1NK6A

Cytosine-cytosine mismatch at the polymerase active site
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk6A01
2BCVA 5J2EA 5KFQA 4DU1A 3GDXA 2R8KA 1RXVA 4IG0A 1WSEA 3MAQA 4HHTA 4JV0A 9ICJA 1T03A 2G8IA 3AO3A 3EW9A 4E1MA 2X6SA 4F3OA 4DSEA 2DY4A 1JXLA 3G6VA 3C1YA 3OYBA 2YHAA 3Q8MA 1EP4A 2C2RA 2UVWA 1WSGA 3HP9A 3FDSA 4EBCA 3LP0A 4HTUA 4GXIA 2XCPA 3FYHA 2RDIA 8ICEA 5DBBA 4DSKA 8ICQA 3G10A 4TURA 4CEZA 3KLGA 4MEXA 9ICHA 1LWFA 1BPZA 3ETLA 4KI4A 1CLQA 4FJGA 1NK4A 1V9PA 8ICBA 4KAZA 3QE9Y 8ICVA 4Y1DA 1BPXA 5JUMA 3NGDA 1HUOA 3AV9A 2NRTA 5DBAA 4DF4A 4Q0BA 5DBCA 1MC8A 4DQPA 3SV3A 4B9MA 1BCOA 4FM1A 3FFIA 2YHBA 3RAXA 1JLCA 5SWMA 4KLOA 3OYJA 2I5JA 5KG5A 5EWEA 3ZSVA 5KFIA 5KT6A 1TKTA 3KK2A 4RQ4A 4XRHA 1EXQA 1X9MA 1BISA 3CFPA 2XO7A 2NRWA 5HMLA 4YQWA 4UB5A 4ID1A 3NHGA 4RUAA 4BDPA 1ZQRA 4FK0A 4RG8A 1S0VA 3MEGA 4FK4A 1NKCA 3PR5B 1SL0A 3L3UA 5KG3A 3WNEA 5KFVA 2G8FA 3HPOA 4BE1A 5KFHA 1JLAA 4EBEA 3GIMA 4B9LA 4RQ3A 4KV8A 1ZQJA 4XA5A 1RNHA 3PV8A 2W8KA 4AH9A 2P5GA 4HVJA 4DQIA 3CFRA 4KLGA 3BQ1A 4O5BA 4CJTA 7ICIA 3AVAA 4M47A 9ICUA 4M3WA 4YR2A 1XO1A 4DTSA 4IBNA 4ED8A 2BE2A 4F4XA 3MXIA 4BGDA 4O55A 3MFHA 4FJ7A 8ICNA 4Z4IA 2AGPA 3H08A 3PX0A 1QE1A 3UXOA 2IS3A 3QZ7A 1ZQBA 3AA2A 4YP3A 2AGOA 8ICAA 4IQWA 1BQNA 4DFKA 3QIOA 2AJQA 1F21A 1IKVA 4DSIA 2F8TA 4M9JA 1TK0A 2IDOA 4JWMA 1NKEA 5KT2A 2J6SA 3OJUA 4DQRA 4NCBA 1XHXA 1D8LA 3ZSOA 4PHEA 2W42A 1TKZA 3AVKA 4NYNA 4Z4GA 3WNHA 2FLPA 4RW7A 1LW0A 1N5YA 1C7YA 5J0PA 4J2AA 5CR0A 1RT6A 3PR4A 3DLHA 4GVMA 5J1EA 3RRHA 8ICXA 2HHVA 4ZH4A 4JV1A 4F5RA 2IA6A 2FPLA 4P4MA 4YVZA 2OPSA 3ISBA 2PI5A 2X74A 4FW1A 1D9DA 4FXDA 1BL3A 4NLKA 1ZQKA 3KLIA 3U6FA 1QHTA 4QZBA 5KFYA 4RW6A 4R8UA 9ICKA 4GW6A 1N6QA 3T3FA 1BIZA 1VSFA 3I0RA 4BXOB 1VSJA 4CERA 3OS2A 1KRPA 7ICKA 3TR8A 4UB3A 5HHHA 5DGBA 4MQ3A 3MXJA 3AO1A 2AU0A 1ASUA 1RTDA 8ICTA 1WNSA 1DGSA 1DTTA 1HJPA 1ZQZA 1S76D 3NH2A 1COOA 4M3XA 5FRMA 3A2FA 3O3FA 4JRPA 3HYFA 1CEZA 4H8KA 4RQ2A 4E7IA 1U45A 3SUQA 1WN7A 3K75D 3RH6A 2V4QA 4I2CA 4AHUA 5BOLA 4CK2A 1BI4A 4YMMA 2PI4A 2XY8A 3ZDCA 3G0ZA 3AU6A 1HJRA 5J0UA 3DMJA 2R8JA 4DTUA 3OHAA 4N56A 2FC0A 4PPXA 4CEBA 1L5UA 4JS5A 3OYIA 3JPPA 5HROA 4DFMA 1FK9A 2G8WA 4N41A 2KZMA 2B5JA 4KLFA 3DRRA 3PW2A 3KHRA 5KRTA 3JYTA 5HP4A 5J29A 5CP2A 4ED3A 4P2HA 3T1AA 1VSKA 2XCAA 3ZSYA 4CJ5A 4YFKA 2A1JB 3GIKA 3HJFA 1B92A 1RDDA 2ZJ8A 2HVIA 4LH5A 5J2GA 2XGQA 1RTJA 4AHSA 8ICMA 4I9LA 2F1HA 3NAEA 2W8LA 4CF8A 5J0YA 4ECYA 3UXPA 4CHQA 4J9OA 5D49A 2VWKA 5DB6A 3D0PA 4FS2A 4LZGA 4TUSA 4CEDA 4ECQA 4KN7A 3PW5A 4B08A 2ZUCA 1RT7A 3ZDDA 2J6UA 3AA5X 3JPSA 5K14A 5BOMA 2KQ2A 1REVA 7ICRA 5DDMA 1BHLA 5C42A 2OPPA 1RT5A 3L2QA 3I0SA 2HHWA 3HVRA 3DLGA 1NK7A 4NXZA 1YT3A 3V9UA 1QSYA 2RKIA 3T5JA 3SPZA 2QXFA 2IHMA 3PW7A 1I3AA 2A1JA 3GV5B 3AU2A 2Y1JA 4HCCA 4FS1A 1B22A 3SI8A 4PH5A 2W9CA 3TFSA 1IKXA 1CUKA 1RCHA 4Z4CA 4CHNA 4EYHB 9ICWA 3BQ2A 4CEOA 5C25A 3C6TA 3Q8QB 4O5EA 3EYZA 1Y88A 3NF9A 4GC6A 4RQ6A 2HW3A 3C6UA 3KHGA 4FJMA 4YN4A 3KK3A 4DFJA 5KFGA 2YNFA 1JMSA 3ZDAA 5IINA 2ZUBA 4RU9A 2ZD1A 3VQ7A 1JL1A 4KLTA 3LP3A 3PUFA 3LALA 2PFPA 1ZBFA 3EZ5A 1BI4B 4OKJA 3H40A 7ICPA 1ZJMA 4CFBA 2KZZA 4F4WA 4NCGA 1HUZA 4NYFA 3RBDA 2E6LA 2DFLA 5FROA 1S1XA 4LD0A 4HCBA 2MUTB 2X6NA 4BWJA 4ECTA 3LZIA 1T3NA 2MAXA 2BKEA 9ICTA 4LVSA 1RDBA 1KLNA 2FMQA 2BANA 1ZQAA 1U47A 5FRNA 9ICXA 3Q8KA 2W9MA 1ZQTA 1ZQWA 3UQ2A 5J0QA 1IM4A 2QKKA 4CECA 1RBUA 5J0WA 5CA7A 1ZQEA 1LW2A 3UIQA 3AVNA 2G8UA 3ZD8A 4N5SA 1NOZA 1DOQA 4C8MA 2BQUA 2BCRA 2ZE2A 3V7KA 2PFNA 8ICGA 1ZQDA 4P4PA 4MFFA 4KKOA 3RTVA 3KHHA 4J9NA 5SZTA 4FJKA 2BQ3A 3V6JA 5IIOA 1Q9YA 2O4GA 3JSMA 4FJLA 3RWUA 3B6PA 3ITHA 4KHYA 4ED1A 2B21A 3EWAA 4QZCA 1Z25A 2LSNA 4M0AA 2R8HA 1BCMA 7ICGA 9ICMA 4DS5A 3SV4A 4M3ZA 1B43A 5L1IA 3RJJA 4CJEA 4DL4A 4KTQA 3GFKB 3SQ1A 4DQQA 4F4YA 4CK3A 3Q8RB 2Q0ZX 1VSLA 2GV9A 4QCLA 4FLTA 4YMOA 4ECWA 2KFZA 2VWJA 1NOMA 3LDAA 1ASVA 3V9SA 3LANA 5HNKA 4DSLA 2XRIA 1SV5A 3AVBA 4C8LA 3RJKA 4DTRA 1BVSA 4HUGA 3LDSA 4OPJA 4Q45A 5DG8A 3VQBA 4KHUA 5KG6A 3OYKA 3JPOA 2VG7A 1JXBA 4Z6CA 4K4IA 1UA1A 5DQHA 2ISPA 3VA0A 3AO4A 2RDJA 4O4GA 2E4LA 2ZQBA 4O0JA 5KT5A 4IRDA 4CIEA 3OYGA 1ZQVA 5KRSA 2YNIA 3LAMA 4CFDA 3RB0A 2OZSA 5EOZA 4RNMA 2C22A 7ICSA 5EU7A 1K1QA 4O5CA 3GIJA 1S9EA 4O5KA 1JLQA 4Z6DA 4QWBA 4G3IA 3MEEA 3LK9A 3QEBZ 1GOAA 2HNDA 4UQGA 4M9LA 5KFTA 2ZJAA 3RJGA 2PFQA 1TKDA 3OSPA 3QEIA 1S10A 4DTMA 2NRZA 1TFRA 3G6YA 4Q44A 3HSTB 3HP6A 4J9QA 3RB4A 2DFHA 4BDYA 4CHZA 5KFAA 1C0UA 1S5JA 1N48A 4IQVA 4I29A 2YKNA 4NY8A 8ICCA 3TFRA 3HT3A 2UVRA 3V6KA 3C2KA 4MFAA 1YTUA 5D3GA 2P6RA 5EWGA 4CEEA 4FLUA 1TAQA 3VQAA 1A77A 2IOCA 2XGPA 3AVCA 3CM5A 3RR7A 4Z4EA 1ZQXA 3PW4A 3TAGA 2BGGA 3L2RA 1VK0A 2ETJA 5D46A 3L3VA 5KG2A 3V7LA 3C21A 5DLGA 3O3GA 1CXUA 2IGIA 1UWBA 3EPIA 3AVHA 3IS9A 5CB1A 2OPRA 4FZZA 2BPFA 4B8AB 2ASJA 4B9UA 4F91B 8ICPA 4L8RB 4RPYA 9ICRA 1D5AA 3DOLA 1I39A 5IIJA 3ZT3A 3AVFA 1SL1A 4I28A 5KFCA 4DOCA 2JEGA 4DL5A 4F4KA 4Z0UA 3LWMA 4K8XA 2F8SA 2AQ4A 1S6PA 4IR1A 4DLEA 4CF2A 2VA8A 5TZVA 9ICVA 4UBBA 2E6MA 1Z3EB 1WSHA 9ICLA 3BQTA 1D8YA 1WSFA 5KTQA 4KLLA 2HB5A 3OYEA 4FZXC 3RJEA 3ZDBA 3IM1A 2A1SA 3KKRA 4PHPA 5KFMA 2FBTA 2ISOA 5CYMA 1TAUA 4J9KA 4KFBA 4RNOA 3PO5A 5KG7A 4Z6EA 4F92B 4CGHA 4O3NA 3H8SA 5J2IA 4B9VA 1U48A 2GWSA 3CFOA 3LPUA 1RBTA 4M6WA 3KJVA 4TQSA 3V1RA 4ED2A 3C94A 3QEXA 2D0BA 1Q8IA 4C8KA 4FM0A 4GMJB 3QETA 2ZJ5A 4ECRA 1ZBLA 4H4OA 5J2HA 2FPMA 3D45A 3QEVA 1S1UA 3OS0A 3V7JA 1T05A 4FCYA 3OVNA 3HO1A 3DRSA 3ZT2A 1RT2A 5HHIA 3MR6A 4KHWA 4RQ7A 2BGWA 3L2UA 3MXMA 4FJ5A 1EX4A 4M42A 2RPIA 1X2IA 9ICIA 3CG7A 4ECSA 3C95A 2F1IA 5KG0A 4CJ4A 4UB1A 1RYSA 1C0MA 3PX4A 4QZIA 4ELVA 1KCFA 4E7LA 1J53A 7ICQA 5CYQA 3LPTA 1JN3A 2FLNA 4M9HA 4TQRA 4O9MA 3JPQA 1CZBA 4CHYA 4RT3A 3HL8A 3RB3A 1SKRA 2JZBB 2LYHA 3T19A 1U04A 4OGEA 3Q8SB 3H4DA 3SUOA 1QSLA 3ASMA 2P6UA 3EY1A 4M45A 4KRFA 1RTIA 4FLWA 1NK6A 4RQ5A 1T8EA 1KTQA 1J5OA 3ISCA 3HK2A 3GILA 4CIFA 2IAJA 4I2EA 4FJIA 2ASLA 4F5QA 4EZ6A 1Y97A 2C2EA 2QKBA 3B0YA 1ZJNA 4LY7A 4DTXA 4KLJA 2JZBA 1ZQSA 2FBXA 3KD5E 3JPTA 3I8DA 3V9ZA 3DLKA 1ZQFA 5HBMA 4PUOA 4QWCA 2JGUA 3C5FA 3OYLA 2YKMA 3S9HA 3OYHA 4OVLA 5IILA 9ICGA 3S3OA 3EPGA 4YD2A 4R8UB 4RW9A 1JLEA 1ZBIA 2I9GA 3ZSXA 3RBEA 1WAJA 2NUBA 3AUOA 2HHSA 3DLEA 4MFCA 5DG7A 2VA2A 2W9AA 1JLFA 1WSJA 1XC9A 1C6VA 4CEQA 2VANA 4E0DA 3HXMA 5KFOA 3LP1A 5F9LA 1KVBA 4R65A 3E2EA 3P83D 3SI6A 5FDLA 3VQCA 5J2JA 3UPQA 3C1ZA 2P5OA 4I9QA 1DTQA 5J0OA 1O1WA 2ZUDA 4CE9A 1S97A 3TAPA 3H8WA 5J0XA 3HM9A 2NRVA 5HMMA 5JS1A 4UB2A 2F96A 1UT5A 4R5PA 8ICOA 2AGQA 7ICFA 5HRSA 2HHTA 4W5NA 4KLMA 3SPYA 2DPIA 4ELUA 3K5MA 3VQ4A 5KT7A 5KT4A 3NF6A 5C24A 1NJYA 1SUQA 4QW9A 4JS4A 1UA0A 4PA1A 2HHQA 3RMCA 3MFIA 3KIOA 4B3OA 1RZTA 4M2YA 3OYFA 4YXMA 3MEDA 4CF0A 4JWNA 1HQEA 1HQUA 1VSHA 2B4JA 3BQ0A 3ZSQA 1BPEA 4CHPA 3TANA 5DDYA 1Z26A 4QZFA 3AO2A 4M04A 5J2KA 1KFSA 4KLDA 4FJ9A 3K5NA 1YVUA 3QINA 3VQ8A 4CIGA 2WONA 3ISDA 3ZT1A 7ICLA 4AHRA 1LAWA 1T7PA 4F3TA 2DFFA 4EP4A 5J0SA 4ECUA 1SKWA 3RAQA 4DU3A 2BHNA 3ULDA 1VSEA 2KFNA 4DLGA 3ZCMA 4QAGA 3QESA 4DS4A 2F1JA 4KLEA 3RB6A 4M9NA 4DTPA 2VG6A 1X9WA 4DFPA 1VRUA 5KFBA 5T7BA 2P51A 4I2IA 5I3UA 3L8BA 1KSPA 1QLNA 2Q3SA 3SYZA 3GV8B 1XWLA 5KFJA 4BACA 8ICWA 1K1SA 2JEIA 9ICQA 1ZQLA 5J0RA 1B9FA 7ICNA 3SJJA 1ZQPA 4HYKA 4FBUA 4KHQA 1B9DA 1IXRA 1KFTA 4XIUA 2J6TA 4FO6A 2PYLA 1UAXA 1ZETA 4EYIB 4ZTFA 3H8JA 2ASDA 4ZHRA 3V6HA 3AVGA 4RW4A 4N76A 3O4QA 3K5LA 1PZNA 9ICSA 1LAVA 1FKPA 4M3UA 1UOCA 4DL3A 4BE0A 4C8OA 1HPZA 4PY5A 2ZTEA 3MR2A 1RBVA 4DL6A 4I2AA 4LSNA 9ICCA 1C1CA 4TSXA 4CGFA 4AHTA 4IR9A 5IIMA 3K58A 1XSPA 5HRNA 1Q9XA 1TVAA 3T5LA 1BPDA 4PQUA 3HPGA 4OGCA 4UB4A 4QZEA 4CJ3A 5KFEA 1RXWA 4DOAA 3C2MA 9ICPA 1TL3A 1LWCA 1NOYA 3S3NA 1SZPA 4M6WB 4RZRA 1N56A 4CJKA 4PHDA 4Z6FA 3AO5A 2H5XA 2XY7A 4I2HA 3OYCA 4Q43A 3L2WA 4I2FA 2BPCA 2DPJA 3QO9A 4FLYA 1U4BA 4DSJA 2P1JA 5CZ2A 5DK5A 4QZHA 3CQ8A 4ID5A 1TK8A 4FLVA 1HYSA 4EBDA 7ICVA 1XI1A 3M9NB 5C5JA 4FJ8A 3SQ0A 4AHVA 2EHGA 3C23A 4ICLA 3VQEA 4R63A 1ASWA 5L1JA 4F8RA 4JLHA 3K59A 4CJQA 1JIHA 3V1OA 5KG4A 4DL7A 1JX4A 3RR8A 1UT8A 4F4ZA 3V4IA 1C1BA 4I2GA 2AQ0A 1RT1A 2YNGA 3WNGA 1NK9A 1W0HA 3OJSA 8ICSA 3NBPA 4AHCA 1NK0A 1S1WA 3AVMA 1D9FA 1TK5A 2XY5A 3MDCA 8ICKA 4E89A 1L3SA 3MBYA 3ISNC 3OYNA 4FLXA 1ZQUA 1NJZA 1A5WA 2GUIA 3AVLA 2PXIA 3CYMA 4CFAA 1ZQIA 4YNQA 4F5PA 2A1RA 4Y1CA 1S77D 3DOKA 4Q8EA 2PZSA 1NKBA 4JRQA 4QZ8A 3U3GA 4KTWA 5L1LA 3QEWA 4DF8A 2FPKA 3BJYA 4RPZA 1NJXA 4OPKA 4FYDA 1VSMA 7ICMA 3U3YA 3K57A 2IBKA 1ZQMA 7ICJA 9ICEA 2JEJA 4ELTA 4ZTJA 3PY8A 2RN2A 5DB9A 4KLIA 3RJHA 1BPBA 5KGXA 3UXNA 2Z1JA 4DG1A 2IHNA 2XY6A 2KN7A 4RQ8A 3V1QA 1NK8A 1H38A 4J9LA 4FW2A 1HMVA 4IG3A 4PWDA 4FM2A 3M8RA 1WAFA 5KFKA 4O0IA 3PNCA 4QW8A 3H4BA 4QWDA 4KLSA 4CEAA 3WNFA 3H7IA 3G6XA 3RMDA 2BCUA 3TAEA 3IRXA 9ICOA 4YR0A 3GV7B 1EXNA 3KLHA 1Z00A 4OKEA 4CEFA 4CHOA 3OY9A 1XSLA 5KFRA 3DRPA 4LH4A 4XQ8A 5KGWA 3AA4A 4RPXA 3BDPA 4CJPA 1X9SA 4K4HA 3V9XA 1TKXA 1WCNA 4GLXA 4KREA 2ATLA 2D0AA 3QIPA 1WSIA 3IAYA 3K2PA 2FMSA 2UVUA 1RPLA 5D4BA 4OLBA 4Q8FA 2FLLA 2OWOA 2M9NA 2Z1IA 4QZ9A 4O44A 5DKWA 3RMBA 1EKEA 2BQRA 4EZ9A 2RF2A 3DLRA 3VQ5A 1Z00B 4DQSA 3NCIA 3TARA 1KFDA 4I27A 3QNNA 2ALZA 3B0XA 1JKHA 3AA3A 2W9BB 4GXJA 4J2BA 8ICLA 1L3VA 3MGIA 4DTNA 1ZQHA 1XU4A 2YV0X 4UAWA 2HNZA 1ZQOA 5HLFA 3TAQA 4YXJA 3O3HA 1XHZA 1IKYA 3E01A 4KO0A 4J9RA 3RJIA 1KVCA 3CM6A 4LZDA 4HUEA 4NLGA 2JLEA 2FBYA 4KMUA 4B9SA 4X5VA 3GIIA 3ZD9A 3IG1A 1J9AA 7ICHA 2BR0A 1XSNA 1RDCA 4O3OA 3PMNA 1LWEA 3V9WA 1RTHA 4CJVA 4FJXA 1A76A 4TUQA 3T5KA 5IIIA 4ECXA 4QWEA 4IKFA 4RW8A 3VN5A 4OLAA 2Z1HA 4QZAA 4QZDA 1S0OA 1JLGA 3C2LA 1QTMA 4RT2A 3B6OA 2C2DA 3NGIA 7ICOA 3PW0A 4DTOA 1VRTA 5CY4A 3PMLA 4KLHA 5J2MA 1XS9D 1L3TA 4CJWA 3M8SA 1JXEA 2NRXA 4BDZA 4MF8A 5KFFA 3VQPA 4DTJA 4R64A 4R66A 1ZBUA 2DTUA 4W5OA 4KHSA 4HUFA 4M41A 9ICNA 3SUNA 4TUPA 3PO4A 8ICUA 4FBTA 3ZT0A 7ICEA 3LZJA 3P5JA 3MECA 5J2FA 1NK5A 2Z1GA 4IDKA 2BPGA 4NM2A 2MUTA 2W9CB 4FJNA 4DWIA 5J0TA 3QERA 5L9XA 4GC7A 4OJRA 4CF1A 3TABA 3SQ4A 3LWLA 3KHLA 4J9SA 1C0TA 2ATQA 1RBSA 3SCXA 4CJLA 4MF2A 4W5QA 3M8QA 3HX0A 3F73A 3HVTA 3MR3A 5EWFA 3AVJA 4KTZA 1AROP 4CJSA 1EETA 1NJWA 3C5GA 8ICJA 4FVMA 2PFOA 2G8KA 3OSNA 4CGGA 4P4OA 1K6YA 2V9WA 3S3MA 1TGOA 9ICFA 1S1VA 3MR5A 1CXQA 1MSWD 4XUSA 3K4GA 2PYJA 1HNIA 1QS4A 2B6AA 4W5RA 4IQUA 1BQMA 3QZ8A 4J9PA 3TWHA 3M9OB 4EP5A 4UAZA 3N97B 4KLQA 3DM2A 1GOCA 1ZBHA 2QK9A 4M3RA 3NDKA 4EEYA 4CESA 2OA8A 1WCLA 2WOMA 3GQCA 5DB8A 5KFXA 1KLMA 1R0AA 5DLFA 5KFUA 2KTQA 1DLOA 5KFDA 1S1TA 4QWAA 4I2PA 5KFPA 2OYQA 4YMNA 4FK2A 5DQIA 4PGQA 4CJUA 2BDPA 3MABA 4H4MA 2WTFA 3ZSRA 3L2VA 2I1QA 4FJJA 1VSIA 3M8PA 3Q8LA 4FJHA 3DI6A 3OYDA 2BCQA 2VG5A 1ZQYA 4KN4A 4E3SA 2D5RA 3SUPA 1S0MA 5DB7A 2HHUA 3NF7A 5CJ7A 4J9MA 4ED0A 4ED7A 3UQ0A 4IFYA 2X78A 8ICHA 3KKSA 4IRCA 1HYZA 2OPQA 1TV6A 1GOBA 3V6DA 1X1PA 4BE2A 3N4MB 4JUZA 5CZ1A 3KLEA 5KFNA 4BWMA 1LV5A 1WLJA 2JEFA 3V81A 2C28A 4DEZA 4AILC 1RBRA 2ITGA 3F9KA 4E1NA 5L1KA 4CJFA 2FMPA 3LP2A 2PY5A 9ICAA 5KFSA 4YG2A 4O3RA 1IKWA 3BGRA 4GXKA 1KDHA 1RT4A 1IG9A 1U49A 4KB1A 5DQGA 5J2NA 3SNNA 1S6QA 7ICUA 1VSDA 8ICZA 1C1AA 3TAMA 1ITGA 5HRRA 8ICFA 4B9NA 3OYMA 3QLHA 3NE6A 4ECZA 4F5OA 4C8NA 3T5HA 2VA3A 8ICRA 5KFZA 5F9NA 2KW4A 3AVIA 5DG9A 4G1QA 4M3TA 1S9FA 3OHBA 4I2DA 4CGDA 3NGYA 3VQ9A 1ZYQA 4KLUA 4E7JA 5CHGA 3VQDA 4Q5VA 5BPCA 4MEYA 1S0NA 5HP1A 5IIKA 1TV9A 1HNVA 3RJFA 4N47A 3KTQA 2D0CA 8ICYA 3DYAA 2FBVA 1HYVA 3TQ1A 4UAYA 1ZQGA 3VQQA 1RDAA 4K8ZA 3K5OA 2R8IA 1T4GA 1A5VA 3NF8A 3ZT4A 4RQ1A 1BGXT 4BXOA 4DOBA 4F2SA 4F50A 4NLZA 1JL2A 4IFVA 5E41A 3LAKA 3KK1A 4CF9A 2ZTCA 3V72A 4FZYA 4PHAA 1SKSA 2G8VA 4IRKA 2HMIA 3HW8A 3ORYA 3RRGA 3QEAZ 2UVVA 1TL1A 4CGJA 1RT3A 4I2JA 4PGXA 2W9BA 1ZQQA 1W9HA 2R8GA 1MQ2A 4DSFA 4RUCA 2HVHA 2XHBA 7ICTA 3ZSZA 3VQ6A 2HNYA 8ICIA 2HHXA 1CZ9A 3HWTA 4I2BA 4KB0A 1BIUA 1BPYA 2BCSA 1KVAA 4E7HA 4UBCA 5DMRA 3SZ2A 4J2EA 4IQTA 2IC3A 4YFUA 4YD1A 1J54A 5J2DA 2DFEA 4QZGA 1A5XA 3THVA 1JLBA 4O3SA 2KZ3A 1HRHA 1LB2B 3PX6A 4CK1A 3OYAA 4LSLA 4JK1A 4DU4A 3PVXA 4OKKA 2IMWP 4NM1A 3MGHA 3JPRA 1ZQNA 3IHQB 4I2QA 4RQ0A 3RH4A 2YNHA 5CWRA 5J2CA 4ECVA 4Z4HA 4KPYA 1FXXA 2OZMA 4CFCA 1KEJA 3TI0A 4QOZB 2XC9A 3MDAA 2R7YA 2G8HA 5KFWA 1YTAA 4YR3A 3NFAA 1QQCA 4I7FA 4NLNA 4WE1A 4CCHA 3DLBA 1IH7A 9ICBA 3KLFA 4B9TA 3TAFA 3ZDEA 3NH0A 4O3PA 3O4NA 3HPHA 4RNNA 3P1GA 4K4GA 2Y1IA 4E7KA 5J2AA 2O4IA 3ALYA 4KHNA 4F93B 1RILA 4J2DA 3OGUA 1RYRA 1SL2A 3KD1E 4CGIA 3ZSWA 5JS2A 3Q8PB 3NGZA 1S9GA 5I42A 4M9GA 4KITB 1QSSA 5KFLA 4ED6A 1FKOA 1MU2A 3NH1A 2ZTDA 4NCAA 3JPNA 3RH5A 3RMAA 4B8CA 3SQ2A 4KI6A 1U9LA 4O3QA 4W5TA 3OS1A 4DL2A 5J2BA 2P66A 5DGAA 5HRPA 4FLZA 1IO2A 3NTUA 5J2PA 4E19A 2V4RA 2GBZA 3VA3A 4MFBA 1TVRA 3QNOA 4YCXA 5J2QA 4F2RA 4Z4FA 3M9MB 4DO9A 4JV2A 5KI6A 4CJRA 1G15A 1L3UA 4DMNA 1ZQCA 3QEPA 5KT3A 5KG1A 4PGYA 4F5NA 4M3YA 2EX3A 1MQ3A
chains in the Genus database with same CATH superfamily
3ENBA 5HMYA 4ZIVA 2DGTA 4DU1A 2XMKA 1RKJA 1RXVA 5IC4B 1WSEA 3MAQA 2JH1A 5AIAA 9ICJA 4XPCA 1HNZF 2QFJA 3HKZC 3UN2A 3EW9A 2CQCA 4NMXA 3Q0AA 1TFWA 2MQOA 1GT8A 3L3CA 3IR7B 1G7CB 2C2RA 3M30A 5KQ8A 3HLUA 4OI3A 4HTUA 1VQMS 3KZBA 5DBBA 5K14B 4F02A 4MFBB 1E4FT 1F3FA 1BPZA 5E2QA 3O0FA 4KI4A 2UUBK 1FD8A 2CPYA 2ILZA 1V9PA 3QE9Y 2LA6A 8ICVA 1SB3C 3NGDA 2WSCC 5DBAA 5ALTA 2CDQA 1IBKF 1MC8A 1X60A 2CQBA 2GO8A 3AFGA 4B9MA 4YORA 4BR0A 3FFIA 3RAXA 5ETQA 1FTCA 5F2RA 3O9QA 1QVGR 5SWMA 4M1KA 3OYJA 2I5JA 2LQ5A 5EWEA 1D8BA 4DV5K 2EPIA 3FFIB 3I1YA 4CF3A 4ED4A 1EXQA 2YPZA 4P52A 5HO4A 3FEYB 5E7OB 2V68A 2XI9A 2NRWA 3US5A 5HMLA 4YQWA 1R6YA 2ZGYA 3EMTA 4ID1A 3NHGA 2WFBA 3ZZPA 3MEGA 4FK4A 3NEKA 3PR5B 1SL0A 3QYPA 2ODGA 3L3UA 2F5GA 4FPAA 2V9KA 4LC9B 1GEHA 3WKAA 1U1RA 1HI8A 4BE1A 3PKMA 4X4RA 2DXFA 4DV2K 1HNZJ 4J91A 2HQIA 4WCEL 4A8YA 2E1MC 4US8A 1RNHA 2W8KA 2KB2A 2IMOA 2B7CB 2XMTA 3BQ1A 3NL0A 4O5BA 7ICIA 3DAWA 2PGCA 4NXMF 3HJEA 3L7UA 2QB0B 1NBEB 2HSTA 1M90O 5E26A 1X9JA 1UVJA 2W6LA 2CRXA 1QUVA 2K1RA 4BGDA 4O55A 3MFHA 5CCLA 1V4SA 4FJ7A 4MMOA 5ETTA 3KK3B 4JI0K 3PX0A 1QE1A 3ZNUA 3M6ZA 3AA2A 8ICAA 2AGOA 3FMBA 4JN4A 1NPRA 1BQNA 4BLGA 1RWMB 2LKYA 1Q1KA 1F21A 5E3QA 2KJVA 4WZQA 1TK0A 2N3OA 4OYAA 5ALEA 1NG9A 5KT2A 2BW7A 4DQRA 3IMXA 4LJXA 3OFGA 1OPIA 2XYHB 2IFXA 3AVKA 4LRAA 2ZNYA 4DR1J 4A47A 2FLPA 2MY8A 3KMSA 2DR5A 4KH0B 1N88A 2AYMA 3CIZA 4ZP6A 1N54B 3I0RB 5HQMA 5L1MA 4BG9A 5CR0A 3PR4A 1J2MA 3TYTA 2V52B 1ZA2B 4DX7A 4X66F 2GH1A 3THWB 3TKAA 3ZXWA 3G71N 3A5MC 2FD2A 2FVRA 1SZHA 3ISBA 4PL8A 1YHQS 1D9DA 2GLEA 4FXDA 5AK5A 2HGLA 2DUYA 5LJWA 4ZVUB 2F8HA 4K42A 2ZIXA 1CULA 5KFYA 4CO3A 4F9OA 4RW6A 2ZM6J 9ICKA 4GW6A 2EW9A 1RT5B 1N6QA 3IWXA 5AHXA 1VSFA 1X5OA 3I0RA 3H5SA 2FJXA 4CERA 4WF9L 2D9PA 7ICKA 1MU2B 2B6AB 2K89A 2GIQA 4Y2PA 5HHHA 1XR7A 4FZLA 2KLAA 4LIRA 2HAIA 3MR7A 8ICTA 3VGVA 4CO4A 1DGSA 3CD7A 4P7TA 4A2BA 1WF1A 2FJBB 4H0OA 2MMYA 3J81Y 3ONQA 5RUBA 4PG8A 3GCXP 1HLWA 4E98A 4TU8A 4H8KA 4E7IA 1NDPA 1U45A 2XULA 1NZPA 3QUBA 3K75D 2QSFA 1DKGD 3PHTA 1D09B 4YOEA 1IXKA 2BZFA 4YMMA 4JI4K 1QE1B 3KOAA 3ZDCA 2J9DE 3GFZA 3JQKA 3AU6A 1HJRA 2H9ZA 3P49B 3SSQA 1R43A 2R8JA 1K8AT 3U02A 3F2DA 4WYBA 4Y2TA 2UXCJ 4LR9A 2ZD1B 4PPXA 2QB0A 3OYIA 4JS5A 5HROA 1FK9A 2IM0A 3ZZ0A 4DV0J 1VQSA 2DH7A 2KZMA 4B3TJ 1BWFO 3DRRA 2CQHA 2RD5C 2IC3B 3WK8A 4DPXA 5KRTA 3KLEB 3QT5A 3CC4N 1IKWB 5CP2A 2M3DA 5CYQB 5DM7L 5EXWA 1FF2A 1F0XA 2P9UB 4JMUA 3HJFA 1S48A 2GFFA 3DWLA 1B92A 1RDDA 1HBNB 4LF1A 5F8NA 1H2VZ 1RAAB 3MGVA 4Y2MA 2FJDB 1R89A 3OFFA 4NRTA 3NAEA 1O6XA 1RWUA 2W8LA 2Q43A 3QIDA 1HHQA 3ENAA 4ECYA 4J9OA 2VKZG 5E3RA 4I6MB 2E8MA 4KN7A 4A8MP 1ITPA 1FJCA 3PW5A 3MD1A 4YB5A 3W0LA 5JJBA 3RU0A 2F3NA 5IM0B 2W54A 1B3TA 3M6UA 4P0QB 5BOMA 3OUYA 2FC9A 2MY7A 4UOGA 2PE8A 4KMOB 4F72A 2LXIA 1G6BA 4BREA 2PFDA 2OHFA 2MQLA 3L2QA 4K0KF 3BH6B 4OHYA 1EP4B 3HVRA 2LU2A 2IOFA 4E2FB 4USWA 2GWKA 3MM6B 1UZHA 2QMWA 2V94A 4N8OA 4OMFG 3PW7A 1FD2A 3QRQA 2Q1NA 4BRCA 4FS1A 3S41A 3QLHB 3CCVS 3LDOA 4PZVA 1RCHA 2MKIA 2XSJB 3LF0A 5D4LA 1VDVA 3EYZA 1FO4A 2HW3A 4B3SF 5J2NB 1F3VA 1HQ2A 1H72C 1U0HA 3LVVA 4WYWA 3GG4A 1LFWA 2GQCA 4BR7A 3CSKA 1WHYA 4DFJA 5KFGA 3PJ9A 1JMSA 4IC9A 5IINA 2ZUBA 3LP3A 3R2DJ 2OTJN 3ZETB 2DNMA 5AJ3J 2PFPA 4X62J 4J90A 2JFDA 4BRPA 1BI4B 4OKJA 3D0HE 4B3RF 1ZOLA 2E6LA 2AT1B 5FROA 1S1XA 4KIAA 2IYIA 2C2MB 1S7HA 4FOEA 3EZOA 1FVSA 3CVKA 4OLOA 1ZQAA 2VHGA 1U2CA 2ALYB 3UQ2A 4CECA 1RBUA 5J0WA 3SMZA 5CA7A 2LDIA 3OQ2A 3C6AA 3SEIA 3OPKA 1PVQA 2HS0A 4I7FB 2BQUA 4K4TA 2ZE2A 3HULA 2GNKA 2ROGA 4RBTA 2KFYA 4WZMA 5A0LA 3KLIB 3VGMA 8ICGA 1W2BM 5AQOA 2CQ2A 4OCZA 4IEEA 1S72S 3KHHA 5SZTA 4CNQA 3RBXA 2BQ3A 1M1HA 3F56A 3I33A 2QGFB 2O4GA 4OZNA 1V3SA 2O6KA 1PVRA 4KHYA 2LSNA 1U02A 1ZAWA 4K59A 1XC3A 7ICGA 4G65A 9ICMA 1IWAA 3WEEA 2E7VA 5LXRA 3DJCA 4RJVA 4DR6K 3QICA 2KH9A 3LA0A 4IOCQ 2DGSA 1JQGA 4EI2A 2KFZA 2V8PA 1M1KO 2V4JA 5HNKA 3HHLA 3LDLA 2XRIA 4XEIA 4C8LA 3AB4B 1BE4A 4P2SA 4FL9A 1IWGA 2H54B 4CTAB 4DV4F 4HUGA 1RDWX 5BR9A 4OPJA 4ICLB 2V2VA 1MLAA 4R25A 1F5AA 3AOCA 3OYKA 2X51A 2VG7A 2UXDF 2PA8D 3VA0A 3CDBA 1VQ4S 3M6WA 3OYGA 4OD0A 2F9WA 2YNIA 5KRSA 1NZAA 2DGQA 1ULRA 2OZSA 2DL0A 4FWKA 4RNMA 3R8EA 1XNQK 5EE3A 5FPDA 3SMSA 7ICSA 3QT7A 4LF6J 1ZD5A 4QJVA 4QWBA 2ZDPA 3MEEA 1RBAA 4Y2RA 3QEBZ 2OXOA 1CC8A 1GOAA 4M9LA 1PSDA 1BY9A 2EQYA 5KFTA 2ZJAA 3K0SA 3RJGA 2PFQA 1UWAA 1ATNA 2FLOA 3C66A 2Y3YA 1BNOA 3G6YA 2JVOA 1UJ5A 4J9QA 1RZMA 2B9YA 4DR2F 3ZTPA 2F63A 3OL9A 4BRAA 1PJ7A 2QIFA 2YKNA 8ICCA 1F60B 3S7RA 8ATCB 1JWWA 3V6KA 1OWXA 1P27B 2CQPA 3SQGA 2E1CA 2P6RA 3KG0A 1T95A 3BYPA 3VQAA 5H9EK 4GMKA 2WB1D 5F8HA 2H51B 3CJCA 3RR7A 1ZQXA 4C8YA 3PW4A 3FQKA 3TAGA 2BGGA 1V38A 4O23A 3L2RA 1UJ4A 5D46A 5KG2A 1D0EA 2I6WA 3CO9A 3TJ8A 5AI0A 5AKKA 5K4LA 5CB1A 4FZZA 5HN0A 3R5JB 1KQSR 4UOFA 3CF5Q 2P8IA 3GFXA 9ICRA 5AXLA 2CIMA 3MM7A 3V6DB 1NZBA 5AXNA 2NXCA 4I28A 4WQ4C 1RM6C 3C0BA 3OA9A 4ID5B 5KL1B 2G2YA 2JZ5A 1IG6A 4DOCA 2JEGA 4JB3A 4F4KA 1P9QC 3SEOA 4Z0UA 4IKAA 2ZIVB 4JKDA 1M1GA 1H2TZ 3L4IA 4K8XA 3HX9A 1S6PA 4IR1A 4A8QA 4CF2A 4LIWA 5TZVA 2KEYA 4UBBA 2L9NA 2GVZB 1WSHA 2FDRA 4KFBB 4CT8A 3C46A 1OH8A 4XH1A 1SXEA 9ICLA 3I55N 1AQ6A 2ZDOA 2J4RA 3OYEA 3ZDBA 1NGJA 3IM1A 2A1SA 3KKRA 5CYMA 4M95A 3UKRB 1KQKA 4USTA 2UUCK 1OMSA 5JVHL 3BH7B 5HOOA 2K3KA 2DRBA 1HNXF 1T0TV 3WU2U 5KG7A 1NO8A 2D8CA 2W01A 4DZDA 5ETNA 2HEKA 4B9VA 2GWSA 4FF2A 2LM1A 1NGBA 3W2VA 1RBTA 2LVWA 3MCNA 5AKIA 3OBIA 3V1RA 4ED2A 3C94A 3M7DA 2IVPA 5AE3A 4HTIA 2OGUA 2BKPA 4GMJB 1NGCA 1LW0B 2OM6A 4EK2A 4CYUA 2BZ2A 1RAGB 4NA3A 3UCUP 4ERDA 2QWQA 2DRAA 1B99A 3QEVA 4K5RA 1S1UA 3CCRN 4BHQA 1N5SA 3OS0A 2HMIB 3ZEUA 4BCAA 3V7JA 4A4JA 1FDDA 4FCYA 5A8WA 3MR6A 4RQ7A 1HKBA 2W55A 3TTDA 4CDGA 2CQ4A 3PEJA 1EX4A 3NVZA 2H3EB 1X2IA 2AX0A 3JSYA 1X4CA 3C95A 3CJ8A 2F1IA 3ILIA 4KPCA 3W62A 4UB1A 2DB1A 3CCMN 4UT4A 4XH5A 5LMNF 1OS5A 1C0MA 3VTIA 4QZIA 1J53A 3OL7A 1JN3A 4M9HA 2MPUA 3Q89A 4TQRA 2LHTA 4K4YA 3VESA 2K4PA 1CZBA 4RT3A 1SJRA 2VOOA 3W2WB 2FVSA 2GA7A 2O66A 5M2RA 4LREA 1Y9OA 4NX9A 5IC6B 2H5IB 3ASMA 3EY1A 1NHVA 4H0TB 1BU6O 3IFRA 3O9RA 2IVMA 1NK6A 4RQ5A 1YZ7A 1T8EA 2D3O1 4LF4F 1KTQA 2B4VA 1J5OA 4QIGA 1W97L 3ISCA 4LF5K 3HI0A 2CJKA 4I2EA 1W7WA 2DD8S 2ZZTA 2V50A 4EZ6A 3D1HA 1QJHA 2Y9UA 3B0YA 4LY7A 1IN0A 4HACA 2GX8A 1VK3A 1ZQSA 2QZ8A 5D78A 3W63A 3I8DA 3OR1B 4H4MB 2CPXA 1T6DA 4OJHA 1FJEB 2JGUA 3C5FA 2O5DA 1C20A 1X4FA 2WTUA 2DNZA 2UUAK 4FWSA 2EBEA 3AD8C 3QGPA 1MROA 3T1HF 1PC5A 4R8UB 4WK1A 2JJ4D 3RBEA 3PIPL 4BY9C 2HHSA 4GKJF 4DR5K 1U09A 4ZVOB 1MA7A 3JTNA 4YHHK 5A8WB 3EKSA 2J9DA 2Q6CA 1WDDA 1JLEB 2VANA 4JI2F 5GADU 9RUBA 3CCES 3RYLA 4NRUA 5KFOA 2RHQB 3LP1A 2C3UA 1KVBA 4WF9Q 1MWQA 2G07A 3VQCA 3RG6A 1KQGB 5J2JA 4DCHA 1RLCL 5LSOA 3DI6B 4I9QA 4USHA 2ZUDA 1S97A 1P9YA 3KUEA 1ZM3A 3WXJA 3H8WA 5J0XA 2Z30B 2UV8G 3CPEA 5JS1A 2JLGA 8ICOA 4CO0A 1C0TB 1KD1O 1QCKA 2HNZB 5IT9O 5ALGA 2DPIA 6FD1A 3UR0A 3D1OA 4JI8F 1F6TA 1FNXH 2DXDA 5KT7A 4LF7J 5KT4A 5C24A 5AICA 5AR0A 4V19S 4QW9A 4CLYA 2G5IB 4ZHRB 2NRHA 4PKIA 3RMCA 5ALKA 4HI1A 3AQPA 3FCVA 1SJFA 2QEXS 2GS8A 3OYFA 1NGDA 2D7SA 2YMQA 1PC4A 3MEDA 4RW9B 3A0IX 1ZPVA 1ZZFA 3KFWX 2UU9J 3BQ0A 4CLWA 1W2IA 4UTGA 2X1GA 2D1KA 1BPEA 1NSQA 2VC1A 5LL6d 4OX9F 2HSEB 4KLDA 4FJ9A 1RLDA 1YRUA 3Q24A 1XK8A 1HHTP 2P9LB 3ISDA 3ZT1A 7ICLA 5HL7L 4AHRA 5JLHA 4CLKA 5J0SA 1SKWA 2NPFA 3C16A 1RI7A 3L0QA 2F4VK 4DLGA 4QAGA 4DPYA 3JAMU 1T3OA 2DY1A 3RB6A 4QPXA 1VRUA 4C2MA 3WKCA 4YOXA 2EAMA 2KJ9A 4LF6F 5A0YA 2IVNA 3SYZA 4ILGB 3GV8B 4MH8A 2IRXA 2JEIA 3ZEUB 4RKUC 1Q7YT 1ZQPA 5ETKA 4FBUA 5LOQA 1IXRA 1KFTA 3FC4A 4CYUB 4FF3A 3DXSX 2NXJA 3UMCA 4EELA 4WTOB 2DKOB 5GAHU 4EYIB 1JALA 3H8JA 1COKA 2WB1F 2YPYA 3CCQS 1JJ2R 3THYA 3GE9A 2JDJA 3DXBA 4E8UA 3T41A 4L3NA 3OTOJ 5FDLB 5C2DA 1UOCA 4DL3A 3UN5A 3UKUA 4BE0A 3IG1B 4C8OA 1HPZA 1NZ8A 2ZTEA 3VCBA 2BOPA 3A4TA 3F5TA 3OXGA 4LSNA 1WACA 1SXDA 4JI3J 4AHTA 1JJCB 1X42A 4IR9A 5IIMA 1XSPA 1F5SA 2AV5A 1ZAXA 2GJFA 1BPDA 4KQZA 1N8RO 4UB4A 1TUVA 1RAOA 1DEJA 2PEBA 1X3NA 1IVZA 9ICPA 4DR3F 4H5NA 4ACOA 3X3UA 5JRTA 1IBLJ 3FNNA 3KWIA 2VGMA 1LOUA 2ABYA 4IEIA 3D6TB 1I94K 1WEYA 1FESA 2H5XA 1KN6A 4I2HA 1F1BB 4Q43A 1XMQK 2KJ5A 3L2WA 4I2FA 4LF8J 3HJVA 3OFHA 2RF2B 3RAMA 4QIWF 4C98A 1VCTA 1HJOA 4QZHA 1EQ0A 3N7SC 5DK5A 5L8RC 4TU7A 3EXYA 4AF1A 4K4ZA 3NUQA 2I38A 1RKIA 2KN4A 1XI1A 5C5JA 4DV3K 3FMWA 4YMEA 4ICLA 5K8NA 2BX6A 1WJ9A 2Z4PA 4B3MJ 3OBWA 5KG4A 1KQFB 3ZZTA 1PYOB 3TZYA 3CIMA 4KY3A 1RT1A 4L3KA 1NK9A 1DQ9A 1VOMA 4DCJB 3E9LA 1K5OA 5ALJA 1WYGA 4JI7F 1GQEA 4ZCMA 2DY9A 1YWXA 2OANA 3OYNA 1EZZB 3TSUA 3RF9A 5BR8J 2PXIA 4YNQA 2HBJA 4HT5A 2BTFA 2XWYA 4CQ1A 3U3GA 5L1LA 2FPKA 3BJYA 4OPKA 3U3YA 3W2WA 4IO8A 2IBKA 3H45C 2JC1A 2EFQA 4ELTA 1ROFA 5DB9A 2LBOA 4KLIA 2VJ4A 5I4MA 1BPBA 3MAAB 4X66J 2Z1JA 2ZIUA 4HWIA 2XY6A 2APOA 4U67L 1GLDG 3D2QA 2AP1A 2Q2RA 4IG3A 3VEXA 2DRDA 4PWDA 1GLCG 2CQIA 3CF5L 3M8RA 3C16B 1WAFA 1N5QA 2R18A 3CD0A 3PNCA 2IM1A 3H4BA 1R0CB 1ELOA 4QWDA 5C15A 3WNFA 3EJMA 2BRKA 3SSSA 3UCGA 4HAIA 2HCFA 3M2RB 3IRXA 3GV7B 1LFPA 1DT9A 1EXNA 1C0GA 1AFJA 2JNJA 4TXSA 4CEFA 3OY9A 2OPQB 2O01C 4A8OA 3KWGA 1X9SA 4NLQA 2G06A 4FNIA 4GLXA 1H2UX 4CD3A 3QIPA 2O8BB 1FNOA 1WSIA 2FMSA 2CQ1A 4DR7F 3L9ZA 5D4BA 3UVJB 4M7XA 1DRZA 5CD4H 4WFZA 4O44A 2RRBA 2G2ZA 4NLVA 1CJTA 3TADC 1Z1ZA 2OCEA 2EI5A 2BQRA 3VQ5A 5DDRC 1F5BA 2HRYA 4YN3B 1KFDA 1YBTA 2MKYA 5IT0A 3BBCA 1JKHA 2W40A 8ICLA 1L3VA 2QLWA 3DU6A 1F2HA 3PKYA 3LP1B 1W7AA 3H20A 4KO0A 3KVGA 2IDEA 4WFBQ 1HHSA 4TN2A 2ZWOA 2W7OA 3IR6B 5E3CA 3MPDA 5HSPA 3IG1A 1RA7A 2VOPA 4WP8A 1GMUA 4IQMA 1J9AA 1XSNA 3O44A 4AQYF 2K8BB 4CJVA 1HR0K 4FJXA 1A76A 4TUQA 2LPEA 3K8VA 4YEAA 1FFSB 3SBTA 3VN5A 2ZJPQ 4QZAA 4QZDA 3FCWA 1QTMA 3THPA 3B6OA 1L6NA 3O8MA 7ICOA 1KS2A 5AFUH 2YKMB 4ZP8A 2VIXA 1VRTA 3BF3A 1UVIA 5ALHA 4JHDB 3PMLA 5B8HA 3NNCA 2WW8A 5J2MA 3R1LA 2I8EA 5AI9A 2VUGA 2FDNA 4CJWA 3EUNA 5A76A 3BF1A 1KW4A 2KV2A 4BDZA 4MF8A 1S6QB 1RAIB 4X64F 5KFFA 2J0QD 3U4LA 3VQPA 3EM1A 4R66A 1ZBUA 5HVHA 3QNMA 5AK6A 2EXUA 1HBUB 3SUNA 8ICUA 3J80Y 4CRJA 1YI2N 1VJQA 1YJWS 4LFBF 4F71A 3MECA 3AJ1A 3VERA 2DXEA 1N33F 2DYAA 5HJXA 3TEGA 3T1YJ 1RWKB 2BPGA 4IDKA 4NM2A 3W1YC 1S72N 3ULEA 3VEVA 2OEJA 4DWIA 1RQNA 1VYAA 3WQUA 4DV5F 2NS1B 4FN5A 4OI4A 2XS7A 1QTNB 4J9SA 4CJLA 3CO0P 4J9UE 1VC5A 2FQQB 1YSJA 4OHXA 2GIFA 1AROP 1WORA 2ZNZA 2VFSA 3BSOA 3G4SN 4B3MF 2PFOA 3OSNA 4CGGA 2M0NA 2DT9A 5D15A 1TGOA 1S1VA 3MR5A 2W11A 3F41A 1MSWD 4XUSA 1HNIA 1HQUB 4CE6A 3QZ8A 4BGBA 4OX6A 3TWHA 3M9OB 3ID8A 3N97B 3AARA 3NCPA 3SLCA 2A2DA 3L3FX 3AD7C 1PAUB 1RDFA 3CCLS 3NDKA 1IBKK 4UAUA 1U1QA 2R7VA 2OA8A 3IRUA 5EE9A 1R7IA 4US9A 2R7WA 3MGJA 4BRKA 5KFXA 1R0AA 2Y0BB 2UUCJ 3H5XA 5DLFA 2V2KA 4JNEA 1FNMA 1S1TA 3PSIA 4RBUA 1YZ6A 1UEKA 4FK2A 5DQIA 4PGQA 4CJUA 3MABA 1N34F 4OLPA 2WTFA 2DNPA 3J80U 2ZBRA 5AQUA 3M8PA 3K1RB 4O5FA 4U7CA 2VQEK 1MMLA 2W2PP 2BCQA 4KN4A 3OUYB 2HHHK 3EGVA 4FYXB 3FZFA 4BS2A 2BJ3A 5A8RA 1RTJB 2D5RA 3NCRA 3D67A 4J9MA 4ED0A 4OI6A 3U27A 4BC7A 3QYYA 2P5VA 5AE1A 4IFYA 4JK8A 5LMUK 2HBZB 5KNIA 3VZHA 2H4WB 2CYYA 4BE2A 1LKYA 1U1NA 1Q4RA 1URRA 2D4WA 1UETA 3SR6A 4WU3A 3R9LA 5JVGQ 1WLJA 1UMJA 5D6GA 4DEZA 1VJ5A 2J7KA 2ZBQA 4Q7AA 3ZTSA 1RBRA 1XO0A 1TL4A 3ID6A 1OW5A 3D2FB 4E1NA 2EWHA 2M0GB 2YWKA 2XZWA 1AA1B 1QDUB 1IKWA 4GXKA 3MCAB 1KDHA 3GJSB 1PG5B 2H3FA 7ICUA 2V63A 2YBVA 5AZJA 2RB7A 3TAMA 5HRRA 2YH1A 8ICFA 3OYMA 4RW6B 3KFUF 1Y5LB 5KFZA 2YXLA 1C4AA 2KOBA 4Z7CA 4G1QA 2WVEA 2HVEA 1LQ9A 5KAIU 1KC8O 3TRGA 4C11A 5FLXO 3NNAA 1RHRB 4KLUA 4UZCA 3VQDA 2ZH4A 5M1KA 1S0NA 4NASA 2BJEA 3WX8A 2PA3A 2NXNA 4JI4F 2XS2A 2W2NP 2XM3A 3KTQA 4C1NI 5HK4A 2GVDB 1ZQGA 5D0RA 3CDUA 1RDAA 4OZJA 2WAQF 2XSFA 1TUYA 4CLLA 1BGXT 1M1KT 3AMZA 4DOBA 2LI6A 3MM6A 4F50A 2GGPB 2NO4A 2O67A 3N6LA 3A3OB 1JL2A 2ZIXB 4U96A 4JKCA 1SKSA 1DQ8A 3GG1A 2OFGX 2I7NA 2V5HG 2HAFA 1YAGA 1ZBTA 4L74A 3HW8A 1YTYA 3MMBB 4CGJA 1RT3A 2W9BA 1P1LA 4DCCA 2C2KB 3CNQP 3HKZD 3DYAB 3ZSZA 2X3DA 3VQ6A 4CP5A 2HNYA 2DEJA 1Q8BA 2VB6A 3HFZB 1EIYB 1CZ9A 2IDLA 3HWTA 2NZTA 2DR7A 4KB0A 3VC8A 1BPYA 1KVAA 2PC6A 5DMRA 3N5BA 1Q7YO 3HVTB 2YWWA 3MMAA 2HQ3A 3MAHA 1J54A 2VWBA 3SENA 5J2DA 2FC8A 5JMVA 3O2IA 3H2VE 1A5XA 2GELA 3THVA 1JLBA 2EFVA 5ADXH 3J7YP 3PX6A 2WC9A 1NSPA 2KP7A 3VEWA 1M5HA 2E5LK 1GTEA 1Q18A 1MG7A 3LGMA 2IMWP 4LR8A 1RHQB 3C8YA 2K06A 2KIWA 3JPRA 3DCAA 3CJRA 4HR2A 4OL8A 2RE2A 1UW4A 2O8EA 1JROA 3IHQB 2YKPA 4F3MA 1T3VA 3RH4A 2MA1A 1N0UA 4GV3A 1BUXA 1SIJA 1VQPS 5D3GB 1FXXA 3HSZA 4QOZB 3MDAA 3IM8A 2H4YB 2R7YA 5KFWA 1VIOA 1YTAA 2FYXA 3NFAA 2Y1RI 1IBMJ 3SQIA 1CG2A 4I7FA 1R59O 2W1BA 3MM8A 4CLUA 4CCHA 1IH7A 1B0XA 3TAFA 4LT6A 3BR9A 4LF6K 4NA1A 5ETVA 4FPBA 4JKGA 3HPHA 1FKOB 4M5MA 2K8GA 4OYWA 1SQGA 4OI1A 4E7KA 4AT1B 2UUCF 2OTJS 3ALYA 3AM9A 1RILA 3OGUA 4X62K 2XHWA 1OQ3A 4CGIA 1IIPA 3TUIC 2ATCB 4Y2QA 3ZSWA 1S9GA 2KM8C 4M9GA 1VLBA 3TUJC 1FKOA 3NH1A 3FBEA 4WP3A 3CJ5A 2QEXN 1VQ8N 3CERA 1U9LA 1TKTB 4M5KA 2DNHA 3OS1A 4DL2A 5J2BA 3MM8B 5IQQA 4FLZA 1IO2A 2BJ8A 4P71A 4O0NA 2C3PA 3T6BA 1VR6A 1I5OB 1KLMB 2MQMA 3QBWA 2RE1A 2OMLA 5A2QY 5ALDA 3CT9A 5CYMB 4P0PB 4JV2A 5KI6A 3A0BU 2E5JA 2WF7A 3QEPA 5KT3A 4LFCK 2NUUG 4FWLA 3LW5C 1TYQB 5ALOA 2LXUA 4OYOA 1A0PA 4U7UD 2FF3B 1HL6A 5KFQA 4MKVA 3P38A 2R8KA 1YKWA 2ZHBA 2E2QA 2ZM6K 3JAMO 5AK4A 4HHTA 4M5DB 3PFOA 1UVLA 3AO3A 4NXMK 3EVMA 3IWLA 4MT1A 3H2UB 4DSEA 4DV3F 2DY4A 2MZRA 3G6VA 4UOCA 2CQ0A 3Q8MA 1EP4A 4CZEA 2UVWA 2YX8A 5ETOA 3HP9A 3LP0A 5GIOA 2IOHA 4CW7B 2PSZA 3NWGA 3FYHA 2LA4A 2HGMA 3C19A 2EVZA 8ICEA 1L8LA 2E1PA 3CDWA 8ICQA 1H3DA 1RG6A 3OTDA 3OTEA 4MEXA 1RT3B 4PCQA 3ETLA 5HMXA 4O3MA 4FJGA 3PJXA 1NK4A 5B0BA 4KAZA 2JXJA 3DLEB 4B3SJ 1BPXA 4DN9A 3NVWA 2U2FA 4DF4A 4P9SA 5DBCA 4Q0BA 4DQPA 3NGRA 1BCOA 4XPEA 4FM1A 2YX6A 4KX5A 2YHBA 1JLAB 4WE1B 4FFDA 2KD1A 2VPYB 1JLCA 3GOIA 1FRMA 4NE9C 5LJ3Y 4QS9A 2DCUB 2R7XA 3BEGB 3ZSVA 1VQ9S 2K4EA 5KFIA 3KK2A 4MIBA 3PYGA 1WHXA 1VQ5S 4XRHA 3G8SA 1H1VA 1X9MA 1UAWA 3OHRA 1XNRF 3CFPA 1R8PA 2VASA 1DRGA 3M6KA 5EE1A 5LM7E 3FJ2A 2NXUA 4UB5A 5F8JA 4RUAA 2WF8A 3H0MB 3K9JA 1NKCA 4LF5J 2P9PB 1SBRA 1LWFB 3FGVA 3WNEA 5I3PA 3OXLA 4XAKA 2UUWA 1WWHA 3I5CA 1JLAA 4EBEA 3GIMA 4LQ9A 4B9LA 4RQ3A 4KV8A 1Q3UA 1ZQJA 4XA5A 1T9XA 5DDOC 2HZVA 4Z2XA 4UY8O 3CJBA 2HI0A 3THTA 2P5GA 3HFKA 3GYGA 4HVJA 5L38A 2DGVA 4CJTA 1N5VA 4KB7A 4PKDB 5C25B 4M3WA 4LRCA 4NI2A 1XO1A 3M2UB 4DTSA 4ED8A 1OH5A 2LQ8A 2QL9B 3SCLE 4F4XA 1ZPWX 4ZLJA 1FJGJ 4PG7A 4C6AA 4EO8A 4Z4IA 3H08A 4C3MA 2VD3A 2UUBF 4CNZA 1ZQBA 5HAOA 4YP3A 4IQWA 2RT3A 5B0EA 2Y8YA 1T02A 4WWSA 1SV4A 2F8TA 2KVSA 1CQNA 2IDOA 3CCVN 4JWMA 3AEVA 1WI6A 4NLCA 2ZJRL 3MOZA 1NKEA 1SIWB 5AI8A 1RP5A 2ZH1A 4XDDA 4PHEA 4Z4GA 3WNHA 3WK6A 2ZBCA 4UB8U 4UOHA 2PMZC 1N5YA 3F44A 4OZ0A 1T9WA 2RP5A 3P31A 1C7YA 5J0PA 2YX4A 1E6VA 3M7VA 3DLHA 4ZOHC 4ZVRB 5J1EA 3AA8A 4DR3J 3RRHA 3CQXA 2E1AA 2D3OR 3QFHA 1U25A 4ZH4A 2CZ4A 4F5RA 1PBUA 2FPLA 1OH7A 1E3MA 4P4MA 4OYBA 2ZKUA 4YVZA 1SH0A 2YX1A 2OPSA 4K8RA 4DUYK 4M3YA 4M63A 1CJVA 3PDNA 5AQHA 4NLKA 1OYDA 3OVSA 2ZIWA 1A7GE 1XTZA 2E44A 4Y00A 2YWHA 4YS2A 5AM0A 2ZXHA 3BB5A 3EICA 3R3TA 1C0FA 1PO6A 2DHAA 3J80O 1VSJA 5B09A 1Z19A 2CGKA 2P6TA 3TR8A 3A3PB 2P9UA 4CH1A 3AO1A 4NEYA 4W98A 1RTDA 2FHJA 3SMVA 4LRDA 1N32J 4WJ3B 1VLYA 1ZQZA 5FRMA 3A2FA 2J0WA 3HYFA 2MKJA 3FK4A 1OSDA 1IKVB 1CEZA 3EGWB 1RDRA 4RQ2A 2XZDB 3SUQA 4KE5A 3GSIA 3RH6A 4I2CA 3A1YG 1N36J 2WB1C 3FFKB 7FD1A 4A8WA 2Y8WA 1BI4A 2PI4A 4JEPA 2N4DA 3LDQA 1R6VA 3G96A 3L09A 4A46A 3TUZC 5GADI 2FC0A 5AT1B 3BZCA 2MZTA 4N41A 3FR0A 2O8DB 2VKQA 2Z56B 2RU3A 3PW2A 4UZBA 3DDNA 1KP6A 3JYTA 5HP4A 2MHNA 4IOXA 1FA0A 3CJ7A 5J29A 4P6QA 4ED3A 2XCAA 1RHUB 1UFWA 4IFYB 1RB0A 1PIEA 4AQYJ 3BQ7A 5F8GA 3ZSYA 1KHWA 2A1JB 2HBKA 4PR6A 3L6QA 2B8PA 3UN3A 1XNQJ 2HVIA 2NUHA 5J2GA 2XGQA 4CLSA 2F1FA 4DN0A 4B1VA 3U8XA 5D49A 5DB6A 3D0PA 4LZGA 4TUSA 2OPPB 4CEDA 5CHIA 3BBFA 1RT7A 4LF8F 3TSQA 3ZDDA 4RLEA 3AA5X 3NMUA 4LF5F 1Z4NA 4G1IA 5MLCV 4B1WB 5C42A 2OPPA 3VF6A 2RHSB 1WBDA 5AQRA 3I0SA 4H54A 2HHWA 3AGRA 3KZIU 2UXBJ 2FPHX 4CZHA 2V8HA 5AKGA 5BPMA 4IOAQ 1JCEA 2LMIA 2ZG6A 1NK7A 1YT3A 1QSYA 2RKIA 4R79A 1YUWA 1IBMF 3SPZA 2ZH3A 2ASOA 3VHQA 2Q1LA 2A1JA 4FZVA 2YWEA 1B22A 2XLKA 3TFSA 1IKXA 5B0AA 1CUKA 2IYGA 5CQGA 4Z4CA 4CHNA 2P9NA 4BC4A 9ICWA 2HBYB 1TYQA 3BQ2A 2A6AA 4CEOA 5C25A 2WRMA 3C6TA 1BQNB 4GC6A 4RQ6A 3D6MB 2DNRA 4FJMA 4B9QA 1WWVA 3KK3A 1APSA 3ZDAA 3IMQJ 2VBZA 2ZD1A 5M2UA 3VQ7A 1JL1A 3TPQA 5G0RA 1RHJB 2GZOA 2DIUA 1ZBFA 4EO6A 4PL7A 3K7RA 5M1NA 1LWXA 7ICPA 1ZJMA 4F4WA 2VFRA 3TUPA 2KXFA 3VTHA 2DFLA 4G9BA 1RHMB 3JQMA 2B51A 1AUDA 4F0HA 4ZA1A 1FCAA 1AUSL 3ZI4A 4GO7X 3IRXB 4NV0A 3LZIA 1T3NA 3QMLA 2DO4A 4NI2B 2FMQA 2B6GA 1D3WA 5F0UA 1ZM4A 5FRNA 1RBLA 2W9MA 1ED1A 4A8EA 2XS5A 1ZQWA 2QARB 1IM4A 2QKKA 1RADB 4PYDA 1HNWF 3VAJA 4L3QA 1VQLS 3TZXA 1ZQEA 2VIHA 1OY6A 3MX5A 3AVNA 4BRLA 2G8UA 3ZD8A 4N5SA 2VL1A 2BCRA 1HWUA 4CLZA 1UVNA 3V7KA 1FW6A 2KSOB 2PFNA 4CZGA 2F4VJ 3UDEA 1ZQDA 5G4DA 4Y2YA 3RSEA 2N4CA 4MFFA 4KKOA 3RTVA 1NUEA 4FJKA 5IIOA 4JI5K 2FSJA 2DGOA 1BMQB 3O1WA 1Q79A 2O8CA 4LF4K 4U95A 3R2CJ 3ITHA 3B6PA 4EWTA 2WB4A 5AK3A 2FHJD 1Y4ZB 4GVBA 1P7DA 1RTHB 1LWEB 4QYZK 5AQPA 5AKEA 3G8QA 4OZ2A 5L1IA 3RJJA 1UW9A 2HZAA 3OT9A 1XNRJ 3SQ1A 4DQQA 2IBOA 3FRYA 4CK3A 2Q0ZX 2GV9A 4ER8A 2XHCA 1JKHB 3OTBA 4FLTA 5JU5A 2QA4N 4YMOA 2LQBA 4ECWA 1ASVA 3V9SA 3CCLN 2EZYA 1JNRB 1UCVA 3H46O 3G71S 1X4GA 4USVA 5DG8A 3VQBA 3PFEA 2CNKB 3MF5A 4GO5X 2QJ3A 1SGGA 3DLKB 1ZTWA 4X64K 1JXBA 3KBBA 1KD1T 5DQHA 2DNYA 3W9JA 4CT9A 1TFYA 2IVOA 4ZP7A 3AO4A 2RDJA 4CZKA 5KT5A 4L75A 1J5EK 5M1PA 4CIEA 2R7TA 4BJQA 1U1OA 2VF3A 3IAM9 4IG0B 2YKAA 2VPWB 5L46A 4TLQA 2VJ5A 1HNWK 2AHOB 2DHSA 5F0XA 1W2BR 2M88A 1VQ7N 4O5CA 1K73T 3EE3A 3Q2SC 1S9EA 4O5KA 2JV3A 4Z6DA 4MIAA 2WK4A 4IOBA 3TVZA 2BV3A 2MGZA 1IJJA 4AXJA 1HNXK 4P0PA 5BPNA 5J2QB 1S10A 4DTMA 2NRZA 1TFRA 1G4CA 4LSNB 3HP6A 4MLEA 3RB4A 4BDYA 4G1QB 5KFAA 4MYTA 2CUYA 2QA2A 3DGPA 2ZOFA 2JHEA 4F0MA 2E9RX 2BA9A 1BA1A 4I6YA 3TFRA 3N5FA 3E9OA 3DNCA 1YTUA 1JJ2M 3C15B 5EWGA 2A6OA 4CEEA 3SFGA 4FLUA 5LT5A 2HFVA 4PWUA 3AVCA 2HWTA 3C28A 5HMZA 5M1OA 3CC4S 1RHKB 5ALLA 2CADA 4BC2A 3TNVA 3L3VA 2MYFA 4LQ3A 2KKVA 4XO0A 2OFHX 3AY0A 2KVIA 3V7LA 3C21A 4FYYB 3WQPA 3JAMY 3ZZZA 4A57A 1FFUA 1U24A 2D69A 2VBYA 2IGIA 1UWBA 3EPIA 4U9RA 2GAGC 4EUVA 3CCSS 4DB3A 2DCLA 4B9UA 1FXDA 4F91B 5K8OA 3P45B 4BRMA 4RPYA 1SS6A 4QR0A 2IJFA 4H4KC 1YJVA 3KNAA 4KO0B 1NM2A 2CRLA 4DL5A 1XMOK 3M1VA 1C1BB 2P9SB 2F8SA 2AQ4A 2JVRA 3R9KA 3AAWB 2ZFHA 1G99A 1OUQA 4F7VA 4C0HA 3PZPA 2LFVA 1BXNA 4QR1A 1WSFA 5KTQA 1J97A 1N63A 4KLLA 3Q22A 4FZXC 1YK9A 3RJEA 4GVLA 3HFVA 2WCXA 5AQGA 1WEZA 2N1RA 5AQQA 2QWOA 3RGIA 1VQ6N 2W3RA 2YKQA 3BP8A 3PO5A 2XMJA 4Z6EA 4F92B 1WB9A 4H5VA 1FERA 1C2PA 2DTJA 3KWMA 5J2IA 2GVDA 2Y1LB 3CEDA 3CFOA 3DGVA 2D0BA 1Q8IA 4FKYA 4BX9C 3QETA 2BXJA 3JTOA 4H4OA 1C1CB 2V6AA 3D45A 2GMHA 4RO0A 2GJ2A 5BR8F 2EWSA 2EKNA 1T05A 2WVBA 1TL3B 5AQXA 3DRSA 3MURP 2RNEA 3LTOA 1RT2A 4NXNK 1WG1A 1KWMA 4C23A 1U1LA 3WIVA 2VFUA 1U2VA 2QA1A 4M42A 2RPIA 5GADP 2BDUA 3EUB2 2FHMA 4X4UA 2YMLA 2POKA 3C15A 5HATA 2AH5A 3MOJB 5AZIB 2DF4B 4KH6A 4A8KA 2OAUA 4ELVA 1KCFA 4FWNA 2MKCA 2HOIA 5GMEA 4FYWB 4DV1F 3NGTA 3CJKA 1KR4A 4AUKA 5GAGP 3JPQA 4DR6J 4CHYA 3HL8A 1QAXA 3RB3A 1TL5A 1QAJA 4C7QA 2O8DA 3T19A 3R7NB 3CMAN 3N4QA 4OGEA 3H4DA 3C2PA 1GO3F 1QSLA 1GLBG 5GINA 2HWIA 1VS3A 4M45A 2GTDA 4KT0C 3Q8VA 3Q83A 5T7LB 4F0KA 2ZJRQ 1NDLA 3HSDA 4CIFA 2IAJA 4QIWC 3ZLJA 4ANCA 4IFEA 4FNHA 1FDNA 2YNFB 1N32F 2PMZF 1ZJNA 5KOWA 2UV8A 3CI5A 1IR1A 3L4BC 2H65B 3OFEA 5HQLA 2HBMA 2JLFA 1RT1B 4JI3F 4EX6A 5CR4A 3W5YA 1JK9B 4C7ZA 1ZQFA 5DM7Q 2UXDJ 2QXLA 3OYLA 4V1Ak 4BQZA 5AQVA 1KKXA 4OVLA 5IILA 3LOUA 1ESVA 4YD2A 2X7IA 3ZSXA 1WAJA 2NUBA 3G86A 4ITSA 2DBYA 5LY3A 1AB8A 4IFVB 2VA2A 1JLFA 3DM2B 3FRZA 1PILA 4FF1A 1C6VA 2B0GA 5LSLA 2O8FB 3S6EA 3HXMA 1J2NA 1TUGB 4R65A 2BRLA 2WOMB 2Z8QA 3G8TA 5J0OA 3MXHP 3ZC4A 4CE9A 4GVBB 3TAPA 2AJFE 5AQZA 2KHVA 2K8AA 1Q46A 1IM6A 4DCOB 4KGXB 2NSBA 2CXEA 1T03B 5HRSA 2HHTA 3SPYA 4ZJQA 1JJHA 1HBOA 3B78A 3CETA 3VQ4A 3P8BB 3F5EA 5GVQA 3BGFA 1SB6A 4IDKB 1UA0A 2HHQA 4F67A 2HS3A 3E51A 5L39A 4JKEA 3CJ9A 4YXMA 1IV0A 5CE3A 2YQ0A 4TLRA 1EB0A 1FFGB 1HQUA 2W04A 1XQIA 2NZCA 2P9KB 3ZSQA 2FZGB 3QT6A 3AO2A 4M04A 5J2KA 2R9LA 4PWWA 1HBMB 3MM5B 3VQ8A 4DV0F 2WW4A 3RUBL 4NLBA 4OZ1A 4WXWA 1T7PA 1Y3JA 4F3TA 2RH3A 5TKWA 1R3NA 1B70B 2NO5A 3ULDA 4AQYK 3ZCMA 2QC3A 2PO4A 4LUBA 4P2MA 3FBBA 5AM1A 2VG6A 4I6AA 5T7BA 4I2IA 1KSPA 2V2ZA 4OHWA 3U1LA 1XWLA 3M6GA 4PG5A 3OW2M 1K1SA 9ICQA 3CDAA 4O4RA 1HX1A 2JH7A 2XB2D 4H4KA 4V19J 5K8PA 3AN1A 3I56N 2AJ1A 1N36K 1VQYA 1U1KA 3KK2B 2PYLA 4ZPVR 1DK3A 2EBGA 3ZO7A 4ZTFA 2ASDA 1RWOB 3ENVA 4CO1A 3HMJG 2DHGA 4ZHRA 4RW4A 4N76A 3C7NB 5DDQC 1PZNA 9ICSA 2GUPA 1LAVA 1FKPA 4M3UA 1R0AB 4PY5A 3VAKA 3MR2A 5IV4A 3IC1A 3DDKA 2KK0A 3GPAA 2XQCA 1C1CA 4RCHA 3HRDD 1S3XA 4X4QA 3IBCB 3K58A 2Y9TA 1TVAA 2ZHOA 5GTHU 4PQUA 3CRXA 2OD6A 5KFEA 3DOKB 2KL8A 3KJNB 4QU6A 1GTHA 4OJGA 1P6TA 3QBXA 1NOYA 4JV5F 3A8EA 3KLGB 1O13A 3B8HA 4RZRA 4GKJK 1N56A 4RW7B 3IDWA 4PHDA 4DKWA 4WFYA 2MQNA 2N7CA 3HSCA 1NGHA 2BPCA 1TKXB 1HI1A 1HKCA 2P1JA 4DSJA 5CZ2A 1NRKA 3HM8A 1MDUB 2BH1A 3QSIA 2H5EA 1H74A 3HT0A 4BBYA 4K0KJ 1TK8A 1DARA 3WHIA 4JKHA 3BPSP 1GAOA 2W7PA 1F9EB 2EG2A 3C23A 4R63A 2R2TA 5LMNJ 2JGAA 3K59A 2G1HA 1X5SA 1JIHA 4MDAA 2JH3A 4DL7A 1JX4A 2VJUA 3RR8A 4WTYA 1C1BA 2CWKA 3N4WA 2XLJA 1W0HA 3HTVA 3BN7A 4K4WA 1HBUA 1P8GA 1Q95G 5DJBA 5BYSA 1S1WA 5D4OA 3CJ0A 4DV2F 4WKRA 1YIJS 2XY5A 3MDCA 8ICKA 1L3SA 2K7JA 2FVPA 4MIWA 1NJZA 1XNQF 3AVLA 2CPZA 4WPAA 1RXOB 3K2YA 3FGUA 1YITS 1TQLA 2D41A 4ILJA 3DOKA 4RWWA 4LFBJ 2PZSA 4QZ8A 3QEWA 4WFXA 4RWXA 1NJXA 4JI0F 4FYDA 7ICMA 2EK1A 4DHYA 7ICJA 2IA0A 2QA4S 2JEJA 4RL1A 2W2MP 4QPTA 3PY8A 1M6YA 2V8GA 5KGXA 5AIBA 4A5BA 1N5WA 1Q0NA 4DG1A 3J7Z5 1YJNS 3I6PA 4CZCA 1O8BA 3V1QA 4FW2A 4JI8K 3QQCD 4ZLPA 1W25A 1GX5A 4BR5A 1MWZA 2HBLA 3CCZA 4JI6K 4KLSA 3CGIA 4UY8T 4CEAA 2Q97A 1Y5IB 2A5XA 3H7IA 3G6XA 1X5TA 1AXQA 2C2NA 1X4BA 2D3DA 2UUAF 4OJLA 4YR0A 4ZOSA 2DNKA 1D4XA 1WG4A 1S1XB 5C2CA 5JLFA 3KLHA 4IYQA 5T41A 1EARA 1DHMA 2OHDA 4CHOA 3DU5A 2M2BA 3H59A 1XSLA 2W43A 3DRPA 4B3OB 3KJVB 4XQ8A 4LH4A 5KGWA 3AA4A 3TO8A 4RPXA 4ZCKA 4CJPA 1NMEB 1N5YB 4PYAA 4K4HA 4JI6F 1LXNA 1WCNA 1TKXA 5I9EB 1ZTTA 1FWPA 4DR5J 3LM9A 2ROEA 3CJ4A 4YHHJ 3K2PA 1HWIA 2UVUA 1WKKA 3UMGA 4Q8FA 4IOCL 2OWOA 2Z1IA 1U0HB 5DKWA 2OSQA 3NG8A 1N33K 2HLUA 1VHXA 2B8QA 1Z1VA 3GB0A 3OLAA 1WWUA 5AKZA 3TARA 1VQON 4HTJA 2ALZA 3CCTA 3B0XA 4BUGA 3CQYA 3MDFA 3MGIA 2DHXA 4DTNA 1VK8A 1VHFA 1XU4A 3M05A 3BZQA 3GMGA 1ZQOA 3TAQA 1SV5B 3O3HA 1IV8A 4PRFA 4FWQA 4J9RA 2KYZA 3D0GE 3LL3A 1KVCA 3THYB 4UY85 4LZDA 3KMQA 4NLGA 1RU1A 5ETSA 3GG0A 1VAZA 4HLBA 4LFCJ 3GZ7A 2HF4A 1SC3B 2WAQD 1OY8A 1SIZA 5D4NA 1GLFO 4USKA 4BRHA 7ICHA 2QG9B 3WUHA 4FXVA 5BJRA 5JICA 3PMNA 4IO9L 2QO3A 3POTA 4PUOB 2GQ2A 1QQ5A 3T5KA 4LR7A 2IM2A 2ZBPA 3IAS9 1SQEA 3SFUA 4RT2A 5ADXA 2R7RA 3QJPA 3NGIA 2UZAA 1N5XA 1VGYA 4FPRA 4BC3A 4DTOA 3AHPA 4H5WA 3B6BA 1HA1A 3CCJS 3M8SA 3EX7B 4NEZA 3RW6A 2QA4G 2HVDA 5KPTA 3MWBA 2IHR1 4DTJA 4HI2A 4CF5A 4ZJLA 3C29A 4M41A 2FI1A 5DZ6A 5DZ7A 3DRRB 5AQKA 3QU5A 2GEMA 4ILMA 1S49A 3ZT0A 7ICEA 1HD1A 4A2AA 2BANB 3P5JA 1NPKA 2XWXA 1NK5A 2M5YA 5HQ8A 3HSGA 1Y64A 2MUTA 2W9CB 4X4NA 3ZETA 2VPXB 5JVHQ 3TU5A 5L9XA 4GC7A 4OJRA 2CJQA 4CF1A 3TABA 2NZ4A 3KHLA 1C0TA 3VVTA 4CZFA 3SCXA 4NCGB 2QYGA 4Y2VA 3D66A 4L72B 3MR3A 3S8SA 3A8IA 3BM7A 3GU3A 3CJKB 1NHKL 1VDHA 4KTZA 5HI7A 5TISU 2E5SA 3C5GA 1NJWA 4FVMA 2MLXA 2ITMA 4HVZA 4IH7A 2F44A 5THWA 3K4GA 2B6AA 4YDDB 4IQUA 1FE4A 4EP5A 4KLQA 3NGKA 3DM2A 2W4CA 4DV6K 2E9TA 3EWGA 4CESA 2ES6A 3I0SB 4IXCA 4FP9A 3QUQA 3S01A 2DH9A 4JI2K 1HPZB 3DC2A 1DLOA 2BE7D 4J03A 3M2VA 5KFPA 2MEWA 3CC7S 4U8YA 1R0BG 4H4MA 4HL9A 2DGZA 2G0JA 1DK2A 3ENWA 2OEMA 3VPZA 2MXYA 4FJHA 3DI6A 3OYDA 3OTCA 3OBYA 1H0HB 3JXOA 1UQVA 4E3SA 2CH6A 4IO1A 1S0MA 5DB7A 2HHUA 2FY1A 3ADAC 4NYZA 3OTOF 1XQSC 2OMOA 3D7SB 3UQ0A 1NGAA 2KXHA 2UXDK 3TWZA 8ICHA 2C42A 4IRCA 1KN5A 3MN7A 2J76E 1TV6A 1BA0A 3MM7B 3V6DA 4LSZB 1MROB 3HVAA 3N4MB 3KDOA 3HRGA 5CZ1A 2VCPA 2BUNA 1HI0P 3O1LA 2CZVC 4PL1A 3AY9A 2JEFA 3OXFA 5A6WA 4AILC 3SSRA 1E6YA 3RW7A 3ALRA 4Q2LA 2LDYA 1VQ6S 5G0RB 4CJFA 3LP2A 2PY5A 9ICAA 2VC0A 3UI3A 1RAJA 4YG2A 3OTOK 2XNQA 2H3GX 1RABB 1F9HA 1KOOA 4KJIA 1LEOA 1P1TA 4Y2SA 1MN9A 1HMVB 5DQGA 4B1UB 3SNNA 3OLBA 3MK6A 2XYPB 4DUZJ 3I32A 2YB1A 2RS2A 1VSDA 1CJKB 1ITGA 4RUBA 4ECZA 4KBIA 4KAIA 5F9NA 4OI2A 2KW4A 1V5VA 5AXKA 4I2DA 4CGDA 3NGYA 1FKAF 4TKTA 2JC0A 3VQ9A 1ZYQA 2E5LJ 4LF8K 1FDBA 5BPCA 2WZ1A 1F44A 3EN9A 1D9AA 5GTIU 4FXWA 4UUXA 4ZITA 5AQTA 1RT6B 4ZVQB 2CNNB 3FKBA 4Y0WA 3F2BA 3AQFA 2JRSA 3UDLA 1HYVA 1TZ0A 5GAEU 4H5RA 3VQQA 4K8ZA 3FSXA 1T4GA 3ZT4A 5G5GA 4WFNQ 2JRZA 4BXOA 1X40A 2F8EX 4F2SA 2J9EA 3L4PA 3KNGA 1U2VB 2RS8A 5E41A 3DHWC 3T7ZA 3J7YI 1VQ4N 3HF5A 4IRKA 3T6JA 2HMIA 2RUSA 4OYZA 2QWRA 2F77X 1TL7B 3ORYA 2ZH2A 4I64A 3GJTB 3GR0A 3IG5A 3KLVA 4DSFA 3GBTA 2CPFA 1WOSA 1DAXA 4CO5A 4X4SA 8ICIA 2V7ZA 1YDLA 4RQNA 3ELHA 1BIUA 5B08A 4UBCA 3SZ2A 2ZZNA 3MMCB 2O1PA 4IQTA 4I56A 1U8WA 3FCHA 4BGAA 3I56S 3NGUA 1MMNA 4BR9A 3HHEA 2IRUA 4QZGA 1HRHA 1NAQA 2LLZA 3N79A 2DVIA 4CK1A 2VQEF 3DRPB 4LSLA 3OYAA 3L95X 1LWCB 3H6EA 3ISND 2K1RB 5T14A 4WQ5C 2H3ZA 4NM1A 4B02A 5FLXU 1ZQNA 1ZOTA 3SAFA 4EFAC 4IJAA 4HH0A 4I2QA 3M2RA 5CWRA 3NS7B 4ECVA 1M5OC 1NGIA 4KPYA 2KVCA 4IS7A 1L7OA 4C4SA 2E88A 1FKPB 4DI6A 1VBYA 4H5TA 2FE9A 3H5UA 1KEJA 4E1JA 1CC7A 3R5CA 3K8WA 3QFPA 1E6YB 2HK2A 3DGPB 3CCUS 4NLNA 2MHEA 4M5NA 9ICBA 1B0PA 4LF9K 2OD4A 3NVVA 2CG8A 4PKGA 3D6JA 3IP0A 4DXLA 3P1GA 2A3VA 2HBQB 1Q8LA 4K4GA 3ZTRA 1X4HA 2O4IA 4KHNA 4F93B 2E2PA 2MZSA 2KDOA 1RYRA 1SL2A 3KD1E 3KK7A 1KKHA 2A3JA 2RAQA 5CABA 3Q8PB 2UP1A 3ILJA 5I42A 2F9JA 4ZVGA 3F53A 3PHEA 3NRZA 1YI2S 4ED6A 1MU2A 2C3YA 4CM2A 1YJWN 1CS4B 3AA9A 5J1EB 3SQ2A 1S12A 1SXLA 4DR6F 3SDEB 1WTBA 1WUDA 5DGAA 5HRPA 5CCMA 3NTUA 1WBBA 2W4PA 3M8ZA 2F4VF 1FWKA 5IV3A 2B7BB 4KSEB 5GIPA 5CA5A 1FHTA 4MN4C 1TVRA 1GXUA 3ENHA 1FJGF 2UU9F 4YCXA 5J2QA 1VQLN 1G15A 2KT5A 4K2XA 5ALIA 5BREA 4F5NA 3NWRA 3A3NB 4OIXA 1I3OB 3ZZRA 2BCVA 2EZZA 5J2EA 2K60A 3QGHA 1R8BA 3D2EB 1SUQB 2XIDA 2YY6A 2ZVIA 4IG0A 4B1ZA 3BF4A 4UARA 2R4FA 3CCRS 2WUSA 5K8MA 3UPFA 1T03A 2HQDA 3Q8YA 4N8NA 4ILRA 4E1MA 3MI7X 3VALA 1JXLA 3C6TB 3C1YA 3OYBA 4CNYA 5ETLA 4DR5F 2ZOGA 1WSGA 4BRGA 3FDSA 2E1RA 1J5EJ 2XCPA 1YJ9S 2RDIA 4J9VA 3WX4A 4DSKA 4P0QA 4CTAA 3KLGA 1TUUA 9ICHA 3EGZA 3OW2R 5CHCB 4WFAQ 2FZKB 5DDPC 4OYXA 3O4WA 3PEHA 4A59A 4UW2A 5JUMA 3AV9A 2NRTA 3JSMB 3ILLA 4GY2B 8RUCA 3SV3A 3WDOA 5LSRA 3SIPB 1W26A 3MPYA 3MZIA 2AYGA 3JS6A 4KLOA 4DG1B 4JKAA 5BRFA 4QYRA 1I51B 2V8VA 1PUZA 4RQ4A 2CVIA 4A61A 4DX5A 5GMDA 1RA6A 1BISA 3TZZA 3VQTA 2XO7A 1BD6A 4NL9A 3HCXA 1VQKN 4LF4J 1SC1B 1VQ7S 1U1MA 4RG8A 1S0VA 4OJ1A 2HRUA 5KG3A 2BBEA 1AFIA 1WOQA 4ZVEA 1BOTO 3UM9A 1WOPA 4QS7A 1VQMN 5KFHA 4OHVA 3MHYA 2CGLA 1WHWA 4PPDA 2HFUA 3M8WA 1KBUA 2QARA 1SV0A 4QQBA 3PV8A 1ECWA 5EY4A 4KHPF 4DQIA 3NNHA 2AYEA 2O8EB 3EGNA 4M47A 2IPOB 4C97A 4AXIA 2LU1A 2WHEA 4ES2A 1X31C 4EFHA 3R27A 4ZPWR 2PMWA 2AGPA 2V0NA 3V4MA 5C2GA 4DV3J 2AP6A 4LRFA 4DFKA 4AL7A 1LK7A 2XI2A 1QAIA 1HYSB 3IFEA 1IKVA 3GSDA 1XEZA 2JWNA 2BJ1A 3FE1A 3HILA 4NCBA 2CGJA 1XHXA 2EK6A 1D8LA 3ZSOA 2W42A 1TKZA 4NYNA 2ZF5O 3H42A 3W65A 1Q53A 1NMNA 4AYBC 2AEJA 3BKUA 1XIQA 4J2AA 1RT6A 3W9IA 3VCDA 3LM2A 3ET6B 4DPWA 4JI2J 2HHVA 5EX3A 1R31A 1REVB 4JV1A 2Y0SD 5ALFA 2UXBF 1IR0A 3D54A 2Q66A 5IT4A 1TL1B 4ZVSB 2GCFA 2P6SA 2X74A 1TL7A 2CVEA 4OX8A 3BO2A 2ZITA 2WMMA 1BL3A 4P74A 1ZQKA 3KLIA 1RUSA 1HPMA 5F3XB 1QHTA 1K0VA 2ZXIA 1QH9A 5KPRA 3UD5A 3MPWA 3FSYA 4R8UA 2DHHA 3I4PA 4PWDB 3D2SA 2YWFA 1M5SA 3OS2A 1KRPA 1AZSB 4UB3A 2UXBK 4CBUA 3MXJA 1GLJO 2ZIUB 1FK9B 3N6NA 2PD1A 2AU0A 1ASUA 1WNSA 3O1BA 1DTTA 4B3RK 1VMBA 2P9SA 4ZS6A 3EE9A 1S76D 1OY9A 3NH2A 4DUZK 1N34J 2WF5A 4JBCA 1KL9A 2V2QA 1GFWB 4TNOA 4DUTA 5ALZA 2VG6B 2OTLN 4PAAA 4M5HA 3SQOP 3HI9A 2V4QA 1X4EA 4AHUA 4K4SA 2EANA 3MX2A 3QWUA 2RRAA 1UPMB 3KJFB 4X84A</