7ICQA 7ICLA 3Q8KA 1TV6A 1WSFA 3AA4A 3LP1A 3H4BA 5J0OA 2UVRA 2IGIA 3F9KA 1SV5A 4YFUA 3C95A 4IDKA 3AO1A 2BGGA 4Q43A 3SV4A 3RR7A 1JLAA 1FXXA 3C1YA 2A1RA 3AVAA 5SZTA 3UXOA 1HYSA 2GBZA 2P5OA 4FS2A 5KT7A 3B0XA 5J0XA 4J9MA 3V72A 3PR5B 2E4LA 4RQ8A 5KFKA 4MFFA 3KIOA 2Y1IA 1VSEA 9ICJA 5KG4A 2RDJA 1LV5A 3L2WA 3DLHA 5KFFA 3DRSA 2P5GA 3PO5A 2ASDA 3K5NA 2OZSA 4R65A 4IRCA 3SPYA 5DDMA 2W9BA 2R8HA 4DSKA 4DTSA 5KG2A 4DFKA 3B6PA 3NGIA 1Y97A 3DLEA 4RPXA 3D45A 3CQ8A 3OYIA 4YMNA 1RBUA 4QZ9A
chains in the Genus database with same CATH superfamily
1TU0B 3SQGA 4DTPA 2LKZA 4KLOA 3Q23A 2XRIA 1GX6A 2O67A 5ETKA 5KG5A 5A2QU 4PHAA 1I3OB 5EE3A 4E1MA 1SZ2A 3PW5A 3SEOA 2KG1A 3SMPA 2K89A 4FVCA 3OJUA 5KFXA 1WSHA 4QIWC 1FX4A 5B0DA 5EXWA 4FPAA 1SQKA 2ZUDA 1U26A 3NAIA 3KOOA 1G1XA 4EBEA 5KFCA 2YJFA 4Y2KA 1N0VC 2NRHA 4DV2K 3R2DJ 1ZBIA 2L9WA 2B4JA 2CQIA 3IXQA 4KN7A 3VV2B 1LKYB 4IQVA 1PBUA 4QWBA 3VAKA 3NFAA 3KNGA 3Q86A 2FI1A 2E5SA 2KFNA 4YR0A 3CRXA 3G71N 3P1GA 5H9EK 4CJQA 4IOAL 3TO8A 4IEEA 4RUCA 2JXJA 4NJ8A 4L73A 4OX9K 2KQ2A 2AJFE 1B4SA 3AA2A 1BPEA 2KHDA 1M1GA 3GLJA 4WZQA 1CZBA 3OVSA 5AQYA 4L8RB 3HHLA 4H0OA 1N4LA 3MCNA 4MLHA 1FXRA 5F8LA 3L2QA 3MPYA 3CC2S 4QIEA 2PFUA 3IBFB 2AX1A 3C2PA 2KU7A 2PMZC 3KHRA 2A2DA 1YF5L 2F1IA 2DIUA 4OZ3A 2EQYA 1T94A 2XEXA 3QIPA 3ZZOA 3OR1B 2ZXHA 1BPYA 3L8BA 3MTKA 3SJHA 3MM7A 1KFDA 1D8ZA 1RTJA 4CRXA 1S4EA 2V4JA 1S48A 3SI6A 4M7XA 3ZSOA 4B6JA 3DXKA 3MHYA 2OEJA 7ICJA 2IOFA 3FC9A 2A40A 2GS8A 2HNYB 1X0PA 4B3SJ 4KIAA 4XH5A 5BR8J 4C8LA 4GLXA 2HW3A 1KC8O 2KYXA 5IT0A 1H7XA 3QEIA 2KFZA 4KFBB 5ALMA 2HZAA 3EDQB 3MK6A 2FY1A 5AQTA 1EQMA 1VJWA 3C23A 5HP4A 3H0MB 5A0YA 1TVRB 3F5AA 1HWKA 2NO4A 2EVZA 4KJIA 3W66A 4EGLA 3Q7CA 1IJEB 1JKHB 3R5DA 3OUYA 1KS2A 3LP1B 3UO0A 4JI1J 4J9OA 3OYBA 4OZ1A 3G82A 5HQ8A 1EETA 3VGKA 2F65A 3D0HE 3M2VA 1WSIA 3ZSXA 1KN6A 1FE0A 1OVYA 4E89A 1QTMA 3RZAA 3ZSYA 4CLSA 2MY8A 1EIYB 4X2BA 2APOA 3GSDA 4KLIA 2W11A 2A1SA 2CPEA 2CGLA 3PEHA 2IHR1 1XNQF 1H0HB 1IQZA 2E8PA 1P7DA 4MJKA 4DMNA 3HX0A 2LQ9A 4CIEA 2ZIXA 2B5JA 2P6SA 4M42A 3DRSB 1N36K 2YQ1A 1UZHA 2E8NA 1PYOB 1S12A 2YNIB 2OM6A 4JKDA 4RBTA 4KHNA 3SYZA 3NAHA 2A6MA 2NXEA 3TA1A 2ZTCA 1N33F 4JRQA 3UN5A 3BP8A 4GXKA 3ZTRA 4GVBA 3QINA 1Q3VA 3OFFA 1FRJA 3AVMA 1BOTO 4I2HA 2OXOA 1ZETA 2GJFA 3TQ1A 2DFHA 2XI9A 3CDEA 1UWBA 3H08A 4LF4K 4DV2J 1RCOB 1JJ2R 4F4AA 1CJKA 2A10A 2HCFA 1MN7A 5EX5A 1TUYA 1YJVA 2HS3A 1OO0B 2W40A 2HVZA 2ZJRQ 1HI1A 4AM7A 5H9EJ 3KLIA 5BOMA 2B9XA 3RW6A 3BSNA 3SMSA 4I2EA 3S3NA 4M9GA 2IDEA 1Q7LB 4I2CA 2WFBA 1MDUB 3NVZA 3LDNA 3OLAA 4JI5F 2VANA 4WXOA 1SAZA 3BS7A 8ICBA 3PLAA 5AKJA 2E9RX 1VQOS 2AX0A 5K20B 3K9JA 2JC0A 2FGCA 3PIPQ 4KPYA 3B82A 3GE9A 5JLFA 3CMAS 2ZJ8A 1AROP 2HHPA 1OQ6A 3TVYA 3HSZA 2HYIB 1HEKA 2CXEA 1FXDA 2H3GX 3HF5A 1VQMS 4ZTFA 5K8MA 2KHCA 2L08A 2HOQA 3F5TA 3AGRA 1KAZA 1QTNB 3BYRA 3OYMA 3CQXA 5EWEA 5GAGI 4TU7A 1R8HA 4BVOA 2B4PA 5IIMA 1BQNB 2ZUCA 4YB7A 3MECB 1DGJA 1FNXH 3AA3A 1IBLK 3R9PA 4LR9A 5J0TA 3AQFA 2W7PA 5AZJA 4AM6A 3MMJA 2BJ9A 2CFXA 5KG1A 2FD2A 5A8KA 1ZZFA 2GHWA 3E01B 2V9KA 3JSRA 3NCRA 2VKRA 3Q8MA 4RKUC 1N8RT 2LQJA 3BKFA 2D1CA 4UB8U 5D4OA 2Y9TA 2FPMA 3ILJA 3H8SA 2Z0GA 2UVVA 2PFOA 2BANA 5KAIU 3T1YK 5BPCA 3AMZA 3B4MA 3M2RA 1Q3UA 4AT1B 4FLWA 4O44B 5EGYA 4C2MA 5EWGA 3VQPA 3C6TB 1ZBSA 4UOCA 4TXSA 4ZVGA 3ZEUA 3HT3A 2RDIA 1N36J 1VISA 4DLGA 1RADB 4CJLA 2KB2A 3DLKA 5AE3A 1YAGA 2KW4A 2EKYA 4ELUA 5HBMA 5BRFA 5J1PA 3CDUA 4L74A 4UARA 5KFZA 1UWAA 4OZ0A 2M3DA 2HHXA 1J97A 4O3OA 4DTJA 1FXLA 1RAGB 3ETLA 2Q1NA 3R1XA 1YZ7A 2VPWB 3OTOF 4KITB 4ES2A 3CCJN 1Q82O 3R7SB 3S7RA 2O8DA 1TKDA 3PX4A 2ZWHA 2G8IA 2J0QD 3QLHA 4KH1B 1M5VC 3TZYA 3J7YP 3V9ZA 2MZ1A 1VQ6S 2WCXA 3QAUA 5K14A 5AQLA 1DBDA 3ZSVA 4DSIA 3JPRA 2MUTA 2V51B 4K0KF 4Z4GA 3QX7A 5DRKA 1YJWS 2QLJB 3TSQA 2I9SA 4LF4J 2IJRA 1L6NA 1H7WA 2DK2A 3G8TA 2ZH1A 1WI6A 5DGBA 1NZBA 2DT9A 1TL3B 2H5XA 1E4GT 3OVAA 3O4QA 3OHRA 3W0LA 1H3DA 4JK1A 1NSKL 3CHWA 3MMCB 3THYB 4QIFA 1K44A 4FLXA 2A1BA 1WSRA 1JWWA 2XCAA 1Y5IB 2DQNB 2V2QA 1FDAA 3IGNA 1FKOA 3L9ZA 3KJFB 1HNZF 2YQ3A 3P96A 2ZWOA 4JS5A 2ZH2A 4BREA 1WB9A 1VBYA 1RPLA 1L7NA 4YOYA 1QE1B 2YHAA 3MM8B 1KLMA 4QBUA 4P7VA 1CG2A 1U09A 2E5LK 3NASA 2DNQA 4FXWA 3P4IA 1Y4ZB 5KT2A 2QRRA 1PBAA 2Q0ZX 4LT6A 4Y2PA 1IV0A 1SV4A 3LAKA 1H74A 1KQGB 3BPDA 4AXIA 2ZG6A 2UUCF 1N61A 5AQOA 2YMMA 1RM6C 4DL0C 3I28A 2IBKA 4A8OA 1VQ4N 2FMQA 2HDOA 1URJA 4DO9A 1V6HA 2X1GA 5HR6A 3CUNA 4ZIWA 4XEIA 3SSRA 1HNIB 2ZTDA 1E6VA 4MK8A 4WQ4A 2WF5A 4CIOA 2HMPA 3IR7B 3OR2A 2PMZD 3TWHA 4JS4A 1HKBA 4BC5A 3HKZF 4WU2A 4M3TA 3SZ2A 3OPKA 5G0RB 3T1HK 1GMVA 3ULEA 3DRRA 1IBLJ 1HFEL 2VH7A 1JJ4A 2ZE2B 2OA8A 3MEDA 1S1TB 1X40A 1NAQA 7ICPA 3IBPA 1FDNA 3EXYA 3LA0A 1U1OA 3TAMB 4RWXA 3IWLA 1S22A 3CPWM 4P4PA 1DKGD 4OYPA 2O6KA 1UVKA 5KFGA 4US9A 3P49B 5ETTA 5A2QY 4I2GA 3ET6A 1NLVA 3HW8A 2CZVC 2ALZA 2I1QA 4WE1A 3O8WA 2ZJRL 3N5BA 1CJTA 3T1YJ 2ZH8A 1X1PA 1CVJA 1SB3C 4B9QA 1VQ5S 2JGAA 2G07A 4B3TK 3DM2A 3RB6A 2VOOA 2R7OA 1WC1A 3NVVA 2GWKA 2P2CB 4W90B 2L5YA 1X66A 1VCTA 3HFZB 2L41A 5J2KA 4NEZA 1YIJN 1VJ5A 2ZC4A 1VBXA 1HMVB 1B3TA 4NLGA 1JXBA 4DCPB 4IYQA 4TY8A 2BJ3A 5D78A 4ZVSB 1IBMF 3CFRA 4XQ8A 1DTTB 4PRFA 2P9IA 3M8PA 1CXUA 3R6LB 3HZ6A 1TAUA 1UEUA 4TQRA 4ECTA 2WSEC 1BO5O 4JHDA 3LDPA 1NJWA 5F2RA 2RS2A 3U9DA 2UXBF 2W54A 5AR0A 3G6YA 1FW6A 3LK9A 1Q86O 3A5LC 4DFJA 1IR1A 3BYPA 4YY3K 3AA5X 2FUG9 3PJ9A 1WN7A 5J2JA 1XC9A 3K5MA 3A8KA 3QT8A 3IM1A 3BZCA 1A77A 2XGQA 4EUVA 1OMSA 2YPZA 2N3OA 2P1JA 5AKGA 2J6TA 3UQSA 1EQ0A 3V7LA 8ICFA 3FBCA 4GO7X 3G6EN 4LF8K 4IBNA 3FFKB 1ZQYA 4LSNB 5FLXO 1NZPA 4WIIA 2HRUA 1NM1A 1QZ5A 1JNZB 1WTFA 3O8MA 3TR8A 4F4YA 2J6UA 2E5LJ 4LF9F 3G25A 1RT5A 3K2PA 3ISND 9ICSA 1TQLA 3PV8A 4UB5A 1VLBA 4B08A 4EBCA 2K1RB 3WK8A 4KI4A 2KVCA 2WOMA 1HR0F 2WRMA 1REVA 3AOCA 1QCKA 3AB2B 1ZQNA 4NRTA 4LY7A 2JEIA 3NWGA 2DGVA 2C3OA 2OPQB 3HZEA 1WSEA 3H3OB 2QARA 1BL3A 1JXVA 3LPUA 3TTFA 2KKHA 3HFVA 2XMKA 5ETOA 3BS5A 2IJFA 1QS4A 5IQQA 5KG0A 3T1HJ 4Y1DA 4JD2B 1MROB 2GIFA 2OZMA 3D3BJ 1S9GA 4ENOA 5F9LA 4IUFA 3ISCA 2HBJA 2DBBA 5AI8A 5E41A 3CF5Q 1VOMA 1Q81O 3M2UA 3TUPA 2YNGB 3LO3A 3CJ4A 3D5MA 4QR2A 2MLYA 4ZCLA 2MA1A 4UAVA 1T4GA 1LW0B 3WQPA 2RQMA 2AD9A 1Q46A 4KE5A 1NGGA 3WXJA 3CD7A 3EKSA 1KTVA 1IBKF 1S9FA 4NZ7A 3HYFA 3AH6A 4P0PA 2QWQA 1CC7A 5ALZA 3K7RA 4CFCA 2NXUA 5E3RA 1XMOJ 4B3TJ 3W2VB 5AQGA 1HNWF 4KLEA 1DJ0A 1UAXA 2Z58B 3ZSQA 1GXLA 2J5AA 2VJ5A 5ALSA 2HHTA 3QQCD 4ZPTR 1J5OB 3TKAA 2FB0A 2N7CA 5EVZA 1DK3A 1RTDA 3A4TA 4ZHRA 3N4MB 1CLFA 4RX6A 4CGZA 2EFNA 1ZRNA 3L4PA 4CJ3A 2YQ0A 2UU9K 4KX5A 2D4WA 4KB0A 4E1NA 3WEEA 4JI4K 3UKUB 4OMFG 4BE0A 3ENAA 4R8UB 2J7UA 4WFXA 3AVIA 3Q2SC 4BE2A 4Y2YA 3M9MB 5J0UA 2DR8A 2YMPA 5ITHA 2HNDA 4Z6FA 4ECWA 2MRLA 1IKXA 3ZYYX 5AXNA 4LREA 3BO3A 9ICLA 1FK9B 4YY3J 1DLOA 2IYGA 4DCCA 4RW6A 3SDEA 3H45C 4YR2A 2KSOB 1T3VA 2XSJA 3C1ZA 1WD6A 4P9SA 1ZC6A 4QZEA 1SC1B 4M7YA 2YNHB 2GHVC 1DRZA 4KPCA 3BGFA 2LYBA 4LF8J 5KFBA 2GW8A 4WCEL 3VEWA 4ZTJA 3V9SA 5BYQA 1FFUA 2KL8A 4CHNA 2NZTA 5AI5A 1UVJA 2HOIA 2CQGA 5A8WB 3J7AP 1ZOLA 3HD2A 2HFVA 1T11A 4OZ5A 1S5LU 1EP4A 3V6HA 3FK4A 2WBNA 4U8VA 5E3AA 3NF9A 4ZP9A 3O9QA 4YHHF 3LM2A 3IM8A 4X4NA 2WC9A 3TEHB 4BQZA 3BR9A 3TADC 2W2PP 5IIKA 1OVQA 3CC2N 5GAEP 3OYKA 3CIZA 4X66K 3TA2A 1S1UB 2AYBA 1C0TB 5LMNF 1GO3F 2YHWA 2K2PA 2MAXA 5B09A 2RHFA 4Y28C 1VSLA 2DHHA 3M05A 3L3CA 3RMBA 2M4MA 4ETXA 1WACA 1HBNB 4UOHA 1C20A 4GV9A 3AVCA 1WC4A 1RTHB 3DLGB 1L7PA 4CLZA 1QD1A 3KD3A 1VC0A 3HD1A 5J2AA 9ICBA 2O1PA 2AWZA 2EZXA 1TL1B 2ROPA 3E9OA 3VPZA 4F0HA 4M04A 3RJHA 3M7VA 2K3KA 4FJ5A 4RJVA 3SBMA 3NS1A 2KYZA 2IS3A 4FK2A 1RT3A 3IWXA 3FE1A 4A47A 3QBWA 5KFRA 3TFSA 2EAPA 3MPVA 3DDHA 3RJFA 4MDBA 4QOTA 3CJ1A 2FVCA 1NH7A 3MPDA 1JXEA 3SSQA 1RDFA 3T7ZA 1T3QA 1OYEA 3TARA 3OT9A 2VKQA 3NRZA 2YKAA 2X1FA 4CECA 4P75A 1TKZA 2Q0RA 3KK7A 3QT6A 4UAZA 4NA1A 2EAOA 2C22A 3L6QA 3FCVA 1ATRA 2B56A 1NGDA 5ALOA 2FSNA 3H8WA 1NXIA 4CTAB 1RDDA 2V9WA 3QEXA 3KHHA 3U27A 4R5PB 2UU9J 1UA0A 4DV3K 4P2FA 5AE2A 1ZD2P 4JI4J 4NYNA 5G4DA 3RWUA 2EK6A 1QH9A 1PYSB 4FJIA 5F8MA 1VDHA 4WK1A 5JLHA 4XPEA 7ICOA 4UB4A 4JV5F 4I2IA 4ZLLA 3SJJA 1D9AA 4HYKA 2IMOA 1VSFA 1N5SA 1R89A 2Y1JA 1H2UX 4EYHB 4OYOA 3NGUA 3G10A 5GAGU 4FW1A 4DV1K 3MM6A 5CHCB 3CF5L 2JZBB 4OJPA 5TZVA 4KH6A 2RRAA 5C2GA 1HYZA 3OY9A 4F50A 3SFGA 4HEA9 1NRKA 4ICLA 1Z1VA 4FK0A 3OS2A 1SIJA 5AHXA 4DL2A 1HBOB 1NB7A 4LF7K 2BYCA 2BKOA 2YVSA 2CN1A 1NPKA 3LDAA 1VQNS 1SUQB 2OTJS 5FPNA 4AHTA 1EHWA 4CEFA 3Q83A 4NCAA 3FR0A 1S97A 3BSAA 4M3ZA 5J0QA 4MK9A 1EXNA 4A61A 3HHLC 3S3MA 1T03B 3ZZUA 4JI7F 1GLFO 1M1KO 2PY5A 4BG8A 2FXUA 3DRPA 2VDIA 2ZEJA 2V67A 1CI4A 5HN0A 3GWCA 1NM2A 4BWMA 5JMVA 2LDIA 3UWTA 1R8PA 5ADXA 3D6RA 1VQON 3GB0A 1FVQA 2CH6A 2XMJA 9ICXA 4DR6K 3CULA 3MN7A 4DS4A 4X66J 2VASA 5KG6A 2QXFA 1NGBA 3CMAN 3ZNJ1 1ASVA 4LF5K 3OFGA 2BKEA 4NL9A 1W25A 1U1RA 4URGA 2RRBA 2EWHA 3GFHA 1ZA2B 5KFVA 1VQMN 3WDOA 4AHUA 5T7BA 2KNJA 5CR0A 1RT7A 1WF0A 4HLBA 5H2FU 1JJHA 2GJ2A 4CZJA 3EGWB 4KR0B 2CJAA 4A8EA 3ZZ0A 1PVQA 4E7HA 2XLKA 1NK5A 4C7YA 2J0XA 1JRPA 2FMSA 4A4JA 3NTUA 2B7BB 1C0FA 3ASMA 4ZP7A 3CGIA 4LFCK 1S1WA 2NLXA 3VALA 2KT2A 2AV5A 2E1FA 1F5AA 3CFOA 3BKUA 2YNFB 1Z2ZA 3A1YG 2MQOA 2RS8A 3C6UA 3N5FA 3WUHA 4AFFA 3DOLB 3ZETB 2BPFA 2MJUA 2XHCA 1MA9B 3GJTB 3UD3P 3IMQJ 2W9CA 1BC6A 4C8ZA 1VLYA 4KLGA 4PA1A 2KIVA 1YZ6A 5KL8B 1KVKA 4DI6A 2A1AA 4M3UA 2QYCA 4DR7K 2CA9A 2NXJA 3ZT3A 3S9HA 4UATA 4GC6A 5KGWA 4ELVA 3O6QA 4F04B 4Z4CA 3GV5B 4DV3J 1F9HA 5U47A 4IFVA 1ZQLA 2NS1B 2VIXA 2WK4A 4FJ8A 4DV6F 4BX9C 1FEEA 4UZBA 1IWGA 4F92B 3BDPA 4NB4A 5B0CA 4B9NA 2V8PA 5BJRA 2Y1LB 4QS9A 2E29A 1SKWA 1U02A 1K47A 2RRDA 3QYPA 4B9SA 2FJ6A 2FBTA 3FZKA 4RU9A 1FWKA 4MF2A 1Z4OA 2A0FB 3A3NB 1IIPA 4LIRA 4DV1J 1UFLA 4PGQA 1TFYA 1NGIA 2R7SA 3AJ2A 1OY6A 4IH7A 1RHKB 2KFYA 5IINA 1XQIA 4EHUA 3AD9C 5E79U 1VQ6N 1ZS6A 2KIWA 2MKYA 3PM9A 3QE9Y 2U1AA 4Q2MA 1YJWN 2IVPA 4LF7J 4NLDA 3ONNA 2MQLA 8RUCA 1E4FT 4K4UA 1CJUA 3KLEA 1GLEG 1RT2A 5FIIA 5AFUA 2FLOA 4WPAA 4ZOHC 1NGFA 2LI6A 2QT7A 4KHPF 1NZ8A 4M5KA 5D8HB 1X6IA 1SV5B 2VYPA 4EX6A 1PYTA 2ZJQQ 4H4MB 4JI1F 4M5JA 3VMFB 3P3DA 1GLBG 1A7GE 3A0HU 1ROFA 5L46A 3DDIA 4M95A 1G15A 2UYTA 4E7KA 2EI5A 2NZ4A 2F9WA 4HL9A 4NZ0A 4YS2A 4CJ4A 3QPIA 4O8UA 3L0QA 4PGYA 2W04A 5K4LA 1AT1B 5LSRA 1MLAA 1ZQRA 1RI7A 1T9WA 2O5DA 2MSSA 3GJSB 2E5HA 2OYYA 3ZT0A 1IVZA 1PZNA 2OHDA 1LFWA 4OQJA 5GIPA 2XICA 4LF5J 1RISA 2W9BB 2BKPA 1TKTB 4PG4A 7AT1B 4G3IA 4BUGA 2R3VA 1Y5LB 3LPTA 4NYOA 4DOCA 4RT2A 4RG8A 3MZIA 2ETJA 2QFIA 3FYHA 1DGKN 1QQCA 4U96A 4JI3F 2P66A 3MMVA 1RAHB 3R5BA 3SQGB 3T5LA 1O1WA 1YJ9S 3AARA 1V3RA 4BY9C 3CCTA 4RWTA 3T5HA 4CEZA 5CP2A 3OSPA 5C2CA 2FDRA 2H3FA 4BWJA 3FMBA 4LFCJ 2BKNA 3GILA 3ZSRA 2CGJA 2LXFA 8ICWA 4TYBA 1RBTA 3K1RB 1FA0A 3EVWA 4DX8H 3M3ZA 1X4DA 5IIOA 3KJNB 5GMKa 2ZGYA 4CZHA 5ALYA 3C46A 5AICA 3AVKA 3THWB 4O3PA 3R7BB 4FDFA 3VGMA 1BWFO 2V8HA 3GFYA 5F0UA 1OS5A 1GH8A 4JYAK 2ZIUB 3FZLA 1FRKA 3MPUB 4F4XA 3RRKA 3QGHA 5GAHI 1F21A 1HKAA 2NREA 5ALKA 4WFAQ 2W41A 1EJ7L 3JTOA 1WLJA 1R7IA 3LGHA 2FZCB 2IIRA 4UY8T 2P51A 3FBEA 2E8AA 3DDNA 4DR7J 4OX9F 4OKJA 1VQ5N 3D4JA 3CM5A 3Q22A 2D0OA 4F36A 3NAEA 3H7HB 4IR1A 1NHKL 4K4HA 1HNVA 1ZQTA 4F2SA 4O4GA 1HLWA 1T02A 3C2LA 5IWAF 1MMDA 2XSFA 2W8KA 1YTAA 3HXMA 2POKA 5LL6Z 4UBCA 4Y2AA 3BEGB 2CQDA 2E7WA 4CEOA 4J9LA 4M5NA 3JPNA 2ZUAA 1TL4A 2HVDA 2O4IA 1TK8A 4ILGB 3VAGA 3W62A 2YWEA 4ACOA 4YP3A 2DKZA 4Y6IA 5HI7A 3R9KA 1EX4A 9ICGA 1UETA 2KOBA 4BR2A 3QIPB 4TVAB 3H59A 2HK3A 2OKQA 4C0BA 4FZLA 2O66A 3VZIA 3L3FX 2AQ4A 2PXIA 5KQDA 2MZRA 3O1BA 3G8QA 3N4QA 4M5DA 3CCVS 1RT6A 3F9MA 3NGZA 1N0UA 2ZZMA 3H5XA 3EGNA 3PDNA 1VJQA 4BGDA 2XGPA 3LPYA 4DFDA 2DFFA 2P9UB 3CJ5A 3IO1A 1RKJA 4DHYA 4KH0B 4QJFB 8ICVA 1WSJA 3HRDD 1L3SA 5A0YB 3MGHA 2KRBA 1NGJA 1FERA 5ALHA 2G0JA 3OBWA 1RB0A 3HJFA 2HBYB 2KVIA 3G82B 5DZ6A 1T9VA 1R27B 1X8DA 3MCPA 5KOXA 3M2VB 4X62K 2A3ZA 4CJFA 2RN2A 4C1NK 1CLQA 2KKVA 5G5HA 2G8UA 4E8UA 2EZYA 5CR4A 3OTQA 4C4RA 3KZIU 4GW6A 1LKYA 1BWEA 5HANA 3HHLD 2O8CB 1VSMA 3CJCA 4FPBA 2G9OA 2V52B 1N36F 4H5WA 4PHTX 2BPGA 2B5JB 2PDAA 2W9AA 2FC0A 3J81O 5L38A 2AXTU 2DRBA 2GELA 3VF2A 4XRHA 1IQTA 4GMKA 4CZLA 4PR6A 4JV2A 5KFDA 4YXJA 4M3XA 4U7CA 2OWOA 4NCGB 4TUQA 1BLUA 2PN6A 5JVHQ 4EX7A 5K8PA 3V7KA 2CRLA 1H72C 4GVBB 2R18A 4PPXA 4K43A 4GRSA 3OS1A 5D4BA 2ISPA 3HSGA 1NK0A 3KLGB 4DUYK 2NYHA 4OHXA 3O44A 2IHMA 4OYXA 5CA5A 1F0XA 3OR1A 5M1FA 4Z4FA 3D6MB 3VC8A 3NXZA 5F8GA 1UQVA 2GAGC 2YWGA 4CD3A 4JYAJ 5CYJA 3EGVA 1CJKB 4YD2A 2W24A 1V3SA 4KHMA 4HUEA 3U6FA 1TK5A 5J2CA 4NYFA 2CQBA 4Y2VA 4PQUB 1KFTA 2ZJQL 3T6JA 4JB3A 2ZIVB 4J9KA 3DNCA 4RLEA 1RHUB 3GYXB 3ILIA 2YH0A 5J2EA 3K8VA 3LPEA 3JYTB 1NMEB 4ILMA 1A0OB 3RMAA 3Q8KA 1RWKB 2KG5A 1WSFA 4CLFA 3VR1A 3LP1A 3AA4A 1FJEB 3CETA 3J7YI 4NLUA 2WMMA 3SV4A 3I4HX 3I87A 2LEPA 2A1RA 3B8AX 5SZTA 3FRZA 3UXOA 3IM9A 2GBZA 3NEKA 1VQKS 3CEDA 2DGTA 4FS2A 1XMQK 2P5OA 3R9LA 2CUYA 1N88A 3DAWA 5J0XA 5L1MA 1RLDA 4TLQA 4QYRA 2CAJA 2WFAA 2Q66A 2HOFA 3UPFA 1XNQK 5KFKA 2BW2A 1VSEA 1Y11A 5KG4A 4DMZA 1J6ZA 2RMLA 3QGIA 4LSZB 3IKMA 3GDQA 2CJQA 2QEXS 4J5OA 1N32K 3DLHA 3C7NB 3DRSA 4GY2B 2P5GA 3EO3A 1T9YA 3UVJA 4CLUA 1VLOA 5IT9O 2VG5B 3SD7A 4P7TA 2OELA 1D0EA 2HHHF 4DSKA 2KHVA 3LF0A 3B6PA 3W2WB 3NGIA 2RNEA 1DEJA 2YKOA 1U0HB 3KTQA 2CJKA 2Z2YB 1N33K 3QSYB 2YX6A 3M30B 3MGJA 2ESEA 4FWRA 5AK3A 2CPJA 9ICMA 2R7QA 5ALUA 2W2OP 1QVGR 3M6VA 4X62J 1KXPA 3T1YF 2DNGA 2RVJA 2W2QP 1RAIB 1MWKA 3M2RB 1LXNA 4U9RA 3ID6A 1S99A 4YORA 2LKYA 3T9ZA 2VKZG 2C2ZB 1JROA 2VICA 2OHFA 2W9MA 5ALQA 1WYGA 4IC9A 1HRHA 3CO0P 4H8KA 2R7VA 1GQEA 5ETPA 2I9GA 1RU2A 2AYEA 2PEBA 1BCOA 2ZUBA 5AQQA 2E3TA 1KVBA 4ILHA 4RU2A 4XIUA 4X4PA 3A8JA 2FTRA 4FZMA 2QKQA 4JI5K 3AO3A 3DRYA 4JK7A 2F4VK 5CWRA 4CJWA 3NF6A 3CE8A 2EEYA 1X4CA 4KMUA 1LFPA 5DS7A 4Y2CA 2O8DB 3B9JA 4A46A 1T7PA 3RF9A 1SJQA 2BACA 5DDRC 2EFQA 4KLJA 4DUYJ 3OPXA 4JK9A 2QWRA 5K14B 1CXQA 2XMVA 1WUUA 2MUTB 3QBCA 4MDAA 4RPYA 1U48A 4HTIA 3MFHA 2AT1B 4K4VA 5BR9A 2YI1A 2J9DE 4HI2A 2PMZF 3CMQA 3JPQA 3P8BB 3PNCA 3MECA 2HSZA 5B0BA 9ICVA 3R27A 4RQ3A 2VC1A 5TKYA 1FKOB 1S0NA 7ICFA 3ETMA 3BY5A 1IM4A 1EKRA 3TANA 5FD1A 1RA6A 1UKUA 4NLTA 3F2BA 3ITHB 1CC8A 3E01A 3DRXA 3KXDA 3V6JA 2ZIWB 4W4MA 4DV4F 3PO4A 5AK6A 4QWDA 2ZH6A 3I31A 3M4XA 1UW4A 3ENQA 3CCRS 1YXQA 3HTVA 1MN9A 5M1KA 5DG9A 2HBKA 2F7VA 3NL0A 1N5WA 3T79A 8ICMA 2O8BB 4Z4HA 5T41A 2QX0A 1OIAA 2DY1A 2CPIA 2NPIA 1XMQJ 2P9KB 2DTUA 4O44A 3OD2A 5D0GA 4CJTA 1WWHA 1XNQJ 3A12A 3TNVA 4RUAA 4QZ8A 4WFYA 1E6VB 4H0PA 2K8AA 3NGYA 2UXCK 2P5VA 2Z1HA 2IYIA 3W5XA 3CXCM 3QJJA 3VQAA 4YMMA 4WJBA 3T1HF 4PH5A 3RFAA 3DRRB 4I64A 2AJQA 1S8OA 2L9NA 4CO5A 3R3LA 4PL1A 3E3XA 1XK8A 3LDSA 1N5VA 3D2WA 1JK9B 2GO9A 5EOZA 1P1TA 4BDYA 3OTOK 1N33J 3NRWA 3DLEB 3ZTSA 4CJSA 3EVMA 1F2HA 5J2QB 1VQNN 1U1KA 2G8KA 1U1MA 2QA4G 3ET6B 3OXGA 4GV3A 4BRLA 2KO1A 3BR8A 4WE1B 2OTJN 2BUNA 3QRQA 4BHQA 4K0KK 1HJRA 4CT8A 3KDNA 1B7YB 4U95A 4V19X 2W3SA 4FYWB 4M3RA 1TL3A 3PSIA 1UVMA 5DDPC 3MMCA 4ITSA 1ZBLA 3ULDA 3K58A 2JLEA 1MNEA 2H4WB 1URNA 4DQPA 2MKIA 4CGIA 3V4MA 2VC0A 5B5EU 3P6YC 2PA8D 1X4EA 2I6WA 3ZFVA 3UMBA 1LQ9A 4AHSA 3GV7B 2KVQE 1HNZK 3VN5A 1QE1A 4M45A 3MM8A 4KAIA 1V85A 3MR6A 3HPGA 4JI5J 4FXVA 3GOIA 2F4VJ 4TUPA 2P9IB 4CEQA 5HP1B 3CJ7A 4WYLA 3EEQA 1S7HA 1Q78A 2RLTA 2E66A 4OZLA 5JVGQ 4XK8C 2UUCK 3SBTA 4PL7A 1BMQB 2X78A 3J7AN 1JB0C 1GTHA 3PCOB 2Z30B 4QIVA 3SQ4A 4J9QA 1HNIA 4PZVA 5J2DA 1WNSA 4X4QA 1XQSC 1RDBA 4B02A 2LHTA 4FCYA 2DNKA 2Y9UA 2HQFA 4J37A 1YKWA 9ICIA 3ZDDA 4USKA 2K60A 3THVA 3ENBA 1KTQA 3VQ6A 1AXQA 3B78A 3RH4A 2PYLA 2OSRA 4RQ2A 4I27A 4XTTA 1ZOTA 3WK9A 4F4ZA 3A0BU 5E3PA 2MB0B 4WFZA 1SJRA 2ZE2A 3PKMA 3KZXA 1S1TA 4Y65A 4Y3CA 4LF8F 4EELA 1JLQB 1F5BA 4BRDA 3AVBA 4H0XB 5A6PA 3GL1A 4PYAA 3MBYA 3EPIA 4EYIB 2DEIA 1N52B 1YT3A 4DTOA 3U1MA 1VQLS 4O3QA 4F3MA 1GT8A 3J80O 2D41A 2DGWA 1O5JA 5G5GA 2D3OR 3CWJA 1DARA 2Z1JA 3W5ZA 2DB1A 3BZQA 3H46O 3J7Z5 1OPZA 1CBKA 3AY9A 1REVB 4EP4A 5FDLB 3I76A 4PZOA 4Z6EA 1RHJB 3W8PA 2XY6A 1M1HA 4ZP8A 2QARB 2ZVSA 3A8IA 3MN9A 3GU3A 1QY7A 2UXCJ 1J2MA 2QKBA 3BS5B 5F9NA 1NNDA 4LBPA 2JHEA 3MM5B 1NI3A 1TL7B 1F9EB 4ATNA 5BOLA 3H8MA 3RSEA 3CDBA 4C8OA 4HKQA 2RUSA 5KTQA 2W4CA 4A8YA 4P52A 2ASJA 2K8GA 4K59A 1C0UA 4FPRA 4NLCA 3I82A 1PC5A 2B6GA 4CFAA 4CO0A 1Z4NA 3OTOJ 3VEYA 1RJJA 3IS9A 5DM7L 3G6XA 4ZVRB 1SPBP 5D4PA 4O0IA 5KFQA 2OJ3A 3UNYA 4KLHA 5BRDA 1EX8A 3E9LA 2UXBK 1AUDA 3HCXA 4B1XB 3M8SA 1OH7A 5HK4A 4K0KJ 4YOUA 2P9SB 3CI5A 4Y2JA 4LMZA 5GAHU 4H0YB 2DR6A 4BRGA 2EK1A 2L3MA 3PYDA 4ZN1A 3LDOA 2QC3A 2WUSA 2ZC3A 3R5JB 5CJ7A 1JMSA 3B54A 3DOKA 4M9JA 5F8IA 3H2VE 4NL9C 4B8CA 1R31A 2E1EA 1GOAA 3I8DA 3CB4A 3MX2A 1HNZJ 3HSDA 2V7ZA 4ZHRB 3U9ZA 1Z00B 4LSNA 2VJ4A 1ED1A 1X5TA 2BUPA 1ATSA 4OJGA 2M9NA 3TAPA 3I96A 1X2IA 5DDQC 3LWMA 5RUBA 1ZJNA 1OQ3A 1K8AO 3WEEB 3LZIA 5BPMA 5CZ2A 2K1RA 4ECQA 1VSDA 2Y3YA 2PT0A 3TJ9A 3U8XA 4AL6A 2UUCJ 5L8RC 4FYDA 4K2JA 2RP5A 1NH8A 1R8BA 1FJGF 5J8YA 2QN6B 3ILLA 1YJ9N 3BSCA 3PHTA 3Q24A 2KM8C 4FJ7A 3K4GA 3NH1A 3K5LA 3KNAA 3PIOQ 5HMMA 4FYYB 5DDYA 5M2PA 4L3QA 2JVOA 5AXLA 2P8IA 3P31A 1DLOB 3D2FA 1ZBHA 1TVAA 4YD1A 2BQUA 3E1YA 1C0GA 1VMBA 2AJ1A 2CG8A 3MR5A 4KLDA 4DV7F 3R5GA 1YVUA 1X4GA 1ZZNA 3G9CA 1M5HA 2ADBA 1MROA 3CCUS 4FWPA 2BQ3A 5ALJA 1WNEA 4R63A 2NR0A 2G8VA 2QL5B 5HOOA 1LAWA 2JOQA 4FS1A 3HSCA 1OH6A 2F40A 4YOWA 2Q1LA 1B4FA 2KJVA 2YNGA 5AXMA 5EHHA 1IO2A 5IXUA 1BIZA 4RTFD 1OSDA 2E9TA 2YQEA 2Q6CA 1LW0A 3QSIA 2DHSA 1FDBA 4NI2B 2E20A 2PFDA 1EP4B 4JP8A 2EX3A 4J8FA 2D3DA 4JAXA 1S72S 4A8QA 3ID8A 4P6QA 5DLFA 5B66U 1FRIA 2YWHA 5EY4A 4NYPA 5FPMA 4G1QB 4NLPA 3W2VA 5I3UA 1S5JA 2QTDA 4CBXA 1YVFA 4X66F 2V63A 4RW7A 4RNOA 2LLZA 2JNJA 1HUZA 3CCQS 5ALLA 3CJBA 1J5OA 3X3UA 2GMJA 1J53A 4AF1A 1B0PA 3F53A 2UV8A 4DG1B 3AO2A 3QUBA 2R8GA 4OJOA 2OLWA 5JVGL 4C7QA 2VG6A 2IY5B 3HVWA 2HWIA 5KT3A 3W64A 2B0GA 2KN4A 3AVLA 2OUGA 3UKUA 3CCVN 4R8UA 3E9PA 3EUNA 1RAOA 2NRTA 2XYPB 1U1QA 4O55A 1FFSB 4A5AA 3WK7A 4ED3A 3TVZA 4USAA 3FSYA 5SUHA 3PYGA 3CPWR 4KLUA 3H1QA 1IBCB 1UHUA 4A5BA 2VIHA 9ICOA 3FKBA 2UXBJ 1Q53A 4USJC 1RT3B 1RQLA 3LUYA 1FK9A 4IH6A 3R7NB 5EU7A 2Q79A 3VF6A 3MFIA 2LU1A 2ZF5O 2OPRA 2I0XA 2D69A 2KSOA 3AAQA 2MQ8A 3QNOA 3PRDA 4CBWA 3M9OB 3CIPA 4BRKA 2ASMA 1TR0A 2RT3A 3M6ZA 2YNHA 3QU4A 2YB4A 1JIHA 5AK4A 2W4DA 1P27B 2EC0A 4K8RA 1WG5A 1N6QA 5L9XA 1EO1A 3V6KA 4DQQA 2BJ7A 2ZD1A 3HJVA 1FTCA 4IQWA 3A3PB 4OO1J 2A2CA 5LY3A 4CHOA 4M2YA 5HL7Q 3IA0A 4ZVPB 2BEFA 3LZJA 4KTWA 1UVIA 4H54A 3C16A 5AKZA 4BC9A 1UVNA 3KZBA 1Q8BA 3BBBA 3NE6A 2B51A 2LA6A 2QSFA 2ABYA 5KFLA 4QU7A 3NHGA 3QUCA 8ATCB 4HCBA 4Y34A 4KLMA 2RIJA 2AGQA 4I2QB 4ZITA 3W7BA 1JLGB 2CQ1A 3MR7A 5J2HA 3L2UA 3MM6B 1U49A 4DJBA 2DKXA 2DCLA 2XMAA 4RW8B 1C0TA 3C14B 1EAYC 1Q9XA 4KAZA 3RB3A 1WEZA 4IO8A 1VR6A 1RTIB 4ZS6A 1U1LA 4FJLA 2N82B 5D46A 3NH2A 2ASOA 1KP6A 2BGWA 3SCJE 1ZXOA 3CJKA 3DOMB 5KFOA 4DPXA 2NNWA 1RTHA 3UXPA 3DLGA 1Q9YA 5BREA 2F3NA 2QWMA 1FHTA 1Q82T 2F63A 2ZH9A 4ILJA 1NKEA 3L3UA 5EN1A 3QFPA 3SIPB 1HARA 2R7YA 4K5RA 1DOQA 2ZXIA 4JKGB 5JXSA 3FQKA 3TAEA 1FTRA 4CZGA 1QQNA 4RW4B 3B6OA 4K4ZA 2NRWA 4EFHA 3HK2A 2VA3A 1QUVA 3EWAA 2QKKA 4ZLNA 3FGUA 4AHRA 4YN4A 4OI3A 1S1VA 2FC8A 3DRPB 4UOFA 1NGHA 4M5MA 5IT4A 2DVIA 2IM2A 1O13A 2ALYB 4DR6F 1OXJA 5DZ7A 1NEEA 4P2SA 4LF5F 4N8NA 5E3CA 2GC8A 1VQ8S 2ZNYA 1VQKN 1Y7PA 3GJQB 1FVSA 3AQPA 3QUTA 5DQGA 4C0HA 4OZ2A 3G4SS 4CGJA 4CTAA 5HRSA 1OY8A 5I4MA 2E44A 2BOPA 5KFHA 4C98A 2QEXN 1RDRA 4ZP6A 1BHNA 1BWVA 3EY1A 3UW1A 3G2XA 2W55A 4QWEA 1XO1A 3P83D 3PIOL 6AT1B 1RBSA 4BXOB 2CGKA 2MXYA 4KKOB 3KMSA 3EPGA 2W03A 2N4DA 8ICPA 1YJNS 4X65K 9ATCB 1S1WB 4JV5K 4K8XA 2HFSA 2KM8B 3HM9A 2QA2A 1QSYA 3T69A 4G9ZA 2GQCA 3JQJA 1YJUA 2JZBA 3R6GB 4BC4A 4FM1A 3LH2S 2DR9A 4FNHA 2D1KA 5I3QA 3TWZA 2LQBA 5ALWA 4BDPA 4KHWA 3FCWA 2FVPA 4CGGA 3BF3A 2XHWA 5AM1A 1WCLA 1HBOA 3AXKA 4I68A 3D2EB 1X9WA 2UP1A 1NBWA 4Y2SA 2J4RA 1SUQA 4F25A 5THWA 5GADP 3FFIB 5F3XB 4C8YA 2Q0UA 2CG4A 5E33A 2CKWA 2HWHA 4IFVB 4C11B 3H0RB 1XNRK 4IOAQ 1MWZA 3MCAB 3HI0A 1Q5YA 4EENA 3QEVA 1T03A 2C3PA 5B0EA 3RUBL 3P45B 2ITGA 2WAQD 2K4HA 8ICQA 3GR0A 3N28A 1ACMB 2ZZNA 1VSIA 4BGAA 3CYMA 1TFWA 2WBRA 4ZVOB 2UUBF 4HAIA 1F3VA 1BI4B 2PO4A 2HGMA 1NDCA 1GX5A 4Y2QA 2JMGA 4MEXA 1LB2B 1RZTA 2Q36A 3IWNC 1W2BM 1VQ7S 2PFFB 1WC5A 5KOWA 2ZZTA 4CJ5A 3DFEA 4I56A 2WVBA 2LVWA 2QLFB 4Z4EA 3W1YC 3PZPA 4HI1A 1I94K 4KMOB 1ZQZA 2PGCA 1RXWA 3KFUF 3FCHA 1VRUB 1U2VA 4CJKA 1XS9D 2ZM6K 1CJUB 2JLGA 3L95X 1T6DA 5HMXA 5TKWA 4F2RA 1VHXA 1FIQA 1NJXA 2VDHA 1AQ6A 1JCFA 2BZFA 2J8AA 1ZQSA 4UAYA 1QQ5A 5F41A 4DCOB 1Q86T 2U2FA 3THXA 3M8WA 5DGAA 4NLKA 2E5IA 2KZMA 5KFJA 3GPAA 2LBOA 2RUGA 3DOLA 4ZDNA 3ZETA 2F5GA 1YBUA 3C3LA 4FWKA 3HLUA 3CCRN 3UD5A 9ICPA 1C7YA 5AKIA 3DGPA 2IM1A 4OGCA 4EZ9A 5KI6A 4OHYA 4QZHA 2YMLA 4Y2TA 2WVEA 3QU7A 4JKEA 2CYYA 4X84A 2PZSA 3AO5A 3VGLA 1R0CB 4C8NA 4LZGA 4C23A 2BX6A 5HQMA 5DK5A 5LJWA 4DV6K 3ZSZA 2VF3A 3SCXA 4OV6A 3MI7X 3D6FB 3KD1E 4ZPAA 1J27A 4X65J 4H4KA 1DHMA 4JV5J 2IM0A 3TADA 1AZSA 4ANEA 1U6BA 4RUHA 2XWYA 1NO8A 4DQRA 3NVYA 2IDLA 3DN9A 1NK9A 1FESA 3KG4A 4WFNL 3Q7BA 3ATVA 2LXUA 4HWIA 3NMRA 5J2NA 3ZD8A 3PUFA 4WKYA 1KEJA 1U0SA 4PG7A 3R3TA 1FO4A 4CEDA 4KO0A 1L8OA 3F5EA 1UEVA 3NWRA 5AI4A 4B9UA 4MFBB 4H5TA 3DMJA 3M32B 5H9FK 4MIBA 3I0SB 1Q81T 1NDPA 3UDVA 3MCOA 1U4BA 3HKZC 2VA8A 5CY4A 4YN3B 1RYUA 4CH1A 4ED0A 1BPXA 1G4CA 3BS9A 5AQZA 4M63A 1RBAA 9ICUA 4KHPK 2MSNA 2FLPA 4JWNA 3BGUA 4F3QA 1XNRJ 4H4MA 5HJXA 1WWVA 2FPKA 1S7IA 4O4GB 5K8OA 2XTJP 2F1FA 4UB2A 3VEOA 1A0PA 4YNQA 2WW8A 1C4CA 1VK8A 3WNHA 3QYYA 3NG8A 1DQ9A 4GFJA 3LDLA 8ICRA 3VA3A 2CPZA 1S6UA 2NO5A 3D7EO 2DGZA 2CQCA 2HGNA 3O9TA 4OI2A 4Z7YA 3BQTA 4DSEA 1VRQC 1ZQBA 5M2UA 1TKTA 4ECRA 2JR5A 1CSJA 4M9LA 3AUOA 1VC6A 5HMLA 2F44A 3IV6A 2CQ0A 3E0FA 3E58A 2LSNA 4IJAA 4K2XA 2ROEA 4USMA 5AJ3K 2BDUA 4BRAA 3MGIA 4JI3K 4EO8A 2ZM6J 4DX5A 4AQYK 1IWAA 1U24A 4PHEA 1NUEA 2E2NA 1NMDA 2ZKUA 3C28A 1TL5A 3QIOA 4MH8A 3KUEA 4J2EA 1WELA 4HT7A 2J76E 3B4DA 5GMEA 3WT0A 4X62F 1XO0A 3MXIA 4CW7B 3V9UA 3THWA 1BPZA 3HSTB 4CLTA 5HRPA 1VQLN 2MEWA 4OHVA 1NPPA 5HVGA 3DC2A 2ZIUA 3EE9A 3RH6A 2MHEA 1V5IB 2DNZA 4AYBC 3RVCA 3UE5A 4PKIA 2KDOA 1RHRB 1SVDA 3LANA 1HX1A 5ETNA 4LR7A 3EUB2 4F5QA 2V94A 1FKPB 3OTDA 3HILA 5BN9A 3U3YA 1RUSA 4H4OB 3AOBA 3H1VX 3RMDA 5CCLA 3IRUA 2YX8A 3UN3A 1NLKL 4DV6J 5KFUA 2K3IA 2FBYA 3VESA 5IWAK 2GFFA 5A8RB 1Z19A 4FWQA 1LK7A 1K8KA 3HHKA 3FZBA 2NSCA 2DNYA 5D4NA 4DUYF 3IUCA 4MMOA 3J7ZT 4FZVA 1BPBA 4AE5A 4B3RF 3TVKA 3Q8YA 3VQ7A 2RQ4A 2EFGA 3IP4B 3MM9A 5A2QO 4QCLA 2JDJA 2HG4A 2MKCA 4FWSA 4YMOA 2D0BA 1SKSA 8AT1B 3HHDA 5KFAA 1ZQWA 3MDCA 2I8EA 4LRDA 3O9UA 4E98A 3GV8B 2YWKA 5A76A 1Q8KA 3OYEA 3R5AA 4EK2A 1VSKA 3OVBA 5H9FJ 3W8GA 1W9HA 2GVZA 2ZKTA 1YUWA 4B1WB 2YXLA 2H9ZA 3UN2A 3TUZC 2OANA 5JU5A 2PFQA 3F44A 3VHQA 4IEIA 2P9UA 5HRRA 1AUSL 4XDCA 1DURA 4KHPJ 2DNHA 2YH1A 2QYGA 2W25A 4F4WA 2KHOA 3SQ1A 5KFIA 2C1EB 2CJBA 7ICVA 1FI4A 4DQSA 4IOCQ 4M3YA 1KNZA 1VSJA 4K4IA 1JUDA 2CVEA 4RT3A 1XMQF 3G86A 1Q1KA 4OKEA 4ZLPA 3G96A 2CNNB 4LF6K 1NHVA 4OYMA 1T44A 1GLAG 4CJ7A 4BRCA 1P6TA 2Z2MA 3IG1B 2O8CA 4J2AA 1BUXA 4K8ZA 3C8YA 1N32F 1KAYA 3JPOA 3UVJB 3W60A 1KVCA 5DKWA 4GXJA 4M9HA 4DV0F 2QO3A 2ZJPL 2FVSA 5AJ3J 2ZBIA 4JI3J 4NCGA 2R8KA 1C0MA 3ZZRA 1BQMB 4CVNE 1AA1B 4AQYJ 1Z25A 3FDSA 4ID8A 3FEXB 3CCUN 4FSVA 1Q16B 4RNMA 3ZX2A 1N34F 3V1QA 3HKWA 1FNMA 1YRUA 3IHQB 4ZVQB 3CC4S 5FROA 4NWBA 3KLGA 5GAGP 1YG0A 3I5CA 3HL8A 2J9DA 2G08A 1ZQKA 2VD3A 4AL5A 3IDWA 4O0NA 4CH7A 3FZMA 2CNOB 3UD4P 4KN4A 3MR2A 3EXCX 1YITS 3NOCA 3H8JA 3L4QA 4U8YA 2GVDA 1O08A 5IOLA 3S6EA 3AHPA 2FJBB 2QWOA 4K5SA 4Z0UA 1S72N 2HMXA 3FBFA 4PQUA 1D8BA 4HDHA 1U1NA 2ZIVA 4NLBA 1MN8A 1OWXA 1KQQA 1WWUA 3JYTA 5KT4A 2CQHA 4OX9J 1D4XA 1VC5A 4K25A 4BGBA 4J03A 3VOVA 1UVLA 1LKZA 3CD6S 2F8HA 3JXUA 2E1MC 2D0AA 2XY7A 3CCQN 2V4RA 4HH0A 1PAEX 3BDEA 3H5SA 2F4VF 2GNKA 2I7PA 3KWGA 5IWAJ 1M1KT 3NS6A 3M6GA 2J7KA 4ZPWR 4B3OB 1DT9A 4F5OA 3GIRA 5AKEA 3MUVP 3H98A 4WYBA 2DPJA 4BRHA 2JZ5A 1VGYA 1NK8A 3CJQA 1HI0P 3VQDA 1X4AA 2EBEA 2HQDA 4Y2RA 2DUYA 4C4SA 1X0FA 2HFNA 4DXLA 3QAEA 4MEYA 3C7NA 3QWUA 4ZJQA 4Z94A 3IAYA 1KL9A 2Q2RA 2M88A 2P6TA 3V4IB 3NLCA 2VG5A 4IOBA 1RT4B 1IR0A 1EZZB 5T7LB 1T05B 3CD0A 1P1LA 2HHHK 3EZWA 3H0LB 6FDRA 4IO9L 2HQGA 2DF4B 4O8KA 3AOAA 4Y2XA 3W2WA 4IQXA 3FQLA 3FZFA 3D0PA 2PFPA 2WTUA 5J0WA 1HUXA 2XMTA 4MKYA 2V68A 1U0HA 3J7A1 3M30A 3O3LA 1YRTA 4HVJA 2VJVA 3A5OC 2XG8A 3QEBZ 1R8AA 1VDVA 4I67A 1ZM9A 5F3ZA 4ZN3A 2ZJAA 4NA3A 2LQ5A 4CK2A 4O3NA 1WDDA 4Q7AA 3GMGA 2Q3PA 3K2YA 4A8FA 1RILA 2FBXA 1OKJA 2D8CA 3MWPA 5J8YC 1HL6A 2XYGB 3PVXA 3ZTPA 4BBYA 1TAMA 4CF1A 3CIMA 5EWFA 4FLVA 3TJ8A 2QXLA 5B8HA 2BHNA 2AA4A 4NM1A 3DLRA 3R8EA 3SUQA 2UXCF 1KN5A 3I0RB 1BVSA 5J0PA 3ISBA 4DR4F 3PYEA 4HHUA 1HA1A 2RJZA 4URQU 2NYVA 5B7WA 2HMIB 3T19A 3NF8A 5M1OA 1NDLA 2F9JA 1ZM4A 4J9PA 1UCVA 4GKKF 4Y2IA 4YQWA 2OSQA 1R8CA 3VGSA 4B1ZA 2KZZA 1KKXA 3J8AA 2HVHA 4OX7A 4EHTA 2FC9A 1M5SA 1ZQUA 5C24B 1OPIA 1M90O 1CEZA 3Q8RB 1GLJO 2XS2A 4U7BA 3HHEA 5DB7A 3DLLQ 1RDAA 1BG3A 4D3GA 3VZHA 1PVRA 4KT0C 1BCMA 4ZVFA 4K4GA 2JWNA 2X51A 1S49A 4DU3A 3CJ9A 1JALA 5KFNA 1RWMB 4IDHA 1WBBA 4E7IA 1ZXIA 3VAFA 4QIWD 4JWMA 4DR5F 2Q6BA 1RBOB 1SH2A 4BQLA 3DGVA 4NLQA 3GIKA 3MPWA 1JNRB 2E1ZA 3CO9A 3VQCA 5C10A 2VB6A 1VSHA 2JLFA 4CWBA 1Y3JA 2Q43A 3VQBA 2NCKL 2JEGA 2FLLA 2WTFA 4IOCL 2GO7A 5AZIA 4CJRA 3ITHA 3G8SA 4CESA 2KTQA 2GO8A 4CP5A 3P5BP 5L39A 4WFBQ 2GV9A 2IMWP 1IG6A 1HLUA 1FNOA 2ZIWA 3BF1A 4AYBD 5ADXH 5AQMA 1VQ8N 1AFJA 2OIHA 8ICCA 2C42A 4I69A 2KMDA 4V19S 4DV4K 7ICQA 1JLCB 1KOOA 2IBOA 4OZJA 1JI7A 3G4SN 4KGXB 2O8BA 1NJIT 1WDTA 2OTLS 5AQHA 5D4LA 2DXEA 4OL8A 2P9KA 4IDKA 1FRHA 2BGGA 4Q43A 3RR7A 3SQIA 4UAUA 3MXHP 4X4TA 2W7AA 2KJ5A 1O0PA 4LSLB 1P8GA 3KK1B 4P74A 3GTYX 2C3UA 2KT5A 3L5KA 2E4LA 3WX4A 4BRIA 3H2UB 1YJNN 3HSJA 4KHRA 3FM9A 2OEHA 1CPZA 1WHXA 1KD1O 3KIOA 2QE5A 1C1CB 5AM2A 1BNPA 3QO9B 3CD5A 1LV5A 2LFVA 2HHHJ 3CCES 3L7PA 3K5NA 2OZSA 4R65A 4V19J 4WQ5A 3SPYA 4P0QB 4YDDB 1F44A 5DDMA 1YBTA 5ALNA 2V8GA 3KLFB 5KG2A 4LUBA 5HMYA 4DFKA 1TKXB 3DLEA 5HQLA 3PG9A 3D45A 3VAIA 1CZAN 3BH7B 4I7FB 5J2QA 4M3WA 2G2YA 3V81B 1H73A 2ZHOA 2RH3A 1ZD4A 1YWXA 5AQSA 1HNXF 4IRKA 4NX9A 1S59A 4WCEQ 2UUTA 1NSQA 1WG1A 4RNFA 3SEIA 2XBPA 2BJ8A 1CZ9A 4EMDA 4XH4A 1LOUA 4DQ8A 4WWSA 1HKCA 1YRXA 4NLVA 1X4HA 2K4PA 4EAHD 4KHUA 1DFDA 4J91A 4DPWA 1SXLA 1WC0A 1IH7A 2DR5A 2WSFC 1BQXA 4JKCA 3MEEA 2DPIA 5IM0A 5EDWA 2NUHA 1UTAA 3RSEB 5KFTA 1GLLO 3W3DA 2YB1A 3NBPA 1RWWB 1VQ7N 1NMNA 3U1NA 3BQ0A 1APSA 1C0UB 4R66A 4F5PA 2NXCA 3T3FA 4M9NA 2G8FA 5HP1A 5EOYA 4NXZA 1FFWB 2M8DB 3WKAA 2J9EA 5HMWA 3IS9B 3HVRA 3CCLS 4A2AA 5JJBA 2G5HB 1LOTB 2OFHX 5ETRA 2P9LB 2E6LA 4JB8B 3M8YA 5HLFA 3W9IA 4QWCA 2DY9A 5KPRA 1QVFM 3VEVA 5AM5A 5AKKA 1OY9A 1FRMA 4PABA 3QT7A 1IJFB 4MKAA 4RQMA 3HMJG 4DB3A 3W9JA 3KK2B 4K7QA 4IJNA 5I3PA 4WU3A 3MXMA 2M8HA 1T3NA 1VRTB 2AGOA 2HSEB 1SZHA 3DOKB 4KC5A 4EEYA 5F1XA 2M0NA 4QR1A 4UF4A 3POTA 5JRTA 1RT1A 5E7OB 3NY0A 5J2FA 1JLQA 4W92B 2FVQA 3KUGA 1QQ7A 4IG0B 8ICJA 3CNHA 5J2MA 4KQZA 2AU0A 3ZCMA 2CADA 3F0NA 2V2ZA 2XMMA 1ZJMA 2IOCA 4BRQA 4DV4J 3LP0A 4J9SA 2K7JA 2B6AB 1NU0A 4FPIA 8ICTA 1RAFB 1WUDA 2LYHA 2YKNB 3ZZTA 3O80A 3A8EA 3H5YA 4FJXA 5FDLA 2R2SA 4NMLA 1TV6B 2DGSA 5EE0A 1UZDA 1SL2A 2AH5A 1NK6A 2DHXA 2Y0BB 1ZQFA 4GC7A 2X3DA 4LR8A 3SBGA 4M94A 4X4SA 4BVPA 4PWDA 3M9NB 5IC4B 2BW7A 5LJ5Y 2P6UA 1UPPA 1DTQA 5HO4A 1JLAB 2HQ3A 3QB0A 2IM3A 1T95A 4RZRA 1X5PA 3D2FB 1HYSB 3OL6A 3MM5A 1B43A 1TL7A 4L6V3 4CLKA 5FRNA 3KD5E 1RG6A 3Q8VA 3DLLL 4DF4A 4ED4A 1B64A 1NG9A 1NK7A 3MC1A 2V2KA 1PCAA 3EE3A 5L9NA 2V50A 4I2AA 2F9DA 1SZPA 4ETZA 4JEPA 5KFMA 2HBMA 1U9LA 4N8OA 1M5PC 2OH2A 5I9EB 5GMDA 3QXGA 3AY0A 4RQ1A 2VBWA 3OXFA 2VQEK 3SQ2A 4YVZA 4I0WA 1SH0A 3BGOP 5F8HA 4HHJA 3OVNA 1YI2S 4C97A 4MN4C 1YHQS 4MYTA 2P9SA 3RBXA 3MOJB 5FJ4A 4F9OA 1SXDA 4ED7A 3RH5A 5I3UB 4WFBL 3MABA 1KHWA 1CJVB 2PYJA 4RW7B 3UFCX 3HP9A 4RO0A 3FLCO 4ED8A 3AN1A 1HI8A 3Q8UA 1T6CA 2XHBA 3IN5A 2H3IA 1Z00A 3O6WA 1W26A 3CXCR 3TFRA 4XUSA 3IAS9 2IAJB 2VG6B 3JSYA 2FVRA 1V5VA 4C80A 1LNQA 3QICA 5DETA 3HFKA 1I1GA 2Q31A 4UUWA 3Q8QB 1S0MA 1X5SA 1ATNA 4BR5A 3US5A 1L7MA 3WX8A 2VWKA 2DRDA 4DBQA 3BZKA 2MMYA 2AJ2A 3PX6A 1QQ6A 1FJGK 2FBVA 1HPZA 1YK9A 2WVFA 1WCNA 2P35A 2PI5A 2J9CA 2KH9A 2P6RA 4CEAA 4B1VA 2OI2A 3AA9A 1LVHA 5AQRA 5HNKA 1C1AA 2OPRB 3GQCA 1PK1B 4AXJA 1R0AB 3MX5A 4FLYA 5ALRA 4DV7K 1RLCL 3CCSS 1FF2A 8ICGA 3MN6A 2FHMA 1E3MA 1MSWD 1X7VA 1U04A 2E7XA 4CO4A 3F73A 5C2DA 2HF3A 2XS7A 2O8FA 4OI4A 2IC3A 4Q45A 2ACMA 3MWTA 4JMUA 1Z4UA 3RRHA 2KHQA 3FVYA 2CXYA 1U45A 3MURP 1N6QB 4BC7A 1TP7A 3A0IX 2E88A 1DQAA <