4DS5A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mg2+
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 207
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds5A01
4O5EA 1W9HA 1FK9A 3RMCA 4B9VA 4EZ6A 5J0OA 3TAGA 3HJFA 2YV0X 1MSWD 4F5QA 2WONA 1QSSA 1WNSA 4NCAA 3CQ8A 3RBDA 9ICQA 5HP4A 1RNHA 4ED7A 4KHYA 2DPIA 9ICMA 1Y88A 5FDLA 3QO9A 3H4BA 4BE0A 4PQUA 2YNIA 4QAGA 4CJ5A 2BQ3A 4E89A 5DQHA 5L1LA 3ISCA 4NLGA 4HCBA 2G8WA 8ICJA 1U04A 3QNNA 4BWMA 2HHWA 4KLMA 8ICVA 3RH4A 5L1JA 3NH2A 1N6QA 3LDSA 4E1NA 1NJYA 2RF2A 4DSKA 9ICSA 2C22A 3UPQA 4F5NA 1TVAA 1J9AA 1ZJMA 1C0TA 4I7FA 5J0WA 4KLGA 1ZBLA 1IG9A 1JLFA 4KLQA 4UB1A 4UBBA 4M9LA 4CEZA 4I9LA 1VSLA 1L3SA 2P1JA 4OJRA 1CZ9A 8ICGA 5KFRA 2ITGA 3EY1A 3SCXA 2C2RA 1U49A 4PHAA 3L2RA 4RQ4A 1HYSA 1XC9A 9ICBA 4DSFA 3B6PA 4FJ9A 1RDDA 3TFRA 1S1TA 1J5OA 4OGEA 4O4GA 1RILA 5J29A 4QCLA 4CCHA 3GV5B 3ISDA 4F3TA 3SUOA 2P66A 9ICFA 1REVA 4P4PA 3H4DA 1MQ3A 4KKOA 2OZMA 3TWHA 1Z3EB 4GC6A 4CJKA 3L2UA 1UT8A 1RPLA 4KLUA 3RJJA 3MFIA 2W8KA 3V7JA 2EHGA 3PR5B 4Z4IA 5CZ1A 1TK8A 4DSIA 4O44A 4CGGA 2O4GA 1SV5A 5KFXA 3E2EA 4CJPA 2NUBA 4CFAA 1S97A 3V81A 4QOZB 4MFAA 3I0RA 5HRSA 1X9MA 4DQIA 2KTQA 4IR9A 1SKRA 5KRTA 1T05A 3NGZA 4FM2A 5HLFA 4O3NA 3KKSA 2XY5A 1K1QA 1L5UA 1CEZA 1A5XA 5J0RA 3LPTA 4CJTA 2DFFA 4DTOA 4MFBA 1MU2A 4M47A 2RN2A 4DU3A 2JEFA 3KLFA 4Z6FA 3M9MB 4CIEA 4KLSA 4E7JA 2OPSA 3DLEA 3NF8A 1KVBA 5BOMA 3MXJA 4HHTA 3LP0A 2GV9A 3RJIA 5HHIA 2FPKA 1X1PA 3NH0A 3DOLA 5L1KA 2QKBA 3LZJA 4QZBA 1WSHA 5KT3A 1S1WA 1DGSA 4IQUA 3WNEA 1QHTA 4CEEA 4LD0A 2HNYA 4YXMA 2PZSA 3RMBA 4IRKA 4BDYA 4J9SA 3LK9A 1KSPA 2VANA 2ATQA 3V9ZA 4BDPA 4PH5A 2P5GA 3HVRA 3ZDCA 1NK7A 2PI4A 1D5AA 2VG7A 4YMOA 3ZSQA 4B9NA 5JUMA 2ZJ8A 2LSNA 4LH4A 5DLFA 5KFIA 1BGXT 3OYKA 3V1OA 3V7KA 1DLOA 5J2FA 1F21A 1NK6A 3PY8A 2KZZA 4FS1A 4DFJA 4AHTA 1D8YA 1TV9A 3DM2A 5KGXA 1B92A 5KFGA 4CHNA 4JV0A 4KLJA 4X5VA 1RZTA 3FYHA 1RCHA 4LZGA 2A1SA 3NFAA 1KCFA 4CJFA 3NHGA 4ECTA 1MQ2A 3NGDA 1LW0A 3AV9A 4Q44A 7ICGA 3ZSWA 5C42A 9ICTA 3VQ7A 4FJXA 3RJGA 1L3TA 3V9WA 5CWRA 1NOYA 3BDPA 3AA2A 5DGAA 2ISOA 4CK1A 1JMSA 4F4WA 5J0XA 3KHLA 1DOQA 3Q8SB 2YHBA 4FLVA 4XA5A 1Z00A 3RR8A 1X2IA 1BI4A 3PMNA 3H40A 4O0IA 3V6KA 4DFKA 1TVRA 3NF6A 3PO4A 3VQ8A 1L3VA 2HVIA 4RQ1A 2PFQA 3PX4A 4JS4A 4FJNA 2DFEA 5KFEA 4WE1A 3V4IA 1JIHA 4AHVA 3QIPA 1YTUA 4NCBA 4RW7A 4DTPA 4FJMA 3ULDA 1S0MA 3LAMA 3SUPA 2BQRA 1JXLA 3ZDBA 3OJSA 3P1GA 5KFFA 5KFWA 4E7HA 1RT1A 2KN7A 3DOKA 4H4OA 1X9WA 2F1IA 3HPGA 5DB6A 4AHCA 4DEZA 3OYHA 3OYFA 3NBPA 2ETJA 2NRTA 3OYDA 3JPQA 4CEFA 4C8NA 5KFTA 3ZSZA 1TV6A 3T3FA 4KHUA 2LYHA 4CFCA 4ECWA 5KT5A 4CJ4A 3DLHA 1JLBA 3SQ1A 3K58A 4XRHA 4DF4A 3MGHA 3V1RA 4YR0A 4CIFA 4RQ6A 2ALZA 1RTDA 4DL3A 1ZQJA 4O5BA 3PW2A 2FC0A 3KHRA 1RBVA 4EP4A 3M8QA 9ICKA 8ICTA 4TUQA 2VA3A 2BCVA 8ICWA 3V9UA 4UB5A 4B9MA 4M3RA 3C2MA 2GWSA 3ISBA 3PR4A 2P6RA 1HPZA 3TQ1A 1NKBA 3OS2A 1C0MA 1WSIA 1RT4A 1W0HA 1NK4A 1JXEA 2VA8A 2BCUA 7ICTA 4DU1A 2J6UA 3C5GA 3ZT4A 4TUPA 3TAEA 3K5OA 1S9FA 1S6QA 3PMLA 2GUIA 3ZDDA 3NAEA 3V9SA 4ED6A 1R0AA 4CJUA 1UT5A 2XGPA 4PWDA 4HCCA 4KHWA 3VA0A 1XO1A 3CFOA 2B4JA 4CE9A 3OGUA 3T5LA 3QEAZ 3OYIA 4EEYA 2HNDA 5KT7A 2JEIA 3UQ2A 5CR0A 1QSYA 1ZBUA 1LWCA 3IS9A 2YNFA 4YVZA 4I2QA 2I9GA 2X6NA 3U3GA 3V6DA 4DL6A 3MDAA 1QLNA 1U9LA 4F4YA 1WSEA 3DYAA 4OKKA 4FLYA 4RW6A 1H38A 3PUFA 3EWAA 4XUSA 3OYMA 4RQ7A 1WLJA 2D0CA 1RBUA 3DLBA 3BGRA 3H8WA 3K57A 4R5PA 1QTMA 4CEAA 4M04A 4Q43A 3C2KA 3SV4A 3L2QA 4E7LA 4CEBA 3IRXA 1UAXA 4B8CA 3E01A 2GBZA 4Q8EA 2YNGA 1Q8IA 2EX3A 1S9GA 3RB3A 3C2LA 1L3UA 2ISPA 8ICOA 4NM1A 4UAZA 1UWBA 3TAPA 3UXPA 5CY4A 4P2HA 4KAZA 4QWCA 4DFPA 4Z0UA 3ZSOA 5DK5A 4Q5VA 1JLEA 3Q8KA 3LPUA 1B43A 3ZD8A 3GILA 1NK8A 3JPOA 2PFNA 2JZBB 4KTZA 2G8UA 4ECXA 2KQ2A 4R66A 2DPJA 1MC8A 1KRPA 2D0BA 4F2SA 4YFUA 1ASUA 1HQUA 4RQ3A 3GDXA 2HHVA 5DGBA 2C28A 4FW1A 4ZTJA 2IOCA 1ZQMA 3AVBA 2IHNA 2Y1JA 3IAYA 3SNNA 2J6TA 4KFBA 1C7YA 4M3YA 1SZPA 3DLGA 2X74A 4K4GA 3WNHA 3CG7A 4E3SA 2OWOA 4O3SA 3O3HA 3QIOA 3JSMA 3QEPA 2RPIA 3AA4A 3B6OA 2HNZA 4DSJA 2F1HA 4O55A 1RDCA 8ICXA 4CJLA 3SUQA 4KPYA 3ZT1A 3G6VA 3PV8A 3T5JA 9ICWA 2FBVA 5KRSA 4N76A 1VRUA 3VQEA 1HRHA 4YD2A 4QZGA 3VQ5A 4FJGA 3PW4A 3K59A 2Z1IA 3O4QA 4PHDA 4DL4A 2I1QA 4JS5A 4M2YA 3NCIA 5FROA 2RDIA 3ORYA 2B6AA 2AQ4A 5DG8A 2FMPA 3L8BA 2QKKA 5EOZA 4F4XA 4EYIB 3TAQA 1C6VA 4IQWA 3RH6A 4F93B 4DWIA 8ICUA 2IMWP 4IFVA 2ASDA 1SL2A 1N48A 1RYRA 4DTRA 4UB2A 3DLRA 4I2PA 3RB4A 5KT4A 5HNKA 8ICMA 2AU0A 1WAJA 5J2MA 2A1JB 2FBTA 3CFRA 4HUGA 4JUZA 1RBSA 4QZCA 3AU6A 1VRTA 2J6SA 4EP5A 3NH1A 4K8XA 5DG9A 3PX6A 3NGYA 4CK3A 3ZSRA 1EP4A 4TQSA 2NRZA 1N5YA 1NJXA 2DY4A 1ZQDA 3RR7A 4FZYA 4JWNA 4BXOA 4O3OA 4QZIA 5J1EA 4M6WB 4J2EA 3OS1A 4ECQA 4DOBA 7ICIA 3BQ2A 1Q9XA 4MEXA 1GOAA 8ICFA 2IC3A 1TKXA 4RNNA 4FS2A 1VSFA 4Z4HA 1XU4A 3OVNA 4N5SA 4KLTA 3ZDAA 3P83D 3DMJA 1GOBA 2ZQBA 3O4NA 3SQ2A 1KFDA 1KFTA 3MEGA 3RMDA 5J2GA 4JRPA 4BE1A 2DTUA 1D9DA 5KFAA 3K5NA 3OYLA 2W42A 1IM4A 4ZH4A 5EWEA 4Q45A 1SL0A 4I2CA 5I42A 2XY7A 1AROP 4EBDA 3G0ZA 3VN5A 2KZMA 4FYDA 1UOCA 3VQQA 4RZRA 3NDKA 3HP6A 4B3OA 3KK1A 1J54A 3OYEA 1COOA 1C0UA 1TK0A 8ICIA 3VQAA 3B0XA 2JEGA 1EX4A 5KFHA 5JS2A 7ICHA 3HL8A 4H4MA 1HJRA 2Z1HA 2AJQA 4RPZA 4DTXA 1ZYQA 4CHYA 4DTUA 5J2KA 3ISNC 3NF9A 1LWFA 1LB2B 2HHTA 4EBCA 7ICFA 4QZ8A 3Q8QB 1JL2A 4CHQA 1BPBA 3D45A 3KD1E 4RT2A 1BQNA 3O3GA 1ZQYA 3N97B 1S1UA 3ALYA 5J2IA 1ZQFA 2BQUA 5L9XA 3ZD9A 3CM5A 4BWJA 3A2FA 4KO0A 2OZSA 4YQWA 1FKOA 4UBCA 1LV5A 4BE2A 2ASLA 3F9KA 3CFPA 2KW4A 1YVUA 1HUZA 2E6MA 4KV8A 4QZHA 1RT5A 4R65A 5J0PA 4AH9A 1TFRA 5DB8A 4OPJA 1NK9A 3V72A 4KLOA 3AVGA 2BHNA 2PXIA 4JK1A 1ZQXA 2IAJA 5HP1A 3ASMA 1B9DA 1ZQTA 3NGIA 2ZUDA 1BISA 5J2AA 1T03A 3MFHA 4FLTA 9ICXA 2G8FA 1WSGA 1VSMA 1TAQA 1WCNA 2X78A 3MR6A 2UVUA 2A1RA 3WNFA 4NYFA 3QERA 4CF0A 1UA1A 8ICEA 4FJJA 3TFSA 1ASVA 1XHZA 3RBEA 3RB0A 5KFKA 3C1YA 3VQBA 1WCLA 3M8SA 2IS3A 3OY9A 4ZTFA 1JN3A 4CJSA 3JPRA 3C95A 1TKZA 2HHXA 7ICQA 4O5CA 4RT3A 3T1AA 2O4IA 4FJ5A 4ECZA 4FJ7A 5KT6A 1VSKA 3QEBZ 3VA3A 4NYNA 3OYJA 3TARA 1Y97A 1SKSA 3NE6A 2JLEA 5KFDA 5J2CA 3K2PA 3KHGA 5CP2A 3BQ0A 4RUAA 4W5TA 3HT3A 4F50A 9ICUA 4E7KA 4J2AA 3V9XA 4FLWA 2BKEA 4CGJA 2OYQA 3IM1A 1O1WA 4OKJA 4LH5A 2Y1IA 4CHOA 5IIMA 4CEQA 2V4QA 1RTHA 3SQ4A 3LANA 3C6UA 3QEXA 3RB6A 4KN4A 3TABA 2H5XA 5DMRA 4IQVA 4QZEA 2VWJA 3ZSYA 4KLFA 3RJHA 2ZJ5A 4UQGA 4PY5A 2AQ0A 4JV2A 2WOMA 5KFBA 1XI1A 5D49A 3PNCA 4FK0A 4CJEA 4KLLA 3OHBA 3H7IA 4CGHA 4ECRA 4QZDA 4CF8A 4KRFA 3ZDEA 4RNMA 4IG0A 1ZQZA 4PPXA 1BQMA 5EWFA 1U48A 4GXKA 3QEWA 1BPZA 2BDPA 4IBNA 3S3NA 2Q0ZX 4I28A 4FJKA 1WAFA 3JPTA 3RWUA 1LAVA 3OJUA 1C1BA 3HP9A 2W9BB 5KFVA 1T4GA 8ICYA 1HUOA 1JXBA 4IRDA 3N4MB 3MXIA 5DLGA 3RH5A 4O5KA 1RT6A 1A76A 3KKRA 4HUFA 3M9NB 2G8IA 4ECUA 3OYBA 1ZQQA 9ICLA 4FJIA 2ZTDA 2ATLA 5HROA 5DDMA 5CB1A 4FCYA 2BCSA 2Z1GA 4NLNA 4M0AA 4J9PA 3OSPA 4EZ9A 5KFCA 2ZTEA 4DTJA 1VSHA 3LALA 9ICGA 3O3FA 3V1QA 4OGCA 2PY5A 3PO5A 3RJKA 3GV8B 3V6HA 7ICSA 4CJ3A 2B21A 4M42A 4YNQA 4DU4A 2AGOA 4UB3A 4DLEA 4FK4A 2G8VA 2FPLA 1BPYA 1K1SA 3VQ9A 5KG0A 2KZ3A 3AVJA 3PVXA 4PUOA 4J9KA 3L2VA 3RAXA 2MUTB 5CJ7A 4HTUA 5CZ2A 5HRPA 3QEVA 3GIIA 3LWMA 3VQPA 4QZ9A 5CYMA 2HHUA 2FBXA 2I5JA 4CF2A 1ZQEA 4FJHA 1RXVA 2PYJA 1ZQWA 4DL2A 1XHXA 4ICLA 9ICVA 4BDZA 1ZQPA 4K8ZA 1B9FA 3L2WA 1S9EA 4XQ8A 4JRQA 4EBEA 5EU7A 5F9NA 4NXZA 4QWEA 1NOMA 4Z4GA 4JWMA 4YD1A 3ZT0A 1LW2A 4DL5A 2YKMA 2XCPA 4YXJA 1S1XA 2KFZA 8ICKA 3SPZA 3AVNA 4M3UA 1B22A 8ICBA 1S5JA 1RTIA 2FLNA 2W9CB 1BPXA 1RXWA 1RTJA 5TZVA 3RJEA 2JZBA 4I27A 4PGXA 4J2DA 4RW4A 4DFMA 3P5JA 2FBYA 3AO1A 5KFJA 3JPNA 2R8IA 3F73A 4F8RA 5DBCA 3LAKA 4B8AB 2ZUBA 4YMNA 1EKEA 4F91B 4W5OA 1KEJA 2E4LA 2P6UA 1ZQVA 1JLAA 4BGDA 5SWMA 3K4GA 7ICPA 3C5FA 3H8JA 3PW7A 2VG6A 4DTSA 1C1AA 1ZQUA 4I2HA 4ED1A 7ICVA 1NOZA 4F4KA 5D46A 1I39A 3PW0A 1ZBHA 3KHHA 4ED3A 3TAFA 4FBUA 1RDBA 3KD5E 1ZQCA 2XGQA 3K5MA 1KTQA 4CJRA 5HRRA 4J2BA 9ICPA 5J2NA 4R63A 4QZFA 2W9MA 4DQSA 4YP3A 5J2HA 3Q8MA 2PI5A 4KB0A 2FMSA 1HQEA 7ICRA 4Q0BA 7ICEA 1NJWA 3MDCA 4KI6A 1CLQA 5J2PA 5KFNA 5BPCA 2HB5A 9ICAA 1K6YA 3SZ2A 3S3OA 2B5JA 1XSPA 5JS1A 2HW3A 2A1JA 8ICSA 4CJVA 4M3XA 4CK2A 3ZSXA 1WN7A 4DQPA 2F8SA 4IG3A 4I2EA 8ICAA 2HHSA 4H8KA 9ICNA 4DTMA 1KVCA 4PHEA 3RRHA 4ED8A 7ICNA 1BCOA 4B9SA 3LP1A 3SJJA 8ICRA 1U47A 2VWKA 7ICKA 2FMQA 3RMAA 1QS4A 3AVFA 4B9TA 4M6WA 4M9NA 2ZD1A 4RQ2A 4IDKA 1BCMA 4M3WA 4PGQA 4FBTA 8ICNA 5SZTA 4KN7A 4W5RA 1T7PA 4RQ5A 2NRVA 1IKWA 1JLCA 4CEOA 2IBKA 2W9AA 2BCQA 3NTUA 1WSJA 4I2JA 4JV1A 3GIKA 3T5KA 4J9OA 4AHSA 1IH7A 4N56A 2PFPA 3GV7B 1CXUA 4CGFA 2PYLA 5HMLA 3CM6A 3DI6A 2UVVA 4GC7A 1ASWA 1RT2A 4DS5A 1QQCA 4CESA 2UVRA 4KHNA 4MFFA 2AGQA 3IG1A 4J9NA 1NK0A 2R8JA 2BGGA 5F9LA 2HMIA 4RPYA 5T7BA 3G10A 4P4MA 4ED2A 3ITHA 3AO5A 1S0OA 7ICOA 1IO2A 8ICQA 2NRWA 4F5PA 4KHSA 4C8MA 5IIKA 4LZDA 3QEIA 3L3UA 4ID5A 4NM2A 1RBRA 4ECSA 1CXQA 4KMUA 3RRGA 2F1JA 2YHAA 4CFBA 9ICJA 4FO6A 2JGUA 1KVAA 1XWLA 5C24A 4Y1DA 2YNHA 1VSEA 1X9SA 4R8UB 3SQ0A 3MR2A 3RAQA 2YKNA 2OPQA 4ELUA 4M3TA 1ITGA 1IKXA 3HPHA 4FJ8A 5DQIA 1YT3A 2F8TA 3HVTA 5IILA 4DMNA 3KLIA 2BGWA 3DRRA 3AO2A 1C1CA 5KFYA 1S77D 3AVKA 1ZBFA 3QNOA 4CFDA 2AGPA 3PX0A 1HNIA 2IA6A 1KLNA 1I3AA 4CGIA 5E41A 1ZQHA 1JLQA 1LAWA 4I2IA 1NKCA 3LP3A 1HJPA 3HX0A 2FLPA 1ZQGA 2ZTCA 3I0SA 4ZHRA 5J0SA 2Z1JA 5IINA 4W5QA 3ZCMA 5CHGA 5IIIA 4Z4EA 3SI6A 2P5OA 9ICHA 5HBMA 5KFSA 3VQDA 2XHBA 5J2EA 4O3RA 2XY8A 3IHQB 3RJFA 4CHZA 5J2JA 4CF9A 5DKWA 3BJYA 4W5NA 3UXNA 7ICJA 1D8LA 5K14A 4EYHB 3MXMA 2M9NA 2XC9A 3MBYA 2WTFA 5KG5A 2VA2A 3PW5A 3LZIA 4M9JA 4QWDA 4F5RA 4KLEA 1VSDA 9ICEA 4XIUA 1T8EA 4RQ0A 3H08A 1BHLA 1FKPA 1NJZA 1BIZA 3KJVA 4OVLA 4UAYA 1PZNA 4O9MA 4FLXA 1IXRA 4KITB 4KREA 4BXOB 3AVIA 4OPKA 4C8LA 3FDSA 3HXMA 1XS9D 4BACA 3OHAA 3SYZA 3SI8A 4I2AA 2G8KA 4QW8A 3OS0A 4YMMA 1HMVA 1ZBIA 5IIJA 5KG6A 3GIJA 4ECYA 2ASJA 3LWLA 1ZQIA 9ICRA 5KFOA 4CIGA 4R64A 2HVHA 5DG7A 4RW8A 3RTVA 3GFKB 4M3ZA 4Y1CA 9ICCA 4NCGA 3KTQA 2OA8A 4DS4A 4DSEA 3T19A 5DBBA 2QXFA 4I2FA 4IRCA 1NK5A 4B9LA 4LVSA 3BQTA 3MR5A 4JLHA 3T5HA 4TURA 3DLKA 4CEDA 3OSNA 1CZBA 2XCAA 3AVCA 5CA7A 3HO1A 1TL1A 3OYNA 2OPRA 1ZQSA 3QINA 3AVLA 2W9BA 5D4BA 5KFLA 4KLDA 4LSLA 3EYZA 2W8LA 4YR3A 3AVAA 5FRNA 5J0YA 5DQGA 3NF7A 4AHRA 2BE2A 4KTWA 3JYTA 4Z4FA 4L8RB 4TSXA 1RYSA 3AO3A 4PGYA 1IKYA 4KI4A 5DBAA 4CJWA 4DSLA 2IGIA 4CERA 2FPMA 2NRXA 4HYKA 3D0PA 4O0JA 2QK9A 4MF8A 5HMMA 5DB7A 2XY6A 4CF1A 3VQ6A 1EXNA 3C1ZA 4GXIA 1ZQKA 4O3QA 1G15A 3KLHA 5CYQA 1KDHA 4GMJB 4KLHA 1VSIA 3MAQA 2FLLA 1S10A 7ICMA 3QE9Y 4OLBA 1RT3A 5DB9A 4PHPA 4FM0A 4NLZA 2OPPA 3OYCA 1ZQNA 1Z26A 4QWBA 4RQ8A 1BVSA 2JEJA 8ICLA 2BCRA 3TANA 3FFIA 3DRPA 4ECVA 3C94A 1BPEA 4RNOA 2MUTA 4FLUA 3WNGA 4E19A 4QZAA 7ICUA 4RG8A 3S9HA 4DOAA 4G3IA 1JL1A 1JKHA 9ICOA 2R8GA 1QSLA 5KG2A 4J9MA 4F5OA 3I8DA 3DRSA 1S0VA 4G1QA 1UA0A 3AO4A 4FXDA 5EWGA 4F2RA 4P4OA 5IIOA 1FXXA 5J0UA 3C23A 4MF2A 5FRMA 4OKEA 2IHMA 4DTNA 4IKFA 1BPDA 4ELTA 4F4ZA 2ZE2A 3M8PA 2BR0A 2C2DA 3UXOA 3BQ1A 2X6SA 5KFPA 4B08A 1U4BA 2W9CA 2R8HA 5KT2A 3G6XA 3SPYA 3EZ5A 4YFKA 1VK0A 3EPIA 5KFZA 3QETA 1D9FA 3LDAA 9ICIA 3MECA 4AHUA 4KLIA 4DOCA 1ZQOA 4DLGA 3GIMA 3AU2A 3K75D 4YCXA 3Q8LA 3QESA 2ZUCA 4Z6CA 2F96A 1JLGA 4E7IA 2P51A 5HHHA 4B9UA 4KHQA 2D0AA 2R8KA 1RT7A 3U3YA 3V6JA 4NLKA 4FJLA 2G8HA 1HNVA 1WSFA 4DG1A 2XO7A 3ETLA 3KK2A 2C2EA 1EETA 3HYFA 1ZQAA 2DFLA 1J53A 3KLEA 1V9PA 1GOCA 2PFOA 3Q8PB 3SUNA 5KFUA 1Z00B 3OYGA 3HPOA 1BI4B 3KK3A 4ELVA 3LP2A 3KIOA 4UAWA 4GVMA 3MEEA 5I3UA 1VSJA 1DTTA 4DQRA 1ZQRA 5KG3A 3M8RA 4M45A 3HW8A 4HVJA 1A77A 1ZQBA 3MR3A 3MGIA 4QW9A 1KLMA 3GQCA 4LSNA 3M9OB 2VG5A 4O3PA 5HRNA 3UIQA 1U45A 4IR1A 1BL3A 3MEDA 2DFHA 4K4HA 3SV3A 1NKEA 4DL7A 4I2GA 4F3OA 4FZZA 4TQRA 1XSNA 4M41A 1S1VA 4DF8A 4CHPA 4FK2A 4E0DA 4RW9A 5KI6A 7ICLA 1Q9YA 4AILC 4KB1A 3VQCA 3JPSA 3JPPA 3G6YA 1TK5A 5BOLA 4FLZA 1S0NA 4K4IA 1HYVA 3THVA 3HK2A 4YN4A 4GXJA 1RDAA 3C21A 3HSTB 8ICCA 4RPXA 4M9HA 3HWTA 5J0TA 1TGOA 4C8OA 5DDYA 3B0YA 4MFCA 3AVMA 3TR8A 3QZ8A 4M9GA 4YR2A 2XRIA 2ZJAA 4RU9A 3H8SA 4Z6DA 4GW6A 4ED0A 4Q8FA 3OYAA 2RKIA 1TKTA 1T3NA 1A5VA 1TAUA 3V7LA 5KFMA 8ICHA 4FVMA 1CUKA 1RBTA 3VQ4A 4QWAA 1N56A 2R7YA 4UB4A 2D5RA 3ZT3A 2BPFA 4I9QA 3TI0A 3HM9A 5D3GA 1LWEA 2HHQA 4FM1A 2BANA 8ICPA 3C6TA 5KFQA 5J2BA 3AA5X 4MEYA 3MABA 1DTQA 5C5JA 4J9QA 3ZT2A 4Z6EA 5KGWA 3AA3A 1YTAA 4E1MA 4N41A 5L1IA 3CYMA 4NY8A 2KFNA 2E6LA 4IFYA 4I2BA 1HYZA 4I29A 1S6PA 2BPCA 4MQ3A 4PA1A 3KLGA 2MAXA 2RDJA 1S76D 4LY7A 2Q3SA 3L3VA 3UQ0A 4TUSA 4RUCA 2V4RA 5J2QA 1ZQLA 4CGDA 3U6FA 2V9WA 1Z25A 5KTQA 4GLXA 3AUOA 4R8UA 1ZETA 5KG4A 4FZXC 3QLHA 4HUEA 4C8KA 2UVWA 4J9RA 3S3MA 1SL1A 3EW9A 4J9LA 1QE1A 4F92B 1SKWA 1KFSA 3Q8RB 1XSLA 4FW2A 4OLAA 3QZ7A 1ZJNA 5J2DA 5KG7A 5C25A 1TKDA 2IDOA 5KG1A 4DO9A 1TL3A 3ZSVA 4YG2A 4Z4CA 4ID1A 4N47A 4CECA 4I2DA 2BPGA 1BIUA 4DQQA 4IQTA 3TAMA 3AVHA 8ICZA 1EXQA 1IKVA 5J0QA 3EPGA 4CJQA 3K5LA 1JX4A 1A5WA 4KTQA 1SUQA
chains in the Genus database with same CATH superfamily
2D3OR 2XYGB 4HHHA 1UVMA 1ICEB 2WFBA 2KKZA 3DDHA 2HF3A 5FPNA 3ZEUB 2L48A 1MSWD 1QSSA 4WKYA 4JI5K 3RBDA 2F65A 2DPIA 4J90A 2ZIWB 5FDLA 4LIWA 4K0KF 4M5DB 1KAXA 1LKZA 4U8VA 1DQ9A 4IJNA 2NPFA 4PEOA 4HCBA 2G8WA 5D77A 5G5GA 4WKRA 1DK3A 3ZTSA 4UB8U 1FE4A 5DO2A 3L4PA 2MKIA 1JLCB 5SUHA 2QXLA 4MK7A 1N6QA 1OWXA 4BRKA 4E1NA 3CVKA 1NJYA 1MWYA 2JJ4D 3O9QA 3NEKA 1XEZA 1KVIA 1DK2A 4RBUA 2A2CA 4IFVB 4W92B 3VV2B 4OZ2A 4KLGA 2M88A 4Y2MA 3P31A 2D1CA 1VLYA 4UBBA 2CJKA 2YWWA 4OZNA 4OYBA 1VSLA 4DU8A 4OJRA 3NCQA 4WU3A 2F7VA 3LDPA 4DFDA 2NCKL 2OH2A 4PJ0U 4ZVEA 3M2RB 3AEVA 3L2RA 1HYSA 3CCES 3D0HE 3GZ7A 1RDDA 1N5YB 4O5FA 4WXWA 4WCEL 2ZITA 4O4GA 1UVJA 3VHQA 4CCHA 2HKEA 2G9OA 2P66A 1U6ZA 4P4PA 1RWWB 4NLBA 2K3KA 4KB7A 2HDOA 2NXJA 4R0EA 2GWJA 4CJKA 1UT8A 1RPLA 2E1PA 3RJJA 2HWIA 1KQSR 5CZ1A 2FZCB 4Y2XA 3UD3P 4Y2AA 3VEVA 3E2EA 3JSBA 4P2MA 1S97A 3LM2A 3H8MA 5HRSA 2K60A 4ZN1A 4Y6IA 3U4LA 5GTHU 1T05A 3R5DA 3CMAN 4G1PA 2IBOA 5I42B 4KE5A 1NGAA 1N33F 4CJTA 4OMFG 2DFFA 1U0HB 4ZA1A 3KK1B 2W55A 3VC8A 2H1YA 3M30B 3EEQA 1WG1A 2OPSA 3OLAA 4J7CA 3UD5A 1BD6A 4JI2F 3W3DA 2QB0B 4I64A 4HHTA 3LP0A 4H4MB 4CYUB 1P8GA 4NXMF 2AZ3A 5ETPA 2GV9A 3RJIA 5A0YB 2QKBA 4N8OA 1NU0A 1B70B 3BGFA 5JLHA 4A61A 3B8HA 4DX8H 3O08A 2HNYA 4JYAJ 3O3LA 1BQNB 4UB6U 4YXMA 2PZSA 4IRKA 1ZXOA 4BDYA 1N62A 1BU6O 3LK9A 2AT1B 1KSPA 1PC5A 4DPTA 3DLLQ 1TMMA 4KHPJ 3V9ZA 2DCUB 1VQMN 2A41A 4X2BA 4FP9A 2PI4A 1FO4A 3ENVA 3WZ0A 5JUMA 1ZTTA 4DBQA 3HHLA 2B3TB 5KFIA 1BGXT 3TZZA 1FKAF 1Q0NA 1B0VA 1DLOA 2J76E 4IYQA 3S1TA 3GOIA 4Y65A 1D8YA 2H3ZA 3DM2A 3IRUA 1SC3B 5F8HA 2FQQB 3UPFA 3PNIA 5KFGA 3W60A 2IAJB 1H3DA 2X51A 1FEZA 1OY8A 4LBHA 4S0MA 5B08A 3N7RC 1OY9A 4CT8A 3SAGA 1LW0A 5F0UA 3CCVS 2P6SA 3EGNA 2CRXA 3OW2R 2PAVA 4OPAA 5C42A 2CN1A 2P35A 4EMDA 3VGSA 1L3TA 3V9WA 3TVZA 2YMMA 2WK4A 3OL6A 2ISOA 3D66A 4F4WA 2DGQA 4CGZA 2OPRB 3G25A 5H9FK 5J8YC 1GLAG 4KBOA 1ZS6A 4XA5A 4MKYA 3LDQA 3RR8A 4K0KK 1X2IA 3C29A 4NYPA 1RWVB 1K5OA 4JD2A 3D2SA 4O0IA 1T9UA 3Q2TC 4OJPA 3HULA 3HSDA 2HVIA 1P8ZA 4JS4A 1FXLA 1ZPWX 3V4IA 4AHVA 4URSA 3T9NA 4NCBA 3PFOA 2ZXHA 1TUUA 5D0GA 4FJMA 1S0MA 1VQ7S 2O8BA 3SUPA 3DGPB 4LJMA 3P1GA 1UQVA 5KFFA 1NNLA 4E7HA 2QJ3A 4H4OA 1WYGA 1X9WA 1NHKL 4NEZA 3OYHA 1GT8A 2NRTA 4NB4A 3KZIU 4CEFA 5KFTA 4KX5A 1TV6A 3T3FA 3VCDA 4KHUA 4CFCA 5HR7A 5KT5A 4C7ZA 3VGUA 4C3LA 4M5MA 2R2UA 2LQ9A 5IQQA 3SQ1A 4I1TA 4PPDA 3QRRA 3SSRA 4EGLA 4YR0A 2IVNA 4RQ6A 3SMZA 4FWSA 3NS7B 1GX6A 4XH1A 3ZETA 4O5BA 4ZVFA 3KHRA 1U2VB 2FI1A 1FHTA 2VA3A 4LF4J 2A1BA 4ICAA 2MLXA 2KJVA 4RUBA 3C2MA 2Y9TA 3KUGA 4DV4J 3C28A 3PR4A 5CYJA 5AQGA 1FDNA 3WK9A 2HBMA 1RT4A 2D3DA 1JXEA 7ICTA 4DU1A 3C5GA 1QVFR 3K5OA 3PMLA 2YWHA 3OHRA 2GO9A 4CJUA 5KQ8A 1FTCA 2YKPA 4DV2F 4KHWA 3VA0A 2ZIUB 3TVKA 5HI7A 4CE9A 4DR3K 3T5LA 2VD3A 5ALJA 4XDCA 4YDUA 4LF9F 1N33K 2DGUA 2LQJA 2NYIA 2X6NA 1N5VA 4YOYA 1AUDA 3NVVA 3UQSA 1XR7A 2AIRB 3FEYB 4XO0A 4JI2K 2VQFF 4XUSA 2D0CA 2MA1A 4NXMK 3RJMB 3BGRA 3H8WA 3MXHP 5M1FA 1WBBA 1VQKN 2F8LA 4M04A 3WXIA 2Z2YB 3L2QA 3M7VA 2YH1A 4PG5A 2ZXIA 1UAXA 2GBZA 2V2KA 4Q8EA 4B9QA 1Q8IA 3C2LA 3G8TA 4NM1A 5AQUA 2R2RA 3MN6A 1BMQB 4X62J 3UXPA 2I9SA 4CO1A 4P2HA 2UXDJ 2XWYA 3NY0A 2ROGA 2LXFA 2CJBA 3FLCO 1RTIB 2VOOA 2UV8A 2LQ5A 2QI2A 5CAAA 2O8FB 1LKYB 1B43A 2OD4A 2PO4A 2D8CA 1RTJB 1WDTA 4E1JA 2PFNA 3QRPA 4KTZA 3T1YK 3CJSA 1SZHA 4NJ8A 4KHPF 3HHKA 2DWQA 3H2VE 3ILJA 4K4WA 1E6VA 2C28A 2DNHA 3UNYA 4BQZA 2MU2A 4CLPA 5AM3A 2AF6A 1VRQC 2CQ3A 2IHNA 2W1BA 2Y1JA 1RCXB 3GG4A 1KHVA 2DEIA 4KFBA 1QUVA 4FYXB 4TLRA 4M3YA 4CO0A 4YOUA 1RCOB 4BUGA 2VG6B 4K4SA 3ZEUA 5M1OA 4FPRA 5AQYA 1CJVB 3SBGA 4OI1A 2XWXA 2OO4A 3WQTA 2ZIWA 5G5HA 8ICXA 1UVKA 3OFHA 2V68A 5JVHL 4UAUA 4M5DA 3PV8A 3E58A 9ICWA 2BM0A 1HRHA 2PMZF 1H6KX 2QWOA 3PW4A 2B43A 3O4QA 4PHDA 4DL4A 2D3ZA 1REGX 2EH9A 3NCIA 4ILMA 1YHQN 1GEHA 2JV3A 2C3MA 4YY3J 4L73A 2W41A 4EYIB 3BYPA 1PIEA 4U7UK 2ZEJA 5ALRA 2GFFA 3RH6A 4CI6A 2FVCA 4IFVA 4QIWD 4U67L 4UB2A 3DLRA 2HS3A 2E20A 5H1SQ 4ED5A 3AN1A 2A1JB 2HSTA 2FBTA 2NRRA 3CFRA 4QZCA 3AU6A 2NSCA 1IJJA 2J6SA 1HWIA 3G8SA 4EP5A 3BEXA 5IZHA 4C4RA 3UCZP 5HVHA 3PX6A 3O8MA 4YB7A 1PK1B 4IQMA 5KPTA 1N5YA 4IQXA 2ZJPL 4C3MA 3RW7A 3QT7A 3QFPA 1H2VZ 4CT9A 1F0MA 4XDDA 1BE4A 3QPIA 3O80A 4ECQA 2VPYB 3Q89A 3WX4A 1O03A 1DZ5A 4H5NA 2MY7A 1GOAA 8ICFA 4OYAA 3QLHB 2EAMA 3BO2A 4YOWA 1XU4A 2VCPA 3OVNA 4N5SA 3ZDAA 2FHJD 4AQYF 1SQGA 3EZWA 1KFDA 4JEPA 4LF5F 1RQLA 1IBKJ 2Z57B 4BE1A 2DTUA 3K5NA 4DV4F 4P9SA 3HSGA 4DV2K 2CH5A 1IM4A 1D3WA 5AKIA 5AQJA 1LEOA 1Y11A 4LR9A 2FSKA 2BKOA 4MK8A 2XG8A 5I42A 4ETXA 2CNLB 4B1VA 1QH9A 5ALGA 2XMAA 1WG8A 3IG1B 3G0ZA 4LF9K 1GLCG 5JU5A 3R2CJ 4CZCA 4ZS6A 3KMQA 5KAIU 1WF1A 4RZRA 1U0HA 3HP6A 1URRA 3KK1A 1J54A 1Q7YO 1RWPB 3M30A 3B0XA 1QY7A 1ZA2B 2QB0A 4H4MA 4CYUA 3HL8A 2VQFK 1HJRA 2R7OA 4OZLA 5A0YA 2WC9A 1VJQA 1VMBA 1SI9A 1OO0B 2DNYA 4JKAA 2HHTA 2LQBA 4EBCA 1VQON 7ICFA 3CCJN 2KEYA 4KAIA 3H5SA 3SBMA 4RT2A 1BQNA 2CPIA 1LCUA 2YKNB 2CPZA 2OP5A 2WHEA 3CM5A 2OZSA 3BSCA 3R5JB 4MMOA 3VEYA 4QU6A 1RHUB 3D28A 2WF6A 1HUZA 3WKDA 5HANA 2X1FA 4R65A 3I5BA 4WP3A 2ERRA 4OPJA 2X7IA 3V72A 1FXDA 1HW9A 4KHPK 1NBEB 5KAFU 3CMAS 2BHNA 2Y3YA 2IAJA 4ZHRB 2UXDF 2F8EX 1UVIA 2GZOA 2FJVA 2PE8A 3MFHA 1VSMA 2K4PA 5KL1B 4ZIVA 3NL0A 1WCNA 3H0LB 1NDPA 2V7ZA 3HOSA 3QERA 1N36F 3D6FB 5ALUA 1UA1A 4KC5A 4O8KA 2W01A 1O6XA 4EENA 2EFNA 2L9NA 5KFKA 3C1YA 2CNOB 2QSWA 2IS3A 4U96A 4ZTFA 3EICA 3ZTQA 1AW0A 4GFJA 4RT3A 1U7LA 2B4UA 4BC9A 4FJ5A 2M52A 4ISEA 1ZRMA 1ZAVA 3VA3A 1H7XA 3OYJA 1CI4A 1VQMS 2PA8D 4US9A 4OLPA 1QZ5A 2ZJRL 4KGVB 5KFDA 3K2PA 4QIVA 4W5TA 3HT3A 1T9VA 4NX9A 3TU5A 4FLWA 1W97L 4CGJA 1NNEA 1BDGA 2OYQA 3F2KA 1IV0A 3DGPA 4CH7A 1LWXA 1XNRJ 4JK9A 1N61A 1RTZA 2Q31A 5DMRA 3VGMA 4IQVA 2IRYA 2BZ2A 3RJHA 2ZJ5A 4PY5A 3NGRA 1G99A 3UMBA 4E8UA 4YY3F 5DM7Q 2ZOMA 5D49A 1AZSB 4FK0A 3H7IA 3CF5Q 2G5IB 4ECRA 2R7WA 4CF8A 4HH1A 1ZQZA 2EFPA 2F8MA 4PPXA 4ZPCA 1U48A 4GXKA 1RKJA 3N7SC 4C3KA 3QGIA 3S3NA 3I76A 3IMQJ 3JPTA 1VC6A 3RWUA 2W7PA 1IUJA 4L3QA 1FRHA 1U2VA 3AQOA 3ZZ0A 3RH5A 4QPXA 1Q5YA 2B8PA 2X1BA 3M9NB 4LJXA 2YX7A 2OELA 3OYBA 1ZQQA 4JMUA 3SMPA 2AP1A 3VERA 2ZTDA 2UV8G 5AQQA 1U2CA 5CB1A 3F0NA 2H3QA 1QQOA 1HKBA 1X66A 3CO0P 3M6WA 4AQYK 2EI5A 3LPYA 4EZ9A 5JICA 4LF5K 4MIBA 2YQ1A 2XMKA 3KLHB 3O3FA 4QIEA 4LRBA 3QU5A 2ZIUA 4DV4K 1TP7A 3WQUA 3GV8B 2PD1A 4NMLA 1HARA 3IR7B 3H98A 2QZ8A 3G8QA 4TU9A 1IIPA 2OPPB 3BN7A 3QGHA 2E7VA 2AGOA 4UB3A 4KGKA 1K1SA 3VQ9A 2JLFA 2MY8A 3POTB 2ZF5O 3AVJA 3L2VA 3FFIB 1SQFA 2V50A 1M90T 2ZNYA 4GY2B 3CE8A 4UUWA 5HRPA 3RW6A 3VCBA 3GIIA 3VGVA 3VQPA 1JUDA 3M8ZA 4QZ9A 3GWCA 1Y10A 4JB3A 5D4NA 2HHUA 4CF2A 1A6LA 1HI1A 3D2EB 1A9NB 9ICVA 4MIAA 1ZQPA 2HFVA 2IM1A 3A3NB 1SS6A 1UJ5A 3J7YU 4JRQA 2UU9K 2IVOA 5F9NA 4QWEA 1JCFA 4YMEA 4HTLA 2R2TA 4Z4GA 4U7CA 4JWMA 4DL5A 1JI7A 3CCSN 3NG8A 2G06A 4YXJA 5BPNA 2ZE2B 6AT1B 1B22A 8ICBA 1S5JA 1IG6A 1RTIA 1U2FA 4H0TB 2O8FA 1LKYA 2KT5A 1BHNA 4WE1B 1RXWA 1RTJA 2ZH8A 7AT1B 4ZLJA 2C2OB 1NNDA 1KBRA 1XQSC 3JPNA 1NDLA 2MSNA 2DGSA 2UXDK 3QT8A 3J7AP 3C2PA 3AAQA 2H65B 3LAKA 1IM6A 4B8AB 4YMNA 3B4MA 4F91B 4W5OA 2E1CA 2M0GB 3K4GA 2DVIA 1S6UA 1N36K 2HEKA 3GR1A 3H8JA 2VG6A 2V2QA 5DM6Q 2ZGZA 2RHQB 2XZTB 2M9KA 4UOFA 3SAFA 5D46A 3HM8A 1I39A 1ZBHA 1CJVA 2QSFA 1N60A 4ED3A 4FBUA 1VQKS 1RDBA 3KD5E 1ZQCA 3OTOJ 2C3UA 4N77A 3OFEA 1KWMA 4J2BA 1VDHA 5L38A 1YBAA 2W9MA 1F1BB 4GKKJ 1TL5A 3ZZUA 2XMJA 4V1Ak 1FJGJ 1L7NA 2QIFA 3HD2A 2GJ2A 4WWSA 3GE1A 4I67A 1RE1B 3SMVA 2F9JA 5AR0A 9ICAA 4KBIA 2LDIA 2DKZA 1QVGR 3S3OA 1WC5A 2A1AA 2JWLA 1IBLJ 5JS1A 3R9PA 2G2OA 4H0YB 4YY3K 2A1JA 4DR7K 3WKBA 1K73T 1IVZA 4O23A 3ZSXA 4DQPA 1F5SA 1KVKA 1SV4A 8ICAA 5TKYA 2HHSA 9ICNA 1PK1A 3KBBA 1RBOB 3OR2B 4PHEA 3RRHA 3TP2A 2J5AA 3ET6B 1BCOA 4FYWB 3IN5A 4AYBD 1YAGA 4RW6B 1E4GT 3VAGA 4USMA 2QTDA 4WP9A 2J0SD 2LYVA 3AJ1A 5EGYA 1RADB 4RQ2A 2B9WA 2HBKA 4M3WA 4FBTA 2FF6A 3MMCB 4KN7A 2VUGA 4DUYF 1RQNA 3VEOA 1FXRA 1FVSA 5E7OB 4RBVA 1YHQS 4M5IA 4KJIA 4NL9A 1K9MT 2IBKA 5ADXA 1RA6A 2GQQA 1UWBB 4JV1A 3GIKA 4J9UE 3EE3A 3GV7B 3DAWA 2PYLA 3CM6A 4JV5J 1R8HA 2P8IA 4C4WA 3J7YI 2UVVA 4A8MP 1OH6A 4CESA 1QQCA 2UVRA 2ZUGA 4JAXA 4MFFA 2NZTA 2CXEA 3IG1A 3OBIA 3OTBA 4HH0A 4ZKAA 1NK0A 1OMSA 2R8JA 2BGGA 5F9LA 1ACMB 4ZCMA 4IFYB 1S6PB 1U6BA 5K5MA 1UFKA 3UDEA 2YWFA 4DR2F 1NPPA 4F5PA 4Y2RA 1NGEA 1M1HA 1Q5VA 5IIKA 2VH7A 2V9KA 3L3UA 1HKGA 4NM2A 5DDOC 3H8YA 1U1LA 2XICA 1BNOA 2DXDA 5HMWA 5M1KA 1J5EK 3RRGA 2F1JA 4CFBA 4FO6A 2OHFA 1M5PC 5LL6d 2O66A 3MR2A 2YKNA 2MZ1A 4AM6A 2CDQA 3BF4A 5MAOA 4C98A 2BGWA 2QWPA 1TTHB 4AF1A 1S77D 3IAM9 3OVBA 1C0GA 2YWEA 2IA6A 1KLNA 4CGIA 1ZQHA 1JLQA 4I2IA 1WF2A 2FLPA 1ZQGA 3QDKA 4ZHRA 3OXFA 3IBFB 3ZCMA 2J7WA 5IIIA 5AKJA 2XMUA 2WF9A 3BO4A 3HHLD 3VQDA 2CJXB 5J2EA 4EU0A 2XY8A 4AXIA 1SUQB 5AHXA 5D0RA 4W5NA 3UXNA 2EFVA 5EUHA 2UZAA 4F0HA 1D8LA 1FK9B 2PIIA 2DQNB 2HFSA 2D3O1 2IM2A 3PDNA 2E7XA 1ZM4A 5ETRA 5U47A 3PW5A 3LZIA 1EP4B 2HI0A 4F5RA 3CJQA 3J81Y 9ICEA 4XIUA 1VQOS 2DNZA 3CCJS 4RQ0A 1F5CA 4X4TA 2KV2A 1BIZA 1F2HA 4UAYA 3GMGA 3JSYA 1TYQB 1PYOB 2WSCC 4PQUB 4Z7CA 2VBWA 2IRXA 4Z94A 4KITB 4JKGB 4KREA 4OPKA 3SI8A 3TADA 4YDUC 2VONA 4YMMA 2AMCB 3GIJA 4ECYA 2KYZA 3LWLA 5KFOA 4C1NI 4CZIA 3I8BA 3CWJA 3FE1A 2FC9A 2KIVA 3GFKB 4AP9A 2U1AA 1ZBTA 2QLTA 1VHXA 4CW7B 2QXFA 3OQ2A 3J7AN 4NRUA 1NK5A 1AZSA 4GVEA 2NXNA 4CJ7A 2OHDA 4ZPTR 3ONNA 1ZM3A 4CD1A 3MM5B 1CZBA 4BRQA 1AXQA 2VFRA 1K47A 4UT4A 2I7PA 2WBNA 1QQNA 2DNGA 2K1RB 4FF3A 1DY3A 2UXBJ 2DHXA 3J81U 4C2MA 3EO3A 4LUBA 4KLDA 3ULEB 3WT0A 5H9EJ 3QUQA 3EYZA 2LA4A 1NZ8A 4G1IA 5IQ6A 1SKUB 1OUQA 1BA0A 2DNOA 1XK8A 1GMVA 1K8AT 2Q79A 4DUYK 2E66A 4CLYA 3AO3A 3DXBA 2DHHA 3CD6N 5HMZA 2PDAA 3DU6A 4HYKA 1SV5B 4MF8A 5HMMA 4M5HA 4CF1A 3CDAA 3TEGA 1RUSA 3V81B 3FBEA 3KLHA 1KD1T 2HOQA 4HHUA 2MDAA 3MMVA 1S10A 2OUGA 4OLBA 3O44A 5JVGQ 5HLFB 1G1XA 1W2BR 2OPPA 4BG9A 1Z26A 3QWPA 5E2QA 1VYAA 3KNGA 4MFBB 4EHUA 5IM0B 2JEJA 3M2UB 4X64F 3POTA 3KLFB 2BCRA 3FFIA 2ZH3A 2EK1A 3ZI4A 3QJLA 2D4WA 4DR2K 3DLEB 4FLUA 3HKWA 4NZ0A 4DOAA 1F9FA 2NXEA 4A8OA 3KWMA 9ICOA 2DY1A 3KWIA 2BJ7A 2Y0SD 2FGOA 2YB4A 4PXCA 3D2EA 3I8DA 1Z1BA 5AJ3J 3R1HA 2MZSA 2MPUA 5EWGA 2BEFA 1ROFA 3A5NC 2G08A 4P4OA 3C23A 3K7RA 1SV0A 2CYYA 3D5MA 1CC7A 2IHMA 4DTNA 1HNWJ 3U8XA 4OYOA 2ZE2A 2C2DA 3BQ1A 2Q97A 3BP8A 4B08A 2YPYA 4YFKA 2LDYA 1BQXA 1FDAA 3LF0A 3MM7A 1APSA 1URNA 2VV5A 1D9FA 3EKUA 3HF5A 3LDAA 3TSQA 2L41A 3IG5A 4KLIA 2VJUA 2Q4TA 1EARA 2BJ3A 1RGVA 1ZQOA 5AQSA 4FWKA 3M8WA 4YCXA 4A2BA 3TWZA 2DK2A 3JS6A 2LM1A 4AL7A 2AXTU 2R8KA 4DPXA 3CQYA 3Q7CA 3PKMA 5AE3A 4O8UA 2XYPB 4KH6A 1FRLA 2GH1A 2JL9A 4FVCA 3ETLA 5CH7B 3SDEB 1K8KA 3DLLL 1V3SA 5KFUA 4LFAJ 3J80Y 3FSYA 9ATCB 4A62A 1FERA 3PXGa 5A8RB 4C97A 3CCSS 2VBXA 4DQRA 1W7WA 4OJ3A 5KG3A 3M8RA 1JJHA 3QIPB 4RW7B 2UUBJ 4CLSA 4QW9A 1YG0A 3GQCA 1ZM9A 3P3DA 3K2YA 4O3PA 1Z2LA 1WSRA 4CM2A 2BOAA 3VVTA 2GUPA 4BREA 2DFHA 2OJ3A 3NBPB 4ZVSB 1XSNA 3M5RA 1TZ0A 4M41A 4CHPA 7ICLA 4B3RF 1JLBB 5HQMA 4FLZA 1A0PA 2JC0A 3OR2A 4K4IA 3TX0A 5F8LA 2EFGA 3ET6A 3N01A 1RDAA 2CJYB 2MQLA 1RTDB 2GHVC 3HWTA 3ZX3A 1M90O 4N7TA 3UO0A 4DR6F 5DDYA 2UUCJ 4DN0A 4BRIA 1XQIA 2VQEJ 4LF6J 3SFUA 2XRIA 3BZCA 3J80U 4RU9A 3H8SA 4Z6DA 3AD8C 5FPEA 1T6DA 2GX8A 4BRGA 3MMCA 3T6BA 2CZ9A 1D1UA 1U1RA 4OX9J 5C15A 8ICHA 2WSEC 4P73A 1N56A 3WK4A 1HKAA 3QAUA 4UB4A 4PKGA 1HWKA 2D5RA 3ZT3A 2BPFA 4I9QA 3F41A 1X5PA 2LVWA 4FL9A 3NVYA 3MMJA 3WX8A 2CG4A 2KSOB 3AA5X 1PC4A 3BQ7A 2RE2A 3MABA 1SWWA 2DGOA 4Z6EA 5KGWA 3AA3A 5AQKA 4N41A 3AMZA 2CVEA 4DHVA 1ATNA 4IFYA 4DI6A 3DWLA 2DGWA 3LGHA 4G6VB 4I29A 1S6PA 3CDWA 1JWWA 3IS9B 4I2QB 4ZDNA 1UJ4A 4X64K 3BZKA 3G96A 3BR9A 5KNIA 2MAXA 5L8RC 3LDOA 4JI0J 3TZYA 3C65A 4WIQA 3UQ0A 2A42A 1M1KO 4R5PB 2QMUB 3H0PA 1ZQLA 2C2NA 4H0OA 2COLA 2ZWOA 2P9UB 3U6FA 1OSDA 4ILGB 2Z58B 2V9WA 2ZH7A 2KKPA 2FJ6A 4W4MA 3PKYA 3K17A 4J9RA 1SL1A 3W5XA 1TUYA 3GL1A 2RQMA 4WYBA 1N2XA 2E1YA 2I5HA 2RUSA 1HNXJ 4GNIA 4CI0B 2IMOA 5AJ3F 3NAHA 1JLEB 5D4LA 2RE1A 1OS5A 5IT9O 3S7RA 5KG7A 1RHJB 3I5AA 4ANCA 1TKDA 1N88A 2IDOA 4DO9A 3ZSVA 2JWKA 4QS9A 1HQUB 3CTRA 1YGYA 8AT1B 3NOCA 1BIUA 3ILIA 2KXFA 3G86A 3RSEB 8ICZA 5A6WA 3JQMA 5CEHA 2A6MA 2QLWA 3K5LA 1YXQA 2V8GA 4JHDB 5DS7A 1SUQA 2HMPA 4O5EA 3J7Z5 5AKEA 3DLGB 3FMWA 1FK9A 3MD1A 1WHXA 4IG3B 1MA9B 4OFZA 3TAGA 3H59A 1CPZA 3HJFA 2YV0X 3LO3A 3JSMB 1KOOA 1EZZB 2AEMA 3E9PA 3H6EA 3CQ8A 5HP4A 4PHTX 4NASA 9ICMA 3H4BA 3M6KA 3NXZA 3NRZA 4PQUA 2C2ZB 4DCOB 1HWJA 4PCQA 4QAGA 4JKGA 1X5OA 4CJ5A 1SXEA 1WTBA 1ILYA 4E89A 4HT7A 4PL2A 4NLGA 8ICJA 2OI2A 4IO8A 2XVTA 1MWKA 1RWOB 4BWMA 3DRXA 5HN0A 4BC7A 1R89A 4KLMA 2V69A 3RH4A 4M5LA 3NH2A 3F5AA 3BPDA 4UARA 3AL0B 4LFAF 3UDLA 3AD7C 2WHOA 1TVAA 2K4HA 1YQHA 2CQIA 5J0WA 2DD8S 1ZBLA 2XLIA 2L3MA 4WQ4A 4KLQA 5A6PA 3JS9A 3CQXA 4M9LA 2XULA 3BB5A 3BGUA 4QS7A 2P1JA 2W2NP 3VF0B 3C16B 1CULB 1YRTA 1X6JA 4LRFA 1HBMB 2ITGA 3EY1A 4C0OC 4B3RK 3SCXA 2GX9A 4PHAA 3MM5A 3IO1A 1SQKA 3FBCA 1XC9A 4WFYA 9ICBA 1WEZA 1I3OB 2RAQA 2K1RA 1T9TA 4DR6K 3ULEA 3NVWA 3D7EO 3OLBA 5AQPA 4CZJA 3GV5B 1CQNA 1MWZA 3ISDA 2W3SA 2WRMA 1P6TA 5AQMA 1U1KA 1AFJA 2FZGB 3L2UA 3BPSP 3M2VB 2W8KA 4FSVA 3PR5B 4C6AA 4Z4IA 3NUQA 4C1NK 1RJJA 3FVYA 1FJCA 1SB3C 2E2QA 4CGGA 2O4GA 1HBUB 1SV5A 2Q66A 2VQEF 2EFQA 3TZXA 3FCVA 2AJ1A 2NUBA 4LF7J 4CFAA 1ZD5A 4J5OA 3V81A 2JVOA 4EAHD 4MFAA 3TZWA 1X9MA 4ES3A 2N3OA 2YX1A 1Z1ZA 4ZPVR 2FVRA 1FJ7A 3LH2S 3NGZA 4FM2A 5HLFA 2EK6A 2CZ4A 3KKSA 1UMJA 2KYXA 1L5UA 2DNLA 5J0RA 4BC2A 4DTOA 4MFBA 5IM0A 2RN2A 4DU3A 3M2UA 2JEFA 3KLFA 3C6AA 3TJ8A 3DKDA 4KLSA 4E7JA 1GLFO 3DLEA 1BLUA 3CJ5A 5A0LA 5EVZA 1CS4B 5CXTA 2YKAA 2RD5C 3QT6A 3TUJC 1X1PA 3LPEA 3LZJA 4NOHA 1P90A 1X42A 4IQUA 2ZBIA 4ER8A 4LD0A 3I55N 2KIWA 2O8DB 3MN7A 1NJIT 1S1UB 2Y1RI 4J9SA 4JI0F 2VANA 5GINA 3CD6S 4DUZF 4PH5A 1X0PA 3DXSX 5HVFA 1EQYA 4M5JA 2YHWA 4XEIA 4FF4A 5ETOA 2LSNA 2DKOB 4X65F 4LMZA 3SQGB 5GAGP 3A8EA 2AEFA 5AJ3K 4OJLA 3SENA 1RT5B 1F21A 1NK6A 3PY8A 1FEEA 4FS1A 3QBWA 2AX1A 3WKAA 1O0PA 1FX2A 4BX9C 2VWBA 4DR5J 3UMGA 4CHNA 4X5VA 5HP1B 3SD7A 4BY9C 4LZGA 2A1SA 3LUYA 4RJVA 1KCFA 4CJFA 3W8PA 3NHGA 4ECTA 4USJC 1MQ2A 3NGDA 1HWUA 2LQ8A 3AODA 2CKWA 4Q44A 7ICGA 3THPA 3ZSWA 9ICTA 1FX4A 5K8OA 4NL9C 3RJGA 1V4SA 5CWRA 1RWMB 3AA2A 4B1WB 4CK1A 1YJWN 1JMSA 1DJ0A 1WOQA 3SDEA 3KHLA 3CJ8A 3AOBA 2V5HG 3O4WA 3IGVA 4Y3CA 1KDNA 2GQCA 2Q6BA 3E9OA 4K4YA 2E1MC 3VAHA 2KDOA 1Q79A 1LQ9A 1S48A 3PRVA 3ZNJ1 3R27A 2QL9B 3C19A 3JXOA 3NF6A 1TELA 2V94A 1M5OC 2M7SA 3QIPA 1YTUA 1UAWA 4RW7A 3VGTA 4WPAA 3F9MA 3FZMA 3PYGA 3ULDA 4LFAK 1PO6A 1R8BA 1JXLA 3OJSA 2HS4A 1IG8A 3US5A 4D3GA 2A3VA 5M1NA 4OJ6A 1VHIA 2JNJA 4ZLNA 2WZ1A 2F3NA 2I7NA 3OYFA 3NBPA 1U6FA 2WOMB 2ETJA 3JXUA 4YOEA 1T3QA 3ZSZA 2LYHA 1VHFA 4JI8J 2F9DA 3DLHA 4BGBA 1JLBA 5KQDA 5A8KA 4R79A 4OCZA 3V1RA 3EN9A 4CIFA 3KG0A 1RTDA 4B3MF 2ZG6A 1C1BB 4ZVHA 1RBVA 2QT7A 4TUQA 1U24A 8ICWA 3T69A 4FPAA 2IY5B 1RT6B 2CJAA 1VFJA 3JAMO 4M3RA 3SLCA 4LC9B 5AQLA 1F44A 2GWSA 3O9TA 4TKTA 2AJFE 1UVNA 2WB1F 3OS2A 1C0MA 3ZXWA 2QE5A 2D69A 1RGIA 3W66A 3ZT4A 4TUPA 2VQEK 1S9FA 2QFJA 3ZDDA 1IJFB 2E8NA 2KSOA 4ED6A 4NLYA 1UT5A 4LRAA 5DM7L 2CADA 3O6WA 3CFOA 3CF5L 1UZHA 1SIJA 3OTQA 4DMZA 3GLJA 1QQMA 4A8YA 4X4QA 4EEYA 5I3QA 5AXNA 4ISFA 4WF9Q 1HIYA 4UOCA 2WW4A 4UZBA 4G9ZA 4BRMA 4LF7F 3R5AA 3IS9A 2YNFA 4I2QA 2P9IB 4PKIA 2ZDOA 2PFDA 1SIZA 3FR0A 3MDAA 3KKAA 1QLNA 1HA1A 1WSEA 3AY9A 4RL1A 3VETA 1JROA 4F72A 2CQCA 3TADC 2VASA 2OM6A 3M32B 4JI1F 3V2UC 3OYMA 4BCAA 4DV1J 3CPWM 3GP9A 4K50A 2GMJA 4R5PA 2WSFC 2Q1NA 3DRYA 1N34K 1Z05A 5ETNA 3A5MC 3FC4A 1VCTA 5BPLA 3MGVA 2B56A 4CEBA 1RAHB 3IAS9 3K0JA 1B0PA 4TY9A 3W63A 1S9EB 3BSAA 4YDXA 1L3UA 2ISPA 4JI0K 4K59A 2ATCB 4DUZK 4ES2A 5RUBA 5CY4A 3R6MA 3A8YA 3CPEA 2ROEA 4KAZA 4P2SA 3ZSOA 4X65K 4TY8B 4Q5VA 1JLEA 3Q8KA 3ZD8A 2ZIVB 5FPDA 3JB9k 1Q7LB 4R66A 5HATA 3JSRA 3NVMA 4P10A 2D0BA 4YFUA 1HQUA 5F8GA 3GDXA 1CRXA 1YUWA 2NXUA 5DGBA 4ID8A 3U27A 2CGLA 3RSEA 2CJQA 4LFCF 1Q16B 2F40A 2IM0A 2KLAA 1EO1A 3SNNA 2DR7A 1X5SA 2DGZA 4JHDA 4USIA 1NAQA 1X0FA 3NGTA 3DLGA 1HKCA 5ALKA 4DR5F 3MZIA 5F8MA 4E3SA 2NXCA 4O3SA 3O3HA 3QIOA 4XK8C 3JSMA 2RPIA 3B6OA 4DQ8A 4NRTA 1S22A 4O55A 3N7PD 2FHKA 2YBVA 2GELA 3SUQA 1PG5B 3ZT1A 4AM7A 3I56N 3G6VA 2FBVA 5J1NA 2CG8A 2KVCA 4EFHA 3VQ5A 3K59A 4TNOA 3QFWA 1F9EB 2CPHA 2I1QA 3DNCA 4JS5A 2RDIA 4MLEA 4WYLA 2B6AA 3H5UA 1B3TA 4B3SJ 4PL1A 2BJDA 3CJCA 2KHOA 4V19S 3C66A 1YF5L 1FW6A 3TAQA 1XR5A 2HSEB 4ISGA 3GB0A 2KE7A 3WC0A 4DWIA 8ICUA 4DV5J 2IMWP 2QYGA 1GMWD 1N52B 3BZQA 4DV3J 3I1YA 2VC0A 2W2MP 1RYRA 5EHHA 3RB4A 2VU5A 1FCAA 3CCRN 4L72B 4CWBA 2M2BA 3OTCA 4JOUA 3N28A 5DZ6A 1NH7A 1L8OA 3C16A 5DM6L 1CULA 1IXKA 1HBMA 3KD3A 1X9JA 3VEXA 3FZBA 4K8XA 2CVIA 5DG9A 4URQU 4CK3A 2PMZC 3ZSRA 1NJXA 4X4VA 2LHTA 2DY4A 1ZZNA 3LP1B 4B3MK 1VJ5A 5GTIU 2XZWA 4FZYA 2HVEA 1HLWA 1VIXA 3MCSA 4PWWA 4YN3B 4FZLA 1S8OA 3EJMA 4BXOA 4JI8F 3TJ9A 5F8JA 4QZIA 1Y5NB 3B6BA 4BRHA 2ZD1B 2HOIA 2O8EB 4DOBA 2VBZA 4DN9A 4AUKA 3BQ2A 1Q9XA 4LFBK 2EFOA 3M2VA 4NE9C 3R5BA 3MGJA 1VSFA 4LRCA 2CQDA 5HAOA 4CZEA 1HBUA 3P83D 3NRWA 2I0XA 3SQ2A 4FWMA 4JRPA 3GTYX 5FPMA 1E4FT 3P49B 3OYLA 1UWAA 2KRBA 2W42A 3O8WA 1WI8A 4ZH4A 4Q45A 2W3RA 1ZAWA 2JSXA 1NRKA 5IS2A 4I4BA 1AROP 3DHXA 4JKBA 4OI0A 2MHEA 5FLXO 3NDKA 4JI5J 3AB4B 3D6JA 2D3UA 5IT0A 1NZAA 2G4BA 8ICIA 1FJEB 5KL8B 1EX4A 1VQYA 4A8XA 3MI7X 4CNZA 7ICHA 2A5XA 4JI1K 1CS4A 1ZYQA 4ID5B 3S01A 3ISNC 2RUGA 2XNRA 3NF9A 3UCGA 3Q8QB 2H9ZA 1X4GA 2A10A 3PTWA 1S72N 3ZNUA 4CHQA 1RWXB 3O3GA 2O8DA 3N97B 1S1UA 5BR8J 2BQUA 3CD5A 3TA2A 5ALMA 4DPYA 3ZD9A 4P0QB 5L9NA 4BWJA 3A2FA 3Q22A 5A2QO 3HVTB 3EMTA 3VZHA 4Y00A 4BE2A 3MN5A 3HSJA 2ASLA 2KW4A 1C1CB 3SQGA 1NGDA 3FEZA 5AK6A 1J2VA 2F8HA 3AD9C 2R7TA 3W2WA 1RT5A 5EE0A 3HMJG 1H98A 4WFAQ 2XHWA 3NKYA 2RQ5A 2OYYA 3RG6A 4KLOA 4KY3A 1WC4A 4JK1A 1ZQXA 5HP1A 1T95A 1V97A 1B9DA 1BISA 5J2AA 1R27B 3FSXA 1WSGA 4LFCK 2GHPA 1RAFB 1CQMA 5AI0A 2WBMA 3T41A 2BJ8A 3MR6A 4CF0A 8ICEA 4MDBA 1NGJA 2CQPA 4DR5K 1R8PA 2VPXB 2VICA 4W98A 3M8SA 2C3OA 3R5CA 1XMQK 3R6LB 2W6LA 3C95A 3W9IA 1FKPB 2HHXA 7ICQA 1QTNB 3I55S 4LF2A 4OYIA 1KEKA 1GTEA 1PGZA 2O4IA 1YI2N 4ECZA 5KT6A 2DRAA 2V4JB 3TARA 3OXLA 4PYAA 5EDWA 2P9EA 1SKSA 1C0FA 4IC9A 4BR5A 5E3AA 3NCRA 3BQ0A 2X1GA 4RUAA 9ICUA 4J2AA 3Q24A 3IM1A 4OKJA 2D6FC 2NSBA 4CHOA 4CEQA 1NGFA 2V4QA 3SQ4A 3LANA 2FDNA 5T41A 2H5XA 3D1OA 3ILLA 4NCGB 3ZSYA 4URGA 1BOTO 1YJVA 1M0SA 1OPIA 2AQ0A 2EKNA 4JV2A 4RNFA 2WOMA 3HJVA 1U02A 2FPHX 3PNCA 3NNHA 4CJEA 1WSVA 4BRNA 1NG9A 2W11A 4CBUA 3NAIA 3OHBA 2AJ4A 4KH1B 2ADBA 5JRTA 3DLKB 4RNMA 4MT1A 3FCWA 4NXNJ 4LF1A 4DV3F 4IWVA 1M1GA 2RLTA 4IBNA 1YJWS 2Q0ZX 2JR5A 4HT5A 2A0FB 4F4AA 3PIOQ 1E6YB 1C1BA 3HP9A 1T4GA 4FZMA 8ICYA 1JXBA 2NO5A 4IRDA 3N4MB 4JI8K 1RT6A 1VISA 4QIGA 2G8IA 4ECUA 4CLZA 2NLXA 2CA9A 9ICLA 4FJIA 3ELHA 3CJ1A 3FZFA 5DDMA 1R6VA 1NJIO 4FCYA 2QEXN 4ATNA 5D0EA 4CBXA 1GX5A 2IDLA 1YBTA 2YI1A 3OSPA 5LSLA 4WFNQ 3BBBA 4LQ3A 3SR6A 5KFCA 1V5VA 3QMQA 2MKSA 1YLXA 3RJKA 1TFWA 4P2FA 5GMDA 2ROPA 5D4OA 7ICSA 3SCJE 4CJ3A 3EGZA 3QICA 4OYWA 3DM2B 4YNQA 2Q1LA 3Q2SC 1QZ6A 1HL6A 4MTPA 2AKWB 4DU4A 4FK4A 2P9IA 5H9FJ 5E3PA 2HURA 5F3ZA 3K1RB 4DCCA 1ZD4A 1NSPA 4ZLPA 2EAPA 4K0KJ 3M32A 3Q8YA 2RQCA 3QEVA 4RTFD 3LWMA 3QAEA 3ZZZA 2N4CA 5AK4A 2LEAA 3W8GA 1R6YA 2LXIA 2BA9A 3GFHA 4UQTA 1LK7A 1ZQEA 4FJHA 1RXVA 2PYJA 2IVFB 1XHXA 3AA9A 1Q3VA 1NM2A 3BR8A 2LU2A 2KG5A 1S9EA 2ZBCA 4EBEA 3ENOA 4A5BA 2WVFA 3HLUA 5B66U 4WQ4C 1Z4NA 3ZT0A 2IOFK 2P9CA 2KM8B 4KQZA 4QQBA 1X4BA 1IV8A 4BR7A 1KQSM 2KFZA 3ZX0A 3IV6A 1DARA 1NH8A 4TY8A 2AV5A 3D0IE 2W9CB 4IOBA 4Q2LA 4ZK7M 2ZIVA 3HKZF 5B0BA 5JVGL 5BR8F 5IWAF 3S8SA 2ABYA 4DFMA 3N5BA 3P5JA 4MDAA 3SBTA 5ALPA 3MECB 2R8IA 3FFKB 3F73A 5DBCA 3L3FX 1N32F 1NDKA 4DB3A 1FF2A 2ZUBA 1JLGB 1X40A 2MHNA 3H5YA 1TV6B 4BGDA 4FWRA 2G1DA 1RT7B 3E0FA 3PW7A 4DCJB 4I2HA 1OSCA 7ICVA 3CJTA 1AB8A 3I96A 1NOZA 2LECA 3PIPQ 3KK2B 3PW0A 1YDLA 1EETB 3KLEB 3B4DA 1KTQA 2F9TA 5HRRA 1WHYA 2RIJA 4CBWA 4FWOA 4NI2B 4UW9A 2NUHA 4DQSA 2UUAJ 5EXWA 4NMXA 1DTTB 2FYXA 1Q8LA 4DR3J 3W61A 4RNHA 2PMHA 1NU4A 3SCLE 5E3RA 1GLJO 1MWMA 2CRLA 1KLMB 3MDCA 1PKUA 3AXKA 2ZC3A 3W9HA 5H1SV 2DIVA 2KHDA 4A8QA 5BPCA 1K6YA 2RMLA 2QA2A 4ZLLA 4NZ7A 3TTCA 2BM1A 4A8SA 1BO5O 1XSPA 2E8AA 4LQ9A 5IV3A 4JI2J 3DFEA 2VFUA 1FTRA 4NXMJ 4CJVA 4MO5A 1RP5A 4C8ZA 4EWTA 1GXLA 1WN7A 4ZJOA 2A6AA 3EZUA 2DHAA 4I2EA 2LI6A 2NNWA 4H8KA 4UTGA 3FM9A 4DTMA 3OW2M 3D2FB 1F9HA 1YK9A 3HX9A 3BBFA 1FE0A 3GCWP 5AQTA 3LP1A 3SJJA 3GDQA 1MMDA 1L7MA 7ICKA 2FMQA 1VLOA 3RMAA 3WBZA 4ES1A 2EKYA 3I56S 3RU0A 4WCEQ 3E9LA 3PSIA 2ZD1A 4NXNF 1BCMA 3S6JA 5LMNJ 2O8EA 5SZTA 2MTLA 3UWTA 3BS9A 1T7PA 4NWBA 5C2CA 3T1YJ 4CEOA 4ACOA 1TE2A 2R7SA 1OKJA 4DV0K 3NTUA 1WSJA 5AQOA 2M70A 3GIRA 2HGMA 5D3GB 1LWEB 4ZN3A 3IG8A 2YX6A 4AHSA 2AYEA 2VIXA 1CXUA 3CNQP 5EOYA 3AOAA 1CBKA 3CJ0A 4CGFA 5HMLA 1HI8A 1H2TZ 3C6TB 1U1NA 1SJ3P 3QFUA 3R5GA 2J0QD 1ASWA 4FZNA 1M5SA 2Q0UA 2ALYB 3CCRS 2GAGC 3UN3A 1PSDA 4DR4J 3KJNB 2KL8A 1M5HA 3C7NB 4Y2UA 3I31A 2WAQC 1X31C 3DXKB 2NRWA 4KHSA 2CWKA 3NGSA 4C8MA 2L5YA 4LZDA 1UPMB 3VQTA 2BE9B 4ID5A 2CFXA 1E3MA 3IXQA 4KMUA 1NMNA 3MUVP 2ZJQQ 1FFUA 1WWUA 3HJEA 1HW8A 3MEKA 3GJQB 5HL7Q 3P4IA 1X9SA 4BRFA 2QA4G 4Z7YA 2MZRA 4Q7AA 1X4HA 1ITGA 3HPHA 1ATRA 5LMUK 4P0QA 2F8TA 3MURP 1WKJA 3HVTA 1HLUA 5IILA 3NOGA 4ILHA 4HI1A 4GO5X 3KLIA 2UP1A 3AO2A 1C1CA 3SSQA 5KFYA 1W2IA 2A6OA 2FXUA 1MLAA 1LVHA 4CFDA 2AGPA 1VJWA 1HNIA 2Y8YA 3MC1A 5E41A 3HTVA 1TL3B 5BR8K 1LAWA 1HD1A 3CDEA 1HJPA 5IWAK 3HX0A 1VBXA 4F3MA 5IINA 1QAIA 1L3KA 2MZJA 4EO6A 4WBFA 4NLPA 2ZIXA 3NWGA 4EO8A 5KFSA 1N32K 2XHBA 4CHZA 3R3TA 4CF9A 2JH7A 7FDRA 3EE8A 2Y8WA 5DKWA 1FRKA 1MMNA 2QWRA 2APOA 1F60B 2DYAA 3MXMA 2M9NA 2CUYA 5AKKA 2VA2A 5AXKA 4WQ5A 2AD9A 1VSDA 3WKEA 4ZPAA 1T8EA 1NZBA 3H1VX 4PL8A 4YB6A 1FKPA 1NJZA 1S72S 3I87A 3QO9B 2XNQA 2FHOB 3IC1A 5AM5A 4FWLA 5ALLA 1RHQB 2V4JA 3Q23A 1NMEB 1DAXA 3FDSA 3HXMA 3HRGA 1XS9D 3OHAA 4OZ0A 1PAEX 2V67A 3CIPA 4DV2J 3QBCA 5JTIA 5TKWA 1ZQIA 5B0GA 2HVHA 1PBAA 5HR6A 3KKAC 3H45C 4LF9J 3CC7N 1PUZA 2RRBA 3MCOA 3THYB 1C0TB 4NCGA 2EANA 3KTQA 4P7VA 2UUAF 1GLDG 4IL6U 1F5BA 2LCWA 3UN5A 2HZVA 4BR2A 5CHCB 5AQWA 4IRCA 4DX6A 2IHR1 2H3IA 4BRPA 5AKXA 4DR3F 3E1YA 3QFHA 2VQFJ 1MDUB 3MR5A 4OV6A 2MKJA 2YHXA 3DLKA 2NS1B 3OSNA 3NGKA 3T1HK 3QBXA 2XCAA 1JMTA 1ZQSA 1NSQA 2BBEA 1S1TB 3ENAA 3OVSA 2V6AA 3DDNA 1E6YA 3AVLA 2V2VA 4LSLA 3QUCA 2VC1A 2W8LA 4YR3A 4U8YA 1REVB 4ZIWA 2VODA 4NXNK 4KKOB 3FNNA 1DT9A 2KRRA 4TSXA 2DNKA 1YJ9N 4PGYA 4KI4A 4CJWA 2IGIA 4QNLA 4J91A 5G0RB 2B7CB 1U8SA 4O44B 2NRXA 1H1VA 5F3XB 2QK9A 2HBRB 4QR0A 4EEKA 3UNGC 3VQ6A 2R7QA 4GXIA 2D0OA 4O3QA 5LMNF 1ZBSA 1G15A 3GG0A 1U2RA 1Y4ZB 1KDHA 3F2BA 1VSIA 2KU7A 2VZ9A 3T1YF 2I8EA 7ICMA 4L3KA 5E0OA 3LYSA 3A3PB 1WC0A 2QX0A 2ZOFA 3OYCA 3PYFA 1V6HA 2RP5A 4A8EA 1WWVA 1KBUA 3ATVA 3BUZB 8ICLA 3W64A 2HRTA 1HD0A 3C94A 4FOIA 4KSEB 2H3VA 3WNGA 2FVSA 4E19A 1SZ2A 2EEYA 3R6GB 2JRSA 2EZXA 2JFKA 4JBCA 4DR4F 1NSKL 1XERA 3DOLB 2R8GA 4A48A 4DDFA 2P5VA 5KG2A 1S1WB 1WI6A 5ALEA 3DRSA 3IMXA 3GE9A 3FCHA 1JCGA 3AO4A 1D4XA 4BR4A 4F2RA 5JJBA 3CCUN 2J4RA 3THWB 1FXXA 4YOXA 2HK3A 3FUYA 2KG1A 4MF2A 2K8GA 2QEXS 4IKFA 1BPDA 1X3MA 2XLJA 2QTWA 4ALZA 1G6BA 5DDRC 5KFPA 1H74A 2E8OA 4LVOP 3U26A 1PVQA 3KNAA 2W9CA 2R8HA 2LYAA 3V4MA 3G6XA 4HWIA 3SPYA 4AYBF 4C23A 5BRFA 3AGKA 1Q81T 3QETA 3P39A 3SQOP 3MECA 1FI4A 3I9ZA 2VPZB 2GVDB 3D68A 4DLGA 3GIMA 3SFGA 3K75D 3LM9A 2EC2A 3L7PA 5C0YA 2BRKA 1KAYA 1T94A 2ZUCA 3QESA 1JLGA 3NLCA 3MWPA 4OHYA 2A3ZA 2L9WA 2WMMA 3PJWA 2Y0BB 1RT7A 4ZP8A 3U3YA 5FIIA 3OUYB 1VI7A 2BVZA 2OEKA 3M1FA 3D6MB 4N8NA 1EB0A 5GADU 1WSFA 3HSZA 2F7TA 2IA0A 2XO7A 2QLJB 3KK2A 1EETA 3HYFA 4J03A 3KLEA 1V9PA 2PFOA 3SUNA 2BOPA 1Z00B 2E8PA 4HKQA 1G2EA 3OYGA 1SH0A 2KXHA 1BI4B 2KP7A 2CQGA 4NI2A 4AQYJ 3KIOA 4F9OA 1TVRB 1YRUA 4LF5J 2CAJA 4ZOSA 2DF4B 1VSJA 2CPRA 3IR5B 1DTTA 5ETQA 4B3TF 4M45A 3T9ZA 3MD3A 6FD1A 3RRKA 3MX2A 3O2IA 4G9BA 3O9RA 3MR3A 1KLMA 2A18A 3M9OB 4JI7K 3G87A 1TL4A 3VF4A 2DGVA 5D0HA 1DBDA 2ZWPA 1U45A 3DOKB 2HLUA 2UUAK 2BABA 2MSTA 3F44A 1ITPA 4K4HA 1DRGA 2RH3A 3T79A 3A1YG 4OO1J 2O5DA 4FK2A 1HBOB 3TQEA 1XC3A 5KI6A 1Q9YA 4AILC 1OQ6A 1DRZA 1NGCA 3JPSA 2GMHA 3O6QA 3G6YA 1NB2A 1M5VC 1TK5A 3D2FA 1WKKA 3AGRA 2A19A 4L6V3 8ICCA 4USUA 2ADCA 2UU9J 5J0TA 4F3QA 2JH1A 1TGOA 2XSJB 1K0VA 2KK0A 4RKUC 1RB0A 4MFCA 3M8QB 1FFSB 1Q82O 3TR8A 1YVFA 1LFPA 2ZJAA 1MN9A 4GW6A 2IJFA 3GJSB 1KW4A 4ED0A 3THTA 4IOXA 3OYAA 5AIAA 3BKFA 3V7LA 5T7LB 2R7YA 3CCZA 4QR2A 5HJXA 3KWGA 2JDJA 2IOFA 2E29A 2GHWA 5D3GA 1FRXA 1LWEA 4CLWA 3TTDA 2HHQA 1RXOB 1T11A 5LMNK 3C6TA 4BBYA 2GW8A 2XS2A 3P4UB 4YUDA 3WIVA 2ZC4A 3TRGA 3S41A 3D2QA 2KJ9A 1N36J 1YTAA 4C0BA 1SCJB 4E1MA 2HNDB 5L1IA 2ILYA 1VBKA 3CJ9A 2GIFA 2KFNA 1X3NA 2E6LA 4M7XA 5B7WA 3C7NA 4I2BA 1LOUA 4QJVA 1TMJA 2BPCA 4WFZA 4IO9L 4MQ3A 2KKHA 4PA1A 2ZFHA 3DXKA 2IM3A 3J7YP 2W2OP 3DYAB 4QR1A 5ETLA 1TUWA 1X4AA 5E84A 4P75A 3L3VA 2ZH4A 4TUSA 4BG8A 2E88A 4DR4K 2FHMA 5AQFA 4ZPDA 3LDNA 3TOQA 2LLZA 3MOZA 4CGDA 1YJNN 2YWGA 3QNMA 1VOMA 5KTQA 3IRXB 1N5WA 1EAYC 1VQPN 3PACA 1S9GB 1ESVA 5GADI 5AQRA 3EW9A 4UF4A 2YJEA 2MEWA 2AYGA 1WWHA 2ILZA 4ZJQA 5ALOA 4K41A 3M05A 3SK3A 4P0PB 4D3HA 1J97A 4OHZA 3H0RB 2V63A 4ZVQB 4X84A 5EE9A 4DR7J 4WF9L 1TL3A 1RABB 1KN5A 3AM9A 3GU3A 4DJBA 2VGNA 2RU3A 1UFWA 2QL7B 4FZVA 1L6NA 5LY3A 3L3CA 4Z2XA 1IKVA 1U1MA 3EPGA 1JX4A 2G0AA 4KPCA 1AYEA 1A5WA 2LKYA 4PZNA 4WZQA 4JI3F 3RMCA 3LOUA 3UDVA 3TJAA 5J0OA 1T3VA 4F5QA 5AE1A 1WNSA 1BWFO 3ZTRA 4ED7A 1B7YB 4K4UA 4YOTA 4KHYA 3UMCA 3HVWA 3QO9A 4XPEA 5B0CA 2KHQA 1Y9OA 1VRUB 3C14B 2AA4A 4CZFA 1KC8O 3G82B 4Y2JA 4B3TK 2HHWA 1Q78A 1XMOJ 4UUXA 8ICVA 3TACB 4WJ3B 2VFSA 4EX7A 1FWKA 1EWRA 3LDSA 4X4UA 2MQ8A 2RSQA 2WF8A 3U1LA 3UPQA 1J9AA 2Y0SF 3THYA 1C0TA 3QJPA 2DGXA 4US8A 4CE6A 2V8HA 1Q86O 1ULRA 2DR8A 3CJAA 1IG9A 2C1EB 1CSJA 1FT8A 2YX8A 4CEZA 5J2MB 3LVVA 3AJ2A 3GFZA 4CO5A 1L3SA 2LU1A 8ICGA 1FWLA 1VRTB 2VBYA 1TAMA 1DEJA 2C2RA 4Y2TA 2B8QA 3AQFA 1J5EJ 3CC4N 1OW5A 3KK7A 3ENWA 4FJ9A 2DR5A 3TO8A 1S1TA 2JX2A 4HACB 1FO1A 4OGEA 4KX3A 1W26A 1RILA 3GBTA 5J29A 1WC6A 4QCLA 2K7JA 3A0BU 1SXDA 9ICFA 1REVA 5GAEU 3WXKA 1MQ3A 4KKOA 2OZMA 3D6RA 4GC6A 5GMKa 3MWBA 2OD6A 3V7JA 2EHGA 2UU9F 2IC3B 2HMXA 5G0RA 1TK8A 3DDIA 4DSIA 2MQPA 4O44A 2MZQA 5KFXA 1O8BA 3QU9A 1IR1A 3CC7S 4OHVA 1F3FA 3MEGB 4RBTA 1J27A 4PAAA 3VF6A 4DQIA 2P9NB 1XR6A 4IR9A 2VDHA 2L08A 3CJ4A 3CJ7A 1JLQB 1SXLA 4O3NA 2XY5A 1K1QA 4A8WA 1QVGM 3P5TL 3NRBA 2XSFA 5MLCQ 5AKLA 1A7GE 4M47A 3CPWR 3CCQN 4Z6FA 3M9MB 4NA2A 1QHAA 2YTCA 3D6TB 4NYZA 4NPOA 1KVBA 2XBPA 5L46A 1U8WA 5HHIA 2FB0A 2FHJA 2FPKA 4A47A 3DOLA 5L1KA 4QZBA 3PEHA 5KT3A 1S1WA 2Y9HA 1DGSA 1QAJA 4F36A 3PM9A 2YCHA 3WNEA 2WUSA 1QHTA 5F1XA 4UY85 3D4JA 2U2FA 3THWA 5ELZA 4F02A 1YJ9S 2R2SA 5FJ4A 2NQPA 1LK5A 3NS5A 2ATQA 4X4RA 1U09A 4BDPA 2P5GA 4KO0B 4FWNA 2OLWA 3HVRA 1NK7A 4YMOA 1SC4B 4B9NA 2LEPA 2ZJ8A 4OV1A 5DLFA 4KV8B 3V1OA 4A57A 2YPZA 5AI9A 2K8BB 5J2FA 3EGWB 2KZZA 3QSIA 1U1OA 5F2RA 1GNKA 2FTRA 2UUWA 3FQLA 4A2AA 1B92A 3O5TB 4PPZA 1FA0A 4JV0A 2GVDA 2R7UA 1MG7A 3BF3A 1RZTA 4IZ9A 1RCHA 1I94K 2A3JA 1T03B 4PABA 1PBUA 4QYRA 4OI3A 1VQNN 1RZMA 3AV9A 3EXYA 3AY0A 4UZCA 4MKVA 4DR7F 4M5KA 1GXTA 4F71A 3OUYA 3VQ7A 4JI3K 1CZAN 3ED5A 1NOYA 1MW7A 2GGPB 2J7UA 5DGAA 2C3PA 4DUYJ 2F1FA 3MF5A 2F4FA 1P9YA 2YQ0A 1TKZB 2N4DA 3BF1A 1Z00A 1VC5A 5BRHA 2JVRA 1BI4A 1RI7A 3CCUS 4RLEA 1YITN 3H40A 1TVRA 4DKWA 4L74A 3U7JA 4JB8B 3VQ8A 2JHEA 4JI4J 3O1BA 4RQ1A 4L76A 2PFQA 3PX4A 2CJ9A 2DFEA 5KFEA 4IEIA 1JIHA 4WFAL 1UTAA 2CQ1A 4LT6A 3LDLA 3J7ZT 2DNRA 4DTPA 2JXJA 2HG4A 3LAMA 2YMQA 2EBGA 1RTHB 3IRWP 2CXYA 4H54A 3C6UB 2QO3A 2E2NA 4DX7A 1H7WA 5ETKA 3TUZC 3DOKA 1I6JA 2ZGYA 2F1IA 3HPGA 5DB6A 4AHCA 4B6JA 4AD6A 4DEZA 4DR2J 1XMOF 3C46A 2GS8A 3MN9A 4C8NA 1HBOA 2R42A 3PYEA 2F8KA 3KZBA 3F2CA 3AHPA 4CJ4A 1X7VA 4IG0B 2KKVA 1HNZJ 2DXEA 2RRDA 1BUPA 5L39A 1YZ7A 4DF4A 1JALA 3MUTP 2E2PA 1PVPA 3NGUA 5AQZA 4DL3A 4XH4A 3PW2A 2XSJA 1XIQA 2JLGA 4EP4A 3M8QA 1ATSA 3K9KA 3V9UA 1J5EF 1DKGD 4B9MA 1N0VC 1AA1B 3ISBA 2BRLA