2GOLA

Xray structure of gag278
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Matrix protein p17 (MA)
publication title Implications for Viral Capsid Assembly from Crystal Structures of HIV-1 Gag 1-278 and CAN 133-278.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2golA00
1A6SA 2GOLA 1ECWA 2N1RA 1L6NA 4ICAA 2H3VA 1HEKA 1ED1A 2H3IA 2K4EA 2H3ZA 1HIWA 4IC9A 2H3FA 2H3QA 1UPHA 2JMGA 2K4IA 2LYAA 1TAMA 2HMXA 2K4HA 4JMUA 2LYBA 2NV3A
chains in the Genus database with same CATH superfamily
3OTQA 5J0XA 2WB1F 4EZ9A 2Q4TA 1U45A 4OJPA 5A0LA 4Y2RA 4Y2SA 5F9LA 1N56A 1YT3A 3M9MB 1T3NA 3HJEA 3NRZA 4JK1A 4UB3A 2HDOA 8ICZA 3MGVA 2G08A 2WF8A 5KFGA 3ZDBA 2ZIVA 1B4FA 3F2BA 4DFPA 5KFPA 4UB4A 3ETRA 4C7YA 4F2RA 2F1HA 7ICTA 2J6UA 1ZQXA 9ICBA 2VANA 3UXNA 3GDXA 3WKDA 3LVWA 2E3TA 5ALUA 1XNSA 2HHTA 1H38A 3UM9A 8ICAA 3RB0A 3I1YA 5DQGA 3JPTA 2ISOA 9ICHA 2IOFK 2F8LA 5HHHA 4ED2A 4MFFA 1NI3A 2Y9TA 5ALFA 5JRTA 3BS5B 4RNMA 3BQ0A 4QIWF 2HHVA 1QQ5A 4JUZA 3KTQA 2ZG6A 5J2CA 1TAUA 1URJA 3HWTA 1SXEA 2LM1A 5DLGA 5J0RA 3ED5A 2WAQC 2DKZA 4K4IA 2KP7A 4OO1J 4J9LA 1JRPA 3UMCA 1IXRA 2AU0A 3RJFA 2OWOA 4US8A 2HHSA 1ZD3A 4RNNA 4O3RA 3C5FA 1U49A 2KJ8A 4C8NA 3SV3A 5CB1A 3JPSA 4GC7A 3GIJA 4PHAA 4QZGA 5J8YC 1Z1BA 4ZH4A 2KIWA 3F2DA 1QH9A 4YQWA 3AEVA 3WK8A 2UVRA 4KLMA 4PHPA 4U7CA 1KQQA 2XO7A 2OXOA 1JXLA 2Q0ZX 3H0LB 3IG5A 3AQFA 4M9LA 2VJ4A 4OJ5A 5C5JA 3M8RA 3BJYA 1KBUA 3D6JA 1JALA 4EBDA 2YY6A 5J2HA 1BNPA 9ICEA 2HHUA 1U47A 3OPXA 2W8LA 2F44A 1N63A 4F72A 3OSNA 2JH7A 2WAQF 2E8OA 2K4IA 1XWLA 3CYMA 3WK6A 4J03A 2PFPA 3HX0A 4IRCA 8ICHA 5G5GA 2BPGA 3U26A 2F2AB 5KL1B 1ZQUA 2R8IA 1X2IA 4ED0A 4F2SA 2A1JB 4ECVA 5AM3A 1COKA 4HYKA 4TQRA 4F4WA 2FE9A 1GO3F 4CCHA 1RXVA 3CW2C 2DGZA 4KMOB 1DK2A 5KFAA 1RYRA 8ICEA 5J2FA 2KSOA 5KFBA 4GFJA 9ICXA 1Y88A 1BGXT 1SIJA 4ACOA 4IQWA 1SXDA 2XGQA 1ZQBA 1ZQIA 2ASJA 3CRXA 2PFQA 2MRLA 2BGWA 7ICGA 3OSPA 1IM4A 4DL5A 3BQTA 4I2DA 3JPQA 1JUDA 4F5NA 1FFUA 5AI0A 4ECTA 4ECWA 4IQTA 5DLFA 4Z6FA 3AUOA 3BQ7A 2LPEA 5ALOA 3AQEA 1ED1A 4IL6U 1SWVA 2D3DA 4Y2PA 5AKZA 5IIJA 4RQ4A 1X40A 4GXKA 5BOMA 3D2NA 7ICIA 2KICA 3QUTA 4I2AA 3UQ0A 2W04A 4USAA 4RQ6A 4B6JA 1WWUA 3C21A 1S76D 4YXMA 4DFJA 2B6GA 1WYGA 5ALPA 2GOLA 2OH2A 1J2MA 1C20A 4MEYA 5AK4A 1RDFA 3K4GA 2G0AA 3RH6A 2KG5A 4F5RA 4RUCA 2AQ4A 1L5UA 7ICUA 3E0FA 4MFCA 4LZDA 3L5KA 1XC9A 4YCXA 4RQMA 1L7OA 5J0OA 3HPOA 3GZFA 2ZJ5A 4EBEA 2NO5A 3MFIA 3TFSA 4J9SA 4DWIA 1ECWA 4RPYA 3D2SA 3E58A 2A1AA 3KKAC 3RJJA 2HSZA 3RAQA 4KLDA 1A0PA 5EWEA 1K1SA 3BZKA 2J6SA 4Y2QA 3QU7A 4I28A 3ISDA 2NRVA 3PNCA 1QLNA 3V7KA 2WFAA 2H3VA 3ISCA 5G5HA 1MA7A 1TK5A 4ECSA 1AROP 4UBBA 1ZQWA 3C2LA 2KFNA 3PW7A 1J2NA 3AL0B 2VA8A 2RP5A 2BQUA 1S77D 1S8OA 3EPIA 2FPLA 5CA7A 4C8KA 1CUKA 3RRGA 4QWEA 1T8EA 4XQ8A 5DBBA 5D49A 4NL9C 3IN5A 1JXEA 4DQRA 1NK7A 2RLTA 2M9NA 1ZQAA 4RPZA 3V72A 2KVCA 2ESEA 3HKZF 4RQNA 4F4XA 2OM6A 2RRDA 2VIXA 2YMLA 5J2DA 3QX7A 4I2JA 2I1QA 4Q45A 4JWMA 4Y2YA 2OEHA 3MDCA 1ZQHA 4I2HA 4O5KA 2ZUCA 2N1RA 4IR9A 4EENA 1WG8A 2FJ6A 4IRKA 2KN7A 2ASDA 4YMOA 8ICMA 3NGDA 4I2FA 4RPXA 2FMSA 5KFUA 3H0RB 5AICA 2HVIA 5KFVA 4P0QB 4QZIA 2EANA 4ICAA 2WF5A 4O3SA 3NVYA 4RT3A 5KFFA 1IV8A 4P0PB 2BKEA 4ED7A 5J0WA 5IILA 2VKQA 3M7DA 5ALVA 3V7LA 4I2BA 4M9JA 3K1ZA 2BZFA 3MR5A 2Y1IA 3KD3A 4DSFA 1IG6A 1NK5A 5DGAA 8ICTA 4R63A 4MFAA 5AK5A 2W7OA 1MQ2A 4KLSA 3M1YA 4NV0A 1TAQA 5KG3A 3RF9A 9ICMA 2KMDA 4MEXA 1S0MA 5KFJA 4QZEA 4PL2A 4R8UB 1X9XA 1ZQKA 3K1RB 2ZIXA 4PGQA 8ICPA 2PI4A 1QSLA 5EE3A 5KG7A 1ZYQA 3O0FA 4Q43A 2Y1JA 3TFRA 3ZI4A 2H3QA 5GTIU 4J9RA 1M6YA 3EW9A 1MN8A 3PW4A 1V9PA 1Q46A 3M6KA 4EZ6A 2BDUA 4M0AA 1T3QA 2W55A 1RYUA 1TFRA 4BDPA 2H3IA 3TANA 5HR7A 2QB0B 2H3ZA 4KN4A 4PZOA 2ALZA 2HHQA 5K4LA 3EYZA 3OHAA 1O03A 3Q8PB 1SB3C 5JU5A 4F4KA 1LKYA 2KK0A 1HUZA 1U9LA 4DCCA 1Z00A 4JV0A 2IA6A 2BCVA 1MQ3A 1DGSA 7ICQA 2W9MA 5EE0A 4KLOA 3ETLA 3PR4A 2XI9A 2K8BB 1S5LU 3SR6A 2P66A 5AKXA 4NLGA 1BPZA 1BPXA 5DG8A 2I5HA 2PKEA 1KLNA 2XC9A 3A0HU 4KLGA 5KFOA 2WTFA 1KSPA 5J2KA 5DDYA 1HEKA 1RPLA 5KG5A 5AI9A 4KLFA 1SL2A 5EWGA 1TKDA 4FS1A 4M9GA 1CI4A 4OJ6A 5IIIA 4F5PA 3RJKA 4C4SA 4CF5A 4DOCA 2W9CA 3WK9A 1K5OA 4NM2A 5L1JA 3MC1A 5AI5A 4P2HA 4AP9A 2HHXA 5GTHU 5HMMA 3QUQA 1TVAA 4KX3A 5KL8B 8ICLA 4DQPA 4B9UA 3TQ1A 3SAGA 1SZPA 3FM9A 4J9KA 3KZXA 2J6TA 4B9MA 5AI8A 2KZZA 4ED3A 4KLIA 3JPNA 2PXIA 3TAPA 2B21A 5J2BA 5KFSA 4EX7A 3KHLA 1SKRA 4EX6A 1S0OA 4DFMA 2BPFA 2A19A 3UMBA 1ZQCA 2DFLA 5AIAA 1JX4A 2AHOB 1JMSA 3MBYA 4B9VA 1BPYA 5HP4A 2UVVA 2F1JA 4Z6DA 5DGBA 1B43A 4YR2A 2KFZA 3TAQA 2F8KA 4CDGA 5KFMA 3IM1A 3RJEA 5B5EU 4JV1A 4QZBA 3RAXA 2BR0A 3NVZA 1RZTA 3V6HA 4BXOA 1ZD5A 4BWMA 4PL1A 1SL1A 3VC8A 3UPQA 1SGGA 2XCAA 1KFDA 3MGHA 2FMPA 3B0XA 3T5HA 4O0IA 2PMZF 1NZBA 1X66A 1UQVA 8ICUA 3NRWA 2K8AA 5J2EA 4ED8A 9ICOA 1D9FA 3J81j 2IBKA 4K4GA 3HW8A 4R64A 1KL9A 4KLTA 3Q8LA 4YMMA 3ZDEA 4X5VA 1S10A 1HUOA 4B9NA 4NLCA 5KFTA 9ICCA 3T5KA 4CF4A 3T5JA 1Z1VA 4DF4A 1NK6A 5DBAA 2ZTEA 3PW2A 3RRHA 3OJUA 4M04A 3S6JA 1N60A 5HNKA 4PPXA 2NV3A 9ICUA 5KAFU 2YMPA 1UHUA 1Q3UA 1UT8A 9ICFA 1J97A 3LDAA 1ZQTA 4FO6A 1XSPA 5J29A 4F71A 3ZDCA 7ICMA 4RU9A 3TI0A 4YN4A 7ICFA 1TK0A 1KFTA 3Q8QB 1TAMA 3AU2A 3WK4A 1N48A 4MHVA 2ZTDA 4C8MA 3SAFA 5HMLA 4PGYA 8ICYA 5E79U 3RJGA 4KN7A 2D8CA 2IOHA 4AYBC 4QW8A 4UB6U 2AGOA 9ICGA 7ICJA 2KOBA 2YMQA 7ICSA 2NRZA 1X9SA 2R8HA 1F0MA 4Y2XA 4LJXA 4IQUA 4ED6A 3GFKB 1BPDA 2F1IA 2WF7A 4DL3A 4US9A 8ICVA 4JB3A 3RFAA 3HRDD 3WKCA 1NK9A 2DQNB 5J2IA 2G07A 4M9NA 4P4OA 5KTQA 2LM4A 3PSPA 3FYHA 3F53A 2BQ3A 5AKLA 2EZYA 1V38A 4OCZA 3H40A 7ICPA 4ECYA 5KG2A 5H2FU 3SV4A 2C22A 4YG2A 5J0QA 1NK0A 3EPGA 2IHNA 2ATLA 3C5GA 4P0QA 4CRXA 4CF3A 2E8NA 1A77A 1XO1A 2OYYA 1T94A 2KV2A 5AI6A 4P0PA 5D46A 2YB4A 2EZXA 2FLNA 1JROA 1ZQNA 1UT5A 4R65A 5ALSA 1DGJA 2W8KA 1FIQA 1S0VA 1PK1B 1A76A 2W9AA 4K4HA 4DO9A 1ZQEA 4AYBF 4ECUA 9ICQA 4P4PA 4CGZA 1TK8A 5J0PA 2XY7A 3PMNA 2WHEA 4Q8FA 5AI4A 2BCRA 3KHRA 2W11A 4QZFA 1YZ7A 3SD7A 2KKPA 2XVTA 2ASLA 3TADA 2JV3A 3NUQA 4R8UA 1ZQGA 9ICNA 2LMRA 4YXJA 4C4RA 2FPMA 3SYZA 2ZIWB 3BDPA 5KT2A 3H8WA 3DEEA 4C8LA 5KFHA 3H0MB 2K4HA 5KT5A 5EWFA 3ISBA 2QARA 2K60A 3RH5A 1DRGA 1ZETA 1O08A 2JXJA 4DOBA 3EUB2 1Z4OA 2EDUA 2ZXHA 2JZBA 4M6WB 8ICKA 9ICPA 4RQ3A 4Q44A 1ZRNA 1NNLA 4I2GA 1SKSA 2EZZA 5DB6A 2KNJA 1OXJA 4JMUA 4DL2A 3N7PD 3SQIA 5C0YA 3H8JA 4GIBA 4FBUA 3LWLA 3L3FX 2VJ5A 1K1QA 5DKWA 3LK9A 2BCSA 5AKKA 3KBBA 5DQHA 4DSIA 4BJQA 2W54A 3RJIA 3ORYA 5ALMA 2H5XA 8ICSA 2G06A 4DFDA 5KT4A 2HVHA 3WKAA 4Y2UA 4J9MA 1N62A 3MABA 1ZJNA 4I2EA 2FMQA 2AGPA 5DB7A 3Q8RB 4ELVA 1YZ6A 4FS2A 3QZ7A 1B0XA 2HW3A 4HAIA 5F9NA 4KLEA 3NTUA 4GXJA 2HMXA 4DQSA 3PSFA 1ZQJA 1A6SA 4KLLA 3TKAA 2RDIA 2E5SA 3MDAA 4C80A 1NKBA 4Y2TA 2OCEA 3GIIA 5ALGA 8ICNA 2NO4A 3SMVA 1L7NA 3K75D 3ICXA 9ICAA 1LB2B 5F3XB 1D8LA 3RB6A 2V9WA 5BOLA 3N7SC 3IG8A 4QZ9A 2BCUA 1OW5A 2DPIA 5JUMA 2P6RA 2FPKA 5CWRA 4DSKA 1ZOLA 3QU4A 4RQ0A 4UQGA 8ICQA 4J9PA 3C1ZA 3PW0A 3EWAA 4QZAA 1ZQZA 1CRXA 4Y2VA 2CRXA 4PZNA 2W7PA 3QU5A 2P6UA 5L1LA 2EAOA 4ECXA 5KT6A 3C1YA 4LVSA 3B0YA 1N61A 2AXTU 3QXGA 1NKEA 5KG0A 4DL4A 3AU6A 5IIOA 5AM2A 9ICSA 3BS5A 2BHNA 4OJOA 2D6FC 4MF2A 2EH9A 3GV5B 1UPHA 1TV9A 4QZDA 3ZDAA 9ICIA 4NWIA 1SL0A 1WCNA 2W9BB 4DLGA 1Z19A 3SAHA 5DG9A 4TQSA 5D4BA 3PW5A 2KJ5A 3SI8A 5L1KA 2DWQA 5KFQA 4FZNA 5KAIU 3JPPA 1F5SA 1ZQVA 3N7RC 3WK7A 2MA1A 2LYAA 3RTVA 4PH5A 3QYPA 1SKWA 7ICVA 1KW4A 2DUYA 2HBJA 4NLKA 1Z4NA 3KOOA 5KFEA 4GLXA 4C8OA 1VLBA 1U4BA 3WKEA 4EEYA 3QE9Y 3IP4B 2EQYA 3H7IA 3TARA 4DFKA 2JEGA 1KEJA 1V85A 3GV7B 1HJPA 2E8MA 1XSNA 4YR3A 3C23A 5IIKA 4F5QA 5AKIA 4ECZA 2XIDA 4O3PA 4ED1A 2Y9UA 3MR6A 3BZCA 4QWBA 1QQ6A 3F2CA 3QEBZ 4BWJA 3QUBA 4UB5A 9ICWA 5AM5A 2A3VA 1ZQMA 1QQ7A 2CPRA 3F5AA 2ZTCA 3V7JA 2LBOA 4Z6EA 3QUCA 7ICLA 5AM1A 3PO5A 2B0CA 2PFOA 4NLNA 4I29A 2AQ0A 1D9DA 5KG6A 4XA5A 1SWWA 3C29A 4ECQA 3R9KA 3EZ5A 4RQ2A 4QZHA 2EAMA 2P35A 3IV6A 3F5EA 2FI1A 2A1JA 1JN3A 4DL7A 2YN4A 4QW9A 1U48A 3IHQB 1QTMA 1D8BA 5DG7A 4EEKA 4MF8A 1RXWA 3LVVA 4UAUA 4UBCA 3QNMA 4PHEA 3SEIA 1UA0A 4YMNA 4RZRA 1KFSA 4UB2A 3MR2A 5KG1A 1L3VA 1VJ5A 1RM6C 1ZXIA 2IOFA 5ALZA 5ALTA 1ZQ1C 3G6YA 4CE6A 2BPCA 1ZQYA 1ZQOA 1N5WA 2ZXIA 1N5XA 4UAYA 7ICHA 4PGXA 1XU4A 2PFNA 2F77X 3C2KA 3LYSA 3MR3A 4PHDA 4KLUA 2XY5A 3JPRA 4G9BA 2G5HB 3KZIU 1ZD2P 2DBYA 1PVQA 1ZQQA 7ICNA 1LVHA 2JR5A 4UARA 1SV0A 3L4PA 5AKYA 3KHGA 4DLEA 1Q3VA 3GILA 8ICWA 1WCLA 2RDJA 3GQCA 2H3FA 3T3FA 2BDPA 3OGUA 1CEZA 2ZIWA 3H8SA 2JMGA 3UXOA 4O5CA 2LI6A 3ALRA 3QZ8A 2HBKA 3TADC 4GXIA 1NKCA 2ZIUB 4NJ8A 4ECRA 4DOAA 4UB8U 4E0DA 4F4YA 5ALHA 3KFUF 1SZHA 4M6WA 3UQ2A 1PVRA 2OHFA 1QSYA 4NLBA 4I27A 2V4RA 4M47A 1C7YA 4RNOA 3NS1A 4QWDA 3WU2U 2HCFA 3N28A 3NASA 4OJLA 5ALEA 5J0TA 4NM1A 2DPJA 4I2CA 3GU3A 3PX6A 3HP6A 4O9MA 2MU2A 1KDHA 5J2GA 3JPOA 4Q8EA 1RG6A 2DL0A 5KFDA 2YX8A 4ZOHC 5KFCA 1NOMA 1UCVA 4F93B 4RQ5A 2C2DA 2Z7JA 1NJYA 3PSIA 4UB1A 3NVVA 2XCPA 1BPEA 2JHDA 1D8YA 5KFLA 3M9OB 2LHTA 1WWVA 1KKXA 5HR6A 8ICCA 1ZD4A 2ZIXB 4XUSA 5ALJA 3IDWA 4F3OA 2LKYA 1RQNA 1EXNA 4ELTA 5J2AA 8ICXA 4UASA 3FDSA 4EYHB 1X6IA 2KHQA 4KITB 2G5IB 2WF6A 4KLQA 3PSTA 2Y0SC 2ZUBA 4F5OA 2UVUA 1B22A 4QNLA 2ODGA 1DOQA 2KVSA 3ZD9A 2GH1A 4JWNA 3PX4A 4QZCA 4IS7A 4F8RA 5L1IA 2MUTB 1WUDA 3IRUA 2BQRA 1ZQDA 2HBMA 3FAHA 4O3NA 4DS5A 4O5EA 4RQ1A 2F76X 5AK3A 2CN1A 1LKYB 2MAXA 4C7ZA 3M8SA 3ZD8A 2QLTA 2GWSA 5KT3A 1Z00B 3Q8MA 3HILA 3GIKA 1ZQLA 1JI7A 1L3SA 3T5LA 3AMZA 4B9LA 4ELUA 4C0ZA 3H4DA 4DSJA 3D2QA 4YP3A 2K4EA 5HHIA 1L8OA 5ALQA 1X9MA 5TISU 5IINA 1XS9D 5ALKA 1FEZA 4O3QA 4DS4A 4TUQA 1BPBA 4KX5A 2JH1A 2KIVA 2KZMA 5ALLA 1NK8A 8ICRA 2R8JA 1QCKA 2W9BA 3RBEA 2ZJAA 4KTQA 4DQQA 3QU2A 2W9CB 5ALWA 2Y0SF 1PVPA 5KFIA 4C4TA 1BVSA 4R66A 2L5YA 4RQ8A 5J2JA 1KTQA 5CR0A 3MGIA 3ZDDA 4DEZA 2HOIA 3I28A 4F4ZA 1PK3A 1T7PA 4UAWA 4DF8A 2UVWA 2E8PA 3M9NB 1L3UA 3BQ2A 2C2RA 1ZQRA 4QJFB 3QEAZ 4FE3A 1QSSA 3TACB 2ZIVB 4BUGA 3PVXA 2JRZA 2W03A 5B66U 5KFXA 2WF9A 5FP0A 1DXSA 3PMLA 3MFHA 2R8GA 1V97A 1L7PA 4F92B 4CNQA 2FLLA 3I76A 2YMMA 5AKGA 2QB0A 2KKVA 1S0NA 2KD1A 1SV4A 2E1EA 3DV9A 1RQLA 5EE9A 1UA1A 4BXOB 4P4MA 3HKZC 1LV5A 1ZQPA 1PUZA 4FZMA 2W3RA 1X42A 5AKJA 4UAVA 4J9QA 1L8LA 1L3TA 2KE7A 1MC8A 5BPCA 4O3OA 2IMWP 3BS7A 5J8YA 4YR0A 3NVWA 4JV2A 4YD1A 3Q8KA 4TURA 5CP2A 2CXYA 1KRPA 1BNOA 1COOA 3A0BU 2ZUDA 3GV8B 5DB9A 4J9OA 5CJ7A 4TUSA 5TZVA 9ICLA 5KFKA 2HI0A 1NJWA 3WK5A 1FO4A 5KG4A 2DF4B 4UW9A 3DDHA 2XY6A 3Q8SB 3N97B 1MSWD 2KZ3A 2IHMA 2QKQA 4QWAA 1ZQSA 4EELA 4RT2A 5ALDA 1F44A 4BX9C 5KT7A 8ICIA 3C28A 3OHBA 1NK4A 4IRDA 5ALXA 4IQVA 1HIWA 4YD2A 8ICGA 2O6KA 2C28A 1L7MA 2V4QA 2NRWA 1T4GA 2KTQA 1ZRMA 2YTUA 4NY8A 4M2YA 3V6JA 9ICRA 3RB4A 3LWMA 3ONNA 1P7DA 4FZLA 4DSEA 4I2IA 3PZPA 4FFDA 3KHHA 2XICA 2RQ5A 4IC9A 1ZJMA 2E1FA 5KFWA 5L1MA 2HBLA 4BGDA 5AK6A 4A8EA 4RQ7A 3PO4A 1SV0C 5AKHA 3PV8A 4EYIB 2ZIUA 5AM4A 4O3MA 5T14A 5DB8A 8ICOA 5AKEA 8ICFA 4KLJA 2DKXA 2K8CB 2EAPA 1PZNA 2NYVA 9ICJA 4TUPA 2KSOB 4Y2JA 2ES6A 3T79A 2W43A 3CP8A 4WJ3B 5ALNA 1ZQFA 4M9HA 1L6NA 4DSLA 4YVZA 1OUQA 4NXZA 4F50A 2KHVA 5AM0A 5CRXA 1N2XA 2HHWA 4DQIA 2JEJA 7ICRA 4QWCA 4UAZA 4IR1A 1XSLA 3FC4A 5KFZA 2AJQA 2I6XA 3G6VA 2YQEA 3RH4A 3B9JA 1DK3A 4YFKA 5DBCA 5CHGA 7ICKA 3UXPA 7ICEA 4EBCA 5J0SA 2I9GA 5DDMA 3V6KA 5CEHA 2KJ9A 5KNIA 4QZ8A 2NRTA 2JEFA 3RR7A 8ICBA 5KFYA 4RUAA 3VCBA 3H4BA 4DL6A 2R18A 3RBDA 3E2EA 5DQIA 3KKAA 2GLEA 3PY8A 2HOFA 9ICKA 5AIBA 3WKBA 2NRXA 2BCQA 1NJZA 5AHXA 2ISPA 3RJHA 4G3IA 3BQ1A 2VA3A 5JTIA 3PX0A 2M0NA 1TE2A 9ICTA 2QARB 2F3NA 3UMGA 2FDRA 1RYSA 3C2MA 3SENA 2JZBB 2W3SA 3SZ2A 2WB1C 3RB3A 2JGAA 2MUTA 2AGQA 2C2EA 3CNHA 5IIMA 4Z6CA 2R8KA 4UATA 3RR8A 4LZGA 4F91B 2PI5A 2JEIA 2K89A 5ALRA 4GC6A 1NJXA 1X6JA 4KMUA 3QU9A 3N4MB 1IIPA 1XO0A 2FLPA 9ICVA 3AM9A 2GO7A 2ZJ8A 1Q8KA 4B9TA 3THVA 5J0UA 7ICOA 2QB1A 2YB1A 1Z3EB 3G6XA 5ALIA 4J9NA 1AQ6A 5L9XA 4NL9A 3GIMA 5KFRA 4KLHA 2G09A 5KFNA 2XGPA 2LYBA 4FBTA 2HOQA 1S9FA 3HT3A 2RHFA 4XRHA 5J0YA 4PJ0U 1PK1A 8ICJA 1NZPA 3AN1A 1S97A 2K4PA 3OJSA 1FFVA 4QIWC 3PR5B 1JIHA 1KN5A 2VA2A 4NLZA 5ALYA 5EE1A 2KEYA 2AH5A 3H8MA 1X9WA 4OD0A 4B9SA 3M6ZA 5EOZA 2MSNA 2PMZC 2LYHA 1VDVA 4U6PA
chains in the Genus database with same CATH topology
4BUGA 2W03A 3VCBA 2WB1F 2KIWA 2Q4TA 2R18A 3C29A 2ZIUB 1HEKA 1WUDA 3L3FX 3F2DA 3AQEA 4OJPA 4P0QA 5A0LA 4CRXA 3ONNA 1ED1A 2VJ5A 1P7DA 2OYYA 2W7OA 1T94A 2KV2A 2HBMA 3KFUF 1SZHA 1YT3A 3F5EA 4FZLA 2HOFA 4U7CA 4NV0A 3PZPA 4P0PA 4NLCA 2YB4A 3IN5A 2XICA 2OXOA 4OJ6A 1PVRA 4OJOA 3RF9A 2D6FC 2F76X 2KKVA 4IC9A 2CN1A 4NLBA 3H0LB 3IG5A 3D2NA 3AQFA 2E1FA 2KICA 2M0NA 3MGVA 2HBLA 2G08A 1UPHA 4BJQA 2KD1A 2VJ4A 2W04A 4OJ5A 2E1EA 2G06A 1D8BA 4PL2A 1KBUA 4NWIA 2NV3A 4A8EA 2ZIVA 3F2BA 2GOLA 2KVCA 4KX3A 4OJLA 5KL8B 3LVVA 2OH2A 1Q3UA 3HKZF 2WB1C 2HBKA 3SAGA 3HKZC 2ZIXA 2JGAA 4C0ZA 4AYBF 3SAHA 1Z19A 2ZIUA 3D2QA 2OM6A 2G0AA 3GU3A 4FZMA 4O3MA 2K4EA 2RRDA 2VIXA 3KZXA 4CGZA 3OPXA 5T14A 2KJ5A 3E0FA 3LVWA 2K8CB 3O0FA 4FZNA 2K89A 2H3QA 3N7RC 1XNSA 3GZFA 2JH7A 2WAQF 2MA1A 2K4IA 2LYAA 2YX8A 3CYMA 1TAMA 2HMXA 2KKPA 3T79A 3SAFA 4KX5A 2JH1A 2F8LA 3M6KA 2F2AB 1IIPA 3CP8A 2HBJA 5KL1B 3PSFA 1XO0A 4WJ3B 2BDUA 1A6SA 1ECWA 2N1RA 2XVTA 1L6NA 1ZQ1C 2E5SA 3D2SA 3NUQA 2Z7JA 3PSIA 1OUQA 2KHVA 2H3IA 5CRXA 2ZXIA 5HR7A 4AYBC 2H3ZA 4QIWF 1GO3F 2YB1A 2JHDA 3IP4B 2F77X 2KOBA 1A0PA 2ZG6A 2LHTA 2ZIWB 3SMVA 1URJA 2DGZA 2Y0SF 3LYSA 4KMOB 2DF4B 1PVPA 3ICXA 5HR6A 2G09A 3DEEA 5C0YA 4GFJA 3H0MB 2K4HA 2WAQC 4CDGA 3H0RB 2G5HB 2LYBA 2ZIXB 3IG8A 3N7SC 4OO1J 1PVQA 4P0QB 2HOQA 3RFAA 2XIDA 4ICAA 2H3VA 4ACOA 1DRGA 1F44A 2DQNB 2HOIA 2G07A 2RHFA 4BX9C 2LKYA 2ZXHA 4P0PB 3F2CA 1MA7A 3C28A 3CRXA 2MRLA 4PL1A 2XI9A 2K8BB 3PSPA 2KJ8A 1Q3VA 3F53A 2VKQA 3M7DA 3VC8A 1HIWA 4QIWC 3AL0B 2RP5A 2KHQA 2KJ9A 2H3FA 1CRXA 2A3VA 2CRXA 2G5IB 4QJFB 2W7PA 2KEYA 2CPRA 3F5AA 3PSTA 2ZIWA 3K1ZA 2Y0SC 4FE3A 2JMGA 2LBOA 2PMZF 3M6ZA 2KNJA 2ZIVB 4QNLA 3ALRA 1NZBA 1Z1BA 2PMZC 4JMUA 4U6PA 3N7PD 3NRWA 3SQIA 2K8AA 2GH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A6S A;  2GOL A;  1ECW A;  2N1R A;  1L6N A;  4ICA A;  2H3V A;  1HEK A;  1ED1 A;  2H3I A;  2K4E A;  2H3Z A;  1HIW A;  4IC9 A;  2H3F A;  2H3Q A;  1UPH A;  2JMG A;  2K4I A;  2LYA A;  1TAM A;  2HMX A;  2K4H A;  4JMU A;  2LYB A;  2NV3 A; 
#chains in the Genus database with same CATH topology
 3OTQ A;  5J0X A;  2WB1 F;  4EZ9 A;  2Q4T A;  1U45 A;  4OJP A;  5A0L A;  4Y2R A;  4Y2S A;  5F9L A;  1N56 A;  1YT3 A;  3M9M B;  1T3N A;  3HJE A;  3NRZ A;  4JK1 A;  4UB3 A;  2HDO A;  8ICZ A;  3MGV A;  2G08 A;  2WF8 A;  5KFG A;  3ZDB A;  2ZIV A;  1B4F A;  3F2B A;  4DFP A;  5KFP A;  4UB4 A;  3ETR A;  4C7Y A;  4F2R A;  2F1H A;  7ICT A;  2J6U A;  1ZQX A;  9ICB A;  2VAN A;  3UXN A;  3GDX A;  3WKD A;  3LVW A;  2E3T A;  5ALU A;  1XNS A;  2HHT A;  1H38 A;  3UM9 A;  8ICA A;  3RB0 A;  3I1Y A;  5DQG A;  3JPT A;  2ISO A;  9ICH A;  2IOF K;  2F8L A;  5HHH A;  4ED2 A;  4MFF A;  1NI3 A;  2Y9T A;  5ALF A;  5JRT A;  3BS5 B;  4RNM A;  3BQ0 A;  4QIW F;  2HHV A;  1QQ5 A;  4JUZ A;  3KTQ A;  2ZG6 A;  5J2C A;  1TAU A;  1URJ A;  3HWT A;  1SXE A;  2LM1 A;  5DLG A;  5J0R A;  3ED5 A;  2WAQ C;  2DKZ A;  4K4I A;  2KP7 A;  4OO1 J;  4J9L A;  1JRP A;  3UMC A;  1IXR A;  2AU0 A;  3RJF A;  2OWO A;  4US8 A;  2HHS A;  1ZD3 A;  4RNN A;  4O3R A;  3C5F A;  1U49 A;  2KJ8 A;  4C8N A;  3SV3 A;  5CB1 A;  3JPS A;  4GC7 A;  3GIJ A;  4PHA A;  4QZG A;  5J8Y C;  1Z1B A;  4ZH4 A;  2KIW A;  3F2D A;  1QH9 A;  4YQW A;  3AEV A;  3WK8 A;  2UVR A;  4KLM A;  4PHP A;  4U7C A;  1KQQ A;  2XO7 A;  2OXO A;  1JXL A;  2Q0Z X;  3H0L B;  3IG5 A;  3AQF A;  4M9L A;  2VJ4 A;  4OJ5 A;  5C5J A;  3M8R A;  3BJY A;  1KBU A;  3D6J A;  1JAL A;  4EBD A;  2YY6 A;  5J2H A;  1BNP A;  9ICE A;  2HHU A;  1U47 A;  3OPX A;  2W8L A;  2F44 A;  1N63 A;  4F72 A;  3OSN A;  2JH7 A;  2WAQ F;  2E8O A;  2K4I A;  1XWL A;  3CYM A;  3WK6 A;  4J03 A;  2PFP A;  3HX0 A;  4IRC A;  8ICH A;  5G5G A;  2BPG A;  3U26 A;  2F2A B;  5KL1 B;  1ZQU A;  2R8I A;  1X2I A;  4ED0 A;  4F2S A;  2A1J B;  4ECV A;  5AM3 A;  1COK A;  4HYK A;  4TQR A;  4F4W A;  2FE9 A;  1GO3 F;  4CCH A;  1RXV A;  3CW2 C;  2DGZ A;  4KMO B;  1DK2 A;  5KFA A;  1RYR A;  8ICE A;  5J2F A;  2KSO A;  5KFB A;  4GFJ A;  9ICX A;  1Y88 A;  1BGX T;  1SIJ A;  4ACO A;  4IQW A;  1SXD A;  2XGQ A;  1ZQB A;  1ZQI A;  2ASJ A;  3CRX A;  2PFQ A;  2MRL A;  2BGW A;  7ICG A;  3OSP A;  1IM4 A;  4DL5 A;  3BQT A;  4I2D A;  3JPQ A;  1JUD A;  4F5N A;  1FFU A;  5AI0 A;  4ECT A;  4ECW A;  4IQT A;  5DLF A;  4Z6F A;  3AUO A;  3BQ7 A;  2LPE A;  5ALO A;  3AQE A;  1ED1 A;  4IL6 U;  1SWV A;  2D3D A;  4Y2P A;  5AKZ A;  5IIJ A;  4RQ4 A;  1X40 A;  4GXK A;  5BOM A;  3D2N A;  7ICI A;  2KIC A;  3QUT A;  4I2A A;  3UQ0 A;  2W04 A;  4USA A;  4RQ6 A;  4B6J A;  1WWU A;  3C21 A;  1S76 D;  4YXM A;  4DFJ A;  2B6G A;  1WYG A;  5ALP A;  2GOL A;  2OH2 A;  1J2M A;  1C20 A;  4MEY A;  5AK4 A;  1RDF A;  3K4G A;  2G0A A;  3RH6 A;  2KG5 A;  4F5R A;  4RUC A;  2AQ4 A;  1L5U A;  7ICU A;  3E0F A;  4MFC A;  4LZD A;  3L5K A;  1XC9 A;  4YCX A;  4RQM A;  1L7O A;  5J0O A;  3HPO A;  3GZF A;  2ZJ5 A;  4EBE A;  2NO5 A;  3MFI A;  3TFS A;  4J9S A;  4DWI A;  1ECW A;  4RPY A;  3D2S A;  3E58 A;  2A1A A;  3KKA C;  3RJJ A;  2HSZ A;  3RAQ A;  4KLD A;  1A0P A;  5EWE A;  1K1S A;  3BZK A;  2J6S A;  4Y2Q A;  3QU7 A;  4I28 A;  3ISD A;  2NRV A;  3PNC A;  1QLN A;  3V7K A;  2WFA A;  2H3V A;  3ISC A;  5G5H A;  1MA7 A;  1TK5 A;  4ECS A;  1ARO P;  4UBB A;  1ZQW A;  3C2L A;  2KFN A;  3PW7 A;  1J2N A;  3AL0 B;  2VA8 A;  2RP5 A;  2BQU A;  1S77 D;  1S8O A;  3EPI A;  2FPL A;  5CA7 A;  4C8K A;  1CUK A;  3RRG A;  4QWE A;  1T8E A;  4XQ8 A;  5DBB A;  5D49 A;  4NL9 C;  3IN5 A;  1JXE A;  4DQR A;  1NK7 A;  2RLT A;  2M9N A;  1ZQA A;  4RPZ A;  3V72 A;  2KVC A;  2ESE A;  3HKZ F;  4RQN A;  4F4X A;  2OM6 A;  2RRD A;  2VIX A;  2YML A;  5J2D A;  3QX7 A;  4I2J A;  2I1Q A;  4Q45 A;  4JWM A;  4Y2Y A;  2OEH A;  3MDC A;  1ZQH A;  4I2H A;  4O5K A;  2ZUC A;  2N1R A;  4IR9 A;  4EEN A;  1WG8 A;  2FJ6 A;  4IRK A;  2KN7 A;  2ASD A;  4YMO A;  8ICM A;  3NGD A;  4I2F A;  4RPX A;  2FMS A;  5KFU A;  3H0R B;  5AIC A;  2HVI A;  5KFV A;  4P0Q B;  4QZI A;  2EAN A;  4ICA A;  2WF5 A;  4O3S A;  3NVY A;  4RT3 A;  5KFF A;  1IV8 A;  4P0P B;  2BKE A;  4ED7 A;  5J0W A;  5IIL A;  2VKQ A;  3M7D A;  5ALV A;  3V7L A;  4I2B A;  4M9J A;  3K1Z A;  2BZF A;  3MR5 A;  2Y1I A;  3KD3 A;  4DSF A;  1IG6 A;  1NK5 A;  5DGA A;  8ICT A;  4R63 A;  4MFA A;  5AK5 A;  2W7O A;  1MQ2 A;  4KLS A;  3M1Y A;  4NV0 A;  1TAQ A;  5KG3 A;  3RF9 A;  9ICM A;  2KMD A;  4MEX A;  1S0M A;  5KFJ A;  4QZE A;  4PL2 A;  4R8U B;  1X9X A;  1ZQK A;  3K1R B;  2ZIX A;  4PGQ A;  8ICP A;  2PI4 A;  1QSL A;  5EE3 A;  5KG7 A;  1ZYQ A;  3O0F A;  4Q43 A;  2Y1J A;  3TFR A;  3ZI4 A;  2H3Q A;  5GTI U;  4J9R A;  1M6Y A;  3EW9 A;  1MN8 A;  3PW4 A;  1V9P A;  1Q46 A;  3M6K A;  4EZ6 A;  2BDU A;  4M0A A;  1T3Q A;  2W55 A;  1RYU A;  1TFR A;  4BDP A;  2H3I A;  3TAN A;  5HR7 A;  2QB0 B;  2H3Z A;  4KN4 A;  4PZO A;  2ALZ A;  2HHQ A;  5K4L A;  3EYZ A;  3OHA A;  1O03 A;  3Q8P B;  1SB3 C;  5JU5 A;  4F4K A;  1LKY A;  2KK0 A;  1HUZ A;  1U9L A;  4DCC A;  1Z00 A;  4JV0 A;  2IA6 A;  2BCV A;  1MQ3 A;  1DGS A;  7ICQ A;  2W9M A;  5EE0 A;  4KLO A;  3ETL A;  3PR4 A;  2XI9 A;  2K8B B;  1S5L U;  3SR6 A;  2P66 A;  5AKX A;  4NLG A;  1BPZ A;  1BPX A;  5DG8 A;  2I5H A;  2PKE A;  1KLN A;  2XC9 A;  3A0H U;  4KLG A;  5KFO A;  2WTF A;  1KSP A;  5J2K A;  5DDY A;  1HEK A;  1RPL A;  5KG5 A;  5AI9 A;  4KLF A;  1SL2 A;  5EWG A;  1TKD A;  4FS1 A;  4M9G A;  1CI4 A;  4OJ6 A;  5III A;  4F5P A;  3RJK A;  4C4S A;  4CF5 A;  4DOC A;  2W9C A;  3WK9 A;  1K5O A;  4NM2 A;  5L1J A;  3MC1 A;  5AI5 A;  4P2H A;  4AP9 A;  2HHX A;  5GTH U;  5HMM A;  3QUQ A;  1TVA A;  4KX3 A;  5KL8 B;  8ICL A;  4DQP A;  4B9U A;  3TQ1 A;  3SAG A;  1SZP A;  3FM9 A;  4J9K A;  3KZX A;  2J6T A;  4B9M A;  5AI8 A;  2KZZ A;  4ED3 A;  4KLI A;  3JPN A;  2PXI A;  3TAP A;  2B21 A;  5J2B A;  5KFS A;  4EX7 A;  3KHL A;  1SKR A;  4EX6 A;  1S0O A;  4DFM A;  2BPF A;  2A19 A;  3UMB A;  1ZQC A;  2DFL A;  5AIA A;  1JX4 A;  2AHO B;  1JMS A;  3MBY A;  4B9V A;  1BPY A;  5HP4 A;  2UVV A;  2F1J A;  4Z6D A;  5DGB A;  1B43 A;  4YR2 A;  2KFZ A;  3TAQ A;  2F8K A;  4CDG A;  5KFM A;  3IM1 A;  3RJE A;  5B5E U;  4JV1 A;  4QZB A;  3RAX A;  2BR0 A;  3NVZ A;  1RZT A;  3V6H A;  4BXO A;  1ZD5 A;  4BWM A;  4PL1 A;  1SL1 A;  3VC8 A;  3UPQ A;  1SGG A;  2XCA A;  1KFD A;  3MGH A;  2FMP A;  3B0X A;  3T5H A;  4O0I A;  2PMZ F;  1NZB A;  1X66 A;  1UQV A;  8ICU A;  3NRW A;  2K8A A;  5J2E A;  4ED8 A;  9ICO A;  1D9F A;  3J81 j;  2IBK A;  4K4G A;  3HW8 A;  4R64 A;  1KL9 A;  4KLT A;  3Q8L A;  4YMM A;  3ZDE A;  4X5V A;  1S10 A;  1HUO A;  4B9N A;  4NLC A;  5KFT A;  9ICC A;  3T5K A;  4CF4 A;  3T5J A;  1Z1V A;  4DF4 A;  1NK6 A;  5DBA A;  2ZTE A;  3PW2 A;  3RRH A;  3OJU A;  4M04 A;  3S6J A;  1N60 A;  5HNK A;  4PPX A;  2NV3 A;  9ICU A;  5KAF U;  2YMP A;  1UHU A;  1Q3U A;  1UT8 A;  9ICF A;  1J97 A;  3LDA A;  1ZQT A;  4FO6 A;  1XSP A;  5J29 A;  4F71 A;  3ZDC A;  7ICM A;  4RU9 A;  3TI0 A;  4YN4 A;  7ICF A;  1TK0 A;  1KFT A;  3Q8Q B;  1TAM A;  3AU2 A;  3WK4 A;  1N48 A;  4MHV A;  2ZTD A;  4C8M A;  3SAF A;  5HML A;  4PGY A;  8ICY A;  5E79 U;  3RJG A;  4KN7 A;  2D8C A;  2IOH A;  4AYB C;  4QW8 A;  4UB6 U;  2AGO A;  9ICG A;  7ICJ A;  2KOB A;  2YMQ A;  7ICS A;  2NRZ A;  1X9S A;  2R8H A;  1F0M A;  4Y2X A;  4LJX A;  4IQU A;  4ED6 A;  3GFK B;  1BPD A;  2F1I A;  2WF7 A;  4DL3 A;  4US9 A;  8ICV A;  4JB3 A;  3RFA A;  3HRD D;  3WKC A;  1NK9 A;  2DQN B;  5J2I A;  2G07 A;  4M9N A;  4P4O A;  5KTQ A;  2LM4 A;  3PSP A;  3FYH A;  3F53 A;  2BQ3 A;  5AKL A;  2EZY A;  1V38 A;  4OCZ A;  3H40 A;  7ICP A;  4ECY A;  5KG2 A;  5H2F U;  3SV4 A;  2C22 A;  4YG2 A;  5J0Q A;  1NK0 A;  3EPG A;  2IHN A;  2ATL A;  3C5G A;  4P0Q A;  4CRX A;  4CF3 A;  2E8N A;  1A77 A;  1XO1 A;  2OYY A;  1T94 A;  2KV2 A;  5AI6 A;  4P0P A;  5D46 A;  2YB4 A;  2EZX A;  2FLN A;  1JRO A;  1ZQN A;  1UT5 A;  4R65 A;  5ALS A;  1DGJ A;  2W8K A;  1FIQ A;  1S0V A;  1PK1 B;  1A76 A;  2W9A A;  4K4H A;  4DO9 A;  1ZQE A;  4AYB F;  4ECU A;  9ICQ A;  4P4P A;  4CGZ A;  1TK8 A;  5J0P A;  2XY7 A;  3PMN A;  2WHE A;  4Q8F A;  5AI4 A;  2BCR A;  3KHR A;  2W11 A;  4QZF A;  1YZ7 A;  3SD7 A;  2KKP A;  2XVT A;  2ASL A;  3TAD A;  2JV3 A;  3NUQ A;  4R8U A;  1ZQG A;  9ICN A;  2LMR A;  4YXJ A;  4C4R A;  2FPM A;  3SYZ A;  2ZIW B;  3BDP A;  5KT2 A;  3H8W A;  3DEE A;  4C8L A;  5KFH A;  3H0M B;  2K4H A;  5KT5 A;  5EWF A;  3ISB A;  2QAR A;  2K60 A;  3RH5 A;  1DRG A;  1ZET A;  1O08 A;  2JXJ A;  4DOB A;  3EUB 2;  1Z4O A;  2EDU A;  2ZXH A;  2JZB A;  4M6W B;  8ICK A;  9ICP A;  4RQ3 A;  4Q44 A;  1ZRN A;  1NNL A;  4I2G A;  1SKS A;  2EZZ A;  5DB6 A;  2KNJ A;  1OXJ A;  4JMU A;  4DL2 A;  3N7P D;  3SQI A;  5C0Y A;  3H8J A;  4GIB A;  4FBU A;  3LWL A;  3L3F X;  2VJ5 A;  1K1Q A;  5DKW A;  3LK9 A;  2BCS A;  5AKK A;  3KBB A;  5DQH A;  4DSI A;  4BJQ A;  2W54 A;  3RJI A;  3ORY A;  5ALM A;  2H5X A;  8ICS A;  2G06 A;  4DFD A;  5KT4 A;  2HVH A;  3WKA A;  4Y2U A;  4J9M A;  1N62 A;  3MAB A;  1ZJN A;  4I2E A;  2FMQ A;  2AGP A;  5DB7 A;  3Q8R B;  4ELV A;  1YZ6 A;  4FS2 A;  3QZ7 A;  1B0X A;  2HW3 A;  4HAI A;  5F9N A;  4KLE A;  3NTU A;  4GXJ A;  2HMX A;  4DQS A;  3PSF A;  1ZQJ A;  1A6S A;  4KLL A;  3TKA A;  2RDI A;  2E5S A;  3MDA A;  4C80 A;  1NKB A;  4Y2T A;  2OCE A;  3GII A;  5ALG A;  8ICN A;  2NO4 A;  3SMV A;  1L7N A;  3K75 D;  3ICX A;  9ICA A;  1LB2 B;  5F3X B;  1D8L A;  3RB6 A;  2V9W A;  5BOL A;  3N7S C;  3IG8 A;  4QZ9 A;  2BCU A;  1OW5 A;  2DPI A;  5JUM A;  2P6R A;  2FPK A;  5CWR A;  4DSK A;  1ZOL A;  3QU4 A;  4RQ0 A;  4UQG A;  8ICQ A;  4J9P A;  3C1Z A;  3PW0 A;  3EWA A;  4QZA A;  1ZQZ A;  1CRX A;  4Y2V A;  2CRX A;  4PZN A;  2W7P A;  3QU5 A;  2P6U A;  5L1L A;  2EAO A;  4ECX A;  5KT6 A;  3C1Y A;  4LVS A;  3B0Y A;  1N61 A;  2AXT U;  3QXG A;  1NKE A;  5KG0 A;  4DL4 A;  3AU6 A;  5IIO A;  5AM2 A;  9ICS A;  3BS5 A;  2BHN A;  4OJO A;  2D6F C;  4MF2 A;  2EH9 A;  3GV5 B;  1UPH A;  1TV9 A;  4QZD A;  3ZDA A;  9ICI A;  4NWI A;  1SL0 A;  1WCN A;  2W9B B;  4DLG A;  1Z19 A;  3SAH A;  5DG9 A;  4TQS A;  5D4B A;  3PW5 A;  2KJ5 A;  3SI8 A;  5L1K A;  2DWQ A;  5KFQ A;  4FZN A;  5KAI U;  3JPP A;  1F5S A;  1ZQV A;  3N7R C;  3WK7 A;  2MA1 A;  2LYA A;  3RTV A;  4PH5 A;  3QYP A;  1SKW A;  7ICV A;  1KW4 A;  2DUY A;  2HBJ A;  4NLK A;  1Z4N A;  3KOO A;  5KFE A;  4GLX A;  4C8O A;  1VLB A;  1U4B A;  3WKE A;  4EEY A;  3QE9 Y;  3IP4 B;  2EQY A;  3H7I A;  3TAR A;  4DFK A;  2JEG A;  1KEJ A;  1V85 A;  3GV7 B;  1HJP A;  2E8M A;  1XSN A;  4YR3 A;  3C23 A;  5IIK A;  4F5Q A;  5AKI A;  4ECZ A;  2XID A;  4O3P A;  4ED1 A;  2Y9U A;  3MR6 A;  3BZC A;  4QWB A;  1QQ6 A;  3F2C A;  3QEB Z;  4BWJ A;  3QUB A;  4UB5 A;  9ICW A;  5AM5 A;  2A3V A;  1ZQM A;  1QQ7 A;  2CPR A;  3F5A A;  2ZTC A;  3V7J A;  2LBO A;  4Z6E A;  3QUC A;  7ICL A;  5AM1 A;  3PO5 A;  2B0C A;  2PFO A;  4NLN A;  4I29 A;  2AQ0 A;  1D9D A;  5KG6 A;  4XA5 A;  1SWW A;  3C29 A;  4ECQ A;  3R9K A;  3EZ5 A;  4RQ2 A;  4QZH A;  2EAM A;  2P35 A;  3IV6 A;  3F5E A;  2FI1 A;  2A1J A;  1JN3 A;  4DL7 A;  2YN4 A;  4QW9 A;  1U48 A;  3IHQ B;  1QTM A;  1D8B A;  5DG7 A;  4EEK A;  4MF8 A;  1RXW A;  3LVV A;  4UAU A;  4UBC A;  3QNM A;  4PHE A;  3SEI A;  1UA0 A;  4YMN A;  4RZR A;  1KFS A;  4UB2 A;  3MR2 A;  5KG1 A;  1L3V A;  1VJ5 A;  1RM6 C;  1ZXI A;  2IOF A;  5ALZ A;  5ALT A;  1ZQ1 C;  3G6Y A;  4CE6 A;  2BPC A;  1ZQY A;  1ZQO A;  1N5W A;  2ZXI A;  1N5X A;  4UAY A;  7ICH A;  4PGX A;  1XU4 A;  2PFN A;  2F77 X;  3C2K A;  3LYS A;  3MR3 A;  4PHD A;  4KLU A;  2XY5 A;  3JPR A;  4G9B A;  2G5H B;  3KZI U;  1ZD2 P;  2DBY A;  1PVQ A;  1ZQQ A;  7ICN A;  1LVH A;  2JR5 A;  4UAR A;  1SV0 A;  3L4P A;  5AKY A;  3KHG A;  4DLE A;  1Q3V A;  3GIL A;  8ICW A;  1WCL A;  2RDJ A;  3GQC A;  2H3F A;  3T3F A;  2BDP A;  3OGU A;  1CEZ A;  2ZIW A;  3H8S A;  2JMG A;  3UXO A;  4O5C A;  2LI6 A;  3ALR A;  3QZ8 A;  2HBK A;  3TAD C;  4GXI A;  1NKC A;  2ZIU B;  4NJ8 A;  4ECR A;  4DOA A;  4UB8 U;  4E0D A;  4F4Y A;  5ALH A;  3KFU F;  1SZH A;  4M6W A;  3UQ2 A;  1PVR A;  2OHF A;  1QSY A;  4NLB A;  4I27 A;  2V4R A;  4M47 A;  1C7Y A;  4RNO A;  3NS1 A;  4QWD A;  3WU2 U;  2HCF A;  3N28 A;  3NAS A;  4OJL A;  5ALE A;  5J0T A;  4NM1 A;  2DPJ A;  4I2C A;  3GU3 A;  3PX6 A;  3HP6 A;  4O9M A;  2MU2 A;  1KDH A;  5J2G A;  3JPO A;  4Q8E A;  1RG6 A;  2DL0 A;  5KFD A;  2YX8 A;  4ZOH C;  5KFC A;  1NOM A;  1UCV A;  4F93 B;  4RQ5 A;  2C2D A;  2Z7J A;  1NJY A;  3PSI A;  4UB1 A;  3NVV A;  2XCP A;  1BPE A;  2JHD A;  1D8Y A;  5KFL A;  3M9O B;  2LHT A;  1WWV A;  1KKX A;  5HR6 A;  8ICC A;  1ZD4 A;  2ZIX B;  4XUS A;  5ALJ A;  3IDW A;  4F3O A;  2LKY A;  1RQN A;  1EXN A;  4ELT A;  5J2A A;  8ICX A;  4UAS A;  3FDS A;  4EYH B;  1X6I A;  2KHQ A;  4KIT B;  2G5I B;  2WF6 A;  4KLQ A;  3PST A;  2Y0S C;  2ZUB A;  4F5O A;  2UVU A;  1B22 A;  4QNL A;  2ODG A;  1DOQ A;  2KVS A;  3ZD9 A;  2GH1 A;  4JWN A;  3PX4 A;  4QZC A;  4IS7 A;  4F8R A;  5L1I A;  2MUT B;  1WUD A;  3IRU A;  2BQR A;  1ZQD A;  2HBM A;  3FAH A;  4O3N A;  4DS5 A;  4O5E A;  4RQ1 A;  2F76 X;  5AK3 A;  2CN1 A;  1LKY B;  2MAX A;  4C7Z A;  3M8S A;  3ZD8 A;  2QLT A;  2GWS A;  5KT3 A;  1Z00 B;  3Q8M A;  3HIL A;  3GIK A;  1ZQL A;  1JI7 A;  1L3S A;  3T5L A;  3AMZ A;  4B9L A;  4ELU A;  4C0Z A;  3H4D A;  4DSJ A;  3D2Q A;  4YP3 A;  2K4E A;  5HHI A;  1L8O A;  5ALQ A;  1X9M A;  5TIS U;  5IIN A;  1XS9 D;  5ALK A;  1FEZ A;  4O3Q A;  4DS4 A;  4TUQ A;  1BPB A;  4KX5 A;  2JH1 A;  2KIV A;  2KZM A;  5ALL A;  1NK8 A;  8ICR A;  2R8J A;  1QCK A;  2W9B A;  3RBE A;  2ZJA A;  4KTQ A;  4DQQ A;  3QU2 A;  2W9C B;  5ALW A;  2Y0S F;  1PVP A;  5KFI A;  4C4T A;  1BVS A;  4R66 A;  2L5Y A;  4RQ8 A;  5J2J A;  1KTQ A;  5CR0 A;  3MGI A;  3ZDD A;  4DEZ A;  2HOI A;  3I28 A;  4F4Z A;  1PK3 A;  1T7P A;  4UAW A;  4DF8 A;  2UVW A;  2E8P A;  3M9N B;  1L3U A;  3BQ2 A;  2C2R A;  1ZQR A;  4QJF B;  3QEA Z;  4FE3 A;  1QSS A;  3TAC B;  2ZIV B;  4BUG A;  3PVX A;  2JRZ A;  2W03 A;  5B66 U;  5KFX A;  2WF9 A;  5FP0 A;  1DXS A;  3PML A;  3MFH A;  2R8G A;  1V97 A;  1L7P A;  4F92 B;  4CNQ A;  2FLL A;  3I76 A;  2YMM A;  5AKG A;  2QB0 A;  2KKV A;  1S0N A;  2KD1 A;  1SV4 A;  2E1E A;  3DV9 A;  1RQL A;  5EE9 A;  1UA1 A;  4BXO B;  4P4M A;  3HKZ C;  1LV5 A;  1ZQP A;  1PUZ A;  4FZM A;  2W3R A;  1X42 A;  5AKJ A;  4UAV A;  4J9Q A;  1L8L A;  1L3T A;  2KE7 A;  1MC8 A;  5BPC A;  4O3O A;  2IMW P;  3BS7 A;  5J8Y A;  4YR0 A;  3NVW A;  4JV2 A;  4YD1 A;  3Q8K A;  4TUR A;  5CP2 A;  2CXY A;  1KRP A;  1BNO A;  1COO A;  3A0B U;  2ZUD A;  3GV8 B;  5DB9 A;  4J9O A;  5CJ7 A;  4TUS A;  5TZV A;  9ICL A;  5KFK A;  2HI0 A;  1NJW A;  3WK5 A;  1FO4 A;  5KG4 A;  2DF4 B;  4UW9 A;  3DDH A;  2XY6 A;  3Q8S B;  3N97 B;  1MSW D;  2KZ3 A;  2IHM A;  2QKQ A;  4QWA A;  1ZQS A;  4EEL A;  4RT2 A;  5ALD A;  1F44 A;  4BX9 C;  5KT7 A;  8ICI A;  3C28 A;  3OHB A;  1NK4 A;  4IRD A;  5ALX A;  4IQV A;  1HIW A;  4YD2 A;  8ICG A;  2O6K A;  2C28 A;  1L7M A;  2V4Q A;  2NRW A;  1T4G A;  2KTQ A;  1ZRM A;  2YTU A;  4NY8 A;  4M2Y A;  3V6J A;  9ICR A;  3RB4 A;  3LWM A;  3ONN A;  1P7D A;  4FZL A;  4DSE A;  4I2I A;  3PZP A;  4FFD A;  3KHH A;  2XIC A;  2RQ5 A;  4IC9 A;  1ZJM A;  2E1F A;  5KFW A;  5L1M A;  2HBL A;  4BGD A;  5AK6 A;  4A8E A;  4RQ7 A;  3PO4 A;  1SV0 C;  5AKH A;  3PV8 A;  4EYI B;  2ZIU A;  5AM4 A;  4O3M A;  5T14 A;  5DB8 A;  8ICO A;  5AKE A;  8ICF A;  4KLJ A;  2DKX A;  2K8C B;  2EAP A;  1PZN A;  2NYV A;  9ICJ A;  4TUP A;  2KSO B;  4Y2J A;  2ES6 A;  3T79 A;  2W43 A;  3CP8 A;  4WJ3 B;  5ALN A;  1ZQF A;  4M9H A;  1L6N A;  4DSL A;  4YVZ A;  1OUQ A;  4NXZ A;  4F50 A;  2KHV A;  5AM0 A;  5CRX A;  1N2X A;  2HHW A;  4DQI A;  2JEJ A;  7ICR A;  4QWC A;  4UAZ A;  4IR1 A;  1XSL A;  3FC4 A;  5KFZ A;  2AJQ A;  2I6X A;  3G6V A;  2YQE A;  3RH4 A;  3B9J A;  1DK3 A;  4YFK A;  5DBC A;  5CHG A;  7ICK A;  3UXP A;  7ICE A;  4EBC A;  5J0S A;  2I9G A;  5DDM A;  3V6K A;  5CEH A;  2KJ9 A;  5KNI A;  4QZ8 A;  2NRT A;  2JEF A;  3RR7 A;  8ICB A;  5KFY A;  4RUA A;  3VCB A;  3H4B A;  4DL6 A;  2R18 A;  3RBD A;  3E2E A;  5DQI A;  3KKA A;  2GLE A;  3PY8 A;  2HOF A;  9ICK A;  5AIB A;  3WKB A;  2NRX A;  2BCQ A;  1NJZ A;  5AHX A;  2ISP A;  3RJH A;  4G3I A;  3BQ1 A;  2VA3 A;  5JTI A;  3PX0 A;  2M0N A;  1TE2 A;  9ICT A;  2QAR B;  2F3N A;  3UMG A;  2FDR A;  1RYS A;  3C2M A;  3SEN A;  2JZB B;  2W3S A;  3SZ2 A;  2WB1 C;  3RB3 A;  2JGA A;  2MUT A;  2AGQ A;  2C2E A;  3CNH A;  5IIM A;  4Z6C A;  2R8K A;  4UAT A;  3RR8 A;  4LZG A;  4F91 B;  2PI5 A;  2JEI A;  2K89 A;  5ALR A;  4GC6 A;  1NJX A;  1X6J A;  4KMU A;  3QU9 A;  3N4M B;  1IIP A;  1XO0 A;  2FLP A;  9ICV A;  3AM9 A;  2GO7 A;  2ZJ8 A;  1Q8K A;  4B9T A;  3THV A;  5J0U A;  7ICO A;  2QB1 A;  2YB1 A;  1Z3E B;  3G6X A;  5ALI A;  4J9N A;  1AQ6 A;  5L9X A;  4NL9 A;  3GIM A;  5KFR A;  4KLH A;  2G09 A;  5KFN A;  2XGP A;  2LYB A;  4FBT A;  2HOQ A;  1S9F A;  3HT3 A;  2RHF A;  4XRH A;  5J0Y A;  4PJ0 U;  1PK1 A;  8ICJ A;  1NZP A;  3AN1 A;  1S97 A;  2K4P A;  3OJS A;  1FFV A;  4QIW C;  3PR5 B;  1JIH A;  1KN5 A;  2VA2 A;  4NLZ A;  5ALY A;  5EE1 A;  2KEY A;  2AH5 A;  3H8M A;  1X9W A;  4OD0 A;  4B9S A;  3M6Z A;  5EOZ A;  2MSN A;  2PMZ C;  2LYH A;  1VDV A;  4U6P A; 
#chains in the Genus database with same CATH homology
 4BUG A;  2W03 A;  3VCB A;  2WB1 F;  2KIW A;  2Q4T A;  2R18 A;  3C29 A;  2ZIU B;  1HEK A;  1WUD A;  3L3F X;  3F2D A;  3AQE A;  4OJP A;  4P0Q A;  5A0L A;  4CRX A;  3ONN A;  1ED1 A;  2VJ5 A;  1P7D A;  2OYY A;  2W7O A;  1T94 A;  2KV2 A;  2HBM A;  3KFU F;  1SZH A;  1YT3 A;  3F5E A;  4FZL A;  2HOF A;  4U7C A;  4NV0 A;  3PZP A;  4P0P A;  4NLC A;  2YB4 A;  3IN5 A;  2XIC A;  2OXO A;  4OJ6 A;  1PVR A;  4OJO A;  3RF9 A;  2D6F C;  2F76 X;  2KKV A;  4IC9 A;  2CN1 A;  4NLB A;  3H0L B;  3IG5 A;  3D2N A;  3AQF A;  2E1F A;  2KIC A;  2M0N A;  3MGV A;  2HBL A;  2G08 A;  1UPH A;  4BJQ A;  2KD1 A;  2VJ4 A;  2W04 A;  4OJ5 A;  2E1E A;  2G06 A;  1D8B A;  4PL2 A;  1KBU A;  4NWI A;  2NV3 A;  4A8E A;  2ZIV A;  3F2B A;  2GOL A;  2KVC A;  4KX3 A;  4OJL A;  5KL8 B;  3LVV A;  2OH2 A;  1Q3U A;  3HKZ F;  2WB1 C;  2HBK A;  3SAG A;  3HKZ C;  2ZIX A;  2JGA A;  4C0Z A;  4AYB F;  3SAH A;  1Z19 A;  2ZIU A;  3D2Q A;  2OM6 A;  2G0A A;  3GU3 A;  4FZM A;  4O3M A;  2K4E A;  2RRD A;  2VIX A;  3KZX A;  4CGZ A;  3OPX A;  5T14 A;  2KJ5 A;  3E0F A;  3LVW A;  2K8C B;  3O0F A;  4FZN A;  2K89 A;  2H3Q A;  3N7R C;  1XNS A;  3GZF A;  2JH7 A;  2WAQ F;  2MA1 A;  2K4I A;  2LYA A;  2YX8 A;  3CYM A;  1TAM A;  2HMX A;  2KKP A;  3T79 A;  3SAF A;  4KX5 A;  2JH1 A;  2F8L A;  3M6K A;  2F2A B;  1IIP A;  3CP8 A;  2HBJ A;  5KL1 B;  3PSF A;  1XO0 A;  4WJ3 B;  2BDU A;  1A6S A;  1ECW A;  2N1R A;  2XVT A;  1L6N A;  1ZQ1 C;  2E5S A;  3D2S A;  3NUQ A;  2Z7J A;  3PSI A;  1OUQ A;  2KHV A;  2H3I A;  5CRX A;  2ZXI A;  5HR7 A;  4AYB C;  2H3Z A;  4QIW F;  1GO3 F;  2YB1 A;  2JHD A;  3IP4 B;  2F77 X;  2KOB A;  1A0P A;  2ZG6 A;  2LHT A;  2ZIW B;  3SMV A;  1URJ A;  2DGZ A;  2Y0S F;  3LYS A;  4KMO B;  2DF4 B;  1PVP A;  3ICX A;  5HR6 A;  2G09 A;  3DEE A;  5C0Y A;  4GFJ A;  3H0M B;  2K4H A;  2WAQ C;  4CDG A;  3H0R B;  2G5H B;  2LYB A;  2ZIX B;  3IG8 A;  3N7S C;  4OO1 J;  1PVQ A;  4P0Q B;  2HOQ A;  3RFA A;  2XID A;  4ICA A;  2H3V A;  4ACO A;  1DRG A;  1F44 A;  2DQN B;  2HOI A;  2G07 A;  2RHF A;  4BX9 C;  2LKY A;  2ZXH A;  4P0P B;  3F2C A;  1MA7 A;  3C28 A;  3CRX A;  2MRL A;  4PL1 A;  2XI9 A;  2K8B B;  3PSP A;  2KJ8 A;  1Q3V A;  3F53 A;  2VKQ A;  3M7D A;  3VC8 A;  1HIW A;  4QIW C;  3AL0 B;  2RP5 A;  2KHQ A;  2KJ9 A;  2H3F A;  1CRX A;  2A3V A;  2CRX A;  2G5I B;  4QJF B;  2W7P A;  2KEY A;  2CPR A;  3F5A A;  3PST A;  2ZIW A;  3K1Z A;  2Y0S C;  4FE3 A;  2JMG A;  2LBO A;  2PMZ F;  3M6Z A;  2KNJ A;  2ZIV B;  4QNL A;  3ALR A;  1NZB A;  1Z1B A;  2PMZ C;  4JMU A;  4U6P A;  3N7P D;  3NRW A;  3SQI A;  2K8A A;  2GH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...