4RQMA

Crystal structure of the semet bicc1 sam domain r924e mutant
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
b'KGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKMLLAISELNKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein bicaudal C homolog 1
molecule tags Protein binding
source organism Homo sapiens
publication title Characterization of the SAM Domain of BICC1
rcsb
total genus 19
structure length 63
sequence length 63
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4rqmA01
2QB0B 2EAOA 1OW5A 4NL9C 4RQMA 1SXEA 5KNIA 1SV4A 1X9XA 2F3NA 2LMRA 1SV0C 3TACB 5J8YA 4PZNA 3TADA 1B0XA 2KE7A 4RQNA 2KSOB 2KSOA 5JTIA 2F8KA 2E8MA 1X40A 1LKYB 1WWVA 1Z1VA 2F44A 2GLEA 4PZOA 3K1RB 3SEIA 2DKXA 5L1MA 2JV3A 3SENA 1UQVA 2K60A 1SV0A 4NJ8A 2D3DA 2B6GA 2EAMA 2QB1A 5JRTA 3BS7A 1COKA 2ESEA 2KIVA 3HILA 2E8OA 2E8NA 4MHVA 3KKAC 1RG6A 1V38A 2ES6A 2DKZA 2KMDA 1PK3A 2EANA 1OXJA 1UCVA 1JI7A 3BS5A 1B4FA 2E8PA 2Y9UA 3IDWA 3BQ7A 3BS5B 2Y9TA 1LKYA 4IS7A 3H8MA 5J8YC 2QKQA 3KKAA 4NL9A 2DL0A 1F0MA 1PK1B 1KW4A 2QB0A 2QARA 5JU5A 2L5YA 2KG5A 2D8CA 1SXDA 1SGGA 1X66A 2YTUA 2K4PA 1WWUA 2FE9A 2LPEA 3TADC 2QARB 2EAPA 1DXSA 5F3XB 1PK1A 1V85A
chains in the Genus database with same CATH superfamily
1A6SA 8ICVA 3ZD9A 3IV6A 2EAOA 1ZQRA 3C29A 3UXOA 3PW2A 8ICRA 4RNNA 4J9MA 5J2FA 3F2DA 4ED8A 3QYPA 5DQHA 4B6JA 3CYMA 4XA5A 4O0IA 2H5XA 3HKZC 3N7RC 4RQNA 5E79U 5KG7A 4QZIA 5DB8A 2J6SA 4PJ0U 5ALMA 5L1LA 4ELTA 2ZJ5A 3PSFA 1V97A 2EDUA 3DV9A 2W7PA 9ICMA 2J6TA 4AP9A 4IQVA 4TUPA 5EE0A 2PFQA 1QSYA 1UQVA 4DSKA 3KHRA 5J0XA 3AMZA 2K8CB 3BZCA 4KX5A 1H38A 7ICJA 4NJ8A 4DLGA 3GILA 3PMNA 2W04A 5ALGA 2F8LA 2K89A 5J2HA 7ICLA 5ALHA 2KD1A 3QU2A 5B66U 1ZQ1C 4QWEA 8ICZA 3MFHA 2UVUA 4PGQA 3NVWA 2I5HA 2KNJA 1PK3A 5HR6A 1KL9A 1JXLA 4JB3A 2LHTA 2PMZF 2DUYA 2WAQF 9ICEA 1NJWA 3BS5B 5CWRA 5KT3A 1LKYA 3OGUA 1NKBA 2O6KA 5J0PA 5KFZA 5KT7A 3O0FA 4NL9A 5EWFA 3D2NA 3PVXA 2D8CA 1SKWA 5KG1A 5KG5A 1UPHA 5AI9A 5AKYA 3GU3A 1S0MA 4FO6A 1HJPA 4GFJA 3WK6A 3D2SA 4Y2RA 3MABA 3PW7A 4I2DA 5ALTA 1COOA 4ECZA 1ZETA 5KFQA 5J0WA 1SV4A 2PXIA 2BQ3A 5ALVA 3H40A 1WUDA 5J2JA 1P7DA 4KLSA 3WK9A 3MC1A 5JTIA 4E0DA 1ECWA 2XICA 3I1YA 5HNKA 4FBUA 1Z1VA 3C2MA 4PGXA 3IRUA 5IILA 3RB3A 1X2IA 2YB1A 2XY6A 1CUKA 4BXOA 2WB1C 4GXIA 5J0UA 3SMVA 5KFSA 1X42A 1IV8A 5EWEA 2GO7A 4OJPA 2OYYA 2ALZA 1TK5A 1COKA 2BKEA 1SL1A 1FFUA 4KTQA 4P0PB 3TARA 3NRWA 4UB3A 1T7PA 5KFFA 2LYAA 4B9UA 3RH5A 2D6FC 1SL2A 1VLBA 1RQLA 1BVSA 2IHNA 3RJJA 2AQ4A 2H3VA 2BCQA 2JEFA 3ISCA 3QUCA 3UMGA 5BOMA 3UMCA 2F1IA 2KIWA 1Z00A 1S0OA 5ALZA 4MFAA 3GIMA 3KTQA 3IHQB 1SGGA 2XCPA 4RPXA 4GLXA 2KK0A 2ZJ8A 2KN7A 3D2QA 5ALEA 1ZQCA 5KFHA 4C7ZA 4QWBA 2KJ5A 5KFXA 5KT6A 4ECTA 1ZXIA 5KFCA 1X9XA 3C1YA 3N97B 2P6UA 3QU4A 4UASA 4Q8FA 4ED1A 1Q46A 4ACOA 4F71A 4DL6A 1S76D 4EYHB 2FI1A 1SWWA 1KLNA 3EWAA 3GZFA 1ZJNA 2BR0A 3C2KA 3BQ1A 4R63A 2WF7A 2PFNA 1KFSA 2ZG6A 3NVYA 4QWCA 3S6JA 3Q8MA 4ECWA 3H7IA 4RQ4A 2G5IB 2EZYA 1NKEA 3TFSA 5AI8A 4G3IA 2LI6A 2F1JA 2JHDA 3HILA 4LZDA 4KITB 4O3SA 2WTFA 2P66A 3BQ0A 3RTVA 1DK3A 3ISBA 4A8EA 5AM5A 4I2FA 1OXJA 5AM4A 2VJ5A 4ELUA 4Y2YA 5KFLA 2W54A 9ICWA 4JV0A 3T5KA 1BPDA 4NV0A 4Z6DA 7ICHA 4CF4A 4U7CA 4IQTA 2KOBA 2Q4TA 2JZBB 3KFUF 1NK8A 9ICFA 2W3SA 2JRZA 4RT3A 1NJXA 4P0QA 4EX6A 2KG5A 4B9LA 5AIBA 2IA6A 5DB7A 2JR5A 2W55A 3PW4A 4F2SA 3V7LA 5DGAA 4O9MA 9ICKA 5EE3A 1PK1A 3RJKA 8ICBA 4KLFA 1XO0A 2HDOA 3LK9A 1BPEA 4F91B 4JV1A 1U48A 5KG3A 4RPYA 4KLJA 1S9FA 2KZZA 2JEIA 4OJOA 4DL2A 4C8MA 4XQ8A 3WK7A 3GV7B 4B9NA 2BPCA 4FFDA 4UB6U 4EX7A 1MQ2A 8ICXA 1MA7A 8ICGA 2P35A 4USAA 3ZDAA 1L7MA 3B0XA 4QZFA 4RUAA 5HP4A 2BDPA 1Z19A 1RM6C 2NRZA 2JEGA 1NK7A 4CE6A 1KFTA 3MR2A 4PHAA 5KFIA 4DL7A 4F50A 5HR7A 4QIWC 3V72A 1WG8A 2WHEA 9ICAA 5ALJA 1KN5A 1ZJMA 3GDXA 4DOAA 3LYSA 1ZQYA 2LYBA 5DQGA 8ICPA 3M7DA 3V7JA 3RR7A 3ALRA 4TUSA 1MQ3A 1VJ5A 2XGQA 2KMDA 2WF5A 2A1JA 2W9AA 2IOHA 4QZCA 2WAQC 4HAIA 1O08A 1PVRA 2QLTA 3KHLA 4F72A 5KFBA 4KLOA 3H8MA 1KBUA 1IM4A 1PK1B 1JMSA 3RJFA 4M9HA 2E5SA 4IR1A 5DG8A 1C20A 3RB6A 5KFGA 2QARB 5KG6A 5KFNA 4M9GA 4RQ1A 4PPXA 1ZQAA 9ICXA 1KDHA 5HHIA 2CXYA 4O3NA 8ICOA 3NVZA 3JPRA 3TQ1A 2JH7A 1NK6A 4ELVA 4QWAA 1SIJA 3M6ZA 1IG6A 1NK9A 4EYIB 2ZIXB 2GLEA 4KLMA 9ICIA 1IIPA 2E1FA 2FPMA 2H3QA 2C2EA 4KMUA 2DKXA 5L1MA 1T94A 4O3PA 3KHHA 2F2AB 2JV3A 1NK0A 5KG4A 2EZXA 1BNPA 2E3TA 4JK1A 3PV8A 1D8YA 5ALQA 3AM9A 1ZQXA 2V4QA 3F53A 3C28A 1K1SA 4YXJA 2H3IA 1O03A 3HW8A 3T5HA 3ICXA 2VANA 5J2GA 8ICJA 8ICAA 1L5UA 3LDAA 2V9WA 1ZQOA 5AHXA 5HMLA 2R8KA 1PVPA 2E8PA 3IDWA 2IOFK 4KLUA 4RUCA 3SQIA 4BUGA 1Z4OA 4Q44A 4EZ6A 4DO9A 4ECSA 3QZ7A 5DKWA 2Y1IA 2HBMA 2DF4B 4IS7A 3QXGA 1U49A 2MA1A 4EEYA 1ZQBA 8ICKA 4AYBC 4KLQA 2DL0A 5ALDA 3V6HA 4DFKA 3N7SC 1FEZA 5GTIU 2HW3A 3EUB2 5DG7A 2EH9A 3QX7A 1ZQTA 2OCEA 4UBBA 2EAPA 4R8UA 3EPGA 3L4PA 3A0HU 5AKGA 3OHAA 2A19A 4P4OA 4I28A 1OW5A 4KLLA 4YN4A 3LVWA 3BQTA 3KZXA 4DL5A 4YVZA 1S77D 1Q3UA 3TAQA 7ICOA 4BWMA 4C0ZA 5J2KA 2IHMA 4P0QB 2HBLA 3FM9A 2KSOA 2PKEA 3M8SA 3MFIA 4NXZA 3HKZF 1ED1A 5DGBA 5DLFA 2K8BB 3RJEA 1ZQQA 4KLEA 3SENA 1RDFA 8ICUA 4B9TA 3AU6A 2UVRA 4CGZA 2NRTA 2ASLA 2KZMA 1ZQEA 4UB2A 4ED3A 1PUZA 1K5OA 5J0OA 5ALRA 1J2NA 3SAFA 3KHGA 4QZGA 2XIDA 2I9GA 1DGSA 2ESEA 5KFDA 2ZIWA 3QUBA 2E8OA 3MDCA 3PX4A 2W8KA 2CRXA 2W9BA 1UHUA 1TAQA 2HHTA 2BCVA 3PO4A 5IIKA 4C4TA 2W9CA 3WKDA 4Q8EA 2Z7JA 2Y9UA 2NRVA 4IQUA 4DFPA 1L3VA 2HOFA 1S8OA 2C2RA 1NJZA 3E2EA 5J2EA 4J9OA 5KFMA 4ECYA 5KFKA 4XUSA 4I2GA 1EXNA 5G5GA 2W11A 2MAXA 1NI3A 5L1JA 4FZLA 3GIKA 4KN7A 3QE9Y 2AGOA 2Q0ZX 4EELA 1DXSA 2BGWA 1CI4A 5CRXA 3K1ZA 2NYVA 3A0BU 2C22A 5ALUA 3M6KA 3G6VA 4YD1A 2KJ8A 5H2FU 2YB4A 5AM3A 2YQEA 4UARA 3OTQA 5CJ7A 3FC4A 4ED7A 4F2RA 1MSWD 2HMXA 1L7PA 2A1JB 1SL0A 5ALKA 3QEBZ 4UAVA 5ALIA 1JIHA 4RNOA 4UB5A 5AI5A 2AXTU 1X9MA 1N56A 2ISOA 2ISPA 5AICA 3RJIA 5AI4A 4FBTA 3CRXA 2DQNB 3PO5A 4Z6CA 4GC7A 5ALLA 1PZNA 4ECQA 1XC9A 2QB1A 2K8AA 2ZTEA 2YMPA 4IRCA 1ZRMA 3K4GA 2LYHA 1RG6A 4NLGA 1HEKA 4Y2SA 1J2MA 4DSEA 2VA2A 3KD3A 4DL3A 2MUTB 4OJ6A 1D9FA 1URJA 2RDJA 5DDYA 3QUQA 1RYUA 2W7OA 5GTHU 1N2XA 2NO5A 2XO7A 4DFDA 1SWVA 3G6XA 5EOZA 4J9PA 4KLDA 5AKEA 4Q43A 1LV5A 2HOIA 3KBBA 2F76X 3IP4B 4CDGA 2A3VA 4YD2A 2XI9A 1SB3C 4RQ7A 1ZD2P 4EZ9A 4LZGA 1BNOA 2LM4A 4JV2A 5F3XB 4NLZA 1TE2A 2CPRA 3CW2C 3FYHA 4M9JA 1TAMA 2GOLA 4QZDA 4RQMA 2LMRA 3TACB 5J8YA 1RXVA 2G5HB 3JPPA 2I6XA 5IIOA 4UAYA 3GFKB 5DB6A 4ED6A 1N60A 3ETRA 4DF8A 4Q45A 4GC6A 2W9MA 1LKYB 3J81j 5KL8B 5J0QA 4UAUA 4F5RA 3OSPA 2HHSA 4ECUA 1T3NA 4F8RA 4M6WA 1QSLA 1BPBA 2ZIVA 2OEHA 2XCAA 3PR4A 4F92B 4K4IA 5C0YA 5AKZA 2XY5A 2R8GA 4FE3A 4RQ2A 4PHDA 7ICPA 3L5KA 5ALWA 3NVVA 3MR6A 4C4SA 4NY8A 2G06A 4KN4A 4Y2XA 4QWDA 3HWTA 2RLTA 4IC9A 1KEJA 2PI4A 2JZBA 5ALNA 2KP7A 9ICHA 3F5AA 1ZQKA 2BPGA 3RJGA 4UW9A 4I2HA 3GIJA 1XS9D 4BWJA 4PL2A 4PHPA 1ZQMA 4JWMA 4F5OA 2I1QA 1JXEA 4NLCA 1NK4A 1WCLA 3OPXA 4C8LA 4KLTA 4NLBA 8ICWA 1KW4A 2QB0A 2RRDA 9ICOA 1L7NA 3HX0A 2AQ0A 3WKBA 4BGDA 3SR6A 2HSZA 4QW8A 2R8JA 5DBBA 3H8WA 1Z3EB 3AQEA 1QSSA 3Q8KA 1GO3F 2KZ3A 2HHWA 2KVSA 3U26A 4ICAA 2OXOA 4M9NA 5KFYA 2F3NA 3T3FA 8ICHA 1KSPA 4DOBA 1OUQA 4OCZA 5ALPA 4DSLA 4I2CA 4DL4A 3AU2A 5AKLA 2KE7A 4R66A 4I2JA 5J0YA 1ZQPA 7ICGA 2BHNA 2N1RA 3EYZA 2MU2A 1WWVA 4LJXA 3LWMA 5HMMA 4I2AA 1L8OA 9ICRA 5KFVA 5AM1A 4RQ5A 3SEIA 2PFPA 4F4XA 4DFMA 2VA3A 5DQIA 3HP6A 9ICSA 2VA8A 1XSLA 1FO4A 2D3DA 4KLGA 4C8NA 5KG0A 3RR8A 5AM2A 5JRTA 1Y88A 3RB4A 4CCHA 1NZPA 3ONNA 1HIWA 3KKAC 2JGAA 5KAIU 1A0PA 4US9A 9ICNA 3PSIA 4FZMA 2DKZA 2EQYA 1U4BA 3TKAA 3UQ2A 3D6JA 1TK0A 3HJEA 3NUQA 2HHUA 4YCXA 3T5LA 2BZFA 4Y2TA 4XRHA 5ALSA 2ZJAA 1N5XA 3KKAA 4YMOA 1XSNA 1U47A 1ZQIA 1MC8A 2QARA 3UXNA 4FS1A 1B43A 2KEYA 2ZIUB 1X6JA 2VKQA 4G9BA 5L1KA 2ZUCA 3ZDBA 3T5JA 5KAFU 3IG8A 1ZQZA 2Y0SC 5A0LA 1TFRA 2ZIVB 5KFAA 4J9KA 4X5VA 3ETLA 1S10A 3IM1A 3V7KA 3GQCA 3HRDD 5B5EU 1K1QA 5JUMA 2JXJA 1N63A 3WK5A 4YFKA 4O3QA 3ZI4A 5KT4A 3UQ0A 1N5WA 3UM9A 1RYSA 4WJ3B 2KJ9A 5AIAA 1IXRA 3RRGA 3QU9A 3WK4A 3WKAA 3AQFA 1XU4A 3H8SA 3MBYA 3PW0A 1LB2B 5KFWA 2RQ5A 2K4HA 4Y2PA 4F5NA 5ALYA 5AK3A 2BQUA 2XC9A 2DWQA 4MFFA 5CB1A 1DRGA 7ICTA 1D9DA 5KFPA 4MF8A 3GIIA 2G09A 4M0AA 3Q8LA 5D46A 3I28A 3EW9A 4IL6U 4RT2A 4F4WA 2KIVA 4M04A 2C28A 8ICNA 3ZDDA 4F4ZA 4F5PA 1ZQDA 2H3FA 4JUZA 3HT3A 1V38A 4Y2JA 1ZQUA 4I27A 2LKYA 3VC8A 4AYBF 3NS1A 3CNHA 2W9BB 1UT8A 4BX9C 3DEEA 8ICTA 3RRHA 1ZQFA 4GXKA 1JI7A 1FIQA 5CP2A 1B4FA 2FMPA 4QNLA 4QZBA 2DFLA 4F3OA 4O3RA 3JPTA 3N28A 1JALA 1ZQSA 2E1EA 4F4KA 3SI8A 4CF5A 2UVVA 3EZ5A 2OM6A 4O3MA 3IN5A 4NM1A 3C23A 1SXDA 4MEYA 1QLNA 3RBEA 1ZD5A 1QCKA 1XNSA 3GV5B 2KICA 1TVAA 9ICUA 1RPLA 1RQNA 2IBKA 4DF4A 1ZQVA 3IG5A 4UAWA 1N62A 3SD7A 2YMMA 4NWIA 2JMGA 1S5LU 4M2YA 2JH1A 4P4PA 1SV0C 5AKJA 5KL1B 3JPQA 3MGIA 4DQPA 2DGZA 2A1AA 4YP3A 3SYZA 4GXJA 2PFOA 1TKDA 1AQ6A 2KSOB 5J0TA 2F8KA 1HUZA 4P0PA 2E8MA 1A76A 3I76A 3QU5A 1C7YA 3FDSA 1QH9A 4PZOA 1S0NA 2ZTDA 4B9VA 2FLNA 5DBCA 5T14A 5KT2A 5IIIA 3Q8QB 8ICMA 2BQRA 4C80A 1ZQHA 4QJFB 3OJSA 1XWLA 4OJ5A 4RNMA 1BPYA 3RFAA 4UBCA 7ICMA 3DDHA 3ZD8A 8ICEA 1Q3VA 4R64A 1Z1BA 3M1YA 2B21A 2HBJA 2W03A 4QIWF 4RQ8A 5KFTA 4IQWA 2V4RA 2VIXA 5C5JA 4DCCA 3MGHA 2NRWA 1KKXA 3MR5A 3SV4A 4QZHA 4GIBA 3QEAZ 3BQ2A 1YZ7A 4O5KA 2XGPA 2J6UA 5G5HA 3SV3A 3MDAA 5JU5A 4BJQA 2FLLA 3RAQA 4M47A 3C5GA 5J29A 3H0LB 2MRLA 1X66A 2K4PA 2R8IA 1JX4A 2YX8A 4Y2VA 3RB0A 2LPEA 4YMNA 1SKSA 3SAHA 2KHVA 5HHHA 3V6KA 1SZHA 5KFEA 3F2BA 2YMLA 5ALXA 1L3SA 1SXEA 5KNIA 1B22A 4B9SA 2C2DA 3BDPA 4PL1A 1XSPA 2KKPA 1L7OA 9ICJA 1NNLA 2NV3A 5J2IA 4J9RA 4ECXA 1F5SA 4RU9A 4DLEA 4OO1J 3ORYA 3TFRA 4BDPA 4YG2A 1UA1A 3C2LA 5K4LA 3KZIU 3OSNA 1X9SA 1M6YA 5ALFA 2ZUDA 3L3FX 2P6RA 2ATLA 2M9NA 2FPLA 1U9LA 1SV0A 2KVCA 4R8UB 4B9MA 1X6IA 1ZD4A 1KTQA 3BS7A 5J2BA 4ECVA 4J9LA 3QUTA 5KFRA 3E58A 4DWIA 2PI5A 3TANA 2ZXIA 2F1HA 4KLHA 4DFJA 1Z00B 4MFCA 3OJUA 2VJ4A 1T8EA 2EANA 3NASA 5IIMA 4ZOHC 2DPJA 4DSFA 2FMQA 5AK6A 2Y9TA 3H4DA 2UVWA 1QQ6A 4K4HA 1T4GA 1ZOLA 4UB1A 5J8YC 8ICSA 4DQSA 1F0MA 4EENA 2DPIA 1X9WA 2WFAA 3RF9A 5J2AA 4DQRA 4FZNA 3VCBA 4CNQA 8ICCA 3TADC 4QZ9A 4PGYA 3CP8A 4O5EA 7ICSA 4TURA 3BJYA 3TI0A 3JPOA 4UB8U 2AJQA 5EWGA 1MN8A 1QQ7A 5AKKA 4KMOB 4YR0A 4QZAA 4EBCA 2ODGA 5KFJA 2G07A 1BPXA 4UB4A 7ICUA 1B0XA 4Y2QA 4YQWA 4I2BA 5L9XA 5DB9A 1JRPA 1NKCA 4F93B 2ZUBA 1X40A 4QW9A 4I2IA 4M6WB 2F44A 4C7YA 3AEVA 9ICLA 2ASJA 3ISDA 1S97A 4FS2A 4I29A 3WK8A 2EZZA 4R65A 3UXPA 4F4YA 1DK2A 2RP5A 3QZ8A 5F9NA 2H3ZA 1QQ5A 4O5CA 2KV2A 2M0NA 2LBOA 5CR0A 4P4MA 3PZPA 2W8LA 5F9LA 3AL0B 5AI0A 2AGPA 4NLKA 4BXOB 4C4RA 1J97A 2FPKA 5CEHA 2IOFA 4NM2A 4M9LA 3N4MB 5AM0A 5KTQA 3NGDA 2ASDA 3NTUA 4OJLA 3BS5A 3FAHA 4Z6EA 4IRDA 5J2CA 3KOOA 5KFOA 5DDMA 1LVHA 3F2CA 2OHFA 4EEKA 2YMQA 1NK5A 5D4BA 4EBEA 1BPZA 2W3RA 3R9KA 1ZYQA 5CA7A 2OH2A 3ZDCA 2HHQA 1JN3A 2HVHA 5ALOA 4J9NA 2BPFA 3LWLA 1ZQGA 4ED2A 3UMBA 2ZIWB 7ICNA 2GWSA 9ICVA 1N61A 4IR9A 3EPIA 5AK4A 2ZIUA 5J0RA 5TZVA 3WKCA 2W9CB 3PSPA 3ED5A 4J9SA 1PVQA 4MEXA 4KLIA 3M9NB 4RQ3A 2WF8A 3WKEA 1AROP 2CN1A 2HCFA 4RQ0A 4UAZA 3SAGA 2HHXA 2OWOA 3PX6A 1RZTA 1L3UA 9ICCA 2LM1A 3B9JA 2HI0A 3H8JA 1QTMA 1SKRA 1BGXT 2RDIA 2KHQA 3K1RB 3V6JA 1VDVA 3SZ2A 1NJYA 9ICBA 4ED0A 4J9QA 3RBDA 5EE1A 5AI6A 4DSIA 1DOQA 1KQQA 4IRKA 4ECRA 3AN1A 4I2EA 2PMZC 4TQRA 5CHGA 4DS5A 8ICIA 1D8LA 2E8NA 1TV9A 3PW5A 1V9PA 2F77X 2NRXA 4TQSA 2BCRA 8ICLA 1L3TA 1YT3A 3F5EA 1UCVA 2HOQA 4EBDA 3H4BA 3BZKA 3OHBA 4DOCA 3T79A 2RHFA 2BCSA 4JMUA 5KFUA 1KFDA 5J0SA 5AKXA 4LVSA 3AUOA 1RYRA 1ZQJA 2GH1A 3M9OB 3PMLA 2K4IA 5BPCA 4O3OA 9ICQA 2L5YA 1Q8KA 4C8OA 2G08A 4NLNA 4Z6FA 4RQ6A 4UQGA 4DQQA 2HHVA 2KFNA 3M8RA 1KRPA 1NOMA 2MUTA 4F5QA 1T3QA 2W43A 2KFZA 4PHEA 5IIJA 2Y0SF 2FDRA 2K4EA 4PZNA 2MSNA 3Q8PB 3G6YA 3TADA 1N48A 2IMWP 3JPNA 3PX0A 4RPZA 4PH5A 1TK8A 1ZRNA 3HPOA 3PSTA 4DEZA 1U45A 1XO1A 3UPQA 3C21A 3E0FA 4K4GA 1L6NA 2WF6A 4CF3A 3MGVA 2AU0A 2AH5A 4YR3A 3MR3A 1CEZA 8ICYA 3C5FA 4DS4A 9ICGA 4YXMA 5KG2A 2KTQA 4YMMA 2YN4A 2XY7A 2ES6A 1WCNA 3ZDEA 4MF2A 3H0RB 4QZEA 4Y2UA 3GV8B 5AKIA 5EE9A 3BQ7A 3QU7A 1NZBA 4ZH4A 5DG9A 1WYGA 7ICVA 2FJ6A 2AGQA 2DBYA 2WF9A 5J2DA 2B0CA 3RH4A 3PNCA 1L8LA 1JROA 2FMSA 7ICKA 3C1ZA 1TAUA 1V85A 4U6PA 2G0AA 2QB0B 4JWNA 1ZQLA 4QZ8A 3JPSA 4NL9C 9ICPA 2XVTA 5D49A 3N7PD 4CRXA 3Q8SB 3RH6A 2BCUA 1UT5A 1SZPA 4J03A 2YY6A 1FFVA 2WB1F 3B0YA 5L1IA 3RJHA 5TISU 4DQIA 2R18A 1YZ6A 2R8HA 5IINA 4DSJA 1UA0A 1ZQNA 2AHOB 1RXWA 1D8BA 1ZD3A 3THVA 2KKVA 3PY8A 3Q8RB 5KT5A 1S0VA 2ZIXA 8ICFA 2FLPA 8ICQA 5AKHA 3H0MB 2BDUA 5DBAA 3PR5B 2K60A 7ICIA 5FP0A 4C8KA 4US8A 3WU2U 2HBKA 2B6GA 2EAMA 1Z4NA 4KX3A 2HVIA 1JUDA 3K75D 4MHVA 3RAXA 1CRXA 3TAPA 9ICTA 7ICQA 3QNMA 3LVVA 2NO4A 7ICFA 4TUQA 7ICEA 2Y1JA 3M9MB 1DGJA 3NRZA 1ZQWA 2ZTCA 2QKQA 5AK5A 7ICRA 5DLGA 4OD0A 1A77A 4P2HA 2ZXHA 2JEJA 2YTUA 4RZRA 1WWUA 1F44A 2FE9A 4YR2A 4UATA 1HUOA 4HYKA 5BOLA
chains in the Genus database with same CATH topology
2QB0B 2EAOA 1OW5A 4NL9C 4RQMA 1SXEA 5KNIA 1SV4A 1X9XA 2F3NA 2LMRA 1SV0C 3TACB 5J8YA 4PZNA 3TADA 1B0XA 2KE7A 4RQNA 2KSOB 2KSOA 5JTIA 2F8KA 2E8MA 1X40A 1LKYB 1WWVA 1Z1VA 2F44A 2GLEA 4PZOA 3K1RB 3SEIA 2DKXA 5L1MA 2JV3A 3SENA 1UQVA 2K60A 1SV0A 4NJ8A 2D3DA 2B6GA 2EAMA 2QB1A 5JRTA 3BS7A 1COKA 2ESEA 2KIVA 3HILA 2E8OA 2E8NA 4MHVA 3KKAC 1RG6A 1V38A 2ES6A 2DKZA 2KMDA 1PK3A 2EANA 1OXJA 1UCVA 1JI7A 3BS5A 1B4FA 2E8PA 2Y9UA 3IDWA 3BQ7A 3BS5B 2Y9TA 1LKYA 4IS7A 3H8MA 5J8YC 2QKQA 3KKAA 4NL9A 2DL0A 1F0MA 1PK1B 1KW4A 2QB0A 2QARA 5JU5A 2L5YA 2KG5A 2D8CA 1SXDA 1SGGA 1X66A 2YTUA 2K4PA 1WWUA 2FE9A 2LPEA 3TADC 2QARB 2EAPA 1DXSA 5F3XB 1PK1A 1V85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QB0 B;  2EAO A;  1OW5 A;  4NL9 C;  4RQM A;  1SXE A;  5KNI A;  1SV4 A;  1X9X A;  2F3N A;  2LMR A;  1SV0 C;  3TAC B;  5J8Y A;  4PZN A;  3TAD A;  1B0X A;  2KE7 A;  4RQN A;  2KSO B;  2KSO A;  5JTI A;  2F8K A;  2E8M A;  1X40 A;  1LKY B;  1WWV A;  1Z1V A;  2F44 A;  2GLE A;  4PZO A;  3K1R B;  3SEI A;  2DKX A;  5L1M A;  2JV3 A;  3SEN A;  1UQV A;  2K60 A;  1SV0 A;  4NJ8 A;  2D3D A;  2B6G A;  2EAM A;  2QB1 A;  5JRT A;  3BS7 A;  1COK A;  2ESE A;  2KIV A;  3HIL A;  2E8O A;  2E8N A;  4MHV A;  3KKA C;  1RG6 A;  1V38 A;  2ES6 A;  2DKZ A;  2KMD A;  1PK3 A;  2EAN A;  1OXJ A;  1UCV A;  1JI7 A;  3BS5 A;  1B4F A;  2E8P A;  2Y9U A;  3IDW A;  3BQ7 A;  3BS5 B;  2Y9T A;  1LKY A;  4IS7 A;  3H8M A;  5J8Y C;  2QKQ A;  3KKA A;  4NL9 A;  2DL0 A;  1F0M A;  1PK1 B;  1KW4 A;  2QB0 A;  2QAR A;  5JU5 A;  2L5Y A;  2KG5 A;  2D8C A;  1SXD A;  1SGG A;  1X66 A;  2YTU A;  2K4P A;  1WWU A;  2FE9 A;  2LPE A;  3TAD C;  2QAR B;  2EAP A;  1DXS A;  5F3X B;  1PK1 A;  1V85 A; 
#chains in the Genus database with same CATH topology
 1A6S A;  8ICV A;  3ZD9 A;  3IV6 A;  2EAO A;  1ZQR A;  3C29 A;  3UXO A;  3PW2 A;  8ICR A;  4RNN A;  4J9M A;  5J2F A;  3F2D A;  4ED8 A;  3QYP A;  5DQH A;  4B6J A;  3CYM A;  4XA5 A;  4O0I A;  2H5X A;  3HKZ C;  3N7R C;  4RQN A;  5E79 U;  5KG7 A;  4QZI A;  5DB8 A;  2J6S A;  4PJ0 U;  5ALM A;  5L1L A;  4ELT A;  2ZJ5 A;  3PSF A;  1V97 A;  2EDU A;  3DV9 A;  2W7P A;  9ICM A;  2J6T A;  4AP9 A;  4IQV A;  4TUP A;  5EE0 A;  2PFQ A;  1QSY A;  1UQV A;  4DSK A;  3KHR A;  5J0X A;  3AMZ A;  2K8C B;  3BZC A;  4KX5 A;  1H38 A;  7ICJ A;  4NJ8 A;  4DLG A;  3GIL A;  3PMN A;  2W04 A;  5ALG A;  2F8L A;  2K89 A;  5J2H A;  7ICL A;  5ALH A;  2KD1 A;  3QU2 A;  5B66 U;  1ZQ1 C;  4QWE A;  8ICZ A;  3MFH A;  2UVU A;  4PGQ A;  3NVW A;  2I5H A;  2KNJ A;  1PK3 A;  5HR6 A;  1KL9 A;  1JXL A;  4JB3 A;  2LHT A;  2PMZ F;  2DUY A;  2WAQ F;  9ICE A;  1NJW A;  3BS5 B;  5CWR A;  5KT3 A;  1LKY A;  3OGU A;  1NKB A;  2O6K A;  5J0P A;  5KFZ A;  5KT7 A;  3O0F A;  4NL9 A;  5EWF A;  3D2N A;  3PVX A;  2D8C A;  1SKW A;  5KG1 A;  5KG5 A;  1UPH A;  5AI9 A;  5AKY A;  3GU3 A;  1S0M A;  4FO6 A;  1HJP A;  4GFJ A;  3WK6 A;  3D2S A;  4Y2R A;  3MAB A;  3PW7 A;  4I2D A;  5ALT A;  1COO A;  4ECZ A;  1ZET A;  5KFQ A;  5J0W A;  1SV4 A;  2PXI A;  2BQ3 A;  5ALV A;  3H40 A;  1WUD A;  5J2J A;  1P7D A;  4KLS A;  3WK9 A;  3MC1 A;  5JTI A;  4E0D A;  1ECW A;  2XIC A;  3I1Y A;  5HNK A;  4FBU A;  1Z1V A;  3C2M A;  4PGX A;  3IRU A;  5IIL A;  3RB3 A;  1X2I A;  2YB1 A;  2XY6 A;  1CUK A;  4BXO A;  2WB1 C;  4GXI A;  5J0U A;  3SMV A;  5KFS A;  1X42 A;  1IV8 A;  5EWE A;  2GO7 A;  4OJP A;  2OYY A;  2ALZ A;  1TK5 A;  1COK A;  2BKE A;  1SL1 A;  1FFU A;  4KTQ A;  4P0P B;  3TAR A;  3NRW A;  4UB3 A;  1T7P A;  5KFF A;  2LYA A;  4B9U A;  3RH5 A;  2D6F C;  1SL2 A;  1VLB A;  1RQL A;  1BVS A;  2IHN A;  3RJJ A;  2AQ4 A;  2H3V A;  2BCQ A;  2JEF A;  3ISC A;  3QUC A;  3UMG A;  5BOM A;  3UMC A;  2F1I A;  2KIW A;  1Z00 A;  1S0O A;  5ALZ A;  4MFA A;  3GIM A;  3KTQ A;  3IHQ B;  1SGG A;  2XCP A;  4RPX A;  4GLX A;  2KK0 A;  2ZJ8 A;  2KN7 A;  3D2Q A;  5ALE A;  1ZQC A;  5KFH A;  4C7Z A;  4QWB A;  2KJ5 A;  5KFX A;  5KT6 A;  4ECT A;  1ZXI A;  5KFC A;  1X9X A;  3C1Y A;  3N97 B;  2P6U A;  3QU4 A;  4UAS A;  4Q8F A;  4ED1 A;  1Q46 A;  4ACO A;  4F71 A;  4DL6 A;  1S76 D;  4EYH B;  2FI1 A;  1SWW A;  1KLN A;  3EWA A;  3GZF A;  1ZJN A;  2BR0 A;  3C2K A;  3BQ1 A;  4R63 A;  2WF7 A;  2PFN A;  1KFS A;  2ZG6 A;  3NVY A;  4QWC A;  3S6J A;  3Q8M A;  4ECW A;  3H7I A;  4RQ4 A;  2G5I B;  2EZY A;  1NKE A;  3TFS A;  5AI8 A;  4G3I A;  2LI6 A;  2F1J A;  2JHD A;  3HIL A;  4LZD A;  4KIT B;  4O3S A;  2WTF A;  2P66 A;  3BQ0 A;  3RTV A;  1DK3 A;  3ISB A;  4A8E A;  5AM5 A;  4I2F A;  1OXJ A;  5AM4 A;  2VJ5 A;  4ELU A;  4Y2Y A;  5KFL A;  2W54 A;  9ICW A;  4JV0 A;  3T5K A;  1BPD A;  4NV0 A;  4Z6D A;  7ICH A;  4CF4 A;  4U7C A;  4IQT A;  2KOB A;  2Q4T A;  2JZB B;  3KFU F;  1NK8 A;  9ICF A;  2W3S A;  2JRZ A;  4RT3 A;  1NJX A;  4P0Q A;  4EX6 A;  2KG5 A;  4B9L A;  5AIB A;  2IA6 A;  5DB7 A;  2JR5 A;  2W55 A;  3PW4 A;  4F2S A;  3V7L A;  5DGA A;  4O9M A;  9ICK A;  5EE3 A;  1PK1 A;  3RJK A;  8ICB A;  4KLF A;  1XO0 A;  2HDO A;  3LK9 A;  1BPE A;  4F91 B;  4JV1 A;  1U48 A;  5KG3 A;  4RPY A;  4KLJ A;  1S9F A;  2KZZ A;  2JEI A;  4OJO A;  4DL2 A;  4C8M A;  4XQ8 A;  3WK7 A;  3GV7 B;  4B9N A;  2BPC A;  4FFD A;  4UB6 U;  4EX7 A;  1MQ2 A;  8ICX A;  1MA7 A;  8ICG A;  2P35 A;  4USA A;  3ZDA A;  1L7M A;  3B0X A;  4QZF A;  4RUA A;  5HP4 A;  2BDP A;  1Z19 A;  1RM6 C;  2NRZ A;  2JEG A;  1NK7 A;  4CE6 A;  1KFT A;  3MR2 A;  4PHA A;  5KFI A;  4DL7 A;  4F50 A;  5HR7 A;  4QIW C;  3V72 A;  1WG8 A;  2WHE A;  9ICA A;  5ALJ A;  1KN5 A;  1ZJM A;  3GDX A;  4DOA A;  3LYS A;  1ZQY A;  2LYB A;  5DQG A;  8ICP A;  3M7D A;  3V7J A;  3RR7 A;  3ALR A;  4TUS A;  1MQ3 A;  1VJ5 A;  2XGQ A;  2KMD A;  2WF5 A;  2A1J A;  2W9A A;  2IOH A;  4QZC A;  2WAQ C;  4HAI A;  1O08 A;  1PVR A;  2QLT A;  3KHL A;  4F72 A;  5KFB A;  4KLO A;  3H8M A;  1KBU A;  1IM4 A;  1PK1 B;  1JMS A;  3RJF A;  4M9H A;  2E5S A;  4IR1 A;  5DG8 A;  1C20 A;  3RB6 A;  5KFG A;  2QAR B;  5KG6 A;  5KFN A;  4M9G A;  4RQ1 A;  4PPX A;  1ZQA A;  9ICX A;  1KDH A;  5HHI A;  2CXY A;  4O3N A;  8ICO A;  3NVZ A;  3JPR A;  3TQ1 A;  2JH7 A;  1NK6 A;  4ELV A;  4QWA A;  1SIJ A;  3M6Z A;  1IG6 A;  1NK9 A;  4EYI B;  2ZIX B;  2GLE A;  4KLM A;  9ICI A;  1IIP A;  2E1F A;  2FPM A;  2H3Q A;  2C2E A;  4KMU A;  2DKX A;  5L1M A;  1T94 A;  4O3P A;  3KHH A;  2F2A B;  2JV3 A;  1NK0 A;  5KG4 A;  2EZX A;  1BNP A;  2E3T A;  4JK1 A;  3PV8 A;  1D8Y A;  5ALQ A;  3AM9 A;  1ZQX A;  2V4Q A;  3F53 A;  3C28 A;  1K1S A;  4YXJ A;  2H3I A;  1O03 A;  3HW8 A;  3T5H A;  3ICX A;  2VAN A;  5J2G A;  8ICJ A;  8ICA A;  1L5U A;  3LDA A;  2V9W A;  1ZQO A;  5AHX A;  5HML A;  2R8K A;  1PVP A;  2E8P A;  3IDW A;  2IOF K;  4KLU A;  4RUC A;  3SQI A;  4BUG A;  1Z4O A;  4Q44 A;  4EZ6 A;  4DO9 A;  4ECS A;  3QZ7 A;  5DKW A;  2Y1I A;  2HBM A;  2DF4 B;  4IS7 A;  3QXG A;  1U49 A;  2MA1 A;  4EEY A;  1ZQB A;  8ICK A;  4AYB C;  4KLQ A;  2DL0 A;  5ALD A;  3V6H A;  4DFK A;  3N7S C;  1FEZ A;  5GTI U;  2HW3 A;  3EUB 2;  5DG7 A;  2EH9 A;  3QX7 A;  1ZQT A;  2OCE A;  4UBB A;  2EAP A;  4R8U A;  3EPG A;  3L4P A;  3A0H U;  5AKG A;  3OHA A;  2A19 A;  4P4O A;  4I28 A;  1OW5 A;  4KLL A;  4YN4 A;  3LVW A;  3BQT A;  3KZX A;  4DL5 A;  4YVZ A;  1S77 D;  1Q3U A;  3TAQ A;  7ICO A;  4BWM A;  4C0Z A;  5J2K A;  2IHM A;  4P0Q B;  2HBL A;  3FM9 A;  2KSO A;  2PKE A;  3M8S A;  3MFI A;  4NXZ A;  3HKZ F;  1ED1 A;  5DGB A;  5DLF A;  2K8B B;  3RJE A;  1ZQQ A;  4KLE A;  3SEN A;  1RDF A;  8ICU A;  4B9T A;  3AU6 A;  2UVR A;  4CGZ A;  2NRT A;  2ASL A;  2KZM A;  1ZQE A;  4UB2 A;  4ED3 A;  1PUZ A;  1K5O A;  5J0O A;  5ALR A;  1J2N A;  3SAF A;  3KHG A;  4QZG A;  2XID A;  2I9G A;  1DGS A;  2ESE A;  5KFD A;  2ZIW A;  3QUB A;  2E8O A;  3MDC A;  3PX4 A;  2W8K A;  2CRX A;  2W9B A;  1UHU A;  1TAQ A;  2HHT A;  2BCV A;  3PO4 A;  5IIK A;  4C4T A;  2W9C A;  3WKD A;  4Q8E A;  2Z7J A;  2Y9U A;  2NRV A;  4IQU A;  4DFP A;  1L3V A;  2HOF A;  1S8O A;  2C2R A;  1NJZ A;  3E2E A;  5J2E A;  4J9O A;  5KFM A;  4ECY A;  5KFK A;  4XUS A;  4I2G A;  1EXN A;  5G5G A;  2W11 A;  2MAX A;  1NI3 A;  5L1J A;  4FZL A;  3GIK A;  4KN7 A;  3QE9 Y;  2AGO A;  2Q0Z X;  4EEL A;  1DXS A;  2BGW A;  1CI4 A;  5CRX A;  3K1Z A;  2NYV A;  3A0B U;  2C22 A;  5ALU A;  3M6K A;  3G6V A;  4YD1 A;  2KJ8 A;  5H2F U;  2YB4 A;  5AM3 A;  2YQE A;  4UAR A;  3OTQ A;  5CJ7 A;  3FC4 A;  4ED7 A;  4F2R A;  1MSW D;  2HMX A;  1L7P A;  2A1J B;  1SL0 A;  5ALK A;  3QEB Z;  4UAV A;  5ALI A;  1JIH A;  4RNO A;  4UB5 A;  5AI5 A;  2AXT U;  1X9M A;  1N56 A;  2ISO A;  2ISP A;  5AIC A;  3RJI A;  5AI4 A;  4FBT A;  3CRX A;  2DQN B;  3PO5 A;  4Z6C A;  4GC7 A;  5ALL A;  1PZN A;  4ECQ A;  1XC9 A;  2QB1 A;  2K8A A;  2ZTE A;  2YMP A;  4IRC A;  1ZRM A;  3K4G A;  2LYH A;  1RG6 A;  4NLG A;  1HEK A;  4Y2S A;  1J2M A;  4DSE A;  2VA2 A;  3KD3 A;  4DL3 A;  2MUT B;  4OJ6 A;  1D9F A;  1URJ A;  2RDJ A;  5DDY A;  3QUQ A;  1RYU A;  2W7O A;  5GTH U;  1N2X A;  2NO5 A;  2XO7 A;  4DFD A;  1SWV A;  3G6X A;  5EOZ A;  4J9P A;  4KLD A;  5AKE A;  4Q43 A;  1LV5 A;  2HOI A;  3KBB A;  2F76 X;  3IP4 B;  4CDG A;  2A3V A;  4YD2 A;  2XI9 A;  1SB3 C;  4RQ7 A;  1ZD2 P;  4EZ9 A;  4LZG A;  1BNO A;  2LM4 A;  4JV2 A;  5F3X B;  4NLZ A;  1TE2 A;  2CPR A;  3CW2 C;  3FYH A;  4M9J A;  1TAM A;  2GOL A;  4QZD A;  4RQM A;  2LMR A;  3TAC B;  5J8Y A;  1RXV A;  2G5H B;  3JPP A;  2I6X A;  5IIO A;  4UAY A;  3GFK B;  5DB6 A;  4ED6 A;  1N60 A;  3ETR A;  4DF8 A;  4Q45 A;  4GC6 A;  2W9M A;  1LKY B;  3J81 j;  5KL8 B;  5J0Q A;  4UAU A;  4F5R A;  3OSP A;  2HHS A;  4ECU A;  1T3N A;  4F8R A;  4M6W A;  1QSL A;  1BPB A;  2ZIV A;  2OEH A;  2XCA A;  3PR4 A;  4F92 B;  4K4I A;  5C0Y A;  5AKZ A;  2XY5 A;  2R8G A;  4FE3 A;  4RQ2 A;  4PHD A;  7ICP A;  3L5K A;  5ALW A;  3NVV A;  3MR6 A;  4C4S A;  4NY8 A;  2G06 A;  4KN4 A;  4Y2X A;  4QWD A;  3HWT A;  2RLT A;  4IC9 A;  1KEJ A;  2PI4 A;  2JZB A;  5ALN A;  2KP7 A;  9ICH A;  3F5A A;  1ZQK A;  2BPG A;  3RJG A;  4UW9 A;  4I2H A;  3GIJ A;  1XS9 D;  4BWJ A;  4PL2 A;  4PHP A;  1ZQM A;  4JWM A;  4F5O A;  2I1Q A;  1JXE A;  4NLC A;  1NK4 A;  1WCL A;  3OPX A;  4C8L A;  4KLT A;  4NLB A;  8ICW A;  1KW4 A;  2QB0 A;  2RRD A;  9ICO A;  1L7N A;  3HX0 A;  2AQ0 A;  3WKB A;  4BGD A;  3SR6 A;  2HSZ A;  4QW8 A;  2R8J A;  5DBB A;  3H8W A;  1Z3E B;  3AQE A;  1QSS A;  3Q8K A;  1GO3 F;  2KZ3 A;  2HHW A;  2KVS A;  3U26 A;  4ICA A;  2OXO A;  4M9N A;  5KFY A;  2F3N A;  3T3F A;  8ICH A;  1KSP A;  4DOB A;  1OUQ A;  4OCZ A;  5ALP A;  4DSL A;  4I2C A;  4DL4 A;  3AU2 A;  5AKL A;  2KE7 A;  4R66 A;  4I2J A;  5J0Y A;  1ZQP A;  7ICG A;  2BHN A;  2N1R A;  3EYZ A;  2MU2 A;  1WWV A;  4LJX A;  3LWM A;  5HMM A;  4I2A A;  1L8O A;  9ICR A;  5KFV A;  5AM1 A;  4RQ5 A;  3SEI A;  2PFP A;  4F4X A;  4DFM A;  2VA3 A;  5DQI A;  3HP6 A;  9ICS A;  2VA8 A;  1XSL A;  1FO4 A;  2D3D A;  4KLG A;  4C8N A;  5KG0 A;  3RR8 A;  5AM2 A;  5JRT A;  1Y88 A;  3RB4 A;  4CCH A;  1NZP A;  3ONN A;  1HIW A;  3KKA C;  2JGA A;  5KAI U;  1A0P A;  4US9 A;  9ICN A;  3PSI A;  4FZM A;  2DKZ A;  2EQY A;  1U4B A;  3TKA A;  3UQ2 A;  3D6J A;  1TK0 A;  3HJE A;  3NUQ A;  2HHU A;  4YCX A;  3T5L A;  2BZF A;  4Y2T A;  4XRH A;  5ALS A;  2ZJA A;  1N5X A;  3KKA A;  4YMO A;  1XSN A;  1U47 A;  1ZQI A;  1MC8 A;  2QAR A;  3UXN A;  4FS1 A;  1B43 A;  2KEY A;  2ZIU B;  1X6J A;  2VKQ A;  4G9B A;  5L1K A;  2ZUC A;  3ZDB A;  3T5J A;  5KAF U;  3IG8 A;  1ZQZ A;  2Y0S C;  5A0L A;  1TFR A;  2ZIV B;  5KFA A;  4J9K A;  4X5V A;  3ETL A;  1S10 A;  3IM1 A;  3V7K A;  3GQC A;  3HRD D;  5B5E U;  1K1Q A;  5JUM A;  2JXJ A;  1N63 A;  3WK5 A;  4YFK A;  4O3Q A;  3ZI4 A;  5KT4 A;  3UQ0 A;  1N5W A;  3UM9 A;  1RYS A;  4WJ3 B;  2KJ9 A;  5AIA A;  1IXR A;  3RRG A;  3QU9 A;  3WK4 A;  3WKA A;  3AQF A;  1XU4 A;  3H8S A;  3MBY A;  3PW0 A;  1LB2 B;  5KFW A;  2RQ5 A;  2K4H A;  4Y2P A;  4F5N A;  5ALY A;  5AK3 A;  2BQU A;  2XC9 A;  2DWQ A;  4MFF A;  5CB1 A;  1DRG A;  7ICT A;  1D9D A;  5KFP A;  4MF8 A;  3GII A;  2G09 A;  4M0A A;  3Q8L A;  5D46 A;  3I28 A;  3EW9 A;  4IL6 U;  4RT2 A;  4F4W A;  2KIV A;  4M04 A;  2C28 A;  8ICN A;  3ZDD A;  4F4Z A;  4F5P A;  1ZQD A;  2H3F A;  4JUZ A;  3HT3 A;  1V38 A;  4Y2J A;  1ZQU A;  4I27 A;  2LKY A;  3VC8 A;  4AYB F;  3NS1 A;  3CNH A;  2W9B B;  1UT8 A;  4BX9 C;  3DEE A;  8ICT A;  3RRH A;  1ZQF A;  4GXK A;  1JI7 A;  1FIQ A;  5CP2 A;  1B4F A;  2FMP A;  4QNL A;  4QZB A;  2DFL A;  4F3O A;  4O3R A;  3JPT A;  3N28 A;  1JAL A;  1ZQS A;  2E1E A;  4F4K A;  3SI8 A;  4CF5 A;  2UVV A;  3EZ5 A;  2OM6 A;  4O3M A;  3IN5 A;  4NM1 A;  3C23 A;  1SXD A;  4MEY A;  1QLN A;  3RBE A;  1ZD5 A;  1QCK A;  1XNS A;  3GV5 B;  2KIC A;  1TVA A;  9ICU A;  1RPL A;  1RQN A;  2IBK A;  4DF4 A;  1ZQV A;  3IG5 A;  4UAW A;  1N62 A;  3SD7 A;  2YMM A;  4NWI A;  2JMG A;  1S5L U;  4M2Y A;  2JH1 A;  4P4P A;  1SV0 C;  5AKJ A;  5KL1 B;  3JPQ A;  3MGI A;  4DQP A;  2DGZ A;  2A1A A;  4YP3 A;  3SYZ A;  4GXJ A;  2PFO A;  1TKD A;  1AQ6 A;  2KSO B;  5J0T A;  2F8K A;  1HUZ A;  4P0P A;  2E8M A;  1A76 A;  3I76 A;  3QU5 A;  1C7Y A;  3FDS A;  1QH9 A;  4PZO A;  1S0N A;  2ZTD A;  4B9V A;  2FLN A;  5DBC A;  5T14 A;  5KT2 A;  5III A;  3Q8Q B;  8ICM A;  2BQR A;  4C80 A;  1ZQH A;  4QJF B;  3OJS A;  1XWL A;  4OJ5 A;  4RNM A;  1BPY A;  3RFA A;  4UBC A;  7ICM A;  3DDH A;  3ZD8 A;  8ICE A;  1Q3V A;  4R64 A;  1Z1B A;  3M1Y A;  2B21 A;  2HBJ A;  2W03 A;  4QIW F;  4RQ8 A;  5KFT A;  4IQW A;  2V4R A;  2VIX A;  5C5J A;  4DCC A;  3MGH A;  2NRW A;  1KKX A;  3MR5 A;  3SV4 A;  4QZH A;  4GIB A;  3QEA Z;  3BQ2 A;  1YZ7 A;  4O5K A;  2XGP A;  2J6U A;  5G5H A;  3SV3 A;  3MDA A;  5JU5 A;  4BJQ A;  2FLL A;  3RAQ A;  4M47 A;  3C5G A;  5J29 A;  3H0L B;  2MRL A;  1X66 A;  2K4P A;  2R8I A;  1JX4 A;  2YX8 A;  4Y2V A;  3RB0 A;  2LPE A;  4YMN A;  1SKS A;  3SAH A;  2KHV A;  5HHH A;  3V6K A;  1SZH A;  5KFE A;  3F2B A;  2YML A;  5ALX A;  1L3S A;  1SXE A;  5KNI A;  1B22 A;  4B9S A;  2C2D A;  3BDP A;  4PL1 A;  1XSP A;  2KKP A;  1L7O A;  9ICJ A;  1NNL A;  2NV3 A;  5J2I A;  4J9R A;  4ECX A;  1F5S A;  4RU9 A;  4DLE A;  4OO1 J;  3ORY A;  3TFR A;  4BDP A;  4YG2 A;  1UA1 A;  3C2L A;  5K4L A;  3KZI U;  3OSN A;  1X9S A;  1M6Y A;  5ALF A;  2ZUD A;  3L3F X;  2P6R A;  2ATL A;  2M9N A;  2FPL A;  1U9L A;  1SV0 A;  2KVC A;  4R8U B;  4B9M A;  1X6I A;  1ZD4 A;  1KTQ A;  3BS7 A;  5J2B A;  4ECV A;  4J9L A;  3QUT A;  5KFR A;  3E58 A;  4DWI A;  2PI5 A;  3TAN A;  2ZXI A;  2F1H A;  4KLH A;  4DFJ A;  1Z00 B;  4MFC A;  3OJU A;  2VJ4 A;  1T8E A;  2EAN A;  3NAS A;  5IIM A;  4ZOH C;  2DPJ A;  4DSF A;  2FMQ A;  5AK6 A;  2Y9T A;  3H4D A;  2UVW A;  1QQ6 A;  4K4H A;  1T4G A;  1ZOL A;  4UB1 A;  5J8Y C;  8ICS A;  4DQS A;  1F0M A;  4EEN A;  2DPI A;  1X9W A;  2WFA A;  3RF9 A;  5J2A A;  4DQR A;  4FZN A;  3VCB A;  4CNQ A;  8ICC A;  3TAD C;  4QZ9 A;  4PGY A;  3CP8 A;  4O5E A;  7ICS A;  4TUR A;  3BJY A;  3TI0 A;  3JPO A;  4UB8 U;  2AJQ A;  5EWG A;  1MN8 A;  1QQ7 A;  5AKK A;  4KMO B;  4YR0 A;  4QZA A;  4EBC A;  2ODG A;  5KFJ A;  2G07 A;  1BPX A;  4UB4 A;  7ICU A;  1B0X A;  4Y2Q A;  4YQW A;  4I2B A;  5L9X A;  5DB9 A;  1JRP A;  1NKC A;  4F93 B;  2ZUB A;  1X40 A;  4QW9 A;  4I2I A;  4M6W B;  2F44 A;  4C7Y A;  3AEV A;  9ICL A;  2ASJ A;  3ISD A;  1S97 A;  4FS2 A;  4I29 A;  3WK8 A;  2EZZ A;  4R65 A;  3UXP A;  4F4Y A;  1DK2 A;  2RP5 A;  3QZ8 A;  5F9N A;  2H3Z A;  1QQ5 A;  4O5C A;  2KV2 A;  2M0N A;  2LBO A;  5CR0 A;  4P4M A;  3PZP A;  2W8L A;  5F9L A;  3AL0 B;  5AI0 A;  2AGP A;  4NLK A;  4BXO B;  4C4R A;  1J97 A;  2FPK A;  5CEH A;  2IOF A;  4NM2 A;  4M9L A;  3N4M B;  5AM0 A;  5KTQ A;  3NGD A;  2ASD A;  3NTU A;  4OJL A;  3BS5 A;  3FAH A;  4Z6E A;  4IRD A;  5J2C A;  3KOO A;  5KFO A;  5DDM A;  1LVH A;  3F2C A;  2OHF A;  4EEK A;  2YMQ A;  1NK5 A;  5D4B A;  4EBE A;  1BPZ A;  2W3R A;  3R9K A;  1ZYQ A;  5CA7 A;  2OH2 A;  3ZDC A;  2HHQ A;  1JN3 A;  2HVH A;  5ALO A;  4J9N A;  2BPF A;  3LWL A;  1ZQG A;  4ED2 A;  3UMB A;  2ZIW B;  7ICN A;  2GWS A;  9ICV A;  1N61 A;  4IR9 A;  3EPI A;  5AK4 A;  2ZIU A;  5J0R A;  5TZV A;  3WKC A;  2W9C B;  3PSP A;  3ED5 A;  4J9S A;  1PVQ A;  4MEX A;  4KLI A;  3M9N B;  4RQ3 A;  2WF8 A;  3WKE A;  1ARO P;  2CN1 A;  2HCF A;  4RQ0 A;  4UAZ A;  3SAG A;  2HHX A;  2OWO A;  3PX6 A;  1RZT A;  1L3U A;  9ICC A;  2LM1 A;  3B9J A;  2HI0 A;  3H8J A;  1QTM A;  1SKR A;  1BGX T;  2RDI A;  2KHQ A;  3K1R B;  3V6J A;  1VDV A;  3SZ2 A;  1NJY A;  9ICB A;  4ED0 A;  4J9Q A;  3RBD A;  5EE1 A;  5AI6 A;  4DSI A;  1DOQ A;  1KQQ A;  4IRK A;  4ECR A;  3AN1 A;  4I2E A;  2PMZ C;  4TQR A;  5CHG A;  4DS5 A;  8ICI A;  1D8L A;  2E8N A;  1TV9 A;  3PW5 A;  1V9P A;  2F77 X;  2NRX A;  4TQS A;  2BCR A;  8ICL A;  1L3T A;  1YT3 A;  3F5E A;  1UCV A;  2HOQ A;  4EBD A;  3H4B A;  3BZK A;  3OHB A;  4DOC A;  3T79 A;  2RHF A;  2BCS A;  4JMU A;  5KFU A;  1KFD A;  5J0S A;  5AKX A;  4LVS A;  3AUO A;  1RYR A;  1ZQJ A;  2GH1 A;  3M9O B;  3PML A;  2K4I A;  5BPC A;  4O3O A;  9ICQ A;  2L5Y A;  1Q8K A;  4C8O A;  2G08 A;  4NLN A;  4Z6F A;  4RQ6 A;  4UQG A;  4DQQ A;  2HHV A;  2KFN A;  3M8R A;  1KRP A;  1NOM A;  2MUT A;  4F5Q A;  1T3Q A;  2W43 A;  2KFZ A;  4PHE A;  5IIJ A;  2Y0S F;  2FDR A;  2K4E A;  4PZN A;  2MSN A;  3Q8P B;  3G6Y A;  3TAD A;  1N48 A;  2IMW P;  3JPN A;  3PX0 A;  4RPZ A;  4PH5 A;  1TK8 A;  1ZRN A;  3HPO A;  3PST A;  4DEZ A;  1U45 A;  1XO1 A;  3UPQ A;  3C21 A;  3E0F A;  4K4G A;  1L6N A;  2WF6 A;  4CF3 A;  3MGV A;  2AU0 A;  2AH5 A;  4YR3 A;  3MR3 A;  1CEZ A;  8ICY A;  3C5F A;  4DS4 A;  9ICG A;  4YXM A;  5KG2 A;  2KTQ A;  4YMM A;  2YN4 A;  2XY7 A;  2ES6 A;  1WCN A;  3ZDE A;  4MF2 A;  3H0R B;  4QZE A;  4Y2U A;  3GV8 B;  5AKI A;  5EE9 A;  3BQ7 A;  3QU7 A;  1NZB A;  4ZH4 A;  5DG9 A;  1WYG A;  7ICV A;  2FJ6 A;  2AGQ A;  2DBY A;  2WF9 A;  5J2D A;  2B0C A;  3RH4 A;  3PNC A;  1L8L A;  1JRO A;  2FMS A;  7ICK A;  3C1Z A;  1TAU A;  1V85 A;  4U6P A;  2G0A A;  2QB0 B;  4JWN A;  1ZQL A;  4QZ8 A;  3JPS A;  4NL9 C;  9ICP A;  2XVT A;  5D49 A;  3N7P D;  4CRX A;  3Q8S B;  3RH6 A;  2BCU A;  1UT5 A;  1SZP A;  4J03 A;  2YY6 A;  1FFV A;  2WB1 F;  3B0Y A;  5L1I A;  3RJH A;  5TIS U;  4DQI A;  2R18 A;  1YZ6 A;  2R8H A;  5IIN A;  4DSJ A;  1UA0 A;  1ZQN A;  2AHO B;  1RXW A;  1D8B A;  1ZD3 A;  3THV A;  2KKV A;  3PY8 A;  3Q8R B;  5KT5 A;  1S0V A;  2ZIX A;  8ICF A;  2FLP A;  8ICQ A;  5AKH A;  3H0M B;  2BDU A;  5DBA A;  3PR5 B;  2K60 A;  7ICI A;  5FP0 A;  4C8K A;  4US8 A;  3WU2 U;  2HBK A;  2B6G A;  2EAM A;  1Z4N A;  4KX3 A;  2HVI A;  1JUD A;  3K75 D;  4MHV A;  3RAX A;  1CRX A;  3TAP A;  9ICT A;  7ICQ A;  3QNM A;  3LVV A;  2NO4 A;  7ICF A;  4TUQ A;  7ICE A;  2Y1J A;  3M9M B;  1DGJ A;  3NRZ A;  1ZQW A;  2ZTC A;  2QKQ A;  5AK5 A;  7ICR A;  5DLG A;  4OD0 A;  1A77 A;  4P2H A;  2ZXH A;  2JEJ A;  2YTU A;  4RZR A;  1WWU A;  1F44 A;  2FE9 A;  4YR2 A;  4UAT A;  1HUO A;  4HYK A;  5BOL A; 
#chains in the Genus database with same CATH homology
 2QB0 B;  2EAO A;  1OW5 A;  4NL9 C;  4RQM A;  1SXE A;  5KNI A;  1SV4 A;  1X9X A;  2F3N A;  2LMR A;  1SV0 C;  3TAC B;  5J8Y A;  4PZN A;  3TAD A;  1B0X A;  2KE7 A;  4RQN A;  2KSO B;  2KSO A;  5JTI A;  2F8K A;  2E8M A;  1X40 A;  1LKY B;  1WWV A;  1Z1V A;  2F44 A;  2GLE A;  4PZO A;  3K1R B;  3SEI A;  2DKX A;  5L1M A;  2JV3 A;  3SEN A;  1UQV A;  2K60 A;  1SV0 A;  4NJ8 A;  2D3D A;  2B6G A;  2EAM A;  2QB1 A;  5JRT A;  3BS7 A;  1COK A;  2ESE A;  2KIV A;  3HIL A;  2E8O A;  2E8N A;  4MHV A;  3KKA C;  1RG6 A;  1V38 A;  2ES6 A;  2DKZ A;  2KMD A;  1PK3 A;  2EAN A;  1OXJ A;  1UCV A;  1JI7 A;  3BS5 A;  1B4F A;  2E8P A;  2Y9U A;  3IDW A;  3BQ7 A;  3BS5 B;  2Y9T A;  1LKY A;  4IS7 A;  3H8M A;  5J8Y C;  2QKQ A;  3KKA A;  4NL9 A;  2DL0 A;  1F0M A;  1PK1 B;  1KW4 A;  2QB0 A;  2QAR A;  5JU5 A;  2L5Y A;  2KG5 A;  2D8C A;  1SXD A;  1SGG A;  1X66 A;  2YTU A;  2K4P A;  1WWU A;  2FE9 A;  2LPE A;  3TAD C;  2QAR B;  2EAP A;  1DXS A;  5F3X B;  1PK1 A;  1V85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...