3VC8A

Crystal structure of the c-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus a59
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
b'TFEEMALTTFMITKESYCKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase
molecule tags Viral protein
source organism Murine hepatitis virus
publication title Crystal structure of the C-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus A59.
pubmed doi rcsb
total genus 28
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3vc8A00
3VC8A 3VCBA 3GZFA
chains in the Genus database with same CATH superfamily
5KFOA 3D6JA 4TQSA 3M9NB 4YR0A 5J2BA 5J2EA 4Z6EA 8ICLA 3V6HA 3KD3A 2NRZA 4PHPA 1T3NA 2KHQA 1SXDA 2HHVA 3RH5A 3GIJA 4BXOA 3RTVA 4UAVA 4QZDA 2W03A 4ED8A 4P4OA 4ELVA 4DSEA 4F5PA 3EUB2 1NK0A 4ECQA 4DL6A 3RRGA 4Z6DA 2RQ5A 5BPCA 1NZBA 2FI1A 4C8KA 3KFUF 1QCKA 5J2AA 3PX4A 3H0MB 5KFVA 5ALSA 3TANA 5HHIA 4R64A 2DPIA 2BPCA 3AQEA 3N7SC 4Q45A 1S0OA 4QWAA 3V7LA 1NNLA 1UPHA 5IILA 4ED0A 4QIWC 4K4IA 2A19A 3H4DA 4BJQA 1PVQA 4M9NA 2JZBA 2W9CA 5ALEA 4JK1A 2FPMA 1Z00B 2KJ9A 2KVCA 1HEKA 3ZD9A 4UB3A 2FLLA 3ETLA 4I2FA 3SAHA 3RH6A 1O08A 3MR2A 3HP6A 2ZJAA 3M9OB 1U9LA 5KFDA 3DEEA 2YB1A 3EPIA 5KG6A 5AI8A 3OHAA 3BDPA 3SAGA 1NOMA 4RT2A 2EDUA 3BQ7A 5J29A 8ICHA 4KLSA 1JI7A 2XY7A 4C4SA 4PH5A 1VDVA 2HOIA 3OPXA 2H3ZA 3NUQA 2ZIUA 5HP4A 2H3QA 4P0PB 5AM1A 1RG6A 4YR2A 4B9LA 2OXOA 5ALIA 4DFMA 3RAXA 1DGJA 1N5XA 4KTQA 2IHNA 4QZ9A 2E8PA 4C8NA 5C5JA 1ZQTA 4UATA 2K8BB 3ZDDA 2F2AB 3UQ0A 5DQIA 5DQHA 1ZQZA 3RRHA 3AN1A 1NKCA 2VJ5A 2I1QA 3RJJA 2W54A 1NK8A 4MHVA 2C2EA 3BS7A 5ALWA 9ICKA 2K8CB 4DSLA 5J0SA 2K4IA 4X5VA 1KW4A 4KLFA 3AUOA 2H3FA 4UB1A 2G07A 2DBYA 3PX0A 5L1MA 4GXJA 2ZTDA 4I2JA 5ALVA 2LHTA 5CB1A 1SGGA 3RJHA 1IV8A 4M9JA 3KKAA 2XC9A 3HKZC 1JN3A 4UB8U 2RRDA 4J9NA 3Q8SB 2KG5A 4IRCA 2NRVA 4I2IA 1XNSA 2UVWA 2KKPA 1SB3C 1BPBA 8ICEA 3OTQA 1XO0A 2KE7A 3N4MB 3KHHA 4QWCA 4FO6A 1X9XA 4G9BA 3MGIA 5AM4A 2B0CA 3WK6A 4OCZA 2E3TA 8ICWA 4QZIA 4KLHA 2EAMA 1BPXA 4M9GA 4UAWA 4BXOB 3SYZA 9ICVA 2HHSA 3DV9A 5C0YA 3MGVA 5J2IA 4J9PA 1TV9A 2ODGA 2YMLA 3EW9A 1NK7A 4QNLA 1BNPA 4YP3A 9ICQA 4DL2A 3T3FA 1X9SA 4DFKA 4Y2VA 1T4GA 3WKBA 5CJ7A 4QZEA 4DCCA 5J2CA 3KZXA 1L3TA 4YQWA 2WAQC 1ZETA 4O5EA 5HR7A 4O3OA 3MFHA 4PGXA 4ZH4A 4B9UA 2BQUA 4DQSA 2JEGA 2DUYA 4KN4A 4M2YA 3D2SA 3PR5B 3H7IA 2RDIA 5J2FA 1P7DA 5IIMA 3O0FA 4RU9A 8ICTA 1TK5A 2LI6A 1BPDA 4ECTA 2JR5A 1ZQAA 1JUDA 2F1HA 4R66A 4Y2XA 3V6JA 5J0TA 1ZD4A 2WF9A 1PVPA 5KG7A 3LVVA 4P0QA 2KVSA 3SENA 3BQ1A 1ZQWA 2KFNA 3PO5A 5J0RA 2KSOB 1U4BA 5DG7A 3U26A 3C2MA 5AICA 2VIXA 5GTHU 9ICXA 5AKLA 1XSLA 3QE9Y 7ICUA 1FEZA 1L6NA 1H38A 3WKEA 3WU2U 4NLBA 2WB1F 4YVZA 3FAHA 2HVHA 5CP2A 5B66U 4RQ1A 7ICRA 2W11A 3UXOA 1TFRA 4US9A 2KZ3A 4XA5A 3F2CA 1RQNA 3B0XA 2A1JB 2NRWA 8ICXA 1ZQGA 3PMNA 4U6PA 2FMPA 3ICXA 4J9LA 2FJ6A 2XVTA 2BHNA 2LYBA 1LKYA 5D4BA 4EX6A 4RQ2A 3EWAA 3M8SA 1IG6A 3MBYA 4F4ZA 2EQYA 4RPXA 9ICJA 7ICHA 4CF4A 2CXYA 3CW2C 3J81j 4NXZA 2QB1A 3TAPA 3K75D 1LB2B 5D49A 2HI0A 1TAUA 1SXEA 3QUQA 1KTQA 5AK5A 5DB8A 1PZNA 2XI9A 4YXJA 2R8IA 3KKAC 1PVRA 1ZRMA 3RJKA 1SKSA 5EE1A 4JUZA 3T5LA 1EXNA 1A6SA 4PZNA 2DGZA 7ICTA 4ECZA 4QJFB 8ICYA 1JROA 5DDYA 4F4WA 1Q46A 1V9PA 3GIMA 4UW9A 1SWVA 4YR3A 2BZFA 2Y9TA 5ALMA 4RQ4A 1MQ3A 3RBDA 2DF4B 1ZQLA 5KG1A 3ZDBA 3KZIU 2WAQF 1V97A 2KEYA 4J9RA 3LK9A 5K4LA 4UQGA 3JPTA 4FBUA 1IIPA 4ECXA 1LKYB 3NVVA 4Q44A 1U47A 1IXRA 1KFTA 1BVSA 2CRXA 5AKJA 2A1AA 2OHFA 3MABA 1N48A 3EPGA 3GV7B 4NJ8A 2BQ3A 4P0QB 3VCBA 4Y2UA 4DL7A 4DLGA 8ICIA 2HVIA 2ZIVA 4J9MA 5DQGA 3TACB 2WF8A 4QWBA 3RH4A 4US8A 2F76X 3RJFA 3L5KA 2A3VA 1ZQSA 1JRPA 2Q0ZX 3SEIA 1J2NA 2V4RA 4DF4A 5DBCA 4P4MA 1URJA 2NO4A 7ICOA 8ICAA 2ZUDA 1M6YA 4JV1A 5ALYA 2XO7A 2GLEA 4I28A 1WCNA 1A77A 3SQIA 3WKAA 2DWQA 1YZ6A 1S77D 5J0UA 3R9KA 3RAQA 4F50A 5ALJA 5JRTA 1ZQEA 3QZ8A 4NM1A 4IQWA 1TAQA 2JV3A 1FFVA 2KP7A 3H0LB 4Q8EA 1ECWA 3HT3A 9ICRA 4R63A 5DDMA 2MUTA 5KFLA 2MUTB 5ALZA 3M8RA 2E8NA 7ICFA 1NKBA 4I27A 1FO4A 4C80A 3FC4A 1JIHA 1XSPA 3S6JA 5ALPA 2YTUA 4NM2A 3NVWA 3GIKA 2V4QA 3ALRA 1ZQNA 3WK9A 2HOQA 7ICQA 4DS4A 4IQTA 3NRZA 3UXPA 1DOQA 3WKDA 4ED6A 4USAA 3GZFA 1SV0C 3PR4A 4KLUA 2W43A 4OJ6A 1Z4NA 2HBKA 3IRUA 5L1LA 1BGXT 9ICSA 1SL1A 1KRPA 9ICEA 2FLPA 2OWOA 1O03A 5KFJA 2KIWA 3Q8MA 1UQVA 2DPJA 1Q8KA 1JX4A 1QSSA 2P35A 1UHUA 3H8WA 3ZDEA 2G09A 2KOBA 3KBBA 4PHEA 4DQPA 2ZIXB 5KNIA 3PSPA 1SV0A 4ICAA 5J0WA 1ZQQA 9ICLA 1NK4A 3UMBA 1DRGA 3C1YA 5H2FU 4KITB 3HX0A 4AYBC 1Q3UA 7ICIA 2R8KA 2F8LA 3PVXA 4YFKA 2BR0A 4QZCA 2L5YA 2GO7A 4OJ5A 4M9LA 4OJPA 8ICGA 4UB2A 3QU4A 1ZD2P 3GIIA 3H40A 4NV0A 3VC8A 2AJQA 3PO4A 1RQLA 4NLNA 2KJ5A 1Z19A 4KLDA 3PW7A 9ICIA 1WG8A 4RQ5A 3CNHA 2ASDA 2VJ4A 5KT5A 2FMQA 3IN5A 4KLIA 3B9JA 2PFQA 1N2XA 4ACOA 2HBMA 4MEYA 1Q3VA 1VLBA 2OH2A 1S8OA 1WCLA 5KFRA 1NK5A 4O3PA 4UAUA 5IIJA 1D8BA 1HIWA 3H8SA 1L7NA 4NLCA 4EELA 5TZVA 2ZJ8A 3HW8A 3BQ2A 3KTQA 5KFPA 4LZGA 4YCXA 5EOZA 4YMNA 5DG8A 3IG5A 3B0YA 4A8EA 2W8LA 1S10A 2ATLA 3RF9A 3QEBZ 2F44A 4KLOA 5J8YC 5D46A 3TAQA 4ELUA 2QLTA 2FLNA 4RQ0A 3M1YA 4YMOA 4ECYA 3PSTA 4F5NA 4UARA 2ZXHA 4YG2A 5F3XB 5CR0A 3HPOA 1Z1BA 1NZPA 4DOBA 2LBOA 4M9HA 5AI6A 8ICKA 1IM4A 3IDWA 4IS7A 4JWMA 4EYIB 1L5UA 1ZQKA 5JUMA 2ZUCA 5KFTA 5ALNA 2AQ0A 4F4KA 3DDHA 2BPGA 1AROP 3AMZA 3SMVA 2KD1A 4QWEA 1N62A 3OGUA 4I2HA 1KDHA 3T5JA 3QNMA 1ZQVA 2GOLA 5KL1B 1D8YA 4CF3A 2UVUA 4MFAA 1X9WA 2YN4A 5TISU 1ZQ1C 3CYMA 2GWSA 2JH7A 3WK4A 2OM6A 1S0MA 5GTIU 3PNCA 1VJ5A 3Q8PB 1KFDA 5KG2A 4FZNA 5DGAA 3OSNA 3BQTA 5KFEA 5KFZA 4P2HA 3EZ5A 2HOFA 2MU2A 2RDJA 2FMSA 4UBCA 5F9LA 2PXIA 4TUSA 5DBBA 5ALLA 2W9AA 1X66A 1X6JA 5AI9A 5KG0A 3KHRA 4PGQA 1CI4A 5AI0A 2IOFA 4DFDA 4KX5A 4RQ3A 2O6KA 4CGZA 4ED3A 2KTQA 2MSNA 1T8EA 1AQ6A 4O0IA 9ICOA 3BZCA 5KAFU 3QYPA 4RQNA 4CRXA 1QSLA 5G5HA 4MEXA 4KLLA 4M0AA 3RB4A 5DKWA 4GLXA 2ES6A 2JRZA 2H3VA 3T79A 2NV3A 4KN7A 4QZHA 5AK3A 3K1RB 4RUAA 1DGSA 3TADA 2EH9A 4RQMA 4Y2YA 2HDOA 8ICOA 2YMPA 2F77X 2HHTA 2IMWP 1S5LU 2D3DA 4QZGA 1S0VA 2UVVA 4B6JA 5KT3A 3QU7A 5AHXA 3JPSA 2V9WA 4ED7A 1MN8A 1SIJA 3A0BU 3QU2A 3TARA 5AKEA 3T5KA 8ICCA 1V85A 9ICCA 1UCVA 4GXKA 1ZQMA 3ZDAA 1UT5A 2DFLA 1HUZA 1TVAA 3RJEA 1ZQRA 3E0FA 2G06A 1TKDA 2BCSA 2F3NA 3C29A 3WK7A 2ASLA 5DGBA 5J8YA 4BWMA 1RDFA 4RPZA 3SI8A 4RQ6A 4Y2PA 2JMGA 1MQ2A 4J9QA 1F0MA 3ISBA 1RYUA 4RQ7A 1K1QA 4JV0A 1ZOLA 2XICA 1WWVA 7ICMA 8ICBA 3RFAA 1N63A 2K4HA 4OJOA 3NVZA 3ZI4A 4M6WA 2PFOA 2PKEA 2JEJA 3MR5A 1S9FA 5KFUA 1KLNA 2LM4A 5J2JA 4IC9A 4IR1A 5T14A 4DFPA 5IIKA 1D9DA 4TQRA 7ICPA 3KOOA 2XY6A 2BPFA 1MSWD 2PI4A 4EBEA 8ICFA 2ISPA 4OO1J 4UB4A 4AP9A 5JTIA 4PZOA 2K4EA 2ZG6A 4KLJA 3ZDCA 2I6XA 2P6RA 5AM2A 3RR7A 3MR6A 1N5WA 2Y0SC 5AM0A 4C7ZA 2DQNB 1T94A 1XU4A 4ECVA 3UXNA 4Y2RA 4ZOHC 4FZLA 4XRHA 4QZ8A 1BPEA 3E2EA 5ALOA 1RYSA 3G6YA 1L3VA 3RB3A 5L1IA 3RBEA 3QXGA 4C7YA 2YQEA 4YXMA 3SR6A 1WUDA 3AL0B 4PHDA 2C2RA 3RR8A 3GDXA 1ZQUA 1TE2A 2W9MA 2OYYA 3BS5B 4RNOA 2W7OA 5KG5A 3QU9A 3L4PA 3BQ0A 2PMZF 1OW5A 4DOAA 1XC9A 3ONNA 5ALRA 4FS1A 3LDAA 7ICGA 1QQ6A 1ZQDA 4I2DA 1JALA 2QKQA 4DL3A 1B22A 2FPLA 5ALXA 4FBTA 3K1ZA 4YMMA 5J2HA 2HBJA 1RZTA 2M9NA 2IA6A 5ALHA 5DB6A 4DQIA 5HMMA 3GQCA 1SL0A 5KG4A 4DLEA 4Z6CA 4RT3A 2KHVA 4CNQA 2B6GA 2Q4TA 4BGDA 2E5SA 4EEKA 4LVSA 2WFAA 3I28A 1ZYQA 2JEFA 1MC8A 4BWJA 2G5HB 4AYBF 1X9MA 3BZKA 4PL2A 1FFUA 2BDUA 4UASA 4Z6FA 5B5EU 1F44A 4DEZA 5KT4A 2F8KA 3UQ2A 5ALGA 5DBAA 1X2IA 3MGHA 2WF7A 4B9NA 1QLNA 4KLMA 4IL6U 5KFKA 4FE3A 3OHBA 1SWWA 2M0NA 5J0XA 2PFNA 1XSNA 1PK1B 4XQ8A 3F2DA 2JGAA 4MF8A 4FFDA 1ZJNA 4PPXA 2W9BB 4B9SA 2D8CA 1KBUA 2HHXA 1D8LA 3AU6A 8ICNA 4DQQA 9ICTA 4B9VA 3PSFA 4IR9A 2BCVA 2NYVA 3WK8A 5AI5A 2ZIXA 4KX3A 3UPQA 2BCRA 2G0AA 4MFFA 2W55A 2ISOA 3IV6A 3PZPA 4RNMA 4DS5A 2QARA 2BCQA 4G3IA 2JXJA 4JWNA 1TAMA 8ICUA 2GH1A 3G6XA 4F92B 1WYGA 5AKIA 2J6UA 2JZBB 3FDSA 1KFSA 3HKZF 3IM1A 4GFJA 2RHFA 4EX7A 5CA7A 4DFJA 2LM1A 2W3SA 4F93B 1QQ5A 1SKRA 1ED1A 1LV5A 4F8RA 1MA7A 5KFIA 3OSPA 3N28A 3M7DA 3KHLA 2Y1IA 4I29A 4NLGA 1SV4A 5KFWA 2KNJA 3EYZA 2K89A 3FM9A 4EZ6A 5L9XA 8ICRA 2KV2A 2AQ4A 5CEHA 5FP0A 2ZIWA 2ALZA 1YT3A 1ZQCA 1COKA 4R8UA 3D2QA 4K4HA 1LVHA 4KLQA 3LVWA 2NRTA 4FZMA 2BGWA 7ICSA 4RPYA 4ELTA 8ICMA 4HAIA 4Y2JA 4KLGA 4I2EA 1C20A 5J0QA 1XWLA 3V6KA 4DSIA 5KL8B 4NY8A 1ZJMA 5JU5A 5IINA 1ZQIA 2QARB 1ZQOA 9ICHA 1L8LA 5EE9A 2N1RA 3D2NA 1ZQFA 5AKYA 4UAYA 2MA1A 4CE6A 1K5OA 4E0DA 4C0ZA 1L8OA 5KFQA 2DKXA 1NJZA 1RXWA 1NJWA 1UT8A 1XO1A 1ZRNA 4QZAA 1L7MA 3GFKB 3C21A 3NASA 1Z3EB 2KKVA 2C2DA 1N60A 3IP4B 2R8JA 2EZYA 5J2DA 2AGQA 4ED1A 2YX8A 3JPQA 3C28A 3M6ZA 3RJGA 2ZIWB 4J03A 1N56A 2CN1A 5L1KA 4RNNA 3MR3A 2IBKA 3UMGA 2KK0A 2KICA 3Q8RB 5ALQA 1S97A 4JV2A 4NL9A 1QTMA 1BPYA 2C22A 1N61A 5J2GA 5DLFA 3C5FA 1COOA 4OJLA 4QWDA 4P0PA 3H4BA 5J0OA 1QSYA 2FDRA 4ECWA 4BX9C 1A0PA 2EAPA 4QZFA 4F3OA 4ED2A 4F2SA 9ICMA 3JPRA 5ALFA 3WK5A 4DWIA 4KMOB 4R65A 5KFMA 4C8LA 5A0LA 1X42A 4DSKA 3V7KA 1U48A 5CHGA 4FS2A 5AKKA 1NI3A 3SV3A 1DXSA 2I9GA 4Q8FA 4UBBA 4O3QA 3RJIA 1KQQA 1JXLA 5KT6A 4DO9A 4J9OA 3HJEA 2IOFK 4F4YA 3G6VA 2B21A 3OJSA 4U7CA 4Y2SA 8ICJA 1ZD5A 3SV4A 3WKCA 1DK3A 2ESEA 1RYRA 5ALDA 3JPNA 3IHQB 4PGYA 1JMSA 2KFZA 2VA8A 2LYAA 3ED5A 5HNKA 3N7PD 4I2AA 3OJUA 4UB5A 4O3RA 4QW9A 7ICVA 4I2CA 4DQRA 3Q8KA 1T7PA 3PV8A 4YD2A 2KZZA 7ICEA 4NWIA 3TFRA 5AIBA 4RZRA 2WB1C 3CP8A 2W9CB 2F1IA 2W3RA 1A76A 4EEYA 1L7PA 4C8MA 3TQ1A 5J0PA 1NK6A 4EENA 2AHOB 1XS9D 4MFCA 3QEAZ 3PX6A 1L3SA 2C28A 4JB3A 2ZUBA 2LPEA 1OXJA 2VA2A 5KFYA 4J9SA 4EBCA 7ICNA 4TUPA 2Y1JA 1D9FA 5CRXA 2XGQA 1B43A 2HBLA 5E79U 2WF6A 4PJ0U 4DF8A 1B0XA 3RB6A 2E8MA 4RQ8A 4O3MA 4F71A 1PUZA 3E58A 4UB6U 2EAOA 3THVA 1QH9A 2ZJ5A 2WTFA 4GC7A 5DB7A 5HMLA 4KMUA 1Z1VA 1ZQYA 2RP5A 5DG9A 2HHWA 2AXTU 3RB0A 5KTQA 2KJ8A 5KFHA 4HYKA 3HRDD 2RLTA 3A0HU 1TK0A 4K4GA 5AKXA 4J9KA 2I5HA 3NS1A 2HHQA 2P66A 1RPLA 5BOLA 3GU3A 4O3SA 5J2KA 1V38A 4ECRA 9ICAA 3SAFA 2XCPA 4I2GA 3QUTA 3GV5B 4Y2TA 1ZQJA 2UVRA 4RUCA 3C23A 5EE3A 1CUKA 9ICBA 4ECUA 3ORYA 5HHHA 2FPKA 2Y9UA 8ICQA 2AU0A 2LKYA 5KAIU 3I76A 4GXIA 5AK4A 2CPRA 1Z00A 4B9TA 4TUQA 2JH1A 2JHDA 3K4GA 1PK3A 2R8HA 5J0YA 1BNOA 4F4XA 3SZ2A 4DL4A 3Q8LA 4LZDA 1UA1A 3ZD8A 1F5SA 2XGPA 4P4PA 5KFGA 5CWRA 2W04A 2VANA 1OUQA 5HR6A 4O5KA 2AH5A 5ALTA 2DL0A 4R8UB 2DKZA 2QB0A 1X40A 2KIVA 2J6TA 3JPPA 4DSFA 4DSJA 4C4TA 2Y0SF 2BKEA 1CEZA 3C2LA 1Z4OA 5AM3A 4IRKA 4O9MA 2ZXIA 3F2BA 1NK9A 4QW8A 4C8OA 4NLKA 1U49A 5DLGA 4IRDA 1QQ7A 8ICVA 1L3UA 5AKGA 5KT2A 4KLEA 3HILA 1RXVA 2G5IB 3GV8B 1WWUA 3N97B 3BJYA 2K60A 1Y88A 2OCEA 5KFNA 3H8MA 3JPOA 8ICPA 2H5XA 2HSZA 4F91B 2R8GA 4NL9C 1PK1A 1C7YA 3AQFA 1S76D 3QUCA 2NRXA 2KMDA 5KG3A 2IHMA 2PFPA 4EYHB 1ZQHA 2HMXA 1RM6C 4PHAA 2YMMA 2NO5A 1ZXIA 5AKZA 2VA3A 8ICZA 4CDGA 1BPZA 4XUSA 5KFCA 3QUBA 4IQVA 3NVYA 2XY5A 3UMCA 3LWMA 1ZQXA 5AI4A 5AM5A 4M47A 2JEIA 4GIBA 9ICWA 5EWEA 3T5HA 4GC6A 4CCHA 2KZMA 4O5CA 1HJPA 4LJXA 3PW2A 9ICUA 2HHUA 1KKXA 2ZTEA 1SZPA 9ICFA 2E1EA 5EWGA 5ALKA 1SL2A 1X6IA 2KN7A 3C1ZA 3PSIA 7ICLA 3PW4A 1KL9A 1ZQBA 3AEVA 5EE0A 9ICNA 4C4RA 2HCFA 2P6UA 3HWTA 4F5RA 3IG8A 3QX7A 1T3QA 3AU2A 4IQUA 5KFAA 4NLZA 3V72A 4BDPA 2D6FC 2BCUA 1KN5A 1DK2A 5AIAA 4JMUA 2H3IA 7ICKA 2IOHA 3PMLA 4QIWF 3KHGA 1ZD3A 2WF5A 1J97A 1ZQPA 4PL1A 3F5EA 3TKAA 4ECSA 3L3FX 2VKQA 9ICGA 2FE9A 3M9MB 3QZ7A 1K1SA 5IIIA 4Y2QA 3NTUA 1B4FA 2XIDA 5BOMA 3V7JA 8ICSA 2EZZA 1KEJA 4DOCA 9ICPA 5ALUA 2XCAA 3LYSA 4UAZA 3NRWA 2W9BA 4F5QA 1S0NA 5KFBA 3TADC 3TI0A 3UM9A 2MRLA 2ZTCA 3F5AA 3H8JA 7ICJA 1NKEA 3MDCA 4O3NA 2AGPA 2HW3A 2YMQA 2BQRA 2PI5A 1UA0A 5KFFA 3PW5A 3N7RC 1GO3F 2K8AA 2F1JA 3H0RB 2QB0B 3MC1A 4F72A 4I2BA 5AKHA 2WHEA 2BDPA 3ISDA 2E8OA 4Q43A 2AGOA 3I1YA 4KLTA 2R18A 2EANA 3MFIA 2W8KA 2E1FA 3F53A 1FIQA 3ISCA 3PY8A 2G08A 1NJXA 4B9MA 3GILA 4M6WB 4F5OA 2EZXA 5DB9A 2LYHA 2MAXA 4BUGA 4WJ3B 5KFSA 5L1JA 2A1JA 5G5GA 4YN4A 2W7PA 5EWFA 1J2MA 1KSPA 2LMRA 2J6SA 3C5GA 3TFSA 5AK6A 5KFXA 3FYHA 3LWLA 3Q8QB 4EZ9A 2K4PA 3ETRA 3MDAA 2ASJA 1SZHA 2YY6A 5F9NA 1NJYA 4OD0A 4MF2A 2YB4A 1L7OA 1CRXA 3AM9A 4TURA 3PW0A 4M04A 1TK8A 4CF5A 4DL5A 2ZIVB 2KSOA 4QZBA 4EBDA 2Z7JA 3CRXA 3NGDA 4F2RA 1HUOA 3M6KA 2OEHA 3SD7A 1U45A 1SKWA 5IIOA 1JXEA 3BS5A 1YZ7A 5KT7A 2ZIUB 4YD1A 2PMZC 3C2KA 3QU5A
chains in the Genus database with same CATH topology
2JGAA 5KL8B 2LYAA 1WUDA 2CPRA 2HOFA 2CRXA 3OPXA 3E0FA 1HIWA 2G06A 2HOIA 3AL0B 1D8BA 2H3ZA 2JH1A 3N7PD 2JHDA 4NLCA 1KBUA 3C29A 4P0QB 3VCBA 3F2CA 3NUQA 3N7RC 3GZFA 2N1RA 1GO3F 3D2NA 2K8AA 3H0RB 2HBKA 2OYYA 4OJ6A 2KHQA 2ZIUA 4U6PA 3IG5A 4A8EA 3ICXA 2MA1A 3PSFA 2W7OA 2H3QA 5C0YA 4P0PB 2ZIVA 2XVTA 2JMGA 3MGVA 4C0ZA 4NWIA 4QNLA 2OXOA 2E1EA 2PMZF 2LYBA 2W03A 3RF9A 2ZIXA 4KX3A 4KX5A 3ONNA 2WB1C 3CP8A 2W04A 2G0AA 2F76X 2R18A 2KIWA 1OUQA 4CGZA 5HR6A 2XICA 2E1FA 2A3VA 3F53A 3KZXA 3PZPA 2K8BB 3PSIA 2G08A 3RFAA 1NZBA 2WAQC 2F2AB 2K4HA 2KKVA 4CRXA 5HR7A 2Y0SF 1TAMA 4OJOA 3KFUF 2GH1A 2G09A 3PSTA 3IP4B 1URJA 3H0MB 3IG8A 3K1ZA 2KOBA 2VJ5A 2YX8A 2ZXHA 2HBJA 2ZXIA 2ZIXB 3F2BA 3AQEA 3PSPA 3C28A 3N7SC 3M6ZA 3HKZF 4ICAA 4GFJA 4BUGA 2ZIWB 1Z1BA 2RHFA 2H3VA 4WJ3B 5CRXA 2HBLA 2CN1A 2K8CB 2NV3A 3T79A 3SQIA 1DRGA 3D2SA 2W7PA 2D6FC 1UPHA 2LBOA 2XI9A 2KICA 2K4IA 4AYBC 1Q3UA 1P7DA 2KHVA 4IC9A 1PVRA 2F8LA 2Q4TA 5T14A 4O3MA 3O0FA 4QIWC 2H3FA 2E5SA 4JMUA 2G07A 4BJQA 2G5IB 2H3IA 1PVQA 4OJLA 1ED1A 4P0PA 1SZHA 2LHTA 4QIWF 1MA7A 4BX9C 1A0PA 2G5HB 1A6SA 2F77X 1PVPA 2KJ9A 4AYBF 2KVCA 2RP5A 2DGZA 3M7DA 4OJ5A 1HEKA 3SMVA 2KD1A 4PL1A 4QJFB 3F5EA 2YB4A 4OO1J 4OJPA 4PL2A 3H0LB 2KJ8A 2VKQA 3L3FX 3LVVA 4KMOB 2K4EA 2ZG6A 4P0QA 1CRXA 1ECWA 2KNJA 3HKZC 2BDUA 2K89A 5A0LA 3AQFA 2XIDA 3SAHA 1F44A 2RRDA 2KV2A 4NV0A 3VC8A 2HMXA 2GOLA 2ZIVB 5KL1B 2VIXA 2Z7JA 2Y0SC 2DF4B 3DEEA 2KJ5A 2YB1A 3GU3A 1Z19A 3CRXA 2ZIWA 2DQNB 4CDGA 1L6NA 1T94A 1YT3A 3LYSA 3M6KA 2WAQF 3NRWA 2VJ4A 3SAFA 2KEYA 3D2QA 2KKPA 1XNSA 1ZQ1C 3CYMA 4FE3A 3LVWA 4FZMA 2M0NA 2JH7A 4FZLA 4NLBA 4U7CA 3IN5A 2OM6A 1XO0A 3SAGA 4ACOA 2HBMA 2WB1F 1Q3VA 1IIPA 3ALRA 2ZIUB 2OH2A 2HOQA 4FZNA 2MRLA 2PMZC 3F5AA 3F2DA 2LKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VC8 A;  3VCB A;  3GZF A; 
#chains in the Genus database with same CATH topology
 5KFO A;  3D6J A;  4TQS A;  3M9N B;  4YR0 A;  5J2B A;  5J2E A;  4Z6E A;  8ICL A;  3V6H A;  3KD3 A;  2NRZ A;  4PHP A;  1T3N A;  2KHQ A;  1SXD A;  2HHV A;  3RH5 A;  3GIJ A;  4BXO A;  3RTV A;  4UAV A;  4QZD A;  2W03 A;  4ED8 A;  4P4O A;  4ELV A;  4DSE A;  4F5P A;  3EUB 2;  1NK0 A;  4ECQ A;  4DL6 A;  3RRG A;  4Z6D A;  2RQ5 A;  5BPC A;  1NZB A;  2FI1 A;  4C8K A;  3KFU F;  1QCK A;  5J2A A;  3PX4 A;  3H0M B;  5KFV A;  5ALS A;  3TAN A;  5HHI A;  4R64 A;  2DPI A;  2BPC A;  3AQE A;  3N7S C;  4Q45 A;  1S0O A;  4QWA A;  3V7L A;  1NNL A;  1UPH A;  5IIL A;  4ED0 A;  4QIW C;  4K4I A;  2A19 A;  3H4D A;  4BJQ A;  1PVQ A;  4M9N A;  2JZB A;  2W9C A;  5ALE A;  4JK1 A;  2FPM A;  1Z00 B;  2KJ9 A;  2KVC A;  1HEK A;  3ZD9 A;  4UB3 A;  2FLL A;  3ETL A;  4I2F A;  3SAH A;  3RH6 A;  1O08 A;  3MR2 A;  3HP6 A;  2ZJA A;  3M9O B;  1U9L A;  5KFD A;  3DEE A;  2YB1 A;  3EPI A;  5KG6 A;  5AI8 A;  3OHA A;  3BDP A;  3SAG A;  1NOM A;  4RT2 A;  2EDU A;  3BQ7 A;  5J29 A;  8ICH A;  4KLS A;  1JI7 A;  2XY7 A;  4C4S A;  4PH5 A;  1VDV A;  2HOI A;  3OPX A;  2H3Z A;  3NUQ A;  2ZIU A;  5HP4 A;  2H3Q A;  4P0P B;  5AM1 A;  1RG6 A;  4YR2 A;  4B9L A;  2OXO A;  5ALI A;  4DFM A;  3RAX A;  1DGJ A;  1N5X A;  4KTQ A;  2IHN A;  4QZ9 A;  2E8P A;  4C8N A;  5C5J A;  1ZQT A;  4UAT A;  2K8B B;  3ZDD A;  2F2A B;  3UQ0 A;  5DQI A;  5DQH A;  1ZQZ A;  3RRH A;  3AN1 A;  1NKC A;  2VJ5 A;  2I1Q A;  3RJJ A;  2W54 A;  1NK8 A;  4MHV A;  2C2E A;  3BS7 A;  5ALW A;  9ICK A;  2K8C B;  4DSL A;  5J0S A;  2K4I A;  4X5V A;  1KW4 A;  4KLF A;  3AUO A;  2H3F A;  4UB1 A;  2G07 A;  2DBY A;  3PX0 A;  5L1M A;  4GXJ A;  2ZTD A;  4I2J A;  5ALV A;  2LHT A;  5CB1 A;  1SGG A;  3RJH A;  1IV8 A;  4M9J A;  3KKA A;  2XC9 A;  3HKZ C;  1JN3 A;  4UB8 U;  2RRD A;  4J9N A;  3Q8S B;  2KG5 A;  4IRC A;  2NRV A;  4I2I A;  1XNS A;  2UVW A;  2KKP A;  1SB3 C;  1BPB A;  8ICE A;  3OTQ A;  1XO0 A;  2KE7 A;  3N4M B;  3KHH A;  4QWC A;  4FO6 A;  1X9X A;  4G9B A;  3MGI A;  5AM4 A;  2B0C A;  3WK6 A;  4OCZ A;  2E3T A;  8ICW A;  4QZI A;  4KLH A;  2EAM A;  1BPX A;  4M9G A;  4UAW A;  4BXO B;  3SYZ A;  9ICV A;  2HHS A;  3DV9 A;  5C0Y A;  3MGV A;  5J2I A;  4J9P A;  1TV9 A;  2ODG A;  2YML A;  3EW9 A;  1NK7 A;  4QNL A;  1BNP A;  4YP3 A;  9ICQ A;  4DL2 A;  3T3F A;  1X9S A;  4DFK A;  4Y2V A;  1T4G A;  3WKB A;  5CJ7 A;  4QZE A;  4DCC A;  5J2C A;  3KZX A;  1L3T A;  4YQW A;  2WAQ C;  1ZET A;  4O5E A;  5HR7 A;  4O3O A;  3MFH A;  4PGX A;  4ZH4 A;  4B9U A;  2BQU A;  4DQS A;  2JEG A;  2DUY A;  4KN4 A;  4M2Y A;  3D2S A;  3PR5 B;  3H7I A;  2RDI A;  5J2F A;  1P7D A;  5IIM A;  3O0F A;  4RU9 A;  8ICT A;  1TK5 A;  2LI6 A;  1BPD A;  4ECT A;  2JR5 A;  1ZQA A;  1JUD A;  2F1H A;  4R66 A;  4Y2X A;  3V6J A;  5J0T A;  1ZD4 A;  2WF9 A;  1PVP A;  5KG7 A;  3LVV A;  4P0Q A;  2KVS A;  3SEN A;  3BQ1 A;  1ZQW A;  2KFN A;  3PO5 A;  5J0R A;  2KSO B;  1U4B A;  5DG7 A;  3U26 A;  3C2M A;  5AIC A;  2VIX A;  5GTH U;  9ICX A;  5AKL A;  1XSL A;  3QE9 Y;  7ICU A;  1FEZ A;  1L6N A;  1H38 A;  3WKE A;  3WU2 U;  4NLB A;  2WB1 F;  4YVZ A;  3FAH A;  2HVH A;  5CP2 A;  5B66 U;  4RQ1 A;  7ICR A;  2W11 A;  3UXO A;  1TFR A;  4US9 A;  2KZ3 A;  4XA5 A;  3F2C A;  1RQN A;  3B0X A;  2A1J B;  2NRW A;  8ICX A;  1ZQG A;  3PMN A;  4U6P A;  2FMP A;  3ICX A;  4J9L A;  2FJ6 A;  2XVT A;  2BHN A;  2LYB A;  1LKY A;  5D4B A;  4EX6 A;  4RQ2 A;  3EWA A;  3M8S A;  1IG6 A;  3MBY A;  4F4Z A;  2EQY A;  4RPX A;  9ICJ A;  7ICH A;  4CF4 A;  2CXY A;  3CW2 C;  3J81 j;  4NXZ A;  2QB1 A;  3TAP A;  3K75 D;  1LB2 B;  5D49 A;  2HI0 A;  1TAU A;  1SXE A;  3QUQ A;  1KTQ A;  5AK5 A;  5DB8 A;  1PZN A;  2XI9 A;  4YXJ A;  2R8I A;  3KKA C;  1PVR A;  1ZRM A;  3RJK A;  1SKS A;  5EE1 A;  4JUZ A;  3T5L A;  1EXN A;  1A6S A;  4PZN A;  2DGZ A;  7ICT A;  4ECZ A;  4QJF B;  8ICY A;  1JRO A;  5DDY A;  4F4W A;  1Q46 A;  1V9P A;  3GIM A;  4UW9 A;  1SWV A;  4YR3 A;  2BZF A;  2Y9T A;  5ALM A;  4RQ4 A;  1MQ3 A;  3RBD A;  2DF4 B;  1ZQL A;  5KG1 A;  3ZDB A;  3KZI U;  2WAQ F;  1V97 A;  2KEY A;  4J9R A;  3LK9 A;  5K4L A;  4UQG A;  3JPT A;  4FBU A;  1IIP A;  4ECX A;  1LKY B;  3NVV A;  4Q44 A;  1U47 A;  1IXR A;  1KFT A;  1BVS A;  2CRX A;  5AKJ A;  2A1A A;  2OHF A;  3MAB A;  1N48 A;  3EPG A;  3GV7 B;  4NJ8 A;  2BQ3 A;  4P0Q B;  3VCB A;  4Y2U A;  4DL7 A;  4DLG A;  8ICI A;  2HVI A;  2ZIV A;  4J9M A;  5DQG A;  3TAC B;  2WF8 A;  4QWB A;  3RH4 A;  4US8 A;  2F76 X;  3RJF A;  3L5K A;  2A3V A;  1ZQS A;  1JRP A;  2Q0Z X;  3SEI A;  1J2N A;  2V4R A;  4DF4 A;  5DBC A;  4P4M A;  1URJ A;  2NO4 A;  7ICO A;  8ICA A;  2ZUD A;  1M6Y A;  4JV1 A;  5ALY A;  2XO7 A;  2GLE A;  4I28 A;  1WCN A;  1A77 A;  3SQI A;  3WKA A;  2DWQ A;  1YZ6 A;  1S77 D;  5J0U A;  3R9K A;  3RAQ A;  4F50 A;  5ALJ A;  5JRT A;  1ZQE A;  3QZ8 A;  4NM1 A;  4IQW A;  1TAQ A;  2JV3 A;  1FFV A;  2KP7 A;  3H0L B;  4Q8E A;  1ECW A;  3HT3 A;  9ICR A;  4R63 A;  5DDM A;  2MUT A;  5KFL A;  2MUT B;  5ALZ A;  3M8R A;  2E8N A;  7ICF A;  1NKB A;  4I27 A;  1FO4 A;  4C80 A;  3FC4 A;  1JIH A;  1XSP A;  3S6J A;  5ALP A;  2YTU A;  4NM2 A;  3NVW A;  3GIK A;  2V4Q A;  3ALR A;  1ZQN A;  3WK9 A;  2HOQ A;  7ICQ A;  4DS4 A;  4IQT A;  3NRZ A;  3UXP A;  1DOQ A;  3WKD A;  4ED6 A;  4USA A;  3GZF A;  1SV0 C;  3PR4 A;  4KLU A;  2W43 A;  4OJ6 A;  1Z4N A;  2HBK A;  3IRU A;  5L1L A;  1BGX T;  9ICS A;  1SL1 A;  1KRP A;  9ICE A;  2FLP A;  2OWO A;  1O03 A;  5KFJ A;  2KIW A;  3Q8M A;  1UQV A;  2DPJ A;  1Q8K A;  1JX4 A;  1QSS A;  2P35 A;  1UHU A;  3H8W A;  3ZDE A;  2G09 A;  2KOB A;  3KBB A;  4PHE A;  4DQP A;  2ZIX B;  5KNI A;  3PSP A;  1SV0 A;  4ICA A;  5J0W A;  1ZQQ A;  9ICL A;  1NK4 A;  3UMB A;  1DRG A;  3C1Y A;  5H2F U;  4KIT B;  3HX0 A;  4AYB C;  1Q3U A;  7ICI A;  2R8K A;  2F8L A;  3PVX A;  4YFK A;  2BR0 A;  4QZC A;  2L5Y A;  2GO7 A;  4OJ5 A;  4M9L A;  4OJP A;  8ICG A;  4UB2 A;  3QU4 A;  1ZD2 P;  3GII A;  3H40 A;  4NV0 A;  3VC8 A;  2AJQ A;  3PO4 A;  1RQL A;  4NLN A;  2KJ5 A;  1Z19 A;  4KLD A;  3PW7 A;  9ICI A;  1WG8 A;  4RQ5 A;  3CNH A;  2ASD A;  2VJ4 A;  5KT5 A;  2FMQ A;  3IN5 A;  4KLI A;  3B9J A;  2PFQ A;  1N2X A;  4ACO A;  2HBM A;  4MEY A;  1Q3V A;  1VLB A;  2OH2 A;  1S8O A;  1WCL A;  5KFR A;  1NK5 A;  4O3P A;  4UAU A;  5IIJ A;  1D8B A;  1HIW A;  3H8S A;  1L7N A;  4NLC A;  4EEL A;  5TZV A;  2ZJ8 A;  3HW8 A;  3BQ2 A;  3KTQ A;  5KFP A;  4LZG A;  4YCX A;  5EOZ A;  4YMN A;  5DG8 A;  3IG5 A;  3B0Y A;  4A8E A;  2W8L A;  1S10 A;  2ATL A;  3RF9 A;  3QEB Z;  2F44 A;  4KLO A;  5J8Y C;  5D46 A;  3TAQ A;  4ELU A;  2QLT A;  2FLN A;  4RQ0 A;  3M1Y A;  4YMO A;  4ECY A;  3PST A;  4F5N A;  4UAR A;  2ZXH A;  4YG2 A;  5F3X B;  5CR0 A;  3HPO A;  1Z1B A;  1NZP A;  4DOB A;  2LBO A;  4M9H A;  5AI6 A;  8ICK A;  1IM4 A;  3IDW A;  4IS7 A;  4JWM A;  4EYI B;  1L5U A;  1ZQK A;  5JUM A;  2ZUC A;  5KFT A;  5ALN A;  2AQ0 A;  4F4K A;  3DDH A;  2BPG A;  1ARO P;  3AMZ A;  3SMV A;  2KD1 A;  4QWE A;  1N62 A;  3OGU A;  4I2H A;  1KDH A;  3T5J A;  3QNM A;  1ZQV A;  2GOL A;  5KL1 B;  1D8Y A;  4CF3 A;  2UVU A;  4MFA A;  1X9W A;  2YN4 A;  5TIS U;  1ZQ1 C;  3CYM A;  2GWS A;  2JH7 A;  3WK4 A;  2OM6 A;  1S0M A;  5GTI U;  3PNC A;  1VJ5 A;  3Q8P B;  1KFD A;  5KG2 A;  4FZN A;  5DGA A;  3OSN A;  3BQT A;  5KFE A;  5KFZ A;  4P2H A;  3EZ5 A;  2HOF A;  2MU2 A;  2RDJ A;  2FMS A;  4UBC A;  5F9L A;  2PXI A;  4TUS A;  5DBB A;  5ALL A;  2W9A A;  1X66 A;  1X6J A;  5AI9 A;  5KG0 A;  3KHR A;  4PGQ A;  1CI4 A;  5AI0 A;  2IOF A;  4DFD A;  4KX5 A;  4RQ3 A;  2O6K A;  4CGZ A;  4ED3 A;  2KTQ A;  2MSN A;  1T8E A;  1AQ6 A;  4O0I A;  9ICO A;  3BZC A;  5KAF U;  3QYP A;  4RQN A;  4CRX A;  1QSL A;  5G5H A;  4MEX A;  4KLL A;  4M0A A;  3RB4 A;  5DKW A;  4GLX A;  2ES6 A;  2JRZ A;  2H3V A;  3T79 A;  2NV3 A;  4KN7 A;  4QZH A;  5AK3 A;  3K1R B;  4RUA A;  1DGS A;  3TAD A;  2EH9 A;  4RQM A;  4Y2Y A;  2HDO A;  8ICO A;  2YMP A;  2F77 X;  2HHT A;  2IMW P;  1S5L U;  2D3D A;  4QZG A;  1S0V A;  2UVV A;  4B6J A;  5KT3 A;  3QU7 A;  5AHX A;  3JPS A;  2V9W A;  4ED7 A;  1MN8 A;  1SIJ A;  3A0B U;  3QU2 A;  3TAR A;  5AKE A;  3T5K A;  8ICC A;  1V85 A;  9ICC A;  1UCV A;  4GXK A;  1ZQM A;  3ZDA A;  1UT5 A;  2DFL A;  1HUZ A;  1TVA A;  3RJE A;  1ZQR A;  3E0F A;  2G06 A;  1TKD A;  2BCS A;  2F3N A;  3C29 A;  3WK7 A;  2ASL A;  5DGB A;  5J8Y A;  4BWM A;  1RDF A;  4RPZ A;  3SI8 A;  4RQ6 A;  4Y2P A;  2JMG A;  1MQ2 A;  4J9Q A;  1F0M A;  3ISB A;  1RYU A;  4RQ7 A;  1K1Q A;  4JV0 A;  1ZOL A;  2XIC A;  1WWV A;  7ICM A;  8ICB A;  3RFA A;  1N63 A;  2K4H A;  4OJO A;  3NVZ A;  3ZI4 A;  4M6W A;  2PFO A;  2PKE A;  2JEJ A;  3MR5 A;  1S9F A;  5KFU A;  1KLN A;  2LM4 A;  5J2J A;  4IC9 A;  4IR1 A;  5T14 A;  4DFP A;  5IIK A;  1D9D A;  4TQR A;  7ICP A;  3KOO A;  2XY6 A;  2BPF A;  1MSW D;  2PI4 A;  4EBE A;  8ICF A;  2ISP A;  4OO1 J;  4UB4 A;  4AP9 A;  5JTI A;  4PZO A;  2K4E A;  2ZG6 A;  4KLJ A;  3ZDC A;  2I6X A;  2P6R A;  5AM2 A;  3RR7 A;  3MR6 A;  1N5W A;  2Y0S C;  5AM0 A;  4C7Z A;  2DQN B;  1T94 A;  1XU4 A;  4ECV A;  3UXN A;  4Y2R A;  4ZOH C;  4FZL A;  4XRH A;  4QZ8 A;  1BPE A;  3E2E A;  5ALO A;  1RYS A;  3G6Y A;  1L3V A;  3RB3 A;  5L1I A;  3RBE A;  3QXG A;  4C7Y A;  2YQE A;  4YXM A;  3SR6 A;  1WUD A;  3AL0 B;  4PHD A;  2C2R A;  3RR8 A;  3GDX A;  1ZQU A;  1TE2 A;  2W9M A;  2OYY A;  3BS5 B;  4RNO A;  2W7O A;  5KG5 A;  3QU9 A;  3L4P A;  3BQ0 A;  2PMZ F;  1OW5 A;  4DOA A;  1XC9 A;  3ONN A;  5ALR A;  4FS1 A;  3LDA A;  7ICG A;  1QQ6 A;  1ZQD A;  4I2D A;  1JAL A;  2QKQ A;  4DL3 A;  1B22 A;  2FPL A;  5ALX A;  4FBT A;  3K1Z A;  4YMM A;  5J2H A;  2HBJ A;  1RZT A;  2M9N A;  2IA6 A;  5ALH A;  5DB6 A;  4DQI A;  5HMM A;  3GQC A;  1SL0 A;  5KG4 A;  4DLE A;  4Z6C A;  4RT3 A;  2KHV A;  4CNQ A;  2B6G A;  2Q4T A;  4BGD A;  2E5S A;  4EEK A;  4LVS A;  2WFA A;  3I28 A;  1ZYQ A;  2JEF A;  1MC8 A;  4BWJ A;  2G5H B;  4AYB F;  1X9M A;  3BZK A;  4PL2 A;  1FFU A;  2BDU A;  4UAS A;  4Z6F A;  5B5E U;  1F44 A;  4DEZ A;  5KT4 A;  2F8K A;  3UQ2 A;  5ALG A;  5DBA A;  1X2I A;  3MGH A;  2WF7 A;  4B9N A;  1QLN A;  4KLM A;  4IL6 U;  5KFK A;  4FE3 A;  3OHB A;  1SWW A;  2M0N A;  5J0X A;  2PFN A;  1XSN A;  1PK1 B;  4XQ8 A;  3F2D A;  2JGA A;  4MF8 A;  4FFD A;  1ZJN A;  4PPX A;  2W9B B;  4B9S A;  2D8C A;  1KBU A;  2HHX A;  1D8L A;  3AU6 A;  8ICN A;  4DQQ A;  9ICT A;  4B9V A;  3PSF A;  4IR9 A;  2BCV A;  2NYV A;  3WK8 A;  5AI5 A;  2ZIX A;  4KX3 A;  3UPQ A;  2BCR A;  2G0A A;  4MFF A;  2W55 A;  2ISO A;  3IV6 A;  3PZP A;  4RNM A;  4DS5 A;  2QAR A;  2BCQ A;  4G3I A;  2JXJ A;  4JWN A;  1TAM A;  8ICU A;  2GH1 A;  3G6X A;  4F92 B;  1WYG A;  5AKI A;  2J6U A;  2JZB B;  3FDS A;  1KFS A;  3HKZ F;  3IM1 A;  4GFJ A;  2RHF A;  4EX7 A;  5CA7 A;  4DFJ A;  2LM1 A;  2W3S A;  4F93 B;  1QQ5 A;  1SKR A;  1ED1 A;  1LV5 A;  4F8R A;  1MA7 A;  5KFI A;  3OSP A;  3N28 A;  3M7D A;  3KHL A;  2Y1I A;  4I29 A;  4NLG A;  1SV4 A;  5KFW A;  2KNJ A;  3EYZ A;  2K89 A;  3FM9 A;  4EZ6 A;  5L9X A;  8ICR A;  2KV2 A;  2AQ4 A;  5CEH A;  5FP0 A;  2ZIW A;  2ALZ A;  1YT3 A;  1ZQC A;  1COK A;  4R8U A;  3D2Q A;  4K4H A;  1LVH A;  4KLQ A;  3LVW A;  2NRT A;  4FZM A;  2BGW A;  7ICS A;  4RPY A;  4ELT A;  8ICM A;  4HAI A;  4Y2J A;  4KLG A;  4I2E A;  1C20 A;  5J0Q A;  1XWL A;  3V6K A;  4DSI A;  5KL8 B;  4NY8 A;  1ZJM A;  5JU5 A;  5IIN A;  1ZQI A;  2QAR B;  1ZQO A;  9ICH A;  1L8L A;  5EE9 A;  2N1R A;  3D2N A;  1ZQF A;  5AKY A;  4UAY A;  2MA1 A;  4CE6 A;  1K5O A;  4E0D A;  4C0Z A;  1L8O A;  5KFQ A;  2DKX A;  1NJZ A;  1RXW A;  1NJW A;  1UT8 A;  1XO1 A;  1ZRN A;  4QZA A;  1L7M A;  3GFK B;  3C21 A;  3NAS A;  1Z3E B;  2KKV A;  2C2D A;  1N60 A;  3IP4 B;  2R8J A;  2EZY A;  5J2D A;  2AGQ A;  4ED1 A;  2YX8 A;  3JPQ A;  3C28 A;  3M6Z A;  3RJG A;  2ZIW B;  4J03 A;  1N56 A;  2CN1 A;  5L1K A;  4RNN A;  3MR3 A;  2IBK A;  3UMG A;  2KK0 A;  2KIC A;  3Q8R B;  5ALQ A;  1S97 A;  4JV2 A;  4NL9 A;  1QTM A;  1BPY A;  2C22 A;  1N61 A;  5J2G A;  5DLF A;  3C5F A;  1COO A;  4OJL A;  4QWD A;  4P0P A;  3H4B A;  5J0O A;  1QSY A;  2FDR A;  4ECW A;  4BX9 C;  1A0P A;  2EAP A;  4QZF A;  4F3O A;  4ED2 A;  4F2S A;  9ICM A;  3JPR A;  5ALF A;  3WK5 A;  4DWI A;  4KMO B;  4R65 A;  5KFM A;  4C8L A;  5A0L A;  1X42 A;  4DSK A;  3V7K A;  1U48 A;  5CHG A;  4FS2 A;  5AKK A;  1NI3 A;  3SV3 A;  1DXS A;  2I9G A;  4Q8F A;  4UBB A;  4O3Q A;  3RJI A;  1KQQ A;  1JXL A;  5KT6 A;  4DO9 A;  4J9O A;  3HJE A;  2IOF K;  4F4Y A;  3G6V A;  2B21 A;  3OJS A;  4U7C A;  4Y2S A;  8ICJ A;  1ZD5 A;  3SV4 A;  3WKC A;  1DK3 A;  2ESE A;  1RYR A;  5ALD A;  3JPN A;  3IHQ B;  4PGY A;  1JMS A;  2KFZ A;  2VA8 A;  2LYA A;  3ED5 A;  5HNK A;  3N7P D;  4I2A A;  3OJU A;  4UB5 A;  4O3R A;  4QW9 A;  7ICV A;  4I2C A;  4DQR A;  3Q8K A;  1T7P A;  3PV8 A;  4YD2 A;  2KZZ A;  7ICE A;  4NWI A;  3TFR A;  5AIB A;  4RZR A;  2WB1 C;  3CP8 A;  2W9C B;  2F1I A;  2W3R A;  1A76 A;  4EEY A;  1L7P A;  4C8M A;  3TQ1 A;  5J0P A;  1NK6 A;  4EEN A;  2AHO B;  1XS9 D;  4MFC A;  3QEA Z;  3PX6 A;  1L3S A;  2C28 A;  4JB3 A;  2ZUB A;  2LPE A;  1OXJ A;  2VA2 A;  5KFY A;  4J9S A;  4EBC A;  7ICN A;  4TUP A;  2Y1J A;  1D9F A;  5CRX A;  2XGQ A;  1B43 A;  2HBL A;  5E79 U;  2WF6 A;  4PJ0 U;  4DF8 A;  1B0X A;  3RB6 A;  2E8M A;  4RQ8 A;  4O3M A;  4F71 A;  1PUZ A;  3E58 A;  4UB6 U;  2EAO A;  3THV A;  1QH9 A;  2ZJ5 A;  2WTF A;  4GC7 A;  5DB7 A;  5HML A;  4KMU A;  1Z1V A;  1ZQY A;  2RP5 A;  5DG9 A;  2HHW A;  2AXT U;  3RB0 A;  5KTQ A;  2KJ8 A;  5KFH A;  4HYK A;  3HRD D;  2RLT A;  3A0H U;  1TK0 A;  4K4G A;  5AKX A;  4J9K A;  2I5H A;  3NS1 A;  2HHQ A;  2P66 A;  1RPL A;  5BOL A;  3GU3 A;  4O3S A;  5J2K A;  1V38 A;  4ECR A;  9ICA A;  3SAF A;  2XCP A;  4I2G A;  3QUT A;  3GV5 B;  4Y2T A;  1ZQJ A;  2UVR A;  4RUC A;  3C23 A;  5EE3 A;  1CUK A;  9ICB A;  4ECU A;  3ORY A;  5HHH A;  2FPK A;  2Y9U A;  8ICQ A;  2AU0 A;  2LKY A;  5KAI U;  3I76 A;  4GXI A;  5AK4 A;  2CPR A;  1Z00 A;  4B9T A;  4TUQ A;  2JH1 A;  2JHD A;  3K4G A;  1PK3 A;  2R8H A;  5J0Y A;  1BNO A;  4F4X A;  3SZ2 A;  4DL4 A;  3Q8L A;  4LZD A;  1UA1 A;  3ZD8 A;  1F5S A;  2XGP A;  4P4P A;  5KFG A;  5CWR A;  2W04 A;  2VAN A;  1OUQ A;  5HR6 A;  4O5K A;  2AH5 A;  5ALT A;  2DL0 A;  4R8U B;  2DKZ A;  2QB0 A;  1X40 A;  2KIV A;  2J6T A;  3JPP A;  4DSF A;  4DSJ A;  4C4T A;  2Y0S F;  2BKE A;  1CEZ A;  3C2L A;  1Z4O A;  5AM3 A;  4IRK A;  4O9M A;  2ZXI A;  3F2B A;  1NK9 A;  4QW8 A;  4C8O A;  4NLK A;  1U49 A;  5DLG A;  4IRD A;  1QQ7 A;  8ICV A;  1L3U A;  5AKG A;  5KT2 A;  4KLE A;  3HIL A;  1RXV A;  2G5I B;  3GV8 B;  1WWU A;  3N97 B;  3BJY A;  2K60 A;  1Y88 A;  2OCE A;  5KFN A;  3H8M A;  3JPO A;  8ICP A;  2H5X A;  2HSZ A;  4F91 B;  2R8G A;  4NL9 C;  1PK1 A;  1C7Y A;  3AQF A;  1S76 D;  3QUC A;  2NRX A;  2KMD A;  5KG3 A;  2IHM A;  2PFP A;  4EYH B;  1ZQH A;  2HMX A;  1RM6 C;  4PHA A;  2YMM A;  2NO5 A;  1ZXI A;  5AKZ A;  2VA3 A;  8ICZ A;  4CDG A;  1BPZ A;  4XUS A;  5KFC A;  3QUB A;  4IQV A;  3NVY A;  2XY5 A;  3UMC A;  3LWM A;  1ZQX A;  5AI4 A;  5AM5 A;  4M47 A;  2JEI A;  4GIB A;  9ICW A;  5EWE A;  3T5H A;  4GC6 A;  4CCH A;  2KZM A;  4O5C A;  1HJP A;  4LJX A;  3PW2 A;  9ICU A;  2HHU A;  1KKX A;  2ZTE A;  1SZP A;  9ICF A;  2E1E A;  5EWG A;  5ALK A;  1SL2 A;  1X6I A;  2KN7 A;  3C1Z A;  3PSI A;  7ICL A;  3PW4 A;  1KL9 A;  1ZQB A;  3AEV A;  5EE0 A;  9ICN A;  4C4R A;  2HCF A;  2P6U A;  3HWT A;  4F5R A;  3IG8 A;  3QX7 A;  1T3Q A;  3AU2 A;  4IQU A;  5KFA A;  4NLZ A;  3V72 A;  4BDP A;  2D6F C;  2BCU A;  1KN5 A;  1DK2 A;  5AIA A;  4JMU A;  2H3I A;  7ICK A;  2IOH A;  3PML A;  4QIW F;  3KHG A;  1ZD3 A;  2WF5 A;  1J97 A;  1ZQP A;  4PL1 A;  3F5E A;  3TKA A;  4ECS A;  3L3F X;  2VKQ A;  9ICG A;  2FE9 A;  3M9M B;  3QZ7 A;  1K1S A;  5III A;  4Y2Q A;  3NTU A;  1B4F A;  2XID A;  5BOM A;  3V7J A;  8ICS A;  2EZZ A;  1KEJ A;  4DOC A;  9ICP A;  5ALU A;  2XCA A;  3LYS A;  4UAZ A;  3NRW A;  2W9B A;  4F5Q A;  1S0N A;  5KFB A;  3TAD C;  3TI0 A;  3UM9 A;  2MRL A;  2ZTC A;  3F5A A;  3H8J A;  7ICJ A;  1NKE A;  3MDC A;  4O3N A;  2AGP A;  2HW3 A;  2YMQ A;  2BQR A;  2PI5 A;  1UA0 A;  5KFF A;  3PW5 A;  3N7R C;  1GO3 F;  2K8A A;  2F1J A;  3H0R B;  2QB0 B;  3MC1 A;  4F72 A;  4I2B A;  5AKH A;  2WHE A;  2BDP A;  3ISD A;  2E8O A;  4Q43 A;  2AGO A;  3I1Y A;  4KLT A;  2R18 A;  2EAN A;  3MFI A;  2W8K A;  2E1F A;  3F53 A;  1FIQ A;  3ISC A;  3PY8 A;  2G08 A;  1NJX A;  4B9M A;  3GIL A;  4M6W B;  4F5O A;  2EZX A;  5DB9 A;  2LYH A;  2MAX A;  4BUG A;  4WJ3 B;  5KFS A;  5L1J A;  2A1J A;  5G5G A;  4YN4 A;  2W7P A;  5EWF A;  1J2M A;  1KSP A;  2LMR A;  2J6S A;  3C5G A;  3TFS A;  5AK6 A;  5KFX A;  3FYH A;  3LWL A;  3Q8Q B;  4EZ9 A;  2K4P A;  3ETR A;  3MDA A;  2ASJ A;  1SZH A;  2YY6 A;  5F9N A;  1NJY A;  4OD0 A;  4MF2 A;  2YB4 A;  1L7O A;  1CRX A;  3AM9 A;  4TUR A;  3PW0 A;  4M04 A;  1TK8 A;  4CF5 A;  4DL5 A;  2ZIV B;  2KSO A;  4QZB A;  4EBD A;  2Z7J A;  3CRX A;  3NGD A;  4F2R A;  1HUO A;  3M6K A;  2OEH A;  3SD7 A;  1U45 A;  1SKW A;  5IIO A;  1JXE A;  3BS5 A;  1YZ7 A;  5KT7 A;  2ZIU B;  4YD1 A;  2PMZ C;  3C2K A;  3QU5 A; 
#chains in the Genus database with same CATH homology
 2JGA A;  5KL8 B;  2LYA A;  1WUD A;  2CPR A;  2HOF A;  2CRX A;  3OPX A;  3E0F A;  1HIW A;  2G06 A;  2HOI A;  3AL0 B;  1D8B A;  2H3Z A;  2JH1 A;  3N7P D;  2JHD A;  4NLC A;  1KBU A;  3C29 A;  4P0Q B;  3VCB A;  3F2C A;  3NUQ A;  3N7R C;  3GZF A;  2N1R A;  1GO3 F;  3D2N A;  2K8A A;  3H0R B;  2HBK A;  2OYY A;  4OJ6 A;  2KHQ A;  2ZIU A;  4U6P A;  3IG5 A;  4A8E A;  3ICX A;  2MA1 A;  3PSF A;  2W7O A;  2H3Q A;  5C0Y A;  4P0P B;  2ZIV A;  2XVT A;  2JMG A;  3MGV A;  4C0Z A;  4NWI A;  4QNL A;  2OXO A;  2E1E A;  2PMZ F;  2LYB A;  2W03 A;  3RF9 A;  2ZIX A;  4KX3 A;  4KX5 A;  3ONN A;  2WB1 C;  3CP8 A;  2W04 A;  2G0A A;  2F76 X;  2R18 A;  2KIW A;  1OUQ A;  4CGZ A;  5HR6 A;  2XIC A;  2E1F A;  2A3V A;  3F53 A;  3KZX A;  3PZP A;  2K8B B;  3PSI A;  2G08 A;  3RFA A;  1NZB A;  2WAQ C;  2F2A B;  2K4H A;  2KKV A;  4CRX A;  5HR7 A;  2Y0S F;  1TAM A;  4OJO A;  3KFU F;  2GH1 A;  2G09 A;  3PST A;  3IP4 B;  1URJ A;  3H0M B;  3IG8 A;  3K1Z A;  2KOB A;  2VJ5 A;  2YX8 A;  2ZXH A;  2HBJ A;  2ZXI A;  2ZIX B;  3F2B A;  3AQE A;  3PSP A;  3C28 A;  3N7S C;  3M6Z A;  3HKZ F;  4ICA A;  4GFJ A;  4BUG A;  2ZIW B;  1Z1B A;  2RHF A;  2H3V A;  4WJ3 B;  5CRX A;  2HBL A;  2CN1 A;  2K8C B;  2NV3 A;  3T79 A;  3SQI A;  1DRG A;  3D2S A;  2W7P A;  2D6F C;  1UPH A;  2LBO A;  2XI9 A;  2KIC A;  2K4I A;  4AYB C;  1Q3U A;  1P7D A;  2KHV A;  4IC9 A;  1PVR A;  2F8L A;  2Q4T A;  5T14 A;  4O3M A;  3O0F A;  4QIW C;  2H3F A;  2E5S A;  4JMU A;  2G07 A;  4BJQ A;  2G5I B;  2H3I A;  1PVQ A;  4OJL A;  1ED1 A;  4P0P A;  1SZH A;  2LHT A;  4QIW F;  1MA7 A;  4BX9 C;  1A0P A;  2G5H B;  1A6S A;  2F77 X;  1PVP A;  2KJ9 A;  4AYB F;  2KVC A;  2RP5 A;  2DGZ A;  3M7D A;  4OJ5 A;  1HEK A;  3SMV A;  2KD1 A;  4PL1 A;  4QJF B;  3F5E A;  2YB4 A;  4OO1 J;  4OJP A;  4PL2 A;  3H0L B;  2KJ8 A;  2VKQ A;  3L3F X;  3LVV A;  4KMO B;  2K4E A;  2ZG6 A;  4P0Q A;  1CRX A;  1ECW A;  2KNJ A;  3HKZ C;  2BDU A;  2K89 A;  5A0L A;  3AQF A;  2XID A;  3SAH A;  1F44 A;  2RRD A;  2KV2 A;  4NV0 A;  3VC8 A;  2HMX A;  2GOL A;  2ZIV B;  5KL1 B;  2VIX A;  2Z7J A;  2Y0S C;  2DF4 B;  3DEE A;  2KJ5 A;  2YB1 A;  3GU3 A;  1Z19 A;  3CRX A;  2ZIW A;  2DQN B;  4CDG A;  1L6N A;  1T94 A;  1YT3 A;  3LYS A;  3M6K A;  2WAQ F;  3NRW A;  2VJ4 A;  3SAF A;  2KEY A;  3D2Q A;  2KKP A;  1XNS A;  1ZQ1 C;  3CYM A;  4FE3 A;  3LVW A;  4FZM A;  2M0N A;  2JH7 A;  4FZL A;  4NLB A;  4U7C A;  3IN5 A;  2OM6 A;  1XO0 A;  3SAG A;  4ACO A;  2HBM A;  2WB1 F;  1Q3V A;  1IIP A;  3ALR A;  2ZIU B;  2OH2 A;  2HOQ A;  4FZN A;  2MRL A;  2PMZ C;  3F5A A;  3F2D A;  2LKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...