2QB1A

2tel crystallization module
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
SIALPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E80-TELSAM domain
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
total genus 19
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qb1A00
3KKAA 3K1RB 2E8NA 2QB0B 2QKQA 1SV4A 3KKAC 4NL9A 2QARA 2EANA 2ESEA 3IDWA 5J8YC 1X66A 2DKZA 2YTUA 1RG6A 2QB1A 2EAMA 2LMRA 1UCVA 1SXEA 1JI7A 2E8OA 1OW5A 2E8PA 2DL0A 5KNIA 3BS5A 1B0XA 3TADC 2K60A 3TACB 5J8YA 2DKXA 1Z1VA 4PZOA 2L5YA 5F3XB 2KG5A 4IS7A 5JTIA 1PK1A 4RQMA 1V38A 1F0MA 2E8MA 3TADA 2QARB 3SENA 5L1MA 2K4PA 4MHVA 1PK1B 4NJ8A 2Y9TA 1V85A 2LPEA 1B4FA 5JRTA 2EAOA 3HILA 2KSOA 1LKYA 2KIVA 3BS5B 2QB0A 2ES6A 1KW4A 1X40A 1PK3A 2JV3A 1WWVA 1LKYB 2Y9UA 4RQNA 1WWUA 1X9XA 1SV0A 2D8CA 2F3NA 5JU5A 2F8KA 1DXSA 1SV0C 3BS7A 3H8MA 1UQVA 2GLEA 2KE7A 2EAPA 2B6GA 1OXJA 2FE9A 2KMDA 3SEIA 1SGGA 1COKA 3BQ7A 4NL9C 2F44A 1SXDA 2KSOB 4PZNA 2D3DA
chains in the Genus database with same CATH superfamily
2DWQA 2M0NA 5J2CA 4DOCA 2K89A 5KFKA 2IOHA 3AU6A 4LZGA 3GZFA 3MR2A 4RNMA 5D46A 4Q45A 3OHBA 1A0PA 2B0CA 2VIXA 1ZD3A 2XY5A 2Y1JA 2ZJAA 5KFSA 2HHXA 2MSNA 5KL1B 4YD1A 3WKDA 2E8OA 4DQIA 3PSFA 5AI9A 5KNIA 4ZOHC 5AKYA 4DWIA 2IBKA 5HMMA 2V9WA 4YXJA 2EDUA 2XICA 1BNPA 3G6YA 2IMWP 3ICXA 2W8KA 2KIWA 2OEHA 2OHFA 4OJ5A 1ZD5A 3F53A 2H3ZA 1BGXT 4J9QA 2E8MA 4KLMA 1S8OA 2E5SA 3NVVA 5KFEA 4MHVA 1PK1B 4NJ8A 7ICSA 4JK1A 5JRTA 4EENA 4DQQA 2WF9A 3K75D 3PSIA 3IHQB 1NKBA 2HBLA 1A77A 4M9LA 3WK6A 4IC9A 2BQRA 3RRGA 2OCEA 3NVZA 4QZAA 1SL2A 4BGDA 4FZNA 3R9KA 4P4MA 3KHLA 5FP0A 2R8KA 2D8CA 4EX6A 4BDPA 1AROP 2NRXA 2IA6A 3H8MA 5DG7A 4UB6U 4DL2A 1ZQEA 3AUOA 3F2CA 1JXEA 4ECRA 7ICRA 2RHFA 2PFPA 2ZTDA 1L7MA 4NY8A 4ECYA 1S9FA 1NZBA 3LK9A 3B9JA 5J0WA 4QWAA 1ZQRA 5DQHA 4QJFB 4QZ9A 1ZQFA 4B9LA 2IOFA 2JEFA 4HAIA 2EANA 2YQEA 3N7SC 4X5VA 3ZDDA 1QQ7A 5KFHA 3D2NA 5F9NA 2K8BB 1LV5A 3PV8A 2NRVA 3ETRA 1L3TA 3UMBA 8ICRA 4YMOA 4F4WA 2IHMA 1B0XA 4QZCA 3G6VA 3M9OB 4EYIB 1D9DA 1KSPA 3GIJA 3RR7A 3GV5B 1T4GA 1PK1A 2RDIA 4RQMA 1V38A 3BZCA 1HJPA 2JEGA 2ZJ5A 5CWRA 4OJPA 4PH5A 3SENA 3V72A 1OUQA 2W9BB 4LVSA 4PHAA 3HILA 2JH1A 1LB2B 1MC8A 3PO4A 1TAQA 1SL1A 2KIVA 2FDRA 3M6KA 2EQYA 5J0QA 1YZ7A 2OM6A 1FFVA 8ICKA 1PK3A 5DBCA 4HYKA 3QUQA 2F1HA 1DXSA 1ZQPA 2H3QA 3SYZA 2YMQA 1UQVA 3QX7A 4QWDA 4J9SA 2JGAA 2HOIA 2XGPA 1JROA 1BPEA 4PHPA 5B66U 4C7ZA 4YQWA 3L3FX 2WHEA 4M2YA 5CA7A 3ZDEA 4F4KA 3WK5A 4E0DA 2UVWA 3V7KA 5DGBA 1SZPA 3ONNA 4Q8FA 1KQQA 3I1YA 1D8LA 1L3SA 1IXRA 2HSZA 5J0RA 2NRZA 1D8BA 5J0YA 2CRXA 3LYSA 3WK4A 4I2IA 4PHEA 3M8RA 5KFXA 1ZXIA 5ALXA 3RAXA 9ICRA 3BS5A 3AM9A 2YMPA 2C2EA 3HP6A 3NTUA 4J9OA 2C2RA 1KBUA 2BZFA 4EEKA 4F5RA 4IRCA 4Q8EA 3GFKB 3AQEA 4MF2A 1PZNA 1VLBA 3TFRA 2KOBA 2WF6A 4EZ6A 3QUCA 4FZLA 2YB1A 4FO6A 3HPOA 3E0FA 1NNLA 2KSOA 4TUPA 1NKEA 1IG6A 4DQPA 2FMQA 1TKDA 2E1EA 3C2MA 7ICKA 4DFPA 2W9MA 4F4XA 3DDHA 7ICIA 7ICOA 2H3IA 1ZQDA 5JU5A 4Y2QA 2AJQA 3PY8A 2HVIA 1FO4A 2W9CB 1ZQIA 2A1JB 5TISU 1HEKA 3MGHA 5DBBA 2UVUA 5AM0A 2BQ3A 1OXJA 5KL8B 3SEIA 4BXOB 1COKA 1ZQNA 2JMGA 3NGDA 1WYGA 4GXIA 2KHVA 2EH9A 3RF9A 4C80A 3GDXA 8ICIA 2GH1A 4R63A 5CEHA 4ELUA 2QLTA 4EYHB 5AI0A 2NO4A 4UAZA 1ED1A 1MQ3A 3H0RB 5L9XA 5DG8A 5EWGA 2C28A 4TUQA 9ICSA 3SAHA 1L6NA 2F1JA 3MDCA 4Y2PA 1S0OA 1RG6A 2F2AB 4ECWA 4I28A 2H3FA 4GXJA 2E8PA 1ECWA 3PSTA 5ALGA 1NJWA 5ALQA 1B43A 5AK3A 4DSIA 3PSPA 1JIHA 2FMPA 4CF3A 1RZTA 2BQUA 5J0SA 3FM9A 5KG6A 2AH5A 4GXKA 1DGSA 3D2SA 3H8WA 5ALIA 4O3MA 1BPZA 3CRXA 3OPXA 2EAOA 3UXNA 4NLKA 1KFTA 5D4BA 4UB1A 2ZTCA 3SMVA 1ZQCA 3PW0A 1Y88A 2QB0A 4BWMA 5TZVA 3IN5A 2WF5A 4O5KA 4O5EA 1TK8A 4KN4A 1Z1BA 2BCVA 5T14A 2W9CA 2A1JA 1J2NA 1TAUA 1PVPA 1QH9A 2OXOA 3SAFA 4BXOA 1UPHA 3NVYA 4UAWA 2ASLA 1IM4A 2Q4TA 1Z4NA 3JPOA 3BQTA 3GV7B 4KLOA 5AKJA 5ALNA 4B9VA 4FE3A 4KLLA 2HBJA 5KFLA 4P4PA 3BJYA 5HHIA 3M7DA 8ICEA 3M9MB 1PUZA 3QUBA 4J03A 4F93B 3ORYA 1N63A 5KT5A 2DPIA 2QKQA 1SV4A 4GC6A 5KFCA 1PVQA 1XWLA 3WKAA 3T5LA 3E58A 2W11A 2G5IB 2ZIUA 1WG8A 3IDWA 4UB5A 5IIIA 1HIWA 4QZHA 5KFYA 2VJ5A 2W7OA 4ICAA 1JMSA 3MFHA 4I2DA 2JEIA 4UAYA 4CF5A 7ICUA 3A0BU 1KDHA 3HJEA 4RQ3A 2LHTA 2Z7JA 3QEBZ 5KFOA 4C8NA 2LM1A 5ALUA 5AK4A 3HT3A 4U6PA 2B21A 1S0VA 4UAVA 2ISOA 3C1YA 4NLGA 2EZZA 3KBBA 4K4GA 4IRDA 1JXLA 5KG0A 4NWIA 4GC7A 1DGJA 2XIDA 2HHUA 3ED5A 3AN1A 8ICAA 2KKPA 3QZ7A 2AQ4A 3EUB2 3FDSA 2HHWA 3C5FA 2BPCA 5AM1A 5J2DA 1XSLA 4MFFA 2XCPA 2KN7A 5IIJA 4Y2RA 3H0LB 2GLEA 1S0MA 4DEZA 2B6GA 3RTVA 2K4EA 2OWOA 3AMZA 5KFBA 3M1YA 4Y2TA 2HBKA 4FS1A 5KT7A 1F44A 5KFWA 1QTMA 2JHDA 3A0HU 4OD0A 4DFJA 8ICWA 1J2MA 2P35A 4B9TA 2W8LA 2YMMA 1UT5A 5EE3A 4ECUA 2AGOA 3NS1A 4C4SA 4EELA 4Y2VA 3RJGA 2NV3A 2KK0A 5J2EA 3RJJA 3C21A 2K4IA 2LMRA 2MRLA 1DOQA 4O5CA 3PR5B 2M9NA 1ZQTA 4C8KA 5EE0A 2KEYA 1JALA 3MABA 1S10A 5ALJA 1N2XA 2FPMA 3ZD8A 5F3XB 3RBEA 5KT6A 1L8OA 4GIBA 2HW3A 2IOFK 4C8MA 4KITB 2PFNA 3LVVA 3RB4A 1SZHA 3ZDAA 3G6XA 3MFIA 4CCHA 5C0YA 4KLJA 3OSNA 4RT2A 4YR2A 3PR4A 5L1LA 3IP4B 4M9NA 4UATA 2JZBB 3V6HA 5KFUA 1HUZA 3PX4A 2MU2A 3GIKA 4RQNA 2WFAA 1X9XA 1XNSA 4Y2SA 4ED1A 3ISBA 3N4MB 5DB6A 8ICCA 2K8AA 5AKZA 5KFZA 1DK2A 1CEZA 1RXVA 1UHUA 8ICUA 4QZFA 5J0OA 4EZ9A 3FC4A 4IR1A 3BQ7A 3RJEA 4P0PB 4M6WB 5ALWA 1VDVA 1TK5A 3TQ1A 1SIJA 2D3DA 1Z00A 3F5AA 3RJFA 2KVSA 5J0UA 9ICCA 1N62A 2KHQA 3ISCA 5KG1A 3F5EA 4QWBA 5AK5A 5J29A 4A8EA 4YVZA 2W55A 2LKYA 4DL4A 5AKEA 3C5GA 2W3RA 1N60A 5ALLA 3B0YA 3Q8KA 3MBYA 4JV0A 2XCAA 4IQUA 1SXEA 2BDPA 4UBBA 4DFDA 5AK6A 4K4HA 3TADC 5KFQA 4BUGA 9ICEA 5D49A 2CPRA 3K1ZA 2VA2A 3S6JA 3OSPA 1AQ6A 2JRZA 5AIBA 2PFQA 3RB6A 1PVRA 2FLPA 3ZI4A 1F0MA 5KFRA 3TADA 4DL5A 2RLTA 4Y2UA 3RR8A 2AGQA 2AU0A 2C22A 4GLXA 3LWLA 1V85A 3KTQA 1ZQWA 2YMLA 1RPLA 1S5LU 4RNOA 2JZBA 3AU2A 3MGVA 4UB4A 4I29A 3UM9A 3JPNA 4F71A 4I2FA 2DFLA 4ED8A 3TAQA 2FLNA 4QW9A 3BS5B 2BDUA 5B5EU 2J6SA 1XO0A 4DSLA 1FIQA 1WWUA 3QUTA 4DSFA 1KLNA 4O0IA 1NK5A 2F3NA 5DQGA 4ED7A 9ICBA 4P0PA 2R18A 3KOOA 4M6WA 1RQNA 3Q8RB 4O3RA 1NOMA 4J9LA 5DB7A 3WKEA 2KZ3A 3Q8PB 4RT3A 1X2IA 4JB3A 4J9KA 2LYBA 2NYVA 2F44A 1ZQQA 4NLNA 1DRGA 2KSOB 2XVTA 5DKWA 3LWMA 2ZUBA 2WTFA 3TAPA 4M9HA 2R8IA 9ICNA 2PKEA 4RQ2A 4C4TA 4EBEA 9ICTA 7ICLA 5J2BA 8ICLA 1NZPA 5ALYA 4U7CA 2R8HA 1ZD2P 2I5HA 1VJ5A 1XO1A 5HHHA 4MF8A 5KFAA 4YR3A 1UCVA 5CRXA 1MA7A 2DL0A 4RUAA 4O3NA 5KFVA 3Q8MA 4AP9A 5KFNA 4KLSA 4F50A 4RPZA 1N5WA 4IS7A 4RQ0A 1ZRNA 3JPTA 4Q43A 2YY6A 5G5HA 4KLUA 3H8JA 1WCNA 2LI6A 2K4PA 1GO3F 3UXOA 2HHVA 1U45A 1B4FA 1BPBA 3DEEA 1ZJNA 2K8CB 3IM1A 1YT3A 3JPQA 3LVWA 9ICGA 1URJA 3SI8A 4K4IA 5HNKA 1LKYB 2W9AA 1FFUA 3CNHA 3EZ5A 4Z6FA 1NI3A 3RJHA 2FLLA 2PMZF 2F8KA 3QU9A 2RQ5A 8ICSA 3TARA 4J9NA 9ICFA 5KAIU 2KE7A 1ZD4A 4UASA 1K1SA 7ICNA 3C23A 3IV6A 4F2SA 1ZQOA 2KJ9A 4UB2A 9ICPA 3KKAA 4YXMA 1COOA 5AIAA 2EZYA 3M9NB 2QB0B 4MEYA 4QW8A 1SL0A 4Y2YA 5K4LA 4DQRA 1ZETA 5KFPA 3K4GA 2KVCA 5IIMA 1TFRA 4JUZA 1UT8A 2ESEA 1IIPA 2IHNA 1L5UA 1X66A 7ICPA 5DLFA 1RQLA 3Q8SB 1ZJMA 2P6RA 3HX0A 4DL6A 1KEJA 3QU7A 4UQGA 4OO1J 2K4HA 5ALRA 3OHAA 4F92B 4TQRA 3QE9Y 1ZRMA 4RQ4A 3I76A 5DBAA 2RDJA 4C0ZA 3GQCA 4YR0A 9ICWA 5BPCA 4PL1A 1Q46A 5HR7A 1X9SA 4ECSA 2ZIUB 5DQIA 2AXTU 3UPQA 2ATLA 2VJ4A 4IR9A 1TK0A 1ZQZA 1LKYA 2G0AA 5J0PA 4FZMA 2XO7A 2XY7A 5AKIA 1NK7A 1JRPA 9ICIA 4RQ5A 4I27A 3D6JA 9ICXA 3BQ2A 7ICHA 1XS9D 8ICMA 2W04A 1D8YA 4F72A 3U26A 4O3QA 2V4QA 2KFZA 1ZQVA 2DBYA 2ZXIA 1X9WA 3RB3A 2KZMA 1RM6C 5KFDA 2PMZC 1MQ2A 1NJYA 4B9MA 2G06A 4M0AA 4NL9C 3HWTA 3PMLA 1X6JA 1KTQA 1V97A 3M6ZA 7ICTA 1F5SA 2WF8A 3QU5A 4FBTA 4YMMA 3MR6A 5G5GA 4R65A 1QLNA 4RNNA 4NL9A 5IIKA 1ZOLA 1KRPA 2HI0A 2HOQA 2JEJA 2DQNB 8ICOA 5EWEA 5AI6A 8ICBA 4DOAA 5ALFA 1QQ5A 1KFDA 3M8SA 4MFCA 4YG2A 5KFMA 3D2QA 3N7RC 2DKXA 4PZOA 3E2EA 4RQ1A 1U47A 4US8A 4IL6U 2HBMA 2L5YA 4US9A 1S0NA 1QCKA 1O03A 2A1AA 4ELTA 4XA5A 1D9FA 4O9MA 9ICUA 1X42A 7ICEA 4RQ6A 4LJXA 4KLIA 4J9RA 5H2FU 3MGIA 3DV9A 4C7YA 3ZDCA 5ALHA 2H5XA 4PHDA 8ICJA 3MC1A 4RPXA 4RU9A 1X40A 3KHRA 1SB3C 3NVWA 2C2DA 2Y9UA 3WKBA 3OTQA 1RDFA 1HUOA 2ODGA 1SV0A 2ZUCA 5DB8A 3SZ2A 1L3UA 3F2DA 2DPJA 2GOLA 4O3SA 9ICOA 3T3FA 4CDGA 3N28A 4CE6A 1DK3A 1ZYQA 3GILA 5BOMA 2HHTA 4I2AA 4USAA 2WB1F 1SXDA 5ALSA 5ALKA 3KFUF 4XRHA 2I9GA 2BCQA 2OYYA 1SKRA 3RB0A 9ICMA 1O08A 3ZD9A 3KD3A 2ISPA 3EPGA 4DLGA 3QZ8A 5J8YC 8ICVA 3GU3A 1ZQXA 4IQTA 3OJSA 2DKZA 2VKQA 2QB1A 2EAMA 2KD1A 5C5JA 2G07A 8ICZA 1JI7A 4KLFA 1T3QA 2PI4A 1L7PA 2LBOA 1UA0A 2BCSA 2O6KA 3TACB 4C8LA 4NM1A 5J8YA 4ED3A 2W7PA 4NXZA 2DF4B 4C4RA 5A0LA 3KZIU 5DB9A 2JXJA 1Z00B 4QZ8A 1QSYA 1KN5A 1NK9A 5KG7A 3PW2A 5JTIA 4QNLA 5AKHA 3C2KA 4XUSA 2ALZA 5L1MA 8ICPA 4OJ6A 2BHNA 2LPEA 3PVXA 4XQ8A 3PZPA 2G09A 4ED0A 4JWNA 3PMNA 3EPIA 2I6XA 3N7PD 2GWSA 4KTQA 4Z6EA 5ALMA 2JV3A 3HW8A 3NRWA 3C1ZA 1CRXA 3TFSA 4KLTA 9ICLA 4CRXA 5KG3A 5J2GA 3TI0A 1L8LA 3HKZC 4KLQA 2NO5A 2W54A 5J2FA 3C2LA 4TQSA 5AM3A 4MFAA 4QZEA 4R66A 4NLZA 4BJQA 2NRWA 3F2BA 1QQ6A 2WB1C 2UVVA 3SV3A 8ICYA 3KHGA 4Z6CA 5ALVA 3CP8A 8ICGA 1SKSA 4ED6A 1K1QA 1BNOA 2BCRA 3JPSA 2PI5A 2QARA 3JPPA 2PXIA 2KICA 3EYZA 1SWWA 5EWFA 1IV8A 3T5KA 3N97B 5CB1A 4BWJA 1UA1A 3SR6A 3RH4A 2DUYA 5DDMA 4O3OA 2LM4A 4NV0A 4CGZA 3V6KA 4O3PA 4RPYA 3RFAA 4DSEA 1KFSA 4F8RA 3QNMA 3T5HA 3H8SA 4RZRA 1JX4A 3V7LA 3MDAA 4P0QB 3H7IA 4GFJA 3ETLA 1N56A 2HDOA 2MUTA 5KFFA 4J9PA 2BPGA 5DGAA 4DFKA 5AHXA 3Q8QB 3NASA 3J81j 7ICQA 4OJLA 2HVHA 2W43A 2AHOB 5EOZA 2BCUA 1QSLA 3H4BA 1U49A 1MSWD 4M9GA 1BPXA 2HHQA 4JWMA 1ZQLA 2G08A 4KN7A 5IIOA 8ICHA 1ZQ1C 2JR5A 5AICA 4C8OA 7ICGA 8ICTA 4YCXA 4M47A 9ICJA 8ICFA 1CI4A 4B6JA 2A19A 2VA8A 3BS7A 2LYHA 1BPYA 4ECZA 3BQ1A 4QZBA 1SWVA 2E3TA 3I28A 2KMDA 9ICKA 2ZIWB 3B0XA 3CYMA 3PW5A 2P6UA 2XI9A 4B9SA 3OGUA 2ZUDA 1K5OA 4IQVA 4F4ZA 4LZDA 5J2JA 4I2EA 2WAQF 1KL9A 2AQ0A 1N61A 4PPXA 3MR3A 4F5QA 5AKGA 3GV8B 5CP2A 4Q44A 3RAQA 5KFTA 4QWCA 1S77D 8ICXA 2XGQA 4ZH4A 2ZIVB 2AGPA 1T8EA 1LVHA 4R64A 3ZDBA 4R8UB 2BKEA 1NK8A 1FEZA 3IG5A 3C29A 4TURA 1L3VA 4P0QA 3QEAZ 2F8LA 3WU2U 4KLHA 2EZXA 1Z1VA 2BGWA 1NJXA 5ALTA 2VA3A 1JUDA 2KG5A 5AM4A 1H38A 9ICQA 4FBUA 1TVAA 3PW4A 5HR6A 2VANA 4ACOA 2R8GA 4I2BA 5KFIA 4M9JA 1U9LA 4P4OA 3QU4A 5J0XA 2ASDA 4I2CA 4RQ7A 4Y2XA 1ZQBA 4ECVA 2KFNA 2RRDA 4QZDA 3QXGA 3HRDD 3EWAA 3TKAA 1A6SA 1T3NA 4KX5A 3H0MB 2HMXA 3PW7A 3SAGA 1ZQHA 3ISDA 1WWVA 4CNQA 4UAUA 4ECTA 3WK9A 5CJ7A 3SD7A 1N48A 2XC9A 5J2KA 5J2IA 3AQFA 2ZIWA 3TANA 4F3OA 4P2HA 4OCZA 5ALPA 5CHGA 4DO9A 1T7PA 1KKXA 3QU2A 5L1KA 3UMGA 4RUCA 4QWEA 4IQWA 4EX7A 3RJKA 4BX9C 3H4DA 4PZNA 4KMUA 4EBCA 1Q8KA 1N5XA 1NJZA 4YN4A 3K1RB 4PGYA 4ED2A 9ICAA 5KT3A 1EXNA 7ICMA 3KKAC 2ZIVA 3LDAA 5BOLA 4R8UA 5AI4A 4NLBA 2WAQC 2UVRA 1J97A 2MAXA 3UXPA 5KT2A 4I2JA 3RBDA 2R8JA 4UB8U 3ALRA 2W9BA 4QZIA 4J9MA 3RH5A 3VC8A 5JUMA 4DS4A 2KNJA 4NM2A 1ZQMA 1OW5A 5AKLA 7ICVA 5J0TA 2YB4A 2FJ6A 3UMCA 2DGZA 1SKWA 1S97A 4DL7A 3QYPA 4B9UA 4PGXA 4EEYA 4M04A 5AI8A 5J2HA 3V7JA 1C7YA 2XY6A 2NRTA 4WJ3B 1L7OA 5CR0A 3CW2C 4JV2A 4JV1A 3RH6A 2Y9TA 1ZQGA 3OJUA 1MN8A 1XSPA 2V4RA 4DOBA 2FMSA 2D6FC 4DCCA 5E79U 2Q0ZX 5KG4A 3H40A 4I2HA 1KW4A 4F4YA 5KG5A 2PFOA 1T94A 3PO5A 2N1RA 2Y0SF 2KTQA 2KV2A 1Q3UA 2YX8A 4IRKA 3JPRA 2FPKA 2F76X 1Z3EB 2W3SA 3MR5A 4MEXA 4KMOB 4KLEA 1S76D 4EBDA 5GTIU 5KT4A 3RJIA 3PX6A 4DSKA 4DL3A 1RYRA 1XSNA 4JMUA 3NRZA 2I1QA 3IRUA 3PNCA 3V6JA 2ZXHA 1U4BA 1JN3A 8ICQA 3SV4A 5L1JA 2YN4A 3O0FA 4F5PA 9ICHA 1WCLA 4YP3A 4ECQA 2FI1A 7ICJA 1RYSA 3L4PA 2HCFA 3VCBA 2F1IA 3AL0B 4ECXA 1ZQYA 2K60A 4G9BA 4B9NA 3GIIA 5KTQA 2WF7A 4TUSA 2P66A 3FYHA 4DFMA 5AKKA 3PX0A 1Z19A 1Q3VA 5AKXA 5HMLA 3L5KA 4DSJA 1ZQAA 2ZG6A 2KZZA 4DF4A 4YFKA 3WKCA 1WUDA 1RXWA 3SQIA 1B22A 1V9PA 5DDYA 2BR0A 2JH7A 1NK0A 1ZQSA 1P7DA 3T79A 1Z4OA 2G5HB 2F77X 1YZ6A 7ICFA 2ES6A 4KLDA 1TE2A 3THVA 1TV9A 4DF8A 2ZJ8A 4OJOA 5AM2A 4QZGA 4KLGA 1TAMA 2Y0SC 4AYBF 1SV0C 5KG2A 2ZIXB 4QIWF 2KJ8A 2OH2A 4UARA 2RP5A 4FFDA 5ALDA 5ALZA 1L7NA 3BZKA 2FE9A 5HP4A 1X6IA 4NLCA 3HKZF 3FAHA 9ICVA 1NKCA 2E8NA 5GTHU 2ZTEA 1M6YA 2BPFA 1X9MA 3Q8LA 1U48A 5AI5A 1NK4A 2YTUA 4YMNA 2KKVA 3WK8A 5ALEA 5L1IA 2KP7A 3EW9A 5AM5A 5IINA 3GIMA 2A3VA 2HOFA 4FS2A 2HHSA 5IILA 1BVSA 4DLEA 1QSSA 4F91B 1RYUA 5J2AA 3NUQA 8ICNA 2E1FA 1ZQKA 4UB3A 1XC9A 4Y2JA 2KJ5A 1CUKA 4F5NA 2CN1A 2H3VA 5F9LA 2MA1A 3WK7A 2QARB 4Z6DA 4YD2A 5KFGA 5EE1A 2J6UA 4F2RA 4PJ0U 3UQ2A 2J6TA 5KAFU 4UBCA 3RRHA 5DG9A 4CF4A 3BDPA 4F5OA 5KFJA 4G3IA 3AEVA 2CXYA 2W03A 4PL2A 2LYAA 3KZXA 5ALOA 3IG8A 3KHHA 1A76A 4UW9A 5EE9A 2ZIXA 4KX3A 1C20A 1ZQUA 4PGQA 1BPDA 3T5JA 4ELVA 4I2GA 1XU4A 4DQSA 2MUTB 2GO7A 4RQ8A 2EAPA 1NK6A 2ASJA 4AYBC 1SGGA 4DS5A 4QIWC 5DLGA 2FPLA 2Y1IA 3C28A 3UQ0A 1ZQJA 3BQ0A
chains in the Genus database with same CATH topology
3KKAA 3K1RB 2E8NA 2QB0B 2QKQA 1SV4A 3KKAC 4NL9A 2QARA 2EANA 2ESEA 3IDWA 5J8YC 1X66A 2DKZA 2YTUA 1RG6A 2QB1A 2EAMA 2LMRA 1UCVA 1SXEA 1JI7A 2E8OA 1OW5A 2E8PA 2DL0A 5KNIA 3BS5A 1B0XA 3TADC 2K60A 3TACB 5J8YA 2DKXA 1Z1VA 4PZOA 2L5YA 5F3XB 2KG5A 4IS7A 5JTIA 1PK1A 4RQMA 1V38A 1F0MA 2E8MA 3TADA 2QARB 3SENA 5L1MA 2K4PA 4MHVA 1PK1B 4NJ8A 2Y9TA 1V85A 2LPEA 1B4FA 5JRTA 2EAOA 3HILA 2KSOA 1LKYA 2KIVA 3BS5B 2QB0A 2ES6A 1KW4A 1X40A 1PK3A 2JV3A 1WWVA 1LKYB 2Y9UA 4RQNA 1WWUA 1X9XA 1SV0A 2D8CA 2F3NA 5JU5A 2F8KA 1DXSA 1SV0C 3BS7A 3H8MA 1UQVA 2GLEA 2KE7A 2EAPA 2B6GA 1OXJA 2FE9A 2KMDA 3SEIA 1SGGA 1COKA 3BQ7A 4NL9C 2F44A 1SXDA 2KSOB 4PZNA 2D3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKA A;  3K1R B;  2E8N A;  2QB0 B;  2QKQ A;  1SV4 A;  3KKA C;  4NL9 A;  2QAR A;  2EAN A;  2ESE A;  3IDW A;  5J8Y C;  1X66 A;  2DKZ A;  2YTU A;  1RG6 A;  2QB1 A;  2EAM A;  2LMR A;  1UCV A;  1SXE A;  1JI7 A;  2E8O A;  1OW5 A;  2E8P A;  2DL0 A;  5KNI A;  3BS5 A;  1B0X A;  3TAD C;  2K60 A;  3TAC B;  5J8Y A;  2DKX A;  1Z1V A;  4PZO A;  2L5Y A;  5F3X B;  2KG5 A;  4IS7 A;  5JTI A;  1PK1 A;  4RQM A;  1V38 A;  1F0M A;  2E8M A;  3TAD A;  2QAR B;  3SEN A;  5L1M A;  2K4P A;  4MHV A;  1PK1 B;  4NJ8 A;  2Y9T A;  1V85 A;  2LPE A;  1B4F A;  5JRT A;  2EAO A;  3HIL A;  2KSO A;  1LKY A;  2KIV A;  3BS5 B;  2QB0 A;  2ES6 A;  1KW4 A;  1X40 A;  1PK3 A;  2JV3 A;  1WWV A;  1LKY B;  2Y9U A;  4RQN A;  1WWU A;  1X9X A;  1SV0 A;  2D8C A;  2F3N A;  5JU5 A;  2F8K A;  1DXS A;  1SV0 C;  3BS7 A;  3H8M A;  1UQV A;  2GLE A;  2KE7 A;  2EAP A;  2B6G A;  1OXJ A;  2FE9 A;  2KMD A;  3SEI A;  1SGG A;  1COK A;  3BQ7 A;  4NL9 C;  2F44 A;  1SXD A;  2KSO B;  4PZN A;  2D3D A; 
#chains in the Genus database with same CATH topology
 2DWQ A;  2M0N A;  5J2C A;  4DOC A;  2K89 A;  5KFK A;  2IOH A;  3AU6 A;  4LZG A;  3GZF A;  3MR2 A;  4RNM A;  5D46 A;  4Q45 A;  3OHB A;  1A0P A;  2B0C A;  2VIX A;  1ZD3 A;  2XY5 A;  2Y1J A;  2ZJA A;  5KFS A;  2HHX A;  2MSN A;  5KL1 B;  4YD1 A;  3WKD A;  2E8O A;  4DQI A;  3PSF A;  5AI9 A;  5KNI A;  4ZOH C;  5AKY A;  4DWI A;  2IBK A;  5HMM A;  2V9W A;  4YXJ A;  2EDU A;  2XIC A;  1BNP A;  3G6Y A;  2IMW P;  3ICX A;  2W8K A;  2KIW A;  2OEH A;  2OHF A;  4OJ5 A;  1ZD5 A;  3F53 A;  2H3Z A;  1BGX T;  4J9Q A;  2E8M A;  4KLM A;  1S8O A;  2E5S A;  3NVV A;  5KFE A;  4MHV A;  1PK1 B;  4NJ8 A;  7ICS A;  4JK1 A;  5JRT A;  4EEN A;  4DQQ A;  2WF9 A;  3K75 D;  3PSI A;  3IHQ B;  1NKB A;  2HBL A;  1A77 A;  4M9L A;  3WK6 A;  4IC9 A;  2BQR A;  3RRG A;  2OCE A;  3NVZ A;  4QZA A;  1SL2 A;  4BGD A;  4FZN A;  3R9K A;  4P4M A;  3KHL A;  5FP0 A;  2R8K A;  2D8C A;  4EX6 A;  4BDP A;  1ARO P;  2NRX A;  2IA6 A;  3H8M A;  5DG7 A;  4UB6 U;  4DL2 A;  1ZQE A;  3AUO A;  3F2C A;  1JXE A;  4ECR A;  7ICR A;  2RHF A;  2PFP A;  2ZTD A;  1L7M A;  4NY8 A;  4ECY A;  1S9F A;  1NZB A;  3LK9 A;  3B9J A;  5J0W A;  4QWA A;  1ZQR A;  5DQH A;  4QJF B;  4QZ9 A;  1ZQF A;  4B9L A;  2IOF A;  2JEF A;  4HAI A;  2EAN A;  2YQE A;  3N7S C;  4X5V A;  3ZDD A;  1QQ7 A;  5KFH A;  3D2N A;  5F9N A;  2K8B B;  1LV5 A;  3PV8 A;  2NRV A;  3ETR A;  1L3T A;  3UMB A;  8ICR A;  4YMO A;  4F4W A;  2IHM A;  1B0X A;  4QZC A;  3G6V A;  3M9O B;  4EYI B;  1D9D A;  1KSP A;  3GIJ A;  3RR7 A;  3GV5 B;  1T4G A;  1PK1 A;  2RDI A;  4RQM A;  1V38 A;  3BZC A;  1HJP A;  2JEG A;  2ZJ5 A;  5CWR A;  4OJP A;  4PH5 A;  3SEN A;  3V72 A;  1OUQ A;  2W9B B;  4LVS A;  4PHA A;  3HIL A;  2JH1 A;  1LB2 B;  1MC8 A;  3PO4 A;  1TAQ A;  1SL1 A;  2KIV A;  2FDR A;  3M6K A;  2EQY A;  5J0Q A;  1YZ7 A;  2OM6 A;  1FFV A;  8ICK A;  1PK3 A;  5DBC A;  4HYK A;  3QUQ A;  2F1H A;  1DXS A;  1ZQP A;  2H3Q A;  3SYZ A;  2YMQ A;  1UQV A;  3QX7 A;  4QWD A;  4J9S A;  2JGA A;  2HOI A;  2XGP A;  1JRO A;  1BPE A;  4PHP A;  5B66 U;  4C7Z A;  4YQW A;  3L3F X;  2WHE A;  4M2Y A;  5CA7 A;  3ZDE A;  4F4K A;  3WK5 A;  4E0D A;  2UVW A;  3V7K A;  5DGB A;  1SZP A;  3ONN A;  4Q8F A;  1KQQ A;  3I1Y A;  1D8L A;  1L3S A;  1IXR A;  2HSZ A;  5J0R A;  2NRZ A;  1D8B A;  5J0Y A;  2CRX A;  3LYS A;  3WK4 A;  4I2I A;  4PHE A;  3M8R A;  5KFX A;  1ZXI A;  5ALX A;  3RAX A;  9ICR A;  3BS5 A;  3AM9 A;  2YMP A;  2C2E A;  3HP6 A;  3NTU A;  4J9O A;  2C2R A;  1KBU A;  2BZF A;  4EEK A;  4F5R A;  4IRC A;  4Q8E A;  3GFK B;  3AQE A;  4MF2 A;  1PZN A;  1VLB A;  3TFR A;  2KOB A;  2WF6 A;  4EZ6 A;  3QUC A;  4FZL A;  2YB1 A;  4FO6 A;  3HPO A;  3E0F A;  1NNL A;  2KSO A;  4TUP A;  1NKE A;  1IG6 A;  4DQP A;  2FMQ A;  1TKD A;  2E1E A;  3C2M A;  7ICK A;  4DFP A;  2W9M A;  4F4X A;  3DDH A;  7ICI A;  7ICO A;  2H3I A;  1ZQD A;  5JU5 A;  4Y2Q A;  2AJQ A;  3PY8 A;  2HVI A;  1FO4 A;  2W9C B;  1ZQI A;  2A1J B;  5TIS U;  1HEK A;  3MGH A;  5DBB A;  2UVU A;  5AM0 A;  2BQ3 A;  1OXJ A;  5KL8 B;  3SEI A;  4BXO B;  1COK A;  1ZQN A;  2JMG A;  3NGD A;  1WYG A;  4GXI A;  2KHV A;  2EH9 A;  3RF9 A;  4C80 A;  3GDX A;  8ICI A;  2GH1 A;  4R63 A;  5CEH A;  4ELU A;  2QLT A;  4EYH B;  5AI0 A;  2NO4 A;  4UAZ A;  1ED1 A;  1MQ3 A;  3H0R B;  5L9X A;  5DG8 A;  5EWG A;  2C28 A;  4TUQ A;  9ICS A;  3SAH A;  1L6N A;  2F1J A;  3MDC A;  4Y2P A;  1S0O A;  1RG6 A;  2F2A B;  4ECW A;  4I28 A;  2H3F A;  4GXJ A;  2E8P A;  1ECW A;  3PST A;  5ALG A;  1NJW A;  5ALQ A;  1B43 A;  5AK3 A;  4DSI A;  3PSP A;  1JIH A;  2FMP A;  4CF3 A;  1RZT A;  2BQU A;  5J0S A;  3FM9 A;  5KG6 A;  2AH5 A;  4GXK A;  1DGS A;  3D2S A;  3H8W A;  5ALI A;  4O3M A;  1BPZ A;  3CRX A;  3OPX A;  2EAO A;  3UXN A;  4NLK A;  1KFT A;  5D4B A;  4UB1 A;  2ZTC A;  3SMV A;  1ZQC A;  3PW0 A;  1Y88 A;  2QB0 A;  4BWM A;  5TZV A;  3IN5 A;  2WF5 A;  4O5K A;  4O5E A;  1TK8 A;  4KN4 A;  1Z1B A;  2BCV A;  5T14 A;  2W9C A;  2A1J A;  1J2N A;  1TAU A;  1PVP A;  1QH9 A;  2OXO A;  3SAF A;  4BXO A;  1UPH A;  3NVY A;  4UAW A;  2ASL A;  1IM4 A;  2Q4T A;  1Z4N A;  3JPO A;  3BQT A;  3GV7 B;  4KLO A;  5AKJ A;  5ALN A;  4B9V A;  4FE3 A;  4KLL A;  2HBJ A;  5KFL A;  4P4P A;  3BJY A;  5HHI A;  3M7D A;  8ICE A;  3M9M B;  1PUZ A;  3QUB A;  4J03 A;  4F93 B;  3ORY A;  1N63 A;  5KT5 A;  2DPI A;  2QKQ A;  1SV4 A;  4GC6 A;  5KFC A;  1PVQ A;  1XWL A;  3WKA A;  3T5L A;  3E58 A;  2W11 A;  2G5I B;  2ZIU A;  1WG8 A;  3IDW A;  4UB5 A;  5III A;  1HIW A;  4QZH A;  5KFY A;  2VJ5 A;  2W7O A;  4ICA A;  1JMS A;  3MFH A;  4I2D A;  2JEI A;  4UAY A;  4CF5 A;  7ICU A;  3A0B U;  1KDH A;  3HJE A;  4RQ3 A;  2LHT A;  2Z7J A;  3QEB Z;  5KFO A;  4C8N A;  2LM1 A;  5ALU A;  5AK4 A;  3HT3 A;  4U6P A;  2B21 A;  1S0V A;  4UAV A;  2ISO A;  3C1Y A;  4NLG A;  2EZZ A;  3KBB A;  4K4G A;  4IRD A;  1JXL A;  5KG0 A;  4NWI A;  4GC7 A;  1DGJ A;  2XID A;  2HHU A;  3ED5 A;  3AN1 A;  8ICA A;  2KKP A;  3QZ7 A;  2AQ4 A;  3EUB 2;  3FDS A;  2HHW A;  3C5F A;  2BPC A;  5AM1 A;  5J2D A;  1XSL A;  4MFF A;  2XCP A;  2KN7 A;  5IIJ A;  4Y2R A;  3H0L B;  2GLE A;  1S0M A;  4DEZ A;  2B6G A;  3RTV A;  2K4E A;  2OWO A;  3AMZ A;  5KFB A;  3M1Y A;  4Y2T A;  2HBK A;  4FS1 A;  5KT7 A;  1F44 A;  5KFW A;  1QTM A;  2JHD A;  3A0H U;  4OD0 A;  4DFJ A;  8ICW A;  1J2M A;  2P35 A;  4B9T A;  2W8L A;  2YMM A;  1UT5 A;  5EE3 A;  4ECU A;  2AGO A;  3NS1 A;  4C4S A;  4EEL A;  4Y2V A;  3RJG A;  2NV3 A;  2KK0 A;  5J2E A;  3RJJ A;  3C21 A;  2K4I A;  2LMR A;  2MRL A;  1DOQ A;  4O5C A;  3PR5 B;  2M9N A;  1ZQT A;  4C8K A;  5EE0 A;  2KEY A;  1JAL A;  3MAB A;  1S10 A;  5ALJ A;  1N2X A;  2FPM A;  3ZD8 A;  5F3X B;  3RBE A;  5KT6 A;  1L8O A;  4GIB A;  2HW3 A;  2IOF K;  4C8M A;  4KIT B;  2PFN A;  3LVV A;  3RB4 A;  1SZH A;  3ZDA A;  3G6X A;  3MFI A;  4CCH A;  5C0Y A;  4KLJ A;  3OSN A;  4RT2 A;  4YR2 A;  3PR4 A;  5L1L A;  3IP4 B;  4M9N A;  4UAT A;  2JZB B;  3V6H A;  5KFU A;  1HUZ A;  3PX4 A;  2MU2 A;  3GIK A;  4RQN A;  2WFA A;  1X9X A;  1XNS A;  4Y2S A;  4ED1 A;  3ISB A;  3N4M B;  5DB6 A;  8ICC A;  2K8A A;  5AKZ A;  5KFZ A;  1DK2 A;  1CEZ A;  1RXV A;  1UHU A;  8ICU A;  4QZF A;  5J0O A;  4EZ9 A;  3FC4 A;  4IR1 A;  3BQ7 A;  3RJE A;  4P0P B;  4M6W B;  5ALW A;  1VDV A;  1TK5 A;  3TQ1 A;  1SIJ A;  2D3D A;  1Z00 A;  3F5A A;  3RJF A;  2KVS A;  5J0U A;  9ICC A;  1N62 A;  2KHQ A;  3ISC A;  5KG1 A;  3F5E A;  4QWB A;  5AK5 A;  5J29 A;  4A8E A;  4YVZ A;  2W55 A;  2LKY A;  4DL4 A;  5AKE A;  3C5G A;  2W3R A;  1N60 A;  5ALL A;  3B0Y A;  3Q8K A;  3MBY A;  4JV0 A;  2XCA A;  4IQU A;  1SXE A;  2BDP A;  4UBB A;  4DFD A;  5AK6 A;  4K4H A;  3TAD C;  5KFQ A;  4BUG A;  9ICE A;  5D49 A;  2CPR A;  3K1Z A;  2VA2 A;  3S6J A;  3OSP A;  1AQ6 A;  2JRZ A;  5AIB A;  2PFQ A;  3RB6 A;  1PVR A;  2FLP A;  3ZI4 A;  1F0M A;  5KFR A;  3TAD A;  4DL5 A;  2RLT A;  4Y2U A;  3RR8 A;  2AGQ A;  2AU0 A;  2C22 A;  4GLX A;  3LWL A;  1V85 A;  3KTQ A;  1ZQW A;  2YML A;  1RPL A;  1S5L U;  4RNO A;  2JZB A;  3AU2 A;  3MGV A;  4UB4 A;  4I29 A;  3UM9 A;  3JPN A;  4F71 A;  4I2F A;  2DFL A;  4ED8 A;  3TAQ A;  2FLN A;  4QW9 A;  3BS5 B;  2BDU A;  5B5E U;  2J6S A;  1XO0 A;  4DSL A;  1FIQ A;  1WWU A;  3QUT A;  4DSF A;  1KLN A;  4O0I A;  1NK5 A;  2F3N A;  5DQG A;  4ED7 A;  9ICB A;  4P0P A;  2R18 A;  3KOO A;  4M6W A;  1RQN A;  3Q8R B;  4O3R A;  1NOM A;  4J9L A;  5DB7 A;  3WKE A;  2KZ3 A;  3Q8P B;  4RT3 A;  1X2I A;  4JB3 A;  4J9K A;  2LYB A;  2NYV A;  2F44 A;  1ZQQ A;  4NLN A;  1DRG A;  2KSO B;  2XVT A;  5DKW A;  3LWM A;  2ZUB A;  2WTF A;  3TAP A;  4M9H A;  2R8I A;  9ICN A;  2PKE A;  4RQ2 A;  4C4T A;  4EBE A;  9ICT A;  7ICL A;  5J2B A;  8ICL A;  1NZP A;  5ALY A;  4U7C A;  2R8H A;  1ZD2 P;  2I5H A;  1VJ5 A;  1XO1 A;  5HHH A;  4MF8 A;  5KFA A;  4YR3 A;  1UCV A;  5CRX A;  1MA7 A;  2DL0 A;  4RUA A;  4O3N A;  5KFV A;  3Q8M A;  4AP9 A;  5KFN A;  4KLS A;  4F50 A;  4RPZ A;  1N5W A;  4IS7 A;  4RQ0 A;  1ZRN A;  3JPT A;  4Q43 A;  2YY6 A;  5G5H A;  4KLU A;  3H8J A;  1WCN A;  2LI6 A;  2K4P A;  1GO3 F;  3UXO A;  2HHV A;  1U45 A;  1B4F A;  1BPB A;  3DEE A;  1ZJN A;  2K8C B;  3IM1 A;  1YT3 A;  3JPQ A;  3LVW A;  9ICG A;  1URJ A;  3SI8 A;  4K4I A;  5HNK A;  1LKY B;  2W9A A;  1FFU A;  3CNH A;  3EZ5 A;  4Z6F A;  1NI3 A;  3RJH A;  2FLL A;  2PMZ F;  2F8K A;  3QU9 A;  2RQ5 A;  8ICS A;  3TAR A;  4J9N A;  9ICF A;  5KAI U;  2KE7 A;  1ZD4 A;  4UAS A;  1K1S A;  7ICN A;  3C23 A;  3IV6 A;  4F2S A;  1ZQO A;  2KJ9 A;  4UB2 A;  9ICP A;  3KKA A;  4YXM A;  1COO A;  5AIA A;  2EZY A;  3M9N B;  2QB0 B;  4MEY A;  4QW8 A;  1SL0 A;  4Y2Y A;  5K4L A;  4DQR A;  1ZET A;  5KFP A;  3K4G A;  2KVC A;  5IIM A;  1TFR A;  4JUZ A;  1UT8 A;  2ESE A;  1IIP A;  2IHN A;  1L5U A;  1X66 A;  7ICP A;  5DLF A;  1RQL A;  3Q8S B;  1ZJM A;  2P6R A;  3HX0 A;  4DL6 A;  1KEJ A;  3QU7 A;  4UQG A;  4OO1 J;  2K4H A;  5ALR A;  3OHA A;  4F92 B;  4TQR A;  3QE9 Y;  1ZRM A;  4RQ4 A;  3I76 A;  5DBA A;  2RDJ A;  4C0Z A;  3GQC A;  4YR0 A;  9ICW A;  5BPC A;  4PL1 A;  1Q46 A;  5HR7 A;  1X9S A;  4ECS A;  2ZIU B;  5DQI A;  2AXT U;  3UPQ A;  2ATL A;  2VJ4 A;  4IR9 A;  1TK0 A;  1ZQZ A;  1LKY A;  2G0A A;  5J0P A;  4FZM A;  2XO7 A;  2XY7 A;  5AKI A;  1NK7 A;  1JRP A;  9ICI A;  4RQ5 A;  4I27 A;  3D6J A;  9ICX A;  3BQ2 A;  7ICH A;  1XS9 D;  8ICM A;  2W04 A;  1D8Y A;  4F72 A;  3U26 A;  4O3Q A;  2V4Q A;  2KFZ A;  1ZQV A;  2DBY A;  2ZXI A;  1X9W A;  3RB3 A;  2KZM A;  1RM6 C;  5KFD A;  2PMZ C;  1MQ2 A;  1NJY A;  4B9M A;  2G06 A;  4M0A A;  4NL9 C;  3HWT A;  3PML A;  1X6J A;  1KTQ A;  1V97 A;  3M6Z A;  7ICT A;  1F5S A;  2WF8 A;  3QU5 A;  4FBT A;  4YMM A;  3MR6 A;  5G5G A;  4R65 A;  1QLN A;  4RNN A;  4NL9 A;  5IIK A;  1ZOL A;  1KRP A;  2HI0 A;  2HOQ A;  2JEJ A;  2DQN B;  8ICO A;  5EWE A;  5AI6 A;  8ICB A;  4DOA A;  5ALF A;  1QQ5 A;  1KFD A;  3M8S A;  4MFC A;  4YG2 A;  5KFM A;  3D2Q A;  3N7R C;  2DKX A;  4PZO A;  3E2E A;  4RQ1 A;  1U47 A;  4US8 A;  4IL6 U;  2HBM A;  2L5Y A;  4US9 A;  1S0N A;  1QCK A;  1O03 A;  2A1A A;  4ELT A;  4XA5 A;  1D9F A;  4O9M A;  9ICU A;  1X42 A;  7ICE A;  4RQ6 A;  4LJX A;  4KLI A;  4J9R A;  5H2F U;  3MGI A;  3DV9 A;  4C7Y A;  3ZDC A;  5ALH A;  2H5X A;  4PHD A;  8ICJ A;  3MC1 A;  4RPX A;  4RU9 A;  1X40 A;  3KHR A;  1SB3 C;  3NVW A;  2C2D A;  2Y9U A;  3WKB A;  3OTQ A;  1RDF A;  1HUO A;  2ODG A;  1SV0 A;  2ZUC A;  5DB8 A;  3SZ2 A;  1L3U A;  3F2D A;  2DPJ A;  2GOL A;  4O3S A;  9ICO A;  3T3F A;  4CDG A;  3N28 A;  4CE6 A;  1DK3 A;  1ZYQ A;  3GIL A;  5BOM A;  2HHT A;  4I2A A;  4USA A;  2WB1 F;  1SXD A;  5ALS A;  5ALK A;  3KFU F;  4XRH A;  2I9G A;  2BCQ A;  2OYY A;  1SKR A;  3RB0 A;  9ICM A;  1O08 A;  3ZD9 A;  3KD3 A;  2ISP A;  3EPG A;  4DLG A;  3QZ8 A;  5J8Y C;  8ICV A;  3GU3 A;  1ZQX A;  4IQT A;  3OJS A;  2DKZ A;  2VKQ A;  2QB1 A;  2EAM A;  2KD1 A;  5C5J A;  2G07 A;  8ICZ A;  1JI7 A;  4KLF A;  1T3Q A;  2PI4 A;  1L7P A;  2LBO A;  1UA0 A;  2BCS A;  2O6K A;  3TAC B;  4C8L A;  4NM1 A;  5J8Y A;  4ED3 A;  2W7P A;  4NXZ A;  2DF4 B;  4C4R A;  5A0L A;  3KZI U;  5DB9 A;  2JXJ A;  1Z00 B;  4QZ8 A;  1QSY A;  1KN5 A;  1NK9 A;  5KG7 A;  3PW2 A;  5JTI A;  4QNL A;  5AKH A;  3C2K A;  4XUS A;  2ALZ A;  5L1M A;  8ICP A;  4OJ6 A;  2BHN A;  2LPE A;  3PVX A;  4XQ8 A;  3PZP A;  2G09 A;  4ED0 A;  4JWN A;  3PMN A;  3EPI A;  2I6X A;  3N7P D;  2GWS A;  4KTQ A;  4Z6E A;  5ALM A;  2JV3 A;  3HW8 A;  3NRW A;  3C1Z A;  1CRX A;  3TFS A;  4KLT A;  9ICL A;  4CRX A;  5KG3 A;  5J2G A;  3TI0 A;  1L8L A;  3HKZ C;  4KLQ A;  2NO5 A;  2W54 A;  5J2F A;  3C2L A;  4TQS A;  5AM3 A;  4MFA A;  4QZE A;  4R66 A;  4NLZ A;  4BJQ A;  2NRW A;  3F2B A;  1QQ6 A;  2WB1 C;  2UVV A;  3SV3 A;  8ICY A;  3KHG A;  4Z6C A;  5ALV A;  3CP8 A;  8ICG A;  1SKS A;  4ED6 A;  1K1Q A;  1BNO A;  2BCR A;  3JPS A;  2PI5 A;  2QAR A;  3JPP A;  2PXI A;  2KIC A;  3EYZ A;  1SWW A;  5EWF A;  1IV8 A;  3T5K A;  3N97 B;  5CB1 A;  4BWJ A;  1UA1 A;  3SR6 A;  3RH4 A;  2DUY A;  5DDM A;  4O3O A;  2LM4 A;  4NV0 A;  4CGZ A;  3V6K A;  4O3P A;  4RPY A;  3RFA A;  4DSE A;  1KFS A;  4F8R A;  3QNM A;  3T5H A;  3H8S A;  4RZR A;  1JX4 A;  3V7L A;  3MDA A;  4P0Q B;  3H7I A;  4GFJ A;  3ETL A;  1N56 A;  2HDO A;  2MUT A;  5KFF A;  4J9P A;  2BPG A;  5DGA A;  4DFK A;  5AHX A;  3Q8Q B;  3NAS A;  3J81 j;  7ICQ A;  4OJL A;  2HVH A;  2W43 A;  2AHO B;  5EOZ A;  2BCU A;  1QSL A;  3H4B A;  1U49 A;  1MSW D;  4M9G A;  1BPX A;  2HHQ A;  4JWM A;  1ZQL A;  2G08 A;  4KN7 A;  5IIO A;  8ICH A;  1ZQ1 C;  2JR5 A;  5AIC A;  4C8O A;  7ICG A;  8ICT A;  4YCX A;  4M47 A;  9ICJ A;  8ICF A;  1CI4 A;  4B6J A;  2A19 A;  2VA8 A;  3BS7 A;  2LYH A;  1BPY A;  4ECZ A;  3BQ1 A;  4QZB A;  1SWV A;  2E3T A;  3I28 A;  2KMD A;  9ICK A;  2ZIW B;  3B0X A;  3CYM A;  3PW5 A;  2P6U A;  2XI9 A;  4B9S A;  3OGU A;  2ZUD A;  1K5O A;  4IQV A;  4F4Z A;  4LZD A;  5J2J A;  4I2E A;  2WAQ F;  1KL9 A;  2AQ0 A;  1N61 A;  4PPX A;  3MR3 A;  4F5Q A;  5AKG A;  3GV8 B;  5CP2 A;  4Q44 A;  3RAQ A;  5KFT A;  4QWC A;  1S77 D;  8ICX A;  2XGQ A;  4ZH4 A;  2ZIV B;  2AGP A;  1T8E A;  1LVH A;  4R64 A;  3ZDB A;  4R8U B;  2BKE A;  1NK8 A;  1FEZ A;  3IG5 A;  3C29 A;  4TUR A;  1L3V A;  4P0Q A;  3QEA Z;  2F8L A;  3WU2 U;  4KLH A;  2EZX A;  1Z1V A;  2BGW A;  1NJX A;  5ALT A;  2VA3 A;  1JUD A;  2KG5 A;  5AM4 A;  1H38 A;  9ICQ A;  4FBU A;  1TVA A;  3PW4 A;  5HR6 A;  2VAN A;  4ACO A;  2R8G A;  4I2B A;  5KFI A;  4M9J A;  1U9L A;  4P4O A;  3QU4 A;  5J0X A;  2ASD A;  4I2C A;  4RQ7 A;  4Y2X A;  1ZQB A;  4ECV A;  2KFN A;  2RRD A;  4QZD A;  3QXG A;  3HRD D;  3EWA A;  3TKA A;  1A6S A;  1T3N A;  4KX5 A;  3H0M B;  2HMX A;  3PW7 A;  3SAG A;  1ZQH A;  3ISD A;  1WWV A;  4CNQ A;  4UAU A;  4ECT A;  3WK9 A;  5CJ7 A;  3SD7 A;  1N48 A;  2XC9 A;  5J2K A;  5J2I A;  3AQF A;  2ZIW A;  3TAN A;  4F3O A;  4P2H A;  4OCZ A;  5ALP A;  5CHG A;  4DO9 A;  1T7P A;  1KKX A;  3QU2 A;  5L1K A;  3UMG A;  4RUC A;  4QWE A;  4IQW A;  4EX7 A;  3RJK A;  4BX9 C;  3H4D A;  4PZN A;  4KMU A;  4EBC A;  1Q8K A;  1N5X A;  1NJZ A;  4YN4 A;  3K1R B;  4PGY A;  4ED2 A;  9ICA A;  5KT3 A;  1EXN A;  7ICM A;  3KKA C;  2ZIV A;  3LDA A;  5BOL A;  4R8U A;  5AI4 A;  4NLB A;  2WAQ C;  2UVR A;  1J97 A;  2MAX A;  3UXP A;  5KT2 A;  4I2J A;  3RBD A;  2R8J A;  4UB8 U;  3ALR A;  2W9B A;  4QZI A;  4J9M A;  3RH5 A;  3VC8 A;  5JUM A;  4DS4 A;  2KNJ A;  4NM2 A;  1ZQM A;  1OW5 A;  5AKL A;  7ICV A;  5J0T A;  2YB4 A;  2FJ6 A;  3UMC A;  2DGZ A;  1SKW A;  1S97 A;  4DL7 A;  3QYP A;  4B9U A;  4PGX A;  4EEY A;  4M04 A;  5AI8 A;  5J2H A;  3V7J A;  1C7Y A;  2XY6 A;  2NRT A;  4WJ3 B;  1L7O A;  5CR0 A;  3CW2 C;  4JV2 A;  4JV1 A;  3RH6 A;  2Y9T A;  1ZQG A;  3OJU A;  1MN8 A;  1XSP A;  2V4R A;  4DOB A;  2FMS A;  2D6F C;  4DCC A;  5E79 U;  2Q0Z X;  5KG4 A;  3H40 A;  4I2H A;  1KW4 A;  4F4Y A;  5KG5 A;  2PFO A;  1T94 A;  3PO5 A;  2N1R A;  2Y0S F;  2KTQ A;  2KV2 A;  1Q3U A;  2YX8 A;  4IRK A;  3JPR A;  2FPK A;  2F76 X;  1Z3E B;  2W3S A;  3MR5 A;  4MEX A;  4KMO B;  4KLE A;  1S76 D;  4EBD A;  5GTI U;  5KT4 A;  3RJI A;  3PX6 A;  4DSK A;  4DL3 A;  1RYR A;  1XSN A;  4JMU A;  3NRZ A;  2I1Q A;  3IRU A;  3PNC A;  3V6J A;  2ZXH A;  1U4B A;  1JN3 A;  8ICQ A;  3SV4 A;  5L1J A;  2YN4 A;  3O0F A;  4F5P A;  9ICH A;  1WCL A;  4YP3 A;  4ECQ A;  2FI1 A;  7ICJ A;  1RYS A;  3L4P A;  2HCF A;  3VCB A;  2F1I A;  3AL0 B;  4ECX A;  1ZQY A;  2K60 A;  4G9B A;  4B9N A;  3GII A;  5KTQ A;  2WF7 A;  4TUS A;  2P66 A;  3FYH A;  4DFM A;  5AKK A;  3PX0 A;  1Z19 A;  1Q3V A;  5AKX A;  5HML A;  3L5K A;  4DSJ A;  1ZQA A;  2ZG6 A;  2KZZ A;  4DF4 A;  4YFK A;  3WKC A;  1WUD A;  1RXW A;  3SQI A;  1B22 A;  1V9P A;  5DDY A;  2BR0 A;  2JH7 A;  1NK0 A;  1ZQS A;  1P7D A;  3T79 A;  1Z4O A;  2G5H B;  2F77 X;  1YZ6 A;  7ICF A;  2ES6 A;  4KLD A;  1TE2 A;  3THV A;  1TV9 A;  4DF8 A;  2ZJ8 A;  4OJO A;  5AM2 A;  4QZG A;  4KLG A;  1TAM A;  2Y0S C;  4AYB F;  1SV0 C;  5KG2 A;  2ZIX B;  4QIW F;  2KJ8 A;  2OH2 A;  4UAR A;  2RP5 A;  4FFD A;  5ALD A;  5ALZ A;  1L7N A;  3BZK A;  2FE9 A;  5HP4 A;  1X6I A;  4NLC A;  3HKZ F;  3FAH A;  9ICV A;  1NKC A;  2E8N A;  5GTH U;  2ZTE A;  1M6Y A;  2BPF A;  1X9M A;  3Q8L A;  1U48 A;  5AI5 A;  1NK4 A;  2YTU A;  4YMN A;  2KKV A;  3WK8 A;  5ALE A;  5L1I A;  2KP7 A;  3EW9 A;  5AM5 A;  5IIN A;  3GIM A;  2A3V A;  2HOF A;  4FS2 A;  2HHS A;  5IIL A;  1BVS A;  4DLE A;  1QSS A;  4F91 B;  1RYU A;  5J2A A;  3NUQ A;  8ICN A;  2E1F A;  1ZQK A;  4UB3 A;  1XC9 A;  4Y2J A;  2KJ5 A;  1CUK A;  4F5N A;  2CN1 A;  2H3V A;  5F9L A;  2MA1 A;  3WK7 A;  2QAR B;  4Z6D A;  4YD2 A;  5KFG A;  5EE1 A;  2J6U A;  4F2R A;  4PJ0 U;  3UQ2 A;  2J6T A;  5KAF U;  4UBC A;  3RRH A;  5DG9 A;  4CF4 A;  3BDP A;  4F5O A;  5KFJ A;  4G3I A;  3AEV A;  2CXY A;  2W03 A;  4PL2 A;  2LYA A;  3KZX A;  5ALO A;  3IG8 A;  3KHH A;  1A76 A;  4UW9 A;  5EE9 A;  2ZIX A;  4KX3 A;  1C20 A;  1ZQU A;  4PGQ A;  1BPD A;  3T5J A;  4ELV A;  4I2G A;  1XU4 A;  4DQS A;  2MUT B;  2GO7 A;  4RQ8 A;  2EAP A;  1NK6 A;  2ASJ A;  4AYB C;  1SGG A;  4DS5 A;  4QIW C;  5DLG A;  2FPL A;  2Y1I A;  3C28 A;  3UQ0 A;  1ZQJ A;  3BQ0 A; 
#chains in the Genus database with same CATH homology
 3KKA A;  3K1R B;  2E8N A;  2QB0 B;  2QKQ A;  1SV4 A;  3KKA C;  4NL9 A;  2QAR A;  2EAN A;  2ESE A;  3IDW A;  5J8Y C;  1X66 A;  2DKZ A;  2YTU A;  1RG6 A;  2QB1 A;  2EAM A;  2LMR A;  1UCV A;  1SXE A;  1JI7 A;  2E8O A;  1OW5 A;  2E8P A;  2DL0 A;  5KNI A;  3BS5 A;  1B0X A;  3TAD C;  2K60 A;  3TAC B;  5J8Y A;  2DKX A;  1Z1V A;  4PZO A;  2L5Y A;  5F3X B;  2KG5 A;  4IS7 A;  5JTI A;  1PK1 A;  4RQM A;  1V38 A;  1F0M A;  2E8M A;  3TAD A;  2QAR B;  3SEN A;  5L1M A;  2K4P A;  4MHV A;  1PK1 B;  4NJ8 A;  2Y9T A;  1V85 A;  2LPE A;  1B4F A;  5JRT A;  2EAO A;  3HIL A;  2KSO A;  1LKY A;  2KIV A;  3BS5 B;  2QB0 A;  2ES6 A;  1KW4 A;  1X40 A;  1PK3 A;  2JV3 A;  1WWV A;  1LKY B;  2Y9U A;  4RQN A;  1WWU A;  1X9X A;  1SV0 A;  2D8C A;  2F3N A;  5JU5 A;  2F8K A;  1DXS A;  1SV0 C;  3BS7 A;  3H8M A;  1UQV A;  2GLE A;  2KE7 A;  2EAP A;  2B6G A;  1OXJ A;  2FE9 A;  2KMD A;  3SEI A;  1SGG A;  1COK A;  3BQ7 A;  4NL9 C;  2F44 A;  1SXD A;  2KSO B;  4PZN A;  2D3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...