3UM9A

Crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
225
structure length
225
Chain Sequence
GMHAIKAVVFDLYGTLYDVYSVRTSCERIFPGQGEMVSKMWRQKQLEYTWMRTLMGQYQDFESATLDALRYTCGSLGLALDADGEAHLCSEYLSLTPFADVPQALQQLRAAGLKTAILSNGSRHSIRQVVGNSGLTNSFDHLISVDEVRLFKPHQKVYELAMDTLHLGESEILFVSCNSWDATGAKYFGYPVCWINRSNGVFDQLGVVPDIVVSDVGVLASRFSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase, type II
publication title Structural adaptations of L-2-haloacid dehalogenases that enable hydrolytic defluorination
rcsb
source organism Polaromonas sp. js666
molecule tags Hydrolase
total genus 88
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3um9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3um9A01
4DFDA 3EPRA 2HF2A 4HGPA 2I55A 3BA6A 5AVYA 2G1AA 1Q92A 1YS9A 2FPRA 3RF6A 1NRWA 2CN1A 5ALOA 1EK2A 5ALGA 2WFAA 2VKQA 3OCWA 5AI8A 3PGVA 4I9GA 4Y2JA 2AUTA 2W43A 2FI1A 4Y2RA 5ALPA 1TA0A 2WF7A 2FDRA 2HCFA 4CNQA 4G9BA 5T41A 2YJ5A 1X42A 3NRJA 1Z4OA 2P9JA 2NO4A 4MWOA 4PNHA 4CF4A 1U2TA 3A1DA 2YFYA 1WR8A 1ZD3A 1S2OA 1YDFA 2RB5A 3MMZA 3PGLA 2YJ6A 3FPSA 2HX1A 3L8EA 3W5CA 1LTQA 1Z4JA 4GIBA 2HDOA 3OCVA 2RARA 3QU2A 1RMTA 2WHEA 2WF8A 2GMWA 3FVVA 3MPOA 3M1YA 3U7HB 4UATA 3OCUA 2GO7A 1ZD5A 4IG4A 3DNPA 3NASA 3L8GA 5AW6A 5ALQA 3NIWA 2CFRA 4EEKA 4EZEA 3UMBA 4BKMA 4Y2SA 3R09A 2NYVA 4UMEA 4DWOA 3EF1A 4BNDB 5AKKA 1S8OA 5AM1A 4KX5A 4UM7A 5AKIA 2FPUA 2FPXA 5ALZA 3P96A 2I34A 4C4TA 1Z4QA 5A3QA 3CZ4A 3FZQA 2R8XA 4H1WA 3UMGA 4DW8A 3B8EA 1TJ5A 5AM2A 4UW9A 1ZOLA 3D6JA 2G06A 2R8YA 3GYGA 5AW0A 2C4NA 3L1VA 1RMQA 1AQ6A 4OCZA 2OM6A 4CF5A 2ZXEA 5AIBA 3KDPA 3F9RA 1WVIA 2JAUA 2ODAA 4BX3A 4XOUA 4UMFA 3WGUA 5AW9A 1YV9A 3U7FB 3QU7A 3WKCA 2D2VA 1T5TA 2IA5A 3ONNA 4Y2TA 4Y2YA 1LVHA 2FEAA 3U7GA 3AR4A 1RLMA 2HO4A 2R8EA 4L57A 1N9KA 3AR2A 3W5DA 3N8GA 2OA0A 4JDPA 3WK5A 3QU5A 2GHQA 1U7OA 2P69A 3I76A 5AW7A 4Y2QA 3BWVA 2ZBGA 4QJBA 2WF5A 4KNVA 2WF9A 3A3YA 3U7EB 5ALXA 4UAVA 2MU2A 3QUQA 4CF3A 2ZBDA 3L0CA 5AVSA 5JJBA 3OPXA 3ZWKA 5ALFA 1U02A 3WK9A 1VJRA 3R4CA 2IYEA 5AKYA 5ALUA 3DDHA 1Z4IA 2IOHA 5ALMA 5AIAA 3N5KA 3ZI4A 4UU1A 1FEZA 5AM4A 5ALHA 1L8LA 5AM5A 4BX2A 2G08A 3A1EA 2PR7A 1JUDA 1YJ5A 2YMPA 3OCXA 1O03A 2FPSA 2ZBEA 2PQ0A 1L7OA 2HI0A 2ZOSA 3L5KA 1Z4NA 3ED5A 3R9KA 1L6RA 3KD3A 4C4RA 4UAUA 4BBJA 3QUBA 3QLEA 1ZJJA 3ZWDA 3SLRA 2R8ZA 4YH1A 4UM5A 5AESA 4YIKA 1RKQA 1RMYA 3L0BA 4XE5A 4AS2A 4EENA 5IS2A 4FYPA 2ZG6A 2HSZA 3I6BA 1KYTA 5AVWA 3AR9A 5AKGA 2YMQA 1RQLA 1TE2A 1TJ3A 4XQ0A 2YN4A 3QX7A 4OHFA 2RAVA 3SD7A 5AI6A 2BDEA 4NFLA 4B6JA 1CR6A 4YCNA 2OYCA 1RQNA 3L8FA 2FUCA 3ZUPA 5AVVA 5AI0A 1YNSA 2B30A 2DQSA 2B82A 5AVUA 1XPJA 1QQ7A 3OTQA 3M9LA 1IWOA 3U19A 4KNWA 3HLTA 1XP5A 1EK1A 1RDFA 4J2TA 4FE3A 5ALEA 1RLOA 3QGMA 1YMQA 5IT0A 1Q91A 5E0OA 3AR5A 3NUQA 3NALA 4FFDA 3E84A 3WKEA 1RLTA 4HGOA 1CQZA 2BDUA 2HEGA 3AR8A 2MU1A 2AMYA 1Z4KA 4EELA 4HYTA 2B8EA 4KN8A 2GFHA 4HGNA 2B1RA 3KOOA 2NO5A 4NV0A 4O8CA 5ALYA 1L8OA 2G0AA 4YGYA 5FP0A 1Z4MA 2C8KA 4NAVA 2W11A 5AVZA 1NF2A 5AW1A 2P27A 2JAWA 1J8DA 4Y2UA 3E81A 3A1CA 3SHQA 3QU4A 2O9JA 5ALRA 4L6CA 1RKVA 2JGAA 4UASA 5AW8A 4CE6A 1QQ6A 1Z88A 4BEVA 1VFPA 4BX0A 4NABA 3W5AA 4ZEVA 3QUTA 1SWVA 2I7DA 3ZX5A 4ZEXA 2YJ4A 3UM9A 3U13A 1O08A 3S6JA 4UMDA 5ALJA 3QU9A 3SKYA 4L6AA 4Y2XA 3SKXA 2AGVA 3ZVNA 3UMCA 5AM3A 1Y8AA 2WM8A 1J97A 2P11A 5AKLA 3ET5A 3QNMA 3N1UA 3WK7A 3KZXA 5AM0A 3E8MA 3OCYA 4I9FA 4DCCA 1VJ5A 2O2XA 4XPZA 3L7YA 2OBBA 3WKBA 2YJ3A 4ZEWA 4YIHA 3FPBA 1U2SA 1L7MA 2EAUA 2Q4TA 3WKAA 3DAOA 4F71A 4AP9A 3SMVA 2IOFK 3WK6A 5AW2A 2W4MA 3I28A 1QYIA 2C9MA 2MSNA 4UU0A 4OD0A 3WK8A 4BNDA 5AK6A 5ALNA 3ZVLA 4E88A 2ZBFA 4NWIA 5AKHA 4C4SA 1MH9A 2QYHA 3WK4A 2JAOA 5ALLA 3HYCA 1ZD2P 1PW5A 4KYTA 5AKXA 4J03A 1Z5GA 2FPWA 3DV9A 5AVRA 3N07A 1RRCA 4EX7A 2G07A 4MUMA 2GHTA 2CFSA 5AVTA 5IT4A 4QQFA 5AK3A 2HOQA 5AKEA 4KX3A 1ZRNA 2WF6A 3ESRA 3ZTWA 2EATA 3ZX4A 3AR6A 3IRUA 4F72A 4IFTA 4HGQA 5A3SA 5AHXA 3N28A 3J7TA 3K1ZA 3MC1A 2YMMA 4EX6A 2HF7A 2G09A 1SU4A 2YY6A 3KC2A 2Q4RA 2BY4A 1ZRMA 3AR7A 2YBDA 3EWIA 4YCMA 1QH9A 5AKJA 5AK5A 3ZVMA 3PDWA 3QXGA 5AW3A 4JB3A 3NANA 3PCTA 2PKEA 5ALDA 3NAMA 2G80A 4OFZA 4RETA 5AKZA 1T5SA 5AW4A 5AI9A 4AS3A 5AVXA 1WZCA 1RC8A 1L7PA 3IB6A 1NNLA 5ALIA 5AW5A 2X4DA 3TLMA 5AI4A 3AR3A 2EARA 4Y3UA 2I6XA 2I33A 2C88A 2B8JA 2AH5A 4BEWA 5AK4A 3I1YA 3OCZA 1QQ5A 2IOFA 1ZD4A 5ALKA 5ALWA 1T9ZA 3IJ5A 4HAIA 1SWWA 3VAYA 1XVIA 3EF0A 4GXTA 2RBKA 4RESA 3W5BA 2CFTA 5AVQA 4YCLA 1WPGA 3RFUA 3CNHA 1U7PA 2B1QA 3ZU6A 5ALTA 5ALSA 3QUCA 1TJ4A 2FUEA 2YMLA 3WKDA 1L7NA 5AI5A 4Y2VA 3L8HA 1K1EA 5ALVA 3U26A 3B9RA 2QLTA 2I54A 3SF0A 3L0YA 3FM9A 1RPZA 3QYPA 3ET4A 3ZTYA 1Z4PX 2JARA 3FGOA 1F5SA 4BYGA 2C8LA 2HHLA 4HGRA 4UARA 4UMVA 3ZW7A 3KBBA 2B0CA 1Z5UA 2Q5EA 3L1UA 4Y2PA 3MN1A 5A3RA 5AICA 3E58A 1Z4LA 1RKUA 1N8NA 3ESQA 3B9BA 4G63A 1ZS9A 3WGVA
chains in the Genus database with same CATH superfamily
1G38A 2Z8ZA 1XZCA 3CURA 2KVCA 3OIWA 2OHOA 2R6CA 3V33A 2ZBQA 2L18A 3LVBA 3G9QA 4L28A 4ZT6A 4EJFA 1TYEB 1Z8FA 4WCVA 1BO6A 5DU2A 8ICNA 2AKYA 1OA0A 3KQPA 1NK8A 5T41A 1Q7CA 3UA3A 4RDHA 1U1DA 1I3KA 1E0KA 4TOIA 4DIFA 1EDBA 2PQ2A 3ZD8A 1FSSA 1E79A 2R86A 4GYYA 3NT5A 1BE0A 5BNZA 4NZYA 3R0XA 4Q93A 4MJLA 4DBZA 1QS0A 2CFRA 3T7KA 3M6KA 2QL5A 3U0BA 6PFKA 3DEAA 1I7NA 5A6VA 5H3HA 3SR0A 2HHAA 2F1KA 2NVWA 4ZU3A 1YR6A 4D8WA 8ICTA 1YRHA 3NR2A 1VPLA 5A3QA 1BKYA 2YZ2A 4Z51A 1K5HA 1JSZA 4EGAA 3RPEA 3EPIA 4HKTA 3NOVA 2YQZA 3Q7RA 4RTQA 2C4WA 4GOKA 8MHTA 2VSFA 1PT6A 2CF6A 1X0XA 2HNKA 1W94A 3I8OA 4CKWA 3K70C 4YR2A 4WL0A 1O95D 3RU3A 8ICCA 3DYBA 2IV2X 1GQFA 4F5EA 3EVCA 4J16A 1QE5A 3DVLA 1QRSA 2VYNA 1GTG1 1SUEA 2R6ZA 3P2JA 16PKA 3E2EA 3RADC 4B9LA 2BKVA 1T1SA 1J49A 1C0KA 1WEHA 4HVTA 4K3VA 1E9RA 4FOPA 2ZT5A 3IL2A 2JDID 4HOYA 3HXPA 4GBGA 4HH3C 2A7XA 2M9NA 4KFUA 3PFWO 1C81A 4ZDKA 3T0GA 5TARA 3MTDA 1ZJ6A 5A3JA 5CGZA 1U9ZA 2IYXA 2EZUA 4UHDA 3O93A 3E9EA 4XM1A 4I5IA 2XMBA 3CVVA 4OHYA 4N47A 5J2BA 1CZUA 1E2FA 1QO9A 4NOJA 3G5TA 1LQ2A 1GNQA 3C4VA 2O59A 4QOEA 5BQPA 2QTAA 3DEEA 3A1NA 4D46A 4JVNA 3TGPA 4B6SA 4FMBB 3NJ4A 1B0XA 2R1TA 4MUGA 4RMGA 1PTJC 3KOXA 3GD7A 1ZCFA 1M0EA 2J87A 2JFHA 3VR6A 4MV7A 3Q7EA 2FN7A 4B31A 4C04A 3GVIA 4RFLA 5BWCA 3V34A 3H11A 1QS0B 1RYZA 2XZLA 9MHTA 1O9HA 4OUDA 2HJ9A 4UMDA 2CNBA 4HWOA 3A4VA 2HQOA 4DC0A 3R76A 4JD5A 2O5RA 1XQVA 2YJ3A 2C96A 1DX9A 3C3XA 5AJXA 3LC2O 4JNCA 1F0KA 1R0BA 1Q50A 3HZHA 4CKWB 2VNKA 3V4OA 5AOVA 1I7LA 1NE2A 3OOJA 3KX2A 1GGNA 4L27A 1CY7A 3CMMA 3OQNA 1WV1A 2GD2A 4G4SO 1MNAA 3IPYA 3I42A 1RKXA 2QE7A 4WESA 3DAPA 2OC4A 1U04A 4MW4A 5AMXA 4IILA 4OM8A 3O26A 4BFTA 3R0JA 4U6NA 3E3OA 3A6JA 3U9TA 1CEXA 3I58A 4JASB 5E7JA 5TGDA 2AI3A 2LZ0A 1R12A 3NVAA 4HYQA 4JLNA 1E3JA 1UMCA 5DLYA 4ECYA 3GOHA 2VSYA 1AUXA 3HJRA 3N2EA 2XADA 4PE5B 3BWCA 2QZZA 4LNHA 4W1QA 3SS9X 3BBPA 3VX3A 4DR3B 3SJAA 3L0ZA 2ISPA 5I4IA 5HIIA 3EMBA 1GLNA 1U5BA 2GBIA 3CINA 4W5WA 2IUTA 2XNSA 3PSIA 4BX8A 1NT4A 1W7AA 4NULA 2JI8A 2PZAA 3U0VA 2A3RA 5IEJA 2E0IA 1TKAA 1TXGA 2BR3A 1UP4A 2R1TB 5K01A 3QX3A 2K4MA 2ZAOA 3MRTA 2Z08A 4AJ4A 2D1TA 1GKYA 4JJ8A 2IK8A 4M46A 4RQ6A 1EP9A 1SHZA 2Q07A 2BKLA 4PLGA 2Y9TA 1XTUA 1O94D 5DM2A 1QP4A 2G1AA 4P4SA 2E2WA 3LU1A 3KQUA 3MA0A 2O06A 3H11B 2K89A 1BVUA 4F8EA 3QNUA 3DW1X 4HLDA 3IQFA 1VYVA 3NEJA 3WNVA 4OUDB 3KKEA 1P7DA 3C39A 1VRCA 1EX7A 4V0RA 3VC7A 3ZE8A 4GKVA 3HU5A 4GNRA 1K86A 1Z7EA 1FDOA 2ZI5A 1LNSA 3AYXB 1G8FA 3M9OB 1EP1B 4PLCA 1YDFA 5H82A 1WPRA 1R18A 3H3FA 4G0QA 4RLHA 1PRYA 1H2EA 4P3OA 2QAIA 5K0BA 3LGAA 2DFDA 1P77A 2W6PA 1FUUA 3BICA 4B4UA 4RHEA 2P91A 3MS2A 1IY8A 1E2NA 4AFNA 2XMQA 2VNIA 4BN5A 5CB4A 4K87A 3VDMA 4KO4S 4PHGA 1DRJA 4WESB 1G60A 4U7HA 4E13A 4U8GA 1VMEA 2HQ1A 4MPTA 3PFNA 4JLUA 1QMGA 4X1YA 3K35A 4KKVA 2CXNA 4GPIB 5C32A 4YP0A 3FWZA 5L4LA 1ZU4A 2KFZA 5CCXA 2Q46A 5FUWA 3VR4H 2R8EA 3GPIA 1QIHA 4GXQA 4TMKA 2IBKA 3QU5A 1UMCB 3J7AC 2YIMA 2B1GA 2KJQA 1VHLA 2ZBDA 2HO5A 1PJAA 2E1FA 5KNIA 4X41A 1AGNA 4AN0A 2IYVA 5AIAA 3GV7B 3PW7A 4MV1A 1G5RA 4RGBA 4YFKA 2NSDA 2BZ1A 4PYMA 2BM0A 2XGGA 4F9TA 4MGYR 2EEZA 3CO0S 4DC9A 4G5YA 2IOYA 4ETIA 5SYNA 5LU9A 4A0GA 2D8CA 3FVRA 3F9CA 3VNUA 1PX0A 4AJHA 3I6BA 3LL7A 2Y66A 4GI1A 1YJQA 4Q9DA 4N0PA 4DS4A 1YZHA 3AMZA 3ALRA 2WWHA 4HAYA 5IHXA 4LF4B 4TLDA 3UYKA 5FPQA 1ZQSA 3KKLA 3BIOA 4WBSA 4P4SB 4XDYA 1QSYA 1T9CA 4LXXA 5EP3A 5DLGA 1ISRA 4CXMA 4HP8A 5HKLA 4FFRA 1LBTA 1DQZA 1V9SA 3L04A 5HJEA 1JEJA 5JSUA 4EYGA 2EP8A 3UCXA 1E61A 2IZ6A 4NLNA 2B8EA 2GCOA 4D5EA 2GFHA 3OJUA 5CIQA 5KUTA 3MRVA 3A1UA 3QPDA 1DJOA 1YAJA 3IJEB 3DTTA 2DKZA 4JC4A 1LF0A 1B0AA 1EUYA 1WD7A 1KRHA 5KYWA 2OSVA 4BNZA 5CB4B 5JQWA 2PBFA 1X1EA 4Q3NA 2A0WA 2LMRA 4E4YA 1QXSA 3E05A 3KRTA 3VU1A 4F4DA 2A8YA 4UQLA 3WK7A 2B37A 4X3CA 2Q7OE 3ZZMA 2LR0A 1NGSA 5JDCC 1ML3A 5SY9A 3FTQA 2IYNA 3CZQA 4MKRA 1BPYA 2UVVA 4X1YB 3QWAA 4I19A 2CHFA 2PUHA 3RRGA 5KQGA 5C5CA 5C34B 3O8QA 5IM5A 2WYIA 2V7WA 4GQBA 2FUG1 5EI5A 1NX9A 4ZDWA 3AY7A 1WB5A 5IVDA 3UC9A 2CHUA 3EWNA 4DWIA 3FLEA 3K0KA 4TT3A 3COWA 3AQEA 4D45A 1GYRA 2VA8A 4EVIA 5ERGB 1ZHFA 3TZHA 2BY4A 1ZBDA 2YHBA 4BMNA 1I7QB 2YVLA 3ESYA 2F1HA 1CUSA 2Q8PA 2Y93A 2EU8A 4LS3A 1DVRA 2HBZA 2VRBA 4I5EA 3VZQA 3I1YA 1QQ5A 2HXYA 2GYYA 2PUBA 3E4DA 3OJEA 2VT2A 5ADHA 2I76A 1RU3A 4J0IA 4HBGA 4B3JA 2GF0A 1BVHA 1KS9A 4WI1A 3W78A 4AJEA 4OMCA 3IKMB 5F4BA 5JNLA 1MD9A 4NEHB 4P2HA 4MUJA 3QENA 4CR8A 5FH9A 1B14A 1PV2A 4TLLB 3PNOA 4L3OA 4QRIA 1NC3A 4GNKA 1GZ7A 5EE1A 3I39X 3SN6A 2GCOB 3COSA 3GDFA 1OE0A 4UKDA 1PJRA 4JQSA 3R9XA 4RSRA 4LYFA 5LLTA 4Q19A 4G01B 1EQ2A 4D3FA 3BE6A 4YPFA 1EINA 4IGEA 3PGVA 4B45A 1U7TA 1I33A 4UVDA 1SXHA 4DM4A 4R65A 3QPUA 1OKKD 2X1MA 5CNJA 1DZIA 1LLDA 3AU2A 1AK2A 2IYZA 3B7WA 5IKMA 2FLLA 2C58A 4KR6A 3AG5A 4BJHB 3PMLA 4OBBA 4ARSA 3QU2A 2HPHA 5BV8A 4LF5B 3D7RA 5DDMA 2NNWB 1OD6A 1TECE 3O8QB 3ZE7A 1EWYA 3T9FA 3MNFA 1Q44A 4WERA 4RGVA 4QFDA 4O1MA 4C87A 2UYYA 5BYJA 3JQ6A 3U09A 1JFFA 3IUMA 1SKMA 2C3PA 4M1QA 4FS8A 4NVRA 4RJJA 1OREA 3AVYA 3SZGA 1QR6A 1DU4A 1K0UA 1LDMA 4NYIQ 4BMCA 4U2GA 3KJGA 3C6MA 4DB4A 5B5EU 2XMGA 5LA6F 1XTJA 1BWRA 3V55A 4BZWA 3OWXA 4AUEA 3MR3A 1XMSA 3U48A 2CKDA 1CX9B 1JVNA 2P4QA 1RQ2A 3D7MA 2Q5LA 3UKOA 1Q0LA 2BH2A 3HDVA 4UBKA 5BURA 5IULC 2I03A 5I4BA 2WC1A 1ZD1A 1YF3A 1Q77A 2FWRA 5C5DA 3LFHA 4FZ3A 3PUJA 2I2WA 4F4YA 3QQPA 1ID1A 2OXOA 3ONWA 2SBTA 1H5UA 1B8OA 4Y1GA 1Q7EA 4E5SA 4EYOA 4FZRA 3R9XB 4EPXA 2O52A 5ELLA 4UVIA 1EJBA 3STVA 3ANNA 1OY1A 3UIEA 4QZDA 1B26A 1P2DA 1Q46A 3W9BA 4PQFA 1VXOA 3CEHA 4TQAA 4L4SA 3LGSA 4YJDA 2QMUA 1GGMA 3BH7A 5DBIA 4D8XA 4DCPA 3SBOA 3EA0A 4K4IA 3WNBA 3PC8A 1DJLA 4S1WA 2O8EA 2F3UA 4IH1A 5KMGB 3ETCA 3LUCA 2V6MA 8ICFA 1J9GA 3COYA 2CUKA 3D02A 2DTXA 3HCAA 4FWBA 3PXDA 4BUGA 4AD8A 4ZVMA 3NVYA 3EF3A 4FCCA 4B4DA 1PZNA 5B55A 5LNK6 4ZQFA 3I9JA 3E9RA 4Y1RA 3PR3A 2QTLA 1SD5A 2BE9A 3FCCA 1JFFB 1W46A 5EEGA 3QOFA 4KBFA 3FSEA 1XZFA 2PXHA 1CJTC 4WNIA 4BFZA 3WK6A 1U8CB 5KFPA 3BD6A 4UTXA 2XTZA 4JLMA 4J9VA 2JAOA 4P32A 3IEMA 3C97A 4BMVA 4KIJA 1NRIA 4LMAA 5DGHA 1FRFS 1L3VA 1BGWA 1Q1EA 1EVYA 3G6XA 2NVBA 2V7XA 3GGPA 4O3NA 1KVTA 1OLSA 5DNCA 4C07A 3TOXA 5IDWA 3PXGA 3ZLBA 2XVTA 1W75A 3HK2A 2H0QA 2JR5A 1KYVA 2YRXA 4J0HA 3RB6A 4LDJA 1EXWA 1JH9A 4ECSA 2GTIA 1K7YA 2GF2A 1Y81A 5F3WB 4H18A 4XZ3A 3V4ZA 1QP8A 4XGIA 2UXDB 4BX9C 1JAIA 3VU3A 3KKAA 4P35A 4K7JA 3VZPA 3NTXA 1A0OA 1UK9A 5F2EA 3KDAA 1UA0A 3T9DA 2VO1A 2RGCA 4C08A 2XT0A 1EBUA 1D9XA 2O8EB 5CXXA 2DY0A 2QMHA 1U2GC 3ZZTA 2BP7A 2QTTA 2PGNA 2CXHA 1G20A 2W43A 1IOLA 1ZQAA 2WKSA 3DHYA 1W1WA 4U7JA 1AB5A 4PEVA 4PNHA 1TK3A 4Y1RB 1FQOA 1I1HA 1A2BA 1M66A 1I4DD 4RQ0A 2PK3A 2RJ3A 4ECVA 3QUAA 3FDXA 1QFXA 3RAGA 4KV7A 1AA6A 3RK0A 1N7GA 4YV1A 1DWQA 2BKUA 3R7FA 3CEJA 3FUWA 2FZ4A 3MGBA 5CA1A 5DNDA 2WAAA 5JUMA 3ESZA 1N2ZA 2ZUTA 1JQJC 4TVKA 5LLSA 5C52B 1QGED 4DJ5X 2PZEA 2FWBA 1XFAA 2OQIA 4MW9A 1JT2A 4KXVA 4PG7A 4ND1A 1JHVA 1HE2A 4FD3A 2W37A 1AGXA 2Z8XA 4EG5A 2V74B 1U9JA 3HXQA 3ZU4A 3PYMA 1OLSB 5K3SA 3CX6A 1KERA 2GVZC 2YXPX 2H4XA 1P9LA 4WBNF 4KUGA 3A6DA 5ENZA 5JJBA 3NIGB 4PVCA 2V5UA 2PL1A 3K2QA 5H68A 3ZWQA 3FNIA 3BE4A 1JTVA 1EIWA 4JEUA 3D8UA 3DHNA 2KMLA 4QPZA 3JYNA 3DL4A 3B1JA 1VSUA 1POWA 3STUA 2AXQA 1M5TA 2PANA 2WU0A 4BBJA 4ARUA 3L1HA 2HHQA 1RVV1 2UKDA 2PSFA 3ZWBA 5F9MA 2YW2A 3C23A 4YRIA 3EVAA 2AF3C 3MR5A 5EIFA 4B0PA 5G0SA 4YR7A 3HMQA 1OA1A 4JGGA 5DHFA 5JYEA 5EESA 1A27A 1URPA 3TINA 2LD4A 2BP7B 4HLCA 4NPHA 2QVZX 2C2KA 4ZJUA 1G20B 2PWZA 4XB2A 4DNPA 3PGA1 3BK2A 4M9ZA 4UHCA 2B8WA 3NBKA 4CMHA 2FCRA 1BNOA 3O1LA 1E9DA 1DT3A 3PF9A 1H2HA 2EQBA 3CPSA 4GX0A 3RH5A 4KFTA 3EBPA 1SQSA 3I52A 3WGIA 3U1BA 3Q3IA 1UZAA 5CMLA 1IBMB 3HH8A 1NI3A 3DOCA 2IHUA 2D6FA 4Y7CA 3I2JA 3GP8A 4AX8A 1BD4A 3GT4A 3CH4B 3BCUA 3SZLA 2J3DA 1CULC 4DMKA 1GTL1 5HR7A 4B35A 1QK5A 1SQ6A 3HBMA 5FQNA 5KTOA 3QFHA 2O2XA 3TR0A 4FDMA 1IUKA 2XUFA 1S96A 2RHJA 4YIHA 1DRVA 2V6GA 1W5TA 2Q4TA 1ZOSA 2ZDQA 4JBHA 4XTCS 1Y48E 2X13A 3HBFA 1EP2B 4PVDA 3FFWA 1OXKB 4DIEA 4C4AA 4Q9KA 3N05A 2FLKA 1RHMA 3PS9A 5G0WA 3GIWA 4BN0A 2QRKA 5K3EA 2NU7A 2RFLA 3CR8A 1DKQA 1R8XA 1TCCA 4MI3A 4HWPA 3OTHA 2D5BA 4TQUS 3MCWA 3MLAA 2ZANA 3BTSA 3IIKA 3F8TA 2H0RA 1XZPA 5KZMB 2QN2A 5AHXA 3ETHA 2PZMA 4QWBA 3TLYA 2YC2C 2QF7A 2GFQA 4X8OA 2WDZA 5GQSA 3IN5A 3DOOA 3TMAA 2JIPA 3AVWA 1VRVA 3KB2A 1UBNA 4I3FA 1DRKA 2BSXA 9GPBA 2JHCA 4BNIA 3FB1A 1OTYA 4LGYA 2WTXA 4KPYA 1F51E 1DIBA 1ZQTA 2AQIA 1DQRA 3IVGA 3C14C 1NW9B 3H0RB 1NQUA 4PXSA 4CDMA 1V9CA 2HU7A 3UH1A 1RWOA 2VHUA 1OH7A 2QORA 3LWDA 3HDTA 2EGGA 3TI0A 3QYPA 2ZRJA 3KOWA 4KFSA 3I9MA 3FJYA 1KY4A 1IY0A 3SAFA 2QUIA 2YCLA 2W9CA 2PPVA 4UTVA 1NJYA 3WB0A 2UUBB 1WOYA 2X2OA 5FFNA 1A77A 4DE5A 4MQ4A 3QF4A 1GNTA 3PA8A 1DAKA 5CDFE 4A23A 4DL2A 1KZGB 1KOJA 3H4DA 1ZQ9A 1NQOA 3MJCA 4JV5B 3PPXA 1L5GB 5HZHA 1S3GA 1Y5RA 4PZYA 4B6RA 4D43A 5DRYA 1RWVA 3FUUA 2YCBA 2O57A 2QJFA 4LJAA 4C3VA 1NUUA 4ALNA 2YNMA 4HXYA 3QI7A 2A1JA 4J0KA 1SG9A 1BAPA 4IL6U 1E0JA 4EHNA 5JOQA 1KBQA 5JD6A 5J2CA 2NU7B 3CZ4A 5D5QA 1BFDA 1T2CA 2VWGA 4UW9A 3R40A 4PAMA 3DHEA 2J45A 4DXHA 5CR9A 3HGMA 3FI9A 3FI0A 3C3PA 2H00A 3K0HA 4R8LA 5L1MA 2I3DA 3PNKA 3K53A 4ZT7A 1SC6A 4L74A 4Z4CA 2Z9CA 4ZOLF 1TK5A 1N9KA 5DQGA 1AGRA 3BDPA 3W5DA 4EGSA 4NONA 1AY0A 4KAXA 2ZJ0A 3X1JA 5TIIA 3SSAA 2A5LA 2WWTA 4W9NC 3M33A 1M8GA 1VDVA 3NVZA 4PPNA 2IHVA 5AM5A 4X8HA 1SV0A 4JGIA 3SR6A 3ZZ0A 1WUHS 4HNGA 2EDCA 5J2DA 4QSHA 2ZBEA 1NJ1A 2G72A 2V98A 1JEAA 3M1AA 2Y0SF 3B5EA 2VEOA 2P8JA 1V7CA 1JJBA 4BQOA 5EUQB 3AFNA 3RIHA 1W4LA 3RH0A 5KS2A 1GRCA 3OA2A 2W9CB 1R15A 4DUGD 4ECZA 4G5FA 2PAFA 3VDQA 1CJBA 4MMXB 5AYVA 4N76A 3QF4B 1QF7A 4EKDA 4L73A 4BZXA 4G4JA 3ZYZA 3WWZA 3GCWA 1V8BA 1PS9A 3NKFA 4ZAWA 3MOIA 3RFFA 2GQ0A 4QDTA 5KHOC 1SKRA 2BDUA 7ICLA 3VO1A 2VC2B 1O9BA 2P9GA 4KN8A 2IXGA 1RCUA 4F04A 4O8CA 5D3ZA 1HLPA 5B6IA 4A2PA 1VHWA 2DKXA 2DR3A 3RM3A 2RCNA 1GPLA 1GCAA 1AHNA 4OLHA 2IUYA 5FPYA 2XWBF 3K7EA 5FTLA 3U56A 3EWAA 1Z0IA 2BCUA 8AT1A 2HA0A 1AM4D 1CDOA 4QU8A 1DTWA 1Z5OA 3NW9A 3C16C 5KQSA 4JSRA 2FK8A 1DS6A 1N5MA 3FB4A 4XUGB 5EJGA 2GZAA 5AW2A 4NAHA 1NKSA 4OJNA 2V55B 1RJ9A 3PPVA 3L7KA 1ECWA 5CTJA 9ICJA 4Q15A 4KREA 1W4CA 3TARA 3E9MA 4WY5A 4E09A 5LP1A 2VR1A 3HM9A 2AIRA 3LW7A 3LCVB 4IF4A 4F4UA 4GOJA 4OJOA 4F72A 3ZCVA 2GFIA 4AYBF 4LF8B 1MA7A 1CZHA 3BIJA 4EX6A 2A0UA 1TVKA 1Y63A 1OGYA 4ELVA 4K9LA 5BVHA 1N2HA 1CFJA 2HRDA 3F73A 3JSAA 1GD1O 4LV6A 2UZ4A 1QAMA 3WYDA 4GOLD 1WO8A 2QBYA 1D7AA 1II0A 3KZIU 4BO2A 1MG5A 4RNDB 4RIEA 3K09C 4Z1OA 1KAMA 2PUVA 1N0HA 3ZWOA 3UWDA 3B9JA 1VKZA 2K4IA 1N2CA 3DOFA 3L79A 5G4LA 4MUNA 2Z8YA 4GQAA 2QSYA 2FFHA 1T15A 1X9HA 2QB0A 4UBLA 4DO9A 2VWQA 1PUZA 4UEJA 4GW3A 2B8TA 2QZJA 1PQPA 4GI3A 1RAEA 5C1BA 2Q6LA 1WMBA 2LE0A 1RC1A 4X5VA 3J81j 5JXIA 5KJ6A 2PGJA 3E3AA 4CLOA 4N6OA 4BLUA 4E31A 3PC6A 2Y9UA 1H1TA 3RB8A 2KHZA 4Q01A 4B47A 2HHXA 1IC6A 3VZSA 1O8CA 1I30A 3G6VA 4NK5A 3I6QA 4JITA 2OEHA 2CYAA 3ICXA 3NOOA 2ZEJA 1YVRA 5KKNB 3QEAZ 2XI9A 3PGLA 5KQPA 2P5YA 2VPPA 4D81A 4PLWA 5JARA 4L0DA 1CUIA 4I2NA 1PEDA 4JJAA 1DO8A 1GR1A 1MVLA 3KTAB 2XB8A 1RJ9B 2P9CA 3IKVA 2GWSA 4MAAA 2PE5A 1BN6A 2B5VA 2Q2OA 2PY6A 1KDVA 2WE8A 3KAQA 2NO7A 1X7DA 3Q10A 1DG1G 3FZQA 4MVJM 1CUYA 4MQFA 4LJ9A 4EGCB 3EC7A 4JY7A 1KJNA 4EI8A 3KKNA 2EBHX 3AOEA 3ZQKA 1AQ6A 3Q8SB 2HMYB 2J9GA 4WKPA 1D8BA 3U62A 3ZN2A 1Q7GA 4H6PA 4RVGA 4ABTA 4KLJA 4Z5XA 1TVKB 1BYUA 2PT5A 4CU2A 2Q3EA 5BVHB 2AV6A 3BA1A 1RLJA 2JF0A 2GM9A 1P0FA 2RIPA 4E2FA 2P69A 2QBYB 3PHLA 2WLTA 2IXDA 1RBMA 1QJ4A 5K0CA 4FEAA 2TMYA 3AL3A 4HJRA 3ZBUA 2CCJA 4F9EA 3V1UA 1A9XA 4BO4A 4J4TA 4Y2HA 5LC1A 2HTEA 4V0NA 3PGJA 3WYBA 3V1MA 5C5EA 5KVCA 1QAQA 5FJIA 3BDIA 1V37A 3OX4A 4FW9A 3UJ8A 4CIYA 1N2CB 2LVBA 3JAWA 3R3JA 3D0QA 2PO7A 4DF4A 3DMTA 1I4EB 3TXYA 2K4PA 2QB0B 4JZYA 1V26A 4MO2A 3VO2A 1U6IA 4LF9B 4BNXA 5KTMA 2ZYUX 3RSZA 3B2EA 3UFBA 5IVHA 1NNI1 3Q12A 4LBYA 3SD7A 1BFKA 5JIBA 3LDGA 4QX6A 4CLOB 4PPQA 2PJZA 4XWYA 2ZAIA 4HSEA 3LSTA 1TYZA 4FQ7A 4WTOA 3Q8QB 3R5KA 3IAEA 2H2FA 1ID8A 4YT8A 4FE3A 2QPAA 1G3UA 5ALEA 2QJTA 2XA1A 4BVAA 3PNSA 1FYVA 1RLTA 1R4NA 1NUAA 2FUNB 4KMSA 4P58A 1WZ2A 4EO9A 4ZOCA 2W42A 1P0CA 3GXBA 1O95C 2CC2A 4DDMA 4N9QA 2JIRA 5FFMA 5EJ9A 3IMEA 2XODA 3V8NA 2X77A 3CJRA 2OCPA 2WY2D 4HPJB 4NABA 4LXYA 2QLMA 1F17A 5DM60 3ZX5A 2R6AA 3M81A 1ZJNA 1A72A 2DWOA 3DZJA 1OWPA 1XVUA 2C20A 2WW8A 4MQFB 1Q12A 1GJRA 4PZ9A 4EQ6A 4ZMBA 3C5EA 5K0LA 4P38A 1MV5A 3QVGA 4MICA 3O6VA 4HPWA 5LXTA 2IUFA 1MA3A 5KFBA 2KLHA 3UK0A 4C01A 3B6JA 1JSRA 1MHPA 4C8OA 1BX3A 1AS2A 2FZ5A 3WLIA 1GV0A 5K6AA 2O8DB 1MH9A 2C42A 3MMXA 1I5OA 2NSJA 3FZYA 3KHGA 1KFEB 5TR9A 4I3GA 1VJGA 2GF9A 1ZL2A 2R4UA 1A9XB 1TM2A 3OEEA 1RI5A 1I6LA 5J2TA 5A7HA 1SBHA 2C4TA 2VBFA 3USES 1H3EA 2MYUA 2E7ZA 3CYMA 1SU4A 3L02A 1CEEA 3JAWB 2OP1A 8GPBA 2VP3A 5IZ4A 5A0TA 3CXRA 1V85A 2WJJA 5AVKA 5BN5A 2PS1A 5IBCA 1SD2A 4TUYF 5FWDA 1B6SA 1KRPA 3KJEA 2E5WA 4WK4B 4H3HB 3M5PA 3RTAA 1TDJA 3OGUA 4M87A 4CWAA 5C8YF 3AMVA 5EJ6A 4TKMA 1BCRA 1HRDA 1YQEA 3KSBC 4LI0A 1D1QA 3IA7A 1ESEA 3X44A 3HTXA 3RJ9A 4JFRA 4WKOA 1VE9A 1S2NA 1QP7A 3I5MA 1NV8A 2HGZA 3M82A 1CKEA 1Y3CE 3O3CA 2W93A 4MCJA 3UG7A 1E3QA 5TT1A 2LM4A 1R4NB 4IIXA 3UGKA 1UIMA 3PBKA 2QQGA 2RAPA 1JLSA 2E5LB 3OEHD 1T26A 1ZPDA 4JL8A 7ICMA 4UQOA 1U8XX 1RYBA 3ZCTA 4KJZA 1YQDA 3JQFC 1T10A 4ZEMA 4F4CA 2DL0A 3E5HA 3FKSD 4R9NA 4JUBA 4N3NA 3TR6A 1KEJA 3WGMA 2WFZA 4CQMA 1KFKB 2AW5A 5ILGA 1ACMA 1SHJA 1FZQA 2IPMA 1Y6ZA 4EQ6B 2QNBA 3QVGB 3KEMA 5L45A 4ZCIA 3EPKA 5LXTB 4INZA 1ZK4A 5BW8A 4QOSA 3K92A 1S0VA 1S8NA 3UMBA 4DWJA 4LWZA 1J90A 1FFHA 1QGUA 2H17A 1HDRA 1ISMA 4RH1A 1PK3A 2FPIA 2NTEA 2KKVA 4Q24A 3QHAA 4WACA 3QP9A 4WVLA 3HSSA 2NT3A 3GNQA 5JY6A 5J2TB 4US2R 3U3MA 4YDSA 5EJFA 1F2TA 4ROTA 3QTTA 2V7PA 1FMJA 1C2TA 3OIVA 3RU2A 1O94C 4QBIA 4M0MA 3M6UA 1KL7A 4QPJC 3JPYA 3SSNA 2NN3C 4PL1A 2G77B 3THOA 5FUYA 4MYUA 3BK7A 4OF4A 1C0IA 5E95A 1BCRB 1F14A 5KCMA 3P45A 2ZT8A 4RV5A 5KIAA 2HV8A 2QM8A 3AKCA 2PQ0A 3SC6A 3MFHA 3ZLJA 5EKTA 3HCEA 2ZUFA 1UOQA 5EWMA 1OPRA 3QLEA 4RNNA 3VZCA 1Z0ZA 1GKUB 3AINA 5AKGA 1DX4A 1AK1A 3I32A 3FWNA 4ZH4A 4MEBA 3Q5EA 3QBVA 2DPXA 3SJBA 3ZUPA 1ECJA 4EQZA 3LPMA 4LHXA 1J9ZA 2Y71A 4KLQA 1N5JA 5IEBA 1SK8A 2KE7A 4Y6GB 4EW3A 3EG5A 2ADMA 5G1NA 2FZEA 1P4AA 3T5LA 4CQMB 1ULUA 4GVPA 1CQZA 4IEEA 4S35A 3NHAA 1IQPA 5A6SA 3G0CA 1NJWA 4NPCA 4F96A 4RHYA 1YIAA 4B7AA 3FC4A 3VR1A 4U7CA 4X00A 2P27A 4KH1A 4HWTA 2FX2A 4DYVA 4JV2A 2GRJA 5KFHA 3PXAA 3EVDA 3LOUA 4P0QA 1UQRA 1QGUB 5EPEA 4YCBA 8ATCA 5B12A 4FHEA 4B3TB 3F74A 2GK4A 4TV9F 4QTYA 1CDDA 1FLNA 4GRAA 2OBLA 4GMKA 1NJ5A 1TZCA 3Q15C 1XYGA 2ZROA 1GFIA 3GHYA 1NVVQ 1F2TB 3U5TA 2WICA 2KM1A 4FOTA 3EVNA 1T3SA 5TEVA 1PK1A 1UEJA 4XGNA 3JQ9C 3WL3A 3ZVLA 3IAM1 3PWKA 2P7IA 4FZNA 4EAQA 3PNVA 2Z04A 4IYRA 2IODA 1KARA 3HY6A 2AVNA 1U3UA 2NRWA 5ENDA 4IQ0A 2OZLA 2M9MA 3I0MA 4J3JA 2NXWA 7ICNA 4HXFB 2REOA 3F6CA 2QRUA 3G7SA 5EWMB 2OHIA 2PQMA 4MB0A 1ISIA 4X93A 5FWNA 4HEJA 2F4NA 3ZWXA 4OGLA 1VSBA 1WOMA 1VKOA 4BAUA 1RAIA 5D3QA 5JCXA 2JEOA 1LUAA 5KYGA 2J3EA 3WNDA 1Y8ZA 5KFMA 3GEEA 4WINA 3IOMA 5KB3A 1U7PA 2JHPA 1RXYA 4BAZA 2AX3A 4QZBA 1QZUA 1JDTA 1WUYA 2ZWOA 4S05A 2GYWA 5DB8A 4LX0A 4I2AA 3ICEA 1YJ8A 4OHBA 3KSRA 3WGGA 3ABQB 2R62A 4UM8B 5A6SB 4S2UA 4ZRDA 4RL6A 4BO3A 4YP1A 3PHIA 2ASDA 2TMDA 2I91A 4UBBA 3HC7A 2JVKA 2VDPB 1T3HA 2YWRA 3GLVA 2C59A 3WZMA 4DL5A 2QLLA 1R5OA 1P81A 4P0QB 1KSFX 3Q8LA 1AUQA 1YCHA 4QQNA 1N1EA 3HJFA 3E23A 2D5IA 1FRQA 1WTAA 2FQWA 1WB4A 3MB5A 3BMNA 3AF6A 3LGXA 5G02A 1XSNA 3UGTA 4YRCA 5DN6D 1GG2A 3ZWWA 3P9PA 4I50A 2VIIA 2AK3A 3HPQA 5GJBA 5CEFA 2ESEA 4BTVA 1PK1B 2EKLA 1D3AA 3KSAC 1VSTA 3V1KA 5F76A 5AKIA 4OQXA 2BVNA 2BHNA 5GTHU 5DYTA 2H0AA 3IP8A 1N2EA 4US9A 3S8EA 3NVDA 3D6JA 1S8AA 4ENPA 2OZLB 4M47A 5IH3A 4RYDA 1UC4B 1LZLA 1ZCAA 5HZKA 3HYNA 5BSUA 2ASVA 1ZM9A 2PRKA 1UJMA 3DWGA 1ZQ1A 2ZJ1A 4PX9A 1HXHA 3CH5A 2AQHA 4OOEA 4JK1A 3QUQA 1TB4A 3FMVA 3BFVA 7REQA 4DPMA 1OW3B 1FIQA 5ITZA 2GYUA 4PC1A 5ES3A 4EPVA 2Y6VA 3EMVA 1Q3VA 1E3MA 1YR9A 5AM4A 1ST2A 4CM5A 3CLSD 3EPLA 5SYAA 2QUKA 3JWIA 2FPSA 4UEWA 5CM9C 4ZYLA 2PV7A 2YIVX 3HKEA 8ICHA 3QSGA 2GZMA 2YS6A 3MZ0A 1CUJA 1QDLB 4HDSA 4IDNA 4MPJA 3TXAA 3BJZA 3KHLA 3N70A 6Q21A 4J9KA 2DQYA 3RTBA 1HSOA 1K4MA 3ZXSA 3BEOA 4DL3A 4MINA 3ICWA 2QG6A 3GT3A 3HB1A 2KD1A 3CH7A 5HBRA 5J0QA 4FJ0A 1QGYA 3H42B 4S3MA 1S0UA 4GKJB 1Z2AA 1NBOA 1ICIA 3WYFA 3BMNB 3QFTA 2ZB2A 4M9CA 3ZU5A 3L43A 2Q8NA 4J7XA 4YI5A 4CM6A 4QL3A 4I50B 4R54A 1PYGA 4AZ3A 2P1DA 3ST7A 2YQEA 1DC8A 1CEYA 1YQQA 1MAWA 2HA6A 3V6MA 2I0FA 4BFYA 5AW8A 4NLGA 2XRFA 3O21A 5JV5A 2OV6A 3UM9A 3U2QA 4YYEA 5B1IA 2EDAA 4EF4A 2KTQA 3NHBA 3WGZA 2D1RA 5FNVF 2X0FA 2YZ7A 1H1LA 4BC0A 1R8QA 1R9NA 1VE3A 3KVOA 3B9PA 2IEBA 1CT9A 2ZW9A 3A3OA 3GBSA 1HE4A 7REQB 4MW6A 4MRNA 4YC7A 5ITZB 1N1DA 1T5DX 3VH3A 1ZQMA 1DMRA 4O1HA 5B64A 3CEPB 2OORA 1AQJA 2NSLA 4F6RB 4IJ6A 5DHSA 4WV3A 3VPDA 3STTA 4BASA 2VDQB 2Y1DA 4G09A 2OVBA 3HKEB 3PCTA 2YN2A 4BP3A 1DOHA 2HF9A 4CUJA 5AUOB 1Y89A 3OCCA 5DSXA 3OF5A 4HDSB 1K1QA 1ZC4A 4HX2A 2HK9A 2C88A 3RD5A 1ADCA 1ZH4A 2BMVA 3A25A 5F5NA 5GPBA 1HL7A 4NHOA 2KZZA 4X44A 4D0NA 1B6TA 3TSCA 4G3XA 2G5CA 2ZSJA 1JTEA 4ZQIA 3I2YX 2IIVA 4PL2A 1TVEA 3GWGA 2X5JO 2VDRB 5J0YA 2C2XA 2VF7A 1EFCA 3IA2A 2BZFA 1YVUA 2FMTA 1T6ZA 3ZHVA 4ZK2A 3TQHA 5H7XA 4XEHA 1J0AA 1XZKA 2OGTA 4RQ7A 3ZY3A 1X8KA 4YRGA 4YT4A 1VMIA 2XD9A 5LP6C 1GGVA 2AOVA 4AZ3B 2H5LA 1OF1A 3T7AA 5KOYA 1TKBA 4XFKA 1QVZA 8ICPA 2MSLA 3B70A 3M6AA 3KEOA 4G89A 3VC1A 4LRUA 1PVOA 5DGCA 3VI3B 1M83A 4H2DA 4G8BA 4RM2A 1ZW1A 1ZL0A 4C7YA 1KS2A 3PI7A 4E70A 2YFYA 1ZETA 3DZ8A 4UC0A 4JMLA 2HWKA 5M04A 3EDQA 1NYLA 1K66A 3D7KA 1H1LB 1ED1A 4NFYA 1J9EA 4Q48A 2ZWIA 4N1AA 2BTOA 3GFOA 3H97A 2P2ZA 3BQ7A 2L5YA 1UWKA 1RADA 4AZSA 3BL8A 3ANSA 1LF5A 1HURA 2HNAA 4H7HA 1NBEA 3HCCA 2O05A 3MCUA 3KR0A 3RH4A 3IRVA 3SJUA 2FEPA 3EEQA 2ZPTX 2HBKA 4XXHA 1EWRA 1XUOA 5M2QA 4HNRA 4TMWA 1T25A 2ILVA 3SQMA 4DF8A 5FLYA 1XDUA 5IU6A 3NTLA 4X6XA 1JVSA 3F53A 1IJBA 1BHQ1 1O5TA 4NC9A 5E4YA 1SBCA 1ZSVA 3DMNA 5ECWA 1KL9A 2RHHA 5IIOA 3MT8A 2PFQA 2H63A 2X8AA 4TV8F 2YMPA 1BX0A 5ED4A 2R8ZA 4H1UA 4YIKA 3DE5X 5DG8A 2I9KA 1GILA 3SZMA 1AHPA 4UBJA 1ECCA 4KRXA 1LJ8A 1QWOA 4YAIA 1LX6A 2H1CA 1HFWA 1NK5A 4RDXA 3K4HA 3MQFA 2ZM5A 3TWOA 4KQHA 5FBKA 2V3VA 4RTJA 1PJ2A 1F6WA 3G0HA 1EK1A 3G2OA 3A6PC 9ICIA 1QYVA 2ZIXA 4U5QA 3HR7A 2HK7A 1DLJA 3O4HA 4KQIA 1YK1A 2HEGA 4EATA 2ZB7A 2Q49A 1T43A 5KFVA 1BVYF 4F5DA 1OCEA 2X4GA 1A8HA 1UJ4A 2Q2WA 4UUMA 4KWHA 2HEIA 3PC2A 1RD4A 5BMVA 5E9QA 2CLIB 5L9AA 2XCLA 4MRSA 1IY1A 5EIHA 4JZKA 3RV4A 1NOKA 3P7MA 1OHHD 3IBGA 3V9PA 1L1RA 2YJ4A 3SP1A 1P9OA 3FSGA 1Y8AA 2RP5A 2FEXA 5EPOA 1EJ6A 5T8KA 2EJTA 1S7CA 3K9NA 2JB9A 4DEYA 1G8PA 2BWJA 5JJIA 1D2CA 2WAQC 5KPDA 1S77D 4RUKA 5EZYA 4MHOA 5CITA 1N92A 3DFZA 3H9QA 1KSGA 4IS7A 4LC9A 2XIJA 4N54A 5AVJA 3DV9A 4OV6B 1RI1A 1KBUA 3LWNA 2ZRIA 2HMUA 5AKEA 2BDPA 4HLQB 2O07A 2IHBA 3ZJ5A 4NV1A 3NHUA 2PRZA 3DB1A 3KS9A 5KMGA 3EOAI 4M7PA 1XCJA 4E7PA 1UK7A 4LVCA 1FRVA 1SGWA 3U7QA 3RDPA 1ZWKA 4CI9A 5JO0A 1M1ZA 5DX0A 4U63A 1SUFA 1G1MA 2WHPA 1LTKA 2AZDA 3RUAA 2C3OA 2POCA 2OCDA 2QEQA 4CQNA 2HD4A 1PHRA 3LYSA 4JFAA 4Z49A 2WYUA 3AZPA 1UDRA 3VDXA 4TS1A 2A2ZA 4A0QA 1ZD9A 2W9XA 3O2NA 2R8IA 1LI4A 1PHPA 3QTBA 3HRHA 3WQBA 1SOAA 3MCVA 4I4CA 4K1LA 4OBWA 5DRTA 1P1JA 3T3NA 3LM8A 4YMVA 2ZIXB 1Z08A 1H3FA 3NYQA 5T6BA 3A11A 4AY6A 1QX3A 4ZOBA 4OXNA 1G21E 2HBMA 1XRMA 5I8ZA 1ZXBA 3KELA 4LF7B 3N2LA 3M6XA 2IPXA 3BTUA 2JI9A 1OUQA 4M99A 1G6HA 3GQCA 3OO0A 4GD3Q 5BMVB 3ZZ1A 4I1VA 3VR2A 1G9SA 4P4MA 2QENA 1O6ZA 3I2KA 3SU8A 1BNPA 1Z7WA 1UJNA 3OLZA 4KIWA 1N6RA 2F9LA 4F91B 4DR1B 2AUTA 2G9ZA 4KQKA 4CM1A 3K75D 3EZNA 2GD0A 1D9ZA 1AS3A 4N5DA 1Z0SA 3EIHA 4C2BA 3ZU2A 4KE6A 2C98A 2WHEA 2A86A 5BV7A 2H9YA 5EZYB 1S2LA 2ZLBA 2VJ4A 2BIFA 1G8GA 5I9TA 1ZYUA 2ZDGA 4CEIA 2LIVA 5FUQA 4MKHA 1CWUA 2OC9A 4OGGA 5HHTA 3KFLA 1I94B 2YS7A 3VNBA 5KTRA 3V8MA 5ADUS 4BAGA 3IAHA 2YDYA 2P8SA 3CLVA 2KZ3A 3QMMA 1DMSA 3OFNA 2F3PA 1LK7A 2I2FA 4H15A 4PRZA 4H7FA 1NQXA 2FX5A 1U0EA 3A6EA 1T5TA 6ABPA 4UXIA 4QG3A 4GXKA 2PZGA 3U7QB 5T4FA 5GTIU 4FONA 4KGDA 4RKQA 2QRPA 2WHPB 4AKTA 1IBKB 1BWQA 5TE9A 2VQDA 4NU0A 3N6RA 1P1HA 5AKYA 5DQHA 4L2IA 1VZ2A 5LQKA 3CA8A 4NM1A 5TMPA 2QXYA 4CV0A 2QL6A 2F1IA 1BXRA 2G4CA 5F51A 1V41E 4M9SA 4K05A 3PJDA 5CA7A 4MUYA 5EQTA 4BCCA 8ABPA 3NNNA 3HBNA 4ZOAA 3RC9A 2I29A 2I5HA 1DFIA 1JEQA 2JBHA 1MQ3A 4CU5A 5IVKA 3MJ4A 3E48A 1ESZA 4MEAA 3QMWA 1P8AA 4QDXA 1RQNA 1D8AA 3JQAD 3DFKA 1FVXA 4ZZ1A 4KQGA 1UT6A 1T8PA 2ZS9A 2C77A 4ZMSA 2ZTEA 3G13A 3OH8A 4GPTA 2WZQA 4UUOA 5BWOA 2VNHA 3OFJA 4O0LA 3TZKA 1COOA 3LXXA 1MT0A 3QEBZ 2EIHA 3WDKA 3LLVA 3Q8KA 5DCWA 3E2PA 2JJ1D 1E1RD 4QYTA 3OE5A 1CU1A 1CVLA 3Q0TA 1BJTA 1FDSA 3I5AA 2IS4A 1NQVA 1YBAA 5JYCA 1QRRA 2JFGA 4C78A 4TKZA 4MGHA 2W7PA 2NVOA 2UYOA 1ZGHA 3UYLA 2X0KA 1TIPA 4CEIB 1TU3A 3RJHA 1Z39A 5CHGA 2RK4A 4XIFA 2AMJA 2I8LA 2Y4NA 5KJFA 4ER6A 2Q4BA 3JZIA 3RGWS 2LCQA 3EQ9A 1TEHA 3NYIA 4MIYA 1DKMA 4X91A 2DE0X 1QUEA 3S7TA 4PBRA 2Q0SA 2WHXA 4LHYA 1A4RA 2IOFK 3D0OA 4E2ZA 2BGKA 4YQFA 4YN3A 2QRJA 2RGGA 4OI2A 2O2IA 1GG9A 4DBLE 1H0KA 1X9IA 2QT0A 4QOFA 3GN2A 1U28C 2FPWA 2WM3A 2AJQA 1PR9A 3HFRA 1MXHA 4L2IB 2BN4A 1W35A 3G8YA 4YRDA 1USGA 4IKEA 3OJOA 3I01A 4EYKA 3GRRA 1BXRB 3VR5H 2YY6A 2Q4RA 4GC6A 2VRCD 4G2TA 4ZYZA 1R4ZA 5D3MA 1LA2A 5DBFA 1UPXA 4GXJA 4F7DA 3L3FX 3QG1A 4EYIB 1JEQB 1VCOA 3E0XA 4ZRMA 4F93B 3HKDB 1GFWA 2W8LA 3OP4A 1SIBE 1J6UA 5HW0A 4ZCTA 3F7TA 1CLEA 5A5GA 1EQUA 3IVRA 3NCTA 4RAQA 3Q6MA 4PHTA 1SXGA 3ECAA 4IIEA 2C8LA 1HEUA 2Q5IA 1XFDA 1N8TA 2X5KO 3WLMA 1EFVB 2PMCA 1YCDA 3NBFA 3SHTA 2JPDA 2VQEB 3E7XA 2P1RA 3SYKA 3V6HA 2QQFA 4K9NA 5JAOA 3OWOA 4W82A 3EZXA 3QBTA 4OP1A 4YCXA 3UWOA 9ICEA 3UOAB 2HWUA 2ERCA 3ED1A 5KFWA 4QYMA 4RJ2A 4J91A 3NBYC 1T5BA 5JBQA 2CSXA 6NULA 3G0BA 1P5ZB 3O31A 4IG4A 1CERA 4AO7A 4DA4A 3MWKA 5L9XA 1ISSA 4ZCSA 1E7MA 2ZR8A 3M34A 4M60A 421PA 4D2IA 4RE6A 2X3UA 4ZV4A 3RG8A 5F64A 2MRLA 4WXYB 2CE2X 1KMCA 3H2KA 3EAFA 1S9FA 4NXMB 1U2QA 4KK3A 4L9WA 3B36A 5LQJA 3DNFA 3QX8A 3T5DA 5AOAA 3PFBA 1VYTA 4P08A 2RHWA 4NZNA 4ENRA 4N3BA 2QWXA 3WIEA 3KLMX 3U4IA 2YASA 4D9CA 1YULA 3LY8A 1ONNA 2GD1O 3DDNA 3KTQA 5D3MB 1U7OA 5H16A 3KKOA 4PZUA 5TPWA 2WF5A 4FNGA 4GC5A 2G5HB 1KFDA 1DB3A 4LHZA 3OQPA 4HDAA 3T3HA 4OFWA 4M89A 3C2KA 1Y9DA 2J3QA 2UYQA 3H3XA 3E5MA 3UBMA 5FF9A 4KN5A 4DG5A 2WKWA 3HLKA 3VR4D 2AN1A 4MF2A 4AURA 3NWPA 2FMXA 1H22A 2A59A 4DS5A 3BQMB 2PI4A 2ANCA 2HNBA 1F8UA 2EHJA 1SU6A 1ZQIA 1JVBA 4ML3A 4WVFA 5DTRA 4INOA 4CN8A 1WBDA 2JIZA 4QPDA 2XPCA 1UBKS 5KT7A 2Q2VA 4RMJA 3JZAA 3AV3A 2NACA 3RANA 2H9AA 2KWIA 3C5HA 4K6GA 2W2LD 1Z5VA 2HUNA 1J2TA 4TRRA 1XPUA 3STWA 1L5NA 4YVFA 5ALYA 1MQ9A 5I8PA 1E9CA 2BHTA 4LI3X 3KFXA 5JROA 1VJTA 3V7JA 4BX0A 4AROA 1SKSA 3RSCA 4OFBA 3DXFA 5BYAA 3VOBA 3KEFA 4AX4A 2AGVA 5H0IA 3WP0A 2FR0A 1FNSA 3D8SA 3T94A 3B9QA 2JHFA 3ET5A 1MN8A 3O4FA 4HEHA 1EAYA 1QU2A 2QKYA 4DLUA 3LRTA 4ZREA 1SR8A 1Q0TA 3M6LA 3GZTB 1Q95A 1GARA 3OPYI 3SMVA 3OJFA 3SX4A 3WIDA 1GSOA 1OBVA 1ZJYA 4YRZA 2ZBFA 2C2MA 4CGYA 1MQAA 5TPWB 3H5IA 4Y0NA 4F6LA 4JKYA 2LPEA 5M29A 1L4EA 3MT0A 4MUMA 4ECUA 1FSGA 3ELUA 4LYGA 5JFTA 3FWHA 4D02A 3BE8A 1Y3DE 3BHJA 1FDUA 4EEXA 1XSLA 2JJQA 4A7PA 2PL5A 1IVSA 5AK5A 1GGJA 4QXQA 5C5JA 3ZI0A 1T5SA 2FVXA 2PX8A 2ZUEA 3IEVA 7ICPA 4H17A 4PC3A 3LP8A 2EGUA 3RR8A 4JAVC 4LWOA 4Z7OB 2HMSA 4HAIA 5KFLA 4ASUD 2R5FA 5HFJA 5LD2C 4Z6EA 3GA7A 4LC1A 3ROEA 1GTMA 3HBAA 1KR5A 4QYWA 1K1EA 3GPLA 1UPTA 1QPZA 4O4HF 1E6WA 1Z5UA 2WV7A 5JZOA 4JLAA 2BLNA 4OGKA 5GJVC 2PFSA 4FIDA 4OTZA 1ZQBA 1SCKA 3EGWA 4X61A 3HO1A 5AJTA 4TXHA 1T6NA 4DSAA 1WYGA 4RUCA 5D84A 1KK1A 2FI1A 2XT6A 4OHMA 3UCFA 1BEEA 4NOKA 3K0SA 5KFRA 4B3RB 2O4CA 3DZHA 4F4WA 2ZRGA 1W25A 1ML4A 3PO5A 4CF4A 3K8QA 5EOZA 5DWDA 2V96A 4J29A 3IMCA 1U8UA 3JPOA 2JFPA 5LZ8A 5FAKA 3PW5A 1GN8A 3ZV5A 2XGPA 3ZE9A 1XCBA 1MJGM 2PXCA 4PGQA 1GSHA 2QUBA 1MOZA 3FLMA 1TU0A 2D3WA 1G16A 1HRKA 4A1OA 5CIWA 2XYRA 4KX5A 3WBKA 5BQ3A 1S0NA 4M9UA 5K0GA 1ABBA 1G2PA 3M1LA 4WCDA 4ODIA 2OG1A 5JFOA 1XCMA 4OB8A 4IC9A 4IIYA 1Q0ZA 2QZ9A 3A2LA 1GL9B 4ZCLA 1G5HA 3K72B 4DFJA 2BMAA 1NXOA 2CK3D 4DCMA 5GTDA 2V4RA 2YICA 3OC0A 4CMGA 2SKCA 3ZJ4A 2BV3A 5T67A 2FN8A 1N6HA 1OROA 5K2MA 3U7GA 3ABSB 2VDLB 3FTNA 3AP2A 1UH5A 4BWYA 1F4LA 3Q8MA 4UTRA 1H2YA 4KNYA 2RHLA 5JMOA 1CPYA 5E3IA 2CLEB 1FQJA 5BNFA 4XYMA 2W6ZA 3U16A 3R9KA 1FUYB 4ZVUA 2F59A 1J0XO 3KTAA 5J59A 1B0PA 1YSCA 1PJ4A 1BVRA 1USKA 5GONA 4QNRA 2P5UA 4MIOA 1TM4E 3NGDA 2A57A 5K3CA 1B0ZA 1CNFA 1G3RA 1HT1E 2RHOA 4BTLA 4B6JA 3RS2A 5I8WA 5FWAA 2Y1WA 2W00A 1D9FA 1C20A 2ZDHA 2GXQA 4M1WA 1EG7A 3TRJA 1SZJG 3GH1A 2QRZA 1UJBA 2IWRA 1NWCA 3M4YA 2ET6A 4Y9TA 4WXMA 4KQMA 1F3LA 1NIPA 4IQGA 3N7AA 4KGXA 4ZAYA 3ITKA 4M38A 5H59A 4L15A 3TADC 2OCAA 1N2BA 2JEGA 2CNNA 1KFTA 4LJSA 1FUKA 3VKFA 1JBEA 3DJFA 4L9RA 4WXPA 2XQIA 5JH7B 1KMNA 2VXOA 2F9FA 5EQJB 2N3ZA 5TISU 3SX0A 5I7AA 1FTWA 4G1MB 3NS7A 4Q3AA 2Q5FA 2PUAA 2P4SA 2PUWA 3UUEA 1PZGA 3OCYA 4WLVA 5ECDA 2AR9A 1JRPA 1MAHA 5EJ2A 2G63A 5F5XA 3GFKB 1KGDA 1L5OA 1WZIA 1BH2A 2NYAA 4KXQA 3VYVA 4GZ6A 2VHTA 1WX1A 1GAEO 2RB4A 5AVOA 3ROZA 4RZUA 1RYHA 1Z5GA 2A3NA 2HL6A 1E2LA 3TSAA 3P0RA 2E4AA 4N6NA 1YI1A 4X24A 1XLTC 3SENA 2Q3MA 4DQUA 4TWZA 1KYYA 2HXSA 2VK1A 1PWYE 1T3ZA 2DECA 4QJ5A 4Q0MA 2BGWA 3IAFA 1K5OA 5LP6F 4R63A 5JAIA 3BQ2A 3JPSA 5BOLA 4EL0A 1Y9ZA 1RC8A 1HE5A 5GONB 1NRXA 4KLEA 3AI2A 2JFZA 3AEYA 3UMVA 1Z00B 3MBOA 1WPQA 3NZEA 4JU8A 3W5BA 3CKKA 4LJKA 1DQYA 4CKEB 1DWPA 1PQUA 3A6KA 4FE7A 2PQ6A 4IHAA 4RK1A 1OGJA 7YASA 4XGQA 3IURA 3WB2A 3MMNA 1E2JA 5LIPA 4KYVA 4OJMX 3HUEA 4NECA 2APJA 4K6MA 2O8DA 2B2CA 3QEOA 5AP9A 5BV2P 2NZYA 4WLUA 3QYJA 2LKYA 2F1RA 3NORA 2Z43A 2P67A 3OSNA 3BA6A 3MWLA 3TM4A 4KLDA 4RQAA 5KFDA 3ZDDA 3L01A 4CFSA 3R41A 1ZUIA 3GK3A 2WF7A 3BHIA 2DERA 2B1IA 3RFXA 2VQ6A 3H13A 5BQOA 5JI2E 4BNFA 1C80A 3SC2A 4C8MA 2CEKA 4XVCA 4K9PA 3DVQX 3LUJA 1Z4JA 3QLVA 4BO1A 3ZG6A 5AXDA 3UQ0A 1GDTA 3O1HB 1QCCA 5CH5A 2J30A 4H7DA 3U44A 1FUEA 1T4BA 2GCNA 1QSSA 2QYSA 1QQTA 2I7VA 3FOWA 3CHYA 2FMPA 1OQAA 5BOMA 1SM4A 1WG8A 4KPEC 1ESCA 1K8QA 3OT5A 1FMCA 2IP1A 5KAPA 4KXYA 5EJEA 4WK6A 1C9NA 1XE3A 4JVSB 5JFGA 1P62B 4O2BB 721PA 3RFVA 2AXPA 1ZGAA 1NASA 4HCJA 4FHCA 4YAGA 3N86A 5I7SA 4ZPXA 3OU7A 3DE1X 4OX9Y 4LQDA 3DGFC 3GCDA 2E4WA 4YBZA 3ZHZA 4PXYA 1ZQPA 2EYUA 3L6DA 2B94A 2OHGA 5KNDH 3PVCA 2NQ8A 4CT5A 5DBOA 2WVAA 1XG5A 5CYGA 3Q1KA 3RUCA 1C7YA 3M8SA 2O3QA 1V5IA 4EA6A 1QE3A 3OI7A 4ZVKA 3FE2A 2C5HA 1SPXA 3LC1O 1VB3A 1RBZA 4D0LB 2ZTLA 1X1CA 9ICAA 3FZNA 3RS9A 3MRSA 1EM6A 1Q3TA 2YQ4A 1ZN7A 1R9JA 3TLEA 4PYKA 3GJSA 4YJGA 5CT4A 9ICCA 4DJFC 2JKZA 2I22A 1QQAA 2WAQF 3DZGA 2GEJA 4F3CA 1J2RA 2FMIA 3A26A 4FM9A 5GV8A 1GU7A 2O2CA 3E5RA 3NEYA 3ER9A 3SC2B 4E21A 1KO5A 4Q05A 4PS0A 1KZ7B 2DP4E 4CEHA 4MKIA 3FOAA 3A6GA 1RBQA 2WT4A 1IPEA 1K3TA 3OIFA 3U44B 1NY5A 1Q6ZA 2HSEA 2IY9A 3BRQA 1JE0A 3T4UA 3NIDB 1E5QA 3PUZA 1NR7A 3BD7A 3CLSC 4MVJG 3SKYA 4NZMA 5C8DA 4UHEA 1XLWA 2AYXA 2ZTDA 4J0FA 2XWPA 1HUQA 4UB5A 4BV2A 3B2QA 1T8SA 3SR4A 1L3CA 5H9WA 3I30X 1ZYQA 1U2SA 2C7QA 2EAUA 2B36A 4KQWA 4LZWA 4U2DA 3Q40A 4GL2A 1T1GA 4CV3A 2AEMA 2XITA 5H8WA 1LC3A 4YXWD 4H31A 2I99A 5AKHA 2IP2A 3U3RA 4P83A 5MN5A 3CE6A 1ZH2A 3T3MB 1XXHE 1T1IA 3NBUA 4L8LA 3A2KA 4DLVA 1PLJA 2R68A 3O38A 3RRYA 4TKVA 1EYZA 5JAPA 2EDUA 3FETA 4IRKA 1TA4A 5A3SA 5IBPA 2OMEA 4ND8A 4IH4A 1EK5A 4QPCA 4PC7A 3QXGA 2PKEA 3PR1A 2JFNA 4WLNA 4CTNA 5AW5A 4A0SA 2OUKA 2E5SA 3BULA 4MVCA 2GPJA 1KSJA 3B1VA 1S10A 4F8YA 1FB5A 1BDIA 3C43A 3LCCA 1S97A 1W49A 3G2IA 5IINA 4YBRA 1SBZA 4YP7A 1RJDA 2ZIVA 5E7QA 5F33A 4YJGB 1O57A 5IYZA 1G19A 1TZ2A 3W06A 4GDMA 4ID3A 4HAUA 4BLQA 3PD1A 1MX1A 2EQAA 1P6QA 2JJMA 3ASYA 1QYCA 1O6BA 2HYDA 3B6KA 2FPMA 3CUYA 5AXBA 1P0IA 5L3ZA 3W05A 5BN1A 4CEHB 1Z6AA 5EJ4A 2QM3A 5IX8A 4ITUA 5FR1A 3HDJA 4ZHQF 1T6XA 1K97A 5J40A 2GN0A 4EY4A 4BQIA 4Q66C 3DCYA 2GBLA 4YMWA 4C89A 1ZQJA 3WJ2A 4P31A 2DMRA 4UB3A 2ODTX 4M0CA 1XEXB 4OXIA 4ZV7A 1VJCA 1G8HA 5BUSA 2GO1A 4IHJF 2NP6A 5IVIA 1FYWA 1ZHOA 1CF2O 2Q1YA 3TTUA 1NC1A 1HTTA 3RT9A 3PYLA 4DIBA 4HJXA 4GFDA 4TPKA 3V8VA 1HTBA 1RHJA 4TKVB 5LIRA 2Q6VA 4DWWA 5CB1A 2IYYA 3DH0A 3BFPA 1XJQA 1LRKA 4YRBA 3AKZA 4JI0B 4M3NA 2GCGA 4ND8B 4C7ZA 2G4LA 4QZEA 2V45A 3ONNA 1TQ6A 1FA9A 3SQLA 4QOGA 3ZCQA 3L6OO 2WINI 1R64A 4GPZA 4B7XA 3BRWD 5BUZA 2XB9A 4DRZA 3TIFA 4HXGA 4R9SA 4BMXA 4L8VA 3K0BA 1QIDA 4G36A 3BJIC 5MHTA 1TC2A 4IIDA 4M0LA 2V1UA 1NZFA 2ZIVB 1E94E 5IYZB 1U7DA 4LBZA 2HI0A 4ED0A 2VPIA 2QUZA 1DO2A 3MWGA 3SAJA 1L5FA 2OH2A 2QD2A 4WCFC 5LJLA 4UM5A 5KDDA 4GU5A 3S2ZA 4LTDA 4EVRA 4UTPA 4E6EA 2ZVJA 4FFOA 1O87A 1XPRA 4YDHB 5DH9A 3OURA 4C4PA 1HZJA 3C21A 1HWYA 1A5TA 5IP5A 2HBLA 2PZBA 5IIMA 3O1IC 5KDOA 2JD1A 5B6PA 2WIJA 2Z7JA 3OEYA 3IP5A 4ILEA 3MUFA 1SXQA 3OZVA 4P9NA 1D6JA 1G42A 1L7VC 3T1YB 1C1YA 4YMLA 1MFZA 2VCHA 4L5JA 1JIKA 2GUGA 1DIAA 4ZCPA 3T06B 3T0FA 1GR0A 5C8VA 4YB8A 4XJXA 3DL2A 1Y7LA 5TGZA 2GM5A 4O2AF 3HXTA 2OBXA 1MO3A 2GWHA 2Q45A 1Z4MA 1UXKA 4BLPA 1ZK0A 2ZRDA 4ZANA 1M2EA 3DDZX 4HNHA 2A9FA 1W0JA 3F2DA 2HFJA 1YRYE 3OSUA 4IIJF 2LV8A 1SWVA 2VPTA 3JXEA 1KN5A 3G8AA 4OQFA 4AKHA 1P73A 3GV0A 1G41A 5F35A 4HQNA 2OY0A 4TZKA 3DBLA 4BGUA 4KACA 1JPUA 5CEJA 2DRIA 3BAFA 4LGCA 2Z4TA 1FJHA 5JAHA 4FSXA 1QLNA 1BC5A 3D3WB 1MH1A 1USVA 3PQFA 1TL7C 3ZHXA 2FF7A 2IVZA 4QAJA 4YMHA 1PL7A 3FNBA 2H7YA 5AKXA 4U9HS 4M8LA 1XQXA 3LCMA 3VAAA 3TIGA 4IRDA 1BH6A 1DC5A 3FAKA 5D86A 2BTQA 3VU8A 1SUSA 2YRFA 1VI6A 2OD7A 3HV0A 3IRUA 4JQOA 3TX2A 4A0RA 1H6CA 2KSOA 1DXYA 3EHDA 2PFNA 2Y1XA 4M22A 4DMLA 5F1KA 1N5IA 2NG1A 4JP5A 4DA7A 4DILA 2H3QA 3T5KA 5DSTA 5FTKA 5M7EA 4BEWA 2JAQA 1X7ZA 5ALWA 1MZVA 1OAOA 5B4VA 4YACA 4Q7QA 1TAHA 4MVYA 3NVKI 5HYVA 1KQ3A 4RESA 3MQ4A 2BCJQ 3EARA 3AX6A 5CVCA 4P98A 2HWWA 2RGNA 4EKYA 3KUCA 4DNOA 1FL9A 4Z1MD 1PJQA 1X9MA 1XMJA 1NJFA 4OLBA 3AFIA 3EGCA 4KVFA 1H65A 3ZWCA 1QTQA 1S1MA 5E2IA 1K98A 3LUPA 4EKNB 3H9CA 3TOVA 4HB0A 4BB0A 4A6DA 4ESOA 4DV6B 5IK2A 4D3YA 4F6RA 2ZJAA 1M2NA 3T3OA 2B6GA 3DBHA 3K0CA 2H1WA 1P4JA 2K4HA 3Q4GA 2G67A 3ZY2A 2CJPA 3AUJB 4KLRA 2I6FA 5LWQA 3T9BA 4OBEA 1SL0A 2FZGA 3URKA 2LI6A 1WAMA 4GBJA 2IXEA 4EM6A 4Q1EA 3JQCA 3TMKA 2H5JA 3DBLB 2HDOA 4JWTA 1T4MA 1U81A 3PLRA 5LZ5A 2YWHA 4L16A 2GLXA 3GZJA 3I6YA 3C7DB 1H42A 4YCAA 5E7MA 3L7DA 2A3VA 1JJVA 1VGQA 2IUEA 3FRHA 1P2UA 3NCHA 3RSQA 3VPBA 2ZULA 3U1TA 3PD7A 4LBWA 4QDUA 2QM0A 4E14A 4FYVA 1JJAA 4I5FA 2BTQB 4HN2A 1KDYA 3E5NA 3HUUA 4H7EA 1T3GA 2BI4A 2KSOB 2CZGA 5J0WA 3MT7A 3GNSA 2HRQA 4M7WA 5JNUA 2NZWA 5D8DA 1ZINA 4DKJA 2NM0A 3AU9A 3V5NA 5KDLA 1FDIA 2N1BA 3BGVA 3IOBA 1K7XB 1XA0A 1NE7A 3GLIE 3HP7A 2VSQA 4YRAA 3AI3A 2WEKA 1VL1A 2QGNA 1X7ZB 1UP6A 1RPLA 4ERNA 1YBMA 4O33A 4L78A 4XKJA 4B33A 1B76A 2NRTA 1W36B 3ORQA 1DPFA 4QT4A 1CJSA 1X86B 1E2KA 2VH5R 1HYBA 5JSHA 4BE7B 4E08A 4X1KA 5IZCA 1UQVA 3TRFA 3C1AA 1D8TA 1PWZA 3CX7A 4IX9A 5FL3A 2WZBA 1PD0A 3BXZA 3B6ZA 5BSGA 4BNTA 1KAGA 4MYRA 4XYLA 2XXJA 3W3AH 1ZIDA 2RIRA 3TD2A 2PI5A 4GWLA 3AKYA 1AQLA 5K0ZA 3AEQA 3H2YA 1CJUC 2GEDA 2QMOA 4QDZA 5FI5A 5TQ2A 4CCAA 1AKUA 2BPCA 3DBHB 1I36A 3L84A 3UHFA 2K8CB 3HJBA 3AR8A 1AIPA 3GJ5A 2XV1A 3U37A 2QVLA 4HN4B 2G0AA 3R7WA 3DE2X 4J8PA 4DSJA 2BFEA 3WTBA 4J1TC 2EJVA 3QU4A 4RY8A 4LVNA 4WLFA 2OPBA 4V3CA 3E70C 4HDKA 3FJOA 2GN4A 4X7MA 4WNAB 4TLMB 3ROMA 2EVWX 4QQ8A 3RVBA 5A2GA 1JG1A 1GZUA 2OKGA 3IIMA 5FWYA 4KSBA 1KJ8A 2FVYA 4HB2A 2OPHA 4OHKA 4F71A 4D4IA 4BL5A 5EUCA 3E0FA 2V4MA 2VRNA 4NJEA 3GGSA 3E9QA 5B3LA 2OHFA 1OXVA 1EFRA 3DTVD 3BF8A 2QTWB 1V5FA 4LHWA 3OSPA 1YQUA 3ORHA 1TAMA 3LBHA 4JELA 4HGQA 3KTFA 4PLFA 3LRPA 4YFVA 3QXSA 4O63O 3AU6A 4G4IA 2VPXA 1T24A 5AI9A 2H2HA 2MT9A 1WZCA 1QV9A 4X1KB 4BP1A 1E7QA 5ALIA 1W30A 4LMBA 3TLMA 3W1EA 3EY9A 4J0CA 5MFPA 2F8KA 1OAKA 1F38A 2O8VA 1UDXA 4IFEA 1SXEA 5AJHA 1C8BA 3N5CA 5DNAA 3CRNA 4ZO6A 2IU0A 5FEMA 2R8JA 1SUPA 1KE1A 3AEQB 1IWBB 1IAQA 5DBGA 4DVJA 5BXYA 5JCJD 1YB5A 5TQ2B 4QZFA 4LV5B 1ODFA 1GA1A 4BBAA 1G2IA 1GTZA 4ZTZB 3QPWA 3TI7A 1W8IA 3KXIA 2Y05A 1M5UA 1JHMA 1Z35A 4G1UC 4MVJF 5G3ZA 3HACA 3QVSA 4BXOB 4PZ0A 3R7WB 2OXEA 4PN7A 5AVYA 1WUDA 4LNUA 2BFEB 1COWD 5TQJA 5DTQA 5A3VA 3GROA 3OZ7A 3JPQA 1VDZA 3CIOA 4HDKB 1A98A 3JWEA 1EE9A 4DQPA 4C7JA 1QGOA 1L1FA 5IPFA 1Y4AE 1ZITA 3I9LA 3AJAA 3BK1A 3IQGX 1ZQFA 1T9GR 5FWYB 1LTQA 4K26A 3GDHA 2I2XB 3WLTA 3FOFC 3H1EA 4POOA 1W52X 3NNSA 3K5WA 4GKBA 3RUIA 4NJEB 5IARA 4CMBA 1AMUA 1Y4UA 2V8OA 1PNOA 2EFEB 9ICPA 3AO0B 5B57C 3HYSA 3LA6A 1G59A 3V6KA 5CDFA 1P3DA 3RKSA 4BNGA 5EHZA 4PFQA 1V5WA 5H83A 1A1VA 1NMZA 2ZXEA 2UZ1A 4FYYA 1TD9A 1LNZA 2TECE 2RQ5A 4E03A 1BDHA 2INGX 4D92A 3UXEA 3REOA 1UC8A 1WJGA 3ZBQA 3ANTA 1P3Y1 2IP4A 2O50A 5JPIA 3VNVA 1G18A 4XM2A 4QT0A 5IC6A 3W77A 3WG9A 3G3EA 1NONA 3IOYA 4G0ZA 4HB4A 4NKRA 1NUSA 2P62A 2VLIA 2GCPA 1ZJMA 4FGLA 1CC1S 4M1KA 4RD3A 2VZ0A 3X2SA 4QZAA 3LZCA 4YK7A 5I9NA 2IW3A 3D7NA 1UPAA 5LLDA 1BHSA 1GPKA 2FRDA 3QKIA 4I6GA 1PFYA 4CL0A 5IXJA 4ZC1A 4LNUB 2GKGA 3BS5A 3AY3A 2XNCA 3U19A 2W6JD 1SQ0A 4U7TB 4A8JA 4DREA 5B53A 1NVEA 4BECA 1H66A 1YMUA 3D2CA 3TD6A 5DIZA 2YN0A 3CLHA 4N9WA 3D31A 2I80A 5G2OA 4WJLA 2W8ZA 5HHIA 5J2UF 3PQ3A 4YMOA 3D43A 5J2HA 5B3JA 4M0UA 1L5MA 2QVCA 4CMAA 4DQKA 3DKKA 3DE7X 3TEMA 2AXNA 4F2DA 3GIIA 4CFZA 3O82A 4N4AA 2ID8A 4IBOA 1JGTA 4RVDA 4LXHA 2UZ1B 4E5DA 1SCDA 4DCUA 2BR0A 2CWWA 3ZE2B 1NK4A 4BNDA 2JXJA 3W5VA 1U80A 4EARA 1H8ED 3H0MB 4A16A 5LVAA 3LVQE 2IBTA 1SVNA 2PA3A 2KVSA 2K2QB 3HVKA 2GJ9A 4MWTA 2KICA 5DG9A 4PG8A 2R97A 2W6IA 1I9GA 5K8CA 3MDCA 3SZUA 4YR0A 4PSVA 4C1NA 1Z17A 5KJCA 2O6LA 3UICA 2R1UA 1X8LA 2YYYA 2I33A 5EIEA 1CDZA 3RU9A 5IG2A 3W0LB 2ZJ3A 2OV2A 3OOYA 4RT2A 1E8DA 1QHEA 2DG2A 2IOQA 3D8BA 3B1FA 2FN4A 1P0QA 3CGWA 4MX8A 4U6QA 3OTIA 5H5JA 2D7CA 1G8KA 3BS5B 1TJ4A 4B7UA 5FADA 3SF0A 2ZJYA 3A4TA 1EFHA 3DFFA 4A8JB 2WFMA 3D8RA 1CS0A 3TPFA 3T5AA 3M3PA 4BDSA 1VLQA 3KWMA 3P4UA 1ADJA 4G1CA 4BMPB 1BU8A 4ZI7F 4PHCA 3F6BX 1Q92A 1R5BA 2E82A 3M2TA 2OGWA 4G5XA 4NS1A 3W6PA 4URZR 4ON9A 5TB5A 1YE8A 4LDRA 3WX0A 1Y4DE 1F1BA 3GLTA 4AN1A 5KX5A 4EEYA 3NHPA 5KTSA 3GEGA 1TVCA 1Q2XA 1KMQA 2GKOA 4A6EA 1T8EA 1V6CA 2G83A 2FSUA 4P80A 3O8CA 1KY2A 2FRXA 1KJZA 2FW1A 3HKDA 3RSLA 1X9XA 1Z0UA 2J9XB 1IOVA 3I0NA 3D1JA 1HDZA 4IIBA 4LGMA 3ZY5A 4BNDB 1VG1A 3HYLA 4IG9A 4LYYA 1UEXC 3QPCA 1PDWA 2DWCA 2XCIA 3PUYA 3ZV6A 4N8EA 1KSPA 1E9BA 3CUEF 2YC4C 3NTOA 5AW0A 3IXMA 3BQ9A 4QUDA 5C18A 1EFVA 3VR0A 4UD6A 3IB3A 4RKFA 4UJ5A 4MB2A 5L7TA 1SO8A 4B3FX 3MTGA 3ITDA 1JJFA 1BTOA 4O5OA 1IDOA 4UDOA 1J1IA 2ECKA 3IJPA 2CD7A 2ODNA 1OZAA 3AGQA 5I5GA 4EEZA 2ABWA 4Z8YA 1L4MA 3I1IA 5JMWA 5CFOA 2IYEA 5KREA 2X3YA 4XIYA 5F9LA 4LQLA 2UZ0A 2BMFA 2NLOA 3ZJYA 5GMOA 1AKYA 4NENB 2XUAA 3GV8B 4C3OB 2OO5A 1CRLA 2CZQA 1L7OA 1C29B 4LMRA 5EZ6B 3H0EA 1B4FA 2WKPA 4LN1A 3CKMA 1HT2E 1BPXA 3ABRB 4UBOA 4MDYA 5IMBA 1CS0B 3TNDA 2Z98A 1PQYA 3KPWA 1M0SA 1TEXA 1OI2A 3KLBA 5ABPA 4I81A 2V6BA 3L77A 3JVVA 3U5ZB 1U47A 1OW5A 1TIKA 4JLJA 1TTHA 1KORA 2W2KA 4GZMA 5KX5B 3KXPA 1J5PA 1IZZA 1T5IA 1PFKA 1LW6E 1PVRA 3OJ0A 4EELA 4K9SA 3O8LA 4JOSA 4S1OA 2XC9A 1ZISA 3FIUA 2QI9C 1VMAA 3P71T 2MSWA 3H2JA 4C22A 1P60A 5BR7A 1U0JA 4GWGA 5D1HA 5L95A 2BF4A 4TMZA 2PSSA 4TSFD 4RFVA 1CEZA 4N7RA 4F06A 1Z88A 3GFPA 1XCGB 3T1NA 2R8OA 5FBZA 4F8RA 5KSZA 2BCEA 1VKHA 5HA5A 1U0SY 3KYJB 1G55A 3CKLA 1VMKA 4BNWA 1OH6A 4QTUB 2IBMA 3IE0A 3UT5A 2FH5B 1S3FA 2K60A 3DHVA 3C7AA 2C9YA 2LCIA 4KQXA 4XI9A 5KQMA 3ASUA 5TMEA 3K0EA 4ND5A 3LLCA 3CTMA 3GJQA 3GPCA 3A28A 4R8KA 4A73A 5KKCA 3LDUA 3OE7A 3ESRA 3T7RA 1X7GA 4G81A 3MAGA 2DLCX 3KDSE 3GLFE 3B3FA 1O6GA 3PY8A 3G89A 4BP8A 2W5UA 1PJZA 2QAJA 1M54A 2XVZA 5DISB 3IP7A 5ELXA 4KLZA 3H7AA 2FWAA 3I4LA 1SWWA 3T9AA 2Y27A 3UB3A 2PU5A 4EBBA 5KVVA 2C7BA 4FDTA 3SIXA 4P5PA 1PUJA 1E1QD 3S2EA 4D82A 5L6MB 2R48A 2Y0BA 2W2KB 4YAFA 3LV8A 1V4BA 4YMSA 1UINA 3JRNA 2G0TA 4KLNA 4TN5A 5WRFA 2OK8A 1QO0D 1SV4A 1PJTA 3EPRA 1XAJA 1WSAA 4PY2A 4ZC8A 2KSQA 1Y5MA 5DNEA 3W5JA 4OVKA 3DE6X 1J21A 3O7WA 2XUGA 2ZTMA 3EPPA 4YLGA 1MPTA 3T1QA 3FX2A 1T7PA 3S55A 4KVAA 5JXGA 1Z62A 1E59A 4DJJA 4ZPJA 1G3IA 1F8XA 3L4BA 2JGKA 1CY0A 3UT5B 3OD5A 3U7RA 3CF4A 1D4AA 2IGTA 4QJFB 4D6YA 1CJMA 4J0QA 4MW5A 5AJWA 3NHSA 1T9GS 1T2DA 2R8PA 1ZD5A 4FI3C 3DNPA 3RSOA 3IDWA 1CQWA 5AW6A 5B66U 3LZ6A 2IPOA 5TJHA 4N7MA 3TE6A 1JA9A 4TVOA 1TJ5A 4K81B 3BKWA 4GEKA 3DEIA 4TS9A 2GA8A 4F46A 4EO7A 4F5NA 2REBA 3IYLW 3UV6A 3MJHA 3CO5A 3T99A 5J8YA 1N48A 4BX3A 4FCTA 4KMOB 4JV0A 1DDOA 4Y2TA 1JTFA 3NWEA 1YH3A 3VAZA 4US1R 4G1FA 1HL3A 1RRGA 4XUDA 1K8XB 3A2NA 1XZMA 5CA0F 1LDGA 1XZQA 3EIXA 1PG5A 5ELMA 1VJRA 1RJFA 3U31A 4OJKA 2XF8A 1Z38A 5TS2A 4BX2A 2J5KA 2IEDA 1PL0A 1QZZA 1PL8A 1DXQA 2ZOSA 2ATLA 3DF9A 5KYXA 1A8UA 3TKLA 3ZS8A 3ENKA 2PMFA 1IB0A 2OUIA 1GQSA 1YBVA 4FYPA 1L5YA 1KYTA 4P6VF 3PNCA 4NBLA 3SY8A 4M9HA 2YN4A