2KSOA

Epha2:ship2 sam:sam complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ephrin type-A receptor 2
publication title Structure and function of the EphA2:SHIP2 SAM domain heterodimer
rcsb
source organism Homo sapiens
total genus 20
structure length 65
sequence length 65
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ksoA00
1WWVA 2EAMA 4RQMA 2EAOA 1PK1A 2D8CA 1PK3A 1WWUA 1UCVA 1SXEA 1SXDA 1X9XA 1SGGA 2QB0A 1OW5A 1KW4A 3KKAA 2B6GA 2E8OA 1Z1VA 5F3XB 5J8YC 3TADC 3BQ7A 4MHVA 2QB1A 2ES6A 1OXJA 2QARB 4NL9C 2KE7A 1SV0A 2Y9UA 5JRTA 5KNIA 3IDWA 1LKYA 5L1MA 3SEIA 2EANA 2E8PA 1X40A 3BS7A 2GLEA 4RQNA 2DKZA 2F8KA 2LPEA 2DKXA 2KMDA 2KG5A 2E8NA 3K1RB 3BS5B 2Y9TA 1F0MA 2KSOB 4NL9A 1RG6A 1B4FA 2KIVA 1SV4A 1UQVA 2EAPA 4PZNA 4IS7A 2YTUA 2F44A 2F3NA 2QKQA 4PZOA 1COKA 3SENA 5JU5A 1B0XA 2QARA 2LMRA 2E8MA 2K60A 2D3DA 1DXSA 3BS5A 1V85A 1JI7A 2KSOA 3TACB 2DL0A 5J8YA 1X66A 3TADA 2L5YA 5JTIA 3HILA 2ESEA 4NJ8A 3KKAC 1PK1B 2FE9A 1V38A 2K4PA 3H8MA 2JV3A 1LKYB 2QB0B 1SV0C
chains in the Genus database with same CATH superfamily
5AM4A 2LM4A 1S77D 2BHNA 5AKIA 2DPJA 2PI5A 1PVPA 4O3MA 8ICGA 4FO6A 4FE3A 5J2AA 4Y2YA 4AYBC 5EE1A 4RQ0A 1Z19A 4UQGA 5ALVA 4JWNA 9ICUA 5KG5A 2B6GA 2W54A 2IHNA 4JV2A 1Z1VA 3WKAA 3PX6A 1DK2A 8ICNA 4O3OA 4NL9C 1L3UA 5KFSA 1TAMA 3G6VA 1F5SA 2R8KA 2KJ5A 2JZBB 4ECXA 3TAPA 1SKSA 5DQHA 3OJUA 4IL6U 8ICWA 3IHQB 2GO7A 4R66A 4MFCA 3D2QA 1T94A 3V7KA 1L7OA 1O08A 2MUTA 2J6SA 4U7CA 7ICFA 4EEKA 5BPCA 4EX7A 1X6JA 3RJEA 3PW2A 7ICOA 1JUDA 5AK3A 4RUAA 4Z6FA 1L8LA 2HOFA 2PI4A 5KT5A 2YTUA 1JMSA 4OD0A 4PZOA 4LZDA 2KEYA 2K60A 4ECQA 2ZUCA 1MQ2A 2PFPA 5KFIA 4O3SA 1M6YA 4I2JA 5DG9A 2YN4A 5C0YA 3ZDDA 3FDSA 1L3VA 5AKKA 3NTUA 3JPQA 1SL0A 3RR7A 4NLNA 2HHQA 1A0PA 3OJSA 1PK1A 3KZIU 2ASLA 2HBKA 5KG3A 4ED6A 4DSKA 3EYZA 4FBTA 1OW5A 1BPDA 2DGZA 3KFUF 3Q8RB 2KJ9A 5F3XB 1WCLA 3TADC 4C80A 1FFVA 2MAXA 4GC7A 3ISBA 5ALHA 2DF4B 4DFDA 4GLXA 2OCEA 4KLSA 4C4TA 3PSTA 3ORYA 4RUCA 1SZPA 3PMLA 1T8EA 1ZQQA 1D8BA 5J2EA 3V7JA 3JPNA 3RRGA 7ICSA 1B22A 2AU0A 1ZQIA 4GFJA 5IINA 4DLGA 2WHEA 1TFRA 1N63A 2KMDA 5DDMA 3QX7A 1KRPA 1ZQPA 3C28A 3MFHA 2KIVA 4YMNA 3T5LA 1URJA 3KBBA 3RBEA 2NV3A 3TI0A 4DOBA 1IXRA 2W9AA 4FBUA 4I2DA 2HDOA 2E8MA 3B9JA 3THVA 5ALUA 2MRLA 9ICSA 3NGDA 8ICJA 2KSOA 5CHGA 2NRXA 5DBCA 2K4IA 1DRGA 4P4MA 4HYKA 1YZ6A 3IV6A 4DSIA 4B9SA 1NI3A 2K4PA 2HHTA 3QU4A 3SI8A 2XO7A 9ICFA 1N5XA 4ECWA 4Y2UA 4ED8A 1NK9A 4AYBF 1TKDA 2JH1A 1VLBA 3ZD8A 1S8OA 3PNCA 2BCQA 4BJQA 1Q8KA 4EBDA 1ZQAA 5DB8A 1JX4A 4O3NA 4WJ3B 3LK9A 3BDPA 5T14A 2BQUA 4BXOA 2AHOB 5AI5A 1QSSA 2KHVA 7ICKA 3WK4A 5GTHU 1U9LA 1U48A 3SD7A 2XY6A 3PVXA 2FLLA 1K1QA 3R9KA 2YY6A 1Q3UA 1XC9A 5AM3A 2BCRA 4F3OA 4DOCA 1GO3F 4IRDA 4K4GA 1QH9A 4QZFA 4DS4A 3EUB2 3HT3A 9ICEA 2VA8A 1C20A 4DFPA 3K4GA 2ZTDA 2AQ0A 4DF8A 4P2HA 2F8KA 4C0ZA 2HBLA 4EENA 4FZNA 8ICZA 3HKZF 4YQWA 1UA0A 7ICMA 4KLOA 3PR5B 3ETRA 3MC1A 1X9MA 1ZQYA 1VDVA 5AKYA 4TUPA 3WK9A 3CRXA 4P4PA 2W7OA 4U6PA 3Q8LA 2OEHA 1ZQXA 2JZBA 4ECUA 3ISCA 4DCCA 1N56A 3C5GA 4UB2A 1Z1BA 3H8MA 3M9MB 2R8IA 1K1SA 3JPOA 5G5GA 3HWTA 4M47A 9ICWA 1NJYA 2ZIVA 3PR4A 2OXOA 3Q8PB 1B43A 8ICCA 7ICIA 5FP0A 5KFYA 1SWWA 9ICJA 1O03A 7ICRA 1UT8A 1T4GA 4RNNA 5IIKA 1SGGA 3N4MB 1ZXIA 5TZVA 2A1AA 2B0CA 4RT2A 5EWFA 1KKXA 9ICVA 1KW4A 2BPCA 3L5KA 1OUQA 1ZQNA 5BOLA 4UAVA 2FLNA 1SL2A 4RNOA 3MGHA 2MUTB 2KD1A 2Y9UA 2WB1C 1ECWA 1MSWD 4B9LA 5J2KA 2Q0ZX 1MQ3A 3AM9A 2WF7A 4QZAA 2KKVA 4QZIA 3TARA 4RQ8A 2KIWA 4IRCA 4J9LA 3GIMA 8ICHA 9ICHA 3QU9A 3JPSA 3RAXA 3RH4A 1KFDA 2E8NA 2HHUA 1NKCA 3KTQA 4UW9A 5EE0A 4F4YA 4NLKA 3CNHA 5AM5A 4Q8FA 5AK6A 2KZMA 2JMGA 3ED5A 2HI0A 1ZQRA 3G6YA 1A76A 3UM9A 3RBDA 4G9BA 2NRWA 2LMRA 5KFMA 2V4QA 4YG2A 4YMOA 4PH5A 5ALSA 2W9CB 4MFAA 2BQRA 3EPGA 1X66A 3RJKA 2GH1A 2WF9A 5DLFA 1PK1B 5KTQA 2JEJA 4YR0A 5IIMA 1ZETA 4Q45A 1JXLA 1X9WA 1KQQA 4O3RA 5ALYA 1FO4A 4PGXA 4DQIA 4NLBA 5CA7A 3H8SA 5ALJA 2MA1A 2OH2A 2A19A 2EAOA 5KL1B 1D8YA 9ICKA 2PFQA 3N7PD 3U26A 1JIHA 2QB0A 1WUDA 3Q8MA 4I27A 3RB4A 1L7PA 3D2NA 5J8YC 4OO1J 2XY7A 4NM1A 2LHTA 5KFOA 3RAQA 5KFXA 4OJPA 2F8LA 5AI9A 3NVYA 5C5JA 5KT4A 5ALKA 4UB1A 3BQ2A 3WKCA 3QXGA 4EEYA 3NVWA 2EANA 3ZD9A 2ZJAA 2H3QA 4O5EA 5DB6A 3H4BA 1RQLA 2DWQA 5GTIU 1KTQA 1NZPA 2ISPA 2UVUA 1FFUA 2DKXA 3WU2U 2VKQA 9ICRA 4KITB 2AGQA 1TAUA 2KSOB 9ICPA 2K4HA 2WAQC 1RYUA 1SV4A 5ALFA 2G5HB 3SV4A 3VC8A 3BQ0A 4PL2A 3NVVA 5BOMA 3V6KA 4NLCA 1HUZA 4DWIA 4PHAA 9ICCA 5HR7A 2F3NA 4KN7A 3QYPA 3RTVA 4DL6A 5EWEA 5J29A 4ELTA 3LDAA 3C23A 5AK4A 1TAQA 4JB3A 2IOHA 4F5OA 5DGAA 5KT6A 4TURA 5CR0A 3HW8A 1EXNA 3KOOA 3T3FA 5ALRA 3GFKB 3C1YA 4F4KA 2I5HA 1TK0A 1TK5A 1RPLA 2LYBA 5DQGA 4BXOB 5AI4A 3M8SA 5KFGA 3E58A 2NYVA 2ZTCA 2HVIA 2A3VA 1PK3A 3TFRA 4IQUA 4KLEA 4Y2VA 2YX8A 1Z4NA 1UCVA 4BWJA 3IM1A 1X9XA 4C8OA 4DQRA 1KL9A 2RHFA 9ICAA 2HHVA 8ICMA 2KZ3A 5J0QA 2ZIWB 4LZGA 1XO1A 4KLIA 2JXJA 3QUBA 2HSZA 1CI4A 4F5NA 4UASA 5KNIA 4IR9A 3MR3A 1KFTA 1L3SA 4QJFB 1RM6C 2G09A 2CN1A 3HX0A 2G0AA 1ZQSA 4KX3A 2Y0SC 8ICKA 4KMUA 2JEGA 4DSJA 3ETLA 2DBYA 1ZQZA 1ZQVA 2XCAA 1SKRA 3KHLA 5KT7A 5KAIU 5TISU 3WK6A 1F0MA 4PHPA 2PXIA 4F71A 5KG4A 5KFAA 3GIJA 3LWLA 3FYHA 4YN4A 4UB4A 2C2RA 4JV0A 1RQNA 3LWMA 3PV8A 5ALWA 1COKA 5JU5A 1H38A 2HVHA 5KFHA 4PHEA 4OJ6A 4C7YA 4Q43A 2K89A 2ZIVB 3TADA 3M9NB 4I2EA 1XNSA 5J2JA 3RF9A 2XGQA 3CW2C 2D6FC 2FE9A 1ZD4A 4RPXA 1JALA 2LYAA 2VA2A 2JV3A 5KFCA 4RT3A 2E3TA 5L1LA 1QLNA 4ECSA 1AROP 3QEBZ 2F1JA 5G5HA 3PO5A 1UT5A 4M04A 2ZJ8A 3HKZC 2AQ4A 5CJ7A 1AQ6A 2LBOA 4R65A 3QZ8A 1S0VA 7ICTA 5J0WA 5AKEA 1X6IA 2B21A 3MBYA 4I2FA 3ZDAA 1MA7A 2JEFA 1Z4OA 4MEXA 4CDGA 3T5HA 2H5XA 9ICQA 2YMMA 3QUQA 8ICPA 2PFOA 1ZOLA 4M2YA 2W9CA 2IA6A 5KG0A 3SAFA 3BQ7A 5J2CA 4QZ8A 3QU7A 4RPYA 1ZQFA 4IQTA 1ZQEA 3JPTA 5DBBA 1BVSA 3C2KA 3IDWA 1PUZA 4XRHA 2OWOA 2HBJA 5L1IA 2ISOA 3AL0B 3C21A 4QZHA 2GLEA 4B9UA 2W9BA 4OJOA 3F2CA 2NO5A 4Y2RA 4QWAA 5CRXA 2WAQF 2HHSA 2LPEA 2R8GA 1JXEA 4M9JA 4QIWC 4DOAA 3T79A 4ZH4A 4ED3A 2LM1A 5ALZA 4UB5A 3RJGA 5J0TA 4I2AA 3UXPA 3IP4B 9ICIA 4Y2QA 4P0QA 3GIKA 3B0XA 3PSFA 3F53A 3MDCA 1NKEA 4I2HA 3NRZA 3PSIA 3H8JA 3QU5A 4O5CA 4DFJA 2PFNA 3UXOA 4DL5A 1P7DA 2F1IA 2UVRA 3HILA 5KFRA 3AU6A 3PSPA 3QU2A 2H3VA 3TFSA 4ELVA 1ZQLA 2MU2A 1NK5A 9ICGA 2QB0B 5KL8B 1ZD3A 1MN8A 3V7LA 1U4BA 2FPLA 4IQWA 2EAMA 4BUGA 5DB7A 2D8CA 3PY8A 8ICAA 4I2IA 3IN5A 4F72A 5ALGA 5HHIA 3N7RC 3RJIA 4Y2XA 5AKJA 4UB6U 2NRZA 1TV9A 3I76A 3QNMA 1X2IA 1WG8A 3C5FA 1ZQUA 5DQIA 1DOQA 1VJ5A 2Y0SF 5AKZA 3M9OB 2HOQA 5JRTA 8ICEA 3BQTA 5AI0A 3OTQA 1HIWA 3F5AA 3WK8A 4UATA 1SB3C 2RDIA 3AMZA 5L9XA 3MR2A 4F5PA 4I2BA 1N5WA 2W43A 3M1YA 4EX6A 4Y2TA 4ECYA 3SR6A 3H0MB 3PZPA 3QUCA 3A0HU 3AN1A 2KVSA 1ZQKA 7ICQA 1WYGA 2K8AA 3FM9A 5B5EU 3MFIA 2W3SA 7ICGA 1MC8A 3KHGA 2ZIWA 3UPQA 2J6TA 3NRWA 4I28A 3RJFA 5KFLA 5EWGA 4P0PA 2D3DA 1ZQWA 3N28A 4YXJA 4F5RA 2YB4A 2L5YA 2ESEA 4Z6DA 9ICMA 2W7PA 3TKAA 3V72A 5J0OA 2RDJA 1S97A 1NZBA 3RB6A 2YQEA 2JEIA 4J9PA 3SQIA 5KAFU 4M9LA 2XY5A 5L1KA 3HPOA 1WCNA 1XSPA 4BDPA 2LKYA 3WKBA 4CCHA 3C1ZA 3OSNA 5CEHA 3OGUA 1SXEA 2PMZC 4CF4A 2E5SA 2BCUA 4FZMA 8ICVA 4XUSA 4QWBA 5D46A 3KKAA 1FEZA 2E8OA 5KFTA 4BWMA 5KFPA 4GXJA 3UMCA 2K4EA 1YT3A 4YFKA 5KG7A 1XSLA 4O0IA 3I28A 5KFUA 4J9QA 2JH7A 2RRDA 2W04A 5DDYA 4PPXA 3H8WA 2K8CB 1DGJA 4QIWF 1X40A 2HMXA 4YP3A 7ICEA 4ECVA 5IIJA 4C8LA 5AM1A 2DKZA 3IRUA 4I2CA 5ALTA 1PZNA 4B9VA 4G3IA 5EOZA 2H3IA 1J2MA 2G08A 4LJXA 3C2LA 3AU2A 1QTMA 3BJYA 1NNLA 4QZDA 2I6XA 1BPYA 3SZ2A 4US9A 1ZD5A 2MSNA 2QKQA 4M6WA 3ZDCA 1KEJA 2C28A 2R8JA 3H40A 3AQEA 1Q3VA 4O3PA 5JUMA 1X9SA 4JK1A 3BS5A 4C8KA 4UBBA 5J8YA 5AKGA 3ZI4A 4RQ4A 3SV3A 2FMSA 5ALNA 2FPKA 2BPFA 3KKAC 4KLUA 4CF5A 4K4IA 2V4RA 2BKEA 1PVRA 3TQ1A 5D49A 1L5UA 2IHMA 4GIBA 3BZCA 2WF6A 2OHFA 4MF8A 4RQMA 4Y2JA 3WKEA 1JN3A 2XI9A 1S5LU 1XWLA 3M8RA 1LVHA 4IQVA 3V6JA 4UB8U 5KG1A 2KFZA 4P4OA 5ALDA 4B6JA 4Q44A 5KFJA 3GQCA 2F77X 3T5JA 2KNJA 2W9BB 4I29A 2BCSA 4DL7A 1ZQMA 1XO0A 2KTQA 1V97A 5AM2A 3RJHA 2P66A 3JPRA 5J2DA 3UQ2A 2H3FA 2VANA 1HEKA 5AM0A 4A8EA 2K8BB 4KLJA 3Q8KA 2CPRA 4C4SA 3AUOA 4KN4A 2KK0A 1V9PA 4ACOA 3H0RB 4RQ1A 4P0QB 4F4ZA 3RB0A 3ZDEA 4QWEA 1N2XA 1BPZA 3GU3A 4AP9A 4RQ3A 8ICOA 3PW5A 5B66U 2ODGA 5HMMA 3SAGA 1C7YA 3L4PA 1NK0A 3VCBA 3OHBA 1U47A 1LV5A 8ICQA 2OM6A 3QUTA 5F9LA 3TAQA 4ZOHC 2HHXA 1CUKA 4QWCA 1IM4A 1DXSA 3LVWA 2DL0A 4QZGA 4C4RA 3SAHA 5J2BA 4HAIA 4US8A 4PGQA 3B0YA 1IIPA 4DL4A 1LKYB 4PHDA 1KSPA 2ASDA 2ZIXB 1ZQ1C 3UQ0A 3RH6A 3EW9A 2PMZF 1WWVA 3DV9A 4DEZA 3A0BU 4TQRA 2YB1A 5DLGA 1RXVA 2JRZA 3WK7A 1A6SA 2W3RA 2XGPA 2KFNA 5ALEA 1TE2A 4UAZA 1S76D 3BQ1A 4J03A 4MHVA 3UMBA 3WKDA 2QARB 4QZBA 3MDAA 1TK8A 2VA3A 2HW3A 3F2DA 1KBUA 4KMOB 2ZIUA 5KFNA 3BS7A 2VIXA 1L7NA 2XICA 2NO4A 5KFFA 1ZQHA 4O9MA 5HNKA 5AK5A 2EQYA 3CYMA 4GXKA 5E79U 4P0PB 3K1RB 2QLTA 2Y9TA 4M9HA 7ICLA 2KZZA 1S0OA 4RQ2A 4RU9A 1QQ5A 3ISDA 4TUQA 3PX4A 5KT2A 1UPHA 4NM2A 2FMPA 3SENA 2FLPA 4YVZA 4DSEA 4F93B 1V85A 4CNQA 1Q46A 4IRKA 3UMGA 2J6UA 4GXIA 2BGWA 2IBKA 3Q8QB 4M0AA 3I1YA 4YR3A 2BPGA 2KN7A 5L1JA 8ICBA 4GC6A 3C2MA 1ZQTA 3M7DA 2WF5A 4KLGA 2FPMA 1N62A 5J0XA 4OJLA 4CE6A 4ECRA 1LB2B 5J0UA 1NJZA 4B9MA 5HHHA 1KN5A 4FS1A 4MEYA 1WWUA 4JWMA 9ICTA 4ED2A 1CRXA 5KG6A 4J9RA 1Z00A 3WK5A 2O6KA 4DFMA 1A77A 1BPEA 1QSYA 5DB9A 2W8KA 2M9NA 2XCPA 2PKEA 1HJPA 2W03A 2G07A 5J2FA 2KE7A 5KFWA 3D6JA 3NASA 3E0FA 1J97A 4LVSA 1XU4A 1L6NA 2ZJ5A 2IMWP 3MGIA 5IIOA 1ZRNA 2KVCA 4CRXA 1NK6A 2VJ4A 4M6WB 5H2FU 2FDRA 4NY8A 2CXYA 5J2HA 4EZ6A 4UB3A 4DSLA 2BDUA 1N60A 3F2BA 2CRXA 2KP7A 3HP6A 3BS5B 3MR6A 1B4FA 3BZKA 4E0DA 4KLFA 3KD3A 4KLHA 3GDXA 4M9NA 2EZYA 5ALQA 2AJQA 1BPBA 2F44A 7ICUA 1B0XA 2ALZA 3RFAA 5J0YA 5KFZA 2C2EA 1S0MA 3MABA 3EWAA 4F2SA 2XIDA 8ICLA 4YD1A 1ZJNA 4EELA 4DL3A 3T5KA 3HRDD 3ONNA 8ICIA 4ECTA 4TQSA 2AGPA 4RQ6A 3Q8SB 4PJ0U 2AXTU 2E1FA 3AQFA 3GILA 2GOLA 3NS1A 2WF8A 4YMMA 1RYSA 1KFSA 5DBAA 5K4LA 4EYIB 1NJWA 5ALOA 3D2SA 1SXDA 5CP2A 2ZTEA 3S6JA 3NUQA 3IG8A 2FI1A 2XC9A 1FIQA 2VJ5A 2W55A 2HBMA 3H4DA 5AICA 2RLTA 4EZ9A 1YZ7A 8ICTA 1SV0A 5KFKA 3L3FX 4Y2SA 4F91B 4USAA 5CWRA 2W11A 1K5OA 1NJXA 1LKYA 3DEEA 1RZTA 2F1HA 9ICLA 2ZIXA 1PVQA 7ICVA 2JGAA 1KDHA 1ZJMA 2KJ8A 3TANA 1N61A 5HR6A 2RP5A 3N7SC 8ICSA 1RDFA 5J0SA 1NK8A 2AGOA 5J2GA 1T3QA 5J2IA 7ICJA 2UVVA 2M0NA 5AI6A 2BQ3A 3ZDBA 5EE3A 3GIIA 2R8HA 2OYYA 2A1JA 2EAPA 2HCFA 1ZQGA 3E2EA 2F76X 2QARA 3RRHA 3GV5B 1BNPA 4BGDA 1QQ6A 1ZQBA 2ASJA 4RQ5A 4DF4A 4YXMA 4CF3A 1NKBA 2AH5A 4QW9A 1J2NA 4ELUA 3DDHA 4R8UA 2WFAA 5D4BA 2E1EA 5IIIA 4JV1A 4BX9C 5DG7A 3K75D 3H0LB 4B9TA 1XSNA 5F9NA 5J0PA 5AIBA 2IOFA 3G6XA 4UAWA 1SV0C 4QZEA 3GV7B 2YMQA 1L7MA 2HOIA 2HHWA 5CB1A 3JPPA 4KLLA 1DK3A 4MFFA 1Z3EB 3RB3A 1SIJA 4DS5A 3IG5A 5AKHA 2ZIUB 2DFLA 4M9GA 5KFBA 5KFVA 4UBCA 4KLTA 4Z6EA 1UHUA 2QB1A 5KFDA 4UAUA 1OXJA 3AEVA 4CGZA 2Z7JA 8ICYA 4KLMA 1N48A 2P6RA 5L1MA 4NXZA 1F44A 2XVTA 4XA5A 3CP8A 2BCVA 2Q4TA 3QZ7A 3SYZA 8ICFA 4DL2A 5KFEA 4J9SA 4RZRA 4F5QA 4C7ZA 3UXNA 2KG5A 2BDPA 4EBCA 3GV8B 5HMLA 1SKWA 4O3QA 3FAHA 2KOBA 1UA1A 3EZ5A 3QE9Y 3C29A 1T3NA 2FJ6A 3F5EA 1T7PA 2EZZA 4DSFA 4DO9A 4ICAA 1ZQCA 4J9KA 4ED0A 5J0RA 1COOA 1JI7A 4NWIA 1S10A 2BR0A 4EBEA 2UVWA 4ECZA 3HJEA 4ED7A 3SMVA 4DQPA 1JROA 2P6UA 3MR5A 4OJ5A 2C2DA 2IOFK 5IILA 1ZQDA 7ICNA 3KHHA 1Z00B 3GZFA 3M6KA 2NRTA 5KFQA 3M6ZA 7ICHA 5ALLA 3PMNA 4QZCA 4TUSA 4KTQA 8ICUA 4JUZA 4NLGA 5DG8A 3H7IA 2YMPA 1IV8A 1BGXT 5AHXA 3OPXA 1BNOA 2EDUA 1SZHA 3QEAZ 1S9FA 1XS9D 4PGYA 4F4XA 9ICBA 1QQ7A 3OHAA 4RQ7A 2R18A 4R64A 3OSPA 1RXWA 3LVVA 1D9DA 4QNLA 3MGVA 4QW8A 4EYHB 5DKWA 2P35A 3SEIA 1RYRA 2I9GA 2E8PA 5ALXA 1SWVA 4Q8EA 4RQNA 2Y1JA 4DLEA 1DGSA 5AKXA 1U49A 2EH9A 1BPXA 4KLDA 2LI6A 4IC9A 4X5VA 2Y1IA 2G5IB 3O0FA 7ICPA 5ALMA 2WTFA 1ZD2P 1RG6A 4DQSA 3RH5A 2YMLA 4DQQA 1UQVA 3J81j 2JR5A 4K4HA 3ALRA 2W9MA 2GWSA 4YD2A 4F92B 3PX0A 4F8RA 4QZ9A 4OCZA 1JRPA 3FC4A 3TACB 1QCKA 4DFKA 5JTIA 2NRVA 2ZXIA 4FZLA 2RQ5A 2JHDA 1CEZA 4JMUA 5A0LA 1V38A 1IG6A 2F2AB 2KICA 2DQNB 4C8NA 5KG2A 3ICXA 4Z6CA 3PO4A 5ALPA 4MF2A 1D9FA 4UAYA 5HP4A 4F4WA 1QSLA 4Y2PA 4XQ8A 4RNMA 2KHQA 5ALIA 2ZG6A 3NVZA 1S0NA 4RPZA 4B9NA 3PW4A 4KLQA 4J9OA 1SL1A 2I1QA 4I2GA 1L3TA 2H3ZA 4ED1A 2DUYA 4FFDA 1NK7A 2BZFA 4PL1A 4YR2A 1D8LA 4NLZA 2FMQA 4F2RA 2ES6A 2ZXHA 3KHRA 2ATLA 2EZXA 4FS2A 2KV2A 9ICOA 3V6HA 4UARA 4R63A 2ZUBA 2DPIA 3N97B 8ICRA 5AIAA 4J9MA 1ZQOA 3RJJA 2A1JB 1HUOA 1X42A 5DGBA 4KX5A 4YCXA 3LYSA 1ZYQA 2G06A 1NOMA 5AI8A 2W8LA 4J9NA 9ICXA 2KKPA 4NL9A 3KZXA 1ZRMA 4QWDA 5AKLA 1TVAA 3PW7A 4PZNA 3PW0A 4IS7A 4R8UB 1ZQJA 9ICNA 1L8OA 2ZUDA 1U45A 4O5KA 4IR1A 1ED1A 2C22A 1Y88A 4C8MA 2LYHA 3RR8A 5EE9A 3K1ZA 2N1RA 4NJ8A 1KLNA 2V9WA 2WB1F 8ICXA 4NV0A 5KT3A 4F50A 1NK4A 3EPIA
chains in the Genus database with same CATH topology
1WWVA 2EAMA 4RQMA 2EAOA 1PK1A 2D8CA 1PK3A 1WWUA 1UCVA 1SXEA 1SXDA 1X9XA 1SGGA 2QB0A 1OW5A 1KW4A 3KKAA 2B6GA 2E8OA 1Z1VA 5F3XB 5J8YC 3TADC 3BQ7A 4MHVA 2QB1A 2ES6A 1OXJA 2QARB 4NL9C 2KE7A 1SV0A 2Y9UA 5JRTA 5KNIA 3IDWA 1LKYA 5L1MA 3SEIA 2EANA 2E8PA 1X40A 3BS7A 2GLEA 4RQNA 2DKZA 2F8KA 2LPEA 2DKXA 2KMDA 2KG5A 2E8NA 3K1RB 3BS5B 2Y9TA 1F0MA 2KSOB 4NL9A 1RG6A 1B4FA 2KIVA 1SV4A 1UQVA 2EAPA 4PZNA 4IS7A 2YTUA 2F44A 2F3NA 2QKQA 4PZOA 1COKA 3SENA 5JU5A 1B0XA 2QARA 2LMRA 2E8MA 2K60A 2D3DA 1DXSA 3BS5A 1V85A 1JI7A 2KSOA 3TACB 2DL0A 5J8YA 1X66A 3TADA 2L5YA 5JTIA 3HILA 2ESEA 4NJ8A 3KKAC 1PK1B 2FE9A 1V38A 2K4PA 3H8MA 2JV3A 1LKYB 2QB0B 1SV0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWV A;  2EAM A;  4RQM A;  2EAO A;  1PK1 A;  2D8C A;  1PK3 A;  1WWU A;  1UCV A;  1SXE A;  1SXD A;  1X9X A;  1SGG A;  2QB0 A;  1OW5 A;  1KW4 A;  3KKA A;  2B6G A;  2E8O A;  1Z1V A;  5F3X B;  5J8Y C;  3TAD C;  3BQ7 A;  4MHV A;  2QB1 A;  2ES6 A;  1OXJ A;  2QAR B;  4NL9 C;  2KE7 A;  1SV0 A;  2Y9U A;  5JRT A;  5KNI A;  3IDW A;  1LKY A;  5L1M A;  3SEI A;  2EAN A;  2E8P A;  1X40 A;  3BS7 A;  2GLE A;  4RQN A;  2DKZ A;  2F8K A;  2LPE A;  2DKX A;  2KMD A;  2KG5 A;  2E8N A;  3K1R B;  3BS5 B;  2Y9T A;  1F0M A;  2KSO B;  4NL9 A;  1RG6 A;  1B4F A;  2KIV A;  1SV4 A;  1UQV A;  2EAP A;  4PZN A;  4IS7 A;  2YTU A;  2F44 A;  2F3N A;  2QKQ A;  4PZO A;  1COK A;  3SEN A;  5JU5 A;  1B0X A;  2QAR A;  2LMR A;  2E8M A;  2K60 A;  2D3D A;  1DXS A;  3BS5 A;  1V85 A;  1JI7 A;  2KSO A;  3TAC B;  2DL0 A;  5J8Y A;  1X66 A;  3TAD A;  2L5Y A;  5JTI A;  3HIL A;  2ESE A;  4NJ8 A;  3KKA C;  1PK1 B;  2FE9 A;  1V38 A;  2K4P A;  3H8M A;  2JV3 A;  1LKY B;  2QB0 B;  1SV0 C; 
#chains in the Genus database with same CATH topology
 5AM4 A;  2LM4 A;  1S77 D;  2BHN A;  5AKI A;  2DPJ A;  2PI5 A;  1PVP A;  4O3M A;  8ICG A;  4FO6 A;  4FE3 A;  5J2A A;  4Y2Y A;  4AYB C;  5EE1 A;  4RQ0 A;  1Z19 A;  4UQG A;  5ALV A;  4JWN A;  9ICU A;  5KG5 A;  2B6G A;  2W54 A;  2IHN A;  4JV2 A;  1Z1V A;  3WKA A;  3PX6 A;  1DK2 A;  8ICN A;  4O3O A;  4NL9 C;  1L3U A;  5KFS A;  1TAM A;  3G6V A;  1F5S A;  2R8K A;  2KJ5 A;  2JZB B;  4ECX A;  3TAP A;  1SKS A;  5DQH A;  3OJU A;  4IL6 U;  8ICW A;  3IHQ B;  2GO7 A;  4R66 A;  4MFC A;  3D2Q A;  1T94 A;  3V7K A;  1L7O A;  1O08 A;  2MUT A;  2J6S A;  4U7C A;  7ICF A;  4EEK A;  5BPC A;  4EX7 A;  1X6J A;  3RJE A;  3PW2 A;  7ICO A;  1JUD A;  5AK3 A;  4RUA A;  4Z6F A;  1L8L A;  2HOF A;  2PI4 A;  5KT5 A;  2YTU A;  1JMS A;  4OD0 A;  4PZO A;  4LZD A;  2KEY A;  2K60 A;  4ECQ A;  2ZUC A;  1MQ2 A;  2PFP A;  5KFI A;  4O3S A;  1M6Y A;  4I2J A;  5DG9 A;  2YN4 A;  5C0Y A;  3ZDD A;  3FDS A;  1L3V A;  5AKK A;  3NTU A;  3JPQ A;  1SL0 A;  3RR7 A;  4NLN A;  2HHQ A;  1A0P A;  3OJS A;  1PK1 A;  3KZI U;  2ASL A;  2HBK A;  5KG3 A;  4ED6 A;  4DSK A;  3EYZ A;  4FBT A;  1OW5 A;  1BPD A;  2DGZ A;  3KFU F;  3Q8R B;  2KJ9 A;  5F3X B;  1WCL A;  3TAD C;  4C80 A;  1FFV A;  2MAX A;  4GC7 A;  3ISB A;  5ALH A;  2DF4 B;  4DFD A;  4GLX A;  2OCE A;  4KLS A;  4C4T A;  3PST A;  3ORY A;  4RUC A;  1SZP A;  3PML A;  1T8E A;  1ZQQ A;  1D8B A;  5J2E A;  3V7J A;  3JPN A;  3RRG A;  7ICS A;  1B22 A;  2AU0 A;  1ZQI A;  4GFJ A;  5IIN A;  4DLG A;  2WHE A;  1TFR A;  1N63 A;  2KMD A;  5DDM A;  3QX7 A;  1KRP A;  1ZQP A;  3C28 A;  3MFH A;  2KIV A;  4YMN A;  3T5L A;  1URJ A;  3KBB A;  3RBE A;  2NV3 A;  3TI0 A;  4DOB A;  1IXR A;  2W9A A;  4FBU A;  4I2D A;  2HDO A;  2E8M A;  3B9J A;  3THV A;  5ALU A;  2MRL A;  9ICS A;  3NGD A;  8ICJ A;  2KSO A;  5CHG A;  2NRX A;  5DBC A;  2K4I A;  1DRG A;  4P4M A;  4HYK A;  1YZ6 A;  3IV6 A;  4DSI A;  4B9S A;  1NI3 A;  2K4P A;  2HHT A;  3QU4 A;  3SI8 A;  2XO7 A;  9ICF A;  1N5X A;  4ECW A;  4Y2U A;  4ED8 A;  1NK9 A;  4AYB F;  1TKD A;  2JH1 A;  1VLB A;  3ZD8 A;  1S8O A;  3PNC A;  2BCQ A;  4BJQ A;  1Q8K A;  4EBD A;  1ZQA A;  5DB8 A;  1JX4 A;  4O3N A;  4WJ3 B;  3LK9 A;  3BDP A;  5T14 A;  2BQU A;  4BXO A;  2AHO B;  5AI5 A;  1QSS A;  2KHV A;  7ICK A;  3WK4 A;  5GTH U;  1U9L A;  1U48 A;  3SD7 A;  2XY6 A;  3PVX A;  2FLL A;  1K1Q A;  3R9K A;  2YY6 A;  1Q3U A;  1XC9 A;  5AM3 A;  2BCR A;  4F3O A;  4DOC A;  1GO3 F;  4IRD A;  4K4G A;  1QH9 A;  4QZF A;  4DS4 A;  3EUB 2;  3HT3 A;  9ICE A;  2VA8 A;  1C20 A;  4DFP A;  3K4G A;  2ZTD A;  2AQ0 A;  4DF8 A;  4P2H A;  2F8K A;  4C0Z A;  2HBL A;  4EEN A;  4FZN A;  8ICZ A;  3HKZ F;  4YQW A;  1UA0 A;  7ICM A;  4KLO A;  3PR5 B;  3ETR A;  3MC1 A;  1X9M A;  1ZQY A;  1VDV A;  5AKY A;  4TUP A;  3WK9 A;  3CRX A;  4P4P A;  2W7O A;  4U6P A;  3Q8L A;  2OEH A;  1ZQX A;  2JZB A;  4ECU A;  3ISC A;  4DCC A;  1N56 A;  3C5G A;  4UB2 A;  1Z1B A;  3H8M A;  3M9M B;  2R8I A;  1K1S A;  3JPO A;  5G5G A;  3HWT A;  4M47 A;  9ICW A;  1NJY A;  2ZIV A;  3PR4 A;  2OXO A;  3Q8P B;  1B43 A;  8ICC A;  7ICI A;  5FP0 A;  5KFY A;  1SWW A;  9ICJ A;  1O03 A;  7ICR A;  1UT8 A;  1T4G A;  4RNN A;  5IIK A;  1SGG A;  3N4M B;  1ZXI A;  5TZV A;  2A1A A;  2B0C A;  4RT2 A;  5EWF A;  1KKX A;  9ICV A;  1KW4 A;  2BPC A;  3L5K A;  1OUQ A;  1ZQN A;  5BOL A;  4UAV A;  2FLN A;  1SL2 A;  4RNO A;  3MGH A;  2MUT B;  2KD1 A;  2Y9U A;  2WB1 C;  1ECW A;  1MSW D;  4B9L A;  5J2K A;  2Q0Z X;  1MQ3 A;  3AM9 A;  2WF7 A;  4QZA A;  2KKV A;  4QZI A;  3TAR A;  4RQ8 A;  2KIW A;  4IRC A;  4J9L A;  3GIM A;  8ICH A;  9ICH A;  3QU9 A;  3JPS A;  3RAX A;  3RH4 A;  1KFD A;  2E8N A;  2HHU A;  1NKC A;  3KTQ A;  4UW9 A;  5EE0 A;  4F4Y A;  4NLK A;  3CNH A;  5AM5 A;  4Q8F A;  5AK6 A;  2KZM A;  2JMG A;  3ED5 A;  2HI0 A;  1ZQR A;  3G6Y A;  1A76 A;  3UM9 A;  3RBD A;  4G9B A;  2NRW A;  2LMR A;  5KFM A;  2V4Q A;  4YG2 A;  4YMO A;  4PH5 A;  5ALS A;  2W9C B;  4MFA A;  2BQR A;  3EPG A;  1X66 A;  3RJK A;  2GH1 A;  2WF9 A;  5DLF A;  1PK1 B;  5KTQ A;  2JEJ A;  4YR0 A;  5IIM A;  1ZET A;  4Q45 A;  1JXL A;  1X9W A;  1KQQ A;  4O3R A;  5ALY A;  1FO4 A;  4PGX A;  4DQI A;  4NLB A;  5CA7 A;  3H8S A;  5ALJ A;  2MA1 A;  2OH2 A;  2A19 A;  2EAO A;  5KL1 B;  1D8Y A;  9ICK A;  2PFQ A;  3N7P D;  3U26 A;  1JIH A;  2QB0 A;  1WUD A;  3Q8M A;  4I27 A;  3RB4 A;  1L7P A;  3D2N A;  5J8Y C;  4OO1 J;  2XY7 A;  4NM1 A;  2LHT A;  5KFO A;  3RAQ A;  5KFX A;  4OJP A;  2F8L A;  5AI9 A;  3NVY A;  5C5J A;  5KT4 A;  5ALK A;  4UB1 A;  3BQ2 A;  3WKC A;  3QXG A;  4EEY A;  3NVW A;  2EAN A;  3ZD9 A;  2ZJA A;  2H3Q A;  4O5E A;  5DB6 A;  3H4B A;  1RQL A;  2DWQ A;  5GTI U;  1KTQ A;  1NZP A;  2ISP A;  2UVU A;  1FFU A;  2DKX A;  3WU2 U;  2VKQ A;  9ICR A;  4KIT B;  2AGQ A;  1TAU A;  2KSO B;  9ICP A;  2K4H A;  2WAQ C;  1RYU A;  1SV4 A;  5ALF A;  2G5H B;  3SV4 A;  3VC8 A;  3BQ0 A;  4PL2 A;  3NVV A;  5BOM A;  3V6K A;  4NLC A;  1HUZ A;  4DWI A;  4PHA A;  9ICC A;  5HR7 A;  2F3N A;  4KN7 A;  3QYP A;  3RTV A;  4DL6 A;  5EWE A;  5J29 A;  4ELT A;  3LDA A;  3C23 A;  5AK4 A;  1TAQ A;  4JB3 A;  2IOH A;  4F5O A;  5DGA A;  5KT6 A;  4TUR A;  5CR0 A;  3HW8 A;  1EXN A;  3KOO A;  3T3F A;  5ALR A;  3GFK B;  3C1Y A;  4F4K A;  2I5H A;  1TK0 A;  1TK5 A;  1RPL A;  2LYB A;  5DQG A;  4BXO B;  5AI4 A;  3M8S A;  5KFG A;  3E58 A;  2NYV A;  2ZTC A;  2HVI A;  2A3V A;  1PK3 A;  3TFR A;  4IQU A;  4KLE A;  4Y2V A;  2YX8 A;  1Z4N A;  1UCV A;  4BWJ A;  3IM1 A;  1X9X A;  4C8O A;  4DQR A;  1KL9 A;  2RHF A;  9ICA A;  2HHV A;  8ICM A;  2KZ3 A;  5J0Q A;  2ZIW B;  4LZG A;  1XO1 A;  4KLI A;  2JXJ A;  3QUB A;  2HSZ A;  1CI4 A;  4F5N A;  4UAS A;  5KNI A;  4IR9 A;  3MR3 A;  1KFT A;  1L3S A;  4QJF B;  1RM6 C;  2G09 A;  2CN1 A;  3HX0 A;  2G0A A;  1ZQS A;  4KX3 A;  2Y0S C;  8ICK A;  4KMU A;  2JEG A;  4DSJ A;  3ETL A;  2DBY A;  1ZQZ A;  1ZQV A;  2XCA A;  1SKR A;  3KHL A;  5KT7 A;  5KAI U;  5TIS U;  3WK6 A;  1F0M A;  4PHP A;  2PXI A;  4F71 A;  5KG4 A;  5KFA A;  3GIJ A;  3LWL A;  3FYH A;  4YN4 A;  4UB4 A;  2C2R A;  4JV0 A;  1RQN A;  3LWM A;  3PV8 A;  5ALW A;  1COK A;  5JU5 A;  1H38 A;  2HVH A;  5KFH A;  4PHE A;  4OJ6 A;  4C7Y A;  4Q43 A;  2K89 A;  2ZIV B;  3TAD A;  3M9N B;  4I2E A;  1XNS A;  5J2J A;  3RF9 A;  2XGQ A;  3CW2 C;  2D6F C;  2FE9 A;  1ZD4 A;  4RPX A;  1JAL A;  2LYA A;  2VA2 A;  2JV3 A;  5KFC A;  4RT3 A;  2E3T A;  5L1L A;  1QLN A;  4ECS A;  1ARO P;  3QEB Z;  2F1J A;  5G5H A;  3PO5 A;  1UT5 A;  4M04 A;  2ZJ8 A;  3HKZ C;  2AQ4 A;  5CJ7 A;  1AQ6 A;  2LBO A;  4R65 A;  3QZ8 A;  1S0V A;  7ICT A;  5J0W A;  5AKE A;  1X6I A;  2B21 A;  3MBY A;  4I2F A;  3ZDA A;  1MA7 A;  2JEF A;  1Z4O A;  4MEX A;  4CDG A;  3T5H A;  2H5X A;  9ICQ A;  2YMM A;  3QUQ A;  8ICP A;  2PFO A;  1ZOL A;  4M2Y A;  2W9C A;  2IA6 A;  5KG0 A;  3SAF A;  3BQ7 A;  5J2C A;  4QZ8 A;  3QU7 A;  4RPY A;  1ZQF A;  4IQT A;  1ZQE A;  3JPT A;  5DBB A;  1BVS A;  3C2K A;  3IDW A;  1PUZ A;  4XRH A;  2OWO A;  2HBJ A;  5L1I A;  2ISO A;  3AL0 B;  3C21 A;  4QZH A;  2GLE A;  4B9U A;  2W9B A;  4OJO A;  3F2C A;  2NO5 A;  4Y2R A;  4QWA A;  5CRX A;  2WAQ F;  2HHS A;  2LPE A;  2R8G A;  1JXE A;  4M9J A;  4QIW C;  4DOA A;  3T79 A;  4ZH4 A;  4ED3 A;  2LM1 A;  5ALZ A;  4UB5 A;  3RJG A;  5J0T A;  4I2A A;  3UXP A;  3IP4 B;  9ICI A;  4Y2Q A;  4P0Q A;  3GIK A;  3B0X A;  3PSF A;  3F53 A;  3MDC A;  1NKE A;  4I2H A;  3NRZ A;  3PSI A;  3H8J A;  3QU5 A;  4O5C A;  4DFJ A;  2PFN A;  3UXO A;  4DL5 A;  1P7D A;  2F1I A;  2UVR A;  3HIL A;  5KFR A;  3AU6 A;  3PSP A;  3QU2 A;  2H3V A;  3TFS A;  4ELV A;  1ZQL A;  2MU2 A;  1NK5 A;  9ICG A;  2QB0 B;  5KL8 B;  1ZD3 A;  1MN8 A;  3V7L A;  1U4B A;  2FPL A;  4IQW A;  2EAM A;  4BUG A;  5DB7 A;  2D8C A;  3PY8 A;  8ICA A;  4I2I A;  3IN5 A;  4F72 A;  5ALG A;  5HHI A;  3N7R C;  3RJI A;  4Y2X A;  5AKJ A;  4UB6 U;  2NRZ A;  1TV9 A;  3I76 A;  3QNM A;  1X2I A;  1WG8 A;  3C5F A;  1ZQU A;  5DQI A;  1DOQ A;  1VJ5 A;  2Y0S F;  5AKZ A;  3M9O B;  2HOQ A;  5JRT A;  8ICE A;  3BQT A;  5AI0 A;  3OTQ A;  1HIW A;  3F5A A;  3WK8 A;  4UAT A;  1SB3 C;  2RDI A;  3AMZ A;  5L9X A;  3MR2 A;  4F5P A;  4I2B A;  1N5W A;  2W43 A;  3M1Y A;  4EX6 A;  4Y2T A;  4ECY A;  3SR6 A;  3H0M B;  3PZP A;  3QUC A;  3A0H U;  3AN1 A;  2KVS A;  1ZQK A;  7ICQ A;  1WYG A;  2K8A A;  3FM9 A;  5B5E U;  3MFI A;  2W3S A;  7ICG A;  1MC8 A;  3KHG A;  2ZIW A;  3UPQ A;  2J6T A;  3NRW A;  4I28 A;  3RJF A;  5KFL A;  5EWG A;  4P0P A;  2D3D A;  1ZQW A;  3N28 A;  4YXJ A;  4F5R A;  2YB4 A;  2L5Y A;  2ESE A;  4Z6D A;  9ICM A;  2W7P A;  3TKA A;  3V72 A;  5J0O A;  2RDJ A;  1S97 A;  1NZB A;  3RB6 A;  2YQE A;  2JEI A;  4J9P A;  3SQI A;  5KAF U;  4M9L A;  2XY5 A;  5L1K A;  3HPO A;  1WCN A;  1XSP A;  4BDP A;  2LKY A;  3WKB A;  4CCH A;  3C1Z A;  3OSN A;  5CEH A;  3OGU A;  1SXE A;  2PMZ C;  4CF4 A;  2E5S A;  2BCU A;  4FZM A;  8ICV A;  4XUS A;  4QWB A;  5D46 A;  3KKA A;  1FEZ A;  2E8O A;  5KFT A;  4BWM A;  5KFP A;  4GXJ A;  3UMC A;  2K4E A;  1YT3 A;  4YFK A;  5KG7 A;  1XSL A;  4O0I A;  3I28 A;  5KFU A;  4J9Q A;  2JH7 A;  2RRD A;  2W04 A;  5DDY A;  4PPX A;  3H8W A;  2K8C B;  1DGJ A;  4QIW F;  1X40 A;  2HMX A;  4YP3 A;  7ICE A;  4ECV A;  5IIJ A;  4C8L A;  5AM1 A;  2DKZ A;  3IRU A;  4I2C A;  5ALT A;  1PZN A;  4B9V A;  4G3I A;  5EOZ A;  2H3I A;  1J2M A;  2G08 A;  4LJX A;  3C2L A;  3AU2 A;  1QTM A;  3BJY A;  1NNL A;  4QZD A;  2I6X A;  1BPY A;  3SZ2 A;  4US9 A;  1ZD5 A;  2MSN A;  2QKQ A;  4M6W A;  3ZDC A;  1KEJ A;  2C28 A;  2R8J A;  3H40 A;  3AQE A;  1Q3V A;  4O3P A;  5JUM A;  1X9S A;  4JK1 A;  3BS5 A;  4C8K A;  4UBB A;  5J8Y A;  5AKG A;  3ZI4 A;  4RQ4 A;  3SV3 A;  2FMS A;  5ALN A;  2FPK A;  2BPF A;  3KKA C;  4KLU A;  4CF5 A;  4K4I A;  2V4R A;  2BKE A;  1PVR A;  3TQ1 A;  5D49 A;  1L5U A;  2IHM A;  4GIB A;  3BZC A;  2WF6 A;  2OHF A;  4MF8 A;  4RQM A;  4Y2J A;  3WKE A;  1JN3 A;  2XI9 A;  1S5L U;  1XWL A;  3M8R A;  1LVH A;  4IQV A;  3V6J A;  4UB8 U;  5KG1 A;  2KFZ A;  4P4O A;  5ALD A;  4B6J A;  4Q44 A;  5KFJ A;  3GQC A;  2F77 X;  3T5J A;  2KNJ A;  2W9B B;  4I29 A;  2BCS A;  4DL7 A;  1ZQM A;  1XO0 A;  2KTQ A;  1V97 A;  5AM2 A;  3RJH A;  2P66 A;  3JPR A;  5J2D A;  3UQ2 A;  2H3F A;  2VAN A;  1HEK A;  5AM0 A;  4A8E A;  2K8B B;  4KLJ A;  3Q8K A;  2CPR A;  4C4S A;  3AUO A;  4KN4 A;  2KK0 A;  1V9P A;  4ACO A;  3H0R B;  4RQ1 A;  4P0Q B;  4F4Z A;  3RB0 A;  3ZDE A;  4QWE A;  1N2X A;  1BPZ A;  3GU3 A;  4AP9 A;  4RQ3 A;  8ICO A;  3PW5 A;  5B66 U;  2ODG A;  5HMM A;  3SAG A;  1C7Y A;  3L4P A;  1NK0 A;  3VCB A;  3OHB A;  1U47 A;  1LV5 A;  8ICQ A;  2OM6 A;  3QUT A;  5F9L A;  3TAQ A;  4ZOH C;  2HHX A;  1CUK A;  4QWC A;  1IM4 A;  1DXS A;  3LVW A;  2DL0 A;  4QZG A;  4C4R A;  3SAH A;  5J2B A;  4HAI A;  4US8 A;  4PGQ A;  3B0Y A;  1IIP A;  4DL4 A;  1LKY B;  4PHD A;  1KSP A;  2ASD A;  2ZIX B;  1ZQ1 C;  3UQ0 A;  3RH6 A;  3EW9 A;  2PMZ F;  1WWV A;  3DV9 A;  4DEZ A;  3A0B U;  4TQR A;  2YB1 A;  5DLG A;  1RXV A;  2JRZ A;  3WK7 A;  1A6S A;  2W3R A;  2XGP A;  2KFN A;  5ALE A;  1TE2 A;  4UAZ A;  1S76 D;  3BQ1 A;  4J03 A;  4MHV A;  3UMB A;  3WKD A;  2QAR B;  4QZB A;  3MDA A;  1TK8 A;  2VA3 A;  2HW3 A;  3F2D A;  1KBU A;  4KMO B;  2ZIU A;  5KFN A;  3BS7 A;  2VIX A;  1L7N A;  2XIC A;  2NO4 A;  5KFF A;  1ZQH A;  4O9M A;  5HNK A;  5AK5 A;  2EQY A;  3CYM A;  4GXK A;  5E79 U;  4P0P B;  3K1R B;  2QLT A;  2Y9T A;  4M9H A;  7ICL A;  2KZZ A;  1S0O A;  4RQ2 A;  4RU9 A;  1QQ5 A;  3ISD A;  4TUQ A;  3PX4 A;  5KT2 A;  1UPH A;  4NM2 A;  2FMP A;  3SEN A;  2FLP A;  4YVZ A;  4DSE A;  4F93 B;  1V85 A;  4CNQ A;  1Q46 A;  4IRK A;  3UMG A;  2J6U A;  4GXI A;  2BGW A;  2IBK A;  3Q8Q B;  4M0A A;  3I1Y A;  4YR3 A;  2BPG A;  2KN7 A;  5L1J A;  8ICB A;  4GC6 A;  3C2M A;  1ZQT A;  3M7D A;  2WF5 A;  4KLG A;  2FPM A;  1N62 A;  5J0X A;  4OJL A;  4CE6 A;  4ECR A;  1LB2 B;  5J0U A;  1NJZ A;  4B9M A;  5HHH A;  1KN5 A;  4FS1 A;  4MEY A;  1WWU A;  4JWM A;  9ICT A;  4ED2 A;  1CRX A;  5KG6 A;  4J9R A;  1Z00 A;  3WK5 A;  2O6K A;  4DFM A;  1A77 A;  1BPE A;  1QSY A;  5DB9 A;  2W8K A;  2M9N A;  2XCP A;  2PKE A;  1HJP A;  2W03 A;  2G07 A;  5J2F A;  2KE7 A;  5KFW A;  3D6J A;  3NAS A;  3E0F A;  1J97 A;  4LVS A;  1XU4 A;  1L6N A;  2ZJ5 A;  2IMW P;  3MGI A;  5IIO A;  1ZRN A;  2KVC A;  4CRX A;  1NK6 A;  2VJ4 A;  4M6W B;  5H2F U;  2FDR A;  4NY8 A;  2CXY A;  5J2H A;  4EZ6 A;  4UB3 A;  4DSL A;  2BDU A;  1N60 A;  3F2B A;  2CRX A;  2KP7 A;  3HP6 A;  3BS5 B;  3MR6 A;  1B4F A;  3BZK A;  4E0D A;  4KLF A;  3KD3 A;  4KLH A;  3GDX A;  4M9N A;  2EZY A;  5ALQ A;  2AJQ A;  1BPB A;  2F44 A;  7ICU A;  1B0X A;  2ALZ A;  3RFA A;  5J0Y A;  5KFZ A;  2C2E A;  1S0M A;  3MAB A;  3EWA A;  4F2S A;  2XID A;  8ICL A;  4YD1 A;  1ZJN A;  4EEL A;  4DL3 A;  3T5K A;  3HRD D;  3ONN A;  8ICI A;  4ECT A;  4TQS A;  2AGP A;  4RQ6 A;  3Q8S B;  4PJ0 U;  2AXT U;  2E1F A;  3AQF A;  3GIL A;  2GOL A;  3NS1 A;  2WF8 A;  4YMM A;  1RYS A;  1KFS A;  5DBA A;  5K4L A;  4EYI B;  1NJW A;  5ALO A;  3D2S A;  1SXD A;  5CP2 A;  2ZTE A;  3S6J A;  3NUQ A;  3IG8 A;  2FI1 A;  2XC9 A;  1FIQ A;  2VJ5 A;  2W55 A;  2HBM A;  3H4D A;  5AIC A;  2RLT A;  4EZ9 A;  1YZ7 A;  8ICT A;  1SV0 A;  5KFK A;  3L3F X;  4Y2S A;  4F91 B;  4USA A;  5CWR A;  2W11 A;  1K5O A;  1NJX A;  1LKY A;  3DEE A;  1RZT A;  2F1H A;  9ICL A;  2ZIX A;  1PVQ A;  7ICV A;  2JGA A;  1KDH A;  1ZJM A;  2KJ8 A;  3TAN A;  1N61 A;  5HR6 A;  2RP5 A;  3N7S C;  8ICS A;  1RDF A;  5J0S A;  1NK8 A;  2AGO A;  5J2G A;  1T3Q A;  5J2I A;  7ICJ A;  2UVV A;  2M0N A;  5AI6 A;  2BQ3 A;  3ZDB A;  5EE3 A;  3GII A;  2R8H A;  2OYY A;  2A1J A;  2EAP A;  2HCF A;  1ZQG A;  3E2E A;  2F76 X;  2QAR A;  3RRH A;  3GV5 B;  1BNP A;  4BGD A;  1QQ6 A;  1ZQB A;  2ASJ A;  4RQ5 A;  4DF4 A;  4YXM A;  4CF3 A;  1NKB A;  2AH5 A;  4QW9 A;  1J2N A;  4ELU A;  3DDH A;  4R8U A;  2WFA A;  5D4B A;  2E1E A;  5III A;  4JV1 A;  4BX9 C;  5DG7 A;  3K75 D;  3H0L B;  4B9T A;  1XSN A;  5F9N A;  5J0P A;  5AIB A;  2IOF A;  3G6X A;  4UAW A;  1SV0 C;  4QZE A;  3GV7 B;  2YMQ A;  1L7M A;  2HOI A;  2HHW A;  5CB1 A;  3JPP A;  4KLL A;  1DK3 A;  4MFF A;  1Z3E B;  3RB3 A;  1SIJ A;  4DS5 A;  3IG5 A;  5AKH A;  2ZIU B;  2DFL A;  4M9G A;  5KFB A;  5KFV A;  4UBC A;  4KLT A;  4Z6E A;  1UHU A;  2QB1 A;  5KFD A;  4UAU A;  1OXJ A;  3AEV A;  4CGZ A;  2Z7J A;  8ICY A;  4KLM A;  1N48 A;  2P6R A;  5L1M A;  4NXZ A;  1F44 A;  2XVT A;  4XA5 A;  3CP8 A;  2BCV A;  2Q4T A;  3QZ7 A;  3SYZ A;  8ICF A;  4DL2 A;  5KFE A;  4J9S A;  4RZR A;  4F5Q A;  4C7Z A;  3UXN A;  2KG5 A;  2BDP A;  4EBC A;  3GV8 B;  5HML A;  1SKW A;  4O3Q A;  3FAH A;  2KOB A;  1UA1 A;  3EZ5 A;  3QE9 Y;  3C29 A;  1T3N A;  2FJ6 A;  3F5E A;  1T7P A;  2EZZ A;  4DSF A;  4DO9 A;  4ICA A;  1ZQC A;  4J9K A;  4ED0 A;  5J0R A;  1COO A;  1JI7 A;  4NWI A;  1S10 A;  2BR0 A;  4EBE A;  2UVW A;  4ECZ A;  3HJE A;  4ED7 A;  3SMV A;  4DQP A;  1JRO A;  2P6U A;  3MR5 A;  4OJ5 A;  2C2D A;  2IOF K;  5IIL A;  1ZQD A;  7ICN A;  3KHH A;  1Z00 B;  3GZF A;  3M6K A;  2NRT A;  5KFQ A;  3M6Z A;  7ICH A;  5ALL A;  3PMN A;  4QZC A;  4TUS A;  4KTQ A;  8ICU A;  4JUZ A;  4NLG A;  5DG8 A;  3H7I A;  2YMP A;  1IV8 A;  1BGX T;  5AHX A;  3OPX A;  1BNO A;  2EDU A;  1SZH A;  3QEA Z;  1S9F A;  1XS9 D;  4PGY A;  4F4X A;  9ICB A;  1QQ7 A;  3OHA A;  4RQ7 A;  2R18 A;  4R64 A;  3OSP A;  1RXW A;  3LVV A;  1D9D A;  4QNL A;  3MGV A;  4QW8 A;  4EYH B;  5DKW A;  2P35 A;  3SEI A;  1RYR A;  2I9G A;  2E8P A;  5ALX A;  1SWV A;  4Q8E A;  4RQN A;  2Y1J A;  4DLE A;  1DGS A;  5AKX A;  1U49 A;  2EH9 A;  1BPX A;  4KLD A;  2LI6 A;  4IC9 A;  4X5V A;  2Y1I A;  2G5I B;  3O0F A;  7ICP A;  5ALM A;  2WTF A;  1ZD2 P;  1RG6 A;  4DQS A;  3RH5 A;  2YML A;  4DQQ A;  1UQV A;  3J81 j;  2JR5 A;  4K4H A;  3ALR A;  2W9M A;  2GWS A;  4YD2 A;  4F92 B;  3PX0 A;  4F8R A;  4QZ9 A;  4OCZ A;  1JRP A;  3FC4 A;  3TAC B;  1QCK A;  4DFK A;  5JTI A;  2NRV A;  2ZXI A;  4FZL A;  2RQ5 A;  2JHD A;  1CEZ A;  4JMU A;  5A0L A;  1V38 A;  1IG6 A;  2F2A B;  2KIC A;  2DQN B;  4C8N A;  5KG2 A;  3ICX A;  4Z6C A;  3PO4 A;  5ALP A;  4MF2 A;  1D9F A;  4UAY A;  5HP4 A;  4F4W A;  1QSL A;  4Y2P A;  4XQ8 A;  4RNM A;  2KHQ A;  5ALI A;  2ZG6 A;  3NVZ A;  1S0N A;  4RPZ A;  4B9N A;  3PW4 A;  4KLQ A;  4J9O A;  1SL1 A;  2I1Q A;  4I2G A;  1L3T A;  2H3Z A;  4ED1 A;  2DUY A;  4FFD A;  1NK7 A;  2BZF A;  4PL1 A;  4YR2 A;  1D8L A;  4NLZ A;  2FMQ A;  4F2R A;  2ES6 A;  2ZXH A;  3KHR A;  2ATL A;  2EZX A;  4FS2 A;  2KV2 A;  9ICO A;  3V6H A;  4UAR A;  4R63 A;  2ZUB A;  2DPI A;  3N97 B;  8ICR A;  5AIA A;  4J9M A;  1ZQO A;  3RJJ A;  2A1J B;  1HUO A;  1X42 A;  5DGB A;  4KX5 A;  4YCX A;  3LYS A;  1ZYQ A;  2G06 A;  1NOM A;  5AI8 A;  2W8L A;  4J9N A;  9ICX A;  2KKP A;  4NL9 A;  3KZX A;  1ZRM A;  4QWD A;  5AKL A;  1TVA A;  3PW7 A;  4PZN A;  3PW0 A;  4IS7 A;  4R8U B;  1ZQJ A;  9ICN A;  1L8O A;  2ZUD A;  1U45 A;  4O5K A;  4IR1 A;  1ED1 A;  2C22 A;  1Y88 A;  4C8M A;  2LYH A;  3RR8 A;  5EE9 A;  3K1Z A;  2N1R A;  4NJ8 A;  1KLN A;  2V9W A;  2WB1 F;  8ICX A;  4NV0 A;  5KT3 A;  4F50 A;  1NK4 A;  3EPI A; 
#chains in the Genus database with same CATH homology
 1WWV A;  2EAM A;  4RQM A;  2EAO A;  1PK1 A;  2D8C A;  1PK3 A;  1WWU A;  1UCV A;  1SXE A;  1SXD A;  1X9X A;  1SGG A;  2QB0 A;  1OW5 A;  1KW4 A;  3KKA A;  2B6G A;  2E8O A;  1Z1V A;  5F3X B;  5J8Y C;  3TAD C;  3BQ7 A;  4MHV A;  2QB1 A;  2ES6 A;  1OXJ A;  2QAR B;  4NL9 C;  2KE7 A;  1SV0 A;  2Y9U A;  5JRT A;  5KNI A;  3IDW A;  1LKY A;  5L1M A;  3SEI A;  2EAN A;  2E8P A;  1X40 A;  3BS7 A;  2GLE A;  4RQN A;  2DKZ A;  2F8K A;  2LPE A;  2DKX A;  2KMD A;  2KG5 A;  2E8N A;  3K1R B;  3BS5 B;  2Y9T A;  1F0M A;  2KSO B;  4NL9 A;  1RG6 A;  1B4F A;  2KIV A;  1SV4 A;  1UQV A;  2EAP A;  4PZN A;  4IS7 A;  2YTU A;  2F44 A;  2F3N A;  2QKQ A;  4PZO A;  1COK A;  3SEN A;  5JU5 A;  1B0X A;  2QAR A;  2LMR A;  2E8M A;  2K60 A;  2D3D A;  1DXS A;  3BS5 A;  1V85 A;  1JI7 A;  2KSO A;  3TAC B;  2DL0 A;  5J8Y A;  1X66 A;  3TAD A;  2L5Y A;  5JTI A;  3HIL A;  2ESE A;  4NJ8 A;  3KKA C;  1PK1 B;  2FE9 A;  1V38 A;  2K4P A;  3H8M A;  2JV3 A;  1LKY B;  2QB0 B;  1SV0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...