4DS5A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mg2+
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 207
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds5A01
4H4MA 2ZUCA 1SUQA 3SV4A 8ICVA 4QZDA 2XY7A 4MQ3A 4E3SA 2G8HA 5KG0A 4NYFA 3TQ1A 5KFCA 3RRGA 3DOKA 4CERA 5DK5A 1TVAA 4M41A 3O3HA 4PHEA 1L3TA 3MR2A 4QW9A 3RB6A 4QZ8A 5KT4A 2HHUA 3WNEA 2ZTCA 5DG8A 4FO6A 3GIJA 1QTMA 5KFOA 3QEXA 5DB6A 1YVUA 3NGZA 1MQ3A 4N41A 5KFYA 3GV8B 4ECYA 4M9JA 5KI6A 4CK2A 4QWCA 4M2YA 4IQVA 4M9GA 1RT7A 4JK1A 2W9CA 4UAZA 1JLFA 2HHXA 4MFFA 3RJFA 4DOCA 3P5JA 2HNZA 4DL5A 3UXPA 3S3NA 4OKKA 1JIHA 4F5NA 3O3FA 4J2EA 3PW4A 3NH1A 3C2LA 7ICSA 4R5PA 1ZQJA 5KFNA 4DTSA 4FZXC 1ZYQA 4E7IA 4XIUA 9ICOA 3DLHA 1BHLA 4HVJA 5J0RA 1D9DA 4I2PA 3Q8LA 2UVUA 4KO0A 4CJSA 4KLUA 4Z6EA 4O0IA 2ITGA 3SI8A 4CEOA 4N5SA 1X9SA 3LZIA 3NCIA 4O4GA 1TKTA 2NRVA 4Z4CA 1ZQVA 4H4OA 3LWMA 1I3AA 4W5RA 3E2EA 1B22A 1HNVA 3L2QA 2XO7A 2ZTEA 2BPFA 4DO9A 1ZQAA 2OPPA 4CK1A 3AA4A 5DQGA 3ISBA 1WN7A 3K59A 2ISPA 5J0XA 5KTQA 4YVZA 5DBBA 1Y97A 1S10A 4J2BA 4ECSA 3DI6A 4I2JA 4ELTA 5EOZA 3HWTA 3TARA 5CJ7A 4CESA 1NOZA 4FS2A 4Q0BA 3WNHA 4W5OA 3ZT4A 4UAYA 3SNNA 2MAXA 3KHHA 1U4BA 4BWMA 1WCNA 2AGQA 4CJUA 3OYHA 4DFKA 1IM4A 4TUPA 3JPTA 4LD0A 1QS4A 3L2UA 3KLGA 2P6UA 4KREA 2UVRA 4RPZA 3IG1A 3KTQA 1Q8IA 1TK8A 3ORYA 4O55A 4CHYA 1XS9D 1HYSA 1ZQDA 2X6SA 3TFRA 4ED0A 4JV0A 4GVMA 3DOLA 3KK2A 3DRRA 2ALZA 4YFUA 1XSLA 4CFCA 1ASWA 4ED8A 2AQ0A 3V7JA 4ZTFA 5J2QA 4HTUA 5KFSA 5FRNA 2V4QA 4LY7A 4BWJA 4DOBA 3TAQA 2OA8A 4ECUA 3KLHA 4E7HA 4Q44A 2PXIA 2ZUDA 1F21A 3PX0A 5JS1A 4RQ5A 1SL2A 4RQ7A 1KLMA 3JYTA 4IQTA 3H40A 8ICMA 4J9QA 5J0PA 3MDAA 1ZBIA 4I9LA 1RYRA 3IHQB 5J2BA 3M8QA 4ECVA 3TFSA 4N47A 4K8XA 4JV2A 8ICEA 1J9AA 3NGDA 5CHGA 4E89A 3QZ7A 3OSNA 1T8EA 1MU2A 5I3UA 2W42A 1UT5A 2IDOA 3H8JA 3S3MA 4QWBA 1N56A 4PUOA 4CF0A 1UWBA 4CJKA 4BACA 4MFAA 3HX0A 4DS5A 5HP1A 2VG6A 3BQ0A 4FM0A 3TAFA 5KG1A 4AHRA 3V7KA 3ZDEA 3SQ1A 4Y1CA 5KT5A 5J1EA 4FJ5A 1NJYA 9ICPA 3LANA 5HMLA 3CFPA 3RMDA 4J2DA 5L9XA 3SPZA 4YG2A 1SL1A 1KEJA 1WSHA 1XSPA 4M3RA 4KLJA 7ICGA 1A77A 4CJ4A 3Q8RB 2VA8A 4LSNA 1BPZA 3N97B 5CA7A 2DY4A 1KVBA 4EP4A 3LP2A 2HHWA 1ZQIA 7ICEA 3DLEA 1TKXA 3RBDA 4PY5A 2OPRA 3B6PA 4DL2A 4FLYA 2BGWA 3MFIA 4I7FA 5KFQA 5KFHA 5SWMA 1GOCA 3HYFA 7ICHA 2JEIA 4KMUA 2FLNA 3BQ1A 2IMWP 2D0CA 2BCRA 2PFOA 2RKIA 3KHGA 3VQQA 1CZBA 1HMVA 3QZ8A 4KLMA 3QINA 4OKJA 4I2IA 5DGBA 4YN4A 4M04A 3KKRA 4YD1A 4GW6A 5KT6A 3B0YA 3OY9A 3V9ZA 4IG0A 1SKRA 1VSFA 4Z4EA 5J2IA 4FK0A 1DGSA 4B9UA 3PX4A 1GOBA 3MEEA 1FXXA 4UQGA 2QXFA 4KHNA 4PHPA 1S9GA 3RAQA 1Z3EB 4DTUA 2C22A 1ZQYA 4DL3A 4KFBA 1HJRA 3JPPA 5KFPA 1RCHA 5HRSA 4M9NA 3H4BA 2J6UA 4CF8A 3F73A 2QKBA 3M9NB 2IA6A 1LW2A 2DFEA 4RQ6A 1KFSA 1RILA 1TFRA 4UB4A 1G15A 4F4ZA 4E7JA 4CJFA 4R8UA 3OJSA 4DSFA 5CZ2A 3TAPA 5TZVA 3MEDA 1JL2A 1U49A 3EPIA 1NK4A 3T3FA 2D0BA 4J9KA 4JV1A 4NCGA 5IIKA 3M9OB 7ICQA 3VQEA 3RBEA 3ZSRA 1B9DA 4F50A 2NUBA 4NY8A 1AROP 1EKEA 3V1QA 3RH5A 4CHOA 4X5VA 4RUAA 1U04A 3VQDA 1S76D 5F9NA 2W9AA 4IQUA 5IINA 2AGOA 3AVGA 3MR3A 3O4QA 5CZ1A 4EBCA 3KD1E 1T3NA 5CB1A 4O44A 2AQ4A 4OPKA 4FJXA 4DG1A 4P4PA 4AHUA 3N4MB 4OLAA 3LPUA 9ICBA 3AVIA 4M3ZA 4F3OA 2HNDA 3QEVA 3PX6A 4FZYA 4ECRA 1GOAA 1RT4A 5CP2A 4B3OA 3V72A 9ICQA 2VWKA 2ISOA 5J0QA 1V9PA 1T05A 1T4GA 2RN2A 5KFJA 4I2EA 3OHAA 4DEZA 5D4BA 2YHBA 4CEZA 2PYJA 1KCFA 5DDYA 4UBCA 5KFUA 1O1WA 3CM5A 3GV7B 3ZSZA 2FMPA 1NOMA 5KFVA 2BCVA 2R8GA 4QW8A 4QOZB 3SQ4A 3BQ2A 2BANA 4NXZA 3QLHA 2Q0ZX 3MGHA 4NLKA 2YNIA 1HYZA 4F5RA 3V81A 4QZCA 1UA1A 1MC8A 5HNKA 4CIEA 4Q8FA 8ICFA 5KFGA 3ZD9A 1REVA 1HQUA 4DF8A 4K4IA 4M6WB 2KTQA 3RRHA 4ELVA 3TAMA 1HYVA 3LZJA 4RQ2A 1ZQZA 2XC9A 1VSJA 1TAQA 1NKCA 4CHQA 4RPXA 2NRZA 2VA3A 3K58A 2Z1IA 4HUFA 4FLTA 5KFEA 4KITB 3G6XA 1VSLA 2C2EA 1ZQCA 2Z1GA 4P2HA 3AU6A 9ICMA 4CF2A 4I2GA 4BE1A 4DTPA 1JN3A 5DG9A 1T7PA 1BPYA 4C8KA 2WONA 3C1YA 3H8WA 4MF2A 2G8FA 5J2CA 1XWLA 4ED1A 4ECZA 2ETJA 4OLBA 1XHXA 5HRPA 3RJHA 1NK6A 2HMIA 4TQRA 4KAZA 4DFMA 3V9UA 3HXMA 3ZT1A 5C24A 2V9WA 4RT2A 4TUSA 2G8IA 2HVIA 3H4DA 1JMSA 4LH5A 4M9HA 5FDLA 3T19A 1KTQA 7ICUA 1IKYA 1HJPA 4JLHA 1C0MA 2JZBA 3HL8A 3U6FA 4Z4IA 3OYAA 3QESA 3K5LA 1ZQFA 4FCYA 2JZBB 2A1JA 4RW7A 1S1TA 3GIMA 5DBAA 1ZBLA 8ICQA 4DSEA 5KG4A 2XGQA 4PHAA 2P1JA 4O3NA 4NCAA 5J2AA 3NGIA 4AHVA 4O3RA 3QIPA 5DLGA 7ICFA 4F5OA 1IKVA 1RT6A 5I42A 3KIOA 4YXJA 4NLGA 2ATLA 4MEXA 1ZQEA 1QQCA 4JWMA 3MECA 5KFKA 3SUOA 5J0UA 1RBRA 3K5OA 3OYCA 5DB7A 3H8SA 1ZQTA 4FJMA 4QZEA 3RMBA 3C2MA 8ICSA 3O3GA 3ZT0A 5HRRA 8ICJA 3EWAA 3KK1A 4RQ8A 4F2SA 4BDZA 2OWOA 2GBZA 4DQRA 4I2HA 4E1MA 3UXOA 2PFQA 4RG8A 4YR2A 2G8UA 4RUCA 1FK9A 1ZQWA 1RXWA 4IKFA 7ICLA 1ZQOA 9ICIA 5SZTA 4J9LA 3O4NA 2IGIA 2RF2A 1L5UA 8ICLA 2Z1JA 4IFYA 4LSLA 4EP5A 2O4IA 1BGXT 4HCBA 5KG2A 4IRDA 2F8SA 5DKWA 4RNMA 1VSEA 4QZGA 3SJJA 1KLNA 2XY6A 1VSHA 4CEFA 5KG6A 4XA5A 2ZE2A 1TK5A 3LAMA 5JS2A 4QZAA 4CGDA 1XO1A 1NK8A 1WNSA 2HHQA 3RH6A 5L1LA 1JLBA 3PO4A 3NAEA 4DQSA 8ICAA 2BQRA 2FLPA 1T03A 4QAGA 1CUKA 4YQWA 3HPHA 4C8MA 5KFDA 4YMMA 4RQ0A 4KLTA 4KI6A 3AA3A 1QSSA 4FZZA 1S5JA 2BCQA 3QEAZ 2BPGA 4I2QA 4TQSA 3NE6A 1VRUA 1HUZA 9ICEA 3JSMA 4PA1A 3G6VA 5L1KA 3T5KA 1S1WA 1IKXA 3PNCA 4YCXA 9ICVA 4BGDA 1NK5A 4DSKA 3EYZA 1ZJNA 3OYBA 4CFAA 4CF9A 3MXIA 4PQUA 4CGIA 2HVHA 4DSLA 4B8AB 2R8IA 4KB1A 4LZDA 3RJKA 5KFFA 2BQ3A 1JL1A 2G8VA 2X6NA 3K75D 3OS1A 3C94A 3RAXA 1JLAA 4DMNA 3GIKA 2M9NA 4TUQA 3VQBA 3AO3A 5KT3A 2R8JA 3LDSA 2ASDA 3GDXA 3AVKA 5J2JA 3L2VA 1JLGA 4CHNA 3OYGA 5J2HA 1Z25A 3C95A 1I39A 1BIUA 3L3UA 4WE1A 2P5GA 1RDCA 1ZQKA 3PVXA 4ECTA 5KFIA 2NRWA 3S3OA 4AH9A 4YP3A 4RPYA 2YHAA 5KFZA 4FS1A 4I29A 5K14A 5BPCA 3L3VA 1X1PA 4KHSA 5DGAA 1WSFA 1DTTA 4QCLA 2HB5A 1FKPA 2ZD1A 4CGHA 4FVMA 4B8CA 4CECA 3RB3A 4E0DA 3V6KA 3T5HA 4N56A 1N48A 3NH0A 3LP3A 1JXBA 3HK2A 1BCMA 9ICLA 2IHMA 4GXKA 1LAVA 1EXNA 2IHNA 4OPJA 3AVJA 4FJNA 3DRPA 1NJWA 4NM2A 3P83D 3ISDA 3NHGA 3ETLA 2G8WA 2PI5A 4MEYA 4QZIA 1UA0A 1BPXA 3JPNA 4EYHB 2VG5A 1C1BA 4GXIA 2OZSA 2V4RA 4F4YA 4DU4A 3G10A 4J9OA 2R7YA 5J0WA 5L1IA 1RT3A 3C2KA 4O0JA 1QLNA 4PGXA 2E6MA 4W5QA 1COOA 4DQPA 5J2EA 1S97A 4O3QA 4DTRA 4I27A 5J29A 4KLLA 4QWDA 3HW8A 2W9MA 2WOMA 4F5QA 3S9HA 1BCOA 9ICHA 4M3XA 1K1SA 2XCAA 4PHDA 4C8LA 4FW2A 2D0AA 4KLQA 5FRMA 4UB3A 3ITHA 4FJJA 4C8OA 2IS3A 1UAXA 3QE9Y 4RQ3A 3SYZA 3RB4A 3D45A 3Q8SB 2G8KA 3UQ0A 4IFVA 2LYHA 4DS4A 3HVRA 2RPIA 3MR6A 2OYQA 3VQCA 3U3YA 3LP1A 2FPKA 1K1QA 1L3UA 4JRPA 4JRQA 4CE9A 5J2DA 4RQ4A 2F96A 2PFNA 5C5JA 4OVLA 3C6TA 4IRCA 3NF6A 3PW0A 1S0NA 3I8DA 5J0OA 3AVMA 1A76A 2AJQA 1SV5A 1NJZA 3ULDA 3SUNA 3QEIA 2KW4A 1ITGA 4ECXA 2DTUA 1S6QA 3KLEA 5EWFA 1UT8A 4I2BA 3ZDAA 1MQ2A 2F1HA 1L3VA 4EZ9A 5KT7A 1BQMA 3OYDA 3DLRA 2YNFA 3AVFA 2FPMA 3K4GA 2PZSA 2QK9A 4BDPA 1KFTA 1BPBA 4UB5A 4ECQA 3QNNA 1XC9A 3AO5A 1ZQRA 5KFXA 4KPYA 2C2DA 4O3OA 4YR3A 5HLFA 1JLQA 4E7LA 1HRHA 2ZQBA 4J2AA 3GIIA 3SI6A 1D8YA 3UQ2A 4I2DA 5J2GA 3RMAA 1KRPA 1JLCA 5FROA 2IAJA 4HHTA 5DDMA 1RDDA 3PY8A 2W9BB 4Y1DA 4KLFA 4XRHA 1CLQA 1S6PA 7ICRA 2AU0A 3C5FA 2HNYA 3PW7A 2B5JA 1DLOA 5KFTA 3G0ZA 1RTIA 2FPLA 3V4IA 5HRNA 4FJHA 2QKKA 3ISNC 4Q45A 4P4MA 4UB2A 1TGOA 3JPSA 4Z6FA 4NLNA 3PW2A 2DFFA 1DOQA 1WLJA 4GC7A 4KLEA 2BE2A 4YNQA 2BCUA 2E6LA 3PR4A 2DFHA 4BE0A 1LWEA 3QEPA 2J6TA 1XSNA 1BVSA 8ICOA 1TKDA 3AV9A 2YV0X 2X78A 1EX4A 1NK9A 5KRTA 3C5GA 4ID5A 5KGXA 3WNGA 3RMCA 3KHLA 4O3SA 2RDIA 3VA0A 1IXRA 1B43A 9ICAA 4FM2A 3HVTA 3MABA 3GV5B 1QSLA 3TAGA 2IOCA 3HPOA 4FJLA 8ICGA 1SL0A 2B6AA 1RDAA 1Q9XA 3C21A 4KV8A 4DWIA 2HHSA 5KGWA 1IO2A 7ICNA 3PO5A 4M3UA 4KTQA 4KTWA 3CQ8A 5J2NA 1LB2B 1ZQBA 4ED7A 1BI4A 3PMLA 2GV9A 3AVHA 4M6WA 1J5OA 2FBYA 1C0UA 4CEAA 1VK0A 4GMJB 1D8LA 2ZTDA 1BI4B 3PUFA 5J0YA 4RW4A 4G1QA 4RW6A 3OHBA 1X9WA 4Z4GA 3SZ2A 4QZFA 2A1SA 3QEWA 7ICMA 4BDYA 3LP0A 1B92A 5KG7A 1MSWD 1EP4A 2GWSA 4QZ9A 4F2RA 3V1RA 2I9GA 3T5LA 4DSIA 4F4XA 4R63A 4DLEA 3AA5X 3RWUA 3ZSYA 2KZZA 4CEDA 3NGYA 2PI4A 3ZSWA 1RPLA 4GLXA 1B9FA 2R8HA 1JXEA 9ICKA 3ZSVA 2HHVA 4YR0A 4YMNA 4LZGA 4ED2A 3CFRA 4Z6CA 2KZ3A 4DTJA 4J9RA 7ICKA 3OYNA 2HW3A 3AUOA 3VQ8A 1Z00A 4YD2A 1CXUA 2O4GA 3HSTB 4Q5VA 2OPQA 4RW8A 1CZ9A 2IBKA 2IC3A 3C23A 1Z00B 3HM9A 2BR0A 2FBXA 1VSIA 4J9MA 3TABA 2BKEA 3JPQA 4AHTA 2JEJA 5KFWA 1ZQGA 4DL4A 5CYQA 1RBVA 3MBYA 2VG7A 4B9LA 2FLLA 4CGJA 4FK2A 1RXVA 3DLGA 4DTNA 3JPRA 1BL3A 1WAJA 1D5AA 3BDPA 3T5JA 1D9FA 4NLZA 4KHUA 3U3GA 4ED6A 2FBTA 3HP6A 9ICJA 4KHQA 2MUTA 4YFKA 1ZJMA 4KRFA 3K5NA 4F3TA 4QWEA 1RTJA 4CJRA 3SV3A 3TI0A 2BGGA 2MUTB 3RJGA 4OKEA 4M0AA 3QNOA 1HQEA 3C1ZA 5KRSA 5KG3A 2XHBA 1CEZA 3SUQA 1J53A 2FMQA 5HMMA 2DPJA 2VANA 1YTAA 3TAEA 2B4JA 8ICNA 4IR9A 2YNHA 1TK0A 3OYMA 1Q9YA 4O5EA 4KHWA 1U45A 1NK7A 3BQTA 9ICCA 1S1VA 3AO1A 4CEEA 1HNIA 3HJFA 8ICPA 3AVLA 1JXLA 3BGRA 1S0OA 3OYKA 4CJTA 3MR5A 4F5PA 4CEQA 4RNNA 5HBMA 3A2FA 2EHGA 5KT2A 3LALA 9ICXA 3OYFA 3SPYA 2F1IA 1FKOA 4B9VA 9ICSA 3VQ9A 5KFLA 1WSIA 1ZQHA 1TV9A 1YTUA 2BHNA 4J9PA 2XY8A 2YKMA 3M8PA 3VA3A 4HUEA 4K8ZA 2PY5A 4DQQA 4M45A 3VN5A 1RTDA 4B9NA 2ZUBA 1ZQNA 1RBTA 1XHZA 1KVCA 4DSJA 2W9CB 4FYDA 2ZJAA 3PW5A 1BIZA 1R0AA 3OYLA 3HP9A 1TKZA 4QZHA 1NJXA 4CFBA 3HT3A 2VA2A 5IIJA 2JEFA 3AVAA 4ZH4A 4Z0UA 1SZPA 2OZMA 1IH7A 3NF9A 8ICWA 3K2PA 4J9SA 3VQ6A 4M3WA 1A5XA 1BPDA 1JLEA 4FLVA 4CIGA 4RNOA 3RB0A 7ICPA 3ZSQA 4K4GA 4FW1A 1QSYA 4F91B 1LWFA 3AO4A 5DMRA 1VSKA 2PYLA 3FYHA 1K6YA 3RTVA 5C42A 1U48A 1S1UA 8ICKA 3GFKB 3TANA 1S0VA 4FJ8A 2BQUA 2BDPA 1ZQXA 2OPSA 3H08A 1C7YA 8ICZA 1S77D 4B9SA 1LAWA 3MGIA 4F92B 4I9QA 4CGFA 4I2FA 3KKSA 5DQHA 1RT5A 3L2WA 2NRTA 1A5VA 4L8RB 5BOLA 7ICIA 9ICUA 1VSDA 2DPIA 3NDKA 4N76A 4ZTJA 4CJLA 4CJ5A 5J2PA 1QHTA 3UIQA 4CJPA 3Q8PB 1XU4A 2C28A 4DL7A 4ZHRA 4IDKA 4H8KA 1ZBHA 3MXJA 3MDCA 4RZRA 4FJGA 4OGCA 3ZT2A 4JS4A 8ICYA 3IS9A 1IKWA 1WSEA 1X2IA 4Z4HA 3IM1A 4O3PA 3DMJA 3B0XA 3I0RA 2P51A 3UPQA 3EW9A 5D46A 5KFMA 5CYMA 4DQIA 2B21A 5EU7A 4K4HA 9ICRA 4KLDA 3B6OA 4ICLA 4B08A 1LW0A 1L3SA 3AU2A 5KG5A 3KLIA 3M8RA 5EWEA 4GC6A 2KQ2A 3DYAA 4BE2A 4DFPA 4FJ9A 7ICTA 4R65A 4FLXA 1ZQLA 3AVNA 4M3TA 3JPOA 1TV6A 9ICTA 4NM1A 4CJ3A 3OJUA 3RH4A 3VQ4A 1S9FA 1S1XA 1SKSA 3VQPA 1EETA 4EZ6A 3OS2A 2A1RA 3SQ2A 2GUIA 2HHTA 8ICCA 3V9SA 3MXMA 2YKNA 5DB9A 1WCLA 7ICJA 3DLBA 4Q43A 1BQNA 3E01A 3WNFA 5DQIA 2JLEA 3V6DA 2NRXA 4FXDA 1ZQQA 3ALYA 3H7IA 3BJYA 2AGPA 4MFCA 1H38A 4J9NA 1JKHA 4LH4A 3V1OA 2I1QA 1KSPA 4E19A 2KZMA 3DLKA 3V6JA 1TL1A 5IIMA 4QWAA 2J6SA 4OGEA 3EPGA 4CJQA 5J0SA 4AHCA 1ZETA 2UVWA 3THVA 1HUOA 3QIOA 4W5TA 2RDJA 3KHRA 2Y1JA 1LV5A 4UB1A 4DU3A 5CR0A 1ASUA 3CM6A 3D0PA 4RT3A 4FLUA 4MFBA 3F9KA 5JUMA 7ICVA 3EY1A 3ZSXA 5J2FA 4PGYA 4KHYA 4IBNA 3TWHA 2P5OA 3OSPA 5DB8A 4XUSA 4CJWA 4UAWA 3L2RA 4UBBA 1A5WA 2UVVA 3EZ5A 3IRXA 4CEBA 3AVCA 3NTUA 3ZD8A 4OJRA 3NFAA 5DBCA 1KDHA 4FBTA 4LVSA 4FLWA 4CGGA 4CIFA 3MAQA 2KFNA 2ZJ8A 3ZDBA 1J54A 3GQCA 4ECWA 5EWGA 5CY4A 4Q8EA 3K5MA 2W9BA 4XQ8A 4YXMA 1N5YA 1S0MA 1PZNA 2XRIA 1Z26A 5HROA 1TAUA 2FC0A 4KB0A 3K57A 5HP4A 1ZQMA 5J0TA 3RJEA 4HYKA 1C0TA 3QERA 1NKBA 4DFJA 7ICOA 1BPEA 5KFAA 1IG9A 2LSNA 4P4OA 4R64A 3PMNA 4M47A 3GILA 3CFOA 2WTFA 4TSXA 3NF8A 1ZBFA 4E7KA 4CK3A 4DLGA 5L1JA 1WAFA 4DOAA 1WSGA 3OYIA 1RZTA 3NH2A 4DTXA 1X9MA 1N6QA 4NCBA 3FFIA 2XY5A 4FM1A 1XI1A 4R8UB 3LPTA 2W8LA 4CJEA 1RDBA 4DTMA 3NBPA 1UOCA 4PPXA 2DFLA 3M8SA 3P1GA 4IG3A 1NOYA 4FJ7A 8ICHA 4KN4A 1C6VA 3IAYA 4KLSA 2Z1HA 3KJVA 4DTOA 1RBSA 4FJKA 5D3GA 2P6RA 2YNGA 3AO2A 4RQ1A 3ISCA 1VRTA 1VSMA 5KFRA 3KK3A 5IILA 4PH5A 2I5JA 1C1CA 1U47A 4CJVA 3UXNA 3OGUA 1TL3A 8ICUA 8ICTA 4F93B 4KLGA 1C1AA 4IR1A 2EX3A 4B9TA 4JWNA 3VQ5A 4IRKA 8ICXA 1SKWA 5HHIA 3VQ7A 3OS0A 4B9MA 3RR8A 4DU1A 3M9MB 1RTHA 1RNHA 4FK4A 3Q8MA 1ZBUA 2ZJ5A 4ELUA 5IIOA 3PR5B 4F8RA 3ZT3A 4RU9A 2BPCA 2H5XA 3LWLA 4NYNA 2E4LA 4AHSA 1RBUA 2XGPA 5BOMA 5D49A 5J2MA 4DF4A 4I2AA 2F8TA 3QETA 3SUPA 4I2CA 3QO9A 4IQWA 4HCCA 2Q3SA 3NF7A 1KFDA 4TURA 4RW9A 4DL6A 1ZQUA 3T1AA 4BXOA 2JEGA 3I0SA 4ID1A 1HPZA 1EXQA 3AA2A 3OVNA 3OYEA 4I28A 4EBDA 3HO1A 3LK9A 3DRSA 4F4KA 4KLOA 9ICNA 3CYMA 3RJIA 5DG7A 4BXOB 3HPGA 1ZQSA 2F1JA 4O5BA 9ICGA 1S9EA 2KN7A 3V6HA 4R66A 4G3IA 9ICFA 3QEBZ 4F4WA 4O5CA 3V9XA 2KFZA 1U9LA 1RYSA 4FJIA 2ASLA 1ZQPA 3SCXA 4AILC 5KFBA 1NKEA 4GXJA 4CHZA 5T7BA 1ASVA 5CWRA 3V9WA 4CF1A 1Y88A 3MFHA 5E41A 5F9LA 2R8KA 3L8BA 3KD5E 3ZDDA 3LAKA 3ZSOA 3V7LA 5DLFA 8ICIA 9ICWA 1YT3A 3FDSA 4EEYA 3C6UA 4KTZA 2FBVA 1TVRA 3RR7A 4KLHA 4M9LA 3DM2A 4KI4A 4ED3A 4M3YA 4CFDA 3KLFA 8ICBA 3PV8A 5J2KA 4KKOA 1BISA 1RT2A 3G6YA 1RT1A 4KN7A 5C25A 2W8KA 4QZBA 4JS5A 2Y1IA 4EYIB 2X74A 4KLIA 3TR8A 1LWCA 4JUZA 3ZDCA 3SQ0A 4CHPA 4FLZA 4CCHA 4C8NA 4Z6DA 1NK0A 4HUGA 2VWJA 4PWDA 3Q8QB 3ASMA 4Z4FA 1CXQA 2ASJA 1W9HA 3OYJA 1W0HA 4PGQA 2P66A 2PFPA 3RJJA 3ZCMA 4MF8A 2C2RA 4E1NA 4YMOA 4O5KA 3CG7A 1WSJA 4EBEA 3MEGA 3VQAA 2BCSA 8ICRA 3Q8KA 1DTQA 2A1JB 4M42A 2FMSA 5HHHA 4W5NA 1QE1A 3AVBA 4O9MA 2D5RA 3LDAA 1KVAA 2XCPA 2JGUA 4FBUA 5IIIA 2ATQA 1JX4A
chains in the Genus database with same CATH superfamily
3NWRA 1VQON 4H4MA 1M90O 1W26A 2VIHA 4FWKA 3OV7A 1A9NB 3DXKB 2KT3A 2G5HB 1TUVA 1RAJA 3POTB 3SEIA 2G8HA 3CC4N 2V52B 2E1YA 3DJCA 5BR9A 3R6MA 1U25A 4V19X 3NGSA 4LRDA 1TVAA 4FDFA 2F9JA 2PMZD 4QW9A 4KH6A 3DOKB 5DG8A 1QTMA 5E3PA 3J81j 1MA7A 4CD1A 1YVUA 1HBNA 1W2IA 2EW9A 4N41A 2RDDA 1EAYC 2AD9A 4IQVA 2KJ8A 4JK1A 2W9CA 1VR6A 4UW9A 2OFHX 2HHXA 4DOCA 3OTDA 4DL5A 3UXPA 1TAMA 4OKKA 3O9TA 1JNZB 2F7VA 3DGPA 3O3FA 1E4FT 1VQLS 4USHA 2ZM6K 3C2LA 7ICSA 2HNZB 3QSIA 1RWXB 1M5HA 4DUZF 4E7IA 9ICOA 2ZE2B 3CT9A 4CZHA 5J0RA 5IM0A 3L7UA 4R5PB 2UVUA 2IVNA 4PG6A 4CZKA 1X5PA 1Q7YT 2XICA 1NU0A 4O0IA 2ITGA 2G5IB 2J7KA 4N5SA 3LZIA 2V51B 1SIZA 3K89A 3NCIA 4KO0B 2BEFA 3ILLA 1TKTA 2FJDB 3OPKA 1EARA 3W1YC 1B22A 2OTLS 4K8RA 5IWAF 1P1TA 2B56A 1FDAA 3WK5A 3RSEA 2XSFA 2RP5A 4O4GB 2GCFA 2G1HA 1JCEA 1ZQAA 4PQUB 3PFEA 2VPZB 3FRYA 2RHQB 4L76A 3WEEB 4UOFA 1X4FA 2DQNB 1N4LA 4I2JA 1SC6A 3P5BP 4ANEA 4KGXB 4Q0BA 4CESA 1NOZA 3G8QA 3W9IA 1YJVA 2W41A 4ZLPA 1B4SA 2IHR1 2GIFA 3W7BA 4BWMA 1NSPA 2WC9A 2AGQA 4JKAA 2CWKA 1KW4A 2Z58B 3IC1A 4K4TA 4RNHA 2GVZA 4LD0A 4DV0K 3JAMO 4KREA 1APSA 1Q8IA 3ORYA 1W25A 3A3PB 2GW8A 1YVNA 3Q89A 4P73A 3VGLA 3KLGB 4IKAA 2X6SA 2X1GA 3EGWB 3KKAA 3UVJB 5K14B 3W3DA 2LEPA 2DXFA 2EK6A 4C48A 5EE9A 2J7UA 4HTLA 3DOLB 4AYBF 1JJHA 2QM1A 4ZDNA 4QS7A 2HOEA 4CF3A 4LY7A 5HQ8A 3QNWB 3TAQA 1WJ9A 1NGFA 2PXIA 2OANA 1OYEA 3CO9A 1F21A 2R2SA 4RQ5A 3EMTA 3SQOP 1SC3B 3F0NA 3R27A 4OI2A 3KMSA 1YBTA 3OFEA 3JTNA 1ZBIA 5ETOA 1KLMB 4W98A 1BD6A 3JYTB 1G99A 3M8QA 4ECVA 3TFSA 2HS0A 1N52B 4K8XA 2VG5B 3KK7A 2ZXIA 3TUZC 3HHLD 3BSCA 3F56A 5ALDA 1CRXA 1KWMA 3DFEA 4DPOA 5K8MA 1UT5A 4OYXA 4AQYJ 2AT1B 3H8JA 5ETTA 3W65A 5AKJA 4PUOA 3ENBA 2WW4A 2WFBA 1UWBA 1UVLA 1U1KA 3VGTA 1VRQC 4LRFA 2Z0GA 2M8DB 4AHRA 1YRTA 1IIPA 4GVLA 1J2NA 4Y1CA 2HVEA 5JRTA 1NJYA 1U26A 5AM5A 2QEXS 2AH5A 1HNWJ 2XVTA 4YOYA 4C7ZA 3RMDA 2KYZA 4ZPDA 4ZP9A 3CB4A 4TLQA 4C11A 4IS7A 4UB8U 7ICGA 3Q8RB 1BPZA 3N97B 2B9XA 2OP5A 1KVBA 2Z56B 1ZQIA 2OEJA 5G0RB 1B0PA 2K8CB 1UHUA 3OTEA 3B6PA 3CDEA 1HBMA 2BGWA 3MFIA 4I7FA 1GOCA 3NMUA 3JB9k 1JRPA 4LVNP 4KMUA 1F5SA 3BQ1A 2JVRA 2ASOA 3T1YJ 2OPRB 1BUPA 2PFOA 3O44A 3BN4A 2PEHA 2RKIA 3KHGA 2P35A 2HHHJ 2VOPA 3NGKA 3TOQA 1AXQA 1FVQA 3FGUA 4EO6A 1Z1BA 1Z19A 4P52A 2HPUA 4OHVA 4ZJLA 3LOUA 4MO5A 1FO4A 3TX8A 1SKRA 2JH1A 4DXLA 4DV6K 1BQMB 4FK0A 3AN1A 2JRZA 1RWVB 3A5LC 1GOBA 3MEEA 5EY4A 4NL9C 1Z3EB 1MWQA 4DL3A 2N82B 2KHVA 5KFPA 5C0YA 1Q16B 2VBZA 5HRSA 2YQEA 2VUGA 1LW2A 2XNQA 2MJUA 2DFEA 5JVHL 4DV5F 4DPWA 3EZOA 3ZXWA 2E5IA 4QPTA 5FPMA 4DSFA 4EENA 3MMAB 3B54A 5BREA 3MEDA 1NRKA 4WF9L 4LJXA 3BUZB 4KHPF 4H0TB 2MYFA 3GG0A 2D0BA 2VB6A 4J9KA 4NCGA 3M9OB 3VQEA 3JS9A 1UJ5A 4QIWD 4CHOA 1X9XA 2BJ8A 2HNYB 3F2CA 4U8YA 4EMDA 2W9AA 1SCJB 5B8HA 1VQLN 4Y34A 3MR3A 1KVJA 3O4QA 3KD1E 2M88A 1WEYA 4PWUA 4P4PA 5KOWA 4AHUA 3N4MB 9ICBA 3DLLL 4M3ZA 4PKGA 4F3OA 3LW5C 3BGOP 3R9LA 4FYYB 9ICQA 2ISOA 5J0QA 3HD2A 1V9PA 1LFPA 1T05A 2W03A 1RZMA 5KFJA 4BR9A 3AT1B 3H8MA 3OHAA 1FEEA 2FHJA 3MMCA 2PA3A 4Q7AA 3FM9A 2OMLA 4ID5B 5D0HA 2OTLN 3HDSA 5E7OB 1RXOB 1MA9B 1HR0F 1S22A 2BMBA 3H5SA 4DZDA 2Q3PA 1SGGA 3QLHA 1V5IB 1BXNA 3FBCA 5AIBA 3MGHA 4NLKA 2YNIA 2MPUA 1HYZA 2CDRB 3V81A 4QZCA 2ABYA 3HZGA 1UA1A 1CULA 1T6CA 2E1FA 8ICFA 4F0MA 4DF8A 2QW9A 2KTQA 3TAMA 1J5OB 2CIMA 3RJMB 2R2UA 4RQ2A 1C0UB 1KL9A 1ZQZA 3D3BJ 4GVEA 4M5KA 2K06A 2W7AA 5D4LA 4KITB 1S57A 2LQ8A 2LA4A 4A8MP 4FSVA 3G6XA 5FP0A 1L7PA 4PQAA 4BS2A 3UM9A 1GFWB 1ZQCA 5AQQA 2MA1A 4YB6A 2LECA 2E5SA 1GMUA 2YX1A 1OY6A 4B3SF 4HT5A 5J8YC 4CBWA 4M95A 1E3MA 4U67L 2YX4A 2QXLA 1DBDA 4MF2A 1WUDA 1SB6A 1RDFA 2HAFA 2MKYA 1XHXA 1UPPA 2FI1A 1NK6A 2HMIA 1FFWB 3J7YI 3C15A 2B9YA 1QVFR 5C24A 4DKWA 4C4SA 4RT2A 4CLTA 4TUSA 1GEHA 3EDRB 4B3RJ 4RUBA 1F2GA 2DNGA 1JMSA 3T19A 1KTQA 1IKYA 1XK8A 1GLJO 2EZXA 3OL7A 3G96A 4CLFA 4G6VB 2F9TA 3HL8A 4PKIA 3N5FA 2E88A 3D1QA 1IUJA 3OYAA 1ZQFA 4H0PA 3UKUB 2JZBB 3KJFB 1UWAA 4IL6U 1YITS 2FSJA 3GIMA 2FSKA 4RR5A 3PRDA 1VISA 1SWWA 4LFCJ 5CHCB 3NGIA 2OO4A 2QWRA 2DUYA 1QY7A 1DKGD 2QEXN 1OJ4A 2EFVA 2CA9A 1X42A 4MEXA 1IKVB 1SC4B 3K8WA 1ZXOA 4PEOA 4YORA 5LMUK 5J0UA 5DB7A 2H3VA 4L3NA 3WK4A 4QZEA 3RMBA 3FQKA 1X5OA 4K25A 2HSEB 2DNKA 2WF9A 5EGYA 3EGZA 2GBZA 4DQRA 1RWWB 4E1MA 2WB1F 5DETA 3CF5L 4RG8A 4YR2A 1FK9A 3KK1B 4IKFA 3CCLS 7ICLA 2A19A 1S79A 1ZQOA 3QJLA 1IJEB 3QRRA 5SZTA 3K1RB 3ONQA 5MLCV 1IN0A 3O4NA 4O4RA 2RF2A 2O4IA 1E6YB 1BGXT 4HCBA 4IRDA 1S1VB 3AARA 1TU0B 4ILMA 1JJ2R 3HZ6A 2G2OA 2V0NA 5DKWA 2RQKA 5DZ6A 1KAXA 4YN3B 4IFYB 3C3LA 4QZGA 1QAXA 5A8WB 1KLNA 1WHWA 4FZVA 3D2QA 1I1GA 1TK5A 5I3QA 2VQFJ 1QHAA 3U02A 2UXBK 1NK8A 3RH6A 1J5EF 3PO4A 1HX1A 1XQIA 3A0BU 1T03A 3HPHA 4UY85 3NY0A 4DL0C 5KFDA 4E98A 4FZZA 4G9ZA 1CQMA 4TQSA 3NE6A 1Z4NA 4LR7A 5GTHU 4PA1A 4FPAA 2H65B 5L1KA 1FTCA 1HBOA 1ZZNA 3Q83A 3UMGA 4WBFA 2RS8A 4CFAA 3MXIA 3I28A 5AQXA 1IKXB 1XMOK 4MK7A 4IWVA 3W2VB 1ESVA 2OSRA 3RAXA 1VI7A 3GP9A 1JLAA 1L6NA 5IOLA 5K8OA 4TUQA 2E5LF 3H1QA 3VQBA 3OL9A 3VMFB 5KT3A 1HBUB 2ASDA 3A12A 3AVKA 2QWMA 3L2VA 1JLGA 1VBZA 2CGJA 5J2HA 1K8AO 1I39A 4OHXA 2KP7A 4JKEA 1ZQKA 5C42B 3HHLC 5IV4A 3S3OA 4AH9A 4PXDA 2JZ5A 4B3TF 4WE1B 2ZF5O 2IOHA 3JAMY 1JJ4A 4AXJA 5KFZA 4NI2A 3G4SS 4FS1A 3D9BA 2N3LA 2LVWA 1DTTA 2EDUA 2XWXA 1AB8A 4QCLA 1ZTTA 2ZD1A 4CGHA 4B8CA 5AJ3J 2BH1A 1FRKA 1PUZA 3T5HA 4JI6F 1N48A 1JXBA 3D2FB 3G8SA 3AD8C 1FKPB 3TZYA 2FHKA 3W5ZA 2LEAA 4GXKA 2KYXA 4OPJA 2HRUA 4FYWB 4FJNA 3VAFA 4NM2A 2KU7A 3BYRA 5F8IA 4IO9Q 3ETLA 1CC7A 2G8WA 2LQJA 3DRPB 1BPXA 3OBIA 3J7YP 4EYHB 1TL5A 4X65K 4DV3K 3AGRA 1KAZA 2UUAK 1QQMA 1FESA 3NMAA 2O8FA 2CQHA 1DGKN 3G10A 4DR2J 1MROB 1P9QC 2E7XA 2UUCK 3UR0A 3KG0A 1QLNA 2VFVA 4KSEB 4W5QA 1COOA 3I9ZA 5J2EA 2N7CA 5AQOA 4DTRA 1HJOA 2NLXA 4A8SA 3PHTA 3FZHA 3KUGA 3O1WA 3SR6A 4NWBA 4A47A 3DYAB 2H48B 5IC6B 2XCAA 3QT5A 3N6LA 5DJBA 1Q7YO 2HBMA 3DOMA 5EX0A 1O8BA 1RGIA 2L9DA 4NLVA 4DHYA 3C16A 1WEXA 4C8OA 3UKRA 4C0BA 1NM1A 2XMJA 1UAXA 3QE9Y 2MQLA 3R6GB 2ZDOA 3V6DB 5L39A 1JB0C 3NNAA 3CCUS 4P71A 4NLOA 1F2HA 2LYHA 3VF4A 3P5TL 1D1UA 5B09A 1FJGF 2CWXA 1YG0A 2WAQF 1HR0K 4IFVB 3U3YA 3O6WA 3LP1A 3WXKA 1K1QA 3O1BA 3H2VE 2V8GA 4JRQA 4JRPA 3LPYA 4RQ4A 1IBLK 2YBVA 4IRCA 3PJXA 3PW0A 1BLUA 5EX3A 5J0OA 2AJQA 3FRZA 4JP8A 1Q46A 1YITN 2DTUA 1VYAA 1S6QA 4QU7A 3WIVA 4JOUA 3C6TB 4OLPA 4M5DB 2KEYA 1MQ2A 1L3VA 4QIWC 2K8AA 3D3CJ 2YWEA 1HPMA 4DR6J 3DLRA 4OZLA 2FPMA 3K4GA 4M5LA 4BG9A 2PZSA 4HACB 4ECQA 3FC4A 2VPYB 2ACMA 3QNNA 2YNFB 1Y0HA 3E51A 1VBXA 4LQ3A 3QMQA 1ZQRA 3W66A 2VJ4A 4DV1F 3MM7B 4KPYA 2VDHA 4O3OA 4RUHA 2J76E 5EHHA 1D8YA 3UQ2A 2ILYA 1T02A 4BC5A 5I4MA 2IAJA 3VAJA 4CLKA 2O01C 2JV3A 2BRLA 3PY8A 5E3QA 2W9BB 1PC5A 1K5OA 1N5YB 2D3O1 3M1VB 2RQMA 3T41A 3C5FA 3PW7A 1JXVA 1HW9A 3HHLB 4UB6U 4H0VB 4JI0J 2PMZF 3PKYA 4L3QA 2A1AA 3M2UB 4PG7A 3O8MA 1LVHA 2E1RA 4P4MA 3FKBA 3JPSA 2J8SA 3V4IB 5LMNK 3FCVA 2FVCA 3L4PA 1DOQA 5AM2A 1RAHB 3SFUA 4C97A 3D2WA 3NGTA 1AYEA 2DFHA 2FHOB 2R7RA 4UUXA 3OTBA 1LWEA 3LVVA 1TKDA 1F1BB 2AJFE 7AT1B 3AV9A 1IJFB 4X4QA 1EX4A 2W2NP 4EI2A 3C5GA 3WNGA 2K7KA 3DXMB 4HH0A 3CDWA 3KJVB 2O3DA 2YNGB 4B1UB 2EPIA 4FJLA 2DF4B 3QBXA 1SL0A 2CQPA 3C21A 3CJBA 4OHWA 4KV8A 3Q7BA 5KGWA 5JICA 3WQTA 2I6WA 2RRBA 1ZQBA 3IBPA 5ETQA 4CTAB 4M6WA 2M52A 4KR0B 1VQNS 1EB0A 3OVBA 3BO2A 1TUYA 2BJ7A 3GJRB 6FDRA 3PUFA 3O3LA 3C19A 4RW6A 1N36K 2IDLA 4EFAC 3G82A 4RW4B 2VFTA 7ICMA 4BDYA 3LP0A 3ULEA 3MDQA 3G4SN 1H3DA 5KG7A 2UXCK 3UQSA 1EP4A 4JEPA 3KD3A 3T5LA 4F4XA 1KNZA 2YQ0A 2GX9A 3ZSYA 1HPZB 5JVGQ 3B4MA 3HI9A 4CLSA 2WHOA 4JI7J 1YHQS 3QU7A 3CNHA 4CH1A 2GNKA 2W43A 4B17A 2LLZA 4DR5F 2YH0A 2A3JA 4DTJA 3VGKA 3OYNA 4MK9A 3HSDA 1FRMA 1Q81T 1Z00A 2O4GA 4Q5VA 1M5OC 2OPQA 3MURP 4U8VA 3BZCA 4RW8A 1WDTA 2IBKA 2M7SA 4NXMF 2XI2A 1TUGB 3GMGA 2DGSA 1M5KC 2AEFA 3QICA 4ILJA 2E20A 2BTFA 2V50A 3P31A 2VBWA 2AP6A 5A76A 4J9MA 3P45B 4OX9F 3OFFA 4OZ5A 5AK6A 1H98A 2HQFA 4JV5K 3BDEA 2JEJA 2YMPA 1RHJB 3QFPA 3QWPA 2E5LK 2E44A 4DL4A 1M1KT 3QT8A 4BJQA 4WYLA 5CR4A 3MBYA 2VG7A 4WXOA 4B9LA 1N0UA 1RXVA 3DLGA 2PO4A 1CJVB 1D5AA 2VC0A 4DR3J 5FPDA 1OIAA 4NLZA 3M6KA 3HP6A 3HLUA 4BRFA 2XLKA 2MUTA 2R2TA 5AM4A 3R5DA 3VTHA 3M8WA 4ZIVA 4DV4F 3TI0A 4NWIA 2WBMA 4CGZA 3RJGA 4OKEA 1ED1A 5H9EJ 4BROA 3IA0A 5KG3A 3CCUN 1NPPA 4L75A 3N7PD 1SQKA 4WQ4C 1UQVA 4N8NA 4FWPA 1O03A 2A6OA 5A0YB 5CH7B 4WYBA 2P9IA 4JI6K 3OUYA 3WBZA 8ICNA 4IR9A 2YNHA 1PYOB 1NK7A 3BQTA 3AO1A 4JYAK 3H42A 1DY3A 2AYMA 3ZTPA 4X62F 5C2DA 4HL9A 3H5XA 2WBNA 4USIA 4M5MA 1HKGA 3BGRA 1S0OA 3OYKA 3C66A 1VHXA 3WU2U 3KFWX 4YB1P 4CLUA 5C15A 3ZZOA 1YI2S 1NGGA 3SPYA 2LXIA 3H0LB 3THYB 1ZQHA 1CS4A 1NHUA 2ZWOA 2GO9A 4C6AA 4J9PA 3QFUA 1OH7A 4HUEA 4M45A 1ZQNA 4YY3F 3K8VA 1JALA 2H4YB 5ITHA 1X31C 2YKMB 4YUDA 2D74B 3DV9A 1KQKA 4N8OA 3HP9A 1TMJA 1NJXA 4ILHA 1VOMA 4ZH4A 4WU2A 3CJKA 4ID8A 5ETSA 2I1RA 2OZMA 4C7QA 1TKZB 1SXLA 2DR9A 4NO7A 2ZM6J 8ICWA 1TL7B 4CT9A 4I2PB 4J9SA 3HMJG 4PR6A 1FJ7A 1ICEB 3RBXA 3C2PA 1H2VZ 1UMJA 2ZOMA 4FLVA 1NZAA 1Q53A 1C2PA 2P9SB 1YZ7A 2DNMA 1X6JA 3NASA 1FJGK 4IQXA 4B3MK 4FW1A 4CNQA 4TU9A 1VQMS 3P4UB 3FYHA 3DRYA 2F8MA 1HI0P 2FF6A 1T94A 2K2PA 1VQKS 4GNIA 2I0XA 1HNVB 2UUBJ 2ZH7A 3GFKB 2KK0A 4TY8B 2OPPB 5F3TA 1Z1ZA 3O8WA 1S77D 2DBYA 4CO4A 3HTVA 1GLFO 2W4CA 4PAAA 4F92B 4I9QA 2FVSA 4WK1A 1YF5L 3L2WA 1O08A 4L8RB 5BOLA 2DISA 3QUCA 5JTIA 2BABA 2A0FB 2QARB 2PE8A 3KZXA 5CD4H 4N76A 2OJ3A 3ET6A 3IRWP 3C28A 2FTRA 1QHTA 4OZJA 2C28A 2X1BA 4ZHRA 4DV1K 3MM5B 4R0EA 1ZBHA 3MXJA 4RZRA 4LR8A 3IG1B 4OGCA 1X6IA 3IS9A 5J2PB 1XNQF 4DV0J 1BOTO 3CNQP 1X2IA 4IYQA 1HYSB 2GEMA 3BN7A 3IM1A 2G09A 4IDKB 2VBXA 1VQNN 2GGPB 4U7BA 1IKWB 3JSRA 3UO0A 2QO3A 2KB2A 2VJUA 3CD7A 3EW9A 2QMUB 4OPAA 4IOXA 3UD5A 3QX7A 2E1MC 2MY8A 4KH5A 4DU7A 4NA1A 4ZN3A 4A62A 1LW0A 1TYQB 5KG5A 2ZIWA 5EWEA 2I7NA 2NRHA 1NAQA 4FJ9A 4FLXA 4NM1A 4CJ3A 2NXJA 3HJEA 3VQ4A 3VQPA 3TU5A 3A5NC 3OS2A 2LMIA 2GUIA 1NZPA 4WFZA 8ICCA 1YHQN 5F2RA 1BA0A 7FDRA 4FXDA 2HBZB 1RCOB 3PSFA 4BRQA 2QFIA 3H7IA 1IQZA 4MFCA 1H38A 1JKHA 3MMBA 5D8HB 2WF6A 3M2RB 3T9ZA 2V5HG 1CSJA 4BRKA 4ISFA 3DLKA 2EFGA 1YX2A 4URQU 5IIMA 1JJCB 3RYLA 4QWAA 3EL2A 5ETRA 1ZETA 4CO5A 1WG5A 3THVA 2CJXB 4YB5A 3QIOA 4P72A 3VV2B 2IVPA 1FO1A 4ED4A 3UDCA 4HVZA 3LP2B 1XBWA 5L1MA 3F9KA 3DHXA 2ZEJA 3DLEB 3EY1A 3FUYA 5J2FA 2BA9A 4IBNA 3OSPA 1N33J 3PSIA 1JI7A 4JHDA 1WTFA 2QB1A 3IFRA 2UVVA 2DK2A 2YKPA 3D54A 2ZOFA 3NTUA 4KQZA 4OYAA 1KS2A 1GX6A 1R31A 4MK8A 1HMVB 4Y2TA 3CMES 1KDHA 3I4PA 2F44A 1QJHA 2ZGZA 1V3SA 2DKZA 3IAM9 4OX7A 4JKHA 3TA0A 1HWJA 2H5EA 4RTFD 1FDNA 2XG8A 5AKXA 2V7YA 3OBYA 5T41A 3VTIA 1KQSR 1PZNA 2B6GA 3H3NO 4I6WA 3K57A 1KXPA 4AD6A 4LF8J 3DU6A 5J0TA 1S9GB 4DV6J 1S49A 2QB0B 4WQ5A 3NGRA 2YKAA 3GLJA 2LSNA 4GV6A 1YI2N 2JRSA 1C0TB 2D1CA 3GR0A 2CYYA 3ATUA 4AQYF 5L1JA 3C8YA 4FOIA 1YAGA 1DZ5A 4NEYA 4WJ3B 1OXJA 4JD2B 5LJ3Y 2JWKA 4R8UB 2W8LA 3GSIA 2F4VF 2MSNA 1COKA 3MM9B 2KHOA 4IG3A 1LNQA 3FSXA 3DGVA 1HNWF 1FDDA 3AJ1A 4FJ7A 3NBPB 3SCIE 5GIPA 4KN4A 2FGOA 5ALPA 4X4NA 3RU0A 2Z1HA 4F3QA 3MCMA 1TR0A 4FJKA 1N32J 4KH0B 4MLEA 4O0NA 2LM4A 3ISCA 5KFRA 4RPFA 4QIEA 4AL7A 5F8GA 2HMXA 1AT1B 5D3GB 4M7YA 4USUA 2E2PA 5B0CA 2DY1A 1FD8A 3R7SB 1QAJA 1LFWA 1C1AA 2E3TA 1X4EA 2KVIA 4JWNA 3GDQA 3VQ5A 4B1ZA 5LJWA 1SKWA 3QGHA 3T1YF 3VQ7A 2JX2A 2EC0A 4DU1A 3M9MB 3A8KA 2HHHF 1OVYA 3WXMB 4FK4A 2CJYB 4TNOA 3UCGA 1ZBUA 3ZTOA 4YHHK 4QIFA 1VQMN 2M9KA 2BPCA 5HMZA 2QLJB 3LWLA 1KQFB 2DTJA 3IWLA 1VQKN 2E4LA 4AHSA 1RBUA 2RMLA 4PG8A 1JK9B 1I51B 4A2AA 2XGPA 1FI4A 2DNNA 4JI4J 4YDUA 5J2MA 2F8TA 3ISND 1PILA 1SJRA 3BP8A 3UMCA 3H8YA 3J81O 4RW9A 4DL6A 3U7JA 2M70A 2VD3A 2JEGA 1EXQA 3OYEA 3SXLA 4EBDA 9ICNA 4C3KA 4BXOB 3HPGA 4KT0C 3I0SB 2Z57B 3L3CA 2KN7A 2EXUA 1R8CA 4TXSA 2DNHA 3QEBZ 2DNRA 3MGJA 1OS5A 2KJ5A 1NCLA 1YIJN 2FC8A 3SCXA 1HKBA 4AILC 4IOCL 1NKEA 4CHZA 1ASVA 2JFDA 2G0JA 1Y88A 3M05A 3MFHA 3KFUF 1IM6A 3TA2A 5DLFA 3SBTA 3HI0A 1YT3A 2V2QA 2QGFB 1HLUA 5AZIA 3DM2A 5LY3A 3A1YG 4KI4A 4ED3A 1W7WA 3ENQA 4LMZA 2WBRA 4I67A 3AGKA 4FL9A 3KLFB 1DQ8A 4QZBA 3O5TB 4HEA9 2X74A 3KKAC 2LBOA 5B7WA 4RCHA 3VESA 3ZDCA 4UOHA 4CHPA 4HUGA 5C25B 5AICA 1VQPS 3C14B 1YJ9S 2E8MA 4FF4A 2HFNA 3ASMA 5D4PA 4Z4FA 3Q7CA 2P66A 3RJJA 2PFPA 1U2VB 3CJ8A 4KB7A 2MY7A 4E1NA 3W3SA 3QRPA 1R59O 2DITA 1CLFA 2RNEA 2EKNA 3VQAA 2E1ZA 2Z2ZA 3THXB 4OHZA 2DEJA 2X51A 4TU8A 3THWA 4RW7B 4P0QA 2VHGA 3RG6A 1XNRF 4CZMA 2BE7D 1VC6A 4JI2K 1Z4UA 4FBUA 2R7QA 3QIPB 2HF3A 2FVPA 5IIIA 2XYPB 2MZJA 1RT6B 1U0HB 4ZJQA 3D0HE 4IOAL 5IT0A 2ZUCA 1SUQA 1WTBA 2MSTA 4DZ6A 2ZGYA 8ICVA 3IR6B 1Q7LB 1KHWA 3W64A 1HEKA 2XS5A 2EFQA 1H72C 2DNPA 1U09A 2HQGA 5DK5A 4M41A 4K0KK 4YDXA 3O3HA 3FSIA 3TVYA 4WKYA 4XPCA 2RIJA 2K89A 1O5JA 5KFOA 3KJQB 5DB6A 1FWLA 5EOYA 2DO4A 3GV8B 4ECYA 1SQGA 2QL5B 4OV6A 2YH1A 4M2YA 3H59A 4M9GA 4UAZA 1HBNB 4XDDA 3CMEN 4LSLB 2DRBA 4MFFA 5ALFA 5M1NA 2HLUA 1T3QA 1JIHA 1CZAN 1E6VA 4J2EA 1FVSA 5EDWA 3NH1A 1ZQJA 3CULA 1HUXA 3KLVA 3I56S 4XIUA 4NXNK 4OV1A 2E29A 4OZ1A 2ZG6A 4HVJA 5IFMA 2BX6A 3HHDA 3G71S 1GT8A 3Q8LA 4URSA 3RBZA 4KX3A 1Q81O 4P2XA 1R8PA 1V9OA 3EICA 3MCSA 2UXBJ 5IM0B 1ZM4A 2AJ1A 2ZZTA 1UVKA 4JMUA 3QGIA 4E2FB 2RRNA 5HL7Q 2YQ3A 4Z4CA 4FXVA 3GE9A 3LWMA 1I3AA 3EO3A 4W5RA 3E2EA 2HOIA 2VPXB 1S1WB 2ZTEA 4OZ2A 4Y2PA 1TKTB 1XJWB 1UVNA 1ULRA 5DQGA 3ISBA 1M1KO 2V2ZA 3K59A 2XQCA 1X3MA 1IG6A 1Y97A 1S10A 3C6AA 4CLPA 1X4CA 2HOQA 1C4AA 3DI6A 1T3VA 5EOZA 1XMOJ 2ZWHA 3TARA 5CJ7A 2NSCA 4HT7A 5LXYA 4W5OA 4UAYA 4ZPWR 2MQOA 3NVMA 2BJ3A 3DXBA 2MHEA 2D3DA 1WCNA 5G5GA 4CJUA 4DFKA 2DGOA 3FEZA 4TUPA 2EEYA 1SWVA 2HS4A 4OYBA 4LREA 1Z4OA 2UVRA 4RPZA 2KMDA 3KTQA 1D09B 1TK8A 3HSJA 2KRRA 3SSQA 4O55A 1JUDA 5AKGA 2GVZB 1SJ4P 1PIEA 3ZNJ1 2KIWA 4M8LA 4ED0A 2R7SA 3KK2A 5B0BA 2ALZA 1NH8A 4ZOSA 1Z2LA 3ZZPA 1OMSA 1IJJA 2AQ0A 2D0OA 3N01A 5J2QA 5D77A 5DDPC 5ALQA 2E8NA 4BWJA 1KTVA 5L38A 3OR2B 1I94F 4X66K 2ZUDA 1VBYA 4DDFA 3PX0A 1CJTA 1HHQA 1SL2A 1QQNA 2CNNB 4EHUA 4Y2AA 2XB2D 3HILA 3IHQB 3BO3A 2H51B 3HOSA 4WJBA 8ICEA 3CI5A 3AY0A 3AB2B 2IOFK 1K9MT 2Y3YA 2UU9K 5EE1A 4K5SA 2H3ZA 3M8QB 1B70B 2F4VK 4X65J 4DV3J 5I3UA 1YGYA 2UUAJ 3GYGA 3BM7A 1N56A 1Q86O 4JKDA 4CJKA 1QUPA 4BACA 3HX0A 3EXCX 3BS5B 4FM0A 1RLCL 5KG1A 4E1JA 5DM6L 4LJMA 4PUOB 3QU9A 2VC1A 4BCAA 1UWBB 1GXUA 2APOA 5ALRA 5J1EA 3E9OA 5LJ5Y 3HSGA 3SCLE 4BRMA 2R3VA 2LYAA 5HMLA 4DPYA 3CFPA 1Y9OA 3VQTA 1SL1A 4F25A 1WSHA 1XSPA 4M3RA 1XMBA 2EWSA 5AQFA 4CJ4A 3IRUA 2XIDA 3BH6B 2ESEA 5CA7A 2QYCA 3LH2S 2I38A 4EP4A 5AI9A 2IDEA 3I87A 7ICEA 1TKXA 3KWMA 1J27A 4PY5A 4FLYA 2CQBA 3QBCA 1RLDA 4I6AA 2GVDA 1M5PC 7ICHA 1SJ3P 2JC0A 1D9AA 1OUQA 1VQPN 2ZH8A 1YJ9N 1QVFM 1GMWA 3IGNA 5B08A 5J1PA 4HWIA 2YJEA 1UVMA 2VV5A 3TVZA 4EGLA 5AQYA 2E8PA 1Z6RA 4KLMA 2CZVC 2KFYA 3ENVA 2RKIB 1HR0J 3ZTSA 2DBBA 3J7A1 1XR7A 1QQ6A 1XIQA 4LF5F 4OD0A 1SV5B 4GW6A 5KT6A 5E5NA 1P8ZA 2IM2A 3B0YA 3RF9A 5BYQA 1PVRA 1HA1A 4IG0A 3A3OB 1G1XA 1R6YA 4ILLA 1X4GA 3PX4A 3EKUA 3VR1A 3AAQA 1FXXA 4F4AA 4UQGA 3LVWA 4KHNA 3WC0A 2R2RA 4DTUA 1X40A 4EHTA 3MEEB 3GFXA 3BF4A 4DR2F 4CF8A 2QKBA 4LFBK 3A13A 3DU5A 4J5OA 3ZX2A 2F76X 5C2CA 1RILA 1G15A 1FXDA 5AKKA 4F4ZA 1LW2B 2KL8A 1JCFA 3LO3A 3Q2TC 4IZ9A 1TELA 1ATSA 2P9LA 4ATNA 4M63A 3EPIA 1NNLA 1N88A 1FRJA 2VGNA 3RBEA 1NBEB 4F50A 1AROP 1BE4A 3RH5A 2J0WA 2L9NA 4BRIA 1U04A 3VQDA 1S76D 4NCGB 5IINA 2AGOA 2O8BA 3AVGA 3CQXA 5CZ1A 3HFVA 4O44A 3I56N 5ETVA 1Y5IB 4OPKA 4FJXA 4DG1A 1NDLA 1K73T 3AVIA 3S6JA 1HIWA 3G71N 4ECRA 4B3OA 1RT4A 5CP2A 2V67A 2J0SD 5AI8A 2BM1A 4A8OA 2YWGA 2MQMA 2VJ5A 2B43A 3O80A 3IV6A 4DEZA 2HBYB 1FWKA 4ISEA 3MWPA 1T05B 4GFJA 2PYJA 4OJ1A 4IQMA 5HR7A 3ZYYX 4IJAA 3IMQJ 3MMCB 1PYTA 5KFUA 1O1WA 3ZSZA 4WFBL 2FMPA 1NOMA 2E9TA 2BCVA 2R8GA 3HVTB 4QOZB 2ZH4A 3SQ4A 2ODGA 2GS8A 3ADAC 2W6LA 3MCAB 3VZHA 2RHFA 4F04B 3A8YA 4JAXA 5AQPA 3DRXA 5HNKA 5J2NB 4CZLA 4FWNA 2AF6A 3MWBA 2YNIB 5KFGA 4FVUA 3V81B 2P9UB 1CULB 1W97L 3TSPA 3F5EA 2XC9A 1VSJA 2BKOA 2NRZA 1PJ7A 3NNHA 3TAMB 3K58A 3FZBA 1T9XA 1OYDA 2NXCA 3EJMA 5KFEA 2PKEA 3E66A 4YDDB 4DX6A 2HDOA 2OIHA 2GWKA 1VSLA 1WSVA 2IRUA 2C2EA 2H4WB 3ULHA 2HQDA 3HKZC 4MYTA 5BJRA 4OZ3A 2G4BA 3M8YA 2JH3A 3CO0P 4I2GA 3TTFA 4BE1A 2JDJA 1T7PA 3NAIA 3FQLA 1RHKB 4M1KA 1OY8A 5JVHQ 2DXDA 2WONA 2P6SA 5IQQA 4JI0F 4ZVRB 3MTKA 4OLBA 4BR7A 3R9PA 4Q2MA 5DM7Q 1U6FA 4OLOA 5HRPA 1J5EJ 4WF9Q 4XK8C 4KAZA 4AF1A 4DFMA 4C1NI 1ILYA 3HXMA 4CZCA 2JHEA 2HMIB 2G8IA 2J5AA 3H4DA 4LH5A 2YX7A 1GXLA 7ICUA 5C24B 3KXDA 4QZVB 2V8DA 2IC3B 1C0MA 4KHMA 3U6FA 3M30A 2HZAA 3MAAB 3CEDA 1IKYB 1VDVA 2VOOA 3DLLQ 4FCYA 2A1JA 2FPHX 2RVJA 5KAFU 3MTJA 3CE8A 5DBAA 4P7VA 4O3NA 2O67A 5ALGA 5J2AA 2IJRA 4A5BA 4AHVA 5DLGA 7ICFA 1IQTA 4F5OA 3WXJA 3E58A 5I42A 3M6VA 3B82A 1F5CA 3HJVA 2E5LJ 3N28A 3KIOA 1FFVA 2ATLA 1ZQEA 2GO7A 5DDRC 1QQCA 3MECA 3CMQA 3POTA 2HQCA 3T6JA 3K5OA 3H8SA 1ZQTA 2GTDA 4DFDA 4NLRA 3FE1A 4Y2VA 3GIRA 3ZT0A 3GJTB 5HJYA 3C29A 1VQ4S 2BV3A 1TZ0A 3SQGA 4I2HA 5HN0A 3UXOA 4OJ5A 1TP7A 1CJKA 1T95A 2G8UA 4RUCA 1YJTA 2XI3A 1ZD2P 1RACB 2GJIA 4LF6K 4I6YA 2GWJA 1XTZA 2CNOB 2IGIA 2QT7A 2Z1JA 4JI6J 4F9OA 2NV3A 2F8SA 4RNMA 3RZAA 2O1PA 4CLWA 3QGPA 4IC9A 1VSEA 4JYAJ 4JI7F 2XY6A 1SXEA 1WSRA 1VIXA 3AXKA 4LF9K 1RAAB 4CEFA 5KG6A 2D7SA 2ZE2A 2WVFA 1UFLA 3LAMA 3CJAA 3VPZA 3AH6A 1JLBA 3NAEA 5B0AA 3FBBA 1R8BA 3KJNB 2BQRA 3WKAA 4U67Q 4JB3A 2ZDPA 5BRDA 3OFGA 2ZIVB 2G13A 5ALXA 4C8MA 1RE1B 4YMMA 2DCUB 1FD2A 4KI6A 3AA3A 3M8PB 5HMYA 1QSSA 4I2QA 3TQEA 2ERRA 1VRUA 3CPWR 9ICEA 3JSMA 2X1FA 2F4FA 4LT6A 2RHSB 1ELOA 3T5KA 3U27A 1R0AB 3PNCA 4MIWA 4YCXA 3I8BA 4WPAA 1X8DA 1NK5A 4DSKA 4PQUA 1ZJNA 1URRA 3M6UA 4CGIA 2HVHA 4DSLA 1VJQA 4B8AB 1HBOB 1F5BA 3BSAA 3WEEA 2BQ3A 2HBLA 4JNEA 4DCJB 2G8VA 4OZNA 2R4FA 5JMVA 3FLCO 2Z2MA 4DR3F 1WC0A 2M9NA 4RKUC 1HWUA 2Y8YA 1DAXA 4LF4K 2VKZG 3TZXA 4K4YA 4CO1A 3ZEUB 3MGVA 2CPRA 3U26A 1AUDA 1MW7A 1R0BG 2QMXA 5K5MA 4CI0B 3L3UA 1LOUA 5E84A 2P5GA 3E9LA 1RDCA 1JLGB 1FJGJ 4P0PA 1Q3VA 3B6BA 5M1OA 3TNVA 4LF5K 1DQAA 1T6DA 4FWSA 3R7BB 1K44A 3QU4A 3I6PA 4I29A 5K14A 2OPSB 5BPCA 1X1PA 5DGAA 3GJSB 5BN9A 1BA1A 4RQNA 4NI2B 2HB5A 3BZKA 2CXEA 2F77X 3RB3A 3A0IX 1KHVA 1OWXA 3V6KA 1QD1A 2XWYA 1BCMA 3CF5Q 3SFGA 5HSPA 3HULA 2IHNA 1LAVA 1U2RA 4X4TA 1PYSB 1NJWA 1HNXK 4Q2LA 4JK7A 2VYPA 3CJ2A 4ZN1A 3P83D 2D9PA 3NHGA 3C7NA 1ZM9A 4OO1J 1KQQA 3MC1A 2VG5A 3R7NB 2PC6A 3IAS9 2OZSA 4DV1J 4DU4A 3KOOA 3N7SC 2ASYA 4OPHA 1FE0A 2VBYA 2R7YA 2WSEC 1VQSA 1SH0A 3O1LA 5J0WA 1RT3A 2BKNA 4H54A 3M8ZA 3I96A 4UOGA 3VC8A 4DMZA 2CQDA 2O8FB 1PVPA 3PKMA 4GMKA 1Q1KA 5BRFA 5CZVA 5JMNA 2U2FA 4DQPA 2DJWA 1S97A 2CPFA 4I27A 2X3GA 4PZOA 3PYFA 4LFAK 4KLLA 3FZLA 4U7CA 1NNEA 1PG5B 2WF5A 1LQ9A 4U9RA 2VCPA 1DRGA 1S48A 2HKEA 4DPTA 1TV6B 4M3XA 4FW2A 1NXIA 3HHKA 2D0AA 5FRMA 3J8AA 3ITHA 3VZIA 3DOMB 5F8HA 2I5HA 1BQNB 2EVZA 2P9KA 5G0RA 2I8EA 1FEZA 1UW4A 3RB4A 3D45A 3C16B 2UUWA 2XYGB 2AXTU 4ZVTB 4L3KA 4DX5A 3TYTA 2RQCA 4DS4A 2G9OA 3JXUA 2RPIA 2DYAA 4CNZA 2FPKA 5ALTA 1MMDA 1L3UA 4CE9A 5J2DA 2ZC4A 5C5JA 2FHMA 1HW8A 3NF6A 3LP1B 4ZPCA 3SUNA 3ULDA 4ZIWA 4KPCA 4F26A 2KW4A 3QEIA 4ECXA 4RO0A 3DDIA 2F9DA 1MNEA 2H3IA 1BQMA 3ZO7A 3R1XA 2YQ1A 5THWA 3U9DA 5A0LA 3DNCA 4MFBB 4KC5A 2MEWA 1H73A 1YJRA 1B4FA 2Z8QA 4BHQA 4DV0F 2QK9A 3O9RA 4UB5A 3AQPA 1KN6A 2D9OA 4ZP6A 4DV7K 2KVQE 1GMVA 2YPYA 2HZCA 2GHPA 1JLQA 1FX2A 2YB4A 1B64A 1HRHA 2ZQBA 1VQ4N 4Y2YA 3ICLA 1OH6A 4I2DA 2QG9B 5J2GA 1KRPA 3TX0A 2HFVA 4HHTA 4JKGA 1WORA 1SV0A 4DHVA 1RDDA 5BXIA 4Y1DA 1NDKA 4F36A 3MN5A 2MGZB 2V7ZA 4ITSA 2B9WA 3KG1A 3NAHA 4F0KA 5HROB 1S6PA 2AU0A 3ICXA 2HNYA 4WWSA 1WACA 1RTIA 1K9MO 1ZOLA 1GX5A 4D3HA 2Y9TA 2AJ0A 4FJHA 2GMJA 2EAPA 4FPRA 3CCVS 2C2ZB 4NASA 4UB2A 2XSJA 5AKLA 2YI1A 2DFFA 2ROGA 1N6QB 4KLEA 2BE2A 3D6TB 2U1AA 3U8XA 3IM8A 3OL6A 2ACYA 1V4SA 2DRAA 3BKUA 1LEOA 1Y7PA 2DKOB 4ID5A 1LWEB 1RG6A 2G1DA 3KHLA 2RDIA 1VLOA 3VQSA 4IJNA 4BVPA 1T9WA 1XNSA 5ALZA 2QN6B 1ZPWX 3BKTA 4WP9A 1ZD5A 1IV8A 3MPWA 5HJXA 4HI2A 2DXEA 3J80Y 5AM1A 5IV3A 1RDAA 1C20A 2DGUA 3ZZZA 1FX4A 3NCPA 2E1PA 1IO2A 7ICNA 4BRNA 2KO1A 4OYPA 4KTQA 2IA0A 4KV8B 2WF8A 2NO5A 4CLZA 2RH3A 4ED7A 3PMLA 2GV9A 5AQWA 1J5OA 2YHWA 1C0UA 4M5JA 4IH5A 1L8LA 2ZTDA 3D68A 2YWHA 3NOCA 2XLJA 3CCRS 5D15A 5HQMA 4RQMA 3OHBA 3NCQA 4LBHA 2RB7A 3IBCB 4ZPTR 5L9NA 4YHHJ 2ZZMA 1UZHA 3QEWA 2IBOA 2DHAA 2NLWA 2CH6A 1B92A 3NMRA 1MSWD 1PC4A 4X62J 2JOQA 3AD7C 2PFUA 3H0MB 1U1MA 2VKQA 2NO4A 2VGMA 4DBQA 5HVFA 1CJUA 4R63A 1EP4B 4DLEA 3W9JA 2CVEA 4DV6F 4CEDA 2YXLA 3BB5A 4OYIA 4TVAB 3GFYA 3ZSWA 3OA9A 5M2PA 9ICKA 2QI2A 4C9DA 3TRGA 3G86A 3ZSVA 5JLHA 2HHVA 4ED2A 3HCXA 2HSZA 5LM7E 1P6TA 4J9RA 7ICKA 2VU5A 4FXWA 3AUOA 1CXUA 4NLDA 1LCUA 2FSNA 1CZ9A 5DO2A 4YY3J 3G9CA 2V4JB 4IDHA 1Z00B 2KNJA 2C2MB 5HO4A 3VAHA 3G25A 4B02A 3LQVA 4ALZA 1Y5LB 3UKUA 4NL9A 1IVZA 2QWLA 3TABA 1TUWA 2Y9HA 3EXYA 3QU2A 2GUPA 3H5YA 1R6VA 3HD1A 2KRBA 2PDAA 1ZTWA 2B7CB 1ZAXA 2YMQA 3UNGC 4KKOB 5CYQA 2J4RA 4ZCLA 3M32B 1RBVA 1K73O 2FLLA 2XMWA 4USMA 2CJKA 2DPNA 3OXLA 1NMEB 1XERA 3JQKA 2X1AA 1GLDG 5B0GA 1D9FA 3U3GA 4ED6A 2FBTA 5CHIA 2UUTA 4CO0A 4YFKA 2RLTA 3D2NA 5AQKA 3QNMA 4CZFA 2KG0A 4KRFA 3K5NA 2J8AA 1RTJA 4I56A 3SV3A 2BGGA 3TPQA 2AZ1A 2GMLA 2MUTB 4EAHD 1NGEA 1L8OA 1HQEA 3C1ZA 3H0PA 5KRSA 2N4CA 1DTQB 3QMLA 2FMQA 5HMMA 4X4UA 1MMNA 2XMAA 1VQ8S 4CYUB 5ALLA 4HTJA 3OXGA 1TK0A 4BC3A 4O5EA 4P9SA 1E6YA 2E8OA 2GH1A 1S1VA 2P9IB 3HJFA 4CEEA 3R5GA 3OUYB 5EVZA 2YNHB 4CJTA 2CGKA 3FGVA 1LWXA 1WF0A 3SSRA 3A2FA 1EHWA 5KT2A 2YTUA 3ZZ0A 1BHNA 2EZYA 4H5RA 4AT1B 4CBXA 3UNYA 1XNQJ 4IH7A 3M6XA 2ZC3A 4KBIA 1WUAA 1S7HA 3MX5A 4K0KJ 2E2QA 4GO5X 4JBCA 1N5XA 1CS4B 4K8ZA 4DQQA 2ZUBA 1HI1A 1KVCA 5IS2A 1RT7B 3WIUA 3BH7B 2ZJAA 2JJ4D 4X64F 1JLFB 2UZAA 4H0XB 3OYLA 4QZHA 4CFBA 1IWAA 2M4MA 2JEFA 1Y3JA 3KOAA 3NF9A 3FNNA 4NA3A 3K2PA 4DR7F 3CJKB 3PM9A 3VQ6A 4M3WA 2CJAA 1KQSM 1BPDA 3VEOA 3BY5A 1IR2A 4CRXA 4I64A 1WDDA 1X66A 3RB0A 1A6LA 3OT9A 3ZSQA 1Y5NB 5HATA 3CCVN 3VEXA 2G0CA 1QSYA 2VFUA 5J8YA 1LWFA 2ZWPA 5E2QA 2ZBRA 1CG2A 5A6PA 1WI6A 3RTVA 3N9UC 5C42A 2BOAA 4QBUA 1Z05A 2HQIA 4A8QA 3TVKA 4FJ8A 2VFRA 5AK4A 1C7YA 8ICZA 4YEAA 4PYAA 1L3KA 5FLXY 4OFZA 2P2CB 4CGFA 1NEEA 3KKSA 4R25A 1H2UX 2NRTA 5CD4A 1ZAVA 7ICIA 4EIAA 2O8CB 9ICUA 2ZNZA 4XH5A 2DPIA 1FKAF 1NBWA 5ALEA 5AQLA 1FRIA 4H03B 2QLFB 4ZTJA 4AL5A 4NPOA 5AKIA 2DR8A 4CJ5A 3Q8PB 5LMUF 3CWJA 3FFKB 1R8HA 2MZRA 4FJGA 1S59A 8ICYA 3SD7A 4USTA 1WSEA 2GLEA 2ZFHA 4ZHRB 3CUNA 3O6QA 4NJ8A 4M5HA 2B7BB 5A2QY 2Q0RA 2Z2YB 3B0XA 3I0RA 2P51A 3DRRB 3UPQA 3WKEA 2K4EA 5KFMA 1HD1A 3CCRN 2QSWA 1PO6A 3PLAA 5ALVA 4K4HA 5EU7A 4KLDA 2AZ3A 4ICLA 3KLIA 3KLHB 2F3NA 3DYAA 4HAIA 3J80U 1I6JA 3O0FA 1WC6A 1ZQLA 3OTQA 3JPOA 4X66J 1RUSA 1S9FA 1SKSA 1M5SA 1EETA 3UI3A 1Q82T 3RW7A 2UXBF 3SQ2A 1A6SA 2XNRA 4Z7YA 3V9SA 2YKNA 5DB9A 1WCLA 1FNOA 3FJ2A 1UP1A 4X4OA 2QWNA 2KXNB 3D6MB 4Y2QA 3E01A 5DQIA 3V6DA 2NRXA 2P8IA 2UU9J 4QYZK 2PGCA 2F4VJ 4DCCA 3RAMA 2LDIA 4QJVA 4J9NA 2HBQB 5HP1B 3V1OA 3N4WA 3SMVA 3CGIA 4E19A 4P75A 3H2UB 2LCWA 1JKHB 3H25A 1K0VA 4FPBA 3MMBB 3GBTA 1NSAA 2WSFC 2IM3A 1RQNA 2JNJA 1XMOF 2JWNA 2J6SA 2CJQA 3DLKB 3NCRA 3NL0A 3WDOA 1S8OA 2UVWA 3PACA 4M5DA 2F2AB 2Y1JA 4ACOA 1LV5A 2CZ9A 2HEKA 4DU3A 1ASUA 3CM6A 1URNA 3D0PA 4A46A 5JUMA 7ICVA 5ETPA 3PHEA 1MN9A 3ZSXA 4PGYA 5A8KA 3TADA 2P5OA 5DB8A 4XUSA 2MZQA 2ZHBA 3J7AP 1WKJA 2W1BA 3S01A 1X4DA 4I6MA 5ALSA 4FVCA 1T0TV 3UCUP 2DB1A 3R5AA 1SJQA 5KAIU 5AQHA 3MM7A 5E3RA 2ATCB 4JHDB 1V5VA 2ZJQQ 3NFAA 2Q6BA 5DBCA 3FC9A 2ES6A 2E5HA 4FBTA 5BPMA 2W7PA 2KFNA 3QXGA 2ZJ8A 3ZDBA 4USKA 3GQCA 4WFNQ 3NS7B 3MAHA 3KDOA 1VQ8N 1T11A 2KJWA 2RQ4A 5U47A 2W9BA 4YXMA 3NLCA 4ETZA 2ZH9A 1N5YA 4AL6A 4MMOA 3M1VA 1TAUA 2FC0A 1FRLA 3HHLA 1J2VA 3PCOB 1GNKA 1ZQMA 3WK7A 3QERA 1RKJA 4DFJA 2Q97A 1BPEA 2HRYA 1NLVA 2LI6A 5KFAA 2KG1A 4R64A 3PMNA 3ZETB 3BR9A 1XEZA 4X65F 4DV3F 2UUAF 1HLWA 4DLGA 2Q36A 2J7WA 4AP9A 4KGKA 1WSGA 4MTPA 3OYIA 2YX8A 1X9MA 2VONA 4LFBJ 5DM7L 3FFIA 2XY5A 3K2YA 2WW8A 4DB3A 5RUBA 2UUCF 2WHEA 3UDEA 5CE3A 3AQEA 3VGUA 4PPXA 1N63A 3FSYA 3CCTA 3M8SA 3P1GA 1FW6A 1IR0A 3K9KA 3CTRA 1NOYA 1NPKA 5EXWA 8ICHA 1X3NA 4WYWA 3IAYA 1FE4A 2F40A 1RAFB 4IG3B 5MLCQ 4KLSA 3KJVA 3A3NB 5AQVA 2WVCA 2YNGA 4UTGA 3LDQA 2ZVSA 3KK3A 4PH5A 3GTYX 1C1CA 3EZUA 2QC3A 4BR5A 2H54B 3SIPB 5AKEA 4AYBD 4OHYA 1YBUA 2HNDB 4MIAA 8ICUA 2ROEA 2B8PA 2ITMA 1YTYA 4CTAA 5HHIA 4CM0A 3EVWA 3GOIA 2RU9A 1RNHA 5D0EA 3Q8MA 4BGAA 2HHPA 3PR5B 4NZ0A 3IWXA 1KD1T 2BW7A 2MKKA 1XNRJ 4PXCA 1OH8A 1EQ0A 1IBLF 2HBKA 5BOMA 4U6PA 1IBMK 2ZOGA 1ZOTA 2BANB 4IQWA 1VIOA 3OFHA 4K5RA 2V68A 3NF7A 5J2MB 4TURA 3GL1A 5I9EB 1HPZA 3X1LB 1O51A 3MPUB 4I28A 3HO1A 4F4KA 3RJIA 4CP5A 5AR0A 1MN7A 5CCLA 2OGUA 1REVB 1ZQSA 1HQUB 2F1JA 5ALIA 9ICGA 1S9EA 3V6HA 1ATNA 4R66A 9ICFA 4P2FA 3KUEA 1DURA 4HHUA 3R6LB 4O5CA 3DDNA 1U9LA 1RYSA 2CPEA 2ASLA 1ZQPA 1WG4A 2Y0SC 4B3RK 4GXJA 2MXYA 4X64K 2FZKB 3D0GE 3QYYA 5F9LA 1HWKA 2R8KA 3W8GA 3L8BA 3KD5E 3ZSOA 3M4XA 3TUIC 4A8FA 8ICIA 3NKYA 3C6UA 3CD5A 3FDSA 4EEYA 2PFDA 4BC7A 4BLGA 5FLXU 4KTZA 2HBRB 4C23A 3HOTA 5IQ6A 2EI5A 4M9LA 1R27B 3UD4P 4M3YA 4DR7K 1NO8A 3E9PA 8AT1B 1DFDA 5AZIB 3GYXB 3R5BA 3R5CA 4H0YB 3DM2B 1FFGB 1FIQA 2W8KA 5TKWA 1CJVA 2Y1IA 2MHNA 3AA8A 3AL0B 1LWCA 3DC2A 2R7XA 4CCHA 2I6XA 4C8NA 2IIHA 2V69A 4KBOA 4PWDA 2BJ1A 5LMNF 4NA2A 1DJ0A 3VGVA 1P9YA 5FDLB 1CXQA 4FZMA 2ASJA 2D6FC 3OYJA 2WRMA 3FBFA 2BVZA 4MF8A 2C2RA 1X5TA 1HKAA 5A2QU 1ROFA 5BN8A 4NV0A 4JI8F 1RWMB 4EBEA 3MEGA 5F3ZA 5T14A 2ZH1A 2BCSA 3ID6A 1S7IA 1RWKB 2FB0A 1B0TA 4I1TA 2J0XA 3ISZA 3ZLJA 3S7RA 4W5NA 1VQ9S 1QE1A 3AVBA 3WK9A 2FQQB 1KEKA 2XCPA 3ELHA 5M1PA 4P0QB 4TKTA 3NS6A 2YPZA 1A0OB 3LYSA 4WU3A 1XMQF 3ZZUA 3AOCA 2ATQA 2DR6A 4DQ8A 2HGMA 5LT5A 2YKOA 3PRBA 3BPSP 4QZDA 1UPMB 5C2FA 4MQ3A 4CI6A 1NMDA 1F3VA 4NYFA 2M5YA 3TQ1A 2VQFK 4W90B 2FUG9 5DZ7A 1SH3A 1L3TA 4ZP8A 2W6KA 3RB6A 5KT4A 2HHUA 3WNEA 1H0HB 2OCEA 4FO6A 3GIJA 3FZ2A 4PL7A 2XULA 4YMEA 1FEHA 1N36F 1MQ3A 2LQBA 4KH4A 2PFFB 5KFYA 1FF2A 4CK2A 4F3MA 2QMWA 1GLAG 1VLBA 5AQNA 2HGLA 1G4CA 1FERA 3R5JB 2WUSA 3A5OC 1MWZA 5E33A 4LF6J 2EZZA 2DGWA 2UXCF 1U2FA 4EX6A 4WTYA 5AT1B 3P5JA 1GK8A 3VETA 1I94J 3MD1A 4IOCQ 3PW4A 4OJ3A 3MI7X 3LF0A 1E6VB 1TUUA 4A48A 1TL7A 1WC1A 1ZQ1C 4I2PA 4LF9J 4BVOA 2OKQA 2RHKA 4ANCA 4CJSA 4Z6EA 3ED5A 2FYXA 3K5PA 2E7WA 3SI8A 2P9SA 4CEOA 2WK4A 3TACB 1RDWX 1X9SA 2IJFA 3CJTA 3CJ1A 1KOOA 2A18A 3W2WB 1U6BA 1VMBA 4A57A 1U7LA 2LU2A 2LFVA 1ZQVA 4H4OA 2E2NA 1L7NA 3U4LA 4LF7K 1HNVA 4TY8A 3ZTRA 2OEHA 3RGIA 1GO3F 5ALHA 4DO9A 2OPPA 4CK1A 3AA4A 2QL7B 1WN7A 5J0XA 1VS3A 5KTQA 4YVZA 1KR4A 4QU6A 5KQDA 1X4HA 4FP9A 4JV5F 2HZVA 4J2BA 4ECSA 3MCNA 1ZD3A 2GQ2A 2CPXA 3MX2A 4ELTA 5AJ3K 4FS2A 3ZT4A 4KGMA 2MAXA 5LSRA 4ER8A 1NM2A 1DK3A 3JXOA 5D6GA 3ILJA 3OYHA 1CQNA 1WF2A 3MM5A 5AXKA 1REGX 2BE9B 4M63C 3IG1A 3S6EA 4IOAQ 1HYSA 3NRWA 1VJWA 3PIOL 2H3EB 3TFRA 5I3PA 4E8UA 2GFFA 2GGPA 3SEOA 4GVMA 4EFHA 3BBFA 4YFUA 2F3JA 3VEZA 4CFCA 4LF5J 1ASWA 1BU6O 2JR5A 5ADZA 1V6HA 4UY8T 2KT5A 3MEKA 4ED8A 3V7JA 3CIMA 3KK2B 5FRNA 2V4QA 3GFHA 2NXUA 4IFEA 4DOBA 1TYQA 4JYAF 3KZBA 4FN5A 2MMYA 4UAVA 4E7HA 4Q44A 5J2QB 3CCMS 5E3CA 4RQ7A 3TZWA 4CF4A 3ETRA 4IQTA 4YOVA 3H40A 4XEIA 3VEVA 3GE1A 5HANA 8ICMA 3AQFA 5J0PA 3MDAA 1CJTB 2KM8C 1RYRA 4WQ4A 2KXFA 1YSJA 3R1HA 1J9AA 1C1BB 2GA7A 3NGDA 2H3FA 5CHGA 3QZ7A 2ZKTA 3Q2SC 1T8EA 1MU2A 4A2BA 4ZLLA 2W42A 2CRLA 2IDOA 2ZUAA 2A6MA 2IVYA 3S3MA 3QT7A 1QDUB 4QWBA 3PXGa 4CF0A 3FCWA 2ZIUB 4TU7A 2VG6A 3BQ0A 3TAFA 5AZJA 3M2RA 4F0HA 4ZPBA 2PMWA 3V7KA 3ZDEA 2C3MA 5KT5A 2WOMB 4DCPB 5K8PA 9ICPA 1RBOB 2C3UA 4LFAJ 4J2DA 1PGZA 5L9XA 3QSYB 5J1EB 4YG2A 4DPUA 2LM1A 3SMZA 2V8VA 2MKJA 1VLYA 2KN4A 1K47A 2G2ZA 1A77A 4LSNA 2YB1A 4RBTA 2GJFA 2FDNA 4FZNA 3LP2A 3UR3C 2YN4A 2HHWA 3DLEA 2FIUA 1KKXA 1NGDA 3NG8A 1KAYA 3CC2S 4YB7A 4B3MF 5SWMA 2CNKB 2JEIA 4RL1A 4NOHA 1LOTB 2FLNA 2FJ6A 2IY5B 3JSBA 3S41A 2IMWP 3QJJA 2W4DA 4DV2F 2GVDB 2HS3A 1HNZK 1HMVA 3QINA 2AW0A 5BPNA 2RAQA 1G2EA 1KN5A 1R8AA 1E4GT 1U1PA 3HF5A 2OMOA 1KBUA 4YD1A 2ASMA 3ID8A 3I76A 3KLEB 2AEMA 4MLHA 4P74A 4C3MA 2Q1NA 2WVDA 5J2IA 4Z4EA 4YOTA 2H3QA 4LQ9A 4WP3A 4ZKAA 5ETLA 5FIIA 4IG0B 2QXFA 1S9GA 3MUVP