3VC8A

Crystal structure of the c-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus a59
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
TFEEMALTTFMITKESYCKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus A59.
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
molecule keywords RNA-directed RNA polymerase
total genus 28
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3vc8A00
3VCBA 3GZFA 3VC8A
chains in the Genus database with same CATH superfamily
2GH1A 9ICHA 1X9WA 2ESEA 3ZD9A 4Y2PA 5DLGA 4CF5A 1MC8A 2JH1A 3BQ1A 4CGZA 2ZJ5A 1WUDA 4K4GA 5KFFA 5JRTA 1XSLA 5KT6A 3TAQA 1Z3EB 2FI1A 3ED5A 4UB3A 3KZIU 5CRXA 2MSNA 2WTFA 1T4GA 2EQYA 2IHNA 4J9KA 1YZ7A 2KZZA 8ICHA 2K8AA 3QEBZ 3NVZA 5BOLA 1QH9A 1B0XA 2KKPA 1D8YA 1ZYQA 2KN7A 4KMOB 4DLEA 3EZ5A 2RLTA 3DEEA 3TADC 4HAIA 4UAWA 4ECYA 3GIIA 1IM4A 1WWVA 1Z1BA 4M6WA 1A6SA 3RJKA 4Q45A 5J2AA 2LM1A 2W9AA 7ICSA 3ISBA 4BGDA 4ECZA 1ZQKA 4NLBA 2B6GA 4F8RA 4KLUA 5ALHA 1SL0A 3H8JA 5EOZA 4I2CA 1OUQA 4I2IA 5J0WA 1NK4A 5KFOA 7ICKA 4KITB 5DDMA 3GQCA 4UAVA 3HRDD 3WK8A 3UXPA 1CEZA 3E58A 3QU4A 2ZTEA 3JPQA 4YP3A 3PY8A 3AUOA 4NL9C 4P0QA 4Y2XA 1QSLA 2KSOA 1ZQNA 2B21A 2HBKA 1F0MA 2DFLA 1N63A 4Y2TA 4EYIB 5KT3A 5ALEA 8ICEA 3PV8A 1TAUA 4F4XA 2EDUA 4RQ3A 3JPTA 1N60A 2KK0A 1EXNA 5J0PA 1ZOLA 4J9PA 1SWWA 1TK5A 1JX4A 2NRWA 4DQSA 9ICBA 3LVVA 2AQ4A 5KT7A 4O3PA 5KG1A 4ELTA 3A0HU 1U47A 2K4IA 9ICAA 3GIKA 4KX5A 4JK1A 5DB6A 2A19A 2BQRA 1SGGA 4GFJA 3H0MB 2KFNA 4RQMA 5A0LA 3PX6A 1ZETA 1ZQDA 8ICUA 8ICCA 2JEGA 2WFAA 4RT3A 2NRZA 4QZCA 3RB4A 3UMCA 3RB6A 3RB3A 1SKRA 7ICOA 5KFVA 1B4FA 3M8SA 1D8LA 3C1ZA 2E1FA 4ZOHC 4Z6CA 3TI0A 2FDRA 2OYYA 2ZG6A 3NASA 3AMZA 3NRWA 2QARB 3HP6A 3M6KA 1RPLA 2AGPA 4KLTA 2W3SA 5ALGA 3PW5A 5C0YA 8ICVA 2EZZA 4UAUA 1RXVA 3B0YA 2C28A 5DKWA 4M9HA 4O9MA 5G5HA 4KLJA 3PO4A 1L3VA 3ZD8A 4Q8FA 5EE1A 4J03A 4IR9A 1NK6A 1J2NA 3MFIA 1U48A 3KHLA 1ZD3A 2F8LA 2H3QA 4F5QA 3RRHA 3Q8SB 1ZQBA 5BPCA 2YB4A 1SWVA 3MR2A 3QUBA 3GV7B 2HBMA 5J0TA 4EELA 2KJ9A 5AI4A 4I2HA 2ISPA 4DF8A 1LB2B 4M6WB 4GC6A 4DSKA 5ALXA 3ZDEA 4F5PA 4QZAA 5KFAA 5DDYA 2P35A 1KLNA 2PMZF 2K60A 2NV3A 4M04A 1IV8A 4ACOA 1JIHA 2RQ5A 5HMLA 4QZ9A 4DS4A 1X66A 2WF7A 1L7MA 2DF4B 2LI6A 2LKYA 3GV8B 4IQTA 4WJ3B 2HOQA 1T3QA 3HJEA 3NTUA 2KIVA 1KQQA 5KFPA 1SB3C 2JZBA 4UAYA 4PHEA 4DFDA 7ICUA 4ELVA 2H5XA 3QNMA 3TACB 5KG6A 8ICYA 3BDPA 4GLXA 5KFHA 4R64A 5DQIA 2MRLA 2RRDA 5KFRA 4C8MA 4RNMA 4Z6FA 1NK7A 3N7PD 5ALTA 5AI8A 1DRGA 5ALOA 4PL2A 4O3NA 1XO0A 4NM2A 4K4IA 4C4SA 4EEYA 4DWIA 2MA1A 5L1MA 9ICJA 3N97B 2M9NA 3ZDAA 4F92B 4MFCA 2W54A 2HHSA 2KZMA 4DL7A 4UB8U 4I2JA 3GFKB 2R8KA 1KTQA 5ALZA 4OD0A 4RPYA 2ZIVA 4YD1A 4QZDA 4DO9A 2GO7A 2FMPA 2KEYA 1IXRA 1HUOA 2G09A 1S0NA 1DOQA 4KLEA 4C7ZA 1X40A 4XUSA 5AKKA 1TV9A 5KFMA 1ZRNA 4JB3A 7ICRA 1CI4A 4EX6A 5KFNA 4PGXA 4F5OA 5JU5A 2HCFA 5KFXA 1QSYA 9ICQA 2BR0A 1PVRA 4MEXA 4JWNA 3UXOA 3MR6A 2HHWA 4I27A 4YQWA 2FLLA 4Y2YA 2R8HA 3CP8A 1FFVA 1SV4A 3OTQA 4M9JA 3JPNA 4NLNA 4QZGA 2KVCA 2PI5A 4TURA 4NLKA 2EAPA 4KMUA 4QIWC 3ETRA 1WG8A 3H0RB 2YX8A 1Y88A 3K1ZA 5EE9A 1ZQMA 4ED2A 3HWTA 2OH2A 3T5HA 2VJ5A 4QNLA 7ICLA 2JH7A 3SAFA 3C5FA 4R8UA 4YR3A 4F91B 1ZQTA 4F5RA 2E3TA 2Q4TA 5D49A 1TAQA 1ZQLA 1LV5A 3D2QA 4RQ1A 5J0XA 4RUCA 2R8GA 3F2BA 2PFQA 1T94A 1L5UA 3V72A 4C0ZA 5KFCA 1V38A 4PZOA 4RQ5A 9ICMA 1H38A 2PFNA 3OSNA 4R66A 4QIWF 2C2DA 9ICGA 4ECXA 2KNJA 3I76A 1RM6C 2F77X 1S0VA 3N7RC 2XICA 2ZIUA 3VC8A 2KMDA 4EEKA 4FO6A 2KVSA 2XVTA 1N56A 2RP5A 7ICFA 2VKQA 1O08A 1PK3A 4YR0A 2F1HA 3WK6A 1SV0C 3MGVA 3B9JA 2BCVA 1ZQRA 1BPYA 2JR5A 1RYRA 1PUZA 5CEHA 5L1KA 3NGDA 4UB5A 3EW9A 1ZQYA 4C8KA 4C8NA 1XU4A 5B5EU 1KFTA 5F9LA 3V7LA 3RJFA 2PI4A 2W55A 5ALFA 4BXOA 1ED1A 4KLFA 5KG0A 4B9MA 1Q46A 8ICJA 2BQUA 1UHUA 2LBOA 1X6IA 2FLPA 3WKBA 1V9PA 4F50A 4RQ2A 5DG8A 2LYHA 4ED0A 1ZJNA 3M9NB 4LVSA 8ICXA 2ZUCA 2FPMA 3BZCA 1KFDA 1DXSA 4UASA 1UPHA 2XGQA 1BNPA 3PR5B 2JZBB 1KDHA 4FZMA 2KZ3A 4C80A 2J6TA 2C22A 2EZYA 1RYSA 3HX0A 5HMMA 4U6PA 2G0AA 3T5KA 5IIJA 1N2XA 3M9MB 2BPFA 1ZD2P 8ICPA 4BDPA 2XCAA 3BJYA 2KIWA 2W7PA 2OEHA 5AIAA 2W7OA 2AHOB 3DDHA 1NK9A 5JTIA 1ZQVA 4UBBA 5AM3A 2OHFA 5IIKA 3IM1A 1UQVA 4LZGA 1KL9A 3CYMA 4I2DA 1XSPA 2XCPA 3MGIA 8ICLA 2LMRA 2KJ8A 4KN7A 3LYSA 1N62A 3BZKA 3RJIA 3EPIA 2IMWP 2BCUA 2KP7A 4OJPA 2DPJA 3F5EA 1QSSA 7ICHA 4I2BA 3PSIA 4UB2A 2YTUA 2IOHA 1V85A 3M9OB 1URJA 3SAGA 9ICIA 3IV6A 1N61A 2AQ0A 4JV0A 3D2NA 2W03A 1XNSA 2A1JA 4C7YA 3Q8PB 1COKA 1L3UA 4DSFA 4DS5A 2O6KA 5DG9A 2ZIWB 3F53A 3WKCA 3Q8LA 5AM1A 4CF3A 2R8IA 1X9SA 2YQEA 3TARA 7ICTA 3TADA 2ZIVB 1ZQFA 2WF5A 2M0NA 3QX7A 1PZNA 4UB1A 2K8CB 1LKYA 1ZD4A 2E8NA 4JWMA 4C4TA 4Q8EA 1ZQUA 1O03A 3T5JA 2Y1IA 2G07A 3FAHA 1X6JA 1FEZA 3RH4A 4RU9A 2AH5A 3Q8MA 3C2LA 4RPXA 5AI9A 5AHXA 2HHUA 5J0QA 3GZFA 4QWDA 2FE9A 1T8EA 5CHGA 4DFKA 3I1YA 3NVWA 1SIJA 8ICNA 3GDXA 4DOBA 3OHBA 4NV0A 3V6JA 2XY5A 1D9DA 2YN4A 1L8OA 3A0BU 5DBCA 9ICLA 1Z4NA 5KFLA 4NL9A 4IQWA 4QWAA 4EX7A 2NO4A 3RTVA 2J6UA 2YB1A 2H3FA 1ZQQA 2P6UA 1PK1A 4EZ6A 2WF9A 5J29A 4J9SA 3BS5A 3NVVA 4O5CA 2I6XA 3V6HA 2PFOA 3OJUA 2FPKA 4ECWA 3C1YA 1FO4A 2KTQA 3KKAA 1K1QA 5KG2A 4XRHA 2K4EA 1U9LA 4NJ8A 4OJLA 5KFGA 5TZVA 3RAXA 2HHVA 1ZQSA 3MBYA 5AIBA 3AEVA 2FLNA 2W9CA 3T3FA 3C29A 3ETLA 3SR6A 3UPQA 1S76D 2OXOA 2KV2A 4F3OA 4NLZA 1ZQEA 3QU2A 3FDSA 1A76A 3AU2A 5KFTA 2DUYA 2DGZA 2OWOA 1DK3A 5ALUA 3F2DA 1Q8KA 2AGOA 7ICVA 3KHRA 3ALRA 4IS7A 1HUZA 2WAQF 3ISDA 2ZIWA 4UB4A 4GXKA 8ICQA 3J81j 8ICRA 1OW5A 5ALYA 3NS1A 4F2RA 4CNQA 3KOOA 2E8OA 4B9UA 4A8EA 1IG6A 2BZFA 1WCNA 4MF2A 3EPGA 1QQ7A 3UXNA 4Y2QA 4F71A 1NJXA 5KFKA 3HKZC 2W9MA 9ICWA 1TK0A 9ICUA 2VJ4A 5ALMA 3TAPA 1TE2A 3C28A 1NZPA 3OJSA 1VDVA 4QZIA 5J8YC 1X2IA 4C4RA 2E5SA 4USAA 5AKJA 1MQ3A 4KX3A 5L1LA 4RQ6A 3L3FX 1SZPA 4KN4A 2XY7A 9ICXA 4OJOA 1D9FA 4JV2A 2G06A 2UVRA 4J9QA 3SENA 3OGUA 4NLGA 4RZRA 5ALVA 4DQQA 2F76X 4B9NA 1JXEA 3AQEA 2F3NA 3KBBA 2HBJA 4RT2A 5ALIA 5J2DA 4MFFA 2P6RA 2HMXA 1U49A 5J0YA 2DBYA 3TANA 5KFQA 4EZ9A 4OO1J 5AKZA 2ZXIA 1ZQIA 3RJEA 1RDFA 2DL0A 3JPSA 3U26A 2DWQA 4G9BA 4F72A 2JHDA 5IIMA 5L1IA 3V7KA 4IL6U 2KKVA 1PVQA 3TQ1A 2RDIA 2ALZA 4P0QB 1PK1B 3SV3A 4X5VA 2KG5A 8ICOA 8ICBA 5KNIA 3WKDA 2E1EA 5J2BA 2LM4A 4ED8A 1L7OA 2FMQA 3NVYA 2JEJA 2K8BB 3SMVA 1KEJA 2W9BA 3K4GA 3BS7A 3QXGA 4YD2A 9ICEA 4Z6DA 2LYBA 5T14A 3WKAA 2I1QA 3PW4A 3SV4A 8ICFA 7ICQA 1BPZA 1Z00A 4M9GA 3K1RB 2ISOA 3MR3A 3KTQA 1OXJA 1VJ5A 3AM9A 3S6JA 5EE3A 1LKYB 3L4PA 2HDOA 1TVAA 4NM1A 9ICVA 4PHPA 4P0PB 7ICJA 4KLIA 3G6YA 4YVZA 4PJ0U 2MUTA 3C2KA 3EWAA 1BNOA 4AYBF 3QYPA 4PHAA 3K75D 3BQ7A 4TQRA 4J9LA 4DSJA 4IRCA 1RZTA 1V97A 2KHQA 4FS2A 4ECTA 2F2AB 3LWLA 2KOBA 4IC9A 3G6XA 2W04A 4J9RA 2ZUBA 3SEIA 2LHTA 2VANA 4DQIA 1UCVA 5KAIU 1ZQWA 1DGJA 3OHAA 3C5GA 1NK5A 2WHEA 3CRXA 2UVWA 2HBLA 4QZFA 4EBEA 1Q3VA 4M9NA 2CXYA 1S97A 5AKLA 2D3DA 4MFAA 3MFHA 5J0UA 3HW8A 4UARA 4I2FA 4RPZA 4PPXA 2FJ6A 1HJPA 2BQ3A 1NNLA 4R8UB 2F44A 2HHTA 3QZ8A 4MF8A 3SD7A 3RB0A 1FIQA 2EAMA 4F4ZA 4NWIA 3BQ0A 3ONNA 5KFZA 3KZXA 1UA0A 1SL2A 5KL1B 3TFRA 1SZHA 4R65A 4P4MA 4ED1A 3QU9A 4EBCA 4FE3A 4OCZA 5KG5A 7ICIA 2LYAA 3M1YA 3PX4A 5KFYA 2DPIA 5KL8B 5CJ7A 2E8MA 5D4BA 5AK4A 3UQ0A 2ASDA 1MN8A 3Q8QB 1DGSA 3M6ZA 5E79U 5HHHA 4BWJA 2EAOA 2YY6A 4PHDA 1YT3A 4ICAA 4TUPA 1SXEA 3SI8A 8ICMA 4Q43A 2XGPA 4MHVA 2RDJA 2ZIXB 5EE0A 4KLSA 2HOIA 2HHQA 4CRXA 5KFEA 3C2MA 5L1JA 4O5EA 5KAFU 2AU0A 5AI5A 1RXWA 4B9SA 4ECVA 2OCEA 3NUQA 5AK3A 4QW8A 1XWLA 3PW7A 3MABA 2V9WA 2GLEA 1RYUA 4BWMA 1B43A 5K4LA 3Q8KA 5KT2A 3KFUF 3AQFA 3IP4B 1TK8A 9ICOA 4O3RA 2D8CA 2H3IA 2VA3A 3L5KA 1F44A 1M6YA 2BCQA 3DV9A 4KLOA 3I28A 2ZIUB 5DGBA 2JV3A 4CF4A 2PXIA 5KG7A 5J2HA 5GTIU 5HNKA 5C5JA 2W8LA 3AN1A 1S5LU 4O3MA 4CCHA 2F8KA 4O3SA 2P66A 9ICCA 2Y9TA 1JXLA 5J2EA 4KLGA 3PSPA 5DQGA 2W11A 4Y2SA 2HVIA 5CR0A 4YN4A 3HKZF 3PVXA 5ALPA 3IDWA 4YFKA 3QU7A 4M0AA 9ICSA 4DCCA 4P0PA 5KT4A 3GU3A 3T79A 4C8LA 4RQ8A 4ECUA 2G5HB 1C7YA 4KLLA 2CPRA 4JMUA 3RBEA 1FFUA 1X42A 1NI3A 2H3VA 4KLDA 1L7PA 3PO5A 2WB1C 1A0PA 2PFPA 1WWUA 1JI7A 3RH6A 3GIMA 4XA5A 2ZIXA 4XQ8A 4DQPA 3JPOA 1Z00B 3RFAA 3PMLA 2WAQC 1BPEA 2GWSA 2R18A 5KG3A 5DQHA 2MAXA 1N5XA 3H8SA 4F93B 2YMPA 3WK7A 1ZQJA 1TFRA 1KN5A 1WCLA 2HSZA 2JEIA 3LWMA 1SKWA 1UT8A 2DKXA 1N48A 2NO5A 1S0MA 5J2IA 9ICPA 2W9BB 2YMMA 3MR5A 4I28A 4I2GA 1NK0A 1KFSA 4FBUA 1HIWA 3ZI4A 2CN1A 3TFSA 2G08A 1MA7A 2NRTA 4Z6EA 5ALKA 1S8OA 1NKCA 4TUQA 2NRXA 3H4BA 3AU6A 3F5AA 3MDAA 5KFJA 9ICFA 1QCKA 2PMZC 3GIJA 3PSFA 5ALJA 3UM9A 1U4BA 4TQSA 2RHFA 5AKGA 2AXTU 4IRKA 3ZDCA 3IHQB 5ALQA 2I9GA 1ECWA 3RR7A 4UATA 3H8MA 3MC1A 2F1JA 4QWBA 2ATLA 4NY8A 9ICRA 4DSEA 2ZUDA 1CUKA 4DOAA 5EWEA 1QTMA 4DL2A 2Z7JA 5ALSA 5J2JA 1BPDA 2QLTA 4US9A 2Y9UA 1NJWA 4UQGA 4QZ8A 4GXJA 1Z4OA 5DBAA 1LVHA 4O5KA 3CW2C 4IR1A 2J6SA 1NKEA 1SKSA 2IOFA 5F3XB 4DFMA 3NRZA 2ZJAA 1PVPA 2A1JB 3H0LB 5AI0A 5EWGA 4RUAA 4J9MA 1C20A 3ZDDA 2BCRA 4B6JA 1MSWD 2ODGA 3PNCA 3TKAA 5IIIA 4F4YA 2W43A 4EENA 4UB6U 3JPPA 3ORYA 5J2GA 3CNHA 3T5LA 3PW2A 2DQNB 4JV1A 3FC4A 5J0OA 2FMSA 2KJ5A 4RQNA 1T7PA 5AK6A 3H40A 3N4MB 2JMGA 4OJ5A 2WF6A 3O0FA 1P7DA 3IG5A 4BUGA 5KT5A 4NXZA 2NRVA 3OPXA 5G5GA 5KFSA 8ICZA 2HOFA 4I2EA 1T3NA 4RQ7A 7ICMA 1NOMA 9ICNA 1ZQPA 3AL0B 2W9CB 2JXJA 4Q44A 4IQUA 1XSNA 4FBTA 1ZXIA 3PSTA 4JUZA 5CA7A 4P4PA 1KW4A 4QZHA 2AJQA 3QEAZ 4YMOA 1Z1VA 5KTQA 3WU2U 3JPRA 4I29A 4YCXA 4RNNA 8ICGA 3C21A 3C23A 5AICA 3RJJA 3BS5B 4PGQA 2FPLA 2JRZA 3RBDA 1ZQOA 3OSPA 2DKZA 4KLHA 2VA2A 3QUCA 5AKXA 4R63A 3SAHA 2V4QA 3RR8A 4QWCA 3H7IA 3UMBA 4FS1A 3MGHA 4ECRA 3ISCA 4B9TA 3HILA 3UQ2A 4DFPA 4C8OA 3UMGA 3WK9A 4ELUA 2HW3A 5BOMA 9ICKA 1GO3F 3QUTA 3F2CA 3IRUA 1ZQ1C 2K4PA 2OM6A 3ICXA 4QWEA 4LZDA 2MU2A 7ICEA 3N28A 1AROP 4KTQA 5HP4A 3EYZA 1Z19A 3WK4A 4F5NA 2R8JA 2QB0A 4BX9C 4CDGA 2H3ZA 5IILA 5IIOA 1QQ5A 2B0CA 2BPCA 3WKEA 5ALWA 2YMQA 1NZBA 4YXMA 2WB1F 1ZQAA 5HR7A 1S9FA 2BKEA 1DK2A 4DQRA 1YZ6A 4B9LA 5J2FA 1JRPA 5KFIA 8ICIA 4P2HA 8ICWA 5AM5A 3RRGA 1JUDA 3M7DA 4O3OA 3HT3A 4ED3A 2EZXA 8ICTA 2WF8A 2KSOB 2HI0A 2ES6A 1RQLA 2ZXHA 5AKYA 2IOFK 5H2FU 4DSLA 4BJQA 4YR2A 2Y1JA 1TAMA 4DF4A 3ZDBA 3WK5A 1J2MA 1B22A 4P4OA 5ALRA 3G6VA 3SQIA 3PZPA 1L6NA 2CRXA 3QZ7A 4F4WA 4RQ0A 8ICAA 4K4HA 1L3TA 1SL1A 2BDPA 1JMSA 2KD1A 2IBKA 4YMNA 4Y2JA 4F4KA 4PZNA 1TKDA 2EH9A 4J9OA 4UBCA 3GV5B 5HR6A 5DG7A 1Q3UA 4Y2UA 4J9NA 1K1SA 2ZJ8A 4AP9A 1BPXA 4TUSA 2BCSA 2W3RA 4DEZA 1S0OA 7ICPA 2I5HA 4RNOA 2HHXA 5AM0A 5ALNA 4ECSA 1UT5A 1XO1A 4NLCA 4EBDA 3E2EA 2QKQA 4QW9A 3RAQA 4M2YA 4EYHB 1XS9D 1A77A 2NYVA 4RQ4A 3LDAA 1BPBA 1L7NA 4DL6A 3HPOA 3E0FA 1ZQGA 2KHVA 2KFZA 3KHGA 4O3QA 4YXJA 1XC9A 4ECQA 4BXOB 4ED7A 5CP2A 4Y2VA 4ED6A 3GILA 2BDUA 4LJXA 2YMLA 1MQ2A 1KKXA 1IIPA 3RF9A 4FZLA 3N7SC 2L5YA 2VA8A 5J0RA 4GXIA 1CRXA 2N1RA 4B9VA 4DOCA 2JEFA 3KKAC 3BQ2A 2Y0SF 3IN5A 5GTHU 5AM4A 2Y0SC 5DB8A 8ICSA 2XI9A 5ALLA 5CWRA 2F1IA 1QLNA 1SV0A 1X9MA 2XIDA 4QZEA 7ICNA 5J2CA 1QQ6A 1ZQHA 2QB1A 9ICTA 2UVVA 2K89A 5AKEA 4IQVA 5J2KA 3QUQA 4FZNA 2XY6A 3BQTA 2HVHA 3RJGA 5AI6A 4DL3A 3SZ2A 5DB9A 5AK5A 1HEKA 1S10A 2VIXA 3RH5A 5DGAA 2GOLA 1NJYA 3EUB2 4I2AA 1RQNA 5J0SA 5DB7A 2W8KA 1BGXT 5IINA 3SYZA 4YMMA 1K5OA 3PX0A 3R9KA 5TISU 2LPEA 5CB1A 1U45A 4MEYA 2MUTB 8ICKA 2ASJA 4FFDA 2XC9A 3H8WA 4M9LA 5D46A 2ZTDA 7ICGA 2BGWA 3KHHA 3PW0A 2KICA 4UW9A 3FM9A 3VCBA 4KLMA 1COOA 4GC7A 1NKBA 4O0IA 5J8YA 4CE6A 1NK8A 2XO7A 1ZJMA 1ZQCA 4GIBA 2JGAA 4KLQA 2PKEA 2ASLA 1JN3A 5EWFA 2K4HA 4OJ6A 4YG2A 2EANA 1JALA 1AQ6A 4DSIA 5ALDA 2ZTCA 2A3VA 3MDCA 2AGQA 2C2RA 2C2EA 4PH5A 3Q8RB 5L9XA 3THVA 4DL5A 4DL4A 2D6FC 3D6JA 4PGYA 4ZH4A 2KE7A 1JROA 4F2SA 1SXDA 2G5IB 4US8A 3H4DA 4HYKA 3V7JA 1X9XA 1S77D 5AKIA 2BPGA 4QZBA 1KRPA 1ZD5A 1N5WA 5KFBA 3PMNA 4UAZA 2E8PA 4DLGA 4PL1A 2V4RA 4QJFB 3M8RA 1L8LA 2Q0ZX 4U7CA 4E0DA 5DBBA 3V6KA 1KBUA 1VLBA 3QE9Y 1F5SA 1ZRMA 1L3SA 2QARA 3KD3A 5AM2A 5B66U 3FYHA 4IRDA 3D2SA 2BHNA 5JUMA 1UA1A 5AKHA 1J97A 2A1AA 1ZQXA 2IHMA 3LVWA 1NJZA 4Y2RA 1ZQZA 5FP0A 3LK9A 5KFWA 3QU5A 4AYBC 1BVSA 4M47A 2UVUA 2QB0B 1RG6A 3PR4A 3B0XA 3IG8A 5KG4A 5F9NA 2IA6A 1D8BA 5HHIA 4G3IA 5KFUA 1KSPA 1WYGA 5DLFA 4DFJA 3RJHA 5KFDA
chains in the Genus database with same CATH topology
2GH1A 3AL0B 2PMZC 5T14A 2KJ9A 2KNJA 4A8EA 4NWIA 3E0FA 2ZIUB 3ONNA 2KHVA 3KZXA 3PSFA 3GZFA 2F77X 2RHFA 3N7RC 2XICA 3PSTA 4O3MA 5KL1B 2JGAA 1SZHA 2JH1A 2KIWA 2BDUA 2ZIUA 4QIWF 3M7DA 3VC8A 2W7PA 2W7OA 4CGZA 1WUDA 1ECWA 1IIPA 4NV0A 3RF9A 4FZLA 2XVTA 2PMZF 3N7SC 2NV3A 2RP5A 3HKZC 1PVRA 2K4HA 3PSPA 4OJ6A 2VJ4A 4FE3A 2VKQA 4ACOA 2ZXHA 2N1RA 1CRXA 3LVVA 3C28A 3MGVA 2A3VA 2LYAA 3HKZF 5CRXA 2YB1A 2D6FC 2H3FA 2K4IA 2Z7JA 4BJQA 3CYMA 3CP8A 2E5SA 4P0PA 3GU3A 2DF4B 2LKYA 4KX5A 3T79A 5KL8B 4KX3A 4WJ3B 2Y0SF 4P0PB 1TAMA 3IN5A 2G5IB 2HOQA 2K8AA 4GFJA 3H0MB 2G5HB 2KVCA 2Y0SC 5A0LA 2KJ8A 4AYBF 2CPRA 2XI9A 3L3FX 4JMUA 3SQIA 4QIWC 3M6ZA 3LYSA 3PZPA 2H3VA 4OJOA 1L6NA 2KKPA 3H0RB 2CRXA 2YX8A 2XIDA 2G06A 1A0PA 2WB1C 3SAHA 3K1ZA 4KMOB 1YT3A 4ICAA 3DEEA 4PL1A 4OJPA 2F76X 2ZIXA 2KD1A 2KHQA 2MRLA 3AQEA 4QJFB 2F2AB 3F5EA 2E1FA 2K4EA 3RFAA 4U7CA 2KOBA 1ED1A 2RRDA 4IC9A 2WAQC 4OJLA 2HBJA 3PSIA 2R18A 1Z1BA 2K89A 1PVPA 3H0LB 1KBUA 2OH2A 1A6SA 2OYYA 2ZG6A 4FZNA 2W04A 3NRWA 2HMXA 2VJ5A 3N7PD 1URJA 5HR6A 3SAGA 2ZIXB 1Q3UA 1HEKA 1DRGA 4PL2A 1XO0A 4QNLA 3C29A 4NLBA 1GO3F 3F2CA 3M6KA 2LBOA 2HOIA 3D2NA 2OXOA 2KV2A 2LHTA 2JH7A 2VIXA 2W03A 1ZQ1C 4CRXA 4OO1J 2MA1A 2OM6A 3ICXA 3SAFA 2ZXIA 1XNSA 1OUQA 3D2SA 5C0YA 2GOLA 2JHDA 2DQNB 2ZIWB 2Q4TA 3F53A 3LVWA 3CRXA 1Z19A 2DGZA 3NUQA 3D2QA 2KKVA 2HBLA 2KJ5A 1Q3VA 4BX9C 1PVQA 1UPHA 4AYBC 3F2DA 4CDGA 2ZIVB 2H3ZA 3IG8A 4P0QB 1HIWA 2JMGA 3ALRA 2M0NA 4OJ5A 4NLCA 3F2BA 2CN1A 2WAQF 2G08A 3O0FA 3AQFA 1P7DA 2ZIWA 3KFUF 1D8BA 1T94A 2K8CB 1MA7A 2E1EA 3IG5A 4FZMA 3IP4B 4BUGA 2ZIVA 4P0QA 4C0ZA 3OPXA 1NZBA 2F8LA 2H3QA 2HOFA 2K8BB 3SMVA 2KEYA 2WB1F 5HR7A 2H3IA 2YB4A 2KICA 2G09A 2G07A 3F5AA 2HBMA 3VCBA 2G0AA 4U6PA 1F44A 2HBKA 2LYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VCB A;  3GZF A;  3VC8 A; 
#chains in the Genus database with same CATH topology
 2GH1 A;  9ICH A;  1X9W A;  2ESE A;  3ZD9 A;  4Y2P A;  5DLG A;  4CF5 A;  1MC8 A;  2JH1 A;  3BQ1 A;  4CGZ A;  2ZJ5 A;  1WUD A;  4K4G A;  5KFF A;  5JRT A;  1XSL A;  5KT6 A;  3TAQ A;  1Z3E B;  2FI1 A;  3ED5 A;  4UB3 A;  3KZI U;  5CRX A;  2MSN A;  2WTF A;  1T4G A;  2EQY A;  2IHN A;  4J9K A;  1YZ7 A;  2KZZ A;  8ICH A;  2K8A A;  3QEB Z;  3NVZ A;  5BOL A;  1QH9 A;  1B0X A;  2KKP A;  1D8Y A;  1ZYQ A;  2KN7 A;  4KMO B;  4DLE A;  3EZ5 A;  2RLT A;  3DEE A;  3TAD C;  4HAI A;  4UAW A;  4ECY A;  3GII A;  1IM4 A;  1WWV A;  1Z1B A;  4M6W A;  1A6S A;  3RJK A;  4Q45 A;  5J2A A;  2LM1 A;  2W9A A;  7ICS A;  3ISB A;  4BGD A;  4ECZ A;  1ZQK A;  4NLB A;  2B6G A;  4F8R A;  4KLU A;  5ALH A;  1SL0 A;  3H8J A;  5EOZ A;  4I2C A;  1OUQ A;  4I2I A;  5J0W A;  1NK4 A;  5KFO A;  7ICK A;  4KIT B;  5DDM A;  3GQC A;  4UAV A;  3HRD D;  3WK8 A;  3UXP A;  1CEZ A;  3E58 A;  3QU4 A;  2ZTE A;  3JPQ A;  4YP3 A;  3PY8 A;  3AUO A;  4NL9 C;  4P0Q A;  4Y2X A;  1QSL A;  2KSO A;  1ZQN A;  2B21 A;  2HBK A;  1F0M A;  2DFL A;  1N63 A;  4Y2T A;  4EYI B;  5KT3 A;  5ALE A;  8ICE A;  3PV8 A;  1TAU A;  4F4X A;  2EDU A;  4RQ3 A;  3JPT A;  1N60 A;  2KK0 A;  1EXN A;  5J0P A;  1ZOL A;  4J9P A;  1SWW A;  1TK5 A;  1JX4 A;  2NRW A;  4DQS A;  9ICB A;  3LVV A;  2AQ4 A;  5KT7 A;  4O3P A;  5KG1 A;  4ELT A;  3A0H U;  1U47 A;  2K4I A;  9ICA A;  3GIK A;  4KX5 A;  4JK1 A;  5DB6 A;  2A19 A;  2BQR A;  1SGG A;  4GFJ A;  3H0M B;  2KFN A;  4RQM A;  5A0L A;  3PX6 A;  1ZET A;  1ZQD A;  8ICU A;  8ICC A;  2JEG A;  2WFA A;  4RT3 A;  2NRZ A;  4QZC A;  3RB4 A;  3UMC A;  3RB6 A;  3RB3 A;  1SKR A;  7ICO A;  5KFV A;  1B4F A;  3M8S A;  1D8L A;  3C1Z A;  2E1F A;  4ZOH C;  4Z6C A;  3TI0 A;  2FDR A;  2OYY A;  2ZG6 A;  3NAS A;  3AMZ A;  3NRW A;  2QAR B;  3HP6 A;  3M6K A;  1RPL A;  2AGP A;  4KLT A;  2W3S A;  5ALG A;  3PW5 A;  5C0Y A;  8ICV A;  2EZZ A;  4UAU A;  1RXV A;  3B0Y A;  2C28 A;  5DKW A;  4M9H A;  4O9M A;  5G5H A;  4KLJ A;  3PO4 A;  1L3V A;  3ZD8 A;  4Q8F A;  5EE1 A;  4J03 A;  4IR9 A;  1NK6 A;  1J2N A;  3MFI A;  1U48 A;  3KHL A;  1ZD3 A;  2F8L A;  2H3Q A;  4F5Q A;  3RRH A;  3Q8S B;  1ZQB A;  5BPC A;  2YB4 A;  1SWV A;  3MR2 A;  3QUB A;  3GV7 B;  2HBM A;  5J0T A;  4EEL A;  2KJ9 A;  5AI4 A;  4I2H A;  2ISP A;  4DF8 A;  1LB2 B;  4M6W B;  4GC6 A;  4DSK A;  5ALX A;  3ZDE A;  4F5P A;  4QZA A;  5KFA A;  5DDY A;  2P35 A;  1KLN A;  2PMZ F;  2K60 A;  2NV3 A;  4M04 A;  1IV8 A;  4ACO A;  1JIH A;  2RQ5 A;  5HML A;  4QZ9 A;  4DS4 A;  1X66 A;  2WF7 A;  1L7M A;  2DF4 B;  2LI6 A;  2LKY A;  3GV8 B;  4IQT A;  4WJ3 B;  2HOQ A;  1T3Q A;  3HJE A;  3NTU A;  2KIV A;  1KQQ A;  5KFP A;  1SB3 C;  2JZB A;  4UAY A;  4PHE A;  4DFD A;  7ICU A;  4ELV A;  2H5X A;  3QNM A;  3TAC B;  5KG6 A;  8ICY A;  3BDP A;  4GLX A;  5KFH A;  4R64 A;  5DQI A;  2MRL A;  2RRD A;  5KFR A;  4C8M A;  4RNM A;  4Z6F A;  1NK7 A;  3N7P D;  5ALT A;  5AI8 A;  1DRG A;  5ALO A;  4PL2 A;  4O3N A;  1XO0 A;  4NM2 A;  4K4I A;  4C4S A;  4EEY A;  4DWI A;  2MA1 A;  5L1M A;  9ICJ A;  3N97 B;  2M9N A;  3ZDA A;  4F92 B;  4MFC A;  2W54 A;  2HHS A;  2KZM A;  4DL7 A;  4UB8 U;  4I2J A;  3GFK B;  2R8K A;  1KTQ A;  5ALZ A;  4OD0 A;  4RPY A;  2ZIV A;  4YD1 A;  4QZD A;  4DO9 A;  2GO7 A;  2FMP A;  2KEY A;  1IXR A;  1HUO A;  2G09 A;  1S0N A;  1DOQ A;  4KLE A;  4C7Z A;  1X40 A;  4XUS A;  5AKK A;  1TV9 A;  5KFM A;  1ZRN A;  4JB3 A;  7ICR A;  1CI4 A;  4EX6 A;  5KFN A;  4PGX A;  4F5O A;  5JU5 A;  2HCF A;  5KFX A;  1QSY A;  9ICQ A;  2BR0 A;  1PVR A;  4MEX A;  4JWN A;  3UXO A;  3MR6 A;  2HHW A;  4I27 A;  4YQW A;  2FLL A;  4Y2Y A;  2R8H A;  3CP8 A;  1FFV A;  1SV4 A;  3OTQ A;  4M9J A;  3JPN A;  4NLN A;  4QZG A;  2KVC A;  2PI5 A;  4TUR A;  4NLK A;  2EAP A;  4KMU A;  4QIW C;  3ETR A;  1WG8 A;  3H0R B;  2YX8 A;  1Y88 A;  3K1Z A;  5EE9 A;  1ZQM A;  4ED2 A;  3HWT A;  2OH2 A;  3T5H A;  2VJ5 A;  4QNL A;  7ICL A;  2JH7 A;  3SAF A;  3C5F A;  4R8U A;  4YR3 A;  4F91 B;  1ZQT A;  4F5R A;  2E3T A;  2Q4T A;  5D49 A;  1TAQ A;  1ZQL A;  1LV5 A;  3D2Q A;  4RQ1 A;  5J0X A;  4RUC A;  2R8G A;  3F2B A;  2PFQ A;  1T94 A;  1L5U A;  3V72 A;  4C0Z A;  5KFC A;  1V38 A;  4PZO A;  4RQ5 A;  9ICM A;  1H38 A;  2PFN A;  3OSN A;  4R66 A;  4QIW F;  2C2D A;  9ICG A;  4ECX A;  2KNJ A;  3I76 A;  1RM6 C;  2F77 X;  1S0V A;  3N7R C;  2XIC A;  2ZIU A;  3VC8 A;  2KMD A;  4EEK A;  4FO6 A;  2KVS A;  2XVT A;  1N56 A;  2RP5 A;  7ICF A;  2VKQ A;  1O08 A;  1PK3 A;  4YR0 A;  2F1H A;  3WK6 A;  1SV0 C;  3MGV A;  3B9J A;  2BCV A;  1ZQR A;  1BPY A;  2JR5 A;  1RYR A;  1PUZ A;  5CEH A;  5L1K A;  3NGD A;  4UB5 A;  3EW9 A;  1ZQY A;  4C8K A;  4C8N A;  1XU4 A;  5B5E U;  1KFT A;  5F9L A;  3V7L A;  3RJF A;  2PI4 A;  2W55 A;  5ALF A;  4BXO A;  1ED1 A;  4KLF A;  5KG0 A;  4B9M A;  1Q46 A;  8ICJ A;  2BQU A;  1UHU A;  2LBO A;  1X6I A;  2FLP A;  3WKB A;  1V9P A;  4F50 A;  4RQ2 A;  5DG8 A;  2LYH A;  4ED0 A;  1ZJN A;  3M9N B;  4LVS A;  8ICX A;  2ZUC A;  2FPM A;  3BZC A;  1KFD A;  1DXS A;  4UAS A;  1UPH A;  2XGQ A;  1BNP A;  3PR5 B;  2JZB B;  1KDH A;  4FZM A;  2KZ3 A;  4C80 A;  2J6T A;  2C22 A;  2EZY A;  1RYS A;  3HX0 A;  5HMM A;  4U6P A;  2G0A A;  3T5K A;  5IIJ A;  1N2X A;  3M9M B;  2BPF A;  1ZD2 P;  8ICP A;  4BDP A;  2XCA A;  3BJY A;  2KIW A;  2W7P A;  2OEH A;  5AIA A;  2W7O A;  2AHO B;  3DDH A;  1NK9 A;  5JTI A;  1ZQV A;  4UBB A;  5AM3 A;  2OHF A;  5IIK A;  3IM1 A;  1UQV A;  4LZG A;  1KL9 A;  3CYM A;  4I2D A;  1XSP A;  2XCP A;  3MGI A;  8ICL A;  2LMR A;  2KJ8 A;  4KN7 A;  3LYS A;  1N62 A;  3BZK A;  3RJI A;  3EPI A;  2IMW P;  2BCU A;  2KP7 A;  4OJP A;  2DPJ A;  3F5E A;  1QSS A;  7ICH A;  4I2B A;  3PSI A;  4UB2 A;  2YTU A;  2IOH A;  1V85 A;  3M9O B;  1URJ A;  3SAG A;  9ICI A;  3IV6 A;  1N61 A;  2AQ0 A;  4JV0 A;  3D2N A;  2W03 A;  1XNS A;  2A1J A;  4C7Y A;  3Q8P B;  1COK A;  1L3U A;  4DSF A;  4DS5 A;  2O6K A;  5DG9 A;  2ZIW B;  3F53 A;  3WKC A;  3Q8L A;  5AM1 A;  4CF3 A;  2R8I A;  1X9S A;  2YQE A;  3TAR A;  7ICT A;  3TAD A;  2ZIV B;  1ZQF A;  2WF5 A;  2M0N A;  3QX7 A;  1PZN A;  4UB1 A;  2K8C B;  1LKY A;  1ZD4 A;  2E8N A;  4JWM A;  4C4T A;  4Q8E A;  1ZQU A;  1O03 A;  3T5J A;  2Y1I A;  2G07 A;  3FAH A;  1X6J A;  1FEZ A;  3RH4 A;  4RU9 A;  2AH5 A;  3Q8M A;  3C2L A;  4RPX A;  5AI9 A;  5AHX A;  2HHU A;  5J0Q A;  3GZF A;  4QWD A;  2FE9 A;  1T8E A;  5CHG A;  4DFK A;  3I1Y A;  3NVW A;  1SIJ A;  8ICN A;  3GDX A;  4DOB A;  3OHB A;  4NV0 A;  3V6J A;  2XY5 A;  1D9D A;  2YN4 A;  1L8O A;  3A0B U;  5DBC A;  9ICL A;  1Z4N A;  5KFL A;  4NL9 A;  4IQW A;  4QWA A;  4EX7 A;  2NO4 A;  3RTV A;  2J6U A;  2YB1 A;  2H3F A;  1ZQQ A;  2P6U A;  1PK1 A;  4EZ6 A;  2WF9 A;  5J29 A;  4J9S A;  3BS5 A;  3NVV A;  4O5C A;  2I6X A;  3V6H A;  2PFO A;  3OJU A;  2FPK A;  4ECW A;  3C1Y A;  1FO4 A;  2KTQ A;  3KKA A;  1K1Q A;  5KG2 A;  4XRH A;  2K4E A;  1U9L A;  4NJ8 A;  4OJL A;  5KFG A;  5TZV A;  3RAX A;  2HHV A;  1ZQS A;  3MBY A;  5AIB A;  3AEV A;  2FLN A;  2W9C A;  3T3F A;  3C29 A;  3ETL A;  3SR6 A;  3UPQ A;  1S76 D;  2OXO A;  2KV2 A;  4F3O A;  4NLZ A;  1ZQE A;  3QU2 A;  3FDS A;  1A76 A;  3AU2 A;  5KFT A;  2DUY A;  2DGZ A;  2OWO A;  1DK3 A;  5ALU A;  3F2D A;  1Q8K A;  2AGO A;  7ICV A;  3KHR A;  3ALR A;  4IS7 A;  1HUZ A;  2WAQ F;  3ISD A;  2ZIW A;  4UB4 A;  4GXK A;  8ICQ A;  3J81 j;  8ICR A;  1OW5 A;  5ALY A;  3NS1 A;  4F2R A;  4CNQ A;  3KOO A;  2E8O A;  4B9U A;  4A8E A;  1IG6 A;  2BZF A;  1WCN A;  4MF2 A;  3EPG A;  1QQ7 A;  3UXN A;  4Y2Q A;  4F71 A;  1NJX A;  5KFK A;  3HKZ C;  2W9M A;  9ICW A;  1TK0 A;  9ICU A;  2VJ4 A;  5ALM A;  3TAP A;  1TE2 A;  3C28 A;  1NZP A;  3OJS A;  1VDV A;  4QZI A;  5J8Y C;  1X2I A;  4C4R A;  2E5S A;  4USA A;  5AKJ A;  1MQ3 A;  4KX3 A;  5L1L A;  4RQ6 A;  3L3F X;  1SZP A;  4KN4 A;  2XY7 A;  9ICX A;  4OJO A;  1D9F A;  4JV2 A;  2G06 A;  2UVR A;  4J9Q A;  3SEN A;  3OGU A;  4NLG A;  4RZR A;  5ALV A;  4DQQ A;  2F76 X;  4B9N A;  1JXE A;  3AQE A;  2F3N A;  3KBB A;  2HBJ A;  4RT2 A;  5ALI A;  5J2D A;  4MFF A;  2P6R A;  2HMX A;  1U49 A;  5J0Y A;  2DBY A;  3TAN A;  5KFQ A;  4EZ9 A;  4OO1 J;  5AKZ A;  2ZXI A;  1ZQI A;  3RJE A;  1RDF A;  2DL0 A;  3JPS A;  3U26 A;  2DWQ A;  4G9B A;  4F72 A;  2JHD A;  5IIM A;  5L1I A;  3V7K A;  4IL6 U;  2KKV A;  1PVQ A;  3TQ1 A;  2RDI A;  2ALZ A;  4P0Q B;  1PK1 B;  3SV3 A;  4X5V A;  2KG5 A;  8ICO A;  8ICB A;  5KNI A;  3WKD A;  2E1E A;  5J2B A;  2LM4 A;  4ED8 A;  1L7O A;  2FMQ A;  3NVY A;  2JEJ A;  2K8B B;  3SMV A;  1KEJ A;  2W9B A;  3K4G A;  3BS7 A;  3QXG A;  4YD2 A;  9ICE A;  4Z6D A;  2LYB A;  5T14 A;  3WKA A;  2I1Q A;  3PW4 A;  3SV4 A;  8ICF A;  7ICQ A;  1BPZ A;  1Z00 A;  4M9G A;  3K1R B;  2ISO A;  3MR3 A;  3KTQ A;  1OXJ A;  1VJ5 A;  3AM9 A;  3S6J A;  5EE3 A;  1LKY B;  3L4P A;  2HDO A;  1TVA A;  4NM1 A;  9ICV A;  4PHP A;  4P0P B;  7ICJ A;  4KLI A;  3G6Y A;  4YVZ A;  4PJ0 U;  2MUT A;  3C2K A;  3EWA A;  1BNO A;  4AYB F;  3QYP A;  4PHA A;  3K75 D;  3BQ7 A;  4TQR A;  4J9L A;  4DSJ A;  4IRC A;  1RZT A;  1V97 A;  2KHQ A;  4FS2 A;  4ECT A;  2F2A B;  3LWL A;  2KOB A;  4IC9 A;  3G6X A;  2W04 A;  4J9R A;  2ZUB A;  3SEI A;  2LHT A;  2VAN A;  4DQI A;  1UCV A;  5KAI U;  1ZQW A;  1DGJ A;  3OHA A;  3C5G A;  1NK5 A;  2WHE A;  3CRX A;  2UVW A;  2HBL A;  4QZF A;  4EBE A;  1Q3V A;  4M9N A;  2CXY A;  1S97 A;  5AKL A;  2D3D A;  4MFA A;  3MFH A;  5J0U A;  3HW8 A;  4UAR A;  4I2F A;  4RPZ A;  4PPX A;  2FJ6 A;  1HJP A;  2BQ3 A;  1NNL A;  4R8U B;  2F44 A;  2HHT A;  3QZ8 A;  4MF8 A;  3SD7 A;  3RB0 A;  1FIQ A;  2EAM A;  4F4Z A;  4NWI A;  3BQ0 A;  3ONN A;  5KFZ A;  3KZX A;  1UA0 A;  1SL2 A;  5KL1 B;  3TFR A;  1SZH A;  4R65 A;  4P4M A;  4ED1 A;  3QU9 A;  4EBC A;  4FE3 A;  4OCZ A;  5KG5 A;  7ICI A;  2LYA A;  3M1Y A;  3PX4 A;  5KFY A;  2DPI A;  5KL8 B;  5CJ7 A;  2E8M A;  5D4B A;  5AK4 A;  3UQ0 A;  2ASD A;  1MN8 A;  3Q8Q B;  1DGS A;  3M6Z A;  5E79 U;  5HHH A;  4BWJ A;  2EAO A;  2YY6 A;  4PHD A;  1YT3 A;  4ICA A;  4TUP A;  1SXE A;  3SI8 A;  8ICM A;  4Q43 A;  2XGP A;  4MHV A;  2RDJ A;  2ZIX B;  5EE0 A;  4KLS A;  2HOI A;  2HHQ A;  4CRX A;  5KFE A;  3C2M A;  5L1J A;  4O5E A;  5KAF U;  2AU0 A;  5AI5 A;  1RXW A;  4B9S A;  4ECV A;  2OCE A;  3NUQ A;  5AK3 A;  4QW8 A;  1XWL A;  3PW7 A;  3MAB A;  2V9W A;  2GLE A;  1RYU A;  4BWM A;  1B43 A;  5K4L A;  3Q8K A;  5KT2 A;  3KFU F;  3AQF A;  3IP4 B;  1TK8 A;  9ICO A;  4O3R A;  2D8C A;  2H3I A;  2VA3 A;  3L5K A;  1F44 A;  1M6Y A;  2BCQ A;  3DV9 A;  4KLO A;  3I28 A;  2ZIU B;  5DGB A;  2JV3 A;  4CF4 A;  2PXI A;  5KG7 A;  5J2H A;  5GTI U;  5HNK A;  5C5J A;  2W8L A;  3AN1 A;  1S5L U;  4O3M A;  4CCH A;  2F8K A;  4O3S A;  2P66 A;  9ICC A;  2Y9T A;  1JXL A;  5J2E A;  4KLG A;  3PSP A;  5DQG A;  2W11 A;  4Y2S A;  2HVI A;  5CR0 A;  4YN4 A;  3HKZ F;  3PVX A;  5ALP A;  3IDW A;  4YFK A;  3QU7 A;  4M0A A;  9ICS A;  4DCC A;  4P0P A;  5KT4 A;  3GU3 A;  3T79 A;  4C8L A;  4RQ8 A;  4ECU A;  2G5H B;  1C7Y A;  4KLL A;  2CPR A;  4JMU A;  3RBE A;  1FFU A;  1X42 A;  1NI3 A;  2H3V A;  4KLD A;  1L7P A;  3PO5 A;  2WB1 C;  1A0P A;  2PFP A;  1WWU A;  1JI7 A;  3RH6 A;  3GIM A;  4XA5 A;  2ZIX A;  4XQ8 A;  4DQP A;  3JPO A;  1Z00 B;  3RFA A;  3PML A;  2WAQ C;  1BPE A;  2GWS A;  2R18 A;  5KG3 A;  5DQH A;  2MAX A;  1N5X A;  3H8S A;  4F93 B;  2YMP A;  3WK7 A;  1ZQJ A;  1TFR A;  1KN5 A;  1WCL A;  2HSZ A;  2JEI A;  3LWM A;  1SKW A;  1UT8 A;  2DKX A;  1N48 A;  2NO5 A;  1S0M A;  5J2I A;  9ICP A;  2W9B B;  2YMM A;  3MR5 A;  4I28 A;  4I2G A;  1NK0 A;  1KFS A;  4FBU A;  1HIW A;  3ZI4 A;  2CN1 A;  3TFS A;  2G08 A;  1MA7 A;  2NRT A;  4Z6E A;  5ALK A;  1S8O A;  1NKC A;  4TUQ A;  2NRX A;  3H4B A;  3AU6 A;  3F5A A;  3MDA A;  5KFJ A;  9ICF A;  1QCK A;  2PMZ C;  3GIJ A;  3PSF A;  5ALJ A;  3UM9 A;  1U4B A;  4TQS A;  2RHF A;  5AKG A;  2AXT U;  4IRK A;  3ZDC A;  3IHQ B;  5ALQ A;  2I9G A;  1ECW A;  3RR7 A;  4UAT A;  3H8M A;  3MC1 A;  2F1J A;  4QWB A;  2ATL A;  4NY8 A;  9ICR A;  4DSE A;  2ZUD A;  1CUK A;  4DOA A;  5EWE A;  1QTM A;  4DL2 A;  2Z7J A;  5ALS A;  5J2J A;  1BPD A;  2QLT A;  4US9 A;  2Y9U A;  1NJW A;  4UQG A;  4QZ8 A;  4GXJ A;  1Z4O A;  5DBA A;  1LVH A;  4O5K A;  3CW2 C;  4IR1 A;  2J6S A;  1NKE A;  1SKS A;  2IOF A;  5F3X B;  4DFM A;  3NRZ A;  2ZJA A;  1PVP A;  2A1J B;  3H0L B;  5AI0 A;  5EWG A;  4RUA A;  4J9M A;  1C20 A;  3ZDD A;  2BCR A;  4B6J A;  1MSW D;  2ODG A;  3PNC A;  3TKA A;  5III A;  4F4Y A;  2W43 A;  4EEN A;  4UB6 U;  3JPP A;  3ORY A;  5J2G A;  3CNH A;  3T5L A;  3PW2 A;  2DQN B;  4JV1 A;  3FC4 A;  5J0O A;  2FMS A;  2KJ5 A;  4RQN A;  1T7P A;  5AK6 A;  3H40 A;  3N4M B;  2JMG A;  4OJ5 A;  2WF6 A;  3O0F A;  1P7D A;  3IG5 A;  4BUG A;  5KT5 A;  4NXZ A;  2NRV A;  3OPX A;  5G5G A;  5KFS A;  8ICZ A;  2HOF A;  4I2E A;  1T3N A;  4RQ7 A;  7ICM A;  1NOM A;  9ICN A;  1ZQP A;  3AL0 B;  2W9C B;  2JXJ A;  4Q44 A;  4IQU A;  1XSN A;  4FBT A;  1ZXI A;  3PST A;  4JUZ A;  5CA7 A;  4P4P A;  1KW4 A;  4QZH A;  2AJQ A;  3QEA Z;  4YMO A;  1Z1V A;  5KTQ A;  3WU2 U;  3JPR A;  4I29 A;  4YCX A;  4RNN A;  8ICG A;  3C21 A;  3C23 A;  5AIC A;  3RJJ A;  3BS5 B;  4PGQ A;  2FPL A;  2JRZ A;  3RBD A;  1ZQO A;  3OSP A;  2DKZ A;  4KLH A;  2VA2 A;  3QUC A;  5AKX A;  4R63 A;  3SAH A;  2V4Q A;  3RR8 A;  4QWC A;  3H7I A;  3UMB A;  4FS1 A;  3MGH A;  4ECR A;  3ISC A;  4B9T A;  3HIL A;  3UQ2 A;  4DFP A;  4C8O A;  3UMG A;  3WK9 A;  4ELU A;  2HW3 A;  5BOM A;  9ICK A;  1GO3 F;  3QUT A;  3F2C A;  3IRU A;  1ZQ1 C;  2K4P A;  2OM6 A;  3ICX A;  4QWE A;  4LZD A;  2MU2 A;  7ICE A;  3N28 A;  1ARO P;  4KTQ A;  5HP4 A;  3EYZ A;  1Z19 A;  3WK4 A;  4F5N A;  2R8J A;  2QB0 A;  4BX9 C;  4CDG A;  2H3Z A;  5IIL A;  5IIO A;  1QQ5 A;  2B0C A;  2BPC A;  3WKE A;  5ALW A;  2YMQ A;  1NZB A;  4YXM A;  2WB1 F;  1ZQA A;  5HR7 A;  1S9F A;  2BKE A;  1DK2 A;  4DQR A;  1YZ6 A;  4B9L A;  5J2F A;  1JRP A;  5KFI A;  8ICI A;  4P2H A;  8ICW A;  5AM5 A;  3RRG A;  1JUD A;  3M7D A;  4O3O A;  3HT3 A;  4ED3 A;  2EZX A;  8ICT A;  2WF8 A;  2KSO B;  2HI0 A;  2ES6 A;  1RQL A;  2ZXH A;  5AKY A;  2IOF K;  5H2F U;  4DSL A;  4BJQ A;  4YR2 A;  2Y1J A;  1TAM A;  4DF4 A;  3ZDB A;  3WK5 A;  1J2M A;  1B22 A;  4P4O A;  5ALR A;  3G6V A;  3SQI A;  3PZP A;  1L6N A;  2CRX A;  3QZ7 A;  4F4W A;  4RQ0 A;  8ICA A;  4K4H A;  1L3T A;  1SL1 A;  2BDP A;  1JMS A;  2KD1 A;  2IBK A;  4YMN A;  4Y2J A;  4F4K A;  4PZN A;  1TKD A;  2EH9 A;  4J9O A;  4UBC A;  3GV5 B;  5HR6 A;  5DG7 A;  1Q3U A;  4Y2U A;  4J9N A;  1K1S A;  2ZJ8 A;  4AP9 A;  1BPX A;  4TUS A;  2BCS A;  2W3R A;  4DEZ A;  1S0O A;  7ICP A;  2I5H A;  4RNO A;  2HHX A;  5AM0 A;  5ALN A;  4ECS A;  1UT5 A;  1XO1 A;  4NLC A;  4EBD A;  3E2E A;  2QKQ A;  4QW9 A;  3RAQ A;  4M2Y A;  4EYH B;  1XS9 D;  1A77 A;  2NYV A;  4RQ4 A;  3LDA A;  1BPB A;  1L7N A;  4DL6 A;  3HPO A;  3E0F A;  1ZQG A;  2KHV A;  2KFZ A;  3KHG A;  4O3Q A;  4YXJ A;  1XC9 A;  4ECQ A;  4BXO B;  4ED7 A;  5CP2 A;  4Y2V A;  4ED6 A;  3GIL A;  2BDU A;  4LJX A;  2YML A;  1MQ2 A;  1KKX A;  1IIP A;  3RF9 A;  4FZL A;  3N7S C;  2L5Y A;  2VA8 A;  5J0R A;  4GXI A;  1CRX A;  2N1R A;  4B9V A;  4DOC A;  2JEF A;  3KKA C;  3BQ2 A;  2Y0S F;  3IN5 A;  5GTH U;  5AM4 A;  2Y0S C;  5DB8 A;  8ICS A;  2XI9 A;  5ALL A;  5CWR A;  2F1I A;  1QLN A;  1SV0 A;  1X9M A;  2XID A;  4QZE A;  7ICN A;  5J2C A;  1QQ6 A;  1ZQH A;  2QB1 A;  9ICT A;  2UVV A;  2K89 A;  5AKE A;  4IQV A;  5J2K A;  3QUQ A;  4FZN A;  2XY6 A;  3BQT A;  2HVH A;  3RJG A;  5AI6 A;  4DL3 A;  3SZ2 A;  5DB9 A;  5AK5 A;  1HEK A;  1S10 A;  2VIX A;  3RH5 A;  5DGA A;  2GOL A;  1NJY A;  3EUB 2;  4I2A A;  1RQN A;  5J0S A;  5DB7 A;  2W8K A;  1BGX T;  5IIN A;  3SYZ A;  4YMM A;  1K5O A;  3PX0 A;  3R9K A;  5TIS U;  2LPE A;  5CB1 A;  1U45 A;  4MEY A;  2MUT B;  8ICK A;  2ASJ A;  4FFD A;  2XC9 A;  3H8W A;  4M9L A;  5D46 A;  2ZTD A;  7ICG A;  2BGW A;  3KHH A;  3PW0 A;  2KIC A;  4UW9 A;  3FM9 A;  3VCB A;  4KLM A;  1COO A;  4GC7 A;  1NKB A;  4O0I A;  5J8Y A;  4CE6 A;  1NK8 A;  2XO7 A;  1ZJM A;  1ZQC A;  4GIB A;  2JGA A;  4KLQ A;  2PKE A;  2ASL A;  1JN3 A;  5EWF A;  2K4H A;  4OJ6 A;  4YG2 A;  2EAN A;  1JAL A;  1AQ6 A;  4DSI A;  5ALD A;  2ZTC A;  2A3V A;  3MDC A;  2AGQ A;  2C2R A;  2C2E A;  4PH5 A;  3Q8R B;  5L9X A;  3THV A;  4DL5 A;  4DL4 A;  2D6F C;  3D6J A;  4PGY A;  4ZH4 A;  2KE7 A;  1JRO A;  4F2S A;  1SXD A;  2G5I B;  4US8 A;  3H4D A;  4HYK A;  3V7J A;  1X9X A;  1S77 D;  5AKI A;  2BPG A;  4QZB A;  1KRP A;  1ZD5 A;  1N5W A;  5KFB A;  3PMN A;  4UAZ A;  2E8P A;  4DLG A;  4PL1 A;  2V4R A;  4QJF B;  3M8R A;  1L8L A;  2Q0Z X;  4U7C A;  4E0D A;  5DBB A;  3V6K A;  1KBU A;  1VLB A;  3QE9 Y;  1F5S A;  1ZRM A;  1L3S A;  2QAR A;  3KD3 A;  5AM2 A;  5B66 U;  3FYH A;  4IRD A;  3D2S A;  2BHN A;  5JUM A;  1UA1 A;  5AKH A;  1J97 A;  2A1A A;  1ZQX A;  2IHM A;  3LVW A;  1NJZ A;  4Y2R A;  1ZQZ A;  5FP0 A;  3LK9 A;  5KFW A;  3QU5 A;  4AYB C;  1BVS A;  4M47 A;  2UVU A;  2QB0 B;  1RG6 A;  3PR4 A;  3B0X A;  3IG8 A;  5KG4 A;  5F9N A;  2IA6 A;  1D8B A;  5HHI A;  4G3I A;  5KFU A;  1KSP A;  1WYG A;  5DLF A;  4DFJ A;  3RJH A;  5KFD A; 
#chains in the Genus database with same CATH homology
 2GH1 A;  3AL0 B;  2PMZ C;  5T14 A;  2KJ9 A;  2KNJ A;  4A8E A;  4NWI A;  3E0F A;  2ZIU B;  3ONN A;  2KHV A;  3KZX A;  3PSF A;  3GZF A;  2F77 X;  2RHF A;  3N7R C;  2XIC A;  3PST A;  4O3M A;  5KL1 B;  2JGA A;  1SZH A;  2JH1 A;  2KIW A;  2BDU A;  2ZIU A;  4QIW F;  3M7D A;  3VC8 A;  2W7P A;  2W7O A;  4CGZ A;  1WUD A;  1ECW A;  1IIP A;  4NV0 A;  3RF9 A;  4FZL A;  2XVT A;  2PMZ F;  3N7S C;  2NV3 A;  2RP5 A;  3HKZ C;  1PVR A;  2K4H A;  3PSP A;  4OJ6 A;  2VJ4 A;  4FE3 A;  2VKQ A;  4ACO A;  2ZXH A;  2N1R A;  1CRX A;  3LVV A;  3C28 A;  3MGV A;  2A3V A;  2LYA A;  3HKZ F;  5CRX A;  2YB1 A;  2D6F C;  2H3F A;  2K4I A;  2Z7J A;  4BJQ A;  3CYM A;  3CP8 A;  2E5S A;  4P0P A;  3GU3 A;  2DF4 B;  2LKY A;  4KX5 A;  3T79 A;  5KL8 B;  4KX3 A;  4WJ3 B;  2Y0S F;  4P0P B;  1TAM A;  3IN5 A;  2G5I B;  2HOQ A;  2K8A A;  4GFJ A;  3H0M B;  2G5H B;  2KVC A;  2Y0S C;  5A0L A;  2KJ8 A;  4AYB F;  2CPR A;  2XI9 A;  3L3F X;  4JMU A;  3SQI A;  4QIW C;  3M6Z A;  3LYS A;  3PZP A;  2H3V A;  4OJO A;  1L6N A;  2KKP A;  3H0R B;  2CRX A;  2YX8 A;  2XID A;  2G06 A;  1A0P A;  2WB1 C;  3SAH A;  3K1Z A;  4KMO B;  1YT3 A;  4ICA A;  3DEE A;  4PL1 A;  4OJP A;  2F76 X;  2ZIX A;  2KD1 A;  2KHQ A;  2MRL A;  3AQE A;  4QJF B;  2F2A B;  3F5E A;  2E1F A;  2K4E A;  3RFA A;  4U7C A;  2KOB A;  1ED1 A;  2RRD A;  4IC9 A;  2WAQ C;  4OJL A;  2HBJ A;  3PSI A;  2R18 A;  1Z1B A;  2K89 A;  1PVP A;  3H0L B;  1KBU A;  2OH2 A;  1A6S A;  2OYY A;  2ZG6 A;  4FZN A;  2W04 A;  3NRW A;  2HMX A;  2VJ5 A;  3N7P D;  1URJ A;  5HR6 A;  3SAG A;  2ZIX B;  1Q3U A;  1HEK A;  1DRG A;  4PL2 A;  1XO0 A;  4QNL A;  3C29 A;  4NLB A;  1GO3 F;  3F2C A;  3M6K A;  2LBO A;  2HOI A;  3D2N A;  2OXO A;  2KV2 A;  2LHT A;  2JH7 A;  2VIX A;  2W03 A;  1ZQ1 C;  4CRX A;  4OO1 J;  2MA1 A;  2OM6 A;  3ICX A;  3SAF A;  2ZXI A;  1XNS A;  1OUQ A;  3D2S A;  5C0Y A;  2GOL A;  2JHD A;  2DQN B;  2ZIW B;  2Q4T A;  3F53 A;  3LVW A;  3CRX A;  1Z19 A;  2DGZ A;  3NUQ A;  3D2Q A;  2KKV A;  2HBL A;  2KJ5 A;  1Q3V A;  4BX9 C;  1PVQ A;  1UPH A;  4AYB C;  3F2D A;  4CDG A;  2ZIV B;  2H3Z A;  3IG8 A;  4P0Q B;  1HIW A;  2JMG A;  3ALR A;  2M0N A;  4OJ5 A;  4NLC A;  3F2B A;  2CN1 A;  2WAQ F;  2G08 A;  3O0F A;  3AQF A;  1P7D A;  2ZIW A;  3KFU F;  1D8B A;  1T94 A;  2K8C B;  1MA7 A;  2E1E A;  3IG5 A;  4FZM A;  3IP4 B;  4BUG A;  2ZIV A;  4P0Q A;  4C0Z A;  3OPX A;  1NZB A;  2F8L A;  2H3Q A;  2HOF A;  2K8B B;  3SMV A;  2KEY A;  2WB1 F;  5HR7 A;  2H3I A;  2YB4 A;  2KIC A;  2G09 A;  2G07 A;  3F5A A;  2HBM A;  3VCB A;  2G0A A;  4U6P A;  1F44 A;  2HBK A;  2LYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...