3VC8A

Crystal structure of the c-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus a59
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
TFEEMALTTFMITKESYCKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus A59.
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
molecule keywords RNA-directed RNA polymerase
total genus 28
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3vc8A00
3VCBA 3GZFA 3VC8A
chains in the Genus database with same CATH superfamily
4UBCA 4P4MA 4B9TA 7ICLA 2YB1A 4QZ8A 3LYSA 2KIWA 7ICNA 3RJKA 3F2DA 2ZIXA 1N48A 9ICGA 2FI1A 3AMZA 3D2NA 1S0VA 2XI9A 4ECRA 3MC1A 5KFQA 2OYYA 1SKWA 5L1JA 3M8RA 3IRUA 1NKEA 3RR8A 2DWQA 4J9KA 3TI0A 3JPNA 4UATA 1RQNA 4F5QA 2VKQA 4QIWC 2BZFA 8ICQA 5D49A 5KG7A 2ASJA 2OEHA 3AQFA 5ALSA 1UA1A 2W9CA 5KFZA 3LDAA 7ICVA 4QZEA 4J9SA 4I2HA 3K1RB 3O0FA 3U26A 1PK1A 8ICOA 4M2YA 2QLTA 3GV7B 1WWUA 4IQWA 3C21A 4DOCA 4EZ6A 1ZRMA 1Y88A 4EYHB 2VA3A 4LVSA 2HW3A 2ATLA 3GU3A 3DEEA 2PFPA 2F1IA 4Y2RA 1KFSA 2R8HA 5ALTA 2KIVA 4QZDA 3H8WA 3IM1A 1HJPA 3F5EA 1TV9A 4KLMA 4C8MA 2BPCA 1SKRA 1ZOLA 4EBEA 1NZPA 4UBBA 1XWLA 3FM9A 4ECUA 1SZHA 1URJA 4QZGA 3DDHA 9ICCA 1LKYA 2P66A 5L1IA 1ZQWA 4Z6CA 4G9BA 2BCRA 2F76X 3M1YA 5ALZA 1ZETA 4RPZA 4KLOA 3M7DA 5J2BA 3GFKB 1N56A 1RXWA 1J2NA 4MF8A 4R64A 4J9NA 1ZQTA 4RNMA 4FBUA 4PGXA 5AM1A 5KG5A 4PZOA 4RQ1A 4Y2VA 2C2EA 5AI0A 4DOAA 2DBYA 7ICPA 4UW9A 2PMZF 2EAOA 1KDHA 1TK8A 3PMNA 4UB2A 1S97A 1BPEA 5EWEA 3T5KA 2R8JA 4M0AA 3V72A 8ICBA 2ZIVA 1KL9A 4JMUA 4Y2YA 2ZIXB 5HMMA 9ICXA 1L3TA 5KFGA 4ED0A 4F71A 2PFQA 1ZQCA 8ICFA 2RDJA 3SV3A 3CP8A 5CR0A 2LMRA 5AKLA 2FE9A 2AU0A 2JEGA 3HP6A 3RJIA 1QSYA 3QZ7A 5J0OA 2W43A 4MEYA 3ORYA 4XRHA 1LKYB 1CRXA 3I28A 4OJ6A 2G08A 5E79U 1L3SA 3ISBA 3RR7A 4J9MA 1FEZA 1KFTA 2NRWA 3N7RC 1IG6A 1YZ7A 1Z4OA 2H5XA 4YXMA 5AM5A 4F2RA 2XCAA 3BQTA 4G3IA 2WHEA 1NK0A 2JH1A 4IR9A 4QZAA 3WKCA 1BPDA 1S8OA 2F1JA 4M47A 3KFUF 4ED2A 3LVWA 5DKWA 1A76A 1RM6C 3RJHA 1ZD3A 8ICNA 4I2IA 4ICAA 3QX7A 4Y2QA 5FP0A 4DWIA 2F1HA 3FYHA 3D2SA 3QUQA 3BDPA 4QNLA 3ZDBA 3BJYA 4J9QA 4FZNA 1CUKA 4U6PA 3M9OB 2HSZA 1Q3UA 1BNPA 3D2QA 1PVPA 3PR5B 2HI0A 2LM1A 3ZD8A 4M9GA 3C1YA 5ALEA 5IIJA 4UB1A 4EENA 2JEJA 4Z6EA 2G06A 8ICKA 4M04A 4JB3A 2W9MA 1C20A 1T7PA 4I2AA 2E8NA 5AKEA 4Y2TA 1X9MA 2JHDA 5KT7A 1U49A 2LM4A 3HJEA 9ICWA 7ICTA 3OTQA 5KNIA 2HHXA 4Z6FA 1L3UA 5ALGA 1RYUA 2JV3A 3AUOA 1YT3A 4I2EA 4B6JA 4F8RA 4YP3A 1ED1A 2GH1A 4YMNA 1ZYQA 4C8LA 4F5RA 1DXSA 1L7PA 3QEAZ 4NLGA 1KBUA 3CW2C 2G5IB 3QU4A 2RDIA 1NK9A 4NXZA 5GTIU 3KD3A 1A6SA 9ICAA 1UA0A 2KV2A 2W54A 3JPSA 1D8BA 3D6JA 5EOZA 4ELTA 1ZD2P 5KT6A 4DS5A 2KSOB 2DL0A 5KFEA 5KG1A 1DRGA 5IINA 4UB6U 3WKEA 5KAIU 3E58A 4NLZA 1WCNA 5BOMA 2KZZA 8ICIA 4ELUA 1ZQNA 1XSPA 1QH9A 4NJ8A 1SV0C 3RB6A 4O5KA 4UB5A 3E0FA 1IV8A 1ZQRA 2DPIA 3QEBZ 4RUCA 4JWMA 2AXTU 1KSPA 2NRXA 2WAQF 4ED8A 4Q43A 2ISPA 4ECWA 2A1JB 1M6YA 4C8KA 2ZJAA 2KNJA 3MR2A 3BS5B 1L8OA 1DGSA 4I27A 5ALFA 3MDAA 3ZDCA 4MFAA 1N2XA 1TAMA 3C2MA 3A0BU 4I2BA 3Q8SB 4BXOB 3IN5A 4BXOA 4Q8FA 5T14A 1QSLA 4R65A 4J9PA 9ICVA 4NLKA 3Q8QB 4B9SA 2Y9TA 3QXGA 8ICEA 3HX0A 3T5HA 4Q44A 4C4TA 4BUGA 4U7CA 3B0XA 7ICUA 2W3SA 4NLBA 2YMQA 5ALJA 5KAFU 2JXJA 1PK1B 3TADA 5KG3A 1SWVA 4AYBC 4IC9A 3GV8B 1NKCA 2IHMA 4RZRA 1S9FA 1SB3C 1COKA 2OHFA 2B0CA 4PZNA 1V9PA 2FLLA 2KVCA 4JV1A 1RYRA 2F8KA 1UHUA 3GIIA 1RYSA 1S10A 3QYPA 1VJ5A 3HKZF 9ICJA 4IS7A 8ICCA 4F72A 1JXEA 2NYVA 1DGJA 1BPYA 1ZQBA 2VANA 5L1MA 3CYMA 4UB3A 5AKXA 8ICMA 2E5SA 1L6NA 5ALHA 3UPQA 9ICLA 1S0OA 5DQHA 9ICBA 4LZGA 2YMPA 2ZXHA 4UB8U 3FC4A 4FZMA 5KFUA 4DL6A 1BPBA 7ICRA 5ALDA 5KL1B 3OSNA 2NV3A 1T8EA 3EPIA 3C5FA 3MABA 5CHGA 1J97A 2I5HA 1BPXA 4O0IA 3QUTA 3C28A 5JTIA 2YB4A 1QSSA 1F0MA 1N60A 5KL8B 5ALVA 2XGPA 3H0RB 3H7IA 4KTQA 1NK6A 1ZQFA 1DK3A 1O08A 2ZIUA 3I1YA 3PV8A 3KZIU 3KKAA 3IP4B 5CRXA 3PO5A 3IDWA 4I2DA 3KZXA 4NL9C 4R8UA 3GV5B 4FO6A 4KLQA 4ECTA 8ICGA 1ZQPA 3JPOA 4GXKA 4YMOA 2F8LA 3TARA 3M9NB 3TAQA 2E3TA 2KICA 5KFHA 4DCCA 4US9A 4FZLA 5AK5A 3KKAC 3NUQA 3L3FX 4PHEA 3V6HA 1JI7A 3TANA 4F91B 3S6JA 2W9AA 3UQ2A 4DQQA 3NS1A 2W55A 5J2JA 2BCQA 4JK1A 4DL4A 8ICSA 5AI5A 5AM2A 2PXIA 1H38A 2IA6A 2IOHA 2C28A 1XSLA 3ZI4A 5DDYA 4QWBA 5J0QA 4YFKA 2I9GA 3C1ZA 4DL7A 1MN8A 5J0WA 4ECYA 1Q3VA 5KFKA 5TZVA 3RB3A 3T79A 2R18A 4M9LA 3LVVA 3RRGA 4EX6A 2PKEA 3WKBA 4CGZA 4TUPA 2FPKA 4YVZA 2WFAA 2J6UA 5KG4A 1XS9D 5DQIA 1KLNA 2RHFA 4RNNA 4B9UA 1KRPA 3MFHA 1ZQ1C 3Q8KA 5ALNA 2KN7A 2LKYA 5AI6A 2KE7A 2IHNA 5KFLA 3ISDA 5KFIA 4US8A 1ZQYA 4GXIA 2OCEA 2JRZA 4NLCA 2W7OA 2KZ3A 4RQ2A 3ZDDA 4RQ5A 4KMOB 4O9MA 1FO4A 5ALRA 2DFLA 4HYKA 3KHRA 1JALA 3UXPA 1N62A 2H3QA 4M9JA 4F4ZA 4NWIA 3L4PA 9ICOA 2GWSA 3M6ZA 3WKAA 4RQ8A 2H3VA 5CB1A 4I2GA 5CA7A 7ICGA 4KLUA 2ZIWB 1Z19A 4DEZA 2UVVA 4R66A 1Z00B 4O3PA 4F4XA 1TVAA 2G0AA 3T5LA 5DGAA 4PGYA 4I28A 5ALQA 4Y2JA 5DDMA 5ALUA 1NNLA 4LZDA 1ZQKA 5KT4A 3PW5A 4UAUA 1ZQSA 5J2IA 4AP9A 5IIMA 1C7YA 1PZNA 5IIKA 1FFUA 1V97A 1D9DA 1DK2A 5D4BA 3NVWA 8ICHA 3ISCA 2R8GA 1PK3A 8ICJA 3BQ0A 2VJ4A 2DQNB 2JEFA 4HAIA 4QZHA 4F92B 3RRHA 1Q8KA 2MAXA 4O3NA 4DFDA 5EE1A 1U48A 2FDRA 2F77X 1WYGA 3WU2U 3PW2A 3AL0B 4O3MA 7ICEA 4YD1A 4XQ8A 2M9NA 1QQ5A 2W8KA 5BPCA 3PVXA 5L9XA 5J2FA 5EE9A 4Y2SA 2BCSA 5KFSA 9ICQA 4M6WA 3JPQA 4KLSA 5J0PA 3ETLA 1X42A 2FMSA 5J0UA 1V38A 1X40A 1XO0A 4BJQA 3C29A 3QU7A 4O3RA 5KFDA 2G5HB 2A1AA 2JZBA 3MR6A 1WWVA 5DBBA 4CE6A 7ICIA 2AHOB 2HHQA 1PVQA 2V9WA 5DB8A 1CI4A 1DOQA 2HVHA 3VC8A 3HKZC 4GC6A 2BQUA 1MA7A 2KZMA 1NI3A 3NVZA 1ZXIA 1ZD5A 4ED6A 5KFWA 3NASA 2I1QA 3Q8LA 4O3SA 4F5OA 1X6IA 2DF4B 1NJYA 3PW0A 2KHVA 2BDUA 4RQ7A 2FMQA 3MGIA 1XO1A 5KFPA 1SV4A 2ZIWA 5J2DA 5H2FU 4RUAA 2WF6A 2BR0A 1KEJA 1RZTA 5TISU 3T5JA 1JIHA 3LK9A 2ZUDA 2BHNA 3TQ1A 2KG5A 3N7PD 4DQRA 5AK6A 5KFJA 4QWDA 1ECWA 2MA1A 3KBBA 3RJFA 2JGAA 2W04A 2NRZA 5EWFA 2ZTCA 2DKXA 7ICOA 2NO5A 1NK5A 4RU9A 2QKQA 4RQ6A 3PX6A 4MEXA 2HOQA 4DSLA 1F44A 4C8OA 3SQIA 5DB9A 3V7LA 1MQ2A 2W8LA 4QJFB 3HRDD 2IBKA 1JMSA 2YMMA 3G6YA 3M6KA 3NGDA 3SAHA 4RQMA 3K4GA 5KFTA 3GILA 2V4RA 3I76A 4ECXA 4MFCA 1N63A 2ODGA 4NM2A 8ICRA 3N97B 5DG7A 5GTHU 1TE2A 3BZCA 5DB6A 2FPMA 4DSEA 1NZBA 2YMLA 2BKEA 8ICAA 1V85A 4QW9A 4KX3A 4WJ3B 3WK6A 5ALYA 2W11A 3PO4A 1RPLA 2PI4A 4R63A 1SXDA 1ZQXA 3FDSA 4J9OA 1X2IA 3NVYA 4O3OA 3RFAA 3C5GA 5F9NA 9ICHA 3NVVA 2UVRA 4IL6U 2VIXA 2HOIA 3UQ0A 2OH2A 3RJEA 2YY6A 1WG8A 3SD7A 2CRXA 1Z4NA 1RQLA 1WUDA 1X9SA 4PL2A 2F2AB 3G6XA 4M9NA 1B43A 2XIDA 2XC9A 5A0LA 2FMPA 3PSFA 3C2KA 2XVTA 3B9JA 3RB0A 2D8CA 3THVA 1JUDA 4YR3A 4BWMA 5KTQA 5EE0A 5K4LA 4CNQA 4TUSA 2D3DA 2FLPA 3KHLA 2QB0B 1IIPA 5KG2A 4RQ4A 1PUZA 3QU2A 2MU2A 1D8YA 1JXLA 3TKAA 5ALLA 2ZIVB 2HCFA 5JU5A 4ELVA 5AKIA 3H0LB 2IOFA 2YX8A 4TUQA 3A0HU 1TKDA 2ZIUB 5DQGA 1BPZA 2KEYA 5AHXA 3M8SA 3JPTA 3RAQA 1UT8A 4QW8A 2CN1A 5KT2A 2AGPA 2KFNA 5IIOA 4O5CA 4Y2UA 2Q0ZX 3N7SC 3PW4A 4Y2PA 1L7OA 4LJXA 1P7DA 1IXRA 4ACOA 4DQSA 5AKYA 4KN7A 1TFRA 4FFDA 5HNKA 3C23A 1ZQMA 2CXYA 5KFAA 2XO7A 4KLIA 3GIJA 3HW8A 3SI8A 5J2EA 1PVRA 2Y1JA 4EBCA 5KFXA 1O03A 2HBMA 4I2FA 3L5KA 2WF9A 5KFRA 1EXNA 2XY7A 4F2SA 3KTQA 1ZQIA 1ZQEA 4RQNA 5J2HA 1NK8A 5J0RA 5G5HA 3OGUA 2W9CB 4DSFA 2E8MA 5KFFA 1S77D 4DQIA 5ALWA 2Y0SC 1B4FA 5AM0A 2NRTA 1F5SA 1ZQUA 2UVWA 4ECQA 1K1QA 5KFOA 2ZXIA 2AQ0A 4YCXA 3EUB2 4QZFA 3H8JA 4ED7A 5CEHA 3QU5A 2OM6A 4K4HA 3PX4A 3BS5A 4YMMA 3NRWA 5J2GA 3BQ1A 1NJXA 1ZD4A 4KLEA 3H0MB 2GLEA 4NLNA 5DGBA 1JROA 2BPFA 4IQUA 4F3OA 1QQ6A 2GOLA 2JH7A 5KFCA 4TURA 2RLTA 1SGGA 3ED5A 2K8BB 5IILA 4F5NA 4I2JA 3Q8RB 3H8MA 2LI6A 5HP4A 1SL0A 3PMLA 1LV5A 2ZG6A 1SIJA 2PI5A 4NY8A 3SAFA 2G09A 8ICWA 3RBDA 4TQRA 4PPXA 4MFFA 4GXJA 4UAYA 4K4IA 3MFIA 5AKZA 1SWWA 4R8UB 3KHHA 1X6JA 5J8YC 4KLTA 1IM4A 2F44A 2MRLA 3TACB 2EH9A 4DLGA 4I29A 4P4PA 2EZYA 2HHVA 5DLGA 3UXOA 5DB7A 3TFSA 5L1LA 4NM1A 7ICMA 4DSIA 5HHHA 4TQSA 4ECSA 5HMLA 2W7PA 2W9BB 4K4GA 2K4HA 2WF8A 3SYZA 5AI9A 2F3NA 4UAWA 3H4BA 1MC8A 2KJ9A 3M9MB 4IQTA 4PHPA 1TK0A 5AI4A 4DFJA 4YR2A 2EQYA 3IG8A 4QIWF 1UT5A 3MBYA 2K60A 4PHDA 3HILA 4EYIB 1ZQLA 1QCKA 1T3NA 4FBTA 1NKBA 3MGHA 2BGWA 2AGOA 1S5LU 5J0XA 3FAHA 2B21A 2KP7A 1NK7A 5J0SA 2YN4A 2EDUA 2MSNA 3ONNA 4C7ZA 2HDOA 3BZKA 5JUMA 8ICXA 2C2RA 5C5JA 5L1KA 5CP2A 1NOMA 2HHWA 2Y0SF 5J2CA 1AQ6A 3OSPA 1QTMA 4BDPA 2J6TA 2LYHA 4DL2A 1ZQZA 1OW5A 4IR1A 5CWRA 4C80A 5KFVA 2ZJ5A 1FIQA 5D46A 2H3FA 1ZQDA 2HMXA 4DSJA 3ZD9A 5DBAA 4Q45A 2ZJ8A 5F3XB 4UAVA 2RQ5A 2HHTA 1X66A 2HBKA 9ICPA 5JRTA 1KN5A 9ICMA 3NTUA 1RG6A 1XC9A 5HR7A 5C0YA 3H8SA 1SKSA 1VDVA 5AM3A 2H3IA 3DV9A 1SL2A 4O3QA 4NV0A 7ICHA 4E0DA 1U9LA 2W3RA 2PFOA 1XSNA 4RT3A 5J0TA 1LVHA 4KLJA 2HHUA 5KFYA 1ZQHA 4Q8EA 1LB2B 4KX5A 4B9MA 2KJ5A 2P6RA 2OXOA 3TADC 3T3FA 1WCLA 2E1FA 5AKKA 2MUTA 2MUTB 5J2AA 2V4QA 3MDCA 4EBDA 3SEIA 4ECZA 3F2CA 1ZRNA 4OJ5A 2AJQA 2RRDA 2LYAA 4Z6DA 2E8OA 1X9XA 2DUYA 2WB1C 5EE3A 2BDPA 4CF5A 5AM4A 3GDXA 7ICFA 5AKJA 2A3VA 2C2DA 3HPOA 1MSWD 1ZQQA 5KFMA 3CNHA 2FPLA 3WK7A 5ALXA 3RJJA 4CRXA 4BWJA 4RQ3A 2E8PA 1T3QA 3ZDAA 1JRPA 3SMVA 4CCHA 2ES6A 4KLFA 5AIAA 1TAUA 2K4EA 5ALOA 3RAXA 4ED1A 4J03A 4IQVA 3F5AA 4DL3A 5F9LA 3QUCA 4P0QB 8ICPA 3R9KA 8ICUA 1Z3EB 2EAMA 4MF2A 5KG6A 1MQ3A 3WK8A 1U45A 4IRCA 3UMBA 2GO7A 3SV4A 4BGDA 4QZIA 2PFNA 3AN1A 2ZUCA 1Z1BA 4KN4A 5AKGA 3N28A 4P0PB 2KHQA 1N5WA 2FLNA 2D6FC 3PZPA 9ICTA 1Z1VA 4DO9A 9ICEA 2E1EA 4EEKA 4C4SA 1N5XA 3AQEA 4QWEA 4DL5A 3ICXA 4MHVA 1GO3F 4DOBA 3TAPA 1ZQOA 5ALIA 1TAQA 1K5OA 3JPRA 3MGVA 3EZ5A 1KW4A 5EWGA 1OUQA 3WK5A 5ALMA 2HOFA 2RP5A 3OHAA 2ISOA 3AEVA 2ESEA 2ZUBA 2KK0A 4QZBA 9ICRA 4OJPA 5ALKA 2IOFK 3K75D 2WF5A 9ICIA 3AM9A 3WKDA 2QARA 4DF8A 3OJUA 4CDGA 3H4DA 1UQVA 4USAA 2NRVA 1HUOA 5AICA 4RQ0A 2AH5A 5HR6A 4ECVA 4DFPA 4OO1J 2Q4TA 2WF7A 4CF3A 3QNMA 2KJ8A 5J2KA 1NJZA 1COOA 2L5YA 2EZXA 4C7YA 1NK4A 3GQCA 2OWOA 4GFJA 3PNCA 1HIWA 4ZOHC 3JPPA 4JUZA 2YTUA 3G6VA 1S0MA 2R8IA 1CEZA 4YQWA 2R8KA 2HHSA 8ICLA 3HWTA 2LBOA 2PMZC 3IG5A 4J9LA 4M6WB 3RJGA 3EPGA 4UASA 7ICSA 4IRKA 2K4IA 9ICNA 2N1RA 2WTFA 4AYBF 9ICUA 1XNSA 4B9VA 5G5GA 2BQRA 2W03A 3KOOA 1SXEA 4DSKA 3ALRA 2VA8A 3AU2A 3QUBA 2ZTDA 8ICTA 3SR6A 1YZ6A 3OJSA 4KLGA 3BQ7A 3QU9A 2KKVA 1ZQAA 4YG2A 3RH4A 7ICQA 1BVSA 2KTQA 2P6UA 4GIBA 1NJWA 4KMUA 4YR0A 3PX0A 1A0PA 4UB4A 1S76D 1D9FA 2QB0A 3TFRA 1BNOA 2XGQA 4DQPA 3RH5A 3QZ8A 2O6KA 4I2CA 3J81j 4P2HA 3CRXA 4GC7A 2K8CB 2KSOA 4JWNA 4KLLA 1L7MA 5ALPA 2BCUA 4F5PA 1HUZA 1ZQGA 3IV6A 3SZ2A 2EZZA 1U47A 4CF4A 1FFVA 2AGQA 3F53A 2ZTEA 5KFBA 4OCZA 3OPXA 1B22A 2QARB 2XY6A 2J6SA 4O5EA 4F50A 1OXJA 1UPHA 3BS7A 4YD2A 5BOLA 4A8EA 2WAQC 1SV0A 2G07A 4OJOA 1S0NA 4IRDA 2A1JA 4EX7A 1ZQJA 7ICJA 3ETRA 3C2LA 4OJLA 2EAPA 9ICKA 1KQQA 5J29A 3KHGA 4PJ0U 2CPRA 1QLNA 4QWCA 3RBEA 2K8AA 3QE9Y 1KKXA 5AKHA 2W9BA 3V6KA 3RH6A 7ICKA 3LWLA 3PW7A 3E2EA 1L7NA 3BQ2A 5DLFA 2Y9UA 2AQ4A 4PHAA 4YXJA 4QZCA 5J0YA 2BQ3A 5AK4A 4RNOA 3SAGA 4J9RA 2VA2A 1T4GA 3PR4A 2DKZA 5AI8A 1JN3A 2I6XA 4C4RA 4YN4A 3PSPA 4F4KA 1J2MA 4DFKA 4UARA 5DG9A 2P35A 4XUSA 3ZDEA 2ASDA 4OD0A 4DS4A 3V7JA 3IHQB 4FS2A 2M0NA 1RDFA 2H3ZA 2HBJA 4PGQA 5AIBA 1T94A 4RPXA 4X5VA 3GIMA 1ZJNA 3EW9A 3B0YA 4DLEA 4F4YA 4KLDA 9ICSA 4NL9A 2HBLA 1BGXT 2IMWP 3UMGA 3OHBA 2VJ5A 4FS1A 2BCVA 3V6JA 2HVIA 1VLBA 4KLHA 4UQGA 4BX9C 2YQEA 3EYZA 2LYBA 4QZ9A 5AK3A 3RTVA 2UVUA 4XA5A 2C22A 3MR3A 1B0XA 1KTQA 3Q8PB 4M9HA 4P4OA 4P0PA 1JX4A 3HT3A 2WB1F 4F93B 4PL1A 3Q8MA 1HEKA 4KITB 1UCVA 2Y1IA 5IIIA 4QWAA 1D8LA 2JR5A 5KT5A 3GIKA 5DBCA 4RPYA 1U4BA 2KD1A 5J8YA 3SENA 4PH5A 1SL1A 1Q46A 4Y2XA 4UAZA 2ASLA 1A77A 4P0QA 5HHIA 3PY8A 3K1ZA 2KFZA 5KT3A 4RT2A 2DGZA 3H40A 3EWAA 4EELA 4GLXA 2XY5A 2ALZA 1KFDA 4EEYA 8ICZA 1XU4A 3NRZA 1TK5A 2Z7JA 5DG8A 4B9NA 2XCPA 2NO4A 5B5EU 3WK4A 3PSTA 4DFMA 3F2BA 3RB4A 4C8NA 1AROP 2QB1A 2KMDA 2K89A 4FE3A 1QQ7A 5CJ7A 3UM9A 2BPGA 3V7KA 1L8LA 8ICYA 8ICVA 2XICA 3N4MB 2KKPA 1K1SA 3GZFA 1RXVA 4ZH4A 4B9LA 3AU6A 1ZJMA 1X9WA 1L5UA 4F4WA 3PSIA 2FJ6A 2K4PA 1SZPA 3LWMA 4ED3A 2B6GA 3WK9A 3RF9A 1L3VA 3UXNA 3VCBA 2JZBB 2LHTA 9ICFA 4C0ZA 1Z00A 2EANA 2KOBA 2LPEA 1N61A 3UMCA 4DF4A 2DPJA 1ZQVA 4EZ9A 4JV0A 5B66U 2JMGA 2JEIA 2KVSA 3MR5A 2A19A 5KFNA 4JV2A 5KG0A
chains in the Genus database with same CATH topology
2WB1F 1UPHA 4PL1A 1WUDA 4A8EA 4PL2A 1HEKA 2WAQC 4GFJA 1DRGA 2F2AB 2MRLA 2G07A 1HIWA 4OJOA 2YB1A 4ICAA 3CYMA 2XIDA 3LYSA 2HBKA 2KIWA 3F2DA 2E5SA 4OJLA 1L6NA 2ZIXA 3D2SA 3N7PD 2KD1A 2PMZF 5HR7A 5A0LA 2LBOA 3D2NA 2PMZC 3IG5A 5C0YA 1Q3VA 2XI9A 2Y0SC 4QNLA 1ECWA 2CPRA 2DQNB 2MA1A 2VJ4A 4OJ6A 1Z1BA 2OYYA 4FZNA 3T79A 3PSFA 2K8AA 4U6PA 2H3IA 2R18A 3E0FA 2XVTA 3LVVA 2KHQA 4P0QA 4P0PB 2ZXHA 2JGAA 3K1ZA 1Q3UA 2W04A 4FZMA 4CGZA 2W7PA 2WAQF 3D2QA 1PVPA 4NV0A 2K4IA 2ZIVA 2VKQA 2ZXIA 4QIWC 2N1RA 2K4HA 3PZPA 2DGZA 2F77X 5KL1B 4AYBF 2E1EA 2NV3A 2RHFA 4JMUA 2KJ9A 3AL0B 1ZQ1C 3AQFA 1XNSA 4P0QB 3AQEA 4O3MA 2W03A 3ICXA 2HOQA 2LKYA 2ZIXB 2KNJA 1GO3F 1F44A 2G06A 2OM6A 3SQIA 3ALRA 4KX5A 2Z7JA 3IG8A 4QIWF 3SAGA 4QJFB 2KJ5A 1IIPA 3NRWA 2OXOA 3M6KA 3MGVA 3C28A 3O0FA 2E1FA 4NLCA 3SAHA 2YB4A 3PSTA 1TAMA 2W7OA 5KL8B 3F2BA 3CP8A 3PSPA 1OUQA 3H0RB 2K89A 2ZIVB 3H0MB 4FE3A 2KKVA 4BJQA 3IN5A 3C29A 3F2CA 4KMOB 1XO0A 2HOFA 2RP5A 4OJ5A 5T14A 3H0LB 2ZIUA 2YX8A 2ZIUB 2JHDA 2G5HB 2KEYA 2RRDA 1NZBA 2LYAA 1CRXA 2H3QA 2XICA 3ONNA 1A0PA 4OJPA 2KKPA 3GZFA 2G08A 3GU3A 2M0NA 3DEEA 3IP4B 4NWIA 2H3ZA 4BUGA 5CRXA 4U7CA 4KX3A 1PVQA 2GOLA 3M6ZA 2WB1C 4NLBA 2JH7A 4WJ3B 2CN1A 1YT3A 2H3VA 2HBJA 3KZXA 1T94A 3PSIA 2K8BB 3F5EA 1ED1A 2GH1A 3VC8A 3HKZC 1MA7A 2A3VA 4CDGA 3CRXA 2D6FC 4AYBC 4IC9A 2ZIWB 2Y0SF 2K8CB 3RF9A 3N7SC 1Z19A 2HBLA 3RFAA 2F8LA 1SZHA 1URJA 3N7RC 3VCBA 1P7DA 1KBUA 2VJ5A 4CRXA 2ZG6A 2LHTA 4C0ZA 2KVCA 2G5IB 2VIXA 4ACOA 3SAFA 5HR6A 2KOBA 2KICA 2G09A 2HOIA 4OO1J 3SMVA 2Q4TA 4BX9C 2G0AA 2OH2A 2DF4B 4FZLA 2K4EA 2LYBA 2KJ8A 2KHVA 2F76X 2JH1A 3F53A 3L3FX 2JMGA 3NUQA 2BDUA 1A6SA 2CRXA 4P0PA 2KV2A 3OPXA 1D8BA 3F5AA 2H3FA 3M7DA 3HKZF 3KFUF 1PVRA 2ZIWA 3LVWA 2HBMA 2HMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VCB A;  3GZF A;  3VC8 A; 
#chains in the Genus database with same CATH topology
 4UBC A;  4P4M A;  4B9T A;  7ICL A;  2YB1 A;  4QZ8 A;  3LYS A;  2KIW A;  7ICN A;  3RJK A;  3F2D A;  2ZIX A;  1N48 A;  9ICG A;  2FI1 A;  3AMZ A;  3D2N A;  1S0V A;  2XI9 A;  4ECR A;  3MC1 A;  5KFQ A;  2OYY A;  1SKW A;  5L1J A;  3M8R A;  3IRU A;  1NKE A;  3RR8 A;  2DWQ A;  4J9K A;  3TI0 A;  3JPN A;  4UAT A;  1RQN A;  4F5Q A;  2VKQ A;  4QIW C;  2BZF A;  8ICQ A;  5D49 A;  5KG7 A;  2ASJ A;  2OEH A;  3AQF A;  5ALS A;  1UA1 A;  2W9C A;  5KFZ A;  3LDA A;  7ICV A;  4QZE A;  4J9S A;  4I2H A;  3K1R B;  3O0F A;  3U26 A;  1PK1 A;  8ICO A;  4M2Y A;  2QLT A;  3GV7 B;  1WWU A;  4IQW A;  3C21 A;  4DOC A;  4EZ6 A;  1ZRM A;  1Y88 A;  4EYH B;  2VA3 A;  4LVS A;  2HW3 A;  2ATL A;  3GU3 A;  3DEE A;  2PFP A;  2F1I A;  4Y2R A;  1KFS A;  2R8H A;  5ALT A;  2KIV A;  4QZD A;  3H8W A;  3IM1 A;  1HJP A;  3F5E A;  1TV9 A;  4KLM A;  4C8M A;  2BPC A;  1SKR A;  1ZOL A;  4EBE A;  1NZP A;  4UBB A;  1XWL A;  3FM9 A;  4ECU A;  1SZH A;  1URJ A;  4QZG A;  3DDH A;  9ICC A;  1LKY A;  2P66 A;  5L1I A;  1ZQW A;  4Z6C A;  4G9B A;  2BCR A;  2F76 X;  3M1Y A;  5ALZ A;  1ZET A;  4RPZ A;  4KLO A;  3M7D A;  5J2B A;  3GFK B;  1N56 A;  1RXW A;  1J2N A;  4MF8 A;  4R64 A;  4J9N A;  1ZQT A;  4RNM A;  4FBU A;  4PGX A;  5AM1 A;  5KG5 A;  4PZO A;  4RQ1 A;  4Y2V A;  2C2E A;  5AI0 A;  4DOA A;  2DBY A;  7ICP A;  4UW9 A;  2PMZ F;  2EAO A;  1KDH A;  1TK8 A;  3PMN A;  4UB2 A;  1S97 A;  1BPE A;  5EWE A;  3T5K A;  2R8J A;  4M0A A;  3V72 A;  8ICB A;  2ZIV A;  1KL9 A;  4JMU A;  4Y2Y A;  2ZIX B;  5HMM A;  9ICX A;  1L3T A;  5KFG A;  4ED0 A;  4F71 A;  2PFQ A;  1ZQC A;  8ICF A;  2RDJ A;  3SV3 A;  3CP8 A;  5CR0 A;  2LMR A;  5AKL A;  2FE9 A;  2AU0 A;  2JEG A;  3HP6 A;  3RJI A;  1QSY A;  3QZ7 A;  5J0O A;  2W43 A;  4MEY A;  3ORY A;  4XRH A;  1LKY B;  1CRX A;  3I28 A;  4OJ6 A;  2G08 A;  5E79 U;  1L3S A;  3ISB A;  3RR7 A;  4J9M A;  1FEZ A;  1KFT A;  2NRW A;  3N7R C;  1IG6 A;  1YZ7 A;  1Z4O A;  2H5X A;  4YXM A;  5AM5 A;  4F2R A;  2XCA A;  3BQT A;  4G3I A;  2WHE A;  1NK0 A;  2JH1 A;  4IR9 A;  4QZA A;  3WKC A;  1BPD A;  1S8O A;  2F1J A;  4M47 A;  3KFU F;  4ED2 A;  3LVW A;  5DKW A;  1A76 A;  1RM6 C;  3RJH A;  1ZD3 A;  8ICN A;  4I2I A;  4ICA A;  3QX7 A;  4Y2Q A;  5FP0 A;  4DWI A;  2F1H A;  3FYH A;  3D2S A;  3QUQ A;  3BDP A;  4QNL A;  3ZDB A;  3BJY A;  4J9Q A;  4FZN A;  1CUK A;  4U6P A;  3M9O B;  2HSZ A;  1Q3U A;  1BNP A;  3D2Q A;  1PVP A;  3PR5 B;  2HI0 A;  2LM1 A;  3ZD8 A;  4M9G A;  3C1Y A;  5ALE A;  5IIJ A;  4UB1 A;  4EEN A;  2JEJ A;  4Z6E A;  2G06 A;  8ICK A;  4M04 A;  4JB3 A;  2W9M A;  1C20 A;  1T7P A;  4I2A A;  2E8N A;  5AKE A;  4Y2T A;  1X9M A;  2JHD A;  5KT7 A;  1U49 A;  2LM4 A;  3HJE A;  9ICW A;  7ICT A;  3OTQ A;  5KNI A;  2HHX A;  4Z6F A;  1L3U A;  5ALG A;  1RYU A;  2JV3 A;  3AUO A;  1YT3 A;  4I2E A;  4B6J A;  4F8R A;  4YP3 A;  1ED1 A;  2GH1 A;  4YMN A;  1ZYQ A;  4C8L A;  4F5R A;  1DXS A;  1L7P A;  3QEA Z;  4NLG A;  1KBU A;  3CW2 C;  2G5I B;  3QU4 A;  2RDI A;  1NK9 A;  4NXZ A;  5GTI U;  3KD3 A;  1A6S A;  9ICA A;  1UA0 A;  2KV2 A;  2W54 A;  3JPS A;  1D8B A;  3D6J A;  5EOZ A;  4ELT A;  1ZD2 P;  5KT6 A;  4DS5 A;  2KSO B;  2DL0 A;  5KFE A;  5KG1 A;  1DRG A;  5IIN A;  4UB6 U;  3WKE A;  5KAI U;  3E58 A;  4NLZ A;  1WCN A;  5BOM A;  2KZZ A;  8ICI A;  4ELU A;  1ZQN A;  1XSP A;  1QH9 A;  4NJ8 A;  1SV0 C;  3RB6 A;  4O5K A;  4UB5 A;  3E0F A;  1IV8 A;  1ZQR A;  2DPI A;  3QEB Z;  4RUC A;  4JWM A;  2AXT U;  1KSP A;  2NRX A;  2WAQ F;  4ED8 A;  4Q43 A;  2ISP A;  4ECW A;  2A1J B;  1M6Y A;  4C8K A;  2ZJA A;  2KNJ A;  3MR2 A;  3BS5 B;  1L8O A;  1DGS A;  4I27 A;  5ALF A;  3MDA A;  3ZDC A;  4MFA A;  1N2X A;  1TAM A;  3C2M A;  3A0B U;  4I2B A;  3Q8S B;  4BXO B;  3IN5 A;  4BXO A;  4Q8F A;  5T14 A;  1QSL A;  4R65 A;  4J9P A;  9ICV A;  4NLK A;  3Q8Q B;  4B9S A;  2Y9T A;  3QXG A;  8ICE A;  3HX0 A;  3T5H A;  4Q44 A;  4C4T A;  4BUG A;  4U7C A;  3B0X A;  7ICU A;  2W3S A;  4NLB A;  2YMQ A;  5ALJ A;  5KAF U;  2JXJ A;  1PK1 B;  3TAD A;  5KG3 A;  1SWV A;  4AYB C;  4IC9 A;  3GV8 B;  1NKC A;  2IHM A;  4RZR A;  1S9F A;  1SB3 C;  1COK A;  2OHF A;  2B0C A;  4PZN A;  1V9P A;  2FLL A;  2KVC A;  4JV1 A;  1RYR A;  2F8K A;  1UHU A;  3GII A;  1RYS A;  1S10 A;  3QYP A;  1VJ5 A;  3HKZ F;  9ICJ A;  4IS7 A;  8ICC A;  4F72 A;  1JXE A;  2NYV A;  1DGJ A;  1BPY A;  1ZQB A;  2VAN A;  5L1M A;  3CYM A;  4UB3 A;  5AKX A;  8ICM A;  2E5S A;  1L6N A;  5ALH A;  3UPQ A;  9ICL A;  1S0O A;  5DQH A;  9ICB A;  4LZG A;  2YMP A;  2ZXH A;  4UB8 U;  3FC4 A;  4FZM A;  5KFU A;  4DL6 A;  1BPB A;  7ICR A;  5ALD A;  5KL1 B;  3OSN A;  2NV3 A;  1T8E A;  3EPI A;  3C5F A;  3MAB A;  5CHG A;  1J97 A;  2I5H A;  1BPX A;  4O0I A;  3QUT A;  3C28 A;  5JTI A;  2YB4 A;  1QSS A;  1F0M A;  1N60 A;  5KL8 B;  5ALV A;  2XGP A;  3H0R B;  3H7I A;  4KTQ A;  1NK6 A;  1ZQF A;  1DK3 A;  1O08 A;  2ZIU A;  3I1Y A;  3PV8 A;  3KZI U;  3KKA A;  3IP4 B;  5CRX A;  3PO5 A;  3IDW A;  4I2D A;  3KZX A;  4NL9 C;  4R8U A;  3GV5 B;  4FO6 A;  4KLQ A;  4ECT A;  8ICG A;  1ZQP A;  3JPO A;  4GXK A;  4YMO A;  2F8L A;  3TAR A;  3M9N B;  3TAQ A;  2E3T A;  2KIC A;  5KFH A;  4DCC A;  4US9 A;  4FZL A;  5AK5 A;  3KKA C;  3NUQ A;  3L3F X;  4PHE A;  3V6H A;  1JI7 A;  3TAN A;  4F91 B;  3S6J A;  2W9A A;  3UQ2 A;  4DQQ A;  3NS1 A;  2W55 A;  5J2J A;  2BCQ A;  4JK1 A;  4DL4 A;  8ICS A;  5AI5 A;  5AM2 A;  2PXI A;  1H38 A;  2IA6 A;  2IOH A;  2C28 A;  1XSL A;  3ZI4 A;  5DDY A;  4QWB A;  5J0Q A;  4YFK A;  2I9G A;  3C1Z A;  4DL7 A;  1MN8 A;  5J0W A;  4ECY A;  1Q3V A;  5KFK A;  5TZV A;  3RB3 A;  3T79 A;  2R18 A;  4M9L A;  3LVV A;  3RRG A;  4EX6 A;  2PKE A;  3WKB A;  4CGZ A;  4TUP A;  2FPK A;  4YVZ A;  2WFA A;  2J6U A;  5KG4 A;  1XS9 D;  5DQI A;  1KLN A;  2RHF A;  4RNN A;  4B9U A;  1KRP A;  3MFH A;  1ZQ1 C;  3Q8K A;  5ALN A;  2KN7 A;  2LKY A;  5AI6 A;  2KE7 A;  2IHN A;  5KFL A;  3ISD A;  5KFI A;  4US8 A;  1ZQY A;  4GXI A;  2OCE A;  2JRZ A;  4NLC A;  2W7O A;  2KZ3 A;  4RQ2 A;  3ZDD A;  4RQ5 A;  4KMO B;  4O9M A;  1FO4 A;  5ALR A;  2DFL A;  4HYK A;  3KHR A;  1JAL A;  3UXP A;  1N62 A;  2H3Q A;  4M9J A;  4F4Z A;  4NWI A;  3L4P A;  9ICO A;  2GWS A;  3M6Z A;  3WKA A;  4RQ8 A;  2H3V A;  5CB1 A;  4I2G A;  5CA7 A;  7ICG A;  4KLU A;  2ZIW B;  1Z19 A;  4DEZ A;  2UVV A;  4R66 A;  1Z00 B;  4O3P A;  4F4X A;  1TVA A;  2G0A A;  3T5L A;  5DGA A;  4PGY A;  4I28 A;  5ALQ A;  4Y2J A;  5DDM A;  5ALU A;  1NNL A;  4LZD A;  1ZQK A;  5KT4 A;  3PW5 A;  4UAU A;  1ZQS A;  5J2I A;  4AP9 A;  5IIM A;  1C7Y A;  1PZN A;  5IIK A;  1FFU A;  1V97 A;  1D9D A;  1DK2 A;  5D4B A;  3NVW A;  8ICH A;  3ISC A;  2R8G A;  1PK3 A;  8ICJ A;  3BQ0 A;  2VJ4 A;  2DQN B;  2JEF A;  4HAI A;  4QZH A;  4F92 B;  3RRH A;  1Q8K A;  2MAX A;  4O3N A;  4DFD A;  5EE1 A;  1U48 A;  2FDR A;  2F77 X;  1WYG A;  3WU2 U;  3PW2 A;  3AL0 B;  4O3M A;  7ICE A;  4YD1 A;  4XQ8 A;  2M9N A;  1QQ5 A;  2W8K A;  5BPC A;  3PVX A;  5L9X A;  5J2F A;  5EE9 A;  4Y2S A;  2BCS A;  5KFS A;  9ICQ A;  4M6W A;  3JPQ A;  4KLS A;  5J0P A;  3ETL A;  1X42 A;  2FMS A;  5J0U A;  1V38 A;  1X40 A;  1XO0 A;  4BJQ A;  3C29 A;  3QU7 A;  4O3R A;  5KFD A;  2G5H B;  2A1A A;  2JZB A;  3MR6 A;  1WWV A;  5DBB A;  4CE6 A;  7ICI A;  2AHO B;  2HHQ A;  1PVQ A;  2V9W A;  5DB8 A;  1CI4 A;  1DOQ A;  2HVH A;  3VC8 A;  3HKZ C;  4GC6 A;  2BQU A;  1MA7 A;  2KZM A;  1NI3 A;  3NVZ A;  1ZXI A;  1ZD5 A;  4ED6 A;  5KFW A;  3NAS A;  2I1Q A;  3Q8L A;  4O3S A;  4F5O A;  1X6I A;  2DF4 B;  1NJY A;  3PW0 A;  2KHV A;  2BDU A;  4RQ7 A;  2FMQ A;  3MGI A;  1XO1 A;  5KFP A;  1SV4 A;  2ZIW A;  5J2D A;  5H2F U;  4RUA A;  2WF6 A;  2BR0 A;  1KEJ A;  1RZT A;  5TIS U;  3T5J A;  1JIH A;  3LK9 A;  2ZUD A;  2BHN A;  3TQ1 A;  2KG5 A;  3N7P D;  4DQR A;  5AK6 A;  5KFJ A;  4QWD A;  1ECW A;  2MA1 A;  3KBB A;  3RJF A;  2JGA A;  2W04 A;  2NRZ A;  5EWF A;  2ZTC A;  2DKX A;  7ICO A;  2NO5 A;  1NK5 A;  4RU9 A;  2QKQ A;  4RQ6 A;  3PX6 A;  4MEX A;  2HOQ A;  4DSL A;  1F44 A;  4C8O A;  3SQI A;  5DB9 A;  3V7L A;  1MQ2 A;  2W8L A;  4QJF B;  3HRD D;  2IBK A;  1JMS A;  2YMM A;  3G6Y A;  3M6K A;  3NGD A;  3SAH A;  4RQM A;  3K4G A;  5KFT A;  3GIL A;  2V4R A;  3I76 A;  4ECX A;  4MFC A;  1N63 A;  2ODG A;  4NM2 A;  8ICR A;  3N97 B;  5DG7 A;  5GTH U;  1TE2 A;  3BZC A;  5DB6 A;  2FPM A;  4DSE A;  1NZB A;  2YML A;  2BKE A;  8ICA A;  1V85 A;  4QW9 A;  4KX3 A;  4WJ3 B;  3WK6 A;  5ALY A;  2W11 A;  3PO4 A;  1RPL A;  2PI4 A;  4R63 A;  1SXD A;  1ZQX A;  3FDS A;  4J9O A;  1X2I A;  3NVY A;  4O3O A;  3RFA A;  3C5G A;  5F9N A;  9ICH A;  3NVV A;  2UVR A;  4IL6 U;  2VIX A;  2HOI A;  3UQ0 A;  2OH2 A;  3RJE A;  2YY6 A;  1WG8 A;  3SD7 A;  2CRX A;  1Z4N A;  1RQL A;  1WUD A;  1X9S A;  4PL2 A;  2F2A B;  3G6X A;  4M9N A;  1B43 A;  2XID A;  2XC9 A;  5A0L A;  2FMP A;  3PSF A;  3C2K A;  2XVT A;  3B9J A;  3RB0 A;  2D8C A;  3THV A;  1JUD A;  4YR3 A;  4BWM A;  5KTQ A;  5EE0 A;  5K4L A;  4CNQ A;  4TUS A;  2D3D A;  2FLP A;  3KHL A;  2QB0 B;  1IIP A;  5KG2 A;  4RQ4 A;  1PUZ A;  3QU2 A;  2MU2 A;  1D8Y A;  1JXL A;  3TKA A;  5ALL A;  2ZIV B;  2HCF A;  5JU5 A;  4ELV A;  5AKI A;  3H0L B;  2IOF A;  2YX8 A;  4TUQ A;  3A0H U;  1TKD A;  2ZIU B;  5DQG A;  1BPZ A;  2KEY A;  5AHX A;  3M8S A;  3JPT A;  3RAQ A;  1UT8 A;  4QW8 A;  2CN1 A;  5KT2 A;  2AGP A;  2KFN A;  5IIO A;  4O5C A;  4Y2U A;  2Q0Z X;  3N7S C;  3PW4 A;  4Y2P A;  1L7O A;  4LJX A;  1P7D A;  1IXR A;  4ACO A;  4DQS A;  5AKY A;  4KN7 A;  1TFR A;  4FFD A;  5HNK A;  3C23 A;  1ZQM A;  2CXY A;  5KFA A;  2XO7 A;  4KLI A;  3GIJ A;  3HW8 A;  3SI8 A;  5J2E A;  1PVR A;  2Y1J A;  4EBC A;  5KFX A;  1O03 A;  2HBM A;  4I2F A;  3L5K A;  2WF9 A;  5KFR A;  1EXN A;  2XY7 A;  4F2S A;  3KTQ A;  1ZQI A;  1ZQE A;  4RQN A;  5J2H A;  1NK8 A;  5J0R A;  5G5H A;  3OGU A;  2W9C B;  4DSF A;  2E8M A;  5KFF A;  1S77 D;  4DQI A;  5ALW A;  2Y0S C;  1B4F A;  5AM0 A;  2NRT A;  1F5S A;  1ZQU A;  2UVW A;  4ECQ A;  1K1Q A;  5KFO A;  2ZXI A;  2AQ0 A;  4YCX A;  3EUB 2;  4QZF A;  3H8J A;  4ED7 A;  5CEH A;  3QU5 A;  2OM6 A;  4K4H A;  3PX4 A;  3BS5 A;  4YMM A;  3NRW A;  5J2G A;  3BQ1 A;  1NJX A;  1ZD4 A;  4KLE A;  3H0M B;  2GLE A;  4NLN A;  5DGB A;  1JRO A;  2BPF A;  4IQU A;  4F3O A;  1QQ6 A;  2GOL A;  2JH7 A;  5KFC A;  4TUR A;  2RLT A;  1SGG A;  3ED5 A;  2K8B B;  5IIL A;  4F5N A;  4I2J A;  3Q8R B;  3H8M A;  2LI6 A;  5HP4 A;  1SL0 A;  3PML A;  1LV5 A;  2ZG6 A;  1SIJ A;  2PI5 A;  4NY8 A;  3SAF A;  2G09 A;  8ICW A;  3RBD A;  4TQR A;  4PPX A;  4MFF A;  4GXJ A;  4UAY A;  4K4I A;  3MFI A;  5AKZ A;  1SWW A;  4R8U B;  3KHH A;  1X6J A;  5J8Y C;  4KLT A;  1IM4 A;  2F44 A;  2MRL A;  3TAC B;  2EH9 A;  4DLG A;  4I29 A;  4P4P A;  2EZY A;  2HHV A;  5DLG A;  3UXO A;  5DB7 A;  3TFS A;  5L1L A;  4NM1 A;  7ICM A;  4DSI A;  5HHH A;  4TQS A;  4ECS A;  5HML A;  2W7P A;  2W9B B;  4K4G A;  2K4H A;  2WF8 A;  3SYZ A;  5AI9 A;  2F3N A;  4UAW A;  3H4B A;  1MC8 A;  2KJ9 A;  3M9M B;  4IQT A;  4PHP A;  1TK0 A;  5AI4 A;  4DFJ A;  4YR2 A;  2EQY A;  3IG8 A;  4QIW F;  1UT5 A;  3MBY A;  2K60 A;  4PHD A;  3HIL A;  4EYI B;  1ZQL A;  1QCK A;  1T3N A;  4FBT A;  1NKB A;  3MGH A;  2BGW A;  2AGO A;  1S5L U;  5J0X A;  3FAH A;  2B21 A;  2KP7 A;  1NK7 A;  5J0S A;  2YN4 A;  2EDU A;  2MSN A;  3ONN A;  4C7Z A;  2HDO A;  3BZK A;  5JUM A;  8ICX A;  2C2R A;  5C5J A;  5L1K A;  5CP2 A;  1NOM A;  2HHW A;  2Y0S F;  5J2C A;  1AQ6 A;  3OSP A;  1QTM A;  4BDP A;  2J6T A;  2LYH A;  4DL2 A;  1ZQZ A;  1OW5 A;  4IR1 A;  5CWR A;  4C80 A;  5KFV A;  2ZJ5 A;  1FIQ A;  5D46 A;  2H3F A;  1ZQD A;  2HMX A;  4DSJ A;  3ZD9 A;  5DBA A;  4Q45 A;  2ZJ8 A;  5F3X B;  4UAV A;  2RQ5 A;  2HHT A;  1X66 A;  2HBK A;  9ICP A;  5JRT A;  1KN5 A;  9ICM A;  3NTU A;  1RG6 A;  1XC9 A;  5HR7 A;  5C0Y A;  3H8S A;  1SKS A;  1VDV A;  5AM3 A;  2H3I A;  3DV9 A;  1SL2 A;  4O3Q A;  4NV0 A;  7ICH A;  4E0D A;  1U9L A;  2W3R A;  2PFO A;  1XSN A;  4RT3 A;  5J0T A;  1LVH A;  4KLJ A;  2HHU A;  5KFY A;  1ZQH A;  4Q8E A;  1LB2 B;  4KX5 A;  4B9M A;  2KJ5 A;  2P6R A;  2OXO A;  3TAD C;  3T3F A;  1WCL A;  2E1F A;  5AKK A;  2MUT A;  2MUT B;  5J2A A;  2V4Q A;  3MDC A;  4EBD A;  3SEI A;  4ECZ A;  3F2C A;  1ZRN A;  4OJ5 A;  2AJQ A;  2RRD A;  2LYA A;  4Z6D A;  2E8O A;  1X9X A;  2DUY A;  2WB1 C;  5EE3 A;  2BDP A;  4CF5 A;  5AM4 A;  3GDX A;  7ICF A;  5AKJ A;  2A3V A;  2C2D A;  3HPO A;  1MSW D;  1ZQQ A;  5KFM A;  3CNH A;  2FPL A;  3WK7 A;  5ALX A;  3RJJ A;  4CRX A;  4BWJ A;  4RQ3 A;  2E8P A;  1T3Q A;  3ZDA A;  1JRP A;  3SMV A;  4CCH A;  2ES6 A;  4KLF A;  5AIA A;  1TAU A;  2K4E A;  5ALO A;  3RAX A;  4ED1 A;  4J03 A;  4IQV A;  3F5A A;  4DL3 A;  5F9L A;  3QUC A;  4P0Q B;  8ICP A;  3R9K A;  8ICU A;  1Z3E B;  2EAM A;  4MF2 A;  5KG6 A;  1MQ3 A;  3WK8 A;  1U45 A;  4IRC A;  3UMB A;  2GO7 A;  3SV4 A;  4BGD A;  4QZI A;  2PFN A;  3AN1 A;  2ZUC A;  1Z1B A;  4KN4 A;  5AKG A;  3N28 A;  4P0P B;  2KHQ A;  1N5W A;  2FLN A;  2D6F C;  3PZP A;  9ICT A;  1Z1V A;  4DO9 A;  9ICE A;  2E1E A;  4EEK A;  4C4S A;  1N5X A;  3AQE A;  4QWE A;  4DL5 A;  3ICX A;  4MHV A;  1GO3 F;  4DOB A;  3TAP A;  1ZQO A;  5ALI A;  1TAQ A;  1K5O A;  3JPR A;  3MGV A;  3EZ5 A;  1KW4 A;  5EWG A;  1OUQ A;  3WK5 A;  5ALM A;  2HOF A;  2RP5 A;  3OHA A;  2ISO A;  3AEV A;  2ESE A;  2ZUB A;  2KK0 A;  4QZB A;  9ICR A;  4OJP A;  5ALK A;  2IOF K;  3K75 D;  2WF5 A;  9ICI A;  3AM9 A;  3WKD A;  2QAR A;  4DF8 A;  3OJU A;  4CDG A;  3H4D A;  1UQV A;  4USA A;  2NRV A;  1HUO A;  5AIC A;  4RQ0 A;  2AH5 A;  5HR6 A;  4ECV A;  4DFP A;  4OO1 J;  2Q4T A;  2WF7 A;  4CF3 A;  3QNM A;  2KJ8 A;  5J2K A;  1NJZ A;  1COO A;  2L5Y A;  2EZX A;  4C7Y A;  1NK4 A;  3GQC A;  2OWO A;  4GFJ A;  3PNC A;  1HIW A;  4ZOH C;  3JPP A;  4JUZ A;  2YTU A;  3G6V A;  1S0M A;  2R8I A;  1CEZ A;  4YQW A;  2R8K A;  2HHS A;  8ICL A;  3HWT A;  2LBO A;  2PMZ C;  3IG5 A;  4J9L A;  4M6W B;  3RJG A;  3EPG A;  4UAS A;  7ICS A;  4IRK A;  2K4I A;  9ICN A;  2N1R A;  2WTF A;  4AYB F;  9ICU A;  1XNS A;  4B9V A;  5G5G A;  2BQR A;  2W03 A;  3KOO A;  1SXE A;  4DSK A;  3ALR A;  2VA8 A;  3AU2 A;  3QUB A;  2ZTD A;  8ICT A;  3SR6 A;  1YZ6 A;  3OJS A;  4KLG A;  3BQ7 A;  3QU9 A;  2KKV A;  1ZQA A;  4YG2 A;  3RH4 A;  7ICQ A;  1BVS A;  2KTQ A;  2P6U A;  4GIB A;  1NJW A;  4KMU A;  4YR0 A;  3PX0 A;  1A0P A;  4UB4 A;  1S76 D;  1D9F A;  2QB0 A;  3TFR A;  1BNO A;  2XGQ A;  4DQP A;  3RH5 A;  3QZ8 A;  2O6K A;  4I2C A;  3J81 j;  4P2H A;  3CRX A;  4GC7 A;  2K8C B;  2KSO A;  4JWN A;  4KLL A;  1L7M A;  5ALP A;  2BCU A;  4F5P A;  1HUZ A;  1ZQG A;  3IV6 A;  3SZ2 A;  2EZZ A;  1U47 A;  4CF4 A;  1FFV A;  2AGQ A;  3F53 A;  2ZTE A;  5KFB A;  4OCZ A;  3OPX A;  1B22 A;  2QAR B;  2XY6 A;  2J6S A;  4O5E A;  4F50 A;  1OXJ A;  1UPH A;  3BS7 A;  4YD2 A;  5BOL A;  4A8E A;  2WAQ C;  1SV0 A;  2G07 A;  4OJO A;  1S0N A;  4IRD A;  2A1J A;  4EX7 A;  1ZQJ A;  7ICJ A;  3ETR A;  3C2L A;  4OJL A;  2EAP A;  9ICK A;  1KQQ A;  5J29 A;  3KHG A;  4PJ0 U;  2CPR A;  1QLN A;  4QWC A;  3RBE A;  2K8A A;  3QE9 Y;  1KKX A;  5AKH A;  2W9B A;  3V6K A;  3RH6 A;  7ICK A;  3LWL A;  3PW7 A;  3E2E A;  1L7N A;  3BQ2 A;  5DLF A;  2Y9U A;  2AQ4 A;  4PHA A;  4YXJ A;  4QZC A;  5J0Y A;  2BQ3 A;  5AK4 A;  4RNO A;  3SAG A;  4J9R A;  2VA2 A;  1T4G A;  3PR4 A;  2DKZ A;  5AI8 A;  1JN3 A;  2I6X A;  4C4R A;  4YN4 A;  3PSP A;  4F4K A;  1J2M A;  4DFK A;  4UAR A;  5DG9 A;  2P35 A;  4XUS A;  3ZDE A;  2ASD A;  4OD0 A;  4DS4 A;  3V7J A;  3IHQ B;  4FS2 A;  2M0N A;  1RDF A;  2H3Z A;  2HBJ A;  4PGQ A;  5AIB A;  1T94 A;  4RPX A;  4X5V A;  3GIM A;  1ZJN A;  3EW9 A;  3B0Y A;  4DLE A;  4F4Y A;  4KLD A;  9ICS A;  4NL9 A;  2HBL A;  1BGX T;  2IMW P;  3UMG A;  3OHB A;  2VJ5 A;  4FS1 A;  2BCV A;  3V6J A;  2HVI A;  1VLB A;  4KLH A;  4UQG A;  4BX9 C;  2YQE A;  3EYZ A;  2LYB A;  4QZ9 A;  5AK3 A;  3RTV A;  2UVU A;  4XA5 A;  2C22 A;  3MR3 A;  1B0X A;  1KTQ A;  3Q8P B;  4M9H A;  4P4O A;  4P0P A;  1JX4 A;  3HT3 A;  2WB1 F;  4F93 B;  4PL1 A;  3Q8M A;  1HEK A;  4KIT B;  1UCV A;  2Y1I A;  5III A;  4QWA A;  1D8L A;  2JR5 A;  5KT5 A;  3GIK A;  5DBC A;  4RPY A;  1U4B A;  2KD1 A;  5J8Y A;  3SEN A;  4PH5 A;  1SL1 A;  1Q46 A;  4Y2X A;  4UAZ A;  2ASL A;  1A77 A;  4P0Q A;  5HHI A;  3PY8 A;  3K1Z A;  2KFZ A;  5KT3 A;  4RT2 A;  2DGZ A;  3H40 A;  3EWA A;  4EEL A;  4GLX A;  2XY5 A;  2ALZ A;  1KFD A;  4EEY A;  8ICZ A;  1XU4 A;  3NRZ A;  1TK5 A;  2Z7J A;  5DG8 A;  4B9N A;  2XCP A;  2NO4 A;  5B5E U;  3WK4 A;  3PST A;  4DFM A;  3F2B A;  3RB4 A;  4C8N A;  1ARO P;  2QB1 A;  2KMD A;  2K89 A;  4FE3 A;  1QQ7 A;  5CJ7 A;  3UM9 A;  2BPG A;  3V7K A;  1L8L A;  8ICY A;  8ICV A;  2XIC A;  3N4M B;  2KKP A;  1K1S A;  3GZF A;  1RXV A;  4ZH4 A;  4B9L A;  3AU6 A;  1ZJM A;  1X9W A;  1L5U A;  4F4W A;  3PSI A;  2FJ6 A;  2K4P A;  1SZP A;  3LWM A;  4ED3 A;  2B6G A;  3WK9 A;  3RF9 A;  1L3V A;  3UXN A;  3VCB A;  2JZB B;  2LHT A;  9ICF A;  4C0Z A;  1Z00 A;  2EAN A;  2KOB A;  2LPE A;  1N61 A;  3UMC A;  4DF4 A;  2DPJ A;  1ZQV A;  4EZ9 A;  4JV0 A;  5B66 U;  2JMG A;  2JEI A;  2KVS A;  3MR5 A;  2A19 A;  5KFN A;  4JV2 A;  5KG0 A; 
#chains in the Genus database with same CATH homology
 2WB1 F;  1UPH A;  4PL1 A;  1WUD A;  4A8E A;  4PL2 A;  1HEK A;  2WAQ C;  4GFJ A;  1DRG A;  2F2A B;  2MRL A;  2G07 A;  1HIW A;  4OJO A;  2YB1 A;  4ICA A;  3CYM A;  2XID A;  3LYS A;  2HBK A;  2KIW A;  3F2D A;  2E5S A;  4OJL A;  1L6N A;  2ZIX A;  3D2S A;  3N7P D;  2KD1 A;  2PMZ F;  5HR7 A;  5A0L A;  2LBO A;  3D2N A;  2PMZ C;  3IG5 A;  5C0Y A;  1Q3V A;  2XI9 A;  2Y0S C;  4QNL A;  1ECW A;  2CPR A;  2DQN B;  2MA1 A;  2VJ4 A;  4OJ6 A;  1Z1B A;  2OYY A;  4FZN A;  3T79 A;  3PSF A;  2K8A A;  4U6P A;  2H3I A;  2R18 A;  3E0F A;  2XVT A;  3LVV A;  2KHQ A;  4P0Q A;  4P0P B;  2ZXH A;  2JGA A;  3K1Z A;  1Q3U A;  2W04 A;  4FZM A;  4CGZ A;  2W7P A;  2WAQ F;  3D2Q A;  1PVP A;  4NV0 A;  2K4I A;  2ZIV A;  2VKQ A;  2ZXI A;  4QIW C;  2N1R A;  2K4H A;  3PZP A;  2DGZ A;  2F77 X;  5KL1 B;  4AYB F;  2E1E A;  2NV3 A;  2RHF A;  4JMU A;  2KJ9 A;  3AL0 B;  1ZQ1 C;  3AQF A;  1XNS A;  4P0Q B;  3AQE A;  4O3M A;  2W03 A;  3ICX A;  2HOQ A;  2LKY A;  2ZIX B;  2KNJ A;  1GO3 F;  1F44 A;  2G06 A;  2OM6 A;  3SQI A;  3ALR A;  4KX5 A;  2Z7J A;  3IG8 A;  4QIW F;  3SAG A;  4QJF B;  2KJ5 A;  1IIP A;  3NRW A;  2OXO A;  3M6K A;  3MGV A;  3C28 A;  3O0F A;  2E1F A;  4NLC A;  3SAH A;  2YB4 A;  3PST A;  1TAM A;  2W7O A;  5KL8 B;  3F2B A;  3CP8 A;  3PSP A;  1OUQ A;  3H0R B;  2K89 A;  2ZIV B;  3H0M B;  4FE3 A;  2KKV A;  4BJQ A;  3IN5 A;  3C29 A;  3F2C A;  4KMO B;  1XO0 A;  2HOF A;  2RP5 A;  4OJ5 A;  5T14 A;  3H0L B;  2ZIU A;  2YX8 A;  2ZIU B;  2JHD A;  2G5H B;  2KEY A;  2RRD A;  1NZB A;  2LYA A;  1CRX A;  2H3Q A;  2XIC A;  3ONN A;  1A0P A;  4OJP A;  2KKP A;  3GZF A;  2G08 A;  3GU3 A;  2M0N A;  3DEE A;  3IP4 B;  4NWI A;  2H3Z A;  4BUG A;  5CRX A;  4U7C A;  4KX3 A;  1PVQ A;  2GOL A;  3M6Z A;  2WB1 C;  4NLB A;  2JH7 A;  4WJ3 B;  2CN1 A;  1YT3 A;  2H3V A;  2HBJ A;  3KZX A;  1T94 A;  3PSI A;  2K8B B;  3F5E A;  1ED1 A;  2GH1 A;  3VC8 A;  3HKZ C;  1MA7 A;  2A3V A;  4CDG A;  3CRX A;  2D6F C;  4AYB C;  4IC9 A;  2ZIW B;  2Y0S F;  2K8C B;  3RF9 A;  3N7S C;  1Z19 A;  2HBL A;  3RFA A;  2F8L A;  1SZH A;  1URJ A;  3N7R C;  3VCB A;  1P7D A;  1KBU A;  2VJ5 A;  4CRX A;  2ZG6 A;  2LHT A;  4C0Z A;  2KVC A;  2G5I B;  2VIX A;  4ACO A;  3SAF A;  5HR6 A;  2KOB A;  2KIC A;  2G09 A;  2HOI A;  4OO1 J;  3SMV A;  2Q4T A;  4BX9 C;  2G0A A;  2OH2 A;  2DF4 B;  4FZL A;  2K4E A;  2LYB A;  2KJ8 A;  2KHV A;  2F76 X;  2JH1 A;  3F53 A;  3L3F X;  2JMG A;  3NUQ A;  2BDU A;  1A6S A;  2CRX A;  4P0P A;  2KV2 A;  3OPX A;  1D8B A;  3F5A A;  2H3F A;  3M7D A;  3HKZ F;  3KFU F;  1PVR A;  2ZIW A;  3LVW A;  2HBM A;  2HMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...