3VC8A

Crystal structure of the c-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus a59
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
b'TFEEMALTTFMITKESYCKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase
publication title Crystal structure of the C-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus A59.
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
total genus 28
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3vc8A00
3GZFA 3VCBA 3VC8A
chains in the Genus database with same CATH superfamily
3L4PA 4ED3A 4DLGA 2BPCA 4PH5A 5IIKA 4Z6EA 5CRXA 2KIVA 3KZXA 2KG5A 3ETLA 2I6XA 5J0SA 2W9MA 1T7PA 4Z6DA 3V7LA 1ZQOA 2W43A 4DSFA 3OGUA 5KAFU 5IIMA 3QX7A 2FMPA 4R8UB 3K1ZA 1JRPA 2FI1A 3BZKA 4ED0A 3ZDAA 3I1YA 1XU4A 2H3QA 5KFGA 3EZ5A 7ICQA 2IOFK 5L1KA 9ICEA 5IIIA 1SL2A 2W3RA 2KV2A 5KT7A 2M9NA 2PI4A 3PW5A 5ALZA 1PK1B 3KZIU 1XNSA 4QZGA 8ICLA 1SXDA 5KT4A 3QUQA 2K89A 4JV1A 2BQUA 1N5WA 1RM6C 2F76X 3H7IA 1KL9A 3LVVA 4Z6FA 3KTQA 2HW3A 1TFRA 4ECWA 3RJEA 4O3MA 1UA1A 5F9NA 1RYSA 1WG8A 1SB3C 4YQWA 3NVZA 2E1FA 1DK2A 1SWWA 1JIHA 3V7KA 4XQ8A 2VJ5A 3B0XA 2NRTA 1SGGA 1LKYA 2CPRA 3TFRA 4NLCA 5KFTA 4PHPA 1ZQVA 3ZDEA 5KFMA 4PZNA 1D8BA 1NJZA 5DB7A 3IRUA 1TV9A 9ICHA 3KKAA 1U9LA 4P0PA 2KVCA 8ICKA 2YX8A 1TVAA 2VA8A 2QB0A 3M6KA 7ICFA 4DFJA 3PR5B 5TISU 4DQIA 5D49A 4NLZA 1Z1BA 5ALSA 1X9XA 3NRZA 2W8KA 1OXJA 4I29A 2H3ZA 5KL8B 3QE9Y 3H8JA 1B4FA 4RPZA 2WB1C 1S9FA 4F4ZA 1X9WA 9ICPA 1BPYA 1BVSA 2JH7A 1PVPA 4G3IA 1OW5A 4IS7A 4QW8A 3SQIA 4ECVA 3JPPA 2XY7A 4PHAA 4YMOA 5AM1A 1FO4A 3BS7A 3GIKA 2BCRA 1ZQSA 1FEZA 2I9GA 2F1IA 4MEYA 1XO1A 1ZETA 3RH4A 4DL4A 3MR3A 3PSPA 3HILA 1SKWA 4YR2A 4C4TA 5ALNA 4J9KA 4DF4A 1KKXA 4MEXA 1F5SA 3NASA 1K1QA 9ICIA 5DBAA 2D8CA 3C5FA 4G9BA 2HBMA 5IIOA 5CR0A 2IHNA 4J9NA 4RQ6A 2JZBA 2KHVA 1ZJMA 5L1IA 9ICWA 2XVTA 4M9NA 5L9XA 2YMPA 5KFRA 1CEZA 3PSIA 4ICAA 4UB8U 1ZQYA 1JMSA 4PHEA 1RXWA 4Y2JA 7ICOA 4I2IA 1ZQEA 2H3VA 1LB2B 2JR5A 3NUQA 3ETRA 5CWRA 2A1JB 4GXJA 4MHVA 7ICHA 2KZ3A 2JHDA 4B9VA 3UXNA 5AI6A 1D8YA 4JB3A 4O3QA 1YZ6A 1U49A 4DL5A 4K4GA 5ALOA 2JRZA 4JUZA 4EBDA 3MDCA 4LZGA 3FM9A 2F8KA 5JUMA 3TAQA 5AM0A 4NXZA 3UXPA 3DDHA 2W11A 4NLKA 4KN7A 1ZXIA 1JROA 4ELTA 3ZDDA 2ASJA 5J2BA 9ICQA 3BQ2A 3ISBA 1BPZA 4PL1A 3UMBA 2WB1F 4Q8EA 4B9TA 4ECYA 2XI9A 4QJFB 4FE3A 1XO0A 5ALTA 1XS9D 4ED7A 3Q8KA 1SIJA 1A77A 2FJ6A 2OCEA 5J2KA 4Q43A 8ICAA 2HOIA 4YCXA 4KLTA 3M7DA 4ED6A 3G6YA 5DKWA 2PXIA 2FLNA 4F5RA 1O08A 5KFVA 3WU2U 3NVVA 5AK3A 2EZYA 5KL1B 5HNKA 5DG9A 4ZH4A 2ZTDA 2ISPA 4GC7A 3DV9A 4C8OA 5B5EU 3IDWA 4YP3A 3IV6A 1L3SA 3T5LA 4C80A 4F8RA 4FZMA 4UAVA 1NOMA 5CEHA 2BR0A 1NK0A 3OHBA 4UB1A 2MRLA 4CE6A 5KTQA 2YMQA 1Q46A 4CRXA 4DSLA 5KFUA 2IOHA 4F4WA 3RJGA 4R8UA 2DFLA 5J2IA 1U48A 3MGHA 2FPMA 4DOAA 7ICEA 2DWQA 5BOMA 2VJ4A 4QZFA 5L1JA 2WF9A 4FBUA 3L3FX 4RQ3A 4OJ6A 2KD1A 2F1JA 5L1LA 7ICKA 5JU5A 1VLBA 4ELVA 4TQSA 5ALWA 3JPNA 1TK8A 1PK1A 1ZQBA 4TUPA 4RQ5A 3E0FA 3RJFA 1X42A 5J2HA 4KTQA 9ICSA 4OJ5A 4ZOHC 2KZZA 4ECRA 4KLGA 3T5HA 2W03A 2W9BB 1UCVA 3RRHA 1Q3VA 4M9JA 3QU2A 3RJKA 2KSOB 3SR6A 4KX3A 3QU9A 1WCNA 3ICXA 1ZQRA 2LM1A 3JPQA 3HW8A 1L7PA 5ALQA 4RQ7A 3CP8A 4ED8A 1S8OA 4DSJA 3SD7A 5DBCA 3ZD9A 3KHRA 2AGQA 2BCSA 3RF9A 4WJ3B 2ASLA 2ZXHA 3PO5A 2B0CA 5T14A 1SXEA 2ZIWB 4Y2SA 5AK5A 4DF8A 1HIWA 2AHOB 3Q8QB 1L7MA 1COOA 1ZQPA 1B43A 2EAOA 4P4OA 3K75D 4ECXA 2BCQA 3V72A 2G07A 2R8KA 4F2SA 5D4BA 1SZHA 4YFKA 3SMVA 2EQYA 1T3QA 2LYBA 3WK6A 4MF8A 1ZD3A 3Q8SB 2PMZC 3GQCA 3EUB2 2AJQA 3V6KA 2KE7A 4EBCA 2HHTA 5AI5A 4K4IA 3H8WA 2HHWA 2RLTA 3PMLA 4AYBC 4BUGA 8ICZA 2XY6A 5AK6A 5KG3A 5G5HA 3EYZA 3GILA 2PFQA 3M9OB 3BS5B 1XC9A 2PFOA 4NM1A 3T5KA 3DEEA 1RQNA 3HT3A 3PX0A 3IN5A 2I1QA 3MR5A 1ZQKA 3WK5A 5K4LA 3GIIA 2VA2A 4X5VA 1X66A 2BPFA 5J0OA 3AQFA 5AI8A 3MDAA 1ZRMA 5ALEA 4UBCA 3Q8RB 1RXVA 3PW2A 4LZDA 4EEYA 3EPGA 3N7SC 5H2FU 1BNPA 5ALHA 4DL3A 4F91B 4O5CA 1T4GA 3PW4A 5GTHU 4EELA 1MC8A 2EAMA 4F93B 1L3TA 2KJ5A 1A76A 4YVZA 1XSPA 3GDXA 5ALXA 5CP2A 2FPKA 3LVWA 2A1JA 7ICPA 3RJHA 5KT6A 5AKEA 5EE9A 4RQNA 3FC4A 3M9NB 4EX7A 1NKEA 3QUCA 3G6VA 4NY8A 1A0PA 4EX6A 4C0ZA 3GIMA 1S0NA 3WKEA 1ECWA 3WKDA 4ECQA 3TFSA 1X9SA 1MSWD 1QSYA 4PGQA 2J6SA 8ICGA 4RUCA 3TADC 4I2EA 2PMZF 3O0FA 3M8SA 4KMOB 1ZQFA 4C7YA 4UAWA 4C8LA 4ECUA 1NK4A 3M6ZA 4UBBA 4DL7A 1QLNA 1T94A 4AYBF 4UQGA 1S76D 4NL9C 3OPXA 5J0XA 1Q3UA 7ICSA 1WUDA 3BQ7A 3I28A 3F5AA 8ICCA 5ALPA 2FMSA 9ICXA 2KKPA 5DLFA 1YT3A 4J9OA 8ICXA 2Q4TA 2KVSA 4EZ6A 2D6FC 1DXSA 1VJ5A 4RU9A 3FYHA 3RR7A 3H4BA 5G5GA 2LHTA 2ALZA 1QQ7A 1RYRA 2MUTB 7ICUA 1A6SA 8ICVA 4UW9A 1BPXA 5ALRA 1MN8A 4DSIA 3LDAA 1M6YA 3WK7A 3VCBA 5DB9A 2HHQA 1NK6A 3H8SA 2KN7A 2XC9A 2JH1A 1JUDA 2GOLA 2C2DA 4KLJA 1JN3A 2Y9TA 2K4PA 3Q8PB 2R18A 3CYMA 1S0MA 4NV0A 3C5GA 2LI6A 1TAMA 3PNCA 4P0QA 4US8A 1ZYQA 3M1YA 5KG1A 5F9LA 4B9SA 3SAHA 3K4GA 5KFIA 4O3SA 1YZ7A 3LYSA 3QUBA 4UB2A 2W54A 2GO7A 3QEBZ 8ICUA 2G06A 1NKBA 4KLUA 2HVHA 4ECZA 5AKXA 4RZRA 4KN4A 1PUZA 9ICCA 2HVIA 1RYUA 1V38A 3H0MB 2V4QA 3NRWA 2QARB 3MC1A 5KFPA 4I27A 2BCUA 4DS4A 4KLDA 2K4HA 1NZBA 5J29A 9ICRA 4RNOA 3PZPA 4TUQA 1WWVA 4Y2VA 4CF4A 1SL0A 4KLIA 7ICGA 2J6TA 1JXLA 2OHFA 2BGWA 2E3TA 2ESEA 1ZQUA 2RP5A 3T79A 4PPXA 4YG2A 4KX5A 2ZIWA 1SZPA 1RQLA 3MFIA 2WHEA 4OO1J 4R64A 1PVRA 5J2EA 1ZQIA 3RBEA 3R9KA 9ICBA 1DOQA 4JV2A 5AHXA 3TADA 3H8MA 3NGDA 2ZTEA 2MAXA 3IM1A 2DUYA 2P66A 2P35A 2RDJA 5HR6A 2ZIXB 4IL6U 4PHDA 4M9HA 4O3RA 1VDVA 2V9WA 2EH9A 5ALUA 5J8YC 1RPLA 2ZIVB 5KFKA 3JPTA 4MF2A 4NL9A 3WKAA 1KFSA 3ZD8A 2PFPA 2V4RA 9ICKA 1ZQQA 1WCLA 1Q8KA 4I2DA 1ED1A 1HUOA 1ZRNA 2ZXIA 1KDHA 2Z7JA 5ALMA 2E8MA 5DB8A 4YMMA 1KRPA 4M9GA 5DDYA 2KMDA 4CGZA 5HHIA 2F77X 4NLGA 4R63A 5CJ7A 1NKCA 3KD3A 1ZQHA 4M47A 3D2QA 5AI4A 4YR0A 3HJEA 4RNMA 1QH9A 4RQ4A 1NNLA 2ISOA 1RZTA 5J0PA 3OSPA 3AEVA 2LM4A 3QU4A 5KFQA 2G5IB 9ICLA 3N97B 3PV8A 1N56A 3FDSA 1KN5A 4QZAA 9ICFA 2YTUA 5EOZA 3QZ8A 1NJWA 1RG6A 2NRXA 3AN1A 5AIBA 2XY5A 8ICFA 5CHGA 1N2XA 4TURA 4BXOA 1L5UA 4ECTA 1S97A 4NM2A 3WK8A 3NVYA 3M9MB 2DGZA 2JV3A 1B0XA 2MU2A 8ICNA 1WWUA 2W8LA 1ZQMA 2UVUA 3UQ2A 1DGSA 4KITB 2VANA 3WK9A 4DQQA 2RDIA 2FLLA 4F5QA 3UXOA 1NK8A 4IQVA 4QZ9A 2ZUDA 1BNOA 1OUQA 3KBBA 1DRGA 2C22A 3GV8B 4QWCA 1KEJA 5AKIA 2EZZA 2HHXA 1N5XA 4DQRA 4IRKA 1ZJNA 2F3NA 2JXJA 1KTQA 3RAQA 2HMXA 3RJJA 4I2FA 2A3VA 5DQIA 3RTVA 2ASDA 1UA0A 3F2BA 4JWMA 1V9PA 2QB1A 3LWMA 2ZJ8A 5F3XB 2H5XA 2AXTU 3ZDBA 1ZQXA 5EWGA 4A8EA 1J97A 5KG2A 3E58A 5J8YA 1Z4OA 5FP0A 2KNJA 5KG5A 3RR8A 2BDPA 7ICTA 4KLFA 4RQ0A 2AH5A 1KFTA 4IRDA 2BQ3A 2KFZA 4PL2A 1NK9A 4C4SA 1ZQDA 2GH1A 7ICRA 1L7NA 4RNNA 4FZLA 4O5EA 1L3VA 1LVHA 4F5PA 3GV5B 5DGBA 3RH6A 1MA7A 4J9MA 3V7JA 3PO4A 4QZDA 4JWNA 1X2IA 5J0QA 4XUSA 5IIJA 1C20A 4PZOA 1ZQGA 2KZMA 3C1ZA 4O5KA 5DLGA 4EEKA 8ICOA 3PVXA 2OWOA 3SZ2A 3HX0A 4UB5A 1LKYB 2JEIA 1XSNA 4RPYA 2DKZA 2G08A 3SV3A 2QARA 2JEFA 2P6UA 3AU2A 1V85A 1N60A 1DK3A 1BPDA 1CRXA 4P0PB 4RT2A 2HHUA 4GLXA 3T5JA 2IOFA 4B9NA 2QB0B 4YN4A 4RQ2A 8ICTA 2F1HA 4DWIA 5AKJA 3JPOA 4DLEA 4O3NA 1TAUA 1HJPA 1FIQA 2MSNA 4Y2UA 3TANA 3GFKB 3RAXA 4DL6A 1CUKA 3AQEA 4K4HA 2HBJA 3AL0B 3AUOA 4B9LA 2YMLA 8ICYA 1PK3A 1SKRA 4UAYA 5DGAA 4OJOA 4J9PA 1N63A 2NRVA 1KSPA 2ZIXA 8ICWA 1T3NA 5HMMA 2M0NA 4B9MA 2YB4A 5ALGA 2WF8A 2Y0SC 3QUTA 4J9SA 3B9JA 4F4KA 5L1MA 1S0VA 4QZHA 2E8PA 1TKDA 2WAQC 3HKZF 4J9RA 2ZIVA 4RQ1A 3QU7A 1ZQNA 3TACB 1U45A 2Y9UA 3BQ1A 4J03A 2KFNA 3CW2C 3PX6A 2LMRA 3SI8A 4KLOA 5A0LA 4KLMA 2B6GA 1D8LA 1WYGA 5ALLA 4KLLA 5ALFA 4YXJA 5J2AA 1XWLA 1X40A 4UB6U 5BPCA 4GC6A 5KG4A 4OCZA 5KFCA 4RUAA 2W7OA 4PGYA 3MBYA 2RHFA 3GZFA 5DG8A 2HSZA 9ICAA 3H0LB 9ICVA 2KJ9A 3A0HU 4DEZA 4RT3A 5E79U 1Z4NA 4JMUA 5J2GA 4EYIB 3MABA 4DFPA 2IBKA 4UAUA 4QZ8A 3GU3A 4BX9C 4MFFA 3PW0A 4YD1A 3T3FA 3PR4A 5C5JA 2E8NA 5KFEA 2KTQA 5KFAA 4OD0A 4KLQA 7ICVA 9ICUA 3SAGA 2BZFA 1N62A 3MGVA 5DB6A 3WK4A 4R65A 1JX4A 1BGXT 4RPXA 1IV8A 2HBLA 2R8IA 2LYAA 2FMQA 4IQUA 4PJ0U 1ZD2P 4HYKA 1NJYA 1JI7A 4E0DA 4O3OA 5EE1A 2WF7A 4GFJA 2FDRA 5AICA 4QIWC 2ZIUB 1Z00B 2R8GA 5CA7A 3K1RB 3C21A 3OHAA 3OJUA 3N28A 3RB6A 2NO4A 2R8JA 1UT8A 5AK4A 2NRWA 3H40A 2Y0SF 3SENA 4IQTA 1COKA 3AU6A 2BDUA 3G6XA 2WAQF 5AKHA 3HP6A 4UAZA 4NWIA 2UVWA 1GO3F 4ECSA 2NYVA 1SL1A 1IIPA 3F2CA 4EZ9A 1L7OA 3NS1A 5AI9A 5KFXA 4Q45A 4GIBA 4UB4A 1UQVA 5AI0A 4FS2A 1QSLA 2UVVA 3IHQB 3PSFA 1QTMA 5EWEA 1HEKA 2L5YA 2K4EA 1JALA 4OJPA 1MQ3A 2EANA 4Q44A 5HHHA 3ONNA 1V97A 2ZG6A 4M6WB 2K60A 2R8HA 3PSTA 2Y1JA 4O9MA 3HRDD 3N7RC 5JTIA 4NLBA 5EWFA 3TKAA 4IR9A 4KLSA 1FFUA 3KHHA 1BPEA 5B66U 1B22A 2CXYA 2ATLA 2DL0A 2HCFA 2W9AA 5AKGA 4R66A 5AIAA 2NRZA 3RFAA 4YMNA 1PZNA 3UMGA 4FO6A 1ZD5A 4DS5A 2WF5A 2K8CB 5KFWA 5ALDA 2DKXA 5AKKA 3KHGA 1D9DA 2W7PA 4I2JA 2ZJ5A 4O0IA 2W9BA 4QIWF 2HHSA 8ICPA 3SEIA 9ICOA 4C8MA 2KSOA 1X6JA 2LPEA 1J2MA 3CRXA 4RQMA 2P6RA 4ED1A 3F53A 4TQRA 3AM9A 4CF3A 4HAIA 4F5OA 4DFKA 9ICNA 3UM9A 3WKCA 2K8BB 3D6JA 1S0OA 5KFOA 3MGIA 5ALKA 2YB1A 2XO7A 1H38A 2J6UA 3V6HA 4Y2TA 2C28A 3CNHA 2D3DA 2I5HA 5EE3A 3E2EA 3D2SA 3A0BU 4UATA 2HDOA 4F71A 1NK5A 4F72A 3M8RA 4P2HA 3V6JA 2Y1IA 8ICBA 7ICLA 2FPLA 2KJ8A 5J0WA 2IA6A 4UB3A 1MQ2A 2KIWA 5KFDA 2MA1A 3QZ7A 3SAFA 2KK0A 2XCAA 1QSSA 2KHQA 4QWDA 4XA5A 4CDGA 8ICJA 2IMWP 1UHUA 4C4RA 2AQ0A 4FFDA 5HMLA 4U7CA 2W9CB 4I2AA 4IR1A 1ZQWA 5KG7A 4I2GA 5GTIU 1CI4A 2OXOA 3WKBA 1NK7A 3JPRA 2HOFA 3BS5A 4M0AA 5KT2A 2VKQA 2JEJA 2IHMA 4LJXA 3OTQA 3ALRA 2JEGA 2UVRA 4BJQA 5HP4A 3C23A 4QZIA 2F8LA 4DFMA 1U47A 2DF4B 2AGOA 4TUSA 7ICJA 2HI0A 2LYHA 1SV0C 1P7DA 3IG5A 2G5HB 3ORYA 2KP7A 1D9FA 1L3UA 2YMMA 5IILA 3ZDCA 5ALJA 2ZJAA 5KFZA 3Q8LA 4B9UA 2HOQA 5J0YA 3GV7B 4RQ8A 1ZQTA 3F2DA 3NVWA 3RBDA 3IP4B 2C2RA 4Q8FA 2ODGA 1TAQA 2JMGA 3S6JA 4LVSA 4P4MA 4Y2YA 1KFDA 4US9A 4FS1A 4I2HA 2H3IA 4DQPA 1L8LA 1LV5A 3LK9A 3C2KA 4J9QA 2QKQA 3TQ1A 1UT5A 2RQ5A 5KFLA 3H4DA 5IINA 1ZQLA 3RB3A 3ISDA 4BWJA 2WTFA 3KFUF 1S77D 1AQ6A 5AM5A 4DSKA 3RB0A 3MR2A 2QLTA 2G0AA 1K5OA 4QZBA 3QYPA 1L6NA 1ZQAA 2VA3A 3QXGA 4BDPA 1KLNA 4C8NA 5KG0A 5AM3A 3C2LA 1L8OA 2ZIUA 1Z00A 3GIJA 4ED2A 2XCPA 2O6KA 3AMZA 1ZQCA 3LWLA 4Y2RA 4QWEA 8ICHA 4DOCA 7ICMA 3SV4A 2EDUA 4Y2QA 4DL2A 2WFAA 5DQGA 1DGJA 4F4YA 2JGAA 3J81j 3RJIA 2OM6A 4AP9A 4OJLA 2W04A 4BGDA 5AKZA 8ICEA 2HHVA 4NJ8A 4DFDA 2Q0ZX 2DPIA 3TARA 2PKEA 5BOLA 1IXRA 4NLNA 5KG6A 5DQHA 3C1YA 2DQNB 1ZD4A 2YY6A 2C2EA 4EBEA 3THVA 4Y2PA 3C29A 3QEAZ 2WF6A 4M9LA 2MUTA 3N7PD 4M04A 4CF5A 5KFJA 2N1RA 1SKSA 2XICA 2LBOA 3HPOA 2E5SA 1AROP 1QQ6A 4BWMA 4M6WA 3NTUA 3UMCA 3HKZC 1EXNA 4GXIA 3VC8A 1QQ5A 2GLEA 3PX4A 4P0QB 2A19A 1IM4A 2K8AA 5KFNA 4YR3A 4USAA 5J2CA 2B21A 1UPHA 5DDMA 3Q8MA 1U4BA 4Z6CA 1KBUA 4O3PA 4F4XA 4DSEA 2W3SA 2BKEA 3HWTA 2OEHA 2PI5A 3RB4A 5J2JA 9ICJA 1SV0A 4MFCA 2OYYA 1HUZA 1NJXA 3ISCA 2F44A 4DO9A 4KMUA 2BCVA 1XSLA 3KHLA 2E8OA 1SV4A 8ICIA 1F44A 2AQ4A 4QNLA 1TE2A 4FZNA 4U6PA 4F50A 5J0RA 4XRHA 1F0MA 5DG7A 2A1AA 2BHNA 5AKYA 1X6IA 1URJA 3ZI4A 4F92B 2GWSA 3EPIA 4JK1A 4I28A 5J2FA 4EENA 5AM4A 4DOBA 1IG6A 4F3OA 1ZQ1C 1TK5A 8ICRA 3FAHA 3JPSA 1RDFA 2KKVA 4QZEA 5KFFA 3UPQA 1S5LU 1ZQZA 1TK0A 4M2YA 4EYHB 3OSNA 4I2BA 2OH2A 2ZTCA 5ALYA 2DBYA 2NO5A 3QNMA 1PVQA 2LKYA 1ZOLA 4P4PA 4DQSA 4Y2XA 2AU0A 1ZQJA 2W55A 2G09A 5TZVA 4C8KA 4UARA 2HBKA 1KW4A 2XGQA 3BJYA 9ICTA 3BZCA 2FLPA 4KLEA 2ZUBA 1KQQA 1NI3A 2VIXA 2E1EA 3C2MA 3TI0A 2PFNA 7ICNA 4PGXA 1Z1VA 2FE9A 1NZPA 1Y88A 3U26A 4IRCA 1N61A 3PY8A 2NV3A 4MFAA 1N48A 2F2AB 5JRTA 5KAIU 4QWBA 9ICGA 3D2NA 1X9MA 5D46A 3BQTA 2W9CA 2K4IA 3MFHA 2JZBB 3RH5A 3L5KA 3QU5A 2KOBA 3UQ0A 3PMNA 3C28A 2H3FA 2CRXA 3PW7A 5KFYA 2EZXA 8ICQA 2YQEA 1FFVA 4YXMA 3F5EA 1J2NA 1Z19A 2RRDA 5ALVA 3I76A 2EAPA 2ES6A 5DBBA 1T8EA 3SYZA 2AGPA 4B6JA 2ZUCA 5KNIA 5KFSA 1C7YA 7ICIA 4CCHA 3BDPA 4JV0A 3H0RB 1SWVA 5KFBA 4J9LA 3BQ0A 3EW9A 3OJSA 5EE0A 4ACOA 4YD2A 2BQRA 4GXKA 3KKAC 2DPJA 4C7ZA 3KOOA 4FBTA 4QWAA 3TAPA 5AKLA 2KICA 9ICMA 4QW9A 4BXOB 2CN1A 4F2RA 4I2CA 4KLHA 3B0YA 8ICSA 3MR6A 5HR7A 1BPBA 3N4MB 1JXEA 4CNQA 4UASA 4IC9A 5J0TA 3EWAA 4QZCA 2YN4A 4ELUA 5ALIA 2XIDA 1K1SA 5J2DA 3IG8A 5KFHA 2BPGA 8ICMA 1O03A 5AM2A 5KT5A 4IQWA 3RRGA 1QCKA 4F5NA 2XGPA 1S10A 5C0YA 2KEYA 4DCCA 5J0UA 3ED5A 5CB1A 1Z3EB 5KT3A
chains in the Genus database with same CATH topology
2MRLA 2K4EA 2W7OA 2VJ5A 2NV3A 3PSIA 4ICAA 4OJPA 1SZHA 2RHFA 2F2AB 3GZFA 1OUQA 1A0PA 5CRXA 4C0ZA 1UPHA 3H0LB 4CRXA 1DRGA 3KFUF 2CPRA 3ONNA 2G08A 2KJ8A 3SMVA 1ECWA 3D2NA 2KJ9A 3KZXA 1KBUA 4NLCA 2H3VA 2ZG6A 3SAHA 1ED1A 2LYBA 4JMUA 2K4IA 2ZXIA 3LYSA 3NUQA 3PSTA 1D8BA 2PMZC 2KIWA 2G0AA 1CRXA 2KOBA 3N7RC 2Z7JA 2HMXA 2JHDA 3GU3A 4NLBA 4BX9C 4P0PB 1L6NA 2MA1A 3C28A 2H3FA 2PMZF 2KVCA 2CRXA 2YX8A 2G06A 3O0FA 4P0PA 2OYYA 2VJ4A 2A3VA 3SAFA 4KMOB 2KHQA 3L3FX 4OJ6A 2KD1A 4CDGA 2ZIUA 4CGZA 3F5EA 3M6KA 3H0MB 2F77X 1F44A 3NRWA 3SAGA 3RFAA 3F2BA 1Z19A 2RRDA 3M6ZA 4AYBC 4QNLA 4BUGA 4FZNA 4U6PA 4U7CA 3D2QA 3MGVA 1T94A 3K1ZA 1URJA 2K8CB 4AYBF 2K4HA 1NZBA 3AQEA 3E0FA 4A8EA 2HBJA 3AL0B 2HBLA 2OXOA 3OPXA 1Q3UA 1WUDA 2LYAA 1Z1BA 2HOFA 3PZPA 3DEEA 2H3QA 2JGAA 2W7PA 2VKQA 3F5AA 2OM6A 4OJ5A 3IN5A 2H3ZA 4OJLA 5KL8B 4GFJA 2KKPA 3ALRA 2W04A 2WB1C 4QIWC 2KNJA 2ZIUB 2G5IB 1YT3A 4BJQA 4PL1A 2W03A 2RP5A 1ZQ1C 4OJOA 3T79A 1Q3VA 2Q4TA 2F8LA 2JH7A 3H0RB 2KKVA 2DF4B 2WB1F 2ZIXA 4QIWF 2KV2A 1PVPA 3SQIA 2M0NA 4KX3A 4KX5A 2XI9A 3ICXA 4QJFB 2D6FC 2ZIWA 4ACOA 2YB4A 3AQFA 4FE3A 2Y0SC 4PL2A 1XO0A 2GH1A 1XNSA 2LHTA 1P7DA 4FZLA 4OO1J 2DQNB 2HOIA 1PVRA 3CRXA 2Y0SF 3CP8A 2OH2A 3IG5A 2WAQC 2G5HB 3F53A 3N7SC 3C29A 3HKZF 2KICA 1A6SA 3M7DA 2ZIVA 2BDUA 2K89A 3N7PD 2CN1A 2WAQF 1MA7A 3PSPA 1PVQA 2LKYA 2HOQA 2F76X 3RF9A 4WJ3B 5KL1B 3F2DA 2K8BB 2N1RA 4NWIA 2XICA 2LBOA 1GO3F 2ZXHA 5HR6A 5HR7A 2ZIXB 3LVVA 2KJ5A 1HEKA 3VCBA 1IIPA 3IP4B 4IC9A 3F2CA 2E5SA 5T14A 2HBMA 2ZIWB 2YB1A 2G09A 2JMGA 5A0LA 4O3MA 1HIWA 2DGZA 2JH1A 2GOLA 2HBKA 2XIDA 3LVWA 3HKZC 3IG8A 2KHVA 2XVTA 4FZMA 2ZIVB 3VC8A 2R18A 2E1FA 3CYMA 2VIXA 2E1EA 5C0YA 2KEYA 3D2SA 4NV0A 2H3IA 4P0QB 1TAMA 3PSFA 2K8AA 2G07A 4P0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZF A;  3VCB A;  3VC8 A; 
#chains in the Genus database with same CATH topology
 3L4P A;  4ED3 A;  4DLG A;  2BPC A;  4PH5 A;  5IIK A;  4Z6E A;  5CRX A;  2KIV A;  3KZX A;  2KG5 A;  3ETL A;  2I6X A;  5J0S A;  2W9M A;  1T7P A;  4Z6D A;  3V7L A;  1ZQO A;  2W43 A;  4DSF A;  3OGU A;  5KAF U;  5IIM A;  3QX7 A;  2FMP A;  4R8U B;  3K1Z A;  1JRP A;  2FI1 A;  3BZK A;  4ED0 A;  3ZDA A;  3I1Y A;  1XU4 A;  2H3Q A;  5KFG A;  3EZ5 A;  7ICQ A;  2IOF K;  5L1K A;  9ICE A;  5III A;  1SL2 A;  2W3R A;  2KV2 A;  5KT7 A;  2M9N A;  2PI4 A;  3PW5 A;  5ALZ A;  1PK1 B;  3KZI U;  1XNS A;  4QZG A;  8ICL A;  1SXD A;  5KT4 A;  3QUQ A;  2K89 A;  4JV1 A;  2BQU A;  1N5W A;  1RM6 C;  2F76 X;  3H7I A;  1KL9 A;  3LVV A;  4Z6F A;  3KTQ A;  2HW3 A;  1TFR A;  4ECW A;  3RJE A;  4O3M A;  1UA1 A;  5F9N A;  1RYS A;  1WG8 A;  1SB3 C;  4YQW A;  3NVZ A;  2E1F A;  1DK2 A;  1SWW A;  1JIH A;  3V7K A;  4XQ8 A;  2VJ5 A;  3B0X A;  2NRT A;  1SGG A;  1LKY A;  2CPR A;  3TFR A;  4NLC A;  5KFT A;  4PHP A;  1ZQV A;  3ZDE A;  5KFM A;  4PZN A;  1D8B A;  1NJZ A;  5DB7 A;  3IRU A;  1TV9 A;  9ICH A;  3KKA A;  1U9L A;  4P0P A;  2KVC A;  8ICK A;  2YX8 A;  1TVA A;  2VA8 A;  2QB0 A;  3M6K A;  7ICF A;  4DFJ A;  3PR5 B;  5TIS U;  4DQI A;  5D49 A;  4NLZ A;  1Z1B A;  5ALS A;  1X9X A;  3NRZ A;  2W8K A;  1OXJ A;  4I29 A;  2H3Z A;  5KL8 B;  3QE9 Y;  3H8J A;  1B4F A;  4RPZ A;  2WB1 C;  1S9F A;  4F4Z A;  1X9W A;  9ICP A;  1BPY A;  1BVS A;  2JH7 A;  1PVP A;  4G3I A;  1OW5 A;  4IS7 A;  4QW8 A;  3SQI A;  4ECV A;  3JPP A;  2XY7 A;  4PHA A;  4YMO A;  5AM1 A;  1FO4 A;  3BS7 A;  3GIK A;  2BCR A;  1ZQS A;  1FEZ A;  2I9G A;  2F1I A;  4MEY A;  1XO1 A;  1ZET A;  3RH4 A;  4DL4 A;  3MR3 A;  3PSP A;  3HIL A;  1SKW A;  4YR2 A;  4C4T A;  5ALN A;  4J9K A;  4DF4 A;  1KKX A;  4MEX A;  1F5S A;  3NAS A;  1K1Q A;  9ICI A;  5DBA A;  2D8C A;  3C5F A;  4G9B A;  2HBM A;  5IIO A;  5CR0 A;  2IHN A;  4J9N A;  4RQ6 A;  2JZB A;  2KHV A;  1ZJM A;  5L1I A;  9ICW A;  2XVT A;  4M9N A;  5L9X A;  2YMP A;  5KFR A;  1CEZ A;  3PSI A;  4ICA A;  4UB8 U;  1ZQY A;  1JMS A;  4PHE A;  1RXW A;  4Y2J A;  7ICO A;  4I2I A;  1ZQE A;  2H3V A;  1LB2 B;  2JR5 A;  3NUQ A;  3ETR A;  5CWR A;  2A1J B;  4GXJ A;  4MHV A;  7ICH A;  2KZ3 A;  2JHD A;  4B9V A;  3UXN A;  5AI6 A;  1D8Y A;  4JB3 A;  4O3Q A;  1YZ6 A;  1U49 A;  4DL5 A;  4K4G A;  5ALO A;  2JRZ A;  4JUZ A;  4EBD A;  3MDC A;  4LZG A;  3FM9 A;  2F8K A;  5JUM A;  3TAQ A;  5AM0 A;  4NXZ A;  3UXP A;  3DDH A;  2W11 A;  4NLK A;  4KN7 A;  1ZXI A;  1JRO A;  4ELT A;  3ZDD A;  2ASJ A;  5J2B A;  9ICQ A;  3BQ2 A;  3ISB A;  1BPZ A;  4PL1 A;  3UMB A;  2WB1 F;  4Q8E A;  4B9T A;  4ECY A;  2XI9 A;  4QJF B;  4FE3 A;  1XO0 A;  5ALT A;  1XS9 D;  4ED7 A;  3Q8K A;  1SIJ A;  1A77 A;  2FJ6 A;  2OCE A;  5J2K A;  4Q43 A;  8ICA A;  2HOI A;  4YCX A;  4KLT A;  3M7D A;  4ED6 A;  3G6Y A;  5DKW A;  2PXI A;  2FLN A;  4F5R A;  1O08 A;  5KFV A;  3WU2 U;  3NVV A;  5AK3 A;  2EZY A;  5KL1 B;  5HNK A;  5DG9 A;  4ZH4 A;  2ZTD A;  2ISP A;  4GC7 A;  3DV9 A;  4C8O A;  5B5E U;  3IDW A;  4YP3 A;  3IV6 A;  1L3S A;  3T5L A;  4C80 A;  4F8R A;  4FZM A;  4UAV A;  1NOM A;  5CEH A;  2BR0 A;  1NK0 A;  3OHB A;  4UB1 A;  2MRL A;  4CE6 A;  5KTQ A;  2YMQ A;  1Q46 A;  4CRX A;  4DSL A;  5KFU A;  2IOH A;  4F4W A;  3RJG A;  4R8U A;  2DFL A;  5J2I A;  1U48 A;  3MGH A;  2FPM A;  4DOA A;  7ICE A;  2DWQ A;  5BOM A;  2VJ4 A;  4QZF A;  5L1J A;  2WF9 A;  4FBU A;  3L3F X;  4RQ3 A;  4OJ6 A;  2KD1 A;  2F1J A;  5L1L A;  7ICK A;  5JU5 A;  1VLB A;  4ELV A;  4TQS A;  5ALW A;  3JPN A;  1TK8 A;  1PK1 A;  1ZQB A;  4TUP A;  4RQ5 A;  3E0F A;  3RJF A;  1X42 A;  5J2H A;  4KTQ A;  9ICS A;  4OJ5 A;  4ZOH C;  2KZZ A;  4ECR A;  4KLG A;  3T5H A;  2W03 A;  2W9B B;  1UCV A;  3RRH A;  1Q3V A;  4M9J A;  3QU2 A;  3RJK A;  2KSO B;  3SR6 A;  4KX3 A;  3QU9 A;  1WCN A;  3ICX A;  1ZQR A;  2LM1 A;  3JPQ A;  3HW8 A;  1L7P A;  5ALQ A;  4RQ7 A;  3CP8 A;  4ED8 A;  1S8O A;  4DSJ A;  3SD7 A;  5DBC A;  3ZD9 A;  3KHR A;  2AGQ A;  2BCS A;  3RF9 A;  4WJ3 B;  2ASL A;  2ZXH A;  3PO5 A;  2B0C A;  5T14 A;  1SXE A;  2ZIW B;  4Y2S A;  5AK5 A;  4DF8 A;  1HIW A;  2AHO B;  3Q8Q B;  1L7M A;  1COO A;  1ZQP A;  1B43 A;  2EAO A;  4P4O A;  3K75 D;  4ECX A;  2BCQ A;  3V72 A;  2G07 A;  2R8K A;  4F2S A;  5D4B A;  1SZH A;  4YFK A;  3SMV A;  2EQY A;  1T3Q A;  2LYB A;  3WK6 A;  4MF8 A;  1ZD3 A;  3Q8S B;  2PMZ C;  3GQC A;  3EUB 2;  2AJQ A;  3V6K A;  2KE7 A;  4EBC A;  2HHT A;  5AI5 A;  4K4I A;  3H8W A;  2HHW A;  2RLT A;  3PML A;  4AYB C;  4BUG A;  8ICZ A;  2XY6 A;  5AK6 A;  5KG3 A;  5G5H A;  3EYZ A;  3GIL A;  2PFQ A;  3M9O B;  3BS5 B;  1XC9 A;  2PFO A;  4NM1 A;  3T5K A;  3DEE A;  1RQN A;  3HT3 A;  3PX0 A;  3IN5 A;  2I1Q A;  3MR5 A;  1ZQK A;  3WK5 A;  5K4L A;  3GII A;  2VA2 A;  4X5V A;  1X66 A;  2BPF A;  5J0O A;  3AQF A;  5AI8 A;  3MDA A;  1ZRM A;  5ALE A;  4UBC A;  3Q8R B;  1RXV A;  3PW2 A;  4LZD A;  4EEY A;  3EPG A;  3N7S C;  5H2F U;  1BNP A;  5ALH A;  4DL3 A;  4F91 B;  4O5C A;  1T4G A;  3PW4 A;  5GTH U;  4EEL A;  1MC8 A;  2EAM A;  4F93 B;  1L3T A;  2KJ5 A;  1A76 A;  4YVZ A;  1XSP A;  3GDX A;  5ALX A;  5CP2 A;  2FPK A;  3LVW A;  2A1J A;  7ICP A;  3RJH A;  5KT6 A;  5AKE A;  5EE9 A;  4RQN A;  3FC4 A;  3M9N B;  4EX7 A;  1NKE A;  3QUC A;  3G6V A;  4NY8 A;  1A0P A;  4EX6 A;  4C0Z A;  3GIM A;  1S0N A;  3WKE A;  1ECW A;  3WKD A;  4ECQ A;  3TFS A;  1X9S A;  1MSW D;  1QSY A;  4PGQ A;  2J6S A;  8ICG A;  4RUC A;  3TAD C;  4I2E A;  2PMZ F;  3O0F A;  3M8S A;  4KMO B;  1ZQF A;  4C7Y A;  4UAW A;  4C8L A;  4ECU A;  1NK4 A;  3M6Z A;  4UBB A;  4DL7 A;  1QLN A;  1T94 A;  4AYB F;  4UQG A;  1S76 D;  4NL9 C;  3OPX A;  5J0X A;  1Q3U A;  7ICS A;  1WUD A;  3BQ7 A;  3I28 A;  3F5A A;  8ICC A;  5ALP A;  2FMS A;  9ICX A;  2KKP A;  5DLF A;  1YT3 A;  4J9O A;  8ICX A;  2Q4T A;  2KVS A;  4EZ6 A;  2D6F C;  1DXS A;  1VJ5 A;  4RU9 A;  3FYH A;  3RR7 A;  3H4B A;  5G5G A;  2LHT A;  2ALZ A;  1QQ7 A;  1RYR A;  2MUT B;  7ICU A;  1A6S A;  8ICV A;  4UW9 A;  1BPX A;  5ALR A;  1MN8 A;  4DSI A;  3LDA A;  1M6Y A;  3WK7 A;  3VCB A;  5DB9 A;  2HHQ A;  1NK6 A;  3H8S A;  2KN7 A;  2XC9 A;  2JH1 A;  1JUD A;  2GOL A;  2C2D A;  4KLJ A;  1JN3 A;  2Y9T A;  2K4P A;  3Q8P B;  2R18 A;  3CYM A;  1S0M A;  4NV0 A;  3C5G A;  2LI6 A;  1TAM A;  3PNC A;  4P0Q A;  4US8 A;  1ZYQ A;  3M1Y A;  5KG1 A;  5F9L A;  4B9S A;  3SAH A;  3K4G A;  5KFI A;  4O3S A;  1YZ7 A;  3LYS A;  3QUB A;  4UB2 A;  2W54 A;  2GO7 A;  3QEB Z;  8ICU A;  2G06 A;  1NKB A;  4KLU A;  2HVH A;  4ECZ A;  5AKX A;  4RZR A;  4KN4 A;  1PUZ A;  9ICC A;  2HVI A;  1RYU A;  1V38 A;  3H0M B;  2V4Q A;  3NRW A;  2QAR B;  3MC1 A;  5KFP A;  4I27 A;  2BCU A;  4DS4 A;  4KLD A;  2K4H A;  1NZB A;  5J29 A;  9ICR A;  4RNO A;  3PZP A;  4TUQ A;  1WWV A;  4Y2V A;  4CF4 A;  1SL0 A;  4KLI A;  7ICG A;  2J6T A;  1JXL A;  2OHF A;  2BGW A;  2E3T A;  2ESE A;  1ZQU A;  2RP5 A;  3T79 A;  4PPX A;  4YG2 A;  4KX5 A;  2ZIW A;  1SZP A;  1RQL A;  3MFI A;  2WHE A;  4OO1 J;  4R64 A;  1PVR A;  5J2E A;  1ZQI A;  3RBE A;  3R9K A;  9ICB A;  1DOQ A;  4JV2 A;  5AHX A;  3TAD A;  3H8M A;  3NGD A;  2ZTE A;  2MAX A;  3IM1 A;  2DUY A;  2P66 A;  2P35 A;  2RDJ A;  5HR6 A;  2ZIX B;  4IL6 U;  4PHD A;  4M9H A;  4O3R A;  1VDV A;  2V9W A;  2EH9 A;  5ALU A;  5J8Y C;  1RPL A;  2ZIV B;  5KFK A;  3JPT A;  4MF2 A;  4NL9 A;  3WKA A;  1KFS A;  3ZD8 A;  2PFP A;  2V4R A;  9ICK A;  1ZQQ A;  1WCL A;  1Q8K A;  4I2D A;  1ED1 A;  1HUO A;  1ZRN A;  2ZXI A;  1KDH A;  2Z7J A;  5ALM A;  2E8M A;  5DB8 A;  4YMM A;  1KRP A;  4M9G A;  5DDY A;  2KMD A;  4CGZ A;  5HHI A;  2F77 X;  4NLG A;  4R63 A;  5CJ7 A;  1NKC A;  3KD3 A;  1ZQH A;  4M47 A;  3D2Q A;  5AI4 A;  4YR0 A;  3HJE A;  4RNM A;  1QH9 A;  4RQ4 A;  1NNL A;  2ISO A;  1RZT A;  5J0P A;  3OSP A;  3AEV A;  2LM4 A;  3QU4 A;  5KFQ A;  2G5I B;  9ICL A;  3N97 B;  3PV8 A;  1N56 A;  3FDS A;  1KN5 A;  4QZA A;  9ICF A;  2YTU A;  5EOZ A;  3QZ8 A;  1NJW A;  1RG6 A;  2NRX A;  3AN1 A;  5AIB A;  2XY5 A;  8ICF A;  5CHG A;  1N2X A;  4TUR A;  4BXO A;  1L5U A;  4ECT A;  1S97 A;  4NM2 A;  3WK8 A;  3NVY A;  3M9M B;  2DGZ A;  2JV3 A;  1B0X A;  2MU2 A;  8ICN A;  1WWU A;  2W8L A;  1ZQM A;  2UVU A;  3UQ2 A;  1DGS A;  4KIT B;  2VAN A;  3WK9 A;  4DQQ A;  2RDI A;  2FLL A;  4F5Q A;  3UXO A;  1NK8 A;  4IQV A;  4QZ9 A;  2ZUD A;  1BNO A;  1OUQ A;  3KBB A;  1DRG A;  2C22 A;  3GV8 B;  4QWC A;  1KEJ A;  5AKI A;  2EZZ A;  2HHX A;  1N5X A;  4DQR A;  4IRK A;  1ZJN A;  2F3N A;  2JXJ A;  1KTQ A;  3RAQ A;  2HMX A;  3RJJ A;  4I2F A;  2A3V A;  5DQI A;  3RTV A;  2ASD A;  1UA0 A;  3F2B A;  4JWM A;  1V9P A;  2QB1 A;  3LWM A;  2ZJ8 A;  5F3X B;  2H5X A;  2AXT U;  3ZDB A;  1ZQX A;  5EWG A;  4A8E A;  1J97 A;  5KG2 A;  3E58 A;  5J8Y A;  1Z4O A;  5FP0 A;  2KNJ A;  5KG5 A;  3RR8 A;  2BDP A;  7ICT A;  4KLF A;  4RQ0 A;  2AH5 A;  1KFT A;  4IRD A;  2BQ3 A;  2KFZ A;  4PL2 A;  1NK9 A;  4C4S A;  1ZQD A;  2GH1 A;  7ICR A;  1L7N A;  4RNN A;  4FZL A;  4O5E A;  1L3V A;  1LVH A;  4F5P A;  3GV5 B;  5DGB A;  3RH6 A;  1MA7 A;  4J9M A;  3V7J A;  3PO4 A;  4QZD A;  4JWN A;  1X2I A;  5J0Q A;  4XUS A;  5IIJ A;  1C20 A;  4PZO A;  1ZQG A;  2KZM A;  3C1Z A;  4O5K A;  5DLG A;  4EEK A;  8ICO A;  3PVX A;  2OWO A;  3SZ2 A;  3HX0 A;  4UB5 A;  1LKY B;  2JEI A;  1XSN A;  4RPY A;  2DKZ A;  2G08 A;  3SV3 A;  2QAR A;  2JEF A;  2P6U A;  3AU2 A;  1V85 A;  1N60 A;  1DK3 A;  1BPD A;  1CRX A;  4P0P B;  4RT2 A;  2HHU A;  4GLX A;  3T5J A;  2IOF A;  4B9N A;  2QB0 B;  4YN4 A;  4RQ2 A;  8ICT A;  2F1H A;  4DWI A;  5AKJ A;  3JPO A;  4DLE A;  4O3N A;  1TAU A;  1HJP A;  1FIQ A;  2MSN A;  4Y2U A;  3TAN A;  3GFK B;  3RAX A;  4DL6 A;  1CUK A;  3AQE A;  4K4H A;  2HBJ A;  3AL0 B;  3AUO A;  4B9L A;  2YML A;  8ICY A;  1PK3 A;  1SKR A;  4UAY A;  5DGA A;  4OJO A;  4J9P A;  1N63 A;  2NRV A;  1KSP A;  2ZIX A;  8ICW A;  1T3N A;  5HMM A;  2M0N A;  4B9M A;  2YB4 A;  5ALG A;  2WF8 A;  2Y0S C;  3QUT A;  4J9S A;  3B9J A;  4F4K A;  5L1M A;  1S0V A;  4QZH A;  2E8P A;  1TKD A;  2WAQ C;  3HKZ F;  4J9R A;  2ZIV A;  4RQ1 A;  3QU7 A;  1ZQN A;  3TAC B;  1U45 A;  2Y9U A;  3BQ1 A;  4J03 A;  2KFN A;  3CW2 C;  3PX6 A;  2LMR A;  3SI8 A;  4KLO A;  5A0L A;  4KLM A;  2B6G A;  1D8L A;  1WYG A;  5ALL A;  4KLL A;  5ALF A;  4YXJ A;  5J2A A;  1XWL A;  1X40 A;  4UB6 U;  5BPC A;  4GC6 A;  5KG4 A;  4OCZ A;  5KFC A;  4RUA A;  2W7O A;  4PGY A;  3MBY A;  2RHF A;  3GZF A;  5DG8 A;  2HSZ A;  9ICA A;  3H0L B;  9ICV A;  2KJ9 A;  3A0H U;  4DEZ A;  4RT3 A;  5E79 U;  1Z4N A;  4JMU A;  5J2G A;  4EYI B;  3MAB A;  4DFP A;  2IBK A;  4UAU A;  4QZ8 A;  3GU3 A;  4BX9 C;  4MFF A;  3PW0 A;  4YD1 A;  3T3F A;  3PR4 A;  5C5J A;  2E8N A;  5KFE A;  2KTQ A;  5KFA A;  4OD0 A;  4KLQ A;  7ICV A;  9ICU A;  3SAG A;  2BZF A;  1N62 A;  3MGV A;  5DB6 A;  3WK4 A;  4R65 A;  1JX4 A;  1BGX T;  4RPX A;  1IV8 A;  2HBL A;  2R8I A;  2LYA A;  2FMQ A;  4IQU A;  4PJ0 U;  1ZD2 P;  4HYK A;  1NJY A;  1JI7 A;  4E0D A;  4O3O A;  5EE1 A;  2WF7 A;  4GFJ A;  2FDR A;  5AIC A;  4QIW C;  2ZIU B;  1Z00 B;  2R8G A;  5CA7 A;  3K1R B;  3C21 A;  3OHA A;  3OJU A;  3N28 A;  3RB6 A;  2NO4 A;  2R8J A;  1UT8 A;  5AK4 A;  2NRW A;  3H40 A;  2Y0S F;  3SEN A;  4IQT A;  1COK A;  3AU6 A;  2BDU A;  3G6X A;  2WAQ F;  5AKH A;  3HP6 A;  4UAZ A;  4NWI A;  2UVW A;  1GO3 F;  4ECS A;  2NYV A;  1SL1 A;  1IIP A;  3F2C A;  4EZ9 A;  1L7O A;  3NS1 A;  5AI9 A;  5KFX A;  4Q45 A;  4GIB A;  4UB4 A;  1UQV A;  5AI0 A;  4FS2 A;  1QSL A;  2UVV A;  3IHQ B;  3PSF A;  1QTM A;  5EWE A;  1HEK A;  2L5Y A;  2K4E A;  1JAL A;  4OJP A;  1MQ3 A;  2EAN A;  4Q44 A;  5HHH A;  3ONN A;  1V97 A;  2ZG6 A;  4M6W B;  2K60 A;  2R8H A;  3PST A;  2Y1J A;  4O9M A;  3HRD D;  3N7R C;  5JTI A;  4NLB A;  5EWF A;  3TKA A;  4IR9 A;  4KLS A;  1FFU A;  3KHH A;  1BPE A;  5B66 U;  1B22 A;  2CXY A;  2ATL A;  2DL0 A;  2HCF A;  2W9A A;  5AKG A;  4R66 A;  5AIA A;  2NRZ A;  3RFA A;  4YMN A;  1PZN A;  3UMG A;  4FO6 A;  1ZD5 A;  4DS5 A;  2WF5 A;  2K8C B;  5KFW A;  5ALD A;  2DKX A;  5AKK A;  3KHG A;  1D9D A;  2W7P A;  4I2J A;  2ZJ5 A;  4O0I A;  2W9B A;  4QIW F;  2HHS A;  8ICP A;  3SEI A;  9ICO A;  4C8M A;  2KSO A;  1X6J A;  2LPE A;  1J2M A;  3CRX A;  4RQM A;  2P6R A;  4ED1 A;  3F53 A;  4TQR A;  3AM9 A;  4CF3 A;  4HAI A;  4F5O A;  4DFK A;  9ICN A;  3UM9 A;  3WKC A;  2K8B B;  3D6J A;  1S0O A;  5KFO A;  3MGI A;  5ALK A;  2YB1 A;  2XO7 A;  1H38 A;  2J6U A;  3V6H A;  4Y2T A;  2C28 A;  3CNH A;  2D3D A;  2I5H A;  5EE3 A;  3E2E A;  3D2S A;  3A0B U;  4UAT A;  2HDO A;  4F71 A;  1NK5 A;  4F72 A;  3M8R A;  4P2H A;  3V6J A;  2Y1I A;  8ICB A;  7ICL A;  2FPL A;  2KJ8 A;  5J0W A;  2IA6 A;  4UB3 A;  1MQ2 A;  2KIW A;  5KFD A;  2MA1 A;  3QZ7 A;  3SAF A;  2KK0 A;  2XCA A;  1QSS A;  2KHQ A;  4QWD A;  4XA5 A;  4CDG A;  8ICJ A;  2IMW P;  1UHU A;  4C4R A;  2AQ0 A;  4FFD A;  5HML A;  4U7C A;  2W9C B;  4I2A A;  4IR1 A;  1ZQW A;  5KG7 A;  4I2G A;  5GTI U;  1CI4 A;  2OXO A;  3WKB A;  1NK7 A;  3JPR A;  2HOF A;  3BS5 A;  4M0A A;  5KT2 A;  2VKQ A;  2JEJ A;  2IHM A;  4LJX A;  3OTQ A;  3ALR A;  2JEG A;  2UVR A;  4BJQ A;  5HP4 A;  3C23 A;  4QZI A;  2F8L A;  4DFM A;  1U47 A;  2DF4 B;  2AGO A;  4TUS A;  7ICJ A;  2HI0 A;  2LYH A;  1SV0 C;  1P7D A;  3IG5 A;  2G5H B;  3ORY A;  2KP7 A;  1D9F A;  1L3U A;  2YMM A;  5IIL A;  3ZDC A;  5ALJ A;  2ZJA A;  5KFZ A;  3Q8L A;  4B9U A;  2HOQ A;  5J0Y A;  3GV7 B;  4RQ8 A;  1ZQT A;  3F2D A;  3NVW A;  3RBD A;  3IP4 B;  2C2R A;  4Q8F A;  2ODG A;  1TAQ A;  2JMG A;  3S6J A;  4LVS A;  4P4M A;  4Y2Y A;  1KFD A;  4US9 A;  4FS1 A;  4I2H A;  2H3I A;  4DQP A;  1L8L A;  1LV5 A;  3LK9 A;  3C2K A;  4J9Q A;  2QKQ A;  3TQ1 A;  1UT5 A;  2RQ5 A;  5KFL A;  3H4D A;  5IIN A;  1ZQL A;  3RB3 A;  3ISD A;  4BWJ A;  2WTF A;  3KFU F;  1S77 D;  1AQ6 A;  5AM5 A;  4DSK A;  3RB0 A;  3MR2 A;  2QLT A;  2G0A A;  1K5O A;  4QZB A;  3QYP A;  1L6N A;  1ZQA A;  2VA3 A;  3QXG A;  4BDP A;  1KLN A;  4C8N A;  5KG0 A;  5AM3 A;  3C2L A;  1L8O A;  2ZIU A;  1Z00 A;  3GIJ A;  4ED2 A;  2XCP A;  2O6K A;  3AMZ A;  1ZQC A;  3LWL A;  4Y2R A;  4QWE A;  8ICH A;  4DOC A;  7ICM A;  3SV4 A;  2EDU A;  4Y2Q A;  4DL2 A;  2WFA A;  5DQG A;  1DGJ A;  4F4Y A;  2JGA A;  3J81 j;  3RJI A;  2OM6 A;  4AP9 A;  4OJL A;  2W04 A;  4BGD A;  5AKZ A;  8ICE A;  2HHV A;  4NJ8 A;  4DFD A;  2Q0Z X;  2DPI A;  3TAR A;  2PKE A;  5BOL A;  1IXR A;  4NLN A;  5KG6 A;  5DQH A;  3C1Y A;  2DQN B;  1ZD4 A;  2YY6 A;  2C2E A;  4EBE A;  3THV A;  4Y2P A;  3C29 A;  3QEA Z;  2WF6 A;  4M9L A;  2MUT A;  3N7P D;  4M04 A;  4CF5 A;  5KFJ A;  2N1R A;  1SKS A;  2XIC A;  2LBO A;  3HPO A;  2E5S A;  1ARO P;  1QQ6 A;  4BWM A;  4M6W A;  3NTU A;  3UMC A;  3HKZ C;  1EXN A;  4GXI A;  3VC8 A;  1QQ5 A;  2GLE A;  3PX4 A;  4P0Q B;  2A19 A;  1IM4 A;  2K8A A;  5KFN A;  4YR3 A;  4USA A;  5J2C A;  2B21 A;  1UPH A;  5DDM A;  3Q8M A;  1U4B A;  4Z6C A;  1KBU A;  4O3P A;  4F4X A;  4DSE A;  2W3S A;  2BKE A;  3HWT A;  2OEH A;  2PI5 A;  3RB4 A;  5J2J A;  9ICJ A;  1SV0 A;  4MFC A;  2OYY A;  1HUZ A;  1NJX A;  3ISC A;  2F44 A;  4DO9 A;  4KMU A;  2BCV A;  1XSL A;  3KHL A;  2E8O A;  1SV4 A;  8ICI A;  1F44 A;  2AQ4 A;  4QNL A;  1TE2 A;  4FZN A;  4U6P A;  4F50 A;  5J0R A;  4XRH A;  1F0M A;  5DG7 A;  2A1A A;  2BHN A;  5AKY A;  1X6I A;  1URJ A;  3ZI4 A;  4F92 B;  2GWS A;  3EPI A;  4JK1 A;  4I28 A;  5J2F A;  4EEN A;  5AM4 A;  4DOB A;  1IG6 A;  4F3O A;  1ZQ1 C;  1TK5 A;  8ICR A;  3FAH A;  3JPS A;  1RDF A;  2KKV A;  4QZE A;  5KFF A;  3UPQ A;  1S5L U;  1ZQZ A;  1TK0 A;  4M2Y A;  4EYH B;  3OSN A;  4I2B A;  2OH2 A;  2ZTC A;  5ALY A;  2DBY A;  2NO5 A;  3QNM A;  1PVQ A;  2LKY A;  1ZOL A;  4P4P A;  4DQS A;  4Y2X A;  2AU0 A;  1ZQJ A;  2W55 A;  2G09 A;  5TZV A;  4C8K A;  4UAR A;  2HBK A;  1KW4 A;  2XGQ A;  3BJY A;  9ICT A;  3BZC A;  2FLP A;  4KLE A;  2ZUB A;  1KQQ A;  1NI3 A;  2VIX A;  2E1E A;  3C2M A;  3TI0 A;  2PFN A;  7ICN A;  4PGX A;  1Z1V A;  2FE9 A;  1NZP A;  1Y88 A;  3U26 A;  4IRC A;  1N61 A;  3PY8 A;  2NV3 A;  4MFA A;  1N48 A;  2F2A B;  5JRT A;  5KAI U;  4QWB A;  9ICG A;  3D2N A;  1X9M A;  5D46 A;  3BQT A;  2W9C A;  2K4I A;  3MFH A;  2JZB B;  3RH5 A;  3L5K A;  3QU5 A;  2KOB A;  3UQ0 A;  3PMN A;  3C28 A;  2H3F A;  2CRX A;  3PW7 A;  5KFY A;  2EZX A;  8ICQ A;  2YQE A;  1FFV A;  4YXM A;  3F5E A;  1J2N A;  1Z19 A;  2RRD A;  5ALV A;  3I76 A;  2EAP A;  2ES6 A;  5DBB A;  1T8E A;  3SYZ A;  2AGP A;  4B6J A;  2ZUC A;  5KNI A;  5KFS A;  1C7Y A;  7ICI A;  4CCH A;  3BDP A;  4JV0 A;  3H0R B;  1SWV A;  5KFB A;  4J9L A;  3BQ0 A;  3EW9 A;  3OJS A;  5EE0 A;  4ACO A;  4YD2 A;  2BQR A;  4GXK A;  3KKA C;  2DPJ A;  4C7Z A;  3KOO A;  4FBT A;  4QWA A;  3TAP A;  5AKL A;  2KIC A;  9ICM A;  4QW9 A;  4BXO B;  2CN1 A;  4F2R A;  4I2C A;  4KLH A;  3B0Y A;  8ICS A;  3MR6 A;  5HR7 A;  1BPB A;  3N4M B;  1JXE A;  4CNQ A;  4UAS A;  4IC9 A;  5J0T A;  3EWA A;  4QZC A;  2YN4 A;  4ELU A;  5ALI A;  2XID A;  1K1S A;  5J2D A;  3IG8 A;  5KFH A;  2BPG A;  8ICM A;  1O03 A;  5AM2 A;  5KT5 A;  4IQW A;  3RRG A;  1QCK A;  4F5N A;  2XGP A;  1S10 A;  5C0Y A;  2KEY A;  4DCC A;  5J0U A;  3ED5 A;  5CB1 A;  1Z3E B;  5KT3 A; 
#chains in the Genus database with same CATH homology
 2MRL A;  2K4E A;  2W7O A;  2VJ5 A;  2NV3 A;  3PSI A;  4ICA A;  4OJP A;  1SZH A;  2RHF A;  2F2A B;  3GZF A;  1OUQ A;  1A0P A;  5CRX A;  4C0Z A;  1UPH A;  3H0L B;  4CRX A;  1DRG A;  3KFU F;  2CPR A;  3ONN A;  2G08 A;  2KJ8 A;  3SMV A;  1ECW A;  3D2N A;  2KJ9 A;  3KZX A;  1KBU A;  4NLC A;  2H3V A;  2ZG6 A;  3SAH A;  1ED1 A;  2LYB A;  4JMU A;  2K4I A;  2ZXI A;  3LYS A;  3NUQ A;  3PST A;  1D8B A;  2PMZ C;  2KIW A;  2G0A A;  1CRX A;  2KOB A;  3N7R C;  2Z7J A;  2HMX A;  2JHD A;  3GU3 A;  4NLB A;  4BX9 C;  4P0P B;  1L6N A;  2MA1 A;  3C28 A;  2H3F A;  2PMZ F;  2KVC A;  2CRX A;  2YX8 A;  2G06 A;  3O0F A;  4P0P A;  2OYY A;  2VJ4 A;  2A3V A;  3SAF A;  4KMO B;  2KHQ A;  3L3F X;  4OJ6 A;  2KD1 A;  4CDG A;  2ZIU A;  4CGZ A;  3F5E A;  3M6K A;  3H0M B;  2F77 X;  1F44 A;  3NRW A;  3SAG A;  3RFA A;  3F2B A;  1Z19 A;  2RRD A;  3M6Z A;  4AYB C;  4QNL A;  4BUG A;  4FZN A;  4U6P A;  4U7C A;  3D2Q A;  3MGV A;  1T94 A;  3K1Z A;  1URJ A;  2K8C B;  4AYB F;  2K4H A;  1NZB A;  3AQE A;  3E0F A;  4A8E A;  2HBJ A;  3AL0 B;  2HBL A;  2OXO A;  3OPX A;  1Q3U A;  1WUD A;  2LYA A;  1Z1B A;  2HOF A;  3PZP A;  3DEE A;  2H3Q A;  2JGA A;  2W7P A;  2VKQ A;  3F5A A;  2OM6 A;  4OJ5 A;  3IN5 A;  2H3Z A;  4OJL A;  5KL8 B;  4GFJ A;  2KKP A;  3ALR A;  2W04 A;  2WB1 C;  4QIW C;  2KNJ A;  2ZIU B;  2G5I B;  1YT3 A;  4BJQ A;  4PL1 A;  2W03 A;  2RP5 A;  1ZQ1 C;  4OJO A;  3T79 A;  1Q3V A;  2Q4T A;  2F8L A;  2JH7 A;  3H0R B;  2KKV A;  2DF4 B;  2WB1 F;  2ZIX A;  4QIW F;  2KV2 A;  1PVP A;  3SQI A;  2M0N A;  4KX3 A;  4KX5 A;  2XI9 A;  3ICX A;  4QJF B;  2D6F C;  2ZIW A;  4ACO A;  2YB4 A;  3AQF A;  4FE3 A;  2Y0S C;  4PL2 A;  1XO0 A;  2GH1 A;  1XNS A;  2LHT A;  1P7D A;  4FZL A;  4OO1 J;  2DQN B;  2HOI A;  1PVR A;  3CRX A;  2Y0S F;  3CP8 A;  2OH2 A;  3IG5 A;  2WAQ C;  2G5H B;  3F53 A;  3N7S C;  3C29 A;  3HKZ F;  2KIC A;  1A6S A;  3M7D A;  2ZIV A;  2BDU A;  2K89 A;  3N7P D;  2CN1 A;  2WAQ F;  1MA7 A;  3PSP A;  1PVQ A;  2LKY A;  2HOQ A;  2F76 X;  3RF9 A;  4WJ3 B;  5KL1 B;  3F2D A;  2K8B B;  2N1R A;  4NWI A;  2XIC A;  2LBO A;  1GO3 F;  2ZXH A;  5HR6 A;  5HR7 A;  2ZIX B;  3LVV A;  2KJ5 A;  1HEK A;  3VCB A;  1IIP A;  3IP4 B;  4IC9 A;  3F2C A;  2E5S A;  5T14 A;  2HBM A;  2ZIW B;  2YB1 A;  2G09 A;  2JMG A;  5A0L A;  4O3M A;  1HIW A;  2DGZ A;  2JH1 A;  2GOL A;  2HBK A;  2XID A;  3LVW A;  3HKZ C;  3IG8 A;  2KHV A;  2XVT A;  4FZM A;  2ZIV B;  3VC8 A;  2R18 A;  2E1F A;  3CYM A;  2VIX A;  2E1E A;  5C0Y A;  2KEY A;  3D2S A;  4NV0 A;  2H3I A;  4P0Q B;  1TAM A;  3PSF A;  2K8A A;  2G07 A;  4P0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...