2QB1A

2tel crystallization module
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
SIALPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E80-TELSAM domain
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
total genus 19
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qb1A00
2EAMA 3SENA 3TACB 5J8YA 2KSOA 1OXJA 5JRTA 1LKYB 3KKAA 1OW5A 4MHVA 2ES6A 2K4PA 2QB0B 4PZOA 1COKA 2KIVA 3BS5A 1SXEA 1Z1VA 5JTIA 1WWVA 1SV0A 2KMDA 5L1MA 1X66A 3HILA 2B6GA 1X40A 2FE9A 2EAOA 2GLEA 2KSOB 4NL9C 1RG6A 3TADA 2JV3A 2F8KA 1V38A 2DKXA 2E8PA 2D8CA 2ESEA 1F0MA 2L5YA 1PK3A 3K1RB 1UCVA 2KG5A 1WWUA 2KE7A 1V85A 3KKAC 1X9XA 5JU5A 2QARA 2E8MA 5F3XB 2K60A 1PK1A 3SEIA 1SV4A 4PZNA 4NL9A 1UQVA 1JI7A 3BS5B 3H8MA 2F44A 5J8YC 1SXDA 4NJ8A 2D3DA 2LMRA 1B0XA 1DXSA 2QARB 2E8OA 1B4FA 2F3NA 1KW4A 1PK1B 2Y9TA 2E8NA 2DKZA 3IDWA 1LKYA 1SGGA 2QB1A 1SV0C 2QKQA 2YTUA 2QB0A 4RQNA 2LPEA 2DL0A 2Y9UA 5KNIA 4IS7A 3BQ7A 3TADC 3BS7A 4RQMA 2EAPA 2EANA
chains in the Genus database with same CATH superfamily
3FAHA 1ZQSA 4RPZA 5TISU 5AHXA 4NV0A 4UAVA 2A3VA 2CRXA 2CN1A 5KFEA 2KJ8A 4Q43A 2ES6A 2K4PA 2F76X 4U7CA 5D49A 3SV3A 4KITB 2F8LA 5J2CA 1Z1VA 3GDXA 4RZRA 3PW5A 5AK3A 4K4HA 5J0YA 4M2YA 3TQ1A 4PL2A 2GLEA 2HHUA 3NVZA 4UAYA 2FDRA 3C5GA 3JPQA 2GOLA 5T14A 1EXNA 5ALPA 1Z4NA 1ZQEA 2B21A 1NZPA 5ALZA 1X6IA 4RU9A 3Q8QB 5AKIA 4FZMA 1ZQAA 4DEZA 3S6JA 3H0MB 7ICVA 4RNNA 1FFUA 4O5KA 2KFZA 1KKXA 1IV8A 1H38A 2HOQA 1X9WA 1U9LA 1COOA 2HHVA 2P35A 5HHIA 2WF8A 2D3DA 3FC4A 3Q8RB 1D9FA 2LYHA 5KFKA 4UB3A 1X6JA 2ZUDA 2DKZA 3RJIA 1X9MA 2Q4TA 7ICQA 2QKQA 5CHGA 3TKAA 5G5GA 2XY6A 4QJFB 4Y2XA 4Q44A 5KT5A 1UA1A 2WAQF 4I2CA 3M9NB 5IIMA 3IG8A 5FP0A 3JPRA 5EWFA 4X5VA 3SENA 1V97A 1F5SA 2HBLA 2G0AA 1TFRA 8ICXA 4BWMA 3PSTA 4YXJA 2W9CA 1ZYQA 3RBEA 1COKA 2JXJA 1UT8A 1S10A 4EZ6A 1WWVA 2OWOA 2XIDA 3PW2A 3PO4A 1NNLA 1X40A 4QZIA 1BPZA 3BZCA 1ZQMA 1AQ6A 1ZRNA 5ALLA 2OCEA 1BVSA 2BCUA 4DSEA 1BNPA 2E8PA 4EYHB 5ALJA 9ICUA 3K1RB 4C8LA 1JRPA 3MGIA 3T3FA 2CXYA 8ICQA 1IIPA 9ICAA 3HPOA 5KFPA 5CA7A 2P66A 1S8OA 3ZD9A 3GILA 4AP9A 5ALFA 3OHAA 3TARA 3G6XA 1SV4A 4PHAA 5KG6A 1YZ6A 4GXIA 5EWEA 3C23A 3C2LA 2H3ZA 1MSWD 2OHFA 2E8OA 1B4FA 4KLSA 1PK1B 3GZFA 4OJOA 1PUZA 2C2DA 2FMSA 1VJ5A 3IDWA 4RT2A 1URJA 3ETRA 3ISBA 4M6WA 2OH2A 4DQPA 2XY7A 2HHTA 3C1YA 4P4PA 2WB1C 1RXVA 3Q8KA 1XSNA 9ICBA 5EE3A 3H8JA 4MFFA 2ZIXB 5HR6A 3D2NA 4IR9A 7ICUA 1DGJA 3V7JA 2AU0A 2YMQA 5ALIA 2RRDA 5KFWA 4CE6A 3BDPA 1Q46A 5JRTA 4F8RA 2KHQA 1SL1A 4B9UA 4QNLA 1WCLA 1SKRA 3C28A 9ICMA 4YG2A 3UPQA 5KFNA 2Z7JA 4JV0A 7ICTA 1X66A 2XI9A 3H4DA 2KVSA 4KLQA 1MC8A 4QZEA 5KFUA 1VDVA 1Q3VA 3WK4A 4R8UA 5IILA 1J2NA 3PX0A 3ZDCA 4IR1A 3ZI4A 3GIIA 4ECQA 2HHQA 3G6YA 3K75D 5CR0A 3RH4A 2LBOA 1V85A 4ICAA 5HR7A 2RDJA 3UXOA 3PO5A 3WKCA 1D8YA 4MF2A 2WF5A 3CW2C 1CRXA 3E2EA 1L6NA 5ALNA 1XSPA 1L7OA 2ZJ5A 2W54A 1WYGA 5DLFA 1O03A 1ZQBA 1JI7A 1KTQA 2JRZA 1WUDA 4F2SA 4QWCA 1HIWA 4JV2A 3PSFA 2JR5A 4FE3A 1D9DA 3AN1A 2QB1A 5KFXA 4QZBA 2MRLA 3V6JA 1ECWA 4EELA 2LPEA 2HMXA 5CEHA 2DL0A 2KHVA 1L3UA 2ZTDA 1NKBA 2IHMA 3LYSA 4I2IA 5KFIA 4YP3A 2ZIWB 3F2CA 2ASDA 5ALTA 2BQUA 2F1JA 1RQNA 4C8NA 2BPCA 1SL2A 3EPIA 5J8YA 2BGWA 2IOFA 1UA0A 3PSPA 5KFVA 2DWQA 2R8GA 4O0IA 1X9SA 1S0OA 1SZPA 8ICAA 2HOIA 3BS5A 3UMCA 2BQ3A 7ICIA 2W03A 5JTIA 4JWMA 3LWMA 4F4WA 1JUDA 1QCKA 5KT7A 4YCXA 3G6VA 3OJUA 1ZQZA 2LM1A 2C28A 3BJYA 4WJ3B 4M9LA 2WB1F 2JV3A 2F8KA 2DKXA 3UXNA 8ICHA 2KTQA 3QEAZ 1T94A 4RNOA 5AM4A 4G3IA 2H3VA 1ZQWA 2PMZC 5DQGA 1JX4A 3H0RB 4Q45A 2LYAA 4KLMA 4CF4A 2ZUCA 2RHFA 4NLCA 5J2JA 3RAQA 3RB4A 1N60A 3HW8A 1C7YA 1L8LA 5KG3A 4EEYA 4Y2QA 4XQ8A 3AU2A 3SI8A 3HX0A 4UATA 5A0LA 1NK6A 4DFMA 3PW7A 3F5AA 3H8WA 4TQSA 1DXSA 3E58A 5KFFA 4HYKA 2Y9TA 3EUB2 3NVYA 1JIHA 2IOFK 3LVVA 2JH1A 1LKYA 1NJYA 4RQ8A 4QWAA 4UAUA 2BPGA 3T5HA 4DFDA 2HW3A 4K4IA 4KN4A 4P4OA 1ZQDA 4TQRA 4FO6A 1QTMA 1QSLA 2H5XA 4CF3A 1NJZA 5AKYA 2PKEA 2HVIA 1OW5A 3RJJA 9ICNA 1QH9A 1XO0A 3KHHA 1FFVA 2K89A 3MFIA 4UAZA 4PZOA 8ICOA 4FS2A 2ASLA 1ZQJA 5IIKA 4YD2A 2I1QA 1N2XA 5L1MA 5KFMA 2W43A 2FLLA 5J0UA 3IM1A 2B6GA 4FFDA 9ICKA 5KFOA 4ECYA 5KT2A 2AH5A 4Y2JA 1KL9A 4I2JA 5IIOA 1F44A 3ETLA 4UB2A 2ESEA 1NK8A 3M8RA 2LHTA 4QZCA 2PXIA 1PK3A 2H3FA 4UARA 1UCVA 4C8OA 8ICUA 3MDCA 4ELVA 2VA8A 4GFJA 4JMUA 7ICMA 5F9LA 2XO7A 3T5LA 3IRUA 2JEJA 2ODGA 2W8LA 3KHGA 3T79A 2VJ4A 3ISDA 3KD3A 2BCRA 4QZ9A 9ICPA 2A1AA 4NL9A 4C8MA 4DFPA 4J9PA 3M7DA 4QIWF 5ALMA 8ICCA 4KLJA 2W3SA 1NK0A 3KFUF 2A1JB 4F4YA 5DDMA 5K4LA 2ZJ8A 5EOZA 1Q3UA 4NLBA 8ICVA 4RQ2A 9ICQA 1ZQQA 3MR6A 4IRCA 2I6XA 3F5EA 4JK1A 4US9A 4DL7A 2BPFA 2QB0A 2BCSA 2UVVA 4J9MA 4EZ9A 2W8KA 1ZQVA 1Z00A 2DUYA 2OXOA 2XICA 2W9BB 3PVXA 2BKEA 5AK6A 2G5HB 5DQIA 3DDHA 2FPMA 2HOFA 8ICEA 3PZPA 2KSOA 4MFAA 4DL5A 1RPLA 3KKAA 2F1IA 4RNMA 3NVVA 1RYRA 1RQLA 4UB4A 1SKSA 2FLPA 1WCNA 5HMMA 3PW0A 4P4MA 4R66A 1SXEA 4FS1A 2YX8A 3F53A 3PR4A 2NRVA 1QQ5A 8ICNA 1N61A 3H8SA 2B0CA 2R8KA 3TADA 3ONNA 2KP7A 4QZFA 2KEYA 4GLXA 1D8LA 3M8SA 4J9QA 4B9SA 4C80A 3WK8A 1U4BA 4NM1A 2L5YA 2K4HA 4BXOB 4MF8A 4KLGA 2ZIVB 1LVHA 4DO9A 3RBDA 2RDIA 4C8KA 4I2DA 5KFAA 3RR8A 1JROA 2K60A 4RQ3A 1MQ3A 5AM5A 9ICGA 5HMLA 4MEXA 2DQNB 5J2KA 1N62A 2HDOA 4B9MA 2H3IA 3WKEA 9ICEA 3RTVA 1NK9A 4DCCA 4DF8A 3CP8A 2YY6A 4NJ8A 2EZZA 5KG4A 5CP2A 5KFCA 2BDPA 4KLOA 4XUSA 3KHLA 2F3NA 5AI4A 4UQGA 2UVUA 4P0PA 2EQYA 3ICXA 1IG6A 3ALRA 4IQWA 3L4PA 5J0OA 3C2MA 5DB7A 1L3VA 1KRPA 5GTHU 5J2IA 5J0PA 1S5LU 2C2RA 1Z19A 5ALRA 4C4RA 4O3MA 3N4MB 1FIQA 5KT4A 5KFDA 2KKPA 4KLLA 2DF4B 4IC9A 4I28A 5B5EU 2E1FA 1T8EA 5AM3A 4Y2SA 1ZD3A 1NJXA 4QWEA 8ICRA 1HJPA 1ZQNA 4P2HA 3SAGA 4Z6DA 3PMNA 1SV0A 5EWGA 1L5UA 3K1ZA 1FEZA 3TFSA 2XVTA 3B0XA 1U48A 3IP4B 5J0TA 4BX9C 4YN4A 3C21A 1DK2A 5J0QA 4HAIA 4XRHA 3WK6A 1XC9A 4F5NA 3EWAA 1AROP 3RJEA 3QUBA 4C0ZA 2H3QA 3GFKB 5ALGA 5BPCA 2YQEA 1N5WA 1ZQ1C 4Z6CA 1T4GA 2QARA 2E3TA 4QWBA 4M9GA 4J9RA 2QLTA 2HBMA 4FBUA 8ICWA 3CYMA 2KFNA 3SYZA 1TK8A 4DOBA 2ZUBA 1ZQHA 1SWWA 5H2FU 3WK9A 3DEEA 3T5KA 2VKQA 4DSFA 2MU2A 2AHOB 1BPDA 4UB8U 4CCHA 3OJSA 1XWLA 5DLGA 4RQNA 4AYBC 1A6SA 1PZNA 2UVRA 5C0YA 3I1YA 3RH6A 4I2EA 2AGOA 1MA7A 5AI5A 4B6JA 4YR2A 2D6FC 3BZKA 4CRXA 4Z6EA 3WKAA 5DG7A 2BZFA 3MGHA 5ALVA 3L3FX 3QZ8A 5EE1A 5DGBA 2JZBA 4YMMA 1U47A 2YB1A 5DDYA 5KG5A 3SR6A 3HILA 2XCPA 4PL1A 3QUQA 2ZTCA 4B9VA 2EAOA 3RRHA 1XU4A 2HHSA 4UB5A 4KTQA 5KFZA 5J2HA 2W9AA 3H4BA 4JV1A 4NLNA 3NRZA 4DLEA 1TKDA 1NKCA 5ALYA 7ICEA 4ED0A 5BOMA 1BGXT 3ISCA 4DQRA 2DBYA 4O3PA 1VLBA 5F3XB 3BQ2A 3TAQA 5ALQA 5AIAA 1RM6C 4J9SA 1ZQRA 2K8BB 3MABA 3WK7A 2JHDA 4ZH4A 3ZDBA 2XGPA 2FMQA 3IN5A 2EDUA 4OJ6A 5KFTA 5L1LA 1T3QA 3HKZC 3CRXA 3B0YA 5J2AA 5KG0A 1MN8A 4TUPA 3PNCA 4Y2VA 1SGGA 7ICHA 2ZG6A 4IL6U 2IA6A 1Z1BA 5AM2A 4UBCA 1L3TA 2NRWA 4ECSA 2FI1A 2IMWP 1XO1A 2KV2A 2IHNA 4IS7A 1PVQA 2G09A 3BQ7A 5DB9A 2EAPA 4LVSA 5KFHA 1TK0A 2HHXA 2HVHA 3AUOA 1TAMA 4F71A 5B66U 4RQ0A 2XCAA 1JXLA 2J6SA 5G5HA 2N1RA 5L1JA 2KVCA 4ECVA 2MSNA 3SZ2A 2W9MA 5EE0A 2OYYA 2W3RA 2HSZA 3N28A 4Y2PA 2MAXA 4DSIA 2DPIA 1UHUA 1DOQA 3MR3A 3K4GA 2P6RA 3B9JA 4K4GA 1ZXIA 2MUTA 2HCFA 2W55A 4JB3A 2W9CB 1KN5A 3SV4A 4DQSA 5KL8B 1KFTA 2KZ3A 3A0HU 2LM4A 4FZLA 2F77X 3N7SC 1WWUA 4DF4A 1XNSA 1RZTA 3HT3A 3SAFA 3C5FA 5AM0A 1ZQCA 1KSPA 1NJWA 2FPLA 5ALDA 4CGZA 2AXTU 1ZQYA 4C7ZA 4F4KA 4UBBA 5GTIU 3AU6A 2YMLA 3OTQA 3D2QA 5HHHA 3RJKA 2ALZA 4EX7A 3OHBA 2KZZA 4F2RA 1D8BA 3ZDDA 2KD1A 5L9XA 3PY8A 1A77A 2ZTEA 2ISOA 8ICBA 5CWRA 4EBCA 1B0XA 2KJ5A 5DG9A 1KEJA 1S76D 1YZ7A 5AI6A 2NYVA 3J81j 5AKLA 4F72A 4QW9A 4RT3A 4ED2A 3UXPA 1S97A 4R65A 4ED8A 4YR0A 4KLIA 3NVWA 3V7KA 4DFKA 3OSNA 5CRXA 2KMDA 8ICLA 7ICGA 4QZHA 1S0VA 3V72A 4C4TA 2JEGA 5AK5A 3QUCA 4PJ0U 4M6WB 5AM1A 2M9NA 5KT3A 2ISPA 7ICFA 5AKEA 4NWIA 1XS9D 2ZXHA 1QQ7A 4OD0A 3QXGA 1T3NA 1ED1A 4US8A 5KT6A 4YMNA 3BQTA 3HWTA 4KX3A 4EYIB 5DQHA 3EZ5A 4GC6A 9ICXA 7ICJA 1V38A 3MC1A 2D8CA 4Q8EA 3JPOA 4IRKA 5AKHA 2WFAA 4OJLA 1U45A 1Z4OA 3RJHA 3THVA 9ICHA 2V9WA 3KKAC 3GIKA 3PX4A 5KFGA 3RR7A 5DBCA 4R8UB 3KHRA 4M0AA 4UB1A 5ALXA 2W7PA 8ICSA 4PZNA 5KFSA 1V9PA 1ZD2P 1BPEA 2NO5A 4P0QB 3ZD8A 1RDFA 4RPXA 7ICSA 4UAWA 8ICKA 4DS4A 4PHPA 1DGSA 4Q8FA 4JWNA 4I2BA 1TE2A 1ZQGA 3MBYA 3ZDEA 1ZRMA 4TURA 5DB8A 9ICCA 2GWSA 5ALUA 4DQQA 4R63A 3KTQA 4A8EA 3RFAA 4YFKA 2XGQA 3RF9A 2UVWA 2YMPA 3NGDA 1ZD4A 3JPPA 1L7NA 4KMUA 3KZXA 3NUQA 3IHQB 5J0RA 4J9LA 1IXRA 1M6YA 4DL4A 9ICTA 2PMZF 3V6HA 1SB3C 2K4IA 5AIBA 2KIVA 2BR0A 5HNKA 2PFOA 3WU2U 2W11A 5AKXA 8ICZA 4RUAA 2BDUA 3QU7A 4J9KA 4DSLA 3F2BA 3E0FA 3NASA 3RJGA 2BCVA 2PFQA 2IBKA 7ICLA 1CEZA 1LB2B 5ALOA 4XA5A 2HI0A 5J29A 2IOHA 3IG5A 3H7IA 4Y2RA 4NM2A 1JALA 5J0XA 3D2SA 3N7PD 3HP6A 4YD1A 1ZD5A 2HHWA 4OCZA 1BPXA 1ZOLA 2PI5A 1PK1A 4KLTA 2VIXA 3RB0A 3MFHA 1O08A 3D6JA 4M9NA 4USAA 1BPYA 4KLDA 5DKWA 1KBUA 2ZIXA 3A0BU 2BQRA 1GO3F 4UASA 4IQUA 3H0LB 2G06A 5KG7A 4O3NA 5J2DA 4DL6A 4PHDA 5KFJA 3GV8B 4BDPA 4MEYA 1TVAA 2WTFA 4B9NA 2GH1A 5ALSA 4F5RA 3EPGA 3QU9A 3U26A 2PI4A 4OO1J 5J0WA 2VANA 5AKGA 1YT3A 3CNHA 1ZQUA 2Y9UA 1ZQIA 1CI4A 1ZQXA 1WG8A 2V4QA 1KFDA 4LZDA 4KLEA 2EANA 4J9NA 1K5OA 3FYHA 9ICOA 2NRXA 2M0NA 9ICWA 4FBTA 1LKYB 4EX6A 2E5SA 2R8HA 4MHVA 2Q0ZX 5AKZA 5ALWA 2OEHA 3LVWA 1ZQOA 9ICFA 3PV8A 4F93B 1N5XA 3FDSA 3WKBA 2FE9A 2P6UA 3MR2A 5EE9A 9ICRA 5TZVA 4RQ7A 4F4XA 5KFLA 2AGPA 3Q8SB 3VC8A 4Y2YA 2KG5A 1QSYA 4DSJA 5DGAA 2K4EA 3SQIA 2G5IB 4O5CA 7ICPA 3RJFA 2Y1IA 3ORYA 3QU2A 2AGQA 2LI6A 2RQ5A 3GV5B 3V6KA 4EBEA 2ZIUB 2WF9A 3QU4A 8ICMA 3UMBA 3PSIA 1MQ2A 1QSSA 1TAUA 3TFRA 2KZMA 2BCQA 4ED3A 3PW4A 4ELUA 4I2FA 5ALEA 3AL0B 2BHNA 1L8OA 3QZ7A 2LKYA 2ASJA 4TUQA 2KK0A 3GIMA 5D4BA 4DS5A 3KOOA 5KAFU 4B9TA 4F5PA 2HBJA 2ZIWA 1HEKA 4KX5A 4YR3A 4Y2UA 4C7YA 3IV6A 2C22A 1TK5A 1N63A 3FM9A 4KLUA 5DBBA 2VA3A 4ED1A 4BJQA 4ACOA 3H40A 3HRDD 2GO7A 3UM9A 2G07A 4TUSA 3PMLA 9ICIA 4NLZA 4RQ6A 3R9KA 3NTUA 3Q8LA 2NV3A 5KFBA 4BUGA 5KFRA 3SMVA 1HUOA 4DWIA 2JGAA 4ECWA 2QB0B 4OJPA 5L1IA 2FLNA 4I2AA 1ZQTA 4M47A 1Z00B 4EBDA 1QLNA 2KN7A 2AQ4A 2CPRA 2JEFA 1RYUA 2MA1A 4KMOB 1KQQA 1BNOA 1NI3A 1SWVA 2KSOB 2WHEA 2J6TA 4C4SA 1ZQFA 3QNMA 4DL3A 4UW9A 2FJ6A 1K1SA 4NLKA 4DSKA 1ZJNA 2EZYA 4Y2TA 5AI8A 3UQ0A 3QU5A 5J0SA 2RLTA 2DPJA 3JPTA 5E79U 5KFYA 4U6PA 2F2AB 2YN4A 1B43A 2NO4A 4O5EA 4I27A 3SEIA 4F92B 4O3RA 4LJXA 2FPKA 5J2GA 1UT5A 1QQ6A 3BQ1A 3C29A 3AEVA 5IIJA 4GXKA 5AK4A 2OM6A 5AICA 4YQWA 2EZXA 3LWLA 2F44A 3KBBA 5J8YC 1NK4A 2RP5A 4NXZA 3RH5A 3SD7A 4M9JA 3M9MB 3RB3A 1TV9A 4ECXA 1NZBA 5AI0A 1UPHA 2JH7A 4R64A 1L7MA 4O3OA 4CNQA 2I5HA 2R8IA 5KNIA 9ICSA 5D46A 2FMPA 4DQIA 4F3OA 3T5JA 2PFPA 4JUZA 4IQVA 3I28A 2KIWA 4P0PB 2EH9A 4IQTA 1XSLA 1Q8KA 4KN7A 3ZDAA 2VJ5A 2O6KA 4YMOA 1LV5A 4QZGA 5IINA 8ICJA 4P0QA 1PVPA 1KLNA 3MDAA 4RQ5A 1L3SA 2LYBA 3QUTA 1RG6A 2ZXIA 2A19A 3DV9A 2KOBA 2WF6A 4O3QA 2ZJAA 3OGUA 3V7LA 2A1JA 4CF5A 1NOMA 2Y0SC 4PGXA 2KICA 3UMGA 4F50A 1SL0A 1ZQLA 9ICVA 3AM9A 5KG2A 1SKWA 2PFNA 3QE9Y 4PPXA 1NK5A 2E8MA 2DGZA 5ALHA 4NLGA 4I2GA 2K8CB 1J97A 4AYBF 5J2FA 1UQVA 4RUCA 4O9MA 3M9OB 1P7DA 2JMGA 2ATLA 4ECUA 4YXMA 2W9BA 5KG1A 3C1ZA 4LZGA 2QARB 3MGVA 3NRWA 2XC9A 4ECTA 1NK7A 4Z6FA 7ICNA 1S9FA 4QZAA 4GXJA 2VA2A 3NS1A 3QEBZ 4PHEA 5J2EA 4QIWC 3N7RC 3BS7A 3AQFA 3UQ2A 2J6UA 4MFCA 8ICGA 3TACB 3RB6A 2NRTA 3QYPA 1S77D 2AJQA 1HUZA 4E0DA 7ICOA 5DBAA 3O0FA 3JPSA 4G9BA 3M6ZA 3WKDA 1L7PA 3HJEA 4BXOA 4ELTA 2ZIVA 7ICRA 4NL9C 4GIBA 3M6KA 3C2KA 2YB4A 5JUMA 9ICLA 4I29A 2W04A 4ECRA 1PVRA 3PR5B 1F0MA 2JZBB 4BWJA 1IM4A 4DOAA 2WF7A 2XY5A 2E1EA 3HKZF 3ED5A 4YVZA 4I2HA 1CUKA 4IRDA 4O3SA 4RQ4A 4EEKA 1X9XA 4PGQA 3GQCA 7ICKA 1NKEA 5ALKA 2W7OA 1JN3A 1C20A 2R8JA 4F91B 5KL1B 4RPYA 1ZJMA 1X2IA 4CDGA 1SZHA 3H8MA 3EYZA 8ICPA 4UB6U 3KZIU 4M9HA 4QZ8A 1N48A 8ICFA 1A0PA 2R18A 1ZQPA 5AKJA 2E8NA 4DOCA 1FO4A 5F9NA 2NRZA 3M1YA 1S0MA 3LK9A 3MR5A 1J2MA 5CJ7A 3GV7B 3AMZA 5KFQA 1A76A 2Y0SF 2YMMA 5C5JA 2I9GA 1DK3A 3TADC 1TAQA 4RQMA 9ICJA 3TANA 5CB1A 2EAMA 4QWDA 2ZIUA 4PGYA 3N97B 1N56A 3PX6A 1OXJA 3GU3A 8ICTA 2KKVA 5AI9A 5AKKA 3GIJA 4J9OA 5J2BA 3AQEA 3SAHA 1B22A 3QX7A 3I76A 4F4ZA 4ZOHC 2V4RA 4DLGA 5HP4A 1RXWA 3RAXA 4KLFA 2F1HA 4RQ1A 1ZETA 5L1KA 1BPBA 4B9LA 4M04A 3OPXA 3F2DA 4QW8A 1DRGA 1JXEA 2KE7A 2KJ9A 4GC7A 2K8AA 4PH5A 4KLHA 1U49A 1JMSA 3TAPA 1S0NA 5JU5A 1T7PA 8ICIA 8ICYA 2MUTB 5BOLA 2WAQC 3RRGA 3BQ0A 5DG8A 4DL2A 5KAIU 1KDHA 1RYSA 3BS5B 3TI0A 5IIIA 3Q8PB 2G08A 4F5OA 3VCBA 4EENA 4FZNA 3L5KA 3EW9A 1SXDA 1K1QA 3JPNA 2AQ0A 3OSPA 2JEIA 2LMRA 2KNJA 1KFSA 4ECZA 2DFLA 1KW4A 1ZQKA 2Y1JA 4F5QA 4J03A 4ED6A 3WK5A 1SIJA 1SV0C 4DFJA 2YTUA 1Y88A 4BGDA 3Q8MA 3LDAA 4QZDA 2HBKA 5DB6A 1Z3EB 1OUQA 1X42A 4OJ5A 2C2EA 4ED7A 4NY8A 5KTQA
chains in the Genus database with same CATH topology
2EAMA 3SENA 3TACB 5J8YA 2KSOA 1OXJA 5JRTA 1LKYB 3KKAA 1OW5A 4MHVA 2ES6A 2K4PA 2QB0B 4PZOA 1COKA 2KIVA 3BS5A 1SXEA 1Z1VA 5JTIA 1WWVA 1SV0A 2KMDA 5L1MA 1X66A 3HILA 2B6GA 1X40A 2FE9A 2EAOA 2GLEA 2KSOB 4NL9C 1RG6A 3TADA 2JV3A 2F8KA 1V38A 2DKXA 2E8PA 2D8CA 2ESEA 1F0MA 2L5YA 1PK3A 3K1RB 1UCVA 2KG5A 1WWUA 2KE7A 1V85A 3KKAC 1X9XA 5JU5A 2QARA 2E8MA 5F3XB 2K60A 1PK1A 3SEIA 1SV4A 4PZNA 4NL9A 1UQVA 1JI7A 3BS5B 3H8MA 2F44A 5J8YC 1SXDA 4NJ8A 2D3DA 2LMRA 1B0XA 1DXSA 2QARB 2E8OA 1B4FA 2F3NA 1KW4A 1PK1B 2Y9TA 2E8NA 2DKZA 3IDWA 1LKYA 1SGGA 2QB1A 1SV0C 2QKQA 2YTUA 2QB0A 4RQNA 2LPEA 2DL0A 2Y9UA 5KNIA 4IS7A 3BQ7A 3TADC 3BS7A 4RQMA 2EAPA 2EANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAM A;  3SEN A;  3TAC B;  5J8Y A;  2KSO A;  1OXJ A;  5JRT A;  1LKY B;  3KKA A;  1OW5 A;  4MHV A;  2ES6 A;  2K4P A;  2QB0 B;  4PZO A;  1COK A;  2KIV A;  3BS5 A;  1SXE A;  1Z1V A;  5JTI A;  1WWV A;  1SV0 A;  2KMD A;  5L1M A;  1X66 A;  3HIL A;  2B6G A;  1X40 A;  2FE9 A;  2EAO A;  2GLE A;  2KSO B;  4NL9 C;  1RG6 A;  3TAD A;  2JV3 A;  2F8K A;  1V38 A;  2DKX A;  2E8P A;  2D8C A;  2ESE A;  1F0M A;  2L5Y A;  1PK3 A;  3K1R B;  1UCV A;  2KG5 A;  1WWU A;  2KE7 A;  1V85 A;  3KKA C;  1X9X A;  5JU5 A;  2QAR A;  2E8M A;  5F3X B;  2K60 A;  1PK1 A;  3SEI A;  1SV4 A;  4PZN A;  4NL9 A;  1UQV A;  1JI7 A;  3BS5 B;  3H8M A;  2F44 A;  5J8Y C;  1SXD A;  4NJ8 A;  2D3D A;  2LMR A;  1B0X A;  1DXS A;  2QAR B;  2E8O A;  1B4F A;  2F3N A;  1KW4 A;  1PK1 B;  2Y9T A;  2E8N A;  2DKZ A;  3IDW A;  1LKY A;  1SGG A;  2QB1 A;  1SV0 C;  2QKQ A;  2YTU A;  2QB0 A;  4RQN A;  2LPE A;  2DL0 A;  2Y9U A;  5KNI A;  4IS7 A;  3BQ7 A;  3TAD C;  3BS7 A;  4RQM A;  2EAP A;  2EAN A; 
#chains in the Genus database with same CATH topology
 3FAH A;  1ZQS A;  4RPZ A;  5TIS U;  5AHX A;  4NV0 A;  4UAV A;  2A3V A;  2CRX A;  2CN1 A;  5KFE A;  2KJ8 A;  4Q43 A;  2ES6 A;  2K4P A;  2F76 X;  4U7C A;  5D49 A;  3SV3 A;  4KIT B;  2F8L A;  5J2C A;  1Z1V A;  3GDX A;  4RZR A;  3PW5 A;  5AK3 A;  4K4H A;  5J0Y A;  4M2Y A;  3TQ1 A;  4PL2 A;  2GLE A;  2HHU A;  3NVZ A;  4UAY A;  2FDR A;  3C5G A;  3JPQ A;  2GOL A;  5T14 A;  1EXN A;  5ALP A;  1Z4N A;  1ZQE A;  2B21 A;  1NZP A;  5ALZ A;  1X6I A;  4RU9 A;  3Q8Q B;  5AKI A;  4FZM A;  1ZQA A;  4DEZ A;  3S6J A;  3H0M B;  7ICV A;  4RNN A;  1FFU A;  4O5K A;  2KFZ A;  1KKX A;  1IV8 A;  1H38 A;  2HOQ A;  1X9W A;  1U9L A;  1COO A;  2HHV A;  2P35 A;  5HHI A;  2WF8 A;  2D3D A;  3FC4 A;  3Q8R B;  1D9F A;  2LYH A;  5KFK A;  4UB3 A;  1X6J A;  2ZUD A;  2DKZ A;  3RJI A;  1X9M A;  2Q4T A;  7ICQ A;  2QKQ A;  5CHG A;  3TKA A;  5G5G A;  2XY6 A;  4QJF B;  4Y2X A;  4Q44 A;  5KT5 A;  1UA1 A;  2WAQ F;  4I2C A;  3M9N B;  5IIM A;  3IG8 A;  5FP0 A;  3JPR A;  5EWF A;  4X5V A;  3SEN A;  1V97 A;  1F5S A;  2HBL A;  2G0A A;  1TFR A;  8ICX A;  4BWM A;  3PST A;  4YXJ A;  2W9C A;  1ZYQ A;  3RBE A;  1COK A;  2JXJ A;  1UT8 A;  1S10 A;  4EZ6 A;  1WWV A;  2OWO A;  2XID A;  3PW2 A;  3PO4 A;  1NNL A;  1X40 A;  4QZI A;  1BPZ A;  3BZC A;  1ZQM A;  1AQ6 A;  1ZRN A;  5ALL A;  2OCE A;  1BVS A;  2BCU A;  4DSE A;  1BNP A;  2E8P A;  4EYH B;  5ALJ A;  9ICU A;  3K1R B;  4C8L A;  1JRP A;  3MGI A;  3T3F A;  2CXY A;  8ICQ A;  1IIP A;  9ICA A;  3HPO A;  5KFP A;  5CA7 A;  2P66 A;  1S8O A;  3ZD9 A;  3GIL A;  4AP9 A;  5ALF A;  3OHA A;  3TAR A;  3G6X A;  1SV4 A;  4PHA A;  5KG6 A;  1YZ6 A;  4GXI A;  5EWE A;  3C23 A;  3C2L A;  2H3Z A;  1MSW D;  2OHF A;  2E8O A;  1B4F A;  4KLS A;  1PK1 B;  3GZF A;  4OJO A;  1PUZ A;  2C2D A;  2FMS A;  1VJ5 A;  3IDW A;  4RT2 A;  1URJ A;  3ETR A;  3ISB A;  4M6W A;  2OH2 A;  4DQP A;  2XY7 A;  2HHT A;  3C1Y A;  4P4P A;  2WB1 C;  1RXV A;  3Q8K A;  1XSN A;  9ICB A;  5EE3 A;  3H8J A;  4MFF A;  2ZIX B;  5HR6 A;  3D2N A;  4IR9 A;  7ICU A;  1DGJ A;  3V7J A;  2AU0 A;  2YMQ A;  5ALI A;  2RRD A;  5KFW A;  4CE6 A;  3BDP A;  1Q46 A;  5JRT A;  4F8R A;  2KHQ A;  1SL1 A;  4B9U A;  4QNL A;  1WCL A;  1SKR A;  3C28 A;  9ICM A;  4YG2 A;  3UPQ A;  5KFN A;  2Z7J A;  4JV0 A;  7ICT A;  1X66 A;  2XI9 A;  3H4D A;  2KVS A;  4KLQ A;  1MC8 A;  4QZE A;  5KFU A;  1VDV A;  1Q3V A;  3WK4 A;  4R8U A;  5IIL A;  1J2N A;  3PX0 A;  3ZDC A;  4IR1 A;  3ZI4 A;  3GII A;  4ECQ A;  2HHQ A;  3G6Y A;  3K75 D;  5CR0 A;  3RH4 A;  2LBO A;  1V85 A;  4ICA A;  5HR7 A;  2RDJ A;  3UXO A;  3PO5 A;  3WKC A;  1D8Y A;  4MF2 A;  2WF5 A;  3CW2 C;  1CRX A;  3E2E A;  1L6N A;  5ALN A;  1XSP A;  1L7O A;  2ZJ5 A;  2W54 A;  1WYG A;  5DLF A;  1O03 A;  1ZQB A;  1JI7 A;  1KTQ A;  2JRZ A;  1WUD A;  4F2S A;  4QWC A;  1HIW A;  4JV2 A;  3PSF A;  2JR5 A;  4FE3 A;  1D9D A;  3AN1 A;  2QB1 A;  5KFX A;  4QZB A;  2MRL A;  3V6J A;  1ECW A;  4EEL A;  2LPE A;  2HMX A;  5CEH A;  2DL0 A;  2KHV A;  1L3U A;  2ZTD A;  1NKB A;  2IHM A;  3LYS A;  4I2I A;  5KFI A;  4YP3 A;  2ZIW B;  3F2C A;  2ASD A;  5ALT A;  2BQU A;  2F1J A;  1RQN A;  4C8N A;  2BPC A;  1SL2 A;  3EPI A;  5J8Y A;  2BGW A;  2IOF A;  1UA0 A;  3PSP A;  5KFV A;  2DWQ A;  2R8G A;  4O0I A;  1X9S A;  1S0O A;  1SZP A;  8ICA A;  2HOI A;  3BS5 A;  3UMC A;  2BQ3 A;  7ICI A;  2W03 A;  5JTI A;  4JWM A;  3LWM A;  4F4W A;  1JUD A;  1QCK A;  5KT7 A;  4YCX A;  3G6V A;  3OJU A;  1ZQZ A;  2LM1 A;  2C28 A;  3BJY A;  4WJ3 B;  4M9L A;  2WB1 F;  2JV3 A;  2F8K A;  2DKX A;  3UXN A;  8ICH A;  2KTQ A;  3QEA Z;  1T94 A;  4RNO A;  5AM4 A;  4G3I A;  2H3V A;  1ZQW A;  2PMZ C;  5DQG A;  1JX4 A;  3H0R B;  4Q45 A;  2LYA A;  4KLM A;  4CF4 A;  2ZUC A;  2RHF A;  4NLC A;  5J2J A;  3RAQ A;  3RB4 A;  1N60 A;  3HW8 A;  1C7Y A;  1L8L A;  5KG3 A;  4EEY A;  4Y2Q A;  4XQ8 A;  3AU2 A;  3SI8 A;  3HX0 A;  4UAT A;  5A0L A;  1NK6 A;  4DFM A;  3PW7 A;  3F5A A;  3H8W A;  4TQS A;  1DXS A;  3E58 A;  5KFF A;  4HYK A;  2Y9T A;  3EUB 2;  3NVY A;  1JIH A;  2IOF K;  3LVV A;  2JH1 A;  1LKY A;  1NJY A;  4RQ8 A;  4QWA A;  4UAU A;  2BPG A;  3T5H A;  4DFD A;  2HW3 A;  4K4I A;  4KN4 A;  4P4O A;  1ZQD A;  4TQR A;  4FO6 A;  1QTM A;  1QSL A;  2H5X A;  4CF3 A;  1NJZ A;  5AKY A;  2PKE A;  2HVI A;  1OW5 A;  3RJJ A;  9ICN A;  1QH9 A;  1XO0 A;  3KHH A;  1FFV A;  2K89 A;  3MFI A;  4UAZ A;  4PZO A;  8ICO A;  4FS2 A;  2ASL A;  1ZQJ A;  5IIK A;  4YD2 A;  2I1Q A;  1N2X A;  5L1M A;  5KFM A;  2W43 A;  2FLL A;  5J0U A;  3IM1 A;  2B6G A;  4FFD A;  9ICK A;  5KFO A;  4ECY A;  5KT2 A;  2AH5 A;  4Y2J A;  1KL9 A;  4I2J A;  5IIO A;  1F44 A;  3ETL A;  4UB2 A;  2ESE A;  1NK8 A;  3M8R A;  2LHT A;  4QZC A;  2PXI A;  1PK3 A;  2H3F A;  4UAR A;  1UCV A;  4C8O A;  8ICU A;  3MDC A;  4ELV A;  2VA8 A;  4GFJ A;  4JMU A;  7ICM A;  5F9L A;  2XO7 A;  3T5L A;  3IRU A;  2JEJ A;  2ODG A;  2W8L A;  3KHG A;  3T79 A;  2VJ4 A;  3ISD A;  3KD3 A;  2BCR A;  4QZ9 A;  9ICP A;  2A1A A;  4NL9 A;  4C8M A;  4DFP A;  4J9P A;  3M7D A;  4QIW F;  5ALM A;  8ICC A;  4KLJ A;  2W3S A;  1NK0 A;  3KFU F;  2A1J B;  4F4Y A;  5DDM A;  5K4L A;  2ZJ8 A;  5EOZ A;  1Q3U A;  4NLB A;  8ICV A;  4RQ2 A;  9ICQ A;  1ZQQ A;  3MR6 A;  4IRC A;  2I6X A;  3F5E A;  4JK1 A;  4US9 A;  4DL7 A;  2BPF A;  2QB0 A;  2BCS A;  2UVV A;  4J9M A;  4EZ9 A;  2W8K A;  1ZQV A;  1Z00 A;  2DUY A;  2OXO A;  2XIC A;  2W9B B;  3PVX A;  2BKE A;  5AK6 A;  2G5H B;  5DQI A;  3DDH A;  2FPM A;  2HOF A;  8ICE A;  3PZP A;  2KSO A;  4MFA A;  4DL5 A;  1RPL A;  3KKA A;  2F1I A;  4RNM A;  3NVV A;  1RYR A;  1RQL A;  4UB4 A;  1SKS A;  2FLP A;  1WCN A;  5HMM A;  3PW0 A;  4P4M A;  4R66 A;  1SXE A;  4FS1 A;  2YX8 A;  3F53 A;  3PR4 A;  2NRV A;  1QQ5 A;  8ICN A;  1N61 A;  3H8S A;  2B0C A;  2R8K A;  3TAD A;  3ONN A;  2KP7 A;  4QZF A;  2KEY A;  4GLX A;  1D8L A;  3M8S A;  4J9Q A;  4B9S A;  4C80 A;  3WK8 A;  1U4B A;  4NM1 A;  2L5Y A;  2K4H A;  4BXO B;  4MF8 A;  4KLG A;  2ZIV B;  1LVH A;  4DO9 A;  3RBD A;  2RDI A;  4C8K A;  4I2D A;  5KFA A;  3RR8 A;  1JRO A;  2K60 A;  4RQ3 A;  1MQ3 A;  5AM5 A;  9ICG A;  5HML A;  4MEX A;  2DQN B;  5J2K A;  1N62 A;  2HDO A;  4B9M A;  2H3I A;  3WKE A;  9ICE A;  3RTV A;  1NK9 A;  4DCC A;  4DF8 A;  3CP8 A;  2YY6 A;  4NJ8 A;  2EZZ A;  5KG4 A;  5CP2 A;  5KFC A;  2BDP A;  4KLO A;  4XUS A;  3KHL A;  2F3N A;  5AI4 A;  4UQG A;  2UVU A;  4P0P A;  2EQY A;  3ICX A;  1IG6 A;  3ALR A;  4IQW A;  3L4P A;  5J0O A;  3C2M A;  5DB7 A;  1L3V A;  1KRP A;  5GTH U;  5J2I A;  5J0P A;  1S5L U;  2C2R A;  1Z19 A;  5ALR A;  4C4R A;  4O3M A;  3N4M B;  1FIQ A;  5KT4 A;  5KFD A;  2KKP A;  4KLL A;  2DF4 B;  4IC9 A;  4I28 A;  5B5E U;  2E1F A;  1T8E A;  5AM3 A;  4Y2S A;  1ZD3 A;  1NJX A;  4QWE A;  8ICR A;  1HJP A;  1ZQN A;  4P2H A;  3SAG A;  4Z6D A;  3PMN A;  1SV0 A;  5EWG A;  1L5U A;  3K1Z A;  1FEZ A;  3TFS A;  2XVT A;  3B0X A;  1U48 A;  3IP4 B;  5J0T A;  4BX9 C;  4YN4 A;  3C21 A;  1DK2 A;  5J0Q A;  4HAI A;  4XRH A;  3WK6 A;  1XC9 A;  4F5N A;  3EWA A;  1ARO P;  3RJE A;  3QUB A;  4C0Z A;  2H3Q A;  3GFK B;  5ALG A;  5BPC A;  2YQE A;  1N5W A;  1ZQ1 C;  4Z6C A;  1T4G A;  2QAR A;  2E3T A;  4QWB A;  4M9G A;  4J9R A;  2QLT A;  2HBM A;  4FBU A;  8ICW A;  3CYM A;  2KFN A;  3SYZ A;  1TK8 A;  4DOB A;  2ZUB A;  1ZQH A;  1SWW A;  5H2F U;  3WK9 A;  3DEE A;  3T5K A;  2VKQ A;  4DSF A;  2MU2 A;  2AHO B;  1BPD A;  4UB8 U;  4CCH A;  3OJS A;  1XWL A;  5DLG A;  4RQN A;  4AYB C;  1A6S A;  1PZN A;  2UVR A;  5C0Y A;  3I1Y A;  3RH6 A;  4I2E A;  2AGO A;  1MA7 A;  5AI5 A;  4B6J A;  4YR2 A;  2D6F C;  3BZK A;  4CRX A;  4Z6E A;  3WKA A;  5DG7 A;  2BZF A;  3MGH A;  5ALV A;  3L3F X;  3QZ8 A;  5EE1 A;  5DGB A;  2JZB A;  4YMM A;  1U47 A;  2YB1 A;  5DDY A;  5KG5 A;  3SR6 A;  3HIL A;  2XCP A;  4PL1 A;  3QUQ A;  2ZTC A;  4B9V A;  2EAO A;  3RRH A;  1XU4 A;  2HHS A;  4UB5 A;  4KTQ A;  5KFZ A;  5J2H A;  2W9A A;  3H4B A;  4JV1 A;  4NLN A;  3NRZ A;  4DLE A;  1TKD A;  1NKC A;  5ALY A;  7ICE A;  4ED0 A;  5BOM A;  1BGX T;  3ISC A;  4DQR A;  2DBY A;  4O3P A;  1VLB A;  5F3X B;  3BQ2 A;  3TAQ A;  5ALQ A;  5AIA A;  1RM6 C;  4J9S A;  1ZQR A;  2K8B B;  3MAB A;  3WK7 A;  2JHD A;  4ZH4 A;  3ZDB A;  2XGP A;  2FMQ A;  3IN5 A;  2EDU A;  4OJ6 A;  5KFT A;  5L1L A;  1T3Q A;  3HKZ C;  3CRX A;  3B0Y A;  5J2A A;  5KG0 A;  1MN8 A;  4TUP A;  3PNC A;  4Y2V A;  1SGG A;  7ICH A;  2ZG6 A;  4IL6 U;  2IA6 A;  1Z1B A;  5AM2 A;  4UBC A;  1L3T A;  2NRW A;  4ECS A;  2FI1 A;  2IMW P;  1XO1 A;  2KV2 A;  2IHN A;  4IS7 A;  1PVQ A;  2G09 A;  3BQ7 A;  5DB9 A;  2EAP A;  4LVS A;  5KFH A;  1TK0 A;  2HHX A;  2HVH A;  3AUO A;  1TAM A;  4F71 A;  5B66 U;  4RQ0 A;  2XCA A;  1JXL A;  2J6S A;  5G5H A;  2N1R A;  5L1J A;  2KVC A;  4ECV A;  2MSN A;  3SZ2 A;  2W9M A;  5EE0 A;  2OYY A;  2W3R A;  2HSZ A;  3N28 A;  4Y2P A;  2MAX A;  4DSI A;  2DPI A;  1UHU A;  1DOQ A;  3MR3 A;  3K4G A;  2P6R A;  3B9J A;  4K4G A;  1ZXI A;  2MUT A;  2HCF A;  2W55 A;  4JB3 A;  2W9C B;  1KN5 A;  3SV4 A;  4DQS A;  5KL8 B;  1KFT A;  2KZ3 A;  3A0H U;  2LM4 A;  4FZL A;  2F77 X;  3N7S C;  1WWU A;  4DF4 A;  1XNS A;  1RZT A;  3HT3 A;  3SAF A;  3C5F A;  5AM0 A;  1ZQC A;  1KSP A;  1NJW A;  2FPL A;  5ALD A;  4CGZ A;  2AXT U;  1ZQY A;  4C7Z A;  4F4K A;  4UBB A;  5GTI U;  3AU6 A;  2YML A;  3OTQ A;  3D2Q A;  5HHH A;  3RJK A;  2ALZ A;  4EX7 A;  3OHB A;  2KZZ A;  4F2R A;  1D8B A;  3ZDD A;  2KD1 A;  5L9X A;  3PY8 A;  1A77 A;  2ZTE A;  2ISO A;  8ICB A;  5CWR A;  4EBC A;  1B0X A;  2KJ5 A;  5DG9 A;  1KEJ A;  1S76 D;  1YZ7 A;  5AI6 A;  2NYV A;  3J81 j;  5AKL A;  4F72 A;  4QW9 A;  4RT3 A;  4ED2 A;  3UXP A;  1S97 A;  4R65 A;  4ED8 A;  4YR0 A;  4KLI A;  3NVW A;  3V7K A;  4DFK A;  3OSN A;  5CRX A;  2KMD A;  8ICL A;  7ICG A;  4QZH A;  1S0V A;  3V72 A;  4C4T A;  2JEG A;  5AK5 A;  3QUC A;  4PJ0 U;  4M6W B;  5AM1 A;  2M9N A;  5KT3 A;  2ISP A;  7ICF A;  5AKE A;  4NWI A;  1XS9 D;  2ZXH A;  1QQ7 A;  4OD0 A;  3QXG A;  1T3N A;  1ED1 A;  4US8 A;  5KT6 A;  4YMN A;  3BQT A;  3HWT A;  4KX3 A;  4EYI B;  5DQH A;  3EZ5 A;  4GC6 A;  9ICX A;  7ICJ A;  1V38 A;  3MC1 A;  2D8C A;  4Q8E A;  3JPO A;  4IRK A;  5AKH A;  2WFA A;  4OJL A;  1U45 A;  1Z4O A;  3RJH A;  3THV A;  9ICH A;  2V9W A;  3KKA C;  3GIK A;  3PX4 A;  5KFG A;  3RR7 A;  5DBC A;  4R8U B;  3KHR A;  4M0A A;  4UB1 A;  5ALX A;  2W7P A;  8ICS A;  4PZN A;  5KFS A;  1V9P A;  1ZD2 P;  1BPE A;  2NO5 A;  4P0Q B;  3ZD8 A;  1RDF A;  4RPX A;  7ICS A;  4UAW A;  8ICK A;  4DS4 A;  4PHP A;  1DGS A;  4Q8F A;  4JWN A;  4I2B A;  1TE2 A;  1ZQG A;  3MBY A;  3ZDE A;  1ZRM A;  4TUR A;  5DB8 A;  9ICC A;  2GWS A;  5ALU A;  4DQQ A;  4R63 A;  3KTQ A;  4A8E A;  3RFA A;  4YFK A;  2XGQ A;  3RF9 A;  2UVW A;  2YMP A;  3NGD A;  1ZD4 A;  3JPP A;  1L7N A;  4KMU A;  3KZX A;  3NUQ A;  3IHQ B;  5J0R A;  4J9L A;  1IXR A;  1M6Y A;  4DL4 A;  9ICT A;  2PMZ F;  3V6H A;  1SB3 C;  2K4I A;  5AIB A;  2KIV A;  2BR0 A;  5HNK A;  2PFO A;  3WU2 U;  2W11 A;  5AKX A;  8ICZ A;  4RUA A;  2BDU A;  3QU7 A;  4J9K A;  4DSL A;  3F2B A;  3E0F A;  3NAS A;  3RJG A;  2BCV A;  2PFQ A;  2IBK A;  7ICL A;  1CEZ A;  1LB2 B;  5ALO A;  4XA5 A;  2HI0 A;  5J29 A;  2IOH A;  3IG5 A;  3H7I A;  4Y2R A;  4NM2 A;  1JAL A;  5J0X A;  3D2S A;  3N7P D;  3HP6 A;  4YD1 A;  1ZD5 A;  2HHW A;  4OCZ A;  1BPX A;  1ZOL A;  2PI5 A;  1PK1 A;  4KLT A;  2VIX A;  3RB0 A;  3MFH A;  1O08 A;  3D6J A;  4M9N A;  4USA A;  1BPY A;  4KLD A;  5DKW A;  1KBU A;  2ZIX A;  3A0B U;  2BQR A;  1GO3 F;  4UAS A;  4IQU A;  3H0L B;  2G06 A;  5KG7 A;  4O3N A;  5J2D A;  4DL6 A;  4PHD A;  5KFJ A;  3GV8 B;  4BDP A;  4MEY A;  1TVA A;  2WTF A;  4B9N A;  2GH1 A;  5ALS A;  4F5R A;  3EPG A;  3QU9 A;  3U26 A;  2PI4 A;  4OO1 J;  5J0W A;  2VAN A;  5AKG A;  1YT3 A;  3CNH A;  1ZQU A;  2Y9U A;  1ZQI A;  1CI4 A;  1ZQX A;  1WG8 A;  2V4Q A;  1KFD A;  4LZD A;  4KLE A;  2EAN A;  4J9N A;  1K5O A;  3FYH A;  9ICO A;  2NRX A;  2M0N A;  9ICW A;  4FBT A;  1LKY B;  4EX6 A;  2E5S A;  2R8H A;  4MHV A;  2Q0Z X;  5AKZ A;  5ALW A;  2OEH A;  3LVW A;  1ZQO A;  9ICF A;  3PV8 A;  4F93 B;  1N5X A;  3FDS A;  3WKB A;  2FE9 A;  2P6U A;  3MR2 A;  5EE9 A;  9ICR A;  5TZV A;  4RQ7 A;  4F4X A;  5KFL A;  2AGP A;  3Q8S B;  3VC8 A;  4Y2Y A;  2KG5 A;  1QSY A;  4DSJ A;  5DGA A;  2K4E A;  3SQI A;  2G5I B;  4O5C A;  7ICP A;  3RJF A;  2Y1I A;  3ORY A;  3QU2 A;  2AGQ A;  2LI6 A;  2RQ5 A;  3GV5 B;  3V6K A;  4EBE A;  2ZIU B;  2WF9 A;  3QU4 A;  8ICM A;  3UMB A;  3PSI A;  1MQ2 A;  1QSS A;  1TAU A;  3TFR A;  2KZM A;  2BCQ A;  4ED3 A;  3PW4 A;  4ELU A;  4I2F A;  5ALE A;  3AL0 B;  2BHN A;  1L8O A;  3QZ7 A;  2LKY A;  2ASJ A;  4TUQ A;  2KK0 A;  3GIM A;  5D4B A;  4DS5 A;  3KOO A;  5KAF U;  4B9T A;  4F5P A;  2HBJ A;  2ZIW A;  1HEK A;  4KX5 A;  4YR3 A;  4Y2U A;  4C7Y A;  3IV6 A;  2C22 A;  1TK5 A;  1N63 A;  3FM9 A;  4KLU A;  5DBB A;  2VA3 A;  4ED1 A;  4BJQ A;  4ACO A;  3H40 A;  3HRD D;  2GO7 A;  3UM9 A;  2G07 A;  4TUS A;  3PML A;  9ICI A;  4NLZ A;  4RQ6 A;  3R9K A;  3NTU A;  3Q8L A;  2NV3 A;  5KFB A;  4BUG A;  5KFR A;  3SMV A;  1HUO A;  4DWI A;  2JGA A;  4ECW A;  2QB0 B;  4OJP A;  5L1I A;  2FLN A;  4I2A A;  1ZQT A;  4M47 A;  1Z00 B;  4EBD A;  1QLN A;  2KN7 A;  2AQ4 A;  2CPR A;  2JEF A;  1RYU A;  2MA1 A;  4KMO B;  1KQQ A;  1BNO A;  1NI3 A;  1SWV A;  2KSO B;  2WHE A;  2J6T A;  4C4S A;  1ZQF A;  3QNM A;  4DL3 A;  4UW9 A;  2FJ6 A;  1K1S A;  4NLK A;  4DSK A;  1ZJN A;  2EZY A;  4Y2T A;  5AI8 A;  3UQ0 A;  3QU5 A;  5J0S A;  2RLT A;  2DPJ A;  3JPT A;  5E79 U;  5KFY A;  4U6P A;  2F2A B;  2YN4 A;  1B43 A;  2NO4 A;  4O5E A;  4I27 A;  3SEI A;  4F92 B;  4O3R A;  4LJX A;  2FPK A;  5J2G A;  1UT5 A;  1QQ6 A;  3BQ1 A;  3C29 A;  3AEV A;  5IIJ A;  4GXK A;  5AK4 A;  2OM6 A;  5AIC A;  4YQW A;  2EZX A;  3LWL A;  2F44 A;  3KBB A;  5J8Y C;  1NK4 A;  2RP5 A;  4NXZ A;  3RH5 A;  3SD7 A;  4M9J A;  3M9M B;  3RB3 A;  1TV9 A;  4ECX A;  1NZB A;  5AI0 A;  1UPH A;  2JH7 A;  4R64 A;  1L7M A;  4O3O A;  4CNQ A;  2I5H A;  2R8I A;  5KNI A;  9ICS A;  5D46 A;  2FMP A;  4DQI A;  4F3O A;  3T5J A;  2PFP A;  4JUZ A;  4IQV A;  3I28 A;  2KIW A;  4P0P B;  2EH9 A;  4IQT A;  1XSL A;  1Q8K A;  4KN7 A;  3ZDA A;  2VJ5 A;  2O6K A;  4YMO A;  1LV5 A;  4QZG A;  5IIN A;  8ICJ A;  4P0Q A;  1PVP A;  1KLN A;  3MDA A;  4RQ5 A;  1L3S A;  2LYB A;  3QUT A;  1RG6 A;  2ZXI A;  2A19 A;  3DV9 A;  2KOB A;  2WF6 A;  4O3Q A;  2ZJA A;  3OGU A;  3V7L A;  2A1J A;  4CF5 A;  1NOM A;  2Y0S C;  4PGX A;  2KIC A;  3UMG A;  4F50 A;  1SL0 A;  1ZQL A;  9ICV A;  3AM9 A;  5KG2 A;  1SKW A;  2PFN A;  3QE9 Y;  4PPX A;  1NK5 A;  2E8M A;  2DGZ A;  5ALH A;  4NLG A;  4I2G A;  2K8C B;  1J97 A;  4AYB F;  5J2F A;  1UQV A;  4RUC A;  4O9M A;  3M9O B;  1P7D A;  2JMG A;  2ATL A;  4ECU A;  4YXM A;  2W9B A;  5KG1 A;  3C1Z A;  4LZG A;  2QAR B;  3MGV A;  3NRW A;  2XC9 A;  4ECT A;  1NK7 A;  4Z6F A;  7ICN A;  1S9F A;  4QZA A;  4GXJ A;  2VA2 A;  3NS1 A;  3QEB Z;  4PHE A;  5J2E A;  4QIW C;  3N7R C;  3BS7 A;  3AQF A;  3UQ2 A;  2J6U A;  4MFC A;  8ICG A;  3TAC B;  3RB6 A;  2NRT A;  3QYP A;  1S77 D;  2AJQ A;  1HUZ A;  4E0D A;  7ICO A;  5DBA A;  3O0F A;  3JPS A;  4G9B A;  3M6Z A;  3WKD A;  1L7P A;  3HJE A;  4BXO A;  4ELT A;  2ZIV A;  7ICR A;  4NL9 C;  4GIB A;  3M6K A;  3C2K A;  2YB4 A;  5JUM A;  9ICL A;  4I29 A;  2W04 A;  4ECR A;  1PVR A;  3PR5 B;  1F0M A;  2JZB B;  4BWJ A;  1IM4 A;  4DOA A;  2WF7 A;  2XY5 A;  2E1E A;  3HKZ F;  3ED5 A;  4YVZ A;  4I2H A;  1CUK A;  4IRD A;  4O3S A;  4RQ4 A;  4EEK A;  1X9X A;  4PGQ A;  3GQC A;  7ICK A;  1NKE A;  5ALK A;  2W7O A;  1JN3 A;  1C20 A;  2R8J A;  4F91 B;  5KL1 B;  4RPY A;  1ZJM A;  1X2I A;  4CDG A;  1SZH A;  3H8M A;  3EYZ A;  8ICP A;  4UB6 U;  3KZI U;  4M9H A;  4QZ8 A;  1N48 A;  8ICF A;  1A0P A;  2R18 A;  1ZQP A;  5AKJ A;  2E8N A;  4DOC A;  1FO4 A;  5F9N A;  2NRZ A;  3M1Y A;  1S0M A;  3LK9 A;  3MR5 A;  1J2M A;  5CJ7 A;  3GV7 B;  3AMZ A;  5KFQ A;  1A76 A;  2Y0S F;  2YMM A;  5C5J A;  2I9G A;  1DK3 A;  3TAD C;  1TAQ A;  4RQM A;  9ICJ A;  3TAN A;  5CB1 A;  2EAM A;  4QWD A;  2ZIU A;  4PGY A;  3N97 B;  1N56 A;  3PX6 A;  1OXJ A;  3GU3 A;  8ICT A;  2KKV A;  5AI9 A;  5AKK A;  3GIJ A;  4J9O A;  5J2B A;  3AQE A;  3SAH A;  1B22 A;  3QX7 A;  3I76 A;  4F4Z A;  4ZOH C;  2V4R A;  4DLG A;  5HP4 A;  1RXW A;  3RAX A;  4KLF A;  2F1H A;  4RQ1 A;  1ZET A;  5L1K A;  1BPB A;  4B9L A;  4M04 A;  3OPX A;  3F2D A;  4QW8 A;  1DRG A;  1JXE A;  2KE7 A;  2KJ9 A;  4GC7 A;  2K8A A;  4PH5 A;  4KLH A;  1U49 A;  1JMS A;  3TAP A;  1S0N A;  5JU5 A;  1T7P A;  8ICI A;  8ICY A;  2MUT B;  5BOL A;  2WAQ C;  3RRG A;  3BQ0 A;  5DG8 A;  4DL2 A;  5KAI U;  1KDH A;  1RYS A;  3BS5 B;  3TI0 A;  5III A;  3Q8P B;  2G08 A;  4F5O A;  3VCB A;  4EEN A;  4FZN A;  3L5K A;  3EW9 A;  1SXD A;  1K1Q A;  3JPN A;  2AQ0 A;  3OSP A;  2JEI A;  2LMR A;  2KNJ A;  1KFS A;  4ECZ A;  2DFL A;  1KW4 A;  1ZQK A;  2Y1J A;  4F5Q A;  4J03 A;  4ED6 A;  3WK5 A;  1SIJ A;  1SV0 C;  4DFJ A;  2YTU A;  1Y88 A;  4BGD A;  3Q8M A;  3LDA A;  4QZD A;  2HBK A;  5DB6 A;  1Z3E B;  1OUQ A;  1X42 A;  4OJ5 A;  2C2E A;  4ED7 A;  4NY8 A;  5KTQ A; 
#chains in the Genus database with same CATH homology
 2EAM A;  3SEN A;  3TAC B;  5J8Y A;  2KSO A;  1OXJ A;  5JRT A;  1LKY B;  3KKA A;  1OW5 A;  4MHV A;  2ES6 A;  2K4P A;  2QB0 B;  4PZO A;  1COK A;  2KIV A;  3BS5 A;  1SXE A;  1Z1V A;  5JTI A;  1WWV A;  1SV0 A;  2KMD A;  5L1M A;  1X66 A;  3HIL A;  2B6G A;  1X40 A;  2FE9 A;  2EAO A;  2GLE A;  2KSO B;  4NL9 C;  1RG6 A;  3TAD A;  2JV3 A;  2F8K A;  1V38 A;  2DKX A;  2E8P A;  2D8C A;  2ESE A;  1F0M A;  2L5Y A;  1PK3 A;  3K1R B;  1UCV A;  2KG5 A;  1WWU A;  2KE7 A;  1V85 A;  3KKA C;  1X9X A;  5JU5 A;  2QAR A;  2E8M A;  5F3X B;  2K60 A;  1PK1 A;  3SEI A;  1SV4 A;  4PZN A;  4NL9 A;  1UQV A;  1JI7 A;  3BS5 B;  3H8M A;  2F44 A;  5J8Y C;  1SXD A;  4NJ8 A;  2D3D A;  2LMR A;  1B0X A;  1DXS A;  2QAR B;  2E8O A;  1B4F A;  2F3N A;  1KW4 A;  1PK1 B;  2Y9T A;  2E8N A;  2DKZ A;  3IDW A;  1LKY A;  1SGG A;  2QB1 A;  1SV0 C;  2QKQ A;  2YTU A;  2QB0 A;  4RQN A;  2LPE A;  2DL0 A;  2Y9U A;  5KNI A;  4IS7 A;  3BQ7 A;  3TAD C;  3BS7 A;  4RQM A;  2EAP A;  2EAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...