3UM9A

Crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
225
structure length
225
Chain Sequence
b'GMHAIKAVVFDLYGTLYDVYSVRTSCERIFPGQGEMVSKMWRQKQLEYTWMRTLMGQYQDFESATLDALRYTCGSLGLALDADGEAHLCSEYLSLTPFADVPQALQQLRAAGLKTAILSNGSRHSIRQVVGNSGLTNSFDHLISVDEVRLFKPHQKVYELAMDTLHLGESEILFVSCNSWDATGAKYFGYPVCWINRSNGVFDQLGVVPDIVVSDVGVLASRFSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase, type II
publication title Structural adaptations of L-2-haloacid dehalogenases that enable hydrolytic defluorination
rcsb
source organism Polaromonas sp. js666
molecule tags Hydrolase
total genus 88
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3um9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3um9A01
3TLMA 3QXGA 1CR6A 1N8NA 2HOQA 4KNWA 4HGNA 4YGYA 4AS2A 4C4RA 1K1EA 2G08A 4BX2A 2OBBA 2O9JA 4HGQA 2FI1A 2JGAA 3WKDA 4QQFA 2YN4A 3NRJA 3CNHA 1Z4LA 2HI0A 1XVIA 4KNVA 1Y8AA 3R9KA 1J8DA 4J03A 1Z88A 3OCUA 1PW5A 3CZ4A 5AW6A 3KDPA 3AR2A 2YJ4A 2AUTA 3U7EB 5AKHA 4B6JA 4Y2VA 1LTQA 3IRUA 3DDHA 4YIHA 3WK7A 2B1QA 4Y2PA 1YDFA 3L0CA 3DNPA 4MUMA 5A3SA 5ALNA 1L8LA 2ZBEA 3FPBA 5ALWA 1U2SA 2MU2A 2WF5A 5IS2A 1Z4IA 4XE5A 3L0BA 1SU4A 4UAVA 5ALDA 1Z4MA 4AS3A 4QJBA 2MSNA 3UMBA 1XP5A 3ED5A 3EPRA 3N07A 3U7FB 3M1YA 3NUQA 2HO4A 3BA6A 1L7PA 1RKQA 5AVWA 2GHQA 1QQ7A 2C4NA 2W4MA 2YJ3A 4Y2UA 3FVVA 3ZTYA 2R8ZA 1SWWA 3QUQA 3WK5A 2CFRA 4L57A 4UMEA 3OCWA 2Q4TA 1XPJA 2R8XA 4BNDA 3N1UA 1RLMA 3SF0A 3MN1A 4UU0A 4HGOA 3KD3A 3F9RA 2HF2A 2B1RA 3EWIA 2QLTA 4GXTA 2PKEA 3AR3A 2C8LA 1TJ5A 1ZD3A 2FPRA 4Y2QA 4EEKA 3L5KA 5FP0A 1FEZA 1Z4PX 4Y2RA 1N9KA 2G1AA 3W5CA 3QU7A 1RLTA 2R8EA 2YFYA 4ZEWA 4EELA 3ZW7A 3W5DA 1TJ3A 2IA5A 1YS9A 3ZWKA 2R8YA 1RC8A 1RMQA 2FPUA 5ALYA 1Z4QA 1QYIA 2PR7A 2RAVA 4BKMA 3QNMA 1O03A 2C9MA 4UMFA 3FPSA 3L1VA 4HAIA 4KX3A 3BWVA 3U13A 4JB3A 4DWOA 3OPXA 1YV9A 3N8GA 3R4CA 5AKYA 3WK6A 2ZBFA 5AIAA 4HYTA 4UARA 1RKUA 4YCMA 2AH5A 1ZD2P 2EARA 3PCTA 5ALRA 2WF8A 4AP9A 3ZVNA 3NANA 3SKXA 1Z4OA 3A1DA 4YCNA 3NASA 2JARA 5AW2A 4UM5A 4PNHA 4NABA 1L8OA 3D6JA 3QU5A 1L7MA 1EK1A 2CFSA 5AW9A 3QUTA 5AK3A 1U02A 2GMWA 2GHTA 5AVXA 5ALOA 2OM6A 3L1UA 1TJ4A 1RPZA 2OYCA 3L8HA 5AM3A 4XOUA 4I9FA 3ZWDA 4BEWA 5AW3A 2P69A 3WKBA 1U7OA 3ONNA 1VJRA 3I6BA 3HYCA 5ALVA 2G09A 1WZCA 5AESA 2DQSA 2I55A 5AM1A 3QUBA 4BBJA 3MC1A 3W5BA 3MMZA 3ET5A 4DW8A 4EZEA 5A3QA 2CN1A 5AKEA 2Q5EA 2FDRA 4OD0A 4YCLA 1EK2A 3B8EA 2IOFK 2QYHA 2YMMA 3QLEA 3PGVA 4Y2JA 4O8CA 1RDFA 1JUDA 3AR4A 4CNQA 1L7OA 4IG4A 3L0YA 4EX6A 3WKAA 3AR7A 4OCZA 4DCCA 5ALJA 5ALTA 4L6AA 4FE3A 1KYTA 1WVIA 1WPGA 2ZXEA 4HGPA 4YIKA 2FPWA 3ZVMA 2YMPA 5ALFA 4CF3A 3ZU6A 1S2OA 1ZJJA 1ZOLA 2WF9A 2GO7A 3WKEA 4BEVA 5AIBA 2CFTA 2I34A 2FUEA 3L8FA 5E0OA 2B82A 5ALZA 1TE2A 5AK5A 2AGVA 1ZS9A 3WGVA 4UATA 1O08A 3OCXA 1RMTA 1LVHA 3UMGA 1L7NA 3QGMA 4BX3A 1Z4NA 4Y2XA 4J2TA 1S8OA 4Y2YA 1MH9A 3UM9A 1Z4KA 5AKGA 4C4SA 2HCFA 2RBKA 3J7TA 2VKQA 4ZEVA 4CE6A 2WM8A 3DV9A 3S6JA 2BDEA 2B0CA 2JAWA 4ZEXA 1AQ6A 3QYPA 2GFHA 2HEGA 2ZG6A 2ZBGA 4Y2TA 2HX1A 5AI6A 3A3YA 3U19A 3SLRA 3W5AA 2HF7A 1ZD5A 5AI0A 3I1YA 5AKZA 5AKKA 3P96A 1YJ5A 1VJ5A 5AHXA 2C88A 3ESRA 2I7DA 3HLTA 3A1CA 3AR9A 4Y3UA 5AKJA 2I6XA 3NIWA 1T9ZA 1U7PA 1WR8A 4BX0A 3ZTWA 1T5TA 3WK8A 5AW5A 3U7HB 5ALXA 5IT0A 4XPZA 2NO5A 5AK6A 4EENA 2EAUA 1YMQA 3MPOA 2P11A 3I28A 2YMQA 4C4TA 2I54A 1Q92A 3E81A 5AKLA 1L6RA 2G0AA 5JJBA 3SHQA 2IOFA 3FGOA 2BY4A 5AK4A 4E88A 5ALGA 1J97A 1Z4JA 5AW1A 2WF6A 3ESQA 3SD7A 2FPSA 3U26A 5IT4A 4OHFA 2HHLA 3OCZA 2FPXA 5AVZA 3UMCA 3ZVLA 4JDPA 3ET4A 2ZOSA 3E58A 5AM4A 2JAUA 4NFLA 3QX7A 3FM9A 5AW8A 5ALEA 5AKIA 3SKYA 4NWIA 4RESA 4F71A 2B8EA 3SMVA 5AM0A 2X4DA 5AVSA 4GIBA 1ZRNA 1YNSA 2P9JA 4UASA 3AR6A 3VAYA 3GYGA 2ZBDA 2G07A 1Z5GA 3EF1A 2OA0A 2FEAA 4CF4A 1CQZA 1ZD4A 2RB5A 2B30A 5AICA 1X42A 4BNDB 3DAOA 4DFDA 5AW0A 2PQ0A 1RRCA 2D2VA 5ALIA 1TA0A 2YY6A 5AVYA 4HGRA 5AI4A 1NNLA 3IJ5A 2Q4RA 2NO4A 3PDWA 5AW4A 2G06A 5ALSA 3E8MA 2P27A 3ZX4A 3L7YA 3E84A 4UAUA 4XQ0A 1U2TA 2AMYA 3R09A 4RETA 5ALKA 3FZQA 3U7GA 3AR5A 3NALA 2C8KA 2ODAA 4UU1A 4IFTA 1VFPA 2WHEA 3QU2A 3B9BA 3WK9A 3A1EA 2HDOA 2W11A 3KOOA 5AVTA 4KN8A 3EF0A 5ALLA 1RMYA 4EX7A 1RLOA 3B9RA 1SWVA 2NYVA 2I33A 3IB6A 1T5SA 3L8GA 3OTQA 3KBBA 1NRWA 3L8EA 4KYTA 5ALUA 2YMLA 3QU4A 3N28A 2YJ6A 3WGUA 3OCVA 5AW7A 5AM5A 2MU1A 5T41A 2RARA 1QQ5A 3OCYA 1QQ6A 3ZX5A 2YBDA 5AVRA 1NF2A 2HSZA 4MWOA 2WFAA 3N5KA 2W43A 5AM2A 2JAOA 3KZXA 4G9BA 3NAMA 5ALHA 1RQLA 4UM7A 4I9GA 2IYEA 1Z5UA 1IWOA 3M9LA 3KC2A 4FYPA 5ALQA 2EATA 4BYGA 2G80A 4FFDA 1ZRMA 2YJ5A 4YH1A 4UW9A 2BDUA 4NAVA 5AVUA 3K1ZA 3AR8A 4NV0A 4F72A 2WF7A 5ALMA 3I76A 4CF5A 2B8JA 5AVQA 3WK4A 1Q91A 4L6CA 5AI8A 2IOHA 4KX5A 3RFUA 1QH9A 5ALPA 1F5SA 5AI9A 4G63A 3ZUPA 4Y2SA 3WKCA 3PGLA 3ZI4A 2O2XA 5AKXA 4H1WA 4UMDA 5AVVA 2FUCA 1RKVA 5AI5A 4OFZA 3RF6A 3QU9A 3QUCA 5A3RA 4UMVA 1RQNA
chains in the Genus database with same CATH superfamily
1UBGA 3DOIA 3AUYA 4WT7A 3EQZA 2LPEA 1SY7A 1QHSA 3NBUA 5P21A 1BA2A 4KTTE 2JGDB 1QV7A 2CD9A 4LGMA 4LXXA 3A1FA 4OIMA 2AOUA 1DAMA 1ZONA 4ZMSA 3PRHA 1RC0A 4EO9A 4WEQA 4Q3CA 4EB0A 5D87A 1UXOA 4HRYA 2VHEA 4ND7A 3E70C 3HMKA 3TQOA 4YREA 1Q0SA 2XGMA 4ETMA 1PUJA 4J75A 1M0TA 2EZ8A 1MMFB 5G1NA 2W9CA 3WZ2A 5FPQA 4ZDKA 4ZDIA 3A3PA 1L5GB 1JIJA 2PVPA 3QBTA 4UU0A 1ZD8A 1XJCA 2Y1FA 3FMGA 4RZ3A 3PRKE 2XGGA 2PMWB 4QREA 4F5OA 1TJ5A 4Y6LA 3NJRA 1X1DA 4N3BA 5K7SA 3OM0A 1T1SA 2JBHA 2F3PA 4ANFA 3GT7A 4ZI2A 1P9OA 4JOCA 2G71A 4LRUA 1XKQA 3DKVA 4O4HA 2H00A 4V2UA 3VO9A 1DWOA 1KFJB 4HS4A 2Y71A 5ISMA 2H18A 3AIOA 4EMTA 3OZRA 4GMXA 4H3HB 2QPOA 9GPBA 2E89A 1KBUA 4OXXA 3RM3A 1A71A 1A4XA 5HKOA 2IYVA 1EK1A 3F5MA 4HLNA 5KOJA 2ZTVA 3GT4A 1Z3IX 4WXYB 3EFOA 3GRFA 1PNVA 3I6BA 3T4XA 4KE7A 5IIOA 2C0CA 3W7BA 2E37A 4S2UA 1RBZA 4PLFA 1DARA 4TOIA 4B6OA 3FTDA 3EG9A 1DGJA 4DQPA 2O3UA 2J4FA 1IHXA 4DV1B 2ZWPA 3AXSA 1GN9A 1N7IA 4CNQA 3G2OA 2XQGA 3CZ5A 4J1NA 3Q98A 3INYA 4G4IA 3HCWA 1S97A 2V4UA 1OB5A 3GJ6A 3NOQA 1QFSA 1XPOA 2ZIEA 3L8FA 1FYDA 2Y9MB 2C28A 3IQXA 4XUCA 4OUDB 2PS1A 3IQDB 2IBMA 2IYAA 1EUDA 3PUVA 5JNWA 2B4KA 1S01A 2A9PA 5B37A 3X2SA 3MHTA 1NT4A 1FO4A 3BREA 1JDZA 4XQGA 1G3IA 1ZIOA 4NXZA 1PR1A 4Q37A 1OI7A 2VCYA 4WLFA 3TXXA 1UBJS 5CM2Z 1GTZA 1MKYA 2XMGA 3K31A 4U2DA 3MPOA 4RZSA 4JELA 3TOSA 4BV3A 3NP9A 3ZY5A 1SKYB 4R8UB 3RRHA 3LBFA 3H7IA 4CW7A 4CMAA 3KZKA 5IT4A 1GM5A 1A04A 2CUNA 1GCOA 1COOA 3AJ9A 4QFMA 1VRWA 3AEXA 3WRYC 2P9JA 4AW9A 3UKOA 1U1IA 4LRXA 4DEVA 3ZHUA 4X6LA 3HU1A 3M9XA 1G38A 2O3QA 3DLPX 4LQDA 4HQFA 2HQSA 2DQKA 4W9NA 2MR6A 3NALA 2I03A 5GQSA 9ICXA 3BB3A 2R6CA 2KMDA 1A5SB 3AIIA 4BLPA 2JZCA 1JHYA 4V0SA 4B9NA 4K0RA 1XZ8A 2JFNA 5HXAA 1KJZA 3N2YA 1JLRA 1SC4A 4IV8A 1Z22A 3OO1A 4RVOA 4TL7A 1TKDA 3KS9A 2WICA 3DE4X 4A15A 3DFFA 2BR5A 2FZEA 4C0AC 2IPXA 3VX4A 3H42B 4TMZA 3WMEA 5ALHA 2BGTA 4DC1A 3LBNA 3QF4A 3H4DA 3H83A 3B6JA 3BK2A 1MFZA 2FQWA 2NAFA 2ZANA 3E53A 8ICXA 4RTOA 1ZRMA 5CB4F 2QQ5A 4NZNA 2O8VA 3PQEA 3L1IA 5AI5A 1P0PA 4B9SA 3ZVRA 4TT3D 1W75A 3ZWAA 3BS5A 1C3XA 1Q0UA 2A8YA 1BWPA 3KJHA 1IRXA 1SG9A 3UY4A 3F6PA 2DRIA 4AJOA 4R98A 3PC7A 1XEWX 2GETA 4YBRA 4F06A 2GQ0A 2HMTA 1LS6A 3KB6A 2RGYA 4O02B 2DFTA 1YT3A 3U7FB 2ZAGA 1YVRA 3BXGA 3N0TA 2Z3WA 2B6GA 5CA7A 1CHNA 3JCZA 5GVRA 5KWEA 4GI7A 4EFDA 1VE3A 4RD3A 4Q3LA 1U8AA 2PYIA 4GSLA 4ECTA 1QPZA 1MZPA 1JQAA 3SI8A 1ZK0A 4YWHA 3T9FA 5T67A 1MOSA 4S0ZA 1VYTA 3A9TA 1Z7BA 2O8BB 3T0FA 2J0UA 4UBBA 2J3IA 2VJOA 2H08A 3RAEC 3LBYA 5TEWA 3SDZA 3LUCA 3HADA 1N8KA 2PGAA 4MV5A 4DQUA 3BS7A 5JU6A 4F12A 2BZ0A 1GA4A 2Z2ZA 5AJTA 1ORTA 5G0TA 4GP9A 3IP3A 4IDEA 1GTVA 3TNLA 3H5LA 4OI4A 1H0KA 3PYXA 1L8OA 4J3JA 1SIWA 1XLWA 1HQYE 2PUAA 3AZQA 2I5PO 2XNDD 4RO0A 2JK1A 1N1MA 1JIUA 3PFWO 2DB3A 3L1UA 1ZNXA 2OBNA 1Q7CA 3GRPA 4MV4A 1U4SA 1XTQA 1DXOA 5ALVA 1TJPB 2E5LB 2OCDA 2CPRA 4B3SB 2D5AA 3FUVA 3H2ZA 2LRHA 2PL1A 2QYHA 4K9OA 1BA3A 1UK9A 3QH4A 2VTBA 3GGPA 3V55A 5HIAA 4BTEA 4ABYA 2GI4A 1SK9A 5ESDA 1GKYA 4CMEA 2NAPA 2CNBA 4Y0NA 5DN6D 2VAPA 4OQXA 2AU0A 3OZFA 5IMBA 3S5JA 4EJSA 4DHWA 3ZHTA 1PV1A 1OT3A 2BGNA 1HT2E 1A69A 2YIMA 2JEJA 1K4YA 4H9GA 1QPBA 1Y1QA 2J3LA 3SPXA 3HTXA 3KK0A 4GR5A 5GVSA 3PA6A 1JG6A 2ZBGA 4QZCA 3FR7A 2R11A 2QUAA 4JDUA 1ZD5A 3Q8MA 3LT1A 3T3OA 1X7YB 3IE2A 4MP6A 2E8MA 3ICCA 3A2NA 4M1KA 1TMYA 4J3FA 2ZYGA 3BCHA 3ANMA 2OFOA 5K20A 2GBGA 3AL3A 5LSAA 3Q3CA 3SD7A 3QVLA 3VNQA 1I2AA 4RY2A 2BEWA 1KP2A 2YWHA 1HUOA 3GUZA 5ITWA 3TNDA 3FM9A 3DOCA 2XADA 1G55A 1NRJB 4PLWA 4JB8A 5A7FA 4PU0A 4WOCA 3RBZA 4BO6A 1XCPA 3PNSA 4DFDA 1Y3FE 3IDSA 3R5FA 3EC2A 3KZIU 2XY7A 1PTJC 2VSOA 2PSSA 1U0HC 3LCVB 2O2HA 4X7PA 5AI4A 1SB3C 1YJXA 3M5WA 1NVMB 1T2CA 3REQA 3KUUA 4BO5A 2PJZA 3QSYA 1XIVA 2R97A 2J6CA 1SXGA 3ROPA 3ABZA 2NYVA 2VIIA 4MGHA 6REQB 3OC6A 1BDBA 4CI9A 1JEDA 2AMVA 1PZFA 3CY6A 3G7NA 1L5LA 1I6MA 1J20A 3LQ1A 2ETXA 1E3EA 4IH1A 2WJ4A 1PWXA 3LUHA 3R23A 4IL5A 4PHCA 1YAHA 4WIAA 4E21A 3KC2A 4US8A 4XB1A 2JFVA 3GZTB 3QBEA 3DS8A 1IEXA 1X8LA 3WK4A 3TR0A 2CMFA 2O2XA 3O4HA 2UUBB 3HVRA 4YJ2F 2XZPA 3E7WA 4U0JA 1ZGAA 2Z3VA 5C32A 2BCRA 1FDRA 5DG9A 5CYFA 2QB1A 1UJBA 5AOBA 1K9VF 1FFXA 1J8MF 2Q50A 2RCYA 3NJ8A 1TAHA 1JALA 5TJ9A 3H0MB 1CFJA 2QLJA 3R9WA 4G97A 1IY0A 3DF7A 2KIWA 4OVKA 4ZKEA 3SR3A 1VI2A 4E09A 2Z0MA 5IXJA 2NTYC 3K6SA 4WAUA 4QM7A 1XU9A 3ETDA 3QITA 2H7CA 3W7AA 4DLNA 4DWVA 2I6QA 3RRMA 3BPSA 5EZ5A 3KD3A 4RX1A 2AUNA 5BSRA 3EFEA 5B7NA 4JGBA 1GDDA 3H86A 2Q6TA 1SEVA 1SUIA 3N76A 4TWAA 2NW6A 5KAFU 4LKOA 2DKNA 5TXGA 3ZU2A 5BV1A 3IP1A 1KDTA 1S8AA 5L3QB 4YY3B 1FFVA 3CA8A 3FCAA 1OT5A 4MWZA 2ZEJA 5KG4A 1KVTA 1ATZA 1THMA 3JALA 5TZVA 2Y1KA 4INZA 3C7KA 2WUVA 2R1VB 2IH4A 4EBDA 3HUTA 4TS1A 3JVVA 1PZNA 4XQEA 2QYSA 1MVLA 1QO7A 5KO2A 2ZROA 2HH9A 4Q82A 4Z8XA 3RUEA 2H9YA 4EMBA 4TM7A 2N75A 1C20A 2OLJA 4BVKA 5C52B 3C3CA 3DFMA 3RSHA 3T7SA 4R8VA 4OXYA 4AYBC 1OX5A 4MTLA 4TSFD 4HWRA 1EMDA 3OECA 1XCOA 2PZEA 4HMPA 4CKYA 1PJ4A 4OI0A 1LV5A 3I2HA 2XV1A 1P5RA 3Q9SA 3IIMA 5CLJA 1NBEA 4MRPA 2XUFA 3DDSA 3HRKA 1EBUA 3DD5A 4BNLA 2OBFA 4HNAA 4HQ6A 2OV3A 4M9NA 3GPDG 1JMVA 1GTSA 3O8NA 2CV2A 1NW6A 2GPYA 3PDHA 4FDTA 3UK6A 2QAGA 3J7TA 1MDBA 3PTZA 3PFIA 3NOVA 3DAHA 1GAJA 3TKAA 4M55A 5AKKA 4GLXA 5KNCD 1MX3A 2WAOA 1WD7A 3KHKA 3PWZA 4RPXA 4Y3UA 4KJXA 1QYCA 3QEOA 5MFZA 2FMPA 2GUGA 3VKGA 3QLUC 4B84A 3ORHA 1I8TA 1AMNA 3INTA 2Q1SA 1Z7EA 1JIIA 2RBEA 2O5EA 1JIHA 2JI6A 2EJVA 4HDRB 6YASA 1SKUA 1EWVA 1P2FA 3A11A 2ZPTX 5LDHA 4IGKA 3DZGA 3RC8A 4LV6A 4DTIA 4JI7B 4MCHA 1XRQA 1ZRNA 1T1IA 2BQ3A 5JS8A 5KFXA 3VISA 4BNFA 4RQNA 1NU6A 1SVLA 2GK6A 3OLVA 1U8CB 3S55A 3GRRA 3QOXA 2X76A 3WRYA 1P4HA 4CHTA 2R2GA 3RV3A 1NW7A 1ZDMA 3IJ5A 4UUMA 3AKDA 4PYKA 3SVLA 3KQSA 2YWCA 3EHEA 3SR6A 2AR0A 1XJQA 1OXKB 3VGJA 3THYB 2IX9A 2HPHA 4BFZA 2PD4A 4W63A 3AF3A 3WK9A 4HG2A 1IOZA 5AJUA 1L7DA 3L6CA 5EVJA 2OUKA 3CX3A 4PIPA 2YW2A 4JLKA 3JZIA 1P73A 4FUTA 3TAXA 2OYRA 3SAFA 3TMAA 4MGYR 1R0SA 4HRXA 5GIOE 1VG8A 3PLNA 1UOPA 1OWPA 2PYZA 1HM5A 2XCRB 2P2YA 4GF5A 3D7LA 1ORVA 1KQ3A 2AE1A 3VJRA 2HT6A 1OSNA 1WWKA 3HCAA 4FYPA 4ASUA 2CXHA 1U81A 3OG9A 1IIPA 3NTOA 3R9IA 2PTHA 4YCSA 3ES9A 4LQLA 4CMGA 5FPTA 4RE5A 4YT2A 4RMJA 3VKVA 2FUCA 3VH1A 1MORA 5B57C 3BFKA 3QUCA 2CK3D 5F4BA 4MCIA 1FTQA 2YNMA 1XMXA 3VZQA 4AS2A 3GBSA 4Q15A 5KYUB 3Q3GE 3D6UA 3NDRA 5DLDA 5B1IA 1OLOA 3EXFB 3UMSA 3FCUB 4P7GA 1E89A 1XO1A 4GLJA 4X8HA 3FNQA 2N42A 1Z47A 1KRPA 4GC7A 4XA8A 2CNWA 4TZ0A 3RBDA 4G0OA 3F2BA 1ED1A 3ZBQA 1OXUA 3M2TA 5HHTA 2OHFA 2X8WA 3FRJA 1V4VA 4DJDC 2P6MA 4DS3A 1TYCA 3KXLA 2ZYHA 3F90A 3LLSA 4G81A 4EB3A 3FKJA 3W5JA 4YJ3B 3OT1B 2D5LA 3DMNA 3R9XB 2R8XA 1KOGA 1TPZA 1QSGA 5IAAA 2DJ5A 2V0GA 4JHLA 3P5SA 2HRBA 3H7AA 2EF1A 3ICQB 5PNTA 1G8KA 2BJHA 4ENWA 3N53A 2HUNA 4AZSA 1Z8HA 1AGPA 2FUG6 4O4HF 1JU3A 2PR7A 4BKMA 1XCGB 4DO9A 5BT9A 3DMTC 4F7DA 2HVIA 2HYDA 3IRVA 2M9MA 2CLDX 4DFMA 3FFBA 3SEIA 3LIIA 1XZLA 1JLLB 4J9NA 3I12A 1M1YE 5FX2A 5GPBA 1T2UA 2O5CA 4EHLA 4RIFA 5KFEA 3AJ8A 4KR7A 5JS2A 4TV9A 5BURA 3WFJA 4U9HS 2E18A 4PQGA 4YP1A 3BN3A 5FF9A 5JC1A 2M9NA 1W4ZA 2B37A 3H8MA 3D6VA 3PQFA 5BWOA 4B9MA 1NP3A 1R8JA 4KZPA 4GBJA 4XOUA 5JANA 3VR3D 2G5HB 1KRHA 5KG0A 1COKA 1KI9A 3D5TA 1BTOA 1JXOA 4XIGS 1Q3HA 1XRPA 3HYTA 4EPTA 4GL4A 4W1QA 2LE0A 3D3KA 3JTEA 4KFUA 4FGJA 1UQUA 1OREA 4GO1A 1T3SA 1R18A 2Q45A 5K8UA 3QW4B 3N6VA 4EVRA 3U9LA 3BMXA 3RUPA 5IM4F 1JTEA 1VC2A 3JZFA 4YROA 1Z7GA 3KTDA 5F3RA 2C31A 5EIFA 3GLVA 2AFIB 4DSKA 1NXSA 3AVWA 4ER6A 2PJDA 1FZQA 3P7MA 1KTIA 1UAGA 2IYWA 1UPAA 5E3HA 1E6EA 4BRUA 5F1OA 2AV6A 2MSLA 3M8RA 1FU7A 4NCXA 2C61A 5DLPA 1UPHA 1U5CA 4QVGA 3IUPA 4UVDA 2MR5A 3WYDA 1JIXA 3DE0X 3IMFA 2XVTA 1TZJA 4KDRA 2ZUUA 1LI5A 3ELBA 4A0GA 1P3DA 1X0VA 1O0BA 5FLEX 1ZJZA 2YMQA 4A2CA 2RSLA 1P4AA 1WCIA 2O07A 2NZUG 2ZXFA 4XI9A 2JKYA 1G7CA 5KT6A 4Y9RA 1DXHA 3Q9LA 3UZUA 3CGWA 4IRUB 1JHZA 1Z7YA 3VAYA 2FSSA 1Q1ZA 4CV0A 3K2QA 3FBGA 2BOVA 4FILA 5JXIA 3M70A 1Y1SA 4LJSA 3F5SA 1XKLA 3H99A 1SRRA 3DVQX 4LECA 4QUJA 3CX7A 1PTJA 1R4MB 3VTFA 4X92A 3UQYS 2I4OA 2Y0EA 1C80A 3HMQA 2XMDA 3W5SA 1G2IA 1FBTA 1LZLA 4ZAWA 1UA1A 4H6WA 2HY7A 5FL7D 5KFKA 5C8DA 2RGNA 3MWEA 2WD7B 1PLKA 4QZHA 2ROQA 2UZIR 3L8GA 4I1OA 4I55B 4FHCA 3EYWA 1E2UA 4YQFA 5JEEA 5EXPA 4R5HA 4CMIB 5FV7A 4O0LA 1UANA 3BXPA 4HB0A 1GYQA 3QZ7A 3QPBA 4FR5A 4BCCA 3TQIA 2E8NA 1K7SN 1DE0A 1SXQA 2FB9A 2HU2A 4UTVA 2CBGA 3HUDA 3HYNA 2ZJ4A 3ZH9B 2YS6A 3HNOA 2Q99A 3DZ8A 4WL0A 4JUCA 5KNDH 1TKBA 4HL6A 1KZ4A 4Q9AA 1E0SA 5BN3A 4WLNA 1ZO8A 3DEHA 1E3MA 4FMDB 4A10A 2ISQA 1JQJC 1DQNA 4HEHA 4HGNA 5JYCA 3SHVA 1KR5A 1T9CA 4BX2A 4NMLA 1E1RA 5JCOC 4IRDA 3L05A 1QIGA 4BVLA 4L3OA 1LKYB 5CBPA 1K88A 2ATIA 3MGHA 3W6PA 2QXUA 1MO4A 2KE5A 4Q66C 1ECJA 3ROEA 5MF6A 4KFSA 3JAWA 3LUAA 4MVWA 2XAUA 1A2KC 2IV7A 3H40A 4PR0A 5K1ZA 3I9V6 2P0EA 1MT0A 1M5TA 1ZKMA 2IYRA 3EE6A 3O2NA 1ZQKA 8ICHA 3EZNA 3F8SA 1RLJA 3U16A 1C4OA 2EOAA 1V6CA 4LBZA 2RAPA 3KKAC 3W5UA 3ZPXA 1ZZEA 1RLTA 3BVPA 1CP3A 2R7NA 5E79U 1L3BA 1T0IA 1QYIA 1XMVA 2PS9A 1I9CA 2KI5A 1O03A 1YS1X 4ZYLA 3I61A 2FZKA 4JL5A 2KN7A 1NK9A 5JALA 1N6LA 1XCBA 3PR2B 4XFKA 1Y3AA 2MYPA 3SE0A 5DDYA 5JU5A 2NV0A 4OGFA 1CPYA 3L7OA 1IB6A 3T1VA 4QWBA 3I64A 5CEJA 1DPGA 4PNHA 3D6JA 1WXGA 2QGNA 3GG9A 2JEFA 3L4KA 5JADA 1RTTA 3ETHA 1PR6A 3CPEA 1KSHA 4OGGA 5LN1A 3D8TA 3T5CA 4NI5A 3CF0A 4DL6A 1X7XB 1XSPA 5DLGA 2PZAA 1T13A 4N12A 2YJZA 2WPDD 5F1KA 2I99A 2Y6UA 4Z6DA 1X3LA 1WPGA 3JY6A 4Z3KA 2ATCA 5L45A 2XXBA 3IUEA 5DEIA 3C4QA 4BFLA 5C34B 1DIBA 1R6TA 2WWIA 3WGHA 2J3EA 2RJ3A 1E3IA 1Z83A 2ZJOA 3OTGA 1M0SA 3HXQA 1Z0SA 1AHPA 1TQ2A 3BTOA 1HSZA 5DYGA 3UMRA 1U8FO 5FULA 3EDMA 3DV9A 3GLRA 4ZEXA 1WB4A 1ZQPA 3P9RA 1UDRA 1E62A 2SKCA 3H6HA 3NXKA 4GECA 1RWOA 3NYWA 2HF7A 3I62A 4B6FA 2BW0A 1JU4A 1B73A 3CJQA 3LM8A 3WNZA 1HEUA 5ESRA 2NU9B 3RB6A 2H5IA 1V8OA 3PUYA 2QJOA 2WSYB 1JMSA 4FU0A 1CUSA 3T5MA 2R5FA 3TSZA 2KPOA 3DLAA 3WOVA 5E9JA 5KJ1A 5CCBA 1NVWQ 4DDKA 5EIOA 4A91A 1N62A 3TADA 1JA1A 2R8PA 4RSRA 3D8HA 1RRKA 1UEJA 3UUWA 5ANRB 3U7QB 4K4HA 2F7SA 1ZYQA 3WGNA 3TAPA 1WTAA 3GGGA 2FEAA 3BXHA 4CDNA 1VHTA 2ZE8A 2CJYA 1A8QA 2PQ0A 5J0QA 2W2KA 3GVIA 1UZMA 3ID6C 2VAXA 2IDZA 2PA3A 5K45A 2AUMA 2E85A 3GD5A 2RRDA 1GR0A 4IDDA 4B6QA 2D06A 2QX4A 4X95A 4WJKB 5JSYA 1QHHB 4BAUA 5KMGB 2JW5A 1QQTA 2O52A 3LYUA 4OUKX 4JKYA 5IG2A 3Q8LA 1T9GR 3K0AB 2VBGA 2XUIA 1NMYA 1Z0IA 4BO4A 1E9CA 3HDQA 3NQ41 1ZOIA 3HYLA 1WXFA 2OFWA 2H5JA 4LDNA 4BGIA 3PQCA 2BCUA 1U7ZA 3SBOA 4RK4A 4CMHA 3ABRB 3VOBA 5AVRA 4IGAA 4QHSA 2W43A 5BV0A 2GK3A 2CVOA 2HWUA 2W2QA 5IN5A 3GLFE 1AUQA 1EJ0A 3KKPA 1EM8B 3U9TA 4MITA 4EVSA 5JISA 4PPFA 2GZ3A 3Q4GA 2PANA 1FSZA 3D2SA 1L2TA 5TMBA 1RKVA 1AC5A 2DVMA 4Z9BA 4CM4B 3EMKA 3BGOS 3UWMA 1ZIDA 2J30A 2ZE7A 2H92A 2R6HA 4D0NA 3VTAA 2QBYB 3RODA 7ICMA 3N2NA 5IABA 2JJ1D 3H04A 3V72A 1O8BA 2X5NA 3HFGA 1BXGA 2X14A 1QH0A 3QF7A 5AP9A 4C4XA 2LIVA 3ZBUA 4X64B 4HDNB 3NV9A 4J6EA 1ESZA 4ARVA 1E3TA 4PGHA 3I3OA 3HWX1 3ENWA 4KRYA 1L7PA 1E8MA 3TTWA 1DTWB 4QARA 3TDMA 4K9PA 2JFHA 2WB1C 2C58A 1W85B 4J0JA 4PXYA 3KRTA 4QZGA 3OOJA 5K0ZA 2PQ2A 5KG7A 2YX8A 3PGMA 1XTIA 3M82A 2QRVA 5E2AA 1PVPA 5G0UA 4GH5A 4KSBA 2ZSKA 3VZBA 1NJ6A 4EUNA 1F12A 5DT2A 4MGZR 4WXEA 4CV2A 1AF7A 5AIAA 2PFQA 3WWPA 4MF2A 1NVXQ 2XOKD 5H5JA 3A1DA 3PNMA 4XM2A 4KHZA 2FJ6A 2V96A 4JBLA 1L1QA 4HH0A 1GKUB 2WZQA 1BMTA 3RDPA 3H11A 1LK7A 2YB1A 5GGYA 2GF9A 4K9KA 5AW3A 1L9KA 3H75A 2JFPA 4QOIA 2I2CA 4PC6A 2CC2A 4JWTA 1GCUA 3OZIA 5A3QA 1HL3A 2IYPA 4R8UA 1XA4A 4DCTA 4ACOA 4NPHA 4DG5A 4CG2A 2ZRQA 4D4GA 1U7DA 1Z5PA 3K5WA 4KE8A 1ZHFA 1SGWA 2H3FA 2Y1LA 1D7AA 4CF3A 4BJ5A 2XH8A 3IERA 3CKLA 1KVSA 1GUZA 2FTKE 4FLEA 4L4UA 2D6FC 3SFVA 2F8MA 4QZIA 4DRXB 5IILA 1JDPA 4D4KA 1S9HA 4Y2XA 1FRFS 3UK1A 3AFNA 3EARA 3H5TA 4PS0A 1OTYA 4X3OA 1NJ1A 2P77A 2RK6A 4XX0B 4G56A 3NPMA 1BVHA 5GONB 4GQAA 3OQIB 1C3OB 5EAIA 2Q0ZX 3MDAA 4IVNA 2O7NA 1UOEA 5CLHA 2O7QA 3LX6A 3U4QB 3D7SA 1OY1A 1GTJ1 1NQAO 3D0QA 4CIDA 3M6AA 4KITB 4I2NA 4CU2A 2REOA 4DCUA 3PSIA 3R5TA 4QO7A 5AK4A 4LZPA 4C1BA 3SOZA 3BJYA 8ADHA 2WM2A 3QX7A 3IUQA 4AROA 1R3DA 2YXBA 2FX2A 1AKNA 3QLVA 1AQUA 1VGVA 4FCWA 4GIBA 5M3BA 4Y8VA 4OL0A 3NBKA 1IZ8A 4UBCA 4KK4A 5AW0A 13PKA 1F06A 1SKMA 1R0XA 4UAZA 2XR1A 4QELA 3C3EA 4C6TA 4R41A 3JX9A 1LB2B 2AX4A 1XDUA 3FZQA 2SBTA 3KPUA 4OBBA 5IX8A 1YDGA 3EH2A 4IV5A 3U0VA 4BFXA 2X1VA 4LZNA 1K89A 2HRRA 3KJXA 2QB0B 4JI6B 3FDZB 1XBTA 1HBJA 3PGKA 3VOAA 2CXSA 1EFHA 5EIWA 5DBOA 4J07A 4J29A 4FYXA 3RS4A 2GJ9A 2HBYA 2BR0A 2OO5C 3GDHA 1TEHA 2AOWA 2AJTA 3ND8A 4G9BA 2JFXA 4QLBA 3SYKA 4FMCF 3ROFA 2VJLA 2QEQA 3H2YA 3QA9A 5CB6A 1S3SA 2BBOA 3PFNA 3TOVA 1VMEA 5EQTA 5TQJA 3TO5A 2Y93A 3IQGX 4S1TA 3D3JA 2P3QA 1QRTA 3R3SA 2P9BA 2HBQA 3T95A 1TK8A 4NLCA 2EFEB 1EXWA 1GPJA 5LNK6 2G25A 4M9UA 1I4EB 5KWVA 4GGPA 1KWKA 5LIRA 1LDNA 4BX8A 4L8GA 5DBEX 5JCOA 1VTKA 1ZR4A 3NU1A 4C5AA 3T38A 3LWZA 1BE6A 4KLIA 2AA3A 3OC0A 4O4IF 1XLUA 3W1EA 4OMFG 3O8QB 3T7EA 3KLBA 9ICCA 1JSZA 2CV1A 4LFAB 2X6QA 4RENA 4DLTA 4QWEA 3S8MA 3GN1A 4JVNA 4JLNA 2O2GA 4KXXA 2EZUA 4XFJA 4YUAA 2Z98A 2VHXA 2J3KA 1LPBB 3GPLA 3OFSA 3S81A 3JWEA 1Z6TA 1FS5A 4DBLE 5I5EA 4YRIA 4B4VA 3VYTB 1IN4A 1GPWB 2EP8A 1I4WA 4US1R 3CLUD 4N03A 1JLMA 4BNKA 1NA5A 1JKIA 1PW7A 3A58B 1SPXA 4CKBB 4LYYA 3WWZA 3Q1LA 1KMMA 4UZSA 3AEUA 5AH0A 3FMPB 1ZUNB 2Y27A 1KEWA 2J3QA 3E61A 4WOPA 7MDHA 2RDMA 4MQLA 2VPTA 2Q21A 1YDWA 3DOHA 3LSTA 3VU1A 2BJVA 2A33A 1P2VA 2KD1A 1Z08A 2IXAA 3O4IA 2HB6A 4KMMA 3PE3A 3RU2A 4CHGA 4AQYB 3DO8A 1CB7A 4CEHB 5BPFA 4PXSA 4RQ6A 1XDZA 3PNBA 1S7GA 2FUG1 3VYUB 1A0PA 1G9SA 1IN6A 1PDOA 1KWGA 3IV9A 4PZLA 4F4CA 1W4AA 1ES9A 2JFBA 3OLWA 1N6IA 3BB1A 2ACKA 2O0LA 1ZN8A 1E1QD 2ZRJA 4Z1MA 3PVXA 3PICA 2X7JA 1XHFA 3GMIA 2NSJA 4QU5A 4Y2TA 1U0SY 4JI3B 4R65A 3R6TA 1E5TA 1BFDA 1U5AA 2WD9A 1ZSYA 4PZEA 3DW3X 3KQTA 2GXQA 3AEYA 2VN8A 6REQA 5AW5A 3IUNA 4I36A 4OB6A 1SHZA 4HUQB 4ILKA 4KYIB 4W7HA 1TQHA 1C30B 3WQHA 3G9QA 3TB6A 1Y6FA 2NU7A 2HHLA 1Z6PA 3L4SO 3DLIA 2E82A 3DZHA 5AHWA 4WZBB 1G8MA 3PK0A 4FDVA 3F3YA 2A1TR 4E12A 1HYEA 3N0VA 4XRRA 4TMTA 4L0MA 4A03A 4QTTB 2Z2YA 3MXTA 4AIRA 3DAPA 3DEZA 1GZ3A 3RWBA 1KMCA 2ZETA 2C97A 4D45A 3G88A 5INTA 1D6MA 1KI6B 5LXTA 7ICTA 5H02A 4FEGA 5DIFA 2HWKA 2MJLA 4EHNA 3OHMA 3M9WA 1FSFA 3GEIA 4JR1A 1YL5A 4R0NA 3OEED 1JW9B 2NU6A 3MYYA 4C30A 4DHEA 4QUIA 4GQIA 5A3JA 3RJZA 3MLBA 2IHNA 3AZPA 2CK3A 4LISA 1YIOA 3HKBA 4DN6A 5L3SB 5K0GA 2ZVPX 3H9QA 3EPHA 1UF9A 3RAFC 3S1LA 4R9RA 2ASDA 1KYWA 1XALA 4F9FA 3IUMA 1ULUA 2OPHA 2O3RA 3EH1A 1KQGA 4NBNA 4QWAA 1PZEA 2ZIZA 5J0XA 1BRTA 5HCIA 4AM8A 2DFLA 2B8JA 3GZNB 1DQYA 1XFAA 3HVIA 5BOLA 1A7JA 3GIIA 3DL4A 3DFZA 1OBHA 1I1QB 3TLMA 5L3QA 5DIZA 1WCNA 2ZJAA 1J2YA 3K2IA 2OORC 4I2EA 2LPMA 1BPEA 5F35A 1KAOA 1UOOA 4I4TA 3GJ3A 2EG9A 5KQMA 4YR2A 5B1YA 4ZIRB 2ZIVA 2EDCA 2IV3A 4L4ZA 3TQTA 2PMKA 1R9MA 3SS8A 4G5GA 4ZCMA 3BK1A 5E6UA 1VZ3A 3PSTA 4NJEB 3W5IA 2FFQA 1W9MA 1IIBA 2A0WA 1SCUA 4PTZA 3G3EA 5DBBA 3TLXA 2E6UX 1Q44A 3QXHA 1WPRA 5EFOA 2ZSFA 3OPVA 3MFHA 3V48A 1W30A 1CEEA 5JFOA 3N1UA 2XNHA 3INRA 1BX1A 4GT1A 1YC5A 3PZBA 3EEBA 3ZQ4A 3LC2O 4EEKA 4G23A 1FEZA 1GRCA 2V5AA 4UPDA 3Q8PB 1JEJA 3PW0A 3KZCA 4CKCB 3IP4B 3REGA 3K71B 1BCRB 3VR3A 4C7OB 4W8GA 1H6BA 4OJLA 4AB1A 4P33A 4YV7A 2LDBA 3I53A 1APBA 2YWFA 4RC9A 2I2DA 5MHTA 2YQ4A 1TOAA 3ZVNA 1IG0A 1XK7A 1ZC3A 3SV4A 1W0JD 1GN8A 1YDHA 1Z2NX 2N1BA 1MV8A 5BWBA 3KWLA 3QNUA 2ZJYA 3I9V1 5T4FA 3BJZA 2D1YA 5H8WA 4R51A 1YI0A 2KLBA 1PHRA 4X44A 3PKJA 3WX0A 3MXOA 5TGTA 1ESNA 3F6BX 4H27A 3RYHB 3ADCA 1COWA 2A5JA 3IJRA 3FMVA 3IIJA 2FN9A 4LYGA 1CUZA 2J0EA 2QQFA 4UAJA 2QJWA 4BQEA 2UYQA 3GP5A 1RQXA 1F2UA 5JFTA 2XI9A 1VHJA 4MSUA 4XD7D 3ZD9A 1LF5A 1TE2A 3G1TA 1LQTA 3OCXA 4B75A 2G6TA 4R68A 2EW8A 4ECAA 3IMGA 3UJNA 2JXJA 1GL3A 5L1KA 2XT0A 3AVQA 2WM8A 5I7HA 1GIAA 3OQBA 2VHVA 4JBWA 1P0FA 5DNAA 2GR9A 1DC3A 1PL0A 3VAZA 1XZBA 3U60B 2CL7X 3VYWA 5LVAA 4DMMA 3UOWA 1BXKA 2OQVA 1U9ZA 3BERA 5D49A 2KWIA 2G63A 3IS3A 4HADA 1SL1A 4LVCA 4J7XA 3RHTA 5KL1B 1J2EA 4F9TA 1WB6A 1F0KA 1VA5A 2D3TA 2WC1A 3GDGA 5AM4A 1Q84A 4IIBA 5EYPB 1N5RA 4UOQA 5K09A 5FL7A 3V34A 1RWQA 2PUCA 3AR6A 1N8TA 4RS3A 3THVA 3PCRB 3PIDA 3LTEA 1GQQA 1MRZA 3MRVA 3NPAA 3N4MB 4EQZA 3A6ZA 3R0ZA 1UXJA 3LY9A 4RLHA 4X00A 3PY8A 2VPZA 3OM9A 4QUEA 3ND5A 3U4AA 4R69A 2Q3DA 5KYUA 4RETA 1J0DA 2IZ7A 3A2LA 1P2UA 1AH2A 1YRQA 2WIBA 4CIWA 1PFQA 3K32A 4TROA 3DDUA 1ISIA 3MT7A 1KPGA 3IELA 3BWCA 1NTRA 1SC9A 5KNBH 4M0LA 5K01A 3F7OA 4FEEA 3JPPA 3ECSA 4Q43A 2XPCA 3F8TA 4JMPA 3RFFA 5REQA 4CM9D 1UINA 2K60A 3ONDA 3WJAA 4TLCA 2PXCA 4CG3A 2H1CA 4MUFA 1Y37A 3SHTA 3B6EA 3FMIA 4J1TC 5KFHA 4EP1A 4RQ7A 4L85A 2MSWA 3RFUA 1XTPA 3G0CA 5J2JA 3WKCA 3ASYA 3VSEA 2FPPB 1XTJA 3CKMA 4BLRA 4RZRA 5F9FA 1FXUA 2Z5GA 1NOKA 4RHCA 1V3QE 3AQIA 4R7TA 2B2CA 1K0FA 3H1TA 5IVDA 2GERA 2E8OA 4CM1A 4GEKA 2MMGA 5ECYA 3ILYA 2WYUA 1NI4A 3FUXA 2HDNB 3LLVA 4WKOA 3PPXA 5DYWA 3L8DA 1WV0A 1SN7A 4G0QA 4XE5A 3GIMA 1DIHA 2QVYX 3WWOA 1IFXA 2RC5A 3NBMA 1KIAA 5LA6A 1XTBA 2I3GA 4L4YA 4FYWA 4DPKA 2VNSA 1LRLA 4AZ3B 1FDVA 1HLPA 3TPZA 2OE2A 4YMNA 4D46A 3RRFA 4GXNA 1GNPA 1HC7A 1A27A 1KRXA 2KG5A 3FRIA 1RXCA 5HRUA 1KEJA 5F77A 3B0XA 3ESBA 3FNFA 2ODWA 4MVCA 4INJA 3B1YA 1OV4A 2JDIA 2EBUA 4N9QA 1YACA 4HAIA 3ANLA 5BN4A 4OJMX 4ZK6A 3DLHA 1USVA 1T9GS 1YT5A 1U0JA 2PI4A 3L6DA 4CFZA 3GRAA 1FS6A 2YHBA 3BMQB 3N2GA 3NLLA 3KQYA 4ZGWA 4MV3A 1M2HA 3E9CA 3BQ7A 4JGGA 3P0JA 2P90A 4I9HA 5DMHA 2A0YA 3B6MA 1X2BA 5TARA 4F2SA 3V7WA 2NTEA 3ONNA 5EGNA 1V1RB 1PS9A 2HW8A 4F2DA 3KT8A 5CCEA 2XZOA 1ZGCA 3E3AA 3ZDDA 2XZTA 1GLGA 2W9BB 5I7VA 5KU7A 5LDDC 1FTWA 2FRXA 4PO9A 1TZCA 1EXNA 3ZU6A 4ZGBA 1ZY2A 4PZDA 2C4KA 4RKRA 3VTKA 4P2GA 3G1WA 2WB2A 5J4LA 2J59A 2NYRA 1IULA 1EJ2A 5EPUA 1MXFA 1ZOOA 2KFZA 4NDNE 4CUZA 1X7ZB 1R4MA 4AY4A 3TQSA 1EIZA 2RKWA 2KSOB 2I1QA 2GFHA 1KHTA 2IEGA 2DBVO 5EKXA 3SLRA 1O8CA 3K1YA 3WNQA 2RK3A 7ICNA 2WD7A 3NYIA 4EKGA 3ETRA 2BPCA 3NRBA 5ECGC 1T2NA 3MJRA 2HJRA 4I8DA 3HWSA 1AKQA 4FI3F 3ZY4A 4BIIA 2HCTA 2JLUA 1ECBA 4WXHA 3LQKA 1W36B 5FUVA 4L95C 2WMNB 3SVZA 1PGJA 4GUAA 5G40A 1ONSA 3T5PA 1SZDA 1N3IA 1Z5GA 3HGTA 5DK6A 3G2IA 3EFHA 2I7XA 3N0WA 4CWAA 3ZU4A 2ZYVX 2QVZX 1FY2A 5AVYA 4WJZA 5D3MB 4TUYA 3CO0S 3VHXA 2WHPA 4PW0A 3HKCB 3P19A 4LWPA 8ICGA 3KHRA 1XMSA 1O7JA 3AR5A 2H1OA 4M53A 2ZIUB 2Z43A 2YC2C 3CB2A 4UJ3A 2IZ0A 1VGRA 2PH1A 4WOJA 2I2WA 1XVUA 3TH5A 3V6LA 1N6PA 1R15A 1V1MB 3EZ9A 4YA6A 1WS6A 2QN7A 3FTQA 4MI6A 3T7JA 2QQGA 5TNXA 1EJBA 1GJRA 3RB8A 1TM3E 2FPMA 2HSZA 1Z35A 5AXDA 1YASA 2OD7A 2WSBA 3LCUA 1Y1PA 1OTXA 1QE5A 3ILHA 1Z0KA 2JJ1A 5ALMA 3D6TB 2ODGA 4G5OA 5FAXA 1N6OA 3KT6A 4JNKA 4FR2A 1PG0A 1C0EA 5GM1A 1E2QA 3BIWA 4RA9A 3L8YA 2R2AA 2ZAIA 4TL6A 4DPLA 4X93A 3E2PA 2FW9A 2GXUA 4COKA 5KFSA 1J8DA 3RYCB 3GFSA 4GD3Q 3R44A 4QNMA 1RM4A 4KL8S 5IZ4A 2Q9BA 1SBHA 2X3FA 1B8PA 1SHUX 3KJQA 1A9XB 1JG1A 3ICPA 1E9SA 2VI5A 4URZR 2D1QA 4ZOBA 1X7XA 1EP1B 3IAXA 4JEMA 3DNMA 3Q8XB 1OUMA 3R7FA 4D9IA 5IJAA 1PFWA 1GTL1 5E3IA 2G9UA 3R3VA 3ND9A 2V55B 3P9PA 4CEIB 3I2IA 4U1RA 3SC2B 1HDRA 1ZM3A 4YXWD 2VP9A 1T2VA 4FCTA 4RA6B 4LVOA 1GCGA 5LNK1 3ZKAA 1XSEA 4L0QA 1QUEA 2QD1A 3QPWA 4E4YA 3A2KA 1FFGA 1TI7A 3LECA 1WYGA 1SA0A 5WRFA 3QVWA 1BU8A 2Y6VA 4WDQA 4Q16A 2HSJA 5DTMA 5IT9A 1V16A 1WU8A 3I6ZA 3SC3A 5BRAA 1V9PA 3DM5A 2YB4A 1OGJA 1CR4A 3B3QA 1MN8A 3ICVA 3U80A 3RS2A 2O1EA 5ER6A 1CY1A 1XK6A 1NXWA 1GOTA 4HAYA 1IVSA 4LG1A 5JBNA 1IY9A 1IU9A 1Q7RA 5G5GA 1IBMB 4YRZA 5CXXA 5KYKA 2JZOA 4O4LA 2JGNA 3W2IA 2KJ8A 4X97A 4UBLA 1N34B 2P7IA 1MQSA 4FIZA 8ICMA 1B0PA 3B53X 3FN4A 2DULA 2BEUB 4QZEA 3WLHA 3KT3A 3LOUA 4I9UA 1Q0QA 4Q4AB 1GNSA 4BVAA 1GPNA 1V47A 3HB5X 2V7EA 2AGVA 4RIGA 4YAJA 4FP9A 3H65A 3EXEB 4GM4A 5I01A 3FYHA 1R8YA 1ORRA 3CVVA 5CYOA 4XJTA 1H5QA 1LSSA 4LCJA 4GXJA 4NBRA 1NJSA 5L9XA 5JJLA 1EK6A 2GRUA 1LK5A 2JAHA 2R6ZA 3K0AA 4UTOA 1QGUB 5SY4A 2QJTA 4IAOA 3VYSB 1PSWA 1J0EA 1YR9A 2CDBA 3IULA 1M1UA 4BUCA 3SE7A 3ISVA 3PF9A 2YUTA 3JATA 1ST2A 3SEFA 3MILA 1YZ3A 3ZGVA 1M1XB 4XVRA 3RVBA 4NZPA 1Q17A 4NSNA 5AKIA 2CHUA 1WX1A 5IYZB 4N5HX 3WYCA 4IDNA 4UTZA 2RB5A 4CCYA 4KSYA 4E6EA 2C3UA 2D2VA 1DV1A 4HGRA 3AU6A 1TGVA 1CZRA 1S02A 1CZHA 1Q1EA 2CDAA 2SKEA 5LXTF 3ZOZA 1J23A 4XQ0A 5G02A 3E9EA 4DLLA 3D1JA 4YGXB 5JV5A 4BXOB 4DMKA 1RRFA 4L15A 4DFPA 3MGCA 1N4AA 2D0IA 4HO1X 3C3BA 3GRYA 2YJNA 2Q3HA 3T5JA 1JLHA 4FPXA 3H1EA 3WGUA 1KJNA 4YFVA 2NQTA 2QSZA 2YJGA 3E9QA 3NVAA 1VSQA 2FEPA 2PAAA 1X7HA 2XQFA 3BD6A 2NUTB 2JI4A 1DTWA 1FPMA 4G25A 1YK0A 2QTTA 4MDFA 4G4GA 2AQ8A 4TQAA 3KOYA 1DAGA 3ZDAA 3R7DA 2WA2A 3TNFA 4PSVA 4X61A 3G7UA 3COYA 2IE8A 2PS3A 1TPYA 4MGIR 1JDUA 2G04A 4J1TA 4JYAB 3RF6A 2QJRA 4I4TF 4NONA 3HA2A 1VJCA 4Q05A 2FI1A 3PQ3A 5FADA 4UUPA 2NO7A 4ND8A 3UHAA 1CY4A 2O8CA 2NZVG 2W6CX 5JH7B 3R7WA 3VZRA 5LMZA 5J0PA 5D84A 4RU1A 2B1QA 1GZHB 4YJFB 3BCRA 3EHDA 4Y6PA 4QAQA 3TJZA 3PNKA 4LXYA 4US0R 1IM8A 2HIGA 1NF9A 3BGWA 3GFRA 9ABPA 4C0SA 1SU6A 1M1NB 3GILA 4WHMA 2JLXA 3O9MA 3SJZA 4LZAA 2W6OA 4CRXA 2K89A 4PC3A 3QWAA 3RJJA 3GHHA 5HBGA 1JNXX 2DECA 1WW8A 2R96A 5JMWA 5EE1A 1X2EA 4NLLA 3HJGA 2A1TS 2ZRAA 3GARA 4B45A 4NE9A 2Z4TA 1R0KA 3PUJA 2PKEA 4QJIA 3W6OA 4XSGA 3BILA 1G21B 1JPUA 2OHIA 3TIFA 1CUBA 5KKNB 4LRSB 5J2TA 2Y1IA 4TRRA 1KH1A 3UKDA 3DNFA 4JKOA 3UAGA 1X7DA 2D5IA 3SZOA 4ELTA 4D3ZA 2F1KA 1RHRA 3IJPA 2C92A 5C0OE 1NW9B 3L6BA 3PF8A 4Z4QA 3HVJA 3JYHA 5GONA 3NI2A 5EWGA 3EPIA 2VR1A 1J9ZA 5DW3A 5K0SA 1DIGA 3X1YA 4I14A 1PRYA 5AVXA 2OM6A 1NI5A 1K5DA 2ZRIA 2YRXA 2IZ5A 1DDOA 1JPJA 2W37A 2XEXA 4ZCLA 3K7EA 4BVFA 1WAMA 2HD4A 2YMMA 5A03A 1CJBA 3EFBA 4AX4A 4J94A 2F9MA 5KYTA 2WWXA 3PDIA 2P3LA 1QZUA 3VR4D 1NG9A 4LQCA 4O5KA 1JHXA 2H54A 3AHIA 1RWXA 1EGQA 1K92A 3FE2A 4ECEA 4IOJA 5ARBA 2J85A 9MHTA 1H0SA 3JW8A 2AI3A 1NKCA 2CWDA 1SAYA 3C1TA 4KRGA 5I47A 5LU9A 4KYUA 2GZAA 1T3QA 1G7SA 3VX3A 1AB6A 4OV6B 1CI4A 4P4MA 4X7MA 4EYKA 3Q41A 3W9YA 3NIWA 3RTDA 2X42A 3AKZA 1HDIA 2J3HA 4QYIB 3SFZA 1IC6A 5EEGA 4MQBA 4PYLA 1KZ7B 2BFBB 5HR6A 2WU8A 3L93A 3LYLA 3WLIA 3ITKA 4GL2A 1N1EA 1PS0A 2VJCA 1HUZA 3Q5EA 3OGUA 3M4YA 1IN8A 1HLDA 2W04A 3SQIA 3OTOB 1J2TA 1BWRA 5BV7A 1XMOB 1QZ3A 5K3CA 5J2EA 2VTDA 2WIFA 1FE8A 4OATA 2JLAA 1S8NA 3C6YA 2D13A 4PV7A 5CTJA 5TEVA 2YS7A 4R9VA 2ZBPA 4KHPB 3A36A 4JXXA 1SKWA 2BM0A 2P78A 3S2SA 3ADDA 3GIKA 3WNVA 3TW8A 1JHPA 1QK5A 4A0FA 1DK2A 2YVQA 5BWCA 3WAJA 1N36B 2ZQ5A 3VSBA 3MR5A 1KMHB 4LSZA 2V9WA 4NM2A 4O1MA 4IQTA 3L8EA 4EHFA 2LZ0A 3NHPA 4CV3A 4A6XA 4BQRA 5F7JA 2RARA 1QQAA 1U0BB 3LDAA 2COKA 1Z2DA 3ZIUA 3AK4A 3BZUA 3X3HA 4LHWA 3IBCA 2AEMA 4YACA 5DWDA 2WWHA 5DQGA 4AKEA 3NHWA 2P8JA 1FJGB 1KQFA 1GQOA 4G2NA 1ZK3A 1RQGA 4S35A 5EY5B 4LF5B 4KAAA 1E58A 4G63A 1Z45A 3GOHA 1SUEA 2P0AA 4UD6A 3UT5A 1TGYA 2QUZA 3GC6A 3URMA 3LO5A 2OBMA 2E5FA 4NU0A 2WQ7A 2HHAA 4MP8A 5CR9A 1N2BA 2FMXA 1Y9JA 4X90A 5F4ZA 4JUZA 1XOIA 2BAGA 4J03A 2DLNA 4B7CA 3KDPA 3OZ7A 4QDZA 1ZC4A 3AW9A 1F14A 4KWCA 5FPKA 4QZAA 4LVUA 3I72A 4H08A 3OKPA 1V35A 3TFQA 5C31A 3L0BA 1RE0A 3ZCXA 2ASVA 4HLDA 3QX3A 2XECA 3QFCA 2Q46A 3STHA 3ICOA 1EUQA 3CLHA 4UMEA 2AC7A 3K0EA 4CEHA 1L4NA 1U3VA 5JDIC 1T5DX 2PD3A 2FZWA 4Y2QA 1MQ2A 1W0JA 4EY6A 1Y9EA 4RELA 4MKIA 3TTUA 5KFYA 3LRTA 5BSWA 1TAMA 4DMHA 1FP6A 1FMTA 4YQYA 1P2DA 3I4FA 3I4LA 2J3JA 4AQDA 4AKGA 1F6WA 4PC1A 2V7VA 4F96A 1A9YA 2R48A 2G8NA 4MRNA 3MQ2A 3P2IA 3A0RB 2I7CA 1V37A 3VR5D 3HHEA 4ABTA 4K2AA 3SMQA 1R4ZA 2J6IA 3HV0A 4F5WA 4RZUA 3QLUA 1MG0A 4IP0A 3FOWA 1DO8A 4PCVA 2QY6A 1UBSB 2V3VA 5EJGA 2E87A 4MH0R 4QXMA 1QRRA 2AJLI 2OCKA 1SL2A 5FBKA 1R12A 1XYGA 4N01A 1WDWB 3ACCA 4RDHA 1I4LD 4LXIA 3KTOA 5CLLA 4UEWA 4UCFA 2J33A 2ZVQX 1XNGA 4WZBA 3WGTA 5ALTA 3B2QA 3CYFA 3EBOA 1OXSC 5MGBA 2W8BB 4ZVMA 4N48A 1IBRA 1KP9A 2JGDA 1XVVA 3A4IA 3P2MA 2PXXA 1DTSA 2X8LA 4LGVA 5C8YB 3NBAA 2C77A 1EFAA 4ED7A 5B58T 2NZ2A 2GH1A 1W0CA 3K94A 2WQZA 1WKBA 5LC1A 5H0IA 4TT3A 3GQBB 3QOFA 1N3LA 1IWPB 2IUUA 1PR5A 4R8KA 1NRIA 3K35A 1O9HA 4A1FA 2QARB 1P2SA 2AYXA 1KC3A 3WMRA 2XUJA 4BLTA 5LB2A 1DRUA 1T4CB 4G3XA 4CTMA 1F9AA 1ZJNA 4NDZA 1V11B 8ICCA 1C29B 4XM1A 4C3VA 3WL6A 3OBBA 4N5NA 3ROKA 1F9EA 2FDXA 2H07A 4CCAA 3SZMA 521PA 2Z6QA 2ID8A 2TMKA 1R0YA 1T43A 3GYGA 5DK4A 3UPUA 4IRKA 3HY6A 3HBJA 4ND4A 2QR3A 3H9UA 4YC7A 1YH3A 5K8IA 5F3XB 2ZS9A 1Z6YA 5IC4A 2RKBA 1UM9B 5FFNA 2FG5A 2VT7A 1P7PA 3Q7SA 2FQQA 4II2A 1FXWA 4R2IA 4D4IA 3D02A 3WXMA 1FW8A 1MA3A 3ZR4B 2OGUA 5AVTA 2IS1A 1C4KA 4F1JA 1KETA 3FZYA 4FYHA 1N7JA 2W9AA 1UJMA 1XTUA 1MPTA 5B7QA 5C8XA 4NJEA 2QNIA 3PO4A 3H2IA 2V6FA 2JJMA 3SX2A 3IDWA 1QJCA 2BI7A 3GCDA 2XNDA 2C4TA 3SCZA 3H2KA 5BW6B 4M88A 1XTTA 1QV9A 4HVLA 1IRIA 7ICUA 4FZNA 3R5HA 3RRNA 1Z8DA 2XRMA 3AGQA 1W1IA 1S0VA 4WFQA 2ZS8A 4X63A 4OUDA 1NAIA 4FFPA 1N3YA 2UUCB 1XZNA 4E15A 4PYQA 2ACWA 1NE7A 1U4BA 4JOQA 3DMTA 4QYXA 2F3RA 1BPDA 2FK8A 2EX1A 5E2IA 2XMBA 1UKZA 1P75A 5BY2A 1E0KA 5IBCA 3QTLA 4C7OA 4LYAA 3K96A 4MYUA 3HZHA 5DN6A 4FW8A 3WAKA 2CFIA 3G0BA 3JQEA 1X1CA 3K1RB 1Z34A 2Q0SA 3MGGA 2PMBA 4JH0A 4KU4A 1GDTA 1L5QA 5CITA 3M4XA 5FTWA 3QVUA 5DHAA 2OY0A 4YRLA 3FYSA 5J0UA 2RHTA 4LNHA 4QXAA 4Z3OA 3BF8A 2DF4B 5CB1A 3WSWA 4JI8B 3AP2A 1LJ8A 3WGZA 3KTQA 3K15A 4HQNA 3HCBA 2YASA 5G5HA 4QKQA 2GAAA 2VDJA 1XD2B 1ZISA 1L5SA 1XPJA 5JTTA 2ZSEA 4GXKA 1TMGE 3CUEF 3KCQA 3NONA 1L5RA 1ZQIA 4MB2A 1RVV1 2NVUB 2NUBA 1HWYA 4OIFA 3RTGA 1E6KA 2SKDA 3A2MA 1IHYA 3E7PA 3E9MA 4AUEA 1I30A 2QM7A 2R84A 7ICFA 3WB1A 3MCAA 1OH7A 2LCFA 3PU6A 4MARA 5D5HA 4DIOA 2HF8A 1PT5A 3HCNA 1D4OA 1TM5E 2EKDA 4I4NA 5L9AA 1DJMA 2BGJA 2GD2A 3AHHA 3A1UA 4ZYUA 1TXGA 4PGMA 1ZPDA 2HU5A 4XUGB 2X1MA 4QECA 4XUDA 2P3OA 5J2GA 1QVZA 3DHNA 3KE9A 3UT0A 2BGLA 2L18A 3NTVA 2HOFA 4R66A 2O8NA 3LVFO 5KG3A 2BTOA 2JAXA 2QL6A 9ICPA 3B85A 2EFGA 1JFRA 2I6GA 1RDFA 5A62A 5EYPA 3QFHA 3QSGA 3MR3A 4K40A 3A1VA 4HAVA 1QVWA 4UBIA 1S1CA 3F97A 1VIVA 2GHIA 1DBRA 2AZ4A 2VTEA 1LVHA 1F1BA 1SG6A 1RI2A 5FD8A 7AT1A 2EAPA 4WJLA 4DT1B 3MABA 4EUEA 3FZGA 3RSCA 1BWQA 3K0KA 1IDOA 4KN4A 3LZ6A 4DDMA 3RB3A 4ZV7A 3U44B 3AR9A 2GCEA 2Z08A 2R5WA 1SIUA 2UZ3A 3I28A 2V45A 2PFNA 2X15A 2IOFA 1UC5B 2X7XA 5JFGA 4W1PA 3ENQA 3IA2A 1JQLB 4PZZA 3RVMA 4YCJA 2XTZA 2G70A 4ZVVA 1J9GA 5KSOA 5KSWB 1X80B 1H22A 1U2RA 3BXFA 3G6VA 2KHZA 2O8BA 4RQBA 2AL7A 2FR8C 3K1JA 3JD3A 5NLLA 4B35A 1GPYA 4PF1A 3VDRA 3KB1A 1ZQOA 3DAOA 2P0YA 3KEGA 5C9ZA 1IJFA 1Q21A 1YR8A 4NZOA 1WSWA 2FFAA 4A5SA 2Q3FA 4F5DA 4DYHA 2VHYA 2O05A 2JGJA 4Y2GA 2R8GA 3RAPR 2Z4RA 2HBJA 1WCWA 1HFJA 1T0HB 1MO2A 2HA2A 2RGWA 1P7YA 4LE1A 1F8XA 1U1EA 4L5IA 5D3ZA 5ALLA 2VA8A 4ZZ0A 2IFTA 3IAM6 3O3CA 4HZUB 3BMOB 2PL3A 1YKGA 1WZIA 4EI2A 4KAFA 4WN9B 1Q1NA 5AM5A 2OLKA 4LOLA 3PWTA 5E9AA 1QQ5A 2C42A 3EQ7A 1X94A 3KKMA 3JPSA 2AZTA 3KKAA 4ZV9A 3WIEA 2OYSA 1G0NA 4FCCA 1HDOA 4YVZA 2R44A 2QNRA 2EP7A 3VPFA 2TMYA 4NMXB 3E22B 1S0NA 5C4IA 1YJCA 4OY3A 4IJ6A 4TV9F 2PR2A 2OFPA 4TSFA 3UGQA 5L3VA 1YB1A 2PJRA 5KVQA 2PXIA 4WZAE 4DQVA 5TF4A 1X7YA 3D7NA 5B2EA 2HHXA 1PJ3A 4PVCA 2W2VA 5DM0A 2YL2A 1DCMA 3A8TA 4RPKA 2GPTA 2A9OA 3F53A 3FCYA 2FWRA 1Y82A 4B3BA 4YXWA 3VO1A 5E7JA 1OYOA 1HG0A 3IO3A 5TR9A 4UHCA 4A8PA 2C2GA 2F55A 1TUIA 1WXWA 2OCGA 1ZQTA 1AXEA 1JTVA 5KNCA 3KOMA 5AVWA 1GPUA 3GJ0A 2RIPA 5KB3A 4F5NA 1VJ0A 3M9NB 4HFMA 3O7MA 3AUAA 4HGOA 3I32A 1QO0D 5I7FA 3GFTA 1VL2A 2W9BA 2G1AA 1ZQCA 4U02A 4UTNA 5J2TF 3ZW7A 2JLBA 3PC8C 3AX6A 1RQPA 5CT6A 1EFRD 2WWFA 4R7ZA 2AG5A 3AWIA 1EFCA 4PZOA 3SFTA 2C5HA 1GNVA 4P84A 4FHGA 1I4DD 2RAUA 3N8GA 2LM4A 1TVCA 3MQ4A 5L4SA 1VLBA 3B3FA 2XRZA 3VTZA 5B4VA 1E9EA 4K3UA 1E61A 1QHXA 3I9MA 1K4MA 3ML1A 3W79A 7ICLA 3KOXA 1QORA 1K5PA 4ROSA 5FA5A 3BG5A 4PG5A 3KQPA 4XH9B 1A8UA 2BI4A 3FLEA 3TJRA 2FW7A 2CUZA 1G1AA 5TVKA 2K8BB 2M98A 4GDMA 3BORA 5KTKA 3W5BA 3BD9A 3WDMA 1PJBA 2NYUA 2QRZA 3CINA 1G4UR 2VJMB 3KZMA 3MR6A 3HJUA 3T15A 2AG1A 4POOA 1N75A 4DCPA 1TYEB 5HJEA 3KO8A 5AQ1A 4FB4A 2PX5A 3NDBB 3RC9A 3EZ2A 1C9MA 1ZMBA 5E2BA 3JWPA 1QVVA 3OEYA 4LK2A 2ZSIA 1Z4KA 1R7RA 2HCFA 4J43A 1Y9AA 5IP5A 1YFKA 3WFIA 1Z00B 1AQ6A 1VM6A 1MAUA 4A1OA 1NATA 3K9CA 4ZCIA 4JFAA 1RM3A 4GXRA 1UEIA 4JA2A 5EE5B 4ZEOA 1C7JA 1ZCAA 5IDVA 3ZLJA 4H3KB 4ZH4A 1E4VA 3BE5A 5EERA 1R9JA 1SHKA 3VGPA 2D1TA 4IH9A 9ICAA 1V1MA 4C4TA 1QP7A 5DP2A 3ZJ4A 2FMHA 1YDEA 1I0IA 5JAQA 1IQRA 5AOVA 5EIXA 5C7YA 3TM5A 4B3MB 2IZ6A 2X9GA 2A58A 3EBLA 2ZIGA 2A57A 1M6EX 1A3CA 3A3NA 5DM70 3B38A 3ZQUA 4QFBA 1ND5A 2ZRPA 1K7EB 4EG7A 4DFJA 3T5TA 2ZAOA 3FTEA 3HWRA 2XOEA 3TZEA 4LDQA 4G0YA 2R1VA 4OJNA 3ZX4A 4QZ9A 1DWQA 3ORSA 5B30A 4ZEMA 4UBMA 4TTVA 3JQ9C 5DLFA 1ZP6A 1AV7A 3B1XA 3C41J 5FEMA 2H16A 4J1SA 1DT5A 5KVVA 1ZJMA 3L6UA 1HZJA 3IJEB 5KHLB 4EITA 2ZYRA 1UP4A 4Q8FA 2D74A 3LCJA 3LDHA 1E1CB 2WIKA 4Q1VA 4MV9A 3A6GA 1QIKA 2I87A 2AVNA 3RLFA 3RUCA 3AB3A 1A50B 1LCIA 3VV2A 2RHDA 4M1EA 2II6A 1FMCA 2G3YA 4LZLA 2X4LA 3RYFB 4TXJA 1B6TA 5BWMA 3CX4A 4FE4A 1I5OA 3D4NA 3ACDA 1AKTA 3RVLA 2C4WA 3ZHYA 5DGTA 3X1KA 5IXSA 5D1HA 3L0ZA 4RA6A 3PEFA 5JARA 3FZNA 1E1LA 4LE2A 2VZEA 1JVSA 4M83A 4UEQA 1B0ZA 5IASA 2X2PA 3JD2A 1V95A 2J87A 1PEDA 4MKGA 3UXEA 2OZPA 3DEJA 1I5RA 5AKHA 4ED2A 4P98A 3HPRA 1ZMRA 3SVTA 2ICAA 4BO8A 2UDPA 4DKXA 4IRCA 1FF9A 2DY1A 4PPGA 4K4IA 1U3TA 2UZ0A 4ZU3A 1DBPA 2VRBA 4HDRA 4JYCA 1GCAA 1NN1A 1PGNA 3OQJA 3OWHA 1PKXA 2C5FA 3K6RA 3DOEA 1L4YA 4UXJA 2Q2OA 3OZWA 3UBTA 3QVSA 2OCEA 2G82A 1HKHA 2JZNA 1SVIA 3C23A 4W5RA 4MMYB 1LH0A 4FZJA 5EMNA 1LRJA 4KIWA 1T3ZA 1VLHA 4KQGA 2X2EA 1GTG1 3O0TA 3BOSA 5JAHA 3W34A 1ZLYA 2VVTA 3HCOA 2QD3A 2D6FA 4HATA 1ULHA 1PCXA 3THYA 2WTNA 1QYDA 3FVWA 2L82A 3ZWYA 3CURA 2RC6A 1NNUA 4IS7A 3TI0A 3RKUA 3FPLA 1NFQA 5T8KC 1MEOA 1VPVA 1EHCA 1RKUA 2Z1MA 4XCXA 1Y8QB 8ICBA 1WCYA 2XGSA 9ATCA 4AP9A 2GD6A 1QTNA 3E0XA 1XD9A 1J2RA 4F4FA 4NPCA 3VR4A 4AYXA 3BT7A 1D2HA 2VHCA 1GO3F 4HWTA 1EZ4A 1RYEA 4K1LA 4EHAA 4TS4A 3LHFA 1QGUA 3I9NA 2ZW9A 1PGQA 3QZUA 3G17A 5EKTA 3U4DA 4A9AA 2KJ9A 2H06A 4BPRA 4DGQA 2JIDA 3SBDA 4YXMA 4JYPA 4GZ5A 2PMZC 1VA4A 2LDXA 2VJKA 1E6MA 1KEZA 1R2QA 1JIKA 2QHXA 2P5TB 2DL0A 1HDGO 4UHEA 4G1CA 1LLQA 1VDZA 4EHHA 1GEEA 1T36B 1Y8ZA 3EXFA 4JWKA 4MIYA 4WKBA 5DKFA 2DUMA 3USCS 1Y4AE 3GDFA 4UVEA 2FOLA 1FYXA 4LAFA 4MLCA 2O6LA 2ZB7A 1H65A 5AXBA 2C7VA 1NV9A 3KJIA 3MAAC 5KG5A 4JBNA 1NJZA 1I1OA 5BWNA 1F2VA 3CLTD 3UYLA 3KJZA 3GXOA 2POQX 1OROA 2ZZNA 3P96A 4E3WA 3QBVA 2GEDA 3I5YA 1PAUA 4XIYA 1EQ2A 1QC5B 4AJKA 5I8PA 4YJ3A 3OT1A 3QOYA 2OO5A 3R9XA 2P2SA 4HDCA 1V71A 1OFUA 1LFAA 1EFLA 1IUKA 3DDOA 2ODEA 1FZTA 2VCHA 4LJXA 3THXB 5KVAA 1DAOA 5ENDA 3NVMB 1T26A 5C81A 4ECSA 3DBRB 2BGGA 2FJUA 1QBKC 1QS0B 5LB4A 2H65A 2P75A 1GSIA 4OX9Y 3LDGA 1TV9A 5F33A 1JLLA 3ND6A 1FRQA 3MRTA 3A31A 2PD6A 1FNBA 3CRXA 2YHUA 2MYUA 1FXWF 4XRGA 3FSRA 3OH8A 1G98A 2J9FB 3KZOA 1MC4A 3CLUC 1F51E 1CIJA 2VYFA 1NNEA 1U0NA 1XELA 3AFOA 1PJTA 4WKCA 3SXJA 5DI9A 3EXG2 4DV7B 4CEJB 3CW9A 2FPLA 1Q16A 1DP4A 2H31A 5E8JA 2IHJA 4ESVA 1JEAA 1PFVA 3NG1A 1R5JA 2OGTA 3N2EA 1EKXA 3CR3C 1NF2A 2NPOA 3V7UA 1NIPA 2A19A 2AX3A 4D74A 3KKKA 2XUKA 5D2CA 2Z2XA 1VP9A 3IXQA 4M1ZA 5HZHA 1R9GA 2AFIA 3VSAA 3GDOA 3G0HA 1ZQ1C 4F72A 5B4TA 3KJFA 5BO5A 1W76A 5HJ7A 3LMKA 4QTUB 1QV6A 3ZHBA 2WPDA 1ZGZA 5K3AA 3RT1A 1CQIB 1I13A 5CK5A 3VKUA 2RLTA 5CNIA 2K4MA 4RKEA 1J6UA 3GPIA 3LD9A 4PGGA 2K4IA 3Q0TA 4RNNA 1YI8A 3Q7RA 2I78A 5DDIP 3SIWA 4FN5A 3EAQA 1S96A 4C6HA 5DJ5A 3T1TA 1B74A 4DOCA 2WAMA 3TFRA 5E8RA 4F2PA 2RI1A 4XWWA 3NDJA 5L1LA 1MV5A 3WV4A 4EW6A 1D6SA 3R8XA 2CL5A 1RXUA 4NFYA 3ZNPA 4JUBA 3K72B 3C28A 5IDWA 4MAFA 3RIHA 4DIKA 4XVHA 3QE2A 3Q7TA 4WNCA 1LSUA 4EBBA 3C0KA 1P6XA 4JL8A 2AZXA 4CJXA 3AL0B 1RLMA 1NLFA 3S1AB 1A8SA 2PX3A 3SBXA 1N6HA 5IWAB 2J08A 1NK6A 4QXRA 3VR5A 4BWJA 1QDEA 4DUZB 1PT9A 3W5CA 1EBFA 1PYGA 3IYLW 3B9QA 4R9NA 1EGHA 3QENA 2DTXA 2AI1A 1AGXA 5F23A 3WLLA 3PC8A 4KKVA 1J5EB 2F2AB 1IH8A 1WZ2A 5MN6A 1P9RA 1QONA 3CR8A 2WYHA 2OQIA 4I55A 3OAAD 2WF8A 1BOOA 1Z4OA 4CMIA 4GZMA 3B6ZA 4IGFA 4UB5A 2CGEA 4JXZA 1QH1B 3MTGA 3RO7A 4WN3A 5IIIA 2EJTA 3LUFA 3DT6A 2A0UA 2ZRDA 5HFAA 1RACA 1LK0A 2P69A 4QYIA 2H4ZA 3KELA 4FDMA 2BFBA 2FFRA 1RWWA 4ERXA 5NULA 1K06A 4LOKA 1O95D 3GO4A 5CPFA 1OZAA 3WJ1A 3NMUF 2XDQB 2XBLA 4HAZA 1IVYA 3N59A 1NJFA 4L6AA 3CWQA 4DUPA 3B7GA 7MHTA 4AO8A 4L9SA 1ZUIA 4ZI7B 3PRJA 3RTBA 4OM7A 2NZXA 4JGIA 2QA5A 10MHA 3UWKA 3DKKA 1X14A 5GTIU 5CDHA 4CDRA 2HSGA 1A77A 3EIUA 5AK5A 4HXEB 3IDZA 2R65A 4F5PA 3BRSA 1LKYA 1ZA2A 2CEKA 2X8JB 5HK9A 2V7GA 1M1YB 4BJ1A 3UM9A 2B7BA 2AZMA 2C00A 5A5VA 1RABA 2DQ4A 4AKIA 1AZTA 5JD6A 3R24A 3PVCA 3PUKA 1K6XA 1OFVA 2EGGA 4F5YA 5CFNA 3KQOA 1TTQB 4OXQA 4PGQA 4ALKA 3D9QX 1DXSA 4TYYA 1SQSA 5A5GA 5CVTA 3OMXA 2OWEA 4ZJUA 2AHRA 4F4IA 4QGHA 2UZ1B 4KXQA 3NEJA 4TV8B 7ABPA 1SMKA 4E30A 3I39X 2ZR7A 1STOA 1U28C 2B4AA 3CE6A 4FLMA 2X2FA 2OGSA 1KAEA 1UH5A 2VKTA 3DHEA 5AVKA 2EQBA 1NYTA 4P54A 3SKYA 3ZHOA 2PGOA 2GF0A 2RMKA 1K75A 4W7IA 3NEPX 3WQBA 4E7OA 3QKRB 3R3ZA 5HZMA 3B3JA 4F38A 1V3VA 4B7ZA 4DSIA 3GA5A 2OORA 1HDYA 2BUAA 4M1YA 3KUCA 4BWVA 4PHAA 4B73A 1U9JA 3BDIA 3BMNB 3C3YA 3CX6A 2D00A 4RQUA 2I9GA 2GEVA 4RHUA 1KAQA 5K6AC 1SU8A 3GFOA 2GPSA 2C9CA 1U8UA 3V8NA 5BMOA 4NE7A 4ZTZB 2C94A 3JQ9A 4ZV4A 3THSA 4M1MA 1O4WA 1PL8A 2VG8A 2FW8A 3BSSA 2W9MA 5ALUA 2XOKA 4YMVA 1VLVA 2VSQA 1CX9B 3OEHD 3G85A 3R5SA 3GK3A 1DCFA 1DO2A 3WRXC 4NBVA 4QXOA 2EEPA 1DIRA 2VJPA 2EATA 4PFKA 4NNPA 3FBWA 4G5HA 5AJYA 2INGX 4H0FA 1Q91A 1TVMA 4PZ0A 4JBGA 1AIPA 1CVRA 4K87A 2H4JA 1P44A 5IKMA 3BAZA 1MDFA 4JJ4A 4MA0A 1GV0A 5A3RA 1Z5VA 2G4CA 4BVGA 2C96A 3F7NA 3ED1A 4EJ2A 2DBYA 3Q7IA 1N8SA 3CNHA 3TQ1A 2NU9A 1PK3A 2HI0A 3L46A 3VMFA 3IAM1 1GFSA 4IILA 1W46A 4Q39A 3O82A 1RKBA 4TYQA 4NC9A 4KACA 1JSXA 1Y3DE 3OSNA 3H5RA 4DQ0A 4BVJA 4M60A 4R2HA 2OZEA 5JPIA 3S2YA 4WNYA 3ZNQA 3FI9A 3INNA 1J0XO 3P45A 4P53A 3U7QA 1YZLA 2RHMA 2YJ3A 4TWBA 4RKQA 1TLFA 2YQZA 1NM5C 2PIAA 3OE5A 1YVUA 2FW1A 1Y1TA 5DHPA 1TDJA 3L7AA 3LZCA 2B1RA 2I8AA 3U3XA 5CLIA 1YCFA 3WADA 1XHLA 2NG1A 4RNMA 3A6JA 4HXGA 1ADFA 3GAFA 4WZ6A 1J0CA 1YCGA 4A0HA 5CW1A 4KQJA 4M8IA 4HNVA 3D8UA 3PEUA 5FTKA 4H7KA 1DBVO 2YIVX 1W36D 4NCNA 4UNRA 3ESAA 1QHHA 4LW8A 3S3TA 3HU5A 5KMGA 1Y7TA 3OJLA 1DHTA 1RYHA 2WNIA 3S2FA 1T5BA 5C8YA 2PMCA 1V9SA 3V4PB 3FPEA 5KAMA 4AECA 2J07A 3BS4A 4C5CA 4DVJA 4LDPA 2ZRCA 2E48A 5I7RA 5T8KA 3VCBA 5TMDA 3MTAA 3GQBA 1C1DB 2WJHA 1TF2A 3PC4A 1FNSA 4BJ3A 4OGWA 1N9GB 3ILSA 2H1FA 3TEFA 1EDOA 3W4JA 1PZGA 2QARA 1U0FA 1EM8A 3F8WA 4H16A 5GP1A 1ZQEA 9LDTA 9LDBA 4N5IX 5K3EA 4DW8A 1USGA 5JXWA 1I7QB 2VDVE 4IO1A 3CLTC 1V11A 2IEDA 2FMUA 2HJSA 4Y2JA 1F7UA 4KI0A 4CM4A 3PE6A 3AYXB 5CEEA 1XF9A 3MJVA 3MB8A 3Q2IA 2GM4A 4TKZA 3T3MB 2QBYA 3B3GA 2IH2A 2VP6A 3IOMA 1L5VA 1SHTX 1UM9A 5JS6A 4NE2A 4I4LA 3RVRA 5DX1A 1MH9A 3NNDA 1PQYA 3V4OA 4C4SA 2E5WA 3B7WA 2G5PA 2JGEA 1CUIA 4HDNA 1Q1BA 3BCSA 1T1JA 3WHLA 2NUPB 3PEEA 4E5VA 1S2MA 5AI0A 5AKZA 4KVZA 1KDHA 2GS9A 3FOFC 5KG2A 3I2FA 4U7FA 4MFCA 5AKJA 4YDHB 3R4VA 1ZH0A 1QRSA 2AYYA 4JB2A 3E1KA 1W85A 4O2LA 1NK8A 3K70B 3VDQA 1CRLA 2HF9A 3FSGD 3OCZA 4ZMRA 3S2UA 5ICFA 2B8WA 5DTRA 4LMRA 4CFYA 1RZUA 2CLFB 5JTUA 3AU8A 3C3MA 4YO7A 3N8NA 3UXHA 1M8KA 1L4MA 4C78A 4HXFB 1JFTA 2PUJA 2L42A 3H17A 2P62A 1IMJA 2VJBA 1P1CA 3C8MA 3LXUX 4CGYA 1G8HA 2PCJA 4I1RA 2AKYA 1G0OA 5AFSA 3MGAA 4MUBA 2I3AA 2PLRA 3NB0A 5BMVB 3MS2A 4YAFA 4KWHA 4J90A 2I9KA 3OD5A 3BUSA 1IJEA 3TS1A 2ISPA 3DOUA 4LTNA 1IE3A 4CR6A 3D2CA 1CZNA 4EY4A 4AFNA 2WB1F 3LFHA 2QTBA 3HWTA 3ZQKA 1C7EA 2JAOA 1Y98A 4ND1A 4TURA 1FRVA 1D1SA 2WT9A 3GCXA 1Y4ZA 5FRDA 4DRXA 2R8OA 3N9IA 2NT3A 2DMRA 1QAQA 2ANBA 1Q0TA 4N6GA 4IZHA 2VSFA 3QUAA 9ICEA 5AT1A 1ZN7A 4HB3A 1G19A 3VR2D 4XX0A 1IMOA 3ZNNA 3OQIA 1C3OA 1KF0A 4URHA 4ILEA 3CRW1 1OTHA 5CNMA 3KSMA 5KFQA 4NOKA 4E2XA 3U4QA 1CUCA 3W3ZB 4I6EA 3W0LB 3W9SA 3RIMA 3T3NA 3UMJA 1TFUA 2GVZC 1CUXA 3KPWA 2EF0A 2QTRA 1NNI1 1E1QA 2VJYA 4ITVA 4RLSA 4JAVC 3OQMA 1EFRA 3VBCA 1RLIA 3GLFB 4LRQA 4P5PA 2IS2A 3ER6A 2JIRA 3CPJB 1EE9A 4NQRA 3R3WA 2HWXA 4RHXA 3G2QA 3X0DA 1UDWA 1MW9X 3BIFA 4WESB 2HKIA 1Q19A 4KBYA 4Y2RA 2H8KA 3HPOA 3TZQA 3TYXA 2JI9A 5TPWB 3HP6A 1X92A 4C0XA 8LDHA 1MBZA 4HQ0A 2QB0A 4YRDA 3QPDA 5DGDA 1O95C 1HQKA 3Q2KA 1QK3A 3FDZA 2RGAA 4C76A 4K46A 3PNQA 5KHAA 3BRCA 2XUHA 1KMNA 4J0GA 1V4BA 3LLUA 2JGIA 3TRFA 2BFWA 1U7TA 1SZHA 1NJWA 3MLAA 1KKUA 2I71A 1GRNA 2A7XA 3F6EX 4OJ6A 4QUAA 1HE4A 3W7VA 4RPGA 5ALOA 3A0BU 4G5SA 4YYZA 2PI5A 4IEFB 5AHKA 3KXKA 1SKRA 4P2BA 3DZDA 3OEEA 4OQQA 2JGKA 4RT2A 3MJFA 2IOFK 1YRYE 2G72A 5KYGA 3D4IA 1JUDA 4IG4A 2TRSB 4QTYA 3D6NB 3KSRA 4TRJA 2FZGA 4E1BA 1AJEA 4HGPA 1X8JA 1LTHR 3ZVMA 1L5KA 1HSOA 2QV7A 3QE4A 3Q2OA 3ZXXA 1DJOA 4P0QB 5A3VA 4R0VA 2ZI7A 1DC5A 3K70D 3H2JA 4AD8A 3GVPA 4H1VA 4QT0A 2CVFA 4KFCA 1PJAA 4ZI5A 2B6NA 3B70A 4IUCS 2FLPA 3BKXA 3GZ4A 9ICOA 4DF4A 5E6SB 3ISBA 3AC0A 5KFLA 1WUYA 1BPXA 2BFMA 2FYTA 4ECVA 1NXOA 2QRNA 3O8QA 3K92A 1KQPA 2NM0A 3L0SA 4U6PA 1WQ1R 2YYYA 4EYOA 5LOVB 3WK8A 4UEOA 4D3SA 1ZEJA 1GILA 4OJ5A 1PK7A 4MF8A 4Z4GA 4WN9A 1U3UA 5CDUA 1SXHA 3MTEA 2G9VA 1OFGA