3UM9A

Crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
225
structure length
225
Chain Sequence
GMHAIKAVVFDLYGTLYDVYSVRTSCERIFPGQGEMVSKMWRQKQLEYTWMRTLMGQYQDFESATLDALRYTCGSLGLALDADGEAHLCSEYLSLTPFADVPQALQQLRAAGLKTAILSNGSRHSIRQVVGNSGLTNSFDHLISVDEVRLFKPHQKVYELAMDTLHLGESEILFVSCNSWDATGAKYFGYPVCWINRSNGVFDQLGVVPDIVVSDVGVLASRFSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase, type II
publication title Structural adaptations of L-2-haloacid dehalogenases that enable hydrolytic defluorination
rcsb
source organism Polaromonas sp. js666
total genus 88
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3um9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3um9A01
2HSZA 4UASA 2X4DA 4F71A 5AVVA 1S2OA 3NAMA 2IYEA 3QU9A 5ALPA 3L8GA 4UMDA 2I6XA 3QU7A 5AIBA 3I28A 3F9RA 4QQFA 1RC8A 5A3SA 1Y8AA 2FPXA 3DNPA 2P69A 4Y2XA 3PCTA 1J8DA 1Z4NA 1Z88A 3A3YA 4RESA 2Q5EA 2C9MA 3EWIA 2YY6A 4NABA 1EK1A 4HGPA 5AKHA 5AW2A 1T5TA 3U7HB 1RKVA 2GMWA 1TA0A 3QU4A 5ALFA 3WK8A 4BBJA 1KYTA 3R9KA 2ZBFA 4E88A 1RMYA 4HGRA 2WFAA 5AKGA 5ALNA 2DQSA 4XPZA 1QH9A 3WK6A 2JAUA 4HGQA 3ET5A 5IT4A 1ZD5A 1T9ZA 3W5DA 3W5CA 3L8HA 2OA0A 2I7DA 5AI8A 2JGAA 4C4TA 3SHQA 5AW6A 2CFRA 3KBBA 2FEAA 3WGVA 4YCNA 1ZS9A 4EELA 1WZCA 3A1EA 4IFTA 3OCYA 1YMQA 1Z5GA 3FPSA 3AR9A 2ZBGA 2R8EA 2C4NA 1LTQA 5A3QA 5AW7A 4UAUA 1NRWA 3AR2A 2MU2A 3SMVA 2RARA 5AI4A 3SKYA 3WKCA 4BX3A 4CF4A 1F5SA 3ZW7A 1RLTA 4FE3A 3QNMA 4XQ0A 3TLMA 1LVHA 1Z4IA 3ZI4A 2YJ6A 3MC1A 4ZEXA 2G1AA 5ALSA 3KC2A 1FEZA 3L8EA 4Y3UA 3MPOA 3WK9A 2RB5A 2I55A 5AKLA 3ZU6A 3FGOA 2AUTA 1QQ5A 1NF2A 3EF0A 3N07A 4UU0A 4KX3A 2B1RA 2FUCA 1Z5UA 3IJ5A 2GFHA 4UARA 1Z4PX 5ALZA 5AVUA 2Q4RA 3N8GA 4F72A 2B30A 3ZTWA 3K1ZA 3AR4A 1YJ5A 5AK4A 3L8FA 2JAWA 4AS2A 5AW4A 4BX0A 2FDRA 4Y2PA 5A3RA 1TJ4A 3ZUPA 3AR7A 5ALRA 3WK4A 2OYCA 3OTQA 3R4CA 5ALTA 4AP9A 1MH9A 3B9BA 2WF5A 3FM9A 5AI5A 3VAYA 4DW8A 2QLTA 5AIAA 2ZBEA 4B6JA 1XPJA 1O08A 4BEVA 2RAVA 5JJBA 5AKJA 1N8NA 5AVRA 3SLRA 3OCWA 3OCZA 1L7PA 3S6JA 1SU4A 3WKBA 1RKUA 1IWOA 4C4RA 3SKXA 3QUCA 4G63A 2O2XA 3NALA 4GIBA 2AMYA 2HO4A 1Z4LA 3U26A 1RKQA 4PNHA 5ALWA 5AVTA 2WF7A 3QUTA 4OFZA 5AVQA 5AW1A 5IS2A 5AK6A 2EATA 3B8EA 3J7TA 4MWOA 5AM5A 3NASA 4BX2A 5IT0A 3WKEA 2B0CA 3ESQA 3ET4A 2YFYA 4Y2UA 3KD3A 2PKEA 3OCUA 1L7MA 1VFPA 2YJ3A 2YJ4A 2HHLA 1CR6A 3L0YA 3DDHA 3QYPA 4O8CA 3NIWA 2IOFK 4OHFA 2FPUA 2EAUA 1ZD4A 4OCZA 1J97A 2FPRA 2R8YA 2IOFA 3U19A 2NO5A 4UMVA 2HCFA 1JUDA 4Y2VA 5ALUA 5ALHA 2C88A 2B8JA 3ZVNA 4HAIA 5ALIA 3QX7A 1O03A 4YCMA 2JAOA 5ALKA 5AM4A 2HF7A 3ZTYA 3WK5A 2WM8A 1U2TA 4FFDA 3L0BA 2Q4TA 1U7PA 1ZD2P 5AVYA 3N5KA 4YIKA 4BEWA 2W4MA 3WGUA 2W43A 3SD7A 2ZG6A 2AGVA 4XOUA 2AH5A 4C4SA 1EK2A 5T41A 3ZWDA 3ONNA 3R09A 4NFLA 3IB6A 4I9FA 1S8OA 4ZEVA 1Z4MA 3MMZA 3UMGA 4Y2SA 3E8MA 4Y2QA 3KDPA 3QLEA 2P27A 2HOQA 2IA5A 3QU5A 1L6RA 1XP5A 1WVIA 5AK3A 2FPSA 2FUEA 2YMQA 3W5BA 3AR3A 3M1YA 4UM7A 3ZX5A 4G9BA 1VJRA 1RMTA 2CFSA 5AKEA 4Y2RA 3QUBA 3CNHA 2WF8A 3PGLA 2P9JA 1AQ6A 5ALOA 3CZ4A 2VKQA 3E84A 1PW5A 3E58A 3AR5A 3UMCA 2O9JA 4KX5A 2ZOSA 1Z4KA 1ZD3A 1T5SA 4J2TA 3ESRA 3L0CA 2CFTA 1QYIA 3GYGA 3I1YA 4JB3A 2YMPA 4Y2JA 4UU1A 3QGMA 1VJ5A 3PGVA 4H1WA 3ZX4A 4DWOA 2QYHA 1RDFA 3SF0A 4KNVA 2WHEA 1CQZA 1YS9A 1ZRNA 1SWVA 2RBKA 4UM5A 2B8EA 3OCVA 4XE5A 4YCLA 5AVSA 1RLMA 2BDEA 5AW5A 2FPWA 1RLOA 2ZBDA 4EENA 1RRCA 5AM0A 2W11A 4Y2TA 5ALQA 4DFDA 3EF1A 3ZVMA 4CE6A 1Q91A 4UMEA 3U13A 3AR6A 2HF2A 3A1CA 3FVVA 3WKDA 1NNLA 5AI6A 5AI9A 1Q92A 3NANA 1Z4JA 4MUMA 2YN4A 2YMMA 1U7OA 4OD0A 2OM6A 3NRJA 2P11A 5AVWA 4RETA 4HGOA 2G80A 2PR7A 2PQ0A 3UMBA 2B82A 4GXTA 1RMQA 5E0OA 3L5KA 1QQ7A 3PDWA 2HEGA 5ALJA 5AVZA 1QQ6A 4EX6A 1L7NA 2R8XA 4I9GA 5AW3A 1XVIA 2JARA 5ALEA 4EX7A 3QUQA 2G0AA 4HYTA 1WR8A 2C8LA 4YH1A 4BKMA 1YV9A 3EPRA 4KYTA 2GHTA 3D6JA 3I6BA 2HX1A 2YJ5A 3L1VA 5ALVA 3W5AA 1Z4QA 1RQLA 1U02A 2C8KA 1TJ3A 2NO4A 4CF3A 5AK5A 4UATA 2HDOA 4L57A 4BYGA 4J03A 3ED5A 1U2SA 2ODAA 2MSNA 3L7YA 5ALDA 2D2VA 4UMFA 3U7EB 3RFUA 2BY4A 4NAVA 1ZOLA 1RQNA 5AICA 4FYPA 3HLTA 3E81A 4NWIA 4HGNA 2HI0A 4L6AA 3KZXA 5ALMA 2FI1A 5ALLA 1L7OA 5AW8A 1Z4OA 4YIHA 2WF6A 4JDPA 3MN1A 4DCCA 2I33A 3DAOA 2WF9A 5AKYA 1L8LA 3I76A 2G08A 2G07A 5AVXA 2NYVA 3UM9A 3U7GA 5AW9A 5AKIA 3FZQA 1YNSA 3WKAA 2G09A 3NUQA 3N1UA 3HYCA 4CF5A 1L8OA 3L1UA 1ZJJA 2B1QA 5AKZA 1ZRMA 5AI0A 5AESA 3WK7A 2I54A 3IRUA 4BNDA 5ALGA 2G06A 3U7FB 5AKKA 1RPZA 2YMLA 3DV9A 4UW9A 1K1EA 4KNWA 2OBBA 3A1DA 2R8ZA 4AS3A 5ALXA 4NV0A 2CN1A 3RF6A 4UAVA 4QJBA 5AW0A 3AR8A 5AKXA 3B9RA 4IG4A 5FP0A 2MU1A 1WPGA 1TE2A 2IOHA 4CNQA 3FPBA 2ZXEA 5AM2A 4KN8A 5ALYA 4L6CA 5AM1A 5AHXA 2YBDA 4Y2YA 2GHQA 3BA6A 3M9LA 3N28A 2I34A 4YGYA 4ZEWA 3ZWKA 3OCXA 3ZVLA 2GO7A 3BWVA 1YDFA 2EARA 3P96A 3OPXA 3QXGA 1X42A 3KOOA 2BDUA 3QU2A 1N9KA 4EZEA 4EEKA 5AM3A 1TJ5A 1SWWA 4BNDB
chains in the Genus database with same CATH superfamily
2KG5A 2TMDA 1U9YA 1DWPA 3CW2C 3QU7A 4O2BA 4GOJA 4CIWA 1K5HA 1QR2A 2BJVA 3RLIA 1Z88A 2C9MA 1PWYE 3INNA 4MGEA 4MW7A 2J3DA 5J4LA 2EF0A 4JUBA 4EJFA 2Q9AA 5EJGA 4K3UA 9LDBA 2FXVA 3LUFA 2EX4A 3UV6A 1J21A 1P1BA 5IT4A 1KPIA 4YDRA 2R8BA 2VRBA 1P0CA 3RUIA 2QG6A 1KDOA 2ZWOA 5M5BA 1FP7A 2PBZA 1OUMA 5JDCA 4URXR 2F67A 1HE3A 3PWKA 3PNBA 1WTCA 1KRXA 2HO5A 3C21A 2ZCVA 3CX4A 1J5EB 2PUEA 4WDQA 4U2GA 4J9VA 3PC3A 3SMVA 1SL1A 4D56A 4NG5A 1MAHA 1SELA 3W8DA 5GVRA 4OJOA 1ECPA 2O20A 4RLSA 2WJPA 4WK6A 1XNSA 4YRJA 3J81A 4I2HA 1DIRA 3PPXA 2GEVA 1ZO8A 1SUIA 4YA6A 3PUHA 3G23A 5KT2A 4X24A 2P6MA 2VP9A 1ORRA 3MWDA 3LY7A 2NSJA 3IG8A 2PQ6A 4KSCA 1RIFA 2YRFA 1JJFA 3WP1B 4B5KA 1BXZA 2D5LA 3DEEA 1SCQA 2DPLA 1WXDA 1JMKC 1NIJA 4LX0A 1ENYA 4PNHA 2V96A 3X1ZA 5EXDA 1Q3TA 4Q00A 4YRRA 2JGMA 5COBA 3TVYA 2FFQA 4MPTA 3FCSB 1K3FA 1VCOA 3RAEC 4BVJA 1BPZA 2YN2A 4TVSA 3OZCA 1VECA 3ELDA 1DOHA 4B44A 2E3TA 4YQWA 4LRWA 3N97B 3FNHA 1Q6ZA 2IVZA 5H83A 5KU1A 3O8RA 3M4NA 3PC8A 1JH8A 4LK3A 4DBVO 4NE7A 1BNOA 3FIUA 1K06A 3DAPA 5K0TA 3QBDA 1H4QA 2GPAA 3SSNA 1PWHA 2KICA 4CM4B 1L0BA 4BJHB 1DX4A 1Y1SA 3M8SA 5U9CA 4GMXA 4GZLA 4Q93A 1LC0A 1PR1A 2AN4A 5FA5A 4M49A 4GC9A 4RIIA 1I3OA 1C3JA 5CBPA 2V3WA 2P9TA 3KTAA 4IGFA 1QZZA 2J5KA 1I36A 1LV8A 2BONA 3LQ1A 3VR4H 1VJ5A 1UK8A 1L1FA 3FTQA 1XIVA 3M8KA 5EUBA 2HRBA 3IPLA 3U1VA 5EE0A 2B8WA 3OKCA 3AEZA 1STOA 4HI0E 2I9KA 3NAQA 2B78A 4I4IA 4Q3DA 3VC8A 3ABQB 4WESB 6AT1A 3FLBA 2YMMA 3W5SA 4XGRA 2G6BA 3PA8A 1KQFA 2IVFA 2CMKA 1QM5A 1N33B 3EVCA 2C8JA 2G6TA 1XTTA 1PFKA 1DBSA 4ZV4A 5KHLB 1YDHA 4FMDF 1FNNA 1ZCZA 1TRHA 4X1OA 1EPUA 2WTUA 1SD1A 2E55A 1YJ8A 1SD2A 2OZKA 1HH4A 1FA9A 3Q6IA 3GJ7A 1OWOA 1DBQA 2PVCA 4MMZB 2WWGA 3FYDA 4D96A 1UQVA 1COZA 1UT8A 2NO7A 1YTUA 2KX7A 3NWOA 2YZ7A 4JZKA 4NAVA 2H17A 4OP2A 4QBFA 2W7OA 1NJSA 2X5OA 1ZOOA 3AHDA 3K94A 2ZSHA 1EFPA 1JEDA 4KQ9A 4BTLA 2QB5A 1OXTA 2OENG 3CZ9A 4UBOA 4P7BA 4ZHQF 3VKFA 1FFEA 1NVUQ 3TLGA 3E0FA 1XQ9A 3ZR4B 2HTFA 3GDFA 3CSDA 4JBNA 3A1DA 4IQWA 1I13A 1TPZA 3I30X 3JWPA 4A0SA 3GO4A 1DAPA 2BZFA 3BK2A 3USES 3IMFA 1JDSA 3EWNA 2QY9A 1CUBA 1J0BA 2IYAA 2UVPA 1DTSA 3EFOB 3S2ZA 1PK1B 1MENA 2O05A 4R3UC 3KSBC 4F4XA 4H16A 5EQFA 3FVWA 4JK3A 4JLSA 4O4LA 2OBFA 3BTVA 3LX4A 1ICEA 1JDVA 2Z0MA 2AG5A 4YCBA 4C29A 3ADBA 5CURA 5JY6A 1G3UA 4U8HA 3WQHA 2ZBFA 3NNDA 2ECPA 4Z0HO 3LYAA 4EHIA 3QPCA 2E5LB 3U4QA 1QGDA 2PUCA 1ZM7A 2HF9A 4NHEA 1Z19A 4CLRA 1GPNA 2L17A 5MGNA 3BWXA 4WEQA 1H5NA 5HSGA 3OKAA 1CUZA 5AI4A 3VZRA 3QZ8A 1OJLA 4IG9A 1ZGAA 1TI7A 2GBIA 2J6IA 4WLNA 4MUJA 1KMMA 4F86A 3EGXB 3PEYA 4CZ2A 4UTOA 5BQFA 3HA5A 5LZ4A 4MR9B 3GVPA 3OTQA 1JLKA 5I9MA 1U0BB 4EY5A 3MYRA 4PZYA 1U0EA 4QBIA 1JALA 3GPLA 3CJTA 3E5HA 4ZOLA 3BIFA 3RUCA 3A6FA 1REQB 3SHWA 4DARA 3C5GA 3OIUA 3MW8A 3NXKA 4MWOA 5FPSA 2JFXA 5IZ4A 1HO3A 5BSEA 2XLCA 3HYLA 4NV3A 4LQCA 1TEZA 1TRKA 2AJCA 4N6OA 2EAUA 1Z5OA 3C87A 2GN0A 1T43A 2WM9B 2IL1A 2XW6A 4KNYA 2VHEA 1T0IA 4R68A 4ZT2A 2WJHA 5KFXA 3OSUA 3ILYA 2D0DA 4QXMA 2Q9BA 3Q15C 1S3GA 1ODJA 1A3CA 4XOUA 4FSXA 4ROSA 1L5NA 1R5JA 1RYEA 3EC1A 3HJFA 2QPAA 3L6RA 1C9NA 4YT8A 3C97A 3DGFC 1WW2A 3KHGA 5JD4A 4TTPA 4F5EA 1N6LA 1JEYA 3H2SA 3HHEA 2OFWA 1RXEA 3WLTA 4PM4A 2P3OA 2RDJA 3FAZA 2XT0A 2PL5A 3PENA 1YRBA 4U2DA 5DFAA 2BCVA 1W44A 1XD2A 4US0R 3V46A 5KHAA 1TUIA 4HP8A 5IEJA 3VC3A 1E9AA 2P65A 1Z3EB 4ER0A 3EZFA 2GWRA 1RLMA 3AEQA 1K7XB 2DGDA 4NARA 4IZIA 4ZCIA 3A1CA 3RIXA 1GGNA 3Q3GE 2XIJA 3ITKA 1C30A 2RK3A 3MABA 1VQ1A 3DE5X 3FUTA 5CW1A 2VUIB 1X74A 5J5VA 3GWZA 5L8VA 4N39A 1E5DA 1OX4B 4BX9A 4OGKA 5MGBA 3BVPA 1BTOA 1R4NB 4J16A 2F43B 2HU7A 4JHXA 4BMDA 3UCXA 2ZRGA 1R8QA 4DC0A 4B33A 4USAA 1WNFA 3D7NA 5FWAA 2GPWA 1RXIA 1Y6JA 1IMOA 4TKVB 3IA7A 5EWLB 3Q5GA 4HLQB 3LPAA 4OHOA 3K0CC 3TZ6A 3SMQA 2EZXA 6REQA 4EI8A 1CR2A 1XQ6A 2HRRA 2KSOB 1S97A 1N7IA 1U04A 4E5UA 3IUMA 1TCUA 2HYDA 4YAIA 3HMKA 3LHDA 2EP8A 4PICA 3WWZA 1UKAA 2VJKA 1GPBA 4UZSA 2JS7A 3EHDA 2BHLA 2Q3JA 4ZQCB 3GILA 1L5MA 3RVQA 1GNQA 3N8IA 3GW8A 3SAFA 2B2CA 4UXJA 4ZEWA 5A5GA 5DTMA 3QXGA 4E09A 5DP2A 3JYHA 2A0WA 5FPPA 5J2JA 4EM6A 5K01A 3LDHA 2OV8A 4TVOA 4HX9A 1X1EA 4UEWA 3BL5A 1AUXA 1Z2PX 2X0EA 1YJXA 2FN9A 2NXEA 4D9JA 1ZCBA 4P6VF 1AKUA 3GA7A 1AD2A 5BV0A 2FYTA 2O2JA 1HK7A 3Q5EA 1I6MA 3AF6A 1FUYB 3CLSD 2IQIA 3JV7A 3T7AA 4HXEB 1NHWA 3OQNA 3OQ6A 4OQNA 4HDKA 5DNAA 5CB0A 1N7JA 4YCNA 5FWNA 2GRJA 4K8OA 1Z5GA 2H1IA 2VHUA 3EOZA 5KMGB 2X22A 1WXIA 5KG2A 1G4HA 1E63A 1K7YA 1YB2A 2GD1O 4Y18A 4J0DA 1O3YA 3X44A 1Z4IA 2JI7A 4C3VA 3LWBA 5E4FA 1K92A 1U2DA 1NZFA 2OHOA 3GJQA 4GF5A 2ZE8A 5IIJA 2X41A 5A0LA 1TKDA 1VPTA 2A6PA 1FBTA 2FZ4A 4EHFA 1YRWA 3ISCA 1TGVA 3OF2A 5HDQA 3VZBA 4Q4JA 5GIOE 4RBNA 3LK9A 1RRKA 1K8RA 5BN5B 5DBOA 1UZLA 2OMEA 3WMWA 1M73E 2NACA 1ZK3A 2CHFA 3W3AH 1AUQA 4C4RA 4LHZA 3QNWA 4NZ9A 1DAOA 4E22A 4DMKA 3L92A 3IP4B 2JZOA 2HF8A 4JY7A 1D0VA 1GXSA 5E6RB 3SCZA 2O2SA 5EIBC 3M81A 2NUPA 4QELA 4LMBA 1EHYA 3UHPA 1UP6A 4FLFA 5ELMA 4UB6U 1VKJA 4JLWA 4R4JA 2Q3FA 2I4MA 4C8OA 1CR4A 3OY2A 4OL0A 5DTIA 1D04A 4C4SA 2GRAA 3MVEA 3U9SA 4YFKA 2WMOB 1T10A 4V0RA 1G3RA 1G291 1GCGA 1DIGA 3KDPA 3N70A 2RI0A 1AA6A 2WZDA 1GVNB 3COJA 4WHMA 1VJGA 3W5BA 2MAXA 3LYHA 3M2PA 3NGXA 5T6BA 3W9SA 3PDUA 1E9FA 4EY4A 4LSMA 2F4NA 4LE1A 1UA0A 4GMKA 2GN8A 2P3QA 2AOVA 2CLLB 13PKA 4OJ5A 4AYWA 4KFUA 5FQOA 3OTOB 1YOVB 1EFHA 5B1DA 5BVGA 5KX5B 4LFAB 4L75A 2Y0PA 1Z18A 5CCXA 4KNVA 4LDZA 1G5TA 4OX9B 2J0UA 3ZOZA 4B82A 3DBLA 3ISVA 3AUYA 5I8PA 4AZVA 4NE2A 3INGA 1E64A 3GBVA 4B3RB 2HHCA 4N7RA 4DQSA 8LDHA 3PO5A 3LL7A 1DOAA 4IR7A 4ZVPA 4CQLB 1JHDA 2JZCA 3W77A 1LZLA 1SKYE 4QJIA 4I4NA 4C0WA 2AG0A 1QV9A 1Q83A 4EX7A 1QUEA 4FE4A 3QXXA 2AN3A 5A5DA 1P1KA 2OV6A 5K8VA 4I8DA 1BJKA 4IO1A 3H3JA 1Y3HA 2XNCA 2UZAA 2YV5A 2JCBA 3WI7A 3DKRA 5I7OA 1OREA 2X0DA 5KQSA 4MIKA 2JHDA 4B3JA 3RJ5A 2RHCA 4EA7A 2BYTA 2IHTA 4AJ1A 1NQAO 2AJLI 2BF4A 2OVFA 5ERYA 1QFMA 3T79A 2I80A 1XLUA 5CD1A 2PO7A 4XB1A 2GAAA 4O2AA 5EHQA 2R96A 2JAHA 3IHKA 4FQ7A 2D5AA 4R2IA 3L82B 3RYHB 1QQTA 5K03A 4FONA 3BCHA 1LBSA 4PLCA 2I7XA 1Y8CA 3E9YA 4HK4A 4FFRA 1OV6A 4EARA 1Q84A 3DEYX 5JNLA 4C8NA 2YR0A 4XLTA 1M2OA 4M0UA 5AHWA 2XE7A 5FUYA 1SKAA 2ZRBA 3KYIB 2DPGA 1V4NA 3OEYA 5JXWA 1EUDA 4JIGA 2REQB 2K4PA 4FOOA 4XJXA 1UDAA 1ZD1A 3NBMA 2BKXA 1NOIA 2RIRA 2CBXA 2RGYA 2WINI 2MIIA 1OIWA 4PFSA 5FYQA 2E21A 5FT9A 3M7IA 2UUOA 2DPYA 3F2DA 3K0HA 3CLTC 5FEUA 1BRMA 4LF4B 3AXTA 1NVFA 4GW3A 2XCAA 4ALIA 1J9ZA 4Q24A 5HX7A 2OCPA 4JSTA 4O2BB 4R8LA 1K2WA 1E20A 1OW5A 1SOMA 4B43A 1PTKA 1RSZA 2Z56A 1CSEE 1GFSA 3TW0A 3E2PA 4DCGA 1HQCA 1N2CE 4U5QA 3V7JA 3ETJA 3IULA 4A27A 1G16A 4F8YA 4LJSA 3CCFA 4MW6A 2E8MA 3NYWA 4PX2A 4WY2A 4ZVNA 3TR0A 4RVCA 3NCTA 1CUVA 2JL1A 4CDNA 4U3JA 4IQ4A 3EEBA 4BCDA 3K0FA 1FQJA 2A86A 3MJEA 4M0FA 3ICEA 3K1ZA 1M8PA 4AWXA 4IX1A 5FWYA 4K9NA 3ZHZA 5ALTA 2QPTA 4NCIA 2XMBA 3H4TA 4UTNA 3E5MA 3TX6A 5JJBA 1ZVMA 5AVRA 3VKUA 2D7CA 3S6JA 5FI5A 3IT0A 5KWJA 4L02A 1R0CA 1ZLYA 3C2KA 4G01B 2C2OA 3O92A 2GVDC 3ROKA 3MWDB 3S2GA 3STTA 4Y2UA 1ZMOA 2A9JA 5KTYA 4QZDA 1JVBA 5HS4A 5DQGA 3N2ZB 4UTRA 1GUAA 1MRNA 1K5OA 4HNRA 3T7RA 1WCYA 3VO2A 4JR2A 3GN1A 4HGYA 3X1DA 1FS6A 3UMVA 1M5RA 2JEJA 1SCDA 1G5HA 1E92A 3ABSB 3TB4A 4FINA 4ZYWA 2XAAA 3NATA 5LKAA 2ZYHA 1GV0A 4O1HA 1JEJA 4J9LA 3WIBA 4B9AA 5F2NA 2OO5A 1NYLA 1IONA 4I9FA 4HHEA 3V7WA 1CYEA 3GT7A 4QJ3A 4OL9A 2NUAA 4BVAA 1WVIA 2IY7A 1JZTA 1L3VA 4PR3A 3ISDA 3PTLA 5HF6A 4RE6A 1QHHB 4OJ6A 3UXHA 3H2IA 2XNHA 4RK0A 3O0TA 4QZCA 3SS9X 4OMUA 5L45A 2I99A 1JEAA 4UE2A 1TK5A 1X7YA 1GVHA 3A0UA 4CMKA 1N0IA 3RC3A 4LGVA 1M10A 2ZCJA 5KHOC 3A9RA 2VBFA 3Q4GA 1YT5A 2NOAA 2I6UA 2XVAA 3QA9A 2ZB7A 1U7WA 5CBPB 1V47A 3KTAB 5KC8A 3LC7O 4G0UA 3JRWA 2J4FA 4OMFG 2BFFA 1BD3A 2HADA 5ILGA 5KFGA 3IH5A 4JKOA 2P67A 3IE1A 2DUUA 1P29A 1V5EA 2BGMA 1N2HA 4YH1A 2EH9A 5ER9A 1TYDE 1WVMA 2O2EA 1KTIA 1G8FA 5IVPA 3W5AA 1G1AA 5EESA 2PKXA 3LUCA 4E5PA 1JFFA 1TTHA 1WDKA 4R0VA 4TKMA 4HJXA 1FMCA 2K87A 5JLJA 1UJ2A 2OLKA 1I9CA 4YMNA 4Y2HA 3MINA 2QMOA 1IIBA 3C3AA 4MLZA 4DEXA 2JG3A 4PPXA 1XSLA 2DFVA 2YHBA 5L7WA 2BHSA 3E2IA 5HW0A 3G2OA 4QQRA 1Y7PA 1P72A 5SICE 3WYDA 1AGYA 4C4AA 3N1UA 3RNLA 3VNBA 4TLLB 2CLHB 4FJ2A 4QIHA 1NUUA 4TMTA 2HREA 2P2LA 3E05A 3LWLA 4XUDA 3DOCA 3KEFA 3TPCA 2IRWA 1X1TA 1EFPB 1EFVA 5KX5F 5BYKA 4V0ME 5CP8A 1XFDA 2Y92A 3M4YA 4J7XA 2J6SA 3KOOA 1OZAA 3TLGB 1XHFA 3HBJA 1OH8A 4LY9A 2BFNA 4F4UA 3JCZA 1BDJA 1EFRA 1CD5A 1JL3A 5B4TA 4GX2A 3VJRA 4RWZA 5F4ZA 1G8HA 5EAIA 2BVNA 1GSIA 2UVPB 3H2YA 1BH2A 2Q8NA 3G2IA 3MF4A 2YVKA 1NNI1 1RMYA 4DLXA 3OICA 1KBQA 2W04A 2VHQA 2JAUA 4Y9DA 1CNMA 4JV2A 3SIPA 4O4LB 2OQVA 1VC2A 3EAQA 1ZCAA 2WP0A 3AKEA 1RHUA 4FN4A 1E9VA 3B2EA 4TMVA 4P3XA 2TYSB 4C7MA 3Q7TA 2Q2OA 1NVVQ 1B14A 1NG1A 1UPUA 4AMZA 3Q3JB 3U4QB 1DCTA 1B6TA 1YKGA 2FZWA 3IPYA 1ZH0A 3T9CA 4CLRB 5DO9A 5F7XA 1Q20A 2QLFA 2QRGA 3LQQA 1L7XA 1TK2A 4WA8A 3AR7A 5IJ9A 3R4VA 5IKEA 3QVWA 1QOZA 3T5BA 3B7WA 1BGWA 1FTWA 1KO4A 1Z6TA 2JVJA 4ASUD 1X13A 1PLLA 1SEVA 2CNWA 4BC1A 4MHOA 1ZM9A 4ZP1A 4RD3A 4DV1B 1W4CA 5K0FA 2IDJA 2OGTA 5H80A 3VH4A 3FNBA 4MGIR 3CVWA 3LYSA 2AE2A 1U0OC 4ZOLB 1OCEA 1ST3A 4ESVA 2MSKA 4NBWA 4NL9C 3MUNA 3M5PA 4OJMX 4ACOA 4FILA 2ENUA 2VPPA 4O2BF 2G67A 1EK2A 3WWYA 3K15A 4CDMA 2ZJ7A 5L3VA 4GZ6A 3GGCA 4G1UC 1XP8A 1GSAA 7ICMA 1JECA 4ZCLA 1LI7A 2BHNA 3BICA 1ZD8A 3GIKA 5DIFA 3R8CA 4B3XA 1CLUA 1C1XA 3S1LA 3ZY3A 1YFZA 2G5TA 2CFTA 4JN6B 3M7DA 1K3TA 1MO4A 3AWIA 4GBED 3JYPA 2BDEA 1TEVA 1JEYB 4K88A 3UMYA 3OQHA 3PWTA 1NP3A 1K9VF 1W2WB 2UXCB 3O73A 1RP1A 1S76D 4KDFA 5BY2A 1XD2B 3GRPA 4MKFA 2Z2IA 4OVKA 4B73A 1XO1A 2XMCA 4RPXA 5EOVA 4EX6A 3AEQB 3IAFA 5DK4A 3RS7A 1FFUA 4HYTA 2V55B 1IN5A 4WQMA 4XQGA 3SM3A 1C30B 4M46A 2KVCA 4ZZ1A 1V1RA 2PGNA 3GRCA 4PGFA 5DWQA 2C4KA 4EO4A 4CMGA 3Q3CA 3DO8A 4D8UA 2HHWA 3VR4D 1Z39A 2H1RA 1H2WA 3GCZA 1NRJB 1GSOA 3T9DA 3TSCA 2I2WA 1AJEA 2ZITA 1DEOA 2JIZD 1KYZA 4LZLA 3UN1A 1SHLA 4DQXA 1JF8A 1CZRA 3CRZA 2R79A 1P9RA 2P5SA 3EVZA 5J3JA 2WU8A 3RV3A 1BN7A 1SKWA 1Q2UA 5SYNA 4ZVTA 4AKGA 4XRHA 3FZNA 4CMBA 3I64A 3MTGA 6REQB 2I03A 3S8EA 1WD5A 2LMRA 4P7GA 3TRKA 1SC9A 1W85A 3LLSA 5LBUA 5CXUA 5ETJA 2ZP1A 2MSWA 4ZK2A 2JIMA 1EWKA 4L6CA 4N65A 1XWFA 4L0CA 4QREA 1RP7A 4C6SA 3ICVA 2OCXA 1GAWA 5T4EA 4DA9A 2AFVA 1SKSA 1OZ0A 3PW4A 2PGAA 1OQAA 4Z99A 4D4HA 1T15A 2AZTA 2EF1A 2NGRA 3KQOA 2QJTA 3I6MA 1PJ2A 2A1AA 4R98A 1AKEA 4IIJF 2IYUA 2Q6LA 4WWHA 4JJFA 2GMWA 4RKWA 4RFLA 1KH1A 5F1YA 3Q7QA 4GMHA 4F4YA 5EKXA 3P8ZA 5L4LA 1MB9A 2FF5A 4R2JA 4PGQA 2XB6A 4JYPA 1L4EA 4Q3NA 1D2NA 4AN4A 1P1CA 4W5QA 3C41J 1X38A 3GFTA 4RV5A 3CLKA 2P4QA 1DXYA 4GE3A 1LLUA 4QUHA 2BMFA 2A0UA 4K9OA 4EA6A 1OV4A 1NXOA 2NSYA 4J0GA 3F78A 1AQIA 2L2QA 2E3JA 1DXSA 2VCHA 2R48A 3OJEA 5LQSA 4HDKB 2BR3A 2AXQA 5AKLA 1PL6A 2K8BB 2NPIA 1KYQA 2JFYA 1ZQSA 2OWEA 1Q7EA 4A0FA 4FHCA 3AFGA 2DKNA 4W4TA 4INZA 3WMFA 2AOWA 1T3ZA 2VPWA 4MFFA 1AZLA 5F7OA 1SG6A 5TY0A 4XWTA 3WOVA 2RBEA 3DHWC 3EH2A 4UEQA 4DJJA 1O54A 1JR3A 1J2NA 4ZGWA 4OU4A 1ORWA 2HH9A 4HWGA 2YWGA 2QUJA 1UOOA 3FWNA 1UK9A 3JVVA 4KIWA 2B4YA 3P5BA 2FP4A 4Q4JB 1ANKA 1OF1A 3CRVA 3W2IA 2YHSA 3I04M 4RQ8A 2C9ZA 1SH7A 1OC4A 5E4JA 1RQ7A 3IX7A 2OV2A 4URZR 3CG0A 3FDFA 2V9CA 2Q5OA 4EUEA 2Q4TA 1LPBB 3MD9A 1NOKA 3FZGA 1GXSB 4O4LF 1CUXA 3K5IA 1F7VA 2CXXA 4W5TA 1RLJA 2NUPB 5C52B 3MS2A 2ESEA 1PR3A 3AU2A 4B1FA 3OZVA 4P58A 4KQ1A 3FCEA 1P0PA 3Q3IA 4EEYA 1SQSA 4KIGA 2Y0EA 2RGGA 4BO8A 3WLSA 4UM7A 3BH7A 2WMYA 1H8HD 5DHFA 1GTZA 2JGDA 3EIHA 1UBNA 1PW5A 5JS1A 3T1QA 4P4NA 3DL7A 1MORA 4MUAA 4O33A 4LWZA 5KWSA 3B51X 3L0CA 2FEPA 1W0KD 1NUHA 4HLUC 4XW2A 3RM3A 2CLFB 4RPZA 4TWAA 1ZQEA 3O47A 4KSBA 4O25A 2YV3A 5CH5A 1QGZA 2D8AA 3RJZA 2FJ6A 1Q11A 1I9GA 2G4LA 4CTJA 4MQFA 1DJOA 2BMJA 4RT3A 2D2XA 4NXZA 2HEIA 4DE5A 2WB1F 3WO0A 4CQMD 2BOVA 3JTEA 5KSPA 1GTMA 2J0UB 1SXJC 1L7NA 3EEYA 3DBLB 3B1WA 2KZ3A 2ZUWA 3B38A 4EG4A 3BF8A 5DCLA 4MVJG 3EXG1 2RMKA 3P9NA 5BXYA 1EVZA 2JJYA 4BFSA 1CFZA 1J6UA 4ZI7A 3FLEA 1QRTA 1ILWA 2XCUA 4DVJA 3RRMA 1MIOA 3UMMA 2BE9A 4CV0A 2VK1A 4XI9A 1C29B 1GIAA 2BBWA 1FFCA 3E3MA 3ETNA 2DF8A 1EEHA 4D26A 5JADA 4DLZA 3HLTA 4ZOCA 3GFGA 3G9XA 1NK8A 4Z8XA 1DB3A 4QO7A 3UM9A 2I3ZA 3F46A 1V1JA 4BNIA 3OJWA 4JYCA 1D6SA 5F51A 2BBSA 3M0EA 3Q3VA 4JMUA 4B47A 2MSEB 3EY9A 4A6DA 5EEHA 2R8ZA 1N2JA 1JGTA 3M4XA 1S3FA 4RTSA 2HOIA 1T6ZA 4CNQA 3NHBA 3E4CA 3R44A 3PI6A 4I6GA 4O2AB 3LTNC 5B5SA 3H0RB 1F48A 1MC8A 1Z07A 2FZCA 4G1CA 3QYJA 1HKHA 2GILA 4MARA 1O7JA 1ZR4A 1V7QA 3CS3A 4KLHA 3ADCA 3CVYA 2QP3A 1OFUA 1M2OB 1BU5A 3PFHA 2V9WA 5HYVA 5D1HA 2IHZA 1Y33E 2H3EA 4MWCA 4FMDB 5J0WA 1EUDB 2VF7A 1WYGA 1N92A 3GFOA 1T3TA 5KAIU 1ZIPA 3HY3A 3OPVA 2NRVA 4QVKA 2UZ4A 4RDIA 1N1GA 1Z2NX 1DXHA 2FR0A 1GPDG 1ZS9A 3E6AA 5DX8A 2GJKA 5CNIA 1HLDA 4JJ6A 2XUJA 3WWCA 4UTXA 4BVBA 8ICKA 1Q3KA 4GWGA 8ICMA 3AC0A 5ENDA 1IZ7A 5HK9A 4TRNA 4G3IA 2VHYA 1ORTA 1AF4A 3DFZA 4M0EA 1QZTA 4FK8A 3N8KA 4E7PA 2ORED 4H4EA 4RK4A 2OHXA 3PQ7A 2EP5A 4CU5A 1SBCA 5JPCA 1JXOA 2QLBA 5ALZA 4RNNA 5DEIA 3LSTA 4ITVA 5F9LA 1E0AA 4F1JA 2PUWA 3W1WA 5DCUA 2EJTA 2P4EA 2PZ8A 3KLMX 2HUPA 4YFVA 4AC9A 1IUOA 3L0ZA 2R5WA 4U3JB 3V4FA 5CA1A 4Q4DA 4ZT4A 5AM5A 3K0FB 3B6IA 1MUUA 5FWYB 3E9NA 4LPSA 1NUSA 4GFJA 3NIWA 3VC7A 4ELVA 4CIAA 3NEJA 4YXFA 1EDEA 2VDWA 4DNOA 3RF9A 3KEGA 4ZANA 1EP2B 7ICKA 1SRQA 3V4LA 1DPFA 5IEBA 4DMCA 4QUBA 4B4VA 2IHMA 4GI2A 4K46A 3AVYA 2LCQA 3ON5A 2WIBA 3B1ZA 1XMXA 4URHA 4F2WA 1XP5A 1RWMA 1DKUA 1R3DA 4ZCMA 1FMFA 3LUGA 1DKQA 2MJLA 5KFDA 3FDXA 4MIOA 1QO0D 3W3AD 4W9RA 3UWMA 2C0QA 2NQTA 4MULA 5JQGA 2QNRA 3CJQA 2WWHA 5FOTA 2P4HX 4MQ6A 4G85A 1OBHA 3H0KA 2D8CA 4EI2A 5BXQC 2P5UA 2NUAB 3ZTTA 4TWZA 5J2FA 1TA9A 2BQUA 1ATZA 1A50B 3IP6A 3AUSA 4LIPD 1Y8QA 4K7JA 3HUTA 4L4XA 2NPFA 1GG9A 2IDMA 1M2FA 1X7YB 5ED4A 4XFKA 3P9PA 1XFAA 2G63A 2C2XA 3QE3A 1ZU5A 1EVKA 1A8UA 5AQEA 3HJTA 1I7SB 1JP7A 3G59A 3D5EA 4U6PA 4KQKA 5E9AA 1V1MA 3WLKX 4KJZA 2AQIA 2BFFB 5B3LA 1V2HE 3LP5A 2C2MA 2MSNA 4TXMA 3L7YA 4N5IX 1XTZA 2X86A 2F7SA 4Z4HA 4M8SA 3QTLA 3U4HA 2CVHA 3DXFA 4FS8A 1JFFB 4C1BA 3M4ZA 4JC5A 4JJEA 3O83A 3EY4A 3G17A 1ZQUA 1H2EA 2VTVA 5K0ZA 4WZBE 2PPLA 1N25A 3MINB 4URUR 3WLIA 3O9MA 3A4NA 4XEHA 4GBJA 2YIJA 2CB9A 3D8BA 1V11A 4CT0A 1XU7A 1LB2B 3C3DA 1LPPA 3ZVLA 1Y48E 4QLAA 2K4HA 4PNEA 3ND8A 1VKNA 3WYFA 1MZPA 3OQMA 1DV2A 5AUOB 1JKJA 4LF6B 4JLOA 3WRYC 3WV5A 2JLYA 4KE7A 1YR6A 1CS4C 4B75A 2NP7A 3PPIA 3RREA 1EFVB 2QYTA 3LRTA 4PVDA 4EHBA 5TNXA 1BJTA 3DJYA 1NVTA 2R8HA 4E32A 1U5BA 1L9XA 4YMIA 2V7PA 3ZC3A 4GLFA 2QUBA 3L0PA 4X1YB 3WL4A 2JJ2A 1M6WA 4UULA 1T25A 4OSOA 3IQDB 1JG1A 4C4TA 2IF0A 3NM4A 1MA7A 4P86A 2G1KA 3VKHA 5ICMA 1JPJA 3HE3A 1QHHA 1E2JA 2FLLA 3SKYA 2R6AA 2X5KO 1YHYA 1VJ1A 1WMBA 1W7AA 4JKIA 2GPYA 2D06A 1GN8A 4UPEA 2FFHA 2P3LA 3TJRA 4NENA 4L4YA 3IBGA 5B58C 5L1MA 4ZALA 4B4UA 4HVLA 4F92B 3D2SA 5AK4A 5M7EA 2OYCA 4B48A 3FH0A 5JCOA 2XVXA 4IIJA 3VAYA 4FBMA 5HK8A 3ENWA 4O2AF 8OHMA 4DL9A 7GPBA 4LOAA 4ZARA 3ML1A 5AVQA 3KHSA 5J8YA 5FAKA 3TDKA 1G8MA 5IJ9B 1ETHA 1NAIA 1ZL2A 4TX1A 3TAPA 4LXHA 1IK4A 2GBLC 1EVEA 3ROTA 5BYBA 3CX3A 4RCYA 1KZ9A 1UZNA 6NULA 4KPFC 1CC1S 2BPCA 1ZCFA 2XHZA 3ZH2A 3SYTA 1JLLA 4L0DA 1YB1A 1WUDA 4ICAA 2XEXA 1RYNA 3NONA 4I8XA 3OT1A 2KV2A 2XH8A 2E4ZA 3EA5A 2ACEA 3NTRA 2A67A 4JP8A 1S9FA 2ZREA 2AG8A 4NY8A 1CZUA 1DJLA 5CB4A 2A9VA 1SOAA 1BIFA 1M6EX 1ZW6A 2NV6A 3TAUA 5JECA 1XRNA 1C14A 5IBPA 3TW6A 3NC0C 3LIIA 1AQJA 1YHZA 3JW8A 4DA6A 2ZUBA 4E0DA 3OOWA 4LJKA 1O0BA 4KACA 1LBEA 5A62A 2IWRA 4N5DA 1WD7A 3OMWA 1E3JA 1XK6A 5DYYA 2Q50A 5K3BA 1UF9A 5T8KA 3SF0A 3EDCA 1TCVA 3TGPA 5CCEA 1UBTS 3U7JA 2D5CA 3H5NA 3HCWA 4WEOA 1C1XB 4UMEA 3PFCA 3ZLTA 2IGTA 2BEKA 1E2PA 3PLAE 1SU8A 1OYWA 1QV6A 5T7BA 3CMMA 1TU3A 4I1UA 2QTCA 3DDWA 1BWSA 4UM9B 1RM4A 2GJAA 1IIRA 3IJPA 4P1ZA 4KN6A 3X0DA 1XHEA 1RAHA 2DQ4A 4C5CA 1QO9A 4KYTA 2WOOA 1W30A 3S5JA 1P45A 4FWBA 3ZDQA 4EY3A 5CG1A 4MQLA 4AQYB 4MVJA 3ODGA 3JPRA 1VYTA 1B3RA 1GZ4A 4DRXA 1JHYA 1QOQB 4ZAVA 1A9RA 1SCIA 3ZH9B 3IVAA 3EOBI 4CKEA 4CF7A 4TTAA 2IEZA 3I76A 3P27A 4W7HA 1KA9H 1V1RB 3VTKA 5TR9A 4AJNA 4PWYA 5IUNC 4HTFA 2WICA 2QL5A 5IZCA 1UMDA 3R9WA 3V1KA 3CO5A 4M54A 4MUNA 3BTUA 1CUSA 3Q1LA 3SY8A 1HTBA 3EBPA 4QQNA 2GHQA 2K4EA 1EJ0A 3DOFA 2HT1A 2YJGA 3RS0A 2JI8A 5EMNA 4MS1A 2O57A 3M6AA 2FE4A 2XYVA 1S0NA 3O3OB 5HF9A 1M0TA 4ECSA 1EVQA 3ILHA 3VKWA 1KL9A 5A3SA 4D79A 1J1ZA 3OOEA 1W85B 3BWEA 5C3MA 3TUIC 2IYOA 4ALNA 2BJHA 5F98A 3BGWA 4EBCA 2AN5A 2FA9A 3L4EA 3SZGA 3MT9A 3UH0A 3VSEA 3HV0A 2ACKA 2C58A 2AEMA 3D1JA 3W5DA 4Z0TA 3SYZA 3ZWPA 2QA5A 4R8SA 3FOCA 1GYPA 1J2JA 4QWDA 1NW6A 1IE3A 2CNNA 1EP3B 1Z0UA 3NIDB 2BEJA 4DM3A 3IAUA 4MI9A 2P4UA 2G4CA 4HDNA 1IQRA 1OXVA 4TUSA 3L8ZA 1WBDA 2OXCA 2PS1A 1GAJA 1L6NA 3PC7A 1EUZA 4KIJA 3RYCA 2EAMA 1WMEA 1N2XA 2VDKB 3EOAI 4GRDA 4NU5A 3ZVRA 3RJGA 4DJAA 1JHAA 7REQA 1RWKA 3HU3A 3LLCA 2GKGA 4G23A 3CR7A 3BZBA 2OCBA 1MX5A 1QYWA 4G65A 3SEIA 3RS8A 1YB4A 5CAEA 5AW4A 3QTBA 3O3NB 3CN7A 4DRYA 2GAFA 3MOGA 4IMIB 4QECA 2ZRJA 4E07A 2E5FA 1CTQA 2OCAA 1P74A 4RIFA 3DL0A 1V8FA 2HTEA 3H4MA 1FTNA 4Z3KA 3TZQA 5AK6A 2PKRA 2ISQA 4B6PA 5J2UA 1U3CA 1HR0B 3SZRA 3OCUA 4UVHA 1E66A 1QCYA 1B8OA 1I2CA 5C46F 4HADA 4LVNA 3D2QA 1Q0PA 3PNKA 2C5LA 2ESRA 5ALHA 1HT1E 5F23A 2GXQA 4MEBA 4FOLA 2I9GA 3JWHA 4KV7A 3KLPX 1E79A 5HIJA 2AL7A 3A9TA 3NTOA 3SEZA 2B34A 2FP4B 5KWEA 4B35A 3BBLA 1Q0LA 2P5YA 1PKXA 4YXWA 2W2KA 4N7BA 2WR8A 1JI7A 1NV8A 3PFGA 5FBKA 3LW8A 5E7JA 3M9OB 1JS1X 2OGSA 1L6RA 2W03A 3BD6A 2OAP1 1TQDA 4E7OA 2J3LA 1U2GC 4MK4A 1E59A 2GFIA 3QUBA 1MQ3A 4RF5A 1FDSA 4RPLA 5INTA 4EJSC 2O3TA 3H40A 4JJIA 3W9UA 4A91A 3MWJA 2FGJA 5E7QA 2Q6VA 1TYAE 1V3UA 4QKQA 4C20A 2QAIA 2V6IA 1LDYA 1A7UA 2BUAA 5A4DA 1QBKC 3BXZA 1PT5A 4OM7A 1U5AA 2C59A 1C4WA 5DDMA 4XM1A 4NESA 4WOPA 3AIIA 2JGDB 5DBBA 3OLYA 1L7RA 3DVSX 2J45A 1WOMA 4J9SA 3DDOA 2X8LA 1T1IA 3K09C 2FG6C 1O57A 3PRHA 1QCCA 4LJYA 1CDEA 5AVWA 4BNXA 3IUQA 1FPQA 3GOQA 5JZVA 1GZ6A 3RJKA 4MDHA 1TM5E 5CFPA 4KO1S 5T4HA 1JDBB 3E9CA 3UA4A 3FBTA 3FFWA 3FBGA 5HHHA 1Y9ZA 4I2EA 4V39A 1VE1A 1SKBA 5LLDA 2I2XB 3BXXA 2R1UA 1O77A 4UD6A 4MQFB 2W00A 4AMYA 1KY2A 4FGLA 3K20A 3TSYA 4JI0B 3GHYA 3K4PA 2FLPA 2PZGA 4PRZA 1O6ZA 2EJCA 1D5WA 4NULA 3G79A 4BNLA 3T5HA 4KQJA 2Z4SA 3A3PA 3IERA 1DQSA 1QPZA 2R8JA 1CT9A 5B12A 3OU6A 4ZI7B 1OGYA 3L1HA 4YT4A 3KVRA 3MXOA 1M6VA 4WGFA 3UXOA 1LPOA 4LMPA 4OFBA 5BWLA 4OO1J 2OB1A 1MIOB 2VQSA 4W5OA 3HRIA 2XQFA 2ACWA 1X6VA 4CCYA 5JAPA 5CIQA 5EQDA 4N3BA 3ID6C 3PQFA 1Z7YA 5FP0A 3ISBA 4HQOA 4AT1A 1SV4A 4PL2A 1RFLA 2JI9A 4KO2S 5FNVA 4KAAA 3RBAA 5ALYA 2EHDA 3PE4A 4X7BA 1LBTA 1D8AA 1SGWA 3NO4A 3W05A 1SR8A 2XMZA 3EQ7A 1PIWA 3IQHX 2WAQC 3I4FA 1RYUA 4DGSA 1N9KA 3ANSA 2H07A 2ONCA 3PKJA 5EPOA 1YZNA 5ALPA 2QUKA 2EV9A 1B4DA 2VA3A 4KMRA 1Z6GA 3A3YA 5TDHA 3G8CA 3CH5A 4KLNA 1T5TA 4UNPA 3EGIA 3WK8A 3CNQS 1T2CA 2W7PA 4ED6A 5EY5B 1MGOA 1BMFD 2CVPA 3K96A 4A36A 4U7FA 1O0CA 4PZLA 1T24A 4Q6BA 5KZMB 1EFKA 2OHGA 3DL2A 3R5TA 3EXG2 1THTA 1IPHA 1R0YA 4C2BA 1YS7A 5IWAB 2EW1A 2HLNA 3PL1A 1IN6A 3WKCA 4AZSA 4DCPA 2BCSA 2GWSA 3D2NA 2R0QC 2JH8A 1AS0A 1FYXA 2W4QA 2OG2A 4GRIA 4TGLA 3ETDA 1RXWA 2FUKA 5IARA 4KQGA 3PVCA 2F1OA 2KJ5A 3JTMA 5A71A 1FPMA 5LQAA 2VSYA 5L3RA 1CRQA 1OT5A 4M21A 3LX8A 2Y9PB 2MYPA 4B6JA 3KPUA 1J20A 2IXAA 3LQ4A 3KHTA 1RM3A 4HT3B 1UZAA 1Z4LA 3IXLA 3OVMA 3F7TA 4ES6A 5IT0A 1YUNA 5B2FA 5WRFA 2YFYA 3S8YA 4ZTBA 3ER9A 1IHDA 2RG1A 2OV3A 4O8CA 3GZTB 1FNSA 2AC4A 1ISHA 4D3YA 4MP6A 2Y27A 1JB1A 4HVAA 4M1KA 5CA1B 3D3WA 1M2JA 5FPYA 4UUMA 4HQ0A 1LX7A 1SZCA 1XLWA 1CKEA 2BKUA 3EPGA 1KS9A 2WKSA 3C6XA 3SFTA 2D00A 4G4GA 2VDWB 5H70A 4Y2SA 4QDZA 1D4ZA 1L5SA 2C2WA 3DBOB 1SUFA 2Z98A 3MRTA 1AXEA 1GKKA 1CHDA 4DLLA 3M6UA 2G3YA 1W36D 2XB9A 5JZMA 4M53A 4EJ2A 2KHQA 2R4QA 4X63A 1FLVA 2PWPA 3W7VA 2PVPA 1BPEA 4FZ3A 3GI1A 5ANRB 2D6FA 1SVOA 1Z0FA 4H17A 4TSFA 3EXEA 1R0KA 3A6JA 3RC1A 2WKPA 3SC6A 1ZN9A 3T8YA 4DUGD 2JGIA 1VJDA 8ICAA 2UYOA 2LKDA 4OBEA 4ARAA 5JQGB 2IP1A 2XDWA 2WTNA 4LWOA 4IAOA 1Y4SA 2QV7A 4ZFNA 4BMSA 4TQ9A 1GADO 5DBCA 4LA4A 2I4TA 2ODNA 3JZFA 1RVDA 2AI1A 3CC8A 4V0SA 3AEXA 3TLXA 1Z35A 3RPEA 1OH7A 2Q27A 3C98A 3SVLA 2DUMA 2Q07A 5B64A 1YV9A 1Y8QB 3KWJA 4HMOA 1ACJA 4QBKA 3WGHA 3IXMA 4FYYA 2DHCA 1U8FO 1UKEA 1UOPA 1O6FA 4KGZA 1E2UA 5AJHA 4BNMA 1FXWA 1UM8A 3MCZA 3F5QA 1OILA 2FX2A 1VMKA 3RG8A 3KKLA 2ZYGA 3I52A 2Y9UA 2Y76A 5MN6A 1BD4A 4OTZA 3VO8A 1G5RA 3QH4A 5F5NA 4ED1A 2YTUA 2WF6A 5FH9A 4DG5A 1V1MB 3U7GA 1CY6A 4GM0A 3MDCA 4LJ7A 2BD0A 4OHRA 4IRCA 3C1OA 5J9FA 3ZQJA 5PNTA 2Y4NA 1DDOA 3IALA 1GQOA 2I1VB 3O4JA 2QGFA 3PFFA 3RUAA 4D0NA 1IY8A 2FH5B 5EFOA 4PZDA 3TSOA 2JEOA 3UJPA 2JD0A 3S3TA 5DASA 4TTQA 3GY0A 3I53A 3H4BA 2CKDA 2AQ4A 3GRUA 4MO2A 3KQMA 2XGSA 3EC7A 1VGQA 3ZS9A 2YWJA 4ENTA 5L95A 1YDGA 1HORA 2F44A 2XCOA 3U31A 3MFIA 4DZTA 3NEAA 3UXPA 1R4ZA 5SZHB 2AN9A 2FLVA 3QIVA 2Q3BA 4RM3A 2FMQA 2CXNA 4KE6A 2WJWA 2JK1A 1U28C 1TW2A 1UJ4A 2BH2A 4ZT3A 1V11B 2GEJA 2R2AA 2IYYA 5EERA 3OFKA 1HNWB 2ODTX 5HZKA 5AKGA 1JHMA 3FTPA 5JZOA 2HPZA 3CKMA 4RQ1A 3A7EA 4ZXFA 3CUYA 1JKJB 3QVXA 2OCKA 4PHDA 4HB0A 4O2RA 6GPBA 2E4AA 1OJ7A 2AMJA 1ED1A 2O8CA 2BEUA 1O8CA 1U5BB 2QM7A 5FBLB 1RLTA 4F2HA 2C7QA 1UHUA 3OIVA 10MHA 4QDKA 3ZOKA 4AMUA 3NHRA 2R2GA 4P3PA 1L4UA 1KK3A 2BPOA 4QRDA 4XX0A 4ZI7F 4FYWA 4JGBA 3EIOA 2NSDA 3WMEA 2WTEA 2IPNA 4U02A 1HQKA 4MW5A 2XMPA 1FFDA 5D84A 1TTPB 2RFLA 1NJYA 1DC3A 2YXDA 1BCSA 1JDJA 4BEVA 4NCHA 4NENB 1H9CA 3FWZA 3GXOA 1V25A 4QATA 4N5HX 3DKPA 3K70C 4JP1A 3V80A 1TIPA 5AXCA 3SKXA 2ZR7A 2NZVG 9ICPA 1XZAA 2JIDA 2PCJA 1AKRA 4AF7A 3N2LA 4BX2A 2G4VA 4NCJA 3VSCA 3LUBA 2X23A 2PH5A 4DSUA 2W8BA 4PG6A 4IIJB 1X1SA 3UGJA 4I1PA 4WXYB 4F84A 3BFXA 4J43A 4R1NA 2P77A 1RBYA 2DR2A 4N8DA 5ALUA 1CK4A 3AV3A 4EUFA 3ESXA 5CEEA 2QLJA 3AYZB 2R65A 4PZNA 1OH6A 1NMXA 4WCFA 3GIMA 4PGXA 3KEMA 4KQ2A 1IY0A 1E1RD 1PDWA 4D6XA 3SSMA 3Q98A 1L1RA 4BS9A 4FI3C 2ZKIA 5KNDH 5IVHA 2ZQZA 2XMSA 3CCCA 3WHLA 3WLOA 4BMZA 2ZAMA 4X3OA 8ICRA 4HMPA 3ZIAA 3MR5A 1RC0A 2G76A 1JLLB 2WWWA 1QG6A 1CQPA 3IIEA 4G24A 4CKXA 3I5YA 4QZEA 3OT1B 3JQFA 5CFLA 1NF3A 3UV7A 5DNEA 4BEBA 1NKTA 4MHTA 1TYCA 1YK0A 5CLJA 5CB4B 1M1YE 2OV1A 3CRNA 1DBWA 1Q57A 2WV9A 2KEYA 3E61A 4FZVA 3ZZ0A 2OFXA 5DN6D 2RQ5A 4C7OA 4AG3A 3DTVA 3GQBA 2O1WA 1YJAA 2PUJA 1XA0A 1MJNA 3U13A 3ZJTA 2HWYA 5AOAA 1AV7A 4X1YA 2ZRDA 3SHTA 5G0SA 1ZVQA 4UTZA 4TVKA 2GSWA 2O8BA 1TMGE 4GXTA 2G5IB 4CR7A 3OQ1A 4ZPJA 1XAIA 2QJFA 1DAMA 2HXGA 1P5ZB 4E11A 4Z6FA 3EH1A 3HXTA 4AWAA 4QIWF 3H9UA 3RJIA 1JFLA 4OHXA 4GC5A 4RHUA 1KORA 3D6NB 4G5GA 5GVSA 4B6RA 5CA1F 1CDOA 4QOGA 4N03A 1C3OA 5HCNA 4KRGA 3JQ7A 3BXOA 3ZHVA 4YR2A 4HNUA 4J3FA 3ZQUA 3PXGA 1QF6A 4H0NA 4NE9A 3TKAA 2P30A 4RGYA 1UJNA 1H5QA 3ZVKA 4TL8A 3CF6R 1N75A 5A9TA 3B13B 1NVXQ 3NUQA 1VDZA 4ZQGA 2GAJA 1UBEA 2NAPA 4PYIA 3A4LA 4LDJA 1LX6A 4DRXB 4R1SA 1EAYA 3GAMA 3B20A 4CKEB 3H2JA 5BSRA 2RGEA 3SR4A 3IPXA 5ELXA 3SJUA 2FEXA 4KP7A 4P4SA 4BYMA 2B21A 2EU8A 1HG0A 4HTFB 4V24A 3K75D 5DRYA 1ZGCA 2RJNA 3GPCA 1UMDB 1LSUA 2HSZA 3U1TA 1LB1B 1P4GA 5JQGF 2ZTHA 1KI3A 3LZCA 4B8YA 3I9JA 2QVGA 3BHIA 2CHEA 1LD3A 2YWFA 1KEJA 3T5KA 4K2HA 2MDTA 2PNJA 4NS1A 5I5EA 1L7QA 4XYGA 1OX6A 2XNDD 5B4UA 4OLAA 1Q44A 3EBLA 3OE5A 5THKA 3MGHA 5DX0A 4MS1B 1P1RA 1Z3IX 2OWOA 1I8TA 2JHGA 4RMIA 3T3MB 3PW0A 5B57C 2VDQB 5K6AC 1T8UA 2W90A 2WIDA 3FPSA 1C8LA 3UKJA 3QVKA 3KHHA 1VP3A 4CV2A 3LOQA 3CE9A 1I3MA 2NO1A 2NYUA 3AQEA 3S29A 1ZGZA 4FKMA 3RRHA 4UVEA 3KQVA 3GFBA 2F55A 2J9XB 2J7PD 2DPMA 4IR9A 3L8EA 1VKHA 4ZMBA 4L8YA 1QQ5A 1IBCA 1K7SN 2BFPA 2JGRA 4J29A 1EBFA 4ZPXA 2XVMA 3PXEA 1XSEA 1RJ9A 4OLFA 4KMUA 3ZTWA 4EW3A 4HDNB 4IJQA 4A2PA 5EJIA 4HAUA 4GPTA 3R7LA 3RYCB 5E1DA 3BE5A 1SHTX 4NHOA 1T3QA 2WSBA 1GUYA 3CZ5A 7REQB 1T7PA 4BRWA 1FFSA 3DHEA 1ZQNA 2VDOB 1UFOA 5CAEB 1K89A 2I4IA 1QVWA 3H83A 3W8NA 2GA8A 3EXIA 4UUAA 3II6X 3IOBA 1C9EA 2QVYX 1X39A 3AILA 4Z6CA 4P83A 3VNVA 5KIAA 5LWQA 1JU9A 1IJKA 2P4SA 1AK2A 5CVEA 4DLUA 2W4IA 4WCDA 4IJWA 3QMPA 2XA9A 1XDDA 7ICJA 3L0BA 3KUUA 5J2UB 3UW3A 2B37A 2IYFA 4FNOA 4QZAA 2O3JA 2QIPA 4G1FA 2IK8A 1R6TA 4ZEVA 1Z4MA 4DLPA 4H0FA 4ZQEA 2JGLA 3I5MA 4DMGA 4CCSA 1UZUA 1Z6QA 1KP3A 2Q2QA 4O5KA 5LLSA 4ZHSA 3LCMA 1A6SA 1FYDA 1TT5A 1AQ6A 1ZC4A 3L8MA 3RF7A 2R7KA 2W2KB 1F1JA 1AC5A 3G5LA 3MB5A 4G1MB 4R69A 4QICA 1UC9A 4DWWA 1TZKA 1IDN1 3KQQA 3L49A 3U2QA 1YR7A 3T9FA 4OQFA 4ECVA 4BQEA 3RS5A 4B84A 4B0PA 5FLEX 2ZUVA 3DC7A 3QEKA 4KODA 3U81A 4UEOA 5HF5A 4MUMA 1NM5C 4ZKDA 3WZLA 4AF8A 1V6CA 3DB1A 4YCJA 4L3VA 2PKWA 3TEFA 3IR6A 3RAJA 3WL8A 1A69A 3UBTA 2CXSA 5G2OA 2DRIA 1J56A 1A7JA 3MJHA 3V7YA 1TKBA 3SG0A 4IJ5A 4DLWA 2HX1A 3CVJA 1NVEA 2BDPA 3MTDA 2GI4A 1GTG1 1SKQA 4GLLA 1VI6A 5DRTA 3GJZA 3FHTA 4FZNA 1NV9A 2X3UA 5JUWA 5FADA 3IAM6 8ICFA 4A8HA 1RQNA 1U1GA 3T1VA 4F5YA 1GKLA 1L5RA 4JU9A 121PA 1QHFA 2HI0A 5ALMA 2AQHA 4WLVA 1KSPA 3I58A 1BKYA 3QV1A 4JV1A 5BV7A 2V4QA 4TWJA 3KPJA 3B9PA 5EJFA 1RE0A 3PCRB 5J5AA 2ZQ5A 1M1ZA 3R7SA 5JH7F 4HZIA 1IRXA 1JA0A 1PGNA 1U8EA 2OBBA 2DERA 4W5HA 3HYRA 2YRWA 2BTEA 3HN2A 5BRAA 1CQIA 2B7LA 5CB4F 4CRWB 1M6VB 5ERGB 4XCQA 2QXTA 4LOJA 1G5FA 4IL6U 2APJA 4GOLD 4CCYB 3NV7A 3AZPA 5TVKA 4P0PA 1N1DA 5AVVA 4QHTA 5DPMA 4UMDA 4IPTA 1V96A 1WABA 2O6KA 3WYEA 2PT6A 4MFAA 2R44A 4LDQA 2HOFA 3ORRA 3A4YA 1ZWKA 5FNVB 2YJZA 5L4NA 3FDSA 3HP4A 3CUKA 4US2R 1HTTA 4FM9A 5C4MA 2CBGA 1DRVA 4DR1B 1KHTA 2EEZA 2WPNA 2YY7A 4J2HA 3PUWA 4KWIA 4BKUA 2ID7A 2C29D 2PS9A 1TVKA 2C1ZA 1PWXA 3AW9A 3O90A 1MFPA 3BRQA 4ZYUA 2G5PA 1J8VA 3D0QA 2XTAA 4B3FX 5C8YA 2FSHA 5CT5A 2KHVA 1ZSVA 1H42A 2PE5A 2ANBA 1E6KA 1R0XA 3LRPA 3RSOA 2E1RA 4D45A 3DAFA 4II2A 4J1TC 1DIAA 1Y3IA 4OPMA 2HMUA 4ZC1A 4MVJF 3A0BU 4P2BA 3HRDD 5FPQA 1V4VA 2BHRA 1ULAA 2Z3ZA 4RXUA 2H9IA 1VZ2A 4JT4A 5ULLA 1AVTA 2ZBEA 2HBYA 1QYVA 4H1VA 5DNWA 1TL7C 2XGPA 4JYBA 3H99A 3TBHA 4R16A 3DWFA 4C1NA 2TECE 1KHHA 4OV6B 4QWMA 3B89A 4LFCB 2ZATA 3AF3A 2W42A 3HXKA 3IVGA 3AWDA 3AG5A 2C2HA 2X6QA 4ZVOA 4RULA 4HH4A 2DR0A 2KD1A 2NO5A 4QVIA 4WN3A 4E31A 4RF2A 2E48A 4BB6A 2ZJFA 1JQ3A 1ZQ1C 3A1WA 2OGZA 3QZ7A 5DBGA 3M9XA 3DYVA 2KYRA 3B6MA 2J67A 2J41A 4BB9A 2XAUA 2PGXA 2IY9A 1LGYA 2R66A 2Y0SC 3E15A 3O3CA 3HY4A 3BM5A 2CWWA 1KYVA 3OUUA 1MJ5A 1XRPA 3DWGA 2CVQA 3D3WB 3RFAA 1NWHA 1VFNA 4N3NA 1HMYA 4EABA 1P4HA 2RJ3A 4DL6A 2JRCA 3AM4A 3V7KA 1HEYA 2AF4C 2RHFA 5EMMA 1JAXA 2H0RA 3FPCA 3T5AA 3IEMA 5TGZA 2KZZA 5SZIA 4YRTA 2CYBA 1U0RA 1WHSA 4S2UA 3RUDA 4LZZA 6PFKA 2IH4A 4D97A 4MHSA 4UZFA 1WJGA 3BQ1A 1JSCA 4OHMA 4TYWA 5GP1A 4M9XA 1NBMA 2M1XA 3F8TA 1HDYA 1ECBA 1QFXA 4OI4A 4PZ0A 2UYGA 1R1DA 2Q9UA 2XUAA 4MCHA 3EXEB 1EYZA 1RMQA 3H1FA 1RTTA 4AL4A 3FVTA 1AG9A 4TYPA 3QV2A 4HXYA 5E2AA 2XUZA 4RPJA 2NXJA 4FN5A 4MOWA 2QAGC 1IHUA 1TTTA 4FS3A 5ESRA 1M9NA 3AMZA 1M5UA 2X8BA 5JDIC 4DUZB 4Q16A 3ZJ5A 2H4ZA 1PVOA 1M2EA 1B42A 5J2UF 5DNDA 4C0AC 2YRXA 2WYUA 3R6LA 1YAHA 4XQ9A 5ALDA 1UFVA 3D8SA 2QE6A 3OQIA 3IBYA 1KBZA 2EERA 3L7KA 4OQQA 3U48A 4QW9A 4L5IA 2PAFA 4LYHA 1EU1A 1Q74A 2AFIA 2J6CA 3TEJA 2YC4C 1R9NA 4A9AA 1WL8A 1GGVA 2XB4A 5KO2A 3S2EA 4TOIA 3JR3A 4QULA 3EX7C 1PX2A 3ASUA 5I7UA 1TM2A 3KJNA 3KB2A 3HACA 3I9FA 3A3OA 1UK6A 1S4MA 2MR5A 2XYHA 2CXQA 4HRAA 1Y1PA 3USCS 5DM0A 4AICA 1VSBA 1XA3A 3N53A 4DCTA 3P0IA 4IMRA 3HN7A 2JI6A 5SYMA 2J3EA 4E1AA 4IV8A 1TQ6A 3WWPA 1X40A 4L78A 1HDIA 2PXXA 2A3RA 9ICMA 4D99A 2PHZA 3NAZA 2XQIA 1LLCA 1B6SA 2O0HA 2D1YA 3HKDA 1YZGA 3TBFA 2PJDA 1F3LA 2X1LA 3U4IA 1N57A 1J2MA 4PEVA 4B7XA 4G0OA 1TJNA 3W6PA 1JTVA 2TSYB 1UDXA 2B20A 3ZDYB 1I2ZA 2A30A 2PTHA 3ET5A 1JHXA 3NHJA 4YXJA 2HHJA 1JJIA 4V1CI 2CFRA 2J30A 5A7FA 1YZTA 2HFKA 1NPYA 3ITDA 1GZVA 1KEZA 1KGSA 5K99A 4REQA 3EQZA 4R6XA 1IU9A 2O5VA 3H2BA 4IV5A 4HRYA 4F5NA 3KTDA 3MAJA 2DUJA 4C4PA 4OHUA 4AUNA 3JPWA 2DWUA 3WK9A 4DLTA 4M0DA 1WOYA 2PKYX 4UDOA 2RH4A 1WZIA 4ODIA 4EUSA 4IIGA 2VQ3A 2BEUB 2O8CB 2JCSA 3E5NA 4KGDA 3OX3A 3D2AA 3GDHA 4CHTA 4C0JA 1T94A 1VBNA 3N0VA 1F2DA 4IXNA 4QG3A 2VP4A 4XX0B 1JIQA 3Q5DA 1WPXA 3JVUA 4OJYA 3R23A 3R2JA 3H4VA 1DFGA 2AVDA 3UPDA 3LCVB 5EUMA 1OT3A 2NRXA 3JX9A 1LLQA 2CNDA 4Y98A 3LC1O 5KYKA 2PMEA 1K3UB 4CCAA 2Q6OA 1CP3A 4C4OA 1BCSB 1QE5A 1Z2EA 2EGUA 3MGCA 3K2IA 5FNVF 1P7VA 5TPWA 4FWTA 2DSTA 4V0NA 4GKJB 2XX3A 1ML3A 5JEEA 3GUUA 5G0WA 2G1JA 4AYBC 4BEWA 3TGLA 3N87A 2CFIA 3N2KA 5EQJB 2W8BB 4PCAA 1YFLA 1TUGA 4MV7A 1VHQA 3HMQA 1Y1LA 3UAOA 1XD8A 1OHHD 1ZINA 3LHKA 5JATA 1WWKA 1UC4B 4ZJZA 1KEEA 3TRJA 3NM6B 3F2IA 4WCFB 5KAPA 2DKXA 3E03A 4YUXA 3T3GA 4IFEA 4YC7A 1XT6A 4BRUA 1CFJA 3ISTA 2SCUA 2ZOSA 4V2UA 2VCYA 1NQ5A 2LCIA 2OHFA 1U1EA 3BHNA 2IYPA 1PK3A 4I2JA 3DOOA 2FFJA 4JJKA 4UXIA 4KE8A 1KIAA 4B3CA 1IK6A 4PLPA 3PDJA 3KPWA 2BCEA 1R64A 4XDGA 5KQRA 3PGXA 3ONDA 5A03A 3G6WA 1AKVA 4WOJA 1KZ6A 3ND7A 1RHJA 3TOXA 5DCYA 5KCZA 2RCYA 3GPIA 3M89A 3R0IA 1PHPA 3W1VA 4PTZA 3CLRC 3JQDA 1XMVA 4JQCA 1N5RA 1VZ3A 3D5TA 4C7OB 3TLJA 2JARA 4KR6A 3WJ2A 1J5XA 3OI7A 5GGXA 2CDNA 3DTVB 3GQBB 1PK9A 4NCNA 1T2UA 4RZ2A 1MXFA 3AHGA 5EMHA 4Z4QA 1GP2A 1B73A 2CF5A 2C8KA 2E5WA 4Q47A 4RIGA 2BR0A 3GJ6A 5TX7A 2O8BB 5H02A 4R71A 2KPOA 2AD5A 4UATA 3PQ6A 2D7DA 1QANA 1QVVA 1H8ED 1P60A 2ZJYA 1ADFA 1V9LA 3MERA 4WBNA 4FYPA 4OHVA 3ULKA 2D5BA 1CDZA 3L07A 3TFQA 3RBEA 3F53A 1DEXA 2VSOA 3L1UA 2FW0A 3A7DA 1C3OB 1N6KA 3EDYA 2CDAA 5DDIP 1YFKA 3WYCA 3T3DA 2VH1A 4AK9A 4ECTA 2ZIFA 2IEYA 3WC4A 2G06A 3T7SA 3JQ7B 4UW9A 3CISA 4KNWA 3T95A 4DQPA 1PFGA 3HBFA 2C20A 1V4BA 1G0NA 2LGJA 2YZGA 5C34B 2Q1SA 5BOSA 3C6BA 4GC6A 4M9SA 1Z5PA 4M22A 1KO8A 1MR3F 3FD8A 2ZI9A 3RJ9A 4CEJA 2A3VA 4AM8A 3HSSA 2RKWA 3WLJA 3I28A 1D3AA 1AZTA 1QUFA 4FFMA 1QKKA 3CLVA 4UQPA 1Z36A 4EFNA 5LVAA 3FOBA 1SKMA 4BMVA 1E98A 1YBHA 4P4SB 1GUZA 3M83A 4I5FA 2YX8A 3B2QA 3BXEA 4B34A 5M34A 1I14A 4PAWA 1ZOSA 3V8QA 1UEXC 3TG8A 4ZVLA 4QYWA 4IQ0A 5J2HA 3RBZA 2NVUA 3OO0A 1YMQA 5KFOA 2I76A 5G53C 1D5CA 4KQFA 3UJ8A 5JH7A 1NXPA 3PR1A 1M2KA 1CEEA 4F85A 2BELA 2XJ4A 2V5VA 2IYXA 3W5JA 5HKBA 3DSRA 2WHRA 5ILOA 1MA0A 5C3UA 4C03A 2WLTA 2Z08A 4MVYA 4WSOA 8ICEA 1DBVO 4C43A 2UVUA 1D4FA 5EJMA 3GCGA 2KJQA 4R2XA 3OBBA 4Z2AA 5FL3A 2QOEA 4PAMA 1DXOA 2E87A 5LQUA 1FXWF 3THOA 3ABRB 3O26A 3W5HA 3L0SA 2F1HA 3TI0A 2G9RA 2XWQA 3V4SA 4UHJA 2BR5A 3HWSA 4MZXA 3T5MA 3FM9A 5CYPA 2ZB2A 3EZ6A 1QKJA 3REFA 4UPDA 4X41A 1ABFA 1MW8X 4MEJA 2PT5A 1IOZA 4WZAA 1RJ9B 5CVJA 2PBFA 3HSYA 3OEED 1FRNA 5K8TA 4RNDB 4PQEA 4BWJA 2ASEA 2LKCA 4F3CA 1SC1A 5K3OA 2L0XA 3FCXA 3LLVA 1NXVA 4AJLA 4KLLA 4IJUA 4N41A 4BTEA 1A4UA 2ENWA 3D7MA 4B46A 1UK7A 1DRKA 2B1JA 3F71A 4PYOA 4GQBA 4EPRA 3K9LA 3ENVA 1E7RA 3RAQA 2Q3DA 4DSIA 5AVYA 2FLWA 4QUEA 5J29A 2MHCA 4BBAA 1M76A 1SQGA 4Y0VA 2W43A 3T15A 2XECA 1ISGA 2FKAA 3EXIB 3ZHYA 1XRSB 3IPRA 3LVWA 1X77A 1SFRA 3LG2A 4RPIA 3P9YA 5J2TA 3V1YA 1PX0A 3E8MA 1JH9A 3JYLA 5IRCD 3HNRA 5TISU 4WFKA 2XNKA 2V7EA 5CXXA 4MVJM 4JI2B 4EPWA 3P45A 1UBHS 4UOEA 1PCXA 2IW3A 4TRMA 3WADA 2X0IA 4H1HA 3EODA 2QQEA 5ALOA 1EINA 3LD9A 1NJZA 4UCFA 3V3TA 4OJQA 1S3SA 1P80A 4KXMA 4LNUA 1HLFA 3FB1A 2PFKA 3AB7A 4IM7A 2P68A 3LL4A 1E8NA 4YMSA 2Z9CA 2F3QA 4Z1MA 3FYUC 4PSVA 1NL3A 1TF2A 3EAGA 3O5AA 3PHLA 2GO1A 4LZPA 4NK5A 1F6BA 1TT5B 4H0CA 2H0AA 3DE4X 2O8VA 5DEOA 5JV5A 1SXEA 3O8DA 3KAPA 2RC6A 3HYNA 2PMDA 5HOEA 3VZPA 4OGWA 3HFRA 4AJ9A 4F5QA 4RA6A 1MH1A 2IUSA 2XCLA 5B36A 5C1IA 5KNDD 1WV0A 3E5RA 1CR1A 5E4YA 4BRZA 2QMQA 3VNAA 4NKRA 1THZA 1R4MA 2QQ5A 3I3SR 4NG4A 1W0JA 3ESBA 2IIVA 5D86A 2Z7JA 1LBHA 4S0XA 5HJ5A 3JQ8A 2JCXA 3E2MA 2JXJA 2A0FA 2VQDA 3RFVA 5A7GA 4K6FA 2CFOA 2OZPA 2D54A 4ETWA 4JMPA 5MFZA 2FWBA 2V4ZA 4P4MA 2EBHX 2WU3A 3V1NA 5CLHA 1KP2A 4MEAA 3QELA 3TFWA 2UYHA 3AHCA 2VF4X 2RHGB 3R0VA 3Q6MA 3H0MB 2WUVA 4CXMA 2DH5A 3D02A 4ENQA 3UZUA 3L6BA 3K0CA 2B98A 1E9BA 1JJBA 3ANNA 4KXWA 3I34X 3G9QA 4G5XA 3L4KA 1ZMTA 2VQ6A 3KLNA 5JYCA 4XYLA 1U9IC 1B23P 1TNDA 2CXRA 5C1PA 4P3YA 4G89A 2B6NA 2HRZA 1KDYA 4GPD1 4AFNA 4RS4A 1MX9A 2RH5A 1SWWA 4IDDA 1W25A 5BYJA 3T9EA 3IJEB 3D0RA 1JT9A 3WL6A 1TF7A 2H63A 3V4OA 1CQIB 1E9CA 3EBOA 2R9VA 2Y9TA 1R4AA 2WTFA 1E32A 3PT5A 3M9NB 3HA2A 3ZE6A 4EIWA 3GAFA 3PFWO 2B6GA 3SYMA 4YROA 1YZKA 1HEIA 3K2QA 1TZ2A 4KN7A 4DLYA 4R1UA 4P0PB 3ENQA 1ZIXA 4L4UA 3FY4A 3ANLA 2J9RA 7ICGA 1LDMA 4LXTA 2QX9A 4LJLA 3CFYA 1K27A 2XVYA 3M6LA 4UEKA 2W48A 3X1KA 5TQ0A 3TTWA 1DRWA 3BGVA 3QFTA 2BFMA 5HBGA 1F9AA 2Y4OA 4F38A 3CG4A 4ZEOA 3BE8A 1Q21A 2OXRA 3CH4B 1MN8A 1SVUA 1NJXA 4JOBA 1TVKB 1V7PC 3LKBA 4O02B 4D43A 1WWUA 3GLFE 4IDGA 3EULA 2G04A 1VPEA 4MUHA 1KFTA 5C8YB 5EIWA 1MVNA 1OI3A 3EIWA 3GELA 2Y1OA 1QXSA 1Q6YA 4RQ6A 1JBEA 5A2QA 1CU1A 1G8YA 4X5OA 2KP7A 3FKSA 1VCNA 3C8UA 2F3UA 1EFAA 3AERA 4E4TA 2ZYDA 4WXRA 4RDHA 1YIOA 1ZQCA 1TM7E 1UEJA 3D6UA 5HGJA 1NI4A 2WK1A 2FWAA 1MTOA 1SOVA 2I87A 2Q3LA 4CR8A 5LQNA 1W9MA 1OUQA 1F0KA 2W2VA 5EG5A 2CYCA 3DKKA 4IUBS 1B93A 1GFZA 2DC1A 1I5OA 5AJYA 3U16A 1JI0A 2HSGA 2B1GA 2J33A 2ZJBA 1QVRA 1CF4A 1QLNA 1T0JB 2VDJA 4O5OA 3LT5A 2AR0A 3EDQA 1XMJA 4AY4A 4DSEA 3VPAA 3FR7A 4R8UA 1JDNA 3ZD7A 4DL5A 1V85A 1YB6A 1TXGA 1CZNA 1XTVA 1XTRA 3NMUF 5KG4A 1B0ZA 4Y6GB 4NBNA 4BNGA 2OBXA 2FRVA 2HPHA 1E1LA 1SIOA 2DFNA 5J4KA 1U0NA 3L7BA 4J9PA 4IUCS 4PGGA 1VMIA 4X8LA 4D80A 3CXRA 2V7UA 4CL3A 3K9NA 3RIYA 1WXFA 4KXXA 2FJUA 1KK2A 2UZIR 4EHHA 4DHWA 1QFSA 5ALQA 2LVBA 1RYYA 3AKYA 4BUCA 1X9WA 1E5VA 3FVVA 5ADHA 4R31A 2AMLA 2R7LA 3GOHA 1XAJA 4PHHA 2PR7A 5AOBA 2FKNA 4KQCA 4GVPA 1WHSB 4BE4A 1Q16A 2AW3A 3PR5B 4AS1A 4PSDA 1ISIA 1UDBA 4LSZA 1IULA 4F3RA 1X6IA 2EX1A 4Z5XA 2UV8A 5GZ3A 5JCJD 3EG9A 1CUCA 3GDGA 1A7AA 1NPTO 5DLFA 4R8RA 4YAEA 3T6KA 4LYGA 1N63A 3LNCA 4O3NA 4GI1A 3QX9A 4F1KA 4MAMA 1LXCA 1S89A 3W5IA 3KE9A 3RVPA 3MHTA 5ALLA 1SQFA 4ZZ2A 4PQFA 5GAJA 1GRCA 3DAOA 4OKNA 3LGSA 5AVXA 4RJIA 3DH0A 4GOKA 4MMXB 1VKRA 5CK5A 1FVFA 1UFRA 3Q8RB 3B60A 2X2FA 3WLQA 2CSUA 3ZIDA 1DAEA 3G82C 2VDLB 4UB2A 4DJEC 5AHOA 3OQIB 3L8CA 5ALXA 5EWMA 4Q6WA 4Z7NB 1IM8A 1B0XA 1X1BA 3ROQA 1X6JA 1O4WA 1OWPA 1DBPA 2QR5A 2AFIB 3AINA 1XTBA 1K7EB 3PB3A 1X42A 1GSHA 1NP7A 4U6QA 1U3GA 1ZN8A 5K3CA 4YP6A 5G0TA 5EE3A 4LKOA 3I83A 5KNIA 5EQTA 5DOVA 1L4GA 4JD5A 4CQJA 3TANA 3OZSA 1XTQA 1N1EA 1I7PA 3HVIA 3JZDA 2NUBA 4C7VA 1M34A 2ZBQA 3DNFA 2QN3A 1PO7A 4C0HA 3RHTA 2IEDA 3ZHCA 1E3IA 3O8OA 4I08A 5FOWA 4BATA 1RZTA 3C2LA 3ZV5A 2X4GA 4B45A 2XRYA 3A1NA 5COQA 1D1QA 3HKDB 5B53A 1WLYA 1NZDA 4U2EA 1F8FA 1X70A 4MYCA 4RCVA 2XD4A 4CQNA 2AN1A 5EC8A 2VEDA 4C14A 2JZNA 4YK7A 1FJHA 4XWGA 3CUVA 3KJZA 5J63A 1PJSA 4E5VA 4REQB 1JHPA 3QLJA 3DPIA 1QORA 1GAXA 1CERA 2C2BA 4K4IA 2LCFA 2FXIA 2EFCB 1JAZA 5ICCA 4P82A 5JSQA 3WB9A 1L1EA 4H6PA 1X1CA 3MQFA 1T8TA 1U8UA 1G21A 4XJVA 4AX4A 4XUGB 1G4UR 3KELA 2J4DA 5LCXA 3RIMA 4MV3A 1O97D 2P0YA 1V35A 4F56A 3I5AA 2D4AA 1BA2A 2PUHA 4UMVA 2HCFA 2VAXA 4JXJA 4QXOA 4EGAA 3FA2A 2F1JA 2CL6X 2D1QA 3QVOA 3B5EA 5IMBA 1I3LA 5UKDA 2LUOA 1W2GA 5CEJA 4LC9A 1PL7A 1OX5A 2MMGA 2I4LA 1X9XA 2J3MA 2GPJA 4TMKA 1COWA 5ISMA 4FC7A 4OYRA 4AAYA 1RQRA 1T1EA 2BM8A 1E2NA 5TPWB 1SKUA 3EMVA 4Y2QA 2AYXA 3C3YA 2ZYRA 3H18A 3PD1A 2P3SA 3B1XA 4IQTA 1JBKA 1PT9A 1YZVA 3N2KB 2F9FA 2QGNA 1D9XA 3M82A 4FYKA 1ZD3A 3AP1A 3G6KA 4KRFA 2GHRA 2ATIA 3ZWMA 3C2QA 3GC6A 4CWAA 4W99A 3OOHA 2Q3CA 1KEEB 1R0BA 2G9NA 1ZRNA 4S1OA 3CN9A 2GPNA 3FOZA 3WWOA 5C8YF 3QM1A 4JXZA 2EZ8A 4ZCPA 5JRZA 2W6ID 4Y6RA 1W76A 1U9ZA 1G55A 4XIGS 2SCUB 3O94A 5ES4B 3O4RA 5A7HA 1FJGB 4MQEA 2EL9A 2X1HA 5SZKB 4DR3B 3L7JA 2DM6A 4E5DA 1M8KA 4G1EB 3M2TA 2DT8A 2EKPA 5HJEA 1S96A 1TC1A 4J0CA 5T4FA 1LPMA 4BWFB 1Q7GA 2LDBA 3ZZNA 1QSYA 5CEHA 4RGQA 3ZXIA 2QP4A 2W6ZA 1Y89A 5ALVA 1GPKA 1XOIA 4TYNA 4XA8A 1QRSA 2B99A 2OCYC 2RC5A 5DVZA 1XZLA 3X2EA 4CLHA 1XDBA 5C2JB 3VYVA 5AVKA 1UAAA 3PSFA 3TLBA 2HQRA 3UWOA 3KR2A 2FQQA 2FW9A 5JOQA 3TGWA 1PFYA 4XYEA 5IIMA 5FTJA 3LTEA 3MCTA 1LZKA 4WERA 1KU6A 1JROA 4ZO9A 3F5FA 2XTZA 2IS2A 2ZE7A 2UAGA 4EVQA 1U9LA 4BO1A 2QR3A 4WBNB 3EA4A 2JRLA 1CJUC 1V7ZA 3N6XA 3MD0A 1Z16A 1EM8A 2G7ZA 4D9MA 3RB4A 4MF8A 3VOAA 3B1YA 2MA1A 1Q15A 3P96A 4GOMD 4P7KA 3JU3A 2X76A 1NVAA 4ID3A 3FPKA 4IOMA 1PU2A 3NVVA 2DZDA 2CVFA 4I5EA 3AY0A 1O89A 1SC6A 2WWRA 3SI8A 5EWJA 1K6EA 3FHOA 4TWRA 2C31A 3MUFA 5BOSB 4DXAA 1PRYA 2E4VA 3SQMA 2GD0A 2VTEA 3HBAA 3ANTA 3BX1A 4MP8A 4CEJB 4IV0A 2ZDQA 1NBIA 2DUWA 5CJPA 3CUSA 3TSZA 4HB3A 4F11A 4TMYA 2H11A 3HDGA 4FS1A 1C7QA 1S8AA 2HBQA 3UQYS 2HPVA 4MVCA 3KYDA 4GP7A 1Q7CA 2NXWA 2QF7A 1AB5A 3I37X 1SB3C 1G7CA 1U0SY 3VO1A 1XTIA 1L4BA 2AFRA 2C4WA 2JDIA 4XQ0A 2WA2A 2ODQA 4GNKA 1LV7A 4Z4FA 1KI2A 3WWDA 5LU8A 2NVUB 1QWSA 2ORWA 4FGZA 4HB4A 2VH5R 2J8ZA 5JH7B 1N7GA 1S02A 1M1XB 3TZEA 1KO1A 4DDTA 2YWHA 1S0UA 1LNSA 1CRLA 4CM9A 4PTYA 4MWBA 2GF2A 3B1KA 5I4BA 2HBKA 1DC6A 1ZQIA 2P79A 3GUHA 3CUTA 4O3RA 4MNTA 5DCWA 1V45E 4X93A 3V1TC 4E2WA 1EI9A 3E3NA 4CTOA 2YASA 2YC2C 1KVQA 3ESCA 3EPIA 2E18A 4NJ8A 2PZJA 4RA9A 2OD7A 5ICSA 1RT9A 2VDPB 2WT4A 4A73A 5IAAA 2GTPA 3P0RA 2FUG6 4DB4A 2CDRA 2ETXA 4WZAB 2PX2A 2JVIA 3WB2A 1WCV1 2PKQO 5DJ5A 1ZQVA 1GDDA 4I2CA 5LQCA 1KC3A 3AF0A 4P4LA