4DS5A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mg2+
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 207
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds5A01
4K4GA 2E4LA 1LW0A 3QETA 1XC9A 7ICJA 1TKTA 4FM1A 4DQQA 1RTHA 1Y97A 5KT5A 1B43A 4DFPA 3M8RA 5KFNA 5HLFA 4IQVA 3LANA 2LSNA 3CM6A 1BPEA 4QZIA 3EPIA 4FLYA 2NRTA 2FBYA 3PV8A 1C0MA 3GFKB 3UXOA 1JKHA 1KFSA 4KB1A 3RWUA 3ETLA 2VA2A 2VG7A 4EYIB 3PW7A 4Q44A 5KT2A 1Z26A 2ISOA 3H8WA 2YV0X 1NK7A 4UAWA 3P1GA 4CJUA 4FYDA 3VQ7A 3C6UA 4RW8A 1V9PA 1X2IA 3V6HA 4EZ9A 3L2VA 4YNQA 4CEAA 3NF8A 1CEZA 3ZSQA 3RJHA 2PYLA 3OYBA 4OLBA 3OYJA 4KN7A 4O44A 3MXIA 3LP2A 1WSIA 3NCIA 1ZETA 3RBEA 5J29A 3VQDA 1SKRA 3QE9Y 4DU1A 3K2PA 5DB8A 1TV9A 9ICFA 3G6XA 1JX4A 2JEJA 3M9MB 3QEBZ 2C22A 1BI4B 1X1PA 2A1JA 3ZDDA 2QK9A 4BGDA 1D9DA 1AROP 3QESA 2G8IA 2JGUA 1IG9A 2P6RA 2P51A 2KZMA 2XRIA 4Z4HA 1UOCA 5KGWA 1TK8A 1K1QA 3SYZA 2BPFA 9ICPA 3TI0A 3BGRA 4TUSA 1RTIA 4ID1A 2DFFA 1RBRA 5CZ2A 3O3FA 3OYKA 3MXMA 1BGXT 3EZ5A 3H08A 1RT7A 3S3NA 1KDHA 1QTMA 3PW5A 1S1UA 8ICBA 3ZT1A 3AVLA 3KD5E 3PW0A 2AU0A 4F3OA 4UAZA 3UIQA 3N4MB 2B4JA 1I39A 4CHZA 4P4MA 3OS2A 3GV8B 3TAPA 9ICEA 4O0JA 4IKFA 1EKEA 1N56A 1KVAA 2C2DA 3NH0A 1T7PA 4P4OA 8ICOA 2WTFA 4DFMA 4F5QA 2FMQA 2Y1JA 1BVSA 3OHBA 4I2BA 2ZTDA 4B8CA 1JLAA 2OPQA 4PGQA 3NH2A 4NM1A 1ZQAA 4QZDA 3GV5B 5HP1A 3NGDA 4QW9A 3AVNA 5DB7A 1ZQBA 1ZQCA 1DTTA 4J9NA 3K5NA 9ICRA 2UVWA 5EOZA 1D8YA 8ICUA 5J2MA 4KLSA 4IQWA 3AV9A 1UWBA 4H4MA 4Q8FA 2J6SA 4NXZA 1S9FA 8ICTA 8ICYA 4PHEA 1KVBA 1MQ2A 4NCAA 2R7YA 1XSNA 3AU2A 2GV9A 3UXPA 7ICTA 3B6OA 2FBTA 1NKBA 3OS1A 2R8KA 2KW4A 4KLHA 3F73A 2D5RA 1ZQZA 1NJYA 1JLEA 4DSEA 2ATQA 1JL2A 5EWGA 2XY6A 3I0SA 1B22A 3P5JA 1NJXA 5C5JA 1B9DA 5J2BA 3ZSRA 4E0DA 5KFHA 5KFEA 4YD2A 2HVIA 8ICLA 2NRXA 3O3GA 4CHYA 2C2EA 3SV4A 1GOCA 2UVVA 4RQ1A 4FJ8A 4E19A 1U49A 4CF8A 4CJWA 3RJFA 3OS0A 7ICPA 1TKZA 1YVUA 4CF1A 2FC0A 1JLFA 3WNGA 2KTQA 4IRDA 4YR0A 4BDYA 3AVGA 4FJXA 4BDPA 3MFIA 1S6PA 4PY5A 1QS4A 3AVIA 1XI1A 2F1JA 4Z6CA 5J2NA 3VQ5A 4ID5A 5C24A 3C94A 8ICAA 5HRNA 3RR7A 2FLPA 1JLBA 1U47A 3T19A 1CUKA 4HYKA 1L5UA 5IIKA 4RW7A 1BPBA 1UA0A 3JPRA 4DQPA 4CIEA 1BPDA 4JLHA 2HHWA 8ICSA 4HTUA 3O4QA 5L1IA 2IAJA 2E6LA 5EU7A 5KFPA 1QSSA 3HPGA 3RMBA 4HUEA 4M3TA 3Q8MA 4Z6FA 5KFGA 2E6MA 3IM1A 4JS5A 4FW1A 4W5TA 4Z6DA 2I9GA 3RJGA 4CCHA 3HPHA 4QWDA 3VN5A 2OYQA 5KI6A 4R65A 1NKCA 4KLLA 3HM9A 4FO6A 3M8QA 5J2JA 3ISBA 4CIFA 4KLTA 4JUZA 1CLQA 2HHSA 4DSIA 3C95A 1O1WA 4PH5A 4IFYA 8ICRA 1WSFA 4I2IA 5KG0A 4MF2A 3VQ6A 1C1CA 4TSXA 3V1OA 3Q8QB 4NY8A 3GV7B 1ZQGA 3ALYA 3V9ZA 4QZEA 4O3RA 3K75D 2HNZA 3KK1A 3PNCA 4ECVA 1ZQSA 3DLKA 1ZQOA 4ED7A 4XA5A 1NK6A 2BDPA 3AVBA 2F1IA 4DLGA 4F93B 3S9HA 5KFTA 1S0NA 3RJKA 3AO2A 4E1NA 4KLQA 1BPXA 1RT2A 2YNFA 1CZ9A 4QAGA 4I28A 3NGIA 3ZSOA 3D45A 2AJQA 7ICOA 2WONA 4PGXA 2BPGA 4OKEA 1NK9A 2XY8A 1HUOA 2IGIA 3PUFA 4CJKA 3BQ1A 2PI4A 4DU3A 4CJVA 5DLGA 1RPLA 1ZQRA 3IRXA 3TAMA 2VA8A 3JSMA 1ZQIA 2HVHA 5KFRA 4N47A 4O5BA 4M3ZA 3OYCA 5J2EA 4CHPA 2Z1JA 4KTQA 4ELVA 4DSLA 3LZJA 4M3UA 4M0AA 4M9HA 4IRCA 4KI6A 2R8JA 3ZCMA 5DB6A 4LD0A 2ZUBA 2PI5A 5KTQA 8ICHA 4KAZA 3AU6A 5E41A 3KK3A 3NTUA 4DQRA 3MGHA 4F2SA 5HBMA 3RMDA 2KQ2A 1XSLA 1LAVA 3EYZA 4DTXA 5DG7A 2RDIA 3C2MA 5F9NA 4M04A 2IDOA 1RBTA 1ZJMA 3JYTA 2J6UA 3A2FA 1VSKA 1W0HA 2VG6A 5DQIA 5CWRA 3M9NB 2PFPA 3LPUA 4FLUA 5DKWA 2OZSA 1UT5A 1TV6A 3MEEA 3JPTA 2R8HA 2RN2A 3DMJA 5JS1A 1ZQYA 4FZXC 4GMJB 4DTMA 4M2YA 3MDAA 3PW2A 4DTNA 3ZSWA 4B9VA 3CG7A 1JXLA 3DLGA 3QZ8A 5KFBA 4CJFA 2WOMA 1RBSA 4CF9A 4FLXA 3VA3A 4E7KA 3GQCA 4DFJA 3DLBA 3KHHA 4I2PA 5J2CA 3SPYA 5KFQA 2Y1IA 4Z4EA 4L8RB 3FDSA 3HSTB 4KN4A 4OPJA 3CFOA 4TQSA 2V4QA 3S3MA 1JL1A 3Q8LA 3E01A 3KHGA 2JZBB 3CM5A 2XO7A 9ICLA 3G6YA 4ZHRA 5L9XA 1XU4A 3VQEA 3C2KA 4QWAA 4JRQA 4GXKA 2ZE2A 1S10A 1RILA 1RXWA 1TL3A 1RT4A 1RXVA 2F96A 1RTDA 4PQUA 4FK0A 1NK8A 4FJ5A 1FKPA 4KO0A 5CB1A 2W8LA 4CFAA 1TAQA 1EXQA 5KG4A 2XCAA 4F4ZA 4RQ6A 4KHQA 3B6PA 5DLFA 3DLHA 4FJGA 1ZQTA 4DFKA 4GVMA 4M3RA 7ICVA 4M6WB 8ICXA 1ZQJA 2H5XA 3SZ2A 1K6YA 2HHTA 3TABA 1VSFA 4M9LA 1RNHA 2D0BA 4CHOA 3L3UA 3V9UA 4F91B 1NOMA 2RPIA 8ICCA 1IKVA 4PWDA 4F8RA 3PMLA 1KVCA 1VSDA 1ZQFA 4RT3A 2IHMA 1ZBLA 3MEDA 5J0TA 3T1AA 5KFUA 3O3HA 3RB4A 2P66A 7ICFA 5BPCA 5HHIA 4W5NA 4O3NA 8ICVA 4RQ4A 5HHHA 4C8KA 4CGFA 2FMSA 4ED2A 1RDBA 4FLTA 1WAFA 4AHCA 1S9GA 3RJEA 4BE1A 5J2PA 3V7JA 4DF4A 1S77D 5KFIA 5HNKA 3ORYA 3SV3A 4O3PA 3C2LA 1FXXA 3SI8A 1WSJA 5J0RA 3DLRA 3L8BA 4IG3A 5KFAA 4QWEA 5J2HA 2ATLA 3C1YA 1D5AA 4EZ6A 1RBVA 4I2QA 1CXQA 1WSHA 3SPZA 4GW6A 4CGIA 4AHTA 3ZDBA 1HRHA 1GOAA 3U3YA 9ICSA 4RPXA 3AVJA 4J9SA 2B21A 3KHRA 5KFYA 4J2DA 2ITGA 3PO4A 3KD1E 5J0OA 4R64A 1UT8A 1QE1A 1XWLA 8ICZA 2Q3SA 2HMIA 3LK9A 4BE0A 1NJZA 4G3IA 1N6QA 1S1VA 4YCXA 2D0AA 1NOYA 1ZQWA 3OYHA 1JLQA 4ECZA 4PHPA 1RT3A 3MECA 4O5EA 5CP2A 2EHGA 1IM4A 3BQ2A 2JEIA 3EPGA 2OWOA 4IQTA 1RT1A 3I0RA 2UVUA 3LWMA 3ZSXA 2VANA 3G0ZA 3PW4A 5CYMA 1JXEA 3H8SA 3HP9A 4B9UA 5D4BA 2X78A 4KLJA 4KMUA 1ZBIA 4R8UA 1LWFA 4CEFA 4ECQA 4EP4A 9ICWA 5DGBA 1SKSA 5HRRA 1U04A 5HRPA 1A5XA 4FM2A 4RPZA 4H4OA 1T05A 4DWIA 1S0OA 3K58A 4N5SA 4O0IA 5J1EA 7ICNA 3SQ0A 5CYQA 3TAGA 2V9WA 4FBUA 4G1QA 4PGYA 2MUTB 4ZTFA 1JIHA 2IOCA 5J0YA 4LVSA 2XC9A 2RDJA 3ZD8A 4FXDA 3K5MA 4DL6A 1RDAA 3AUOA 4RQ0A 4DOBA 4WE1A 3C21A 3LAMA 2ASJA 1PZNA 3MXJA 5J2IA 1LWEA 4PHAA 3ASMA 1ZQQA 3HVRA 5EWFA 5J0UA 7ICHA 3HO1A 5FRMA 4B3OA 1ITGA 4FCYA 3V4IA 1HYVA 5FDLA 1ZQUA 2FPLA 4W5RA 4F3TA 3BDPA 1EXNA 1QQCA 4CIGA 4EP5A 9ICKA 3QERA 5IIMA 2AQ0A 2HB5A 4Q5VA 1C7YA 4C8MA 4K8XA 2HNDA 2BKEA 3K4GA 4KLDA 1NOZA 1S1XA 1A5WA 2BANA 3ZSZA 2NRWA 4HHTA 2J6TA 5F9LA 4O3QA 1VSIA 1SL0A 4FLWA 3OJSA 4ECXA 3DOKA 4Z4GA 1VRTA 3NE6A 3RB6A 4ELTA 4ED1A 3LDAA 3ISDA 3PVXA 3OYDA 3LZIA 2YKNA 5J2GA 3MFHA 1RCHA 3L2QA 4N76A 3B0XA 2Z1IA 1KLMA 2HNYA 4LH4A 1WSEA 2IS3A 3I8DA 4F5RA 1XS9D 4KHNA 1SL1A 1JN3A 4BDZA 2Q0ZX 3LP3A 3BQTA 4KLEA 1JMSA 4CEBA 2KZ3A 1IH7A 3THVA 3V72A 4F2RA 4RPYA 4DTPA 5J2QA 3QIPA 4FJMA 3OYNA 5HMMA 1VRUA 4F4YA 3RRGA 4J2AA 4J9LA 3V1QA 3OYEA 4ECUA 3C5FA 4IDKA 1TVRA 4IBNA 3NDKA 4I9QA 4Q43A 1CXUA 5C42A 5KGXA 3UQ2A 4W5QA 4NLZA 5KT4A 3LPTA 2RKIA 3AA3A 5JS2A 2HW3A 1HYSA 2BQRA 2MUTA 1IXRA 5J0WA 2ZTCA 3GIMA 3HX0A 3ZSVA 2NRVA 5DGAA 4E3SA 5KT6A 3T5KA 1WLJA 3WNEA 3TR8A 1Y88A 1KLNA 4YVZA 3H4DA 3B0YA 1BL3A 8ICWA 5KFWA 1RYRA 4M41A 5KT7A 7ICEA 2AQ4A 4CEQA 1KTQA 1C1AA 3LDSA 2G8UA 1D9FA 1J53A 3V7KA 4JWNA 3OYLA 3DRPA 4ECYA 2ZUDA 1VSJA 3QEXA 1ZQNA 5L1JA 1TK0A 4F4KA 8ICIA 4E7HA 8ICNA 3OSNA 2W9BB 4KLGA 4DOAA 3E2EA 3OYAA 4FZYA 3SUOA 5KFFA 3PO5A 4O3OA 5T7BA 7ICQA 3AA2A 4AILC 4DL7A 4QZAA 7ICSA 5K14A 3SNNA 1RDDA 1W9HA 3OY9A 2P5GA 4MQ3A 3UQ0A 1ZQEA 2VWJA 4C8LA 4DU4A 1IO2A 2NRZA 4I2JA 1WSGA 5CA7A 1VSEA 3OYIA 1KEJA 1WCNA 1ZQVA 9ICMA 4KPYA 4BACA 1NKEA 2ETJA 2P1JA 3NBPA 4CE9A 1QSLA 1RT6A 1D8LA 3H7IA 4XRHA 1RZTA 3QIOA 1ZQKA 5DQGA 1BCMA 3V6DA 4UB4A 1KCFA 8ICFA 3ISNC 2D0CA 3IS9A 3NAEA 1G15A 5DG9A 2Z1GA 3BJYA 4GC6A 3QNNA 1ZBFA 1VSMA 2DFEA 1QSYA 3RR8A 4FW2A 1ASUA 5KRTA 4C8NA 4K4IA 3DM2A 3VQ9A 3SUQA 3WNFA 4KHWA 8ICPA 1HJPA 1JXBA 4Z6EA 3HW8A 4E89A 2DFLA 4N41A 3NF6A 4YFUA 2VG5A 4KHUA 1RBUA 1DGSA 5EWEA 2ZD1A 5D3GA 1KFTA 3JPPA 1L3SA 4NYFA 2GWSA 4I2AA 5KFXA 4Q45A 4RQ5A 3JPQA 4PHDA 1SKWA 1TFRA 3KTQA 2YHAA 2A1RA 3U3GA 3QLHA 4MEYA 4FBTA 2X6SA 1TKXA 4W5OA 1C1BA 5IIJA 4J9MA 5IINA 4CFCA 3VQAA 4R5PA 4RNMA 3LAKA 1MC8A 1H38A 2XCPA 3PX6A 4KFBA 1BPYA 2I1QA 4I2HA 4DTUA 5DBCA 4LZDA 3HJFA 4M3XA 3OGUA 3L2WA 3NFAA 4QZCA 4QZGA 1COOA 2G8WA 4JV2A 1FK9A 2A1SA 5KFCA 4DTRA 3L2UA 4PA1A 1WCLA 1ASWA 5KFSA 3V81A 3HT3A 4DTJA 4QZ9A 7ICGA 3N97B 9ICAA 1J54A 4CK3A 1UAXA 4DS4A 5I3UA 2B6AA 4R8UB 3QZ7A 4M3WA 2BHNA 3ITHA 3PX0A 1EETA 3SQ4A 4XUSA 4XQ8A 1YTAA 3K5LA 3C5GA 1IKYA 3OHAA 5J2KA 4ZH4A 2LYHA 3VQ4A 4TURA 4DO9A 3RJJA 2OPPA 2GUIA 1ZQLA 3SUNA 4NCBA 4DSKA 2FMPA 3SQ1A 3ZT2A 4MFAA 3AO3A 3TFSA 2YKMA 4RQ3A 3G10A 4CK1A 1TL1A 3NGYA 3P83D 2F8SA 4OGCA 4DQSA 1HYZA 4RQ8A 5J2DA 2NUBA 4YR3A 4I2CA 3NH1A 5KFDA 3ZSYA 4PUOA 4F5PA 4FJIA 5L1LA 4FJ7A 2OPRA 1CZBA 1U48A 1BQMA 3O4NA 4TUQA 4CEOA 3SCXA 3RMAA 2BCVA 3TARA 5J2FA 4AHSA 2DPIA 2FBVA 3T5JA 4DTOA 3DLEA 4CF0A 4GXJA 3CQ8A 2XGQA 3TAQA 2FPMA 4NYNA 1Z00B 5TZVA 1UA1A 2G8VA 3TAEA 3ISCA 2PFQA 1HMVA 5J0PA 4LH5A 5FRNA 1X9MA 3AVAA 3RTVA 5CZ1A 2XHBA 4MFFA 4RW6A 3IAYA 1NK4A 1C0TA 4BXOA 5KFKA 4JK1A 1S5JA 9ICHA 3HPOA 4OLAA 4NLNA 3PY8A 3QEVA 5DBBA 9ICTA 3UXNA 9ICXA 3LWLA 2ZJ5A 4ECRA 1K1SA 1BHLA 3MEGA 3U6FA 4B9SA 1HQEA 4CJTA 9ICIA 1XSPA 4E7IA 3KKSA 2OA8A 1YTUA 2W42A 5KG7A 2KFZA 4RG8A 4RNOA 3D0PA 1MSWD 3V7LA 4YFKA 4DOCA 1U45A 8ICQA 2O4GA 4ICLA 4LSNA 2C28A 4DSJA 4CJQA 4BE2A 3JPOA 1ZYQA 4KLMA 1RTJA 3K5OA 1JLCA 4CK2A 2PZSA 3DYAA 4YMMA 4Q8EA 1MQ3A 5DDMA 3ZDCA 1Q8IA 2G8FA 2X74A 1RT5A 3CYMA 4OKKA 1ZQXA 4GXIA 4CHQA 4F5NA 5DQHA 4RT2A 5HP4A 4J9KA 4KLOA 4FS1A 3RRHA 4CJLA 1SUQA 4IG0A 4Q0BA 9ICQA 1BI4A 3AO1A 1T03A 3MDCA 4KREA 1R0AA 1XO1A 4GLXA 4I9LA 3TFRA 4RNNA 2R8GA 3L2RA 5KG2A 4KLUA 4ED3A 2KFNA 2XY5A 4CJ5A 2PXIA 1IKWA 3RH5A 4FJLA 4KLIA 9ICGA 3ULDA 2VWKA 3K59A 1Z00A 4HCBA 5DBAA 3V9WA 4J2EA 4ECTA 3JPNA 2KN7A 1DLOA 1BISA 2PFNA 3OYGA 2BQ3A 9ICUA 5CHGA 4F4WA 4M45A 2YHBA 2YNIA 3KLFA 5KFJA 4KTWA 5CR0A 4HVJA 5KG1A 2I5JA 1A76A 4JWMA 2EX3A 4X5VA 3AO4A 1L3UA 3ZDAA 4NCGA 9ICCA 4Y1CA 4HUFA 4I2FA 3MABA 5BOMA 2FLLA 1BIZA 4BWJA 4IR1A 2W9BA 3L3VA 1A5VA 1S1TA 4YXMA 1GOBA 2JEFA 4RU9A 4CJSA 4IFVA 3MBYA 4PPXA 4M3YA 3OVNA 3KLIA 1ZQPA 4O5KA 3V9XA 3ZD9A 4P4PA 4DL4A 4C8OA 2BCUA 4KI4A 3M8SA 4I7FA 4FK4A 1S76D 4ED8A 3F9KA 5CY4A 3MR2A 3SUPA 3VQPA 1TK5A 4UB1A 2BE2A 1J5OA 1BPZA 1REVA 3AVHA 4DLEA 7ICLA 4MFBA 5HMLA 1T8EA 1F21A 2BQUA 2M9NA 4CFDA 4EEYA 3EY1A 4CEDA 4Z4IA 3OJUA 1IKXA 5KFMA 1QLNA 2QXFA 3QINA 4CGDA 3RB0A 2DFHA 4LZGA 3GDXA 1HJRA 5J2AA 4JV0A 1U4BA 1S0VA 2HHQA 1X9WA 4FJ9A 3KLGA 3SQ2A 3NGZA 4CEEA 5D46A 4YMOA 2FLNA 8ICKA 3Q8SB 1TGOA 1DTQA 4DL2A 4RW4A 3TAFA 3JPSA 3M9OB 4QWCA 4OJRA 1ZBHA 4CHNA 3NHGA 3AVKA 3EW9A 4Y1DA 3C23A 4FJNA 3IHQB 5DDYA 2JZBA 4I27A 3QNOA 3Q8PB 3V1RA 3AA5X 4DG1A 4QCLA 3RMCA 3Q8RB 1N5YA 3QEPA 3KLEA 3CFRA 3HWTA 3SJJA 5FROA 4RQ2A 4CJEA 3C1ZA 2X6NA 2IBKA 4M9NA 4DEZA 2UVRA 2VA3A 3MR5A 4AHVA 4DQIA 3RJIA 9ICBA 3QEAZ 4IRKA 4H8KA 1Z3EB 3H4BA 3QO9A 4QW8A 5D49A 1I3AA 2AGPA 4E7JA 4CJ3A 3HP6A 5HROA 4QZFA 3GIKA 3DRSA 4J9RA 4O4GA 5J0XA 2W8KA 8ICGA 4KHYA 4Z4CA 4KV8A 4Z0UA 3V6JA 4DL3A 3T5HA 3TWHA 1QHTA 1TKDA 2XGPA 2W9CB 1T3NA 2DTUA 1ZJNA 1VSLA 4AHRA 4RQ7A 3H8JA 4TUPA 4CESA 5KG3A 4E1MA 4JS4A 3QEIA 3HYFA 4I2DA 7ICUA 5DB9A 5KG6A 2R8IA 4EYHB 2AGOA 2ZJ8A 1NK0A 4M9JA 2ZQBA 1S9EA 2DY4A 1SL2A 1SV5A 4JV1A 3GILA 1U9LA 3ZT3A 4RW9A 3GIJA 4CFBA 3M8PA 3DI6A 2BCSA 4M9GA 3KKRA 2P5OA 2IC3A 3FFIA 4QOZB 4IQUA 4CEZA 3GIIA 4QZ8A 1S6QA 1RDCA 1EX4A 5KRSA 3S3OA 4BWMA 4QWBA 4B8AB 2BGWA 4KKOA 4B9TA 3UPQA 2ASDA 5HRSA 1NK5A 1Q9XA 4ZTJA 1BIUA 2B5JA 4YG2A 4DL5A 2PFOA 2F1HA 2HHUA 2GBZA 4YMNA 4MEXA 4ED0A 3TANA 4OPKA 3TQ1A 5IIIA 4OKJA 1JLGA 4HCCA 3SI6A 3AVMA 1WNSA 2ISPA 4Z4FA 2BR0A 2IMWP 2YNHA 1N48A 1TVAA 4FVMA 4LY7A 2BGGA 5JUMA 1ZQMA 3VQQA 7ICMA 3VQ8A 1LWCA 2HHXA 4RUCA 1WN7A 4B9MA 3PR4A 4I2EA 4KHSA 3MR3A 4FJJA 4UQGA 1TAUA 3ZT4A 4DMNA 3PR5B 4E7LA 2ASLA 3K57A 1C6VA 2AGQA 4CGGA 1S0MA 1ASVA 3H40A 3RAQA 3BQ0A 3MAQA 4OVLA 3RH6A 7ICIA 4EBEA 2ZUCA 3RH4A 4JRPA 5KFVA 4KLFA 3PX4A 4KTZA 3DOLA 1NJWA 4NLGA 2W9CA 2XY7A 4CF2A 4R63A 3MGIA 4CJRA 1HNVA 1SZPA 1VK0A 4FLZA 1BQNA 4HUGA 4YD1A 4NM2A 4KB0A 2O4IA 1C0UA 4BXOB 2YNGA 4XIUA 4GC7A 1LB2B 1S1WA 4FM0A 3V9SA 4P2HA 1DOQA 4DF8A 3OYFA 2FPKA 1HUZA 4F50A 2MAXA 3HXMA 3OSPA 3CFPA 4UBCA 4YXJA 5SWMA 4FK2A 3FYHA 1S97A 4F4XA 1LAWA 4J9OA 3KLHA 4F5OA 4AH9A 4IR9A 7ICKA 9ICOA 1KSPA 4K4HA 4K8ZA 1Q9YA 4FZZA 5C25A 4DS5A 4J2BA 4YP3A 1T4GA 3HK2A 4UB3A 2IA6A 1HPZA 2Z1HA 3DRRA 4M47A 2ALZA 3LP1A 1L3TA 4RUAA 4QZBA 4O3SA 3PMNA 3Q8KA 4UBBA 4FS2A 4FJKA 4CJ4A 4AHUA 2PYJA 3V6KA 1MU2A 3AO5A 3KJVA 5KT3A 1ZQHA 4J9PA 3AA4A 2G8HA 4M42A 2P6UA 5DMRA 1B9FA 1FKOA 1B92A 3EWAA 4I2GA 3AVFA 2QKBA 5IIOA 2V4RA 3HVTA 3LALA 3LP0A 5KG5A 3KK2A 3WNHA 3IG1A 4FJHA 3NF9A 5I42A 1LV5A 4M6WA 4N56A 2QKKA 4DTSA 4KITB 9ICNA 1BCOA 4YQWA 4J9QA 2BPCA 3G6VA 4DSFA 3KHLA 3NF7A 4ECSA 3ZT0A 3RB3A 2W9AA 5CJ7A 5DK5A 3ZDEA 5L1KA 1HQUA 4YR2A 4NLKA 3RAXA 5BOLA 4I29A 4B08A 4R66A 2PY5A 4QZHA 4KRFA 4LSLA 4YN4A 2C2RA 4B9LA 1EP4A 1J9AA 1HNIA 4FLVA 3MR6A 1KRPA 4CGHA 1X9SA 2A1JB 3C6TA 9ICVA 2RF2A 4OGEA 5KFZA 3T5LA 1XHZA 2F8TA 2OZMA 4CGJA 1ZBUA 2ZTEA 3HL8A 1WAJA 8ICMA 2JEGA 5DG8A 2KZZA 4CECA 8ICEA 1Z25A 1RYSA 4O55A 4O9MA 1LW2A 4CERA 4RZRA 1VSHA 4MFCA 2OPSA 5SZTA 1YT3A 3QEWA 4ECWA 1A77A 2W9MA 8ICJA 3VQBA 4CJPA 3VQCA 3OYMA 2JLEA 4TQRA 4ED6A 5KFLA 1KFDA 7ICRA 5J0SA 2ZJAA 3KIOA 4MF8A 4O5CA 4F92B 1XHXA 1ZQDA 9ICJA 5IILA 1L3VA 4B9NA 4EBDA 3RBDA 5KFOA 4UB5A 2IHNA 3T3FA 3AVCA 3VA0A 4ELUA 2FBXA 4UAYA 5J0QA 2DPJA 2HHVA 4EBCA 2G8KA 2BCQA 2BCRA 4UB2A
chains in the Genus database with same CATH superfamily
3THYB 2E4LA 4UY85 3EZUA 2KG0A 1XC9A 1KXPA 4LF4J 4PWWA 3OVSA 4FM1A 1RHQB 1RHUB 3L0QA 1Y97A 5KT5A 1FXDA 2JLFA 3NUQA 3M8RA 1HWKA 4DPWA 3KUEA 3IGVA 1VHIA 1T9WA 2J5AA 2HQ3A 2PMHA 2GMLA 5H1SQ 3HILA 1BPEA 4QZIA 3OBYA 2CRXA 3IRXB 2EZZA 3JSMB 2P9NA 1IG6A 4RW6B 2WF8A 1UPMB 1SZ2A 3FR0A 2ZH3A 1C0MA 4BRGA 1HQUB 3UXOA 2DTJA 3RWUA 2VA2A 4LBPA 1X6JA 3CC2N 3ZEUB 4UAWA 1BY9A 4CJUA 2ZH7A 2UUAK 3I9ZA 2A3ZA 3AA9A 1X2IA 3V6HA 4EZ9A 1XQSC 3L2VA 4XH5A 3ZETA 3SR6A 2RF2B 3OYBA 4OLBA 3OYJA 3OR1A 3SLCA 3H2VE 3NCIA 3RBEA 3C2PA 5J29A 4DR2F 4UY8T 4A5AA 3QE9Y 1P6TA 3NG8A 2GGPA 4F4AA 1IJEB 4QPXA 5ETVA 5AQGA 2KYXA 9ICFA 1QUPA 1JX4A 4M5DA 3M9MB 1X1PA 2A1JA 3RF9A 1WI6A 3DRXA 1D9DA 2V9KA 1Q81T 3RSEB 3EX7B 1Z2LA 1RCOB 3GJQB 1BO5O 1IG9A 2CQ4A 5JXSA 6FDRA 2O67A 1VK3A 1JLGB 1RAIB 2H5IB 4MT1A 2ZBQA 3AHPA 2GUPA 1Z4UA 3IM8A 3TSQA 4JI1F 1Y9OA 4PZVA 2XZTB 3MF5A 2MY8A 1KBUA 1Y4ZB 4ID1A 5CZ2A 2QLTA 2G5IB 5JVHQ 3O3FA 1BGXT 3EZ5A 3H08A 4OV1A 2YQ3A 1KDHA 1LWCB 2E1CA 1QTMA 2FVRA 1S1UA 8ICBA 4ZVGA 1VQON 3KD5E 3CC2S 1ZM2A 3PW0A 2AU0A 1NH7A 2M8DB 4YB6A 4UAZA 4QIFA 3UIQA 3N4MB 2B4JA 4BLGA 4K50A 4P4MA 3NRBA 3OS2A 3TAPA 4O0JA 1WEYA 1I6JA 4M5HA 4LR9A 2F9JA 1EKEA 5AKEA 2C2DA 1IR2A 4P4OA 8ICOA 4CZMA 3QIDA 2K06A 4DFMA 3H6EA 2EZXA 3OHBA 4NRUA 1P7DA 4NM1A 1ZQAA 2W01A 3QFPA 3NGDA 5DB7A 4A61A 2V4JA 2LXFA 2FJXA 2GVZB 1XN9A 3GR1A 4OHYA 2UXBJ 3K5NA 3IDHA 2UVWA 5EOZA 1D8YA 1OWXA 1LFWA 1RAGB 1H6KX 3EUNA 2W25A 3R5DA 2AXTU 3H0PA 2HSZA 1KQKA 3DLLQ 2LEAA 4H4MA 5AT1B 4BGBA 3V4MA 3LW5C 1S9FA 8ICTA 4QIEA 4Y2TA 1NPPA 1MQ2A 4NCAA 5AKXA 1X7VA 2CPJA 4K0KF 5AQUA 3KWIA 1XSNA 2ILZA 4KBIA 3AU2A 5ALQA 4QIWD 2GV9A 4BG9A 7ICTA 2LBOA 3IWNC 4O5FA 1JJ2R 3BF1A 3HBTA 1RJJA 2KW4A 4IOXA 2YKPA 2VJVA 2Y0SC 3TEHB 5GADP 2W2OP 4W92B 1HNZK 1B22A 3P5JA 1RGVA 3T1HK 2PDAA 2OH2A 2JDJA 2LQBA 1LK7A 3JB9k 4AQYK 3DN9A 5G5HA 3O9UA 3R5JB 4YD2A 3DLKB 3MM7B 2HBJA 2NXEA 3BDEA 2CPRA 7FD1A 3B4DA 3ETRA 1F9HA 4E19A 1UTAA 3WX8A 2QMWA 1RDWX 5A6WA 4CF1A 4JI6K 2VKQA 2AJ4A 4ERDA 4YR0A 3AVGA 3PIOQ 1OYDA 1S6PA 4PY5A 2WC9A 1QS4A 3AVIA 2F1JA 4Z6CA 4LF8F 4N77A 3HJVA 3VQ5A 4ID5A 3QRPA 5AJ3J 2DB1A 1WKKA 4HL9A 5THWA 5HRNA 2LI6A 2FLPA 4EELA 1JLBA 1UHUA 2OYYA 1SKUB 2DGVA 3VTIA 1V4TA 4RW7A 4Y2XA 4JKAA 4JLHA 3VQTA 1VQKN 2HHWA 3QU9A 3EKSA 2DR6A 4DR6F 5L1IA 1BHNA 3HPGA 3GMGA 1HBUB 1RADB 1FNOA 3IM1A 3QU4A 4CM2A 1DTTB 4YN3B 2I9GA 1Z1VA 3VN5A 4KJIA 1T3VA 4R65A 3MCAB 4KLLA 5JRTA 2ESEA 4FO6A 3ETMA 3M8QA 5J2JA 3CP8A 4CIFA 4KLTA 1OH6A 2P9KA 2HK2A 1U2RA 1WSRA 4MMOA 1WSFA 1IJFB 2F4VK 5LMUK 4TSXA 2EFNA 4ILGB 3V1OA 2FC9A 3BKFA 4CZIA 3Q8QB 3V9ZA 1ZQGA 3BH7B 1C1BB 3IFRA 2QB1A 4ECVA 3DLKA 1GNKA 4XA5A 2L9DA 4DLGA 1GQEA 3S9HA 3WIUA 3CXCM 5GMDA 2X7IA 5KFTA 5AI9A 3RJKA 3I1YA 1MN7A 4B9QA 2H3QA 2YNFA 3CD6S 5B09A 1CZ9A 3TUZC 2A18A 4QAGA 4I28A 3NGIA 3BN7A 3ZSOA 2IJNA 1VQ4N 3N7SC 5D4OA 3BQ1A 2PI4A 4DPUA 4ZPBA 4CJVA 2P35A 4DUTA 5IT9U 5DLGA 1L8OA 5EXWA 2HFNA 1NMDA 3IRXA 3JSMA 1U0SA 4OJ3A 3I8BA 1TAMA 4UF4A 1JCFA 1KAYA 5A8KB 2XLKA 4OJ5A 3E1YA 3OFEA 4M3UA 4M0AA 4Y6IA 4RCHA 1GXTA 3G71S 3K17A 2PI5A 5K4LA 3I55N 5KTQA 4RKUC 2UYTA 5ALSA 4KAZA 3AU6A 1RE1B 1WB9A 4OLOA 3CIZA 1WUUA 2KQ2A 1FKPB 4MIBA 4ANCA 4U7UD 1P90A 3EYZA 4NLVA 4ZCMA 1J27A 1P27B 2V68A 2X1AA 4JI4F 3R2CJ 4DCHA 1ZJMA 2GELA 1UVKA 1N32K 2VG6A 1W0HA 3U9ZA 5B0FA 3OR2B 4MK7A 4FLUA 3MEEA 2F40A 4AT1B 2E1MC 3W5YA 2DEJA 2VKZG 4BR0A 1B99A 2NZTA 4ZLPA 1WC6A 3ZSWA 3CG7A 1IUJA 5KFBA 5AI4A 4FLXA 4RWTA 3A5OC 3M2VB 2ZH1A 4C0ZA 3GQCA 3R5AA 4DFJA 3KHHA 3LGNA 5J2CA 1ZC6A 4Y2VA 4AUKA 3A0HU 2P6SA 2F2AB 4LRAA 3C14A 4DQ8A 2A42A 1OXJA 3C46A 3PLAA 1CJKB 2V8DA 2QGFB 4KN4A 2V4QA 3S3MA 1S1UB 4CLPA 1W2IA 3DRSB 2KL8A 1YJUA 3W9JA 3MM9A 1N4LA 3J7AN 4KGXB 1RWMB 1S10A 2ZE2A 2MPUA 1RT4A 2C3PA 4DV0F 1HNWF 2KT2A 3O3LA 1FCAA 3KK3B 1RXVA 3TZXA 4B3SK 4TVAB 3ZZ0A 2F96A 1RTDA 2BE9B 1EXQA 3HTVA 3MK6A 1SB3C 4F4ZA 3IAM9 1RABB 3IBCB 3M2RA 2YWFA 1H74A 3M8PB 1DJ0A 1IBMJ 1O8BA 3CD6N 1UZHA 4NL5A 1ED1A 4M3RA 3RGIA 5B08A 1DQ8A 8ICXA 1D8ZA 3SSRA 2M2BA 1K6YA 2HHTA 1QAIA 2C3OA 2KHVA 4M9LA 2D0BA 1FWPA 4DFDA 3D3CJ 3J80Y 3L3UA 3V9UA 2KXFA 2D1KA 4F91B 4JV5J 4PKIA 1U6ZA 1NOMA 4GVBB 2O8EB 4PWDA 4F8RA 5BR9A 1XBWA 5EY4A 4L72B 1JMTA 1VSDA 1T05B 2IHMA 3UN3A 3DXMB 3T1AA 3O3HA 3MEEB 3WIVA 1QZ6A 3LGHA 1FJGK 1S9EB 7ICFA 4WK1A 1UPPA 1PVQA 3MXHP 1F2GA 4RQ4A 1GLAG 1RDFA 2EK1A 4C8KA 3CCQN 4C0HA 3VF4A 5FLXO 1EIYB 3D4JA 2A0FB 2HGLA 3BQ7A 2MHEA 3M6ZA 3FZ2A 4ZDNA 2J8SA 2DHAA 4ID8A 1YJ9N 5K8MA 1WYGA 4DV3J 1JLFB 3CSKA 1MWKA 3H59A 2KHDA 4KSEB 2RLTA 2HQIA 2EXUA 3SMZA 5KFIA 5HNKA 1V3RA 3JTPA 1WSJA 3MM8A 1ZD2P 1MW7A 2WW4A 2CPYA 2M88A 1M90T 5HL7L 2CG4A 2FLOA 3BS7A 5J2HA 3C1YA 2DNRA 3QXGA 4USJC 4YHHK 2W24A 3NVKA 4HI1A 3QMLA 3SPZA 5E3CA 2P8IA 2CYYA 1HRHA 3H2UB 2Y8YA 2DNOA 2MKKA 3SDEB 1UJ6A 3AD8C 4LT6A 5KFYA 2YKMB 3MX2A 4UW9A 3S01A 3L4QA 3BS9A 3KD1E 1DRZA 1HD1A 1EKRA 2IIRA 2G0AA 2NYIA 1REVB 5CABA 3FZLA 1PUZA 3BZQA 4G3IA 4YCXA 3JS9A 2Q4TA 3W2WA 5F8NA 4W4MA 3BBCA 3OYHA 2GWJA 3BQ2A 2H9ZA 5F8MA 3EPGA 3CWJA 2OP5A 3HHKA 2UVUA 5D0GA 1HNWK 2ASPA 3ZSXA 3H8SA 5AM3A 3H7HB 4LSZB 3KMQA 3IV6A 4L75A 4KLJA 3DXMA 4KMUA 4HI2A 4H0VB 5HMYA 5F8HA 3D7SB 3EWGA 1VQMN 1KC8T 1RYUA 4Y3CA 2FVPA 1SKSA 3H25A 4FM2A 3TW0A 4Y2PA 1S0OA 1MMDA 1VQ5N 3FK4A 1VBZA 4LF5F 2RAQA 2DKOB 4ILLA 4WU2A 3RRKA 1EQMA 4JI7J 4G1QA 2MUTB 5BREA 2RQ5A 1FA0A 2C2ZB 2XNRA 1CULB 1FKAF 4RTFD 3IRUA 5L38A 4OI0A 2RDJA 3ZD8A 4IG3B 4DV1K 2BA9A 3PTWA 3K5MA 3DRYA 2QTWA 2CJYB 3HVTB 1RDAA 1RK8A 3AUOA 2HQGA 4DOBA 3OUYA 3C21A 2A2DA 2GC8A 2OFHX 4KRWA 2ASJA 3D6JA 5J0UA 4J90A 1UCVA 2AF6A 2V2ZA 1T11A 1O08A 1NNLA 1ZQUA 4DR4J 1EXNA 1FESA 4TU7A 1JLQB 4F67A 2EBEA 5AE3A 3VEYA 4KHPJ 2HB5A 1C7YA 2ZF5O 5LL6d 2BKEA 3K4GA 4KLDA 1S1XA 3WU2U 2VJ5A 5F8IA 2R2UA 4F3MA 1ZM4A 2YY6A 2J6TA 4O3QA 4FLWA 1SL0A 3MPYA 3HULA 2VYPA 3THWB 4OL8A 2PC6A 3LZIA 3OTBA 3MAAA 4US9A 4WU3A 3HI9A 4U95A 2Z1IA 5ETPA 4JI2F 3CC7N 1XS9D 4LSLB 3PIPQ 2JRZA 1RI7A 3CETA 2YKOA 4M5IA 2HMXA 2LLZA 3V72A 4PG4A 3CD0A 4RPYA 5J2QA 1CG2A 4F4YA 2IC3B 4J2AA 4ECUA 4OJOA 1NH8A 4IBNA 3NDKA 4I9QA 4IDHA 5C42A 5KGXA 3N7RC 2VIXA 2F63A 3B54A 1VOMA 3R1XA 3JQJA 2G0CA 4CTAA 2PA3A 5JS2A 2HW3A 1HYSA 2MUTA 1KEKA 5J0WA 5GAHI 3ZSVA 5AQHA 1VQKS 5DGAA 2DHGA 2PO4A 3BEGB 5ETRA 3WNEA 3MM7A 3MR7A 4IUFA 2IRYA 1RA6A 1Y88A 4YVZA 3H4DA 4JBCA 3B0YA 1BL3A 2ITMA 2KIWA 3QJLA 4E1JA 1IV0A 3R1LA 3C19A 1RB0A 3AY9A 3OYLA 2RD5C 2H3VA 3QEXA 2RHKA 1GO3F 2G07A 1FXRA 4E7HA 3OSNA 3E2EA 2W4CA 4DOAA 2ZIUB 2VHGA 4FZYA 3LP1B 3U1NA 7ICQA 5BN8A 2F3JA 2D9PA 4QZAA 7ICSA 2OKQA 1UVIA 5ALIA 3KJFB 3ENHA 2BZ2A 1YTYA 3RW6A 1HR0J 3H45C 3UQ0A 5D0EA 1OH7A 3S41A 2IJFA 4ES1A 1IKXB 2CIMA 4ZLJA 4I2JA 4OLPA 1KEJA 3CNQP 1BD6A 1NKEA 4ACOA 2RRDA 3VF2A 4CE9A 1QSLA 1RT6A 3N4QA 4O8UA 1MN9A 3QNWB 9ATCB 3OTOF 3ISND 2R7XA 4XK8C 4ZOHC 3VAMA 1BCMA 4UB4A 4BUGA 3IS9A 5H9EJ 3GG1A 5ALRA 4QNLA 5DJBA 1FFWB 4B1UB 1QSYA 2E5JA 3TJ8A 1ASUA 3BO2A 2OPPB 3TKAA 1RCXB 3VQ9A 1IQZA 3DGVA 3PZPA 4K4WA 2J9CA 4KHWA 1HJPA 1OY8A 2QARA 3HW8A 4E89A 3AL0B 3KD3A 4CGZA 4XDDA 3NF6A 4YFUA 4OYOA 1RBUA 5EWEA 1KFTA 3EE3A 4BC2A 4JV5K 5M1PA 4CVNE 4PZOA 2EW9A 4A8EA 2D3ZA 3JPQA 4PHDA 2D3O1 3CCSN 1LXNA 5ALHA 1NDPA 4XPEA 2DO4A 4ZLLA 3DYAB 4DR1F 3FZMA 3VQAA 4RNMA 4OPAA 4DV0K 1HIYA 2VFUA 3HJFA 5TKYA 4M3XA 3OGUA 4UB8U 3BS5B 4QZCA 2G8WA 2NNWA 1KKXA 3BF4A 5FIIA 4PA1A 4BR4A 3V81A 3MPUB 3HT3A 4DTJA 7ICGA 5ALLA 3N97B 4IWVA 1FRLA 2XYGB 3KLEB 3TYTA 1J54A 5IZHA 1EP4B 4QYZK 5I3UA 3W9IA 4R8UB 3QZ7A 4M3WA 1S48A 4FL9A 1OSCA 3SQ4A 2GAHC 1YGYA 2QSWA 1YHQN 3K5LA 3C5GA 4BQLA 4CD1A 3RVCA 3Q24A 2QLWA 3B8HA 2X3DA 5J2KA 3ZYYX 4ZH4A 2E5IA 2DRDA 1RGIA 2AT1B 4DO9A 3JTNA 3RJJA 2L41A 4V19X 1R31A 3GE9A 5F8LA 3SAGA 3SUNA 4CW7B 3M6GA 3OL6A 2KM8C 2PFFB 3PCOB 4DSKA 3SQ1A 1SJ1A 1F44A 3AO3A 4FOEA 4BC5A 3TFSA 1P1TA 3MCNA 3AA8A 1MWYA 1VI7A 1X4BA 2E3TA 3NNAA 5EX0A 1PK1B 4OGCA 4J9VA 1U8SA 3CMAN 4U96A 2NUBA 3WKDA 3E9OA 3TO8A 3NH1A 4HDHA 4M5NA 4I68A 5BR8J 1N36J 1OVQA 5L1LA 4FJ7A 1X4DA 2FJAB 1Q5YA 3O6QA 1U48A 3O4NA 1X5TA 5KAKA 4CEOA 4PCQA 2MHNA 5IQ6A 4QS8A 1X8DA 4UZCA 2NCKL 3N5FA 3OQ2A 1SUQB 4IG0B 2FPMA 4DV4K 2C2KB 2JV3A 3FGVA 2V0NA 2I5HA 4WKYA 5AKHA 4DUZJ 2MQOA 3WKEA 2KFYA 2QKQA 1JB0C 5J0PA 3G4SN 5FRNA 2DBBA 3AVAA 3RTVA 3HCXA 3JYTB 4TLRA 4H4OB 4UUWA 2QG9B 3IXQA 2V51B 1KD1T 5DM7Q 5AE2A 3PY8A 3QEVA 4JB3A 5DBBA 4LF6J 5E2QA 2Z30B 4TNOA 4ECRA 1QAJA 5AQOA 3SAFA 2ZG6A 3UKRB 1XSPA 4I6MB 1S1XB 2W42A 1NJIT 4PABA 1YBAA 3HFKA 1QCKA 2KFZA 4USTA 4RNOA 3D0PA 5AI8A 3V7LA 1MSWD 4YFKA 4DOCA 1U45A 1YKWA 2UUBF 1H7XA 2C28A 1N63A 4DSJA 3R5CA 4U7UK 4CJQA 4BE2A 3C6AA 1ZYQA 2FHJD 4M5JA 1F2HA 4NJ8A 3V4IB 5E5NA 4YMMA 1Q8IA 4FF2A 3CYMA 4A8MP 3M8YA 3QGPA 3VCBA 1K5OA 2XLIA 1ZQXA 1NNDA 4S0MA 5CQGA 4FKYA 4DR4K 1WD6A 4WTOB 3QRQA 2X1FA 1GLJO 5HP4A 1UEUA 2AA4A 4FS1A 3ENWA 3P6YC 2MJNA 2DNYA 1PCAA 3SK3A 2F5GA 2B51A 3BF3A 3AEVA 2EBGA 4ZPVR 1MMLA 4GLXA 4AYBC 3PHTA 3FBCA 4OYAA 3EN9A 1ZOLA 4WFAL 5AQSA 3FCWA 3KKAA 2KFNA 2A41A 5FPNA 3R9PA 4CJ5A 1IKWA 3RH5A 9ICGA 1AUDA 4EIAA 4FF1A 2HAFA 3K59A 4HCBA 3QATA 4J2EA 2LM4A 2IYGA 1Z19A 2AW0A 2KN7A 2E9TA 1DLOA 1BISA 2BEFA 3ED5A 3OYGA 4KH4A 5CHGA 2WZ1A 3CI5A 3KLFA 3FSXA 3PJXA 3P4IA 2DGQA 4G1PA 2I5JA 1A76A 4JWMA 1D4XA 3BZCA 2KI2A 5EDWA 3ZDAA 9ICCA 4I2FA 4FZLA 2Z8QA 1R6VA 4URGA 2FLLA 2ZH6A 3P3DA 3E58A 2W9BA 3Q2TC 2I0XA 1A5VA 4IEIA 1S1TA 1RTZA 4YXMA 1GOBA 4GV3A 4RU9A 4CJSA 3F41A 5IOLA 1WC4A 2HOIA 5ETNA 2MQPA 4DUYF 4PKGA 3F2CA 4M3YA 2MRLA 3B4MA 3KLIA 1ZQPA 5B66U 3V9XA 5I3QA 3AOBA 1N32F 2MJUA 3ZD9A 4P4PA 4C8OA 3T9NA 4CLZA 3KHYA 2Y1LB 4FK4A 5AKGA 4ED8A 2P9GA 3B8AX 3F9KA 5CY4A 3MR2A 1KD1O 3VQPA 4KH1B 2VQFK 1ZTWA 1S1VB 2MKCA 4UB1A 1REVA 1TE2A 5EE9A 2ZVSA 4PXCA 2C2NA 4Z4IA 2VWBA 1IKXA 1Q82O 3IP4B 3DFEA 2ZD1B 5FPDA 1ELOA 5CYMB 3TA2A 1S0VA 2HHQA 1OS5A 1UETA 4YOWA 3SSSA 4V19S 8ICKA 1DTQA 3TAFA 3W64A 3CJSA 5IC4B 4QWCA 1EARA 2CZVC 2EG1A 3NHGA 4OI1A 5AZIA 4ZVHA 3C23A 4DL0C 1PILA 2JZBA 4I27A 7AT1B 2E5LK 4NCGB 2HBRB 3IC1A 1K47A 3QMQA 4IFEA 2JHEA 2IYIA 5IXUA 3T1YF 2QFIA 4Z37A 2YNIB 2OD4A 3MUTP 2DPNA 2XMWA 2BMBA 4X4SA 2J0SD 3CRXA 2R7TA 2PT0A 4F0MA 2HOFA 2BW7A 3VESA 3CCRS 3GSDA 2E5SA 4WYLA 1N5VA 3QEAZ 3VCDA 4IRKA 4CT9A 4UY8O 1ATNA 4B3MK 4ZLNA 3QO9A 1BWVA 1I3AA 2CFXA 2AGPA 1U1NA 4CJ3A 4U7CA 4QZFA 2HNDB 4TY9A 1QDUB 3DRSA 3S6EA 3KLIB 1HLWA 2QLFB 4X4RA 8ICGA 4DL3A 4UZBA 4ISEA 4NLXA 3TWHA 4BR2A 2B4UA 2KJ9A 2XGPA 2DGWA 3P4UB 4NA1A 1ZJNA 2DTUA 4AHRA 5B0DA 1PAUB 3GSIA 1K8KB 1RTDB 5LJVA 1KOHA 5DB9A 2HRTA 4DN9A 2FHJA 2ZJ8A 4M9JA 1CJVB 1W2BR 1SL2A 4YB5A 1SV5A 2ZC3A 4ILRA 4OD0A 1KLMB 3KOAA 4K4YA 2DO0A 1VQSA 4DV6K 2QM1A 3M8PA 4DV5F 3DI6A 2BCSA 2P5OA 4LBIA 1TFYA 1X5PA 4ILHA 4CEZA 3GIIA 4QZ8A 1YLXA 4DR5F 1H7WA 1EX4A 4NMLA 3S3OA 5CCLA 4QWBA 4H0XB 3FNNA 3BSOA 1WHVA 2ZNYA 3CPEA 3TPQA 3I9V9 1AA1B 3N6MA 4OX9F 4A8YA 1Q82T 1Q9XA 4JI5K 2ZZMA 4WBFA 3AJDA 1Q7LB 3C15A 2F1HA 4ED0A 3O9QA 3TANA 2XZDB 2HVZA 2NREA 4OJGA 1KHWA 2BR0A 3WXIA 2MB0B 4LRBA 3G9CA 4ZVTB 3W7BA 4LY7A 1ZQMA 1AFIA 3VQSA 3CB4A 3DXSX 4RUCA 1NNEA 1WN7A 1RUSA 2OTJN 3GFYA 4OX8A 3M2UA 3CIPA 3PR4A 4KIAA 4PL1A 1CPZA 4LF9F 2FTRA 2X51A 4MIWA 4ES3A 1RP5A 2IVPA 1L3KA 2WFAA 2ASLA 3K57A 4TY8B 3NS6A 1ASVA 3UR0A 3H40A 1VHXA 1HQEB 3MAQA 4LRDA 4EBEA 2ZUCA 1M6YA 5KFVA 5D0HA 3ULEA 2JXJA 3PX4A 1RT2B 1CZAN 3PM9A 4CF2A 4CJRA 1HNVA 5BPMA 2PSZA 3BSCA 1SZPA 1VK0A 2GHWA 4ANEA 5HBMB 3V5RA 2O5DA 3KG0A 3EGVA 4BXOB 3TEGA 2KSOB 4QS7A 4CDGA 4FM0A 1XMQJ 2FZKB 1DOQA 3SMPA 2M4MA 2FPKA 2WB1D 1LVHA 4QQBA 4UASA 4YXJA 3W2WB 1A6SA 1UVLA 3LTOA 2UXDK 4J9OA 3KLHA 3UMGA 4BRAA 4CO5A 3GZFA 4ZOSA 1QTNB 1Q9YA 3FMWA 3NRZA 5DZ7A 4J2BA 4CLUA 3HK2A 4UB3A 2MSSA 1LWXA 4M47A 2ALZA 5CXTA 4QZBA 3PMNA 3D9BA 2WF9A 1KAXA 4KKOB 1HWIA 4PHTX 4ZJLA 4NWIA 2VONA 5AM2A 3PKYA 1EX8A 1TKXB 4Y0WA 3GJTB 5C10A 3VAGA 4CYUB 4DB3A 4Z7YA 4DHYA 5AXMA 2P6UA 1FKOA 5M1FA 3UE5A 4K0KJ 1X31C 4N8NA 1RTHB 2BABA 5IIOA 2MXYA 3DHXA 4CM0A 3KK2A 3QLHB 1I3OB 3IG1A 1HJOA 2HYIB 4H5WA 3HKZC 1HARA 2VC0A 4N56A 4X4UA 9ICNA 3IP0A 4LJMA 1Y5NB 4DCJB 4L76A 3H1VX 3RUBL 1WSVA 4ZPDA 5G0RB 1NZBA 3MEKA 3RB3A 4NYZA 2K1RB 2VQEF 4P0QA 5IS2A 3GZ7A 5DK5A 2YNGB 3ZDEA 4YR2A 1NBWA 3VAHA 4FO0A 3BS5A 1VJ5A 3GP9A 1Q86O 2ZH8A 2PY5A 4WF9Q 4YN4A 3NGTA 2E44A 1TUVA 3W66A 4BRQA 2YMQA 4KFBB 2GCFA 1EZZB 2A1JB 3A13A 5JVGL 3QFWA 4F7VA 9ICVA 3K0JA 1RU1A 3N5BA 3RSEA 4B1VA 4NWBA 1BLUA 4OGEA 2IPOB 4FWMA 3VAJA 3T5LA 2YBVA 1HW8A 4B1YB 3UI3A 3Q8VA 3HL8A 8ICMA 2HRUA 2ZXHA 5DG8A 1E6VA 4ZP7A 4CECA 1RYSA 4O55A 2OI2A 2BVZA 1U02A 1TL1B 2OPRB 2Y1RI 3F56A 4CP5A 2FD2A 3EMTA 4ECWA 1IKYB 1A77A 2W9MA 3VQBA 3L6QA 2U2FA 2JLEA 4DV2J 4ED6A 3LDOA 3NMAA 7ICRA 1K9MT 1RQNA 2HWTA 1JROA 1HEKA 4YDDB 1ZRNA 4DR6K 4F0KA 3W65A 3CC4N 5AKIA 4EBDA 4Y2JA 3CMES 1RWPB 3N9UC 2IHNA 4EGLA 3AVCA 4UAYA 4KYZA 1IR1A 2G8KA 1SZHA 5C42B 5CHCB 4UB2A 1WG4A 1KR4A 1YJ7A 2EEYA 3B9JA 1WTBA 2ZM6K 1LW0A 4FNHA 1TKTA 2H5EA 2EZYA 1ZAVA 3GU3A 4ZP6A 3CDAA 5M1KA 4DFPA 5KFNA 2E8OA 1P9QC 4I2QB 1YJWN 2HBZB 4IQVA 4M5GA 2HBYB 3I5AA 3HMJG 1J6ZA 4F25A 4JI5F 3PACA 4GKJJ 3CCQS 1ZOTA 2HOQA 4LFCF 3PV8A 1MMNA 3GCWP 5EE3A 1S57A 1KFSA 4FF4A 1YVNA 2ZIUA 5RUBA 5KT2A 1MROA 2CJ9A 3EZOA 1XJWB 5D4PA 4LF7J 3BGOP 2QEXN 1S4EA 4FF3A 2HVDA 1FRKA 2FXUA 4FYDA 4X65F 3MD1A 1S5ZA 3VQ7A 1Z4OA 4LR7A 2OPSB 4IXCA 2Q2RA 2K3KA 3WK9A 5L46A 3ZSQA 3CCEN 3RJHA 2PYLA 5A8KA 3AB4B 2OSRA 2XSJA 4WYWA 4O44A 4FE3A 3LP2A 3MMCA 3THXA 2OPQB 3FEXB 3VQDA 4TU8A 3U26A 4DOZA 2QLJB 1HI0P 3HHLB 1VC5A 1EWQA 5IM0B 3U9DA 4NLOA 2I6WA 1ZAWA 3EDRB 4U6PA 3BGFA 2QK9A 1AROP 1I5OB 1N36F 4C6AA 2YB1A 5ALVA 2JGUA 2G8IA 5JMVA 5A0LA 2P51A 5FLXY 2HDOA 3CJ2A 2KZMA 3TUJC 4LF1A 2XRIA 4ZJQA 4Z4HA 1D0EA 1A6LA 1TK8A 3LF0A 1OVYA 9ICPA 3TI0A 1KOOA 2CVIA 5FDLB 2Q31A 3MAAB 4OX6A 3OYKA 1CULA 4JI1J 2DH7A 3PW5A 5ADXH 4KB7A 2BE7D 2VQFF 2M7SA 1M1KO 4CHZA 4MKVA 2BW2A 4X66J 1NWKA 2O8DB 2YQ0A 4RQNA 4LF6F 3CGIA 2AYGA 2FSKA 2WF6A 3R9KA 4AE5A 4ID5B 4I2BA 3O6WA 1JLAA 3KJNB 4QZDA 1WC5A 3GV5B 3DCAA 2BJ1A 2FJBB 3DGPA 4J91A 5HP1A 1KN6A 1N33F 5HMWA 5AQRA 4C11B 5AQVA 3MPWA 4EI2A 2ZBRA 8ICUA 1NXIA 2V8PA 2MLYA 4WFZA 1DHMA 1AYEA 4KLSA 4KR0B 4YOXA 3MMAA 5C7PA 3CCRN 2ZC4A 1HKCA 4IDKB 1GLBG 2NLXA 4PHEA 2Q6CA 1VRTB 4QIWF 3A0BU 4WWSA 3BGRB 3UXPA 1YX2A 4K2JA 3MOJB 2FBTA 1NKBA 2W7AA 2R2TA 3GBTA 2RSQA 1IQTA 2QEXS 4KLHA 3UCGA 1RAHB 3UDCA 2DIUA 1ZQZA 1NJYA 1VC6A 1JLEA 4TKTA 3UDEA 2ATQA 2FF6A 1JL2A 5EWGA 1VJWA 3I0SA 2XMVA 5AZJB 5C5JA 1AZSB 3PFEA 3KDNA 1F9EB 3N6NA 1Z05A 3BPDA 5KFHA 3R6GB 5KFEA 2HVIA 2C2EA 2AYEA 4EO6A 2KIVA 2UVVA 1C0TB 4CF8A 4CJWA 3OTDA 1G3OA 1YVUA 2CJQA 2LMRA 5CRXA 2W2MP 1JLFA 3WNGA 5HOOA 4IRDA 2F65A 2Z2LA 4FJXA 4BDPA 3MFIA 3H0MB 2WONB 3F9MA 4PPZA 3OD2A 2V2QA 3C94A 3HHEA 2E7XA 1ZS6A 3T19A 4LF8J 4PYAA 4DUYK 4HYKA 2EC2A 4ZCLA 1L5UA 5K14B 1UA0A 4I1TA 1PVPA 4DQPA 2K8AA 3C29A 4LF2A 3KUGA 4HTLA 3AQPA 1DQAA 4RUBA 2IAJA 1B7FA 5EU7A 2KT5A 5HQMA 3Q8MA 2NRRA 5B0CA 4BX9C 4Z6FA 3KZIU 5KFGA 2B43A 2G2ZA 4Z6DA 1KDNA 3IR6B 2WW8A 4BCAA 2MZSA 3THYA 1P1LA 4OHVA 1OYEA 4CCHA 2OYQA 2G9OA 1FDNA 2VH7A 3WC2A 3MTJA 2MSNA 2PMWA 4U67L 2KXNB 1IV8A 3L09A 2WAQC 1Q81O 4JMUA 4PH5A 2K2PA 5HQLA 2ZE2B 3V6DB 5CCMA 3WXJA 2Z2ZA 3VQ6A 1C1CA 1EB0A 1RT4B 2V2KA 1EAYC 3P38A 3D6MB 4A46A 3T1YJ 4QZEA 2QWLA 3O1BA 1FEZA 2APOA 4O3RA 2XQCA 2HNZA 1NSAA 1FFSB 3BGLA 5F3ZA 5A2QU 2ZHAA 4IOCL 3UDLA 2Y3YA 1F6TA 4YHHF 3J80U 4YORA 5B0AA 3M6WA 3RW7A 4KLQA 1BPXA 1M90O 2K7KA 5ALWA 1YJTA 1B0XA 1TKTB 4QR0A 5C24B 3T1HF 5CZVA 3D1OA 3J7YI 5EN1A 2HMPA 2M0NA 1SH3A 4JI0J 2VPXB 2ES6A 1EQYA 3D45A 2WONA 5IT4A 2BPGA 4ZHRB 4TY8A 2LCWA 2XY8A 1HUOA 2IGIA 1WTFA 3CCMN 5LOQA 2VFSA 1ZQRA 2R7SA 3NRWA 3TAMA 4MKYA 2HVHA 2UXCJ 2B8PA 4ZIVA 4X2BA 1PIEA 4O5BA 3MM5A 2Z1JA 2P9EA 3ZTQA 4ELVA 5A76A 3LZJA 3SFUA 4KI6A 3MMBB 2LECA 2J0QD 4FNIA 3PG9A 1HPZB 2D6FC 4JK8A 3GB0A 2PA8D 2DKXA 2CQCA 5F0UA 2A6AA 2YTUA 4F2SA 3NGRA 4KHPF 3IUCA 3CCVS 3RMDA 1KNZA 2YJEA 2VODA 4DTXA 3MN6A 3C2MA 1E4FT 4M04A 4DXLA 3DRRB 3JYTA 2AEMA 1VSKA 5A0YB 3MM8B 3QIPB 4Y2RA 4M5KA 2LPEA 1NGAA 4GVBA 2CQDA 2CADA 5DKWA 4CO4A 2OZSA 1GX5A 1UT5A 3K8WA 2FF3B 2BV3A 3DMJA 4YY3K 5JS1A 3VEXA 2O8BA 1ZQYA 4FZXC 2IOHA 4GMJB 4DTMA 2F4FA 4M2YA 2HQFA 1E3MA 2YQEA 3PW2A 3BBBA 4HHJA 1JXLA 1EKSA 2GMJA 2CPHA 4CJFA 4CF9A 1RBSA 4BC7A 1KQGB 2C2MB 4NO7A 3IMQJ 1U1OA 2HIQA 3MEDB 3WEEA 3QUTA 3KK2B 3SPYA 2Y1IA 3FCVA 3QPIA 4TYAA 3HSTB 2I7NA 3CFOA 4TQSA 1JL1A 2JH3A 2XO7A 3G6YA 1X60A 4ZHRA 1XU4A 2DY9A 3EL2A 2N1RA 1TL4A 2G09A 4QWAA 3MZIA 1RILA 1TL3A 3WKAA 2OEHA 1RAOA 4E8UA 1SI9A 2KHQA 1SJ3P 4I0WA 5LMUJ 5ETOA 3W2VB 2XI2A 5ETLA 4PQUA 2QT7A 1TUYA 5T41A 4FK0A 2KG5A 2XLJA 4KO0A 1TAQA 1WBBA 1M0SA 2QW9A 2OAUA 3SEIA 1IKWB 1CC7A 2KICA 5HP1B 2JGAA 4RWWA 5B8HA 1F3VA 2QYGA 1ZQTA 3M1VA 2GZOA 4DFKA 3EO3A 3CDUA 2IM1A 3OVBA 2ODGA 1VCTA 1VISA 2H5XA 2EFVA 3FBEA 3TABA 2AEJA 1KAZA 3DRPB 4CHOA 4EK2A 2CJKA 4ED4A 3G6EN 5LJWA 2NO5A 2MQQA 4X4QA 3O2IA 3UPFA 4A57A 4DR7K 4BC9A 3RYLA 4NXMJ 1CJUB 1ZBLA 2BUPA 1NGJA 5J0TA 2XM3A 1YJWS 5KFUA 3QJPA 4ZVPB 4WP3A 2P66A 1HBNA 4O3NA 3FFKB 2JFKA 3I32A 5HHHA 1HD0A 4CGFA 2W41A 3HKZD 2XSFA 4ZVUB 3A3OB 1ZPVA 4FLTA 1FI4A 4H4KA 2QWPA 1K9MO 4QIWC 4L73A 4DBQA 4K4UA 4AHCA 1OY6A 2BOPA 5LSOA 1RU2A 2VCPA 1S9GA 2RVJA 1KTVA 2IBOA 3RJEA 4USVA 2ZWHA 4HKQA 4A8WA 4FXVA 4DV4F 4JEPA 1FJEB 3GJRB 3L8BA 4IG3A 5J1EB 3BKTA 1U25A 2VQEJ 5H9FK 1J2NA 3P96A 1TUGB 1RBVA 4I2QA 2R4FA 5KPRA 4GW6A 3ZDBA 4JKGA 2B0GA 4OZJA 3KLVA 1JCGA 1H73A 3AVJA 3KHRA 2F8EX 1TL5A 4J2DA 3GU0A 4WFBL 2N82B 4K5SA 2P9KB 3HSJA 4R64A 3GDQA 1MA7A 2IDLA 2V34A 4PYDA 1D3WA 4ZKAA 3LK9A 4BE0A 5KPTA 2ZZTA 1NJZA 3OTOK 1S1VA 5AQJA 2LKZA 2GWKA 2E1FA 4DU8A 2UUCK 4OO1J 4BC3A 4BRNA 1GLDG 4XH4A 1IKVB 2KSOA 2MKSA 2D3DA 4PHPA 3MGVA 3MECA 3L7OA 4NLTA 4DKWA 4GO7X 3I0RA 2IRXA 4DCOB 2E9ZA 5CYMA 3G0ZA 1JXEA 1UJ5A 4B9UA 5D4BA 3KLHB 3AODA 2CQHA 1BNPA 3QU5A 2FHKA 4P10A 2QWOA 4BR5A 1ZQ1C 4QOTA 3HRDD 2CPIA 5AQKA 1DTQB 4WYBA 3OR1B 3HZGA 3EE8A 1PK1A 4V1Ak 5HRPA 4RPZA 1T05A 1GTEA 4DWIA 1BG3A 1NJIO 2PMZD 2EPIA 3PDNA 1WI8A 2MQMA 4C9DA 1NMNA 2RKIB 4YOYA 1QH9A 3QAUA 1A0PA 4US8A 2KKPA 4ZN1A 2IOCA 1RWOB 2IY5B 5J0YA 2XYHB 4CO0A 1T95A 4J37A 2KG1A 2HQCA 3H3NO 3D67A 3J7ZT 1LQ9A 2B9YA 3ENOA 4WE1A 3LAMA 4CZEA 5J2IA 3P5BP 4PHAA 3ASMA 1ZQQA 1R6YA 3BEXA 4KHPK 3TP2A 2MLXA 1T6DA 4B3OA 4Y2MA 4Z2XA 3MTKA 1HYVA 3A8KA 2FPLA 4W5RA 2K1RA 1BMQB 4F3TA 1OSDA 2YHYA 2RRNA 4CIGA 3PIPL 3TADC 4K8XA 2HNDA 3SEOA 4UB6U 4DV6F 1CLFA 1F1BB 4UUXA 5HN0A 1MNEA 2BANA 4C0OC 1U2CA 4WQ5A 3OJSA 2F1FA 4ECXA 1X9XA 2GIQA 3NE6A 4ELTA 4ED1A 4FFDA 4P72A 3PVXA 2FZGB 3VVTA 3HLUA 4JP8A 4C7YA 4X65J 2V8HA 2QLXA 5J2GA 2WBNA 4JI0K 4N76A 3SBGA 4YMEA 1R8BA 3MMBA 1Y64A 3I6PA 1OPIA 1KLMA 2E88A 2HNYA 4LH4A 4I64A 2E1YA 3PJWA 3EEQA 4PL8A 1XC3A 3LVWA 4DMZA 2Q0ZX 3LP3A 3UVJB 2ROEA 4KLEA 4JI2J 1JMSA 4D3GA 2KZ3A 1IH7A 1EO1A 3DAWA 3Q7BA 3CD5A 2UUBJ 1ZM9A 2FJ6A 3CJ7A 1K8AT 3QIPA 3OYNA 5HMMA 1VRUA 3FFIB 3V1QA 2UXBF 5HVGA 1TVRA 2VOOA 4K4ZA 1W97L 4USMA 4W5QA 2R42A 1WKJA 5KT4A 3NCRA 3ZX3A 3LPTA 2RKIA 1NGEA 3L9ZA 3IBFB 3NP5A 8AT1B 4OYZA 2N7YA 3QDKA 3GIMA 3HX0A 2NRVA 2LQ5A 3TR8A 4I67A 3C16B 4OYXA 3NOCA 2P9IB 4M41A 4IO9L 5KT7A 1CSJA 1HX1A 3N6LA 1YAGA 4DR2K 4BR9A 2LKYA 3SENA 1LWFB 1UJ4A 3LDSA 3SQIA 1UCNA 4JWNA 2E8AA 4H5NA 2ZUDA 2YKNB 3ENBA 1VSJA 2E1ZA 1ZQNA 2ZZNA 5L1JA 3J7ZO 5HO4A 1EHWA 3QGHA 8ICNA 1BNOA 3M30A 5BXIA 4PWDB 2W9BB 3OYAA 4HACA 3SUOA 3MUMP 4NL9C 2GGPB 4O3OA 1LFPA 3M6UA 5T7BA 1YJNN 2CZ4A 2ZNZA 4MTPA 1GTHA 1RAJA 1YZ7A 5K14A 4BR7A 1X3NA 3AQFA 3N01A 1LEOA 2V50A 2GQCA 5ALGA 2VWJA 4I6YA 4GVLA 3M4XA 3W60A 3A12A 4OZ1A 1YQHA 2BJ7A 4KPYA 1C2PA 2ETJA 4H5VA 2P1JA 1HR0F 3R6MA 4C2MA 1XMOJ 3H7IA 4JHDA 4Y2CA 5G5GA 1ZQKA 5DQGA 2Z2YB 8ICFA 1ZD5A 3ISNC 2D0CA 2NXUA 4YDUA 2UU9F 4X4OA 1V5VA 5HJXA 3UR3C 5G0RA 4O44B 1NG9A 4GC6A 4EX6A 1VSMA 2DFEA 2H3EB 1CJUA 2FGOA 5KRTA 3AJ2A 5GAEP 4C8NA 4K4IA 3OTEA 3DM2A 3SUQA 3WNFA 4J03A 1UW4A 4Y2SA 3D0GE 1M1KT 2OFGX 1ZD3A 4G9ZA 4N41A 3C28A 4KHUA 1ZH5A 1DGSA 4KX3A 4MKBA 1N61A 5ALTA 1L3SA 1U1RA 2WB1C 5L1MA 4C98A 4QIVA 1MLAA 4O0NA 3O4WA 2HRYA 3KTQA 1TFRA 4AL7A 2P9IA 2A1RA 2CPEA 5EUHA 3U3GA 4PUOB 3QLHA 1M5PC 2X6SA 3OXGA 3TADA 1C1BA 2N3LA 4J9MA 4MK9A 1FTCA 4OI2A 3LAKA 1MC8A 3IWXA 4LQ9A 4OZ3A 3FZFA 3PX6A 2IOFA 1WELA 5TKWA 2GA7A 3H5UA 4I2HA 4DPOA 3BB5A 4LZDA 2A1BA 1XERA 1A0OB 3L2WA 2R7WA 1OUQA 3NEKA 3GONA 4GRSA 1FK9A 2Y9UA 5KFCA 3CJ0A 1RLDA 3L2UA 1ASWA 2QLBB 1URNA 3TQEA 4QZ9A 2VGNA 5ETKA 9ICAA 3HVAA 3KFUF 2KV2A 3ITHA 3KK1B 3GE1A 5C15A 4A8OA 3PX0A 1EETA 4WKRA 4JKEA 1IBLF 4YDXA 3NBPB 1YTAA 1TMJA 4KH5A 1REGX 2DT9A 2O01C 3VQ4A 3O08A 2CWKA 1RT1B 1PGZA 2FVSA 4BQZA 1HI1A 4A2BA 4JKBA 4WFNQ 1ZQLA 4BRMA 1F5BA 2UZAA 3C3LA 3VEWA 5DO2A 3OW2R 2FMPA 3ZT2A 1Q46A 5D15A 4RQ3A 2JWLA 4CO1A 4CK1A 1S6OA 1PG5B 3A5LC 1SIWB 5AI5A 1TL1A 3MN5A 3P83D 1TV6B 3K7RA 5DDRC 2GNKA 1HYZA 5J2DA 3WK5A 5KFDA 2Q97A 1QM9A 2P2CB 4H0YB 1BQMA 2XIDA 1JNZB 2C3YA 3CC4S 2PMZF 5GAEU 2DNGA 3IM9A 4DR5J 4TUQA 1DRGA 3SCXA 2BCVA 3TRGA 5BR8F 5J2FA 4U67Q 4AHSA 3FJ2A 1FXLA 2DNMA 5M1QA 4LRFA 4DTOA 3DLEA 5JVGQ 4CF0A 4GXJA 3UW1A 2Y8WA 3QUCA 4ZA1A 1UA1A 2G8VA 4JI4J 1QVGR 2PFQA 2JVOA 4WFYA 4I4BA 1BQXA 2LEBA 1HMVA 3H1QA 3UN2A 3BREA 2AIRB 5CZ1A 1MDUB 3F0NA 2OD6A 2XSJB 1NK4A 1C0TA 3IAYA 1GMWA 1SC4B 4XH1A 2GEMA 2VOPA 4HTIA 2OM6A 1S1WB 4JI0F 2W11A 4X64F 9ICHA 1XNQF 3HPOA 1WDTA 1R0BG 5AQFA 1JWWA 1TL3B 2ZJ5A 1C0FA 4XTTA 3MX5A 5U47A 1BHLA 3W2VA 4B9SA 1HQEA 4AD6A 2HF3A 4CJTA 1F5AA 5D3GB 4E7IA 3FEYB 3KKSA 2UXCF 2OA8A 3KFWX 4LF9J 2RU9A 3ULEB 3H5SA 2RRAA 4FWKA 8ICQA 3QT6A 5CE3A 3K5OA 1VGYA 1YDLA 5LXYA 4JOUA 5I3UB 3CULA 1MQ3A 2GLEA 3H8YA 4HLBA 2X74A 1ITPA 4XDCA 4F5NA 2DRAA 4DV0J 1PSDA 2YXLA 2K60A 2O1PA 3MGJA 2EWSA 4Q0BA 5L9NA 2QRRA 3NL0A 1BI4A 3AO1A 5ETSA 3R3TA 3UO0A 2F44A 2E5GA 3UFCX 3KNAA 4PJ0U 2D1CA 2QL9B 1Q8BA 4CLLA 3LDNA 5KG2A 4FN5A 1VRUB 4C23A 3B6BA 1F60B 1BDGA 1AB8A 4LFAF 4JI7K 1TZ0A 4FJLA 3ULDA 3TJAA 1HWUA 4IOCQ 2AH5A 4NYPA 5FPEA 1NAQA 2QL7B 5DM6Q 4EMDA 5AQLA 4ECTA 4JI6F 1Y3KA 5ALZA 1FVSA 1HWJA 2QWRA 3H8MA 4RLEA 3FZBA 3GFHA 4IH7A 4JB8B 1ZXIA 4F4WA 3ONQA 1Q86T 3VGTA 1WHWA 5EX3A 1NB7A 1NZAA 3IA0A 1VLBA 2YNIA 4B17A 5KFJA 1CJVA 4KTWA 3VWSA 4HVJA 2CQPA 1T3QA 2VPZB 1AT1B 2V52B 3O9RA 4X5VA 2GJ2A 2BOAA 4HUFA 4OYMA 4C48A 4EAHD 1QE1B 4A62A 4BWJA 4IR1A 3QGIA 3FQKA 4WZMA 2W40A 4PPDA 3WQUA 3TTCA 2JEFA 4DX5A 3L3CA 3CDEA 4P0QB 3GTYX 4EFAC 4KBOA 4JNEA 5AQWA 1XTZA 3A1YG 4M95A 3UCZP 2LYAA 1AW0A 4DL4A 4CH7A 2BCUA 4DV3F 1NCLA 1FF2A 4YY3F 3G82B 3G2XA 2MYFA 1KHVA 5AZJA 1J5OA 3CF5Q 5J2MB 2PMZC 5HMLA 1T8EA 2HBKA 4A8SA 1BWEA 2AP1A 1TUWA 2M9NA 2VL1A 2LYVA 1HUXA 4CEDA 2HHPA 2KM8B 2GAGC 1FJ7A 1B0VA 3RB0A 1QJHA 5E84A 3VMFB 3KLGA 3FCHA 3SQ2A 3KVGA 4CEEA 2FLNA 1R3NA 3Q8SB 1TGOA 5EVZA 3FE1A 1WC1A 3F5AA 3AXKA 5GVQA 4P7VA 3W5ZA 1Y0HA 1SIZA 3M9OB 3Q8YA 3DC2A 5ETTA 4KHRA 3D2FA 2VZ9A 3AVKA 2JWNA 4FJNA 2FVQA 4AYBF 3V1RA 3AA5X 4DG1A 1FJGJ 3DMJB 1SJ4P 4HDGA 1XNSA 1JUDA 3OT9A 4D3HA 2IOFK 4NZ0A 4M5MA 2MZTA 1O13A 2E7VA 3CHWA 3KLEA 1T3OA 4DV2F 3VEOA 4BVOA 5FROA 1RHKB 3M6KA 4PG6A 4RQ2A 2OHFA 1R7IA 2X6NA 2IBKA 4DEZA 1V6HA 4AF1A 4PZNA 3MR5A 4DUZK 1I94K 4DQIA 3RJIA 9ICBA 5IV3A 2I6XA 1DLOB 4IOBA 1RQLA 1N0VC 2GS8A 4FWLA 1X0PA 1VQLS 4OZNA 4E7JA 5HROA 2B3TB 5GIOA 5KQ8A 2VFRA 3CQXA 1VK8A 2YJFA 4LF5J 1VQ6N 4J9RA 1SV0A 2Y9TA 3SBMA 2NZCA 4KV8A 4Z0UA 1YIJN 2H65B 1JJCB 3CO9A 1QHTA 1G6BA 2OANA 1TKDA 2W9CB 2WSCC 1SQGA 2HSTA 4TUPA 2GHVC 4MLHA 4E1MA 3EJMA 1KQSM 3FQLA 4I2DA 3DU6A 4RW4B 5ALDA 1FRXA 7ICUA 3DOMB 1CQMA 1VQMS 1U1PA 1S9EA 1ATRA 2QJ3A 1XIQA 4WK3A 3SIPB 4ZPTR 3ZT3A 1M1HA 4CZJA 3GIJA 1MROB 4X62J 4NPOA 4M9GA 2E5HA 3NVVA 4JI5J 2ADCA 3FSYA 1JRPA 2HAIA 2F9TA 4LFCJ 4RW7B 2HNYB 2E8PA 3IFEA 3M32A 3ZZUA 4BWMA 3KLGB 3ILLA 5ELZA 4AM6A 4JI8J 3GL1A 2KVCA 3UPQA 4LF7F 3ID8A 2MY7A 4Q7AA 4HWIA 5HRSA 1NK5A 4QYZJ 1KQFB 1ECWA 1HBUA 2YX4A 2B5JA 1ACMB 1K0VA 1BIUA 2CGJA 4YG2A 2QMUB 4DL5A 2JC1A 2WVBA 5DDPC 3ZTOA 1BOTO 1B4FA 4MH8A 4OX9J 3AFGA 1Q16B 4B3TJ 1HIWA 1MWMA 1VDVA 4DG1B 4OKJA 4F9OA 1COKA 1WNSA 2Q43A 1NU4A 2YNHA 2AZ1A 2FJEB 1N48A 1J5EK 4CLTA 4F72A 2F8KA 4FVMA 1U24A 2CQ1A 3RU0A 4CH1A 2GIFA 3VQQA 7ICMA 3M6VA 3G6ES 1TELA 4WQ5C 4KE5A 1OW5A 1X4AA 1VQ8N 4NLUA 4AP9A 1E6VB 4I2EA 4RO0A 4KHSA 3MR3A 5GAHU 4FJJA 3DDNA 1TAUA 1U0HA 1C6VA 2LU1A 2OHDA 1HKGA 3RAQA 2Z2MA 4FWSA 3P8BB 4OVLA 1OKJA 2OCEA 4TN2A 4KLFA 2KEYA 1NJWA 4DZ6A 2YNFB 2IHR1 2W9CA 1YRUA 4R63A 1RTJB 2W55A 1TYQB 4KGVB 4FLZA 1BQNA 5GAHP 4HUGA 2OEMA 2O4IA 2VQFJ 1QQ6A 2K89A 1D1UA 4XIUA 2FHOB 2KN4A 4GC7A 3HFVA 1LB2B 1GLCG 1RT3B 3ID6A 3SQGA 4P2HA 2HF4A 1UWBB 1VQLN 2R18A 2W2QP 1WOSA 2W6KA 3RFAA 3OSPA 3CFPA 3VR1A 2CWXA 3PHEA 5IT9O 2GQ2A 4FK2A 2EFOA 1XMQF 4B3MJ 2VASA 4JHDB 3KXDA 5IFMA 2X1BA 4IR9A 3SXLA 2JNJA 9ICOA 2YMPA 4LVOP 4FZZA 3MMAB 4X66K 2WVEA 1G4CA 1Y5IB 2B5JB 4ZIWA 1QQ7A 3DRRA 3R97A 5GIPA 2D9OA 3S8SA 4GV9A 2LVWA 4UBBA 4W90B 4FJKA 3MCPA 2KO1A 3ZZZA 4O23A 2FY8A 5AKZA 4Y65A 1N34F 2QO3A 4G1IA 2HZVA 1ZQHA 2KE7A 2CA9A 3PJ9A 4DV5K 1SV4A 2G8HA 2G0IA 4GKKK 2KP7A 1W2BM 3EWAA 4NL9A 4I2GA 3ZZOA 1JLBB 1W7WA 4FJHA 5KG5A 3NF9A 4DX8H 1Q18A 4GVEA 4NRTA 4DTSA 2YWKA 5BRHA 2XWYA 4X64K 3PRVA 1SV0C 2J9EA 3DDHA 4J9QA 3J8AA 4WIIA 3ZT0A 4ECSA 4H5TA 1KKHA 2W9AA 5L1KA 3CCES 1IBKJ 4AM7A 4NLKA 3AB2B 2MSTA 2P9CA 3TX8A 3RAXA 5BOLA 4J8FA 4FWQA 2C42A 3TUPA 4QZHA 4LSLA 4B9LA 4CNZA 1YJ9S 4CGHA 2KJ8A 4FWNA 3BY5A 1GK8A 2CKWA 5BN9A 2L9NA 5LMNK 2WF7A 4V19J 3MM9B 5KFZA 3E3XA 1EETB 2PEHA 2CUYA 3KG1A 4C0BA 1ZBUA 4NZ7A 5A8RA 3IN5A 4MYTA 2KZZA 4MAKA 8ICEA 3LQVA 1WC0A 4URQU 1X66A 2XMKA 2OLWA 2VB6A 4RL1A 3OL8A 4CERA 3K1RB 4MFCA 2OPSA 2CQ0A 1YT3A 1OQ3A 3QEWA 2GOLA 8ICJA 3W9HA 4USUA 2U1AA 4TQRA 5M2UA 5CYJA 3KIOA 4MF8A 4O5CA 1RBOB 4CWBA 4JK9A 4F92B 1XHXA 2BH1A 5GMEA 3TVZA 4JKGB 2JMGA 1HNZJ 3CEDA 3B82A 2KJ5A 2HIYA 5E33A 5IM0A 1LXJA 5KFOA 4UB5A 1Y10A 3W8PA 1J2MA 2GJFA 1B7YB 3ISZA 3VA0A 4NA2A 3FLCO 2P9LB 5AQYA 3CT9A 5AI6A 5J0QA 2RT3A 3UDVA 4NLRA 1FO1A 2KKHA 1A9NB 4FWOA 3QETA 1RT7B 7FDRA 2W2PP 7ICJA 2R7UA 2YHXA 4DX6A 1TUUA 3WKBA 2VU5A 2JLGA 4FDFA 1RTHA 3M05A 3CMEN 1B43A 3LVVA 4BRCA 5HLFA 3W61A 1N5XA 5HROB 3CM6A 4RX6A 4FLYA 3EPIA 2FBYA 2CGLA 2J9DE 2ZDOA 3DXKA 4CBXA 4KB1A 3CJQA 3MAHA 3ETLA 4P2XA 3IAS9 3I33A 3JSYA 3PW7A 1SH2A 1SQEA 4GKJF 3T1HJ 3AOAA 1Z26A 2DGTA 3H3OB 2VBXA 1IBLJ 3K8VA 1IVZA 3CNHA 2GX9A 2ROGA 4XPCA 2B9EA 2B56A 2HWIA 5KOXA 3DGPB 3SDEA 3FEZA 4RW8A 4USWA 3FC9A 4K4VA 1KQQA 3HM8A 4GFJA 4CEAA 1CEZA 1FE0A 3MDFA 4KN7A 5GAGU 1BUPA 3BN4A 3GFZA 1FE4A 1WSIA 3MXIA 1ZETA 3HD1A 2UUAJ 5DETA 2ZH4A 1SKRA 5EGYA 4DU1A 3K2PA 5DB8A 1TV9A 3O9SA 2ADBA 4IO9Q 2C22A 1BI4B 1U6BA 1FIQA 3ZDDA 3Q8UA 1YBUA 5AXKA 1HPMA 1DK3A 4UAVA 4CE6A 2KKVA 2P6RA 1N36K 1Q3UA 3ZFVA 3DM2B 2A10A 5A2QO 2L5YA 1U2FA 1BWFO 2NO4A 1UOCA 5KGWA 1WEZA 3SYZA 4ILJA 1IWGA 5C2DA 2E1EA 2YWGA 1RTIA 2YKQA 3MXMA 2Q36A 1RT7A 4ER8A 3S3NA 3E8OA 3ZT1A 3Q89A 5G4DA 1JI7A 3IBWA 2VGMA 1CRXA 2BM1A 5T7LB 4NXNK 1VQYA 1I39A 9ICEA 5LSRA 2IVOA 4IKFA 4OYBA 1NMEB 1N56A 4IH6A 1KVAA 3UD4P 3NH0A 1T7PA 2PN6A 2M5YA 4Y28C 3ZX2A 2LXUA 2FMQA 1FFGB 3G86A 2Y1JA 1DXSA 2ZTDA 3ZZPA 2XULA 4B8CA 4X66F 1LKYA 4QW9A 1RHJB 3AVNA 4NB4A 2JJ4D 1DKGD 1U7LA 1ZQCA 3I87A 3I56S 3ZI4A 1S6PB 4HVZA 9ICRA 5B5EU 4EO8A 5J2MA 4RW8B 2ZFHA 2I8EA 4JI3K 1Y3JA 5EE0A 4PEOA 2E1PA 1UWBA 5LMUF 1BA0A 1PKUA 3OLBA 4Q8FA 2Z57B 3EUB2 2J6SA 3KUHA 3L95X 8ICYA 1KVBA 4IFYB 3A8EA 1KC8O 1N32J 2R7YA 3SMSA 1ZTTA 3UVJA 3ADAC 1HBOB 1QD1A 1FX2A 1WF2A 3OFFA 2R8KA 2DH8A 3QWUA 3F73A 4FYWB 2AYBA 4L3QA 3FC4A 4ENOA 2RE1A 3I5CA 4L74A 1NJXA 3JQMA 2HLUA 2KJWA 1R0CB 2MTLA 2QC3A 4NMXA 1NPKA 5J2BA 3ZSRA 4E0DA 2P9PA 8ICLA 4LFBK 4P0PA 2NRXA 3MM5B 5C25B 1WF0A 4CHYA 1TL7A 2QN6B 2HBLA 2PFUA 2VJ4A 1KVKA 2GJIA 4RQ1A 4FJ8A 5KAFU 2ATCB 2RIJA 5ALJA 3K0SA 3CJ8A 1TKZA 1HFEL 2VFVA 1N2XA 2FC0A 2B0CA 4OYPA 3BO4A 2HVEA 2KTQA 4DV1J 1NGDA 3AGRA 2OGUA 1U09A 4OMFG 1XI1A 5J2NA 2HOEA 4P2MA 5C24A 8ICAA 1R8PA 3RR7A 1FD8A 2CXEA 1U47A 3GFXA 1FTRA 1CUKA 4WQ4C 4E98A 3U4LA 1D8BA