2KSOA

Epha2:ship2 sam:sam complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the EphA2:SHIP2 SAM domain heterodimer
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ephrin type-A receptor 2
total genus 20
structure length 65
sequence length 65
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ksoA00
1X9XA 4PZNA 2KIVA 4NL9C 1SV4A 2Y9TA 2EAMA 1KW4A 2L5YA 3BS5B 1B4FA 3KKAA 2QARA 1X40A 2ES6A 2EAOA 5KNIA 5F3XB 4NL9A 2K4PA 1SXDA 2E8NA 3TADC 1WWUA 2FE9A 3SENA 1X66A 1OXJA 2KSOA 4RQMA 1SGGA 3HILA 3SEIA 2DKZA 4PZOA 5JU5A 2KG5A 1F0MA 1SXEA 1LKYB 2F3NA 2B6GA 3KKAC 3BQ7A 2QB0B 3TADA 2LPEA 2K60A 2LMRA 1UQVA 5L1MA 1JI7A 2YTUA 2D3DA 1UCVA 1B0XA 1RG6A 1Z1VA 3BS7A 2E8OA 2KMDA 1OW5A 4IS7A 2DKXA 2Y9UA 1PK3A 2QB0A 1LKYA 1PK1B 5J8YC 2E8PA 1V85A 4RQNA 4NJ8A 2QKQA 2F8KA 3K1RB 2EANA 3TACB 2QARB 2JV3A 2GLEA 2KE7A 2QB1A 2D8CA 5J8YA 5JRTA 4MHVA 1PK1A 3BS5A 1DXSA 3H8MA 1COKA 2E8MA 1SV0A 3IDWA 2DL0A 2F44A 1V38A 5JTIA 2EAPA 1SV0C 2ESEA 1WWVA 2KSOB
chains in the Genus database with same CATH superfamily
5EE9A 1B4FA 5DQIA 8ICZA 3IM1A 2PMZC 5DBCA 1XO0A 2A1AA 5AKXA 4OO1J 1KKXA 4ZOHC 3OHAA 8ICLA 5ALOA 2WF7A 4DFKA 4JV2A 5L1KA 3OSNA 4J9PA 2AU0A 5KFMA 4M0AA 3OGUA 5JU5A 3T79A 1IXRA 3LVWA 2KG5A 7ICJA 2AHOB 3RR8A 4BUGA 4I2BA 9ICIA 2HVHA 1HUOA 1S76D 3QUQA 4YP3A 2XCAA 5L1MA 3ZDAA 4GFJA 2LBOA 2D3DA 1B0XA 3PSIA 3MFIA 2FPLA 2LKYA 1L3VA 1ZQRA 5KT3A 9ICSA 3WK7A 4F5NA 2W55A 1S77D 1L7MA 3NVYA 1A77A 1BPXA 4C8KA 1XSLA 5KFTA 1S9FA 2FJ6A 3U26A 4B9LA 2ZIXB 3EPGA 5KT5A 4Y2RA 3N7SC 2AH5A 2F8KA 2JEGA 4I27A 3T5LA 2HW3A 2OEHA 4RNMA 5ALFA 5ALUA 2K8CB 3M9NB 1QH9A 2OXOA 3BS5A 1NJXA 1OUQA 3G6XA 3H0RB 2ZIVB 1COKA 4F2RA 4J9SA 4YVZA 4M9HA 4CRXA 4DSLA 2R8KA 3PO4A 1ZQJA 3SYZA 5EE0A 2G5HB 4KLQA 3ZI4A 3G6YA 2W9BB 3MR2A 2NYVA 2A1JB 2WB1C 4CE6A 4UB1A 3QU4A 4USAA 2ZIUB 5F3XB 2KNJA 2C28A 2HMXA 1WYGA 1RDFA 4TQRA 5HHHA 4DQIA 2KJ9A 4Y2UA 4R8UA 5L1JA 4FBTA 3GDXA 4PH5A 2OHFA 1ZQYA 3Q8KA 1F5SA 2XGQA 3S6JA 9ICCA 1S97A 2MUTA 1SB3C 1ZQHA 4QZEA 4Y2VA 5AKJA 3GV5B 2K60A 2PI4A 3QU5A 9ICKA 1MN8A 3ZDEA 2XI9A 5HR7A 5KT2A 3AEVA 2Z7JA 4Y2TA 2FLLA 2PKEA 4UASA 4KLFA 1RYRA 2KEYA 4YR2A 4M6WB 4GXKA 4FS2A 2NO4A 4QIWC 2HBLA 1JIHA 3M1YA 2O6KA 2JRZA 4ELTA 3HT3A 1A76A 2G09A 2BPGA 4IQVA 2LYHA 5AK3A 1UPHA 1J2NA 3QXGA 4OCZA 4QNLA 2PFNA 4KLLA 2JV3A 5EE3A 1ZQNA 3H7IA 5G5HA 5KG1A 1PK1A 3KHLA 3QEAZ 4RQ0A 4NLCA 1BPDA 5DDMA 4R66A 1U45A 2NRXA 4B9MA 2BQ3A 1C7YA 2F76X 1TFRA 2EAPA 1XS9D 3B9JA 4B9VA 1X9WA 2J6UA 3ZD8A 4AYBC 2XO7A 3V6JA 4C80A 4F91B 4J9QA 1D8LA 1L8LA 4FZNA 2A3VA 3Q8MA 2HDOA 2BCQA 4NWIA 3I76A 3PSTA 4BXOB 4JK1A 3PV8A 2BR0A 4OD0A 4Q45A 1T3QA 2DQNB 2BPCA 2RQ5A 2KN7A 2XY7A 4M9NA 2HBJA 1SGGA 2KTQA 4F5RA 1NK5A 3SQIA 5ALPA 5AI6A 2KICA 4RNOA 2DGZA 1VDVA 2KHQA 4UAVA 2LMRA 1VLBA 2EZXA 3K4GA 3QUBA 5CR0A 3RH5A 5J0WA 2KOBA 9ICHA 2J6TA 2OM6A 4Z6EA 1ZQKA 4ZH4A 4C7ZA 5J29A 3K1ZA 4C4SA 1U47A 5KG7A 4GXIA 3IP4B 3IN5A 5KFEA 1HIWA 3EUB2 2QKQA 1U48A 5AI0A 5IIJA 3BJYA 5J2BA 3K1RB 7ICOA 1ZQTA 4B9TA 2KE7A 1SIJA 3AQEA 1BPBA 5KG5A 2DPJA 3H4DA 4RT3A 4EENA 1MQ2A 4YMMA 3I28A 4YMNA 4QZ9A 2A1JA 1HUZA 4DQPA 1V38A 4FZLA 1D8YA 4M2YA 4DL4A 5J2EA 2AQ4A 2R18A 4KLEA 4KLHA 2ZTEA 1EXNA 3RJJA 5ALEA 3T3FA 5AKYA 3WKDA 2MRLA 4U6PA 5AK4A 1ZQOA 1IV8A 3L4PA 1ZQUA 4RUCA 2K4PA 4G9BA 1ZRNA 3CRXA 3SD7A 1WWUA 2FPKA 4KMUA 3OHBA 3HILA 3M7DA 1SXEA 1ZQLA 2BCSA 4QZHA 5AI5A 3JPOA 4YMOA 4ECQA 2HHXA 1RZTA 1RXVA 3C23A 1K1SA 1X6IA 2JGAA 4J03A 3SAHA 2YMMA 3KFUF 3KZXA 2XIDA 2ISOA 5ALQA 4DF8A 1KDHA 5IIKA 1D9DA 2K4IA 3ISCA 2NRWA 1ZYQA 5KFYA 4DF4A 4Z6CA 1N48A 1SL2A 5ALWA 2MSNA 4PGXA 2B21A 1TKDA 5EWFA 4I2HA 2P66A 2BHNA 8ICSA 5CRXA 2ZTDA 5E79U 7ICGA 4TQSA 5AIBA 3T5KA 1IG6A 3SV3A 5ALZA 3N4MB 1NZBA 4NLZA 5T14A 1TAQA 4NLKA 4QWEA 4F4WA 4P0PA 1N56A 1NK8A 4LVSA 3UPQA 3KTQA 5KL8B 3SAGA 1SL1A 9ICEA 4RQ8A 4GLXA 1NKBA 9ICLA 4TUQA 1BNOA 7ICEA 2KZMA 2EAOA 3JPTA 1QQ7A 5EE1A 3KHHA 9ICFA 2CXYA 3D2SA 1NK9A 2BCVA 2ZIVA 3PZPA 2WF8A 4UW9A 2MU2A 3GIMA 4BWMA 4DL2A 1L7PA 2JEIA 5KFOA 2EZYA 3BQ0A 3GILA 2DBYA 5KFDA 3ICXA 5CHGA 4B9NA 2YY6A 1CI4A 2Q0ZX 5D46A 2QB0B 5J0RA 4OJPA 3LDAA 4RZRA 4QZBA 5J2DA 9ICMA 3C2KA 1XSPA 9ICRA 5DDYA 5AK5A 4U7CA 1D8BA 2UVWA 4I2EA 2WFAA 2WTFA 5AM5A 2E8OA 4DSKA 1ZQXA 4IS7A 4UARA 5IIOA 5DB9A 4M04A 3NVZA 4DQSA 2WF6A 1ZETA 7ICTA 2JMGA 5IIIA 2E1EA 5GTIU 3LVVA 3PMLA 4JMUA 1NNLA 2W43A 5C5JA 5AI8A 3C2LA 1XC9A 4J9OA 3AU6A 1NJWA 4PPXA 2HSZA 3AN1A 1NJYA 4RNNA 5AK6A 3OJSA 2E8MA 1YZ6A 2LM4A 2E5SA 4RT2A 3TARA 5DKWA 5AM1A 4F92B 1N60A 4AP9A 1IIPA 4RQ5A 3G6VA 5ALDA 7ICNA 3SI8A 5L1IA 2H3VA 5DG9A 3GV7B 5ALMA 5ALNA 3MGHA 3NTUA 2W7PA 3MDAA 2JZBB 1ZQAA 3HPOA 4MF8A 4C4RA 4KLSA 3C1ZA 3KOOA 4P4OA 2JHDA 2W9MA 2R8JA 5DB7A 4RQMA 4EX7A 2DKZA 2GOLA 1SZPA 3NS1A 4Y2PA 2W7OA 3ISBA 2VA8A 5KL1B 3BQ7A 2H3IA 4UB6U 1ZQ1C 4KX3A 1ZQVA 2IOFA 2MA1A 4YN4A 1RPLA 5DQGA 4R64A 4XUSA 3N28A 7ICRA 3K75D 1NK0A 4ED2A 2LYBA 2I9GA 4NM2A 5AI4A 3FYHA 2G5IB 3J81j 3PY8A 3E2EA 4PJ0U 4YXJA 2Y9UA 1ZD3A 5AKZA 3JPSA 3SV4A 4UAWA 5IIMA 1B43A 4ECWA 4YG2A 5J8YC 3PVXA 4F4YA 4KX5A 1GO3F 5KFWA 5B5EU 1WUDA 4QWAA 4O5EA 3MFHA 3E0FA 2QARB 2W9CB 5J8YA 4EBEA 4KLIA 1K5OA 1UHUA 8ICKA 5CJ7A 4BJQA 1K1QA 4UB4A 4J9MA 1TAUA 4ED0A 4IRCA 5TISU 7ICFA 9ICXA 2P6UA 2YX8A 4RQ7A 4IR1A 2HOFA 2ESEA 3C29A 5ALHA 2EAMA 1KW4A 2G07A 2IBKA 3RR7A 1YT3A 4IR9A 4M9GA 2W54A 5J2FA 4KTQA 2BDUA 3HJEA 5HMMA 4I2JA 4ED1A 9ICAA 4O5CA 3BZCA 8ICPA 2YN4A 3LWLA 2EQYA 3F2CA 3QU2A 1QTMA 2F1IA 3TFSA 2K4EA 1X66A 5J2GA 3OJUA 8ICQA 5AKEA 5KFPA 1ZOLA 2XVTA 3V6HA 2VJ4A 5J0UA 2H3QA 3LK9A 3OSPA 4DSIA 2ZIUA 2HHVA 2V9WA 2NO5A 3T5JA 4M6WA 1LV5A 1Z19A 2LPEA 3V7KA 2AXTU 4DLGA 5J0QA 1ZQEA 1S0NA 5J0YA 3QE9Y 1Z1VA 2HI0A 5FP0A 2KV2A 1L3SA 7ICUA 1TK0A 4I2CA 2LM1A 5EWEA 4A8EA 1NKEA 1LKYA 1PK1B 1JRPA 5KT4A 3Q8LA 3RB3A 3HX0A 4MFCA 4DL5A 4EZ6A 2ZJ5A 4Z6FA 1LVHA 4Y2JA 4DFDA 1V85A 4DLEA 1RYUA 1KRPA 5A0LA 4BDPA 4KLGA 2FI1A 1ZD5A 4JWNA 3PW2A 4QZIA 7ICVA 4EBCA 2QB1A 3O0FA 4GXJA 5JRTA 3SMVA 1FO4A 5KFLA 1KLNA 5CB1A 1NK6A 1PVRA 1KSPA 2R8GA 1C20A 5L9XA 1FFVA 2BKEA 2C2RA 4NLGA 8ICNA 2B0CA 4Q8EA 3JPNA 3BQ1A 1FEZA 2BGWA 1JX4A 4F93B 1X40A 7ICKA 2KVCA 2ATLA 4WJ3B 5CEHA 5J0XA 4DS5A 4DO9A 5ALJA 3A0HU 2W3SA 1KFTA 1SXDA 5ALIA 4O3MA 3UMCA 5KFBA 4PL2A 1RYSA 2ZIWB 2C2DA 5TZVA 5J2CA 4IRDA 2F3NA 2DPIA 7ICQA 3KHGA 4O3RA 3KKAC 3RJEA 2H3ZA 2ZUBA 2KZ3A 5J0SA 2W04A 4QZFA 3UXPA 1QSSA 1PVQA 3UMGA 1ZQFA 2R8IA 3ED5A 3IRUA 4O3SA 3H0LB 2W8KA 1OW5A 2WAQF 3JPQA 5KFIA 5IINA 3TFRA 5KT7A 3DEEA 1L6NA 3CP8A 4DWIA 2MAXA 3HRDD 2F1HA 2WAQC 5IILA 2NRZA 2DF4B 3GIIA 3HKZC 2D8CA 5C0YA 2GWSA 3Q8PB 2I6XA 2KVSA 5KFJA 1UA1A 4TUSA 2JEFA 4UAZA 1ZRMA 1AQ6A 1SL0A 2KIWA 3H8MA 2OCEA 5DG8A 3TQ1A 2E1FA 4XRHA 3C2MA 5ALVA 1ZJMA 4TURA 1CUKA 5D49A 4UB5A 4QIWF 1WWVA 2KSOB 1XNSA 1KTQA 3BDPA 2W8LA 2K4HA 3H40A 4DSEA 2DWQA 3KKAA 3KZIU 1Z00A 1QSLA 2F8LA 3AQFA 2KD1A 3RJKA 3ZDCA 8ICEA 4NM1A 1RQNA 5ALLA 3WKAA 1S5LU 3D2NA 5J2AA 2V4RA 1NI3A 3F2DA 5ALRA 4ELUA 3SENA 3RB0A 2FLNA 4Q44A 2JEJA 3RBDA 2I5HA 1A0PA 4GIBA 5KG0A 5KAFU 9ICTA 1TE2A 3D6JA 4AYBF 4LJXA 1J2MA 2HHTA 1Z00B 8ICXA 1M6YA 1NOMA 2WF9A 3LWMA 2K8AA 1L7OA 4QWBA 4DFPA 1ZXIA 7ICSA 3TADA 4NXZA 3RH4A 4I2IA 2YTUA 2ZIXA 3WK9A 2G06A 7ICLA 2XY5A 3LYSA 2KMDA 1T4GA 1QCKA 4PHPA 2DKXA 4F4KA 2YMQA 3PR4A 2HBKA 4I2FA 1X42A 5KFZA 1J97A 5KFKA 3Q8QB 2H3FA 1KL9A 1T94A 3RBEA 4KMOB 1X2IA 4ELVA 4I2DA 1WG8A 3OPXA 2XC9A 4M9LA 2W11A 1BPYA 4YCXA 5AKHA 4MHVA 3IV6A 2W9AA 5KG6A 4RQ2A 2IHNA 1Z4OA 2AGOA 1ZQWA 2VANA 2AQ0A 2ASJA 5KFSA 3RRHA 3KD3A 1S0MA 1ZQQA 7ICPA 3HP6A 3RTVA 5AI9A 4F8RA 4YQWA 2KKPA 3GQCA 4DFJA 5HR6A 3QZ7A 2VA3A 4DOCA 4JV0A 4QZGA 5GTHU 5AM3A 2F2AB 1NK4A 3RFAA 2ALZA 3AL0B 5KNIA 4O3QA 3TANA 1Z3EB 4IQTA 5ALXA 5ALSA 4BGDA 1L3TA 4MFAA 4OJLA 4EX6A 2IA6A 3VC8A 1KEJA 4RQ4A 4QZCA 4RQ3A 1WCLA 2WF5A 5AHXA 1XO1A 3QU9A 3PNCA 1DRGA 1T7PA 4IC9A 4MEXA 3ALRA 2FPMA 4YXMA 1ZQSA 2HHUA 2YMPA 5KFGA 3HW8A 4UB3A 4DOAA 4BX9C 5J2KA 3AUOA 2MUTB 4I2GA 2QB0A 4J9RA 3MABA 4UBCA 2KHVA 1PVPA 4DEZA 3GIJA 2ASDA 9ICGA 3EPIA 4PHAA 8ICMA 4ECVA 3M8RA 1PZNA 1BGXT 1ZQMA 4MFFA 4ECYA 5J0TA 2C22A 4QWCA 8ICVA 3RB4A 1KFDA 1NKCA 1QQ5A 2QLTA 9ICBA 3IDWA 4F5OA 3MR6A 4BXOA 5KFNA 2F44A 1BPZA 1O03A 1X9XA 5F9LA 3PW4A 1SV4A 3GU3A 2Y9TA 4KLJA 3V6KA 2KP7A 4CDGA 5AKKA 2E3TA 3HKZF 2BQUA 9ICQA 2HOQA 2HCFA 3GZFA 4O9MA 4NL9A 2E8NA 3ISDA 1ZQPA 2FMPA 4C8OA 3L5KA 1ZQCA 1S0VA 2VA2A 5KFQA 1TVAA 1RXWA 5KFAA 1N63A 4JUZA 4B9SA 1COOA 3UXNA 3TAPA 1RQLA 5KFXA 4DL6A 4PGQA 1NK7A 4F5QA 3A0BU 4MF2A 5CWRA 3QUCA 3PMNA 4K4HA 2RDJA 1BPEA 4O3PA 2YB4A 3NASA 1ZQIA 3MR3A 1HEKA 3H0MB 4C0ZA 2RHFA 1UQVA 8ICYA 1SKSA 3CYMA 4DSJA 3GV8B 1ZQDA 4M9JA 4US9A 1XU4A 3RAXA 4F3OA 3H4BA 2Y1JA 4ECZA 3V72A 4DL7A 2XY6A 1H38A 5BOMA 3C5FA 1CRXA 2UVVA 3DV9A 3FDSA 5B66U 2GLEA 3KBBA 3MR5A 2AJQA 2VIXA 5H2FU 4XA5A 3ZDDA 1D9FA 4ECTA 1TAMA 2ZUCA 2HBMA 1A6SA 1T3NA 1JN3A 4YR0A 2KKVA 1HJPA 2Y1IA 4PZNA 3QZ8A 2KIVA 4ECXA 1ZQGA 1SKRA 5KT6A 2ODGA 5K4LA 2EZZA 2GH1A 2ES6A 1ZD4A 1MQ3A 1ZQZA 9ICVA 4QZAA 1DK3A 4CNQA 2OWOA 4DL3A 4NV0A 2V4QA 1SKWA 2CN1A 3V7LA 1X9SA 4I29A 4P0QA 3EZ5A 2KZZA 8ICWA 4RPZA 3PX4A 4C8NA 2GO7A 3SEIA 2KFZA 3RH6A 5AKGA 3B0XA 1JALA 1N5WA 3F53A 3RAQA 4MEYA 2LYAA 4KLDA 1DOQA 9ICOA 3MC1A 1NZPA 1UCVA 5L1LA 1RG6A 4RUAA 4G3IA 3FAHA 3UXOA 4Q8FA 1L8OA 5BOLA 2PFOA 2PI5A 4CF3A 5KFCA 3N97B 4F2SA 2I1QA 5HMLA 2ZJ8A 4NJ8A 1B22A 1ZJNA 5BPCA 1Q3VA 2EANA 3TACB 3H8JA 5DQHA 2HHSA 4EEKA 4BWJA 3VCBA 4US8A 3AMZA 3KHRA 2OYYA 2PXIA 2ASLA 1X9MA 3D2QA 3PW5A 3BQTA 5J0PA 4ED3A 3IG8A 1ZD2P 2AGQA 3RJFA 3ONNA 3M9MB 4CGZA 4Y2QA 5AM0A 5JTIA 2HHQA 4O0IA 1QLNA 2N1RA 4E0DA 2ZJAA 3ZD9A 7ICHA 3PW7A 4LZGA 2QARA 1FIQA 3QX7A 4P2HA 2ZIWA 1U9LA 1CEZA 5AM2A 5DB6A 5ALKA 4QJFB 2W3RA 4F4ZA 5HHIA 3RJHA 2IOHA 2IMWP 4UATA 4ECRA 4R63A 3RJIA 1S10A 4KITB 1OXJA 1MSWD 4F5PA 3QYPA 5KAIU 3MDCA 2YMLA 2BZFA 4EYHB 3M8SA 4Z6DA 3M9OB 2B6GA 3WKBA 4OJ5A 4YR3A 1UA0A 1X6JA 2RRDA 3GFKB 2FMQA 2G08A 3ORYA 1JXLA 3AU2A 4F71A 3PO5A 4PL1A 3RJGA 4P4PA 3ETLA 2W9CA 1DK2A 3N7RC 2P35A 2FMSA 2KJ5A 3N7PD 1V97A 2G0AA 3ZDBA 2J6SA 3WK5A 2HOIA 4QZDA 4YFKA 2ZUDA 4PHEA 4QW9A 1Z1BA 2E8PA 2OH2A 4I28A 3PW0A 4JWMA 2R8HA 4RQ1A 2KFNA 1ECWA 3ETRA 3CW2C 4QW8A 8ICBA 3NRZA 3R9KA 1DXSA 2Y0SC 5ALGA 4B6JA 4YD2A 3L3FX 3RF9A 2M0NA 1SV0A 2BQRA 3SR6A 2EDUA 9ICUA 4OJOA 5AKIA 2FDRA 2F1JA 2VJ5A 2Y0SF 4O5KA 4EZ9A 1Q8KA 4UQGA 4P0QB 2KJ8A 2L5YA 4KLMA 2DFLA 9ICPA 3GIKA 1ED1A 1P7DA 4P4MA 1L5UA 4I2AA 4GC6A 1JMSA 5DGBA 1YZ7A 4IRKA 4ECSA 2H5XA 4M47A 4RU9A 1TV9A 4LZDA 4KLTA 3TADC 5CP2A 2FE9A 4O3NA 3TI0A 4ED8A 3C5GA 4QWDA 5DLGA 2WB1F 2LI6A 4IQUA 3JPRA 4R65A 4RPXA 4IL6U 3F2BA 2BPFA 1JROA 1F0MA 1LKYB 2NV3A 1UT5A 1L3UA 4NLBA 3NRWA 3JPPA 4EYIB 2C2EA 2PFQA 1UT8A 1MA7A 2JH7A 2D6FC 1TK5A 2CRXA 1U4BA 4F4XA 3MGVA 5DBAA 3WK6A 3EWAA 3OTQA 2BDPA 9ICJA 4EBDA 3HWTA 4EELA 2DUYA 4Y2XA 2K89A 2PFPA 4TUPA 3EW9A 1PK3A 4XQ8A 1U49A 4ED6A 1N2XA 1JXEA 5DG7A 5KFUA 5G5GA 5HNKA 4NY8A 1VJ5A 8ICIA 2PMZF 1IM4A 2W9BA 2ZG6A 4PGYA 4DSFA 4HAIA 2HVIA 2A19A 8ICCA 1Z4NA 4ACOA 3NVWA 2CPRA 4UAUA 1Y88A 3T5HA 1BNPA 1MC8A 1SWWA 3CNHA 4KN7A 4K4GA 4K4IA 3IHQB 3NVVA 3DDHA 4R8UB 5HP4A 4JV1A 4NL9C 2JXJA 3SAFA 4J9KA 1TK8A 4JB3A 5J2IA 4ED7A 2WHEA 2UVUA 4CF5A 4FO6A 4RQ6A 2RLTA 1F44A 4KLUA 9ICNA 1S8OA 4DS4A 4DQRA 3Q8RB 2JH1A 1RM6C 1S0OA 3M6KA 3V7JA 4CCHA 3MBYA 5J2HA 4CF4A 1N61A 5AKLA 2K8BB 8ICTA 2KSOA 4PZOA 3WKCA 4OJ6A 3PX0A 3QNMA 3WKEA 8ICAA 1V9PA 4UB2A 2XGPA 8ICHA 4DQQA 5KG2A 5KFFA 1Q3UA 1JI7A 1SZHA 4X5VA 3PX6A 3BS7A 1JUDA 7ICMA 5CA7A 3BQ2A 5KFHA 4FFDA 5JUMA 3EYZA 1KQQA 2BCRA 5ALYA 1DGSA 3RB6A 2JR5A 3NUQA 4P0PB 8ICOA 1KBUA 8ICJA 4RQNA 4Q43A 1T8EA 2HHWA 5DLFA 2EH9A 5KFRA 3F5EA 2RP5A 4DFMA 3E58A 5F9NA 5EOZA 1O08A 5J0OA 4C4TA 1WCNA 8ICFA 3NGDA 8ICRA 2F77X 3H8WA 3AM9A 2W03A 4IQWA 4B9UA 2ZTCA 2AGPA 2UVRA 3WK8A 2VKQA 2IOFK 1SV0C 1L7NA 2Q4TA 3PR5B 4Y2SA 2XICA 2RDIA 3QUTA 4RPYA 3BS5B 3QU7A 1DGJA 4GC7A 5J2JA 4FS1A 1XSNA 7ICIA 4DOBA 4FE3A 4NLNA 3UQ0A 2ZXHA 5AM4A 5ALTA 2KK0A 1KFSA 2BCUA 1BVSA 3MGIA 2XCPA 3QEBZ 3FM9A 4C7YA 4FBUA 1PUZA 3H8SA 3F5AA 2LHTA 3C1YA 5D4BA 1ZQBA 1QQ6A 5KFVA 1KN5A 3TKAA 4KN4A 3Q8SB 1NJZA 4UBBA 4QZ8A 2YQEA 5EWGA 4KLOA 8ICUA 5KG3A 3RRGA 3PSPA 1AROP 3UMBA 3M6ZA 4C8LA 4F50A 3PSFA 4DCCA 4HYKA 4ECUA 1LB2B 4EEYA 3TAQA 3IG5A 1SWVA 4O3OA 5KG4A 1URJA 4FZMA 5DB8A 2ZXIA 2FLPA 4ICAA 5DGAA 1Q46A 8ICGA 5AIAA 3FC4A 3WU2U 3THVA 3UM9A 2NRTA 3B0YA 3SZ2A 4UAYA 4Y2YA 5DBBA 1FFUA 1N5XA 9ICWA 3C21A 1QSYA 4YD1A 4C8MA 2NRVA 2ISPA 2M9NA 4PHDA 1XWLA 1N62A 4J9LA 2IHMA 4J9NA 5KTQA 2P6RA 5AICA 3I1YA 2DL0A 2JZBA 2YB1A 3C28A 4UB8U 4F72A 3BZKA 3WK4A 3UQ2A
chains in the Genus database with same CATH topology
1X9XA 4PZNA 2KIVA 4NL9C 1SV4A 2Y9TA 2EAMA 1KW4A 2L5YA 3BS5B 1B4FA 3KKAA 2QARA 1X40A 2ES6A 2EAOA 5KNIA 5F3XB 4NL9A 2K4PA 1SXDA 2E8NA 3TADC 1WWUA 2FE9A 3SENA 1X66A 1OXJA 2KSOA 4RQMA 1SGGA 3HILA 3SEIA 2DKZA 4PZOA 5JU5A 2KG5A 1F0MA 1SXEA 1LKYB 2F3NA 2B6GA 3KKAC 3BQ7A 2QB0B 3TADA 2LPEA 2K60A 2LMRA 1UQVA 5L1MA 1JI7A 2YTUA 2D3DA 1UCVA 1B0XA 1RG6A 1Z1VA 3BS7A 2E8OA 2KMDA 1OW5A 4IS7A 2DKXA 2Y9UA 1PK3A 2QB0A 1LKYA 1PK1B 5J8YC 2E8PA 1V85A 4RQNA 4NJ8A 2QKQA 2F8KA 3K1RB 2EANA 3TACB 2QARB 2JV3A 2GLEA 2KE7A 2QB1A 2D8CA 5J8YA 5JRTA 4MHVA 1PK1A 3BS5A 1DXSA 3H8MA 1COKA 2E8MA 1SV0A 3IDWA 2DL0A 2F44A 1V38A 5JTIA 2EAPA 1SV0C 2ESEA 1WWVA 2KSOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9X A;  4PZN A;  2KIV A;  4NL9 C;  1SV4 A;  2Y9T A;  2EAM A;  1KW4 A;  2L5Y A;  3BS5 B;  1B4F A;  3KKA A;  2QAR A;  1X40 A;  2ES6 A;  2EAO A;  5KNI A;  5F3X B;  4NL9 A;  2K4P A;  1SXD A;  2E8N A;  3TAD C;  1WWU A;  2FE9 A;  3SEN A;  1X66 A;  1OXJ A;  2KSO A;  4RQM A;  1SGG A;  3HIL A;  3SEI A;  2DKZ A;  4PZO A;  5JU5 A;  2KG5 A;  1F0M A;  1SXE A;  1LKY B;  2F3N A;  2B6G A;  3KKA C;  3BQ7 A;  2QB0 B;  3TAD A;  2LPE A;  2K60 A;  2LMR A;  1UQV A;  5L1M A;  1JI7 A;  2YTU A;  2D3D A;  1UCV A;  1B0X A;  1RG6 A;  1Z1V A;  3BS7 A;  2E8O A;  2KMD A;  1OW5 A;  4IS7 A;  2DKX A;  2Y9U A;  1PK3 A;  2QB0 A;  1LKY A;  1PK1 B;  5J8Y C;  2E8P A;  1V85 A;  4RQN A;  4NJ8 A;  2QKQ A;  2F8K A;  3K1R B;  2EAN A;  3TAC B;  2QAR B;  2JV3 A;  2GLE A;  2KE7 A;  2QB1 A;  2D8C A;  5J8Y A;  5JRT A;  4MHV A;  1PK1 A;  3BS5 A;  1DXS A;  3H8M A;  1COK A;  2E8M A;  1SV0 A;  3IDW A;  2DL0 A;  2F44 A;  1V38 A;  5JTI A;  2EAP A;  1SV0 C;  2ESE A;  1WWV A;  2KSO B; 
#chains in the Genus database with same CATH topology
 5EE9 A;  1B4F A;  5DQI A;  8ICZ A;  3IM1 A;  2PMZ C;  5DBC A;  1XO0 A;  2A1A A;  5AKX A;  4OO1 J;  1KKX A;  4ZOH C;  3OHA A;  8ICL A;  5ALO A;  2WF7 A;  4DFK A;  4JV2 A;  5L1K A;  3OSN A;  4J9P A;  2AU0 A;  5KFM A;  4M0A A;  3OGU A;  5JU5 A;  3T79 A;  1IXR A;  3LVW A;  2KG5 A;  7ICJ A;  2AHO B;  3RR8 A;  4BUG A;  4I2B A;  9ICI A;  2HVH A;  1HUO A;  1S76 D;  3QUQ A;  4YP3 A;  2XCA A;  5L1M A;  3ZDA A;  4GFJ A;  2LBO A;  2D3D A;  1B0X A;  3PSI A;  3MFI A;  2FPL A;  2LKY A;  1L3V A;  1ZQR A;  5KT3 A;  9ICS A;  3WK7 A;  4F5N A;  2W55 A;  1S77 D;  1L7M A;  3NVY A;  1A77 A;  1BPX A;  4C8K A;  1XSL A;  5KFT A;  1S9F A;  2FJ6 A;  3U26 A;  4B9L A;  2ZIX B;  3EPG A;  5KT5 A;  4Y2R A;  3N7S C;  2AH5 A;  2F8K A;  2JEG A;  4I27 A;  3T5L A;  2HW3 A;  2OEH A;  4RNM A;  5ALF A;  5ALU A;  2K8C B;  3M9N B;  1QH9 A;  2OXO A;  3BS5 A;  1NJX A;  1OUQ A;  3G6X A;  3H0R B;  2ZIV B;  1COK A;  4F2R A;  4J9S A;  4YVZ A;  4M9H A;  4CRX A;  4DSL A;  2R8K A;  3PO4 A;  1ZQJ A;  3SYZ A;  5EE0 A;  2G5H B;  4KLQ A;  3ZI4 A;  3G6Y A;  2W9B B;  3MR2 A;  2NYV A;  2A1J B;  2WB1 C;  4CE6 A;  4UB1 A;  3QU4 A;  4USA A;  2ZIU B;  5F3X B;  2KNJ A;  2C28 A;  2HMX A;  1WYG A;  1RDF A;  4TQR A;  5HHH A;  4DQI A;  2KJ9 A;  4Y2U A;  4R8U A;  5L1J A;  4FBT A;  3GDX A;  4PH5 A;  2OHF A;  1ZQY A;  3Q8K A;  1F5S A;  2XGQ A;  3S6J A;  9ICC A;  1S97 A;  2MUT A;  1SB3 C;  1ZQH A;  4QZE A;  4Y2V A;  5AKJ A;  3GV5 B;  2K60 A;  2PI4 A;  3QU5 A;  9ICK A;  1MN8 A;  3ZDE A;  2XI9 A;  5HR7 A;  5KT2 A;  3AEV A;  2Z7J A;  4Y2T A;  2FLL A;  2PKE A;  4UAS A;  4KLF A;  1RYR A;  2KEY A;  4YR2 A;  4M6W B;  4GXK A;  4FS2 A;  2NO4 A;  4QIW C;  2HBL A;  1JIH A;  3M1Y A;  2O6K A;  2JRZ A;  4ELT A;  3HT3 A;  1A76 A;  2G09 A;  2BPG A;  4IQV A;  2LYH A;  5AK3 A;  1UPH A;  1J2N A;  3QXG A;  4OCZ A;  4QNL A;  2PFN A;  4KLL A;  2JV3 A;  5EE3 A;  1ZQN A;  3H7I A;  5G5H A;  5KG1 A;  1PK1 A;  3KHL A;  3QEA Z;  4RQ0 A;  4NLC A;  1BPD A;  5DDM A;  4R66 A;  1U45 A;  2NRX A;  4B9M A;  2BQ3 A;  1C7Y A;  2F76 X;  1TFR A;  2EAP A;  1XS9 D;  3B9J A;  4B9V A;  1X9W A;  2J6U A;  3ZD8 A;  4AYB C;  2XO7 A;  3V6J A;  4C80 A;  4F91 B;  4J9Q A;  1D8L A;  1L8L A;  4FZN A;  2A3V A;  3Q8M A;  2HDO A;  2BCQ A;  4NWI A;  3I76 A;  3PST A;  4BXO B;  4JK1 A;  3PV8 A;  2BR0 A;  4OD0 A;  4Q45 A;  1T3Q A;  2DQN B;  2BPC A;  2RQ5 A;  2KN7 A;  2XY7 A;  4M9N A;  2HBJ A;  1SGG A;  2KTQ A;  4F5R A;  1NK5 A;  3SQI A;  5ALP A;  5AI6 A;  2KIC A;  4RNO A;  2DGZ A;  1VDV A;  2KHQ A;  4UAV A;  2LMR A;  1VLB A;  2EZX A;  3K4G A;  3QUB A;  5CR0 A;  3RH5 A;  5J0W A;  2KOB A;  9ICH A;  2J6T A;  2OM6 A;  4Z6E A;  1ZQK A;  4ZH4 A;  4C7Z A;  5J29 A;  3K1Z A;  4C4S A;  1U47 A;  5KG7 A;  4GXI A;  3IP4 B;  3IN5 A;  5KFE A;  1HIW A;  3EUB 2;  2QKQ A;  1U48 A;  5AI0 A;  5IIJ A;  3BJY A;  5J2B A;  3K1R B;  7ICO A;  1ZQT A;  4B9T A;  2KE7 A;  1SIJ A;  3AQE A;  1BPB A;  5KG5 A;  2DPJ A;  3H4D A;  4RT3 A;  4EEN A;  1MQ2 A;  4YMM A;  3I28 A;  4YMN A;  4QZ9 A;  2A1J A;  1HUZ A;  4DQP A;  1V38 A;  4FZL A;  1D8Y A;  4M2Y A;  4DL4 A;  5J2E A;  2AQ4 A;  2R18 A;  4KLE A;  4KLH A;  2ZTE A;  1EXN A;  3RJJ A;  5ALE A;  3T3F A;  5AKY A;  3WKD A;  2MRL A;  4U6P A;  5AK4 A;  1ZQO A;  1IV8 A;  3L4P A;  1ZQU A;  4RUC A;  2K4P A;  4G9B A;  1ZRN A;  3CRX A;  3SD7 A;  1WWU A;  2FPK A;  4KMU A;  3OHB A;  3HIL A;  3M7D A;  1SXE A;  1ZQL A;  2BCS A;  4QZH A;  5AI5 A;  3JPO A;  4YMO A;  4ECQ A;  2HHX A;  1RZT A;  1RXV A;  3C23 A;  1K1S A;  1X6I A;  2JGA A;  4J03 A;  3SAH A;  2YMM A;  3KFU F;  3KZX A;  2XID A;  2ISO A;  5ALQ A;  4DF8 A;  1KDH A;  5IIK A;  1D9D A;  2K4I A;  3ISC A;  2NRW A;  1ZYQ A;  5KFY A;  4DF4 A;  4Z6C A;  1N48 A;  1SL2 A;  5ALW A;  2MSN A;  4PGX A;  2B21 A;  1TKD A;  5EWF A;  4I2H A;  2P66 A;  2BHN A;  8ICS A;  5CRX A;  2ZTD A;  5E79 U;  7ICG A;  4TQS A;  5AIB A;  3T5K A;  1IG6 A;  3SV3 A;  5ALZ A;  3N4M B;  1NZB A;  4NLZ A;  5T14 A;  1TAQ A;  4NLK A;  4QWE A;  4F4W A;  4P0P A;  1N56 A;  1NK8 A;  4LVS A;  3UPQ A;  3KTQ A;  5KL8 B;  3SAG A;  1SL1 A;  9ICE A;  4RQ8 A;  4GLX A;  1NKB A;  9ICL A;  4TUQ A;  1BNO A;  7ICE A;  2KZM A;  2EAO A;  3JPT A;  1QQ7 A;  5EE1 A;  3KHH A;  9ICF A;  2CXY A;  3D2S A;  1NK9 A;  2BCV A;  2ZIV A;  3PZP A;  2WF8 A;  4UW9 A;  2MU2 A;  3GIM A;  4BWM A;  4DL2 A;  1L7P A;  2JEI A;  5KFO A;  2EZY A;  3BQ0 A;  3GIL A;  2DBY A;  5KFD A;  3ICX A;  5CHG A;  4B9N A;  2YY6 A;  1CI4 A;  2Q0Z X;  5D46 A;  2QB0 B;  5J0R A;  4OJP A;  3LDA A;  4RZR A;  4QZB A;  5J2D A;  9ICM A;  3C2K A;  1XSP A;  9ICR A;  5DDY A;  5AK5 A;  4U7C A;  1D8B A;  2UVW A;  4I2E A;  2WFA A;  2WTF A;  5AM5 A;  2E8O A;  4DSK A;  1ZQX A;  4IS7 A;  4UAR A;  5IIO A;  5DB9 A;  4M04 A;  3NVZ A;  4DQS A;  2WF6 A;  1ZET A;  7ICT A;  2JMG A;  5III A;  2E1E A;  5GTI U;  3LVV A;  3PML A;  4JMU A;  1NNL A;  2W43 A;  5C5J A;  5AI8 A;  3C2L A;  1XC9 A;  4J9O A;  3AU6 A;  1NJW A;  4PPX A;  2HSZ A;  3AN1 A;  1NJY A;  4RNN A;  5AK6 A;  3OJS A;  2E8M A;  1YZ6 A;  2LM4 A;  2E5S A;  4RT2 A;  3TAR A;  5DKW A;  5AM1 A;  4F92 B;  1N60 A;  4AP9 A;  1IIP A;  4RQ5 A;  3G6V A;  5ALD A;  7ICN A;  3SI8 A;  5L1I A;  2H3V A;  5DG9 A;  3GV7 B;  5ALM A;  5ALN A;  3MGH A;  3NTU A;  2W7P A;  3MDA A;  2JZB B;  1ZQA A;  3HPO A;  4MF8 A;  4C4R A;  4KLS A;  3C1Z A;  3KOO A;  4P4O A;  2JHD A;  2W9M A;  2R8J A;  5DB7 A;  4RQM A;  4EX7 A;  2DKZ A;  2GOL A;  1SZP A;  3NS1 A;  4Y2P A;  2W7O A;  3ISB A;  2VA8 A;  5KL1 B;  3BQ7 A;  2H3I A;  4UB6 U;  1ZQ1 C;  4KX3 A;  1ZQV A;  2IOF A;  2MA1 A;  4YN4 A;  1RPL A;  5DQG A;  4R64 A;  4XUS A;  3N28 A;  7ICR A;  3K75 D;  1NK0 A;  4ED2 A;  2LYB A;  2I9G A;  4NM2 A;  5AI4 A;  3FYH A;  2G5I B;  3J81 j;  3PY8 A;  3E2E A;  4PJ0 U;  4YXJ A;  2Y9U A;  1ZD3 A;  5AKZ A;  3JPS A;  3SV4 A;  4UAW A;  5IIM A;  1B43 A;  4ECW A;  4YG2 A;  5J8Y C;  3PVX A;  4F4Y A;  4KX5 A;  1GO3 F;  5KFW A;  5B5E U;  1WUD A;  4QWA A;  4O5E A;  3MFH A;  3E0F A;  2QAR B;  2W9C B;  5J8Y A;  4EBE A;  4KLI A;  1K5O A;  1UHU A;  8ICK A;  5CJ7 A;  4BJQ A;  1K1Q A;  4UB4 A;  4J9M A;  1TAU A;  4ED0 A;  4IRC A;  5TIS U;  7ICF A;  9ICX A;  2P6U A;  2YX8 A;  4RQ7 A;  4IR1 A;  2HOF A;  2ESE A;  3C29 A;  5ALH A;  2EAM A;  1KW4 A;  2G07 A;  2IBK A;  3RR7 A;  1YT3 A;  4IR9 A;  4M9G A;  2W54 A;  5J2F A;  4KTQ A;  2BDU A;  3HJE A;  5HMM A;  4I2J A;  4ED1 A;  9ICA A;  4O5C A;  3BZC A;  8ICP A;  2YN4 A;  3LWL A;  2EQY A;  3F2C A;  3QU2 A;  1QTM A;  2F1I A;  3TFS A;  2K4E A;  1X66 A;  5J2G A;  3OJU A;  8ICQ A;  5AKE A;  5KFP A;  1ZOL A;  2XVT A;  3V6H A;  2VJ4 A;  5J0U A;  2H3Q A;  3LK9 A;  3OSP A;  4DSI A;  2ZIU A;  2HHV A;  2V9W A;  2NO5 A;  3T5J A;  4M6W A;  1LV5 A;  1Z19 A;  2LPE A;  3V7K A;  2AXT U;  4DLG A;  5J0Q A;  1ZQE A;  1S0N A;  5J0Y A;  3QE9 Y;  1Z1V A;  2HI0 A;  5FP0 A;  2KV2 A;  1L3S A;  7ICU A;  1TK0 A;  4I2C A;  2LM1 A;  5EWE A;  4A8E A;  1NKE A;  1LKY A;  1PK1 B;  1JRP A;  5KT4 A;  3Q8L A;  3RB3 A;  3HX0 A;  4MFC A;  4DL5 A;  4EZ6 A;  2ZJ5 A;  4Z6F A;  1LVH A;  4Y2J A;  4DFD A;  1V85 A;  4DLE A;  1RYU A;  1KRP A;  5A0L A;  4BDP A;  4KLG A;  2FI1 A;  1ZD5 A;  4JWN A;  3PW2 A;  4QZI A;  7ICV A;  4EBC A;  2QB1 A;  3O0F A;  4GXJ A;  5JRT A;  3SMV A;  1FO4 A;  5KFL A;  1KLN A;  5CB1 A;  1NK6 A;  1PVR A;  1KSP A;  2R8G A;  1C20 A;  5L9X A;  1FFV A;  2BKE A;  2C2R A;  4NLG A;  8ICN A;  2B0C A;  4Q8E A;  3JPN A;  3BQ1 A;  1FEZ A;  2BGW A;  1JX4 A;  4F93 B;  1X40 A;  7ICK A;  2KVC A;  2ATL A;  4WJ3 B;  5CEH A;  5J0X A;  4DS5 A;  4DO9 A;  5ALJ A;  3A0H U;  2W3S A;  1KFT A;  1SXD A;  5ALI A;  4O3M A;  3UMC A;  5KFB A;  4PL2 A;  1RYS A;  2ZIW B;  2C2D A;  5TZV A;  5J2C A;  4IRD A;  2F3N A;  2DPI A;  7ICQ A;  3KHG A;  4O3R A;  3KKA C;  3RJE A;  2H3Z A;  2ZUB A;  2KZ3 A;  5J0S A;  2W04 A;  4QZF A;  3UXP A;  1QSS A;  1PVQ A;  3UMG A;  1ZQF A;  2R8I A;  3ED5 A;  3IRU A;  4O3S A;  3H0L B;  2W8K A;  1OW5 A;  2WAQ F;  3JPQ A;  5KFI A;  5IIN A;  3TFR A;  5KT7 A;  3DEE A;  1L6N A;  3CP8 A;  4DWI A;  2MAX A;  3HRD D;  2F1H A;  2WAQ C;  5IIL A;  2NRZ A;  2DF4 B;  3GII A;  3HKZ C;  2D8C A;  5C0Y A;  2GWS A;  3Q8P B;  2I6X A;  2KVS A;  5KFJ A;  1UA1 A;  4TUS A;  2JEF A;  4UAZ A;  1ZRM A;  1AQ6 A;  1SL0 A;  2KIW A;  3H8M A;  2OCE A;  5DG8 A;  3TQ1 A;  2E1F A;  4XRH A;  3C2M A;  5ALV A;  1ZJM A;  4TUR A;  1CUK A;  5D49 A;  4UB5 A;  4QIW F;  1WWV A;  2KSO B;  1XNS A;  1KTQ A;  3BDP A;  2W8L A;  2K4H A;  3H40 A;  4DSE A;  2DWQ A;  3KKA A;  3KZI U;  1Z00 A;  1QSL A;  2F8L A;  3AQF A;  2KD1 A;  3RJK A;  3ZDC A;  8ICE A;  4NM1 A;  1RQN A;  5ALL A;  3WKA A;  1S5L U;  3D2N A;  5J2A A;  2V4R A;  1NI3 A;  3F2D A;  5ALR A;  4ELU A;  3SEN A;  3RB0 A;  2FLN A;  4Q44 A;  2JEJ A;  3RBD A;  2I5H A;  1A0P A;  4GIB A;  5KG0 A;  5KAF U;  9ICT A;  1TE2 A;  3D6J A;  4AYB F;  4LJX A;  1J2M A;  2HHT A;  1Z00 B;  8ICX A;  1M6Y A;  1NOM A;  2WF9 A;  3LWM A;  2K8A A;  1L7O A;  4QWB A;  4DFP A;  1ZXI A;  7ICS A;  3TAD A;  4NXZ A;  3RH4 A;  4I2I A;  2YTU A;  2ZIX A;  3WK9 A;  2G06 A;  7ICL A;  2XY5 A;  3LYS A;  2KMD A;  1T4G A;  1QCK A;  4PHP A;  2DKX A;  4F4K A;  2YMQ A;  3PR4 A;  2HBK A;  4I2F A;  1X42 A;  5KFZ A;  1J97 A;  5KFK A;  3Q8Q B;  2H3F A;  1KL9 A;  1T94 A;  3RBE A;  4KMO B;  1X2I A;  4ELV A;  4I2D A;  1WG8 A;  3OPX A;  2XC9 A;  4M9L A;  2W11 A;  1BPY A;  4YCX A;  5AKH A;  4MHV A;  3IV6 A;  2W9A A;  5KG6 A;  4RQ2 A;  2IHN A;  1Z4O A;  2AGO A;  1ZQW A;  2VAN A;  2AQ0 A;  2ASJ A;  5KFS A;  3RRH A;  3KD3 A;  1S0M A;  1ZQQ A;  7ICP A;  3HP6 A;  3RTV A;  5AI9 A;  4F8R A;  4YQW A;  2KKP A;  3GQC A;  4DFJ A;  5HR6 A;  3QZ7 A;  2VA3 A;  4DOC A;  4JV0 A;  4QZG A;  5GTH U;  5AM3 A;  2F2A B;  1NK4 A;  3RFA A;  2ALZ A;  3AL0 B;  5KNI A;  4O3Q A;  3TAN A;  1Z3E B;  4IQT A;  5ALX A;  5ALS A;  4BGD A;  1L3T A;  4MFA A;  4OJL A;  4EX6 A;  2IA6 A;  3VC8 A;  1KEJ A;  4RQ4 A;  4QZC A;  4RQ3 A;  1WCL A;  2WF5 A;  5AHX A;  1XO1 A;  3QU9 A;  3PNC A;  1DRG A;  1T7P A;  4IC9 A;  4MEX A;  3ALR A;  2FPM A;  4YXM A;  1ZQS A;  2HHU A;  2YMP A;  5KFG A;  3HW8 A;  4UB3 A;  4DOA A;  4BX9 C;  5J2K A;  3AUO A;  2MUT B;  4I2G A;  2QB0 A;  4J9R A;  3MAB A;  4UBC A;  2KHV A;  1PVP A;  4DEZ A;  3GIJ A;  2ASD A;  9ICG A;  3EPI A;  4PHA A;  8ICM A;  4ECV A;  3M8R A;  1PZN A;  1BGX T;  1ZQM A;  4MFF A;  4ECY A;  5J0T A;  2C22 A;  4QWC A;  8ICV A;  3RB4 A;  1KFD A;  1NKC A;  1QQ5 A;  2QLT A;  9ICB A;  3IDW A;  4F5O A;  3MR6 A;  4BXO A;  5KFN A;  2F44 A;  1BPZ A;  1O03 A;  1X9X A;  5F9L A;  3PW4 A;  1SV4 A;  3GU3 A;  2Y9T A;  4KLJ A;  3V6K A;  2KP7 A;  4CDG A;  5AKK A;  2E3T A;  3HKZ F;  2BQU A;  9ICQ A;  2HOQ A;  2HCF A;  3GZF A;  4O9M A;  4NL9 A;  2E8N A;  3ISD A;  1ZQP A;  2FMP A;  4C8O A;  3L5K A;  1ZQC A;  1S0V A;  2VA2 A;  5KFQ A;  1TVA A;  1RXW A;  5KFA A;  1N63 A;  4JUZ A;  4B9S A;  1COO A;  3UXN A;  3TAP A;  1RQL A;  5KFX A;  4DL6 A;  4PGQ A;  1NK7 A;  4F5Q A;  3A0B U;  4MF2 A;  5CWR A;  3QUC A;  3PMN A;  4K4H A;  2RDJ A;  1BPE A;  4O3P A;  2YB4 A;  3NAS A;  1ZQI A;  3MR3 A;  1HEK A;  3H0M B;  4C0Z A;  2RHF A;  1UQV A;  8ICY A;  1SKS A;  3CYM A;  4DSJ A;  3GV8 B;  1ZQD A;  4M9J A;  4US9 A;  1XU4 A;  3RAX A;  4F3O A;  3H4B A;  2Y1J A;  4ECZ A;  3V72 A;  4DL7 A;  2XY6 A;  1H38 A;  5BOM A;  3C5F A;  1CRX A;  2UVV A;  3DV9 A;  3FDS A;  5B66 U;  2GLE A;  3KBB A;  3MR5 A;  2AJQ A;  2VIX A;  5H2F U;  4XA5 A;  3ZDD A;  1D9F A;  4ECT A;  1TAM A;  2ZUC A;  2HBM A;  1A6S A;  1T3N A;  1JN3 A;  4YR0 A;  2KKV A;  1HJP A;  2Y1I A;  4PZN A;  3QZ8 A;  2KIV A;  4ECX A;  1ZQG A;  1SKR A;  5KT6 A;  2ODG A;  5K4L A;  2EZZ A;  2GH1 A;  2ES6 A;  1ZD4 A;  1MQ3 A;  1ZQZ A;  9ICV A;  4QZA A;  1DK3 A;  4CNQ A;  2OWO A;  4DL3 A;  4NV0 A;  2V4Q A;  1SKW A;  2CN1 A;  3V7L A;  1X9S A;  4I29 A;  4P0Q A;  3EZ5 A;  2KZZ A;  8ICW A;  4RPZ A;  3PX4 A;  4C8N A;  2GO7 A;  3SEI A;  2KFZ A;  3RH6 A;  5AKG A;  3B0X A;  1JAL A;  1N5W A;  3F53 A;  3RAQ A;  4MEY A;  2LYA A;  4KLD A;  1DOQ A;  9ICO A;  3MC1 A;  1NZP A;  1UCV A;  5L1L A;  1RG6 A;  4RUA A;  4G3I A;  3FAH A;  3UXO A;  4Q8F A;  1L8O A;  5BOL A;  2PFO A;  2PI5 A;  4CF3 A;  5KFC A;  3N97 B;  4F2S A;  2I1Q A;  5HML A;  2ZJ8 A;  4NJ8 A;  1B22 A;  1ZJN A;  5BPC A;  1Q3V A;  2EAN A;  3TAC B;  3H8J A;  5DQH A;  2HHS A;  4EEK A;  4BWJ A;  3VCB A;  4US8 A;  3AMZ A;  3KHR A;  2OYY A;  2PXI A;  2ASL A;  1X9M A;  3D2Q A;  3PW5 A;  3BQT A;  5J0P A;  4ED3 A;  3IG8 A;  1ZD2 P;  2AGQ A;  3RJF A;  3ONN A;  3M9M B;  4CGZ A;  4Y2Q A;  5AM0 A;  5JTI A;  2HHQ A;  4O0I A;  1QLN A;  2N1R A;  4E0D A;  2ZJA A;  3ZD9 A;  7ICH A;  3PW7 A;  4LZG A;  2QAR A;  1FIQ A;  3QX7 A;  4P2H A;  2ZIW A;  1U9L A;  1CEZ A;  5AM2 A;  5DB6 A;  5ALK A;  4QJF B;  2W3R A;  4F4Z A;  5HHI A;  3RJH A;  2IOH A;  2IMW P;  4UAT A;  4ECR A;  4R63 A;  3RJI A;  1S10 A;  4KIT B;  1OXJ A;  1MSW D;  4F5P A;  3QYP A;  5KAI U;  3MDC A;  2YML A;  2BZF A;  4EYH B;  3M8S A;  4Z6D A;  3M9O B;  2B6G A;  3WKB A;  4OJ5 A;  4YR3 A;  1UA0 A;  1X6J A;  2RRD A;  3GFK B;  2FMQ A;  2G08 A;  3ORY A;  1JXL A;  3AU2 A;  4F71 A;  3PO5 A;  4PL1 A;  3RJG A;  4P4P A;  3ETL A;  2W9C A;  1DK2 A;  3N7R C;  2P35 A;  2FMS A;  2KJ5 A;  3N7P D;  1V97 A;  2G0A A;  3ZDB A;  2J6S A;  3WK5 A;  2HOI A;  4QZD A;  4YFK A;  2ZUD A;  4PHE A;  4QW9 A;  1Z1B A;  2E8P A;  2OH2 A;  4I28 A;  3PW0 A;  4JWM A;  2R8H A;  4RQ1 A;  2KFN A;  1ECW A;  3ETR A;  3CW2 C;  4QW8 A;  8ICB A;  3NRZ A;  3R9K A;  1DXS A;  2Y0S C;  5ALG A;  4B6J A;  4YD2 A;  3L3F X;  3RF9 A;  2M0N A;  1SV0 A;  2BQR A;  3SR6 A;  2EDU A;  9ICU A;  4OJO A;  5AKI A;  2FDR A;  2F1J A;  2VJ5 A;  2Y0S F;  4O5K A;  4EZ9 A;  1Q8K A;  4UQG A;  4P0Q B;  2KJ8 A;  2L5Y A;  4KLM A;  2DFL A;  9ICP A;  3GIK A;  1ED1 A;  1P7D A;  4P4M A;  1L5U A;  4I2A A;  4GC6 A;  1JMS A;  5DGB A;  1YZ7 A;  4IRK A;  4ECS A;  2H5X A;  4M47 A;  4RU9 A;  1TV9 A;  4LZD A;  4KLT A;  3TAD C;  5CP2 A;  2FE9 A;  4O3N A;  3TI0 A;  4ED8 A;  3C5G A;  4QWD A;  5DLG A;  2WB1 F;  2LI6 A;  4IQU A;  3JPR A;  4R65 A;  4RPX A;  4IL6 U;  3F2B A;  2BPF A;  1JRO A;  1F0M A;  1LKY B;  2NV3 A;  1UT5 A;  1L3U A;  4NLB A;  3NRW A;  3JPP A;  4EYI B;  2C2E A;  2PFQ A;  1UT8 A;  1MA7 A;  2JH7 A;  2D6F C;  1TK5 A;  2CRX A;  1U4B A;  4F4X A;  3MGV A;  5DBA A;  3WK6 A;  3EWA A;  3OTQ A;  2BDP A;  9ICJ A;  4EBD A;  3HWT A;  4EEL A;  2DUY A;  4Y2X A;  2K89 A;  2PFP A;  4TUP A;  3EW9 A;  1PK3 A;  4XQ8 A;  1U49 A;  4ED6 A;  1N2X A;  1JXE A;  5DG7 A;  5KFU A;  5G5G A;  5HNK A;  4NY8 A;  1VJ5 A;  8ICI A;  2PMZ F;  1IM4 A;  2W9B A;  2ZG6 A;  4PGY A;  4DSF A;  4HAI A;  2HVI A;  2A19 A;  8ICC A;  1Z4N A;  4ACO A;  3NVW A;  2CPR A;  4UAU A;  1Y88 A;  3T5H A;  1BNP A;  1MC8 A;  1SWW A;  3CNH A;  4KN7 A;  4K4G A;  4K4I A;  3IHQ B;  3NVV A;  3DDH A;  4R8U B;  5HP4 A;  4JV1 A;  4NL9 C;  2JXJ A;  3SAF A;  4J9K A;  1TK8 A;  4JB3 A;  5J2I A;  4ED7 A;  2WHE A;  2UVU A;  4CF5 A;  4FO6 A;  4RQ6 A;  2RLT A;  1F44 A;  4KLU A;  9ICN A;  1S8O A;  4DS4 A;  4DQR A;  3Q8R B;  2JH1 A;  1RM6 C;  1S0O A;  3M6K A;  3V7J A;  4CCH A;  3MBY A;  5J2H A;  4CF4 A;  1N61 A;  5AKL A;  2K8B B;  8ICT A;  2KSO A;  4PZO A;  3WKC A;  4OJ6 A;  3PX0 A;  3QNM A;  3WKE A;  8ICA A;  1V9P A;  4UB2 A;  2XGP A;  8ICH A;  4DQQ A;  5KG2 A;  5KFF A;  1Q3U A;  1JI7 A;  1SZH A;  4X5V A;  3PX6 A;  3BS7 A;  1JUD A;  7ICM A;  5CA7 A;  3BQ2 A;  5KFH A;  4FFD A;  5JUM A;  3EYZ A;  1KQQ A;  2BCR A;  5ALY A;  1DGS A;  3RB6 A;  2JR5 A;  3NUQ A;  4P0P B;  8ICO A;  1KBU A;  8ICJ A;  4RQN A;  4Q43 A;  1T8E A;  2HHW A;  5DLF A;  2EH9 A;  5KFR A;  3F5E A;  2RP5 A;  4DFM A;  3E58 A;  5F9N A;  5EOZ A;  1O08 A;  5J0O A;  4C4T A;  1WCN A;  8ICF A;  3NGD A;  8ICR A;  2F77 X;  3H8W A;  3AM9 A;  2W03 A;  4IQW A;  4B9U A;  2ZTC A;  2AGP A;  2UVR A;  3WK8 A;  2VKQ A;  2IOF K;  1SV0 C;  1L7N A;  2Q4T A;  3PR5 B;  4Y2S A;  2XIC A;  2RDI A;  3QUT A;  4RPY A;  3BS5 B;  3QU7 A;  1DGJ A;  4GC7 A;  5J2J A;  4FS1 A;  1XSN A;  7ICI A;  4DOB A;  4FE3 A;  4NLN A;  3UQ0 A;  2ZXH A;  5AM4 A;  5ALT A;  2KK0 A;  1KFS A;  2BCU A;  1BVS A;  3MGI A;  2XCP A;  3QEB Z;  3FM9 A;  4C7Y A;  4FBU A;  1PUZ A;  3H8S A;  3F5A A;  2LHT A;  3C1Y A;  5D4B A;  1ZQB A;  1QQ6 A;  5KFV A;  1KN5 A;  3TKA A;  4KN4 A;  3Q8S B;  1NJZ A;  4UBB A;  4QZ8 A;  2YQE A;  5EWG A;  4KLO A;  8ICU A;  5KG3 A;  3RRG A;  3PSP A;  1ARO P;  3UMB A;  3M6Z A;  4C8L A;  4F50 A;  3PSF A;  4DCC A;  4HYK A;  4ECU A;  1LB2 B;  4EEY A;  3TAQ A;  3IG5 A;  1SWV A;  4O3O A;  5KG4 A;  1URJ A;  4FZM A;  5DB8 A;  2ZXI A;  2FLP A;  4ICA A;  5DGA A;  1Q46 A;  8ICG A;  5AIA A;  3FC4 A;  3WU2 U;  3THV A;  3UM9 A;  2NRT A;  3B0Y A;  3SZ2 A;  4UAY A;  4Y2Y A;  5DBB A;  1FFU A;  1N5X A;  9ICW A;  3C21 A;  1QSY A;  4YD1 A;  4C8M A;  2NRV A;  2ISP A;  2M9N A;  4PHD A;  1XWL A;  1N62 A;  4J9L A;  2IHM A;  4J9N A;  5KTQ A;  2P6R A;  5AIC A;  3I1Y A;  2DL0 A;  2JZB A;  2YB1 A;  3C28 A;  4UB8 U;  4F72 A;  3BZK A;  3WK4 A;  3UQ2 A; 
#chains in the Genus database with same CATH homology
 1X9X A;  4PZN A;  2KIV A;  4NL9 C;  1SV4 A;  2Y9T A;  2EAM A;  1KW4 A;  2L5Y A;  3BS5 B;  1B4F A;  3KKA A;  2QAR A;  1X40 A;  2ES6 A;  2EAO A;  5KNI A;  5F3X B;  4NL9 A;  2K4P A;  1SXD A;  2E8N A;  3TAD C;  1WWU A;  2FE9 A;  3SEN A;  1X66 A;  1OXJ A;  2KSO A;  4RQM A;  1SGG A;  3HIL A;  3SEI A;  2DKZ A;  4PZO A;  5JU5 A;  2KG5 A;  1F0M A;  1SXE A;  1LKY B;  2F3N A;  2B6G A;  3KKA C;  3BQ7 A;  2QB0 B;  3TAD A;  2LPE A;  2K60 A;  2LMR A;  1UQV A;  5L1M A;  1JI7 A;  2YTU A;  2D3D A;  1UCV A;  1B0X A;  1RG6 A;  1Z1V A;  3BS7 A;  2E8O A;  2KMD A;  1OW5 A;  4IS7 A;  2DKX A;  2Y9U A;  1PK3 A;  2QB0 A;  1LKY A;  1PK1 B;  5J8Y C;  2E8P A;  1V85 A;  4RQN A;  4NJ8 A;  2QKQ A;  2F8K A;  3K1R B;  2EAN A;  3TAC B;  2QAR B;  2JV3 A;  2GLE A;  2KE7 A;  2QB1 A;  2D8C A;  5J8Y A;  5JRT A;  4MHV A;  1PK1 A;  3BS5 A;  1DXS A;  3H8M A;  1COK A;  2E8M A;  1SV0 A;  3IDW A;  2DL0 A;  2F44 A;  1V38 A;  5JTI A;  2EAP A;  1SV0 C;  2ESE A;  1WWV A;  2KSO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...