2QB1A

2tel crystallization module
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
SIALPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
molecule keywords E80-TELSAM domain
total genus 19
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qb1A00
1SGGA 1X66A 2DKZA 5KNIA 5J8YA 5F3XB 5J8YC 2F44A 2KG5A 2E8PA 4PZNA 4MHVA 3H8MA 3HILA 2Y9UA 1Z1VA 3TADC 1WWUA 2JV3A 2K60A 2KMDA 1RG6A 3BS7A 2ES6A 5JTIA 1SV4A 2F3NA 1PK1A 2YTUA 4NJ8A 2DL0A 2B6GA 1UQVA 1KW4A 4PZOA 2F8KA 2L5YA 2KSOB 2QB0A 1SXDA 2E8MA 2ESEA 2E8OA 3BS5B 2GLEA 4RQMA 3K1RB 2D8CA 2QKQA 1LKYA 2K4PA 4RQNA 2QARA 2QB1A 3SENA 4NL9C 3KKAA 3SEIA 3TADA 2E8NA 5JU5A 3BS5A 1X40A 1SV0A 1X9XA 1V85A 2KSOA 2LPEA 4NL9A 1F0MA 1V38A 1DXSA 2DKXA 2KIVA 4IS7A 1PK1B 2EAPA 2QARB 3BQ7A 1OW5A 3IDWA 2KE7A 3TACB 1LKYB 1COKA 1UCVA 1JI7A 3KKAC 1SXEA 1SV0C 2EAOA 1WWVA 2QB0B 2Y9TA 2D3DA 2EANA 2EAMA 5L1MA 1OXJA 2FE9A 2LMRA 5JRTA 1PK3A 1B0XA 1B4FA
chains in the Genus database with same CATH superfamily
4M0AA 4Q8EA 1RYUA 1IV8A 4JV0A 5BOLA 4IC9A 4KLTA 3SAHA 4UBCA 1N56A 4ECRA 5CHGA 3KHHA 1UT8A 3M9MB 8ICFA 5TZVA 4UB3A 4FBTA 3SV4A 4IQVA 4NLBA 5KG2A 4M04A 2H3FA 3RJJA 4CF4A 4ECSA 1UQVA 2ASJA 3V6KA 5AM4A 2XY6A 2W03A 5HHIA 5D46A 3BS5B 5DQIA 4Y2SA 2ZXHA 2NRWA 4J9QA 5IIMA 2QKQA 3PZPA 1KKXA 5AI4A 2ODGA 4MFFA 4UW9A 2DF4B 1ZQJA 8ICNA 4NL9C 4DL5A 4YMOA 5KFYA 2YMQA 4B9TA 4O3SA 5AM5A 2OH2A 1SV0A 3H4BA 4I2BA 3RJEA 5DQHA 3K4GA 9ICRA 3MR3A 2VJ5A 2BQRA 2ISPA 2P35A 4CE6A 5ALQA 5J0XA 2R18A 3AU2A 1URJA 4MF8A 2VKQA 2XCAA 4YFKA 4US9A 4DCCA 5J2FA 4F50A 2M0NA 5ALIA 2FPKA 2PFPA 1RQNA 2MRLA 3MR6A 2OYYA 3E58A 7ICTA 4K4HA 4F4YA 3OPXA 3GIJA 1UT5A 2ASDA 1ZOLA 2FMPA 3Q8KA 1NK9A 1Z4NA 1S0VA 2J6UA 4OJ6A 4BGDA 3BQTA 5KFHA 5AI0A 3V72A 2ZG6A 4P2HA 2E8PA 2XI9A 3EWAA 1KFDA 4Y2YA 2DWQA 3PSPA 2WB1C 3H8MA 2HHSA 3HILA 5AK6A 3PSTA 4BXOA 9ICFA 2HOQA 5EWEA 5J29A 4P4OA 5KFAA 1CI4A 3SV3A 4J9PA 5G5GA 2IOFK 9ICVA 2QB0A 3MDAA 1NKEA 1JXLA 1S97A 5AKGA 9ICTA 5HMLA 1Z4OA 4OJ5A 1ZQ1C 4UAUA 2WAQF 4F5NA 9ICXA 1ZD3A 4C8KA 1Y88A 4JB3A 4EX7A 3DDHA 4RQNA 2LI6A 4Z6EA 2BKEA 5DLFA 3LWMA 1YZ7A 4Z6FA 2XVTA 8ICOA 1WCLA 4JV1A 5CRXA 3FAHA 4DFMA 2FMQA 2A19A 1ZQMA 3MABA 4F92B 5KFWA 3WK4A 1FEZA 2LKYA 4RQ6A 4IR1A 5J2JA 2NYVA 1X9SA 5AM3A 3AUOA 2W11A 2G5IB 5J0YA 1ZQCA 3ZDDA 1WWVA 3M9NB 2ZTCA 3PO4A 5KT7A 3BZKA 1MSWD 1BPYA 2ZIVB 2KIWA 3JPTA 4Z6CA 4UBBA 3ICXA 3M7DA 5J8YA 1ZQWA 1PVQA 3UMGA 4M9JA 2KJ8A 1MN8A 3T5HA 4B9MA 4Y2UA 4ZH4A 1ZXIA 4RNMA 3ORYA 4JMUA 5CEHA 2KMDA 5G5HA 3FDSA 4DSFA 4FZLA 3D2QA 4RPYA 3F5AA 4UB2A 4EEYA 3TFSA 2F8KA 5L1KA 1TAQA 4QIWC 1LVHA 1N5WA 1SL1A 1Z19A 4QZFA 1ECWA 4GXJA 4EBCA 2W7PA 2XICA 4GXIA 4F5OA 1T8EA 4PGQA 1RXVA 4R63A 2ZUCA 1KLNA 3KKAA 5J0OA 4DSKA 2KHQA 5DLGA 5CP2A 5AKHA 4RQ8A 2DPJA 1ZQFA 3ZDEA 2ZIXB 2KFZA 7ICMA 5J2CA 3TARA 4FE3A 4OCZA 2KD1A 1KDHA 1BNOA 4DL3A 4PHAA 5EE3A 3WK8A 3L3FX 3QXGA 5AK5A 2EZZA 8ICVA 3KD3A 4YR0A 2CXYA 4C8OA 4J9KA 2RDIA 2K8BB 4MEYA 4YMMA 2FJ6A 2VJ4A 1KEJA 3WK9A 3NS1A 4Z6DA 2W9CA 4GC7A 3KZXA 5E79U 5DBBA 5ALUA 3MDCA 1JN3A 4TQSA 3C1YA 3MFIA 2HBLA 3HX0A 4UAZA 4UAWA 4UARA 4IQUA 2BR0A 4BWJA 3PW0A 3M1YA 3HKZC 4Y2TA 3RFAA 1QLNA 1SIJA 3KOOA 2OXOA 1L7PA 1MA7A 2DUYA 1SL0A 2LM1A 1ZQGA 1CRXA 4FS2A 1YT3A 5L1LA 2B6GA 3ZDCA 3QE9Y 2BDPA 1JUDA 2V4QA 5DB9A 4P0QA 3WU2U 3Q8MA 3N7PD 2HDOA 2LM4A 2GLEA 4RQMA 5J2IA 4E0DA 2P6UA 4CF5A 5KFGA 3RTVA 4MFCA 4F91B 3K1ZA 3D2SA 1N5XA 5J0WA 3IN5A 2LPEA 1HUOA 3AEVA 3JPNA 1ZD2P 3GQCA 8ICTA 4AYBC 1L7OA 5KFSA 4XA5A 3BQ7A 8ICKA 1BPXA 3K75D 4DF4A 5EWGA 4I2GA 4KLQA 3C2MA 4O3NA 4DSIA 2KKVA 3O0FA 3BJYA 2E1FA 2XY5A 3WKDA 5D49A 4Q44A 1C7YA 2IMWP 1Z3EB 1BPDA 3TI0A 4XQ8A 2OM6A 4KLEA 2LMRA 5AKXA 4ELTA 3RB3A 5DDYA 5KT6A 2J6TA 4AP9A 3QU2A 5CB1A 3T5JA 2KJ9A 2VIXA 4DQIA 4FZMA 4DOBA 2NO5A 1JRPA 5ALXA 4PZNA 1WG8A 4F2RA 4YG2A 3RAXA 1TE2A 5ALJA 3N28A 5C5JA 3PW7A 1Z1VA 5KFMA 4HYKA 2KHVA 3H0RB 5KG5A 9ICKA 2W9MA 4B9UA 1RG6A 2HMXA 1ZRMA 4NLGA 3ED5A 2EH9A 4RPZA 4C8LA 5KFUA 4UAVA 2GH1A 1ZD5A 2UVVA 4JK1A 3UQ0A 3QNMA 1COOA 4QWBA 9ICJA 3OTQA 2DQNB 3K1RB 3RRGA 1L5UA 4EYHB 3SEIA 4DO9A 5ALTA 1HEKA 4KLIA 4PPXA 7ICLA 7ICSA 1XU4A 4USAA 5GTIU 3PSFA 5IINA 3EPGA 5KFPA 4TUSA 1D9FA 3QZ7A 4RQ7A 2JRZA 1KQQA 4FS1A 3ISDA 4RNOA 1JIHA 2Z7JA 1V9PA 2I5HA 2R8HA 1ZQKA 1JX4A 3KKAC 3SAGA 5EE0A 1SXEA 1ZQPA 3C23A 4ED6A 2AQ0A 4RZRA 4CDGA 4I27A 4JWNA 1KFTA 1S0NA 2BQUA 5KFTA 1FIQA 1B4FA 2G06A 2FLLA 2DGZA 4KLFA 5J0PA 4DLEA 3KBBA 2K4HA 1X9WA 3LVWA 1KBUA 2PFOA 1BNPA 3Q8QB 2XO7A 4TUQA 3Q8LA 4QZIA 4P0QB 3HJEA 3MR5A 3AL0B 5KFVA 5ALMA 2IBKA 3RR7A 2UVRA 4OJLA 1L8LA 5AIAA 1X6JA 5KG4A 4J9MA 2W55A 1ZQVA 3BS7A 1RZTA 3IM1A 4ECZA 5JTIA 5ALRA 1RYRA 3CRXA 5DGBA 1AROP 5GTHU 3SZ2A 5J0TA 3SR6A 1QQ7A 1J2MA 3TKAA 3F2DA 1T7PA 2P6RA 1U47A 4ICAA 4PZOA 3PW2A 2L5YA 5KFLA 2HBJA 2W04A 4F8RA 4PHDA 3GFKB 2WB1F 1KTQA 4MEXA 4O9MA 7ICGA 2W43A 4RU9A 2W9CB 2QB1A 4KLGA 5KFKA 3I28A 3TADA 4J9LA 3QU7A 3QUBA 3BS5A 3GV8B 4DLGA 5KFCA 4QZCA 1CEZA 1V38A 1D8LA 1U49A 3T79A 4IS7A 5KG0A 2QARB 4F2SA 2OEHA 1K1SA 4M9NA 4UB6U 1COKA 3PY8A 4PL1A 1P7DA 1SKSA 2ALZA 2H3VA 4J03A 1ZQRA 2HHXA 3H8SA 2KK0A 4QWAA 1S0OA 3QUCA 1X6IA 4DQSA 1ZRNA 1NK6A 4LZDA 3SD7A 5J0UA 3UQ2A 3HW8A 3C5GA 3PR5B 2D6FC 3GDXA 2ZIWB 2BZFA 1NOMA 5KT3A 5D4BA 4PHEA 4C80A 2Y9UA 4F3OA 4I28A 4ED1A 3SQIA 1QQ5A 2NO4A 3OJUA 4U7CA 4PL2A 3I76A 2AGPA 1LB2B 2PMZF 4Y2QA 3QUTA 1QCKA 1Q3VA 3LWLA 1BPBA 9ICUA 2XGPA 1ZQBA 4U6PA 1PZNA 1TVAA 3V7LA 3AMZA 2W7OA 4ZOHC 2RP5A 3T3FA 8ICHA 3MGIA 4UASA 3KHGA 1S5LU 1KL9A 2LHTA 5ALZA 1PUZA 2XY7A 5JU5A 3C2KA 4O3PA 4KTQA 2PI4A 1SWWA 1XO1A 1X2IA 2RRDA 1F44A 3OJSA 3AQFA 1O08A 4FO6A 2KP7A 4TQRA 4QW8A 3GV5B 1DOQA 3BQ2A 1NK7A 3FC4A 2HHVA 2E1EA 4QZBA 4KLUA 3H8JA 5CA7A 3V7KA 4GC6A 2ASLA 4Y2XA 3SAFA 5KFEA 4M6WB 3G6YA 3F2CA 4CGZA 2UVWA 3CP8A 4I2DA 4EBDA 5TISU 2ZJ8A 4DFPA 1S0MA 3RAQA 1FFVA 4KLJA 4OJOA 4YVZA 3OGUA 4GLXA 9ICCA 4OJPA 4C8NA 3RB4A 3T5LA 1BGXT 4G9BA 3PX4A 5B5EU 2IOFA 1RYSA 3J81j 2C28A 2K8CB 2VANA 2AHOB 5CWRA 4KMOB 2MUTA 3I1YA 3N7SC 5ALOA 1U4BA 4FFDA 1PK1A 2H3QA 3N4MB 2JH7A 3TFRA 5J0RA 3M8RA 4Y2RA 5AM1A 3BQ1A 2ZJAA 4QW9A 1FO4A 4RUCA 3GZFA 1DGJA 5AM2A 2C2RA 2HVIA 4UB8U 5IILA 1LKYA 1T4GA 3Q8SB 2YN4A 4PJ0U 1C20A 2KVCA 1V97A 1TK0A 2W8LA 2BPGA 3RB0A 2BCSA 3F5EA 4B6JA 3L4PA 2OHFA 4BJQA 4O3QA 3RBEA 2KSOA 5AICA 4DL4A 1T94A 1F5SA 2WF7A 4JUZA 4IQTA 4RQ2A 3PVXA 1U48A 4DQRA 4F4WA 4C4TA 4NLZA 2KN7A 5EOZA 1LKYB 1T3QA 2BCVA 3UMCA 1JI7A 3QU4A 5KTQA 1RDFA 1N63A 4QZHA 1ZETA 2KICA 8ICEA 3MR2A 5KL8B 8ICUA 2Y9TA 3QU9A 3H40A 1ZQIA 1YZ6A 5CR0A 2ZUBA 3RJKA 4J9NA 5JRTA 4QWCA 4O5CA 2JEJA 3KHLA 3F53A 4M47A 4IR9A 4FBUA 2AU0A 4F4KA 2NV3A 2PKEA 1ZYQA 2NRTA 3UXOA 5ALWA 2NRVA 4I2IA 3ZDBA 2ZTDA 3GU3A 3R9KA 3THVA 5AI5A 5HMMA 3PW5A 2PMZC 1A0PA 5HHHA 2KZZA 4RUAA 2YMPA 1S10A 8ICJA 2HHWA 4X5VA 3C21A 2WAQC 4J9RA 4EZ9A 3B9JA 7ICRA 9ICIA 2HVHA 5ALPA 2Y1JA 5AKEA 4QIWF 1RXWA 1NJWA 4R65A 2XIDA 5KFNA 3HP6A 3PO5A 3RJHA 1M6YA 5AKZA 3PX0A 7ICKA 3WKBA 5KAFU 2HHUA 9ICOA 1TFRA 2RHFA 2W3RA 2K4PA 4PHPA 2LBOA 4ECTA 3H4DA 3C2LA 1PVRA 4ELVA 4YXJA 9ICSA 2F76X 4ED2A 3NVYA 4NL9A 2RDJA 5FP0A 4M2YA 2A1AA 1ED1A 4NWIA 4WJ3B 9ICLA 3UMBA 9ICNA 4UB1A 3PX6A 2I6XA 3QU5A 2KE7A 4JWMA 1J2NA 5KT2A 4R8UB 9ICMA 4KLDA 2KZMA 1KSPA 4YR3A 4PH5A 2EAMA 3HRDD 3EPIA 2XGQA 1ZQNA 1ZQZA 1RM6C 2WF9A 4B9LA 2G0AA 3OSNA 1D8BA 2KOBA 1X66A 3OSPA 5L9XA 3KFUF 3ZI4A 5AHXA 1ZJNA 1HJPA 4EBEA 8ICCA 2KVSA 3N97B 3ETLA 3JPOA 3NUQA 5AM0A 1X9MA 2I9GA 4DFDA 2ZIWA 2W9AA 4EENA 4C0ZA 2W9BA 1SL2A 1XSLA 4GXKA 3M6KA 1NK4A 1NJXA 4BUGA 4KX3A 1IIPA 1TAMA 2EZXA 4QZAA 4P4MA 2FMSA 2JXJA 9ICPA 2AH5A 5DKWA 2W8KA 2BCQA 4F5PA 4KN7A 3KHRA 4DQQA 2QARA 2W54A 4R66A 1NJZA 3UXPA 3FYHA 2E8NA 7ICUA 4YXMA 4QNLA 3DEEA 5AI6A 5J2KA 4KLOA 4I2AA 1B22A 1QSLA 9ICGA 3AN1A 1NK0A 4RQ1A 8ICXA 3RRHA 2KKPA 4ECVA 1VDVA 1L3SA 5EWFA 3WKAA 4YMNA 3RF9A 4I2EA 4K4IA 3M8SA 1SB3C 3AU6A 5J2AA 2AXTU 5L1MA 4RQ5A 2YQEA 2GWSA 1KRPA 4ED7A 4C4SA 2E3TA 4J9OA 4YQWA 3ISCA 2F44A 1NI3A 1AQ6A 3F2BA 2KV2A 1D9DA 5AKYA 5AI9A 1UA0A 5AK4A 2C22A 1VLBA 4F93B 2GOLA 3LDAA 4P4PA 1NZBA 2ZIXA 5F9LA 2AQ4A 5J2GA 5KG7A 5ALSA 4NM2A 3MBYA 1S77D 4F71A 8ICBA 1Q46A 4IRCA 3WKEA 5J2EA 2C2DA 3JPRA 3SI8A 7ICNA 3PSIA 1K1QA 4DF8A 2IHNA 1ZQUA 7ICQA 5ALGA 4QZGA 3AM9A 4M9LA 2JZBA 2HBKA 4ECQA 3BZCA 1BPZA 5L1IA 3A0HU 2ZXIA 3V7JA 1ZQHA 9ICWA 2FPMA 4C4RA 1SXDA 2ESEA 2E8OA 2ZIUA 4RQ4A 5ALLA 2P66A 3PW4A 1TAUA 7ICOA 8ICWA 2JR5A 3H7IA 3ALRA 1JROA 4LVSA 2F2AB 1WUDA 3Q8RB 4O3RA 1WYGA 4ACOA 2MU2A 5ALHA 1QTMA 3A0BU 1O03A 4YCXA 2H3ZA 4MF2A 3V6HA 2F1IA 2G09A 1ZJMA 7ICFA 2B0CA 2Q4TA 2FLPA 2FPLA 3C29A 5ALEA 2WF6A 4KITB 4XRHA 3IRUA 1UPHA 3NTUA 2FDRA 5DG8A 3IV6A 5J2BA 2BCUA 2EQYA 2BDUA 2YB1A 2OWOA 4QZ8A 1SV0C 2ZUDA 2EAOA 4DWIA 2YX8A 2R8IA 4B9NA 1ZQDA 3NRWA 4M9GA 4RPXA 3ZD9A 1N61A 4KLHA 4RT2A 2HOIA 2AJQA 2JHDA 4QWDA 2G07A 5ALFA 7ICIA 1ZQLA 3KTQA 8ICGA 5K4LA 8ICLA 2HOFA 2WF8A 1KN5A 3QEAZ 2YMLA 3N7RC 3RJIA 3TANA 3JPPA 4DOAA 4UATA 1SKWA 4LZGA 2F1HA 1NZPA 4DL7A 3TAPA 1A77A 5KFBA 2DBYA 2JMGA 5J0QA 2ES6A 5T14A 3LK9A 3UM9A 2YTUA 2DL0A 3GIKA 1NKCA 4MFAA 1XS9D 5EE1A 3PMLA 2VA8A 4UB4A 4P0PA 2BHNA 3WK6A 4NY8A 1SWVA 5KG1A 3IG5A 1L7NA 2O6KA 2ZTEA 1XWLA 3SENA 3U26A 4CNQA 2ZIUB 4ED0A 1RPLA 1MQ2A 2G5HB 1F0MA 2KZ3A 2BQ3A 4M9HA 1DXSA 5J2HA 5HR6A 4KX5A 4DL6A 1U45A 4NLNA 2DFLA 5ALVA 4FZNA 4DEZA 4I2FA 2HHQA 1TKDA 5DQGA 3SMVA 1SZPA 2K89A 5KFFA 5EE9A 3QYPA 8ICIA 3BQ0A 2N1RA 3HWTA 1OXJA 4NM1A 2F8LA 3GIMA 3M9OB 4PGXA 3IP4B 4EELA 3B0YA 2JEFA 5KFJA 1SZHA 4KLMA 2NRZA 2AGQA 5KFIA 1LV5A 1N62A 1IM4A 2KEYA 1XC9A 3H0LB 5AIBA 9ICHA 3DV9A 2F77X 3QEBZ 2K60A 3CNHA 2V4RA 4QZDA 2BPFA 3RJFA 1ZQXA 5KT4A 3Q8PB 1L3VA 5ALKA 1ZQAA 2G08A 2LYBA 3M6ZA 1Z1BA 2C2EA 1UA1A 3EZ5A 3BDPA 3E2EA 3NVWA 2RQ5A 2KJ5A 5HNKA 3ONNA 4F5RA 5KL1B 1N48A 3QX7A 3G6VA 4KLLA 3ZDAA 2HBMA 4G3IA 4I2HA 2NRXA 4F4ZA 4RQ3A 5DBCA 5AK3A 5CJ7A 3TQ1A 4O5EA 3G6XA 2JEIA 1X40A 1X9XA 7ICPA 4NV0A 2MAXA 8ICZA 4QZEA 3HT3A 4O5KA 3RH4A 3H8WA 1L8OA 3NVVA 3QZ8A 1L7MA 1UHUA 1A76A 2F1JA 1OW5A 2QLTA 2WF5A 1TV9A 1TK8A 1L3UA 2M9NA 1MC8A 1DRGA 5AI8A 2Y0SC 3B0XA 3UPQA 4YN4A 8ICSA 2KFNA 3WKCA 5KG3A 2D3DA 5ALYA 2YMMA 2EANA 4YD1A 2XCPA 4EEKA 3CW2C 5ALDA 2A3VA 2VA2A 1IXRA 3D6JA 4QZ9A 2BPCA 2DKZA 4A8EA 5BPCA 4YD2A 2FLNA 4IQWA 2CPRA 3UXNA 2LYHA 4P0PB 1ZQOA 3HPOA 3RR8A 1S76D 3GV7B 1PVPA 4F4XA 4R64A 1VJ5A 2I1QA 7ICEA 5DG7A 5KT5A 2Q0ZX 1D8YA 2HCFA 4CF3A 4MHVA 4DQPA 3RH6A 4EYIB 3TADC 1WWUA 3QUQA 3JPSA 3D2NA 2PFNA 1N2XA 2BGWA 4R8UA 5KFOA 1ZQQA 3C28A 4NLCA 2UVUA 4AYBF 1QSYA 2ZIVA 3NRZA 3PV8A 4DL2A 4ECYA 3EUB2 4I2JA 8ICYA 4Y2VA 2E8MA 7ICVA 2R8GA 1Q8KA 3KZIU 3RH5A 7ICJA 2H5XA 2HSZA 5BOMA 4JV2A 1XSNA 5DB8A 4Q8FA 7ICHA 4DSJA 1SKRA 2A1JA 2CN1A 5AKJA 4HAIA 3T5KA 3EW9A 3S6JA 2CRXA 2ISOA 3LYSA 3MC1A 1L3TA 9ICAA 1DK2A 5AKIA 3RB6A 5HR7A 3OHBA 2IOHA 3MGVA 2KIVA 4GFJA 2EAPA 2YY6A 4UAYA 2IA6A 3NGDA 1ZD4A 3JPQA 5B66U 2PFQA 3TACB 9ICBA 5AKKA 3VCBA 5IIIA 2R8KA 1NNLA 2EZYA 3HKZF 5KG6A 1Q3UA 2QB0B 4DS5A 8ICPA 4QJFB 3MFHA 3E0FA 1FFUA 4ECWA 1WCNA 4RNNA 4US8A 4EX6A 4YR2A 2RLTA 2PXIA 1XNSA 2LYAA 8ICRA 3RBDA 5F3XB 5J8YC 5J2DA 5KAIU 2DPIA 4KLSA 5J0SA 4QWEA 4OO1J 4BDPA 5KFRA 1ZQYA 3EYZA 4BXOB 5IIJA 4DSLA 1BVSA 1KFSA 4KMUA 4B9SA 2R8JA 4O3OA 4CCHA 2MSNA 3AQEA 2JEGA 3RJGA 4O3MA 4BX9C 2JZBB 2JV3A 1X42A 1U9LA 2EDUA 4DOCA 1Z00B 1L6NA 3V6JA 9ICQA 4RQ0A 2IHMA 2AGOA 2PI5A 8ICAA 1DGSA 4NJ8A 4C8MA 4DFJA 2HI0A 3L5KA 5L1JA 1NJYA 1JXEA 4PGYA 1EXNA 2KSOB 4TUPA 2B21A 4NXZA 3SYZA 2V9WA 4Q45A 5KFDA 3LVVA 5DB6A 3TAQA 4ELUA 2JGAA 3GILA 2WTFA 1B43A 2Y0SF 5KFZA 4YP3A 1Z00A 5DG9A 2W3SA 3CYMA 8ICMA 4I2CA 4TURA 1DK3A 3MGHA 2E5SA 4XUSA 4EZ6A 2K4EA 3IG8A 1ZQSA 4K4GA 1PK1B 2KTQA 1XSPA 4F72A 5DBAA 4O0IA 5A0LA 2WHEA 1CUKA 2MUTB 1S9FA 3WK5A 1H38A 4NLKA 1N60A 4IRDA 4DS4A 4DFKA 1JMSA 5DB7A 5ALNA 3ZD8A 1RQLA 5KFXA 2FE9A 4C7YA 5KFQA 3IHQB 1SGGA 5KNIA 1T3NA 2GO7A 4C7ZA 4Y2PA 4ECXA 3H0MB 4IRKA 5AKLA 4M6WA 4DSEA 2WFAA 2KG5A 2MA1A 3GIIA 4F5QA 1K5OA 3PR4A 2K8AA 3PMNA 5C0YA 4LJXA 4RT3A 1HUZA 2HW3A 1S8OA 3FM9A 3NASA 9ICEA 2A1JB 4BWMA 2K4IA 1ZQEA 5H2FU 1SV4A 5IIKA 2F3NA 2W9BB 1QQ6A 5IIOA 2YB4A 2J6SA 1KW4A 2XC9A 2VA3A 4Y2JA 1NK5A 2FI1A 5JUMA 3ISBA 2ZJ5A 1QH9A 3VC8A 1A6SA 1JALA 4ED8A 2D8CA 4J9SA 4UB5A 4ECUA 4B9VA 4ED3A 1J97A 3PNCA 1HIWA 4CRXA 1NKBA 1QSSA 3OHAA 4GIBA 3C1ZA 1V85A 3ETRA 2H3IA 3NVZA 1GO3F 8ICQA 1TK5A 2DKXA 5HP4A 4I29A 2BCRA 4Q43A 2OCEA 1ZQTA 1NK8A 4KN4A 3IDWA 1XO0A 3WK7A 3C5FA 4OD0A 5DDMA 1IG6A 1UCVA 1MQ3A 5DGAA 2Y1IA 2HHTA 1BPEA 2KNJA 5F9NA 4UQGA 1OUQA 4IL6U 2JH1A 1PK3A 1B0XA 2ATLA
chains in the Genus database with same CATH topology
1SGGA 1X66A 2DKZA 5KNIA 5J8YA 5F3XB 5J8YC 2F44A 2KG5A 2E8PA 4PZNA 4MHVA 3H8MA 3HILA 2Y9UA 1Z1VA 3TADC 1WWUA 2JV3A 2K60A 2KMDA 1RG6A 3BS7A 2ES6A 5JTIA 1SV4A 2F3NA 1PK1A 2YTUA 4NJ8A 2DL0A 2B6GA 1UQVA 1KW4A 4PZOA 2F8KA 2L5YA 2KSOB 2QB0A 1SXDA 2E8MA 2ESEA 2E8OA 3BS5B 2GLEA 4RQMA 3K1RB 2D8CA 2QKQA 1LKYA 2K4PA 4RQNA 2QARA 2QB1A 3SENA 4NL9C 3KKAA 3SEIA 3TADA 2E8NA 5JU5A 3BS5A 1X40A 1SV0A 1X9XA 1V85A 2KSOA 2LPEA 4NL9A 1F0MA 1V38A 1DXSA 2DKXA 2KIVA 4IS7A 1PK1B 2EAPA 2QARB 3BQ7A 1OW5A 3IDWA 2KE7A 3TACB 1LKYB 1COKA 1UCVA 1JI7A 3KKAC 1SXEA 1SV0C 2EAOA 1WWVA 2QB0B 2Y9TA 2D3DA 2EANA 2EAMA 5L1MA 1OXJA 2FE9A 2LMRA 5JRTA 1PK3A 1B0XA 1B4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGG A;  1X66 A;  2DKZ A;  5KNI A;  5J8Y A;  5F3X B;  5J8Y C;  2F44 A;  2KG5 A;  2E8P A;  4PZN A;  4MHV A;  3H8M A;  3HIL A;  2Y9U A;  1Z1V A;  3TAD C;  1WWU A;  2JV3 A;  2K60 A;  2KMD A;  1RG6 A;  3BS7 A;  2ES6 A;  5JTI A;  1SV4 A;  2F3N A;  1PK1 A;  2YTU A;  4NJ8 A;  2DL0 A;  2B6G A;  1UQV A;  1KW4 A;  4PZO A;  2F8K A;  2L5Y A;  2KSO B;  2QB0 A;  1SXD A;  2E8M A;  2ESE A;  2E8O A;  3BS5 B;  2GLE A;  4RQM A;  3K1R B;  2D8C A;  2QKQ A;  1LKY A;  2K4P A;  4RQN A;  2QAR A;  2QB1 A;  3SEN A;  4NL9 C;  3KKA A;  3SEI A;  3TAD A;  2E8N A;  5JU5 A;  3BS5 A;  1X40 A;  1SV0 A;  1X9X A;  1V85 A;  2KSO A;  2LPE A;  4NL9 A;  1F0M A;  1V38 A;  1DXS A;  2DKX A;  2KIV A;  4IS7 A;  1PK1 B;  2EAP A;  2QAR B;  3BQ7 A;  1OW5 A;  3IDW A;  2KE7 A;  3TAC B;  1LKY B;  1COK A;  1UCV A;  1JI7 A;  3KKA C;  1SXE A;  1SV0 C;  2EAO A;  1WWV A;  2QB0 B;  2Y9T A;  2D3D A;  2EAN A;  2EAM A;  5L1M A;  1OXJ A;  2FE9 A;  2LMR A;  5JRT A;  1PK3 A;  1B0X A;  1B4F A; 
#chains in the Genus database with same CATH topology
 4M0A A;  4Q8E A;  1RYU A;  1IV8 A;  4JV0 A;  5BOL A;  4IC9 A;  4KLT A;  3SAH A;  4UBC A;  1N56 A;  4ECR A;  5CHG A;  3KHH A;  1UT8 A;  3M9M B;  8ICF A;  5TZV A;  4UB3 A;  4FBT A;  3SV4 A;  4IQV A;  4NLB A;  5KG2 A;  4M04 A;  2H3F A;  3RJJ A;  4CF4 A;  4ECS A;  1UQV A;  2ASJ A;  3V6K A;  5AM4 A;  2XY6 A;  2W03 A;  5HHI A;  5D46 A;  3BS5 B;  5DQI A;  4Y2S A;  2ZXH A;  2NRW A;  4J9Q A;  5IIM A;  2QKQ A;  3PZP A;  1KKX A;  5AI4 A;  2ODG A;  4MFF A;  4UW9 A;  2DF4 B;  1ZQJ A;  8ICN A;  4NL9 C;  4DL5 A;  4YMO A;  5KFY A;  2YMQ A;  4B9T A;  4O3S A;  5AM5 A;  2OH2 A;  1SV0 A;  3H4B A;  4I2B A;  3RJE A;  5DQH A;  3K4G A;  9ICR A;  3MR3 A;  2VJ5 A;  2BQR A;  2ISP A;  2P35 A;  4CE6 A;  5ALQ A;  5J0X A;  2R18 A;  3AU2 A;  1URJ A;  4MF8 A;  2VKQ A;  2XCA A;  4YFK A;  4US9 A;  4DCC A;  5J2F A;  4F50 A;  2M0N A;  5ALI A;  2FPK A;  2PFP A;  1RQN A;  2MRL A;  3MR6 A;  2OYY A;  3E58 A;  7ICT A;  4K4H A;  4F4Y A;  3OPX A;  3GIJ A;  1UT5 A;  2ASD A;  1ZOL A;  2FMP A;  3Q8K A;  1NK9 A;  1Z4N A;  1S0V A;  2J6U A;  4OJ6 A;  4BGD A;  3BQT A;  5KFH A;  5AI0 A;  3V72 A;  2ZG6 A;  4P2H A;  2E8P A;  2XI9 A;  3EWA A;  1KFD A;  4Y2Y A;  2DWQ A;  3PSP A;  2WB1 C;  3H8M A;  2HHS A;  3HIL A;  5AK6 A;  3PST A;  4BXO A;  9ICF A;  2HOQ A;  5EWE A;  5J29 A;  4P4O A;  5KFA A;  1CI4 A;  3SV3 A;  4J9P A;  5G5G A;  2IOF K;  9ICV A;  2QB0 A;  3MDA A;  1NKE A;  1JXL A;  1S97 A;  5AKG A;  9ICT A;  5HML A;  1Z4O A;  4OJ5 A;  1ZQ1 C;  4UAU A;  2WAQ F;  4F5N A;  9ICX A;  1ZD3 A;  4C8K A;  1Y88 A;  4JB3 A;  4EX7 A;  3DDH A;  4RQN A;  2LI6 A;  4Z6E A;  2BKE A;  5DLF A;  3LWM A;  1YZ7 A;  4Z6F A;  2XVT A;  8ICO A;  1WCL A;  4JV1 A;  5CRX A;  3FAH A;  4DFM A;  2FMQ A;  2A19 A;  1ZQM A;  3MAB A;  4F92 B;  5KFW A;  3WK4 A;  1FEZ A;  2LKY A;  4RQ6 A;  4IR1 A;  5J2J A;  2NYV A;  1X9S A;  5AM3 A;  3AUO A;  2W11 A;  2G5I B;  5J0Y A;  1ZQC A;  3ZDD A;  1WWV A;  3M9N B;  2ZTC A;  3PO4 A;  5KT7 A;  3BZK A;  1MSW D;  1BPY A;  2ZIV B;  2KIW A;  3JPT A;  4Z6C A;  4UBB A;  3ICX A;  3M7D A;  5J8Y A;  1ZQW A;  1PVQ A;  3UMG A;  4M9J A;  2KJ8 A;  1MN8 A;  3T5H A;  4B9M A;  4Y2U A;  4ZH4 A;  1ZXI A;  4RNM A;  3ORY A;  4JMU A;  5CEH A;  2KMD A;  5G5H A;  3FDS A;  4DSF A;  4FZL A;  3D2Q A;  4RPY A;  3F5A A;  4UB2 A;  4EEY A;  3TFS A;  2F8K A;  5L1K A;  1TAQ A;  4QIW C;  1LVH A;  1N5W A;  1SL1 A;  1Z19 A;  4QZF A;  1ECW A;  4GXJ A;  4EBC A;  2W7P A;  2XIC A;  4GXI A;  4F5O A;  1T8E A;  4PGQ A;  1RXV A;  4R63 A;  2ZUC A;  1KLN A;  3KKA A;  5J0O A;  4DSK A;  2KHQ A;  5DLG A;  5CP2 A;  5AKH A;  4RQ8 A;  2DPJ A;  1ZQF A;  3ZDE A;  2ZIX B;  2KFZ A;  7ICM A;  5J2C A;  3TAR A;  4FE3 A;  4OCZ A;  2KD1 A;  1KDH A;  1BNO A;  4DL3 A;  4PHA A;  5EE3 A;  3WK8 A;  3L3F X;  3QXG A;  5AK5 A;  2EZZ A;  8ICV A;  3KD3 A;  4YR0 A;  2CXY A;  4C8O A;  4J9K A;  2RDI A;  2K8B B;  4MEY A;  4YMM A;  2FJ6 A;  2VJ4 A;  1KEJ A;  3WK9 A;  3NS1 A;  4Z6D A;  2W9C A;  4GC7 A;  3KZX A;  5E79 U;  5DBB A;  5ALU A;  3MDC A;  1JN3 A;  4TQS A;  3C1Y A;  3MFI A;  2HBL A;  3HX0 A;  4UAZ A;  4UAW A;  4UAR A;  4IQU A;  2BR0 A;  4BWJ A;  3PW0 A;  3M1Y A;  3HKZ C;  4Y2T A;  3RFA A;  1QLN A;  1SIJ A;  3KOO A;  2OXO A;  1L7P A;  1MA7 A;  2DUY A;  1SL0 A;  2LM1 A;  1ZQG A;  1CRX A;  4FS2 A;  1YT3 A;  5L1L A;  2B6G A;  3ZDC A;  3QE9 Y;  2BDP A;  1JUD A;  2V4Q A;  5DB9 A;  4P0Q A;  3WU2 U;  3Q8M A;  3N7P D;  2HDO A;  2LM4 A;  2GLE A;  4RQM A;  5J2I A;  4E0D A;  2P6U A;  4CF5 A;  5KFG A;  3RTV A;  4MFC A;  4F91 B;  3K1Z A;  3D2S A;  1N5X A;  5J0W A;  3IN5 A;  2LPE A;  1HUO A;  3AEV A;  3JPN A;  1ZD2 P;  3GQC A;  8ICT A;  4AYB C;  1L7O A;  5KFS A;  4XA5 A;  3BQ7 A;  8ICK A;  1BPX A;  3K75 D;  4DF4 A;  5EWG A;  4I2G A;  4KLQ A;  3C2M A;  4O3N A;  4DSI A;  2KKV A;  3O0F A;  3BJY A;  2E1F A;  2XY5 A;  3WKD A;  5D49 A;  4Q44 A;  1C7Y A;  2IMW P;  1Z3E B;  1BPD A;  3TI0 A;  4XQ8 A;  2OM6 A;  4KLE A;  2LMR A;  5AKX A;  4ELT A;  3RB3 A;  5DDY A;  5KT6 A;  2J6T A;  4AP9 A;  3QU2 A;  5CB1 A;  3T5J A;  2KJ9 A;  2VIX A;  4DQI A;  4FZM A;  4DOB A;  2NO5 A;  1JRP A;  5ALX A;  4PZN A;  1WG8 A;  4F2R A;  4YG2 A;  3RAX A;  1TE2 A;  5ALJ A;  3N28 A;  5C5J A;  3PW7 A;  1Z1V A;  5KFM A;  4HYK A;  2KHV A;  3H0R B;  5KG5 A;  9ICK A;  2W9M A;  4B9U A;  1RG6 A;  2HMX A;  1ZRM A;  4NLG A;  3ED5 A;  2EH9 A;  4RPZ A;  4C8L A;  5KFU A;  4UAV A;  2GH1 A;  1ZD5 A;  2UVV A;  4JK1 A;  3UQ0 A;  3QNM A;  1COO A;  4QWB A;  9ICJ A;  3OTQ A;  2DQN B;  3K1R B;  3RRG A;  1L5U A;  4EYH B;  3SEI A;  4DO9 A;  5ALT A;  1HEK A;  4KLI A;  4PPX A;  7ICL A;  7ICS A;  1XU4 A;  4USA A;  5GTI U;  3PSF A;  5IIN A;  3EPG A;  5KFP A;  4TUS A;  1D9F A;  3QZ7 A;  4RQ7 A;  2JRZ A;  1KQQ A;  4FS1 A;  3ISD A;  4RNO A;  1JIH A;  2Z7J A;  1V9P A;  2I5H A;  2R8H A;  1ZQK A;  1JX4 A;  3KKA C;  3SAG A;  5EE0 A;  1SXE A;  1ZQP A;  3C23 A;  4ED6 A;  2AQ0 A;  4RZR A;  4CDG A;  4I27 A;  4JWN A;  1KFT A;  1S0N A;  2BQU A;  5KFT A;  1FIQ A;  1B4F A;  2G06 A;  2FLL A;  2DGZ A;  4KLF A;  5J0P A;  4DLE A;  3KBB A;  2K4H A;  1X9W A;  3LVW A;  1KBU A;  2PFO A;  1BNP A;  3Q8Q B;  2XO7 A;  4TUQ A;  3Q8L A;  4QZI A;  4P0Q B;  3HJE A;  3MR5 A;  3AL0 B;  5KFV A;  5ALM A;  2IBK A;  3RR7 A;  2UVR A;  4OJL A;  1L8L A;  5AIA A;  1X6J A;  5KG4 A;  4J9M A;  2W55 A;  1ZQV A;  3BS7 A;  1RZT A;  3IM1 A;  4ECZ A;  5JTI A;  5ALR A;  1RYR A;  3CRX A;  5DGB A;  1ARO P;  5GTH U;  3SZ2 A;  5J0T A;  3SR6 A;  1QQ7 A;  1J2M A;  3TKA A;  3F2D A;  1T7P A;  2P6R A;  1U47 A;  4ICA A;  4PZO A;  3PW2 A;  2L5Y A;  5KFL A;  2HBJ A;  2W04 A;  4F8R A;  4PHD A;  3GFK B;  2WB1 F;  1KTQ A;  4MEX A;  4O9M A;  7ICG A;  2W43 A;  4RU9 A;  2W9C B;  2QB1 A;  4KLG A;  5KFK A;  3I28 A;  3TAD A;  4J9L A;  3QU7 A;  3QUB A;  3BS5 A;  3GV8 B;  4DLG A;  5KFC A;  4QZC A;  1CEZ A;  1V38 A;  1D8L A;  1U49 A;  3T79 A;  4IS7 A;  5KG0 A;  2QAR B;  4F2S A;  2OEH A;  1K1S A;  4M9N A;  4UB6 U;  1COK A;  3PY8 A;  4PL1 A;  1P7D A;  1SKS A;  2ALZ A;  2H3V A;  4J03 A;  1ZQR A;  2HHX A;  3H8S A;  2KK0 A;  4QWA A;  1S0O A;  3QUC A;  1X6I A;  4DQS A;  1ZRN A;  1NK6 A;  4LZD A;  3SD7 A;  5J0U A;  3UQ2 A;  3HW8 A;  3C5G A;  3PR5 B;  2D6F C;  3GDX A;  2ZIW B;  2BZF A;  1NOM A;  5KT3 A;  5D4B A;  4PHE A;  4C80 A;  2Y9U A;  4F3O A;  4I28 A;  4ED1 A;  3SQI A;  1QQ5 A;  2NO4 A;  3OJU A;  4U7C A;  4PL2 A;  3I76 A;  2AGP A;  1LB2 B;  2PMZ F;  4Y2Q A;  3QUT A;  1QCK A;  1Q3V A;  3LWL A;  1BPB A;  9ICU A;  2XGP A;  1ZQB A;  4U6P A;  1PZN A;  1TVA A;  3V7L A;  3AMZ A;  2W7O A;  4ZOH C;  2RP5 A;  3T3F A;  8ICH A;  3MGI A;  4UAS A;  3KHG A;  1S5L U;  1KL9 A;  2LHT A;  5ALZ A;  1PUZ A;  2XY7 A;  5JU5 A;  3C2K A;  4O3P A;  4KTQ A;  2PI4 A;  1SWW A;  1XO1 A;  1X2I A;  2RRD A;  1F44 A;  3OJS A;  3AQF A;  1O08 A;  4FO6 A;  2KP7 A;  4TQR A;  4QW8 A;  3GV5 B;  1DOQ A;  3BQ2 A;  1NK7 A;  3FC4 A;  2HHV A;  2E1E A;  4QZB A;  4KLU A;  3H8J A;  5CA7 A;  3V7K A;  4GC6 A;  2ASL A;  4Y2X A;  3SAF A;  5KFE A;  4M6W B;  3G6Y A;  3F2C A;  4CGZ A;  2UVW A;  3CP8 A;  4I2D A;  4EBD A;  5TIS U;  2ZJ8 A;  4DFP A;  1S0M A;  3RAQ A;  1FFV A;  4KLJ A;  4OJO A;  4YVZ A;  3OGU A;  4GLX A;  9ICC A;  4OJP A;  4C8N A;  3RB4 A;  3T5L A;  1BGX T;  4G9B A;  3PX4 A;  5B5E U;  2IOF A;  1RYS A;  3J81 j;  2C28 A;  2K8C B;  2VAN A;  2AHO B;  5CWR A;  4KMO B;  2MUT A;  3I1Y A;  3N7S C;  5ALO A;  1U4B A;  4FFD A;  1PK1 A;  2H3Q A;  3N4M B;  2JH7 A;  3TFR A;  5J0R A;  3M8R A;  4Y2R A;  5AM1 A;  3BQ1 A;  2ZJA A;  4QW9 A;  1FO4 A;  4RUC A;  3GZF A;  1DGJ A;  5AM2 A;  2C2R A;  2HVI A;  4UB8 U;  5IIL A;  1LKY A;  1T4G A;  3Q8S B;  2YN4 A;  4PJ0 U;  1C20 A;  2KVC A;  1V97 A;  1TK0 A;  2W8L A;  2BPG A;  3RB0 A;  2BCS A;  3F5E A;  4B6J A;  3L4P A;  2OHF A;  4BJQ A;  4O3Q A;  3RBE A;  2KSO A;  5AIC A;  4DL4 A;  1T94 A;  1F5S A;  2WF7 A;  4JUZ A;  4IQT A;  4RQ2 A;  3PVX A;  1U48 A;  4DQR A;  4F4W A;  4C4T A;  4NLZ A;  2KN7 A;  5EOZ A;  1LKY B;  1T3Q A;  2BCV A;  3UMC A;  1JI7 A;  3QU4 A;  5KTQ A;  1RDF A;  1N63 A;  4QZH A;  1ZET A;  2KIC A;  8ICE A;  3MR2 A;  5KL8 B;  8ICU A;  2Y9T A;  3QU9 A;  3H40 A;  1ZQI A;  1YZ6 A;  5CR0 A;  2ZUB A;  3RJK A;  4J9N A;  5JRT A;  4QWC A;  4O5C A;  2JEJ A;  3KHL A;  3F53 A;  4M47 A;  4IR9 A;  4FBU A;  2AU0 A;  4F4K A;  2NV3 A;  2PKE A;  1ZYQ A;  2NRT A;  3UXO A;  5ALW A;  2NRV A;  4I2I A;  3ZDB A;  2ZTD A;  3GU3 A;  3R9K A;  3THV A;  5AI5 A;  5HMM A;  3PW5 A;  2PMZ C;  1A0P A;  5HHH A;  2KZZ A;  4RUA A;  2YMP A;  1S10 A;  8ICJ A;  2HHW A;  4X5V A;  3C21 A;  2WAQ C;  4J9R A;  4EZ9 A;  3B9J A;  7ICR A;  9ICI A;  2HVH A;  5ALP A;  2Y1J A;  5AKE A;  4QIW F;  1RXW A;  1NJW A;  4R65 A;  2XID A;  5KFN A;  3HP6 A;  3PO5 A;  3RJH A;  1M6Y A;  5AKZ A;  3PX0 A;  7ICK A;  3WKB A;  5KAF U;  2HHU A;  9ICO A;  1TFR A;  2RHF A;  2W3R A;  2K4P A;  4PHP A;  2LBO A;  4ECT A;  3H4D A;  3C2L A;  1PVR A;  4ELV A;  4YXJ A;  9ICS A;  2F76 X;  4ED2 A;  3NVY A;  4NL9 A;  2RDJ A;  5FP0 A;  4M2Y A;  2A1A A;  1ED1 A;  4NWI A;  4WJ3 B;  9ICL A;  3UMB A;  9ICN A;  4UB1 A;  3PX6 A;  2I6X A;  3QU5 A;  2KE7 A;  4JWM A;  1J2N A;  5KT2 A;  4R8U B;  9ICM A;  4KLD A;  2KZM A;  1KSP A;  4YR3 A;  4PH5 A;  2EAM A;  3HRD D;  3EPI A;  2XGQ A;  1ZQN A;  1ZQZ A;  1RM6 C;  2WF9 A;  4B9L A;  2G0A A;  3OSN A;  1D8B A;  2KOB A;  1X66 A;  3OSP A;  5L9X A;  3KFU F;  3ZI4 A;  5AHX A;  1ZJN A;  1HJP A;  4EBE A;  8ICC A;  2KVS A;  3N97 B;  3ETL A;  3JPO A;  3NUQ A;  5AM0 A;  1X9M A;  2I9G A;  4DFD A;  2ZIW A;  2W9A A;  4EEN A;  4C0Z A;  2W9B A;  1SL2 A;  1XSL A;  4GXK A;  3M6K A;  1NK4 A;  1NJX A;  4BUG A;  4KX3 A;  1IIP A;  1TAM A;  2EZX A;  4QZA A;  4P4M A;  2FMS A;  2JXJ A;  9ICP A;  2AH5 A;  5DKW A;  2W8K A;  2BCQ A;  4F5P A;  4KN7 A;  3KHR A;  4DQQ A;  2QAR A;  2W54 A;  4R66 A;  1NJZ A;  3UXP A;  3FYH A;  2E8N A;  7ICU A;  4YXM A;  4QNL A;  3DEE A;  5AI6 A;  5J2K A;  4KLO A;  4I2A A;  1B22 A;  1QSL A;  9ICG A;  3AN1 A;  1NK0 A;  4RQ1 A;  8ICX A;  3RRH A;  2KKP A;  4ECV A;  1VDV A;  1L3S A;  5EWF A;  3WKA A;  4YMN A;  3RF9 A;  4I2E A;  4K4I A;  3M8S A;  1SB3 C;  3AU6 A;  5J2A A;  2AXT U;  5L1M A;  4RQ5 A;  2YQE A;  2GWS A;  1KRP A;  4ED7 A;  4C4S A;  2E3T A;  4J9O A;  4YQW A;  3ISC A;  2F44 A;  1NI3 A;  1AQ6 A;  3F2B A;  2KV2 A;  1D9D A;  5AKY A;  5AI9 A;  1UA0 A;  5AK4 A;  2C22 A;  1VLB A;  4F93 B;  2GOL A;  3LDA A;  4P4P A;  1NZB A;  2ZIX A;  5F9L A;  2AQ4 A;  5J2G A;  5KG7 A;  5ALS A;  4NM2 A;  3MBY A;  1S77 D;  4F71 A;  8ICB A;  1Q46 A;  4IRC A;  3WKE A;  5J2E A;  2C2D A;  3JPR A;  3SI8 A;  7ICN A;  3PSI A;  1K1Q A;  4DF8 A;  2IHN A;  1ZQU A;  7ICQ A;  5ALG A;  4QZG A;  3AM9 A;  4M9L A;  2JZB A;  2HBK A;  4ECQ A;  3BZC A;  1BPZ A;  5L1I A;  3A0H U;  2ZXI A;  3V7J A;  1ZQH A;  9ICW A;  2FPM A;  4C4R A;  1SXD A;  2ESE A;  2E8O A;  2ZIU A;  4RQ4 A;  5ALL A;  2P66 A;  3PW4 A;  1TAU A;  7ICO A;  8ICW A;  2JR5 A;  3H7I A;  3ALR A;  1JRO A;  4LVS A;  2F2A B;  1WUD A;  3Q8R B;  4O3R A;  1WYG A;  4ACO A;  2MU2 A;  5ALH A;  1QTM A;  3A0B U;  1O03 A;  4YCX A;  2H3Z A;  4MF2 A;  3V6H A;  2F1I A;  2G09 A;  1ZJM A;  7ICF A;  2B0C A;  2Q4T A;  2FLP A;  2FPL A;  3C29 A;  5ALE A;  2WF6 A;  4KIT B;  4XRH A;  3IRU A;  1UPH A;  3NTU A;  2FDR A;  5DG8 A;  3IV6 A;  5J2B A;  2BCU A;  2EQY A;  2BDU A;  2YB1 A;  2OWO A;  4QZ8 A;  1SV0 C;  2ZUD A;  2EAO A;  4DWI A;  2YX8 A;  2R8I A;  4B9N A;  1ZQD A;  3NRW A;  4M9G A;  4RPX A;  3ZD9 A;  1N61 A;  4KLH A;  4RT2 A;  2HOI A;  2AJQ A;  2JHD A;  4QWD A;  2G07 A;  5ALF A;  7ICI A;  1ZQL A;  3KTQ A;  8ICG A;  5K4L A;  8ICL A;  2HOF A;  2WF8 A;  1KN5 A;  3QEA Z;  2YML A;  3N7R C;  3RJI A;  3TAN A;  3JPP A;  4DOA A;  4UAT A;  1SKW A;  4LZG A;  2F1H A;  1NZP A;  4DL7 A;  3TAP A;  1A77 A;  5KFB A;  2DBY A;  2JMG A;  5J0Q A;  2ES6 A;  5T14 A;  3LK9 A;  3UM9 A;  2YTU A;  2DL0 A;  3GIK A;  1NKC A;  4MFA A;  1XS9 D;  5EE1 A;  3PML A;  2VA8 A;  4UB4 A;  4P0P A;  2BHN A;  3WK6 A;  4NY8 A;  1SWV A;  5KG1 A;  3IG5 A;  1L7N A;  2O6K A;  2ZTE A;  1XWL A;  3SEN A;  3U26 A;  4CNQ A;  2ZIU B;  4ED0 A;  1RPL A;  1MQ2 A;  2G5H B;  1F0M A;  2KZ3 A;  2BQ3 A;  4M9H A;  1DXS A;  5J2H A;  5HR6 A;  4KX5 A;  4DL6 A;  1U45 A;  4NLN A;  2DFL A;  5ALV A;  4FZN A;  4DEZ A;  4I2F A;  2HHQ A;  1TKD A;  5DQG A;  3SMV A;  1SZP A;  2K89 A;  5KFF A;  5EE9 A;  3QYP A;  8ICI A;  3BQ0 A;  2N1R A;  3HWT A;  1OXJ A;  4NM1 A;  2F8L A;  3GIM A;  3M9O B;  4PGX A;  3IP4 B;  4EEL A;  3B0Y A;  2JEF A;  5KFJ A;  1SZH A;  4KLM A;  2NRZ A;  2AGQ A;  5KFI A;  1LV5 A;  1N62 A;  1IM4 A;  2KEY A;  1XC9 A;  3H0L B;  5AIB A;  9ICH A;  3DV9 A;  2F77 X;  3QEB Z;  2K60 A;  3CNH A;  2V4R A;  4QZD A;  2BPF A;  3RJF A;  1ZQX A;  5KT4 A;  3Q8P B;  1L3V A;  5ALK A;  1ZQA A;  2G08 A;  2LYB A;  3M6Z A;  1Z1B A;  2C2E A;  1UA1 A;  3EZ5 A;  3BDP A;  3E2E A;  3NVW A;  2RQ5 A;  2KJ5 A;  5HNK A;  3ONN A;  4F5R A;  5KL1 B;  1N48 A;  3QX7 A;  3G6V A;  4KLL A;  3ZDA A;  2HBM A;  4G3I A;  4I2H A;  2NRX A;  4F4Z A;  4RQ3 A;  5DBC A;  5AK3 A;  5CJ7 A;  3TQ1 A;  4O5E A;  3G6X A;  2JEI A;  1X40 A;  1X9X A;  7ICP A;  4NV0 A;  2MAX A;  8ICZ A;  4QZE A;  3HT3 A;  4O5K A;  3RH4 A;  3H8W A;  1L8O A;  3NVV A;  3QZ8 A;  1L7M A;  1UHU A;  1A76 A;  2F1J A;  1OW5 A;  2QLT A;  2WF5 A;  1TV9 A;  1TK8 A;  1L3U A;  2M9N A;  1MC8 A;  1DRG A;  5AI8 A;  2Y0S C;  3B0X A;  3UPQ A;  4YN4 A;  8ICS A;  2KFN A;  3WKC A;  5KG3 A;  2D3D A;  5ALY A;  2YMM A;  2EAN A;  4YD1 A;  2XCP A;  4EEK A;  3CW2 C;  5ALD A;  2A3V A;  2VA2 A;  1IXR A;  3D6J A;  4QZ9 A;  2BPC A;  2DKZ A;  4A8E A;  5BPC A;  4YD2 A;  2FLN A;  4IQW A;  2CPR A;  3UXN A;  2LYH A;  4P0P B;  1ZQO A;  3HPO A;  3RR8 A;  1S76 D;  3GV7 B;  1PVP A;  4F4X A;  4R64 A;  1VJ5 A;  2I1Q A;  7ICE A;  5DG7 A;  5KT5 A;  2Q0Z X;  1D8Y A;  2HCF A;  4CF3 A;  4MHV A;  4DQP A;  3RH6 A;  4EYI B;  3TAD C;  1WWU A;  3QUQ A;  3JPS A;  3D2N A;  2PFN A;  1N2X A;  2BGW A;  4R8U A;  5KFO A;  1ZQQ A;  3C28 A;  4NLC A;  2UVU A;  4AYB F;  1QSY A;  2ZIV A;  3NRZ A;  3PV8 A;  4DL2 A;  4ECY A;  3EUB 2;  4I2J A;  8ICY A;  4Y2V A;  2E8M A;  7ICV A;  2R8G A;  1Q8K A;  3KZI U;  3RH5 A;  7ICJ A;  2H5X A;  2HSZ A;  5BOM A;  4JV2 A;  1XSN A;  5DB8 A;  4Q8F A;  7ICH A;  4DSJ A;  1SKR A;  2A1J A;  2CN1 A;  5AKJ A;  4HAI A;  3T5K A;  3EW9 A;  3S6J A;  2CRX A;  2ISO A;  3LYS A;  3MC1 A;  1L3T A;  9ICA A;  1DK2 A;  5AKI A;  3RB6 A;  5HR7 A;  3OHB A;  2IOH A;  3MGV A;  2KIV A;  4GFJ A;  2EAP A;  2YY6 A;  4UAY A;  2IA6 A;  3NGD A;  1ZD4 A;  3JPQ A;  5B66 U;  2PFQ A;  3TAC B;  9ICB A;  5AKK A;  3VCB A;  5III A;  2R8K A;  1NNL A;  2EZY A;  3HKZ F;  5KG6 A;  1Q3U A;  2QB0 B;  4DS5 A;  8ICP A;  4QJF B;  3MFH A;  3E0F A;  1FFU A;  4ECW A;  1WCN A;  4RNN A;  4US8 A;  4EX6 A;  4YR2 A;  2RLT A;  2PXI A;  1XNS A;  2LYA A;  8ICR A;  3RBD A;  5F3X B;  5J8Y C;  5J2D A;  5KAI U;  2DPI A;  4KLS A;  5J0S A;  4QWE A;  4OO1 J;  4BDP A;  5KFR A;  1ZQY A;  3EYZ A;  4BXO B;  5IIJ A;  4DSL A;  1BVS A;  1KFS A;  4KMU A;  4B9S A;  2R8J A;  4O3O A;  4CCH A;  2MSN A;  3AQE A;  2JEG A;  3RJG A;  4O3M A;  4BX9 C;  2JZB B;  2JV3 A;  1X42 A;  1U9L A;  2EDU A;  4DOC A;  1Z00 B;  1L6N A;  3V6J A;  9ICQ A;  4RQ0 A;  2IHM A;  2AGO A;  2PI5 A;  8ICA A;  1DGS A;  4NJ8 A;  4C8M A;  4DFJ A;  2HI0 A;  3L5K A;  5L1J A;  1NJY A;  1JXE A;  4PGY A;  1EXN A;  2KSO B;  4TUP A;  2B21 A;  4NXZ A;  3SYZ A;  2V9W A;  4Q45 A;  5KFD A;  3LVV A;  5DB6 A;  3TAQ A;  4ELU A;  2JGA A;  3GIL A;  2WTF A;  1B43 A;  2Y0S F;  5KFZ A;  4YP3 A;  1Z00 A;  5DG9 A;  2W3S A;  3CYM A;  8ICM A;  4I2C A;  4TUR A;  1DK3 A;  3MGH A;  2E5S A;  4XUS A;  4EZ6 A;  2K4E A;  3IG8 A;  1ZQS A;  4K4G A;  1PK1 B;  2KTQ A;  1XSP A;  4F72 A;  5DBA A;  4O0I A;  5A0L A;  2WHE A;  1CUK A;  2MUT B;  1S9F A;  3WK5 A;  1H38 A;  4NLK A;  1N60 A;  4IRD A;  4DS4 A;  4DFK A;  1JMS A;  5DB7 A;  5ALN A;  3ZD8 A;  1RQL A;  5KFX A;  2FE9 A;  4C7Y A;  5KFQ A;  3IHQ B;  1SGG A;  5KNI A;  1T3N A;  2GO7 A;  4C7Z A;  4Y2P A;  4ECX A;  3H0M B;  4IRK A;  5AKL A;  4M6W A;  4DSE A;  2WFA A;  2KG5 A;  2MA1 A;  3GII A;  4F5Q A;  1K5O A;  3PR4 A;  2K8A A;  3PMN A;  5C0Y A;  4LJX A;  4RT3 A;  1HUZ A;  2HW3 A;  1S8O A;  3FM9 A;  3NAS A;  9ICE A;  2A1J B;  4BWM A;  2K4I A;  1ZQE A;  5H2F U;  1SV4 A;  5IIK A;  2F3N A;  2W9B B;  1QQ6 A;  5IIO A;  2YB4 A;  2J6S A;  1KW4 A;  2XC9 A;  2VA3 A;  4Y2J A;  1NK5 A;  2FI1 A;  5JUM A;  3ISB A;  2ZJ5 A;  1QH9 A;  3VC8 A;  1A6S A;  1JAL A;  4ED8 A;  2D8C A;  4J9S A;  4UB5 A;  4ECU A;  4B9V A;  4ED3 A;  1J97 A;  3PNC A;  1HIW A;  4CRX A;  1NKB A;  1QSS A;  3OHA A;  4GIB A;  3C1Z A;  1V85 A;  3ETR A;  2H3I A;  3NVZ A;  1GO3 F;  8ICQ A;  1TK5 A;  2DKX A;  5HP4 A;  4I29 A;  2BCR A;  4Q43 A;  2OCE A;  1ZQT A;  1NK8 A;  4KN4 A;  3IDW A;  1XO0 A;  3WK7 A;  3C5F A;  4OD0 A;  5DDM A;  1IG6 A;  1UCV A;  1MQ3 A;  5DGA A;  2Y1I A;  2HHT A;  1BPE A;  2KNJ A;  5F9N A;  4UQG A;  1OUQ A;  4IL6 U;  2JH1 A;  1PK3 A;  1B0X A;  2ATL A; 
#chains in the Genus database with same CATH homology
 1SGG A;  1X66 A;  2DKZ A;  5KNI A;  5J8Y A;  5F3X B;  5J8Y C;  2F44 A;  2KG5 A;  2E8P A;  4PZN A;  4MHV A;  3H8M A;  3HIL A;  2Y9U A;  1Z1V A;  3TAD C;  1WWU A;  2JV3 A;  2K60 A;  2KMD A;  1RG6 A;  3BS7 A;  2ES6 A;  5JTI A;  1SV4 A;  2F3N A;  1PK1 A;  2YTU A;  4NJ8 A;  2DL0 A;  2B6G A;  1UQV A;  1KW4 A;  4PZO A;  2F8K A;  2L5Y A;  2KSO B;  2QB0 A;  1SXD A;  2E8M A;  2ESE A;  2E8O A;  3BS5 B;  2GLE A;  4RQM A;  3K1R B;  2D8C A;  2QKQ A;  1LKY A;  2K4P A;  4RQN A;  2QAR A;  2QB1 A;  3SEN A;  4NL9 C;  3KKA A;  3SEI A;  3TAD A;  2E8N A;  5JU5 A;  3BS5 A;  1X40 A;  1SV0 A;  1X9X A;  1V85 A;  2KSO A;  2LPE A;  4NL9 A;  1F0M A;  1V38 A;  1DXS A;  2DKX A;  2KIV A;  4IS7 A;  1PK1 B;  2EAP A;  2QAR B;  3BQ7 A;  1OW5 A;  3IDW A;  2KE7 A;  3TAC B;  1LKY B;  1COK A;  1UCV A;  1JI7 A;  3KKA C;  1SXE A;  1SV0 C;  2EAO A;  1WWV A;  2QB0 B;  2Y9T A;  2D3D A;  2EAN A;  2EAM A;  5L1M A;  1OXJ A;  2FE9 A;  2LMR A;  5JRT A;  1PK3 A;  1B0X A;  1B4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...