2KSOA

Epha2:ship2 sam:sam complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
b'TVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
molecule tags Protein binding
source organism Homo sapiens
publication title Structure and function of the EphA2:SHIP2 SAM domain heterodimer
rcsb
total genus 20
structure length 65
sequence length 65
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ksoA00
3KKAA 1SXDA 2DL0A 2KE7A 2F8KA 2QB1A 2QB0A 3BQ7A 1V38A 2KMDA 3H8MA 1X40A 2QB0B 4NJ8A 2EAOA 5JTIA 5J8YC 4NL9A 3TADA 1UQVA 1SV0A 1SV0C 2Y9TA 1V85A 4MHVA 2ES6A 5F3XB 1JI7A 1Z1VA 2YTUA 4PZNA 2K60A 3KKAC 2KSOB 3BS7A 2F44A 1F0MA 2E8OA 3BS5A 5JU5A 2EAMA 3TACB 2K4PA 1OXJA 1LKYB 3SENA 2EANA 2FE9A 2KIVA 3SEIA 2B6GA 1RG6A 1DXSA 2Y9UA 5JRTA 1UCVA 4RQMA 1PK3A 5L1MA 2QARA 2ESEA 2QARB 1X9XA 2E8NA 3TADC 4RQNA 2D3DA 2E8PA 1X66A 1B4FA 4PZOA 1LKYA 1WWVA 2D8CA 2E8MA 1PK1B 1WWUA 2JV3A 1PK1A 3BS5B 1SGGA 1SV4A 2DKXA 5J8YA 3HILA 1B0XA 1COKA 2QKQA 2KSOA 3K1RB 4IS7A 4NL9C 2LPEA 2F3NA 2EAPA 2LMRA 2DKZA 2KG5A 2L5YA 2GLEA 1SXEA 5KNIA 1KW4A 3IDWA 1OW5A
chains in the Genus database with same CATH superfamily
4C4RA 1ZQRA 5CWRA 2RDIA 2WF7A 3GQCA 4XQ8A 1TV9A 4ED0A 4J9SA 4QZBA 4KLGA 4C8KA 5J2FA 2E5SA 3NS1A 8ICZA 2NV3A 2ZTEA 1NZBA 4DSKA 2KD1A 3BJYA 3TFSA 5KT4A 3RBEA 3QNMA 2HVIA 2JR5A 2EZZA 1JI7A 1ZJMA 2ZTDA 3NASA 3OJUA 4ED3A 2C2RA 4KLJA 1N5XA 4OD0A 5AIBA 1ZQUA 3NRZA 3M1YA 2NO5A 1JUDA 4FZNA 5AKEA 4DF8A 4ELTA 2CN1A 4EBDA 4DSIA 1Z19A 2BQRA 4DCCA 4Y2SA 3TQ1A 1SWVA 2M0NA 1Z4OA 5KG7A 2RP5A 2PMZF 2W9MA 2BQUA 3MGIA 2D3DA 3Q8RB 1B4FA 1K1SA 3H40A 1ZQGA 2R18A 4IRKA 3QZ8A 5DBAA 2V4QA 5CHGA 8ICPA 1CRXA 4KLQA 5HNKA 1ZQEA 2EZXA 4UAVA 4QIWF 4UB8U 3D2QA 4I27A 3PX4A 4KTQA 4GC7A 3HRDD 2H5XA 2JRZA 1IM4A 2BHNA 2LKYA 2XC9A 5DGAA 3C1ZA 4M9LA 8ICWA 4I2HA 4DQRA 2PFPA 7ICTA 5KL8B 5B66U 2MU2A 4GC6A 4F2SA 1S77D 1N61A 4DFJA 3F2DA 2HW3A 2BZFA 1FFVA 3ICXA 4K4GA 2J6SA 1O03A 3UXPA 3TAQA 7ICMA 5KG0A 4B9MA 1IXRA 1ZQWA 4NJ8A 5D4BA 4PL1A 3WKEA 1ECWA 9ICNA 1UQVA 5KFWA 2DQNB 3SYZA 3ISCA 1U45A 4OO1J 2BDPA 2EH9A 4F8RA 1LVHA 4YMOA 3ZD9A 4PZNA 4RUCA 3OPXA 3JPPA 4RPYA 2JEGA 4M6WA 4Q44A 4Q8FA 1DK2A 3QUCA 5J2EA 4F5RA 2KJ8A 4DS5A 4OJ6A 3PW7A 4ECWA 1D9DA 1TK0A 3TACB 4NLGA 1S5LU 1NK8A 5JRTA 1SZPA 3PR4A 3QEBZ 2JEJA 4PJ0U 4FZMA 4DLGA 2WHEA 1XNSA 1NI3A 2BPGA 2W9CA 1S8OA 3PNCA 1T3NA 2WTFA 3SI8A 1PVPA 2JV3A 4BDPA 1JMSA 2AGQA 4DWIA 1S97A 1NZPA 3KTQA 2ZJ8A 5J0QA 3BQ0A 3GV5B 1VDVA 3MBYA 2LPEA 3SZ2A 4I2EA 2PFNA 1RQLA 4Z6DA 5IILA 4UW9A 2AGOA 5KFAA 5AKHA 9ICVA 3TANA 2PFOA 1ZQQA 3S6JA 2HOFA 1MC8A 1L7OA 2WF8A 2A1JB 4CF3A 3C2LA 1XWLA 2MAXA 5J8YC 1SKSA 3RAQA 2WF5A 4F92B 3IN5A 3PW4A 1QLNA 4YD1A 5KFHA 3PZPA 5IIMA 7ICQA 1SKRA 3GDXA 1RYSA 4I2AA 4M9GA 3RJHA 4J03A 1KEJA 4Y2TA 1PZNA 2E3TA 5JU5A 3KHLA 3MR5A 9ICIA 5B5EU 5KFTA 8ICHA 2CPRA 4RUAA 3GV7B 4IQUA 2W9BA 3DV9A 4RQMA 5DQIA 2K89A 4DSLA 4M6WB 2DPJA 5KFEA 3C28A 2N1RA 2BCRA 2W7OA 5AK4A 4O0IA 2Y1JA 5J2BA 2IHNA 3WKAA 3PX6A 5HR7A 1FFUA 2XY5A 5KFOA 3MABA 1WWUA 3AU6A 5AI9A 2DPIA 4TURA 1Z1BA 4CDGA 1NJXA 3L5KA 2PFQA 1ED1A 8ICXA 4RNNA 2IHMA 3LDAA 4YMNA 4ECQA 4PL2A 3UQ0A 1J2NA 4YN4A 3ETRA 2HBMA 3TAPA 3WK5A 1VLBA 2ISOA 4FS2A 1COOA 3J81j 2XGQA 1NOMA 4J9NA 5ALTA 3RBDA 2XGPA 1RYUA 2BCVA 9ICPA 4RQ6A 4FBUA 3KZIU 4M9HA 4MFAA 4RT3A 2HHWA 4DQIA 1FIQA 2XCPA 5L1LA 2RQ5A 2ES6A 1Z1VA 1BGXT 4RU9A 9ICMA 4KITB 1MQ2A 4IR1A 2KSOB 1L7PA 3RH4A 4RPXA 1S0VA 2G0AA 3EUB2 1Z3EB 2KICA 3GV8B 4B9UA 3PR5B 4R63A 4PHPA 3CP8A 3D2NA 4UAYA 3LK9A 1A76A 2K4PA 3IRUA 4QJFB 1KBUA 3RRGA 4QW9A 4Y2VA 1RQNA 4PHDA 3DEEA 3F5AA 4KLOA 4M04A 2ZIWB 3GU3A 3T3FA 1Y88A 5DLGA 1HJPA 4G3IA 1IG6A 2R8GA 2H3VA 5ALEA 2PKEA 2XCAA 4O9MA 4UB1A 1U4BA 4O3QA 2DKXA 3JPQA 3NUQA 5AM4A 4UAZA 4RQ5A 3K1RB 4M9JA 2KOBA 2MUTA 1BVSA 3EYZA 4DQPA 2L5YA 3UPQA 3RJJA 7ICEA 2ATLA 3GILA 4ECUA 1SXEA 3K4GA 2XICA 3M9OB 5J2HA 2KHQA 4JMUA 3U26A 1OW5A 8ICIA 2DL0A 1Q3VA 5DG7A 2HDOA 2W3RA 1WG8A 3RJIA 4NL9A 3B0XA 3ZD8A 2ZG6A 3QU7A 2JZBB 2FLPA 2OWOA 5AM1A 9ICUA 5J0YA 4B6JA 2OHFA 5DQHA 4P4OA 9ICKA 9ICSA 2WAQF 5CJ7A 2DF4B 2HSZA 3T5KA 2G06A 2NRZA 3PO4A 3PW5A 3PSPA 2WFAA 3JPTA 9ICXA 3RFAA 2KKVA 2HHUA 4K4IA 3ISBA 1NKEA 1KFSA 2UVWA 2RHFA 2FE9A 3SEIA 1RG6A 5E79U 2VIXA 4RQ0A 3AM9A 2BCQA 1TVAA 1NK7A 1NKCA 1X2IA 2PXIA 1U49A 5KG2A 1D8YA 1L3TA 1N2XA 4F4KA 1SGGA 2H3FA 2ASDA 2DUYA 1D9FA 4CGZA 1DRGA 4MFFA 4OJ5A 1S76D 1TAQA 2G07A 1T8EA 4DL7A 4LZGA 1YZ6A 3ZDDA 1ZQJA 3SAFA 3PW2A 1X9MA 3JPNA 4NL9C 2ZUDA 5EWGA 3ETLA 4GLXA 2RRDA 4EX6A 3OJSA 1V97A 2GOLA 3ZDBA 4Z6FA 5ALFA 2YMMA 3OTQA 8ICRA 2P66A 1ZETA 5AM5A 3KKAA 3L3FX 1SXDA 4FZLA 5EE3A 4XA5A 1ZQPA 3C2MA 4MF8A 4DFKA 2MUTB 5KFDA 3FDSA 8ICYA 2HVHA 1NJZA 5DB9A 8ICOA 4MEXA 5CRXA 5KFCA 1F44A 1D8LA 5TZVA 5ALMA 5J0XA 4QIWC 3AMZA 4ED1A 4DS4A 1L3SA 4CCHA 1UHUA 1JN3A 1SL2A 1CEZA 4XUSA 4KLFA 3OHAA 1FO4A 4Y2JA 3SV4A 3V7JA 3NTUA 3QUQA 5HHHA 5AKZA 1B22A 5F9NA 1N56A 3BS7A 3RTVA 2F44A 8ICLA 5DB7A 4RNOA 4RQ7A 4Z6EA 5ALXA 1PVRA 1TAMA 3ISDA 5A0LA 4JV1A 5C5JA 7ICUA 2I6XA 2E8NA 4RQNA 3CRXA 1ZOLA 8ICBA 3MGVA 3BZCA 1BPXA 4ELUA 2LYHA 2KTQA 3TARA 1DK3A 4YVZA 3BS5B 1NK0A 5HHIA 8ICJA 4CRXA 2DBYA 4US9A 2LM1A 4ECXA 2Y0SF 5T14A 4UB6U 5AI5A 4HYKA 2WF6A 5KFNA 3B0YA 1ZQAA 3AUOA 9ICBA 4P0QB 1O08A 4TQSA 8ICGA 4NV0A 4C4TA 2OYYA 4UASA 2OM6A 5AKIA 5J0OA 3KHRA 3RH6A 4KLMA 2FDRA 4QWAA 1TE2A 3M7DA 5KT3A 3Q8KA 3C5GA 8ICCA 3RJEA 4O3SA 1QQ5A 2H3ZA 4P4PA 3N28A 2KFZA 2UVUA 2PI4A 5GTHU 5KFQA 9ICFA 2GO7A 5G5GA 4PHEA 1BNOA 1V85A 2DGZA 2F1HA 2AH5A 4MHVA 2DFLA 8ICMA 3QYPA 1ZQZA 1ZXIA 3VCBA 4DO9A 2K4HA 5J2CA 4UB5A 5AKXA 3N7PD 1SL0A 3WK9A 4KLDA 1DOQA 5KFFA 3G6YA 3V6JA 4QZ8A 4UAWA 1F0MA 2Y0SC 7ICKA 1QH9A 3ZDCA 1ZQVA 4IQVA 3Q8QB 2LI6A 1XS9D 5F9LA 1S0MA 4QNLA 5D49A 5DGBA 5EOZA 2E1EA 9ICEA 1KFTA 4UB3A 1PK3A 3UM9A 2BCUA 2KP7A 4F91B 2OEHA 4M2YA 2QARB 4I2GA 5KFUA 3T79A 4BXOA 3CW2C 3NGDA 1WWVA 5H2FU 1HEKA 4GIBA 4UBBA 1YZ7A 2JZBA 2W04A 1DGJA 2VA8A 5ALRA 4F50A 4EZ9A 1HUZA 4Y2XA 4FO6A 4EYIB 4DFMA 1ZQOA 4IL6U 4QWDA 4NXZA 4R64A 2EAPA 2XVTA 3HX0A 1ZQKA 4ICAA 4QWEA 3ALRA 2KIWA 5KNIA 1KW4A 2KN7A 4OJLA 4YFKA 3GIJA 5J2AA 2XI9A 4J9RA 5IIOA 3HP6A 4ED2A 2HHSA 2QB0A 5ALQA 3AN1A 3GZFA 3QEAZ 4I29A 2OXOA 9ICHA 1X40A 4J9KA 4ACOA 2I5HA 3TKAA 2RDJA 2FLNA 4F71A 2W8LA 2HCFA 2FMSA 5DB6A 1Q3UA 3KOOA 4P0QA 3HPOA 1T3QA 2Y9TA 4Y2YA 2PI5A 2WB1F 4O5EA 1ZQSA 4NWIA 3PY8A 2ALZA 3C23A 3KKAC 5KT2A 7ICNA 1S10A 4QZIA 2ZIXA 2BGWA 3HWTA 2F2AB 4P2HA 1UT8A 5CA7A 1K5OA 5DKWA 2LYBA 4JUZA 3RJFA 3M6KA 5HR6A 4YCXA 2MRLA 2XIDA 3M9NB 2B6GA 4O3RA 1QCKA 5AM0A 2AQ0A 3MGHA 4RT2A 4C0ZA 5D46A 4UB2A 4JWNA 2AU0A 2A1AA 2QARA 5L1MA 3IV6A 3A0BU 1MSWD 1AQ6A 3ZDEA 5J2IA 5DLFA 1T4GA 4PZOA 1A6SA 1N60A 2LHTA 2IMWP 2K4IA 2XY7A 2BDUA 4YG2A 4QZFA 1X9WA 3H0LB 2HOQA 4DQSA 3D2SA 4TUQA 2W9AA 4DFPA 3HKZC 1WUDA 2HOIA 2KJ9A 2YQEA 5HMLA 5ALDA 1ZQ1C 4O5KA 1ZQCA 4IC9A 1TAUA 2DKZA 2JMGA 5DDMA 5AI4A 3NVVA 5BOLA 4Y2PA 4KX3A 1JIHA 2KE7A 1NKBA 4C8LA 1Z4NA 2ASLA 1TK8A 3H8MA 1ZD4A 2Q4TA 1RXWA 5J0PA 4IQWA 3FYHA 4QZCA 3OSNA 4CE6A 5KT6A 4P4MA 1XO1A 1IV8A 3NVWA 2FMPA 1L6NA 3NRWA 3UXOA 4UQGA 1C7YA 5J0SA 1ZQYA 5IIIA 5ALIA 1L3VA 3RR7A 4ECSA 5BOMA 4JWMA 5HMMA 1ZYQA 2W9BB 1L5UA 2A19A 3MR2A 3HW8A 5IIJA 3RB4A 4OJOA 5KFJA 4NLKA 2NRWA 1XC9A 2K8BB 3WK8A 4ED7A 1ZQXA 8ICKA 4R8UA 2B0CA 5AKJA 1X6JA 1BPBA 5KFMA 5G5HA 1TK5A 4EX7A 1X66A 4QZEA 1JALA 1D8BA 1U47A 7ICHA 2VA3A 2E8MA 8ICAA 4F3OA 4G9BA 3PX0A 2R8HA 4MFCA 1SZHA 4JB3A 4ECTA 1A0PA 5FP0A 5AI8A 4B9TA 1YT3A 7ICOA 4PH5A 3EPGA 2IA6A 4PGYA 2F3NA 1L8OA 4Y2UA 1T94A 4DOAA 3ED5A 4MEYA 2JH7A 2NYVA 1XSNA 7ICIA 4BGDA 1BNPA 5AK5A 2M9NA 1ZRMA 4Y2RA 3FAHA 3MFIA 5DQGA 2FLLA 3N7SC 2JHDA 4NLBA 3RB3A 3H4DA 4AP9A 5EWFA 3PW0A 4UATA 2HHVA 4Q43A 5J0WA 2YMPA 5KFIA 4M0AA 4KN7A 2ISPA 3BDPA 3VC8A 4J9MA 2KFNA 4F4XA 2WAQC 1X9SA 1UT5A 3WK4A 5KFZA 4QWCA 2RLTA 5J2JA 3M6ZA 2GWSA 2NRVA 3B9JA 5DG8A 4YR3A 2ODGA 4Q45A 4YR0A 4KLTA 3BS5A 3MR3A 1NJYA 3PMNA 4NM2A 4B9VA 1WCNA 2G5IB 1NNLA 5BPCA 4IR9A 2MSNA 2WB1C 1TKDA 1ZQIA 3AL0B 4KN4A 3H0MB 3OHBA 5ALZA 1ZQFA 2DWQA 4U7CA 4F5PA 5ALKA 5KG3A 1EXNA 4O3NA 3EW9A 5KAFU 1S0NA 3H8WA 8ICUA 2ZIXB 2YMLA 3AU2A 8ICFA 1COKA 2W3SA 1JXLA 3OSPA 1Q8KA 2C2EA 3LWLA 2YY6A 3WKCA 2W8KA 2AHOB 3O0FA 2O6KA 1QSYA 3UMBA 1JX4A 1LV5A 2A3VA 2QB1A 3G6VA 4NLCA 2KJ5A 3FC4A 2OH2A 1KN5A 3QU5A 5L1JA 2ZUCA 1JXEA 2EAOA 4RQ3A 4EYHB 3KZXA 4Q8EA 1MA7A 1SV0A 3UQ2A 4JK1A 8ICVA 4C7ZA 3PVXA 3N97B 4GXJA 1Q46A 2YTUA 4MF2A 2H3IA 2C2DA 4F5NA 5KT7A 3LVWA 3QU4A 4FBTA 1KLNA 4DSFA 3H0RB 2XY6A 5AKYA 4O3PA 3JPRA 2D6FC 2K8AA 7ICJA 5ALNA 2E8OA 3H7IA 3E2EA 2ZIVA 1U9LA 2J6UA 3Q8PB 1T7PA 1OXJA 2EANA 3C21A 2GH1A 2W9CB 2V9WA 3OGUA 1CUKA 2G5HB 1ZQLA 4AYBF 2HBJA 4AYBC 2AJQA 3GIIA 1CI4A 1UA1A 3TADC 4DQQA 4I2IA 5KFYA 4EBCA 2KHVA 3N4MB 2ZJ5A 5KG4A 3KHGA 2D8CA 4J9LA 2FJ6A 1PK1B 4EELA 1PK1A 4C8MA 4DSJA 2YB1A 3Q8LA 7ICFA 3T5HA 4OJPA 5J2KA 3THVA 3WKDA 2HHXA 2EQYA 4IRCA 3CYMA 8ICQA 2YB4A 2LMRA 1V9PA 2KG5A 2XO7A 1ZD5A 2GLEA 3EWAA 4F4YA 4TQRA 1J97A 5AM2A 2KEYA 5DBCA 4DFDA 3QU2A 2FMQA 2ZJAA 2W55A 2KMDA 2ZIUB 5IINA 3LVVA 4IQTA 4UB4A 2QB0B 3MDCA 4FFDA 2KKPA 3MR6A 3H4BA 5JTIA 1ZQDA 3AQFA 4RQ4A 3V72A 1MN8A 5AHXA 3SAHA 5KFLA 1SV0C 7ICPA 2ZUBA 2JEIA 7ICSA 4BWMA 4EBEA 2J6TA 2KV2A 1ZQMA 2BKEA 2R8IA 4I2CA 4O3MA 4J9OA 2K60A 5KFRA 4QWBA 1XU4A 4EEYA 2IOFA 1UA0A 1Z00A 1XSLA 2NO4A 3KD3A 2FI1A 7ICVA 2P35A 9ICLA 3RH5A 5KFSA 1BPYA 3F2CA 2KIVA 5DG9A 5TISU 3V7LA 2PMZC 2OCEA 1ZD3A 5KG5A 9ICQA 3RJGA 2C22A 1X9XA 4DOBA 3H8JA 9ICJA 4YP3A 1ZQTA 3MDAA 1C20A 1A77A 3KHHA 5ALSA 4HAIA 4I2BA 1NK4A 3GIKA 1JROA 7ICRA 4UBCA 4ECYA 1QTMA 5DDYA 8ICTA 2K4EA 9ICOA 2Z7JA 2MA1A 1QSSA 2VA2A 5DB8A 4PPXA 4RQ2A 5ALWA 3MFHA 4F4ZA 4DL4A 1HUOA 3IDWA 2CXYA 5AKKA 4KLHA 7ICGA 5EE1A 3RAXA 3RF9A 4TUSA 4X5VA 3RR8A 5IIKA 3BQ7A 1LB2B 4M9NA 1TFRA 1AROP 3UXNA 3WKBA 5J2DA 2KVSA 5CB1A 3BQTA 2KZ3A 4I2JA 2F1JA 9ICCA 2YN4A 2JEFA 4DL6A 2W43A 4P0PB 2F1IA 3M8RA 1ZQBA 3WK7A 3G6XA 2AQ4A 1QQ7A 5KFGA 1RYRA 4KLSA 4QZHA 1SL1A 3PV8A 4I28A 9ICTA 4QZ9A 2I9GA 3LWMA 1PVQA 1LKYB 1S0OA 3HT3A 3CNHA 3QZ7A 1KQQA 9ICWA 1NK6A 3F2BA 2Y9UA 3C1YA 1KTQA 1KKXA 5L1IA 1L7MA 3BZKA 4R8UB 5ALPA 4OCZA 2E8PA 3K75D 3N7RC 3I76A 3SQIA 2AGPA 4GXKA 3RB6A 1N62A 4RQ1A 3IG5A 3SMVA 1MQ3A 3E0FA 3ORYA 2FPLA 4B9LA 2G08A 2NRTA 4YXMA 5J0TA 3TI0A 2YX8A 5GTIU 4F72A 2QLTA 3SV3A 1SWWA 5JUMA 5L9XA 2VJ5A 1B0XA 3PSIA 1IIPA 2KSOA 1X42A 4IS7A 2V4RA 5DBBA 2KZMA 2F8LA 1BPEA 4DL2A 4ED6A 1SIJA 1NK5A 3JPSA 4BX9C 2ZIVB 2I1QA 4BJQA 5KTQA 5AK3A 4PGQA 2F8KA 4E0DA 3EZ5A 1VJ5A 2A1JA 3DDHA 3FM9A 1L7NA 4R66A 1QQ6A 4F4WA 8ICSA 2LBOA 3T5LA 3PO5A 4BWJA 4DSEA 4FE3A 1U48A 5ALGA 5ALJA 4P0PA 2R8JA 2VKQA 3I1YA 3K1ZA 5KFBA 3RRHA 4KX5A 4I2FA 2B21A 2HBLA 1RM6C 5KFVA 5L1KA 5AIAA 2BPFA 4EEKA 3QU9A 4PHAA 2FPMA 3ZI4A 3Q8MA 2BCSA 2JXJA 5EWEA 2K8CB 1DGSA 4ED8A 4F5OA 2EDUA 3PSFA 5KG1A 3QUBA 4RQ8A 1XSPA 1WYGA 2EAMA 2ASJA 1FEZA 4C80A 4ECVA 1KSPA 1RXVA 2LM4A 1QSLA 2ZXIA 1KDHA 1ZD2P 4QW8A 1DXSA 2KK0A 3LYSA 4CNQA 3SD7A 1BPDA 2P6UA 3SAGA 4DOCA 1XO0A 3C5FA 4PGXA 5KL1B 3PMLA 2P6RA 1LKYA 4ZH4A 5J0UA 3IP4B 1KRPA 4YR2A 5AKGA 4F2RA 3V6KA 4WJ3B 3GIMA 3BQ1A 3I28A 1RZTA 4O5CA 4ZOHC 8ICNA 3HJEA 4XRHA 1P7DA 5J8YA 2NRXA 4B9SA 5J2GA 2ZIUA 3NVYA 3AQEA 1URJA 3MC1A 4KLLA 2HHTA 3PSTA 4NM1A 2CRXA 4KMOB 1HIWA 2YMQA 2KNJA 3L4PA 2IBKA 2E1FA 9ICRA 3Q8SB 1RPLA 9ICAA 1L3UA 1V38A 3M8SA 2LYAA 5ALLA 5KFXA 4F93B 2BQ3A 1NJWA 4JV0A 2F77X 4QZDA 2Y1IA 1ZQNA 4I2DA 1N63A 2UVVA 5HP4A 1JRPA 5EE0A 3A0HU 1UPHA 4J9QA 4A8EA 5AICA 5F3XB 1S9FA 3SR6A 4YMMA 4USAA 4NY8A 3NVZA 4GXIA 4YQWA 3UMGA 2BR0A 1OUQA 1SKWA 4DEZA 3IM1A 3QUTA 3TFRA 1WCLA 2F76X 3IHQB 3SENA 3EPIA 5AI0A 4FS1A 4KLUA 5ALUA 3QXGA 2VANA 4F5QA 1ZRNA 2W54A 4NLNA 1H38A 2ESEA 4DL3A 2HI0A 3R9KA 4KMUA 2HHQA 5J29A 4K4HA 4UAUA 4IRDA 5AM3A 2UVRA 5EE9A 4M47A 3JPOA 7ICLA 5KFKA 4RZRA 4EZ6A 1PUZA 3ZDAA 1B43A 2IOFK 1Z00B 2VJ4A 4O3OA 3HILA 4US8A 2W03A 2EZYA 1ZJNA 3IG8A 4RNMA 4ECZA 3D6JA 5CEHA 3E58A 3BQ2A 3KFUF 3F5EA 4Z6CA 2G09A 2H3QA 3WK6A 1NK9A 2WF9A 4CF4A 1GO3F 4Y2QA 1KFDA 4KLIA 2FPKA 4JV2A 5AI6A 4LZDA 3F53A 4ECRA 4U6PA 4R65A 1L8LA 3TADA 4EENA 4J9PA 1N5WA 3QX7A 1RDFA 1SB3C 4C7YA 4UARA 4CF5A 4YXJA 2HMXA 3AEVA 4GFJA 3H8SA 4BXOB 3RJKA 5KFPA 4YD2A 4LVSA 9ICGA 3V7KA 4LJXA 4QZGA 1F5SA 5C0YA 5KG6A 1BPZA 3WU2U 4DL5A 3C29A 2ZXHA 2HBKA 4C8NA 5AKLA 8ICEA 2ZTCA 5AK6A 3RB0A 3T5JA 1M6YA 1J2MA 5KT5A 3QE9Y 4C4SA 1UCVA 2R8KA 2JGAA 2ZIWA 5KAIU 2W11A 2W7PA 4NLZA 4RPZA 4DLEA 5J0RA 5ALYA 3HKZF 2KZZA 3V6HA 5CR0A 1N48A 1X6IA 3KBBA 2BPCA 1SV4A 3GFKB 1K1QA 4KLEA 2KVCA 3C2KA 2JH1A 2QKQA 1KL9A 3UMCA 4ELVA 4B9NA 5K4LA 4QZAA 5ALVA 2C28A 2Q0ZX 4DF4A 3ONNA 5CP2A 1ZQHA 2AXTU 5ALOA 2IOHA 3M9MB 4C8OA 4BUGA 4TUPA 5ALHA
chains in the Genus database with same CATH topology
3KKAA 1SXDA 2DL0A 2KE7A 2F8KA 2QB1A 2QB0A 3BQ7A 1V38A 2KMDA 3H8MA 1X40A 2QB0B 4NJ8A 2EAOA 5JTIA 5J8YC 4NL9A 3TADA 1UQVA 1SV0A 1SV0C 2Y9TA 1V85A 4MHVA 2ES6A 5F3XB 1JI7A 1Z1VA 2YTUA 4PZNA 2K60A 3KKAC 2KSOB 3BS7A 2F44A 1F0MA 2E8OA 3BS5A 5JU5A 2EAMA 3TACB 2K4PA 1OXJA 1LKYB 3SENA 2EANA 2FE9A 2KIVA 3SEIA 2B6GA 1RG6A 1DXSA 2Y9UA 5JRTA 1UCVA 4RQMA 1PK3A 5L1MA 2QARA 2ESEA 2QARB 1X9XA 2E8NA 3TADC 4RQNA 2D3DA 2E8PA 1X66A 1B4FA 4PZOA 1LKYA 1WWVA 2D8CA 2E8MA 1PK1B 1WWUA 2JV3A 1PK1A 3BS5B 1SGGA 1SV4A 2DKXA 5J8YA 3HILA 1B0XA 1COKA 2QKQA 2KSOA 3K1RB 4IS7A 4NL9C 2LPEA 2F3NA 2EAPA 2LMRA 2DKZA 2KG5A 2L5YA 2GLEA 1SXEA 5KNIA 1KW4A 3IDWA 1OW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKA A;  1SXD A;  2DL0 A;  2KE7 A;  2F8K A;  2QB1 A;  2QB0 A;  3BQ7 A;  1V38 A;  2KMD A;  3H8M A;  1X40 A;  2QB0 B;  4NJ8 A;  2EAO A;  5JTI A;  5J8Y C;  4NL9 A;  3TAD A;  1UQV A;  1SV0 A;  1SV0 C;  2Y9T A;  1V85 A;  4MHV A;  2ES6 A;  5F3X B;  1JI7 A;  1Z1V A;  2YTU A;  4PZN A;  2K60 A;  3KKA C;  2KSO B;  3BS7 A;  2F44 A;  1F0M A;  2E8O A;  3BS5 A;  5JU5 A;  2EAM A;  3TAC B;  2K4P A;  1OXJ A;  1LKY B;  3SEN A;  2EAN A;  2FE9 A;  2KIV A;  3SEI A;  2B6G A;  1RG6 A;  1DXS A;  2Y9U A;  5JRT A;  1UCV A;  4RQM A;  1PK3 A;  5L1M A;  2QAR A;  2ESE A;  2QAR B;  1X9X A;  2E8N A;  3TAD C;  4RQN A;  2D3D A;  2E8P A;  1X66 A;  1B4F A;  4PZO A;  1LKY A;  1WWV A;  2D8C A;  2E8M A;  1PK1 B;  1WWU A;  2JV3 A;  1PK1 A;  3BS5 B;  1SGG A;  1SV4 A;  2DKX A;  5J8Y A;  3HIL A;  1B0X A;  1COK A;  2QKQ A;  2KSO A;  3K1R B;  4IS7 A;  4NL9 C;  2LPE A;  2F3N A;  2EAP A;  2LMR A;  2DKZ A;  2KG5 A;  2L5Y A;  2GLE A;  1SXE A;  5KNI A;  1KW4 A;  3IDW A;  1OW5 A; 
#chains in the Genus database with same CATH topology
 4C4R A;  1ZQR A;  5CWR A;  2RDI A;  2WF7 A;  3GQC A;  4XQ8 A;  1TV9 A;  4ED0 A;  4J9S A;  4QZB A;  4KLG A;  4C8K A;  5J2F A;  2E5S A;  3NS1 A;  8ICZ A;  2NV3 A;  2ZTE A;  1NZB A;  4DSK A;  2KD1 A;  3BJY A;  3TFS A;  5KT4 A;  3RBE A;  3QNM A;  2HVI A;  2JR5 A;  2EZZ A;  1JI7 A;  1ZJM A;  2ZTD A;  3NAS A;  3OJU A;  4ED3 A;  2C2R A;  4KLJ A;  1N5X A;  4OD0 A;  5AIB A;  1ZQU A;  3NRZ A;  3M1Y A;  2NO5 A;  1JUD A;  4FZN A;  5AKE A;  4DF8 A;  4ELT A;  2CN1 A;  4EBD A;  4DSI A;  1Z19 A;  2BQR A;  4DCC A;  4Y2S A;  3TQ1 A;  1SWV A;  2M0N A;  1Z4O A;  5KG7 A;  2RP5 A;  2PMZ F;  2W9M A;  2BQU A;  3MGI A;  2D3D A;  3Q8R B;  1B4F A;  1K1S A;  3H40 A;  1ZQG A;  2R18 A;  4IRK A;  3QZ8 A;  5DBA A;  2V4Q A;  5CHG A;  8ICP A;  1CRX A;  4KLQ A;  5HNK A;  1ZQE A;  2EZX A;  4UAV A;  4QIW F;  4UB8 U;  3D2Q A;  4I27 A;  3PX4 A;  4KTQ A;  4GC7 A;  3HRD D;  2H5X A;  2JRZ A;  1IM4 A;  2BHN A;  2LKY A;  2XC9 A;  5DGA A;  3C1Z A;  4M9L A;  8ICW A;  4I2H A;  4DQR A;  2PFP A;  7ICT A;  5KL8 B;  5B66 U;  2MU2 A;  4GC6 A;  4F2S A;  1S77 D;  1N61 A;  4DFJ A;  3F2D A;  2HW3 A;  2BZF A;  1FFV A;  3ICX A;  4K4G A;  2J6S A;  1O03 A;  3UXP A;  3TAQ A;  7ICM A;  5KG0 A;  4B9M A;  1IXR A;  1ZQW A;  4NJ8 A;  5D4B A;  4PL1 A;  3WKE A;  1ECW A;  9ICN A;  1UQV A;  5KFW A;  2DQN B;  3SYZ A;  3ISC A;  1U45 A;  4OO1 J;  2BDP A;  2EH9 A;  4F8R A;  1LVH A;  4YMO A;  3ZD9 A;  4PZN A;  4RUC A;  3OPX A;  3JPP A;  4RPY A;  2JEG A;  4M6W A;  4Q44 A;  4Q8F A;  1DK2 A;  3QUC A;  5J2E A;  4F5R A;  2KJ8 A;  4DS5 A;  4OJ6 A;  3PW7 A;  4ECW A;  1D9D A;  1TK0 A;  3TAC B;  4NLG A;  1S5L U;  1NK8 A;  5JRT A;  1SZP A;  3PR4 A;  3QEB Z;  2JEJ A;  4PJ0 U;  4FZM A;  4DLG A;  2WHE A;  1XNS A;  1NI3 A;  2BPG A;  2W9C A;  1S8O A;  3PNC A;  1T3N A;  2WTF A;  3SI8 A;  1PVP A;  2JV3 A;  4BDP A;  1JMS A;  2AGQ A;  4DWI A;  1S97 A;  1NZP A;  3KTQ A;  2ZJ8 A;  5J0Q A;  3BQ0 A;  3GV5 B;  1VDV A;  3MBY A;  2LPE A;  3SZ2 A;  4I2E A;  2PFN A;  1RQL A;  4Z6D A;  5IIL A;  4UW9 A;  2AGO A;  5KFA A;  5AKH A;  9ICV A;  3TAN A;  2PFO A;  1ZQQ A;  3S6J A;  2HOF A;  1MC8 A;  1L7O A;  2WF8 A;  2A1J B;  4CF3 A;  3C2L A;  1XWL A;  2MAX A;  5J8Y C;  1SKS A;  3RAQ A;  2WF5 A;  4F92 B;  3IN5 A;  3PW4 A;  1QLN A;  4YD1 A;  5KFH A;  3PZP A;  5IIM A;  7ICQ A;  1SKR A;  3GDX A;  1RYS A;  4I2A A;  4M9G A;  3RJH A;  4J03 A;  1KEJ A;  4Y2T A;  1PZN A;  2E3T A;  5JU5 A;  3KHL A;  3MR5 A;  9ICI A;  5B5E U;  5KFT A;  8ICH A;  2CPR A;  4RUA A;  3GV7 B;  4IQU A;  2W9B A;  3DV9 A;  4RQM A;  5DQI A;  2K89 A;  4DSL A;  4M6W B;  2DPJ A;  5KFE A;  3C28 A;  2N1R A;  2BCR A;  2W7O A;  5AK4 A;  4O0I A;  2Y1J A;  5J2B A;  2IHN A;  3WKA A;  3PX6 A;  5HR7 A;  1FFU A;  2XY5 A;  5KFO A;  3MAB A;  1WWU A;  3AU6 A;  5AI9 A;  2DPI A;  4TUR A;  1Z1B A;  4CDG A;  1NJX A;  3L5K A;  2PFQ A;  1ED1 A;  8ICX A;  4RNN A;  2IHM A;  3LDA A;  4YMN A;  4ECQ A;  4PL2 A;  3UQ0 A;  1J2N A;  4YN4 A;  3ETR A;  2HBM A;  3TAP A;  3WK5 A;  1VLB A;  2ISO A;  4FS2 A;  1COO A;  3J81 j;  2XGQ A;  1NOM A;  4J9N A;  5ALT A;  3RBD A;  2XGP A;  1RYU A;  2BCV A;  9ICP A;  4RQ6 A;  4FBU A;  3KZI U;  4M9H A;  4MFA A;  4RT3 A;  2HHW A;  4DQI A;  1FIQ A;  2XCP A;  5L1L A;  2RQ5 A;  2ES6 A;  1Z1V A;  1BGX T;  4RU9 A;  9ICM A;  4KIT B;  1MQ2 A;  4IR1 A;  2KSO B;  1L7P A;  3RH4 A;  4RPX A;  1S0V A;  2G0A A;  3EUB 2;  1Z3E B;  2KIC A;  3GV8 B;  4B9U A;  3PR5 B;  4R63 A;  4PHP A;  3CP8 A;  3D2N A;  4UAY A;  3LK9 A;  1A76 A;  2K4P A;  3IRU A;  4QJF B;  1KBU A;  3RRG A;  4QW9 A;  4Y2V A;  1RQN A;  4PHD A;  3DEE A;  3F5A A;  4KLO A;  4M04 A;  2ZIW B;  3GU3 A;  3T3F A;  1Y88 A;  5DLG A;  1HJP A;  4G3I A;  1IG6 A;  2R8G A;  2H3V A;  5ALE A;  2PKE A;  2XCA A;  4O9M A;  4UB1 A;  1U4B A;  4O3Q A;  2DKX A;  3JPQ A;  3NUQ A;  5AM4 A;  4UAZ A;  4RQ5 A;  3K1R B;  4M9J A;  2KOB A;  2MUT A;  1BVS A;  3EYZ A;  4DQP A;  2L5Y A;  3UPQ A;  3RJJ A;  7ICE A;  2ATL A;  3GIL A;  4ECU A;  1SXE A;  3K4G A;  2XIC A;  3M9O B;  5J2H A;  2KHQ A;  4JMU A;  3U26 A;  1OW5 A;  8ICI A;  2DL0 A;  1Q3V A;  5DG7 A;  2HDO A;  2W3R A;  1WG8 A;  3RJI A;  4NL9 A;  3B0X A;  3ZD8 A;  2ZG6 A;  3QU7 A;  2JZB B;  2FLP A;  2OWO A;  5AM1 A;  9ICU A;  5J0Y A;  4B6J A;  2OHF A;  5DQH A;  4P4O A;  9ICK A;  9ICS A;  2WAQ F;  5CJ7 A;  2DF4 B;  2HSZ A;  3T5K A;  2G06 A;  2NRZ A;  3PO4 A;  3PW5 A;  3PSP A;  2WFA A;  3JPT A;  9ICX A;  3RFA A;  2KKV A;  2HHU A;  4K4I A;  3ISB A;  1NKE A;  1KFS A;  2UVW A;  2RHF A;  2FE9 A;  3SEI A;  1RG6 A;  5E79 U;  2VIX A;  4RQ0 A;  3AM9 A;  2BCQ A;  1TVA A;  1NK7 A;  1NKC A;  1X2I A;  2PXI A;  1U49 A;  5KG2 A;  1D8Y A;  1L3T A;  1N2X A;  4F4K A;  1SGG A;  2H3F A;  2ASD A;  2DUY A;  1D9F A;  4CGZ A;  1DRG A;  4MFF A;  4OJ5 A;  1S76 D;  1TAQ A;  2G07 A;  1T8E A;  4DL7 A;  4LZG A;  1YZ6 A;  3ZDD A;  1ZQJ A;  3SAF A;  3PW2 A;  1X9M A;  3JPN A;  4NL9 C;  2ZUD A;  5EWG A;  3ETL A;  4GLX A;  2RRD A;  4EX6 A;  3OJS A;  1V97 A;  2GOL A;  3ZDB A;  4Z6F A;  5ALF A;  2YMM A;  3OTQ A;  8ICR A;  2P66 A;  1ZET A;  5AM5 A;  3KKA A;  3L3F X;  1SXD A;  4FZL A;  5EE3 A;  4XA5 A;  1ZQP A;  3C2M A;  4MF8 A;  4DFK A;  2MUT B;  5KFD A;  3FDS A;  8ICY A;  2HVH A;  1NJZ A;  5DB9 A;  8ICO A;  4MEX A;  5CRX A;  5KFC A;  1F44 A;  1D8L A;  5TZV A;  5ALM A;  5J0X A;  4QIW C;  3AMZ A;  4ED1 A;  4DS4 A;  1L3S A;  4CCH A;  1UHU A;  1JN3 A;  1SL2 A;  1CEZ A;  4XUS A;  4KLF A;  3OHA A;  1FO4 A;  4Y2J A;  3SV4 A;  3V7J A;  3NTU A;  3QUQ A;  5HHH A;  5AKZ A;  1B22 A;  5F9N A;  1N56 A;  3BS7 A;  3RTV A;  2F44 A;  8ICL A;  5DB7 A;  4RNO A;  4RQ7 A;  4Z6E A;  5ALX A;  1PVR A;  1TAM A;  3ISD A;  5A0L A;  4JV1 A;  5C5J A;  7ICU A;  2I6X A;  2E8N A;  4RQN A;  3CRX A;  1ZOL A;  8ICB A;  3MGV A;  3BZC A;  1BPX A;  4ELU A;  2LYH A;  2KTQ A;  3TAR A;  1DK3 A;  4YVZ A;  3BS5 B;  1NK0 A;  5HHI A;  8ICJ A;  4CRX A;  2DBY A;  4US9 A;  2LM1 A;  4ECX A;  2Y0S F;  5T14 A;  4UB6 U;  5AI5 A;  4HYK A;  2WF6 A;  5KFN A;  3B0Y A;  1ZQA A;  3AUO A;  9ICB A;  4P0Q B;  1O08 A;  4TQS A;  8ICG A;  4NV0 A;  4C4T A;  2OYY A;  4UAS A;  2OM6 A;  5AKI A;  5J0O A;  3KHR A;  3RH6 A;  4KLM A;  2FDR A;  4QWA A;  1TE2 A;  3M7D A;  5KT3 A;  3Q8K A;  3C5G A;  8ICC A;  3RJE A;  4O3S A;  1QQ5 A;  2H3Z A;  4P4P A;  3N28 A;  2KFZ A;  2UVU A;  2PI4 A;  5GTH U;  5KFQ A;  9ICF A;  2GO7 A;  5G5G A;  4PHE A;  1BNO A;  1V85 A;  2DGZ A;  2F1H A;  2AH5 A;  4MHV A;  2DFL A;  8ICM A;  3QYP A;  1ZQZ A;  1ZXI A;  3VCB A;  4DO9 A;  2K4H A;  5J2C A;  4UB5 A;  5AKX A;  3N7P D;  1SL0 A;  3WK9 A;  4KLD A;  1DOQ A;  5KFF A;  3G6Y A;  3V6J A;  4QZ8 A;  4UAW A;  1F0M A;  2Y0S C;  7ICK A;  1QH9 A;  3ZDC A;  1ZQV A;  4IQV A;  3Q8Q B;  2LI6 A;  1XS9 D;  5F9L A;  1S0M A;  4QNL A;  5D49 A;  5DGB A;  5EOZ A;  2E1E A;  9ICE A;  1KFT A;  4UB3 A;  1PK3 A;  3UM9 A;  2BCU A;  2KP7 A;  4F91 B;  2OEH A;  4M2Y A;  2QAR B;  4I2G A;  5KFU A;  3T79 A;  4BXO A;  3CW2 C;  3NGD A;  1WWV A;  5H2F U;  1HEK A;  4GIB A;  4UBB A;  1YZ7 A;  2JZB A;  2W04 A;  1DGJ A;  2VA8 A;  5ALR A;  4F50 A;  4EZ9 A;  1HUZ A;  4Y2X A;  4FO6 A;  4EYI B;  4DFM A;  1ZQO A;  4IL6 U;  4QWD A;  4NXZ A;  4R64 A;  2EAP A;  2XVT A;  3HX0 A;  1ZQK A;  4ICA A;  4QWE A;  3ALR A;  2KIW A;  5KNI A;  1KW4 A;  2KN7 A;  4OJL A;  4YFK A;  3GIJ A;  5J2A A;  2XI9 A;  4J9R A;  5IIO A;  3HP6 A;  4ED2 A;  2HHS A;  2QB0 A;  5ALQ A;  3AN1 A;  3GZF A;  3QEA Z;  4I29 A;  2OXO A;  9ICH A;  1X40 A;  4J9K A;  4ACO A;  2I5H A;  3TKA A;  2RDJ A;  2FLN A;  4F71 A;  2W8L A;  2HCF A;  2FMS A;  5DB6 A;  1Q3U A;  3KOO A;  4P0Q A;  3HPO A;  1T3Q A;  2Y9T A;  4Y2Y A;  2PI5 A;  2WB1 F;  4O5E A;  1ZQS A;  4NWI A;  3PY8 A;  2ALZ A;  3C23 A;  3KKA C;  5KT2 A;  7ICN A;  1S10 A;  4QZI A;  2ZIX A;  2BGW A;  3HWT A;  2F2A B;  4P2H A;  1UT8 A;  5CA7 A;  1K5O A;  5DKW A;  2LYB A;  4JUZ A;  3RJF A;  3M6K A;  5HR6 A;  4YCX A;  2MRL A;  2XID A;  3M9N B;  2B6G A;  4O3R A;  1QCK A;  5AM0 A;  2AQ0 A;  3MGH A;  4RT2 A;  4C0Z A;  5D46 A;  4UB2 A;  4JWN A;  2AU0 A;  2A1A A;  2QAR A;  5L1M A;  3IV6 A;  3A0B U;  1MSW D;  1AQ6 A;  3ZDE A;  5J2I A;  5DLF A;  1T4G A;  4PZO A;  1A6S A;  1N60 A;  2LHT A;  2IMW P;  2K4I A;  2XY7 A;  2BDU A;  4YG2 A;  4QZF A;  1X9W A;  3H0L B;  2HOQ A;  4DQS A;  3D2S A;  4TUQ A;  2W9A A;  4DFP A;  3HKZ C;  1WUD A;  2HOI A;  2KJ9 A;  2YQE A;  5HML A;  5ALD A;  1ZQ1 C;  4O5K A;  1ZQC A;  4IC9 A;  1TAU A;  2DKZ A;  2JMG A;  5DDM A;  5AI4 A;  3NVV A;  5BOL A;  4Y2P A;  4KX3 A;  1JIH A;  2KE7 A;  1NKB A;  4C8L A;  1Z4N A;  2ASL A;  1TK8 A;  3H8M A;  1ZD4 A;  2Q4T A;  1RXW A;  5J0P A;  4IQW A;  3FYH A;  4QZC A;  3OSN A;  4CE6 A;  5KT6 A;  4P4M A;  1XO1 A;  1IV8 A;  3NVW A;  2FMP A;  1L6N A;  3NRW A;  3UXO A;  4UQG A;  1C7Y A;  5J0S A;  1ZQY A;  5III A;  5ALI A;  1L3V A;  3RR7 A;  4ECS A;  5BOM A;  4JWM A;  5HMM A;  1ZYQ A;  2W9B B;  1L5U A;  2A19 A;  3MR2 A;  3HW8 A;  5IIJ A;  3RB4 A;  4OJO A;  5KFJ A;  4NLK A;  2NRW A;  1XC9 A;  2K8B B;  3WK8 A;  4ED7 A;  1ZQX A;  8ICK A;  4R8U A;  2B0C A;  5AKJ A;  1X6J A;  1BPB A;  5KFM A;  5G5H A;  1TK5 A;  4EX7 A;  1X66 A;  4QZE A;  1JAL A;  1D8B A;  1U47 A;  7ICH A;  2VA3 A;  2E8M A;  8ICA A;  4F3O A;  4G9B A;  3PX0 A;  2R8H A;  4MFC A;  1SZH A;  4JB3 A;  4ECT A;  1A0P A;  5FP0 A;  5AI8 A;  4B9T A;  1YT3 A;  7ICO A;  4PH5 A;  3EPG A;  2IA6 A;  4PGY A;  2F3N A;  1L8O A;  4Y2U A;  1T94 A;  4DOA A;  3ED5 A;  4MEY A;  2JH7 A;  2NYV A;  1XSN A;  7ICI A;  4BGD A;  1BNP A;  5AK5 A;  2M9N A;  1ZRM A;  4Y2R A;  3FAH A;  3MFI A;  5DQG A;  2FLL A;  3N7S C;  2JHD A;  4NLB A;  3RB3 A;  3H4D A;  4AP9 A;  5EWF A;  3PW0 A;  4UAT A;  2HHV A;  4Q43 A;  5J0W A;  2YMP A;  5KFI A;  4M0A A;  4KN7 A;  2ISP A;  3BDP A;  3VC8 A;  4J9M A;  2KFN A;  4F4X A;  2WAQ C;  1X9S A;  1UT5 A;  3WK4 A;  5KFZ A;  4QWC A;  2RLT A;  5J2J A;  3M6Z A;  2GWS A;  2NRV A;  3B9J A;  5DG8 A;  4YR3 A;  2ODG A;  4Q45 A;  4YR0 A;  4KLT A;  3BS5 A;  3MR3 A;  1NJY A;  3PMN A;  4NM2 A;  4B9V A;  1WCN A;  2G5I B;  1NNL A;  5BPC A;  4IR9 A;  2MSN A;  2WB1 C;  1TKD A;  1ZQI A;  3AL0 B;  4KN4 A;  3H0M B;  3OHB A;  5ALZ A;  1ZQF A;  2DWQ A;  4U7C A;  4F5P A;  5ALK A;  5KG3 A;  1EXN A;  4O3N A;  3EW9 A;  5KAF U;  1S0N A;  3H8W A;  8ICU A;  2ZIX B;  2YML A;  3AU2 A;  8ICF A;  1COK A;  2W3S A;  1JXL A;  3OSP A;  1Q8K A;  2C2E A;  3LWL A;  2YY6 A;  3WKC A;  2W8K A;  2AHO B;  3O0F A;  2O6K A;  1QSY A;  3UMB A;  1JX4 A;  1LV5 A;  2A3V A;  2QB1 A;  3G6V A;  4NLC A;  2KJ5 A;  3FC4 A;  2OH2 A;  1KN5 A;  3QU5 A;  5L1J A;  2ZUC A;  1JXE A;  2EAO A;  4RQ3 A;  4EYH B;  3KZX A;  4Q8E A;  1MA7 A;  1SV0 A;  3UQ2 A;  4JK1 A;  8ICV A;  4C7Z A;  3PVX A;  3N97 B;  4GXJ A;  1Q46 A;  2YTU A;  4MF2 A;  2H3I A;  2C2D A;  4F5N A;  5KT7 A;  3LVW A;  3QU4 A;  4FBT A;  1KLN A;  4DSF A;  3H0R B;  2XY6 A;  5AKY A;  4O3P A;  3JPR A;  2D6F C;  2K8A A;  7ICJ A;  5ALN A;  2E8O A;  3H7I A;  3E2E A;  2ZIV A;  1U9L A;  2J6U A;  3Q8P B;  1T7P A;  1OXJ A;  2EAN A;  3C21 A;  2GH1 A;  2W9C B;  2V9W A;  3OGU A;  1CUK A;  2G5H B;  1ZQL A;  4AYB F;  2HBJ A;  4AYB C;  2AJQ A;  3GII A;  1CI4 A;  1UA1 A;  3TAD C;  4DQQ A;  4I2I A;  5KFY A;  4EBC A;  2KHV A;  3N4M B;  2ZJ5 A;  5KG4 A;  3KHG A;  2D8C A;  4J9L A;  2FJ6 A;  1PK1 B;  4EEL A;  1PK1 A;  4C8M A;  4DSJ A;  2YB1 A;  3Q8L A;  7ICF A;  3T5H A;  4OJP A;  5J2K A;  3THV A;  3WKD A;  2HHX A;  2EQY A;  4IRC A;  3CYM A;  8ICQ A;  2YB4 A;  2LMR A;  1V9P A;  2KG5 A;  2XO7 A;  1ZD5 A;  2GLE A;  3EWA A;  4F4Y A;  4TQR A;  1J97 A;  5AM2 A;  2KEY A;  5DBC A;  4DFD A;  3QU2 A;  2FMQ A;  2ZJA A;  2W55 A;  2KMD A;  2ZIU B;  5IIN A;  3LVV A;  4IQT A;  4UB4 A;  2QB0 B;  3MDC A;  4FFD A;  2KKP A;  3MR6 A;  3H4B A;  5JTI A;  1ZQD A;  3AQF A;  4RQ4 A;  3V72 A;  1MN8 A;  5AHX A;  3SAH A;  5KFL A;  1SV0 C;  7ICP A;  2ZUB A;  2JEI A;  7ICS A;  4BWM A;  4EBE A;  2J6T A;  2KV2 A;  1ZQM A;  2BKE A;  2R8I A;  4I2C A;  4O3M A;  4J9O A;  2K60 A;  5KFR A;  4QWB A;  1XU4 A;  4EEY A;  2IOF A;  1UA0 A;  1Z00 A;  1XSL A;  2NO4 A;  3KD3 A;  2FI1 A;  7ICV A;  2P35 A;  9ICL A;  3RH5 A;  5KFS A;  1BPY A;  3F2C A;  2KIV A;  5DG9 A;  5TIS U;  3V7L A;  2PMZ C;  2OCE A;  1ZD3 A;  5KG5 A;  9ICQ A;  3RJG A;  2C22 A;  1X9X A;  4DOB A;  3H8J A;  9ICJ A;  4YP3 A;  1ZQT A;  3MDA A;  1C20 A;  1A77 A;  3KHH A;  5ALS A;  4HAI A;  4I2B A;  1NK4 A;  3GIK A;  1JRO A;  7ICR A;  4UBC A;  4ECY A;  1QTM A;  5DDY A;  8ICT A;  2K4E A;  9ICO A;  2Z7J A;  2MA1 A;  1QSS A;  2VA2 A;  5DB8 A;  4PPX A;  4RQ2 A;  5ALW A;  3MFH A;  4F4Z A;  4DL4 A;  1HUO A;  3IDW A;  2CXY A;  5AKK A;  4KLH A;  7ICG A;  5EE1 A;  3RAX A;  3RF9 A;  4TUS A;  4X5V A;  3RR8 A;  5IIK A;  3BQ7 A;  1LB2 B;  4M9N A;  1TFR A;  1ARO P;  3UXN A;  3WKB A;  5J2D A;  2KVS A;  5CB1 A;  3BQT A;  2KZ3 A;  4I2J A;  2F1J A;  9ICC A;  2YN4 A;  2JEF A;  4DL6 A;  2W43 A;  4P0P B;  2F1I A;  3M8R A;  1ZQB A;  3WK7 A;  3G6X A;  2AQ4 A;  1QQ7 A;  5KFG A;  1RYR A;  4KLS A;  4QZH A;  1SL1 A;  3PV8 A;  4I28 A;  9ICT A;  4QZ9 A;  2I9G A;  3LWM A;  1PVQ A;  1LKY B;  1S0O A;  3HT3 A;  3CNH A;  3QZ7 A;  1KQQ A;  9ICW A;  1NK6 A;  3F2B A;  2Y9U A;  3C1Y A;  1KTQ A;  1KKX A;  5L1I A;  1L7M A;  3BZK A;  4R8U B;  5ALP A;  4OCZ A;  2E8P A;  3K75 D;  3N7R C;  3I76 A;  3SQI A;  2AGP A;  4GXK A;  3RB6 A;  1N62 A;  4RQ1 A;  3IG5 A;  3SMV A;  1MQ3 A;  3E0F A;  3ORY A;  2FPL A;  4B9L A;  2G08 A;  2NRT A;  4YXM A;  5J0T A;  3TI0 A;  2YX8 A;  5GTI U;  4F72 A;  2QLT A;  3SV3 A;  1SWW A;  5JUM A;  5L9X A;  2VJ5 A;  1B0X A;  3PSI A;  1IIP A;  2KSO A;  1X42 A;  4IS7 A;  2V4R A;  5DBB A;  2KZM A;  2F8L A;  1BPE A;  4DL2 A;  4ED6 A;  1SIJ A;  1NK5 A;  3JPS A;  4BX9 C;  2ZIV B;  2I1Q A;  4BJQ A;  5KTQ A;  5AK3 A;  4PGQ A;  2F8K A;  4E0D A;  3EZ5 A;  1VJ5 A;  2A1J A;  3DDH A;  3FM9 A;  1L7N A;  4R66 A;  1QQ6 A;  4F4W A;  8ICS A;  2LBO A;  3T5L A;  3PO5 A;  4BWJ A;  4DSE A;  4FE3 A;  1U48 A;  5ALG A;  5ALJ A;  4P0P A;  2R8J A;  2VKQ A;  3I1Y A;  3K1Z A;  5KFB A;  3RRH A;  4KX5 A;  4I2F A;  2B21 A;  2HBL A;  1RM6 C;  5KFV A;  5L1K A;  5AIA A;  2BPF A;  4EEK A;  3QU9 A;  4PHA A;  2FPM A;  3ZI4 A;  3Q8M A;  2BCS A;  2JXJ A;  5EWE A;  2K8C B;  1DGS A;  4ED8 A;  4F5O A;  2EDU A;  3PSF A;  5KG1 A;  3QUB A;  4RQ8 A;  1XSP A;  1WYG A;  2EAM A;  2ASJ A;  1FEZ A;  4C80 A;  4ECV A;  1KSP A;  1RXV A;  2LM4 A;  1QSL A;  2ZXI A;  1KDH A;  1ZD2 P;  4QW8 A;  1DXS A;  2KK0 A;  3LYS A;  4CNQ A;  3SD7 A;  1BPD A;  2P6U A;  3SAG A;  4DOC A;  1XO0 A;  3C5F A;  4PGX A;  5KL1 B;  3PML A;  2P6R A;  1LKY A;  4ZH4 A;  5J0U A;  3IP4 B;  1KRP A;  4YR2 A;  5AKG A;  4F2R A;  3V6K A;  4WJ3 B;  3GIM A;  3BQ1 A;  3I28 A;  1RZT A;  4O5C A;  4ZOH C;  8ICN A;  3HJE A;  4XRH A;  1P7D A;  5J8Y A;  2NRX A;  4B9S A;  5J2G A;  2ZIU A;  3NVY A;  3AQE A;  1URJ A;  3MC1 A;  4KLL A;  2HHT A;  3PST A;  4NM1 A;  2CRX A;  4KMO B;  1HIW A;  2YMQ A;  2KNJ A;  3L4P A;  2IBK A;  2E1F A;  9ICR A;  3Q8S B;  1RPL A;  9ICA A;  1L3U A;  1V38 A;  3M8S A;  2LYA A;  5ALL A;  5KFX A;  4F93 B;  2BQ3 A;  1NJW A;  4JV0 A;  2F77 X;  4QZD A;  2Y1I A;  1ZQN A;  4I2D A;  1N63 A;  2UVV A;  5HP4 A;  1JRP A;  5EE0 A;  3A0H U;  1UPH A;  4J9Q A;  4A8E A;  5AIC A;  5F3X B;  1S9F A;  3SR6 A;  4YMM A;  4USA A;  4NY8 A;  3NVZ A;  4GXI A;  4YQW A;  3UMG A;  2BR0 A;  1OUQ A;  1SKW A;  4DEZ A;  3IM1 A;  3QUT A;  3TFR A;  1WCL A;  2F76 X;  3IHQ B;  3SEN A;  3EPI A;  5AI0 A;  4FS1 A;  4KLU A;  5ALU A;  3QXG A;  2VAN A;  4F5Q A;  1ZRN A;  2W54 A;  4NLN A;  1H38 A;  2ESE A;  4DL3 A;  2HI0 A;  3R9K A;  4KMU A;  2HHQ A;  5J29 A;  4K4H A;  4UAU A;  4IRD A;  5AM3 A;  2UVR A;  5EE9 A;  4M47 A;  3JPO A;  7ICL A;  5KFK A;  4RZR A;  4EZ6 A;  1PUZ A;  3ZDA A;  1B43 A;  2IOF K;  1Z00 B;  2VJ4 A;  4O3O A;  3HIL A;  4US8 A;  2W03 A;  2EZY A;  1ZJN A;  3IG8 A;  4RNM A;  4ECZ A;  3D6J A;  5CEH A;  3E58 A;  3BQ2 A;  3KFU F;  3F5E A;  4Z6C A;  2G09 A;  2H3Q A;  3WK6 A;  1NK9 A;  2WF9 A;  4CF4 A;  1GO3 F;  4Y2Q A;  1KFD A;  4KLI A;  2FPK A;  4JV2 A;  5AI6 A;  4LZD A;  3F53 A;  4ECR A;  4U6P A;  4R65 A;  1L8L A;  3TAD A;  4EEN A;  4J9P A;  1N5W A;  3QX7 A;  1RDF A;  1SB3 C;  4C7Y A;  4UAR A;  4CF5 A;  4YXJ A;  2HMX A;  3AEV A;  4GFJ A;  3H8S A;  4BXO B;  3RJK A;  5KFP A;  4YD2 A;  4LVS A;  9ICG A;  3V7K A;  4LJX A;  4QZG A;  1F5S A;  5C0Y A;  5KG6 A;  1BPZ A;  3WU2 U;  4DL5 A;  3C29 A;  2ZXH A;  2HBK A;  4C8N A;  5AKL A;  8ICE A;  2ZTC A;  5AK6 A;  3RB0 A;  3T5J A;  1M6Y A;  1J2M A;  5KT5 A;  3QE9 Y;  4C4S A;  1UCV A;  2R8K A;  2JGA A;  2ZIW A;  5KAI U;  2W11 A;  2W7P A;  4NLZ A;  4RPZ A;  4DLE A;  5J0R A;  5ALY A;  3HKZ F;  2KZZ A;  3V6H A;  5CR0 A;  1N48 A;  1X6I A;  3KBB A;  2BPC A;  1SV4 A;  3GFK B;  1K1Q A;  4KLE A;  2KVC A;  3C2K A;  2JH1 A;  2QKQ A;  1KL9 A;  3UMC A;  4ELV A;  4B9N A;  5K4L A;  4QZA A;  5ALV A;  2C28 A;  2Q0Z X;  4DF4 A;  3ONN A;  5CP2 A;  1ZQH A;  2AXT U;  5ALO A;  2IOH A;  3M9M B;  4C8O A;  4BUG A;  4TUP A;  5ALH A; 
#chains in the Genus database with same CATH homology
 3KKA A;  1SXD A;  2DL0 A;  2KE7 A;  2F8K A;  2QB1 A;  2QB0 A;  3BQ7 A;  1V38 A;  2KMD A;  3H8M A;  1X40 A;  2QB0 B;  4NJ8 A;  2EAO A;  5JTI A;  5J8Y C;  4NL9 A;  3TAD A;  1UQV A;  1SV0 A;  1SV0 C;  2Y9T A;  1V85 A;  4MHV A;  2ES6 A;  5F3X B;  1JI7 A;  1Z1V A;  2YTU A;  4PZN A;  2K60 A;  3KKA C;  2KSO B;  3BS7 A;  2F44 A;  1F0M A;  2E8O A;  3BS5 A;  5JU5 A;  2EAM A;  3TAC B;  2K4P A;  1OXJ A;  1LKY B;  3SEN A;  2EAN A;  2FE9 A;  2KIV A;  3SEI A;  2B6G A;  1RG6 A;  1DXS A;  2Y9U A;  5JRT A;  1UCV A;  4RQM A;  1PK3 A;  5L1M A;  2QAR A;  2ESE A;  2QAR B;  1X9X A;  2E8N A;  3TAD C;  4RQN A;  2D3D A;  2E8P A;  1X66 A;  1B4F A;  4PZO A;  1LKY A;  1WWV A;  2D8C A;  2E8M A;  1PK1 B;  1WWU A;  2JV3 A;  1PK1 A;  3BS5 B;  1SGG A;  1SV4 A;  2DKX A;  5J8Y A;  3HIL A;  1B0X A;  1COK A;  2QKQ A;  2KSO A;  3K1R B;  4IS7 A;  4NL9 C;  2LPE A;  2F3N A;  2EAP A;  2LMR A;  2DKZ A;  2KG5 A;  2L5Y A;  2GLE A;  1SXE A;  5KNI A;  1KW4 A;  3IDW A;  1OW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...