4RQMA

Crystal structure of the semet bicc1 sam domain r924e mutant
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
KGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKMLLAISELNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of the SAM Domain of BICC1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Protein bicaudal C homolog 1
total genus 19
structure length 63
sequence length 63
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4rqmA01
1UQVA 2B6GA 2QKQA 1B4FA 4RQNA 2EAPA 2Y9UA 3HILA 2KG5A 2F8KA 1V38A 4PZOA 1LKYB 2KSOB 2DKXA 1DXSA 4MHVA 2K60A 2YTUA 2E8MA 1OXJA 4NL9C 3H8MA 2ESEA 3BS5B 2DL0A 2FE9A 5JRTA 1B0XA 3SENA 2QARA 1PK3A 2K4PA 3TACB 1F0MA 1KW4A 1V85A 3K1RB 2E8OA 2QB1A 2D8CA 1SV4A 2E8NA 1X9XA 3BQ7A 2QARB 1LKYA 2F3NA 2QB0B 2F44A 1COKA 3KKAA 5KNIA 3SEIA 2ES6A 1OW5A 1PK1A 2KIVA 2KE7A 2EAOA 2LMRA 5L1MA 2Y9TA 2KMDA 2D3DA 3BS5A 5J8YC 3KKAC 1Z1VA 3TADC 1SXEA 2LPEA 3IDWA 2KSOA 4RQMA 2E8PA 1JI7A 1SV0A 2EANA 1PK1B 2EAMA 3BS7A 1X40A 2QB0A 1RG6A 1SV0C 4IS7A 2DKZA 1WWUA 2JV3A 5J8YA 1X66A 2GLEA 5JTIA 5F3XB 1SXDA 3TADA 2L5YA 1WWVA 4NL9A 1UCVA 5JU5A 4PZNA 4NJ8A 1SGGA
chains in the Genus database with same CATH superfamily
4KLDA 2B6GA 4NLBA 1SL1A 1N48A 3HPOA 2XI9A 4YG2A 3THVA 3TAQA 2FPMA 5KFYA 2YX8A 2R8HA 1NKEA 2G08A 2YMLA 4Y2UA 1KL9A 2Y1IA 4IR9A 4QNLA 2K89A 2AU0A 2WF7A 4C80A 3C1ZA 4C8KA 4ECQA 3SYZA 2F8LA 1KKXA 4C8NA 1NJZA 1T3QA 4UAVA 2OM6A 2K4PA 5A0LA 5B66U 4NWIA 3EUB2 1ZQDA 3SQIA 2AQ4A 2R8GA 4UBBA 4US8A 4QIWC 4M47A 5DGAA 2F3NA 5ALIA 2KKVA 2K8BB 3HT3A 5DQHA 2KIVA 4I29A 1MSWD 2LMRA 3EPIA 2EZYA 4GC7A 1UT5A 3QEBZ 4YR0A 3KKAC 4X5VA 1WG8A 2W3RA 2VIXA 5ALPA 4NLGA 4WJ3B 4PHDA 4LZGA 1BGXT 2F77X 2XY6A 3MR5A 3V6KA 2CRXA 1SZHA 1WWUA 2P35A 7ICFA 3TADA 3Q8LA 3RTVA 3RH4A 4R8UA 1COOA 1YZ7A 2HBJA 1QSYA 3E0FA 1NK4A 2R8KA 3KZIU 3NVYA 4O9MA 1TVAA 5HMLA 7ICVA 3KHLA 5FP0A 1ZD3A 5CR0A 1JRPA 5K4LA 3BZCA 2C2DA 2Y9UA 2GO7A 4ECVA 5ALRA 5DQGA 4P4OA 1L3SA 2G0AA 3M7DA 3RJHA 2K4HA 2K60A 2RHFA 4PPXA 2DPJA 1U9LA 5ALKA 7ICNA 2BDPA 5KFNA 2NYVA 9ICVA 2HHWA 2JH1A 4K4GA 4RNOA 2BKEA 1FIQA 9ICJA 3SENA 5AI6A 2NRXA 5J2HA 5EE9A 3N4MB 9ICOA 4Y2QA 3RJEA 3JPOA 4F3OA 3CNHA 1BPDA 4IL6U 1P7DA 2YB1A 4KLIA 1TE2A 4Y2JA 4C7ZA 3KHGA 3HP6A 4GXJA 4RUAA 9ICMA 9ICTA 4UAWA 1JMSA 4UASA 4QJFB 4CF5A 8ICCA 1BPEA 4RQ2A 1L7OA 2WAQC 3SR6A 4BUGA 1NK7A 1D8YA 4O3NA 2FMPA 5AI0A 4C4RA 5AKXA 8ICTA 4UB3A 5KFMA 2E8PA 5AI9A 2P66A 2BQRA 5CP2A 4DQPA 1Q3UA 3JPQA 2PMZF 1SXDA 5AM2A 2IHMA 4OJ5A 5KG0A 4GXIA 4NM2A 2HHSA 2E5SA 4B9LA 1ZQYA 3H4BA 4RT3A 1B4FA 4C7YA 1HUZA 2EAPA 1FFVA 3BQ0A 2J6SA 4JWNA 2KG5A 3H8SA 4ED2A 2DKXA 5J0UA 2DBYA 3UMCA 5KFLA 2OEHA 5F9NA 2BGWA 4G3IA 3OJSA 4J9SA 4RPXA 4O5KA 5IIOA 3MGHA 2H5XA 1C7YA 4XA5A 4ELVA 3UXNA 5JRTA 3KOOA 4Y2VA 2XY7A 5EOZA 1ZQLA 2VA3A 1N2XA 2GOLA 2FPLA 5DLFA 5EE0A 4ACOA 5G5GA 1V85A 3ZD9A 1TV9A 3ZDAA 2VJ4A 4UB6U 5HNKA 4F4KA 2KZ3A 3QZ7A 1T7PA 3ZDBA 3PO4A 3BQ7A 5IIJA 4Y2SA 5J2EA 2OWOA 2LHTA 8ICSA 3M8SA 3SAHA 2HBLA 3M6KA 5AK4A 4Q8EA 2CPRA 2NO4A 3H40A 2G06A 9ICCA 1L8LA 4DOAA 2D3DA 4PGXA 3I28A 4BWMA 2AH5A 2ZUBA 4I27A 3UMGA 1Q3VA 7ICGA 4CDGA 1NOMA 3GQCA 4K4IA 2XGPA 5AM5A 1S10A 1RG6A 3J81j 1S0OA 2ISPA 1WCNA 5DBAA 2HOQA 4NL9A 4ELTA 5JU5A 5CHGA 4PZNA 2G09A 3DDHA 5HR7A 4UAUA 4KX3A 4DSFA 1S77D 4YP3A 3F2BA 1MQ2A 4YFKA 2F1HA 2HI0A 5KFVA 4DOCA 1DXSA 4F4WA 3FAHA 1PUZA 3HWTA 3MDAA 3PY8A 4OCZA 5KFFA 7ICPA 4MFCA 7ICEA 1T8EA 3ZD8A 3C1YA 5KFQA 2DPIA 5J0YA 8ICMA 4Q44A 2KFZA 3SI8A 3TFSA 2W9CA 2KZZA 4M9JA 2W9AA 4CCHA 1N5WA 4PL1A 7ICKA 8ICGA 4RQ3A 4NY8A 3QU7A 4EYIB 1CUKA 3TKAA 5J2FA 4AYBC 8ICJA 5ALXA 2FPKA 3KZXA 2ZIUA 2WFAA 3C23A 4YD2A 4F4ZA 3V6JA 4RZRA 3PO5A 5TZVA 2FLPA 3QNMA 3ISDA 3IN5A 8ICZA 3AQFA 4ECYA 4Q8FA 3SEIA 2ES6A 1FFUA 1OW5A 3ICXA 3SZ2A 2WTFA 5J2DA 3PX0A 2Y9TA 5KFXA 8ICBA 4P4PA 4KLFA 3N7SC 1SWVA 8ICQA 2LI6A 3Q8QB 1KFDA 1X9MA 5E79U 5J2CA 4C4TA 2GLEA 4FFDA 3VC8A 4DQQA 4P2HA 5CJ7A 5AKIA 5KFSA 4QWEA 5ALEA 3FC4A 1RDFA 4Q45A 3ETLA 2G07A 1V97A 4IRDA 5KL8B 2VKQA 2FMSA 2KV2A 2HHUA 1TK8A 3LK9A 1DK2A 5CEHA 1K5OA 2BCSA 1V38A 2GH1A 4CRXA 3MABA 2NO5A 3GIJA 5KFEA 1SZPA 4MHVA 2JEIA 2YTUA 2AJQA 5AI4A 5L1IA 1S97A 5KG3A 4P0PB 1QSSA 3PSFA 2XC9A 5KFBA 8ICFA 4B9MA 3WKCA 2BQUA 3QEAZ 4QZFA 4K4HA 2IOHA 4JV1A 4QZEA 4GC6A 4ECWA 2RDIA 3PW7A 2ASJA 3ONNA 2JEJA 4M0AA 3H0LB 2HBKA 2QARB 4DQSA 1U47A 5KNIA 2PFQA 4IQWA 2GWSA 5J2IA 4KLLA 3S6JA 1ZD4A 4OO1J 1D8LA 4U6PA 1NK0A 4TUQA 1XC9A 2ZXIA 4NLCA 4NM1A 3RB3A 3OPXA 2YMQA 3PVXA 4J9MA 4ED8A 3UM9A 5KL1B 1XO0A 1HUOA 5AI8A 1ZRNA 3G6XA 4M6WA 4UQGA 4J9QA 2HBMA 4DWIA 2EANA 2MUTA 5ALTA 5CB1A 3TQ1A 1N60A 1NK8A 2FI1A 4EZ9A 1TAQA 2HHQA 3NUQA 4B6JA 1NJYA 4ED7A 4CE6A 4NJ8A 8ICKA 1ZQAA 4LVSA 7ICSA 1N5XA 3OJUA 3HX0A 1U49A 1URJA 3PMNA 3B0XA 3I76A 1T94A 4J9PA 4QW9A 3UQ2A 1NKBA 4ECZA 4XUSA 2J6TA 3KBBA 1X9WA 2YY6A 4DF8A 3AU6A 2BQ3A 4M04A 4DSIA 5ALHA 1BPZA 1UT8A 5J0OA 4Y2RA 4LJXA 3JPNA 7ICLA 5AK6A 2FDRA 1PZNA 2ZJ5A 3NRWA 4RQ7A 2WB1C 2KJ8A 2DGZA 4PL2A 4UARA 2ZTEA 4FO6A 2ALZA 3KHRA 4B9VA 1S0NA 5KAIU 3T3FA 1L3UA 3IHQB 4ED3A 5B5EU 2QB1A 5ALWA 4ED0A 3AMZA 5DQIA 1RQLA 9ICWA 4BXOB 4AP9A 4ECUA 5KFRA 2E8NA 1ZQQA 3SV4A 5EWFA 1XNSA 1QQ5A 2ZIWA 2XVTA 4FBTA 2ZUCA 7ICHA 3TFRA 3PR4A 3SD7A 3VCBA 5J8YC 1ZQBA 2LYHA 2DFLA 1ZQVA 2KK0A 3ALRA 1ZXIA 4B9TA 5EE3A 5IIKA 5J0PA 4QZ9A 2JHDA 2DKZA 2KHVA 1ZQEA 4J9NA 1DK3A 2WB1F 2H3IA 5ALGA 2K8AA 1BPYA 2ZIXB 2KEYA 1TAUA 4MEYA 2NRVA 4DFMA 2HDOA 1U45A 3LYSA 1T4GA 3WK5A 4RQNA 3SAGA 2YB4A 2F8KA 1Q46A 1J2NA 5DKWA 3N97B 2WF8A 1WCLA 2WF5A 9ICUA 3WK6A 2W03A 5AI5A 2HW3A 2HOIA 4I2HA 2OYYA 1ZJMA 5KFKA 3C2KA 2LM4A 4UB1A 3C29A 5J2KA 3BJYA 2EZZA 3C2MA 3M9MB 3D6JA 2PKEA 3GDXA 3SAFA 3R9KA 1HEKA 4B9UA 4DFJA 4MF8A 2CXYA 4FZLA 1PK3A 5AM0A 3L3FX 2Y0SC 1F0MA 2AGQA 5DB8A 3NRZA 4EEYA 4HAIA 4PJ0U 3DEEA 4YMMA 4YMOA 2W11A 4F5QA 7ICIA 3M9NB 3KTQA 3WK8A 3WK7A 1IM4A 2QB0B 2OHFA 3KKAA 3RB0A 4DFDA 5DBCA 8ICRA 5T14A 1RXVA 2C22A 2XY5A 4QZ8A 4RQ6A 1A0PA 4ICAA 2R8IA 4BXOA 2KIWA 2K4EA 1WYGA 2E1FA 3EPGA 2RDJA 1O08A 4DFKA 4KLGA 2J6UA 3PV8A 5HMMA 2NV3A 3MBYA 1JN3A 1D9FA 4RNMA 5JTIA 5ALLA 3EWAA 2WAQF 4Y2YA 5ALZA 2VJ5A 2ZJAA 1ZQJA 4JMUA 3ORYA 5JUMA 5ALSA 3JPTA 1B43A 1J97A 4RQ5A 3H8JA 1SGGA 1KN5A 1UQVA 2Q0ZX 4O5CA 4DO9A 5J0RA 1ZQUA 1C20A 3WKAA 4NXZA 1Z19A 4PGQA 4B9NA 4RQ0A 9ICSA 2HSZA 5AIAA 1RZTA 1Z00A 4EX6A 4Z6EA 4KLEA 4YCXA 1TK0A 2UVWA 9ICLA 1OXJA 4QIWF 7ICUA 3FM9A 2PMZC 3RJKA 2ESEA 8ICLA 3BS5B 2ZG6A 5J2GA 4U7CA 2MSNA 1L8OA 3RH6A 5AKYA 8ICPA 2ZJ8A 2PI5A 3MGIA 2BPCA 2JEFA 5AKKA 4UAYA 3M6ZA 5J2AA 1L7NA 3QX7A 1JALA 3ETRA 9ICNA 2MA1A 4DSKA 1O03A 2KZMA 3MR3A 5D4BA 3Q8KA 2HHXA 4DL6A 2BCVA 2WF6A 3LWMA 4ZOHC 3ED5A 1X9XA 5HHIA 4PHPA 3QU4A 2F1IA 4F5PA 2N1RA 2ATLA 5KFWA 2OH2A 2KTQA 4ECRA 8ICIA 1TAMA 4NV0A 4CF4A 1X9SA 1BNPA 2FMQA 5KFUA 2RRDA 4TUSA 3RJIA 1ZRMA 4C4SA 2KFNA 1NK6A 2F1JA 2V9WA 2E1EA 2HVIA 3M8RA 3ZDCA 4I2AA 9ICHA 2W43A 2PFOA 2BPFA 3DV9A 3T5JA 1RQNA 3WKBA 3PSTA 5AKZA 1XSLA 9ICKA 4KTQA 2M9NA 4DSJA 3A0HU 1ZQMA 2C2RA 1Z4NA 5ALUA 1VLBA 4R66A 2QKQA 4MFAA 3E58A 2W7OA 1DOQA 5L9XA 3QYPA 5DG9A 2I5HA 1ZQXA 2A1JA 2ZIVA 3IV6A 4PGYA 4RPYA 4NLKA 2BZFA 4KLOA 4KLQA 1A77A 1VJ5A 4QZBA 4NL9C 5KG2A 3KFUF 3H8MA 1BVSA 4JK1A 3QZ8A 2DL0A 1D9DA 1B0XA 3QU9A 4RQ1A 2FJ6A 4EEKA 4DLEA 4E0DA 4QWBA 5KFCA 3B9JA 2YN4A 1NK9A 1IXRA 1JUDA 2F2AB 1KFTA 3F5EA 4A8EA 3UPQA 4Z6FA 3C21A 3UXOA 2OCEA 3I1YA 5AICA 2I6XA 5J0QA 1IG6A 5KFDA 1ZQCA 2KVSA 5CA7A 5J2JA 2O6KA 1JROA 1ZQRA 2JRZA 4DL7A 1N61A 2EZXA 4AYBF 2EAOA 1ED1A 4P0PA 3SV3A 1UA1A 1JX4A 2DQNB 4KN4A 1JXLA 4NLZA 4XQ8A 4O3QA 4IC9A 5CRXA 3T5HA 4J9OA 2YMMA 4F93B 2YMPA 4KX5A 1PK1B 4F2RA 2HHTA 1SV0C 3FYHA 4QZDA 4EYHB 2KOBA 5ALQA 7ICRA 2IHNA 2MAXA 5KFHA 3OSPA 3QUCA 1K1SA 5AM4A 1SKWA 1LKYB 2W8KA 1A6SA 1S76D 9ICBA 9ICRA 1ZQKA 2E8MA 3PX4A 4Y2TA 9ICGA 2ZTDA 1FEZA 3RF9A 2UVUA 8ICWA 1RYUA 2BPGA 4HYKA 1ZQZA 3TACB 3K75D 2LYAA 2PI4A 5AK5A 4JUZA 4CNQA 4O3PA 1S9FA 4FZNA 1Q8KA 3WK4A 1QQ6A 1ZQGA 4P4MA 2XGQA 3QUTA 3RAXA 4IQVA 3RJFA 2HOFA 3PW0A 5DG8A 4FE3A 2JZBB 3CW2C 1Z1BA 4M2YA 1UPHA 2Q4TA 3PW5A 1ZD5A 2M0NA 1MN8A 3LVVA 5KFTA 8ICXA 3G6VA 3C2LA 1L7PA 2RLTA 4OJLA 3U26A 4YVZA 4RQ4A 3LVWA 5KFPA 1Z1VA 3TADC 2PXIA 3QXGA 2EDUA 2KSOA 4CGZA 5KFZA 1ZQWA 1PVPA 3D2SA 2HMXA 1X40A 3RFAA 2OXOA 2LBOA 5AKGA 3Q8RB 4Y2XA 4DS5A 1WWVA 1L3VA 2H3VA 2I9GA 4F5RA 2PFNA 3L4PA 3KD3A 3EYZA 1B22A 5BOLA 4F4YA 4QZHA 5AK3A 4NLNA 3Q8PB 2Y1JA 4UATA 4YR2A 3T79A 4YN4A 5ALOA 1ZQIA 2W9MA 4F71A 4YMNA 2B21A 3HRDD 2KP7A 8ICYA 4I2GA 4ECXA 2JXJA 2BCQA 4KLJA 2BHNA 4UBCA 3F53A 2W54A 2LYBA 3V7KA 2FE9A 3K1ZA 5D46A 4Q43A 3C28A 5EE1A 2K8CB 5AHXA 2ZIWB 1J2MA 4I2IA 5KG5A 2D6FC 4DSLA 4JWMA 1DGJA 1MQ3A 5J0TA 3AL0B 3TAPA 4US9A 2KHQA 2RP5A 4OJPA 4RPZA 3QE9Y 2H3QA 2EQYA 4KLSA 2KJ5A 3K1RB 9ICIA 3NS1A 2DF4B 4G9BA 4I2DA 3V72A 2D8CA 1SV4A 4ED1A 3N7RC 1XSPA 1SKSA 5ALMA 2G5IB 2W3SA 5H2FU 4M9HA 5G5HA 4C8MA 1XSNA 1COKA 4ZH4A 1ZYQA 4QZGA 4BX9C 1NJWA 4UB4A 4DS4A 4QZCA 2V4RA 1TK5A 3N28A 3RBEA 8ICHA 5AM1A 3O0FA 4KLHA 4O3MA 4PHAA 2LPEA 3IDWA 4JV0A 4DSEA 1N56A 1YZ6A 1XWLA 1N62A 4Z6DA 1RYRA 1OUQA 9ICPA 2VA2A 3GIKA 1SV0A 3BS7A 1GO3F 4M9LA 4R63A 4ED6A 4O0IA 3CP8A 3CYMA 3IRUA 3Q8MA 4ELUA 2ASLA 4QWDA 4C8LA 3QUBA 4J9LA 3H0MB 2MUTB 1NKCA 1ZQTA 1U4BA 1ZOLA 2KSOB 5ALDA 5HP4A 3NASA 2RQ5A 3T5LA 2MRLA 3LWLA 1NJXA 7ICQA 1TFRA 2IA6A 2ZTCA 1ZQHA 1IIPA 4DL2A 5HR6A 3RJGA 4EELA 5KTQA 4F91B 2XCPA 5L1LA 4EBDA 5TISU 5KFOA 4F4XA 2QARA 5AKLA 1QTMA 3QU5A 1KW4A 2IOFA 4P0QB 3UXPA 5DGBA 1MA7A 2E8OA 1KQQA 3EW9A 3NVVA 2UVVA 2A1JB 1TKDA 1H38A 1YT3A 3EZ5A 3OSNA 3AU2A 4RQ8A 4FS2A 3RR7A 2KVCA 5BOMA 3JPSA 5L1KA 2R18A 3IP4B 3ISBA 4I2FA 5L1MA 2KMDA 3BS5A 1Z4OA 1F5SA 4M9GA 4DF4A 2Y0SF 5KFGA 4UB8U 1HJPA 2W7PA 2ASDA 4I28A 1KLNA 2KNJA 3D2QA 1Z00B 3V7LA 1ZJNA 4P0QA 4O3SA 1MC8A 5D49A 4M9NA 2H3ZA 3TI0A 4I2CA 2W04A 1UCVA 7ICTA 5AIBA 5DDYA 3HKZC 4JV2A 2PFPA 2YQEA 2DUYA 3PX6A 4UB5A 3GIIA 4QWCA 3AM9A 2HCFA 1QCKA 4GIBA 1ZQFA 3GFKB 1X6JA 1NK5A 1KRPA 3RRHA 3TANA 3PZPA 4BJQA 4MFFA 3M9OB 3BDPA 3E2EA 3NGDA 5HHHA 4DQIA 4DQRA 2JR5A 4M6WB 3RRGA 4J03A 3FDSA 5KG6A 1EXNA 2KICA 7ICMA 1D8BA 4OD0A 8ICNA 2XICA 1LB2B 1L6NA 2HVHA 5J0XA 4YR3A 3MFHA 2FLNA 3JPPA 4I2EA 2KKPA 3ZI4A 1BNOA 8ICOA 4F5OA 3H7IA 1PK1A 1JXEA 4LZDA 4KN7A 3BQTA 4QW8A 1XS9D 3PMLA 3OGUA 3WKEA 1ZQOA 2JEGA 3GILA 1NI3A 4B9SA 3GZFA 1CI4A 5IINA 3PR5B 1X2IA 4KMUA 5DBBA 1FO4A 1RM6C 1ZQPA 1Z3EB 4UW9A 4FZMA 2E3TA 3ZDEA 3NTUA 3SMVA 3GV7B 4EENA 5KT3A 8ICVA 5KG7A 1X66A 2L5YA 1KEJA 1L3TA 1SB3C 3MFIA 3PSPA 3D2NA 2K4IA 4TURA 5KFIA 4BWJA 4Y2PA 3PW4A 3HILA 3RH5A 5KG1A 4DCCA 3CRXA 1AROP 1XU4A 5KT5A 4IR1A 4PZOA 1ZQNA 4YQWA 2QLTA 8ICEA 1S0VA 4MEXA 2F76X 1NZBA 3MR2A 1QQ7A 2UVRA 3PNCA 1SL0A 5IIMA 5L1JA 1ZD2P 3ZDDA 4IRKA 3HKZF 4FS1A 5DB9A 2P6RA 3K4GA 1ZETA 4KLMA 1HIWA 3V6HA 3IG5A 4DL5A 8ICAA 3ISCA 3B0YA 1X42A 1BPXA 1ZQ1C 1PVQA 5GTHU 1SIJA 5DLGA 1SWWA 3PW2A 3AUOA 1UHUA 3RR8A 3F2CA 2LKYA 4ECSA 1K1QA 2JH7A 3AQEA 4R65A 1LKYA 5DDMA 5DB6A 2IBKA 2F44A 4EBEA 5DB7A 5DG7A 1LV5A 2KE7A 4TQRA 2G5HB 2A1AA 4OJOA 2ZUDA 4YXJA 4GLXA 1SXEA 1RPLA 2W55A 5ALVA 9ICAA 2XCAA 2AGOA 3BQ2A 5EWEA 2FLLA 4ECTA 3MDCA 1RXWA 4IRCA 3C5FA 3RB6A 4IS7A 4USAA 1LVHA 4KMOB 4DL4A 9ICFA 2A19A 3QUQA 5AM3A 4OJ6A 4R64A 2C28A 4RUCA 3HW8A 2XO7A 1NNLA 2XIDA 2WHEA 3WKDA 1T3NA 4F72A 4MF2A 1A76A 4GXKA 4KLUA 1RYSA 5KG4A 4YD1A 5F9LA 5C0YA 4J9RA 5KT2A 4EBCA 3H8WA 5KAFU 2I1QA 3NVWA 3MGVA 1M6YA 4PH5A 2NRZA 1S5LU 2H3FA 3WK9A 3MR6A 1JIHA 3OHAA 5AKHA 2AQ0A 5CWRA 3GV8B 3PSIA 3M1YA 5ALNA 3RJJA 3JPRA 2W9CB 4EZ6A 2ZXHA 5BPCA 2A3VA 3OTQA 3UMBA 3BQ1A 1UA0A 2BCRA 2Z7JA 1QSLA 5C5JA 3LDAA 4BGDA 3H0RB 4QZAA 1XO1A 4YXMA 2C2EA 5IILA 1L7MA 4RU9A 4UB2A 4DEZA 2CN1A 4KLTA 2WF9A 2IOFK 5J29A 5IIIA 2IMWP 4QZIA 4TUPA 1KTQA 1QH9A 2JGAA 4DL3A 9ICQA 5KFJA 2KN7A 2AHOB 3QU2A 2DWQA 3WU2U 9ICEA 4CF3A 4F5NA 3C5GA 3Q8SB 2VANA 4F92B 1BPBA 5AKJA 4C0ZA 2R8JA 3HJEA 2EAMA 1CRXA 1L5UA 7ICOA 1F44A 2EH9A 2QB0A 4JB3A 4F2SA 2AXTU 4DOBA 2JV3A 1KSPA 1PVRA 1SKRA 5F3XB 3UQ0A 2JZBA 5J0WA 2LM1A 1WUDA 1Y88A 4KITB 4I2BA 4FBUA 3IM1A 2B0CA 3GIMA 1VDVA 4R8UB 3OHBA 1KDHA 3F5AA 3RBDA 3AEVA 9ICXA 1X6IA 1QLNA 3GU3A 4O5EA 4UAZA 4GFJA 4TQSA 1AQ6A 5AKEA 3GV5B 5ALJA 1DRGA 4O3OA 4RNNA 1S0MA 1IV8A 8ICUA 2MU2A 2KJ9A 2W9BA 2AGPA 4XRHA 4RT2A 4DLGA 2P6UA 2VA8A 4C8OA 5GTIU 2W9BB 3G6YA 1NZPA 2JMGA 2BDUA 2ZIUB 2V4QA 3L5KA 3AN1A 3V7JA 3TARA 1N63A 2ODGA 2ZIXA 3IG8A 4IQTA 5ALYA 4I2JA 3NVZA 2W8LA 5KT7A 5J0SA 3F2DA 3N7PD 2HHVA 1SL2A 1U48A 4O3RA 3BZKA 5KT4A 2NRTA 1DGSA 1KFSA 2NRWA 4J9KA 3A0BU 4QWAA 1S8OA 4Z6CA 4DFPA 4F50A 1KBUA 4RQMA 4BDPA 2BCUA 1V9PA 2ISOA 2ZIVB 1JI7A 3RAQA 2BR0A 5J2BA 3T5KA 4PHEA 4F8RA 5J8YA 3RB4A 3H4DA 5KFAA 3KHHA 1ZQSA 4EX7A 5ALFA 5EWGA 5KT6A 1CEZA 7ICJA 4IQUA 2KD1A 3MC1A 1ECWA
chains in the Genus database with same CATH topology
1UQVA 2B6GA 2QKQA 1B4FA 4RQNA 2EAPA 2Y9UA 3HILA 2KG5A 2F8KA 1V38A 4PZOA 1LKYB 2KSOB 2DKXA 1DXSA 4MHVA 2K60A 2YTUA 2E8MA 1OXJA 4NL9C 3H8MA 2ESEA 3BS5B 2DL0A 2FE9A 5JRTA 1B0XA 3SENA 2QARA 1PK3A 2K4PA 3TACB 1F0MA 1KW4A 1V85A 3K1RB 2E8OA 2QB1A 2D8CA 1SV4A 2E8NA 1X9XA 3BQ7A 2QARB 1LKYA 2F3NA 2QB0B 2F44A 1COKA 3KKAA 5KNIA 3SEIA 2ES6A 1OW5A 1PK1A 2KIVA 2KE7A 2EAOA 2LMRA 5L1MA 2Y9TA 2KMDA 2D3DA 3BS5A 5J8YC 3KKAC 1Z1VA 3TADC 1SXEA 2LPEA 3IDWA 2KSOA 4RQMA 2E8PA 1JI7A 1SV0A 2EANA 1PK1B 2EAMA 3BS7A 1X40A 2QB0A 1RG6A 1SV0C 4IS7A 2DKZA 1WWUA 2JV3A 5J8YA 1X66A 2GLEA 5JTIA 5F3XB 1SXDA 3TADA 2L5YA 1WWVA 4NL9A 1UCVA 5JU5A 4PZNA 4NJ8A 1SGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UQV A;  2B6G A;  2QKQ A;  1B4F A;  4RQN A;  2EAP A;  2Y9U A;  3HIL A;  2KG5 A;  2F8K A;  1V38 A;  4PZO A;  1LKY B;  2KSO B;  2DKX A;  1DXS A;  4MHV A;  2K60 A;  2YTU A;  2E8M A;  1OXJ A;  4NL9 C;  3H8M A;  2ESE A;  3BS5 B;  2DL0 A;  2FE9 A;  5JRT A;  1B0X A;  3SEN A;  2QAR A;  1PK3 A;  2K4P A;  3TAC B;  1F0M A;  1KW4 A;  1V85 A;  3K1R B;  2E8O A;  2QB1 A;  2D8C A;  1SV4 A;  2E8N A;  1X9X A;  3BQ7 A;  2QAR B;  1LKY A;  2F3N A;  2QB0 B;  2F44 A;  1COK A;  3KKA A;  5KNI A;  3SEI A;  2ES6 A;  1OW5 A;  1PK1 A;  2KIV A;  2KE7 A;  2EAO A;  2LMR A;  5L1M A;  2Y9T A;  2KMD A;  2D3D A;  3BS5 A;  5J8Y C;  3KKA C;  1Z1V A;  3TAD C;  1SXE A;  2LPE A;  3IDW A;  2KSO A;  4RQM A;  2E8P A;  1JI7 A;  1SV0 A;  2EAN A;  1PK1 B;  2EAM A;  3BS7 A;  1X40 A;  2QB0 A;  1RG6 A;  1SV0 C;  4IS7 A;  2DKZ A;  1WWU A;  2JV3 A;  5J8Y A;  1X66 A;  2GLE A;  5JTI A;  5F3X B;  1SXD A;  3TAD A;  2L5Y A;  1WWV A;  4NL9 A;  1UCV A;  5JU5 A;  4PZN A;  4NJ8 A;  1SGG A; 
#chains in the Genus database with same CATH topology
 4KLD A;  2B6G A;  4NLB A;  1SL1 A;  1N48 A;  3HPO A;  2XI9 A;  4YG2 A;  3THV A;  3TAQ A;  2FPM A;  5KFY A;  2YX8 A;  2R8H A;  1NKE A;  2G08 A;  2YML A;  4Y2U A;  1KL9 A;  2Y1I A;  4IR9 A;  4QNL A;  2K89 A;  2AU0 A;  2WF7 A;  4C80 A;  3C1Z A;  4C8K A;  4ECQ A;  3SYZ A;  2F8L A;  1KKX A;  4C8N A;  1NJZ A;  1T3Q A;  4UAV A;  2OM6 A;  2K4P A;  5A0L A;  5B66 U;  4NWI A;  3EUB 2;  1ZQD A;  3SQI A;  2AQ4 A;  2R8G A;  4UBB A;  4US8 A;  4QIW C;  4M47 A;  5DGA A;  2F3N A;  5ALI A;  2KKV A;  2K8B B;  3HT3 A;  5DQH A;  2KIV A;  4I29 A;  1MSW D;  2LMR A;  3EPI A;  2EZY A;  4GC7 A;  1UT5 A;  3QEB Z;  4YR0 A;  3KKA C;  4X5V A;  1WG8 A;  2W3R A;  2VIX A;  5ALP A;  4NLG A;  4WJ3 B;  4PHD A;  4LZG A;  1BGX T;  2F77 X;  2XY6 A;  3MR5 A;  3V6K A;  2CRX A;  1SZH A;  1WWU A;  2P35 A;  7ICF A;  3TAD A;  3Q8L A;  3RTV A;  3RH4 A;  4R8U A;  1COO A;  1YZ7 A;  2HBJ A;  1QSY A;  3E0F A;  1NK4 A;  2R8K A;  3KZI U;  3NVY A;  4O9M A;  1TVA A;  5HML A;  7ICV A;  3KHL A;  5FP0 A;  1ZD3 A;  5CR0 A;  1JRP A;  5K4L A;  3BZC A;  2C2D A;  2Y9U A;  2GO7 A;  4ECV A;  5ALR A;  5DQG A;  4P4O A;  1L3S A;  2G0A A;  3M7D A;  3RJH A;  2K4H A;  2K60 A;  2RHF A;  4PPX A;  2DPJ A;  1U9L A;  5ALK A;  7ICN A;  2BDP A;  5KFN A;  2NYV A;  9ICV A;  2HHW A;  2JH1 A;  4K4G A;  4RNO A;  2BKE A;  1FIQ A;  9ICJ A;  3SEN A;  5AI6 A;  2NRX A;  5J2H A;  5EE9 A;  3N4M B;  9ICO A;  4Y2Q A;  3RJE A;  3JPO A;  4F3O A;  3CNH A;  1BPD A;  4IL6 U;  1P7D A;  2YB1 A;  4KLI A;  1TE2 A;  4Y2J A;  4C7Z A;  3KHG A;  3HP6 A;  4GXJ A;  4RUA A;  9ICM A;  9ICT A;  4UAW A;  1JMS A;  4UAS A;  4QJF B;  4CF5 A;  8ICC A;  1BPE A;  4RQ2 A;  1L7O A;  2WAQ C;  3SR6 A;  4BUG A;  1NK7 A;  1D8Y A;  4O3N A;  2FMP A;  5AI0 A;  4C4R A;  5AKX A;  8ICT A;  4UB3 A;  5KFM A;  2E8P A;  5AI9 A;  2P66 A;  2BQR A;  5CP2 A;  4DQP A;  1Q3U A;  3JPQ A;  2PMZ F;  1SXD A;  5AM2 A;  2IHM A;  4OJ5 A;  5KG0 A;  4GXI A;  4NM2 A;  2HHS A;  2E5S A;  4B9L A;  1ZQY A;  3H4B A;  4RT3 A;  1B4F A;  4C7Y A;  1HUZ A;  2EAP A;  1FFV A;  3BQ0 A;  2J6S A;  4JWN A;  2KG5 A;  3H8S A;  4ED2 A;  2DKX A;  5J0U A;  2DBY A;  3UMC A;  5KFL A;  2OEH A;  5F9N A;  2BGW A;  4G3I A;  3OJS A;  4J9S A;  4RPX A;  4O5K A;  5IIO A;  3MGH A;  2H5X A;  1C7Y A;  4XA5 A;  4ELV A;  3UXN A;  5JRT A;  3KOO A;  4Y2V A;  2XY7 A;  5EOZ A;  1ZQL A;  2VA3 A;  1N2X A;  2GOL A;  2FPL A;  5DLF A;  5EE0 A;  4ACO A;  5G5G A;  1V85 A;  3ZD9 A;  1TV9 A;  3ZDA A;  2VJ4 A;  4UB6 U;  5HNK A;  4F4K A;  2KZ3 A;  3QZ7 A;  1T7P A;  3ZDB A;  3PO4 A;  3BQ7 A;  5IIJ A;  4Y2S A;  5J2E A;  2OWO A;  2LHT A;  8ICS A;  3M8S A;  3SAH A;  2HBL A;  3M6K A;  5AK4 A;  4Q8E A;  2CPR A;  2NO4 A;  3H40 A;  2G06 A;  9ICC A;  1L8L A;  4DOA A;  2D3D A;  4PGX A;  3I28 A;  4BWM A;  2AH5 A;  2ZUB A;  4I27 A;  3UMG A;  1Q3V A;  7ICG A;  4CDG A;  1NOM A;  3GQC A;  4K4I A;  2XGP A;  5AM5 A;  1S10 A;  1RG6 A;  3J81 j;  1S0O A;  2ISP A;  1WCN A;  5DBA A;  2HOQ A;  4NL9 A;  4ELT A;  5JU5 A;  5CHG A;  4PZN A;  2G09 A;  3DDH A;  5HR7 A;  4UAU A;  4KX3 A;  4DSF A;  1S77 D;  4YP3 A;  3F2B A;  1MQ2 A;  4YFK A;  2F1H A;  2HI0 A;  5KFV A;  4DOC A;  1DXS A;  4F4W A;  3FAH A;  1PUZ A;  3HWT A;  3MDA A;  3PY8 A;  4OCZ A;  5KFF A;  7ICP A;  4MFC A;  7ICE A;  1T8E A;  3ZD8 A;  3C1Y A;  5KFQ A;  2DPI A;  5J0Y A;  8ICM A;  4Q44 A;  2KFZ A;  3SI8 A;  3TFS A;  2W9C A;  2KZZ A;  4M9J A;  2W9A A;  4CCH A;  1N5W A;  4PL1 A;  7ICK A;  8ICG A;  4RQ3 A;  4NY8 A;  3QU7 A;  4EYI B;  1CUK A;  3TKA A;  5J2F A;  4AYB C;  8ICJ A;  5ALX A;  2FPK A;  3KZX A;  2ZIU A;  2WFA A;  3C23 A;  4YD2 A;  4F4Z A;  3V6J A;  4RZR A;  3PO5 A;  5TZV A;  2FLP A;  3QNM A;  3ISD A;  3IN5 A;  8ICZ A;  3AQF A;  4ECY A;  4Q8F A;  3SEI A;  2ES6 A;  1FFU A;  1OW5 A;  3ICX A;  3SZ2 A;  2WTF A;  5J2D A;  3PX0 A;  2Y9T A;  5KFX A;  8ICB A;  4P4P A;  4KLF A;  3N7S C;  1SWV A;  8ICQ A;  2LI6 A;  3Q8Q B;  1KFD A;  1X9M A;  5E79 U;  5J2C A;  4C4T A;  2GLE A;  4FFD A;  3VC8 A;  4DQQ A;  4P2H A;  5CJ7 A;  5AKI A;  5KFS A;  4QWE A;  5ALE A;  3FC4 A;  1RDF A;  4Q45 A;  3ETL A;  2G07 A;  1V97 A;  4IRD A;  5KL8 B;  2VKQ A;  2FMS A;  2KV2 A;  2HHU A;  1TK8 A;  3LK9 A;  1DK2 A;  5CEH A;  1K5O A;  2BCS A;  1V38 A;  2GH1 A;  4CRX A;  3MAB A;  2NO5 A;  3GIJ A;  5KFE A;  1SZP A;  4MHV A;  2JEI A;  2YTU A;  2AJQ A;  5AI4 A;  5L1I A;  1S97 A;  5KG3 A;  4P0P B;  1QSS A;  3PSF A;  2XC9 A;  5KFB A;  8ICF A;  4B9M A;  3WKC A;  2BQU A;  3QEA Z;  4QZF A;  4K4H A;  2IOH A;  4JV1 A;  4QZE A;  4GC6 A;  4ECW A;  2RDI A;  3PW7 A;  2ASJ A;  3ONN A;  2JEJ A;  4M0A A;  3H0L B;  2HBK A;  2QAR B;  4DQS A;  1U47 A;  5KNI A;  2PFQ A;  4IQW A;  2GWS A;  5J2I A;  4KLL A;  3S6J A;  1ZD4 A;  4OO1 J;  1D8L A;  4U6P A;  1NK0 A;  4TUQ A;  1XC9 A;  2ZXI A;  4NLC A;  4NM1 A;  3RB3 A;  3OPX A;  2YMQ A;  3PVX A;  4J9M A;  4ED8 A;  3UM9 A;  5KL1 B;  1XO0 A;  1HUO A;  5AI8 A;  1ZRN A;  3G6X A;  4M6W A;  4UQG A;  4J9Q A;  2HBM A;  4DWI A;  2EAN A;  2MUT A;  5ALT A;  5CB1 A;  3TQ1 A;  1N60 A;  1NK8 A;  2FI1 A;  4EZ9 A;  1TAQ A;  2HHQ A;  3NUQ A;  4B6J A;  1NJY A;  4ED7 A;  4CE6 A;  4NJ8 A;  8ICK A;  1ZQA A;  4LVS A;  7ICS A;  1N5X A;  3OJU A;  3HX0 A;  1U49 A;  1URJ A;  3PMN A;  3B0X A;  3I76 A;  1T94 A;  4J9P A;  4QW9 A;  3UQ2 A;  1NKB A;  4ECZ A;  4XUS A;  2J6T A;  3KBB A;  1X9W A;  2YY6 A;  4DF8 A;  3AU6 A;  2BQ3 A;  4M04 A;  4DSI A;  5ALH A;  1BPZ A;  1UT8 A;  5J0O A;  4Y2R A;  4LJX A;  3JPN A;  7ICL A;  5AK6 A;  2FDR A;  1PZN A;  2ZJ5 A;  3NRW A;  4RQ7 A;  2WB1 C;  2KJ8 A;  2DGZ A;  4PL2 A;  4UAR A;  2ZTE A;  4FO6 A;  2ALZ A;  3KHR A;  4B9V A;  1S0N A;  5KAI U;  3T3F A;  1L3U A;  3IHQ B;  4ED3 A;  5B5E U;  2QB1 A;  5ALW A;  4ED0 A;  3AMZ A;  5DQI A;  1RQL A;  9ICW A;  4BXO B;  4AP9 A;  4ECU A;  5KFR A;  2E8N A;  1ZQQ A;  3SV4 A;  5EWF A;  1XNS A;  1QQ5 A;  2ZIW A;  2XVT A;  4FBT A;  2ZUC A;  7ICH A;  3TFR A;  3PR4 A;  3SD7 A;  3VCB A;  5J8Y C;  1ZQB A;  2LYH A;  2DFL A;  1ZQV A;  2KK0 A;  3ALR A;  1ZXI A;  4B9T A;  5EE3 A;  5IIK A;  5J0P A;  4QZ9 A;  2JHD A;  2DKZ A;  2KHV A;  1ZQE A;  4J9N A;  1DK3 A;  2WB1 F;  2H3I A;  5ALG A;  2K8A A;  1BPY A;  2ZIX B;  2KEY A;  1TAU A;  4MEY A;  2NRV A;  4DFM A;  2HDO A;  1U45 A;  3LYS A;  1T4G A;  3WK5 A;  4RQN A;  3SAG A;  2YB4 A;  2F8K A;  1Q46 A;  1J2N A;  5DKW A;  3N97 B;  2WF8 A;  1WCL A;  2WF5 A;  9ICU A;  3WK6 A;  2W03 A;  5AI5 A;  2HW3 A;  2HOI A;  4I2H A;  2OYY A;  1ZJM A;  5KFK A;  3C2K A;  2LM4 A;  4UB1 A;  3C29 A;  5J2K A;  3BJY A;  2EZZ A;  3C2M A;  3M9M B;  3D6J A;  2PKE A;  3GDX A;  3SAF A;  3R9K A;  1HEK A;  4B9U A;  4DFJ A;  4MF8 A;  2CXY A;  4FZL A;  1PK3 A;  5AM0 A;  3L3F X;  2Y0S C;  1F0M A;  2AGQ A;  5DB8 A;  3NRZ A;  4EEY A;  4HAI A;  4PJ0 U;  3DEE A;  4YMM A;  4YMO A;  2W11 A;  4F5Q A;  7ICI A;  3M9N B;  3KTQ A;  3WK8 A;  3WK7 A;  1IM4 A;  2QB0 B;  2OHF A;  3KKA A;  3RB0 A;  4DFD A;  5DBC A;  8ICR A;  5T14 A;  1RXV A;  2C22 A;  2XY5 A;  4QZ8 A;  4RQ6 A;  1A0P A;  4ICA A;  2R8I A;  4BXO A;  2KIW A;  2K4E A;  1WYG A;  2E1F A;  3EPG A;  2RDJ A;  1O08 A;  4DFK A;  4KLG A;  2J6U A;  3PV8 A;  5HMM A;  2NV3 A;  3MBY A;  1JN3 A;  1D9F A;  4RNM A;  5JTI A;  5ALL A;  3EWA A;  2WAQ F;  4Y2Y A;  5ALZ A;  2VJ5 A;  2ZJA A;  1ZQJ A;  4JMU A;  3ORY A;  5JUM A;  5ALS A;  3JPT A;  1B43 A;  1J97 A;  4RQ5 A;  3H8J A;  1SGG A;  1KN5 A;  1UQV A;  2Q0Z X;  4O5C A;  4DO9 A;  5J0R A;  1ZQU A;  1C20 A;  3WKA A;  4NXZ A;  1Z19 A;  4PGQ A;  4B9N A;  4RQ0 A;  9ICS A;  2HSZ A;  5AIA A;  1RZT A;  1Z00 A;  4EX6 A;  4Z6E A;  4KLE A;  4YCX A;  1TK0 A;  2UVW A;  9ICL A;  1OXJ A;  4QIW F;  7ICU A;  3FM9 A;  2PMZ C;  3RJK A;  2ESE A;  8ICL A;  3BS5 B;  2ZG6 A;  5J2G A;  4U7C A;  2MSN A;  1L8O A;  3RH6 A;  5AKY A;  8ICP A;  2ZJ8 A;  2PI5 A;  3MGI A;  2BPC A;  2JEF A;  5AKK A;  4UAY A;  3M6Z A;  5J2A A;  1L7N A;  3QX7 A;  1JAL A;  3ETR A;  9ICN A;  2MA1 A;  4DSK A;  1O03 A;  2KZM A;  3MR3 A;  5D4B A;  3Q8K A;  2HHX A;  4DL6 A;  2BCV A;  2WF6 A;  3LWM A;  4ZOH C;  3ED5 A;  1X9X A;  5HHI A;  4PHP A;  3QU4 A;  2F1I A;  4F5P A;  2N1R A;  2ATL A;  5KFW A;  2OH2 A;  2KTQ A;  4ECR A;  8ICI A;  1TAM A;  4NV0 A;  4CF4 A;  1X9S A;  1BNP A;  2FMQ A;  5KFU A;  2RRD A;  4TUS A;  3RJI A;  1ZRM A;  4C4S A;  2KFN A;  1NK6 A;  2F1J A;  2V9W A;  2E1E A;  2HVI A;  3M8R A;  3ZDC A;  4I2A A;  9ICH A;  2W43 A;  2PFO A;  2BPF A;  3DV9 A;  3T5J A;  1RQN A;  3WKB A;  3PST A;  5AKZ A;  1XSL A;  9ICK A;  4KTQ A;  2M9N A;  4DSJ A;  3A0H U;  1ZQM A;  2C2R A;  1Z4N A;  5ALU A;  1VLB A;  4R66 A;  2QKQ A;  4MFA A;  3E58 A;  2W7O A;  1DOQ A;  5L9X A;  3QYP A;  5DG9 A;  2I5H A;  1ZQX A;  2A1J A;  2ZIV A;  3IV6 A;  4PGY A;  4RPY A;  4NLK A;  2BZF A;  4KLO A;  4KLQ A;  1A77 A;  1VJ5 A;  4QZB A;  4NL9 C;  5KG2 A;  3KFU F;  3H8M A;  1BVS A;  4JK1 A;  3QZ8 A;  2DL0 A;  1D9D A;  1B0X A;  3QU9 A;  4RQ1 A;  2FJ6 A;  4EEK A;  4DLE A;  4E0D A;  4QWB A;  5KFC A;  3B9J A;  2YN4 A;  1NK9 A;  1IXR A;  1JUD A;  2F2A B;  1KFT A;  3F5E A;  4A8E A;  3UPQ A;  4Z6F A;  3C21 A;  3UXO A;  2OCE A;  3I1Y A;  5AIC A;  2I6X A;  5J0Q A;  1IG6 A;  5KFD A;  1ZQC A;  2KVS A;  5CA7 A;  5J2J A;  2O6K A;  1JRO A;  1ZQR A;  2JRZ A;  4DL7 A;  1N61 A;  2EZX A;  4AYB F;  2EAO A;  1ED1 A;  4P0P A;  3SV3 A;  1UA1 A;  1JX4 A;  2DQN B;  4KN4 A;  1JXL A;  4NLZ A;  4XQ8 A;  4O3Q A;  4IC9 A;  5CRX A;  3T5H A;  4J9O A;  2YMM A;  4F93 B;  2YMP A;  4KX5 A;  1PK1 B;  4F2R A;  2HHT A;  1SV0 C;  3FYH A;  4QZD A;  4EYH B;  2KOB A;  5ALQ A;  7ICR A;  2IHN A;  2MAX A;  5KFH A;  3OSP A;  3QUC A;  1K1S A;  5AM4 A;  1SKW A;  1LKY B;  2W8K A;  1A6S A;  1S76 D;  9ICB A;  9ICR A;  1ZQK A;  2E8M A;  3PX4 A;  4Y2T A;  9ICG A;  2ZTD A;  1FEZ A;  3RF9 A;  2UVU A;  8ICW A;  1RYU A;  2BPG A;  4HYK A;  1ZQZ A;  3TAC B;  3K75 D;  2LYA A;  2PI4 A;  5AK5 A;  4JUZ A;  4CNQ A;  4O3P A;  1S9F A;  4FZN A;  1Q8K A;  3WK4 A;  1QQ6 A;  1ZQG A;  4P4M A;  2XGQ A;  3QUT A;  3RAX A;  4IQV A;  3RJF A;  2HOF A;  3PW0 A;  5DG8 A;  4FE3 A;  2JZB B;  3CW2 C;  1Z1B A;  4M2Y A;  1UPH A;  2Q4T A;  3PW5 A;  1ZD5 A;  2M0N A;  1MN8 A;  3LVV A;  5KFT A;  8ICX A;  3G6V A;  3C2L A;  1L7P A;  2RLT A;  4OJL A;  3U26 A;  4YVZ A;  4RQ4 A;  3LVW A;  5KFP A;  1Z1V A;  3TAD C;  2PXI A;  3QXG A;  2EDU A;  2KSO A;  4CGZ A;  5KFZ A;  1ZQW A;  1PVP A;  3D2S A;  2HMX A;  1X40 A;  3RFA A;  2OXO A;  2LBO A;  5AKG A;  3Q8R B;  4Y2X A;  4DS5 A;  1WWV A;  1L3V A;  2H3V A;  2I9G A;  4F5R A;  2PFN A;  3L4P A;  3KD3 A;  3EYZ A;  1B22 A;  5BOL A;  4F4Y A;  4QZH A;  5AK3 A;  4NLN A;  3Q8P B;  2Y1J A;  4UAT A;  4YR2 A;  3T79 A;  4YN4 A;  5ALO A;  1ZQI A;  2W9M A;  4F71 A;  4YMN A;  2B21 A;  3HRD D;  2KP7 A;  8ICY A;  4I2G A;  4ECX A;  2JXJ A;  2BCQ A;  4KLJ A;  2BHN A;  4UBC A;  3F53 A;  2W54 A;  2LYB A;  3V7K A;  2FE9 A;  3K1Z A;  5D46 A;  4Q43 A;  3C28 A;  5EE1 A;  2K8C B;  5AHX A;  2ZIW B;  1J2M A;  4I2I A;  5KG5 A;  2D6F C;  4DSL A;  4JWM A;  1DGJ A;  1MQ3 A;  5J0T A;  3AL0 B;  3TAP A;  4US9 A;  2KHQ A;  2RP5 A;  4OJP A;  4RPZ A;  3QE9 Y;  2H3Q A;  2EQY A;  4KLS A;  2KJ5 A;  3K1R B;  9ICI A;  3NS1 A;  2DF4 B;  4G9B A;  4I2D A;  3V72 A;  2D8C A;  1SV4 A;  4ED1 A;  3N7R C;  1XSP A;  1SKS A;  5ALM A;  2G5I B;  2W3S A;  5H2F U;  4M9H A;  5G5H A;  4C8M A;  1XSN A;  1COK A;  4ZH4 A;  1ZYQ A;  4QZG A;  4BX9 C;  1NJW A;  4UB4 A;  4DS4 A;  4QZC A;  2V4R A;  1TK5 A;  3N28 A;  3RBE A;  8ICH A;  5AM1 A;  3O0F A;  4KLH A;  4O3M A;  4PHA A;  2LPE A;  3IDW A;  4JV0 A;  4DSE A;  1N56 A;  1YZ6 A;  1XWL A;  1N62 A;  4Z6D A;  1RYR A;  1OUQ A;  9ICP A;  2VA2 A;  3GIK A;  1SV0 A;  3BS7 A;  1GO3 F;  4M9L A;  4R63 A;  4ED6 A;  4O0I A;  3CP8 A;  3CYM A;  3IRU A;  3Q8M A;  4ELU A;  2ASL A;  4QWD A;  4C8L A;  3QUB A;  4J9L A;  3H0M B;  2MUT B;  1NKC A;  1ZQT A;  1U4B A;  1ZOL A;  2KSO B;  5ALD A;  5HP4 A;  3NAS A;  2RQ5 A;  3T5L A;  2MRL A;  3LWL A;  1NJX A;  7ICQ A;  1TFR A;  2IA6 A;  2ZTC A;  1ZQH A;  1IIP A;  4DL2 A;  5HR6 A;  3RJG A;  4EEL A;  5KTQ A;  4F91 B;  2XCP A;  5L1L A;  4EBD A;  5TIS U;  5KFO A;  4F4X A;  2QAR A;  5AKL A;  1QTM A;  3QU5 A;  1KW4 A;  2IOF A;  4P0Q B;  3UXP A;  5DGB A;  1MA7 A;  2E8O A;  1KQQ A;  3EW9 A;  3NVV A;  2UVV A;  2A1J B;  1TKD A;  1H38 A;  1YT3 A;  3EZ5 A;  3OSN A;  3AU2 A;  4RQ8 A;  4FS2 A;  3RR7 A;  2KVC A;  5BOM A;  3JPS A;  5L1K A;  2R18 A;  3IP4 B;  3ISB A;  4I2F A;  5L1M A;  2KMD A;  3BS5 A;  1Z4O A;  1F5S A;  4M9G A;  4DF4 A;  2Y0S F;  5KFG A;  4UB8 U;  1HJP A;  2W7P A;  2ASD A;  4I28 A;  1KLN A;  2KNJ A;  3D2Q A;  1Z00 B;  3V7L A;  1ZJN A;  4P0Q A;  4O3S A;  1MC8 A;  5D49 A;  4M9N A;  2H3Z A;  3TI0 A;  4I2C A;  2W04 A;  1UCV A;  7ICT A;  5AIB A;  5DDY A;  3HKZ C;  4JV2 A;  2PFP A;  2YQE A;  2DUY A;  3PX6 A;  4UB5 A;  3GII A;  4QWC A;  3AM9 A;  2HCF A;  1QCK A;  4GIB A;  1ZQF A;  3GFK B;  1X6J A;  1NK5 A;  1KRP A;  3RRH A;  3TAN A;  3PZP A;  4BJQ A;  4MFF A;  3M9O B;  3BDP A;  3E2E A;  3NGD A;  5HHH A;  4DQI A;  4DQR A;  2JR5 A;  4M6W B;  3RRG A;  4J03 A;  3FDS A;  5KG6 A;  1EXN A;  2KIC A;  7ICM A;  1D8B A;  4OD0 A;  8ICN A;  2XIC A;  1LB2 B;  1L6N A;  2HVH A;  5J0X A;  4YR3 A;  3MFH A;  2FLN A;  3JPP A;  4I2E A;  2KKP A;  3ZI4 A;  1BNO A;  8ICO A;  4F5O A;  3H7I A;  1PK1 A;  1JXE A;  4LZD A;  4KN7 A;  3BQT A;  4QW8 A;  1XS9 D;  3PML A;  3OGU A;  3WKE A;  1ZQO A;  2JEG A;  3GIL A;  1NI3 A;  4B9S A;  3GZF A;  1CI4 A;  5IIN A;  3PR5 B;  1X2I A;  4KMU A;  5DBB A;  1FO4 A;  1RM6 C;  1ZQP A;  1Z3E B;  4UW9 A;  4FZM A;  2E3T A;  3ZDE A;  3NTU A;  3SMV A;  3GV7 B;  4EEN A;  5KT3 A;  8ICV A;  5KG7 A;  1X66 A;  2L5Y A;  1KEJ A;  1L3T A;  1SB3 C;  3MFI A;  3PSP A;  3D2N A;  2K4I A;  4TUR A;  5KFI A;  4BWJ A;  4Y2P A;  3PW4 A;  3HIL A;  3RH5 A;  5KG1 A;  4DCC A;  3CRX A;  1ARO P;  1XU4 A;  5KT5 A;  4IR1 A;  4PZO A;  1ZQN A;  4YQW A;  2QLT A;  8ICE A;  1S0V A;  4MEX A;  2F76 X;  1NZB A;  3MR2 A;  1QQ7 A;  2UVR A;  3PNC A;  1SL0 A;  5IIM A;  5L1J A;  1ZD2 P;  3ZDD A;  4IRK A;  3HKZ F;  4FS1 A;  5DB9 A;  2P6R A;  3K4G A;  1ZET A;  4KLM A;  1HIW A;  3V6H A;  3IG5 A;  4DL5 A;  8ICA A;  3ISC A;  3B0Y A;  1X42 A;  1BPX A;  1ZQ1 C;  1PVQ A;  5GTH U;  1SIJ A;  5DLG A;  1SWW A;  3PW2 A;  3AUO A;  1UHU A;  3RR8 A;  3F2C A;  2LKY A;  4ECS A;  1K1Q A;  2JH7 A;  3AQE A;  4R65 A;  1LKY A;  5DDM A;  5DB6 A;  2IBK A;  2F44 A;  4EBE A;  5DB7 A;  5DG7 A;  1LV5 A;  2KE7 A;  4TQR A;  2G5H B;  2A1A A;  4OJO A;  2ZUD A;  4YXJ A;  4GLX A;  1SXE A;  1RPL A;  2W55 A;  5ALV A;  9ICA A;  2XCA A;  2AGO A;  3BQ2 A;  5EWE A;  2FLL A;  4ECT A;  3MDC A;  1RXW A;  4IRC A;  3C5F A;  3RB6 A;  4IS7 A;  4USA A;  1LVH A;  4KMO B;  4DL4 A;  9ICF A;  2A19 A;  3QUQ A;  5AM3 A;  4OJ6 A;  4R64 A;  2C28 A;  4RUC A;  3HW8 A;  2XO7 A;  1NNL A;  2XID A;  2WHE A;  3WKD A;  1T3N A;  4F72 A;  4MF2 A;  1A76 A;  4GXK A;  4KLU A;  1RYS A;  5KG4 A;  4YD1 A;  5F9L A;  5C0Y A;  4J9R A;  5KT2 A;  4EBC A;  3H8W A;  5KAF U;  2I1Q A;  3NVW A;  3MGV A;  1M6Y A;  4PH5 A;  2NRZ A;  1S5L U;  2H3F A;  3WK9 A;  3MR6 A;  1JIH A;  3OHA A;  5AKH A;  2AQ0 A;  5CWR A;  3GV8 B;  3PSI A;  3M1Y A;  5ALN A;  3RJJ A;  3JPR A;  2W9C B;  4EZ6 A;  2ZXH A;  5BPC A;  2A3V A;  3OTQ A;  3UMB A;  3BQ1 A;  1UA0 A;  2BCR A;  2Z7J A;  1QSL A;  5C5J A;  3LDA A;  4BGD A;  3H0R B;  4QZA A;  1XO1 A;  4YXM A;  2C2E A;  5IIL A;  1L7M A;  4RU9 A;  4UB2 A;  4DEZ A;  2CN1 A;  4KLT A;  2WF9 A;  2IOF K;  5J29 A;  5III A;  2IMW P;  4QZI A;  4TUP A;  1KTQ A;  1QH9 A;  2JGA A;  4DL3 A;  9ICQ A;  5KFJ A;  2KN7 A;  2AHO B;  3QU2 A;  2DWQ A;  3WU2 U;  9ICE A;  4CF3 A;  4F5N A;  3C5G A;  3Q8S B;  2VAN A;  4F92 B;  1BPB A;  5AKJ A;  4C0Z A;  2R8J A;  3HJE A;  2EAM A;  1CRX A;  1L5U A;  7ICO A;  1F44 A;  2EH9 A;  2QB0 A;  4JB3 A;  4F2S A;  2AXT U;  4DOB A;  2JV3 A;  1KSP A;  1PVR A;  1SKR A;  5F3X B;  3UQ0 A;  2JZB A;  5J0W A;  2LM1 A;  1WUD A;  1Y88 A;  4KIT B;  4I2B A;  4FBU A;  3IM1 A;  2B0C A;  3GIM A;  1VDV A;  4R8U B;  3OHB A;  1KDH A;  3F5A A;  3RBD A;  3AEV A;  9ICX A;  1X6I A;  1QLN A;  3GU3 A;  4O5E A;  4UAZ A;  4GFJ A;  4TQS A;  1AQ6 A;  5AKE A;  3GV5 B;  5ALJ A;  1DRG A;  4O3O A;  4RNN A;  1S0M A;  1IV8 A;  8ICU A;  2MU2 A;  2KJ9 A;  2W9B A;  2AGP A;  4XRH A;  4RT2 A;  4DLG A;  2P6U A;  2VA8 A;  4C8O A;  5GTI U;  2W9B B;  3G6Y A;  1NZP A;  2JMG A;  2BDU A;  2ZIU B;  2V4Q A;  3L5K A;  3AN1 A;  3V7J A;  3TAR A;  1N63 A;  2ODG A;  2ZIX A;  3IG8 A;  4IQT A;  5ALY A;  4I2J A;  3NVZ A;  2W8L A;  5KT7 A;  5J0S A;  3F2D A;  3N7P D;  2HHV A;  1SL2 A;  1U48 A;  4O3R A;  3BZK A;  5KT4 A;  2NRT A;  1DGS A;  1KFS A;  2NRW A;  4J9K A;  3A0B U;  4QWA A;  1S8O A;  4Z6C A;  4DFP A;  4F50 A;  1KBU A;  4RQM A;  4BDP A;  2BCU A;  1V9P A;  2ISO A;  2ZIV B;  1JI7 A;  3RAQ A;  2BR0 A;  5J2B A;  3T5K A;  4PHE A;  4F8R A;  5J8Y A;  3RB4 A;  3H4D A;  5KFA A;  3KHH A;  1ZQS A;  4EX7 A;  5ALF A;  5EWG A;  5KT6 A;  1CEZ A;  7ICJ A;  4IQU A;  2KD1 A;  3MC1 A;  1ECW A; 
#chains in the Genus database with same CATH homology
 1UQV A;  2B6G A;  2QKQ A;  1B4F A;  4RQN A;  2EAP A;  2Y9U A;  3HIL A;  2KG5 A;  2F8K A;  1V38 A;  4PZO A;  1LKY B;  2KSO B;  2DKX A;  1DXS A;  4MHV A;  2K60 A;  2YTU A;  2E8M A;  1OXJ A;  4NL9 C;  3H8M A;  2ESE A;  3BS5 B;  2DL0 A;  2FE9 A;  5JRT A;  1B0X A;  3SEN A;  2QAR A;  1PK3 A;  2K4P A;  3TAC B;  1F0M A;  1KW4 A;  1V85 A;  3K1R B;  2E8O A;  2QB1 A;  2D8C A;  1SV4 A;  2E8N A;  1X9X A;  3BQ7 A;  2QAR B;  1LKY A;  2F3N A;  2QB0 B;  2F44 A;  1COK A;  3KKA A;  5KNI A;  3SEI A;  2ES6 A;  1OW5 A;  1PK1 A;  2KIV A;  2KE7 A;  2EAO A;  2LMR A;  5L1M A;  2Y9T A;  2KMD A;  2D3D A;  3BS5 A;  5J8Y C;  3KKA C;  1Z1V A;  3TAD C;  1SXE A;  2LPE A;  3IDW A;  2KSO A;  4RQM A;  2E8P A;  1JI7 A;  1SV0 A;  2EAN A;  1PK1 B;  2EAM A;  3BS7 A;  1X40 A;  2QB0 A;  1RG6 A;  1SV0 C;  4IS7 A;  2DKZ A;  1WWU A;  2JV3 A;  5J8Y A;  1X66 A;  2GLE A;  5JTI A;  5F3X B;  1SXD A;  3TAD A;  2L5Y A;  1WWV A;  4NL9 A;  1UCV A;  5JU5 A;  4PZN A;  4NJ8 A;  1SGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...