2GOLA

Xray structure of gag278
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein p17 (MA)
publication title Implications for Viral Capsid Assembly from Crystal Structures of HIV-1 Gag 1-278 and CAN 133-278.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2golA00
2LYBA 2NV3A 2K4IA 1L6NA 2K4HA 1ED1A 2GOLA 2K4EA 2HMXA 2H3QA 1HEKA 2LYAA 2H3IA 2H3ZA 2N1RA 4ICAA 2JMGA 1A6SA 4JMUA 4IC9A 1HIWA 2H3FA 2H3VA 1ECWA 1UPHA 1TAMA
chains in the Genus database with same CATH superfamily
2OXOA 2GLEA 5KFSA 2HBMA 4CF4A 1XWLA 5KG5A 3ZDCA 4I2BA 2WB1F 2VA2A 3KHGA 2ZXIA 3RTVA 4J9PA 4PHEA 4DCCA 2BPGA 2H3FA 2FDRA 5D46A 1X2IA 5C0YA 4UAVA 4DLEA 5J2HA 4DFDA 2YB4A 4ECZA 1UHUA 2KK0A 1SV0C 5A0LA 4PHAA 2UVVA 3NVVA 4PGQA 4P2HA 3HW8A 3NUQA 4GXJA 2HHXA 3KZIU 4ECRA 1HIWA 3GU3A 3MR5A 5KG6A 7ICOA 2E8MA 2ASJA 1UT8A 4CNQA 5ALJA 4XRHA 4O3QA 4M6WB 2G0AA 3NRWA 2ZJAA 1J97A 5J2EA 2A1JB 8ICLA 4UB2A 3QXGA 2F1JA 5D49A 5AI8A 1ZD3A 1IV8A 1WUDA 4C8LA 3UXOA 2PMZC 4QZ8A 1N62A 2RQ5A 7ICUA 2W04A 3ORYA 4CGZA 4KITB 1FIQA 2YMLA 2EDUA 1NKEA 3IDWA 5KFKA 1Q3VA 1L3SA 5ALGA 3H8JA 2N1RA 4F4YA 4YR3A 1L8LA 1UT5A 4UW9A 1PK1A 3PMLA 2DWQA 4C4RA 2KE7A 3PW0A 4XA5A 4QZBA 2PFNA 4M9JA 2Z7JA 3I76A 4DF4A 4QZDA 3RAXA 7ICHA 3SAHA 3SMVA 3AU6A 3LYSA 3RR7A 4G3IA 4RQ1A 2W03A 5AI6A 3KZXA 3IHQB 3B0YA 2KVCA 3N4MB 4P0PB 4F72A 4ED1A 5KT4A 4BXOA 4QZEA 2MSNA 1X9SA 2EZYA 2ZTDA 3SR6A 3AL0B 1ZQOA 1J2MA 1NNLA 2XGQA 4RQ2A 1ZQXA 5KG7A 3ZD9A 2DF4B 3BQ1A 5HHIA 1S5LU 3OJSA 5ALOA 4RQ5A 3ISCA 4WJ3B 1B22A 3WKDA 1QH9A 3HX0A 3PSIA 5KFCA 1X42A 4KLJA 4ECTA 1VJ5A 1KRPA 4YMNA 5J2JA 3VCBA 4OJOA 3LVVA 1M6YA 2UVUA 4F5RA 4UB1A 2K8AA 3TKAA 8ICQA 2R8IA 3ICXA 3FC4A 3HP6A 2WAQC 2I5HA 4TQSA 4JB3A 2PFPA 5IIOA 4MF2A 4RNMA 1ZXIA 1RQNA 4OJ6A 3SV4A 3Q8PB 2KZZA 4F5NA 1X6IA 1KKXA 3L4PA 1X66A 2XC9A 1S76D 3JPRA 3QU5A 9ICPA 1V85A 4F4XA 2F8LA 2XY5A 1ZQMA 2VJ4A 4O9MA 3WK4A 1O03A 7ICVA 1YT3A 4KLMA 1GO3F 1BPXA 2HOQA 5HMMA 4EBEA 3HT3A 4LVSA 5DQGA 2KVSA 3EPIA 9ICFA 2LPEA 1SL1A 1IM4A 4FS2A 2NV3A 1TKDA 2OH2A 4YCXA 2BKEA 2ZJ8A 3WKEA 4TURA 2P66A 1EXNA 1V38A 3RJKA 9ICMA 3HILA 3QNMA 4EENA 4PH5A 5KFOA 4F2SA 4KLEA 4M2YA 5ALRA 2M9NA 1LKYB 2KICA 5AM5A 3QZ8A 1ZQZA 4RNOA 2F1IA 3BS5B 4BUGA 3VC8A 4K4HA 2NRWA 1U48A 3D2SA 1C7YA 3PZPA 1NJWA 7ICSA 1DXSA 2ZUBA 4YXJA 5J8YC 3ZDDA 3RH4A 1JMSA 3ZDEA 4EEKA 3PVXA 4O5CA 1WWUA 4NWIA 2KIVA 4MF8A 5ALFA 4F91B 1RDFA 3UXNA 4ECUA 3UXPA 8ICCA 2HBLA 1X9WA 2YB1A 5KFPA 4UAWA 3RJHA 1NK5A 2ZIXB 4PL2A 5J2AA 5J0TA 2ZTEA 3M8SA 4I2EA 1XO0A 1TAUA 4ECWA 2PFQA 4DSFA 3OHAA 2DL0A 1ZQUA 2EANA 1S0OA 4LZGA 1YZ6A 4Q8EA 4P4MA 5DB7A 2KJ8A 1Z00A 1ZOLA 1BPBA 5IIKA 2F76X 2I6XA 2C28A 2JEFA 4X5VA 1Z4OA 2EZXA 3QUCA 3A0HU 3H40A 3JPPA 5KNIA 3QEBZ 2V4QA 4C8MA 3NS1A 9ICGA 4ED8A 5IIMA 1DOQA 4DFMA 4C0ZA 3QUTA 5ALVA 5JU5A 5AKHA 3SYZA 2NO5A 5DG8A 1XSLA 2YY6A 3CP8A 3NASA 3MGVA 1KBUA 1DRGA 1SKSA 4I2JA 1ZJNA 4RUCA 3QUQA 1MSWD 3IM1A 2H3VA 5KG1A 3C2LA 1ZQWA 1ZQAA 4GIBA 3S6JA 5IIIA 5J2CA 5AKLA 1L3UA 4NM1A 5HHHA 1XC9A 1Z19A 1SV0A 5DG7A 3RH6A 2W9CB 3F2DA 1AQ6A 3ED5A 1JN3A 4UB3A 4ECYA 5D4BA 5J2GA 3PSPA 2MAXA 2ZIXA 3GV5B 2E1FA 1SWWA 1QCKA 5KFZA 3U26A 4MFCA 2L5YA 2VA3A 4B9LA 4O5EA 4OJ5A 2YMPA 2HBKA 5CP2A 4F71A 1QTMA 3Q8SB 2AXTU 2H3ZA 1N2XA 5KG3A 1BVSA 2W9BB 4ED2A 4P4PA 4Y2JA 4BWJA 2YQEA 4CCHA 4O3PA 1L7NA 4UBCA 8ICIA 4NLBA 3L5KA 3TFRA 3M9MB 4KN7A 4YR0A 2BCVA 3HKZC 2XCAA 5J2FA 3T5KA 5AHXA 2ZXHA 3NRZA 4RU9A 4ZOHC 2C2RA 2BCSA 3WK8A 5DDYA 2AJQA 2C22A 5KT5A 5AM2A 8ICVA 3NTUA 1NJXA 4M9NA 5KFGA 3ZD8A 2W9CA 1B4FA 3RJGA 1LB2B 4K4GA 5KFAA 2VIXA 3NVWA 1ZQNA 4ELUA 1MQ3A 2FMPA 4XUSA 5C5JA 2KJ5A 3BZCA 4B9TA 2ISPA 1JRPA 5JUMA 4TUSA 2WF5A 4Y2SA 2HOIA 5EE3A 5L1JA 1UPHA 4GC6A 3SAFA 2IMWP 4MHVA 5DB9A 5J0SA 7ICKA 3ZDBA 3IG5A 5K4LA 4B9UA 4QW8A 8ICXA 1ZQHA 4KLDA 5AKGA 3H8MA 1J2NA 5L1MA 5KT7A 1JIHA 4RT3A 3T5LA 1D8BA 2FPMA 5DKWA 1NJYA 2ZJ5A 1BPZA 4YP3A 3MGHA 3C5FA 2K4HA 2XY7A 4UQGA 2CPRA 3RJIA 5ALPA 2JXJA 2DGZA 5J0UA 4YXMA 9ICLA 2NRZA 5H2FU 3Q8RB 2JHDA 4MFFA 4GXIA 1PZNA 1NKBA 5F3XB 2RHFA 1ZRMA 4O3MA 2DKXA 8ICZA 2PMZF 5KFFA 1D9FA 4O3RA 1LVHA 1A0PA 4F2RA 4RQ4A 3KHRA 2ZIWB 2KOBA 3N7RC 4P0QB 1X9MA 2Y9UA 3QU4A 9ICOA 3V7KA 2W3SA 4DQPA 2KP7A 4KLUA 4MFAA 4TUPA 1OW5A 2YTUA 4IR1A 4NL9A 5AI0A 1NJZA 1SKWA 2H3QA 5BOLA 2EZZA 7ICPA 4QZ9A 3PW7A 1TAQA 1D8YA 4E0DA 4QZAA 1Y88A 5ALEA 4Q8FA 4I2HA 3THVA 5J2IA 2KD1A 3UMGA 3KFUF 2BR0A 2F2AB 1WG8A 1BGXT 3QZ7A 1V9PA 5HNKA 3RB6A 2HI0A 5L9XA 3FYHA 3TQ1A 1C20A 8ICUA 2J6SA 2NRVA 1SGGA 5KFDA 4BJQA 2H3IA 2KMDA 4DS4A 1S0VA 3PX4A 5HP4A 5DLFA 1PVPA 2PI5A 5J8YA 2JGAA 4IC9A 4RPXA 9ICHA 4KLSA 4F4ZA 3BQ0A 4RQ0A 4UAYA 3LWMA 1Z1BA 1NZPA 4O3OA 4RPZA 3JPOA 4DQSA 2BPFA 1QQ7A 8ICSA 4NV0A 3QUBA 4C80A 4JK1A 2JRZA 2ZIWA 3C21A 5EE1A 9ICIA 4IRDA 3E0FA 8ICAA 3KHLA 3H7IA 1WCNA 2WAQF 3Q8LA 1NK7A 1ZQSA 7ICIA 1LV5A 8ICGA 3ALRA 4Q43A 4Z6EA 5DB8A 2NYVA 2JMGA 5KAFU 4PHPA 2IHMA 1SL2A 1N63A 3PNCA 5L1LA 1K1SA 1NK6A 1RM6C 3SZ2A 4R8UB 2LI6A 1T4GA 4YR2A 5AKIA 5CA7A 4F5PA 2E3TA 5KFQA 3AQEA 4UAUA 3K1RB 3HPOA 2O6KA 2QB1A 2QARB 4PJ0U 4R66A 1JUDA 1NOMA 3IV6A 3H4BA 2MA1A 3HWTA 3QU9A 2AHOB 4J03A 4GXKA 4I2AA 2ZTCA 2LBOA 4KMUA 3TACB 8ICNA 1QSYA 2W7OA 2KSOB 3HRDD 4KLGA 4EX7A 2F8KA 5KFLA 1ZQBA 5T14A 5DBCA 3JPTA 9ICAA 3N7PD 3GZFA 1L3TA 4KLLA 2OCEA 1JXLA 4DOBA 7ICQA 5KFWA 2KN7A 4M6WA 8ICRA 5ALUA 2A1JA 2AGOA 2PI4A 3CNHA 7ICRA 4FZLA 3N97B 2HHQA 3E58A 4FBTA 3H0MB 3SENA 4B6JA 1ZQIA 2XY6A 3JPSA 4MEYA 2HBJA 4PHDA 4C4SA 4NLKA 3KHHA 5AKKA 2K8BB 2PXIA 2W55A 5AM4A 4R8UA 4RQ3A 2YX8A 4IS7A 3NGDA 1SL0A 2E8OA 2R8GA 2HHVA 2B21A 2QARA 3CYMA 5F9NA 3N28A 3I28A 1PK3A 1U4BA 2RP5A 2OM6A 1IIPA 4DQRA 1SV4A 1S8OA 2XIDA 3IN5A 1U45A 2GOLA 7ICGA 4DSKA 2HMXA 4AYBC 2JV3A 2KV2A 3UQ2A 5KFNA 5ALKA 3UMCA 3C1ZA 4KLHA 1V97A 4P0PA 9ICBA 3GIIA 3M9OB 3QU7A 1ZETA 3UQ0A 2XI9A 1ECWA 3KKAC 3V6HA 1CRXA 4UB6U 2DPIA 5AI4A 2DQNB 2K8CB 3BQTA 4I29A 3M1YA 1O08A 2MUTB 3C1YA 2J6TA 1TK0A 1KLNA 1U49A 5J0PA 4NL9C 1Q46A 4IQWA 3M7DA 3R9KA 4KLFA 1SXDA 9ICTA 4YFKA 2CRXA 2QLTA 4G9BA 4ED3A 4CRXA 2AQ4A 2KG5A 2ASLA 3QX7A 4YQWA 2F1HA 2A3VA 4P4OA 9ICKA 3EW9A 1TK5A 1BPDA 3MC1A 2KZ3A 1JX4A 4QW9A 2G07A 4DOCA 5KFIA 3SD7A 1ZQKA 3AUOA 4DFKA 3DEEA 4GFJA 1NZBA 2G5IB 3MFHA 2HDOA 4RT2A 5KT2A 3LK9A 1ZD4A 4QIWF 5AK5A 3MBYA 4ECVA 5CRXA 4M04A 1ZQEA 2HVIA 5EWFA 3V7LA 1T3QA 2H5XA 1RQLA 1XSPA 2GH1A 5CHGA 1TK8A 2ZUDA 2R8KA 4NLZA 3LDAA 4ELVA 1XO1A 1OXJA 2YN4A 3RBEA 3HKZF 1ED1A 1Z1VA 4DFJA 3TADA 3K75D 3ISBA 4Y2UA 2F77X 1T94A 2DKZA 3ZI4A 5CEHA 2KNJA 2V9WA 4C7ZA 2DBYA 2W11A 2WFAA 3Q8MA 2LM4A 4RQNA 3D6JA 4I28A 1LKYA 1HUZA 2DUYA 3BS5A 3AMZA 9ICVA 1BPEA 1SXEA 4RQ8A 2K4EA 2AGPA 5KG2A 4O5KA 3JPNA 4AP9A 1TVAA 5J0WA 4J9SA 4I2DA 2BDPA 2LMRA 5J0YA 2BHNA 3H0LB 1VLBA 4QZHA 3M6ZA 4QJFB 2E8NA 3OHBA 3K4GA 1KEJA 2KFNA 3DV9A 2AGQA 2EH9A 5GTHU 3WKBA 2QKQA 3T79A 4F93B 4IRKA 5ALDA 3RBDA 2ISOA 4DO9A 4Z6CA 2BQ3A 2BDUA 5J2KA 1S77D 5EE9A 5BPCA 2LKYA 3GIJA 2W54A 2BCRA 3MR2A 4F92B 3GV7B 2FLPA 1CI4A 1QLNA 2QB0B 4K4IA 2DPJA 4NJ8A 3TI0A 5J2DA 2VKQA 4FE3A 3GILA 1PVQA 3SAGA 5ALXA 4DL5A 5IILA 5AK3A 2XCPA 4JMUA 5AICA 2Q4TA 4ED0A 4FZMA 4IQVA 1ZQQA 4RQMA 2BZFA 3V7JA 2W7PA 4KMOB 1CEZA 2P35A 1XS9D 4IL6U 1RZTA 1MA7A 2D8CA 1K1QA 3IG8A 3RRGA 9ICNA 4ACOA 2FJ6A 2KKPA 4F5QA 1YZ7A 3MFIA 1L7OA 4OJPA 4GLXA 1KW4A 4CE6A 5DDMA 4DSLA 5CB1A 2AQ0A 4JV0A 3LVWA 5DLGA 5TISU 1N5WA 3SEIA 5HMLA 1XSNA 1QSLA 1D8LA 3WK6A 2I9GA 5L1KA 1N61A 5E79U 1SZHA 4FS1A 3ETRA 3H8SA 4DL3A 3C23A 1Q8KA 2OHFA 5AIAA 2E1EA 2WF9A 1ZQRA 8ICWA 4J9OA 5J0RA 4QZCA 1WCLA 2R8HA 9ICWA 4EYIB 1T3NA 5L1IA 3V72A 3RB4A 2K4IA 3F5EA 5DB6A 5DBAA 3MR6A 1P7DA 1KFSA 5CR0A 4UB5A 2BQRA 3C5GA 2IOFK 5KTQA 1IG6A 4YD1A 3RFAA 2W9BA 3M6KA 4FO6A 3PX6A 5KG4A 3H0RB 4IQTA 1TAMA 5IINA 2UVWA 1QSSA 4DL7A 3GV8B 4BDPA 2KJ9A 2ZIVB 5AM1A 2V4RA 3RJJA 1NK8A 8ICPA 9ICUA 3NVZA 9ICRA 3G6XA 5AI5A 5AKXA 4CF5A 5ALQA 4KLIA 3OJUA 2XICA 2EAOA 4DEZA 2BPCA 2B0CA 3T5JA 4UAZA 3SQIA 4GC7A 4A8EA 4USAA 3N7SC 1KDHA 3V6KA 2E8PA 8ICJA 4M9HA 3KKAA 2YMMA 1VDVA 1L7PA 2OWOA 4I2FA 5GTIU 3GFKB 2ASDA 5J29A 4UASA 4ECQA 5KFBA 1SIJA 1TE2A 2Y1IA 3TADC 3BDPA 2M0NA 4YMMA 5KFTA 1RG6A 4KX5A 3JPQA 4LJXA 4IRCA 1T7PA 5J0XA 4ZH4A 5BOMA 2D6FC 5KFEA 2XO7A 3QEAZ 1SZPA 2LYBA 4ECSA 5ALLA 1MC8A 1L3VA 4KLOA 3MR3A 3F2CA 3BQ2A 2VJ5A 3C28A 4JV2A 4QWBA 5KL8B 4J9QA 3OSNA 2IOFA 4JUZA 3FDSA 1B43A 2Y0SC 3MDCA 2HVHA 4OJLA 2HSZA 1N5XA 3SI8A 1F5SA 1XNSA 4EYHB 4QZIA 5AK4A 1RYUA 2NRTA 2W3RA 5ALMA 4M9LA 5ALSA 4TQRA 3FAHA 2HHTA 1PK1B 1X9XA 4P0QA 5EOZA 4DL4A 2J6UA 1H38A 2K89A 3FM9A 2Y9TA 1ZYQA 1KQQA 8ICYA 3G6YA 4O3NA 4C8KA 4BXOB 2HHSA 1XU4A 4IQUA 4KLQA 3CW2C 4AYBF 2PFOA 3ISDA 4US9A 3MDAA 4JWNA 1DK3A 4RUAA 1L6NA 2WF7A 2BGWA 2VA8A 4O3SA 4Z6DA 4ECXA 2FE9A 3WKAA 5J2BA 4I2CA 3LWLA 3PR4A 5J0QA 3PW5A 1N60A 4DF8A 1N48A 5DGBA 4Z6FA 1ZD2P 3WK5A 3UPQA 4UB4A 1DGJA 2K4PA 4CF3A 3V6JA 4IR9A 3BQ7A 3UM9A 8ICKA 4QWDA 4UBBA 5ALZA 5ALHA 3TANA 2P6RA 3BS7A 1S0NA 1S0MA 2GWSA 4Y2QA 1Q3UA 1MN8A 1ZQYA 1S97A 3GIMA 3WU2U 2JEIA 2YMQA 4B9VA 5AKZA 3T3FA 4Q44A 2W43A 1HJPA 3AN1A 4EX6A 4R63A 4M9GA 3O0FA 3H4DA 8ICOA 5KFYA 4I2IA 4TUQA 7ICEA 3HJEA 2LM1A 3EZ5A 4YG2A 5KFUA 4R65A 4US8A 2FMSA 2AH5A 3AEVA 1DGSA 2KHVA 1HUOA 9ICEA 3RH5A 2GO7A 5KFHA 2HCFA 4EZ6A 3QU2A 3RAQA 3RJEA 2ES6A 7ICJA 4J9LA 2ZUCA 2RRDA 2WB1C 3GIKA 5JRTA 2DFLA 2CN1A 7ICTA 1ZQGA 1TFRA 3BJYA 1UQVA 5KG0A 2AU0A 3PSTA 1UA0A 3GDXA 4J9RA 3SV3A 5FP0A 2BCQA 1KSPA 3BZKA 1JALA 5KFXA 5KT3A 1ZQDA 4NXZA 2ALZA 2F44A 3OSPA 1WWVA 2HHUA 1ZQCA 2ZIUB 9ICJA 2KSOA 1MQ2A 3EPGA 2F3NA 4RPYA 4PGXA 3E2EA 4NM2A 4YMOA 2WF6A 1A76A 2KKVA 3TFSA 5ALNA 4R64A 2EQYA 4Y2RA 4C4TA 4F5OA 4DSIA 4NLCA 2ATLA 1NK9A 4OCZA 1U9LA 9ICSA 1NKCA 3PX0A 4EELA 7ICFA 3IRUA 4HYKA 1Z4NA 4CDGA 2D3DA 4U7CA 7ICLA 4DSJA 2G09A 3M9NB 1AROP 3PMNA 2HHWA 1Z00B 4M0AA 4F8RA 3G6VA 2JH1A 5B5EU 1L7MA 3Q8KA 3EYZA 5ALTA 3EUB2 3QYPA 4Q45A 1F0MA 4Y2PA 3WK9A 3TARA 4I27A 4YVZA 4KLTA 1F44A 3KOOA 2CXYA 4DLGA 1S10A 4U6PA 2WTFA 4ED6A 5AK6A 3WKCA 1KL9A 4RQ7A 2NRXA 1U47A 1DK2A 1A6SA 4Y2XA 1X40A 2ZIUA 2R8JA 3AU2A 1KTQA 5AIBA 5B66U 3J81j 4BX9C 1OUQA 3ETLA 3MABA 5ALWA 5KL1B 3C29A 2EAMA 3RB3A 1IXRA 5ALIA 1BNPA 3IP4B 2MUTA 2OYYA 2ESEA 4PPXA 4ICAA 5EE0A 2MU2A 4F4WA 4JWMA 4C8NA 1ZQTA 4UB8U 3PR5B 3KTQA 3H8WA 4OD0A 3EWAA 4C7YA 2PKEA 2RDIA 3KD3A 5DGAA 1RYSA 1UCVA 1JI7A 1ZJMA 1CUKA 2C2EA 3PO5A 4B9SA 5AKYA 1L8OA 2LHTA 2NO4A 3OGUA 2FMQA 3PY8A 2LYHA 5CJ7A 3KBBA 2UVRA 2G5HB 2KEYA 2KFZA 5F9LA 3C2KA 4LZDA 4DQQA 5DQHA 4I2GA 2HOFA 4J9MA 2RLTA 4RQ6A 4QWCA 1HEKA 1BNOA 4RZRA 2IHNA 5KT6A 4EBDA 2VANA 2C2DA 3Q8QB 3A0BU 2JR5A 8ICEA 3T5HA 8ICFA 3PV8A 8ICHA 5EWGA 4F50A 5DBBA 2WHEA 2W8KA 1ZQLA 4Y2TA 1KFDA 1COKA 1WYGA 5G5GA 4QWEA 4DQIA 3PSFA 2BQUA 1SWVA 2IOHA 4DSEA 4NLGA 2JH7A 4J9KA 4B9MA 1QQ6A 1RXWA 5KFRA 4B9NA 1PVRA 1A77A 1KFTA 1BPYA 2G08A 3TAQA 4KN4A 5IIJA 4FBUA 2W8LA 4KTQA 1D9DA 1ZQJA 1FFUA 2FLLA 4DFPA 4OO1J 5EWEA 2R18A 3D2NA 3PW4A 3F53A 4HAIA 5CWRA 5KFMA 4EEYA 4ELTA 3AM9A 2W9MA 2BCUA 3C2MA 4QIWC 3L3FX 8ICBA 1N56A 4F4KA 4QZFA 1RYRA 2ZG6A 2JEJA 4NY8A 4YD2A 5AKEA 2G06A 1NK0A 5TZVA 4XQ8A 9ICCA 3RB0A 2KHQA 8ICTA 4UARA 4Y2VA 1FO4A 5HR7A 2FI1A 3PO4A 2FLNA 4O0IA 2IBKA 2KTQA 4DL6A 7ICNA 4Y2YA 1NI3A 5KAIU 3OPXA 3OTQA 3K1ZA 4J9NA 3NVYA 1S9FA 4M47A 2Y1JA 1COOA 3PW2A 2QB0A 5AM0A 3RRHA 1SB3C 2Y0SF 5AKJA 4KX3A 2EAPA 2FPKA 3MGIA 4YN4A 3AQFA 4ED7A 2KIWA 7ICMA 4JV1A 5KFJA 5G5HA 9ICXA 5ALYA 2A1AA 2I1QA 3B9JA 1ZQ1C 1UA1A 2W9AA 2HW3A 1RXVA 1QQ5A 1SKRA 3F5AA 2JZBB 4EZ9A 3RF9A 2JEGA 4BGDA 5DQIA 1JXEA 2ODGA 5JTIA 1URJA 9ICQA 4PL1A 1PUZA 5AI9A 4MEXA 3GQCA 2MRLA 4C8OA 1ZQFA 4DL2A 4EBCA 4FFDA 4NLNA 2LYAA 2P6UA 1B0XA 3RJFA 2OEHA 3TAPA 4QWAA 1TV9A 5HR6A 4FZNA 1NK4A 1T8EA 5J0OA 2RDJA 3D2QA 3F2BA 4DWIA 4UATA 1RPLA 2B6GA 3CRXA 4PZNA 3UMBA 1L5UA 1KN5A 1Z3EB 1ZQVA 1ZRNA 2A19A 4PGYA 3QE9Y 2KZMA 3M8RA 3ZDAA 3RR8A 1K5OA 1FEZA 4RNNA 3WK7A 1ZQPA 4QZGA 3ONNA 2Q0ZX 4BWMA 4DS5A 1ZD5A 2K60A 5KFVA 1JROA 2ZIVA 2WF8A 1X6JA 2JZBA 3B0XA 2XVTA 4F3OA 2E5SA 2FPLA 2XGPA 4QNLA 8ICMA 4PZOA 1FFVA 5AM3A 4DOAA 3I1YA 2IA6A 5DG9A 3DDHA
chains in the Genus database with same CATH topology
4C0ZA 2XIDA 2OXOA 2RRDA 3SQIA 3IN5A 2WB1C 1ZQ1C 2NV3A 3HKZF 3SAHA 4U6PA 1MA7A 3SMVA 1ED1A 2GOLA 3LYSA 3IG8A 2HMXA 3CP8A 4A8EA 2W03A 3AQEA 2H3QA 2HBMA 4ACOA 3MGVA 1KBUA 2KKPA 2F77X 1T94A 3N7SC 2CN1A 4AYBC 2KNJA 1DRGA 3F5AA 2KV2A 3KZXA 4OJPA 3PSFA 2VIXA 2KVCA 4P0PB 3RF9A 1A6SA 2WB1F 3PSTA 2KJ5A 2ZXIA 2JH7A 2ZIUA 4P0PA 2H3FA 2KD1A 2KICA 5C0YA 2H3VA 3KFUF 2XI9A 3LVWA 1ECWA 4AYBF 2F2AB 4BX9C 1PVRA 2MA1A 1CRXA 1OUQA 3AL0B 2HOIA 4BUGA 1URJA 1UPHA 2DQNB 2G08A 4PL1A 3SAFA 5KL1B 2K8CB 3C29A 3VC8A 1Z19A 2YB4A 1L6NA 2LBOA 2MRLA 2DF4B 2K4EA 5A0LA 3IP4B 3IG5A 1F44A 3F2DA 2R18A 3D2SA 3D2NA 4OO1J 2LYAA 2OYYA 2W7OA 4WJ3B 1SZHA 3F53A 2OH2A 4BJQA 2H3IA 3M7DA 2M0NA 3NUQA 1PVPA 3PSIA 4ICAA 2E1EA 2ZIUB 3H0LB 2JGAA 3PZPA 4IC9A 3PSPA 1D8BA 3M6ZA 4KX5A 2ZIXA 1HIWA 4FZNA 2E1FA 3GU3A 4QJFB 5HR6A 2CRXA 4QIWC 3L3FX 5T14A 1Z1BA 2KKVA 3VCBA 4OJOA 3LVVA 4CRXA 3D2QA 3N7PD 3F2BA 2D6FC 3GZFA 2ZG6A 4NWIA 4NLCA 2LYBA 2G06A 2G0AA 4NV0A 3NRWA 3T79A 2K4IA 2A3VA 3CRXA 2K4HA 4OJ5A 3F5EA 2CPRA 2K8AA 2KHQA 2DGZA 2HBKA 1P7DA 2HBLA 3ICXA 2LHTA 3F2CA 2YB1A 5HR7A 4FZLA 1Q3UA 2WAQC 2H3ZA 2ZIWA 2VJ5A 2BDUA 3H0MB 2ZIXB 1WUDA 4PL2A 3C28A 3RFAA 2PMZC 5KL8B 2G5HB 2JHDA 2KEYA 4OJ6A 2G07A 4CDGA 1XO0A 2HBJA 3M6KA 2LKYA 4U7CA 3E0FA 2Y0SC 3OPXA 3O0FA 2K8BB 2W04A 2G09A 3K1ZA 3H0RB 3ONNA 4OJLA 4KMOB 4CGZA 1XNSA 3DEEA 1TAMA 2RHFA 2WAQF 4GFJA 1NZBA 2HOFA 2YX8A 2G5IB 4O3MA 2KJ8A 2JH1A 2KJ9A 2PMZF 2ZIVB 4NLBA 1A0PA 2VKQA 2F76X 1HEKA 2KHVA 3ALRA 1Q3VA 2ZIVA 2Y0SF 4QIWF 4FE3A 4KX3A 1PVQA 5CRXA 3SAGA 2ZIWB 2KOBA 3N7RC 2F8LA 2N1RA 4P0QB 2JMGA 3HKZC 2VJ4A 2GH1A 2XVTA 3AQFA 4JMUA 2KIWA 2Q4TA 3CYMA 4P0QA 2E5SA 4FZMA 2XICA 1YT3A 1GO3F 4QNLA 2HOQA 2RP5A 2OM6A 1IIPA 2ZXHA 2W7PA 2Z7JA 2K89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYB A;  2NV3 A;  2K4I A;  1L6N A;  2K4H A;  1ED1 A;  2GOL A;  2K4E A;  2HMX A;  2H3Q A;  1HEK A;  2LYA A;  2H3I A;  2H3Z A;  2N1R A;  4ICA A;  2JMG A;  1A6S A;  4JMU A;  4IC9 A;  1HIW A;  2H3F A;  2H3V A;  1ECW A;  1UPH A;  1TAM A; 
#chains in the Genus database with same CATH topology
 2OXO A;  2GLE A;  5KFS A;  2HBM A;  4CF4 A;  1XWL A;  5KG5 A;  3ZDC A;  4I2B A;  2WB1 F;  2VA2 A;  3KHG A;  2ZXI A;  3RTV A;  4J9P A;  4PHE A;  4DCC A;  2BPG A;  2H3F A;  2FDR A;  5D46 A;  1X2I A;  5C0Y A;  4UAV A;  4DLE A;  5J2H A;  4DFD A;  2YB4 A;  4ECZ A;  1UHU A;  2KK0 A;  1SV0 C;  5A0L A;  4PHA A;  2UVV A;  3NVV A;  4PGQ A;  4P2H A;  3HW8 A;  3NUQ A;  4GXJ A;  2HHX A;  3KZI U;  4ECR A;  1HIW A;  3GU3 A;  3MR5 A;  5KG6 A;  7ICO A;  2E8M A;  2ASJ A;  1UT8 A;  4CNQ A;  5ALJ A;  4XRH A;  4O3Q A;  4M6W B;  2G0A A;  3NRW A;  2ZJA A;  1J97 A;  5J2E A;  2A1J B;  8ICL A;  4UB2 A;  3QXG A;  2F1J A;  5D49 A;  5AI8 A;  1ZD3 A;  1IV8 A;  1WUD A;  4C8L A;  3UXO A;  2PMZ C;  4QZ8 A;  1N62 A;  2RQ5 A;  7ICU A;  2W04 A;  3ORY A;  4CGZ A;  4KIT B;  1FIQ A;  2YML A;  2EDU A;  1NKE A;  3IDW A;  5KFK A;  1Q3V A;  1L3S A;  5ALG A;  3H8J A;  2N1R A;  4F4Y A;  4YR3 A;  1L8L A;  1UT5 A;  4UW9 A;  1PK1 A;  3PML A;  2DWQ A;  4C4R A;  2KE7 A;  3PW0 A;  4XA5 A;  4QZB A;  2PFN A;  4M9J A;  2Z7J A;  3I76 A;  4DF4 A;  4QZD A;  3RAX A;  7ICH A;  3SAH A;  3SMV A;  3AU6 A;  3LYS A;  3RR7 A;  4G3I A;  4RQ1 A;  2W03 A;  5AI6 A;  3KZX A;  3IHQ B;  3B0Y A;  2KVC A;  3N4M B;  4P0P B;  4F72 A;  4ED1 A;  5KT4 A;  4BXO A;  4QZE A;  2MSN A;  1X9S A;  2EZY A;  2ZTD A;  3SR6 A;  3AL0 B;  1ZQO A;  1J2M A;  1NNL A;  2XGQ A;  4RQ2 A;  1ZQX A;  5KG7 A;  3ZD9 A;  2DF4 B;  3BQ1 A;  5HHI A;  1S5L U;  3OJS A;  5ALO A;  4RQ5 A;  3ISC A;  4WJ3 B;  1B22 A;  3WKD A;  1QH9 A;  3HX0 A;  3PSI A;  5KFC A;  1X42 A;  4KLJ A;  4ECT A;  1VJ5 A;  1KRP A;  4YMN A;  5J2J A;  3VCB A;  4OJO A;  3LVV A;  1M6Y A;  2UVU A;  4F5R A;  4UB1 A;  2K8A A;  3TKA A;  8ICQ A;  2R8I A;  3ICX A;  3FC4 A;  3HP6 A;  2WAQ C;  2I5H A;  4TQS A;  4JB3 A;  2PFP A;  5IIO A;  4MF2 A;  4RNM A;  1ZXI A;  1RQN A;  4OJ6 A;  3SV4 A;  3Q8P B;  2KZZ A;  4F5N A;  1X6I A;  1KKX A;  3L4P A;  1X66 A;  2XC9 A;  1S76 D;  3JPR A;  3QU5 A;  9ICP A;  1V85 A;  4F4X A;  2F8L A;  2XY5 A;  1ZQM A;  2VJ4 A;  4O9M A;  3WK4 A;  1O03 A;  7ICV A;  1YT3 A;  4KLM A;  1GO3 F;  1BPX A;  2HOQ A;  5HMM A;  4EBE A;  3HT3 A;  4LVS A;  5DQG A;  2KVS A;  3EPI A;  9ICF A;  2LPE A;  1SL1 A;  1IM4 A;  4FS2 A;  2NV3 A;  1TKD A;  2OH2 A;  4YCX A;  2BKE A;  2ZJ8 A;  3WKE A;  4TUR A;  2P66 A;  1EXN A;  1V38 A;  3RJK A;  9ICM A;  3HIL A;  3QNM A;  4EEN A;  4PH5 A;  5KFO A;  4F2S A;  4KLE A;  4M2Y A;  5ALR A;  2M9N A;  1LKY B;  2KIC A;  5AM5 A;  3QZ8 A;  1ZQZ A;  4RNO A;  2F1I A;  3BS5 B;  4BUG A;  3VC8 A;  4K4H A;  2NRW A;  1U48 A;  3D2S A;  1C7Y A;  3PZP A;  1NJW A;  7ICS A;  1DXS A;  2ZUB A;  4YXJ A;  5J8Y C;  3ZDD A;  3RH4 A;  1JMS A;  3ZDE A;  4EEK A;  3PVX A;  4O5C A;  1WWU A;  4NWI A;  2KIV A;  4MF8 A;  5ALF A;  4F91 B;  1RDF A;  3UXN A;  4ECU A;  3UXP A;  8ICC A;  2HBL A;  1X9W A;  2YB1 A;  5KFP A;  4UAW A;  3RJH A;  1NK5 A;  2ZIX B;  4PL2 A;  5J2A A;  5J0T A;  2ZTE A;  3M8S A;  4I2E A;  1XO0 A;  1TAU A;  4ECW A;  2PFQ A;  4DSF A;  3OHA A;  2DL0 A;  1ZQU A;  2EAN A;  1S0O A;  4LZG A;  1YZ6 A;  4Q8E A;  4P4M A;  5DB7 A;  2KJ8 A;  1Z00 A;  1ZOL A;  1BPB A;  5IIK A;  2F76 X;  2I6X A;  2C28 A;  2JEF A;  4X5V A;  1Z4O A;  2EZX A;  3QUC A;  3A0H U;  3H40 A;  3JPP A;  5KNI A;  3QEB Z;  2V4Q A;  4C8M A;  3NS1 A;  9ICG A;  4ED8 A;  5IIM A;  1DOQ A;  4DFM A;  4C0Z A;  3QUT A;  5ALV A;  5JU5 A;  5AKH A;  3SYZ A;  2NO5 A;  5DG8 A;  1XSL A;  2YY6 A;  3CP8 A;  3NAS A;  3MGV A;  1KBU A;  1DRG A;  1SKS A;  4I2J A;  1ZJN A;  4RUC A;  3QUQ A;  1MSW D;  3IM1 A;  2H3V A;  5KG1 A;  3C2L A;  1ZQW A;  1ZQA A;  4GIB A;  3S6J A;  5III A;  5J2C A;  5AKL A;  1L3U A;  4NM1 A;  5HHH A;  1XC9 A;  1Z19 A;  1SV0 A;  5DG7 A;  3RH6 A;  2W9C B;  3F2D A;  1AQ6 A;  3ED5 A;  1JN3 A;  4UB3 A;  4ECY A;  5D4B A;  5J2G A;  3PSP A;  2MAX A;  2ZIX A;  3GV5 B;  2E1F A;  1SWW A;  1QCK A;  5KFZ A;  3U26 A;  4MFC A;  2L5Y A;  2VA3 A;  4B9L A;  4O5E A;  4OJ5 A;  2YMP A;  2HBK A;  5CP2 A;  4F71 A;  1QTM A;  3Q8S B;  2AXT U;  2H3Z A;  1N2X A;  5KG3 A;  1BVS A;  2W9B B;  4ED2 A;  4P4P A;  4Y2J A;  4BWJ A;  2YQE A;  4CCH A;  4O3P A;  1L7N A;  4UBC A;  8ICI A;  4NLB A;  3L5K A;  3TFR A;  3M9M B;  4KN7 A;  4YR0 A;  2BCV A;  3HKZ C;  2XCA A;  5J2F A;  3T5K A;  5AHX A;  2ZXH A;  3NRZ A;  4RU9 A;  4ZOH C;  2C2R A;  2BCS A;  3WK8 A;  5DDY A;  2AJQ A;  2C22 A;  5KT5 A;  5AM2 A;  8ICV A;  3NTU A;  1NJX A;  4M9N A;  5KFG A;  3ZD8 A;  2W9C A;  1B4F A;  3RJG A;  1LB2 B;  4K4G A;  5KFA A;  2VIX A;  3NVW A;  1ZQN A;  4ELU A;  1MQ3 A;  2FMP A;  4XUS A;  5C5J A;  2KJ5 A;  3BZC A;  4B9T A;  2ISP A;  1JRP A;  5JUM A;  4TUS A;  2WF5 A;  4Y2S A;  2HOI A;  5EE3 A;  5L1J A;  1UPH A;  4GC6 A;  3SAF A;  2IMW P;  4MHV A;  5DB9 A;  5J0S A;  7ICK A;  3ZDB A;  3IG5 A;  5K4L A;  4B9U A;  4QW8 A;  8ICX A;  1ZQH A;  4KLD A;  5AKG A;  3H8M A;  1J2N A;  5L1M A;  5KT7 A;  1JIH A;  4RT3 A;  3T5L A;  1D8B A;  2FPM A;  5DKW A;  1NJY A;  2ZJ5 A;  1BPZ A;  4YP3 A;  3MGH A;  3C5F A;  2K4H A;  2XY7 A;  4UQG A;  2CPR A;  3RJI A;  5ALP A;  2JXJ A;  2DGZ A;  5J0U A;  4YXM A;  9ICL A;  2NRZ A;  5H2F U;  3Q8R B;  2JHD A;  4MFF A;  4GXI A;  1PZN A;  1NKB A;  5F3X B;  2RHF A;  1ZRM A;  4O3M A;  2DKX A;  8ICZ A;  2PMZ F;  5KFF A;  1D9F A;  4O3R A;  1LVH A;  1A0P A;  4F2R A;  4RQ4 A;  3KHR A;  2ZIW B;  2KOB A;  3N7R C;  4P0Q B;  1X9M A;  2Y9U A;  3QU4 A;  9ICO A;  3V7K A;  2W3S A;  4DQP A;  2KP7 A;  4KLU A;  4MFA A;  4TUP A;  1OW5 A;  2YTU A;  4IR1 A;  4NL9 A;  5AI0 A;  1NJZ A;  1SKW A;  2H3Q A;  5BOL A;  2EZZ A;  7ICP A;  4QZ9 A;  3PW7 A;  1TAQ A;  1D8Y A;  4E0D A;  4QZA A;  1Y88 A;  5ALE A;  4Q8F A;  4I2H A;  3THV A;  5J2I A;  2KD1 A;  3UMG A;  3KFU F;  2BR0 A;  2F2A B;  1WG8 A;  1BGX T;  3QZ7 A;  1V9P A;  5HNK A;  3RB6 A;  2HI0 A;  5L9X A;  3FYH A;  3TQ1 A;  1C20 A;  8ICU A;  2J6S A;  2NRV A;  1SGG A;  5KFD A;  4BJQ A;  2H3I A;  2KMD A;  4DS4 A;  1S0V A;  3PX4 A;  5HP4 A;  5DLF A;  1PVP A;  2PI5 A;  5J8Y A;  2JGA A;  4IC9 A;  4RPX A;  9ICH A;  4KLS A;  4F4Z A;  3BQ0 A;  4RQ0 A;  4UAY A;  3LWM A;  1Z1B A;  1NZP A;  4O3O A;  4RPZ A;  3JPO A;  4DQS A;  2BPF A;  1QQ7 A;  8ICS A;  4NV0 A;  3QUB A;  4C80 A;  4JK1 A;  2JRZ A;  2ZIW A;  3C21 A;  5EE1 A;  9ICI A;  4IRD A;  3E0F A;  8ICA A;  3KHL A;  3H7I A;  1WCN A;  2WAQ F;  3Q8L A;  1NK7 A;  1ZQS A;  7ICI A;  1LV5 A;  8ICG A;  3ALR A;  4Q43 A;  4Z6E A;  5DB8 A;  2NYV A;  2JMG A;  5KAF U;  4PHP A;  2IHM A;  1SL2 A;  1N63 A;  3PNC A;  5L1L A;  1K1S A;  1NK6 A;  1RM6 C;  3SZ2 A;  4R8U B;  2LI6 A;  1T4G A;  4YR2 A;  5AKI A;  5CA7 A;  4F5P A;  2E3T A;  5KFQ A;  3AQE A;  4UAU A;  3K1R B;  3HPO A;  2O6K A;  2QB1 A;  2QAR B;  4PJ0 U;  4R66 A;  1JUD A;  1NOM A;  3IV6 A;  3H4B A;  2MA1 A;  3HWT A;  3QU9 A;  2AHO B;  4J03 A;  4GXK A;  4I2A A;  2ZTC A;  2LBO A;  4KMU A;  3TAC B;  8ICN A;  1QSY A;  2W7O A;  2KSO B;  3HRD D;  4KLG A;  4EX7 A;  2F8K A;  5KFL A;  1ZQB A;  5T14 A;  5DBC A;  3JPT A;  9ICA A;  3N7P D;  3GZF A;  1L3T A;  4KLL A;  2OCE A;  1JXL A;  4DOB A;  7ICQ A;  5KFW A;  2KN7 A;  4M6W A;  8ICR A;  5ALU A;  2A1J A;  2AGO A;  2PI4 A;  3CNH A;  7ICR A;  4FZL A;  3N97 B;  2HHQ A;  3E58 A;  4FBT A;  3H0M B;  3SEN A;  4B6J A;  1ZQI A;  2XY6 A;  3JPS A;  4MEY A;  2HBJ A;  4PHD A;  4C4S A;  4NLK A;  3KHH A;  5AKK A;  2K8B B;  2PXI A;  2W55 A;  5AM4 A;  4R8U A;  4RQ3 A;  2YX8 A;  4IS7 A;  3NGD A;  1SL0 A;  2E8O A;  2R8G A;  2HHV A;  2B21 A;  2QAR A;  3CYM A;  5F9N A;  3N28 A;  3I28 A;  1PK3 A;  1U4B A;  2RP5 A;  2OM6 A;  1IIP A;  4DQR A;  1SV4 A;  1S8O A;  2XID A;  3IN5 A;  1U45 A;  2GOL A;  7ICG A;  4DSK A;  2HMX A;  4AYB C;  2JV3 A;  2KV2 A;  3UQ2 A;  5KFN A;  5ALK A;  3UMC A;  3C1Z A;  4KLH A;  1V97 A;  4P0P A;  9ICB A;  3GII A;  3M9O B;  3QU7 A;  1ZET A;  3UQ0 A;  2XI9 A;  1ECW A;  3KKA C;  3V6H A;  1CRX A;  4UB6 U;  2DPI A;  5AI4 A;  2DQN B;  2K8C B;  3BQT A;  4I29 A;  3M1Y A;  1O08 A;  2MUT B;  3C1Y A;  2J6T A;  1TK0 A;  1KLN A;  1U49 A;  5J0P A;  4NL9 C;  1Q46 A;  4IQW A;  3M7D A;  3R9K A;  4KLF A;  1SXD A;  9ICT A;  4YFK A;  2CRX A;  2QLT A;  4G9B A;  4ED3 A;  4CRX A;  2AQ4 A;  2KG5 A;  2ASL A;  3QX7 A;  4YQW A;  2F1H A;  2A3V A;  4P4O A;  9ICK A;  3EW9 A;  1TK5 A;  1BPD A;  3MC1 A;  2KZ3 A;  1JX4 A;  4QW9 A;  2G07 A;  4DOC A;  5KFI A;  3SD7 A;  1ZQK A;  3AUO A;  4DFK A;  3DEE A;  4GFJ A;  1NZB A;  2G5I B;  3MFH A;  2HDO A;  4RT2 A;  5KT2 A;  3LK9 A;  1ZD4 A;  4QIW F;  5AK5 A;  3MBY A;  4ECV A;  5CRX A;  4M04 A;  1ZQE A;  2HVI A;  5EWF A;  3V7L A;  1T3Q A;  2H5X A;  1RQL A;  1XSP A;  2GH1 A;  5CHG A;  1TK8 A;  2ZUD A;  2R8K A;  4NLZ A;  3LDA A;  4ELV A;  1XO1 A;  1OXJ A;  2YN4 A;  3RBE A;  3HKZ F;  1ED1 A;  1Z1V A;  4DFJ A;  3TAD A;  3K75 D;  3ISB A;  4Y2U A;  2F77 X;  1T94 A;  2DKZ A;  3ZI4 A;  5CEH A;  2KNJ A;  2V9W A;  4C7Z A;  2DBY A;  2W11 A;  2WFA A;  3Q8M A;  2LM4 A;  4RQN A;  3D6J A;  4I28 A;  1LKY A;  1HUZ A;  2DUY A;  3BS5 A;  3AMZ A;  9ICV A;  1BPE A;  1SXE A;  4RQ8 A;  2K4E A;  2AGP A;  5KG2 A;  4O5K A;  3JPN A;  4AP9 A;  1TVA A;  5J0W A;  4J9S A;  4I2D A;  2BDP A;  2LMR A;  5J0Y A;  2BHN A;  3H0L B;  1VLB A;  4QZH A;  3M6Z A;  4QJF B;  2E8N A;  3OHB A;  3K4G A;  1KEJ A;  2KFN A;  3DV9 A;  2AGQ A;  2EH9 A;  5GTH U;  3WKB A;  2QKQ A;  3T79 A;  4F93 B;  4IRK A;  5ALD A;  3RBD A;  2ISO A;  4DO9 A;  4Z6C A;  2BQ3 A;  2BDU A;  5J2K A;  1S77 D;  5EE9 A;  5BPC A;  2LKY A;  3GIJ A;  2W54 A;  2BCR A;  3MR2 A;  4F92 B;  3GV7 B;  2FLP A;  1CI4 A;  1QLN A;  2QB0 B;  4K4I A;  2DPJ A;  4NJ8 A;  3TI0 A;  5J2D A;  2VKQ A;  4FE3 A;  3GIL A;  1PVQ A;  3SAG A;  5ALX A;  4DL5 A;  5IIL A;  5AK3 A;  2XCP A;  4JMU A;  5AIC A;  2Q4T A;  4ED0 A;  4FZM A;  4IQV A;  1ZQQ A;  4RQM A;  2BZF A;  3V7J A;  2W7P A;  4KMO B;  1CEZ A;  2P35 A;  1XS9 D;  4IL6 U;  1RZT A;  1MA7 A;  2D8C A;  1K1Q A;  3IG8 A;  3RRG A;  9ICN A;  4ACO A;  2FJ6 A;  2KKP A;  4F5Q A;  1YZ7 A;  3MFI A;  1L7O A;  4OJP A;  4GLX A;  1KW4 A;  4CE6 A;  5DDM A;  4DSL A;  5CB1 A;  2AQ0 A;  4JV0 A;  3LVW A;  5DLG A;  5TIS U;  1N5W A;  3SEI A;  5HML A;  1XSN A;  1QSL A;  1D8L A;  3WK6 A;  2I9G A;  5L1K A;  1N61 A;  5E79 U;  1SZH A;  4FS1 A;  3ETR A;  3H8S A;  4DL3 A;  3C23 A;  1Q8K A;  2OHF A;  5AIA A;  2E1E A;  2WF9 A;  1ZQR A;  8ICW A;  4J9O A;  5J0R A;  4QZC A;  1WCL A;  2R8H A;  9ICW A;  4EYI B;  1T3N A;  5L1I A;  3V72 A;  3RB4 A;  2K4I A;  3F5E A;  5DB6 A;  5DBA A;  3MR6 A;  1P7D A;  1KFS A;  5CR0 A;  4UB5 A;  2BQR A;  3C5G A;  2IOF K;  5KTQ A;  1IG6 A;  4YD1 A;  3RFA A;  2W9B A;  3M6K A;  4FO6 A;  3PX6 A;  5KG4 A;  3H0R B;  4IQT A;  1TAM A;  5IIN A;  2UVW A;  1QSS A;  4DL7 A;  3GV8 B;  4BDP A;  2KJ9 A;  2ZIV B;  5AM1 A;  2V4R A;  3RJJ A;  1NK8 A;  8ICP A;  9ICU A;  3NVZ A;  9ICR A;  3G6X A;  5AI5 A;  5AKX A;  4CF5 A;  5ALQ A;  4KLI A;  3OJU A;  2XIC A;  2EAO A;  4DEZ A;  2BPC A;  2B0C A;  3T5J A;  4UAZ A;  3SQI A;  4GC7 A;  4A8E A;  4USA A;  3N7S C;  1KDH A;  3V6K A;  2E8P A;  8ICJ A;  4M9H A;  3KKA A;  2YMM A;  1VDV A;  1L7P A;  2OWO A;  4I2F A;  5GTI U;  3GFK B;  2ASD A;  5J29 A;  4UAS A;  4ECQ A;  5KFB A;  1SIJ A;  1TE2 A;  2Y1I A;  3TAD C;  3BDP A;  2M0N A;  4YMM A;  5KFT A;  1RG6 A;  4KX5 A;  3JPQ A;  4LJX A;  4IRC A;  1T7P A;  5J0X A;  4ZH4 A;  5BOM A;  2D6F C;  5KFE A;  2XO7 A;  3QEA Z;  1SZP A;  2LYB A;  4ECS A;  5ALL A;  1MC8 A;  1L3V A;  4KLO A;  3MR3 A;  3F2C A;  3BQ2 A;  2VJ5 A;  3C28 A;  4JV2 A;  4QWB A;  5KL8 B;  4J9Q A;  3OSN A;  2IOF A;  4JUZ A;  3FDS A;  1B43 A;  2Y0S C;  3MDC A;  2HVH A;  4OJL A;  2HSZ A;  1N5X A;  3SI8 A;  1F5S A;  1XNS A;  4EYH B;  4QZI A;  5AK4 A;  1RYU A;  2NRT A;  2W3R A;  5ALM A;  4M9L A;  5ALS A;  4TQR A;  3FAH A;  2HHT A;  1PK1 B;  1X9X A;  4P0Q A;  5EOZ A;  4DL4 A;  2J6U A;  1H38 A;  2K89 A;  3FM9 A;  2Y9T A;  1ZYQ A;  1KQQ A;  8ICY A;  3G6Y A;  4O3N A;  4C8K A;  4BXO B;  2HHS A;  1XU4 A;  4IQU A;  4KLQ A;  3CW2 C;  4AYB F;  2PFO A;  3ISD A;  4US9 A;  3MDA A;  4JWN A;  1DK3 A;  4RUA A;  1L6N A;  2WF7 A;  2BGW A;  2VA8 A;  4O3S A;  4Z6D A;  4ECX A;  2FE9 A;  3WKA A;  5J2B A;  4I2C A;  3LWL A;  3PR4 A;  5J0Q A;  3PW5 A;  1N60 A;  4DF8 A;  1N48 A;  5DGB A;  4Z6F A;  1ZD2 P;  3WK5 A;  3UPQ A;  4UB4 A;  1DGJ A;  2K4P A;  4CF3 A;  3V6J A;  4IR9 A;  3BQ7 A;  3UM9 A;  8ICK A;  4QWD A;  4UBB A;  5ALZ A;  5ALH A;  3TAN A;  2P6R A;  3BS7 A;  1S0N A;  1S0M A;  2GWS A;  4Y2Q A;  1Q3U A;  1MN8 A;  1ZQY A;  1S97 A;  3GIM A;  3WU2 U;  2JEI A;  2YMQ A;  4B9V A;  5AKZ A;  3T3F A;  4Q44 A;  2W43 A;  1HJP A;  3AN1 A;  4EX6 A;  4R63 A;  4M9G A;  3O0F A;  3H4D A;  8ICO A;  5KFY A;  4I2I A;  4TUQ A;  7ICE A;  3HJE A;  2LM1 A;  3EZ5 A;  4YG2 A;  5KFU A;  4R65 A;  4US8 A;  2FMS A;  2AH5 A;  3AEV A;  1DGS A;  2KHV A;  1HUO A;  9ICE A;  3RH5 A;  2GO7 A;  5KFH A;  2HCF A;  4EZ6 A;  3QU2 A;  3RAQ A;  3RJE A;  2ES6 A;  7ICJ A;  4J9L A;  2ZUC A;  2RRD A;  2WB1 C;  3GIK A;  5JRT A;  2DFL A;  2CN1 A;  7ICT A;  1ZQG A;  1TFR A;  3BJY A;  1UQV A;  5KG0 A;  2AU0 A;  3PST A;  1UA0 A;  3GDX A;  4J9R A;  3SV3 A;  5FP0 A;  2BCQ A;  1KSP A;  3BZK A;  1JAL A;  5KFX A;  5KT3 A;  1ZQD A;  4NXZ A;  2ALZ A;  2F44 A;  3OSP A;  1WWV A;  2HHU A;  1ZQC A;  2ZIU B;  9ICJ A;  2KSO A;  1MQ2 A;  3EPG A;  2F3N A;  4RPY A;  4PGX A;  3E2E A;  4NM2 A;  4YMO A;  2WF6 A;  1A76 A;  2KKV A;  3TFS A;  5ALN A;  4R64 A;  2EQY A;  4Y2R A;  4C4T A;  4F5O A;  4DSI A;  4NLC A;  2ATL A;  1NK9 A;  4OCZ A;  1U9L A;  9ICS A;  1NKC A;  3PX0 A;  4EEL A;  7ICF A;  3IRU A;  4HYK A;  1Z4N A;  4CDG A;  2D3D A;  4U7C A;  7ICL A;  4DSJ A;  2G09 A;  3M9N B;  1ARO P;  3PMN A;  2HHW A;  1Z00 B;  4M0A A;  4F8R A;  3G6V A;  2JH1 A;  5B5E U;  1L7M A;  3Q8K A;  3EYZ A;  5ALT A;  3EUB 2;  3QYP A;  4Q45 A;  1F0M A;  4Y2P A;  3WK9 A;  3TAR A;  4I27 A;  4YVZ A;  4KLT A;  1F44 A;  3KOO A;  2CXY A;  4DLG A;  1S10 A;  4U6P A;  2WTF A;  4ED6 A;  5AK6 A;  3WKC A;  1KL9 A;  4RQ7 A;  2NRX A;  1U47 A;  1DK2 A;  1A6S A;  4Y2X A;  1X40 A;  2ZIU A;  2R8J A;  3AU2 A;  1KTQ A;  5AIB A;  5B66 U;  3J81 j;  4BX9 C;  1OUQ A;  3ETL A;  3MAB A;  5ALW A;  5KL1 B;  3C29 A;  2EAM A;  3RB3 A;  1IXR A;  5ALI A;  1BNP A;  3IP4 B;  2MUT A;  2OYY A;  2ESE A;  4PPX A;  4ICA A;  5EE0 A;  2MU2 A;  4F4W A;  4JWM A;  4C8N A;  1ZQT A;  4UB8 U;  3PR5 B;  3KTQ A;  3H8W A;  4OD0 A;  3EWA A;  4C7Y A;  2PKE A;  2RDI A;  3KD3 A;  5DGA A;  1RYS A;  1UCV A;  1JI7 A;  1ZJM A;  1CUK A;  2C2E A;  3PO5 A;  4B9S A;  5AKY A;  1L8O A;  2LHT A;  2NO4 A;  3OGU A;  2FMQ A;  3PY8 A;  2LYH A;  5CJ7 A;  3KBB A;  2UVR A;  2G5H B;  2KEY A;  2KFZ A;  5F9L A;  3C2K A;  4LZD A;  4DQQ A;  5DQH A;  4I2G A;  2HOF A;  4J9M A;  2RLT A;  4RQ6 A;  4QWC A;  1HEK A;  1BNO A;  4RZR A;  2IHN A;  5KT6 A;  4EBD A;  2VAN A;  2C2D A;  3Q8Q B;  3A0B U;  2JR5 A;  8ICE A;  3T5H A;  8ICF A;  3PV8 A;  8ICH A;  5EWG A;  4F50 A;  5DBB A;  2WHE A;  2W8K A;  1ZQL A;  4Y2T A;  1KFD A;  1COK A;  1WYG A;  5G5G A;  4QWE A;  4DQI A;  3PSF A;  2BQU A;  1SWV A;  2IOH A;  4DSE A;  4NLG A;  2JH7 A;  4J9K A;  4B9M A;  1QQ6 A;  1RXW A;  5KFR A;  4B9N A;  1PVR A;  1A77 A;  1KFT A;  1BPY A;  2G08 A;  3TAQ A;  4KN4 A;  5IIJ A;  4FBU A;  2W8L A;  4KTQ A;  1D9D A;  1ZQJ A;  1FFU A;  2FLL A;  4DFP A;  4OO1 J;  5EWE A;  2R18 A;  3D2N A;  3PW4 A;  3F53 A;  4HAI A;  5CWR A;  5KFM A;  4EEY A;  4ELT A;  3AM9 A;  2W9M A;  2BCU A;  3C2M A;  4QIW C;  3L3F X;  8ICB A;  1N56 A;  4F4K A;  4QZF A;  1RYR A;  2ZG6 A;  2JEJ A;  4NY8 A;  4YD2 A;  5AKE A;  2G06 A;  1NK0 A;  5TZV A;  4XQ8 A;  9ICC A;  3RB0 A;  2KHQ A;  8ICT A;  4UAR A;  4Y2V A;  1FO4 A;  5HR7 A;  2FI1 A;  3PO4 A;  2FLN A;  4O0I A;  2IBK A;  2KTQ A;  4DL6 A;  7ICN A;  4Y2Y A;  1NI3 A;  5KAI U;  3OPX A;  3OTQ A;  3K1Z A;  4J9N A;  3NVY A;  1S9F A;  4M47 A;  2Y1J A;  1COO A;  3PW2 A;  2QB0 A;  5AM0 A;  3RRH A;  1SB3 C;  2Y0S F;  5AKJ A;  4KX3 A;  2EAP A;  2FPK A;  3MGI A;  4YN4 A;  3AQF A;  4ED7 A;  2KIW A;  7ICM A;  4JV1 A;  5KFJ A;  5G5H A;  9ICX A;  5ALY A;  2A1A A;  2I1Q A;  3B9J A;  1ZQ1 C;  1UA1 A;  2W9A A;  2HW3 A;  1RXV A;  1QQ5 A;  1SKR A;  3F5A A;  2JZB B;  4EZ9 A;  3RF9 A;  2JEG A;  4BGD A;  5DQI A;  1JXE A;  2ODG A;  5JTI A;  1URJ A;  9ICQ A;  4PL1 A;  1PUZ A;  5AI9 A;  4MEX A;  3GQC A;  2MRL A;  4C8O A;  1ZQF A;  4DL2 A;  4EBC A;  4FFD A;  4NLN A;  2LYA A;  2P6U A;  1B0X A;  3RJF A;  2OEH A;  3TAP A;  4QWA A;  1TV9 A;  5HR6 A;  4FZN A;  1NK4 A;  1T8E A;  5J0O A;  2RDJ A;  3D2Q A;  3F2B A;  4DWI A;  4UAT A;  1RPL A;  2B6G A;  3CRX A;  4PZN A;  3UMB A;  1L5U A;  1KN5 A;  1Z3E B;  1ZQV A;  1ZRN A;  2A19 A;  4PGY A;  3QE9 Y;  2KZM A;  3M8R A;  3ZDA A;  3RR8 A;  1K5O A;  1FEZ A;  4RNN A;  3WK7 A;  1ZQP A;  4QZG A;  3ONN A;  2Q0Z X;  4BWM A;  4DS5 A;  1ZD5 A;  2K60 A;  5KFV A;  1JRO A;  2ZIV A;  2WF8 A;  1X6J A;  2JZB A;  3B0X A;  2XVT A;  4F3O A;  2E5S A;  2FPL A;  2XGP A;  4QNL A;  8ICM A;  4PZO A;  1FFV A;  5AM3 A;  4DOA A;  3I1Y A;  2IA6 A;  5DG9 A;  3DDH A; 
#chains in the Genus database with same CATH homology
 4C0Z A;  2XID A;  2OXO A;  2RRD A;  3SQI A;  3IN5 A;  2WB1 C;  1ZQ1 C;  2NV3 A;  3HKZ F;  3SAH A;  4U6P A;  1MA7 A;  3SMV A;  1ED1 A;  2GOL A;  3LYS A;  3IG8 A;  2HMX A;  3CP8 A;  4A8E A;  2W03 A;  3AQE A;  2H3Q A;  2HBM A;  4ACO A;  3MGV A;  1KBU A;  2KKP A;  2F77 X;  1T94 A;  3N7S C;  2CN1 A;  4AYB C;  2KNJ A;  1DRG A;  3F5A A;  2KV2 A;  3KZX A;  4OJP A;  3PSF A;  2VIX A;  2KVC A;  4P0P B;  3RF9 A;  1A6S A;  2WB1 F;  3PST A;  2KJ5 A;  2ZXI A;  2JH7 A;  2ZIU A;  4P0P A;  2H3F A;  2KD1 A;  2KIC A;  5C0Y A;  2H3V A;  3KFU F;  2XI9 A;  3LVW A;  1ECW A;  4AYB F;  2F2A B;  4BX9 C;  1PVR A;  2MA1 A;  1CRX A;  1OUQ A;  3AL0 B;  2HOI A;  4BUG A;  1URJ A;  1UPH A;  2DQN B;  2G08 A;  4PL1 A;  3SAF A;  5KL1 B;  2K8C B;  3C29 A;  3VC8 A;  1Z19 A;  2YB4 A;  1L6N A;  2LBO A;  2MRL A;  2DF4 B;  2K4E A;  5A0L A;  3IP4 B;  3IG5 A;  1F44 A;  3F2D A;  2R18 A;  3D2S A;  3D2N A;  4OO1 J;  2LYA A;  2OYY A;  2W7O A;  4WJ3 B;  1SZH A;  3F53 A;  2OH2 A;  4BJQ A;  2H3I A;  3M7D A;  2M0N A;  3NUQ A;  1PVP A;  3PSI A;  4ICA A;  2E1E A;  2ZIU B;  3H0L B;  2JGA A;  3PZP A;  4IC9 A;  3PSP A;  1D8B A;  3M6Z A;  4KX5 A;  2ZIX A;  1HIW A;  4FZN A;  2E1F A;  3GU3 A;  4QJF B;  5HR6 A;  2CRX A;  4QIW C;  3L3F X;  5T14 A;  1Z1B A;  2KKV A;  3VCB A;  4OJO A;  3LVV A;  4CRX A;  3D2Q A;  3N7P D;  3F2B A;  2D6F C;  3GZF A;  2ZG6 A;  4NWI A;  4NLC A;  2LYB A;  2G06 A;  2G0A A;  4NV0 A;  3NRW A;  3T79 A;  2K4I A;  2A3V A;  3CRX A;  2K4H A;  4OJ5 A;  3F5E A;  2CPR A;  2K8A A;  2KHQ A;  2DGZ A;  2HBK A;  1P7D A;  2HBL A;  3ICX A;  2LHT A;  3F2C A;  2YB1 A;  5HR7 A;  4FZL A;  1Q3U A;  2WAQ C;  2H3Z A;  2ZIW A;  2VJ5 A;  2BDU A;  3H0M B;  2ZIX B;  1WUD A;  4PL2 A;  3C28 A;  3RFA A;  2PMZ C;  5KL8 B;  2G5H B;  2JHD A;  2KEY A;  4OJ6 A;  2G07 A;  4CDG A;  1XO0 A;  2HBJ A;  3M6K A;  2LKY A;  4U7C A;  3E0F A;  2Y0S C;  3OPX A;  3O0F A;  2K8B B;  2W04 A;  2G09 A;  3K1Z A;  3H0R B;  3ONN A;  4OJL A;  4KMO B;  4CGZ A;  1XNS A;  3DEE A;  1TAM A;  2RHF A;  2WAQ F;  4GFJ A;  1NZB A;  2HOF A;  2YX8 A;  2G5I B;  4O3M A;  2KJ8 A;  2JH1 A;  2KJ9 A;  2PMZ F;  2ZIV B;  4NLB A;  1A0P A;  2VKQ A;  2F76 X;  1HEK A;  2KHV A;  3ALR A;  1Q3V A;  2ZIV A;  2Y0S F;  4QIW F;  4FE3 A;  4KX3 A;  1PVQ A;  5CRX A;  3SAG A;  2ZIW B;  2KOB A;  3N7R C;  2F8L A;  2N1R A;  4P0Q B;  2JMG A;  3HKZ C;  2VJ4 A;  2GH1 A;  2XVT A;  3AQF A;  4JMU A;  2KIW A;  2Q4T A;  3CYM A;  4P0Q A;  2E5S A;  4FZM A;  2XIC A;  1YT3 A;  1GO3 F;  4QNL A;  2HOQ A;  2RP5 A;  2OM6 A;  1IIP A;  2ZXH A;  2W7P A;  2Z7J A;  2K89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...