1NK6A

Cytosine-cytosine mismatch at the polymerase active site
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk6A01
1HYSA 3H08A 2HNZA 1NK4A 3ISDA 2IGIA 4G3IA 7ICMA 3MEGA 3ZT0A 3AVJA 4CK2A 4RQ0A 3NAEA 1C0MA 4WE1A 3GV8B 1VSHA 4FLZA 3C95A 2YHAA 4O3NA 1ASWA 2XY7A 3UXPA 1WSJA 4Q5VA 2R8HA 1TL3A 4YR3A 1MQ3A 1NJXA 4JS4A 3AVKA 3GV7B 2C22A 4QW9A 4DTUA 2HNDA 2I9GA 5DBCA 4TUPA 4QW8A 3K5NA 4CGGA 2P5OA 3QEPA 3M9MB 4F5RA 3RBEA 3L2UA 3AA4A 2Z1HA 4TUSA 3ZT4A 2ZTDA 4DFPA 3VA0A 4DS5A 1EP4A 4CHNA 4W5OA 4DTSA 3RTVA 4RUCA 2ZQBA 3QEWA 1LWFA 3F73A 4H4MA 1VSIA 3TFRA 1TKDA 3ZSQA 4YMMA 4MQ3A 3CM6A 1QQCA 4J9QA 2VA3A 4DMNA 4M42A 1C7YA 5SWMA 2F8SA 3TAEA 8ICEA 1DOQA 1ZQPA 3M8SA 2M9NA 1UAXA 4FZXC 2ZTCA 4DTOA 1HMVA 5HMLA 9ICEA 2Y1JA 5KG3A 3KKRA 5KG4A 2KN7A 5JUMA 1NOYA 2PFOA 5J2CA 1RYRA 4W5NA 4ECVA 1XSLA 2Z1GA 1JKHA 4XIUA 1MQ2A 5J2NA 3SV3A 4ED8A 3IRXA 1WSEA 1VRUA 4DL2A 2IMWP 2RF2A 3EPIA 3ETLA 2EHGA 5IIMA 4DWIA 4CF9A 5KG5A 2BQUA 2OPRA 5FRMA 4OKEA 4GW6A 4CEAA 1TGOA 1JX4A 4KMUA 2NRVA 4PH5A 4ED1A 3C6TA 4I2EA 2Z1JA 4KITB 4E1MA 1RDCA 3V9ZA 1QS4A 3V4IA 3OYNA 1VRTA 5KRSA 3ZSWA 4E7KA 3HO1A 4QZFA 4CCHA 1KVCA 3O3HA 3O3FA 3H7IA 4DQQA 1IH7A 3PV8A 4DTRA 7ICKA 4YVZA 1CZ9A 2P1JA 5HRSA 2PYLA 4Z4EA 3EW9A 2W9BB 3OYGA 2ZJ5A 4F5PA 3K59A 3PUFA 4EEYA 3C2LA 9ICBA 1ZQQA 2AGPA 2IC3A 1SKRA 1WN7A 1GOCA 3QESA 2ASDA 1ZQCA 3C1ZA 1TKXA 1NK7A 1ZQMA 4JRPA 4ECWA 4CEQA 1J9AA 4Y1DA 3V1RA 4O0IA 4RUAA 3PR4A 3JPPA 2GWSA 2R8GA 4NLGA 4GC7A 4JLHA 3OSPA 2I1QA 1VSMA 2VWJA 3QEIA 1FKPA 3G0ZA 4KLGA 3ISNC 3QIOA 1QSLA 3LK9A 4CJTA 4EYIB 1HJRA 2B4JA 2BCUA 2NRWA 5J0TA 8ICRA 2GUIA 3MEEA 8ICZA 2IBKA 4R66A 4CJKA 2MUTB 5KFWA 3LDAA 2ZJAA 4KTWA 4C8MA 3AVMA 4PUOA 2D0AA 4DU1A 4FJ8A 4ED7A 3MBYA 4C8NA 4OKKA 4M6WA 3B0YA 2NRTA 1JL2A 4J2AA 1BISA 3VQ8A 5J2JA 1WSFA 4DLGA 3SCXA 1JXEA 5KI6A 1UT8A 3ITHA 3V9UA 2ITGA 3LAMA 5DDYA 4RT2A 3JPOA 5DMRA 3V7JA 1ZQAA 4I2DA 1HNIA 5KFHA 2P66A 4KLUA 4CJRA 3FYHA 1NJZA 2RPIA 1TAQA 3QINA 4AHTA 4Z4FA 3AVCA 3EY1A 9ICMA 2F1IA 2AQ4A 3VQ4A 2YNIA 4RNMA 2AJQA 2A1RA 5JS1A 2VA8A 2O4GA 4O3QA 2KZ3A 1CEZA 3KLHA 7ICEA 4QZHA 3C5FA 3AVNA 4QWEA 1K1SA 4R8UA 4DQSA 5BPCA 1KVBA 5KRTA 3ISBA 1ZQSA 4ZTJA 5CP2A 2BR0A 1DTQA 4TUQA 5KFMA 4KHQA 4J9MA 2MAXA 2YHBA 4OLBA 4YMOA 9ICAA 3MABA 4KLSA 3MDCA 1FK9A 3HXMA 3M9NB 4NLKA 4RNNA 9ICUA 4N5SA 2DFEA 2OZMA 1ZYQA 2V4QA 1HYZA 2G8HA 4DSFA 3HP9A 2V4RA 5CYQA 9ICLA 4CERA 8ICCA 4FJHA 1LAWA 3M8QA 3C23A 1TV9A 2EX3A 4YN4A 3RJJA 5KG0A 3ULDA 3PNCA 3NFAA 3HK2A 3ZD8A 3DYAA 5HP1A 5DK5A 3P83D 4M3ZA 5CJ7A 3OVNA 2OA8A 1ZQTA 2B21A 4R8UB 1RBSA 1A5VA 9ICNA 2VG7A 5J0WA 1XSPA 2IAJA 1J5OA 5HRRA 3AA2A 3LP1A 1Z26A 7ICSA 4UQGA 3B6OA 1IM4A 3RH6A 4X5VA 3NF8A 1RT5A 4IDKA 3K2PA 9ICJA 2FBXA 5DGBA 8ICWA 4F91B 1NK8A 4CEFA 4CGDA 4KKOA 4BDPA 3LALA 5J2QA 2VG5A 4JUZA 3ZSYA 1CLQA 4PA1A 1JMSA 4RQ7A 7ICRA 4F2SA 3UIQA 3ZSZA 2FBYA 3K57A 3NTUA 4E7LA 4F3TA 4E0DA 4OLAA 2AU0A 3K5MA 4EZ9A 3G10A 5CHGA 2Q3SA 3OHBA 1IKYA 4M9NA 1ZQYA 4MF8A 3OS2A 5HP4A 4Z0UA 1BPYA 1S10A 4JWNA 3C94A 3SUQA 4RW8A 5FRNA 1VSEA 1A5WA 4N41A 3DLGA 4OPJA 2HB5A 3NF7A 1U45A 2AGOA 3AVAA 1CXUA 3ZSXA 3SZ2A 4BWMA 5KFNA 4ICLA 1ZJMA 3VA3A 1KFDA 1UWBA 4H4OA 3NBPA 3HYFA 4QZ8A 4QZCA 3I0RA 1LWEA 3ALYA 4O44A 2FBTA 2PXIA 4KTZA 3MFIA 3QZ8A 5KFZA 2A1SA 5J2BA 4W5QA 3LWMA 1U04A 7ICFA 3LZIA 3NGIA 3EPGA 4I9LA 2GBZA 3OYBA 4O55A 4F4YA 1T3NA 2UVVA 1ZQVA 4NXZA 1GOAA 4BGDA 8ICUA 5J2MA 3CFPA 3PW4A 1UA1A 5I42A 7ICLA 2OPQA 4IR1A 1S5JA 1S0OA 1SV5A 3OHAA 3KLGA 1TFRA 4CK1A 3RB0A 3V1OA 5KT3A 2D0CA 3VQCA 1BHLA 3AV9A 4KB1A 2G8KA 4AHVA 1ZQUA 4NYNA 4BE0A 4LD0A 4FK0A 9ICRA 2XGPA 5J0XA 4DL4A 4PPXA 3DLKA 4J2BA 4M6WB 2G8UA 1NK5A 2XY6A 1S0NA 3GQCA 1RT4A 3IHQB 1YTUA 1RT2A 3OY9A 1LB2B 4LZDA 1D5AA 3V7LA 2BQ3A 2E6MA 5J2DA 3GV5B 5KFRA 1CZBA 3PW0A 2HHWA 2IDOA 3ASMA 3LPUA 4M3TA 4KLTA 4M2YA 1ZBFA 3H8JA 3HPHA 3SQ4A 3OYCA 2LYHA 1RBUA 1QSSA 3SQ2A 3H8WA 4TQRA 2VG6A 4HHTA 1JLEA 5KFAA 3L8BA 5SZTA 3TAPA 1S1WA 4E7IA 5EWEA 3CYMA 1CXQA 2ZUDA 3KHLA 3T5JA 3H4BA 2UVUA 1S1VA 2AGQA 4PQUA 2VWKA 4M47A 3C21A 1RT6A 3VQ6A 2MUTA 4FBTA 4FW1A 3JPRA 3LP3A 4KO0A 4ED6A 3RWUA 5IIOA 3AO5A 1WNSA 4Q43A 2R8JA 3K58A 1L5UA 4DFKA 3JPTA 2W9BA 3PY8A 3LDSA 4DQRA 3V6JA 3V9XA 2C2EA 3S9HA 1VSJA 3SI6A 5KG2A 3HP6A 3VQ9A 4Q0BA 1NKCA 4Z6EA 5J1EA 2XY5A 2DFLA 2HVIA 1K1QA 1BI4B 4RU9A 2FBVA 5EOZA 5CZ1A 3AO4A 4BE2A 4I2IA 1S77D 4TSXA 4GXJA 1S6QA 3OYLA 4CJSA 5L1KA 1X1PA 4AILC 5J0SA 2PY5A 1TK5A 4PGXA 2BE2A 3ZDBA 4HCBA 7ICHA 4F2RA 3VN5A 3H4DA 3PO5A 2NRZA 7ICOA 5DG9A 2KFZA 3EZ5A 3L2WA 3SPZA 3I0SA 2HHSA 2Z1IA 1IKXA 2KQ2A 3AA3A 1IO2A 4UAYA 5KFIA 4CIEA 3RRGA 3OYHA 1DTTA 1EX4A 1W0HA 4FJLA 1ZETA 3DOKA 3MEDA 5DB6A 2BPFA 2FPKA 3AU6A 3V7KA 4CIFA 4QZGA 1WSHA 2B6AA 4MF2A 2P6UA 1RILA 2ZTEA 4DTNA 4KHNA 3K5OA 3CFOA 4CEZA 4FLVA 2X78A 2OPSA 1T4GA 1HNVA 4CF0A 4YG2A 4BXOA 1ZQZA 1S97A 1JXBA 3MR3A 3OYFA 4J2EA 4CJQA 4W5RA 5CA7A 5IINA 4MFAA 2XO7A 1ZJNA 3CFRA 2DTUA 2KFNA 4CJ4A 5J2AA 2QK9A 4DSKA 4CJUA 4CK3A 3MDAA 3D45A 3KK3A 8ICBA 5DBAA 4KHUA 2LSNA 4PY5A 3KD5E 4CHZA 3DRSA 3TR8A 1RXVA 4M04A 3RB4A 4I2CA 2ATLA 3PW5A 2RDIA 5DLGA 3IM1A 1NOZA 3AA5X 4FLWA 4FLTA 3NGDA 4TURA 1WCLA 1KSPA 3SJJA 2X6NA 4CESA 1L3SA 3PW2A 4Q8FA 4QZEA 1WAFA 3U3GA 1B9DA 4I2PA 4GVMA 4XRHA 3NF9A 1RPLA 4RPXA 4EBEA 1J54A 4NLNA 4RQ5A 1B43A 4IQVA 4FJ9A 4KLJA 4DLEA 5DKWA 3DOLA 1NK6A 1RT3A 3SV4A 3RR7A 1C0UA 3AVGA 1S76D 3AVFA 3E01A 3OGUA 5DBBA 4K4GA 5IIIA 9ICQA 8ICNA 5L1LA 5J2HA 2ISOA 4CHOA 1N56A 3M9OB 2DY4A 3V1QA 3RR8A 4KI6A 1ZQBA 3NCIA 1W9HA 2FMQA 2IS3A 3RMAA 8ICSA 4CIGA 2E4LA 3LP2A 3BQ2A 4E7HA 3IAYA 2JLEA 4KLFA 3UQ2A 4FM1A 3M8PA 4E3SA 3ZCMA 2G8IA 1JLGA 2BDPA 4CJLA 4ELUA 1BGXT 2Q0ZX 3B0XA 5DG8A 4YCXA 1Y88A 4F4ZA 5KFUA 5J29A 4MFCA 4DFMA 4CEOA 3KHGA 3AVHA 3RJHA 3NH1A 2W8LA 4KB0A 2VANA 5BOMA 2BPCA 2FMSA 4AHUA 7ICTA 4QZAA 3C5GA 4KLIA 4RW4A 4M0AA 1X2IA 3IS9A 3T5KA 5E41A 1SL1A 1U48A 4KRFA 5KFEA 1XWLA 4KLOA 1T05A 1BIZA 3ZSRA 3L3UA 2BCVA 2JZBA 4RQ6A 4JWMA 1N6QA 4QCLA 2E6LA 4M9GA 3BQ1A 3JPNA 4DL6A 3DLEA 2AQ0A 1QLNA 2ZE2A 4QWCA 3O4NA 2FPLA 7ICJA 3OYEA 3RJIA 4N47A 3K4GA 3T1AA 1A76A 4FS2A 4CEEA 3Q8MA 3Q8PB 3KK1A 5FDLA 4IQUA 3QEBZ 3G6XA 1ZQNA 3RB6A 4ECTA 3NGYA 3NH0A 1ITGA 4EZ6A 3QO9A 1T03A 1B9FA 4KV8A 8ICMA 4I7FA 3O3GA 2HHQA 1SZPA 4ED3A 3HL8A 4XQ8A 1C6VA 4PHAA 1RBTA 1WSGA 2XHBA 3MXMA 4QZ9A 3S3NA 2F1JA 5L9XA 4K8ZA 1S9EA 5T7BA 1TAUA 4P4OA 2C2DA 4Z6CA 4IR9A 3PVXA 1FXXA 9ICFA 4CJFA 4HUFA 4DS4A 3TANA 4KI4A 3LPTA 4BACA 3RMBA 1ZQJA 4JV0A 4FM0A 4F4XA 2JEIA 1ZQXA 4FJXA 3FDSA 4DOAA 3L2RA 1RT1A 4UBCA 4MEYA 4DQIA 2J6SA 4YFUA 4O4GA 1KRPA 4IRKA 1JLAA 4ZHRA 1NJYA 1BPZA 5J2KA 1HPZA 8ICIA 9ICTA 4OJRA 2OYQA 2ASJA 1WSIA 3AVBA 3NE6A 4M3XA 4KLEA 3WNFA 2W8KA 2FLPA 5I3UA 1XHZA 4B9LA 4YNQA 4NCGA 5C24A 3EYZA 4J9LA 3AU2A 1U9LA 2BCSA 1AROP 3DRPA 4PGQA 3ZDCA 4NY8A 4CFDA 3FFIA 2O4IA 3N4MB 5J0UA 3E2EA 4YMNA 3HPGA 1C1BA 4I29A 2J6UA 2HHVA 1KDHA 2X74A 1RTJA 5J0RA 5CY4A 4EBCA 1SKWA 3T19A 1J53A 1N5YA 2QXFA 4MFFA 4IFYA 1CUKA 2BKEA 4IQTA 4ECQA 4BDZA 4RW6A 1XO1A 4R64A 1VSKA 4CF8A 4DTJA 4CJEA 3QLHA 4IG3A 4J9NA 3PX0A 4YR0A 1ZQLA 3SQ1A 2YNHA 3VQ7A 1VSLA 4KHWA 4DU3A 4NLZA 4XA5A 4CE9A 3QNNA 3PW7A 5KFQA 3ZT2A 3KJVA 4YXJA 2W9CB 3HVTA 4B9MA 3JPSA 2KZZA 4B9SA 2NUBA 5DQIA 5K14A 1KFTA 4YQWA 5KFBA 3TFSA 4YP3A 3C2MA 4AHCA 4KLDA 3MR5A 4EBDA 4R5PA 1WCNA 5KFTA 4HCCA 3V72A 5J0PA 4I2BA 3DI6A 8ICGA 2HVHA 4MFBA 2KZMA 2F8TA 1JIHA 2FLLA 5D4BA 3C6UA 3UPQA 1RDAA 3MGHA 2BCRA 5DQGA 1LWCA 1G15A 3TAGA 3OYMA 3OYDA 3TAQA 3BQTA 4FBUA 4P4PA 5DB9A 1TKTA 4KAZA 4ED2A 5HNKA 2YNGA 1TV6A 1O1WA 3QEAZ 1KVAA 4B8CA 1KLMA 3V6DA 2C2RA 7ICQA 3CM5A 3D0PA 3P5JA 3ISCA 4YXMA 3L2QA 5KT6A 3SYZA 4CF1A 4RPYA 4F93B 4M45A 4KHYA 4M3UA 1BCMA 4LSLA 1Q9YA 1ZQIA 4JV1A 2BGGA 4KN7A 1RTIA 4FYDA 4Q8EA 4DSEA 1UT5A 3UXNA 2JEGA 4LH5A 1A5XA 3KKSA 4LZGA 4KPYA 1JLCA 4ED0A 1HQUA 1EETA 5EWFA 4IRDA 1UA0A 3DM2A 3PMLA 4CHYA 1BPBA 3PMNA 1DLOA 3KLEA 4JRQA 5D3GA 4M3YA 1WAJA 4O3OA 3T5HA 1I39A 3F9KA 4Q45A 3DMJA 5L1JA 4CJWA 2ZUCA 1L3TA 4E1NA 4FW2A 4M9LA 1RNHA 3HX0A 3C1YA 1TVRA 5KFLA 4RQ4A 3BDPA 2PFNA 4IRCA 3RJGA 5KFSA 8ICJA 4Z6FA 2ZD1A 4FVMA 4UAZA 4M9HA 5DG7A 1KCFA 3H40A 4F8RA 1DGSA 2YKMA 5JS2A 4BDYA 4OKJA 4QWDA 4CEDA 2IHMA 1EXNA 1C0TA 1QSYA 3ZD9A 3RH5A 4J9RA 4HUGA 1BIUA 3PX6A 4O5KA 4EP5A 3CQ8A 5EWGA 4FK4A 4F5QA 3JYTA 2RKIA 4OGEA 1ASUA 4QOZB 3VQQA 3TWHA 4UB4A 3WNHA 4DOCA 1QHTA 5KFGA 4GMJB 9ICSA 3U3YA 4CECA 9ICKA 1EXQA 3WNEA 3Q8LA 1ZBUA 3RMDA 7ICIA 4ELTA 4HYKA 5L1IA 4FLYA 4I2JA 8ICLA 9ICGA 1JLQA 4EYHB 3VQ5A 4B9UA 4I2GA 4DL5A 1BPDA 1KEJA 5KG6A 4RPZA 1TL1A 3VQAA 1N48A 2RN2A 1YVUA 2R8IA 8ICOA 4IQWA 7ICVA 3L2VA 5KFFA 4FS1A 4QAGA 5DDMA 4W5TA 2DPIA 4RQ1A 3TQ1A 3PX4A 2PFPA 5KT2A 7ICUA 3DLRA 4IBNA 4BWJA 3AUOA 4CFBA 4J9KA 1S0MA 3HWTA 1JN3A 4B3OA 2HW3A 4M3WA 1IXRA 5CZ2A 3OJUA 1RDBA 4DL3A 3MR2A 3LWLA 2BCQA 2FPMA 4DO9A 3SNNA 4F3OA 3CG7A 5KFVA 5KFDA 3KD1E 4Y1CA 3ZT3A 5F9NA 4I2QA 2FC0A 3MGIA 1VSFA 5KT5A 4ECSA 2X6SA 4F4WA 4RZRA 8ICVA 4IG0A 1JLBA 4LH4A 4Q44A 4B9NA 3BQ0A 3THVA 1I3AA 2ISPA 4B9TA 2DFHA 2QKKA 3MAQA 2XY8A 2WTFA 1XC9A 5CR0A 3C2KA 1S1UA 3HPOA 5BOLA 3JSMA 4J9OA 8ICHA 4QZDA 1U49A 2ATQA 2QKBA 1MC8A 2KW4A 5KFJA 4LSNA 9ICXA 1KLNA 3Q8KA 1ASVA 2D5RA 3KLIA 4DTMA 1XS9D 1EKEA 1PZNA 5DB8A 3Q8RB 3KHRA 1TK8A 4PHDA 2R7YA 4KLMA 1K6YA 3QIPA 8ICYA 1X9MA 3JPQA 1RBVA 3H8SA 4K8XA 7ICNA 3Q8QB 4LY7A 4F4KA 4RNOA 8ICQA 1NKEA 2YNFA 4UB5A 3WNGA 1C1CA 9ICCA 1BCOA 2XCPA 4HVJA 3HM9A 3SUOA 4KLQA 4UB2A 8ICXA 4NYFA 1HQEA 1S1TA 2XCAA 4M9JA 3BGRA 4O9MA 1ZQKA 2B5JA 2WONA 2DFFA 5HHHA 3GFKB 4N56A 4B08A 3MECA 2ZUBA 5D46A 3V9WA 2G8VA 4C8LA 4KTQA 3S3OA 4FJNA 4YD1A 3S3MA 5KFXA 4JK1A 4GXIA 3LANA 1B22A 4CGFA 1RCHA 3SI8A 2JGUA 3G6VA 4O3PA 4K4IA 3PO4A 2W9AA 5HROA 5DLFA 1YTAA 4FJ7A 3NH2A 1Z00B 3L3VA 1NK0A 1D9DA 3OS0A 4G1QA 1NK9A 4J2DA 4EP4A 4DTPA 2PFQA 1F21A 3RAXA 1RXWA 9ICIA 3VQPA 2G8FA 3RBDA 1JXLA 4O5CA 1VSDA 2ETJA 1IKVA 1V9PA 5KFOA 1SL0A 4GC6A 4JS5A 2W9MA 4RQ2A 3UXOA 2UVRA 3V6HA 4OGCA 4E19A 3KTQA 4CFCA 1RT7A 4C8OA 3TAMA 9ICVA 2A1JA 3T5LA 4UB3A 4DQPA 4CJ3A 1GOBA 3HW8A 5F9LA 4QZBA 9ICOA 2ZJ8A 5HLFA 3HSTB 1HRHA 4HUEA 2GV9A 5KGXA 5C5JA 4DSIA 4UB1A 4F5OA 2PZSA 1ZQOA 3OYJA 3TARA 4E7JA 4AH9A 1HYVA 4CJPA 3VQBA 3QETA 4I27A 4CF2A 4P2HA 3HVRA 1ZBLA 4L8RB 5HBMA 1KFSA 3SQ0A 3N97B 3OSNA 5KFCA 4Z4GA 1L3VA 4FZZA 4PWDA 4NM2A 4I2FA 4DF4A 4PHEA 2BANA 2HMIA 4B8AB 5KFPA 5J2IA 2H5XA 2C28A 1REVA 1ZQFA 4KFBA 1COOA 2BGWA 1FKOA 3OS1A 4RQ8A 7ICGA 4FO6A 1ZQDA 3HJFA 3GILA 2UVWA 2OWOA 4O0JA 5J0OA 3QEXA 5KT4A 1T7PA 4I2AA 3MXIA 3KK2A 3IG1A 1XSNA 2KTQA 1LW0A 3TABA 3V81A 3P1GA 2OPPA 4DL7A 3LZJA 1RBRA 1BPEA 4KN4A 3RJKA 3DRRA 4QWAA 2HHTA 2W42A 1X9WA 5J2PA 4PHPA 2IHNA 3NGZA 1RTDA 3AVLA 4J9SA 4KHSA 3V9SA 1TVAA 4FXDA 4GXKA 4ZH4A 4N76A 4O3RA 4NCAA 4RW7A 1QE1A 3QERA 4ECYA 4O5BA 1XI1A 4F92B 1D8YA 2PI4A 4IKFA 3AO2A 4OVLA 4DEZA 3K5LA 1ZQRA 3QE9Y 3GIMA 1NKBA 4NCBA 1HUZA 5IIJA 5J2EA 2W9CA 4FJIA 4DF8A 1U47A 4K4HA 1S0VA 3RH4A 4CHPA 4FM2A 4ID1A 1RZTA 5J0QA 4ZTFA 2HHUA 4FJMA 1X9SA 4FJGA 5CWRA 4DSJA 5J2FA 4RT3A 4Z4HA 3KIOA 4CFAA 3Q8SB 4DOBA 2IA6A 3LAKA 3AO1A 5HHIA 2G8WA 5IILA 1Z3EB 4I28A 3T3FA 2I5JA 3TI0A 4ECRA 4HTUA 4M41A 4UAWA 3MXJA 3OYAA 1XHXA 2D0BA 2A1JB 5KGWA 4PGYA 2WOMA 2P5GA 3ORYA 4CHQA 3RB3A 1C1AA 1HJPA 7ICPA 4DSLA 3QZ7A 1LV5A 1BQNA 2V9WA 1D8LA 2JZBB 5EU7A 4Z4IA 1S1XA 1ZQWA 3VQDA 3OYIA 4FLUA 2PYJA 4J9PA 4FJ5A 5DGAA 3OYKA 1S9GA 4FCYA 2JEJA 3DLBA 3O4QA 3ZSVA 4ID5A 5KFYA 2RDJA 4ECZA 4H8KA 1LAVA 3BJYA 3M8RA 2BHNA 2XRIA 4BE1A 1WLJA 4ECUA 3RJEA 3NHGA 3QEVA 1IKWA 5J2GA 1TK0A 5D49A 2XGQA 4CEBA 1BI4A 1Q9XA 4O3SA 1Y97A 1SL2A 4RG8A 2JEFA 1H38A 2HHXA 1T8EA 2PI5A 5HMMA 2FLNA 5IIKA 1RTHA 2YV0X 4DG1A 1ZBIA 3PR5B 1R0AA 3GIKA 1XU4A 4F50A 3NF6A 1QTMA 4C8KA 4FZYA 4QWBA 1MU2A 3U6FA 5DB7A 5HRPA 4ELVA 3G6YA 1JLFA 1S9FA 1Z00A 4Z6DA 4FJKA 3LP0A 2P51A 4CGHA 8ICFA 1UOCA 3SPYA 2J6TA 3GIJA 4TQSA 4P4MA 2BPGA 3VQEA 4CJ5A 4FLXA 3ZSOA 2FMPA 3DLHA 4FK2A 3SUPA 2R8KA 1NJWA 4UBBA 3EWAA 5HRNA 1B92A 4IFVA 8ICTA 4B9VA 5KG7A 3MFHA 3ZDEA 4I2HA 1ZQGA 1RDDA 5KT7A 3NDKA 4RW9A 4O5EA 4F5NA 1YT3A 9ICWA 5TZVA 5FROA 4KREA 4CGIA 4CGJA 4DU4A 1RYSA 3TAFA 1D9FA 3GIIA 8ICKA 3ZT1A 1BL3A 1VK0A 1MSWD 3I8DA 3MR6A 5CYMA 1JL1A 4AHSA 8ICAA 3UQ0A 3RJFA 4KLLA 4M3RA 4I9QA 1NOMA 9ICHA 1BVSA 1LW2A 4AHRA 3KLFA 2BQRA 1Z25A 4XUSA 3RMCA 1ZQHA 4YD2A 5J0YA 9ICPA 1BQMA 3RRHA 3ZDAA 1HUOA 2HNYA 2F1HA 2NRXA 4DFJA 5CB1A 4E89A 1L3UA 2YKNA 4Z4CA 1IG9A 4FJJA 3B6PA 5KTQA 1SKSA 2VA2A 3V6KA 1S6PA 4DTXA 4BXOB 1TKZA 1Q8IA 3K75D 4JV2A 5KG1A 2Y1IA 3AO3A 4OPKA 1KTQA 4QZIA 5KFKA 1ZBHA 3HT3A 5C25A 4YR2A 5C42A 3GDXA 2DPJA 4R63A 4R65A 2XC9A 4KLHA 2P6RA 4CJVA 4RQ3A 4YFKA 2F96A 2IOCA 4MEXA 1BPXA 1ZQEA 4NM1A 3RAQA 3KHHA 3ZDDA 1U4BA 1SUQA 4GLXA 3QNOA 5DQHA 3SUNA 3OJSA 8ICPA 2OZSA 4LVSA 2ALZA 4ECXA 2ASLA 1A77A 3A2FA 3AVIA
chains in the Genus database with same CATH superfamily
2QTWA 3D6HB 1HYSA 3G96A 5ETKA 3ISDA 2HQIA 4DCJB 1RK8A 2W7OA 1UEVA 1ZH5A 2GVDB 3MCMA 1X31C 4GRSA 4FLZA 1ZBTA 8RUCA 3VAHA 3AOAA 4LF6F 3IM8A 2KIVA 4O3NA 1ASWA 4Q5VA 4NOHA 1WSJA 2LEPA 3L3CA 1MQ3A 1NJXA 5T7LA 3AVKA 1U1NA 4Y2MA 2FIUA 2FY8A 4CO0A 4DTUA 2HIQA 4H5TA 3BKFA 3TADA 3LDNA 2AJ4A 5DBCA 3CNQP 3SSRA 5IM0B 3K5NA 2NXEA 2HHHJ 1T3VA 3L2UA 4A46A 1SC4B 4NYZA 2H5JB 4TUSA 3C29A 5I3PA 3ZT4A 4DFPA 2BKPA 3EGWB 4DS5A 1EP4A 4DTSA 4PXBA 3WX4A 2FVSA 2GMHA 4G1IA 3F73A 3CCES 2XTJP 3TFRA 3VGTA 4MQ3A 3ITHB 1EARA 3KKAC 4J9QA 4DMNA 3AARA 2QWNA 3O1WA 3H25A 3O8WA 3TAEA 4DR4K 1YSJA 1DOQA 2W01A 1ZQPA 3M8SA 3ZZYA 2ZTCA 3TADC 4CF3A 1KC8O 2D1CA 1HMVA 3NMAA 3OA9A 2KU7A 4Y2JA 1RQNA 3M2RA 4UOFA 5AQVA 5JUMA 3ONQA 5J2CA 1HR0F 4ECVA 1URJA 1XIQA 4K7QA 1JKHA 2OANA 1BO5O 1WWVA 3G86A 2GHWA 3IRXA 1WSEA 4ZVRB 1VRUA 1RDFA 4DL2A 1XERA 2AEJA 3TTDA 2LPEA 1Q8LA 1M1HA 2RF2A 1SGGA 3ETLA 1R8AA 1C0TB 4DWIA 3GJRB 4CF9A 2P2CB 2BQUA 1FO1A 1FIQA 5LMUK 2ZXHA 3Q2TC 2V8DA 3ZO7A 2X3GA 1BWVA 4KMUA 1OWXA 4ED1A 3FZHA 3C6TA 2RF2B 2Z1JA 1PBAA 4KITB 1WELA 3VEOA 1RDCA 2WC9A 1N5SA 1QS4A 1Z6RA 3G8SA 1VRTA 2ZIUB 2OCEA 4FOIA 2GGPB 1EWRA 1YIJS 1JKHB 1LOTB 1WF2A 3NKYA 5MLCQ 3O3FA 4LFCF 2JHEA 4BC7A 1WKJA 4PZVA 5HRSA 2IFXA 2PYLA 4Z4EA 3EW9A 3H0MB 1JB0C 1RCOB 1NPKA 2HK2A 2ZJ5A 3K59A 3DU5A 3CVKA 3QU9A 4ZITA 5AM0A 2EAMA 3A8IA 5JVHQ 2IC3A 3ENWA 1SKRA 3V81B 4WF9L 2QE5A 1GOCA 3QESA 3QGPA 1ZQCA 2M0GB 1NK7A 3U27A 1CBKA 3QBWA 1PK1A 1EIYB 2ZZTA 4FF2A 1UW9A 1JJ4A 3VEVA 3G4SS 4A8MP 2I1QA 5IZHA 4OYAA 3QIOA 3F5EA 4I6MA 3CC7S 1SQGA 2B4JA 4H03B 4XEIA 5J0TA 8ICRA 4WXWA 1ESVA 8ICZA 2IBKA 1M5VC 4R66A 1IVZA 3KDNA 3I1YA 1G1XA 3PHTA 3CCEN 4HEA9 3D9BA 3M6ZA 4A8QA 3OQ2A 2D0AA 1WHYA 4ED7A 4P72A 3MBYA 1WC1A 4UB6U 4OKKA 1JL2A 4K4XA 1BISA 3VQ8A 3D2FB 1ZOLA 2IY5B 2RQCA 4OYPA 4Y65A 1PC4A 4IL6U 3ITHA 2ITGA 2UXBJ 4RT2A 3MPUB 3HSDA 3V7JA 5BYRA 2L9NA 1HNIA 4CT9A 3KJQB 2LLZA 3D7SB 2UUBK 2P66A 2VJUA 5AQGA 3FYHA 3U1MA 4AHTA 5C24B 2MLYA 2MQOA 3KYLA 9ICMA 2YI1A 1Z4OA 1X5OA 4PXDA 1YITN 3OLAA 4Y6IA 1RT5B 4UARA 2A1RA 1I94F 4Y2VA 2RS2A 4A5BA 2XI9A 1J5OB 2KZ3A 2E3TA 1CEZA 2B9XA 1YIJN 4DV5F 4OFZA 4H0TB 2FI1A 1VMBA 4MLHA 1T9TA 2IC3B 2UUTA 1ZQSA 4NA1A 1AQ6A 2W25A 3ADAC 5CP2A 4W90B 2OUGA 4ZPDA 2VB6A 5KFMA 4KHQA 4J9MA 1RAJA 4F9OA 3FCWA 1IWAA 2MAXA 2YHYA 1HWLA 2H54B 3T1HF 4K0KK 4YMOA 3P39A 1FK9A 3HXMA 2IOHA 3M9NB 4ZCKA 2DFEA 9ICUA 3PYEA 3TR5A 3T1YJ 2XWXA 1ZYQA 4I4BA 4RJVA 2CPHA 1L8OA 1SJ1A 3UB5A 3MUMP 1ATNA 2G13A 5BR8K 8ICCA 4O8UA 1TV9A 2EX3A 1VDHA 4B3SF 1N5XA 2MXYA 3CCMS 5KG0A 1HNZF 3GPAA 4LT6A 1FRKA 2AH5A 3HK2A 3CJ0A 2R9LA 4ZVHA 2AF6A 1ZQTA 3H45C 3SQOP 3Q8UA 1RBSA 1YJTA 9ICNA 1F5CA 3KLGB 5J0WA 2QRRA 2KKPA 3DXBA 4OJ1A 4H5WA 3DJCA 3QUQA 3AA2A 4X62K 2DRDA 3R3LA 3RH6A 3TKAA 1J2VA 4DV4J 4PG7A 1S48A 8ICWA 3FCVA 4CEFA 2V4JA 2KRBA 4JI8J 3VQSA 2KKHA 2CQGA 5J2QA 4JUZA 4PA1A 3F56A 4LFAF 3K2YA 5GAGU 4F3TA 3CB4A 1ZD5A 3TX0A 2AV5A 3OHBA 4NLVA 4EEKA 2MQMA 2Q3SA 1IKYA 1WDTA 4M9NA 2MKSA 3CULA 2YX4A 3VEXA 1G6BA 4RW4B 3O8MA 3GG4A 1TQLA 4Y2KA 2D9OA 2ZUGA 1IUJA 2K4EA 2HRTA 3NXZA 5AKLA 1CXUA 3GBTA 3EGNA 3ZSXA 2Z8QA 3SZ2A 4IUFA 2LVWA 1XMOK 5KFNA 3DYAB 2GQ2A 4WCEQ 3NY0A 2OXOA 3NBPA 1EKSA 2A5XA 3HYFA 3JB9k 4PRFA 5AQLA 5AQIA 2DGTA 2FHKA 5BYQA 2W43A 4W98A 5ETSA 2YKMB 3IWLA 3DWLA 2UU9J 3I32A 1V9OA 3MOJB 1NHVA 4BLGA 3VMFB 2WF7A 5DDOC 3LWMA 1U04A 3WK8A 2QJ3A 4AL7A 2CGKA 4UW9A 5E7OB 5M1QA 2GBZA 3OYBA 2B4VA 3D67A 2ASMA 4C11B 2A41A 3RW7A 1N34J 4ZVEA 1QVGR 1WBDA 2CQ2A 1HNXK 3O1BA 1ZQVA 3M2VA 2LP4A 4Y2AA 2MKJA 4MAKA 2HRYA 2V63A 2YJEA 1UA1A 4FE3A 3W2WB 1SV5A 3OXFA 1YVNA 2XEXA 4Y2PA 4H0XB 2VG7B 3CERA 5C0YA 2D0CA 4NL5A 3VQCA 3MMAB 2E5LF 2JH7A 4AHVA 1DURA 5CXTA 4NYNA 4FZNA 1JUDA 4BE0A 2EKNA 4LD0A 1WOPA 4J37A 2XGPA 2APOA 3W8PA 2YNIB 2A6AA 4PPXA 2PFUA 2R7RA 3JSRA 2XY6A 2FDRA 4HH0A 3R3TA 4A8WA 3O5BA 3W3DA 4M95A 3IHQB 4IOAQ 3OTDA 3NCQA 4O5FA 5AQRA 3GV5B 4KQZA 5KFRA 3TRGA 1S1XB 2QWRA 1V3SA 1CZBA 3DXKA 4BCAA 3ASMA 1PBUA 3D0IE 3LPUA 1HW9A 4M3TA 2MEWA 4U8VA 5A2QU 4I6MB 3BSOA 3H8JA 2RKIB 2LYHA 4TY8B 1QSSA 2WF5A 3CCRN 2WOMB 4UOHA 2P9CA 1OYDA 4HHTA 3OTOK 4OX9K 2V8VA 3GG0A 4E7IA 3F5AA 2H5EA 4YB1P 3CYMA 4GFJA 4NI2B 1FD8A 2UVUA 1YDLA 3T9NA 2MMYA 3JAMU 2VWKA 4WCEL 3C21A 1RT6A 2NPFA 4FBTA 1A6SA 2OFGX 4H4MB 3KLHB 3JPRA 5ETLA 4ED6A 4PZNA 2HBQB 3OT9A 1WNSA 1B0VA 4ZVPB 3AXKA 3PHEA 3TTFA 2R2RA 1BWEA 2OGUA 4UAVA 1OPZA 1BA0A 1U0HA 1D3WA 2YPYA 2W40A 4U95A 2IJNA 2W9BA 2W11A 2XSJA 5GAHI 3ZZOA 3VQ9A 2HS3A 1TFYA 3D1QA 2ZEJA 2C3YA 1JCGA 3LYSA 1NKCA 4Z6EA 1KC8T 2PEBA 1UJ4A 1C20A 2VPWB 2FZKB 2DNMA 3AO4A 4I2IA 1S77D 3CJ2A 1S6QA 3C6UB 1XNQK 4C97A 3THXB 2PY5A 4WQ5A 1LKYB 1TK5A 2HNZB 4LF7F 2BE2A 3ZDBA 3AOBA 3U7JA 4ZCIA 3TSPA 1TFWA 1ZAXA 4F2RA 4X65J 5AI8A 7ICOA 3IRXB 4B17A 1R8PA 5CE3A 3L2WA 4KH5A 2HHSA 3AA3A 1Q0NA 3OYHA 3DAWA 1RU1A 2ZWHA 5LOQA 1SV0C 5U47A 3HSJA 1EX4A 3D3BJ 3HDSA 5DB6A 2K4HA 3AU6A 3R7NB 3AB4B 5ETQA 4QZGA 2P6UA 1RILA 5M1NA 4QJVA 4I64A 4KHNA 1PJ6A 4ISFA 3CFOA 4NE9C 2LA6A 5HBMB 2H48B 3HZ6A 1JXBA 3OYFA 2B3TB 4CJQA 5HVHA 1NJIT 5E0OA 4MFAA 5F8JA 3U9DA 3WK4A 5AQPA 3AQPA 1XNRK 1DK3A 4KHPF 2DNHA 1K8KB 2DGXA 3MDAA 3D45A 3BGOP 2DKOB 2HAIA 3LDLA 2E9ZA 2F8EX 2EZZA 3DRSA 1RXVA 2W4PA 3BP8A 1U2VB 4P0QB 4I2CA 3H42A 3OVAA 3CCVN 1OH6A 2RDIA 5DLGA 1NOZA 3AA5X 3C15B 4JI3J 3TU5A 4N8NA 3KZIU 2MZ1A 3DGVA 2WF9A 4TURA 3CTRA 1FTRA 1KSPA 5AJ3F 1NGBA 3GFXA 4W92B 3VF2A 1WAFA 4TU8A 1B9DA 4I2PA 3HI0A 2VFUA 4GVMA 3NF9A 2NYIA 4NLNA 2DCLA 1C4CA 1B43A 2UUWA 1SIJA 1RT3A 2MKCA 3SV4A 3RR7A 4TXSA 3OHRA 1S76D 2RNEA 3AVFA 3OGUA 1RAAB 2QSWA 5DBBA 4K4GA 3O9TA 1TR0A 1LXNA 1BY9A 2ISOA 4GVLA 1HEKA 2F2AB 1CI4A 3V1QA 4KI6A 1ZQBA 3EE3A 2E9RX 4KBIA 2FMQA 3JTNA 5F8IA 4HH1A 3BQ2A 4E7HA 3UQ2A 2CPEA 5B0EA 4MK7A 3IG8A 2WRMA 3QSYB 1D8ZA 5C12A 1RAHB 2G8IA 4C4TA 3CCSN 2BDPA 2D8CA 2P9IA 4FVCA 4LF4J 2WFBA 3T6BA 1BGXT 5DG8A 4YCXA 5KOXA 1Y88A 4ZS6A 1YITS 3P4IA 4DX5A 4XAKA 4DX7A 5J29A 2MU2A 3J7Z5 2P9PB 3NH1A 2RQMA 4KB0A 2VANA 5BOMA 1YAGA 1NJIO 2BPCA 2FMSA 4AHUA 7ICTA 2COLA 3S41A 4QZAA 3C5GA 2BW2A 3WC2A 2ZH3A 1WUDA 3BGUA 3IS9A 3G71N 4DR2J 1VBZA 2E1AA 3T5KA 5E41A 2ADCA 4WFNL 4KRFA 2PBDA 1XWLA 2K3KA 1BIZA 3CXCM 2HNYB 2BCVA 3HI9A 4IZ9A 2JZBA 3CC4N 1V4SA 2P8IA 3BZKA 1QJHA 1X4CA 4FKYA 3HFVA 1VQ9N 3BQ1A 4CLSA 4FKXA 1XMQF 1RHQB 2P9GA 3R7SB 3HVAA 4GO7X 1NGGA 2F9DA 3PIOL 3T1AA 1A76A 4YOUA 4FS2A 4K59A 3AY0A 1XMOF 3Q8MA 2LU1A 4WP9A 2I38A 4USKA 3ATUA 4IQUA 3QEBZ 4JYAF 3FVYA 5TISU 3J80O 4HKQA 4YOYA 4LF5J 4EZ6A 3N01A 4NZ6A 3IWXA 3KNGA 3AQOA 4GY2B 3G8QA 3O3GA 5EE0A 2FY1A 5ITHA 2XMAA 1RBTA 1TUVA 1ZOTA 4BBYA 3NCPA 3VAKA 3S3NA 2F1JA 5L9XA 1P1TA 3M8YA 4OYMA 4YDDB 1Y10A 2R2SA 1NGCA 1X0PA 6AT1B 4J7CA 3SBGA 4CJFA 4HUFA 2DT9A 4DS4A 4KI4A 1Y9OA 1L7NA 1ZQJA 4FM0A 4A8SA 2XMWA 2FC8A 3SMPA 5GIPA 4LFAK 2ZD1B 2J6SA 2IRXA 3QAUA 2A40A 3GCXP 4KSEB 1NJYA 2JSXA 2RVJA 2Y1RI 1HPZA 8ICIA 7AT1B 3LM2A 2OYQA 3HF5A 1WSIA 9RUBA 1NSQA 5HJXA 1SQEA 4P7TA 1U2VA 4M3XA 4KLEA 3WNFA 2U1AA 4OYOA 4B3RK 2FLPA 1QUPA 4NCGA 2EBGA 3E66A 4DPWA 2VODA 2YXLA 3BYPA 4HHJA 2E1ZA 4DUYK 3OUYB 2QG9B 1HIYA 3UCGA 4PGQA 1PCAA 1Y0HA 3FEXB 4CFDA 2VFVA 3FFIA 4NMLA 2QFJA 2PC6A 4DN0A 4C2MA 1RTJA 1V6HA 1AXQA 3CUNA 3UCUP 1X9XA 3DDIA 2QXFA 2E88A 1SKUB 4QS8A 2QA4N 2BKEA 4ECQA 4IQTA 1R8CA 4BRHA 1IV0A 4ZP7A 4RW6A 1VLOA 4DX8H 4R64A 2F65A 1X7VA 5BR8F 5AQXA 4CF8A 4CJEA 4O8KA 3QLHA 4IG3A 3LH2S 3MM8A 3HSCA 1NSPA 2CPZA 3DHWC 1V3ZA 4YR0A 3EXYA 2MPUA 1QQOA 2HQ3A 4DU3A 4IQMA 3PW7A 2HBKA 2QYCA 3ZT2A 2CZ4A 2A2DA 4IKAA 3ETRA 2UXBF 5AK5A 3R6GB 3FAHA 3KKAA 1EETB 3M6UA 4B9SA 5HMXA 4FWSA 3QWPA 5KFBA 4LBPA 3W7BA 2DBBA 1WI6A 4R5PA 3A0IX 2H3IA 1X4BA 3FRZA 4I2BA 1H6KX 5C2FA 2HVHA 2VKQA 4MFBA 2MZSA 2F8TA 1NM2A 1YRUA 3CDBA 5FLXY 2D0OA 3ID8A 3R8EA 1FDBA 3R2CJ 1FFSB 4A8FA 4XPCA 1HNZK 2JWKA 2J76E 4L72B 3TAGA 5EY4A 4JKFA 3TAQA 3FR0A 1HBNB 4FBUA 1BG3A 3C14B 2BUPA 1O1WA 3QEAZ 1KVAA 1LWXA 4OJ6A 2C2RA 2DXEA 2ZBQA 2IVYA 2DGUA 4DN9A 1WC5A 2AX0A 4HI2A 2BJEA 1RFQA 2B4PA 4TY9A 4RQMA 1APSA 3SJHA 4RNHA 3CMQA 4KHYA 1OQ6A 1QQMA 4WKYA 2HHPA 4LSLA 2VGNA 1ZQIA 4A4JA 2YQ1A 2BGGA 2W3SA 4Q8EA 3C8YA 1UT5A 2DNQA 5DZ7A 2WTUA 1VRUB 2JVOA 4KPYA 2JL9A 4DR5K 4ILHA 4CLKA 4F04B 1TTHB 4LF5F 4PAAA 1N5QA 3DM2A 1QAXA 1L6NA 2Q66A 1BPBA 3HSGA 3KLEA 2E8OA 4M3YA 3QIDA 4DI6A 4Y3CA 3J7ZT 5GAEP 4JV5K 5L39A 4FW2A 5AI5A 1UVNA 3QO9B 3HX0A 3BDPA 3VZHA 2PFNA 2BEFA 2YX1A 2V8GA 8ICJA 4FVMA 1DJ0A 1YBAA 2KT3A 3H20A 1NB7A 2DNRA 1DGSA 2YKMA 5JS2A 2GO8A 4BDYA 2IHMA 3HULA 3MDFA 1EXNA 3PKYA 1HIWA 3ZD9A 3TAMB 3RH5A 4HUGA 3GWCA 3BPDA 1WWUA 4P2MA 1IG8A 3CQ8A 3JYTA 1DK2A 4OGEA 1ASUA 4QOZB 3WNHA 3O9QA 1QHTA 3TOQA 1ZA1B 4HLBA 4B3MK 3U3YA 4CECA 4F71A 1YVFA 3G8TA 5EVZA 2VFSA 3CF5Q 2DGSA 4DJBA 2ROEA 1HD0A 1J27A 5KQ8A 2RIJA 1S1UB 1J5EK 4JB3A 4HYKA 5LM7E 4LSLB 4PPZA 9ICGA 1JLQA 2QLXA 4WE1B 1GLBG 3G25A 3DOMB 3VQ5A 4B9UA 5KG6A 4I6AA 4RPZA 1TL1A 3VQAA 1N48A 1YBUA 1YVUA 4YOEA 3MZIA 2F4VJ 4CF5A 1DARA 3WK7A 7ICVA 5KFFA 1SC1B 4FS1A 5DDMA 1UVIA 2Y8WA 2DPIA 3VCBA 2PMZC 4RQ1A 3PX4A 5KT2A 3P4UB 4IBNA 4CFBA 2A6MA 4ILGB 4FPAA 1HR0K 2VOPA 2XULA 3PSTA 3OJUA 1RDBA 2D7SA 3CJ1A 3MR2A 1EHWA 3LWLA 4GV3A 5JVGL 2HFZA 4DO9A 2ASPA 1QAYA 5KFVA 5KFDA 1VQ5S 3JQJA 2KXNB 4Y1CA 3ZT3A 4LFCK 1TYQB 4Y2RA 4YY3J 2HHHK 3MTKA 4RZRA 4IG0A 2UV8A 4B9NA 1YJ9S 1I3AA 1UWBB 2ISPA 1YJ7A 3ZZ0A 4C8ZA 3MWPA 2VASA 4B9TA 2MZRA 3AAPA 7FDRA 2QKKA 1HPMA 3FE1A 3A12A 2Y9UA 4OV6A 4HT5A 3B82A 1AZSA 4H5RA 1X3MA 2BMBA 5CR0A 3C2KA 1LVHA 2GIFA 2FTRA 4LRBA 2VWBA 2GS8A 1HD1A 2O66A 8ICHA 1U49A 4I2PB 4QPXA 1RLDA 1FKAF 4LSNA 2NRRA 3UWTA 2G0IA 1KLNA 3Q8KA 9ATCB 2D5RA 3EL2A 1Q3VA 4MIBA 1XS9D 2WB1D 1M1KO 2MY8A 3PACA 1I94J 2CJYB 3SEOA 2Y9TA 4OX6A 1NMDA 3TEGA 2VDIA 2WVCA 2GAGC 1IBKF 1N62A 7ICNA 2VUGA 4F4KA 5CZXA 2YNFA 4DR5F 3AL0B 2EH9A 5IV4A 2JRZA 3LP0B 3ZX2A 1ZM3A 2OSRA 1WOOA 2ZC3A 1UVJA 4UB2A 2C2ZB 8ICXA 2UUAK 3GB0A 3BBFA 4NYFA 1HQEA 1YJVA 1MU2B 2XCAA 4M9JA 1HNIB 5C15A 2QKQA 2B5JA 4ZPTR 2JOQA 1NAQA 4B08A 3MECA 1KNZA 1CULA 4DPYA 5A76A 3KJNB 5J8YC 4KTQA 4P10A 3S3OA 2GO9A 4FJNA 2BJ9A 3I87A 3SAGA 1D9AA 3QYPA 3UVJB 3LANA 4U6PA 4KYZA 2R7TA 2MQQA 4DUZF 1CJKB 4BJQA 2QLWA 4RUBA 2DXFA 2WHEA 5AKZA 1HKAA 2GJ2A 5CH7B 2OO4A 2E1PA 1P9QC 4NLXA 1YTAA 2W54A 3QXGA 3NH2A 4FJ7A 5B66U 2CIMA 1Z00B 3HZEA 5AQZA 3P5BP 3MGJA 4G1QA 4FO0A 3R7BB 1OSDA 2PFQA 3WU2U 4PPDA 1IKYB 3RAXA 1RXWA 2CYYA 3MOZA 1VSDA 1VQ6N 4RQ2A 1ZD2P 3UXOA 3MM9A 2LI6A 4C8OA 3TAMA 3ZTOA 2A1JA 3MHYA 3MTJA 3MCNA 4UB3A 2YWKA 3QPIA 4KH4A 1KOHA 2HKEA 3M7VA 4ICAA 4YHHK 5HQMA 1XUPO 2J7UA 4LFAJ 3TUPA 3BSAA 2GV9A 3THTA 5AIAA 1ACMB 3RJMB 2XICA 4DSIA 3AODA 1ZQOA 5AM2A 2AYBA 4QU7A 3CEDA 4LVOP 1WHVA 5LJ5Y 4AH9A 1NGJA 3MMCB 3HVRA 2DIUA 3C28A 4CI6A 3NEKA 3GIRA 4F0HA 4L8RB 2C3PA 5LMNJ 2YN4A 4JKEA 5EGYA 2FJ6A 4OZNA 4PWDA 4DF4A 2BANA 4B8AB 5KFPA 5J2IA 2H5XA 1UAWA 4JI2J 1RBOB 2Q97A 3H5UA 3OBIA 2KK0A 1COOA 2HLUA 4ZLLA 1KN5A 7ICGA 4OZJA 3CQXA 2MDAA 3C3LA 4WJBA 3KG1A 4AQYK 3VC8A 3QBXA 3MXIA 1HBOA 3IG1A 1Z05A 3MEEB 1GLLO 4ES1A 1RXOB 2GJFA 2ZUAA 2GVZB 4LRDA 3GE1A 2OLWA 2ZH5A 4FXWA 1N34F 1R0BG 1RTDA 3AVLA 4KHSA 3NASA 3W66A 4GXKA 2RE1A 4O3RA 5FP0A 1AUDA 1FVSA 2Z2LA 1Z2ZA 3IUCA 1TAMA 4BRKA 1HNWJ 3K5LA 2PN6A 4A59A 4NCBA 4O23A 2W9CA 2IBOA 4EFAC 2QTDA 3ENBA 1K0VA 2ESEA 2Y0SC 4M63C 1JJ2R 2HOIA 4QIGA 4DF8A 2CVIA 1VIXA 3KFWX 2HBLA 1SV5B 3M2UB 5AXLA 4FM2A 4K0KJ 4EU0A 4BX9C 2Z2YB 4URQU 3W0LA 4BC4A 2OPPB 4ZJQA 3W2VA 4K43A 1DLOB 3BF4A 4FJMA 4KPCA 2HZAA 4OZ5A 1H7XA 5CWRA 4ANCA 4CFAA 3Q8SB 1WG8A 2AA4A 2NO4A 4DOBA 4LFBF 1RBAA 4M5KA 2KHVA 3DN9A 4Z94A 2D69A 2XBPA 2G8WA 5IILA 4F0MA 4YOVA 2WSCC 1FA0A 4HTUA 1FERA 3GP9A 3Q89A 3AAWB 3MXJA 3ZETA 5H9FJ 4C80A 2L9WA 2D0BA 4YHHJ 3NOGA 2V51B 4ETZA 3ORYA 2DKXA 3RB3A 1RU2A 4BRQA 2B0CA 2A10A 1KEKA 3GFZA 5KPTA 4FWNA 4AYBF 3CCJS 3ALRA 1ZQWA 4QNLA 3IP0A 3VQDA 1MA9B 3GOIA 2PYJA 5DGAA 2KSOA 4D3HA 1UCNA 3JS9A 3TX8A 3BPSP 3PJWA 4BRMA 4QU6A 3VZIA 2V8PA 1MNEA 2DGQA 2CNOB 4IYQA 5KFYA 3OTBA 2BE2B 1JJ2M 3AHPA 4USMA 2LDYA 1DXSA 1X4AA 1VBKA 2VKRA 1N33F 1IKWA 2IAJB 5ADXH 2MB0B 1TK0A 3T9ZA 2XGQA 3B4DA 4X66K 5D0HA 2KICA 1EZZB 4RG8A 2JEFA 4JP8A 2C2KB 2HHXA 2F9JA 5AQMA 4Y2UA 1T8EA 3H2VE 2HVZA 2OHDA 4ZOHC 2KVIA 2YV0X 1Q7YT 4DV6F 1R0AA 1XU4A 2J9DA 3JTOA 3UDCA 4C8KA 1WF1A 2BJ7A 3U6FA 2CPIA 3P45B 4PXCA 3KD3A 4ELVA 1IBLK 1DKGD 3G6YA 2AD9A 3PSIA 1YRTA 2XG8A 3K8VA 3K0JA 3ILJA 3H3NO 1VRTB 5ETOA 3UDVA 2AZ3A 1AYEA 2ODGA 4C3KA 2VFRA 3VQEA 4LR8A 2CXEA 1QD1A 3VGUA 4BC2A 2R8KA 5ALTA 4UBBA 1H72C 1S1WB 4NXMK 3SBTA 2LXIA 4ISEA 3ZZTA 3CD7A 4AL6A 3MFHA 4K4YA 1VC0A 3WX8A 4KHPK 1DGJA 1SIZA 2D3DA 3AQFA 5TZVA 3PFEA 3KHYA 1VHXA 3TAFA 8ICKA 3OUYA 2LMIA 1PSDA 4YDUA 2E5HA 5CYMA 3LM9A 3F2CA 4AHSA 4YOTA 2M0NA 5JMVA 1H73A 1YWXA 1HQ2A 2LFVA 3HBTA 3F5TA 1LQ9A 3HT0A 1SH2A 1R0AB 2IYIA 2CG4A 4YD2A 3I5CA 3FEYB 1VBYA 1HUOA 2F1HA 1TUGB 4DFJA 2NRXA 4E89A 2ZIWA 3B9JA 2YKNA 1FRLA 5F8NA 1F60B 2CQCA 2E20A 4Y0WA 2NREA 3H90A 2VA2A 5AZIA 5FLXU 3K75D 5KG1A 4DR1J 3F44A 5C25A 4YR2A 2XC9A 4KLHA 5T7LB 2XLJA 4YOWA 1KW4A 4RQ3A 1EQYA 1VQ7S 3IRUA 5AQTA 2VD3A 2Y9HA 2F96A 2IOCA 2V69A 1BPXA 3CCVS 1ZQEA 2NZ4A 2H65B 3L09A 4NX9A 2HCFA 3KHHA 2LYVA 1XR6A 3ZDDA 3KUEA 2AJFE 1O13A 2ERRA 4A8XA 1GXLA 1S72N 3WK9A 1CJTB 8ICPA 3CCUN 3DGPB 1SH3A 2BJDA 4LVSA 5MLCV 5H1SQ 4JEPA 1S7IA 5HMWA 3GZ7A 3MUTP 2H3ZA 1A77A 3J81U 4FZMA 4I2QB 3H08A 4DPXA 2IGIA 7ICMA 3ZT0A 2V67A 3AVJA 4RQ0A 4IJNA 3GV8B 2HSEB 3VGVA 4TKTA 3RSEA 3C95A 1DRGA 2A3VA 2RRDA 4AT1B 3UXPA 4YR3A 1OSCA 4ZOSA 4L3KA 2YWHA 2UXCK 4O3MA 1AFJA 2HNDA 5AQYA 3N9UC 5E2QA 3QFHA 3NS6A 3Q8VA 2I9GA 1N33J 1M1KT 3EGVA 2IJFA 2P5OA 4NXMJ 4ANEA 3RBEA 3AA4A 2Z1HA 3TEHB 4DV3F 3LGMA 1B7YB 1QQNA 4QS9A 2PSZA 2AP1A 4O4RA 3VA0A 4W5OA 1NGDA 4M94A 3JQKA 3QAEA 1LWFA 4BROA 4H4MA 4XH4A 2PE8A 4AM6A 4DR2F 4OZ3A 4ILLA 1GLJO 2H3FA 1C7YA 4JHDB 1FX4A 5F3TA 2F63A 2BJ3A 4FXVA 4DV1F 4DV7J 2VQEK 2E2QA 1U1QA 1S4FA 5KG3A 2FC9A 1N36F 1IR0A 2PFOA 2W2MP 4NXNF 1UVLA 1XQSC 2KKVA 5G4DA 4CLLA 2HFSA 1XSLA 4XIUA 5J2NA 1MW7A 3TACB 2O8DB 4NLQA 3QRQA 3TWZA 3EPIA 1TU0B 2RAQA 5ETNA 2PDAA 2NSBA 3QJLA 5KG5A 4M5HA 2P9LA 4IS7A 2RS8A 2RLTA 1VQ7N 1JX4A 2NRVA 2QW9A 4I2EA 3J81O 4E1MA 5DRKA 3WKDA 2R7QA 2QT7A 3ZSWA 4BGBA 4ZK7M 1Y64A 1WHWA 1T6DA 3U26A 3O3HA 2HQFA 2KG0A 3BR8A 4OJPA 2H3VA 2CUYA 2YX7A 2W9BB 3OYGA 2BXJA 3AGRA 2DR8A 4UY8T 2DNGA 2BZFA 4M7YA 2HYIB 2DKZA 3D0HE 2AGPA 4USUA 4ZVSB 1E4GT 1NDLA 4WFAQ 1QTNB 4KGKA 2MLXA 3T79A 3SMVA 1ZQMA 4ECWA 3BB5A 4USAA 3N28A 4CO4A 2V7YA 3W63A 3SQIA 1YJUA 4RUAA 1RWOB 4G9BA 2GWSA 2R8GA 4JKGB 4JLHA 1PUZA 3PCOB 2WSFC 3OSPA 1VSMA 2VWJA 3QEIA 3ISNC 1QSLA 2D74B 2F8KA 4QIWC 1HJRA 2BCUA 2NRWA 3OR1A 4FL9A 3NVWA 4AD6A 3QUTA 1NWKA 4KY3A 5DDRC 2MUTB 1NNLA 2ZKTA 2DYAA 4FYXB 5DDQC 4PUOA 2NXJA 3TSUA 3ZETB 4XO0A 3O1LA 3W60A 3UKUB 2FJWA 4XDDA 2LYBA 5AICA 2FJBB 1SJ4P 4JI4F 2X1FA 2ZF5O 2CDRB 5KI6A 1UT8A 1JJHA 4OV1A 3M6KA 2C2NA 5DDYA 2CADA 5DMRA 2CQ0A 2ZH8A 1B64A 3EE9A 5FPNA 3IGVA 5KFHA 2YNHB 1FXDA 4CJRA 4KLUA 5HMZA 4NA2A 4IJAA 1Q3UA 3BZQA 1Q8BA 4F36A 2EAPA 3QGHA 5I3UB 3TUJC 2G9OA 4JD2B 1XK8A 1NZBA 4CF4A 1DBDA 2ZBCA 4R25A 4DHVA 3FBCA 3VQ4A 2Q36A 4RNMA 2ZH9A 2AJQA 1WACA 2IM0A 3D28A 5JS1A 2VA8A 1TL5A 3EWGA 3KLHA 3GJSB 3VGMA 1RT6B 4YMEA 3ISZA 4QWEA 3CO9A 5BPCA 3TPQA 1MA7A 5KRTA 2CJKA 2CGLA 2UZAA 2VICA 4ZTJA 1LWEB 2OTJS 2KHDA 2BR0A 4TUQA 1CVJA 4ZLJA 3NVZA 1U2FA 2DNPA 3MF5A 1ECWA 3OVBA 1Y00A 1N0UA 4UB8U 1HI0P 3MABA 1QVGM 1PYSB 4RLEA 3H46O 2DGWA 4N5SA 2NXUA 3CJBA 2XM3A 5G0RB 2CPXA 2W2QP 2AMCB 2M9KA 2M5YA 3CJRA 1VQLS 3R9PA 2KVSA 1XTZA 3HP9A 2V4RA 3QICA 2MHEA 3O9SA 2V2KA 3VAGA 3GU3A 2B4OA 2GIQA 5F1XA 3RJJA 2DISA 1T6CA 2DO0A 3ULDA 3SXLA 4CZJA 1ZA2B 3D6TB 1I94K 3MM6B 1GMUA 1Q81T 3RF9A 1VQNN 1CS4B 1FRXA 4IOXA 5HP1A 5DK5A 2ASOA 4M3ZA 1KS2A 3DLGB 2B8PA 2D3OR 2VG7A 1BLUA 3I6PA 2GX9A 1XSPA 2IAJA 1J5OA 1KAXA 7ICSA 2A42A 4UQGA 1VQ8N 3B6OA 1IM4A 2ZJQQ 4LQ3A 1NK8A 2LXFA 2WAQF 3OW2R 4BDPA 3SENA 1ICEB 1I5OB 4M5IA 2VG5A 1EO1A 4LF9K 1CLQA 4RQ7A 4F2SA 4P52A 1U1OA 2FBYA 3NTUA 5LSOA 2AYGA 5IC6B 4OLAA 2CH6A 5LJVA 4EZ9A 1JK9B 1CSJA 3G10A 1L7PA 2RJZA 4FN5A 5CHCB 4OLPA 2CAJA 1U8WA 3GE9A 3TP2A 3AXMA 3DC2A 4NYPA 3K1RB 2R3VA 4K2XA 4MF8A 4LF7J 2KT2A 3OS2A 3E0FA 1BPYA 3M8QB 1HBUA 4ZN3A 3R5AA 5LMNF 1KBUA 2B0GA 2ZJRL 5DJBA 4RW8A 4WYWA 5HANA 3JAMO 3ENVA 3NF7A 4GKKK 2ZWPA 4H4KA 4DR3J 5F3ZA 2BH1A 4DV2J 4BWMA 2OEHA 4ICLA 1XR5A 4RX6A 4U7CA 1UWBA 5BPLA 4M5DB 2GC8A 4NB4A 3ALYA 8ATCB 2GAHC 1ZPVA 4Y2YA 4KTZA 2HWHA 3QZ8A 1RTHB 3C16B 1ZC6A 2A1SA 4RQNA 2EG2A 3NGIA 3J80U 1S6OA 2AJ2A 3LVVA 1QZ5A 2Q0UA 1T9VA 4GV9A 3MX2A 3TZXA 1VC6A 1MLAA 2W6KA 4OJLA 3KFUF 3PW4A 1CJVA 2QGFB 1H2TZ 3OHAA 5KL1B 2DNLA 4JI0K 2R4FA 1MWMA 1FRIA 2F8LA 3M7DA 3OBWA 2M2BA 3TUZC 1PG5B 1OH8A 4KB1A 2QL9B 1RTIB 3BR9A 3US5A 4EX7A 3D6RA 2G8KA 5H1SV 1ZQUA 4DCCA 4OYWA 1NM1A 2YWGA 1FESA 5J0XA 1RHRB 2DH8A 3VERA 2G8UA 1S0NA 1C0FA 1QQ5A 3T69A 5ALYA 2E5JA 2HOFA 1RT2A 4OL8A 1AZSB 3J81j 4Z7CA 2BQ3A 2E6MA 1Y7PA 5KPZA 2F3JA 2HHWA 3M3ZA 2IDOA 1RDUA 4NL9A 2H4WB 4L3QA 2RILA 4M2YA 1ZBFA 1P8GA 3N6MA 3EUB2 2KHQA 2HPUA 1JMTA 2CGJA 3H8WA 3KBBA 1WSRA 1FJGF 2E1RA 3L8BA 1OKJA 5EWEA 1CXQA 3ELHA 3IDHA 5AI9A 2AGQA 3CCQS 3QSIA 1FJGK 2VBWA 5HK4A 3LP3A 3ZZPA 2F3NA 1SJQA 2JWNA 5IIOA 4U96A 4KRWA 4WQ5C 3K58A 4Q0BB 2B8QA 3CJ3A 2K8CB 5DZ6A 3JPTA 1W2IA 3G9CA 4DV2K 3FCHA 3S9HA 3KOAA 2DNZA 3SI6A 3HP6A 2AYEA 4QIFA 1CJUB 1T44A 5J1EA 1N32F 4JI6J 4RU9A 4UZBA 4L3NA 2XMKA 5HROB 3OYLA 4CJSA 3F2BA 5L1KA 1PVRA 3A3OB 2KVQE 5K5MA 3CMEN 1WHXA 3UN3A 2FHOB 1YJWN 4CVNE 5DM7Q 7ICHA 1FDNA 3DRRB 3PJXA 2NRZA 2JNJA 4AM7A 1CQMA 2RHKA 1IKXA 4CBWA 2ZIVB 5KFIA 3D2EA 4CIEA 1VQ5N 2FB0A 1DTTA 4NRTA 3B54A 1VQ4S 2DGOA 3QUCA 4QR1A 4P7VA 3DOKA 3M30A 1EWQA 2FPKA 5IT9U 4I69A 4KFBB 4CIFA 2MQ8A 4K8RA 3R5JB 1WSHA 2B6AA 3KZXA 3PYGA 3HHKA 4K4UA 4DTNA 4LIRA 1PYOB 2FQQB 1FEHA 3FBEA 3CPEA 4CEZA 4YORA 4HI1A 1HNVA 1VQON 1TKZB 1Q46A 1ZQZA 3ZFVA 4J2EA 3W5XA 3QBCA 1NRKA 2AJ0A 2XO7A 3U1NA 3CFRA 3MR7A 1N8RT 2KFNA 4CJ4A 5J2AA 2RE2A 5J2MB 4PKDB 4CJUA 1VFJA 2GVZA 4CK3A 5BRFA 2U2FA 2BE7D 2QC3A 2ZZMA 4HT7A 4CHZA 4RWXA 5GAGP 4IO9Q 2G5HB 3RB4A 1LWFB 5B09A 3CJCA 4NV0A 3PW5A 3CJTA 5KPRA 3SFUA 2HURA 1SCJB 1HA1A 1VJ5A 4FLWA 3DU6A 5JJBA 2W1BA 1ZZFA 4O44B 3SJJA 3BBBA 3C14A 3MAAA 4JI1F 1JCEA 4Q8FA 4DR6F 2WF8A 2H3QA 4QZEA 5ALXA 1RWUA 2XHCA 2P9KA 3QDKA 3U3GA 3OL7A 3AMZA 4RPXA 3VALA 1UCVA 4RQ5A 4XH5A 3AD8C 4LJMA 4KLJA 4CWBA 3DOLA 3QATA 4J9UE 2ZGYA 3IR6B 4JI6K 2GHVC 3E01A 3QUBA 5J2HA 4DV0F 1N56A 3M9OB 1P90A 1H2UX 4LREA 3ZYYX 4GVBA 5HOOA 2H51B 3EN9A 3RMAA 8ICSA 2ALYB 1R31A 3LP2A 2WBMA 2JLEA 4KLFA 4DR1K 3NVKA 4ACOA 3F2KA 4FM1A 2BRLA 3OTQA 3ZTPA 4E3SA 2FHMA 4K4WA 5HSPA 1JLGA 2C42A 4CJLA 4ELUA 2CWKA 3CI5A 3NWGA 4I0WA 3M6GA 1VQ4N 5AQUA 5F0XA 2FUG9 2P9UA 3KLFB 4KKOB 4GVEA 4DR4J 2FSNA 4RW6B 4DFMA 3AVHA 2JHDA 2W8LA 4CE6A 3HD1A 2EFQA 5C25B 3A8EA 5A8KB 4K5SA 3IA0A 1C4AA 4B1ZA 4ITSA 2VJ5A 1X2IA 4WK3A 4BQZA 2PEHA 2DH9A 1V38A 1SL1A 1U48A 4NPOA 2KI2A 3W5YA 1VYAA 4JI5K 2XS7A 4OCZA 5EX3A 2ZGZA 1F9EB 5E3PA 4RQ6A 4K42A 1N6QA 1WEZA 3W65A 4QCLA 4V19J 4MKVA 3DLEA 4DL6A 3IBCB 3OL9A 1QLNA 1SH0A 4QWCA 4ZP8A 1JLBB 3C19A 2AEMA 4KX5A 1GQEA 2MY7A 1RLCL 4WFBQ 4OZLA 4N47A 1SXEA 4CEEA 1NPRA 3Q8PB 3KK1A 4KC5A 5FDLA 2KKZA 1LFPA 1KOOA 1ZQNA 3RB6A 1EQMA 2BM0A 5K8OA 3NH0A 1TVRB 1LOUA 1YG0A 4KV8A 2ITMA 8ICMA 1LFWA 4I67A 4I7FA 1SZPA 4ED3A 3HTVA 1C6VA 3MPWA 5LY3A 1AB8A 3SQGA 4BR0A 3W2VB 3DLLQ 4S0MA 2ZOGA 4K8ZA 2HQCA 4NLPA 4P4OA 2C2DA 4Z6CA 1Z1BA 2W4DA 4IR9A 4X4QA 4ILMA 3PRDA 3LPTA 5M1FA 3L0QA 2JEIA 2W3RA 4X65K 1HW8A 2M52A 3L2RA 4MEYA 2ZC4A 3LGNA 1VQ8S 4DR6K 3BKTA 4IRKA 2XSFA 3A0BU 2EFNA 4ZHRA 4OJ5A 4OMFG 4ZMMA 1UP1A 3Q2SC 2QYGA 3AVBA 1UEUA 3MK6A 3IN5A 4B3TK 3DXMA 4LRFA 3BO2A 4ILJA 1OH7A 4B9LA 3VHQA 2PKEA 3WDOA 2PMZD 1Z4NA 4FZVA 3T1YK 3AOCA 5AZJA 2BCSA 1M5OC 1L8LA 1Q79A 2XZTB 1QY7A 1S99A 2VHGA 3PRVA 3MAAB 2PFFB 5M1OA 2LA4A 5GAHU 3N4MB 1LKYA 4YMNA 4JI3K 4CLPA 4B1YB 2RQ5A 3GYGA 3I9ZA 2IM1A 4MFBB 4JI1J 3R8YA 3R5DA 3QRRA 1M6YA 2ROPA 5ALEA 2XLKA 3T19A 1GX5A 3QQCD 1SZHA 1NGEA 1RA6A 1CUKA 2YB1A 3A8KA 1YZ6A 1WB9A 3LOUA 2OMOA 1CQNA 2VFTA 2P9SA 1RYUA 5AK4A 2D3ZA 4DKWA 1HI1A 2VCPA 4KR0B 2J9EA 4XPEA 3SQ1A 1E6VB 2W55A 2KN4A 5ALPA 2CQ4A 2P9SB 3RAMA 3QJJA 3KJVA 4F3QA 2CQPA 3R2DJ 4YXJA 4DUYJ 3WC0A 4B9MA 4CO2A 1U6ZA 1NGHA 5DQIA 5K14A 3M5RA 1KFTA 4NI2A 1F9HA 4US8A 4KLDA 3UKUA 3MR5A 4EBDA 2QMUB 3V72A 5J0PA 2VG6B 3H6EA 4J91A 1NDPA 3HKZD 4DR7J 1JLQB 3T7ZA 2OEKA 3CJKA 4CZHA 4WQ4C 5D4BA 3UPQA 1UVKA 3VGKA 2N3OA 3MGHA 4YEAA 2DIVA 2BCRA 1UPHA 5CZVA 1F3VA 1REGX 1LWCA 5IQ6A 1G15A 3THWB 3L4IA 4WYBA 2AEFA 2OH2A 2KSOB 4P4PA 3UQSA 3VAFA 2YNGA 5HNKA 1TV6A 3D2SA 1KLMA 1VK8A 3AB2B 7ICQA 1U24A 5CCMA 3CM5A 5LMUJ 4DR2K 5KT6A 1Y11A 4KX3A 2RB7A 4OHZA 3SYZA 4CDIA 4CF1A 1X6JA 2R7OA 3AD7C 4JV1A 4ZVQB 4ZJOA 1HX1A 4FYDA 4C98A 3UXNA 4PQUB 2JEGA 3OXLA 4LH5A 4UY85 2UUCF 4UAUA 3CF5L 4ED0A 2JH3A 4WK1A 3O08A 2ZM6F 1Q81O 5EWFA 5B8HA 1HHSA 3ZTQA 4B3SJ 1A6LA 1DLOA 1HNZJ 5CD4H 2PD1A 5D3GA 4JRQA 3ETOA 4RWWA 5AQFA 3RGIA 3QB0A 1U0HB 3J81Y 4M5GA 3T5HA 5HQ8A 1HQEB 1X5TA 5L1JA 4DV1J 1YJNN 4E1NA 3M2UA 1Q7LB 3UD3P 2JR5A 3MPVA 2N4DA 1TVRA 5KFLA 4RQ4A 4XH1A 1PYTA 2R7SA 3A3PB 2PMZF 3PSFA 4IRCA 4UAZA 1Q7YO 2GNKA 1KCFA 2XS2A 3C7NB 3RRKA 1GNKA 3D6MB 5G5GA 1K73O 1B0TA 1QSYA 4RBTA 3PX6A 4AXJA 4EP5A 4BHQA 5EWGA 4FK4A 1BQXA 3KLIB 2ZJPL 3TWHA 1FRMA 1PKUA 4LSNB 1Q16B 3O0FA 4GMJB 1JLCB 1HQUB 2Z2MA 4E1JA 2YTCA 1EXQA 3CWJA 3Q8LA 3RMDA 4QOTA 7ICIA 3ULEB 1MDUB 4FLYA 5L1IA 1DRZA 1F5AA 4F4AA 2RUSA 2HWTA 4EYHB 1LKZA 3NGUA 2W7PA 4I2GA 4G6VB 3L7PA 1WG5A 2RU9A 1GFWB 2M8HA 4ZPVR 3NWRA 2OI2A 8ICOA 4DR7K 3UI3A 4JI7K 2B7BB 4LF1A 2J0QD 3CXCR 1UL3A 3Q8YA 1MMNA 3HLUA 3DLRA 7ICUA 4AYBD 4BWJA 3A0HU 3HWTA 4FFDA 1VQ9S 1J97A 1CJVB 2CKWA 4IO8A 4RUHA 1RGIA 4DV6K 3M2VB 4DZ6A 4DL3A 3NNAA 4ANDA 5AKIA 4DHYA 1CJKA 5D6GA 5AQWA 3UVJA 2FPMA 1RP5A 3BGFA 1KQGB 4M5LA 3CJAA 3GG1A 2FC0A 1N63A 3MGIA 3HVTB 2X6SA 4ECSA 3CRXA 2GV1A 4FPRA 5AK6A 2UP1A 4BVPA 1JLBA 4C1NI 1KL9A 5HJYA 5GVQA 3I28A 3BQ0A 3FLCO 3MM9B 4ZVUB 1SAZA 3MPDA 1UPMB 4LR7A 1EJ7L 1ILYA 1TL1B 1VLYA 5DETA 2DFHA 3PEHA 2WW8A 3TUIC 2J0XA 2I7NA 3HHEA 5JMNA 5GMDA 5JVHL 4DV4K 4MTPA 4R79A 4OX9F 2IMOA 2XI3A 1S1UA 4PYAA 1IN0A 2EK6A 1VAZA 3DXMB 3ZXWA 1WTBA 4ES2A 3DLEB 3RFAA 2NPIA 5KFJA 1MWQA 4NASA 3VEWA 1IBMK 4C7QA 4CNYA 3MN6A 1U1RA 1EKEA 4H4KC 2VV5A 3Q8RB 3KHRA 4Y2CA 1QZ6A 2A3ZA 4OIXA 3W8GA 1U1KA 1FI4A 1JROA 2R7YA 2OYYA 3GTYX 1K6YA 4RBVA 2OSQA 3MECB 4IEIA 4U9RA 3UE2A 4CLZA 4K8XA 3Q8QB 2RHSB 2QX0A 2B6AB 4WFYA 1NKEA 4DMZA 2ROGA 4UB5A 2Z58B 1LEOA 4KLQA 1IJEB 2J4RA 2FVPA 1YK9A 1MWKA 2EWHA 5TKWA 3OW2M 2DFFA 2ZIVA 5HHHA 4N56A 1RCXB 2R7XA 5AE1A 4C8LA 1FF2A 1HWKA 4JI7J 1S9EB 5M2PA 2EW9A 1BNPA 5KFXA 3QU2A 4UF4A 1U25A 3KG4A 3M8WA 1RCHA 2JGUA 2P9NB 3UNYA 4HTLA 3G6VA 3DRYA 3FC4A 2ILZA 4WJ3B 5HROA 2Y0SF 1TZ0A 5D77A 2XZDB 3L3VA 5HATA 2P6SA 3CIPA 1G7CB 3OS0A 3SDEB 1Y5NB 1NK9A 1S9GB 2QFIA 4EP4A 1OVYA 2JC1A 2G08A 2G8FA 4CP5A 3Q23A 1JXLA 4I6WA 4C48A 4O5CA 3EMTA 1V9PA 3TW0A 5KFOA 4OJOA 3CCZA 1RAGB 4JS5A 4PKGA 2UVRA 3V6HA 4OYZA 4EI2A 3DOMA 3KTQA 1RT7A 4OJGA 1HJOA 2JDJA 4KIAA 3LP2B 4RKUC 1IKWB 1GOBA 2KE7A 3HW8A 3NAIA 4M5NA 4JMUA 4BQLA 4QYZJ 2ZJ8A 3KDOA 3IC1A 5HLFA 1HRHA 4HUEA 2K7JA 3JXUA 2K89A 2UXCJ 2VF3A 3DMJB 2PZSA 4Q7AA 1FFWB 1QUVA 4RNFA 3MEDB 5IWAF 2Q79A 4CJPA 3L4QA 4U67Q 4IOBA 1ZBLA 3FKBA 1KFSA 2F8MA 5KFCA 5EN1A 3GR0A 2ZHBA 3KOOA 3MN5A 2DXDA 4PL7A 2HMIA 3VPZA 3OR2A 3OTCA 4DV0K 1WOQA 1REVA 3LUYA 4KFBA 2MSNA 1FWPA 3P3DA 4QQBA 3J7AP 2QMWA 1ZQDA 3IXQA 3HJFA 2KXFA 2UVWA 4O0JA 4OI3A 3QEXA 1NZAA 4NL9C 3KK2A 1M1GA 1TUYA 3QFWA 5AQSA 2VU5A 3P38A 4DB3A 3TABA 4NLOA 1FJCA 3S01A 5BRHA 3P1GA 4B1UB 4U7UD 4DL7A 2ZVSA 3LZJA 2EFVA 3DRRA 2V8HA 3LA0A 4CRXA 1OXJA 1IM6A 1X9WA 3NGZA 3V9SA 1TUUA 2YX8A 1P27B 1W7AA 1RWMB 2WSEC 1VJWA 4RW7A 2DHHA 5M1KA 2EZXA 4ECYA 5IC4B 4O5BA 1D8YA 3IGNA 1TP7A 4OVLA 4DEZA 4UT4A 2MJUA 3QE9Y 3GIMA 1NKBA 4RW7B 2W6LA 3BQ7A 4ZVTB 2MGZB 4X4OA 3M05A 3QGGA 1S0VA 1V5VA 3IWNC 1F5SA 4EGLA 2IVPA 1R3NA 1RZTA 4KH1B 3KLEB 3BV8A 4FF4A 4FJGA 1MN8A 4YOXA 4JI5J 2VBXA 3AO1A 5HHIA 2DHSA 4OI1A 2WBRA 1Z3EB 4JI7F 3T3FA 2XQCA 4JI2K 3BEXA 1K8AT 1FXLA 4M41A 4UAWA 1SV4A 2CXYA 3IM9A 4WF9Q 3V5RA 1XHXA 4RO0A 3IR5B 4QYZK 5C2DA 5KGWA 2P5GA 2PMWA 5IT4A 4JKBA 3OFGA 2KLAA 1R8HA 4OYXA 2JZBB 3QLHB 2DGZA 4LF4K 3KWIA 5I3QA 3RW6A 4FLUA 3OYIA 2DNYA 2UUAF 1X0FA 4J9PA 3QYYA 1COKA 3Q83A 1T3OA 4BGAA 3M2RB 1MROB 5BXIA 2JEJA 2I2YA 4ID5A 2DR5A 1KD1T 4H8KA 2CA9A 1FRHA 3M8RA 2BHNA 4BE1A 1WLJA 4ECUA 3BREA 1ROFA 2FPHX 4CZEA 1WUAA 4A47A 2HHHF 2F8HA 3FFIB 1PVPA 4LJXA 1RWVB 1BI4A 1Y97A 5AHXA 2XMUA 1UQVA 1H38A 2QWQA 1N32J 2PI5A 4IDHA 4ZCMA 1D09B 2ZJQL 1RTHA 2JWLA 2O8BA 4HACA 4MDAA 4FZYA 2KD1A 1S1TB 2G07A 4NEYA 5HRPA 4DXLA 4X4RA 4Q2MA 1BNOA 4AXIA 1Z00A 4G1PA 4Z6DA 2BRKA 2G1DA 2L08A 3I56S 1NGIA 3H3OB 3GIJA 4TQSA 4JI0F 1DHMA 1Q86T 4KT0C 3KMSA 3BM7A 5EUHA 4FLXA 2FMPA 5AQOA 1RJJA 1A7GE 3SUPA 3ZZRA 1NJWA 2CG8A 2D1KA 3EWAA 5HRNA 1B92A 5KG7A 3FNNA 5C42B 4JBCA 4DOZA 4WZMA 1KHVA 1ZQGA 3WIVA 1T11A 3AA8A 4MIAA 1Z1ZA 2V34A 4O5EA 1WG4A 1YT3A 4F5NA 5AKXA 3L9ZA 9ICWA 3M6WA 3W1YC 5FROA 4BRCA 4C0ZA 4A2AA 4B3MF 4FWLA 1BL3A 1VK0A 1MSWD 1HMVB 3IBWA 1TL4A 4Y28C 3NS1A 2MSTA 1ZRNA 2HBRB 4B3RJ 3W2WA 2RUGA 2HFOA 1S79A 4I9QA 2F9WA 1LW2B 1BVSA 2BQRA 1Z25A 2MJNA 4XUSA 3RMCA 2GQQA 5J0YA 1KVKA 3DHXA 1X4EA 2E7XA 4C11A 9ICPA 1BQMA 1Z19A 2WAQD 3RRHA 2HNYA 2OELA 2F77X 1L3UA 3D54A 2PA8D 4FWRA 5CQGA 4Z4CA 5L8RC 4OZ1A 3M8PB 3B6PA 4P75A 2ZH7A 4JV2A 5IM0A 4OPKA 4QZIA 2E5IA 1J6ZA 1CS4A 1ZBHA 3HT3A 2MKIA 2DPJA 2DWQA 3B8HA 5EE1A 2P6RA 4DPTA 4I6YA 4YFKA 4MEXA 3HVWA 4NM1A 1JJCB 2RQKA 1U6BA 5D4PA 3DLLL 3OLBA 2LM4A 5CYMB 4DR3K 1TL7B 2HMPA 1U4BA 2JX2A 2KHOA 1KTVA 3K1ZA 5DQHA 4F72A 1SQFA 5G0RA 3OJSA 4CM0A 4I1TA 2L3MA 1K5OA 3AD9C 2WVFA 3HOSA 2C3OA 4ECXA 4WP3A 2ASLA 2VKZG 4DG1B 2E2PA 4P9SA 3A2FA 2D3O1 3Q86A 3AVIA 4H5VA 2HNZA 3AT1B 4XDCA 3WKAA 3VESA 1CG2A 3MEGA 3NNCA 4CK2A 3VAJA 1C0MA 5F0UA 2N4CA 1QDUB 3EKSA 1R59O 3WXIA 1VSHA 2YHAA 1FFGB 2LKYA 1OYEA 1I3OB 2YTUA 3KK7A 2R8HA 1TL3A 1UJ6A 4JS4A 3GV7B 5IWAK 3Q22A 2C22A 4QW9A 4V19X 3BY5A 3ET6A 4Y00A 2YJFA 1OY9A 2XB2D 1O03A 2HBJA 4TUPA 4QW8A 4PXEA 4CGGA 5L9NA 1JI7A 5ALLA 3BF3A 2L48A 2UUCJ 2C2MB 4CHNA 3RTVA 4RUCA 4TYAA 2ZM6J 1UVMA 3TA0A 2ZQBA 3J7ZO 2UXBK 4CZFA 3QEWA 4KO0B 3DDNA 2CPFA 1TKDA 3ZSQA 4YMMA 3W64A 5F8LA 3C6TB 2VQFJ 1QQCA 3CM6A 2VA3A 4DCHA 1J2NA 3E58A 1GH8A 3MMJA 1PAEX 3KUHA 8ICEA 1IBCB 2O3DA 3CMES 2M9NA 1Q8KA 2F5GA 1WKLA 2V94A 3AJ1A 3N4WA 5HMLA 2VBYA 9ICEA 4WQ4A 2KN7A 4JI0J 2CWXA 1ZTWA 4JV5J 1RYRA 3HHLA 4W5NA 1XMOJ 2ZBPA 4FPBA 1KXPA 3DXKB 4HAIA 4PJ0U 1BQNB 1U8SA 3HZGA 1B4FA 2M4MA 1S5LU 5I9EB 1RBLA 3UR3C 5IIMA 3UPFA 3WEEA 2OPRA 5FRMA 4MHVA 2W24A 2QLBB 2QSFA 2XYPB 2CJQA 3PJ9A 1R89A 1JXVA 3J7YP 1UFLA 4ZVGA 3Q0AA 1XNQJ 4CBXA 4CQ1A 1GT8A 3VV2B 3V4IA 4C1NK 3OYNA 4E7KA 5AKGA 5CR4A 3HO1A 3OR1B 5JLHA 4B3RF 1K73T 2VC0A 2FJXA 1A0PA 3QMLA 3H7IA 4DQQA 4P2FA 3PV8A 4DTRA 2B9WA 7ICKA 2P1JA 2FVQA 2O8CB 1HUXA 5F41A 2Z57B 2OD6A 4DZDA 1SIWB 1BUPA 3ATVA 3DM2B 4F5PA 4H0OA 4OJ3A 1AT1B 3C2LA 1ZQQA 2DJWA 1WN7A 5ALJA 2CQ1A 2O01C 3C1ZA 1TKXA 3UFCX 2NSCA 5GAEU 2W2PP 1PIEA 1VQSA 2HGMA 2OPSB 4EHUA 1RACB 4DR1F 1J9AA 2WB4A 3D2FA 1ZM4A 4O0IA 4WFXA 1HLWA 3PR4A 3JPPA 4WWSA 2ES6A 5J1NA 1FKPA 2CPJA 2HMIB 1D4XA 1M90O 3EUNA 2FSJA 4YB6A 4LF8K 2KO1A 4EYIB 5JVGQ 2CQBA 1N54B 2GUIA 5LSLA 3D2QA 3MEEA 3SSQA 2XWYA 4CJKA 5KFWA 3LDAA 1PILA 4QYRA 4KTWA 4MT1A 3CJKB 3AVMA 3CGIA 4CH7A 1Q95G 4DU1A 2NUHA 4FJ8A 4DR3F 5L38A 4C8NA 1H3DA 2EI5A 2GQCA 3SLCA 3B0YA 2NRTA 4J2AA 5ALHA 1PK1B 4J8FA 2CJAA 5J2JA 1WSFA 3SCXA 3ZC4A 3ZX3A 1KR4A 4OJHA 2KJ9A 2X1BA 5A8WB 3VETA 5AZIB 3JPOA 1WC0A 5F0WA 4Y0FA 1ZQAA 4I2DA 5LJWA 1WC3A 4ZKAA 4H0VB 4A62A 4QIEA 3MMBA 2QLTA 2W2OP 1NJZA 2RPIA 1QVFM 2AX1A 4NRUA 4Z4FA 3EICA 2CRLA 3AVCA 3KVGA 3KKFA 4NWIA 2JFDA 3BEGB 1NNDA 2AQ4A 1SB6A 3ILOA 2GWJA 1YF5L 2YNIA 2LQ5A</