4RQMA

Crystal structure of the semet bicc1 sam domain r924e mutant
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
KGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKMLLAISELNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of the SAM Domain of BICC1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Protein bicaudal C homolog 1
total genus 19
structure length 63
sequence length 63
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4rqmA01
1RG6A 2K60A 2KSOA 2Y9TA 2QB0A 1SV0A 1B0XA 2QB0B 2KSOB 2EAMA 4RQMA 2GLEA 3H8MA 1SGGA 1OW5A 5JRTA 2QKQA 1PK3A 1WWUA 2EAOA 2K4PA 2LPEA 1V85A 5J8YA 4NJ8A 5F3XB 1OXJA 1SV4A 2F8KA 2E8OA 2Y9UA 2D8CA 2EAPA 3TADA 2KG5A 2KE7A 2F3NA 1X9XA 1F0MA 2JV3A 2DL0A 3BS7A 1JI7A 1UQVA 2B6GA 3SENA 2QARB 5JU5A 1V38A 3IDWA 4MHVA 3BS5B 1LKYA 1KW4A 1PK1B 2QB1A 2DKZA 4NL9C 1PK1A 5JTIA 3TADC 3BS5A 4PZNA 2E8PA 5L1MA 1UCVA 1COKA 2L5YA 4IS7A 3BQ7A 2E8MA 1SXDA 5J8YC 4PZOA 1DXSA 2YTUA 1LKYB 2EANA 3K1RB 4NL9A 3SEIA 1B4FA 2ES6A 5KNIA 2QARA 1SV0C 2E8NA 4RQNA 1Z1VA 2F44A 2KMDA 2DKXA 2ESEA 2KIVA 2FE9A 1SXEA 3KKAC 2D3DA 3KKAA 2LMRA 1X66A 1X40A 1WWVA 3TACB 3HILA
chains in the Genus database with same CATH superfamily
1S9FA 2Y9TA 4YMNA 2OHFA 3C1ZA 2BDUA 4DFPA 2ASDA 3PW5A 4KMOB 5TZVA 4DSLA 3N7PD 4M9GA 1WWUA 4O9MA 4FO6A 5ALUA 3SV3A 1BNOA 4Q44A 3GIMA 5KT2A 3T5KA 2I6XA 4UB1A 3IG5A 1S97A 4PL1A 3LVWA 3JPRA 1TK5A 2H3ZA 2KHVA 3BQ0A 1YZ6A 4YMMA 3RRHA 2R8IA 4R63A 2G09A 1XSPA 1PVRA 4RPYA 4M0AA 4KX3A 1KSPA 3RJFA 5AKGA 4NL9C 3PO5A 3M9OB 1PK1A 3UMCA 5KG2A 4O3SA 3KOOA 5KFVA 1L8LA 4J9SA 1PVQA 4IR1A 8ICKA 1ZQDA 2KJ8A 3WK9A 5KFYA 1IXRA 2JR5A 2RLTA 4NY8A 3T3FA 3IG8A 5L1JA 3IV6A 5J0UA 3V72A 2IHNA 5KFPA 1LKYB 4IL6U 4MFCA 1D9FA 2BQRA 4ICAA 3PNCA 4IC9A 4DL7A 5ALDA 2KMDA 3LYSA 2MUTA 2F1JA 5ALWA 4YVZA 2EDUA 2XY6A 5BPCA 3WKCA 1X40A 2NRVA 2BR0A 2VJ4A 5EWFA 2XGQA 3KHGA 2LYAA 3H0MB 1S77D 4I2EA 1NOMA 2RHFA 4UAVA 2OH2A 4QZHA 4BJQA 2RRDA 2EAMA 1T3NA 1Q8KA 4KITB 3B0YA 2AQ4A 4US9A 1PK3A 4JUZA 7ICGA 3MDCA 2K4IA 5DB6A 1D9DA 4U7CA 4KLDA 2KD1A 3RB6A 1D8YA 2H3FA 1RQNA 5J0OA 4F5QA 2KHQA 5KFQA 4C8NA 5J2BA 1SL2A 2ZTEA 3SAHA 1BPEA 2LBOA 2E1FA 3OHAA 2V9WA 5F9LA 5CA7A 1KDHA 4F5RA 3V7JA 3VCBA 1N2XA 4ELVA 3QXGA 4IRKA 2AJQA 1NJXA 3BJYA 4ELUA 1P7DA 5KFLA 2W9CA 1KFSA 1UHUA 4IS7A 3AQFA 3PR4A 5KFKA 2W9BA 3F2CA 1C7YA 2ZUDA 2A1JA 5KT7A 1HEKA 3SEIA 1QSLA 3MGHA 3F5EA 2E8NA 4M47A 5EOZA 5GTHU 5DB8A 5HNKA 5KFAA 3QU7A 5KFNA 5J0WA 3MFHA 3HILA 1FO4A 3DDHA 4RQ8A 1N62A 1WG8A 3RTVA 4Q43A 2F76X 1FEZA 5F9NA 3BZCA 4CNQA 4QZCA 4PHEA 2ZJ5A 3NTUA 3OGUA 3PW4A 4Y2JA 1ZQJA 1OW5A 3WK4A 3UQ2A 3GV7B 1MA7A 4TUQA 2ZIUB 4OJ6A 2F8LA 8ICRA 4DFDA 5IIIA 3RJIA 5HR6A 4F91B 4P0PA 3H0RB 1NKCA 4FE3A 1NKEA 5DB9A 2YMQA 4ACOA 3UXPA 3TADA 2KG5A 1NI3A 1MQ3A 3FYHA 1WCNA 2KP7A 3AN1A 3JPNA 2WAQC 5DQIA 4QWEA 4FBUA 1KQQA 2ATLA 2I1QA 8ICQA 4RPZA 5KAFU 4BWMA 7ICKA 2HHUA 1DK3A 3PSFA 3Q8QB 4HAIA 3EUB2 1LB2B 3KZIU 5KFXA 2WF5A 3HRDD 4O3MA 1UT8A 4QJFB 4ECTA 4M6WA 3F5AA 2KZ3A 1N63A 1SWVA 3BQ2A 5AK3A 1LV5A 4KLQA 2WHEA 2ZIXB 1HJPA 4DFKA 5J0PA 1RQLA 4UATA 5KL1B 2BCUA 9ICQA 3SR6A 2VIXA 5AI0A 4O3QA 4NL9A 1B4FA 3Q8RB 1T3QA 1XU4A 5HHIA 4F4YA 1ZQAA 2ZTCA 2Y0SF 5ALEA 2DKXA 2LKYA 4UAYA 2HVIA 4PHAA 2P66A 2D3DA 1ZQCA 5AICA 1M6YA 4Z6FA 3QZ8A 2K60A 2JHDA 3ZDAA 1SV0A 4C80A 2QB0B 4UARA 1XSNA 2V4RA 2BGWA 5J0TA 4EYIB 3OPXA 3WKAA 1BPBA 1PVPA 1N5WA 2OWOA 1JX4A 3H4DA 3L4PA 4DQQA 5KFBA 4BX9C 4F4KA 5KFFA 1RZTA 2HHSA 1X42A 5J0SA 2EH9A 2CXYA 5CHGA 4Q8EA 2KE7A 1VJ5A 4J9LA 2DL0A 3G6VA 2PFPA 3KBBA 2NV3A 5AM0A 3ISCA 3QYPA 5ALPA 5JUMA 3ICXA 2JGAA 4CE6A 1B22A 8ICUA 4RNNA 1NK8A 5KTQA 4RQ3A 2Y1IA 1T94A 2DKZA 4J9OA 2ISOA 2NYVA 3MGIA 5KFSA 1ZD3A 5ALGA 1C20A 4YN4A 3EPGA 2W11A 1BNPA 1L6NA 3GIKA 2KZZA 3PVXA 1JROA 1MC8A 4M6WB 1ZQPA 5AKEA 4KX5A 1BVSA 7ICFA 3N28A 2BCQA 2GWSA 4NLZA 3C29A 3RBDA 1A6SA 2OM6A 3RH4A 2HSZA 1QSYA 3D6JA 9ICRA 2PXIA 1TK0A 1SV0C 5J2FA 2XI9A 4I2IA 5DG9A 1PUZA 4RT3A 4MF2A 3TACB 3KHHA 1COOA 3H0LB 7ICJA 1RG6A 5KFUA 2I9GA 1QSSA 4B9UA 4G9BA 1TAUA 4USAA 3H8MA 2W9MA 2PI4A 5IINA 4O5EA 4ELTA 2W3RA 3SD7A 4I2GA 3PW0A 4RUAA 1V85A 4HYKA 5J2JA 4QW9A 4UAZA 2H3IA 2NRTA 3NS1A 3TARA 7ICQA 4RQ5A 2Y9UA 4C8MA 2BPFA 2FMQA 2ZIXA 5DB7A 2FLLA 2PFOA 3ZDBA 3NRZA 3BS7A 5DG7A 4KLHA 2UVRA 3ISDA 1HUZA 4PGYA 2PMZC 1JIHA 3V6HA 1BGXT 1JUDA 4Y2VA 3BQ1A 5AM1A 5AKYA 2XCPA 3HW8A 4PL2A 4YXMA 3NVYA 5EWGA 8ICLA 2W8LA 5ALLA 5IILA 1JRPA 4NM1A 2JZBA 5J2CA 1U48A 1S0VA 1WYGA 1X9SA 2AXTU 2FLNA 4QWAA 4KMUA 4GC6A 4KLFA 1QTMA 2HBMA 2LYBA 3MDAA 4YP3A 9ICLA 4PGXA 2YQEA 4KLEA 5KT6A 3QZ7A 5HP4A 2W7PA 7ICPA 4O3RA 3GILA 3M6ZA 4UB5A 4LZDA 1A76A 4TUPA 2HOFA 5AM4A 4ED2A 5CB1A 3A0HU 1L7NA 5DQGA 4K4GA 8ICAA 3GQCA 3RH6A 3QUCA 5G5HA 2E3TA 1U45A 1Z3EB 4UB6U 3RJKA 4OCZA 5KG1A 4ED7A 2QKQA 2OYYA 1SL1A 2EAOA 2BCVA 4MFFA 2DFLA 3GIIA 3OSNA 3GZFA 9ICTA 3AU6A 2A1JB 5KFJA 4YMOA 4MFAA 2FJ6A 4Y2QA 7ICUA 1MSWD 1A0PA 1SKRA 9ICBA 1L3TA 1ZQHA 2NO5A 4O0IA 4YR3A 1DGSA 2P6UA 3MR3A 1AROP 4JV1A 2ZUBA 5KG4A 3GIJA 3GFKB 1LKYA 8ICGA 1BPYA 4CCHA 4ECSA 4F4XA 4QWDA 1U49A 2C2EA 1KTQA 2KFZA 4CGZA 4J03A 2W04A 2JEFA 4EELA 2FDRA 2XIDA 4KLIA 3FC4A 4RNMA 5L1MA 2NO4A 4ED6A 2MA1A 1COKA 3ISBA 3ED5A 2JH1A 3M8SA 4Y2UA 4RUCA 5KG6A 4P0QB 3SAGA 4PHDA 4QZFA 5CRXA 1Z4NA 5DGBA 2WF9A 3K75D 3Q8SB 5J2KA 1N61A 3M9MB 1L3SA 2KVSA 3Q8KA 5KNIA 3F2BA 1QQ7A 3C1YA 3D2SA 2HHTA 1Z1VA 9ICHA 3TAPA 2CN1A 1JALA 5KT3A 1SZPA 2XICA 2K4HA 1UA0A 5DGAA 1B0XA 2W54A 2DPJA 1X9WA 2KSOB 1JXEA 3CNHA 5G5GA 2ZJ8A 1SGGA 1ZXIA 4DSKA 1TE2A 3WKEA 1RXWA 2R8GA 4QZAA 3MGVA 1TAMA 4EBEA 4KLOA 4DL5A 3DEEA 1CUKA 2LPEA 5BOLA 1SV4A 2YB4A 4DOCA 4DQSA 1ZJNA 4NLBA 1N48A 4YD2A 9ICSA 5DQHA 1BPDA 2B6GA 2JEGA 2VJ5A 4ECVA 5BOMA 1PK1B 4BXOA 5D46A 4QWCA 3C23A 4PJ0U 3IN5A 3C5FA 5AKKA 2VKQA 4P4PA 4KLMA 3QUTA 4RQ7A 2ASJA 4C0ZA 4B9TA 3CW2C 2ODGA 4JWNA 2PMZF 4I2AA 4IQUA 4DCCA 1S0NA 5KAIU 3PMNA 5KFDA 2ES6A 3GU3A 1A77A 9ICUA 4DF8A 4I27A 2BQUA 7ICSA 3KD3A 1KFTA 4UBCA 3RRGA 2K8AA 4QWBA 3KKAC 1NK7A 5C0YA 1QLNA 2HVHA 7ICMA 2KSOA 8ICBA 4QNLA 1NZPA 3UMGA 2P35A 2N1RA 3HKZC 3D2NA 3N7RC 4ECZA 3RJGA 3EZ5A 1D8BA 5CJ7A 1BPXA 3FAHA 4TURA 1IM4A 5IIKA 3AUOA 3LWMA 4BDPA 1RYUA 2HW3A 2K8BB 1KLNA 1DOQA 2ZJAA 2LYHA 5FP0A 4I2BA 1NNLA 5D4BA 4EBDA 4DFJA 2KTQA 5L9XA 3HT3A 2ZIWA 4J9QA 1JI7A 3AMZA 2MUTB 3I28A 4YFKA 2OCEA 1VLBA 3Q8MA 4OJ5A 4J9PA 1ZQRA 2KNJA 3IDWA 4MHVA 3BS5B 5D49A 3SAFA 4FFDA 4B9LA 4FZNA 4NXZA 1J2MA 5JTIA 1X6IA 1LVHA 1JN3A 2FMSA 4QZBA 1F5SA 3VC8A 3IRUA 1Q3UA 5AI4A 1UCVA 4F3OA 2J6UA 3IM1A 4UQGA 4DWIA 1NK6A 1KEJA 3BDPA 3UPQA 4UAUA 3Q8LA 1U9LA 4RQ0A 2Q0ZX 4BXOB 2MRLA 2WAQF 3C5GA 2B0CA 3M8RA 4GXJA 4ED0A 4MEYA 4QZ9A 1TVAA 2P6RA 1ZQQA 1S5LU 3IP4B 2XY5A 4KTQA 1J97A 3RB0A 3JPPA 1SIJA 8ICXA 5HHHA 3HWTA 2RDIA 3KHLA 1UPHA 5ALMA 1ZD5A 4UB2A 3RH5A 1DRGA 3M1YA 4PPXA 2IHMA 5E79U 2RQ5A 1ZQUA 2IBKA 3G6YA 1WCLA 2YB1A 5ALIA 4B9MA 4ZOHC 4PH5A 1ZQWA 4RT2A 4F5PA 1K1SA 4F50A 5AHXA 2OEHA 2FPLA 1L8OA 1XO0A 2LM4A 3H4BA 2R8HA 5KG0A 4KLJA 5DLGA 1ZQFA 2JV3A 3ZI4A 1UQVA 3QEBZ 5J2AA 8ICCA 3AEVA 4DQIA 1JXLA 1URJA 1V97A 5AK4A 4QZEA 4P2HA 5AM5A 1KW4A 2HCFA 2D6FC 4JV2A 4FS1A 2XC9A 2AH5A 2B21A 1NZBA 1FIQA 5ALQA 4O5KA 1KFDA 3CYMA 5J2HA 5AKJA 5DDMA 5KG5A 2HMXA 3BQ7A 4R66A 2IOFK 1SZHA 2VA8A 4NWIA 5AI9A 2F2AB 1DXSA 3T5HA 8ICEA 4ECYA 4YR0A 2MSNA 1RYSA 5ALTA 5CEHA 2QARA 5J0YA 2VA3A 5EE3A 3I1YA 5DBCA 3WKDA 7ICRA 3F2DA 9ICNA 3RFAA 3WK7A 2KIVA 8ICFA 1ZQKA 2FE9A 3DV9A 1Z00B 2BZFA 2EZYA 1IV8A 4WJ3B 4NM2A 4OO1J 4CF4A 1ZRNA 4C4RA 4UB3A 5ALFA 1QCKA 2FPMA 4EEKA 8ICYA 2DBYA 2HBJA 4GC7A 4RQMA 4ECQA 2ZTDA 4DL4A 2EZZA 2AGPA 2AGOA 3HKZF 2J6TA 4GLXA 5B66U 1OUQA 1O03A 4K4HA 2ALZA 4QZ8A 5T14A 1Q46A 3T5LA 1FFUA 9ICCA 2E8OA 1XO1A 1FFVA 5EWEA 2HBKA 1ZQGA 4BWJA 1ZQIA 2C22A 2ZXIA 4KLGA 3AU2A 4Y2TA 5A0LA 1KBUA 2M0NA 4Y2YA 2YMMA 3L5KA 2VA2A 3RJEA 2WTFA 1KN5A 2HHXA 1V38A 4F8RA 2XVTA 1QQ5A 9ICVA 1NK5A 2ASLA 1L7MA 4GFJA 4O3PA 3LWLA 3ALRA 4CF5A 4DOBA 9ICXA 2DF4B 5CP2A 4A8EA 4ECXA 3WU2U 5KFIA 2W55A 1KKXA 5J2EA 4RPXA 7ICLA 4FBTA 3TI0A 2LI6A 3EPIA 1HUOA 3CRXA 2DUYA 4Z6CA 4PZOA 5DKWA 2YTUA 2ZIVB 2BQ3A 1T7PA 5J0RA 2JEIA 4O3OA 5CR0A 9ICAA 5ALZA 3UM9A 4I2CA 4RQNA 5ALOA 3NUQA 5AI5A 4DL6A 3Q8PB 1X66A 4US8A 3ZDEA 3QU4A 4YR2A 4K4IA 2QB0A 2XO7A 2HI0A 1MQ2A 4EBCA 2EQYA 3H8JA 2IOHA 2JMGA 5J0XA 1TKDA 3H8WA 3N7SC 3EYZA 4Y2PA 1CEZA 3C2LA 2DPIA 1O08A 4RQ6A 3E2EA 3TKAA 5DBBA 1GO3F 4FS2A 3TFSA 2WF6A 5AK6A 5IIMA 4R8UA 2W7OA 2IMWP 4DL2A 3K4GA 2WFAA 2AHOB 2WB1C 4NJ8A 1DGJA 1RXVA 1L7OA 3V7KA 1Y88A 2G0AA 4RNOA 4X5VA 4TQSA 3SENA 2H5XA 5IIOA 4R64A 3EW9A 5ALRA 5ALVA 3EWAA 4GXKA 3U26A 4DLGA 1Q3VA 4LJXA 2YX8A 4EENA 1RM6C 2HOIA 8ICWA 1T4GA 2BKEA 3SV4A 5KFHA 2W03A 3WKBA 4DF4A 3OTQA 4UASA 2VANA 3E0FA 3NVZA 1ZQBA 5ALYA 2LM1A 3GV5B 2HBLA 4IQTA 5B5EU 1NK0A 4B6JA 4NLGA 4IQVA 3K1ZA 3UXOA 1TV9A 2ZXHA 3RR8A 2EANA 4J9RA 4QZIA 3V6JA 4R8UB 4F93B 9ICFA 3AM9A 2LHTA 3HPOA 4I2DA 2YMPA 4I29A 3ONNA 1QH9A 4YD1A 1TAQA 1WUDA 1ZETA 4QW8A 3OJUA 3V6KA 2H3VA 4G3IA 1WWVA 4EYHB 9ICEA 2PFNA 4UW9A 3MR2A 5J2IA 3RJHA 2NRWA 4QIWF 3S6JA 3ZDDA 1X2IA 1S0OA 3C21A 5ALKA 4O5CA 4Q45A 1CRXA 3SMVA 3G6XA 2F1HA 8ICPA 4EEYA 1RDFA 2M9NA 2FLPA 4RU9A 2G07A 3LVVA 4OJLA 3FDSA 4M9LA 3QU5A 3KHRA 7ICHA 5F3XB 1ZD2P 2UVUA 4Y2RA 8ICJA 1UA1A 3PR5B 3C28A 2G08A 2Z7JA 2NRZA 3WK5A 3L3FX 4XQ8A 2HHVA 1XSLA 4B9VA 1ZQTA 3QE9Y 1AQ6A 5J2DA 5JU5A 4C7ZA 2KIWA 4QZGA 3PY8A 5DG8A 5CWRA 3WK8A 1U4BA 1ECWA 3RB3A 3KFUF 2R18A 4XRHA 1S8OA 1S10A 3SQIA 3ETRA 4F71A 2KN7A 3J81j 2W8KA 3OSPA 2JZBB 4KN4A 1ZYQA 8ICHA 9ICKA 3M7DA 4NLKA 5DDYA 5H2FU 4EX7A 2J6SA 3LDAA 2UVWA 1H38A 4GIBA 8ICZA 1TFRA 4DSFA 3QU9A 4F4WA 4CDGA 7ICEA 5KFCA 3MFIA 1U47A 1RPLA 3PSTA 2ESEA 3QUQA 8ICVA 2FMPA 4DO9A 3ZDCA 2A3VA 3PX0A 1N60A 2RDJA 1ZOLA 2ZG6A 1YT3A 4UB8U 5ALSA 8ICOA 4JK1A 9ICJA 7ICIA 2AU0A 4J9KA 4Y2XA 3T79A 4C4SA 4ECRA 3R9KA 1X9MA 4C7YA 1VDVA 2KJ9A 4TUSA 2IOFA 4RZRA 4I2HA 4J9NA 2YN4A 3BQTA 2XCAA 4DS4A 3N97B 5L1IA 2GO7A 3I76A 2R8KA 1Z4OA 8ICSA 4FZMA 3QX7A 3PSIA 4F72A 2EZXA 5ALXA 2QLTA 3H40A 5AKZA 5KT5A 2D8CA 4EX6A 4GXIA 3T5JA 2F3NA 1L3VA 5AKHA 4M9HA 1QQ6A 2K8CB 3SZ2A 7ICVA 2KKVA 5KFTA 4F4ZA 2C2DA 4M9JA 3PW2A 5HMLA 3UMBA 4AYBF 2GH1A 5TISU 5ALHA 3RAXA 4OD0A 1L3UA 1DK2A 4M04A 3ZD9A 5AKXA 4DSJA 5KFWA 3GDXA 3TAQA 5KFZA 2G5IB 2Y1JA 3ORYA 2WF8A 3FM9A 3E58A 3RF9A 2BCRA 1NJZA 2F1IA 4UB4A 1ZRMA 2Q4TA 2PI5A 5J8YC 3F53A 4C8KA 2BCSA 1KL9A 4IRCA 2A19A 3LK9A 3MBYA 3KZXA 3AQEA 4P0PB 2V4QA 2K89A 4EZ9A 4F92B 1ZQ1C 4KLLA 3H7IA 4DFMA 2GOLA 1XC9A 1XWLA 4U6PA 9ICOA 4RQ4A 3QEAZ 3PX4A 2BPGA 4DS5A 5AKIA 2LMRA 4YXJA 2CPRA 5HR7A 3O0FA 5KFGA 4MEXA 5AM3A 5KT4A 1SWWA 1Z19A 2I5HA 1MN8A 3D2QA 1BPZA 2PFQA 5EE9A 4QIWC 5KFMA 1N5XA 1PZNA 4ED3A 4E0DA 3BZKA 2K4PA 4ED8A 3HJEA 4I2FA 4DLEA 3B9JA 2JXJA 8ICTA 1OXJA 4BGDA 4XA5A 2F8KA 3JPQA 2KK0A 5EE0A 2W9BB 4DOAA 2EAPA 1SB3C 2E5SA 1F0MA 4DSEA 1IIPA 2AGQA 4KLSA 4JV0A 4OJPA 1SL0A 2O6KA 1D8LA 5IIJA 1X6JA 5AKLA 1ZQLA 3RJJA 4P4MA 1ZQOA 8ICNA 1RYRA 2QB1A 4ED1A 4NLNA 5J2GA 4DSIA 4LVSA 2WF7A 2R8JA 9ICGA 5ALNA 1Z1BA 1KRPA 5ALJA 3SYZA 4BUGA 3JPTA 2KFNA 2W43A 2E8PA 1ZQZA 1ZQEA 4Z6DA 3KTQA 4I2JA 2MU2A 3THVA 4AYBC 3NVWA 1T8EA 4PHPA 2CRXA 2E8MA 2YMLA 4R65A 2OXOA 1L7PA 5DBAA 4F5OA 1UT5A 5AI6A 3UQ0A 4ECUA 1NKBA 2G5HB 1K5OA 3IHQB 3MR5A 2HHQA 1S0MA 3K1RB 3NVVA 1NK4A 3ETLA 1IG6A 2BPCA 1B43A 2BHNA 3HP6A 3CP8A 3ZD8A 4LZGA 2C2RA 4JB3A 3NRWA 9ICWA 3QU2A 9ICPA 3MABA 2IA6A 4YG2A 4AP9A 1ZQSA 3PZPA 2KV2A 1J2NA 2PKEA 3NASA 1K1QA 5C5JA 4DEZA 2GLEA 4C8LA 1ED1A 2ZIUA 2KICA 4Q8FA 2KJ5A 4CRXA 3JPOA 4P4OA 1JMSA 4FZLA 3MC1A 3AL0B 5KFEA 2A1AA 4QZDA 3V7LA 3TANA 3RB4A 4O3NA 4JMUA 4C4TA 2K4EA 9ICMA 4F2SA 3QNMA 3A0BU 2KOBA 4CF3A 2G06A 1EXNA 5AM2A 2W3SA 4RQ1A 7ICOA 2ZIVA 5AIBA 4F2RA 3GV8B 2ISPA 3TADC 4C8OA 2W9CB 2L5YA 2JEJA 4B9NA 3PMLA 3PSPA 2HOQA 1SXDA 3PX6A 4IRDA 4NLCA 4KLTA 3RR7A 2UVVA 1ZQYA 2HHWA 4OJOA 3M9NB 5L1KA 1ZQMA 4DL3A 2JRZA 4ZH4A 1SKSA 3NGDA 2F44A 4IR9A 4YQWA 2ZIWB 3PW7A 4PGQA 5AIAA 4UBBA 7ICNA 1ZJMA 5K4LA 3QUBA 8ICIA 4NV0A 4UAWA 5KFOA 2RP5A 3C2MA 2XY7A 4M9NA 4TQRA 1ZD4A 2W9AA 3PO4A 5JRTA 2FI1A 5KG3A 2F77X 1V9PA 3OHBA 1NK9A 3TFRA 5J29A 5GTIU 2NRXA 4EZ6A 5J8YA 2KVCA 4KLUA 1L5UA 3M6KA 2E1EA 3RAQA 2Y0SC 5L1LA 1ZQXA 4Z6EA 4RQ2A 1XS9D 1Z00A 3TQ1A 1X9XA 4P0QA 1NJWA 3UXNA 2KZMA 5HMMA 2BDPA 4IQWA 2QARB 5DLFA 2DGZA 5EE1A 1ZQNA 5KG7A 1XNSA 4YCXA 4I28A 5AI8A 2C28A 2FPKA 4F5NA 4ECWA 2KKPA 4M2YA 3MR6A 7ICTA 3H8SA 3BS5A 4PZNA 2DWQA 2JH7A 1N56A 9ICIA 4B9SA 2H3QA 3HX0A 2ZUCA 5KL8B 5J0QA 3OJSA 2HDOA 4MF8A 4DQRA 4Y2SA 1SKWA 3JPSA 2AQ0A 3C2KA 1S76D 2KEYA 4KN7A 3PV8A 3B0XA 1NJYA 1TK8A 2YY6A 1ZQVA 1YZ7A 3WK6A 2XGPA 3SI8A 5KFRA 1HIWA 4JWMA 5AK5A 4DQPA 2WB1F 3RBEA 2DQNB 1SXEA 4J9MA 3KKAA 8ICMA 1F44A 3N4MB 4XUSA 2MAXA 1CI4A
chains in the Genus database with same CATH topology
1RG6A 2K60A 2KSOA 2Y9TA 2QB0A 1SV0A 1B0XA 2QB0B 2KSOB 2EAMA 4RQMA 2GLEA 3H8MA 1SGGA 1OW5A 5JRTA 2QKQA 1PK3A 1WWUA 2EAOA 2K4PA 2LPEA 1V85A 5J8YA 4NJ8A 5F3XB 1OXJA 1SV4A 2F8KA 2E8OA 2Y9UA 2D8CA 2EAPA 3TADA 2KG5A 2KE7A 2F3NA 1X9XA 1F0MA 2JV3A 2DL0A 3BS7A 1JI7A 1UQVA 2B6GA 3SENA 2QARB 5JU5A 1V38A 3IDWA 4MHVA 3BS5B 1LKYA 1KW4A 1PK1B 2QB1A 2DKZA 4NL9C 1PK1A 5JTIA 3TADC 3BS5A 4PZNA 2E8PA 5L1MA 1UCVA 1COKA 2L5YA 4IS7A 3BQ7A 2E8MA 1SXDA 5J8YC 4PZOA 1DXSA 2YTUA 1LKYB 2EANA 3K1RB 4NL9A 3SEIA 1B4FA 2ES6A 5KNIA 2QARA 1SV0C 2E8NA 4RQNA 1Z1VA 2F44A 2KMDA 2DKXA 2ESEA 2KIVA 2FE9A 1SXEA 3KKAC 2D3DA 3KKAA 2LMRA 1X66A 1X40A 1WWVA 3TACB 3HILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RG6 A;  2K60 A;  2KSO A;  2Y9T A;  2QB0 A;  1SV0 A;  1B0X A;  2QB0 B;  2KSO B;  2EAM A;  4RQM A;  2GLE A;  3H8M A;  1SGG A;  1OW5 A;  5JRT A;  2QKQ A;  1PK3 A;  1WWU A;  2EAO A;  2K4P A;  2LPE A;  1V85 A;  5J8Y A;  4NJ8 A;  5F3X B;  1OXJ A;  1SV4 A;  2F8K A;  2E8O A;  2Y9U A;  2D8C A;  2EAP A;  3TAD A;  2KG5 A;  2KE7 A;  2F3N A;  1X9X A;  1F0M A;  2JV3 A;  2DL0 A;  3BS7 A;  1JI7 A;  1UQV A;  2B6G A;  3SEN A;  2QAR B;  5JU5 A;  1V38 A;  3IDW A;  4MHV A;  3BS5 B;  1LKY A;  1KW4 A;  1PK1 B;  2QB1 A;  2DKZ A;  4NL9 C;  1PK1 A;  5JTI A;  3TAD C;  3BS5 A;  4PZN A;  2E8P A;  5L1M A;  1UCV A;  1COK A;  2L5Y A;  4IS7 A;  3BQ7 A;  2E8M A;  1SXD A;  5J8Y C;  4PZO A;  1DXS A;  2YTU A;  1LKY B;  2EAN A;  3K1R B;  4NL9 A;  3SEI A;  1B4F A;  2ES6 A;  5KNI A;  2QAR A;  1SV0 C;  2E8N A;  4RQN A;  1Z1V A;  2F44 A;  2KMD A;  2DKX A;  2ESE A;  2KIV A;  2FE9 A;  1SXE A;  3KKA C;  2D3D A;  3KKA A;  2LMR A;  1X66 A;  1X40 A;  1WWV A;  3TAC B;  3HIL A; 
#chains in the Genus database with same CATH topology
 1S9F A;  2Y9T A;  4YMN A;  2OHF A;  3C1Z A;  2BDU A;  4DFP A;  2ASD A;  3PW5 A;  4KMO B;  5TZV A;  4DSL A;  3N7P D;  4M9G A;  1WWU A;  4O9M A;  4FO6 A;  5ALU A;  3SV3 A;  1BNO A;  4Q44 A;  3GIM A;  5KT2 A;  3T5K A;  2I6X A;  4UB1 A;  3IG5 A;  1S97 A;  4PL1 A;  3LVW A;  3JPR A;  1TK5 A;  2H3Z A;  2KHV A;  3BQ0 A;  1YZ6 A;  4YMM A;  3RRH A;  2R8I A;  4R63 A;  2G09 A;  1XSP A;  1PVR A;  4RPY A;  4M0A A;  4KX3 A;  1KSP A;  3RJF A;  5AKG A;  4NL9 C;  3PO5 A;  3M9O B;  1PK1 A;  3UMC A;  5KG2 A;  4O3S A;  3KOO A;  5KFV A;  1L8L A;  4J9S A;  1PVQ A;  4IR1 A;  8ICK A;  1ZQD A;  2KJ8 A;  3WK9 A;  5KFY A;  1IXR A;  2JR5 A;  2RLT A;  4NY8 A;  3T3F A;  3IG8 A;  5L1J A;  3IV6 A;  5J0U A;  3V72 A;  2IHN A;  5KFP A;  1LKY B;  4IL6 U;  4MFC A;  1D9F A;  2BQR A;  4ICA A;  3PNC A;  4IC9 A;  4DL7 A;  5ALD A;  2KMD A;  3LYS A;  2MUT A;  2F1J A;  5ALW A;  4YVZ A;  2EDU A;  2XY6 A;  5BPC A;  3WKC A;  1X40 A;  2NRV A;  2BR0 A;  2VJ4 A;  5EWF A;  2XGQ A;  3KHG A;  2LYA A;  3H0M B;  1S77 D;  4I2E A;  1NOM A;  2RHF A;  4UAV A;  2OH2 A;  4QZH A;  4BJQ A;  2RRD A;  2EAM A;  1T3N A;  1Q8K A;  4KIT B;  3B0Y A;  2AQ4 A;  4US9 A;  1PK3 A;  4JUZ A;  7ICG A;  3MDC A;  2K4I A;  5DB6 A;  1D9D A;  4U7C A;  4KLD A;  2KD1 A;  3RB6 A;  1D8Y A;  2H3F A;  1RQN A;  5J0O A;  4F5Q A;  2KHQ A;  5KFQ A;  4C8N A;  5J2B A;  1SL2 A;  2ZTE A;  3SAH A;  1BPE A;  2LBO A;  2E1F A;  3OHA A;  2V9W A;  5F9L A;  5CA7 A;  1KDH A;  4F5R A;  3V7J A;  3VCB A;  1N2X A;  4ELV A;  3QXG A;  4IRK A;  2AJQ A;  1NJX A;  3BJY A;  4ELU A;  1P7D A;  5KFL A;  2W9C A;  1KFS A;  1UHU A;  4IS7 A;  3AQF A;  3PR4 A;  5KFK A;  2W9B A;  3F2C A;  1C7Y A;  2ZUD A;  2A1J A;  5KT7 A;  1HEK A;  3SEI A;  1QSL A;  3MGH A;  3F5E A;  2E8N A;  4M47 A;  5EOZ A;  5GTH U;  5DB8 A;  5HNK A;  5KFA A;  3QU7 A;  5KFN A;  5J0W A;  3MFH A;  3HIL A;  1FO4 A;  3DDH A;  4RQ8 A;  1N62 A;  1WG8 A;  3RTV A;  4Q43 A;  2F76 X;  1FEZ A;  5F9N A;  3BZC A;  4CNQ A;  4QZC A;  4PHE A;  2ZJ5 A;  3NTU A;  3OGU A;  3PW4 A;  4Y2J A;  1ZQJ A;  1OW5 A;  3WK4 A;  3UQ2 A;  3GV7 B;  1MA7 A;  4TUQ A;  2ZIU B;  4OJ6 A;  2F8L A;  8ICR A;  4DFD A;  5III A;  3RJI A;  5HR6 A;  4F91 B;  4P0P A;  3H0R B;  1NKC A;  4FE3 A;  1NKE A;  5DB9 A;  2YMQ A;  4ACO A;  3UXP A;  3TAD A;  2KG5 A;  1NI3 A;  1MQ3 A;  3FYH A;  1WCN A;  2KP7 A;  3AN1 A;  3JPN A;  2WAQ C;  5DQI A;  4QWE A;  4FBU A;  1KQQ A;  2ATL A;  2I1Q A;  8ICQ A;  4RPZ A;  5KAF U;  4BWM A;  7ICK A;  2HHU A;  1DK3 A;  3PSF A;  3Q8Q B;  4HAI A;  3EUB 2;  1LB2 B;  3KZI U;  5KFX A;  2WF5 A;  3HRD D;  4O3M A;  1UT8 A;  4QJF B;  4ECT A;  4M6W A;  3F5A A;  2KZ3 A;  1N63 A;  1SWV A;  3BQ2 A;  5AK3 A;  1LV5 A;  4KLQ A;  2WHE A;  2ZIX B;  1HJP A;  4DFK A;  5J0P A;  1RQL A;  4UAT A;  5KL1 B;  2BCU A;  9ICQ A;  3SR6 A;  2VIX A;  5AI0 A;  4O3Q A;  4NL9 A;  1B4F A;  3Q8R B;  1T3Q A;  1XU4 A;  5HHI A;  4F4Y A;  1ZQA A;  2ZTC A;  2Y0S F;  5ALE A;  2DKX A;  2LKY A;  4UAY A;  2HVI A;  4PHA A;  2P66 A;  2D3D A;  1ZQC A;  5AIC A;  1M6Y A;  4Z6F A;  3QZ8 A;  2K60 A;  2JHD A;  3ZDA A;  1SV0 A;  4C80 A;  2QB0 B;  4UAR A;  1XSN A;  2V4R A;  2BGW A;  5J0T A;  4EYI B;  3OPX A;  3WKA A;  1BPB A;  1PVP A;  1N5W A;  2OWO A;  1JX4 A;  3H4D A;  3L4P A;  4DQQ A;  5KFB A;  4BX9 C;  4F4K A;  5KFF A;  1RZT A;  2HHS A;  1X42 A;  5J0S A;  2EH9 A;  2CXY A;  5CHG A;  4Q8E A;  2KE7 A;  1VJ5 A;  4J9L A;  2DL0 A;  3G6V A;  2PFP A;  3KBB A;  2NV3 A;  5AM0 A;  3ISC A;  3QYP A;  5ALP A;  5JUM A;  3ICX A;  2JGA A;  4CE6 A;  1B22 A;  8ICU A;  4RNN A;  1NK8 A;  5KTQ A;  4RQ3 A;  2Y1I A;  1T94 A;  2DKZ A;  4J9O A;  2ISO A;  2NYV A;  3MGI A;  5KFS A;  1ZD3 A;  5ALG A;  1C20 A;  4YN4 A;  3EPG A;  2W11 A;  1BNP A;  1L6N A;  3GIK A;  2KZZ A;  3PVX A;  1JRO A;  1MC8 A;  4M6W B;  1ZQP A;  5AKE A;  4KX5 A;  1BVS A;  7ICF A;  3N28 A;  2BCQ A;  2GWS A;  4NLZ A;  3C29 A;  3RBD A;  1A6S A;  2OM6 A;  3RH4 A;  2HSZ A;  1QSY A;  3D6J A;  9ICR A;  2PXI A;  1TK0 A;  1SV0 C;  5J2F A;  2XI9 A;  4I2I A;  5DG9 A;  1PUZ A;  4RT3 A;  4MF2 A;  3TAC B;  3KHH A;  1COO A;  3H0L B;  7ICJ A;  1RG6 A;  5KFU A;  2I9G A;  1QSS A;  4B9U A;  4G9B A;  1TAU A;  4USA A;  3H8M A;  2W9M A;  2PI4 A;  5IIN A;  4O5E A;  4ELT A;  2W3R A;  3SD7 A;  4I2G A;  3PW0 A;  4RUA A;  1V85 A;  4HYK A;  5J2J A;  4QW9 A;  4UAZ A;  2H3I A;  2NRT A;  3NS1 A;  3TAR A;  7ICQ A;  4RQ5 A;  2Y9U A;  4C8M A;  2BPF A;  2FMQ A;  2ZIX A;  5DB7 A;  2FLL A;  2PFO A;  3ZDB A;  3NRZ A;  3BS7 A;  5DG7 A;  4KLH A;  2UVR A;  3ISD A;  1HUZ A;  4PGY A;  2PMZ C;  1JIH A;  3V6H A;  1BGX T;  1JUD A;  4Y2V A;  3BQ1 A;  5AM1 A;  5AKY A;  2XCP A;  3HW8 A;  4PL2 A;  4YXM A;  3NVY A;  5EWG A;  8ICL A;  2W8L A;  5ALL A;  5IIL A;  1JRP A;  4NM1 A;  2JZB A;  5J2C A;  1U48 A;  1S0V A;  1WYG A;  1X9S A;  2AXT U;  2FLN A;  4QWA A;  4KMU A;  4GC6 A;  4KLF A;  1QTM A;  2HBM A;  2LYB A;  3MDA A;  4YP3 A;  9ICL A;  4PGX A;  2YQE A;  4KLE A;  5KT6 A;  3QZ7 A;  5HP4 A;  2W7P A;  7ICP A;  4O3R A;  3GIL A;  3M6Z A;  4UB5 A;  4LZD A;  1A76 A;  4TUP A;  2HOF A;  5AM4 A;  4ED2 A;  5CB1 A;  3A0H U;  1L7N A;  5DQG A;  4K4G A;  8ICA A;  3GQC A;  3RH6 A;  3QUC A;  5G5H A;  2E3T A;  1U45 A;  1Z3E B;  4UB6 U;  3RJK A;  4OCZ A;  5KG1 A;  4ED7 A;  2QKQ A;  2OYY A;  1SL1 A;  2EAO A;  2BCV A;  4MFF A;  2DFL A;  3GII A;  3OSN A;  3GZF A;  9ICT A;  3AU6 A;  2A1J B;  5KFJ A;  4YMO A;  4MFA A;  2FJ6 A;  4Y2Q A;  7ICU A;  1MSW D;  1A0P A;  1SKR A;  9ICB A;  1L3T A;  1ZQH A;  2NO5 A;  4O0I A;  4YR3 A;  1DGS A;  2P6U A;  3MR3 A;  1ARO P;  4JV1 A;  2ZUB A;  5KG4 A;  3GIJ A;  3GFK B;  1LKY A;  8ICG A;  1BPY A;  4CCH A;  4ECS A;  4F4X A;  4QWD A;  1U49 A;  2C2E A;  1KTQ A;  2KFZ A;  4CGZ A;  4J03 A;  2W04 A;  2JEF A;  4EEL A;  2FDR A;  2XID A;  4KLI A;  3FC4 A;  4RNM A;  5L1M A;  2NO4 A;  4ED6 A;  2MA1 A;  1COK A;  3ISB A;  3ED5 A;  2JH1 A;  3M8S A;  4Y2U A;  4RUC A;  5KG6 A;  4P0Q B;  3SAG A;  4PHD A;  4QZF A;  5CRX A;  1Z4N A;  5DGB A;  2WF9 A;  3K75 D;  3Q8S B;  5J2K A;  1N61 A;  3M9M B;  1L3S A;  2KVS A;  3Q8K A;  5KNI A;  3F2B A;  1QQ7 A;  3C1Y A;  3D2S A;  2HHT A;  1Z1V A;  9ICH A;  3TAP A;  2CN1 A;  1JAL A;  5KT3 A;  1SZP A;  2XIC A;  2K4H A;  1UA0 A;  5DGA A;  1B0X A;  2W54 A;  2DPJ A;  1X9W A;  2KSO B;  1JXE A;  3CNH A;  5G5G A;  2ZJ8 A;  1SGG A;  1ZXI A;  4DSK A;  1TE2 A;  3WKE A;  1RXW A;  2R8G A;  4QZA A;  3MGV A;  1TAM A;  4EBE A;  4KLO A;  4DL5 A;  3DEE A;  1CUK A;  2LPE A;  5BOL A;  1SV4 A;  2YB4 A;  4DOC A;  4DQS A;  1ZJN A;  4NLB A;  1N48 A;  4YD2 A;  9ICS A;  5DQH A;  1BPD A;  2B6G A;  2JEG A;  2VJ5 A;  4ECV A;  5BOM A;  1PK1 B;  4BXO A;  5D46 A;  4QWC A;  3C23 A;  4PJ0 U;  3IN5 A;  3C5F A;  5AKK A;  2VKQ A;  4P4P A;  4KLM A;  3QUT A;  4RQ7 A;  2ASJ A;  4C0Z A;  4B9T A;  3CW2 C;  2ODG A;  4JWN A;  2PMZ F;  4I2A A;  4IQU A;  4DCC A;  1S0N A;  5KAI U;  3PMN A;  5KFD A;  2ES6 A;  3GU3 A;  1A77 A;  9ICU A;  4DF8 A;  4I27 A;  2BQU A;  7ICS A;  3KD3 A;  1KFT A;  4UBC A;  3RRG A;  2K8A A;  4QWB A;  3KKA C;  1NK7 A;  5C0Y A;  1QLN A;  2HVH A;  7ICM A;  2KSO A;  8ICB A;  4QNL A;  1NZP A;  3UMG A;  2P35 A;  2N1R A;  3HKZ C;  3D2N A;  3N7R C;  4ECZ A;  3RJG A;  3EZ5 A;  1D8B A;  5CJ7 A;  1BPX A;  3FAH A;  4TUR A;  1IM4 A;  5IIK A;  3AUO A;  3LWM A;  4BDP A;  1RYU A;  2HW3 A;  2K8B B;  1KLN A;  1DOQ A;  2ZJA A;  2LYH A;  5FP0 A;  4I2B A;  1NNL A;  5D4B A;  4EBD A;  4DFJ A;  2KTQ A;  5L9X A;  3HT3 A;  2ZIW A;  4J9Q A;  1JI7 A;  3AMZ A;  2MUT B;  3I28 A;  4YFK A;  2OCE A;  1VLB A;  3Q8M A;  4OJ5 A;  4J9P A;  1ZQR A;  2KNJ A;  3IDW A;  4MHV A;  3BS5 B;  5D49 A;  3SAF A;  4FFD A;  4B9L A;  4FZN A;  4NXZ A;  1J2M A;  5JTI A;  1X6I A;  1LVH A;  1JN3 A;  2FMS A;  4QZB A;  1F5S A;  3VC8 A;  3IRU A;  1Q3U A;  5AI4 A;  1UCV A;  4F3O A;  2J6U A;  3IM1 A;  4UQG A;  4DWI A;  1NK6 A;  1KEJ A;  3BDP A;  3UPQ A;  4UAU A;  3Q8L A;  1U9L A;  4RQ0 A;  2Q0Z X;  4BXO B;  2MRL A;  2WAQ F;  3C5G A;  2B0C A;  3M8R A;  4GXJ A;  4ED0 A;  4MEY A;  4QZ9 A;  1TVA A;  2P6R A;  1ZQQ A;  1S5L U;  3IP4 B;  2XY5 A;  4KTQ A;  1J97 A;  3RB0 A;  3JPP A;  1SIJ A;  8ICX A;  5HHH A;  3HWT A;  2RDI A;  3KHL A;  1UPH A;  5ALM A;  1ZD5 A;  4UB2 A;  3RH5 A;  1DRG A;  3M1Y A;  4PPX A;  2IHM A;  5E79 U;  2RQ5 A;  1ZQU A;  2IBK A;  3G6Y A;  1WCL A;  2YB1 A;  5ALI A;  4B9M A;  4ZOH C;  4PH5 A;  1ZQW A;  4RT2 A;  4F5P A;  1K1S A;  4F50 A;  5AHX A;  2OEH A;  2FPL A;  1L8O A;  1XO0 A;  2LM4 A;  3H4B A;  2R8H A;  5KG0 A;  4KLJ A;  5DLG A;  1ZQF A;  2JV3 A;  3ZI4 A;  1UQV A;  3QEB Z;  5J2A A;  8ICC A;  3AEV A;  4DQI A;  1JXL A;  1URJ A;  1V97 A;  5AK4 A;  4QZE A;  4P2H A;  5AM5 A;  1KW4 A;  2HCF A;  2D6F C;  4JV2 A;  4FS1 A;  2XC9 A;  2AH5 A;  2B21 A;  1NZB A;  1FIQ A;  5ALQ A;  4O5K A;  1KFD A;  3CYM A;  5J2H A;  5AKJ A;  5DDM A;  5KG5 A;  2HMX A;  3BQ7 A;  4R66 A;  2IOF K;  1SZH A;  2VA8 A;  4NWI A;  5AI9 A;  2F2A B;  1DXS A;  3T5H A;  8ICE A;  4ECY A;  4YR0 A;  2MSN A;  1RYS A;  5ALT A;  5CEH A;  2QAR A;  5J0Y A;  2VA3 A;  5EE3 A;  3I1Y A;  5DBC A;  3WKD A;  7ICR A;  3F2D A;  9ICN A;  3RFA A;  3WK7 A;  2KIV A;  8ICF A;  1ZQK A;  2FE9 A;  3DV9 A;  1Z00 B;  2BZF A;  2EZY A;  1IV8 A;  4WJ3 B;  4NM2 A;  4OO1 J;  4CF4 A;  1ZRN A;  4C4R A;  4UB3 A;  5ALF A;  1QCK A;  2FPM A;  4EEK A;  8ICY A;  2DBY A;  2HBJ A;  4GC7 A;  4RQM A;  4ECQ A;  2ZTD A;  4DL4 A;  2EZZ A;  2AGP A;  2AGO A;  3HKZ F;  2J6T A;  4GLX A;  5B66 U;  1OUQ A;  1O03 A;  4K4H A;  2ALZ A;  4QZ8 A;  5T14 A;  1Q46 A;  3T5L A;  1FFU A;  9ICC A;  2E8O A;  1XO1 A;  1FFV A;  5EWE A;  2HBK A;  1ZQG A;  4BWJ A;  1ZQI A;  2C22 A;  2ZXI A;  4KLG A;  3AU2 A;  4Y2T A;  5A0L A;  1KBU A;  2M0N A;  4Y2Y A;  2YMM A;  3L5K A;  2VA2 A;  3RJE A;  2WTF A;  1KN5 A;  2HHX A;  1V38 A;  4F8R A;  2XVT A;  1QQ5 A;  9ICV A;  1NK5 A;  2ASL A;  1L7M A;  4GFJ A;  4O3P A;  3LWL A;  3ALR A;  4CF5 A;  4DOB A;  9ICX A;  2DF4 B;  5CP2 A;  4A8E A;  4ECX A;  3WU2 U;  5KFI A;  2W55 A;  1KKX A;  5J2E A;  4RPX A;  7ICL A;  4FBT A;  3TI0 A;  2LI6 A;  3EPI A;  1HUO A;  3CRX A;  2DUY A;  4Z6C A;  4PZO A;  5DKW A;  2YTU A;  2ZIV B;  2BQ3 A;  1T7P A;  5J0R A;  2JEI A;  4O3O A;  5CR0 A;  9ICA A;  5ALZ A;  3UM9 A;  4I2C A;  4RQN A;  5ALO A;  3NUQ A;  5AI5 A;  4DL6 A;  3Q8P B;  1X66 A;  4US8 A;  3ZDE A;  3QU4 A;  4YR2 A;  4K4I A;  2QB0 A;  2XO7 A;  2HI0 A;  1MQ2 A;  4EBC A;  2EQY A;  3H8J A;  2IOH A;  2JMG A;  5J0X A;  1TKD A;  3H8W A;  3N7S C;  3EYZ A;  4Y2P A;  1CEZ A;  3C2L A;  2DPI A;  1O08 A;  4RQ6 A;  3E2E A;  3TKA A;  5DBB A;  1GO3 F;  4FS2 A;  3TFS A;  2WF6 A;  5AK6 A;  5IIM A;  4R8U A;  2W7O A;  2IMW P;  4DL2 A;  3K4G A;  2WFA A;  2AHO B;  2WB1 C;  4NJ8 A;  1DGJ A;  1RXV A;  1L7O A;  3V7K A;  1Y88 A;  2G0A A;  4RNO A;  4X5V A;  4TQS A;  3SEN A;  2H5X A;  5IIO A;  4R64 A;  3EW9 A;  5ALR A;  5ALV A;  3EWA A;  4GXK A;  3U26 A;  4DLG A;  1Q3V A;  4LJX A;  2YX8 A;  4EEN A;  1RM6 C;  2HOI A;  8ICW A;  1T4G A;  2BKE A;  3SV4 A;  5KFH A;  2W03 A;  3WKB A;  4DF4 A;  3OTQ A;  4UAS A;  2VAN A;  3E0F A;  3NVZ A;  1ZQB A;  5ALY A;  2LM1 A;  3GV5 B;  2HBL A;  4IQT A;  5B5E U;  1NK0 A;  4B6J A;  4NLG A;  4IQV A;  3K1Z A;  3UXO A;  1TV9 A;  2ZXH A;  3RR8 A;  2EAN A;  4J9R A;  4QZI A;  3V6J A;  4R8U B;  4F93 B;  9ICF A;  3AM9 A;  2LHT A;  3HPO A;  4I2D A;  2YMP A;  4I29 A;  3ONN A;  1QH9 A;  4YD1 A;  1TAQ A;  1WUD A;  1ZET A;  4QW8 A;  3OJU A;  3V6K A;  2H3V A;  4G3I A;  1WWV A;  4EYH B;  9ICE A;  2PFN A;  4UW9 A;  3MR2 A;  5J2I A;  3RJH A;  2NRW A;  4QIW F;  3S6J A;  3ZDD A;  1X2I A;  1S0O A;  3C21 A;  5ALK A;  4O5C A;  4Q45 A;  1CRX A;  3SMV A;  3G6X A;  2F1H A;  8ICP A;  4EEY A;  1RDF A;  2M9N A;  2FLP A;  4RU9 A;  2G07 A;  3LVV A;  4OJL A;  3FDS A;  4M9L A;  3QU5 A;  3KHR A;  7ICH A;  5F3X B;  1ZD2 P;  2UVU A;  4Y2R A;  8ICJ A;  1UA1 A;  3PR5 B;  3C28 A;  2G08 A;  2Z7J A;  2NRZ A;  3WK5 A;  3L3F X;  4XQ8 A;  2HHV A;  1XSL A;  4B9V A;  1ZQT A;  3QE9 Y;  1AQ6 A;  5J2D A;  5JU5 A;  4C7Z A;  2KIW A;  4QZG A;  3PY8 A;  5DG8 A;  5CWR A;  3WK8 A;  1U4B A;  1ECW A;  3RB3 A;  3KFU F;  2R18 A;  4XRH A;  1S8O A;  1S10 A;  3SQI A;  3ETR A;  4F71 A;  2KN7 A;  3J81 j;  2W8K A;  3OSP A;  2JZB B;  4KN4 A;  1ZYQ A;  8ICH A;  9ICK A;  3M7D A;  4NLK A;  5DDY A;  5H2F U;  4EX7 A;  2J6S A;  3LDA A;  2UVW A;  1H38 A;  4GIB A;  8ICZ A;  1TFR A;  4DSF A;  3QU9 A;  4F4W A;  4CDG A;  7ICE A;  5KFC A;  3MFI A;  1U47 A;  1RPL A;  3PST A;  2ESE A;  3QUQ A;  8ICV A;  2FMP A;  4DO9 A;  3ZDC A;  2A3V A;  3PX0 A;  1N60 A;  2RDJ A;  1ZOL A;  2ZG6 A;  1YT3 A;  4UB8 U;  5ALS A;  8ICO A;  4JK1 A;  9ICJ A;  7ICI A;  2AU0 A;  4J9K A;  4Y2X A;  3T79 A;  4C4S A;  4ECR A;  3R9K A;  1X9M A;  4C7Y A;  1VDV A;  2KJ9 A;  4TUS A;  2IOF A;  4RZR A;  4I2H A;  4J9N A;  2YN4 A;  3BQT A;  2XCA A;  4DS4 A;  3N97 B;  5L1I A;  2GO7 A;  3I76 A;  2R8K A;  1Z4O A;  8ICS A;  4FZM A;  3QX7 A;  3PSI A;  4F72 A;  2EZX A;  5ALX A;  2QLT A;  3H40 A;  5AKZ A;  5KT5 A;  2D8C A;  4EX6 A;  4GXI A;  3T5J A;  2F3N A;  1L3V A;  5AKH A;  4M9H A;  1QQ6 A;  2K8C B;  3SZ2 A;  7ICV A;  2KKV A;  5KFT A;  4F4Z A;  2C2D A;  4M9J A;  3PW2 A;  5HML A;  3UMB A;  4AYB F;  2GH1 A;  5TIS U;  5ALH A;  3RAX A;  4OD0 A;  1L3U A;  1DK2 A;  4M04 A;  3ZD9 A;  5AKX A;  4DSJ A;  5KFW A;  3GDX A;  3TAQ A;  5KFZ A;  2G5I B;  2Y1J A;  3ORY A;  2WF8 A;  3FM9 A;  3E58 A;  3RF9 A;  2BCR A;  1NJZ A;  2F1I A;  4UB4 A;  1ZRM A;  2Q4T A;  2PI5 A;  5J8Y C;  3F53 A;  4C8K A;  2BCS A;  1KL9 A;  4IRC A;  2A19 A;  3LK9 A;  3MBY A;  3KZX A;  3AQE A;  4P0P B;  2V4Q A;  2K89 A;  4EZ9 A;  4F92 B;  1ZQ1 C;  4KLL A;  3H7I A;  4DFM A;  2GOL A;  1XC9 A;  1XWL A;  4U6P A;  9ICO A;  4RQ4 A;  3QEA Z;  3PX4 A;  2BPG A;  4DS5 A;  5AKI A;  2LMR A;  4YXJ A;  2CPR A;  5HR7 A;  3O0F A;  5KFG A;  4MEX A;  5AM3 A;  5KT4 A;  1SWW A;  1Z19 A;  2I5H A;  1MN8 A;  3D2Q A;  1BPZ A;  2PFQ A;  5EE9 A;  4QIW C;  5KFM A;  1N5X A;  1PZN A;  4ED3 A;  4E0D A;  3BZK A;  2K4P A;  4ED8 A;  3HJE A;  4I2F A;  4DLE A;  3B9J A;  2JXJ A;  8ICT A;  1OXJ A;  4BGD A;  4XA5 A;  2F8K A;  3JPQ A;  2KK0 A;  5EE0 A;  2W9B B;  4DOA A;  2EAP A;  1SB3 C;  2E5S A;  1F0M A;  4DSE A;  1IIP A;  2AGQ A;  4KLS A;  4JV0 A;  4OJP A;  1SL0 A;  2O6K A;  1D8L A;  5IIJ A;  1X6J A;  5AKL A;  1ZQL A;  3RJJ A;  4P4M A;  1ZQO A;  8ICN A;  1RYR A;  2QB1 A;  4ED1 A;  4NLN A;  5J2G A;  4DSI A;  4LVS A;  2WF7 A;  2R8J A;  9ICG A;  5ALN A;  1Z1B A;  1KRP A;  5ALJ A;  3SYZ A;  4BUG A;  3JPT A;  2KFN A;  2W43 A;  2E8P A;  1ZQZ A;  1ZQE A;  4Z6D A;  3KTQ A;  4I2J A;  2MU2 A;  3THV A;  4AYB C;  3NVW A;  1T8E A;  4PHP A;  2CRX A;  2E8M A;  2YML A;  4R65 A;  2OXO A;  1L7P A;  5DBA A;  4F5O A;  1UT5 A;  5AI6 A;  3UQ0 A;  4ECU A;  1NKB A;  2G5H B;  1K5O A;  3IHQ B;  3MR5 A;  2HHQ A;  1S0M A;  3K1R B;  3NVV A;  1NK4 A;  3ETL A;  1IG6 A;  2BPC A;  1B43 A;  2BHN A;  3HP6 A;  3CP8 A;  3ZD8 A;  4LZG A;  2C2R A;  4JB3 A;  3NRW A;  9ICW A;  3QU2 A;  9ICP A;  3MAB A;  2IA6 A;  4YG2 A;  4AP9 A;  1ZQS A;  3PZP A;  2KV2 A;  1J2N A;  2PKE A;  3NAS A;  1K1Q A;  5C5J A;  4DEZ A;  2GLE A;  4C8L A;  1ED1 A;  2ZIU A;  2KIC A;  4Q8F A;  2KJ5 A;  4CRX A;  3JPO A;  4P4O A;  1JMS A;  4FZL A;  3MC1 A;  3AL0 B;  5KFE A;  2A1A A;  4QZD A;  3V7L A;  3TAN A;  3RB4 A;  4O3N A;  4JMU A;  4C4T A;  2K4E A;  9ICM A;  4F2S A;  3QNM A;  3A0B U;  2KOB A;  4CF3 A;  2G06 A;  1EXN A;  5AM2 A;  2W3S A;  4RQ1 A;  7ICO A;  2ZIV A;  5AIB A;  4F2R A;  3GV8 B;  2ISP A;  3TAD C;  4C8O A;  2W9C B;  2L5Y A;  2JEJ A;  4B9N A;  3PML A;  3PSP A;  2HOQ A;  1SXD A;  3PX6 A;  4IRD A;  4NLC A;  4KLT A;  3RR7 A;  2UVV A;  1ZQY A;  2HHW A;  4OJO A;  3M9N B;  5L1K A;  1ZQM A;  4DL3 A;  2JRZ A;  4ZH4 A;  1SKS A;  3NGD A;  2F44 A;  4IR9 A;  4YQW A;  2ZIW B;  3PW7 A;  4PGQ A;  5AIA A;  4UBB A;  7ICN A;  1ZJM A;  5K4L A;  3QUB A;  8ICI A;  4NV0 A;  4UAW A;  5KFO A;  2RP5 A;  3C2M A;  2XY7 A;  4M9N A;  4TQR A;  1ZD4 A;  2W9A A;  3PO4 A;  5JRT A;  2FI1 A;  5KG3 A;  2F77 X;  1V9P A;  3OHB A;  1NK9 A;  3TFR A;  5J29 A;  5GTI U;  2NRX A;  4EZ6 A;  5J8Y A;  2KVC A;  4KLU A;  1L5U A;  3M6K A;  2E1E A;  3RAQ A;  2Y0S C;  5L1L A;  1ZQX A;  4Z6E A;  4RQ2 A;  1XS9 D;  1Z00 A;  3TQ1 A;  1X9X A;  4P0Q A;  1NJW A;  3UXN A;  2KZM A;  5HMM A;  2BDP A;  4IQW A;  2QAR B;  5DLF A;  2DGZ A;  5EE1 A;  1ZQN A;  5KG7 A;  1XNS A;  4YCX A;  4I28 A;  5AI8 A;  2C28 A;  2FPK A;  4F5N A;  4ECW A;  2KKP A;  4M2Y A;  3MR6 A;  7ICT A;  3H8S A;  3BS5 A;  4PZN A;  2DWQ A;  2JH7 A;  1N56 A;  9ICI A;  4B9S A;  2H3Q A;  3HX0 A;  2ZUC A;  5KL8 B;  5J0Q A;  3OJS A;  2HDO A;  4MF8 A;  4DQR A;  4Y2S A;  1SKW A;  3JPS A;  2AQ0 A;  3C2K A;  1S76 D;  2KEY A;  4KN7 A;  3PV8 A;  3B0X A;  1NJY A;  1TK8 A;  2YY6 A;  1ZQV A;  1YZ7 A;  3WK6 A;  2XGP A;  3SI8 A;  5KFR A;  1HIW A;  4JWM A;  5AK5 A;  4DQP A;  2WB1 F;  3RBE A;  2DQN B;  1SXE A;  4J9M A;  3KKA A;  8ICM A;  1F44 A;  3N4M B;  4XUS A;  2MAX A;  1CI4 A; 
#chains in the Genus database with same CATH homology
 1RG6 A;  2K60 A;  2KSO A;  2Y9T A;  2QB0 A;  1SV0 A;  1B0X A;  2QB0 B;  2KSO B;  2EAM A;  4RQM A;  2GLE A;  3H8M A;  1SGG A;  1OW5 A;  5JRT A;  2QKQ A;  1PK3 A;  1WWU A;  2EAO A;  2K4P A;  2LPE A;  1V85 A;  5J8Y A;  4NJ8 A;  5F3X B;  1OXJ A;  1SV4 A;  2F8K A;  2E8O A;  2Y9U A;  2D8C A;  2EAP A;  3TAD A;  2KG5 A;  2KE7 A;  2F3N A;  1X9X A;  1F0M A;  2JV3 A;  2DL0 A;  3BS7 A;  1JI7 A;  1UQV A;  2B6G A;  3SEN A;  2QAR B;  5JU5 A;  1V38 A;  3IDW A;  4MHV A;  3BS5 B;  1LKY A;  1KW4 A;  1PK1 B;  2QB1 A;  2DKZ A;  4NL9 C;  1PK1 A;  5JTI A;  3TAD C;  3BS5 A;  4PZN A;  2E8P A;  5L1M A;  1UCV A;  1COK A;  2L5Y A;  4IS7 A;  3BQ7 A;  2E8M A;  1SXD A;  5J8Y C;  4PZO A;  1DXS A;  2YTU A;  1LKY B;  2EAN A;  3K1R B;  4NL9 A;  3SEI A;  1B4F A;  2ES6 A;  5KNI A;  2QAR A;  1SV0 C;  2E8N A;  4RQN A;  1Z1V A;  2F44 A;  2KMD A;  2DKX A;  2ESE A;  2KIV A;  2FE9 A;  1SXE A;  3KKA C;  2D3D A;  3KKA A;  2LMR A;  1X66 A;  1X40 A;  1WWV A;  3TAC B;  3HIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...