1ED1A

Crystal structure of simian immunodeficiency virus matrix antigen (siv ma) at 100k.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
SVLSGKKADELEKIRLRPGGKKKYMLKHVVWAANELDRFGLAESLLENKEGCQKILSVLAPLVPTGSENLKSLYNTVCVIWCIHAEEKVKHTEEAKQIVQRHLVVETGTAETMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GAG POLYPROTEIN
publication title Crystal structure of SIV matrix antigen and implications for virus assembly.
pubmed doi rcsb
source organism Simian immunodeficiency virus - mac
total genus 37
structure length 114
sequence length 114
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1ed1A00
1ECWA 1ED1A 2K4HA 1TAMA 2H3QA 2LYBA 2GOLA 2HMXA 2H3VA 4JMUA 1A6SA 2H3FA 2N1RA 2JMGA 1UPHA 4ICAA 1HIWA 1HEKA 2K4IA 2H3ZA 2LYAA 2NV3A 2H3IA 4IC9A 1L6NA 2K4EA
chains in the Genus database with same CATH superfamily
3BS5B 3WKEA 4F5PA 2G08A 1XO0A 2IOFK 2AQ4A 5DBBA 2UVWA 4UAYA 1CEZA 2RDIA 2ZJ8A 5FP0A 5KFIA 3QU7A 5AIAA 4ED7A 2ZUBA 2FPLA 4TQSA 5KFMA 2V4RA 4Y2VA 4B9MA 1NNLA 4FFDA 2ZTDA 1K5OA 1XC9A 4US8A 3Q8KA 3ZD9A 4BWJA 4DSEA 4MEYA 1QSYA 2PMZC 3SZ2A 3MR5A 3M8SA 1Z3EB 1D9FA 4EZ9A 5KFJA 1QQ6A 3EZ5A 3A0HU 2C2DA 2IOFA 2K4EA 3KZIU 2K4PA 3O0FA 4PZNA 3M8RA 2HOIA 7ICPA 3JPQA 2PI4A 3CW2C 4NLNA 1XSNA 2KHQA 4M6WB 2AH5A 1MA7A 3IN5A 1C7YA 1XU4A 5IILA 1L3TA 1JUDA 3KHGA 1X40A 4GFJA 3GQCA 4I2IA 1A0PA 4Y2PA 2KSOA 5KFTA 4NLCA 5IIKA 2W9CA 7ICSA 1L5UA 1UA1A 3C2KA 4RQ8A 2HBLA 5ALUA 7ICHA 1D8LA 5EE9A 2VKQA 3PY8A 2F77X 1XWLA 3GFKB 3AQEA 2G07A 2KG5A 2QB0A 3WK5A 8ICEA 5BPCA 5CRXA 1AQ6A 3PNCA 4I2BA 1RG6A 2PFNA 1OUQA 2Y1IA 5AM2A 9ICUA 5KG7A 3PR4A 1U48A 1SV0A 4FZLA 9ICQA 4O3MA 1ZRMA 3ZD8A 1ZQBA 3H8MA 3ZDAA 4J9MA 5KFPA 1TAUA 4YVZA 4K4HA 1B4FA 4Q8FA 5EWFA 1DGJA 5AKEA 2L5YA 3AMZA 4YR2A 4J9OA 2BQRA 1PK1B 1KRPA 4CCHA 1ZQXA 2JEGA 3GIKA 2F1HA 1HJPA 1UT5A 2JRZA 8ICOA 4MFCA 3JPNA 4C0ZA 4M0AA 1PUZA 2RP5A 5AI8A 3BQ0A 1RXWA 1QCKA 2JMGA 5KG1A 1TK8A 3LVWA 4GXKA 5KL8B 1TKDA 5ALVA 2ZIUB 4XQ8A 5E79U 3JPOA 3MGHA 8ICCA 5AK3A 8ICLA 1N61A 1VDVA 3BZCA 4DWIA 4MF2A 1Q3UA 5ALMA 5D46A 4YMMA 1NKBA 1U45A 5IINA 2WAQF 1COKA 4RU9A 4KLQA 7ICUA 2EAMA 3IRUA 4BXOA 1O08A 5L1MA 4P4PA 2E8MA 2G5HB 3AU6A 4QZBA 3TAQA 9ICWA 4IQTA 4JV2A 5KFLA 2BDUA 9ICVA 3Q8SB 1Z00A 2BCSA 2HMXA 4Q44A 4F93B 4TUPA 4M9LA 4Q45A 5KG2A 2RQ5A 3IDWA 1SL0A 5KG0A 4R63A 3RB6A 5AKJA 3EWAA 4B9NA 4EZ6A 2FPKA 2BQ3A 5AKLA 4K4IA 3D2NA 4O3RA 3IM1A 2XY5A 3PZPA 5KG6A 2E5SA 7ICEA 3TKAA 5K4LA 1DGSA 2P66A 5DQHA 3RRGA 2XO7A 1ED1A 5KAIU 4UBBA 4F2RA 4J9KA 2KJ5A 4O5CA 4NM1A 4ECWA 2W11A 4P0PA 1EXNA 3GV5B 5BOMA 3G6XA 4ED1A 1ZQWA 2QARA 1ZQZA 2DPJA 4QZIA 4I2JA 3RR7A 1ZQOA 2IHMA 2Y1JA 2KK0A 1SWVA 1J2MA 5AM4A 3UQ0A 5D4BA 4OJPA 4USAA 1BPXA 3KOOA 2F8LA 4UAVA 4GXIA 2HVIA 2IHNA 4RQ5A 3PW2A 3OJSA 5DLGA 4KLJA 1WWVA 4ED2A 4F4YA 2XI9A 1X9WA 5KFFA 5EE3A 5ALWA 1ZQUA 2B0CA 2VA8A 5EOZA 3OHAA 2E8PA 1ZQ1C 3TQ1A 3BQTA 4C4RA 1B0XA 1UQVA 2YX8A 2F2AB 2PKEA 4IS7A 4ELTA 4O3PA 3SYZA 4J9QA 2EZZA 5DGBA 3N4MB 2P6RA 4O5EA 5J0TA 1JRPA 3PW5A 3E2EA 3MR3A 2OM6A 3OTQA 3RJJA 4ELUA 4EX6A 1N2XA 4F4XA 1LVHA 3V7LA 4QWDA 3ETLA 1N56A 1XO1A 2I1QA 1L8OA 4QIWF 4Y2QA 4JWMA 4DL5A 3FAHA 5EE1A 5J29A 4F50A 2WF5A 8ICKA 1NZPA 1JMSA 4XRHA 2JH7A 2OEHA 3ONNA 2ASJA 2ZJAA 5KFZA 3HPOA 4ZOHC 2FJ6A 1F0MA 1ZQGA 4WJ3B 1V97A 5AM5A 1YZ7A 3D6JA 4A8EA 4DL3A 2Y9UA 1KFSA 4DSLA 1RQNA 3BZKA 4I29A 2YN4A 4UARA 9ICXA 1SB3C 5AI4A 3C23A 3SV3A 2HOFA 5C5JA 1HUOA 5EE0A 2C2RA 4YQWA 2AGPA 3ISBA 3BS7A 5KFVA 1A6SA 1NZBA 3GIIA 5ALGA 2OXOA 5J0XA 4PHPA 5JU5A 2E1EA 4NL9A 3G6YA 2WF8A 3NRZA 3QU9A 4RQ1A 4IL6U 2JXJA 2BGWA 9ICFA 4P4MA 5J2DA 2CXYA 3WKAA 4J9LA 2XVTA 4AP9A 2FMSA 4NY8A 2DWQA 3HWTA 1L3UA 2HHVA 4F91B 3C5GA 2KOBA 1BPZA 3DV9A 1IXRA 3ALRA 2DPIA 1BPDA 3UXNA 4B9VA 4Z6EA 2ZIWA 2RHFA 7ICTA 1LB2B 5ALFA 5KFOA 2Y0SF 4CE6A 3OJUA 2VJ5A 2NO4A 3M7DA 2VA3A 2KZZA 5AK5A 4P4OA 2GWSA 4GXJA 5CA7A 4KX5A 4PHDA 1SXEA 3H0MB 2KKPA 4UB3A 3PW4A 3GV7B 1F5SA 5ALDA 2HCFA 1ZQQA 5KFYA 5TISU 4DLEA 2JEFA 4PHAA 4U7CA 1ZQEA 9ICIA 5DBAA 4NWIA 5KFKA 2CPRA 2W9BB 2KVCA 5BOLA 4RQ7A 4R64A 5DB6A 4J9PA 3Q8RB 3HT3A 3F53A 2W55A 4QWBA 4RT2A 1BPBA 5DG8A 1V9PA 5HMLA 4DL6A 4I2EA 4NLKA 1FFUA 2FI1A 3K1ZA 4MFFA 1ZOLA 1AROP 3U26A 1Q46A 4TUSA 4IQWA 4JB3A 4JV1A 4C8OA 4KLGA 4OJOA 2R8JA 2XIDA 4Y2SA 4DQSA 5KL1B 4ED0A 5AHXA 1ZYQA 3JPSA 5AKGA 2YMQA 4RQ3A 4DQRA 5IIIA 2E1FA 3L4PA 8ICXA 4I2CA 1GO3F 4KMUA 2H3ZA 8ICQA 3I76A 4TUQA 4CDGA 4DSFA 4KLUA 2UVUA 3F5AA 3HKZF 4KN4A 1N60A 3QU2A 5ALJA 4RPZA 5KT4A 1ZQDA 4X5VA 1KTQA 2MUTB 4UB4A 4MF8A 3RR8A 1TK0A 5ALTA 2KP7A 4ED3A 3QX7A 1RZTA 4EBEA 3I1YA 1XNSA 1UA0A 2NRXA 5KG4A 3PW0A 3QEBZ 5DB7A 1ZJMA 1RPLA 1C20A 1WYGA 2HDOA 1XSLA 1X2IA 1RYRA 2I5HA 5CWRA 5AKXA 4TURA 4QZAA 4OJLA 3K75D 5AIBA 5J2CA 2FLLA 2G0AA 3C29A 1NKEA 4DFJA 4C7YA 1LKYA 4C8LA 4MEXA 1B22A 2EANA 2JZBB 2H3FA 2F1IA 3GDXA 3M1YA 3MR6A 2C22A 1UPHA 5DGAA 3M9OB 2HHXA 2E8OA 7ICRA 2J6SA 1Z4NA 4B9LA 2G5IB 9ICOA 2ZTEA 2VIXA 1L7MA 2JEJA 1PK1A 3PV8A 4JWNA 3H40A 2I6XA 4KLEA 4F71A 4ECSA 2RRDA 1SKSA 5CHGA 4IQUA 5J0QA 2KEYA 5J2IA 4TQRA 3HRDD 3QNMA 2NYVA 1SGGA 4CNQA 2JR5A 8ICZA 1HUZA 4GC7A 2A1JB 3ZDCA 1BPYA 1KL9A 3Q8PB 2EQYA 1XSPA 4R66A 2BR0A 1V38A 3TARA 1Y88A 5J0UA 3F2CA 3ISDA 4KLFA 2G09A 1KEJA 1J97A 1MC8A 3SD7A 2B21A 5ALRA 2BDPA 2HHWA 4NL9C 9ICSA 3PSTA 5J2AA 3M9MB 2AXTU 2GO7A 1Z19A 2HBKA 2BHNA 4YCXA 3DEEA 1S77D 1KFDA 3B0YA 3K4GA 3VC8A 2KD1A 1U9LA 4F5NA 1Z1VA 4O0IA 3RJEA 3E0FA 2E3TA 3GZFA 4QWCA 3C21A 4PGQA 4EX7A 3V7KA 5ALNA 2MAXA 8ICNA 4JV0A 2KMDA 2LM1A 2KNJA 3AEVA 3WK8A 3NVZA 3C5FA 3NS1A 9ICTA 4I2DA 2PI5A 5IIJA 4DOAA 5B5EU 2JV3A 1CUKA 2H3IA 2BCVA 4O3NA 5ALPA 3H0LB 4Y2TA 2ZXHA 8ICWA 3RTVA 3RRHA 4B9SA 3M9NB 2FE9A 4DL7A 2B6GA 4F5RA 3QUQA 4F72A 4QJFB 3J81j 3AL0B 2KSOB 1CRXA 2IMWP 5KG5A 4DOBA 2YQEA 4KX3A 2W9CB 2FMQA 3AQFA 4PH5A 1ECWA 4KLTA 3RJKA 4IQVA 1RYSA 1ZQMA 5J8YC 3OHBA 4ACOA 2H3VA 2ZIXA 5J0WA 3BJYA 4YR0A 2QB0B 5DBCA 3THVA 5HHHA 7ICOA 5L1KA 2D8CA 1HIWA 2AU0A 4BUGA 1L6NA 3ZDBA 5JUMA 2DF4B 4YMNA 1JX4A 4EENA 3R9KA 4E0DA 1ZD5A 8ICRA 1L8LA 3UM9A 5KFRA 1X9MA 4US9A 5KFXA 4KTQA 3AN1A 3MR2A 2EAPA 5J2EA 4J9RA 2DFLA 2VJ4A 4AYBF 3RH4A 3IV6A 3BQ1A 3HP6A 1NK9A 1X9SA 4DOCA 2EDUA 1SL2A 3I28A 4M2YA 2DQNB 3SAHA 5CR0A 4CRXA 3RAQA 3LDAA 4YFKA 4UATA 1ZQIA 1T4GA 3NVYA 2W3SA 5ALOA 1SKRA 1S0VA 2O6KA 2IOHA 2WHEA 2W04A 1CI4A 2BKEA 5KAFU 2WAQC 5CB1A 2KFNA 1S0NA 2WB1F 3WK4A 2W3RA 2PFOA 3VCBA 2FLPA 1TVAA 1PVQA 1S8OA 1IM4A 2HI0A 4IRKA 2HHSA 4F4KA 3L3FX 2XICA 5DG9A 9ICLA 3RAXA 4UQGA 4BXOB 3H8JA 2Q4TA 2AGQA 2F1JA 1YZ6A 3RH6A 4OJ5A 4DSIA 5KFSA 2YMPA 4C8NA 4NM2A 5J2BA 3MFIA 3UXPA 5D49A 5J0SA 3GIMA 2KFZA 3NASA 4DS5A 1Z00B 2KZ3A 4YD1A 1U4BA 1WUDA 4DF8A 4XA5A 1P7DA 3OSPA 4LVSA 4DEZA 4NXZA 1URJA 1J2NA 2W9AA 4RNNA 3H7IA 3RJHA 4C4SA 3RB4A 3RH5A 1T3QA 4B6JA 4ECXA 1KQQA 3WK6A 2FDRA 4YR3A 1S5LU 3QUCA 4Z6DA 1Z4OA 3LWMA 4DSKA 7ICLA 2DBYA 2W54A 4IC9A 4DO9A 1N48A 9ICJA 1RM6C 4PGYA 1ZQKA 4DL4A 1TAQA 5DDYA 4DQIA 2ESEA 3PR5B 3PO4A 4P0PB 5AKHA 4IRDA 4I27A 4RT3A 3QU4A 3SV4A 2RLTA 3MC1A 1ZD3A 2QARB 1X9XA 2KHVA 4UBCA 1ZQHA 2W7OA 4F5OA 4J9SA 3PO5A 3WK7A 2BPFA 2M9NA 4RPXA 4Z6CA 4CF3A 2FPMA 1BNPA 4XUSA 4KMOB 2H3QA 1ZQTA 4O3QA 4F3OA 5HR6A 2OYYA 3OPXA 4IR9A 1KBUA 8ICBA 4F2SA 5J0PA 2BQUA 3Q8LA 3KZXA 2FMPA 3S6JA 2ZTCA 3OSNA 4QZGA 1QQ7A 2IA6A 2YTUA 4QZDA 3UMGA 1ZRNA 3F2DA 1H38A 4Y2YA 2ES6A 4PL1A 1KKXA 4QZEA 4BWMA 2EZXA 1O03A 1NK4A 4QNLA 4QIWC 5KFQA 8ICJA 3EPGA 2ALZA 3SEIA 5F3XB 1T8EA 7ICKA 3KTQA 1JI7A 1ZQRA 2ZUCA 3SAFA 2GLEA 5J2HA 1ZD4A 5HMMA 3PSFA 4QZ8A 3GILA 1NJYA 5T14A 5EWEA 1KSPA 2AQ0A 1NI3A 4QWEA 4ED8A 5J2KA 2F3NA 2ZIVA 4LZDA 3SQIA 1NK7A 1BVSA 9ICPA 4EYIB 1SIJA 3WU2U 1N5WA 5F9LA 1VLBA 4YN4A 4QZFA 5KG3A 2R18A 1WCLA 3HJEA 4RQ0A 1Q3VA 1NJXA 1QSSA 2AHOB 4P0QA 2MUTA 7ICQA 4DFDA 7ICNA 4OD0A 4R8UB 3QZ8A 3RJIA 5ALQA 2EAOA 1DK3A 5KNIA 3KHLA 1BGXT 2AJQA 4FBTA 3BS5A 4IRCA 9ICCA 4RPYA 2QLTA 3TFRA 5J8YA 4Y2JA 1X6IA 3BQ7A 1S9FA 9ICNA 3FYHA 1JIHA 3SAGA 5ALEA 2I9GA 4IR1A 3SI8A 2MU2A 2LPEA 7ICFA 9ICGA 3LK9A 1KLNA 3WK9A 2KIWA 4BGDA 4Q43A 4C80A 4DQQA 2R8GA 8ICMA 4U6PA 3LVVA 2YB1A 1UHUA 5B66U 2Y0SC 4KLHA 2KV2A 3QXGA 2YY6A 1TV9A 2K4IA 1K1SA 1SXDA 1K1QA 5AI0A 3L5KA 4HYKA 3GU3A 3QU5A 1ZJNA 1IV8A 4M6WA 4UAUA 2OWOA 2V4QA 2XGPA 2G06A 3TADC 2PMZF 2ZIWB 2JH1A 1N5XA 4RQNA 1SV4A 4YG2A 4EEYA 1UCVA 3KFUF 4QWAA 2HSZA 4CGZA 1FFVA 2P35A 5GTIU 3C1YA 1RQLA 3QE9Y 1ZETA 4GLXA 1MQ3A 3M6ZA 3NVVA 4QW9A 8ICVA 5ALLA 3PMLA 9ICEA 4M9JA 2KJ9A 1JXEA 1A77A 4KLMA 3V6KA 5J0OA 4F92B 4DFKA 2ZUDA 2WTFA 3KHRA 8ICGA 2KZMA 5KFNA 2NV3A 2GH1A 5AI9A 4M9GA 3NRWA 3TAPA 3FM9A 3N97B 4YP3A 5DDMA 2J6UA 1JALA 3UMCA 2LYBA 1N63A 4PZOA 4Y2XA 3TANA 4EYHB 3UQ2A 1S0MA 4BDPA 5G5HA 3N7SC 3CP8A 5ALSA 4MHVA 4DCCA 3V6HA 2BPGA 1NOMA 3RFAA 1YT3A 1X42A 1JN3A 4PJ0U 3T5HA 4QZHA 1SWWA 2BCQA 3N28A 3HKZC 3EUB2 1T94A 4FE3A 7ICMA 1T7PA 4EELA 5J2FA 5HP4A 2ZIUA 1PVRA 3FDSA 3MDAA 3KHHA 5KFEA 4HAIA 3H8WA 2XY7A 2MSNA 1TAMA 2W9MA 3B9JA 5F9NA 4I2GA 1DRGA 2ZXIA 1QLNA 4C4TA 1KW4A 4ELVA 3QUTA 3RBEA 5KTQA 7ICJA 4PGXA 4UAWA 5J0RA 2KTQA 8ICIA 5HNKA 2YMMA 4UB5A 2OHFA 1ZQFA 4J9NA 4M9NA 2W8LA 1ZD2P 2XY6A 1OXJA 9ICAA 4F8RA 4I2AA 3PSPA 1S97A 4KLLA 3PMNA 2WF9A 3PX0A 1U49A 1D8BA 3H0RB 3QYPA 3HW8A 1OW5A 8ICSA 1X6JA 3WKDA 1BNOA 3T79A 1LKYB 5KFGA 1FEZA 1L7NA 4UB2A 1ZXIA 2DKXA 3JPTA 5IIOA 3BDPA 2JEIA 3F5EA 3ISCA 2CRXA 4QW8A 1NK0A 4B9UA 3T5LA 2HBJA 9ICRA 4YXMA 2H5XA 5L9XA 2JHDA 4CF4A 4PHEA 2K8CB 2F76X 2BCUA 5KFCA 4JMUA 2ZJ5A 4YXJA 4KITB 3T3FA 4EEKA 1NK5A 3IP4B 1PVPA 3A0BU 2EZYA 2XC9A 7ICVA 3GV8B 2A19A 2R8HA 4ECZA 7ICIA 3D2QA 9ICMA 4KLSA 3T5JA 3UPQA 4O3OA 7ICGA 1NK8A 2FLNA 2LHTA 3TFSA 4M04A 4GC6A 4CF5A 2NO5A 5G5GA 5A0LA 2WF6A 2Y9TA 4FO6A 1B43A 2MA1A 3IG8A 4OCZA 3JPPA 2D3DA 9ICKA 3QZ7A 5J2GA 1S10A 3FC4A 3RF9A 4EBDA 5L1LA 5IIMA 9ICHA 2YB4A 1QSLA 3ETRA 2GOLA 8ICUA 5DB8A 5GTHU 4YD2A 2ATLA 3UMBA 1ZQPA 5H2FU 3V7JA 4ZH4A 1Q8KA 2W8KA 1D8YA 4PPXA 3EW9A 5AI5A 2R8KA 3D2SA 4C7ZA 4Z6FA 2NRWA 1ZQSA 5J2JA 3BQ2A 2KIVA 4G3IA 2XGQA 2A3VA 2HW3A 1L3SA 4RQMA 2V9WA 2RDJA 1NJZA 4F4WA 4DFMA 3T5KA 2UVRA 4ECYA 2MRLA 2W7PA 3KKAC 2BPCA 4UASA 1ZQYA 3LWLA 1QH9A 4DLGA 3TADA 4DQPA 2QKQA 5DQGA 3ICXA 2W43A 5AKZA 5ALYA 1WWUA 4O5KA 1WCNA 1DK2A 2ODGA 1MQ2A 3TI0A 2LYAA 3OGUA 5DKWA 5HR7A 2KKVA 3AU2A 3KBBA 4RZRA 3M6KA 4ECRA 2ISOA 3Q8QB 3N7RC 3EYZA 3PX6A 3RB3A 5L1IA 4RQ2A 1V85A 8ICYA 2ZIXB 4M9HA 4RNOA 2OH2A 4KLOA 3V72A 4AYBC 4KLIA 2EH9A 5ALXA 4M47A 4R65A 2NRVA 4KN7A 1S76D 5KT2A 1N62A 2LMRA 4UB8U 5KT3A 4DF4A 2AGOA 4K4GA 2NRTA 5KFBA 4YMOA 4LJXA 3H4BA 5KT6A 3ED5A 1NJWA 1DOQA 3H8SA 4FS2A 2N1RA 1QTMA 2HOQA 3C28A 5ALHA 4NJ8A 2LM4A 4ECTA 2WB1C 2WFAA 1LV5A 5L1JA 3CRXA 5AM3A 4UB6U 2K8BB 5KT5A 5DQIA 8ICHA 8ICTA 2Z7JA 4OJ6A 4DSJA 3C2LA 3RB0A 4J03A 2LYHA 2YMLA 5DB9A 4O3SA 3WKCA 4ECUA 4G9BA 5AKKA 1DXSA 2NRZA 2C28A 2BCRA 4EBCA 3NTUA 1Z1BA 2K89A 4PL2A 4UB1A 4R8UA 2HBMA 3NUQA 4I28A 4NLBA 3PVXA 2W9BA 2PFPA 4JK1A 2QB1A 5JTIA 3MBYA 1SZPA 5J0YA 3F2BA 4I2HA 3IG5A 2CN1A 1FO4A 3HILA 3MABA 1U47A 1RYUA 4DL2A 3PSIA 4QZ9A 2ASDA 1SV0C 1UT8A 2HHQA 1MSWD 4F5QA 4P2HA 1JXLA 2PXIA 1XS9D 2LBOA 2DL0A 1KDHA 2ASLA 3MFHA 3ORYA 2J6TA 3DDHA 2JGAA 4NLZA 2LKYA 4ED6A 1KFTA 1ZQCA 4ECVA 4RUAA 1L7OA 5CP2A 5KFDA 2C2EA 1SL1A 3NVWA 5JRTA 2K60A 2XCPA 3TACB 5AKIA 5ALZA 3GIJA 3WKBA 1MN8A 2K8AA 3G6VA 2A1AA 3MGVA 3MDCA 5AKYA 3AUOA 4DS4A 2ZG6A 3ZI4A 1QQ5A 2BZFA 1X66A 4I2FA 1S0OA 3PW7A 2IBKA 4LZGA 4BJQA 3ZDEA 4FBUA 2WF7A 1WG8A 3NGDA 1IIPA 4BX9C 4Y2UA 4KLDA 3IHQB 8ICAA 5AM0A 4OO1J 4O9MA 3UXOA 2OCEA 2DGZA 4RUCA 1IG6A 5AK6A 2KVSA 2W03A 2KN7A 1RXVA 5CEHA 2KJ8A 5KFHA 4RNMA 1L3VA 3MGIA 1NKCA 4RQ6A 4FZMA 4C8KA 3RJGA 1TFRA 2R8IA 1FIQA 4FS1A 5C0YA 5DG7A 1SKWA 3HX0A 5EWGA 5KFWA 1HEKA 5DLFA 3SENA 5CJ7A 3ZDDA 2P6UA 3QEAZ 3SMVA 4UW9A 2VA2A 3EPIA 1PZNA 3Q8MA 2K4HA 1KN5A 2LI6A 1M6YA 5TZVA 1ZQNA 1NK6A 2JZBA 2ISPA 1RDFA 2E8NA 2Q0ZX 2HHTA 4ECQA 3AM9A 2F44A 1COOA 3N7PD 2VANA 4B9TA 4JUZA 8ICFA 3JPRA 4FZNA 1A76A 1SZHA 2DKZA 4Y2RA 5AI6A 3C1ZA 5KFAA 3RBDA 1F44A 5HHIA 3B0XA 4QZCA 3H4DA 5KFUA 1ZQLA 1VJ5A 3V6JA 1TE2A 5ALKA 1TK5A 5AK4A 2ZIVB 1T3NA 1L7PA 4GIBA 3K1RB 4DFPA 1ZQAA 4NLGA 4ICAA 4NV0A 5AM1A 2M0NA 2A1JA 3KKAA 1D9DA 8ICPA 3RJFA 3KD3A 2PFQA 1ZQVA 1ZQJA 5KT7A 3E58A 3CNHA 1BPEA 3SR6A 2UVVA 4RQ4A 9ICBA 5ALIA 2KICA 1PK3A 4P0QB 2XCAA 4MFAA 5AICA 3QUBA 1JROA 3C2MA 4F4ZA 2DUYA 3LYSA 4UAZA 2F8KA 4C8MA 2HVHA 2HHUA 3CYMA 3PX4A 2D6FC 2KE7A 4Q8EA
chains in the Genus database with same CATH topology
1ECWA 4CDGA 1OUQA 2W03A 3F2DA 4OJ5A 3RFAA 1YT3A 2G08A 4PL1A 1XO0A 2JHDA 4U6PA 3F5AA 2KJ8A 2ZIWA 2RHFA 4QIWF 2K8CB 2F76X 3HKZF 4ACOA 2H3VA 4JMUA 2K89A 4QNLA 1Z1BA 3LVVA 3D2NA 2ZIXA 3ICXA 4PL2A 4FZMA 4QIWC 3F2CA 2Y0SF 3HKZC 4FZLA 2VJ5A 3M7DA 4O3MA 2HBMA 3NUQA 3PZPA 1T94A 1WUDA 3IP4B 2YB1A 4FE3A 2G09A 4NLBA 2Y0SC 5C0YA 1PVPA 1P7DA 2E5SA 2KV2A 2JH7A 1HIWA 1HEKA 2K4IA 4BUGA 3SAFA 4KX5A 3F2BA 3ONNA 2LYAA 1L6NA 3H0MB 3IG5A 2KKPA 1URJA 2ZIUA 3D2QA 2DF4B 5HR7A 3GU3A 2KKVA 1PVRA 3SMVA 2CN1A 1ED1A 4WJ3B 3M6KA 3PSTA 3PSFA 1XNSA 2KJ5A 2K4HA 5T14A 1TAMA 2LHTA 1Z19A 3N7RC 4P0PA 2G06A 2HBKA 4A8EA 3PSIA 2PMZF 2ZIWB 3DEEA 2JH1A 1DRGA 4U7CA 5A0LA 2ZXIA 3VC8A 2PMZC 2KD1A 2ZIXB 4NWIA 4C0ZA 2ZIVA 3N7PD 2RP5A 3SQIA 2OH2A 2MA1A 3IG8A 2VJ4A 4AYBF 2CPRA 2JMGA 3E0FA 3GZFA 2KVCA 4FZNA 2LBOA 3KFUF 4OJLA 3LVWA 4CGZA 1SZHA 4AYBC 4IC9A 2DQNB 3SAHA 2K4EA 2JGAA 2G0AA 3O0FA 5KL8B 3C29A 2HOIA 4CRXA 2ZIUB 2HOFA 2LKYA 3RF9A 1F44A 3F53A 2KNJA 2KHQA 2R18A 3M6ZA 2YB4A 4OJPA 1Q3VA 1MA7A 2GOLA 3IN5A 4P0PB 2F8LA 2KJ9A 1Q3UA 4P0QA 2W04A 2WAQF 4GFJA 1A6SA 3PSPA 3K1ZA 2H3FA 1NZBA 1A0PA 2K8AA 2ZIVB 3MGVA 2N1RA 2WAQC 2OXOA 2XI9A 2KHVA 2HOQA 4NLCA 1UPHA 3C28A 4ICAA 2E1EA 4NV0A 2W7OA 2NV3A 2GH1A 2H3IA 2WB1F 3H0RB 2M0NA 3NRWA 1D8BA 2G5HB 2G5IB 2ZG6A 3D2SA 3VCBA 4OJOA 2HBLA 2WB1C 2VIXA 1ZQ1C 3H0LB 2XIDA 1PVQA 5KL1B 2YX8A 2ZXHA 4KMOB 2F2AB 4BJQA 2BDUA 2VKQA 3CRXA 2F77X 2H3QA 2LYBA 2HMXA 3T79A 2K8BB 2XVTA 3AQEA 5HR6A 2OYYA 2RRDA 3OPXA 3SAGA 2G07A 2KICA 2A3VA 1KBUA 1IIPA 4P0QB 2Z7JA 4OJ6A 2E1FA 2KEYA 4BX9C 3L3FX 4QJFB 2XICA 3F5EA 2CRXA 3AL0B 3LYSA 3KZXA 4OO1J 2KOBA 3N7SC 1CRXA 5CRXA 2DGZA 2OM6A 1GO3F 3ALRA 3CP8A 2H3ZA 3CYMA 4KX3A 2D6FC 2Q4TA 2KIWA 2HBJA 3AQFA 2MRLA 2W7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ECW A;  1ED1 A;  2K4H A;  1TAM A;  2H3Q A;  2LYB A;  2GOL A;  2HMX A;  2H3V A;  4JMU A;  1A6S A;  2H3F A;  2N1R A;  2JMG A;  1UPH A;  4ICA A;  1HIW A;  1HEK A;  2K4I A;  2H3Z A;  2LYA A;  2NV3 A;  2H3I A;  4IC9 A;  1L6N A;  2K4E A; 
#chains in the Genus database with same CATH topology
 3BS5 B;  3WKE A;  4F5P A;  2G08 A;  1XO0 A;  2IOF K;  2AQ4 A;  5DBB A;  2UVW A;  4UAY A;  1CEZ A;  2RDI A;  2ZJ8 A;  5FP0 A;  5KFI A;  3QU7 A;  5AIA A;  4ED7 A;  2ZUB A;  2FPL A;  4TQS A;  5KFM A;  2V4R A;  4Y2V A;  4B9M A;  1NNL A;  4FFD A;  2ZTD A;  1K5O A;  1XC9 A;  4US8 A;  3Q8K A;  3ZD9 A;  4BWJ A;  4DSE A;  4MEY A;  1QSY A;  2PMZ C;  3SZ2 A;  3MR5 A;  3M8S A;  1Z3E B;  1D9F A;  4EZ9 A;  5KFJ A;  1QQ6 A;  3EZ5 A;  3A0H U;  2C2D A;  2IOF A;  2K4E A;  3KZI U;  2K4P A;  3O0F A;  4PZN A;  3M8R A;  2HOI A;  7ICP A;  3JPQ A;  2PI4 A;  3CW2 C;  4NLN A;  1XSN A;  2KHQ A;  4M6W B;  2AH5 A;  1MA7 A;  3IN5 A;  1C7Y A;  1XU4 A;  5IIL A;  1L3T A;  1JUD A;  3KHG A;  1X40 A;  4GFJ A;  3GQC A;  4I2I A;  1A0P A;  4Y2P A;  2KSO A;  5KFT A;  4NLC A;  5IIK A;  2W9C A;  7ICS A;  1L5U A;  1UA1 A;  3C2K A;  4RQ8 A;  2HBL A;  5ALU A;  7ICH A;  1D8L A;  5EE9 A;  2VKQ A;  3PY8 A;  2F77 X;  1XWL A;  3GFK B;  3AQE A;  2G07 A;  2KG5 A;  2QB0 A;  3WK5 A;  8ICE A;  5BPC A;  5CRX A;  1AQ6 A;  3PNC A;  4I2B A;  1RG6 A;  2PFN A;  1OUQ A;  2Y1I A;  5AM2 A;  9ICU A;  5KG7 A;  3PR4 A;  1U48 A;  1SV0 A;  4FZL A;  9ICQ A;  4O3M A;  1ZRM A;  3ZD8 A;  1ZQB A;  3H8M A;  3ZDA A;  4J9M A;  5KFP A;  1TAU A;  4YVZ A;  4K4H A;  1B4F A;  4Q8F A;  5EWF A;  1DGJ A;  5AKE A;  2L5Y A;  3AMZ A;  4YR2 A;  4J9O A;  2BQR A;  1PK1 B;  1KRP A;  4CCH A;  1ZQX A;  2JEG A;  3GIK A;  2F1H A;  1HJP A;  1UT5 A;  2JRZ A;  8ICO A;  4MFC A;  3JPN A;  4C0Z A;  4M0A A;  1PUZ A;  2RP5 A;  5AI8 A;  3BQ0 A;  1RXW A;  1QCK A;  2JMG A;  5KG1 A;  1TK8 A;  3LVW A;  4GXK A;  5KL8 B;  1TKD A;  5ALV A;  2ZIU B;  4XQ8 A;  5E79 U;  3JPO A;  3MGH A;  8ICC A;  5AK3 A;  8ICL A;  1N61 A;  1VDV A;  3BZC A;  4DWI A;  4MF2 A;  1Q3U A;  5ALM A;  5D46 A;  4YMM A;  1NKB A;  1U45 A;  5IIN A;  2WAQ F;  1COK A;  4RU9 A;  4KLQ A;  7ICU A;  2EAM A;  3IRU A;  4BXO A;  1O08 A;  5L1M A;  4P4P A;  2E8M A;  2G5H B;  3AU6 A;  4QZB A;  3TAQ A;  9ICW A;  4IQT A;  4JV2 A;  5KFL A;  2BDU A;  9ICV A;  3Q8S B;  1Z00 A;  2BCS A;  2HMX A;  4Q44 A;  4F93 B;  4TUP A;  4M9L A;  4Q45 A;  5KG2 A;  2RQ5 A;  3IDW A;  1SL0 A;  5KG0 A;  4R63 A;  3RB6 A;  5AKJ A;  3EWA A;  4B9N A;  4EZ6 A;  2FPK A;  2BQ3 A;  5AKL A;  4K4I A;  3D2N A;  4O3R A;  3IM1 A;  2XY5 A;  3PZP A;  5KG6 A;  2E5S A;  7ICE A;  3TKA A;  5K4L A;  1DGS A;  2P66 A;  5DQH A;  3RRG A;  2XO7 A;  1ED1 A;  5KAI U;  4UBB A;  4F2R A;  4J9K A;  2KJ5 A;  4O5C A;  4NM1 A;  4ECW A;  2W11 A;  4P0P A;  1EXN A;  3GV5 B;  5BOM A;  3G6X A;  4ED1 A;  1ZQW A;  2QAR A;  1ZQZ A;  2DPJ A;  4QZI A;  4I2J A;  3RR7 A;  1ZQO A;  2IHM A;  2Y1J A;  2KK0 A;  1SWV A;  1J2M A;  5AM4 A;  3UQ0 A;  5D4B A;  4OJP A;  4USA A;  1BPX A;  3KOO A;  2F8L A;  4UAV A;  4GXI A;  2HVI A;  2IHN A;  4RQ5 A;  3PW2 A;  3OJS A;  5DLG A;  4KLJ A;  1WWV A;  4ED2 A;  4F4Y A;  2XI9 A;  1X9W A;  5KFF A;  5EE3 A;  5ALW A;  1ZQU A;  2B0C A;  2VA8 A;  5EOZ A;  3OHA A;  2E8P A;  1ZQ1 C;  3TQ1 A;  3BQT A;  4C4R A;  1B0X A;  1UQV A;  2YX8 A;  2F2A B;  2PKE A;  4IS7 A;  4ELT A;  4O3P A;  3SYZ A;  4J9Q A;  2EZZ A;  5DGB A;  3N4M B;  2P6R A;  4O5E A;  5J0T A;  1JRP A;  3PW5 A;  3E2E A;  3MR3 A;  2OM6 A;  3OTQ A;  3RJJ A;  4ELU A;  4EX6 A;  1N2X A;  4F4X A;  1LVH A;  3V7L A;  4QWD A;  3ETL A;  1N56 A;  1XO1 A;  2I1Q A;  1L8O A;  4QIW F;  4Y2Q A;  4JWM A;  4DL5 A;  3FAH A;  5EE1 A;  5J29 A;  4F50 A;  2WF5 A;  8ICK A;  1NZP A;  1JMS A;  4XRH A;  2JH7 A;  2OEH A;  3ONN A;  2ASJ A;  2ZJA A;  5KFZ A;  3HPO A;  4ZOH C;  2FJ6 A;  1F0M A;  1ZQG A;  4WJ3 B;  1V97 A;  5AM5 A;  1YZ7 A;  3D6J A;  4A8E A;  4DL3 A;  2Y9U A;  1KFS A;  4DSL A;  1RQN A;  3BZK A;  4I29 A;  2YN4 A;  4UAR A;  9ICX A;  1SB3 C;  5AI4 A;  3C23 A;  3SV3 A;  2HOF A;  5C5J A;  1HUO A;  5EE0 A;  2C2R A;  4YQW A;  2AGP A;  3ISB A;  3BS7 A;  5KFV A;  1A6S A;  1NZB A;  3GII A;  5ALG A;  2OXO A;  5J0X A;  4PHP A;  5JU5 A;  2E1E A;  4NL9 A;  3G6Y A;  2WF8 A;  3NRZ A;  3QU9 A;  4RQ1 A;  4IL6 U;  2JXJ A;  2BGW A;  9ICF A;  4P4M A;  5J2D A;  2CXY A;  3WKA A;  4J9L A;  2XVT A;  4AP9 A;  2FMS A;  4NY8 A;  2DWQ A;  3HWT A;  1L3U A;  2HHV A;  4F91 B;  3C5G A;  2KOB A;  1BPZ A;  3DV9 A;  1IXR A;  3ALR A;  2DPI A;  1BPD A;  3UXN A;  4B9V A;  4Z6E A;  2ZIW A;  2RHF A;  7ICT A;  1LB2 B;  5ALF A;  5KFO A;  2Y0S F;  4CE6 A;  3OJU A;  2VJ5 A;  2NO4 A;  3M7D A;  2VA3 A;  2KZZ A;  5AK5 A;  4P4O A;  2GWS A;  4GXJ A;  5CA7 A;  4KX5 A;  4PHD A;  1SXE A;  3H0M B;  2KKP A;  4UB3 A;  3PW4 A;  3GV7 B;  1F5S A;  5ALD A;  2HCF A;  1ZQQ A;  5KFY A;  5TIS U;  4DLE A;  2JEF A;  4PHA A;  4U7C A;  1ZQE A;  9ICI A;  5DBA A;  4NWI A;  5KFK A;  2CPR A;  2W9B B;  2KVC A;  5BOL A;  4RQ7 A;  4R64 A;  5DB6 A;  4J9P A;  3Q8R B;  3HT3 A;  3F53 A;  2W55 A;  4QWB A;  4RT2 A;  1BPB A;  5DG8 A;  1V9P A;  5HML A;  4DL6 A;  4I2E A;  4NLK A;  1FFU A;  2FI1 A;  3K1Z A;  4MFF A;  1ZOL A;  1ARO P;  3U26 A;  1Q46 A;  4TUS A;  4IQW A;  4JB3 A;  4JV1 A;  4C8O A;  4KLG A;  4OJO A;  2R8J A;  2XID A;  4Y2S A;  4DQS A;  5KL1 B;  4ED0 A;  5AHX A;  1ZYQ A;  3JPS A;  5AKG A;  2YMQ A;  4RQ3 A;  4DQR A;  5III A;  2E1F A;  3L4P A;  8ICX A;  4I2C A;  1GO3 F;  4KMU A;  2H3Z A;  8ICQ A;  3I76 A;  4TUQ A;  4CDG A;  4DSF A;  4KLU A;  2UVU A;  3F5A A;  3HKZ F;  4KN4 A;  1N60 A;  3QU2 A;  5ALJ A;  4RPZ A;  5KT4 A;  1ZQD A;  4X5V A;  1KTQ A;  2MUT B;  4UB4 A;  4MF8 A;  3RR8 A;  1TK0 A;  5ALT A;  2KP7 A;  4ED3 A;  3QX7 A;  1RZT A;  4EBE A;  3I1Y A;  1XNS A;  1UA0 A;  2NRX A;  5KG4 A;  3PW0 A;  3QEB Z;  5DB7 A;  1ZJM A;  1RPL A;  1C20 A;  1WYG A;  2HDO A;  1XSL A;  1X2I A;  1RYR A;  2I5H A;  5CWR A;  5AKX A;  4TUR A;  4QZA A;  4OJL A;  3K75 D;  5AIB A;  5J2C A;  2FLL A;  2G0A A;  3C29 A;  1NKE A;  4DFJ A;  4C7Y A;  1LKY A;  4C8L A;  4MEX A;  1B22 A;  2EAN A;  2JZB B;  2H3F A;  2F1I A;  3GDX A;  3M1Y A;  3MR6 A;  2C22 A;  1UPH A;  5DGA A;  3M9O B;  2HHX A;  2E8O A;  7ICR A;  2J6S A;  1Z4N A;  4B9L A;  2G5I B;  9ICO A;  2ZTE A;  2VIX A;  1L7M A;  2JEJ A;  1PK1 A;  3PV8 A;  4JWN A;  3H40 A;  2I6X A;  4KLE A;  4F71 A;  4ECS A;  2RRD A;  1SKS A;  5CHG A;  4IQU A;  5J0Q A;  2KEY A;  5J2I A;  4TQR A;  3HRD D;  3QNM A;  2NYV A;  1SGG A;  4CNQ A;  2JR5 A;  8ICZ A;  1HUZ A;  4GC7 A;  2A1J B;  3ZDC A;  1BPY A;  1KL9 A;  3Q8P B;  2EQY A;  1XSP A;  4R66 A;  2BR0 A;  1V38 A;  3TAR A;  1Y88 A;  5J0U A;  3F2C A;  3ISD A;  4KLF A;  2G09 A;  1KEJ A;  1J97 A;  1MC8 A;  3SD7 A;  2B21 A;  5ALR A;  2BDP A;  2HHW A;  4NL9 C;  9ICS A;  3PST A;  5J2A A;  3M9M B;  2AXT U;  2GO7 A;  1Z19 A;  2HBK A;  2BHN A;  4YCX A;  3DEE A;  1S77 D;  1KFD A;  3B0Y A;  3K4G A;  3VC8 A;  2KD1 A;  1U9L A;  4F5N A;  1Z1V A;  4O0I A;  3RJE A;  3E0F A;  2E3T A;  3GZF A;  4QWC A;  3C21 A;  4PGQ A;  4EX7 A;  3V7K A;  5ALN A;  2MAX A;  8ICN A;  4JV0 A;  2KMD A;  2LM1 A;  2KNJ A;  3AEV A;  3WK8 A;  3NVZ A;  3C5F A;  3NS1 A;  9ICT A;  4I2D A;  2PI5 A;  5IIJ A;  4DOA A;  5B5E U;  2JV3 A;  1CUK A;  2H3I A;  2BCV A;  4O3N A;  5ALP A;  3H0L B;  4Y2T A;  2ZXH A;  8ICW A;  3RTV A;  3RRH A;  4B9S A;  3M9N B;  2FE9 A;  4DL7 A;  2B6G A;  4F5R A;  3QUQ A;  4F72 A;  4QJF B;  3J81 j;  3AL0 B;  2KSO B;  1CRX A;  2IMW P;  5KG5 A;  4DOB A;  2YQE A;  4KX3 A;  2W9C B;  2FMQ A;  3AQF A;  4PH5 A;  1ECW A;  4KLT A;  3RJK A;  4IQV A;  1RYS A;  1ZQM A;  5J8Y C;  3OHB A;  4ACO A;  2H3V A;  2ZIX A;  5J0W A;  3BJY A;  4YR0 A;  2QB0 B;  5DBC A;  3THV A;  5HHH A;  7ICO A;  5L1K A;  2D8C A;  1HIW A;  2AU0 A;  4BUG A;  1L6N A;  3ZDB A;  5JUM A;  2DF4 B;  4YMN A;  1JX4 A;  4EEN A;  3R9K A;  4E0D A;  1ZD5 A;  8ICR A;  1L8L A;  3UM9 A;  5KFR A;  1X9M A;  4US9 A;  5KFX A;  4KTQ A;  3AN1 A;  3MR2 A;  2EAP A;  5J2E A;  4J9R A;  2DFL A;  2VJ4 A;  4AYB F;  3RH4 A;  3IV6 A;  3BQ1 A;  3HP6 A;  1NK9 A;  1X9S A;  4DOC A;  2EDU A;  1SL2 A;  3I28 A;  4M2Y A;  2DQN B;  3SAH A;  5CR0 A;  4CRX A;  3RAQ A;  3LDA A;  4YFK A;  4UAT A;  1ZQI A;  1T4G A;  3NVY A;  2W3S A;  5ALO A;  1SKR A;  1S0V A;  2O6K A;  2IOH A;  2WHE A;  2W04 A;  1CI4 A;  2BKE A;  5KAF U;  2WAQ C;  5CB1 A;  2KFN A;  1S0N A;  2WB1 F;  3WK4 A;  2W3R A;  2PFO A;  3VCB A;  2FLP A;  1TVA A;  1PVQ A;  1S8O A;  1IM4 A;  2HI0 A;  4IRK A;  2HHS A;  4F4K A;  3L3F X;  2XIC A;  5DG9 A;  9ICL A;  3RAX A;  4UQG A;  4BXO B;  3H8J A;  2Q4T A;  2AGQ A;  2F1J A;  1YZ6 A;  3RH6 A;  4OJ5 A;  4DSI A;  5KFS A;  2YMP A;  4C8N A;  4NM2 A;  5J2B A;  3MFI A;  3UXP A;  5D49 A;  5J0S A;  3GIM A;  2KFZ A;  3NAS A;  4DS5 A;  1Z00 B;  2KZ3 A;  4YD1 A;  1U4B A;  1WUD A;  4DF8 A;  4XA5 A;  1P7D A;  3OSP A;  4LVS A;  4DEZ A;  4NXZ A;  1URJ A;  1J2N A;  2W9A A;  4RNN A;  3H7I A;  3RJH A;  4C4S A;  3RB4 A;  3RH5 A;  1T3Q A;  4B6J A;  4ECX A;  1KQQ A;  3WK6 A;  2FDR A;  4YR3 A;  1S5L U;  3QUC A;  4Z6D A;  1Z4O A;  3LWM A;  4DSK A;  7ICL A;  2DBY A;  2W54 A;  4IC9 A;  4DO9 A;  1N48 A;  9ICJ A;  1RM6 C;  4PGY A;  1ZQK A;  4DL4 A;  1TAQ A;  5DDY A;  4DQI A;  2ESE A;  3PR5 B;  3PO4 A;  4P0P B;  5AKH A;  4IRD A;  4I27 A;  4RT3 A;  3QU4 A;  3SV4 A;  2RLT A;  3MC1 A;  1ZD3 A;  2QAR B;  1X9X A;  2KHV A;  4UBC A;  1ZQH A;  2W7O A;  4F5O A;  4J9S A;  3PO5 A;  3WK7 A;  2BPF A;  2M9N A;  4RPX A;  4Z6C A;  4CF3 A;  2FPM A;  1BNP A;  4XUS A;  4KMO B;  2H3Q A;  1ZQT A;  4O3Q A;  4F3O A;  5HR6 A;  2OYY A;  3OPX A;  4IR9 A;  1KBU A;  8ICB A;  4F2S A;  5J0P A;  2BQU A;  3Q8L A;  3KZX A;  2FMP A;  3S6J A;  2ZTC A;  3OSN A;  4QZG A;  1QQ7 A;  2IA6 A;  2YTU A;  4QZD A;  3UMG A;  1ZRN A;  3F2D A;  1H38 A;  4Y2Y A;  2ES6 A;  4PL1 A;  1KKX A;  4QZE A;  4BWM A;  2EZX A;  1O03 A;  1NK4 A;  4QNL A;  4QIW C;  5KFQ A;  8ICJ A;  3EPG A;  2ALZ A;  3SEI A;  5F3X B;  1T8E A;  7ICK A;  3KTQ A;  1JI7 A;  1ZQR A;  2ZUC A;  3SAF A;  2GLE A;  5J2H A;  1ZD4 A;  5HMM A;  3PSF A;  4QZ8 A;  3GIL A;  1NJY A;  5T14 A;  5EWE A;  1KSP A;  2AQ0 A;  1NI3 A;  4QWE A;  4ED8 A;  5J2K A;  2F3N A;  2ZIV A;  4LZD A;  3SQI A;  1NK7 A;  1BVS A;  9ICP A;  4EYI B;  1SIJ A;  3WU2 U;  1N5W A;  5F9L A;  1VLB A;  4YN4 A;  4QZF A;  5KG3 A;  2R18 A;  1WCL A;  3HJE A;  4RQ0 A;  1Q3V A;  1NJX A;  1QSS A;  2AHO B;  4P0Q A;  2MUT A;  7ICQ A;  4DFD A;  7ICN A;  4OD0 A;  4R8U B;  3QZ8 A;  3RJI A;  5ALQ A;  2EAO A;  1DK3 A;  5KNI A;  3KHL A;  1BGX T;  2AJQ A;  4FBT A;  3BS5 A;  4IRC A;  9ICC A;  4RPY A;  2QLT A;  3TFR A;  5J8Y A;  4Y2J A;  1X6I A;  3BQ7 A;  1S9F A;  9ICN A;  3FYH A;  1JIH A;  3SAG A;  5ALE A;  2I9G A;  4IR1 A;  3SI8 A;  2MU2 A;  2LPE A;  7ICF A;  9ICG A;  3LK9 A;  1KLN A;  3WK9 A;  2KIW A;  4BGD A;  4Q43 A;  4C80 A;  4DQQ A;  2R8G A;  8ICM A;  4U6P A;  3LVV A;  2YB1 A;  1UHU A;  5B66 U;  2Y0S C;  4KLH A;  2KV2 A;  3QXG A;  2YY6 A;  1TV9 A;  2K4I A;  1K1S A;  1SXD A;  1K1Q A;  5AI0 A;  3L5K A;  4HYK A;  3GU3 A;  3QU5 A;  1ZJN A;  1IV8 A;  4M6W A;  4UAU A;  2OWO A;  2V4Q A;  2XGP A;  2G06 A;  3TAD C;  2PMZ F;  2ZIW B;  2JH1 A;  1N5X A;  4RQN A;  1SV4 A;  4YG2 A;  4EEY A;  1UCV A;  3KFU F;  4QWA A;  2HSZ A;  4CGZ A;  1FFV A;  2P35 A;  5GTI U;  3C1Y A;  1RQL A;  3QE9 Y;  1ZET A;  4GLX A;  1MQ3 A;  3M6Z A;  3NVV A;  4QW9 A;  8ICV A;  5ALL A;  3PML A;  9ICE A;  4M9J A;  2KJ9 A;  1JXE A;  1A77 A;  4KLM A;  3V6K A;  5J0O A;  4F92 B;  4DFK A;  2ZUD A;  2WTF A;  3KHR A;  8ICG A;  2KZM A;  5KFN A;  2NV3 A;  2GH1 A;  5AI9 A;  4M9G A;  3NRW A;  3TAP A;  3FM9 A;  3N97 B;  4YP3 A;  5DDM A;  2J6U A;  1JAL A;  3UMC A;  2LYB A;  1N63 A;  4PZO A;  4Y2X A;  3TAN A;  4EYH B;  3UQ2 A;  1S0M A;  4BDP A;  5G5H A;  3N7S C;  3CP8 A;  5ALS A;  4MHV A;  4DCC A;  3V6H A;  2BPG A;  1NOM A;  3RFA A;  1YT3 A;  1X42 A;  1JN3 A;  4PJ0 U;  3T5H A;  4QZH A;  1SWW A;  2BCQ A;  3N28 A;  3HKZ C;  3EUB 2;  1T94 A;  4FE3 A;  7ICM A;  1T7P A;  4EEL A;  5J2F A;  5HP4 A;  2ZIU A;  1PVR A;  3FDS A;  3MDA A;  3KHH A;  5KFE A;  4HAI A;  3H8W A;  2XY7 A;  2MSN A;  1TAM A;  2W9M A;  3B9J A;  5F9N A;  4I2G A;  1DRG A;  2ZXI A;  1QLN A;  4C4T A;  1KW4 A;  4ELV A;  3QUT A;  3RBE A;  5KTQ A;  7ICJ A;  4PGX A;  4UAW A;  5J0R A;  2KTQ A;  8ICI A;  5HNK A;  2YMM A;  4UB5 A;  2OHF A;  1ZQF A;  4J9N A;  4M9N A;  2W8L A;  1ZD2 P;  2XY6 A;  1OXJ A;  9ICA A;  4F8R A;  4I2A A;  3PSP A;  1S97 A;  4KLL A;  3PMN A;  2WF9 A;  3PX0 A;  1U49 A;  1D8B A;  3H0R B;  3QYP A;  3HW8 A;  1OW5 A;  8ICS A;  1X6J A;  3WKD A;  1BNO A;  3T79 A;  1LKY B;  5KFG A;  1FEZ A;  1L7N A;  4UB2 A;  1ZXI A;  2DKX A;  3JPT A;  5IIO A;  3BDP A;  2JEI A;  3F5E A;  3ISC A;  2CRX A;  4QW8 A;  1NK0 A;  4B9U A;  3T5L A;  2HBJ A;  9ICR A;  4YXM A;  2H5X A;  5L9X A;  2JHD A;  4CF4 A;  4PHE A;  2K8C B;  2F76 X;  2BCU A;  5KFC A;  4JMU A;  2ZJ5 A;  4YXJ A;  4KIT B;  3T3F A;  4EEK A;  1NK5 A;  3IP4 B;  1PVP A;  3A0B U;  2EZY A;  2XC9 A;  7ICV A;  3GV8 B;  2A19 A;  2R8H A;  4ECZ A;  7ICI A;  3D2Q A;  9ICM A;  4KLS A;  3T5J A;  3UPQ A;  4O3O A;  7ICG A;  1NK8 A;  2FLN A;  2LHT A;  3TFS A;  4M04 A;  4GC6 A;  4CF5 A;  2NO5 A;  5G5G A;  5A0L A;  2WF6 A;  2Y9T A;  4FO6 A;  1B43 A;  2MA1 A;  3IG8 A;  4OCZ A;  3JPP A;  2D3D A;  9ICK A;  3QZ7 A;  5J2G A;  1S10 A;  3FC4 A;  3RF9 A;  4EBD A;  5L1L A;  5IIM A;  9ICH A;  2YB4 A;  1QSL A;  3ETR A;  2GOL A;  8ICU A;  5DB8 A;  5GTH U;  4YD2 A;  2ATL A;  3UMB A;  1ZQP A;  5H2F U;  3V7J A;  4ZH4 A;  1Q8K A;  2W8K A;  1D8Y A;  4PPX A;  3EW9 A;  5AI5 A;  2R8K A;  3D2S A;  4C7Z A;  4Z6F A;  2NRW A;  1ZQS A;  5J2J A;  3BQ2 A;  2KIV A;  4G3I A;  2XGQ A;  2A3V A;  2HW3 A;  1L3S A;  4RQM A;  2V9W A;  2RDJ A;  1NJZ A;  4F4W A;  4DFM A;  3T5K A;  2UVR A;  4ECY A;  2MRL A;  2W7P A;  3KKA C;  2BPC A;  4UAS A;  1ZQY A;  3LWL A;  1QH9 A;  4DLG A;  3TAD A;  4DQP A;  2QKQ A;  5DQG A;  3ICX A;  2W43 A;  5AKZ A;  5ALY A;  1WWU A;  4O5K A;  1WCN A;  1DK2 A;  2ODG A;  1MQ2 A;  3TI0 A;  2LYA A;  3OGU A;  5DKW A;  5HR7 A;  2KKV A;  3AU2 A;  3KBB A;  4RZR A;  3M6K A;  4ECR A;  2ISO A;  3Q8Q B;  3N7R C;  3EYZ A;  3PX6 A;  3RB3 A;  5L1I A;  4RQ2 A;  1V85 A;  8ICY A;  2ZIX B;  4M9H A;  4RNO A;  2OH2 A;  4KLO A;  3V72 A;  4AYB C;  4KLI A;  2EH9 A;  5ALX A;  4M47 A;  4R65 A;  2NRV A;  4KN7 A;  1S76 D;  5KT2 A;  1N62 A;  2LMR A;  4UB8 U;  5KT3 A;  4DF4 A;  2AGO A;  4K4G A;  2NRT A;  5KFB A;  4YMO A;  4LJX A;  3H4B A;  5KT6 A;  3ED5 A;  1NJW A;  1DOQ A;  3H8S A;  4FS2 A;  2N1R A;  1QTM A;  2HOQ A;  3C28 A;  5ALH A;  4NJ8 A;  2LM4 A;  4ECT A;  2WB1 C;  2WFA A;  1LV5 A;  5L1J A;  3CRX A;  5AM3 A;  4UB6 U;  2K8B B;  5KT5 A;  5DQI A;  8ICH A;  8ICT A;  2Z7J A;  4OJ6 A;  4DSJ A;  3C2L A;  3RB0 A;  4J03 A;  2LYH A;  2YML A;  5DB9 A;  4O3S A;  3WKC A;  4ECU A;  4G9B A;  5AKK A;  1DXS A;  2NRZ A;  2C28 A;  2BCR A;  4EBC A;  3NTU A;  1Z1B A;  2K89 A;  4PL2 A;  4UB1 A;  4R8U A;  2HBM A;  3NUQ A;  4I28 A;  4NLB A;  3PVX A;  2W9B A;  2PFP A;  4JK1 A;  2QB1 A;  5JTI A;  3MBY A;  1SZP A;  5J0Y A;  3F2B A;  4I2H A;  3IG5 A;  2CN1 A;  1FO4 A;  3HIL A;  3MAB A;  1U47 A;  1RYU A;  4DL2 A;  3PSI A;  4QZ9 A;  2ASD A;  1SV0 C;  1UT8 A;  2HHQ A;  1MSW D;  4F5Q A;  4P2H A;  1JXL A;  2PXI A;  1XS9 D;  2LBO A;  2DL0 A;  1KDH A;  2ASL A;  3MFH A;  3ORY A;  2J6T A;  3DDH A;  2JGA A;  4NLZ A;  2LKY A;  4ED6 A;  1KFT A;  1ZQC A;  4ECV A;  4RUA A;  1L7O A;  5CP2 A;  5KFD A;  2C2E A;  1SL1 A;  3NVW A;  5JRT A;  2K60 A;  2XCP A;  3TAC B;  5AKI A;  5ALZ A;  3GIJ A;  3WKB A;  1MN8 A;  2K8A A;  3G6V A;  2A1A A;  3MGV A;  3MDC A;  5AKY A;  3AUO A;  4DS4 A;  2ZG6 A;  3ZI4 A;  1QQ5 A;  2BZF A;  1X66 A;  4I2F A;  1S0O A;  3PW7 A;  2IBK A;  4LZG A;  4BJQ A;  3ZDE A;  4FBU A;  2WF7 A;  1WG8 A;  3NGD A;  1IIP A;  4BX9 C;  4Y2U A;  4KLD A;  3IHQ B;  8ICA A;  5AM0 A;  4OO1 J;  4O9M A;  3UXO A;  2OCE A;  2DGZ A;  4RUC A;  1IG6 A;  5AK6 A;  2KVS A;  2W03 A;  2KN7 A;  1RXV A;  5CEH A;  2KJ8 A;  5KFH A;  4RNM A;  1L3V A;  3MGI A;  1NKC A;  4RQ6 A;  4FZM A;  4C8K A;  3RJG A;  1TFR A;  2R8I A;  1FIQ A;  4FS1 A;  5C0Y A;  5DG7 A;  1SKW A;  3HX0 A;  5EWG A;  5KFW A;  1HEK A;  5DLF A;  3SEN A;  5CJ7 A;  3ZDD A;  2P6U A;  3QEA Z;  3SMV A;  4UW9 A;  2VA2 A;  3EPI A;  1PZN A;  3Q8M A;  2K4H A;  1KN5 A;  2LI6 A;  1M6Y A;  5TZV A;  1ZQN A;  1NK6 A;  2JZB A;  2ISP A;  1RDF A;  2E8N A;  2Q0Z X;  2HHT A;  4ECQ A;  3AM9 A;  2F44 A;  1COO A;  3N7P D;  2VAN A;  4B9T A;  4JUZ A;  8ICF A;  3JPR A;  4FZN A;  1A76 A;  1SZH A;  2DKZ A;  4Y2R A;  5AI6 A;  3C1Z A;  5KFA A;  3RBD A;  1F44 A;  5HHI A;  3B0X A;  4QZC A;  3H4D A;  5KFU A;  1ZQL A;  1VJ5 A;  3V6J A;  1TE2 A;  5ALK A;  1TK5 A;  5AK4 A;  2ZIV B;  1T3N A;  1L7P A;  4GIB A;  3K1R B;  4DFP A;  1ZQA A;  4NLG A;  4ICA A;  4NV0 A;  5AM1 A;  2M0N A;  2A1J A;  3KKA A;  1D9D A;  8ICP A;  3RJF A;  3KD3 A;  2PFQ A;  1ZQV A;  1ZQJ A;  5KT7 A;  3E58 A;  3CNH A;  1BPE A;  3SR6 A;  2UVV A;  4RQ4 A;  9ICB A;  5ALI A;  2KIC A;  1PK3 A;  4P0Q B;  2XCA A;  4MFA A;  5AIC A;  3QUB A;  1JRO A;  3C2M A;  4F4Z A;  2DUY A;  3LYS A;  4UAZ A;  2F8K A;  4C8M A;  2HVH A;  2HHU A;  3CYM A;  3PX4 A;  2D6F C;  2KE7 A;  4Q8E A; 
#chains in the Genus database with same CATH homology
 1ECW A;  4CDG A;  1OUQ A;  2W03 A;  3F2D A;  4OJ5 A;  3RFA A;  1YT3 A;  2G08 A;  4PL1 A;  1XO0 A;  2JHD A;  4U6P A;  3F5A A;  2KJ8 A;  2ZIW A;  2RHF A;  4QIW F;  2K8C B;  2F76 X;  3HKZ F;  4ACO A;  2H3V A;  4JMU A;  2K89 A;  4QNL A;  1Z1B A;  3LVV A;  3D2N A;  2ZIX A;  3ICX A;  4PL2 A;  4FZM A;  4QIW C;  3F2C A;  2Y0S F;  3HKZ C;  4FZL A;  2VJ5 A;  3M7D A;  4O3M A;  2HBM A;  3NUQ A;  3PZP A;  1T94 A;  1WUD A;  3IP4 B;  2YB1 A;  4FE3 A;  2G09 A;  4NLB A;  2Y0S C;  5C0Y A;  1PVP A;  1P7D A;  2E5S A;  2KV2 A;  2JH7 A;  1HIW A;  1HEK A;  2K4I A;  4BUG A;  3SAF A;  4KX5 A;  3F2B A;  3ONN A;  2LYA A;  1L6N A;  3H0M B;  3IG5 A;  2KKP A;  1URJ A;  2ZIU A;  3D2Q A;  2DF4 B;  5HR7 A;  3GU3 A;  2KKV A;  1PVR A;  3SMV A;  2CN1 A;  1ED1 A;  4WJ3 B;  3M6K A;  3PST A;  3PSF A;  1XNS A;  2KJ5 A;  2K4H A;  5T14 A;  1TAM A;  2LHT A;  1Z19 A;  3N7R C;  4P0P A;  2G06 A;  2HBK A;  4A8E A;  3PSI A;  2PMZ F;  2ZIW B;  3DEE A;  2JH1 A;  1DRG A;  4U7C A;  5A0L A;  2ZXI A;  3VC8 A;  2PMZ C;  2KD1 A;  2ZIX B;  4NWI A;  4C0Z A;  2ZIV A;  3N7P D;  2RP5 A;  3SQI A;  2OH2 A;  2MA1 A;  3IG8 A;  2VJ4 A;  4AYB F;  2CPR A;  2JMG A;  3E0F A;  3GZF A;  2KVC A;  4FZN A;  2LBO A;  3KFU F;  4OJL A;  3LVW A;  4CGZ A;  1SZH A;  4AYB C;  4IC9 A;  2DQN B;  3SAH A;  2K4E A;  2JGA A;  2G0A A;  3O0F A;  5KL8 B;  3C29 A;  2HOI A;  4CRX A;  2ZIU B;  2HOF A;  2LKY A;  3RF9 A;  1F44 A;  3F53 A;  2KNJ A;  2KHQ A;  2R18 A;  3M6Z A;  2YB4 A;  4OJP A;  1Q3V A;  1MA7 A;  2GOL A;  3IN5 A;  4P0P B;  2F8L A;  2KJ9 A;  1Q3U A;  4P0Q A;  2W04 A;  2WAQ F;  4GFJ A;  1A6S A;  3PSP A;  3K1Z A;  2H3F A;  1NZB A;  1A0P A;  2K8A A;  2ZIV B;  3MGV A;  2N1R A;  2WAQ C;  2OXO A;  2XI9 A;  2KHV A;  2HOQ A;  4NLC A;  1UPH A;  3C28 A;  4ICA A;  2E1E A;  4NV0 A;  2W7O A;  2NV3 A;  2GH1 A;  2H3I A;  2WB1 F;  3H0R B;  2M0N A;  3NRW A;  1D8B A;  2G5H B;  2G5I B;  2ZG6 A;  3D2S A;  3VCB A;  4OJO A;  2HBL A;  2WB1 C;  2VIX A;  1ZQ1 C;  3H0L B;  2XID A;  1PVQ A;  5KL1 B;  2YX8 A;  2ZXH A;  4KMO B;  2F2A B;  4BJQ A;  2BDU A;  2VKQ A;  3CRX A;  2F77 X;  2H3Q A;  2LYB A;  2HMX A;  3T79 A;  2K8B B;  2XVT A;  3AQE A;  5HR6 A;  2OYY A;  2RRD A;  3OPX A;  3SAG A;  2G07 A;  2KIC A;  2A3V A;  1KBU A;  1IIP A;  4P0Q B;  2Z7J A;  4OJ6 A;  2E1F A;  2KEY A;  4BX9 C;  3L3F X;  4QJF B;  2XIC A;  3F5E A;  2CRX A;  3AL0 B;  3LYS A;  3KZX A;  4OO1 J;  2KOB A;  3N7S C;  1CRX A;  5CRX A;  2DGZ A;  2OM6 A;  1GO3 F;  3ALR A;  3CP8 A;  2H3Z A;  3CYM A;  4KX3 A;  2D6F C;  2Q4T A;  2KIW A;  2HBJ A;  3AQF A;  2MRL A;  2W7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...