2QB1A

2tel crystallization module
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
SIALPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase regulator
molecule keywords E80-TELSAM domain
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qb1A00
1V85A 5JTIA 2KE7A 2YTUA 1PK1B 1F0MA 3KKAA 1V38A 1WWVA 1KW4A 2D8CA 2QKQA 3TADC 2KSOA 2KIVA 5JU5A 1Z1VA 2KMDA 3TACB 1OW5A 2Y9UA 2EAOA 2LMRA 2QB0A 3H8MA 5KNIA 1X66A 2FE9A 4RQNA 2E8NA 1B4FA 3SENA 2E8MA 4PZNA 1LKYA 2D3DA 2GLEA 1OXJA 4PZOA 2JV3A 4NL9C 2E8PA 2Y9TA 1COKA 2K60A 2F44A 2EAMA 2ES6A 1RG6A 3KKAC 5J8YC 2KSOB 1WWUA 1UCVA 3K1RB 2QB0B 1B0XA 2B6GA 2ESEA 2KG5A 5F3XB 4NJ8A 1SV0C 1LKYB 1SXDA 2F3NA 5JRTA 2EANA 1SV4A 3BS7A 2QARA 4RQMA 2EAPA 2K4PA 4IS7A 2DKXA 1DXSA 1JI7A 1PK1A 2DKZA 2E8OA 4NL9A 2LPEA 1X40A 3IDWA 1SGGA 3TADA 5L1MA 2F8KA 4MHVA 5J8YA 3BQ7A 1PK3A 1SXEA 1UQVA 2DL0A 3BS5A 3SEIA 3HILA 2QARB 1X9XA 3BS5B 2L5YA 1SV0A 2QB1A
chains in the Genus database with same CATH superfamily
2PMZC 2BQ3A 3NVZA 1ZQWA 4IQTA 4J9KA 2W54A 1ZQBA 1SL0A 5GTHU 3KKAA 2FPMA 1JXEA 1BPYA 5ALGA 3L5KA 3QXGA 5F9NA 2BDPA 5KFHA 5KFKA 3C23A 1X66A 3N4MB 1TKDA 4US9A 4QWEA 3C21A 4KLEA 4QW9A 2J6SA 9ICIA 7ICMA 2K89A 3ONNA 5ALNA 5KFOA 2FPLA 2E8PA 2W9CB 1U49A 5KG4A 2BCUA 2LM4A 8ICFA 4NM1A 3O0FA 1NK8A 3ZI4A 2A3VA 3ZD8A 1MA7A 2JEFA 2ZIUB 1ZD2P 1A6SA 2XY6A 4LVSA 4CDGA 4I2BA 5B5EU 1CRXA 4U7CA 5KT2A 3T79A 1DK2A 3TAQA 4IS7A 5BPCA 4WJ3B 2AQ0A 3NUQA 5AKYA 4JV1A 2CN1A 5KG5A 2ZXHA 2BPCA 2FI1A 2ZTDA 3H4DA 2J6UA 1NKEA 4ZOHC 4J9SA 3QEAZ 1L7NA 3ED5A 2P6RA 2R8IA 9ICLA 2L5YA 2OCEA 7ICKA 4UB5A 2XGQA 5AK5A 3JPTA 2V4QA 2ASJA 3H8JA 3G6VA 5DB7A 2JR5A 4UASA 4F4YA 7ICVA 5DBCA 5AKZA 3E58A 2KIVA 2G09A 4YD1A 1X2IA 3TAPA 4C80A 5A0LA 3PNCA 4QNLA 4IRCA 2QB0A 1S10A 7ICFA 4AP9A 5AK6A 1X9SA 1ZQOA 3NVWA 2D3DA 5CJ7A 5KAIU 5ALEA 1KFSA 1Z4OA 5DBAA 4YMNA 4DOAA 2P6UA 1T3QA 4JV2A 2AQ4A 1B22A 1LV5A 4UATA 3PSFA 1JALA 4KN4A 2R8HA 4M9LA 3UXNA 3MABA 3WKAA 5EWFA 1M6YA 1JUDA 3SR6A 4ED8A 2IHMA 2KZZA 2Z7JA 1ED1A 2PXIA 2RQ5A 5J0YA 5ALSA 2ALZA 2PFQA 2AGPA 4EEKA 4KX3A 1XNSA 1RZTA 4DS5A 4NLCA 2K8AA 4QJFB 9ICKA 2KK0A 3WK9A 5DG9A 3JPOA 5ALZA 4O3QA 3C2KA 1AQ6A 2C2DA 4ZH4A 3C1ZA 4YXMA 5DLGA 1SZHA 4KLHA 4EZ9A 1XU4A 3M9MB 1XSPA 4DSIA 2HBKA 2YY6A 5J0SA 1N5WA 2FLLA 2XY7A 4BDPA 5ALKA 4RPYA 5AK4A 2EQYA 4ECWA 2ZJAA 2FDRA 4CF4A 4F5OA 3BQ1A 3WKDA 1D9DA 4O3OA 1D8YA 1SWVA 1SKRA 2BHNA 4DL7A 2MA1A 3MFIA 1XO0A 5HR7A 2VA8A 2EH9A 5L9XA 2AHOB 4NWIA 4F4KA 1PVRA 1ZQIA 3J81j 4HAIA 4X5VA 3AM9A 4B9VA 4NLBA 3PW0A 3Q8KA 3AQFA 5L1KA 2AJQA 1ZD4A 2HHXA 4DQPA 3N7PD 4CGZA 3JPPA 3ISCA 3KKAC 3BQTA 4MFAA 3PW5A 3CW2C 3TARA 1QQ5A 1BPDA 2IOFK 4CCHA 3PR4A 4OD0A 3EPIA 4FBTA 4A8EA 3MBYA 4EX6A 4QWCA 3F2CA 4DFPA 3UMGA 4O3MA 2R8GA 4RQ2A 2HBMA 3ISBA 9ICVA 2M9NA 2EZXA 8ICYA 3IG8A 4I2IA 4US8A 4DOBA 2Y1JA 4J9PA 5AI4A 1K1QA 2W11A 5J2CA 4RPXA 4DFJA 4P0QB 3GV5B 1SGGA 3RR7A 3B0XA 5BOLA 1QSSA 2KTQA 4Y2UA 4TQRA 3MR5A 4KLJA 3HKZF 4AYBF 2KVCA 1NJZA 5AI6A 3Q8PB 2VA3A 4QZDA 2C2EA 1RQLA 5KFSA 4O0IA 2F76X 5HNKA 1SL2A 3RFAA 7ICRA 1Z00A 3KHGA 2HDOA 3C1YA 4B9UA 3WK6A 1RXVA 5DQIA 4ED3A 3R9KA 3HJEA 1L5UA 2AXTU 3G6YA 1QH9A 3WK7A 4KN7A 4PH5A 3BDPA 9ICOA 4RQNA 1H38A 2RHFA 1J2MA 2J6TA 2W9BA 4DEZA 2K4EA 4O3PA 1D8BA 2DF4B 2KZ3A 2G08A 1ZETA 5EWGA 2BCVA 2YMLA 1F44A 2VA2A 3K4GA 4EBCA 2W04A 3GZFA 4EELA 2ZTEA 4U6PA 2R8KA 3KHRA 3NS1A 1JRPA 3UM9A 3C28A 3OHBA 3V6KA 2KN7A 2ISPA 2K8BB 5F3XB 1UT8A 3HX0A 3IV6A 4B9SA 8ICLA 2DBYA 4BUGA 3HT3A 4Q45A 9ICQA 4ECZA 2EANA 4I2GA 7ICGA 3KOOA 5ALMA 5ALOA 3PW7A 4FS2A 3C2MA 1O08A 2AGQA 3V7KA 4R63A 4I28A 4O3RA 3F2BA 4KLIA 2HOIA 2N1RA 5KG7A 2D6FC 2YB4A 5FP0A 4MHVA 1ZQDA 3OTQA 3BQ7A 2JEIA 1ZJNA 3WKEA 2EZYA 3RBDA 1QLNA 3JPQA 1S77D 1UHUA 1X9XA 2ZUCA 1FEZA 4YMOA 2V9WA 7ICNA 4PL1A 4DLEA 1Q8KA 5D46A 9ICJA 3NASA 4M6WB 5C0YA 5AM5A 4DFMA 2ZTCA 2E1FA 4ELVA 3TACB 2NRZA 3UMCA 2UVWA 3BJYA 2HVIA 5KFFA 3MDCA 1NZPA 2LKYA 3PX6A 2EDUA 4K4HA 3KTQA 4ECRA 5AK3A 1J2NA 4BJQA 2LYAA 3GIIA 2JGAA 2YMMA 3E2EA 2KHQA 2ASDA 3D2QA 9ICBA 2G0AA 5DQHA 2VKQA 3KFUF 2XICA 2BCQA 1HJPA 2A19A 4IQVA 2FJ6A 3GDXA 4BXOA 2LBOA 4KLLA 2B21A 2NO5A 4UB4A 5JRTA 1SV4A 3QUQA 5ALYA 4JK1A 3SZ2A 2FMQA 2OH2A 5DG8A 4RQ1A 3OJSA 1KFDA 2DKXA 2DQNB 1KRPA 2IBKA 4QZ8A 4F2RA 5KFCA 2DKZA 5KFTA 1TVAA 3N28A 4NL9A 3F5AA 3SAHA 2HCFA 5AKXA 4UBBA 5J0TA 5JUMA 5KT7A 4DQSA 1KKXA 3TADA 4UAYA 5KFLA 1DGSA 3EUB2 4BWJA 5DLFA 4PHEA 3DDHA 4I29A 4QZBA 5EE1A 4ICAA 8ICTA 1PK3A 3BS5A 3RJHA 2W8LA 4Q8EA 4F4WA 9ICHA 5T14A 2KE7A 4UAVA 5ALHA 1L3TA 4ED2A 4Y2TA 5B66U 2GOLA 1QTMA 1ZQVA 1RYRA 2ZIWA 5KL1B 1WWVA 1KW4A 9ICUA 1BPZA 2HBJA 3Q8MA 5AHXA 2KMDA 4I27A 3L3FX 1N48A 3Q8QB 4CRXA 3FC4A 1B4FA 1MN8A 2G07A 8ICAA 3SV4A 4DL4A 5KG6A 1ZQXA 4BX9C 4KLTA 4KMUA 8ICRA 3CP8A 1N60A 2RDJA 4QIWF 3QUCA 1COKA 2W55A 5ALDA 3KHLA 5AI5A 1KLNA 4C0ZA 3AEVA 2NRXA 3AN1A 3RJIA 1CEZA 2KSOB 4DF4A 3C5GA 1ZQKA 1NNLA 3M1YA 4F3OA 2PFPA 4F50A 1ZOLA 3UMBA 4EYHB 3T5JA 1NK4A 4UAZA 3BS7A 2NYVA 3FYHA 2WAQC 4EBEA 4CF3A 3EWAA 9ICNA 4UQGA 1HEKA 3THVA 2E8OA 2WF5A 5L1JA 4R64A 4KLUA 2KP7A 4KX5A 5KFBA 2CXYA 2JXJA 4YP3A 3DV9A 4F91B 3V72A 5L1MA 5HP4A 2ZIXB 4YR3A 3PO4A 1BNPA 1ZQNA 2NO4A 2E3TA 2QLTA 4ED7A 2Y0SF 4UB1A 4FBUA 4F5NA 2HHQA 4QZEA 1BPXA 2QARB 1T3NA 8ICQA 3V6JA 2KVSA 2R8JA 2WTFA 1F0MA 1ZQTA 4CF5A 5DQGA 1Z1VA 4J9LA 1XO1A 4RNNA 1VDVA 4ECSA 8ICHA 8ICEA 2K8CB 3GIJA 8ICNA 3RJGA 5AM2A 3HKZC 4AYBC 2LI6A 9ICTA 1N5XA 3H7IA 1L8LA 1S97A 3UXPA 3TKAA 1KDHA 5KFPA 3LVWA 3SD7A 1ZQZA 2V4RA 1XWLA 5KFEA 2A1JB 5TZVA 3MR2A 1L3SA 1L7PA 1TE2A 5AIAA 4FS1A 4NLNA 5KFDA 1B0XA 3SAFA 4C8NA 1FFUA 1URJA 4KLDA 1V97A 4KLOA 2PFOA 2LM1A 4GC7A 4DL3A 4GC6A 2EAPA 5DB9A 2DWQA 3SAGA 5AKLA 1YZ6A 7ICLA 2XI9A 5KT3A 2IA6A 1TK5A 2W9MA 2GO7A 3SV3A 1Q46A 4RQ3A 3T3FA 4UB8U 2H3IA 2E5SA 4P4OA 5J8YA 1Z4NA 3QU7A 2JEGA 2KICA 3EZ5A 3PSIA 4OO1J 1T8EA 1SXEA 2XIDA 2HVHA 3LWMA 1SV0A 2H5XA 1DRGA 9ICWA 2HSZA 1RQNA 5J2JA 4YR0A 1PK1B 5DGBA 3QUBA 1IV8A 5GTIU 2BGWA 2FMSA 4I2HA 3TADC 3PY8A 2YB1A 3A0HU 1LVHA 4F5QA 3PZPA 4B9TA 2ZUBA 4KITB 2EAOA 3RJJA 2LMRA 5AM4A 4QZAA 3H0LB 4ELTA 3MFHA 3PW2A 4R65A 1T7PA 4J9OA 2IMWP 2MSNA 3LDAA 2K60A 4NM2A 1RG6A 4C8LA 1X9MA 4F71A 4Y2PA 4DWIA 2WFAA 3K1RB 4XRHA 2ZUDA 4BWMA 1GO3F 5ALXA 8ICXA 1LKYB 3AMZA 3F5EA 4GIBA 5DDMA 2BQRA 4M04A 4P0PA 3QNMA 5DDYA 2KIWA 1RYSA 3QYPA 4NLKA 2C2RA 5KG1A 4MEYA 4OJOA 1HUZA 1T94A 3D6JA 4OJLA 4OJPA 1TAUA 3Q8LA 4XUSA 1U48A 4PHDA 3QU2A 5IIIA 1ZQPA 3ZD9A 3PSTA 7ICSA 4UARA 1SKSA 4C4TA 5KFMA 4OJ6A 1DK3A 4DS4A 1TAQA 3VCBA 3M7DA 2KKVA 4DOCA 5KFQA 4EYIB 2YMPA 3KHHA 4B9MA 1Z00B 5J2EA 5KT5A 5JU5A 2IOHA 5J2BA 4ECQA 4QWBA 1JX4A 2Y9UA 2JMGA 1ZQGA 4QW8A 3T5KA 3H4BA 1ZQRA 2B0CA 2E8MA 3LWLA 3BQ2A 4EEYA 4TUPA 4YN4A 3RH4A 5HMLA 3GU3A 4I2DA 5IIMA 2C22A 2MRLA 4RNOA 3M6ZA 2WF8A 2NRWA 3M9NB 1SB3C 2ES6A 4IRDA 5KFIA 4Q44A 2KZMA 3D2SA 7ICPA 4YQWA 4P0QA 3QX7A 5KT6A 2OYYA 3S6JA 4RQ4A 1ZQQA 4I2AA 2F1HA 1L3UA 3RTVA 1ECWA 5CA7A 5J0QA 7ICEA 2KEYA 1A76A 2MUTA 4NXZA 4DSJA 5CHGA 4GXKA 2K4HA 1U47A 2ZIVB 3GIMA 4C4SA 4KLSA 1JXLA 4QIWC 5AI0A 2F8KA 4FE3A 1X42A 4F92B 5EOZA 5KL8B 4YG2A 3MGVA 3GIKA 3UQ2A 2JH1A 5EE3A 2GH1A 4RT2A 1NJXA 3L4PA 2KJ5A 4TUQA 4JB3A 3I1YA 4O3NA 2YTUA 2WF9A 8ICSA 5CRXA 4NY8A 2MU2A 1L7MA 4O5EA 1U45A 1V38A 1SWWA 2R18A 3PX0A 8ICOA 4YXJA 3RJKA 1KSPA 3HRDD 4C7YA 4I2FA 1KEJA 1X6IA 4LZGA 1WG8A 1YZ7A 5ALLA 4NV0A 5C5JA 5KG2A 4PHAA 3SMVA 1S0NA 1LB2B 1COOA 5KFUA 1OXJA 3OHAA 4YCXA 1CUKA 5KFGA 2Y0SC 4DF8A 2JZBB 2M0NA 5ALIA 2Y1IA 2GWSA 1VLBA 1XSLA 2WHEA 1S76D 1D9FA 2LYBA 1C20A 5ALQA 3U26A 7ICJA 1BPEA 4PL2A 3RH5A 2G5HB 3ETRA 5ALTA 2H3VA 5KFZA 5AICA 1FFVA 5J0XA 4Y2SA 3GV8B 4DQQA 2F3NA 1IG6A 3IRUA 4CNQA 2KOBA 3ZDEA 2ODGA 3HP6A 4O3SA 5G5HA 3M8SA 1NKCA 2F2AB 2W43A 4M47A 4UBCA 2P35A 4KTQA 4RQ6A 3NTUA 4Q43A 4ED6A 5J0UA 2OHFA 4P4MA 4MF2A 2XO7A 2DUYA 3PO5A 1T4GA 4OJ5A 2AGOA 3QU9A 1UQVA 3HILA 5KG3A 4P4PA 3BS5B 1MQ2A 5JTIA 3WK5A 3IM1A 1ZJMA 4R8UA 3MDAA 3V7LA 5DKWA 1NI3A 2O6KA 9ICFA 3K1ZA 1QSLA 3GILA 2FPKA 4Z6FA 3PVXA 5L1LA 1ZRNA 3T5LA 5AI8A 5BOMA 2KJ8A 2E8NA 5KFYA 4DQIA 4JWNA 3SENA 4UB2A 5AKIA 2CRXA 4PPXA 1PVPA 5KFVA 3RRGA 8ICCA 2XVTA 2GLEA 3OSNA 4IQWA 4YMMA 4PZOA 3D2NA 4RQ8A 2FLPA 2KFZA 4F5RA 3RF9A 1CI4A 4KLFA 3NGDA 5IINA 1SL1A 4DO9A 4IRKA 4TURA 5DBBA 4R66A 7ICTA 1FO4A 4YR2A 3M6KA 4KLQA 2B6GA 1NZBA 2ZG6A 2ESEA 4IL6U 4XQ8A 4FZMA 1XSNA 3FAHA 1C7YA 5J2KA 2BPGA 5CR0A 2HMXA 3QU5A 2K4PA 2HHVA 1NK6A 2I1QA 5HHIA 1ZQAA 2MAXA 1S0MA 2VANA 4DL6A 1ZQJA 5HHHA 3IHQB 1A0PA 3RBEA 1X40A 2WB1F 9ICSA 4J03A 3ETLA 2IOFA 4B9LA 4M9GA 2HHTA 4ACOA 2XCPA 4F4ZA 3F2DA 3C5FA 2NRVA 2UVUA 1KTQA 1ZQ1C 3RB6A 2WF6A 4JUZA 2DL0A 3KZIU 1HIWA 1XC9A 4EX7A 1WCNA 2QB1A 2KJ9A 1PVQA 9ICGA 2XC9A 2ASLA 4I2EA 2VIXA 5KFJA 3PR5B 1J97A 4EENA 2HW3A 2LHTA 4RNMA 1UA1A 1DOQA 4F4XA 2AH5A 1NKBA 4J9QA 2KD1A 2KSOA 2HHUA 3ZDCA 3H8WA 3UPQA 1MQ3A 4NLGA 1RDFA 5J0RA 5DGAA 1Z3EB 2LYHA 2W9CA 4PGYA 4O9MA 4KLGA 3OGUA 7ICQA 3E0FA 4QZIA 3RAXA 2F44A 1VJ5A 5ALPA 2KHVA 4JMUA 4Y2XA 1A77A 4UW9A 5AIBA 2I5HA 2ZIUA 2QB0B 2ZIXA 2PFNA 4FFDA 4DCCA 4C7ZA 2KFNA 5ALVA 3F53A 8ICZA 1S8OA 1L7OA 3JPNA 3SYZA 2QARA 2W3RA 1B43A 5KFRA 1K1SA 4Y2VA 2YMQA 3HWTA 5J29A 4M9NA 3RR8A 3K75D 3RJEA 1Y88A 2ZJ5A 2HOQA 2Q0ZX 3PSPA 2ZXIA 3PW4A 5E79U 2F1IA 2W9AA 9ICXA 2FLNA 4YFKA 4QZFA 8ICMA 9ICRA 1ZQSA 4ECTA 1MC8A 4TUSA 2C28A 5ALRA 1JROA 4Q8FA 1U9LA 1SKWA 3CNHA 4Y2YA 2NRTA 3GQCA 4ED0A 5KAFU 4FZNA 5AM1A 2A1JA 1ZQCA 3VC8A 3AQEA 1SIJA 3RB4A 1F5SA 1IM4A 1EXNA 1N2XA 1UA0A 1OW5A 1L8OA 2IHNA 3EYZA 2FE9A 2YN4A 1S9FA 4MEXA 7ICHA 2F77X 1TAMA 5KG0A 1HUOA 2PI5A 4GXIA 4PZNA 3ZDBA 1RPLA 3CRXA 3TFSA 2E1EA 4IR9A 1Q3UA 5J2AA 8ICUA 4NL9C 4F72A 2RDIA 2Y9TA 4DSKA 1ZQLA 2JRZA 3MR3A 1N61A 1Z1BA 3HPOA 1ZRMA 5DB6A 1BPBA 1RM6C 3M8RA 1WWUA 3FDSA 3I76A 1ZYQA 3AL0B 5AKKA 1UCVA 5EWEA 4JV0A 2OWOA 3CYMA 4PGXA 2PMZF 3ZDDA 3A0BU 3C2LA 2BZFA 4J9RA 1SXDA 4C8KA 4I2CA 2BKEA 4RZRA 4RUAA 5J2GA 1S0VA 1KL9A 4IR1A 4P0PB 2H3ZA 1JI7A 5HR6A 1PK1A 2A1AA 5L1IA 3LK9A 1ZQMA 4DQRA 4I2JA 3QZ7A 1P7DA 1QSYA 4C8OA 4F8RA 3NVVA 3H0RB 2H3FA 1XS9D 5IIOA 5G5GA 5ALWA 5K4LA 8ICGA 1V9PA 4P2HA 2YX8A 3C29A 3RJFA 3TANA 5ALJA 3UXOA 1NK0A 2YQEA 2W7OA 8ICBA 7ICOA 3SEIA 4O5CA 2G5IB 5EE0A 4UB3A 1DGJA 5CP2A 2HOFA 3H8SA 9ICPA 1IXRA 2JHDA 2WAQF 7ICUA 2WF7A 1WUDA 3RB3A 4ECXA 5F9LA 1NK7A 1NOMA 3NVYA 5DG7A 1IIPA 4FZLA 1FIQA 4TQSA 5IIJA 1RYUA 2JH7A 2D8CA 4XA5A 5AM0A 5KT4A 3JPRA 2NV3A 2I9GA 1BGXT 4ED1A 5ALFA 3LYSA 5CEHA 4QWAA 3H8MA 5KNIA 2EZZA 5AKHA 5ALUA 4GFJA 5KFWA 5H2FU 1KN5A 1LKYA 3DEEA 3ORYA 5AI9A 5DB8A 5J0PA 1ZQUA 3QU4A 3Q8RB 2HBLA 3N7SC 2AU0A 1JMSA 1N63A 3I28A 3H40A 3AUOA 9ICEA 4O5KA 3FM9A 4DFKA 4DL5A 4DL2A 3KZXA 4Y2JA 1UPHA 9ICMA 4CE6A 4QWDA 3H0MB 1KBUA 1S5LU 4PGQA 3GV7B 4B9NA 2RLTA 2F8LA 4RU9A 4NJ8A 1PUZA 2KV2A 5AM3A 2UVVA 2W9BB 1TV9A 4UB6U 1WCLA 5AKJA 2OM6A 4KMOB 4QZCA 5D49A 3RH6A 3ICXA 4PJ0U 4M9HA 2PI4A 1DXSA 3Q8SB 4J9NA 4IQUA 3QEBZ 3N7RC 2MUTB 5KFXA 4FO6A 3ISDA 4B6JA 4DSEA 3HW8A 3AU6A 4DFDA 3IDWA 2HHSA 3QUTA 2OXOA 4RPZA 2H3QA 1ZQYA 1ZQHA 1WYGA 3WK4A 3TQ1A 5D4BA 3RRHA 1NK5A 2DPJA 4MF8A 2BR0A 1TK8A 4E0DA 4F2SA 4J9MA 1ZD5A 1K5OA 1NK9A 1KFTA 4QZHA 2DPIA 3PMNA 1QCKA 1RXWA 1BNOA 1D8LA 5AKEA 5HMMA 1UT5A 3AU2A 3BZKA 1L3VA 2BDUA 2W03A 4DSFA 5J2FA 1ZXIA 4NLZA 2CPRA 1ZQEA 4M9JA 2BPFA 2W8KA 2WB1C 5AKGA 3QE9Y 1S0OA 5J2DA 4RQ5A 2DGZA 4ECUA 2RRDA 4OCZA 5J2IA 1X9WA 2FMPA 3EPGA 1N56A 2JV3A 5EE9A 5KFAA 5IIKA 3OJUA 4Z6DA 4Z6CA 2EAMA 8ICWA 4Y2RA 4RUCA 2G06A 3ALRA 2Q4TA 4YVZA 4C8MA 5J8YC 2ZIVA 4QZ9A 2W7PA 3LVVA 4LJXA 3GFKB 4DLGA 1AROP 1MSWD 4F5PA 4EBDA 1JN3A 3MGHA 2W3SA 1SV0C 2I6XA 2P66A 4IC9A 5J2HA 4ECYA 4USAA 4RT3A 4F93B 4K4GA 4G9BA 5KFNA 3V6HA 4C4RA 8ICIA 4UAWA 2LPEA 4M0AA 3OPXA 9ICAA 1ZD3A 4KLMA 5TISU 1PZNA 4EZ6A 1TK0A 1QQ6A 3KBBA 4BXOB 2PKEA 5J0WA 3ZDAA 3KD3A 3B0YA 4YD2A 4RQ0A 2K4IA 4GXJA 1V85A 3G6XA 2UVRA 1Q3VA 1L6NA 2JZBA 4LZDA 4DSLA 3QZ8A 4M6WA 2VJ5A 3NRWA 3SQIA 2BCSA 4Y2QA 3SI8A 3IP4B 4R8UB 2BQUA 3MR6A 2KKPA 3B9JA 2QKQA 3RAQA 2HHWA 1Z19A 2XY5A 3MC1A 1U4BA 4HYKA 1N62A 1KQQA 1OUQA 3TI0A 8ICPA 4GLXA 4M2YA 4JWMA 3WK8A 2OEHA 5KTQA 5J0OA 2HI0A 3PMLA 3NRZA 3M9OB 4Z6EA 4QZGA 3BZCA 5IILA 2JEJA 1NJYA 2ZIWB 3WU2U 2ISOA 2KNJA 5CB1A 2XCAA 4BGDA 3PX4A 2F1JA 1JIHA 1QQ7A 2KG5A 2VJ4A 1BVSA 8ICJA 3EW9A 3WKBA 3RB0A 1NJWA 1SZPA 3UQ0A 2ATLA 8ICKA 4MFFA 4RQMA 3TFRA 7ICIA 4PHPA 2RP5A 4RQ7A 5CWRA 2BCRA 2DFLA 4ECVA 4ELUA 1YT3A 2XGPA 3N97B 1O03A 3OSPA 3JPSA 1TFRA 4G3IA 3MGIA 3V7JA 1ZQFA 3IN5A 3WKCA 1X6JA 3BQ0A 8ICVA 3PV8A 9ICCA 4K4IA 2ZJ8A 4UAUA 3IG5A 4MFCA 3T5HA
chains in the Genus database with same CATH topology
1V85A 5JTIA 2KE7A 2YTUA 1PK1B 1F0MA 3KKAA 1V38A 1WWVA 1KW4A 2D8CA 2QKQA 3TADC 2KSOA 2KIVA 5JU5A 1Z1VA 2KMDA 3TACB 1OW5A 2Y9UA 2EAOA 2LMRA 2QB0A 3H8MA 5KNIA 1X66A 2FE9A 4RQNA 2E8NA 1B4FA 3SENA 2E8MA 4PZNA 1LKYA 2D3DA 2GLEA 1OXJA 4PZOA 2JV3A 4NL9C 2E8PA 2Y9TA 1COKA 2K60A 2F44A 2EAMA 2ES6A 1RG6A 3KKAC 5J8YC 2KSOB 1WWUA 1UCVA 3K1RB 2QB0B 1B0XA 2B6GA 2ESEA 2KG5A 5F3XB 4NJ8A 1SV0C 1LKYB 1SXDA 2F3NA 5JRTA 2EANA 1SV4A 3BS7A 2QARA 4RQMA 2EAPA 2K4PA 4IS7A 2DKXA 1DXSA 1JI7A 1PK1A 2DKZA 2E8OA 4NL9A 2LPEA 1X40A 3IDWA 1SGGA 3TADA 5L1MA 2F8KA 4MHVA 5J8YA 3BQ7A 1PK3A 1SXEA 1UQVA 2DL0A 3BS5A 3SEIA 3HILA 2QARB 1X9XA 3BS5B 2L5YA 1SV0A 2QB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V85 A;  5JTI A;  2KE7 A;  2YTU A;  1PK1 B;  1F0M A;  3KKA A;  1V38 A;  1WWV A;  1KW4 A;  2D8C A;  2QKQ A;  3TAD C;  2KSO A;  2KIV A;  5JU5 A;  1Z1V A;  2KMD A;  3TAC B;  1OW5 A;  2Y9U A;  2EAO A;  2LMR A;  2QB0 A;  3H8M A;  5KNI A;  1X66 A;  2FE9 A;  4RQN A;  2E8N A;  1B4F A;  3SEN A;  2E8M A;  4PZN A;  1LKY A;  2D3D A;  2GLE A;  1OXJ A;  4PZO A;  2JV3 A;  4NL9 C;  2E8P A;  2Y9T A;  1COK A;  2K60 A;  2F44 A;  2EAM A;  2ES6 A;  1RG6 A;  3KKA C;  5J8Y C;  2KSO B;  1WWU A;  1UCV A;  3K1R B;  2QB0 B;  1B0X A;  2B6G A;  2ESE A;  2KG5 A;  5F3X B;  4NJ8 A;  1SV0 C;  1LKY B;  1SXD A;  2F3N A;  5JRT A;  2EAN A;  1SV4 A;  3BS7 A;  2QAR A;  4RQM A;  2EAP A;  2K4P A;  4IS7 A;  2DKX A;  1DXS A;  1JI7 A;  1PK1 A;  2DKZ A;  2E8O A;  4NL9 A;  2LPE A;  1X40 A;  3IDW A;  1SGG A;  3TAD A;  5L1M A;  2F8K A;  4MHV A;  5J8Y A;  3BQ7 A;  1PK3 A;  1SXE A;  1UQV A;  2DL0 A;  3BS5 A;  3SEI A;  3HIL A;  2QAR B;  1X9X A;  3BS5 B;  2L5Y A;  1SV0 A;  2QB1 A; 
#chains in the Genus database with same CATH topology
 2PMZ C;  2BQ3 A;  3NVZ A;  1ZQW A;  4IQT A;  4J9K A;  2W54 A;  1ZQB A;  1SL0 A;  5GTH U;  3KKA A;  2FPM A;  1JXE A;  1BPY A;  5ALG A;  3L5K A;  3QXG A;  5F9N A;  2BDP A;  5KFH A;  5KFK A;  3C23 A;  1X66 A;  3N4M B;  1TKD A;  4US9 A;  4QWE A;  3C21 A;  4KLE A;  4QW9 A;  2J6S A;  9ICI A;  7ICM A;  2K89 A;  3ONN A;  5ALN A;  5KFO A;  2FPL A;  2E8P A;  2W9C B;  1U49 A;  5KG4 A;  2BCU A;  2LM4 A;  8ICF A;  4NM1 A;  3O0F A;  1NK8 A;  3ZI4 A;  2A3V A;  3ZD8 A;  1MA7 A;  2JEF A;  2ZIU B;  1ZD2 P;  1A6S A;  2XY6 A;  4LVS A;  4CDG A;  4I2B A;  5B5E U;  1CRX A;  4U7C A;  5KT2 A;  3T79 A;  1DK2 A;  3TAQ A;  4IS7 A;  5BPC A;  4WJ3 B;  2AQ0 A;  3NUQ A;  5AKY A;  4JV1 A;  2CN1 A;  5KG5 A;  2ZXH A;  2BPC A;  2FI1 A;  2ZTD A;  3H4D A;  2J6U A;  1NKE A;  4ZOH C;  4J9S A;  3QEA Z;  1L7N A;  3ED5 A;  2P6R A;  2R8I A;  9ICL A;  2L5Y A;  2OCE A;  7ICK A;  4UB5 A;  2XGQ A;  5AK5 A;  3JPT A;  2V4Q A;  2ASJ A;  3H8J A;  3G6V A;  5DB7 A;  2JR5 A;  4UAS A;  4F4Y A;  7ICV A;  5DBC A;  5AKZ A;  3E58 A;  2KIV A;  2G09 A;  4YD1 A;  1X2I A;  3TAP A;  4C80 A;  5A0L A;  3PNC A;  4QNL A;  4IRC A;  2QB0 A;  1S10 A;  7ICF A;  4AP9 A;  5AK6 A;  1X9S A;  1ZQO A;  3NVW A;  2D3D A;  5CJ7 A;  5KAI U;  5ALE A;  1KFS A;  1Z4O A;  5DBA A;  4YMN A;  4DOA A;  2P6U A;  1T3Q A;  4JV2 A;  2AQ4 A;  1B22 A;  1LV5 A;  4UAT A;  3PSF A;  1JAL A;  4KN4 A;  2R8H A;  4M9L A;  3UXN A;  3MAB A;  3WKA A;  5EWF A;  1M6Y A;  1JUD A;  3SR6 A;  4ED8 A;  2IHM A;  2KZZ A;  2Z7J A;  1ED1 A;  2PXI A;  2RQ5 A;  5J0Y A;  5ALS A;  2ALZ A;  2PFQ A;  2AGP A;  4EEK A;  4KX3 A;  1XNS A;  1RZT A;  4DS5 A;  4NLC A;  2K8A A;  4QJF B;  9ICK A;  2KK0 A;  3WK9 A;  5DG9 A;  3JPO A;  5ALZ A;  4O3Q A;  3C2K A;  1AQ6 A;  2C2D A;  4ZH4 A;  3C1Z A;  4YXM A;  5DLG A;  1SZH A;  4KLH A;  4EZ9 A;  1XU4 A;  3M9M B;  1XSP A;  4DSI A;  2HBK A;  2YY6 A;  5J0S A;  1N5W A;  2FLL A;  2XY7 A;  4BDP A;  5ALK A;  4RPY A;  5AK4 A;  2EQY A;  4ECW A;  2ZJA A;  2FDR A;  4CF4 A;  4F5O A;  3BQ1 A;  3WKD A;  1D9D A;  4O3O A;  1D8Y A;  1SWV A;  1SKR A;  2BHN A;  4DL7 A;  2MA1 A;  3MFI A;  1XO0 A;  5HR7 A;  2VA8 A;  2EH9 A;  5L9X A;  2AHO B;  4NWI A;  4F4K A;  1PVR A;  1ZQI A;  3J81 j;  4HAI A;  4X5V A;  3AM9 A;  4B9V A;  4NLB A;  3PW0 A;  3Q8K A;  3AQF A;  5L1K A;  2AJQ A;  1ZD4 A;  2HHX A;  4DQP A;  3N7P D;  4CGZ A;  3JPP A;  3ISC A;  3KKA C;  3BQT A;  4MFA A;  3PW5 A;  3CW2 C;  3TAR A;  1QQ5 A;  1BPD A;  2IOF K;  4CCH A;  3PR4 A;  4OD0 A;  3EPI A;  4FBT A;  4A8E A;  3MBY A;  4EX6 A;  4QWC A;  3F2C A;  4DFP A;  3UMG A;  4O3M A;  2R8G A;  4RQ2 A;  2HBM A;  3ISB A;  9ICV A;  2M9N A;  2EZX A;  8ICY A;  3IG8 A;  4I2I A;  4US8 A;  4DOB A;  2Y1J A;  4J9P A;  5AI4 A;  1K1Q A;  2W11 A;  5J2C A;  4RPX A;  4DFJ A;  4P0Q B;  3GV5 B;  1SGG A;  3RR7 A;  3B0X A;  5BOL A;  1QSS A;  2KTQ A;  4Y2U A;  4TQR A;  3MR5 A;  4KLJ A;  3HKZ F;  4AYB F;  2KVC A;  1NJZ A;  5AI6 A;  3Q8P B;  2VA3 A;  4QZD A;  2C2E A;  1RQL A;  5KFS A;  4O0I A;  2F76 X;  5HNK A;  1SL2 A;  3RFA A;  7ICR A;  1Z00 A;  3KHG A;  2HDO A;  3C1Y A;  4B9U A;  3WK6 A;  1RXV A;  5DQI A;  4ED3 A;  3R9K A;  3HJE A;  1L5U A;  2AXT U;  3G6Y A;  1QH9 A;  3WK7 A;  4KN7 A;  4PH5 A;  3BDP A;  9ICO A;  4RQN A;  1H38 A;  2RHF A;  1J2M A;  2J6T A;  2W9B A;  4DEZ A;  2K4E A;  4O3P A;  1D8B A;  2DF4 B;  2KZ3 A;  2G08 A;  1ZET A;  5EWG A;  2BCV A;  2YML A;  1F44 A;  2VA2 A;  3K4G A;  4EBC A;  2W04 A;  3GZF A;  4EEL A;  2ZTE A;  4U6P A;  2R8K A;  3KHR A;  3NS1 A;  1JRP A;  3UM9 A;  3C28 A;  3OHB A;  3V6K A;  2KN7 A;  2ISP A;  2K8B B;  5F3X B;  1UT8 A;  3HX0 A;  3IV6 A;  4B9S A;  8ICL A;  2DBY A;  4BUG A;  3HT3 A;  4Q45 A;  9ICQ A;  4ECZ A;  2EAN A;  4I2G A;  7ICG A;  3KOO A;  5ALM A;  5ALO A;  3PW7 A;  4FS2 A;  3C2M A;  1O08 A;  2AGQ A;  3V7K A;  4R63 A;  4I28 A;  4O3R A;  3F2B A;  4KLI A;  2HOI A;  2N1R A;  5KG7 A;  2D6F C;  2YB4 A;  5FP0 A;  4MHV A;  1ZQD A;  3OTQ A;  3BQ7 A;  2JEI A;  1ZJN A;  3WKE A;  2EZY A;  3RBD A;  1QLN A;  3JPQ A;  1S77 D;  1UHU A;  1X9X A;  2ZUC A;  1FEZ A;  4YMO A;  2V9W A;  7ICN A;  4PL1 A;  4DLE A;  1Q8K A;  5D46 A;  9ICJ A;  3NAS A;  4M6W B;  5C0Y A;  5AM5 A;  4DFM A;  2ZTC A;  2E1F A;  4ELV A;  3TAC B;  2NRZ A;  3UMC A;  2UVW A;  3BJY A;  2HVI A;  5KFF A;  3MDC A;  1NZP A;  2LKY A;  3PX6 A;  2EDU A;  4K4H A;  3KTQ A;  4ECR A;  5AK3 A;  1J2N A;  4BJQ A;  2LYA A;  3GII A;  2JGA A;  2YMM A;  3E2E A;  2KHQ A;  2ASD A;  3D2Q A;  9ICB A;  2G0A A;  5DQH A;  2VKQ A;  3KFU F;  2XIC A;  2BCQ A;  1HJP A;  2A19 A;  4IQV A;  2FJ6 A;  3GDX A;  4BXO A;  2LBO A;  4KLL A;  2B21 A;  2NO5 A;  4UB4 A;  5JRT A;  1SV4 A;  3QUQ A;  5ALY A;  4JK1 A;  3SZ2 A;  2FMQ A;  2OH2 A;  5DG8 A;  4RQ1 A;  3OJS A;  1KFD A;  2DKX A;  2DQN B;  1KRP A;  2IBK A;  4QZ8 A;  4F2R A;  5KFC A;  2DKZ A;  5KFT A;  1TVA A;  3N28 A;  4NL9 A;  3F5A A;  3SAH A;  2HCF A;  5AKX A;  4UBB A;  5J0T A;  5JUM A;  5KT7 A;  4DQS A;  1KKX A;  3TAD A;  4UAY A;  5KFL A;  1DGS A;  3EUB 2;  4BWJ A;  5DLF A;  4PHE A;  3DDH A;  4I29 A;  4QZB A;  5EE1 A;  4ICA A;  8ICT A;  1PK3 A;  3BS5 A;  3RJH A;  2W8L A;  4Q8E A;  4F4W A;  9ICH A;  5T14 A;  2KE7 A;  4UAV A;  5ALH A;  1L3T A;  4ED2 A;  4Y2T A;  5B66 U;  2GOL A;  1QTM A;  1ZQV A;  1RYR A;  2ZIW A;  5KL1 B;  1WWV A;  1KW4 A;  9ICU A;  1BPZ A;  2HBJ A;  3Q8M A;  5AHX A;  2KMD A;  4I27 A;  3L3F X;  1N48 A;  3Q8Q B;  4CRX A;  3FC4 A;  1B4F A;  1MN8 A;  2G07 A;  8ICA A;  3SV4 A;  4DL4 A;  5KG6 A;  1ZQX A;  4BX9 C;  4KLT A;  4KMU A;  8ICR A;  3CP8 A;  1N60 A;  2RDJ A;  4QIW F;  3QUC A;  1COK A;  2W55 A;  5ALD A;  3KHL A;  5AI5 A;  1KLN A;  4C0Z A;  3AEV A;  2NRX A;  3AN1 A;  3RJI A;  1CEZ A;  2KSO B;  4DF4 A;  3C5G A;  1ZQK A;  1NNL A;  3M1Y A;  4F3O A;  2PFP A;  4F50 A;  1ZOL A;  3UMB A;  4EYH B;  3T5J A;  1NK4 A;  4UAZ A;  3BS7 A;  2NYV A;  3FYH A;  2WAQ C;  4EBE A;  4CF3 A;  3EWA A;  9ICN A;  4UQG A;  1HEK A;  3THV A;  2E8O A;  2WF5 A;  5L1J A;  4R64 A;  4KLU A;  2KP7 A;  4KX5 A;  5KFB A;  2CXY A;  2JXJ A;  4YP3 A;  3DV9 A;  4F91 B;  3V72 A;  5L1M A;  5HP4 A;  2ZIX B;  4YR3 A;  3PO4 A;  1BNP A;  1ZQN A;  2NO4 A;  2E3T A;  2QLT A;  4ED7 A;  2Y0S F;  4UB1 A;  4FBU A;  4F5N A;  2HHQ A;  4QZE A;  1BPX A;  2QAR B;  1T3N A;  8ICQ A;  3V6J A;  2KVS A;  2R8J A;  2WTF A;  1F0M A;  1ZQT A;  4CF5 A;  5DQG A;  1Z1V A;  4J9L A;  1XO1 A;  4RNN A;  1VDV A;  4ECS A;  8ICH A;  8ICE A;  2K8C B;  3GIJ A;  8ICN A;  3RJG A;  5AM2 A;  3HKZ C;  4AYB C;  2LI6 A;  9ICT A;  1N5X A;  3H7I A;  1L8L A;  1S97 A;  3UXP A;  3TKA A;  1KDH A;  5KFP A;  3LVW A;  3SD7 A;  1ZQZ A;  2V4R A;  1XWL A;  5KFE A;  2A1J B;  5TZV A;  3MR2 A;  1L3S A;  1L7P A;  1TE2 A;  5AIA A;  4FS1 A;  4NLN A;  5KFD A;  1B0X A;  3SAF A;  4C8N A;  1FFU A;  1URJ A;  4KLD A;  1V97 A;  4KLO A;  2PFO A;  2LM1 A;  4GC7 A;  4DL3 A;  4GC6 A;  2EAP A;  5DB9 A;  2DWQ A;  3SAG A;  5AKL A;  1YZ6 A;  7ICL A;  2XI9 A;  5KT3 A;  2IA6 A;  1TK5 A;  2W9M A;  2GO7 A;  3SV3 A;  1Q46 A;  4RQ3 A;  3T3F A;  4UB8 U;  2H3I A;  2E5S A;  4P4O A;  5J8Y A;  1Z4N A;  3QU7 A;  2JEG A;  2KIC A;  3EZ5 A;  3PSI A;  4OO1 J;  1T8E A;  1SXE A;  2XID A;  2HVH A;  3LWM A;  1SV0 A;  2H5X A;  1DRG A;  9ICW A;  2HSZ A;  1RQN A;  5J2J A;  4YR0 A;  1PK1 B;  5DGB A;  3QUB A;  1IV8 A;  5GTI U;  2BGW A;  2FMS A;  4I2H A;  3TAD C;  3PY8 A;  2YB1 A;  3A0H U;  1LVH A;  4F5Q A;  3PZP A;  4B9T A;  2ZUB A;  4KIT B;  2EAO A;  3RJJ A;  2LMR A;  5AM4 A;  4QZA A;  3H0L B;  4ELT A;  3MFH A;  3PW2 A;  4R65 A;  1T7P A;  4J9O A;  2IMW P;  2MSN A;  3LDA A;  2K60 A;  4NM2 A;  1RG6 A;  4C8L A;  1X9M A;  4F71 A;  4Y2P A;  4DWI A;  2WFA A;  3K1R B;  4XRH A;  2ZUD A;  4BWM A;  1GO3 F;  5ALX A;  8ICX A;  1LKY B;  3AMZ A;  3F5E A;  4GIB A;  5DDM A;  2BQR A;  4M04 A;  4P0P A;  3QNM A;  5DDY A;  2KIW A;  1RYS A;  3QYP A;  4NLK A;  2C2R A;  5KG1 A;  4MEY A;  4OJO A;  1HUZ A;  1T94 A;  3D6J A;  4OJL A;  4OJP A;  1TAU A;  3Q8L A;  4XUS A;  1U48 A;  4PHD A;  3QU2 A;  5III A;  1ZQP A;  3ZD9 A;  3PST A;  7ICS A;  4UAR A;  1SKS A;  4C4T A;  5KFM A;  4OJ6 A;  1DK3 A;  4DS4 A;  1TAQ A;  3VCB A;  3M7D A;  2KKV A;  4DOC A;  5KFQ A;  4EYI B;  2YMP A;  3KHH A;  4B9M A;  1Z00 B;  5J2E A;  5KT5 A;  5JU5 A;  2IOH A;  5J2B A;  4ECQ A;  4QWB A;  1JX4 A;  2Y9U A;  2JMG A;  1ZQG A;  4QW8 A;  3T5K A;  3H4B A;  1ZQR A;  2B0C A;  2E8M A;  3LWL A;  3BQ2 A;  4EEY A;  4TUP A;  4YN4 A;  3RH4 A;  5HML A;  3GU3 A;  4I2D A;  5IIM A;  2C22 A;  2MRL A;  4RNO A;  3M6Z A;  2WF8 A;  2NRW A;  3M9N B;  1SB3 C;  2ES6 A;  4IRD A;  5KFI A;  4Q44 A;  2KZM A;  3D2S A;  7ICP A;  4YQW A;  4P0Q A;  3QX7 A;  5KT6 A;  2OYY A;  3S6J A;  4RQ4 A;  1ZQQ A;  4I2A A;  2F1H A;  1L3U A;  3RTV A;  1ECW A;  5CA7 A;  5J0Q A;  7ICE A;  2KEY A;  1A76 A;  2MUT A;  4NXZ A;  4DSJ A;  5CHG A;  4GXK A;  2K4H A;  1U47 A;  2ZIV B;  3GIM A;  4C4S A;  4KLS A;  1JXL A;  4QIW C;  5AI0 A;  2F8K A;  4FE3 A;  1X42 A;  4F92 B;  5EOZ A;  5KL8 B;  4YG2 A;  3MGV A;  3GIK A;  3UQ2 A;  2JH1 A;  5EE3 A;  2GH1 A;  4RT2 A;  1NJX A;  3L4P A;  2KJ5 A;  4TUQ A;  4JB3 A;  3I1Y A;  4O3N A;  2YTU A;  2WF9 A;  8ICS A;  5CRX A;  4NY8 A;  2MU2 A;  1L7M A;  4O5E A;  1U45 A;  1V38 A;  1SWW A;  2R18 A;  3PX0 A;  8ICO A;  4YXJ A;  3RJK A;  1KSP A;  3HRD D;  4C7Y A;  4I2F A;  1KEJ A;  1X6I A;  4LZG A;  1WG8 A;  1YZ7 A;  5ALL A;  4NV0 A;  5C5J A;  5KG2 A;  4PHA A;  3SMV A;  1S0N A;  1LB2 B;  1COO A;  5KFU A;  1OXJ A;  3OHA A;  4YCX A;  1CUK A;  5KFG A;  2Y0S C;  4DF8 A;  2JZB B;  2M0N A;  5ALI A;  2Y1I A;  2GWS A;  1VLB A;  1XSL A;  2WHE A;  1S76 D;  1D9F A;  2LYB A;  1C20 A;  5ALQ A;  3U26 A;  7ICJ A;  1BPE A;  4PL2 A;  3RH5 A;  2G5H B;  3ETR A;  5ALT A;  2H3V A;  5KFZ A;  5AIC A;  1FFV A;  5J0X A;  4Y2S A;  3GV8 B;  4DQQ A;  2F3N A;  1IG6 A;  3IRU A;  4CNQ A;  2KOB A;  3ZDE A;  2ODG A;  3HP6 A;  4O3S A;  5G5H A;  3M8S A;  1NKC A;  2F2A B;  2W43 A;  4M47 A;  4UBC A;  2P35 A;  4KTQ A;  4RQ6 A;  3NTU A;  4Q43 A;  4ED6 A;  5J0U A;  2OHF A;  4P4M A;  4MF2 A;  2XO7 A;  2DUY A;  3PO5 A;  1T4G A;  4OJ5 A;  2AGO A;  3QU9 A;  1UQV A;  3HIL A;  5KG3 A;  4P4P A;  3BS5 B;  1MQ2 A;  5JTI A;  3WK5 A;  3IM1 A;  1ZJM A;  4R8U A;  3MDA A;  3V7L A;  5DKW A;  1NI3 A;  2O6K A;  9ICF A;  3K1Z A;  1QSL A;  3GIL A;  2FPK A;  4Z6F A;  3PVX A;  5L1L A;  1ZRN A;  3T5L A;  5AI8 A;  5BOM A;  2KJ8 A;  2E8N A;  5KFY A;  4DQI A;  4JWN A;  3SEN A;  4UB2 A;  5AKI A;  2CRX A;  4PPX A;  1PVP A;  5KFV A;  3RRG A;  8ICC A;  2XVT A;  2GLE A;  3OSN A;  4IQW A;  4YMM A;  4PZO A;  3D2N A;  4RQ8 A;  2FLP A;  2KFZ A;  4F5R A;  3RF9 A;  1CI4 A;  4KLF A;  3NGD A;  5IIN A;  1SL1 A;  4DO9 A;  4IRK A;  4TUR A;  5DBB A;  4R66 A;  7ICT A;  1FO4 A;  4YR2 A;  3M6K A;  4KLQ A;  2B6G A;  1NZB A;  2ZG6 A;  2ESE A;  4IL6 U;  4XQ8 A;  4FZM A;  1XSN A;  3FAH A;  1C7Y A;  5J2K A;  2BPG A;  5CR0 A;  2HMX A;  3QU5 A;  2K4P A;  2HHV A;  1NK6 A;  2I1Q A;  5HHI A;  1ZQA A;  2MAX A;  1S0M A;  2VAN A;  4DL6 A;  1ZQJ A;  5HHH A;  3IHQ B;  1A0P A;  3RBE A;  1X40 A;  2WB1 F;  9ICS A;  4J03 A;  3ETL A;  2IOF A;  4B9L A;  4M9G A;  2HHT A;  4ACO A;  2XCP A;  4F4Z A;  3F2D A;  3C5F A;  2NRV A;  2UVU A;  1KTQ A;  1ZQ1 C;  3RB6 A;  2WF6 A;  4JUZ A;  2DL0 A;  3KZI U;  1HIW A;  1XC9 A;  4EX7 A;  1WCN A;  2QB1 A;  2KJ9 A;  1PVQ A;  9ICG A;  2XC9 A;  2ASL A;  4I2E A;  2VIX A;  5KFJ A;  3PR5 B;  1J97 A;  4EEN A;  2HW3 A;  2LHT A;  4RNM A;  1UA1 A;  1DOQ A;  4F4X A;  2AH5 A;  1NKB A;  4J9Q A;  2KD1 A;  2KSO A;  2HHU A;  3ZDC A;  3H8W A;  3UPQ A;  1MQ3 A;  4NLG A;  1RDF A;  5J0R A;  5DGA A;  1Z3E B;  2LYH A;  2W9C A;  4PGY A;  4O9M A;  4KLG A;  3OGU A;  7ICQ A;  3E0F A;  4QZI A;  3RAX A;  2F44 A;  1VJ5 A;  5ALP A;  2KHV A;  4JMU A;  4Y2X A;  1A77 A;  4UW9 A;  5AIB A;  2I5H A;  2ZIU A;  2QB0 B;  2ZIX A;  2PFN A;  4FFD A;  4DCC A;  4C7Z A;  2KFN A;  5ALV A;  3F53 A;  8ICZ A;  1S8O A;  1L7O A;  3JPN A;  3SYZ A;  2QAR A;  2W3R A;  1B43 A;  5KFR A;  1K1S A;  4Y2V A;  2YMQ A;  3HWT A;  5J29 A;  4M9N A;  3RR8 A;  3K75 D;  3RJE A;  1Y88 A;  2ZJ5 A;  2HOQ A;  2Q0Z X;  3PSP A;  2ZXI A;  3PW4 A;  5E79 U;  2F1I A;  2W9A A;  9ICX A;  2FLN A;  4YFK A;  4QZF A;  8ICM A;  9ICR A;  1ZQS A;  4ECT A;  1MC8 A;  4TUS A;  2C28 A;  5ALR A;  1JRO A;  4Q8F A;  1U9L A;  1SKW A;  3CNH A;  4Y2Y A;  2NRT A;  3GQC A;  4ED0 A;  5KAF U;  4FZN A;  5AM1 A;  2A1J A;  1ZQC A;  3VC8 A;  3AQE A;  1SIJ A;  3RB4 A;  1F5S A;  1IM4 A;  1EXN A;  1N2X A;  1UA0 A;  1OW5 A;  1L8O A;  2IHN A;  3EYZ A;  2FE9 A;  2YN4 A;  1S9F A;  4MEX A;  7ICH A;  2F77 X;  1TAM A;  5KG0 A;  1HUO A;  2PI5 A;  4GXI A;  4PZN A;  3ZDB A;  1RPL A;  3CRX A;  3TFS A;  2E1E A;  4IR9 A;  1Q3U A;  5J2A A;  8ICU A;  4NL9 C;  4F72 A;  2RDI A;  2Y9T A;  4DSK A;  1ZQL A;  2JRZ A;  3MR3 A;  1N61 A;  1Z1B A;  3HPO A;  1ZRM A;  5DB6 A;  1BPB A;  1RM6 C;  3M8R A;  1WWU A;  3FDS A;  3I76 A;  1ZYQ A;  3AL0 B;  5AKK A;  1UCV A;  5EWE A;  4JV0 A;  2OWO A;  3CYM A;  4PGX A;  2PMZ F;  3ZDD A;  3A0B U;  3C2L A;  2BZF A;  4J9R A;  1SXD A;  4C8K A;  4I2C A;  2BKE A;  4RZR A;  4RUA A;  5J2G A;  1S0V A;  1KL9 A;  4IR1 A;  4P0P B;  2H3Z A;  1JI7 A;  5HR6 A;  1PK1 A;  2A1A A;  5L1I A;  3LK9 A;  1ZQM A;  4DQR A;  4I2J A;  3QZ7 A;  1P7D A;  1QSY A;  4C8O A;  4F8R A;  3NVV A;  3H0R B;  2H3F A;  1XS9 D;  5IIO A;  5G5G A;  5ALW A;  5K4L A;  8ICG A;  1V9P A;  4P2H A;  2YX8 A;  3C29 A;  3RJF A;  3TAN A;  5ALJ A;  3UXO A;  1NK0 A;  2YQE A;  2W7O A;  8ICB A;  7ICO A;  3SEI A;  4O5C A;  2G5I B;  5EE0 A;  4UB3 A;  1DGJ A;  5CP2 A;  2HOF A;  3H8S A;  9ICP A;  1IXR A;  2JHD A;  2WAQ F;  7ICU A;  2WF7 A;  1WUD A;  3RB3 A;  4ECX A;  5F9L A;  1NK7 A;  1NOM A;  3NVY A;  5DG7 A;  1IIP A;  4FZL A;  1FIQ A;  4TQS A;  5IIJ A;  1RYU A;  2JH7 A;  2D8C A;  4XA5 A;  5AM0 A;  5KT4 A;  3JPR A;  2NV3 A;  2I9G A;  1BGX T;  4ED1 A;  5ALF A;  3LYS A;  5CEH A;  4QWA A;  3H8M A;  5KNI A;  2EZZ A;  5AKH A;  5ALU A;  4GFJ A;  5KFW A;  5H2F U;  1KN5 A;  1LKY A;  3DEE A;  3ORY A;  5AI9 A;  5DB8 A;  5J0P A;  1ZQU A;  3QU4 A;  3Q8R B;  2HBL A;  3N7S C;  2AU0 A;  1JMS A;  1N63 A;  3I28 A;  3H40 A;  3AUO A;  9ICE A;  4O5K A;  3FM9 A;  4DFK A;  4DL5 A;  4DL2 A;  3KZX A;  4Y2J A;  1UPH A;  9ICM A;  4CE6 A;  4QWD A;  3H0M B;  1KBU A;  1S5L U;  4PGQ A;  3GV7 B;  4B9N A;  2RLT A;  2F8L A;  4RU9 A;  4NJ8 A;  1PUZ A;  2KV2 A;  5AM3 A;  2UVV A;  2W9B B;  1TV9 A;  4UB6 U;  1WCL A;  5AKJ A;  2OM6 A;  4KMO B;  4QZC A;  5D49 A;  3RH6 A;  3ICX A;  4PJ0 U;  4M9H A;  2PI4 A;  1DXS A;  3Q8S B;  4J9N A;  4IQU A;  3QEB Z;  3N7R C;  2MUT B;  5KFX A;  4FO6 A;  3ISD A;  4B6J A;  4DSE A;  3HW8 A;  3AU6 A;  4DFD A;  3IDW A;  2HHS A;  3QUT A;  2OXO A;  4RPZ A;  2H3Q A;  1ZQY A;  1ZQH A;  1WYG A;  3WK4 A;  3TQ1 A;  5D4B A;  3RRH A;  1NK5 A;  2DPJ A;  4MF8 A;  2BR0 A;  1TK8 A;  4E0D A;  4F2S A;  4J9M A;  1ZD5 A;  1K5O A;  1NK9 A;  1KFT A;  4QZH A;  2DPI A;  3PMN A;  1QCK A;  1RXW A;  1BNO A;  1D8L A;  5AKE A;  5HMM A;  1UT5 A;  3AU2 A;  3BZK A;  1L3V A;  2BDU A;  2W03 A;  4DSF A;  5J2F A;  1ZXI A;  4NLZ A;  2CPR A;  1ZQE A;  4M9J A;  2BPF A;  2W8K A;  2WB1 C;  5AKG A;  3QE9 Y;  1S0O A;  5J2D A;  4RQ5 A;  2DGZ A;  4ECU A;  2RRD A;  4OCZ A;  5J2I A;  1X9W A;  2FMP A;  3EPG A;  1N56 A;  2JV3 A;  5EE9 A;  5KFA A;  5IIK A;  3OJU A;  4Z6D A;  4Z6C A;  2EAM A;  8ICW A;  4Y2R A;  4RUC A;  2G06 A;  3ALR A;  2Q4T A;  4YVZ A;  4C8M A;  5J8Y C;  2ZIV A;  4QZ9 A;  2W7P A;  3LVV A;  4LJX A;  3GFK B;  4DLG A;  1ARO P;  1MSW D;  4F5P A;  4EBD A;  1JN3 A;  3MGH A;  2W3S A;  1SV0 C;  2I6X A;  2P66 A;  4IC9 A;  5J2H A;  4ECY A;  4USA A;  4RT3 A;  4F93 B;  4K4G A;  4G9B A;  5KFN A;  3V6H A;  4C4R A;  8ICI A;  4UAW A;  2LPE A;  4M0A A;  3OPX A;  9ICA A;  1ZD3 A;  4KLM A;  5TIS U;  1PZN A;  4EZ6 A;  1TK0 A;  1QQ6 A;  3KBB A;  4BXO B;  2PKE A;  5J0W A;  3ZDA A;  3KD3 A;  3B0Y A;  4YD2 A;  4RQ0 A;  2K4I A;  4GXJ A;  1V85 A;  3G6X A;  2UVR A;  1Q3V A;  1L6N A;  2JZB A;  4LZD A;  4DSL A;  3QZ8 A;  4M6W A;  2VJ5 A;  3NRW A;  3SQI A;  2BCS A;  4Y2Q A;  3SI8 A;  3IP4 B;  4R8U B;  2BQU A;  3MR6 A;  2KKP A;  3B9J A;  2QKQ A;  3RAQ A;  2HHW A;  1Z19 A;  2XY5 A;  3MC1 A;  1U4B A;  4HYK A;  1N62 A;  1KQQ A;  1OUQ A;  3TI0 A;  8ICP A;  4GLX A;  4M2Y A;  4JWM A;  3WK8 A;  2OEH A;  5KTQ A;  5J0O A;  2HI0 A;  3PML A;  3NRZ A;  3M9O B;  4Z6E A;  4QZG A;  3BZC A;  5IIL A;  2JEJ A;  1NJY A;  2ZIW B;  3WU2 U;  2ISO A;  2KNJ A;  5CB1 A;  2XCA A;  4BGD A;  3PX4 A;  2F1J A;  1JIH A;  1QQ7 A;  2KG5 A;  2VJ4 A;  1BVS A;  8ICJ A;  3EW9 A;  3WKB A;  3RB0 A;  1NJW A;  1SZP A;  3UQ0 A;  2ATL A;  8ICK A;  4MFF A;  4RQM A;  3TFR A;  7ICI A;  4PHP A;  2RP5 A;  4RQ7 A;  5CWR A;  2BCR A;  2DFL A;  4ECV A;  4ELU A;  1YT3 A;  2XGP A;  3N97 B;  1O03 A;  3OSP A;  3JPS A;  1TFR A;  4G3I A;  3MGI A;  3V7J A;  1ZQF A;  3IN5 A;  3WKC A;  1X6J A;  3BQ0 A;  8ICV A;  3PV8 A;  9ICC A;  4K4I A;  2ZJ8 A;  4UAU A;  3IG5 A;  4MFC A;  3T5H A; 
#chains in the Genus database with same CATH homology
 1V85 A;  5JTI A;  2KE7 A;  2YTU A;  1PK1 B;  1F0M A;  3KKA A;  1V38 A;  1WWV A;  1KW4 A;  2D8C A;  2QKQ A;  3TAD C;  2KSO A;  2KIV A;  5JU5 A;  1Z1V A;  2KMD A;  3TAC B;  1OW5 A;  2Y9U A;  2EAO A;  2LMR A;  2QB0 A;  3H8M A;  5KNI A;  1X66 A;  2FE9 A;  4RQN A;  2E8N A;  1B4F A;  3SEN A;  2E8M A;  4PZN A;  1LKY A;  2D3D A;  2GLE A;  1OXJ A;  4PZO A;  2JV3 A;  4NL9 C;  2E8P A;  2Y9T A;  1COK A;  2K60 A;  2F44 A;  2EAM A;  2ES6 A;  1RG6 A;  3KKA C;  5J8Y C;  2KSO B;  1WWU A;  1UCV A;  3K1R B;  2QB0 B;  1B0X A;  2B6G A;  2ESE A;  2KG5 A;  5F3X B;  4NJ8 A;  1SV0 C;  1LKY B;  1SXD A;  2F3N A;  5JRT A;  2EAN A;  1SV4 A;  3BS7 A;  2QAR A;  4RQM A;  2EAP A;  2K4P A;  4IS7 A;  2DKX A;  1DXS A;  1JI7 A;  1PK1 A;  2DKZ A;  2E8O A;  4NL9 A;  2LPE A;  1X40 A;  3IDW A;  1SGG A;  3TAD A;  5L1M A;  2F8K A;  4MHV A;  5J8Y A;  3BQ7 A;  1PK3 A;  1SXE A;  1UQV A;  2DL0 A;  3BS5 A;  3SEI A;  3HIL A;  2QAR B;  1X9X A;  3BS5 B;  2L5Y A;  1SV0 A;  2QB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...