3VC8A

Crystal structure of the c-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus a59
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
TFEEMALTTFMITKESYCKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase
publication title Crystal structure of the C-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus A59.
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
total genus 28
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3vc8A00
3GZFA 3VCBA 3VC8A
chains in the Genus database with same CATH superfamily
2OEHA 1T3NA 5KFPA 1KL9A 2E8PA 4Y2QA 3H0MB 4F5RA 3C2LA 4F50A 3RRGA 3RJEA 3NUQA 3QU7A 1PK3A 5IINA 2IHNA 5J0XA 2H3FA 4QZ9A 2OCEA 2EAOA 4Q45A 2KN7A 3F2CA 2EAPA 2ASDA 1JIHA 4RPZA 5KG5A 1SL2A 2FJ6A 4F5NA 3PO5A 3TANA 5IILA 1RYUA 7ICOA 8ICLA 3JPTA 4KLUA 4RQ4A 3ORYA 3EW9A 4DL3A 3NASA 4EX7A 3Q8PB 3RAQA 4NJ8A 3UQ2A 5KTQA 2KSOB 3J81j 3H4DA 2DQNB 4EYHB 5KNIA 3RH4A 5GTHU 4RQ7A 4F2RA 1D8LA 2E3TA 4ECQA 2LHTA 5KG4A 1Q8KA 2JGAA 3PX0A 4ZOHC 3BZKA 4OD0A 4XRHA 4NV0A 1N62A 4C8MA 4J9RA 2DUYA 2WF9A 1L3UA 5AI0A 4UBCA 4DOBA 9ICGA 5JTIA 3GV8B 2XCAA 3EPGA 2GO7A 4PGYA 5J0YA 1QLNA 1UT8A 2F1HA 1MN8A 2XI9A 2F77X 3QU9A 4IRCA 4ECRA 2H3QA 2NRXA 2WB1C 1N5XA 3E0FA 9ICJA 2G5IB 1KQQA 4M6WA 3WK7A 2EANA 3ZDDA 2HHTA 2K4HA 4F4KA 9ICUA 4UB2A 2W9BA 3EWAA 3NTUA 2KOBA 2VKQA 2WF5A 3QXGA 3N4MB 9ICSA 3M6ZA 1ZQGA 5J2DA 2JHDA 3H0LB 4RQ2A 4RNMA 1JRPA 2FI1A 2YN4A 1Z1BA 1T4GA 1RXVA 4B9SA 4MFAA 2HHQA 3WKBA 3Q8SB 3M9OB 2ISPA 4PHAA 3RJJA 4ECSA 4P0PA 3AEVA 3QE9Y 4MFFA 4JV2A 4BX9C 2K60A 5HR7A 4KN4A 1SKRA 2V4RA 1SB3C 4ECTA 1L3VA 3SMVA 1L3SA 2NO4A 1ZQQA 5KFJA 1ED1A 9ICOA 1L7NA 3NGDA 1L7PA 5J2JA 2W43A 4IRKA 8ICQA 3DDHA 1O03A 4F8RA 4AP9A 2HHSA 3PY8A 4ED1A 1EXNA 4EENA 2WHEA 4TURA 2RHFA 4B9UA 2PMZF 4NLBA 3GILA 5KT4A 3PW0A 1AQ6A 1WCNA 2R8IA 3G6VA 1JXLA 1B43A 2MSNA 5AM0A 2HCFA 1BPDA 1QCKA 4CCHA 3E58A 3MC1A 1U47A 7ICFA 5ALXA 1ZQNA 2HHXA 5DDMA 4NLGA 2ZUDA 1KRPA 4J9PA 2NYVA 3SAGA 4RU9A 2I6XA 1XSNA 4IR1A 3LVWA 4IS7A 3WK9A 4GC7A 5FP0A 4M04A 3HW8A 1F0MA 4LJXA 3KD3A 8ICYA 1X42A 3IDWA 4IQUA 3KZXA 1JI7A 2VIXA 3K4GA 4ED3A 2BPCA 2VANA 5AM5A 5J2KA 2G08A 2LM4A 5ALPA 5L1MA 3HPOA 4M2YA 1XO0A 3QUTA 3LWLA 1U4BA 4I29A 3V6HA 4QZCA 1ZQBA 1JN3A 3BQ2A 3SAFA 3LVVA 2JMGA 4KLJA 2JEGA 1X6IA 4UAYA 2Q0ZX 2KJ5A 5CRXA 3GV5B 4M47A 2DWQA 1ZQMA 4B9TA 4KLGA 9ICXA 5E79U 4DFPA 2JXJA 1MA7A 2XVTA 5T14A 2KHQA 3JPRA 4R63A 3U26A 5D49A 4GXKA 1UHUA 1Z4NA 1COOA 2CN1A 4J9QA 5KFAA 2BQRA 2E1EA 5AKLA 4QW8A 2OWOA 3MFHA 1WWUA 2ZIXB 3PR5B 4R8UB 1QSLA 2HHVA 5KFHA 4F5PA 3MGVA 3RJFA 7ICHA 4NLKA 2MU2A 2QLTA 2ASJA 3T5HA 1DOQA 4JUZA 2A1AA 4TUSA 2W3RA 1NOMA 4UAUA 4J9KA 5KT5A 1TVAA 5HR6A 4UAVA 4I27A 3F2BA 1Z1VA 1IV8A 1BPXA 2K8CB 2VA3A 5KFUA 4PJ0U 2JH7A 1NZBA 2KD1A 1N2XA 4NLNA 2JZBA 3V6JA 4UATA 3IHQB 3C5GA 2ALZA 4DL4A 4KMUA 4DL5A 2EQYA 2LYHA 3QX7A 2R8GA 3H7IA 4Y2RA 1SZHA 2C2EA 5BOMA 3VC8A 4NY8A 3DV9A 4CF4A 1WWVA 5AKXA 5B5EU 4UARA 4EELA 8ICEA 1D9FA 4IQTA 4Y2UA 2HOFA 4OJOA 3V7JA 2JRZA 2W9CA 4DFMA 1ZETA 4PHEA 1J97A 1RYRA 4HYKA 3EUB2 3GZFA 2ZIUB 3TQ1A 2DGZA 3M7DA 5J29A 5J0UA 4FZMA 1ZQSA 2BKEA 1BPBA 2XCPA 1L7MA 1X9XA 4G9BA 5D46A 7ICKA 3ISDA 4DF8A 2AJQA 4QWAA 2E1FA 1N60A 2Y1IA 1NKEA 4IL6U 2KVSA 4CGZA 2P35A 2W04A 3UMCA 4ECWA 2XIDA 1B22A 1QQ7A 2FPMA 1HUOA 1T3QA 1VJ5A 3AU2A 1ECWA 3BQ0A 5AI6A 3C5FA 2KJ9A 1KKXA 3PR4A 2I9GA 4ED0A 4LZGA 2ZXIA 4O3RA 4GLXA 5IIOA 9ICNA 2ZJ8A 3T5KA 1QTMA 5DBAA 1MQ3A 1HUZA 1Z19A 4KX3A 4ZH4A 1TAQA 3GV7B 1QSSA 2YMPA 1C20A 2YY6A 1WUDA 4P4OA 3HWTA 5J2IA 1NKBA 3FDSA 4JMUA 3OSNA 2ZJ5A 4YD2A 3TARA 2F76X 4O3OA 1DK2A 4GXJA 2G06A 1ZJMA 2JEJA 3B0YA 2KZMA 1ZJNA 4UAWA 2BPFA 2F44A 2J6SA 1TK5A 2YQEA 5J0OA 2RDJA 4ACOA 1TV9A 4O3MA 1Z3EB 1V97A 3N7RC 2R8HA 3TKAA 2K8AA 4RQ5A 5KFCA 3GIJA 3H8SA 1BPEA 4C7ZA 2K4EA 2AQ4A 5ALRA 1SZPA 7ICRA 3FM9A 1RPLA 4I2AA 9ICPA 3ZDBA 3QU4A 4GFJA 3JPSA 1T8EA 3BS5A 4YMNA 3GU3A 3RJIA 3PV8A 3F2DA 2ESEA 2FMQA 1JXEA 1WCLA 5B66U 4Z6CA 5J0WA 1FIQA 1VLBA 3WKEA 3TAPA 5HMLA 1TK0A 2PFNA 1ZQUA 4PGQA 4QZHA 4FBTA 4M6WB 4UBBA 3OTQA 4JV1A 1U49A 4YCXA 1XSLA 3O0FA 2W9BB 5KL1B 4UASA 1ZQRA 2LYAA 4O5EA 1SXDA 1PVQA 3HP6A 1D8YA 5DDYA 4BWJA 3H40A 3M8SA 4ECUA 1V85A 4UW9A 2ZIVA 4CNQA 1DRGA 4YMMA 5KFWA 1S10A 2YMQA 5J2BA 5IIMA 5ALEA 1ZQKA 2D8CA 5J2CA 4P0PB 2IHMA 3C2KA 4RT3A 4YN4A 2P6UA 1QQ6A 1KFSA 3N28A 1Z00B 4EYIB 3RTVA 3E2EA 3RBDA 4Y2YA 5AK6A 1NK7A 1C7YA 4M9HA 4NWIA 4C8KA 2IOHA 2OH2A 2NV3A 4X5VA 1D9DA 2BDUA 9ICBA 3OPXA 4DLEA 4O3PA 4QIWC 2KICA 2M9NA 5ALWA 4MEYA 4Y2XA 5J2FA 4OJ6A 1JALA 5AM2A 4EBDA 2EAMA 4AYBF 4P0QB 4C7YA 1Q46A 4J03A 5BPCA 5AK5A 3PSTA 5AHXA 3AN1A 5JRTA 3IN5A 3IRUA 4YXMA 5KFXA 3T5LA 1Q3UA 5HMMA 4Z6DA 2YX8A 4DOAA 2ZJAA 3QZ7A 3OJSA 4EX6A 1JUDA 4OCZA 3IG5A 4KLOA 4IC9A 1JROA 9ICIA 1SGGA 3I1YA 5KFMA 4KLEA 1ZQTA 4RNOA 9ICFA 3HILA 2H3ZA 4UB1A 8ICJA 2OHFA 3PSFA 3V7LA 3MFIA 5ALLA 3LWMA 4OO1J 3RB3A 4MFCA 3F5AA 9ICKA 2G07A 2DBYA 3RJGA 1ZRMA 5J8YA 4YR2A 3C28A 3TADA 1X6JA 3RAXA 3SD7A 2GLEA 2KIVA 1S8OA 4YVZA 1N61A 5KFTA 4F92B 5CJ7A 5TZVA 4IR9A 2D6FC 1KW4A 1S77D 1KFTA 3PW2A 4B9LA 1UCVA 8ICMA 3N97B 2V9WA 1ZQPA 2RQ5A 1A76A 5F9LA 3SI8A 2FLLA 2HI0A 4I2EA 2M0NA 4ELUA 1N63A 2ZXHA 2DKZA 5EWFA 2D3DA 2Y0SC 3QU2A 3GDXA 9ICRA 2GOLA 4UB5A 3WKDA 5KT3A 5AIAA 3KOOA 3Q8QB 3LK9A 4NL9C 1SWVA 2EZXA 1D8BA 4DCCA 4BXOB 1ZRNA 4BDPA 3UXPA 2HMXA 5DLGA 2BPGA 5F9NA 3UMBA 1ZQJA 5J0SA 2HBMA 1ZOLA 3ZD9A 2KVCA 1RQLA 4Q8EA 1TFRA 3MDCA 5L9XA 3QZ8A 4YQWA 4CRXA 5AM3A 4PH5A 3CNHA 5G5HA 4A8EA 2HBKA 1KBUA 5DBBA 5KG7A 2W55A 2A3VA 3OGUA 5CP2A 5ALNA 2XY6A 8ICFA 3PNCA 2JR5A 4WJ3B 4J9MA 1SL1A 3Q8LA 4U6PA 4ICAA 2Q4TA 2HBJA 2RLTA 1TKDA 4TQRA 4Y2PA 1T94A 2MA1A 5J0RA 3ONNA 2W9CB 3SQIA 3RH5A 7ICIA 5AKHA 2BCVA 3WKAA 4LVSA 2V4QA 2DPIA 4KX5A 3PX6A 4RQ3A 1LKYA 3AM9A 4PZOA 1UT5A 5ALGA 2W8LA 4QWBA 1BNPA 4ELTA 3PX4A 5DQHA 1DGJA 3OHAA 4C0ZA 1PUZA 4I2FA 3HKZC 9ICCA 4MF2A 2HVHA 1ZD3A 1NK4A 3KKAC 1NJXA 3MR3A 5KT2A 3IG8A 4KLMA 3AL0B 4US9A 9ICMA 3RFAA 2BCQA 5EWEA 2EZZA 2W9AA 3T3FA 3RR7A 3ICXA 1ZQOA 2QB1A 3HT3A 3TI0A 1RZTA 4QZDA 3B0XA 3PO4A 5HHHA 1N5WA 1S0NA 2HVIA 3AUOA 1SKSA 2XGPA 3V6KA 1X66A 1KTQA 2QARA 8ICTA 4EBEA 3EYZA 5DB6A 3NVVA 4MF8A 2BHNA 1KSPA 3H8WA 4KLTA 4TQSA 2F8LA 2EDUA 2MUTA 3NRZA 2KKPA 4NL9A 2KMDA 1YZ7A 5CR0A 4DEZA 5L1IA 3M8RA 1UQVA 2KFNA 7ICMA 2FE9A 2I1QA 1UPHA 3M1YA 5CHGA 5ALKA 1RXWA 1XU4A 1COKA 1JMSA 5KFLA 2XICA 5EE9A 4UB8U 1YZ6A 2LBOA 3WK6A 5KFNA 1PVRA 4Z6EA 4F4YA 2BQ3A 5A0LA 4PL1A 4MHVA 3Q8RB 3L5KA 2BGWA 7ICJA 1S0VA 4PGXA 1XWLA 3MR5A 4QW9A 4JV0A 2C22A 2NRWA 4DO9A 9ICWA 5ALTA 4ELVA 3BS5B 2YTUA 2LKYA 3A0HU 4RT2A 3SV4A 1L5UA 2VJ4A 4DSFA 4F5QA 5AI9A 5AKGA 1CEZA 2ZIWB 3K1ZA 5AKZA 2KEYA 3QUBA 2AU0A 5KFEA 1TE2A 3AQFA 1J2NA 5EWGA 2C2RA 4R64A 2XC9A 3L4PA 9ICTA 3M9NB 3LYSA 3N7PD 2UVUA 5HHIA 4EEYA 3NVYA 1LB2B 4DS4A 1NK8A 2H3IA 2ZG6A 4J9OA 3I76A 3RH6A 1FO4A 7ICTA 1JX4A 2ZIVB 3N7SC 1U48A 2G0AA 4CDGA 1WYGA 5JU5A 2KV2A 3GFKB 5AI8A 3IM1A 2WAQC 3L3FX 2J6TA 8ICGA 2W9MA 3JPQA 4DQRA 4JWMA 2F3NA 5J2GA 4GXIA 2H5XA 4FBUA 8ICWA 1N48A 4M9JA 2DL0A 1OXJA 1ZQYA 1ZQVA 3TACB 1BPZA 3F5EA 4Q8FA 1TAUA 2WF6A 4E0DA 1BPYA 4I2HA 3PSPA 2YB1A 1ZQHA 4RQNA 2DPJA 5KFZA 3IV6A 3JPOA 3FAHA 1BNOA 4UB3A 3KHRA 4DQSA 1KFDA 5KAFU 4OJPA 8ICOA 2K8BB 1KLNA 1SIJA 5J2AA 3EZ5A 2IMWP 4UQGA 2KIWA 2ZUBA 4YP3A 1RQNA 1SL0A 2QB0A 4OJ5A 3ED5A 5ALUA 5EOZA 2P66A 2FLPA 5KL8B 3SR6A 2PI4A 2ZIXA 4RQMA 2PI5A 2N1RA 3PW5A 2VA2A 3MR2A 5KFYA 5ALIA 3BS7A 4C4RA 2AGQA 4NM1A 4F72A 4P4PA 8ICUA 4ECVA 2IOFA 2HOIA 2R8JA 5KFDA 1ZYQA 2PFQA 2J6UA 4EBCA 5DG9A 4ED8A 3PMLA 1S0OA 2FMPA 3ZDAA 3C2MA 2W7PA 1ZD4A 5G5GA 3QUQA 1SKWA 4KLLA 2K4IA 4KLFA 3KFUF 1J2MA 3MABA 4G3IA 1HIWA 3H0RB 2BCRA 3KZIU 4FFDA 2F1JA 2MAXA 2VJ5A 4CE6A 5DG7A 4MEXA 2AHOB 2ZTDA 2KFZA 7ICEA 8ICCA 3C23A 2AGPA 3WK4A 4FS1A 2ZTCA 7ICNA 4K4GA 4O3QA 3UPQA 4QNLA 3KHGA 2C28A 5DG8A 5ALVA 1X2IA 4US8A 3RJHA 2GH1A 4QIWF 2FLNA 4RUAA 4I2BA 2KZZA 2KZ3A 4NLZA 2HSZA 5ALQA 5KG6A 3SEIA 4O5CA 2BCUA 1ZD5A 3MBYA 4QWCA 3K75D 9ICLA 2KKVA 3PSIA 3SZ2A 1XO1A 3AU6A 3NVWA 4YD1A 4B9VA 4I2DA 3SAHA 4DFDA 2Z7JA 5EE0A 5GTIU 3UXNA 2BCSA 2W3SA 4PL2A 3RBEA 5KFOA 4OJLA 5DGAA 4RZRA 4QZEA 3ZI4A 4M9GA 5J0PA 1UA0A 3SYZA 2W8KA 1Z4OA 2E5SA 5KFQA 5HNKA 3V7KA 8ICHA 4R65A 4RUCA 1UA1A 3A0BU 4KLQA 9ICAA 4DLGA 5D4BA 3LDAA 3T79A 5JUMA 5DB8A 5AKIA 1SV4A 1PK1A 4FZNA 5ALFA 8ICVA 4YXJA 1Q3VA 2KP7A 3WK8A 4M9LA 3KHHA 3RRHA 4J9SA 1QH9A 1ZQFA 3RB0A 2AGOA 3RR8A 2WF7A 3Q8KA 2ATLA 5ALOA 2DF4B 3NS1A 2E8NA 2IOFK 2ASLA 1HJPA 3QYPA 4C4SA 3TFRA 9ICVA 2WB1F 4KTQA 4M0AA 2B6GA 3BQTA 1CI4A 4Y2VA 3WU2U 1DGSA 4KLSA 2G09A 1L8LA 4PHPA 3D6JA 3KHLA 4ECXA 3JPPA 8ICSA 3H8MA 2H3VA 5AM4A 4RPXA 2Y0SF 4KMOB 1IXRA 1LKYB 5DLFA 2FPKA 2FDRA 2YMLA 4FE3A 1NK0A 2UVRA 1DK3A 3G6YA 1CRXA 4IQWA 1ZQZA 1XNSA 4KN7A 2ISOA 3IP4B 5BOLA 5DKWA 2A1JA 4DQQA 4PHDA 2LPEA 4ECZA 3H4BA 4Z6FA 4RPYA 3OJUA 3MGHA 1ZQDA 1HEKA 1XS9D 4IQVA 5KFSA 5AKJA 5KFKA 4AYBC 4C80A 3B9JA 1ZQEA 1X9WA 4QWEA 4Y2JA 1X9SA 3M6KA 1GO3F 4U7CA 4F4WA 3ISCA 1A77A 2XY7A 1QQ5A 4NM2A 2LI6A 2QARB 4QZIA 4J9NA 1ZQLA 2RRDA 1ZQXA 5ALZA 2HOQA 5KG3A 5KFVA 4KLDA 3V72A 1XC9A 2MUTB 2UVWA 2KG5A 5KG0A 3OSPA 5KFIA 4BJQA 3HRDD 3QEBZ 2Y9UA 4Y2TA 4QZAA 5J0QA 3UXOA 5DB9A 3UQ0A 2RDIA 4I2JA 2BZFA 3TFSA 5AKKA 4BGDA 1A0PA 2PKEA 1WG8A 5C0YA 1X9MA 3C1YA 2F8KA 5TISU 2L5YA 3C21A 5KAIU 1H38A 4O0IA 8ICPA 2JZBB 2CRXA 2FMSA 2NO5A 1P7DA 5EE1A 1Z00A 2HDOA 2R8KA 1KN5A 1ZD2P 4BUGA 3UM9A 3HKZF 2WFAA 2JH1A 5F3XB 2K4PA 4DF4A 5IIKA 2I5HA 4JB3A 3HX0A 2R18A 4YR0A 1L3TA 3ZDCA 1RG6A 3NRWA 5IIJA 4I2CA 5J0TA 3PMNA 5K4LA 1T7PA 4PPXA 2PFPA 4DL7A 2AXTU 4P0QA 5J2EA 4F71A 1K1SA 1URJA 3JPNA 5AIBA 4O3NA 2W54A 4ED6A 5CB1A 3RJKA 4EEKA 3RF9A 2HBLA 4DL6A 1B0XA 3R9KA 4EZ9A 2OYYA 4DFJA 3G6XA 1PZNA 4ED2A 4QZ8A 1B4FA 2UVVA 1U45A 7ICVA 3C29A 2KSOA 4F2SA 1A6SA 3BJYA 3Q8MA 3ETLA 4FO6A 2NRZA 1M6YA 1V38A 3F53A 3I28A 2JV3A 4QWDA 3SV3A 1X40A 4QZFA 5ALSA 5DB7A 4DSKA 3UMGA 2EZYA 2WF8A 7ICPA 5AK4A 4K4HA 2AQ0A 2W03A 4KLHA 5DQIA 4F3OA 4DSIA 2PMZC 2W11A 5AK3A 1PVPA 4C4TA 2YMMA 3PW7A 4GC6A 4PZNA 4I2IA 1BGXT 1NI3A 4UB6U 4YMOA 1BVSA 1VDVA 4DOCA 3GIKA 2JEIA 1ZXIA 4HAIA 5CEHA 1F5SA 4USAA 2HW3A 1AROP 4TUQA 4I28A 4C8NA 4FS2A 1ZQCA 4XQ8A 2QB0B 9ICHA 2DKXA 5CA7A 3KTQA 1NNLA 3GQCA 2XY5A 7ICQA 4RQ6A 1LV5A 3D2QA 1S9FA 5KFGA 5AI4A 1S0MA 1SWWA 2Y9TA 8ICRA 5KG2A 4J9LA 2BDPA 1OUQA 5KFFA 2CXYA 4Q44A 3WKCA 4BXOA 4RNNA 2RP5A 1TK8A 1NKCA 2WAQF 2LM1A 4RQ1A 2KHVA 2YB4A 5IIIA 3ISBA 4B9MA 8ICBA 1NK6A 5DGBA 3S6JA 3ZD8A 4R66A 4CF5A 4YR3A 2DFLA 8ICIA 3TAQA 1ZQ1C 5DBCA 2OXOA 3C1ZA 3WK5A 4DFKA 1NJZA 1DXSA 3AMZA 3FYHA 1ZQIA 7ICUA 5ALJA 4I2GA 4Q43A 1NK5A 3VCBA 3MR6A 8ICXA 5KT7A 5H2FU 4P4MA 3MDAA 1LVHA 1YT3A 2HHWA 5ALYA 5KT6A 2PFOA 5J2HA 4O5KA 2G5HB 3QNMA 2E8MA 8ICAA 5EE3A 5AKEA 1Y88A 1XSPA 2O6KA 7ICGA 1NJWA 5L1LA 1V9PA 1SV0C 4F5OA 3GIIA 2E8OA 4UB4A 4DQIA 8ICZA 2CPRA 1MQ2A 4DSJA 4QZGA 3KKAA 4F91B 3FC4A 2HHUA 4QZBA 4O3SA 2NRTA 2ZUCA 1PK1B 1U9LA 1L7OA 3K1RB 4C8LA 5L1KA 4JK1A 2JEFA 3ETRA 1F44A 5ALHA 4F93B 3BZCA 3AQEA 1KDHA 3THVA 1NJYA 2A19A 4LZDA 2XO7A 4P2HA 3CRXA 5KFBA 5C5JA 4NLCA 1NZPA 4BWMA 4B9NA 2KNJA 4F4ZA 2C2DA 5AICA 4GIBA 5KFRA 4DWIA 4IRDA 5L1JA 2ODGA 3OHBA 2MRLA 2KJ8A 1NK9A 2KTQA 1K1QA 4RQ8A 3NVZA 4YG2A 1S97A 3KBBA 4ED7A 9ICEA 1K5OA 5HP4A 5ALMA 3CYMA 2NRVA 2B0CA 3D2NA 4R8UA 1L6NA 4F4XA 4DQPA 4C8OA 5CWRA 4TUPA 3PVXA 2B21A 3ZDEA 2W7OA 1MSWD 1IG6A 2LMRA 2KK0A 3PW4A 3GIMA 3MGIA 4B6JA 5ALDA 3CW2C 4RQ0A 2K89A 2QKQA 2LYBA 4XA5A 3CP8A 4UAZA 4M9NA 3QUCA 2IBKA 5AKYA 4DSLA 2XGQA 4KITB 1FFVA 1RM6C 4DS5A 1N56A 3D2SA 5DQGA 2ZTEA 4CF3A 2A1JB 2ES6A 2KE7A 3DEEA 1OW5A 1RYSA 3RB6A 1IIPA 3H8JA 4NXZA 8ICKA 1L8OA 3HJEA 1SXEA 2F1IA 3ALRA 5J8YC 9ICQA 1FEZA 1ZQAA 2EH9A 4K4IA 8ICNA 3TADC 4ECYA 1TAMA 2FPLA 3BQ7A 1S5LU 2ZIWA 1O08A 2VA8A 3RB4A 3PZPA 7ICSA 3QU5A 4FZLA 2WTFA 3BDPA 3BQ1A 1S76D 4XUSA 4DSEA 2Y1JA 4O9MA 4Y2SA 2ZIUA 1RDFA 1CUKA 3SENA 2F2AB 5KG1A 1KEJA 4EZ6A 2PXIA 1ZQWA 2OM6A 1SV0A 1FFUA 2GWSA 4DL2A 2AH5A 4KLIA 3M9MB 2BQUA 2P6RA 7ICLA 2BR0A 1MC8A 4JWNA 5AI5A 5AM1A 3T5JA 4YFKA 1QSYA 1IM4A 3QEAZ 2IA6A 3EPIA 4QJFB
chains in the Genus database with same CATH topology
3LVWA 4QNLA 2KD1A 4KX3A 3VCBA 4OO1J 2PMZC 1A0PA 2KOBA 2KKPA 5C0YA 3F5AA 1PVPA 2G07A 2K89A 2VKQA 2ZIVA 3H0MB 4WJ3B 2LYBA 1WUDA 3CP8A 2GH1A 4QIWF 1YT3A 2H3VA 4U6PA 3KZXA 2VIXA 1DRGA 1UPHA 3M6ZA 2G5HB 2G08A 2Y0SF 4KMOB 3C28A 4ICAA 2CRXA 3NUQA 1P7DA 1SZHA 3F5EA 2Q4TA 2XICA 4JMUA 2HBJA 3D2SA 2LBOA 4P0PB 2H3FA 4BUGA 2JHDA 1T94A 2MA1A 3H0LB 3ONNA 3SQIA 4FE3A 1XO0A 3HKZF 2F76X 3VC8A 2JH1A 3PSPA 2YB1A 2KKVA 3PSIA 3F2CA 1PVRA 1Z1BA 3DEEA 1CRXA 3SAHA 2Z7JA 2CPRA 2R18A 4PL1A 5A0LA 2D6FC 1IIPA 3NRWA 2G06A 1XNSA 4KX5A 3SAFA 4NWIA 2HOFA 2OH2A 4PL2A 2NV3A 3LVVA 4OJOA 2JMGA 4OJLA 2BDUA 4P0PA 3IP4B 3OPXA 4OJPA 3ALRA 2K8BB 4BX9C 4ACOA 3D2QA 2M0NA 3GZFA 4QIWC 2ZIUB 2ZXHA 2KICA 2DGZA 4P0QA 1TAMA 2KJ5A 1URJA 2KIWA 5CRXA 3M7DA 4O3MA 4OJ6A 3N7RC 2Y0SC 4FZMA 2E5SA 2K8AA 2ZIWA 3SMVA 2LKYA 4OJ5A 4AYBF 1HEKA 2GOLA 4C0ZA 2K4EA 3PZPA 4P0QB 1F44A 2VJ4A 2XVTA 1MA7A 3HKZC 1OUQA 3AQEA 3RF9A 2HBLA 2KHQA 1ED1A 4FZLA 4AYBC 5T14A 3PSTA 5HR7A 3T79A 2DQNB 2ZIWB 3K1ZA 3IN5A 2E1FA 5KL8B 2KEYA 2OYYA 2JH7A 2ZIUA 4FZNA 2RP5A 3M6KA 3AQFA 3CRXA 1GO3F 2LHTA 1Q3UA 4U7CA 2CN1A 2YX8A 2ZIXA 4CGZA 1D8BA 2F2AB 1Q3VA 2JGAA 3IG8A 2N1RA 2WAQF 4GFJA 3AL0B 3RFAA 2W04A 3C29A 3GU3A 2E1EA 2KHVA 2YB4A 2OM6A 4NLCA 3F2DA 2RHFA 2HMXA 1A6SA 2XIDA 4NV0A 3LYSA 3N7PD 2PMZF 2ZIXB 4NLBA 2HOIA 2KNJA 3ICXA 3IG5A 4IC9A 2RRDA 3MGVA 2H3IA 2DF4B 2HBMA 2KJ8A 2MRLA 2ZG6A 3F53A 2HOQA 2W7PA 2K4IA 2KVCA 3KFUF 1ECWA 2WB1F 1ZQ1C 1HIWA 3H0RB 3O0FA 2XI9A 3CYMA 2F77X 5KL1B 2H3ZA 2KJ9A 4CRXA 2OXOA 2H3QA 4BJQA 2VJ5A 2WB1C 3D2NA 2LYAA 4A8EA 1L6NA 2ZIVB 3N7SC 2G0AA 4CDGA 3PSFA 2KV2A 1PVQA 5HR6A 2ZXIA 3E0FA 2W03A 4QJFB 2W7OA 2HBKA 2G5IB 2WAQC 3L3FX 3F2BA 1KBUA 2K8CB 2F8LA 2G09A 2A3VA 3SAGA 1Z19A 2K4HA 1NZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZF A;  3VCB A;  3VC8 A; 
#chains in the Genus database with same CATH topology
 2OEH A;  1T3N A;  5KFP A;  1KL9 A;  2E8P A;  4Y2Q A;  3H0M B;  4F5R A;  3C2L A;  4F50 A;  3RRG A;  3RJE A;  3NUQ A;  3QU7 A;  1PK3 A;  5IIN A;  2IHN A;  5J0X A;  2H3F A;  4QZ9 A;  2OCE A;  2EAO A;  4Q45 A;  2KN7 A;  3F2C A;  2EAP A;  2ASD A;  1JIH A;  4RPZ A;  5KG5 A;  1SL2 A;  2FJ6 A;  4F5N A;  3PO5 A;  3TAN A;  5IIL A;  1RYU A;  7ICO A;  8ICL A;  3JPT A;  4KLU A;  4RQ4 A;  3ORY A;  3EW9 A;  4DL3 A;  3NAS A;  4EX7 A;  3Q8P B;  3RAQ A;  4NJ8 A;  3UQ2 A;  5KTQ A;  2KSO B;  3J81 j;  3H4D A;  2DQN B;  4EYH B;  5KNI A;  3RH4 A;  5GTH U;  4RQ7 A;  4F2R A;  1D8L A;  2E3T A;  4ECQ A;  2LHT A;  5KG4 A;  1Q8K A;  2JGA A;  3PX0 A;  4ZOH C;  3BZK A;  4OD0 A;  4XRH A;  4NV0 A;  1N62 A;  4C8M A;  4J9R A;  2DUY A;  2WF9 A;  1L3U A;  5AI0 A;  4UBC A;  4DOB A;  9ICG A;  5JTI A;  3GV8 B;  2XCA A;  3EPG A;  2GO7 A;  4PGY A;  5J0Y A;  1QLN A;  1UT8 A;  2F1H A;  1MN8 A;  2XI9 A;  2F77 X;  3QU9 A;  4IRC A;  4ECR A;  2H3Q A;  2NRX A;  2WB1 C;  1N5X A;  3E0F A;  9ICJ A;  2G5I B;  1KQQ A;  4M6W A;  3WK7 A;  2EAN A;  3ZDD A;  2HHT A;  2K4H A;  4F4K A;  9ICU A;  4UB2 A;  2W9B A;  3EWA A;  3NTU A;  2KOB A;  2VKQ A;  2WF5 A;  3QXG A;  3N4M B;  9ICS A;  3M6Z A;  1ZQG A;  5J2D A;  2JHD A;  3H0L B;  4RQ2 A;  4RNM A;  1JRP A;  2FI1 A;  2YN4 A;  1Z1B A;  1T4G A;  1RXV A;  4B9S A;  4MFA A;  2HHQ A;  3WKB A;  3Q8S B;  3M9O B;  2ISP A;  4PHA A;  3RJJ A;  4ECS A;  4P0P A;  3AEV A;  3QE9 Y;  4MFF A;  4JV2 A;  4BX9 C;  2K60 A;  5HR7 A;  4KN4 A;  1SKR A;  2V4R A;  1SB3 C;  4ECT A;  1L3V A;  3SMV A;  1L3S A;  2NO4 A;  1ZQQ A;  5KFJ A;  1ED1 A;  9ICO A;  1L7N A;  3NGD A;  1L7P A;  5J2J A;  2W43 A;  4IRK A;  8ICQ A;  3DDH A;  1O03 A;  4F8R A;  4AP9 A;  2HHS A;  3PY8 A;  4ED1 A;  1EXN A;  4EEN A;  2WHE A;  4TUR A;  2RHF A;  4B9U A;  2PMZ F;  4NLB A;  3GIL A;  5KT4 A;  3PW0 A;  1AQ6 A;  1WCN A;  2R8I A;  3G6V A;  1JXL A;  1B43 A;  2MSN A;  5AM0 A;  2HCF A;  1BPD A;  1QCK A;  4CCH A;  3E58 A;  3MC1 A;  1U47 A;  7ICF A;  5ALX A;  1ZQN A;  2HHX A;  5DDM A;  4NLG A;  2ZUD A;  1KRP A;  4J9P A;  2NYV A;  3SAG A;  4RU9 A;  2I6X A;  1XSN A;  4IR1 A;  3LVW A;  4IS7 A;  3WK9 A;  4GC7 A;  5FP0 A;  4M04 A;  3HW8 A;  1F0M A;  4LJX A;  3KD3 A;  8ICY A;  1X42 A;  3IDW A;  4IQU A;  3KZX A;  1JI7 A;  2VIX A;  3K4G A;  4ED3 A;  2BPC A;  2VAN A;  5AM5 A;  5J2K A;  2G08 A;  2LM4 A;  5ALP A;  5L1M A;  3HPO A;  4M2Y A;  1XO0 A;  3QUT A;  3LWL A;  1U4B A;  4I29 A;  3V6H A;  4QZC A;  1ZQB A;  1JN3 A;  3BQ2 A;  3SAF A;  3LVV A;  2JMG A;  4KLJ A;  2JEG A;  1X6I A;  4UAY A;  2Q0Z X;  2KJ5 A;  5CRX A;  3GV5 B;  4M47 A;  2DWQ A;  1ZQM A;  4B9T A;  4KLG A;  9ICX A;  5E79 U;  4DFP A;  2JXJ A;  1MA7 A;  2XVT A;  5T14 A;  2KHQ A;  3JPR A;  4R63 A;  3U26 A;  5D49 A;  4GXK A;  1UHU A;  1Z4N A;  1COO A;  2CN1 A;  4J9Q A;  5KFA A;  2BQR A;  2E1E A;  5AKL A;  4QW8 A;  2OWO A;  3MFH A;  1WWU A;  2ZIX B;  3PR5 B;  4R8U B;  1QSL A;  2HHV A;  5KFH A;  4F5P A;  3MGV A;  3RJF A;  7ICH A;  4NLK A;  2MU2 A;  2QLT A;  2ASJ A;  3T5H A;  1DOQ A;  4JUZ A;  2A1A A;  4TUS A;  2W3R A;  1NOM A;  4UAU A;  4J9K A;  5KT5 A;  1TVA A;  5HR6 A;  4UAV A;  4I27 A;  3F2B A;  1Z1V A;  1IV8 A;  1BPX A;  2K8C B;  2VA3 A;  5KFU A;  4PJ0 U;  2JH7 A;  1NZB A;  2KD1 A;  1N2X A;  4NLN A;  2JZB A;  3V6J A;  4UAT A;  3IHQ B;  3C5G A;  2ALZ A;  4DL4 A;  4KMU A;  4DL5 A;  2EQY A;  2LYH A;  3QX7 A;  2R8G A;  3H7I A;  4Y2R A;  1SZH A;  2C2E A;  5BOM A;  3VC8 A;  4NY8 A;  3DV9 A;  4CF4 A;  1WWV A;  5AKX A;  5B5E U;  4UAR A;  4EEL A;  8ICE A;  1D9F A;  4IQT A;  4Y2U A;  2HOF A;  4OJO A;  3V7J A;  2JRZ A;  2W9C A;  4DFM A;  1ZET A;  4PHE A;  1J97 A;  1RYR A;  4HYK A;  3EUB 2;  3GZF A;  2ZIU B;  3TQ1 A;  2DGZ A;  3M7D A;  5J29 A;  5J0U A;  4FZM A;  1ZQS A;  2BKE A;  1BPB A;  2XCP A;  1L7M A;  1X9X A;  4G9B A;  5D46 A;  7ICK A;  3ISD A;  4DF8 A;  2AJQ A;  4QWA A;  2E1F A;  1N60 A;  2Y1I A;  1NKE A;  4IL6 U;  2KVS A;  4CGZ A;  2P35 A;  2W04 A;  3UMC A;  4ECW A;  2XID A;  1B22 A;  1QQ7 A;  2FPM A;  1HUO A;  1T3Q A;  1VJ5 A;  3AU2 A;  1ECW A;  3BQ0 A;  5AI6 A;  3C5F A;  2KJ9 A;  1KKX A;  3PR4 A;  2I9G A;  4ED0 A;  4LZG A;  2ZXI A;  4O3R A;  4GLX A;  5IIO A;  9ICN A;  2ZJ8 A;  3T5K A;  1QTM A;  5DBA A;  1MQ3 A;  1HUZ A;  1Z19 A;  4KX3 A;  4ZH4 A;  1TAQ A;  3GV7 B;  1QSS A;  2YMP A;  1C20 A;  2YY6 A;  1WUD A;  4P4O A;  3HWT A;  5J2I A;  1NKB A;  3FDS A;  4JMU A;  3OSN A;  2ZJ5 A;  4YD2 A;  3TAR A;  2F76 X;  4O3O A;  1DK2 A;  4GXJ A;  2G06 A;  1ZJM A;  2JEJ A;  3B0Y A;  2KZM A;  1ZJN A;  4UAW A;  2BPF A;  2F44 A;  2J6S A;  1TK5 A;  2YQE A;  5J0O A;  2RDJ A;  4ACO A;  1TV9 A;  4O3M A;  1Z3E B;  1V97 A;  3N7R C;  2R8H A;  3TKA A;  2K8A A;  4RQ5 A;  5KFC A;  3GIJ A;  3H8S A;  1BPE A;  4C7Z A;  2K4E A;  2AQ4 A;  5ALR A;  1SZP A;  7ICR A;  3FM9 A;  1RPL A;  4I2A A;  9ICP A;  3ZDB A;  3QU4 A;  4GFJ A;  3JPS A;  1T8E A;  3BS5 A;  4YMN A;  3GU3 A;  3RJI A;  3PV8 A;  3F2D A;  2ESE A;  2FMQ A;  1JXE A;  1WCL A;  5B66 U;  4Z6C A;  5J0W A;  1FIQ A;  1VLB A;  3WKE A;  3TAP A;  5HML A;  1TK0 A;  2PFN A;  1ZQU A;  4PGQ A;  4QZH A;  4FBT A;  4M6W B;  4UBB A;  3OTQ A;  4JV1 A;  1U49 A;  4YCX A;  1XSL A;  3O0F A;  2W9B B;  5KL1 B;  4UAS A;  1ZQR A;  2LYA A;  4O5E A;  1SXD A;  1PVQ A;  3HP6 A;  1D8Y A;  5DDY A;  4BWJ A;  3H40 A;  3M8S A;  4ECU A;  1V85 A;  4UW9 A;  2ZIV A;  4CNQ A;  1DRG A;  4YMM A;  5KFW A;  1S10 A;  2YMQ A;  5J2B A;  5IIM A;  5ALE A;  1ZQK A;  2D8C A;  5J2C A;  4P0P B;  2IHM A;  3C2K A;  4RT3 A;  4YN4 A;  2P6U A;  1QQ6 A;  1KFS A;  3N28 A;  1Z00 B;  4EYI B;  3RTV A;  3E2E A;  3RBD A;  4Y2Y A;  5AK6 A;  1NK7 A;  1C7Y A;  4M9H A;  4NWI A;  4C8K A;  2IOH A;  2OH2 A;  2NV3 A;  4X5V A;  1D9D A;  2BDU A;  9ICB A;  3OPX A;  4DLE A;  4O3P A;  4QIW C;  2KIC A;  2M9N A;  5ALW A;  4MEY A;  4Y2X A;  5J2F A;  4OJ6 A;  1JAL A;  5AM2 A;  4EBD A;  2EAM A;  4AYB F;  4P0Q B;  4C7Y A;  1Q46 A;  4J03 A;  5BPC A;  5AK5 A;  3PST A;  5AHX A;  3AN1 A;  5JRT A;  3IN5 A;  3IRU A;  4YXM A;  5KFX A;  3T5L A;  1Q3U A;  5HMM A;  4Z6D A;  2YX8 A;  4DOA A;  2ZJA A;  3QZ7 A;  3OJS A;  4EX6 A;  1JUD A;  4OCZ A;  3IG5 A;  4KLO A;  4IC9 A;  1JRO A;  9ICI A;  1SGG A;  3I1Y A;  5KFM A;  4KLE A;  1ZQT A;  4RNO A;  9ICF A;  3HIL A;  2H3Z A;  4UB1 A;  8ICJ A;  2OHF A;  3PSF A;  3V7L A;  3MFI A;  5ALL A;  3LWM A;  4OO1 J;  3RB3 A;  4MFC A;  3F5A A;  9ICK A;  2G07 A;  2DBY A;  3RJG A;  1ZRM A;  5J8Y A;  4YR2 A;  3C28 A;  3TAD A;  1X6J A;  3RAX A;  3SD7 A;  2GLE A;  2KIV A;  1S8O A;  4YVZ A;  1N61 A;  5KFT A;  4F92 B;  5CJ7 A;  5TZV A;  4IR9 A;  2D6F C;  1KW4 A;  1S77 D;  1KFT A;  3PW2 A;  4B9L A;  1UCV A;  8ICM A;  3N97 B;  2V9W A;  1ZQP A;  2RQ5 A;  1A76 A;  5F9L A;  3SI8 A;  2FLL A;  2HI0 A;  4I2E A;  2M0N A;  4ELU A;  1N63 A;  2ZXH A;  2DKZ A;  5EWF A;  2D3D A;  2Y0S C;  3QU2 A;  3GDX A;  9ICR A;  2GOL A;  4UB5 A;  3WKD A;  5KT3 A;  5AIA A;  3KOO A;  3Q8Q B;  3LK9 A;  4NL9 C;  1SWV A;  2EZX A;  1D8B A;  4DCC A;  4BXO B;  1ZRN A;  4BDP A;  3UXP A;  2HMX A;  5DLG A;  2BPG A;  5F9N A;  3UMB A;  1ZQJ A;  5J0S A;  2HBM A;  1ZOL A;  3ZD9 A;  2KVC A;  1RQL A;  4Q8E A;  1TFR A;  3MDC A;  5L9X A;  3QZ8 A;  4YQW A;  4CRX A;  5AM3 A;  4PH5 A;  3CNH A;  5G5H A;  4A8E A;  2HBK A;  1KBU A;  5DBB A;  5KG7 A;  2W55 A;  2A3V A;  3OGU A;  5CP2 A;  5ALN A;  2XY6 A;  8ICF A;  3PNC A;  2JR5 A;  4WJ3 B;  4J9M A;  1SL1 A;  3Q8L A;  4U6P A;  4ICA A;  2Q4T A;  2HBJ A;  2RLT A;  1TKD A;  4TQR A;  4Y2P A;  1T94 A;  2MA1 A;  5J0R A;  3ONN A;  2W9C B;  3SQI A;  3RH5 A;  7ICI A;  5AKH A;  2BCV A;  3WKA A;  4LVS A;  2V4Q A;  2DPI A;  4KX5 A;  3PX6 A;  4RQ3 A;  1LKY A;  3AM9 A;  4PZO A;  1UT5 A;  5ALG A;  2W8L A;  4QWB A;  1BNP A;  4ELT A;  3PX4 A;  5DQH A;  1DGJ A;  3OHA A;  4C0Z A;  1PUZ A;  4I2F A;  3HKZ C;  9ICC A;  4MF2 A;  2HVH A;  1ZD3 A;  1NK4 A;  3KKA C;  1NJX A;  3MR3 A;  5KT2 A;  3IG8 A;  4KLM A;  3AL0 B;  4US9 A;  9ICM A;  3RFA A;  2BCQ A;  5EWE A;  2EZZ A;  2W9A A;  3T3F A;  3RR7 A;  3ICX A;  1ZQO A;  2QB1 A;  3HT3 A;  3TI0 A;  1RZT A;  4QZD A;  3B0X A;  3PO4 A;  5HHH A;  1N5W A;  1S0N A;  2HVI A;  3AUO A;  1SKS A;  2XGP A;  3V6K A;  1X66 A;  1KTQ A;  2QAR A;  8ICT A;  4EBE A;  3EYZ A;  5DB6 A;  3NVV A;  4MF8 A;  2BHN A;  1KSP A;  3H8W A;  4KLT A;  4TQS A;  2F8L A;  2EDU A;  2MUT A;  3NRZ A;  2KKP A;  4NL9 A;  2KMD A;  1YZ7 A;  5CR0 A;  4DEZ A;  5L1I A;  3M8R A;  1UQV A;  2KFN A;  7ICM A;  2FE9 A;  2I1Q A;  1UPH A;  3M1Y A;  5CHG A;  5ALK A;  1RXW A;  1XU4 A;  1COK A;  1JMS A;  5KFL A;  2XIC A;  5EE9 A;  4UB8 U;  1YZ6 A;  2LBO A;  3WK6 A;  5KFN A;  1PVR A;  4Z6E A;  4F4Y A;  2BQ3 A;  5A0L A;  4PL1 A;  4MHV A;  3Q8R B;  3L5K A;  2BGW A;  7ICJ A;  1S0V A;  4PGX A;  1XWL A;  3MR5 A;  4QW9 A;  4JV0 A;  2C22 A;  2NRW A;  4DO9 A;  9ICW A;  5ALT A;  4ELV A;  3BS5 B;  2YTU A;  2LKY A;  3A0H U;  4RT2 A;  3SV4 A;  1L5U A;  2VJ4 A;  4DSF A;  4F5Q A;  5AI9 A;  5AKG A;  1CEZ A;  2ZIW B;  3K1Z A;  5AKZ A;  2KEY A;  3QUB A;  2AU0 A;  5KFE A;  1TE2 A;  3AQF A;  1J2N A;  5EWG A;  2C2R A;  4R64 A;  2XC9 A;  3L4P A;  9ICT A;  3M9N B;  3LYS A;  3N7P D;  2UVU A;  5HHI A;  4EEY A;  3NVY A;  1LB2 B;  4DS4 A;  1NK8 A;  2H3I A;  2ZG6 A;  4J9O A;  3I76 A;  3RH6 A;  1FO4 A;  7ICT A;  1JX4 A;  2ZIV B;  3N7S C;  1U48 A;  2G0A A;  4CDG A;  1WYG A;  5JU5 A;  2KV2 A;  3GFK B;  5AI8 A;  3IM1 A;  2WAQ C;  3L3F X;  2J6T A;  8ICG A;  2W9M A;  3JPQ A;  4DQR A;  4JWM A;  2F3N A;  5J2G A;  4GXI A;  2H5X A;  4FBU A;  8ICW A;  1N48 A;  4M9J A;  2DL0 A;  1OXJ A;  1ZQY A;  1ZQV A;  3TAC B;  1BPZ A;  3F5E A;  4Q8F A;  1TAU A;  2WF6 A;  4E0D A;  1BPY A;  4I2H A;  3PSP A;  2YB1 A;  1ZQH A;  4RQN A;  2DPJ A;  5KFZ A;  3IV6 A;  3JPO A;  3FAH A;  1BNO A;  4UB3 A;  3KHR A;  4DQS A;  1KFD A;  5KAF U;  4OJP A;  8ICO A;  2K8B B;  1KLN A;  1SIJ A;  5J2A A;  3EZ5 A;  2IMW P;  4UQG A;  2KIW A;  2ZUB A;  4YP3 A;  1RQN A;  1SL0 A;  2QB0 A;  4OJ5 A;  3ED5 A;  5ALU A;  5EOZ A;  2P66 A;  2FLP A;  5KL8 B;  3SR6 A;  2PI4 A;  2ZIX A;  4RQM A;  2PI5 A;  2N1R A;  3PW5 A;  2VA2 A;  3MR2 A;  5KFY A;  5ALI A;  3BS7 A;  4C4R A;  2AGQ A;  4NM1 A;  4F72 A;  4P4P A;  8ICU A;  4ECV A;  2IOF A;  2HOI A;  2R8J A;  5KFD A;  1ZYQ A;  2PFQ A;  2J6U A;  4EBC A;  5DG9 A;  4ED8 A;  3PML A;  1S0O A;  2FMP A;  3ZDA A;  3C2M A;  2W7P A;  1ZD4 A;  5G5G A;  3QUQ A;  1SKW A;  4KLL A;  2K4I A;  4KLF A;  3KFU F;  1J2M A;  3MAB A;  4G3I A;  1HIW A;  3H0R B;  2BCR A;  3KZI U;  4FFD A;  2F1J A;  2MAX A;  2VJ5 A;  4CE6 A;  5DG7 A;  4MEX A;  2AHO B;  2ZTD A;  2KFZ A;  7ICE A;  8ICC A;  3C23 A;  2AGP A;  3WK4 A;  4FS1 A;  2ZTC A;  7ICN A;  4K4G A;  4O3Q A;  3UPQ A;  4QNL A;  3KHG A;  2C28 A;  5DG8 A;  5ALV A;  1X2I A;  4US8 A;  3RJH A;  2GH1 A;  4QIW F;  2FLN A;  4RUA A;  4I2B A;  2KZZ A;  2KZ3 A;  4NLZ A;  2HSZ A;  5ALQ A;  5KG6 A;  3SEI A;  4O5C A;  2BCU A;  1ZD5 A;  3MBY A;  4QWC A;  3K75 D;  9ICL A;  2KKV A;  3PSI A;  3SZ2 A;  1XO1 A;  3AU6 A;  3NVW A;  4YD1 A;  4B9V A;  4I2D A;  3SAH A;  4DFD A;  2Z7J A;  5EE0 A;  5GTI U;  3UXN A;  2BCS A;  2W3S A;  4PL2 A;  3RBE A;  5KFO A;  4OJL A;  5DGA A;  4RZR A;  4QZE A;  3ZI4 A;  4M9G A;  5J0P A;  1UA0 A;  3SYZ A;  2W8K A;  1Z4O A;  2E5S A;  5KFQ A;  5HNK A;  3V7K A;  8ICH A;  4R65 A;  4RUC A;  1UA1 A;  3A0B U;  4KLQ A;  9ICA A;  4DLG A;  5D4B A;  3LDA A;  3T79 A;  5JUM A;  5DB8 A;  5AKI A;  1SV4 A;  1PK1 A;  4FZN A;  5ALF A;  8ICV A;  4YXJ A;  1Q3V A;  2KP7 A;  3WK8 A;  4M9L A;  3KHH A;  3RRH A;  4J9S A;  1QH9 A;  1ZQF A;  3RB0 A;  2AGO A;  3RR8 A;  2WF7 A;  3Q8K A;  2ATL A;  5ALO A;  2DF4 B;  3NS1 A;  2E8N A;  2IOF K;  2ASL A;  1HJP A;  3QYP A;  4C4S A;  3TFR A;  9ICV A;  2WB1 F;  4KTQ A;  4M0A A;  2B6G A;  3BQT A;  1CI4 A;  4Y2V A;  3WU2 U;  1DGS A;  4KLS A;  2G09 A;  1L8L A;  4PHP A;  3D6J A;  3KHL A;  4ECX A;  3JPP A;  8ICS A;  3H8M A;  2H3V A;  5AM4 A;  4RPX A;  2Y0S F;  4KMO B;  1IXR A;  1LKY B;  5DLF A;  2FPK A;  2FDR A;  2YML A;  4FE3 A;  1NK0 A;  2UVR A;  1DK3 A;  3G6Y A;  1CRX A;  4IQW A;  1ZQZ A;  1XNS A;  4KN7 A;  2ISO A;  3IP4 B;  5BOL A;  5DKW A;  2A1J A;  4DQQ A;  4PHD A;  2LPE A;  4ECZ A;  3H4B A;  4Z6F A;  4RPY A;  3OJU A;  3MGH A;  1ZQD A;  1HEK A;  1XS9 D;  4IQV A;  5KFS A;  5AKJ A;  5KFK A;  4AYB C;  4C80 A;  3B9J A;  1ZQE A;  1X9W A;  4QWE A;  4Y2J A;  1X9S A;  3M6K A;  1GO3 F;  4U7C A;  4F4W A;  3ISC A;  1A77 A;  2XY7 A;  1QQ5 A;  4NM2 A;  2LI6 A;  2QAR B;  4QZI A;  4J9N A;  1ZQL A;  2RRD A;  1ZQX A;  5ALZ A;  2HOQ A;  5KG3 A;  5KFV A;  4KLD A;  3V72 A;  1XC9 A;  2MUT B;  2UVW A;  2KG5 A;  5KG0 A;  3OSP A;  5KFI A;  4BJQ A;  3HRD D;  3QEB Z;  2Y9U A;  4Y2T A;  4QZA A;  5J0Q A;  3UXO A;  5DB9 A;  3UQ0 A;  2RDI A;  4I2J A;  2BZF A;  3TFS A;  5AKK A;  4BGD A;  1A0P A;  2PKE A;  1WG8 A;  5C0Y A;  1X9M A;  3C1Y A;  2F8K A;  5TIS U;  2L5Y A;  3C21 A;  5KAI U;  1H38 A;  4O0I A;  8ICP A;  2JZB B;  2CRX A;  2FMS A;  2NO5 A;  1P7D A;  5EE1 A;  1Z00 A;  2HDO A;  2R8K A;  1KN5 A;  1ZD2 P;  4BUG A;  3UM9 A;  3HKZ F;  2WFA A;  2JH1 A;  5F3X B;  2K4P A;  4DF4 A;  5IIK A;  2I5H A;  4JB3 A;  3HX0 A;  2R18 A;  4YR0 A;  1L3T A;  3ZDC A;  1RG6 A;  3NRW A;  5IIJ A;  4I2C A;  5J0T A;  3PMN A;  5K4L A;  1T7P A;  4PPX A;  2PFP A;  4DL7 A;  2AXT U;  4P0Q A;  5J2E A;  4F71 A;  1K1S A;  1URJ A;  3JPN A;  5AIB A;  4O3N A;  2W54 A;  4ED6 A;  5CB1 A;  3RJK A;  4EEK A;  3RF9 A;  2HBL A;  4DL6 A;  1B0X A;  3R9K A;  4EZ9 A;  2OYY A;  4DFJ A;  3G6X A;  1PZN A;  4ED2 A;  4QZ8 A;  1B4F A;  2UVV A;  1U45 A;  7ICV A;  3C29 A;  2KSO A;  4F2S A;  1A6S A;  3BJY A;  3Q8M A;  3ETL A;  4FO6 A;  2NRZ A;  1M6Y A;  1V38 A;  3F53 A;  3I28 A;  2JV3 A;  4QWD A;  3SV3 A;  1X40 A;  4QZF A;  5ALS A;  5DB7 A;  4DSK A;  3UMG A;  2EZY A;  2WF8 A;  7ICP A;  5AK4 A;  4K4H A;  2AQ0 A;  2W03 A;  4KLH A;  5DQI A;  4F3O A;  4DSI A;  2PMZ C;  2W11 A;  5AK3 A;  1PVP A;  4C4T A;  2YMM A;  3PW7 A;  4GC6 A;  4PZN A;  4I2I A;  1BGX T;  1NI3 A;  4UB6 U;  4YMO A;  1BVS A;  1VDV A;  4DOC A;  3GIK A;  2JEI A;  1ZXI A;  4HAI A;  5CEH A;  1F5S A;  4USA A;  2HW3 A;  1ARO P;  4TUQ A;  4I28 A;  4C8N A;  4FS2 A;  1ZQC A;  4XQ8 A;  2QB0 B;  9ICH A;  2DKX A;  5CA7 A;  3KTQ A;  1NNL A;  3GQC A;  2XY5 A;  7ICQ A;  4RQ6 A;  1LV5 A;  3D2Q A;  1S9F A;  5KFG A;  5AI4 A;  1S0M A;  1SWW A;  2Y9T A;  8ICR A;  5KG2 A;  4J9L A;  2BDP A;  1OUQ A;  5KFF A;  2CXY A;  4Q44 A;  3WKC A;  4BXO A;  4RNN A;  2RP5 A;  1TK8 A;  1NKC A;  2WAQ F;  2LM1 A;  4RQ1 A;  2KHV A;  2YB4 A;  5III A;  3ISB A;  4B9M A;  8ICB A;  1NK6 A;  5DGB A;  3S6J A;  3ZD8 A;  4R66 A;  4CF5 A;  4YR3 A;  2DFL A;  8ICI A;  3TAQ A;  1ZQ1 C;  5DBC A;  2OXO A;  3C1Z A;  3WK5 A;  4DFK A;  1NJZ A;  1DXS A;  3AMZ A;  3FYH A;  1ZQI A;  7ICU A;  5ALJ A;  4I2G A;  4Q43 A;  1NK5 A;  3VCB A;  3MR6 A;  8ICX A;  5KT7 A;  5H2F U;  4P4M A;  3MDA A;  1LVH A;  1YT3 A;  2HHW A;  5ALY A;  5KT6 A;  2PFO A;  5J2H A;  4O5K A;  2G5H B;  3QNM A;  2E8M A;  8ICA A;  5EE3 A;  5AKE A;  1Y88 A;  1XSP A;  2O6K A;  7ICG A;  1NJW A;  5L1L A;  1V9P A;  1SV0 C;  4F5O A;  3GII A;  2E8O A;  4UB4 A;  4DQI A;  8ICZ A;  2CPR A;  1MQ2 A;  4DSJ A;  4QZG A;  3KKA A;  4F91 B;  3FC4 A;  2HHU A;  4QZB A;  4O3S A;  2NRT A;  2ZUC A;  1PK1 B;  1U9L A;  1L7O A;  3K1R B;  4C8L A;  5L1K A;  4JK1 A;  2JEF A;  3ETR A;  1F44 A;  5ALH A;  4F93 B;  3BZC A;  3AQE A;  1KDH A;  3THV A;  1NJY A;  2A19 A;  4LZD A;  2XO7 A;  4P2H A;  3CRX A;  5KFB A;  5C5J A;  4NLC A;  1NZP A;  4BWM A;  4B9N A;  2KNJ A;  4F4Z A;  2C2D A;  5AIC A;  4GIB A;  5KFR A;  4DWI A;  4IRD A;  5L1J A;  2ODG A;  3OHB A;  2MRL A;  2KJ8 A;  1NK9 A;  2KTQ A;  1K1Q A;  4RQ8 A;  3NVZ A;  4YG2 A;  1S97 A;  3KBB A;  4ED7 A;  9ICE A;  1K5O A;  5HP4 A;  5ALM A;  3CYM A;  2NRV A;  2B0C A;  3D2N A;  4R8U A;  1L6N A;  4F4X A;  4DQP A;  4C8O A;  5CWR A;  4TUP A;  3PVX A;  2B21 A;  3ZDE A;  2W7O A;  1MSW D;  1IG6 A;  2LMR A;  2KK0 A;  3PW4 A;  3GIM A;  3MGI A;  4B6J A;  5ALD A;  3CW2 C;  4RQ0 A;  2K89 A;  2QKQ A;  2LYB A;  4XA5 A;  3CP8 A;  4UAZ A;  4M9N A;  3QUC A;  2IBK A;  5AKY A;  4DSL A;  2XGQ A;  4KIT B;  1FFV A;  1RM6 C;  4DS5 A;  1N56 A;  3D2S A;  5DQG A;  2ZTE A;  4CF3 A;  2A1J B;  2ES6 A;  2KE7 A;  3DEE A;  1OW5 A;  1RYS A;  3RB6 A;  1IIP A;  3H8J A;  4NXZ A;  8ICK A;  1L8O A;  3HJE A;  1SXE A;  2F1I A;  3ALR A;  5J8Y C;  9ICQ A;  1FEZ A;  1ZQA A;  2EH9 A;  4K4I A;  8ICN A;  3TAD C;  4ECY A;  1TAM A;  2FPL A;  3BQ7 A;  1S5L U;  2ZIW A;  1O08 A;  2VA8 A;  3RB4 A;  3PZP A;  7ICS A;  3QU5 A;  4FZL A;  2WTF A;  3BDP A;  3BQ1 A;  1S76 D;  4XUS A;  4DSE A;  2Y1J A;  4O9M A;  4Y2S A;  2ZIU A;  1RDF A;  1CUK A;  3SEN A;  2F2A B;  5KG1 A;  1KEJ A;  4EZ6 A;  2PXI A;  1ZQW A;  2OM6 A;  1SV0 A;  1FFU A;  2GWS A;  4DL2 A;  2AH5 A;  4KLI A;  3M9M B;  2BQU A;  2P6R A;  7ICL A;  2BR0 A;  1MC8 A;  4JWN A;  5AI5 A;  5AM1 A;  3T5J A;  4YFK A;  1QSY A;  1IM4 A;  3QEA Z;  2IA6 A;  3EPI A;  4QJF B; 
#chains in the Genus database with same CATH homology
 3LVW A;  4QNL A;  2KD1 A;  4KX3 A;  3VCB A;  4OO1 J;  2PMZ C;  1A0P A;  2KOB A;  2KKP A;  5C0Y A;  3F5A A;  1PVP A;  2G07 A;  2K89 A;  2VKQ A;  2ZIV A;  3H0M B;  4WJ3 B;  2LYB A;  1WUD A;  3CP8 A;  2GH1 A;  4QIW F;  1YT3 A;  2H3V A;  4U6P A;  3KZX A;  2VIX A;  1DRG A;  1UPH A;  3M6Z A;  2G5H B;  2G08 A;  2Y0S F;  4KMO B;  3C28 A;  4ICA A;  2CRX A;  3NUQ A;  1P7D A;  1SZH A;  3F5E A;  2Q4T A;  2XIC A;  4JMU A;  2HBJ A;  3D2S A;  2LBO A;  4P0P B;  2H3F A;  4BUG A;  2JHD A;  1T94 A;  2MA1 A;  3H0L B;  3ONN A;  3SQI A;  4FE3 A;  1XO0 A;  3HKZ F;  2F76 X;  3VC8 A;  2JH1 A;  3PSP A;  2YB1 A;  2KKV A;  3PSI A;  3F2C A;  1PVR A;  1Z1B A;  3DEE A;  1CRX A;  3SAH A;  2Z7J A;  2CPR A;  2R18 A;  4PL1 A;  5A0L A;  2D6F C;  1IIP A;  3NRW A;  2G06 A;  1XNS A;  4KX5 A;  3SAF A;  4NWI A;  2HOF A;  2OH2 A;  4PL2 A;  2NV3 A;  3LVV A;  4OJO A;  2JMG A;  4OJL A;  2BDU A;  4P0P A;  3IP4 B;  3OPX A;  4OJP A;  3ALR A;  2K8B B;  4BX9 C;  4ACO A;  3D2Q A;  2M0N A;  3GZF A;  4QIW C;  2ZIU B;  2ZXH A;  2KIC A;  2DGZ A;  4P0Q A;  1TAM A;  2KJ5 A;  1URJ A;  2KIW A;  5CRX A;  3M7D A;  4O3M A;  4OJ6 A;  3N7R C;  2Y0S C;  4FZM A;  2E5S A;  2K8A A;  2ZIW A;  3SMV A;  2LKY A;  4OJ5 A;  4AYB F;  1HEK A;  2GOL A;  4C0Z A;  2K4E A;  3PZP A;  4P0Q B;  1F44 A;  2VJ4 A;  2XVT A;  1MA7 A;  3HKZ C;  1OUQ A;  3AQE A;  3RF9 A;  2HBL A;  2KHQ A;  1ED1 A;  4FZL A;  4AYB C;  5T14 A;  3PST A;  5HR7 A;  3T79 A;  2DQN B;  2ZIW B;  3K1Z A;  3IN5 A;  2E1F A;  5KL8 B;  2KEY A;  2OYY A;  2JH7 A;  2ZIU A;  4FZN A;  2RP5 A;  3M6K A;  3AQF A;  3CRX A;  1GO3 F;  2LHT A;  1Q3U A;  4U7C A;  2CN1 A;  2YX8 A;  2ZIX A;  4CGZ A;  1D8B A;  2F2A B;  1Q3V A;  2JGA A;  3IG8 A;  2N1R A;  2WAQ F;  4GFJ A;  3AL0 B;  3RFA A;  2W04 A;  3C29 A;  3GU3 A;  2E1E A;  2KHV A;  2YB4 A;  2OM6 A;  4NLC A;  3F2D A;  2RHF A;  2HMX A;  1A6S A;  2XID A;  4NV0 A;  3LYS A;  3N7P D;  2PMZ F;  2ZIX B;  4NLB A;  2HOI A;  2KNJ A;  3ICX A;  3IG5 A;  4IC9 A;  2RRD A;  3MGV A;  2H3I A;  2DF4 B;  2HBM A;  2KJ8 A;  2MRL A;  2ZG6 A;  3F53 A;  2HOQ A;  2W7P A;  2K4I A;  2KVC A;  3KFU F;  1ECW A;  2WB1 F;  1ZQ1 C;  1HIW A;  3H0R B;  3O0F A;  2XI9 A;  3CYM A;  2F77 X;  5KL1 B;  2H3Z A;  2KJ9 A;  4CRX A;  2OXO A;  2H3Q A;  4BJQ A;  2VJ5 A;  2WB1 C;  3D2N A;  2LYA A;  4A8E A;  1L6N A;  2ZIV B;  3N7S C;  2G0A A;  4CDG A;  3PSF A;  2KV2 A;  1PVQ A;  5HR6 A;  2ZXI A;  3E0F A;  2W03 A;  4QJF B;  2W7O A;  2HBK A;  2G5I B;  2WAQ C;  3L3F X;  3F2B A;  1KBU A;  2K8C B;  2F8L A;  2G09 A;  2A3V A;  3SAG A;  1Z19 A;  2K4H A;  1NZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...