4RQMA

Crystal structure of the semet bicc1 sam domain r924e mutant
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
b'KGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKMLLAISELNKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein bicaudal C homolog 1
publication title Characterization of the SAM Domain of BICC1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 19
structure length 63
sequence length 63
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4rqmA01
3K1RB 5L1MA 2GLEA 1RG6A 2Y9TA 3TADC 3BQ7A 4IS7A 3HILA 2KMDA 4MHVA 5JRTA 2EAMA 4NL9C 1SGGA 2KSOB 2YTUA 5J8YC 3IDWA 1X66A 5JU5A 2F8KA 1SV0C 2KG5A 3BS7A 2QB0A 1UQVA 3BS5A 3TACB 1SV4A 2ES6A 1X9XA 3KKAC 4RQNA 1UCVA 2E8MA 2F44A 3SEIA 2QKQA 3SENA 1PK3A 3TADA 1F0MA 1LKYA 2F3NA 1PK1A 1X40A 2DKXA 5KNIA 2K60A 4NL9A 2QB0B 1SXDA 2DKZA 1WWUA 3BS5B 2E8OA 1B4FA 2E8PA 2B6GA 1COKA 2D3DA 2Y9UA 2KE7A 1V38A 4RQMA 2K4PA 1LKYB 5JTIA 2D8CA 1PK1B 2QARA 4PZOA 1DXSA 2EAPA 4PZNA 3H8MA 2E8NA 2EANA 2KIVA 5J8YA 1SXEA 1SV0A 1V85A 2JV3A 2DL0A 5F3XB 1WWVA 2L5YA 2LPEA 3KKAA 1KW4A 1Z1VA 2ESEA 2FE9A 2QARB 1OW5A 2KSOA 4NJ8A 1OXJA 1JI7A 2EAOA 1B0XA 2QB1A 2LMRA
chains in the Genus database with same CATH superfamily
2NRWA 1D9FA 2HOQA 4M6WA 1UPHA 3HP6A 3LVWA 5KFIA 1KTQA 2ASJA 4G9BA 4IQUA 4KLJA 5H2FU 2HHUA 4I2IA 4YD2A 5L9XA 7ICMA 4XRHA 4CF4A 5AM3A 3C21A 3D2NA 4DFDA 1X6JA 5D4BA 4J9OA 2W43A 2YY6A 8ICIA 2YMPA 3RB0A 4CF5A 4RQ8A 4J9PA 4LZDA 1NNLA 2GO7A 2I5HA 3IP4B 2FLPA 3N7PD 2CN1A 5KFBA 3QE9Y 4RQ3A 2DKXA 4EEKA 5ALRA 4ED1A 2CRXA 4ECYA 4K4GA 2MAXA 1EXNA 4OJ5A 4Y2RA 2XY6A 4EX7A 4M0AA 1SB3C 4I2DA 5AI6A 3OJSA 1KN5A 2DWQA 5ALJA 5AM5A 4PPXA 5KFFA 5J0PA 1NJZA 2QARA 3K1ZA 3KBBA 3AQEA 2K8AA 2WF5A 3OSPA 1QCKA 1FO4A 1L8OA 5DBBA 3IN5A 4DF4A 4TUSA 3PW0A 4RZRA 2HI0A 1QLNA 1YT3A 3NUQA 2RRDA 5AKKA 2NRZA 5L1JA 5F3XB 3JPSA 4GXJA 5AI8A 2XY7A 4F4ZA 4I2HA 8ICRA 4DQSA 2ASDA 1A6SA 5KTQA 3AU2A 3OTQA 4ECSA 5ALLA 3NVZA 1C20A 2OYYA 4C8NA 3AL0B 2G08A 2IOFA 8ICTA 2HBMA 3RB4A 9ICHA 2NRTA 3HKZF 4KLHA 3RR8A 3OHBA 2YMQA 3V6JA 2Y1IA 4F72A 2JEGA 2KD1A 2KG5A 2HHWA 1ZQGA 1LV5A 2OXOA 3TKAA 5CHGA 3TI0A 4MFFA 5AK3A 5DB8A 2ISPA 4F50A 5DQIA 3U26A 3PW5A 4B9UA 1VLBA 1KDHA 3BQ1A 3T5LA 3OHAA 5KFOA 3D2QA 4DL4A 3WK6A 3PX0A 2WB1C 3T5KA 2ISOA 1ZD4A 3SMVA 4EZ6A 8ICMA 2A1JA 2QLTA 3H8SA 1Z3EB 2E8OA 5J0QA 1ZXIA 8ICZA 4I2CA 1RYRA 3TQ1A 3MR5A 1RYSA 1K1QA 9ICFA 4R65A 1N62A 5JUMA 3F2DA 4QWAA 3PW7A 4DL5A 2W11A 1QSSA 5KFGA 5CJ7A 5KG5A 4PGXA 7ICHA 5JTIA 3D2SA 1JROA 2Z7JA 3JPRA 5KG2A 1ZQPA 1DXSA 1RPLA 2XI9A 4J9NA 8ICCA 1RQNA 5J2KA 4QZFA 1QQ5A 4EEYA 4XA5A 3TAQA 4IR1A 4EELA 3PZPA 2XGPA 4IL6U 2Y0SC 5DDYA 9ICXA 3IV6A 1L7PA 3PX4A 1ZQEA 5ALFA 3LK9A 5AI4A 3Q8QB 1ZQRA 1AQ6A 4UAZA 1PZNA 7ICTA 3MGVA 2KEYA 4RQ4A 4EYHB 5HP4A 2KSOA 4ELUA 4ED3A 7ICSA 5HHHA 4I29A 8ICEA 4QZCA 2RQ5A 9ICQA 5KFEA 1LVHA 2XY5A 9ICLA 5CR0A 3WK9A 3BQ7A 1ZD2P 5EWEA 3QZ7A 3OPXA 3LWLA 2BCSA 1QTMA 5DLFA 8ICHA 2M0NA 1JRPA 2LM1A 2KOBA 3BS5A 8ICVA 2AQ0A 2RP5A 1X9XA 5KFNA 2G07A 4I27A 2PI4A 8ICUA 3MDCA 4Z6EA 2HHSA 3BQ2A 2JZBA 3DDHA 3SENA 2HOIA 2W9CA 1JMSA 3E0FA 7ICIA 5KFYA 7ICNA 4ELTA 2R8KA 4QZHA 3AEVA 2I9GA 1Q3VA 1ZQDA 1WWUA 3H4BA 4QZ9A 3H0MB 2B21A 4UAVA 4RQ0A 4EBEA 4M9JA 2M9NA 3JPTA 1O03A 4LVSA 5ALPA 2JR5A 2JEJA 1HIWA 1S97A 1V97A 2IMWP 5AKZA 8ICGA 1TV9A 3CP8A 3M9NB 4DL7A 5DQGA 3UQ0A 3C2MA 1V85A 3H4DA 1SKRA 2K4HA 4Z6CA 1OW5A 4UB2A 2FPKA 1A0PA 2HBJA 4P0QA 2QB1A 3KD3A 2Q0ZX 1Q3UA 2BCQA 4DFMA 4F5RA 4O3QA 4KITB 2FLNA 3KHRA 1N56A 2F8LA 4UAUA 5ALOA 4NV0A 4J9LA 3Q8PB 4IQTA 7ICEA 4RPYA 2ZIUB 5EE1A 2BGWA 1J2NA 4ZOHC 3IDWA 4J03A 4ED2A 1HUZA 4YQWA 4LJXA 4FFDA 1WG8A 3MDAA 4YR3A 4F4YA 5J2GA 3OSNA 4P2HA 2WB1F 1HEKA 4HAIA 5DB7A 9ICGA 4UB3A 4EYIB 5J2AA 1F0MA 1VJ5A 4DEZA 5AICA 3GILA 5KG7A 4UB5A 3KZXA 3TAPA 3QUCA 3TFRA 1L3TA 2ZXIA 4B9MA 2BPCA 2DFLA 5KG0A 3RJJA 4KN7A 4P0PB 3RB3A 3JPOA 2R8JA 3F53A 3I1YA 4CRXA 2Y0SF 2V4QA 1NOMA 4F93B 2IOHA 1QSLA 4DFPA 2DL0A 3QUBA 4ED0A 1D8YA 3NVVA 2HSZA 3K75D 5AM1A 4KLEA 4F71A 3QX7A 1OXJA 1PVRA 1X6IA 2J6UA 1BVSA 4EZ9A 3PX6A 5C5JA 2FMQA 1NJXA 3M9MB 4O3MA 1ZQMA 3FAHA 5L1LA 1ZQ1C 1L5UA 1ZQXA 4RQ1A 4NL9C 3ONNA 1KFDA 8ICYA 5FP0A 2W03A 1KL9A 5BOLA 3BQ0A 1UQVA 3N7RC 4M6WB 1RDFA 4ECXA 4QW8A 1SKWA 4NXZA 4RQNA 1U9LA 1KBUA 2MRLA 4RT3A 3ISBA 5EOZA 1IV8A 1PUZA 2HVHA 1KKXA 3TADA 1TVAA 3NRZA 3PR4A 4UBCA 5KFAA 1KRPA 3BDPA 1KLNA 4OJ6A 2DKZA 4I2BA 3Q8KA 1ZD3A 5KAFU 1Q8KA 3HJEA 4JUZA 2WTFA 5AKLA 2W54A 3L5KA 1NKCA 4GC7A 3MGIA 5KAIU 1PVPA 1FEZA 4R8UA 2MUTA 4NLBA 1X9WA 3ICXA 3RR7A 4RNOA 1L3UA 1BGXT 4CE6A 4KTQA 2ZJAA 4NLCA 4P4OA 1L7OA 2ZIXA 3V7LA 3E2EA 2WFAA 4ZH4A 2KJ9A 2MSNA 2NO5A 2J6TA 3IG8A 2KJ5A 4QZAA 4Y2XA 2QARB 5KG6A 5J2EA 2MA1A 2HBLA 2XO7A 1NJYA 2YQEA 3SV3A 2LHTA 5AI5A 1SIJA 2DF4B 3C23A 4JWNA 4EX6A 3B9JA 5HR7A 1XO1A 4IRDA 4UASA 5DG8A 1F44A 5DB9A 2XCPA 2AH5A 4UQGA 1F5SA 2YN4A 4UW9A 1S0MA 2ZJ8A 2KFNA 1MA7A 4PHPA 4RQ6A 3NASA 1L7NA 1TK0A 2PFQA 4GFJA 2FPLA 1NZPA 4B6JA 2A19A 3VC8A 3JPNA 1NZBA 2YB1A 3LWMA 4F5OA 8ICBA 4O3NA 5CA7A 1J97A 7ICKA 4P4PA 3PY8A 1S77D 4U6PA 1ZD5A 1BPDA 2N1RA 3TARA 2FLLA 2VA8A 1PK1A 2LYAA 4DSFA 1KEJA 2UVWA 2B0CA 1KSPA 1S0VA 3F2CA 3AN1A 2E8PA 3FM9A 2ZIWA 3EPIA 1T94A 5KFUA 2OEHA 1UT8A 2KVCA 1K1SA 3JPPA 2PI5A 7ICJA 1L8LA 4F3OA 5J29A 4PHAA 4Y2UA 3IRUA 1Y88A 1WCNA 3EZ5A 4KMOB 2KTQA 5ALHA 2VJ4A 2A1JB 3H0LB 5KT4A 2LM4A 2E8NA 4UB4A 5TZVA 4TUPA 4BWJA 4DL3A 2RDIA 3MC1A 1SXEA 2W3RA 5HHIA 4BJQA 1ZQYA 5AKXA 3H40A 4IRKA 4DFKA 2NRXA 3V7KA 4F8RA 2RLTA 3RFAA 1X42A 2UVVA 3AQFA 4A8EA 2W9MA 4YVZA 3ISCA 3QZ8A 1ZQQA 5ALVA 4KX5A 1JALA 8ICAA 1ZQVA 1XU4A 1CEZA 3BZKA 2ZUBA 1BPXA 5IIJA 4NLZA 5KFZA 4CDGA 1ZQSA 3LDAA 3PNCA 9ICOA 1SL1A 3M1YA 2WF6A 4Y2PA 5JRTA 3UPQA 3ZDEA 2LI6A 4UB6U 2KSOB 1YZ7A 3HPOA 1JIHA 1X66A 3ZDDA 2JMGA 1M6YA 2JEIA 5HMLA 4FO6A 3GIMA 1SWVA 3NVWA 2P66A 4Q8FA 2K4EA 2AGOA 3PO4A 4JWMA 3AU6A 2KZ3A 4YD1A 4GXKA 1ZQIA 2AGQA 3RJHA 1Z00A 3C1YA 2ZIVA 4O3RA 3V6HA 4F92B 2EDUA 3WKDA 4ED8A 5AK6A 4C7YA 3BS5B 4ECRA 2HMXA 5F9LA 1MQ2A 5DG7A 4YMMA 3MFHA 4I2JA 2W9AA 1BPBA 5ALMA 3ED5A 1MQ3A 2XC9A 3T5JA 5IIOA 2FMPA 2JZBB 1T3QA 2Q4TA 1ED1A 2W9CB 1ZQNA 2VKQA 1L6NA 4BXOA 4O3OA 5KFDA 4UAWA 3RAXA 3NS1A 4EENA 4ECQA 1Z19A 2EANA 2LKYA 1ZYQA 3RJEA 4PHDA 1CI4A 1WWVA 2L5YA 2LBOA 1TAQA 4KLQA 4QZ8A 5KFXA 3WU2U 4YMNA 3ZDBA 2ZUDA 3KZIU 3RRGA 3BQTA 2YX8A 2W8KA 2OHFA 2FMSA 3J81j 1U4BA 4PHEA 1KQQA 4O5KA 2BKEA 2WF7A 4DSEA 5ALDA 2A3VA 5AKGA 4F5PA 2FJ6A 4MHVA 3OGUA 4ELVA 3MBYA 4TURA 3H8WA 4RQ5A 4F4KA 4P0QB 4QZBA 5KG1A 1T7PA 2F44A 4YXMA 3AMZA 3O0FA 3M8SA 1U49A 2W3SA 4O5CA 3IHQB 4YP3A 5TISU 1NK6A 1DGSA 1ZQWA 5DKWA 1B43A 3ALRA 4KLSA 4F2RA 2H5XA 2W04A 1Q46A 3C29A 1T4GA 3AM9A 5AHXA 2KNJA 2PKEA 4K4HA 2K89A 3PMNA 4ECZA 4X5VA 9ICKA 4PZNA 4FS1A 3QU4A 5A0LA 3GU3A 1S9FA 4U7CA 3QU7A 5G5HA 1ZRNA 2CXYA 2LPEA 4RPZA 5ALXA 2OWOA 4IR9A 4QWBA 2DQNB 2AU0A 2KHVA 3A0HU 2IBKA 1U48A 1B0XA 9ICNA 2BQ3A 2LMRA 3K1RB 1X2IA 5AK5A 5ALNA 1XWLA 3K4GA 1LB2B 4QNLA 8ICKA 2C22A 3WK5A 3RJIA 5DGAA 1Z4OA 2WAQC 3HILA 9ICAA 1ZQKA 5J2JA 5KG4A 4KLFA 4DSIA 3DV9A 3T3FA 4Z6DA 4B9VA 7ICQA 1MN8A 3QYPA 1ZRMA 2VJ5A 3MFIA 4F5NA 3UMBA 4C4RA 2Y1JA 1ZQTA 4F5QA 2BQRA 4DLGA 1SXDA 2H3VA 3V6KA 2BZFA 1QSYA 4AYBC 2KKPA 2EZXA 2NV3A 1FIQA 2W7PA 5KFLA 2KK0A 4DL6A 2DUYA 1K5OA 1XS9D 5L1KA 1MSWD 4Q8EA 2HCFA 3CYMA 4QIWC 2IHMA 3CW2C 1S8OA 4UAYA 5B5EU 5HMMA 2ZJ5A 4UARA 5CEHA 3H8MA 3UQ2A 9ICBA 2KICA 4M9NA 3G6VA 8ICXA 4KMUA 1ZQCA 4MF2A 4C8LA 3HX0A 4R8UB 2MUTB 5E79U 9ICWA 4F4XA 5CP2A 4Q43A 5J0WA 2PFOA 2NO4A 4NM1A 2F1IA 3SAFA 4F91B 3N7SC 2ZIXB 4R63A 2GLEA 1BPZA 3IG5A 3GIIA 9ICVA 1L3VA 4KX3A 2EZYA 4NWIA 2W7OA 4ECWA 1ECWA 1IG6A 1HJPA 2EAMA 4FBTA 1CUKA 4O5EA 3MR3A 4QZEA 3V7JA 2BCVA 2WF8A 4NLGA 3A0BU 1SV4A 2HHVA 2DPJA 3PV8A 3RTVA 1NKBA 1U47A 2BDPA 1XSNA 1ZQOA 4YFKA 1UCVA 5GTIU 2JRZA 5ALZA 5IINA 2QKQA 2VA2A 1N2XA 1SL2A 2R8GA 2KP7A 4BDPA 2JXJA 3RH4A 4XQ8A 1L3SA 4UB1A 4KLUA 2G5IB 3FC4A 2K8CB 5KFVA 4KLLA 4KLIA 3OJUA 7ICVA 5IIMA 3H8JA 1IIPA 2G0AA 5AKYA 3Q8LA 4GIBA 3RJKA 5T14A 4I28A 2F76X 4K4IA 5ALKA 1PK1B 1TKDA 4I2GA 3E58A 4JV2A 2NRVA 3GV5B 3SAGA 4AP9A 4UATA 5ALWA 1D8BA 5KFHA 4C7ZA 2ZIWB 4P4MA 3Q8RB 4DWIA 4FBUA 4O0IA 2BQUA 2VANA 4O3SA 3EPGA 5KG3A 4BX9C 7ICLA 1B22A 2ZUCA 3N97B 4Y2JA 2FE9A 4HYKA 4ED7A 4C0ZA 4DF8A 1L7MA 5CRXA 1MC8A 2H3ZA 1PVQA 3C5FA 4MFCA 2WAQF 4G3IA 1X9MA 1NI3A 4RUCA 3LYSA 5EE9A 3TADC 7ICRA 4IS7A 4NY8A 8ICJA 2XVTA 4GC6A 2HDOA 2AGPA 3R9KA 2QB0A 3C1ZA 5ALQA 4YCXA 2HHXA 3RBEA 3GDXA 5C0YA 3WK8A 4I2EA 1DRGA 3RJFA 4J9MA 5KFPA 3EYZA 1D8LA 3QU5A 1NK0A 3ETRA 2F3NA 4J9RA 3F5AA 2C28A 1A77A 4KLTA 4AYBF 1RXWA 2ZXHA 5J0RA 1XNSA 3RB6A 1UT5A 5AI0A 1COOA 4I2AA 3PVXA 5ALEA 1B4FA 2W9BA 1BNPA 3L3FX 3C2LA 8ICLA 2Y9UA 1O08A 3H7IA 4PL1A 2KE7A 4QIWF 1V38A 4JK1A 5DLGA 3PW2A 1Z1BA 1ZQFA 2HHTA 3PR5B 3KHHA 3DEEA 2UVRA 2UVUA 3TFSA 1Z00B 2EZZA 2ZIVB 1Z4NA 2D8CA 2GWSA 1P7DA 3Q8MA 2EH9A 4FZLA 3T79A 4DFJA 1NK8A 4M9HA 1DGJA 2C2EA 2J6SA 4CGZA 3QNMA 1D9DA 3UXNA 2H3IA 2ODGA 3UXOA 5KT6A 2KKVA 2AQ4A 3F5EA 2P35A 2FI1A 1DK2A 5G5GA 3N28A 3N4MB 2VIXA 3ZDCA 4BXOB 7ICGA 3QU9A 4Q44A 1RQLA 7ICOA 9ICUA 5AKIA 4YR2A 3SYZA 1XSPA 1JI7A 4J9KA 5AK4A 9ICSA 2KZMA 4GXIA 5L1MA 2KIWA 3NRWA 3M6ZA 1N5WA 1IXRA 2WF9A 2GH1A 4EBDA 3BZCA 1NKEA 3WKEA 4QWEA 5ALUA 1SGGA 2EQYA 5KFJA 4QZDA 1FFUA 2AHOB 3UMGA 5JU5A 1T8EA 2R18A 5AI9A 4C4TA 1SL0A 2JEFA 2G06A 3KTQA 5CB1A 2V4RA 5D46A 2KZZA 3RJGA 2RHFA 3SEIA 3VCBA 2KVSA 4OD0A 4B9NA 3H0RB 1LKYA 2I1QA 1NK7A 1GO3F 4UBBA 5KT5A 4KLMA 4NM2A 1URJA 9ICMA 4PJ0U 2E5SA 1SZHA 3SQIA 2H3QA 3ZI4A 2XCAA 1UHUA 4TQSA 5AM2A 3MR6A 1ZJMA 4QZGA 3SD7A 3SV4A 1QQ7A 4DS4A 2EAPA 2BR0A 3ZD9A 1JXEA 4E0DA 4JMUA 2MU2A 8ICFA 1QQ6A 3KHGA 3KOOA 2NYVA 3PW4A 1TAMA 1CRXA 3GZFA 1S0NA 4QWDA 2DPIA 2E1FA 3NVYA 5KFRA 1TAUA 1WYGA 1KW4A 1Z1VA 4UB8U 3RH6A 5K4LA 4IQVA 4KLDA 4F4WA 2H3FA 2EAOA 2HOFA 4ACOA 4DS5A 1TFRA 5AIAA 1RG6A 4MEXA 1HUOA 5ALTA 2OH2A 5D49A 2CPRA 4DCCA 5DG9A 1QH9A 4Z6FA 9ICIA 4Y2QA 2R8IA 1RYUA 4CCHA 3WKBA 3ORYA 2IA6A 2ASLA 4DOAA 4M9GA 4KN4A 2XGQA 5DQHA 3C2KA 1N63A 4BGDA 2R8HA 3BS7A 1ZJNA 2HBKA 3TACB 4DSKA 3GQCA 5J0TA 4FZMA 2BHNA 2E8MA 2KV2A 2PXIA 4RT2A 1N61A 4USAA 4Q45A 4RNNA 3SR6A 1DOQA 4DLEA 1SZPA 1SKSA 3JPQA 4DL2A 1J2MA 2K60A 1NK4A 5J2DA 2K8BB 2PFNA 2BCRA 1UA1A 4OJOA 3T5HA 1ZQHA 3RF9A 2JHDA 1RM6C 4OCZA 7ICFA 5IILA 2VA3A 5AIBA 8ICPA 2ZTEA 4EBCA 4DOCA 5KFSA 2KN7A 3RH5A 4M04A 4NLKA 4PH5A 1ZQZA 3M9OB 2BCUA 3BJYA 8ICWA 1BPYA 3QEBZ 9ICEA 2ATLA 3HRDD 4BUGA 4ICAA 4RNMA 3QUQA 2PMZC 2G5HB 1ZOLA 1A76A 2A1AA 4DO9A 2FPMA 5KFKA 4XUSA 2ESEA 5AKJA 9ICJA 5KFCA 4IC9A 1OUQA 4M47A 4RQ7A 4TQRA 4Y2VA 3EWAA 3UM9A 3B0YA 1SWWA 3ETLA 3WKAA 3M8RA 2IHNA 4QWCA 2ZTDA 5IIKA 3B0XA 3L4PA 3PSIA 4RUAA 4DQRA 2KMDA 1ZETA 2XIDA 2HW3A 8ICNA 1RZTA 4US9A 4CNQA 2E3TA 2YTUA 4B9LA 1C7YA 2KFZA 4TUQA 3QU2A 4DOBA 5J0OA 5KFQA 3GV7B 1WUDA 5DGBA 3V72A 4PGYA 2P6RA 3SAHA 3KFUF 2ES6A 4YN4A 2ZG6A 3GIJA 3C5GA 1TK8A 4YXJA 5AKHA 2HVIA 2F77X 4JV0A 3ZDAA 2PFPA 5ALYA 1ZQJA 4C80A 5J0YA 5KFWA 1PK3A 2JH7A 1ZQAA 3MGHA 4Y2YA 1RXVA 2RDJA 3Q8SB 4US8A 2O6KA 4OO1J 3RAQA 2OCEA 3THVA 2JH1A 4C8MA 2F1HA 4JB3A 1IM4A 2D3DA 3SZ2A 2GOLA 5GTHU 1JX4A 5L1IA 2ALZA 2AXTU 5DBCA 4NLNA 4QJFB 5KT2A 5KL8B 1JN3A 4RQ2A 1XC9A 3G6YA 4PGQA 3WKCA 3PSFA 3EUB2 2IOFK 5J0UA 1N48A 4R66A 5J8YA 2P6UA 4O3PA 2BPFA 3CNHA 1JUDA 4QW9A 5EWGA 3ZD8A 4KLGA 5KT3A 5AM0A 7ICPA 7ICUA 3KHLA 3KKAA 5IIIA 3HW8A 4RU9A 3ISDA 4CF3A 3TANA 4ECTA 2F1JA 1FFVA 3D6JA 3EW9A 3CRXA 4C8OA 4J9QA 2DGZA 1WCLA 4DQQA 2DBYA 2Y9TA 5F9NA 8ICSA 5J8YC 1ZQUA 3NTUA 3LVVA 1KFSA 5EWFA 9ICCA 4WJ3B 3FDSA 1TK5A 2E1EA 1S76D 3KKAC 4O9MA 4I2FA 3UMCA 4PL2A 3FYHA 5J2FA 4KLOA 1U45A 3QUTA 3M7DA 1S10A 2V9WA 4R64A 4DQIA 2FDRA 5BOMA 4MF8A 2WHEA 1AROP 4NL9A 5EE0A 2QB0B 2XICA 1BPEA 4DSJA 3C28A 3QEAZ 4RPXA 3QXGA 2B6GA 4YR0A 2KJ8A 2F2AB 4GLXA 4C4SA 3UXPA 5HR6A 1V9PA 2K4PA 3WK4A 4QZIA 5J2BA 1N60A 4PZOA 2BDUA 4BWMA 4MFAA 5J2CA 1ZQBA 5ALSA 2KIVA 3F2BA 2PMZF 2W9BB 3RBDA 3PSPA 4FE3A 1YZ6A 5J2HA 4FS2A 5HNKA 4B9SA 1SV0A 2YB4A 4ECVA 2I6XA 8ICOA 4YMOA 2C2RA 4FZNA 4Y2TA 4IQWA 5AM4A 9ICRA 2LYBA 2ZIUA 4J9SA 4MEYA 5AKEA 9ICPA 5DB6A 4YG2A 2W8LA 1XO0A 3GIKA 1BNOA 1VDVA 1N5XA 2ZTCA 2BPGA 5J0SA 3MR2A 4F2SA 4JV1A 3NGDA 2G09A 4Y2SA 2YMMA 4M2YA 2AJQA 2W55A 5KFTA 3PSTA 3HKZC 2F8KA 1SV0C 5KL1B 1JXLA 5KFMA 4C8KA 5CWRA 1H38A 3GFKB 4LZGA 2LYHA 3I28A 1NK5A 2YMLA 4P0PA 1ZQLA 3HT3A 5ALGA 1X9SA 1X40A 3PO5A 5KNIA 3WK7A 5KT7A 2C2DA 1NK9A 5BPCA 3IM1A 3GV8B 3AUOA 3PMLA 5ALIA 1COKA 1XSLA 1TE2A 4RQMA 4DQPA 3SI8A 4M9LA 4B9TA 4OJPA 1LKYB 3RRHA 5DDMA 2HHQA 1S5LU 5DBAA 1UA0A 3MABA 9ICTA 8ICQA 4DSLA 2JV3A 3G6XA 1DK3A 2KHQA 1S0OA 3I76A 1NJWA 4ECUA 5J0XA 3HWTA 4ED6A 5B66U 3M6KA 3S6JA 4OJLA 4IRCA 2JGAA 5EE3A 4NJ8A 2D6FC 1KFTA 2K4IA 2OM6A 1T3NA 5J2IA
chains in the Genus database with same CATH topology
3K1RB 5L1MA 2GLEA 1RG6A 2Y9TA 3TADC 3BQ7A 4IS7A 3HILA 2KMDA 4MHVA 5JRTA 2EAMA 4NL9C 1SGGA 2KSOB 2YTUA 5J8YC 3IDWA 1X66A 5JU5A 2F8KA 1SV0C 2KG5A 3BS7A 2QB0A 1UQVA 3BS5A 3TACB 1SV4A 2ES6A 1X9XA 3KKAC 4RQNA 1UCVA 2E8MA 2F44A 3SEIA 2QKQA 3SENA 1PK3A 3TADA 1F0MA 1LKYA 2F3NA 1PK1A 1X40A 2DKXA 5KNIA 2K60A 4NL9A 2QB0B 1SXDA 2DKZA 1WWUA 3BS5B 2E8OA 1B4FA 2E8PA 2B6GA 1COKA 2D3DA 2Y9UA 2KE7A 1V38A 4RQMA 2K4PA 1LKYB 5JTIA 2D8CA 1PK1B 2QARA 4PZOA 1DXSA 2EAPA 4PZNA 3H8MA 2E8NA 2EANA 2KIVA 5J8YA 1SXEA 1SV0A 1V85A 2JV3A 2DL0A 5F3XB 1WWVA 2L5YA 2LPEA 3KKAA 1KW4A 1Z1VA 2ESEA 2FE9A 2QARB 1OW5A 2KSOA 4NJ8A 1OXJA 1JI7A 2EAOA 1B0XA 2QB1A 2LMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1R B;  5L1M A;  2GLE A;  1RG6 A;  2Y9T A;  3TAD C;  3BQ7 A;  4IS7 A;  3HIL A;  2KMD A;  4MHV A;  5JRT A;  2EAM A;  4NL9 C;  1SGG A;  2KSO B;  2YTU A;  5J8Y C;  3IDW A;  1X66 A;  5JU5 A;  2F8K A;  1SV0 C;  2KG5 A;  3BS7 A;  2QB0 A;  1UQV A;  3BS5 A;  3TAC B;  1SV4 A;  2ES6 A;  1X9X A;  3KKA C;  4RQN A;  1UCV A;  2E8M A;  2F44 A;  3SEI A;  2QKQ A;  3SEN A;  1PK3 A;  3TAD A;  1F0M A;  1LKY A;  2F3N A;  1PK1 A;  1X40 A;  2DKX A;  5KNI A;  2K60 A;  4NL9 A;  2QB0 B;  1SXD A;  2DKZ A;  1WWU A;  3BS5 B;  2E8O A;  1B4F A;  2E8P A;  2B6G A;  1COK A;  2D3D A;  2Y9U A;  2KE7 A;  1V38 A;  4RQM A;  2K4P A;  1LKY B;  5JTI A;  2D8C A;  1PK1 B;  2QAR A;  4PZO A;  1DXS A;  2EAP A;  4PZN A;  3H8M A;  2E8N A;  2EAN A;  2KIV A;  5J8Y A;  1SXE A;  1SV0 A;  1V85 A;  2JV3 A;  2DL0 A;  5F3X B;  1WWV A;  2L5Y A;  2LPE A;  3KKA A;  1KW4 A;  1Z1V A;  2ESE A;  2FE9 A;  2QAR B;  1OW5 A;  2KSO A;  4NJ8 A;  1OXJ A;  1JI7 A;  2EAO A;  1B0X A;  2QB1 A;  2LMR A; 
#chains in the Genus database with same CATH topology
 2NRW A;  1D9F A;  2HOQ A;  4M6W A;  1UPH A;  3HP6 A;  3LVW A;  5KFI A;  1KTQ A;  2ASJ A;  4G9B A;  4IQU A;  4KLJ A;  5H2F U;  2HHU A;  4I2I A;  4YD2 A;  5L9X A;  7ICM A;  4XRH A;  4CF4 A;  5AM3 A;  3C21 A;  3D2N A;  4DFD A;  1X6J A;  5D4B A;  4J9O A;  2W43 A;  2YY6 A;  8ICI A;  2YMP A;  3RB0 A;  4CF5 A;  4RQ8 A;  4J9P A;  4LZD A;  1NNL A;  2GO7 A;  2I5H A;  3IP4 B;  2FLP A;  3N7P D;  2CN1 A;  5KFB A;  3QE9 Y;  4RQ3 A;  2DKX A;  4EEK A;  5ALR A;  4ED1 A;  2CRX A;  4ECY A;  4K4G A;  2MAX A;  1EXN A;  4OJ5 A;  4Y2R A;  2XY6 A;  4EX7 A;  4M0A A;  1SB3 C;  4I2D A;  5AI6 A;  3OJS A;  1KN5 A;  2DWQ A;  5ALJ A;  5AM5 A;  4PPX A;  5KFF A;  5J0P A;  1NJZ A;  2QAR A;  3K1Z A;  3KBB A;  3AQE A;  2K8A A;  2WF5 A;  3OSP A;  1QCK A;  1FO4 A;  1L8O A;  5DBB A;  3IN5 A;  4DF4 A;  4TUS A;  3PW0 A;  4RZR A;  2HI0 A;  1QLN A;  1YT3 A;  3NUQ A;  2RRD A;  5AKK A;  2NRZ A;  5L1J A;  5F3X B;  3JPS A;  4GXJ A;  5AI8 A;  2XY7 A;  4F4Z A;  4I2H A;  8ICR A;  4DQS A;  2ASD A;  1A6S A;  5KTQ A;  3AU2 A;  3OTQ A;  4ECS A;  5ALL A;  3NVZ A;  1C20 A;  2OYY A;  4C8N A;  3AL0 B;  2G08 A;  2IOF A;  8ICT A;  2HBM A;  3RB4 A;  9ICH A;  2NRT A;  3HKZ F;  4KLH A;  3RR8 A;  3OHB A;  2YMQ A;  3V6J A;  2Y1I A;  4F72 A;  2JEG A;  2KD1 A;  2KG5 A;  2HHW A;  1ZQG A;  1LV5 A;  2OXO A;  3TKA A;  5CHG A;  3TI0 A;  4MFF A;  5AK3 A;  5DB8 A;  2ISP A;  4F50 A;  5DQI A;  3U26 A;  3PW5 A;  4B9U A;  1VLB A;  1KDH A;  3BQ1 A;  3T5L A;  3OHA A;  5KFO A;  3D2Q A;  4DL4 A;  3WK6 A;  3PX0 A;  2WB1 C;  3T5K A;  2ISO A;  1ZD4 A;  3SMV A;  4EZ6 A;  8ICM A;  2A1J A;  2QLT A;  3H8S A;  1Z3E B;  2E8O A;  5J0Q A;  1ZXI A;  8ICZ A;  4I2C A;  1RYR A;  3TQ1 A;  3MR5 A;  1RYS A;  1K1Q A;  9ICF A;  4R65 A;  1N62 A;  5JUM A;  3F2D A;  4QWA A;  3PW7 A;  4DL5 A;  2W11 A;  1QSS A;  5KFG A;  5CJ7 A;  5KG5 A;  4PGX A;  7ICH A;  5JTI A;  3D2S A;  1JRO A;  2Z7J A;  3JPR A;  5KG2 A;  1ZQP A;  1DXS A;  1RPL A;  2XI9 A;  4J9N A;  8ICC A;  1RQN A;  5J2K A;  4QZF A;  1QQ5 A;  4EEY A;  4XA5 A;  3TAQ A;  4IR1 A;  4EEL A;  3PZP A;  2XGP A;  4IL6 U;  2Y0S C;  5DDY A;  9ICX A;  3IV6 A;  1L7P A;  3PX4 A;  1ZQE A;  5ALF A;  3LK9 A;  5AI4 A;  3Q8Q B;  1ZQR A;  1AQ6 A;  4UAZ A;  1PZN A;  7ICT A;  3MGV A;  2KEY A;  4RQ4 A;  4EYH B;  5HP4 A;  2KSO A;  4ELU A;  4ED3 A;  7ICS A;  5HHH A;  4I29 A;  8ICE A;  4QZC A;  2RQ5 A;  9ICQ A;  5KFE A;  1LVH A;  2XY5 A;  9ICL A;  5CR0 A;  3WK9 A;  3BQ7 A;  1ZD2 P;  5EWE A;  3QZ7 A;  3OPX A;  3LWL A;  2BCS A;  1QTM A;  5DLF A;  8ICH A;  2M0N A;  1JRP A;  2LM1 A;  2KOB A;  3BS5 A;  8ICV A;  2AQ0 A;  2RP5 A;  1X9X A;  5KFN A;  2G07 A;  4I27 A;  2PI4 A;  8ICU A;  3MDC A;  4Z6E A;  2HHS A;  3BQ2 A;  2JZB A;  3DDH A;  3SEN A;  2HOI A;  2W9C A;  1JMS A;  3E0F A;  7ICI A;  5KFY A;  7ICN A;  4ELT A;  2R8K A;  4QZH A;  3AEV A;  2I9G A;  1Q3V A;  1ZQD A;  1WWU A;  3H4B A;  4QZ9 A;  3H0M B;  2B21 A;  4UAV A;  4RQ0 A;  4EBE A;  4M9J A;  2M9N A;  3JPT A;  1O03 A;  4LVS A;  5ALP A;  2JR5 A;  2JEJ A;  1HIW A;  1S97 A;  1V97 A;  2IMW P;  5AKZ A;  8ICG A;  1TV9 A;  3CP8 A;  3M9N B;  4DL7 A;  5DQG A;  3UQ0 A;  3C2M A;  1V85 A;  3H4D A;  1SKR A;  2K4H A;  4Z6C A;  1OW5 A;  4UB2 A;  2FPK A;  1A0P A;  2HBJ A;  4P0Q A;  2QB1 A;  3KD3 A;  2Q0Z X;  1Q3U A;  2BCQ A;  4DFM A;  4F5R A;  4O3Q A;  4KIT B;  2FLN A;  3KHR A;  1N56 A;  2F8L A;  4UAU A;  5ALO A;  4NV0 A;  4J9L A;  3Q8P B;  4IQT A;  7ICE A;  4RPY A;  2ZIU B;  5EE1 A;  2BGW A;  1J2N A;  4ZOH C;  3IDW A;  4J03 A;  4ED2 A;  1HUZ A;  4YQW A;  4LJX A;  4FFD A;  1WG8 A;  3MDA A;  4YR3 A;  4F4Y A;  5J2G A;  3OSN A;  4P2H A;  2WB1 F;  1HEK A;  4HAI A;  5DB7 A;  9ICG A;  4UB3 A;  4EYI B;  5J2A A;  1F0M A;  1VJ5 A;  4DEZ A;  5AIC A;  3GIL A;  5KG7 A;  4UB5 A;  3KZX A;  3TAP A;  3QUC A;  3TFR A;  1L3T A;  2ZXI A;  4B9M A;  2BPC A;  2DFL A;  5KG0 A;  3RJJ A;  4KN7 A;  4P0P B;  3RB3 A;  3JPO A;  2R8J A;  3F53 A;  3I1Y A;  4CRX A;  2Y0S F;  2V4Q A;  1NOM A;  4F93 B;  2IOH A;  1QSL A;  4DFP A;  2DL0 A;  3QUB A;  4ED0 A;  1D8Y A;  3NVV A;  2HSZ A;  3K75 D;  5AM1 A;  4KLE A;  4F71 A;  3QX7 A;  1OXJ A;  1PVR A;  1X6I A;  2J6U A;  1BVS A;  4EZ9 A;  3PX6 A;  5C5J A;  2FMQ A;  1NJX A;  3M9M B;  4O3M A;  1ZQM A;  3FAH A;  5L1L A;  1ZQ1 C;  1L5U A;  1ZQX A;  4RQ1 A;  4NL9 C;  3ONN A;  1KFD A;  8ICY A;  5FP0 A;  2W03 A;  1KL9 A;  5BOL A;  3BQ0 A;  1UQV A;  3N7R C;  4M6W B;  1RDF A;  4ECX A;  4QW8 A;  1SKW A;  4NXZ A;  4RQN A;  1U9L A;  1KBU A;  2MRL A;  4RT3 A;  3ISB A;  5EOZ A;  1IV8 A;  1PUZ A;  2HVH A;  1KKX A;  3TAD A;  1TVA A;  3NRZ A;  3PR4 A;  4UBC A;  5KFA A;  1KRP A;  3BDP A;  1KLN A;  4OJ6 A;  2DKZ A;  4I2B A;  3Q8K A;  1ZD3 A;  5KAF U;  1Q8K A;  3HJE A;  4JUZ A;  2WTF A;  5AKL A;  2W54 A;  3L5K A;  1NKC A;  4GC7 A;  3MGI A;  5KAI U;  1PVP A;  1FEZ A;  4R8U A;  2MUT A;  4NLB A;  1X9W A;  3ICX A;  3RR7 A;  4RNO A;  1L3U A;  1BGX T;  4CE6 A;  4KTQ A;  2ZJA A;  4NLC A;  4P4O A;  1L7O A;  2ZIX A;  3V7L A;  3E2E A;  2WFA A;  4ZH4 A;  2KJ9 A;  2MSN A;  2NO5 A;  2J6T A;  3IG8 A;  2KJ5 A;  4QZA A;  4Y2X A;  2QAR B;  5KG6 A;  5J2E A;  2MA1 A;  2HBL A;  2XO7 A;  1NJY A;  2YQE A;  3SV3 A;  2LHT A;  5AI5 A;  1SIJ A;  2DF4 B;  3C23 A;  4JWN A;  4EX6 A;  3B9J A;  5HR7 A;  1XO1 A;  4IRD A;  4UAS A;  5DG8 A;  1F44 A;  5DB9 A;  2XCP A;  2AH5 A;  4UQG A;  1F5S A;  2YN4 A;  4UW9 A;  1S0M A;  2ZJ8 A;  2KFN A;  1MA7 A;  4PHP A;  4RQ6 A;  3NAS A;  1L7N A;  1TK0 A;  2PFQ A;  4GFJ A;  2FPL A;  1NZP A;  4B6J A;  2A19 A;  3VC8 A;  3JPN A;  1NZB A;  2YB1 A;  3LWM A;  4F5O A;  8ICB A;  4O3N A;  5CA7 A;  1J97 A;  7ICK A;  4P4P A;  3PY8 A;  1S77 D;  4U6P A;  1ZD5 A;  1BPD A;  2N1R A;  3TAR A;  2FLL A;  2VA8 A;  1PK1 A;  2LYA A;  4DSF A;  1KEJ A;  2UVW A;  2B0C A;  1KSP A;  1S0V A;  3F2C A;  3AN1 A;  2E8P A;  3FM9 A;  2ZIW A;  3EPI A;  1T94 A;  5KFU A;  2OEH A;  1UT8 A;  2KVC A;  1K1S A;  3JPP A;  2PI5 A;  7ICJ A;  1L8L A;  4F3O A;  5J29 A;  4PHA A;  4Y2U A;  3IRU A;  1Y88 A;  1WCN A;  3EZ5 A;  4KMO B;  2KTQ A;  5ALH A;  2VJ4 A;  2A1J B;  3H0L B;  5KT4 A;  2LM4 A;  2E8N A;  4UB4 A;  5TZV A;  4TUP A;  4BWJ A;  4DL3 A;  2RDI A;  3MC1 A;  1SXE A;  2W3R A;  5HHI A;  4BJQ A;  1ZQY A;  5AKX A;  3H40 A;  4IRK A;  4DFK A;  2NRX A;  3V7K A;  4F8R A;  2RLT A;  3RFA A;  1X42 A;  2UVV A;  3AQF A;  4A8E A;  2W9M A;  4YVZ A;  3ISC A;  3QZ8 A;  1ZQQ A;  5ALV A;  4KX5 A;  1JAL A;  8ICA A;  1ZQV A;  1XU4 A;  1CEZ A;  3BZK A;  2ZUB A;  1BPX A;  5IIJ A;  4NLZ A;  5KFZ A;  4CDG A;  1ZQS A;  3LDA A;  3PNC A;  9ICO A;  1SL1 A;  3M1Y A;  2WF6 A;  4Y2P A;  5JRT A;  3UPQ A;  3ZDE A;  2LI6 A;  4UB6 U;  2KSO B;  1YZ7 A;  3HPO A;  1JIH A;  1X66 A;  3ZDD A;  2JMG A;  1M6Y A;  2JEI A;  5HML A;  4FO6 A;  3GIM A;  1SWV A;  3NVW A;  2P66 A;  4Q8F A;  2K4E A;  2AGO A;  3PO4 A;  4JWM A;  3AU6 A;  2KZ3 A;  4YD1 A;  4GXK A;  1ZQI A;  2AGQ A;  3RJH A;  1Z00 A;  3C1Y A;  2ZIV A;  4O3R A;  3V6H A;  4F92 B;  2EDU A;  3WKD A;  4ED8 A;  5AK6 A;  4C7Y A;  3BS5 B;  4ECR A;  2HMX A;  5F9L A;  1MQ2 A;  5DG7 A;  4YMM A;  3MFH A;  4I2J A;  2W9A A;  1BPB A;  5ALM A;  3ED5 A;  1MQ3 A;  2XC9 A;  3T5J A;  5IIO A;  2FMP A;  2JZB B;  1T3Q A;  2Q4T A;  1ED1 A;  2W9C B;  1ZQN A;  2VKQ A;  1L6N A;  4BXO A;  4O3O A;  5KFD A;  4UAW A;  3RAX A;  3NS1 A;  4EEN A;  4ECQ A;  1Z19 A;  2EAN A;  2LKY A;  1ZYQ A;  3RJE A;  4PHD A;  1CI4 A;  1WWV A;  2L5Y A;  2LBO A;  1TAQ A;  4KLQ A;  4QZ8 A;  5KFX A;  3WU2 U;  4YMN A;  3ZDB A;  2ZUD A;  3KZI U;  3RRG A;  3BQT A;  2YX8 A;  2W8K A;  2OHF A;  2FMS A;  3J81 j;  1U4B A;  4PHE A;  1KQQ A;  4O5K A;  2BKE A;  2WF7 A;  4DSE A;  5ALD A;  2A3V A;  5AKG A;  4F5P A;  2FJ6 A;  4MHV A;  3OGU A;  4ELV A;  3MBY A;  4TUR A;  3H8W A;  4RQ5 A;  4F4K A;  4P0Q B;  4QZB A;  5KG1 A;  1T7P A;  2F44 A;  4YXM A;  3AMZ A;  3O0F A;  3M8S A;  1U49 A;  2W3S A;  4O5C A;  3IHQ B;  4YP3 A;  5TIS U;  1NK6 A;  1DGS A;  1ZQW A;  5DKW A;  1B43 A;  3ALR A;  4KLS A;  4F2R A;  2H5X A;  2W04 A;  1Q46 A;  3C29 A;  1T4G A;  3AM9 A;  5AHX A;  2KNJ A;  2PKE A;  4K4H A;  2K89 A;  3PMN A;  4ECZ A;  4X5V A;  9ICK A;  4PZN A;  4FS1 A;  3QU4 A;  5A0L A;  3GU3 A;  1S9F A;  4U7C A;  3QU7 A;  5G5H A;  1ZRN A;  2CXY A;  2LPE A;  4RPZ A;  5ALX A;  2OWO A;  4IR9 A;  4QWB A;  2DQN B;  2AU0 A;  2KHV A;  3A0H U;  2IBK A;  1U48 A;  1B0X A;  9ICN A;  2BQ3 A;  2LMR A;  3K1R B;  1X2I A;  5AK5 A;  5ALN A;  1XWL A;  3K4G A;  1LB2 B;  4QNL A;  8ICK A;  2C22 A;  3WK5 A;  3RJI A;  5DGA A;  1Z4O A;  2WAQ C;  3HIL A;  9ICA A;  1ZQK A;  5J2J A;  5KG4 A;  4KLF A;  4DSI A;  3DV9 A;  3T3F A;  4Z6D A;  4B9V A;  7ICQ A;  1MN8 A;  3QYP A;  1ZRM A;  2VJ5 A;  3MFI A;  4F5N A;  3UMB A;  4C4R A;  2Y1J A;  1ZQT A;  4F5Q A;  2BQR A;  4DLG A;  1SXD A;  2H3V A;  3V6K A;  2BZF A;  1QSY A;  4AYB C;  2KKP A;  2EZX A;  2NV3 A;  1FIQ A;  2W7P A;  5KFL A;  2KK0 A;  4DL6 A;  2DUY A;  1K5O A;  1XS9 D;  5L1K A;  1MSW D;  4Q8E A;  2HCF A;  3CYM A;  4QIW C;  2IHM A;  3CW2 C;  1S8O A;  4UAY A;  5B5E U;  5HMM A;  2ZJ5 A;  4UAR A;  5CEH A;  3H8M A;  3UQ2 A;  9ICB A;  2KIC A;  4M9N A;  3G6V A;  8ICX A;  4KMU A;  1ZQC A;  4MF2 A;  4C8L A;  3HX0 A;  4R8U B;  2MUT B;  5E79 U;  9ICW A;  4F4X A;  5CP2 A;  4Q43 A;  5J0W A;  2PFO A;  2NO4 A;  4NM1 A;  2F1I A;  3SAF A;  4F91 B;  3N7S C;  2ZIX B;  4R63 A;  2GLE A;  1BPZ A;  3IG5 A;  3GII A;  9ICV A;  1L3V A;  4KX3 A;  2EZY A;  4NWI A;  2W7O A;  4ECW A;  1ECW A;  1IG6 A;  1HJP A;  2EAM A;  4FBT A;  1CUK A;  4O5E A;  3MR3 A;  4QZE A;  3V7J A;  2BCV A;  2WF8 A;  4NLG A;  3A0B U;  1SV4 A;  2HHV A;  2DPJ A;  3PV8 A;  3RTV A;  1NKB A;  1U47 A;  2BDP A;  1XSN A;  1ZQO A;  4YFK A;  1UCV A;  5GTI U;  2JRZ A;  5ALZ A;  5IIN A;  2QKQ A;  2VA2 A;  1N2X A;  1SL2 A;  2R8G A;  2KP7 A;  4BDP A;  2JXJ A;  3RH4 A;  4XQ8 A;  1L3S A;  4UB1 A;  4KLU A;  2G5I B;  3FC4 A;  2K8C B;  5KFV A;  4KLL A;  4KLI A;  3OJU A;  7ICV A;  5IIM A;  3H8J A;  1IIP A;  2G0A A;  5AKY A;  3Q8L A;  4GIB A;  3RJK A;  5T14 A;  4I28 A;  2F76 X;  4K4I A;  5ALK A;  1PK1 B;  1TKD A;  4I2G A;  3E58 A;  4JV2 A;  2NRV A;  3GV5 B;  3SAG A;  4AP9 A;  4UAT A;  5ALW A;  1D8B A;  5KFH A;  4C7Z A;  2ZIW B;  4P4M A;  3Q8R B;  4DWI A;  4FBU A;  4O0I A;  2BQU A;  2VAN A;  4O3S A;  3EPG A;  5KG3 A;  4BX9 C;  7ICL A;  1B22 A;  2ZUC A;  3N97 B;  4Y2J A;  2FE9 A;  4HYK A;  4ED7 A;  4C0Z A;  4DF8 A;  1L7M A;  5CRX A;  1MC8 A;  2H3Z A;  1PVQ A;  3C5F A;  4MFC A;  2WAQ F;  4G3I A;  1X9M A;  1NI3 A;  4RUC A;  3LYS A;  5EE9 A;  3TAD C;  7ICR A;  4IS7 A;  4NY8 A;  8ICJ A;  2XVT A;  4GC6 A;  2HDO A;  2AGP A;  3R9K A;  2QB0 A;  3C1Z A;  5ALQ A;  4YCX A;  2HHX A;  3RBE A;  3GDX A;  5C0Y A;  3WK8 A;  4I2E A;  1DRG A;  3RJF A;  4J9M A;  5KFP A;  3EYZ A;  1D8L A;  3QU5 A;  1NK0 A;  3ETR A;  2F3N A;  4J9R A;  3F5A A;  2C28 A;  1A77 A;  4KLT A;  4AYB F;  1RXW A;  2ZXH A;  5J0R A;  1XNS A;  3RB6 A;  1UT5 A;  5AI0 A;  1COO A;  4I2A A;  3PVX A;  5ALE A;  1B4F A;  2W9B A;  1BNP A;  3L3F X;  3C2L A;  8ICL A;  2Y9U A;  1O08 A;  3H7I A;  4PL1 A;  2KE7 A;  4QIW F;  1V38 A;  4JK1 A;  5DLG A;  3PW2 A;  1Z1B A;  1ZQF A;  2HHT A;  3PR5 B;  3KHH A;  3DEE A;  2UVR A;  2UVU A;  3TFS A;  1Z00 B;  2EZZ A;  2ZIV B;  1Z4N A;  2D8C A;  2GWS A;  1P7D A;  3Q8M A;  2EH9 A;  4FZL A;  3T79 A;  4DFJ A;  1NK8 A;  4M9H A;  1DGJ A;  2C2E A;  2J6S A;  4CGZ A;  3QNM A;  1D9D A;  3UXN A;  2H3I A;  2ODG A;  3UXO A;  5KT6 A;  2KKV A;  2AQ4 A;  3F5E A;  2P35 A;  2FI1 A;  1DK2 A;  5G5G A;  3N28 A;  3N4M B;  2VIX A;  3ZDC A;  4BXO B;  7ICG A;  3QU9 A;  4Q44 A;  1RQL A;  7ICO A;  9ICU A;  5AKI A;  4YR2 A;  3SYZ A;  1XSP A;  1JI7 A;  4J9K A;  5AK4 A;  9ICS A;  2KZM A;  4GXI A;  5L1M A;  2KIW A;  3NRW A;  3M6Z A;  1N5W A;  1IXR A;  2WF9 A;  2GH1 A;  4EBD A;  3BZC A;  1NKE A;  3WKE A;  4QWE A;  5ALU A;  1SGG A;  2EQY A;  5KFJ A;  4QZD A;  1FFU A;  2AHO B;  3UMG A;  5JU5 A;  1T8E A;  2R18 A;  5AI9 A;  4C4T A;  1SL0 A;  2JEF A;  2G06 A;  3KTQ A;  5CB1 A;  2V4R A;  5D46 A;  2KZZ A;  3RJG A;  2RHF A;  3SEI A;  3VCB A;  2KVS A;  4OD0 A;  4B9N A;  3H0R B;  1LKY A;  2I1Q A;  1NK7 A;  1GO3 F;  4UBB A;  5KT5 A;  4KLM A;  4NM2 A;  1URJ A;  9ICM A;  4PJ0 U;  2E5S A;  1SZH A;  3SQI A;  2H3Q A;  3ZI4 A;  2XCA A;  1UHU A;  4TQS A;  5AM2 A;  3MR6 A;  1ZJM A;  4QZG A;  3SD7 A;  3SV4 A;  1QQ7 A;  4DS4 A;  2EAP A;  2BR0 A;  3ZD9 A;  1JXE A;  4E0D A;  4JMU A;  2MU2 A;  8ICF A;  1QQ6 A;  3KHG A;  3KOO A;  2NYV A;  3PW4 A;  1TAM A;  1CRX A;  3GZF A;  1S0N A;  4QWD A;  2DPI A;  2E1F A;  3NVY A;  5KFR A;  1TAU A;  1WYG A;  1KW4 A;  1Z1V A;  4UB8 U;  3RH6 A;  5K4L A;  4IQV A;  4KLD A;  4F4W A;  2H3F A;  2EAO A;  2HOF A;  4ACO A;  4DS5 A;  1TFR A;  5AIA A;  1RG6 A;  4MEX A;  1HUO A;  5ALT A;  2OH2 A;  5D49 A;  2CPR A;  4DCC A;  5DG9 A;  1QH9 A;  4Z6F A;  9ICI A;  4Y2Q A;  2R8I A;  1RYU A;  4CCH A;  3WKB A;  3ORY A;  2IA6 A;  2ASL A;  4DOA A;  4M9G A;  4KN4 A;  2XGQ A;  5DQH A;  3C2K A;  1N63 A;  4BGD A;  2R8H A;  3BS7 A;  1ZJN A;  2HBK A;  3TAC B;  4DSK A;  3GQC A;  5J0T A;  4FZM A;  2BHN A;  2E8M A;  2KV2 A;  2PXI A;  4RT2 A;  1N61 A;  4USA A;  4Q45 A;  4RNN A;  3SR6 A;  1DOQ A;  4DLE A;  1SZP A;  1SKS A;  3JPQ A;  4DL2 A;  1J2M A;  2K60 A;  1NK4 A;  5J2D A;  2K8B B;  2PFN A;  2BCR A;  1UA1 A;  4OJO A;  3T5H A;  1ZQH A;  3RF9 A;  2JHD A;  1RM6 C;  4OCZ A;  7ICF A;  5IIL A;  2VA3 A;  5AIB A;  8ICP A;  2ZTE A;  4EBC A;  4DOC A;  5KFS A;  2KN7 A;  3RH5 A;  4M04 A;  4NLK A;  4PH5 A;  1ZQZ A;  3M9O B;  2BCU A;  3BJY A;  8ICW A;  1BPY A;  3QEB Z;  9ICE A;  2ATL A;  3HRD D;  4BUG A;  4ICA A;  4RNM A;  3QUQ A;  2PMZ C;  2G5H B;  1ZOL A;  1A76 A;  2A1A A;  4DO9 A;  2FPM A;  5KFK A;  4XUS A;  2ESE A;  5AKJ A;  9ICJ A;  5KFC A;  4IC9 A;  1OUQ A;  4M47 A;  4RQ7 A;  4TQR A;  4Y2V A;  3EWA A;  3UM9 A;  3B0Y A;  1SWW A;  3ETL A;  3WKA A;  3M8R A;  2IHN A;  4QWC A;  2ZTD A;  5IIK A;  3B0X A;  3L4P A;  3PSI A;  4RUA A;  4DQR A;  2KMD A;  1ZET A;  2XID A;  2HW3 A;  8ICN A;  1RZT A;  4US9 A;  4CNQ A;  2E3T A;  2YTU A;  4B9L A;  1C7Y A;  2KFZ A;  4TUQ A;  3QU2 A;  4DOB A;  5J0O A;  5KFQ A;  3GV7 B;  1WUD A;  5DGB A;  3V72 A;  4PGY A;  2P6R A;  3SAH A;  3KFU F;  2ES6 A;  4YN4 A;  2ZG6 A;  3GIJ A;  3C5G A;  1TK8 A;  4YXJ A;  5AKH A;  2HVI A;  2F77 X;  4JV0 A;  3ZDA A;  2PFP A;  5ALY A;  1ZQJ A;  4C80 A;  5J0Y A;  5KFW A;  1PK3 A;  2JH7 A;  1ZQA A;  3MGH A;  4Y2Y A;  1RXV A;  2RDJ A;  3Q8S B;  4US8 A;  2O6K A;  4OO1 J;  3RAQ A;  2OCE A;  3THV A;  2JH1 A;  4C8M A;  2F1H A;  4JB3 A;  1IM4 A;  2D3D A;  3SZ2 A;  2GOL A;  5GTH U;  1JX4 A;  5L1I A;  2ALZ A;  2AXT U;  5DBC A;  4NLN A;  4QJF B;  5KT2 A;  5KL8 B;  1JN3 A;  4RQ2 A;  1XC9 A;  3G6Y A;  4PGQ A;  3WKC A;  3PSF A;  3EUB 2;  2IOF K;  5J0U A;  1N48 A;  4R66 A;  5J8Y A;  2P6U A;  4O3P A;  2BPF A;  3CNH A;  1JUD A;  4QW9 A;  5EWG A;  3ZD8 A;  4KLG A;  5KT3 A;  5AM0 A;  7ICP A;  7ICU A;  3KHL A;  3KKA A;  5III A;  3HW8 A;  4RU9 A;  3ISD A;  4CF3 A;  3TAN A;  4ECT A;  2F1J A;  1FFV A;  3D6J A;  3EW9 A;  3CRX A;  4C8O A;  4J9Q A;  2DGZ A;  1WCL A;  4DQQ A;  2DBY A;  2Y9T A;  5F9N A;  8ICS A;  5J8Y C;  1ZQU A;  3NTU A;  3LVV A;  1KFS A;  5EWF A;  9ICC A;  4WJ3 B;  3FDS A;  1TK5 A;  2E1E A;  1S76 D;  3KKA C;  4O9M A;  4I2F A;  3UMC A;  4PL2 A;  3FYH A;  5J2F A;  4KLO A;  1U45 A;  3QUT A;  3M7D A;  1S10 A;  2V9W A;  4R64 A;  4DQI A;  2FDR A;  5BOM A;  4MF8 A;  2WHE A;  1ARO P;  4NL9 A;  5EE0 A;  2QB0 B;  2XIC A;  1BPE A;  4DSJ A;  3C28 A;  3QEA Z;  4RPX A;  3QXG A;  2B6G A;  4YR0 A;  2KJ8 A;  2F2A B;  4GLX A;  4C4S A;  3UXP A;  5HR6 A;  1V9P A;  2K4P A;  3WK4 A;  4QZI A;  5J2B A;  1N60 A;  4PZO A;  2BDU A;  4BWM A;  4MFA A;  5J2C A;  1ZQB A;  5ALS A;  2KIV A;  3F2B A;  2PMZ F;  2W9B B;  3RBD A;  3PSP A;  4FE3 A;  1YZ6 A;  5J2H A;  4FS2 A;  5HNK A;  4B9S A;  1SV0 A;  2YB4 A;  4ECV A;  2I6X A;  8ICO A;  4YMO A;  2C2R A;  4FZN A;  4Y2T A;  4IQW A;  5AM4 A;  9ICR A;  2LYB A;  2ZIU A;  4J9S A;  4MEY A;  5AKE A;  9ICP A;  5DB6 A;  4YG2 A;  2W8L A;  1XO0 A;  3GIK A;  1BNO A;  1VDV A;  1N5X A;  2ZTC A;  2BPG A;  5J0S A;  3MR2 A;  4F2S A;  4JV1 A;  3NGD A;  2G09 A;  4Y2S A;  2YMM A;  4M2Y A;  2AJQ A;  2W55 A;  5KFT A;  3PST A;  3HKZ C;  2F8K A;  1SV0 C;  5KL1 B;  1JXL A;  5KFM A;  4C8K A;  5CWR A;  1H38 A;  3GFK B;  4LZG A;  2LYH A;  3I28 A;  1NK5 A;  2YML A;  4P0P A;  1ZQL A;  3HT3 A;  5ALG A;  1X9S A;  1X40 A;  3PO5 A;  5KNI A;  3WK7 A;  5KT7 A;  2C2D A;  1NK9 A;  5BPC A;  3IM1 A;  3GV8 B;  3AUO A;  3PML A;  5ALI A;  1COK A;  1XSL A;  1TE2 A;  4RQM A;  4DQP A;  3SI8 A;  4M9L A;  4B9T A;  4OJP A;  1LKY B;  3RRH A;  5DDM A;  2HHQ A;  1S5L U;  5DBA A;  1UA0 A;  3MAB A;  9ICT A;  8ICQ A;  4DSL A;  2JV3 A;  3G6X A;  1DK3 A;  2KHQ A;  1S0O A;  3I76 A;  1NJW A;  4ECU A;  5J0X A;  3HWT A;  4ED6 A;  5B66 U;  3M6K A;  3S6J A;  4OJL A;  4IRC A;  2JGA A;  5EE3 A;  4NJ8 A;  2D6F C;  1KFT A;  2K4I A;  2OM6 A;  1T3N A;  5J2I A; 
#chains in the Genus database with same CATH homology
 3K1R B;  5L1M A;  2GLE A;  1RG6 A;  2Y9T A;  3TAD C;  3BQ7 A;  4IS7 A;  3HIL A;  2KMD A;  4MHV A;  5JRT A;  2EAM A;  4NL9 C;  1SGG A;  2KSO B;  2YTU A;  5J8Y C;  3IDW A;  1X66 A;  5JU5 A;  2F8K A;  1SV0 C;  2KG5 A;  3BS7 A;  2QB0 A;  1UQV A;  3BS5 A;  3TAC B;  1SV4 A;  2ES6 A;  1X9X A;  3KKA C;  4RQN A;  1UCV A;  2E8M A;  2F44 A;  3SEI A;  2QKQ A;  3SEN A;  1PK3 A;  3TAD A;  1F0M A;  1LKY A;  2F3N A;  1PK1 A;  1X40 A;  2DKX A;  5KNI A;  2K60 A;  4NL9 A;  2QB0 B;  1SXD A;  2DKZ A;  1WWU A;  3BS5 B;  2E8O A;  1B4F A;  2E8P A;  2B6G A;  1COK A;  2D3D A;  2Y9U A;  2KE7 A;  1V38 A;  4RQM A;  2K4P A;  1LKY B;  5JTI A;  2D8C A;  1PK1 B;  2QAR A;  4PZO A;  1DXS A;  2EAP A;  4PZN A;  3H8M A;  2E8N A;  2EAN A;  2KIV A;  5J8Y A;  1SXE A;  1SV0 A;  1V85 A;  2JV3 A;  2DL0 A;  5F3X B;  1WWV A;  2L5Y A;  2LPE A;  3KKA A;  1KW4 A;  1Z1V A;  2ESE A;  2FE9 A;  2QAR B;  1OW5 A;  2KSO A;  4NJ8 A;  1OXJ A;  1JI7 A;  2EAO A;  1B0X A;  2QB1 A;  2LMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...