1NK6A

Cytosine-cytosine mismatch at the polymerase active site
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk6A01
5TZVA 3ISBA 4E7JA 3MEEA 3LPTA 4RW9A 3UXOA 5J0UA 4FLUA 4QW9A 4E7LA 4DSIA 3NGYA 4E89A 4KLDA 3AA3A 3UPQA 1COOA 5J0OA 3PW4A 5KFSA 2WTFA 4DSFA 4RQ0A 3KKSA 4C8NA 1NK9A 4AHCA 4DSKA 4E19A 3MXIA 2C2EA 2AQ0A 4AHTA 1JXEA 1WSGA 5J0XA 4O5BA 1I39A 4RQ6A 3ZSYA 4NY8A 4I27A 4R66A 4F2SA 1IKXA 1TFRA 1K1QA 3QZ7A 4KLSA 4Z4FA 3Q8RB 3H40A 4KTWA 4MEXA 4JK1A 1S0VA 4O55A 1N5YA 3UQ0A 5HRNA 5CYMA 1JKHA 2BPGA 5DQGA 4CJRA 1DTQA 8ICKA 4HCBA 4F5RA 1TL3A 2VG7A 4MFBA 3TARA 5HROA 4RW7A 1ZQMA 1WSEA 1LAWA 3SUQA 4F2RA 4FBUA 3AVFA 1XC9A 3C2KA 3N97B 2ITGA 4P2HA 3C2MA 3SI6A 1A5WA 4J9OA 4FJHA 3K58A 4DTRA 3JPNA 3V6JA 2BCQA 4Z6EA 4O0JA 3UIQA 3NDKA 4O9MA 5KFLA 4GMJB 4CJEA 5J2KA 4KAZA 1RYSA 1JLBA 3BQTA 5JUMA 4YR2A 1VRTA 3TANA 3SCXA 2KZ3A 4FZXC 1C7YA 9ICEA 5J0QA 1RTJA 1CLQA 1K1SA 4M3WA 2D0CA 3HM9A 8ICBA 8ICOA 4BACA 4Z6CA 2BCSA 1WN7A 3H08A 5DGAA 4M9JA 4ED7A 5F9LA 4Z4CA 3L2UA 1XHXA 1NK8A 4I7FA 2XCPA 3HVTA 4KHQA 4EP4A 1UA0A 2XGPA 5KFCA 5EWFA 1ZQJA 3JPRA 2F1IA 3AVIA 5BPCA 4PGXA 2AGOA 4F4ZA 4J2BA 4DQRA 4DWIA 3KHRA 1RBUA 4W5TA 4IQVA 2C2DA 4RPYA 2G8HA 2Q0ZX 4FM0A 4YD2A 3TWHA 3HP9A 3NF9A 1NOZA 4YFKA 2BCVA 1BQMA 4CHQA 1XS9D 5D46A 8ICGA 1IKYA 4CERA 4E3SA 2G8UA 3VA3A 4KLGA 5CHGA 4CJ4A 1RT1A 4CF1A 4NCBA 1Y97A 3LWMA 5KT2A 3QEPA 4F93B 4DQQA 4RNNA 4JRPA 3SZ2A 3T1AA 5KFOA 2E6MA 3VQPA 4AILC 4KI4A 3HPOA 3OS0A 4M3YA 9ICGA 3M9NB 2B6AA 1UT8A 8ICEA 2BCRA 4IG0A 4KHWA 2YNGA 4Y1CA 1A76A 1BL3A 1WNSA 3UXPA 2AGPA 1YVUA 4IFYA 4ED3A 4RZRA 3B0YA 2BKEA 3OYAA 4RW8A 2DFEA 2DPJA 3NH1A 1ZQUA 5KFYA 1RPLA 2ZQBA 4GC6A 4DL2A 2FPKA 2V4QA 1L5UA 3PO5A 3K4GA 4B8AB 4B9NA 4F92B 4FCYA 4E7HA 3ZSVA 4DEZA 1ZQGA 4FZYA 4DOBA 3DYAA 5KFDA 1U48A 3OYGA 4QCLA 3RRHA 5L1JA 8ICVA 4YNQA 4RU9A 1TKZA 1ZQWA 5J2HA 8ICXA 3MDCA 2HHWA 4HCCA 2IS3A 3F9KA 4B9LA 3V7LA 3V1RA 4DTXA 4E1MA 4O3NA 4PWDA 2W9BA 2UVRA 8ICZA 1EX4A 5F9NA 3AA2A 4IRDA 3RMAA 7ICJA 3DI6A 1RT7A 4KI6A 1JLGA 2G8VA 4FLXA 2H5XA 5IINA 4AHRA 2O4IA 2I9GA 4KHYA 4M41A 2BGWA 3AVKA 4CEZA 2Y1JA 3VQ8A 2D0BA 4QZDA 4YVZA 5KT3A 5FROA 2P51A 5FRNA 1ASUA 4R65A 4CF9A 5D4BA 5KG4A 1FK9A 4UB1A 2MUTA 3ZDEA 1S1VA 1ZJMA 1CXQA 4RT3A 3KKRA 2LSNA 1KVBA 1XHZA 9ICWA 4F5QA 1BPYA 3QEAZ 1J54A 1KCFA 2W9CB 1IXRA 1HPZA 1NKEA 2QXFA 3KK2A 4KB0A 1ZQXA 2Z1HA 3VQQA 5L1KA 3TAMA 3SUOA 3U6FA 2RN2A 5IILA 4B8CA 1EKEA 1L3SA 1U47A 1NOMA 4XIUA 1U04A 1RT4A 4CJQA 3TQ1A 2FLLA 3OY9A 1BPEA 4TUQA 4DQPA 4KTQA 1RXVA 8ICFA 2DTUA 5CJ7A 4GXIA 4IQWA 1GOBA 3RMBA 5L1IA 3LALA 3H8SA 3S3MA 4F4XA 3OYIA 2P66A 3P83D 3ZDAA 3ZDBA 4JV1A 2RKIA 2IMWP 4DTPA 5BOLA 3HPHA 1T3NA 1HMVA 3EZ5A 1NKCA 1WSJA 4BE2A 4IQTA 3OYDA 2JLEA 1XSNA 3CFRA 4CEOA 3PO4A 3PW2A 4FK2A 3H4BA 4ID1A 5KT5A 2JEIA 3ALYA 3PX0A 5KFQA 4OKKA 2BANA 5DB9A 1S9GA 4JS4A 3V9WA 3JPPA 4PQUA 1C1AA 1WCNA 2RF2A 2RDIA 4R5PA 7ICGA 5L9XA 4ECVA 4RUAA 3VQDA 4LD0A 4K8ZA 3QESA 4NM2A 4P4MA 1X1PA 4DF8A 5HRRA 3OYMA 9ICTA 1HRHA 3V6HA 3V6KA 1MSWD 4FS1A 3EW9A 4DOAA 3OGUA 3RJIA 2V9WA 4FJ8A 4B9UA 9ICBA 4EZ6A 3VQBA 2GV9A 4I2JA 5C5JA 1C1BA 2PZSA 4KREA 3DMJA 3NHGA 4IR9A 3L2VA 5J2JA 4FJGA 5DKWA 1JXLA 4J9SA 4CJ5A 4TSXA 3BGRA 1RNHA 1TV9A 2E4LA 1ZQRA 5KFVA 4MFAA 4FO6A 1GOAA 1ZJNA 2XGQA 1HQUA 4R8UA 4ECZA 4KKOA 3QEVA 8ICCA 3O3HA 2ASDA 1U49A 4J9RA 4RNOA 7ICRA 4CJUA 1VRUA 2RDJA 1ZYQA 4TUPA 1NOYA 4OPJA 4CGFA 3KTQA 4ED8A 5KRSA 5CZ2A 3AVNA 2ETJA 4J9KA 7ICOA 1PZNA 1QQCA 3QNOA 5HHHA 4L8RB 4ZH4A 4IFVA 4KHSA 4ELTA 4FZZA 4DTJA 3LP2A 4EP5A 4M45A 4I2FA 2PFQA 4WE1A 1RBRA 3MEGA 2R7YA 3HJFA 3RAXA 3A2FA 4JV2A 3QIPA 4IRKA 4CIGA 3OYLA 2Z1GA 2OZMA 5KFKA 3NFAA 3GIMA 3NCIA 3THVA 4YMNA 3GV7B 3K75D 2BQUA 5KFWA 1ZQLA 5CZ1A 4GVMA 3P5JA 4CGJA 3H8WA 2W8KA 2NRVA 4ECWA 3CYMA 4Q43A 1HJRA 4CFAA 4TQSA 2UVWA 1JMSA 4JLHA 3LP0A 4O3OA 4ECRA 4IG3A 1NK4A 3MEDA 3SV3A 1DLOA 3JPSA 4LZGA 4ZTJA 2O4GA 5KFBA 7ICVA 1X2IA 4RQ4A 1ZQBA 3LAKA 4QZIA 8ICPA 3ITHA 3ZT3A 3K57A 5E41A 3S9HA 5SWMA 4UAWA 1ZQQA 3I0RA 4J2DA 4ECXA 1B9FA 3LDSA 3T5KA 8ICWA 4QZEA 1UWBA 1QS4A 4CF0A 5I42A 4IQUA 1RTDA 2XCAA 4MF8A 3OYKA 2BE2A 8ICMA 3HYFA 3K5MA 2BPFA 2ZJ8A 9ICMA 4NLNA 4DFPA 4RW4A 4Z4EA 2VG6A 4CHZA 1V9PA 2F1JA 1TAQA 1IG9A 2VANA 4QZAA 4DSLA 7ICSA 1LV5A 4OGEA 1DGSA 3S3NA 1Z00B 4BXOA 2VG5A 2BDPA 1BPBA 3T3FA 5CB1A 4UBBA 1ZQEA 2IHMA 4QWAA 3IRXA 1ZQCA 1ZQFA 2XO7A 4M3TA 4E1NA 4KFBA 4CEBA 3KLEA 3RRGA 4YCXA 4CEQA 4JS5A 4JWNA 4HUFA 5KFFA 2OYQA 5DB8A 1TKXA 1N6QA 1ZQVA 5IIOA 4TUSA 1HUOA 1ITGA 5J0PA 4UB4A 5J0RA 2P6UA 3PW0A 4YN4A 2YNHA 5K14A 1RXWA 1S97A 2BQ3A 4MFCA 3NH2A 1QHTA 5FDLA 4NXZA 9ICAA 1VSJA 4DTMA 2FC0A 4KPYA 2XY7A 2X78A 4OKEA 2ZTDA 2ATQA 4LZDA 2DFLA 4I29A 4ED0A 3TAQA 1JLAA 8ICUA 3TFSA 3VQ5A 4DMNA 8ICJA 2DFFA 2FPLA 2MAXA 3HW8A 1RDBA 1RTIA 2UVVA 4OGCA 1XI1A 1LWEA 4M2YA 1WSFA 3CG7A 1T03A 1YTUA 2ZJ5A 3LANA 3O4NA 1KVCA 4EBDA 4O5EA 2KFNA 1I3AA 3IM1A 1SL1A 2HW3A 1ZBIA 1TGOA 4Y1DA 1Q9XA 2ASJA 3ISNC 4RQ1A 1VSHA 4QZ9A 1RBSA 2ATLA 2DY4A 4OVLA 4BGDA 4K4HA 5HRSA 1QSSA 1S9EA 1WSIA 2FBVA 3KD1E 9ICLA 2NRXA 5CWRA 2KZZA 2DFHA 3CFOA 4KLIA 1BPDA 4RT2A 3ZD9A 4I2AA 3OYJA 3AA5X 3PMNA 3D0PA 3NGZA 1IO2A 4KLTA 3SQ0A 4HVJA 1DOQA 4K4IA 3UQ2A 1BCOA 5CYQA 1X9MA 2J6SA 2IC3A 4KV8A 3QE9Y 2IHNA 4EYHB 5C25A 4EZ9A 3OJUA 3AVJA 5KG5A 5DMRA 1T7PA 4M9LA 2HHSA 4DQSA 2ALZA 1W0HA 3SI8A 3SJJA 2F8SA 4F8RA 4C8KA 4DL3A 2KN7A 1ZQSA 4ECSA 4UAYA 3LPUA 2UVUA 1HNVA 1HQEA 3NF8A 5JS1A 2JEJA 4I2EA 3AO4A 3SQ2A 1TKTA 3WNFA 4DFKA 5KG3A 4J9QA 2BR0A 2GBZA 4LY7A 4FLWA 5J2NA 3EPGA 2B4JA 1Z00A 4BXOB 3Q8SB 4M9GA 2V4RA 1HUZA 3AVHA 3AV9A 4BE1A 2VA2A 4I2IA 1Z26A 2JZBB 4E7IA 1ZQNA 4Z6FA 3KD5E 3L2QA 3G0ZA 4DTNA 2YKNA 3QLHA 1A5XA 2PFNA 4CJSA 2ZUBA 1UT5A 7ICIA 4DL7A 4DTUA 1BPXA 1SUQA 1JL2A 1HJPA 3DLBA 4J9LA 3N4MB 4PA1A 4JUZA 3C5GA 3PX6A 4YD1A 4PH5A 5J2FA 1S1UA 4FK4A 3GIIA 1S1WA 3QEWA 8ICAA 5KFZA 1BISA 4DL6A 4QWEA 3RR8A 3ZT2A 3RJFA 2C2RA 2YNFA 2W9AA 3KHLA 2EHGA 1XO1A 8ICTA 2X6NA 4QOZB 3NE6A 4DQIA 3AO1A 4PHDA 4NYFA 1KRPA 9ICQA 5DB6A 4FLZA 3CFPA 4NLZA 4N5SA 4UBCA 2QKKA 5KFHA 4EBCA 1UAXA 4F5NA 2F1HA 3ETLA 2R8IA 2HHVA 2G8KA 4FXDA 1ZBHA 3MR2A 4W5RA 4CHPA 1RT6A 3TABA 3AVBA 3O3FA 1REVA 4QZGA 3ZSOA 4AHVA 1ZBFA 2KZMA 4KLLA 1J53A 1X9WA 4F4YA 3MR3A 2M9NA 4KO0A 1ZQYA 3V7KA 4MFFA 3JSMA 3SV4A 1B92A 4FLTA 1SKWA 1VSKA 3M8RA 1KFTA 3OHAA 7ICNA 1VSMA 3C6TA 3LZIA 3V9XA 2PI4A 3FDSA 4N56A 3V72A 4O5KA 3H7IA 2HVHA 4J9NA 3VQ7A 3OHBA 3TAFA 4H4MA 3MFHA 3OYNA 3AVMA 1D8LA 5KG2A 3ZT4A 1S77D 2W8LA 4RPXA 5KFAA 3RB0A 4G1QA 4CFDA 2YHBA 1J5OA 4DTSA 3QINA 3RJHA 2XHBA 4OLBA 4O4GA 5CY4A 2FLPA 3SYZA 1B43A 3O3GA 4CJTA 1WCLA 4ECTA 3M8QA 4CEFA 4FM2A 3HP6A 1RTHA 4QWDA 4BDYA 1N48A 2IA6A 5DBBA 3HT3A 4FJXA 4FJLA 2KW4A 4Z6DA 5C24A 4RNMA 3OS1A 5KFIA 1K6YA 2HNYA 3TAEA 2OZSA 4M0AA 4OJRA 4R64A 5HHIA 4PHEA 3KJVA 2ZJAA 3ZSRA 3C5FA 3B6PA 1XSPA 1QSLA 1JIHA 3DOLA 1S76D 4DU3A 4YXJA 1D8YA 4DLGA 2HHUA 3AUOA 3V9ZA 4UB5A 4Q8EA 4ZTFA 1RDAA 3VQCA 1S5JA 4KHUA 5DLGA 2Q3SA 2JZBA 1Q9YA 4O3RA 3LDAA 3G10A 1XU4A 4FJMA 1QTMA 3RJEA 4M3XA 3V9UA 4KLQA 3AU6A 5J0TA 4F5PA 3VQEA 4N41A 2P1JA 4CJVA 3KLHA 1T8EA 4KN4A 4KRFA 1ZETA 3CQ8A 4PUOA 4XA5A 9ICHA 3RB3A 4H8KA 4CFCA 1DTTA 1ZQHA 3JPTA 4FJJA 1JX4A 9ICFA 9ICIA 9ICOA 4OPKA 1W9HA 4I2GA 5KG6A 3RBDA 1JLEA 2JGUA 1CEZA 5J2DA 4UAZA 4ICLA 3NBPA 1BIZA 3RR7A 4DU1A 3PNCA 4CFBA 3D45A 2HB5A 8ICLA 3G6YA 4JWMA 3M8PA 5J2EA 2W9CA 1MC8A 5IIKA 1WSHA 1LWCA 1J9AA 3BQ2A 4DFMA 4C8LA 1YT3A 3IAYA 3QEIA 4F4KA 3EPIA 4DSEA 5I3UA 4CJLA 3T5JA 3L8BA 3HK2A 1B9DA 1LW2A 3SQ1A 1TK0A 4PPXA 4CEAA 4FJ7A 3AVGA 4FVMA 1HYVA 4CECA 3PX4A 2ASLA 3KIOA 2PYJA 5KG0A 3RMCA 2BPCA 4CK2A 2HHQA 3ZDCA 2P5OA 3ZSXA 7ICQA 3V4IA 3OYHA 2BCUA 3H8JA 2OPRA 4J9PA 3SPZA 1ASWA 2BQRA 4GC7A 4PGQA 1RT5A 9ICKA 3QIOA 1U45A 1Y88A 4KLEA 2IDOA 3PW5A 2NUBA 2OPPA 5KFTA 2BGGA 3PUFA 3RAQA 5FRMA 4FW2A 4J2EA 4EEYA 2FLNA 3BDPA 4PHPA 4I2DA 1VSFA 3PY8A 2NRWA 1SKRA 4LH5A 4F91B 3TR8A 1RT3A 3UXNA 2IGIA 5L1LA 1CUKA 4DFJA 2Y1IA 2ISPA 3HO1A 4IBNA 1ZQTA 3KLFA 1S1XA 3RH6A 1JN3A 4YMOA 3C23A 1CZBA 3AO5A 3V9SA 4FW1A 5DDYA 9ICPA 4C8OA 1ZQKA 3S3OA 4CK3A 4I9QA 4TQRA 5KFGA 3RJGA 2YNIA 4HTUA 2AJQA 4CF2A 2OPSA 3NGIA 1RDCA 8ICIA 3TAPA 3ZDDA 1ZBLA 3NAEA 3Q8PB 4CJPA 1C1CA 5J0YA 4B9TA 3FFIA 3VQ4A 3K5OA 3DLHA 3LZJA 4IDKA 3Q8MA 1IKVA 3JPOA 4CGHA 1KLNA 5IIMA 5J2PA 4BWMA 4ED2A 2HNZA 1BI4A 5JS2A 3L2WA 8ICRA 8ICNA 4ELVA 3TAGA 5IIJA 2X6SA 3OS2A 4DO9A 5KFNA 4W5OA 3AO2A 4RW6A 4B3OA 2FMPA 2A1JB 4CJKA 8ICSA 1TKDA 4CEDA 3RJJA 4RQ2A 4O0IA 2ZUCA 3SPYA 1S1TA 3V7JA 2P5GA 1FXXA 1D5AA 4LSNA 4CE9A 3HWTA 4DSJA 5EWGA 3HXMA 3ZD8A 1SV5A 4O5CA 5BOMA 3PVXA 1C0MA 2VWKA 1VSLA 1S6QA 4Z4IA 4FYDA 1NK6A 2YV0X 2G8FA 1KSPA 4CHOA 4O3SA 3CM5A 5J0WA 4I2PA 4K4GA 3SNNA 4KLFA 1L3TA 4EYIB 5DB7A 3BQ0A 1LB2B 1KFDA 2A1SA 4CIEA 1S0OA 3JPQA 1MQ3A 3V81A 1A77A 3LP1A 4FJ9A 3MXMA 3JYTA 5J1EA 5HP4A 2XY5A 3T5LA 4CEEA 2OA8A 2IAJA 1S0NA 5KFPA 3M9OB 3TI0A 1BPZA 2VA3A 2FPMA 3RH4A 4QZHA 4M04A 5DBAA 4JV0A 5T7BA 1S9FA 3C2LA 3TFRA 3O4QA 4QZFA 3MAQA 4CIFA 4P4PA 2DPIA 1D9FA 4K8XA 1SZPA 3RWUA 4QAGA 4NCAA 4CHYA 3BQ1A 4Z0UA 1HNIA 2OPQA 5DG8A 4KLUA 1BGXT 3SUNA 1CXUA 1IH7A 3VQ9A 4I2BA 1SL0A 4LVSA 2VWJA 4FJKA 2ZTCA 4O44A 1ASVA 1QSYA 4GXJA 4KLHA 3HSTB 2KFZA 1CZ9A 5HMMA 1QLNA 7ICPA 2ZD1A 1S0MA 3QEBZ 4DS5A 1KEJA 4PHAA 1VSDA 5CP2A 3KLGA 3IHQB 3K5NA 2W42A 4E0DA 5CA7A 3NH0A 5KRTA 1D9DA 4YMMA 3Q8QB 4P4OA 1QE1A 4YR3A 1ZQAA 1HYZA 1EP4A 4FLVA 2XC9A 3E2EA 3GFKB 4W5NA 2EX3A 5DDMA 4CGDA 3WNHA 3LWLA 4DLEA 3VQAA 3ZSZA 4DU4A 1SKSA 5HNKA 1RYRA 4H4OA 3DRSA 1WAFA 3SUPA 4GXKA 3DLGA 5KFEA 9ICNA 3V1OA 3LK9A 4UB2A 5DGBA 2LYHA 5J29A 4F5OA 4M9HA 5KTQA 3GILA 2F8TA 3G6XA 1UA1A 4DOCA 4MQ3A 3NF6A 2JEGA 4RPZA 1N56A 3L3UA 2FBXA 3KHHA 4ED6A 1KDHA 2J6UA 4CJFA 4NLGA 4I2QA 1H38A 3IG1A 1VSIA 4RUCA 2FBTA 4MEYA 4CK1A 4KLMA 2MUTB 2FMSA 3C94A 9ICXA 4FS2A 3VA0A 4J9MA 4XUSA 3B0XA 4YQWA 4UQGA 4M6WA 3C95A 4KLJA 4KTZA 1LW0A 4I9LA 3V6DA 3ISCA 4CESA 3Q8KA 3OSNA 2R8JA 5HRPA 4LH4A 4Z4HA 2WOMA 3PV8A 4RQ3A 1JLQA 4FJ5A 2JEFA 2D0AA 4NCGA 3ZT0A 4Q45A 4I28A 4M3ZA 5DLFA 4KLOA 5DK5A 5EWEA 3G6VA 2QKBA 3E01A 3ULDA 5DQHA 7ICLA 3WNEA 3DLKA 5J2QA 3HVRA 8ICYA 5DG9A 4FLYA 1TAUA 3C21A 2OWOA 4DL4A 4M9NA 2PI5A 4XQ8A 1WLJA 3RJKA 3EWAA 2IBKA 3FYHA 9ICCA 1BCMA 3K5LA 1NJXA 3MDAA 7ICTA 3ZSWA 4IR1A 3H4DA 1TK8A 1NKBA 2A1RA 3BJYA 2Z1JA 2HMIA 5KFXA 1IKWA 4NLKA 3U3GA 1BVSA 2ZUDA 5KT4A 3QERA 3PR5B 5IIIA 5CR0A 8ICHA 2PXIA 2VA8A 3GIKA 3AA4A 4O3QA 1NK7A 1RBVA 5J0SA 1KLMA 2GUIA 3F73A 2FBYA 3MFIA 4FK0A 2WONA 1L3UA 1TV6A 4M47A 5HP1A 4X5VA 1BQNA 3EY1A 1RILA 3T19A 1Z3EB 4KITB 2YKMA 2ZTEA 3MGIA 1C6VA 1A5VA 1BHLA 3DRPA 4R8UB 3T5HA 1RDDA 4HUGA 1XSLA 3AVCA 4IKFA 3AU2A 4PY5A 4LSLA 2W9BB 3KHGA 7ICEA 3PW7A 4KHNA 3MABA 4FM1A 4Q44A 4OLAA 2X74A 3KK3A 2ISOA 4QW8A 1X9SA 4C8MA 2I1QA 9ICSA 3AVLA 3K59A 3C1YA 3OYCA 1NJZA 1RBTA 3QO9A 3NF7A 4EBEA 9ICUA 5DG7A 4PGYA 3VN5A 2ZE2A 4DL5A 1TK5A 2NRTA 4CJWA 1NK5A 3QNNA 3C6UA 5C42A 3OJSA 4QWBA 4M42A 4M3UA 4OKJA 4FBTA 3VQ6A 3KK1A 3EYZA 3ZT1A 5DQIA 5HLFA 1XWLA 1AROP 7ICFA 4AHSA 1HYSA 2PFOA 4DTOA 1O1WA 2C22A 3ORYA 3QETA 1EETA 3GV5B 2KTQA 4DS4A 4I2HA 5KGWA 4M3RA 4AHUA 4GLXA 4BDPA 2XRIA 5J2MA 4QZBA 4RG8A 4M6WB 1ZQPA 3M9MB 3I0SA 3GQCA 2XY6A 1U4BA 1UOCA 4ED1A 1FKPA 2D5RA 3HPGA 5KFMA 4B9SA 3DLEA 5KT7A 1RT2A 1KFSA 4FJNA 2QK9A 4FJIA 2RPIA 1TL1A 4CF8A 4CCHA 1C0UA 4CJ3A 1VSEA 3IS9A 2F96A 5SZTA 3DM2A 3MXJA 1SL2A 3LAMA 1B22A 3L2RA 4ELUA 4ECYA 2YHAA 5HMLA 3U3YA 5D49A 2PYLA 1MU2A 5KFRA 5J2BA 4GW6A 1RCHA 3WNGA 1JLFA 4ZHRA 3C1ZA 1TVAA 1JLCA 1T4GA 3OSPA 4R63A 3PR4A 2HHTA 4XRHA 4ECUA 3LP3A 4NM1A 4BDZA 1NJWA 4UB3A 2AQ4A 3L3VA 3SQ4A 5KFUA 3QEXA 3QZ8A 4Q0BA 3B6OA 4QZ8A 1IM4A 4RQ8A 4ECQA 3OYBA 1TVRA 4YP3A 1LAVA 3RMDA 7ICUA 4TURA 4Q8FA 4AH9A 4RQ5A 4B9MA 4Z4GA 2BHNA 4CGIA 4IRCA 3NGDA 5KFJA 2E6LA 1U9LA 3DLRA 2R8GA 1NK0A 5EU7A 4F4WA 1F21A 4JRQA 2PY5A 3PMLA 4MF2A 2XY8A 4BE0A 5D3GA 3RH5A 3I8DA 4B9VA 9ICJA 2B21A 5HBMA 3RBEA 2G8IA 4QWCA 1R0AA 4YR0A 2P6RA 2AGQA 4E7KA 4G3IA 3P1GA 1JXBA 4HHTA 3M8SA 9ICRA 2B5JA 2NRZA 1RZTA 4DF4A 3RB6A 1GOCA 2G8WA 3ISDA 4YG2A 4F3OA 3GIJA 1BI4B 1T05A 4QZCA 2HHXA 4HUEA 1ZQZA 3MGHA 2R8KA 5J2IA 4O3PA 3Q8LA 2KQ2A 4F3TA 8ICQA 5KT6A 4W5QA 4N76A 2A1JA 4NYNA 4KMUA 2PFPA 5KG1A 4F50A 1Z25A 3OVNA 4Q5VA 5KI6A 1EXNA 5KG7A 5DBCA 2R8HA 4DG1A 4KN7A 3ZCMA 1VK0A 7ICMA 4YXMA 3CM6A 3GV8B 1G15A 2AU0A 1S10A 3MBYA 1ZBUA 1EXQA 4CGGA 4RQ7A 3ASMA 4I2CA 2FMQA 3V1QA 1BIUA 4J2AA 4N47A 3RTVA 3DRRA 1JL1A 5J2GA 1L3VA 2C28A 2IOCA 4HYKA 1YTAA 3NTUA 1C0TA 3ZSQA 2I5JA 1WAJA 3GDXA 7ICHA 4BWJA 3OYEA 3HX0A 1Q8IA 1S6PA 3AVAA 3RB4A 5J2AA 2J6TA 1KTQA 4ID5A 3AO3A 2GWSA 1FKOA 1ZQOA 5EOZA 3HL8A 1ZQIA 9ICVA 1ZQDA 3K2PA 2HNDA 3MECA 1MQ2A 3MR5A 2HVIA 1NJYA 4CHNA 3OYFA 4KB1A 7ICKA 3DOKA 3MR6A 3KLIA 5J2CA 1KVAA 5KGXA 4YFUA 1LWFA 4B08A 2W9MA 2Z1IA
chains in the Genus database with same CATH superfamily
2F3NA 1FHTA 1Q82O 3MEEA 4I64A 3LPTA 4NZ0A 3UXOA 1J6ZA 3I31A 3IS9B 1SJ3P 4NEYA 4ZVFA 4E89A 4KLDA 2F8LA 1X8DA 2DY1A 3JTNA 1COOA 3KKAC 5J0OA 3EDRB 3PW4A 1RLCL 3GSIA 5KFSA 4QYZK 4AHCA 1O51A 3H42A 1UVLA 3MXIA 2C2EA 5AKIA 4NLRA 3TRGA 4AHTA 1RCXB 3U27A 1P8ZA 4J8FA 4ZVTB 4OHZA 2ZBCA 4NY8A 5JLFA 1P90A 2C3MA 1SUQB 4HDGA 5CRXA 4DU7A 1RAAB 2VDIA 4LFBJ 4M1KA 4ZKAA 5AHXA 2O8CA 3QYPA 2CQGA 4JK1A 1YRXA 4RBUA 4NLUA 1N5YA 4C7ZA 1VGYA 2BPGA 5DQGA 1FRMA 1F0XA 4F5RA 1TL3A 1HD0A 5KOXA 4IEIA 4H4KA 3CDAA 2G4BA 2KHOA 2QA4S 2VD3A 2CADA 2V8PA 5IT4A 3GSDA 3AVFA 4OI0A 3N97B 3SI6A 2UYTA 3KJFB 4J9OA 4FJHA 4X4PA 1XMOF 3K2YA 3MOJB 2NZTA 1XERA 3PEHA 1CRXA 3UIQA 2F1FA 3NDKA 1T9VA 2AT1B 3K9JA 4PJ0U 2U1AA 3POTB 2HWIA 2P9CA 4J7CA 3TANA 3SCXA 1UAWA 2YKQA 2MKSA 4CYUB 4FZXC 1C7YA 9ICEA 1CLQA 5E5NA 1K1SA 1FD2A 4BC2A 5M1FA 4C80A 4ES2A 8ICOA 4Z6CA 2V4JB 2B4VA 4WFBQ 3G8QA 5F9LA 4I6MB 4I7FA 2XCPA 3K1ZA 4EP4A 4KY3A 4B3RK 1YJVA 3EX7B 3PJ9A 3UNYA 5EWFA 4AQYJ 3AVIA 5BPCA 3QQCD 4IDHA 4C97A 4DPOA 2J9CA 5M1KA 4LFAK 3MAAA 3HBTA 2P9PB 1APSA 2I6XA 2D0PA 4FVCA 3KHRA 3T1HF 1RBUA 5M1OA 4IQVA 2I5JB 4ED4A 4RPYA 4OX9K 4KX3A 1NHKL 4QQBA 3CWJA 4YFKA 2O8DA 1ZM9A 1AA1B 4Y2CA 1RBAA 3BF4A 4C8ZA 4PG8A 2MTLA 3FR0A 4NLXA 1RT1A 1PILA 1SJFA 1Y97A 4F93B 3R27A 4P7TA 4DUZJ 4KI4A 4DV3J 3US5A 3OS0A 2BCRA 2YNGA 2IIHA 4Y1CA 3SSRA 2PMZF 1YG0A 1A76A 1ZXOA 5I3PA 5AFUA 4ED3A 4X2BA 4RZRA 2M8DB 2DIVA 3OYAA 3UN3A 3BKUA 1SGGA 1RPLA 2HZCA 4DL2A 1X60A 2V4QA 2BJ1A 2K4IA 3BN7A 3M7VA 5AQXA 1CS4A 4Y2KA 4FCYA 1SV0A 3QMLA 4DEZA 3FRYA 4DR3J 2YKOA 4I56A 4DOBA 1VS3A 1RWPB 1ZQ1C 5KFDA 2G9OA 3RRHA 3FMBA 1PK3A 1X4BA 2UXBJ 2ASOA 4YNQA 3CNHA 1TKZA 3DXBA 3ILLA 3TVZA 2HHWA 4CF4A 1HI8A 3F9KA 3V7LA 1LWXA 3G25A 3V1RA 4PWDA 2W9BA 3ULEB 3ZNUA 3KLHB 4KBIA 3AA2A 3D0GE 1UTAA 1ATNA 2BE9B 3NGTA 1R43A 3I9ZA 1N33J 2BGWA 1KKHA 4QZDA 5FPDA 1ATSA 4LF4F 4G6VB 4AUKA 2KVQE 3M30A 5FRNA 5I3UB 3F2KA 3A0BU 3UNGC 4R0EA 3PSFA 2P9KB 3EEQA 4UB1A 2JVRA 3ZDEA 1YWXA 1ZJMA 4J9VA 2LSNA 1C20A 1KVBA 4A57A 4Y65A 1Q46A 4F5QA 1J54A 2F76X 2DK2A 1NKEA 2DGVA 1ZQXA 4PG6A 4ANCA 2R4FA 3LDPA 5LMNK 3EKSA 5M2PA 3ID8A 1AUSL 5CZXA 5F1XA 2RN2A 4B8CA 2IJRA 1L3SA 2K8BB 4XIUA 4X4UA 3D6RA 1FO1A 4CJQA 2XO6A 3VEYA 3L7OA 4IO8A 5CJ7A 4JI0K 3ZTRA 3LH2S 3UR3C 1IR0A 2ILZA 3N7RC 3OYIA 1U09A 5CABA 5HMWA 2GOLA 1HLWA 2P66A 1IBKF 3ZDBA 3S01A 1TUWA 4XAKA 3PLAA 3MUTP 2RKIA 1S6OA 2IMWP 4DTPA 1X4EA 2NXEA 1T3NA 2CPFA 3TA1A 1HMVA 3EZ5A 1NKCA 5T7LA 1WSJA 2UUCK 1JLQB 2ZBQA 3U1MA 4CEOA 4AM7A 1BDGA 3PO4A 4NCGB 2PD1A 4WZQA 1T3OA 3BYRA 4ZMMA 2EAOA 3AJ2A 1AXQA 4Z37A 2BANA 3TYTA 5DB9A 3D6FB 3VCBA 1HQ2A 3ILIA 1QVGR 2RDIA 7ICGA 2C2MB 3W9HA 3VQDA 4LD0A 4K8ZA 3QESA 1L7OA 4L75A 5A6PA 1SIWB 1QHAA 2VZ9A 3LVWA 4J37A 1RXOB 3OGUA 1QZ6A 4B9UA 9ICBA 3VQBA 3BSOA 5C5JA 4K7QA 1GXUA 2XZWA 2PZSA 2DNYA 4IR9A 1R3NA 4UARA 3OFFA 5J2JA 3QGGA 2JH3A 4YHHK 5DKWA 3HHLB 3WXIA 3JSYA 1RNHA 2E4LA 2W41A 5KFVA 1V3RA 1Y64A 3QEVA 1QAIA 3NMRA 4ZVUB 2WHOA 1U49A 5ITHA 4CJUA 4LSLB 4OPHA 1VRUA 2OANA 2RDJA 1ZYQA 2OI2A 4U95A 4ED8A 4URGA 2ETJA 4J9KA 1PZNA 2ZG6A 4ZH4A 3UE5A 4KHSA 2VFSA 1U1KA 5GAEU 4A8OA 3PM9A 1GFWB 3M05A 4U7BA 1IN0A 4M5KA 3ZX0A 4P74A 2R7YA 5ALNA 1M5PC 3RAXA 4DV7K 1ZOTA 2JWLA 2HCFA 2J7WA 4NWIA 1WACA 3N4PA 3SQGA 3FZHA 1YGYA 2H1YA 2QE5A 6AT1B 2AA4A 3GIMA 1N32F 1KL9A 1XQSC 3T1HK 3KZXA 3FCHA 2BQUA 5KFWA 4LQ3A 4GVMA 2DRBA 1TYQB 1SZ2A 1E4GT 1U0HB 2NRVA 4ECWA 1TR0A 4FWNA 3H3OB 1I94K 4TYAA 1YIJS 1UHUA 4O3OA 3E51A 1P1TA 1FKAF 1FKOB 4B1WB 3A3NB 1VQMN 3DDNA 3O6QA 3SR6A 3PRVA 4JD2A 4PZNA 1X2IA 3LAKA 2NLXA 1U6BA 3VCDA 3MM8B 3QBCA 1FNOA 2RAQA 4UAWA 1ZQQA 3LPYA 4DCOB 4ECXA 1JJ2R 3AGKA 3LDSA 8ICWA 3BH6B 3ZZUA 4CF0A 4IQMA 1YSJA 2JL9A 3V4IB 5J1EB 2BE2A 3OYKA 3K5MA 4JBCA 1MU2B 5AKKA 4Z4EA 4Y2TA 2VG6A 1V9PA 1TAQA 1IG9A 4M5MA 4OGEA 3BP8A 3G4SN 1AZSA 1S7IA 4BXOA 3SDEA 1SBRA 4BR2A 1KBRA 2IFXA 1Z05A 5F8JA 2ZD1B 4BGBA 3GCWP 2NYVA 2R2RA 2NV3A 3DXMB 2W54A 3PKMA 3WK6A 2IHMA 2Z7JA 4EAHD 2XO7A 2DH8A 3MMCA 4CEBA 2DGSA 3TQEA 4CEQA 1U6FA 3U9DA 5KFFA 4HH1A 4JI6K 5DB8A 1N6QA 5A8KB 2Y8YA 5CCMA 3FZLA 5J0PA 2APOA 1HEKA 4NYZA 3PW0A 2YNHA 1RXWA 1S97A 2BQ3A 3EICA 4ZOHC 3NH2A 3RVCA 4F04B 1QHTA 1QUPA 3MCPA 4NXZA 4HHJA 2FC0A 1VQPS 2IA0A 2Z0GA 3D2SA 2XY7A 4JI1K 1OY8A 5AM3A 2X7IA 2CRLA 2Y1LB 4XH4A 4HT5A 2DFLA 1H6KX 2MY7A 1MWZA 2ERRA 1JLAA 3UI3A 4LRBA 4DMNA 1VRUB 1MDUB 3P31A 4RR5A 2FPLA 2MAXA 3HW8A 2QB1A 2FGOA 1RTIA 2HF3A 4OGCA 4LRDA 2CZ9A 4QR0A 3DXKB 2UXBK 4B3OB 4LF4K 1GH8A 3IBPA 2Q97A 1SL1A 3H0RB 4W92B 4P10A 4ZIVA 1XQIA 3CC2N 3VAGA 3DEEA 3S1TA 4CDIA 3FZ2A 5H1SQ 3H2UB 1VSHA 4Y2MA 2QRRA 2YKAA 3U8XA 3J81Y 4PXEA 4YEAA 4JEPA 1RAEB 2V67A 3NWGA 5HRSA 3TO8A 4EO8A 1CZAN 3N6NA 2VQEF 3HJEA 1QSSA 1VQNN 4CZHA 2KJ5A 1S9EA 2ZIVA 1U0HA 2ZGYA 4C1NK 4X84A 4DR4J 4KLIA 2GVZB 3MX5A 4RT2A 3QT8A 3MAHA 1NGAA 3AA5X 3D0PA 2EFOA 4RLEA 4HVJA 3UQ2A 4K2XA 3HRGA 1LWFB 1X9MA 3R5JB 3N28A 2ZM6F 3VZHA 4MKYA 1SQEA 2A5XA 3SLCA 4EZ9A 1WC6A 3OJUA 5KG5A 3GYGA 1S7HA 1T7PA 4M9LA 2O6KA 3R9KA 2HHSA 1W0HA 2RQKA 4OLOA 2F8SA 3PHTA 1BA0A 4F8RA 5HK4A 3MUMP 1L6NA 3E9PA 1ZQSA 2FSNA 4UAYA 3LPUA 1HQEA 5JS1A 3MK6A 2P9LB 2BUNA 1SV0C 5DZ6A 4QPTA 4NYPA 1ECWA 2KKVA 8RUCA 1K8AT 2FI1A 4ZN3A 2F8KA 1LKZA 1Z00A 1RU2A 1Z1ZA 2OPQB 1IKWB 2LM4A 1YRUA 5AKJA 3AV9A 4WQ5C 1ITPA 1RGVA 2VWBA 3IR5B 3NL0A 4X64F 1RAOA 1M0SA 5FPEA 2DGTA 1RDUA 1KC8T 2VUGA 3D67A 2CZVC 2YKNA 3H0MB 3QLHA 2BJ7A 4V19S 2RMLA 4DL7A 1KW4A 4JI1J 4J9LA 3CIZA 4PA1A 2KXHA 2KKPA 2Q43A 3W64A 4ZVRB 4JUZA 3C5GA 4RWTA 2B9YA 4NMXA 1RHJB 3QXGA 1S1WA 1OMSA 2NO4A 1ZH5A 2XYPB 3O8MA 3ZT2A 3OLAA 2W9AA 2YNFA 5F41A 2ZOGA 2WC9A 1LQ9A 3KHLA 2A3JA 5AQVA 1RLDA 2NCKL 4C6AA 4CJ7A 2H9ZA 2MJUA 4PHDA 2HHHK 4NYFA 3U02A 2BEFA 5EE3A 3O08A 2CPRA 1EJ7L 3CFPA 4FLZA 2IYGA 5HVFA 4UBCA 1UAXA 3B6BA 2WB4A 1ZBHA 3R5GA 1LWCB 4XPCA 2HOFA 3AVBA 1REVA 2G0JA 5ADZA 4QZGA 1ZBFA 2KZMA 2GO9A 4ZVOB 3PKYA 5AQQA 2M9NA 4H0XB 4BRCA 3CJBA 2JR5A 3JSMA 1K73T 1R0CB 3JQMA 5E33A 3KMQA 5MLCQ 3M8RA 1KFTA 1RU1A 7ICNA 1GXLA 3OV7A 3C29A 1VSMA 2DNRA 4L73A 3LZIA 1ZBSA 2F65A 3FDSA 1N5XA 4N56A 3KZBA 3V72A 2YPYA 4YY3K 4R25A 2HVHA 3MUVP 1X40A 4ZN1A 4DR7J 3VQ7A 1ZZNA 1YX2A 4YHHJ 3AVMA 1VMBA 5KG2A 2L9DA 2GHPA 2JJ4D 5LSLA 2LYAA 1RT1B 3T1YJ 4G1QA 1VFJA 3RJHA 4FYXB 4OLBA 1YIJN 3HHKA 4O4GA 3DLKB 4WQ5A 3SYZA 4F9OA 3O3GA 5IWAF 2YNGB 1VLOA 3EZWA 4FM2A 2I5HA 1RTHA 4DV6J 4GVBA 5DBBA 3HT3A 2XZDB 3TVKA 1FDAA 4UOCA 5F8LA 2CQ2A 1OIAA 3M2UB 4JI0F 1Y3KA 4A2AA 4DR7K 5HHIA 2DGWA 4DV4J 3KJVA 2F4VJ 4JI6J 1N62A 3BUZB 1JIHA 1N8RT 3DOLA 1FDDA 4DLGA 3BF3A 3AUOA 2J76E 1WUDA 4UB5A 4ZPBA 2E2PA 3HULA 1RDAA 4LRAA 2RRDA 1CSJA 1F5SA 3R1HA 2CXEA 1Q9YA 5HP1B 4Y2AA 3NNCA 3N4QA 1PKUA 3JSRA 4QIVA 5D0RA 3FJ2A 2BMBA 3V9UA 4Y0FA 5KPZA 3VQEA 1IBLF 2PDAA 3KLHA 5E2QA 4KN4A 1UJ5A 4A5AA 2D3ZA 2M70A 3CQ8A 4XA5A 1XMBA 1NGBA 5AK5A 1WOQA 1DTTA 1YQHA 4E1JA 3NNAA 3CMEN 2E2QA 1GTHA 3RW6A 4A46A 2WSEC 3NAHA 1SWWA 4A4JA 2G2YA 3OLBA 3RBDA 1JLEA 4YOYA 4JV5J 3NBPA 1BIZA 5FPMA 4MK8A 1X5TA 3PNCA 4CFBA 1E6VB 1S99A 1EX8A 3M8PA 4F4AA 8AT1B 2W9CA 4OFZA 2LDYA 3FC4A 4OI2A 2IM2A 5FPNA 5EX0A 2DEJA 1NAQA 1GK8A 4DFMA 3ILJA 2HNDB 3QEIA 3DRRB 4YHHF 2N3LA 5ALQA 3RJMB 2XTJP 2XICA 5BR8F 2YWKA 3T5JA 1C0TB 1B9DA 2B9XA 2COLA 3SQ1A 2V2ZA 3C3LA 3WK9A 2ABYA 7AT1B 3QAEA 5DS7A 2ASLA 2DT9A 3QU9A 3A1YG 3G9CA 3PZPA 2YWHA 3I0SB 3RMCA 2QW9A 3R7SB 2P5OA 4WFZA 2A6OA 4CD1A 4CH7A 1B70B 2DR8A 5CEHA 2F7TA 2IVMA 4GNIA 2GIRA 4MH8A 3ET6A 1B0PA 2OPRA 1NUEA 5IT0A 4JI4J 1QQOA 4BBYA 1U2CA 3SPZA 4BRPA 1WF2A 2BQRA 1NB2A 3CJKA 2Z2LA 4HAIA 1S4FA 2FZKB 2CH6A 3CJ7A 1Y88A 1N33K 2IDOA 4DX7A 4AXJA 2YX1A 4ZOSA 1DQ9A 3RAQA 2BXJA 4F0MA 1HJOA 5FRMA 3SAFA 1W7AA 2F4VK 1LK7A 2H3EB 4I2DA 1VSFA 5HVHA 4WIQA 5AQHA 2AW0A 3UXNA 4X4VA 2IGIA 1WG5A 4M5HA 3QUTA 3HO1A 4FDFA 4IBNA 1ZQTA 2B8QA 3RH6A 3WDOA 1JN3A 1IWAA 3G87A 4YMOA 3C23A 2MHEA 4JHDB 5ALEA 5DDYA 9ICPA 1QDUB 1VQSA 4PXBA 3JQKA 3DLLQ 2OFGX 2O3DA 4A59A 5KFGA 2HQIA 2XULA 2YMMA 3OBWA 4GKJJ 2DD8S 2XM3A 2JZ5A 1GMVA 2VFTA 3A12A 2VGNA 1UEUA 4K41A 2MQLA 5AT1B 3NOGA 1RTJB 4ATNA 2ZNZA 1ZBLA 3NAEA 2UXDK 4LF8K 4M5IA 5GIPA 2P9EA 4BCAA 3Q8MA 2YKPA 4M94A 1KLNA 3CTRA 4WQ4C 3T9ZA 4ILLA 3CCLN 4CNQA 1T3QA 4DX5A 3TAGA 4PUOB 5IIJA 3OS2A 2W7AA 4DUTA 1HARA 3HFVA 2FMPA 1RQLA 2A1JB 3HI9A 3PEJA 5HL7L 1C0FA 2ZUCA 1P27B 3QUCA 1S1TA 4JKDA 1HWKA 3BO4A 1D5AA 2WSCC 3PIOQ 2ZZNA 4CE9A 4AM6A 3OTOK 4O5CA 3OVAA 3ISND 5BOMA 1C0MA 4B3MK 4UZCA 3TVYA 3KZIU 4J5OA 2PIIA 1DLOB 2V51B 1HBMA 2RRNA 2BTFA 4I2PA 4JD2B 2RQMA 4K4GA 4M7YA 1N5WA 5IM0B 4KLFA 2O8BB 1TMJA 1DY3A 3M2RB 5IXUA 3BQ0A 1O08A 3I0RB 5I3QA 1KXPA 1UVJA 2AF6A 2HFVA 4CIEA 1ICEB 3QGIA 4OHWA 3QGPA 2I0XA 3IR6B 1FFSB 3LP1A 3MXMA 4ZPVR 3FZMA 2HYIB 2VQEK 3ZZZA 5HP4A 4IG3B 3CJ4A 1LNQA 5K8NA 3SQOP 2HQCA 2MQ8A 3NY0A 1HBOB 3I56S 1FJ7A 1WJ9A 4JI0J 4BRFA 1KBUA 4WYLA 3TR5A 5DBAA 4FWKA 3UDCA 4JV0A 3WK4A 2LQ9A 1S9FA 2GGPB 2E1EA 3C2LA 4UATA 1NPPA 4I68A 3O4QA 3VF4A 4MDAA 2RT3A 1HHQA 3UKRA 4W90B 2YHWA 4P4PA 2D74B 1HWLA 2FVSA 5BR8J 3WKBA 3KG4A 4MHVA 2HFZA 4CRJA 3LDOA 2ODGA 3A8EA 3VQSA 3DN9A 5MAOA 3SUNA 1IH7A 2CGLA 2RH3A 4LVSA 2VWJA 1UZHA 3ETMA 1ASVA 4GXJA 4OZJA 3I1YA 1GLBG 5A8KA 3SBMA 2YKMB 7ICPA 1S0MA 3WXMB 4DS5A 2QFJA 1HFEL 1VSDA 2QYCA 4ILJA 4PKGA 1N2XA 4CZIA 5H9EJ 1SH2A 1WI6A 2CQDA 2W42A 2J9EA 5CA7A 2X51A 5KRTA 2UXDJ 1D9DA 1HW9A 4BS2A 1T94A 1V38A 3GFZA 4FLVA 2XC9A 1WHWA 3FMWA 2AXTU 2QKQA 1F9FA 4W5NA 2EX3A 3D3CJ 5K14B 4DLEA 1SKSA 3O9RA 3IDWA 3KYLA 4URQU 3WKDA 4ZVEA 9ICNA 3LK9A 2F9DA 5J29A 4ZPCA 1YITS 3BPSP 4F5OA 2HBYB 1VRTB 3TAMB 4DOCA 3NF6A 2JEGA 3CDUA 4RPZA 2YWEA 3QBXA 3N9UC 3QWPA 1OXJA 4CBWA 4I2QA 1HLUA 1AB8A 1EARA 3FGUA 2KVIA 2CGJA 4KO0B 4C3KA 2D8CA 4DFDA 4DPUA 2F4VF 4FWMA 3GL1A 4XUSA 3L7PA 3OTCA 4KH4A 2VFUA 4LF6K 4K8RA 4ZPDA 5E84A 2MQQA 4FZLA 4ACOA 3OSNA 5E3CA 2O8EA 2XBPA 3ZETB 4Z4HA 3T6BA 3PV8A 4IO9Q 4FJ5A 2DBYA 1ELOA 1FXRA 4ILHA 2MKKA 2D0AA 1LCUA 2IOHA 1QJHA 4Q45A 1Q53A 2ZKUA 3VEZA 4P2MA 3SD7A 4IKAA 5DK5A 4I6AA 2W2PP 3W65A 4NOHA 3MHYA 2QKBA 4TY8A 1SXEA 7ICLA 1UKUA 5J2QA 4EX7A 8ICYA 2CQ3A 5DG9A 2E5LK 4FLYA 1HW8A 3CD5A 3C21A 4BRDA 1KQSR 3EGZA 1XNQK 2PI5A 4Q0BB 1WLJA 4KX5A 2R3VA 4A8QA 5EOYA 4F67A 1BCMA 4KV8B 2MXYA 4CZMA 2O1PA 2ROPA 1SC3B 3MDAA 1M1KT 1LKYB 3U1LA 2CPEA 4B6JA 4PR6A 3DHXA 3UKRB 4WQ4A 2WMMA 3H2VE 3QRPA 4GKKJ 3PR5B 2DHAA 3CCRS 2IIRA 1GO3F 2DHHA 1VJQA 2MMYA 2FLOA 4CNYA 4CLZA 3CNQP 2XMUA 4OI6A 2PXIA 5AK3A 1CC8A 3VMFB 5L9NA 2FBYA 3H46O 4Y3CA 3D6TB 4FK0A 2WONA 1L3UA 3W5ZA 4KGVB 1XMOJ 3A5LC 4IXCA 5B5EU 2Q66A 2XWXA 2YKMA 4CQ1A 1C6VA 5DM7L 1DK2A 1P8GA 1IBKJ 2KN4A 3D1HA 4PPDA 2FJWA 1BHLA 1RDDA 4JKGA 4JN4A 3AU2A 4A8YA 2E8NA 4LSLA 5AQNA 3MABA 4Q44A 2X74A 4NA3A 4Y2QA 4F71A 3KK3A 5JMVA 4DG1B 1XJWB 3VGKA 4IFVB 2IPOB 3I4HX 2E1MC 2I1QA 3CPWM 3F2BA 2GWKA 3K59A 3C1YA 4F26A 1BUXA 3F5AA 2F44A 2ZM6J 1XNSA 1WOPA 1JK9B 1VQKS 4ZIWA 3SQGB 4BRGA 2DH9A 3D9BA 3M8WA 3WXKA 3QNNA 2GVDA 3C6UA 1FA0A 4MO5A 4BREA 1P9QC 3EVMA 3GZFA 1X4FA 2YWGA 1D8ZA 4G1IA 2AKWB 3ZT1A 5HLFA 1O1WA 3MM7B 3ORYA 2P2CB 4DS4A 4I2HA 3W3DA 2DNZA 1RBOB 4OZLA 3VF2A 4JV5F 2ZHBA 4DUYJ 3M9MB 3ALRA 4HL9A 2QARA 4CLKA 2XY6A 3TW0A 4U67Q 2RQCA 1I51B 3OL8A 3F5EA 5LJWA 4FJNA 2QK9A 4KH5A 3H8MA 2E29A 1LFPA 3IS9A 5SZTA 4LJXA 3DM2A 1SL2A 2KU7A 5HSPA 1YXQA 2PYLA 2OPPB 2KH9A 4MK7A 1WHVA 1RCHA 1JLFA 5GMDA 2WVCA 1JLCA 1IQTA 1KNZA 1A9NB 3PR4A 3OA9A 1JNRB 4XRHA 2FHMA 4ECUA 4NM1A 1NJWA 4UB3A 3L3VA 1NZAA 2F7VA 3GJRB 1LEOA 2AYBA 3QEXA 4X4TA 3SQ4A 4Q0BA 4QZ8A 1RT3B 4RQ8A 1YHQN 2MKYA 3P45B 1WOOA 2W2NP 4YP3A 3MMVA 7ICUA 4B9MA 4Z4GA 2WK4A 3FLCO 1U1RA 3KLFB 1N5YB 1N0UA 3NGDA 5KFJA 4WP3A 4YB1P 4H0TB 2JOQA 1WORA 5LMNF 2F2AB 3TTDA 2FY8A 4ILMA 2GQ2A 4C3LA 4A8KA 2WSFC 4MFBB 1G99A 5BPNA 2YQEA 3TJAA 3RRKA 3RH5A 1XR7A 3MGVA 1PCAA 3A13A 3R2DJ 5EE9A 3WKEA 2B21A 3W62A 1X9JA 1R6VA 1KAZA 1MN9A 3L6QA 4OI1A 2FF3B 1KLMB 3CCSN 3C19A 1FRXA 2CPIA 2VBYA 2PSZA 3JQJA 3GYNA 2V8HA 3FEZA 5E3QA 2F9WA 4P71A 4QZCA 1S57A 4FXWA 4HUEA 4QBUA 3TKAA 4PEOA 5J2IA 4QU6A 4O3PA 4KC5A 3Q8LA 2KQ2A 3KDNA 2EBGA 4HACA 5KT6A 2PFPA 4LVNP 3H45C 3UVJA 4WKRA 2J0WA 2O8FB 5KI6A 3V4MA 5DBCA 3OPKA 5H9EK 3VAHA 3PYFA 4DUZF 1D09B 2IJFA 3GV8B 1G15A 2AU0A 1S10A 2HK3A 1B0VA 3NS6A 1GLDG 3VAIA 1EXQA 1TL4A 3IN5A 4CGGA 4L3KA 2HOQA 1M90O 2FMQA 2KMDA 3V1QA 5ALSA 1BIUA 5BREA 1FX4A 3RTVA 4JAXA 2A1BA 3ED5A 2FDRA 3W5XA 4HYKA 1A6LA 2IRUA 4OMFG 2I5JA 3GDXA 2H5EA 2QL5B 4UB8U 3THYA 1K8KA 1YI2N 3RB4A 2O8DB 3BO2A 4QIFA 2ZIUB 2W03A 2W6LA 3HOTA 1ZQOA 3HL8A 5AXMA 9ICVA 4P0PA 3G6ES 2E7XA 3MR6A 4NLTA 4J90A 1Q3UA 4F02A 4YFUA 1LWFA 5U47A 1XNRF 3IGNA 4E7JA 4CNZA 3IP4B 1NMDA 5A76A 2NXNA 3M6ZA 1FNMA 2E2OA 4FLUA 3AJ1A 4RW4B 4E7LA 4DSIA 3MM5A 1N36F 1VQ9N 2YX4A 1RBLA 3AA3A 1SXDA 1PC4A 1PYOB 3LVVA 2EAMA 4B1YB 1HQEB 4DSFA 3NGSA 3KKSA 1NK9A 4E19A 2RSQA 4ZLPA 4Q2LA 3H8YA 3R6LB 5J0XA 1I39A 2HRYA 3ZSYA 3OR2A 3D2FB 3VAKA 4NLYA 1HNZK 4TXSA 3QZ7A 5AIBA 2XQCA 1FTRA 3GG0A 4KLSA 1J5EJ 4Z4FA 3H5UA 3KLEB 3Q8RB 4BC4A 4KTWA 4MEXA 3U7JA 5A0YB 4O55A 3CD7A 3UQ0A 3KNGA 3Q24A 1H72C 5D4OA 2X1AA 1DTQA 8ICKA 2YKNB 1XNRJ 2EZZA 4MFBA 3TARA 2EH9A 1VQ8S 4ZK7M 1IM6A 2I9SA 1ZQMA 5D3GB 2NZCA 1NGEA 1WSEA 2MZJA 1UQVA 4FN5A 2DNGA 1L7NA 4X66J 1SCJB 1XC9A 1N54B 1VI7A 2ITGA 3QU7A 5B0EA 3V5RA 3JPNA 1PK1B 1R8BA 4O9MA 4GMJB 4KAZA 4QIGA 1RYSA 3NVYA 1JLBA 1B3TA 3MOZA 1UFKA 3BQTA 3HILA 4ZVQB 3CCRN 5LMUK 4YR2A 4MYUA 2P9KA 3AQEA 3QWUA 4BRNA 1T05B 3EGVA 1YF5L 3BH7B 1RG6A 2DGQA 2BW2A 2OAUA 3HM9A 3KK7A 2QG9B 2JVOA 4NLDA 3EGWB 5AJ3J 1VQ9S 3CJQA 1HWUA 3N0VA 3J81U 2NNWA 4AT1B 4Z4CA 3Q7BA 5CA5A 2GW8A 1EHWA 2I6WA 4H5NA 4IJAA 1UA0A 2XGPA 1FERA 2K60A 3I9V9 2UV8A 3QFHA 1VLBA 2UUTA 1TL5A 3TEHB 4H4MB 2MGZA 4WFNQ 2F1IA 3HD1A 3P3DA 4JV5K 2BOAA 4PGXA 4OZ1A 4F4ZA 1ZXIA 2MRLA 2HMXA 4DPWA 3FCVA 2CFXA 5B08A 2KYXA 3J81j 2WF5A 3THYB 1NOZA 3RSEB 3MXHP 1NB7A 4CHQA 5D46A 4M5DB 4DV1F 3VA3A 4KLGA 1X4AA 2NS1B 3O9QA 4EHUA 2DRAA 2J0XA 3MECB 2ZWOA 1HNWJ 1TP7A 1ZM2A 2JSXA 5KT2A 5CD4H 3QEPA 5C25B 3SZ2A 2NSBA 3CJCA 2CPZA 1Q86T 2V63A 3N01A 1UCVA 1UT8A 4IG0A 4KHWA 1ZAVA 3VPZA 5H9FJ 3O1BA 1WNSA 1FI4A 1YVUA 2G13A 3SCIE 2BKEA 3O5BA 3IWNC 2DFEA 1MG7A 1WG4A 1ZQUA 3P49B 2ZQBA 2HBZB 1S5LU 1KC8O 2FPKA 1L5UA 5AKHA 2AJ1A 3ONQA 1HNWF 3K4GA 1URRA 4B8AB 5IOLA 1S12A 1HR0K 1YLXA 4F92B 5AQLA 1PJ7A 5JVHL 1LXNA 1BQNB 2B7BB 2BZ2A 1F5AA 8ICVA 3FCWA 3JAMO 3CQYA 2AX0A 5J2HA 5HN0A 2BRLA 4EO6A 2YN4A 2IS3A 5CYMB 8ATCB 4K4UA 5AI0A 1R6YA 2KXNB 2OFHX 4E1MA 2D9OA 2F63A 3QSIA 2EFNA 3BSAA 1S1UB 1EX4A 3OPXA 3PXGa 3CJAA 2VONA 1NSPA 4IRDA 3THWA 2VBXA 5AKGA 2VBZA 4ENOA 1JJ4A 2NPFA 2GWJA 4FLXA 4GO7X 2CZ4A 5IINA 2CVIA 1W97L 2A19A 2O4IA 2I9GA 2H54B 2NPIA 1MWKA 1URJA 1UMJA 4KHYA 3A5OC 4M41A 4K4YA 3AVKA 2Y1JA 2D0BA 4M63C 4YVZA 1OH8A 3VV2B 4OYPA 2CNKB 1YTYA 2E2NA 1HBUB 1WF1A 1ASUA 1F9EB 4R65A 2HLTA 1FEEA 5ELZA 1FK9A 3I32A 2MUTA 5DZ7A 2XI2A 3EVOA 2V34A 2RUSA 2GH1A 2BABA 1XHZA 9ICWA 3J80Y 5JTIA 2W9CB 1HPZA 4LFCF 3VEXA 2Z2YB 1I6JA 1B7YB 2Z1HA 3VQQA 5L1KA 3C15A 4MYTA 4U7CA 3SUOA 4NZ6A 2PT0A 4Q7AA 3UFCX 3MM8A 1U04A 3ITHB 2R7XA 4MKVA 4DPXA 2AJ2A 1BPEA 4DQPA 3OT9A 2M0NA 2KB2A 4KTQA 3A4TA 4GXIA 5ALDA 4IQWA 1Q18A 1GOBA 2DHXA 3LALA 3S3MA 4CLUA 2K89A 3P83D 1YJ7A 3ZDAA 1VQLS 3BS5A 4JV1A 1U2FA 3DKDA 5BOLA 1HHTP 4IQTA 3JTPA 4GY2B 3ET6B 4S0MA 2J8AA 5KPRA 4NRUA 3VVTA 1WB9A 2QM1A 4ILGB 4ZLLA 4OKKA 2D0OA 4CI6A 2OHDA 2B4UA 3M8QB 5ALGA 1XMQJ 4MIBA 3QAUA 5L9XA 4CZFA 3WX8A 3ZTSA 2FD2A 2LLZA 1QAJA 1ZOLA 4P4MA 4PWWA 3E0FA 1CG2A 3KLVA 1PUZA 4DF8A 2Z2ZA 1TKXB 4BX9C 9ICTA 5HOOA 1HRHA 3V6KA 2G08A 2E1CA 3UN5A 3NS7B 2FJ6A 3FQLA 3I6PA 4IFEA 4PL2A 2QB0A 1SQGA 3V2UC 4FJ8A 2LYBA 2GV9A 3WK8A 3GJQB 3DMJA 3NHGA 3Q7CA 2XZTB 4FJGA 4IDKB 2OJ3A 1JXLA 1LFWA 4J9SA 1WC4A 2GELA 4TSXA 4LF5J 4DCHA 4ETZA 4QYRA 4ZCKA 1ZJNA 3ZEUA 1Q16B 1SB3C 4KKOA 1TAMA 1OPZA 2ASDA 3I76A 4A8SA 4Y2UA 3CC7N 3K9KA 7ICOA 2HVDA 4CZLA 4L8RB 4IFVA 4AXIA 1S72S 4OYXA 1CULA 3PDNA 2E8PA 3EXCX 2E8AA 3MEGA 3ETRA 3O9TA 4RBVA 2HRUA 3HJFA 3A2FA 1B4FA 1JLGB 4LF6J 4DV2K 4JV2A 4RUHA 2ZJPQ 3DOMA 2OTLN 3OYLA 2Z1GA 3BBBA 5KFKA 3NFAA 3UD4P 2KM8B 3NCIA 3GV7B 4LC9B 2EFPA 3WKCA 3P5JA 1U1OA 2R7VA 2EXUA 3HSDA 4Q43A 1S1VB 3MM7A 5GAGP 2KICA 4CFAA 1W2BM 4AFFA 5LXYA 1S6PB 3LP0A 2G09A 4DV0J 2MB0B 4ECRA 1DT9A 1RSCA 3LPEA 2LEBA 1DLOA 1QVFR 3JPSA 4UW2A 2WF9A 4ZTJA 3NVKA 1WUUA 2KO1A 4C23A 2QARB 7ICVA 2GIFA 4K5RA 8ICPA 3ITHA 5E41A 5SWMA 3I0RA 4J2DA 3T5KA 1QS4A 1YUWA 1H74A 2UXDF 4TKTA 1D0EA 2Z57B 4JKBA 1T02A 3O1WA 3SCJE 8ICMA 3HYFA 2JC0A 9ICMA 4FKYA 2ZIXB 5B0DA 4PHTX 1S3XA 4N8NA 3LW5C 1JLFB 4TU8A 5THWA 2CDRB 3C7NB 4QZAA 4DSLA 1LV5A 5CCLA 2DKZA 5LT5A 1RT5B 3S3NA 4U96A 2GX9A 2DY9A 1ZM4A 1Z00B 2VG5A 2NXCA 2W11A 3T69A 5CB1A 5B0AA 3G86A 2QGFB 1NMNA 5HO4A 1RACB 3KJQB 4QWAA 3IRXA 1ZQCA 4HI2A 2VICA 5B0FA 3LDNA 1NZPA 4Y2YA 3RRGA 2YMLA 1NGFA 3QPIA 2ZH2A 4JWNA 3I55N 5AK4A 2CUYA 3JSBA 3JXOA 2OYQA 1TKXA 2RE1A 1ZQVA 2GMJA 4CVNE 1HUOA 1TVRB 3SFGA 3E58A 3KFWX 3AAWB 4FO0A 3DGPB 1IR1A 3KLGB 5IC4B 5FDLA 2GIQA 9ICAA 2QWPA 2OPSB 3J7YP 3F2DA 1U1MA 2B0GA 2UP1A 2B7CB 1J5EK 2RNEA 1YHQS 5AM5A 3P8BB 3EE3A 2DGXA 3TAQA 2O01C 2K7KA 8ICUA 3TFSA 3O0FA 5AI5A 4JMUA 2KT2A 4BC9A 4UASA 3G82B 1WWVA 3TSPA 4R0JA 3C14A 3TADC 2DO0A 4P0QB 5J2PB 2ZH7A 2YB1A 3WU2U 2XIDA 1T03A 4C0ZA 4P6QA 4HKQA 5JRTA 3GFXA 1KVCA 3BBCA 2KFNA 1I3AA 3U9ZA 2G07A 1YZ7A 2CPHA 5H9FK 3BSCA 4F72A 1ZTTA 1TGOA 4KT0C 4Y1DA 4TY9A 3IG1B 3ISNC 3QFPA 4ZVSB 2K8GA 2EW9A 4QZ9A 1GMUA 2ATLA 1CVJA 1RB0A 1XK8A 4CI0B 2VKQA 3P38A 4P9SA 3LGMA 2LQ5A 1WSIA 3V6DB 2VH7A 4A62A 5CWRA 2HAFA 3UMBA 4FKXA 1YJ9N 2GC8A 2OMLA 4EU0A 1DBDA 2ZIWA 1HKBA 2P9SA 2PFUA 3OYJA 4E8UA 3DDKA 2CWKA 3SQ0A 1UPPA 3GU0A 2N4CA 1BCOA 1U2VB 2GJIA 2J6SA 2IC3A 1M5HA 5ALJA 2WVDA 2Q6CA 3HHEA 5J2QB 3JYTB 1F9HA 2BUPA 3EM1A 3SI8A 1S59A 4WWSA 2QWMA 2YI1A 3MM5B 2FY1A 4PL7A 4TLRA 3ZX2A 3MMAB 2PMHA 1BWVA 4IFYB 2G06A 3BBFA 2QA4N 4ECSA 2UVUA 3DOKB 1N34J 2JEJA 4I2EA 1RWNB 4UQTA 1VJWA 2Z30B 4L74A 4DFKA 4DV7F 2IRXA 1TV6B 2ZJRQ 4K4TA 4FLWA 1VCTA 3EPGA 4UZBA 1CS4B 5LL6d 2J7KA 1T9TA 4CLPA 4M9GA 3IXQA 3DRXA 2V4RA 3CCMN 3R5BA 3L3FX 1X4HA 2OMOA 4BE1A 3AB4B 4OD0A 2DNNA 2AH5A 1B64A 1GAOA 2VA2A 3F56A 3OFHA 2BJDA 4NLBA 4E7IA 3KD5E 1HI1A 1SJQA 2HSTA 4A8MP 3G0ZA 4DTNA 1IBCB 3TADA 4CJSA 2BH1A 4JI4F 1MA7A 2HS0A 3DLBA 1KOHA 2V8DA 4YD1A 4LSZB 5J2FA 1WHXA 4GKJK 1W2IA 2I7PA 5KFZA 3HHLD 1BISA 4YN3B 4DU8A 4QWEA 4EMDA 3RR8A 3M1VB 3LGHA 1XO1A 4B3MJ 4IOAQ 8ICTA 3CCUS 3CSKA 3CCVN 2K2PA 1TL3B 2CJKA 1OQ6A 2ASMA 3CIMA 5AZJA 4YY3F 1KRPA 9ICQA 2AV5A 3M30B 3G2XA 1CPZA 2YH1A 2FC8A 3IO1A 3R5DA 4EBCA 5KFHA 4F5NA 2R8IA 2F1HA 5GIOA 4W5RA 2ADBA 4CHPA 2BA9A 3WQTA 3TABA 1E3MA 4OZ2A 3O80A 4HTJA 1AUDA 4WFXA 4N7TA 2FQQB 3POTA 1J53A 5D15A 3KWMA 2HFSA 1X66A 1O03A 2LVWA 3SV4A 4MO4A 4B9QA 1XN9A 2O66A 5ALVA 2FB0A 3S41A 4O8UA 1RWVB 3FVYA 5C15A 2H3GX 4J9NA 5D0HA 3DU5A 3AXMA 3SBTA 4K0KJ 1FE4A 1X6IA 2YHYA 1WKLA 2XMMA 1CJVA 1WEZA 1S77D 2CQCA 3GDQA 3H90A 4B3SF 3NLCA 5KFAA 2ZIWB 3GE1A 4MN4C 2V94A 2VBWA 3VWSA 2YHBA 4QYZJ 2P9SB 3QINA 2XHBA 2P9PA 3W5YA 1HR0F 1KHVA 2FLPA 2OTJN 1B43A 2PA8D 3DM2B 4CJTA 4IG0B 4CEFA 3IWLA 3TJ8A 1N36K 3JAMU 3QDKA 5LMUJ 2PE8A 3K1RB 4RW8B 5DETA 2IA6A 2E1PA 1JLCB 5F0WA 4FJLA 2KW4A 3B78A 4Z6DA 5HQLA 3ILOA 1VQPN 3ZX3A 2RHQB 3OS1A 3KMSA 3AAQA 1UP1A 4OJRA 5GAGI 4DR5K 1GLCG 1NH7A 4PHEA 3MPUB 5C2DA 2ZJAA 3ZSRA 1NNLA 2OXOA 4TNOA 4L3NA 5ETNA 1XSPA 1QSLA 1FRIA 4DU3A 1S76D 5J2NB 1EO1A 2HHUA 2VKRA 2AYMA 5CR4A 4H5WA 4Q8EA 4ZTFA 4BR9A 5KPTA 3VQCA 3CJ2A 1SJRA 5DLGA 2L9WA 2Y3YA 2ZH9A 2JZBA 2CA9A 4O3RA 3BEXA 3H20A 2XLJA 1PGZA 4RU2A 4GVLA 3CC4S 3R5CA 3B8AX 1KQKA 2FJAB 2YHXA 4CJVA 2BKNA 2E66A 3OQ2A 4PUOA 1UVMA 3EDQB 9ICHA 3WK5A 2ILYA 2M9KA 3AGRA 4H8KA 2ZBIA 3HKZC 4CFCA 2QFIA 2BX6A 2JHDA 2Q0UA 5JVGQ 4F7VA 1IUJA 2BRKA 4LF8J 2LHTA 1W9HA 1Q4RA 5KG6A 2DGUA 2EANA 3PRBA 2JGUA 3L4QA 4W98A 5GAEP 1CEZA 2VYPA 5J2DA 4JI8F 4X65J 3AA8A 5GADI 4NJ8A 3RR7A 4L6V3 3CETA 2KKZA 4JWMA 4FWSA 1TYQA 4KPCA 1WKJA 2RJZA 3ZZTA 1V5IB 3LGNA 3PJWA 3HDSA 5B0BA 3VAJA 4F4KA 5I3UA 5ADXH 3IBWA 5KQ8A 3A8IA 3CJTA 3QT6A 4YOVA 4CJLA 1HYSB 3A5NC 2H3ZA 2YY6A 2BKPA 4OPAA 4YOXA 4KR0B 4FVMA 3V81B 1HKAA 3MEEB 4KH6A 5A2QY 3IUCA 3J7ZT 2D6FC 2ZIUA 5SUHA 3KIOA 3L0QA 5KG0A 4AQYK 3ZDCA 1VQ6N 2UXCJ 4P0PB 7ICQA 3UE2A 3CP8A 5CQGA 1EKSA 2OEJA 1WHYA 2M0GB 2OUGA 3HFZB 1ASWA 2QA1A 3BZQA 2E5HA 3ZI4A 3K0SA 4FF3A 4FYWB 1HR0J 9ICKA 2DL0A 1U45A 1RE1B 3PW5A 3LOUA 3M5RA 2BGGA 3H98A 5HAOA 4XDCA 2O8CB 2BZFA 2FSKA 3BZKA 3DXSX 1V3SA 2W4DA 4J2EA 3D0HE 5BRDA 4CTAB 3ZTPA 4AL5A 4LH5A 4BRHA 4F91B 3MMCB 1TUUA 4G1PA 4JI7J 4YORA 5ETKA 1F3VA 1RFQA 3F53A 1X0PA 3TNVA 2GMLA 4KHRA 1H98A 1S1XA 3KKFA 4ZPAA 4LMZA 2WFBA 3PFOA 2E5JA 3FBBA 4FW1A 4GO5X 4WCEQ 2VFVA 4JK9A 1ZQKA 3S3OA 2F3JA 2RS2A 4CK3A 4I9QA 4TQRA 2A41A 1HX1A 1QQ6A 1QD1A 4C0HA 3GZ7A 4PRFA 4KH0B 3D7SB 2YNIA 4HTUA 1BD6A 4JKFA 4LBPA 2H3QA 2BJ9A 3H7HB 1WDTA 3UCUP 2HBKA 2AZ3A 4IOXA 8ICIA 3ZDDA 2B5JB 4DR4F 5J0YA 4B9TA 3MPVA 3FUYA 3CPEA 3VQ4A 5AM0A 3FNNA 4FPAA 2P6SA 2BW7A 4BWMA 4ED2A 2A6MA 1BI4A 4C9DA 1IR2A 8ICNA 4X65K 5GADU 1FJGK 2X6SA 5KFNA 1QTNB 4RW6A 3C46A 5BN9A 2CNLB 3SCKE 5D78A 4B3OA 3RU0A 2AD9A 1TUYA 5BYRA 3TZWA 3KXDA 1VQKN 1RK8A 1KR4A 8ICSA 1TKDA 3QFUA 4CEDA 4RQ2A 3RJJA 1NU0A 1FEHA 3SPYA 3V7JA 2XB2D 3W9IA 2QWRA 2P5GA 3UDLA 1S8OA 4ZP8A 2Y0BB 2O8EB 3RYLA 3SENA 2VGMA 3QBWA 2KE7A 3PVXA 2IDEA 3CGIA 1R0BG 2VJUA 3RAMA 2ZIVB 2MGZB 3PSPA 1RGIA 4JI3J 3QB0A 1A0PA 1YJWN 2MZ1A 1MWQA 2FHJA 3MMJA 1WG1A 2GA7A 2KXFA 1KFDA 5LSRA 4JKHA 3JPQA 1SS6A 4ISGA 1SC1B 4CZEA 2Q79A 3V81A 3DC2A 4U8YA 4EK2A 1JROA 3AQFA 1FFWB 2W7PA 4KE5A 3T5LA 4M5DA 5C12A 1N32K 3UPFA 2IAJA 1S0NA 2MLZA 2M4MA 5KFPA 1Y00A 2LP4A 5AXNA 3DWLA 2J7UA 1ZRMA 4QZHA 4M04A 2GX8A 3D2WA 4OYOA 3QT7A 3TFRA 4UY8T 2VJ5A 4RO0A 5HQ8A 3RWUA 4OLPA 4NO7A 1HNIA 2QC3A 2OPQA 1IBLJ 3FZKA 5EE0A 5DG8A 1IJEB 2HHPA 4U8VA 1HL6A 2WVFA 4FJKA 1TKZB 5IQ6A 4C48A 3MMBA 4O44A 2C2ZB 2WB1C 3HSTB 2W1BA 4BG9A 2MY8A 1QLNA 3CI5A 1LVHA 5AI4A 4PWDB 2ZD1A 2XEXA 3QEBZ 3ULEA 4PHAA 2I1RA 1JJHA 1FNXH 3KLGA 2RE2A 4OI3A 5G0RA 4P2SA 1C4CA 3K5NA 2AYEA 1H2UX 1XNQF 4E0DA 1JKHB 1NGHA 3BM7A 1VAZA 1Z19A 2XYGB 2CQHA 1S1WB 1ZQAA 4YR3A 1QE1A 1JMTA 3GIRA 4IQXA 3KK3B 2DEIA 3CXCR 2FIUA 1GNKA 4AYBD 4DCCA 1VQNS 2VQFK 4CGDA 3AJDA 3LWLA 2YNHB 3ZSZA 5LMUF 2CDQA 5HNKA 3I28A 4OJ5A 1RYRA 3DRSA 4WXWA 4DV0F 2PMWA 3JTOA 4GXKA 4M7XA 5KFEA 2RVJA 4CZGA 2ZE2B 4A8FA 4US8A 1MROB 1R31A 5KTQA 4U6PA 3VESA 3T41A 5C42B 2MQNA 3AOAA 2HGNA 1N56A 2ZJPL 3L3UA 4YOEA 3W1YC 1OUQA 2FBXA 5KNIA 3D1OA 4BG8A 4ED6A 2J6UA 4USJC 4CLTA 4CJFA 3IG1A 2B56A 4RUCA 4USKA 2FBTA 4MEYA 1DJ0A 4NYOA 1UW4A 2MUTB 2GQCA 1ZAXA 4XH1A 4FS2A 3VA0A 5LY3A 4O5FA 4J9MA 1F2GA 3B0XA 5AI8A 5J1PA 3CC2S 1EIYB 1PAUB 4KB7A 2HZAA 4OHYA 2HI0A 4UQGA 4HR2A 2WZ1A 4KTZA 2CYYA 1VHIA 3THPA 3HRDD 5ALUA 5A8RB 3V6DA 3ISCA 4CESA 3Q8KA 5AM1A 3F2CA 1RUSA 3I8BA 4OYZA 1RT4B 2KL8A 4B3TJ 4JI5K 5AQMA 5J8YC 3ZT0A 1D8BA 5DLFA 4CBUA 4KLOA 4QU7A 1U8WA 3IAS9 1QM9A 3CJ5A 3EE8A 1QVGM 1NBWA 1S9EB 4BR4A 3W8GA 4DR6K 1TAUA 1F60B 4WJBA 4NXMF 1RZMA 5CD4A 4CM0A 3FYHA 9ICCA 3K5LA 5HVGA 1GLAG 3UW1A 3SAGA 4IR1A 1T0TV 4K25A 1VHXA 1TK8A 3C16B 1Q0NA 1NKBA 5JJBA 3RZAA 3KJVB 4H5VA 2H5JB 1BVSA 2ZUDA 1RAHB 3QERA 4BHQA 2K8CB 5IIIA 2LA4A 2E5LF 2H48B 4IOCL 4LFAJ 4US9A 1YJWS 4X64K 1S22A 2V2KA 5HBMB 2U2FA 3AA4A 4O3QA 1RHMB 4FFDA 2W43A 4X4RA 1KLMA 3F73A 5F8NA 4OJOA 3MCSA 5HP1A 3N79A 2XSFA 2F40A 2E8MA 3DAWA 2YJEA 2Y9TA 2ZTEA 2OGUA 2Q2RA 1SQFA 1A5VA 4USVA 4DR4K 2D1CA 4EELA 4JYAJ 1JUDA 3VAFA 4KGKA 2E3TA 1XSLA 5I4MA 2OH2A 2IHR1 2V2QA 3AVCA 4IKFA 4UF4A 4OZ3A 3P5TL 2I2YA 2W9BB 7ICEA 1BOTO 4KHNA 4FF2A 4FM1A 2WVEA 1RQ0A 2QLBB 2C2NA 1RWUA 1ULRA 1J2MA 4NLCA 4LRCA 2ZVSA 1FE0A 2JRSA 3J8AA 4C8MA 5EHHA 3L4PA 1IIPA 2RQ5A 5H1SV 1CULB 3OYCA 1NJZA 3QO9A 1KVKA 4EBEA 1SJ1A 1RDRA 2DNKA 1DXSA 2KOBA 1U02A 3NMUA 3QMQA 3J80U 3NVVA 5DG7A 5AQJA 2ZE2A 2ZHOA 4IS7A 3QU4A 1WC0A 1NK5A 1R27B 3NS5A 2IVPA 2R9LA 4LF2A 1X9XA 1PVPA 4QWBA 5C42A 2RU3A 1VIXA 4M3UA 4CM2A 5GAHI 1HNXJ 2MEWA 2DYAA 2KIWA 1XWLA 5L38A 3L95X 3CC7S 3M32B 4DTOA 2C22A 3U1NA 1LW2B 2DITA 3NCQA 2XS7A 5ADXA 1ZD4A 4KHMA 3GV5B 2CQIA 5ALFA 5KGWA 4GV9A 3TA2A 3MM6B 2XRIA 3SAHA 2B4OA 5J2MA 2GNKA 3ZZ0A 2Y9HA 3AXKA 2Y9UA 2B9WA 1ZQPA 2Q1LA 3I0SA 3GQCA 1UOCA 4ED1A 5AQRA 3HPGA 5KFMA 2A6AA 2W2OP 5KT7A 2F8HA 4LFCJ 2RPIA 3OXLA 1TL1A 1QQNA 4CJ3A 2XWYA 3D66A 1ZS6A 3OFEA 1HPMA 4FL9A 4CO4A 5E3PA 3L2RA 1UJ4A 4ELUA 3AOBA 4ECYA 2FZCB 1NSKL 4OZ0A 3NUQA 4GW6A 3L9ZA 3BR9A 3P96A 1U6ZA 3QJLA 3OSPA 2HHTA 3OR2B 4OJHA 1IKXB 2F4FA 4RWWA 5CHIA 3QZ8A 4ZVGA 3B6OA 1NGGA 5ALLA 1WEYA 2ALYB 4JB8B 5HATA 3EMTA 4UY85 4F0KA 4WKYA 2A3ZA 3CDWA 2ZXIA 2UU9F 1UVNA 4YOUA 1ZZFA 5CZVA 3D2NA 3BEGB 3C16A 1RKJA 3DLRA 1DTQB 5EU7A 5BXIA 1OS5A 4LREA 4RWXA 4DV4F 4XEIA 4CZJA 1Q5YA 4GVBB 2VG7B 1JCFA 3GG1A 3MTKA 3N7PD 4MF2A 2V9KA 2ZWPA 1SI9A 2HURA 4BE0A 5D3GA 3MZIA 3W61A 2JLGA 3I8DA 2W6KA 4B9VA 4PL8A 9ICJA 2WAQF 3D5MA 5BRFA 1A6SA 5HBMA 3RBEA 2G8IA 1X5OA 2HGLA 3HSJA 5EY4A 2E1RA 1TZ0A 1R0AA 2ATCB 5E3AA 1EZZB 3M8SA 4K59A 4DPYA 1RZTA 1FESA 2OEMA 2XYHB 3ISDA 3GE9A 4F3OA 3TTCA 4BRMA 1T05A 4RKUC 4NPOA 3A8KA 1N32J 2QL9B 3IGVA 2A1JA 1S5ZA 2E44A 2UU9J 3LP2B 4F50A 1Z25A 3OTQA 4Q5VA 1Q79A 1EXNA 2OSRA 4QIEA 5KG7A 1Q5VA 4BVPA 5BR9A 3HVTB 3AT1B 2R8HA 4M5NA 1H1VA 7ICMA 4YXMA 4V1Ak 1PSDA 5ALMA 4WTYA 2M5YA 4DQ8A 3CJRA 4RQ7A 3ASMA 3AOCA 1Q78A 3ID6A 3EJMA 2G0CA 4J2AA 1IBLK 5J2GA 4RBTA 2A10A 3BREA 1MNEA 2C28A 2FHKA 3N6MA 2LI6A 2EG1A 4KIAA 3NBPB 1YTAA 2D4WA 3NTUA 1KOOA 2IJNA 4IYQA 3MWBA 3M6WA 4BWJA 2MHNA 1VOMA 1KVJA 5CH7B 1Q8IA 2FDNA 3W63A 2AJ4A 4BVOA 1WC1A 3AVAA 2HQGA 4ID5A 1KTQA 1XMQK 4IJNA 2I38A 1FKOA 4QIWF 1ED1A 3VF6A 2CXYA 3R9PA 4HLBA 4AYBF 3OFGA 5ALYA 1Y9OA 5EOZA 2KYZA 4JK8A 4KGMA 3M4XA 1ZQIA 4WBFA 3MECA 3K2PA 3MEKA 3SSQA 1BG3A 1U8SA 4ZITA 3OYFA 1SV4A 1HNVB 3GCXP 3BN4A 3KLIA 1KVAA 3T7ZA 1U2VA 4LF7K 2W9MA 2KD1A 5DRKA 3ISBA 1ZD3A 3WC2A 4DV2J 3NVMA 4RW9A 4MKBA 4DDFA 5JLHA 1TL1B 5AJ3F 3VEVA 1FJEB 3ZC4A 2DKOB 2F5GA 1ZA1B 1VC5A 2DKXA 1XTZA 3GP9A 2CNOB 1LK5A 4B1ZA 2OKQA 4ISEA 4CO2A 2OPRB 3HZEA 5IV3A 4C8NA 4DSKA 3N5FA 5ALIA 1JXEA 3HM8A 1WSGA 3CMAN 3B4MA 3VZIA 1KQSM 2QJ3A 4ZCIA 1URNA 4X64J 4BQLA 4UY8O 4F2SA 1IKXA 5ETTA 4P75A 4WYBA 1TFRA 1K1QA 2YJFA 4ES1A 1U26A 4P72A 2L48A 4C2MA 4NA1A 3H40A 3I5AA 2HS3A 3CUNA 3IC1A 1JWWA 4DV7J 3I82A 3UCZP 5CYMA 4DR5F 5ALKA 1Q82T 1N6QB 3KUEA 1IXKA 1L7PA 4BRIA 4HCBA 2VG7A 3ZZRA 2VPXB 2NZ4A 2ZH1A 5HROA 3WEEA 4X62F 2W25A 1LAWA 3SUQA 2H3VA 4F2RA 5AQFA 1Y7PA 2LXIA 4RX6A 4LFBF 4IWVA 3D7EO 3K58A 3KVGA 3V6JA 1FEZA 1REGX 2B4PA 2LQJA 3UO0A 2QEXN 4AL6A 3GFYA 5KFLA 1REVB 4CJEA 1FO4A 5J2KA 3PHEA 1IG6A 4NLVA 1RWXB 3MPWA 5JUMA 3OVSA 4DX6A 5J0QA 5K8PA 3TA0A 4N77A 2D0CA 4FOIA 4CO1A 4BACA 5K9FA 1SIJA 2BCSA 1WN7A 5AQWA 3H08A 3KK2B 3CF5L 1SQKA 4M9JA 1SIZA 2AX1A 3MGJA 4EFHA 4ED7A 4CT8A 4CBXA 3L2UA 5KL1B 1NK8A 4NLOA 2H4WB 3HVTA 4KHQA 5EX5A 4BR7A 1NPRA 3M2VA 1VQOS 1BU6O 1TELA 1KQGB 4HT7A 6FD1A 3F9MA 5KFCA 1EQMA 3BO3A 3KDOA 3HMJG 2C1EB 1N88A 4CLLA 2P5VA 3EGNA 4DQRA 4AD6A 2PFFB 2C2DA 2ZH6A 1KQFB 2VPYB 3E8OA 4CZCA 1GXTA 3W66A 1SV5B 2CQ1A 2OTLS 3R3TA 2BCVA 2ZBRA 1XS9D 2QLJB 8ICGA 1IKYA 4H4KC 4I6WA 4FOEA 4H0YB 4NXNF 2G8UA 1CJVB 4ZS6A 3U4LA 5GTIU 4CF3A 2JXJA 2P9GA 4NE9C 3ICLA 3LWMA 4ERDA 4RNNA 1ROFA 2EFGA 4H5TA 2V2VA 3T1AA 5KFOA 4AILC 3ZFVA 3EZOA 5FLXU 5K4LA 9ICGA 2B6AA 8ICEA 3VETA 2CKWA 1FVQA 1GQEA 1YJNS 2LMIA 4DL0C 4B1VA 2ESEA 2FHJD 3B0YA 4RW8A 5B7WA 4QJVA 3E3XA 3AM9A 4GC6A 2R18A 4ANDA 2KHDA 2HQ3A 2HNYB 2YVSA 1RABB 2GGPA 1VQ8N 3PRDA 2HSZA 3HCXA 3K89A 4WU3A 2IVFB 1FRKA 1ZQGA 4BRQA 1S6UA 4NLQA 2WONB 3DLJA 3ZEUB 1VDVA 2YWWA 1X42A 3DYAA 1U48A 5G0RB 2R2SA 4DZ6A 3KD3A 4QR2A 1DAXA 4LF4J 1IBMJ 2E8OA 8ICXA 4LR8A 3PSTA 4B9LA 4K4SA 4IOAL 1SC6A 4O3NA 1DRGA 5LMNJ 2UVRA 8ICZA 3M6XA 2KVCA 4RW7B 1OH6A 5F9NA 3BQ7A 2FC9A 3ZTOA 3RMAA 7ICJA 1E6VA 4KI6A 4FYYB 1JLGA 2G8VA 4XTTA 4KGXB 3DLGB 2H5XA 2VODA 4AHRA 5GAHU 4EFAC 4MIWA 1NJIO 2MSTA</