3UM9A

Crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
225
structure length
225
Chain Sequence
b'GMHAIKAVVFDLYGTLYDVYSVRTSCERIFPGQGEMVSKMWRQKQLEYTWMRTLMGQYQDFESATLDALRYTCGSLGLALDADGEAHLCSEYLSLTPFADVPQALQQLRAAGLKTAILSNGSRHSIRQVVGNSGLTNSFDHLISVDEVRLFKPHQKVYELAMDTLHLGESEILFVSCNSWDATGAKYFGYPVCWINRSNGVFDQLGVVPDIVVSDVGVLASRFSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase, type II
molecule tags Hydrolase
source organism Polaromonas sp. js666
publication title Structural adaptations of L-2-haloacid dehalogenases that enable hydrolytic defluorination
rcsb
total genus 88
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3um9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3um9A01
1RQLA 4HYTA 1LTQA 5AKGA 5ALRA 2EAUA 3SD7A 2HF7A 4YCNA 2WF6A 3FM9A 1Z5GA 2AH5A 4C4RA 3U7EB 4DWOA 2C88A 3NALA 2W11A 3ZVMA 3BA6A 3R9KA 2AMYA 5AIAA 4YIKA 2YMPA 3ZTYA 3SKXA 2GHTA 4L6AA 2C4NA 5ALYA 5ALUA 3AR6A 4F72A 5AW7A 4Y2VA 5AI0A 1RMTA 2Q4TA 2ZBEA 5JJBA 4OD0A 5FP0A 3OCWA 5A3QA 1RKUA 5A3RA 4PNHA 1ZD2P 3A1EA 5AKKA 1L7PA 2PKEA 3M9LA 4J03A 3HYCA 1RLOA 2FUEA 3WK5A 1Z4JA 2B8EA 2IA5A 5AM3A 3E84A 4HGNA 4XPZA 2ZOSA 5AW0A 2HDOA 4JB3A 3L0BA 4OHFA 1RC8A 3PGVA 1VFPA 4G9BA 3U26A 2CFTA 3IRUA 3WKBA 4EX6A 2YJ6A 3WK7A 2FPUA 2OYCA 3RFUA 5AVXA 3PCTA 1Z4IA 3D6JA 2RARA 4C4SA 4H1WA 2HSZA 5AVWA 5ALPA 5ALTA 3NAMA 3U13A 3QU7A 2P69A 2P27A 3OCVA 4UU1A 2MU2A 3KOOA 1LVHA 5AI4A 1RKVA 5AI5A 4EZEA 4CF3A 2HEGA 1QQ6A 1NNLA 4XE5A 4OFZA 3UMBA 2HI0A 4KYTA 2W43A 3I6BA 3E58A 5AM2A 1TJ4A 2RB5A 4Y2QA 1QQ7A 1XVIA 3OPXA 1SU4A 2YFYA 3A3YA 2WHEA 1Z4MA 4UAUA 1IWOA 3N07A 2FUCA 4Y2YA 1XP5A 4NAVA 2JAOA 5ALJA 1TE2A 3QU2A 4HGRA 5AI8A 3BWVA 1U2TA 5AKHA 3L0YA 2VKQA 4BX2A 1RPZA 3QXGA 2R8XA 2WF9A 3AR3A 3ESRA 1Z4KA 1U2SA 2X4DA 3FPSA 2R8YA 3A1CA 3IB6A 4ZEWA 3KZXA 3ZWKA 3AR4A 4Y2TA 3SLRA 5AK5A 1RLMA 2BY4A 1O08A 3IJ5A 3L8GA 3L8HA 2G08A 3N5KA 4G63A 3FGOA 1J8DA 3W5BA 3QUTA 3QYPA 3VAYA 2YBDA 3PGLA 5ALDA 2WF5A 1T5SA 3DDHA 2O9JA 1K1EA 4DW8A 3MN1A 3NANA 2GHQA 4IG4A 4UMEA 1TA0A 2NO5A 1NF2A 2YJ5A 3QU9A 2JARA 3QUQA 2YMLA 2IYEA 3WKEA 3S6JA 1J97A 1F5SA 1RLTA 5AM1A 4BEVA 5AKXA 2PQ0A 4FFDA 4UMFA 4AP9A 1ZRNA 3WKAA 3SF0A 1YDFA 2YJ3A 5IS2A 1L7OA 3ZVLA 5ALWA 4RESA 5AK3A 4CNQA 5ALIA 4C4TA 3F9RA 2FDRA 4UM7A 3ZVNA 3OCZA 2NYVA 2G0AA 1Z4OA 3SHQA 1L7NA 3NRJA 4BYGA 4NV0A 3WKDA 3UMCA 5ALNA 2I6XA 2ZG6A 4KX5A 2C8LA 4KN8A 3I28A 3I1YA 3OTQA 2FEAA 5AVSA 3N28A 3QUCA 2Q4RA 2ZBGA 5AESA 4F71A 5AW3A 4I9FA 2CN1A 5AM4A 1O03A 3K1ZA 5AVRA 5AW1A 3TLMA 2JGAA 1YS9A 1N8NA 1TJ5A 2FI1A 1X42A 1ZS9A 5ALFA 3ZUPA 2HCFA 4BBJA 3L0CA 5AM0A 5AVVA 2RBKA 1QQ5A 3NUQA 5ALEA 1VJRA 5IT0A 3RF6A 5AVYA 4L6CA 3KDPA 2FPRA 2RAVA 4ZEXA 5ALZA 3EF0A 2R8ZA 1N9KA 1WZCA 2MSNA 3FVVA 3WK4A 1Z4QA 2DQSA 2P11A 2JAUA 4NWIA 4BNDA 5AW5A 3UMGA 5AW2A 5A3SA 2B30A 2FPXA 3EWIA 2BDEA 3ET4A 3ZX4A 5ALLA 2ZBDA 4YGYA 2HX1A 1ZOLA 5AM5A 1Y8AA 2YJ4A 2EARA 4DCCA 3UM9A 3L8FA 1QYIA 4YH1A 1RMYA 4YCLA 2D2VA 3E81A 3HLTA 4HAIA 2B8JA 4FYPA 2G06A 4ZEVA 1ZD4A 5AI9A 1XPJA 2JAWA 5ALGA 3WK9A 2B82A 4I9GA 2YMQA 2EATA 2ODAA 3GYGA 1WVIA 3CNHA 4UW9A 2OBBA 3QU4A 4Y2JA 3ED5A 3AR2A 1Q92A 1KYTA 2G80A 3DV9A 5ALXA 4DFDA 1Z4LA 3L5KA 4RETA 4Y2SA 4CF4A 1MH9A 2GMWA 4L57A 4UATA 3EF1A 5AKIA 3MMZA 5AK6A 2BDUA 3AR8A 1Z5UA 4GXTA 3ZW7A 3QGMA 2NO4A 2O2XA 5AKEA 3L7YA 4YCMA 2YN4A 4UARA 1EK2A 5IT4A 2G09A 4UM5A 5E0OA 3A1DA 5ALOA 3L1VA 1RKQA 5AI6A 2CFSA 4KNVA 1U7OA 3R09A 4MWOA 4UAVA 5ALQA 3QX7A 2P9JA 3QLEA 4KNWA 4AS2A 4BEWA 3OCXA 1VJ5A 5AHXA 2I34A 4UU0A 3OCUA 1RMQA 1WR8A 1TJ3A 4EELA 1ZJJA 3FZQA 1Q91A 3I76A 4UASA 3CZ4A 2PR7A 3W5DA 3ET5A 4HGOA 1S2OA 2C8KA 5AKLA 3QNMA 5AW9A 3WKCA 3AR9A 1RDFA 5AIBA 4Y2UA 2Q5EA 3U7HB 3NIWA 2GO7A 2MU1A 2OM6A 2YY6A 4BNDB 1CQZA 4E88A 1EK1A 2HO4A 3MC1A 4Y2RA 3W5CA 3ZI4A 3B9BA 4AS3A 1Z4PX 3WK6A 4IFTA 1AQ6A 3L8EA 3ZTWA 1SWVA 2IOFA 5AVQA 3DAOA 1YJ5A 5ALVA 3NASA 5ALHA 4BX0A 2W4MA 2B0CA 2G1AA 2CFRA 5ALKA 3SMVA 3R4CA 1L6RA 3QU5A 2WF8A 1RQNA 2IOHA 2ZBFA 3MPOA 3ZX5A 5AW6A 2GFHA 1ZD3A 4EX7A 2HHLA 3WGVA 5AVZA 4CF5A 4CE6A 5AK4A 4J2TA 4XOUA 2QLTA 2FPWA 5AKJA 2R8EA 4BX3A 4MUMA 3U7GA 2OA0A 3N1UA 4Y2XA 1FEZA 2YMMA 5AW4A 1S8OA 1PW5A 5T41A 3L1UA 4UMDA 2WM8A 2HF2A 2I55A 1WPGA 3M1YA 1NRWA 4HGPA 4NABA 1ZD5A 2B1QA 3FPBA 3ESQA 1RRCA 4O8CA 3E8MA 3WK8A 3B9RA 1JUDA 3EPRA 1U7PA 2WF7A 1L7MA 3KBBA 2IOFK 1T9ZA 1YMQA 2AUTA 4Y2PA 3OCYA 3U19A 5AVUA 3U7FB 4QQFA 4HGQA 2G07A 4JDPA 1T5TA 1YNSA 4FE3A 5AKYA 3SKYA 2I7DA 3KD3A 1CR6A 5AKZA 4GIBA 2HOQA 4KX3A 3WGUA 4EENA 5ALSA 1Z88A 1SWWA 1YV9A 3J7TA 2FPSA 4QJBA 2I54A 2B1RA 2WFAA 3N8GA 5AICA 3KC2A 4B6JA 4UMVA 1L8OA 3ZU6A 4BKMA 4EEKA 3DNPA 4Y3UA 5ALMA 2C9MA 2ZXEA 2I33A 3ONNA 5AW8A 1ZRMA 4NFLA 1QH9A 4XQ0A 3B8EA 2QYHA 3AR7A 3ZWDA 3W5AA 4OCZA 5AVTA 3AR5A 3P96A 1Z4NA 1U02A 3PDWA 4YIHA 2AGVA 3QUBA 1L8LA
chains in the Genus database with same CATH superfamily
3JPYA 2P1ZA 3UJ8A 3LVVA 4Q3OA 2PRKA 2HF7A 3PUVA 2PSSA 3KZNA 3RUAA 1Z5GA 3AL0B 3SFTA 5EWLA 2XITA 3KX2A 3PR2B 4G0UA 5ED4A 3M83A 3U7EB 1TVCA 2XD4A 2ENWA 3A6FA 2V7EA 1MB4A 2F48A 4D6YA 5JNVA 1WDTA 2WW8A 2IJGX 3WRWA 2QIOA 1PF7E 4Z4QA 2C1XA 4FCWA 5KEIA 1NAHA 3F8SA 1IY2A 1VCNA 3NOXA 2I4LA 3H1TA 3QQ5A 4HNRA 4ZRMA 5KS2A 3A1VA 5CIWA 2QA5A 1IH8A 3I6QA 3ISDA 4CV2A 4J49A 2PMFA 2RIRA 1WM1A 3D7LA 4I4CA 1PJSA 3D4PA 3M7DA 4L6AA 1SVIA 4XWOA 2SECE 3DHWC 1V1MB 3EC7A 4RVNA 1ZA2A 3WRXC 5AW7A 2NACA 4C8MA 1G6OA 3ZNQA 5AI0A 3LH5A 3BCHA 4X41A 3RS8A 4BZPA 1EM6A 2EZXA 1RMTA 3VJMA 4KMRA 3HZOA 2IZ0A 2P79A 3CNLA 1T4MA 1I1NA 5CYOA 2J45A 2EIXA 2SKCA 4TSRA 1YS4A 1ZXXA 5IVDA 3TRFA 3PVXA 4NDAA 4KR6A 2CNLA 4KMOB 1U5BA 3OSNA 5KYXA 4YWJA 4X1IA 4C4XA 4O4LB 1UC9A 1EG7A 4JBXA 3RYTC 2R8JA 1RWKA 3HDYA 4L73A 3A1FA 1QHSA 5EWGA 2W4QA 2NZ2A 1DEOA 4IUDS 1NVVQ 1KJIA 2CD9A 1TDJA 1P2BA 4NJEA 2AW5A 3BMNB 1F2TA 3RO7A 3QX8A 2XHZA 3ROZA 5LR6A 3NWPA 1I80A 3RS5A 4CXMA 4JBYA 1RC8A 1IJKA 4OHFA 1LC0A 4D2IA 1QWSA 3PWKA 3SQOA 4MUBA 5CUQA 1W4AA 4MVJI 5EJ6A 3REFA 3O1LA 3FHCB 1JIHA 2VJOA 4OHVA 1S8AA 3WG9A 4C88A 1BG6A 2YJ6A 1W30A 2P3SA 3E9YA 1RAAA 1PYOA 3ICEA 4KWHA 4KGXA 2WYWA 3R9XB 2P66A 2GDJA 1FU7A 1R6BX 2X5JO 3TFSA 5KFAA 3PXEA 3B51X 4KAJA 4ECSA 3TNFA 3BMQA 2BH2A 5ALPA 4K9LA 5IKEA 1CRPA 2FFAA 4ZC1A 5EE0A 5IJXA 3QU7A 4Q45A 1JVSA 1RFGE 3ICCA 3IJEB 4Z5XA 2I67A 1JN0A 5TQ0B 3IOCA 3GRYA 5HTKA 1LVHA 1SXJA 3DMRA 4AZWA 2PQ2A 4LJAA 2Z6UA 2Y1DA 4M9SA 3C1OA 1IBCA 3I04A 3ZHYA 2HEGA 4B9MA 3JZFA 3KJHA 4CM6A 1RS0A 4N3GA 4I4TF 2GX6A 1UJ2A 4PHPA 2QL5A 5KCMA 4AZSA 1UZAA 2DPIA 3F5FA 3AH8A 4WLOA 1FZTA 1G1AA 1LQ2A 1TJ4A 2PL1A 4ENUA 7ICKA 3SHVA 1SG0A 2HUNA 4Q3KA 1F6WA 5H59A 4GLOA 3K71B 3MLAA 2KE7A 4YI3A 3BIOA 3ZH9B 4ETWA 1S3IA 2FJUA 1PUJA 1QYWA 2ORIA 5HF8A 2KE5A 1DRVA 4B3GA 3HO1A 3ZHZA 4HDRB 4I5EA 4E11A 1N2EA 1Z4MA 2GESA 3GYBA 5KT5A 4CEHA 3GGOA 4Y2YA 3OJUA 1XP5A 4Y6LA 2B7LA 3UKJA 2QGFA 5FTNA 4UDYX 4YT4A 5K4HA 3KSRA 3S2UA 1Y9EA 3ZR4B 3FCSB 1SUWA 1RWQA 2OHHA 2ZZKA 4NMLA 4FEEA 4L0QA 1L5LA 4C22A 2W6ID 3HEAA 5DIFA 2ZATA 1AA6A 3CZCA 3AB7A 4QDXA 1SB9A 1KEPA 1D4AA 4TTAA 3RC7A 3UENA 3L06A 2AFIA 1AXEA 1YL6A 4CKBB 2ID9A 3PUZA 2JPDA 3AU6A 1PZNA 1L4FA 2QPTA 4DV5B 2JFBA 2YBEA 3BQMB 4X1KB 5ABPA 4GXQA 1CZKA 1XJCA 2AHRA 2E2WA 2AC2A 1HEIA 2HA2A 1P81A 2IC5A 3NMUF 4BMSA 1NXTA 2GJ8A 1I4OA 1SEPA 1VB5A 2XB6A 2VP2A 2Z5FA 3MJCA 3OZWA 1PSWA 4LIPD 3OIWA 4ZO6A 5L3VA 4WBNF 4DB2A 2VPQA 3L8GA 1BPDA 1EQAA 1TVKA 2LCIA 5E4YA 3SEZA 4C4PA 3R5KA 1OILA 1B41A 4F7WA 2VAPA 2F44A 1C4OA 5FL7A 3VDXA 4TWAA 4GT1A 2A4KA 3L8CA 4XIGS 2HBRA 4QDJA 1CR2A 2OV6A 3K6SB 1O87A 2QP3A 2WF5A 1XZIA 1V4VA 3IILA 5HPYB 3O0DA 5K3BA 1PT6A 2NG1A 3ZGZA 4F6RA 1Z15A 1PNRA 4PHDA 2GN0A 2MA1A 2LYHA 4ECZA 5AMXA 3H6KA 4IQFA 3OJSA 1RC1A 4RLFA 5L7YA 4BMOB 3NR2A 4BKQA 3EWNA 2Q4DA 2JARA 2JCVA 4HAZA 4TQRA 4GPAA 5EZYF 1JQAA 1S77D 1DE0A 1RABA 1ZISA 3HGQA 4YDSA 1UMKA 3MCVA 2VA9A 5DRYA 5HBRA 2Q2OA 3TMAA 3BDIA 3IUSA 5EE1A 3IB3A 3SDSA 1J7KA 1QG0A 3GBSA 2GJ4A 1MGOA 4TTRA 2CDNA 2ZRAA 3PX3A 4EY4A 2C7BA 3NBMA 1CQJB 3ZWCA 1E59A 4CR6A 1NZBA 1EFTA 1FVFA 3PGA1 4QGSA 5LZ9A 1TM4E 2XKKA 3H99A 3ZVLA 3WJ7A 1FFSA 2G67A 2HFKA 4CNQA 1IN7A 1FRVA 2X9VA 3F9RA 3TEFA 1PEKE 1DKUA 3HPQA 1AN9A 2WFLA 1N3LA 2OKCA 2YH2A 4LY6A 2BBOA 1JAXA 1H9AA 4RV4A 1G5PA 1RHKA 5F3DA 2AXNA 2XIDA 2JAQA 8ICCA 4K6KA 4F3YA 5KNDA 1M2JA 1SHLA 4H3SA 4JL5A 5ER9A 2R84A 4J7XA 4DMGA 1ISFA 2E7ZA 2BFEA 2YJZA 2W0SA 1BE0A 4IOKA 1M73E 4KPUA 5BV7A 3QE9Y 1YBVA 1ZN7A 1VE9A 2VHVA 3GT3A 3I9NA 4X97A 3RHTA 4QW8A 2UZ0A 4M46A 5C53B 2FQ1A 4WI1A 1KQFA 4EA8A 5IEJA 1CQPA 1ZQBA 2B8TA 4R16A 2IXEA 5BOSA 5KQGA 5L6MB 3DT8A 4ZGWA 4R8UA 2JGJA 2FRXA 4MYHA 4WEQA 5B1HA 4CMGA 5C5JA 1BH6A 2HZBA 2Q3LA 3EODA 3JVDA 2MRLA 2FEPA 2WVGA 4QYMA 5SY9A 4DCUA 1BD3A 1E18A 1N5LA 2V4UA 4ZRDA 5LU8A 1EWVA 4CM8A 4DCMA 2FPIB 4FW8A 1ISRA 4B9NA 1XJ0A 5TVGA 2XRFA 4ECEA 4Z86A 3CYMA 5KOHA 2GQ0A 3FNRA 4DRXA 4V2IA 1JKJB 3FRHA 3HU2A 1BA3A 1SV0A 5IP5A 4ZI7B 4J0CA 2VDWA 3LUKA 1T0IA 3PTLA 4P22A 4YD1A 1QF7A 2V59A 4MA0A 5BSVA 4MHOA 1G16A 3IL2A 5C8YB 5HIIA 3UAZA 4PNEA 4KLCA 2OHVA 1FS6A 4R66A 2OZLA 3ADPA 4IM7A 4TQ9A 1IUOA 3WGJA 2ACVA 4BVEA 2H5JA 1TJPB 4HX2A 2OXTA 3F5SA 3NHUA 3OOJA 4ZCSA 3VPFA 2IUFA 4C0WA 1M10A 5J8YC 2XMDA 2O1SA 5KMGB 3E9EA 3AM4A 4MB2A 2EG9A 2O2YA 2QZ4A 2XBLA 2FMTA 2P77A 1Y42X 4LJRA 1BO6A 3ISTA 4DBLC 2C8JA 4NLKA 4AECA 1TJNA 1K3UB 3AZQA 3CQ9A 3LUBA 2HX1A 4UXHA 3KRTA 1N62A 3R0XA 1WAMA 3L4PA 2JGKA 3B3QA 4GYWA 3VPAA 1LS1A 1H9CA 2XGSA 3VYRB 2DKFA 3N3BC 5CAEB 4FYHA 4JUDX 3ZCRA 1L8QA 1JI7A 2DQYA 3EE6A 2CFCA 1G17A 2I3BA 3DAFA 4ILEA 5C4MA 2ZT6A 2YCBA 3E70C 4NE2A 4CV3A 1YVUA 5LU9A 4AI6A 8ICOA 2F3PA 3O5AA 1K2VN 5IC5A 1AQLA 2OR3A 5BRJA 2Q3EA 4B3FX 1KSJA 1XTUA 2QSUA 9ATCA 5I45A 2FEKA 1OXUA 2OV4A 4IX9A 2CVQA 4OXYA 3ZK7A 2FZVA 4BFTA 3KQVA 4MUXA 2B4TO 3PX2A 4GVXA 4US1R 1L3SA 1H1LA 4DA0A 5IUKC 3U4QB 2V6JA 5F33A 3D9QX 3D8TA 1SU7A 4X92A 1I51A 2IYRA 2IY8A 1PJZA 5KFXA 1IG3A 3AR2A 3DAPA 1X2BA 3CUUA 4GZMA 3U49A 4K87A 3WLJA 4RE5A 1EI9A 3RPEA 3PZPA 4OIMA 3LF1A 3TYXA 1Q95A 3IMGA 1KSGA 2OAEA 3NDIA 1NK9A 5C4IA 2J9FB 1DG1G 3CO5A 4N48A 4ZAGA 1O8BA 4L74A 3RKUA 4PPXA 2GN2A 1ZNWA 4MW5A 1SOWA 1JFTA 4KMUA 2KZZA 4KLIA 2AF3C 3NS7A 4CN9A 1RYNA 3LJKA 4GXTA 2F2AB 3TIVA 1A9QA 1RRFA 3CO0S 3BQ1A 4YRIA 2PUTA 1GXSA 1ADJA 1QIMA 4PCLA 2CUKA 2GILA 5KQPA 1G21B 4DQQA 4WCVA 4QEDA 5IT4A 2VHXA 1EJ0A 4JVLA 2IU0A 3F5MA 5E3JA 4B73A 4IEFB 1P80A 4UAVA 4UUBA 4Q9NA 2VRBA 3NEJA 2MYNA 4II3A 4ZODA 3U3ZA 5HILA 1MC4A 4XH9B 3NRBA 3SAJA 4TS3A 5JSUA 2HLNA 4DARA 4J9LA 4WT7A 1M0TA 4LNUA 3WB0A 2DQZA 2NXWA 1M76A 2O19A 1UQVA 1ITZA 4TMTA 3GIJA 1DBSA 5DQIA 3HNRA 3TLCA 1BFUA 3IAM6 5KQSA 1WZEA 2G72A 3QNMA 3THOA 3HYNA 4K9OA 4R63A 2G7ZA 1HUZA 3ZIAD 1NYTA 5CA0F 3LPLA 3DOUA 1NSTA 2H18A 3QIAA 4EHAA 4I2NA 4N0PA 2PWBA 2E6UX 1CZUA 1H4QA 1JECA 1ZCZA 2C7VA 4C07A 3PR1A 1LRLA 4QECA 1KO5A 5TT1A 1G2OA 4NATA 3K1JA 4KBGA 2WYOA 3Q8XB 5G0WA 5A7GA 2ATIA 4QM6A 3OAAD 4Y2RA 4ZJUA 3H4BA 3NVZA 5EIAA 4IKPA 5KFJA 1J4AA 4LCEA 1F1JA 3AXSA 2CHEA 4E70A 4UTZA 3GIWA 4TLAA 3P2MA 3UA4A 4XD7A 3Q15C 2VFAA 1PZFA 3A0BU 3IR5A 4TZTA 1E9CA 3BHIA 5ALVA 1FTSA 1WB6A 3OQHA 2OCEA 3NASA 2OV1A 3MOGA 3LZ6A 1CJUC 2H5LA 2BHRA 1YL7A 5AWFC 1KBQA 2A1TR 2NRZA 4KK3A 4C4OA 4UFPA 2Q41A 4UHCA 3VZCA 3TW8B 4DWWA 4YDHB 2D1FA 1P33A 1DJQA 2QQ0A 2CMDA 1KQNA 3C1UA 4DMHA 4EJ2A 1JFFB 3GNSA 4U02A 3J7AC 2QP9X 3EJ6A 1CJVC 1OHHA 9ICAA 1HTTA 2NZ8A 3O9ZA 1RKBA 4I1UA 5ERXA 1EKXA 1LA2A 3D4NA 5E9AA 4B6RA 3A9UA 5IAAA 2C9DA 2C2HA 2H2WA 5IYZA 1WIWA 1X1QA 4AJ1A 1GADO 3LHDA 2E8OA 2CLSA 1L1RA 3QLJA 4R1QA 3WWCA 3EPHA 2JCSA 2TECE 2F17A 4QVIA 2ZJ5A 1R2QA 1CEXA 4JCOA 4PNPA 1X1RA 2RDIA 2R00A 3RAGA 3I45A 16PKA 3VC7A 1VL6A 2JASA 2R96A 1A69A 4DGQA 2HM7A 2I8LA 2FG5A 3KZIU 3G0OA 4M3NA 4NAUA 4LYFA 2CPRA 4TYNA 1R15A 2QRMA 4BP3A 1L3TA 4PZEA 2JHPA 4FGUA 5D8DA 3MUNA 5JD6A 4GGMX 4Q7EA 2I55A 1Q1AA 1X1CA 3R7AA 1Z37A 2N9UA 4DM3A 4F6LA 4V0NA 4N82A 4DA9A 2W8KA 3M0EA 3QEMA 5BPFA 3VZSA 3G6XA 1OTXA 1RKXA 3AUXA 1LZLA 1NIPA 4HBZA 1N0HA 4IS7A 7ICPA 3O1JC 4IH9A 4L6IA 4OJQA 4EMBA 1WMBA 4ON9A 1NFFA 2I4RA 4DUPA 1YAHA 1ENZA 1OI4A 2PWPA 3I01A 2WVAA 3H9GA 4UD6A 4S05A 3BSYA 4QZVA 5KDLA 3MGGA 3PT5A 5JD5A 4CEIA 2EU8A 1L4GA 3JU3A 2R5FA 1UR5A 3R20A 3TNJA 1LX7A 4I99A 4RQ3A 1V8OA 2A35A 3G82C 3HCWA 4DUGA 4YRMA 4CCWA 5G5GA 1DFIA 5IVPA 5TPWA 3P71T 1H5UA 2QP4A 1UQRA 3AFNA 4DQDA 1OZGA 2G07A 4IGKA 3R7LA 4H59A 1J20A 3IVMA 2XDWA 3UJCA 3K5HA 3RAEC 4YRZA 1K97A 3GZJA 2NNLD 2KM1A 4ED8A 1XK7A 1LWNA 3BTUA 5LMZA 1LX6A 1DCTA 3QKRA 2P68A 4BKRA 1C5KA 1P17A 2KIWA 2WU8A 4FYMA 4RANA 4D4HA 2CHQA 4TWIA 5CT9A 2BUBA 2RGYA 2XUJA 3RVDA 4XIIA 4ZCRA 2K4HA 2I54A 4Q1AA 1MFPA 2B1RA 4B6OA 1ZQOA 4XWTA 4LFBB 1C4WA 1V8BA 2OD7A 4IRCA 2PLNA 3UFBA 1D04A 3QWBA 1ZMBA 4O0LA 2L69A 5SZKB 4RHYA 1L8OA 3WRYA 4K9QA 1LB2B 3BXPA 4AY5A 4GGPA 5GVRA 4EEYA 1U2GC 1NY5A 3BSSA 4J76A 2V03A 3K2IA 3MR5A 4F8RA 3U40A 1FFEA 3ZU4A 4ZREA 4O1HA 3V1MA 3QZ8A 5HZMA 4WADA 2A1UB 1SXJB 4B84A 1IN5A 1N56A 1DLIA 1RM3A 2I80A 1QFZA 2QVYX 1CF2O 1ODJA 2AB0A 2O50A 3KK0A 4MGZR 2QMEA 3B52X 2DBYA 1NVMB 1E20A 4V3BA 4CIYA 2W7OA 3HSSA 1NDUA 1P5FA 2VTBA 2XUHA 4UAYA 3FF4A 1KZ1A 2XUQA 3EXEA 4LZOA 3TQIA 3P96A 3VH4A 3VTZA 1SB8A 1S3GA 3E7WA 4GM1A 5TPZD 5A5FA 1MIHA 3SIRA 2FXIA 1Q16A 2CXOA 2I8AA 1XWLA 1R9JA 1JKFA 1T10A 2ZPTX 4LHVA 4HYTA 3ZK8A 2BIFA 3U9TA 4QRHA 4Q4HA 1MP0A 1KYQA 1TKAA 4KIGA 4JXKA 5FTMA 4L4RA 4YCNA 2I7XA 4HLCA 1T3SA 2ZM5A 3TKAA 1YVEI 3WIOA 5ADVA 2BISA 1NBME 3LUFA 2D4HA 2PMWB 1MHPA 2P6OA 4EUEA 4GPD1 3BD8A 4GX2A 4OXKA 5JJCA 1C3XA 1ZQEA 1R9MA 2IEAA 4NU5A 5K0JA 1D9FA 2AMYA 2ZIEA 2NZJA 3ORQA 2WPDA 4ERNA 2PZKA 4RBNA 1I5OA 4C06A 1VE6A 3JWHA 3WIBA 1WSAA 4JP2A 1Y33E 4Z1OA 2KHZA 3IQEA 3ENVA 3PJFA 4AO7A 1B4FA 4QWAA 2VP5A 4TMXA 1VOTA 3HHEA 1FQWA 2F43B 2IHKA 5F4ZA 3WMFA 1D7AA 2FPPA 2F3NA 4PHEA 2DYKA 2YV4A 4HMOA 4MQUA 4RWEA 1QTQA 2X3UA 4TLBA 3JPRA 4LVOA 4HG2A 1ZCBA 4DMMA 1W2GA 3JTMA 1PVOA 3R41A 5TV2A 2OWOA 1XDSA 2ZYHA 3LY7A 3WIVA 5ADWA 3MK31 1KDVA 4OO3A 1FFYA 2BM9A 2RK3A 3A58B 2JZCA 4R40A 4ECTA 2QU8A 3A1EA 5B2ZA 5MN5A 4PR0A 1XJQA 1RP7A 1W8DA 1WV1A 2NU7A 3K9LA 2FUEA 4IXNA 4V0QA 4EM6A 1Z4JA 1GPBA 3OJXA 5AUQA 3IEMA 4DQIA 1H2XA 4E5UA 1J2UA 5JRZA 2QF7A 1FFVA 2Z1NA 1NBIA 3D5QA 3NHPA 4WK4B 2QTNA 3Q8RB 1MAHA 4C7VA 1ONPA 1LBHA 1E0AA 2RCNA 3NTVA 3FDZB 1O5IA 4BU1A 5CIYA 2V4MA 3EXFB 5AJWA 3W5IA 1Q1QA 1I4DD 3ADKA 5F2NA 3M2TA 4XPIB 3CEHA 4F5PA 4EX6A 3MCZA 5K0NA 2H48A 3KT8A 3WK7A 4U7FA 5HSGA 1MB0A 3QF4A 3RFUA 1N9GA 1ZICA 2XCPA 3KOWA 3L7AA 1PT8A 4KLAA 4RNNA 5MGBA 3E7DA 3UNXA 1UA1A 1P74A 4DRXB 1EG2A 3B1YA 1KDPA 3IHQB 4EHFA 1OH7A 3PZBA 4YX9A 3GH1A 3ZHTA 2PRZA 5GINE 3DEJA 4EGQA 1F0MA 1VYTA 3VYUB 3WJAA 1ZQJA 1FDIA 4UU1A 1E7MA 3NPMA 1VL0A 4M1OA 2IH5A 3ZHXA 2OBNA 1MTOA 4ELVA 2I6QA 2Y68A 1M2VB 1CQWA 1R27A 3KHUA 2WU1A 2LUOA 3L7CA 2G0TA 3VSBA 3C1TA 4L4XA 5GONA 4H7HA 4NJMA 4CLHA 1I9GA 2CNWA 1XLVA 3URKA 5JI2E 2BV3A 4ARZB 2HU5A 1GSIA 4U6PA 3QVMA 1YJAA 3I8XA 3LG2A 5KG7A 4LQCA 1GM5A 2A1AA 2NXCA 2ZIZA 1ADGA 4BO5A 1N2GA 1RWVA 5DYTA 1G9SA 3R2JA 4LK2A 4F8JA 1XRQA 2O3JA 4FSDA 3ZDDA 3AEKA 2RGNC 4GLXA 1NMZA 1U9IC 3P7MA 1MT0A 3TIXB 1WDMA 5DB8A 4M0LA 3UQYS 1AHPA 1CDZA 2PI5A 2FW1A 5TE9A 4Z6KA 2Z8YM 4ED1A 1X80B 2JCGA 4ZT6A 1E1LA 4E1VA 1WBBA 3JQ9A 4K05A 1K4KA 1SGGA 3HXLA 5AJYA 4OHWA 1UXOA 2ZJ3A 4W6ZA 2Z08A 4B47A 1Z33A 4EO9A 3KSBC 3CF6R 3BC1A 3CEMA 2K87A 4HGRA 3L0PA 2YHIA 4RHCA 2AT1A 2BPOA 5L3SB 1SULA 3KT0A 2D2EA 4JQZA 1XO0A 4UU7A 3SM9A 1JDSA 4FT4A 3M6VA 3Q10A 3A1SA 5JS8A 3ESRA 1GN8A 2GERA 2R8YA 1JEQB 3PNQA 4CJXA 1XKTA 1P3Y1 4ESVA 1GL9B 4IV0A 4TQAA 1N34B 4ZEWA 4B2YA 1OJ7A 3AVXA 2E1PA 4NJ8A 3A3NA 3FUVA 1KR2A 1Z2PX 1G18A 5TX7A 5L6LB 5BQPA 2QR3A 5CXSA 2PWYA 1FNSA 2XH8A 5GGXA 4FHCA 3ROFA 4MGYR 1WQ4A 3PRKE 2AQIA 5TGZA 2DETA 2ATVA 3NUZA 2GEUA 2ODNA 3PSIA 4HQOA 1SVNA 4ZYZA 221PA 4RAQA 2RP5A 1DX9A 3P94A 4O8ZA 4DJJA 2J3MA 3C5EA 1PL8A 8ICYA 4MVJF 3WJ1A 1JR4A 4UNSA 2FE4A 4HH4A 4N7MA 4E46A 4PZYA 3RFFA 4E5DA 3OZXA 3TOVA 3GEBA 2O59A 4WJ3B 1BN6A 2GK7A 2GVNA 1GZUA 2O4UX 4FMCF 2PUGA 3SBEA 4PZCA 2AV6A 5J0TA 1TAUA 2OC4A 4NK5A 4IZIA 3N0RA 3VDRA 1CEQA 5EMKA 621PA 2ZT5A 4YROA 2R5WA 4H7FA 4ZO7A 4A15A 4RF3A 1PBTA 1GZ5A 1G291 1Y7IA 2IFTA 4P5DA 1DJPA 3OFJA 4I5GA 3VC3A 1J99A 5CJ7A 3UXPA 4PSKA 4I0WB 2ACWA 1KVQA 1F5NA 2H17A 2XZTA 3KQQA 5LQCA 3EDRA 3ZI0A 4X90A 3G2OA 2GLTA 3L02A 2A9RA 1KFJB 3AMZA 1CS0B 3CRW1 2Q21A 4NZOA 3ZBPA 4OOEA 2HBKA 3G85A 1QE3A 1L7OA 2ESEA 3HR8A 4K6CA 1D2AA 3CH7A 1H0RA 2GBIA 1KJ9A 3R7FA 2I4IA 3T1QA 3EX7C 1RSZA 2ZIAA 1IDN1 2W6MA 5JARA 2ZQZA 1WVMA 3OLQA 3QG1A 3JWIA 3P4UA 1FZQA 1KAOA 2VBFA 3GMTA 3DTTA 4KVZA 4O5OA 4Z3KA 1TF5A 5KQLA 1QHHB 4W8OA 3GJ4A 1N6OA 1XRNA 2RBEA 4QNMA 4RF4A 3SHTA 3UAGA 1PKEA 3ETNA 2BKXA 3KXKA 5LB4A 1E9RA 2PO5A 4PHHA 3HKBB 3DE7X 2BGMA 2JGRA 2ZT8A 1XZEA 1X77A 3T9FA 1W85A 2FWPA 3UJAA 2RDJA 1LSUA 1ODLA 2WV7A 3BK1A 1BJRE 3IP9A 3OIDA 1EE1A 2F67A 5TEVA 3WLIA 1BX1A 4JUZA 1JA9A 1EP1B 3JQGA 3O8QA 2WKQA 3DFMA 4M8LA 5LXTB 2A92A 2XEDA 3D3WA 4XA5A 1NI4B 2AFHA 4D45A 4PIPA 4YV1A 5K0EA 1BC5A 1GL6A 1PEAA 2PKRA 1HE4A 2IV2X 3P0JA 4FIDA 3DDOA 1Q0PA 2WILA 2YS7A 4GS5A 7ICGA 1UZNA 2J6CA 4O4IA 4IJ5A 4Q9LA 4F96A 2XTJA 1XWWA 4IYJA 2XIQA 3G6VA 2GK3A 4PG6A 4CF7A 2RKWA 1GTG1 4HFNA 2PUHA 5JVDA 2XE8A 3BB4A 2AXPA 3PLRA 1OYOA 4BE9A 4L0DA 3H87A 3KZMA 4Y30A 3AEQB 1TI7A 3O82A 5FKJA 2HHHB 4WOCA 1F2TB 4XFDA 5CFMA 4BP1A 2HWKA 3UMGA 3D7RA 2VXOA 5SV2A 4DQPA 1G8AA 1FMTA 2FK8A 2XWPA 4LY0A 3FSRA 5DHTA 4DY4A 3MWEB 2C1ZA 3MFIA 4A0SA 4DMKA 3DPIA 3AUOA 3V1NA 4CBVA 1PE0A 5ALLA 5L4NA 2IIVA 2J0EA 2XBUA 3FW1A 4JI4B 1O95C 4YQZA 3HTXA 1GA4A 3TI0A 2ZREA 3CM0A 3ETDA 3JD4A 1WHSB 1XVUA 1WCIB 1KY3A 2FWIA 1DQNA 2FMSA 1N0VC 2WWHA 4WKNA 1HMYA 3RROA 2CY0A 4WCFA 3QNUA 1M0WA 2G4CA 1Y6JA 2VP9A 2VSYA 3C74A 1TF7A 3DLIA 1LV8A 4F5QA 3JX9A 1K1QA 3G88A 1QSYA 5SICE 5H80A 3ERCA 2O54A 2I4OA 2CEAA 1J5PA 2DFLA 1U28A 3EVBA 1AIPA 3LQRA 4HY3A 1XZAA 3PJRA 2H16A 4Q15A 1AHIA 2D8AA 1G5QA 4HEA1 2MAXA 1T1IA 4D42A 2PMZF 2QTVB 4ZVVA 5LA6F 3B48A 2ZE8A 2ZFUA 3EEQA 4DS5A 3UICA 5JAIA 2POQX 1A1SA 3L6CA 4ER3A 2J1LA 1Q92A 2X8WA 4E2ZA 5JROA 1W7AA 2WG0A 4IMPA 3ZN2A 2OENG 2WZQA 3IQFA 1CIJA 5CFLA 1SUCA 4IFIA 1GIAA 2QL9A 3EZXA 4Y1RB 4KWEA 4EY8A 4BQNA 4R6XA 4EECA 4CL3A 2VQEB 1OVGA 1IOVA 3RFCA 1FVHA 2FX3A 2O8EA 1P19A 3VYSB 2GPWA 3ZHOA 3B1ZA 1N6RA 1OTHA 3BDAA 3EF1A 5CLLA 5HWSA 4QTXA 2BDUA 1T3HA 1K5DA 4RSGA 3LWLA 4ZOHC 4FHZA 1NNEA 2QVGA 2FP4A 2VS1A 2ZTLA 4WKGA 5K0CA 1GITA 2YN4A 1J8FA 1B0UA 1E7YA 4TTTS 1EK2A 5BVGA 3BDPA 1E96A 3S68A 2PJRA 3O7WA 2XLCA 3GT4A 3O8NA 4JWKA 2VJQA 4F97A 3C2LA 1Q17A 3DP7A 4YXFA 7ICQA 4MWOA 1GGJA 5ALQA 4BL5A 4IZ6A 2WWVD 4MHTA 4ECXA 1P75A 2QTFA 3PC3A 4PVCA 1IXRA 2ALJA 1IVSA 1SCBA 3L07A 5LBIA 4YCSA 2OY0A 4R2WA 1FFUA 2GBPA 1XXLA 3JQAD 1NVBA 2YIDA 3AN1A 1GZHB 3WMGA 3CLTC 3H86A 3GXBA 3U81A 4FEYA 3K0SA 5ARDA 2JLRA 4M7OA 2B1GA 2PGJA 3EH2A 3WE7A 3PLAE 4ND6A 2Y6UA 4LRQA 3CR7A 4BUZA 4PHCA 1FY2A 1KDZA 3UC9A 2QAGA 4Z2AA 3FWNA 3SNHA 4N76A 4WX2B 1M1XB 4C7OA 4NENA 1HKHA 3FPAA 1B00A 1OIXA 4OJOA 2YY6A 4KXFB 4FR5A 4ILKA 4MICA 5EE3A 3HBLA 5DGHA 1C8BA 5J58A 4IHAA 3M4ZA 4HQLA 5BV8A 2QN1A 5UKDA 4EL5A 3C3AA 4YPVA 2ODGA 3FMFA 5HR5A 3IMEA 1FIUA 1HE2A 1MJHA 2C59A 1LC3A 1Z0IA 3QX9A 3UCXA 4QT4A 4J4BA 2TMDA 1SUDA 3H0KA 3MJHA 4E3ZA 3IG5A 2K4IA 5L3SA 3HVKA 2WT8A 1IPEA 2W00A 5BSWA 3UA3A 5AVQA 1TLTA 1NMYA 1ZK3A 3DAOA 2OXIA 3FAZA 3L40A 4C3UA 4OPMA 4EBBA 2J0VA 1KE2A 2AR0A 1VPTA 1HM5A 1JAZA 1Z0FA 2DSNA 2GFQA 3C3PA 3FCUB 1JHVA 1KY4A 1JAHA 3EIHA 1KBZA 1UOQA 4MYTA 3BZBA 5L8VA 3QG5A 6REQA 4C2TA 1PJBA 4OVKA 2IYWA 3THYB 5K0FA 2ZSBA 4N9QA 2R66A 3I72A 1MAUA 2DBRA 4F4YA 4O2BF 1YZGA 5KOJA 4HKTA 3W7VA 2PQMA 1NQOA 2C3YA 3GFTA 1JJFA 1S2LA 3L8DA 1A8PA 1F4LA 3AYXB 4P33A 3G9ZA 1KO4A 2FN4A 1IHUA 3AJEA 3V8PA 1C1XB 1KYZA 3IDQA 4B9UA 3WGVA 3IUJA 5J2JA 1P4RA 1PQUA 4EG6A 5ICSA 2QX6A 2PSFA 2V6MA 3FOBA 5CBPA 1ZJWA 5IFLA 2A0WA 1JIXA 2HIHA 2YVUA 2PSJA 3WRXA 1WBDA 5JJKA 3A4YA 3A1NA 3I04M 1Z6TA 2QLNA 4LZGA 3DC7A 4FN5A 2O48X 1M2VA 2Q28A 3GDHA 4WXEA 5JLAA 4Y2XA 1GCAA 1FEZA 2PWAA 4GOMD 4YMTA 3FHJA 1QQAA 1DRGA 1XNRB 5EKTA 3LHIA 1PJ8A 3EYAA 3T94A 3AKEA 4LOKA 1W5EA 2I03A 4IDQA 4W1RA 2C2EA 1LUAA 2GPYA 2OORA 4LK3A 3A6EA 4R69A 3OESA 4RK4A 5HCNA 2UVPA 4MRRA 1FF9A 5IKOA 2WPDD 3Q3GE 1S0UA 3E22B 4FYVA 4Q3EA 5CDYA 3F6PA 1XEFA 1FX0A 1H85A 3N0TA 2HVHA 3U80A 4BQIA 4DLUA 4UAGA 3F3MA 1ISGA 4A82A 1W0KA 2NV6A 3NYRA 4IRUB 1TC2A 3RKRA 4COKA 3CW2A 3FDZA 2ZAGA 3MNFA 1K6JA 4UB8U 4ER7A 1DUVG 5CM9C 2QEQA 5FBRB 4EFKA 1UHUA 3ZDFA 2I1VB 1GKYA 4WMLA 2BPFA 4P3KA 4YAKA 1O97C 4FE3A 3UJ7A 4EB6B 1DB3A 1J0EA 2JFFA 4YK7A 4KW7A 1TAMA 4OJNA 4W1QA 5ECWA 5F78A 4DLBA 2Z95A 1MW8X 4IR1A 4KLOA 3AJ9A 3QRWA 2JFWA 2PKYX 1V97A 1Q0TA 1J24A 4HYKA 2O0KA 3TBHA 4E31A 1AUQA 2DR0A 2FPSA 1SIJA 1E1QA 2P0EA 3L6BA 3RRGA 4W99A 1UM9A 4BMPB 2PX8A 4Q0MA 4B6QA 1NVUQ 2VOJA 3QHPA 4RZUA 3WDMA 3ZQKA 3KC2A 1MQ8B 3GJ8A 1W44A 3JQFC 1GPDG 4PEVA 3EUWA 3QEBZ 1L5WA 1U5CA 2YVQA 3GZNB 1CEYA 4JZYA 4JLKA 3GLIB 1HG0A 3KM0A 4RU1A 1L5SA 3RRMA 4FEGA 1PUIA 4DCVA 9ICCA 1V7QA 1NZDA 3GD7A 2WNSA 3OBIA 3PSHA 4UHHA 5EN4A 5BWMA 2WI8A 5I4BA 4GNKA 4Q3CA 2H31A 3B8EA 1CULC 4LISA 3UGQA 4AMYA 5BORA 2XQGA 4UXIA 3PGKA 5IJZA 1B0ZA 4YUAA 4YRCA 2FMKA 2XXAB 2IHZA 5BQXA 2ASDA 2GTIA 3PEEA 1GUBA 3ZZUA 4OLAA 1SG6A 1H0SA 4PW0A 3W90A 2QYOA 4YPOA 5I9LA 1ISSA 1ECGA 4C01A 3EXAA 4NK4A 3FDSA 3SJBA 4QRIA 2EANA 2WF6A 1GPYA 3FM9A 3QKIA 3P9QA 5CDHA 5L7TA 1PTJA 2WBLC 3THVA 1ZVKA 2G5GX 3DOJA 3EFOA 4IHQA 3U4AA 4BGVA 4DCPA 1NY6A 1CZRA 2EIHA 3GV0A 4IY1A 4F5DA 1Z6AA 3HI4A 5B53A 3JQ7A 4IDHA 1LLUA 5K05A 4QDTA 1NNI1 3ZVMA 5EKXA 3QUSA 3FPFA 2PX5A 4IGFA 3SSMA 2DUNA 2E3JA 3OLVA 1U0OC 1UZLA 2XDAA 3AUFA 2BGTA 3LWDA 3PI6A 3THWA 4K4GA 5E1OA 3URMA 3RK1A 3VSAA 3LXRA 4UXJA 4ZYLA 1TB4A 1Z16A 3KLOA 3W7AA 1IYZA 1CK4A 3UPQA 2GEKA 1J06A 5JW6A 3SDZA 3BZUA 4AJEA 1AQNA 2X9LA 2WD7A 1C0PA 4QZHA 3ANNA 1H2FA 3IDFA 4JLMA 4AVYA 5EZQA 4BP9A 4D3DA 4DJ5X 1EBBA 4ZYWA 4TXMA 2PO7A 1U6JA 4RDXA 2QQEA 4GEGA 3C8MA 5K3DA 4XXHA 1C0EA 4Y6QA 3G7SA 1H23A 1NBAA 1NBHA 3I58A 1BMQA 1XA4A 4KLTA 1QLWA 4G4SP 2H1IA 3P5BA 5A3VA 5HIAA 1WF6A 1PX2A 2LYBA 3E84A 5CPBA 5K6AA 3DWGA 3ESAA 3K94A 3GRPA 2OVBA 3RSFA 4EW6A 4X62B 1V9SA 2LD4A 2VRWA 2ZS7A 3ZZ1A 4BJ1A 4IAOA 2V1UA 3BZCA 1UPTA 3PKIA 3N2EA 4BU0A 4F3RA 3OJWA 2XCOA 4LYDA 1AB5A 3VMFA 4YRRA 2A1JB 3FPGA 5EE5B 5JXGA 2AZTA 3S8EA 4KRFA 4DA8A 4RQ0A 4KV9A 4AL4A 1XXHE 5DWQA 1V4NA 3GF4A 1KFBB 3MWFA 3I8SA 3MQ4A 2BTQB 3CB2A 2JGLA 4DF3A 3SVLA 3NHFA 1PLLA 4W5OA 3TTUA 2DKNA 3EDYA 2ZXIA 4HTFB 1LV5A 2OOKA 4C6TB 5KFZA 2VDRB 2VPZA 1JHXA 2C54A 4P81A 2MU2A 2I62A 4Y6SA 4KLUA 3U3MA 2GHIA 3TAUA 1E2NA 3KSAC 5J2CA 1N2JA 1QO0A 1KTQA 5FBKA 1PD0A 1RHQA 4L51A 3R7WA 3GIKA 1AMNA 1QH8A 1X15A 4QFMA 3ROPA 3VAZA 2ZUBA 2X8JB 2WUDA 5DG7A 3BJRA 4B4KA 4Q3NA 4OLFA 4R8KA 1DBRA 1QO9A 3A6GA 2GZ1A 3CVJA 3E58A 1CG6A 4OHOA 4Q43A 1GOTA 1MB3A 5IU6A 1U4SA 5HHHA 2BHTA 3F1KA 1G0OA 4WUVA 1QQ7A 4D7AA 2W2PA 5J3JA 1F60A 1SU4A 2FWRA 2VK4A 1X7HA 7YASA 3OOHA 3RJEA 4C4ZA 3F7MA 1A1VA 2XA2A 3ANTA 1E5VA 1DTWA 4KQ9A 4URXR 2A9OA 3RB3A 1W49A 4R65A 2GVDC 3MCWA 5T64A 3U31A 4A6XA 3O8RA 1RP1A 2XA1A 2AGQA 3ML1A 3RVSA 1NONA 4KXYA 2K89A 3E0XA 2QMOA 4IXMA 3FN4A 5AR1A 1N7JA 1U4NA 4RENA 1QAMA 3THRA 4EJSA 1U8ZA 1XWFA 4QLOA 4E13A 4EYGA 3LK9A 1JL3A 1NBMD 3JWEA 4IDEA 2H4WA 5THKA 3UK0A 4B31A 2C5HA 2JHCA 3HQ4O 1M74A 4MVJP 1Z36A 4D9HA 4RTOA 1ZH4A 4E6EA 9LDBA 3I1FA 1L4HA 4PC3A 1ES9A 2GRAA 2UYYA 4R9VA 4RTPA 2YQZA 1NT2A 2J9YB 3PQ7A 3G0IA 3KZXA 3WRYC 5E4FA 3V2HA 1CRWG 1BCRB 4YAUA 3TZKA 3Q3EA 2JK1A 3ETCA 2WYUA 5BSKA 5KWJA 4JB8A 4MEYA 4D9MA 3L3FX 1MQAA 4NL9A 1BKYA 4W1PA 4AK9A 3VKHA 1J8DA 2HU7A 2AFIE 3TL6A 4UHKA 4RTNA 1RI5A 1GQ2A 1Z68A 1EVLA 4MKIA 4RIEA 3QUTA 3FR8A 2HDHA 4B43A 4ZO4A 1G41A 1HOXA 2GDZA 4HV4A 1E3MA 1AGXA 1D07A 2PGIA 2W70A 4AY3A 1AHHA 1QF9A 1K1EA 2CKDA 4ER5A 1N32B 3DTVB 2QW0X 3NANA 3SC2B 3DKKA 1JR3A 1WOMA 4ZICA 3W6ZA 4MRMA 1D1QA 4LPKA 3Q88A 2BGLA 4YAJA 1A5BB 3MDCA 2YJ5A 2YMLA 2IYEA 1W93A 3DBIA 2CXUA 2J33A 5JH7F 2GJ9A 2J9RA 3P0FA 3FY4A 1KEKA 1SPBS 4BO3A 2QRQA 5EMHA 2CHGA 1KDOA 4DL6A 3IMCA 5DM2A 5BQFA 4UCXA 4BNHA 3WLMA 4OQNA 3EG5A 1BPEA 3ROTA 1S1CA 4JWTA 3ILSA 5FHQA 5TIIA 4U7DA 4L16A 1NASA 3UMRA 1EPUA 5ALWA 4U7PB 3EZ9A 3AJRA 3C24A 3IA2A 4DLWA 5EOVA 13PKA 1RXYA 1T0BA 1FXUA 3N58A 4G2NA 2Z4RA 3GFOA 4P4LA 3NGLA 1JQLB 2PFPA 3I2IA 3B82A 2Z43A 1IHPA 3LA8A 2V5VA 3VNAA 3VZPA 5K8UA 1OHHD 2NUTA 3F7OA 2OP1A 1N3BA 4UE6A 5EIEA 5BYKA 1YQWA 3DCNA 4G8CA 2IMWP 4R9NA 1VIMA 4D0RA 4X7RA 1AGRA 3SYKA 3DVLA 3AM3A 3KAKA 3NJRA 4TM7A 2KJ9A 2IPOA 4LZNA 4DZZA 3OM1A 3NHYA 5AVRA 3GMSA 4L8YA 2IYZA 3QVOA 2JMGA 2XUKA 1ZWKA 2D2FA 8ABPA 3FPJA 2FI1A 3GP3A 3W2EA 4EYHB 4QOEA 4R84A 1QHXA 3B6KA 4JV5B 2B4KA 2XI9A 5CNMA 4XUGB 3TDMA 3ONVA 2Q8QA 3H3JA 3MRXA 3UMYA 3WIDA 5A4FS 1H2AS 3HKCB 1R0RE 3AIKA 2P75A 2XOXA 3HUDA 4TUYB 4PLHA 4IO0A 4ZEOA 1NOMA 4X7PA 4IIVA 3WLNA 3RAXA 5IRCD 5ALEA 3CNNA 1J2YA 3C5CA 4Y7DA 1CUHA 4R3WA 1QIKA 4K46A 3JYNA 3E03A 3MWYW 2HLDA 2IYXA 3G2QA 2XQVA 3EDOA 1DAGA 2AEFA 1QKKA 3CLVA 2WFZA 3E9CA 3EF0A 3F96A 4HPXB 3RJ9A 4A8HA 3PC7A 3SI8A 1U1GA 3EDMA 1NUTA 4WPGA 3H8JA 1K7CA 5KNIA 1K9VF 3VV3A 2R1TB 3GDGA 3K1TA 3ZTYA 3ZU2A 2DHDA 2DCMA 4AF8A 2FSVC 2JGEA 2NYAA 4YALA 2B30A 4RXMA 5C8YA 2JD2A 2A30A 2NPOA 4EB3A 1S6YA 3LTNC 3PX6A 2CYBA 2H1RA 5FWYB 3W8DA 2OZEA 4OGWA 3TMYA 2QXTA 5F77A 2C2BA 1MQSA 3OZSA 4B09A 5MFZA 1IV8A 4RXUA 3M6UA 4F4XA 1ATIA 2G76A 1GG8A 4QBHA 5DOVA 4DLSA 4L9SA 1TYAE 3P8ZA 4LYGA 2R2GA 5JBNA 4HNUA 3H0RB 1W6RA 3QVWA 2O3RA 3LS2A 1HOTA 1U3TA 2ZTVA 1YJ8A 4LJ7A 5E8RA 3W5SA 4W5QA 1A5ZA 4RY2A 2XVXA 1J9EA 2YZGA 4OTZA 1AY0A 2BFDB 2Y0SC 2JFZA 2WJZB 2HH9A 4KTQA 4R3UC 2IBSA 2FPMA 4MI6A 4IINA 1LB1B 1FTGA 1TIBA 1M7HA 2ZDHA 1P73A 3E2IA 1UDCA 2P9YA 5JZBA 4JYZA 2PK3A 4RKQA 4LYHA 4CM3A 1GAQA 4BEJA 2O2HA 4Q39A 1GTVA 2VPWA 5EWMA 2QORA 7MHTA 3OCJA 2RHDA 3II6X 2GYWA 3F8TA 4INZA 5JNUA 5JJIA 3K1AA 2ZTEA 2PIAA 2PLFA 2IF2A 2DR2A 5IJ9B 1STOA 4XUEA 5J0OA 2NYRA 3JYOA 4G0MA 4EPRA 4D79A 3DM9B 3RJIA 2F4NA 3TI7A 2W2KA 1NP3A 3HNPA 4Y0NA 1U2QA 3QTBA 5LP6C 1OH6A 4LX0A 4Q66C 2WDZA 4US8A 3X0DA 4GKVA 1G3IA 4WBSA 2PUFA 4FFBA 3TS1A 4WNAA 3J81j 1ZH8A 2CL0X 2ES4A 1H69A 4TVOA 5JMPA 2XLBA 2ZYGA 5DG9A 4MV4A 4WZ6A 4KQXA 1LSSA 2DE0X 3DXYA 3BL8A 3RB8A 2ZKLA 3DAYA 4IEIA 1JPNA 3EA5A 1T9GR 1T5LA 2AOXA 2FEXA 1S4MA 3QPAA 3ENWA 4MJXA 3U1BA 3QVGA 4BP8A 1GG9A 2BCSA 3B7PA 4FB4A 4YCMA 1CQIA 3DL0A 2ECKA 4PNZA 4QU5A 5AI6A 4JNKA 2EZTA 4U4AA 4TQGA 4HMPA 1C9KA 3I30X 1Y34E 4KNWA 4R1PA 1ACJA 1GKIA 2WZCA 1P1RA 2VAVA 1ZXBA 3OCUA 1Z82A 4TT8A 1O95A 2YS6A 3BMXA 1P0IA 1UJ5A 3CLUC 2B6HA 2P91A 1Q57A 4JY7A 4UASA 5J1SB 5J2TA 4P84A 1P9WA 1Z35A 2FOIA 2ATLA 1HMPA 2B1JA 1P6QA 2PRYA 2ZSUA 3ICPA 3OD5A 4J43A 5EZSA 4ECAA 2E48A 1XDUA 2I2DA 2AXEA 3CLUD 1XJWA 1TVKB 4UB2A 1VLZA 5D87A 1KRPA 2FZCA 3S5JA 3SXUA 2WJPA 1EGAA 1YZLA 1KPGA 2I6GA 1NW9B 2JJYA 3A9WA 1R18A 2HF8A 5K51A 3DMFA 2YWGA 4QGAA 5KNLA 4B3TB 1VYHA 1OUQA 5HF5A 4IILA 3RU7A 3S2FA 4KITB 2CLCX 3Q9UA 1D9XA 3OPQA 1G4HA 3I12A 1CQZA 1GN9A 3DDNA 3G8CA 1DEKA 2QYSA 3IUEA 3L2OB 1AA9A 3VGJA 1WPRA 2P6NA 3O4JA 5AYVA 4DDMA 4NOKA 1QIFA 3E61A 3ND7A 2H8KA 5EIFA 1N4DA 3PFKA 1NM5A 4CKBA 1Q21A 1YB6A 3B9BA 4A8JA 1RI2A 1DP4A 1ZQNA 1XK6A 4RH1A 3SYLA 4F2DA 3T7KA 4ND7A 1WUDA 3O38A 4XIJA 1TYZA 5CJPA 3ZZNA 1CY1A 3UQ2A 4BMZA 4CR7A 5ES4B 3MGHA 1T6NA 1I7QB 4XRHA 2BCRA 1U3DA 1PSZA 4UB3A 1ZIXA 4GR9A 5DULA 3LUCA 1W2HA 5GGYA 4A2PA 3MJRA 3EQ7A 1EUDB 1PJ3A 3LBNA 3Q7IA 3S29A 2XOKA 5DHAA 3I37X 3SGLA 4I55F 3H2HA 1YR6A 3DLBA 3PC8C 2OPBA 1PFUA 4DL2A 2WKRA 1GKLA 3MHTA 2ESRA 5ITSA 1EX9A 1OX6A 1U1IA 1QYXA 2XB2A 5HKBA 1GQFA 1QONA 2A0FA 3AEUB 2HMWA 1QTRA 1JS1X 1FDTA 3ZHCA 3ZDRA 2ZBFA 1M5TA 4ZT7A 4DNFA 2B7CA 4XEUA 2BEVB 2OV2A 1C7RA 1DOHA 4LZLA 4WLEA 2BZGA 2EGGA 3RFTA 3V4LA 4A6EA 5K2MA 3VZRA 3S27A 1D03A 5J2UB 4FBGA 4KBFA 4M0FA 3DZFA 5CLFA 2BYTA 2ZJ6A 2FH5B 3KKKA 4NHOA 3FSEA 4S1OA 5TS2A 4YD2A 3UK6A 5K4GA 1GZ7A 1NYQA 3GDFA 5EWFA 3KQYA 3Q9LA 1U3FA 4BAGA 1J2RA 5EXEA 3P9SA 3C16C 3GJYA 4AKSA 5JSFA 1KAEA 1QR6A 3CEAA 3O8OA 2BTQA 3CC8A 3VU0A 3MABA 4NLCA 1QTNA 2YXBA 4GU5A 4NE7A 5JEDA 3GG2A 1KETA 3X2EA 4C6RA 5B6JA 2IH2A 1WL8A 2JF0A 1SZPA 3GQVA 5INTA 4GECA 3PUXA 1G8MA 4I1OA 2OYYA 5EJGA 1OV4A 3ZWYA 2ZUEA 4F7DA 1WPGA 5DFAA 4PX9A 2BSAA 4WN9B 4OM8A 3I01M 4I3HA 2GEBA 1ZD5A 1SZHA 1M2NA 4NLLA 4P54A 3V4FA 1B3RA 4NU0A 5ECDA 3C2QA 3W8RA 1RRCA 1PL0A 4LS3A 4MKZA 4LE1A 4LQLA 1N2ZA 1JDJA 2P1DA 1W4RA 3S70A 1HL7A 3H1PA 4QUJA 1YZ6A 2PG3A 3KSZO 1ULZA 1XE3A 2NX2A 1BNPA 2ETVA 4B9SA 2ZULA 1E1RA 1PFQA 4MVJE 3RARA 1EVEA 3KZCA 5HQ3B 4BX0A 3BQ2A 4K5QA 3SQDA 3NOQA 4R5MA 4BDPA 4HD8A 5F21A 4JSYA 1A7KA 2POCA 4LY9A 2DGZA 3IOYA 2ZIWA 2ET6A 1UFOA 2X6TA 3UVEA 4GC6A 2UYOA 3IDSA 1HQCA 4RSHA 1UJNA 3RHFA 3RTAA 2XQKA 4JP1A 4PINA 1U94A 4KO4S 2YYYA 3DMTA 4KSCA 4RGYA 3IAEA 4MQ4A 2RI1A 5I5GA 4CL0A 3B1JA 5HFNA 4KX3A 4TUQA 5K99A 5K0LA 1P7ZA 3T1NA 2O2EA 5KFUA 1ZD9A 3AGQA 4EFLA 5C81A 5HZKA 1RC0A 4PAWA 4CT0A 2V7XA 3ZXIA 2K2QB 2Q62A 1S9DA 1YC2A 2FMQA 3FBWA 4FLEA 2FN7A 2V7UA 2ZW9A 3W4KA 1P6UA 4Y1FA 4FDMA 4BKMA 1VQ1A 4EEKA 4MWTA 1T26A 1ZUD1 2O14A 3EY9A 2VPPA 2ZAOA 2W2LD 3KOUA 3DPSA 4B4DA 2AJTA 2WHYA 4YBZA 5GJCA 4M54A 4UBBA 3IERA 3ZKAA 3Q9SA 4Q6BA 1T3NA 2Q5LA 1XLWA 1O0SA 3RRBA 4B6PA 5GZ3A 3RANA 4H18A 3BORA 3OFKA 3DQZA 3BGVA 2QB0A 3Q5DA 2CLOB 2QVCA 2DPYA 4LGMA 3TGWA 3WA7A 1TZCA 3H83A 1BVSA 3FOEC 3VX4A 4B74A 4M36A 3FAHA 5DN9A 2ORED 2I7TA 3LPMA 1WSBA 2C58A 3AINA 4M9UA 3H8WA 3SHFA 3CN7A 3SBDA 4F5NA 3OZ7A 2WP0A 4XM2A 5FUVA 3REQB 1T2CA 5ALRA 3TIIA 3WV4A 4E3WA 3TPFA 4PANA 5K0SA 4WY5A 2I8CA 1E0KA 1OLXB 4QL3A 3M8SA 2Q5QA 3KCNA 4YJ3B 4X64B 1CT9A 3GZNA 3IQZA 3U1TA 3SZ3A 2JXJA 1PDWA 4WFQA 3ZHUA 1Z25A 3RVLA 4QC2A 3GJZA 3PSAA 2Z1DA 3K1RB 1R00A 3ZH2A 4MARA 3RRYA 5K8TA 1KRXA 3D2QA 1UKCA 2C4MA 2EC5A 4GYKA 1GHTA 2VYQA 4AW9A 4M04A 1YB7A 4BQRA 2WT9A 2XIJA 4NFHA 2YMPA 1U2PA 2VNJA 1DG9A 2RHFA 3PO5A 3B70A 3BQ9A 3KUDA 3ZDYB 3BIFA 1L7DA 5JWHA 2Z04A 4F5ZA 2QMZA 5ALUA 1FQOA 2R6R1 3G5TA 4LI0A 3ANYB 3KT3A 4OSEA 3A4MA 2IX9A 3T3MB 4Y2VA 1PZMA 2PJUA 4E22A 3EMVA 4DJAA 4C4YA 2GA8A 1WEKA 3KKNA 4IO1A 2BGIA 4B4WA 2ZUCA 1B26A 3AQEA 1DHTA 5FP0A 1Z6GA 3PUKA 4M9QA 1YT3A 1ULTA 2ZK7A 3RGWS 3FD8A 4D9IA 4KDCA 2RHBA 4CIBA 3AEXA 3JPWA 1NVAA 3R5XA 2H9AA 5DSZA 4C05A 1G6HA 2XNCA 3O4VA 2WLTA 5FADA 1IUPA 4YRJA 4IJMA 1EHCA 1P7DA 3DLTA 4ZQBA 1ZQVA 3TADA 2PUBA 4DLGA 1M1YB 4QT0A 3NHSA 4B7CA 2LPMA 3PQ6A 2D0IA 1EEXB 4NPAA 4RQUA 4B2LA 2HDOA 3L7IA 4R1MA 4DLZA 2GH1A 1U6KA 2UVPB 3PGVA 3TFWA 3T3FA 1OLOA 1VIYA 3MOSA 1U48A 1U80A 4P98A 1NKCA 4BFUA 3SC3A 3K8OE 2LMRA 1OFIA 4O4JF 1PDOA 1XCBA 2P4QA 3QQPA 3R40A 4LPSA 3ZLBA 4DSKA 2P3OA 4FHDA 4UU8A 2Y1LA 1GSHA 3D6JA 2C0QA 3CU5A 2C83A 1KAGA 3HPOA 4MVJA 4DQ0A 3T3PB 4H1WA 2V7VA 1G7SA 1W88A 2ADOA 2WMOB 4IGIA 1YIDA 2JJ2D 4IDAA 1NHGA 3JZMA 4MGEA 2ZJBA 3K70B 1A4RA 2XCQA 1QP8A 2O5CA 4JN6B 5DHSA 4O5AA 1W1WA 1U9IA 3EIOA 3M4XA 3QE3A 1T1SA 3VMMA 2F1KA 2FSVA 2E4UA 1EAYA 4EZEA 1MAWA 3NRZA 2YWHA 4Q9KA 1U63A 1RR6A 4EKNB 4Y2HA 3JAKA 1EFAA 3TG8A 4X8MA 2WYHA 1Q12A 2QVXX 2W43A 1CPYA 3OPYB 1D0SA 1Q0QA 3I6BA 5AM2A 1P62B 2ZYSA 3H2JA 3BE8A 3D81A 1PR4A 1WYGA 1RJGA 3HU5A 2WSYB 4LBWA 1M6NA 3GMDA 3T5TA 6REQB 4MTCA 1XVIA 3AM5A 4JK1A 1CX9B 3EDQA 3G13A 3IHTA 2CD7A 2J3DA 5EJ4A 1LNSA 1EFHA 3SS9X 4GQAA 4NYMQ 3ZE2B 4NYIR 7ICMA 4KTTE 5AHRA 4UAUA 3BHMA 3FWKA 4I27A 5E6RB 3N7RC 3R7SA 3CF4A 1ISPA 5KFFA 3EAFA 4M0DA 4NAVA 2HLPA 2P6RA 3CP8A 3QW2A 1HXHA 1J22A 3I6ZA 1AM4D 1FRFS 3IVRA 5DNWA 3SEAA 4D3YA 5LA6B 3AG5A 2SHKA 3AVUA 1N33B 3PE3A 3RM3A 1GPMA 4MQLA 3BE5A 3KYIB 1WMAA 3G02A 3GY0A 3VHLB 4LYYA 2EZZA 3MR2A 3FZEA 2H52A 2BKAA 2ZE5A 1U2DC 2H1SA 5FI5A 2GZSA 4F2PA 1NHWA 3HEBA 5MN6A 5EHXA 1QM5A 1P1HA 2HADA 3A1CA 3N8HA 3UWDA 1P1IA 1QV9A 2HIMA 4EATA 3NC4A 2ONZA 3W6PA 2E4WA 3LLSA 3OT1A 3PIDA 3BKXA 1EWQA 2OVFA 3ZGYA 3CHYA 4CQLA 4FFVA 4NBTA 4XR4A 2DPJA 5ERGB 4B32A 1U6IA 3HO8A 1Q50A 1OXXK 4XASA 1RLMA 3D02A 4QODA 2B69A 1TW2A 3D1LA 3NORA 2B35A 2AMVA 2G08A 4CQJA 3FGOA 2PKCA 4MWEA 1N0WA 5DU2A 2XGGA 2YOFA 1BXGA 4GKJB 5CH5A 3GRAA 3U39A 1PDVA 3PMNA 3TB4A 5JATA 4MF8A 1QGOA 1S96A 1K68A 5D6NA 1ZM2A 5EPUA 1F2UB 5LYJF 5KC8A 4K0KB 2O9JA 1GGFA 2NO9A 1NXQA 4XUSA 3MINB 3N0WA 3A4VA 1S0VA 2P5YA 4I28A 5KFEA 4B9TA 1T13A 3JQCA 3SE0A 4EW2A 4P3OA 1J8YF 3R6DA 2W5UA 5J5CA 5CT6A 4FYYA 3ER6A 1XB2A 1SVUA 2Q4BA 4GMHA 1THMA 3GWGA 1XTQA 1WXEA 4NOMA 3WKEA 4GOXA 4TXLA 3QVSA 3TINA 4IIGA 3ESZA 3GR6A 4QOIA 3W8NA 4YHHB 4H27A 4FO6A 1WZNA 3WDKA 4N3NA 1QU2A 3DS8A 1H38A 1RAEA 2XCSB 1ECJA 1P1CA 4ZZ1A 3N8DA 5E7MA 3WB2A 4BUJA 5IS2A 2PKQO 4MTLA 1LPNA 1OWMA 4WFIA 2E87A 2GTPA 1ECBA 1VSBA 2P4HX 1XTSA 3G0HA 2NADA 1DX6A 1PK1B 2YOHA 4Q9IA 4EA7A 1OLSA 1OMOA 4QO8A 2TSYB 3L8MA 2Z56A 4GI7A 2JEGA 3V97A 1L7NA 1IY1A 3KEQA 2R4UA 2IE8A 4K7JA 2VZEA 3O0FA 1CUEA 4HLUA 3LBFA 5J2HA 2GZRA 1G3QA 3S7TA 1UMDB 1WCLA 5I5EA 3ORFA 4LSMA 2YW9A 4MRNA 3VZQA 1NVVR 4HVLA 4MGHA 1A9OA 2I9KA 2OEHA 2W37A 5A7FA 4JMPA 1MG0A 4QM7A 2H4HA 5K01A 3U6KA 2O06A 4RKYA 8ICWA 9LDTA 2C92A 4OP1A 5AESA 1LJLA 1U45A 2D1YA 2FR8C 1N5IA 3K6RA 4HL6A 2YICA 5KFIA 3I1IA 2FB9A 3TRDA 1ZM4A 3R3WA 4YBRA 4TVKA 4DC9A 3IBCA 3QMVA 1GQYA 1K6IA 2DPLA 3P9RA 3R3SA 1ECLA 2B98A 2CHVA 5EQJB 3L05A 1DAMA 1QOQB 4M1EA 3RW9A 3RRJA 1NVXQ 6ADHA 2LDXA 1G5TA 1YQEA 5ESXA 2Y4OA 5DXFA 3BS4A 2YFQA 3HA5A 3KR0A 3PQDA 3W04A 2IS2A 4ADSG 1MAAA 2PZAA 4ITUA 5E4JA 5CA0A 2C94A 2G9VA 1K6XA 3LPCA 1H4VB 5KG5A 3UWPA 3VR1A 1E8DA 2X9QA 3U7QA 2P35A 1N6IA 3LE8A 1Y8RA 4NZZA 1IZYA 3NXSA 4ITVA 4D74A 1S0MA 2FMHA 4BNDA 1PK9A 4EK9A 1I4EB 4ENSA 2GBLC 4QXQA 4EYIB 3CJRA 1LFDB 1HSOA 2G17A 2IYLD 3LX8A 2H0RA 5C8ZA 1FMFA 4PHGA 4B6SA 1SCQA 2VF2A 4RXTA 4P0TA 1CUWA 3GAZA 4L3WA 4HAUA 4YGYA 3U0BA 4OI0A 1J8QA 3F1LA 3O8QB 2P6PA 4L8WB 4C9BA 5AM5A 3NHRA 1GCUA 1K86A 1LVGA 2NN3C 2RHOA 1TVEA 2CLIB 4JEUA 4I5FA 1YE3A 2IPNA 4K9PA 3DXZA 3GLRA 2D0OB 2HJGA 1O5OA 5EGNA 4OGLA 4PXAA 3NNDA 1E3IA 3D6VA 3LHSA 1U5AA 4FYPA 2ZUTA 1C8KA 3PW5A 1KJNA 2X9GA 1GYQA 3E3MA 3ESDA 1QXSA 2Q0XA 3CX4A 1OZHA 3SLGA 3WADA 2QNBA 4CETA 2PZFA 3GDOA 3WK9A 2O2IA 4MV0A 4I9GA 1WMFA 3HXPA 4Z3DA 2WTXA 1SD5A 4QXRA 1XC9A 3HR7A 3SYTA 3UJPA 4EH1A 2JLZA 1WXQA 2EDUA 1FVOA 1TEZA 4HS9A 4Z0HO 3U4CA 2O8DA 3L49A 3DM5A 1RXEA 1USUA 4HEHA 3SAFA 3VR6H 4BX8A 3D6UA 4ZDWA 3AV3A 1QIHA 2AKAB 3F2BA 1MZPA 1YULA 4P0QB 1CS0A 1OGYA 1TOAA 1DELA 1VKJA 3FYUA 3GCDA 1EUZA 2IUEA 4MS4B 1PVPA 1VBFA 2G5CA 3ROQA 3DMPA 1DUSA 4EEZA 1O57A 2R7MA 3SZGA 3PXBA 4EBFA 1FLVA 2AX4A 3SEFA 3KEFA 4KGVA 3UHJA 4Y2SA 1CP3A 3COVA 1NDHA 2BBWA 3T5HA 4YO7A 1J1UA 4M2LA 5GQSA 2Q4EA 2XAAA 4YJGA 5JSHA 4NRDA 2LNDA 3HUTA 1VRWA 4MWCA 4RQ1A 4D5GA 1FX1A 3DMNA 3TMKA 3ZCVA 1UBGA 4DV0B 5KAIU 3W9UA 5FL3A 1Y8RB 3RB0A 2PX0A 3LDHA 3GEIA 3OX1A 4M0MA 3OZFA 3EPKA 2WAMA 2IYVA 2PEZA 1QTIA 3PNKA 4G4JA 3FTFA 4P32A 2D74A 1A2QA 3AHJA 3K53A 3R6LA 4R2KA 1T34A 2GARA 5DX0A 4CM9A 3GO4A 3LY5A 3IP5A 1EVZA 4UZFA 2HXSA 4ROSA 2RGWA 2YZKA 4X45A 4EKGA 1Y88A 2QGZA 3LGSA 2ODTX 2OE2A 2ZJ2A 3OCXA 4W9NA 1LK5A 1MEJA 1U8CB 3I32A 4M9LA 1NF8A 2J7KA 1TJ3A 2P8SA 4H17A 2X9NA 4N7JA 1YAJA 2XKAA 3DUWA 4CG1A 1L4KA 3NPAA 1TK3A 2FE9A 4B81A 1A27A 3FNHA 1NJ2A 3BX1A 2YUIA 3GC6A 3ET5A 3VTKA 5KWEA 4YG2A 4ZPJA 4KREA 4ZN6A 3KVOA 4PTZA 1WXDA 3MR6A 4BNTA 4UTXA 4IXDA 3TLJA 1R4AA 4XQEA 1NVGA 2Q1XA 4MR7A 5J2GA 1QANA 5EHQA 4UNRA 4KUGA 4J9SA 3DUFA 1L3UA 5K8VA 2GCPA 1E69A 2F62A 1OU0A 2VANA 1PT5A 2HMTA 2X22A 4FOTA 4NE9A 4N39A 5CM2Z 3BCUA 5TGDA 5LQUA 4MLZA 3UCFA 1NKSA 2BBTA 6Q21A 1QH1B 3PZRA 3T6KA 3W5CA 2CW5A 1G8HA 3G17A 3TQSA 4TT3D 3E3LA 2NO6A 3LGAA 2HHTA 1UEJA 4WL0A 1SQSA 3PHCA 4LGVA 3ZI7A 3TZHA 4QIWF 3HB0A 2AGPA 2EL9A 3JQAB 4EMUA 1M6WA 1PK1A 2UUOA 3PW4A 5BV1A 2VP6A 1WU8A 2BHSA 1YJ5A 4FYIA 4EY7A 3MIZA 1E6LA 4H15A 2IPXA 1DT5A 4RA9B 2H3HA 1KO1A 5ALHA 3FRJA 5TNXA 4TUYA 1YQXA 1YZKA 1R88A 2Y93A 3OHMA 1U7HA 3C28A 4MQBA 4DADA 4LVNA 3E8SA 3O6VA 3O90A 4F46A 2HHVA 2E55A 1M2OB 3PGMA 3PWTA 5FTLA 1EWRA 3SQXA 1JN3A 2Q9BA 1C1YA 2QRPA 2XYHA 3DPUA 2DLNA 1JZQA 3F5AA 1E9VA 1P4SA 2Q3CA 2JLSA 5EPOA 4C03A 3NNSA 3T38A 5HYVA 1X87A 1K0FA 2Q6IA 3RUCA 2GPBA 3G9TA 3IE0A 3N39C 1FJXA 3RHSA 5CXUA 1ULSA 1TRHA 2RHGB 3EAQA 3WYDA 3MTGA 1E6MA 2GASA 4RK0A 4W4TA 5GONB 3MPOA 4LSZA 4S2EA 2YNMA 3ZX5A 2NSHA 3IBYA 3AESB 5B64A 1YUBA 5KKNB 1J49A 1WZUA 4P4UA 1D2CA 2WM9B 3AESA 3MINA 4RJKA 4HFJA 1L5NA 3F6SA 1SRQA 2O2ZA 2FZGA 2QZ9A 3AX6A 4RT2A 4HVCA 4B76A 4JJGA 4NZNA 1BXGB 1JIUA 2ASEA 1M9NA 5ITVA 3KSDO 2HO5A 1U90A 2OXEA 4HB2A 1WCV1 3N1UA 4OATA 5AW4A 1P7YA 1TJYA 1C41A 1WVGA 5DP1A 2QW8A 1W4CA 4QDKA 1ZJ5A 1QCDA 3L1UA 3PD7A 3PXGA 5HKKA 4KMMA 1QHYA 1YFJA 3RK0A 2YV2A 3WXMA 1AQUA 4XTCS 4CEJB 3LDUA 4LRWA 4PYKA 4X24A 1UCVA 4EVIA 4NX2A 1E1DA 1Q0LA 2H57A 4EGSA 4NEQA 3A3OA 2ATCA 4GPBA 4FFNA 4Q9AA 3B85A 5IKPA 1X1EA 1ED1A 5IASA 4YFKA 4O25A 3DBRA 1PR2A 1BVHA 4ZZIA 3T4EA 4YLGA 2WF7A 4JSRA 3HJHA 1KRWA 2WUGA 2A9VA 4JUIA 2IOFK 1K5HA 4ECQA 3QZ7A 1XYGA 1ZXLA 3GUYA 3H2IA 1KP3A 1XDGA 2QJFA 3RV4A 4F4WA 2RI0A 4FM9A 4H6PA 3QVLA 3QLUC 2Y66A 4U8HA 3RS9A 1U0BB 3HILA 1FYDA 2A0KA 1OWOA 2A5LA 1HDIA 3PXUA 4LNAA 2Y1FA 4KLHA 3M89A 4N6GA 3PHJA 5E6RA 2VJ5A 1ORHA 1YNSA 3O84A 3P4YA 4MR7B 2AD5A 3HBJA 1XV5A 4OBWA 2FPPB 4W8HA 2DLCX 5AKZA 3AF0A 1I7SB 1H3EA 4BQOA 3THXA 2H2GA 2YYAA 3KPVA 5DNEA 4DJTA 1BDBA 3EK2A 4EENA 3OE5A 4L0CA 1GV1A 3RC8A 1OFGA 3ISBA 2D1SA 4QRDA 5BN4B 2OPHA 3T1OA 1KVUA 3GNTA 3HJUA 4BRUA 1L1QA 4N7RA 4MDYA 1BCRA 5JAQA 4RV9A 3EGCA 1M2WA 1UBUS 3VYVA 4HNVA 3TL2A 1RZRD 3LZCA 4XRGA 1PZHA 3MTBA 2Q5FA 2ZYWX 2XB4A 4UJ3A 5HFJA 1H1TA 2CCKA 4ZT3A 4A26A 4NCKA 4BFZA 1N5JA 2NUPB 4FDUA 4MAAA 1PTJC 5TGTA 5HCUA 2ZR8A 5AW8A 4JHLA 2N75A 3KWFA 2CNNA 5CA1A 5DVZA 1I01A 3CCFA 3V8NA 2GXAA 4A92A 3S1SA 2FU5C 3QPBA 3W5AA 4YJGB 4XJXA 1G8JA 2PBFA 4AP6A 1NJ6A 4GICA 1XGKA 4JKIA 3KP1A 3M5WA 1NKEA 4EOGA 2VTBB 2Z1MA 5DM1A 2HSJA 2FUG1 1BDJA 3NHKA 3GLGA 3KKLA 1O3YA 2HOIA 2G82A 4TROA 5EHGA 2ZXHA 1V8ZA 2QI9F 3EGDB 4GVLA 5HP4A 1LV7A 2XDYA 4NC9A 4XR9A 5KDOA 3SENA 2H4ZA 1X3SA 2HNKA 4JEMA 4RHUA 1V0JA 4IDFA 4RVDA 4DSJA 1N5MA 4D0SA 2C88A 2SNIE 2ZWOA 2A84A 4JBLA 4JR2A 4WCDA 4FBLA 1X9HA 5DX1A 1TUGA 2BFCB 2EAPA 1SBZA 3HB7A 2PS0A 1K5PA 2GEVA 5KSPA 5CEFA 5J4KA 4U1RA 2IYAA 2AE1A 3DFFA 1SIOA 4A9AA 3ER9A 2X8JA 2P9GA 1HT0A 1SOVA 3HSKA 3JD1A 3I9V1 1V3QE 4B3HA 1RAIA 2Z2ZA 5L9AA 3MILA 5CA7A 1WUJS 2BM1A 2VP0A 1P4JA 2Y1OA 1Q0ZA 4JX8A 1U4OA 2NZXA 4XYEA 4AJ9A 4F6CA 1DAEA 3PKJA 1FRQA 4R2JA 1B0XA 1PIWA 2C31A 2B4RO 1I7LA 2YCLA 1DBWA 1M3SA 3IKMB 4ICIA 2VDJA 3WYAA 3VBEA 1Z12A 1ZH6A 1ZH0A 1F9AA 2XMQA 4MCAA 3CVOA 4ZXPA 4QZFA 5JAZA 5CYFA 4Z7OB 3DGEC 1TYDE 2VKTA 3PYLA 4FXOA 1WZ2A 3JAWB 3W4JA 1ETUA 1M33A 2M98A 5CDGA 5I7OA 1WY5A 5D5PA 5I7AA 1WB9A 4HJXA 1KQOA 2DFTA 5B5SA 2F1OA 4TL6A 3A9CA 3D4OA 5KI6A 3KS9A 2QN9A 1YTLA 5GADl 4R1SA 4ZI3A 2R8BA 4JJKA 3FDXA 5DASA 3A28A 2OBFA 1I3LA 1NVDA 5IH7A 3LC1O 5FPSA 1T3ZA 2BC9A 5BQOA 1TMKA 3CF4G 4LJKA 4N8EA 4XZ3A 4MYUA 4XKJA 2WIBA 1DG3A 4NSNA 1J5XA 1IBRA 1LBEA 4XA8A 4ETIA 1MPTA 1M7GA 4MQMA 3KJGA 4BNGA 4DS4A 4LZWA 5FO1A 3QFSA 4B3BA 2KJ8A 3SFZA 5CA0B 4QTYA 2JGDB 2W2MA 3L1JA 1ZY2A 1YB4A 3U3JA 5KC9A 1Q2UA 3WP1B 2AC7A 5KU7A 5JMOA 1E99A 1Q5PA 2ZI6A 2NO7A 5I9NA 3ER8A 2H7YA 2ODBA 1AF4A 1FU4A 3NAMA 2WD7B 4PAMA 5DIZA 2IGTA 9ICRA 1ONOA 3ILHA 1Z06A 2FMUA 2P30A 4CLXA 4EI9A 4MS3A 1EZ1A 4LJ5A 4U2KA 5DW3A 4ACBA 1SUPA 1SIBE 1UBCA 1IOWA 1MVNA 2AZMA 3W3ZB 4U9UA 3ZJ5A 5D3ZA 1FXWA 3R9WA 3ST7A 2V55B 2QG6A 2FWBA 2JFNA 3CRZA 3FYDA 4HH3C 4XE5A 1FSGA 3QHQA 4C3VA 1XL0A 3QA3E 4MB0A 5LUBA 4DY6A 3LXUX 4M9ZA 5EYPB 2NIPA 4DA4A 2JIRA 5IBRA 1OU4A 3QBEA 1G0NA 5KJCA 4DNXA 1TW3A 3TANA 4CDGA 1A4UA 1BRTA 4Y2QA 1FBTA 3N7TA 4XEHA 4AURA 1FS4A 2DMRA 3EFOB 1SGWA 4WNYA 4Y67A 3PNCA 8ADHA 4JCCA 4TLCA 5G53C 1DBQA 2Q6LA 3C3DA 3PHBE 2O7NA 4WSOA 2DFDA 3X2SA 2NGRA 5JI3E 1N63A 4C7YA 3JALA 1QSGA 3GCZA 4WGFA 3ZJUA 1GGNA 1OTYA 5IDWA 3GFSA 1CY7A 2W71A 3BUSA 4KIUA 1LPSA 2ZRGA 4IRMA 4M1TA 1YBFA 2B94A 3LA6A 1ZN2A 3MTAA 4XQGA 4K40A 4TPKA 3M1IA 3V9PA 5BN5A 2A4MA 2YZNA 5D4BA 4QTZA 3LBYA 4LECA 3D64A 1LW6E 4M1YA 5FOSA 3ICXA 1S3SA 4GZ6A 2PSEA 1N2XA 2R65A 3V7YA 1VCIA 3EXIB 1JE0A 3MUEA 4MQEA 3JQBA 3IV9A 3L7JA 2W93A 4P31A 4W6QA 3UKDA 4BECA 3AC0A 4ARCA 1ECCA 1C3OA 2TRSB 3ZXUB 4QBFA 4AJKA 4N0DA 3L6OO 5KHOC 5FUYA 1Y7PA 1UBRS 4O3PA 2WFMA 3OLWA 4AXXA 2VHUA 1PJLA 1SKYE 2JI8A 3V8BA 4QQKA 1F2UA 3PQ5A 2R11A 3IGFA 3QPVA 1FFBA 1JQEA 3E1SA 1NI4A 2YVAA 3B7GA 3OH8A 3PEWA 3OE7A 2MT9A 3C3XA 3T54A 4OKIA 1UXKA 2H8GA 2J4FA 3A9RA 2WU3A 5DEIA 4KXUA 5EEGA 4MFFA 5FOXA 3O26A 3VC8A 5KFQA 4IMJB 4KTVE 2ZUVA 3R3YA 2IY9A 1DAPA 1M34E 3RBDA 1RQPA 4XQ9A 1TO6A 4I81A 3DD1A 3LIPA 1OVMA 1NDQA 2OHXA 4UAJA 3LU1A 3U9LA 1NF9A 3UAYA 5B7PA 5K3FB 1KYVA 5D1HA 2VYVD 2GHQA 3C1AA 4FMDF 4UMEA 4W9NC 3DA8A 5J2UA 1V47A 2GWHA 2TMGA 2IYNA 2Z57A 3O4HA 3V4RA 3BQ7A 4D3SA 4K8RB 1HNXB 2NO5A 3NRWA 1FPQA 2W48A 4HXFB 2QDXA 3ADOA 3I6YA 3TFOA 5IIJA 4AYBC 1VJ0A 4DKXA 5CG2A 3LKBA 1DOAA 5J59A 2FSUA 2L18A 3L1IA 1MXHA 1BOFA 1F6BA 2Q27A 4M22A 3J81k 3B6EA 2J9FA 4UMFA 1COKA 5DHPA 3GVXA 5GV7A 1QO7A 1ZRNA 2QARA 5LP6A 4A1OA 3KKZA 3CLTD 3N2GB 2D8CA 1QKJA 1EE2A 5KAFU 2X8AA 4OYYA 4C30A 1KXZA 3WMWA 3FOAA 4AROA 8ICJA 4FGZA 2WICA 2FDRA 4WRRA 3G1TA 3G6YA 3MXTA 5H1YA 2A9QA 5L95A 4O29A 5F23A 3PE6A 3KVYA 3UPTA 2C61A 1IIRA 4Z9BA 2A58A 3NJ4A 4H0FA 4N6NA 1TLLA 8OHMA 5JALA 3HWX1 4F85A 2Q1YA 4UEJA 4YCXA 2ZG6A 2H1FA 2MSWA 2PE5A 3PCXA 3GLHA 1NXXA 2EAOA 3PW0A 3C3BA 4PX2A 3IESA 2OGUA 2VJLA 2XHEA 4RIFA 5H7XA 4B8YA 3VU3A 3JD2A 3VO8A 1YR1A 3B3AA