1NK6A

Cytosine-cytosine mismatch at the polymerase active site
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk6A01
1ZBLA 1YTAA 3RAXA 2C22A 1RT2A 2DFFA 3T19A 4E7HA 2BPGA 5DB9A 1HQUA 4J9OA 2X74A 2FMQA 2FBYA 4HUFA 5L1JA 3OYLA 1WCLA 2BQRA 3ZD9A 5BOLA 4CJ3A 1RDCA 5C5JA 3K75D 4F4KA 1IM4A 1NK8A 4FBTA 4PGQA 2PFOA 4ZTJA 4I2DA 3O3FA 3CFRA 4KITB 4QW8A 3BQTA 1F21A 7ICKA 4ECTA 3AVLA 5KG5A 1WSJA 1JXBA 5J2PA 4CEAA 1S5JA 3V9WA 8ICTA 4RQ2A 1PZNA 9ICHA 4FJKA 4J2EA 4QZ8A 4CHNA 2G8VA 9ICCA 2HNYA 3SYZA 5HBMA 4Q44A 4DSLA 3PW7A 5KGWA 4UBBA 5E41A 3EPIA 3TFSA 1NK5A 1WLJA 5KT4A 5CB1A 2E6LA 4DWIA 1ZBIA 3DI6A 4PHEA 9ICKA 3KLEA 3RMCA 3KLHA 4UB1A 3K57A 7ICRA 4KLGA 5C42A 2VWJA 3JPNA 2ZUDA 4Z6EA 3SUQA 1XU4A 4CJTA 2OPPA 4HUEA 9ICUA 3RBDA 3RR7A 4M9JA 2BQ3A 3RMDA 4I9QA 4RQ1A 4I2QA 1J53A 5J2IA 2OWOA 1LAVA 3JPPA 1IH7A 4M3UA 1DLOA 2VWKA 4FXDA 4CF0A 3RH4A 3S3NA 4DTJA 4G1QA 3Q8SB 3RH5A 2KQ2A 3GV5B 4NCGA 1VSFA 2B5JA 5SZTA 3VQ9A 1X2IA 4FS2A 3ZSWA 3ZSVA 2FBVA 3ZSQA 1NKBA 1TGOA 1X1PA 3ITHA 1K1QA 1WSGA 3C94A 3LZIA 1JX4A 3RJKA 2R8JA 4CFDA 3E2EA 4RZRA 4CJ5A 2AGOA 8ICXA 3LWMA 3MXIA 3M9MB 4FO6A 4FCYA 4EBEA 5KFJA 3OYMA 1NK9A 1BPZA 4I2GA 1JLCA 1VSLA 5KFMA 3EY1A 3K5OA 1RXWA 4B9UA 1HUZA 1WSIA 5KFNA 3GIJA 2WONA 4M3RA 3NAEA 1FKPA 5CA7A 1S76D 2KZZA 5J2MA 5J2QA 5KFAA 2YKMA 2BE2A 1JXEA 3AVNA 3VQCA 1MQ2A 3V6KA 2G8WA 5HRRA 3H7IA 3DLHA 3L2UA 1ZQZA 1C6VA 4CJRA 1K6YA 3BQ0A 4ELVA 3KK3A 4KLIA 1I39A 3RBEA 2W9CB 3DLBA 1N48A 2VA2A 4YFKA 8ICWA 2V9WA 4I28A 4KV8A 4OGEA 2ATLA 3LPTA 4FLVA 4CFBA 4KI4A 2XCAA 1BGXT 2F1HA 1RT4A 3PR5B 4DSJA 2QKBA 4QWCA 5KI6A 5DDYA 4QCLA 4KHUA 2PI4A 1RTJA 1XO1A 4FK2A 4I2HA 2RN2A 3HP9A 1TAUA 4CFAA 3KIOA 3RB4A 3AA3A 1N56A 3PX0A 4K4GA 1ZQLA 5KFPA 4DOCA 3O4NA 1XWLA 4FM2A 3HM9A 4FJ9A 1TVRA 1RBTA 2W42A 2E6MA 4K8ZA 3WNFA 2GBZA 3CFPA 3AVIA 4NCBA 4BWJA 3V7KA 2FLNA 4M9GA 2ASJA 5J0WA 5C24A 4RUCA 3BQ1A 1L3UA 3SV4A 2ZE2A 4FW2A 3MFHA 4J9LA 3AA5X 3V6JA 2I5JA 5IIIA 3CYMA 2VG5A 1U04A 2QXFA 2P51A 2JEJA 4RW8A 4CGHA 3NE6A 3S3MA 3ZDEA 9ICIA 4N47A 3MR2A 3PNCA 2M9NA 4GLXA 3ISDA 5KFTA 4DU1A 2KFNA 4QZAA 4HUGA 2Z1IA 5J29A 1DTTA 3TAMA 4F4WA 1SKSA 4KN7A 2HB5A 2R8HA 4F5QA 3QEAZ 2W8LA 4CJVA 4B8AB 5HRSA 3C23A 5KG7A 5KG2A 4CEFA 2IMWP 2DPJA 1Z00A 4OPKA 4JV2A 4IQVA 2O4GA 2XY7A 4UBCA 2W8KA 2I1QA 3V9SA 2OPQA 2XY6A 9ICPA 3C5GA 1RT3A 1SKWA 1EXNA 5DG9A 2F8TA 3AVMA 2W9BA 3V6HA 1XHXA 2DFEA 5CY4A 4YP3A 3FFIA 5L9XA 3HT3A 1ZQRA 1NJZA 4CE9A 4CK3A 4J2BA 1ZQGA 3IM1A 5KFWA 2BDPA 4AHCA 2BPCA 4E0DA 2G8FA 3OS1A 3AVGA 2P6UA 2ZTDA 4G3IA 1YTUA 1S0VA 3T5JA 1RZTA 1LW0A 4YD1A 5DBCA 1ZQKA 2FLPA 5DBAA 3Q8RB 1TK0A 2WTFA 4CJQA 4OGCA 5DQIA 4B9TA 4AHTA 3UXOA 4QZEA 2RDIA 4ECZA 3PX4A 2B4JA 4R8UB 4FLUA 2AGQA 3C6TA 3NGZA 4Z0UA 3V4IA 2Z1JA 2P66A 4UB2A 3RB0A 3JYTA 4PUOA 3M9NB 2J6TA 7ICVA 4DMNA 4B8CA 4J9MA 1JL2A 4DOBA 4DFJA 3KHLA 3ZSXA 4QWBA 4O4GA 2OYQA 5EOZA 2AJQA 3PMNA 5IIOA 3Q8PB 4KTQA 1ZQSA 3IHQB 2BPFA 3JSMA 5J0QA 1U9LA 4HYKA 3RRHA 3MR6A 3LDAA 4KHQA 1TL1A 4HCCA 4C8OA 1D8YA 4PQUA 3VQPA 5IIJA 4CIGA 3OYDA 3P5JA 4F3OA 4JRPA 4AH9A 4QWAA 5KT6A 3SCXA 5KFQA 1XSPA 9ICWA 2ISPA 1GOAA 5HHIA 3NH0A 4J9RA 4WE1A 4GC6A 1ZQVA 1BIUA 1Z3EB 3HL8A 3ZD8A 4OVLA 2PXIA 4Z4CA 1WSEA 4XUSA 1QSLA 4R64A 4Q8EA 1TK8A 4DTNA 2FMPA 2FPMA 4I9LA 3ISNC 5HRPA 3N4MB 3ZSYA 5KFYA 3DLRA 3AO3A 3DLEA 4DSFA 1T4GA 3KLFA 5SWMA 2PYJA 5DMRA 3NF9A 2FBTA 5I3UA 5D4BA 4YMOA 4KLEA 1NJXA 1VSMA 3UXPA 4CHPA 1CEZA 3G10A 4F2RA 4CK1A 4KRFA 4RW6A 4F8RA 1Y88A 7ICLA 1LWCA 4Z6FA 4KLOA 3HK2A 1KVAA 4W5NA 4HTUA 2F96A 9ICEA 4UB5A 4MEYA 3VQQA 3M8PA 3L2WA 4I2JA 3OSNA 5HP4A 3TANA 1QHTA 5J0RA 4RPXA 2GUIA 3NGIA 2IOCA 4DFMA 3L8BA 3T5LA 4AHUA 4FLXA 2PFNA 5DLFA 1JKHA 2UVRA 3HYFA 2D0AA 4Z6CA 3OJSA 4ZHRA 3ZDCA 4TSXA 3CFOA 5KT7A 1RYRA 4B9VA 1JLEA 3KHGA 3WNGA 4CGIA 2ATQA 4CEQA 4JV0A 4K4IA 5DLGA 1Z00B 1C1AA 3RJFA 2R8GA 2PZSA 3PO4A 2G8IA 3OHAA 4FJ8A 4PHDA 4F91B 5FRNA 2ZTEA 4PWDA 3PR4A 4FS1A 8ICIA 2ZUCA 1S9EA 4O3OA 1S9FA 2Y1IA 2YNGA 1ASUA 3H8SA 1RCHA 2W9CA 3RB3A 4X5VA 2DFLA 1T8EA 3PV8A 4DL6A 4NLZA 3HW8A 2LSNA 4W5RA 3S3OA 4TURA 3DLGA 4P4PA 4QZDA 4ECUA 5D49A 4Z4EA 4DQIA 3RMBA 3U3YA 1TKZA 1L3SA 4J9KA 1IKVA 4ID1A 3AVCA 4CF9A 2XCPA 5DGBA 3DMJA 4DFKA 3ETLA 1MQ3A 4B9MA 3V81A 1T05A 2UVWA 3ZT0A 2ZJ8A 4IQUA 1VRUA 1T7PA 8ICCA 4FJMA 1S97A 2XY5A 1R0AA 1C7YA 3L2RA 7ICEA 4YMNA 4OKKA 4DO9A 3NF8A 4O5KA 1A76A 1RDAA 3AA2A 3GILA 3AU2A 4CHYA 5IIMA 1SZPA 9ICAA 3UIQA 3QEBZ 9ICBA 3K58A 1BL3A 5KFEA 2FPLA 3JPQA 4M47A 3OSPA 1C1CA 3WNEA 2HHWA 4FJXA 2UVVA 4EYHB 1KEJA 3MECA 3QEWA 5CWRA 1C0UA 4DTRA 4BDZA 4AHVA 1D9DA 3OVNA 2B6AA 4KHYA 1VSHA 4YFUA 3JPRA 3V9XA 9ICGA 4O44A 3P1GA 1Q8IA 3SQ4A 4P2HA 4M3TA 2DFHA 4QZHA 4KLDA 5DB7A 5J0XA 1TL3A 1HJPA 2IS3A 3BDPA 8ICRA 4LY7A 2HNZA 4XRHA 3CM5A 3DRRA 3MGIA 1ZJMA 3MDCA 7ICQA 4FZXC 2XC9A 9ICFA 5DQHA 1B9DA 1TV9A 4KKOA 4CF2A 1D9FA 5HMMA 4DS5A 3LP0A 4M42A 2Y1JA 3AV9A 1S10A 1HUOA 4M41A 2NRWA 5CZ2A 8ICNA 1UT5A 3BJYA 3OYFA 4DTOA 1ZQMA 5F9LA 1YVUA 2HHQA 1NK0A 5KGXA 4O5EA 5EWGA 2AGPA 1RILA 1ZQUA 5J2BA 3RB6A 4AHSA 5KG3A 5FDLA 4MFAA 4PPXA 3MR3A 1JLGA 4DTMA 3DLKA 1HYVA 4FK0A 4YN4A 3LP3A 3KD5E 5KFKA 1TKTA 3DRPA 4YG2A 1XI1A 3G6XA 4RQ7A 3QZ8A 3L3UA 1ASWA 3UPQA 2FPKA 4Q5VA 1N5YA 4MFBA 4R8UA 3LK9A 3QINA 4JS5A 4I2AA 4NY8A 2BQUA 4CEZA 4I2FA 3H40A 4E19A 3OYBA 5KT2A 3LWLA 3VA3A 1WN7A 3QO9A 8ICHA 5J1EA 3HPOA 4CJPA 3B6OA 1ZQHA 1AROP 1ZBUA 3ZSRA 4OJRA 4DTPA 2YKNA 5KFCA 5FROA 3MR5A 3QLHA 2NUBA 3B0YA 4J9NA 5HMLA 3U3GA 4Q43A 4M9HA 5EWFA 5D3GA 3C2MA 3HVTA 3AO2A 3HXMA 4DG1A 3V1QA 1S0OA 3RJIA 3QEVA 2ALZA 3RTVA 3RR8A 4EZ6A 2ITGA 1IKYA 4QZBA 1NK6A 2RF2A 2DTUA 4JWNA 5CZ1A 1ZQOA 4MFFA 3LZJA 4DL2A 3L3VA 4RQ5A 1RDBA 1QTMA 1VSEA 3DYAA 2YHBA 4E89A 1BCMA 2PYLA 1KCFA 1Z26A 2MAXA 2IC3A 1HQEA 4LZDA 4LZGA 4O3RA 3ISBA 4DL5A 1SL2A 4CESA 4M0AA 1ZQJA 4DFPA 4PGXA 4NXZA 4CEOA 4QZGA 4ED1A 1A5XA 1VSIA 4NLGA 4FJ7A 1FKOA 2KZ3A 1HMVA 2BGWA 1CZBA 4OLAA 4RNMA 1MU2A 3HJFA 4DOAA 1HPZA 2C2DA 2R7YA 4M6WB 3QESA 1N6QA 8ICQA 4R5PA 2VANA 3AVFA 3G6YA 7ICHA 2MUTB 4DU3A 4W5TA 4AHRA 4J2DA 1S1WA 4RQ0A 1H38A 5J2AA 4F3TA 1SL1A 5KG6A 3VQ4A 5C25A 3OS0A 3JPOA 4UQGA 1COOA 1NJWA 5J2DA 4ID5A 2R8KA 3EW9A 3AVAA 3LP1A 2F8SA 1HYSA 2XY8A 1D5AA 3MXJA 9ICQA 1FK9A 4BWMA 1I3AA 4YR2A 4O0JA 2JGUA 4Q0BA 4R63A 1JLQA 4OKJA 8ICOA 5KFBA 1T03A 1A77A 3KHRA 1QSYA 1RTDA 1KLNA 4N76A 3LP2A 3PY8A 4KB1A 1KSPA 3QIOA 2XHBA 4IG0A 1KVBA 3MEGA 3RJEA 4FW1A 4GC7A 1LWEA 4C8LA 3V7LA 1C1BA 3SV3A 7ICUA 3PW0A 2J6SA 2FBXA 3TR8A 4NLNA 5KRSA 4DEZA 2ASLA 4CEBA 4M3YA 3SPZA 3V9ZA 4KMUA 1BPEA 2ZTCA 3RWUA 4MQ3A 3HO1A 4ECSA 2HVHA 2DY4A 1MC8A 2ZUBA 4CHOA 2F1JA 9ICMA 1WNSA 8ICKA 4RG8A 4PGYA 2BCRA 4CGDA 3GV7B 1U45A 1WAFA 3LDSA 4UB4A 4BE2A 3QEXA 3NDKA 2PFPA 4IBNA 4O5BA 5K14A 1RYSA 4CJSA 5D46A 4I2IA 1CZ9A 3H4DA 9ICSA 4O3PA 3ALYA 3G6VA 3ULDA 1LAWA 1ZQEA 3F9KA 3HX0A 4DL3A 4RQ3A 4IQWA 4JLHA 1SV5A 3VQDA 2DPIA 3AVHA 4FLWA 4F5PA 4FJHA 2EHGA 2G8HA 4M04A 1C0TA 3I8DA 4C8NA 1KVCA 4RQ4A 2GV9A 3TFRA 1RXVA 3KD1E 9ICLA 2NRXA 5DKWA 3LPUA 1QLNA 2BCUA 4MEXA 4DF4A 3VA0A 3NGDA 2D0CA 1L3TA 4DL4A 4IRDA 2J6UA 4DTSA 4LSLA 5KFGA 1S9GA 1S6PA 4W5OA 4F93B 1RBUA 4JUZA 1NOMA 5BPCA 5J0UA 5KFRA 4F50A 3VQ5A 3MEDA 4Z6DA 2RDJA 2PI5A 1WAJA 1ZQWA 4R65A 4DQRA 3AVBA 2VA3A 3ASMA 2C28A 3ZSZA 4Z4GA 4CCHA 2HHVA 3NH2A 5IILA 1L5UA 3C95A 3QEIA 8ICMA 7ICMA 4MF8A 4CFCA 1TFRA 4B9NA 3WNHA 9ICOA 1SL0A 4RW4A 5CP2A 1ZQQA 3K59A 2HVIA 3C6UA 3SPYA 3PUFA 3A2FA 3CQ8A 3OYKA 2YV0X 4GXJA 4ELUA 4ECVA 2FLLA 1A5VA 4BDYA 2UVUA 4LD0A 1BIZA 4QZFA 1ZQIA 4RQ8A 3AVJA 3ISCA 4KHSA 1VSKA 3HP6A 1IG9A 3OGUA 1LV5A 1KDHA 3QNNA 4CF8A 3UQ2A 5J2JA 4TQRA 8ICPA 1UA1A 4RW9A 5CYQA 4TQSA 5KFUA 2NRZA 5CJ7A 2C2EA 4NM2A 1EKEA 4JV1A 4I27A 5J0TA 5T7BA 2HHSA 3L2VA 3SZ2A 4J9PA 3RH6A 4FZZA 8ICZA 5F9NA 4PY5A 1LW2A 2YNHA 3NCIA 2H5XA 3GIIA 4ECWA 1Z25A 4TUSA 3OYIA 4E1MA 3PW2A 2OA8A 3IG1A 3BQ2A 3TAGA 4UAZA 3THVA 2RPIA 4Y1DA 3T5KA 5KFFA 5KFHA 2ZJ5A 1CXUA 5J2FA 4L8RB 4IG3A 3M8QA 4QZCA 4XIUA 2HW3A 3RRGA 2YNFA 3KJVA 2AU0A 4N5SA 4M45A 5HRNA 4K8XA 2HHTA 3E01A 3V1RA 3I0RA 3O3HA 2Q0ZX 2X6NA 2P6RA 4FJJA 1JLBA 2AQ4A 1KRPA 3MAQA 4DQSA 3AU6A 2JZBB 3KK2A 4ECXA 5CHGA 2E4LA 4FBUA 2Z1HA 4IDKA 1RBVA 3H4BA 9ICTA 2BR0A 3PVXA 1A5WA 3V72A 4DLEA 3AA4A 2V4RA 4NYNA 4F5NA 2KN7A 1ZYQA 3ZT3A 1JIHA 4P4OA 3TWHA 2D5RA 1JN3A 2JEFA 3M8SA 4K4HA 5HNKA 3KLIA 5TZVA 3ZCMA 4JK1A 3K2PA 4FM1A 3RMAA 4Q8FA 4KAZA 3M8RA 3NHGA 3K5MA 1TK5A 4IR1A 8ICJA 1RT1A 4CJLA 4FJLA 1X9SA 2YNIA 3EYZA 2VG7A 4UB3A 1QE1A 3QE9Y 2HHUA 1TKXA 4DSEA 1CXQA 4M6WA 1RDDA 3LANA 9ICRA 3ZT2A 5KT3A 2P1JA 3KLGA 4F4ZA 2MUTA 4ED6A 3C1ZA 4W5QA 3V6DA 3MDAA 2Q3SA 4EBCA 4QAGA 3QNOA 7ICJA 4CEDA 4CJ4A 9ICXA 2P5GA 4CGGA 4CIFA 4FK4A 4F4XA 2ZQBA 8ICVA 3NF6A 1RNHA 3NGYA 1BCOA 4H8KA 1XC9A 5DG8A 4DS4A 4Z4HA 2BCVA 3NFAA 2IHMA 4EP4A 4ZTFA 2QK9A 4FJIA 4MF2A 4N41A 1SUQA 3SNNA 4KLLA 3P83D 3GIKA 4IRCA 4I2EA 3HPHA 2IDOA 1ZQXA 4NM1A 1SKRA 3B0XA 1JLAA 2BCSA 3OYNA 4PA1A 1B9FA 1NOZA 2IGIA 3DM2A 8ICUA 2BCQA 3EWAA 4XQ8A 4BE1A 5IINA 1D8LA 4I7FA 1J9AA 4KPYA 4C8MA 8ICYA 1BI4B 4RQ6A 4DTUA 3VQAA 2BKEA 3OJUA 3O3GA 4TUQA 7ICOA 4DTXA 1IXRA 3ZT1A 2P5OA 3SI8A 1CLQA 1BPYA 3TAEA 4Q45A 5DGAA 3CG7A 3D45A 4Z4FA 4BGDA 5J0OA 4LSNA 1K1SA 4JWMA 4OKEA 1JXLA 4BXOB 5KFZA 4ICLA 3KHHA 1W9HA 1ZBHA 1HRHA 1REVA 3KTQA 2A1JB 3DOLA 4O9MA 5J0SA 4E1NA 4RPYA 4JS4A 4YR0A 4JRQA 2JEGA 4H4OA 1QQCA 1NOYA 4CK2A 4ECRA 1W0HA 3K5NA 2RKIA 5CR0A 1MSWD 2X6SA 4M3WA 1X9WA 3QETA 1RT7A 3FDSA 3MBYA 5CYMA 3TAPA 1QS4A 1UAXA 3SUPA 4E7LA 1DGSA 4LH4A 3SUNA 3C2KA 2FMSA 4J2AA 4O3NA 4BE0A 1WSFA 1CUKA 3KKRA 2F1IA 3DOKA 4FJNA 1DOQA 4NLKA 3K5LA 3N97B 3NH1A 3C21A 4UAWA 8ICLA 4XA5A 1RTIA 4UAYA 4O5CA 1IO2A 3T3FA 4KLTA 1IKWA 3L2QA 1XSLA 1ZQNA 3VQ6A 1L3VA 5KFDA 3Q8LA 4KTWA 3AO5A 3TABA 1Q9YA 4M3XA 4KB0A 2BHNA 4YD2A 4YQWA 1B92A 1S1XA 3Q8KA 1B22A 4FJ5A 1S6QA 4FLTA 3GQCA 7ICPA 4QZ9A 5KFLA 4J9QA 4O3SA 1U49A 4RNOA 4NCAA 4B08A 2W9MA 3C2LA 3VQ8A 4GXIA 3LAMA 4Z4IA 3ZDDA 3HPGA 1HJRA 4ECYA 4DL7A 4KFBA 4F2SA 4BDPA 1T3NA 3CM6A 4B3OA 3I0SA 3SI6A 1ZQBA 2Z1GA 3PX6A 2ISOA 5KG0A 1ZQFA 4GXKA 1ITGA 4CJWA 4PHAA 4CECA 2IA6A 4YXJA 5JS1A 2HNDA 4I2BA 5L1IA 4BACA 3OHBA 3SQ2A 3BGRA 2VG6A 3IS9A 3RAQA 3OYHA 4KREA 1C0MA 2LYHA 4YR3A 3VN5A 4O0IA 9ICNA 2PY5A 1BHLA 4KHWA 4N56A 5DK5A 2OPSA 3C5FA 1NK4A 1NKEA 2I9GA 1NKCA 1X9MA 2NRTA 1RT5A 4IFVA 3PW4A 3SQ1A 2KW4A 1ZQCA 2R8IA 4HHTA 7ICIA 4KLFA 1UWBA 2B21A 4DF8A 1BISA 3EZ5A 1RPLA 1KLMA 5KFSA 2V4QA 2KFZA 4YNQA 2IHNA 4CJUA 5L1KA 1LB2B 4ED8A 4CF1A 2ZJAA 4QWEA 4O55A 1FXXA 3MABA 1BPBA 3FYHA 1VRTA 2O4IA 4QZIA 7ICTA 2G8KA 5BOMA 3PO5A 3ORYA 1ZQAA 4FVMA 3NF7A 4KTZA 3OYCA 4FLYA 4E7IA 2G8UA 2OZMA 4RPZA 5IIKA 2YHAA 4QOZB 1S1UA 1EX4A 9ICVA 3HSTB 1ZQPA 5J2HA 4EBDA 4E3SA 7ICGA 5J0PA 3EPGA 8ICBA 5HHHA 1U47A 5KFVA 5J2NA 2KZMA 3GFKB 2X78A 2WOMA 2JZBA 4IKFA 1JMSA 1S0MA 5KRTA 4YVZA 3Q8MA 4KLUA 1BPXA 3U6FA 4GVMA 1BQNA 3NTUA 1RBRA 1KFTA 4M9LA 4DQPA 4CJKA 1V9PA 3TARA 1QSSA 4AILC 1XS9D 4E7KA 4J9SA 1ZQTA 4IR9A 2ETJA 1Q9XA 4F4YA 3UQ0A 2QKKA 4H4MA 5HROA 4TUPA 4PH5A 4CERA 4LVSA 1GOCA 5J2GA 3V9UA 1UA0A 5DDMA 5EU7A 3VQEA 2GWSA 1WCNA 9ICJA 3RJJA 3QEPA 3MGHA 2A1RA 2KTQA 4RT2A 3UXNA 4KHNA 4QW9A 3ZT4A 3M9OB 3AO4A 3VQ7A 3IAYA 4CEEA 5JUMA 4CHQA 2HMIA 4F92B 2IBKA 3PMLA 1O1WA 4I2PA 3D0PA 1DTQA 5I42A 1VSDA 1UT8A 4B9SA 1G15A 3K4GA 4O3QA 1BPDA 4KLQA 4CGJA 1BQMA 4IRKA 2JEIA 3V7JA 3JPSA 3AUOA 4M3ZA 3H8JA 4IFYA 4PHPA 1U4BA 5J0YA 5DB6A 3O4QA 8ICAA 1J54A 4FZYA 4HCBA 5EWEA 1ASVA 3OYJA 2C2RA 3F73A 5KG1A 3GIMA 4KLHA 1NK7A 3Q8QB 4RNNA 4C8KA 3TI0A 7ICSA 1JL1A 3C1YA 4NYFA 1BVSA 1IKXA 4CIEA 5KFXA 2BGGA 3GDXA 4LH5A 4OLBA 4CJFA 4RT3A 4GW6A 8ICGA 5KFIA 1TVAA 3OYGA 3OY9A 5DQGA 3LALA 3QIPA 3MXMA 3HWTA 7ICNA 3G0ZA 1BI4A 4KN4A 3S9HA 1KFSA 1S1TA 4ECQA 4MFCA 1J5OA 3ZDBA 5DBBA 1RTHA 5L1LA 4DSKA 1TV6A 3PW5A 1RT6A 1YT3A 4B9LA 4KLMA 3KK1A 3QERA 2XO7A 1ZJNA 3VQBA 4ED3A 2ZD1A 3AO1A 1S77D 1U48A 3H8WA 5DG7A 5J2KA 4DSIA 4BXOA 4GMJB 1TAQA 4ED2A 4I2CA 4FJGA 4EP5A 3OYAA 4QWDA 2A1JA 3TQ1A 2AQ0A 4EYIB 2W9AA 2EX3A 8ICEA 4FM0A 2HHXA 1S1VA 2IAJA 5HLFA 4CHZA 4RUAA 1XSNA 4ELTA 5DB8A 3IRXA 3MFIA 3H08A 4CJEA 1Y97A 2FC0A 1UOCA 2OPRA 1ZQYA 1KFDA 3DRSA 1EETA 4ED0A 3TAQA 1GOBA 2VA8A 1S0NA 3SUOA 1HNIA 8ICFA 1JLFA 3MEEA 5JS2A 1TKDA 1HYZA 3RJHA 1EP4A 4F5OA 2JLEA 3LAKA 3TAFA 2XRIA 4RU9A 5KG4A 2ASDA 4FYDA 3HVRA 5KTQA 3GV8B 2BANA 3OYEA 5J2CA 4FLZA 4CGFA 4ED7A 3AVKA 4Y1CA 2D0BA 5KT5A 1WSHA 8ICSA 4OPJA 7ICFA 1VK0A 3OS2A 5FRMA 2A1SA 4F5RA 2OZSA 2NRVA 1B43A 4ZH4A 1ZBFA 4HVJA 2XGPA 4M2YA 3T1AA 4R66A 1ZETA 4E7JA 5HP1A 5J2EA 2W9BB 4KI6A 4IQTA 3T5HA 4DU4A 1RBSA 4DLGA 3QZ7A 3RJGA 4KLSA 4DQQA 1EXQA 4EZ9A 1XHZA 4YXMA 4EEYA 4M9NA 3B6PA 3JPTA 1VSJA 4KO0A 1KTQA 1NJYA 4I29A 3NBPA 2XGQA 3ZSOA 5KFOA 1ZQDA 4P4MA 4KLJA 2PFQA 3ZDAA 3V1OA 4YCXA 3SQ0A 3SJJA 4RW7A 3KKSA 1HNVA 1LWFA 4YMMA
chains in the Genus database with same CATH superfamily
2JMGA 4P2FA 3G2XA 2RU9A 4I68A 3D2FB 2C22A 1S79A 2ZH8A 1N61A 5CZVA 2JR5A 2BPGA 4E7HA 4KH5A 5DB9A 4NWIA 4YMEA 3WK9A 3GSIA 4AL6A 3SBMA 3B82A 2JX2A 3KOOA 2QT7A 1WCLA 1VBXA 3ZD9A 4CJ3A 3QMQA 1RDCA 5C5JA 4FO0A 4O4GB 1NK8A 2DY9A 5AJ3F 1XC3A 5LMNK 4ZTJA 4CP5A 2GA7A 4I2DA 3QFUA 4KITB 1VLOA 2VQEF 3IBCB 2C2MB 4QW8A 2AKWB 3JSMB 1Y4ZB 2RAQA 8ICTA 4EO6A 4HI2A 3P4UB 3W64A 2VDHA 3IWLA 2B9YA 1NM1A 1PZNA 3PEJA 3E1YA 1VQPS 4UF4A 3HZEA 2G8VA 4K59A 1FDBA 3SYZA 1RK8A 2U1AA 1YTYA 5LL6Z 4DSLA 1OY6A 4CZGA 4UBBA 4LF8F 2F5GA 4F04B 3QYPA 1NU4A 3FKBA 2CADA 1NK5A 5CB1A 3FBBA 1Y64A 9ICKA 4CW7B 3HSCA 3RMCA 4UB1A 3K57A 1U8WA 5ETSA 2WSCC 1C20A 1CS4A 2OM6A 3SIPB 1YJ9S 1XU4A 2F8EX 4LF7F 2OPPA 3TSUA 4X62F 5AKHA 4ACOA 4M9JA 2BQ3A 4I9QA 4RQ1A 4I2QA 3FMBA 4LRCA 3ZI4A 3ULHA 4FE3A 4LVNP 2Z7JA 4ANDA 2VFTA 2XULA 4KB7A 2UU9F 2YJEA 4WWSA 3O5BA 4G1QA 4OI2A 3RH5A 2KQ2A 2B5JA 1X0FA 1VSFA 1NMDA 5FPMA 3AD9C 2GVDB 3PKMA 2UXBF 3ZSWA 4FS2A 4OYXA 1VHIA 4EEKA 5DDOC 3ZSVA 1WKJA 3N9UC 1QAXA 1TGOA 3ITHA 1LWCB 1K1QA 1JX4A 4QPTA 3DXKA 4RZRA 3AOCA 2AGOA 4XO0A 4ZVPB 4QIWD 3KKAC 3EZWA 4O4RA 1SIJA 1WG4A 2IVOA 4WU3A 4LSZB 1YJWN 3CC7S 1GLLO 5BR8K 4ZLPA 4Y2UA 2XI3A 3VEZA 1JKHB 1J2VA 4P2XA 4FSVA 3TX0A 4WP8A 3GIJA 2LBOA 2WONA 1FDAA 5D4LA 3ILLA 1FKPA 1JLEB 3MN7A 2KZZA 3OTBA 3O80A 4RBUA 4JI4F 4Y2TA 4EHUA 2KKPA 2I1RA 5AK5A 2PC6A 2YKMA 5DETA 3M6VA 1LOTB 3VQCA 3K9KA 1MQ2A 3MMBA 4NXMJ 2EKNA 3DLHA 1WD6A 3IMQJ 4NA2A 4OO1J 4PWDB 3G8TA 4KGKA 4GO5X 2YXLA 5GAGP 3BQ0A 4HH0A 4CLZA 1I39A 3L5KA 1F9EB 2R7UA 2HDOA 3J7YU 3IBFB 4E8UA 2MKKA 2MLXA 4KHPF 2QZ8A 2NSBA 5D4PA 2ZBQA 1PAUB 4OGEA 3HTVA 2HBRB 2O1PA 2ATLA 2HZVA 3LPTA 3VPZA 1VYAA 3MM8A 2E5SA 4Y34A 4KI4A 3G82B 5ALVA 4CTAA 5AM5A 1X4AA 3PR5B 2E8AA 4QWCA 5B0EA 4CZCA 1QQNA 5KI6A 3PEHA 1NGJA 1U6ZA 5HN0A 4FK2A 4X64K 5CRXA 1TAUA 3ISND 4XDDA 3MPUB 2XWXA 1FRHA 2CQ3A 3ED5A 3PX0A 1SV0A 1ZQLA 3RFAA 3OQ2A 5KFPA 4BC3A 1BXNA 1N32J 3O4NA 1VRUB 3DXBA 1TVRA 3LDPA 1UEKA 2PD1A 4NLRA 1XERA 2ZH5A 2KKHA 2VGMA 2X1FA 1VQLN 2D7SA 1B7YB 4NZ0A 3Q2SC 3VGKA 5A8KB 5ETLA 5JLFA 5D4NA 3ZC4A 2RE2A 1FO4A 4H5NA 1DFDA 1L3UA 2ZE2A 4FW2A 3EE8A 1C1CB 3MFHA 3AA5X 3PXGa 2J76E 4CT9A 1U2RA 2Z58B 1YIJS 2CPIA 2V69A 3P39A 2I5JA 5IIIA 1BWVA 3UE2A 3CCLS 1EHWA 4BRKA 3CO0P 2QXFA 3VEOA 1L7PA 1B99A 4RW8A 3KBBA 3S3MA 5AR0A 9ICIA 4N47A 2N7YA 4LFCF 3SCKE 4BGBA 3M30B 3W66A 5KFTA 4HUGA 2HLTA 3MCMA 3ZX2A 4BVOA 3BZQA 2VJ5A 4DU7A 2EFGA 1IR2A 2F1FA 3EGNA 3PIPQ 5KG7A 5KG2A 3IKMA 1Z00A 3QIDA 4JV2A 2Z2LA 3DRRB 4IQVA 4NRTA 2K2PA 3IUCA 2I1QA 4G1QB 2HOEA 4YDUC 3C5GA 3BSOA 1VIOA 4HVZA 1DRGA 2EC2A 3TYTA 1WTBA 2DFEA 4YP3A 4WFZA 5L9XA 5F8HA 5AJ3J 2AZ3A 4LVOP 3KLVA 2IHR1 2VQEJ 2MQ8A 1FX4A 4J2BA 5LMUJ 2YI1A 3CCJN 1ZQGA 5HMXA 4PXDA 3OV7A 1UEVA 4E0DA 3Q23A 3OS1A 2G8FA 2P6UA 1YRTA 1Q78A 3C16A 8RUCA 1VQ4S 4RWTA 2WTFA 4CBXA 2HQ3A 5DQIA 4B9TA 4B3TF 5D15A 1TKTB 4AHTA 3UXOA 1ZZNA 3WXMB 1MA9B 2WBNA 2OSQA 2HWTA 5ALEA 4GKKF 4MFBB 4R8UB 4FLUA 3C6TA 4LF8J 2RIJA 4Z0UA 1XO0A 2P66A 4PG4A 4UB2A 2EZZA 1A7GE 3JYTA 2DD8S 2P2CB 4DMNA 3EGZA 1UJ5A 9RUBA 4OD0A 3QBXA 5EOZA 3WX8A 5AQSA 2BEFA 1N5WA 1N33F 3PMNA 5IIOA 2YKMB 1Q82T 4LF7J 4X62J 1Q5YA 1KN5A 4HYKA 1KWMA 2ZWPA 1NB7A 2W2PP 4NL5A 1NGGA 2PSZA 3LDAA 1DQAA 1MMNA 4MMOA 4LRDA 3NGKA 4C8OA 2V8PA 2UU9J 2WW8A 3VQPA 5IIJA 3UDLA 3P5JA 3PHEA 2O6KA 5AK3A 3QPIA 4F3OA 2MQPA 3L9ZA 3CMAS 4AH9A 4QYRA 3SCXA 2BKNA 4ZP7A 2UXBJ 2VPZB 5TKWA 9ICWA 3A0BU 5HHIA 3VF4A 1TUVA 1BIUA 3Q8VA 3HL8A 3ZD8A 5AQQA 1S48A 1WI6A 1QSLA 1U0HB 2PMZD 1F1BB 5C2FA 2B9WA 2H3EB 1VQ9N 2FMPA 4I9LA 1YJVA 3ISNC 2EBGA 2NRHA 1HMVB 3DLEA 4JI6F 4RTFD 2YKQA 3NVKA 1YJTA 3GJSB 4LFBF 5DMRA 1NGAA 1RI7A 5I3UA 1NJXA 4P75A 3UXPA 4JI4J 2FVCA 3OL8A 3I8BA 4CK1A 4RW6A 1OSCA 3J7AP 2FE9A 4C1NK 3DU5A 3G25A 3C6HA 1SVDA 4MEYA 3M8PA 5HP4A 3TANA 1QVGR 5J0RA 3PJ9A 3NGIA 4KSEB 2ZGZA 4V1Ak 4DFMA 3RW7A 1FESA 4G9ZA 2ZKUA 3M7DA 3IC1A 4KHPJ 2HSEB 3KZXA 3IFRA 1N5SA 1T03B 5F3TA 1Q81O 1MWZA 2D0AA 3ZDCA 3M1FA 4TSXA 5HSPA 3D9BA 3CCWA 4OYMA 3PDNA 3WNGA 3L4BC 4LFAK 3CJRA 4K4IA 1Z00B 2VOPA 3O44A 1WC1A 3AD7C 2R8GA 3WU2U 5MLCV 1HBUA 4DZ6A 2I0XA 2N7CA 2HMPA 4L73A 3Q0AA 4FS1A 1S9EA 1TYQB 3UDVA 1WI8A 4DX6A 3I55N 3N7RC 3UO0A 3VV2B 2W9CA 5IM0A 3RB3A 1BNPA 1BOTO 2DFLA 3R1HA 4NLZA 3HVAA 2K4IA 2KHOA 4DCPB 3GE9A 2R7TA 2AJ2A 3D6TB 3DLGA 5M2RA 3H42A 1TKZA 5L1MA 5GAEP 1KVJA 1W25A 4YOVA 4J9KA 5AQPA 5AE1A 4LJMA 5H9FK 2FHJD 4DFKA 1T3QA 3FEYB 4YB1P 4B9MA 1MQ3A 2A0FB 3KZIU 5FLXU 2AEFA 2ZJ8A 4C2MA 3SMPA 2KEYA 3H45C 3EGVA 3KD3A 1RAJA 3UW1A 3BBBA 4CH1A 3D0HE 1F5CA 2MZSA 2KSOA 1HWJA 5DM6Q 2M8DB 4K25A 3AT1B 2HRYA 2KJ5A 1CZAN 3NP5A 5GIPA 1BDGA 2HOIA 4FYVB 1OH5A 4ID8A 3GILA 1BMQB 2FJEB 1WF0A 3HZ6A 1XQSC 2NXEA 1G4CA 1S9GB 2V2ZA 3JPQA 3OSPA 2M52A 4E2FB 4LBPA 3FBCA 4BG8A 1VJQA 1KEJA 3MEDB 1YLXA 3Q2TC 2VJUA 2DJWA 2HZAA 4YFUA 9ICGA 3N79A 4O44A 2D0OA 4NOHA 1Q8IA 2L9NA 4EO8A 3C6UB 4M3TA 5G5GA 3EUB2 2QSWA 2DFHA 4FWPA 2E5JA 4B3TJ 4KLDA 3F53A 3NMAA 3GPAA 1TL3A 5LJ5Y 2HNZA 4GKKJ 3H1VX 3SSQA 1DHMA 7ICQA 2XC9A 2WSEC 1VQMN 2W4CA 4WKYA 4KKOA 1SC3B 3LYSA 4JI7J 4RW9B 2Y1JA 3FCHA 4FFDA 1HUOA 4CGZA 3VGSA 4M41A 2G2YA 5CZ2A 1FA0A 4DTOA 4NMLA 1U2VB 1N33J 5KGXA 3KHYA 1V97A 5EWGA 2C1EB 1FFWB 3NRBA 5AK4A 1VQ8S 3N4PA 2CJXB 1Q4RA 1VQNN 1WHVA 4Y2CA 4BRHA 1JLGA 4MTPA 1NRKA 4EFHA 4DTMA 4HH1A 2HAIA 1R0BG 1QD1A 4OI3A 1LWXA 3KD5E 5KFKA 4YG2A 2Q1LA 1XI1A 2KRRA 4RQ7A 2OTLN 3B6BA 4OJ5A 5HVHA 1FFSB 2K7KA 4JS5A 4I2AA 3LF0A 1EIYB 4NY8A 4DV4F 3NRZA 1CJKA 4ZMMA 4IG3B 3NRWA 3DC2A 4E19A 3LWLA 4Y2SA 3NOGA 4K43A 1FRLA 2P9SA 3CMES 2YNFB 3ICLA 1ZTTA 4CJPA 2YMMA 2GC8A 5ALKA 1YX2A 3E01B 3H2LA 2VQFF 5FPNA 3ENHA 1AROP 3ZSRA 3TJAA 2W7AA 4C6AA 3HMJG 3MR5A 2AEMA 5AQOA 3B0YA 5HMLA 3F2BA 2IRYA 4JKCA 3LM2A 4ZIWA 3AO2A 2RHFA 2KV2A 4JI6J 2CQ0A 2QFIA 2HQDA 3UDCA 3QEVA 4ILLA 2ALZA 4EZ6A 2G0CA 4YOEA 4LFBJ 2LCWA 4QZBA 2WZ1A 4IOXA 3C19A 2DTUA 3P31A 4BRLA 1ZQOA 2Y0SF 2KB2A 4EMDA 4DL2A 1RDBA 5HVFA 3NGTA 4G1PA 1KC8T 1VSEA 5AQGA 5DRKA 1ZH5A 3I1YA 3DLGB 4E89A 3CCRN 1CC8A 3MM5B 1FKAF 1NSAA 2CPYA 2VH7A 3FVYA 3ISBA 2F9JA 3I87A 2LYBA 1SQEA 3WXIA 3BS5A 4B1WB 2O01C 2B43A 4JBCA 5ALSA 4QZGA 3BQ7A 5AI9A 1A5XA 1TU0B 3T7ZA 4PWUA 1RP5A 3HZGA 4DPUA 3Q8UA 2VG7B 3ID8A 4TU9A 2GVZB 4RNMA 3W8PA 1TKXB 4DOAA 3HJFA 5TKYA 4NI2B 2Q3PA 2R7YA 3A5NC 1FNOA 4R0EA 2J0XA 5FLXY 3N6NA 2OYYA 3G6YA 3P4IA 2MUTB 3C15B 4CLTA 2BJ3A 4W5TA 4RQ0A 4I6AA 2AJ0A 2OH2A 5E3CA 5KG6A 3VQ4A 4ER8A 1OSDA 4C0BA 4ID5A 1LFPA 3EW9A 2F8SA 1WOOA 2CG8A 1XTZA 1FXDA 2V8HA 2ZUAA 2PBDA 5E7OB 2KE7A 1GFWB 2JGUA 1JLQA 8ICOA 5J8YC 1SUQB 3ILJA 4NXNK 4QU6A 1KSPA 2XHBA 1KVBA 5CEHA 4GC7A 2JHEA 3V7LA 2ILYA 3SV3A 4DUZF 7ICUA 2RLTA 4OQJA 2GTDA 3CIMA 3SPZA 5DZ7A 2GELA 2CH6A 3UB5A 2WB1F 5HL7Q 3V9ZA 2ZTCA 2K1RA 2EEYA 1CQNA 3K5PA 3CCSS 1M5SA 4QQBA 9ICMA 3I31A 4RG8A 4C0ZA 3KFWX 2HSTA 2BCRA 2CH5A 2F63A 4C3KA 1LEOA 1U45A 1WAFA 1RQ0A 3LDSA 4UB4A 4BE2A 5CQGA 1VQ7N 2VPWB 1N52B 4ANEA 2PT0A 1V5VA 2VQEK 5LMUK 2QYCA 1H1VA 1KQKA 4AF1A 2FLOA 1SV5A 1J27A 2VOOA 2DPIA 2JNJA 1B64A 3ULEA 4P0QA 2EHGA 5B08A 4CLYA 3BPSP 1C0TA 4FN5A 3I8DA 4C8NA 3W9IA 5EE1A 3K17A 9ICLA 2WVFA 1K8KB 4LRFA 1VR6A 2DB1A 3LDNA 4KC5A 3DOKB 2XLKA 2ZFHA 4RX6A 1CI4A 4H0TB 2ESEA 1GXLA 3NY0A 2RQ5A 1WWHA 2LM1A 3BN7A 4LSLA 1S6PA 4W5OA 2CZ9A 3TUIC 4W92B 1V85A 1UP1A 4DR3K 5BPCA 4X62K 5KFRA 4F50A 5BPMA 3RSEA 2Q0RA 1Q16B 1ZQWA 4DQRA 3AVBA 4USTA 2C28A 4U7BA 1UFLA 3CJKB 1VIXA 3CJSA 2Q2RA 1X5PA 3N0VA 3C95A 3MD1A 4OIXA 3AOBA 4JD2A 1TFRA 4CIOA 4A2AA 1Z4OA 1SL0A 5DDPC 3TNVA 3HI0A 3K59A 2MJNA 5CYJA 2NLXA 3R5DA 3SPYA 2YV0X 4A8XA 2FY8A 4J5OA 5A76A 3SDEB 4ECVA 1A5VA 2QV6A 1BIZA 3M6GA 1FI4A 4QZFA 4ALZA 3OXFA 1VSKA 4C7ZA 2V8GA 2R7WA 1XEZA 3OGUA 1LV5A 1KDHA 4L72B 4DV4J 4CF8A 2E5IA 4IO1A 4ZN3A 3UPFA 3UQ2A 1SJ4P 5CYQA 8ICPA 2ZZMA 5KFUA 2C2EA 4NM2A 3T9ZA 1Q3UA 1NZ8A 2ZH9A 2P9CA 2XHCA 4EENA 2VQFJ 4I67A 1V5IB 2CJAA 5AZIB 3SZ2A 4J9PA 4FZZA 1V4SA 4IFVB 4NLVA 2GX9A 4O5FA 1LW2A 2JRSA 2E2QA 1HWLA 1IG8A 4ECWA 3JQMA 2APOA 2R7SA 3X3UA 3NNHA 4UAZA 4H0VB 5KFFA 2OELA 4H0YB 1VRTB 3MGJA 3M8QA 4QZCA 4Y2XA 2FJAB 1P9QC 2QLBB 1NJIT 5LSOA 3ZZUA 3CDUA 3N7PD 1N36F 2EFQA 4DR5F 1REGX 2MGZB 2Q0ZX 4DB3A 1YBAA 3EVWA 3FK4A 3U8XA 4FJJA 1KQFB 2BJ7A 3E66A 4CZEA 1P8ZA 1S22A 1NNDA 3KK2A 1QDUB 4PG8A 2E4LA 1ZXIA 2Z1HA 1I51B 5AKJA 9ICTA 1KL9A 1A5WA 2YHXA 2XZTB 3AA4A 3QGIA 1N34F 2J4RA 5HJXA 2KN7A 3MTKA 1ZYQA 4PL2A 3ZT3A 3TWHA 3M1YA 2XQCA 5EGYA 1J2NA 4H4MB 5HROB 3M8SA 1F9FA 3KLIA 1RHRB 2J5AA 3MCAB 4JK1A 1SV0C 4BBYA 1BD6A 3JTPA 1K47A 4Q8FA 1RAHB 3HHLA 3QWUA 4WF9L 2RQMA 3K5MA 2RS2A 1JJ2M 4IR1A 3OD2A 1RT1A 4ES1A 4CJLA 5JVGQ 2YNIA 3MM6B 3W61A 3TUPA 1GT8A 3PG9A 2DGQA 1QE1A 3QE9Y 5ALNA 4DSEA 4OZ1A 5M1QA 1OO0B 4MK8A 2QEXS 3T6BA 9ICRA 2G0IA 3DGPB 1DRZA 2W40A 1V38A 4TNOA 3JS6A 1NG9A 4LBHA 1OJ4A 2BUNA 3S41A 2ROPA 2XM3A 2WF7A 4DUZJ 4EBCA 4QAGA 1SH3A 2MQOA 3BBFA 3VVUA 4CEDA 4CIFA 1QQ5A 2M7SA 1K73O 4DR4K 8ICVA 2ZWOA 1VHXA 3NGYA 4CH0S 4R0JA 5LY3A 4PL1A 1ITPA 4ED4A 3CJ3A 3CC4N 2JFKA 3HJVA 4FDFA 1SJFA 5LOQA 3D68A 4Z4HA 4NLWA 3R6GB 4ZTFA 2MKHA 1WC4A 4FJIA 1EX8A 4N41A 1IKXB 4OJOA 1FNXH 2IDOA 4DUYF 4XPCA 3B0XA 1GK8A 3BSAA 1X4EA 3CJ8A 5D4OA 1HWUA 1OH6A 2AZ1A 4XQ8A 4CLUA 3WXLA 2BJDA 5T7LA 4BE1A 2ZGYA 5IINA 1PSDA 2ASPA 2GO7A 3QIPB 4I7FA 1J9AA 1NGDA 2X3GA 2O8CA 3O3GA 1RTHB 1TV6B 3ZT1A 2P5OA 2ZJQQ 2ERRA 4ZVUB 3TAEA 2OKQA 5AKXA 3KK1B 1E6VA 2HQIA 4BGDA 2BM1A 4F7VA 2P9UB 2C2OB 4LSNA 3BO3A 4PXEA 5CHCB 3UD3P 1N8RO 4JI7K 4AE5A 4H03B 5K9FA 1FIQA 1JXLA 4BXOB 5TISU 2ZVSA 1ZBHA 3TEGA 1REVA 3PSTA 1Y7PA 4RBTA 1UMJA 4YR0A 3AA8A 3GYGA 4JRQA 1S1VB 4H4OA 1M90O 3BEGB 2LKYA 4ECRA 3H0RB 3W2WB 2DITA 2LU2A 3QAUA 5IS2A 3J81O 4HT7A 5CR0A 1D1UA 3DRSB 1RT7A 4V19J 1UAXA 1PCAA 3SUPA 3OL9A 4E7LA 3LPYA 4ZN1A 1RE1B 2FMSA 4O3NA 1CPZA 4DN0A 1RAGB 4NLBA 2PA8D 2CQ2A 2D4WA 3ELHA 2PEHA 4NLKA 4DJBA 2AYMA 4CJ7A 8ICLA 1RTIA 3QXGA 4UAYA 3THXB 1DK2A 2BANB 2RSQA 2AIRB 4DFDA 4KLTA 5K5MA 1IKWA 4KTWA 5ADXH 1RWNB 3AO5A 2V34A 3Q86A 4BR9A 2E1CA 2V2QA 3Q8KA 2P9IA 2CQGA 1B22A 3D7EO 5A2QU 1SPBP 5KNIA 1WYGA 3M8YA 2DTJA 4O3SA 4RNOA 5JMNA 2C3YA 5HP1B 3NGUA 2Q97A 4EGLA 3ZLJA 4JI6K 2KYZA 1SJ1A 3GOIA 3C2LA 2VBYA 4LT6A 7FD1A 4Z4IA 1BU6O 2W43A 4KFBA 4ECYA 3FE1A 2DR7A 2ZIWB 4RR5A 3KUGA 4BDPA 3O1BA 4PKIA 3NBPB 2KJ9A 3UR0A 3KKFA 4YN3B 4HTJA 1SJRA 2UUAF 2E8PA 2DHXA 1FVSA 3SI6A 1N4LA 4UY8O 5KG0A 1ZQFA 2ILZA 1ITGA 1HNVB 1WSVA 2HNDA 1RAOA 1ZRMA 3C65A 4BACA 3OHBA 3BGRA 1RT2B 4HTLA 3RAQA 3OYHA 2OMOA 2YKAA 1NZPA 2UP1A 5AE3A 2LYHA 1I3OB 1YQHA 3TUJC 5DK5A 1N36J 1MWYA 4DR5J 1SI9A 1NK4A 3NASA 2XWYA 3CD6S 1X9MA 4K0KJ 2QA4S 3HLUA 1YJ9N 3VGVA 3CCTA 5EUHA 2R8IA 1T6CA 4HHTA 2FSKA 5AM4A 1WHXA 2CPHA 5EE0A 5J2PB 1KLMA 2V4QA 2IPOB 1OUQA 2IHNA 3C8YA 3H8YA 4OI1A 1N34J 3R9LA 2HBQB 4QZIA 7ICTA 4BR2A 3WK6A 4OX8A 3LUYA 4LBIA 1N0VC 2VD3A 4KTZA 3OYCA 1YUWA 3D28A 1OS5A 4RPZA 4QPXA 2RU3A 2D69A 3J7YI 3A1YG 1ZQPA 3EL2A 3VOVA 4I7FB 1RBOB 2I7PA 1H3DA 4X4RA 2HI0A 2G2OA 3SFGA 5J0PA 1U47A 5KFVA 5J2NA 4YOUA 2EFVA 2WOMA 2HK2A 1JMSA 3KYLA 4K4SA 1I1GA 3JTNA 3U6FA 3D67A 2MHEA 1DLOB 1HPMA 3CC7N 1S3XA 3UDEA 1RBRA 2KHCA 1KFTA 2FGCA 3RJMB 3MCPA 1X40A 2AEJA 4I6MA 1U0SA 3TARA 4AILC 1K8AO 2QO3A 1M1KO 3U02A 1L7NA 3UQ0A 3IWXA 3ONQA 4C8ZA 4TUPA 5AXNA 4CERA 2WCXA 5J2GA 1EJ7L 3NAHA 3B4MA 3ZO7A 5E84A 3A4TA 3VQEA 4FP9A 9ICJA 3RRKA 1UZDA 3F9MA 1T9WA 1FNMA 2ADBA 2QWOA 2A1RA 4KHNA 4ZPDA 1U8SA 5C10A 1NGEA 4P7VA 5JUMA 4DUYJ 2CNOB 4JMUA 4O0NA 1JLCB 3A5MC 2H3GX 4PXBA 1MWMA 2JWKA 4KGMA 4C0HA 4JN4A 2KVQE 3IGVA 2GWKA 1F3VA 2BV3A 1T0TV 1G15A 3K4GA 1IKWB 4JYAF 1BQMA 4IRKA 3T1HF 2JEIA 1BLUA 3V7JA 1HLWA 1RU1A 4M3ZA 2UUCK 4PHPA 3SMVA 1J54A 3ISZA 4FZYA 2ZIXA 5AHXA 4X4SA 4HCBA 4CDGA 3OYJA 3F73A 1EKRA 3GIMA 3UD5A 3NMUA 4KLHA 3KK3B 2IOFK 2R7RA 3C1YA 1J5EF 2CUYA 2ZM6F 5A2QY 2W55A 2GFFA 5E3QA 5BPNA 3BZKA 3MCNA 2V5HG 2HBKA 3CXCR 4LH5A 4KV8B 3VZHA 4CJFA 5EE9A 2PKEA 2UYTA 5KFIA 4C97A 4UZCA 4RQMA 1RT4B 4A61A 1NLVA 1YIJN 3G0ZA 3AQEA 4KN4A 2YX1A 4MT1A 1S1TA 4ECQA 3CCLN 1OVYA 1UJ4A 1CC7A 4HEA9 4DSKA 4WQ5A 4KLMA 4DV3F 4HR2A 2ZD1A 3BREA 4LR8A 3R2CJ 4DV4K 4JNEA 4I1TA 1JJCB 5DG7A 5J2KA 4JI2F 1TAQA 4LF4K 4FJGA 3LVVA 3QU4A 1F6TA 1HA1A 4H0PA 2MZTA 4ZVFA 3BPDA 4D3HA 5D0EA 1ZC6A 1HL6A 2W9AA 1WWUA 2Z0GA 2EX3A 4FM0A 2A6AA 2VQFK 4HACB 2IAJA 1KLMB 1T02A 5KAIU 5HLFA 3CP8A 2KXHA 4CJEA 2K8CB 4KGVB 2FC0A 3UVJB 1ZQYA 4OI4A 3F2DA 1KFDA 1EETA 1WWVA 3QRPA 2YN4A 5F0XA 1X9JA 2DHAA 2M9KA 3MI7X 5ETMA 3BZCA 3L4IA 1KAYA 4FZMA 1AYEA 2CQIA 1G7CB 3U1MA 4F5OA 3TAFA 2XRIA 3C7NA 5KG4A 4HWIA 2CPJA 4QS8A 3HVRA 1VQ4N 3GV8B 2UUAJ 1RXOB 5AQFA 3OYEA 2KN4A 2HGLA 1IBLF 1S4EA 2IMOA 2F7VA 2WOMB 4ZVEA 4M95A 3AVKA 4QJVA 2D0BA 5KT5A 1WSHA 1GTEA 7ICFA 3IP4B 4F0MA 2XZDB 2CQBA 4F5RA 1O03A 3H2UB 2E7VA 1QAYA 4LF5F 1Q7YO 3T1AA 4R66A 2E5HA 2YY6A 5J2EA 4ZCKA 3FZFA 3JAMU 5GVQA 3FFIB 4DU4A 1RBSA 3K8VA 4KLSA 1VMBA 4BRQA 4I69A 4MDAA 3B6PA 4IO8A 2EAMA 1KTQA 4DDFA 1F2GA 1F0XA 3ZSOA 5EVZA 3BGUA 2PFQA 1LW0B 3CETA 5M1FA 4YCXA 4RW7A 2A1BA 2Y3YA 5HBMA 3ENVA 1LWFA 3ILIA 3LPEA 3RAXA 1FXLA 3O8MA 4WFBL 3CMAN 3OFEA 3PYDA 1Z1VA 2DFFA 2IVNA 3CSKA 4ZJOA 3V4IB 4DV2F 1FEEA 4WFAL 1HQUA 5L39A 4J9OA 2X74A 2FMQA 4ZP8A 2C3UA 5BOLA 3K75D 4F4KA 4JI1F 4FBTA 2DGZA 2PFOA 4FNIA 3MWTA 2OGUA 3BQTA 2ZWHA 4ECTA 3AVLA 5HQMA 2F40A 2UV8A 3D2EA 5E3AA 1JXBA 3VERA 3F5AA 2X3DA 1RISA 1CSJA 1H6KX 9ICHA 1TL1B 4PABA 3N5FA 2Y1LB 3PTWA 1IJEB 5E33A 9ICCA 4KAIA 4Q44A 3PW7A 5THWA 2J0WA 4YB6A 2Q1NA 5KGWA 3E9LA 1C0FA 5EHHA 4NE9C 3TFSA 1IN0A 1WLJA 3QQCD 1NU0A 3TKAA 2QWQA 3ZTQA 3DI6A 5AQZA 3KLEA 4BR5A 4JHDB 7ICRA 4JAXA 4KLGA 2BM0A 1OQ3A 3GYXB 4TY8B 2ZUDA 4GY2B 2V68A 3NVMA 1S1TB 1U7LA 2DO0A 2G1HA 4IH6A 3R6LB 3MPVA 9ICUA 3TSQA 4WXWA 2CN1A 2RMLA 3AQOA 2AYEA 1O0PA 5J2IA 1S7HA 4UOGA 3FBEA 5AKLA 4DR2F 2VWKA 3S3NA 2NUHA 3LW5C 2F2AB 3KLFB 3HHLD 1B70B 3GR0A 4M7YA 4Z7YA 1QAJA 3O4WA 5SZTA 2CQCA 2HF4A 1Q8LA 3UMGA 3T1HJ 2ZIUA 3VQ9A 2IAJB 3ZSQA 1DURA 4ZP9A 1Y9OA 3C94A 1UVIA 3HHDA 4IOAQ 2HGNA 2J7UA 2E3TA 2XG8A 3NL0A 3UM9A 1XNQK 2HHPA 4FO6A 4PPDA 5C2CA 1J5EJ 4FVUA 5KFJA 2GZOA 3OW2M 2ZM6J 2AA4A 2G13A 3V2UC 1NK9A 3NS1A 4ATNA 1VSLA 5KFMA 3EY1A 3K5OA 1KVKA 4B9UA 1HUZA 5KFNA 2OIHA 1YHQS 4WIIA 3AN1A 4LC9B 1S76D 1XMQF 5J2MA 5KFAA 2KIVA 4FPRA 2YQ1A 2P6TA 2BE2A 4NJ8A 3BKFA 3JTOA 4ANCA 3H0MB 2DH7A 1NEEA 2H1YA 1SB6A 4DV3J 3WUHA 3JXUA 4ELVA 4H5WA 4DPOA 3WK4A 3RBEA 3DLBA 2VA2A 2V9WA 2EZYA 3LTOA 3TU5A 1WC5A 2XCAA 1BGXT 1S57A 3HCXA 5FLXO 3FQKA 4KQZA 4DSJA 2IM1A 4QCLA 1R8CA 4PG5A 3CTRA 1XO1A 2B4UA 4I2HA 1ZZFA 3P96A 1XJWB 2Q4TA 4CFAA 3KIOA 3AA3A 4C7YA 1N56A 3Q22A 4L6V3 1YWXA 4CM2A 3LQVA 3DEEA 3HM9A 3W63A 2LA6A 2YWEA 3PRVA 2W42A 4ZCLA 3C66A 4K4ZA 2DF4B 2E6MA 1KD1O 3O9TA 3I9ZA 5ALIA 2GBZA 3OR2B 2YWFA 1UW9A 3AVIA 4I0WA 3J7A1 4KR0B 4NCBA 1IBLJ 3V7KA 2FLNA 4M9GA 2CPDA 4KT0C 1N36K 4DR5K 5C24A 2I9SA 3U26A 3UN2A 3WC0A 1U6BA 4K0KK 4ILJA 2N4DA 4J9LA 3IAM9 1JALA 3CPEA 4LF5J 2PMHA 4LJXA 4KIAA 1KONA 3ENWA 3PZPA 4NYZA 3TW0A 1VQ9S 3L0QA 3GU3A 4OZLA 2JH1A 2CVIA 2JEJA 4OMFG 4CGHA 3AAQA 2B6AB 3I4HX 1VQ8N 3EVMA 1RUSA 4IZ9A 1N34K 2XSJA 4GLXA 1J2MA 3CUNA 3E0FA 1AQ6A 1RWXB 3HKZC 1DTTA 2O67A 2QLTA 2ZHAA 1KKHA 1PK1A 1RBLA 4B8AB 5HRSA 1VISA 2KKZA 2I38A 1PK3A 5C2GA 5F3ZA 3R6MA 2YWKA 2XY7A 3V9SA 5ADXA 2OPQA 4DV2J 2OUGA 3BEXA 1IR1A 9ICPA 2QLXA 2AJ4A 3D3CJ 3QGGA 3CMEN 4Y2VA 2F8TA 5J1PA 2W9BA 4K5RA 3V6HA 3HHLC 4JI1J 5CY4A 2GGPA 4IOBA 1DQ9A 2O8DA 4YY3K 5ETKA 3WHIA 2Q0UA 3ZFVA 1NJZA 4CK3A 2BDPA 2BPCA 3AVGA 4YHHF 4DPTA 1K9MO 4DU8A 1Z2ZA 1L7OA 4G3IA 5M1NA 2J8SA 1S0VA 1RZTA 4B02A 2A42A 5DBCA 3VENA 5DBAA 1ZM9A 1TK0A 3OFHA 4Y2AA 4F72A 4USUA 1S99A 2ZH1A 2A1AA 4BG9A 2B4JA 3NGZA 2G08A 3QT8A 2Z1JA 1S59A 2Z56B 3OL6A 3M9NB 2J6TA 2COLA 4B8CA 3WQPA 3CD0A 1JL2A 4DOBA 3NCQA 2VONA 2VASA 3KHLA 3VQSA 3K9JA 4QWBA 3I55S 3ENQA 3AJ1A 3OUYB 2AJQA 3IRWP 5AQTA 3Q8PB 4KTQA 2KP7A 1GLEG 3KKAA 5LSRA 2K89A 3VAHA 1QVFM 3QLHB 4Y6IA 2FJVA 5EX3A 2FVPA 1JXVA 4Z94A 4KHQA 1URNA 3JSYA 3HVTB 4D3GA 2QWPA 5M1KA 4HCCA 4YB7A 4PQUA 1WBBA 3DOMB 4JI8J 2FJDB 3NEKA 1KC8O 1N5VA 2RS8A 3OYDA 3A3OB 2WBRA 1K5OA 4QWAA 5A0YB 3O9UA 5KFQA 2UZAA 1P1LA 2E2OA 2ISPA 4DL0C 4WK1A 4J9RA 4WE1A 3QYYA 4DV7F 1EB0A 4M5DB 2VBXA 1XMOF 2OEKA 4XUSA 2OCEA 2YHWA 1RHKB 3L7OA 3PHTA 2R2SA 4DTNA 4IDHA 4FOEA 5HRPA 2ZJRL 1FKOB 1VLBA 2UUBK 4CYUB 1LCUA 3H8MA 2EWHA 3DLRA 2F8LA 5DM7L 2QFJA 3ZNJ1 2F4VJ 5GAHP 2A2CA 4KX3A 1HPZB 5SWMA 4X65F 3TZYA 1N6QB 3NF9A 2Y0SD 1FERA 3MOZA 5D4BA 4Y2IA 4R5PB 4YMOA 4KLEA 5AQWA 1XMQJ 3TVZA 1CEZA 3CDEA 4A8OA 1DY3A 1UKUA 2P35A 2YB4A 4F8RA 3ZTOA 4LIWA 1VS3A 4KLOA 3CJ5A 4A48A 1VDVA 3IFEA 3AY9A 3VQQA 2W25A 2BRKA 1QHTA 2O66A 1UPHA 2JVOA 3FGVA 3GWCA 3R3LA 2AP6A 4A8QA 3HKWA 4Q0BB 3L8BA 3T5LA 5IV3A 4AHUA 2PFNA 3VAKA 1EO1A 3MUTP 4GO7X 5DLFA 3FQLA 3ENBA 2FVQA 2F7TA 3H2VE 4U67L 4ZHRA 5B09A 1HIWA 3S7RA 3CFOA 3MEGB 5KT7A 1RYRA 4MLEA 4B9VA 2ATQA 3POTA 3RJFA 4HTIA 1VQNS 3PO4A 2DUYA 4YDXA 4PHDA 4FJ8A 2NYIA 4F91B 1UETA 4ZS6A 5FRNA 4EI2A 2ZTEA 2B4PA 2KKVA 3PR4A 4Y2RA 3CPWM 3DJCA 4QIFA 2YNGA 2AYGA 2UXDF 1ASUA 4M5MA 2GUPA 1BNOA 1R8HA 1Q86T 1T8EA 4ILHA 3PV8A 2PFDA 5JXSA 4DL6A 1Y10A 3UKUA 1AFIA 3QATA 2CDQA 2W7OA 3T41A 1P90A 2QX0A 1FO1A 5F8LA 2EAPA 4DQIA 4XPEA 3RMBA 3CERA 2R9LA 1C4AA 4B3MF 3VMFB 1IKVA 3IDHA 4ID1A 3SJHA 5BRDA 3UN3A 3DMJA 3IXQA 1SJQA 5IZHA 3ZX0A 3Q7BA 2MEWA 1T05A 1URRA 2WB1D 2YVSA 2XIDA 2FJXA 5AK6A 4RWWA 2L48A 4KBOA 2EK6A 4IWVA 1T7PA 8ICCA 1R0AA 2HFZA 4ZPAA 2P8IA 3NF8A 1ZD5A 5H2FU 3F41A 1A76A 2LDYA 5B0GA 1CJTA 5HQ8A 3AU2A 4CHYA 2AX1A 3MOJB 4GVEA 1CULA 1BL3A 4M47A 3Q8YA 4A8FA 3BV8A 5L8RC 1TL7B 4QBUA 3MECA 4B3SK 1R8AA 5CWRA 3AJDA 1ATSA 1C0UA 4BDZA 3OVNA 2FZGB 4PKDB 4M7XA 1GMWA 3VEXA 1G1XA 3V9XA 1PC5A 1OWXA 2K7JA 5EOYA 1I94K 5JU5A 4YHHJ 3P1GA 4RW4B 3SQGA 3SQ4A 1W7WA 2P9PB 4P2HA 4FOIA 4QZHA 3SENA 1N5XA 2OHFA 4A59A 2RJZA 5DB7A 5J0XA 1HJPA 1F2HA 4LY7A 3CVKA 4XRHA 3CM5A 3MGIA 5ALFA 1ZJMA 2JJ4D 3MDCA 1F9HA 2KM8B 2B8PA 5IWAK 3R8EA 9ICFA 1JB0C 3WK7A 3IDWA 5DQHA 1C4CA 2UUWA 1B9DA 4DCHA 4CF2A 1D9FA 3LP0A 2ZH7A 3PSPA 4AL5A 1X4HA 4KE5A 2I6WA 4ES3A 2RHSB 1Q46A 1DZ5A 2CQ1A 1UT5A 2G9OA 4U7CA 1ZQMA 1YVUA 2Y0SC 3VR1A 1T6DA 4H5RA 4UAUA 3D4JA 5FDLA 4BGAA 4MFAA 4PPXA 2NS1B 3MR3A 3DLKA 5ITHA 2KD1A 4WP3A 3DRPA 1HR0F 3L3UA 3VGTA 4FF3A 2FPKA 5GAGU 1N5YA 3LK9A 1H0HB 4J7CA 1RLDA 4K4VA 4CEZA 2E1RA 2RRNA 3QAEA 5G0RB 3IR7B 5A8RB 5KT2A 2HHHK 1FX2A 3VA3A 1WN7A 4DR1K 4USAA 3KJQB 3QO9A 5J1EA 2F9WA 4L76A 4DV7J 2ABYA 4PRFA 2WVCA 1ZQHA 5HOOA 2J9EA 1XMOJ 1Y3KA 4NA1A 3POTB 4C4SA 1KQQA 2YKNA 1RADB 5FROA 2W1BA 4DV6J 2NUBA 3U3GA 1VQ7S 2E2PA 3KWIA 3ID6A 4M9HA 5EWFA 5D3GA 3UQSA 4DG1A 3V1QA 3MK6A 2DHGA 4YOWA 3D5MA 3RJIA 3G8QA 3RTVA 3RR8A 3J7Z5 1IKYA 4X65J 5CZ1A 2B4OA 4MFFA 1NSQA 1ROFA 3DYAA 2PN6A 1HBNB 2IFXA 1WDDA 2DYAA 3LH2S 1RDUA 2MAXA 2IC3A 2XMWA 4LZDA 4O3RA 4WQ5C 4M0AA 4RL1A 2EC0A 4DFPA 3IWNC 3DMJB 1CJVA 1VGYA 4CEOA 5AIAA 4LIRA 4ED1A 2DY1A 4H5VA 4A62A 2KZ3A 5AM3A 1SB3C 2NR0A 1X42A 2BGWA 1AUSL 2QARA 4Q2LA 2VWBA 2P6SA 1MU2A 3GLJA 2IOFA 4UARA 3ILOA 3QNWB 4FPBA 3MM7B 3KLGB 3AVFA 7ICHA 1WKLA 4BY9C 4LQ3A 1N60A 5AKEA 1S1WA 4JKHA 1VQOS 3QFPA 4K2XA 3CQXA 2KYXA 4TKTA 2R2RA 1U2FA 2O3DA 3OS0A 3X1LB 3DRXA 4UQGA 2QLFB 1COOA 3GSDA 1IBLK 1NJWA 5J2DA 3JXOA 2R8KA 4F3MA 3BO2A 3LP1A 1CBKA 1HYSA 2XY8A 2UXDJ 4HDGA 3R7BB 1UPMB 1ZQ1C 3GBTA 1QQOA 3MXJA 3P49B 9ICQA 1FK9A 1I3AA 4YR2A 4O0JA 2FGOA 4R63A 2W4PA 3EMTA 4OKJA 4CD1A 5E26A 4IJNA 3KHRA 4X4QA 1O6XA 3PYEA 3SQGB 4CNZA 5A8WB 1RTDA 1X9XA 4KB1A 3QIOA 1JLAB 2KK0A 2H3QA 1IWAA 4PEOA 3CE8A 2C2KB 2KVSA 3W2VA 1NZAA 4FW1A 4B3MJ 1LWEA 1RB0A 3SBTA 4C8LA 3KNAA 1NH7A 1C1BA 3PW0A 2J6SA 2FBXA 4NLNA 2HCFA 5AQLA 1I5OB 3FZBA 4M3YA 4CEBA 5MLCQ 3TACB 3RWUA 3HO1A 2HVHA 5ETOA 2ZITA 1T9TA 8ICKA 1SGGA 1WC6A 3D3BJ 1VQKS 3F2KA 2LVWA 4WCEL 3IN5A 5F8NA 3NDKA 1QH9A 4ICLB 2PFPA 4IBNA 4O5BA 3DLKB 5K14A 1RYSA 4CJSA 2W2QP 4GVBA 2C2ZB 5BYRA 3H4DA 3MZIA 2V7YA 4C4RA 3G6VA 2HRTA 3HX0A 4RQ3A 4IQWA 1MWQA 4ZLLA 3VQDA 1WC0A 3AVHA 2ZOFA 4FLWA 2J7WA 5CR4A 4TYAA 2HAFA 2VB6A 4C98A 5CYMB 1UAWA 4NLDA 3M8ZA 1ESVA 4MIAA 3TFRA 3VCBA 4N7TA 3KD1E 3HSZA 4BRMA 5DKWA 2GJ2A 3IR5B 4RJVA 1X4DA 1WF1A 3D66A 3IA0A 3EDRB 4DPWA 4OZ3A 3A8EA 3VA0A 3NGDA 2VUGA 1HBOA 4NLYA 5A2QO 1L3TA 4A8MP 4DTSA 2KDOA 3TO8A 4AFFA 5ALOA 1S49A 5CH7B 2D3DA 4RCHA 3CCUS 1S6QB 2RDJA 3CRXA 2DNYA 4F25A 1GLCG 3ASMA 2HEKA 4US9A 2HHVA 3NH2A 3ZXWA 1L5UA 5ALUA 1NDCA 4ES2A 8ICMA 7ICMA 4JI8K 3CD6N 4P0PB 4RNHA 2R7VA 2QA4N 4BRAA 2NPIA 4B9NA 3WNHA 3VGUA 1ZQQA 4FXVA 5E3RA 4ZLJA 3PUFA 2A3JA 3KJFB 3I0SB 1HR0J 4ELUA 2FLLA 3M6WA 4BDYA 4LD0A 3M4XA 3W7BA 3RZAA 1ZQIA 2I8EA 4KHSA 5BN9A 2QYGA 3HP6A 1RWMB 1IG9A 2LM4A 2DRBA 4NO7A 4F26A 5ALTA 3K8WA 3FSYA 1MU2B 3MHYA 5J2JA 1UA1A 3G4SS 4TQSA 2NZCA 3IS9B 5CJ7A 3O5TB 2DXFA 4JV1A 2XMJA 4I27A 5ALPA 1FRKA 5AZJB 5T7BA 2JHDA 2LXIA 3K7RA 3BF1A 3I82A 2BOAA 3L2VA 3QT7A 2F4VK 3M2UA 1OW5A 4K4UA 2GAHC 4C4TA 2F4FA 3DRYA 1RT5B 3PCOB 8ICZA 4PYDA 4PQAA 3DDHA 2WBMA 3TA1A 3MMCA 4FWNA 1UWBB 3WEEA 3HJEA 4FVCA 1HNWK 1KVIA 3OYIA 2C42A 1F5AA 4FYYB 1FK9B 2OA8A 3IG1A 2RPIA 2UXCJ 3BGOP 3T5KA 5KFHA 1CXUA 5J2FA 3O6QA 2X1AA 3HF5A 2IYIA 3P6YC 3OHRA 1D8ZA 4IQXA 4PZVA 2BTFA 3KJVA 1UWAA 3WIUA 2QWLA 2FSJA 1ED1A 3J81U 4K8XA 2CG4A 1MROA 4JV5K 1RDFA 5F3XB 4ISGA 2J9DE 2JWLA 2MKCA 1FE4A 1GXTA 3DV9A 3I0RA 2BH1A 3O3HA 2M3DA 1C1BB 2CQPA 2P6RA 2DKOB 1JLBA 1ZA1B 4P7TA 2DR8A 1HWKA 5BPLA 3L95X 3MAQA 3AU6A 5M2PA 5AFUH 2GV1A 4MK7A 5B0FA 2YMQA 4FBUA 4IDKA 3M1VA 1PBUA 3ET6B 1RBVA 3ZTPA 2FF6A 4DLEA 2DCUB 2QB1A 2A6MA 4AQYF 2V4RA 2NREA 1NPKA 2IRXA 5ADZA 1JIHA 1JN3A 5K14B 2JEFA 2NXJA 2WRMA 2L9DA 2LMIA 1UCNA 2H54B 2FZKB 2LQJA 4UZBA 4FM1A 4OX7A 3TWZA 4KAZA 2HBYB 3NHGA 1G2EA 1TK5A 1ATNA 1JCFA 1CJUA 1XR5A 1Z19A 2V4JA 4Y00A 4FJLA 1X9SA 3MWBA 5AQNA 3NCRA 3GR1A 4MLHA 1A6LA 2HMIB 4M6WA 3THYA 1RDDA 1AXQA 3ZT2A 5KT3A 2ZH4A 4I2PB 3GG0A 4KGXB 4U7UD 3THWB 4F4ZA 2YCHA 5I42B 4ED6A 1RA7A 2C3MA 4PXCA 4A47A 4YOXA 3V6DA 2A3ZA 3MDAA 2P9EA 4TLRA 1E6YA 2V2VA 5AM1A 7ICJA 2P5GA 1TR0A 5GMKa 2L5YA 4F4XA 2ZQBA 1RNHA 3KOAA 1XC9A 1LK7A 2KFYA 3DXSX 5DG8A 4BHQA 4DS4A 2ZDPA 2BCVA 4EP4A 2D1CA 4PG6A 3FEXB 3M2RA 1X7VA 4MF2A 1AFJA 1EZZB 3P83D 4IRCA 4I2EA 1XNRF 3HPHA 2VBWA 3GJTB 3GU0A 3LDQA 1SKRA 2J7KA 2H5EA 4GKJF 2BCQA 3QJJA 1WG5A 3D6FB 4HHHA 1NM2A 3DLLQ 3FMWA 2KL8A 1BI4B 4RQ6A 4DTUA 1RWOB 2V2KA 3OJUA 3GONA 3RF9A 2F44A 4DTXA 2MPUA 3SBGA 4A8YA 3QGHA 3SFUA 1BPYA 2ZDOA 5DGAA 3CG7A 3D45A 4USHA 2AW0A 5J0OA 4ZK7M 1U6FA 2CPZA 1FFUA 4QOTA 1K44A 1YJNS 2EFOA 3THTA 2QL5B 2YX4A 4OKEA 3IM8A 1EQYA 3TSPA 2J8AA 3DOLA 2A1JB 2P9KA 4J91A 2W6LA 1X6JA 1RBAA 3MMCB 1HBMB 4AM6A 4RPFA 4OX9F 1QQCA 2MZ1A 3EE9A 5FPDA 4CLLA 1FDNA 2RKIA 2OPRB 1MSWD 2X6SA 4M3WA 1X9WA 1D8BA 1Y0HA 2NXUA 5BRFA 3MBYA 3TAPA 4IKAA 2DNPA 1QS4A 1HNIB 3MEEB 3CMQA 3GZ7A 4F02A 2GCFA 3M32A 2RDDA 5B0AA 2KVIA 1T3VA 3VGLA 1WSFA 4UUWA 4XTTA 3K5LA 1GH8A 3NH1A 4UAWA 2Q6CA 2H9ZA 1CG2A 4JEPA 4B3RF 3WQUA 4QJFB 2QI2A 2RILA 4O5CA 5L46A 3J81Y 4DV7K 3HFVA 3L2QA 3Q8LA 1XMOK 1GMWD 3TABA 3CDBA 2BHNA 4YD2A 2E1FA 1WC3A 1Q18A 4H5TA 3O1LA 3JAMO 3MPDA 1XUPO 1HNXF 1SJ3P 4DV6K 2BUPA 1NH8A 2DBYA 4WTYA 2GW8A 1VBYA 1WBDA 4E98A 5KFLA 4J9QA 3F2CA 1U49A 3VF6A 1M5VC 4B08A 1IBMF 4AM7A 2WMMA 2K3KA 3CEDA 4GXIA 3PIPL 5AI0A 4X65K 1R8BA 4OHXA 2ZIVB 1T3NA 4B3OA 3G6EN 4KO0B 2KM8C 2DT9A 3R5AA 4KYZA 2D3O1 1VQ5S 1KS2A 1RAEB 4DV0F 3OA9A 2Z1GA 2W11A 3PX6A 2P9NB 4J37A 4CJWA 2FD2A 2LEBA 2Y0BB 1QHAA 1R43A 2B3TB 2IA6A 3L4QA 4YXJA 2L9WA 4EIAA 1YZ6A 3SQ2A 3LOUA 4PZNA 2VG6A 5A6PA 1UFKA 1VFJA 4DBQA 4P72A 1C0MA 3P5BP 2R3VA 1KQSM 2VIHA 3WKEA 1ZAVA 3MX2A 3M6KA 4O0IA 9ICNA 2PY5A 1BHLA 4KHWA 1X6IA 2OPSA 1S5LU 5ALHA 3C5FA 3Q83A 2WF8A 1NKCA 2DH8A 4JI5F 2NRTA 4OJLA 2OHDA 2LMRA 5KQDA 1R3NA 3PW4A 3L3FX 2HIQA 1FRIA 2AF6A 1ZQCA 4HL9A 2WK4A 3EICA 4KLFA 2YPYA 3BSCA 5C15A 2B21A 4DF8A 3EZ5A 1PJ5A 5BXIA 3O1WA 1WDTA 1CRXA 2KFZA 3CCEN 2DNNA 2CDRB 1ZPWX 3TJ9A 3BKUA 4CF1A 1Z4UA 2E5LF 2ZJAA 4AQYJ 4O55A 3MABA 1BPBA 4NLUA 3KDOA 5LMNF 1NDLA 2G8KA 4FVMA 4JK8A 3NF7A 2UXDK 3I9V9 2KT3A 3RUBL 2DNMA 3A8YA 1S1UA 1EX4A 1AT1B 2O8EA 1M5PC 1Q81T 2MLZA 3OTDA 4NLSA 1B0VA 3SEIA 7ICGA 1CS4B 1X5OA 1B0TA 8ICBA 2F9DA 3R3TA 3KMSA 2OPPB 2A18A 2XBPA 1WOPA 3UN5A 2MTLA 3H5XA 4I2QB 3FLCO 2X78A 5AXKA 2JZBA 5BRHA 1MN9A 3A5LC 4JP8A 3MN6A 1BPXA 1XR6A 5GADP 3SLCA 4GVMA 1BQNA 1YDLA 5KL8B 5L9NA 4M9LA 1QJHA 3N5BA 2V51B 1V9PA 2G09A 1M0SA 1QSSA 1MG7A 2HK3A 4V19X 1OH7A 3DKDA 2B5JB 3DOLB 3SQIA 2ETJA 1YHQN 3ENAA 5JVHQ 2Y9HA 1UW4A 4DX7A 3W3DA 4LVSA 2DEIA 1GOCA 2WAQF 3V9UA 1S8OA 2OP5A 3GFYA 4M8LA 5EU7A 2GWSA 3RJJA 3ITHB 2OD4A 3DXKB 4FWMA 2VV5A 5KOXA 1KAXA 2KTQA 2CZ4A 2Y8YA 2PFUA 4ZVRB 3ZT4A 3M9OB 3M32B 5K8PA 2YB1A 3C46A 1XNRJ 4U95A 5AQYA 2B8QA 3PMLA 1AW0A 3D0PA 4GKJJ 3HHEA 4WU2A 4AUKA 3AGKA 3TRGA 2WONB 1UT8A 4O3QA 4AXJA 1FKPB 1PJ6A 3HKZF 5HANA 4GV6A 3CNHA 4IFYA 4KPCA 4P52A 1KR4A 8ICAA 1RCXB 5H1SV 3MMBB 4DCJB 1YJRA 5EWEA 1PYSB 3AFGA 5BR8F 2GO8A 2J9DA 5B7WA 5KG1A 5B0CA 2Z4PA 4B17A 1ZAWA 3Q8QB 3PKYA 4RNNA 3QUBA 1Y5IB 2XMVA 2NXCA 3GDXA 1KHVA 2MKIA 4LF6K 1KOHA 5DS7A 4OLBA 4IYQA 3HX9A 5FD1A 4X66K 4GW6A 3MM8B 4KHRA 3QUTA 4OX9J 2KJWA 2IVYA 2AH5A 5D77A 3OY9A 4CTAB 1RWWB 1OY9A 5IFMA 3HWTA 3W62A 1J5OA 4CNQA 3HT0A 5BN8A 3CIZA 1PYOB 4X84A 1RT6A 1U02A 1YT3A 3MM9A 2XYGB 3C28A 3EE3A 1C2PA 3CHWA 3DXMA 5K8OA 2KHDA 2XO7A 1ZJNA 3AOAA 4ED3A 3VQBA 3AO1A 1TVRB 3UCZP 2CJ9A 1ZM4A 3CJ9A 4GMJB 4ED2A 3OYAA 3SEOA 2GJIA 1RHMB 4WK3A 2HIYA 3PIOL 4X64F 3DHXA 4GV3A 1FHTA 8ICEA 2CPFA 1IBKK 1YITN 1K0VA 3H0PA 3HRDD 2ZHBA 1XSNA 1ZM3A 3IRXA 2ZE2B 3MFIA 1YSJA 2XYPB 1UOCA 2OJ3A 3D1QA 5DM6L 2I5JB 1SIZA 4URGA 1GOBA 2I7NA 2VA8A 4M94A 1S0NA 2EWSA 3E9PA 3SUOA 2O8BA 1P27B 8ICFA 1JLFA 4J9VA 1IR0A 1IBMJ 4FWQA 1E4FT 5D0HA 1TKDA 4RW8B 1HYZA 3DDIA 3B54A 4YORA 2UXCK 5C7PA 2CXYA 3RJHA 1EP4A 2GQCA 2QTDA 1ZD2P 5IT9U 2ASDA 1D09B 4DV0J 5J2CA 4NLXA 4Y1CA 4CH7A 8ICSA 2GO9A 2QA2A 2G06A 2LKZA 5HO4A 2X7IA 2HBJA 1BC6A 1NGFA 4WJ3B 1NGHA 3CT9A 2NRVA 3MAAA 4OL8A 1B43A 4ZH4A 4HVJA 3IBPA 2XGPA 4M2YA 1H7WA 1NNEA 2MZJA 4E7JA 2DIUA 2I5HA 4OZNA 3T5HA 2HMXA 1OPIA 3ZZZA 3RJGA 2IYGA 4C3MA 3VEWA 4DQQA 3DDKA 3EGWB 4EZ9A 1XHZA 3VAGA 3EWGA 1VQYA 4M9NA 5B5EU 3JPTA 3GJRB 1BQXA 1VSJA 4KRWA 1NJYA 4I29A 4DN9A 3QJLA 5HMZA 5F8JA 5KFOA 1ZQDA 1WOSA 3C16B 4UOCA 4WFXA 4P4MA 1TL5A 3V1OA 2AJ1A 2GJFA 5AT1B 1BA0A 2E5LJ 1ZBLA 1YTAA 3TEHB 4FYXB 2QM1A 5LMNJ 3C6TB 1JWWA 3PIOQ 3JYTB 1QZ6A 4HUFA 3OYLA 2BQRA 1DEJA 2LQ9A 4LFCJ 4M5GA 3KVGA 3O3FA 4EAHD 2CRXA 3UD4P 3O0FA 4C0OC 4XK8C 1L6NA 3HVWA 1F21A 2PFFB 1DJ0A 3FZHA 4JKAA 2BBEA 2WSFC 5HQLA 4FL9A 1V9OA 4U8YA 4CEAA 3NGRA 4JK7A 4OHZA 4JI3F 2JH3A 4ICAA 4FJKA 4J2EA 2FB0A 3CJ2A 1EKSA 1B4FA 2HNYA 1Z05A 3OL7A 2ALYB 3Q24A 5E41A 3C29A 4QR0A 3FJ2A 4PL7A 1MNEA 4DWIA 1ZBIA 4PHEA 3H25A 3KLHA 4YB5A 1VI7A 5M2UA 5C42A 3LDOA 1YZ7A 2VWJA 2DNHA 3CDWA 1GMVA 1WHYA 2GMLA 3E3XA 4HUEA 3RBDA 3RR7A 3RMDA 2W04A 4ZVSB 1KEKA 2QW9A 1LAVA 3FRYA 3DXMB 3JPPA 2YWWA 1IH7A 1FF2A 1XN9A 2DGUA 4FXDA 2LQ5A 3DLEB 5AFUA 4DTJA 4BVPA 2Z2ZA 3R5CA 3GV5B 4NCGA 5D78A 2R7OA 3EXYA 2K4EA 3ZEUA 2DXEA 2YQ3A 5I3UB 3BKTA 3G87A 4DOZA 3KMQA 2NO4A 5KQ8A 1UFWA 4F71A 1X2IA 4WFNQ 3R1XA 3LDLA 4Y2PA 1BWEA 4RW6B 1NKBA 1WSGA 3QUCA 1VDHA 3ADAC 4CFDA 3E2EA 5BR8J 4CJ5A 1RWPB 8ICXA 2O8FA 3LWMA 3MXIA 3M8PB 1F3FA 2DK2A 1H2TZ 4QS9A 1JCGA 3T9NA 4FCYA 3GP9A 4EBEA 2EK1A 1ZOTA 1EP4B 3ZZRA 3QSYB 4I2GA 3G96A 2FJWA 2HSZA 3GFZA 2L41A 1RXWA 2XI2A 2ROEA 4WQ4A 4EELA 4M3RA 3SMZA 2R2UA 3QMLA 3C14A 2JH7A 4ZOSA 2NRRA 5IT9Y 1JXEA 3AVNA 4BRIA 2G8WA 3H7IA 1HBUB 5T14A 3L2UA 1ZQZA 1C6VA 4ZLNA 2G5HB 3GTYX 1LKYA 1K6YA 3MGVA 1S9EB 2KT5A 5B66U 4B1XB 2WF5A 1WJ9A 4KLIA 2W9CB 4KBIA 2YQEA 5HMWA 5IM0B 1SIWB 3MDQA 5E5NA 3L09A 4LFAF 4YFKA 3L3CA 8ICWA 4NXMK 2KMDA 5ALQA 4X64J 4HAIA 3BS7A 1IG6A 1T9VA 2P9LA 1WTFA 1QAIA 5HL7L 2VICA 2EDUA 2F1HA 2D3ZA 1TKZB 2OD6A 2PI4A 1RTJA 3HP9A 4F36A 3DLJA 4MKVA 3E58A 2DNKA 1GEHA 3PFOA 1WF2A 4CO1A 2JLFA 5GAGI 1XWLA 4OJPA 4FM2A 4FJ9A 2DR6A 2K8BB 4A5AA 2KSOB