2GOLA

Xray structure of gag278
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Implications for Viral Capsid Assembly from Crystal Structures of HIV-1 Gag 1-278 and CAN 133-278.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Matrix protein p17 (MA)
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2golA00
4ICAA 2GOLA 2K4HA 2LYAA 2H3IA 2H3FA 1HEKA 2LYBA 1ECWA 2JMGA 2HMXA 4IC9A 1A6SA 1L6NA 2H3ZA 1UPHA 4JMUA 2K4IA 1HIWA 2N1RA 2H3QA 2H3VA 1TAMA 1ED1A 2K4EA 2NV3A
chains in the Genus database with same CATH superfamily
4R66A 1FIQA 1NKEA 4DO9A 5JTIA 4PHDA 2ASJA 5AKLA 1MQ3A 3JPNA 5EE0A 5HMLA 2JEFA 9ICXA 1Z1VA 3MGIA 2D3DA 2XY5A 2K89A 3I1YA 2WF8A 1SL2A 5DBBA 2WAQC 4QZIA 2RQ5A 4ZH4A 1SXDA 8ICXA 4GFJA 1ZRNA 3TAQA 1K1SA 2JHDA 5ALFA 2CPRA 2HHUA 1RZTA 4DQSA 3QXGA 3SV4A 2C28A 1NK4A 2ZIWB 2RHFA 1XO0A 3JPRA 1QTMA 3UQ0A 4Z6FA 3EPIA 5JU5A 2G5HB 4U7CA 4BWMA 5J2EA 3OHBA 2PMZF 3QNMA 1KW4A 1WWVA 1PK1A 1D9DA 2Y9TA 8ICKA 9ICBA 4M9LA 4O5EA 8ICOA 1C20A 2LM4A 2LYBA 4F5RA 3RJEA 2Y0SC 5AI8A 3C2LA 3OPXA 4RQMA 5KT5A 7ICQA 2IOFK 4NLKA 4KMOB 4RUAA 4UW9A 3ALRA 3MGVA 1X6JA 4JB3A 4YVZA 2W55A 5AK4A 2YMQA 1NZPA 2W54A 1JUDA 3PX6A 3EPGA 3E0FA 7ICFA 3RR7A 4YD1A 2XY7A 4AYBC 2C2RA 3H4BA 1D8YA 1PUZA 1SV4A 2W9CA 1ZQFA 3H8WA 7ICEA 4KLGA 4PL2A 3M1YA 4F3OA 4B9TA 2PMZC 3TADA 1F0MA 1XSLA 5EOZA 1MA7A 4ELVA 8ICQA 2Y1JA 2V4RA 4J03A 3RFAA 1DOQA 1BPZA 5ALZA 2F8LA 5KG5A 4B9SA 5DQGA 2KG5A 4O5CA 2ISOA 1ZQZA 4RQ0A 4EENA 5DG7A 9ICAA 2KK0A 4YR0A 1AROP 2PFQA 5AHXA 4I28A 2HMXA 2YB1A 4M6WA 2ZJ8A 3C2MA 4RPXA 3ZDBA 2LYHA 2ZIXB 2WB1F 4NY8A 2IHMA 4MF2A 5JRTA 3RBEA 4J9NA 1L8OA 5J2KA 5L1MA 3ORYA 4YCXA 1TFRA 4BUGA 2NRWA 3KZIU 4NM1A 3JPPA 4BDPA 4YFKA 4RQ5A 2FJ6A 2W9AA 4I2IA 3CW2C 4JV2A 2ZIWA 2G06A 4QJFB 3AUOA 3BJYA 4M9HA 5ALMA 1NKBA 1PVRA 5C0YA 3H8JA 4YN4A 5F9NA 3TI0A 1BPXA 5J8YA 2ES6A 4MFAA 4IS7A 1LV5A 1V38A 4MHVA 5DB8A 8ICPA 7ICJA 4RNMA 2NRXA 4KLMA 1TE2A 5KFIA 4YXJA 4ELUA 3SMVA 1H38A 1XWLA 3PW7A 3PVXA 4BJQA 4P4PA 1NJYA 1HUZA 4PZOA 1FFVA 4OJPA 3RH4A 5KAFU 3PR5B 4NL9A 1QSYA 5H2FU 1YZ7A 1XU4A 5HHHA 4F4WA 2JMGA 5CB1A 3NRWA 2J6UA 4UAZA 2G0AA 3V6KA 4ECUA 1L5UA 3LYSA 1WWUA 5ALHA 1LKYB 1S77D 1ZQAA 5J2DA 4F50A 3T3FA 1N60A 8ICFA 2EAMA 4DEZA 3GQCA 3MABA 3AU6A 3HT3A 1KQQA 3H0MB 3RB4A 2HBLA 1T3NA 1HEKA 2DFLA 3QYPA 1D8LA 2NO4A 1O08A 1K1QA 5BOLA 1L3UA 5KFMA 3IG8A 3GV7B 4B9LA 4QIWC 3RJJA 8ICUA 3ED5A 3QU9A 2R8HA 2KJ8A 4I29A 1ZQJA 1M6YA 4DL6A 2YQEA 5JUMA 4IRDA 2K8CB 3FM9A 4DL3A 1FO4A 1PVPA 4MFCA 5IILA 5AICA 7ICVA 1N62A 2FE9A 4PGQA 4B9UA 4KLJA 3QUTA 1NK9A 2P6RA 5KL8B 4EEKA 5AK3A 3SAHA 4P4MA 2VJ4A 1QSSA 3KHGA 5AK6A 2PFNA 2KVCA 1LKYA 4C7YA 1ZQCA 2L5YA 1NK6A 8ICMA 4P0QA 7ICRA 3RF9A 3Q8PB 2HHXA 4FZNA 2KD1A 1RG6A 3M9MB 1NJXA 4KLIA 2KKVA 1JALA 1SGGA 1RYRA 5IINA 4KLSA 2H5XA 3RTVA 2FLLA 1DRGA 4MF8A 1CI4A 4QZCA 2E1EA 1RYUA 4F5PA 4P4OA 2XY6A 4M9NA 4Y2JA 3PNCA 4FZLA 1JRPA 3AEVA 2N1RA 4C4TA 4QZFA 7ICSA 3C28A 4I2JA 3GV5B 1CRXA 2J6TA 1KDHA 3D6JA 5CR0A 1IV8A 4ECTA 2FMSA 1SL0A 4QW9A 3KHHA 4I2EA 2H3ZA 1UA0A 1NJWA 4C80A 2HOFA 1X66A 3AN1A 4JK1A 4QNLA 3D2SA 3H7IA 2LI6A 4OO1J 5J0TA 1N63A 5AI9A 3H0LB 1GO3F 4UAVA 5DG8A 4Y2VA 4UB5A 5GTIU 2NRTA 3I76A 4J9SA 4R63A 2G09A 4F5NA 2XI9A 2XC9A 2FPLA 1L8LA 3B0YA 4FS1A 4P0PB 5L9XA 1ZQYA 3WKDA 5KFBA 3GV8B 4BXOA 2BPCA 5CA7A 3EWAA 4PHEA 4FE3A 1SWWA 5ALTA 2HSZA 3WK4A 3TADC 3NUQA 3PW0A 2Y0SF 3BS5B 1ZQHA 5F3XB 5HNKA 3LDAA 2E8PA 2B21A 1KFDA 3DEEA 4XA5A 1S0VA 4DWIA 4CF4A 2P35A 1F5SA 4Y2TA 1MQ2A 2ZJ5A 4RNNA 4PZNA 2RDJA 2A19A 4NLGA 1NKCA 3AQEA 1X2IA 2KICA 1X9MA 1JXEA 2A1JA 1EXNA 4EELA 5AI4A 4UB3A 3SR6A 5KFZA 1T7PA 1ZD5A 3C5GA 3PY8A 4DSEA 1S0NA 3OTQA 4I2CA 3ISDA 3NVYA 3N7RC 1Q46A 4LJXA 1SL1A 3V6HA 3Q8LA 2KJ5A 4UB8U 3RH5A 5ALGA 5J0YA 2OCEA 3KOOA 4DOCA 5J2JA 3RJKA 2UVRA 5KT4A 2EZYA 4Y2UA 8ICRA 1TK5A 1Z19A 3VCBA 4YR2A 3HX0A 2JGAA 2LKYA 1VJ5A 4KLDA 3RB6A 2HBJA 4DFPA 1A0PA 2FI1A 5KG3A 5AKXA 3PSIA 2FLPA 2DPIA 5HMMA 1Y88A 1U45A 5J0RA 1L6NA 2OM6A 2JR5A 3PO5A 4UB2A 9ICEA 1ZQQA 5J8YC 1RQNA 2XVTA 3H8SA 2HHTA 1N61A 1D8BA 5J0XA 2XCPA 4PL1A 9ICCA 5DDMA 4QWCA 4GIBA 2QB0B 3PW5A 4RQ3A 4KN7A 4FZMA 2CRXA 2KSOB 4A8EA 4IR9A 8ICNA 4USAA 4M9GA 2FMQA 4P0PA 4NLNA 4Q45A 3OSPA 9ICUA 2ZXIA 1BPDA 3QU2A 4ICAA 1PK3A 3G6VA 3PW2A 2UVWA 4I2HA 3EYZA 4UQGA 9ICGA 4KLTA 7ICMA 4DLEA 1OXJA 2F44A 1ZQLA 4ED7A 2HDOA 2YX8A 2I6XA 2W11A 5KFRA 1ZQ1C 1KFSA 2ZUDA 2G08A 3A0BU 1Z00A 5DLFA 2H3IA 3KBBA 4YP3A 2W8LA 3C29A 4IQUA 3HW8A 2HVIA 4KLLA 1SKSA 4TQRA 5DKWA 4DFJA 2QB0A 1SXEA 3MDCA 1DK3A 1JIHA 5AKGA 4UB6U 4R64A 4QWBA 3QUCA 3QUQA 1JI7A 1RXVA 2DF4B 4Y2RA 2F3NA 4EYHB 4R65A 3UPQA 4KLFA 4J9KA 4DSLA 2JRZA 1XNSA 5AI6A 4F5OA 1V97A 2WTFA 4J9OA 2HHQA 1BPYA 4M47A 4O3SA 1Z4OA 5TISU 1U47A 3GILA 4F2SA 2DUYA 3FYHA 5CRXA 2DKXA 2GOLA 2R18A 3C1ZA 2ZIXA 4DQRA 2BKEA 3F5EA 2KE7A 3QE9Y 4ECVA 1SZHA 3FAHA 3BQ1A 2JEJA 3TAPA 1ZQBA 3SV3A 7ICIA 1ZQSA 9ICKA 5KTQA 2MAXA 7ICUA 5K4LA 3T79A 4IR1A 7ICLA 5DB7A 3SEIA 2GWSA 2MSNA 1UPHA 5EWGA 4Y2YA 5ALOA 4RT2A 1SV0A 1WCNA 2AQ0A 4F92B 1JN3A 3CNHA 1ZQKA 4C8LA 5IIMA 3KZXA 2KN7A 5KFYA 8ICCA 1XC9A 8ICHA 2VA8A 2ZXHA 1B0XA 3M9OB 1QQ6A 2EZXA 2ODGA 2EH9A 2HI0A 5J0UA 1L7OA 8ICJA 5ALEA 2HCFA 3ISBA 3GDXA 1TK8A 4FFDA 4ECZA 8ICTA 2LYAA 5AM4A 1X9SA 2VA3A 3QU4A 2R8KA 1QLNA 2IA6A 1ZQTA 1L7MA 2LM1A 2ATLA 5FP0A 1LB2B 4DL5A 4RZRA 4I2BA 2D8CA 2AQ4A 3RJIA 5HR6A 1QCKA 2HOQA 1N5WA 5EE1A 5KFJA 4C4RA 4OJLA 5T14A 1FFUA 4EYIB 1XO1A 2QB1A 1XSPA 3BS7A 2KIWA 2XICA 3ZD8A 2BQUA 4JV1A 2KZZA 2XCAA 4CE6A 2UVVA 1RDFA 2E8NA 4DSJA 4XUSA 2Q4TA 1KN5A 1Z00B 3R9KA 2ZIVA 2AU0A 3THVA 3RBDA 5C5JA 2JZBB 4GXIA 4FO6A 4F93B 4DFMA 2YY6A 3SENA 3ETRA 3TKAA 2BQ3A 1ZQNA 2O6KA 3QU5A 1DXSA 1NNLA 1U4BA 2ZTCA 2HOIA 2RRDA 2QARB 3UXPA 4J9MA 3OSNA 3N97B 4EBDA 1NK0A 4IRKA 2W43A 3MBYA 2YMMA 5HR7A 2NRZA 5AKJA 1S0MA 1WYGA 2YB4A 3M6ZA 1K5OA 4XQ8A 1VLBA 4C7ZA 4U6PA 2EDUA 1ZD3A 4PPXA 8ICYA 4PGYA 1URJA 4M0AA 2E3TA 4CRXA 4Y2XA 5ALVA 3F53A 4M2YA 2XGQA 5KG0A 1WG8A 4Q44A 3AU2A 4NM2A 4KITB 2K8BB 3NVVA 1KSPA 4F5QA 2RDIA 2KVSA 3U26A 5B5EU 2KOBA 3ICXA 2ZIVB 4RQ1A 3PX4A 1A77A 1KKXA 4Y2PA 4ED2A 3ZDDA 4Q8FA 2KFNA 2HBKA 1F44A 2A3VA 5CP2A 4RNOA 4DL7A 1PVQA 5J2BA 2UVUA 2FPKA 5AI5A 3VC8A 4RQ2A 4ECWA 4ED3A 2W3RA 2ALZA 3WK9A 8ICLA 4KX5A 1A76A 5AM0A 4JUZA 2HHVA 3GIMA 4RT3A 4RUCA 2EANA 2DQNB 5KAIU 1Q3VA 4LZGA 2GLEA 4DFDA 2IOHA 2K60A 3BZKA 3MR2A 1WCLA 2BQRA 4ECRA 1ZD4A 4YQWA 2JEGA 2W7OA 2HHWA 5D4BA 1Z4NA 3EW9A 5ALYA 2Q0ZX 5L1KA 2M9NA 1IXRA 5DLGA 3Q8SB 1N2XA 1TAQA 1COKA 5DGAA 4R8UB 4YG2A 5CEHA 4CGZA 1JMSA 1COOA 2KIVA 5KFWA 2B0CA 5KG7A 1RQLA 2JZBA 2BPFA 1ZQGA 1SKRA 3RRGA 4IQTA 3PW4A 2BPGA 1T3QA 3ZD9A 3ZDCA 3BS5A 1Z1BA 4BGDA 2H3QA 2HHSA 5ALWA 4KX3A 5J2FA 1ZYQA 4TUPA 2K4HA 1MC8A 2C2DA 3Q8KA 2XIDA 1N5XA 4OJ5A 3PO4A 5B66U 3UXOA 5AKHA 1ZQUA 2VKQA 3GU3A 1ZJMA 4DFKA 4X5VA 4MEYA 4QZEA 4MEXA 3T5HA 1MN8A 4NLCA 4F8RA 3WKEA 1L3SA 2I5HA 3RAXA 4NWIA 5J2IA 5CJ7A 1ZQIA 2FLNA 4QZHA 5ALSA 8ICSA 2WF6A 3WKCA 2F2AB 9ICNA 2JV3A 2BCRA 2OEHA 2CN1A 5BPCA 3BQ7A 3SD7A 5DBAA 2YMLA 2BR0A 4ECXA 1QSLA 1JX4A 5ALUA 2E1FA 2JEIA 1ED1A 4GLXA 4DQIA 2G5IB 4QZAA 5KFHA 4AYBF 4CCHA 2FDRA 3IV6A 3KD3A 5G5HA 1L7PA 1RXWA 5J0QA 5IIJA 3F2DA 1YZ6A 1NK7A 1T4GA 5AM3A 9ICIA 1X9XA 2W9MA 4UAYA 4XRHA 2I1QA 4ACOA 2F1IA 3C1YA 2LMRA 5KFXA 7ICHA 2ZUBA 1ZQVA 3QU7A 5DQHA 2BHNA 1ZQRA 5EE9A 2IHNA 2HVHA 4UARA 4QZGA 3PSPA 5J2GA 1ECWA 3UM9A 4RPYA 3JPTA 2QKQA 1TVAA 1N48A 1S10A 3N7PD 3UQ2A 2BCSA 3GZFA 5DBCA 1S5LU 4JWMA 3F2BA 2YTUA 5L1LA 4I27A 4F4ZA 3UXNA 2OXOA 2VIXA 4RU9A 2PI4A 1KL9A 3HP6A 2E8MA 2AGOA 3Q8QB 2KZ3A 4K4HA 3KHRA 4QW8A 4F4KA 3D2NA 3J81j 4DSFA 9ICTA 2NO5A 4WJ3B 4RQ8A 1QQ5A 4Z6CA 2QARA 1QH9A 2DPJA 5KFQA 4KTQA 3IP4B 3M8RA 2F1HA 2KJ9A 2KHQA 3TACB 1RM6C 4YMMA 4KMUA 1RYSA 5J2CA 5AM5A 3MR6A 4O9MA 3LVWA 5KG1A 3KFUF 1U48A 3HKZC 2BDUA 1X9WA 4LZDA 2WB1C 3K1RB 4RPZA 5EWFA 3M9NB 4TQSA 5KFFA 4I2GA 1ZQMA 1BGXT 3IRUA 3KKAC 3PMLA 1U49A 4YMOA 1KEJA 2ZIUB 4UBCA 3H40A 4J9QA 9ICMA 9ICVA 2DKZA 5AKIA 3RRHA 1ZETA 4US8A 4YMNA 5DB9A 4OCZA 1XSNA 3IG5A 5ALQA 2ZG6A 2V4QA 8ICAA 4O3MA 2PXIA 1MSWD 2KMDA 5AIAA 1HJPA 2Y1IA 3CP8A 2H3FA 5IIKA 3MFHA 4KLUA 4B9VA 4OD0A 4Z6EA 9ICRA 5EE3A 4QIWF 1BNOA 5KFSA 2XO7A 2ESEA 1OW5A 3PSTA 4B9MA 4JMUA 4RQ6A 8ICGA 2K4PA 4ECYA 1NK5A 2RP5A 4UATA 3NGDA 4BXOB 3L3FX 2KV2A 4F71A 2W04A 4DQQA 4QZ8A 1JROA 1V9PA 4NV0A 7ICOA 3F5AA 5AKZA 4YR3A 2BCUA 5ALRA 1AQ6A 5L1IA 4DF4A 3M7DA 4HAIA 2E5SA 3V72A 3H8MA 2EQYA 1TV9A 3ZDEA 2KTQA 1L3TA 1UT8A 5AK5A 2LPEA 4ED6A 3NRZA 2AJQA 3HPOA 1ZQEA 4QWEA 5G5GA 1NK8A 3RJGA 2KZMA 2JH7A 9ICQA 2Z7JA 4G3IA 4EZ9A 2ASDA 1CUKA 5KFOA 3LWMA 5J29A 1L3VA 2A1AA 3L4PA 4RQ7A 1NI3A 2OH2A 3TARA 3UMGA 3FC4A 2IMWP 3BZCA 3WK6A 2BZFA 7ICPA 4GC7A 5GTHU 1SB3C 4ED8A 3EZ5A 5D46A 3I28A 8ICWA 2KHVA 4PH5A 2F77X 4ED0A 3K75D 4EEYA 3NS1A 3GIKA 3IHQB 4J9PA 2KFZA 1O03A 3MR5A 3QUBA 3QEAZ 3G6XA 8ICIA 3G6YA 1B22A 3RJFA 5KT2A 1Z3EB 2CXYA 2EZZA 1DK2A 2DGZA 5J0OA 2WF9A 9ICPA 4UBBA 4HYKA 1C7YA 1SIJA 3M8SA 4Y2QA 2VANA 2C2EA 2WF5A 2AGQA 4KN4A 3KHLA 1Q3UA 8ICVA 4QZDA 2HW3A 4PJ0U 4MFFA 3JPSA 4C8NA 3K1ZA 3QEBZ 4G9BA 4IQWA 4KLHA 4BWJA 1PZNA 2R8JA 4FBUA 1JXLA 5KG6A 5KT6A 5AI0A 3BQ2A 3E2EA 4O0IA 5KL1B 2ISPA 4C8KA 3QZ7A 4JWNA 2K8AA 2IOFA 1CEZA 2EAOA 4DSKA 2W3SA 4Q8EA 5AKEA 5KG4A 3CYMA 4K4GA 5L1JA 2W7PA 1ZXIA 5KFEA 2NV3A 4GC6A 1J2MA 4ECSA 5EWEA 4UB4A 5J0PA 5KFUA 4DS4A 5KFGA 1J2NA 3TFSA 1RPLA 2FPMA 3MC1A 4O3QA 1HUOA 1QQ7A 1PK1B 5KG2A 3C21A 3F2CA 3C2KA 3UMCA 4QWAA 4IQVA 2PFPA 4KLQA 3RAQA 3TFRA 1ZQXA 1P7DA 7ICNA 3SYZA 1DGJA 3UMBA 2KEYA 5DDYA 3S6JA 5DGBA 1NZBA 2W9BB 3O0FA 4ZOHC 2FMPA 1ZQWA 1S9FA 4ED1A 4NLZA 4TURA 3PMNA 3N4MB 4F2RA 4UAWA 2QLTA 3KKAA 2W03A 5CHGA 4YD2A 5KNIA 3CRXA 2ZIUA 2MRLA 3Q8MA 4OJ6A 4O3OA 5TZVA 1UQVA 3SAGA 3RH6A 4DOBA 9ICJA 4DOAA 2GH1A 3JPQA 1J97A 2MUTB 5IIOA 1DGSA 3NTUA 4CDGA 4DSIA 3MDAA 2OHFA 1OUQA 7ICTA 1SWVA 1NJZA 3PV8A 4UB1A 4O3PA 2WAQF 2MU2A 3RB3A 3K4GA 1WUDA 2BCVA 1ZOLA 4Y2SA 2F76X 5DB6A 4US9A 1ZQDA 4BX9C 9ICFA 1IIPA 2AHOB 4I2DA 3TQ1A 3ONNA 3OJSA 3SQIA 2H3VA 4NLBA 9ICWA 4PGXA 2P66A 4IL6U 4C4SA 1BPEA 5AKYA 1VDVA 5E79U 9ICOA 3ETLA 3SZ2A 1ZD2P 5KFLA 3T5JA 3AMZA 5IIIA 2DL0A 4P2HA 3OGUA 4ELTA 4FS2A 3ZDAA 3RR8A 3HKZF 5AKKA 1NOMA 4Z6DA 1KLNA 2J6SA 4QZBA 2BGWA 5BOMA 3BQTA 3MR3A 2P6UA 3NVZA 1Q8KA 1KFTA 2ZTDA 4IC9A 2F8KA 4QZ9A 4LVSA 4M04A 1ZQOA 7ICKA 3H4DA 4M9JA 3T5KA 5J0SA 1S76D 1BVSA 2B6GA 4I2AA 4YXMA 1UCVA 2D6FC 5D49A 3B0XA 1YT3A 5ALNA 2WF7A 3N28A 1A6SA 3GIIA 3WKAA 4DCCA 3PR4A 1ZJNA 4C8MA 1XS9D 2JH1A 5ALDA 2DWQA 2YMPA 1S97A 5J0WA 2E8OA 2A1JB 2W9CB 5AM2A 4CF5A 5AIBA 4DL2A 1SV0C 3HILA 3AQFA 2MA1A 5ALPA 4EX7A 3SAFA 2KKPA 3WK8A 5J2HA 4O3RA 4GXKA 3QX7A 2R8IA 4PHPA 4EBCA 1ZRMA 1UA1A 3RB0A 4UAUA 4F4YA 2ZUCA 3JPOA 4F72A 1UHUA 5ALLA 2WHEA 4O3NA 2BDPA 3OJUA 2KSOA 3Q8RB 3E58A 1B43A 1T94A 5KT7A 4CF3A 5HP4A 4F91B 5ALXA 1B4FA 2WFAA 4EZ6A 5KFDA 3MFIA 4DLGA 2IBKA 3WU2U 3AL0B 1SZPA 3AM9A 3TANA 3V7LA 4DS5A 2ASLA 1X6IA 1T8EA 3DV9A 5CWRA 3V7KA 5KFAA 1X40A 4IRCA 1SKWA 2PKEA 3PSFA 4OJOA 2GO7A 5A0LA 4CNQA 2F1JA 1KRPA 2RLTA 5AM1A 2W8KA 4KLEA 2XGPA 4EX6A 5F9LA 4FBTA 4RQ4A 4ECQA 2PFOA 3NVWA 2JXJA 4B9NA 1KTQA 4B6JA 3IM1A 2ZJAA 3A0HU 1LVHA 2DBYA 9ICHA 3C5FA 3GFKB 1S8OA 3PZPA 5KFNA 4K4IA 3LVVA 2W9BA 2YN4A 2LBOA 2G07A 4C8OA 3IDWA 5KFTA 2VA2A 3L5KA 4AP9A 3V6JA 4RQNA 1D9FA 9ICSA 4R8UA 1BNPA 3KTQA 1TAMA 1L7NA 2R8GA 3RJHA 4UASA 3FDSA 4TUSA 4NXZA 3D2QA 2AH5A 5KFKA 3PX0A 3HJEA 1N56A 8ICZA 2MUTA 4E0DA 4P0QB 3C23A 8ICEA 4GXJA 3MGHA 1UT5A 2NRVA 1FEZA 4QWDA 7ICGA 4KLOA 3H0RB 2NYVA 3WK7A 2M0NA 3LWLA 2KNJA 5KFCA 4NL9C 4TUQA 3QZ8A 5KFVA 5ALJA 3DDHA 3WK5A 5KT3A 3LK9A 3ISCA 3BDPA 8ICBA 4DL4A 3M6KA 5DQIA 1HIWA 1TKDA 3N7SC 4Q43A 2PI5A 2EAPA 4F4XA 1KBUA 4O5KA 2AGPA 1S0OA 2LHTA 2Y9UA 3OHAA 2ZTEA 5DG9A 4C0ZA 3EUB2 2C22A 2HBMA 4J9LA 3BQ0A 4EBEA 1IG6A 4DQPA 3IN5A 4JV0A 2KP7A 4NJ8A 1TAUA 1TK0A 2I9GA 9ICLA 1IM4A 1X42A 2K4IA 5J2AA 3NASA 2V9WA 5ALKA 5HHIA 3WKBA 3ZI4A 2BCQA 4DF8A 4J9RA 3T5LA 3HWTA 2OWOA 3V7JA 5ALIA 4PHAA 3SI8A 3HRDD 1ZQPA 1V85A 2OYYA 2AXTU 4I2FA 2VJ5A 4M6WB 1U9LA 3GIJA 1BPBA 5KFPA 3B9JA 2K4EA
chains in the Genus database with same CATH topology
4ICAA 2G5IB 2Q4TA 3AQEA 3D2QA 4AYBF 2KICA 2ZIVA 2ZIUB 4PL2A 3T79A 1DRGA 2K89A 2JMGA 2E1EA 2PMZC 3NRWA 2W7OA 3F2DA 4P0QB 2G0AA 1MA7A 3IG5A 3LYSA 1UPHA 2KHVA 2F77X 4FZLA 2ZG6A 4ACOA 2WAQC 2N1RA 3F2CA 3RFAA 2YX8A 4O3MA 2F8LA 4GFJA 3C28A 1ZQ1C 2JHDA 2HOIA 3HKZF 3CP8A 1T94A 2CPRA 2G08A 2H3FA 2RRDA 3KZXA 3N7RC 1CRXA 2KJ5A 4CGZA 1P7DA 3H0RB 2M0NA 2ZIWB 2H3IA 2KEYA 2RHFA 3H0MB 2KNJA 3PSPA 1XO0A 1NZBA 2HBLA 1HEKA 3O0FA 1ECWA 2ZXHA 3C29A 2HMXA 2YB1A 5HR7A 2DGZA 4QIWF 4IC9A 3N7PD 2ZIXB 3AL0B 2G5HB 2WB1F 3PSTA 4U7CA 2H3ZA 3GZFA 2PMZF 3IG8A 2YB4A 3M6KA 3M6ZA 4JMUA 1Z1BA 4QIWC 1HIWA 2HOFA 2W03A 2RP5A 1Z19A 2H3QA 3N7SC 3F2BA 1KBUA 4QNLA 3VCBA 3D2SA 3CRXA 4KX3A 3PSFA 2JGAA 2LKYA 2MRLA 2ZIUA 4OJOA 5A0LA 2DF4B 4OJ6A 2KJ8A 3L3FX 2KV2A 2LHTA 1Q3UA 4OO1J 1URJA 4BUGA 2K4HA 3SAGA 4CRXA 2W04A 4C0ZA 2LYAA 2OXOA 2HBJA 2VIXA 1A0PA 2HBMA 2XIDA 2K8CB 3F53A 1XNSA 2GH1A 3H0LB 1GO3F 2LYBA 3PSIA 4NV0A 1PVPA 2Y0SC 3F5AA 2D6FC 4OJ5A 3IN5A 4U6PA 1YT3A 3K1ZA 3D2NA 4CDGA 2ZIWA 2G06A 2VKQA 3GU3A 2OM6A 3OPXA 4WJ3B 3M7DA 1A6SA 1L6NA 2G09A 2K8BB 5KL8B 4QJFB 2XI9A 2K4IA 2E5SA 1OUQA 3SAHA 2KOBA 3ICXA 5HR6A 2XVTA 4KMOB 2JH1A 1PVRA 2VJ4A 2ZIVB 4P0PB 2WAQF 5C0YA 2HOQA 2KVCA 2HBKA 3ALRA 4NLCA 3MGVA 1F44A 1D8BA 5CRXA 2GOLA 2A3VA 4PL1A 5KL1B 3IP4B 4OJLA 1WUDA 4P0QA 2R18A 3PZPA 3RF9A 2ZIXA 2KJ9A 5T14A 4NWIA 1PVQA 2K8AA 2KHQA 2F76X 3E0FA 3LVVA 4FE3A 3VC8A 4FZNA 2LBOA 2KD1A 4FZMA 2G07A 3AQFA 3F5EA 2CRXA 2JH7A 2F2AB 3NUQA 2OYYA 2MA1A 4A8EA 1SZHA 4KX5A 2Z7JA 4BX9C 3LVWA 2Y0SF 3KFUF 1IIPA 3CYMA 3HKZC 2VJ5A 3DEEA 2BDUA 3SAFA 2CN1A 2KIWA 2WB1C 3SMVA 3ONNA 2KKVA 2KKPA 4BJQA 2XICA 3SQIA 2H3VA 4P0PA 1TAMA 4AYBC 4NLBA 2E1FA 2DQNB 2W7PA 2ZXIA 1ED1A 4OJPA 1Q3VA 2OH2A 2K4EA 2NV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ICA A;  2GOL A;  2K4H A;  2LYA A;  2H3I A;  2H3F A;  1HEK A;  2LYB A;  1ECW A;  2JMG A;  2HMX A;  4IC9 A;  1A6S A;  1L6N A;  2H3Z A;  1UPH A;  4JMU A;  2K4I A;  1HIW A;  2N1R A;  2H3Q A;  2H3V A;  1TAM A;  1ED1 A;  2K4E A;  2NV3 A; 
#chains in the Genus database with same CATH topology
 4R66 A;  1FIQ A;  1NKE A;  4DO9 A;  5JTI A;  4PHD A;  2ASJ A;  5AKL A;  1MQ3 A;  3JPN A;  5EE0 A;  5HML A;  2JEF A;  9ICX A;  1Z1V A;  3MGI A;  2D3D A;  2XY5 A;  2K89 A;  3I1Y A;  2WF8 A;  1SL2 A;  5DBB A;  2WAQ C;  4QZI A;  2RQ5 A;  4ZH4 A;  1SXD A;  8ICX A;  4GFJ A;  1ZRN A;  3TAQ A;  1K1S A;  2JHD A;  5ALF A;  2CPR A;  2HHU A;  1RZT A;  4DQS A;  3QXG A;  3SV4 A;  2C28 A;  1NK4 A;  2ZIW B;  2RHF A;  1XO0 A;  3JPR A;  1QTM A;  3UQ0 A;  4Z6F A;  3EPI A;  5JU5 A;  2G5H B;  4U7C A;  4BWM A;  5J2E A;  3OHB A;  2PMZ F;  3QNM A;  1KW4 A;  1WWV A;  1PK1 A;  1D9D A;  2Y9T A;  8ICK A;  9ICB A;  4M9L A;  4O5E A;  8ICO A;  1C20 A;  2LM4 A;  2LYB A;  4F5R A;  3RJE A;  2Y0S C;  5AI8 A;  3C2L A;  3OPX A;  4RQM A;  5KT5 A;  7ICQ A;  2IOF K;  4NLK A;  4KMO B;  4RUA A;  4UW9 A;  3ALR A;  3MGV A;  1X6J A;  4JB3 A;  4YVZ A;  2W55 A;  5AK4 A;  2YMQ A;  1NZP A;  2W54 A;  1JUD A;  3PX6 A;  3EPG A;  3E0F A;  7ICF A;  3RR7 A;  4YD1 A;  2XY7 A;  4AYB C;  2C2R A;  3H4B A;  1D8Y A;  1PUZ A;  1SV4 A;  2W9C A;  1ZQF A;  3H8W A;  7ICE A;  4KLG A;  4PL2 A;  3M1Y A;  4F3O A;  4B9T A;  2PMZ C;  3TAD A;  1F0M A;  1XSL A;  5EOZ A;  1MA7 A;  4ELV A;  8ICQ A;  2Y1J A;  2V4R A;  4J03 A;  3RFA A;  1DOQ A;  1BPZ A;  5ALZ A;  2F8L A;  5KG5 A;  4B9S A;  5DQG A;  2KG5 A;  4O5C A;  2ISO A;  1ZQZ A;  4RQ0 A;  4EEN A;  5DG7 A;  9ICA A;  2KK0 A;  4YR0 A;  1ARO P;  2PFQ A;  5AHX A;  4I28 A;  2HMX A;  2YB1 A;  4M6W A;  2ZJ8 A;  3C2M A;  4RPX A;  3ZDB A;  2LYH A;  2ZIX B;  2WB1 F;  4NY8 A;  2IHM A;  4MF2 A;  5JRT A;  3RBE A;  4J9N A;  1L8O A;  5J2K A;  5L1M A;  3ORY A;  4YCX A;  1TFR A;  4BUG A;  2NRW A;  3KZI U;  4NM1 A;  3JPP A;  4BDP A;  4YFK A;  4RQ5 A;  2FJ6 A;  2W9A A;  4I2I A;  3CW2 C;  4JV2 A;  2ZIW A;  2G06 A;  4QJF B;  3AUO A;  3BJY A;  4M9H A;  5ALM A;  1NKB A;  1PVR A;  5C0Y A;  3H8J A;  4YN4 A;  5F9N A;  3TI0 A;  1BPX A;  5J8Y A;  2ES6 A;  4MFA A;  4IS7 A;  1LV5 A;  1V38 A;  4MHV A;  5DB8 A;  8ICP A;  7ICJ A;  4RNM A;  2NRX A;  4KLM A;  1TE2 A;  5KFI A;  4YXJ A;  4ELU A;  3SMV A;  1H38 A;  1XWL A;  3PW7 A;  3PVX A;  4BJQ A;  4P4P A;  1NJY A;  1HUZ A;  4PZO A;  1FFV A;  4OJP A;  3RH4 A;  5KAF U;  3PR5 B;  4NL9 A;  1QSY A;  5H2F U;  1YZ7 A;  1XU4 A;  5HHH A;  4F4W A;  2JMG A;  5CB1 A;  3NRW A;  2J6U A;  4UAZ A;  2G0A A;  3V6K A;  4ECU A;  1L5U A;  3LYS A;  1WWU A;  5ALH A;  1LKY B;  1S77 D;  1ZQA A;  5J2D A;  4F50 A;  3T3F A;  1N60 A;  8ICF A;  2EAM A;  4DEZ A;  3GQC A;  3MAB A;  3AU6 A;  3HT3 A;  1KQQ A;  3H0M B;  3RB4 A;  2HBL A;  1T3N A;  1HEK A;  2DFL A;  3QYP A;  1D8L A;  2NO4 A;  1O08 A;  1K1Q A;  5BOL A;  1L3U A;  5KFM A;  3IG8 A;  3GV7 B;  4B9L A;  4QIW C;  3RJJ A;  8ICU A;  3ED5 A;  3QU9 A;  2R8H A;  2KJ8 A;  4I29 A;  1ZQJ A;  1M6Y A;  4DL6 A;  2YQE A;  5JUM A;  4IRD A;  2K8C B;  3FM9 A;  4DL3 A;  1FO4 A;  1PVP A;  4MFC A;  5IIL A;  5AIC A;  7ICV A;  1N62 A;  2FE9 A;  4PGQ A;  4B9U A;  4KLJ A;  3QUT A;  1NK9 A;  2P6R A;  5KL8 B;  4EEK A;  5AK3 A;  3SAH A;  4P4M A;  2VJ4 A;  1QSS A;  3KHG A;  5AK6 A;  2PFN A;  2KVC A;  1LKY A;  4C7Y A;  1ZQC A;  2L5Y A;  1NK6 A;  8ICM A;  4P0Q A;  7ICR A;  3RF9 A;  3Q8P B;  2HHX A;  4FZN A;  2KD1 A;  1RG6 A;  3M9M B;  1NJX A;  4KLI A;  2KKV A;  1JAL A;  1SGG A;  1RYR A;  5IIN A;  4KLS A;  2H5X A;  3RTV A;  2FLL A;  1DRG A;  4MF8 A;  1CI4 A;  4QZC A;  2E1E A;  1RYU A;  4F5P A;  4P4O A;  2XY6 A;  4M9N A;  4Y2J A;  3PNC A;  4FZL A;  1JRP A;  3AEV A;  2N1R A;  4C4T A;  4QZF A;  7ICS A;  3C28 A;  4I2J A;  3GV5 B;  1CRX A;  2J6T A;  1KDH A;  3D6J A;  5CR0 A;  1IV8 A;  4ECT A;  2FMS A;  1SL0 A;  4QW9 A;  3KHH A;  4I2E A;  2H3Z A;  1UA0 A;  1NJW A;  4C80 A;  2HOF A;  1X66 A;  3AN1 A;  4JK1 A;  4QNL A;  3D2S A;  3H7I A;  2LI6 A;  4OO1 J;  5J0T A;  1N63 A;  5AI9 A;  3H0L B;  1GO3 F;  4UAV A;  5DG8 A;  4Y2V A;  4UB5 A;  5GTI U;  2NRT A;  3I76 A;  4J9S A;  4R63 A;  2G09 A;  4F5N A;  2XI9 A;  2XC9 A;  2FPL A;  1L8L A;  3B0Y A;  4FS1 A;  4P0P B;  5L9X A;  1ZQY A;  3WKD A;  5KFB A;  3GV8 B;  4BXO A;  2BPC A;  5CA7 A;  3EWA A;  4PHE A;  4FE3 A;  1SWW A;  5ALT A;  2HSZ A;  3WK4 A;  3TAD C;  3NUQ A;  3PW0 A;  2Y0S F;  3BS5 B;  1ZQH A;  5F3X B;  5HNK A;  3LDA A;  2E8P A;  2B21 A;  1KFD A;  3DEE A;  4XA5 A;  1S0V A;  4DWI A;  4CF4 A;  2P35 A;  1F5S A;  4Y2T A;  1MQ2 A;  2ZJ5 A;  4RNN A;  4PZN A;  2RDJ A;  2A19 A;  4NLG A;  1NKC A;  3AQE A;  1X2I A;  2KIC A;  1X9M A;  1JXE A;  2A1J A;  1EXN A;  4EEL A;  5AI4 A;  4UB3 A;  3SR6 A;  5KFZ A;  1T7P A;  1ZD5 A;  3C5G A;  3PY8 A;  4DSE A;  1S0N A;  3OTQ A;  4I2C A;  3ISD A;  3NVY A;  3N7R C;  1Q46 A;  4LJX A;  1SL1 A;  3V6H A;  3Q8L A;  2KJ5 A;  4UB8 U;  3RH5 A;  5ALG A;  5J0Y A;  2OCE A;  3KOO A;  4DOC A;  5J2J A;  3RJK A;  2UVR A;  5KT4 A;  2EZY A;  4Y2U A;  8ICR A;  1TK5 A;  1Z19 A;  3VCB A;  4YR2 A;  3HX0 A;  2JGA A;  2LKY A;  1VJ5 A;  4KLD A;  3RB6 A;  2HBJ A;  4DFP A;  1A0P A;  2FI1 A;  5KG3 A;  5AKX A;  3PSI A;  2FLP A;  2DPI A;  5HMM A;  1Y88 A;  1U45 A;  5J0R A;  1L6N A;  2OM6 A;  2JR5 A;  3PO5 A;  4UB2 A;  9ICE A;  1ZQQ A;  5J8Y C;  1RQN A;  2XVT A;  3H8S A;  2HHT A;  1N61 A;  1D8B A;  5J0X A;  2XCP A;  4PL1 A;  9ICC A;  5DDM A;  4QWC A;  4GIB A;  2QB0 B;  3PW5 A;  4RQ3 A;  4KN7 A;  4FZM A;  2CRX A;  2KSO B;  4A8E A;  4IR9 A;  8ICN A;  4USA A;  4M9G A;  2FMQ A;  4P0P A;  4NLN A;  4Q45 A;  3OSP A;  9ICU A;  2ZXI A;  1BPD A;  3QU2 A;  4ICA A;  1PK3 A;  3G6V A;  3PW2 A;  2UVW A;  4I2H A;  3EYZ A;  4UQG A;  9ICG A;  4KLT A;  7ICM A;  4DLE A;  1OXJ A;  2F44 A;  1ZQL A;  4ED7 A;  2HDO A;  2YX8 A;  2I6X A;  2W11 A;  5KFR A;  1ZQ1 C;  1KFS A;  2ZUD A;  2G08 A;  3A0B U;  1Z00 A;  5DLF A;  2H3I A;  3KBB A;  4YP3 A;  2W8L A;  3C29 A;  4IQU A;  3HW8 A;  2HVI A;  4KLL A;  1SKS A;  4TQR A;  5DKW A;  4DFJ A;  2QB0 A;  1SXE A;  3MDC A;  1DK3 A;  1JIH A;  5AKG A;  4UB6 U;  4R64 A;  4QWB A;  3QUC A;  3QUQ A;  1JI7 A;  1RXV A;  2DF4 B;  4Y2R A;  2F3N A;  4EYH B;  4R65 A;  3UPQ A;  4KLF A;  4J9K A;  4DSL A;  2JRZ A;  1XNS A;  5AI6 A;  4F5O A;  1V97 A;  2WTF A;  4J9O A;  2HHQ A;  1BPY A;  4M47 A;  4O3S A;  1Z4O A;  5TIS U;  1U47 A;  3GIL A;  4F2S A;  2DUY A;  3FYH A;  5CRX A;  2DKX A;  2GOL A;  2R18 A;  3C1Z A;  2ZIX A;  4DQR A;  2BKE A;  3F5E A;  2KE7 A;  3QE9 Y;  4ECV A;  1SZH A;  3FAH A;  3BQ1 A;  2JEJ A;  3TAP A;  1ZQB A;  3SV3 A;  7ICI A;  1ZQS A;  9ICK A;  5KTQ A;  2MAX A;  7ICU A;  5K4L A;  3T79 A;  4IR1 A;  7ICL A;  5DB7 A;  3SEI A;  2GWS A;  2MSN A;  1UPH A;  5EWG A;  4Y2Y A;  5ALO A;  4RT2 A;  1SV0 A;  1WCN A;  2AQ0 A;  4F92 B;  1JN3 A;  3CNH A;  1ZQK A;  4C8L A;  5IIM A;  3KZX A;  2KN7 A;  5KFY A;  8ICC A;  1XC9 A;  8ICH A;  2VA8 A;  2ZXH A;  1B0X A;  3M9O B;  1QQ6 A;  2EZX A;  2ODG A;  2EH9 A;  2HI0 A;  5J0U A;  1L7O A;  8ICJ A;  5ALE A;  2HCF A;  3ISB A;  3GDX A;  1TK8 A;  4FFD A;  4ECZ A;  8ICT A;  2LYA A;  5AM4 A;  1X9S A;  2VA3 A;  3QU4 A;  2R8K A;  1QLN A;  2IA6 A;  1ZQT A;  1L7M A;  2LM1 A;  2ATL A;  5FP0 A;  1LB2 B;  4DL5 A;  4RZR A;  4I2B A;  2D8C A;  2AQ4 A;  3RJI A;  5HR6 A;  1QCK A;  2HOQ A;  1N5W A;  5EE1 A;  5KFJ A;  4C4R A;  4OJL A;  5T14 A;  1FFU A;  4EYI B;  1XO1 A;  2QB1 A;  1XSP A;  3BS7 A;  2KIW A;  2XIC A;  3ZD8 A;  2BQU A;  4JV1 A;  2KZZ A;  2XCA A;  4CE6 A;  2UVV A;  1RDF A;  2E8N A;  4DSJ A;  4XUS A;  2Q4T A;  1KN5 A;  1Z00 B;  3R9K A;  2ZIV A;  2AU0 A;  3THV A;  3RBD A;  5C5J A;  2JZB B;  4GXI A;  4FO6 A;  4F93 B;  4DFM A;  2YY6 A;  3SEN A;  3ETR A;  3TKA A;  2BQ3 A;  1ZQN A;  2O6K A;  3QU5 A;  1DXS A;  1NNL A;  1U4B A;  2ZTC A;  2HOI A;  2RRD A;  2QAR B;  3UXP A;  4J9M A;  3OSN A;  3N97 B;  4EBD A;  1NK0 A;  4IRK A;  2W43 A;  3MBY A;  2YMM A;  5HR7 A;  2NRZ A;  5AKJ A;  1S0M A;  1WYG A;  2YB4 A;  3M6Z A;  1K5O A;  4XQ8 A;  1VLB A;  4C7Z A;  4U6P A;  2EDU A;  1ZD3 A;  4PPX A;  8ICY A;  4PGY A;  1URJ A;  4M0A A;  2E3T A;  4CRX A;  4Y2X A;  5ALV A;  3F53 A;  4M2Y A;  2XGQ A;  5KG0 A;  1WG8 A;  4Q44 A;  3AU2 A;  4NM2 A;  4KIT B;  2K8B B;  3NVV A;  1KSP A;  4F5Q A;  2RDI A;  2KVS A;  3U26 A;  5B5E U;  2KOB A;  3ICX A;  2ZIV B;  4RQ1 A;  3PX4 A;  1A77 A;  1KKX A;  4Y2P A;  4ED2 A;  3ZDD A;  4Q8F A;  2KFN A;  2HBK A;  1F44 A;  2A3V A;  5CP2 A;  4RNO A;  4DL7 A;  1PVQ A;  5J2B A;  2UVU A;  2FPK A;  5AI5 A;  3VC8 A;  4RQ2 A;  4ECW A;  4ED3 A;  2W3R A;  2ALZ A;  3WK9 A;  8ICL A;  4KX5 A;  1A76 A;  5AM0 A;  4JUZ A;  2HHV A;  3GIM A;  4RT3 A;  4RUC A;  2EAN A;  2DQN B;  5KAI U;  1Q3V A;  4LZG A;  2GLE A;  4DFD A;  2IOH A;  2K60 A;  3BZK A;  3MR2 A;  1WCL A;  2BQR A;  4ECR A;  1ZD4 A;  4YQW A;  2JEG A;  2W7O A;  2HHW A;  5D4B A;  1Z4N A;  3EW9 A;  5ALY A;  2Q0Z X;  5L1K A;  2M9N A;  1IXR A;  5DLG A;  3Q8S B;  1N2X A;  1TAQ A;  1COK A;  5DGA A;  4R8U B;  4YG2 A;  5CEH A;  4CGZ A;  1JMS A;  1COO A;  2KIV A;  5KFW A;  2B0C A;  5KG7 A;  1RQL A;  2JZB A;  2BPF A;  1ZQG A;  1SKR A;  3RRG A;  4IQT A;  3PW4 A;  2BPG A;  1T3Q A;  3ZD9 A;  3ZDC A;  3BS5 A;  1Z1B A;  4BGD A;  2H3Q A;  2HHS A;  5ALW A;  4KX3 A;  5J2F A;  1ZYQ A;  4TUP A;  2K4H A;  1MC8 A;  2C2D A;  3Q8K A;  2XID A;  1N5X A;  4OJ5 A;  3PO4 A;  5B66 U;  3UXO A;  5AKH A;  1ZQU A;  2VKQ A;  3GU3 A;  1ZJM A;  4DFK A;  4X5V A;  4MEY A;  4QZE A;  4MEX A;  3T5H A;  1MN8 A;  4NLC A;  4F8R A;  3WKE A;  1L3S A;  2I5H A;  3RAX A;  4NWI A;  5J2I A;  5CJ7 A;  1ZQI A;  2FLN A;  4QZH A;  5ALS A;  8ICS A;  2WF6 A;  3WKC A;  2F2A B;  9ICN A;  2JV3 A;  2BCR A;  2OEH A;  2CN1 A;  5BPC A;  3BQ7 A;  3SD7 A;  5DBA A;  2YML A;  2BR0 A;  4ECX A;  1QSL A;  1JX4 A;  5ALU A;  2E1F A;  2JEI A;  1ED1 A;  4GLX A;  4DQI A;  2G5I B;  4QZA A;  5KFH A;  4AYB F;  4CCH A;  2FDR A;  3IV6 A;  3KD3 A;  5G5H A;  1L7P A;  1RXW A;  5J0Q A;  5IIJ A;  3F2D A;  1YZ6 A;  1NK7 A;  1T4G A;  5AM3 A;  9ICI A;  1X9X A;  2W9M A;  4UAY A;  4XRH A;  2I1Q A;  4ACO A;  2F1I A;  3C1Y A;  2LMR A;  5KFX A;  7ICH A;  2ZUB A;  1ZQV A;  3QU7 A;  5DQH A;  2BHN A;  1ZQR A;  5EE9 A;  2IHN A;  2HVH A;  4UAR A;  4QZG A;  3PSP A;  5J2G A;  1ECW A;  3UM9 A;  4RPY A;  3JPT A;  2QKQ A;  1TVA A;  1N48 A;  1S10 A;  3N7P D;  3UQ2 A;  2BCS A;  3GZF A;  5DBC A;  1S5L U;  4JWM A;  3F2B A;  2YTU A;  5L1L A;  4I27 A;  4F4Z A;  3UXN A;  2OXO A;  2VIX A;  4RU9 A;  2PI4 A;  1KL9 A;  3HP6 A;  2E8M A;  2AGO A;  3Q8Q B;  2KZ3 A;  4K4H A;  3KHR A;  4QW8 A;  4F4K A;  3D2N A;  3J81 j;  4DSF A;  9ICT A;  2NO5 A;  4WJ3 B;  4RQ8 A;  1QQ5 A;  4Z6C A;  2QAR A;  1QH9 A;  2DPJ A;  5KFQ A;  4KTQ A;  3IP4 B;  3M8R A;  2F1H A;  2KJ9 A;  2KHQ A;  3TAC B;  1RM6 C;  4YMM A;  4KMU A;  1RYS A;  5J2C A;  5AM5 A;  3MR6 A;  4O9M A;  3LVW A;  5KG1 A;  3KFU F;  1U48 A;  3HKZ C;  2BDU A;  1X9W A;  4LZD A;  2WB1 C;  3K1R B;  4RPZ A;  5EWF A;  3M9N B;  4TQS A;  5KFF A;  4I2G A;  1ZQM A;  1BGX T;  3IRU A;  3KKA C;  3PML A;  1U49 A;  4YMO A;  1KEJ A;  2ZIU B;  4UBC A;  3H40 A;  4J9Q A;  9ICM A;  9ICV A;  2DKZ A;  5AKI A;  3RRH A;  1ZET A;  4US8 A;  4YMN A;  5DB9 A;  4OCZ A;  1XSN A;  3IG5 A;  5ALQ A;  2ZG6 A;  2V4Q A;  8ICA A;  4O3M A;  2PXI A;  1MSW D;  2KMD A;  5AIA A;  1HJP A;  2Y1I A;  3CP8 A;  2H3F A;  5IIK A;  3MFH A;  4KLU A;  4B9V A;  4OD0 A;  4Z6E A;  9ICR A;  5EE3 A;  4QIW F;  1BNO A;  5KFS A;  2XO7 A;  2ESE A;  1OW5 A;  3PST A;  4B9M A;  4JMU A;  4RQ6 A;  8ICG A;  2K4P A;  4ECY A;  1NK5 A;  2RP5 A;  4UAT A;  3NGD A;  4BXO B;  3L3F X;  2KV2 A;  4F71 A;  2W04 A;  4DQQ A;  4QZ8 A;  1JRO A;  1V9P A;  4NV0 A;  7ICO A;  3F5A A;  5AKZ A;  4YR3 A;  2BCU A;  5ALR A;  1AQ6 A;  5L1I A;  4DF4 A;  3M7D A;  4HAI A;  2E5S A;  3V72 A;  3H8M A;  2EQY A;  1TV9 A;  3ZDE A;  2KTQ A;  1L3T A;  1UT8 A;  5AK5 A;  2LPE A;  4ED6 A;  3NRZ A;  2AJQ A;  3HPO A;  1ZQE A;  4QWE A;  5G5G A;  1NK8 A;  3RJG A;  2KZM A;  2JH7 A;  9ICQ A;  2Z7J A;  4G3I A;  4EZ9 A;  2ASD A;  1CUK A;  5KFO A;  3LWM A;  5J29 A;  1L3V A;  2A1A A;  3L4P A;  4RQ7 A;  1NI3 A;  2OH2 A;  3TAR A;  3UMG A;  3FC4 A;  2IMW P;  3BZC A;  3WK6 A;  2BZF A;  7ICP A;  4GC7 A;  5GTH U;  1SB3 C;  4ED8 A;  3EZ5 A;  5D46 A;  3I28 A;  8ICW A;  2KHV A;  4PH5 A;  2F77 X;  4ED0 A;  3K75 D;  4EEY A;  3NS1 A;  3GIK A;  3IHQ B;  4J9P A;  2KFZ A;  1O03 A;  3MR5 A;  3QUB A;  3QEA Z;  3G6X A;  8ICI A;  3G6Y A;  1B22 A;  3RJF A;  5KT2 A;  1Z3E B;  2CXY A;  2EZZ A;  1DK2 A;  2DGZ A;  5J0O A;  2WF9 A;  9ICP A;  4UBB A;  4HYK A;  1C7Y A;  1SIJ A;  3M8S A;  4Y2Q A;  2VAN A;  2C2E A;  2WF5 A;  2AGQ A;  4KN4 A;  3KHL A;  1Q3U A;  8ICV A;  4QZD A;  2HW3 A;  4PJ0 U;  4MFF A;  3JPS A;  4C8N A;  3K1Z A;  3QEB Z;  4G9B A;  4IQW A;  4KLH A;  4BWJ A;  1PZN A;  2R8J A;  4FBU A;  1JXL A;  5KG6 A;  5KT6 A;  5AI0 A;  3BQ2 A;  3E2E A;  4O0I A;  5KL1 B;  2ISP A;  4C8K A;  3QZ7 A;  4JWN A;  2K8A A;  2IOF A;  1CEZ A;  2EAO A;  4DSK A;  2W3S A;  4Q8E A;  5AKE A;  5KG4 A;  3CYM A;  4K4G A;  5L1J A;  2W7P A;  1ZXI A;  5KFE A;  2NV3 A;  4GC6 A;  1J2M A;  4ECS A;  5EWE A;  4UB4 A;  5J0P A;  5KFU A;  4DS4 A;  5KFG A;  1J2N A;  3TFS A;  1RPL A;  2FPM A;  3MC1 A;  4O3Q A;  1HUO A;  1QQ7 A;  1PK1 B;  5KG2 A;  3C21 A;  3F2C A;  3C2K A;  3UMC A;  4QWA A;  4IQV A;  2PFP A;  4KLQ A;  3RAQ A;  3TFR A;  1ZQX A;  1P7D A;  7ICN A;  3SYZ A;  1DGJ A;  3UMB A;  2KEY A;  5DDY A;  3S6J A;  5DGB A;  1NZB A;  2W9B B;  3O0F A;  4ZOH C;  2FMP A;  1ZQW A;  1S9F A;  4ED1 A;  4NLZ A;  4TUR A;  3PMN A;  3N4M B;  4F2R A;  4UAW A;  2QLT A;  3KKA A;  2W03 A;  5CHG A;  4YD2 A;  5KNI A;  3CRX A;  2ZIU A;  2MRL A;  3Q8M A;  4OJ6 A;  4O3O A;  5TZV A;  1UQV A;  3SAG A;  3RH6 A;  4DOB A;  9ICJ A;  4DOA A;  2GH1 A;  3JPQ A;  1J97 A;  2MUT B;  5IIO A;  1DGS A;  3NTU A;  4CDG A;  4DSI A;  3MDA A;  2OHF A;  1OUQ A;  7ICT A;  1SWV A;  1NJZ A;  3PV8 A;  4UB1 A;  4O3P A;  2WAQ F;  2MU2 A;  3RB3 A;  3K4G A;  1WUD A;  2BCV A;  1ZOL A;  4Y2S A;  2F76 X;  5DB6 A;  4US9 A;  1ZQD A;  4BX9 C;  9ICF A;  1IIP A;  2AHO B;  4I2D A;  3TQ1 A;  3ONN A;  3OJS A;  3SQI A;  2H3V A;  4NLB A;  9ICW A;  4PGX A;  2P66 A;  4IL6 U;  4C4S A;  1BPE A;  5AKY A;  1VDV A;  5E79 U;  9ICO A;  3ETL A;  3SZ2 A;  1ZD2 P;  5KFL A;  3T5J A;  3AMZ A;  5III A;  2DL0 A;  4P2H A;  3OGU A;  4ELT A;  4FS2 A;  3ZDA A;  3RR8 A;  3HKZ F;  5AKK A;  1NOM A;  4Z6D A;  1KLN A;  2J6S A;  4QZB A;  2BGW A;  5BOM A;  3BQT A;  3MR3 A;  2P6U A;  3NVZ A;  1Q8K A;  1KFT A;  2ZTD A;  4IC9 A;  2F8K A;  4QZ9 A;  4LVS A;  4M04 A;  1ZQO A;  7ICK A;  3H4D A;  4M9J A;  3T5K A;  5J0S A;  1S76 D;  1BVS A;  2B6G A;  4I2A A;  4YXM A;  1UCV A;  2D6F C;  5D49 A;  3B0X A;  1YT3 A;  5ALN A;  2WF7 A;  3N28 A;  1A6S A;  3GII A;  3WKA A;  4DCC A;  3PR4 A;  1ZJN A;  4C8M A;  1XS9 D;  2JH1 A;  5ALD A;  2DWQ A;  2YMP A;  1S97 A;  5J0W A;  2E8O A;  2A1J B;  2W9C B;  5AM2 A;  4CF5 A;  5AIB A;  4DL2 A;  1SV0 C;  3HIL A;  3AQF A;  2MA1 A;  5ALP A;  4EX7 A;  3SAF A;  2KKP A;  3WK8 A;  5J2H A;  4O3R A;  4GXK A;  3QX7 A;  2R8I A;  4PHP A;  4EBC A;  1ZRM A;  1UA1 A;  3RB0 A;  4UAU A;  4F4Y A;  2ZUC A;  3JPO A;  4F72 A;  1UHU A;  5ALL A;  2WHE A;  4O3N A;  2BDP A;  3OJU A;  2KSO A;  3Q8R B;  3E58 A;  1B43 A;  1T94 A;  5KT7 A;  4CF3 A;  5HP4 A;  4F91 B;  5ALX A;  1B4F A;  2WFA A;  4EZ6 A;  5KFD A;  3MFI A;  4DLG A;  2IBK A;  3WU2 U;  3AL0 B;  1SZP A;  3AM9 A;  3TAN A;  3V7L A;  4DS5 A;  2ASL A;  1X6I A;  1T8E A;  3DV9 A;  5CWR A;  3V7K A;  5KFA A;  1X40 A;  4IRC A;  1SKW A;  2PKE A;  3PSF A;  4OJO A;  2GO7 A;  5A0L A;  4CNQ A;  2F1J A;  1KRP A;  2RLT A;  5AM1 A;  2W8K A;  4KLE A;  2XGP A;  4EX6 A;  5F9L A;  4FBT A;  4RQ4 A;  4ECQ A;  2PFO A;  3NVW A;  2JXJ A;  4B9N A;  1KTQ A;  4B6J A;  3IM1 A;  2ZJA A;  3A0H U;  1LVH A;  2DBY A;  9ICH A;  3C5F A;  3GFK B;  1S8O A;  3PZP A;  5KFN A;  4K4I A;  3LVV A;  2W9B A;  2YN4 A;  2LBO A;  2G07 A;  4C8O A;  3IDW A;  5KFT A;  2VA2 A;  3L5K A;  4AP9 A;  3V6J A;  4RQN A;  1D9F A;  9ICS A;  4R8U A;  1BNP A;  3KTQ A;  1TAM A;  1L7N A;  2R8G A;  3RJH A;  4UAS A;  3FDS A;  4TUS A;  4NXZ A;  3D2Q A;  2AH5 A;  5KFK A;  3PX0 A;  3HJE A;  1N56 A;  8ICZ A;  2MUT A;  4E0D A;  4P0Q B;  3C23 A;  8ICE A;  4GXJ A;  3MGH A;  1UT5 A;  2NRV A;  1FEZ A;  4QWD A;  7ICG A;  4KLO A;  3H0R B;  2NYV A;  3WK7 A;  2M0N A;  3LWL A;  2KNJ A;  5KFC A;  4NL9 C;  4TUQ A;  3QZ8 A;  5KFV A;  5ALJ A;  3DDH A;  3WK5 A;  5KT3 A;  3LK9 A;  3ISC A;  3BDP A;  8ICB A;  4DL4 A;  3M6K A;  5DQI A;  1HIW A;  1TKD A;  3N7S C;  4Q43 A;  2PI5 A;  2EAP A;  4F4X A;  1KBU A;  4O5K A;  2AGP A;  1S0O A;  2LHT A;  2Y9U A;  3OHA A;  2ZTE A;  5DG9 A;  4C0Z A;  3EUB 2;  2C22 A;  2HBM A;  4J9L A;  3BQ0 A;  4EBE A;  1IG6 A;  4DQP A;  3IN5 A;  4JV0 A;  2KP7 A;  4NJ8 A;  1TAU A;  1TK0 A;  2I9G A;  9ICL A;  1IM4 A;  1X42 A;  2K4I A;  5J2A A;  3NAS A;  2V9W A;  5ALK A;  5HHI A;  3WKB A;  3ZI4 A;  2BCQ A;  4DF8 A;  4J9R A;  3T5L A;  3HWT A;  2OWO A;  3V7J A;  5ALI A;  4PHA A;  3SI8 A;  3HRD D;  1ZQP A;  1V85 A;  2OYY A;  2AXT U;  4I2F A;  2VJ5 A;  4M6W B;  1U9L A;  3GIJ A;  1BPB A;  5KFP A;  3B9J A;  2K4E A; 
#chains in the Genus database with same CATH homology
 4ICA A;  2G5I B;  2Q4T A;  3AQE A;  3D2Q A;  4AYB F;  2KIC A;  2ZIV A;  2ZIU B;  4PL2 A;  3T79 A;  1DRG A;  2K89 A;  2JMG A;  2E1E A;  2PMZ C;  3NRW A;  2W7O A;  3F2D A;  4P0Q B;  2G0A A;  1MA7 A;  3IG5 A;  3LYS A;  1UPH A;  2KHV A;  2F77 X;  4FZL A;  2ZG6 A;  4ACO A;  2WAQ C;  2N1R A;  3F2C A;  3RFA A;  2YX8 A;  4O3M A;  2F8L A;  4GFJ A;  3C28 A;  1ZQ1 C;  2JHD A;  2HOI A;  3HKZ F;  3CP8 A;  1T94 A;  2CPR A;  2G08 A;  2H3F A;  2RRD A;  3KZX A;  3N7R C;  1CRX A;  2KJ5 A;  4CGZ A;  1P7D A;  3H0R B;  2M0N A;  2ZIW B;  2H3I A;  2KEY A;  2RHF A;  3H0M B;  2KNJ A;  3PSP A;  1XO0 A;  1NZB A;  2HBL A;  1HEK A;  3O0F A;  1ECW A;  2ZXH A;  3C29 A;  2HMX A;  2YB1 A;  5HR7 A;  2DGZ A;  4QIW F;  4IC9 A;  3N7P D;  2ZIX B;  3AL0 B;  2G5H B;  2WB1 F;  3PST A;  4U7C A;  2H3Z A;  3GZF A;  2PMZ F;  3IG8 A;  2YB4 A;  3M6K A;  3M6Z A;  4JMU A;  1Z1B A;  4QIW C;  1HIW A;  2HOF A;  2W03 A;  2RP5 A;  1Z19 A;  2H3Q A;  3N7S C;  3F2B A;  1KBU A;  4QNL A;  3VCB A;  3D2S A;  3CRX A;  4KX3 A;  3PSF A;  2JGA A;  2LKY A;  2MRL A;  2ZIU A;  4OJO A;  5A0L A;  2DF4 B;  4OJ6 A;  2KJ8 A;  3L3F X;  2KV2 A;  2LHT A;  1Q3U A;  4OO1 J;  1URJ A;  4BUG A;  2K4H A;  3SAG A;  4CRX A;  2W04 A;  4C0Z A;  2LYA A;  2OXO A;  2HBJ A;  2VIX A;  1A0P A;  2HBM A;  2XID A;  2K8C B;  3F53 A;  1XNS A;  2GH1 A;  3H0L B;  1GO3 F;  2LYB A;  3PSI A;  4NV0 A;  1PVP A;  2Y0S C;  3F5A A;  2D6F C;  4OJ5 A;  3IN5 A;  4U6P A;  1YT3 A;  3K1Z A;  3D2N A;  4CDG A;  2ZIW A;  2G06 A;  2VKQ A;  3GU3 A;  2OM6 A;  3OPX A;  4WJ3 B;  3M7D A;  1A6S A;  1L6N A;  2G09 A;  2K8B B;  5KL8 B;  4QJF B;  2XI9 A;  2K4I A;  2E5S A;  1OUQ A;  3SAH A;  2KOB A;  3ICX A;  5HR6 A;  2XVT A;  4KMO B;  2JH1 A;  1PVR A;  2VJ4 A;  2ZIV B;  4P0P B;  2WAQ F;  5C0Y A;  2HOQ A;  2KVC A;  2HBK A;  3ALR A;  4NLC A;  3MGV A;  1F44 A;  1D8B A;  5CRX A;  2GOL A;  2A3V A;  4PL1 A;  5KL1 B;  3IP4 B;  4OJL A;  1WUD A;  4P0Q A;  2R18 A;  3PZP A;  3RF9 A;  2ZIX A;  2KJ9 A;  5T14 A;  4NWI A;  1PVQ A;  2K8A A;  2KHQ A;  2F76 X;  3E0F A;  3LVV A;  4FE3 A;  3VC8 A;  4FZN A;  2LBO A;  2KD1 A;  4FZM A;  2G07 A;  3AQF A;  3F5E A;  2CRX A;  2JH7 A;  2F2A B;  3NUQ A;  2OYY A;  2MA1 A;  4A8E A;  1SZH A;  4KX5 A;  2Z7J A;  4BX9 C;  3LVW A;  2Y0S F;  3KFU F;  1IIP A;  3CYM A;  3HKZ C;  2VJ5 A;  3DEE A;  2BDU A;  3SAF A;  2CN1 A;  2KIW A;  2WB1 C;  3SMV A;  3ONN A;  2KKV A;  2KKP A;  4BJQ A;  2XIC A;  3SQI A;  2H3V A;  4P0P A;  1TAM A;  4AYB C;  4NLB A;  2E1F A;  2DQN B;  2W7P A;  2ZXI A;  1ED1 A;  4OJP A;  1Q3V A;  2OH2 A;  2K4E A;  2NV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...