2KSOA

Epha2:ship2 sam:sam complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
publication title Structure and function of the EphA2:SHIP2 SAM domain heterodimer
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 65
sequence length 65
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ksoA00
2QKQA 2QARB 1SV4A 2E8NA 1RG6A 4NJ8A 4IS7A 2DL0A 1WWVA 2YTUA 1UCVA 2KG5A 2KIVA 5KNIA 5JRTA 1JI7A 4NL9C 1X9XA 3IDWA 1SXDA 2Y9TA 2L5YA 4NL9A 1SV0C 3TADC 2DKXA 1SV0A 2EANA 3H8MA 2D3DA 3K1RB 2K4PA 3BQ7A 1OW5A 2QARA 3SENA 1SGGA 5F3XB 1UQVA 2QB1A 2GLEA 1PK3A 2QB0B 2KE7A 2LMRA 2FE9A 2LPEA 2K60A 2F3NA 2E8MA 3BS5B 4RQNA 2D8CA 4RQMA 1LKYB 1PK1B 3KKAC 2EAPA 4PZNA 3TADA 1SXEA 3KKAA 2KSOB 2B6GA 3SEIA 5J8YC 2F8KA 2QB0A 4PZOA 2EAMA 5J8YA 1X40A 1B4FA 2DKZA 1V38A 2JV3A 3BS5A 3BS7A 3HILA 1COKA 1Z1VA 1KW4A 2ESEA 1LKYA 1PK1A 1OXJA 4MHVA 2E8OA 2F44A 2KSOA 2E8PA 1X66A 3TACB 2Y9UA 1V85A 1B0XA 2KMDA 5L1MA 5JU5A 1WWUA 2EAOA 2ES6A 5JTIA 1F0MA 1DXSA
chains in the Genus database with same CATH superfamily
4F5OA 4I2IA 9ICEA 8ICKA 3GV8B 1S0OA 3FDSA 4OJ5A 5AI6A 2JR5A 3RJIA 4EZ6A 5KT3A 1D8YA 3V6HA 3OJUA 1T4GA 5DDYA 1NJXA 2HBKA 2DF4B 1O08A 2HMXA 3TADC 3M6ZA 1ZETA 1RPLA 1ZJNA 2W9CA 1UA1A 4R65A 5KG5A 4PHEA 2J6UA 3QUTA 2AJQA 1TV9A 4QJFB 2BR0A 3BQ0A 1XSLA 3GFKB 1TE2A 3TFSA 3LVVA 1QSSA 3CRXA 9ICUA 4DFMA 5EE9A 2N1RA 1TFRA 3PSIA 2IBKA 2W11A 3ZD8A 4KITB 2AQ4A 4RNNA 5HNKA 5KL8B 4Y2SA 3CW2C 4QIWC 3KHHA 4EBCA 1BPDA 3PO4A 4DFPA 3Q8LA 2IOFK 3OJSA 1KSPA 5AK6A 3RTVA 1WUDA 1MA7A 4YR2A 4B9MA 2WHEA 5KFUA 2WF9A 2HI0A 1TAQA 3A0BU 2GOLA 2UVVA 1SZPA 4ED3A 1NK8A 1JALA 1NI3A 1B43A 2FMSA 1Q8KA 3LVWA 2KIWA 7ICPA 2KVCA 5KFOA 3WU2U 4KLHA 1EXNA 1KFTA 1S9FA 1N60A 9ICFA 2F2AB 2NYVA 3F5AA 4Y2XA 2V9WA 2LHTA 5ALDA 3AQEA 5IIKA 5KFXA 2WB1F 5ALHA 4YG2A 4IS7A 5J2EA 4FBUA 1WWVA 4M47A 9ICNA 1N63A 1ED1A 2NRVA 5AI0A 5ALIA 3EZ5A 4NL9C 4F93B 1SIJA 4KLGA 3RBEA 3WKEA 1IG6A 2ZG6A 2ISOA 4F72A 4DL4A 1FO4A 2NRTA 2KD1A 3SENA 2W3RA 4DSKA 3MFIA 3GDXA 4IR9A 2ASDA 4ECSA 2ZUCA 3RFAA 3F2BA 5TZVA 3TANA 3PY8A 4EBDA 1RZTA 5IILA 2OEHA 3B9JA 1LKYB 4BXOA 2R18A 1BPEA 4M2YA 3OPXA 3ISBA 2MAXA 2ZIWB 5J8YC 2ZTCA 3KD3A 5BOMA 3HJEA 3QNMA 5KG0A 5EOZA 1PVQA 5ALEA 9ICWA 2F8LA 4MFCA 3BS7A 3RJKA 1XNSA 4AYBF 7ICFA 2B0CA 2WF6A 1SWVA 4EEKA 2HHUA 2W3SA 3CNHA 4FZMA 4F4WA 3SYZA 5ALTA 4USAA 4B6JA 5AI5A 4QZCA 2Y0SF 1P7DA 1TKDA 1J97A 2XIDA 1A77A 2OXOA 1ZOLA 1T8EA 3GV7B 1SB3C 2W9CB 5ALLA 3PZPA 4J9PA 4RZRA 4DF4A 3RJFA 4DQRA 3PW0A 5DGAA 2AGOA 3NVWA 2E1EA 5ALFA 5KFQA 2A3VA 4KLMA 4P4OA 3HPOA 2BCSA 2AQ0A 2H5XA 3F53A 1JI7A 2R8HA 3QU4A 4ED6A 1TVAA 4BGDA 3FC4A 1ECWA 2WAQF 4ECXA 2E1FA 3K1RB 1KQQA 1SKRA 2XY7A 5KG7A 7ICQA 1S0NA 4KTQA 1UQVA 5HHHA 4QWCA 4I28A 2XC9A 4UASA 4EELA 2XGPA 2ISPA 2VA2A 3UQ2A 3N7RC 3ZD9A 4KLFA 5AK4A 1FFVA 1RXWA 5DB7A 3JPPA 1TK0A 3TAPA 1RDFA 4MFAA 3H7IA 3TADA 1NZBA 4K4HA 4UAYA 3JPNA 2C2EA 4I2FA 2JEFA 3A0HU 3I28A 3GIKA 1QLNA 1K1SA 3J81j 2HBMA 4R66A 1JXLA 4ECTA 1ZQBA 1BNPA 2RRDA 5T14A 2W9AA 1X6JA 2W8KA 1JROA 2OCEA 3K1ZA 5AKLA 2BDPA 3PX6A 3HP6A 2A1AA 2F77X 7ICOA 5J2GA 1V85A 3Q8PB 3PW5A 2KMDA 4PH5A 4RQ7A 4PJ0U 2V4RA 2ZIXA 3ALRA 2NO4A 2WF8A 4OJPA 4ECWA 3HX0A 5K4LA 2AGPA 1U48A 3C28A 5B5EU 4J9QA 4M9LA 4C4TA 3RRHA 4C80A 4QWAA 5KG6A 4JV1A 2LKYA 5AICA 4BWMA 1DK2A 5KFVA 1XO0A 2DL0A 3MBYA 4BX9C 4JV2A 3IG5A 8ICBA 5AKKA 2PI4A 3PMNA 3D2SA 3RB3A 5ALUA 3ETLA 4UB3A 2YQEA 1RQNA 5AIBA 4BXOB 3QEBZ 4KX3A 1FEZA 3M6KA 4KN7A 4QWEA 4DFDA 1QTMA 3QX7A 9ICHA 4A8EA 4KLTA 4KLUA 5KFYA 2KHVA 7ICUA 1NK4A 1D8BA 1QQ7A 2ODGA 4GXIA 3KTQA 3NTUA 1A0PA 3SEIA 5B66U 2GWSA 4Y2RA 2MUTA 3F2DA 3RF9A 2G5HB 4M9NA 3CYMA 2JEIA 2XO7A 1NJYA 1Z1VA 5KAIU 2ESEA 2VANA 4Y2QA 2CRXA 2PFPA 2J6SA 5AKEA 2F44A 3KBBA 1MQ3A 3SAGA 3N28A 4KLQA 4BJQA 2PFQA 2HOFA 8ICWA 4AP9A 2JH7A 5JU5A 1S76D 1NOMA 1PZNA 3GQCA 5KFIA 3PVXA 2FLLA 1KL9A 1ZYQA 2B21A 3L4PA 5AM0A 3QU2A 2AH5A 2MU2A 4I2GA 3I1YA 5KTQA 2K4HA 3UMBA 5E79U 3NRZA 3F2CA 1RYUA 3OHBA 1CRXA 2LM1A 2VJ4A 4Y2VA 5KFKA 8ICPA 5GTIU 3PV8A 4DOBA 4F92B 1JMSA 9ICMA 4WJ3B 4ED1A 3IP4B 4RQ0A 4NLBA 2UVRA 2QARA 1SGGA 2I6XA 3OHAA 4I2HA 4CNQA 3MR6A 1Z1BA 4RQ4A 4DOCA 4F2RA 2JH1A 2BGWA 1CUKA 4B9NA 3GIMA 5AI4A 4RQNA 3TAQA 4DEZA 5CHGA 1DK3A 4JWNA 2KICA 5ALXA 5AHXA 4YD1A 5J2DA 1O03A 7ICLA 4RU9A 1KLNA 3UM9A 4KMOB 4DWIA 2YY6A 4PZOA 2EAMA 2KJ8A 4DCCA 2XGQA 2ZIXB 2ZTDA 4Q8EA 4DL2A 2VJ5A 4B9VA 4I2JA 5AKJA 1OXJA 4MHVA 4F91B 5ALKA 1HUOA 7ICVA 3RB4A 5HR6A 2I9GA 1XWLA 3ONNA 4EX6A 1SZHA 5G5GA 3B0YA 5F9NA 4IR1A 4FS2A 1NK6A 4RNOA 4PHAA 4RQ5A 3N97B 4LJXA 2XY5A 2KTQA 4QWDA 3ZDBA 4U7CA 4U6PA 4CF5A 1NK5A 1XSPA 4QZBA 4HYKA 2M0NA 1N5XA 3GZFA 8ICMA 4UB5A 3WK8A 3MR5A 4CDGA 3T5HA 4NJ8A 1ZQHA 7ICIA 4B9UA 7ICGA 4ECVA 2IOHA 5KAFU 2JRZA 4YR0A 5J0SA 1KN5A 1L3UA 1X9XA 1DGJA 2G5IB 4DLEA 2ZTEA 2YN4A 4KLLA 8ICOA 3PO5A 2KV2A 5D49A 3MDAA 2KNJA 3E0FA 4CRXA 4J9RA 2PFOA 3BQ7A 4C4RA 4EYHB 4ICAA 1C20A 1K5OA 4I2BA 1PK3A 4QZHA 2MUTB 2WF5A 5AM3A 4I2EA 4O5KA 4GXJA 3TQ1A 1ZQFA 5KG4A 8ICJA 1BPXA 3SAFA 1C7YA 2EAPA 4DQPA 4JWMA 2YMLA 4MF8A 1NZPA 3ZDEA 4FE3A 1TK8A 2KN7A 3T5KA 2EH9A 2EZYA 1QSYA 5DQHA 1Z3EB 4Y2UA 1KFSA 1WCLA 2ZXIA 5J0UA 1X40A 1ZJMA 3M8SA 9ICKA 9ICVA 5EWGA 5KFLA 3QU9A 3LYSA 4RQ8A 4GFJA 3JPRA 1ZQIA 1KW4A 2C28A 5C0YA 4Z6EA 4BUGA 1TK5A 4Q45A 2LYBA 1ZQLA 2OM6A 1VLBA 3U26A 4O9MA 4YXJA 4P2HA 1N48A 3D2QA 5HP4A 3H0MB 1FIQA 2LM4A 2FPKA 2HVHA 3RJJA 3M9OB 2HW3A 2LI6A 2QARB 3C1ZA 2AU0A 5ALRA 3BZCA 1ZQJA 2PMZC 3SV3A 2KG5A 5KNIA 4KLDA 3RH4A 1ZQQA 4OJLA 4OD0A 4DQIA 3NVVA 4PGXA 1X9WA 4Q44A 3HWTA 2PFNA 2DPJA 2I5HA 2K4PA 3AQFA 5ALQA 2G0AA 3OSPA 4ELUA 9ICPA 3AU2A 4C8OA 4OO1J 2W04A 4IQUA 3AUOA 1RXVA 2K4EA 4RNMA 5ALJA 4PL2A 4B9SA 4DOAA 3S6JA 4UARA 3PW2A 2K8CB 5KFPA 1S97A 1Z00A 4F8RA 5IIMA 4O0IA 4P4PA 2IHNA 3QUBA 3ISCA 1MQ2A 1L3SA 1S0MA 1ZQXA 3K4GA 5CJ7A 5ALPA 3G6YA 2RDJA 2KZ3A 1HIWA 1PK1A 3LWLA 3IN5A 4JB3A 2C22A 3WK9A 1OUQA 2RP5A 2IA6A 1L3TA 4XRHA 1IXRA 5J0RA 3C23A 3WK4A 5KT2A 3PSPA 3DDHA 3EUB2 5A0LA 4M6WA 4K4IA 1TAMA 4O3QA 1VDVA 4M9JA 4KLOA 2QKQA 2ZIVA 3BDPA 2KFNA 3H8SA 4NWIA 2AXTU 2VIXA 3HKZF 4NM2A 5KG3A 1AROP 2YX8A 1BPYA 2YTUA 7ICNA 2JGAA 4YCXA 1ZXIA 3IV6A 2HBLA 1ZQKA 4NLKA 2L5YA 4Z6DA 4YMOA 1IV8A 2PKEA 4JUZA 4F4XA 2K4IA 3H8MA 1XU4A 2ALZA 5DB8A 4QZIA 2IHMA 3R9KA 4NXZA 1U9LA 2R8IA 3ZDDA 5DBCA 1LVHA 3MGVA 2FLPA 7ICMA 5J2FA 2F3NA 1X42A 5D46A 2OH2A 4C8NA 9ICRA 3QU7A 1L7PA 3UXPA 2D6FC 4RQ3A 9ICJA 3M8RA 5J0YA 4J9KA 8ICRA 2BQRA 4ED2A 4C7ZA 5AK5A 2DGZA 2W8LA 3BQTA 3T79A 5H2FU 4MEYA 4I2DA 3C2MA 5DLGA 3Q8SB 3SV4A 3UXNA 2F1HA 5J2KA 2HVIA 2BCQA 3OSNA 4JMUA 2K8AA 3QE9Y 5HR7A 2C2RA 3M9MB 5AM4A 4LZDA 3TACB 5KFSA 4NY8A 2NV3A 5CR0A 2Q4TA 5DB9A 5KFEA 3RH6A 3EPIA 3N7PD 8ICLA 2F1JA 4ECQA 3WKDA 3GILA 1NJZA 4YMMA 1T3QA 1JX4A 5KFGA 4KLEA 5CRXA 4UBCA 2BPFA 1WYGA 5J0PA 5KFTA 1QSLA 1U4BA 3LWMA 2P6UA 1ZQGA 4UBBA 5DQIA 8ICEA 3PX4A 1UCVA 3JPQA 4O3OA 1IIPA 5KFWA 2P6RA 5ALYA 5J0TA 4EENA 3UPQA 7ICEA 9ICCA 2ZUDA 5DKWA 8ICUA 1WCNA 2D3DA 5J2HA 1Z00B 1GO3F 1OW5A 5KG2A 5F3XB 2Q0ZX 1ZRNA 4YQWA 4RPYA 5KT4A 2WB1C 5EWFA 5ALZA 5BPCA 2YMMA 1X2IA 4J9MA 3RB6A 1ZRMA 4M9GA 4RT3A 2IOFA 1ZQYA 1PK1B 5KT7A 1KFDA 3SQIA 3V72A 1Q3VA 5ALSA 4UB1A 5ALGA 2M9NA 4KX5A 1Q3UA 4UAZA 4XQ8A 4JK1A 1Z4NA 3EYZA 3IM1A 4UB4A 5TISU 3WKBA 2CN1A 3C1YA 4M6WB 4US9A 4M9HA 4DSIA 5KG1A 3PW4A 2ZIVB 3MFHA 1RQLA 4DF8A 8ICIA 2EQYA 5L1KA 1NJWA 1DGSA 4HAIA 1ZQ1C 3QUCA 9ICSA 4O3NA 4PL1A 3ED5A 1B0XA 3N7SC 3AMZA 3V7JA 4DO9A 2KP7A 4DSJA 3SI8A 9ICAA 4LVSA 1KEJA 2AHOB 3WKCA 4QWBA 3EW9A 1KKXA 3D2NA 3TFRA 4AYBC 8ICCA 9ICGA 2E8NA 1ZQWA 7ICKA 4UAWA 3MGIA 4DFJA 2DPIA 3PMLA 2CPRA 2Y0SC 2Y9TA 2NRWA 1N5WA 2UVUA 5GTHU 4IRDA 9ICIA 2KFZA 3AEVA 2J6TA 4QIWF 5KFJA 4IQVA 2JHDA 5CEHA 1JIHA 9ICXA 2KKPA 2UVWA 3K75D 1PUZA 1S5LU 1UHUA 2K8BB 3SMVA 1ZD3A 5KT5A 2K60A 4CGZA 4C7YA 3H40A 4OCZA 4RQMA 4O3PA 2BHNA 3IHQB 3H0RB 1T3NA 2JXJA 4QZAA 2EZZA 3QXGA 2W7OA 3CP8A 2BQUA 1Z4OA 1S8OA 5IIJA 5AM2A 1YT3A 2WFAA 3AL0B 1L8LA 2W7PA 1K1QA 1B4FA 3PSFA 4RPXA 5AM5A 1MSWD 1COKA 9ICLA 1RYSA 4XUSA 3RBDA 1SKWA 1SKSA 4UB8U 2NO5A 3JPSA 1BNOA 2PXIA 4YFKA 5DBAA 2R8KA 2KSOA 2E8PA 3SZ2A 2F76X 5DQGA 2P66A 2KOBA 3NUQA 1B22A 4B9TA 4FZLA 2R8GA 4P0PA 3DEEA 9ICOA 5EE3A 2FPMA 4IL6U 4F5NA 2ES6A 5L1LA 3PX0A 5JUMA 2FJ6A 2ZJ5A 3C2KA 1H38A 1SWWA 5DBBA 1SV4A 4UB2A 4UAUA 1FFUA 4J03A 1RG6A 2FLNA 3L3FX 4GIBA 3NGDA 4CF4A 3E2EA 2KIVA 2ZXHA 3AU6A 4RQ2A 4RQ6A 3NVYA 1JUDA 1PVPA 1L5UA 3RB0A 2RQ5A 4YVZA 4F4YA 8ICTA 1DRGA 5KFFA 3RJHA 1S77D 5HHIA 4I27A 5DG8A 1X9SA 4F2SA 4TQRA 1L7OA 1UT8A 5J2BA 3ICXA 5DLFA 2OWOA 1X6IA 1ZQUA 4I2CA 4GC6A 3C21A 3C5FA 5KFZA 4O3SA 4JV0A 2RDIA 3Q8MA 2XI9A 4QW8A 3MGHA 1SXEA 3AN1A 4R64A 1JN3A 4M04A 1ZQOA 3SD7A 4YR3A 4DLGA 4J9NA 4UW9A 4O3RA 4RUCA 1N62A 5BOLA 4QZGA 2HOQA 1A76A 2WF7A 3GIJA 4NLGA 1V9PA 1XC9A 4RQ1A 4MEXA 5AIAA 2KEYA 7ICHA 1ZQTA 3T3FA 3F5EA 3BQ2A 5AM1A 5DB6A 3EWAA 3SR6A 3LDAA 5EE1A 5J29A 4F4ZA 3C2LA 1N56A 5J2JA 4G9BA 2VA8A 2H3ZA 2ZIUA 1SL0A 4F3OA 5ALOA 5CB1A 4EZ9A 2BCVA 5CA7A 2KK0A 1X9MA 3HW8A 1DXSA 4FO6A 2W54A 1DOQA 4PGQA 3N4MB 5J0QA 4QNLA 4DS4A 2HHQA 2Z7JA 4FZNA 3PR5B 2V4QA 3RAQA 1QQ6A 3IDWA 1SXDA 1UT5A 2HOIA 2LBOA 2LYAA 1ZQEA 4FBTA 2KVSA 4J9OA 2HDOA 1SV0A 8ICFA 2W03A 2FMPA 3VCBA 1NK9A 2F1IA 4C4SA 4ED0A 4ECYA 4J9SA 1ZQSA 1PVRA 2LMRA 3QYPA 3HT3A 4QW9A 4QZFA 3KHGA 2DWQA 4ELTA 4ED7A 4CF3A 2A19A 4F5RA 8ICAA 5KFNA 7ICTA 5KT6A 1ZQNA 3KKAA 3M9NB 4EBEA 2KSOB 2LYHA 2A1JA 2P35A 4IQTA 2E3TA 8ICNA 1A6SA 3WK7A 3PW7A 4ECZA 5ALNA 2DKZA 3LK9A 4P0PB 1HJPA 5AKXA 4TUQA 1NKEA 4KMUA 2ZJ8A 1VJ5A 3TARA 4UB6U 4ELVA 5EE0A 1Z19A 1KRPA 1X66A 4Y2YA 5EWEA 3QEAZ 2HBJA 4O3MA 8ICGA 3D6JA 3EPGA 4PHDA 5J0WA 1D8LA 5HMMA 3KZIU 1QCKA 8ICQA 4IRKA 9ICQA 2DFLA 3MC1A 4UAVA 4UQGA 3TKAA 4F4KA 3G6XA 4Q8FA 2OYYA 1BGXT 2HHTA 4TUSA 3E58A 2K89A 4IC9A 3MR2A 3ZDAA 2NRZA 3OTQA 3H8JA 1COOA 1ZQVA 5AI8A 4XA5A 1ZD4A 1UPHA 2GLEA 1LB2B 1L8OA 5DG7A 4UATA 5IIIA 5KFDA 2VKQA 4MF2A 4GC7A 4KN4A 4MFFA 5DGBA 1ZQAA 2WTFA 5L1JA 3DV9A 4YMNA 8ICVA 2O6KA 5DDMA 4DSFA 2F8KA 2W9BA 2QB0A 2XICA 5AKZA 4DL6A 2HHSA 4DSLA 4DL5A 1NNLA 2ZIUB 4Z6FA 2ZUBA 4Y2TA 1KBUA 1MC8A 2JV3A 2MRLA 3H0LB 3BJYA 5F9LA 1NKCA 5J2CA 5J0XA 2RHFA 4F71A 4X5VA 2XY6A 4NM1A 2E8OA 4LZGA 1N2XA 3O0FA 3ZDCA 5AKYA 7ICSA 2ATLA 4R8UA 2AGQA 4R63A 1ZQDA 1M6YA 3V7LA 3QU5A 5D4BA 3RR8A 3NRWA 3BQ1A 4I2AA 1ZD5A 2KKVA 4YP3A 3RRGA 2PI5A 5JTIA 4ECRA 1F0MA 3UQ0A 5AKHA 3NVZA 4FFDA 2VA3A 5AK3A 2HHXA 4ECUA 4CE6A 3UMCA 4B9LA 1U49A 1Y88A 1ZQPA 2JEGA 4F5QA 5KFHA 4QZ8A 5KFCA 1J2MA 5L1IA 4TURA 3C5GA 2BKEA 2DQNB 5ALVA 3PSTA 8ICXA 3FM9A 3M7DA 1J2NA 2A1JB 3NASA 2YMPA 2XVTA 4NV0A 4RT2A 3PNCA 9ICBA 4C0ZA 4DQQA 4YXMA 2EDUA 4I29A 2KE7A 1BPBA 3ZI4A 2FE9A 4OJOA 4YN4A 2YMQA 5C5JA 3B0XA 1XO1A 4TQSA 1SL2A 4Y2JA 5DG9A 4EYIB 4FS1A 5AKIA 1Q46A 1RM6C 2KZZA 4F5PA 9ICTA 4GXKA 1HEKA 2B6GA 3OGUA 3TI0A 3GV5B 2HCFA 4J9LA 4C8KA 1HUZA 4ED8A 3HRDD 3V6JA 5ALWA 2DBYA 1V38A 3H4BA 1T7PA 1U47A 3BS5A 5J0OA 2H3IA 1L3VA 3QUQA 1ZQRA 1ZQZA 3Q8QB 4US8A 5IINA 1KTQA 1BVSA 5HMLA 3MR3A 2BZFA 2JZBA 4P0QA 3MDCA 3IG8A 5L1MA 3Q8KA 1WWUA 1AQ6A 1MN8A 2JEJA 3AM9A 3UXOA 2XCPA 2RLTA 5ALMA 8ICSA 2MSNA 4KLJA 1JXEA 2G09A 3BZKA 2BCUA 4DQSA 4M0AA 1CEZA 2QLTA 4K4GA 3FAHA 5JRTA 3H4DA 4EEYA 4DSEA 1RYRA 2C2DA 3QZ8A 1ZQMA 4NL9A 1SV0C 5L9XA 2DUYA 3L5KA 1SL1A 2HHVA 2DKXA 3KHLA 1WG8A 5J2AA 4BDPA 4CCHA 4DL7A 1F5SA 2QB1A 4YD2A 4DL3A 4PGYA 5KFMA 4RPZA 5AKGA 2W9BB 2IMWP 3HKZC 2BQ3A 1LV5A 3QZ7A 1QQ5A 2QB0B 3JPOA 2FDRA 4OJ6A 1N61A 2LPEA 2I1QA 4Y2PA 4GLXA 3SAHA 2D8CA 1YZ6A 3KKAC 3V6KA 1BPZA 7ICJA 2ASJA 8ICHA 2Y1IA 2KZMA 2BCRA 5KL1B 1IM4A 2KJ9A 4DS5A 3WK6A 4O5EA 7ICRA 1QH9A 1XS9D 4R8UB 4ZH4A 1D9FA 3I76A 5J8YA 1U45A 1V97A 8ICZA 8ICYA 1F44A 4RUAA 1NK0A 2EZXA 2W9MA 1ZD2P 3H8WA 2H3FA 5IIOA 5KFRA 2W55A 1L7NA 1S0VA 2G06A 3JPTA 4IRCA 2WAQC 2CXYA 4TUPA 2KJ5A 4P4MA 2PMZF 2E5SA 2BPCA 3MABA 4NLNA 1D9DA 1ZQCA 4NLZA 2EAOA 3RR7A 3KOOA 1TAUA 4BWJA 1NKBA 3IRUA 1YZ7A 3T5LA 4G3IA 2MA1A 2R8JA 2G07A 4Z6CA 4QZ9A 1JRPA 4O5CA 1NK7A 2GO7A 3ETRA 4C8LA 2GH1A 1L6NA 2EANA 3ORYA 4EX7A 2OHFA 3GIIA 3VC8A 4PHPA 4KLSA 4C8MA 2BDUA 3FYHA 2Y1JA 3C29A 3RAXA 2BPGA 2JMGA 1XSNA 1UA0A 2YB4A 5AI9A 2XCAA 2E8MA 3M1YA 3BS5B 3WK5A 1URJA 2H3QA 2FI1A 3T5JA 1T94A 4IQWA 4DFKA 3GU3A 4PZNA 5FP0A 3PR4A 2NRXA 5G5HA 3KFUF 4QZDA 4PPXA 2H3VA 3ISDA 4QZEA 2JZBB 3WKAA 4P0QB 3NS1A 1S10A 2ZJAA 5KFBA 3Q8RB 2ASLA 1CI4A 3V7KA 4ACOA 3HILA 4Q43A 5CP2A 3UMGA 1LKYA 2KHQA 3THVA 3G6VA 2W43A 3KZXA 3KHRA 3RJGA 3RJEA 2ZIWA 4F50A 4ZOHC 4KLIA 2Y9UA 2FPLA 5KFAA 4NLCA 2HSZA 4E0DA 5CWRA 2FMQA 1L7MA 2HHWA 2G08A 2YB1A 5J2IA 3RH5A 1KDHA
chains in the Genus database with same CATH topology
2QKQA 2QARB 1SV4A 2E8NA 1RG6A 4NJ8A 4IS7A 2DL0A 1WWVA 2YTUA 1UCVA 2KG5A 2KIVA 5KNIA 5JRTA 1JI7A 4NL9C 1X9XA 3IDWA 1SXDA 2Y9TA 2L5YA 4NL9A 1SV0C 3TADC 2DKXA 1SV0A 2EANA 3H8MA 2D3DA 3K1RB 2K4PA 3BQ7A 1OW5A 2QARA 3SENA 1SGGA 5F3XB 1UQVA 2QB1A 2GLEA 1PK3A 2QB0B 2KE7A 2LMRA 2FE9A 2LPEA 2K60A 2F3NA 2E8MA 3BS5B 4RQNA 2D8CA 4RQMA 1LKYB 1PK1B 3KKAC 2EAPA 4PZNA 3TADA 1SXEA 3KKAA 2KSOB 2B6GA 3SEIA 5J8YC 2F8KA 2QB0A 4PZOA 2EAMA 5J8YA 1X40A 1B4FA 2DKZA 1V38A 2JV3A 3BS5A 3BS7A 3HILA 1COKA 1Z1VA 1KW4A 2ESEA 1LKYA 1PK1A 1OXJA 4MHVA 2E8OA 2F44A 2KSOA 2E8PA 1X66A 3TACB 2Y9UA 1V85A 1B0XA 2KMDA 5L1MA 5JU5A 1WWUA 2EAOA 2ES6A 5JTIA 1F0MA 1DXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKQ A;  2QAR B;  1SV4 A;  2E8N A;  1RG6 A;  4NJ8 A;  4IS7 A;  2DL0 A;  1WWV A;  2YTU A;  1UCV A;  2KG5 A;  2KIV A;  5KNI A;  5JRT A;  1JI7 A;  4NL9 C;  1X9X A;  3IDW A;  1SXD A;  2Y9T A;  2L5Y A;  4NL9 A;  1SV0 C;  3TAD C;  2DKX A;  1SV0 A;  2EAN A;  3H8M A;  2D3D A;  3K1R B;  2K4P A;  3BQ7 A;  1OW5 A;  2QAR A;  3SEN A;  1SGG A;  5F3X B;  1UQV A;  2QB1 A;  2GLE A;  1PK3 A;  2QB0 B;  2KE7 A;  2LMR A;  2FE9 A;  2LPE A;  2K60 A;  2F3N A;  2E8M A;  3BS5 B;  4RQN A;  2D8C A;  4RQM A;  1LKY B;  1PK1 B;  3KKA C;  2EAP A;  4PZN A;  3TAD A;  1SXE A;  3KKA A;  2KSO B;  2B6G A;  3SEI A;  5J8Y C;  2F8K A;  2QB0 A;  4PZO A;  2EAM A;  5J8Y A;  1X40 A;  1B4F A;  2DKZ A;  1V38 A;  2JV3 A;  3BS5 A;  3BS7 A;  3HIL A;  1COK A;  1Z1V A;  1KW4 A;  2ESE A;  1LKY A;  1PK1 A;  1OXJ A;  4MHV A;  2E8O A;  2F44 A;  2KSO A;  2E8P A;  1X66 A;  3TAC B;  2Y9U A;  1V85 A;  1B0X A;  2KMD A;  5L1M A;  5JU5 A;  1WWU A;  2EAO A;  2ES6 A;  5JTI A;  1F0M A;  1DXS A; 
#chains in the Genus database with same CATH topology
 4F5O A;  4I2I A;  9ICE A;  8ICK A;  3GV8 B;  1S0O A;  3FDS A;  4OJ5 A;  5AI6 A;  2JR5 A;  3RJI A;  4EZ6 A;  5KT3 A;  1D8Y A;  3V6H A;  3OJU A;  1T4G A;  5DDY A;  1NJX A;  2HBK A;  2DF4 B;  1O08 A;  2HMX A;  3TAD C;  3M6Z A;  1ZET A;  1RPL A;  1ZJN A;  2W9C A;  1UA1 A;  4R65 A;  5KG5 A;  4PHE A;  2J6U A;  3QUT A;  2AJQ A;  1TV9 A;  4QJF B;  2BR0 A;  3BQ0 A;  1XSL A;  3GFK B;  1TE2 A;  3TFS A;  3LVV A;  1QSS A;  3CRX A;  9ICU A;  4DFM A;  5EE9 A;  2N1R A;  1TFR A;  3PSI A;  2IBK A;  2W11 A;  3ZD8 A;  4KIT B;  2AQ4 A;  4RNN A;  5HNK A;  5KL8 B;  4Y2S A;  3CW2 C;  4QIW C;  3KHH A;  4EBC A;  1BPD A;  3PO4 A;  4DFP A;  3Q8L A;  2IOF K;  3OJS A;  1KSP A;  5AK6 A;  3RTV A;  1WUD A;  1MA7 A;  4YR2 A;  4B9M A;  2WHE A;  5KFU A;  2WF9 A;  2HI0 A;  1TAQ A;  3A0B U;  2GOL A;  2UVV A;  1SZP A;  4ED3 A;  1NK8 A;  1JAL A;  1NI3 A;  1B43 A;  2FMS A;  1Q8K A;  3LVW A;  2KIW A;  7ICP A;  2KVC A;  5KFO A;  3WU2 U;  4KLH A;  1EXN A;  1KFT A;  1S9F A;  1N60 A;  9ICF A;  2F2A B;  2NYV A;  3F5A A;  4Y2X A;  2V9W A;  2LHT A;  5ALD A;  3AQE A;  5IIK A;  5KFX A;  2WB1 F;  5ALH A;  4YG2 A;  4IS7 A;  5J2E A;  4FBU A;  1WWV A;  4M47 A;  9ICN A;  1N63 A;  1ED1 A;  2NRV A;  5AI0 A;  5ALI A;  3EZ5 A;  4NL9 C;  4F93 B;  1SIJ A;  4KLG A;  3RBE A;  3WKE A;  1IG6 A;  2ZG6 A;  2ISO A;  4F72 A;  4DL4 A;  1FO4 A;  2NRT A;  2KD1 A;  3SEN A;  2W3R A;  4DSK A;  3MFI A;  3GDX A;  4IR9 A;  2ASD A;  4ECS A;  2ZUC A;  3RFA A;  3F2B A;  5TZV A;  3TAN A;  3PY8 A;  4EBD A;  1RZT A;  5IIL A;  2OEH A;  3B9J A;  1LKY B;  4BXO A;  2R18 A;  1BPE A;  4M2Y A;  3OPX A;  3ISB A;  2MAX A;  2ZIW B;  5J8Y C;  2ZTC A;  3KD3 A;  5BOM A;  3HJE A;  3QNM A;  5KG0 A;  5EOZ A;  1PVQ A;  5ALE A;  9ICW A;  2F8L A;  4MFC A;  3BS7 A;  3RJK A;  1XNS A;  4AYB F;  7ICF A;  2B0C A;  2WF6 A;  1SWV A;  4EEK A;  2HHU A;  2W3S A;  3CNH A;  4FZM A;  4F4W A;  3SYZ A;  5ALT A;  4USA A;  4B6J A;  5AI5 A;  4QZC A;  2Y0S F;  1P7D A;  1TKD A;  1J97 A;  2XID A;  1A77 A;  2OXO A;  1ZOL A;  1T8E A;  3GV7 B;  1SB3 C;  2W9C B;  5ALL A;  3PZP A;  4J9P A;  4RZR A;  4DF4 A;  3RJF A;  4DQR A;  3PW0 A;  5DGA A;  2AGO A;  3NVW A;  2E1E A;  5ALF A;  5KFQ A;  2A3V A;  4KLM A;  4P4O A;  3HPO A;  2BCS A;  2AQ0 A;  2H5X A;  3F53 A;  1JI7 A;  2R8H A;  3QU4 A;  4ED6 A;  1TVA A;  4BGD A;  3FC4 A;  1ECW A;  2WAQ F;  4ECX A;  2E1F A;  3K1R B;  1KQQ A;  1SKR A;  2XY7 A;  5KG7 A;  7ICQ A;  1S0N A;  4KTQ A;  1UQV A;  5HHH A;  4QWC A;  4I28 A;  2XC9 A;  4UAS A;  4EEL A;  2XGP A;  2ISP A;  2VA2 A;  3UQ2 A;  3N7R C;  3ZD9 A;  4KLF A;  5AK4 A;  1FFV A;  1RXW A;  5DB7 A;  3JPP A;  1TK0 A;  3TAP A;  1RDF A;  4MFA A;  3H7I A;  3TAD A;  1NZB A;  4K4H A;  4UAY A;  3JPN A;  2C2E A;  4I2F A;  2JEF A;  3A0H U;  3I28 A;  3GIK A;  1QLN A;  1K1S A;  3J81 j;  2HBM A;  4R66 A;  1JXL A;  4ECT A;  1ZQB A;  1BNP A;  2RRD A;  5T14 A;  2W9A A;  1X6J A;  2W8K A;  1JRO A;  2OCE A;  3K1Z A;  5AKL A;  2BDP A;  3PX6 A;  3HP6 A;  2A1A A;  2F77 X;  7ICO A;  5J2G A;  1V85 A;  3Q8P B;  3PW5 A;  2KMD A;  4PH5 A;  4RQ7 A;  4PJ0 U;  2V4R A;  2ZIX A;  3ALR A;  2NO4 A;  2WF8 A;  4OJP A;  4ECW A;  3HX0 A;  5K4L A;  2AGP A;  1U48 A;  3C28 A;  5B5E U;  4J9Q A;  4M9L A;  4C4T A;  3RRH A;  4C80 A;  4QWA A;  5KG6 A;  4JV1 A;  2LKY A;  5AIC A;  4BWM A;  1DK2 A;  5KFV A;  1XO0 A;  2DL0 A;  3MBY A;  4BX9 C;  4JV2 A;  3IG5 A;  8ICB A;  5AKK A;  2PI4 A;  3PMN A;  3D2S A;  3RB3 A;  5ALU A;  3ETL A;  4UB3 A;  2YQE A;  1RQN A;  5AIB A;  4BXO B;  3QEB Z;  4KX3 A;  1FEZ A;  3M6K A;  4KN7 A;  4QWE A;  4DFD A;  1QTM A;  3QX7 A;  9ICH A;  4A8E A;  4KLT A;  4KLU A;  5KFY A;  2KHV A;  7ICU A;  1NK4 A;  1D8B A;  1QQ7 A;  2ODG A;  4GXI A;  3KTQ A;  3NTU A;  1A0P A;  3SEI A;  5B66 U;  2GWS A;  4Y2R A;  2MUT A;  3F2D A;  3RF9 A;  2G5H B;  4M9N A;  3CYM A;  2JEI A;  2XO7 A;  1NJY A;  1Z1V A;  5KAI U;  2ESE A;  2VAN A;  4Y2Q A;  2CRX A;  2PFP A;  2J6S A;  5AKE A;  2F44 A;  3KBB A;  1MQ3 A;  3SAG A;  3N28 A;  4KLQ A;  4BJQ A;  2PFQ A;  2HOF A;  8ICW A;  4AP9 A;  2JH7 A;  5JU5 A;  1S76 D;  1NOM A;  1PZN A;  3GQC A;  5KFI A;  3PVX A;  2FLL A;  1KL9 A;  1ZYQ A;  2B21 A;  3L4P A;  5AM0 A;  3QU2 A;  2AH5 A;  2MU2 A;  4I2G A;  3I1Y A;  5KTQ A;  2K4H A;  3UMB A;  5E79 U;  3NRZ A;  3F2C A;  1RYU A;  3OHB A;  1CRX A;  2LM1 A;  2VJ4 A;  4Y2V A;  5KFK A;  8ICP A;  5GTI U;  3PV8 A;  4DOB A;  4F92 B;  1JMS A;  9ICM A;  4WJ3 B;  4ED1 A;  3IP4 B;  4RQ0 A;  4NLB A;  2UVR A;  2QAR A;  1SGG A;  2I6X A;  3OHA A;  4I2H A;  4CNQ A;  3MR6 A;  1Z1B A;  4RQ4 A;  4DOC A;  4F2R A;  2JH1 A;  2BGW A;  1CUK A;  4B9N A;  3GIM A;  5AI4 A;  4RQN A;  3TAQ A;  4DEZ A;  5CHG A;  1DK3 A;  4JWN A;  2KIC A;  5ALX A;  5AHX A;  4YD1 A;  5J2D A;  1O03 A;  7ICL A;  4RU9 A;  1KLN A;  3UM9 A;  4KMO B;  4DWI A;  2YY6 A;  4PZO A;  2EAM A;  2KJ8 A;  4DCC A;  2XGQ A;  2ZIX B;  2ZTD A;  4Q8E A;  4DL2 A;  2VJ5 A;  4B9V A;  4I2J A;  5AKJ A;  1OXJ A;  4MHV A;  4F91 B;  5ALK A;  1HUO A;  7ICV A;  3RB4 A;  5HR6 A;  2I9G A;  1XWL A;  3ONN A;  4EX6 A;  1SZH A;  5G5G A;  3B0Y A;  5F9N A;  4IR1 A;  4FS2 A;  1NK6 A;  4RNO A;  4PHA A;  4RQ5 A;  3N97 B;  4LJX A;  2XY5 A;  2KTQ A;  4QWD A;  3ZDB A;  4U7C A;  4U6P A;  4CF5 A;  1NK5 A;  1XSP A;  4QZB A;  4HYK A;  2M0N A;  1N5X A;  3GZF A;  8ICM A;  4UB5 A;  3WK8 A;  3MR5 A;  4CDG A;  3T5H A;  4NJ8 A;  1ZQH A;  7ICI A;  4B9U A;  7ICG A;  4ECV A;  2IOH A;  5KAF U;  2JRZ A;  4YR0 A;  5J0S A;  1KN5 A;  1L3U A;  1X9X A;  1DGJ A;  2G5I B;  4DLE A;  2ZTE A;  2YN4 A;  4KLL A;  8ICO A;  3PO5 A;  2KV2 A;  5D49 A;  3MDA A;  2KNJ A;  3E0F A;  4CRX A;  4J9R A;  2PFO A;  3BQ7 A;  4C4R A;  4EYH B;  4ICA A;  1C20 A;  1K5O A;  4I2B A;  1PK3 A;  4QZH A;  2MUT B;  2WF5 A;  5AM3 A;  4I2E A;  4O5K A;  4GXJ A;  3TQ1 A;  1ZQF A;  5KG4 A;  8ICJ A;  1BPX A;  3SAF A;  1C7Y A;  2EAP A;  4DQP A;  4JWM A;  2YML A;  4MF8 A;  1NZP A;  3ZDE A;  4FE3 A;  1TK8 A;  2KN7 A;  3T5K A;  2EH9 A;  2EZY A;  1QSY A;  5DQH A;  1Z3E B;  4Y2U A;  1KFS A;  1WCL A;  2ZXI A;  5J0U A;  1X40 A;  1ZJM A;  3M8S A;  9ICK A;  9ICV A;  5EWG A;  5KFL A;  3QU9 A;  3LYS A;  4RQ8 A;  4GFJ A;  3JPR A;  1ZQI A;  1KW4 A;  2C28 A;  5C0Y A;  4Z6E A;  4BUG A;  1TK5 A;  4Q45 A;  2LYB A;  1ZQL A;  2OM6 A;  1VLB A;  3U26 A;  4O9M A;  4YXJ A;  4P2H A;  1N48 A;  3D2Q A;  5HP4 A;  3H0M B;  1FIQ A;  2LM4 A;  2FPK A;  2HVH A;  3RJJ A;  3M9O B;  2HW3 A;  2LI6 A;  2QAR B;  3C1Z A;  2AU0 A;  5ALR A;  3BZC A;  1ZQJ A;  2PMZ C;  3SV3 A;  2KG5 A;  5KNI A;  4KLD A;  3RH4 A;  1ZQQ A;  4OJL A;  4OD0 A;  4DQI A;  3NVV A;  4PGX A;  1X9W A;  4Q44 A;  3HWT A;  2PFN A;  2DPJ A;  2I5H A;  2K4P A;  3AQF A;  5ALQ A;  2G0A A;  3OSP A;  4ELU A;  9ICP A;  3AU2 A;  4C8O A;  4OO1 J;  2W04 A;  4IQU A;  3AUO A;  1RXV A;  2K4E A;  4RNM A;  5ALJ A;  4PL2 A;  4B9S A;  4DOA A;  3S6J A;  4UAR A;  3PW2 A;  2K8C B;  5KFP A;  1S97 A;  1Z00 A;  4F8R A;  5IIM A;  4O0I A;  4P4P A;  2IHN A;  3QUB A;  3ISC A;  1MQ2 A;  1L3S A;  1S0M A;  1ZQX A;  3K4G A;  5CJ7 A;  5ALP A;  3G6Y A;  2RDJ A;  2KZ3 A;  1HIW A;  1PK1 A;  3LWL A;  3IN5 A;  4JB3 A;  2C22 A;  3WK9 A;  1OUQ A;  2RP5 A;  2IA6 A;  1L3T A;  4XRH A;  1IXR A;  5J0R A;  3C23 A;  3WK4 A;  5KT2 A;  3PSP A;  3DDH A;  3EUB 2;  5A0L A;  4M6W A;  4K4I A;  1TAM A;  4O3Q A;  1VDV A;  4M9J A;  4KLO A;  2QKQ A;  2ZIV A;  3BDP A;  2KFN A;  3H8S A;  4NWI A;  2AXT U;  2VIX A;  3HKZ F;  4NM2 A;  5KG3 A;  1ARO P;  2YX8 A;  1BPY A;  2YTU A;  7ICN A;  2JGA A;  4YCX A;  1ZXI A;  3IV6 A;  2HBL A;  1ZQK A;  4NLK A;  2L5Y A;  4Z6D A;  4YMO A;  1IV8 A;  2PKE A;  4JUZ A;  4F4X A;  2K4I A;  3H8M A;  1XU4 A;  2ALZ A;  5DB8 A;  4QZI A;  2IHM A;  3R9K A;  4NXZ A;  1U9L A;  2R8I A;  3ZDD A;  5DBC A;  1LVH A;  3MGV A;  2FLP A;  7ICM A;  5J2F A;  2F3N A;  1X42 A;  5D46 A;  2OH2 A;  4C8N A;  9ICR A;  3QU7 A;  1L7P A;  3UXP A;  2D6F C;  4RQ3 A;  9ICJ A;  3M8R A;  5J0Y A;  4J9K A;  8ICR A;  2BQR A;  4ED2 A;  4C7Z A;  5AK5 A;  2DGZ A;  2W8L A;  3BQT A;  3T79 A;  5H2F U;  4MEY A;  4I2D A;  3C2M A;  5DLG A;  3Q8S B;  3SV4 A;  3UXN A;  2F1H A;  5J2K A;  2HVI A;  2BCQ A;  3OSN A;  4JMU A;  2K8A A;  3QE9 Y;  5HR7 A;  2C2R A;  3M9M B;  5AM4 A;  4LZD A;  3TAC B;  5KFS A;  4NY8 A;  2NV3 A;  5CR0 A;  2Q4T A;  5DB9 A;  5KFE A;  3RH6 A;  3EPI A;  3N7P D;  8ICL A;  2F1J A;  4ECQ A;  3WKD A;  3GIL A;  1NJZ A;  4YMM A;  1T3Q A;  1JX4 A;  5KFG A;  4KLE A;  5CRX A;  4UBC A;  2BPF A;  1WYG A;  5J0P A;  5KFT A;  1QSL A;  1U4B A;  3LWM A;  2P6U A;  1ZQG A;  4UBB A;  5DQI A;  8ICE A;  3PX4 A;  1UCV A;  3JPQ A;  4O3O A;  1IIP A;  5KFW A;  2P6R A;  5ALY A;  5J0T A;  4EEN A;  3UPQ A;  7ICE A;  9ICC A;  2ZUD A;  5DKW A;  8ICU A;  1WCN A;  2D3D A;  5J2H A;  1Z00 B;  1GO3 F;  1OW5 A;  5KG2 A;  5F3X B;  2Q0Z X;  1ZRN A;  4YQW A;  4RPY A;  5KT4 A;  2WB1 C;  5EWF A;  5ALZ A;  5BPC A;  2YMM A;  1X2I A;  4J9M A;  3RB6 A;  1ZRM A;  4M9G A;  4RT3 A;  2IOF A;  1ZQY A;  1PK1 B;  5KT7 A;  1KFD A;  3SQI A;  3V72 A;  1Q3V A;  5ALS A;  4UB1 A;  5ALG A;  2M9N A;  4KX5 A;  1Q3U A;  4UAZ A;  4XQ8 A;  4JK1 A;  1Z4N A;  3EYZ A;  3IM1 A;  4UB4 A;  5TIS U;  3WKB A;  2CN1 A;  3C1Y A;  4M6W B;  4US9 A;  4M9H A;  4DSI A;  5KG1 A;  3PW4 A;  2ZIV B;  3MFH A;  1RQL A;  4DF8 A;  8ICI A;  2EQY A;  5L1K A;  1NJW A;  1DGS A;  4HAI A;  1ZQ1 C;  3QUC A;  9ICS A;  4O3N A;  4PL1 A;  3ED5 A;  1B0X A;  3N7S C;  3AMZ A;  3V7J A;  4DO9 A;  2KP7 A;  4DSJ A;  3SI8 A;  9ICA A;  4LVS A;  1KEJ A;  2AHO B;  3WKC A;  4QWB A;  3EW9 A;  1KKX A;  3D2N A;  3TFR A;  4AYB C;  8ICC A;  9ICG A;  2E8N A;  1ZQW A;  7ICK A;  4UAW A;  3MGI A;  4DFJ A;  2DPI A;  3PML A;  2CPR A;  2Y0S C;  2Y9T A;  2NRW A;  1N5W A;  2UVU A;  5GTH U;  4IRD A;  9ICI A;  2KFZ A;  3AEV A;  2J6T A;  4QIW F;  5KFJ A;  4IQV A;  2JHD A;  5CEH A;  1JIH A;  9ICX A;  2KKP A;  2UVW A;  3K75 D;  1PUZ A;  1S5L U;  1UHU A;  2K8B B;  3SMV A;  1ZD3 A;  5KT5 A;  2K60 A;  4CGZ A;  4C7Y A;  3H40 A;  4OCZ A;  4RQM A;  4O3P A;  2BHN A;  3IHQ B;  3H0R B;  1T3N A;  2JXJ A;  4QZA A;  2EZZ A;  3QXG A;  2W7O A;  3CP8 A;  2BQU A;  1Z4O A;  1S8O A;  5IIJ A;  5AM2 A;  1YT3 A;  2WFA A;  3AL0 B;  1L8L A;  2W7P A;  1K1Q A;  1B4F A;  3PSF A;  4RPX A;  5AM5 A;  1MSW D;  1COK A;  9ICL A;  1RYS A;  4XUS A;  3RBD A;  1SKW A;  1SKS A;  4UB8 U;  2NO5 A;  3JPS A;  1BNO A;  2PXI A;  4YFK A;  5DBA A;  2R8K A;  2KSO A;  2E8P A;  3SZ2 A;  2F76 X;  5DQG A;  2P66 A;  2KOB A;  3NUQ A;  1B22 A;  4B9T A;  4FZL A;  2R8G A;  4P0P A;  3DEE A;  9ICO A;  5EE3 A;  2FPM A;  4IL6 U;  4F5N A;  2ES6 A;  5L1L A;  3PX0 A;  5JUM A;  2FJ6 A;  2ZJ5 A;  3C2K A;  1H38 A;  1SWW A;  5DBB A;  1SV4 A;  4UB2 A;  4UAU A;  1FFU A;  4J03 A;  1RG6 A;  2FLN A;  3L3F X;  4GIB A;  3NGD A;  4CF4 A;  3E2E A;  2KIV A;  2ZXH A;  3AU6 A;  4RQ2 A;  4RQ6 A;  3NVY A;  1JUD A;  1PVP A;  1L5U A;  3RB0 A;  2RQ5 A;  4YVZ A;  4F4Y A;  8ICT A;  1DRG A;  5KFF A;  3RJH A;  1S77 D;  5HHI A;  4I27 A;  5DG8 A;  1X9S A;  4F2S A;  4TQR A;  1L7O A;  1UT8 A;  5J2B A;  3ICX A;  5DLF A;  2OWO A;  1X6I A;  1ZQU A;  4I2C A;  4GC6 A;  3C21 A;  3C5F A;  5KFZ A;  4O3S A;  4JV0 A;  2RDI A;  3Q8M A;  2XI9 A;  4QW8 A;  3MGH A;  1SXE A;  3AN1 A;  4R64 A;  1JN3 A;  4M04 A;  1ZQO A;  3SD7 A;  4YR3 A;  4DLG A;  4J9N A;  4UW9 A;  4O3R A;  4RUC A;  1N62 A;  5BOL A;  4QZG A;  2HOQ A;  1A76 A;  2WF7 A;  3GIJ A;  4NLG A;  1V9P A;  1XC9 A;  4RQ1 A;  4MEX A;  5AIA A;  2KEY A;  7ICH A;  1ZQT A;  3T3F A;  3F5E A;  3BQ2 A;  5AM1 A;  5DB6 A;  3EWA A;  3SR6 A;  3LDA A;  5EE1 A;  5J29 A;  4F4Z A;  3C2L A;  1N56 A;  5J2J A;  4G9B A;  2VA8 A;  2H3Z A;  2ZIU A;  1SL0 A;  4F3O A;  5ALO A;  5CB1 A;  4EZ9 A;  2BCV A;  5CA7 A;  2KK0 A;  1X9M A;  3HW8 A;  1DXS A;  4FO6 A;  2W54 A;  1DOQ A;  4PGQ A;  3N4M B;  5J0Q A;  4QNL A;  4DS4 A;  2HHQ A;  2Z7J A;  4FZN A;  3PR5 B;  2V4Q A;  3RAQ A;  1QQ6 A;  3IDW A;  1SXD A;  1UT5 A;  2HOI A;  2LBO A;  2LYA A;  1ZQE A;  4FBT A;  2KVS A;  4J9O A;  2HDO A;  1SV0 A;  8ICF A;  2W03 A;  2FMP A;  3VCB A;  1NK9 A;  2F1I A;  4C4S A;  4ED0 A;  4ECY A;  4J9S A;  1ZQS A;  1PVR A;  2LMR A;  3QYP A;  3HT3 A;  4QW9 A;  4QZF A;  3KHG A;  2DWQ A;  4ELT A;  4ED7 A;  4CF3 A;  2A19 A;  4F5R A;  8ICA A;  5KFN A;  7ICT A;  5KT6 A;  1ZQN A;  3KKA A;  3M9N B;  4EBE A;  2KSO B;  2LYH A;  2A1J A;  2P35 A;  4IQT A;  2E3T A;  8ICN A;  1A6S A;  3WK7 A;  3PW7 A;  4ECZ A;  5ALN A;  2DKZ A;  3LK9 A;  4P0P B;  1HJP A;  5AKX A;  4TUQ A;  1NKE A;  4KMU A;  2ZJ8 A;  1VJ5 A;  3TAR A;  4UB6 U;  4ELV A;  5EE0 A;  1Z19 A;  1KRP A;  1X66 A;  4Y2Y A;  5EWE A;  3QEA Z;  2HBJ A;  4O3M A;  8ICG A;  3D6J A;  3EPG A;  4PHD A;  5J0W A;  1D8L A;  5HMM A;  3KZI U;  1QCK A;  8ICQ A;  4IRK A;  9ICQ A;  2DFL A;  3MC1 A;  4UAV A;  4UQG A;  3TKA A;  4F4K A;  3G6X A;  4Q8F A;  2OYY A;  1BGX T;  2HHT A;  4TUS A;  3E58 A;  2K89 A;  4IC9 A;  3MR2 A;  3ZDA A;  2NRZ A;  3OTQ A;  3H8J A;  1COO A;  1ZQV A;  5AI8 A;  4XA5 A;  1ZD4 A;  1UPH A;  2GLE A;  1LB2 B;  1L8O A;  5DG7 A;  4UAT A;  5III A;  5KFD A;  2VKQ A;  4MF2 A;  4GC7 A;  4KN4 A;  4MFF A;  5DGB A;  1ZQA A;  2WTF A;  5L1J A;  3DV9 A;  4YMN A;  8ICV A;  2O6K A;  5DDM A;  4DSF A;  2F8K A;  2W9B A;  2QB0 A;  2XIC A;  5AKZ A;  4DL6 A;  2HHS A;  4DSL A;  4DL5 A;  1NNL A;  2ZIU B;  4Z6F A;  2ZUB A;  4Y2T A;  1KBU A;  1MC8 A;  2JV3 A;  2MRL A;  3H0L B;  3BJY A;  5F9L A;  1NKC A;  5J2C A;  5J0X A;  2RHF A;  4F71 A;  4X5V A;  2XY6 A;  4NM1 A;  2E8O A;  4LZG A;  1N2X A;  3O0F A;  3ZDC A;  5AKY A;  7ICS A;  2ATL A;  4R8U A;  2AGQ A;  4R63 A;  1ZQD A;  1M6Y A;  3V7L A;  3QU5 A;  5D4B A;  3RR8 A;  3NRW A;  3BQ1 A;  4I2A A;  1ZD5 A;  2KKV A;  4YP3 A;  3RRG A;  2PI5 A;  5JTI A;  4ECR A;  1F0M A;  3UQ0 A;  5AKH A;  3NVZ A;  4FFD A;  2VA3 A;  5AK3 A;  2HHX A;  4ECU A;  4CE6 A;  3UMC A;  4B9L A;  1U49 A;  1Y88 A;  1ZQP A;  2JEG A;  4F5Q A;  5KFH A;  4QZ8 A;  5KFC A;  1J2M A;  5L1I A;  4TUR A;  3C5G A;  2BKE A;  2DQN B;  5ALV A;  3PST A;  8ICX A;  3FM9 A;  3M7D A;  1J2N A;  2A1J B;  3NAS A;  2YMP A;  2XVT A;  4NV0 A;  4RT2 A;  3PNC A;  9ICB A;  4C0Z A;  4DQQ A;  4YXM A;  2EDU A;  4I29 A;  2KE7 A;  1BPB A;  3ZI4 A;  2FE9 A;  4OJO A;  4YN4 A;  2YMQ A;  5C5J A;  3B0X A;  1XO1 A;  4TQS A;  1SL2 A;  4Y2J A;  5DG9 A;  4EYI B;  4FS1 A;  5AKI A;  1Q46 A;  1RM6 C;  2KZZ A;  4F5P A;  9ICT A;  4GXK A;  1HEK A;  2B6G A;  3OGU A;  3TI0 A;  3GV5 B;  2HCF A;  4J9L A;  4C8K A;  1HUZ A;  4ED8 A;  3HRD D;  3V6J A;  5ALW A;  2DBY A;  1V38 A;  3H4B A;  1T7P A;  1U47 A;  3BS5 A;  5J0O A;  2H3I A;  1L3V A;  3QUQ A;  1ZQR A;  1ZQZ A;  3Q8Q B;  4US8 A;  5IIN A;  1KTQ A;  1BVS A;  5HML A;  3MR3 A;  2BZF A;  2JZB A;  4P0Q A;  3MDC A;  3IG8 A;  5L1M A;  3Q8K A;  1WWU A;  1AQ6 A;  1MN8 A;  2JEJ A;  3AM9 A;  3UXO A;  2XCP A;  2RLT A;  5ALM A;  8ICS A;  2MSN A;  4KLJ A;  1JXE A;  2G09 A;  3BZK A;  2BCU A;  4DQS A;  4M0A A;  1CEZ A;  2QLT A;  4K4G A;  3FAH A;  5JRT A;  3H4D A;  4EEY A;  4DSE A;  1RYR A;  2C2D A;  3QZ8 A;  1ZQM A;  4NL9 A;  1SV0 C;  5L9X A;  2DUY A;  3L5K A;  1SL1 A;  2HHV A;  2DKX A;  3KHL A;  1WG8 A;  5J2A A;  4BDP A;  4CCH A;  4DL7 A;  1F5S A;  2QB1 A;  4YD2 A;  4DL3 A;  4PGY A;  5KFM A;  4RPZ A;  5AKG A;  2W9B B;  2IMW P;  3HKZ C;  2BQ3 A;  1LV5 A;  3QZ7 A;  1QQ5 A;  2QB0 B;  3JPO A;  2FDR A;  4OJ6 A;  1N61 A;  2LPE A;  2I1Q A;  4Y2P A;  4GLX A;  3SAH A;  2D8C A;  1YZ6 A;  3KKA C;  3V6K A;  1BPZ A;  7ICJ A;  2ASJ A;  8ICH A;  2Y1I A;  2KZM A;  2BCR A;  5KL1 B;  1IM4 A;  2KJ9 A;  4DS5 A;  3WK6 A;  4O5E A;  7ICR A;  1QH9 A;  1XS9 D;  4R8U B;  4ZH4 A;  1D9F A;  3I76 A;  5J8Y A;  1U45 A;  1V97 A;  8ICZ A;  8ICY A;  1F44 A;  4RUA A;  1NK0 A;  2EZX A;  2W9M A;  1ZD2 P;  3H8W A;  2H3F A;  5IIO A;  5KFR A;  2W55 A;  1L7N A;  1S0V A;  2G06 A;  3JPT A;  4IRC A;  2WAQ C;  2CXY A;  4TUP A;  2KJ5 A;  4P4M A;  2PMZ F;  2E5S A;  2BPC A;  3MAB A;  4NLN A;  1D9D A;  1ZQC A;  4NLZ A;  2EAO A;  3RR7 A;  3KOO A;  1TAU A;  4BWJ A;  1NKB A;  3IRU A;  1YZ7 A;  3T5L A;  4G3I A;  2MA1 A;  2R8J A;  2G07 A;  4Z6C A;  4QZ9 A;  1JRP A;  4O5C A;  1NK7 A;  2GO7 A;  3ETR A;  4C8L A;  2GH1 A;  1L6N A;  2EAN A;  3ORY A;  4EX7 A;  2OHF A;  3GII A;  3VC8 A;  4PHP A;  4KLS A;  4C8M A;  2BDU A;  3FYH A;  2Y1J A;  3C29 A;  3RAX A;  2BPG A;  2JMG A;  1XSN A;  1UA0 A;  2YB4 A;  5AI9 A;  2XCA A;  2E8M A;  3M1Y A;  3BS5 B;  3WK5 A;  1URJ A;  2H3Q A;  2FI1 A;  3T5J A;  1T94 A;  4IQW A;  4DFK A;  3GU3 A;  4PZN A;  5FP0 A;  3PR4 A;  2NRX A;  5G5H A;  3KFU F;  4QZD A;  4PPX A;  2H3V A;  3ISD A;  4QZE A;  2JZB B;  3WKA A;  4P0Q B;  3NS1 A;  1S10 A;  2ZJA A;  5KFB A;  3Q8R B;  2ASL A;  1CI4 A;  3V7K A;  4ACO A;  3HIL A;  4Q43 A;  5CP2 A;  3UMG A;  1LKY A;  2KHQ A;  3THV A;  3G6V A;  2W43 A;  3KZX A;  3KHR A;  3RJG A;  3RJE A;  2ZIW A;  4F50 A;  4ZOH C;  4KLI A;  2Y9U A;  2FPL A;  5KFA A;  4NLC A;  2HSZ A;  4E0D A;  5CWR A;  2FMQ A;  1L7M A;  2HHW A;  2G08 A;  2YB1 A;  5J2I A;  3RH5 A;  1KDH A; 
#chains in the Genus database with same CATH homology
 2QKQ A;  2QAR B;  1SV4 A;  2E8N A;  1RG6 A;  4NJ8 A;  4IS7 A;  2DL0 A;  1WWV A;  2YTU A;  1UCV A;  2KG5 A;  2KIV A;  5KNI A;  5JRT A;  1JI7 A;  4NL9 C;  1X9X A;  3IDW A;  1SXD A;  2Y9T A;  2L5Y A;  4NL9 A;  1SV0 C;  3TAD C;  2DKX A;  1SV0 A;  2EAN A;  3H8M A;  2D3D A;  3K1R B;  2K4P A;  3BQ7 A;  1OW5 A;  2QAR A;  3SEN A;  1SGG A;  5F3X B;  1UQV A;  2QB1 A;  2GLE A;  1PK3 A;  2QB0 B;  2KE7 A;  2LMR A;  2FE9 A;  2LPE A;  2K60 A;  2F3N A;  2E8M A;  3BS5 B;  4RQN A;  2D8C A;  4RQM A;  1LKY B;  1PK1 B;  3KKA C;  2EAP A;  4PZN A;  3TAD A;  1SXE A;  3KKA A;  2KSO B;  2B6G A;  3SEI A;  5J8Y C;  2F8K A;  2QB0 A;  4PZO A;  2EAM A;  5J8Y A;  1X40 A;  1B4F A;  2DKZ A;  1V38 A;  2JV3 A;  3BS5 A;  3BS7 A;  3HIL A;  1COK A;  1Z1V A;  1KW4 A;  2ESE A;  1LKY A;  1PK1 A;  1OXJ A;  4MHV A;  2E8O A;  2F44 A;  2KSO A;  2E8P A;  1X66 A;  3TAC B;  2Y9U A;  1V85 A;  1B0X A;  2KMD A;  5L1M A;  5JU5 A;  1WWU A;  2EAO A;  2ES6 A;  5JTI A;  1F0M A;  1DXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...