2KSOA

Epha2:ship2 sam:sam complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
publication title Structure and function of the EphA2:SHIP2 SAM domain heterodimer
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 65
sequence length 65
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ksoA00
3K1RB 5JRTA 2E8OA 2DL0A 1UQVA 1PK3A 2Y9UA 1SGGA 3SENA 4PZOA 4NL9C 1X9XA 5J8YC 2DKZA 3KKAC 1Z1VA 3HILA 1COKA 1KW4A 5L1MA 2E8PA 2DKXA 5JU5A 2EANA 4PZNA 2E8NA 1WWVA 3BS7A 4RQMA 2QARA 2D3DA 2QB0A 1JI7A 1SXDA 3H8MA 2EAMA 1RG6A 1F0MA 1V85A 1WWUA 2QARB 2QB0B 1DXSA 1B0XA 1PK1A 3TACB 2EAOA 2YTUA 2QB1A 1LKYA 2LMRA 4IS7A 3BS5A 1SV4A 1PK1B 2Y9TA 5JTIA 3IDWA 1OXJA 2L5YA 2F44A 2JV3A 2GLEA 2KIVA 1SXEA 1LKYB 2K4PA 3BS5B 2KE7A 2QKQA 2B6GA 2D8CA 2F3NA 4RQNA 1SV0A 5F3XB 3TADA 2EAPA 2KSOA 4NJ8A 2ES6A 4MHVA 2KG5A 1V38A 1OW5A 1UCVA 1B4FA 1X66A 3BQ7A 2E8MA 2F8KA 2KSOB 2LPEA 4NL9A 5KNIA 5J8YA 2ESEA 3KKAA 1X40A 2KMDA 2K60A 3SEIA 1SV0C 2FE9A 3TADC
chains in the Genus database with same CATH superfamily
3MFIA 4TUQA 3SAHA 2P66A 1TAMA 2V4RA 4CGZA 2FLNA 1D8LA 2FPMA 1X9MA 4B9VA 1UT8A 4DL2A 4O3QA 4R66A 5DG7A 3SI8A 4ED7A 1YZ6A 2EANA 1T7PA 1WWVA 3BS7A 1A0PA 1ZQXA 4QZDA 7ICUA 2F1JA 1Z3EB 2F2AB 2LYBA 1XS9D 5KTQA 4DOAA 1S76D 4WJ3B 1JXEA 3VC8A 2PFOA 7ICVA 1QSSA 8ICPA 7ICHA 2XGPA 3RJGA 5DDMA 4G9BA 3QZ7A 2JGAA 1JRPA 5H2FU 1JROA 4KITB 2RQ5A 3PMLA 4BUGA 5AKYA 2EAOA 5AM0A 1YT3A 1ZQQA 2JEGA 1ZETA 1F5SA 2XCAA 4IC9A 5IIIA 2JHDA 3PSPA 4PHAA 1XNSA 5J0XA 1Z00A 4F93B 3GQCA 2HBLA 4XA5A 3QU5A 4AP9A 2NV3A 1XU4A 2BDPA 5AKIA 4M04A 3N7PD 3QZ8A 4IL6U 4DSIA 3V6JA 3IRUA 2GWSA 5F9NA 4P0QB 3BDPA 8ICHA 4EELA 5ALUA 2KEYA 4GXIA 4B9UA 2KSOA 3NVVA 3AL0B 2W8LA 2EH9A 2VANA 3C29A 4UB6U 2FDRA 1ZQSA 2A1JB 1D8BA 1X42A 1ZD4A 4DF4A 1OW5A 1X66A 3TARA 2WB1C 2FLLA 5AI8A 2HHWA 4F4XA 4QZHA 2G5IB 1RYRA 4X5VA 4ACOA 1ZQZA 4RPXA 4Q8FA 5ALKA 2HCFA 2JEJA 3RJFA 1X6JA 3IG8A 4QWBA 1MA7A 4KN7A 3HILA 5J2BA 2KZ3A 8ICOA 2KP7A 2W43A 4HYKA 4IRCA 2E8NA 4KLOA 8ICAA 4R64A 1NZBA 1BPZA 1FEZA 5EWGA 3PVXA 1KEJA 1X2IA 4B9NA 1C7YA 4QIWF 4DS4A 2RDIA 8ICIA 1SXDA 7ICTA 3QEBZ 2HW3A 1V85A 3RH6A 5J2FA 2W9BA 2I9GA 2HVHA 4P0PA 1J97A 1N48A 9ICQA 4QZBA 5DBBA 4GFJA 1LVHA 4FS1A 3AU2A 2EZYA 5CA7A 4KN4A 1IM4A 5ALXA 5DB9A 3H4BA 2FPLA 3H0MB 3OTQA 3PSFA 2GLEA 4CDGA 3WK5A 4FO6A 1TKDA 8ICQA 4M2YA 3C28A 2YMLA 4KLTA 4UARA 5KT5A 4IQTA 2AH5A 4PGQA 2IA6A 2R8KA 4YR0A 2JXJA 2AQ4A 1NKBA 2ASDA 4Y2RA 2E5SA 3WKEA 4C8OA 4I2CA 3MGIA 1ZQVA 8ICCA 1ZQCA 3ETLA 4M9HA 3H0LB 9ICKA 1ZQYA 4UATA 1NJWA 2HHXA 5KNIA 1DGJA 1BPBA 4RQ4A 2Q0ZX 2V4QA 2M0NA 1ZQDA 2P35A 2H3FA 2IOFK 1KLNA 4M9JA 1UQVA 2ZXHA 4ED3A 2HVIA 1U45A 4C4SA 8ICSA 5KG3A 5ALQA 3GZFA 1ZQBA 5J0QA 3JPPA 3DDHA 1CI4A 1ZQMA 3HKZC 1M6YA 4Z6EA 2DKXA 4RQMA 1RQLA 1DK2A 2M9NA 2YB1A 4C8LA 5DB6A 5IILA 3F53A 4JV2A 5KFPA 2DBYA 4RQ2A 4Y2XA 5G5GA 3BQ1A 1N62A 5BOMA 3BZKA 2N1RA 9ICPA 5T14A 3M9OB 3V7KA 2WF9A 9ICJA 3C5GA 3GV7B 4UAYA 3QYPA 5AKGA 4F3OA 3BQTA 4QZEA 2Y9TA 1KL9A 2I5HA 3TFSA 2L5YA 4QNLA 1XO0A 3UMCA 4NM2A 5DBAA 3FAHA 2EDUA 8ICMA 3QUCA 3TADA 5KFGA 4RZRA 4ED6A 5AI4A 2HHUA 4O3RA 4R8UA 4F4YA 4MHVA 1RZTA 3NVWA 1UCVA 1ED1A 2AXTU 4QZIA 2YN4A 3Q8QB 2W11A 4Y2SA 1U4BA 5KG2A 3UPQA 2R8GA 1MSWD 3MABA 3MDAA 4ECZA 3RR8A 5KAIU 3TADC 2HOFA 2NRXA 5KG0A 3OGUA 5B66U 3RJJA 3NVYA 3N4MB 3ICXA 1NOMA 4I2HA 1X9SA 1ZD2P 2Y0SC 2BHNA 4NLZA 3SENA 3HWTA 4KLEA 3RAQA 2IMWP 5J0YA 4KLGA 4CF3A 3LWMA 2MSNA 3PR5B 2DPJA 4TQRA 1GO3F 1L3UA 3F5EA 2ZJ5A 1FO4A 5IINA 3JPQA 2PFPA 1ZD5A 3C2MA 3D2NA 4OJ6A 2MU2A 5AKHA 4PJ0U 1LV5A 4DL7A 1KSPA 4ECXA 1ZQRA 5J2HA 4PH5A 4ECRA 2HI0A 3PW0A 4ICAA 4KX5A 1TV9A 3L4PA 4MEXA 2HBKA 3RFAA 1ZQIA 4TUPA 2BCUA 4P2HA 5KFAA 1D9DA 7ICQA 2FMSA 4AYBF 1PZNA 3H7IA 2ES6A 5KFZA 2NO4A 5HP4A 3R9KA 1WG8A 3QU7A 1D8YA 5L1IA 1BNOA 3Q8MA 3HT3A 3UQ0A 3NRWA 1N61A 3SEIA 5KT7A 3ZDBA 1CRXA 7ICJA 2BDUA 4YN4A 4OO1J 2AGOA 2FPKA 4ED2A 3TKAA 4UB3A 4KLIA 2XCPA 1JN3A 5D4BA 4UAZA 2CN1A 1HUZA 4DQQA 4C80A 2MRLA 4ED0A 4PZOA 5BOLA 4NV0A 5AKZA 3UXOA 4YD2A 2DPIA 2EQYA 2UVWA 2CXYA 4KLSA 5DDYA 4I2FA 3QUBA 4RNMA 3QE9Y 4FBTA 1L8LA 3THVA 4BGDA 2HHSA 2BGWA 1BPDA 3M9MB 4Y2TA 3OPXA 5DG9A 1QLNA 5DG8A 3IM1A 3NRZA 4PHDA 3ORYA 5ALIA 2IOHA 9ICHA 1A77A 3B9JA 2OYYA 5AKXA 3ZDDA 1L7OA 5DLFA 4UW9A 3SD7A 3QUQA 5KFUA 2BQUA 3FC4A 3RTVA 4I28A 2VJ4A 2ZIXA 4JWNA 4C4TA 4JWMA 5K4LA 2LMRA 3PV8A 2C2EA 2D6FC 2G08A 4ECSA 4P4OA 5JTIA 4JK1A 1OXJA 1VJ5A 3KTQA 1S10A 5ALGA 4DSJA 2K4HA 4KLHA 1Z00B 2JZBA 1B22A 4J9OA 2XY5A 4O5EA 2F3NA 3SZ2A 2IBKA 2BZFA 3JPNA 2EZXA 4Z6DA 3MR6A 4NM1A 1Q3VA 1QTMA 1NZPA 2KSOB 2LPEA 1T3NA 2K89A 1DGSA 1UA1A 2KMDA 3Q8KA 4M47A 3E58A 2XO7A 1S0MA 4UB2A 1FFUA 4KMOB 3M6ZA 3CYMA 4DFPA 1SWWA 4QZAA 4Q8EA 1XO1A 5EOZA 5KFIA 4XUSA 3RAXA 4YG2A 2JEFA 3MC1A 2KFNA 9ICUA 2XY6A 5J2EA 1Q46A 3OHAA 5L1MA 3K4GA 4YFKA 1L3VA 5J0RA 1RYSA 4LZGA 1ZQ1C 3FM9A 4ECYA 1NI3A 1TFRA 2XIDA 2QARA 5AM4A 5KFFA 4KLJA 4UAVA 1H38A 1JI7A 4I2DA 3QNMA 3M8RA 3RJEA 4J9KA 1NJYA 4J9QA 2PMZF 4NY8A 4DOBA 4EZ9A 2GO7A 5KFQA 1PK1A 5HHIA 5ALTA 1ZQPA 2JMGA 4Z6CA 7ICEA 3RF9A 1LKYA 2ASLA 2W9BB 3OSPA 3NGDA 3PY8A 1FFVA 1SKWA 4YMOA 5EE9A 4K4GA 4P0PB 5EWEA 1KRPA 1O08A 4F8RA 5J0UA 1L7PA 4GC6A 1ZQAA 3M8SA 4O3NA 3KHLA 1SIJA 3IV6A 2EZZA 2KTQA 4EBDA 1Q8KA 2IHNA 3I76A 4DFMA 5KG1A 4PHEA 5EE1A 9ICCA 3CP8A 4NJ8A 4C0ZA 5L9XA 1ZJNA 4C8KA 5CP2A 1CUKA 4RNNA 4ECQA 1RXWA 2J6SA 1IXRA 2KKVA 4DL6A 8ICLA 2E8MA 3MDCA 4Y2VA 4I2BA 3WKDA 3QEAZ 1JALA 1HUOA 3PMNA 2KJ5A 1KFDA 2F77X 1QQ7A 4DFDA 2H3ZA 2WF7A 4YD1A 5JUMA 4NLKA 4GC7A 5AI9A 1MQ2A 3HW8A 1NK4A 2W3SA 3T5HA 2JH1A 2F8LA 4Q45A 2ASJA 2XY7A 2W54A 2AJQA 3KZXA 4Q43A 2J6UA 5DGBA 2UVVA 5KFHA 1Q3UA 2YMPA 5KL1B 4F5RA 2I1QA 4DL4A 1OUQA 7ICRA 4ECUA 1ZQKA 4J9NA 1X9WA 3ED5A 3CNHA 3V7LA 5KFBA 2RRDA 4RU9A 1JXLA 3GFKB 5KL8B 9ICSA 4BX9C 5AI5A 2GH1A 4M0AA 4IRDA 4QZCA 3ISBA 3GU3A 2YTUA 4F5NA 3BS5A 1L3TA 2KICA 2ZUCA 2KHVA 1MC8A 4E0DA 2KIVA 4RQ3A 4JV0A 4YMMA 4DCCA 5TZVA 1BVSA 4US9A 1JMSA 3G6VA 3F5AA 4G3IA 2H3VA 2FJ6A 2Z7JA 5J2KA 3RR7A 5ALWA 1KDHA 4NL9A 3RH4A 3TAPA 4F5QA 4R8UB 3PX0A 2C22A 3FYHA 4IQVA 2P6RA 4B6JA 2ATLA 3ZD8A 4GIBA 3C21A 3M7DA 2YY6A 2KJ9A 5IIKA 3V7JA 4I2AA 3LYSA 2WB1F 3O0FA 4YP3A 3RH5A 3L5KA 9ICTA 3I28A 1XSNA 1TK5A 5KAFU 3J81j 1QQ6A 4NL9C 2K8AA 1X9XA 1RDFA 5CRXA 4QZ9A 1QCKA 3NUQA 4M9GA 4IQWA 3WK6A 1NK5A 2KIWA 4DS5A 9ICWA 3EUB2 1HJPA 5E79U 1ZQOA 2D3DA 2KNJA 3WK8A 1V97A 2YMMA 2WAQC 4Y2PA 3MBYA 2DFLA 3PW7A 1S8OA 1SZPA 4KTQA 4GLXA 1K5OA 5AI6A 4EBCA 3RB0A 4F4KA 2XI9A 4F91B 5J0WA 1KN5A 3AUOA 5C0YA 5KT3A 3KD3A 3NASA 5ALMA 2G07A 1SV4A 1TVAA 2NO5A 3E2EA 2G09A 4QWCA 2VA3A 3RBEA 2C2RA 2F44A 4C8NA 8ICZA 1JUDA 3D2QA 5ALJA 3TAQA 9ICOA 2K4PA 1X6IA 4F4WA 4CF5A 3EWAA 2KFZA 4IRKA 4F72A 3PSIA 4F2RA 2FLPA 4C7ZA 2K4EA 3WKBA 1DRGA 3T5JA 5J8YA 2W9MA 1X40A 3ZD9A 1NK6A 4RPYA 5G5HA 1TE2A 9ICFA 4F4ZA 3SV4A 3OSNA 3RRGA 1FIQA 2BQRA 4QW9A 1ECWA 1PK3A 3UQ2A 8ICFA 4ZOHC 4JUZA 2HHVA 2R8IA 5ALRA 4IR9A 3I1YA 1K1QA 1PVRA 3V6KA 1JIHA 5J8YC 4PL1A 2HMXA 2BPCA 4YVZA 4UASA 4YQWA 5KFMA 4OJLA 1ZQEA 5AKLA 2H3QA 1B43A 8ICEA 2ZTEA 4AYBC 4B9TA 2ZUBA 3QUTA 4K4IA 4I27A 2LHTA 1F44A 4PGYA 3QU2A 4EZ6A 3UM9A 2K8BB 1TK8A 1ZQUA 9ICVA 3SAGA 3GIKA 5GTHU 1UT5A 4UB4A 4NLCA 3SMVA 4I2GA 2OEHA 4LJXA 5DQHA 4IQUA 3TI0A 4Y2JA 3C1YA 5J0TA 5CB1A 3JPTA 1T3QA 2W3RA 3HJEA 2OH2A 2LYAA 2OHFA 2ZUDA 2ZIXB 4DQIA 3LVWA 1SXEA 2DUYA 8ICNA 1N56A 7ICIA 3ZDCA 7ICKA 4ED8A 5DGAA 3E0FA 2QKQA 5IIJA 2W7PA 3PW2A 1SV0A 3ZDEA 2HHQA 1J2MA 4QZ8A 1VLBA 5J0PA 4MFAA 1Z4NA 4QZGA 1S0VA 2JZBB 2XC9A 2RDJA 5AM2A 4J9PA 4F5OA 3H8JA 5L1LA 5C5JA 1Y88A 1ZOLA 1SL2A 3KKAA 2WHEA 3D6JA 2NRWA 4ED1A 1SV0C 2KVSA 2MAXA 4OJPA 4DL5A 5HHHA 4OCZA 4CE6A 5JRTA 4Y2UA 4CF4A 2XGQA 2DF4B 2V9WA 1RQNA 1S97A 4US8A 3GIIA 2FI1A 3KKAC 3AQFA 2YB4A 4ELTA 1HEKA 1KW4A 4UBBA 2F76X 2ZIWA 2NRZA 4LZDA 3M6KA 2W9CA 2A1AA 4PZNA 5ALPA 5CHGA 1K1SA 1ZQTA 3K1ZA 2Y0SF 2QB0A 4IR1A 3H8MA 3A0BU 3KHHA 2R18A 4FE3A 4OD0A 2BCVA 5AI0A 2PI4A 2QARB 4EENA 7ICLA 3U26A 3ETRA 3JPRA 3H0RB 3KZIU 4DO9A 9ICIA 1A76A 1KFSA 1ZYQA 1PK1B 3MFHA 4EYIB 1KFTA 3WKAA 2ALZA 2HSZA 4QWAA 1A6SA 1LKYB 3EZ5A 1N2XA 4B9LA 1T8EA 5DB8A 2D8CA 2IHMA 3C23A 2KVCA 5AK3A 4M6WA 2AHOB 1EXNA 4I2IA 1QQ5A 1NK0A 2ZTCA 2ZJ8A 4HAIA 2F8KA 1S9FA 4F5PA 3G6XA 5KFCA 2Y1JA 2CRXA 5AK6A 3N7RC 4RQ1A 4YXJA 1SZHA 1RYUA 5KG6A 3UXNA 4MFFA 2PMZC 5ALHA 3RRHA 1WCLA 1L6NA 2KJ8A 3MGHA 4J9LA 2W8KA 1ZQWA 3LK9A 2DWQA 1T94A 4DLEA 2KN7A 4F2SA 2RHFA 1SL0A 2UVUA 1SL1A 2IOFA 2W04A 4QWDA 4FZMA 3PW5A 2BCQA 2K8CB 3NTUA 3OHBA 2VIXA 1ZQHA 4KLLA 2HBMA 3M9NB 9ICGA 1XWLA 1BGXT 3SAFA 2EAMA 2A3VA 3WK7A 3G6YA 4KLUA 5CWRA 4O9MA 1BPEA 1WWUA 1N60A 4RQ8A 2DGZA 4ECVA 2BCRA 2C2DA 3H8WA 2BQ3A 3C5FA 1S77D 4Y2QA 3H4DA 3PW4A 4USAA 3NS1A 5ALDA 2HHTA 4BJQA 1L5UA 1L7NA 3WK4A 2YMQA 1ZQFA 4DFKA 4C4RA 2JV3A 3MR3A 1RXVA 1J2NA 3D2SA 3BS5B 2KE7A 3RB3A 3AEVA 3DEEA 4FFDA 2EAPA 2KZMA 2LYHA 5FP0A 2HDOA 1KQQA 1ZQJA 1TAUA 2K4IA 4JV1A 1B4FA 2NRTA 2KOBA 5ALZA 2XICA 2WF6A 3N28A 5B5EU 1YZ7A 4F71A 2VA8A 4KMUA 4UAWA 5IIMA 1P7DA 5J2JA 3BZCA 4FBUA 3BQ2A 2Y1IA 4B9MA 4FZNA 5ALNA 4KLDA 4CCHA 2LI6A 2PI5A 4BXOA 4P4PA 9ICAA 4QIWC 3OJUA 2BPGA 1COKA 2BPFA 2E8PA 3B0YA 5KT4A 4QW8A 2PKEA 5JU5A 5J29A 4RQ7A 5KT6A 4ECWA 2ZIVA 5KFXA 1PVQA 3BQ0A 4DQRA 5DQGA 3S6JA 2NYVA 5TISU 4YR2A 2F1IA 4UQGA 3RB4A 3N97B 2KHQA 2WFAA 2OCEA 3PO5A 1U47A 5ALFA 4UBCA 2ZG6A 3Q8SB 5ALSA 3UXPA 1SWVA 1RPLA 5CEHA 3UMBA 3Q8PB 2WF5A 1C20A 3T5LA 5AKKA 2KKPA 3DV9A 2B6GA 2ZIUA 3L3FX 5D49A 5EWFA 2OWOA 4O3MA 2WF8A 1DOQA 1UHUA 1ZQGA 4DLGA 1URJA 1NKCA 1KKXA 2KG5A 2MUTA 4B9SA 3ISCA 2UVRA 4NLBA 1ZQLA 2C28A 3LWLA 4CNQA 4UB8U 2LKYA 4DQSA 3CRXA 4O5CA 4O3SA 3B0XA 7ICSA 3PNCA 2A19A 1AQ6A 3LDAA 2FE9A 4FS2A 3PSTA 1ZD3A 2W9AA 3KOOA 1N5XA 1NK9A 3AMZA 1NJXA 1HIWA 3JPOA 7ICNA 4Y2YA 2YQEA 5J0SA 4Z6FA 3RJHA 5AM1A 3T3FA 2I6XA 4I2JA 3V72A 2HOIA 1Z1BA 2PFNA 5J2IA 4KLMA 8ICBA 1XSPA 3EPIA 3PX4A 3IN5A 3HRDD 1DK3A 4RQ6A 3Q8LA 1VDVA 2KV2A 4J03A 3SQIA 2W03A 3MR5A 4NLGA 5KFNA 3UMGA 1LB2B 3H8SA 2ZTDA 5AIAA 1F0MA 2ISPA 4PGXA 4YCXA 3MGVA 3KBBA 2O6KA 5HMLA 5DLGA 3IHQB 3M1YA 1KBUA 3FDSA 1PUZA 7ICOA 4UB1A 2FMQA 2QB1A 5KFKA 3F2DA 9ICLA 2Q4TA 4P0QA 3HP6A 5F9LA 5DBCA 5DQIA 5CR0A 4BWJA 4DOCA 2G5HB 2A1JA 4TUSA 1QSLA 5HR7A 8ICRA 5KFVA 1TK0A 3A0HU 3TFRA 4KLFA 1T4GA 1IV8A 3IG5A 3TQ1A 2PFQA 4M9NA 5AKJA 4KLQA 5KFJA 3ALRA 4C8MA 2W7OA 3T5KA 2LM4A 2JH7A 2FMPA 2ESEA 3HX0A 3NVZA 4MEYA 5ALLA 1ZJMA 4O5KA 1XC9A 3RJKA 5EE3A 1JX4A 1ZRNA 1U48A 2AQ0A 3GDXA 1IIPA 4UAUA 4FZLA 1PVPA 2H5XA 3Q8RB 4I2EA 4XQ8A 3QX7A 4DSLA 4GXJA 7ICFA 1TAQA 4NLNA 1SGGA 3SR6A 5KG5A 3RBDA 4EEYA 1U49A 4DQPA 9ICXA 9ICMA 3F2BA 4ELUA 5HMMA 5J2DA 5KFTA 2WTFA 2ODGA 1MQ3A 1KTQA 5J2AA 2QLTA 2OXOA 8ICYA 4DFJA 5AICA 2ZIWB 4EYHB 2W9CB 1SB3C 4EX6A 4ZH4A 3PX6A 2QB0B 1N5WA 2DQNB 3C2LA 1B0XA 4J9RA 5A0LA 3VCBA 3C2KA 4PHPA 4TQSA 2WAQF 2H3IA 1WYGA 2KD1A 5AKEA 1IG6A 4OJ5A 1RM6C 1S5LU 3KHGA 3K75D 4JB3A 4P4MA 4DEZA 3IDWA 1QH9A 5DB7A 3JPSA 5IIOA 3HKZF 2YX8A 4NWIA 4EX7A 1NJZA 2B21A 3WU2U 8ICWA 4O0IA 5AM3A 5EE0A 1SKRA 3ISDA 4O3PA 1XSLA 2AU0A 4M9LA 2G06A 4Q44A 3KFUF 3GIJA 4DL3A 3HPOA 4K4HA 4GXKA 4ECTA 3OJSA 4QZFA 9ICBA 3ZI4A 4C7YA 4KX3A 5AK5A 5J2GA 1UA0A 4RQ5A 4M6WB 4MFCA 2E1FA 4RUCA 3KHRA 3GILA 9ICEA 1UPHA 8ICJA 5L1KA 3AU6A 1NKEA 4XRHA 4QWEA 3K1RB 1V9PA 3QXGA 5KFLA 1CEZA 3PO4A 1WUDA 8ICTA 3ZDAA 3N7SC 1BPYA 3V6HA 2Y9UA 2JRZA 1BPXA 4YXMA 4DF8A 1AROP 2CPRA 4A8EA 1Z1VA 2BKEA 2NRVA 5DKWA 4R63A 3PR4A 4RT3A 2KZZA 4EBEA 4U6PA 1ZXIA 4RPZA 2R8HA 5GTIU 3SV3A 1NK8A 1RG6A 1Z4OA 3WKCA 1SKSA 2XVTA 4J9SA 1DXSA 5HNKA 1U9LA 4F50A 2E3TA 3BJYA 5KFOA 3EW9A 4NXZA 2G0AA 4YMNA 4DSEA 5KFEA 1ZRMA 5KG7A 1L7MA 4DSFA 4BDPA 2RLTA 4MF2A 4I29A 2BR0A 3AQEA 2MA1A 3PZPA 4QJFB 3GIMA 3EYZA 1ZQNA 4DWIA 4PL2A 5F3XB 2JR5A 2P6UA 9ICNA 7ICGA 2W55A 5ALYA 8ICXA 4EEKA 3CW2C 2AGPA 3SYZA 2GOLA 1V38A 5KFWA 3AM9A 3BQ7A 2E1EA 3GV8B 5KFRA 2F1HA 3F2CA 2OM6A 2K60A 1O03A 3IP4B 1N63A 5KFDA 3ONNA 5D46A 2BCSA 1D9FA 2E8OA 2DL0A 2KK0A 5J0OA 5KG4A 4RUAA 2DKZA 4YR3A 2JEIA 2HOQA 4ELVA 2LM1A 3LVVA 1COOA 5L1JA 4BXOB 3T79A 2RP5A 3C1ZA 1S0OA 3EPGA 1L3SA 2VA2A 1S0NA 3QU4A 3RJIA 2B0CA 2ZJAA 8ICGA 5ALEA 1Z19A 5J2CA 1NK7A 2ZIVB 2ISOA 5AIBA 5CJ7A 3H40A 4F92B 3TACB 4R65A 1NNLA 2J6TA 2PXIA 4RT2A 4RQ0A 5BPCA 4CRXA 5KFSA 8ICVA 1WCNA 4IS7A 5KFYA 4J9MA 4DSKA 4LVSA 2LBOA 2AGQA 2HBJA 4RNOA 5AHXA 1QSYA 8ICKA 2VJ5A 3GV5B 2R8JA 4OJOA 1L8OA 4BWMA 5AK4A 5AM5A 4UB5A 4RQNA 4MF8A 2ZXIA 3AN1A 3WK9A 5HR6A 1BNPA 3RB6A 5ALOA 1MN8A 2ZIUB 3QU9A 4U7CA 3MR2A 9ICRA 7ICPA 7ICMA 5KT2A 4TURA 4JMUA 8ICUA 4PPXA 4O3OA 2MUTB 3TANA 5ALVA 2VKQA
chains in the Genus database with same CATH topology
3K1RB 5JRTA 2E8OA 2DL0A 1UQVA 1PK3A 2Y9UA 1SGGA 3SENA 4PZOA 4NL9C 1X9XA 5J8YC 2DKZA 3KKAC 1Z1VA 3HILA 1COKA 1KW4A 5L1MA 2E8PA 2DKXA 5JU5A 2EANA 4PZNA 2E8NA 1WWVA 3BS7A 4RQMA 2QARA 2D3DA 2QB0A 1JI7A 1SXDA 3H8MA 2EAMA 1RG6A 1F0MA 1V85A 1WWUA 2QARB 2QB0B 1DXSA 1B0XA 1PK1A 3TACB 2EAOA 2YTUA 2QB1A 1LKYA 2LMRA 4IS7A 3BS5A 1SV4A 1PK1B 2Y9TA 5JTIA 3IDWA 1OXJA 2L5YA 2F44A 2JV3A 2GLEA 2KIVA 1SXEA 1LKYB 2K4PA 3BS5B 2KE7A 2QKQA 2B6GA 2D8CA 2F3NA 4RQNA 1SV0A 5F3XB 3TADA 2EAPA 2KSOA 4NJ8A 2ES6A 4MHVA 2KG5A 1V38A 1OW5A 1UCVA 1B4FA 1X66A 3BQ7A 2E8MA 2F8KA 2KSOB 2LPEA 4NL9A 5KNIA 5J8YA 2ESEA 3KKAA 1X40A 2KMDA 2K60A 3SEIA 1SV0C 2FE9A 3TADC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1R B;  5JRT A;  2E8O A;  2DL0 A;  1UQV A;  1PK3 A;  2Y9U A;  1SGG A;  3SEN A;  4PZO A;  4NL9 C;  1X9X A;  5J8Y C;  2DKZ A;  3KKA C;  1Z1V A;  3HIL A;  1COK A;  1KW4 A;  5L1M A;  2E8P A;  2DKX A;  5JU5 A;  2EAN A;  4PZN A;  2E8N A;  1WWV A;  3BS7 A;  4RQM A;  2QAR A;  2D3D A;  2QB0 A;  1JI7 A;  1SXD A;  3H8M A;  2EAM A;  1RG6 A;  1F0M A;  1V85 A;  1WWU A;  2QAR B;  2QB0 B;  1DXS A;  1B0X A;  1PK1 A;  3TAC B;  2EAO A;  2YTU A;  2QB1 A;  1LKY A;  2LMR A;  4IS7 A;  3BS5 A;  1SV4 A;  1PK1 B;  2Y9T A;  5JTI A;  3IDW A;  1OXJ A;  2L5Y A;  2F44 A;  2JV3 A;  2GLE A;  2KIV A;  1SXE A;  1LKY B;  2K4P A;  3BS5 B;  2KE7 A;  2QKQ A;  2B6G A;  2D8C A;  2F3N A;  4RQN A;  1SV0 A;  5F3X B;  3TAD A;  2EAP A;  2KSO A;  4NJ8 A;  2ES6 A;  4MHV A;  2KG5 A;  1V38 A;  1OW5 A;  1UCV A;  1B4F A;  1X66 A;  3BQ7 A;  2E8M A;  2F8K A;  2KSO B;  2LPE A;  4NL9 A;  5KNI A;  5J8Y A;  2ESE A;  3KKA A;  1X40 A;  2KMD A;  2K60 A;  3SEI A;  1SV0 C;  2FE9 A;  3TAD C; 
#chains in the Genus database with same CATH topology
 3MFI A;  4TUQ A;  3SAH A;  2P66 A;  1TAM A;  2V4R A;  4CGZ A;  2FLN A;  1D8L A;  2FPM A;  1X9M A;  4B9V A;  1UT8 A;  4DL2 A;  4O3Q A;  4R66 A;  5DG7 A;  3SI8 A;  4ED7 A;  1YZ6 A;  2EAN A;  1T7P A;  1WWV A;  3BS7 A;  1A0P A;  1ZQX A;  4QZD A;  7ICU A;  2F1J A;  1Z3E B;  2F2A B;  2LYB A;  1XS9 D;  5KTQ A;  4DOA A;  1S76 D;  4WJ3 B;  1JXE A;  3VC8 A;  2PFO A;  7ICV A;  1QSS A;  8ICP A;  7ICH A;  2XGP A;  3RJG A;  5DDM A;  4G9B A;  3QZ7 A;  2JGA A;  1JRP A;  5H2F U;  1JRO A;  4KIT B;  2RQ5 A;  3PML A;  4BUG A;  5AKY A;  2EAO A;  5AM0 A;  1YT3 A;  1ZQQ A;  2JEG A;  1ZET A;  1F5S A;  2XCA A;  4IC9 A;  5III A;  2JHD A;  3PSP A;  4PHA A;  1XNS A;  5J0X A;  1Z00 A;  4F93 B;  3GQC A;  2HBL A;  4XA5 A;  3QU5 A;  4AP9 A;  2NV3 A;  1XU4 A;  2BDP A;  5AKI A;  4M04 A;  3N7P D;  3QZ8 A;  4IL6 U;  4DSI A;  3V6J A;  3IRU A;  2GWS A;  5F9N A;  4P0Q B;  3BDP A;  8ICH A;  4EEL A;  5ALU A;  2KEY A;  4GXI A;  4B9U A;  2KSO A;  3NVV A;  3AL0 B;  2W8L A;  2EH9 A;  2VAN A;  3C29 A;  4UB6 U;  2FDR A;  1ZQS A;  2A1J B;  1D8B A;  1X42 A;  1ZD4 A;  4DF4 A;  1OW5 A;  1X66 A;  3TAR A;  2WB1 C;  2FLL A;  5AI8 A;  2HHW A;  4F4X A;  4QZH A;  2G5I B;  1RYR A;  4X5V A;  4ACO A;  1ZQZ A;  4RPX A;  4Q8F A;  5ALK A;  2HCF A;  2JEJ A;  3RJF A;  1X6J A;  3IG8 A;  4QWB A;  1MA7 A;  4KN7 A;  3HIL A;  5J2B A;  2KZ3 A;  8ICO A;  2KP7 A;  2W43 A;  4HYK A;  4IRC A;  2E8N A;  4KLO A;  8ICA A;  4R64 A;  1NZB A;  1BPZ A;  1FEZ A;  5EWG A;  3PVX A;  1KEJ A;  1X2I A;  4B9N A;  1C7Y A;  4QIW F;  4DS4 A;  2RDI A;  8ICI A;  1SXD A;  7ICT A;  3QEB Z;  2HW3 A;  1V85 A;  3RH6 A;  5J2F A;  2W9B A;  2I9G A;  2HVH A;  4P0P A;  1J97 A;  1N48 A;  9ICQ A;  4QZB A;  5DBB A;  4GFJ A;  1LVH A;  4FS1 A;  3AU2 A;  2EZY A;  5CA7 A;  4KN4 A;  1IM4 A;  5ALX A;  5DB9 A;  3H4B A;  2FPL A;  3H0M B;  3OTQ A;  3PSF A;  2GLE A;  4CDG A;  3WK5 A;  4FO6 A;  1TKD A;  8ICQ A;  4M2Y A;  3C28 A;  2YML A;  4KLT A;  4UAR A;  5KT5 A;  4IQT A;  2AH5 A;  4PGQ A;  2IA6 A;  2R8K A;  4YR0 A;  2JXJ A;  2AQ4 A;  1NKB A;  2ASD A;  4Y2R A;  2E5S A;  3WKE A;  4C8O A;  4I2C A;  3MGI A;  1ZQV A;  8ICC A;  1ZQC A;  3ETL A;  4M9H A;  3H0L B;  9ICK A;  1ZQY A;  4UAT A;  1NJW A;  2HHX A;  5KNI A;  1DGJ A;  1BPB A;  4RQ4 A;  2Q0Z X;  2V4Q A;  2M0N A;  1ZQD A;  2P35 A;  2H3F A;  2IOF K;  1KLN A;  4M9J A;  1UQV A;  2ZXH A;  4ED3 A;  2HVI A;  1U45 A;  4C4S A;  8ICS A;  5KG3 A;  5ALQ A;  3GZF A;  1ZQB A;  5J0Q A;  3JPP A;  3DDH A;  1CI4 A;  1ZQM A;  3HKZ C;  1M6Y A;  4Z6E A;  2DKX A;  4RQM A;  1RQL A;  1DK2 A;  2M9N A;  2YB1 A;  4C8L A;  5DB6 A;  5IIL A;  3F53 A;  4JV2 A;  5KFP A;  2DBY A;  4RQ2 A;  4Y2X A;  5G5G A;  3BQ1 A;  1N62 A;  5BOM A;  3BZK A;  2N1R A;  9ICP A;  5T14 A;  3M9O B;  3V7K A;  2WF9 A;  9ICJ A;  3C5G A;  3GV7 B;  4UAY A;  3QYP A;  5AKG A;  4F3O A;  3BQT A;  4QZE A;  2Y9T A;  1KL9 A;  2I5H A;  3TFS A;  2L5Y A;  4QNL A;  1XO0 A;  3UMC A;  4NM2 A;  5DBA A;  3FAH A;  2EDU A;  8ICM A;  3QUC A;  3TAD A;  5KFG A;  4RZR A;  4ED6 A;  5AI4 A;  2HHU A;  4O3R A;  4R8U A;  4F4Y A;  4MHV A;  1RZT A;  3NVW A;  1UCV A;  1ED1 A;  2AXT U;  4QZI A;  2YN4 A;  3Q8Q B;  2W11 A;  4Y2S A;  1U4B A;  5KG2 A;  3UPQ A;  2R8G A;  1MSW D;  3MAB A;  3MDA A;  4ECZ A;  3RR8 A;  5KAI U;  3TAD C;  2HOF A;  2NRX A;  5KG0 A;  3OGU A;  5B66 U;  3RJJ A;  3NVY A;  3N4M B;  3ICX A;  1NOM A;  4I2H A;  1X9S A;  1ZD2 P;  2Y0S C;  2BHN A;  4NLZ A;  3SEN A;  3HWT A;  4KLE A;  3RAQ A;  2IMW P;  5J0Y A;  4KLG A;  4CF3 A;  3LWM A;  2MSN A;  3PR5 B;  2DPJ A;  4TQR A;  1GO3 F;  1L3U A;  3F5E A;  2ZJ5 A;  1FO4 A;  5IIN A;  3JPQ A;  2PFP A;  1ZD5 A;  3C2M A;  3D2N A;  4OJ6 A;  2MU2 A;  5AKH A;  4PJ0 U;  1LV5 A;  4DL7 A;  1KSP A;  4ECX A;  1ZQR A;  5J2H A;  4PH5 A;  4ECR A;  2HI0 A;  3PW0 A;  4ICA A;  4KX5 A;  1TV9 A;  3L4P A;  4MEX A;  2HBK A;  3RFA A;  1ZQI A;  4TUP A;  2BCU A;  4P2H A;  5KFA A;  1D9D A;  7ICQ A;  2FMS A;  4AYB F;  1PZN A;  3H7I A;  2ES6 A;  5KFZ A;  2NO4 A;  5HP4 A;  3R9K A;  1WG8 A;  3QU7 A;  1D8Y A;  5L1I A;  1BNO A;  3Q8M A;  3HT3 A;  3UQ0 A;  3NRW A;  1N61 A;  3SEI A;  5KT7 A;  3ZDB A;  1CRX A;  7ICJ A;  2BDU A;  4YN4 A;  4OO1 J;  2AGO A;  2FPK A;  4ED2 A;  3TKA A;  4UB3 A;  4KLI A;  2XCP A;  1JN3 A;  5D4B A;  4UAZ A;  2CN1 A;  1HUZ A;  4DQQ A;  4C80 A;  2MRL A;  4ED0 A;  4PZO A;  5BOL A;  4NV0 A;  5AKZ A;  3UXO A;  4YD2 A;  2DPI A;  2EQY A;  2UVW A;  2CXY A;  4KLS A;  5DDY A;  4I2F A;  3QUB A;  4RNM A;  3QE9 Y;  4FBT A;  1L8L A;  3THV A;  4BGD A;  2HHS A;  2BGW A;  1BPD A;  3M9M B;  4Y2T A;  3OPX A;  5DG9 A;  1QLN A;  5DG8 A;  3IM1 A;  3NRZ A;  4PHD A;  3ORY A;  5ALI A;  2IOH A;  9ICH A;  1A77 A;  3B9J A;  2OYY A;  5AKX A;  3ZDD A;  1L7O A;  5DLF A;  4UW9 A;  3SD7 A;  3QUQ A;  5KFU A;  2BQU A;  3FC4 A;  3RTV A;  4I28 A;  2VJ4 A;  2ZIX A;  4JWN A;  4C4T A;  4JWM A;  5K4L A;  2LMR A;  3PV8 A;  2C2E A;  2D6F C;  2G08 A;  4ECS A;  4P4O A;  5JTI A;  4JK1 A;  1OXJ A;  1VJ5 A;  3KTQ A;  1S10 A;  5ALG A;  4DSJ A;  2K4H A;  4KLH A;  1Z00 B;  2JZB A;  1B22 A;  4J9O A;  2XY5 A;  4O5E A;  2F3N A;  3SZ2 A;  2IBK A;  2BZF A;  3JPN A;  2EZX A;  4Z6D A;  3MR6 A;  4NM1 A;  1Q3V A;  1QTM A;  1NZP A;  2KSO B;  2LPE A;  1T3N A;  2K89 A;  1DGS A;  1UA1 A;  2KMD A;  3Q8K A;  4M47 A;  3E58 A;  2XO7 A;  1S0M A;  4UB2 A;  1FFU A;  4KMO B;  3M6Z A;  3CYM A;  4DFP A;  1SWW A;  4QZA A;  4Q8E A;  1XO1 A;  5EOZ A;  5KFI A;  4XUS A;  3RAX A;  4YG2 A;  2JEF A;  3MC1 A;  2KFN A;  9ICU A;  2XY6 A;  5J2E A;  1Q46 A;  3OHA A;  5L1M A;  3K4G A;  4YFK A;  1L3V A;  5J0R A;  1RYS A;  4LZG A;  1ZQ1 C;  3FM9 A;  4ECY A;  1NI3 A;  1TFR A;  2XID A;  2QAR A;  5AM4 A;  5KFF A;  4KLJ A;  4UAV A;  1H38 A;  1JI7 A;  4I2D A;  3QNM A;  3M8R A;  3RJE A;  4J9K A;  1NJY A;  4J9Q A;  2PMZ F;  4NY8 A;  4DOB A;  4EZ9 A;  2GO7 A;  5KFQ A;  1PK1 A;  5HHI A;  5ALT A;  1ZQP A;  2JMG A;  4Z6C A;  7ICE A;  3RF9 A;  1LKY A;  2ASL A;  2W9B B;  3OSP A;  3NGD A;  3PY8 A;  1FFV A;  1SKW A;  4YMO A;  5EE9 A;  4K4G A;  4P0P B;  5EWE A;  1KRP A;  1O08 A;  4F8R A;  5J0U A;  1L7P A;  4GC6 A;  1ZQA A;  3M8S A;  4O3N A;  3KHL A;  1SIJ A;  3IV6 A;  2EZZ A;  2KTQ A;  4EBD A;  1Q8K A;  2IHN A;  3I76 A;  4DFM A;  5KG1 A;  4PHE A;  5EE1 A;  9ICC A;  3CP8 A;  4NJ8 A;  4C0Z A;  5L9X A;  1ZJN A;  4C8K A;  5CP2 A;  1CUK A;  4RNN A;  4ECQ A;  1RXW A;  2J6S A;  1IXR A;  2KKV A;  4DL6 A;  8ICL A;  2E8M A;  3MDC A;  4Y2V A;  4I2B A;  3WKD A;  3QEA Z;  1JAL A;  1HUO A;  3PMN A;  2KJ5 A;  1KFD A;  2F77 X;  1QQ7 A;  4DFD A;  2H3Z A;  2WF7 A;  4YD1 A;  5JUM A;  4NLK A;  4GC7 A;  5AI9 A;  1MQ2 A;  3HW8 A;  1NK4 A;  2W3S A;  3T5H A;  2JH1 A;  2F8L A;  4Q45 A;  2ASJ A;  2XY7 A;  2W54 A;  2AJQ A;  3KZX A;  4Q43 A;  2J6U A;  5DGB A;  2UVV A;  5KFH A;  1Q3U A;  2YMP A;  5KL1 B;  4F5R A;  2I1Q A;  4DL4 A;  1OUQ A;  7ICR A;  4ECU A;  1ZQK A;  4J9N A;  1X9W A;  3ED5 A;  3CNH A;  3V7L A;  5KFB A;  2RRD A;  4RU9 A;  1JXL A;  3GFK B;  5KL8 B;  9ICS A;  4BX9 C;  5AI5 A;  2GH1 A;  4M0A A;  4IRD A;  4QZC A;  3ISB A;  3GU3 A;  2YTU A;  4F5N A;  3BS5 A;  1L3T A;  2KIC A;  2ZUC A;  2KHV A;  1MC8 A;  4E0D A;  2KIV A;  4RQ3 A;  4JV0 A;  4YMM A;  4DCC A;  5TZV A;  1BVS A;  4US9 A;  1JMS A;  3G6V A;  3F5A A;  4G3I A;  2H3V A;  2FJ6 A;  2Z7J A;  5J2K A;  3RR7 A;  5ALW A;  1KDH A;  4NL9 A;  3RH4 A;  3TAP A;  4F5Q A;  4R8U B;  3PX0 A;  2C22 A;  3FYH A;  4IQV A;  2P6R A;  4B6J A;  2ATL A;  3ZD8 A;  4GIB A;  3C21 A;  3M7D A;  2YY6 A;  2KJ9 A;  5IIK A;  3V7J A;  4I2A A;  3LYS A;  2WB1 F;  3O0F A;  4YP3 A;  3RH5 A;  3L5K A;  9ICT A;  3I28 A;  1XSN A;  1TK5 A;  5KAF U;  3J81 j;  1QQ6 A;  4NL9 C;  2K8A A;  1X9X A;  1RDF A;  5CRX A;  4QZ9 A;  1QCK A;  3NUQ A;  4M9G A;  4IQW A;  3WK6 A;  1NK5 A;  2KIW A;  4DS5 A;  9ICW A;  3EUB 2;  1HJP A;  5E79 U;  1ZQO A;  2D3D A;  2KNJ A;  3WK8 A;  1V97 A;  2YMM A;  2WAQ C;  4Y2P A;  3MBY A;  2DFL A;  3PW7 A;  1S8O A;  1SZP A;  4KTQ A;  4GLX A;  1K5O A;  5AI6 A;  4EBC A;  3RB0 A;  4F4K A;  2XI9 A;  4F91 B;  5J0W A;  1KN5 A;  3AUO A;  5C0Y A;  5KT3 A;  3KD3 A;  3NAS A;  5ALM A;  2G07 A;  1SV4 A;  1TVA A;  2NO5 A;  3E2E A;  2G09 A;  4QWC A;  2VA3 A;  3RBE A;  2C2R A;  2F44 A;  4C8N A;  8ICZ A;  1JUD A;  3D2Q A;  5ALJ A;  3TAQ A;  9ICO A;  2K4P A;  1X6I A;  4F4W A;  4CF5 A;  3EWA A;  2KFZ A;  4IRK A;  4F72 A;  3PSI A;  4F2R A;  2FLP A;  4C7Z A;  2K4E A;  3WKB A;  1DRG A;  3T5J A;  5J8Y A;  2W9M A;  1X40 A;  3ZD9 A;  1NK6 A;  4RPY A;  5G5H A;  1TE2 A;  9ICF A;  4F4Z A;  3SV4 A;  3OSN A;  3RRG A;  1FIQ A;  2BQR A;  4QW9 A;  1ECW A;  1PK3 A;  3UQ2 A;  8ICF A;  4ZOH C;  4JUZ A;  2HHV A;  2R8I A;  5ALR A;  4IR9 A;  3I1Y A;  1K1Q A;  1PVR A;  3V6K A;  1JIH A;  5J8Y C;  4PL1 A;  2HMX A;  2BPC A;  4YVZ A;  4UAS A;  4YQW A;  5KFM A;  4OJL A;  1ZQE A;  5AKL A;  2H3Q A;  1B43 A;  8ICE A;  2ZTE A;  4AYB C;  4B9T A;  2ZUB A;  3QUT A;  4K4I A;  4I27 A;  2LHT A;  1F44 A;  4PGY A;  3QU2 A;  4EZ6 A;  3UM9 A;  2K8B B;  1TK8 A;  1ZQU A;  9ICV A;  3SAG A;  3GIK A;  5GTH U;  1UT5 A;  4UB4 A;  4NLC A;  3SMV A;  4I2G A;  2OEH A;  4LJX A;  5DQH A;  4IQU A;  3TI0 A;  4Y2J A;  3C1Y A;  5J0T A;  5CB1 A;  3JPT A;  1T3Q A;  2W3R A;  3HJE A;  2OH2 A;  2LYA A;  2OHF A;  2ZUD A;  2ZIX B;  4DQI A;  3LVW A;  1SXE A;  2DUY A;  8ICN A;  1N56 A;  7ICI A;  3ZDC A;  7ICK A;  4ED8 A;  5DGA A;  3E0F A;  2QKQ A;  5IIJ A;  2W7P A;  3PW2 A;  1SV0 A;  3ZDE A;  2HHQ A;  1J2M A;  4QZ8 A;  1VLB A;  5J0P A;  4MFA A;  1Z4N A;  4QZG A;  1S0V A;  2JZB B;  2XC9 A;  2RDJ A;  5AM2 A;  4J9P A;  4F5O A;  3H8J A;  5L1L A;  5C5J A;  1Y88 A;  1ZOL A;  1SL2 A;  3KKA A;  2WHE A;  3D6J A;  2NRW A;  4ED1 A;  1SV0 C;  2KVS A;  2MAX A;  4OJP A;  4DL5 A;  5HHH A;  4OCZ A;  4CE6 A;  5JRT A;  4Y2U A;  4CF4 A;  2XGQ A;  2DF4 B;  2V9W A;  1RQN A;  1S97 A;  4US8 A;  3GII A;  2FI1 A;  3KKA C;  3AQF A;  2YB4 A;  4ELT A;  1HEK A;  1KW4 A;  4UBB A;  2F76 X;  2ZIW A;  2NRZ A;  4LZD A;  3M6K A;  2W9C A;  2A1A A;  4PZN A;  5ALP A;  5CHG A;  1K1S A;  1ZQT A;  3K1Z A;  2Y0S F;  2QB0 A;  4IR1 A;  3H8M A;  3A0B U;  3KHH A;  2R18 A;  4FE3 A;  4OD0 A;  2BCV A;  5AI0 A;  2PI4 A;  2QAR B;  4EEN A;  7ICL A;  3U26 A;  3ETR A;  3JPR A;  3H0R B;  3KZI U;  4DO9 A;  9ICI A;  1A76 A;  1KFS A;  1ZYQ A;  1PK1 B;  3MFH A;  4EYI B;  1KFT A;  3WKA A;  2ALZ A;  2HSZ A;  4QWA A;  1A6S A;  1LKY B;  3EZ5 A;  1N2X A;  4B9L A;  1T8E A;  5DB8 A;  2D8C A;  2IHM A;  3C23 A;  2KVC A;  5AK3 A;  4M6W A;  2AHO B;  1EXN A;  4I2I A;  1QQ5 A;  1NK0 A;  2ZTC A;  2ZJ8 A;  4HAI A;  2F8K A;  1S9F A;  4F5P A;  3G6X A;  5KFC A;  2Y1J A;  2CRX A;  5AK6 A;  3N7R C;  4RQ1 A;  4YXJ A;  1SZH A;  1RYU A;  5KG6 A;  3UXN A;  4MFF A;  2PMZ C;  5ALH A;  3RRH A;  1WCL A;  1L6N A;  2KJ8 A;  3MGH A;  4J9L A;  2W8K A;  1ZQW A;  3LK9 A;  2DWQ A;  1T94 A;  4DLE A;  2KN7 A;  4F2S A;  2RHF A;  1SL0 A;  2UVU A;  1SL1 A;  2IOF A;  2W04 A;  4QWD A;  4FZM A;  3PW5 A;  2BCQ A;  2K8C B;  3NTU A;  3OHB A;  2VIX A;  1ZQH A;  4KLL A;  2HBM A;  3M9N B;  9ICG A;  1XWL A;  1BGX T;  3SAF A;  2EAM A;  2A3V A;  3WK7 A;  3G6Y A;  4KLU A;  5CWR A;  4O9M A;  1BPE A;  1WWU A;  1N60 A;  4RQ8 A;  2DGZ A;  4ECV A;  2BCR A;  2C2D A;  3H8W A;  2BQ3 A;  3C5F A;  1S77 D;  4Y2Q A;  3H4D A;  3PW4 A;  4USA A;  3NS1 A;  5ALD A;  2HHT A;  4BJQ A;  1L5U A;  1L7N A;  3WK4 A;  2YMQ A;  1ZQF A;  4DFK A;  4C4R A;  2JV3 A;  3MR3 A;  1RXV A;  1J2N A;  3D2S A;  3BS5 B;  2KE7 A;  3RB3 A;  3AEV A;  3DEE A;  4FFD A;  2EAP A;  2KZM A;  2LYH A;  5FP0 A;  2HDO A;  1KQQ A;  1ZQJ A;  1TAU A;  2K4I A;  4JV1 A;  1B4F A;  2NRT A;  2KOB A;  5ALZ A;  2XIC A;  2WF6 A;  3N28 A;  5B5E U;  1YZ7 A;  4F71 A;  2VA8 A;  4KMU A;  4UAW A;  5IIM A;  1P7D A;  5J2J A;  3BZC A;  4FBU A;  3BQ2 A;  2Y1I A;  4B9M A;  4FZN A;  5ALN A;  4KLD A;  4CCH A;  2LI6 A;  2PI5 A;  4BXO A;  4P4P A;  9ICA A;  4QIW C;  3OJU A;  2BPG A;  1COK A;  2BPF A;  2E8P A;  3B0Y A;  5KT4 A;  4QW8 A;  2PKE A;  5JU5 A;  5J29 A;  4RQ7 A;  5KT6 A;  4ECW A;  2ZIV A;  5KFX A;  1PVQ A;  3BQ0 A;  4DQR A;  5DQG A;  3S6J A;  2NYV A;  5TIS U;  4YR2 A;  2F1I A;  4UQG A;  3RB4 A;  3N97 B;  2KHQ A;  2WFA A;  2OCE A;  3PO5 A;  1U47 A;  5ALF A;  4UBC A;  2ZG6 A;  3Q8S B;  5ALS A;  3UXP A;  1SWV A;  1RPL A;  5CEH A;  3UMB A;  3Q8P B;  2WF5 A;  1C20 A;  3T5L A;  5AKK A;  2KKP A;  3DV9 A;  2B6G A;  2ZIU A;  3L3F X;  5D49 A;  5EWF A;  2OWO A;  4O3M A;  2WF8 A;  1DOQ A;  1UHU A;  1ZQG A;  4DLG A;  1URJ A;  1NKC A;  1KKX A;  2KG5 A;  2MUT A;  4B9S A;  3ISC A;  2UVR A;  4NLB A;  1ZQL A;  2C28 A;  3LWL A;  4CNQ A;  4UB8 U;  2LKY A;  4DQS A;  3CRX A;  4O5C A;  4O3S A;  3B0X A;  7ICS A;  3PNC A;  2A19 A;  1AQ6 A;  3LDA A;  2FE9 A;  4FS2 A;  3PST A;  1ZD3 A;  2W9A A;  3KOO A;  1N5X A;  1NK9 A;  3AMZ A;  1NJX A;  1HIW A;  3JPO A;  7ICN A;  4Y2Y A;  2YQE A;  5J0S A;  4Z6F A;  3RJH A;  5AM1 A;  3T3F A;  2I6X A;  4I2J A;  3V72 A;  2HOI A;  1Z1B A;  2PFN A;  5J2I A;  4KLM A;  8ICB A;  1XSP A;  3EPI A;  3PX4 A;  3IN5 A;  3HRD D;  1DK3 A;  4RQ6 A;  3Q8L A;  1VDV A;  2KV2 A;  4J03 A;  3SQI A;  2W03 A;  3MR5 A;  4NLG A;  5KFN A;  3UMG A;  1LB2 B;  3H8S A;  2ZTD A;  5AIA A;  1F0M A;  2ISP A;  4PGX A;  4YCX A;  3MGV A;  3KBB A;  2O6K A;  5HML A;  5DLG A;  3IHQ B;  3M1Y A;  1KBU A;  3FDS A;  1PUZ A;  7ICO A;  4UB1 A;  2FMQ A;  2QB1 A;  5KFK A;  3F2D A;  9ICL A;  2Q4T A;  4P0Q A;  3HP6 A;  5F9L A;  5DBC A;  5DQI A;  5CR0 A;  4BWJ A;  4DOC A;  2G5H B;  2A1J A;  4TUS A;  1QSL A;  5HR7 A;  8ICR A;  5KFV A;  1TK0 A;  3A0H U;  3TFR A;  4KLF A;  1T4G A;  1IV8 A;  3IG5 A;  3TQ1 A;  2PFQ A;  4M9N A;  5AKJ A;  4KLQ A;  5KFJ A;  3ALR A;  4C8M A;  2W7O A;  3T5K A;  2LM4 A;  2JH7 A;  2FMP A;  2ESE A;  3HX0 A;  3NVZ A;  4MEY A;  5ALL A;  1ZJM A;  4O5K A;  1XC9 A;  3RJK A;  5EE3 A;  1JX4 A;  1ZRN A;  1U48 A;  2AQ0 A;  3GDX A;  1IIP A;  4UAU A;  4FZL A;  1PVP A;  2H5X A;  3Q8R B;  4I2E A;  4XQ8 A;  3QX7 A;  4DSL A;  4GXJ A;  7ICF A;  1TAQ A;  4NLN A;  1SGG A;  3SR6 A;  5KG5 A;  3RBD A;  4EEY A;  1U49 A;  4DQP A;  9ICX A;  9ICM A;  3F2B A;  4ELU A;  5HMM A;  5J2D A;  5KFT A;  2WTF A;  2ODG A;  1MQ3 A;  1KTQ A;  5J2A A;  2QLT A;  2OXO A;  8ICY A;  4DFJ A;  5AIC A;  2ZIW B;  4EYH B;  2W9C B;  1SB3 C;  4EX6 A;  4ZH4 A;  3PX6 A;  2QB0 B;  1N5W A;  2DQN B;  3C2L A;  1B0X A;  4J9R A;  5A0L A;  3VCB A;  3C2K A;  4PHP A;  4TQS A;  2WAQ F;  2H3I A;  1WYG A;  2KD1 A;  5AKE A;  1IG6 A;  4OJ5 A;  1RM6 C;  1S5L U;  3KHG A;  3K75 D;  4JB3 A;  4P4M A;  4DEZ A;  3IDW A;  1QH9 A;  5DB7 A;  3JPS A;  5IIO A;  3HKZ F;  2YX8 A;  4NWI A;  4EX7 A;  1NJZ A;  2B21 A;  3WU2 U;  8ICW A;  4O0I A;  5AM3 A;  5EE0 A;  1SKR A;  3ISD A;  4O3P A;  1XSL A;  2AU0 A;  4M9L A;  2G06 A;  4Q44 A;  3KFU F;  3GIJ A;  4DL3 A;  3HPO A;  4K4H A;  4GXK A;  4ECT A;  3OJS A;  4QZF A;  9ICB A;  3ZI4 A;  4C7Y A;  4KX3 A;  5AK5 A;  5J2G A;  1UA0 A;  4RQ5 A;  4M6W B;  4MFC A;  2E1F A;  4RUC A;  3KHR A;  3GIL A;  9ICE A;  1UPH A;  8ICJ A;  5L1K A;  3AU6 A;  1NKE A;  4XRH A;  4QWE A;  3K1R B;  1V9P A;  3QXG A;  5KFL A;  1CEZ A;  3PO4 A;  1WUD A;  8ICT A;  3ZDA A;  3N7S C;  1BPY A;  3V6H A;  2Y9U A;  2JRZ A;  1BPX A;  4YXM A;  4DF8 A;  1ARO P;  2CPR A;  4A8E A;  1Z1V A;  2BKE A;  2NRV A;  5DKW A;  4R63 A;  3PR4 A;  4RT3 A;  2KZZ A;  4EBE A;  4U6P A;  1ZXI A;  4RPZ A;  2R8H A;  5GTI U;  3SV3 A;  1NK8 A;  1RG6 A;  1Z4O A;  3WKC A;  1SKS A;  2XVT A;  4J9S A;  1DXS A;  5HNK A;  1U9L A;  4F50 A;  2E3T A;  3BJY A;  5KFO A;  3EW9 A;  4NXZ A;  2G0A A;  4YMN A;  4DSE A;  5KFE A;  1ZRM A;  5KG7 A;  1L7M A;  4DSF A;  4BDP A;  2RLT A;  4MF2 A;  4I29 A;  2BR0 A;  3AQE A;  2MA1 A;  3PZP A;  4QJF B;  3GIM A;  3EYZ A;  1ZQN A;  4DWI A;  4PL2 A;  5F3X B;  2JR5 A;  2P6U A;  9ICN A;  7ICG A;  2W55 A;  5ALY A;  8ICX A;  4EEK A;  3CW2 C;  2AGP A;  3SYZ A;  2GOL A;  1V38 A;  5KFW A;  3AM9 A;  3BQ7 A;  2E1E A;  3GV8 B;  5KFR A;  2F1H A;  3F2C A;  2OM6 A;  2K60 A;  1O03 A;  3IP4 B;  1N63 A;  5KFD A;  3ONN A;  5D46 A;  2BCS A;  1D9F A;  2E8O A;  2DL0 A;  2KK0 A;  5J0O A;  5KG4 A;  4RUA A;  2DKZ A;  4YR3 A;  2JEI A;  2HOQ A;  4ELV A;  2LM1 A;  3LVV A;  1COO A;  5L1J A;  4BXO B;  3T79 A;  2RP5 A;  3C1Z A;  1S0O A;  3EPG A;  1L3S A;  2VA2 A;  1S0N A;  3QU4 A;  3RJI A;  2B0C A;  2ZJA A;  8ICG A;  5ALE A;  1Z19 A;  5J2C A;  1NK7 A;  2ZIV B;  2ISO A;  5AIB A;  5CJ7 A;  3H40 A;  4F92 B;  3TAC B;  4R65 A;  1NNL A;  2J6T A;  2PXI A;  4RT2 A;  4RQ0 A;  5BPC A;  4CRX A;  5KFS A;  8ICV A;  1WCN A;  4IS7 A;  5KFY A;  4J9M A;  4DSK A;  4LVS A;  2LBO A;  2AGQ A;  2HBJ A;  4RNO A;  5AHX A;  1QSY A;  8ICK A;  2VJ5 A;  3GV5 B;  2R8J A;  4OJO A;  1L8O A;  4BWM A;  5AK4 A;  5AM5 A;  4UB5 A;  4RQN A;  4MF8 A;  2ZXI A;  3AN1 A;  3WK9 A;  5HR6 A;  1BNP A;  3RB6 A;  5ALO A;  1MN8 A;  2ZIU B;  3QU9 A;  4U7C A;  3MR2 A;  9ICR A;  7ICP A;  7ICM A;  5KT2 A;  4TUR A;  4JMU A;  8ICU A;  4PPX A;  4O3O A;  2MUT B;  3TAN A;  5ALV A;  2VKQ A; 
#chains in the Genus database with same CATH homology
 3K1R B;  5JRT A;  2E8O A;  2DL0 A;  1UQV A;  1PK3 A;  2Y9U A;  1SGG A;  3SEN A;  4PZO A;  4NL9 C;  1X9X A;  5J8Y C;  2DKZ A;  3KKA C;  1Z1V A;  3HIL A;  1COK A;  1KW4 A;  5L1M A;  2E8P A;  2DKX A;  5JU5 A;  2EAN A;  4PZN A;  2E8N A;  1WWV A;  3BS7 A;  4RQM A;  2QAR A;  2D3D A;  2QB0 A;  1JI7 A;  1SXD A;  3H8M A;  2EAM A;  1RG6 A;  1F0M A;  1V85 A;  1WWU A;  2QAR B;  2QB0 B;  1DXS A;  1B0X A;  1PK1 A;  3TAC B;  2EAO A;  2YTU A;  2QB1 A;  1LKY A;  2LMR A;  4IS7 A;  3BS5 A;  1SV4 A;  1PK1 B;  2Y9T A;  5JTI A;  3IDW A;  1OXJ A;  2L5Y A;  2F44 A;  2JV3 A;  2GLE A;  2KIV A;  1SXE A;  1LKY B;  2K4P A;  3BS5 B;  2KE7 A;  2QKQ A;  2B6G A;  2D8C A;  2F3N A;  4RQN A;  1SV0 A;  5F3X B;  3TAD A;  2EAP A;  2KSO A;  4NJ8 A;  2ES6 A;  4MHV A;  2KG5 A;  1V38 A;  1OW5 A;  1UCV A;  1B4F A;  1X66 A;  3BQ7 A;  2E8M A;  2F8K A;  2KSO B;  2LPE A;  4NL9 A;  5KNI A;  5J8Y A;  2ESE A;  3KKA A;  1X40 A;  2KMD A;  2K60 A;  3SEI A;  1SV0 C;  2FE9 A;  3TAD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...