3UM9A

Crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
225
structure length
225
Chain Sequence
GMHAIKAVVFDLYGTLYDVYSVRTSCERIFPGQGEMVSKMWRQKQLEYTWMRTLMGQYQDFESATLDALRYTCGSLGLALDADGEAHLCSEYLSLTPFADVPQALQQLRAAGLKTAILSNGSRHSIRQVVGNSGLTNSFDHLISVDEVRLFKPHQKVYELAMDTLHLGESEILFVSCNSWDATGAKYFGYPVCWINRSNGVFDQLGVVPDIVVSDVGVLASRFSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural adaptations of L-2-haloacid dehalogenases that enable hydrolytic defluorination
rcsb
source organism Polaromonas sp. js666
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase, type II
total genus 88
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3um9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3um9A01
3L0BA 5ALNA 3OCZA 2YMLA 2G80A 4MWOA 1T5SA 3N5KA 3NALA 5AICA 5AVTA 3ONNA 3IJ5A 1Y8AA 5AKGA 4EX7A 2C88A 3PGVA 2ZBGA 3U7EB 1SU4A 2FPRA 4KNWA 3NANA 1FEZA 3M1YA 3HLTA 2FUEA 3ZUPA 2GFHA 2WM8A 3TLMA 4UAUA 1RDFA 3WK4A 3AR6A 2OBBA 5T41A 3U13A 4QJBA 4Y2UA 5ALYA 5ALPA 2CFTA 5ALKA 3GYGA 5IS2A 5AW9A 5ALXA 1F5SA 2BDUA 2HSZA 3OTQA 1XP5A 2MU1A 1ZD4A 3EPRA 4UASA 3L8FA 3NASA 4OD0A 3WK8A 1Z4OA 2ZBEA 1YMQA 1N8NA 1LTQA 3ZW7A 3ZVNA 2HF7A 4CF5A 1T9ZA 2CFSA 2RBKA 3KBBA 2G1AA 3FZQA 4Y2VA 2OA0A 2OM6A 1QQ6A 2ZBFA 4FYPA 3E8MA 2EAUA 4B6JA 4G9BA 3I1YA 4AS2A 2AGVA 5AW6A 1RKUA 3FVVA 5AW1A 4Y2PA 5AI0A 4L6CA 2B30A 5ALGA 2GHTA 2WFAA 2B8JA 2IOHA 2HF2A 3L0YA 1RMQA 3KDPA 2G08A 3W5CA 3AR3A 2HOQA 3FPBA 5AI9A 2WF7A 2HEGA 3ZWKA 1ZJJA 4YH1A 4BYGA 2IOFA 5AKEA 1JUDA 3QU9A 3DDHA 4CNQA 4IFTA 3W5BA 2EATA 4UARA 4UW9A 5ALEA 3F9RA 2W4MA 2CFRA 5AW0A 3MN1A 3L8GA 4QQFA 4Y2QA 1O08A 4HYTA 4DFDA 3A1EA 3W5AA 2R8ZA 3L8HA 2QLTA 3SF0A 3U7FB 1Q91A 2O9JA 1RQLA 1T5TA 1WPGA 2FEAA 1L7MA 2JAUA 2AH5A 3RFUA 4BNDA 3QU4A 1TA0A 1VJ5A 4UM7A 4F71A 1YNSA 3L5KA 3AR5A 4Y2TA 1IWOA 3UMBA 1SWWA 4BX2A 3QGMA 3WKBA 4DCCA 3W5DA 4EELA 1Z4QA 3N1UA 3ZX5A 4L57A 4OCZA 2EARA 3I28A 1ZS9A 2W11A 3EF0A 3U7HB 3U19A 4Y3UA 3FM9A 5AW4A 4YIKA 2NYVA 1LVHA 3QUCA 2X4DA 4UMFA 2MU2A 3L1UA 4OHFA 5AW5A 1RPZA 3A3YA 3OCWA 4HGOA 1QH9A 5ALLA 3I6BA 1RKVA 3ZI4A 1VJRA 3KC2A 4UU1A 3ZX4A 1RC8A 2R8EA 2Q4RA 5AW7A 4CF4A 3ZU6A 4J2TA 2CN1A 4YIHA 4HGPA 1Z4MA 4KN8A 3OCUA 2I33A 5IT4A 4C4SA 1XVIA 4BX0A 2BY4A 4HGNA 2RARA 3QUTA 1ZOLA 5AKYA 3DNPA 3KOOA 5AVVA 3QUQA 2OYCA 5AW3A 3R09A 2AMYA 4DWOA 3PCTA 4G63A 3FGOA 4UATA 5AM5A 3I76A 2YJ3A 2C9MA 3ED5A 5A3SA 4KNVA 4HAIA 2YJ5A 3SLRA 1RMTA 1YDFA 5ALZA 5AI6A 3WK5A 1Z4PX 5AKHA 3EF1A 2RB5A 5ALRA 1NNLA 3KZXA 3N07A 3SKYA 2JARA 5ALOA 2I34A 2HHLA 4YCLA 3IB6A 3BA6A 4XE5A 1Z4LA 2Q4TA 1CQZA 3OPXA 2R8YA 1NRWA 1Z5GA 4J03A 4E88A 3OCVA 4KX5A 1NF2A 2O2XA 1ZD3A 1XPJA 2P9JA 1ZRMA 5AIBA 3WKEA 3WK7A 2ODAA 4L6AA 3ZVMA 2FPXA 1RLMA 4YCNA 2HCFA 4GIBA 1J97A 3E81A 4KYTA 2RAVA 1L7OA 3SKXA 5AW8A 1U2TA 3U7GA 3IRUA 4UAVA 3AR2A 4UM5A 3PDWA 4CF3A 5ALFA 3P96A 2GO7A 2DQSA 4ZEXA 1S2OA 4Y2XA 2JAOA 1EK1A 5AKLA 5AKKA 3HYCA 1TJ4A 1QQ7A 4RESA 3SHQA 2I55A 4O8CA 4C4RA 5AKIA 1K1EA 4XQ0A 2G06A 3E84A 1TJ3A 5AK4A 3WKDA 1RLOA 4JDPA 2B8EA 2HO4A 4UMEA 5AK5A 2FI1A 1L8OA 4ZEVA 4EZEA 4UMDA 4KX3A 5E0OA 3L0CA 4GXTA 1RKQA 1YS9A 4BEVA 5AVXA 2YN4A 2G0AA 2YJ4A 5FP0A 5AI8A 5ALJA 3NIWA 3WGVA 3UMGA 3VAYA 1L7PA 4EENA 1Z4JA 2FPSA 2FUCA 3AR9A 3RF6A 3ZTYA 4I9GA 4EX6A 3UM9A 1U02A 2WHEA 2D2VA 3MMZA 1Z4IA 1Z88A 2G07A 1QQ5A 1CR6A 1U7OA 3AR7A 2QYHA 2ZG6A 5AM4A 2I7DA 2GHQA 4NFLA 3QU5A 1ZRNA 2WF6A 1Z5UA 4PNHA 2JGAA 1J8DA 3M9LA 3S6JA 1Z4KA 1ZD2P 3NRJA 2C4NA 4RETA 3ET4A 3CZ4A 1S8OA 3QX7A 4I9FA 1RMYA 3WK9A 2B82A 4Y2JA 2C8KA 2R8XA 5AM1A 1PW5A 2HX1A 5AIAA 1YJ5A 3L7YA 5AVWA 4OFZA 2B1RA 3AR8A 3MPOA 1Z4NA 4DW8A 4XOUA 1N9KA 5AW2A 1SWVA 4XPZA 2PR7A 2GMWA 2HI0A 1WZCA 2YBDA 5AVZA 1L7NA 2B1QA 1RQNA 5AK6A 1RLTA 2WF5A 2P11A 2W43A 3ZTWA 3QU7A 3QUBA 2WF8A 2JAWA 5AHXA 5AVYA 5AVSA 5ALVA 5AVQA 4YCMA 5ALWA 2Q5EA 4HGQA 4Y2YA 3N8GA 3QU2A 3WKCA 3PGLA 2AUTA 3D6JA 3KD3A 5AVRA 5AVUA 1TE2A 3R4CA 3ZWDA 3SMVA 4FFDA 5IT0A 3B9RA 4CE6A 2I54A 2P69A 1TJ5A 2ZXEA 5AM2A 1EK2A 3L1VA 2YMQA 3N28A 4NAVA 4ZEWA 3B8EA 5AKZA 4IG4A 2YFYA 3U26A 1WR8A 5AI4A 5ALIA 5AKJA 5A3RA 4UMVA 3OCYA 2VKQA 5AESA 5A3QA 5AKXA 4BNDB 3QLEA 1AQ6A 3EWIA 5AI5A 3SD7A 2NO4A 4JB3A 2FPWA 4NWIA 2YMPA 2C8LA 3A1CA 3ET5A 1L6RA 4C4TA 4BEWA 1MH9A 2IOFK 4BBJA 4HGRA 5ALUA 2NO5A 2YJ6A 2ZOSA 5ALMA 5AK3A 4NV0A 2FPUA 1YV9A 3QXGA 1WVIA 4AP9A 1X42A 1VFPA 4MUMA 1Q92A 2YY6A 4NABA 4YGYA 1KYTA 1U2SA 2BDEA 3K1ZA 3DV9A 3AR4A 3DAOA 3ESRA 3ZVLA 3A1DA 3UMCA 3MC1A 2G09A 3B9BA 2MSNA 2HDOA 2IA5A 5ALSA 3WGUA 3QNMA 2FDRA 5ALQA 1U7PA 3NUQA 5ALHA 3WK6A 2PQ0A 3NAMA 5JJBA 4Y2SA 3L8EA 2YMMA 4UU0A 1QYIA 5AM3A 4EEKA 4AS3A 5ALDA 5AM0A 3CNHA 2PKEA 2IYEA 4F72A 4BKMA 3ESQA 2I6XA 3OCXA 4H1WA 3QYPA 2ZBDA 2P27A 3BWVA 2B0CA 5ALTA 3J7TA 1O03A 3E58A 3FPSA 1RRCA 2WF9A 3R9KA 4FE3A 4BX3A 1L8LA 1ZD5A 4Y2RA 3WKAA
chains in the Genus database with same CATH superfamily
1CZOA 2JFGA 2GEDA 5DU2A 1KEVA 1J8VA 3WIOA 4Z0HO 4BKUA 5KAIU 4DQQA 1A4XA 3CH6A 4E4RA 4EZ6A 1XCJA 1U4BA 1Y3BE 4ITRC 4DR6B 1I2BA 3S2GA 5BNZA 3EGWA 4EK9A 1WJGA 4UB6U 2VQ3A 2ZANA 5JVDB 2H1FA 1UXJA 2PLRA 1J0AA 3GRAA 4XQEA 4D4GA 5FDFA 5JAZA 1LPPA 3HVUA 4GFJA 1QHIA 1FCJA 2JAXA 2XVMA 3Q9NA 4PLCA 3A9TA 1UT8A 4LS3A 2Y8EA 4Z9YA 4ELVA 4EATA 4EECA 3FOFC 2H1CA 3OIFA 3NP9A 3H05A 3QVLA 3VC3A 2D13A 3D2CA 2GKOA 2Y1LA 3PXXA 5DH9A 2FZVA 1DIGA 5EIHA 5EZYB 1BZYA 1Y1PA 4FFWA 3AOGA 2NXWA 4I55B 9ICIA 1P7PA 1RE1A 3AG6A 3DEJA 4M7RA 5GY7A 2IPMA 4V02A 5J2CA 4UHBA 5L4LA 1XL0A 1MTZA 1J42A 1O95A 1BCRB 1CE8B 3HXPA 1ZL0A 4FDAA 3TM4A 3D31A 2HQOA 1B6TA 5L9AA 2BMWA 3ITNA 2N3ZA 4OGLA 4WFJA 4Z0TA 1JZQA 1S2LA 4R1UA 5AHWA 3V4OA 3ZDQA 1TDJA 5ENDA 2EZ8A 1U28C 1HQYE 3RSFA 1SKUA 1Z4OA 5TB5A 2AI1A 1C7JA 2VHEA 2EAMA 1ONPA 2EEZA 2ZJBA 3Q3CA 4KE7A 5HBGA 1XZHA 4IJVA 4CMJA 5SYNA 1BJRE 1K92A 3MRVA 1D5CA 1KJWA 4GMKA 2KV2A 3KKAC 4Y2VA 1K97A 3C7DB 2OM6A 3D64A 4RQAA 4X8HA 3RTGA 3R9XA 2AMLA 3I52A 5GVSA 1H69A 1NQOA 1ODCA 1KJNA 3NAQA 4PLVA 2PRSA 3VR4H 3UW1A 1F12A 4G9BA 1B0ZA 1KAMA 1T3TA 2R79A 4H7EA 1UDRA 1QDUA 1X7HA 3GJ7A 1DRJA 1J8QA 1LZLA 3DZDA 4AS2A 2BVNA 5C4IA 4Y8VA 1GTRA 3KOXA 2CE7A 3OEYA 3K6SA 4B2IA 1PDWA 2GHTA 2OT3B 5FUWA 4QFDA 4A23A 4A15A 1FQJA 4KPUA 1IBLB 2I4RA 4D4MA 1G8MA 5FNZA 1YS2X 3MTIA 4RM2A 4MAFA 5K9ZA 3KQHA 1H5QA 3OLYA 2GB4A 3ZGOA 1B4FA 7ICTA 1WUJS 4YT8A 1BHJA 3FUVA 1ZJ4A 1LBIA 2QPAA 3HJRA 1PQYA 2E48A 1FLAA 3KAPA 4FFRA 4L5JA 4M0LA 4Q4JB 5AKEA 1JUDA 4RUKA 1WUHS 4Z1MA 4UEKA 4EZIA 1SIWA 4IFTA 4GDFA 4NK5A 1MB3A 3CE6A 5IAKA 2GCPA 4TN5A 4EA9A 5DMXA 2JI6A 2IHMA 1E94E 2A9RA 3L8GA 1PK7A 5KSPA 4HEQA 4HFMA 1KBQA 2XYPA 4XIYA 3W4KA 3IEIA 5B5EU 4X91A 3AVXA 1DJOA 3RSOA 1FTNA 1YZLA 2WKSA 3UJNA 4DFDA 1N9GA 3NUGA 4MPJA 4H1TA 1F4VA 1LI4A 1XZIA 4F2RA 1CU1A 4NENB 4F11A 5I7FA 1RPAA 1OWMA 4KQGA 3D5QA 1ZI6A 3NATA 4AULA 5EJ9A 4C7VA 2CDBA 2B92A 3AR5A 4C7MA 2XNKA 4NEGA 1RCUA 3V5NA 3PK0A 5CA0F 3O83A 4J1NA 1PVOA 1R8YA 1PT6A 4U0KA 4OYRA 3WGYA 1SWWA 2GUGA 3IUNA 2A0YA 4WZ6A 4EKGA 2H2IA 4LXIA 4XEHA 1Z2DA 3ZX5A 1NRIA 1C9DB 1A5SB 4BO6A 2ZYTX 3EF0A 2ZZKA 4RPGA 3OZXA 4QXAA 3JWJA 4X20B 2F4VB 2M1XA 3LDUA 4K46A 4EVSA 2Q6KA 3RC9A 1CF4A 4RNOA 2JK0A 4OK3A 4WUVA 4E5DA 1DXYA 3ELWA 4AYTA 3MB5A 4FW9A 3IAFA 4OHFA 4CHGA 4Z7OB 4LDAA 2QL5A 3SQOA 4YFVA 5I8PA 3VH4A 1TKRA 1UZAA 2C04A 2FR8A 4ECVA 1ZMRA 2NU7A 3ESYA 4HVAA 4MUGA 4P7JA 4KQXA 4D3YA 3ZWYA 1RLIA 5ILOA 4AS1A 4ZVSA 1IN8A 4LNUB 1JYFA 5IVKA 1XEWY 1TVKA 1KQNA 4KRXA 4BTLA 1QIEA 2Z1DA 3NHRA 4TTIA 4UE6A 3ZBTA 1N75A 1US8B 3T1QA 1SUBA 2PWYA 2QG4A 3GN1A 4YIHA 4Q4DA 2EVWX 2XUAA 5ED0A 3OJWA 3V7YA 1XVIA 2XF8A 1MPXA 1RWKA 2VOJA 4OX9Y 4FMBB 3KV3O 3I9V1 1ZOLA 4LWPA 3ZYZA 1JLHA 4UJ5A 3A0BU 1Q12A 3GA0A 2VCHA 4QWMA 4X92A 3KLPX 3OOSA 2HQRA 4WCFC 2Q21A 3GRCA 2DF4B 2W6ID 3H6GA 4G63A 3NGLA 2PGOA 3A25A 3EXHB 2BMAA 2W8ZA 2B3DA 2NNLD 3VDMA 2WAQC 5CB8A 4ZARA 5JPCA 2CXSA 7ICQA 4J91A 2LNDA 4PBSA 4EH1A 4JWNA 4MRMB 1BOFA 3PDHA 3H2YA 5DNAA 3QF4A 4WXEA 3WDLA 3B6KA 4R3UC 4YVFA 1MOZA 3FYCA 3URKA 2VF4X 3UXPA 4GICA 1RMTA 4MUXA 1E98A 2OLEA 4MR7A 1D9ZA 1KMQA 4KR7A 5CNKA 3BCRA 3S0JA 1IBSA 1UFRA 2PL5A 2WAAA 3LNTA 5JJKA 3PFCA 3IUQA 2JVIA 3G0CA 4BMOB 3E23A 1WA5A 3T3IA 3IB6A 1Q5PA 3BA6A 5JHHB 3G88A 1PG0A 1CQZA 2JIRA 4ZQIA 3CEJA 3ORYA 3STWA 1PK3A 4F9FA 5BVHB 5IJXA 1VHTA 1PWEA 1MDFA 2JNWA 5F52A 2V6FA 4IQ4A 3OCVA 4LDJA 3SZMA 1E7SA 5B3KA 4BASA 1QWSA 5JAPA 4QM6A 3DHNA 1GPLA 2NO7A 1QOZA 1L1QA 3E05A 2J6SA 4HWSA 3R5HA 4L5IA 2XVYA 1QFYA 1YTUA 3N86A 4KXYA 1QH1B 4GECA 4KUEA 2PE5A 2HDWA 1MXFA 5FOWA 4DMHA 5EIWA 5H7XA 2JZOA 2W9CA 4D7AA 2C78A 3O9VA 2LGJA 2WU1A 4CIAA 1A2KC 1ZINA 3C70A 4HAZA 4HYKA 2BFWA 3GEDA 3SXUB 4BKPA 3SYTA 4YJHB 3D5EA 1JYSA 1N6KA 3OEHD 1IG0A 2XGMA 3H2ZA 1ETHA 1VPTA 3A6KA 1U2TA 4LRUA 1TJPB 3PRKE 1V9CA 5CWRA 4TWRA 2PGNA 4M0MA 1WCXA 1RAEA 4W9NC 3RS2A 2EBUA 1CIVA 4ENTA 3T5AA 1KU0A 2Q3DA 2WV7A 4PQRA 1WY7A 2CVOA 1Z3EB 1OJLA 3DYIA 5CCDA 4RPYA 2ISOA 1PJRA 5ALFA 4JLPA 2GO7A 1A88A 1NIPA 1QYVA 1NV9A 2PZKA 4ZEXA 4O4LF 1MA0A 1FMCA 2XIJA 3D8NA 4M22A 2PMZC 2PPVA 3JAKA 3VNBA 3W7VA 4AKTA 3E0FA 4EBEA 2R6JA 1DIRA 2H48A 5JSUA 1UZMA 4J9UE 1GITA 3WNVA 1WBDA 1U3FA 2HSGA 3A04A 4GLLA 2HSWA 5G0VA 4TROA 4P4GA 4ZOLB 2OPBA 1K6IA 2BHRA 2VJKA 5KOHB 4Q3BA 2NZWA 2ZYIA 2ZI9A 4PYKA 1Z00B 4IJUA 1XHLA 4BXOA 4ND1A 1X6VA 1HFKA 1KXJA 1PE0A 1E3QA 1PQPA 2Q07A 3TN7A 3AUKA 4JI3B 5BOSA 5CFZA 3E1GA 1PNOA 4MUJA 4B6EA 4GH5A 4HAUA 1UH5A 1I2DA 4MW7A 3GHYA 1ZYQA 3GLQA 2XBMA 2HHQA 3VO8A 1WXWA 4RQMA 1X7YB 3EZ5A 2WK1A 4BQSA 5CD9A 1UC8A 4MA4A 2CNNA 1HT0A 1QQTA 1EP3B 3F97A 3QOXA 3R7DA 4P32A 1YZHA 3T0GA 1VXRA 4GPEA 4C43A 2KYRA 1QBGA 3SBOA 3ZNNA 4GYWA 4D6XA 2RHWA 2UAGA 1LFDB 3BAZA 1CR1A 3F90A 1GL9B 1DFGA 2HT1A 4OJPA 4WN3A 1Q7RA 1N6LA 2B4YA 2QHXA 4F4KA 1DUVG 5KT4A 3M6IA 3LQ4A 2GPJA 1CY1A 1EKXA 3FBGA 4ED1A 2VJOA 1FYVA 2E6KA 4K9MA 2YCLA 2KD1A 3RR8A 2O7QA 4REMA 7ICIA 4P22A 5EC8A 5KKAA 5TX7A 2PFNA 2E21A 8ICPA 4C7BA 5T64A 1QIHA 4F60A 1CR6A 4JT9A 5LP6A 2RDIA 4M9ZA 3EXG2 5EJ4A 2KOBA 3IMKA 2WYHA 4TQUS 4R2XA 1JMYA 4AURA 2HVIA 4HEJA 1KI2A 4NFLA 3VPHA 1PS9A 2BM0A 3NIGB 3C1TA 5B3JA 3RSGA 1X86B 2J6CA 2R8GA 2XXBA 5FNVA 3E5NA 2WMNB 3VO1A 3LYUA 1D8YA 1MW9X 5DNDA 4DDHA 1X1AA 2ODGA 1W0KA 3JQRA 4NDAA 3L84A 1XNRB 3OUUA 4BRWA 3FROA 4TV8F 4D1YA 5CVDA 3VH1A 2GBGA 4ECQA 5FWXB 2I9KA 2VZLA 2YNMA 4O4HB 2FEOA 1CQJA 4J8PA 2Y71A 2AIRA 3BE8A 5EVCA 1VL2A 3AIOA 4PYJA 3K0KA 3NAZA 4PBTA 1JI3A 1SUAA 2Q9CA 3GDFA 1CUUA 3F5EA 4CI9A 2O0HA 3HJEA 4TZKA 5KNDD 3UTCA 4B9SA 3OX4A 3OOJA 3GDXA 1KVQA 4DLGA 1GGKA 1NQUA 3BRCA 2BSQA 3NYIA 2QB0B 1BMQA 1CRPA 2BEWA 3K0AB 8LDHA 1JR2A 1JIVA 4QUIA 3D02A 1OLXA 3HEBA 4UAJA 4LYHA 2GD2A 2W8BA 4BFTA 4LHVA 4MX8A 4NL4H 4C08A 4N5NA 5HM8A 3O4JA 1DQPA 1GSHA 3IHLA 2PGAA 1JWBB 3JSAA 2ZU6A 3DTTA 3IULA 4GBMA 3W8EA 1RACA 1QLJA 3HB5X 4WL0A 4RL6A 4PIMA 5A4JA 4BZWA 1GTSA 4C2TA 4JD5A 3AB7A 3THVA 3NJRA 4FXOA 2YHAA 4I8IA 5IABA 1HOXA 2A0XA 5I8WA 3GLFA 3R3XA 1C30A 1ZUNB 4Y2YA 4HGQA 1WQ3A 1LC0A 4DB4A 4RGQA 3OOYA 3Q6MA 4BRUA 5CRXA 4YRZA 4NAUA 4ZYWA 5FA6A 3OQ6A 5JV5A 2PZAA 1WZUA 4BNUA 4E14A 1MG0A 3CJTA 4IRDA 3NBYC 3TXAA 4K1XA 2GJ8A 3NOOA 1MGOA 4QZIA 5IDYA 3Q4GA 5CA1F 3C6BA 5AJUA 1NBWB 1P4JA 5F76A 3FOZA 1JQ5A 2EDCA 4NBKA 5JAHA 3VR4D 1QM5A 4ESVA 5JJLA 2ZM5A 2WJWA 4D41A 3S2FA 4OAOA 3B8EA 2Y0SC 3TINA 3OBBA 3WO0A 4DEXA 3KSBC 1Q1EA 3U26A 1WR8A 1OW3B 3R3JA 1L5GB 4G0PA 2KZ3A 3K1JA 4WVLA 2OENG 1X13A 3Q3EA 3GJZA 4D4KA 4FR0A 3R8XA 1B16A 3CIFA 1PQ4A 3U1VA 2ONYA 2Y1KA 2ZRMA 4H77A 4Q01A 2DQKA 4DWVA 4MUKA 3WDSA 5JATA 1TGYA 3TJMA 3TH5A 2VC2B 1GPH1 2ODQA 1Z06A 4OXNA 4OXRA 1A7JA 5H82A 1NOJA 1G64A 4WAUA 4X71A 3LD9A 2G7ZA 2EG9A 4BB0A 5CTAA 5EJ6A 4KXFB 2PX6A 1TQ4A 4NWIA 3TSAA 4DABA 3B13B 2CLKB 5BSUA 3B82A 4QDTA 3GMDA 4WECA 4CKBA 1XI2A 3ETEA 5BWBA 3W6UA 2DQYA 1J33A 3EBOA 3DMFA 2W9MA 1JKIA 4MITA 1Q83A 4JL8A 3F73A 4NMXB 3E9EA 1IJEA 2FMQA 4ZAGA 2A1JA 3KZOA 4HZGA 1URPA 2I6UA 3BSFA 2NZVG 4ZH4A 1P1CA 5IIIA 1V95A 4DMRA 2H7CA 3D7LA 4J7UA 4D82A 1SC1A 3W77A 2OQRA 1TQ8A 3RJHA 4YGYA 2QKYA 1OYVA 3AR4A 1NVTA 1M2KA 1ZQTA 1FUKA 1Y3HA 2Q4DA 3A1DA 3HWRA 3UMCA 1XMIA 4OSOA 5DX0A 4HT3B 1KN5A 3P2IA 4MKHA 2X23A 4RHEA 3LC1O 2AN3A 1DLIA 3UPUA 4C7ZA 4ZCRA 4RD2A 1Y6RA 4FS2A 1DC3A 3TGPA 3NB0A 1EFVA 5D01A 3ZDRA 4QM7A 5BNTA 1TM7E 1S3SA 2GWRA 1J6UA 2IZ7A 3CN7A 2BP7B 1JBQA 3I12A 4J1TC 4TMZA 3ZOKA 3SKYA 4I5FA 3U7GA 2UYHA 4EJ6A 3QSGA 4JH0A 1EVYA 2YJTD 4H7HA 3R7AA 4JQOA 5CEEA 1C7YA 4GXIA 4KN6A 3EY4A 5JT1A 3K15A 1BWRA 1VSVA 2HK6A 4C6TB 5FWNA 5C7LO 4Y1RB 3DMDA 4E6PA 5FAXA 4M1ZA 4QGHA 2C92A 1N2SA 2V9CA 2CXYA 1ZJ5A 3CMCO 5MN6A 1Q3UA 4RCVA 4GC7A 2CHUA 1VBKA 3OWXA 4K9LA 1UPHA 1KKUA 1NONA 3FPHA 4ZQGA 3SQXA 4J7AA 4U02A 4BNMA 1FOEB 3BA1A 1V8OA 3ZYCA 3JRNA 2X1VA 1GRRA 3KLBA 5HJ7A 4D25A 4MWGA 1PR6A 3L6BA 4NCXA 4YRPA 4AZ3B 4FE3A 5JSFA 1IQ0A 4DSZA 1SURA 1KYWA 5KJFA 3VSCA 3DOHA 1K88A 4Q8FA 2I2BA 4F4XA 2K4HA 1HPLA 2CDNA 3L0BA 3Q5DA 4G89A 4R68A 5DGDA 3SF8A 4A5SA 4BO8A 2ZVPX 2HZ7A 3F1KA 5BSTA 1RBZA 1ZISA 1KO5A 3CPJB 3DZ8A 5T4BA 3GP3A 4WCFB 3LVBA 2GN8A 3RS9A 4UAYA 3STTA 2EWWA 3MWGA 1KBOA 1HH4A 4G5XA 3UV6A 4DF3A 4Y18A 1N2CB 2ZJ5A 1KQQA 1CD5A 5JY1A 1UWKA 1F0YA 2Z8YM 5D87A 4RIIA 3UT6A 4EI7A 4QC2A 2RONA 2C2BA 4BX9A 4DC1A 1EJ0A 4IX1A 4RHYA 2ZUVA 2FEWB 1Z5WA 2V96A 3K05A 5EIBD 4ETMA 1YFKA 2MYTA 5HS6A 3KYJB 3VPGA 1SKWA 3L3BA 4TQAA 1MF7A 1RZUA 1SUIA 3BTVA 4FW8A 5FYQA 5JI2E 1LLQA 4LDZA 5H70A 5JROA 2ZSUA 3DTVA 2QRPA 4Q00A 5C4GB 3SBEA 4W8HA 2OL4A 2DY1A 4PN3A 3T5MA 1N56A 2V1XA 4R1OA 4ZO7A 4D0LB 4PGQA 1S77D 3GOQA 3SMQA 1P19A 3WZMA 1B26A 2XEDA 1JJFA 4UEJA 5DLDA 2W71A 5IS2A 1WB6A 4AYWA 4Z7QB 4QFBA 4XWYA 5KWEA 5BMVF 3G2JA 4JCOA 2LTAA 1L1FA 4GM0A 1PCXA 3H5NA 3N76A 1ADCA 3GLGE 3GLHA 5C34B 3MR2A 2BI7A 3ORRA 4C30A 3OE7D 4PG8A 2X0NA 4LXUA 4M37A 4OJ5A 1KFTA 3UG6A 2H54A 3ZE2B 1SCQA 1H6DA 5I48A 4B73A 4CF5A 5LQRA 1KEEA 2HNKA 3GGPA 2R1TA 5JG7A 3ASYA 3T5HA 3T8YA 1C3XA 3KSDO 2BKXA 2AUNA 3H1PA 4BLVA 2A9FA 4JV0A 1JSCA 3BH6A 5HE8A 4C0BA 5E9QA 4C05A 2X77A 1ZGAA 1MAAA 3EC2A 2LBOA 5IH3A 5E4YA 5AW6A 1ODKA 1ZGJA 4S1WA 2IYRA 5AI0A 3R7BA 2B30A 4MKRA 2VT7A 1Q84A 4TUYA 1L5QA 1CUJA 5JAIA 2P6PA 3DE4X 2CCKA 4FHEA 4CQMA 5IDXA 5C35A 4KO1S 5T6BA 3VTKA 3DLCA 3TRHA 4AJHA 4ZOQI 4EPRA 1SM4A 3WO1A 4HNVA 3E5RA 4BJ1A 4DS3A 1ZQMA 1ADYA 1H5UA 4BN5A 1TTTA 4BYGA 1VE6A 2GD6A 2Q3JA 3GGJA 2IOFA 3DZBA 3Q3VA 2XKKA 5F9HA 3F3KA 1V43A 2RGEA 1EWYA 2WSLA 3ZDEA 4DOAA 3BIOA 1JVBA 2VDRB 2A5LA 3U1BA 3CB4A 4N5IX 1QHNA 1W47A 1GD1O 5KWVA 3LQRA 2I4OA 2J4FA 2BZGA 2WTMA 5DN6D 4DFJA 1Y88A 2GYVA 4MNTA 3PX2A 3VR6H 1OY1A 3N53A 3U16A 4H35A 3M9WA 5K8JB 1RZ3A 3KXIA 2X22A 1TAUA 2AR7A 2V0CA 2TMDA 4R7TA 3ADDA 3VH3A 2F55A 1X1BA 3FPAA 5TF4A 4B83A 2I2AA 4MV8A 4PPNA 1L7MA 5KNCA 1SIUA 1LDEA 2C5FA 4L85A 1PHPA 4R9RA 5IHXA 4IDGA 4XQ9A 2UZ0A 3TBFA 3ICEA 1K98A 2RHCA 2RGWA 2HIHA 5BPHA 4R8MA 2RE8A 1SQSA 3NPMA 5DGHA 4DEVA 1XVLA 1Z7EA 2YV2A 5C7OO 3VX4A 3DLAA 4GOMD 3M1IA 3L0IB 1HDGO 3WQHA 3HCNA 4UNQA 3ZXYA 1P7CA 2H9AA 1U0OC 5J59A 1KJQA 1M2EA 1G98A 4RMHA 5LXTA 2RGRA 2ZE8A 5I7VA 3MWEB 4AL4A 2FP4B 3RASA 5BN3A 2OLJA 2R8IA 4DCPA 1M0EA 1CFJA 3RYIA 5F9MA 4WZBA 3WGMA 1Q0SA 1DPFA 8ICTA 4UPVA 1GGFA 3CCFA 3GN2A 2QD1A 4YIKA 4QWAA 5AW4A 1AHPA 3PFFA 4MIEA 2EOAA 2NVOA 3L1UA 4KUHA 5K0ZA 4MCHA 4M9UA 4UDXX 1E2BA 3NOQA 3Q8MA 1OF1A 4FSHA 3UYLA 1O54A 4R31A 3QKTA 4COOA 3KJZA 3D2QA 4KLEA 1ORRA 3OY7A 1CJMA 1JR3D 3GLUA 3RRZA 3PITA 4P93A 5KFSA 3ZI4A 1W1UA 3VC2A 3PUKA 4DTCA 4Z7NB 1RC8A 2QN3A 2YWHA 3AIKA 3NBMA 4OL0A 3EDQA 1G17A 1N2CE 4X1YA 5I4BA 3FNEA 3PNPA 1HDOA 1BEUB 1OAKA 3DQPA 1NQVA 4DCVA 4YAKA 5BURA 3VNVA 2FPIA 3GUUA 3G5UA 1L4EA 1SEPA 1GXSA 2RARA 3K30A 3WNDA 4CR8A 1VXOA 1FP7A 1O95D 1U3UA 1XYGA 4CFYA 2VSYA 2FOIA 4EZBA 2BWJA 5JEDA 1U0JA 3WGZA 4GO1A 4CLHA 1FX0A 3QKRA 2XMSA 2ZIFA 4QPDA 1WTCA 5CHGA 1V5FA 1VG8A 5C1PA 4QG3A 3W5SA 1BS2A 1CF2O 2R6HA 3BXHA 1TI7A 1VMEA 4RFSA 4XR9A 4GMFA 1EXVA 3CMMA 3WWDA 2Y4NA 4KNVA 1N2CA 4GZ6A 2BZ1A 2IDKA 4D8YA 5ADWA 4F2DA 4NMWA 5IT9A 3WMFA 2J5XA 1YACA 3ITDA 2FPGB 3KSUA 4GOJA 2FXIA 1S1CA 4S05A 2QMHA 2YY5A 1EX1A 3PNSA 1G18A 3MJRA 1V8BA 3C74A 2PX2A 5FUYA 4A92A 4E2YA 4FGLA 1V45E 2DUNA 3LLSA 4LX0A 4I50A 4LRXA 3TFWA 3TUJC 2PSDA 2WD8A 4LF6B 3EZ2A 3H13A 3FHJA 2GZ1A 4ZCSA 2K8CB 2PGLA 1WIWA 2FSHA 5ALOA 3LWNA 3QFTA 4J9PA 3EAFA 2R6GA 1W2WB 3QA3E 5HF9A 3OSZA 1XUOA 3PDIB 3UA3A 4CMEC 2DBVO 1GZVA 3U3XA 1SL0A 1NKSA 2IY7A 3QHPA 4MS3A 4N1AA 5CB4B 3PSHA 2H4XA 3ZZTA 3GILA 3TTSA 1U28A 5IMSA 1D07A 3GJ3A 3A6JA 2N46A 1JXOA 5DBGA 3ER8A 3IELA 4CL8A 4YLYA 3JATB 3JPYA 2XAUA 5AIBA 2D8CA 2CXNA 1JI7A 2R8HA 1NZBA 1XZQA 4QUKA 2PU5A 5CB6A 3ZVMA 3HMKA 3EQ2A 1X1CA 1BEEA 1ZNQO 3PV0A 3H9BA 3BXFA 4JX9A 2RFLA 1UODA 1ZSVA 2EWMA 2WB1C 3Q5EA 3VU9B 1RRPA 3ZCUA 3EMDA 4C0ZA 2W7OA 2GVDC 4YJ2B 4K6HA 1EUCA 1MB4A 2EC5A 4U9IS 3H1TA 2QLJA 2VF8A 1EHCA 3K35A 3T3OA 5FNVF 3BM5A 1NR1A 1SXJA 1YTLA 3A9WA 1NM5A 1SHLA 2BV3A 1IY9A 3SM3A 3JQBC 3F3YA 3HYLA 4TMFA 2JJMA 4RTPA 2JEGA 2Z8YA 3BWBA 1QVWA 4KO3S 2HRRA 3AEQA 1Y5RA 4FQ7A 1FNSA 2RHFA 1XZGA 2V8BA 3KUKA 3EEBA 4E51A 4F38A 5C8XA 1N1EA 2IYNA 3DZIA 3EQ6A 3QENA 4PICA 5BYBA 5J8YA 1H2ZA 3ZWPA 1QTRA 4IDPA 2FZEA 3CRXA 1N5KA 3RR2A 2E4WA 1XMOB 1QYWA 1RM4A 3AK4A 1M1ZA 1W9MA 5LBIA 3BK2A 3BHJA 1E18A 3O2NA 2I55A 2E3TA 3CP8A 2J9FA 4QPPA 4BX9C 4BAZA 1JDPA 4N6NA 3V6JA 4YGXB 2CEKA 1E3JA 4LOIA 4E2ZA 1KI6B 1I1HA 2QD5A 1E9AA 1JSZA 1TZ2A 1IUKA 2BR3A 2V3VA 3LU1A 3KYIB 3OFND 2F2AB 5IK2A 1F0MA 1MJGM 1MAHA 3UGKA 1I7SB 1DDIA 1GZUA 1M6HA 4E2FA 2OKGA 4N3BA 1QANA 2A1TS 3EG9B 3GLIE 1U8TA 3IJEB 2B8EA 4B76A 4HTFA 3T5BA 5KFIA 4ZEVA 1L8OA 2GZHA 1SUFA 3Q6NA 3SICE 4JI5B 4MUYA 3G6YA 3U56A 4NESA 4DDMA 1GRQA 3A36A 5E0OA 3GNSA 4LC1A 3FSGD 4MV4A 4BEVA 1TM2A 4Q24A 4YP1A 4DJ5X 2C5HA 2DUUA 4E1AA 1QIMA 3TSWA 2RK4A 1J1ZA 1K1SA 4BLSA 5I7RA 5AI8A 3A4IA 1KYXA 3LY7A 3GRRA 4H3HB 1H0KA 3DYVA 1YCGA 2ZJ4A 1VHLA 3IDSA 1E2PA 4R2LA 4HLUA 2QR2A 1A2BA 3VC1A 1IBRA 1KK0A 4CIDA 8ICRA 1EX9A 4K6GA 9LDTA 1FFBA 4ZJPA 1XN1A 1YI8A 3HZOA 3P9IA 2D1FA 3LL7A 3NCTA 1BPBA 1U8ZA 3O8QA 3OOWA 1NRXA 1Z33A 1VCHA 4JROA 2JZBA 1H6AA 2QPLA 4HPWA 2JLYA 2J3KA 1RJWA 4OYHA 2PUDA 2O6KA 5TARA 2IL1A 3LGAA 4FP9A 1AKYA 1ZU4A 5F7ZA 3OF3A 2R96A 3SAFA 4RAQA 5J2HA 3E0QA 2I7DA 3SBXA 3X43A 1H1TA 3UKOA 2KIVA 3DZKA 1E3LA 5IU6A 2JFBA 2CJPA 1MHPA 2CD7A 3NEYA 3BMQB 2VHWA 1YB7A 3RS7A 2YN2A 3V1TC 4ZGBA 1VL8A 3FWPA 1PNRA 3B5EA 5EUCA 4ME6A 1KJ9A 4IIJA 1IN1A 1SUEA 1IXRA 4G6ZA 3WLMA 3CZ4A 1UBNA 1XMPA 3TEMA 1MX3A 4ALIA 3OTWA 4EHJA 4BNLA 3F9CA 4MR9B 3MJHA 4B46A 1YGPA 2WWRA 2RB4A 2VXBA 1MGPA 3LH5A 4PZYA 1U4NA 1V7QA 3PDCA 4PAMA 3SK0A 1F2UB 1XLTC 2C4VA 3AWIA 4BGUA 4FJ2A 3V7KA 4JBWA 3S1AB 4F6LA 4OQMA 2W9XA 3FFBA 4AKSA 5E3HA 3UBTA 4MRNA 3AVYA 4DFMA 5DDYA 5J2TF 2CBXA 4UB8U 2OBFA 3QVUA 2EWVA 2CJFA 2YICA 4FCWA 4QSMA 5KAMA 2A9QA 4NQRA 2NSDA 3RIMA 4C78A 1C7FA 3ZGLA 4XPZA 3SV3A 3QKSA 3PUYA 1PBNA 1FUUA 2O7NA 5J0QA 2JFZA 3BGOS 5EQFA 1IPFA 3WFIA 4C80A 2ERCA 1DCTA 3RFAA 1QPZA 1KMHA 1RBYA 4IMIB 1CQIA 3RJEA 4CM7A 2VRNA 3A4MA 4X5VA 3GR6A 1LQUA 4J2HA 1HF3A 3VR6D 1J7KA 3BMCB 1Y9DA 1U5CA 1PUJA 3RQSA 2FMFA 3W8NA 2JFNA 4J49A 1EDBA 4FNOA 3FOAA 5EWLA 1TMKA 5EHNA 5ES4B 3O4FA 1Z36A 4MDEA 5DP2A 3CLRD 1Q0RA 1M2HA 3PNCA 1TTPB 3SOPA 3C3XA 4KV9A 3AX6A 4EA6A 4BU1A 3Q8PB 2WU3A 1YJ8A 3KDAA 1F0KA 3WLJA 2EQYA 4AY6A 3PEUA 2FMTA 3PR1A 3ZWDA 4FFDA 2HA7A 3JTEA 2J7PA 4N3AA 4ZT2A 2C1ZA 5AVKA 1YQEA 3AONB 2QF7A 1ZIPA 1XTVA 5ICFA 3ECCA 1H0RA 1YWGO 4LQDA 3WGIA 2DB3A 1GA4A 3G8BA 4Z4GA 2YMQA 4LCEA 1NK4A 4OHPA 4H17A 1IFXA 2WQZA 3UWSA 5HUJA 3D2BA 2CMGA 5AI4A 3NETA 1TK9A 3EYWA 1DTSA 2BH2A 2OXEA 3OETA 1AD2A 4MV7A 1PSZA 4PO8A 5GP1A 2JLUA 2HJVA 1HQKA 1ISMA 4J4BA 3DLIA 3O31A 2O54A 2OORA 3DZHA 1QKKA 1WD5A 3KK0A 3W9SA 2QGZA 2P7HA 3N8KA 1PVPA 2BZFA 3NDJA 3C48A 1BS9A 1Q20A 2IXDA 3LF1A 4LGMA 1MP0A 3DWGA 4O2AB 1M0TA 3JATA 3WU2U 1VLBA 4OXQA 4YRNA 5IASA 5AI5A 3OPQA 3UJHA 1C1DA 4DEZA 4QASA 5CMLA 2G1PA 4GMXA 3ETLA 3TLYA 1VC2A 3OMWA 2I4NA 2IXTA 2BE9A 3U81A 4A2QA 3R4VA 9ICHA 1IY2A 3GHHA 5ECWA 2R9VA 3HK2A 3KKQA 2CLDX 2H07A 2WFLB 2BBWA 1DBQA 1OLXB 2IYQA 3PHIA 2ZJ8A 2NO5A 2YJ6A 4TXHA 3L6OO 4HUTA 1YZTA 1A4RA 1QU3A 3CRRA 1WMDA 4IOJA 4KR0A 2F1KA 2R5NA 2YZNA 4PTYA 4OIFA 4QLBA 1NLZA 1MIHA 8ICVA 5CG2A 3EBLA 3P45A 1XF1A 2P4QA 3QXGA 2O8BB 3W4IA 2EQBA 3RF7A 3VV3A 2SKDA 1AA6A 2WE7A 1JHYA 2VLIA 3ACBA 4QU8A 2OCEA 5A1TA 2HA5A 3V8VA 3Q8SB 3HP7A 5EN4A 4X00A 3FF4A 2G09A 1M75A 5KFGA 4U7WA 1C9EA 3D8SA 1W93A 3CZCA 4HWOA 5CIYA 1RLJA 2G4CA 2QORA 3MJCA 5EHIA 2Q41A 5ADVA 1AQYA 5D7NA 4A26A 8ICBA 5U4QA 3VU8A 4RVOA 4ZIRB 3M4JA 1CDDA 2PZBA 4O4IB 4ZJYA 1QFSA 3H7AA 1Z7BA 4CV2A 2JI4A 1W36B 1KJJA 3HBMA 3WSTA 2J33A 2YNMD 5EMMA 1ZHOA 4NG4A 3JQAB 5EEHA 2A1IA 3V7WA 2QZ4A 2C2EA 2Z56A 5I9BA 1RQXA 5F9NA 2V5UA 3I72A 2H3ZA 2IEGA 3KB8A 4EUFA 4OIMA 4QUEA 3IHWA 1UKZA 4B3FX 3J7TA 1I80A 1T8RA 5EPUA 1ESNA 3IEMA 4F3TA 4FS1A 1JHPA 5U1PA 3VOSA 2W22A 3K5WA 2KHVA 4C0LA 2XADA 1I3LA 2G1JA 4J1SA 4Q3EA 4XVQA 1DFHA 2VP5A 5AUNB 4R8RA 1E3WB 4CU2A 4CMEA 1P1BA 4S04A 9ICPA 1YVUA 2XWPA 5E4TA 5E6RA 5HZHA 2E18A 2DLDA 4NRDA 4EKIA 1MJGA 1OFUX 3DHEA 4KU4A 3IIIA 2CYAA 3CLRC 4ZAZA 5F4BA 2HJSA 3RFVA 2WHRA 2VNIA 2V7VA 5J4HA 3TG8A 4FFBA 4WVFA 3UHAA 4FPXA 3ZV6A 4HSGA 4P7FA 3SIPA 3T3MB 1TKCA 2ATEA 2F9MA 1FU4A 2GYYA 4RKFA 3U3ZA 2J0EA 4CTJA 4J0QA 1OH6A 1VYVA 1JG1A 5K0NA 4IIEA 5BYKA 4ZMRA 2ZBGA 3SIWA 5DCWA 4QUHA 5DM2A 3LUPA 1WMBA 4KNWA 3PPWA 3U0VA 3U4MA 1WSAA 3D3NA 1S10A 2QRQA 1C5KA 3KYDB 3DKVA 4OMFG 1SPXA 3N59A 3ZGVA 5CDUA 1DKRA 3VC7A 1PD0A 1QZTA 2QDKA 3PRHA 4RVNA 2Q0HA 4RABA 1N6HA 4UBMA 5DBFA 3TX2A 4DYDA 1R10A 3PQEA 1OLUB 3VSEA 4R0VA 3IP9A 2BL4A 5JQGA 3V7JA 3ILYA 3JQBA 5K2MA 3U13A 4JLAA 3T5DA 1XCLA 3GI1A 4Z3DA 2EJCA 5D49A 2OE2A 3ER6A 4MGIR 2JK1A 4Q18A 1ZXLA 4LF5B 3RJTA 4F6RA 5ICMA 4PNPA 2L18A 3ZEIA 3QX3A 3CRZA 2Z09A 4MI6A 1NWHA 4N12A 3CVYA 3QV1A 4CLRA 1M67A 1P1FA 2ZDHA 1SR8A 1Y1SA 1SBZA 3AF0A 3PI7A 3TKYA 3AFHA 1CUZA 2SHKA 3HPRA 4DXAA 1QJCA 3JAWB 5DLGA 2VZ9A 5EJ8A 1A5ZA 3Q8QB 4GI1A 4GWLA 1K75A 1WX1A 2ESEA 4LXYA 1P1IA 4BN0A 1H9CA 3L1HA 1TPZA 3DEZA 3RH4A 1DAOA 2AXQA 4PVCA 2RBKA 3A9RA 5LQCA 1M1NA 1M2WA 1XQ6A 2XMRA 2JC3A 1JR4A 3T1NA 2HLPA 3AUXA 3IAS1 4ENPA 5JMPA 4WZAA 3O2JA 3SHWA 1C81A 4ED9A 5KQMA 3PD0A 4ECZA 1IN4A 2RHTA 3LO5A 4Q1AA 5BV7A 1DO0A 1SQFA 4OYLA 3RANA 1U3WA 2QTTA 1FFAA 3JD3A 1F2TA 3IMCA 4P6VF 4Q9KA 5ALGA 4F92B 4NU6A 2B8JA 4TLBA 1WMEA 1P9RA 5IULC 4FYXA 5A6VA 4LN1A 3T79A 3ND6A 5CLIA 3RRNA 2R6FA 3SHFA 1S9HA 5JDIA 4ND6A 4JUDX 2HHWA 4LZPA 1JVNA 3NKVA 1BCRA 2RHOA 1N34B 3MT8A 2RSLA 1TADA 3L8ZA 3W6PA 5GOTA 2FN8A 2GN9A 4LVSA 4IV5A 4UXIA 3O9ZA 4YH1A 3EIOA 5DYTA 5TE9A 2W0MA 3RHTA 1E63A 3CZRA 3F7TA 1BXGB 2AQHA 3H42B 4WZAE 2VAPA 1TOAA 2W4MA 2GJ4A 4G0QA 5J5AA 5JSKA 4RZXA 4G0VA 5DKWA 1P3JA 1YDWA 5LXTF 1GKKA 4IHAA 2QUKA 4RPJA 4LHEA 3ZY2A 2VIXA 1ORIA 2KW5A 1UXGA 8ICFA 4YROA 5DMHA 5TPZA 1VM6A 2V65A 2PYIA 4N5DA 1QCDA 3CF6R 1ZQQA 3T0IA 3KQUA 2Q0ZX 1F6WA 2OV3A 2YQZA 4Q3CA 4FC6A 1Q91A 3I3SR 2WWVD 3AEKB 2YW2A 4DPMA 1MNAA 2MHCA 7ABPA 1BE8A 5JZMA 4WDRA 5GIOE 4D3FA 1RABA 3IQDB 3RFUA 4MUIA 1CUHA 3PQ8A 5J2TA 2QUZA 4NYMR 1A77A 1EQAA 3JPWA 2ZRQA 4EGCB 1JL3A 2B20A 5BWCA 5AUQA 3T3DA 3B3FA 2NX2A 1F38A 2NIPA 4NFHA 5JY6A 5HILA 3ONVA 1KR2A 1Z35A 2AFHE 1N5JA 3FUTA 4ZEOA 3I39X 3TTWA 3JALA 1GFWA 4QPJC 2EBWA 5B37A 4LZDA 3TB4A 3C3EA 4X7MA 3GJ5A 4XSHA 3UQZA 1GNTA 4P34A 2MRLA 3TFSA 1ZN9A 2ODNA 1EFTA 3EEQA 1FDTA 1LK0A 4KLSA 2C7VA 2EKDA 3KDSE 4LVNA 3GJRA 3VBEA 4AF7A 3RTDA 4OM7A 3IJPA 5J1SB 4HH3C 1XCMA 2I7VA 4HDSA 2MMCA 3PTAA 3ORHA 3PIDA 4DDTA 1PJQA 4UMFA 2LPEA 1XZ8A 4P0TA 3IPRA 3C41J 4P4NA 4YV2A 2QIOA 1RD4A 4D81A 3QBTA 2ZRJA 2O2CA 4TUYB 4U2KA 3GLHE 1O6GA 3C97A 5C5IA 1ECFA 3UPDA 3HM2A 2ALZA 4ZGWA 1FPQA 2FQQA 3KL2A 3LKVA 4GKJB 4L07A 3JQAA 4DIDA 3F74A 5HQJA 2K5UA 3ALRA 2REBA 3TNJA 4EY3A 3ZU6A 2LKYA 3ZG6A 1GAJA 2XCQA 4K9KA 2QM3A 4LY6A 5AJZA 4LOAA 5F64A 3U7QB 3TSYA 4R01A 2QG9A 4C0WA 1QQBA 3H5LA 3NDBB 4B87A 4H7KA 2OMKA 4OQXA 2IEBA 2XLCA 3B5JA 4LUCA 2CSXA 2FPLA 2G8NA 3QUTA 4ZI7A 3PJGA 5TJHA 3O4RA 4JYZA 3C28A 3C39A 2GSDA 4DY4A 4B4DA 1GSIA 4MDFA 2VP6A 3B1FA 5DWVA 2I7XA 3PB3A 3OZCA 2OH2A 5JSQA 1U2QA 4JENA 4CLDA 3L46A 4PRLA 5E38A 4KIJA 3MILA 3S8MA 3OFKA 3PHHA 5D3MA 1YK0A 2AW5A 4NMHA 4QYMA 4KLNA 5HE9A 4DV7B 5BMVA 5KTTA 4AZVA 3W5HA 4P86A 3H1AA 2PD6A 4O3QA 5CVCA 2YJNA 2QBYB 4G0WA 2R5FA 1G20E 4Y1FA 3LHIA 2NT4A 4DVJA 2IMWP 1NU8A 1RAFA 1G21A 1SOVA 1ZVKA 1T5IA 3G5TA 1DAKA 2KM1A 1E1QA 4D0NA 1F8YA 1G8KA 3S1SA 4PLGA 5CNIA 3T41A 1MQ2A 3R3ZA 3VR5A 3AV3A 1K8YB 2ZIUA 1X6IA 2GM5A 3PJEA 3TMAA 3VDXA 2F8TA 3PO4A 1JJAA 4X97A 1NMEA 4EB3A 3A06A 2HZBA 2JAPA 4QNMA 1R8QA 3L8CA 2VHQA 3OMLA 2P9CA 4ZOLA 1P7ZA 4DLZA 3T3NA 2HO5A 9ICXA 2KHZA 1GILA 1HMYA 4W6ZA 1ZL2A 5FLKA 1ZG3A 3P4XA 1R4AA 1JXAA 2GCOA 4K6CA 3GB9A 1Q21A 2NSHA 2OP1A 1IRIA 4L74A 5BPFA 4PLFA 4JKYA 1JQ3A 1LA2A 1OA0A 4BFZA 3X0DA 4XUDA 3V97A 5BOSB 1KRPA 2HYDA 4H4DA 2B7BA 3RW9A 2A9OA 3FDJA 5B1IA 1XCPA 1IPEA 2YBEA 1PQWA 4LBYA 1Z0FA 1USIA 1VGRA 5DM1A 3BWYA 4XUCA 2PMZF 4QZAA 1M6NA 1E32A 3ZXUB 5BN4A 5CFOA 4A6DA 3H7IA 5F1PA 5LA6A 1ESCA 1XRRA 5LJLA 1E1YA 2EFYA 1PVQA 2X5OA 3GEMA 1LF5A 4U3JB 3WC4A 2BGJA 1EG2A 1RIFA 2GRUA 3U48A 2ZTVA 3WYEA 2EZTA 3FYDA 1ISHA 2PDAA 4A8TA 3IRUA 2IBSA 3QF4B 5DLEA 2E4XA 3ND9A 2D0DA 2IRWA 2OQ2A 3Q11A 4JA0A 1YDHA 3NG1A 3B2QA 4MK4A 2DF8A 4KQ6A 1UC5B 3H0EA 5T4FA 4F91B 1ULZA 4NV3A 1RRMA 2ZDGA 4M89A 1USWA 3C8DA 5TT0A 3K09A 2J3HA 4PC2A 3VOTA 1O0SA 4HH0A 2PXXA 3BYZA 1SXPA 4B5LA 2JJYA 4FZJA 3HU2A 1CUEA 3G7SA 3AVVA 1E1NA 5AJTA 1N7IA 5LP6B 4KR6A 2G9UA 4PS0A 5A7HA 4F3OA 4C7KA 1K3FA 1USVA 2EYQA 4WNCA 4XJXA 2W83A 3E84A 4CDGA 3CH4B 3TTUA 4FMCF 3DDWA 5T57A 1YR9A 1J9GA 1Q2UA 1GR0A 3TLEA 3MELA 4AZ0A 4Y6OA 2C82A 1I4LD 1XZNA 4I1VA 3ETCA 5FHRA 1F4PA 3A2MA 1XYVA 2Z83A 1SKQA 2VPYA 2OHGA 3VMMA 1WD7A 4Q15A 5IHPA 1QVZA 1XDGA 2HNBA 3QVKA 3EQ8A 4H7FA 2WABA 4DLNA 4MIYA 2X5XA 1SGGA 3VR3D 5AVXA 1P0MA 2ECPA 3CKKA 3IDWA 5FP0A 3K5IA 3QI2A 1GPMA 3PBKA 4GX2A 2OBLA 1P7YA 2RCYA 3S5JA 4IIJF 1M8PA 4LPKA 1NMZA 1WPXA 1W76A 3UFXA 5JNSA 4HV4A 2QW0X 5HVNA 5JC8A 3PF8A 1AVTA 2B7CA 2GF2A 3MS2A 5CNMA 2I4IA 4JASB 2OZEA 2Q5QA 1QP8A 1R4NA 3IVCA 4V0MA 2ZQYA 1CY2A 2J45A 3VU0A 3LDAA 1UQVA 1BC5A 5HYVA 1NVGA 2AFRA 3O47A 3A6PC 1ZJMA 4I1IA 4I0WB 2R00A 1O6BA 4DGSA 3PSTA 3PC8C 4PR0A 3LXXA 3SZUA 7ADHA 3MGKA 3MINA 3ONFA 3F2IA 2ZB2A 1ZRNA 1YQ9A 5KFKA 2AOVA 3I61A 4ZCTA 2JH7A 3GFSA 4CEJB 3VU1A 3H4IA 4MJ3A 1VBFA 3RU7A 3R0JA 3CSUA 1E2KA 3COYA 4JB2A 3BFKA 2X2EA 4FBUA 5AFSA 4AI6A 3DB2A 4UHFA 4QULA 4F97A 4AF6A 4JR2A 3NJ4A 4FWIB 2XYHA 4OQZA 3U17A 3I64A 2VDMB 3GPBA 3PGA1 4EF6A 3WK9A 4C6RA 3U7QA 3PE4A 1PS8A 4H6WA 1PO7A 3U61B 2RGBA 1IQUA 1EFLA 1YL6A 2OESA 5JXJA 4BVBA 3M8KA 4FTWA 5JCXA 3MXTA 2FR0A 2X9GA 5CK5A 2D8MA 1P3Y1 1FU8A 2XBLA 1E2UA 3VZDA 3AR8A 4TVSA 1YZVA 2B3TA 1X9HA 1BW9B 3TTVA 1N9KA 3EDRA 3ZLUA 1T0IA 1WMSA 2J08A 1GL6A 2ZXIA 1QLHA 2BHSA 1EA5A 3BTOA 5CH5A 5FFFA 3W8FA 4W4TA 3T9FA 3M6XA 1JV2B 3RFTA 3WBFA 3A8TA 3B51X 3S44A 2Q27A 1NOMA 3HGTA 1WZCA 1U04A 1NN0A 4K9RA 1UBHS 4B4WA 1P0IA 1K5PA 1V1RB 4R3WA 3AUTA 2DGZA 1EE2A 3EPIA 3FPGA 4G85A 2E49A 1U9JA 1KDOA 4B80A 1E9BA 821PA 3UHPA 1ZCJA 2GBCA 1ZI8A 1HEYA 5BSGA 1L4NA 2D74A 2XKBA 5THKA 3BE5A 5FNVB 5M2QA 2J67A 1SU8A 1QLNA 4L8LA 1WP9A 2GF0A 3W79A 4Q6WA 1GU0A 4GWKA 3NTXA 1QDEA 3K0BA 4QUGA 1RT9A 1DCKA 5DHTA 1LI7A 2WJIA 5JD3A 3FTNA 1CSEE 3L7KA 3ESAA 1CZKA 2BF4A 1TEVA 1C1XB 3FLBA 4KE8A 4RTSA 5FFMA 3GLVA 2Z43A 2FSSA 3NTUA 1Z68A 2WIJA 3PJFA 4UBJA 4EQ6B 5HUHA 1P2UA 3E9QA 2I54A 4D4IA 5AXDA 2XNDA 3QEMB 3NAGA 4NZNA 2X3YA 3IAM6 4OHBA 3MTEA 1QV6A 1LS6A 1ST2A 4DJAA 1RQ2A 4WXYB 1DWUA 3DE5X 1JFVA 5KTKA 2NTEA 5E6SA 3GQBB 2JLSA 4B6FA 5FWYA 2OV4A 3IKJA 4JBHA 3T7IA 3GZFA 4FNMA 4E2XA 5A5GA 1EP1B 4FUTA 4LZOA 3TB6A 1L4BA 2FW7A 3HKDB 5K4GA 1AA9A 2ZJ1A 3JV7A 5H4GA 3GD7A 2HHTA 1X14A 2W2LD 1AQ6A 3P0RA 2ZSAA 2WC1A 1L5HB 2V1UA 4ROTA 5G40A 2AMJA 3UK6A 1IEWA 1RADA 2OFOA 4RPXA 1ZUIA 3NO4A 1C9NA 2YMPA 1E9CA 1CIPA 2C8LA 2XB8A 3T7TA 4C76A 3GLFB 2WP8J 3H3JA 3HUFA 4LRSB 3FBWA 4OLFA 3KSZO 2G7MC 2GN1A 4QYTA 4ZRMA 4CV3A 4GFDA 2ZSKA 3BTSA 3OQIB 7ICPA 5J2UB 3TRKA 4YRGA 2JFHA 2TSYB 1UINA 2BTEA 4O9MA 1P9LA 2PZ8A 4AZ3A 4DUGD 1YAJA 1VL1A 3IL2A 5T4EA 3LI2A 1E8NA 2FVXA 4U4AA 1SVOA 2GEJA 2PMBA 3KVRA 1PIWA 1T2CA 2A5DA 4TTTS 4AG6A 1Z26A 3JR7A 2UYGA 1AXGA 4MB2A 4WLEA 2HJRA 4BJ5A 1NAIA 3RAPR 1R3DA 3UJPA 3H4MA 4BWMA 1FLVA 1SD1A 2EQAA 3GJTA 2OP0A 4XZ3A 5GV8A 4CKCB 4RACA 1YH3A 1CE8A 1S6YA 2H9IA 1CKEA 1EAYA 1P2SA 2CLIB 1OXKB 2I4MA 3GGCA 4OVKA 5EMHA 4A6EA 2BLNA 4Y6PA 2VXCA 1TA9A 5B6IA 4Q16A 3L8EA 5JRDS 1KVSA 3H17A 4CU5A 1ZXXA 5IVDA 5TVGA 4RD3A 4UU0A 1JXQA 2IYSA 2C00A 1B1AA 4MEYA 1GG2A 1NX6A 3D59A 3INYA 5FT9A 1CR4A 1OFTA 4JI2B 2NZUG 4CIBA 1E7WA 4FEYA 1J2JA 1Y33E 1RHMA 1RJEA 2BTQB 3OCXA 1RYDA 2KIWA 4Q3NA 4ZA2A 4BNVA 4HB4A 5A03A 1V47A 1BDHA 2WSYB 2LWIA 3DVAB 4GRDA 3UGTA 4CM8B 2WJAA 3NDIA 4EYOA 4OHKA 4MDHA 4F2GA 1JEJA 4ZYLA 1O9BA 3F5FA 5EKTA 3EFEA 3OE4A 4ECWA 1M1YA 1JE1A 3TAQA 2P2SA 1VL6A 4PGMA 4DSUA 3PC3A 3KJXA 2D5LA 3ME5A 3IUEA 3B1ZA 3MTGA 2I87A 4OI4A 1M10A 5COAA 5TGZA 1NWCA 4KLGA 5CBPB 4NCHA 1G41A 2XMBA 4M7PA 2J30A 2IA6A 1OIXA 3ZHQA 1H4QA 5CBKA 4BQFA 5JMOA 4XYEA 5HKKA 3F2CA 1IU9A 1P2DA 5IDVA 5TC4A 1UKBA 3DKRA 2DUMA 4DWIA 1QNFA 1WL8A 2GS9A 3C21A 1X7GA 2AFHB 2CJYA 1NSTA 2GBFA 3B9QA 4MW1A 3TW6A 4B0OA 3ESXA 4R2WA 3T7AA 4C20A 1EK6A 4ER7A 4YDRA 5GZ3A 5KEIA 5K0EA 1M76A 4FFOA 1TQ2A 2VS1A 2ZJAA 3FXAA 3PR5B 3ZH2A 3TE6A 2OAGA 1QC5A 3NDRA 1PX2A 3WHLA 3V32A 1FSSA 3Q40A 4GVLA 4HDKA 1Z8NA 5IX8A 4LYGA 1DXOA 2YHIB 3NBUA 4FC7A 1FDWA 3R5FA 5C32A 5BNIA 3KD2A 4ZODA 2UYQA 5EEGA 3THYB 3LVVA 3ZPXA 4LZLA 3WL7A 4M9GA 3SZ2A 3CB2A 2CFTA 2EJWA 1M73E 2LUOA 4Q21A 4Q34A 5IWAB 4E5VA 2DZDA 3KX2A 3BDAA 4X5OA 1W25A 2JKYA 4DV6B 3UHOA 1LLDA 4AO6A 4DYVA 1VL0A 1P80A 3IUBA 3MS7A 4FYVA 1UJBA 1ZUD1 2I1WA 1SG0A 3W6ZA 4I36A 1FTWA 1VBNA 1G5HA 5E6UA 3WL4A 2VA3A 4IL6U 1QRDA 3OJEA 4XDGA 4OJOA 3ZLTA 2RH8A 1JDZA 5HIIA 1ZGGA 4MGHA 3DWIA 3FE2A 2ZBEA 5E95A 3ZW7A 3HUEA 1JALA 1DWPA 1Q17A 3H2GA 5I51A 4CUKA 2G71A 3QTLA 1OV6A 5EKXA 2PH7A 4GMHA 5JXHA 2EJUA 1XTIA 4Y0NA 3IA2A 2NU6B 1N1GA 2ZBFA 3JW8A 3CF0A 2J85A 3O4IA 4FYPA 1GY8A 4JSYA 1KE1A 1EFCA 4LW8A 4FYKA 4IRKA 2YUTA 5CP8A 2W48A 2WY2D 3STHA 3PHLA 3HHPA 4YP6A 5IJ9B 4RLSA 2AGVA 4I9UA 4I8DA 3SC6A 5A4KA 3O26A 3S2IA 5E4JA 1CNMA 4U5QA 4BVKA 3PHGA 4R8UB 3JASA 1TZBA 1F1BA 3Q9LA 1BA3A 4JXZA 4PHEA 2ZREA 1EMDA 1V4BA 3G1UA 1XAGA 3FLMA 3HPQA 4HPJB 4NSNA 2HMYB 4F4FA 4D92A 5KC8A 2XEXA 3SPXA 1P73A 4PBRA 5L3VA 2YIJA 4NLZA 4IP0A 4U5XA 1NJ1A 3ABQB 4K3UA 4ZRNA 4IVQA 4FEGA 1WB4A 2NYAA 4MO9A 3K6JA 1R18A 5TJ9A 3ENZA 3GIIA 2JIOA 2P5YA 4HD8A 5KYNA 3RAQA 2Y0EA 3H0CA 4HUJA 1ZEJA 3H18A 2CDCA 5IAEA 3QEMA 2PRYA 5HMMA 3OO0A 4ZO8A 4ZREA 1RYEA 2QAGC 5DHQA 5JJ5A 2A2ZA 4Y2QA 1XA3A 3E7XA 4RZ3A 1O08A 3O94A 2LCQA 2WAMA 3OP1A 3SQIA 1DSSG 1NGSA 2M6SA 3AESB 1A76A 3MQ4A 3Q1LA 4GGOA 2FUG6 4M36A 3L8HA 3F4LA 1KEEB 4DJTA 2EGGA 2QP9X 2V58A 2DFKB 4DO9A 2JEYA 1NSYA 5I9LA 4ZVKA 3HKDA 2WKRA 1WPGA 4PL1A 1G3QA 3CH5A 3CKLA 2JAUA 5EE9A 2VK4A 3EXIA 4GX5A 4QBIA 4V0RA 1QP0A 1AKTA 1EVLA 1TLFA 4MWDA 2DCMA 3JQFC 3TIXB 3H04A 3WLAA 5CLFA 3M3PA 5F2EA 2WNIA 2ZYVX 3QV2A 4QG7A 2G82A 1YR2A 5E3IA 1S02A 3TIVA 3V6LA 3R5XA 4JL6A 4RTKA 2FF7A 4IGFA 4E12A 4ED0A 1S0MA 4CFZA 7REQA 5IVPA 1M3SA 2FNAA 1H9AA 4GLFA 3EVNA 3WA6A 3HFSA 2XDWA 1YJAA 1YDGA 4REQA 5JFOA 1VBMA 3FCYA 3N7UA 1BYIA 1FNMA 1S2NA 2W8KA 4LCJA 4RVHA 5HFAA 5J0OA 2PI4A 1XQ1A 3CLKA 4RDXA 2QOEA 1JIIA 2CV2A 4AK9A 4R1MA 2CNWA 4NXZA 4GMGA 1U98A 1FP1D 4N3CA 4O1IA 3V1UA 4KDRA 3OJ0A 4C1NA 8ICWA 2ZIZA 4N9QA 4CM5A 4RK6A 4CKWB 4F50A 3TAUA 1YAHA 1XVAA 16PKA 4LYYA 3LQKA 2RDMA 4LSGA 4EVIA 3QVXA 3UAZA 4BVGA 3I6BA 4R84A 6AT1A 4N0QA 1MN8A 1GTL1 5C8ZA 3B38A 2C3YA 1A1VA 4DCGA 4ZQBA 1E8DA 2WAOA 3B1YA 3WDKA 4B3GA 1LEHA 3BXXA 4ZAVA 2P40A 2WTBA 3AG5A 3OIWA 1O4WA 3OCUA 1J1IA 2VTVA 2O2YA 1A4IA 1HQCA 5J23A 3G3EA 3V7LA 3TANA 2F1HA 3GH3A 3WYGA 5AVVA 4HZUB 3BL6A 1HE2A 2WEKA 3LX5A 4OHUA 1DWOA 2AMYA 3P9ZA 4YMOA 4HZIA 2A78A 3SHTA 3G0IA 1OJ7A 1X9XA 2G70A 3JAKB 4NVRA 2XC9A 1D9FA 1KY2A 1OWNA 3HX0A 3LTEA 1EUCB 1ONBA 1P0QA 2XTZA 4MW6A 2YJ3A 3U2QA 4F8JA 4IIYA 3PX4A 1DCMA 3AHJA 5HP4A 3NWBA 4PY2A 4D97A 5LMNB 4DS4A 4JOCA 3CEMA 3HU3A 4P3XA 4EYHB 3W34A 3P2JA 1QBKC 3R7LA 1NU6A 3C85A 4DQIA 3KPUA 4L15A 1WY5A 3CZ5A 3AEQB 5AKHA 3RNLA 4GOKA 2BBOA 2JH9A 3K9NA 1X92A 2A0WA 2QD2A 2V7UA 4EPYA 2H4YA 3PENA 4KFTA 4E11A 3W5IA 3EGXA 5E7IA 1X7YA 4R4JA 1SV0A 4DANA 4EJFA 1OPXA 4UHEA 1RXSA 4KKVA 1L5LA 1TYAE 2AFHA 2ZAGA 4ECYA 4NY1A 3BWDD 1IY8A 4HVLA 5L1MA 1T13A 1PZFA 2GN0A 3IP5A 4OHVA 4WWHA 2IU6A 4YAFA 5DGTA 5FULA 2HXSA 6ABPA 4CQNA 2QARB 5G4KA 1GTG1 2DR0A 3GARA 1XDZA 4JSTA 4JQSA 1IMJA 1R74A 4WJ3B 1K7YA 4FFLA 5J63A 3FI0A 1JKFA 2H4JA 2WILA 2RHBA 3WLRA 1ULSA 1FYEA 1LXCA 1XC7A 2PM8A 3M89A 4ITUA 3OQBA 4NBRA 4UREA 1XPRA 1JEYB 1P31A 5ARDA 1D2GA 2RK3A 3BFPA 5AR1A 1K7CA 4UQGA 5JDCC 2RHHA 3SSAA 3FIJA 4O2BF 3BFJA 3UNXA 3F46A 3EPKA 3C43A 5JFGA 2AE1A 5JNUA 4CIXA 4POAA 1W5FA 3V9AA 2PNJA 1N6NA 1W35A 1UPFA 2V9ZA 3CW2A 4AICA 4BYMA 1HZJA 3CLUD 1A04A 9ICOA 1I3MA 1DCFA 4GQBA 3ZXSA 4CKYA 1ZK0A 4UAVA 4MKGA 2FDXA 4I1RA 4LDNA 1H1LB 1WCV1 4B32A 3S2YA 3ZCRA 1ML3A 4A3SA 2H1OA 3RUIA 2FZCA 1X3SA 5J4LA 1JG4A 2R6ZA 1G0OA 1MVLA 1FJHA 1WNFA 3AQ4A 4FFNA 1WUTA 2UYYA 3IG5A 3RS5A 1GAEO 5J4VA 1RZVA 2V45A 2A9JA 3MERA 4BNHA 1PR3A 1KO1A 2DBQA 1PJ4A 5C5EA 4NCIA 7ICEA 3KZVA 2CV0A 1NJFA 2GXQA 3OM8A 3QE3A 3WX0A 3G9TA 4IEIA 1NFFA 3NX4A 2HMAA 4DE5A 4ED6A 2CB9A 4BMZA 4R3NA 4KI7A 3W2HA 2QAGB 1G2IA 4RQBA 3X2SA 4B3RB 3UOAB 4KLOA 3LPMA 2WSIA 2VJ5A 3QEKA 3TVYA 3Q9UA 1WXIA 1EDEA 3BQMB 5EUBA 1JN0A 5B7GA 5KQRA 2Z2YA 4PZPA 4XDYA 4ONEA 2QTWB 1XQYA 4O4HF 5AJHA 4NY8A 1B2RA 4MV9A 2FI1A 1X9GA 1B15A 2O2ZA 2HK7A 2LYAA 3N6VA 1SXEA 2PSSA 1IONA 4UMDA 2KSOA 1LLUA 3GEPA 3QVMA 4X1OA 4CWAA 3Q7PA 3I4FA 5TLSA 5GPBA 2O50A 2ACEA 4OJ6A 5KFLA 2ATCA 2QM0A 2WYUA 2XKJE 3AT1A 1KEUA 3BXOA 3FVQA 3GDGA 4FJ0A 1VG9B 3A26A 4MR9A 5CJPA 4TWJA 4LG1A 3N7RC 2JGLA 4ODIA 4YJFA 4L3OA 2AXTU 4MO2A 1DJMA 4YRLA 4LXHA 5LR6A 1TT7A 1QHHB 4ITVA 3F5QA 10MHA 4HRXA 1C50A 3M33A 4OHXA 1TM1E 1GUFA 3CUKA 3ZY6A 1OFHA 3SEAA 3BB3A 4A8EA 4H7PA 4EW3A 5BSHA 2Z4RA 1X39A 3NOVA 4RPCA 4GT1A 4EHDA 4AMGA 4MFAA 5FH9A 2BDPA 1JDSA 2ZRGA 1NNEA 1XVVA 2N1RA 3HO1A 1JN3A 3RSLA 1O57A 3U3KA 3WVNA 4L0DA 1H2XA 4Z6KA 1MLDA 2VOEA 1JXEA 1U7OA 3U1TA 4AYBC 2JGNA 4YC7A 4C03A 4DJFC 5EJ5A 3VPFA 4R6XA 4K2HA 4XJVA 3VR2A 1HDRA 2ZJFA 4Z4FA 2YZ7A 3G2LA 3WGNA 3PEEA 1VGVA 2AN9A 3KJNA 3M83A 5FWAA 1YS7A 3RHZA 5JCOC 2FPPB 1FL9A 2OFFA 4ENVA 3U44A 3WB1A 4YHHB 1XZEA 1SEVA 4KLJA 2GN4A 3QPWA 1P0CA 3RYHA 4GKVA 4L3VA 4QZCA 1J2EA 1YD7A 4EG4A 4GP7A 2C2KA 4ED2A 2LIPA 4YQYA 5K3AA 2G9ZA 3V4PB 2FX5A 1MABB 4W7IA 1PEDA 2IXFA 5JHGB 1T36B 1FA9A 2XOKD 3IALA 2WBLC 5GONF 3IP6A 4RPHA 4G24A 5B7QA 1PUXA 2WD7A 4ND3A 3COPA 2QSZA 1K4MA 3WR5A 1ZDMA 2HREA 1QS0A 1OXXK 1UUFA 1H3NA 4MQ5A 4EUKA 4ENRA 1PQUA 4ZOLF 3WXMA 4YPOA 5JW6A 1FFSA 4NP6A 1HT1E 1C0LA 3TOXA 3GRFA 4INJA 4QDKA 2X8WA 5EWGA 4Q3AA 1U0SY 4A8PA 1G5QA 5F51A 3ZDCA 1CUAA 2GMWA 2PWZA 3ZQ6A 3KXDA 4F4UA 5GTDA 2D8AA 2IITA 4O4LB 1D4OA 2BLLA 4LOLA 1WCIA 4RANA 5B53A 3VYSB 1WF3A 4CKEA 2QW8A 1D03A 1YZKA 3D6TB 2QRHA 4KK3A 1O95C 4MTCA 4RNMA 3R23A 3TLGB 1BQEA 5K0GA 1F06A 4NYJR 2JAWA 2Z3WA 4Y0VA 1PW7A 1SXGA 6CHYA 9ICBA 1ORWA 2ST1A 3AZQA 2HWWA 4LJ8A 4EPVA 3N97B 4KPUB 5FJIA 2JCBA 4PZ0A 1C3EA 1Y63A 2IODA 2OBNA 3TTYA 2IZ5A 3IBFA 2FK7A 2W2QA 3HEMA 3M4XA 3N8GA 3EXFB 3QPDA 4J0KA 5ERYA 1SB8A 2II6A 3VDNB 3HPOA 2QUHA 1KDRA 1MA7A 4YV7A 4Q05A 5HX7A 3GLGA 1INLA 1JHRA 3L7CA 4M0UA 3L8DA 4L50A 4Y6RA 1E3IA 4PW0A 3A3NA 1GPNA 4DMLA 3S27A 1GLGA 3SMVA 1RI1A 1SUSA 2OCGA 2QTZA 7ICLA 1I7LA 3P20A 2JLZA 1NZDA 2CNLA 2W6CX 3OQVA 3KKAA 3IIKA 2G76A 5DDIP 4CKZA 1K6JA 3EX7C 1N7HA 3BDPA 2XMQA 2IKSA 2E1EA 4I2GA 1R9JA 1IVNA 4JP1A 3BB1A 3RUDA 4K3VA 4OXIA 4ZTUB 4L9SA 5EE0A 5DV9A 1N25A 1XU7A 3NHSA 3QG1A 1A9QA 5AOBA 2I78A 4QXMA 3MCZA 5A3RA 2RIRA 4XWKA 2CK3A 2VKQA 4LK2A 3UJ6A 4MUBA 1C4KA 2IK8A 3QLEA 3T5JA 1RWQA 2GEVA 4QYIB 4XPIA 1CW2B 2CBGA 4O4IA 5LD2C 4ZANA 2X8JA 5GTIU 4ZT5A 2QLFA 4HAOA 5KJ1A 1NHWA 1GGVA 4E0BA 1K5OA 1D7AA 1G16A 3LWDA 3H5OA 1T4DA 2CKDA 3C7CB 1G9TA 2FPWA 4EGQA 4BAUA 1C2TA 3A1CA 4EFNA 1ML4A 4DIFA 1TVEA 2PBZA 5KG0A 4U7GA 1BVSA 1CIJA 2X1MA 4QZFA 2E4UA 4EG8A 3USCS 3IGFA 1F3OA 1JXLA 1TAHA 1P8AA 3H2HA 4X20A 2F7SA 1ISPA 1BH2A 1RYNA 1NF9A 1EVKA 2ECKA 1R27A 4MULA 2BRUC 4LYJA 4NAHA 3VHXA 1ZCAA 4FKZA 4P4SB 5H2FU 3FAZA 4RVFA 1NC1A 4TTSA 1GFIA 1NVFA 1NY6A 3CPEA 4LCBA 5DLFA 4HLCA 1YQXA 3F5AA 3M34A 1X42A 1Z0IA 2A59A 1NI3A 4AP5A 2K4MA 3RYCA 1K8ZB 1UC4B 1H2FA 4BLUA 5LUAA 2HLNA 3BRSA 3ZV3A 1AURA 3DAOA 3X1ZA 2Z57A 5F5NA 2DMRA 1JDBC 3PUJA 4QE3A 5ITZA 5DBCA 1XQWA 4WNAB 3PWTA 5A0VA 4UXJA 3F2BA 5AOCA 2MSNA 2IYXA 2XYQA 4JLKA 5AXBA 3K4QA 4CMHA 2FW1A 2LYBA 1XMSA 3RSHA 1FYDA 2C59A 5A06A 4CGZA 5JDIC 4RQ8A 2WVJA 3DC2A 4RULA 8ICCA 2HQBA 1YS1X 3NH6A 1NKCA 1XWLA 2PI5A 3E7DA 1W2HA 3AJEA 3PKJA 4H08A 4WEQA 1IVYA 2E5WA 5AWFC 4MLZA 2O14A 1BPXA 1TUBA 4KXWA 5A9SB 2A33A 3ED1A 4G5SA 4RJTA 1ZN7A 5C31A 4TRMA 3ESQA 1UA0A 2WUGA 3RVQA 4CMKA 2C2MA 3WL3A 1UKEA 2PV7A 2RKWA 1GQ2A 1PNTA 4NEQA 5CEFA 2ZZMA 1ZHFA 3MT9A 4TMKA 1GKUB 3L6EA 3OZUA 5PGMA 4JMUA 3LDHA 4LVUA 1Q19A 4I4LA 1J0DA 1VE3A 2DH5A 4MVCA 1L4LA 5DNEA 3L4BC 4FGJA 2F43A 5KG6A 4QREA 2CE2X 2WW8A 4N7JA 4V1CI 3BHIA 3BZUA 1R8XA 3SKVA 2IHBA 5IYZB 4YXFA 1YR6A 4QWEA 5CA0B 1UXHA 4JGIA 4YJ2F 4QPZA 3CF2A 3L40A 4BMNA 5ICGA 3W8RA 3IYLW 4FINA 3JQ7A 3R3VA 4L75A 2BEKA 2PFKA 2Q1TA 3WGHA 1FUIA 9ICFA 1T5SA 3T54A 2D3WA 5TF0A 1QX4A 3AEUA 5IJWA 4HRAA 1XZLA 1SCJA 4B3MB 5BYJA 1Y8AA 2YXPX 3K1AA 5J8YC 3T3FA 1D8TA 2W04A 2XRYA 4ZHQB 5F5XA 3GCXA 3KZNA 4JNCA 3BJEA 1T1GA 1NG1A 4KZPA 2EGUA 4DSJA 2VCEA 1XB2A 5CB4F 2RHMA 1J90A 4MR7B 3VKHA 1B43A 1LWOA 2LRHA 3QSYA 1FFXB 1HO3A 4XW2A 1YL7A 2Q5OA 2M32A 2YQ5A 5J58A 1ICIA 1ULAA 2W9AA 1DEXA 4MLPA 1AB5A 3KKMA 4CTKA 4DQKA 1XR3A 5J47A 2RKBA 3GEHA 3VYTB 3DOEA 1M2VA 4FFVA 4TLEA 2UUCB 3AIMA 1TJNA 2PBLA 1BD4A 4F2WA 3WGLA 2JL1A 5F2OA 3K53A 4QTYA 1TKDA 2VSOA 4JLJA 3A0RB 2YX8A 4NBTA 1MEEA 1DX9A 4UQOA 3S28A 3B48A 2MU1A 2NP6A 9ICCA 1FS6A 1YZQA 3MYYA 2GCGA 5C8YF 5AQEA 1P39A 1YRHA 3EN0A 3LBYA 3PQFA 4BNXA 3DDUA 2OVFA 3OUZA 1Q1GA 4CXMA 3EPHA 2H5XA 3WK8A 2W9CB 3RC3A 1LTQA 1I9GA 2GLUA 4FK8A 3N0WA 3L6RA 4PS1A 4B3SB 1PEKE 1KIMA 1K3UB 1X7WA 2CFSA 2MR6A 2SECE 3H9UA 3IOMA 2CNOA 4S2EA 1ZQCA 3H65A 1ZNWA 4XGKA 4LZJA 1YQWA 4C0XA 1V5IA 1QQ6A 4HQ6A 5EWMA 2SBTA 4K8RB 4O4LA 2B94A 1NVVQ 1H5NA 3NS1A 3MBIA 1ESDA 2MUTA 5G3YA 2VBCA 5EHGA 5IAGA 4IO0A 3IDOA 4AP6A 1Z18A 4NYJQ 1MQ3A 1XELA 1J2RA 2EP8A 4N40A 1NXWA 1LV8A 4IXNA 5IC6A 5HJ5A 1IK4A 3ADCA 1TTHA 2NXNA 5CAEA 2XPCA 4P80A 3HXMA 2G36A 4LRWA 2REOA 3RFCA 4GL2A 1MZVA 1I7PA 4NOLA 5CW2A 4EGSA 3H1BA 3NW9A 1TA4A 2WYOA 4Q7MB 4G4GA 4EG5A 5JBQA 3DVSX 3JYOA 3K1RB 3V8MA 3HL4A 2ZZNA 1C8BA 3TDNA 1AO0A 4UARA 2AU0A 4UW9A 3BXEA 3AL3A 5KUTA 2DVMA 3QQ5A 5BWNA 2K4EA 1YFJA 2W6NA 5KOYA 3LS2A 1BGVA 1R6DA 3FMGA 5JH7F 4BPBA 1CR2A 1Y1QA 3D81A 4A9AA 3CRMA 4KN7A 2JEIA 1GCUA 3W9BA 4PCAA 3PWZA 4MV5A 4B9VA 2BKUA 1C2YA 4PGAA 1M7BA 1T9HA 2VHZA 3JD0A 2DPYA 4RK5A 2PT5A 3LY5A 5F2KA 3LPDA 3RGWS 5I7UA 3MCWA 3SS8A 1CVRA 4B6OA 1PZNA 1IUNA 1P5FA 1ZQXA 1NK0A 1E66A 1D6JA 1FRNA 2C22A 2Q5CA 1OFUA 1C1HA 4ZO4A 4ZDKA 3MMNA 1TCUA 1QWOA 4NCKA 2NZ8A 4HFNA 1JHQA 2E5LB 1GJRA 1QIGA 1VDMA 1SG9A 5FBLB 3OF2A 1R5BA 2R11A 2HBRA 5KYWA 1FNDA 1WQ1R 3A2NA 5DE3A 2K2WA 4RYLA 3V33A 3I9KA 3FGPA 4MVWA 2YQ4A 3I28A 5LQNA 4G65A 3KVVA 3MFYA 3M7IA 5FI3A 1MH1A 3RFFA 1E3TA 2YB1A 1TW3A 4RF4A 1Z5OA 1RQ7A 3WYDA 3R8FA 4IR9A 5HZMA 3RR7A 1CRLA 3OF5A 3FW1A 1MC1A 4F9EA 5A4IS 2HLDA 3AF1A 5DTIA 5TNXA 3KB1A 2P67A 3T9AA 2BCUA 3KZKA 3ZWNA 2O5CA 3A3KA 1ZQDA 9ICLA 3PRYA 3SC3A 3CEHA 3VR6A 3VXKA 5BRAA 3W1VA 1U49A 2HMSA 3FTEA 5CDHA 3OFVA 3A3YA 1Y5LA 1PVRA 1OX4A 1XDDA 9ICVA 3QVSA 2ZW9A 3U80A 2GAAA 4PWZA 1VJRA 4WLFA 1NG9A 4QO8A 5JRTA 1Y9EA 2BFCB 3HR4A 3LCUA 4IHQA 1TX4B 5KNCH 2IP1A 3P0IA 5BR1A 4CIWA 1EGVB 3BHMA 5EJGA 3LWLA 3N75A 1PR1A 4KGZA 2CMDA 2P8JA 2UVPB 2ZK7A 2Q2NA 2C96A 2XOEA 2V7WA 1VSTA 2AN1A 3Q2KA 4W82A 5HIJA 4ZV7A 2ZT5A 5JS1A 4GXNA 1YHZA 5CA0A 3QUQA 2OYCA 3IO5A 1FP4A 1K2VN 1M1XB 2XYRA 2C7GA 1NFQA 4G8BA 4K5QA 5CYOA 1ISGA 3GROA 1JQLB 5KYUA 3VTFA 3WP1B 2XNDD 2YTZA 4YACA 1KMIY 1XQVA 2YVUA 4LHSA 1SO8A 4ZDWA 5I7AA 5TQ0B 5CVEA 9ICWA 3EFOA 3P32A 4ZWNA 1RAHA 3EWSA 4UCXA 5GV7A 3X1JA 3ELYA 1WBBA 4WHMA 1QVRA 1XKXA 2W2VA 4ZVQA 3UPTA 1WXXA 2D1YA 4DM7A 2RHLA 3A1FA 3ORFA 1VIMA 1OFGA 3QOYA 4O2BB 4IZIA 4X95A 4GPZA 3WYFA 3U7JA 2XVAA 1NW6A 2COEA 3KZXA 2ZRPA 1X7ZA 1NOKA 3BEOA 1C30B 1ZUNA 2QUAA 3N07A 4TVKA 4W5TA 2ZCUA 1ZD8A 3LPLA 3TLZA 4AJNA 2Q6VA 1A9TA 3T7DA 2NUBA 3HCDA 2HHAA 1PJZA 1EM8A 4JKIA 4KXXA 3SLGA 2BEVB 4HYYA 3I73A 5JVDA 3KVYA 2HTFA 4F04A 2LP4Y 2FP3A 2WSMA 3I9NA 3WAKA 3TOVA 3ZN2A 3LKBA 4NBWA 1W59A 1T2AA 1I5EA 7ICNA 3IP1A 1D6NA 1M8KA 1JDJA 2KEYA 3DMHA 2LM4A 4J2OA 1DHTA 3ODGA 1TQDA 3IKLA 3IXLA 4F3KA 5LD2B 3IOCA 1ZR4A 3OD5A 2KVSA 1Y4UA 3BDVA 1V16B 2I2XB 3TQIA 3TTTA 4ZZ3A 2PTHA 4XIJA 1OBVA 3N0XA 4B9MA 1OT5A 2PMDA 3WGGA 1SQ0A 1TCAA 2BCEA 3DB1A 4LC0A 2PLWA 4E5PA 8AT1A 1V6CA 1YIDA 1R0CA 3JQGB 1Y5NA 2QN2A 3IMFA 3PI6A 4URFA 4CI0B 3PGXA 3SP1A 2RKOA 3F71A 1R0ZA 4DLUA 1DBPA 5AJYA 3C6ZA 1QK3A 3PDWA 3T35A 1ND5A 2Y3IA 8ICGA 1CS4C 2OFXA 4MP8A 3SS9X 2IS4A 1WOMA 3EHEA 4JOSA 4URYR 4XWAA 5J2BA 1EK1A 2FLNA 3EOZA 4X64B 3SYZA 2ZAIA 2RMKA 3GFFA 3DE7X 2W3RA 2FWRA 2Y1JA 3NNDA 3QUAA