4RQMA

Crystal structure of the semet bicc1 sam domain r924e mutant
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
KGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKMLLAISELNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein bicaudal C homolog 1
publication title Characterization of the SAM Domain of BICC1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 19
structure length 63
sequence length 63
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4rqmA01
1V38A 4RQNA 1Z1VA 1LKYA 1X66A 5J8YA 2B6GA 2YTUA 1UCVA 5F3XB 4IS7A 2E8NA 1WWUA 2D8CA 2JV3A 2E8OA 4RQMA 2EAPA 4NL9A 1COKA 2Y9UA 3BS7A 1LKYB 3IDWA 3TACB 1JI7A 2LPEA 1SGGA 1SV0C 2F3NA 2EAMA 1OXJA 3BQ7A 3H8MA 2F44A 1OW5A 3K1RB 1WWVA 3BS5A 5J8YC 3SEIA 1B4FA 2ESEA 1UQVA 2K60A 2EANA 2KSOA 4NL9C 2F8KA 3BS5B 1X40A 2KSOB 1DXSA 1SV4A 4PZOA 2GLEA 1V85A 3KKAA 2QB0A 3SENA 5JU5A 1X9XA 2E8MA 3TADA 2QARA 2LMRA 2KE7A 1PK3A 2QB0B 1RG6A 2QKQA 5L1MA 2KIVA 2KG5A 1SXEA 2FE9A 1PK1A 2DKXA 2DKZA 2QARB 1KW4A 2E8PA 4NJ8A 5JTIA 5KNIA 4MHVA 1B0XA 1F0MA 1SXDA 2ES6A 3KKAC 2K4PA 5JRTA 1PK1B 2KMDA 2D3DA 2EAOA 4PZNA 3TADC 2L5YA 2Y9TA 2DL0A 2QB1A 1SV0A 3HILA
chains in the Genus database with same CATH superfamily
4RQNA 1IIPA 2ODGA 2MUTB 1TAMA 1ZQ1C 4C8MA 4DL2A 4P4MA 4JB3A 1WCNA 4J9MA 3QUTA 4KTQA 4JMUA 1NK4A 2JV3A 4PGQA 3EWAA 3HJEA 1RZTA 4YR0A 1AROP 3V6KA 4OD0A 3KFUF 1D8BA 4F2RA 4IL6U 3NGDA 9ICMA 2K4HA 3G6VA 3CP8A 2JMGA 1ZJMA 3K1ZA 1QSYA 2XCAA 4YD2A 1QTMA 4DQQA 2J6UA 4DFMA 4I2GA 3BS5A 5IIKA 2ISOA 1K1SA 2BQ3A 1CEZA 5AI5A 4P4OA 3PX6A 2PMZF 1DRGA 1Z4OA 2F8KA 4BWMA 2A1JA 4Y2TA 8ICFA 5DBCA 5F9LA 2ATLA 1XSNA 4FO6A 1X9WA 3D2QA 2Y1JA 4PHAA 2BR0A 4C8LA 2A3VA 3BZCA 4M2YA 3HKZC 3WK8A 4KLFA 3Q8LA 4F5NA 3PMNA 4ED8A 3SAFA 5EWFA 5DB7A 4Q8FA 4C80A 1SXEA 2JEIA 2DKXA 1KTQA 3F53A 1HUZA 5JTIA 9ICVA 4C4RA 4ECXA 7ICHA 5EE0A 2C2RA 1TE2A 2W7PA 2KZ3A 5HNKA 3MR2A 4UW9A 3V7KA 3PX4A 1MN8A 5ALWA 3CRXA 1FIQA 3IP4B 1U4BA 3L3FX 3TFSA 1X66A 4YP3A 4KLIA 3GIJA 3V7LA 4NL9A 5J2KA 4KLUA 1COKA 4UQGA 1S10A 2EQYA 4M9NA 1M6YA 4ECUA 1S76D 5ALLA 4US8A 4DQIA 1U49A 3N28A 4TUSA 4KLDA 4F72A 3H0RB 3F5AA 2ZXIA 3BJYA 2HHQA 5ALGA 1JXEA 4IRCA 2NRTA 2D6FC 3IM1A 4M9GA 7ICRA 3PO5A 1BVSA 4QZHA 2HOIA 2KSOA 3B9JA 4EBDA 4NL9C 2KJ8A 3SZ2A 3RR7A 4J9PA 4Y2VA 4BGDA 4UBCA 2K8AA 1SL1A 5AKJA 1U47A 2PI4A 4ED3A 1CUKA 4UATA 5AI6A 5JU5A 1N62A 2I9GA 7ICVA 2HCFA 2XIDA 3JPPA 4OJLA 1RQNA 3F2DA 2BQRA 3BQ2A 5ALZA 3OJSA 2KZZA 4QZ8A 3E2EA 2ZIWB 3C1ZA 2KG5A 7ICLA 5J2EA 3RJJA 5J2IA 2BQUA 5EWGA 2JRZA 1ZQSA 1KFDA 1L7MA 2Y0SF 3C23A 3RFAA 3EPIA 4MF2A 4DFDA 2DF4B 4I27A 4NLKA 2NRWA 1V38A 2KIWA 3QZ8A 2HMXA 4I2BA 3M6KA 1X2IA 4QIWC 3AU6A 2KN7A 1NKCA 4Y2YA 3PSFA 4Z6CA 5DBAA 3QX7A 2UVRA 4F5OA 4I29A 3ISCA 4AYBF 5EWEA 3RB3A 5KT4A 4Z6FA 4UASA 4Q43A 1WUDA 1Z19A 3WK6A 4RPZA 2H3VA 2ZUBA 1JUDA 1F44A 4R65A 1KLNA 3AU2A 2WB1C 3D6JA 2BPCA 4IQWA 1JN3A 1ZQVA 3V6HA 9ICXA 4DQPA 5FP0A 3UXNA 4J9KA 7ICMA 2VA2A 2A1AA 4LZDA 2XC9A 5L1IA 3MGVA 2JH7A 4I2DA 2KZMA 2XO7A 8ICYA 1X6JA 4KLQA 1X6IA 3PSIA 5AIBA 1ZJNA 3C2LA 2EH9A 2V9WA 2HHVA 1JALA 1JROA 2YMQA 4O9MA 1VLBA 3C1YA 5AKKA 1ZQHA 3M1YA 4DFPA 1QLNA 3JPQA 4F4YA 3JPNA 1Q3UA 7ICFA 5HHIA 5J2JA 1ZQKA 3UQ0A 1S0OA 1X9SA 3UQ2A 4J9LA 4LJXA 1URJA 1ZQIA 2KHVA 1SB3C 4YG2A 5HMMA 2OYYA 4EZ9A 3ZDBA 5AICA 4I2FA 1NK8A 4NM1A 5ALSA 2AQ4A 4J9RA 3SV4A 4U7CA 4Y2QA 3K75D 4RUCA 4ED0A 3MR6A 2C2DA 4C7YA 5HR7A 5J8YA 5DQHA 4I2AA 3IRUA 2OHFA 2K89A 5KG2A 5J0SA 1Z1BA 4NLCA 8ICKA 1KBUA 3MABA 4PJ0U 4RQMA 8ICBA 4I2JA 4KLSA 2AH5A 5AI4A 4CF4A 4RPXA 1LKYB 4B9UA 1JI7A 4YR2A 5KFXA 1RQLA 3U26A 9ICBA 2C22A 2GH1A 2Q4TA 3RB6A 3RAXA 4RU9A 4UB3A 3NS1A 5J8YC 3SYZA 4EZ6A 2PKEA 2ESEA 4CDGA 3IG8A 1RPLA 3ETLA 3MR3A 3MGHA 4X5VA 4F2SA 2RLTA 4EELA 8ICSA 2DGZA 2AJQA 9ICHA 2JHDA 5AHXA 1ZQXA 4ECSA 2C28A 5KFZA 4QZ9A 2JEGA 2ZIXA 3G6XA 2BGWA 4KLGA 4UB8U 4ECYA 4MEYA 2GLEA 2AU0A 1Q3VA 2WAQF 2JR5A 3E0FA 4RUAA 5J2FA 3TADA 3MR5A 1NNLA 2FI1A 2HHXA 5DG7A 5JUMA 3RBEA 2QB0B 2KIVA 4F93B 1QSSA 1K5OA 2KK0A 2FLLA 3NASA 1ZETA 3BZKA 2E8PA 4DSKA 3PV8A 4DS5A 1B0XA 5H2FU 2K4PA 4QWCA 3GV8B 5KFTA 3LWMA 3PR5B 2OEHA 3TADC 4KX5A 4Y2XA 2CXYA 3WKBA 2DL0A 3H8WA 3FDSA 3KTQA 2VANA 2M9NA 3H0MB 5D4BA 4Q45A 3Q8MA 1N56A 1RM6C 5KG7A 4IS7A 2E8NA 9ICCA 1CI4A 2FLPA 4GIBA 2OWOA 5DGAA 2BHNA 3N7SC 1IM4A 4QWEA 4QWBA 1C7YA 1BPEA 5KAFU 3M9OB 5EE3A 4F8RA 1HJPA 3M9MB 3RBDA 3OSNA 1XO1A 3QE9Y 1S0VA 4DL7A 1BGXT 1NKEA 3SMVA 1B4FA 4UB5A 5KG0A 4ED6A 5TISU 2P35A 5ALVA 3SAHA 5KFBA 3MDCA 5EOZA 5GTHU 3BDPA 9ICJA 1X40A 4KLHA 5ALNA 4PHPA 1UA1A 3C21A 2HHSA 3T5JA 3SAGA 2PMZC 5F9NA 4R8UA 2JXJA 4QW9A 4C8KA 5DG9A 2KD1A 2VIXA 3RTVA 2HBLA 2QKQA 2VA8A 3LDAA 4RT3A 2YMMA 2QARB 4M9LA 2UVWA 4B9NA 4KLJA 3H40A 2N1RA 2LM1A 4C0ZA 5KFRA 3RB0A 5KNIA 5KT2A 1YT3A 4MHVA 4C7ZA 4O5KA 3A0BU 3QEBZ 1D8LA 5KT3A 1T8EA 4DSFA 3NVWA 2L5YA 3M8SA 1TFRA 1ZQJA 2JEJA 5HMLA 3IN5A 3HX0A 1IG6A 4YVZA 2KNJA 2H3ZA 3E58A 3KBBA 3Q8PB 3T79A 3TAPA 1UHUA 5DDYA 3V6JA 2IHMA 2ASLA 2FMPA 3ICXA 1ZQOA 1MQ2A 1KFSA 4YD1A 1SGGA 3L4PA 1JX4A 4F3OA 2EAMA 4NM2A 3TFRA 3TKAA 1NK9A 5J2CA 2ZUCA 2ZG6A 2ISPA 4BJQA 4J9SA 4KX3A 4BXOB 5KAIU 4RNOA 1SKWA 1ZQLA 4GFJA 1DK2A 1B43A 4NXZA 5DQGA 3NVVA 4J9OA 4O3NA 3WK4A 3PW5A 4IRDA 1HEKA 4M9HA 1X9XA 4QZEA 4DEZA 2HBJA 4ECRA 1TK5A 5CR0A 5AM1A 4NWIA 3OJUA 5L1MA 4IQTA 4O5EA 1FEZA 1IV8A 2JGAA 3MFHA 2VJ5A 1F5SA 2W8KA 2K4IA 3AQEA 2HBMA 7ICJA 2W9BA 4FBTA 1F0MA 5BOMA 5AM5A 2MUTA 3TANA 4J9QA 5KFLA 2HBKA 5KFDA 2W8LA 3RJKA 4MEXA 1OUQA 4R66A 3T3FA 3SQIA 3QNMA 5DB9A 4O0IA 3PX0A 2R8JA 1L3SA 3SR6A 2HHTA 5HP4A 2GOLA 4DSLA 1UCVA 4F5RA 3RR8A 1FFVA 1SZHA 2I5HA 5B66U 4YMNA 2M0NA 2Y9UA 1ZYQA 5KFNA 2KVSA 1DGJA 3GV5B 4YXJA 2LBOA 2W04A 4RQ8A 4DQRA 1XWLA 5AI9A 4QZCA 1PZNA 3T5LA 2ASDA 4B9SA 5ALDA 3LK9A 2RQ5A 1D8YA 2DWQA 3G6YA 3T5KA 2EANA 1U48A 1XNSA 2P6UA 9ICFA 4BUGA 4YQWA 3AN1A 3LVVA 5KFOA 3I1YA 2F2AB 4OJOA 1XU4A 5CJ7A 2YN4A 3NRZA 2YQEA 2XY5A 4DOBA 4DL5A 2RRDA 5G5HA 5J2BA 1ZD5A 4DS4A 4DFJA 2G5HB 5KT6A 1RYSA 2KE7A 4I2CA 2ZTDA 3AMZA 2XICA 2FDRA 1MC8A 2HHUA 2ZIVB 2OM6A 4Y2UA 4ELTA 5AKXA 3HWTA 9ICEA 5J0UA 1B22A 3AQFA 1TV9A 4R64A 4NJ8A 2FMQA 5AKZA 5L1JA 2BCSA 4B9VA 1Z4NA 2LYHA 3RJEA 4F50A 1BPXA 2BCUA 1DK3A 1SZPA 4QZGA 3ETRA 3UMGA 2PI5A 4Z6DA 2XY7A 4FFDA 4OJ6A 2D8CA 5KL1B 5ALJA 4PHDA 1Q46A 1KDHA 3NVZA 2KTQA 5EE9A 3ZDEA 1NKBA 1NK0A 1IXRA 4FBUA 2LPEA 5KL8B 4OJ5A 1SL2A 4Y2PA 7ICSA 1OXJA 4TQRA 4XQ8A 5DBBA 5ALPA 2Z7JA 5TZVA 3ZD9A 7ICGA 5ALIA 2W55A 4Y2RA 4EBCA 1ZQUA 4RQ1A 1ZQGA 2K60A 2PFOA 4NLZA 3NTUA 2IBKA 1SIJA 3H0LB 2K4EA 1L3UA 4CNQA 1DXSA 4R63A 1BNOA 2I1QA 8ICHA 2RP5A 2ZIWA 3AUOA 2FLNA 4F91B 2E8MA 1U45A 3PVXA 5ALTA 5BOLA 5J0RA 4UAZA 2CRXA 4PL1A 4TUPA 4YCXA 1D9DA 3EPGA 2WF5A 4PHEA 4NY8A 2ZJ5A 2KEYA 1QQ7A 1RDFA 2G0AA 5L1KA 3JPRA 3K4GA 2NRZA 3HP6A 2WAQC 4JWNA 2ES6A 1NK6A 4UB2A 1PK1B 4PZNA 7ICPA 1J2MA 1P7DA 1QQ5A 2Y9TA 3MC1A 7ICKA 3F5EA 1NI3A 5AK5A 4XA5A 2AGOA 3S6JA 4DFKA 3VCBA 4QNLA 2WF9A 2HHWA 5KFUA 5KFWA 3TAQA 5J0QA 1NJWA 5AM4A 2XVTA 3PMLA 3PW4A 2IOHA 5KFFA 5L1LA 5J29A 5KFSA 4I2EA 2MAXA 4DLEA 3GIKA 2A19A 2WTFA 3GDXA 4BDPA 1L3VA 5KT5A 2XY6A 5KTQA 4Y2JA 3H8JA 3OHAA 5KG3A 8ICXA 5IIMA 1N48A 1H38A 3QXGA 3WU2U 2G08A 4CF5A 3RH6A 5IIOA 3K1RB 3DDHA 2W9MA 1KL9A 1JRPA 2VJ4A 4GC6A 4IRKA 1ZQYA 2KICA 1Z00B 4UBBA 3MDAA 4RZRA 8ICLA 5DQIA 4FS2A 5AKLA 4MFAA 4USAA 4O3QA 4DL3A 2PFNA 4QZDA 2JZBB 2YB1A 5HHHA 3GQCA 2CN1A 5IILA 5AK3A 9ICLA 3R9KA 4GXKA 4P0QB 2VA3A 3RB4A 4FS1A 2W03A 5DG8A 2MRLA 4JV0A 5AM0A 2G06A 2W3SA 2BCRA 1Q8KA 1KW4A 1N60A 3GIMA 4CCHA 2ASJA 4QZFA 1ZRMA 3NRWA 1SKSA 2B21A 2BPFA 4A8EA 9ICOA 3B0YA 4O3OA 1UA0A 2D3DA 1PVPA 2FJ6A 3TI0A 4ELVA 2EDUA 5DB6A 4CGZA 2AGQA 3JPSA 3IG5A 5J2HA 9ICKA 5B5EU 3QU7A 1LKYA 5F3XB 5KFEA 2DUYA 1ECWA 4PH5A 1Z00A 5KFQA 3LWLA 3D2NA 1XSPA 3PSPA 3UXOA 1QH9A 1X9MA 1LVHA 1U9LA 4DCCA 1ZQWA 4Q44A 3NUQA 5ALHA 1XS9D 4RNMA 1SWWA 2LI6A 1TAUA 2R8IA 4MFFA 1ZQPA 4KLLA 1Z3EB 3PY8A 4J03A 2YB4A 3SI8A 5KG1A 2H3QA 1UT8A 4UARA 3C29A 4DF8A 5KFVA 1WG8A 3NVYA 2DPJA 3CYMA 2BZFA 1XSLA 5A0LA 4FZLA 2BCQA 4IC9A 5IIJA 3ZDAA 2ZIUB 1N5WA 5KG6A 4EEKA 3MBYA 3KHGA 2HOQA 4YXMA 3N4MB 1XO0A 2BCVA 3L5KA 2B0CA 3QYPA 9ICWA 3CNHA 2UVVA 2F1HA 2CPRA 5ALRA 3KKAA 2QB0A 2YY6A 1TKDA 4CRXA 4UAUA 4OO1J 3LYSA 3M8RA 2P66A 2E1FA 1RYRA 4EENA 4PL2A 4M6WB 2EZYA 2BKEA 2XGQA 2HOFA 5T14A 4QZAA 1BNPA 3N7PD 1ZQBA 1KEJA 5KFIA 1O03A 4EX6A 1SL0A 3KKAC 4UB1A 2F8LA 5JRTA 1NJZA 2EAOA 3I76A 3KHRA 2PFQA 1NK5A 5AIAA 3ISDA 7ICUA 4DO9A 1N61A 2F1IA 2W9CB 1ZD4A 1ZD3A 2ZIUA 3A0HU 2AGPA 4DWIA 5GTIU 2YTUA 4LVSA 1QQ6A 1KSPA 8ICZA 3KZXA 3IV6A 2EAPA 3QU5A 3T5HA 2FPMA 1A6SA 2KFNA 1KRPA 2IOFK 3QUBA 3H7IA 8ICJA 4NV0A 4EYIB 5J0XA 3BQ7A 2RDIA 4B6JA 2H3FA 3ORYA 1J97A 1V9PA 1L7PA 5KG4A 3FC4A 1UQVA 4JWMA 4M6WA 1ZQMA 2V4RA 2DPIA 1EXNA 4RQ6A 3SV3A 2KHQA 3BS5B 9ICUA 5ALYA 2LHTA 2RDJA 2MA1A 3V72A 3N97B 5J0YA 3C2KA 3FM9A 1WYGA 5G5GA 3HT3A 1ZQZA 1V85A 3B0XA 4F92B 4KLOA 4K4HA 4KMUA 1KN5A 3MGIA 1NK7A 4IR9A 4CE6A 2RHFA 5J2GA 5CRXA 2QARA 3ISBA 3PNCA 1PVRA 7ICOA 1A77A 4QW8A 9ICRA 1N5XA 5AK6A 3ZI4A 3H8SA 4YR3A 3GU3A 1UPHA 2XI9A 1RYUA 2NRVA 5KFHA 8ICEA 4CF3A 8ICGA 1TVAA 3M9NB 2WFAA 1ZQNA 8ICMA 2ZTCA 2WF8A 1A76A 1ZOLA 4RQ2A 3ED5A 1Z1VA 5KFGA 2K8BB 4RQ7A 5AKIA 4MF8A 3QU4A 4P4PA 1ZQQA 1T3NA 4F71A 2FMSA 8ICOA 4O3SA 3IDWA 5AKYA 4XUSA 3EUB2 2JEFA 3THVA 1BPBA 2ZJAA 4P2HA 3RRGA 4BXOA 1Y88A 4YMMA 3RAQA 3H8MA 4ZOHC 2I6XA 2W7OA 2KFZA 8ICCA 3UXPA 4YMOA 2JH1A 3LVWA 3ALRA 4DSJA 1JIHA 2W3RA 2KV2A 3QU2A 2Y0SC 3TARA 5ALFA 4OJPA 2WF7A 3O0FA 3QUCA 9ICSA 2E3TA 3DEEA 1ZQEA 3F2CA 2KSOB 8ICIA 2MU2A 1GO3F 4NLNA 4RQ0A 3JPOA 2QLTA 4O3MA 3TQ1A 1N2XA 1SKRA 3GV7B 5BPCA 4FZNA 1SWVA 5CB1A 2YMPA 4AYBC 1QCKA 1ZRNA 3D2SA 2OXOA 1PK3A 1RG6A 4EBEA 2DKZA 2W9AA 2LKYA 3J81j 4JV1A 5K4LA 1LB2B 1JXLA 4ICAA 3FAHA 1S97A 5EE1A 3JPTA 2NO4A 7ICEA 2KMDA 5ALUA 4UAWA 5L9XA 2QB1A 3RH5A 4B9MA 1NZPA 3RH4A 4PPXA 2HW3A 3C5FA 5AKGA 3F2BA 7ICTA 3WK9A 1LV5A 3ZDCA 3CW2C 2DQNB 2ZTEA 2R8HA 1KFTA 3PZPA 5ALKA 4P0PB 1S77D 4QWDA 4I28A 3Q8SB 2R8KA 1S5LU 1MSWD 1VDVA 5ALQA 3EYZA 2V4QA 4G9BA 3RJHA 5IINA 1L6NA 3M7DA 4E0DA 5AK4A 3GFKB 5KFKA 4K4IA 3HKZF 5KT7A 5J0PA 4ACOA 5C5JA 1TK8A 3WK7A 4GXIA 1L8LA 1XC9A 8ICWA 3HW8A 3BQTA 4KLMA 1S8OA 4KLTA 4HAIA 3OHBA 3ZDDA 3Q8RB 4DL6A 1L7NA 2ZIVA 9ICAA 3UPQA 3SD7A 1CRXA 4ZH4A 4US9A 3M6ZA 2LMRA 2KVCA 1MA7A 3RJFA 1ZQDA 3KD3A 3PW2A 2GWSA 4ED2A 5D46A 4C4SA 4Z6EA 4DLGA 2XGPA 3QU9A 4NLGA 4J9NA 5AI0A 4I2HA 1COOA 2BDUA 4P0PA 4GLXA 9ICTA 1O08A 2R18A 4BX9C 8ICVA 1SXDA 3OTQA 4I2IA 3I28A 5DDMA 1UT5A 4RNNA 4QWAA 5ALEA 4C8OA 3V7JA 2XCPA 4AP9A 5CP2A 1YZ6A 2AHOB 2H5XA 4UAVA 3WK5A 3PW7A 4LZGA 1WWUA 2HI0A 4KITB 2E8OA 5AKEA 1A0PA 2F1JA 5KFCA 4C8NA 5J0WA 5AI8A 2G09A 3TACB 4DSIA 3GIIA 2NRXA 1YZ7A 1NZBA 4M47A 2KJ9A 2LYBA 3PSTA 2KKVA 1WWVA 4K4GA 3SEIA 2F77X 1L5UA 4ECZA 3AEVA 1AQ6A 1K1QA 4EEYA 4JUZA 5KFPA 2KP7A 1N63A 2W11A 4TUQA 1S0MA 2OH2A 2MSNA 3KOOA 5KFAA 1NJXA 3KHLA 1KKXA 3WKDA 4XRHA 4ELUA 8ICAA 2KKPA 1TAQA 3GZFA 3UMCA 3H4DA 1FFUA 4JV2A 4Q8EA 4QZBA 4F4KA 2ZIXB 3ZD8A 2O6KA 1NJYA 5KFMA 4C4TA 2DFLA 4ECTA 3GILA 5J0OA 2OCEA 4ECWA 2G5IB 2FE9A 3QEAZ 1PK1A 7ICNA 2K8CB 5D49A 2W43A 4QIWF 4RPYA 2J6SA 3UM9A 1KQQA 1HUOA 1J2NA 4QZIA 1BPZA 2WHEA 5ALXA 3RJGA 5J0TA 8ICUA 2IOFA 1JMSA 4G3IA 4KLEA 1NOMA 4KN7A 5DKWA 9ICIA 3WKAA 1V97A 1ZQCA 4PGYA 5KG5A 1BPYA 1SV0A 3AM9A 1ZQRA 3HILA 1ZQTA 1C20A 3Q8KA 4F4WA 1ZQFA 2FPKA 2C2EA 4TURA 2WB1F 3BQ1A 1TK0A 2WF6A 5HR6A 4EX7A 1L3TA 1PUZA 4M04A 4O3PA 8ICQA 2GO7A 4ED1A 5J2AA 5IIIA 1S0NA 1L8OA 2NV3A 8ICNA 3N7RC 4UB6U 4UAYA 5KFYA 4GXJA 9ICNA 1SV0C 2F3NA 2ZJ8A 1ZXIA 1T94A 3HPOA 2F44A 4F4ZA 3HRDD 2HVIA 4Y2SA 1T4GA 3PR4A 4FZMA 1ZQAA 2J6TA 2R8GA 4YN4A 1BPDA 2JZBA 1MQ3A 5AKHA 4RQ3A 1DGSA 5DB8A 3C28A 8ICTA 4WJ3B 4YFKA 3OPXA 5KFJA 4P0QA 5ALOA 3RRHA 2UVUA 3C5GA 5CEHA 4BWJA 5DLGA 2ZXHA 4DOAA 1D9FA 2LM4A 1HIWA 4ED7A 2DBYA 5CWRA 3OSPA 2FPLA 4F5QA 2LYAA 4IQUA 3VC8A 2BDPA 4R8UB 2KJ5A 3EZ5A 5ALMA 2IHNA 4B9LA 5J2DA 3KHHA 2YX8A 4O3RA 4DL4A 4DQSA 4KMOB 2F76X 3H4BA 1ED1A 2IA6A 4JK1A 1ZD2P 3IHQB 4MFCA 2EZZA 1VJ5A 1RXVA 3DV9A 2B6GA 2HSZA 1WCLA 1QSLA 9ICQA 4DSEA 4U6PA 2IMWP 2HDOA 1L7OA 4TQSA 3Q8QB 4HYKA 3BS7A 3RF9A 3QZ7A 2Y1IA 1FO4A 7ICIA 4RT2A 2VKQA 4M0AA 2W54A 3BQ0A 3UMBA 4KN4A 4NLBA 4O5CA 1OW5A 4DF4A 4GC7A 4IR1A 1PVQA 2ALZA 5DLFA 1T7PA 5C0YA 5E79U 3AL0B 4DOCA 3ONNA 1X42A 4F4XA 4RQ5A 4PGXA 5AM2A 2ZUDA 7ICQA 1DOQA 2HVHA 9ICPA 4RQ4A 2PFPA 3MFIA 1SV4A 4PZOA 5CA7A 4ECVA 4F5PA 2Q0ZX 3WKEA 2E1EA 2H3IA 3SENA 3QUQA 5CHGA 2E5SA 2YMLA 5DGBA 4IQVA 2NO5A 4FE3A 4EYHB 3KZIU 3WKCA 2NYVA 4OCZA 3PO4A 8ICRA 3FYHA 4ECQA 1RXWA 1T3QA 3EW9A 3OGUA 2BPGA 2AQ0A 8ICPA 3PW0A 9ICGA 2G07A 4QJFB 5AM3A 4B9TA 2A1JB 2AXTU 2W9CA 3RJIA 2EZXA 1S9FA 2PXIA 2P6RA 3C2MA 4UB4A 4M9JA 2KOBA 2W9BB
chains in the Genus database with same CATH topology
1V38A 4RQNA 1Z1VA 1LKYA 1X66A 5J8YA 2B6GA 2YTUA 1UCVA 5F3XB 4IS7A 2E8NA 1WWUA 2D8CA 2JV3A 2E8OA 4RQMA 2EAPA 4NL9A 1COKA 2Y9UA 3BS7A 1LKYB 3IDWA 3TACB 1JI7A 2LPEA 1SGGA 1SV0C 2F3NA 2EAMA 1OXJA 3BQ7A 3H8MA 2F44A 1OW5A 3K1RB 1WWVA 3BS5A 5J8YC 3SEIA 1B4FA 2ESEA 1UQVA 2K60A 2EANA 2KSOA 4NL9C 2F8KA 3BS5B 1X40A 2KSOB 1DXSA 1SV4A 4PZOA 2GLEA 1V85A 3KKAA 2QB0A 3SENA 5JU5A 1X9XA 2E8MA 3TADA 2QARA 2LMRA 2KE7A 1PK3A 2QB0B 1RG6A 2QKQA 5L1MA 2KIVA 2KG5A 1SXEA 2FE9A 1PK1A 2DKXA 2DKZA 2QARB 1KW4A 2E8PA 4NJ8A 5JTIA 5KNIA 4MHVA 1B0XA 1F0MA 1SXDA 2ES6A 3KKAC 2K4PA 5JRTA 1PK1B 2KMDA 2D3DA 2EAOA 4PZNA 3TADC 2L5YA 2Y9TA 2DL0A 2QB1A 1SV0A 3HILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V38 A;  4RQN A;  1Z1V A;  1LKY A;  1X66 A;  5J8Y A;  2B6G A;  2YTU A;  1UCV A;  5F3X B;  4IS7 A;  2E8N A;  1WWU A;  2D8C A;  2JV3 A;  2E8O A;  4RQM A;  2EAP A;  4NL9 A;  1COK A;  2Y9U A;  3BS7 A;  1LKY B;  3IDW A;  3TAC B;  1JI7 A;  2LPE A;  1SGG A;  1SV0 C;  2F3N A;  2EAM A;  1OXJ A;  3BQ7 A;  3H8M A;  2F44 A;  1OW5 A;  3K1R B;  1WWV A;  3BS5 A;  5J8Y C;  3SEI A;  1B4F A;  2ESE A;  1UQV A;  2K60 A;  2EAN A;  2KSO A;  4NL9 C;  2F8K A;  3BS5 B;  1X40 A;  2KSO B;  1DXS A;  1SV4 A;  4PZO A;  2GLE A;  1V85 A;  3KKA A;  2QB0 A;  3SEN A;  5JU5 A;  1X9X A;  2E8M A;  3TAD A;  2QAR A;  2LMR A;  2KE7 A;  1PK3 A;  2QB0 B;  1RG6 A;  2QKQ A;  5L1M A;  2KIV A;  2KG5 A;  1SXE A;  2FE9 A;  1PK1 A;  2DKX A;  2DKZ A;  2QAR B;  1KW4 A;  2E8P A;  4NJ8 A;  5JTI A;  5KNI A;  4MHV A;  1B0X A;  1F0M A;  1SXD A;  2ES6 A;  3KKA C;  2K4P A;  5JRT A;  1PK1 B;  2KMD A;  2D3D A;  2EAO A;  4PZN A;  3TAD C;  2L5Y A;  2Y9T A;  2DL0 A;  2QB1 A;  1SV0 A;  3HIL A; 
#chains in the Genus database with same CATH topology
 4RQN A;  1IIP A;  2ODG A;  2MUT B;  1TAM A;  1ZQ1 C;  4C8M A;  4DL2 A;  4P4M A;  4JB3 A;  1WCN A;  4J9M A;  3QUT A;  4KTQ A;  4JMU A;  1NK4 A;  2JV3 A;  4PGQ A;  3EWA A;  3HJE A;  1RZT A;  4YR0 A;  1ARO P;  3V6K A;  4OD0 A;  3KFU F;  1D8B A;  4F2R A;  4IL6 U;  3NGD A;  9ICM A;  2K4H A;  3G6V A;  3CP8 A;  2JMG A;  1ZJM A;  3K1Z A;  1QSY A;  2XCA A;  4YD2 A;  1QTM A;  4DQQ A;  2J6U A;  4DFM A;  4I2G A;  3BS5 A;  5IIK A;  2ISO A;  1K1S A;  2BQ3 A;  1CEZ A;  5AI5 A;  4P4O A;  3PX6 A;  2PMZ F;  1DRG A;  1Z4O A;  2F8K A;  4BWM A;  2A1J A;  4Y2T A;  8ICF A;  5DBC A;  5F9L A;  2ATL A;  1XSN A;  4FO6 A;  1X9W A;  3D2Q A;  2Y1J A;  4PHA A;  2BR0 A;  4C8L A;  2A3V A;  3BZC A;  4M2Y A;  3HKZ C;  3WK8 A;  4KLF A;  3Q8L A;  4F5N A;  3PMN A;  4ED8 A;  3SAF A;  5EWF A;  5DB7 A;  4Q8F A;  4C80 A;  1SXE A;  2JEI A;  2DKX A;  1KTQ A;  3F53 A;  1HUZ A;  5JTI A;  9ICV A;  4C4R A;  4ECX A;  7ICH A;  5EE0 A;  2C2R A;  1TE2 A;  2W7P A;  2KZ3 A;  5HNK A;  3MR2 A;  4UW9 A;  3V7K A;  3PX4 A;  1MN8 A;  5ALW A;  3CRX A;  1FIQ A;  3IP4 B;  1U4B A;  3L3F X;  3TFS A;  1X66 A;  4YP3 A;  4KLI A;  3GIJ A;  3V7L A;  4NL9 A;  5J2K A;  4KLU A;  1COK A;  4UQG A;  1S10 A;  2EQY A;  4M9N A;  1M6Y A;  4ECU A;  1S76 D;  5ALL A;  4US8 A;  4DQI A;  1U49 A;  3N28 A;  4TUS A;  4KLD A;  4F72 A;  3H0R B;  3F5A A;  2ZXI A;  3BJY A;  2HHQ A;  5ALG A;  1JXE A;  4IRC A;  2NRT A;  2D6F C;  3IM1 A;  4M9G A;  7ICR A;  3PO5 A;  1BVS A;  4QZH A;  2HOI A;  2KSO A;  3B9J A;  4EBD A;  4NL9 C;  2KJ8 A;  3SZ2 A;  3RR7 A;  4J9P A;  4Y2V A;  4BGD A;  4UBC A;  2K8A A;  1SL1 A;  5AKJ A;  1U47 A;  2PI4 A;  4ED3 A;  1CUK A;  4UAT A;  5AI6 A;  5JU5 A;  1N62 A;  2I9G A;  7ICV A;  2HCF A;  2XID A;  3JPP A;  4OJL A;  1RQN A;  3F2D A;  2BQR A;  3BQ2 A;  5ALZ A;  3OJS A;  2KZZ A;  4QZ8 A;  3E2E A;  2ZIW B;  3C1Z A;  2KG5 A;  7ICL A;  5J2E A;  3RJJ A;  5J2I A;  2BQU A;  5EWG A;  2JRZ A;  1ZQS A;  1KFD A;  1L7M A;  2Y0S F;  3C23 A;  3RFA A;  3EPI A;  4MF2 A;  4DFD A;  2DF4 B;  4I27 A;  4NLK A;  2NRW A;  1V38 A;  2KIW A;  3QZ8 A;  2HMX A;  4I2B A;  3M6K A;  1X2I A;  4QIW C;  3AU6 A;  2KN7 A;  1NKC A;  4Y2Y A;  3PSF A;  4Z6C A;  5DBA A;  3QX7 A;  2UVR A;  4F5O A;  4I29 A;  3ISC A;  4AYB F;  5EWE A;  3RB3 A;  5KT4 A;  4Z6F A;  4UAS A;  4Q43 A;  1WUD A;  1Z19 A;  3WK6 A;  4RPZ A;  2H3V A;  2ZUB A;  1JUD A;  1F44 A;  4R65 A;  1KLN A;  3AU2 A;  2WB1 C;  3D6J A;  2BPC A;  4IQW A;  1JN3 A;  1ZQV A;  3V6H A;  9ICX A;  4DQP A;  5FP0 A;  3UXN A;  4J9K A;  7ICM A;  2VA2 A;  2A1A A;  4LZD A;  2XC9 A;  5L1I A;  3MGV A;  2JH7 A;  4I2D A;  2KZM A;  2XO7 A;  8ICY A;  1X6J A;  4KLQ A;  1X6I A;  3PSI A;  5AIB A;  1ZJN A;  3C2L A;  2EH9 A;  2V9W A;  2HHV A;  1JAL A;  1JRO A;  2YMQ A;  4O9M A;  1VLB A;  3C1Y A;  5AKK A;  1ZQH A;  3M1Y A;  4DFP A;  1QLN A;  3JPQ A;  4F4Y A;  3JPN A;  1Q3U A;  7ICF A;  5HHI A;  5J2J A;  1ZQK A;  3UQ0 A;  1S0O A;  1X9S A;  3UQ2 A;  4J9L A;  4LJX A;  1URJ A;  1ZQI A;  2KHV A;  1SB3 C;  4YG2 A;  5HMM A;  2OYY A;  4EZ9 A;  3ZDB A;  5AIC A;  4I2F A;  1NK8 A;  4NM1 A;  5ALS A;  2AQ4 A;  4J9R A;  3SV4 A;  4U7C A;  4Y2Q A;  3K75 D;  4RUC A;  4ED0 A;  3MR6 A;  2C2D A;  4C7Y A;  5HR7 A;  5J8Y A;  5DQH A;  4I2A A;  3IRU A;  2OHF A;  2K89 A;  5KG2 A;  5J0S A;  1Z1B A;  4NLC A;  8ICK A;  1KBU A;  3MAB A;  4PJ0 U;  4RQM A;  8ICB A;  4I2J A;  4KLS A;  2AH5 A;  5AI4 A;  4CF4 A;  4RPX A;  1LKY B;  4B9U A;  1JI7 A;  4YR2 A;  5KFX A;  1RQL A;  3U26 A;  9ICB A;  2C22 A;  2GH1 A;  2Q4T A;  3RB6 A;  3RAX A;  4RU9 A;  4UB3 A;  3NS1 A;  5J8Y C;  3SYZ A;  4EZ6 A;  2PKE A;  2ESE A;  4CDG A;  3IG8 A;  1RPL A;  3ETL A;  3MR3 A;  3MGH A;  4X5V A;  4F2S A;  2RLT A;  4EEL A;  8ICS A;  2DGZ A;  2AJQ A;  9ICH A;  2JHD A;  5AHX A;  1ZQX A;  4ECS A;  2C28 A;  5KFZ A;  4QZ9 A;  2JEG A;  2ZIX A;  3G6X A;  2BGW A;  4KLG A;  4UB8 U;  4ECY A;  4MEY A;  2GLE A;  2AU0 A;  1Q3V A;  2WAQ F;  2JR5 A;  3E0F A;  4RUA A;  5J2F A;  3TAD A;  3MR5 A;  1NNL A;  2FI1 A;  2HHX A;  5DG7 A;  5JUM A;  3RBE A;  2QB0 B;  2KIV A;  4F93 B;  1QSS A;  1K5O A;  2KK0 A;  2FLL A;  3NAS A;  1ZET A;  3BZK A;  2E8P A;  4DSK A;  3PV8 A;  4DS5 A;  1B0X A;  5H2F U;  2K4P A;  4QWC A;  3GV8 B;  5KFT A;  3LWM A;  3PR5 B;  2OEH A;  3TAD C;  4KX5 A;  4Y2X A;  2CXY A;  3WKB A;  2DL0 A;  3H8W A;  3FDS A;  3KTQ A;  2VAN A;  2M9N A;  3H0M B;  5D4B A;  4Q45 A;  3Q8M A;  1N56 A;  1RM6 C;  5KG7 A;  4IS7 A;  2E8N A;  9ICC A;  1CI4 A;  2FLP A;  4GIB A;  2OWO A;  5DGA A;  2BHN A;  3N7S C;  1IM4 A;  4QWE A;  4QWB A;  1C7Y A;  1BPE A;  5KAF U;  3M9O B;  5EE3 A;  4F8R A;  1HJP A;  3M9M B;  3RBD A;  3OSN A;  1XO1 A;  3QE9 Y;  1S0V A;  4DL7 A;  1BGX T;  1NKE A;  3SMV A;  1B4F A;  4UB5 A;  5KG0 A;  4ED6 A;  5TIS U;  2P35 A;  5ALV A;  3SAH A;  5KFB A;  3MDC A;  5EOZ A;  5GTH U;  3BDP A;  9ICJ A;  1X40 A;  4KLH A;  5ALN A;  4PHP A;  1UA1 A;  3C21 A;  2HHS A;  3T5J A;  3SAG A;  2PMZ C;  5F9N A;  4R8U A;  2JXJ A;  4QW9 A;  4C8K A;  5DG9 A;  2KD1 A;  2VIX A;  3RTV A;  2HBL A;  2QKQ A;  2VA8 A;  3LDA A;  4RT3 A;  2YMM A;  2QAR B;  4M9L A;  2UVW A;  4B9N A;  4KLJ A;  3H40 A;  2N1R A;  2LM1 A;  4C0Z A;  5KFR A;  3RB0 A;  5KNI A;  5KT2 A;  1YT3 A;  4MHV A;  4C7Z A;  4O5K A;  3A0B U;  3QEB Z;  1D8L A;  5KT3 A;  1T8E A;  4DSF A;  3NVW A;  2L5Y A;  3M8S A;  1TFR A;  1ZQJ A;  2JEJ A;  5HML A;  3IN5 A;  3HX0 A;  1IG6 A;  4YVZ A;  2KNJ A;  2H3Z A;  3E58 A;  3KBB A;  3Q8P B;  3T79 A;  3TAP A;  1UHU A;  5DDY A;  3V6J A;  2IHM A;  2ASL A;  2FMP A;  3ICX A;  1ZQO A;  1MQ2 A;  1KFS A;  4YD1 A;  1SGG A;  3L4P A;  1JX4 A;  4F3O A;  2EAM A;  4NM2 A;  3TFR A;  3TKA A;  1NK9 A;  5J2C A;  2ZUC A;  2ZG6 A;  2ISP A;  4BJQ A;  4J9S A;  4KX3 A;  4BXO B;  5KAI U;  4RNO A;  1SKW A;  1ZQL A;  4GFJ A;  1DK2 A;  1B43 A;  4NXZ A;  5DQG A;  3NVV A;  4J9O A;  4O3N A;  3WK4 A;  3PW5 A;  4IRD A;  1HEK A;  4M9H A;  1X9X A;  4QZE A;  4DEZ A;  2HBJ A;  4ECR A;  1TK5 A;  5CR0 A;  5AM1 A;  4NWI A;  3OJU A;  5L1M A;  4IQT A;  4O5E A;  1FEZ A;  1IV8 A;  2JGA A;  3MFH A;  2VJ5 A;  1F5S A;  2W8K A;  2K4I A;  3AQE A;  2HBM A;  7ICJ A;  2W9B A;  4FBT A;  1F0M A;  5BOM A;  5AM5 A;  2MUT A;  3TAN A;  4J9Q A;  5KFL A;  2HBK A;  5KFD A;  2W8L A;  3RJK A;  4MEX A;  1OUQ A;  4R66 A;  3T3F A;  3SQI A;  3QNM A;  5DB9 A;  4O0I A;  3PX0 A;  2R8J A;  1L3S A;  3SR6 A;  2HHT A;  5HP4 A;  2GOL A;  4DSL A;  1UCV A;  4F5R A;  3RR8 A;  1FFV A;  1SZH A;  2I5H A;  5B66 U;  4YMN A;  2M0N A;  2Y9U A;  1ZYQ A;  5KFN A;  2KVS A;  1DGJ A;  3GV5 B;  4YXJ A;  2LBO A;  2W04 A;  4RQ8 A;  4DQR A;  1XWL A;  5AI9 A;  4QZC A;  1PZN A;  3T5L A;  2ASD A;  4B9S A;  5ALD A;  3LK9 A;  2RQ5 A;  1D8Y A;  2DWQ A;  3G6Y A;  3T5K A;  2EAN A;  1U48 A;  1XNS A;  2P6U A;  9ICF A;  4BUG A;  4YQW A;  3AN1 A;  3LVV A;  5KFO A;  3I1Y A;  2F2A B;  4OJO A;  1XU4 A;  5CJ7 A;  2YN4 A;  3NRZ A;  2YQE A;  2XY5 A;  4DOB A;  4DL5 A;  2RRD A;  5G5H A;  5J2B A;  1ZD5 A;  4DS4 A;  4DFJ A;  2G5H B;  5KT6 A;  1RYS A;  2KE7 A;  4I2C A;  2ZTD A;  3AMZ A;  2XIC A;  2FDR A;  1MC8 A;  2HHU A;  2ZIV B;  2OM6 A;  4Y2U A;  4ELT A;  5AKX A;  3HWT A;  9ICE A;  5J0U A;  1B22 A;  3AQF A;  1TV9 A;  4R64 A;  4NJ8 A;  2FMQ A;  5AKZ A;  5L1J A;  2BCS A;  4B9V A;  1Z4N A;  2LYH A;  3RJE A;  4F50 A;  1BPX A;  2BCU A;  1DK3 A;  1SZP A;  4QZG A;  3ETR A;  3UMG A;  2PI5 A;  4Z6D A;  2XY7 A;  4FFD A;  4OJ6 A;  2D8C A;  5KL1 B;  5ALJ A;  4PHD A;  1Q46 A;  1KDH A;  3NVZ A;  2KTQ A;  5EE9 A;  3ZDE A;  1NKB A;  1NK0 A;  1IXR A;  4FBU A;  2LPE A;  5KL8 B;  4OJ5 A;  1SL2 A;  4Y2P A;  7ICS A;  1OXJ A;  4TQR A;  4XQ8 A;  5DBB A;  5ALP A;  2Z7J A;  5TZV A;  3ZD9 A;  7ICG A;  5ALI A;  2W55 A;  4Y2R A;  4EBC A;  1ZQU A;  4RQ1 A;  1ZQG A;  2K60 A;  2PFO A;  4NLZ A;  3NTU A;  2IBK A;  1SIJ A;  3H0L B;  2K4E A;  1L3U A;  4CNQ A;  1DXS A;  4R63 A;  1BNO A;  2I1Q A;  8ICH A;  2RP5 A;  2ZIW A;  3AUO A;  2FLN A;  4F91 B;  2E8M A;  1U45 A;  3PVX A;  5ALT A;  5BOL A;  5J0R A;  4UAZ A;  2CRX A;  4PL1 A;  4TUP A;  4YCX A;  1D9D A;  3EPG A;  2WF5 A;  4PHE A;  4NY8 A;  2ZJ5 A;  2KEY A;  1QQ7 A;  1RDF A;  2G0A A;  5L1K A;  3JPR A;  3K4G A;  2NRZ A;  3HP6 A;  2WAQ C;  4JWN A;  2ES6 A;  1NK6 A;  4UB2 A;  1PK1 B;  4PZN A;  7ICP A;  1J2M A;  1P7D A;  1QQ5 A;  2Y9T A;  3MC1 A;  7ICK A;  3F5E A;  1NI3 A;  5AK5 A;  4XA5 A;  2AGO A;  3S6J A;  4DFK A;  3VCB A;  4QNL A;  2WF9 A;  2HHW A;  5KFU A;  5KFW A;  3TAQ A;  5J0Q A;  1NJW A;  5AM4 A;  2XVT A;  3PML A;  3PW4 A;  2IOH A;  5KFF A;  5L1L A;  5J29 A;  5KFS A;  4I2E A;  2MAX A;  4DLE A;  3GIK A;  2A19 A;  2WTF A;  3GDX A;  4BDP A;  1L3V A;  5KT5 A;  2XY6 A;  5KTQ A;  4Y2J A;  3H8J A;  3OHA A;  5KG3 A;  8ICX A;  5IIM A;  1N48 A;  1H38 A;  3QXG A;  3WU2 U;  2G08 A;  4CF5 A;  3RH6 A;  5IIO A;  3K1R B;  3DDH A;  2W9M A;  1KL9 A;  1JRP A;  2VJ4 A;  4GC6 A;  4IRK A;  1ZQY A;  2KIC A;  1Z00 B;  4UBB A;  3MDA A;  4RZR A;  8ICL A;  5DQI A;  4FS2 A;  5AKL A;  4MFA A;  4USA A;  4O3Q A;  4DL3 A;  2PFN A;  4QZD A;  2JZB B;  2YB1 A;  5HHH A;  3GQC A;  2CN1 A;  5IIL A;  5AK3 A;  9ICL A;  3R9K A;  4GXK A;  4P0Q B;  2VA3 A;  3RB4 A;  4FS1 A;  2W03 A;  5DG8 A;  2MRL A;  4JV0 A;  5AM0 A;  2G06 A;  2W3S A;  2BCR A;  1Q8K A;  1KW4 A;  1N60 A;  3GIM A;  4CCH A;  2ASJ A;  4QZF A;  1ZRM A;  3NRW A;  1SKS A;  2B21 A;  2BPF A;  4A8E A;  9ICO A;  3B0Y A;  4O3O A;  1UA0 A;  2D3D A;  1PVP A;  2FJ6 A;  3TI0 A;  4ELV A;  2EDU A;  5DB6 A;  4CGZ A;  2AGQ A;  3JPS A;  3IG5 A;  5J2H A;  9ICK A;  5B5E U;  3QU7 A;  1LKY A;  5F3X B;  5KFE A;  2DUY A;  1ECW A;  4PH5 A;  1Z00 A;  5KFQ A;  3LWL A;  3D2N A;  1XSP A;  3PSP A;  3UXO A;  1QH9 A;  1X9M A;  1LVH A;  1U9L A;  4DCC A;  1ZQW A;  4Q44 A;  3NUQ A;  5ALH A;  1XS9 D;  4RNM A;  1SWW A;  2LI6 A;  1TAU A;  2R8I A;  4MFF A;  1ZQP A;  4KLL A;  1Z3E B;  3PY8 A;  4J03 A;  2YB4 A;  3SI8 A;  5KG1 A;  2H3Q A;  1UT8 A;  4UAR A;  3C29 A;  4DF8 A;  5KFV A;  1WG8 A;  3NVY A;  2DPJ A;  3CYM A;  2BZF A;  1XSL A;  5A0L A;  4FZL A;  2BCQ A;  4IC9 A;  5IIJ A;  3ZDA A;  2ZIU B;  1N5W A;  5KG6 A;  4EEK A;  3MBY A;  3KHG A;  2HOQ A;  4YXM A;  3N4M B;  1XO0 A;  2BCV A;  3L5K A;  2B0C A;  3QYP A;  9ICW A;  3CNH A;  2UVV A;  2F1H A;  2CPR A;  5ALR A;  3KKA A;  2QB0 A;  2YY6 A;  1TKD A;  4CRX A;  4UAU A;  4OO1 J;  3LYS A;  3M8R A;  2P66 A;  2E1F A;  1RYR A;  4EEN A;  4PL2 A;  4M6W B;  2EZY A;  2BKE A;  2XGQ A;  2HOF A;  5T14 A;  4QZA A;  1BNP A;  3N7P D;  1ZQB A;  1KEJ A;  5KFI A;  1O03 A;  4EX6 A;  1SL0 A;  3KKA C;  4UB1 A;  2F8L A;  5JRT A;  1NJZ A;  2EAO A;  3I76 A;  3KHR A;  2PFQ A;  1NK5 A;  5AIA A;  3ISD A;  7ICU A;  4DO9 A;  1N61 A;  2F1I A;  2W9C B;  1ZD4 A;  1ZD3 A;  2ZIU A;  3A0H U;  2AGP A;  4DWI A;  5GTI U;  2YTU A;  4LVS A;  1QQ6 A;  1KSP A;  8ICZ A;  3KZX A;  3IV6 A;  2EAP A;  3QU5 A;  3T5H A;  2FPM A;  1A6S A;  2KFN A;  1KRP A;  2IOF K;  3QUB A;  3H7I A;  8ICJ A;  4NV0 A;  4EYI B;  5J0X A;  3BQ7 A;  2RDI A;  4B6J A;  2H3F A;  3ORY A;  1J97 A;  1V9P A;  1L7P A;  5KG4 A;  3FC4 A;  1UQV A;  4JWM A;  4M6W A;  1ZQM A;  2V4R A;  2DPI A;  1EXN A;  4RQ6 A;  3SV3 A;  2KHQ A;  3BS5 B;  9ICU A;  5ALY A;  2LHT A;  2RDJ A;  2MA1 A;  3V72 A;  3N97 B;  5J0Y A;  3C2K A;  3FM9 A;  1WYG A;  5G5G A;  3HT3 A;  1ZQZ A;  1V85 A;  3B0X A;  4F92 B;  4KLO A;  4K4H A;  4KMU A;  1KN5 A;  3MGI A;  1NK7 A;  4IR9 A;  4CE6 A;  2RHF A;  5J2G A;  5CRX A;  2QAR A;  3ISB A;  3PNC A;  1PVR A;  7ICO A;  1A77 A;  4QW8 A;  9ICR A;  1N5X A;  5AK6 A;  3ZI4 A;  3H8S A;  4YR3 A;  3GU3 A;  1UPH A;  2XI9 A;  1RYU A;  2NRV A;  5KFH A;  8ICE A;  4CF3 A;  8ICG A;  1TVA A;  3M9N B;  2WFA A;  1ZQN A;  8ICM A;  2ZTC A;  2WF8 A;  1A76 A;  1ZOL A;  4RQ2 A;  3ED5 A;  1Z1V A;  5KFG A;  2K8B B;  4RQ7 A;  5AKI A;  4MF8 A;  3QU4 A;  4P4P A;  1ZQQ A;  1T3N A;  4F71 A;  2FMS A;  8ICO A;  4O3S A;  3IDW A;  5AKY A;  4XUS A;  3EUB 2;  2JEF A;  3THV A;  1BPB A;  2ZJA A;  4P2H A;  3RRG A;  4BXO A;  1Y88 A;  4YMM A;  3RAQ A;  3H8M A;  4ZOH C;  2I6X A;  2W7O A;  2KFZ A;  8ICC A;  3UXP A;  4YMO A;  2JH1 A;  3LVW A;  3ALR A;  4DSJ A;  1JIH A;  2W3R A;  2KV2 A;  3QU2 A;  2Y0S C;  3TAR A;  5ALF A;  4OJP A;  2WF7 A;  3O0F A;  3QUC A;  9ICS A;  2E3T A;  3DEE A;  1ZQE A;  3F2C A;  2KSO B;  8ICI A;  2MU2 A;  1GO3 F;  4NLN A;  4RQ0 A;  3JPO A;  2QLT A;  4O3M A;  3TQ1 A;  1N2X A;  1SKR A;  3GV7 B;  5BPC A;  4FZN A;  1SWV A;  5CB1 A;  2YMP A;  4AYB C;  1QCK A;  1ZRN A;  3D2S A;  2OXO A;  1PK3 A;  1RG6 A;  4EBE A;  2DKZ A;  2W9A A;  2LKY A;  3J81 j;  4JV1 A;  5K4L A;  1LB2 B;  1JXL A;  4ICA A;  3FAH A;  1S97 A;  5EE1 A;  3JPT A;  2NO4 A;  7ICE A;  2KMD A;  5ALU A;  4UAW A;  5L9X A;  2QB1 A;  3RH5 A;  4B9M A;  1NZP A;  3RH4 A;  4PPX A;  2HW3 A;  3C5F A;  5AKG A;  3F2B A;  7ICT A;  3WK9 A;  1LV5 A;  3ZDC A;  3CW2 C;  2DQN B;  2ZTE A;  2R8H A;  1KFT A;  3PZP A;  5ALK A;  4P0P B;  1S77 D;  4QWD A;  4I28 A;  3Q8S B;  2R8K A;  1S5L U;  1MSW D;  1VDV A;  5ALQ A;  3EYZ A;  2V4Q A;  4G9B A;  3RJH A;  5IIN A;  1L6N A;  3M7D A;  4E0D A;  5AK4 A;  3GFK B;  5KFK A;  4K4I A;  3HKZ F;  5KT7 A;  5J0P A;  4ACO A;  5C5J A;  1TK8 A;  3WK7 A;  4GXI A;  1L8L A;  1XC9 A;  8ICW A;  3HW8 A;  3BQT A;  4KLM A;  1S8O A;  4KLT A;  4HAI A;  3OHB A;  3ZDD A;  3Q8R B;  4DL6 A;  1L7N A;  2ZIV A;  9ICA A;  3UPQ A;  3SD7 A;  1CRX A;  4ZH4 A;  4US9 A;  3M6Z A;  2LMR A;  2KVC A;  1MA7 A;  3RJF A;  1ZQD A;  3KD3 A;  3PW2 A;  2GWS A;  4ED2 A;  5D46 A;  4C4S A;  4Z6E A;  4DLG A;  2XGP A;  3QU9 A;  4NLG A;  4J9N A;  5AI0 A;  4I2H A;  1COO A;  2BDU A;  4P0P A;  4GLX A;  9ICT A;  1O08 A;  2R18 A;  4BX9 C;  8ICV A;  1SXD A;  3OTQ A;  4I2I A;  3I28 A;  5DDM A;  1UT5 A;  4RNN A;  4QWA A;  5ALE A;  4C8O A;  3V7J A;  2XCP A;  4AP9 A;  5CP2 A;  1YZ6 A;  2AHO B;  2H5X A;  4UAV A;  3WK5 A;  3PW7 A;  4LZG A;  1WWU A;  2HI0 A;  4KIT B;  2E8O A;  5AKE A;  1A0P A;  2F1J A;  5KFC A;  4C8N A;  5J0W A;  5AI8 A;  2G09 A;  3TAC B;  4DSI A;  3GII A;  2NRX A;  1YZ7 A;  1NZB A;  4M47 A;  2KJ9 A;  2LYB A;  3PST A;  2KKV A;  1WWV A;  4K4G A;  3SEI A;  2F77 X;  1L5U A;  4ECZ A;  3AEV A;  1AQ6 A;  1K1Q A;  4EEY A;  4JUZ A;  5KFP A;  2KP7 A;  1N63 A;  2W11 A;  4TUQ A;  1S0M A;  2OH2 A;  2MSN A;  3KOO A;  5KFA A;  1NJX A;  3KHL A;  1KKX A;  3WKD A;  4XRH A;  4ELU A;  8ICA A;  2KKP A;  1TAQ A;  3GZF A;  3UMC A;  3H4D A;  1FFU A;  4JV2 A;  4Q8E A;  4QZB A;  4F4K A;  2ZIX B;  3ZD8 A;  2O6K A;  1NJY A;  5KFM A;  4C4T A;  2DFL A;  4ECT A;  3GIL A;  5J0O A;  2OCE A;  4ECW A;  2G5I B;  2FE9 A;  3QEA Z;  1PK1 A;  7ICN A;  2K8C B;  5D49 A;  2W43 A;  4QIW F;  4RPY A;  2J6S A;  3UM9 A;  1KQQ A;  1HUO A;  1J2N A;  4QZI A;  1BPZ A;  2WHE A;  5ALX A;  3RJG A;  5J0T A;  8ICU A;  2IOF A;  1JMS A;  4G3I A;  4KLE A;  1NOM A;  4KN7 A;  5DKW A;  9ICI A;  3WKA A;  1V97 A;  1ZQC A;  4PGY A;  5KG5 A;  1BPY A;  1SV0 A;  3AM9 A;  1ZQR A;  3HIL A;  1ZQT A;  1C20 A;  3Q8K A;  4F4W A;  1ZQF A;  2FPK A;  2C2E A;  4TUR A;  2WB1 F;  3BQ1 A;  1TK0 A;  2WF6 A;  5HR6 A;  4EX7 A;  1L3T A;  1PUZ A;  4M04 A;  4O3P A;  8ICQ A;  2GO7 A;  4ED1 A;  5J2A A;  5III A;  1S0N A;  1L8O A;  2NV3 A;  8ICN A;  3N7R C;  4UB6 U;  4UAY A;  5KFY A;  4GXJ A;  9ICN A;  1SV0 C;  2F3N A;  2ZJ8 A;  1ZXI A;  1T94 A;  3HPO A;  2F44 A;  4F4Z A;  3HRD D;  2HVI A;  4Y2S A;  1T4G A;  3PR4 A;  4FZM A;  1ZQA A;  2J6T A;  2R8G A;  4YN4 A;  1BPD A;  2JZB A;  1MQ3 A;  5AKH A;  4RQ3 A;  1DGS A;  5DB8 A;  3C28 A;  8ICT A;  4WJ3 B;  4YFK A;  3OPX A;  5KFJ A;  4P0Q A;  5ALO A;  3RRH A;  2UVU A;  3C5G A;  5CEH A;  4BWJ A;  5DLG A;  2ZXH A;  4DOA A;  1D9F A;  2LM4 A;  1HIW A;  4ED7 A;  2DBY A;  5CWR A;  3OSP A;  2FPL A;  4F5Q A;  2LYA A;  4IQU A;  3VC8 A;  2BDP A;  4R8U B;  2KJ5 A;  3EZ5 A;  5ALM A;  2IHN A;  4B9L A;  5J2D A;  3KHH A;  2YX8 A;  4O3R A;  4DL4 A;  4DQS A;  4KMO B;  2F76 X;  3H4B A;  1ED1 A;  2IA6 A;  4JK1 A;  1ZD2 P;  3IHQ B;  4MFC A;  2EZZ A;  1VJ5 A;  1RXV A;  3DV9 A;  2B6G A;  2HSZ A;  1WCL A;  1QSL A;  9ICQ A;  4DSE A;  4U6P A;  2IMW P;  2HDO A;  1L7O A;  4TQS A;  3Q8Q B;  4HYK A;  3BS7 A;  3RF9 A;  3QZ7 A;  2Y1I A;  1FO4 A;  7ICI A;  4RT2 A;  2VKQ A;  4M0A A;  2W54 A;  3BQ0 A;  3UMB A;  4KN4 A;  4NLB A;  4O5C A;  1OW5 A;  4DF4 A;  4GC7 A;  4IR1 A;  1PVQ A;  2ALZ A;  5DLF A;  1T7P A;  5C0Y A;  5E79 U;  3AL0 B;  4DOC A;  3ONN A;  1X42 A;  4F4X A;  4RQ5 A;  4PGX A;  5AM2 A;  2ZUD A;  7ICQ A;  1DOQ A;  2HVH A;  9ICP A;  4RQ4 A;  2PFP A;  3MFI A;  1SV4 A;  4PZO A;  5CA7 A;  4ECV A;  4F5P A;  2Q0Z X;  3WKE A;  2E1E A;  2H3I A;  3SEN A;  3QUQ A;  5CHG A;  2E5S A;  2YML A;  5DGB A;  4IQV A;  2NO5 A;  4FE3 A;  4EYH B;  3KZI U;  3WKC A;  2NYV A;  4OCZ A;  3PO4 A;  8ICR A;  3FYH A;  4ECQ A;  1RXW A;  1T3Q A;  3EW9 A;  3OGU A;  2BPG A;  2AQ0 A;  8ICP A;  3PW0 A;  9ICG A;  2G07 A;  4QJF B;  5AM3 A;  4B9T A;  2A1J B;  2AXT U;  2W9C A;  3RJI A;  2EZX A;  1S9F A;  2PXI A;  2P6R A;  3C2M A;  4UB4 A;  4M9J A;  2KOB A;  2W9B B; 
#chains in the Genus database with same CATH homology
 1V38 A;  4RQN A;  1Z1V A;  1LKY A;  1X66 A;  5J8Y A;  2B6G A;  2YTU A;  1UCV A;  5F3X B;  4IS7 A;  2E8N A;  1WWU A;  2D8C A;  2JV3 A;  2E8O A;  4RQM A;  2EAP A;  4NL9 A;  1COK A;  2Y9U A;  3BS7 A;  1LKY B;  3IDW A;  3TAC B;  1JI7 A;  2LPE A;  1SGG A;  1SV0 C;  2F3N A;  2EAM A;  1OXJ A;  3BQ7 A;  3H8M A;  2F44 A;  1OW5 A;  3K1R B;  1WWV A;  3BS5 A;  5J8Y C;  3SEI A;  1B4F A;  2ESE A;  1UQV A;  2K60 A;  2EAN A;  2KSO A;  4NL9 C;  2F8K A;  3BS5 B;  1X40 A;  2KSO B;  1DXS A;  1SV4 A;  4PZO A;  2GLE A;  1V85 A;  3KKA A;  2QB0 A;  3SEN A;  5JU5 A;  1X9X A;  2E8M A;  3TAD A;  2QAR A;  2LMR A;  2KE7 A;  1PK3 A;  2QB0 B;  1RG6 A;  2QKQ A;  5L1M A;  2KIV A;  2KG5 A;  1SXE A;  2FE9 A;  1PK1 A;  2DKX A;  2DKZ A;  2QAR B;  1KW4 A;  2E8P A;  4NJ8 A;  5JTI A;  5KNI A;  4MHV A;  1B0X A;  1F0M A;  1SXD A;  2ES6 A;  3KKA C;  2K4P A;  5JRT A;  1PK1 B;  2KMD A;  2D3D A;  2EAO A;  4PZN A;  3TAD C;  2L5Y A;  2Y9T A;  2DL0 A;  2QB1 A;  1SV0 A;  3HIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...