2GOLA

Xray structure of gag278
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Implications for Viral Capsid Assembly from Crystal Structures of HIV-1 Gag 1-278 and CAN 133-278.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Matrix protein p17 (MA)
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2golA00
1HEKA 2N1RA 2H3QA 2NV3A 4JMUA 2HMXA 1L6NA 2LYBA 2H3ZA 1TAMA 2H3VA 2K4HA 2GOLA 2H3FA 1ED1A 2K4EA 1ECWA 4IC9A 1HIWA 4ICAA 2H3IA 2JMGA 1A6SA 1UPHA 2K4IA 2LYAA
chains in the Genus database with same CATH superfamily
1N62A 4F50A 1L6NA 4MHVA 1T4GA 3WK6A 1T3QA 1ZQZA 5TZVA 1HJPA 4DFMA 4BXOA 2K4HA 4F92B 3T5HA 3DV9A 2VIXA 2W9BA 3MR2A 4O3PA 4JUZA 3C2LA 4Y2SA 2Y0SC 3OHAA 5J0UA 2ZIUB 2M9NA 4PHAA 5ALUA 1SWWA 2BPCA 2W9MA 9ICGA 3N7PD 5IINA 2KFNA 1LB2B 1SXDA 3KKAC 5AI4A 1U45A 1XC9A 4I28A 4OJ6A 2FPLA 1NOMA 1BPDA 5KFZA 1Y88A 3KKAA 1NJZA 4F4WA 2WF5A 1UQVA 2W8KA 3UQ2A 5KT6A 1L7MA 2JH1A 2ZG6A 5CWRA 2KHVA 5KFMA 3K4GA 5KFRA 5ALSA 5ALJA 2FI1A 2YMLA 1TKDA 1TV9A 2KKPA 4Y2XA 3RH5A 1D8LA 2LYHA 1NKCA 5DB7A 1IG6A 4O0IA 2QARB 2PMZC 5CB1A 4PHDA 5DQGA 1K1QA 3AEVA 2K4PA 4RQ3A 3AMZA 1K1SA 1XS9D 1ZQHA 1AQ6A 4FZMA 3PVXA 4TQSA 1ZQKA 2HBKA 4C4RA 1TK0A 2I5HA 4NY8A 3PR5B 1ZJNA 4RNNA 1N5WA 4IR1A 5B5EU 4I2AA 2ZUBA 4KLQA 4DS5A 8ICVA 2IA6A 5KFVA 4TUPA 2JGAA 2WB1F 3M1YA 4I2IA 3V6HA 5AIBA 1PK1A 3B0YA 5AKIA 1KSPA 3TADA 5ALEA 2QB1A 2PFPA 5DBBA 2JEIA 1N61A 1V38A 1T3NA 4ELVA 9ICAA 4KLHA 9ICVA 2K8CB 4YXJA 4AYBC 5TISU 7ICLA 1JX4A 3B0XA 3MGVA 1JALA 1HEKA 4PJ0U 4M2YA 1KRPA 2FDRA 1QCKA 2K8AA 9ICPA 4F72A 4ECSA 2DKZA 3U26A 1HIWA 4C80A 5ALOA 3ZD9A 8ICKA 4P4PA 1Z4OA 2OEHA 3K75D 4B6JA 4QIWF 4F93B 4DQQA 1IXRA 3J81j 5EE9A 4J03A 3RJIA 3RH6A 2VA3A 4QWDA 3IHQB 3QUTA 1LKYB 2KP7A 4M6WA 1O03A 4QZHA 4KMUA 4IRCA 4GIBA 8ICSA 4KX5A 9ICTA 3PZPA 3LDAA 4QWEA 3VC8A 4OO1J 4FS2A 2W55A 4XA5A 2W8LA 4BJQA 4DSIA 4P0QB 2D3DA 4BWJA 4PGQA 4B9LA 4NM2A 4R8UA 4TURA 2W9CB 2ZJAA 4RQ7A 5AK6A 1U9LA 1ZD4A 2KZZA 2KVCA 4XQ8A 1ZQYA 3RBEA 2HOQA 2ZIXA 4DO9A 1V9PA 5IILA 4O3SA 1Z3EB 1NJXA 3Q8QB 9ICIA 4O9MA 3TKAA 4CCHA 3TI0A 4EBDA 4DL5A 2FLLA 3UMGA 2FLNA 5KFGA 5AM3A 2F76X 1AROP 2K89A 2XIDA 3SMVA 4UB1A 3OJSA 3M6ZA 2L5YA 4Y2RA 1XSPA 3OSPA 4NL9A 3T3FA 3KHHA 3H40A 2AGQA 7ICTA 4DFJA 1SIJA 5KFCA 9ICNA 4EBEA 5ALIA 4C7YA 3T5LA 3UMBA 5ALPA 1S97A 8ICRA 3RTVA 1ZOLA 5KFEA 1VJ5A 3C2MA 2G08A 4QZEA 2KN7A 3GILA 1ZJMA 2XICA 4Y2TA 3RF9A 1NKEA 1Z1VA 5DQIA 7ICPA 3ZD8A 2HI0A 2R8IA 4GXIA 1HUOA 1L8OA 4CDGA 8ICOA 2BDPA 2NO4A 3H0LB 3QU2A 8ICMA 2FE9A 3MFHA 5ALKA 8ICLA 4RU9A 1NK8A 2UVUA 3M9MB 1X9WA 3PY8A 5J0QA 2KJ9A 4OJOA 2B6GA 8ICXA 2OYYA 3HT3A 1PVPA 2XCAA 2QB0A 4DSEA 5AICA 3HX0A 5DG8A 4AP9A 4KLIA 1A6SA 2PXIA 4J9SA 4O5KA 5J0PA 1F44A 3ZI4A 2KZ3A 3A0HU 5J0OA 4KN7A 4Q8EA 4B9VA 2OWOA 2C22A 4I29A 2CPRA 2AJQA 3QNMA 3FDSA 1ZQLA 3QU9A 4YXMA 4Q44A 3WKBA 4IQWA 1S76D 5DDMA 3D2QA 4FZNA 2K8BB 3D2NA 5KFPA 4Z6CA 2DPJA 5DB9A 7ICUA 2VJ4A 1N48A 3RH4A 4RQ1A 3PW2A 3BQ0A 4ECUA 2IOFK 2IOHA 3MR6A 4UAVA 1RYSA 1DK2A 3O0FA 1Q3VA 4FZLA 4EX6A 3LVVA 8ICTA 1FIQA 2KNJA 1S0VA 1X66A 3UMCA 2F1JA 4Z6DA 5AK4A 2FPKA 3C28A 2ZIVA 2LI6A 7ICEA 2KICA 2YB4A 2F8KA 1RZTA 4LVSA 3EUB2 2I1QA 1KW4A 4C8OA 4UB5A 2ZIWB 5EWGA 1CI4A 1C20A 4J9PA 2EAOA 4HAIA 2HHQA 4CF4A 2WHEA 2OXOA 4O3RA 5KT2A 2PKEA 4GXKA 4ECWA 1X6IA 1S10A 4ECXA 1BPXA 4K4IA 5F9NA 2M0NA 4DQSA 1DGJA 1BVSA 5L1JA 4JB3A 3DDHA 3AL0B 1ZRMA 2JHDA 2K60A 4F71A 2JH7A 3NRWA 4DFKA 2ZTDA 5DDYA 1S9FA 5ALRA 1QH9A 3FYHA 5KAFU 1ECWA 5J8YC 2YY6A 4J9KA 4PGYA 5JRTA 1BPYA 1QTMA 3V6KA 5GTHU 4DL4A 1ZD3A 5CEHA 3OPXA 4LZGA 4P4MA 3JPPA 1GO3F 3N7RC 3NTUA 2F44A 4BDPA 1Z4NA 4Y2JA 4NLNA 1A77A 3ICXA 2HHXA 4PGXA 1HUZA 3GZFA 2EAPA 4J9QA 3LK9A 1NK7A 4MEYA 2EANA 1X42A 2C2EA 2JEJA 1B0XA 4PPXA 5AKKA 4XRHA 4IRKA 2G06A 1OW5A 3GFKB 4DL3A 5J2EA 3GDXA 4WJ3B 5BPCA 5CR0A 9ICCA 3KHRA 2MUTA 3G6VA 2RQ5A 2FLPA 1BPZA 2KEYA 5ALHA 3KFUF 5IIJA 3KOOA 1DXSA 2W3SA 2NYVA 4KLMA 2WFAA 1ZQGA 4TUSA 1JXLA 1TK8A 1ZQMA 1ZRNA 2EZXA 1CEZA 2YTUA 4NV0A 3JPOA 3ZDEA 2DBYA 4OCZA 2DWQA 4DL2A 2G07A 4R63A 3Q8SB 3MABA 1JROA 5AKHA 4QZCA 5KFBA 2JXJA 4U6PA 1PUZA 1ZQCA 4K4HA 1K5OA 1U49A 2NRXA 2BR0A 1A0PA 5H2FU 2ZJ5A 3SAGA 5IIKA 1KFDA 3H8WA 4PZNA 2OHFA 3NRZA 4HYKA 5AM0A 2WTFA 1QLNA 2RHFA 2A1JA 4BGDA 1BPBA 5AIAA 3WKEA 2F8LA 4DOBA 1X2IA 1IIPA 4O3OA 1JI7A 1URJA 2LM4A 5KG3A 5ALZA 2JRZA 2ZIVB 3HILA 3S6JA 2EH9A 5J2JA 3M8SA 5AI5A 2KJ8A 1RYUA 4UASA 1NI3A 3ETLA 3IM1A 2HW3A 4UB3A 3R9KA 2H5XA 3RJFA 1SV0C 2LYAA 3BS5A 3F2CA 1SGGA 1SZPA 3RB6A 2BZFA 3N7SC 1N60A 2KZMA 5D46A 3TACB 3JPNA 2ASJA 4RPXA 4R8UB 5ALDA 3PX6A 2DUYA 8ICZA 4YR2A 3GU3A 3WK8A 3EZ5A 4KLOA 1ZQRA 1B4FA 8ICBA 1WG8A 5DLFA 4EX7A 3GIJA 2ZXHA 8ICGA 4ECTA 1NK9A 4DL6A 3V72A 4ECRA 2WF7A 2J6TA 3IV6A 2MRLA 1EXNA 3ZDAA 5KFLA 3UM9A 2ZUDA 1NJWA 1LKYA 5KFSA 5J0TA 3HP6A 1RDFA 2YB1A 1OUQA 1PVRA 4MFAA 4KLEA 1RYRA 4DQIA 4RQNA 5C5JA 3PMLA 3MR3A 4B9UA 3H8JA 4IQTA 2B0CA 9ICLA 1M6YA 2OH2A 1LVHA 1QQ5A 4P4OA 2HHSA 4EYIB 1WWVA 2W43A 5AI9A 3NASA 2ZXIA 4NM1A 4KLTA 3WK5A 3WU2U 2GWSA 2AGOA 5D4BA 4ELTA 2E8MA 3AN1A 3RB0A 8ICPA 4DQRA 4IR9A 3WK7A 3PV8A 5EWEA 3GV8B 4FO6A 5HR7A 5J0WA 2E3TA 4C8MA 1ZQDA 2FMSA 5DQHA 1VLBA 9ICUA 2BHNA 5EWFA 2KOBA 1SWVA 4IS7A 4CRXA 4QZ8A 7ICKA 1PK1B 3RFAA 2CN1A 3MGIA 4X5VA 4B9SA 2EZYA 1MC8A 5AK3A 1F5SA 3SI8A 1SL2A 1C7YA 4UATA 5KT7A 4GLXA 2G09A 1ZQUA 1IM4A 3SAHA 5AM4A 8ICUA 3IDWA 3LVWA 4Y2VA 2HOIA 3IN5A 7ICNA 1ZQIA 4FBUA 1ZD5A 4O3MA 3BQ7A 4I2CA 2PI4A 4QZ9A 5AKYA 3AQFA 3FM9A 4C4TA 4Y2UA 2D6FC 4KLFA 8ICHA 4MF8A 4ZOHC 2ZTCA 1FO4A 2J6SA 2AHOB 2HBMA 4KTQA 5KFJA 2V9WA 2IHMA 2ZIXB 3AM9A 4M9JA 1ZQJA 4I2EA 1L3VA 3TAQA 8ICYA 3F5AA 2LPEA 2IOFA 1Q3UA 1BNOA 1ZD2P 3AU6A 3GIIA 3F2DA 2E5SA 4QWBA 3QYPA 2I6XA 4I2BA 1P7DA 1VDVA 2IMWP 2HHUA 3BQTA 3RB4A 2YX8A 3ISDA 4DF8A 1XO0A 1J2MA 2J6UA 2A1JB 4NLBA 5KG5A 3SD7A 4UB2A 3MBYA 2C28A 3Q8PB 2DPIA 1MQ2A 1ZQ1C 4JMUA 4M04A 5IIMA 1L7PA 5J29A 4KX3A 3Q8KA 4M6WB 1BNPA 4EENA 2Y1JA 2LHTA 1JN3A 5L1LA 9ICKA 1KEJA 2F77X 9ICJA 3JPRA 2F1IA 5DBAA 1KFTA 3PO4A 1WCNA 4ACOA 4DWIA 2UVVA 4XUSA 1CRXA 1ZETA 2BQ3A 2H3QA 1NK4A 4R64A 2V4RA 4KLDA 4YP3A 1XU4A 2LM1A 4KLJA 2YQEA 9ICQA 3G6XA 5EE0A 3ORYA 2K4EA 5KAIU 2MA1A 3QU5A 4MFCA 4I2DA 3OGUA 1YT3A 3GV7B 3VCBA 2KHQA 3G6YA 2ZJ8A 8ICCA 2MUTB 2XCPA 5DLGA 2P35A 1QQ6A 2NRTA 1J2NA 3HRDD 4I27A 1D8YA 8ICAA 3QU7A 2KV2A 9ICRA 2RDJA 2LYBA 2KJ5A 1QSSA 9ICEA 4J9OA 5J2IA 2MU2A 1X9SA 3I1YA 4J9NA 5BOMA 3RRGA 5F3XB 4IRDA 4DS4A 3PMNA 5GTIU 3BDPA 5L1MA 7ICOA 5ALXA 2FJ6A 1ZQPA 1RXVA 1L3TA 4US9A 4QJFB 2N1RA 4KN4A 2KE7A 3PNCA 1MN8A 5K4LA 4KMOB 4F5PA 2A3VA 2DQNB 4EELA 5KT4A 2RP5A 2ATLA 2O6KA 2KIWA 2W11A 4NLCA 1MSWD 2QARA 4RNMA 1UPHA 2FPMA 1COOA 2XY5A 2YMPA 3PW5A 1FFUA 1Q46A 3EPIA 4YVZA 2CXYA 4DQPA 4YR3A 1U48A 3KTQA 3TFRA 3H8SA 3CRXA 2Q0ZX 3MDCA 4TUQA 3BS5B 1Z19A 4UAZA 3E0FA 3EYZA 2ZUCA 5HP4A 2NO5A 5KFOA 2XC9A 1SKRA 5ALQA 5B66U 2UVWA 2FMPA 4UB8U 2NRZA 4JV0A 4CE6A 4I2GA 1QSYA 2RRDA 4YD2A 3TQ1A 8ICNA 3Q8MA 5AK5A 5CJ7A 4FS1A 5E79U 4RPZA 1SB3C 3V7LA 4KLSA 2JV3A 4ICAA 3B9JA 5DKWA 1JXEA 5AM2A 5AM1A 2ZIUA 2HSZA 3ONNA 4UAWA 2KTQA 4RQ8A 1FEZA 1SZHA 4NL9C 1KDHA 3RJGA 4BXOB 4M0AA 3JPQA 5T14A 4DSJA 2JEFA 2WF9A 2AQ0A 2P6UA 3SYZA 2W9AA 1SXEA 2W54A 4JV1A 4RQ4A 2BKEA 2ODGA 3NVZA 4OJ5A 4J9RA 3RB3A 1KQQA 4Y2QA 2CRXA 5ALGA 2ASDA 4F3OA 3ZDDA 3IRUA 3ED5A 1TFRA 4RQ5A 1QSLA 3C1ZA 4UB4A 1S5LU 3M7DA 2HHWA 2XGPA 1RG6A 4ELUA 9ICSA 5EE3A 1UT8A 1H38A 1T8EA 2JZBB 5ALYA 5AI6A 4QW9A 1UCVA 3F53A 4CGZA 4M47A 2A19A 2UVRA 2KG5A 4G3IA 5HR6A 3H8MA 1ZQXA 2KKVA 1BPEA 2R8KA 3AQEA 3L4PA 2V4QA 1N2XA 1F0MA 1WWUA 5KFDA 3QUQA 3A0BU 5J2KA 4UBCA 2Y9TA 4RQ6A 4F5QA 4OD0A 2OM6A 2A1AA 3MFIA 3MGHA 1NZBA 1S8OA 4O5EA 2JMGA 2KSOA 5J2HA 3M9NB 4PHPA 2GH1A 2F2AB 2YN4A 3K1ZA 4KLGA 3RAXA 3CYMA 1SKWA 8ICEA 3E2EA 4A8EA 3UPQA 4RZRA 5AKLA 3NVVA 2AU0A 1NK5A 3QX7A 4Q43A 1LV5A 2OCEA 3PX0A 2JEGA 4YR0A 4YD1A 4I2HA 4GC6A 3FAHA 2K4IA 2PFNA 2BPGA 5ALMA 2BQRA 1JIHA 4IQVA 2XI9A 1UHUA 5AI8A 4QW8A 4YFKA 4YQWA 4EBCA 5J0YA 5ALTA 3EPGA 4ED8A 3KZXA 5HMLA 1SKSA 2VA2A 1N56A 2EDUA 5DG9A 3THVA 3C1YA 3PSPA 2YMMA 3H0RB 4B9MA 3EWAA 5DB8A 4C8KA 2R8HA 3NVWA 2WAQF 4DEZA 4CNQA 8ICJA 4F4XA 2YMQA 3H4DA 1KTQA 4J9LA 3WK4A 3RAQA 3H4BA 2MAXA 2B21A 5DBCA 4U7CA 2ZIWA 2AGPA 3CW2C 4Z6FA 1WCLA 3NGDA 5KFHA 5KFIA 5F9LA 1D9DA 2I9GA 4QNLA 2HBJA 2Y1IA 7ICSA 3AU2A 8ICFA 2E1EA 2W03A 2AQ4A 2F1HA 3C21A 4C4SA 4UBBA 2BCRA 3ZDBA 2W9CA 2EZZA 1UT5A 2BPFA 1Z00A 2NV3A 3Q8LA 4Y2PA 4UAYA 4P0QA 3PSTA 2GLEA 5KG2A 2EQYA 5FP0A 9ICOA 4OJLA 5KG4A 3AUOA 2KVSA 4PL1A 5AKXA 5DGBA 2JR5A 4RUAA 2VKQA 3RJKA 3D2SA 9ICFA 1BGXT 1TE2A 1X40A 4NLZA 3WKCA 3ISCA 1J97A 4NWIA 3NS1A 4UW9A 5J0RA 2DFLA 7ICVA 2QB0B 1DK3A 1ZQSA 3WK9A 3CNHA 3SR6A 1SL0A 2ISOA 1ZQWA 3D6JA 2Y9UA 4M9GA 4RQ2A 4EZ6A 5L1IA 2H3IA 4I2FA 4MFFA 2E8OA 4CF3A 5HMMA 4MF2A 1MQ3A 5G5GA 4B9NA 3SENA 4F5NA 4RUCA 5KFKA 4KLLA 5CP2A 4QWAA 2C2DA 2G5IB 3LYSA 3SEIA 1ZXIA 4YMNA 2LKYA 1ED1A 2W3RA 4LZDA 3HKZF 3QE9Y 4DSKA 4YN4A 3V7KA 5G5HA 5J0XA 4J9MA 3OTQA 3BS7A 1UA0A 4BX9C 3IG5A 4GC7A 8ICWA 4EEKA 4ECZA 3TFSA 5DB6A 4Q8FA 1KFSA 4EZ9A 7ICRA 2KD1A 5KT3A 3M8RA 1O08A 5AKJA 3RR8A 3ZDCA 3BQ1A 4MEXA 2F3NA 2KMDA 4E0DA 3UXPA 4QZIA 1WUDA 2HOFA 2HVHA 5EOZA 3JPTA 1PK3A 5AKEA 2WF6A 5HHHA 4JWNA 2HVIA 1X6JA 1B22A 3RR7A 3OJUA 3QZ8A 4DOCA 4ZH4A 3SQIA 3LWMA 3C29A 1NJYA 5KL1B 1PVQA 1S0NA 1KLNA 4OJPA 3RJEA 1PZNA 3C23A 1RM6C 4F2RA 4RT3A 2KFZA 5KG6A 1Q8KA 1X9XA 2W04A 3H7IA 4RPYA 3TADC 3OSNA 2HHVA 4RT2A 4NLKA 2G0AA 4NXZA 1ZQNA 4Q45A 2BGWA 5JUMA 4JV2A 5CA7A 4QWCA 7ICJA 3HJEA 2DGZA 5KFXA 2W9BB 4DLGA 1L3UA 3QUCA 1D9FA 4EEYA 1L7NA 4C0ZA 4ED1A 1TVAA 3QEAZ 4DFPA 3N4MB 1NNLA 1DGSA 1NZPA 3UXNA 5HHIA 1ZYQA 4Z6EA 2PFOA 1JRPA 2BCSA 2E8PA 2EAMA 4ECQA 5AKZA 4QZFA 4JWMA 4F8RA 2ESEA 1CUKA 1FFVA 5BOLA 3C5FA 2H3ZA 1L8LA 2XVTA 2WAQC 3UQ0A 4QZDA 5KFYA 5J2AA 3KHGA 3V6JA 2BCVA 5HNKA 4ED3A 3C2KA 4F4YA 3MC1A 5KL8B 2HBLA 2VANA 3NVYA 4F91B 1KL9A 4B9TA 1TAUA 3ISBA 1L5UA 2C2RA 4ED2A 2H3VA 5ALWA 3GV5B 2MSNA 4EYHB 2DF4B 3F5EA 1S0MA 1SV4A 4DLEA 3GIKA 3LWLA 5C0YA 4FBTA 5KTQA 4RQMA 1XSNA 1SL1A 1YZ7A 2FMQA 1RQLA 1ZQTA 4P0PB 5J8YA 1WYGA 5J2FA 5IIIA 1T94A 5AI0A 4C8NA 2ALZA 1TK5A 3JPSA 3QU4A 4C8LA 3TAPA 3NUQA 4PHEA 2D8CA 5KFQA 3PR4A 3RBDA 5ALVA 4QIWC 5DG7A 4DOAA 5KNIA 3HPOA 2HHTA 2DL0A 3EW9A 3UXOA 7ICGA 3KHLA 3HKZC 3OHBA 5A0LA 4NLGA 5J0SA 3BZCA 4R66A 3CP8A 4O3QA 1MA7A 4IL6U 4GFJA 3RRHA 5KFNA 9ICWA 4G9BA 4M9HA 5ALLA 1N63A 2RLTA 4F4ZA 3GIMA 7ICHA 4R65A 5AHXA 5KFTA 2P6RA 1COKA 2XY7A 3WKDA 1KN5A 4GXJA 3PO5A 5AKGA 5KFWA 5EE1A 1XNSA 1A76A 2VA8A 3GQCA 3PSIA 2BCUA 3MDAA 3I28A 8ICQA 2XO7A 3I76A 4UB6U 1U47A 3V7JA 1YZ6A 4BUGA 5J2BA 1V97A 4F4KA 8ICIA 2R18A 1L7OA 4M9NA 4UARA 1XSLA 3SAFA 3SV3A 3PSFA 3IP4B 2GOLA 4YMOA 3PW0A 5KG0A 2Y0SF 1NK0A 2PMZF 2GO7A 2Z7JA 4ED7A 4DCCA 2W7OA 2IHNA 3HW8A 2JZBA 1D8BA 5JTIA 3RJHA 2NRVA 3N28A 3BQ2A 5J2DA 1ZQBA 2E1FA 4YG2A 4DSFA 2WF8A 1RPLA 2VJ5A 2NRWA 1ZQQA 3Q8RB 4RNOA 3ALRA 1Z00B 7ICMA 4FE3A 3KZIU 1Z1BA 1SV0A 4QZGA 2ISPA 3IG8A 3T5KA 1TAMA 2LBOA 4K4GA 4TQRA 3N97B 3PW4A 5CHGA 1XO1A 4RQ0A 1OXJA 2KIVA 1NKBA 4LJXA 1X9MA 1RXWA 4IC9A 1DOQA 3SZ2A 3ETRA 3KBBA 4PL2A 2AH5A 2AXTU 5JU5A 5KG1A 4ECVA 2ASLA 4I2JA 4US8A 1T7PA 1L3SA 2KK0A 4BWMA 2BQUA 3RJJA 3PW7A 3L3FX 2LMRA 2HDOA 9ICXA 4F2SA 1ZQFA 1KBUA 2PFQA 1IV8A 5J2CA 4YMMA 9ICMA 5KFAA 4IQUA 1JMSA 4DSLA 1TAQA 5ALFA 3DEEA 4QZAA 4ED0A 3QUBA 4PZOA 9ICHA 2WB1C 3L5KA 5KFFA 4UQGA 1V85A 2RDIA 4F5OA 2Q4TA 1N5XA 3MR5A 2G5HB 2ES6A 5DGAA 1UA1A 5L9XA 7ICFA 5KT5A 4AYBF 4P0PA 1U4BA 3QXGA 3TANA 3SV4A 1JUDA 3WKAA 7ICQA 1ZQVA 2QLTA 5KG7A 3BJYA 4USAA 3TARA 9ICBA 4O5CA 5AM5A 3T79A 2P66A 4P2HA 3K1RB 5CRXA 2XGQA 1ZQEA 2H3FA 4ED6A 1ZQAA 1NK6A 1RQNA 2DKXA 4F5RA 4UAUA 4JK1A 1DRGA 2KSOB 2R8GA 4FFDA 1S0OA 2XY6A 4ECYA 5KFUA 7ICIA 2HMXA 2E8NA 5IIOA 2BDUA 2QKQA 3QZ7A 2W7PA 3QEBZ 1QQ7A 5D49A 2HCFA 4O3NA 3T5JA 3M9OB 2ZTEA 3E58A 3H0MB 4QZBA 5J2GA 4M9LA 4CF5A 3KD3A 3C5GA 4Y2YA 3FC4A 4YCXA 4DFDA 3HWTA 4KITB 4C7ZA 1XWLA 2R8JA 4NJ8A 4PH5A 1KKXA 1B43A 3BZKA 4DL7A 3F2BA 5L1KA 2IBKA 4DF4A 2BCQA 3M6KA 5ALNA 3PX4A 4KLUA 1S77D 2PI5A 1ZQOA
chains in the Genus database with same CATH topology
4OJPA 4QJFB 3DEEA 2N1RA 5C0YA 3F5AA 4BUGA 2KVCA 1F44A 1Q3UA 2CRXA 2WB1C 3AL0B 2HOQA 1L6NA 2JGAA 2WB1F 2ZIXA 2R18A 2JHDA 2JH7A 1A0PA 3NRWA 4KMOB 3F2DA 2E5SA 2DQNB 2Q4TA 3SAGA 2A3VA 2W04A 3SAFA 2CPRA 3PSFA 2K4HA 2ZXIA 3IP4B 1P7DA 2G5HB 2GOLA 2RP5A 3M7DA 2KIWA 2VIXA 1ECWA 4U7CA 2G0AA 4NLCA 2Y0SF 2YX8A 2PMZF 2ZIWA 1XO0A 4P0PB 2Y0SC 2RHFA 2Z7JA 2F76X 1T94A 2K89A 2XIDA 2H3IA 2F8LA 4NLBA 3SMVA 4AYBF 2K8CB 2DGZA 4P0PA 3F53A 1UPHA 3D2QA 2ZIUB 3M6ZA 4AYBC 1IIPA 2W7OA 1URJA 4CGZA 3MGVA 1HEKA 4FZNA 3OPXA 4C0ZA 1ZQ1C 2K8BB 3D2NA 4JMUA 5HR7A 3NUQA 5HR6A 1GO3F 4QNLA 2HBJA 2KKVA 3N7RC 4KX3A 3N7PD 1D8BA 2K8AA 4QIWC 2VJ4A 3AQEA 3T79A 2E1EA 2W03A 2ZIVB 3CRXA 4OJ6A 2G5IB 2LHTA 3LYSA 5CRXA 2E1FA 2F77X 2KOBA 2LKYA 2H3FA 2KJ8A 1ED1A 1Z19A 4CRXA 3E0FA 3ICXA 2VJ5A 3HKZF 4ACOA 3RFAA 3HKZC 2CN1A 1HIWA 2OM6A 3GZFA 5A0LA 1CRXA 3ALRA 2G08A 1NZBA 2JMGA 3CP8A 3O0FA 4FE3A 1Q3VA 4FZLA 1DRGA 2LYAA 3LVVA 3F2CA 2XICA 1MA7A 4QIWF 2KNJA 1Z1BA 2H3QA 2NV3A 3RF9A 4BX9C 2GH1A 2RRDA 2F2AB 3IG5A 2HMXA 2JH1A 3N7SC 4GFJA 2ZG6A 2G06A 4P0QA 3IG8A 2H3ZA 2BDUA 2G09A 2XVTA 1TAMA 2WAQC 3K1ZA 3PSTA 2LBOA 2KHVA 2W7PA 3CYMA 3C28A 4A8EA 3SAHA 4WJ3B 4CDGA 2ZIVA 2KD1A 3LVWA 2K4EA 3IN5A 2HOIA 3GU3A 4OJLA 2KICA 2YB4A 3H0LB 2KEYA 2KKPA 4IC9A 2MA1A 3KFUF 4O3MA 1YT3A 4ICAA 4PL1A 4KX5A 3VCBA 3PZPA 2KHQA 2ZIWB 2ZXHA 3AQFA 2HBLA 3H0MB 2K4IA 4PL2A 5KL8B 3VC8A 4OO1J 2ZIUA 2VKQA 3ONNA 2PMZC 2XI9A 1WUDA 2KV2A 2D6FC 4BJQA 2HOFA 3D2SA 2LYBA 2MRLA 3L3FX 2KJ5A 2KJ9A 4P0QB 1SZHA 4NV0A 4OJOA 2OXOA 2H3VA 1XNSA 2OYYA 2HBMA 3KZXA 2YB1A 3PSIA 2G07A 5T14A 3F2BA 1PVPA 1OUQA 1KBUA 2DF4B 4FZMA 3F5EA 1PVRA 3PSPA 2HBKA 3H0RB 2ZIXB 4NWIA 3M6KA 3SQIA 1A6SA 2WAQF 4U6PA 3C29A 2M0NA 1PVQA 5KL1B 4OJ5A 2OH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HEK A;  2N1R A;  2H3Q A;  2NV3 A;  4JMU A;  2HMX A;  1L6N A;  2LYB A;  2H3Z A;  1TAM A;  2H3V A;  2K4H A;  2GOL A;  2H3F A;  1ED1 A;  2K4E A;  1ECW A;  4IC9 A;  1HIW A;  4ICA A;  2H3I A;  2JMG A;  1A6S A;  1UPH A;  2K4I A;  2LYA A; 
#chains in the Genus database with same CATH topology
 1N62 A;  4F50 A;  1L6N A;  4MHV A;  1T4G A;  3WK6 A;  1T3Q A;  1ZQZ A;  5TZV A;  1HJP A;  4DFM A;  4BXO A;  2K4H A;  4F92 B;  3T5H A;  3DV9 A;  2VIX A;  2W9B A;  3MR2 A;  4O3P A;  4JUZ A;  3C2L A;  4Y2S A;  2Y0S C;  3OHA A;  5J0U A;  2ZIU B;  2M9N A;  4PHA A;  5ALU A;  1SWW A;  2BPC A;  2W9M A;  9ICG A;  3N7P D;  5IIN A;  2KFN A;  1LB2 B;  1SXD A;  3KKA C;  5AI4 A;  1U45 A;  1XC9 A;  4I28 A;  4OJ6 A;  2FPL A;  1NOM A;  1BPD A;  5KFZ A;  1Y88 A;  3KKA A;  1NJZ A;  4F4W A;  2WF5 A;  1UQV A;  2W8K A;  3UQ2 A;  5KT6 A;  1L7M A;  2JH1 A;  2ZG6 A;  5CWR A;  2KHV A;  5KFM A;  3K4G A;  5KFR A;  5ALS A;  5ALJ A;  2FI1 A;  2YML A;  1TKD A;  1TV9 A;  2KKP A;  4Y2X A;  3RH5 A;  1D8L A;  2LYH A;  1NKC A;  5DB7 A;  1IG6 A;  4O0I A;  2QAR B;  2PMZ C;  5CB1 A;  4PHD A;  5DQG A;  1K1Q A;  3AEV A;  2K4P A;  4RQ3 A;  3AMZ A;  1K1S A;  1XS9 D;  1ZQH A;  1AQ6 A;  4FZM A;  3PVX A;  4TQS A;  1ZQK A;  2HBK A;  4C4R A;  1TK0 A;  2I5H A;  4NY8 A;  3PR5 B;  1ZJN A;  4RNN A;  1N5W A;  4IR1 A;  5B5E U;  4I2A A;  2ZUB A;  4KLQ A;  4DS5 A;  8ICV A;  2IA6 A;  5KFV A;  4TUP A;  2JGA A;  2WB1 F;  3M1Y A;  4I2I A;  3V6H A;  5AIB A;  1PK1 A;  3B0Y A;  5AKI A;  1KSP A;  3TAD A;  5ALE A;  2QB1 A;  2PFP A;  5DBB A;  2JEI A;  1N61 A;  1V38 A;  1T3N A;  4ELV A;  9ICA A;  4KLH A;  9ICV A;  2K8C B;  4YXJ A;  4AYB C;  5TIS U;  7ICL A;  1JX4 A;  3B0X A;  3MGV A;  1JAL A;  1HEK A;  4PJ0 U;  4M2Y A;  1KRP A;  2FDR A;  1QCK A;  2K8A A;  9ICP A;  4F72 A;  4ECS A;  2DKZ A;  3U26 A;  1HIW A;  4C80 A;  5ALO A;  3ZD9 A;  8ICK A;  4P4P A;  1Z4O A;  2OEH A;  3K75 D;  4B6J A;  4QIW F;  4F93 B;  4DQQ A;  1IXR A;  3J81 j;  5EE9 A;  4J03 A;  3RJI A;  3RH6 A;  2VA3 A;  4QWD A;  3IHQ B;  3QUT A;  1LKY B;  2KP7 A;  4M6W A;  1O03 A;  4QZH A;  4KMU A;  4IRC A;  4GIB A;  8ICS A;  4KX5 A;  9ICT A;  3PZP A;  3LDA A;  4QWE A;  3VC8 A;  4OO1 J;  4FS2 A;  2W55 A;  4XA5 A;  2W8L A;  4BJQ A;  4DSI A;  4P0Q B;  2D3D A;  4BWJ A;  4PGQ A;  4B9L A;  4NM2 A;  4R8U A;  4TUR A;  2W9C B;  2ZJA A;  4RQ7 A;  5AK6 A;  1U9L A;  1ZD4 A;  2KZZ A;  2KVC A;  4XQ8 A;  1ZQY A;  3RBE A;  2HOQ A;  2ZIX A;  4DO9 A;  1V9P A;  5IIL A;  4O3S A;  1Z3E B;  1NJX A;  3Q8Q B;  9ICI A;  4O9M A;  3TKA A;  4CCH A;  3TI0 A;  4EBD A;  4DL5 A;  2FLL A;  3UMG A;  2FLN A;  5KFG A;  5AM3 A;  2F76 X;  1ARO P;  2K89 A;  2XID A;  3SMV A;  4UB1 A;  3OJS A;  3M6Z A;  2L5Y A;  4Y2R A;  1XSP A;  3OSP A;  4NL9 A;  3T3F A;  3KHH A;  3H40 A;  2AGQ A;  7ICT A;  4DFJ A;  1SIJ A;  5KFC A;  9ICN A;  4EBE A;  5ALI A;  4C7Y A;  3T5L A;  3UMB A;  5ALP A;  1S97 A;  8ICR A;  3RTV A;  1ZOL A;  5KFE A;  1VJ5 A;  3C2M A;  2G08 A;  4QZE A;  2KN7 A;  3GIL A;  1ZJM A;  2XIC A;  4Y2T A;  3RF9 A;  1NKE A;  1Z1V A;  5DQI A;  7ICP A;  3ZD8 A;  2HI0 A;  2R8I A;  4GXI A;  1HUO A;  1L8O A;  4CDG A;  8ICO A;  2BDP A;  2NO4 A;  3H0L B;  3QU2 A;  8ICM A;  2FE9 A;  3MFH A;  5ALK A;  8ICL A;  4RU9 A;  1NK8 A;  2UVU A;  3M9M B;  1X9W A;  3PY8 A;  5J0Q A;  2KJ9 A;  4OJO A;  2B6G A;  8ICX A;  2OYY A;  3HT3 A;  1PVP A;  2XCA A;  2QB0 A;  4DSE A;  5AIC A;  3HX0 A;  5DG8 A;  4AP9 A;  4KLI A;  1A6S A;  2PXI A;  4J9S A;  4O5K A;  5J0P A;  1F44 A;  3ZI4 A;  2KZ3 A;  3A0H U;  5J0O A;  4KN7 A;  4Q8E A;  4B9V A;  2OWO A;  2C22 A;  4I29 A;  2CPR A;  2AJQ A;  3QNM A;  3FDS A;  1ZQL A;  3QU9 A;  4YXM A;  4Q44 A;  3WKB A;  4IQW A;  1S76 D;  5DDM A;  3D2Q A;  4FZN A;  2K8B B;  3D2N A;  5KFP A;  4Z6C A;  2DPJ A;  5DB9 A;  7ICU A;  2VJ4 A;  1N48 A;  3RH4 A;  4RQ1 A;  3PW2 A;  3BQ0 A;  4ECU A;  2IOF K;  2IOH A;  3MR6 A;  4UAV A;  1RYS A;  1DK2 A;  3O0F A;  1Q3V A;  4FZL A;  4EX6 A;  3LVV A;  8ICT A;  1FIQ A;  2KNJ A;  1S0V A;  1X66 A;  3UMC A;  2F1J A;  4Z6D A;  5AK4 A;  2FPK A;  3C28 A;  2ZIV A;  2LI6 A;  7ICE A;  2KIC A;  2YB4 A;  2F8K A;  1RZT A;  4LVS A;  3EUB 2;  2I1Q A;  1KW4 A;  4C8O A;  4UB5 A;  2ZIW B;  5EWG A;  1CI4 A;  1C20 A;  4J9P A;  2EAO A;  4HAI A;  2HHQ A;  4CF4 A;  2WHE A;  2OXO A;  4O3R A;  5KT2 A;  2PKE A;  4GXK A;  4ECW A;  1X6I A;  1S10 A;  4ECX A;  1BPX A;  4K4I A;  5F9N A;  2M0N A;  4DQS A;  1DGJ A;  1BVS A;  5L1J A;  4JB3 A;  3DDH A;  3AL0 B;  1ZRM A;  2JHD A;  2K60 A;  4F71 A;  2JH7 A;  3NRW A;  4DFK A;  2ZTD A;  5DDY A;  1S9F A;  5ALR A;  1QH9 A;  3FYH A;  5KAF U;  1ECW A;  5J8Y C;  2YY6 A;  4J9K A;  4PGY A;  5JRT A;  1BPY A;  1QTM A;  3V6K A;  5GTH U;  4DL4 A;  1ZD3 A;  5CEH A;  3OPX A;  4LZG A;  4P4M A;  3JPP A;  1GO3 F;  3N7R C;  3NTU A;  2F44 A;  4BDP A;  1Z4N A;  4Y2J A;  4NLN A;  1A77 A;  3ICX A;  2HHX A;  4PGX A;  1HUZ A;  3GZF A;  2EAP A;  4J9Q A;  3LK9 A;  1NK7 A;  4MEY A;  2EAN A;  1X42 A;  2C2E A;  2JEJ A;  1B0X A;  4PPX A;  5AKK A;  4XRH A;  4IRK A;  2G06 A;  1OW5 A;  3GFK B;  4DL3 A;  5J2E A;  3GDX A;  4WJ3 B;  5BPC A;  5CR0 A;  9ICC A;  3KHR A;  2MUT A;  3G6V A;  2RQ5 A;  2FLP A;  1BPZ A;  2KEY A;  5ALH A;  3KFU F;  5IIJ A;  3KOO A;  1DXS A;  2W3S A;  2NYV A;  4KLM A;  2WFA A;  1ZQG A;  4TUS A;  1JXL A;  1TK8 A;  1ZQM A;  1ZRN A;  2EZX A;  1CEZ A;  2YTU A;  4NV0 A;  3JPO A;  3ZDE A;  2DBY A;  4OCZ A;  2DWQ A;  4DL2 A;  2G07 A;  4R63 A;  3Q8S B;  3MAB A;  1JRO A;  5AKH A;  4QZC A;  5KFB A;  2JXJ A;  4U6P A;  1PUZ A;  1ZQC A;  4K4H A;  1K5O A;  1U49 A;  2NRX A;  2BR0 A;  1A0P A;  5H2F U;  2ZJ5 A;  3SAG A;  5IIK A;  1KFD A;  3H8W A;  4PZN A;  2OHF A;  3NRZ A;  4HYK A;  5AM0 A;  2WTF A;  1QLN A;  2RHF A;  2A1J A;  4BGD A;  1BPB A;  5AIA A;  3WKE A;  2F8L A;  4DOB A;  1X2I A;  1IIP A;  4O3O A;  1JI7 A;  1URJ A;  2LM4 A;  5KG3 A;  5ALZ A;  2JRZ A;  2ZIV B;  3HIL A;  3S6J A;  2EH9 A;  5J2J A;  3M8S A;  5AI5 A;  2KJ8 A;  1RYU A;  4UAS A;  1NI3 A;  3ETL A;  3IM1 A;  2HW3 A;  4UB3 A;  3R9K A;  2H5X A;  3RJF A;  1SV0 C;  2LYA A;  3BS5 A;  3F2C A;  1SGG A;  1SZP A;  3RB6 A;  2BZF A;  3N7S C;  1N60 A;  2KZM A;  5D46 A;  3TAC B;  3JPN A;  2ASJ A;  4RPX A;  4R8U B;  5ALD A;  3PX6 A;  2DUY A;  8ICZ A;  4YR2 A;  3GU3 A;  3WK8 A;  3EZ5 A;  4KLO A;  1ZQR A;  1B4F A;  8ICB A;  1WG8 A;  5DLF A;  4EX7 A;  3GIJ A;  2ZXH A;  8ICG A;  4ECT A;  1NK9 A;  4DL6 A;  3V72 A;  4ECR A;  2WF7 A;  2J6T A;  3IV6 A;  2MRL A;  1EXN A;  3ZDA A;  5KFL A;  3UM9 A;  2ZUD A;  1NJW A;  1LKY A;  5KFS A;  5J0T A;  3HP6 A;  1RDF A;  2YB1 A;  1OUQ A;  1PVR A;  4MFA A;  4KLE A;  1RYR A;  4DQI A;  4RQN A;  5C5J A;  3PML A;  3MR3 A;  4B9U A;  3H8J A;  4IQT A;  2B0C A;  9ICL A;  1M6Y A;  2OH2 A;  1LVH A;  1QQ5 A;  4P4O A;  2HHS A;  4EYI B;  1WWV A;  2W43 A;  5AI9 A;  3NAS A;  2ZXI A;  4NM1 A;  4KLT A;  3WK5 A;  3WU2 U;  2GWS A;  2AGO A;  5D4B A;  4ELT A;  2E8M A;  3AN1 A;  3RB0 A;  8ICP A;  4DQR A;  4IR9 A;  3WK7 A;  3PV8 A;  5EWE A;  3GV8 B;  4FO6 A;  5HR7 A;  5J0W A;  2E3T A;  4C8M A;  1ZQD A;  2FMS A;  5DQH A;  1VLB A;  9ICU A;  2BHN A;  5EWF A;  2KOB A;  1SWV A;  4IS7 A;  4CRX A;  4QZ8 A;  7ICK A;  1PK1 B;  3RFA A;  2CN1 A;  3MGI A;  4X5V A;  4B9S A;  2EZY A;  1MC8 A;  5AK3 A;  1F5S A;  3SI8 A;  1SL2 A;  1C7Y A;  4UAT A;  5KT7 A;  4GLX A;  2G09 A;  1ZQU A;  1IM4 A;  3SAH A;  5AM4 A;  8ICU A;  3IDW A;  3LVW A;  4Y2V A;  2HOI A;  3IN5 A;  7ICN A;  1ZQI A;  4FBU A;  1ZD5 A;  4O3M A;  3BQ7 A;  4I2C A;  2PI4 A;  4QZ9 A;  5AKY A;  3AQF A;  3FM9 A;  4C4T A;  4Y2U A;  2D6F C;  4KLF A;  8ICH A;  4MF8 A;  4ZOH C;  2ZTC A;  1FO4 A;  2J6S A;  2AHO B;  2HBM A;  4KTQ A;  5KFJ A;  2V9W A;  2IHM A;  2ZIX B;  3AM9 A;  4M9J A;  1ZQJ A;  4I2E A;  1L3V A;  3TAQ A;  8ICY A;  3F5A A;  2LPE A;  2IOF A;  1Q3U A;  1BNO A;  1ZD2 P;  3AU6 A;  3GII A;  3F2D A;  2E5S A;  4QWB A;  3QYP A;  2I6X A;  4I2B A;  1P7D A;  1VDV A;  2IMW P;  2HHU A;  3BQT A;  3RB4 A;  2YX8 A;  3ISD A;  4DF8 A;  1XO0 A;  1J2M A;  2J6U A;  2A1J B;  4NLB A;  5KG5 A;  3SD7 A;  4UB2 A;  3MBY A;  2C28 A;  3Q8P B;  2DPI A;  1MQ2 A;  1ZQ1 C;  4JMU A;  4M04 A;  5IIM A;  1L7P A;  5J29 A;  4KX3 A;  3Q8K A;  4M6W B;  1BNP A;  4EEN A;  2Y1J A;  2LHT A;  1JN3 A;  5L1L A;  9ICK A;  1KEJ A;  2F77 X;  9ICJ A;  3JPR A;  2F1I A;  5DBA A;  1KFT A;  3PO4 A;  1WCN A;  4ACO A;  4DWI A;  2UVV A;  4XUS A;  1CRX A;  1ZET A;  2BQ3 A;  2H3Q A;  1NK4 A;  4R64 A;  2V4R A;  4KLD A;  4YP3 A;  1XU4 A;  2LM1 A;  4KLJ A;  2YQE A;  9ICQ A;  3G6X A;  5EE0 A;  3ORY A;  2K4E A;  5KAI U;  2MA1 A;  3QU5 A;  4MFC A;  4I2D A;  3OGU A;  1YT3 A;  3GV7 B;  3VCB A;  2KHQ A;  3G6Y A;  2ZJ8 A;  8ICC A;  2MUT B;  2XCP A;  5DLG A;  2P35 A;  1QQ6 A;  2NRT A;  1J2N A;  3HRD D;  4I27 A;  1D8Y A;  8ICA A;  3QU7 A;  2KV2 A;  9ICR A;  2RDJ A;  2LYB A;  2KJ5 A;  1QSS A;  9ICE A;  4J9O A;  5J2I A;  2MU2 A;  1X9S A;  3I1Y A;  4J9N A;  5BOM A;  3RRG A;  5F3X B;  4IRD A;  4DS4 A;  3PMN A;  5GTI U;  3BDP A;  5L1M A;  7ICO A;  5ALX A;  2FJ6 A;  1ZQP A;  1RXV A;  1L3T A;  4US9 A;  4QJF B;  2N1R A;  4KN4 A;  2KE7 A;  3PNC A;  1MN8 A;  5K4L A;  4KMO B;  4F5P A;  2A3V A;  2DQN B;  4EEL A;  5KT4 A;  2RP5 A;  2ATL A;  2O6K A;  2KIW A;  2W11 A;  4NLC A;  1MSW D;  2QAR A;  4RNM A;  1UPH A;  2FPM A;  1COO A;  2XY5 A;  2YMP A;  3PW5 A;  1FFU A;  1Q46 A;  3EPI A;  4YVZ A;  2CXY A;  4DQP A;  4YR3 A;  1U48 A;  3KTQ A;  3TFR A;  3H8S A;  3CRX A;  2Q0Z X;  3MDC A;  4TUQ A;  3BS5 B;  1Z19 A;  4UAZ A;  3E0F A;  3EYZ A;  2ZUC A;  5HP4 A;  2NO5 A;  5KFO A;  2XC9 A;  1SKR A;  5ALQ A;  5B66 U;  2UVW A;  2FMP A;  4UB8 U;  2NRZ A;  4JV0 A;  4CE6 A;  4I2G A;  1QSY A;  2RRD A;  4YD2 A;  3TQ1 A;  8ICN A;  3Q8M A;  5AK5 A;  5CJ7 A;  4FS1 A;  5E79 U;  4RPZ A;  1SB3 C;  3V7L A;  4KLS A;  2JV3 A;  4ICA A;  3B9J A;  5DKW A;  1JXE A;  5AM2 A;  5AM1 A;  2ZIU A;  2HSZ A;  3ONN A;  4UAW A;  2KTQ A;  4RQ8 A;  1FEZ A;  1SZH A;  4NL9 C;  1KDH A;  3RJG A;  4BXO B;  4M0A A;  3JPQ A;  5T14 A;  4DSJ A;  2JEF A;  2WF9 A;  2AQ0 A;  2P6U A;  3SYZ A;  2W9A A;  1SXE A;  2W54 A;  4JV1 A;  4RQ4 A;  2BKE A;  2ODG A;  3NVZ A;  4OJ5 A;  4J9R A;  3RB3 A;  1KQQ A;  4Y2Q A;  2CRX A;  5ALG A;  2ASD A;  4F3O A;  3ZDD A;  3IRU A;  3ED5 A;  1TFR A;  4RQ5 A;  1QSL A;  3C1Z A;  4UB4 A;  1S5L U;  3M7D A;  2HHW A;  2XGP A;  1RG6 A;  4ELU A;  9ICS A;  5EE3 A;  1UT8 A;  1H38 A;  1T8E A;  2JZB B;  5ALY A;  5AI6 A;  4QW9 A;  1UCV A;  3F53 A;  4CGZ A;  4M47 A;  2A19 A;  2UVR A;  2KG5 A;  4G3I A;  5HR6 A;  3H8M A;  1ZQX A;  2KKV A;  1BPE A;  2R8K A;  3AQE A;  3L4P A;  2V4Q A;  1N2X A;  1F0M A;  1WWU A;  5KFD A;  3QUQ A;  3A0B U;  5J2K A;  4UBC A;  2Y9T A;  4RQ6 A;  4F5Q A;  4OD0 A;  2OM6 A;  2A1A A;  3MFI A;  3MGH A;  1NZB A;  1S8O A;  4O5E A;  2JMG A;  2KSO A;  5J2H A;  3M9N B;  4PHP A;  2GH1 A;  2F2A B;  2YN4 A;  3K1Z A;  4KLG A;  3RAX A;  3CYM A;  1SKW A;  8ICE A;  3E2E A;  4A8E A;  3UPQ A;  4RZR A;  5AKL A;  3NVV A;  2AU0 A;  1NK5 A;  3QX7 A;  4Q43 A;  1LV5 A;  2OCE A;  3PX0 A;  2JEG A;  4YR0 A;  4YD1 A;  4I2H A;  4GC6 A;  3FAH A;  2K4I A;  2PFN A;  2BPG A;  5ALM A;  2BQR A;  1JIH A;  4IQV A;  2XI9 A;  1UHU A;  5AI8 A;  4QW8 A;  4YFK A;  4YQW A;  4EBC A;  5J0Y A;  5ALT A;  3EPG A;  4ED8 A;  3KZX A;  5HML A;  1SKS A;  2VA2 A;  1N56 A;  2EDU A;  5DG9 A;  3THV A;  3C1Y A;  3PSP A;  2YMM A;  3H0R B;  4B9M A;  3EWA A;  5DB8 A;  4C8K A;  2R8H A;  3NVW A;  2WAQ F;  4DEZ A;  4CNQ A;  8ICJ A;  4F4X A;  2YMQ A;  3H4D A;  1KTQ A;  4J9L A;  3WK4 A;  3RAQ A;  3H4B A;  2MAX A;  2B21 A;  5DBC A;  4U7C A;  2ZIW A;  2AGP A;  3CW2 C;  4Z6F A;  1WCL A;  3NGD A;  5KFH A;  5KFI A;  5F9L A;  1D9D A;  2I9G A;  4QNL A;  2HBJ A;  2Y1I A;  7ICS A;  3AU2 A;  8ICF A;  2E1E A;  2W03 A;  2AQ4 A;  2F1H A;  3C21 A;  4C4S A;  4UBB A;  2BCR A;  3ZDB A;  2W9C A;  2EZZ A;  1UT5 A;  2BPF A;  1Z00 A;  2NV3 A;  3Q8L A;  4Y2P A;  4UAY A;  4P0Q A;  3PST A;  2GLE A;  5KG2 A;  2EQY A;  5FP0 A;  9ICO A;  4OJL A;  5KG4 A;  3AUO A;  2KVS A;  4PL1 A;  5AKX A;  5DGB A;  2JR5 A;  4RUA A;  2VKQ A;  3RJK A;  3D2S A;  9ICF A;  1BGX T;  1TE2 A;  1X40 A;  4NLZ A;  3WKC A;  3ISC A;  1J97 A;  4NWI A;  3NS1 A;  4UW9 A;  5J0R A;  2DFL A;  7ICV A;  2QB0 B;  1DK3 A;  1ZQS A;  3WK9 A;  3CNH A;  3SR6 A;  1SL0 A;  2ISO A;  1ZQW A;  3D6J A;  2Y9U A;  4M9G A;  4RQ2 A;  4EZ6 A;  5L1I A;  2H3I A;  4I2F A;  4MFF A;  2E8O A;  4CF3 A;  5HMM A;  4MF2 A;  1MQ3 A;  5G5G A;  4B9N A;  3SEN A;  4F5N A;  4RUC A;  5KFK A;  4KLL A;  5CP2 A;  4QWA A;  2C2D A;  2G5I B;  3LYS A;  3SEI A;  1ZXI A;  4YMN A;  2LKY A;  1ED1 A;  2W3R A;  4LZD A;  3HKZ F;  3QE9 Y;  4DSK A;  4YN4 A;  3V7K A;  5G5H A;  5J0X A;  4J9M A;  3OTQ A;  3BS7 A;  1UA0 A;  4BX9 C;  3IG5 A;  4GC7 A;  8ICW A;  4EEK A;  4ECZ A;  3TFS A;  5DB6 A;  4Q8F A;  1KFS A;  4EZ9 A;  7ICR A;  2KD1 A;  5KT3 A;  3M8R A;  1O08 A;  5AKJ A;  3RR8 A;  3ZDC A;  3BQ1 A;  4MEX A;  2F3N A;  2KMD A;  4E0D A;  3UXP A;  4QZI A;  1WUD A;  2HOF A;  2HVH A;  5EOZ A;  3JPT A;  1PK3 A;  5AKE A;  2WF6 A;  5HHH A;  4JWN A;  2HVI A;  1X6J A;  1B22 A;  3RR7 A;  3OJU A;  3QZ8 A;  4DOC A;  4ZH4 A;  3SQI A;  3LWM A;  3C29 A;  1NJY A;  5KL1 B;  1PVQ A;  1S0N A;  1KLN A;  4OJP A;  3RJE A;  1PZN A;  3C23 A;  1RM6 C;  4F2R A;  4RT3 A;  2KFZ A;  5KG6 A;  1Q8K A;  1X9X A;  2W04 A;  3H7I A;  4RPY A;  3TAD C;  3OSN A;  2HHV A;  4RT2 A;  4NLK A;  2G0A A;  4NXZ A;  1ZQN A;  4Q45 A;  2BGW A;  5JUM A;  4JV2 A;  5CA7 A;  4QWC A;  7ICJ A;  3HJE A;  2DGZ A;  5KFX A;  2W9B B;  4DLG A;  1L3U A;  3QUC A;  1D9F A;  4EEY A;  1L7N A;  4C0Z A;  4ED1 A;  1TVA A;  3QEA Z;  4DFP A;  3N4M B;  1NNL A;  1DGS A;  1NZP A;  3UXN A;  5HHI A;  1ZYQ A;  4Z6E A;  2PFO A;  1JRP A;  2BCS A;  2E8P A;  2EAM A;  4ECQ A;  5AKZ A;  4QZF A;  4JWM A;  4F8R A;  2ESE A;  1CUK A;  1FFV A;  5BOL A;  3C5F A;  2H3Z A;  1L8L A;  2XVT A;  2WAQ C;  3UQ0 A;  4QZD A;  5KFY A;  5J2A A;  3KHG A;  3V6J A;  2BCV A;  5HNK A;  4ED3 A;  3C2K A;  4F4Y A;  3MC1 A;  5KL8 B;  2HBL A;  2VAN A;  3NVY A;  4F91 B;  1KL9 A;  4B9T A;  1TAU A;  3ISB A;  1L5U A;  2C2R A;  4ED2 A;  2H3V A;  5ALW A;  3GV5 B;  2MSN A;  4EYH B;  2DF4 B;  3F5E A;  1S0M A;  1SV4 A;  4DLE A;  3GIK A;  3LWL A;  5C0Y A;  4FBT A;  5KTQ A;  4RQM A;  1XSN A;  1SL1 A;  1YZ7 A;  2FMQ A;  1RQL A;  1ZQT A;  4P0P B;  5J8Y A;  1WYG A;  5J2F A;  5III A;  1T94 A;  5AI0 A;  4C8N A;  2ALZ A;  1TK5 A;  3JPS A;  3QU4 A;  4C8L A;  3TAP A;  3NUQ A;  4PHE A;  2D8C A;  5KFQ A;  3PR4 A;  3RBD A;  5ALV A;  4QIW C;  5DG7 A;  4DOA A;  5KNI A;  3HPO A;  2HHT A;  2DL0 A;  3EW9 A;  3UXO A;  7ICG A;  3KHL A;  3HKZ C;  3OHB A;  5A0L A;  4NLG A;  5J0S A;  3BZC A;  4R66 A;  3CP8 A;  4O3Q A;  1MA7 A;  4IL6 U;  4GFJ A;  3RRH A;  5KFN A;  9ICW A;  4G9B A;  4M9H A;  5ALL A;  1N63 A;  2RLT A;  4F4Z A;  3GIM A;  7ICH A;  4R65 A;  5AHX A;  5KFT A;  2P6R A;  1COK A;  2XY7 A;  3WKD A;  1KN5 A;  4GXJ A;  3PO5 A;  5AKG A;  5KFW A;  5EE1 A;  1XNS A;  1A76 A;  2VA8 A;  3GQC A;  3PSI A;  2BCU A;  3MDA A;  3I28 A;  8ICQ A;  2XO7 A;  3I76 A;  4UB6 U;  1U47 A;  3V7J A;  1YZ6 A;  4BUG A;  5J2B A;  1V97 A;  4F4K A;  8ICI A;  2R18 A;  1L7O A;  4M9N A;  4UAR A;  1XSL A;  3SAF A;  3SV3 A;  3PSF A;  3IP4 B;  2GOL A;  4YMO A;  3PW0 A;  5KG0 A;  2Y0S F;  1NK0 A;  2PMZ F;  2GO7 A;  2Z7J A;  4ED7 A;  4DCC A;  2W7O A;  2IHN A;  3HW8 A;  2JZB A;  1D8B A;  5JTI A;  3RJH A;  2NRV A;  3N28 A;  3BQ2 A;  5J2D A;  1ZQB A;  2E1F A;  4YG2 A;  4DSF A;  2WF8 A;  1RPL A;  2VJ5 A;  2NRW A;  1ZQQ A;  3Q8R B;  4RNO A;  3ALR A;  1Z00 B;  7ICM A;  4FE3 A;  3KZI U;  1Z1B A;  1SV0 A;  4QZG A;  2ISP A;  3IG8 A;  3T5K A;  1TAM A;  2LBO A;  4K4G A;  4TQR A;  3N97 B;  3PW4 A;  5CHG A;  1XO1 A;  4RQ0 A;  1OXJ A;  2KIV A;  1NKB A;  4LJX A;  1X9M A;  1RXW A;  4IC9 A;  1DOQ A;  3SZ2 A;  3ETR A;  3KBB A;  4PL2 A;  2AH5 A;  2AXT U;  5JU5 A;  5KG1 A;  4ECV A;  2ASL A;  4I2J A;  4US8 A;  1T7P A;  1L3S A;  2KK0 A;  4BWM A;  2BQU A;  3RJJ A;  3PW7 A;  3L3F X;  2LMR A;  2HDO A;  9ICX A;  4F2S A;  1ZQF A;  1KBU A;  2PFQ A;  1IV8 A;  5J2C A;  4YMM A;  9ICM A;  5KFA A;  4IQU A;  1JMS A;  4DSL A;  1TAQ A;  5ALF A;  3DEE A;  4QZA A;  4ED0 A;  3QUB A;  4PZO A;  9ICH A;  2WB1 C;  3L5K A;  5KFF A;  4UQG A;  1V85 A;  2RDI A;  4F5O A;  2Q4T A;  1N5X A;  3MR5 A;  2G5H B;  2ES6 A;  5DGA A;  1UA1 A;  5L9X A;  7ICF A;  5KT5 A;  4AYB F;  4P0P A;  1U4B A;  3QXG A;  3TAN A;  3SV4 A;  1JUD A;  3WKA A;  7ICQ A;  1ZQV A;  2QLT A;  5KG7 A;  3BJY A;  4USA A;  3TAR A;  9ICB A;  4O5C A;  5AM5 A;  3T79 A;  2P66 A;  4P2H A;  3K1R B;  5CRX A;  2XGQ A;  1ZQE A;  2H3F A;  4ED6 A;  1ZQA A;  1NK6 A;  1RQN A;  2DKX A;  4F5R A;  4UAU A;  4JK1 A;  1DRG A;  2KSO B;  2R8G A;  4FFD A;  1S0O A;  2XY6 A;  4ECY A;  5KFU A;  7ICI A;  2HMX A;  2E8N A;  5IIO A;  2BDU A;  2QKQ A;  3QZ7 A;  2W7P A;  3QEB Z;  1QQ7 A;  5D49 A;  2HCF A;  4O3N A;  3T5J A;  3M9O B;  2ZTE A;  3E58 A;  3H0M B;  4QZB A;  5J2G A;  4M9L A;  4CF5 A;  3KD3 A;  3C5G A;  4Y2Y A;  3FC4 A;  4YCX A;  4DFD A;  3HWT A;  4KIT B;  4C7Z A;  1XWL A;  2R8J A;  4NJ8 A;  4PH5 A;  1KKX A;  1B43 A;  3BZK A;  4DL7 A;  3F2B A;  5L1K A;  2IBK A;  4DF4 A;  2BCQ A;  3M6K A;  5ALN A;  3PX4 A;  4KLU A;  1S77 D;  2PI5 A;  1ZQO A; 
#chains in the Genus database with same CATH homology
 4OJP A;  4QJF B;  3DEE A;  2N1R A;  5C0Y A;  3F5A A;  4BUG A;  2KVC A;  1F44 A;  1Q3U A;  2CRX A;  2WB1 C;  3AL0 B;  2HOQ A;  1L6N A;  2JGA A;  2WB1 F;  2ZIX A;  2R18 A;  2JHD A;  2JH7 A;  1A0P A;  3NRW A;  4KMO B;  3F2D A;  2E5S A;  2DQN B;  2Q4T A;  3SAG A;  2A3V A;  2W04 A;  3SAF A;  2CPR A;  3PSF A;  2K4H A;  2ZXI A;  3IP4 B;  1P7D A;  2G5H B;  2GOL A;  2RP5 A;  3M7D A;  2KIW A;  2VIX A;  1ECW A;  4U7C A;  2G0A A;  4NLC A;  2Y0S F;  2YX8 A;  2PMZ F;  2ZIW A;  1XO0 A;  4P0P B;  2Y0S C;  2RHF A;  2Z7J A;  2F76 X;  1T94 A;  2K89 A;  2XID A;  2H3I A;  2F8L A;  4NLB A;  3SMV A;  4AYB F;  2K8C B;  2DGZ A;  4P0P A;  3F53 A;  1UPH A;  3D2Q A;  2ZIU B;  3M6Z A;  4AYB C;  1IIP A;  2W7O A;  1URJ A;  4CGZ A;  3MGV A;  1HEK A;  4FZN A;  3OPX A;  4C0Z A;  1ZQ1 C;  2K8B B;  3D2N A;  4JMU A;  5HR7 A;  3NUQ A;  5HR6 A;  1GO3 F;  4QNL A;  2HBJ A;  2KKV A;  3N7R C;  4KX3 A;  3N7P D;  1D8B A;  2K8A A;  4QIW C;  2VJ4 A;  3AQE A;  3T79 A;  2E1E A;  2W03 A;  2ZIV B;  3CRX A;  4OJ6 A;  2G5I B;  2LHT A;  3LYS A;  5CRX A;  2E1F A;  2F77 X;  2KOB A;  2LKY A;  2H3F A;  2KJ8 A;  1ED1 A;  1Z19 A;  4CRX A;  3E0F A;  3ICX A;  2VJ5 A;  3HKZ F;  4ACO A;  3RFA A;  3HKZ C;  2CN1 A;  1HIW A;  2OM6 A;  3GZF A;  5A0L A;  1CRX A;  3ALR A;  2G08 A;  1NZB A;  2JMG A;  3CP8 A;  3O0F A;  4FE3 A;  1Q3V A;  4FZL A;  1DRG A;  2LYA A;  3LVV A;  3F2C A;  2XIC A;  1MA7 A;  4QIW F;  2KNJ A;  1Z1B A;  2H3Q A;  2NV3 A;  3RF9 A;  4BX9 C;  2GH1 A;  2RRD A;  2F2A B;  3IG5 A;  2HMX A;  2JH1 A;  3N7S C;  4GFJ A;  2ZG6 A;  2G06 A;  4P0Q A;  3IG8 A;  2H3Z A;  2BDU A;  2G09 A;  2XVT A;  1TAM A;  2WAQ C;  3K1Z A;  3PST A;  2LBO A;  2KHV A;  2W7P A;  3CYM A;  3C28 A;  4A8E A;  3SAH A;  4WJ3 B;  4CDG A;  2ZIV A;  2KD1 A;  3LVW A;  2K4E A;  3IN5 A;  2HOI A;  3GU3 A;  4OJL A;  2KIC A;  2YB4 A;  3H0L B;  2KEY A;  2KKP A;  4IC9 A;  2MA1 A;  3KFU F;  4O3M A;  1YT3 A;  4ICA A;  4PL1 A;  4KX5 A;  3VCB A;  3PZP A;  2KHQ A;  2ZIW B;  2ZXH A;  3AQF A;  2HBL A;  3H0M B;  2K4I A;  4PL2 A;  5KL8 B;  3VC8 A;  4OO1 J;  2ZIU A;  2VKQ A;  3ONN A;  2PMZ C;  2XI9 A;  1WUD A;  2KV2 A;  2D6F C;  4BJQ A;  2HOF A;  3D2S A;  2LYB A;  2MRL A;  3L3F X;  2KJ5 A;  2KJ9 A;  4P0Q B;  1SZH A;  4NV0 A;  4OJO A;  2OXO A;  2H3V A;  1XNS A;  2OYY A;  2HBM A;  3KZX A;  2YB1 A;  3PSI A;  2G07 A;  5T14 A;  3F2B A;  1PVP A;  1OUQ A;  1KBU A;  2DF4 B;  4FZM A;  3F5E A;  1PVR A;  3PSP A;  2HBK A;  3H0R B;  2ZIX B;  4NWI A;  3M6K A;  3SQI A;  1A6S A;  2WAQ F;  4U6P A;  3C29 A;  2M0N A;  1PVQ A;  5KL1 B;  4OJ5 A;  2OH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...