1NK6A

Cytosine-cytosine mismatch at the polymerase active site
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk6A01
4K8XA 1JLCA 3RJIA 4DF4A 4UAWA 2PFOA 4KLUA 3AVLA 4R65A 4N76A 4EBCA 3PR5B 4J2AA 3QNNA 1UOCA 4PPXA 2PFNA 1WNSA 3PNCA 2R7YA 5BOLA 3RB3A 2I5JA 2A1JB 3MGIA 3WNHA 1RT3A 4FM0A 3RJFA 2G8VA 2R8HA 3A2FA 5HROA 3NDKA 4CF2A 4YMMA 1SUQA 5KG5A 5J2CA 2XGQA 2VA2A 5KT2A 5HBMA 5J2MA 3LDAA 3QE9Y 1RXVA 8ICEA 3RB6A 4QZDA 2WTFA 1SL1A 4W5OA 3KLFA 2OA8A 3AA4A 1REVA 3DRRA 5KFRA 1D8LA 4J2BA 4RQ6A 3LANA 3OYLA 3DRPA 3HPOA 3OHAA 2Y1JA 4I2PA 3QEXA 9ICQA 4E3SA 3RWUA 4PHEA 1J9AA 3SJJA 3GILA 2ZD1A 3LK9A 1PZNA 4CEEA 2HB5A 3S3NA 5HRRA 3SV4A 3AVCA 5KFWA 3FFIA 4BE1A 1QQCA 4M3TA 1T8EA 4FW1A 3PO4A 4QZAA 1EX4A 3H7IA 3QLHA 1LWFA 3DM2A 4M3XA 7ICJA 3HWTA 5KG1A 4R8UA 4TUSA 3C23A 4ZTFA 4M42A 3KLHA 3MGHA 1RT2A 5DDMA 5IIMA 1TVAA 1KVAA 1JX4A 4CIGA 1D9DA 2BGGA 4K4HA 3IAYA 4ZTJA 4C8LA 4M9NA 7ICEA 3V9UA 5IIIA 3ZCMA 3KK1A 3NTUA 3VQQA 1NKCA 3LDSA 3NGZA 3SNNA 4XA5A 1ZQRA 4Q8FA 3ISBA 1NOZA 2BE2A 1Y97A 3GV8B 4JV2A 5CYMA 3AUOA 4F8RA 3JPOA 4F5QA 4CJSA 3PW0A 3OS2A 1U48A 1CXUA 4QW8A 3EZ5A 1SKWA 4N56A 2G8HA 1KLMA 1SL2A 1FKPA 4FLUA 3SYZA 5J2QA 4N41A 2NRTA 5FRNA 4KI4A 3V6HA 3SCXA 1XHZA 1RBSA 3MXMA 3TR8A 4QCLA 4FJMA 3BQ0A 4NCBA 1RT7A 5KFEA 5KFYA 3L8BA 4PHPA 4DSFA 3VQ4A 9ICMA 4RQ1A 3V9ZA 2W9CB 4QWCA 3MEDA 2HMIA 4CGHA 4DMNA 4ED2A 2FLLA 1SV5A 3NHGA 3GV7B 3QEVA 2I9GA 3S9HA 3HPHA 3V81A 1ZQSA 1D9FA 7ICFA 3V72A 3ZSQA 1NJZA 4CGIA 3KLGA 3BJYA 4Y1DA 3MDAA 2FBYA 3TAQA 1JKHA 3OYGA 2X74A 4IBNA 2A1JA 1BPZA 3HX0A 2AGOA 1VSKA 4FLXA 1HYZA 4DQQA 4Z4GA 1O1WA 4X5VA 4ED3A 3F9KA 4QW9A 3C5GA 4CJ5A 3M8SA 4P2HA 1C7YA 3HW8A 1KVBA 4FLYA 4E0DA 1ZQZA 3LP0A 4TQSA 5CB1A 3HPGA 4B08A 4FZXC 1WN7A 2IHNA 2XY7A 3PR4A 2X6SA 3K2PA 4I2DA 4FK2A 2W8KA 4FJIA 4O5BA 1NKBA 4E89A 4IQVA 3RH5A 5J2KA 4RQ8A 3HP6A 5BPCA 3P5JA 1K6YA 1WSGA 3EW9A 2Q3SA 1ZQHA 5DB8A 3NF6A 4CEQA 2D0BA 2IAJA 5DBCA 3AVAA 1RTJA 5L1LA 4UB2A 4FLZA 5CWRA 3M9NB 4TURA 5J1EA 5HP4A 3V7JA 4CHNA 7ICLA 2A1RA 4KLFA 5KFOA 4F2RA 3QZ7A 8ICWA 2G8FA 3PW5A 2RN2A 4QZ8A 3RJHA 4DS5A 2ITGA 1J5OA 3OYCA 1ZQUA 7ICRA 3KD5E 4FLWA 3O4NA 4QZ9A 2PYJA 1S6PA 5J0WA 4OPJA 4DU3A 4DOAA 4M9LA 4Z4IA 1W9HA 2W9BB 4ID1A 3M9MB 3GFKB 2W9MA 3MABA 3ZT1A 5KT3A 4K8ZA 1TFRA 4RPXA 3T5KA 7ICKA 2FBVA 2PFQA 4DS4A 4R63A 3RB4A 4QWBA 3MEEA 3VA3A 3RMBA 3DLBA 3VQ5A 1C1BA 3TFSA 4DU4A 4FJNA 3GIIA 3L2UA 1JXLA 4MFCA 3OYKA 1YT3A 3K75D 3OYIA 3QIOA 3HJFA 2HNYA 3G6YA 9ICFA 2IC3A 4Y1CA 3G6VA 4CEAA 3H8SA 4KB0A 3ZDCA 4KLOA 2MAXA 5EU7A 1RILA 4KHNA 2IBKA 3AVNA 3PX6A 3JPNA 1IKXA 4M0AA 3QEWA 5KG2A 5J0UA 1ZQXA 1I39A 2ASJA 1K1QA 3LPUA 4RW4A 4BDPA 1RTDA 4DG1A 4RNNA 5KFKA 4MQ3A 4PH5A 4C8NA 4J9LA 2OPPA 4F3OA 4RQ5A 3MFIA 1QE1A 1XHXA 3BQ1A 1TK8A 4O5KA 3KLEA 4Q8EA 5TZVA 3UPQA 5IINA 4O0IA 8ICZA 3SPZA 3RJKA 4YP3A 3SI6A 3MR3A 1S1UA 3V7LA 1GOAA 1JXEA 3QESA 4O44A 9ICGA 1LV5A 5DQIA 4CJRA 5J0XA 1HNIA 1ZBIA 3UXNA 2BQRA 2XY6A 3AVHA 3H40A 1QLNA 4ECRA 1S9EA 4KTWA 3V9XA 4BXOB 4LY7A 5CZ1A 4RQ3A 3L3UA 5J0QA 2ALZA 2XRIA 4O3PA 9ICRA 4KLEA 4J9KA 2Y1IA 1CZBA 3D0PA 8ICIA 2DFFA 3OVNA 4YD2A 4RT3A 4OJRA 4CK2A 3OY9A 3MEGA 4KHWA 3T5LA 1XSPA 8ICNA 2HHTA 1TKDA 3AO2A 4DSIA 5C24A 4NY8A 1EETA 2A1SA 9ICNA 1XSLA 2ZUBA 4KAZA 3IRXA 3JPTA 2DTUA 4CECA 3AVBA 3C2KA 2W9AA 5KFUA 1VSLA 4M3RA 4CJ4A 1AROP 5J0PA 1S0VA 4F5NA 2JLEA 4AHRA 1XSNA 4CEDA 3H8WA 3PW4A 2DFLA 4CGDA 5IIJA 4DO9A 1HQUA 4RUAA 2HHQA 3S3OA 3MR6A 2AU0A 1UA0A 1ZQFA 4KLLA 4MFBA 5KG4A 5KFFA 3QEPA 1HMVA 4IG3A 4J9QA 3AO5A 4MEXA 3ZDDA 2OZSA 4I2QA 3KKSA 1U04A 3PMNA 5C42A 4Z6EA 5EWFA 3OYHA 2P66A 8ICJA 1XS9D 4FZZA 2W9BA 5DKWA 3ZDBA 4M3YA 1L3UA 4W5NA 3UXPA 3SQ1A 4B8AB 1ASUA 3NH2A 4MF2A 3RJGA 4Q5VA 2G8KA 4QZBA 3AA5X 4DFMA 8ICYA 3C94A 2B5JA 1RT5A 2YHAA 4E7JA 4E7LA 1TL1A 1C0MA 1ZQKA 3JPRA 8ICHA 1LB2B 1S0NA 4NCAA 3DOKA 5HMMA 4F4XA 5HHHA 1DTTA 4ZH4A 4TQRA 7ICTA 3TANA 3HO1A 4FS2A 3VQ9A 4W5QA 2XY8A 1RTIA 3VQAA 1L3VA 4JRQA 5DB7A 3GIKA 1TV9A 2P6RA 4Z4HA 2QKBA 1ZQTA 4EZ9A 3U3YA 4QWAA 1SKRA 4FW2A 2ZJ5A 3KHHA 2YNGA 2DFEA 1T05A 3MR5A 4DWIA 3SUPA 4Q0BA 1LAWA 1JLEA 1N5YA 5D3GA 1KVCA 2BPFA 4FXDA 4ECUA 2F1HA 1WAJA 1LWCA 4EP5A 3OSNA 4DQIA 1HJRA 1S0MA 2RKIA 2F8TA 4TUQA 3ZSRA 4OKJA 5IIOA 4DL2A 4KLGA 4DOCA 4DEZA 2IMWP 1EXQA 1UA1A 3K5LA 4ECVA 4YFKA 2IHMA 3ISDA 3HM9A 4YVZA 2H5XA 1GOBA 4NYFA 3OGUA 4DTRA 4YR2A 2LYHA 4M04A 3IHQB 4DSLA 1VSMA 3AVGA 4PHAA 5J2PA 4DTOA 2AQ0A 1VRTA 3WNFA 1ZQCA 5J2IA 2F96A 4BXOA 3HL8A 5KFMA 4CHQA 4EEYA 3CM5A 3SUQA 2QKKA 3V9SA 1ZJNA 2BQ3A 5J0RA 3CFPA 2HHVA 4KLMA 4QAGA 1W0HA 3P83D 4IFVA 1BQMA 3LAMA 4FS1A 4B8CA 5J2BA 5DGBA 1TKXA 3NFAA 2BCSA 3GIJA 2D0AA 5KRSA 4PA1A 4JS5A 1NOYA 1EP4A 8ICVA 4M3WA 1TL3A 3CM6A 5BOMA 1BPXA 4B9TA 4Z6DA 1ZJMA 4O0JA 4OKKA 2ASLA 2BR0A 4CK3A 3I0RA 2BPGA 5IILA 3ZSZA 3NCIA 2LSNA 4DTNA 1ZBLA 2KZMA 7ICUA 4M9HA 1VSHA 5CJ7A 3RH4A 3AVJA 4FJ5A 2WOMA 3RRHA 2R8IA 4AHCA 4Z4CA 4EBEA 3DLKA 1TK0A 4HCCA 4O3NA 3T1AA 1MC8A 3BGRA 1RBVA 5L1IA 4HYKA 1NJWA 1ZQMA 1NOMA 5J29A 5KFSA 1VSFA 4ECWA 4CJTA 4BDZA 1NKEA 1TGOA 8ICPA 4ECYA 1X9WA 2FMQA 4CERA 9ICAA 1EKEA 3QETA 4E1MA 3NBPA 1Q9YA 4J9MA 1ZQQA 5DGAA 1HNVA 1RDBA 5EOZA 2ISPA 3OYJA 2RF2A 1ZQEA 2FMSA 4IRCA 3B6PA 1D5AA 2DFHA 2XHBA 2RDIA 1RDDA 2OPRA 2VA3A 2VA8A 3B0YA 4DTPA 3OJUA 1VSEA 3ZD9A 1TAUA 4H8KA 3EY1A 3TAEA 1YTUA 1B22A 1JN3A 1ZBUA 4JV0A 1Z3EB 4BACA 4IR1A 4EP4A 3LP2A 4M9JA 4KLSA 1RXWA 4W5RA 3OYBA 3V1OA 1HYVA 4YCXA 4XIUA 2ETJA 3RRGA 7ICIA 1ZQAA 3T5HA 4UB5A 2ZTCA 1BPEA 4KLDA 4F4ZA 4PHDA 4OKEA 4HCBA 4OLAA 1YTAA 2JEFA 9ICXA 2HHSA 3EWAA 4LD0A 3K59A 1L3SA 3SI8A 5CR0A 3MFHA 4IQUA 5KT4A 4C8OA 4E1NA 4PUOA 8ICLA 1ZBHA 3PMLA 4CF8A 4QZIA 4CFAA 1CXQA 1NK9A 2E6MA 4F5PA 3VN5A 7ICQA 2I1QA 2IOCA 4L8RB 1F21A 2PI5A 4CJEA 2X6NA 5J0SA 5KG0A 3C1YA 5DK5A 5DQGA 3H4DA 4HTUA 4RU9A 4I2IA 3QO9A 2BCUA 2EX3A 2Z1GA 4F93B 3Q8KA 2J6UA 3D45A 3FDSA 4J9PA 3K5MA 5JS2A 5CYQA 4TUPA 1N6QA 1X9MA 4YQWA 1SL0A 2DPIA 4RQ2A 4N47A 3TWHA 3IG1A 4OGCA 4CFBA 4M6WB 2FLNA 2YNFA 4DTMA 4B3OA 4ZHRA 4IR9A 4CJUA 4R5PA 4M41A 4CK1A 2NRWA 1SZPA 1BGXT 1KFSA 5KFCA 4IQWA 4CHYA 4I2FA 3DLGA 3WNGA 1N48A 1COOA 1MQ3A 3L3VA 3PX4A 1RT1A 1D8YA 3GV5B 8ICUA 1QSYA 4CGJA 5FRMA 4FLTA 1KFDA 3DLHA 5SWMA 2KZZA 5F9NA 3DOLA 1Z00B 8ICBA 1JLAA 3GDXA 4F4KA 2J6SA 5L9XA 3NAEA 4NYNA 1U47A 3ISNC 4GXIA 4IKFA 3NF9A 1C0UA 3ZSXA 1NK7A 3RAQA 4RUCA 4I27A 1U9LA 4KV8A 1B9DA 7ICMA 5KRTA 4Q45A 3KJVA 2NRXA 2ZJAA 1JL1A 1DOQA 3K57A 3MR2A 3K4GA 3KD1E 1UT8A 3FYHA 4FJ7A 4IRKA 2PZSA 3RJJA 4QZFA 3NF8A 2Z1HA 5KI6A 4CJKA 5J2NA 1NJXA 3RBEA 1A77A 1TKTA 1S77D 4B9NA 2KTQA 4FK0A 4JWNA 3C95A 5J2DA 4G1QA 3BQ2A 3LPTA 5KFDA 5KFNA 3O3GA 3M9OB 9ICIA 4R66A 4CF1A 8ICAA 4KITB 4ECSA 3U6FA 5KG7A 2C2RA 1Q8IA 1ZQGA 1RCHA 2R8GA 5KFXA 1BISA 4I9LA 4M9GA 1V9PA 2HHWA 3RMCA 4FJXA 2ZE2A 1JMSA 3KHLA 3OSPA 2W9CA 3E01A 2GUIA 3OS1A 1CZ9A 3RTVA 1HJPA 2XC9A 3THVA 1RTHA 3DLRA 4Z6FA 4LH4A 4CHPA 4F3TA 2RPIA 4JK1A 4HUFA 4F91B 4RW6A 2KW4A 3SQ4A 2V4QA 1RYRA 1IH7A 3VQ8A 5DBBA 3VA0A 1MQ2A 1JLFA 2B6AA 4TSXA 2ZQBA 2NRVA 4YD1A 3RMDA 4EYHB 4CHZA 4IG0A 3SUOA 5J0TA 4NLKA 4DL3A 1ZETA 4CF9A 4JWMA 7ICPA 9ICVA 4I2CA 2YV0X 4FJKA 1JL2A 5KFJA 4MFAA 4YR0A 4M6WA 2V4RA 3EYZA 4ICLA 1LWEA 4AH9A 4ELTA 4KHQA 4XRHA 4YN4A 5KFPA 3O3HA 3C6UA 2R8JA 2O4IA 3OJSA 4B9LA 4LZDA 4FJHA 1HYSA 4DTUA 8ICFA 2HNDA 4CJVA 3SQ2A 4O55A 4I2AA 3G10A 2EHGA 3DLEA 4XQ8A 4Z0UA 1WSJA 1ASVA 2B4JA 4QZEA 1S6QA 3UXOA 4UAZA 3HYFA 3LZJA 3HP9A 3QEIA 4DSKA 2BKEA 4NCGA 4ED7A 3ZSVA 2YNHA 3JPSA 1JIHA 1RBUA 4DTJA 1BPYA 1Z00A 2FPKA 9ICCA 4F4YA 2OPSA 3KIOA 1Z26A 2UVRA 4I29A 1TVRA 3KLIA 1RYSA 5KFZA 1WLJA 4KFBA 1BPBA 2P51A 4DTSA 3AV9A 3VQDA 4FM2A 4IRDA 3MECA 1I3AA 4CFDA 3RR8A 1KSPA 3M8PA 1NK8A 2DY4A 4PGYA 5CHGA 2VWJA 3TAFA 2NRZA 1BPDA 1WSFA 2BCVA 4DFJA 4AHSA 1U45A 2M9NA 2KFZA 4RZRA 1T4GA 5KGWA 9ICTA 3ZSOA 4NLGA 7ICSA 5FROA 4I9QA 4KRFA 1B43A 1ZQLA 4ECXA 5KG3A 4UB3A 7ICOA 1HUZA 3Q8LA 4FZYA 4O5CA 4UAYA 1HUOA 3RAXA 3K5NA 3BDPA 4RPZA 5KFVA 4I2EA 2XO7A 2FMPA 3JPQA 2BCRA 3RBDA 3NE6A 1IXRA 4IDKA 4R8UB 3TAPA 4FJLA 3S3MA 1L5UA 4JLHA 2BQUA 2AQ4A 3PO5A 3V4IA 9ICLA 1Q9XA 4IFYA 3RR7A 3LWLA 3AU2A 3LP3A 4KTZA 1X2IA 4CEBA 4DTXA 2XCPA 3OHBA 4DQSA 4FJ9A 3KHRA 3Q8PB 3DI6A 4BE0A 5T7BA 4B9VA 3AO4A 1BL3A 1S1WA 3NF7A 2JZBB 5CP2A 3MBYA 5KFTA 3U3GA 1GOCA 4F5OA 5DG9A 1KEJA 3OS0A 2D5RA 1ASWA 1S1TA 1UAXA 3ZDEA 1MU2A 3OYFA 2AJQA 3LP1A 2P6UA 1HRHA 3ZSWA 3MAQA 4QOZB 1T7PA 4R64A 8ICKA 5E41A 5K14A 4DSEA 4AHTA 3CG7A 2VG7A 3K58A 4QZCA 4GXKA 5C25A 5J2AA 2BDPA 4CE9A 4QZHA 5HHIA 3Q8QB 1YVUA 4ED1A 2OZMA 2VANA 4FLVA 4KTQA 4P4MA 3LWMA 3JYTA 2BPCA 3RH6A 3VQCA 8ICGA 4YR3A 4KLTA 3C2MA 1QSSA 1N56A 3ZSYA 4PY5A 3TARA 7ICGA 2BHNA 3L2RA 9ICUA 4B9UA 4JUZA 4KLIA 2XGPA 4M47A 1A5WA 4O3OA 3LAKA 5IIKA 3N4MB 4EZ6A 1IG9A 4FJ8A 4AHVA 4CIFA 1A5XA 4P4PA 1QS4A 3GQCA 1KFTA 1LAVA 4RT2A 1ZQDA 4CGFA 4LH5A 4CJLA 4RQ7A 5HMLA 5CA7A 1XC9A 1DTQA 4KI6A 8ICXA 7ICVA 2OPQA 2B21A 5HP1A 3T19A 4YNQA 2F8SA 2YNIA 4CJPA 4YMNA 4YMOA 5KFIA 3AU6A 4Z4EA 4UQGA 3ZT2A 1FK9A 4RG8A 2UVWA 3F73A 3ITHA 1C1CA 3ZT0A 2R8KA 1KRPA 2PXIA 1K1SA 4CEZA 4DLGA 1IM4A 4IQTA 3VQBA 2C2EA 8ICMA 3L2WA 1FXXA 3H08A 5C5JA 5DG7A 1VSJA 1ZQYA 4O3QA 4J9SA 3AO1A 3BQTA 1IO2A 4CJWA 1MSWD 1T03A 5SZTA 2ISOA 4B9SA 2HHXA 5J2HA 5I3UA 4I7FA 3ETLA 4HUEA 2PYLA 4DQRA 3RB0A 3PW2A 1TAQA 2ZJ8A 5CY4A 1HQEA 3I0SA 2W8LA 4RQ4A 1QTMA 3QEAZ 1ZQNA 4E7KA 5DLGA 3V6KA 4RW9A 4Z4FA 1X9SA 3OYAA 4KKOA 1BIZA 4GMJB 4CF0A 1TKZA 2AGQA 4O3RA 4CJFA 4C8KA 4RW7A 1A76A 4FK4A 3L2VA 2P5OA 2RDJA 2ZUDA 2WONA 1T3NA 2IS3A 1S1XA 4NLNA 2D0CA 2G8IA 3O4QA 2JZBA 4H4OA 1ZQVA 4OLBA 4I2GA 9ICBA 4UB4A 2P1JA 3VQPA 2OWOA 4UBCA 2PFPA 2BANA 1H38A 3ULDA 2HVHA 4GW6A 3HVTA 2J6TA 3L2QA 2FC0A 3TABA 4QZGA 2KN7A 3JPPA 3SZ2A 4J2DA 1UT5A 3AVMA 1ITGA 4DLEA 1ZYQA 3V7KA 3RJEA 1S1VA 3C1ZA 4EBDA 3ALYA 2ZTEA 4DL6A 5CZ2A 3I8DA 3G6XA 5KT5A 4DFKA 2Q0ZX 1NK5A 4FBUA 1BI4B 4YG2A 4J9OA 3ASMA 3HT3A 3K5OA 1B92A 5J2FA 4BGDA 3UIQA 4LSLA 2MUTB 1RPLA 1RBTA 4M3ZA 4HHTA 3KK3A 5J2GA 3AVIA 1NK0A 4CGGA 3TI0A 4CHOA 4DOBA 2Z1IA 3MXIA 5HLFA 4F50A 3EPIA 1JXBA 4C8MA 5KTQA 2ASDA 1BVSA 2HHUA 3AA3A 4AHUA 5DDYA 2NUBA 7ICNA 2FPMA 1VSDA 4BWMA 2P5GA 4ECZA 3SV3A 3CYMA 4UB1A 8ICCA 4CJQA 3H4BA 4G3IA 9ICPA 4NM2A 1CEZA 4KLQA 2QXFA 1SKSA 3DRSA 3NH0A 3OYDA 1XU4A 1S5JA 2HVIA 2KZ3A 1QHTA 2YKNA 3CQ8A 3V1RA 2HW3A 1DGSA 3UQ2A 1G15A 4MFFA 4LSNA 3HVRA 2UVVA 4KN4A 3T3FA 1VK0A 3HXMA 1RZTA 4PGXA 5KGXA 3V9WA 1J53A 3VQ7A 5KFHA 4CEFA 2V9WA 3HSTB 5KFGA 1XWLA 2OYQA 2ZUCA 3B0XA 1JLQA 2G8WA 2YKMA 5D49A 1KCFA 5FDLA 2XCAA 3V6JA 4LZGA 2GBZA 4J9RA 4GLXA 5D4BA 4DFPA 1LW2A 2GV9A 3NGIA 5KG6A 4O3SA 3ZDAA 4E7HA 4XUSA 7ICHA 3ISCA 1WCLA 1FKOA 3Q8MA 4ELUA 4F4WA 4KHSA 3E2EA 3TFRA 4BDYA 4KN7A 4Q43A 1RT4A 5L1JA 4DL5A 4JS4A 4FBTA 2W42A 4FM1A 2ATLA 4JRPA 3QZ8A 1WSIA 3NGYA 5DMRA 3TQ1A 3QEBZ 3SPYA 3ZT4A 4CESA 3OYMA 4RQ0A 4DL4A 1S10A 3AVFA 5KFQA 4M45A 4DQPA 2ATQA 3Q8SB 5JUMA 3PX0A 4YXJA 2KQ2A 1A5VA 3B6OA 4J9NA 4KLJA 1NJYA 1C1AA 3IM1A 2PY5A 3KHGA 4CFCA 3MDCA 5DB9A 1BCOA 1Z25A 3JSMA 4QWDA 5EWGA 3Q8RB 4FCYA 4ED0A 3HK2A 2FBTA 4KO0A 4YXMA 4DSJA 4BWJA 4K4IA 1ZQWA 3VQEA 5I42A 2DPJA 1S9GA 1U4BA 3TAMA 4WE1A 5DBAA 4ED6A 2E6LA 3NH1A 1S76D 3QIPA 1KDHA 1NK4A 5DG8A 1BI4A 4P4OA 1NK6A 1VRUA 4RPYA 3GIMA 4FVMA 1WCNA 2QK9A 1S97A 2MUTA 2BCQA 1WSHA 4ELVA 3P1GA 3RMAA 5KT7A 2GWSA 5J2JA 1S0OA 1WAFA 2VWKA 4QWEA 4JV1A 4ECQA 8ICRA 4DF8A 4N5SA 3QERA 2IGIA 8ICTA 3ZD8A 4OPKA 2F1IA 9ICSA 3LZIA 4CCHA 4F5RA 2C2DA 9ICOA 2KFNA 8ICSA 1IKVA 1CUKA 1BCMA 1RDCA 2X78A 2JGUA 1U49A 1X1PA 3AVKA 8ICOA 4CEOA 4PQUA 1L3TA 4B9MA 4PWDA 4I28A 4K4GA 3SUNA 3UQ0A 2BGWA 3CFOA 2YHBA 9ICWA 3EPGA 5JS1A 4RNMA 1XO1A 3LALA 4RW8A 3M8RA 5DB6A 4CIEA 1C0TA 4NM1A 3QINA 4O9MA 4GC6A 1BQNA 4H4MA 1VSIA 4ID5A 3PUFA 4GC7A 2FBXA 5HRNA 3V6DA 3MXJA 3QNOA 2JEIA 9ICHA 2C22A 2UVUA 3KKRA 1WSEA 2JEJA 3C21A 4KB1A 3N97B 1IKWA 4ED8A 3AA2A 4O4GA 2VG6A 2PI4A 4Z6CA 5KFAA 2FLPA 4KLHA 4NLZA 4RNOA 4I2HA 5J2EA 1JLBA 1TV6A 1R0AA 4KPYA 3G0ZA 3KTQA 8ICQA 3C5FA 1DLOA 9ICEA 4FYDA 4KMUA 2XY5A 5J0YA 4F2SA 4DU1A 1ZQPA 1RBRA 4KREA 5KT6A 3SQ0A 3OYNA 1JLGA 3VQ6A 1KLNA 1ZQBA 4MF8A 2G8UA 4MEYA 4M2YA 1B9FA 2ZTDA 1BIUA 1UWBA 1ZQOA 5F9LA 1S9FA 4E7IA 4PGQA 5J0OA 1ZQJA 5HRPA 4AILC 3C2LA 4O5EA 1TK5A 2JEGA 2IDOA 5EWEA 9ICKA 3IS9A 4KHYA 5HNKA 4E19A 1XI1A 1EXNA 3DYAA 2AGPA 1HPZA 2VG5A 2HNZA 3M8QA 4J2EA 4OVLA 4EYIB 3OYEA 4ECTA 3DMJA 5DLFA 3PW7A 1RDAA 3WNEA 4Q44A 4GVMA 1BHLA 2IA6A 5L1KA 5KFBA 3CFRA 2C28A 3V1QA 4M3UA 4HUGA 2F1JA 3NGDA 4I2BA 3T5JA 1C6VA 3TAGA 1ZQIA 1J54A 4NXZA 4W5TA 4FJJA 1KTQA 1IKYA 1Y88A 3PVXA 4HVJA 1ZBFA 2O4GA 3H8JA 4LVSA 3O3FA 1RT6A 2FPLA 5HRSA 3ZT3A 4F92B 2Z1JA 4FJGA 4UBBA 4I2JA 1QSLA 9ICJA 4KHUA 4BE2A 3ORYA 1CLQA 5KFLA 4OGEA 3AO3A 2E4LA 1RNHA 5D46A 4DL7A 3PV8A 4CJ3A 3KK2A 5DQHA 4GXJA 4FO6A 3PY8A 4YFUA 1LW0A 3C6TA
chains in the Genus database with same CATH superfamily
3RJIA 2UXCJ 4I0WA 1FDDA 4LFBF 1VQLS 1HHSA 3AVLA 3MK6A 1HR0J 2XYHB 4EBCA 4LF1A 4BR5A 4J2AA 1UOCA 4PPXA 2PFNA 3ELHA 1A6SA 2J76E 2R7YA 2FGCA 1JKHB 4GV9A 3MC1A 4P0PA 2I5JA 3QBXA 3WNHA 3C8YA 4FM0A 1N32J 4LF9K 3KWMA 5B8HA 4JK7A 4CIOA 4USKA 5HBMA 2DBYA 4E8UA 1RDRA 5CZXA 4OJ6A 5BYRA 1ATNA 8ICEA 1URRA 3IG1B 3RB6A 4OX6A 3KLFA 2K8BB 2YNFB 4LF9J 2ZWHA 3MF5A 2WF8A 4DCOB 3DC2A 2FY1A 2C3UA 4DPUA 5KFRA 3R9PA 5G0RB 2IVOA 2E1YA 3OYLA 4FYYB 2R18A 2OYYA 2RD5C 2XZWA 4PKIA 3AT1B 1J9AA 2VUGA 4ISFA 3S3NA 2WVEA 4H4KA 3SV4A 3AVCA 2CKWA 3A3PB 1QQCA 4M3TA 1J27A 1VLOA 4FW1A 4NA3A 3R1HA 3V5RA 1EX4A 4YMEA 3ZTQA 7ICJA 5IT0A 3G9CA 1J5EK 1WKKA 4NOHA 1YJTA 4ITSA 2PFDA 4CIGA 1YJRA 4FXWA 3IAYA 4ED4A 2NZTA 4M9NA 5AKLA 3H42A 3R3TA 1P1TA 4FFDA 1J5EJ 2LDYA 3ZCMA 3KK1A 2QKQA 3VQQA 2XI3A 4NE9C 2M2BA 1X4CA 4OV1A 2PFUA 4Q8FA 3EKUA 3ISBA 1NOZA 3FRZA 3MM6B 3MEEB 3MN5A 4PKGA 1IV0A 1KP6A 2KSOA 1U48A 3JTNA 3THYB 4N56A 2E5LF 3R2DJ 1LWXA 2LQ8A 1KLMA 2VIHA 3R6MA 2UUCF 4N41A 5FRNA 1PIEA 4KI4A 4IWVA 4BRDA 1I1GA 3TR8A 3UDVA 3BQ0A 4FJMA 2POKA 3L8BA 2WVBA 2ROEA 3PIPQ 4PHPA 5HAOA 4PQAA 3BO3A 1BWFO 3CTRA 2W2OP 2ILYA 1SV5A 3GV7B 2CQ4A 3L4BC 2Y9HA 2OANA 1ZQSA 4CYUB 4DG1B 1W7WA 2BUPA 3H46O 1QE1B 1IJJA 2IPOB 3PJXA 5KAIU 1JKHA 3OYGA 1MDUB 4IBNA 1BPZA 3HX0A 1ZD4A 4IG0B 4DQQA 1GQEA 2M7SA 1HYZA 4U7UD 4LT6A 2CUYA 1NGCA 3F9KA 4QW9A 4CJ5A 3M8SA 1IJFB 1REGX 3W8GA 4TQSA 3KUHA 3ZX0A 5K8PA 2E8MA 2O6KA 1XR6A 3N5FA 5AI4A 2ZH4A 2JSXA 1A7GE 3TKAA 1P9QC 3H59A 5J2KA 2VBWA 4WYLA 3ICLA 2CZVC 5BPCA 3C6UB 3NNCA 4UASA 2IVPA 5G0RA 1K6YA 1WSGA 3EW9A 2Q3SA 3NF6A 4ZVOB 2I6WA 2QLXA 3TU5A 4TURA 4GV6A 2F9JA 5K8MA 4UB6U 1BWEA 3VAFA 5BRDA 3IRXB 2YNHB 4CHNA 2J9EA 3NCRA 2G8FA 3PW5A 2RN2A 4QZ8A 1TVRB 3OLBA 3OXLA 4WIQA 3RJHA 1J5OA 1JK9B 3G8SA 4MFBB 3OYCA 3MMVA 4M95A 4IEIA 3VERA 4FKXA 3PXGa 3PKMA 3I55N 2BXJA 3O4NA 1AXQA 1HNWK 4CZJA 5J0WA 4DU3A 3DNCA 4M9LA 3M6GA 3C16B 3EKSA 1FRHA 5KNIA 4K8ZA 5KT3A 3OQ2A 2YX6A 5E84A 4RPXA 5RUBA 5BR9A 4DS4A 5JMNA 3RB4A 3MM6A 3MEEA 1WKLA 1TL1B 1HNWJ 2ESEA 3VQ5A 5M2UA 3HM8A 3KFUF 3THYA 3GIIA 2IDLA 3TA0A 4MFCA 3HJVA 4BC5A 1NM1A 3OYIA 2GMJA 2W01A 3HJFA 2N3OA 3G6YA 3G6VA 2W2MP 5AXMA 5M1QA 3TO8A 2HOFA 1VRQC 3AAPA 4USTA 4KB0A 5EU7A 2P9IB 1AT1B 1CZAN 3MCMA 1IKXA 4M0AA 1JLEB 3BKUA 2HZAA 2ZH6A 1Z1BA 3M2VA 3LPUA 5H1SQ 1DEJA 2ZBIA 5J1PA 4BDPA 2HQIA 1TMJA 4CYUA 4DG1A 3B8HA 4YDUA 4MQ3A 2QGFB 3S6EA 1QE1A 5ETKA 1XHXA 4EU0A 3BQ1A 1TK8A 4O5KA 4HTJA 2B4VA 4C1NK 1CJTA 5F8LA 3BZCA 8ICZA 2QLJB 3HSCA 4OYOA 3UMBA 3CD6N 1ZTWA 1GOAA 1JXEA 5AI0A 2VJ5A 3J80U 4JI7K 4V19J 5M1PA 3U27A 1X3NA 1LV5A 5DQIA 3WKEA 3CD0A 3UDCA 2F2AB 5J2PB 3AVHA 1QLNA 3SR6A 4KTWA 4BXOB 1FNMA 2CNKB 1M1HA 4JI7J 4O3PA 2Y1IA 3NAHA 2OHDA 3SEOA 4IFVB 4JV5F 2WVDA 3OVNA 4CK2A 7FD1A 3OY9A 4DX5A 1N5QA 3EZUA 4KHWA 2Z7JA 3MM5B 1KAZA 1XSPA 4I6WA 3EVWA 3M8ZA 3D2WA 2RRBA 1TKDA 9ICNA 2LPEA 1XSLA 1YJWS 4KAZA 3IRXA 5F3TA 5BN9A 3Q8VA 1H2UX 4X66K 2Z8QA 1FWLA 3C2KA 1VBKA 5IV4A 2QYGA 3CMEN 2V69A 1IJEB 5LJ5Y 3W2VA 1UEKA 4AHRA 1XSNA 3H8WA 2DFLA 3ENWA 1HWUA 1HLUA 2WOMB 1UA0A 2CADA 3PRBA 4KLLA 4MFBA 4P7TA 5KG4A 1K73T 3L4PA 3L4QA 5EHHA 2G06A 1HMVA 4J9QA 4X66J 3BGRB 2A1AA 1RWXB 3KKSA 2UXDF 3TZZA 3J81Y 5EWFA 2HKEA 5HQ8A 2OHFA 2IMOA 4OJ1A 3OVSA 8ICJA 1XS9D 2CYYA 4JD2B 3C16A 2RILA 4UTGA 5DKWA 1CLFA 4M3YA 4DR5F 3SQ1A 2ZHOA 4B8AB 3NH2A 4MF2A 3M1YA 5CR4A 2XZDB 2HFUA 3NBPB 2BE9B 3MMJA 1TL1A 3G2XA 1ZQKA 8ICHA 4OI6A 1S0NA 4CZFA 4NCAA 1MN9A 1GEHA 2HBLA 1OJ4A 1IBLF 4ZH4A 1KNZA 4YEAA 1X4HA 3TANA 4FS2A 2XY8A 1ICEB 2YWHA 1L3VA 2YJFA 4P74A 3ZTOA 5DB7A 4MIAA 3VOVA 2H54B 3KBBA 4CI6A 1Q7LB 4BC9A 3SSRA 3KHHA 2F9TA 3X1LB 1HX1A 5AKKA 4Q0BA 1TUUA 2PT0A 1JLEA 3PM9A 5MLCQ 4ZPAA 4JKGB 3E0FA 4ECUA 4K0KK 2PIIA 1SS6A 4PG4A 4EP5A 4MK9A 1N8RT 2A3ZA 2HF4A 4EIAA 3MPWA 2F8TA 4OKJA 5IIOA 5AQRA 4KLGA 2WSEC 3R7NB 4DOCA 3HD2A 4U96A 4H5TA 4K0KJ 1KXPA 3CMQA 4YFKA 2IHMA 3ISDA 2DY1A 1WTBA 3H3OB 4MTPA 4PUOB 4BRGA 4HEA9 2B9XA 4JBCA 2YMMA 1JJ2R 4B02A 4X4QA 4MKVA 2KKPA 5HR6A 4QR0A 5JRTA 3DDHA 1S79A 1Z4UA 5J2PA 1QUPA 2AQ0A 1VRTA 2DIUA 3BGUA 3WNFA 1WOSA 2QJ3A 4BXOA 5HMXA 4XPEA 4WTOB 4IXCA 2KVIA 5BRHA 3NMRA 2QKKA 1ZJNA 3ZZPA 2BQ3A 4OHZA 2UXBF 3UWTA 3QO9B 1Q86O 4FL9A 4KLMA 4QAGA 4IFVA 1W0HA 3P83D 2HRTA 4B8CA 4FS1A 5J2BA 4ENOA 3R97A 5DDPC 2KE7A 3MM5A 1N6QB 2WK4A 4G9ZA 3GIJA 2BW2A 4EUVA 1RAHB 3OR2B 4Z6DA 2KHQA 1H0HB 1K44A 4AQYF 1PO6A 4CK3A 2BPGA 2Z58B 1SC1B 5IILA 3NCIA 2ZWOA 1UZHA 2Q4TA 4DTNA 1VSHA 5ETQA 1FE0A 1RDFA 1IIPA 1N5VA 4GVEA 2WOMA 2ZIXB 4AHCA 4OYMA 2EKNA 1X4GA 4K4TA 2YPYA 1MC8A 3BGRA 4IOAQ 4EAHD 4H4KC 1ZQMA 4UF4A 1RT1B 4BDZA 1X9WA 5CD4H 4JD2A 4CERA 2AJ0A 4BY9C 4OI3A 3H7HB 4FF1A 1JLAB 2F63A 2F8HA 2WB1D 2F3JA 5BREA 3NBPA 3OBWA 2LQBA 1EQYA 2VHGA 4E2FB 1ZM3A 1RDBA 4HHJA 2ISPA 1FRMA 3UN5A 5F8NA 2F9WA 3OYJA 1ZQEA 2JWLA 5IT9Y 2OFGX 2F8MA 3D6JA 3B0YA 4A8WA 3OJUA 4IH6A 3D2FB 5AJ3F 3ZO7A 3AXKA 1EO1A 2V2KA 3NGUA 5AKGA 3MI7X 1B22A 2H65B 1JN3A 2XM3A 3EWGA 3OW2M 3ENVA 3ENHA 4JV0A 2R2RA 3BDEA 1N88A 2WBRA 3R27A 4IR1A 4JKGA 4ES1A 3A4TA 3LP2A 4M9JA 4W5RA 2DB1A 3TA1A 1UEUA 2GAHC 4DV0K 3K17A 1ZPWX 3NRBA 4XIUA 2ZHBA 1QAIA 3MM7A 4UB5A 1NHVA 3S8SA 3NKYA 4A8EA 4OKEA 1VQON 3M8WA 3AQEA 2HBQB 2JEFA 4C8YA 3HULA 1D3WA 2ZE2B 3EUNA 2MQQA 2FVRA 1DQ9A 1WWUA 3E01B 1L3SA 4K4WA 2LYAA 2BKNA 2HLUA 3MFHA 1T0TV 4IQUA 5AQIA 4DV0J 3VC8A 2RS8A 4L3NA 4IOCQ 4PUOA 3PMLA 4CF8A 2F4VK 1CXQA 3CJ9A 4UT4A 1NM2A 4L8RB 1RACB 3QIPB 4U7BA 4MIBA 5KG0A 2P9KA 1JLFB 1HARA 1I51B 1UPHA 3QO9A 4RWWA 4ILGB 2F4VJ 3WHIA 1NGEA 1FE4A 2EX3A 3KKAA 3CXCR 3UPFA 2G13A 2DRBA 4ZVGA 3CJAA 1LKZA 4TUPA 3D6FB 3DRXA 1N6QA 4YQWA 3CSKA 5AI5A 4N47A 2IRUA 4OGCA 4M6WB 3OR2A 5E2QA 4ICLB 4KHPF 2DF4B 2HAIA 2FLNA 4OYBA 1QZ5A 1NZBA 2LLZA 4CJUA 2E5HA 2NXNA 3P6YC 2NRWA 2M5YA 4DV7F 2ZIXA 1KFSA 4QIFA 2OEMA 1DFDA 4ATNA 1OY8A 2EG1A 2BJ1A 4RW8B 1XUPO 2MZSA 1YWXA 1NSQA 2AJFE 1A0PA 5AK3A 2ES6A 3L3VA 2GX9A 4CH0S 3PX4A 1RT1A 1D8YA 4WFAL 8ICUA 1QSYA 2HS0A 5FRMA 4CRJA 3DLHA 2BA9A 1JLAA 3T1HF 3GDXA 4F4KA 3V6DB 2OPSB 2HBKA 3MAHA 2GHWA 2R7RA 2Q36A 5LSLA 4NYNA 1QVGM 4PG6A 1NK7A 2M8DB 3IO1A 2QX0A 3MECB 4KV8A 3M8PB 7ICMA 5KRTA 1XMQF 2GQQA 2HHPA 1DOQA 4H5WA 2A3JA 5FLXY 2PMZC 3K4GA 4DV4K 1G6BA 1LK5A 4QZFA 2IBOA 1S77D 2XS7A 3L3CA 3J80O 4B1ZA 4FZMA 3H2LA 2XICA 3FCWA 3LPTA 3O3GA 4DV4J 1V3RA 3PSTA 2HIQA 8ICAA 1MWYA 2KRBA 1DQ8A 3PACA 4EEKA 3FLCO 1BMQB 5K20B 3LGHA 1RCHA 4Z94A 2H5IB 2EDUA 1KL9A 5E3PA 2E88A 3RMCA 2DGTA 2ZE2A 1JMSA 3OSPA 2W9CA 2FB0A 2W4CA 3E01A 5AQKA 3CB4A 3FEXB 3OS1A 1W7AA 2VCPA 3I56N 1HJPA 3D6HB 4HL9A 4ZITA 3QWUA 3DLRA 2CJBA 4X4SA 2GJIA 4Y2JA 1XR5A 5AI6A 1ZZFA 4HUFA 1S1WB 4F91B 3LGMA 4RW6A 1UFWA 5D4OA 1RYRA 3WX8A 1MN8A 2EZZA 1BO5O 1JLFA 2H3GX 2YB1A 4DX8H 5AI9A 2VDHA 2ZQBA 2NRVA 2HBRB 4YD1A 4EYHB 4JI0F 3IBCB 4NLKA 1ZETA 5K14B 3AQPA 3BYPA 4B3SF 4CF9A 1FO1A 7ICPA 3MCPA 2M0GB 4IS7A 4I2CA 2XMMA 5C25B 4F0HA 1YJ9S 5F2RA 2YBVA 4M6WA 2AHOB 2EQYA 2D9OA 4AL5A 4ICLA 3DN9A 1LWEA 2YPZA 1WTFA 4XRHA 3JYTB 4LBIA 3MUTP 4LF8F 1O13A 3O3HA 3J7YP 4B9LA 1FIQA 3MCOA 2VL1A 1VQKN 1WHWA 1Z19A 2MJNA 2BJEA 1QZ6A 4I4BA 2OIHA 4QU6A 4NWIA 3HYFA 4UAZA 2E8OA 3QEIA 5B09A 3WK9A 1VQYA 2ZZNA 1M1GA 1RBUA 4ZP7A 2KH9A 2OPSA 3KUEA 1Z26A 3A0HU 2DQNB 1RCOB 5DM6Q 5LXYA 5KFZA 4M5KA 3A5LC 1D8BA 5GTHU 3MECA 5AQVA 4DR7K 3M8PA 3OXFA 4WWSA 3F2BA 2D69A 2IIHA 4PGYA 2EFPA 2NRZA 4M5JA 5JLHA 3MTKA 4MT1A 2DKXA 2O01C 1WSFA 2VBYA 2CQ3A 3ULHA 4UY85 3ZFVA 2LVWA 3ENBA 4DFJA 2VJUA 4A8YA 3KFWX 2KFZA 2MTLA 1IBMK 2Q79A 4DR7J 4YB6A 3OT9A 5KGWA 2J7WA 3HVWA 3AOBA 2CPEA 3ZSOA 4FN5A 5DO2A 2D74B 1S7IA 1JJ4A 2O8FB 4KRFA 2DR8A 3R2CJ 2DXFA 1P8ZA 7ICOA 2G08A 4OYZA 1RAAB 4UZCA 3IP4B 3OXGA 1HUOA 3HT0A 3BDPA 2FF3B 1IBMJ 3I5AA 5ALNA 5F8IA 1ZD3A 3JPQA 3UFCX 4USIA 2LMRA 2P9GA 5E26A 4NYZA 5H1SV 5TKYA 4IJAA 4O0NA 2Y8YA 2UV8G 4YB7A 2DCLA 2BRKA 1XNQF 3W5ZA 3QMQA 2K2PA 2QLFB 4H5VA 1Q81O 3RR7A 2KG0A 1H7WA 1NLKL 2AYBA 4DQSA 4CRXA 1WUDA 4GO7X 4FJ9A 3KHRA 5HI7A 1H98A 2GIRA 3AO4A 2MZ1A 3C29A 2G07A 1S1WA 3VVTA 4FOIA 2W7AA 1PAEX 4UATA 1KEJA 2D5RA 3ILOA 1UAXA 2FXUA 3OYFA 3GL1A 5CE3A 3VETA 4ERDA 1ZZNA 3E66A 4ILJA 4C11B 3HVTB 3IMQJ 4FPBA 1T7PA 5K14A 3FCHA 4QZCA 5C25A 1WHVA 4CE9A 4ER8A 3NG8A 2GC8A 2E7WA 3RSEB 4ED1A 1QAYA 4NO7A 1RWWB 2OZMA 3CPEA 3JYTA 3VQCA 3FZ2A 2Y0SF 1HEKA 2QB1A 7ICGA 2HVEA 4YOUA 3KK3B 4Q7AA 3TWZA 4OI1A 1F9FA 3CGIA 2KL8A 4DHVA 2IOHA 4L3QA 3OV7A 4JB8B 1QS4A 2V2ZA 4A8XA 1XC9A 1YITN 3FBFA 3QU5A 4KI6A 3A3OB 3P8BB 2ZIWB 3MAAB 8ICXA 1HWLA 4M5HA 4QQBA 1TZ0A 7ICVA 4CF4A 1EAYC 5CA5A 2B21A 2CQHA 2UU9F 4ANDA 2YX7A 2ZNYA 2MQPA 2QXLA 3CD7A 4LF4F 5KFIA 3AU6A 3C15A 3M6WA 3F9MA 1JROA 1FK9A 3O2IA 2JLGA 2UVWA 2PE8A 3F73A 2R7VA 1IUJA 3SAHA 1XTZA 4GVBB 2DO4A 2A2DA 3RG6A 3GFXA 3WC2A 1Q3UA 3IGNA 1IM4A 2X1FA 3L2WA 1FXXA 2EAOA 4OHVA 3VAKA 2CJQA 3WK7A 1ZQYA 4J9SA 3FZFA 1IO2A 1U2CA 2KJ8A 3BH7B 4ZVRB 5LOQA 1X40A 3IRWP 5J2HA 1XNRK 2O8FA 3EM1A 3ZTRA 3EVOA 2WRMA 2DCUB 3RB0A 5EX3A 3PW2A 3BH6B 2WB1C 5FDLB 1FJEB 4XO0A 1TAQA 3K9JA 3C6HA 2V52B 3H90A 2CPHA 3FZMA 1Z2LA 3FMBA 1G7CB 2W8LA 4ZCLA 2Y0BB 2BOAA 1Y10A 1XNRJ 2GWKA 3CJKB 2XLJA 4NWBA 1VQPN 1DY3A 3G8QA 2AGQA 4O3RA 4HAIA 3WXLA 4H5RA 2OMLA 3L2VA 1S6PB 1JCEA 3F44A 1CVJA 5ALTA 3MX5A 2IS3A 1KEKA 3D4JA 4OV6A 4NLNA 3ATVA 2KM8B 4DR2F 1HWIA 2D0CA 2G8IA 3FCVA 2CVEA 1VQ7S 5H2FU 4E98A 4QS7A 3J7AN 3B6BA 4ZCKA 5DM7L 3BBFA 4OLBA 3BY5A 1TYQB 4IO8A 4U7UK 4X64K 2OWOA 4UBCA 1HKAA 4C11A 3BSNA 3HVTA 1Y9OA 3L2QA 5IM0B 1UT5A 3F5EA 4YUDA 2ITMA 4DLEA 1GXUA 4RCHA 1FXLA 2D0OA 3VV2B 3I5CA 4DL6A 3U02A 2QB0B 1IG8A 2K60A 4X64J 2Q0ZX 1MG7A 5IQQA 1URNA 1BI4B 4YG2A 3KKAC 4RQMA 1VLYA 3JQMA 1NLVA 2M88A 3CIMA 2MUTB 2Z4PA 4NJ8A 1RBTA 3BS5B 3KK3A 4ILRA 5ALWA 4CGGA 1K47A 3AJDA 1ZAWA 1NEEA 3EPIA 4C8MA 5KTQA 1Q95G 1ED1A 3P38A 2HHUA 4TVAB 2ZKUA 4QS8A 1FNXH 2FPMA 4H0OA 1VSDA 4AF1A 3BB5A 3DCAA 3CYMA 2ZIWA 1N0VC 3MAAA 2KJWA 1KAXA 3OTEA 3H4BA 4OQJA 4EHUA 4MYUA 9ICPA 2N1RA 2U1AA 4KPCA 4BR4A 1CEZA 1F1BB 3HCXA 2A3VA 1GX6A 3UN3A 2IJFA 1HNIB 2M9KA 2JHEA 3OYDA 2YMLA 1S9EB 2YQEA 4GVBA 1LVHA 3GR1A 4PEOA 3CQ8A 1DGSA 3UQ2A 3GCWP 1G15A 4H4MB 4ID5B 3V4MA 1VIOA 3HFKA 4B3TK 3VQ7A 3O8MA 2H9ZA 2J8AA 5GIPA 2DGZA 1GXTA 1AZSB 1X7VA 4DV1K 5F1XA 2CPDA 4TYBA 1DAXA 3K1ZA 2IM1A 3B0XA 5D49A 1FRKA 3IR5B 5FDLA 3L4IA 5AE3A 2MKCA 2GELA 4J9RA 2VPZB 2O66A 4DFPA 2HWTA 3NGIA 1SQKA 4B3TJ 3QB0A 5ALXA 2IFXA 4DV1J 2UUBK 3CJKA 5AM0A 3W7BA 1DLOB 4JI8F 3CE8A 5LMUF 4JS4A 3HMJG 4FM1A 1R8CA 3NGYA 5CYJA 1KHWA 2ZUAA 2DNGA 3ZT4A 2HOEA 2UUBJ 3CCLS 2WF9A 1UWBB 4M45A 3BR9A 3Q8SB 3EXCX 4YXJA 2KQ2A 1A5VA 4ZPTR 1ZS6A 3B6OA 2YQ3A 1TYQA 3KHGA 3LTOA 3TYTA 4OPHA 3CC2S 2GCFA 4CFCA 3MDCA 4OHXA 2ZJRL 5DB9A 1Z25A 2VG5B 5IM0A 1Y3JA 2D3DA 2Z30B 4LJXA 3CERA 2BE7D 1QQ5A 2ZEJA 1VHXA 2DPJA 2ZJQL 1QD1A 3KZIU 4ED6A 1BI4A 2HBZB 4JMUA 3TJAA 2O3DA 2LA6A 1NK6A 4YS2A 2HSZA 4FNIA 4W92B 2XNRA 2G5HB 3D2NA 4OX8A 2RU9A 2XMKA 1T3QA 1NDCA 2YX8A 2BCQA 2MUTA 4C3LA 1W2BR 2A6OA 1JJ2M 5KT7A 5ETSA 4XH1A 1NB2A 1WAFA 2ZDOA 4IEEA 2PKEA 4QWEA 1HNXF 1YRXA 5K8OA 4C80A 4P10A 1Y3KA 1U7LA 8ICTA 3ZD8A 2ZBQA 5ETVA 1E6VB 4CCHA 2K06A 1YZ6A 2KFNA 8ICSA 4NXMF 2O8EB 1IKVA 1CUKA 2MY8A 2QTWA 1BCMA 3IXQA 5H9EK 1X1PA 4LF6F 4KGXB 3SIPB 4A46A 1TUVA 4I28A 2VZ9A 2BGWA 1B0VA 1JLCB 4RNMA 5D4PA 1UVMA 1ELOA 3M8RA 1HBUA 5DB6A 2KKZA 5AQXA 1JCFA 2FE9A 4NM1A 5H9EJ 2KN4A 4D3GA 3NVKA 4DX6A 4H4MA 2ERRA 3GYNA 4ID5A 1WDTA 3PUFA 4FYXB 2IYIA 5HRNA 2G2YA 1MWKA 4ZVTB 2J0WA 5D77A 3TEGA 2P9CA 4ZN3A 5CRXA 1N5SA 1IBKK 5CCMA 5HOOA 2B3TB 1U1OA 3C21A 4KB1A 3MM8B 2XB2D 4ZIVA 4WZQA 1Z2ZA 2ZBCA 1REVB 1UJ6A 4CNQA 2PI4A 3GG1A 3WKDA 1BWVA 4Z6CA 4RNOA 3AGKA 4P73A 1R0AA 1IBKJ 3G0ZA 1DLOA 1U6FA 4FYDA 1EWRA 4KMUA 2XY5A 4I2PB 4FP9A 4OX7A 1RWKB 3A8EA 4DL0C 4DU1A 4LR8A 2RIJA 3SQ0A 3Q83A 2L08A 4TYAA 1BIUA 1UWBA 1ZQOA 1XERA 2QEXS 3C46A 4FVCA 2OI2A 4H03B 2CJXB 3QLHB 3FUYA 3P4UB 4PGQA 5J0OA 1ZQJA 3M1FA 2K8GA 3C3LA 4O5EA 2OSQA 2DNNA 1Q82O 2JEGA 3SBMA 1BUPA 3C14B 1RT2B 1K73O 1EXNA 4KH1B 2VG5A 1NH8A 1VHIA 4OZLA 4J2EA 4BJQA 4EYIB 3CJ2A 3CDBA 4Y0FA 5AQQA 3DMJA 4NLPA 3KNGA 4ZS6A 1RDAA 2CFXA 2YI1A 4Q44A 4HHHA 1NGHA 4K2JA 1VK3A 3CFRA 2GS8A 3MM9B 2F1JA 4HUGA 1R8HA 4I2BA 4DKWA 2E44A 2KYZA 5CYMB 4ZJLA 3LDLA 3MTJA 1C6VA 3TAGA 4LRAA 1ZQIA 1J54A 1H7XA 4F02A 2F40A 1KTQA 1FKPB 1Y88A 1U8WA 3TUIC 2CNNB 1FKAF 4KH0B 3CETA 4GKKK 3H8JA 1TUWA 4PKDB 2FPLA 2W4DA 3G8TA 1QQOA 2COLA 3HHLD 2KK0A 4DR3K 4UBBA 4AD6A 4BE2A 3ORYA 4FWRA 3CJ1A 2QSWA 1NDLA 1RABB 3MEDB 1DKGD 1OKJA 2EFVA 3AO3A 2E4LA 2MKYA 1UFKA 1NZ8A 4GKKJ 3CXCM 1S22A 4C0HA 1XBWA 4NPOA 1DHMA 3CCRN 4DR3J 1JLCA 4G1PA 8AT1B 5EN1A 3NGSA 2PFOA 3A1YG 1S4FA 3HHLA 1WOPA 3G87A 3SMVA 3KLGB 2OP5A 4N76A 2PAVA 3PR5B 3QNNA 1N8RO 2MLYA 3PNCA 1YJUA 3R7SB 5JVHQ 5BOLA 1ZM2A 2A1JB 2B7CB 2ACMA 3GFYA 4MO4A 3VHQA 2R8HA 3NDKA 4YMMA 3GZFA 2AA4A 3KJFB 3CF5Q 2D3ZA 4OIXA 2LXUA 3N6NA 1CSJA 2NV3A 2SXLA 3LDAA 2J8SA 2FJVA 3JSYA 4AL7A 3M30A 2W2QP 2WTFA 1NGJA 3AFGA 1O8BA 4I1TA 3OTBA 4W5OA 4DQ8A 4ZHRB 2CGJA 3AA4A 1REVA 3QJLA 4HH0A 2ZH7A 3HKWA 2LBOA 3P45B 5AK6A 1KOHA 1C4AA 1JWWA 4OYPA 1D8LA 4CLYA 4RQ6A 3LANA 3KDOA 1B4SA 5GADI 2KKVA 4OJ3A 5AE1A 1Q4RA 3OHAA 4LF2A 4I2PA 1RTJB 3QEXA 2HHHK 9ICQA 4E3SA 3RWUA 2A1BA 1QQMA 1C0GA 3C7NB 3H6EA 2C2NA 4RX6A 3LK9A 1PZNA 1FERA 4CEEA 2EWHA 3QIDA 2HB5A 5KFWA 3DOLB 1T8EA 4OLPA 2YXLA 3PO4A 1QQ6A 1NPPA 3H7IA 2RHSB 3QLHA 5B0GA 4GIBA 5AQFA 3DM2A 2XYPB 3O1LA 2HHHJ 5KG1A 3ZYYX 1BE4A 2Z2YB 1GLDG 5DRKA 3C66A 4CO3A 3OFFA 1N36K 3VEOA 1UVJA 3MGHA 2ZH5A 1RT2A 5IIMA 4M7XA 2HVDA 5I3PA 4DB3A 1YAGA 3HHNB 3PHTA 1NB7A 2KVSA 1FFWB 4K4HA 1PYSB 4ZTJA 7ICEA 5IIIA 1S48A 3NTUA 1N36J 4XA5A 3BREA 1RHJB 3MM9A 3J81U 3GV8B 3JSBA 3ICXA 5CYMA 3AUOA 4F8RA 5JVGL 4F5QA 3PW0A 2I6XA 1NHUA 4CNZA 3VAMA 4QW8A 1SKWA 2HQDA 2G8HA 4A8OA 1SL2A 1FKPA 4BC7A 2DGOA 2JX2A 2K7JA 3UQSA 3G4SS 3V6HA 2Y0SD 4USUA 2V51B 3MXMA 3L7OA 2DEIA 5KFEA 5DZ6A 1GMUA 5D6GA 1BA0A 1DK2A 3R5AA 1MMDA 2P8IA 4RQ1A 3MGVA 3V9ZA 4QWCA 1YBAA 3MEDA 5A6PA 2DXDA 4K4ZA 4CGHA 2P9LB 1B0XA 2Q6BA 4DMNA 3H25A 2DNKA 2DYAA 2FLLA 1KD1O 3HZ6A 2AEJA 3NHGA 3S9HA 2PSZA 3V81A 3Q2TC 2DHAA 3EXYA 1SH2A 2EW9A 4HT7A 1RTDB 5AQOA 4CGIA 3KLGA 2CXYA 5GAEI 1H73A 2OPPB 4Y1DA 3TUJC 3MDAA 2FBYA 2A18A 1VBZA 3TAQA 5D8HB 2A1JA 3N4QA 3FEZA 1VSKA 3ATUA 4Z4GA 4DUTA 2I1RA 2NXUA 4BRFA 4PL8A 5HL7Q 3W0LA 3C5GA 1BD6A 5KPRA 2LHTA 2DGSA 3ZEUB 5HATA 2BX6A 3TRGA 3EL2A 1KVBA 4FLYA 1S6OA 2ZG6A 4B08A 3HPGA 1WN7A 2IHNA 4QNLA 5EUHA 4ED5A 2XY7A 3PR4A 3GCXP 3N5BA 3K2PA 5IS2A 4LFAK 3KMQA 4FK2A 1V4TA 5A2QU 2W8KA 4FJIA 4A62A 4O5BA 3E8OA 3RGIA 1KQQA 1U1QA 4ZPBA 4K41A 2QA4N 1ZQHA 1V4SA 1NGAA 2XWYA 2D0BA 1QY7A 4USWA 3TTDA 3MEGB 4LFAJ 1MNEA 1M1KO 5F3ZA 4KYZA 1C0FA 3GYXB 1RTJA 4UB2A 3SCJE 2ADBA 3C19A 3CC7S 2J9DE 7ICLA 1T44A 1VDHA 4KLFA 3D2EA 2AJ4A 1Q8BA 3CC4S 1X9JA 1NCLA 4ZCMA 3B54A 4UUXA 4F3MA 2OTLN 3UN2A 3VTHA 2YX1A 1ZQUA 4IG3B 3ZTSA 5LM7E 1PBAA 4BRLA 2CPIA 3NP5A 2YHWA 2CH5A 2GZOA 1ZXOA 4N77A 3NMUA 2KM8C 1TELA 2OTJS 4A2AA 4QZ9A 1GMVA 1D09B 1RU2A 1R3NA 3SMZA 3OLAA 4JYAK 4ID1A 1K9MT 3E1YA 2W9MA 3ZT1A 1TFRA 3T5KA 1YI2N 7ICKA 4R63A 3O8WA 4FYWB 2HI0A 4QWBA 2DHHA 2B5JB 3ETMA 4NZ0A 2DNLA 4F71A 4DPYA 3OL6A 2VGNA 1BLUA 2GHVC 4DU4A 4JB3A 4JYAJ 3L2UA 1F9HA 1JXLA 4FZVA 1S8OA 3K75D 3CDAA 1S5LU 1CC7A 3FMWA 5ETPA 3ZDCA 3WXIA 3PSPA 2MAXA 1SH0A 3W3DA 3M4XA 1TTHB 3V4IB 5IT9U 1EQ0A 3LPYA 2IBKA 3AVNA 1VBYA 2P9LA 4IFYB 2OH2A 2VONA 5D3GB 1O0PA 4OCZA 2GQCA 2AP1A 5J0UA 4TLQA 3CDEA 3H1VX 1NNLA 3I4HX 2DNPA 4I6YA 1RSCA 1LWCB 4BUGA 2NS1B 1RTDA 2ALYB 2YWGA 4Y34A 4V1Ak 5BXIA 4C8NA 2OPPA 4F3OA 2VODA 2XZTB 4NEZA 4Q8EA 1PJ5A 1PVPA 5SUHA 4CZHA 1CG2A 4MYTA 2YKQA 2QMXA 3VALA 2E2NA 3QAUA 3FSXA 4CLFA 3V7LA 3A3NB 3QESA 3BS9A 3HSJA 9ICGA 4K4YA 1CJKB 2QL5B 4RBVA 4JI5F 2CQGA 2XMUA 1SJQA 1SJFA 3ULEB 1ZBIA 3H40A 3WEEB 4ECRA 3CNQP 4F36A 3BO2A 5B08A 4UQTA 2XRIA 4LRDA 5L38A 3CMAN 2Y9UA 2F76X 4KLEA 4J9KA 4F25A 4WFNL 8ICIA 1BQMB 4NRUA 1MMLA 4UZBA 4IQMA 2LXFA 2PC6A 3MEGA 1GLCG 3T5LA 2JNJA 1NMNA 2Q1NA 3BKTA 8ICNA 2ZVIA 4LFCF 2XEXA 4GNIA 1RYUA 2A1SA 2JR5A 3JPTA 2HFSA 4OX9K 4CECA 3VGUA 2DKZA 4NLBA 2RVJA 4Z2XA 1K8KB 4UOHA 2A10A 4M3RA 2EEYA 1AROP 3PDNA 1NWKA 4NLYA 1S0VA 1WI6A 2Y9TA 2DNHA 4CGDA 4DO9A 4JI6K 5D0EA 1LOTB 1OIAA 4NI2B 2ZF5O 1FRXA 1ZQFA 4F0MA 4R79A 4IG3A 5GAHU 3DU5A 4OX9J 4MEXA 4O5FA 2UXCF 1OPIA 4Y65A 4Z6EA 1NMDA 1HR0F 3OYHA 2Z56B 2P66A 4JI6J 2P6SA 4P9SA 4LQ9A 1RAJA 2VFTA 1ASUA 4BR0A 4OD0A 4P2FA 2B5JA 1NSAA 3VQTA 4E7JA 3GBTA 1QDUB 2HS3A 3OL7A 1VHFA 4A5AA 4K2XA 1VQ6N 1O08A 1A0OB 4W5QA 4WQ4A 1CS4B 1SPBP 3I0SB 2ZJPL 4NLRA 1TV9A 1VLBA 3R7BB 4HT5A 4JV5K 2QKBA 1ZQTA 2CZ4A 1ULRA 1HIYA 2QLBB 3VF2A 1WG1A 4ID8A 2D8CA 3TW0A 4FW2A 3SK3A 2ZJ5A 3AH6A 3DGVA 3BGOP 2DFEA 4BRPA 2J5AA 4CO2A 3SUPA 4CNYA 1LAWA 2ZC3A 3G71S 5D3GA 4JV5J 2DITA 2MY7A 4NL9A 2WONB 1BDGA 2RU3A 2F1HA 4Y2PA 4R0JA 1LWCA 3OSNA 2QIFA 4TUQA 1SQGA 1Q86T 4FF3A 3FBBA 3ENOA 4YDDB 2MZTA 3I55S 2ZIUB 2IMWP 4IH5A 1F9EB 1CPZA 2W55A 4ECVA 6FD1A 4OJLA 4YVZA 5HVHA 4JNEA 1O51A 2Q0RA 4DTRA 5HMYA 4HH1A 3LVVA 4H0PA 4LQ3A 4K50A 3ULEA 1LNQA 1P27B 3DXMB 4PHAA 2FYXA 3WEEA 2PGCA 5J2IA 4OJOA 4EEYA 4MLEA 2V0NA 3CFPA 1T11A 4CBXA 4ISGA 1BQMA 1NGBA 1KONA 1YF5L 1U1LA 3NFAA 4KMOB 3GWCA 1PG5B 1EQMA 3R5BA 4B3RF 3VEZA 4O0JA 4OKKA 4AYBD 4B3OB 2YKAA 3NEKA 5GTIU 3FNNA 2LSNA 3OTOF 1ZBLA 4R5PB 7ICUA 1N2XA 4FJ5A 3WKAA 3CVKA 2NZCA 4Z4CA 4EBEA 2KXNB 3CCQN 1JALA 5B0CA 3WK6A 4FDFA 3T1AA 3W66A 2M52A 2DIVA 3QGIA 4HYKA 3ETOA 1NOMA 5KFSA 4LF7K 1VSFA 5GAHP 1MWZA 4ECWA 3CD6S 8ICPA 2F9DA 3THWB 3Q24A 2EK1A 5FPMA 4CF3A 1NGDA 5U47A 1EKEA 1XC3A 4JI1K 4BC4A 4R0EA 2H4YB 3QETA 2DH7A 1PGZA 2O67A 4E1MA 4LUBA 4LF7J 4EK2A 4F26A 1Q9YA 4OI2A 3ZI4A 4K7QA 4CE6A 1C0UB 1FVSA 1WC1A 3NGKA 3GE9A 3P96A 3NWGA 1SWVA 4KGZB 3B6PA 1D5AA 1NRKA 1CS4A 4JI1J 1P7DA 2VA3A 2ZITA 5ALQA 1LOUA 1B0TA 4YY3K 1VSEA 3FRYA 4WFBQ 3ZZZA 5A8WB 3HOTA 1YDLA 1CJUB 2OMOA 3TAEA 2ZDPA 3QQCD 3H8YA 2EZXA 3SLCA 1EKRA 3K89A 3CMES 5ALYA 3NWRA 3JXUA 4ZK7M 4V19X 2HZVA 4YY3J 3A8IA 1PJ7A 3QWPA 1R43A 1RAIB 3WT0A 3LOUA 1HYVA 3IDHA 3U4LA 5A2QO 4YCXA 1RQ0A 1SI9A 2ETJA 4IJNA 1ZQAA 4RU2A 3T5HA 3DLLL 1XNSA 2JV3A 1RQNA 4KLDA 4KGKA 4F4ZA 4F72A 4PHDA 3HX9A 4OLAA 5IXUA 2RQKA 1YTAA 2CQ2A 2RQ5A 4H5NA 3I5BA 5GVQA 1WBDA 2B9WA 4LD0A 3K59A 4J9UE 4LR9A 3SI8A 5CR0A 4USJC 2DR5A 5KT4A 3NL0A 1T9TA 3H1QA 1ZM9A 1ZC6A 4E1NA 8ICLA 2WVFA 3CW2C 1UVIA 1ZBHA 4IOXA 4BG8A 4EO8A 4AUKA 5IC4B 1NPRA 3IFEA 1NK9A 2JVRA 2BYCA 3P5BP 2E6MA 4F5PA 2PD1A 3VN5A 1WBBA 2I1QA 5C12A 3TOQA 3BF3A 4HHUA 3EGNA 3BBBA 4WZMA 4WFYA 4ZVHA 3C1YA 2YQ0A 4U8VA 4CLTA 1AUDA 5DQGA 3H4DA 2B6AB 2E5GA 1YXQA 2BV3A 3S41A 4RU9A 2IOFA 4I2IA 2NREA 3PLAA 3QNWB 5BRFA 2BCUA 3CQXA 2Q97A 3FDSA 4J9PA 5JS2A 3GZ7A 1SJRA 2GGPA 2VIXA 4EELA 2LM1A 1YGYA 1SL0A 2DGVA 4P7VA 2ZH9A 2DPIA 4RQ2A 1WKJA 2MSTA 1NUEA 3TWHA 4CFBA 4OZ2A 2MDAA 1XQIA 3NCQA 1RGIA 1YSJA 2MSSA 3QJPA 4DN9A 1B64A 3BN4A 4B3OA 4DTMA 2A42A 4M1KA 4LBPA 5L46A 4R5PA 2BEFA 2E66A 4NV0A 4M5GA 1SZPA 2ZBPA 1BGXT 2QEXN 3L3FX 2KFYA 1HYSB 5KFCA 2NLXA 1VQNN 1RP5A 1FHTA 4IQWA 4RKUC 4BS2A 1N52B 3DLEB 1CJVB 3WNGA 4RWXA 3R5CA 3UR3C 4MN4C 2FJ6A 1NAQA 3CDWA 1FF2A 4NCGB 3NS1A 4FLTA 3THWA 1KFDA 3UMCA 2KZZA 3HD1A 3AJ2A 4BHQA 3ZZ0A 4TU9A 1VDVA 5IT9O 3KLIB 5F3XB 3WK5A 2YWFA 2D3OR 4XH4A 4GXIA 4IKFA 1C0UA 3RAQA 1N63A 4I27A 3CIPA 2WBNA 5BPLA 5KAKA 4O8KA 2HBMA 1FRIA 2QWPA 3QGPA 5AXNA 3V2UC 4RWTA 4A48A 4Q45A 1N32K 5KQ8A 3K57A 3L09A 3MR2A 4JI7F 4Y2IA 1TV6B 3KD1E 3FYHA 5A8WA 1EB0A 4HI2A 2XI9A 3O6WA 1NJXA 5CEHA 2HSEB 1UCVA 1R89A 4JWNA 3NNHA 2OSRA 3C95A 5J2DA 2WAQC 2YKPA 1JLGB 1T02A 1W2IA 2VQEK 2V68A 2AD9A 2GJ2A 3MMBA 5HVGA 4JK9A 5BPNA 4KX3A 1N5TA 2R8GA 1X5PA 1FJ7A 4I9LA 4N7TA 4FJXA 2IM0A 2VQEJ 3MXHP 3T1YK 2R7XA 2W4PA 1CZ9A 3PG9A 4X66F 3RTVA 1Q18A 1H2VZ 3R8YA 1ZQ1C 2ZGYA 3HKZD 2MGZB 2QTDA 2XC9A 3NOCA 1TQLA 4LH4A 4CHPA 1ZAVA 1R27B 1KHVA 1X60A 4C6AA 2KJ9A 3T1YJ 5DDOC 1IH7A 5DBBA 3EE8A 2J0XA 1FESA 2B6AA 1S1TB 3O9QA 1MU2B 2I7PA 3RW6A 5F8JA 3RMDA 1S3XA 5M1FA 2GMLA 5J0TA 3LP1B 3PIOL 3TNVA 4P72A 1V5IB 2WF7A 3J7ZT 2W41A 1RT6B 2YV0X 4FJKA 2HFNA 1IR2A 3MUVP 2CQIA 3CPWR 4ELTA 4KHQA 4O3MA 3VR1A 2DHXA 2R2TA 4YN4A 1NDKA 3PJWA 5KFPA 3KK2B 4DR4K 4PABA 3L5KA 3HRGA 1HYSA 8ICFA 4JKCA 4O55A 4I2AA 1VQOS 3G10A 2UUWA 3DLEA 4Z0UA 2EFNA 1CJVA 1F3FA 1ASVA 5ALJA 4QZEA 1BXNA 4OL8A 3HP9A 4DSKA 4DR4J 2B43A 1BY9A 4NCGA 2HOIA 3ZSVA 4PL7A 1DTQB 2HGNA 2FPKA 1DARA 9ICCA 5HBMB 4OLOA 3N6LA 1L7OA 4I29A 1L8LA 1CULA 3KLIA 4J90A 3B8AX 1RYSA 3GTYX 2IRXA 3MD3A 4P75A 2EFQA 2P51A 3PTWA 3BV8A 4WJBA 2L3MA 4BREA 3SQGB 4IRDA 3KLFB 1WSRA 4CFDA 3RR8A 2R7OA 1C1CB 1HUXA 2DY4A 3BF4A 1Y7PA 2MZJA 1BPDA 1FFGB 1M90T 4WPAA 2CJKA 3GDQA 5HVFA 3BEGB 2BCVA 3AOAA 1UP1A 3EGZA 3HFVA 1QVGR 5ETTA 4DPTA 1T4GA 2HWHA 3T6JA 1CRXA 2V2QA 3WIUA 4JI3K 4WQ4C 1UZDA 7ICSA 5FROA 1FXDA 1O5JA 3F2CA 1ZQLA 5AM3A 4UB3A 3UCZP 3Q8LA 2QYCA 4DUYF 1HQEB 3G96A 4RPZA 3LH2S 1VQMN 5KFVA 3WXKA 2Y1RI 3P39A 2M4MA 3RBDA 3NE6A 2R7TA 4JI3J 1MA7A 4IDKA 3TAPA 4RW9B 4H54A 3W9IA 2V7ZA 3KWGA 4FJLA 2LXIA 4UUWA 3S3MA 1L5UA 1YJNN 1XQSC 1ZD5A 3PO5A 4NL9C 3IN5A 4LVOP 3MOZA 3CCMS 2MGZA 3FSYA 3I9ZA 1TFWA 4CEBA 4DTXA 1TR0A 4BE0A 3QRPA 3FEYB 5T7BA 4LVNP 4UY8T 1BL3A 2YQ1A 1FD8A 1RWPB 2AP6A 3U3GA 2LEBA 2CPYA 4F5OA 3AY0A 4Y2MA 1ASWA 1S1TA 2PFFB 1MU2A 4JHDB 2KSOB 1RJJA 3U9DA 3LP1A 2DK2A 4QOZB 8ICKA 3A5NC 3K58A 2DBBA 1S1VB 2E9RX 3R9KA 4GXKA 1PK1B 1RBAA 2BDPA 2HMPA 2Z57B 2L9DA 4F3QA 3FBEA 4AP9A 2LYBA 1W25A 4JKAA 2QL7B 2XULA 2VANA 4P4MA 8ICGA 1SKUB 3EVMA 1RGVA 2VPXB 2QI2A 5EVZA 5J8YA 2GOLA 3ZSYA 2BHNA 4JUZA 4KLIA 3PNIA 3CUNA 2GEMA 1WG4A 1LXNA 4DZ6A 2G4BA 4A2BA 3LAKA 1BNPA 4EZ6A 2XMVA 1P1LA 3J7A1 3GJSB 4Y28C 2IM2A 5JVGQ 5IZHA 1LCUA 1K0TA 3KOOA 1LAVA 4RT2A 3TQEA 3W5XA 4NASA 3I56S 4LH5A 4CJLA 4RQ7A 2OTJN 1DTQA 1UL3A 2BMBA 2MKIA 3SCLE 4YHHK 3I8BA 2QG9B 1WWHA 4BGAA 2WF6A 2OPQA 1RDWX 3T19A 2LCWA 4DV0F 4Z7CA 2IYGA 1KWMA 1ZTTA 4YMNA 4CJPA 4WCEL 4AYBC 3ZT2A 2HBJA 3SQGA 3FQLA 2KU7A 4K4UA 2P6TA 2DVIA 3ITHA 1C1CA 4YHHJ 2VKRA 2PXIA 3W2WB 8ICMA 2AV5A 3T69A 1ILYA 3IFRA 3MPYA 4DV6K 1VSJA 1T9VA 2F4VF 4M63A 3AO1A 3QT5A 2RT3A 3Q8UA 1Q53A 3QT6A 2WW8A 4PZVA 1MSWD 5B0DA 3M6ZA 2ISOA 5SZTA 4Q2MA 2XSFA 4FE3A 1N61A 4I7FA 3ETLA 2JJ4D 2QFJA 3CCUN 1NNEA 1HPMA 2PYLA 4CZCA 4DQRA 2Z0GA 4WYBA 4ES2A 4DV6J 3DXKB 1BU6O 4ZCIA 4OMFG 2ZJ8A 2C2KB 4LIWA 1HQEA 1VQKS 3DOMA 4YOEA 1PK3A 3H0PA 3QEAZ 1ZQNA 4E7KA 4RW9A 3V6KA 3LDPA 1FTRA 2QA1A 4NLOA 1J5OB 4BVOA 5ALGA 3W8PA 2MKSA 4C8ZA 1WF1A 1YX2A 3OYAA 2EBEA 3I1YA 3L7PA 2W03A 1TKZA 1APSA 1F60B 3TZXA 4MDAA 2LI6A 3BO4A 2DWQA 1Y64A 1T3NA 5K4LA 2LMIA 1PC5A 1X4AA 1FRLA 3AGRA 4IL6U 3FBCA 1ZQVA 4LF4K 2P35A 2IIRA 2DNOA 3IMXA 4JHDA 3LW5C 5ALRA 3ZC4A 2HVHA 2FC0A 4PZNA 2VV5A 4QZGA 2KN7A 3SZ2A 4MAKA 2CQDA 4Y2VA 2H1YA 1ZYQA 3EN9A 4LF4J 3V7KA 3C28A 2GLEA 1KS2A 1S1VA 1PK1A 3ALYA 2ZTEA 3I32A 1QM9A 5CZ2A 1S9GB 3TAMB 3G6XA 4WE1B 3A5OC 3KD3A 3RYLA 4KX5A 1IKXB 1F2GA 5J2FA 4BGDA 4HR2A 2KT3A 3NUQA 3C6AA 3M2VB 5ADXA 4HHTA 5J2GA 3Q22A 2QC3A 5LL6Z 1DZ5A 4DOBA 2ZM6F 4X4NA 3QICA 2NYIA 3MXIA 2KO1A 1X0PA 4F50A 3I82A 1YKWA 1BVSA 3PYEA 2KT2A 5JMVA 1CJTB 2ZFHA 7ICNA 2XHWA 2E9ZA 1WB9A 4ECZA 2C42A 3SCIE 4BRCA 5ALIA 1B7FA 2PA3A 2N4DA 3HOSA 2NRHA 2EI5A 2B0CA 3HFZB 1RI7A 2HG4A 4UARA 3BPSP 2A6AA 2W6KA 2E1MC 3NH0A 2K4PA 1VMBA 2A41A 1T95A 4WK3A 1S5JA 1JQGA 1S99A 2HVIA 3W2WA 2WC9A 1BQNB 2HW3A 1TUYA 5D4LA 4CVNE 4USAA 4LSNA 2E1ZA 2UVVA 2KIVA 2JDJA 1UCNA 4EHTA 3CJTA 3R3LA 1TL7B 2GTDA 3LVWA 2ZBRA 3VAHA 4CEFA 4CO4A 2V9WA 3HSTB 3I76A 1XWLA 3PIPL 2OYQA 2HIYA 2G8WA 4P0QB 3DXKA 3G71N 2HSTA 3W2VB 5B66U 4ICAA 2H5EA 3BM7A 2P9NB 2GV9A 5K5MA 3DDKA 3ZDAA 4E7HA 1HW9A 5EE9A 1KR4A 3OL9A 4F4WA 3E2EA 1HMVB 4KN7A 5ETRA 4Q43A 5ALMA 5L1JA 4A8MP 2I2YA 2ATLA 5HN0A 1RKJA 4CWBA 1YITS 5HJXA 1N4LA 5DMRA 3TQ1A 4KE5A 5D0HA 2BJDA 4WFNQ 8RUCA 4CESA 1GMWD 8ATCB 1ESVA 1S10A 4PPZA 5KFQA 1B99A 4DV2K 3PX0A 1SQFA 1X66A 3SDEB 1X9XA 2E1PA 1HD1A 4CTAB 1FWPA 1RZMA 3IS9B 2VPWB 3FZLA 6FDRA 2QT7A 2AEMA 4KO0A 1L7MA 3M8QB 1GMWA 1R31A 4CLLA 2RRNA 4DV2J 2HCFA 4BWJA 2FTRA 4K4IA 1ZQWA 1BOTO 4NX9A 2KLAA 4DMZA 2UUAK 1S9GA 1U4BA 3TAMA 3K0JA 4WE1A 1K9MO 5DBAA 3W65A 2D3UA 4P4OA 1M0SA 3HKZC 5AT1B 4Q0BB 1UJ4A 3EEQA 2CQ1A 4RNHA 3VGKA 1FEEA 1YIJN 3JXOA 1WCNA 1S97A 2PO4A 1Z1ZA 1WSHA 2H3FA 3KDNA 2YY3A 2HK2A 2UUAJ 4IUFA 1S0OA 3U7JA 1VQPS 1IBMF 4ECQA 8ICRA 4N5SA 2IGIA 2FDNA 2F1IA 3LZIA 3HJEA 2ZOFA 9ICOA 4JKBA 4B6JA 1RDCA 2AJ1A 3T6BA 4U6PA 4PXDA 2NZ4A 4KRWA 5AQHA 9ICWA 5JS1A 1VQ9S 3TP2A 4CIEA 4BRAA 1VRTB 3LM2A 1C0TA 3AA9A 3QINA 1HHQA 4O9MA 2B8PA 1BQNA 2CGLA 1X5TA 1WUUA 4J91A 5C10A 1VSIA 5HROB 2VJVA 2FBXA 1TL7A 2ZXHA 5ADZA 3QNOA 3SJHA 4IQXA 1S57A 1IQTA 3KXDA 4P2MA 2OUGA 7AT1B 4U9RA 1F6TA 4Y3CA 4MHVA 1ZBSA 2FHJD 4OI4A 5AQLA 4ETXA 3KWIA 4P0QA 2ATCB 3AA2A 4O4GA 1UKUA 1Q82T 2P9NA 5I9EB 1HBMB 2FLPA 1AW0A 4KLHA 5JICA 4NLZA 2LQ5A 3RW7A 2NO5A 1GAOA 4YB1P 4KPYA 2QWOA 1TP7A 1HNXK 3C5FA 5HJYA 4A5BA 3TEHB 4FPIA 2F8EX 2RE1A 4F2SA 3UDEA 2FHJA 4DCPB 3Q8YA 2MHNA 4CLSA 4AM7A 4ZP6A 4MEYA 4M2YA 4NXNF 4DPWA 5T14A 1HNXJ 4Y2SA 3GG4A 4RBTA 4A8QA 1X5OA 5F9LA 4H0TB 5AK4A 3SDEA 4CZEA 5E5NA 4M5MA 1TK5A 5G5HA 5EWEA 2CA9A 4CTAA 3IS9A 2CQCA 4KHYA 3QSIA 2DJWA 4E19A 2BJ8A 4FWOA 2L9NA 1N54B 4N8OA 1V3SA 2AX0A 1VQSA 3ILIA 3M8QA 3QYPA 4QIWC 3M6UA 4ECTA 3F5AA 4GVMA 2VQFK 2IA6A 3MEKA 3HSDA 5ALUA 3ONNA 4TU8A 1RU1A 2V67A 1T9YA 3OTQA 2HGLA 3TZWA 3BN7A 2F4FA 3ZZTA 4ZLPA 1WDDA 4W4MA 1S5ZA 1U8SA 5AQTA 4XK8C 3LP2B 2VQFJ 1IKYA 2C2ZB 4ZOHC 5J2QB 2EXUA 2NSBA 4KQZA 2KD1A 3PVXA 3A0IX 4HVJA 2ILZA 4LVSA 3VEXA 1VK8A 1OH5A 3MM7B 1PC4A 2B6GA 1RT7B 1UHUA 2HURA 2Z1JA 4FJGA 5J8YC 4ZPDA 1FT8A 5KFLA 3VGTA 5DDRC 3NNAA 1XNRF 4OGEA 4FZNA 4DR1F 4NZ7A 3NRZA 4DV3K 2KMDA 4DL7A 3PV8A 4RPFA 4CJ3A 5M1OA 5DQHA 4GXJA 2E7XA 2DPNA 3PY8A 4YFUA 3OVBA 1I6JA 2B9EA 1X31C 4K8XA 3MURP 3EICA 3CCZA 1FX4A 1XIQA 4K59A 3AA8A 2BKOA 2P9KB 2QZ8A 4F67A 4DV3J 3CHWA 2MU2A 1PYOB 2CAJA 1N0UA 3D5MA 3RB3A 3MGIA 1RT3A 4TXSA 4U8YA 1NI3A 5AM1A 2ZHAA 4Y2TA 5HROA 2E7VA 4Y2YA 2FVPA 4CF2A 5JLFA 1WC0A 3KZXA 4H0XB 2VA2A 5KT2A 3DLLQ 4HVZA 3HRDD 4ZMMA 4TLRA 1KAYA 3NVZA 1YJ7A 4QZDA 2W7OA 1RA6A 1SL1A 1HJOA 2M70A 3EGVA 3HILA 3F56A 3ISZA 4A8SA 3DRRA 1HBMA 3UNYA 4J2BA 3THPA 1M5KC 2NYVA 2YMQA 4HKQA 3DRPA 3HPOA 1AFIA 1TUGB 2Y1JA 3R5DA 5DJBA 3GFZA 4PHEA 2QN6B 3GILA 3IR7B 3O80A 2KJVA 3AQFA 1R8AA 2XWXA 5HRRA 3H5YA 4BE1A 3T41A 2IJRA 4QZAA 1UWAA 4M3XA 3HWTA 4FWLA 4R8UA 4TUSA 5A8RB 3US5A 2IOFK 3C23A 4ZTFA 3SENA 3KLHA 2C2OB 1NO8A 3IBWA 2GAGC 4KV8B 2O8DB 2WTUA 2FI1A 3G82B 1G1XA 2HAFA 1N33K 2RAQA 2ZIVA 1WF2A 5EE3A 4FWSA 2FVCA 1IR0A 3IV6A 1Q5VA 3V9UA 1HNZK 5TKWA 1VGYA 2RHKA 2PMZF 3D3BJ 5AFUH 1PBUA 1K8AO 4QYZK 2DTJA 4NA1A 4CP5A 2DH8A 1KD1T 1N33J 2CZ9A 5AQWA 4CJSA 1C1BB 3OS2A 5E3AA 4GRSA 1HNZJ 2CQBA 2EBGA 5J2QA 4FLUA 2NRTA 3QFPA 4QYZJ 2HNYB 1XHZA 1RBSA 2IC3B 2XMWA 2WFBA 5BR8K 5JXSA 4J8FA 4QCLA 1RT7A 1QQNA 5KFYA 3J7YI 3EX7B 2FJBB 4DV1F 9ICMA 3DEEA 2W9CB 4IOAL 4O23A 2JRZA 2CWXA 2RE2A 1VOMA 1FWKA 2J0QD 2X1BA 5BR8J 3QEVA 2I9GA 2H5JB 2ZOMA 3HPHA 3J81j 5LL6d 2HEKA 3IKMA 1D9FA 7ICFA 2V4JB 4RW6B 1HKCA 2KB2A 1Y00A 5D15A 2XMTA 3BJYA 1SVDA 3CPWM 2DR7A 3MDFA 2JMGA 5GINA 1FFSB 2X74A 2BUNA 1OO0B 2AGOA 4FLXA 2UV8A 1M1KT 2HMXA 1KC8T 4OHWA 3HW8A 3VZIA 2APOA 2H4WB 4E0DA 4FZXC 3D0GE 1LWEB 2GFFA 4NMLA 4FWQA 2F7TA 4I2DA 5F0UA 2F65A 4RL1A 2JXJA 3RH5A 4RQ8A 3FE1A 3HP6A 4YB5A 2JC1A 3P5JA 3R5GA 1WEYA 4CF5A 2V34A 4AXJA 4CO5A 4CEQA 1SIJA 3H3NO 1QHAA 1J6ZA 3AVAA 2FSKA 5L1LA 4FLZA 3ZNJ1 5J1EA 2RLTA 3QFUA 3V7JA 2O8BB 4NLUA 3CCMN 3QZ7A 5C2CA 8ICWA 3CCRS 1PKUA 4P2XA 4IOCL 1SXDA 1GK8A 2ITGA 4X4TA 2X7IA 5A8RA 3H2UB 2CG8A 4CLUA 1U02A 4IFEA 4EFHA 4PL2A 3OL8A 7ICRA 4I2QB 3KD5E 2O8DA 3G82A 4FLWA 4C4SA 3ZZUA 4BRKA 1OYDA 2AXTU 3UM9A 4LF5K 4Z4IA 1FRJA 1W9HA 2W9BB 3AODA 3GFKB 4U95A 2PFQA 2ZH3A 1ZRMA 1IVZA 2GH1A 3KNAA 1GLAG 1BA1A 3QUBA 3NVVA 4X62K 1RT5B 4QPTA 1SBRA 1P90A 4LF5J 3VA3A 3DLBA 3RMBA 4K8RA 4WU3A 1C1BA 4FJNA 2W11A 1DTTB 3EO3A 5IFMA