3VC8A

Crystal structure of the c-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus a59
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
TFEEMALTTFMITKESYCKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords RNA-directed RNA polymerase
publication title Crystal structure of the C-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus A59.
pubmed doi rcsb
source organism Murine hepatitis virus
total genus 28
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3vc8A00
3VC8A 3VCBA 3GZFA
chains in the Genus database with same CATH superfamily
3BS5B 4PJ0U 2GLEA 2RDJA 3WKBA 5AIBA 4JWMA 3BQTA 2HHXA 3UPQA 5F9NA 5AIAA 1NK7A 4J9PA 3N7SC 1KKXA 8ICXA 4UBCA 5DG7A 5AKLA 2RRDA 2J6UA 4J03A 4G3IA 2WB1C 2G5HB 3EUB2 5J0TA 2HBLA 9ICXA 4C8LA 4ED6A 4MFCA 2MUTA 3QUBA 4DFMA 2G09A 4BUGA 3PZPA 4C4RA 5L1JA 1WYGA 1JALA 2AU0A 2F1HA 1KTQA 4KLFA 3SMVA 1XO1A 3AUOA 4QZIA 3H0MB 5AM2A 4AP9A 2BCSA 1Z00A 9ICUA 4QJFB 3OSPA 2BGWA 4QNLA 4F5PA 2FMPA 2ESEA 1ZQEA 2LMRA 7ICPA 4F5QA 2GWSA 5KFCA 2W11A 2FJ6A 3FYHA 2ALZA 2XY5A 1J2NA 2PFNA 3OGUA 3MBYA 5ALKA 1HUZA 2IHNA 5KFRA 3GFKB 4DF8A 2B0CA 1VDVA 1RXVA 3N7RC 2K4EA 3QU2A 4EEYA 1A0PA 2HI0A 7ICSA 5G5GA 5EWEA 2ZUBA 4R8UB 2ZIUA 3PW5A 4NV0A 3DDHA 4CCHA 5AK4A 4QZ9A 8ICBA 5ALPA 3N97B 2XC9A 4PH5A 3H8MA 4J9LA 3T3FA 2P6UA 4C7YA 3TFSA 4Z6FA 3SAGA 2HBKA 4F4YA 1SWVA 2RP5A 3MGVA 1S77D 4C0ZA 2HOIA 5L1LA 4PHPA 4B9VA 1XWLA 7ICLA 2C2RA 3K4GA 2K60A 4DLGA 3GIKA 4B9MA 3MGIA 4B9LA 2NRXA 3OHAA 2HVIA 3JPQA 2A3VA 1ZQIA 5GTIU 4NM1A 4ECUA 4I29A 5AI9A 4R64A 3UMBA 8ICOA 5KT2A 3ONNA 5J0WA 3DEEA 5KAFU 3RBDA 4RQMA 2K8BB 3TACB 3MR3A 4KMOB 3T5HA 5C0YA 2HOQA 2ASLA 2VANA 5TISU 4I2HA 4EEKA 2KFZA 5EOZA 4CRXA 2KIVA 3GV7B 4F3OA 1ZQVA 3PW7A 3PW2A 3WKEA 1KL9A 5GTHU 8ICNA 3PSIA 1L6NA 5CP2A 5BOLA 3CRXA 1ZQWA 4MFFA 4YP3A 1MC8A 3GILA 4GLXA 3G6XA 1PVRA 5ALUA 4KLLA 5KFGA 4DFJA 1NKEA 4OJ6A 4ECQA 2ASDA 4FZLA 4B6JA 3HPOA 2IHMA 2QARA 4AYBF 5DG8A 4RNNA 1L8OA 3UXNA 2LM4A 1XO0A 2JR5A 2F76X 2WFAA 1X2IA 5IIKA 1L7NA 1SKSA 2KZMA 4YMNA 4YCXA 4EYHB 1RXWA 3PR4A 2KJ8A 1KRPA 4EBCA 5AI0A 1UA1A 3QUTA 2G06A 5ALSA 2VA3A 4C8KA 2ZJ5A 3IG8A 8ICQA 2HDOA 3RAXA 9ICCA 4RQ3A 2G0AA 2XIDA 1QSLA 5AM5A 2KE7A 4PZNA 5KG2A 5HHHA 1WWVA 4CF3A 4IL6U 3KBBA 3V72A 3WKDA 2Y1IA 3QNMA 4IQTA 1TVAA 1ZQCA 4YR3A 4KLSA 1ZJNA 2AGPA 3OHBA 2ZIVB 1SL0A 4GXIA 3TAQA 4Y2RA 3M6KA 1ZD4A 4F2RA 2A1JA 5ALMA 5HMLA 4DS5A 4RQ2A 2LBOA 4DWIA 1NJZA 1UT8A 3TARA 5J29A 3KHGA 5ALOA 3TAPA 2I1QA 3OJUA 4IR1A 4K4HA 9ICBA 4F8RA 1ZQRA 5KFWA 5KFBA 4NLBA 2AQ4A 1XSPA 1IV8A 1SGGA 4F72A 3HP6A 1B0XA 3O0FA 3QEBZ 2JMGA 4EBDA 1S0MA 4F91B 1OW5A 1JUDA 3PX6A 3C2MA 1WUDA 2UVRA 3LDAA 1F44A 2XY7A 2XGQA 2JRZA 1KSPA 4P4PA 1SKWA 2UVWA 4RUAA 5KAIU 2D8CA 3C1YA 3ISBA 5KT5A 4YG2A 4EELA 2W9AA 5FP0A 4YMMA 2ZTDA 4FFDA 5KG1A 5KFEA 1SXEA 4NLZA 1ZQUA 1ZQTA 3B0XA 2ZTEA 4M9HA 2VIXA 3MFHA 4UAUA 4UAZA 4RQ8A 2GH1A 4EYIB 1NJYA 1B43A 3KHLA 3C21A 3T5JA 2NRVA 5KFDA 3GU3A 4PL2A 2I5HA 4Q8FA 1JIHA 4RZRA 3GZFA 3K1ZA 3RJEA 1X9XA 3H4BA 2HHVA 4MHVA 4B9SA 5A0LA 4XQ8A 1N63A 5JTIA 2QARB 3LWLA 4J9NA 1NK6A 1B4FA 1ZRNA 2RQ5A 5EE9A 5BPCA 1K1SA 1KW4A 4RPZA 4IQUA 5L1MA 1FFUA 1S5LU 4F93B 5EWFA 4DL4A 4BJQA 1JRPA 2RDIA 4QIWC 5J2DA 5AKIA 1S10A 2E8NA 4M6WA 3PX4A 7ICIA 3PO5A 5DKWA 4QZ8A 4F5RA 2VA2A 4O3OA 2PKEA 1TK5A 1QQ7A 3WK8A 4ECVA 5JU5A 1SV0C 3RF9A 3EPIA 5ALTA 2ZIXB 5J8YC 4O5CA 1DK3A 4KLMA 4DSKA 3BS5A 4UAYA 3T5KA 4ED3A 5KFAA 2A1JB 2AXTU 4A8EA 1ZQYA 2W43A 1HJPA 2B21A 1N48A 7ICHA 2HOFA 2HW3A 3C1ZA 3V6HA 4ED0A 4O5KA 4Y2TA 1TAMA 4I2JA 4RUCA 3RJJA 4ECRA 1A6SA 1MQ3A 5ALXA 3LWMA 5ALEA 3EPGA 4DOAA 1LVHA 5L9XA 4ED7A 3WU2U 4GFJA 4IRKA 4I2DA 4UASA 1ZJMA 1ZQJA 2N1RA 2Y9UA 3Q8KA 2Q0ZX 5ALVA 3E2EA 1ZD5A 3PR5B 4QW8A 1L3UA 3KTQA 2F2AB 1ZYQA 3S6JA 5J2FA 3C2LA 3AU6A 4P0QB 1LB2B 5KTQA 4QZHA 3BQ7A 5AM0A 5IIOA 5IINA 2BQUA 1HEKA 2BCRA 4WJ3B 1SZHA 2HHUA 3SZ2A 3ETRA 2W3SA 1UHUA 4IS7A 2ODGA 4QW9A 1BPZA 1J97A 4RQ7A 1ZQKA 4Y2UA 4NL9C 4FS1A 4DCCA 3PY8A 3BS7A 9ICGA 3PNCA 5IIJA 4M47A 5J2EA 3SYZA 2BCQA 3MABA 1SV0A 1YZ7A 4BWMA 5ALNA 3CW2C 5J8YA 8ICFA 2D3DA 5KT6A 1O08A 3BJYA 3V6KA 4QWBA 3F2DA 1T3QA 2NRWA 3SI8A 3ZDEA 1SXDA 2H3ZA 4DOBA 2IOFK 2YQEA 3PO4A 1ZQDA 2E1EA 1ZQSA 2FLNA 2RLTA 1F5SA 4K4IA 8ICHA 2BDUA 2F44A 3AU2A 9ICAA 1BPDA 5AKGA 5BOMA 3WK9A 2ZXHA 3IM1A 7ICTA 5KFIA 8ICGA 4DSLA 5TZVA 5CRXA 2D6FC 2IOHA 3RR7A 1P7DA 1RZTA 4MEYA 4UB3A 2OCEA 4R65A 4KX3A 3WK7A 2DUYA 1ZQAA 2ZUDA 2V4QA 3FAHA 5J0PA 8ICVA 1ZRMA 2KG5A 1ED1A 3WK5A 4K4GA 3I1YA 5DB9A 3MC1A 3QU9A 3ZDBA 1QH9A 3D2NA 5EE3A 1H38A 3WK6A 1QSSA 9ICIA 2GOLA 4KLQA 7ICOA 8ICSA 4NM2A 4GXKA 4MF2A 3NVZA 4JK1A 1TAQA 3BQ2A 4OJOA 3GIJA 3BZCA 4NL9A 1QSYA 3T79A 2W8LA 5KL8B 3V7KA 3LVWA 1TAUA 2JEJA 4ELVA 3NVVA 3EWAA 4DFPA 3UM9A 2YMLA 4QZFA 4OJPA 3IG5A 4TUQA 3ISCA 4RT3A 4YR0A 4Y2XA 4KLHA 3RAQA 4FZNA 2JEGA 2EDUA 4DO9A 8ICPA 5DBCA 8ICJA 1AQ6A 4BDPA 3ED5A 2KICA 2ZJ8A 3N7PD 9ICPA 2HBJA 2I6XA 2LYAA 4FS2A 4PGXA 3RJKA 1X40A 4O3PA 4FZMA 3IN5A 2BZFA 4MFAA 3MDAA 4YQWA 3NVWA 4DQSA 4KLGA 2HHWA 3PSPA 3CYMA 1RQNA 5JRTA 1KN5A 2HBMA 4QZCA 3G6YA 3PX0A 3H40A 2H3VA 3BQ0A 5HNKA 4PHDA 3BQ1A 2P66A 2KSOB 2ZIWB 3HILA 4F4XA 2ZIVA 2K4PA 3QU5A 2LM1A 4R66A 3NUQA 5D4BA 1K5OA 5ALQA 2PFOA 4Q44A 4QZDA 2JXJA 1D9DA 1LV5A 5D49A 2ES6A 5L1KA 5DB6A 3L5KA 4RNOA 1T4GA 1XU4A 2BCUA 7ICVA 4CF5A 2R8HA 2EAMA 1ZQGA 4RQ6A 1A77A 1L7PA 1WWUA 1ZQPA 1DXSA 2BQRA 1KEJA 1PVQA 5KNIA 5AI5A 5KFLA 1U47A 2HSZA 4KITB 4USAA 2JH7A 8ICAA 4KLIA 2AQ0A 3F53A 3CP8A 4NJ8A 3RFAA 4TURA 4NLKA 3SAHA 2M0NA 4LVSA 1V85A 4G9BA 4KLEA 2DL0A 1XNSA 1WCNA 3MR5A 1NZBA 3NVYA 5DB8A 2BPGA 1COKA 4KMUA 3ZD8A 3UXOA 3L3FX 1SIJA 1ZETA 2K4HA 2DKXA 3PMNA 8ICEA 3T5LA 2J6TA 4EX7A 1UT5A 4I27A 5ALRA 1ZD3A 2BPFA 4J9OA 3BDPA 1RM6C 5ALWA 1BPYA 4F4ZA 1U9LA 5JUMA 4UB5A 4MEXA 2G5IB 1UCVA 3NTUA 2KK0A 3GV8B 4TQSA 1N62A 5DLGA 4O0IA 2AHOB 1UQVA 5J0RA 4J9SA 1SKRA 2CXYA 5HR6A 3F5EA 1DGSA 2KKPA 3AEVA 3WKCA 2YN4A 3V6JA 2EZZA 4JUZA 5KG5A 3Q8QB 4JV2A 1XC9A 4O3RA 3C28A 5AI6A 4YVZA 3KFUF 3KOOA 5CWRA 4HAIA 1S0NA 5F3XB 2ZIXA 5AI8A 2DQNB 3TADA 4QWEA 2DPJA 3H0LB 3WKAA 2JGAA 3IV6A 2KHVA 2ZXIA 3LYSA 4O5EA 2XI9A 2E8PA 2KVCA 2YX8A 4M2YA 3UQ2A 1N60A 1RDFA 1S76D 1X9MA 5DDMA 3JPOA 5KG0A 4KLUA 3PVXA 4UB2A 3KZIU 3TFRA 2LI6A 3E58A 1NZPA 4ELTA 8ICRA 2EQYA 2DKZA 3HT3A 8ICTA 1AROP 1UPHA 5J0XA 2CRXA 2R8GA 5ALJA 1SV4A 2H3FA 1RPLA 4OJ5A 2ZG6A 7ICEA 1NI3A 4OCZA 2A19A 2BR0A 1X9WA 3Q8LA 1QCKA 3M7DA 2EANA 2MRLA 2KMDA 4UB8U 2NV3A 2EAOA 1V38A 2DPIA 1L3SA 1QTMA 9ICOA 4AYBC 2RHFA 5EWGA 5KT7A 2AH5A 5IIMA 3OSNA 4M9JA 4DFDA 1COOA 7ICUA 9ICQA 2PMZF 5AM1A 9ICVA 4P0QA 4J9RA 2NO4A 3KHRA 1MSWD 1N2XA 4CNQA 5DGBA 2KHQA 5AK5A 1NJXA 2G08A 4XUSA 3V7JA 3B9JA 4C7ZA 3HW8A 4QZGA 3RBEA 4Y2VA 2Y9TA 3RJHA 1FFVA 5J2BA 5CEHA 3A0HU 1RYUA 4GC6A 5KFPA 2LYHA 4DQPA 4DL7A 1CEZA 3TQ1A 4EBEA 1SL2A 2HVHA 5KFMA 1A76A 4C8MA 3KKAC 5CA7A 4TUSA 4UQGA 2DWQA 4NLGA 2FPMA 4OD0A 3ZDAA 2DF4B 4RQ1A 8ICKA 1OUQA 3QZ8A 5J2HA 4YXJA 5AKYA 3M6ZA 1MQ2A 3SR6A 4B9UA 2FMSA 1FO4A 1HUOA 1CUKA 8ICLA 2F1JA 1C20A 2CPRA 2ZJAA 3AL0B 3GV5B 1RYSA 3WK4A 1BVSA 4R63A 1F0MA 1JN3A 2KEYA 7ICMA 2JEFA 2LYBA 4B9TA 1ZQNA 3H8SA 3ZD9A 4O3QA 5K4LA 2HMXA 2B6GA 2JV3A 5KFTA 1TE2A 1YZ6A 2PMZC 1Q8KA 1T8EA 2YB1A 3OTQA 4QZEA 4UATA 2DFLA 1JMSA 9ICMA 4ECTA 1NJWA 3PMLA 4F2SA 5AI4A 1NK5A 5AK3A 3MGHA 3FM9A 2QB0B 2F77X 5AKJA 3I28A 2FE9A 5KFXA 1KFDA 4Q45A 5J2KA 1ECWA 1ZQHA 4NLCA 3C2KA 2E3TA 4ED8A 1Z19A 3EZ5A 2VKQA 7ICKA 4DQRA 5DBBA 4NLNA 1Z1BA 2MU2A 4PZOA 2W7OA 1SL1A 3KKAA 1KDHA 9ICRA 3QYPA 1Y88A 3H7IA 4M0AA 1X66A 1NOMA 4DL3A 3IDWA 2QKQA 3RJGA 3MR2A 1HIWA 4U7CA 3TANA 1TKDA 1RYRA 1WCLA 2KJ5A 3U26A 2YMMA 1S97A 2OXOA 4ED2A 1BNOA 4Y2YA 2FI1A 3UXPA 4CGZA 3M8RA 2XCPA 4C4TA 2G07A 2FLPA 3Q8PB 2KV2A 1ZQOA 3GQCA 4ACOA 2OYYA 3JPSA 4C4SA 4ZOHC 5EE1A 7ICNA 3D2QA 5KT4A 3MR6A 3AN1A 5J0QA 1NK4A 8ICIA 4UB4A 4BWJA 4JB3A 4DSFA 2H3QA 5DDYA 5AKHA 3ZDCA 3F2CA 3UMGA 2KSOA 2ZIWA 3K75D 5HHIA 1TK0A 2BHNA 1ZQFA 4NY8A 2DGZA 5KFQA 4P2HA 1CRXA 2OEHA 3OJSA 4KN4A 1PK1B 4MF8A 1Q46A 3IHQB 3EYZA 3H0RB 2E1FA 2XVTA 4ELUA 8ICUA 5J0OA 2KP7A 4PL1A 5KFVA 3F5AA 1IXRA 2C22A 3QUQA 5KG4A 1BPBA 2PFQA 3Q8RB 2PI4A 2KD1A 4KTQA 1FIQA 3SAFA 4EZ6A 5DG9A 4HYKA 3SQIA 3H8JA 1KBUA 4JMUA 3AQEA 1ZD2P 2NRTA 1TK8A 3ISDA 8ICWA 3HJEA 2KFNA 2KKVA 4ECSA 2JHDA 2W9BB 4Q43A 1JROA 2OWOA 2EZYA 4DSIA 1D8BA 2W04A 4I2BA 1X9SA 3AM9A 1SWWA 3QXGA 1SB3C 2KZZA 2R8IA 4IQVA 4QWDA 2JH1A 1NK9A 3DV9A 4EX6A 4UB1A 3NRWA 1UA0A 4KN7A 2W8KA 5AKZA 2XGPA 3KD3A 2C28A 4RPYA 2BPCA 2W3RA 1Z4OA 1L3VA 3AMZA 4IQWA 3TKAA 2KTQA 5KFZA 1T94A 5DQIA 1Q3VA 4KLOA 2ASJA 2Z7JA 4RQ5A 5CR0A 2AGQA 2V9WA 4DS4A 3QEAZ 2ATLA 1BPEA 4NXZA 3M9MB 3MFIA 5J2AA 1L3TA 2HHTA 3TI0A 4RQ4A 4F92B 2R18A 9ICNA 1S0OA 3AQFA 4JV0A 5AKEA 3VC8A 5DQGA 1PZNA 2AJQA 2W7PA 1U49A 3ZI4A 2ZUCA 2E8MA 5J2GA 9ICJA 1QLNA 1Z4NA 2K8CB 2QLTA 3M1YA 5KL1B 2H3IA 4YR2A 2YY6A 2KN7A 2XICA 9ICEA 2HCFA 4CE6A 1T3NA 2WAQF 4YFKA 4ED1A 5ALLA 2MAXA 4Y2JA 4C80A 3NRZA 3RRHA 2ISPA 3H4DA 9ICFA 1LKYB 1ZQZA 4LZDA 3ICXA 5ALFA 2CN1A 2PXIA 3R9KA 3SENA 1BPXA 3PW0A 3TADC 5E79U 1NK0A 3RB6A 4BXOB 1KQQA 4OO1J 1N61A 4P4MA 5KFNA 4YXMA 3FDSA 1DGJA 5IILA 1S9FA 3EW9A 4RT2A 4US9A 4RQ0A 5ALZA 4CF4A 2ISOA 3RB3A 4UAWA 4ZH4A 3PV8A 4XA5A 1L5UA 3KZXA 9ICKA 4I2FA 3Q8MA 5C5JA 2A1AA 2WF8A 2P35A 1ZQ1C 2JEIA 3C29A 1Q3UA 2HHQA 3RTVA 3ALRA 2WTFA 4DL2A 2VJ5A 2W9CA 1ZQBA 3M9NB 2MUTB 3V7LA 3QUCA 3F2BA 4ECXA 2NYVA 1JI7A 1QQ5A 4UARA 9ICHA 5KG6A 1B22A 1V9PA 2P6RA 4GIBA 4YMOA 3LK9A 3C5GA 3THVA 1D8YA 2J6SA 5KFKA 2W54A 3RH4A 1Z00B 4U6PA 5KFOA 2R8JA 3HWTA 5ALYA 1NKCA 5KG7A 1C7YA 4DEZA 3A0BU 3QX7A 2WAQC 1JX4A 2YMQA 4NWIA 4QZAA 3JPNA 2LHTA 1XSNA 2F8LA 2Y0SF 1JXLA 5EE0A 4I2GA 1Z3EB 5AKXA 5CHGA 2FMQA 4DSEA 4IC9A 2JZBA 2KVSA 1URJA 4F71A 2BQ3A 2F1IA 2C2DA 4UW9A 1ZQMA 5DGAA 4OJLA 3JPPA 4IRDA 4J9QA 2Y1JA 2ZIUB 1U4BA 5KFYA 4I2EA 2EZXA 4C8OA 3HRDD 3QE9Y 4QZBA 1IM4A 8ICYA 2YTUA 2R8KA 2WF6A 5H2FU 9ICLA 4F5NA 1BNPA 2WHEA 5KFJA 1OXJA 2NO5A 1KLNA 2FPLA 5J2IA 1ZXIA 2K89A 1U45A 3M9OB 2UVVA 9ICTA 4QIWF 1ZQQA 4P0PA 4F50A 2WF9A 3N4MB 4ECYA 4KLJA 2O6KA 4DL6A 4US8A 3GIIA 3RH6A 1DK2A 4C8NA 4J9MA 2QB0A 2VJ4A 4XRHA 3SV4A 3ORYA 4KLDA 5J0UA 4O3SA 4FBTA 3LVVA 1ZQLA 4ECWA 1X42A 4O3MA 1NK8A 4Y2PA 7ICGA 3IRUA 5ALIA 2PI5A 2K4IA 2YMPA 1BGXT 2FDRA 4RU9A 4FBUA 5DQHA 1L8LA 4FO6A 3MDCA 3RJIA 2XY6A 5IIIA 1TV9A 1M6YA 5DBAA 2E8OA 4I28A 4KLTA 7ICFA 2Q4TA 2Y0SC 3HKZF 2XCAA 3VCBA 2LKYA 2W03A 2W9CB 3SV3A 4Q8EA 4BGDA 4CDGA 4PGQA 1T7PA 2E5SA 3N28A 1QQ6A 4YN4A 4X5VA 2YB4A 2HHSA 3L4PA 2LPEA 2WF7A 4DF4A 2WF5A 5HP4A 4EZ9A 4KX5A 2EAPA 1PUZA 1DOQA 4Z6CA 9ICSA 3RJFA 8ICMA 2BDPA 4ECZA 3BZKA 3SEIA 1ZQXA 5AHXA 3PW4A 2GO7A 4TUPA 4O9MA 3C23A 5L1IA 4F5OA 3RRGA 4DLEA 4UAVA 4B9NA 4JWNA 4LJXA 2IOFA 3GIMA 2KOBA 1FEZA 2FLLA 5B66U 2QB1A 4DQQA 1NKBA 1PK3A 4Z6DA 3KHHA 2BCVA 1KFSA 1X6JA 3C5FA 1PK1A 9ICWA 2JZBB 2IBKA 1EXNA 1VLBA 2V4RA 2ZTCA 3JPTA 4E0DA 4I2CA 1K1QA 4M9GA 1D9FA 4QWCA 1MA7A 1RQLA 2OHFA 5F9LA 5G5HA 3E0FA 5J2CA 2BKEA 4DOCA 1RG6A 4DQIA 1VJ5A 5CJ7A 1U48A 5KFSA 3GDXA 2F8KA 4UBBA 1KFTA 3SD7A 5AM4A 1DRGA 5CB1A 2XO7A 4GC7A 3IP4B 4GXJA 1PVPA 5J2JA 3G6VA 2M9NA 5AM3A 2IA6A 4M04A 4P0PB 4EENA 2W9BA 3HKZC 5ALDA 4M9LA 4DFKA 1N56A 5ALGA 2OH2A 1J2MA 2VA8A 3D2SA 1N5XA 2DBYA 4JV1A 2K8AA 3UMCA 1JXEA 4TQRA 5DLFA 1ZOLA 4YD2A 5KFUA 2F3NA 2C2EA 3J81j 3NASA 1S8OA 4Y2SA 3ZDDA 4Y2QA 2EH9A 5KFFA 2FPKA 1TFRA 1NNLA 3ETLA 7ICJA 4M9NA 1N5WA 4PHEA 3RR8A 3JPRA 4IR9A 5HR7A 1L7MA 1D8LA 2NRZA 4PPXA 7ICQA 4FE3A 2W9MA 2KNJA 1X6IA 5HMMA 4DSJA 2PFPA 7ICRA 5AKKA 1IG6A 1S0VA 3K1RB 4O3NA 2WB1F 3OPXA 3RH5A 3QZ7A 3RB0A 8ICCA 5D46A 4F4KA 5KG3A 4UB6U 2MSNA 2AGOA 2UVUA 1GO3F 1Z1VA 3B0YA 1CI4A 1YT3A 3CNHA 3QU7A 2IMWP 3H8WA 1SZPA 5J0SA 5DB7A 1IIPA 4ICAA 4I2IA 4I2AA 4BX9C 2W55A 4F4WA 4J9KA 5T14A 4RNMA 5KT3A 5B5EU 1XS9D 3PSTA 4R8UA 4LZGA 3D6JA 1XSLA 2KZ3A 4DL5A 4RPXA 3NGDA 3FC4A 4M6WB 8ICZA 2KIWA 4QWAA 5AICA 4PGYA 1L7OA 3NS1A 3PSFA 4P4OA 1LKYA 3QU4A 2I9GA 4PHAA 2H5XA 2L5YA 1MN8A 5AK6A 2MA1A 3RB4A 4BXOA 1WG8A 1V97A 5ALHA 4YD1A 3HX0A 5KFHA 4IRCA 3M8SA 4Z6EA 3I76A 5J0YA 3UQ0A 1O03A 2KJ9A 2OM6A 3Q8SB 4RQNA
chains in the Genus database with same CATH topology
2G07A 4AYBF 2KV2A 1NZBA 2CPRA 1XO0A 2E1EA 4ACOA 2KICA 1UPHA 2F76X 2JH1A 2OYYA 2ZIUB 2HOFA 3AL0B 2CRXA 3N7PD 2H3FA 2HBJA 3D2QA 3N7SC 3L3FX 2ZG6A 2HBKA 4OJ5A 2BDUA 3SAGA 5HR7A 2RP5A 3MGVA 2LYAA 2K4HA 2KOBA 1TAMA 2RRDA 3NRWA 4FZMA 3M7DA 3IN5A 2KJ8A 1A6SA 2KEYA 2VIXA 2MRLA 4C0ZA 4FE3A 2HOIA 2NV3A 2LYBA 2GH1A 2KNJA 2H3QA 2WB1C 3KZXA 2G5HB 2ZXHA 3F2CA 4GFJA 2G06A 4AYBC 2RHFA 2WB1F 2HBLA 2ZIWA 3GU3A 3OPXA 3PSPA 3CYMA 2K89A 4PL2A 5CRXA 2D6FC 3GZFA 3IG8A 3K1ZA 2HMXA 2OH2A 4QIWF 1T94A 2HBMA 1ZQ1C 1Q3VA 2G5IB 2PMZC 2N1RA 2Z7JA 1P7DA 4P0PA 2H3VA 3C29A 1Q3UA 2G0AA 2XIDA 5A0LA 2A3VA 2YB1A 2PMZF 2DGZA 1GO3F 4KX3A 3ALRA 2ZIWB 4P0QA 2G09A 4BUGA 1YT3A 1CRXA 3D2SA 2VJ5A 3PZPA 1L6NA 2VJ4A 2ZIVA 1MA7A 2KHQA 2G08A 3E0FA 1IIPA 3ONNA 3H0RB 4ICAA 2F2AB 2E1FA 2XVTA 3DEEA 3LVVA 3SMVA 3F2BA 3NUQA 4BX9C 5HR6A 3F5EA 4O3MA 4P0QB 5T14A 4PL1A 2K8BB 1ED1A 2R18A 3F5AA 2KKPA 3H0MB 4BJQA 4QIWC 4KMOB 3T79A 2ZIVB 2F77X 5C0YA 3CRXA 2HOQA 3PSTA 3AQFA 4QJFB 1HEKA 4QNLA 4WJ3B 1SZHA 3M6KA 3VC8A 3D2NA 2KD1A 4CRXA 1ECWA 2W7PA 1DRGA 3SAFA 2GOLA 2K4IA 4NLCA 3C28A 3SQIA 2LBOA 1PVQA 1Z19A 3IP4B 3KFUF 4U6PA 1PVPA 2K8CB 5KL1B 2KIWA 2VKQA 2ZIXA 4P0PB 3PSFA 4JMUA 4OJOA 1KBUA 2H3IA 3AQEA 2WAQC 3HKZC 2DQNB 2XICA 1Z1BA 4NWIA 2W7OA 2LHTA 2Q4TA 2WAQF 2Y0SC 3H0LB 2JGAA 3HKZF 3PSIA 3VCBA 2KHVA 2LKYA 2W03A 2ZXIA 3LYSA 3RF9A 2DF4B 2XI9A 2KVCA 2YX8A 4NLBA 2F8LA 2KKVA 2Y0SF 2ZIXB 5KL8B 4CDGA 1OUQA 2E5SA 2JHDA 3LVWA 3O0FA 1HIWA 2MA1A 1PVRA 4U7CA 2YB4A 2K8AA 4OJ6A 2JMGA 3ICXA 2JH7A 2K4EA 3N7RC 2KJ5A 4OJPA 3M6ZA 3IG5A 2CN1A 1A0PA 1D8BA 4KX5A 2W04A 4IC9A 4FZNA 2OXOA 3F53A 3CP8A 1WUDA 1URJA 3F2DA 2ZIUA 4FZLA 1F44A 4NV0A 3RFAA 4OO1J 3SAHA 2M0NA 4CGZA 2KJ9A 2OM6A 2H3ZA 4OJLA 1XNSA 4A8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VC8 A;  3VCB A;  3GZF A; 
#chains in the Genus database with same CATH topology
 3BS5 B;  4PJ0 U;  2GLE A;  2RDJ A;  3WKB A;  5AIB A;  4JWM A;  3BQT A;  2HHX A;  3UPQ A;  5F9N A;  5AIA A;  1NK7 A;  4J9P A;  3N7S C;  1KKX A;  8ICX A;  4UBC A;  5DG7 A;  5AKL A;  2RRD A;  2J6U A;  4J03 A;  4G3I A;  2WB1 C;  2G5H B;  3EUB 2;  5J0T A;  2HBL A;  9ICX A;  4C8L A;  4ED6 A;  4MFC A;  2MUT A;  3QUB A;  4DFM A;  2G09 A;  4BUG A;  3PZP A;  4C4R A;  5L1J A;  1WYG A;  1JAL A;  2AU0 A;  2F1H A;  1KTQ A;  4KLF A;  3SMV A;  1XO1 A;  3AUO A;  4QZI A;  3H0M B;  5AM2 A;  4AP9 A;  2BCS A;  1Z00 A;  9ICU A;  4QJF B;  3OSP A;  2BGW A;  4QNL A;  4F5P A;  2FMP A;  2ESE A;  1ZQE A;  2LMR A;  7ICP A;  4F5Q A;  2GWS A;  5KFC A;  2W11 A;  2FJ6 A;  3FYH A;  2ALZ A;  2XY5 A;  1J2N A;  2PFN A;  3OGU A;  3MBY A;  5ALK A;  1HUZ A;  2IHN A;  5KFR A;  3GFK B;  4DF8 A;  2B0C A;  1VDV A;  1RXV A;  3N7R C;  2K4E A;  3QU2 A;  4EEY A;  1A0P A;  2HI0 A;  7ICS A;  5G5G A;  5EWE A;  2ZUB A;  4R8U B;  2ZIU A;  3PW5 A;  4NV0 A;  3DDH A;  4CCH A;  5AK4 A;  4QZ9 A;  8ICB A;  5ALP A;  3N97 B;  2XC9 A;  4PH5 A;  3H8M A;  4J9L A;  3T3F A;  2P6U A;  4C7Y A;  3TFS A;  4Z6F A;  3SAG A;  2HBK A;  4F4Y A;  1SWV A;  2RP5 A;  3MGV A;  1S77 D;  4C0Z A;  2HOI A;  5L1L A;  4PHP A;  4B9V A;  1XWL A;  7ICL A;  2C2R A;  3K4G A;  2K60 A;  4DLG A;  3GIK A;  4B9M A;  3MGI A;  4B9L A;  2NRX A;  3OHA A;  2HVI A;  3JPQ A;  2A3V A;  1ZQI A;  5GTI U;  4NM1 A;  4ECU A;  4I29 A;  5AI9 A;  4R64 A;  3UMB A;  8ICO A;  5KT2 A;  3ONN A;  5J0W A;  3DEE A;  5KAF U;  3RBD A;  4RQM A;  2K8B B;  3TAC B;  3MR3 A;  4KMO B;  3T5H A;  5C0Y A;  2HOQ A;  2ASL A;  2VAN A;  5TIS U;  4I2H A;  4EEK A;  2KFZ A;  5EOZ A;  4CRX A;  2KIV A;  3GV7 B;  4F3O A;  1ZQV A;  3PW7 A;  3PW2 A;  3WKE A;  1KL9 A;  5GTH U;  8ICN A;  3PSI A;  1L6N A;  5CP2 A;  5BOL A;  3CRX A;  1ZQW A;  4MFF A;  4YP3 A;  1MC8 A;  3GIL A;  4GLX A;  3G6X A;  1PVR A;  5ALU A;  4KLL A;  5KFG A;  4DFJ A;  1NKE A;  4OJ6 A;  4ECQ A;  2ASD A;  4FZL A;  4B6J A;  3HPO A;  2IHM A;  2QAR A;  4AYB F;  5DG8 A;  4RNN A;  1L8O A;  3UXN A;  2LM4 A;  1XO0 A;  2JR5 A;  2F76 X;  2WFA A;  1X2I A;  5IIK A;  1L7N A;  1SKS A;  2KZM A;  4YMN A;  4YCX A;  4EYH B;  1RXW A;  3PR4 A;  2KJ8 A;  1KRP A;  4EBC A;  5AI0 A;  1UA1 A;  3QUT A;  2G06 A;  5ALS A;  2VA3 A;  4C8K A;  2ZJ5 A;  3IG8 A;  8ICQ A;  2HDO A;  3RAX A;  9ICC A;  4RQ3 A;  2G0A A;  2XID A;  1QSL A;  5AM5 A;  2KE7 A;  4PZN A;  5KG2 A;  5HHH A;  1WWV A;  4CF3 A;  4IL6 U;  3KBB A;  3V72 A;  3WKD A;  2Y1I A;  3QNM A;  4IQT A;  1TVA A;  1ZQC A;  4YR3 A;  4KLS A;  1ZJN A;  2AGP A;  3OHB A;  2ZIV B;  1SL0 A;  4GXI A;  3TAQ A;  4Y2R A;  3M6K A;  1ZD4 A;  4F2R A;  2A1J A;  5ALM A;  5HML A;  4DS5 A;  4RQ2 A;  2LBO A;  4DWI A;  1NJZ A;  1UT8 A;  3TAR A;  5J29 A;  3KHG A;  5ALO A;  3TAP A;  2I1Q A;  3OJU A;  4IR1 A;  4K4H A;  9ICB A;  4F8R A;  1ZQR A;  5KFW A;  5KFB A;  4NLB A;  2AQ4 A;  1XSP A;  1IV8 A;  1SGG A;  4F72 A;  3HP6 A;  1B0X A;  3O0F A;  3QEB Z;  2JMG A;  4EBD A;  1S0M A;  4F91 B;  1OW5 A;  1JUD A;  3PX6 A;  3C2M A;  1WUD A;  2UVR A;  3LDA A;  1F44 A;  2XY7 A;  2XGQ A;  2JRZ A;  1KSP A;  4P4P A;  1SKW A;  2UVW A;  4RUA A;  5KAI U;  2D8C A;  3C1Y A;  3ISB A;  5KT5 A;  4YG2 A;  4EEL A;  2W9A A;  5FP0 A;  4YMM A;  2ZTD A;  4FFD A;  5KG1 A;  5KFE A;  1SXE A;  4NLZ A;  1ZQU A;  1ZQT A;  3B0X A;  2ZTE A;  4M9H A;  2VIX A;  3MFH A;  4UAU A;  4UAZ A;  4RQ8 A;  2GH1 A;  4EYI B;  1NJY A;  1B43 A;  3KHL A;  3C21 A;  3T5J A;  2NRV A;  5KFD A;  3GU3 A;  4PL2 A;  2I5H A;  4Q8F A;  1JIH A;  4RZR A;  3GZF A;  3K1Z A;  3RJE A;  1X9X A;  3H4B A;  2HHV A;  4MHV A;  4B9S A;  5A0L A;  4XQ8 A;  1N63 A;  5JTI A;  2QAR B;  3LWL A;  4J9N A;  1NK6 A;  1B4F A;  1ZRN A;  2RQ5 A;  5EE9 A;  5BPC A;  1K1S A;  1KW4 A;  4RPZ A;  4IQU A;  5L1M A;  1FFU A;  1S5L U;  4F93 B;  5EWF A;  4DL4 A;  4BJQ A;  1JRP A;  2RDI A;  4QIW C;  5J2D A;  5AKI A;  1S10 A;  2E8N A;  4M6W A;  3PX4 A;  7ICI A;  3PO5 A;  5DKW A;  4QZ8 A;  4F5R A;  2VA2 A;  4O3O A;  2PKE A;  1TK5 A;  1QQ7 A;  3WK8 A;  4ECV A;  5JU5 A;  1SV0 C;  3RF9 A;  3EPI A;  5ALT A;  2ZIX B;  5J8Y C;  4O5C A;  1DK3 A;  4KLM A;  4DSK A;  3BS5 A;  4UAY A;  3T5K A;  4ED3 A;  5KFA A;  2A1J B;  2AXT U;  4A8E A;  1ZQY A;  2W43 A;  1HJP A;  2B21 A;  1N48 A;  7ICH A;  2HOF A;  2HW3 A;  3C1Z A;  3V6H A;  4ED0 A;  4O5K A;  4Y2T A;  1TAM A;  4I2J A;  4RUC A;  3RJJ A;  4ECR A;  1A6S A;  1MQ3 A;  5ALX A;  3LWM A;  5ALE A;  3EPG A;  4DOA A;  1LVH A;  5L9X A;  4ED7 A;  3WU2 U;  4GFJ A;  4IRK A;  4I2D A;  4UAS A;  1ZJM A;  1ZQJ A;  2N1R A;  2Y9U A;  3Q8K A;  2Q0Z X;  5ALV A;  3E2E A;  1ZD5 A;  3PR5 B;  4QW8 A;  1L3U A;  3KTQ A;  2F2A B;  1ZYQ A;  3S6J A;  5J2F A;  3C2L A;  3AU6 A;  4P0Q B;  1LB2 B;  5KTQ A;  4QZH A;  3BQ7 A;  5AM0 A;  5IIO A;  5IIN A;  2BQU A;  1HEK A;  2BCR A;  4WJ3 B;  1SZH A;  2HHU A;  3SZ2 A;  3ETR A;  2W3S A;  1UHU A;  4IS7 A;  2ODG A;  4QW9 A;  1BPZ A;  1J97 A;  4RQ7 A;  1ZQK A;  4Y2U A;  4NL9 C;  4FS1 A;  4DCC A;  3PY8 A;  3BS7 A;  9ICG A;  3PNC A;  5IIJ A;  4M47 A;  5J2E A;  3SYZ A;  2BCQ A;  3MAB A;  1SV0 A;  1YZ7 A;  4BWM A;  5ALN A;  3CW2 C;  5J8Y A;  8ICF A;  2D3D A;  5KT6 A;  1O08 A;  3BJY A;  3V6K A;  4QWB A;  3F2D A;  1T3Q A;  2NRW A;  3SI8 A;  3ZDE A;  1SXD A;  2H3Z A;  4DOB A;  2IOF K;  2YQE A;  3PO4 A;  1ZQD A;  2E1E A;  1ZQS A;  2FLN A;  2RLT A;  1F5S A;  4K4I A;  8ICH A;  2BDU A;  2F44 A;  3AU2 A;  9ICA A;  1BPD A;  5AKG A;  5BOM A;  3WK9 A;  2ZXH A;  3IM1 A;  7ICT A;  5KFI A;  8ICG A;  4DSL A;  5TZV A;  5CRX A;  2D6F C;  2IOH A;  3RR7 A;  1P7D A;  1RZT A;  4MEY A;  4UB3 A;  2OCE A;  4R65 A;  4KX3 A;  3WK7 A;  2DUY A;  1ZQA A;  2ZUD A;  2V4Q A;  3FAH A;  5J0P A;  8ICV A;  1ZRM A;  2KG5 A;  1ED1 A;  3WK5 A;  4K4G A;  3I1Y A;  5DB9 A;  3MC1 A;  3QU9 A;  3ZDB A;  1QH9 A;  3D2N A;  5EE3 A;  1H38 A;  3WK6 A;  1QSS A;  9ICI A;  2GOL A;  4KLQ A;  7ICO A;  8ICS A;  4NM2 A;  4GXK A;  4MF2 A;  3NVZ A;  4JK1 A;  1TAQ A;  3BQ2 A;  4OJO A;  3GIJ A;  3BZC A;  4NL9 A;  1QSY A;  3T79 A;  2W8L A;  5KL8 B;  3V7K A;  3LVW A;  1TAU A;  2JEJ A;  4ELV A;  3NVV A;  3EWA A;  4DFP A;  3UM9 A;  2YML A;  4QZF A;  4OJP A;  3IG5 A;  4TUQ A;  3ISC A;  4RT3 A;  4YR0 A;  4Y2X A;  4KLH A;  3RAQ A;  4FZN A;  2JEG A;  2EDU A;  4DO9 A;  8ICP A;  5DBC A;  8ICJ A;  1AQ6 A;  4BDP A;  3ED5 A;  2KIC A;  2ZJ8 A;  3N7P D;  9ICP A;  2HBJ A;  2I6X A;  2LYA A;  4FS2 A;  4PGX A;  3RJK A;  1X40 A;  4O3P A;  4FZM A;  3IN5 A;  2BZF A;  4MFA A;  3MDA A;  4YQW A;  3NVW A;  4DQS A;  4KLG A;  2HHW A;  3PSP A;  3CYM A;  1RQN A;  5JRT A;  1KN5 A;  2HBM A;  4QZC A;  3G6Y A;  3PX0 A;  3H40 A;  2H3V A;  3BQ0 A;  5HNK A;  4PHD A;  3BQ1 A;  2P66 A;  2KSO B;  2ZIW B;  3HIL A;  4F4X A;  2ZIV A;  2K4P A;  3QU5 A;  2LM1 A;  4R66 A;  3NUQ A;  5D4B A;  1K5O A;  5ALQ A;  2PFO A;  4Q44 A;  4QZD A;  2JXJ A;  1D9D A;  1LV5 A;  5D49 A;  2ES6 A;  5L1K A;  5DB6 A;  3L5K A;  4RNO A;  1T4G A;  1XU4 A;  2BCU A;  7ICV A;  4CF5 A;  2R8H A;  2EAM A;  1ZQG A;  4RQ6 A;  1A77 A;  1L7P A;  1WWU A;  1ZQP A;  1DXS A;  2BQR A;  1KEJ A;  1PVQ A;  5KNI A;  5AI5 A;  5KFL A;  1U47 A;  2HSZ A;  4KIT B;  4USA A;  2JH7 A;  8ICA A;  4KLI A;  2AQ0 A;  3F53 A;  3CP8 A;  4NJ8 A;  3RFA A;  4TUR A;  4NLK A;  3SAH A;  2M0N A;  4LVS A;  1V85 A;  4G9B A;  4KLE A;  2DL0 A;  1XNS A;  1WCN A;  3MR5 A;  1NZB A;  3NVY A;  5DB8 A;  2BPG A;  1COK A;  4KMU A;  3ZD8 A;  3UXO A;  3L3F X;  1SIJ A;  1ZET A;  2K4H A;  2DKX A;  3PMN A;  8ICE A;  3T5L A;  2J6T A;  4EX7 A;  1UT5 A;  4I27 A;  5ALR A;  1ZD3 A;  2BPF A;  4J9O A;  3BDP A;  1RM6 C;  5ALW A;  1BPY A;  4F4Z A;  1U9L A;  5JUM A;  4UB5 A;  4MEX A;  2G5I B;  1UCV A;  3NTU A;  2KK0 A;  3GV8 B;  4TQS A;  1N62 A;  5DLG A;  4O0I A;  2AHO B;  1UQV A;  5J0R A;  4J9S A;  1SKR A;  2CXY A;  5HR6 A;  3F5E A;  1DGS A;  2KKP A;  3AEV A;  3WKC A;  2YN4 A;  3V6J A;  2EZZ A;  4JUZ A;  5KG5 A;  3Q8Q B;  4JV2 A;  1XC9 A;  4O3R A;  3C28 A;  5AI6 A;  4YVZ A;  3KFU F;  3KOO A;  5CWR A;  4HAI A;  1S0N A;  5F3X B;  2ZIX A;  5AI8 A;  2DQN B;  3TAD A;  4QWE A;  2DPJ A;  3H0L B;  3WKA A;  2JGA A;  3IV6 A;  2KHV A;  2ZXI A;  3LYS A;  4O5E A;  2XI9 A;  2E8P A;  2KVC A;  2YX8 A;  4M2Y A;  3UQ2 A;  1N60 A;  1RDF A;  1S76 D;  1X9M A;  5DDM A;  3JPO A;  5KG0 A;  4KLU A;  3PVX A;  4UB2 A;  3KZI U;  3TFR A;  2LI6 A;  3E58 A;  1NZP A;  4ELT A;  8ICR A;  2EQY A;  2DKZ A;  3HT3 A;  8ICT A;  1ARO P;  1UPH A;  5J0X A;  2CRX A;  2R8G A;  5ALJ A;  1SV4 A;  2H3F A;  1RPL A;  4OJ5 A;  2ZG6 A;  7ICE A;  1NI3 A;  4OCZ A;  2A19 A;  2BR0 A;  1X9W A;  3Q8L A;  1QCK A;  3M7D A;  2EAN A;  2MRL A;  2KMD A;  4UB8 U;  2NV3 A;  2EAO A;  1V38 A;  2DPI A;  1L3S A;  1QTM A;  9ICO A;  4AYB C;  2RHF A;  5EWG A;  5KT7 A;  2AH5 A;  5IIM A;  3OSN A;  4M9J A;  4DFD A;  1COO A;  7ICU A;  9ICQ A;  2PMZ F;  5AM1 A;  9ICV A;  4P0Q A;  4J9R A;  2NO4 A;  3KHR A;  1MSW D;  1N2X A;  4CNQ A;  5DGB A;  2KHQ A;  5AK5 A;  1NJX A;  2G08 A;  4XUS A;  3V7J A;  3B9J A;  4C7Z A;  3HW8 A;  4QZG A;  3RBE A;  4Y2V A;  2Y9T A;  3RJH A;  1FFV A;  5J2B A;  5CEH A;  3A0H U;  1RYU A;  4GC6 A;  5KFP A;  2LYH A;  4DQP A;  4DL7 A;  1CEZ A;  3TQ1 A;  4EBE A;  1SL2 A;  2HVH A;  5KFM A;  1A76 A;  4C8M A;  3KKA C;  5CA7 A;  4TUS A;  4UQG A;  2DWQ A;  4NLG A;  2FPM A;  4OD0 A;  3ZDA A;  2DF4 B;  4RQ1 A;  8ICK A;  1OUQ A;  3QZ8 A;  5J2H A;  4YXJ A;  5AKY A;  3M6Z A;  1MQ2 A;  3SR6 A;  4B9U A;  2FMS A;  1FO4 A;  1HUO A;  1CUK A;  8ICL A;  2F1J A;  1C20 A;  2CPR A;  2ZJA A;  3AL0 B;  3GV5 B;  1RYS A;  3WK4 A;  1BVS A;  4R63 A;  1F0M A;  1JN3 A;  2KEY A;  7ICM A;  2JEF A;  2LYB A;  4B9T A;  1ZQN A;  3H8S A;  3ZD9 A;  4O3Q A;  5K4L A;  2HMX A;  2B6G A;  2JV3 A;  5KFT A;  1TE2 A;  1YZ6 A;  2PMZ C;  1Q8K A;  1T8E A;  2YB1 A;  3OTQ A;  4QZE A;  4UAT A;  2DFL A;  1JMS A;  9ICM A;  4ECT A;  1NJW A;  3PML A;  4F2S A;  5AI4 A;  1NK5 A;  5AK3 A;  3MGH A;  3FM9 A;  2QB0 B;  2F77 X;  5AKJ A;  3I28 A;  2FE9 A;  5KFX A;  1KFD A;  4Q45 A;  5J2K A;  1ECW A;  1ZQH A;  4NLC A;  3C2K A;  2E3T A;  4ED8 A;  1Z19 A;  3EZ5 A;  2VKQ A;  7ICK A;  4DQR A;  5DBB A;  4NLN A;  1Z1B A;  2MU2 A;  4PZO A;  2W7O A;  1SL1 A;  3KKA A;  1KDH A;  9ICR A;  3QYP A;  1Y88 A;  3H7I A;  4M0A A;  1X66 A;  1NOM A;  4DL3 A;  3IDW A;  2QKQ A;  3RJG A;  3MR2 A;  1HIW A;  4U7C A;  3TAN A;  1TKD A;  1RYR A;  1WCL A;  2KJ5 A;  3U26 A;  2YMM A;  1S97 A;  2OXO A;  4ED2 A;  1BNO A;  4Y2Y A;  2FI1 A;  3UXP A;  4CGZ A;  3M8R A;  2XCP A;  4C4T A;  2G07 A;  2FLP A;  3Q8P B;  2KV2 A;  1ZQO A;  3GQC A;  4ACO A;  2OYY A;  3JPS A;  4C4S A;  4ZOH C;  5EE1 A;  7ICN A;  3D2Q A;  5KT4 A;  3MR6 A;  3AN1 A;  5J0Q A;  1NK4 A;  8ICI A;  4UB4 A;  4BWJ A;  4JB3 A;  4DSF A;  2H3Q A;  5DDY A;  5AKH A;  3ZDC A;  3F2C A;  3UMG A;  2KSO A;  2ZIW A;  3K75 D;  5HHI A;  1TK0 A;  2BHN A;  1ZQF A;  4NY8 A;  2DGZ A;  5KFQ A;  4P2H A;  1CRX A;  2OEH A;  3OJS A;  4KN4 A;  1PK1 B;  4MF8 A;  1Q46 A;  3IHQ B;  3EYZ A;  3H0R B;  2E1F A;  2XVT A;  4ELU A;  8ICU A;  5J0O A;  2KP7 A;  4PL1 A;  5KFV A;  3F5A A;  1IXR A;  2C22 A;  3QUQ A;  5KG4 A;  1BPB A;  2PFQ A;  3Q8R B;  2PI4 A;  2KD1 A;  4KTQ A;  1FIQ A;  3SAF A;  4EZ6 A;  5DG9 A;  4HYK A;  3SQI A;  3H8J A;  1KBU A;  4JMU A;  3AQE A;  1ZD2 P;  2NRT A;  1TK8 A;  3ISD A;  8ICW A;  3HJE A;  2KFN A;  2KKV A;  4ECS A;  2JHD A;  2W9B B;  4Q43 A;  1JRO A;  2OWO A;  2EZY A;  4DSI A;  1D8B A;  2W04 A;  4I2B A;  1X9S A;  3AM9 A;  1SWW A;  3QXG A;  1SB3 C;  2KZZ A;  2R8I A;  4IQV A;  4QWD A;  2JH1 A;  1NK9 A;  3DV9 A;  4EX6 A;  4UB1 A;  3NRW A;  1UA0 A;  4KN7 A;  2W8K A;  5AKZ A;  2XGP A;  3KD3 A;  2C28 A;  4RPY A;  2BPC A;  2W3R A;  1Z4O A;  1L3V A;  3AMZ A;  4IQW A;  3TKA A;  2KTQ A;  5KFZ A;  1T94 A;  5DQI A;  1Q3V A;  4KLO A;  2ASJ A;  2Z7J A;  4RQ5 A;  5CR0 A;  2AGQ A;  2V9W A;  4DS4 A;  3QEA Z;  2ATL A;  1BPE A;  4NXZ A;  3M9M B;  3MFI A;  5J2A A;  1L3T A;  2HHT A;  3TI0 A;  4RQ4 A;  4F92 B;  2R18 A;  9ICN A;  1S0O A;  3AQF A;  4JV0 A;  5AKE A;  3VC8 A;  5DQG A;  1PZN A;  2AJQ A;  2W7P A;  1U49 A;  3ZI4 A;  2ZUC A;  2E8M A;  5J2G A;  9ICJ A;  1QLN A;  1Z4N A;  2K8C B;  2QLT A;  3M1Y A;  5KL1 B;  2H3I A;  4YR2 A;  2YY6 A;  2KN7 A;  2XIC A;  9ICE A;  2HCF A;  4CE6 A;  1T3N A;  2WAQ F;  4YFK A;  4ED1 A;  5ALL A;  2MAX A;  4Y2J A;  4C80 A;  3NRZ A;  3RRH A;  2ISP A;  3H4D A;  9ICF A;  1LKY B;  1ZQZ A;  4LZD A;  3ICX A;  5ALF A;  2CN1 A;  2PXI A;  3R9K A;  3SEN A;  1BPX A;  3PW0 A;  3TAD C;  5E79 U;  1NK0 A;  3RB6 A;  4BXO B;  1KQQ A;  4OO1 J;  1N61 A;  4P4M A;  5KFN A;  4YXM A;  3FDS A;  1DGJ A;  5IIL A;  1S9F A;  3EW9 A;  4RT2 A;  4US9 A;  4RQ0 A;  5ALZ A;  4CF4 A;  2ISO A;  3RB3 A;  4UAW A;  4ZH4 A;  3PV8 A;  4XA5 A;  1L5U A;  3KZX A;  9ICK A;  4I2F A;  3Q8M A;  5C5J A;  2A1A A;  2WF8 A;  2P35 A;  1ZQ1 C;  2JEI A;  3C29 A;  1Q3U A;  2HHQ A;  3RTV A;  3ALR A;  2WTF A;  4DL2 A;  2VJ5 A;  2W9C A;  1ZQB A;  3M9N B;  2MUT B;  3V7L A;  3QUC A;  3F2B A;  4ECX A;  2NYV A;  1JI7 A;  1QQ5 A;  4UAR A;  9ICH A;  5KG6 A;  1B22 A;  1V9P A;  2P6R A;  4GIB A;  4YMO A;  3LK9 A;  3C5G A;  3THV A;  1D8Y A;  2J6S A;  5KFK A;  2W54 A;  3RH4 A;  1Z00 B;  4U6P A;  5KFO A;  2R8J A;  3HWT A;  5ALY A;  1NKC A;  5KG7 A;  1C7Y A;  4DEZ A;  3A0B U;  3QX7 A;  2WAQ C;  1JX4 A;  2YMQ A;  4NWI A;  4QZA A;  3JPN A;  2LHT A;  1XSN A;  2F8L A;  2Y0S F;  1JXL A;  5EE0 A;  4I2G A;  1Z3E B;  5AKX A;  5CHG A;  2FMQ A;  4DSE A;  4IC9 A;  2JZB A;  2KVS A;  1URJ A;  4F71 A;  2BQ3 A;  2F1I A;  2C2D A;  4UW9 A;  1ZQM A;  5DGA A;  4OJL A;  3JPP A;  4IRD A;  4J9Q A;  2Y1J A;  2ZIU B;  1U4B A;  5KFY A;  4I2E A;  2EZX A;  4C8O A;  3HRD D;  3QE9 Y;  4QZB A;  1IM4 A;  8ICY A;  2YTU A;  2R8K A;  2WF6 A;  5H2F U;  9ICL A;  4F5N A;  1BNP A;  2WHE A;  5KFJ A;  1OXJ A;  2NO5 A;  1KLN A;  2FPL A;  5J2I A;  1ZXI A;  2K89 A;  1U45 A;  3M9O B;  2UVV A;  9ICT A;  4QIW F;  1ZQQ A;  4P0P A;  4F50 A;  2WF9 A;  3N4M B;  4ECY A;  4KLJ A;  2O6K A;  4DL6 A;  4US8 A;  3GII A;  3RH6 A;  1DK2 A;  4C8N A;  4J9M A;  2QB0 A;  2VJ4 A;  4XRH A;  3SV4 A;  3ORY A;  4KLD A;  5J0U A;  4O3S A;  4FBT A;  3LVV A;  1ZQL A;  4ECW A;  1X42 A;  4O3M A;  1NK8 A;  4Y2P A;  7ICG A;  3IRU A;  5ALI A;  2PI5 A;  2K4I A;  2YMP A;  1BGX T;  2FDR A;  4RU9 A;  4FBU A;  5DQH A;  1L8L A;  4FO6 A;  3MDC A;  3RJI A;  2XY6 A;  5III A;  1TV9 A;  1M6Y A;  5DBA A;  2E8O A;  4I28 A;  4KLT A;  7ICF A;  2Q4T A;  2Y0S C;  3HKZ F;  2XCA A;  3VCB A;  2LKY A;  2W03 A;  2W9C B;  3SV3 A;  4Q8E A;  4BGD A;  4CDG A;  4PGQ A;  1T7P A;  2E5S A;  3N28 A;  1QQ6 A;  4YN4 A;  4X5V A;  2YB4 A;  2HHS A;  3L4P A;  2LPE A;  2WF7 A;  4DF4 A;  2WF5 A;  5HP4 A;  4EZ9 A;  4KX5 A;  2EAP A;  1PUZ A;  1DOQ A;  4Z6C A;  9ICS A;  3RJF A;  8ICM A;  2BDP A;  4ECZ A;  3BZK A;  3SEI A;  1ZQX A;  5AHX A;  3PW4 A;  2GO7 A;  4TUP A;  4O9M A;  3C23 A;  5L1I A;  4F5O A;  3RRG A;  4DLE A;  4UAV A;  4B9N A;  4JWN A;  4LJX A;  2IOF A;  3GIM A;  2KOB A;  1FEZ A;  2FLL A;  5B66 U;  2QB1 A;  4DQQ A;  1NKB A;  1PK3 A;  4Z6D A;  3KHH A;  2BCV A;  1KFS A;  1X6J A;  3C5F A;  1PK1 A;  9ICW A;  2JZB B;  2IBK A;  1EXN A;  1VLB A;  2V4R A;  2ZTC A;  3JPT A;  4E0D A;  4I2C A;  1K1Q A;  4M9G A;  1D9F A;  4QWC A;  1MA7 A;  1RQL A;  2OHF A;  5F9L A;  5G5H A;  3E0F A;  5J2C A;  2BKE A;  4DOC A;  1RG6 A;  4DQI A;  1VJ5 A;  5CJ7 A;  1U48 A;  5KFS A;  3GDX A;  2F8K A;  4UBB A;  1KFT A;  3SD7 A;  5AM4 A;  1DRG A;  5CB1 A;  2XO7 A;  4GC7 A;  3IP4 B;  4GXJ A;  1PVP A;  5J2J A;  3G6V A;  2M9N A;  5AM3 A;  2IA6 A;  4M04 A;  4P0P B;  4EEN A;  2W9B A;  3HKZ C;  5ALD A;  4M9L A;  4DFK A;  1N56 A;  5ALG A;  2OH2 A;  1J2M A;  2VA8 A;  3D2S A;  1N5X A;  2DBY A;  4JV1 A;  2K8A A;  3UMC A;  1JXE A;  4TQR A;  5DLF A;  1ZOL A;  4YD2 A;  5KFU A;  2F3N A;  2C2E A;  3J81 j;  3NAS A;  1S8O A;  4Y2S A;  3ZDD A;  4Y2Q A;  2EH9 A;  5KFF A;  2FPK A;  1TFR A;  1NNL A;  3ETL A;  7ICJ A;  4M9N A;  1N5W A;  4PHE A;  3RR8 A;  3JPR A;  4IR9 A;  5HR7 A;  1L7M A;  1D8L A;  2NRZ A;  4PPX A;  7ICQ A;  4FE3 A;  2W9M A;  2KNJ A;  1X6I A;  5HMM A;  4DSJ A;  2PFP A;  7ICR A;  5AKK A;  1IG6 A;  1S0V A;  3K1R B;  4O3N A;  2WB1 F;  3OPX A;  3RH5 A;  3QZ7 A;  3RB0 A;  8ICC A;  5D46 A;  4F4K A;  5KG3 A;  4UB6 U;  2MSN A;  2AGO A;  2UVU A;  1GO3 F;  1Z1V A;  3B0Y A;  1CI4 A;  1YT3 A;  3CNH A;  3QU7 A;  2IMW P;  3H8W A;  1SZP A;  5J0S A;  5DB7 A;  1IIP A;  4ICA A;  4I2I A;  4I2A A;  4BX9 C;  2W55 A;  4F4W A;  4J9K A;  5T14 A;  4RNM A;  5KT3 A;  5B5E U;  1XS9 D;  3PST A;  4R8U A;  4LZG A;  3D6J A;  1XSL A;  2KZ3 A;  4DL5 A;  4RPX A;  3NGD A;  3FC4 A;  4M6W B;  8ICZ A;  2KIW A;  4QWA A;  5AIC A;  4PGY A;  1L7O A;  3NS1 A;  3PSF A;  4P4O A;  1LKY A;  3QU4 A;  2I9G A;  4PHA A;  2H5X A;  2L5Y A;  1MN8 A;  5AK6 A;  2MA1 A;  3RB4 A;  4BXO A;  1WG8 A;  1V97 A;  5ALH A;  4YD1 A;  3HX0 A;  5KFH A;  4IRC A;  3M8S A;  4Z6E A;  3I76 A;  5J0Y A;  3UQ0 A;  1O03 A;  2KJ9 A;  2OM6 A;  3Q8S B;  4RQN A; 
#chains in the Genus database with same CATH homology
 2G07 A;  4AYB F;  2KV2 A;  1NZB A;  2CPR A;  1XO0 A;  2E1E A;  4ACO A;  2KIC A;  1UPH A;  2F76 X;  2JH1 A;  2OYY A;  2ZIU B;  2HOF A;  3AL0 B;  2CRX A;  3N7P D;  2H3F A;  2HBJ A;  3D2Q A;  3N7S C;  3L3F X;  2ZG6 A;  2HBK A;  4OJ5 A;  2BDU A;  3SAG A;  5HR7 A;  2RP5 A;  3MGV A;  2LYA A;  2K4H A;  2KOB A;  1TAM A;  2RRD A;  3NRW A;  4FZM A;  3M7D A;  3IN5 A;  2KJ8 A;  1A6S A;  2KEY A;  2VIX A;  2MRL A;  4C0Z A;  4FE3 A;  2HOI A;  2NV3 A;  2LYB A;  2GH1 A;  2KNJ A;  2H3Q A;  2WB1 C;  3KZX A;  2G5H B;  2ZXH A;  3F2C A;  4GFJ A;  2G06 A;  4AYB C;  2RHF A;  2WB1 F;  2HBL A;  2ZIW A;  3GU3 A;  3OPX A;  3PSP A;  3CYM A;  2K89 A;  4PL2 A;  5CRX A;  2D6F C;  3GZF A;  3IG8 A;  3K1Z A;  2HMX A;  2OH2 A;  4QIW F;  1T94 A;  2HBM A;  1ZQ1 C;  1Q3V A;  2G5I B;  2PMZ C;  2N1R A;  2Z7J A;  1P7D A;  4P0P A;  2H3V A;  3C29 A;  1Q3U A;  2G0A A;  2XID A;  5A0L A;  2A3V A;  2YB1 A;  2PMZ F;  2DGZ A;  1GO3 F;  4KX3 A;  3ALR A;  2ZIW B;  4P0Q A;  2G09 A;  4BUG A;  1YT3 A;  1CRX A;  3D2S A;  2VJ5 A;  3PZP A;  1L6N A;  2VJ4 A;  2ZIV A;  1MA7 A;  2KHQ A;  2G08 A;  3E0F A;  1IIP A;  3ONN A;  3H0R B;  4ICA A;  2F2A B;  2E1F A;  2XVT A;  3DEE A;  3LVV A;  3SMV A;  3F2B A;  3NUQ A;  4BX9 C;  5HR6 A;  3F5E A;  4O3M A;  4P0Q B;  5T14 A;  4PL1 A;  2K8B B;  1ED1 A;  2R18 A;  3F5A A;  2KKP A;  3H0M B;  4BJQ A;  4QIW C;  4KMO B;  3T79 A;  2ZIV B;  2F77 X;  5C0Y A;  3CRX A;  2HOQ A;  3PST A;  3AQF A;  4QJF B;  1HEK A;  4QNL A;  4WJ3 B;  1SZH A;  3M6K A;  3VC8 A;  3D2N A;  2KD1 A;  4CRX A;  1ECW A;  2W7P A;  1DRG A;  3SAF A;  2GOL A;  2K4I A;  4NLC A;  3C28 A;  3SQI A;  2LBO A;  1PVQ A;  1Z19 A;  3IP4 B;  3KFU F;  4U6P A;  1PVP A;  2K8C B;  5KL1 B;  2KIW A;  2VKQ A;  2ZIX A;  4P0P B;  3PSF A;  4JMU A;  4OJO A;  1KBU A;  2H3I A;  3AQE A;  2WAQ C;  3HKZ C;  2DQN B;  2XIC A;  1Z1B A;  4NWI A;  2W7O A;  2LHT A;  2Q4T A;  2WAQ F;  2Y0S C;  3H0L B;  2JGA A;  3HKZ F;  3PSI A;  3VCB A;  2KHV A;  2LKY A;  2W03 A;  2ZXI A;  3LYS A;  3RF9 A;  2DF4 B;  2XI9 A;  2KVC A;  2YX8 A;  4NLB A;  2F8L A;  2KKV A;  2Y0S F;  2ZIX B;  5KL8 B;  4CDG A;  1OUQ A;  2E5S A;  2JHD A;  3LVW A;  3O0F A;  1HIW A;  2MA1 A;  1PVR A;  4U7C A;  2YB4 A;  2K8A A;  4OJ6 A;  2JMG A;  3ICX A;  2JH7 A;  2K4E A;  3N7R C;  2KJ5 A;  4OJP A;  3M6Z A;  3IG5 A;  2CN1 A;  1A0P A;  1D8B A;  4KX5 A;  2W04 A;  4IC9 A;  4FZN A;  2OXO A;  3F53 A;  3CP8 A;  1WUD A;  1URJ A;  3F2D A;  2ZIU A;  4FZL A;  1F44 A;  4NV0 A;  3RFA A;  4OO1 J;  3SAH A;  2M0N A;  4CGZ A;  2KJ9 A;  2OM6 A;  2H3Z A;  4OJL A;  1XNS A;  4A8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...