2GOLA

Xray structure of gag278
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Implications for Viral Capsid Assembly from Crystal Structures of HIV-1 Gag 1-278 and CAN 133-278.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Matrix protein p17 (MA)
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2golA00
2H3QA 1ECWA 1L6NA 2HMXA 2H3VA 2N1RA 4JMUA 1HIWA 2H3IA 1UPHA 4IC9A 4ICAA 2H3FA 1ED1A 2LYBA 2K4IA 1TAMA 2K4EA 2H3ZA 2NV3A 2GOLA 2JMGA 1HEKA 2K4HA 2LYAA 1A6SA
chains in the Genus database with same CATH superfamily
4KLDA 1X9WA 7ICSA 4I2DA 1N48A 2KKPA 2G08A 1DOQA 3KBBA 1A76A 1WUDA 1S0VA 2KSOB 4OO1J 2LBOA 2HBMA 1QH9A 5AI5A 3H4DA 5DG7A 3MDCA 1KBUA 4M9GA 3M7DA 5J2DA 1U49A 1SV0A 1NK6A 3TARA 3Q8RB 2BR0A 2W9AA 2JEGA 4CRXA 3SV3A 1PZNA 3ISDA 1S5LU 5L1KA 3M9MB 4QZEA 4C4TA 3M6KA 5J0OA 3KD3A 4IR9A 2W7PA 8ICYA 4NWIA 4DFKA 2A1JB 4NJ8A 5HHHA 4KLSA 2JH1A 4UB5A 3QEAZ 1SKWA 1KN5A 5DDYA 3RRHA 1KQQA 3OGUA 4IRKA 3PNCA 4KN7A 4I2BA 4Q44A 1JALA 1COOA 4B9LA 5AM0A 2JHDA 4A8EA 4F71A 5DG9A 2ASDA 4O3PA 9ICQA 1NKEA 1CRXA 1T3NA 4O3OA 4K4GA 3HX0A 1KEJA 4B9MA 3C2KA 5TZVA 4RQ6A 1YZ7A 3HKZC 4UAZA 3PW2A 2F3NA 3T79A 4UB4A 4RPXA 3BS5B 3RTVA 4J9MA 2QLTA 4ECZA 3RJJA 4P0QB 1B43A 2KVSA 2Y0SF 1BPDA 1LV5A 3LWMA 2JH7A 4Y2XA 3UXNA 2FLPA 5E79U 2LKYA 2W3SA 2KSOA 3NVZA 4CF4A 2ESEA 3F53A 3UXPA 1BPYA 1NK0A 2PMZC 4PHAA 4O3SA 4ECYA 2ZJ8A 3SENA 4P0QA 4M0AA 3RJIA 1UQVA 2H3QA 5AKKA 1X2IA 4FS2A 2YMLA 2KHQA 4C4SA 1YZ6A 5DBAA 2KK0A 2E8NA 4DEZA 2GWSA 1UCVA 3NRZA 5KFOA 4O5EA 2NO4A 5JTIA 4IR1A 1B4FA 4EX7A 1KKXA 4ECUA 5CWRA 5FP0A 2XY6A 4PL2A 2K4HA 5KT7A 3S6JA 4USAA 3NGDA 4C8LA 3CNHA 3LVVA 3AU2A 1ZQOA 7ICRA 3A0BU 2XICA 5J0RA 4KLIA 3UMGA 9ICSA 1DXSA 5G5HA 2EH9A 4JUZA 3GDXA 1JX4A 4Y2TA 1SIJA 3Q8SB 1N61A 1KTQA 2HSZA 1Q3VA 2PXIA 3K1RB 3EZ5A 3TAQA 5ALGA 4YCXA 4LJXA 5KT6A 4YMOA 5J0SA 4CF3A 1BVSA 4G9BA 1ZQDA 5EE1A 3BQ0A 5J2HA 2P66A 4QWEA 1JIHA 2Q0ZX 5CA7A 2C2RA 3HWTA 3V72A 1X42A 1WWUA 1FEZA 4QJFB 2JR5A 5KT2A 3PY8A 2ASLA 3JPRA 1COKA 8ICTA 5JU5A 2W11A 4HYKA 1KRPA 4RU9A 3PX6A 2E1EA 4OJLA 5KG6A 9ICVA 3FYHA 1BGXT 7ICKA 4EX6A 5IIJA 1RDFA 3IG5A 4CNQA 1K5OA 2G5HB 4Z6FA 3UMBA 2W9BA 3T5KA 5KFEA 4Q8EA 1ZQIA 3DV9A 2JEFA 1O08A 3D2NA 4ACOA 4P4PA 4YG2A 2UVVA 3RB0A 2VKQA 1QQ5A 3VC8A 2W7OA 3QZ7A 5AK3A 2WTFA 1NK7A 4GIBA 4RNMA 7ICGA 7ICVA 4BWMA 2BDUA 3IDWA 3R9KA 4YN4A 2HOQA 1CI4A 1MC8A 4TQRA 3H8MA 4Y2JA 3Q8PB 1F44A 1ZETA 2HHXA 1NZPA 4US8A 1UHUA 2MSNA 5J29A 4M2YA 3QU5A 2EAMA 1F5SA 5T14A 1OXJA 4RQMA 1U47A 5AIAA 4F4XA 1S0OA 1DK2A 5AHXA 1IG6A 9ICMA 3C21A 1UA0A 4F4ZA 5CB1A 3BZKA 3QUBA 4I27A 2QB0A 4QWAA 3PO5A 5KFRA 1BNOA 4PGQA 3T5LA 2ISOA 2EAPA 1VDVA 2IOHA 1WCLA 3HJEA 3F5EA 2GH1A 1CEZA 4RQNA 1Z00A 5H2FU 1SWVA 3MGHA 4O9MA 2E1FA 4C80A 2KIWA 4QIWC 5AKIA 2KFZA 5HMMA 2KZMA 5AIBA 5AI8A 2W9CA 4J9QA 3BDPA 3ED5A 3WK4A 2J6TA 1L7NA 5KFUA 3ISBA 1Z1VA 3GFKB 3KFUF 2FMQA 4AYBC 1Q3UA 1SL0A 1X6IA 2NRWA 5ALFA 1WYGA 3GZFA 4YVZA 5ALWA 3WK7A 4Y2SA 1N5XA 4GXJA 2IMWP 5ALKA 3WKDA 2OWOA 4O5KA 4EELA 2NRZA 3SI8A 3TFSA 4F5RA 4PGXA 3U26A 9ICAA 2JGAA 3RF9A 4R8UB 4BXOB 4DQSA 1ZQQA 3RR8A 2K8BB 1U4BA 2K4PA 2MAXA 2NRXA 1Z4NA 3TAPA 1ZQXA 4P0PB 3PSFA 2HHQA 2IOFK 1T8EA 4LVSA 8ICLA 4DO9A 2BZFA 5BOMA 3RJFA 2ZJAA 2KP7A 2NRTA 4UB3A 2XGQA 3UXOA 5DLFA 4GFJA 2ZIWA 4ECRA 1LKYB 8ICRA 2RRDA 3N97B 5ALHA 3RB6A 2KKVA 2K60A 3ALRA 3K75D 4J9LA 3GV5B 2HHSA 1UT8A 2FMPA 2C22A 4IL6U 2WF8A 4NY8A 1ZRMA 5AK5A 4IQWA 2G5IB 4UARA 2LMRA 4NM2A 8ICKA 3RRGA 2H3VA 2BCQA 4DQQA 4FBUA 3SAHA 4F91B 3PO4A 4ED7A 2I6XA 4XUSA 3MFIA 1S8OA 2E8PA 2JEJA 4LZGA 3PW7A 4F3OA 1N56A 2KIVA 3EYZA 4F4YA 1L8LA 1X9XA 3H0RB 4HAIA 2LHTA 2EZZA 5AM5A 2J6UA 4B9UA 3F2DA 1FIQA 1TAMA 1V97A 5L1MA 4K4HA 3SAFA 5J0WA 4C4RA 4KLMA 2JMGA 4I2IA 4RUAA 3KKAC 3L3FX 3C1ZA 3D2QA 3KHRA 3BZCA 3V7LA 4JV1A 1KL9A 2KNJA 4PGYA 1NKCA 1RYUA 1RYRA 1XSPA 1TAUA 4QW8A 3DDHA 5J0XA 4E0DA 1QTMA 3QX7A 1L3SA 2NV3A 3J81j 1ZRNA 1B0XA 7ICPA 2K89A 2KFNA 3L4PA 3GIIA 4OJ6A 3RJEA 2GLEA 8ICFA 2FPKA 4PL1A 1NI3A 3SV4A 4DOBA 2WB1C 3H0MB 1T3QA 2OHFA 3MBYA 1D8BA 2JV3A 4DF4A 3HKZF 3ETRA 2LYBA 1QQ6A 3N7RC 4ED8A 3TACB 3KKAA 7ICLA 4RQ7A 2QARA 2ZXIA 4US9A 2BPGA 4BX9C 4DSJA 5J2EA 2FLNA 2HMXA 5KT3A 2E8MA 2ATLA 2W8KA 3K1ZA 1NJWA 4DFDA 5AI0A 3RAXA 4DS5A 5KFVA 4DF8A 2JEIA 5BPCA 4RQ5A 4R64A 3GQCA 9ICXA 3V6KA 2P6RA 9ICOA 1PK1A 1X6JA 1WWVA 2ZJ5A 3UQ0A 1MSWD 1BPEA 3CYMA 3KZXA 4U7CA 2HHWA 4MF8A 1S0MA 1D8YA 3LYSA 2PFQA 1NNLA 2KG5A 3WKEA 4R65A 2W54A 5IILA 5AKYA 2KVCA 1ZQ1C 4ED3A 4G3IA 4TUPA 2CRXA 1ZXIA 3ISCA 3M1YA 1Z19A 3BQ7A 5ALXA 1ZQAA 1EXNA 1N60A 1X66A 5KFMA 2F1JA 2WHEA 4FE3A 2A19A 1WG8A 5KG7A 5AI4A 2Y1IA 2EZXA 4QZHA 3N4MB 5KFBA 4QZBA 2JRZA 5EWFA 3M9NB 4QZDA 5CHGA 2RDJA 2M9NA 5KG3A 5J2FA 2AU0A 1FFVA 4Z6EA 3THVA 4EYIB 3NASA 5DBBA 2V4RA 5ALRA 2VIXA 2PI5A 5KAIU 1DGSA 3QNMA 3QUTA 4J9RA 5J2BA 2ZIUB 5AKXA 4GC7A 4XA5A 2W03A 4KLEA 4RPYA 1MQ2A 8ICZA 8ICSA 3EPGA 4FO6A 4DL5A 7ICEA 3ZI4A 2ISPA 1SZHA 2HHTA 1PVQA 3C5GA 3WU2U 3Q8MA 3CP8A 5L1LA 4ED1A 2ES6A 2QB1A 2HOIA 5TISU 2O6KA 4DS4A 1JXEA 3I28A 2C28A 2QKQA 5AKEA 3NUQA 2KMDA 4QNLA 1OW5A 1ZQSA 2KHVA 1H38A 4CF5A 2F1HA 1NK8A 2W9CB 5KFNA 8ICCA 4MF2A 4B9VA 1GO3F 1ZQZA 3PW5A 3TANA 2IHMA 4IQUA 4O3RA 3QZ8A 3RH6A 4Y2PA 2E8OA 5KFWA 1ZQRA 3M6ZA 2WF6A 2OM6A 1UA1A 5KFHA 2KOBA 5D49A 2D3DA 1SL1A 3NVWA 4DSLA 3OSNA 2FMSA 9ICPA 5KG5A 4JMUA 3H0LB 5D4BA 2BQRA 2ASJA 2P6UA 4I2FA 4RT2A 3AEVA 3RBDA 4ZH4A 3MDAA 2FPLA 5KFTA 4RT3A 2XY7A 4PPXA 1T4GA 3ZDBA 1XO1A 3QEBZ 1K1QA 3AMZA 1AROP 5JUMA 2ZIWB 5ALJA 4LZDA 1ZJNA 4ED0A 3JPQA 3LVWA 3MGVA 8ICOA 4Y2UA 4PJ0U 3IN5A 2IOFA 1MA7A 1K1SA 2YQEA 5KT4A 4RQ0A 5F9LA 4B9NA 4ELTA 4J9OA 2J6SA 1XWLA 2KZZA 4KMUA 1V85A 2FI1A 4C7YA 2HVHA 4BGDA 8ICJA 3HRDD 1SL2A 5AKHA 1ZYQA 1SXEA 5KG4A 3AU6A 1O03A 2F2AB 3LK9A 5L1JA 1TVAA 5IIOA 4F8RA 3SR6A 5ALIA 4J9SA 3FM9A 3TADC 2YMQA 2B0CA 5AKZA 5CP2A 4UBCA 1JUDA 4JV2A 2XCAA 9ICJA 5HR6A 3WKCA 4QZ9A 1P7DA 8ICIA 4OJOA 4JK1A 3RJKA 1D9FA 4DSKA 1U48A 3C23A 2Y0SC 4YFKA 3HILA 3WKAA 4KLUA 3QU9A 4YXMA 3MABA 1RG6A 3H40A 1FFUA 5A0LA 5JRTA 5KFKA 5CJ7A 4PH5A 4UAVA 1TK5A 3C2MA 9ICNA 2RDIA 2FPMA 8ICWA 4YR2A 1ZQTA 5EE3A 1Z00B 2HHVA 2KZ3A 2LYHA 5KFZA 5CEHA 4QW9A 3KHHA 3C29A 4KMOB 3TKAA 4YD1A 9ICFA 7ICMA 5KFLA 4QZCA 3F5AA 3GILA 1Z1BA 5K4LA 1X40A 4TQSA 4Y2RA 5J2IA 1UPHA 2F76X 1RPLA 5HMLA 2HVIA 1FO4A 1N63A 2EQYA 3T3FA 2AGPA 2D6FC 1TAQA 2YMMA 4PHPA 5HP4A 2R8HA 1X9SA 4EZ6A 2MUTA 3JPOA 3PMLA 2QB0B 2C2EA 3GV8B 1S97A 4NLCA 1IXRA 2R8IA 2BKEA 3D6JA 9ICCA 1PK1B 1SWWA 2YN4A 3M8RA 3RB4A 5DG8A 2EDUA 2W9BB 4EBEA 1XO0A 3GIMA 5J2GA 4FZNA 3IHQB 2XC9A 5KG1A 2FDRA 5ALYA 5KFPA 4DFJA 2D8CA 3RBEA 4TUQA 1ZJMA 5HHIA 4QZIA 4OD0A 5AI6A 3G6VA 4CCHA 4NLNA 1L3TA 4DQPA 4CDGA 4F2RA 5L1IA 1SGGA 3EPIA 2WFAA 4NLZA 2MRLA 9ICGA 4XQ8A 1ZQPA 1L7PA 3DEEA 3PSTA 3SQIA 3KOOA 1J2NA 4BWJA 7ICFA 5KFSA 2XI9A 1N5WA 4Y2YA 4I2AA 2R8GA 2K8CB 1L8OA 5J2JA 3NTUA 1V9PA 1OUQA 2YMPA 1NJXA 2F1IA 1HEKA 4DSIA 4O3MA 2DL0A 4TURA 8ICUA 4NLGA 3SZ2A 2RQ5A 5CRXA 3NVVA 3Q8KA 5ALVA 3M9OB 4QWBA 3B9JA 2FE9A 5KFYA 5AKGA 3HPOA 2HBJA 5GTIU 1F0MA 5KFAA 5AM1A 2B6GA 1S9FA 2DF4B 5KNIA 4UASA 4DQIA 7ICTA 1SKSA 2HCFA 5ALUA 3JPTA 4UW9A 3C2LA 2BQUA 8ICPA 8ICAA 5F9NA 5DB7A 2FLLA 3PZPA 1U45A 2DWQA 5AKLA 2ZXHA 2RP5A 3HT3A 1KFSA 2L5YA 4ECTA 1ZQMA 1HUOA 5KTQA 5ALTA 4JWNA 1L5UA 4OCZA 1V38A 4BUGA 3AN1A 2AHOB 1PVRA 2Y9TA 1JXLA 5DQIA 3ZD9A 3UMCA 4UAYA 4DSFA 4DL6A 5J8YA 2G09A 5DQGA 3ONNA 2AGOA 2K4EA 3WKBA 2W55A 2JXJA 1SZPA 5AM2A 4M04A 3E58A 4F5PA 4K4IA 2KJ9A 5AI9A 5AICA 5KFJA 4EEYA 3BJYA 4IC9A 5J0TA 3QE9Y 4ICAA 2YB4A 4F5QA 5C5JA 1RXWA 5HR7A 9ICBA 2NYVA 5AM3A 2DGZA 2WF9A 4BJQA 5KFIA 8ICNA 2ODGA 3C1YA 2XY5A 1RXVA 1Q8KA 2PMZF 2ZIXB 4IQVA 4ED6A 2WF5A 3GIJA 4KX3A 4JV0A 1XSLA 2CXYA 7ICQA 5G5GA 2A3VA 2W3RA 2I5HA 2DPJA 2XCPA 3RAQA 5IIKA 1KDHA 3AQFA 4MHVA 2BQ3A 1KW4A 2VANA 1QQ7A 4ELVA 2LI6A 2AGQA 1ZQEA 1ZQYA 3OSPA 1KFDA 3WK9A 2W04A 4MFFA 4Q8FA 9ICUA 2KICA 4Y2VA 2HDOA 2V9WA 3SEIA 5IINA 4B6JA 4YP3A 1ZQVA 1NKBA 4DL4A 5KFDA 9ICHA 5GTHU 1XC9A 4B9TA 2BCRA 3TADA 5DBCA 2AJQA 5KFQA 2DUYA 4EYHB 1SV4A 5ALQA 3IG8A 4DLEA 4CE6A 1ZQCA 2E3TA 4KLLA 1XSNA 4C8MA 4C0ZA 3NVYA 4C8KA 3T5HA 2XGPA 4FBTA 4F50A 3PSPA 3RJHA 4F2SA 1DGJA 1N2XA 3KHLA 2AQ4A 4QZGA 1D8LA 4EEKA 3TI0A 5AK4A 4AP9A 2KJ5A 3RJGA 1ZQGA 4QZAA 4P0PA 3SMVA 1JN3A 2F8KA 4C7ZA 2EANA 3H8JA 4QZ8A 1A0PA 3ETLA 1Y88A 2LM4A 4RUCA 2WF7A 1RYSA 4BDPA 4DQRA 4FZLA 3N7PD 4DL7A 4F5OA 4KLJA 3MFHA 2Y1JA 3FC4A 4F5NA 3QU2A 2VJ5A 3H4BA 4Q45A 8ICXA 4NXZA 3C28A 1ZOLA 4RNOA 2C2DA 3JPNA 2F44A 2B21A 3CRXA 1C7YA 2ZIUA 3BQ1A 2KN7A 2AQ0A 3ZD8A 2YY6A 5DB6A 3BQ2A 5ALEA 3E2EA 4MFCA 2K4IA 4EENA 4DFPA 4DL3A 1XNSA 1MQ3A 2HI0A 1TK0A 1VLBA 3ORYA 4Y2QA 4I2GA 2F8LA 4M47A 5KFFA 1SXDA 1BPBA 1D9DA 2G0AA 2KTQA 4O3QA 3K4GA 1M6YA 4UATA 4ECWA 3KZIU 4UBBA 8ICQA 4UB1A 4FZMA 3OJSA 5B66U 3V6JA 3PV8A 4YMNA 4F4KA 4EBCA 1NK5A 2W8LA 2I9GA 4C8NA 2YX8A 2ZG6A 5BOLA 3D2SA 5KAFU 4P4OA 4DOCA 2MU2A 4GXKA 2GO7A 5J0YA 2PFPA 3H7IA 1RM6C 2QARB 3HW8A 1JRPA 4NL9C 7ICJA 1QSYA 2UVRA 1NZBA 7ICUA 4ELUA 3N7SC 1Z3EB 5KG2A 2P35A 2R18A 3V7JA 4YMMA 1LVHA 2YB1A 2RHFA 5ALPA 1ZD5A 2ZIVA 3QUCA 3SD7A 1ZD4A 2MA1A 1RQNA 3L5KA 3IV6A 5J0UA 4ECVA 3A0HU 2RLTA 4KLOA 4KTQA 1DRGA 5EWGA 3MR3A 3PSIA 3GU3A 3RR7A 1HIWA 2H3IA 2KV2A 4I2HA 2BPFA 1HJPA 8ICVA 2IBKA 3B0YA 3JPSA 3UM9A 1TK8A 4JB3A 3NS1A 1T94A 4IS7A 1S76D 2AXTU 3NRWA 1T7PA 3IRUA 4RQ1A 2LM1A 4UAUA 2BPCA 2ZUBA 5J8YC 1IV8A 2NRVA 2DPIA 1BNPA 4MEYA 3OHBA 5DGBA 3F2BA 1NJZA 1JROA 3ZDAA 3GV7B 4RQ8A 2EAOA 1ZD2P 1KSPA 2W43A 9ICRA 5EWEA 2GOLA 3IM1A 4YR3A 1JMSA 4I28A 4ED2A 9ICEA 4J9KA 4GLXA 2XO7A 1SKRA 3ICXA 2OCEA 4RZRA 4QIWF 2PFOA 1S77D 1L7OA 2BDPA 1X9MA 2E5SA 5DGAA 4NM1A 1L7MA 5J0PA 3H8SA 2VA8A 4EBDA 5ALMA 4DLGA 2ZTEA 5ALLA 4KX5A 3MR6A 5IIMA 5KG0A 2OEHA 2HBKA 1B22A 4F72A 2OXOA 1LKYA 4YXJA 1DK3A 4KLGA 2JZBB 3UQ2A 5HNKA 1J2MA 3PR4A 2LYAA 3HP6A 5AKJA 4KLHA 4J9PA 1NOMA 4O3NA 4DCCA 4F92B 8ICEA 3SAGA 2HW3A 3V7KA 3B0XA 4UB8U 7ICHA 1C20A 2R8KA 5EE0A 3Q8LA 3QYPA 2WAQF 2ZTCA 4NLKA 4QZFA 1ZQNA 2DBYA 4B9SA 4RQ4A 3WK6A 1NJYA 1ZQBA 1AQ6A 4ECXA 4GC6A 1TV9A 4DWIA 1QCKA 3EUB2 4J9NA 3PVXA 3QUQA 2F77X 2UVWA 5J2KA 2VA2A 3PX0A 4NV0A 9ICKA 3ZDEA 2K8AA 4P4MA 5DDMA 4UQGA 1ZQFA 4FFDA 4BXOA 1U9LA 4M6WB 3AUOA 4YQWA 9ICIA 2M0NA 4RQ2A 3ZDDA 1A77A 1ZD3A 8ICMA 5ALZA 1MN8A 3PW0A 9ICLA 1ED1A 4UAWA 2ZUCA 5ALNA 4J03A 2NO5A 3EWAA 5J0QA 2JZBA 2EZYA 3JPPA 1UT5A 4ECSA 2IHNA 3PMNA 3KHGA 2OH2A 2UVUA 1KFTA 1ZQWA 4RNNA 2WAQC 3CW2C 3AM9A 2A1AA 2Z7JA 4O5CA 3G6XA 1IM4A 2DKZA 3QXGA 5EOZA 1QSLA 2W9MA 1WCNA 3OHAA 1Q46A 4YD2A 3KTQA 1ZQHA 4R63A 4UB6U 8ICGA 4KITB 3LWLA 1ECWA 4JWMA 4M9HA 5AM4A 5DKWA 3VCBA 2MUTB 1ZQLA 4EZ9A 2Q4TA 5KL1B 4RQ3A 4MEXA 1NK9A 3RH5A 2CN1A 2A1JA 3RFAA 4DL2A 2G06A 1BPXA 4I2JA 4M9LA 1QSSA 4QWCA 2BHNA 2KD1A 2XVTA 3RB3A 3UPQA 1L3UA 4GXIA 3MGIA 4Q43A 3I76A 4DSEA 3WK8A 7ICOA 3EW9A 1L3VA 2ZTDA 2H5XA 4I2EA 4PZOA 2LPEA 2H3FA 3IP4B 5ALDA 5L9XA 8ICBA 1YT3A 2BCSA 3M8SA 4R8UA 2HBLA 3TQ1A 4NL9A 1N62A 4KLQA 3AL0B 2CPRA 3E0FA 1ZQUA 4MFAA 4M9JA 5C0YA 4RPZA 2OYYA 9ICWA 4M9NA 1PVPA 3PR5B 3OJUA 5KFXA 3F2CA 2DFLA 5J2CA 1TE2A 1LB2B 2KE7A 2BCVA 5EE9A 4ZOHC 3ZDCA 4IRCA 4FS1A 7ICNA 9ICTA 1CUKA 2FJ6A 5AK6A 3N28A 2HHUA 1XU4A 4Z6CA 3Q8QB 2N1RA 1ZQJA 2ZIVB 3LDAA 4F93B 2VA3A 3BQTA 3OPXA 5D46A 3PW4A 3V6HA 4YR0A 4P2HA 1KLNA 4O0IA 1A6SA 4TUSA 2PKEA 1BPZA 2G07A 2DKXA 1S10A 2V4QA 4OJ5A 1URJA 3I1YA 4DFMA 1IIPA 1NK4A 1HUZA 5DB8A 4KLTA 3AQEA 3C5FA 1J97A 1RZTA 3O0FA 5IIIA 3T5JA 3OTQA 2KEYA 3FDSA 2XIDA 2BGWA 2AH5A 5DQHA 3G6YA 3PX4A 2IA6A 4DOAA 5ALOA 1ZQKA 3QU4A 5F3XB 1VJ5A 2PI4A 4OJPA 5CR0A 5B5EU 4PHDA 1QLNA 4I29A 4KN4A 3RH4A 4IQTA 2ZIXA 4NLBA 1PUZA 5KFGA 2YTUA 4C8OA 1RQLA 1PK3A 5DLGA 7ICIA 3WK5A 3BS7A 1JI7A 2I1QA 4Z6DA 5J2AA 5KFCA 3GIKA 2VJ4A 4KLFA 4ECQA 4M6WA 1L6NA 4QWDA 4F4WA 1TFRA 2WB1F 2Y9UA 3FAHA 3QU7A 3BS5A 2BCUA 2PFNA 1Z4OA 2HOFA 4R66A 5KL8B 4XRHA 4WJ3B 3MC1A 2ZUDA 2DQNB 4IRDA 3H8WA 3MR2A 1SV0C 1S0NA 4I2CA 4CGZA 4PZNA 4PHEA 5ALSA 5KT5A 2ALZA 2R8JA 5DB9A 3SYZA 4X5VA 4AYBF 4UB2A 1TKDA 8ICHA 2H3ZA 2KJ8A 1XS9D 3MR5A 1SB3C 4U6PA 3TFRA
chains in the Genus database with same CATH topology
4P0QB 4QJFB 1ECWA 4BX9C 1SZHA 2W04A 2G07A 1PVQA 1DRGA 2G5IB 2HMXA 2KKPA 2G08A 2Y0SF 3PZPA 3CP8A 3PSIA 4OJ5A 3SAGA 2ZIUA 2H3VA 3GU3A 2KICA 3CRXA 1URJA 2HOIA 3VCBA 1HIWA 1IIPA 2E1EA 2H3IA 2KV2A 4NLCA 1WUDA 2JH7A 2ZXHA 3SAHA 3K1ZA 2RP5A 4OJLA 2LKYA 4OO1J 3AQEA 2WAQF 3O0FA 3D2SA 2K4IA 2LBOA 2HBMA 3NUQA 1T94A 3F53A 2Q4TA 1XNSA 5KL1B 2PMZC 3KFUF 3IG5A 4QNLA 2G5HB 3NRWA 1XO0A 2KEYA 2CN1A 2KHVA 2XIDA 4P0QA 3RFAA 2F8LA 2G06A 4AYBC 1KBUA 2F2AB 1Q3UA 4FZNA 2KD1A 2XVTA 3M7DA 4BUGA 2H3QA 2G0AA 3GZFA 1PVRA 3D2NA 4ACOA 2KHQA 3F2BA 1GO3F 3CYMA 3IG8A 3H0RB 3KZXA 4FZMA 4OJPA 2LHTA 4U7CA 4CRXA 2VKQA 3VC8A 2F77X 2W7OA 3LYSA 4CDGA 2H3FA 3IP4B 3F2DA 2G09A 4C0ZA 2ZIXA 3ONNA 4NLBA 4NV0A 1P7DA 1YT3A 5HR6A 4OJOA 1TAMA 2K4EA 2MRLA 3M6KA 2JGAA 2YX8A 3M6ZA 3SAFA 2BDUA 2KVCA 1ZQ1C 2GOLA 2ZG6A 2OM6A 2K8AA 2Y0SC 3PSPA 2JMGA 4PL2A 2K4HA 3RF9A 2HOQA 2KOBA 2CRXA 2VJ4A 1Z19A 2HBLA 3DEEA 3PSTA 2W7PA 3AL0B 3SQIA 1L6NA 2CPRA 3L3FX 1F44A 3LVVA 2M0NA 5A0LA 4FE3A 2KJ9A 2K8BB 2WB1F 2XICA 3E0FA 3ICXA 3D2QA 4NWIA 5C0YA 2XI9A 5T14A 2OYYA 4JMUA 4QIWF 1PVPA 3H0LB 2KNJA 4IC9A 2HOFA 2JH1A 2KJ5A 2K8CB 4ICAA 2YB4A 1ED1A 3F2CA 5KL8B 4P0PA 1NZBA 5HR7A 3SMVA 4P0PB 3PSFA 2NV3A 2DGZA 1OUQA 4WJ3B 3N7SC 2E5SA 4BJQA 2D6FC 1HEKA 1Q3VA 2K89A 1A0PA 3C29A 4KMOB 4O3MA 2R18A 4OJ6A 2JHDA 2YB1A 4A8EA 2DQNB 3F5AA 4PL1A 2PMZF 2ZIXB 5CRXA 2VIXA 2OH2A 1Z1BA 4FZLA 3F5EA 4KX5A 2RHFA 2WAQC 2WB1C 2N1RA 2ZIWB 3N7PD 2GH1A 3H0MB 4GFJA 1CRXA 4CGZA 2ZIWA 2Z7JA 4KX3A 1UPHA 2HBKA 1D8BA 2F76X 2OXOA 2HBJA 3HKZC 2ZIVB 3HKZF 2A3VA 3LVWA 3MGVA 2RRDA 3OPXA 2ZIUB 2LYBA 2VJ5A 2ZIVA 3T79A 4AYBF 2MA1A 2KKVA 3N7RC 2DF4B 2W03A 3AQFA 2E1FA 3IN5A 2H3ZA 2KJ8A 3ALRA 1MA7A 3C28A 2ZXIA 2LYAA 2KIWA 4U6PA 4QIWC 1A6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3Q A;  1ECW A;  1L6N A;  2HMX A;  2H3V A;  2N1R A;  4JMU A;  1HIW A;  2H3I A;  1UPH A;  4IC9 A;  4ICA A;  2H3F A;  1ED1 A;  2LYB A;  2K4I A;  1TAM A;  2K4E A;  2H3Z A;  2NV3 A;  2GOL A;  2JMG A;  1HEK A;  2K4H A;  2LYA A;  1A6S A; 
#chains in the Genus database with same CATH topology
 4KLD A;  1X9W A;  7ICS A;  4I2D A;  1N48 A;  2KKP A;  2G08 A;  1DOQ A;  3KBB A;  1A76 A;  1WUD A;  1S0V A;  2KSO B;  4OO1 J;  2LBO A;  2HBM A;  1QH9 A;  5AI5 A;  3H4D A;  5DG7 A;  3MDC A;  1KBU A;  4M9G A;  3M7D A;  5J2D A;  1U49 A;  1SV0 A;  1NK6 A;  3TAR A;  3Q8R B;  2BR0 A;  2W9A A;  2JEG A;  4CRX A;  3SV3 A;  1PZN A;  3ISD A;  1S5L U;  5L1K A;  3M9M B;  4QZE A;  4C4T A;  3M6K A;  5J0O A;  3KD3 A;  4IR9 A;  2W7P A;  8ICY A;  4NWI A;  4DFK A;  2A1J B;  4NJ8 A;  5HHH A;  4KLS A;  2JH1 A;  4UB5 A;  3QEA Z;  1SKW A;  1KN5 A;  5DDY A;  3RRH A;  1KQQ A;  3OGU A;  4IRK A;  3PNC A;  4KN7 A;  4I2B A;  4Q44 A;  1JAL A;  1COO A;  4B9L A;  5AM0 A;  2JHD A;  4A8E A;  4F71 A;  5DG9 A;  2ASD A;  4O3P A;  9ICQ A;  1NKE A;  1CRX A;  1T3N A;  4O3O A;  4K4G A;  3HX0 A;  1KEJ A;  4B9M A;  3C2K A;  5TZV A;  4RQ6 A;  1YZ7 A;  3HKZ C;  4UAZ A;  3PW2 A;  2F3N A;  3T79 A;  4UB4 A;  4RPX A;  3BS5 B;  3RTV A;  4J9M A;  2QLT A;  4ECZ A;  3RJJ A;  4P0Q B;  1B43 A;  2KVS A;  2Y0S F;  1BPD A;  1LV5 A;  3LWM A;  2JH7 A;  4Y2X A;  3UXN A;  2FLP A;  5E79 U;  2LKY A;  2W3S A;  2KSO A;  3NVZ A;  4CF4 A;  2ESE A;  3F53 A;  3UXP A;  1BPY A;  1NK0 A;  2PMZ C;  4PHA A;  4O3S A;  4ECY A;  2ZJ8 A;  3SEN A;  4P0Q A;  4M0A A;  3RJI A;  1UQV A;  2H3Q A;  5AKK A;  1X2I A;  4FS2 A;  2YML A;  2KHQ A;  4C4S A;  1YZ6 A;  5DBA A;  2KK0 A;  2E8N A;  4DEZ A;  2GWS A;  1UCV A;  3NRZ A;  5KFO A;  4O5E A;  2NO4 A;  5JTI A;  4IR1 A;  1B4F A;  4EX7 A;  1KKX A;  4ECU A;  5CWR A;  5FP0 A;  2XY6 A;  4PL2 A;  2K4H A;  5KT7 A;  3S6J A;  4USA A;  3NGD A;  4C8L A;  3CNH A;  3LVV A;  3AU2 A;  1ZQO A;  7ICR A;  3A0B U;  2XIC A;  5J0R A;  4KLI A;  3UMG A;  9ICS A;  1DXS A;  5G5H A;  2EH9 A;  4JUZ A;  3GDX A;  1JX4 A;  4Y2T A;  1SIJ A;  3Q8S B;  1N61 A;  1KTQ A;  2HSZ A;  1Q3V A;  2PXI A;  3K1R B;  3EZ5 A;  3TAQ A;  5ALG A;  4YCX A;  4LJX A;  5KT6 A;  4YMO A;  5J0S A;  4CF3 A;  1BVS A;  4G9B A;  1ZQD A;  5EE1 A;  3BQ0 A;  5J2H A;  2P66 A;  4QWE A;  1JIH A;  2Q0Z X;  5CA7 A;  2C2R A;  3HWT A;  3V72 A;  1X42 A;  1WWU A;  1FEZ A;  4QJF B;  2JR5 A;  5KT2 A;  3PY8 A;  2ASL A;  3JPR A;  1COK A;  8ICT A;  5JU5 A;  2W11 A;  4HYK A;  1KRP A;  4RU9 A;  3PX6 A;  2E1E A;  4OJL A;  5KG6 A;  9ICV A;  3FYH A;  1BGX T;  7ICK A;  4EX6 A;  5IIJ A;  1RDF A;  3IG5 A;  4CNQ A;  1K5O A;  2G5H B;  4Z6F A;  3UMB A;  2W9B A;  3T5K A;  5KFE A;  4Q8E A;  1ZQI A;  3DV9 A;  2JEF A;  1O08 A;  3D2N A;  4ACO A;  4P4P A;  4YG2 A;  2UVV A;  3RB0 A;  2VKQ A;  1QQ5 A;  3VC8 A;  2W7O A;  3QZ7 A;  5AK3 A;  2WTF A;  1NK7 A;  4GIB A;  4RNM A;  7ICG A;  7ICV A;  4BWM A;  2BDU A;  3IDW A;  3R9K A;  4YN4 A;  2HOQ A;  1CI4 A;  1MC8 A;  4TQR A;  3H8M A;  4Y2J A;  3Q8P B;  1F44 A;  1ZET A;  2HHX A;  1NZP A;  4US8 A;  1UHU A;  2MSN A;  5J29 A;  4M2Y A;  3QU5 A;  2EAM A;  1F5S A;  5T14 A;  1OXJ A;  4RQM A;  1U47 A;  5AIA A;  4F4X A;  1S0O A;  1DK2 A;  5AHX A;  1IG6 A;  9ICM A;  3C21 A;  1UA0 A;  4F4Z A;  5CB1 A;  3BZK A;  3QUB A;  4I27 A;  2QB0 A;  4QWA A;  3PO5 A;  5KFR A;  1BNO A;  4PGQ A;  3T5L A;  2ISO A;  2EAP A;  1VDV A;  2IOH A;  1WCL A;  3HJE A;  3F5E A;  2GH1 A;  1CEZ A;  4RQN A;  1Z00 A;  5H2F U;  1SWV A;  3MGH A;  4O9M A;  2E1F A;  4C80 A;  2KIW A;  4QIW C;  5AKI A;  2KFZ A;  5HMM A;  2KZM A;  5AIB A;  5AI8 A;  2W9C A;  4J9Q A;  3BDP A;  3ED5 A;  3WK4 A;  2J6T A;  1L7N A;  5KFU A;  3ISB A;  1Z1V A;  3GFK B;  3KFU F;  2FMQ A;  4AYB C;  1Q3U A;  1SL0 A;  1X6I A;  2NRW A;  5ALF A;  1WYG A;  3GZF A;  4YVZ A;  5ALW A;  3WK7 A;  4Y2S A;  1N5X A;  4GXJ A;  2IMW P;  5ALK A;  3WKD A;  2OWO A;  4O5K A;  4EEL A;  2NRZ A;  3SI8 A;  3TFS A;  4F5R A;  4PGX A;  3U26 A;  9ICA A;  2JGA A;  3RF9 A;  4R8U B;  4BXO B;  4DQS A;  1ZQQ A;  3RR8 A;  2K8B B;  1U4B A;  2K4P A;  2MAX A;  2NRX A;  1Z4N A;  3TAP A;  1ZQX A;  4P0P B;  3PSF A;  2HHQ A;  2IOF K;  1T8E A;  4LVS A;  8ICL A;  4DO9 A;  2BZF A;  5BOM A;  3RJF A;  2ZJA A;  2KP7 A;  2NRT A;  4UB3 A;  2XGQ A;  3UXO A;  5DLF A;  4GFJ A;  2ZIW A;  4ECR A;  1LKY B;  8ICR A;  2RRD A;  3N97 B;  5ALH A;  3RB6 A;  2KKV A;  2K60 A;  3ALR A;  3K75 D;  4J9L A;  3GV5 B;  2HHS A;  1UT8 A;  2FMP A;  2C22 A;  4IL6 U;  2WF8 A;  4NY8 A;  1ZRM A;  5AK5 A;  4IQW A;  2G5I B;  4UAR A;  2LMR A;  4NM2 A;  8ICK A;  3RRG A;  2H3V A;  2BCQ A;  4DQQ A;  4FBU A;  3SAH A;  4F91 B;  3PO4 A;  4ED7 A;  2I6X A;  4XUS A;  3MFI A;  1S8O A;  2E8P A;  2JEJ A;  4LZG A;  3PW7 A;  4F3O A;  1N56 A;  2KIV A;  3EYZ A;  4F4Y A;  1L8L A;  1X9X A;  3H0R B;  4HAI A;  2LHT A;  2EZZ A;  5AM5 A;  2J6U A;  4B9U A;  3F2D A;  1FIQ A;  1TAM A;  1V97 A;  5L1M A;  4K4H A;  3SAF A;  5J0W A;  4C4R A;  4KLM A;  2JMG A;  4I2I A;  4RUA A;  3KKA C;  3L3F X;  3C1Z A;  3D2Q A;  3KHR A;  3BZC A;  3V7L A;  4JV1 A;  1KL9 A;  2KNJ A;  4PGY A;  1NKC A;  1RYU A;  1RYR A;  1XSP A;  1TAU A;  4QW8 A;  3DDH A;  5J0X A;  4E0D A;  1QTM A;  3QX7 A;  1L3S A;  2NV3 A;  3J81 j;  1ZRN A;  1B0X A;  7ICP A;  2K89 A;  2KFN A;  3L4P A;  3GII A;  4OJ6 A;  3RJE A;  2GLE A;  8ICF A;  2FPK A;  4PL1 A;  1NI3 A;  3SV4 A;  4DOB A;  2WB1 C;  3H0M B;  1T3Q A;  2OHF A;  3MBY A;  1D8B A;  2JV3 A;  4DF4 A;  3HKZ F;  3ETR A;  2LYB A;  1QQ6 A;  3N7R C;  4ED8 A;  3TAC B;  3KKA A;  7ICL A;  4RQ7 A;  2QAR A;  2ZXI A;  4US9 A;  2BPG A;  4BX9 C;  4DSJ A;  5J2E A;  2FLN A;  2HMX A;  5KT3 A;  2E8M A;  2ATL A;  2W8K A;  3K1Z A;  1NJW A;  4DFD A;  5AI0 A;  3RAX A;  4DS5 A;  5KFV A;  4DF8 A;  2JEI A;  5BPC A;  4RQ5 A;  4R64 A;  3GQC A;  9ICX A;  3V6K A;  2P6R A;  9ICO A;  1PK1 A;  1X6J A;  1WWV A;  2ZJ5 A;  3UQ0 A;  1MSW D;  1BPE A;  3CYM A;  3KZX A;  4U7C A;  2HHW A;  4MF8 A;  1S0M A;  1D8Y A;  3LYS A;  2PFQ A;  1NNL A;  2KG5 A;  3WKE A;  4R65 A;  2W54 A;  5IIL A;  5AKY A;  2KVC A;  1ZQ1 C;  4ED3 A;  4G3I A;  4TUP A;  2CRX A;  1ZXI A;  3ISC A;  3M1Y A;  1Z19 A;  3BQ7 A;  5ALX A;  1ZQA A;  1EXN A;  1N60 A;  1X66 A;  5KFM A;  2F1J A;  2WHE A;  4FE3 A;  2A19 A;  1WG8 A;  5KG7 A;  5AI4 A;  2Y1I A;  2EZX A;  4QZH A;  3N4M B;  5KFB A;  4QZB A;  2JRZ A;  5EWF A;  3M9N B;  4QZD A;  5CHG A;  2RDJ A;  2M9N A;  5KG3 A;  5J2F A;  2AU0 A;  1FFV A;  4Z6E A;  3THV A;  4EYI B;  3NAS A;  5DBB A;  2V4R A;  5ALR A;  2VIX A;  2PI5 A;  5KAI U;  1DGS A;  3QNM A;  3QUT A;  4J9R A;  5J2B A;  2ZIU B;  5AKX A;  4GC7 A;  4XA5 A;  2W03 A;  4KLE A;  4RPY A;  1MQ2 A;  8ICZ A;  8ICS A;  3EPG A;  4FO6 A;  4DL5 A;  7ICE A;  3ZI4 A;  2ISP A;  1SZH A;  2HHT A;  1PVQ A;  3C5G A;  3WU2 U;  3Q8M A;  3CP8 A;  5L1L A;  4ED1 A;  2ES6 A;  2QB1 A;  2HOI A;  5TIS U;  2O6K A;  4DS4 A;  1JXE A;  3I28 A;  2C28 A;  2QKQ A;  5AKE A;  3NUQ A;  2KMD A;  4QNL A;  1OW5 A;  1ZQS A;  2KHV A;  1H38 A;  4CF5 A;  2F1H A;  1NK8 A;  2W9C B;  5KFN A;  8ICC A;  4MF2 A;  4B9V A;  1GO3 F;  1ZQZ A;  3PW5 A;  3TAN A;  2IHM A;  4IQU A;  4O3R A;  3QZ8 A;  3RH6 A;  4Y2P A;  2E8O A;  5KFW A;  1ZQR A;  3M6Z A;  2WF6 A;  2OM6 A;  1UA1 A;  5KFH A;  2KOB A;  5D49 A;  2D3D A;  1SL1 A;  3NVW A;  4DSL A;  3OSN A;  2FMS A;  9ICP A;  5KG5 A;  4JMU A;  3H0L B;  5D4B A;  2BQR A;  2ASJ A;  2P6U A;  4I2F A;  4RT2 A;  3AEV A;  3RBD A;  4ZH4 A;  3MDA A;  2FPL A;  5KFT A;  4RT3 A;  2XY7 A;  4PPX A;  1T4G A;  3ZDB A;  1XO1 A;  3QEB Z;  1K1Q A;  3AMZ A;  1ARO P;  5JUM A;  2ZIW B;  5ALJ A;  4LZD A;  1ZJN A;  4ED0 A;  3JPQ A;  3LVW A;  3MGV A;  8ICO A;  4Y2U A;  4PJ0 U;  3IN5 A;  2IOF A;  1MA7 A;  1K1S A;  2YQE A;  5KT4 A;  4RQ0 A;  5F9L A;  4B9N A;  4ELT A;  4J9O A;  2J6S A;  1XWL A;  2KZZ A;  4KMU A;  1V85 A;  2FI1 A;  4C7Y A;  2HVH A;  4BGD A;  8ICJ A;  3HRD D;  1SL2 A;  5AKH A;  1ZYQ A;  1SXE A;  5KG4 A;  3AU6 A;  1O03 A;  2F2A B;  3LK9 A;  5L1J A;  1TVA A;  5IIO A;  4F8R A;  3SR6 A;  5ALI A;  4J9S A;  3FM9 A;  3TAD C;  2YMQ A;  2B0C A;  5AKZ A;  5CP2 A;  4UBC A;  1JUD A;  4JV2 A;  2XCA A;  9ICJ A;  5HR6 A;  3WKC A;  4QZ9 A;  1P7D A;  8ICI A;  4OJO A;  4JK1 A;  3RJK A;  1D9F A;  4DSK A;  1U48 A;  3C23 A;  2Y0S C;  4YFK A;  3HIL A;  3WKA A;  4KLU A;  3QU9 A;  4YXM A;  3MAB A;  1RG6 A;  3H40 A;  1FFU A;  5A0L A;  5JRT A;  5KFK A;  5CJ7 A;  4PH5 A;  4UAV A;  1TK5 A;  3C2M A;  9ICN A;  2RDI A;  2FPM A;  8ICW A;  4YR2 A;  1ZQT A;  5EE3 A;  1Z00 B;  2HHV A;  2KZ3 A;  2LYH A;  5KFZ A;  5CEH A;  4QW9 A;  3KHH A;  3C29 A;  4KMO B;  3TKA A;  4YD1 A;  9ICF A;  7ICM A;  5KFL A;  4QZC A;  3F5A A;  3GIL A;  1Z1B A;  5K4L A;  1X40 A;  4TQS A;  4Y2R A;  5J2I A;  1UPH A;  2F76 X;  1RPL A;  5HML A;  2HVI A;  1FO4 A;  1N63 A;  2EQY A;  3T3F A;  2AGP A;  2D6F C;  1TAQ A;  2YMM A;  4PHP A;  5HP4 A;  2R8H A;  1X9S A;  4EZ6 A;  2MUT A;  3JPO A;  3PML A;  2QB0 B;  2C2E A;  3GV8 B;  1S97 A;  4NLC A;  1IXR A;  2R8I A;  2BKE A;  3D6J A;  9ICC A;  1PK1 B;  1SWW A;  2YN4 A;  3M8R A;  3RB4 A;  5DG8 A;  2EDU A;  2W9B B;  4EBE A;  1XO0 A;  3GIM A;  5J2G A;  4FZN A;  3IHQ B;  2XC9 A;  5KG1 A;  2FDR A;  5ALY A;  5KFP A;  4DFJ A;  2D8C A;  3RBE A;  4TUQ A;  1ZJM A;  5HHI A;  4QZI A;  4OD0 A;  5AI6 A;  3G6V A;  4CCH A;  4NLN A;  1L3T A;  4DQP A;  4CDG A;  4F2R A;  5L1I A;  1SGG A;  3EPI A;  2WFA A;  4NLZ A;  2MRL A;  9ICG A;  4XQ8 A;  1ZQP A;  1L7P A;  3DEE A;  3PST A;  3SQI A;  3KOO A;  1J2N A;  4BWJ A;  7ICF A;  5KFS A;  2XI9 A;  1N5W A;  4Y2Y A;  4I2A A;  2R8G A;  2K8C B;  1L8O A;  5J2J A;  3NTU A;  1V9P A;  1OUQ A;  2YMP A;  1NJX A;  2F1I A;  1HEK A;  4DSI A;  4O3M A;  2DL0 A;  4TUR A;  8ICU A;  4NLG A;  3SZ2 A;  2RQ5 A;  5CRX A;  3NVV A;  3Q8K A;  5ALV A;  3M9O B;  4QWB A;  3B9J A;  2FE9 A;  5KFY A;  5AKG A;  3HPO A;  2HBJ A;  5GTI U;  1F0M A;  5KFA A;  5AM1 A;  2B6G A;  1S9F A;  2DF4 B;  5KNI A;  4UAS A;  4DQI A;  7ICT A;  1SKS A;  2HCF A;  5ALU A;  3JPT A;  4UW9 A;  3C2L A;  2BQU A;  8ICP A;  8ICA A;  5F9N A;  5DB7 A;  2FLL A;  3PZP A;  1U45 A;  2DWQ A;  5AKL A;  2ZXH A;  2RP5 A;  3HT3 A;  1KFS A;  2L5Y A;  4ECT A;  1ZQM A;  1HUO A;  5KTQ A;  5ALT A;  4JWN A;  1L5U A;  4OCZ A;  1V38 A;  4BUG A;  3AN1 A;  2AHO B;  1PVR A;  2Y9T A;  1JXL A;  5DQI A;  3ZD9 A;  3UMC A;  4UAY A;  4DSF A;  4DL6 A;  5J8Y A;  2G09 A;  5DQG A;  3ONN A;  2AGO A;  2K4E A;  3WKB A;  2W55 A;  2JXJ A;  1SZP A;  5AM2 A;  4M04 A;  3E58 A;  4F5P A;  4K4I A;  2KJ9 A;  5AI9 A;  5AIC A;  5KFJ A;  4EEY A;  3BJY A;  4IC9 A;  5J0T A;  3QE9 Y;  4ICA A;  2YB4 A;  4F5Q A;  5C5J A;  1RXW A;  5HR7 A;  9ICB A;  2NYV A;  5AM3 A;  2DGZ A;  2WF9 A;  4BJQ A;  5KFI A;  8ICN A;  2ODG A;  3C1Y A;  2XY5 A;  1RXV A;  1Q8K A;  2PMZ F;  2ZIX B;  4IQV A;  4ED6 A;  2WF5 A;  3GIJ A;  4KX3 A;  4JV0 A;  1XSL A;  2CXY A;  7ICQ A;  5G5G A;  2A3V A;  2W3R A;  2I5H A;  2DPJ A;  2XCP A;  3RAQ A;  5IIK A;  1KDH A;  3AQF A;  4MHV A;  2BQ3 A;  1KW4 A;  2VAN A;  1QQ7 A;  4ELV A;  2LI6 A;  2AGQ A;  1ZQE A;  1ZQY A;  3OSP A;  1KFD A;  3WK9 A;  2W04 A;  4MFF A;  4Q8F A;  9ICU A;  2KIC A;  4Y2V A;  2HDO A;  2V9W A;  3SEI A;  5IIN A;  4B6J A;  4YP3 A;  1ZQV A;  1NKB A;  4DL4 A;  5KFD A;  9ICH A;  5GTH U;  1XC9 A;  4B9T A;  2BCR A;  3TAD A;  5DBC A;  2AJQ A;  5KFQ A;  2DUY A;  4EYH B;  1SV4 A;  5ALQ A;  3IG8 A;  4DLE A;  4CE6 A;  1ZQC A;  2E3T A;  4KLL A;  1XSN A;  4C8M A;  4C0Z A;  3NVY A;  4C8K A;  3T5H A;  2XGP A;  4FBT A;  4F50 A;  3PSP A;  3RJH A;  4F2S A;  1DGJ A;  1N2X A;  3KHL A;  2AQ4 A;  4QZG A;  1D8L A;  4EEK A;  3TI0 A;  5AK4 A;  4AP9 A;  2KJ5 A;  3RJG A;  1ZQG A;  4QZA A;  4P0P A;  3SMV A;  1JN3 A;  2F8K A;  4C7Z A;  2EAN A;  3H8J A;  4QZ8 A;  1A0P A;  3ETL A;  1Y88 A;  2LM4 A;  4RUC A;  2WF7 A;  1RYS A;  4BDP A;  4DQR A;  4FZL A;  3N7P D;  4DL7 A;  4F5O A;  4KLJ A;  3MFH A;  2Y1J A;  3FC4 A;  4F5N A;  3QU2 A;  2VJ5 A;  3H4B A;  4Q45 A;  8ICX A;  4NXZ A;  3C28 A;  1ZOL A;  4RNO A;  2C2D A;  3JPN A;  2F44 A;  2B21 A;  3CRX A;  1C7Y A;  2ZIU A;  3BQ1 A;  2KN7 A;  2AQ0 A;  3ZD8 A;  2YY6 A;  5DB6 A;  3BQ2 A;  5ALE A;  3E2E A;  4MFC A;  2K4I A;  4EEN A;  4DFP A;  4DL3 A;  1XNS A;  1MQ3 A;  2HI0 A;  1TK0 A;  1VLB A;  3ORY A;  4Y2Q A;  4I2G A;  2F8L A;  4M47 A;  5KFF A;  1SXD A;  1BPB A;  1D9D A;  2G0A A;  2KTQ A;  4O3Q A;  3K4G A;  1M6Y A;  4UAT A;  4ECW A;  3KZI U;  4UBB A;  8ICQ A;  4UB1 A;  4FZM A;  3OJS A;  5B66 U;  3V6J A;  3PV8 A;  4YMN A;  4F4K A;  4EBC A;  1NK5 A;  2W8L A;  2I9G A;  4C8N A;  2YX8 A;  2ZG6 A;  5BOL A;  3D2S A;  5KAF U;  4P4O A;  4DOC A;  2MU2 A;  4GXK A;  2GO7 A;  5J0Y A;  2PFP A;  3H7I A;  1RM6 C;  2QAR B;  3HW8 A;  1JRP A;  4NL9 C;  7ICJ A;  1QSY A;  2UVR A;  1NZB A;  7ICU A;  4ELU A;  3N7S C;  1Z3E B;  5KG2 A;  2P35 A;  2R18 A;  3V7J A;  4YMM A;  1LVH A;  2YB1 A;  2RHF A;  5ALP A;  1ZD5 A;  2ZIV A;  3QUC A;  3SD7 A;  1ZD4 A;  2MA1 A;  1RQN A;  3L5K A;  3IV6 A;  5J0U A;  4ECV A;  3A0H U;  2RLT A;  4KLO A;  4KTQ A;  1DRG A;  5EWG A;  3MR3 A;  3PSI A;  3GU3 A;  3RR7 A;  1HIW A;  2H3I A;  2KV2 A;  4I2H A;  2BPF A;  1HJP A;  8ICV A;  2IBK A;  3B0Y A;  3JPS A;  3UM9 A;  1TK8 A;  4JB3 A;  3NS1 A;  1T94 A;  4IS7 A;  1S76 D;  2AXT U;  3NRW A;  1T7P A;  3IRU A;  4RQ1 A;  2LM1 A;  4UAU A;  2BPC A;  2ZUB A;  5J8Y C;  1IV8 A;  2NRV A;  2DPI A;  1BNP A;  4MEY A;  3OHB A;  5DGB A;  3F2B A;  1NJZ A;  1JRO A;  3ZDA A;  3GV7 B;  4RQ8 A;  2EAO A;  1ZD2 P;  1KSP A;  2W43 A;  9ICR A;  5EWE A;  2GOL A;  3IM1 A;  4YR3 A;  1JMS A;  4I28 A;  4ED2 A;  9ICE A;  4J9K A;  4GLX A;  2XO7 A;  1SKR A;  3ICX A;  2OCE A;  4RZR A;  4QIW F;  2PFO A;  1S77 D;  1L7O A;  2BDP A;  1X9M A;  2E5S A;  5DGA A;  4NM1 A;  1L7M A;  5J0P A;  3H8S A;  2VA8 A;  4EBD A;  5ALM A;  4DLG A;  2ZTE A;  5ALL A;  4KX5 A;  3MR6 A;  5IIM A;  5KG0 A;  2OEH A;  2HBK A;  1B22 A;  4F72 A;  2OXO A;  1LKY A;  4YXJ A;  1DK3 A;  4KLG A;  2JZB B;  3UQ2 A;  5HNK A;  1J2M A;  3PR4 A;  2LYA A;  3HP6 A;  5AKJ A;  4KLH A;  4J9P A;  1NOM A;  4O3N A;  4DCC A;  4F92 B;  8ICE A;  3SAG A;  2HW3 A;  3V7K A;  3B0X A;  4UB8 U;  7ICH A;  1C20 A;  2R8K A;  5EE0 A;  3Q8L A;  3QYP A;  2WAQ F;  2ZTC A;  4NLK A;  4QZF A;  1ZQN A;  2DBY A;  4B9S A;  4RQ4 A;  3WK6 A;  1NJY A;  1ZQB A;  1AQ6 A;  4ECX A;  4GC6 A;  1TV9 A;  4DWI A;  1QCK A;  3EUB 2;  4J9N A;  3PVX A;  3QUQ A;  2F77 X;  2UVW A;  5J2K A;  2VA2 A;  3PX0 A;  4NV0 A;  9ICK A;  3ZDE A;  2K8A A;  4P4M A;  5DDM A;  4UQG A;  1ZQF A;  4FFD A;  4BXO A;  1U9L A;  4M6W B;  3AUO A;  4YQW A;  9ICI A;  2M0N A;  4RQ2 A;  3ZDD A;  1A77 A;  1ZD3 A;  8ICM A;  5ALZ A;  1MN8 A;  3PW0 A;  9ICL A;  1ED1 A;  4UAW A;  2ZUC A;  5ALN A;  4J03 A;  2NO5 A;  3EWA A;  5J0Q A;  2JZB A;  2EZY A;  3JPP A;  1UT5 A;  4ECS A;  2IHN A;  3PMN A;  3KHG A;  2OH2 A;  2UVU A;  1KFT A;  1ZQW A;  4RNN A;  2WAQ C;  3CW2 C;  3AM9 A;  2A1A A;  2Z7J A;  4O5C A;  3G6X A;  1IM4 A;  2DKZ A;  3QXG A;  5EOZ A;  1QSL A;  2W9M A;  1WCN A;  3OHA A;  1Q46 A;  4YD2 A;  3KTQ A;  1ZQH A;  4R63 A;  4UB6 U;  8ICG A;  4KIT B;  3LWL A;  1ECW A;  4JWM A;  4M9H A;  5AM4 A;  5DKW A;  3VCB A;  2MUT B;  1ZQL A;  4EZ9 A;  2Q4T A;  5KL1 B;  4RQ3 A;  4MEX A;  1NK9 A;  3RH5 A;  2CN1 A;  2A1J A;  3RFA A;  4DL2 A;  2G06 A;  1BPX A;  4I2J A;  4M9L A;  1QSS A;  4QWC A;  2BHN A;  2KD1 A;  2XVT A;  3RB3 A;  3UPQ A;  1L3U A;  4GXI A;  3MGI A;  4Q43 A;  3I76 A;  4DSE A;  3WK8 A;  7ICO A;  3EW9 A;  1L3V A;  2ZTD A;  2H5X A;  4I2E A;  4PZO A;  2LPE A;  2H3F A;  3IP4 B;  5ALD A;  5L9X A;  8ICB A;  1YT3 A;  2BCS A;  3M8S A;  4R8U A;  2HBL A;  3TQ1 A;  4NL9 A;  1N62 A;  4KLQ A;  3AL0 B;  2CPR A;  3E0F A;  1ZQU A;  4MFA A;  4M9J A;  5C0Y A;  4RPZ A;  2OYY A;  9ICW A;  4M9N A;  1PVP A;  3PR5 B;  3OJU A;  5KFX A;  3F2C A;  2DFL A;  5J2C A;  1TE2 A;  1LB2 B;  2KE7 A;  2BCV A;  5EE9 A;  4ZOH C;  3ZDC A;  4IRC A;  4FS1 A;  7ICN A;  9ICT A;  1CUK A;  2FJ6 A;  5AK6 A;  3N28 A;  2HHU A;  1XU4 A;  4Z6C A;  3Q8Q B;  2N1R A;  1ZQJ A;  2ZIV B;  3LDA A;  4F93 B;  2VA3 A;  3BQT A;  3OPX A;  5D46 A;  3PW4 A;  3V6H A;  4YR0 A;  4P2H A;  1KLN A;  4O0I A;  1A6S A;  4TUS A;  2PKE A;  1BPZ A;  2G07 A;  2DKX A;  1S10 A;  2V4Q A;  4OJ5 A;  1URJ A;  3I1Y A;  4DFM A;  1IIP A;  1NK4 A;  1HUZ A;  5DB8 A;  4KLT A;  3AQE A;  3C5F A;  1J97 A;  1RZT A;  3O0F A;  5III A;  3T5J A;  3OTQ A;  2KEY A;  3FDS A;  2XID A;  2BGW A;  2AH5 A;  5DQH A;  3G6Y A;  3PX4 A;  2IA6 A;  4DOA A;  5ALO A;  1ZQK A;  3QU4 A;  5F3X B;  1VJ5 A;  2PI4 A;  4OJP A;  5CR0 A;  5B5E U;  4PHD A;  1QLN A;  4I29 A;  4KN4 A;  3RH4 A;  4IQT A;  2ZIX A;  4NLB A;  1PUZ A;  5KFG A;  2YTU A;  4C8O A;  1RQL A;  1PK3 A;  5DLG A;  7ICI A;  3WK5 A;  3BS7 A;  1JI7 A;  2I1Q A;  4Z6D A;  5J2A A;  5KFC A;  3GIK A;  2VJ4 A;  4KLF A;  4ECQ A;  4M6W A;  1L6N A;  4QWD A;  4F4W A;  1TFR A;  2WB1 F;  2Y9U A;  3FAH A;  3QU7 A;  3BS5 A;  2BCU A;  2PFN A;  1Z4O A;  2HOF A;  4R66 A;  5KL8 B;  4XRH A;  4WJ3 B;  3MC1 A;  2ZUD A;  2DQN B;  4IRD A;  3H8W A;  3MR2 A;  1SV0 C;  1S0N A;  4I2C A;  4CGZ A;  4PZN A;  4PHE A;  5ALS A;  5KT5 A;  2ALZ A;  2R8J A;  5DB9 A;  3SYZ A;  4X5V A;  4AYB F;  4UB2 A;  1TKD A;  8ICH A;  2H3Z A;  2KJ8 A;  1XS9 D;  3MR5 A;  1SB3 C;  4U6P A;  3TFR A; 
#chains in the Genus database with same CATH homology
 4P0Q B;  4QJF B;  1ECW A;  4BX9 C;  1SZH A;  2W04 A;  2G07 A;  1PVQ A;  1DRG A;  2G5I B;  2HMX A;  2KKP A;  2G08 A;  2Y0S F;  3PZP A;  3CP8 A;  3PSI A;  4OJ5 A;  3SAG A;  2ZIU A;  2H3V A;  3GU3 A;  2KIC A;  3CRX A;  1URJ A;  2HOI A;  3VCB A;  1HIW A;  1IIP A;  2E1E A;  2H3I A;  2KV2 A;  4NLC A;  1WUD A;  2JH7 A;  2ZXH A;  3SAH A;  3K1Z A;  2RP5 A;  4OJL A;  2LKY A;  4OO1 J;  3AQE A;  2WAQ F;  3O0F A;  3D2S A;  2K4I A;  2LBO A;  2HBM A;  3NUQ A;  1T94 A;  3F53 A;  2Q4T A;  1XNS A;  5KL1 B;  2PMZ C;  3KFU F;  3IG5 A;  4QNL A;  2G5H B;  3NRW A;  1XO0 A;  2KEY A;  2CN1 A;  2KHV A;  2XID A;  4P0Q A;  3RFA A;  2F8L A;  2G06 A;  4AYB C;  1KBU A;  2F2A B;  1Q3U A;  4FZN A;  2KD1 A;  2XVT A;  3M7D A;  4BUG A;  2H3Q A;  2G0A A;  3GZF A;  1PVR A;  3D2N A;  4ACO A;  2KHQ A;  3F2B A;  1GO3 F;  3CYM A;  3IG8 A;  3H0R B;  3KZX A;  4FZM A;  4OJP A;  2LHT A;  4U7C A;  4CRX A;  2VKQ A;  3VC8 A;  2F77 X;  2W7O A;  3LYS A;  4CDG A;  2H3F A;  3IP4 B;  3F2D A;  2G09 A;  4C0Z A;  2ZIX A;  3ONN A;  4NLB A;  4NV0 A;  1P7D A;  1YT3 A;  5HR6 A;  4OJO A;  1TAM A;  2K4E A;  2MRL A;  3M6K A;  2JGA A;  2YX8 A;  3M6Z A;  3SAF A;  2BDU A;  2KVC A;  1ZQ1 C;  2GOL A;  2ZG6 A;  2OM6 A;  2K8A A;  2Y0S C;  3PSP A;  2JMG A;  4PL2 A;  2K4H A;  3RF9 A;  2HOQ A;  2KOB A;  2CRX A;  2VJ4 A;  1Z19 A;  2HBL A;  3DEE A;  3PST A;  2W7P A;  3AL0 B;  3SQI A;  1L6N A;  2CPR A;  3L3F X;  1F44 A;  3LVV A;  2M0N A;  5A0L A;  4FE3 A;  2KJ9 A;  2K8B B;  2WB1 F;  2XIC A;  3E0F A;  3ICX A;  3D2Q A;  4NWI A;  5C0Y A;  2XI9 A;  5T14 A;  2OYY A;  4JMU A;  4QIW F;  1PVP A;  3H0L B;  2KNJ A;  4IC9 A;  2HOF A;  2JH1 A;  2KJ5 A;  2K8C B;  4ICA A;  2YB4 A;  1ED1 A;  3F2C A;  5KL8 B;  4P0P A;  1NZB A;  5HR7 A;  3SMV A;  4P0P B;  3PSF A;  2NV3 A;  2DGZ A;  1OUQ A;  4WJ3 B;  3N7S C;  2E5S A;  4BJQ A;  2D6F C;  1HEK A;  1Q3V A;  2K89 A;  1A0P A;  3C29 A;  4KMO B;  4O3M A;  2R18 A;  4OJ6 A;  2JHD A;  2YB1 A;  4A8E A;  2DQN B;  3F5A A;  4PL1 A;  2PMZ F;  2ZIX B;  5CRX A;  2VIX A;  2OH2 A;  1Z1B A;  4FZL A;  3F5E A;  4KX5 A;  2RHF A;  2WAQ C;  2WB1 C;  2N1R A;  2ZIW B;  3N7P D;  2GH1 A;  3H0M B;  4GFJ A;  1CRX A;  4CGZ A;  2ZIW A;  2Z7J A;  4KX3 A;  1UPH A;  2HBK A;  1D8B A;  2F76 X;  2OXO A;  2HBJ A;  3HKZ C;  2ZIV B;  3HKZ F;  2A3V A;  3LVW A;  3MGV A;  2RRD A;  3OPX A;  2ZIU B;  2LYB A;  2VJ5 A;  2ZIV A;  3T79 A;  4AYB F;  2MA1 A;  2KKV A;  3N7R C;  2DF4 B;  2W03 A;  3AQF A;  2E1F A;  3IN5 A;  2H3Z A;  2KJ8 A;  3ALR A;  1MA7 A;  3C28 A;  2ZXI A;  2LYA A;  2KIW A;  4U6P A;  4QIW C;  1A6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...