2GOLA

Xray structure of gag278
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
b'SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein p17 (MA)
publication title Implications for Viral Capsid Assembly from Crystal Structures of HIV-1 Gag 1-278 and CAN 133-278.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2golA00
2H3FA 1TAMA 1ECWA 2H3QA 2H3VA 1UPHA 1L6NA 2LYAA 2K4IA 2H3IA 2GOLA 2K4HA 4JMUA 2LYBA 2K4EA 4ICAA 1HEKA 1A6SA 1ED1A 1HIWA 2H3ZA 2N1RA 4IC9A 2JMGA 2NV3A 2HMXA
chains in the Genus database with same CATH superfamily
1U48A 4ECXA 4GC6A 5J2CA 8ICSA 5AI9A 2AH5A 1TVAA 4JV1A 3KZIU 1NKBA 2P35A 5ALIA 2B6GA 5DGAA 2FLNA 1RZTA 2M0NA 4Q45A 4DOCA 5CB1A 4CNQA 3M8RA 2F2AB 1YZ6A 3GZFA 4RQ0A 4TQRA 1F5SA 4LZGA 1JIHA 5KTQA 2H3QA 2C2EA 2ISPA 3UXOA 1D9DA 1ZQRA 5ALEA 4I2GA 2JXJA 4TUSA 1QSSA 2G0AA 3QU5A 4KTQA 3F2CA 4QWCA 5J0UA 2R8JA 3EYZA 3L3FX 2LI6A 1ZQIA 3MGHA 1KN5A 4F3OA 1C20A 2ZUBA 2HOQA 4R63A 5KFDA 1L7OA 4O3SA 4CRXA 4Y2QA 4PHEA 1S97A 1MQ3A 3B0YA 3M9NB 3M1YA 3OPXA 3ISBA 1SV0C 4LVSA 2KKPA 4Y2PA 4F5OA 2KSOB 3KHHA 4MEYA 1ZJMA 1ZQKA 3H8SA 4XA5A 4O3PA 2XICA 5C5JA 1S0NA 3OJUA 1ZQZA 2OH2A 3ZDAA 5J0YA 3QXGA 2B0CA 5ALVA 3TI0A 4IRCA 4FBTA 5DQHA 4UBBA 1NZPA 3ZDBA 2LBOA 4ELUA 3AL0B 1WCNA 1A6SA 2HHVA 1FO4A 4J9LA 1IXRA 3C29A 1U47A 1RM6C 3PW4A 1HUOA 1T3QA 4RQ7A 4RZRA 2ZIVB 4GFJA 5ALJA 3NVZA 3M9MB 4NLNA 4O3NA 2V9WA 1D8BA 3CP8A 1WWVA 1PUZA 3BQTA 1BVSA 3NGDA 4J9NA 3WU2U 4J9MA 4DOBA 1JUDA 3RAXA 1PK1B 1KEJA 3OSNA 2HOIA 2HW3A 5KFXA 4QWAA 2IHNA 5AI5A 1S0OA 4F4ZA 2LYBA 2KN7A 3SAHA 3IHQB 5KFLA 4O3MA 5KG1A 1D8YA 5CWRA 1Z00A 1J97A 2IBKA 2AU0A 4B9UA 3UMGA 3RJIA 2NO5A 2ZJAA 3A0HU 4RQ1A 9ICAA 3HPOA 5J0PA 2XY5A 2FI1A 5AK5A 2LM4A 4R66A 7ICQA 3UXPA 2JH1A 3UMBA 4KMUA 5DG8A 5KFOA 4NLBA 7ICTA 5KFJA 1JROA 1DK2A 5KFAA 2WFAA 3GIJA 3H0RB 2H5XA 4ED2A 3QZ7A 2FE9A 3NVWA 2WB1C 2F1HA 2KNJA 1JMSA 2ZG6A 3GQCA 1K1SA 3SQIA 3WK6A 1WG8A 1B4FA 4Y2TA 1CUKA 3ORYA 3PX6A 1MN8A 1ZQGA 2E8OA 9ICBA 2ATLA 5DG7A 5D4BA 4P4MA 4DF8A 3WKAA 4RUAA 5C0YA 2GLEA 4FE3A 1V97A 1NK9A 1COKA 3BQ7A 2K89A 4I2IA 4J9OA 4C7ZA 4CF3A 5ALTA 4DSIA 2D8CA 1ZQFA 1X66A 3IM1A 3V72A 4MFCA 5DB9A 4YD1A 2BGWA 1NJWA 3T5KA 3RH6A 2YX8A 1KSPA 1SL2A 3RAQA 2DF4B 1Z4OA 3BZKA 5DGBA 4RQNA 1ZQPA 4PHPA 5J0OA 7ICIA 2F3NA 1SZHA 3EUB2 4US9A 3R9KA 1IIPA 3D2QA 1Q8KA 3QE9Y 5HHHA 3RR7A 1ED1A 2PKEA 3PMNA 3FDSA 4OO1J 2NRXA 1T94A 1ZQWA 4UW9A 3I76A 5ALFA 1DOQA 3NVYA 4JUZA 2KP7A 1BNPA 2HBMA 3PR4A 3UM9A 4M6WB 1UA1A 3V7KA 4GXJA 2KSOA 2J6SA 5AHXA 4YVZA 3SENA 3HT3A 2WF5A 4I2HA 4NL9C 1NK8A 5E79U 1DXSA 2DKZA 4WJ3B 1WUDA 5AICA 3F2BA 1TAQA 1Y88A 8ICNA 3IP4B 2A1JB 4F4KA 1RQLA 5KFCA 1S77D 9ICGA 1X42A 3GIMA 4PL2A 1NOMA 1ZD2P 1KQQA 4M0AA 1IV8A 4DL4A 2ZIVA 5KFWA 5F9LA 2UVUA 5K4LA 3NS1A 3WK5A 2C2DA 3THVA 4NM1A 4DQIA 2JRZA 4C8KA 1IG6A 2E8MA 3V7JA 3O0FA 2W7OA 1FIQA 2HDOA 5L1MA 1PK1A 2KVSA 3UQ0A 5AI0A 1U49A 2HOFA 4IQVA 3AQFA 4HAIA 3MGVA 4OD0A 1ZQBA 9ICOA 5AKZA 2E5SA 4P0QA 4M9HA 4KMOB 4ECRA 2BCUA 4XQ8A 4DSJA 1URJA 4J9SA 1O03A 1KDHA 1N5WA 4O3RA 5T14A 3H8JA 3FYHA 4YR3A 5DLFA 3C5FA 2KHVA 5ALNA 4IRKA 4RQ6A 3ZD8A 5EE3A 2EZZA 8ICUA 3JPNA 5J0WA 7ICEA 2KJ9A 5JUMA 3EWAA 5DBBA 1KKXA 4M9NA 9ICUA 2KKVA 4KX5A 4YFKA 4GXIA 1S76D 5AM5A 3M9OB 2MRLA 4I2JA 1KBUA 4MFAA 5AKGA 2Z7JA 4B6JA 4UB8U 2JH7A 3KBBA 3C1YA 4Q44A 5J29A 1Q3UA 2PFQA 4EZ6A 2YMQA 1T4GA 4M9JA 5HP4A 4JWMA 3GIIA 3H8WA 3JPQA 4PGQA 1ZQYA 3C21A 4YR0A 2KMDA 1SV0A 3HX0A 9ICHA 3QYPA 4KLOA 3C2KA 5J2HA 3HRDD 1TK0A 1L3UA 4US8A 3MBYA 2QLTA 3KKAC 2NO4A 4X5VA 5AM4A 4NLGA 1RG6A 3H0LB 1N63A 3LVWA 3WK9A 3FC4A 5AKJA 1RYSA 3CRXA 1L3TA 9ICVA 1ZQQA 2JEIA 3LK9A 4YG2A 4F2RA 4DLEA 1Z00B 2YY6A 4I27A 2LKYA 2IA6A 5J2IA 3OJSA 4USAA 5KFVA 1JX4A 4F4XA 4PH5A 4JK1A 3Q8PB 3C2LA 3K4GA 3AU2A 1TK8A 9ICCA 2XGQA 4DL6A 4P0PA 5KFTA 1UQVA 1N48A 1HUZA 4UB6U 4BJQA 4C8LA 3H8MA 3KHLA 3M6ZA 3C23A 1BNOA 2F8LA 1QQ5A 2YN4A 4RPZA 1SZPA 4FZLA 2PMZC 5KAFU 5EE0A 2GH1A 1PVPA 1DRGA 2UVRA 3IV6A 4IS7A 1V85A 1LKYB 2W43A 4ED3A 2VKQA 2HHTA 2I1QA 4AP9A 5J2EA 1SXEA 5AK4A 3MR2A 4M6WA 2KIVA 5BOMA 3RB6A 8ICGA 4IQUA 3BJYA 4UAZA 4DSKA 5AKYA 2HHUA 7ICKA 1UCVA 4BX9C 2AGOA 4FZMA 3RJFA 2L5YA 9ICKA 5KFUA 1RPLA 2WAQC 4YXJA 4ECVA 8ICBA 1SWVA 2J6UA 4RT3A 2B21A 4F4WA 2A1JA 2KIWA 3V6KA 2XIDA 3TADC 3AN1A 2K4IA 3HWTA 2AQ0A 1XSNA 2BCVA 2XO7A 4ELVA 3N97B 1M6YA 2ZJ8A 2E8NA 2DUYA 4CDGA 3GFKB 3TANA 3ISCA 2NRVA 5KFMA 1XU4A 4QIWC 2BQUA 2JR5A 2Y9UA 3V6JA 2DGZA 3SV3A 4NLKA 1RXWA 2WF9A 4LJXA 2DFLA 3FM9A 4ZH4A 2R8KA 4JB3A 4F8RA 3L5KA 1ZQLA 2KV2A 4B9LA 1B43A 4KLSA 4UASA 4M9GA 2DKXA 5J2FA 4KLFA 4QZ9A 1XO1A 2P6UA 5HR6A 4DQQA 2WF7A 5KNIA 3RF9A 4UATA 4DOAA 4C8OA 5AIBA 2GOLA 1TK5A 1SB3C 2JEFA 2AHOB 4F5PA 4DSLA 1RDFA 4IC9A 4NXZA 2ZTEA 2NV3A 8ICPA 4BXOB 3TARA 1NK4A 3M8SA 2BKEA 2PI5A 3JPRA 4M9LA 5ALYA 4O9MA 2ZUDA 4FO6A 8ICZA 1QSYA 1H38A 3QNMA 5KL8B 2W8KA 2PXIA 4YMOA 5CA7A 4DF4A 2FLPA 2ZIWB 8ICRA 4PHDA 4RU9A 3ETRA 5CP2A 3G6VA 4Y2VA 4YP3A 2W9AA 4LZDA 4RPXA 2FPMA 5J2GA 4J9QA 4M2YA 5HR7A 2BZFA 4CF4A 2D6FC 2BCRA 4KLIA 3OHAA 4JMUA 1B22A 4QWBA 4I2AA 4ICAA 1XO0A 3ALRA 3D6JA 4M47A 2KZZA 3N7SC 3ZDCA 4ECYA 2FDRA 3MDCA 4Q8FA 3RH4A 2HMXA 5AM3A 2RDJA 4C8NA 1Q3VA 1BPDA 1X9MA 5CHGA 5AKXA 2Y0SF 4QWEA 3N7RC 7ICLA 4NL9A 3QX7A 3QUTA 5IILA 3QUQA 1N60A 5EWGA 4ED0A 4RQ2A 2JV3A 4P0QB 1L7NA 2KICA 2XVTA 4ED1A 5J0QA 2OHFA 3N7PD 3UMCA 1PK3A 5B5EU 4R8UA 4NM2A 7ICNA 4YN4A 5GTIU 4GC7A 3HKZC 3E58A 8ICAA 7ICPA 4RQ4A 4DFDA 4KN4A 2WHEA 3QZ8A 4C0ZA 2KOBA 2ZIXB 4UBCA 2RHFA 1SKRA 3PR5B 3WKBA 3NUQA 1WWUA 4KLLA 3ICXA 3EPGA 3BQ0A 3KZXA 4UB5A 4TQSA 1QTMA 1LKYA 5L1KA 2QKQA 4IRDA 3PMLA 5J2DA 9ICTA 1SV4A 5DDYA 1PVRA 5EE1A 2FMPA 4B9MA 4B9VA 3NTUA 3IN5A 3A0BU 1JXEA 1ZQAA 2OCEA 5DDMA 3QU9A 2AQ4A 2IOFA 2KE7A 7ICRA 3KHRA 4XUSA 3GV7B 5J0XA 4PZOA 3PO4A 2MAXA 3RJJA 2FMQA 4I2FA 3RBEA 8ICXA 1KFSA 1CEZA 1SIJA 2ASLA 3LDAA 5J0RA 5ALQA 1L3SA 1VDVA 3MGIA 3M6KA 3H4BA 1B0XA 2YMMA 2W03A 3WKEA 2BHNA 1U9LA 4C4SA 4Q8EA 1ZRNA 2M9NA 1Q46A 4DL2A 2ZXHA 4EEKA 2D3DA 1QQ6A 4QZDA 1CRXA 5KFFA 3NRZA 1ZQUA 4Y2RA 1VLBA 2KJ5A 3CNHA 1SKWA 3PV8A 1ZQNA 5DB7A 1TAUA 3B0XA 1HJPA 3GU3A 1SXDA 7ICFA 2IOFK 3ONNA 5KG5A 1L6NA 3QUCA 3AM9A 4O0IA 4QJFB 2PMZF 5ALXA 9ICJA 2Y9TA 5DLGA 4P0PB 3PO5A 1COOA 2EQYA 2KK0A 1NKCA 1T8EA 4QZ8A 4PL1A 5TZVA 2YMPA 5AM0A 2EAMA 4DFJA 2XC9A 1NI3A 3BQ1A 1S8OA 3OSPA 1T3NA 4J03A 4UAUA 3KKAA 4O5EA 3WKCA 4I2BA 3B9JA 3C1ZA 2R8IA 2I9GA 4GIBA 1JXLA 7ICUA 5KT6A 1AROP 4ELTA 2F1JA 1TKDA 2YQEA 3C5GA 2ASDA 2NRZA 4GXKA 3VC8A 4BXOA 2KFZA 3RH5A 7ICVA 3I28A 3CYMA 5IIOA 2ESEA 1TAMA 9ICPA 5DBAA 1N56A 4U6PA 5DQIA 5AK3A 5KG0A 5KFBA 4IQTA 1L5UA 1A77A 4UB1A 4K4GA 1ZQTA 2DPJA 5ALZA 4QIWF 1LVHA 2W3SA 1DGSA 2E8PA 5HNKA 2ZIWA 3MFHA 9ICLA 3FAHA 1S9FA 2ZTCA 4OJLA 4DFKA 4MF8A 4MF2A 3GV8B 4RNOA 4J9PA 4FS1A 3L4PA 4M04A 4PGXA 1MQ2A 5J8YC 5CJ7A 5ALMA 1Z1VA 2FPLA 1F44A 5KFEA 5KT7A 5CRXA 2P66A 3NVVA 8ICKA 4NJ8A 3PW0A 1SL1A 2W04A 3TFRA 4B9SA 3H40A 2XY7A 1K5OA 1SGGA 3PSIA 4RQ8A 1ECWA 4KX3A 4Z6FA 4YMNA 1N5XA 3TKAA 4QZCA 3LWLA 4MFFA 4B9TA 4KLGA 3ISDA 3QEBZ 3BS5B 3E0FA 5J2AA 4DSFA 2HCFA 2K8CB 1LB2B 5AKHA 1D9FA 4O5CA 2JEGA 3TADA 2KVCA 1Z4NA 5ALSA 1S0VA 2ES6A 2G09A 3HILA 2MA1A 5TISU 3AEVA 2LMRA 1L8OA 5B66U 1OW5A 2G08A 1J2MA 1A76A 4K4HA 5IIKA 2ZIXA 5HMMA 4EBDA 2EAPA 5ALWA 8ICHA 1TFRA 4PHAA 4QZFA 2E1EA 2PI4A 5KG2A 5DG9A 2BCQA 2YTUA 5KFNA 2VA3A 4OJ6A 4DSEA 2FLLA 2K4PA 1EXNA 1ZQJA 2HVHA 1A0PA 3WK8A 2K60A 2KZMA 3GILA 2R18A 5ALLA 4RQ3A 2VJ5A 3RRHA 4R64A 3PZPA 2XCAA 4F4YA 2Q0ZX 4RUCA 2VIXA 3PX0A 2W9MA 1SWWA 4Y2SA 2PFNA 2LHTA 2H3IA 3Q8MA 2Q4TA 2ZUCA 5KG4A 2BCSA 1WYGA 3TACB 3Q8RB 1ZD3A 4QZAA 4DFPA 2FJ6A 4F72A 2N1RA 3BQ2A 4KLMA 3HKZF 2KHQA 3SMVA 2JZBA 3K75D 3IG5A 3RFAA 2H3FA 4CGZA 7ICSA 2XI9A 4TUPA 4R8UB 1ZQ1C 5CR0A 5AKEA 5J2BA 2RRDA 4Z6EA 1ZRMA 4YR2A 2HHXA 3AMZA 3MDAA 5KG3A 3SEIA 4NLCA 1ZJNA 8ICIA 4YQWA 2ODGA 1ZQDA 2I6XA 3Q8KA 4OCZA 5KG6A 4DFMA 4FS2A 5A0LA 1FEZA 2WB1F 4KN7A 5KFGA 4QZHA 1MSWD 3K1ZA 3ZD9A 4EENA 4RQ5A 5KFIA 4RQMA 3BS7A 4Q43A 1XSLA 1L7PA 4B9NA 4IL6U 4F5RA 1ZYQA 2A1AA 3G6YA 1D8LA 4YMMA 5H2FU 2BQ3A 4KLQA 4IQWA 4ED6A 2CN1A 1O08A 2JGAA 2OYYA 9ICMA 3OGUA 5ALDA 1RYUA 4OJPA 4QZBA 1QSLA 2ALZA 2AGPA 2BPCA 1X6JA 2KD1A 1X9XA 2DBYA 3C28A 3F5AA 1JALA 2NRTA 4P2HA 2OWOA 1KRPA 2PFPA 1PZNA 2OM6A 3QU7A 4BWMA 5DKWA 4C4TA 1DGJA 2W9CB 4A8EA 4ECQA 1IM4A 3WKDA 1TE2A 4ECWA 3RJEA 2V4QA 1SL0A 1UT8A 4Y2JA 1UA0A 9ICIA 2AJQA 4CE6A 5BPCA 1L3VA 3OHBA 4UAWA 3DDHA 4ZOHC 2G06A 2H3ZA 2J6TA 2HSZA 2RP5A 4ED8A 1KW4A 1ZQCA 1J2NA 4AYBC 5ALOA 5KFQA 2V4RA 1BPYA 1MC8A 2R8HA 4J9RA 1ZXIA 2ZXIA 3Q8LA 3PX4A 3BS5A 2MUTA 1K1QA 4DQPA 1X6IA 4K4IA 4FFDA 1KTQA 2G5HB 4QW9A 2YB4A 3SD7A 4DO9A 2VJ4A 3MC1A 4OJOA 2HHWA 1L7MA 1PVQA 1QH9A 2C28A 4R65A 4J9KA 5KFSA 5AIAA 1CI4A 2ZIUB 1RXVA 2W11A 3CW2C 8ICOA 1N61A 3OTQA 3ETLA 3EW9A 1VJ5A 3G6XA 1T7PA 2KTQA 1JN3A 3T79A 4KLHA 5J0SA 1HEKA 4YD2A 3F2DA 4NWIA 1ZETA 4DWIA 4I2DA 2JMGA 8ICYA 3PNCA 3EZ5A 2EZYA 1SKSA 3PSTA 4RPYA 3F53A 5D46A 3JPOA 1XWLA 3NRWA 4OJ5A 8ICTA 2HBJA 2R8GA 8ICWA 3KTQA 3D2NA 4EYIB 1ZQMA 5KT2A 4DS5A 4UB2A 1X40A 5KT5A 4MEXA 5G5HA 4IR1A 1BPXA 3HW8A 3KD3A 1NNLA 2KFNA 2GO7A 4TUQA 4UAVA 2DPIA 3QU2A 2BDUA 1ZQHA 1X2IA 3N4MB 3PY8A 5KAIU 4C4RA 2W3RA 3HP6A 2W7PA 3RJGA 1Z19A 2QB1A 1ZOLA 4G9BA 3IG8A 7ICJA 3TFSA 3RB0A 1QLNA 2MU2A 4BDPA 2HVIA 2DWQA 2WTFA 3DV9A 1NK6A 5KG7A 2YMLA 5IIJA 2I5HA 2W8LA 4PGYA 3T5HA 2W9BB 1NKEA 5L1JA 2BPGA 5JTIA 3WK4A 5G5GA 5J8YA 1FFVA 2Y1JA 4EYHB 8ICLA 5KT4A 3J81j 5IIMA 3KFUF 3SAFA 4QZGA 5HHIA 4XRHA 4C80A 1ZQOA 3GDXA 5AKLA 4RNNA 3SYZA 3AU6A 2WF6A 1N62A 3BDPA 2QARB 3T5LA 1JI7A 1N2XA 2HBLA 4HYKA 3LWMA 2RDIA 2O6KA 2K8AA 4QW8A 4F5QA 2K8BB 1QCKA 2VANA 3GV5B 4KITB 4KLTA 9ICQA 1ZQXA 3E2EA 2YB1A 1X9SA 4I28A 1RYRA 3D2SA 5DBCA 2EANA 1DK3A 5ALKA 2EZXA 3RTVA 2KJ8A 4PZNA 3AUOA 1LV5A 1OUQA 8ICJA 3RB3A 2JZBB 2A3VA 2BPFA 9ICRA 2LYHA 2HHQA 4RT2A 5L9XA 2HI0A 2JHDA 1QQ7A 4EEYA 4IR9A 2ASJA 2QB0B 4I2CA 4BWJA 2KEYA 3EPIA 1XS9D 2W9CA 2RQ5A 1P7DA 4G3IA 2ZTDA 2P6RA 1BPBA 2CXYA 2Y1IA 2E3TA 3RR8A 5IIIA 4EBEA 5ALUA 4CF5A 2IHMA 1KFTA 4ECUA 3TQ1A 5AKIA 2F8KA 3UXNA 2F77X 3KOOA 2GWSA 1BGXT 2ZJ5A 4F50A 3T3FA 2FMSA 1BPZA 2OEHA 3IDWA 3MABA 5GTHU 3RJHA 1XC9A 3MR3A 5JU5A 5DB6A 4BGDA 2WAQF 1ZQSA 1X9WA 1OXJA 3H7IA 5F9NA 9ICWA 3K1RB 3WK7A 5BOLA 4PJ0U 5J2KA 3PW5A 7ICOA 2ZIUA 2BQRA 3I1YA 4UB4A 2NRWA 2EDUA 1GO3F 2C22A 2EAOA 1ZD5A 5ALGA 7ICMA 2UVWA 5KT3A 1TV9A 2K4EA 4UARA 5CEHA 1XSPA 5HMLA 5KFRA 3RB4A 2IMWP 2LPEA 2DQNB 5AKKA 4KLDA 4MHVA 1S10A 1YZ7A 4ECSA 1NK5A 4DEZA 4EELA 2F44A 1KFDA 5F3XB 2HBKA 4JV2A 1ZD4A 2PFOA 4UAYA 4JWNA 4EX7A 1U45A 5KFKA 3SAGA 2CRXA 5KFZA 4AYBF 2DL0A 4NV0A 2W55A 4P4OA 3GIKA 8ICQA 1UT5A 2VA2A 5AI6A 5J0TA 4DS4A 4KLJA 1KL9A 3RBDA 4DL5A 3MR5A 3SV4A 2NYVA 2H3VA 1F0MA 1UPHA 3V7LA 5J2JA 2XGPA 8ICEA 3T5JA 3IRUA 3PW2A 1S0MA 2WF8A 4F2SA 4DL7A 3KHGA 3AQEA 2MUTB 4F91B 1NZBA 3C2MA 5D49A 4EX6A 1XNSA 1HIWA 1S5LU 4Z6DA 3QU4A 4GLXA 1NK7A 1MA7A 3JPPA 4JV0A 9ICFA 2W9BA 4QNLA 2G07A 3PSFA 4P4PA 3LVVA 4FZNA 1L8LA 2Y0SC 2A19A 2MSNA 4UQGA 3QEAZ 7ICHA 1C7YA 2IOHA 4EBCA 4Z6CA 5IINA 1Z1BA 3V6HA 1FFUA 5DB8A 4NY8A 4QZIA 5ALRA 3TAQA 3Q8SB 4DL3A 5KFHA 1ZQVA 2F1IA 3Q8QB 8ICVA 3U26A 1RQNA 4BUGA 5ALHA 3TAPA 4EZ9A 3PVXA 1Z3EB 2QARA 4I2EA 5AM1A 1NJZA 1YT3A 4DQSA 2FPKA 1BPEA 2W54A 3H0MB 4KLUA 1V38A 4E0DA 4DQRA 1U4BA 1NJXA 4QWDA 1V9PA 5FP0A 5EWFA 1NK0A 5L1LA 8ICMA 4Y2YA 2RLTA 3ZDEA 2AGQA 4O5KA 3LYSA 3VCBA 2BR0A 3UPQA 5EWEA 4UB3A 2LM1A 2LYAA 3RRGA 8ICFA 1WCLA 2HHSA 4ACOA 3RJKA 5KFPA 3ZI4A 2K4HA 5ALPA 4ECZA 3ZDDA 4YCXA 4I29A 2XCPA 3SI8A 2QB0A 4ECTA 5AK6A 3DEEA 1AQ6A 2OXOA 9ICSA 3SZ2A 3SR6A 1NJYA 2C2RA 2E1FA 4RNMA 2AXTU 4U7CA 4C7YA 2KG5A 2ISOA 4DLGA 1KLNA 2UVVA 4PPXA 4F71A 3JPSA 4FBUA 4F93B 3N28A 3H4DA 4O3OA 3M7DA 5AI4A 4Y2XA 4KLEA 3PW7A 2EH9A 2G5IB 4F92B 5AI8A 1JRPA 3S6JA 9ICXA 2VA8A 5L1IA 2CPRA 5DQGA 4DCCA 4F5NA 5EE9A 5EOZA 3UQ2A 3F5EA 7ICGA 2JEJA 5KFYA 5JRTA 3PSPA 3ED5A 3MR6A 3QUBA 3HJEA 4YXMA 4QZEA 3BZCA 2F76X 5KL1B 4Y2UA 2KZ3A 4O3QA 4ED7A 1ZQEA 9ICEA 3NASA 2XY6A 9ICNA 5AM2A 4NLZA 3MFIA 8ICCA 1UHUA 4TURA 2BDPA 4CCHA 3JPTA 4C8MA
chains in the Genus database with same CATH topology
1P7DA 2VKQA 2ZIXB 3C29A 3SQIA 3F2BA 2MRLA 3LYSA 3VCBA 4P0PA 1KBUA 2RHFA 2ZXIA 2G09A 2H3VA 1UPHA 2Z7JA 2MA1A 2LYAA 2ZIVB 4GFJA 5HR6A 3IP4B 5A0LA 3NUQA 4ACOA 2JH7A 2WB1F 2G08A 2K4HA 2G5HB 3ICXA 1Q3UA 3KZXA 5KL8B 2YB4A 3AQEA 4PL2A 2VJ4A 4OJOA 2M0NA 1D8BA 3K1ZA 3CP8A 1NZBA 3DEEA 2F77X 1XNSA 1HIWA 3VC8A 4BX9C 4FZMA 2OXOA 2ZIXA 2WAQC 2F2AB 2ZIWB 3GZFA 1PVQA 3CYMA 1MA7A 2ZIVA 5C0YA 1TAMA 1PVRA 2H3QA 2HOIA 3KFUF 3SAFA 2KIWA 4FE3A 2E1EA 2E1FA 4U6PA 4QNLA 2XIDA 5HR7A 2ZIUB 2G07A 2D6FC 4U7CA 2K89A 2K4IA 3PSFA 3IN5A 3LVVA 4FZNA 4OJ6A 4JMUA 2LYBA 2CN1A 2Y0SC 2G0AA 3SAHA 2WAQF 3O0FA 4ICAA 3ALRA 4QIWF 3F2CA 1XO0A 2JGAA 2OYYA 2W7OA 3N7SC 3T79A 1A0PA 1HEKA 3H0LB 3F2DA 3L3FX 4NWIA 2ZIWA 2R18A 3LVWA 4CDGA 4O3MA 2JMGA 2HOFA 4QIWC 3AQFA 4OJLA 3MGVA 3M7DA 3CRXA 2YX8A 2HMXA 2VJ5A 3PZPA 4OJPA 2HOQA 3M6KA 2HBLA 2ZIUA 2DF4B 3PSTA 1Z1BA 1Q3VA 2W03A 3F53A 2VIXA 4CRXA 2G5IB 2K8AA 2Y0SF 1GO3F 2E5SA 2DGZA 4P0QA 3N7RC 4KMOB 2K8BB 3NRWA 4OJ5A 2LHTA 2H3IA 2CPRA 2HBJA 2ZXHA 1F44A 2LKYA 2Q4TA 1SZHA 2KD1A 3D2NA 3OPXA 1CRXA 1URJA 4P0QB 2K4EA 1IIPA 3D2QA 3C28A 5CRXA 2KKPA 3F5EA 3F5AA 4BUGA 2KICA 2KJ5A 1ED1A 5T14A 2YB1A 2KV2A 2XVTA 2DQNB 2N1RA 2W04A 3D2SA 4OO1J 1YT3A 3HKZF 2KHQA 2OM6A 3SMVA 3PSPA 2XICA 3N7PD 3IG5A 2KJ8A 3GU3A 2JH1A 2KHVA 2BDUA 2H3FA 3ONNA 1T94A 3PSIA 1ECWA 4KX3A 3H0MB 4NLCA 3RFAA 4CGZA 1OUQA 2XI9A 2F76X 4A8EA 2OH2A 1L6NA 3RF9A 4QJFB 4NLBA 3HKZC 2PMZF 5KL1B 2A3VA 4BJQA 1ZQ1C 4P0PB 2HBKA 2GOLA 2HBMA 3M6ZA 2W7PA 2F8LA 1Z19A 2KJ9A 3E0FA 3IG8A 3H0RB 2RRDA 4FZLA 3SAGA 2K8CB 2PMZC 2CRXA 4PL1A 2JHDA 2GH1A 2LBOA 4AYBF 1PVPA 2WB1C 3AL0B 1A6SA 1DRGA 2G06A 2H3ZA 4NV0A 2KKVA 2RP5A 4IC9A 4KX5A 2KEYA 2KNJA 4C0ZA 2KVCA 2KOBA 2ZG6A 4WJ3B 2NV3A 1WUDA 4AYBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3F A;  1TAM A;  1ECW A;  2H3Q A;  2H3V A;  1UPH A;  1L6N A;  2LYA A;  2K4I A;  2H3I A;  2GOL A;  2K4H A;  4JMU A;  2LYB A;  2K4E A;  4ICA A;  1HEK A;  1A6S A;  1ED1 A;  1HIW A;  2H3Z A;  2N1R A;  4IC9 A;  2JMG A;  2NV3 A;  2HMX A; 
#chains in the Genus database with same CATH topology
 1U48 A;  4ECX A;  4GC6 A;  5J2C A;  8ICS A;  5AI9 A;  2AH5 A;  1TVA A;  4JV1 A;  3KZI U;  1NKB A;  2P35 A;  5ALI A;  2B6G A;  5DGA A;  2FLN A;  1RZT A;  2M0N A;  4Q45 A;  4DOC A;  5CB1 A;  4CNQ A;  3M8R A;  2F2A B;  1YZ6 A;  3GZF A;  4RQ0 A;  4TQR A;  1F5S A;  4LZG A;  1JIH A;  5KTQ A;  2H3Q A;  2C2E A;  2ISP A;  3UXO A;  1D9D A;  1ZQR A;  5ALE A;  4I2G A;  2JXJ A;  4TUS A;  1QSS A;  2G0A A;  3QU5 A;  4KTQ A;  3F2C A;  4QWC A;  5J0U A;  2R8J A;  3EYZ A;  3L3F X;  2LI6 A;  1ZQI A;  3MGH A;  1KN5 A;  4F3O A;  1C20 A;  2ZUB A;  2HOQ A;  4R63 A;  5KFD A;  1L7O A;  4O3S A;  4CRX A;  4Y2Q A;  4PHE A;  1S97 A;  1MQ3 A;  3B0Y A;  3M9N B;  3M1Y A;  3OPX A;  3ISB A;  1SV0 C;  4LVS A;  2KKP A;  4Y2P A;  4F5O A;  2KSO B;  3KHH A;  4MEY A;  1ZJM A;  1ZQK A;  3H8S A;  4XA5 A;  4O3P A;  2XIC A;  5C5J A;  1S0N A;  3OJU A;  1ZQZ A;  2OH2 A;  3ZDA A;  5J0Y A;  3QXG A;  2B0C A;  5ALV A;  3TI0 A;  4IRC A;  4FBT A;  5DQH A;  4UBB A;  1NZP A;  3ZDB A;  2LBO A;  4ELU A;  3AL0 B;  1WCN A;  1A6S A;  2HHV A;  1FO4 A;  4J9L A;  1IXR A;  3C29 A;  1U47 A;  1RM6 C;  3PW4 A;  1HUO A;  1T3Q A;  4RQ7 A;  4RZR A;  2ZIV B;  4GFJ A;  5ALJ A;  3NVZ A;  3M9M B;  4NLN A;  4O3N A;  2V9W A;  1D8B A;  3CP8 A;  1WWV A;  1PUZ A;  3BQT A;  1BVS A;  3NGD A;  4J9N A;  3WU2 U;  4J9M A;  4DOB A;  1JUD A;  3RAX A;  1PK1 B;  1KEJ A;  3OSN A;  2HOI A;  2HW3 A;  5KFX A;  4QWA A;  2IHN A;  5AI5 A;  1S0O A;  4F4Z A;  2LYB A;  2KN7 A;  3SAH A;  3IHQ B;  5KFL A;  4O3M A;  5KG1 A;  1D8Y A;  5CWR A;  1Z00 A;  1J97 A;  2IBK A;  2AU0 A;  4B9U A;  3UMG A;  3RJI A;  2NO5 A;  2ZJA A;  3A0H U;  4RQ1 A;  9ICA A;  3HPO A;  5J0P A;  2XY5 A;  2FI1 A;  5AK5 A;  2LM4 A;  4R66 A;  7ICQ A;  3UXP A;  2JH1 A;  3UMB A;  4KMU A;  5DG8 A;  5KFO A;  4NLB A;  7ICT A;  5KFJ A;  1JRO A;  1DK2 A;  5KFA A;  2WFA A;  3GIJ A;  3H0R B;  2H5X A;  4ED2 A;  3QZ7 A;  2FE9 A;  3NVW A;  2WB1 C;  2F1H A;  2KNJ A;  1JMS A;  2ZG6 A;  3GQC A;  1K1S A;  3SQI A;  3WK6 A;  1WG8 A;  1B4F A;  4Y2T A;  1CUK A;  3ORY A;  3PX6 A;  1MN8 A;  1ZQG A;  2E8O A;  9ICB A;  2ATL A;  5DG7 A;  5D4B A;  4P4M A;  4DF8 A;  3WKA A;  4RUA A;  5C0Y A;  2GLE A;  4FE3 A;  1V97 A;  1NK9 A;  1COK A;  3BQ7 A;  2K89 A;  4I2I A;  4J9O A;  4C7Z A;  4CF3 A;  5ALT A;  4DSI A;  2D8C A;  1ZQF A;  1X66 A;  3IM1 A;  3V72 A;  4MFC A;  5DB9 A;  4YD1 A;  2BGW A;  1NJW A;  3T5K A;  3RH6 A;  2YX8 A;  1KSP A;  1SL2 A;  3RAQ A;  2DF4 B;  1Z4O A;  3BZK A;  5DGB A;  4RQN A;  1ZQP A;  4PHP A;  5J0O A;  7ICI A;  2F3N A;  1SZH A;  3EUB 2;  4US9 A;  3R9K A;  1IIP A;  3D2Q A;  1Q8K A;  3QE9 Y;  5HHH A;  3RR7 A;  1ED1 A;  2PKE A;  3PMN A;  3FDS A;  4OO1 J;  2NRX A;  1T94 A;  1ZQW A;  4UW9 A;  3I76 A;  5ALF A;  1DOQ A;  3NVY A;  4JUZ A;  2KP7 A;  1BNP A;  2HBM A;  3PR4 A;  3UM9 A;  4M6W B;  1UA1 A;  3V7K A;  4GXJ A;  2KSO A;  2J6S A;  5AHX A;  4YVZ A;  3SEN A;  3HT3 A;  2WF5 A;  4I2H A;  4NL9 C;  1NK8 A;  5E79 U;  1DXS A;  2DKZ A;  4WJ3 B;  1WUD A;  5AIC A;  3F2B A;  1TAQ A;  1Y88 A;  8ICN A;  3IP4 B;  2A1J B;  4F4K A;  1RQL A;  5KFC A;  1S77 D;  9ICG A;  1X42 A;  3GIM A;  4PL2 A;  1NOM A;  1ZD2 P;  1KQQ A;  4M0A A;  1IV8 A;  4DL4 A;  2ZIV A;  5KFW A;  5F9L A;  2UVU A;  5K4L A;  3NS1 A;  3WK5 A;  2C2D A;  3THV A;  4NM1 A;  4DQI A;  2JRZ A;  4C8K A;  1IG6 A;  2E8M A;  3V7J A;  3O0F A;  2W7O A;  1FIQ A;  2HDO A;  5L1M A;  1PK1 A;  2KVS A;  3UQ0 A;  5AI0 A;  1U49 A;  2HOF A;  4IQV A;  3AQF A;  4HAI A;  3MGV A;  4OD0 A;  1ZQB A;  9ICO A;  5AKZ A;  2E5S A;  4P0Q A;  4M9H A;  4KMO B;  4ECR A;  2BCU A;  4XQ8 A;  4DSJ A;  1URJ A;  4J9S A;  1O03 A;  1KDH A;  1N5W A;  4O3R A;  5T14 A;  3H8J A;  3FYH A;  4YR3 A;  5DLF A;  3C5F A;  2KHV A;  5ALN A;  4IRK A;  4RQ6 A;  3ZD8 A;  5EE3 A;  2EZZ A;  8ICU A;  3JPN A;  5J0W A;  7ICE A;  2KJ9 A;  5JUM A;  3EWA A;  5DBB A;  1KKX A;  4M9N A;  9ICU A;  2KKV A;  4KX5 A;  4YFK A;  4GXI A;  1S76 D;  5AM5 A;  3M9O B;  2MRL A;  4I2J A;  1KBU A;  4MFA A;  5AKG A;  2Z7J A;  4B6J A;  4UB8 U;  2JH7 A;  3KBB A;  3C1Y A;  4Q44 A;  5J29 A;  1Q3U A;  2PFQ A;  4EZ6 A;  2YMQ A;  1T4G A;  4M9J A;  5HP4 A;  4JWM A;  3GII A;  3H8W A;  3JPQ A;  4PGQ A;  1ZQY A;  3C21 A;  4YR0 A;  2KMD A;  1SV0 A;  3HX0 A;  9ICH A;  3QYP A;  4KLO A;  3C2K A;  5J2H A;  3HRD D;  1TK0 A;  1L3U A;  4US8 A;  3MBY A;  2QLT A;  3KKA C;  2NO4 A;  4X5V A;  5AM4 A;  4NLG A;  1RG6 A;  3H0L B;  1N63 A;  3LVW A;  3WK9 A;  3FC4 A;  5AKJ A;  1RYS A;  3CRX A;  1L3T A;  9ICV A;  1ZQQ A;  2JEI A;  3LK9 A;  4YG2 A;  4F2R A;  4DLE A;  1Z00 B;  2YY6 A;  4I27 A;  2LKY A;  2IA6 A;  5J2I A;  3OJS A;  4USA A;  5KFV A;  1JX4 A;  4F4X A;  4PH5 A;  4JK1 A;  3Q8P B;  3C2L A;  3K4G A;  3AU2 A;  1TK8 A;  9ICC A;  2XGQ A;  4DL6 A;  4P0P A;  5KFT A;  1UQV A;  1N48 A;  1HUZ A;  4UB6 U;  4BJQ A;  4C8L A;  3H8M A;  3KHL A;  3M6Z A;  3C23 A;  1BNO A;  2F8L A;  1QQ5 A;  2YN4 A;  4RPZ A;  1SZP A;  4FZL A;  2PMZ C;  5KAF U;  5EE0 A;  2GH1 A;  1PVP A;  1DRG A;  2UVR A;  3IV6 A;  4IS7 A;  1V85 A;  1LKY B;  2W43 A;  4ED3 A;  2VKQ A;  2HHT A;  2I1Q A;  4AP9 A;  5J2E A;  1SXE A;  5AK4 A;  3MR2 A;  4M6W A;  2KIV A;  5BOM A;  3RB6 A;  8ICG A;  4IQU A;  3BJY A;  4UAZ A;  4DSK A;  5AKY A;  2HHU A;  7ICK A;  1UCV A;  4BX9 C;  2AGO A;  4FZM A;  3RJF A;  2L5Y A;  9ICK A;  5KFU A;  1RPL A;  2WAQ C;  4YXJ A;  4ECV A;  8ICB A;  1SWV A;  2J6U A;  4RT3 A;  2B21 A;  4F4W A;  2A1J A;  2KIW A;  3V6K A;  2XID A;  3TAD C;  3AN1 A;  2K4I A;  3HWT A;  2AQ0 A;  1XSN A;  2BCV A;  2XO7 A;  4ELV A;  3N97 B;  1M6Y A;  2ZJ8 A;  2E8N A;  2DUY A;  4CDG A;  3GFK B;  3TAN A;  3ISC A;  2NRV A;  5KFM A;  1XU4 A;  4QIW C;  2BQU A;  2JR5 A;  2Y9U A;  3V6J A;  2DGZ A;  3SV3 A;  4NLK A;  1RXW A;  2WF9 A;  4LJX A;  2DFL A;  3FM9 A;  4ZH4 A;  2R8K A;  4JB3 A;  4F8R A;  3L5K A;  1ZQL A;  2KV2 A;  4B9L A;  1B43 A;  4KLS A;  4UAS A;  4M9G A;  2DKX A;  5J2F A;  4KLF A;  4QZ9 A;  1XO1 A;  2P6U A;  5HR6 A;  4DQQ A;  2WF7 A;  5KNI A;  3RF9 A;  4UAT A;  4DOA A;  4C8O A;  5AIB A;  2GOL A;  1TK5 A;  1SB3 C;  2JEF A;  2AHO B;  4F5P A;  4DSL A;  1RDF A;  4IC9 A;  4NXZ A;  2ZTE A;  2NV3 A;  8ICP A;  4BXO B;  3TAR A;  1NK4 A;  3M8S A;  2BKE A;  2PI5 A;  3JPR A;  4M9L A;  5ALY A;  4O9M A;  2ZUD A;  4FO6 A;  8ICZ A;  1QSY A;  1H38 A;  3QNM A;  5KL8 B;  2W8K A;  2PXI A;  4YMO A;  5CA7 A;  4DF4 A;  2FLP A;  2ZIW B;  8ICR A;  4PHD A;  4RU9 A;  3ETR A;  5CP2 A;  3G6V A;  4Y2V A;  4YP3 A;  2W9A A;  4LZD A;  4RPX A;  2FPM A;  5J2G A;  4J9Q A;  4M2Y A;  5HR7 A;  2BZF A;  4CF4 A;  2D6F C;  2BCR A;  4KLI A;  3OHA A;  4JMU A;  1B22 A;  4QWB A;  4I2A A;  4ICA A;  1XO0 A;  3ALR A;  3D6J A;  4M47 A;  2KZZ A;  3N7S C;  3ZDC A;  4ECY A;  2FDR A;  3MDC A;  4Q8F A;  3RH4 A;  2HMX A;  5AM3 A;  2RDJ A;  4C8N A;  1Q3V A;  1BPD A;  1X9M A;  5CHG A;  5AKX A;  2Y0S F;  4QWE A;  3N7R C;  7ICL A;  4NL9 A;  3QX7 A;  3QUT A;  5IIL A;  3QUQ A;  1N60 A;  5EWG A;  4ED0 A;  4RQ2 A;  2JV3 A;  4P0Q B;  1L7N A;  2KIC A;  2XVT A;  4ED1 A;  5J0Q A;  2OHF A;  3N7P D;  3UMC A;  1PK3 A;  5B5E U;  4R8U A;  4NM2 A;  7ICN A;  4YN4 A;  5GTI U;  4GC7 A;  3HKZ C;  3E58 A;  8ICA A;  7ICP A;  4RQ4 A;  4DFD A;  4KN4 A;  2WHE A;  3QZ8 A;  4C0Z A;  2KOB A;  2ZIX B;  4UBC A;  2RHF A;  1SKR A;  3PR5 B;  3WKB A;  3NUQ A;  1WWU A;  4KLL A;  3ICX A;  3EPG A;  3BQ0 A;  3KZX A;  4UB5 A;  4TQS A;  1QTM A;  1LKY A;  5L1K A;  2QKQ A;  4IRD A;  3PML A;  5J2D A;  9ICT A;  1SV4 A;  5DDY A;  1PVR A;  5EE1 A;  2FMP A;  4B9M A;  4B9V A;  3NTU A;  3IN5 A;  3A0B U;  1JXE A;  1ZQA A;  2OCE A;  5DDM A;  3QU9 A;  2AQ4 A;  2IOF A;  2KE7 A;  7ICR A;  3KHR A;  4XUS A;  3GV7 B;  5J0X A;  4PZO A;  3PO4 A;  2MAX A;  3RJJ A;  2FMQ A;  4I2F A;  3RBE A;  8ICX A;  1KFS A;  1CEZ A;  1SIJ A;  2ASL A;  3LDA A;  5J0R A;  5ALQ A;  1L3S A;  1VDV A;  3MGI A;  3M6K A;  3H4B A;  1B0X A;  2YMM A;  2W03 A;  3WKE A;  2BHN A;  1U9L A;  4C4S A;  4Q8E A;  1ZRN A;  2M9N A;  1Q46 A;  4DL2 A;  2ZXH A;  4EEK A;  2D3D A;  1QQ6 A;  4QZD A;  1CRX A;  5KFF A;  3NRZ A;  1ZQU A;  4Y2R A;  1VLB A;  2KJ5 A;  3CNH A;  1SKW A;  3PV8 A;  1ZQN A;  5DB7 A;  1TAU A;  3B0X A;  1HJP A;  3GU3 A;  1SXD A;  7ICF A;  2IOF K;  3ONN A;  5KG5 A;  1L6N A;  3QUC A;  3AM9 A;  4O0I A;  4QJF B;  2PMZ F;  5ALX A;  9ICJ A;  2Y9T A;  5DLG A;  4P0P B;  3PO5 A;  1COO A;  2EQY A;  2KK0 A;  1NKC A;  1T8E A;  4QZ8 A;  4PL1 A;  5TZV A;  2YMP A;  5AM0 A;  2EAM A;  4DFJ A;  2XC9 A;  1NI3 A;  3BQ1 A;  1S8O A;  3OSP A;  1T3N A;  4J03 A;  4UAU A;  3KKA A;  4O5E A;  3WKC A;  4I2B A;  3B9J A;  3C1Z A;  2R8I A;  2I9G A;  4GIB A;  1JXL A;  7ICU A;  5KT6 A;  1ARO P;  4ELT A;  2F1J A;  1TKD A;  2YQE A;  3C5G A;  2ASD A;  2NRZ A;  4GXK A;  3VC8 A;  4BXO A;  2KFZ A;  3RH5 A;  7ICV A;  3I28 A;  3CYM A;  5IIO A;  2ESE A;  1TAM A;  9ICP A;  5DBA A;  1N56 A;  4U6P A;  5DQI A;  5AK3 A;  5KG0 A;  5KFB A;  4IQT A;  1L5U A;  1A77 A;  4UB1 A;  4K4G A;  1ZQT A;  2DPJ A;  5ALZ A;  4QIW F;  1LVH A;  2W3S A;  1DGS A;  2E8P A;  5HNK A;  2ZIW A;  3MFH A;  9ICL A;  3FAH A;  1S9F A;  2ZTC A;  4OJL A;  4DFK A;  4MF8 A;  4MF2 A;  3GV8 B;  4RNO A;  4J9P A;  4FS1 A;  3L4P A;  4M04 A;  4PGX A;  1MQ2 A;  5J8Y C;  5CJ7 A;  5ALM A;  1Z1V A;  2FPL A;  1F44 A;  5KFE A;  5KT7 A;  5CRX A;  2P66 A;  3NVV A;  8ICK A;  4NJ8 A;  3PW0 A;  1SL1 A;  2W04 A;  3TFR A;  4B9S A;  3H40 A;  2XY7 A;  1K5O A;  1SGG A;  3PSI A;  4RQ8 A;  1ECW A;  4KX3 A;  4Z6F A;  4YMN A;  1N5X A;  3TKA A;  4QZC A;  3LWL A;  4MFF A;  4B9T A;  4KLG A;  3ISD A;  3QEB Z;  3BS5 B;  3E0F A;  5J2A A;  4DSF A;  2HCF A;  2K8C B;  1LB2 B;  5AKH A;  1D9F A;  4O5C A;  2JEG A;  3TAD A;  2KVC A;  1Z4N A;  5ALS A;  1S0V A;  2ES6 A;  2G09 A;  3HIL A;  2MA1 A;  5TIS U;  3AEV A;  2LMR A;  1L8O A;  5B66 U;  1OW5 A;  2G08 A;  1J2M A;  1A76 A;  4K4H A;  5IIK A;  2ZIX A;  5HMM A;  4EBD A;  2EAP A;  5ALW A;  8ICH A;  1TFR A;  4PHA A;  4QZF A;  2E1E A;  2PI4 A;  5KG2 A;  5DG9 A;  2BCQ A;  2YTU A;  5KFN A;  2VA3 A;  4OJ6 A;  4DSE A;  2FLL A;  2K4P A;  1EXN A;  1ZQJ A;  2HVH A;  1A0P A;  3WK8 A;  2K60 A;  2KZM A;  3GIL A;  2R18 A;  5ALL A;  4RQ3 A;  2VJ5 A;  3RRH A;  4R64 A;  3PZP A;  2XCA A;  4F4Y A;  2Q0Z X;  4RUC A;  2VIX A;  3PX0 A;  2W9M A;  1SWW A;  4Y2S A;  2PFN A;  2LHT A;  2H3I A;  3Q8M A;  2Q4T A;  2ZUC A;  5KG4 A;  2BCS A;  1WYG A;  3TAC B;  3Q8R B;  1ZD3 A;  4QZA A;  4DFP A;  2FJ6 A;  4F72 A;  2N1R A;  3BQ2 A;  4KLM A;  3HKZ F;  2KHQ A;  3SMV A;  2JZB A;  3K75 D;  3IG5 A;  3RFA A;  2H3F A;  4CGZ A;  7ICS A;  2XI9 A;  4TUP A;  4R8U B;  1ZQ1 C;  5CR0 A;  5AKE A;  5J2B A;  2RRD A;  4Z6E A;  1ZRM A;  4YR2 A;  2HHX A;  3AMZ A;  3MDA A;  5KG3 A;  3SEI A;  4NLC A;  1ZJN A;  8ICI A;  4YQW A;  2ODG A;  1ZQD A;  2I6X A;  3Q8K A;  4OCZ A;  5KG6 A;  4DFM A;  4FS2 A;  5A0L A;  1FEZ A;  2WB1 F;  4KN7 A;  5KFG A;  4QZH A;  1MSW D;  3K1Z A;  3ZD9 A;  4EEN A;  4RQ5 A;  5KFI A;  4RQM A;  3BS7 A;  4Q43 A;  1XSL A;  1L7P A;  4B9N A;  4IL6 U;  4F5R A;  1ZYQ A;  2A1A A;  3G6Y A;  1D8L A;  4YMM A;  5H2F U;  2BQ3 A;  4KLQ A;  4IQW A;  4ED6 A;  2CN1 A;  1O08 A;  2JGA A;  2OYY A;  9ICM A;  3OGU A;  5ALD A;  1RYU A;  4OJP A;  4QZB A;  1QSL A;  2ALZ A;  2AGP A;  2BPC A;  1X6J A;  2KD1 A;  1X9X A;  2DBY A;  3C28 A;  3F5A A;  1JAL A;  2NRT A;  4P2H A;  2OWO A;  1KRP A;  2PFP A;  1PZN A;  2OM6 A;  3QU7 A;  4BWM A;  5DKW A;  4C4T A;  1DGJ A;  2W9C B;  4A8E A;  4ECQ A;  1IM4 A;  3WKD A;  1TE2 A;  4ECW A;  3RJE A;  2V4Q A;  1SL0 A;  1UT8 A;  4Y2J A;  1UA0 A;  9ICI A;  2AJQ A;  4CE6 A;  5BPC A;  1L3V A;  3OHB A;  4UAW A;  3DDH A;  4ZOH C;  2G06 A;  2H3Z A;  2J6T A;  2HSZ A;  2RP5 A;  4ED8 A;  1KW4 A;  1ZQC A;  1J2N A;  4AYB C;  5ALO A;  5KFQ A;  2V4R A;  1BPY A;  1MC8 A;  2R8H A;  4J9R A;  1ZXI A;  2ZXI A;  3Q8L A;  3PX4 A;  3BS5 A;  2MUT A;  1K1Q A;  4DQP A;  1X6I A;  4K4I A;  4FFD A;  1KTQ A;  2G5H B;  4QW9 A;  2YB4 A;  3SD7 A;  4DO9 A;  2VJ4 A;  3MC1 A;  4OJO A;  2HHW A;  1L7M A;  1PVQ A;  1QH9 A;  2C28 A;  4R65 A;  4J9K A;  5KFS A;  5AIA A;  1CI4 A;  2ZIU B;  1RXV A;  2W11 A;  3CW2 C;  8ICO A;  1N61 A;  3OTQ A;  3ETL A;  3EW9 A;  1VJ5 A;  3G6X A;  1T7P A;  2KTQ A;  1JN3 A;  3T79 A;  4KLH A;  5J0S A;  1HEK A;  4YD2 A;  3F2D A;  4NWI A;  1ZET A;  4DWI A;  4I2D A;  2JMG A;  8ICY A;  3PNC A;  3EZ5 A;  2EZY A;  1SKS A;  3PST A;  4RPY A;  3F53 A;  5D46 A;  3JPO A;  1XWL A;  3NRW A;  4OJ5 A;  8ICT A;  2HBJ A;  2R8G A;  8ICW A;  3KTQ A;  3D2N A;  4EYI B;  1ZQM A;  5KT2 A;  4DS5 A;  4UB2 A;  1X40 A;  5KT5 A;  4MEX A;  5G5H A;  4IR1 A;  1BPX A;  3HW8 A;  3KD3 A;  1NNL A;  2KFN A;  2GO7 A;  4TUQ A;  4UAV A;  2DPI A;  3QU2 A;  2BDU A;  1ZQH A;  1X2I A;  3N4M B;  3PY8 A;  5KAI U;  4C4R A;  2W3R A;  3HP6 A;  2W7P A;  3RJG A;  1Z19 A;  2QB1 A;  1ZOL A;  4G9B A;  3IG8 A;  7ICJ A;  3TFS A;  3RB0 A;  1QLN A;  2MU2 A;  4BDP A;  2HVI A;  2DWQ A;  2WTF A;  3DV9 A;  1NK6 A;  5KG7 A;  2YML A;  5IIJ A;  2I5H A;  2W8L A;  4PGY A;  3T5H A;  2W9B B;  1NKE A;  5L1J A;  2BPG A;  5JTI A;  3WK4 A;  5G5G A;  5J8Y A;  1FFV A;  2Y1J A;  4EYH B;  8ICL A;  5KT4 A;  3J81 j;  5IIM A;  3KFU F;  3SAF A;  4QZG A;  5HHI A;  4XRH A;  4C80 A;  1ZQO A;  3GDX A;  5AKL A;  4RNN A;  3SYZ A;  3AU6 A;  2WF6 A;  1N62 A;  3BDP A;  2QAR B;  3T5L A;  1JI7 A;  1N2X A;  2HBL A;  4HYK A;  3LWM A;  2RDI A;  2O6K A;  2K8A A;  4QW8 A;  4F5Q A;  2K8B B;  1QCK A;  2VAN A;  3GV5 B;  4KIT B;  4KLT A;  9ICQ A;  1ZQX A;  3E2E A;  2YB1 A;  1X9S A;  4I28 A;  1RYR A;  3D2S A;  5DBC A;  2EAN A;  1DK3 A;  5ALK A;  2EZX A;  3RTV A;  2KJ8 A;  4PZN A;  3AUO A;  1LV5 A;  1OUQ A;  8ICJ A;  3RB3 A;  2JZB B;  2A3V A;  2BPF A;  9ICR A;  2LYH A;  2HHQ A;  4RT2 A;  5L9X A;  2HI0 A;  2JHD A;  1QQ7 A;  4EEY A;  4IR9 A;  2ASJ A;  2QB0 B;  4I2C A;  4BWJ A;  2KEY A;  3EPI A;  1XS9 D;  2W9C A;  2RQ5 A;  1P7D A;  4G3I A;  2ZTD A;  2P6R A;  1BPB A;  2CXY A;  2Y1I A;  2E3T A;  3RR8 A;  5III A;  4EBE A;  5ALU A;  4CF5 A;  2IHM A;  1KFT A;  4ECU A;  3TQ1 A;  5AKI A;  2F8K A;  3UXN A;  2F77 X;  3KOO A;  2GWS A;  1BGX T;  2ZJ5 A;  4F50 A;  3T3F A;  2FMS A;  1BPZ A;  2OEH A;  3IDW A;  3MAB A;  5GTH U;  3RJH A;  1XC9 A;  3MR3 A;  5JU5 A;  5DB6 A;  4BGD A;  2WAQ F;  1ZQS A;  1X9W A;  1OXJ A;  3H7I A;  5F9N A;  9ICW A;  3K1R B;  3WK7 A;  5BOL A;  4PJ0 U;  5J2K A;  3PW5 A;  7ICO A;  2ZIU A;  2BQR A;  3I1Y A;  4UB4 A;  2NRW A;  2EDU A;  1GO3 F;  2C22 A;  2EAO A;  1ZD5 A;  5ALG A;  7ICM A;  2UVW A;  5KT3 A;  1TV9 A;  2K4E A;  4UAR A;  5CEH A;  1XSP A;  5HML A;  5KFR A;  3RB4 A;  2IMW P;  2LPE A;  2DQN B;  5AKK A;  4KLD A;  4MHV A;  1S10 A;  1YZ7 A;  4ECS A;  1NK5 A;  4DEZ A;  4EEL A;  2F44 A;  1KFD A;  5F3X B;  2HBK A;  4JV2 A;  1ZD4 A;  2PFO A;  4UAY A;  4JWN A;  4EX7 A;  1U45 A;  5KFK A;  3SAG A;  2CRX A;  5KFZ A;  4AYB F;  2DL0 A;  4NV0 A;  2W55 A;  4P4O A;  3GIK A;  8ICQ A;  1UT5 A;  2VA2 A;  5AI6 A;  5J0T A;  4DS4 A;  4KLJ A;  1KL9 A;  3RBD A;  4DL5 A;  3MR5 A;  3SV4 A;  2NYV A;  2H3V A;  1F0M A;  1UPH A;  3V7L A;  5J2J A;  2XGP A;  8ICE A;  3T5J A;  3IRU A;  3PW2 A;  1S0M A;  2WF8 A;  4F2S A;  4DL7 A;  3KHG A;  3AQE A;  2MUT B;  4F91 B;  1NZB A;  3C2M A;  5D49 A;  4EX6 A;  1XNS A;  1HIW A;  1S5L U;  4Z6D A;  3QU4 A;  4GLX A;  1NK7 A;  1MA7 A;  3JPP A;  4JV0 A;  9ICF A;  2W9B A;  4QNL A;  2G07 A;  3PSF A;  4P4P A;  3LVV A;  4FZN A;  1L8L A;  2Y0S C;  2A19 A;  2MSN A;  4UQG A;  3QEA Z;  7ICH A;  1C7Y A;  2IOH A;  4EBC A;  4Z6C A;  5IIN A;  1Z1B A;  3V6H A;  1FFU A;  5DB8 A;  4NY8 A;  4QZI A;  5ALR A;  3TAQ A;  3Q8S B;  4DL3 A;  5KFH A;  1ZQV A;  2F1I A;  3Q8Q B;  8ICV A;  3U26 A;  1RQN A;  4BUG A;  5ALH A;  3TAP A;  4EZ9 A;  3PVX A;  1Z3E B;  2QAR A;  4I2E A;  5AM1 A;  1NJZ A;  1YT3 A;  4DQS A;  2FPK A;  1BPE A;  2W54 A;  3H0M B;  4KLU A;  1V38 A;  4E0D A;  4DQR A;  1U4B A;  1NJX A;  4QWD A;  1V9P A;  5FP0 A;  5EWF A;  1NK0 A;  5L1L A;  8ICM A;  4Y2Y A;  2RLT A;  3ZDE A;  2AGQ A;  4O5K A;  3LYS A;  3VCB A;  2BR0 A;  3UPQ A;  5EWE A;  4UB3 A;  2LM1 A;  2LYA A;  3RRG A;  8ICF A;  1WCL A;  2HHS A;  4ACO A;  3RJK A;  5KFP A;  3ZI4 A;  2K4H A;  5ALP A;  4ECZ A;  3ZDD A;  4YCX A;  4I29 A;  2XCP A;  3SI8 A;  2QB0 A;  4ECT A;  5AK6 A;  3DEE A;  1AQ6 A;  2OXO A;  9ICS A;  3SZ2 A;  3SR6 A;  1NJY A;  2C2R A;  2E1F A;  4RNM A;  2AXT U;  4U7C A;  4C7Y A;  2KG5 A;  2ISO A;  4DLG A;  1KLN A;  2UVV A;  4PPX A;  4F71 A;  3JPS A;  4FBU A;  4F93 B;  3N28 A;  3H4D A;  4O3O A;  3M7D A;  5AI4 A;  4Y2X A;  4KLE A;  3PW7 A;  2EH9 A;  2G5I B;  4F92 B;  5AI8 A;  1JRP A;  3S6J A;  9ICX A;  2VA8 A;  5L1I A;  2CPR A;  5DQG A;  4DCC A;  4F5N A;  5EE9 A;  5EOZ A;  3UQ2 A;  3F5E A;  7ICG A;  2JEJ A;  5KFY A;  5JRT A;  3PSP A;  3ED5 A;  3MR6 A;  3QUB A;  3HJE A;  4YXM A;  4QZE A;  3BZC A;  2F76 X;  5KL1 B;  4Y2U A;  2KZ3 A;  4O3Q A;  4ED7 A;  1ZQE A;  9ICE A;  3NAS A;  2XY6 A;  9ICN A;  5AM2 A;  4NLZ A;  3MFI A;  8ICC A;  1UHU A;  4TUR A;  2BDP A;  4CCH A;  3JPT A;  4C8M A; 
#chains in the Genus database with same CATH homology
 1P7D A;  2VKQ A;  2ZIX B;  3C29 A;  3SQI A;  3F2B A;  2MRL A;  3LYS A;  3VCB A;  4P0P A;  1KBU A;  2RHF A;  2ZXI A;  2G09 A;  2H3V A;  1UPH A;  2Z7J A;  2MA1 A;  2LYA A;  2ZIV B;  4GFJ A;  5HR6 A;  3IP4 B;  5A0L A;  3NUQ A;  4ACO A;  2JH7 A;  2WB1 F;  2G08 A;  2K4H A;  2G5H B;  3ICX A;  1Q3U A;  3KZX A;  5KL8 B;  2YB4 A;  3AQE A;  4PL2 A;  2VJ4 A;  4OJO A;  2M0N A;  1D8B A;  3K1Z A;  3CP8 A;  1NZB A;  3DEE A;  2F77 X;  1XNS A;  1HIW A;  3VC8 A;  4BX9 C;  4FZM A;  2OXO A;  2ZIX A;  2WAQ C;  2F2A B;  2ZIW B;  3GZF A;  1PVQ A;  3CYM A;  1MA7 A;  2ZIV A;  5C0Y A;  1TAM A;  1PVR A;  2H3Q A;  2HOI A;  3KFU F;  3SAF A;  2KIW A;  4FE3 A;  2E1E A;  2E1F A;  4U6P A;  4QNL A;  2XID A;  5HR7 A;  2ZIU B;  2G07 A;  2D6F C;  4U7C A;  2K89 A;  2K4I A;  3PSF A;  3IN5 A;  3LVV A;  4FZN A;  4OJ6 A;  4JMU A;  2LYB A;  2CN1 A;  2Y0S C;  2G0A A;  3SAH A;  2WAQ F;  3O0F A;  4ICA A;  3ALR A;  4QIW F;  3F2C A;  1XO0 A;  2JGA A;  2OYY A;  2W7O A;  3N7S C;  3T79 A;  1A0P A;  1HEK A;  3H0L B;  3F2D A;  3L3F X;  4NWI A;  2ZIW A;  2R18 A;  3LVW A;  4CDG A;  4O3M A;  2JMG A;  2HOF A;  4QIW C;  3AQF A;  4OJL A;  3MGV A;  3M7D A;  3CRX A;  2YX8 A;  2HMX A;  2VJ5 A;  3PZP A;  4OJP A;  2HOQ A;  3M6K A;  2HBL A;  2ZIU A;  2DF4 B;  3PST A;  1Z1B A;  1Q3V A;  2W03 A;  3F53 A;  2VIX A;  4CRX A;  2G5I B;  2K8A A;  2Y0S F;  1GO3 F;  2E5S A;  2DGZ A;  4P0Q A;  3N7R C;  4KMO B;  2K8B B;  3NRW A;  4OJ5 A;  2LHT A;  2H3I A;  2CPR A;  2HBJ A;  2ZXH A;  1F44 A;  2LKY A;  2Q4T A;  1SZH A;  2KD1 A;  3D2N A;  3OPX A;  1CRX A;  1URJ A;  4P0Q B;  2K4E A;  1IIP A;  3D2Q A;  3C28 A;  5CRX A;  2KKP A;  3F5E A;  3F5A A;  4BUG A;  2KIC A;  2KJ5 A;  1ED1 A;  5T14 A;  2YB1 A;  2KV2 A;  2XVT A;  2DQN B;  2N1R A;  2W04 A;  3D2S A;  4OO1 J;  1YT3 A;  3HKZ F;  2KHQ A;  2OM6 A;  3SMV A;  3PSP A;  2XIC A;  3N7P D;  3IG5 A;  2KJ8 A;  3GU3 A;  2JH1 A;  2KHV A;  2BDU A;  2H3F A;  3ONN A;  1T94 A;  3PSI A;  1ECW A;  4KX3 A;  3H0M B;  4NLC A;  3RFA A;  4CGZ A;  1OUQ A;  2XI9 A;  2F76 X;  4A8E A;  2OH2 A;  1L6N A;  3RF9 A;  4QJF B;  4NLB A;  3HKZ C;  2PMZ F;  5KL1 B;  2A3V A;  4BJQ A;  1ZQ1 C;  4P0P B;  2HBK A;  2GOL A;  2HBM A;  3M6Z A;  2W7P A;  2F8L A;  1Z19 A;  2KJ9 A;  3E0F A;  3IG8 A;  3H0R B;  2RRD A;  4FZL A;  3SAG A;  2K8C B;  2PMZ C;  2CRX A;  4PL1 A;  2JHD A;  2GH1 A;  2LBO A;  4AYB F;  1PVP A;  2WB1 C;  3AL0 B;  1A6S A;  1DRG A;  2G06 A;  2H3Z A;  4NV0 A;  2KKV A;  2RP5 A;  4IC9 A;  4KX5 A;  2KEY A;  2KNJ A;  4C0Z A;  2KVC A;  2KOB A;  2ZG6 A;  4WJ3 B;  2NV3 A;  1WUD A;  4AYB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...