1NK6A

Cytosine-cytosine mismatch at the polymerase active site
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk6A01
4YXJA 4F92B 1WCNA 3ISDA 3OSNA 3QNNA 3JPPA 3RH6A 4DL7A 2RKIA 8ICGA 4I27A 5J2BA 3KHHA 4E7IA 3AVKA 5EWEA 3OJUA 3UQ2A 2OZMA 1NJZA 2OYQA 5DG8A 5FROA 4CF9A 3HM9A 2ZJ5A 1CUKA 4DL2A 1BPDA 3KHGA 4ED1A 4KLOA 4R8UB 4E7JA 3GIJA 1LWEA 2P6RA 4PPXA 9ICQA 4EZ6A 3DLKA 4UB4A 5KFYA 4KTQA 3HX0A 1DOQA 1ZQDA 4CEEA 3L2VA 4JV1A 1IM4A 1RTHA 4B9LA 4FJHA 5J2MA 3T3FA 4YFUA 4M6WA 3KIOA 4CESA 3D45A 4DSFA 5D4BA 2KZMA 1Y88A 2FBYA 4PH5A 4ED2A 1SKSA 1HYZA 1ZQZA 2LYHA 3ZSQA 3S3OA 4CIFA 4JRQA 5IILA 5L1IA 5C5JA 3L2WA 1DTQA 4I2AA 5CY4A 1G15A 5CJ7A 4QZEA 2Z1HA 8ICMA 3NE6A 3DLBA 5DBBA 1UA1A 2R8KA 4KLDA 2FPLA 4MFBA 2G8UA 2Q3SA 2R8GA 1VRUA 3H8SA 4B9TA 1H38A 3MR2A 8ICOA 2G8WA 4DTNA 2PFPA 2F1IA 1ZQBA 4EYHB 2YKNA 4EBCA 3GFKB 3OYFA 3TFSA 3HT3A 4QZCA 4P4PA 4YMMA 1REVA 3NTUA 2HHVA 4J9OA 3NH0A 2YNHA 3K5OA 3NF9A 4NYFA 4UBCA 1S0OA 8ICIA 5KFCA 3EYZA 4QZ8A 4Q43A 1C0TA 3K5LA 4HCBA 5J29A 3DOLA 5D3GA 3VQEA 1HUOA 1CEZA 1YTUA 3SPYA 4NY8A 4FJNA 2W9MA 1ZQMA 2UVWA 1RBVA 4F5PA 4DTPA 4LVSA 3TAGA 4QZHA 2RDJA 4CK1A 1J54A 1BVSA 2BHNA 4YD2A 3H08A 3ISNC 3LWMA 4IKFA 2ZTDA 4M47A 3QEVA 1ZJNA 4LZDA 9ICSA 1RT3A 4OGCA 4ZH4A 4HVJA 3HP9A 2IDOA 5KT3A 5SWMA 4CJLA 5EOZA 2G8FA 3JPSA 1J53A 3TR8A 8ICPA 4J9LA 7ICVA 5KG0A 4IRKA 4F5RA 3KTQA 4GC7A 2D0AA 2PYJA 5J2KA 3Q8PB 1O1WA 1ASWA 4N56A 4JLHA 1XSPA 4KLHA 2G8VA 4DF4A 3P1GA 1ZQAA 7ICHA 1A5XA 3VQBA 1Q9XA 4BXOB 4RUAA 4PHDA 4O3SA 2P6UA 2YNIA 3AVJA 3G10A 4NM2A 4NLKA 4LD0A 3M8RA 4YR2A 4M9LA 1NK9A 5KTQA 3AVBA 4KFBA 4B9VA 3VQAA 1K6YA 3SJJA 4I29A 3FFIA 3AVNA 3HSTB 1S0VA 5HBMA 4EZ9A 1COOA 4ELUA 1XHXA 3IHQB 3B0YA 4CEBA 3GV7B 1NKEA 1Q9YA 4KHUA 4CF8A 1RYSA 3NH1A 1U4BA 3C94A 3K2PA 2KQ2A 4W5RA 1EX4A 1SZPA 1VSMA 4PWDA 4IDKA 4IQUA 1WSIA 1TK0A 2FBXA 4O3NA 4B08A 1RTJA 4ECZA 2V4QA 2EX3A 4O0JA 2P5OA 1JN3A 4FLYA 8ICRA 3K57A 1A76A 1HNIA 3HVRA 4FYDA 4ZTJA 5KRTA 4Q5VA 1RXWA 4Z6CA 2VA2A 1ZQHA 1ZQLA 3H7IA 4J9NA 3V72A 2ISOA 4JS5A 4DSJA 2XCPA 2XY7A 4E89A 4UAYA 1QE1A 1EXNA 5EWFA 4J2BA 3S3NA 3DLEA 1BGXT 4I7FA 4XA5A 2OWOA 3VQ7A 3OS0A 2JEFA 2HNZA 8ICJA 4O3OA 3MDCA 5HHIA 1T3NA 1CLQA 1KRPA 3SV3A 2XY5A 4J9KA 4CJQA 1LB2B 2IBKA 3NF8A 4R5PA 1LWCA 5DLFA 2BR0A 3HJFA 2RF2A 1TK5A 1XSLA 2PFQA 3ZT0A 3PX4A 2HW3A 1RZTA 1HMVA 4IQTA 5KFGA 3IRXA 1HPZA 3H4BA 4RQ8A 3V6KA 4MQ3A 2W9CA 1JMSA 4C8KA 5CR0A 2PI4A 1BCMA 2X78A 3MFHA 2NRXA 2VG7A 2KTQA 5HROA 3V7JA 1A5VA 4NYNA 4IR1A 4M0AA 3MECA 4FZZA 3MXJA 1Z00B 1JLCA 5KFXA 1RT4A 4RU9A 1JX4A 1BPYA 2PY5A 4N47A 5KFVA 3SI6A 2KZZA 8ICNA 2IA6A 4KPYA 3AVHA 3C1YA 1J5OA 2HNDA 2ASJA 3V81A 3B6OA 9ICUA 1VRTA 4YR3A 4Y1CA 2IC3A 4LH4A 4FJJA 3KD1E 3TQ1A 2W9BA 2VG6A 3K5NA 2IS3A 4EEYA 4OLBA 4NCBA 1ZBIA 3CG7A 4CHOA 1QS4A 1ITGA 1C6VA 4DL6A 1NJWA 7ICTA 3ZT1A 3T5LA 3HWTA 3HPHA 5DQHA 9ICNA 4KLTA 1MQ3A 1PZNA 1ZQNA 3MGHA 3OYLA 4DTRA 4E7LA 5HMMA 4UB2A 1JLAA 3M8PA 4KREA 2BCRA 4F2SA 2KFNA 3GIMA 2GUIA 5J2HA 4CFDA 4GVMA 4JWMA 5CZ2A 3TANA 3QNOA 5HLFA 3C2KA 1S1XA 4DFMA 4YD1A 4RQ3A 5HNKA 4LZGA 3E01A 4O5KA 2QXFA 4DFJA 4KHYA 1I3AA 2F1HA 2BE2A 1B92A 4JV0A 1JXLA 2BQUA 2AQ0A 5JUMA 4CFBA 3BQ0A 4KI6A 4YG2A 3QE9Y 1HJRA 2KZ3A 1UT8A 9ICVA 3L2QA 1L3UA 4XIUA 5HRNA 1MC8A 3V9SA 1ZQEA 4PHPA 2DFHA 3A2FA 4P4MA 3RB6A 1TGOA 1S6PA 2QKKA 2MUTA 5FRNA 1S1WA 1R0AA 2G8KA 3PNCA 4F4XA 1ZQTA 2NRZA 1QSYA 1L3SA 4CJEA 1X9WA 4UB1A 5KFEA 1F21A 2HB5A 1B9FA 4M41A 2ZUDA 2G8HA 4M3RA 3V1RA 4BE0A 3U6FA 3Q8RB 4Z4CA 4I2EA 4IR9A 1RDBA 3OYAA 3QERA 5J2GA 2Y1IA 4FLTA 4TUSA 3RMAA 4RW8A 5I3UA 5J1EA 3MDAA 2XGPA 5DK5A 9ICTA 2BCUA 4CJPA 3M9NB 3HP6A 5KFIA 2PI5A 2B6AA 1VSHA 4W5OA 4JV2A 3GV8B 5DBCA 4M3ZA 1UT5A 1QSLA 4KLGA 4RQ6A 1CXUA 4CJ4A 2NRWA 1IXRA 1S9EA 8ICVA 1BI4A 3SI8A 4N76A 1KVBA 3VQDA 3MAQA 1ZQUA 4CHQA 4EBDA 4ED3A 2E6LA 2Y1JA 5J0UA 8ICXA 4JK1A 3VQ9A 5J2FA 3OYCA 3AO3A 4M9GA 2IOCA 3QLHA 4XUSA 4OKEA 2A1JA 5KFAA 4I2DA 4ECXA 4ICLA 1Z25A 3KKSA 4FJKA 4RNMA 2ITGA 3GQCA 1HYSA 3L3UA 1JLBA 3KHLA 3LALA 4R64A 2IAJA 2KW4A 2W8LA 3C21A 4AHSA 3TI0A 3C5GA 1T8EA 4NLZA 4FJIA 4AHVA 3M9OB 1WCLA 5DKWA 4PY5A 3O4QA 3AVCA 3PVXA 1RBTA 1NKCA 4ID1A 5KT7A 3KD5E 1SKRA 2W8KA 4BDYA 3KLHA 3NFAA 2W42A 1KVAA 2DTUA 2XC9A 2ETJA 3RMCA 3B0XA 1RYRA 1NK0A 2W9AA 4M9NA 4AHUA 3KLFA 3JPQA 2PFOA 3ZSRA 4DTMA 1JLEA 3SUNA 1ZQFA 9ICBA 3QINA 5DGAA 1ZQXA 1ZQCA 3VQ4A 4JRPA 3EWAA 1HQEA 2Z1IA 1UA0A 2JGUA 4OLAA 1RT2A 4DOAA 4CJFA 4QW8A 4FK2A 1S77D 3NAEA 3OYBA 2AQ4A 3TAMA 4M6WB 3RJIA 3TAEA 2YNGA 3CFPA 4MF8A 2I9GA 4TSXA 3OHAA 4NM1A 4O55A 5J0QA 1TKXA 4HCCA 3NCIA 1LWFA 4QZAA 1KTQA 2BGGA 5KFFA 3HO1A 4FBTA 2HHUA 1ZQYA 1S9FA 3MEDA 5IIOA 4X5VA 3NF6A 4CCHA 4AHCA 1DLOA 3O3GA 3P83D 1TK8A 1TKTA 4PGYA 5KFWA 1XU4A 9ICEA 2VWKA 4CJRA 3V6HA 3OYJA 3H40A 3T5HA 3DMJA 4F4KA 1EKEA 4MEYA 5J2NA 1BPEA 4H4OA 4RQ7A 3T5JA 2YNFA 5DB8A 4Z4HA 1BPZA 1NK8A 4F3TA 3NGYA 4CF2A 1TKDA 1L3TA 3RJKA 5DBAA 1RDCA 2P51A 2AJQA 4RW7A 4BACA 3LAKA 4CFCA 4CJSA 4QZGA 1HNVA 2AU0A 4I28A 2A1RA 3CFRA 2QK9A 1U9LA 4I2IA 4KKOA 1IKVA 4OKJA 3AVAA 2OPRA 1S5JA 3V7KA 7ICMA 2B5JA 4Q8FA 3OGUA 4JWNA 1VSKA 4CIGA 3Q8MA 4RT2A 1WN7A 3LZJA 2NRVA 1EP4A 5DLGA 1N56A 3AA2A 4E1MA 3PW0A 4M42A 5L1JA 1ZQWA 1BCOA 4YMOA 1NK5A 4M45A 4DTXA 1RBUA 1D8YA 3KKRA 9ICLA 3AO2A 3OHBA 3ZSXA 1ZYQA 4I2BA 3DRRA 2B21A 5C42A 2JZBA 5CB1A 4UAWA 3V1OA 1ZQQA 1NOMA 1ZETA 4CK2A 3D0PA 5J0YA 1VSDA 3LZIA 3ZD9A 4RPYA 4QWDA 3ZDEA 4HUGA 2F1JA 5CWRA 3QEPA 4C8LA 1W9HA 9ICCA 4E19A 4DO9A 5DB6A 4ECTA 3GIKA 1XC9A 3DRPA 3V9ZA 4RNOA 5KFKA 1JXEA 5KFDA 3NBPA 3DLRA 5KFNA 3N4MB 1VSIA 4DFKA 2C28A 2UVRA 4H8KA 3AVLA 5HHHA 1S0MA 3E2EA 3H8JA 4GLXA 4DTOA 4Z4IA 5JS1A 3Q8QB 2C22A 2FLNA 3MEGA 3LK9A 3IM1A 3HXMA 4OKKA 1QQCA 4FBUA 2OPSA 3C1ZA 3KLIA 3MEEA 4ZHRA 3AVMA 1KSPA 2C2DA 2HHSA 1U48A 3T19A 3ETLA 2ASDA 4B9NA 5D49A 3QESA 1S76D 2ZTCA 3OSPA 1L5UA 1CZBA 3T5KA 4R65A 3N97B 4I2FA 1QLNA 4Y1DA 1VSLA 3KLGA 4HTUA 4M9HA 3PW4A 2F96A 4FJ9A 3WNFA 4DEZA 3UXNA 4KLIA 4BDZA 4F4ZA 1KDHA 3PR5B 3HW8A 2DPIA 3O3HA 1ZBUA 1RNHA 1WNSA 2JEIA 1ZBHA 4YMNA 3JPOA 1L3VA 3OYHA 4M3WA 2V4RA 4E7HA 4QZDA 4Q0BA 4OGEA 3MFIA 4R63A 3M8SA 5E41A 2HVIA 4FS2A 1LW0A 3RAXA 3ZT4A 4DS4A 4ID5A 4F8RA 4KMUA 3VQPA 4QWBA 4CEAA 1JLFA 4DU3A 4C8OA 4UQGA 8ICAA 3SQ0A 4N41A 3CFOA 1ZJMA 4JUZA 1YTAA 4B9MA 3LAMA 4KLSA 2BPFA 4AHTA 4I9LA 2F8SA 4YCXA 4YP3A 2YHBA 3EW9A 5SZTA 4O5BA 7ICIA 3TWHA 5DQIA 1RBRA 4F5OA 1XS9D 2NUBA 5KI6A 3SPZA 1FXXA 4K4HA 3VQ5A 2W9CB 5J2AA 2YHAA 5KFBA 1TAUA 5TZVA 2PFNA 4MF2A 5KG2A 4KITB 2BCSA 1TV9A 1QSSA 4TQRA 1NK4A 4EP4A 1SV5A 4CFAA 3AU2A 7ICRA 3Q8LA 2P1JA 5DDYA 4J9PA 4I2HA 2Z1JA 4CJ5A 3OS2A 3NHGA 4CF1A 3KK3A 8ICTA 2RDIA 2AGOA 3TAFA 9ICHA 4AHRA 9ICFA 4CGJA 1NK7A 4DLGA 1BQMA 1NJXA 3MXIA 4JS4A 3O4NA 1RXVA 5L1KA 1J9AA 4Z0UA 2X74A 7ICPA 9ICAA 3QZ8A 5J0RA 5HMLA 3Q8SB 4BE1A 2W9BB 4QZBA 4UAZA 4RQ1A 4CEQA 3SZ2A 2AGPA 2V9WA 3V6JA 4IFYA 4CGHA 2R8IA 2PZSA 3L2UA 3G6VA 2HHTA 1Z26A 4E3SA 3TABA 3DRSA 4UB3A 4DOCA 1WSJA 4GXIA 3LPUA 4B8CA 4KHNA 4ECYA 1LW2A 3AO1A 1UOCA 7ICEA 4QW9A 1IKWA 4FW1A 1Z00A 5KFMA 3QEIA 4F93B 3BQ1A 8ICCA 1RT5A 3S3MA 2O4IA 1RBSA 4CGDA 4QZIA 3SUPA 1ZBLA 3Q8KA 1RPLA 3RJFA 4KLQA 1N6QA 4KB0A 2ZUBA 4I2JA 3UPQA 2FLPA 8ICEA 1KLNA 3NGIA 4F4WA 3PR4A 3FYHA 4CERA 1S0NA 1TKZA 1WAFA 1I39A 3RBDA 3ITHA 4PQUA 4KAZA 4F5NA 1VSEA 1KEJA 3LPTA 3PW7A 1C1AA 4HUEA 5FRMA 5DQGA 2D0BA 1QHTA 1Z3EB 2ZJAA 2ISPA 1ASVA 4FM1A 4DFPA 1SUQA 4CHZA 3NGDA 4DQPA 4DSKA 3AV9A 2KN7A 3RMDA 8ICSA 4CGIA 5CHGA 4GXJA 4ECRA 2D5RA 4O5CA 2MUTB 3VN5A 1DGSA 1JLQA 1ZQKA 5J2EA 3SV4A 3C6TA 4YN4A 2BQ3A 3UQ0A 4CGFA 4O0IA 3C6UA 2FPMA 4BE2A 8ICBA 4CEOA 3RB4A 1FK9A 4C8MA 8ICQA 1WSFA 1CZ9A 2C2EA 4KLLA 2G8IA 3ZSWA 4NCAA 5J2QA 1TL1A 4ED8A 1GOBA 5CYQA 3OYIA 3SUQA 4K8XA 3EZ5A 2JLEA 1X9SA 4DTJA 4F3OA 4TUPA 3RMBA 8ICZA 5EWGA 3DOKA 3OJSA 3PO5A 5KT5A 2IMWP 3JPNA 3LDSA 3WNHA 5CYMA 4KHQA 1MSWD 3H4DA 3UIQA 3RH4A 3V9UA 1NKBA 2HHXA 5KFQA 1BI4B 1BHLA 3GDXA 7ICFA 3PW5A 4DSLA 4KB1A 2D0CA 4ELVA 2VG5A 3ZSOA 4Q44A 2R8JA 1T05A 3MBYA 4F5QA 4M3UA 3ZT3A 3V6DA 1K1QA 5KGXA 2BCVA 2A1JB 5KFUA 3ZDBA 1N48A 1VK0A 4O3QA 3HPOA 4ECUA 5KFSA 3MGIA 8ICHA 3C95A 1YVUA 3OS1A 1BPXA 4DSEA 4RQ4A 3K58A 4HYKA 3V9XA 1A77A 3PX6A 5DB7A 3TAQA 4HHTA 4Z6FA 2ATQA 2XCAA 4GC6A 3NF7A 4E1NA 3SQ2A 4C8NA 1S1UA 4Z4FA 4J9QA 3OYNA 3PO4A 5IIMA 5KG4A 4FJLA 1MU2A 3DM2A 4F50A 4RNNA 4Z6EA 9ICJA 2RN2A 4NLGA 1XI1A 1ZQSA 4I2CA 1RT6A 2YKMA 2DY4A 3PMNA 2JEJA 4ECVA 3JPTA 4Z4GA 1B22A 5J2CA 4O3PA 3QEBZ 1FKPA 4KLJA 2WOMA 2AGQA 3DLHA 5DGBA 1IG9A 4PGQA 1TVRA 4BWMA 2HHQA 4AILC 3JSMA 3DYAA 3RJJA 4QZFA 3HYFA 2P66A 1HQUA 9ICGA 4YR0A 1D9FA 2ASLA 1TL3A 3RBEA 4FJXA 3G6YA 4KN7A 1XHZA 4FK4A 1JKHA 4J2EA 4FJ7A 3PMLA 3RR8A 4YQWA 1AROP 3OY9A 3NGZA 5KT2A 4ED6A 4W5TA 1V9PA 1KLMA 4IG3A 4IQWA 3L2RA 2JEGA 2ZJ8A 3C2MA 4O5EA 2O4GA 4FXDA 3SNNA 4RT3A 1ZQOA 2VA3A 1NK6A 3SUOA 1ZQJA 2KFZA 4TUQA 1FKOA 2GBZA 3OYMA 2UVUA 3OYGA 4CEFA 4NLNA 5HRSA 5KG5A 3VA0A 3NDKA 2F8TA 7ICQA 5BPCA 4M3TA 3OYKA 3MXMA 4LSLA 3ZDCA 1IKYA 4CK3A 4ED0A 3SQ4A 2BCQA 4R8UA 4O9MA 4DQSA 2XY8A 1C0UA 1IKXA 5IINA 9ICXA 1KFTA 4Q45A 2ZTEA 3K75D 5J0TA 4CE9A 4FCYA 4ECSA 2VA8A 4J9RA 4RW9A 1KFSA 2DFFA 4N5SA 3HPGA 4KLMA 3LP2A 4LH5A 4BDPA 4DU4A 1DTTA 3I8DA 4IG0A 2JZBB 2I1QA 1JXBA 2IGIA 3SCXA 1KCFA 5IIKA 3AO4A 4ED7A 4RQ2A 1BIZA 1C7YA 2XO7A 1D8LA 4XRHA 1BIUA 3IAYA 2BKEA 1K1SA 4FLXA 3NH2A 3OVNA 4KRFA 5L9XA 5KGWA 4RPXA 5KFRA 3MABA 4FJGA 3T1AA 2PXIA 3RJHA 4NXZA 1XSNA 2FBVA 4DG1A 8ICKA 3KJVA 4KHSA 1SL0A 4M9JA 4BGDA 3QEAZ 4Q8EA 1HUZA 3SYZA 5IIJA 4M04A 2BGWA 2XRIA 2FMSA 4WE1A 5KT4A 1RCHA 3U3YA 2ZD1A 1T7PA 2R7YA 1RDAA 3RRHA 3EPGA 4DSIA 1S9GA 1WSEA 4OJRA 1RT7A 4J9SA 1IH7A 2BQRA 5HRPA 2XHBA 1U49A 3UXPA 4DF8A 4EBEA 3QO9A 4FZYA 1VSJA 4OPKA 1GOCA 4DTUA 5T7BA 3GIIA 2C2RA 1TAQA 1HYVA 1RDDA 4PHAA 5FDLA 1RILA 3JYTA 3OYDA 3F73A 4RW6A 7ICKA 1LAWA 7ICNA 1S97A 5J2PA 3K4GA 1VSFA 2FLLA 5J0OA 5K14A 2BPGA 1S10A 4LY7A 3ZT2A 3AU6A 9ICMA 3BQ2A 3VQ6A 3MR5A 3ZSYA 4I2GA 3PX0A 3ZD8A 4DLEA 4GW6A 3EPIA 4YNQA 4O4GA 3AVIA 2E4LA 3QEWA 9ICPA 4DL4A 4KO0A 5JS2A 3PW2A 5KRSA 4CIEA 3RB0A 2FMQA 3CYMA 3G0ZA 2OPQA 3AUOA 4BXOA 4FM0A 4PA1A 5F9LA 5D46A 4CGGA 1QTMA 4QWEA 3VA3A 4FK0A 1ZQGA 1ASUA 4CJKA 4MFCA 1ZBFA 1WLJA 3ZSZA 4M3XA 4KHWA 5KG3A 1W0HA 1LAVA 4FJ5A 4J9MA 9ICWA 2FMPA 4DL5A 3KK1A 3V7LA 5C24A 3HL8A 5HP1A 4M3YA 3AA3A 1TVAA 2H5XA 5KG7A 2M9NA 3ALYA 3V9WA 1BL3A 5HRRA 2HHWA 1XWLA 4CHYA 2I5JA 4RPZA 4EYIB 3QIPA 3GILA 3JPRA 4MFAA 4O44A 5J2DA 3HK2A 1ZQRA 2OZSA 1TFRA 2R8HA 1X1PA 4ECWA 1U04A 5KG1A 3VQQA 2LSNA 4RZRA 2VANA 4K4IA 4RQ5A 3AO5A 4Z6DA 3LP0A 3L8BA 4P4OA 4OPJA 4FLZA 3TARA 1S1TA 2PYLA 2EHGA 3WNGA 1ZQVA 5J0XA 1CXQA 5J0WA 4K8ZA 3OYEA 5KFZA 4B9SA 3RJGA 1D5AA 2FC0A 2ATLA 1KFDA 3SQ1A 3UXOA 3AA4A 3ZDDA 4MEXA 1BISA 1C1CA 3QZ7A 1T03A 4UBBA 3KK2A 1TV6A 3LWLA 1B43A 5DMRA 1NOZA 4KTWA 3I0SA 1B9DA 3S9HA 9ICRA 3CM6A 1Q8IA 3F9KA 4IQVA 4DTSA 4BWJA 2NRTA 1WAJA 5L1LA 5KG6A 2XY6A 1NJYA 1X2IA 5CZ1A 2J6TA 4LSNA 8ICYA 2FPKA 4RUCA 3U3GA 3LANA 1HRHA 5DB9A 5F9NA 3ZDAA 4KTZA 3ISBA 4O3RA 4KLEA 4M2YA 4I2QA 1U45A 2X6SA 3FDSA 3RR7A 5C25A 4GXKA 4B8AB 3ORYA 8ICLA 3P5JA 3BGRA 4IRDA 3KLEA 4PUOA 4G3IA 1N5YA 2BDPA 1JL1A 5KFJA 2BANA 8ICUA 1BQNA 5J0SA 2RPIA 4QAGA 2IHNA 4FS1A 1WSHA 3PUFA 4B3OA 4KLFA 3MR3A 1EXQA 3RWUA 3DLGA 4QWCA 2HNYA 1ZQPA 4DWIA 4IBNA 4KN4A 3ZCMA 4FVMA 1MQ2A 5KFTA 3ZSVA 4DMNA 2UVVA 4MFFA 2Q0ZX 5KFHA 1ZQIA 1JLGA 3AVFA 2MAXA 3K5MA 2QKBA 1D9DA 4H4MA 1GOAA 5IIIA 4IFVA 5KFOA 4CJTA 3C5FA 3ASMA 1T4GA 5CP2A 4IRCA 4GMJB 3M9MB 1YT3A 4KI4A 2X6NA 7ICGA 3RH5A 8ICFA 1EETA 2YV0X 4B9UA 4Z4EA 5BOMA 4TURA 3AA5X 1JIHA 4CJ3A 4CEZA 4CJVA 4QZ9A 3HVTA 3B6PA 5CA7A 3IG1A 4P2HA 4UB5A 3I0RA 4FJMA 5BOLA 3LP1A 4AH9A 4CHPA 3PY8A 2DPJA 5DG7A 7ICOA 4FLVA 1X9MA 4YVZA 4W5QA 4TQSA 3RTVA 4YXMA 1HJPA 3RJEA 4FO6A 4KLUA 4FLWA 3RRGA 5J2JA 2A1SA 4EP5A 1A5WA 2OPPA 1Y97A 3BQTA 3DI6A 4J2AA 9ICKA 3CM5A 4CJWA 2ALZA 1SKWA 4NCGA 3QIOA 4F2RA 3BJYA 3PV8A 2GWSA 4RQ0A 4PHEA 3TAPA 5J2IA 2J6SA 3WNEA 1S1VA 3VQCA 4K4GA 4F91B 2WTFA 3CQ8A 4FM2A 4L8RB 5DDMA 4DS5A 4E0DA 4CF0A 4DU1A 4KV8A 3ISCA 1WSGA 4FW2A 3ULDA 4ELTA 4FLUA 7ICUA 3RB3A 4QOZB 1KVCA 4I9QA 3V1QA 3LP3A 3BDPA 1C0MA 1RTIA 3KHRA 8ICWA 1BPBA 4J2DA 1IO2A 4OVLA 3VQ8A 3M8QA 7ICLA 3G6XA 3MR6A 1S6QA 4CHNA 7ICSA 3QEXA 1JL2A 2BPCA 1XO1A 4PGXA 2HMIA 2DFEA 2E6MA 2HVHA 4I2PA 2J6UA 1SL2A 1UWBA 2XGQA 5DG9A 4HUFA 4F4YA 1SL1A 2IHMA 4ECQA 3THVA 2GV9A 3GV5B 2P5GA 1NOYA 4QCLA 3V4IA 3H8WA 2DFLA 3C23A 3LDAA 4CJUA 9ICIA 3AVGA 3EY1A 4DQQA 5KFLA 2ZQBA 4RW4A 3L3VA 5KT6A 4DL3A 2WONA 2OA8A 4FZXC 1RT1A 1RTDA 4DQRA 2VWJA 1C1BA 2FBTA 3TFRA 3IS9A 4FJ8A 2B4JA 4DOBA 1LV5A 5J0PA 3O3FA 4YFKA 4CECA 4XQ8A 5HP4A 5I42A 4QWAA 1U47A 1UAXA 3K59A 4RG8A 2ZUCA 2ZE2A 5KFPA 4CEDA 5EU7A 4G1QA 4W5NA 4R66A 4E7KA 4ZTFA 7ICJA 3RAQA 3QETA 3C2LA 4DQIA 2Z1GA 9ICOA
chains in the Genus database with same CATH superfamily
2HBRB 4F92B 4LIWA 3ISDA 2Q6BA 5HR6A 1X4HA 1YITS 3JPPA 1S8OA 3EICA 4DV6J 2IVYA 4BRPA 4EFAC 5A2QO 2H54B 3KHHA 4E7IA 4F9OA 3AVKA 3K8VA 5GAEI 4C1NI 5EWEA 3OJUA 3UQ2A 5DG8A 5FROA 4CF9A 3EDQB 4HT7A 3P3DA 4DL2A 3OTCA 1CC7A 1LWEA 2P6RA 9ICQA 3IG8A 1C0UB 3BGUA 3W5XA 4HHJA 1Q86O 1BXNA 2M0NA 4KTQA 1NNDA 5ETPA 4JB3A 1ZQDA 2ZM6K 2BW2A 4RW9B 2AX1A 5AKGA 5ALPA 5DETA 1PIEA 3L2VA 4JV1A 2C3PA 1IM4A 3IRUA 3K5PA 2YPYA 4FJHA 3ZTQA 5E33A 2O8EB 2QMWA 5E0OA 4ED2A 5GAEP 3R7BB 2ZGYA 4CIFA 4JRQA 2JHEA 4C8YA 3C6HA 1YGYA 2WMMA 3TSQA 2PMZF 3NS5A 1WKKA 3Q24A 2MRLA 3VGSA 1KC8O 2A3JA 5CA5A 4WPAA 4QQBA 2Y9HA 4AQYF 4X65F 5DBBA 3HVWA 2ZH2A 3VAJA 2RRBA 3O2IA 1QAIA 1OH7A 3WX4A 2P9KA 4KLDA 4MN4C 2FPLA 2ADBA 4MFBA 2D41A 5G5HA 3HHLD 3H8SA 4WXOA 5AXNA 5C0YA 4GO5X 3ID6A 2VFUA 3L95X 3MMBB 4JI6K 4R0EA 3OLAA 3KK7A 2F8LA 1B70B 3SR6A 3KDOA 3WK9A 2YQ1A 3R6LB 4B1XB 2N3OA 4LF7F 2YNHA 3NH0A 1HR0J 2CQ3A 1BO5O 3B54A 1WOSA 5D3GA 2F9TA 3VQEA 1HUOA 1H2VZ 1YTUA 2W9MA 3D2QA 2LM4A 1RBVA 2RRAA 1YJ9S 2AEFA 4NLYA 5J2PB 1FJGK 2VBZA 5KOWA 3H08A 1ZQ1C 3LWMA 2LECA 4IKFA 3QEVA 1ZJNA 4M5NA 9ICSA 2NCKL 4OGCA 4ZH4A 1A0OB 2RH3A 3P49B 3FM9A 1ZD5A 4JI8J 2J0QD 5KG0A 2GFFA 4IZ9A 2WCXA 2PYJA 5E3AA 3WKBA 3ID8A 1Q7YT 1ASWA 1EB0A 2UXCK 1EKRA 3GTYX 3D2EA 1IG8A 4O5FA 1A5XA 1N33K 4OMFG 2M9KA 2NO5A 4C9DA 4I64A 4JI7K 1Q78A 4NM2A 3UE5A 5ALKA 1VIXA 4M9LA 3S8SA 2W40A 1RHMB 1B3TA 1WYGA 5GAGI 3VQAA 1K6YA 5FPEA 3FFIA 3LQVA 3KK1B 3AVNA 5C24B 1L7NA 1COOA 3DXKB 1I51B 4CEBA 1NKEA 1Q9YA 1CULA 3LGHA 1U6ZA 2EFNA 2H48B 1HBUA 3QIPB 2RUSA 2KQ2A 2ZIXB 4H0TB 4YOXA 4RPFA 3IC1A 1VSMA 3K0JA 1TK0A 2R7VA 4DZDA 3I87A 2JXJA 4O0JA 1B4SA 2MZSA 2RDDA 2CWKA 5GAGP 5ADXH 3HKZC 2HHPA 3V72A 4R79A 4J2BA 3V4MA 5FD1A 4DQ8A 2LPEA 1T3QA 4XA5A 2AYMA 5M1KA 4CGZA 1RZMA 3CE8A 3VQ7A 5K8OA 2V2VA 3S6EA 3L4QA 2FHOB 3T41A 3MCMA 4O3OA 5HHIA 2HFZA 1CLQA 1KRPA 4LFBF 3L5KA 4ZVHA 4BR0A 3L3CA 3SJHA 2IBKA 3QRPA 4R5PA 4DV2J 3HJFA 3WXKA 2MQLA 4JI0F 2L48A 1XSLA 2PFQA 2W54A 3PX4A 4JHDA 3Q23A 1QZ5A 1FEZA 5F8GA 1VQKS 5AFUA 3V6KA 4OL8A 3QDKA 5F1XA 2W9CA 2Z4PA 2EFOA 3HSZA 4C8KA 1BCMA 3D7SB 5AQPA 2KNJA 2KTQA 5HROA 1GLBG 4NYNA 1IBLF 2GVDB 2VDHA 2HK3A 2JVRA 1XMBA 3CCSN 4RU9A 3BGRB 1BPYA 2WSCC 4PPDA 1ULRA 2I7PA 3SSRA 3D0GE 2BANB 1BQNB 5IQQA 5BRHA 3NGTA 3H0LB 2HGNA 4CRXA 2NYVA 2CYYA 1VQPN 2PT0A 1J5EK 5JTIA 3AAQA 1MWYA 2E5LF 4LF6J 4CLKA 1FA0A 4OI3A 3M2VB 3R8YA 1IG6A 1FFUA 4BRLA 4EEYA 3ZNUA 4H4MB 3CG7A 4IFVB 1QS4A 1ITGA 1C6VA 1V5VA 3VESA 1N62A 4A61A 2ZNYA 1SZ2A 3HPHA 2HURA 5AFUH 1CJTB 3VENA 4KLTA 1WI6A 3BZQA 1PZNA 5AQHA 1FVSA 2FTRA 1VIOA 1JLAA 4OJHA 4PXDA 1Y10A 4K0KK 4KREA 2BCRA 4J90A 3IG1B 2KFNA 1NZAA 1EIYB 2AYBA 5KQ8A 2GUIA 3GB0A 3VF2A 4IQMA 2VUGA 3N6LA 3TANA 2OKQA 2GJFA 1F9EB 3QNOA 2WBNA 5HNKA 4QU7A 3D2FB 3GIRA 1RAIB 4O5KA 3ZZUA 2VD3A 2ZJQL 2QXFA 5AKIA 4BCAA 5CR4A 1BMQB 3QUCA 4CLWA 4KHYA 4F7VA 1NU0A 4DPWA 3MX5A 4FOIA 4NYZA 2BE2A 2ZVIA 2K1RB 1T9UA 1Q82T 2R7XA 5M2PA 5GVQA 3NNAA 2OM6A 5JUMA 3HF5A 2QV6A 3UWTA 3VWSA 4XIUA 2RIJA 2A2DA 4NCGB 2DRAA 1ZQEA 4PHPA 2YWKA 3A2FA 1R8BA 3ZZYA 3WK7A 4JI5K 1S1VB 2QKKA 5AJ3F 3FRYA 2NLWA 2FD2A 4F4XA 1ZQTA 4IDHA 2PGCA 4OYBA 5KFEA 4I68A 3J81U 2WAQD 1UVJA 2IDEA 1B9FA 4M41A 2Q1NA 3SQOP 2YTUA 1NM2A 1COKA 1URJA 2G8HA 3O8MA 4X64J 2XHWA 4Z4CA 1VISA 4IR9A 2OSQA 1RDBA 3OYAA 1IV8A 3AA8A 1CPZA 4ZLLA 4DCCA 5J2GA 2CUYA 1TL7B 4RW8A 5I3UA 5DK5A 3G8SA 2BCUA 3BH7B 4Y2PA 2G2ZA 1AZSB 2PI5A 3LW5C 3UMGA 2QL9B 3PFEA 1LEOA 4YDXA 4W5OA 4JV2A 4CJ4A 1GK8A 3CJKA 3M2RB 1T9WA 1SWWA 4ERDA 4DR4F 3QNMA 1KVBA 4DUZK 3UVJB 4UQTA 5IM0A 3A0IX 4CHQA 4EBDA 2KEYA 2MXYA 1RTDB 2CPDA 4W90B 2QE5A 3S1TA 3IS9B 3M2UA 5J2FA 1Q86T 3WDOA 3QU7A 5GTHU 3EXCX 2H3ZA 5KFAA 2DXDA 3VQTA 3KKAA 1PG5B 1DEJA 2VQEF 1Z25A 4P0PA 2NXJA 2KYXA 4FJKA 2ITGA 1HYSA 2ZE2B 1JLBA 3MUMP 3KHLA 4R64A 4NLWA 2IAJA 2W8LA 4AHSA 2BM1A 3GOIA 3TI0A 5J2MB 3FAHA 2BMBA 1ILYA 3HTVA 1WDDA 4NLZA 4FJIA 4DXLA 4AHVA 2LHTA 3PRBA 4PY5A 2P9IB 1H74A 3AVCA 3PVXA 4ID1A 4CLSA 4IFEA 2B7BB 4W98A 1KC8T 1R27B 3CCMN 4BDYA 2XC9A 3RMCA 1NDCA 2YB1A 3B0XA 1RYRA 4I0WA 3HZ6A 4ZP7A 4X66K 4A8YA 4EWTA 1ZBSA 3QINA 5DGAA 1X31C 1VBXA 3VQ4A 2OYYA 2GMJA 1HLUA 3EWAA 5CD4A 3JXOA 4BC5A 4K41A 2HYIB 3NAEA 1CC8A 3R1XA 2YNGA 3CFPA 3C14B 5J0QA 1TKXA 2E8NA 3UI3A 5A8RB 1S5LU 3HO1A 4OHWA 2HHUA 2CJQA 2FY1A 1ATRA 5IIOA 2MZJA 2AV5A 4DR1F 4P75A 4CCHA 2VODA 4AHCA 4FZNA 3QT8A 1Y5NB 4FF3A 2CPFA 2E7WA 2L9WA 3VETA 3U9ZA 3IFRA 3QAEA 2RHKA 5KFWA 2UXDK 5GIOA 4DUYK 5LSOA 1UETA 2E29A 3ZTRA 4F4KA 4MEYA 2E5JA 1DK3A 4ALZA 2VV5A 2YNFA 2HRUA 2DL0A 3NL0A 1VQNS 5JLHA 4DV1F 2NSCA 3G2XA 4IH6A 1BPZA 1NK8A 2D9OA 4F3TA 2Y1LB 1HI0P 3R5BA 5F3XB 1L3TA 3RJKA 2P51A 4FFDA 2AJQA 4RW7A 4KH0B 1YZ6A 4H0VB 2RMLA 2ATCB 3VALA 5CD4H 4FE3A 1AT1B 3TZZA 4OKJA 2A6AA 1S5JA 3V7KA 2O8DA 2KHQA 3OGUA 3H8MA 1REVB 3LZJA 1EP4A 5EUHA 1N56A 4LFCJ 3GSDA 4E1MA 3PW0A 4K2JA 1C0TB 3VF6A 3OTOJ 1RBUA 2VGNA 5CE3A 1D8YA 4ZPAA 2ZUGA 1WTBA 4Y2TA 3AO2A 3OHBA 3AD7C 2PBDA 3TUZC 1ZYQA 1WHXA 2M3DA 3QUBA 3CP8A 2ZXIA 1NNLA 5A0YA 1ZQQA 1NOMA 3ZZZA 1RT3B 1Y9OA 1VQSA 2R7OA 4NLVA 5JXSA 2CIMA 5E3RA 1UVIA 4BR9A 9ICCA 3FZKA 5HAOA 3VVUA 4ECTA 3NEKA 2HKEA 4MLHA 5EDWA 3DN9A 2BKNA 3CCEN 1VSIA 4H8KA 1KKHA 3ATUA 3E2EA 4DTOA 2YNIB 2C22A 2K8GA 3GFXA 2PMZD 3IM1A 4ZVFA 1HA1A 3OVBA 2CADA 2OPSA 2W6KA 3SD7A 4KFBB 4YHHK 3MD1A 5C7PA 3O1LA 4NB4A 1U48A 2HPUA 1GLDG 4DV6F 3WKEA 2ASDA 1FWLA 3HHEA 4CZMA 4Y2JA 3JAMY 5JMNA 4KBOA 4U7UD 3CUNA 3I1YA 2ZTCA 3OSPA 2WK4A 4GKKK 2RQ5A 3G86A 2GO8A 3TACB 4WYBA 1HKBA 1JJ2R 1VSLA 2HHHK 4HTUA 3L4BC 2F96A 3O80A 4FJ9A 4DEZA 4BRAA 1WOPA 5EN1A 4BDZA 1RTJB 4DR6K 3O3HA 1ZBUA 4OJPA 1HBOA 1WNSA 2JEIA 4BX9C 3D6JA 1HNIB 3JPOA 4YOEA 4WQ4C 4WFXA 4EK2A 3OYHA 2D8CA 4E7HA 2O5DA 1UPMB 4R63A 4OX8A 3M8SA 4QNLA 3CDBA 1YJVA 2HVIA 2VB6A 4YUDA 2P9NB 4I7FB 4BBYA 3ZT4A 1Q5YA 2R2UA 2HCFA 3VZIA 4KMUA 1PKUA 2DGUA 3GCXP 1HQ2A 4CEAA 1TAMA 2PA8D 2D3ZA 2IMOA 3L4PA 5CZXA 8ICAA 2HNZB 2GVZA 2HG4A 1RFQA 1KHWA 4JUZA 4HHUA 1YIJS 1LK7A 4UB8U 3Q8YA 1NCLA 2BPFA 3B78A 4AHTA 2N82B 2F7VA 2W41A 1Z19A 4NEYA 2YHBA 3EW9A 2IM0A 2UXBK 7ICIA 1D9AA 5A8WA 1RBRA 3GBTA 1XS9D 1FE4A 1PAUB 1HMVB 4IO8A 4NLSA 2W7PA 5BXIA 1VJWA 3SPZA 4BRKA 2XSJA 3HSDA 1RYUA 3VQ5A 5B0AA 8RUCA 3RW6A 4BRIA 3MM9B 2GCFA 3K1ZA 2PFNA 2E8MA 1QSSA 2VFVA 3SAFA 4CFAA 2LBOA 3AQFA 1UCVA 1O8BA 3TU5A 2LXFA 2YH0A 3UCZP 2EVZA 3D2SA 3O5BA 4IOBA 2UUTA 3V81B 4CJ5A 2UUBK 3BS7A 2GIQA 4CGJA 4CNQA 5GTIU 4DLGA 4IL6U 1OY9A 1R8PA 3MXIA 3O4NA 5L1KA 4JI1J 4NA2A 7ICPA 4CW7B 3Q8SB 4J91A 2W9BB 1OSCA 3CJ3A 1KEKA 4CBXA 2KKVA 1ZPVA 2NYHA 1M5OC 4ISGA 2VIHA 2OMOA 1YITN 4CGHA 3G6VA 4E3SA 3DRSA 4NE9C 1WSJA 5AQOA 2QL5B 4ZVPB 4DBQA 1OVYA 3LPUA 2CJ9A 4Q2LA 4BRNA 3M8PB 4B3TJ 1PJ6A 4FW1A 1FO1A 2D69A 1RBSA 5HLFB 3C15A 3SUPA 3Q8KA 1RPLA 1S1XB 4MLEA 3E01B 2IOFA 8ICEA 3R5JB 3U1LA 3PKMA 2EK1A 3FYHA 2P9LB 2F8HA 5CQGA 1AQ6A 3AT1B 1IBKJ 1I39A 5M1QA 4D3GA 1GAOA 2GNKA 4XDCA 4OZ0A 5AI4A 2D0BA 1QHTA 1CSJA 1J6ZA 2QMUB 4DFPA 3NGDA 1VC0A 4F72A 5GAHI 3AV9A 3QX7A 2KN7A 4FZLA 2LDYA 5CAAA 3KWMA 1CG2A 5CHGA 1S6PB 1Z1BA 1O6XA 3GJTB 2IVMA 5E84A 2DH8A 3C6TA 4YN4A 4Y65A 2YMQA 3OQ2A 4YY3J 3A12A 3C6UA 3UDLA 8ICBA 2R2RA 4CEOA 4BE2A 5AI0A 1TUGB 2CH5A 4H5WA 8ICQA 3C28A 3M3ZA 3TA2A 2G8IA 4NMLA 2DUYA 3ZSWA 2XYPB 4NCAA 2MZRA 1TL1A 3ZX3A 2EFGA 2HAIA 4ED8A 1A6LA 1GOBA 3O1WA 3VERA 3SUQA 1VBYA 3CI5A 5J1EB 4K8XA 3E58A 4F3OA 2KG5A 4N8NA 5GAHP 1SJ3P 4UAUA 1H2UX 3H2LA 2ZM6F 3DOKA 5DM6Q 3BPSP 2EQYA 3CJ4A 3KG0A 3BGOP 2K8BB 3SIPB 2IMWP 4DV2F 3HFVA 3VGMA 4G1PA 6FDRA 1E6VA 5CYMA 4RBTA 4KHQA 3I82A 4J9UE 1JCFA 1VQLN 2HHXA 2VONA 3UMBA 1CJVA 3CULA 5IWAK 1BHLA 3OFGA 3MMVA 3OXGA 3NVZA 4L74A 7ICFA 2J9DA 2KVCA 3JXUA 1B0VA 3UDEA 2D0CA 4WFYA 4Q44A 2R8JA 1SB6A 3PFOA 3PIPQ 5ETRA 3WK4A 1QCKA 4JI3J 4BHQA 4QPXA 1EJ7L 4QIWC 5KGXA 4M7XA 2A1JB 4HI2A 4ECUA 5KFSA 4CF5A 4ICLB 1DQ8A 2DNZA 5AXKA 1YVUA 1X7VA 3HDSA 5IT9O 3BF4A 3RUBL 1CJUB 1Y4ZB 2Y8YA 1Q8KA 4DSEA 2HZAA 3TNVA 5AZIB 4OJ3A 3CJ8A 1A77A 2JR5A 1JRPA 1VDVA 4LF6F 2F5GA 2ZWHA 4P74A 4HHTA 2CNNB 4CO5A 2ZOMA 2IYIA 2XCAA 4GC6A 2XIDA 2ZKTA 3CF5Q 3K7RA 3JTPA 2NPFA 3ETMA 4Z4FA 3OYNA 2QWPA 4WBFA 2IVNA 3DM2A 4F50A 4Z6EA 2HI0A 9ICJA 4WTOB 4X84A 1YRTA 4NLGA 1XI1A 4I2CA 2DY4A 1MN9A 4ECVA 3NRBA 4HTLA 2OTJN 4Z4GA 1B22A 4O3PA 1FKPA 1RT2B 2Z2LA 2AGQA 2BVZA 3DLHA 2CPRA 1XBWA 4WQ5C 1S59A 3W5ZA 2FPHX 4IH7A 4F3MA 3DYAA 1YRUA 1LWFB 2QARB 4YR0A 2ASLA 2KV2A 3MEDB 5BR8K 2GS8A 1I94J 4FJXA 2LLZA 3FJ2A 2UXCF 3G6YA 1XHZA 4FK4A 4FJ7A 1QH9A 3ISND 3RR8A 3MPYA 5M1FA 1ZXIA 4YQWA 2MKHA 4LR7A 1N33F 3OY9A 4QS8A 4W5TA 3O08A 4IG3A 2J7UA 1SZHA 3C2MA 2ASMA 1KVJA 4AXJA 3AQOA 4C4WA 1ZQJA 2GBZA 1F0MA 4HVZA 4KRWA 4CEFA 3M30B 2ZWPA 3NDKA 4ISFA 3K17A 2F8TA 7ICQA 3QJLA 1HNVB 3AB4B 4LF5K 2V8GA 2YPZA 4M3TA 2HVZA 4CT9A 2HFVA 3T1HJ 2IVPA 4X64F 4BR5A 3MCPA 1W25A 2B5JB 3SQ4A 4JK7A 2YWHA 2FIUA 2DF4B 3UNYA 3FKBA 2DGVA 1B64A 1C0UA 3NGRA 2LXUA 2DR6A 1SCJB 1Q1KA 1HIYA 4J9RA 4RW9A 3PSTA 2X1AA 1NSKL 5ALDA 2WF9A 3HPGA 3QMLA 5EY4A 2E1FA 1NGBA 2LA6A 4UATA 1K73O 2F40A 5C2DA 3M6ZA 2O8EA 4K59A 2W24A 4C2MA 1M6YA 4DU4A 1RWKB 3VVTA 5C42B 1N36K 2JZBB 2HF3A 3CD7A 3SCXA 3VZHA 1OYEA 3NS7B 2K7KA 2W4PA 2CGKA 1E4FT 2W2PP 3AAWB 3ULHA 1D8LA 4AT1B 3GU3A 2M0GB 2MKSA 4H5RA 3DDKA 3F9MA 2EG1A 3OVNA 3Q8UA 3UW1A 2QLJB 2R7QA 4RPXA 3T1YJ 3IKMA 3BSCA 3ENAA 2HEKA 4XK8C 2PXIA 1XSNA 1UMJA 3MEGB 4KHSA 2KXFA 1IJFB 1XMQJ 2CZVC 2E3TA 3MMBA 4CLPA 5ETKA 4JKGB 2AEJA 2HBMA 2FMSA 4H54A 3ZC4A 5KT4A 1RCHA 2ZFHA 4DKWA 2LA4A 4RWWA 2YX4A 1M5PC 1RDAA 2Y0SF 4J37A 4LRAA 1R8HA 1WSEA 4CM0A 1IH7A 4WYLA 2HWTA 2XHBA 1U49A 1DJ0A 1OKJA 4EBEA 1VSJA 2OXOA 1GOCA 1PK3A 5T7BA 1AB8A 3C16B 1SB3C 4OIXA 3QWPA 4PHAA 3M1VB 3F73A 7ICKA 3G8QA 1NUEA 2KDOA 1WI8A 5J2PA 3IR6B 2NXCA 3QT5A 1WC5A 1Z4NA 1VSFA 2GELA 3BH6B 2BPGA 2DR7A 2ZZTA 3BQ2A 5DM7Q 3KLVA 3PX0A 3ZD8A 3LUYA 2ZBIA 2E4LA 3BP8A 4ZN1A 2D4WA 3KKFA 4ID5B 2B7CB 2KM8C 2XI2A 2FMQA 1HBMA 1JLFB 5ETOA 4D3HA 1VAZA 1N2XA 5F9LA 4WIIA 2WVEA 2K8AA 2LEAA 2QA4S 1QTMA 4PG8A 4FK0A 4S0MA 3DFEA 1NMDA 3UN5A 4FJ5A 9ICWA 2NRHA 3KK1A 5C24A 4ZDNA 1KTVA 4Y2KA 2FGOA 3AA3A 1YBTA 4L73A 3DXKA 4EENA 2RU9A 4OI2A 4RWTA 1XR5A 2M9NA 2J8AA 2HHWA 4DV3K 4R0JA 2FDNA 4ILRA 3Q2SC 5GMKa 4USJC 3QIPA 2B4OA 2ZIXA 4MFAA 5EX0A 2HZCA 4X2BA 5J2DA 5M1PA 1R43A 5LMUK 1SV5B 1U04A 4LFCF 4NXNK 2VANA 4A8QA 3OTOF 3A8IA 4DB3A 3L8BA 4RQMA 2JWLA 4OPJA 1F44A 4DV5J 4FLZA 3TARA 1P1LA 3W8GA 1N34J 2PYLA 1T11A 2EHGA 3AARA 2P6SA 3VF4A 3KK3B 4UZCA 3MD3A 1RWMB 2LEPA 2KVSA 1BQMB 1N8RO 2YB4A 3N5FA 5J0XA 2UZAA 1CXQA 4NYPA 2A40A 5T7LA 2FC0A 4UOGA 2ZITA 5ALIA 2FUG9 4B3MK 2G0AA 3TZYA 4JYAK 3ZDDA 4UT4A 4YB5A 3K0SA 2ITMA 3U1NA 1D09B 1KN6A 1RXOB 1ZD2P 4IFYB 3D0IE 1NOZA 2FJEB 1U8SA 2IPOB 2X1BA 9ICRA 1F3VA 1Q8IA 2ASOA 1F5CA 1W97L 5LMNK 1YX2A 3MN7A 4CM2A 3FBFA 5JU5A 4FF4A 2XY6A 1X4CA 3THYA 1LW2B 3H3NO 4ISEA 1NJYA 1PBAA 1QVGM 3FR0A 1IKWB 5CZ1A 3TJ9A 2J6TA 3O6WA 1OQ6A 4TXSA 3EGWB 1HRHA 3NP5A 1N6QB 4QIFA 2JDJA 3WXIA 1J27A 3CD5A 1BY9A 5B0BA 2ZC3A 2NXUA 1U45A 3Q7CA 4ILLA 3RR7A 4GXKA 4B8AB 1R3NA 2GVDA 4PQUB 4WP3A 4C0BA 3P5JA 3BGRA 5EE0A 4Q7AA 4CZGA 2Z2ZA 4BROA 5EE9A 1JL1A 1SUQB 2BANA 1BQNA 5J0SA 3SCIE 2F2AB 1P8GA 4DPYA 3OFEA 2Y0BB 3BN4A 3ZCMA 5KQDA 2CPEA 3IBFB 4X4SA 1FDNA 3QFPA 3M2VA 4MFFA 5KFHA 3X1LB 2MAXA 4PKHA 5AE1A 3DU6A 2G1DA 4H4MA 3G96A 4IFVA 3L7PA 5KFOA 1IWAA 2HBYB 4CJTA 1HARA 2UUAJ 5I3QA 5ALLA 3M9MB 2RE1A 4KI4A 8ICFA 1FHTA 1CJTA 3WK5A 3MTKA 3CJSA 1APSA 5BOMA 5A2QY 1QZ6A 3Q83A 1FJEB 3IG1A 5ALVA 1KAYA 3PNIA 4Y0WA 3CMAN 1MMLA 4UOHA 1G4CA 3PY8A 4NLRA 5DG7A 3FZFA 4FLVA 1RBAA 5HVGA 3BEXA 1KKXA 3D2FA 1ZTTA 3RTVA 3GZFA 2ZH9A 4KLUA 4GO7X 3CJ0A 3IDWA 3MPUB 3AY9A 4NLPA 1N5QA 2K1RA 4EP5A 1A5WA 3DLLL 3BQTA 1XNRJ 1ATNA 3NWRA 3EZWA 3QBXA 2VG5B 1C4AA 3KG1A 2R2SA 3CM5A 2QT7A 4DUYF 4PG4A 2MSNA 4NCGA 1RE1B 2I7NA 1VQ8S 2VQFK 2GWSA 2C3OA 1S1VA 2DGTA 3WXLA 1ROFA 3TSPA 5IS2A 3W7BA 4F91B 3H8YA 3SFGA 2VJ5A 2Q36A 4KH5A 5DDMA 5CCMA 1NU4A 4LFAK 4DMZA 2VL1A 5D4LA 7ICUA 3IAS9 3RB3A 2B9XA 4QOZB 4ZJQA 1KVCA 4I9QA 3V1QA 4ZPBA 3LP3A 3O5TB 3GYGA 1VHFA 2DBBA 4J2DA 1IO2A 3ZZ0A 7ICLA 1TL7A 1U1NA 4CD3A 4KY3A 2DFEA 2Q3PA 1AZSA 2HVHA 4OYAA 2ZNZA 2BZ2A 2DIUA 4WK3A 1YBUA 1ICEB 3UR3C 4IQXA 4B3TF 2GWKA 3THVA 1NOYA 3VEWA 1VK8A 3M2RA 2WTUA 3LDAA 3WBZA 3UVJA 4CJUA 4JKBA 5AM1A 3B82A 1MROB 4E8UA 3L3VA 2N4CA 2A5XA 1Y11A 2OA8A 3OR1B 4JN4A 4LF4F 1RTDA 3JSMB 3FCHA 4DQRA 2VWJA 3TFRA 5F8JA 3IS9A 1HQUB 4FJ8A 3A8JA 3H5XA 1TL3B 5J0PA 4JD2B 1S4EA 1WSRA 1IR0A 4QWAA 1U47A 1UAXA 2ZUCA 1K73T 2ZE2A 1KLMB 2ZH1A 5KFPA 5EU7A 1ZS6A 2N7YA 1GMVA 4E7KA 7ICJA 3RAQA 1GX6A 3C2LA 3KNAA 1DURA 5BN8A 2J9DE 3H2UB 5J2MA 5CXTA 2MEWA 4WF9Q 1Q16B 4USWA 1WCNA 3LF0A 3OSNA 1U1MA 3QNNA 1V97A 3RH6A 4DL7A 2F9DA 8ICGA 2RKIA 2P9IA 2EG2A 5FLXU 2E5HA 4YY3F 2GIRA 1R6VA 1VLOA 2VIXA 1U0HB 2HS0A 2ZF5O 1NJZA 4C1NK 3AEVA 3HM9A 2ZJ5A 3KHGA 4ED1A 2IVFB 4KLOA 4R8UB 5AIAA 5DJBA 4NLQA 4KJIA 1F2GA 4ID8A 2N3LA 4JAXA 2EAOA 2AT1B 2KFYA 2MSTA 3M1YA 1U2CA 2Q0UA 1BU6O 3T3FA 3C14A 3D45A 1UQVA 1P8ZA 5D4BA 1UJ4A 1P6TA 1SKSA 5A8RA 1M1GA 1HYZA 3ZSQA 3S3OA 2R7UA 1OYDA 2PIIA 4QJVA 1J2VA 3CW2C 4GKJJ 5AQVA 2B0GA 2IJNA 3GR1A 2H3GX 5JICA 3O9QA 4I2AA 2PEBA 3PIPL 1NAQA 1G15A 2DH9A 2BJ7A 3DGPB 4JI3F 2MKKA 1FJCA 2KMDA 4QZEA 3AHPA 5AXMA 8ICMA 1TP7A 3B8HA 4Y2MA 4A57A 1NBEB 1LVHA 2R8KA 4HACB 1FTCA 3CC2N 1RBOB 3R9KA 4PWWA 3MEKA 2R8GA 4B9TA 2IA0A 8ICOA 1H3DA 4OZJA 2G8WA 3J7YI 2PFPA 4UZBA 2X51A 4EYHB 2I6XA 1FEHA 4EBCA 2HF4A 3OTBA 3TFSA 4RCHA 3HT3A 3WK8A 3RF9A 2ZD1B 5T14A 4GIBA 2XWXA 1REVA 2WB1C 4KPCA 3NF9A 4UBCA 2GJ2A 1C0TA 4OYOA 1QVGR 4ZOSA 4MAKA 3K5LA 4HCBA 5J29A 1SC3B 3QO9B 5BREA 4IH5A 2F8MA 4ETZA 1O08A 3PHTA 4H5NA 4JK8A 4FJNA 2UUBF 5FDLB 2BV3A 1A7GE 2ZH7A 3T7ZA 4DTPA 4LVSA 4RW6B 1X6IA 1FRXA 3J7YP 4QZHA 4YOWA 1J54A 3VAIA 1ELOA 1UZHA 1ZAXA 4B1WB 4M47A 3C19A 2VYPA 3HBTA 2JFKA 4LZDA 1RT3A 2EPIA 1LKYB 1MW7A 4PKDB 1BC6A 3SEOA 3H5YA 1QDUB 4Y00A 5EOZA 3L9ZA 1MG7A 2CXEA 3ELHA 3TR8A 1M90O 7ICVA 4IRKA 4O4GB 3OBWA 5J2KA 3ICXA 2CVIA 3Q8PB 1O03A 1I94F 4N56A 3O9TA 3P1GA 4QS7A 1ZQAA 2MZQA 7ICHA 3SBGA 2FF3B 2OPQB 2PMHA 4EMDA 3QJPA 2YNIA 2P6UA 3AVJA 4ANCA 3R7SB 4DR7J 1N8RT 4NZ6A 4LD0A 4F36A 5BRFA 1G2EA 4WWSA 4KFBA 3K1RB 4L3QA 5AM4A 4LRDA 4EZ9A 5HP1B 2QLXA 1XTZA 3CD6S 4BUGA 5GAGU 4KHUA 4CLUA 2GEMA 3H0MB 3U4LA 4CF8A 3T1HF 3NH1A 1U4BA 3TADA 2CZ9A 3C94A 4JKHA 3ILJA 2F44A 1YI2N 4O44B 3RFAA 1WSIA 3FQKA 2MZTA 4B08A 3ENOA 1RTJA 4C0OC 5AKLA 4K4ZA 5JVGQ 3FK4A 2EX3A 2WZ1A 2P5OA 1JN3A 3LP0B 1HNIA 1SC6A 4H0XB 5KRTA 1L8LA 4Q5VA 1PJ7A 2V0NA 2OEKA 4Z6CA 3KZBA 3ZTPA 5B08A 5ALSA 2VICA 1ZQLA 3H7IA 2HRTA 2L9NA 2CZ4A 4LF8J 2RD5C 7FD1A 2P9NA 4JI4K 3DLEA 1BGXT 4I7FA 1XK8A 2D6FC 3PYEA 4RBUA 3W9HA 4GVLA 3OS0A 2HNZA 1TV6B 2DNHA 4LC9B 3MDCA 1DQAA 4B3RJ 1HBNB 1KS2A 1H6KX 1YSJA 1SQKA 1RGIA 2ZDPA 2CG4A 3IR7B 2MKJA 4LQ9A 4AYBC 4J9KA 4CJQA 4A8SA 2FSNA 2RUGA 1LB2B 1NEEA 4I56A 3TUIC 4USMA 2QA1A 4OYWA 4DX7A 1HMVA 1XMQF 1VQ9N 5AM0A 5KFGA 2EI5A 2F1FA 2K89A 2QFJA 4LMZA 3MM9A 5CR0A 2PI4A 4I2QB 1Y5LB 3UPFA 4M0AA 1ZRMA 1Z00B 3AGRA 4IO1A 1RP5A 1QQ5A 2J8SA 4A8FA 1JX4A 2PY5A 1KQQA 2CKWA 2QB1A 3UDVA 2KZZA 1MWZA 3W62A 3WC2A 3TTFA 1ZBTA 4LF2A 3V81A 1WG1A 4B3OB 2FHKA 3B6OA 1LQ9A 4Y1CA 3D0HE 1CZAN 1S48A 5AK6A 3OPKA 4FJJA 4EX7A 3QBWA 3PRDA 1N5SA 3KD1E 2FZCB 1QQOA 2W9BA 5D0GA 2IS3A 1R8AA 2DHHA 1RAOA 2ZH4A 1OS5A 2P6TA 3UN3A 7ICTA 3HWTA 4NXMK 1EETB 1K8KB 5EX3A 1XERA 4U8YA 5AQRA 5HQLA 1BNOA 4TLQA 3WKAA 3M8PA 4MO5A 3GIMA 4ILJA 5J2HA 3O4WA 3LP1B 4JWMA 1QD1A 3EGZA 5HLFA 2R7SA 2V7YA 2KHDA 3C2KA 1S1XA 3IWNC 4YD1A 4RQ3A 4LZGA 3E01A 2B56A 3NVWA 4CQ1A 1DK2A 1WUDA 2P9LA 4G9ZA 4DFJA 2SXLA 2F3NA 1IBMK 5ALGA 2CNOB 3F2DA 2FHMA 2DCUB 5F0XA 2OPPB 3N4WA 1HHTP 5HATA 2BQUA 1SJFA 4CE6A 2OANA 1XO0A 3DI6B 1GLFO 4CFBA 3QE9Y 9ICVA 1UT8A 3T79A 4ZA1A 2AH5A 4TNOA 2K7JA 3ETRA 1RDFA 2BXJA 1ZOTA 3OR2B 2L41A 3KBBA 2HQCA 3RB6A 4BY9C 1S6PA 5AI8A 1RAEB 1HD1A 4DV5F 2Q1LA 1N34F 3PNCA 2VPWB 5AQZA 2ROEA 5ALQA 2GMHA 4KV8B 1RTZA 3BO4A 1VQ6S 1JCGA 2CJYB 4LF5F 2QWOA 4F25A 4M3RA 4BE0A 3NKYA 3QERA 3MMJA 1U8WA 2PFUA 2CGJA 2Y1IA 5DRKA 2J9CA 3M8QB 4TUSA 3M8YA 2MQOA 3ZYYX 5J1EA 3MDAA 2GQ2A 1IXKA 2HMIB 4CJPA 1OMSA 3HP6A 3UR0A 3FZHA 5HR7A 1ACMB 4QYZJ 2E8OA 4I2PB 3PHEA 1UWBB 3BREA 4OZLA 3OL9A 4J5OA 1IXRA 4OYZA 1FJ7A 4CO2A 4I6MB 4OI4A 5L8RC 1UFLA 4X65J 3OL6A 3SAGA 1WWUA 4ED3A 2E6LA 3UO0A 1VBZA 1NG9A 1RT1B 8ICXA 2QEXN 3A8EA 2FVSA 1S49A 5ETTA 4ZVTB 4DOZA 3AXKA 4J8FA 1Y3KA 2P9PB 4XUSA 4OKEA 2A1JA 4I2DA 4ICLA 5I42B 3KKSA 2MMYA 1FESA 2IM3A 4TVAB 4RNMA 4RLEA 3GQCA 2NV3A 3CERA 3L3UA 2FZKB 3C0BA 1CJUA 1NRKA 5AZIA 1T8EA 2X1GA 3HILA 3O6QA 2QA4N 3M9OB 1WCLA 5DKWA 4IS7A 5KT7A 4EEKA 3KD5E 2UUAF 3IBWA 3CPEA 2YX1A 2W42A 3VV2B 3S6JA 1KVAA 2DTUA 4ZJOA 5AQMA 1A9NB 3U7JA 4M9NA 2MSSA 2IM2A 1YJNS 3ZSRA 4DTMA 2JZ5A 9ICBA 1I5OB 1HW9A 1B4FA 1ZQXA 1ZQCA 3DLKB 3SMSA 1KDNA 4JRPA 3F0NA 1UA0A 2K4IA 4OPHA 1K44A 4OLAA 1RT2A 4FWSA 4MMOA 2OAUA 4QW8A 1DGKN 1DXSA 2A3VA 3OYBA 3RJIA 2N1RA 3CMES 2I9GA 3OHAA 4CP5A 5KPZA 3BBBA 3WQTA 2E2NA 1LWFA 4QZAA 1KTQA 2JV3A 2QARA 2O66A 4FBTA 4BQZA 2NNWA 1VHXA 3MEDA 4X5VA 5J8YA 3M6WA 2UU9K 3SXLA 1YJTA 3H98A 3H90A 1VJQA 9ICEA 4CJRA 3OYJA 3H40A 2JL9A 1YHQS 2CPXA 1WELA 1ITPA 4Z4HA 2XMVA 2QSFA 4PL8A 2KO1A 4DHYA 2ZHBA 1S7HA 1VRUB 1WC0A 1EWQA 5DBAA 1RDCA 3M30A 3AOAA 4JI2J 2W7AA 3LAKA 3IMQJ 4M5DB 1HNVA 2DWQA 2KJ5A 4UOCA 2A1RA 4DV3F 3CFRA 1U9LA 4OHYA 7ICMA 2B5JA 5MLCV 1HKGA 3NGUA 2E1RA 5ALJA 4HWIA 2J76E 2FSJA 5L1JA 5G5GA 4CVNE 1V5IB 1BCOA 2E2PA 4M45A 1G3OA 4X4NA 5AKZA 1H7WA 3ZSXA 2DYAA 2EFVA 3TVKA 2IOHA 3GLJA 2GZOA 4LREA 1ZD4A 5C42A 2JZBA 5CB1A 4UAWA 4F71A 2ZVSA 3D6FB 4ZPVR 3CCLS 3HJVA 3CGIA 3V1OA 2DR8A 5J0YA 3LZIA 2CJXB 3O9RA 4JI0J 3QEPA 4CWBA 3R1LA 1FERA 3MCAB 3D6HB 5DB6A 3GJRB 3I28A 3QU5A 3GIKA 3N4QA 3V9ZA 1UEKA 1YKWA 2GQCA 5KFKA 4C97A 1JXEA 2IIHA 5KFDA 1JNZB 4ACOA 3DLRA 5KFNA 3N4MB 3KD3A 2UVRA 3AVLA 1YJUA 2VKZG 4Z4IA 1IBLJ 4LT6A 3Q8QB 5AQWA 2FLNA 3MEGA 3N6MA 5JS1A 4EHUA 1UPHA 3C1ZA 4JKGA 4WCEQ 3FZ2A 1S99A 3AVMA 4WF9L 1KSPA 2XB2D 4DCHA 4H5TA 5AQKA 2WVFA 1SC1B 5HBMB 5K4LA 2V94A 3QESA 3DDNA 3ENVA 3UKUB 4C11B 1S76D 4IWVA 2D74B 1CZBA 3KOOA 2RHQB 3BKUA 4R65A 4I2FA 2E5LJ 2K4HA 2MJNA 4Y1DA 3MUTP 2QWRA 4CBWA 2JVOA 4M9HA 3UMCA 3AJ2A 3SCLE 3THWB 2E5SA 3C16A 4PWDB 3FVYA 3UXNA 2P5VA 3M1VA 1KDHA 1JJCB 5HMXA 3N7PD 4ES2A 5MLCQ 1ZBHA 1CJKB 4YMNA 3NCRA 3U02A 1L3VA 1VQ8N 3KZXA 3FC9A 2XI3A 4QZDA 4L76A 3CIZA 1NGGA 3G6EN 2AKWB 5BYSA 2YTCA 1OY8A 1NHKL 2ADCA 4GKJF 4UAVA 1UVNA 4ID5A 2NXNA 4AM6A 4QWBA 2E5IA 1JLFA 4DU3A 1VYAA 4TU9A 3CFOA 4E2FB 2I2YA 3FNNA 3GJSB 3CCUN 4KLSA 4OYIA 5F0WA 1Q81T 3Q7BA 2YKQA 4KHPK 1CVJA 1KW4A 5SZTA 1LWCB 1N0VC 4KQZA 3CXCM 1HNWK 3TWHA 2RF2B 2XG8A 2IHR1 3D1HA 5E3QA 2R7RA 1AXQA 4RX6A 4E1JA 4HKQA 5KI6A 1HPZB 2HK2A 1PUZA 4KGMA 2DVIA 5J2AA 3K2YA 5E3PA 4TYAA 4DR3K 2YHAA 2MLXA 5KFBA 3LO3A 5HK4A 3C66A 2VG7B 2J0XA 2EDUA 4O4RA 1NK4A 5LJ3Y 1JLCB 1SV5A 3BO3A 4A46A 2YJFA 2M2BA 2VQFF 3AU2A 1OSDA 2DT9A 5LSRA 1WHWA 2NRRA 2WSEC 1WORA 1NBWA 3OS2A 4OI6A 4CF1A 3KK3A 8ICTA 1VRTB 2E9ZA 3TAFA 4LFAF 9ICFA 4DFDA 1NK7A 1BQMA 2BABA 4DV0K 5AIBA 3JSBA 3RW7A 2FSKA 1RCOB 4JS4A 1RXVA 2IC3B 3DOMB 1J9AA 2X74A 1FX2A 1B0XA 9ICAA 3QZ8A 3GU0A 3GE9A 3O44A 5J0RA 5HMLA 1BQXA 1WC1A 4FWNA 3GPAA 2MQQA 4RQ1A 4LBHA 2AGPA 2V9WA 2QI2A 5IT9Y 4IFYA 4JP8A 3ENBA 2QM1A 2R8IA 1HWIA 4PABA 3GP9A 1RAFB 4IOXA 1XUPO 4UB3A 4C7QA 4U67Q 4NI2B 1FFWB 4IYQA 3PM9A 1LW2A 3AO1A 1S22A 1UOCA 7ICEA 3QICA 1IKWA 2EFPA 3H25A 3KUGA 2IY5B 3S3MA 4DR7F 2OI2A 2XTJP 4EI2A 1ZBLA 1N6QA 4A8EA 4I2JA 1Z4UA 2VQEJ 1U1PA 3TTDA 3UPQA 2FLPA 3KFUF 2WAQF 1T6DA 3MAAB 1KLNA 4F4WA 3PR4A 1ZAVA 2XVTA 3RBDA 4PQUA 5E79U 4UY85 2BJ1A 4F5NA 1KEJA 4GVEA 3LPTA 4PZOA 3PW7A 4IEIA 2ZH5A 1Z3EB 1ASVA 3JQJA 3AOCA 1SUQA 1HNXK 1C2PA 5IV3A 3OVSA 4DSKA 4WKYA 1WD6A 3CT9A 4JV5J 5JVGL 1NDKA 8ICSA 4KHRA 3TX8A 5LJ5Y 2MUTB 1E4GT 1XNQK 2OMLA 1S1WB 3JSRA 1ZQKA 2KG1A 5J2EA 2DRBA 3UCGA 3SAHA 1VLYA 2E7XA 2NREA 1FRMA 1VFJA 1WF2A 2NZCA 2FPMA 4WXWA 3BO2A 5ALFA 2C2EA 2C2NA 4Z37A 4AL7A 3R6GB 4WZQA 4ZP9A 2XMJA 4B3SJ 4B3RF 5B0GA 2WF8A 3RMBA 1BHNA 5EWGA 4CNZA 4EO6A 4C3LA 1ED1A 3C3LA 3OJSA 3PO5A 2B6AB 4DR1J 2ZH6A 1X3MA 1GXTA 3CDWA 3JPNA 1WF0A 3UD3P 3CJTA 2FQQB 3WNHA 4JKAA 3UIQA 2ZDOA 4FYYB 4K4XA 3D66A 1S9EB 5KFQA 1L6NA 1AUDA 3OW2M 2VBXA 4ZPCA 1XNSA 2EWSA 3QU4A 3GDXA 2EKNA 3TVZA 3AMZA 2CPZA 4LR9A 4DR2K 4M5GA 3I9ZA 1U7LA 2VG5A 2OH2A 4JBCA 3JS9A 5IT0A 4M3UA 1S72N 5CRXA 3ENWA 4P9SA 4CZFA 5FPDA 1GMWA 3NXZA 4MKAA 5AKJA 4KIAA 2W25A 1G1XA 2BCVA 5KFUA 1VK0A 3MGIA 1V9OA 3C95A 2DK2A 1NJIT 3M8ZA 3NMAA 3MCSA 3GWCA 1BPXA 3K58A 4HYKA 4NLOA 4X62J 3PX6A 2Y3YA 3KUHA 5DB7A 1Q95G 3MOZA 3QXGA 4Z6FA 5HMYA 2ATQA 3EZOA 3MGJA 4E1NA 5EVZA 3LM9A 4J9QA 5IIMA 3RVCA 5KG4A 3KLHB 3EUNA 4RNNA 5AR0A 3CD6N 2NLXA 2MJUA 4HTIA 3IWLA 2GO7A 4OZ3A 3J80Y 1VCTA 3AGKA 5F3TA 3ET6B 5AZJB 2RSQA 3FSIA 2CJBA 4IUFA 3QEBZ 3ZETB 3M7VA 2A1AA 1B99A 2FVRA 2FHJA 4PGQA 1MROA 3A13A 4BWMA 2HHQA 1NZPA 3DXSX 1Q46A 3OR1A 2IYGA 3JSMA 1RWUA 1NPKA 3RJJA 4EAHD 2VC0A 4DV4K 2YI1A 2RP5A 1HQUA 2K3IA 3WKCA 1UW9A 1TL3A 4JD2A 3N7SC 1N5TA 2PMWA 4KN7A 5B8HA 4J2EA 3PMLA 3FLCO 1TKTB 1KLMA 2KKHA 3DMJB 2LP4A 2O4GA 4H4OB 1ZA1B 4EO8A 3HRDD 2BBEA 2VA3A 3GYNA 3OUYB 1TFWA 1SJ1A 2RRNA 1M5KC 2KFZA 4GV9A 3FEXB 2DTJA 3S7RA 3OYGA 5HRSA 3VA0A 2KIVA 4CIOA 1U0HA 5ETNA 2G07A 5HJYA 4IC9A 1VQMS 1KAXA 4WFBQ 4ZPTR 2BJDA 2W4DA 2OPRB 3D4JA 4R8UA 4NLDA 3P8BB 3CXCR 4DQSA 4N7TA 2DD8S 5IINA 9ICXA 3QFUA 5AQFA 2D0OA 3K75D 5J0TA 2GGPB 2ZJRQ 2VA8A 1BWEA 5DDQC 2B6GA 1SIWB 3OL8A 2V8VA 2U1AA 4KLMA 2VPZB 3QYYA 5L38A 4OQJA 2E66A 2LKYA 4MO4A 5AE3A 4LH5A 2J5AA 1OPZA 3DRRB 2Z2YB 3CCVS 4F3QA 4NWIA 3D5MA 2IGIA 4W92B 2AJ2A 5D3GB 2ZWOA 5J1NA 1SGGA 1GX5A 1U09A 2XS5A 3NAHA 3AODA 4QOTA 3HKZD 1T9VA 2A41A 2XO7A 2HOIA 2EZXA 4XRHA 3DGPA 3HULA 4TLRA 4EGLA 1XMOJ 3DRPB 1UWAA 4LF9J 2D9PA 1VQ4N 2XS2A 4Y2RA 3Q89A 3NBPB 4HACA 4DPTA 2A3ZA 1KD1O 5ADZA 1PC5A 2FVQA 3HFZB 2XSFA 2FBVA 4BGDA 3QEAZ 4Q8EA 4OX9J 4M04A 3GG4A 2BGWA 2XRIA 1YTYA 2ZIUA 1KNZA 1AFIA 1FRHA 2ZD1A 1T7PA 3C8YA 4UARA 1IQZA 2W01A 5ETQA 3VAKA 5B7WA 4ZN3A 4DSIA 4WU2A 1ZTWA 4KGXB 4AM7A 2BQRA 5HRPA 4LVNP 2VOOA 1VQ5N 2HQDA 4FZYA 3QO9A 4C80A 2F4VJ 3KLGB 1JCEA 5H9EK 4DTUA 1FXLA 2C2RA 1HYVA 3H46O 3TEGA 5FDLA 3A5MC 1R6YA 3H0RB 3GJQB 2HOFA 3TKAA 4RW6A 2YHWA 3W64A 2VDIA 3K4GA 2CH6A 2VZ9A 4L72B 3I8BA 1PVRA 4Q0BB 1RCXB 3NASA 1LKYA 2LYBA 4LY7A 3MGVA 1L3KA 1RQNA 3AU6A 3RRKA 5D4OA 3ZSYA 3ALRA 2A42A 2JFDA 2A0FB 2XMWA 1LW0B 4YNQA 4O4GA 1RJJA 2QA4G 5FPMA 1GLJO 9ICPA 1RUSA 5DDOC 3D3CJ 3BYRA 5JS2A 1VQ6N 3WXMB 3RB0A 3ONQA 3R5CA 2HOQA 3AUOA 2OPQA 4FM0A 3QSIA 2HBKA 1K47A 3PIOQ 4CGGA 1F9FA 4QWEA 3IM9A 1ZQGA 4BRQA 1NI3A 2PEHA 1WLJA 4M3XA 1K8AO 2DGSA 1JB0C 3R5AA 1Z2LA 3VCBA 2JOQA 5HI7A 5HP1A 5D77A 4JI2F 3NY0A 4Y34A 1IBMF 1HNZJ 2FJAB 1K9MO 1H98A 4AQYK 2YQ3A 3ALYA 3V9WA 4YOUA 5HRRA 5A76A 1WHVA 4NLXA 3LOUA 4EYIB 1DRGA 3JPRA 3PJ9A 2BRLA 1ZPWX 4O44A 4Y2XA 1YVNA 3HK2A 2OZSA 1TFRA 3PJXA 3US5A 2GHPA 3FEZA 5K5MA 3AO5A 2DEIA 3AB2B 3OW2R 4Z6DA 3LP0A 3A0HU 3ILOA 3NNCA 1NH8A 2XZTB 4Y6IA 3LGMA 3IWXA 4F67A 4PXEA 1KONA 3HSGA 2VASA 3JB9k 3EUB2 1ZC6A 4LF7K 3KNGA 3G71S 4DU7A 4K8ZA 5KFZA 2ZM6J 1D5AA 3RJGA 4US8A 2JRZA 4NL5A 2MZ1A 2MKIA 2RS8A 1DFDA 1FDBA 3SQ1A 3AA4A 4MEXA 1WSVA 1H72C 4Z2XA 4OJLA 1TV6A 3KK2A 1B43A 1RWWB 1HBNA 3ED5A 3VGUA 4B1ZA 2MY8A 3S9HA 2X3DA 4PCQA 4IQVA 2WF5A 3A8KA 1RQLA 1WAJA 2EEYA 3Q86A 2XS7A 2J7WA 1IWGA 2XZDB 1YJNN 5IQ6A 2FPKA 4RUCA 2NO4A 1PC4A 4WCEL 4U9RA 3LANA 3ETOA 5J1PA 3WX8A 3P45B 2L3MA 3ISBA 3TO8A 4ZKAA 1HI8A 4I2QA 4KLEA 4RBVA 4M1KA 2PC6A 1CRXA 1HKAA 2HGMA 5BN9A 3IP4B 2O8BB 5CABA 1S79A 3MM6B 3ORYA 4C4TA 1PYTA 3JAMU 2GOLA 2DNLA 4ZMMA 4O3MA 8ICLA 4JI6J 4IRDA 4DX6A 3QUTA 3MUVP 4PUOA 4G3IA 2BDPA 3CCTA 2FGCA 5KFJA 2K60A 8ICUA 4XPCA 2IHNA 4ENOA 3CNQP 4B3OA 5D0EA 1WG4A 2Y0SC 4Y28C 1U2RA 4QWCA 3JS6A 2CQGA 4DWIA 1DY3A 4IBNA 2YKPA 1JLQB 5HSPA 4CLYA 2LCWA 5KFTA 1B7FA 2XICA 4DMNA 3TZXA 4BRDA 1GOAA 3T9NA 5M2UA 2ODGA 1FK9B 2QLFB 1T4GA 2PD1A 4IRCA 2M88A 2OELA 5EE3A 1FJGJ 2X6NA 7ICGA 1EETA 1K8KA 4XH1A 4CH1A 3NNHA 5J2QB 3QU2A 4TURA 2DY9A 1RU2A 1TZ0A 4DR5K 5CYQB 3ZI4A 1TFYA 4CEZA 3B6PA 5CA7A 4WQ5A 4P2HA 4TY9A 4FJMA 3LP1A 3FZBA 2IRXA 1CS4B 7ICOA 3PZPA 4X4VA 4A5AA 2Z0GA 3PSPA 2UXCJ 2KN4A 1RB0A 1QVFM 4URQU 1N33J 4YXMA 4NA1A 4IO9Q 3JQKA 5LSLA 4FO6A 4FLWA 3RRGA 1X5TA 4JI7J 1WDTA 2YY6A 4ZCIA 4LFBK 4BC7A 2A1SA 4MK7A 2OPPA 4QS9A 4JKFA 1RLDA 1WJ9A 3DI6A 5HQ8A 9ICKA 3J81O 1T05B 2HAFA 4CJWA 2DGWA 2ALZA 2OGUA 2XZWA 3V6DB 2A18A 3DKDA 2E1CA 3OR2A 2BM0A 4CF4A 3CJ7A 1RHJB 1N54B 4RQ0A 3TAPA 2J6SA 3GG0A 3VQCA 4P6QA 4NV0A 1HEKA 2ALYB 1H2TZ 1RWOB 2G2YA 4M7YA 2WTFA 4FM2A 3BEGB 2OO4A 1MNEA 1DRZA 4DS5A 2QTWA 2UUCF 4DU1A 3NOCA 4KV8A 5C2FA 3GYXB 3DHXA 1V38A 1WSGA 5IV4A 1RADB 1NPRA 4RUHA 4ZCKA 3BDPA 1C0MA 3LH2S 3P5TL 3VQ8A 3M8QA 2XM3A 1GMWD 1FRIA 1H0HB 2YWFA 4EU0A 5HL7L 1W26A 1YUWA 5JLFA 2BPCA 2GV1A 4PGXA 2HMIA 1MU2B 4AFFA 2E5LK 3N7RC 3GCWP 4U67L 4I2PA 4OYMA 2CJKA 4KSEB 1SL2A 2C3MA 4ZK7M 1UWBA 1RT6B 2XGQA 4PWUA 3D3BJ 3CCZA 2LI6A 1ZM3A 3R8EA 3GV5B 4ZVRB 4I6MA 3C23A 2Y9UA 2WOMB 4FWOA 1X4DA 2W2MP 3EY1A 5KFLA 2ZQBA 1TVRB 4DL3A 1IV0A 5HN0A 2AP1A 1RT1A 1N32K 3ZX2A 3NVKA 4J03A 4K8RA 3RU0A 4C0HA 4DJBA 2B4JA 2B4PA 1HD0A 4CO4A 1LV5A 1WBBA 5FP0A 2MLYA 3TP2A 2HDOA 3RJMB 2P9PA 4DV7K 1JKHB 3I32A 2YNGB 3UKRB 3I55S 1JJHA 5I42A 1WG5A 3TRGA 1MMDA 2GW8A 4I6YA 4JV5F 4R66A 1C20A 1UL3A 4DQIA 9ICOA 3CC7N 2FHJD 3I33A 1A0PA 3H2VE 1VQPS 2F9WA 4F0MA 4I27A 1FKOB 4OFZA 5J2BA 4QIEA 3TWZA 3WT0A 1YJWN 2W7OA 2Q97A 2DO0A 3F5AA 4BRFA 2OZMA 3MHYA 1J5EJ 3ZZTA 4ES3A 5H1SQ 4LSLB 1IKYB 5AJ3K 1CUKA 3N6NA 3NAIA 5D78A 3KYLA 3SQIA 3SFUA 2VOPA 4IOAQ 3IUCA 4YMEA 4E7JA 1Q3UA 2QYCA 1KD1T 4PPXA 4B3SF 4EZ6A 3BKTA 3DLKA 3VC8A 5KFYA 3HX0A 4RUBA 1CQMA 2KRRA 3G4SS 4MKVA 4B9LA 1GO3F 3O1BA 3KIOA 3LP2B 1FKAF 4DSFA 3TX0A 4K0KJ 2OTLN 2KH9A 4IG0B 5KNIA 4CYUB 2M8HA 3G25A 3MN5A 1T9TA 5GADI 2CFXA 3WEEB 2J4RA 4FO0A 2UV8G 3DWLA 5CJ7A 2LDIA 3MK6A 1F0XA 2P2CB 4DR4K 3DLBA 3R9PA 3EDRB 1FD2A 4MKBA 4FKYA 2PE8A 5AI9A 1HNWF 4FVUA 2B8QA 2PA3A 2NQPA 2H4WB 1VRUA 1FNXH 2LQ8A 3QBCA 4DG1B 4KC5A 4XH5A 5FJ4A 4RJVA 4FXWA 4DTNA 2JHDA 2J9EA 4X62F 2F1IA 4NLCA 5AM5A 2V2ZA 4JI5J 4J9VA 3M32B 2VHGA 4P4PA 3FCVA 4YMMA 5GADP 3EKUA 3J7YU 1DBDA 2QW9A 1S0OA 8ICIA 3EYZA 4QZ8A 5BPLA 2QX0A 4CZCA 4OCZA 3PXGa 2CPYA 5EX5A 4Y2CA 5KPRA 2AP6A 1F5BA 1ZQMA 2XLKA 1M5HA 4F5PA 4DV0F 1XJWB 3TAGA 4BG8A 2RDJA 3MMAB 1QQNA 3EZUA 1K9MT 2BHNA 4YD2A 3PKYA 4KGVB 4KBIA 1URNA 3HP9A 2IDOA 4ZCLA 4CJLA 4A2BA 3JPSA 1J53A 1BA0A 4J9LA 1VGYA 1Q79A 1L7MA 4P52A 1NMNA 4HTJA 4GC7A 4DUZJ 1CLFA 1NDPA 5IT4A 3ISZA 4GRSA 1HHQA 4LUBA 5H9FK 2FLOA 1O1WA 3F2KA 4DF4A 4LBIA 3KJNB 1QAXA 2G2OA 2GIFA 1RBLA 3VQBA 4CNYA 1GNKA 2KOBA 3HHNB 4RUAA 1X8DA 2FC8A 3CCJN 3G10A 2EH9A 3KMQA 3EX7B 3GL1A 3M8RA 4YR2A 5KOXA 1NK9A 5KTQA 3AVBA 4B9VA 2UYTA 1VS3A 3Q8VA 4I29A 3HSTB 1S0VA 5HBMA 2LQ5A 1TR0A 1QJHA 3CIPA 1XHXA 3IHQB 3UKUA 4ZJLA 2QLWA 1VLBA 3GV7B 1SV0A 1N4LA 5AK5A 3OD2A 3K2PA 4DV1K 3AFGA 3KJFB 5AQIA 1O51A 2ZOFA 3CCMS 3THWA 4M5IA 2AYEA 1JROA 4PWDA 5GIPA 5L46A 3MXHP 4IQUA 3D6MB 4QBUA 4IXCA 1T9YA 5ELZA 4ECZA 4A2AA 4K42A 4FLYA 1CJKA 4FYDA 4RKUC 4ZTJA 1W2BM 3MM7B 4JB8B 4EHTA 4X66J 4C3KA 1RXWA 2VA2A 2BOPA 4LF1A 2WSFC 4UUXA 3KOAA 2XCPA 5IOLA 3PYDA 1NGAA 4UAYA 5EWFA 3B4DA 4XO0A 2CQIA 2E88A 2CDQA 4A5BA 4DCOB 1Q7YO 3S3NA 1QUVA 3UNGC 2VFSA 3JQMA 3QRQA 2VU5A 3RSEB 4JNEA 1JWWA 3QFHA 2HQIA 2AHOB 2JEFA 3ZTOA 2H65B 1T3VA 2HSEB 3J7AN 2JSXA 1N52B 5AQQA 1XMOF 3EE8A 1P9YA 3EGNA 3QIDA 1TUUA 4LF9F 3PCOB 1LWCA 5DLFA 2BR0A 3OTQA 2RF2A 2AZ3A 1AYEA 2UXDJ 2HW3A 4DUYJ 1RZTA 2FJBB 3OHRA 4OX9F 4LSNB 3TA1A 2XULA 4QR2A 1HPZA 2JRSA 3BKFA 3N01A 3H4BA 1AW0A 5E7OB 1JMSA 2OIHA 3EN9A 2U2FA 4UB6U 4DR2F 2HMXA 1SI9A 2NRXA 2VG7A 3V7JA 1A5VA 3S41A 1MWMA 2ZBQA 4IR1A 1M5SA 1RWNB 1TUWA 1JLCA 4NLTA 5KFXA 1FCAA 1WEXA 1QHAA 1TL4A 3MOJB 4JKEA 4K50A 2F4VF