4DS5A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mg2+
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 207
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds5A01
4IG3A 5CZ2A 3HP6A 2HNDA 1UA1A 2JEGA 3KHGA 2HHXA 4KN7A 4CJTA 2ZJ8A 2FLPA 3V1QA 1TFRA 2ZJAA 4CJ5A 1C7YA 3DMJA 1H38A 2HHQA 3I0RA 2XY7A 3AO2A 2PY5A 3MEEA 1PZNA 2JEFA 3PX6A 1L3UA 3Q8RB 4CHOA 4J9RA 3RMDA 3B0YA 9ICTA 2KZMA 3QNOA 4OKEA 1EXQA 2ZE2A 4FJJA 2PFNA 3ZSXA 2FBVA 3M8PA 3S3NA 1NKEA 1ASUA 4LSNA 4I2JA 3LPUA 9ICJA 5FROA 4GC6A 4FLXA 3KHHA 4ELTA 4GXIA 4ZH4A 1K1SA 4NYFA 3QNNA 1KLMA 4PPXA 4QZHA 4I9QA 3QO9A 5DKWA 1COOA 3ZSRA 4R64A 5JUMA 5J0PA 3AUOA 1HQEA 4JWMA 1TL1A 5DDYA 3HP9A 3ZDDA 3IG1A 3S9HA 3N97B 3T5LA 4I2IA 2IOCA 8ICMA 3T19A 1FK9A 2W9MA 4F4ZA 2ZTDA 4CEEA 4ECQA 4MF8A 8ICHA 4CGFA 4EEYA 5D49A 4H4OA 5L1IA 2OZSA 3K5LA 4FLVA 2UVRA 3V9ZA 4KLGA 3OHAA 2W9BB 1X9WA 3RJIA 4IKFA 4EYHB 4R8UA 2FPLA 4IBNA 3MR5A 1I39A 4LSLA 3Q8QB 1ZQRA 4F4KA 1U49A 3MXIA 4DSEA 2NRTA 8ICNA 3OY9A 4IRDA 4Z0UA 4HHTA 5J0UA 2E6LA 3PO5A 2I9GA 4FJKA 1IKVA 1S6QA 3JSMA 4RQ1A 8ICKA 3IS9A 1JLCA 4M3RA 3V9XA 3ALYA 4OVLA 9ICOA 1S97A 9ICRA 1KTQA 1ZQXA 5KGXA 3IHQB 3BQ1A 4KLIA 1D9DA 1S0NA 5KI6A 5EWFA 4YD2A 1Z00B 4BWMA 3ZDAA 4UBCA 3UPQA 3RMAA 3SV3A 4FK0A 2C22A 1QTMA 2QXFA 5J1EA 3NCIA 3H7IA 2HHVA 2YNIA 4FLUA 3B6OA 3VA3A 3PMLA 4DQSA 4MEXA 4J2BA 3V7LA 4CHYA 3AVNA 7ICRA 2VG7A 4M3ZA 4CGHA 3DLGA 4CGDA 1CZBA 3ZT3A 2DY4A 1BISA 2I1QA 4YMOA 5KFBA 4ED1A 4FM1A 2ASJA 5KG5A 1ZBUA 3ISNC 4QWAA 3HYFA 5J0SA 2HHSA 1MQ3A 3LP3A 3V9SA 3RB3A 1XSLA 1RCHA 1HYZA 3TQ1A 2XGPA 2IC3A 3OJUA 3KLHA 3RB0A 3OYEA 4CJKA 1RDDA 1A76A 8ICTA 4CJEA 3M9OB 1T3NA 3QIOA 1KCFA 4F3OA 1G15A 3OYFA 4TQSA 5KFYA 1EP4A 4LD0A 3WNFA 2C2RA 3V1OA 3OYBA 4O5EA 3KD5E 4M2YA 3QEVA 4PHEA 1BL3A 4GXKA 4E1MA 4RNOA 2HNZA 4Q8EA 3MABA 3ISCA 2VG5A 4PQUA 4UQGA 3GIJA 2RN2A 4CK1A 1NOZA 1IM4A 1XHZA 4RG8A 4G3IA 4HYKA 1VSMA 4OPJA 4RNNA 5E41A 3PX4A 4I27A 4KLDA 2WOMA 2E6MA 4Q0BA 2R8JA 3OYDA 4NYNA 4E1NA 5F9NA 3RR7A 9ICPA 4FM2A 7ICHA 4MFFA 4MQ3A 3CFRA 1KFSA 3QEAZ 1QSLA 4QW8A 3SQ1A 3SQ2A 3PW0A 4CHPA 1A5WA 3NGIA 4LH5A 4KI6A 2YKMA 3IRXA 1ZQQA 4FLZA 1HPZA 2IBKA 4XIUA 4FJ7A 1Z3EB 3T5JA 4KLJA 4AHVA 3A2FA 3LWMA 3HPHA 5KFOA 4IQTA 4R63A 3ZT0A 3U6FA 3Q8KA 4M0AA 4FXDA 1CLQA 2C28A 3KLGA 3GFKB 4BDYA 4KLMA 3JPQA 4RQ3A 4Z6EA 1EETA 4KREA 3ZDBA 3ITHA 1RBVA 2FPMA 4CGJA 3VQQA 4KITB 1ZQKA 9ICXA 3V6DA 3C6TA 1JLBA 3VN5A 4Z4IA 4DTPA 2AGPA 3RR8A 5J0WA 4DQPA 1MU2A 2HHUA 4EBDA 4ID1A 2BGWA 1SKSA 3G10A 4KI4A 2P66A 1NJZA 2KTQA 1HUOA 7ICQA 3F73A 1KFTA 4FLYA 2ZJ5A 2P1JA 4BACA 1S76D 3PR5B 1YVUA 2W9CA 1RNHA 3NFAA 4E7IA 1DTTA 1TK5A 3C1YA 9ICMA 3ORYA 4F4WA 2A1SA 2XY8A 4CHNA 1U45A 3NGZA 1LWEA 2C2DA 3ZT4A 5KFLA 3TAQA 4JV1A 4I2EA 1LAVA 1QLNA 3BDPA 4AHSA 1BCMA 3H40A 5KT5A 4C8NA 3RRGA 3MFIA 3SUPA 2FLNA 3VQAA 2HHTA 2XHBA 7ICTA 4R5PA 4R65A 2GUIA 3AA4A 2C2EA 3ASMA 1F21A 1ZQLA 2ZQBA 3EY1A 4F92B 1VSHA 4KLTA 1ZQYA 2XC9A 4I2QA 1SZPA 1LAWA 4EP5A 3AA2A 4M3UA 3HWTA 4QZ8A 1VSDA 2IHMA 4CEOA 1Q9XA 1T05A 1A5XA 3VQDA 5HLFA 4IR9A 3P83D 4E0DA 3MGIA 5KG3A 2VANA 5DGAA 1ZJNA 3CM5A 1YTUA 3OJSA 4FW2A 5HNKA 1S0VA 4E7LA 2IDOA 5KG1A 9ICNA 1S1TA 3RAQA 9ICEA 3NHGA 1ZQZA 4ECTA 4CFBA 3OS1A 3EWAA 4H4MA 1ZQUA 4YMNA 2FBXA 1NJXA 1J54A 4B3OA 5J2QA 1RT2A 3JPSA 3VQ8A 4FO6A 1S9EA 4E7HA 4TURA 3MDAA 1SKRA 3EZ5A 2EX3A 5KFIA 5FDLA 1WSGA 4CCHA 4TQRA 4BE2A 3QE9Y 3LANA 4QW9A 7ICJA 3AA3A 4R66A 4N47A 1Q9YA 4Q43A 3M8RA 4CHQA 1D8YA 4NCGA 1BQNA 4DO9A 3OYLA 4MFAA 2BHNA 1ZQGA 1BIUA 1JX4A 1WAFA 9ICCA 4CF9A 2XCPA 4AHUA 3OYKA 2W9AA 4IG0A 4Z4EA 1TKTA 1JXBA 3G6VA 2HW3A 4Y1DA 1RTDA 2BPFA 1Y97A 4UAYA 3V1RA 1XU4A 1S9FA 2P6UA 4OLAA 5DQGA 8ICBA 4LZDA 1MQ2A 2VG6A 1TK0A 1Z25A 1HQUA 2GBZA 4YD1A 3TAFA 3D0PA 4F8RA 2YKNA 5HRPA 2V4RA 4R8UB 3SPYA 4RQ2A 1T4GA 3NAEA 1VK0A 1MC8A 1S10A 3C1ZA 4QAGA 3NDKA 4I2FA 4KLLA 2OZMA 4JV0A 4IDKA 3ISBA 4LVSA 5KFSA 3VQ5A 8ICXA 2FMSA 1IG9A 4EZ9A 4AILC 3VA0A 2PFQA 4DSIA 3OVNA 4Q5VA 4F3TA 2H5XA 4JS4A 1T8EA 3VQ9A 1N6QA 3TWHA 3LP1A 1XS9D 2XY6A 1KDHA 3RAXA 3T1AA 1R0AA 5L1LA 4RW4A 1LWFA 4ID5A 5CHGA 4FZYA 2BKEA 4UBBA 1BI4A 4LY7A 4LZGA 5HHHA 1ZQWA 1CXQA 4JWNA 1ZQFA 1VSLA 3KD1E 1FKOA 2NRVA 4J2EA 4DS5A 1S1XA 4QOZB 1C6VA 4FZZA 1XWLA 3SUOA 4DWIA 9ICGA 5IIOA 3C5FA 3RJEA 4FJMA 4NM1A 2X6NA 4FJ8A 2Z1HA 4W5OA 1X2IA 4QZCA 2J6UA 4BXOA 1KVBA 3O4NA 5DQHA 1BVSA 2YNFA 4QZIA 3K5MA 2R8GA 4CEDA 3TFRA 4NLZA 2R8IA 2IHNA 4FK4A 2XGQA 3BQ2A 3NTUA 4BGDA 2D0CA 5CA7A 1VSJA 4ECYA 4M6WB 2F1IA 5KFWA 1ZQIA 8ICIA 5FRNA 4DF8A 4ECVA 1RXVA 4I28A 4ECZA 3GV7B 4HCCA 3ETLA 4O55A 4QWEA 2ASLA 1U9LA 1KVAA 2Y1IA 2IMWP 4DTOA 3SYZA 3Q8PB 3JPRA 1RXWA 4DF4A 4DS4A 1L3SA 4B9TA 5CB1A 3THVA 4ED7A 8ICLA 4KTQA 5DBCA 3KJVA 3HVRA 5J2PA 1U47A 8ICOA 3UQ0A 4CJ4A 9ICQA 4DTUA 2W9BA 2OWOA 3I0SA 4XRHA 2F8SA 4F93B 2FMPA 5BOMA 3KLIA 1RTIA 4UB1A 3QERA 4YG2A 4P4OA 3GV5B 2BE2A 4AHTA 4DTNA 4CFAA 5HRSA 3RBDA 4FW1A 1TAUA 4DU1A 2VA8A 3H4DA 1QS4A 2AGOA 3QETA 5IIJA 4DSLA 4KRFA 4M47A 3JPPA 3HT3A 8ICFA 2R8KA 4RU9A 3CFOA 8ICQA 3QLHA 3RH5A 4I7FA 3WNEA 5KFVA 3EPGA 2ETJA 4F4XA 1HNVA 1IO2A 1ZBHA 2G8FA 3AVIA 3LP0A 2DFLA 1WSIA 5KT2A 4RPYA 2WTFA 3RJGA 4XUSA 5J29A 3ZT1A 1TAQA 2AQ0A 1ZBLA 8ICCA 3L2UA 3O4QA 3RBEA 3QESA 5IIIA 3SZ2A 3NBPA 1RTJA 9ICKA 4KLQA 1SL0A 4DOAA 8ICRA 5KFMA 4F4YA 2D0AA 3B6PA 4ECRA 1XC9A 1EX4A 2Y1JA 3L3VA 4FJ5A 2AQ4A 4O4GA 4PH5A 3NH0A 7ICNA 1ZQPA 3MEDA 4FM0A 2R8HA 1LV5A 2LSNA 4CJPA 3NH2A 5D46A 2O4IA 1KRPA 2Z1GA 5KG7A 4ECWA 1NOYA 2JGUA 4P2HA 3HL8A 3C2MA 2HMIA 4UAZA 4DTRA 2D5RA 4WE1A 3GQCA 1BCOA 2QKKA 2YHBA 3FFIA 3FDSA 3L2RA 4KLFA 5J2NA 4IQWA 1U04A 5CYQA 4MFCA 4JLHA 2ATQA 2R7YA 4CF2A 1ZQEA 8ICYA 2DFEA 5DBAA 3V4IA 4HUGA 4F5OA 3O3GA 1ZETA 3VQ4A 4CERA 5HBMA 3FYHA 3HO1A 2DPJA 8ICZA 1RT6A 3VQEA 5DMRA 4K4IA 1A5VA 3AVLA 9ICHA 1HYVA 4BE0A 2B5JA 3PO4A 3MFHA 4M3XA 5C42A 3U3YA 4O44A 1NK6A 2XRIA 2X74A 3BJYA 3JPNA 1RT5A 4BDZA 3ZCMA 3GIMA 3C6UA 9ICBA 2VA3A 3C2KA 1B9DA 4CJVA 3F9KA 1J9AA 1IKWA 4RQ0A 4J2DA 4Z4CA 1S1WA 1X9SA 3VQ7A 4EZ6A 9ICLA 1BPXA 3ZD9A 4PUOA 4DQRA 1VSKA 1W0HA 3ZDEA 4P4MA 3DM2A 1XHXA 1HNIA 4M9JA 2P5OA 4CEFA 4Q45A 2DFFA 2I5JA 1HUZA 2BGGA 2G8IA 4NLGA 5KGWA 5IIMA 3NF9A 2B6AA 3AVAA 4KLEA 2VA2A 2BR0A 4F5PA 3G0ZA 3SNNA 2FMQA 2BDPA 1S0OA 5J0OA 4W5QA 5KFXA 3V6KA 3LPTA 5CR0A 5JS2A 4RQ8A 2D0BA 4DFMA 3HPOA 8ICVA 1KEJA 3K58A 3TARA 2RKIA 3KTQA 3LP2A 1K6YA 4AH9A 1UT8A 1CZ9A 1TKDA 9ICIA 4YVZA 3HJFA 3T5KA 4J9KA 5J2JA 1S9GA 4CEQA 5DG8A 5KG6A 2JLEA 4Z6CA 4CF1A 4B9UA 2E4LA 4KLSA 1ZQTA 4UB4A 4HCBA 2V9WA 3AU2A 3H8SA 3HPGA 4OJRA 4DEZA 1L5UA 4FJHA 4B9VA 5J0QA 1WSEA 4B8CA 3TAPA 1NK7A 2XY5A 4Z6DA 2BPCA 1TKZA 2HB5A 4YQWA 3VQCA 4W5NA 1V9PA 1NK0A 3SJJA 4UB5A 1SL2A 3WNGA 4ECSA 5KTQA 4M9LA 1ZQBA 4YP3A 4O5CA 4RQ7A 1WSHA 3UXOA 3KKSA 3K75D 4DLEA 3NE6A 5J2AA 1SV5A 4FJXA 2ZTEA 9ICSA 4JRQA 2DPIA 2NRZA 1N48A 3SV4A 5KT6A 5J2EA 4IQUA 5KFPA 4KHYA 1CXUA 4BXOB 4BDPA 2QKBA 3RTVA 1SKWA 1JXEA 1HRHA 1KFDA 3PMNA 4N5SA 4M6WA 4I29A 2PYLA 1K1QA 1JL1A 4TUPA 3V72A 1RPLA 1QQCA 4B9LA 1C1CA 3AVBA 4IQVA 4RPZA 1NOMA 2YNGA 2BCSA 4FS1A 2BCUA 8ICWA 4CK3A 1BI4B 2YNHA 2KN7A 4RW7A 5HRRA 4FCYA 4CJRA 4NCBA 3K2PA 4ELUA 3TAGA 4J9PA 4ED8A 4FJIA 4BE1A 1S1VA 3ZSVA 1RILA 1RT1A 2DFHA 2W9CB 1BPYA 3DOKA 4HTUA 1JLAA 5C5JA 8ICAA 5F9LA 2IA6A 3MEGA 5HMMA 5L1KA 4TSXA 1DTQA 4DL6A 2JZBB 1BHLA 1GOBA 7ICKA 5TZVA 1NK4A 3PV8A 5CJ7A 4RQ5A 1ZQMA 4RW8A 4KHWA 3RRHA 4NCAA 2HVIA 1NK9A 2ATLA 1ZQNA 3RMBA 4K4GA 2V4QA 5KFRA 4DLGA 5IINA 4J9SA 5DQIA 5L1JA 2BQ3A 3T5HA 3Q8MA 1UA0A 2KZ3A 3GIKA 3OS2A 3HVTA 4RNMA 4KKOA 1ZQSA 4AHRA 2JEJA 3O3FA 4FVMA 4FJGA 1REVA 3G6YA 1ZQDA 4K8ZA 2KFZA 4F5NA 4TUQA 1S6PA 4RZRA 2RDIA 3MR2A 2AJQA 4FLWA 2KQ2A 4DTXA 3P5JA 3KK1A 3GILA 4B9NA 1WSJA 4FJNA 4QZBA 3QINA 3RJJA 2G8VA 3VQBA 5KG0A 7ICPA 2KW4A 2NUBA 5DB7A 4W5TA 4YXMA 4XA5A 3AVJA 3V7JA 2B21A 9ICFA 4CJFA 1IH7A 1RBUA 4M9GA 2NRXA 4C8KA 1Z26A 5DBBA 2ZTCA 1JLEA 4EP4A 4O0IA 3RMCA 1U4BA 3MXJA 3K5OA 1VRUA 4M41A 3DLKA 1JKHA 4DOBA 3I8DA 3ZSYA 4Z4FA 4X5VA 2UVWA 4F2SA 1GOCA 2BANA 4CJSA 3RWUA 2JZBA 9ICUA 2UVVA 2YHAA 4NXZA 4YR2A 4DU4A 3MR6A 4E19A 1NKCA 1NJYA 3MBYA 4M42A 4DL5A 2HNYA 3LK9A 1CEZA 1VSIA 1LB2B 2RPIA 5HP4A 4Z4HA 1EKEA 4OLBA 2X78A 4W5RA 1N56A 1ZQCA 2OPRA 1ZYQA 3QEWA 4KLHA 1ASVA 2F96A 2OPSA 4CF0A 4E3SA 4KMUA 5HP1A 5J0YA 4CIEA 3N4MB 4DSKA 2ITGA 5DB6A 2MUTA 4CFCA 2J6TA 3QEXA 2GV9A 7ICUA 4L8RB 1TL3A 1ZJMA 4F5QA 3SQ0A 4XQ8A 4DL2A 1BIZA 1A77A 5J2FA 1T03A 1RDBA 3LDAA 4QWBA 2BCRA 2G8HA 3RB6A 1BPEA 2Z1JA 4K8XA 4QZ9A 4F2RA 1WSFA 5KFEA 3C5GA 8ICPA 3JPOA 1JLQA 3AVHA 3AVKA 1HYSA 3V81A 4K4HA 3RJFA 3QIPA 5EWEA 4NY8A 3HM9A 2OPQA 3C94A 3UXPA 3KIOA 3NH1A 4C8OA 4KTWA 2W8KA 4Q44A 4O5BA 4CJQA 1T7PA 2B4JA 4HVJA 4QWCA 4DQQA 2VWKA 4E7KA 4CJWA 3NGDA 1RBSA 4BWJA 3TANA 3OYGA 2G8UA 2XO7A 2PFPA 4B9SA 1BPDA 2J6SA 1BPZA 3V6JA 3SI8A 4M3YA 4MFBA 4GMJB 2IS3A 3CQ8A 4CGGA 4G1QA 3MGHA 5KT7A 3GIIA 4QZFA 3RH4A 3OYIA 1YT3A 2ASDA 3UQ2A 2Q0ZX 4DFPA 5DLGA 3AVMA 4GLXA 3LAMA 3K59A 1B22A 2IGIA 5KFUA 4AHCA 1LW2A 2F1HA 5J0RA 3SI6A 3KLEA 5CY4A 1QSSA 1C0UA 3OGUA 2FLLA 1NKBA 8ICSA 4CJ3A 4KB0A 1U48A 4O3SA 5K14A 3TABA 1FXXA 1TK8A 4I2HA 1RBTA 5I42A 3KKRA 5HHIA 4F50A 3ZSOA 4YFUA 4ICLA 3AO3A 1CUKA 3PUFA 1WCNA 4FZXC 5FRMA 3C2LA 3PW7A 9ICVA 3C23A 3TFSA 1S77D 5J0XA 3PR4A 3OS0A 3DLRA 4I2AA 3OYNA 2P5GA 5KFKA 3QEPA 3T3FA 3AU6A 3ZSZA 1XO1A 1VSFA 2A1JB 3B0XA 4KO0A 7ICEA 4OGCA 4QZDA 1UWBA 1HJPA 4QZGA 2PI5A 2HHWA 2Q3SA 1S0MA 5KFGA 1LW0A 3KK2A 4DL3A 3DYAA 5T7BA 3M9MB 2PYJA 4MF2A 1BGXT 4J9LA 5KT4A 5J0TA 2ALZA 3AO1A 4F91B 4JUZA 3CFPA 2MAXA 4OGEA 4I2PA 1XI1A 3HSTB 2BPGA 2VWJA 4J9NA 2HVHA 3K5NA 4KHNA 2W8LA 3JPTA 5DG7A 4DL4A 3RJKA 1TV9A 1JMSA 5KG2A 3MR3A 2G8WA 2XCAA 3V9UA 4ED2A 5KFFA 2AGQA 3SCXA 1IKYA 3M9NB 3Q8LA 1RZTA 3QEIA 1W9HA 5HMLA 1NK8A 4J2AA 3OSNA 1L3TA 4E7JA 2A1RA 5CYMA 3QZ7A 4CK2A 3CYMA 3KHRA 2QK9A 2FBYA 3PX0A 5KT3A 1MSWD 3DRSA 9ICWA 1JLGA 2FC0A 4C8MA 3AA5X 3DRRA 1RT3A 7ICMA 4Y1CA 2G8KA 3V7KA 4FBTA 3P1GA 3QZ8A 3S3OA 1Y88A 3ZDCA 1KVCA 4ZHRA 3VQ6A 2KFNA 2ZUBA 4M3WA 4F5RA 5EWGA 4YR0A 3AO5A 4N76A 4UAWA 4ECUA 3E2EA 5J2IA 4H8KA 1O1WA 4YMMA 1RYRA 4FJLA 4KFBA 4O0JA 5L9XA 4UB2A 4KLUA 1JL2A 3LDSA 3UXNA 4JV2A 3PW4A 3LWLA 4P4PA 4RUCA 3C95A 3OHBA 5KFNA 1UOCA 1ZQHA 2FBTA 2YV0X 4FS2A 1Q8IA 5J2BA 4DQIA 1ZQVA 4PWDA 3AVFA 4IFYA 4DOCA 2ISOA 5D3GA 4OPKA 2NRWA 4GC7A 3LZJA 3PW2A 1QE1A 1GOAA 4O3RA 4QZEA 5J2GA 1TVAA 4RQ6A 3JYTA 2W42A 1IKXA 4CEAA 4I9LA 4YNQA 3HXMA 4CGIA 3PY8A 1DGSA 1DLOA 2PZSA 5C24A 4UB3A 3H4BA 5J2HA 5BOLA 1L3VA 1B9FA 3KHLA 4KLOA 2ZUDA 3IM1A 2IAJA 3E01A 4OKJA 1BPBA 1JN3A 4J9OA 3CG7A 3ZSWA 4DFJA 1ZQOA 4FLTA 2F1JA 1JIHA 1YTAA 2JEIA 5EOZA 4DTJA 3LZIA 1FKPA 2ISPA 3H8JA 4IRKA 4O3PA 1JLFA 4FBUA 2OPPA 3TI0A 4DTMA 4DG1A 3NF7A 3CM6A 3MAQA 4JRPA 1KSPA 5KFQA 4RPXA 3GV8B 3OYAA 4M9HA 3PNCA 3BGRA 4GXJA 1SL1A 3EPIA 5KG4A 3AV9A 3V6HA 1TVRA 1ZQJA 4PGQA 1DOQA 3KLFA 3QEBZ 1C0TA 3G6XA 4CJLA 3M8SA 1QHTA 4HUEA 1RT4A 4RT3A 4M9NA 3SQ4A 1D8LA 3MECA 4NLNA 3NGYA 1RBRA 4O3QA 5SZTA 4CE9A 3VQPA 3U3GA 3ZSQA 3H8WA 3NF8A 1C1AA 1D5AA 4IFVA 3HW8A 4ED6A 4DSFA 7ICVA 4CIGA 3L2VA 2BQUA 1X1PA 3OYCA 1WN7A 1Z00A 2MUTB 4ELVA 4RT2A 2P6RA 4RW9A 5I3UA 7ICSA 4DSJA 4CFDA 5CZ1A 1S5JA 2RDJA 4ED3A 1B43A 5SWMA 3ISDA 4M3TA 4LH4A 1RDAA 1SUQA 4NLKA 8ICGA 2PI4A 2FPKA 3O3HA 4GW6A 2OYQA 1NJWA 4I2CA 3TAEA 5KFDA 5CP2A 1EXNA 4DMNA 3SUQA 4CEZA 3K57A 2KZZA 1S1UA 3OSPA 1WNSA 4YCXA 5KFTA 1J53A 1TGOA 3C21A 2PXIA 3S3MA 4PGXA 4JK1A 3Q8SB 4M04A 3OYJA 5J2CA 5DLFA 5HRNA 1WAJA 7ICGA 4KAZA 3AVCA 4B08A 5D4BA 1I3AA 3SUNA 4O9MA 3LAKA 4J9MA 8ICEA 3DLBA 4N41A 4TUSA 4CEBA 4PGYA 4B9MA 3AO4A 3IAYA 4Z6FA 4CIFA 2WONA 3PW5A 1TKXA 4KHSA 5DG9A 3PVXA 1D9FA 5KFAA 4RUAA 7ICLA 3SPZA 3DRPA 4KTZA 5BPCA 1ZQAA 5DGBA 2X6SA 9ICAA 4ZTFA 4IR1A 5DK5A 1HJRA 2P51A 4O5KA 1VRTA 3OYMA 4PHDA 4ED0A 4I2GA 2LYHA 4NM2A 3NF6A 3DLHA 2RF2A 3DLEA 3L3UA 5J2KA 3ULDA 1LWCA 2ZUCA 4ECXA 4KHQA 5HROA 4KPYA 1HMVA 1UT5A 4YFKA 4ZTJA 3L2WA 1BQMA 1B92A 1X9MA 4CF8A 3HX0A 3EYZA 5IILA 4B8AB 4CHZA 3RB4A 4PY5A 2A1JA 3BQTA 4GVMA 2AU0A 7ICOA 3H08A 4HUFA 2PFOA 3DOLA 2GWSA 5KFHA 4EYIB 2BCVA 4I2DA 4RQ4A 3AVGA 5KRSA 5IIKA 4OKKA 3ZT2A 5DB9A 1ZBFA 4KHUA 3LALA 1J5OA 4C8LA 4EBCA 4J9QA 1VSEA 4I2BA 4N56A 4DL7A 1C0MA 1XSNA 2OA8A 1AROP 5DDMA 5KRTA 4Q8FA 1RDCA 4CECA 5J2MA 4PHAA 4KV8A 4Z4GA 5DB8A 4DU3A 3TR8A 4CESA 1C1BA 3L2QA 4QWDA 4O3OA 5EU7A 5KFJA 1RYSA 3HK2A 5JS1A 2BQRA 2DTUA 1RTHA 5C25A 3D45A 3L8BA 1N5YA 4EBEA 1UAXA 2Z1IA 3RH6A 1TV6A 4MEYA 4PHPA 7ICIA 8ICJA 4M45A 1NK5A 4QCLA 1ASWA 4O3NA 4E89A 1ZBIA 4YXJA 5KFZA 2M9NA 3MXMA 4FJ9A 4IRCA 5J2DA 1ITGA 4FYDA 2O4GA 4FK2A 3RJHA 3ZD8A 5KFCA 4CJUA 4YN4A 3MDCA 3V9WA 3DI6A 4YR3A 1KLNA 3KK3A 4PA1A 1WCLA 4DFKA 1JXLA 3UIQA 4QZAA 1QSYA 3OYHA 3WNHA 2UVUA 1IXRA 3EW9A 4JS5A 2BCQA 5CWRA 3GDXA 3K4GA 3BQ0A 8ICUA 1WLJA 4RW6A 2ZD1A 4DTSA 4KN4A 3TAMA 2EHGA 7ICFA 1RT7A 3M8QA 1XSPA 2F8TA 4KB1A
chains in the Genus database with same CATH superfamily
4G9BA 4IG3A 3NOGA 2DKXA 5CZ2A 4YORA 5ALHA 2HNDA 2JEGA 5KPTA 4Y34A 3LH2S 4KN7A 4CJTA 3SK3A 4BRKA 3M2VB 2RU9A 1HA1A 3CCMS 5DDRC 1H38A 3ATVA 4ZVGA 2PY5A 5BRHA 1L3UA 1O8BA 2QE5A 3AJDA 3VERA 3OVBA 4DV0J 2E5LF 3TSQA 4J9RA 2V4JA 2CPXA 3RMDA 3B0YA 5HJXA 2M4MA 1WKJA 1R89A 1KQSR 1NNLA 3PFEA 3GL1A 2ZE2A 4QOTA 5GAGI 3G4SS 4LFBK 2PFNA 5GVQA 2VCPA 3S3NA 1ASUA 4LSNA 4I2JA 4OJLA 4TU7A 2DXFA 2JJ4D 4GXIA 4ZH4A 2R2UA 1WORA 3LDQA 2CPRA 1K1SA 2NUHA 4PPDA 1KLMA 4QZHA 3A3OB 2XLJA 4X66K 2QB0A 3AUOA 4K4UA 2VBZA 1HR0J 1SXLA 1EWRA 1JNRB 2MRLA 2CZ9A 3DHWC 4JWMA 5EE3A 1TL1A 3BN7A 5DDYA 1DAXA 1XMQF 1QQ6A 3S9HA 3N97B 5HQ8A 2IYGA 4I2IA 1TUUA 3O80A 5CZXA 2IC3B 3CCQS 2W9MA 4USVA 4F4ZA 3MM6A 3EVMA 2E9ZA 2J9DE 3LDPA 5K8PA 4JKCA 2JH3A 4CGFA 5AKJA 4I68A 2VJ4A 4EEYA 4JV5K 1NM2A 2F5GA 5L1IA 1QTNB 4OX9K 4OJOA 2HWHA 1NGHA 1BA1A 4CO3A 4JI4F 3MGJA 3OHAA 3BSAA 3ED5A 3RJIA 5DDPC 4BC9A 1HI8A 5MLCQ 2H5EA 2W4DA 3GCWP 2R7OA 1ZQRA 3KK1B 1NHKL 3PTWA 1M90O 3OTOF 4DR5K 2AHOB 1F44A 4IRDA 4HHTA 2YQEA 3TRGA 2HHHF 4C0OC 1VGYA 5IC6B 3VAJA 2Q36A 3NNCA 3GG4A 4M3RA 1RQNA 9ICOA 2P2CB 5I3UB 2WSEC 2ERRA 1TUYA 4YB1P 4ZVQB 2KJVA 5KI6A 2Y1LB 5AQTA 1Z00B 3IDHA 1TUVA 1D1UA 4F67A 1FCAA 3RMAA 4EFAC 2C22A 4QPXA 5LL6d 5T7LB 5J1EA 3QWPA 5ALFA 4FOIA 3NCIA 2KXHA 2AEMA 4RUBA 5MAOA 1VMBA 3VA3A 1FWLA 4HEA9 4DX5A 4JYAK 3PMLA 4MEXA 3M6VA 4GFJA 1S6PB 3SSSA 3BS7A 2DK2A 3E58A 1RADB 4BRFA 3D5MA 4M3ZA 4JI5K 5ALZA 5KPZA 2NNWA 2C2OB 3TVYA 2I1QA 1FK9B 2VV5A 3PSFA 3MF5A 1J5EJ 3N5BA 1DQ9A 2ASJA 1UW4A 5AKZA 4NO7A 2HHSA 4R0JA 1VYAA 3J81j 1ZTTA 3MMBB 5F0UA 2JC1A 1PBUA 2IC3A 3ZNUA 1N6QB 2YWKA 3OYEA 3BZCA 1WWUA 1HPZB 3CCWA 1A76A 3SMPA 4CJEA 2CNKB 4F3OA 1G15A 1EP4A 2F8MA 2ZDOA 2XMWA 4O5EA 1VQ6N 3GR0A 5EUHA 4CD3A 4A8XA 3IV6A 2Q1NA 4PL1A 5FLXY 4CVNE 2CPEA 4RNOA 5T7LA 5J1EB 3BS5B 4Q8EA 3MABA 3ISCA 3DRPB 3O8WA 5B0AA 4IFYB 1YRUA 4UQGA 2WVFA 4DL0C 2R7RA 1WKKA 1NOZA 1ATRA 1XHZA 3ELHA 2F9TA 2E8OA 4D3GA 1RWWB 4I27A 3CERA 1RTJB 3KLGB 2Q31A 2E6MA 4DV5K 4NYNA 3ZEUB 9ICPA 5IT0A 5ETLA 4MFFA 2WSCC 4MQ3A 5BXIA 1KFSA 4P9SA 3LP0B 4L3QA 4GMKA 1I1GA 2IFXA 3SQ1A 2D9PA 1HWIA 1E6VB 2OD6A 3HD2A 3NGIA 1B4SA 3BH6B 3IRXA 1ZQQA 2DNGA 2Y0SF 2DY9A 2VKZG 4AHVA 3E66A 4F0HA 2VC1A 4USUA 3LWMA 3RYLA 3T1YJ 5KFOA 4IQTA 3IS9B 3ZT0A 1NGJA 4DR1K 2W3SA 4M0AA 4NLOA 1Q86T 3GFKB 4BDYA 3M1VA 1M1GA 4RQ3A 1DJ0A 2K89A 4CLLA 5LXRA 1N8RO 3DJCA 3PEHA 1EETA 4UY8O 1HKAA 3OXLA 1F0MA 1VQON 1F1BB 3TX0A 4AL7A 2WAQD 2KVQE 2AGPA 2RQ5A 2XHWA 1K44A 3RUBL 2HHUA 5I42B 1UVIA 1Q16B 5AZJB 3VEYA 3KFWX 2UUWA 2UXDJ 2P66A 1LWXA 2NYVA 1NJZA 1FDNA 2W7PA 2ZJ5A 5F8JA 1BOTO 2J0SD 1YVUA 3H0LB 2NCKL 3OT9A 2QLTA 2Y1RI 2VYPA 2ZNYA 1VQSA 1V3RA 1XNQJ 3GZFA 3ZT4A 1ZXOA 1S72S 3CJ2A 3KXDA 5AJ3J 2V7ZA 2QSFA 1KHVA 3G4SN 3H40A 4USAA 1DTQB 2AV5A 4XH1A 4A5BA 2D3O1 2P9PA 3ADAC 2GUIA 3OVSA 1H2UX 1BNPA 1F21A 3ASMA 1DQ8A 1ZQLA 2F8EX 1RWOB 3G71S 2EWSA 3BS9A 1VSHA 2VFRA 5D78A 1E6YA 4I2QA 3D2EB 3CJKA 2XS2A 2HRTA 4M3UA 3HWTA 2RILA 3O4WA 3SAHA 1A5XA 3VQDA 3MEEB 4K5RA 3P83D 3IBPA 2VANA 4JI3K 1YTUA 2LA6A 4EEKA 5HNKA 4E7LA 2IDOA 2FJ6A 3WXIA 3RAQA 1DTTB 1GT8A 3J7YU 2HDOA 3VAHA 2HNDB 4OLOA 2ZWPA 3DLLQ 1ZQUA 2FBXA 1NJXA 4LIRA 1MW7A 4B3OA 3THWA 2FPHX 4CQ1A 3VQ8A 4FO6A 1FERA 1DQAA 3O9UA 1SKRA 4NZ7A 2EX3A 1JI7A 2KYXA 1OYEA 4KFBB 4RW4B 1IKWB 4IUFA 3QUQA 2B0GA 4FWSA 4C11B 2KVSA 5ALSA 4R66A 4N47A 3D2FA 1H73A 3QNWB 4MIBA 4TVAB 2HFNA 4NWBA 1D8YA 4XO0A 1WHYA 2NYIA 4DUYJ 4F02A 4DO9A 4DUZJ 3O1WA 1TUWA 3CF5L 4FSVA 1JX4A 3UN3A 2JHEA 3PM9A 3OYKA 3BM7A 4O8UA 4HTIA 4Z4EA 3W5YA 3NNHA 1Y5IB 2ZC4A 2NXUA 1K47A 2A3JA 3MUMP 4NL9A 3P4UB 1SV0C 1XU4A 2G0CA 1VQMS 2P6UA 4BRNA 2ZOFA 1UJ4A 5ETSA 4F9OA 2VG6A 1TK0A 3DC2A 4UF4A 5F41A 4F8RA 3SPYA 4R8UB 3MOZA 1MC8A 2FTRA 3QMLA 3T6JA 2VDIA 1TL4A 2IVYA 2W2NP 4M5JA 4LC9B 4PWUA 5JU5A 3NDKA 1NJIT 4Y0WA 2OZMA 4LVSA 5M1PA 3HZGA 1PVQA 2O6KA 1N5SA 5ALUA 1OSCA 1IG9A 1WHXA 2NXEA 1WHWA 2FGCA 4K0KK 1HNXK 4JS4A 2A6MA 1JALA 4LQ3A 5AK6A 3VOVA 4Y28C 1T8EA 3FZ2A 2XY6A 2B56A 1IR1A 2E5JA 4H0VB 5LSLA 2UZAA 2OCEA 2DNMA 1U2RA 2EG1A 1RYUA 5CHGA 1F0XA 3EVOA 4LZGA 1CXQA 4A8WA 4JWNA 1VSLA 4U7CA 2ZIUA 2A5XA 1Y64A 3O9SA 4J2EA 1XN9A 3MPWA 2ROEA 4NLQA 2HNZB 5ALLA 3DLGB 1V3SA 2DO4A 2X6NA 4W5OA 3TP2A 1X2IA 2J6UA 1RU2A 1BLUA 1OQ3A 5DQHA 1HQ2A 4DPYA 2FSJA 2YNFA 4YOWA 3G6EN 2R8GA 2W4CA 3PRVA 4PXEA 2AX1A 2BE7D 4KR0B 3KJQB 1LWFB 3NAIA 3ENWA 4FK4A 4PQUB 3GE9A 1RACB 2BJ9A 2X1AA 4YY3J 4U67L 2MB0B 5CA7A 2W40A 4CW7B 4ECYA 3F53A 5KFWA 8ICIA 3P3DA 4I28A 3GV7B 4HCCA 1ICEB 3LOUA 4B6JA 2ASLA 4CZFA 1U9LA 1EQYA 2Y1IA 4NEYA 4DTOA 1AB8A 1RABB 1L3SA 5CB1A 3RGIA 2P9LA 2Y9UA 3TWZA 4ED7A 5A8RB 3SAFA 3E3XA 4IH6A 3KJVA 4M5DA 3HVRA 1FX4A 1U47A 1CULA 9ICQA 4KH1B 2W9BA 3I0SA 3U26A 3LUYA 3ILOA 2W3RA 1Q0NA 2LQBA 2IBOA 3UCGA 2DO0A 3T9NA 3KLIA 4P4OA 2CPHA 4CFAA 4WXOA 1QVGR 1FE4A 4FXWA 5HMXA 3RVCA 1TAUA 2AGOA 1IBLK 1IWAA 4NYZA 4JYAF 3ZTPA 3NMAA 2HZAA 3MXHP 2RHFA 2I7NA 1YXQA 3JPPA 2ZBPA 4GKJF 4WTOB 3HT3A 2HBJA 8ICFA 2AF6A 4RU9A 3RH5A 2QEXS 2Q2RA 2M0NA 3EPGA 1RT3B 1HNVA 1IO2A 2A6OA 1ZBHA 1N5WA 1WSIA 4JKFA 2DVIA 2EDUA 5J29A 3ZT1A 1S72N 1Y3KA 2AQ0A 8ICCA 2FHJD 2X1GA 3O4QA 3L2UA 1X8DA 3NBPA 2QWPA 4KLQA 2VQEK 3LTOA 8ICRA 3H0MB 2DF4B 3PACA 4F4YA 2Y1JA 4FJ5A 2AQ4A 4W90B 7ICNA 2R8HA 2YHYA 4XEIA 3NH2A 5D46A 2FLOA 5G0RB 2FSKA 4CH7A 4NLSA 2A6AA 3VCDA 4C6AA 1MROA 2KIWA 3AHPA 2X1BA 4PQAA 3FFIA 3CSKA 3FSIA 5J2NA 2D41A 2LQ9A 2ASOA 1SB3C 1P8GA 3NMUA 4UUWA 3K17A 1IIPA 1N32K 2AJ2A 3JB9k 1LVHA 2KRRA 2EZYA 4HUGA 4F5OA 3MTKA 1ZETA 3VQ4A 5EY4A 2B4OA 1ATSA 4NLXA 5HBMA 2KHQA 3FYHA 3HO1A 3HRGA 4DCHA 3X1LB 2E29A 2JGAA 4O44A 4JK8A 2QLFB 4EU0A 5FPEA 2HFUA 3ZCMA 5EX5A 1H2VZ 4YY3F 1F9HA 2W1BA 3KJNB 4C4WA 2F65A 3D4JA 1KAXA 2DNRA 1FJ7A 3H5YA 2IM0A 4Z4CA 1YF5L 4AL5A 1Q7LB 4HWIA 2VONA 4EZ6A 5AXNA 9ICLA 3A8YA 2E5LK 4PUOA 3NS7B 4DQRA 3VF2A 5K14B 3SEIA 3ZDEA 1M1HA 3QJLA 2Q43A 4EX6A 4O4RA 2VIXA 4MLEA 3T1YF 1NGIA 2PGCA 1RT7B 2PT0A 1CG2A 2BGGA 2G8IA 3HZEA 3NF9A 2BR0A 1YG0A 5GAEU 3G0ZA 3SNNA 2BDPA 1RKJA 2LXFA 1JCFA 5AI4A 5J0OA 2D7SA 1B64A 3V6KA 1FRJA 2D0BA 4LBIA 3QRQA 2XULA 3TARA 3KTQA 3QT5A 4X62J 4YVZA 4ED5A 4F3QA 3HZ6A 4X4NA 1S9GA 5I4MA 5BREA 1W2IA 3MCPA 2DISA 3D2QA 3OPKA 1AQ6A 1NHUA 4Z6CA 3T79A 2V9WA 4KHRA 1YZ6A 3H8SA 3DNCA 1L5UA 2O8EB 1NGDA 1GLDG 1NZPA 5J0QA 3SR6A 4IQXA 3R8YA 2XS5A 4DQ8A 2VBWA 2OELA 2ZIUB 4WF9Q 4JHDA 2RT3A 3KVGA 2HB5A 2R2TA 4YQWA 4RQMA 2ZJRQ 4W5NA 1U2FA 4ICLB 5GADU 2UU9J 1AFJA 4I64A 3AGRA 3WDOA 3I82A 4ECSA 2YMLA 5KTQA 3L3CA 3UXOA 3QU2A 5CYMB 4WQ4A 1O03A 2OPSB 3NE6A 5J2AA 1O5JA 5ALYA 5E3PA 4RTFD 1M1KO 2GH1A 4KHYA 5KFPA 1FKOB 4BDPA 4CYUB 1C4CA 1YJ9S 2QKBA 2NV3A 4H4KC 3RBZA 4ZPAA 2F7TA 3FSYA 4YB5A 4N5SA 2FSNA 2O8BA 2Q6BA 4X65K 4CNQA 4I29A 1JL1A 3V72A 3R3LA 1QQCA 4IH5A 4IQVA 3TACB 2DH9A 1L7PA 2YNGA 3EEQA 2ILZA 3WEEA 2BZFA 2WZ1A 3DXMA 2BCUA 2GMJA 3GU3A 4CK3A 4QR1A 2YNHA 4YMEA 2GJIA 2WK4A 2X7IA 1RB0A 5HRRA 2VQEF 1VJQA 1HI1A 3L4IA 3BN4A 1TR0A 2DEIA 1M90T 3AGKA 5AI6A 4J9PA 1SWVA 1KN5A 4FJIA 3PYFA 2NLWA 1BPYA 1BWVA 3OHRA 5A2QO 2NREA 3DOKA 2HI0A 3QAEA 3Q7BA 5F9LA 3AOBA 1YBUA 4JI7K 2FZGB 2RNEA 3KLIB 4TSXA 1DTQA 4DL6A 3K8WA 2L08A 3VGVA 1VRTB 3N5FA 5E0OA 3NVWA 4FWKA 3PV8A 1PVPA 2V8GA 1T11A 3JSBA 3QSYB 4I6AA 4J37A 5IINA 5ETTA 2JR5A 4KGMA 1HBOB 2PKEA 4CLUA 3UKRA 4DUYF 5I3PA 4X4TA 1EQMA 2YKQA 1S4FA 3OS2A 3CI5A 2I5JB 3D0HE 3JAMU 5EHHA 4AHRA 2UXCF 3O3FA 5F8LA 3QXGA 1KHWA 2RRNA 2VH7A 2EFNA 4ZCLA 5HK4A 3OTQA 3O3LA 4JKAA 2RDIA 4RZRA 3MR2A 2KQ2A 5AKHA 2BOAA 4DTXA 3RFAA 4P2XA 3IRWP 3KLFB 2IPOB 4B9NA 4FJNA 1L7OA 3RJJA 2DNYA 2A1BA 2G8VA 1L8OA 5KG0A 2ZIVB 3OD2A 3LGMA 3I33A 4KMOB 1V5VA 4YXMA 3WK9A 4XA5A 1ZM3A 4BRHA 2KOBA 2E1AA 3AVJA 2B21A 3FQKA 2A1AA 4CJFA 2K8AA 1RBUA 1TMMA 2NRXA 1RAHB 2EFGA 1P6TA 4NXMJ 1Z26A 4XDCA 5DBBA 1UPMB 4ZVOB 4LF8J 3DXBA 2O3DA 2VHGA 4O0IA 3G82A 4FPBA 2AZ1A 1G7CB 2FGOA 4RW8B 5B0FA 3PG9A 3ZZZA 4DOBA 4X64J 2ZXHA 3IBFB 2JZBA 1RWMB 3SENA 2CQIA 3MM5A 2YHAA 3D66A 4JI5J 3CC2N 1NKCA 4IO1A 4DL5A 2HNYA 1NGBA 5AQFA 1LB2B 2XSFA 1E6YB 2HLTA 3VESA 4Z4HA 5E3RA 2P5VA 1R8HA 2CXEA 3W2VA 3WKAA 1MDUB 1ZQCA 1ASVA 5LJVA 2DNKA 1HKBA 4KMUA 1P90A 2ZD1B 4JI1J 5J0YA 4JI6F 3SSRA 2XB2D 4CIEA 2MUTA 4URQU 2J6TA 3QEXA 1HNVB 4YDUC 4M7YA 2NZ4A 3D6TB 2NYHA 3CCTA 1BIZA 1A77A 5J2FA 3C14A 4H54A 2AIRB 3A4TA 4JMUA 3UM9A 4JI6K 4JB8B 5L9NA 2K4IA 3CC7S 4YDDB 2P8IA 2OSRA 5GINA 8ICPA 1R0BG 3EDRB 1EP4B 3AVKA 1HYSA 4GO5X 4V19S 3V81A 2FJVA 1OJ4A 5AT1B 5FLXO 4IO9Q 3FZHA 4DV7F 4LUBA 1YBAA 4Q44A 2P6TA 4C3LA 2KHVA 3JTOA 4CJQA 1T7PA 4HVJA 4US9A 3IAM9 4DQQA 4QNLA 1BD6A 2VKQA 1MWQA 1DKGD 5GMEA 3FZLA 3HHLA 2G8UA 3JSRA 3GFYA 2DBYA 3SCJE 1FI4A 1BPZA 4ZIWA 2WVBA 3KKFA 3VF6A 3HFZB 3I87A 1R7IA 3C16B 4GMJB 1U1MA 3GIIA 1WBBA 2PN6A 3R2DJ 3I5AA 4P2MA 3SMSA 2ASDA 1TL1B 1HI0P 3CJ1A 2B6GA 1HNXF 5AI9A 1TKXB 1LK5A 4Y2MA 3PFOA 1URJA 2QLJB 3QT8A 5KFUA 2IDEA 2FVSA 4BRMA 4LF9F 4CTAB 3KJFB 3VF0B 1QSSA 4LF7J 5CY4A 2DUYA 2MZSA 2V52B 2KP7A 1NKBA 1U48A 5JLHA 2LCWA 1FXXA 1Q7YO 1JLQB 2QFIA 2QL9B 3W9JA 5I42A 1JJHA 5HHIA 2ZZTA 4F50A 1MA9B 1WTFA 4QS8A 3I0SB 5DM7L 4H5WA 3BEXA 3TO8A 3M2UA 4OIXA 4YFUA 1JLCB 3O2IA 4LVNP 9ICVA 4DUYK 4H4OB 5T41A 4DV3F 2ACMA 1T95A 1FEEA 2M7SA 3ILLA 3OS0A 3CJ3A 2ZIVA 2VODA 4I2AA 1NDPA 1NCLA 3FAHA 3TUJC 1QH9A 4QYZK 2B5JB 5KFKA 3T3FA 3AU6A 2BABA 3R2CJ 5AIAA 3FEZA 1FRKA 4AFFA 1SIJA 1UVLA 4ZS6A 3C19A 3NKYA 2C3MA 3P49B 4DN9A 4DV6F 3G82B 2DNZA 2HHWA 3D6MB 1S0MA 1EHWA 2HF4A 4DL3A 1ZM2A 2PYJA 3M9MB 4DV6K 5J0TA 2ALZA 3G71N 2LECA 4JUZA 1Z4UA 4ZJQA 4OX8A 4EENA 3P38A 2HVHA 3SLCA 2WFBA 5KL1B 4LBPA 3NGKA 3KLEB 4ANDA 4G1IA 1OSDA 4ZP7A 4JI5F 2HMXA 2ZZMA 2R3VA 2AGQA 1VC5A 2OJ3A 3CP8A 2B4VA 4OQJA 1YGYA 4IOAQ 5HMLA 3QSIA 4JI4J 2GO7A 1VOMA 3OSNA 2WBNA 4PAAA 4A8FA 4DV7K 2VFUA 3GYGA 3M1FA 4KGKA 1C0GA 1AXQA 1CJKA 5KT3A 4LF5F 9ICWA 4IG0B 4C0BA 3AA5X 1K9MO 4LF9K 1RT3A 2ZIWA 2G2ZA 2J0XA 2UUCK 4UAVA 4QBUA 3E1YA 3C66A 4AXJA 3IR7B 2HHHJ 3IR6B 3UDLA 4WZMA 1Z1BA 4I7FB 4ZHRA 4KE5A 4NCGB 5J1PA 2NZCA 2F8HA 1Z4NA 2IRXA 5ETVA 4M3WA 1QUVA 2GNKA 1SC1B 4DR4J 1JRPA 4H8KA 2HQCA 4FYXB 3DMJB 1WACA 1K0TA 4LRDA 4DR2F 1FWPA 4JI4K 2E1YA 3N6LA 3FBCA 5JVHL 1LQ9A 4LFCK 4KLUA 5E3CA 3LWLA 2KHDA 4Y2UA 2FVCA 5KFNA 4BR0A 5J2BA 3ZEUA 4DQIA 3MPDA 5CEHA 4PWDA 1QAYA 3AVFA 3CRXA 2Y9TA 4KGXB 1PVRA 1HBNB 2Q6CA 4ACOA 3MAHA 4B1ZA 2VQFK 1JNZB 3KFUF 3PW2A 1QE1A 1Y0HA 3GG1A 2LYVA 3CDEA 1TL7B 4QZEA 2A18A 4OLPA 2GWKA 1XC3A 2PFUA 4CEAA 3R7NB 3HXMA 3PYDA 1D8ZA 1R43A 4LF7F 2QXLA 1DURA 4ZPWR 5HMZA 2BDUA 4HI2A 3DXKB 3TA1A 2EANA 1DGSA 2H1YA 2WF5A 1UMJA 3G8TA 1ZAXA 4NZ0A 3D3CJ 3KHLA 4DV0F 2E5LJ 2IAJA 4KT0C 3E01A 4OKJA 2RB7A 1LOUA 2CNLB 1GTHA 3ZSWA 3SQIA 4WFYA 1JMTA 3W8PA 2UU9F 1S99A 1EX8A 3GFZA 4A46A 4IRKA 2B9YA 2GGPA 1WTBA 4GRSA 4O3PA 4FBUA 4OYMA 4OFZA 5JMVA 1X4CA 3NF7A 1YJRA 2JHDA 4QIVA 1KSPA 4F25A 5KFQA 4QS9A 1OXJA 1UP1A 2HWTA 3PYEA 5AM0A 3IBWA 3I4HX 1RK8A 3ICXA 3P96A 5CHIA 3KLFA 3G6XA 1GLJO 3M8SA 2DNLA 4DV5F 2DGTA 4M9NA 3F9MA 3MECA 4DX6A 2LFVA 3UVJB 3NVVA 4JBCA 4Y2SA 2HLUA 4OYWA 1RBRA 3V2UC 3E9PA 4BHQA 3SSQA 3IG5A 3UR0A 2MKHA 3U3GA 1SC6A 2FHMA 3SCLE 3L2VA 5F8GA 1N52B 3FBEA 1X5OA 3N9UC 3PEJA 2MUTB 4ILRA 1VIOA 3QJJA 3KKAC 1NSAA 1SIWB 4LF6J 2DKZA 3TPQA 1YX2A 5F1XA 4RW9A 2GOLA 1U8SA 3HLUA 3POTB 4BRQA 7ICSA 1URRA 3O1BA 2KM8C 1S5JA 2RDJA 4ED3A 1B43A 5SWMA 3KWIA 3NS5A 4NLKA 2XWXA 3O3HA 4J8FA 2KD1A 4C1NI 3DKDA 4WPAA 2HQDA 3FLCO 1HKCA 3AARA 2QTWA 2JVOA 4B3RJ 4MIAA 2CJYB 1LXJA 4DMNA 4CEZA 3SUQA 3D2FB 1PYOB 5CCMA 2MZ1A 3WIUA 3TR5A 4UATA 3OSPA 2W41A 2XS7A 1WNSA 3NS6A 4NJ8A 1J53A 4V19X 2PXIA 4DPUA 1EO1A 3OYJA 4EHUA 5J2CA 1U25A 5DETA 3RU0A 4KAZA 3DWLA 4HH0A 1VK3A 1A9NB 4FP9A 4CE6A 5M2RA 1A7GE 1UJ5A 3DLBA 4TUSA 4XTTA 3EE8A 2DGWA 1NGGA 1TVRB 3AO4A 4Y65A 3IAYA 4CLZA 2KSOA 4CBWA 5ALNA 3UKUB 2JRSA 1EIYB 4H03B 3BKUA 2X3DA 4Y2QA 4KTZA 4LRAA 5AXKA 3DOKB 3W3DA 4IR1A 5DK5A 2YN4A 1HJRA 4JK9A 3OYMA 4WK1A 2HS0A 4ED0A 3ZZYA 2FXUA 1F5BA 3KDOA 2W6LA 3L5KA 2ZM6J 2HWIA 1N5YB 1DT9A 4UZCA 3KBBA 1LWCA 1I94K 4ECXA 2JWKA 3MAAA 4KPYA 1J5EK 1X4EA 4IDKB 3VENA 4YFKA 4P0PB 1N36K 3L2WA 1BQMA 1R8CA 5FIIA 3THXA 4HHJA 3EYZA 5IILA 2YMQA 2GX8A 4X64F 4CHZA 1WC1A 3CJRA 4JD2A 4PY5A 2A1JA 3BQTA 3IC1A 3U27A 4PR6A 3NRWA 4AQYK 4HUFA 5LSRA 1HW8A 5KFHA 3SEOA 5AKXA 2YY6A 4JB3A 5IIKA 2G2YA 5DB9A 1RHMB 3MMVA 2CH6A 2V68A 1ZBFA 3HD1A 4KHUA 3CCLS 2WFAA 4FVUA 1VQ9N 1RT2B 1VSEA 4M5HA 4I2BA 1IBKK 3GJRB 1C0MA 2RQ4A 4JKBA 1XSNA 3SFGA 1AROP 3KK2B 1CZAN 5U47A 1YUWA 3O9RA 3I0RB 2WVEA 1QM9A 2CG4A 1QQ7A 4PG8A 3TR8A 2EKYA 3DRYA 2OHDA 2PMZD 3WK7A 5EU7A 3H8YA 3OTOJ 5KFJA 4P72A 3HULA 3PKYA 1RYSA 1AFIA 2YB4A 2HS4A 4ZN3A 3J80Y 3DN9A 3C0BA 4ZK7M 5C25A 2D3OR 1N5YA 4EBEA 1UAXA 4PHPA 2V8DA 2EAMA 3OR2A 2W2QP 1ASWA 5KFZA 2HRYA 4E8UA 1G1XA 3W5ZA 4WFBQ 2B8QA 2AX0A 1JXVA 1HBMB 4JI8K 4FYDA 4AQYF 2E9RX 2O4GA 3VQSA 2VGNA 3RJHA 1WC3A 3M8WA 3ZD8A 4CJUA 5IV3A 4KHPF 4NLPA 2WF8A 5HMWA 4YR3A 1KLNA 1NDLA 4PPZA 5DZ7A 1N61A 2CQCA 5GAGP 3OUYA 1UFLA 3OXFA 4NE9C 2HKEA 4J7CA 3EW9A 2BCQA 5CWRA 3IGNA 2X3GA 2MPUA 2ZD1A 4KN4A 4C4RA 2BTFA 3RJMB 2JLFA 1B3TA 5H1SV 3MN9A 3W2WA 1UCNA 2W24A 4JI0F 1ED1A 5LMUJ 3KHGA 2HHXA 1Y9OA 2IA0A 2ZJ8A 2FLPA 2KG1A 2ZJAA 4OD0A 5BPNA 4WFAQ 1HNWK 3J8AA 2XY7A 5F0XA 2PMWA 2MSNA 1HPMA 1PZNA 3EICA 5C2GA 1SV5B 2YNGB 4WJBA 4CIOA 2QKQA 2QYGA 3QRPA 2OPRB 2KZMA 4AYBD 3DDNA 1S79A 3FBFA 1XNQK 4USWA 3BBCA 1NKEA 1CC7A 5FROA 1EB0A 2IVFB 5AQZA 4FLXA 4OJ3A 3KHHA 4ELTA 2CQHA 2RS2A 4K41A 1OQ6A 3VTIA 2BW2A 2I7PA 1CJUB 3QNNA 3KZXA 1XMOK 1IKXB 4DPXA 3QO9A 5DKWA 2WBRA 1COOA 2H54B 3O0FA 2EW9A 2HCFA 3GCXP 2AJFE 1YJ9N 5LSOA 3OR2B 2CAJA 3NVZA 3NUQA 3HP9A 3IG1A 3BPDA 1KL9A 2PDAA 5I9EB 2ZITA 1GMVA 1FK9A 3KLHB 4O0NA 4DPWA 2I2YA 4OYOA 3AFGA 3CW2C 2AYEA 4CLTA 3ISND 2AKWB 1X3NA 3MEDB 1QVFM 3M1YA 2C3YA 3CJKB 1Z6RA 4ISFA 4FLVA 2DITA 4PKDB 2C2MB 3BH7B 3KUEA 4FKXA 1CC8A 4QJFB 4S0MA 4CM2A 1V4TA 1CJTA 3VEOA 2CDQA 4F4KA 3J80U 1U49A 2ZJPQ 2F9WA 3UD4P 1J2MA 4WYLA 3NCQA 4Z0UA 1RHKB 4FJKA 2I9GA 4FYYB 2Z58B 5D0GA 1E4FT 2UXBJ 1IKVA 1EZZB 3HM8A 4F3MA 1IN0A 4DX8H 2N4DA 8ICKA 2K3KA 4RJVA 2NRHA 2CRXA 1V38A 3ALYA 4OJHA 4JI7J 4XPCA 1TYQB 2ILYA 1KC8O 9ICRA 1KTQA 1ZQXA 5KGXA 1VQMN 1S3XA 4KLIA 4TXSA 2GVDA 2LQJA 2N7CA 2YNHB 4GKJJ 4BWMA 3ZDAA 1HD0A 3VAFA 4FK0A 5B0EA 4DR6J 2YTCA 4FLUA 2BJ1A 1LEOA 3C15A 4UW9A 3V7LA 4CHYA 4NL9C 1S6QB 3VALA 2YWGA 2C3OA 3QQCD 1VQ7S 5ALXA 2CYYA 1RLCL 2H3ZA 3UR3C 5F3XB 1VRQC 3BGRB 4QR2A 2L5YA 3ZXWA 2DY4A 4DPTA 5H9EJ 1RXOB 2QZ8A 3DGPB 2EH9A 1ZBUA 2HQFA 3J7Z5 5J0SA 1BQMB 3LP3A 3V9SA 3L4PA 1VQ9S 1HYZA 3TQ1A 3KLHA 3QNMA 3RB0A 4BRDA 4B1XB 2VU5A 1RDDA 8ICTA 2HFZA 3M9OB 1T3NA 1WOQA 1KCFA 1NNDA 4C23A 1FO4A 2C2RA 3H98A 4A48A 2KNJA 2BH1A 1QZ5A 5KAIU 3WK6A 4DCCA 4E1MA 3CJBA 1NUEA 3H0PA 1NSQA 4NXMK 1I6JA 4DPOA 2Q0UA 3QUTA 5HP1B 1WUAA 2MLZA 2VG5A 1D4XA 2CFXA 4UASA 2DIUA 4LFAJ 2H48B 2RN2A 4CK1A 3CJ8A 4M5GA 2AP1A 4OX7A 2H3IA 2RE2A 2E5IA 2G4BA 4G3IA 3W65A 4HYKA 2O8FB 1VSMA 2VWBA 4CRJA 5ADZA 4RNNA 5E41A 4UY85 3AMZA 4AYBC 1GO3F 3NASA 3CPWM 2E8AA 2EFOA 3QLHB 2ODGA 4GV6A 2QN6B 4K5SA 4DR6K 3RR7A 3E0FA 5C12A 1G2EA 3FQLA 8AT1B 1VQPN 2ZUGA 1RAAB 3IAS9 3PW0A 4CHPA 5CCLA 1KP6A 2XI3A 1COKA 4UZBA 4X4UA 5A0YA 1HPZA 4XIUA 3SAGA 1Z3EB 4KLJA 5KOXA 1N34J 2QTDA 3A2FA 1WF0A 4L76A 1U6FA 2F3NA 1YK9A 3Q22A 1CLQA 2YHXA 2G9OA 2MDAA 2P9UA 1N88A 1AYEA 1Q46A 1X9JA 4Z6EA 4KREA 2VF3A 1FXDA 3ITHA 5CYJA 1RBVA 2FPMA 5AM2A 3WKCA 9ICXA 2HK3A 2IAJB 1IQZA 5D4PA 1C1CB 1JLBA 2P9EA 3VN5A 4Z4IA 2NO4A 4A5AA 4HDHA 2RSQA 4EFHA 3RR8A 5J0WA 4DQPA 3W66A 1R8BA 3HFVA 3IKMA 2UXDK 2KTQA 1HUOA 7ICQA 4FLYA 4JYAJ 1HBMA 4E7IA 4JK7A 4TKTA 4YOXA 4NWIA 3EE9A 5AQKA 3FR0A 3QFWA 2A1SA 4H4MB 4CHNA 5KQDA 4BY9C 4DR6F 1LWEA 2C2DA 2JDJA 2XI2A 4KO0B 1O0PA 1DARA 3TAQA 1BQNB 1KNZA 4FNHA 3QPIA 4ZVHA 4C0HA 3JQKA 1LAVA 1QLNA 3BDPA 5HBMB 2ZIXB 4AHSA 1R6YA 1FD8A 3M1VB 4PL8A 5KT5A 4C8NA 1HWLA 2Q79A 3TTDA 1PK1A 1IKYB 3HILA 4R5PA 4CZEA 4DV4J 2JWLA 2O8DB 1NXIA 2C2EA 3TADC 1RI7A 3P6YC 2ZM6F 2ZEJA 1NM1A 1UJ6A 3MMCB 4BREA 4KLTA 2GGPB 2XC9A 5IWAK 1ZD5A 3ID8A 3NWGA 4Z37A 1N60A 2MKKA 3MEKA 4ZLNA 3MGIA 1ZJNA 4KIAA 4FZVA 2C2KB 1S12A 3QGIA 2ADBA 1XBWA 3R1LA 4ECTA 2YWEA 4NASA 2JFDA 1K8KB 2GQ2A 3EWAA 4YMNA 3WU2U 3J81U 2QB0B 2VJUA 4RW6B 4TURA 3MDAA 3EZ5A 2GIRA 5FDLA 3KOAA 1QUPA 5AQPA 1JWWA 4WFNL 4BE2A 2BJ3A 1QAJA 3QE9Y 4ZP6A 3IMXA 3AD8C 1IR0A 2QA4G 3AA3A 2ZH5A 3Q8VA 5HVGA 1FRLA 3M8RA 3UKRB 1TKZB 3ID6A 2RU3A 4Y2PA 3BF4A 4USIA 3L4BC 4NCGA 4LF5K 4AM7A 4I2QB 1AW0A 2WSFC 2CZ4A 1KVJA 2B4PA 1DHMA 4WU2A 1Y10A 1KBUA 4FF3A 4G1PA 2XCPA 1JLGB 3MK6A 1JXBA 3G6VA 2G09A 5LMNF 1SQFA 2BPFA 4YB7A 3V1RA 2A0FB 1S9FA 3TOQA 1Z1ZA 1SJ1A 2PO4A 3QU7A 2J9DA 2E1PA 3CIZA 3HMJG 1HQUA 2XNQA 2GBZA 3D68A 4YD1A 2YKNA 4YUDA 3GMGA 2IOFK 1JLAB 4ENOA 3TSUA 1IBMK 3I55S 1BWEA 3FBBA 4KC5A 4GNIA 4QAGA 2OFHX 4I2FA 4X4PA 2CADA 3FUYA 5AM3A 2FMSA 4GV9A 1WF2A 1VQNN 3KMQA 4EZ9A 1C4AA 2QA4S 4KV8B 3ZNJ1 4DSIA 3FFKB 1KOOA 2P9KB 4DV2K 2Y0SD 1WWVA 1BC6A 1RGIA 1FNXH 3VQ9A 1RQ0A 1XS9D 1S1TB 5LJ3Y 2R7WA 5L1LA 3KD3A 1LWFA 3AN1A 2ZH3A 5F8NA 3N4QA 1MWMA 2V9KA 2F40A 4ATNA 3KD1E 3C6AA 5T14A 1IQTA 4RL1A 2NRVA 4DS5A 5HR6A 2QW9A 1SI9A 4FZZA 1WOOA 5CZVA 4DWIA 1LFWA 4N7TA 1SJFA 4N77A 2VG7B 3K9JA 4FJ8A 4NZ6A 2Z1HA 2EAOA 1OS5A 3A5MC 2RQCA 1BVSA 5AQOA 3LA0A 1RDUA 1P1TA 2R8IA 4EI2A 4ILMA 4KHPK 2IHNA 3OBYA 3CMEN 2XGQA 3T9ZA 1QHAA 3CDBA 1S22A 2CQBA 2D0CA 1ZC6A 3WQTA 1KBRA 2F1IA 4DF8A 3TVZA 3BB5A 2E8MA 2F4VK 4ECZA 1XMOF 3DGPA 5AZIA 1OH6A 3ETLA 3VCBA 4QWEA 3EKUA 2BJ7A 5C2FA 2IMWP 5E3AA 3Q8PB 4ED4A 3JPRA 3M32A 4V1Ak 5KAKA 4A8SA 4MO4A 2O67A 3H2VE 1FO1A 1N4LA 4FF1A 1YJWS 1T44A 1J97A 3C8YA 3OFHA 4U7BA 1PC4A 2A3ZA 4DTUA 2E1MC 2OWOA 1B7YB 3NXZA 3NCRA 1JB0C 2XIDA 4UB6U 4ILLA 1UWAA 1OO0B 5GMKa 1HLWA 5IXUA 3L09A 1D9AA 1RTIA 1B4FA 5IC4B 2BE2A 2WVDA 3POTA 1WI6A 2HVEA 3AT1B 1JJ2R 1X9XA 3IXQA 1FHTA 1WWHA 4FW1A 2JX2A 3JQJA 2D3UA 2MYFA 2DKOB 1FRHA 3QETA 4DDFA 4QJVA 2W25A 2YCHA 4DV1J 3VETA 3I5BA 4AM6A 1YJNS 4LT6A 8ICQA 2V50A 4F72A 3QLHA 3FVYA 3VEVA 5KFVA 4F4XA 1PILA 1VQKS 4C4SA 2GS8A 2DFLA 1HBOA 4DV3J 2QMUB 1HW9A 5A0LA 5KT2A 4JNEA 4XUSA 4USHA 2MKSA 1FNMA 4HACB 3RBEA 5AI0A 3SZ2A 1RTJA 1SL0A 4LR8A 2DY1A 5HJYA 1HNIB 2GCFA 2KMDA 3C14B 3OFFA 3B6PA 1XC9A 4JAXA 4DR7F 5E79U 3L3VA 4PH5A 4URGA 5H1SQ 1LKZA 4LF8F 1ZQPA 2LA4A 3D6HB 1E3MA 4ILGB 1KQKA 3M6WA 2OSQA 1WBDA 1NOYA 2JGUA 1WEYA 2XLKA 3HL8A 2OM6A 2JL9A 2CKWA 4K2JA 3J81Y 5K4LA 3GQCA 2IVNA 1BCOA 2YH1A 4X64K 5ALMA 3FDSA 2XMUA 4PWDB 4DG1B 4NLUA 1Q8KA 4IQWA 2XHCA 1U04A 2VZ9A 1WC0A 1VC6A 5AXMA 4HT5A 2DGVA 4HTLA 4B3TJ 1P8ZA 4ZA1A 3MMCA 3V4IA 2C3PA 1D09B 3MR7A 4M5KA 3NRZA 3PJXA 3EWGA 4CERA 2DPJA 1RT6A 2XZDB 4DUZK 4K4IA 4HACA 4I1TA 3TSPA 2KYZA 2ZG6A 3PO4A 3MFHA 1DFDA 5D4LA 2YX7A 2ZXIA 4Y00A 1WOSA 1PUZA 3U3YA 2N3OA 3CJTA 2X74A 4MKYA 3KWGA 3BJYA 1MN7A 2CPJA 3DOMB 1SXEA 1GLFO 3M5RA 3VZHA 2CQGA 2H9ZA 2BUNA 3BYRA 1B9DA 3AM9A 1JCEA 1TAMA 3CJ4A 1WG5A 1X5PA 3VQ7A 1HIWA 3ZD9A 1RAOA 4OJGA 5BJRA 4DV7J 4P4MA 1Z2LA 1DEJA 3HJEA 5A76A 4CF3A 4IG3B 1RJJA 2YVSA 3R5AA 4Q45A 4ETZA 3KUHA 2DFFA 5KGWA 2K3IA 2LXIA 2B6AA 3AVAA 5AQGA 2NO5A 1FRIA 4KLEA 1HQUB 1S0OA 2OYYA 4PZOA 4KB7A 3AQOA 3HHDA 4M95A 5JS2A 2QT7A 1HHSA 5AICA 3K58A 4DR3J 1K6YA 3BR8A 3US5A 3CIPA 4DCOB 4A57A 3IP4B 1TKDA 2BACA 2QX0A 2DB1A 3MDQA 3CD6S 2HQGA 1VR6A 3HX9A 2IIHA 1APSA 3MTJA 4CZHA 1OWXA 5HQLA 3N01A 3KZIU 4ZLJA 4HCBA 3KG0A 1W7AA 4JI3F 3NOCA 4Q0BB 2G0JA 4A8EA 3ZETB 1WSEA 5K9FA 3NY0A 2XY5A 4Z6DA 2BPCA 4IFVB 4WFBL 1TKZA 4QIGA 3VQCA 2EKNA 2DD8S 3P5TL 2E9TA 1UFWA 1RG6A 3F44A 3SJJA 4UB5A 4AF1A 1RT5B 2KFYA 5J1NA 4YP3A 3K75D 3LGHA 2C2NA 4EO8A 9ICSA 4JRQA 1SZHA 4F0KA 2DPIA 2NRZA 1RISA 2EBGA 4P73A 4PABA 5D8HB 4ALZA 3G96A 2JV3A 5EOYA 1CXUA 2GHPA 5HQMA 1HNZJ 1SKWA 1ULRA 1JXEA 3FRZA 3TZXA 1HRHA 1Q7YT 3F56A 2E7XA 4DV5J 1K1QA 4TUPA 2K06A 2V63A 3G8SA 3B54A 4PEOA 1C1CA 1VRUB 2YKPA 3AVBA 3MWBA 2BCSA 4CZCA 8ICWA 2HEKA 2GHWA 4UUXA 1N0UA 3W9HA 3OLBA 2DNOA 2DRDA 1Y11A 4A2AA 1GEHA 4ED8A 1SVDA 4BE1A 2W55A 4LFBF 2E2OA 4NA1A 1B0PA 4K42A 4HTUA 2GQCA 3ONNA 4DX7A 3MDFA 2CUYA 5M2UA 2IA6A 2HBLA 2E1EA 2KKZA 5FJ4A 1SBRA 5HMMA 5L1KA 1H0HB 1J27A 5IS2A 1RHQB 2XM3A 1BHLA 3MWTA 1PO6A 4L6V3 5TZVA 1NK4A 1FFGB 4I4BA 4RQ5A 2QWQA 4KX5A 1NU0A 2NXNA 1FXRA 1VQYA 4NCAA 3EUB2 1ECWA 1IM6A 2P9GA 2ATLA 1ZQNA 5CHCB 3D7EO 3RMBA 1VQKN 5AM4A 4C7ZA 2HQ3A 5KFRA 2JFKA 5DQIA 2DGSA 3F2BA 3T5HA 3T1HF 3KYLA 4OZNA 2KZ3A 3R6LB 4M5DB 2EI5A 3GIKA 1BWFO 1WC4A 2AD9A 2M3DA 2AYBA 1NBEB 4B3TK 4GVEA 2JEJA 1IR2A 4FVMA 4FJGA 2LDYA 3G6YA 4K8ZA 1RTIB 2L41A 4XH5A 5HATA 2AJQA 5FPDA 2ZZNA 5EX3A 2B9EA 3AQPA 3ZX2A 4DFDA 4C3MA 1ZTWA 2PEBA 2FF3B 3V7JA 2J8AA 4NPOA 1OH7A 1JQGA 4FOEA 1FD2A 5C2CA 4OZ0A 2JWNA 2V2KA 1I51B 4EP4A 2QWNA 2HBMA 1UWBB 3MXJA 3VGSA 5HLFB 1VRUA 1YIJS 2OAUA 2OHFA 4M41A 4QIWC 1PK1B 1X4FA 3ZSYA 4Z4FA 3I1YA 4I0WA 4JP8A 2BANA 3RWUA 3M05A 1RBAA 9ICUA 4RU2A 4YR2A 3P39A 3DFEA 2DYAA 3GFHA 2LQ5A 3WXJA 1NJYA 4M42A 1VI7A 3FCWA 3MEGB 5HP4A 1PBAA 1F3FA 4H0OA 1TL5A 2YWFA 3V4IB 4W5RA 3E9LA 1S9EB 2OPRA 1ZYQA 3TJ8A 3QEWA 1N5XA 4HR2A 3O44A 2KB2A 2OPSA 2W4PA 3R5DA 5C24B 2F96A 4CF0A 1PAUB 1UVMA 3TUZC 5HP1A 2ZWHA 2CA9A 1QAIA 4G6VB 4DSKA 1U24A 5DB6A 2GV9A 7ICUA 1KWMA 3UDVA 4ER8A 1ZJMA 2N7YA 1U2CA 4J03A 2R2SA 4WFXA 3VGLA 1N5VA 3LDOA 1C20A 1K5OA 1YZ7A 4P2SA 2LP4A 2DR9A 1WSFA 3C5GA 2V67A 4QIWF 2JC0A 2Z2ZA 4M1KA 3IBCB 1FTRA 2WUSA 3AVHA 1U0HA 5EN1A 3NCPA 5FD1A 3RJFA 5GTHU 4NY8A 2OPQA 1TKTB 4K8RA 3I9V9 4ZPBA 4O5BA 2B4JA 2JRZA 3WKBA 2B6AB 4WIIA 1QQNA 2HSEB 1RGVA 4BWJA 1REVB 1M5KC 2U2FA 2XO7A 2PFPA 4B9SA 1SKUB 2RUGA 2MY7A 3R97A 3SI8A 1BHNA 4M3YA 3UO0A 2IS3A 2L9NA 1U6BA 5KT7A 1YTYA 4QIWD 5K8OA 4ANCA 5LL6Z 4KSEB 1NG9A 1LWEB 4PHTX 1FNOA 2MZRA 2WW8A 2V5HG 5D3GB 3WX4A 4WQ5C 3BO3A 4B3SF 1GAOA 4DOZA 1OY6A 4CBXA 3KKAA 3LAMA 3AVMA 4GLXA 2VG6B 5AQWA 1B22A 3WXKA 3M8ZA 2IGIA 2H4WB 3FGUA 4FWRA 4OHWA 5J0RA 3OGUA 9RUBA 2AJ4A 2ZFHA 4CJ3A 3THYA 5K14A 3PZPA 4US8A 1SJ4P 4I2HA 3TEHB 1RBTA 2GVDB 3CCRS 1WC5A 3SXLA 2OEJA 2DGXA 3MCSA 2KKVA 4ICLA 5DM6Q 3GJQB 3R9LA 2OO4A 1WCNA 2D8CA 4FZXC 3C2LA 3PW7A 2MQQA 1URNA 3NL0A 3C23A 4L3NA 3WIVA 2HGLA 1K73O 3TFSA 1S77D 5J0XA 4BG8A 3PR4A 2ZGYA 3DLRA 1KR4A 5B0DA 1FRMA 1UETA 2VICA 1NRKA 2XTJP 1VSFA 2A1JB 3M30B 4W92B 2LVWA 1YRTA 1UWBA 2PI5A 3A3NB 4DI6A 4B9QA 5KFGA 1RUSA 5T7BA 3E9OA 4J9LA 3AO1A 3QBCA 2HQIA 4F91B 3CFPA 2MAXA 1U2VB 3Q2TC 3HSTB 4OI6A 1NZAA 1UEUA 3K5NA 2FZKB 2W8LA 3B8HA 2U1AA 2O8EA 3RJKA 5M1OA 4EIAA 2B51A 2P6SA 1Z1VA 2DIVA 5KFFA 1Q1KA 4MKVA 1U09A 3M9NB 3W0LA 3CNHA 3QGGA 3QEIA 3PCOB 5AI8A 2DR5A 1W9HA 1U0SA 5M1NA 4J2AA 2ZIXA 3J81O 4M7XA 4E7JA 3G9CA 1MMDA 2H5IB 5CYMA 1IBKJ 4H0TB 4CK2A 4A47A 2WHOA 4CZGA 1HARA 2FBYA 3W62A 3K0JA 2MGZA 3LW5C 1VQ8N 1SV0A 1MSWD 3DRSA 3OL8A 3M6ZA 3FSXA 3DRRA 4MKBA 5CD4A 7ICMA 2BM1A 3V4MA 3T7ZA 2E44A 4FE3A 1HLUA 3H2LA 2KJWA 3S3OA 1Y88A 4DCJB 3HHKA 4HVZA 2UXBF 3TAMB 3ZDCA 2R42A 4LR7A 3TEGA 1J6ZA 3VQ6A 4BR5A 4B3RF 2UXCK 2KFNA 3C7NA 3K8VA 2DT9A 5BYRA 1HEKA 4F5RA 4JI8J 5EWGA 3JTPA 4ILJA 2BRKA 3AO5A 4EO6A 4NLBA 1ITPA 1A6LA 6FDRA 1N33K 4GVBA 4OPHA 2VIHA 1RYRA 1D0EA 3BBFA 1N54B 3AXMA 4O0JA 4UY8T 2J4RA 3A0BU 4K2XA 2PA8D 1JL2A 4ZVEA 3PW4A 2ZBQA 4KH5A 3K0SA 3C95A 3QMQA 1VAZA 1EQ0A 2LBOA 4DCPB 3SIPB 3VEXA 2FBTA 4IWVA 1Q8IA 3U02A 1ZQVA 3HBTA 4C97A 3D9BA 4IFYA 4DOCA 4OPKA 3LZJA 4CF4A 2RHKA 3X3UA 1YQHA 1RDFA 2ZJQQ 3H2UB 1VQ4N 4RQ6A 1I94J 3AAQA 2W42A 5IT4A 3N7PD 5CD4H 3C6UB 2PZSA 3VVUA 4P75A 5D15A 4ZPVR 5C24A 5AM1A 4ZPDA 3HI9A 4I67A 4YN3B 1B9FA 4C1NK 1CBKA 1XNQF 1JN3A 4J9OA 3CG7A 3VQTA 4LF4J 1YTAA 3W63A 1VQLS 3ENVA 3B4MA 3LZIA 4CNYA 2R4FA 3QO9B 3VC8A 2ISPA 2AYMA 5AQQA 5G5GA 2OPPA 1XQSC 4DG1A 3IFEA 2D1CA 4P52A 1U1NA 4JRPA 1GXUA 1UPHA 2RRAA 4RPXA 3OTOK 3T6BA 2MY8A 4AE5A 5KG4A 1X42A 2D74B 1RQLA 4Y2VA 4PGQA 3QEBZ 2MQNA 1RDWX 2DGZA 1G4CA 4CJLA 1ELOA 1VJWA 1RT4A 4RT3A 1WG4A 3G8QA 4EMDA 4NLNA 1WDDA 3N6MA 3Q7CA 4P0QB 3BPSP 2K4HA 1D5AA 5THWA 5B08A 1X1PA 4O8KA 3RAMA 1SJQA 1IBLJ 1FVQA 4AQYJ 1GX6A 2ABYA 3PHTA 2F4FA 4ZVUB 2JMGA 4LFBJ 4DSJA 4ANEA 2KDOA 4YEAA 2IRYA 3ISDA 4LQ9A 3JS9A 3AJ1A 2H3EB 2EZXA 3LVWA 2F1FA 1UW9A 3FMWA 3TZZA 5BR8J 3CJ5A 2NRRA 1IV8A 2OYQA 2JNJA 1A0OB 4I2CA 4FWMA 2KSOB 4JI2J 2YWHA 3D6JA 3N7SC 1N32F 2M5YA 3MCNA 1CJTB 3OTEA 3BDEA 3OXGA 4YCXA 3C21A 3S3MA 3Q8SB 4M04A 3HDSA 3QWUA 5DLFA 3TA2A 4YY3K 1YJNN 2XMJA 1XJWB 2Q3PA 1I3AA 2CPZA 3SUNA 4C3KA 3LAKA 1K8AT 4RWTA 1FFSB 2QWLA 2J0WA 8ICEA 3HSDA 5BN8A 4PGYA 4F26A 5HO4A 3OQ2A 4FFDA 2A10A 4CIFA 3O5TB 2DHHA 3PW5A 1TKXA 4KHSA 1S48A 1H2TZ 5BPCA 1ZQAA 1H1VA 4YOYA 3D1OA 1MN9A 1VRTA 4O5KA 4J90A 4PHDA 5L46A 3H20A 4I2GA 2RP5A 3DLHA 5J2KA 1J5EF 2CGJA 4KHQA 1UT5A 1F5CA 4ZTJA 4USKA 1VLYA 1B92A 4CF8A 1FDAA 3H1QA 5D77A 4M5IA 4GVMA 1IV0A 2LDIA 2PFOA 2GWSA 4EYIB 4I2DA 3DYAB 2YKMB 4OKKA 4BVOA 3ZT2A 4DBQA 2BJ8A 4CT8A 1J5OA 4EBCA 4YOUA 4I2PB 4RR5A 4O4GB 2WW4A 3Q83A 1HWUA 2OA8A 3TJ9A 4Q8FA 2MZQA 2CVIA 3EGNA 3AB4B 3M8YA 4LJMA 1T6CA 4PHAA 4KV8A 4Z4GA 4CESA 1X4GA 3L2QA 3TYTA 4QWDA 2KK0A 3KOOA 2GWJA 1NJIO 1UQVA 3HK2A 5JS1A 3MM6B 2BQRA 1HNWF 2VG5B 1NI3A 1D3WA 1EAYC 3D45A 3L8BA 1T9YA 2GLEA 1MLAA 2ZH2A 5IM0A 1S1WB 7ICIA 2M70A 1N34K 8ICJA 1KDNA 2E20A 4QCLA 4O3NA 3CCVS 4GVBB 5GAGU 3SMVA 1YRXA 1EWQA 3UN2A 2WAQF 3CCJS 3W7BA 1GMWD 1BNOA 3MWPA 3I56N 2E66A 4OYPA 2ZKUA 5KFCA 4JV5F 1KW4A 2RKIB 5GIPA 3CJ7A 1ZAWA 2V8PA 3GPAA 2JLGA 5LY3A 3TW0A 1WC6A 1HJOA 4DFKA 2B0CA 4QZAA 3DRRB 2QGFB 3D2SA 1OY9A 2OTJN 2PMZF 1WLJA 3DOMA 2JH7A 4JI2F 1XSPA 3JQMA 1M5PC 5F8MA 2VFTA 4B3SJ 2DH7A 2QLBB 3OLAA 1WNEA 4DR7K 2A3VA 4Y2IA 2JZ5A 4ZVTB 3C15B 3V1QA 3M6UA 4TY8B 4CJ5A 1NPRA 3DMJA 2C2ZB 4MDAA 2HHQA 1Q53A 2HZVA 1NZBA 2GO9A 3VEZA 4QU6A 1T9XA 3MEEA 1G3OA 2J7UA 3PX6A 3Q86A 3MX5A 4PWWA 3Q8RB 5HROB 5C25B 4LVOP 3MMAA 5RUBA 9ICTA 3QNOA 4OKEA 5B0GA 2OPPB 3ZSXA 9ATCB 4WJ3B 2FBVA 3M8PA 2Q1LA 4LREA 2BVZA 3KUGA 1SC4B 4LR9A 9ICJA 3MN7A 4O5FA 4GC6A 1DY3A 4JI6J 3AAPA 2Z8QA 4ID8A 3H5XA 2Z2LA 4DR5J 4NYFA 1P1LA 4LBHA 3ZSRA 3U9DA 4R64A 2IJRA 5JUMA 4QIFA 3D0IE 1HQEA 1KS2A 3UVJA 3ZDDA 8ATCB 1N5QA 4JN4A 4NA2A 2G5IB 4BC7A 3T5LA 3BSOA 3L6QA 3BY5A 1ZM4A 2IOCA 2O8CA 8ICMA 1XR5A 3T19A 3LM2A 1XMOJ 4CZMA 2ZTDA 3EGVA 4CEEA 4RWXA 2G08A 1X6IA 4CZKA 2BKNA 2OZSA 4CO4A 3GZ7A 5AQSA 2NLXA 3CC4S 1Y3JA 1YHQS 2UVRA 1NGFA 2KJ9A 3V9ZA 3QYYA 1RAIB 2LHTA 2W9BB 3R5CA 5HL7Q 3CCES 4EYHB 3I32A 3M4XA 4R8UA 3IUCA 2FPLA 3ENAA 3VEWA 4IBNA 3MR5A 4ZCKA 2K60A 3Q8QB 2XBPA 4CJ7A 2VBYA 3FC9A 2NRTA 8ICNA 1E6VA 3F41A 1XR6A 3V5RA 3RG6A 4CF5A 4H5VA 1XR7A 5D0HA 2FYXA 5EX0A 1IJJA 1VBZA 3QGPA 3PO5A 2DHXA 2D6FC 4PG4A 1HNXJ 3JSMA 2YJEA 4KH0B 3IS9A 1FW6A 1JLCA 1RLDA 2LXUA 2K7JA 2MHNA 4DJBA 3G25A 3BO2A 5DZ6A 5AR0A 4OI0A 1S97A 4P2FA 2ZH8A 3BQ1A 4ZN1A 3CMAS 4J5OA 2R18A 4YD2A 1O08A 4ZOSA 3CDAA 5JJBA 1RAEB 1NDKA 3SV3A 4CZLA 1QTMA 3ET6A 4JV5J 3UCZP 2YNIA 4Y2XA 4GVLA 3B6OA 5AXLA 3JAMY 1PJ5A 2QA4N 3DLGA 2B43A 4JI1K 3WK8A 3FCVA 3IA0A 2F9JA 5CAAA 1BISA 3NVYA 4DHVA 3DAWA 2YQ0A 4FM1A 5KG5A 3HYFA 3NGTA 1IVZA 1MQ3A 3MECB 1ZD4A 3RB3A 1S1UB 2NZTA 1XSLA 4UOFA 1RCHA 3CQXA 4OV6A 2XGPA 3NVMA 1WKLA 4DMZA 3CCRN 2WAQC 3H3NO 2F3JA 3PRDA 4CJKA 3A5LC 1RM6C 3QBWA 3QIOA 4GKKK 4JKEA 2K4EA 5KFYA 4MMOA 4LD0A 3WNFA 4RBUA 3OYBA 4PJ0U 1T9WA 1J5OB 4DV3K 3DLLL 2SXLA 1KAYA 3MCOA 3BV8A 4K43A 2HNYB 4KH6A 4PHEA 2CQ0A 4GXKA 2YQ3A 1MU2B 3LYSA 2V2VA 2HNZA 4I56A 3WXMB 4C2MA 2I38A 2KXNB 1X40A 1P9QC 1GMWA 4PQUA 2IVMA 2KICA 2WONB 4RBVA 2ZBCA 4TY9A 1EARA 3UQSA 5C7PA 4RG8A 3VGTA 3GONA 3G6ES 2OFGX 4A59A 3PX4A 4KLDA 2WOMA 1YI2N 4Q0BA 3A8EA 4BQLA 1QAXA 5IT9U 2R8JA 5BRDA 3OYDA 1PAEX 3GSIA 3VHQA 3THXB 3I96A 4F04B 4YB6A 2LM1A 3SBMA 3CFRA 1SJ3P 5AQUA 4UOCA 1IG6A 4M5LA 4QW8A 1E4GT 1S59A 1U6ZA 4X66J 5GAHP 3SQ2A 1HX1A 4LH5A 2Y0SC 3D2WA 4UAUA 2BM0A 2V51B 4FLZA 2IBKA 3T1HK 5ETQA 3HKZF 1XNRF 3T5JA 3ISZA 1QY7A 3GYXB 2IVPA 4RNHA 2OTJS 3Q8KA 3RBXA 4CGZA 2C28A 1BUXA 4OZ1A 3JPQA 3SMZA 3SQGA 1DBDA 4OO1J 1NLVA 3CJQA 3ZDBA 2MA1A 1PSDA 4CGJA 4KITB 1ZQKA 3V6DA