2KSOA

Epha2:ship2 sam:sam complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the EphA2:SHIP2 SAM domain heterodimer
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ephrin type-A receptor 2
total genus 20
structure length 65
sequence length 65
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ksoA00
3SENA 1WWVA 3TADA 1V38A 2QARA 1SV4A 1UQVA 2F8KA 2EAOA 2ESEA 2LPEA 5F3XB 1SXEA 1SGGA 2D8CA 3IDWA 4PZOA 1X9XA 3K1RB 1Z1VA 4MHVA 3TACB 4RQNA 5JRTA 3TADC 1JI7A 1COKA 3H8MA 2QB0B 2KSOB 1KW4A 1F0MA 1WWUA 2E8OA 1LKYA 2QB0A 1RG6A 2EAPA 1OW5A 2KSOA 1DXSA 5JU5A 1SV0A 2Y9TA 4RQMA 2KMDA 2EAMA 2YTUA 3KKAC 2D3DA 2KG5A 2Y9UA 1B0XA 3HILA 2E8PA 1B4FA 2JV3A 3BS5A 2K4PA 2LMRA 1SXDA 2FE9A 2QB1A 5J8YC 5JTIA 2F3NA 2QARB 2B6GA 5J8YA 4PZNA 2DKXA 2DL0A 2KIVA 2F44A 2L5YA 1SV0C 2E8MA 2EANA 2QKQA 1PK1B 4NJ8A 2ES6A 1V85A 3KKAA 1X66A 4NL9C 2E8NA 3BS7A 1LKYB 2KE7A 3BS5B 4NL9A 3SEIA 5KNIA 2DKZA 1X40A 2K60A 5L1MA 3BQ7A 1PK3A 1PK1A 2GLEA 4IS7A 1OXJA 1UCVA
chains in the Genus database with same CATH superfamily
4M9HA 1HUOA 4M47A 2FMPA 4J9QA 5B66U 1NKCA 3PMNA 3M9OB 2IOHA 5F3XB 2IOFK 5J0TA 4RZRA 3BQTA 8ICUA 4ZOHC 3ZDEA 4EBDA 2ZXIA 2Y1IA 4IC9A 5AKYA 4QZGA 2D6FC 2RDJA 1U45A 8ICCA 1U4BA 4I2CA 3RB6A 1F0MA 1SKWA 9ICVA 5DB6A 2QB0A 1S9FA 1DXSA 9ICRA 1AQ6A 4CGZA 3E58A 8ICYA 1WCLA 2KZMA 1N60A 4A8EA 1K5OA 1PVRA 1ZQLA 3NVWA 2HDOA 2HMXA 1B4FA 2HHQA 2MU2A 3QU4A 5KT5A 1A0PA 4MF2A 1KEJA 2KD1A 4YR0A 3Q8PB 2E1EA 1KQQA 3RJKA 3SAFA 4Z6CA 4LZGA 4GXIA 4J9PA 1TE2A 2OM6A 4RQ0A 3WK9A 4X5VA 9ICEA 2UVWA 5AK3A 2FDRA 4YMNA 4UBCA 3KTQA 2QKQA 1TK0A 1QSLA 1Q46A 4MEYA 1B43A 1KLNA 4RT3A 4NWIA 1LKYB 3D2NA 2A1JA 4IQTA 5KNIA 3RJIA 1RXWA 3LVWA 4I27A 2O6KA 1A76A 1N62A 2AHOB 1QSSA 5CWRA 4UB1A 2P6RA 2PI4A 2F8KA 3JPRA 4QZIA 2W9AA 4KTQA 1JN3A 3QU9A 1SXEA 4UB3A 9ICBA 3NTUA 2HHSA 3DDHA 4IRCA 1JXEA 3QUTA 3ED5A 3UM9A 2XC9A 4KLJA 1MA7A 4QZBA 1FEZA 1A6SA 1Z1BA 2HOFA 3PX6A 2HHXA 2DWQA 3GIMA 3TADC 3F5AA 3MDCA 3H8MA 3H8SA 4UB2A 3KHGA 2ISPA 5EE3A 4QWBA 4PPXA 4MEXA 1L5UA 1XSNA 2LM1A 2NRZA 2FMQA 3NVYA 3UQ0A 3RAXA 4B6JA 4KLSA 4C8MA 5L1JA 2W11A 4B9VA 1MQ3A 5ALSA 4GFJA 1NJZA 1XSPA 2IBKA 3OTQA 4U7CA 4DSLA 4DSEA 3NVVA 4UW9A 4JWMA 4DL5A 2QB1A 2B6GA 5KFZA 4DQSA 1S0MA 3T5JA 2F44A 1N48A 4M9JA 3C2MA 5EWEA 4Q8FA 2PMZF 5ALPA 3QEAZ 2C2RA 4O3NA 4KLMA 2E5SA 5ALKA 2JH7A 5CA7A 1BPBA 3H40A 2FPMA 4G9BA 3GU3A 3NRZA 5J2EA 3AEVA 1NK4A 2HSZA 3K4GA 4QWCA 3C5GA 4M9GA 4YFKA 4EENA 1XWLA 1TVAA 5DB8A 1UQVA 4Q8EA 1UT5A 2F1IA 2WTFA 2LPEA 7ICJA 2ZTCA 1HIWA 3I28A 3MDAA 3ZDCA 3J81j 3TANA 4MHVA 7ICFA 4Q45A 3UMGA 5DQGA 1N61A 2C28A 4XQ8A 8ICAA 4R8UB 1NK9A 3C23A 3MR3A 2JH1A 4WJ3B 2KKPA 4C8NA 1OW5A 4PHPA 2KSOA 3JPTA 8ICHA 5J2IA 4PGXA 4IQUA 4EBEA 3C5FA 5AI9A 1ZQMA 4NLNA 4I29A 5AI8A 4TUPA 8ICGA 2LMRA 1ZQOA 5EOZA 1KKXA 4Z6EA 2H3IA 2LKYA 4KLGA 2EZYA 2L5YA 2E1FA 4FS2A 3O0FA 1TAUA 1T94A 2NRVA 1FFUA 4YP3A 3MGHA 1CEZA 2BPGA 3KHRA 1ZRNA 1XC9A 2G0AA 3GIIA 2MUTB 1LB2B 4QJFB 3BDPA 2V9WA 3C28A 2XY5A 4GLXA 2K4IA 4J9LA 1DOQA 2ZTDA 3PR4A 5HR7A 3TADA 4PL1A 4BXOA 2G06A 9ICIA 1S5LU 3H0MB 3EPGA 2XY6A 5KFTA 4ED3A 5F9NA 1JXLA 2NRXA 3H8WA 4DFPA 4PHEA 3LK9A 5KFJA 2HBKA 3WU2U 1S97A 1YT3A 3G6YA 3FAHA 5AI4A 2W8KA 5L1IA 4YQWA 2HOQA 5HR6A 5KG4A 3QE9Y 2PFOA 2HW3A 3RJFA 4Y2RA 5KFKA 5KT6A 4RUCA 2KJ5A 1SKRA 3Q8KA 2Q0ZX 1BPYA 3QX7A 2EAPA 3ZDDA 3RAQA 2F2AB 2H3ZA 3TQ1A 4K4GA 1Z19A 3SAGA 4DF8A 2A19A 1RYUA 3RH5A 1RDFA 1L3TA 2JV3A 3D6JA 2VJ4A 4C8LA 1J97A 3JPNA 1NKBA 3QZ7A 1SIJA 3Q8RB 1UA0A 4FO6A 3I76A 5AM5A 4FS1A 2NRTA 4IL6U 2W54A 3KHLA 5EE9A 3OSPA 1ZQDA 3IM1A 1ZQYA 1DGJA 4DOCA 5E79U 4IRDA 2EDUA 2ZG6A 4ACOA 2ALZA 4DSJA 3EPIA 5J0SA 4KLOA 5L1MA 4KLTA 2P6UA 3SYZA 1BVSA 4UAUA 4ELVA 2HHWA 3CNHA 4YVZA 4OCZA 3QU2A 3E2EA 9ICAA 3T5LA 1ZQ1C 3IG8A 2FLLA 1V38A 2YMPA 4F4XA 4YMOA 8ICMA 4JV2A 3H8JA 5ALWA 4MFFA 4QW8A 4Q44A 2K89A 8ICLA 8ICWA 3R9KA 4QZ8A 5AKLA 4EZ6A 2MRLA 4PGYA 2KHQA 5DG9A 2J6UA 2IOFA 4NLCA 3ALRA 5KFWA 1ZQGA 1O08A 4ECXA 1KFDA 1KW4A 1WWUA 1QQ6A 2PKEA 1NKEA 4RQ7A 2K4HA 1L8LA 2HCFA 1SV0A 2JGAA 4RQMA 2YMQA 2R8HA 8ICSA 4DF4A 5EE1A 3RH4A 3D2QA 4ED2A 1ZD2P 5J2JA 4F8RA 3OHAA 2NO4A 4ECSA 1Z3EB 3MFIA 2E8PA 3SR6A 1PVPA 3OGUA 1ZQFA 4TQRA 1WG8A 4ECWA 4NLKA 5T14A 1DK2A 1ZQAA 5TZVA 3ZDBA 2DPIA 1QLNA 2KZZA 2BPCA 5AI5A 3CW2C 3PSPA 1NK8A 2HVIA 3V72A 1RQLA 2Y1JA 5AM3A 7ICMA 5AKXA 8ICIA 2KE7A 4IQVA 5J29A 8ICVA 5CJ7A 5KL1B 9ICWA 1ZQVA 7ICUA 5ALJA 4YR2A 4F5RA 1TV9A 3RJGA 4J9KA 3PW5A 2Q4TA 4KITB 4BGDA 1CRXA 2ZIXB 3N28A 1UPHA 4Y2YA 3EUB2 4QZCA 5KG3A 2EAOA 1ZQNA 2W8LA 5DBAA 4F4YA 4ELTA 1HJPA 1Y88A 2F77X 2W9BB 4UB8U 9ICCA 4KLIA 3DEEA 4F4WA 4M9LA 4TUQA 1JIHA 4KLEA 2MAXA 1N5XA 4PL2A 5KFNA 3BQ2A 4Y2PA 2MUTA 5C0YA 3C29A 1C7YA 4NLZA 4DFJA 1X9MA 5AM4A 5DB9A 1SWWA 4UB5A 4ZH4A 3M8SA 3BJYA 3IN5A 1B0XA 3HILA 2NRWA 2MA1A 5CRXA 3Q8MA 4P4OA 5J2BA 2ZIVA 3V7LA 5J8YC 2OXOA 4KX5A 3F5EA 2KIVA 4PHAA 2I6XA 4P0QA 4EZ9A 2BQRA 3SQIA 2EANA 2J6SA 2NYVA 4TURA 2OWOA 3UXPA 4EELA 4DFKA 3NUQA 4UASA 5ALOA 4DS5A 3A0HU 1RPLA 4QNLA 3SEIA 4PGQA 1X2IA 1VLBA 2DQNB 5ALXA 3ZD9A 5CR0A 3WK7A 3GIJA 3PZPA 4O5CA 2ZTEA 4Y2SA 5AKJA 5D49A 4QWEA 3HX0A 2H3VA 4AYBF 1OXJA 1UCVA 4RQ3A 1WWVA 5EWGA 1N5WA 2I5HA 2QARA 3QXGA 1SV4A 1QCKA 1SB3C 3KHHA 5F9LA 2D8CA 2DPJA 3N97B 1T3NA 2JHDA 9ICUA 3GFKB 4C8KA 1Z1VA 1ZQEA 5J0WA 4O5KA 3TACB 4DSFA 1JMSA 3RTVA 8ICQA 5AM2A 1ZD4A 5AIAA 3TKAA 5KFHA 4Y2XA 4JV0A 1Z00B 2VJ5A 3AM9A 4QWDA 2ZJAA 1SL1A 4QIWF 4RPYA 1X9SA 3TI0A 2AGQA 3RBDA 5KFBA 1D9DA 3AMZA 5KFRA 2C22A 5ALGA 3AL0B 1X42A 1EXNA 3C2KA 4EYHB 5DG7A 1KDHA 3HKZF 5AIBA 2FE9A 3VC8A 4B9UA 4PZNA 2HHVA 3NVZA 5KT7A 4Y2TA 4ECVA 8ICKA 4KN7A 2F1JA 2YY6A 3SAHA 4F50A 9ICLA 4DQQA 2LYBA 7ICGA 4ECTA 2I1QA 5ALRA 1VJ5A 1ZQCA 2DKZA 3NS1A 2WF8A 2GWSA 1ZQJA 3H4DA 1PK3A 1ZQUA 3B0XA 5J0YA 5KG1A 5BOMA 3RB4A 3K1ZA 1T4GA 1X6JA 3M8RA 1P7DA 2KTQA 1PZNA 3BZKA 3UPQA 1ZYQA 4MF8A 2FLPA 3PX4A 2IMWP 5BPCA 2G07A 1NJYA 1FO4A 1U49A 2AJQA 5H2FU 4RNNA 4AP9A 3SMVA 5JRTA 2HBMA 3LYSA 3NASA 1X6IA 3GV8B 2OH2A 4CCHA 4JWNA 1MC8A 3FM9A 2KSOB 5G5HA 2UVVA 1WUDA 3RRHA 2JZBB 2IHMA 4MFCA 3AQEA 3OSNA 4Z6DA 2PFPA 5D4BA 5DQHA 4RQ4A 4I2GA 1ZRMA 3CYMA 5CP2A 2Y9UA 2G5IB 2PI5A 3TAPA 1D9FA 3C21A 3THVA 3M1YA 4KMUA 4O3OA 1L7OA 2PFNA 4R66A 1ZXIA 4YXMA 5A0LA 1DRGA 2GOLA 4OJOA 1JRPA 5DGBA 4RNMA 4M2YA 3OPXA 4RU9A 4K4IA 1QSYA 4JUZA 3NGDA 1ZQZA 2F8LA 3GV5B 5BOLA 4P2HA 1N56A 3CP8A 2R8IA 4DLEA 1WCNA 2KOBA 5G5GA 4BWMA 1QQ7A 2XI9A 2W3RA 5J0OA 4RUAA 4B9TA 4KX3A 2K4EA 4TUSA 3KD3A 3H7IA 3IG5A 3T5HA 7ICEA 2KJ9A 1NZBA 4IRKA 5J0RA 3RRGA 4DL2A 1ZOLA 2R8KA 3IRUA 2JEGA 5KFAA 2AQ0A 4EEKA 3N7RC 4USAA 4DOBA 3M9MB 3AU6A 4DL6A 4I2DA 1T8EA 4ECZA 1T3QA 2BCUA 1ZQXA 3JPSA 2DBYA 2BR0A 1JROA 2AH5A 4DSKA 4ED8A 4JMUA 1S0OA 1K1QA 1ZD3A 2M9NA 5J0PA 4P4PA 3RJHA 1NOMA 3UQ2A 1RG6A 1L7MA 4I2FA 3ZI4A 4OO1J 4GIBA 4F5NA 4O3PA 3A0BU 3AU2A 5IIMA 1QTMA 7ICIA 3C1ZA 4QZHA 1L3VA 3SD7A 8ICZA 2ZJ5A 2H3FA 3WKDA 1ZQWA 3NRWA 4F5OA 4GXKA 5JTIA 3ZDAA 2QARB 4FBTA 4KLUA 1SWVA 3V6HA 2OEHA 4DL3A 2GH1A 4CDGA 1U47A 1U9LA 3MFHA 1D8YA 3B0YA 1SV0C 5J2HA 5DLGA 2R18A 4ED1A 4ED7A 2EZXA 4ED0A 1J2NA 1H38A 2RHFA 4C4TA 2BZFA 2CPRA 1V85A 2KKVA 5KFUA 4J9OA 3IV6A 5AI0A 3TARA 4I2IA 4QZDA 1K1SA 3WKBA 3PW2A 4YG2A 3PO5A 4RQ2A 2R8GA 2K60A 4QZ9A 3QEBZ 5KFMA 2Y0SF 3WKCA 1YZ6A 3PX0A 1MQ2A 1X9WA 1V97A 4M04A 5KFLA 2WF7A 5ALNA 4YD1A 3MR2A 3ISCA 4EBCA 4BX9C 3SV3A 1QH9A 2ESEA 3UMCA 4F3OA 7ICTA 5KT3A 4ELUA 3H0RB 9ICMA 4PZOA 4C8OA 1BNPA 3WKAA 2PFQA 3PY8A 2BGWA 2E3TA 4C7ZA 5DKWA 3MR5A 5KFOA 2XGPA 5J2DA 8ICNA 4GXJA 3SI8A 3HW8A 2HHUA 1KBUA 3H0LB 5KFYA 2KV2A 1RQNA 5DG8A 1ZETA 2BHNA 7ICPA 3L5KA 3M6KA 2E8OA 3RF9A 5AHXA 2ASDA 2ASJA 3HWTA 2YQEA 5L1LA 2LI6A 5JUMA 2OYYA 3C1YA 3QZ8A 2G08A 2KN7A 3M9NB 2PXIA 3EWAA 2JEIA 2OHFA 4UBBA 2ZXHA 2C2EA 1XNSA 2EZZA 5DB7A 3HKZC 3UXOA 2JRZA 3FYHA 3IP4B 4QIWC 2W3SA 3KBBA 2BCRA 1MSWD 2K8CB 4BDPA 4R63A 3PW4A 4NLBA 2MSNA 4C0ZA 1CI4A 3DV9A 4EX6A 2ZIUA 2FI1A 4YN4A 1VDVA 1ZQBA 4NJ8A 4ECYA 1KL9A 4Y2UA 4J9NA 3BQ0A 4B9MA 4CE6A 2XCPA 4ED6A 4O9MA 3BS5B 3BQ1A 2W9BA 4KN4A 4F2SA 3ICXA 4F4KA 1GO3F 3GQCA 5IIIA 1TKDA 3EYZA 3PO4A 4C4SA 1Z4NA 1JUDA 1KFTA 4RPXA 9ICKA 1L3SA 8ICFA 8ICJA 3PNCA 3L4PA 3PVXA 4FZLA 3AQFA 5ALEA 4O0IA 9ICJA 1SGGA 2JR5A 1Z4OA 3JPOA 5KFIA 3V7JA 2W9CB 3K1RB 9ICHA 3HRDD 4LZDA 2W55A 3PR5B 3ONNA 1ZQHA 1FIQA 4M0AA 1WYGA 2V4RA 3M6ZA 2KJ8A 2ZUCA 2RDIA 2QB0B 1PVQA 2BDUA 5AK4A 2B0CA 5KT2A 1SZHA 3D2SA 2DUYA 2HI0A 5EE0A 3V6KA 2XICA 2LHTA 3ETLA 5KG0A 2VA3A 4Y2VA 3TAQA 1KRPA 4DWIA 2Z7JA 1LVHA 2XIDA 3LWLA 8ICRA 3FDSA 5J0QA 2HVHA 4US9A 5ALDA 2DL0A 4O3MA 5K4LA 2E8MA 4NV0A 1NJXA 2VANA 3LWMA 4F5QA 2RP5A 3AN1A 9ICTA 4M6WA 5IILA 5AKEA 5D46A 4QWAA 5ALTA 1KSPA 9ICFA 5HNKA 2WFAA 4DQRA 3GIKA 2BQUA 1SL2A 2LBOA 5EWFA 3KFUF 2FJ6A 1PUZA 1Q3UA 2ZIVB 4EYIB 2W04A 2R8JA 4J9RA 2AQ4A 4B9LA 1PK1A 2YN4A 2EQYA 2G09A 5DBBA 4DFMA 4NM1A 9ICOA 2J6TA 2HBJA 7ICRA 4ECQA 3RJEA 4UB4A 1O03A 1Z00A 3HT3A 4NLGA 4JB3A 3JPPA 2FLNA 2JMGA 5C5JA 1A77A 4RQNA 2CRXA 1JI7A 5ALMA 3ETRA 3RR8A 3QU7A 3RB3A 1URJA 5KG7A 5IIKA 1LKYA 1BPDA 5J2GA 4DL4A 4RNOA 2A1JB 4R8UA 2W03A 1S8OA 1RYSA 1D8LA 3I1YA 1HUZA 3F2BA 5ALYA 5KG6A 4CNQA 9ICGA 2KHVA 5KFSA 3PV8A 1NK6A 4J03A 3RR7A 2ZJ8A 4F4ZA 1U48A 3PSFA 2LM4A 2HHTA 1OUQA 4RPZA 5KFFA 1L7NA 5DDMA 4ICAA 4CRXA 5DGAA 2BCQA 4GC6A 1JALA 4P0QB 3KKAA 1X66A 4Y2JA 1S10A 2F1HA 4ECUA 5IINA 4PHDA 1NK5A 3G6XA 4DQIA 3MBYA 9ICNA 2KIWA 5ALFA 4B9NA 4CF5A 4YR3A 3PW7A 3GZFA 1UHUA 4M6WB 2WB1F 4OJ6A 5J2KA 1F44A 2FMSA 3SENA 5J2CA 1ZQTA 5ALUA 5AM1A 3KZXA 4KLHA 1DGSA 4NXZA 4LVSA 3HJEA 1KTQA 4DQPA 1RYRA 2VA2A 3OHBA 4RQ6A 4I28A 7ICKA 2YMMA 1FFVA 5HHHA 4R65A 4PJ0U 4JV1A 2ISOA 3HPOA 5AM0A 2QLTA 2LYHA 3RJJA 1L8OA 2BPFA 3ISDA 4CF3A 4YMMA 1XU4A 1XSLA 1ZQQA 1NZPA 5AKZA 2WB1C 4DSIA 1ED1A 4O3RA 3E0FA 4R64A 2XO7A 2JEFA 1COOA 8ICEA 1ZQPA 3QYPA 2YTUA 3KKAC 4I2JA 5KT4A 1RM6C 3FC4A 4I2HA 5DDYA 3BS5A 4IR1A 4RQ5A 5AKHA 2KICA 1NK7A 3F2DA 2K4PA 5J0XA 4G3IA 3T79A 4OJ5A 5KL8B 1TK5A 5ALZA 4KLDA 3B9JA 1S77D 4J9MA 4P0PB 2ASLA 3V6JA 1ZQRA 4FZNA 3TFRA 5FP0A 3N7PD 4MFAA 1F5SA 4RT2A 3WK8A 5ALQA 4XA5A 2YX8A 4OJPA 4EX7A 3PW0A 3BS7A 5AKIA 3C2LA 5GTIU 1BGXT 3UXNA 4F2RA 5CB1A 5KFGA 2XY7A 4UARA 4O3SA 4J9SA 3ORYA 2K8BB 1IV8A 3RH6A 3Q8LA 1BPEA 1D8BA 3G6VA 4EEYA 2WHEA 5KAIU 4QW9A 4O3QA 5ALHA 3VCBA 8ICTA 2YB1A 3WK5A 1NNLA 2W43A 5L1KA 8ICXA 2H5XA 4DLGA 2UVUA 4F93B 9ICQA 5J0UA 5IIOA 4F92B 4DFDA 2BCSA 4GC7A 1Q3VA 1S76D 5AKGA 3EZ5A 7ICHA 2RQ5A 2KEYA 2DF4B 1T7PA 2WF6A 4BUGA 4DCCA 4FZMA 1HEKA 3QUBA 2BKEA 4BWJA 5JU5A 1L3UA 4I2BA 5CHGA 3KOOA 1V9PA 1ZQIA 1AROP 2WF5A 3QUCA 4RQ1A 5KFXA 7ICOA 2NO5A 4JK1A 2AGPA 2M0NA 2ZUDA 3QNMA 2XGQA 3QUQA 1SXDA 3K75D 2W7OA 2JXJA 3F53A 2W7PA 2JEJA 5J8YA 4UB6U 5J2AA 3BZCA 1ZQKA 3WK4A 2BDPA 4I2EA 3T3FA 3PSTA 7ICQA 4UQGA 1S0VA 1BPZA 4HAIA 2B21A 1XO1A 5KFQA 4Z6FA 2ZUBA 4F91B 1UA1A 4OD0A 7ICLA 1B22A 1S0NA 1JX4A 2WAQC 2AGOA 3RB0A 2UVRA 1ZD5A 4UATA 1X40A 1IM4A 3SV4A 3BQ7A 2AXTU 5B5EU 2KNJA 3U26A 4NY8A 8ICPA 2P66A 5KG5A 5DLFA 4P4MA 4NM2A 5HMMA 1M6YA 1BPXA 3GDXA 5J2FA 1KFSA 3Q8QB 5CEHA 4KLQA 1ECWA 4UAWA 3QU5A 3AUOA 4IQWA 2H3QA 2NV3A 3OJUA 2KVSA 2WF9A 1N2XA 2BCVA 4LJXA 8ICBA 1ZJMA 5IIJA 1DK3A 3ISBA 5KFDA 2I9GA 3OJSA 3TFSA 1IXRA 1COKA 5ALIA 4ECRA 4M9NA 1ZJNA 1BNOA 4DEZA 1TAMA 4XUSA 2BQ3A 1ZQSA 3PMLA 4C4RA 2XCAA 4QZEA 1TFRA 5AKKA 3IHQB 5ALLA 4Q43A 1TK8A 2DFLA 4XRHA 2PMZC 2KMDA 2KP7A 2EAMA 5DQIA 2WAQF 4YXJA 5KFEA 2ZIUB 7ICSA 4QZAA 3LDAA 2F76X 5KAFU 3F2CA 1IG6A 2G5HB 4KLFA 2F3NA 2ZIWA 1C20A 5KFCA 4HYKA 3Q8SB 5HMLA 2A1AA 2IHNA 4DS4A 2EH9A 1L7PA 2KFZA 4KMOB 5KG2A 4YCXA 2ES6A 1L6NA 1XO0A 5HHIA 4YD2A 5HP4A 4NL9C 2CN1A 2E8NA 2N1RA 4FFDA 3HP6A 4I2AA 4B9SA 4FE3A 3M7DA 5AICA 1SL0A 2ZIXA 5GTHU 2HOIA 4RQ8A 7ICNA 3EW9A 2W9CA 2GLEA 2YB4A 5TISU 3MGVA 1RZTA 4IS7A 4CF4A 4TQSA 3ZD8A 2ODGA 3SZ2A 4F5PA 2RLTA 2LYAA 2ATLA 4O5EA 4DO9A 4F72A 1UT8A 3IDWA 3N7SC 1MN8A 4KLLA 3V7KA 3CRXA 3T5KA 3UMBA 1N63A 4US8A 1X9XA 2V4QA 1SKSA 9ICSA 5KFPA 4UAVA 3WK6A 3KZIU 1NK0A 4U6PA 3GV7B 4E0DA 1LV5A 2P35A 3WKEA 4F71A 4PH5A 3JPQA 4FBUA 4AYBC 1Q8KA 4DL7A 2Y0SC 2IA6A 2HBLA 2DGZA 3N4MB 2KZ3A 4UAYA 3MC1A 2C2DA 2YMLA 2OCEA 4C7YA 2D3DA 3LVVA 2KG5A 2XVTA 3L3FX 4QZFA 3S6JA 4P0PA 1NI3A 4IR9A 1YZ7A 2JZBA 4K4HA 2W9MA 8ICOA 2RRDA 2A3VA 2GO7A 1NJWA 7ICVA 9ICXA 1RXVA 1SZPA 2DKXA 1XS9D 2VIXA 2KK0A 1J2MA 1IIPA 1TAQA 2FPKA 5KTQA 3GILA 9ICPA 1PK1B 3MR6A 3MABA 2KVCA 4Y2QA 1QQ5A 5KFVA 3RFAA 2ZIWB 4DOAA 5AK5A 3PSIA 4OJLA 4C80A 4NL9A 3H4BA 4BJQA 2AU0A 2FPLA 5L9XA 3MGIA 4BXOB 5DBCA 3RBEA 2KFNA 2CXYA 5AI6A 1CUKA 2VKQA 2K8AA 1KN5A 5AK6A 5ALVA 4UAZA 2VA8A 2Y9TA
chains in the Genus database with same CATH topology
3SENA 1WWVA 3TADA 1V38A 2QARA 1SV4A 1UQVA 2F8KA 2EAOA 2ESEA 2LPEA 5F3XB 1SXEA 1SGGA 2D8CA 3IDWA 4PZOA 1X9XA 3K1RB 1Z1VA 4MHVA 3TACB 4RQNA 5JRTA 3TADC 1JI7A 1COKA 3H8MA 2QB0B 2KSOB 1KW4A 1F0MA 1WWUA 2E8OA 1LKYA 2QB0A 1RG6A 2EAPA 1OW5A 2KSOA 1DXSA 5JU5A 1SV0A 2Y9TA 4RQMA 2KMDA 2EAMA 2YTUA 3KKAC 2D3DA 2KG5A 2Y9UA 1B0XA 3HILA 2E8PA 1B4FA 2JV3A 3BS5A 2K4PA 2LMRA 1SXDA 2FE9A 2QB1A 5J8YC 5JTIA 2F3NA 2QARB 2B6GA 5J8YA 4PZNA 2DKXA 2DL0A 2KIVA 2F44A 2L5YA 1SV0C 2E8MA 2EANA 2QKQA 1PK1B 4NJ8A 2ES6A 1V85A 3KKAA 1X66A 4NL9C 2E8NA 3BS7A 1LKYB 2KE7A 3BS5B 4NL9A 3SEIA 5KNIA 2DKZA 1X40A 2K60A 5L1MA 3BQ7A 1PK3A 1PK1A 2GLEA 4IS7A 1OXJA 1UCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEN A;  1WWV A;  3TAD A;  1V38 A;  2QAR A;  1SV4 A;  1UQV A;  2F8K A;  2EAO A;  2ESE A;  2LPE A;  5F3X B;  1SXE A;  1SGG A;  2D8C A;  3IDW A;  4PZO A;  1X9X A;  3K1R B;  1Z1V A;  4MHV A;  3TAC B;  4RQN A;  5JRT A;  3TAD C;  1JI7 A;  1COK A;  3H8M A;  2QB0 B;  2KSO B;  1KW4 A;  1F0M A;  1WWU A;  2E8O A;  1LKY A;  2QB0 A;  1RG6 A;  2EAP A;  1OW5 A;  2KSO A;  1DXS A;  5JU5 A;  1SV0 A;  2Y9T A;  4RQM A;  2KMD A;  2EAM A;  2YTU A;  3KKA C;  2D3D A;  2KG5 A;  2Y9U A;  1B0X A;  3HIL A;  2E8P A;  1B4F A;  2JV3 A;  3BS5 A;  2K4P A;  2LMR A;  1SXD A;  2FE9 A;  2QB1 A;  5J8Y C;  5JTI A;  2F3N A;  2QAR B;  2B6G A;  5J8Y A;  4PZN A;  2DKX A;  2DL0 A;  2KIV A;  2F44 A;  2L5Y A;  1SV0 C;  2E8M A;  2EAN A;  2QKQ A;  1PK1 B;  4NJ8 A;  2ES6 A;  1V85 A;  3KKA A;  1X66 A;  4NL9 C;  2E8N A;  3BS7 A;  1LKY B;  2KE7 A;  3BS5 B;  4NL9 A;  3SEI A;  5KNI A;  2DKZ A;  1X40 A;  2K60 A;  5L1M A;  3BQ7 A;  1PK3 A;  1PK1 A;  2GLE A;  4IS7 A;  1OXJ A;  1UCV A; 
#chains in the Genus database with same CATH topology
 4M9H A;  1HUO A;  4M47 A;  2FMP A;  4J9Q A;  5B66 U;  1NKC A;  3PMN A;  3M9O B;  2IOH A;  5F3X B;  2IOF K;  5J0T A;  4RZR A;  3BQT A;  8ICU A;  4ZOH C;  3ZDE A;  4EBD A;  2ZXI A;  2Y1I A;  4IC9 A;  5AKY A;  4QZG A;  2D6F C;  2RDJ A;  1U45 A;  8ICC A;  1U4B A;  4I2C A;  3RB6 A;  1F0M A;  1SKW A;  9ICV A;  5DB6 A;  2QB0 A;  1S9F A;  1DXS A;  9ICR A;  1AQ6 A;  4CGZ A;  3E58 A;  8ICY A;  1WCL A;  2KZM A;  1N60 A;  4A8E A;  1K5O A;  1PVR A;  1ZQL A;  3NVW A;  2HDO A;  2HMX A;  1B4F A;  2HHQ A;  2MU2 A;  3QU4 A;  5KT5 A;  1A0P A;  4MF2 A;  1KEJ A;  2KD1 A;  4YR0 A;  3Q8P B;  2E1E A;  1KQQ A;  3RJK A;  3SAF A;  4Z6C A;  4LZG A;  4GXI A;  4J9P A;  1TE2 A;  2OM6 A;  4RQ0 A;  3WK9 A;  4X5V A;  9ICE A;  2UVW A;  5AK3 A;  2FDR A;  4YMN A;  4UBC A;  3KTQ A;  2QKQ A;  1TK0 A;  1QSL A;  1Q46 A;  4MEY A;  1B43 A;  1KLN A;  4RT3 A;  4NWI A;  1LKY B;  3D2N A;  2A1J A;  4IQT A;  5KNI A;  3RJI A;  1RXW A;  3LVW A;  4I27 A;  2O6K A;  1A76 A;  1N62 A;  2AHO B;  1QSS A;  5CWR A;  4UB1 A;  2P6R A;  2PI4 A;  2F8K A;  3JPR A;  4QZI A;  2W9A A;  4KTQ A;  1JN3 A;  3QU9 A;  1SXE A;  4UB3 A;  9ICB A;  3NTU A;  2HHS A;  3DDH A;  4IRC A;  1JXE A;  3QUT A;  3ED5 A;  3UM9 A;  2XC9 A;  4KLJ A;  1MA7 A;  4QZB A;  1FEZ A;  1A6S A;  1Z1B A;  2HOF A;  3PX6 A;  2HHX A;  2DWQ A;  3GIM A;  3TAD C;  3F5A A;  3MDC A;  3H8M A;  3H8S A;  4UB2 A;  3KHG A;  2ISP A;  5EE3 A;  4QWB A;  4PPX A;  4MEX A;  1L5U A;  1XSN A;  2LM1 A;  2NRZ A;  2FMQ A;  3NVY A;  3UQ0 A;  3RAX A;  4B6J A;  4KLS A;  4C8M A;  5L1J A;  2W11 A;  4B9V A;  1MQ3 A;  5ALS A;  4GFJ A;  1NJZ A;  1XSP A;  2IBK A;  3OTQ A;  4U7C A;  4DSL A;  4DSE A;  3NVV A;  4UW9 A;  4JWM A;  4DL5 A;  2QB1 A;  2B6G A;  5KFZ A;  4DQS A;  1S0M A;  3T5J A;  2F44 A;  1N48 A;  4M9J A;  3C2M A;  5EWE A;  4Q8F A;  2PMZ F;  5ALP A;  3QEA Z;  2C2R A;  4O3N A;  4KLM A;  2E5S A;  5ALK A;  2JH7 A;  5CA7 A;  1BPB A;  3H40 A;  2FPM A;  4G9B A;  3GU3 A;  3NRZ A;  5J2E A;  3AEV A;  1NK4 A;  2HSZ A;  3K4G A;  4QWC A;  3C5G A;  4M9G A;  4YFK A;  4EEN A;  1XWL A;  1TVA A;  5DB8 A;  1UQV A;  4Q8E A;  1UT5 A;  2F1I A;  2WTF A;  2LPE A;  7ICJ A;  2ZTC A;  1HIW A;  3I28 A;  3MDA A;  3ZDC A;  3J81 j;  3TAN A;  4MHV A;  7ICF A;  4Q45 A;  3UMG A;  5DQG A;  1N61 A;  2C28 A;  4XQ8 A;  8ICA A;  4R8U B;  1NK9 A;  3C23 A;  3MR3 A;  2JH1 A;  4WJ3 B;  2KKP A;  4C8N A;  1OW5 A;  4PHP A;  2KSO A;  3JPT A;  8ICH A;  5J2I A;  4PGX A;  4IQU A;  4EBE A;  3C5F A;  5AI9 A;  1ZQM A;  4NLN A;  4I29 A;  5AI8 A;  4TUP A;  8ICG A;  2LMR A;  1ZQO A;  5EOZ A;  1KKX A;  4Z6E A;  2H3I A;  2LKY A;  4KLG A;  2EZY A;  2L5Y A;  2E1F A;  4FS2 A;  3O0F A;  1TAU A;  1T94 A;  2NRV A;  1FFU A;  4YP3 A;  3MGH A;  1CEZ A;  2BPG A;  3KHR A;  1ZRN A;  1XC9 A;  2G0A A;  3GII A;  2MUT B;  1LB2 B;  4QJF B;  3BDP A;  2V9W A;  3C28 A;  2XY5 A;  4GLX A;  2K4I A;  4J9L A;  1DOQ A;  2ZTD A;  3PR4 A;  5HR7 A;  3TAD A;  4PL1 A;  4BXO A;  2G06 A;  9ICI A;  1S5L U;  3H0M B;  3EPG A;  2XY6 A;  5KFT A;  4ED3 A;  5F9N A;  1JXL A;  2NRX A;  3H8W A;  4DFP A;  4PHE A;  3LK9 A;  5KFJ A;  2HBK A;  3WU2 U;  1S97 A;  1YT3 A;  3G6Y A;  3FAH A;  5AI4 A;  2W8K A;  5L1I A;  4YQW A;  2HOQ A;  5HR6 A;  5KG4 A;  3QE9 Y;  2PFO A;  2HW3 A;  3RJF A;  4Y2R A;  5KFK A;  5KT6 A;  4RUC A;  2KJ5 A;  1SKR A;  3Q8K A;  2Q0Z X;  1BPY A;  3QX7 A;  2EAP A;  3ZDD A;  3RAQ A;  2F2A B;  2H3Z A;  3TQ1 A;  4K4G A;  1Z19 A;  3SAG A;  4DF8 A;  2A19 A;  1RYU A;  3RH5 A;  1RDF A;  1L3T A;  2JV3 A;  3D6J A;  2VJ4 A;  4C8L A;  1J97 A;  3JPN A;  1NKB A;  3QZ7 A;  1SIJ A;  3Q8R B;  1UA0 A;  4FO6 A;  3I76 A;  5AM5 A;  4FS1 A;  2NRT A;  4IL6 U;  2W54 A;  3KHL A;  5EE9 A;  3OSP A;  1ZQD A;  3IM1 A;  1ZQY A;  1DGJ A;  4DOC A;  5E79 U;  4IRD A;  2EDU A;  2ZG6 A;  4ACO A;  2ALZ A;  4DSJ A;  3EPI A;  5J0S A;  4KLO A;  5L1M A;  4KLT A;  2P6U A;  3SYZ A;  1BVS A;  4UAU A;  4ELV A;  2HHW A;  3CNH A;  4YVZ A;  4OCZ A;  3QU2 A;  3E2E A;  9ICA A;  3T5L A;  1ZQ1 C;  3IG8 A;  2FLL A;  1V38 A;  2YMP A;  4F4X A;  4YMO A;  8ICM A;  4JV2 A;  3H8J A;  5ALW A;  4MFF A;  4QW8 A;  4Q44 A;  2K89 A;  8ICL A;  8ICW A;  3R9K A;  4QZ8 A;  5AKL A;  4EZ6 A;  2MRL A;  4PGY A;  2KHQ A;  5DG9 A;  2J6U A;  2IOF A;  4NLC A;  3ALR A;  5KFW A;  1ZQG A;  1O08 A;  4ECX A;  1KFD A;  1KW4 A;  1WWU A;  1QQ6 A;  2PKE A;  1NKE A;  4RQ7 A;  2K4H A;  1L8L A;  2HCF A;  1SV0 A;  2JGA A;  4RQM A;  2YMQ A;  2R8H A;  8ICS A;  4DF4 A;  5EE1 A;  3RH4 A;  3D2Q A;  4ED2 A;  1ZD2 P;  5J2J A;  4F8R A;  3OHA A;  2NO4 A;  4ECS A;  1Z3E B;  3MFI A;  2E8P A;  3SR6 A;  1PVP A;  3OGU A;  1ZQF A;  4TQR A;  1WG8 A;  4ECW A;  4NLK A;  5T14 A;  1DK2 A;  1ZQA A;  5TZV A;  3ZDB A;  2DPI A;  1QLN A;  2KZZ A;  2BPC A;  5AI5 A;  3CW2 C;  3PSP A;  1NK8 A;  2HVI A;  3V72 A;  1RQL A;  2Y1J A;  5AM3 A;  7ICM A;  5AKX A;  8ICI A;  2KE7 A;  4IQV A;  5J29 A;  8ICV A;  5CJ7 A;  5KL1 B;  9ICW A;  1ZQV A;  7ICU A;  5ALJ A;  4YR2 A;  4F5R A;  1TV9 A;  3RJG A;  4J9K A;  3PW5 A;  2Q4T A;  4KIT B;  4BGD A;  1CRX A;  2ZIX B;  3N28 A;  1UPH A;  4Y2Y A;  3EUB 2;  4QZC A;  5KG3 A;  2EAO A;  1ZQN A;  2W8L A;  5DBA A;  4F4Y A;  4ELT A;  1HJP A;  1Y88 A;  2F77 X;  2W9B B;  4UB8 U;  9ICC A;  4KLI A;  3DEE A;  4F4W A;  4M9L A;  4TUQ A;  1JIH A;  4KLE A;  2MAX A;  1N5X A;  4PL2 A;  5KFN A;  3BQ2 A;  4Y2P A;  2MUT A;  5C0Y A;  3C29 A;  1C7Y A;  4NLZ A;  4DFJ A;  1X9M A;  5AM4 A;  5DB9 A;  1SWW A;  4UB5 A;  4ZH4 A;  3M8S A;  3BJY A;  3IN5 A;  1B0X A;  3HIL A;  2NRW A;  2MA1 A;  5CRX A;  3Q8M A;  4P4O A;  5J2B A;  2ZIV A;  3V7L A;  5J8Y C;  2OXO A;  4KX5 A;  3F5E A;  2KIV A;  4PHA A;  2I6X A;  4P0Q A;  4EZ9 A;  2BQR A;  3SQI A;  2EAN A;  2J6S A;  2NYV A;  4TUR A;  2OWO A;  3UXP A;  4EEL A;  4DFK A;  3NUQ A;  4UAS A;  5ALO A;  4DS5 A;  3A0H U;  1RPL A;  4QNL A;  3SEI A;  4PGQ A;  1X2I A;  1VLB A;  2DQN B;  5ALX A;  3ZD9 A;  5CR0 A;  3WK7 A;  3GIJ A;  3PZP A;  4O5C A;  2ZTE A;  4Y2S A;  5AKJ A;  5D49 A;  4QWE A;  3HX0 A;  2H3V A;  4AYB F;  1OXJ A;  1UCV A;  4RQ3 A;  1WWV A;  5EWG A;  1N5W A;  2I5H A;  2QAR A;  3QXG A;  1SV4 A;  1QCK A;  1SB3 C;  3KHH A;  5F9L A;  2D8C A;  2DPJ A;  3N97 B;  1T3N A;  2JHD A;  9ICU A;  3GFK B;  4C8K A;  1Z1V A;  1ZQE A;  5J0W A;  4O5K A;  3TAC B;  4DSF A;  1JMS A;  3RTV A;  8ICQ A;  5AM2 A;  1ZD4 A;  5AIA A;  3TKA A;  5KFH A;  4Y2X A;  4JV0 A;  1Z00 B;  2VJ5 A;  3AM9 A;  4QWD A;  2ZJA A;  1SL1 A;  4QIW F;  4RPY A;  1X9S A;  3TI0 A;  2AGQ A;  3RBD A;  5KFB A;  1D9D A;  3AMZ A;  5KFR A;  2C22 A;  5ALG A;  3AL0 B;  1X42 A;  1EXN A;  3C2K A;  4EYH B;  5DG7 A;  1KDH A;  3HKZ F;  5AIB A;  2FE9 A;  3VC8 A;  4B9U A;  4PZN A;  2HHV A;  3NVZ A;  5KT7 A;  4Y2T A;  4ECV A;  8ICK A;  4KN7 A;  2F1J A;  2YY6 A;  3SAH A;  4F50 A;  9ICL A;  4DQQ A;  2LYB A;  7ICG A;  4ECT A;  2I1Q A;  5ALR A;  1VJ5 A;  1ZQC A;  2DKZ A;  3NS1 A;  2WF8 A;  2GWS A;  1ZQJ A;  3H4D A;  1PK3 A;  1ZQU A;  3B0X A;  5J0Y A;  5KG1 A;  5BOM A;  3RB4 A;  3K1Z A;  1T4G A;  1X6J A;  3M8R A;  1P7D A;  2KTQ A;  1PZN A;  3BZK A;  3UPQ A;  1ZYQ A;  4MF8 A;  2FLP A;  3PX4 A;  2IMW P;  5BPC A;  2G07 A;  1NJY A;  1FO4 A;  1U49 A;  2AJQ A;  5H2F U;  4RNN A;  4AP9 A;  3SMV A;  5JRT A;  2HBM A;  3LYS A;  3NAS A;  1X6I A;  3GV8 B;  2OH2 A;  4CCH A;  4JWN A;  1MC8 A;  3FM9 A;  2KSO B;  5G5H A;  2UVV A;  1WUD A;  3RRH A;  2JZB B;  2IHM A;  4MFC A;  3AQE A;  3OSN A;  4Z6D A;  2PFP A;  5D4B A;  5DQH A;  4RQ4 A;  4I2G A;  1ZRM A;  3CYM A;  5CP2 A;  2Y9U A;  2G5I B;  2PI5 A;  3TAP A;  1D9F A;  3C21 A;  3THV A;  3M1Y A;  4KMU A;  4O3O A;  1L7O A;  2PFN A;  4R66 A;  1ZXI A;  4YXM A;  5A0L A;  1DRG A;  2GOL A;  4OJO A;  1JRP A;  5DGB A;  4RNM A;  4M2Y A;  3OPX A;  4RU9 A;  4K4I A;  1QSY A;  4JUZ A;  3NGD A;  1ZQZ A;  2F8L A;  3GV5 B;  5BOL A;  4P2H A;  1N56 A;  3CP8 A;  2R8I A;  4DLE A;  1WCN A;  2KOB A;  5G5G A;  4BWM A;  1QQ7 A;  2XI9 A;  2W3R A;  5J0O A;  4RUA A;  4B9T A;  4KX3 A;  2K4E A;  4TUS A;  3KD3 A;  3H7I A;  3IG5 A;  3T5H A;  7ICE A;  2KJ9 A;  1NZB A;  4IRK A;  5J0R A;  3RRG A;  4DL2 A;  1ZOL A;  2R8K A;  3IRU A;  2JEG A;  5KFA A;  2AQ0 A;  4EEK A;  3N7R C;  4USA A;  4DOB A;  3M9M B;  3AU6 A;  4DL6 A;  4I2D A;  1T8E A;  4ECZ A;  1T3Q A;  2BCU A;  1ZQX A;  3JPS A;  2DBY A;  2BR0 A;  1JRO A;  2AH5 A;  4DSK A;  4ED8 A;  4JMU A;  1S0O A;  1K1Q A;  1ZD3 A;  2M9N A;  5J0P A;  4P4P A;  3RJH A;  1NOM A;  3UQ2 A;  1RG6 A;  1L7M A;  4I2F A;  3ZI4 A;  4OO1 J;  4GIB A;  4F5N A;  4O3P A;  3A0B U;  3AU2 A;  5IIM A;  1QTM A;  7ICI A;  3C1Z A;  4QZH A;  1L3V A;  3SD7 A;  8ICZ A;  2ZJ5 A;  2H3F A;  3WKD A;  1ZQW A;  3NRW A;  4F5O A;  4GXK A;  5JTI A;  3ZDA A;  2QAR B;  4FBT A;  4KLU A;  1SWV A;  3V6H A;  2OEH A;  4DL3 A;  2GH1 A;  4CDG A;  1U47 A;  1U9L A;  3MFH A;  1D8Y A;  3B0Y A;  1SV0 C;  5J2H A;  5DLG A;  2R18 A;  4ED1 A;  4ED7 A;  2EZX A;  4ED0 A;  1J2N A;  1H38 A;  2RHF A;  4C4T A;  2BZF A;  2CPR A;  1V85 A;  2KKV A;  5KFU A;  4J9O A;  3IV6 A;  5AI0 A;  3TAR A;  4I2I A;  4QZD A;  1K1S A;  3WKB A;  3PW2 A;  4YG2 A;  3PO5 A;  4RQ2 A;  2R8G A;  2K60 A;  4QZ9 A;  3QEB Z;  5KFM A;  2Y0S F;  3WKC A;  1YZ6 A;  3PX0 A;  1MQ2 A;  1X9W A;  1V97 A;  4M04 A;  5KFL A;  2WF7 A;  5ALN A;  4YD1 A;  3MR2 A;  3ISC A;  4EBC A;  4BX9 C;  3SV3 A;  1QH9 A;  2ESE A;  3UMC A;  4F3O A;  7ICT A;  5KT3 A;  4ELU A;  3H0R B;  9ICM A;  4PZO A;  4C8O A;  1BNP A;  3WKA A;  2PFQ A;  3PY8 A;  2BGW A;  2E3T A;  4C7Z A;  5DKW A;  3MR5 A;  5KFO A;  2XGP A;  5J2D A;  8ICN A;  4GXJ A;  3SI8 A;  3HW8 A;  2HHU A;  1KBU A;  3H0L B;  5KFY A;  2KV2 A;  1RQN A;  5DG8 A;  1ZET A;  2BHN A;  7ICP A;  3L5K A;  3M6K A;  2E8O A;  3RF9 A;  5AHX A;  2ASD A;  2ASJ A;  3HWT A;  2YQE A;  5L1L A;  2LI6 A;  5JUM A;  2OYY A;  3C1Y A;  3QZ8 A;  2G08 A;  2KN7 A;  3M9N B;  2PXI A;  3EWA A;  2JEI A;  2OHF A;  4UBB A;  2ZXH A;  2C2E A;  1XNS A;  2EZZ A;  5DB7 A;  3HKZ C;  3UXO A;  2JRZ A;  3FYH A;  3IP4 B;  4QIW C;  2W3S A;  3KBB A;  2BCR A;  1MSW D;  2K8C B;  4BDP A;  4R63 A;  3PW4 A;  4NLB A;  2MSN A;  4C0Z A;  1CI4 A;  3DV9 A;  4EX6 A;  2ZIU A;  2FI1 A;  4YN4 A;  1VDV A;  1ZQB A;  4NJ8 A;  4ECY A;  1KL9 A;  4Y2U A;  4J9N A;  3BQ0 A;  4B9M A;  4CE6 A;  2XCP A;  4ED6 A;  4O9M A;  3BS5 B;  3BQ1 A;  2W9B A;  4KN4 A;  4F2S A;  3ICX A;  4F4K A;  1GO3 F;  3GQC A;  5III A;  1TKD A;  3EYZ A;  3PO4 A;  4C4S A;  1Z4N A;  1JUD A;  1KFT A;  4RPX A;  9ICK A;  1L3S A;  8ICF A;  8ICJ A;  3PNC A;  3L4P A;  3PVX A;  4FZL A;  3AQF A;  5ALE A;  4O0I A;  9ICJ A;  1SGG A;  2JR5 A;  1Z4O A;  3JPO A;  5KFI A;  3V7J A;  2W9C B;  3K1R B;  9ICH A;  3HRD D;  4LZD A;  2W55 A;  3PR5 B;  3ONN A;  1ZQH A;  1FIQ A;  4M0A A;  1WYG A;  2V4R A;  3M6Z A;  2KJ8 A;  2ZUC A;  2RDI A;  2QB0 B;  1PVQ A;  2BDU A;  5AK4 A;  2B0C A;  5KT2 A;  1SZH A;  3D2S A;  2DUY A;  2HI0 A;  5EE0 A;  3V6K A;  2XIC A;  2LHT A;  3ETL A;  5KG0 A;  2VA3 A;  4Y2V A;  3TAQ A;  1KRP A;  4DWI A;  2Z7J A;  1LVH A;  2XID A;  3LWL A;  8ICR A;  3FDS A;  5J0Q A;  2HVH A;  4US9 A;  5ALD A;  2DL0 A;  4O3M A;  5K4L A;  2E8M A;  4NV0 A;  1NJX A;  2VAN A;  3LWM A;  4F5Q A;  2RP5 A;  3AN1 A;  9ICT A;  4M6W A;  5IIL A;  5AKE A;  5D46 A;  4QWA A;  5ALT A;  1KSP A;  9ICF A;  5HNK A;  2WFA A;  4DQR A;  3GIK A;  2BQU A;  1SL2 A;  2LBO A;  5EWF A;  3KFU F;  2FJ6 A;  1PUZ A;  1Q3U A;  2ZIV B;  4EYI B;  2W04 A;  2R8J A;  4J9R A;  2AQ4 A;  4B9L A;  1PK1 A;  2YN4 A;  2EQY A;  2G09 A;  5DBB A;  4DFM A;  4NM1 A;  9ICO A;  2J6T A;  2HBJ A;  7ICR A;  4ECQ A;  3RJE A;  4UB4 A;  1O03 A;  1Z00 A;  3HT3 A;  4NLG A;  4JB3 A;  3JPP A;  2FLN A;  2JMG A;  5C5J A;  1A77 A;  4RQN A;  2CRX A;  1JI7 A;  5ALM A;  3ETR A;  3RR8 A;  3QU7 A;  3RB3 A;  1URJ A;  5KG7 A;  5IIK A;  1LKY A;  1BPD A;  5J2G A;  4DL4 A;  4RNO A;  2A1J B;  4R8U A;  2W03 A;  1S8O A;  1RYS A;  1D8L A;  3I1Y A;  1HUZ A;  3F2B A;  5ALY A;  5KG6 A;  4CNQ A;  9ICG A;  2KHV A;  5KFS A;  3PV8 A;  1NK6 A;  4J03 A;  3RR7 A;  2ZJ8 A;  4F4Z A;  1U48 A;  3PSF A;  2LM4 A;  2HHT A;  1OUQ A;  4RPZ A;  5KFF A;  1L7N A;  5DDM A;  4ICA A;  4CRX A;  5DGA A;  2BCQ A;  4GC6 A;  1JAL A;  4P0Q B;  3KKA A;  1X66 A;  4Y2J A;  1S10 A;  2F1H A;  4ECU A;  5IIN A;  4PHD A;  1NK5 A;  3G6X A;  4DQI A;  3MBY A;  9ICN A;  2KIW A;  5ALF A;  4B9N A;  4CF5 A;  4YR3 A;  3PW7 A;  3GZF A;  1UHU A;  4M6W B;  2WB1 F;  4OJ6 A;  5J2K A;  1F44 A;  2FMS A;  3SEN A;  5J2C A;  1ZQT A;  5ALU A;  5AM1 A;  3KZX A;  4KLH A;  1DGS A;  4NXZ A;  4LVS A;  3HJE A;  1KTQ A;  4DQP A;  1RYR A;  2VA2 A;  3OHB A;  4RQ6 A;  4I28 A;  7ICK A;  2YMM A;  1FFV A;  5HHH A;  4R65 A;  4PJ0 U;  4JV1 A;  2ISO A;  3HPO A;  5AM0 A;  2QLT A;  2LYH A;  3RJJ A;  1L8O A;  2BPF A;  3ISD A;  4CF3 A;  4YMM A;  1XU4 A;  1XSL A;  1ZQQ A;  1NZP A;  5AKZ A;  2WB1 C;  4DSI A;  1ED1 A;  4O3R A;  3E0F A;  4R64 A;  2XO7 A;  2JEF A;  1COO A;  8ICE A;  1ZQP A;  3QYP A;  2YTU A;  3KKA C;  4I2J A;  5KT4 A;  1RM6 C;  3FC4 A;  4I2H A;  5DDY A;  3BS5 A;  4IR1 A;  4RQ5 A;  5AKH A;  2KIC A;  1NK7 A;  3F2D A;  2K4P A;  5J0X A;  4G3I A;  3T79 A;  4OJ5 A;  5KL8 B;  1TK5 A;  5ALZ A;  4KLD A;  3B9J A;  1S77 D;  4J9M A;  4P0P B;  2ASL A;  3V6J A;  1ZQR A;  4FZN A;  3TFR A;  5FP0 A;  3N7P D;  4MFA A;  1F5S A;  4RT2 A;  3WK8 A;  5ALQ A;  4XA5 A;  2YX8 A;  4OJP A;  4EX7 A;  3PW0 A;  3BS7 A;  5AKI A;  3C2L A;  5GTI U;  1BGX T;  3UXN A;  4F2R A;  5CB1 A;  5KFG A;  2XY7 A;  4UAR A;  4O3S A;  4J9S A;  3ORY A;  2K8B B;  1IV8 A;  3RH6 A;  3Q8L A;  1BPE A;  1D8B A;  3G6V A;  4EEY A;  2WHE A;  5KAI U;  4QW9 A;  4O3Q A;  5ALH A;  3VCB A;  8ICT A;  2YB1 A;  3WK5 A;  1NNL A;  2W43 A;  5L1K A;  8ICX A;  2H5X A;  4DLG A;  2UVU A;  4F93 B;  9ICQ A;  5J0U A;  5IIO A;  4F92 B;  4DFD A;  2BCS A;  4GC7 A;  1Q3V A;  1S76 D;  5AKG A;  3EZ5 A;  7ICH A;  2RQ5 A;  2KEY A;  2DF4 B;  1T7P A;  2WF6 A;  4BUG A;  4DCC A;  4FZM A;  1HEK A;  3QUB A;  2BKE A;  4BWJ A;  5JU5 A;  1L3U A;  4I2B A;  5CHG A;  3KOO A;  1V9P A;  1ZQI A;  1ARO P;  2WF5 A;  3QUC A;  4RQ1 A;  5KFX A;  7ICO A;  2NO5 A;  4JK1 A;  2AGP A;  2M0N A;  2ZUD A;  3QNM A;  2XGQ A;  3QUQ A;  1SXD A;  3K75 D;  2W7O A;  2JXJ A;  3F53 A;  2W7P A;  2JEJ A;  5J8Y A;  4UB6 U;  5J2A A;  3BZC A;  1ZQK A;  3WK4 A;  2BDP A;  4I2E A;  3T3F A;  3PST A;  7ICQ A;  4UQG A;  1S0V A;  1BPZ A;  4HAI A;  2B21 A;  1XO1 A;  5KFQ A;  4Z6F A;  2ZUB A;  4F91 B;  1UA1 A;  4OD0 A;  7ICL A;  1B22 A;  1S0N A;  1JX4 A;  2WAQ C;  2AGO A;  3RB0 A;  2UVR A;  1ZD5 A;  4UAT A;  1X40 A;  1IM4 A;  3SV4 A;  3BQ7 A;  2AXT U;  5B5E U;  2KNJ A;  3U26 A;  4NY8 A;  8ICP A;  2P66 A;  5KG5 A;  5DLF A;  4P4M A;  4NM2 A;  5HMM A;  1M6Y A;  1BPX A;  3GDX A;  5J2F A;  1KFS A;  3Q8Q B;  5CEH A;  4KLQ A;  1ECW A;  4UAW A;  3QU5 A;  3AUO A;  4IQW A;  2H3Q A;  2NV3 A;  3OJU A;  2KVS A;  2WF9 A;  1N2X A;  2BCV A;  4LJX A;  8ICB A;  1ZJM A;  5IIJ A;  1DK3 A;  3ISB A;  5KFD A;  2I9G A;  3OJS A;  3TFS A;  1IXR A;  1COK A;  5ALI A;  4ECR A;  4M9N A;  1ZJN A;  1BNO A;  4DEZ A;  1TAM A;  4XUS A;  2BQ3 A;  1ZQS A;  3PML A;  4C4R A;  2XCA A;  4QZE A;  1TFR A;  5AKK A;  3IHQ B;  5ALL A;  4Q43 A;  1TK8 A;  2DFL A;  4XRH A;  2PMZ C;  2KMD A;  2KP7 A;  2EAM A;  5DQI A;  2WAQ F;  4YXJ A;  5KFE A;  2ZIU B;  7ICS A;  4QZA A;  3LDA A;  2F76 X;  5KAF U;  3F2C A;  1IG6 A;  2G5H B;  4KLF A;  2F3N A;  2ZIW A;  1C20 A;  5KFC A;  4HYK A;  3Q8S B;  5HML A;  2A1A A;  2IHN A;  4DS4 A;  2EH9 A;  1L7P A;  2KFZ A;  4KMO B;  5KG2 A;  4YCX A;  2ES6 A;  1L6N A;  1XO0 A;  5HHI A;  4YD2 A;  5HP4 A;  4NL9 C;  2CN1 A;  2E8N A;  2N1R A;  4FFD A;  3HP6 A;  4I2A A;  4B9S A;  4FE3 A;  3M7D A;  5AIC A;  1SL0 A;  2ZIX A;  5GTH U;  2HOI A;  4RQ8 A;  7ICN A;  3EW9 A;  2W9C A;  2GLE A;  2YB4 A;  5TIS U;  3MGV A;  1RZT A;  4IS7 A;  4CF4 A;  4TQS A;  3ZD8 A;  2ODG A;  3SZ2 A;  4F5P A;  2RLT A;  2LYA A;  2ATL A;  4O5E A;  4DO9 A;  4F72 A;  1UT8 A;  3IDW A;  3N7S C;  1MN8 A;  4KLL A;  3V7K A;  3CRX A;  3T5K A;  3UMB A;  1N63 A;  4US8 A;  1X9X A;  2V4Q A;  1SKS A;  9ICS A;  5KFP A;  4UAV A;  3WK6 A;  3KZI U;  1NK0 A;  4U6P A;  3GV7 B;  4E0D A;  1LV5 A;  2P35 A;  3WKE A;  4F71 A;  4PH5 A;  3JPQ A;  4FBU A;  4AYB C;  1Q8K A;  4DL7 A;  2Y0S C;  2IA6 A;  2HBL A;  2DGZ A;  3N4M B;  2KZ3 A;  4UAY A;  3MC1 A;  2C2D A;  2YML A;  2OCE A;  4C7Y A;  2D3D A;  3LVV A;  2KG5 A;  2XVT A;  3L3F X;  4QZF A;  3S6J A;  4P0P A;  1NI3 A;  4IR9 A;  1YZ7 A;  2JZB A;  4K4H A;  2W9M A;  8ICO A;  2RRD A;  2A3V A;  2GO7 A;  1NJW A;  7ICV A;  9ICX A;  1RXV A;  1SZP A;  2DKX A;  1XS9 D;  2VIX A;  2KK0 A;  1J2M A;  1IIP A;  1TAQ A;  2FPK A;  5KTQ A;  3GIL A;  9ICP A;  1PK1 B;  3MR6 A;  3MAB A;  2KVC A;  4Y2Q A;  1QQ5 A;  5KFV A;  3RFA A;  2ZIW B;  4DOA A;  5AK5 A;  3PSI A;  4OJL A;  4C80 A;  4NL9 A;  3H4B A;  4BJQ A;  2AU0 A;  2FPL A;  5L9X A;  3MGI A;  4BXO B;  5DBC A;  3RBE A;  2KFN A;  2CXY A;  5AI6 A;  1CUK A;  2VKQ A;  2K8A A;  1KN5 A;  5AK6 A;  5ALV A;  4UAZ A;  2VA8 A;  2Y9T A; 
#chains in the Genus database with same CATH homology
 3SEN A;  1WWV A;  3TAD A;  1V38 A;  2QAR A;  1SV4 A;  1UQV A;  2F8K A;  2EAO A;  2ESE A;  2LPE A;  5F3X B;  1SXE A;  1SGG A;  2D8C A;  3IDW A;  4PZO A;  1X9X A;  3K1R B;  1Z1V A;  4MHV A;  3TAC B;  4RQN A;  5JRT A;  3TAD C;  1JI7 A;  1COK A;  3H8M A;  2QB0 B;  2KSO B;  1KW4 A;  1F0M A;  1WWU A;  2E8O A;  1LKY A;  2QB0 A;  1RG6 A;  2EAP A;  1OW5 A;  2KSO A;  1DXS A;  5JU5 A;  1SV0 A;  2Y9T A;  4RQM A;  2KMD A;  2EAM A;  2YTU A;  3KKA C;  2D3D A;  2KG5 A;  2Y9U A;  1B0X A;  3HIL A;  2E8P A;  1B4F A;  2JV3 A;  3BS5 A;  2K4P A;  2LMR A;  1SXD A;  2FE9 A;  2QB1 A;  5J8Y C;  5JTI A;  2F3N A;  2QAR B;  2B6G A;  5J8Y A;  4PZN A;  2DKX A;  2DL0 A;  2KIV A;  2F44 A;  2L5Y A;  1SV0 C;  2E8M A;  2EAN A;  2QKQ A;  1PK1 B;  4NJ8 A;  2ES6 A;  1V85 A;  3KKA A;  1X66 A;  4NL9 C;  2E8N A;  3BS7 A;  1LKY B;  2KE7 A;  3BS5 B;  4NL9 A;  3SEI A;  5KNI A;  2DKZ A;  1X40 A;  2K60 A;  5L1M A;  3BQ7 A;  1PK3 A;  1PK1 A;  2GLE A;  4IS7 A;  1OXJ A;  1UCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...