4DS5A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mg2+
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 207
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds5A01
5KTQA 4FLZA 1WAFA 3H4DA 3TI0A 4CEOA 3MDAA 4K4GA 1HJRA 1TL3A 4QCLA 4MQ3A 2ETJA 1C7YA 9ICIA 4M3ZA 3BDPA 3KLHA 3NCIA 3SCXA 4AHUA 4M2YA 4RQ4A 1IM4A 3H08A 4O4GA 2FBYA 4AHVA 1QLNA 3ZSWA 3PO4A 3NF6A 1CZBA 4UBBA 1I3AA 4UAWA 1T03A 5KG4A 2Q0ZX 2BPCA 4CK3A 2FBXA 7ICTA 1ZBFA 3UXPA 1J5OA 4Z4GA 3PY8A 4J2EA 1NK6A 3C2MA 4BXOA 3K5LA 4IDKA 1VSDA 1TGOA 3MR6A 4ZH4A 4ZTFA 2BCVA 3AVNA 4PHAA 8ICPA 4UBCA 2H5XA 2KN7A 4JV2A 3MXJA 3DM2A 4Q5VA 9ICXA 3HYFA 3KJVA 3UPQA 1UA1A 4BXOB 3B6PA 2F1IA 4DL2A 4I9QA 3TWHA 4FLTA 4M9JA 2PY5A 5J2MA 5J2KA 2W9CA 1B9DA 4QZIA 5SWMA 3EWAA 1COOA 3SNNA 1X1PA 2JEFA 4CCHA 1RTHA 3LZJA 4UB1A 4J9QA 4GXJA 1Q8IA 1F21A 2B6AA 2PI5A 5J0WA 3AO3A 1RTIA 8ICOA 7ICSA 4FJNA 1TAQA 1HYVA 4H4MA 3V72A 3GILA 2IGIA 1XO1A 4KLSA 5DQIA 5IILA 3OYNA 4F4WA 3ZT2A 3SQ4A 5CA7A 2O4IA 1ZBLA 5BOLA 4OLBA 3F9KA 1EXNA 3ZCMA 1HUZA 4I2CA 1TVAA 1Z25A 4HTUA 5KFRA 5KFJA 3RJIA 2XC9A 4P4OA 3QE9Y 2BR0A 1JLGA 1RILA 2RN2A 5KT7A 3RH5A 4M04A 1B9FA 3I0SA 1KDHA 1RT1A 1A5XA 4HCBA 3KK3A 4M3TA 1JN3A 2A1RA 3ZSXA 3HP6A 3P83D 2BHNA 5IIOA 4GXKA 3V6DA 9ICSA 1S0VA 9ICFA 3O4NA 4W5NA 1TK5A 5J0YA 1CZ9A 4RNNA 4M6WB 4ECUA 4M3RA 1KCFA 4NCGA 5KFXA 3EW9A 1S6PA 1D5AA 4DQIA 3TFRA 9ICPA 4CHPA 1ZQNA 1S1TA 4ED8A 2G8IA 2JGUA 1Z3EB 1ZJMA 1JL1A 3NF9A 4E1MA 1ZQPA 1X9WA 1JMSA 3TAFA 2BQ3A 1KFTA 1CLQA 8ICHA 3AV9A 3JPRA 4YD2A 8ICEA 4UB2A 2IA6A 4GC6A 4UB5A 1JX4A 5DQGA 4IQWA 8ICVA 1JKHA 3PMNA 4CGIA 1VSHA 3WNHA 7ICKA 3KLIA 1L3UA 1VRTA 1ZQCA 3F73A 3QEWA 3MGIA 3V81A 1WCLA 4O9MA 9ICEA 3DOLA 4YMNA 1D8YA 1QQCA 3Q8PB 1S0MA 3V7JA 4I28A 3JPQA 3TR8A 3MR3A 4M3WA 3RJFA 4JS5A 3V9UA 4DTXA 3DLRA 5DLFA 2D5RA 2JEIA 3AO2A 2QK9A 1ZQQA 4JK1A 3DRSA 3GDXA 4CJTA 4PGXA 4Z4CA 1ZQGA 1BI4B 4FS2A 1RBTA 5KFPA 4TUPA 3OS1A 1KLNA 2G8VA 1DTQA 1KTQA 1X2IA 9ICAA 4BDPA 4B08A 3KHGA 5D49A 2BPFA 2JEJA 3NH0A 4MFBA 2OPQA 2UVVA 3QIOA 3KKSA 2GUIA 9ICJA 3OS2A 4KLGA 8ICIA 3UXNA 2P5OA 1A77A 5DBAA 3AO5A 9ICTA 4C8LA 4EYHB 1ZBIA 3U3YA 4O3RA 4EP4A 4HUEA 1ZQDA 2PYJA 4NXZA 2OA8A 3OYJA 3JPPA 3S9HA 3WNGA 7ICUA 1TKDA 4M3XA 4QZDA 2G8UA 1T05A 1ZQBA 1ZQOA 1DLOA 4O3QA 3OYEA 1VSIA 4Q8EA 1NJWA 4E7HA 2P5GA 4KRFA 3UXOA 2OPPA 1IKXA 4ED6A 3SI8A 1NOZA 3E01A 2WTFA 4KFBA 1SKRA 4HUFA 1WCNA 3GIKA 4F93B 3E2EA 3AVJA 4LH4A 4C8OA 4FCYA 4KI6A 1S5JA 2EHGA 1TK0A 5F9LA 3DRRA 2YNFA 3M8SA 2AGOA 4F3TA 4QZAA 3RB3A 2X78A 4P2HA 1WSEA 3OJUA 4RUCA 3HXMA 1UWBA 4O55A 2G8FA 2Q3SA 1BPYA 3VQDA 2P6UA 5J2QA 4IFVA 3ZT3A 2F1HA 1JLQA 2MUTA 2DFEA 4I29A 5HRNA 2ASDA 4M42A 3RJEA 4DQRA 2W9AA 5KFZA 3NDKA 5J0QA 2UVRA 1LV5A 5DDYA 2R7YA 3FDSA 4ECZA 4NLZA 1CXQA 5KFBA 2MUTB 4C8KA 2VA2A 2G8WA 1ZETA 4FJKA 1WLJA 3LANA 4CFAA 4TQSA 1UT8A 4YD1A 2XRIA 4J9KA 3QERA 3M9MB 2XY7A 2IBKA 3GIMA 3QESA 1MQ3A 5J2FA 1LW2A 1C1AA 1MC8A 3K59A 4CHNA 4W5TA 2YNIA 4LY7A 5JS1A 4FJJA 4F5QA 3L2VA 8ICZA 1IH7A 3MEEA 2IAJA 1NOMA 1HQEA 4ED2A 4HVJA 3C1ZA 4O0IA 3K75D 7ICRA 3LAMA 2PYLA 2J6SA 3TAMA 1RDBA 4OPJA 2ZJAA 9ICCA 3C23A 5KFWA 4J9RA 1VK0A 3NH2A 4QZFA 1WSHA 1HPZA 4Z6EA 3Q8KA 4Z6CA 5J29A 1J53A 1TV9A 2P66A 4CK2A 3NF7A 3MAQA 4NCAA 9ICRA 7ICMA 4RW4A 1LWCA 3K4GA 3HSTB 1U45A 3H7IA 4DOBA 2HNDA 3RBEA 1Z00A 4CFCA 2BCRA 1FKPA 2FMSA 3G10A 4ED1A 2RKIA 3RH4A 4RG8A 4RW8A 1SL2A 1V9PA 9ICUA 3HPOA 5KG0A 1RBRA 4CJEA 5DDMA 2HHUA 4YR2A 4O0JA 4KLOA 4IR9A 4K4HA 4DMNA 4Z4EA 4MFCA 4H4OA 4ECVA 4J9MA 3Q8RB 3G6XA 3QNOA 4FXDA 4CJ4A 2R8GA 4G3IA 4QOZB 4IG3A 4KMUA 5J0RA 3OHAA 2KZMA 4HUGA 1RXVA 3GIJA 4LH5A 4IRDA 1RNHA 4DO9A 3SYZA 4LVSA 4HYKA 4QZGA 5J2CA 1KFSA 5JS2A 2KFZA 2Z1IA 4GXIA 4JS4A 2P51A 4RW6A 4Q45A 4E0DA 2BCSA 3CFOA 3OYHA 1SL1A 4YFKA 4FJ9A 4CJQA 3K5OA 4QWBA 3LAKA 4E7JA 1TKTA 4EYIB 4KITB 3VN5A 4GVMA 4BGDA 4KPYA 5CR0A 1RT6A 3NGDA 3AVHA 4R64A 4FLUA 1QSSA 8ICGA 4DF8A 1BPXA 4CEFA 2FPKA 1BIUA 3JPTA 4PA1A 3SUOA 4IQUA 4O3SA 1BPEA 3IS9A 3HVRA 1FKOA 1BPZA 4Y1DA 4FJGA 5BOMA 2GBZA 4ECYA 3KHHA 4DL6A 4RT2A 2RPIA 4O5KA 4YFUA 2JZBB 1ZQIA 4FLXA 4UB3A 3VQ5A 4R8UA 4EZ6A 3NFAA 3HVTA 4GC7A 1Q9XA 4MEYA 5J2DA 7ICQA 4N5SA 3RAQA 1HMVA 3QZ8A 1EX4A 5CWRA 4FW1A 1IKWA 1JIHA 3OYBA 3C21A 3B0XA 4XQ8A 5L9XA 4C8MA 4YP3A 1EXQA 2ASLA 1S1UA 4J9LA 3RMDA 2PFQA 8ICKA 1ZYQA 1JLEA 5D3GA 3JPOA 1Y88A 5KG6A 4I2AA 2KZZA 3AA4A 3DLGA 3G0ZA 3L2RA 4CJSA 4XIUA 4LSNA 3K58A 3RTVA 1A5VA 4ECRA 2HVHA 4YMMA 4CJ5A 2FPMA 4FJIA 4IR1A 8ICUA 4PGQA 2DFLA 3HT3A 1N56A 3QLHA 5DMRA 5J0OA 4KLUA 3D45A 4AH9A 3SJJA 4NCBA 4CFBA 3RR7A 2W8LA 3L2UA 1TFRA 4Z6DA 4NYNA 3B0YA 2NRTA 2NUBA 2ASJA 2VG6A 4RQ5A 3QO9A 4B8AB 5EWEA 4NM2A 3QIPA 1NJXA 1ZQKA 3PVXA 4Z4IA 1KFDA 1WSJA 3ZSZA 3QEIA 4KLLA 4E3SA 3RMCA 4CF2A 3UQ0A 4KREA 4PH5A 2E4LA 4CEEA 4Z6FA 5IIKA 4EBEA 2P1JA 4L8RB 3L3VA 5KFMA 1NKCA 4CHZA 4JLHA 2A1SA 4CJ3A 1ZQRA 3UIQA 3ISDA 3ZD9A 4DL4A 3VQCA 4PY5A 5KFGA 1RDDA 1REVA 2PFPA 4MFAA 4KHQA 3NGZA 3N97B 4DTPA 4RNOA 3V6KA 4ELVA 1ZBHA 4IQVA 4M9GA 4RQ0A 4O3PA 1ZQHA 1IKVA 4IRCA 2A1JA 3V9ZA 3KHRA 1ZQWA 5J2JA 2R8JA 1RBSA 1YTUA 4P4PA 1UOCA 1S9GA 3GV5B 5HHHA 1ZQEA 4EBCA 4ED0A 3LP1A 1LAWA 4KLHA 3OJSA 3OYDA 3ZDCA 2W9CB 4OJRA 2V4QA 2Y1IA 3RJGA 1A5WA 3ZT0A 2BKEA 3BQ1A 8ICRA 1ZQYA 4FJ7A 9ICBA 1VSJA 1RZTA 4YNQA 4TQRA 1S0NA 4J2BA 4CFDA 3AO1A 4CECA 1W9HA 4E1NA 2ZTEA 2YV0X 2OPRA 4J9NA 3PX6A 2OYQA 4Z4HA 4W5QA 1TAUA 2FBTA 2OZMA 2VA8A 4B8CA 5HNKA 1XSNA 4BDYA 4IKFA 1NJZA 1G15A 3T5HA 2OPSA 1WNSA 3ORYA 3ISBA 1KVAA 3IHQB 1C6VA 2DPJA 1TK8A 4OKJA 2AQ0A 4KB0A 7ICNA 3PX4A 3WNEA 2C22A 1S1XA 3O4QA 3N4MB 2VWJA 3PW7A 3EY1A 4CEBA 4DQQA 4FLWA 4YCXA 5HRRA 3C1YA 4DSIA 5DBCA 4FZZA 2YNGA 1SKWA 4UQGA 5FRNA 4RPYA 1SL0A 1ZJNA 2YKNA 3DLEA 3A2FA 3KIOA 3PNCA 2IS3A 3QZ7A 2QKKA 5DBBA 8ICYA 3HK2A 3V7LA 1S9EA 3SV4A 4CJUA 8ICCA 4F4XA 3CYMA 3DRPA 2B4JA 4O3NA 2VWKA 4CGHA 3VQ8A 5KRTA 5KFCA 3OSNA 1JLBA 1RT5A 2NRWA 1CXUA 4PWDA 1YTAA 2XY8A 4YXMA 4FBTA 2Z1JA 1QHTA 3OYCA 3CQ8A 3DLBA 5DLGA 2ZQBA 3RB0A 9ICWA 4FVMA 5KFAA 4M9LA 8ICJA 2AGPA 3OYFA 2IMWP 3LK9A 4I2GA 3P5JA 1LW0A 4YN4A 4EEYA 3HP9A 2GV9A 4B3OA 7ICLA 2GWSA 1CUKA 2AGQA 4RQ6A 3L2QA 2W9BA 1RCHA 1GOAA 4I27A 1J54A 4TURA 2ZE2A 2BGGA 2KQ2A 3VQPA 3HW8A 3EZ5A 4PGYA 3OS0A 1ZQVA 4E19A 3PO5A 4KLQA 4XA5A 4FW2A 4NLNA 5J0PA 5EWFA 1W0HA 1XHXA 5L1IA 1ZQFA 4R65A 3MDCA 2XO7A 4DSKA 3ZDAA 2ISPA 4FM0A 4B9UA 4PHEA 5J2AA 5CYQA 4CJWA 4DFMA 1KVCA 2IOCA 3SUPA 1ZBUA 3PW0A 1PZNA 4E7IA 4DL7A 4IG0A 4E7KA 4OGCA 4GMJB 2G8HA 5KT5A 1LB2B 4RQ3A 4FYDA 3DLHA 1U9LA 3V1OA 5DB9A 4NM1A 3BQ2A 3ZSOA 4KI4A 4RQ2A 4Q0BA 2BDPA 4JV1A 3PV8A 3ALYA 4KTQA 5HMLA 1UA0A 2NRXA 4ECSA 3OYLA 3TAGA 4NLKA 3IM1A 4ECTA 1S1VA 2X6SA 1KEJA 4AILC 2NRZA 3K5NA 2Y1JA 2ITGA 4ELTA 5HMMA 1ZQZA 3HJFA 1QE1A 4I2BA 4QAGA 2C2RA 3KLGA 8ICTA 2XGQA 1NJYA 4F4YA 4M45A 2NRVA 1T8EA 3MBYA 5EU7A 1HUOA 1RT4A 3V9XA 4YXJA 1XS9D 4FJ5A 2FMQA 4KLDA 2VG5A 3FFIA 2C2DA 1BCOA 5CY4A 4JWNA 3SUNA 2FLPA 3KD5E 5KG2A 1T4GA 4OGEA 3KK2A 5J0XA 3M9OB 1BGXT 5L1KA 1ASWA 5HRPA 4CERA 4MF2A 3LP2A 3VA3A 4O5BA 1B43A 3GQCA 3LP3A 1FK9A 3PW5A 4QZ8A 1S10A 5CZ1A 3SPYA 2IHMA 4FZXC 3NTUA 4DTSA 4FJMA 1K6YA 4B9MA 4ICLA 3SQ2A 3OHBA 4KAZA 1L3SA 3MECA 3PR4A 2BCQA 1C0MA 1XC9A 1IG9A 5IIIA 4UAZA 4I2PA 2VG7A 3G6YA 5DK5A 4CIFA 5F9NA 4DSJA 1S76D 4JV0A 1RTJA 3NHGA 1B22A 2HHWA 1VRUA 3CFRA 2J6TA 1LWFA 2YKMA 4YR3A 3IRXA 5KFVA 2YHBA 9ICQA 1BL3A 3SI6A 4OVLA 1K1SA 3K2PA 3S3NA 2FMPA 3LPTA 5KFTA 4RT3A 2HNYA 5KFYA 3OYAA 3HPHA 3SV3A 5C25A 8ICFA 1NK9A 4M9HA 4Q43A 3AVAA 2ZUBA 5KT4A 4DEZA 4CGFA 5CHGA 3C95A 4LD0A 2YHAA 2QKBA 1U49A 4RPXA 3MGHA 1UAXA 2IDOA 4DF4A 4DOCA 4M47A 2J6UA 1Y97A 3GV8B 4BE1A 1VSFA 3Q8QB 2X6NA 3SUQA 1WSIA 3HX0A 1BPDA 2JLEA 4ED7A 3V4IA 2D0BA 1Z00B 1HNIA 4CJLA 2XY5A 1C0TA 3VQ4A 5J2BA 4KLJA 4RQ8A 3EYZA 4M41A 5DGAA 3IAYA 5KG5A 4N76A 3RJKA 4QWDA 1LWEA 3V1QA 1UT5A 4QW9A 5IINA 5I42A 2RDIA 1ZQUA 7ICGA 3OSPA 4B9VA 4FLVA 3GV7B 5J2GA 4FBUA 1RYRA 4RU9A 1NKBA 5KG7A 1XSLA 1CEZA 1VSEA 1ITGA 5K14A 4CGDA 3AU6A 1LAVA 1RDAA 5KFLA 3ITHA 3DLKA 4B9NA 2WONA 5FDLA 3HO1A 4ELUA 3O3HA 4YR0A 4QWCA 4F5PA 7ICHA 2I5JA 2D0CA 4P4MA 3KLFA 3EPGA 4TUQA 4CHQA 1JL2A 1QSLA 3QEAZ 4KHWA 3BGRA 3RMBA 4MFFA 4WE1A 4QZEA 4DTOA 2V9WA 4TUSA 4QWEA 4DSLA 1RBVA 2ZJ5A 1ZQLA 4PPXA 5KFIA 2W8KA 3QNNA 4HCCA 3D0PA 4DU4A 1RXWA 2E6LA 3VQQA 1JLCA 1I39A 7ICOA 1ASUA 4JWMA 4AHRA 9ICVA 9ICKA 2PFOA 4LSLA 3QETA 1S1WA 3AA2A 2M9NA 2F8TA 4PHDA 4R8UB 4CF8A 4FZYA 3H40A 1XWLA 3UQ2A 4DG1A 3ZSYA 2ZD1A 8ICXA 1FXXA 4GW6A 1DTTA 4E89A 4DTUA 4J9SA 4BWJA 1KSPA 1L3VA 2LSNA 3T19A 3KTQA 3L2WA 3RRGA 7ICJA 4NLGA 8ICLA 3AU2A 3T1AA 5KFEA 2VA3A 4B9SA 3AVBA 3SPZA 3I8DA 3RB6A 4KTWA 1NKEA 2KTQA 5DKWA 3SZ2A 2DFFA 4FJHA 5KGWA 1BISA 2Z1GA 2R8HA 1XHZA 3QEVA 2MAXA 8ICAA 1IO2A 2X74A 4BDZA 3MXMA 4KLEA 3ZSRA 4DL5A 2BPGA 4AHTA 3PMLA 4N41A 3OY9A 3PX0A 8ICWA 3LPUA 1WAJA 5KG1A 5IIMA 2F96A 2FLLA 4NYFA 1DGSA 3L3UA 1IKYA 2KW4A 5DB7A 2ALZA 3C5FA 3QEPA 1VSLA 4M9NA 2C2EA 4F2RA 4F5OA 1N48A 2EX3A 3G6VA 4FJLA 3GFKB 3Q8SB 4G1QA 4JRQA 2IC3A 2ZUCA 5KG3A 4CEDA 3OYMA 3SQ1A 2FC0A 3WNFA 4E7LA 4X5VA 4OKEA 3T3FA 3V7KA 1U48A 4I7FA 1NOYA 3MFHA 3HPGA 4CJRA 4CF9A 1MU2A 1NK4A 1B92A 4M3YA 1KVBA 3RR8A 2A1JB 1BPBA 1ZQXA 3CG7A 4Q44A 5DG9A 1BQNA 2ZJ8A 2B5JA 4FO6A 5KFNA 3AVIA 3L8BA 3ZD8A 4F8RA 2XY6A 2AU0A 4OPKA 4I2QA 4IBNA 4RW9A 3RAXA 1RT3A 1J9AA 3AO4A 2BCUA 1YT3A 4CF1A 1QS4A 4J2DA 5KFHA 5C42A 1ZQSA 4CHOA 4DS5A 4I2HA 1S97A 4KN4A 1RDCA 1EETA 3ZT1A 4RW7A 1BVSA 1HYSA 3LZIA 3U6FA 1VSKA 4HHTA 3T5JA 2W9MA 2PXIA 4QZHA 2YNHA 4B9TA 1K1QA 1WN7A 4B9LA 5KFOA 2OZSA 1NK5A 1IXRA 4CESA 4I2DA 1NK8A 3PR5B 4KHSA 4RPZA 4N47A 3ZDBA 4ED3A 4LZDA 3ZDDA 1Z26A 4RQ1A 3B6OA 4YQWA 4CK1A 4TSXA 2AQ4A 5CYMA 3MEDA 3Q8MA 5HLFA 4M6WA 4M3UA 4R66A 3MEGA 2BANA 2HHSA 2HNZA 4F2SA 1S6QA 4DU3A 3BQTA 4GLXA 4CIGA 2R8KA 3AA5X 5IIJA 4DS4A 1TKXA 4F91B 1D8LA 5J2HA 4J9OA 2BE2A 5HROA 2XCAA 2ZTCA 5J2IA 4F4KA 5KT3A 4CF0A 4O5CA 3TABA 4Z4FA 2ZTDA 3T5LA 4O5EA 4QW8A 4JRPA 4I2FA 2PI4A 4KTZA 1HQUA 3SQ0A 5KI6A 1N5YA 3V6HA 3TAPA 1TL1A 4CEZA 5J2PA 1RBUA 4RUAA 2IHNA 3GIIA 1C1BA 3TARA 4K8ZA 2FBVA 3AVKA 2F8SA 4DWIA 4KO0A 5BPCA 1GOCA 3NBPA 4CHYA 9ICHA 5E41A 3CM5A 3M8PA 4O3OA 1KRPA 2BGWA 1JLFA 2DFHA 1EKEA 3M8RA 4F5NA 1QSYA 5CP2A 4XRHA 2XGPA 4DQSA 2W9BB 4DU1A 3C94A 4F4ZA 3U3GA 1C0UA 9ICGA 1L5UA 2XHBA 1BI4A 5CJ7A 4QWAA 2O4GA 2HW3A 5KFQA 4ZTJA 1XI1A 2ATLA 4I2JA 1MQ2A 2HVIA 4LZGA 1BHLA 5HRSA 8ICQA 4I2IA 2DY4A 5J2NA 1SUQA 3VQBA 1WSGA 4PQUA 4N56A 1C1CA 5I3UA 2R8IA 5CZ2A 3KD1E 2DPIA 1WSFA 4CJKA 3LP0A 1BCMA 2KFNA 4J9PA 1T3NA 5HBMA 5J2EA 1RPLA 4CEAA 3VQ7A 5KT2A 2VANA 5EWGA 4ZHRA 3QEXA 3NH1A 3H4BA 1NK7A 3BQ0A 1L3TA 2OWOA 4CE9A 3AA3A 1VSMA 5KRSA 3TAQA 3EPIA 1MSWD 9ICOA 4F3OA 4H8KA 4YVZA 4KLTA 5J1EA 4FK4A 4RNMA 4DFJA 5TZVA 5KFKA 4DSEA 1JXLA 1H38A 3AVGA 5J0UA 2HHTA 3LWMA 4NY8A 3O3FA 3TAEA 4AHSA 4R5PA 3OYGA 4K8XA 2Z1HA 2BQRA 2XCPA 7ICPA 3NF8A 3VA0A 8ICSA 4IFYA 4XUSA 3T5KA 2HHQA 4IQTA 5KGXA 4KHYA 4KB1A 4YMOA 5HP4A 3TANA 4Q8FA 3C6UA 3K5MA 4KHNA 3H8WA 9ICMA 2B21A 3QEBZ 5DG8A 1HYZA 2ATQA 4MEXA 4DTJA 4I2EA 4DFPA 4MF8A 3V9SA 3RMAA 4KLMA 2ISOA 7ICIA 1SZPA 3MR5A 1XU4A 1ZQJA 5HHIA 3OYIA 5KT6A 3AUOA 1JLAA 4KHUA 1X9SA 4OLAA 2P6RA 1YVUA 1BIZA 2UVWA 4PUOA 4AHCA 3AVMA 3NAEA 3HM9A 5DB8A 5KFSA 3KLEA 3VQ6A 4F92B 3PUFA 2HMIA 2FPLA 4KKOA 1HNVA 3OGUA 8ICNA 3KHLA 4R63A 3THVA 3M9NB 3JPNA 1RT7A 8ICBA 3MABA 4CJFA 1RYSA 4EZ9A 3ULDA 3P1GA 4QZ9A 2F1JA 3TQ1A 3PW2A 1ZQAA 4FM2A 2I1QA 4DLGA 1QTMA 4BE0A 2ZUDA 2RF2A 1GOBA 4F5RA 3AVLA 4PHPA 3S3MA 3HWTA 1D9FA 5JUMA 4F50A 4KLIA 1U47A 1HRHA 1JXBA 4FK0A 4DSFA 3PW4A 2HHXA 4M0AA 4EP5A 5KFDA 4CGGA 4C8NA 4O44A 4FJ8A 5FRMA 1O1WA 3DYAA 3I0RA 3VQ9A 3MXIA 1R0AA 2QXFA 1A76A 1XSPA 4W5RA 3LALA 2I9GA 3VQEA 2V4RA 3C5GA 3IG1A 1NK0A 4DTMA 3ZSVA 3V6JA 2AJQA 2C28A 3NE6A 1X9MA 3JPSA 2HB5A 1U4BA 5J0TA 9ICNA 3DMJA 1TKZA 3NGYA 2D0AA 8ICMA 3AVCA 3ZSQA 1TV6A 2UVUA 4DTRA 5CB1A 3Q8LA 4I9LA 3V1RA 3OYKA 4BE2A 3RWUA 1TVRA 1ASVA 4J2AA 3QINA 2DTUA 4OKKA 4DFKA 4CEQA 2WOMA 3ISCA 4FLYA 2RDJA 1DOQA 2FLNA 5C5JA 3HL8A 1U04A 4KN7A 3C2KA 9ICLA 3TFSA 3JYTA 1T7PA 1N6QA 4DOAA 4CIEA 3NGIA 4DQPA 3ZT4A 4DLEA 1SKSA 4CGJA 3RJHA 4CJVA 5D46A 3KKRA 7ICEA 2KZ3A 3LDSA 2PZSA 1ZQMA 5DB6A 4RZRA 3C2LA 4FK2A 2E6MA 4Y1CA 4FM1A 4ECWA 4UAYA 5T7BA 3H8JA 3JSMA 4KLFA 5C24A 3MFIA 1AROP 1HJPA 3ETLA 4FS1A 4K4IA 1JXEA 3H8SA 1ZQTA 3DI6A 3ISNC 5J0SA 3S3OA 1RTDA 4Z0UA 2W42A 3CFPA 4ECXA 7ICVA 2JZBA 5DG7A 4W5OA 3RB4A 1Q9YA 4ECQA 3ASMA 3OVNA 3FYHA 5DQHA 3RH6A 4CJPA 5EOZA 4JUZA 3RBDA 3VQAA 4DL3A 3LWLA 4YG2A 4ID5A 5FROA 5L1LA 3C6TA 4BACA 1EP4A 5HP1A 1D9DA 3V9WA 3MR2A 5D4BA 1S9FA 3K57A 4EBDA 1RT2A 5KFFA 5L1JA 7ICFA 3AVFA 3LDAA 4FJXA 3BJYA 2HHVA 1KLMA 3KK1A 3DOKA 5SZTA 4ID1A 2JEGA 3CM6A 5DGBA 1S0OA 2PFNA 3M8QA 1SV5A 3RRHA 1BQMA 4QZCA 2G8KA 3RJJA 1S77D 4UB4A 4BWMA 3O3GA 4RQ7A 2LYHA 3ZDEA 4DTNA 4QZBA 4IRKA 2BQUA 5KFUA 4KV8A
chains in the Genus database with same CATH superfamily
5KTQA 5AQSA 4KQZA 4L73A 4CEOA 3J7YU 3VAIA 4EELA 3G8SA 1HJRA 5GINA 3CJCA 4MQ3A 3BSAA 4BC3A 1FESA 3ENVA 4M3ZA 1U6ZA 5FD1A 3BDPA 2BBEA 1KEKA 1HPMA 4BR0A 1PVQA 1D0EA 4EFAC 5B7WA 3C28A 4M2YA 1NMEB 4H0VB 1GLAG 4M5MA 4AHVA 3MX5A 2V4JA 3W9IA 4WFNQ 1Q16B 2QYCA 1CZBA 4UBBA 3GU0A 2E9TA 1I6JA 3OTCA 1CJTA 4X64F 1J5OA 1S7IA 2CXYA 2WSFC 1QAIA 2MZSA 4MO4A 3C2MA 3RW7A 3DRXA 2OD4A 1VSDA 4ZH4A 4ZTFA 3J81U 1Y00A 1RAOA 8ICPA 4UBCA 2MKKA 1XNRF 4JV2A 2AJ0A 3IP0A 2GNKA 3DM2A 3HYFA 3PFOA 4H4KA 4USWA 2CPXA 4EI2A 4DL2A 3EN9A 1B0VA 3MDFA 2PY5A 2JWLA 4QR2A 4FP9A 5J2MA 2W9CA 3CJ7A 3DLJA 2YX6A 3W9HA 4QZIA 3JSBA 1K8AO 1COOA 4PZVA 1KP6A 2JHDA 4OO1J 2XI9A 1H7WA 2PT0A 2JEFA 2NNWA 4CCHA 1RTHA 4Y3CA 1GFWB 2O01C 3FE1A 4DV0J 4J9QA 4OJ3A 3DAWA 1Q8IA 1TL7B 2B6AA 1HKBA 4USKA 2K7JA 1RTIA 5HQ8A 7ICSA 2XLKA 4Y0WA 3M32B 1BQNB 2WB1F 1UW4A 3F44A 3KUEA 4N77A 1FIQA 1FVQA 2MY8A 4F4WA 2O4IA 4I2QB 2RQMA 3N7PD 4RWXA 1HUZA 4I2CA 2MZQA 4HTUA 4I69A 4U67L 5KFRA 1D09B 2PFDA 2YBVA 3FK4A 4X4VA 4A48A 1EETB 5HR6A 2BR0A 4P6QA 4RW7B 1JXVA 5HJXA 3MD3A 4QZVB 1JN3A 3KNGA 4DUYJ 1FCAA 3IKMA 2YWEA 2BHNA 4DV5J 5M1NA 3K9KA 4PL1A 5J0YA 4FWKA 1V4SA 3ZTOA 1VQMN 2D3DA 2XZDB 1RLDA 2AEMA 3MEGB 4NCGA 3U9DA 4NLCA 2MSTA 2HNZB 1D5AA 1RLCL 3EEQA 4MH8A 3I76A 2RHSB 4PABA 3TFRA 4C3KA 3O5BA 2MQOA 4H0PA 1VS3A 3BEXA 2BJDA 2Q0RA 1S1TA 4ED8A 3FCHA 2ZIUA 2LA6A 2G8IA 2RU9A 4ZVRB 3NF9A 2K7KA 1M6YA 3R8YA 4U7UK 1BU6O 3DFEA 4JHDB 3OR2A 2KRBA 1YVNA 3VESA 4KY3A 5HANA 5DM6Q 3BBBA 2IA6A 4PKIA 1JX4A 3BKFA 2KI2A 1JKHA 3PMNA 2CPEA 5BN9A 1GXUA 2RDDA 2GQQA 2XMMA 3QEWA 3AA9A 1WCLA 4O9MA 2AZ3A 4RBTA 1YJ9S 1QQCA 4KBOA 3NMRA 3UCZP 4F3QA 3JPQA 3TR8A 4TU7A 5EOYA 2P9CA 3HSGA 2DNYA 4PPDA 1A0OB 4DR1F 2QK9A 1TU0B 2LP4A 4JK1A 1UJ4A 3OR1B 1YI2N 3PSFA 1RBTA 1KXPA 4Y2VA 1KVKA 1FJEB 3G6EN 2E5IA 1OO0B 4B08A 4F02A 5D49A 3TA1A 2YHWA 4MFBA 5C0YA 3NRZA 4FZNA 3AB2B 2WAQC 2M0NA 3BYRA 3D6HB 1NPKA 2GUIA 1YBUA 1Q7YT 1Y3KA 2Q66A 1UVJA 1HWUA 3AO5A 4C8LA 5ALVA 4GRSA 2CDQA 5HBMB 1GMWD 4LJMA 2PYJA 3JPPA 2CQGA 3WNGA 2UUBF 3FVYA 4QBUA 1ZQBA 3AA8A 4UUWA 3H45C 1DKGD 2E7XA 2Q31A 4O3QA 1S22A 3OYEA 2AW0A 4Q8EA 1RHRB 1YRUA 4K8RA 5AQOA 1D9AA 2DKOB 3EWGA 5J1EB 2P5GA 2OPPA 1UVNA 2DXFA 1JJ4A 2VJ4A 3SI8A 2CJQA 1SKRA 4HUFA 4KE5A 3A12A 4M5DA 4DR3F 2B4OA 5DO2A 4LH4A 5AK4A 4JI3F 2M8HA 2E29A 4FF4A 1WC5A 1NM2A 5F8LA 1VQOS 3DRRA 1Z2LA 3M8SA 2AGOA 2OCEA 1WSEA 2ZZTA 3HZ6A 2Q3SA 2WBNA 2QW9A 3MC1A 1BPYA 4ZP8A 3WQPA 1VQLS 4CD3A 4YS2A 4Y2AA 3EMTA 3ILOA 2NSCA 4ED5A 2QT7A 4IFVA 3A8KA 4I29A 2HGLA 4M42A 4OJPA 1RWWB 4DN0A 5K8PA 1T6DA 1SJFA 3W7BA 1F5BA 1KDNA 3FDSA 3Q89A 4ECZA 4QYZK 1CXQA 4YDDB 4F0MA 2MUTB 3I96A 2Q0UA 4FJKA 2CJXB 3LANA 1WLJA 2OIHA 1RWUA 2PFFB 2K4IA 1EKSA 3DCAA 3TU5A 4CFAA 1UT8A 2XRIA 1MN9A 2ZH6A 2WVCA 4BGAA 5CHCB 1RTZA 2WF7A 1KN6A 1PJ6A 1HR0K 3M9MB 3GIMA 2MTLA 1W97L 1HHTP 4UT4A 5J2FA 1LW2A 4FYXB 4MLEA 3TTDA 4C8YA 4P0PB 1U1KA 2LYAA 3QU9A 4USIA 4LY7A 4F5QA 3L2VA 2HBRB 2IAJA 1NGBA 3TVYA 3POTB 2HKEA 3K75D 4Y2YA 7ICRA 3LAMA 2E3TA 3KMQA 1U2VB 3PHTA 4CZEA 2RF2B 2FYXA 1GO3F 3AD9C 3WXJA 5AKEA 3PNIA 2M5YA 1WSHA 1HPZA 1TFYA 4LF5J 4M1KA 4K4YA 4BCAA 4EEKA 1J53A 2BKOA 4CK2A 2GX9A 2R3VA 2A3JA 9ICRA 3UKUB 5E3QA 4DCPB 2WVEA 3SQGA 3ILJA 3QXGA 2JRSA 4YHHF 4O44B 3RBEA 2XWYA 3BF4A 4YDUA 2YH0A 3J81Y 2FMSA 4ED1A 5A8KA 3BEGB 2RKIA 3RH4A 3I0RB 4F71A 5K20B 1SL2A 2MMYA 3OL9A 4USMA 1RBRA 2P6SA 4YR2A 4O0JA 4KLOA 4K4HA 3ZC4A 4MFCA 4H4OA 5AQHA 1AFJA 1F5AA 1U1MA 4L3QA 4DZDA 3TR5A 4NLXA 2HS3A 3G6XA 3QNOA 1NGDA 3OV7A 1XNQK 1XO0A 4CJ4A 2R8GA 1X3NA 5EXWA 4AYBF 3VZHA 5L38A 4DV2K 4LF6J 1UAWA 4BRMA 4WYWA 2IBOA 3TUIC 4LH5A 2V6AA 4CI0B 4DO9A 3QYPA 3D0HE 5CYJA 5T14A 1DGKN 4QZGA 2HOQA 3OXFA 4IG3B 2HK2A 1XQSC 2IY5B 1IJJA 2P51A 3FNNA 1OPZA 4YFKA 1N6QB 3FKBA 4RO0A 4E7JA 1TKTA 5AQKA 2E44A 4X4TA 4GVMA 5BR8J 1RT6A 2A1BA 3AVHA 4OL8A 8ICGA 1SBRA 2EFOA 1BPXA 3DWLA 4DR6K 4PA1A 1PYOB 1S4EA 2OMLA 1TMJA 1OYDA 5BOMA 2GZOA 2GBZA 3DXSX 2ZBCA 2RPIA 4F9OA 2Q43A 1RTDB 1VQKN 5KNIA 3O08A 4UB3A 1WSRA 1QH9A 2BJ8A 3B78A 4MEYA 5J2DA 7ICQA 1AB8A 1ILYA 4ID5B 2QGFB 4NE9C 1IKWA 3K89A 5D4NA 1WF1A 4WTOB 3B0XA 4XQ8A 2VQEF 5AM1A 4YP3A 4B3SK 3NVMA 3OXGA 4WTYA 4X4RA 5FLXO 5D3GA 2RRAA 3JPOA 4I2AA 2FJ6A 3AA4A 4CJSA 1XK8A 4NI2B 4ILMA 1FJ7A 4K2XA 2VFUA 4CJ5A 4OX9J 3LGMA 2NS1B 2W4PA 4IR1A 2DFLA 2UV8A 1N56A 3QLHA 1XIQA 2OSQA 3UKRA 1BC6A 3KJNB 3RR7A 2NRHA 2DO0A 3BY5A 3BV8A 2CG8A 3AAQA 4NYNA 2GQCA 3CI5A 4UOHA 1HNXK 3CJTA 2IVMA 2NUBA 3QO9A 4B8AB 2Y0BB 4WPAA 4NM2A 3SCKE 4OYOA 3KLHB 2BZFA 3BO2A 4Z4IA 4OYMA 3CJ9A 3P8BB 3MN5A 3UQ0A 1TFWA 3ET6B 4PH5A 3CVKA 2ZOFA 2P1JA 2DH7A 3L3VA 3G82B 1J2MA 4BLGA 3H42A 1WTFA 5FPDA 4IYQA 1N63A 4P7TA 3LVVA 2UUAK 2NXJA 2OD6A 5KFGA 4IQXA 4LIRA 4M5LA 1REVA 2K4EA 4MFAA 3JTPA 3THWA 1ZBHA 2ZOMA 1YKWA 4ZLNA 1P9YA 4W98A 4IRCA 3FEYB 3UDVA 1SS6A 1RBSA 2ZKTA 4K0KJ 3VF2A 3MK6A 3QUTA 1ZQEA 4MHVA 2KHOA 4EBCA 3L7UA 1L7MA 3IR6B 1KKHA 2CDRB 5KL8B 3WKAA 3UE5A 2R7QA 4MDBA 3OVSA 1LOTB 3Q8YA 3BQ1A 4JD2B 1HBUA 3AHPA 1KD1O 2YPYA 4LF8F 3Q24A 1VSJA 3O6WA 2E1EA 3CCWA 4TQRA 5AKJA 2OANA 2GGPB 2F3NA 4J2BA 4HHUA 4CFDA 4IL6U 2YWKA 1L7NA 1RYUA 1IR0A 3D1QA 3UD3P 1G6BA 1YDLA 1YJNS 3IP4B 2R2TA 2XZTB 3ID6A 1FRHA 4W5QA 5K5MA 3OTOJ 2FBTA 3SFGA 4B8CA 3ISZA 5HNKA 2EKNA 1NJZA 5AQRA 2HHHJ 3ISBA 3C14A 2JH7A 1TK8A 1JNZB 2AQ0A 2RRDA 3NVVA 2AP1A 3ZZYA 3FCVA 2C22A 5M1OA 2VWJA 2PMZF 1J5EF 4BVPA 4PZOA 3EY1A 1WG4A 4DQQA 1YZ7A 2A5XA 3V4MA 2Z2MA 4JI6F 5KPZA 1LVHA 3P4UB 2L41A 3A4TA 3D3CJ 2DWQA 3MI7X 4FOEA 1RISA 5KL1B 1Y11A 3A2FA 4U9RA 2FUG9 3PNCA 3Q2TC 4I56A 3I4PA 1JQGA 3QJLA 2U1AA 5A0YA 2DNRA 2KXNB 3HK2A 3GL1A 4CJUA 1K5OA 8ICCA 2B4JA 2VWKA 2DGXA 5KFCA 1SQEA 1JLBA 2NRWA 1RT5A 3MTKA 1CXUA 5KRTA 4FBTA 3IG8A 5AKHA 4A8EA 3DLBA 1S9EB 2ZQBA 1TELA 4FVMA 5KFAA 8ICJA 3B4DA 4WIQA 2IMWP 1MLAA 2WBRA 3MHYA 1HNWK 4I2GA 4JI1F 3P5JA 1U1LA 5HATA 2MZTA 4EEYA 2GV9A 2KL8A 1C0GA 2GWSA 4EFHA 2AGQA 3W60A 4ZVPB 1FHTA 1RCHA 1GOAA 1X4FA 4R79A 3X1LB 3T79A 2LDYA 4DV6K 3C66A 4RKUC 2VFSA 3ENQA 3KLIB 2PBDA 2CZVC 2CPZA 1YSJA 3V81B 1FXLA 5AKKA 3Q7BA 1X5OA 3PO5A 4X66F 2CH5A 2E8AA 1B0PA 1HWIA 3FUYA 2XB2D 2B8QA 5E33A 1X3MA 3OUYB 4H5NA 1X8DA 4CO0A 2DNPA 1RG6A 5J0PA 1W0HA 4ZP7A 2ROEA 3I8BA 2J9DA 1XHXA 1HBOB 1ZQFA 3BQ7A 1WOSA 1VIOA 1YITN 3ZDAA 3NG8A 1DZ5A 4KHPF 4FM0A 2E8NA 3DRSB 3ULEA 4G9ZA 1DJ0A 4CI6A 4DR4J 4CJWA 5CYQA 3L3FX 3PW0A 2NRRA 3J8AA 1RBAA 5HMYA 4E7IA 1IV8A 4E7KA 2G8HA 1U2RA 5KT5A 1LB2B 4CZLA 3ID8A 4FYDA 1BNOA 5H1SQ 3FBFA 1U9LA 4DR2F 3V1OA 2XICA 3BQ2A 4ED4A 1I1GA 2AIRB 4RQ2A 1ZA2B 1H2VZ 2HS0A 5HMLA 1UA0A 5ITHA 4OI3A 2VFRA 4LUBA 4ECTA 4LSZB 4N8OA 1FDNA 2ZGZA 5EX5A 2MZRA 1KQKA 2Q36A 3DN9A 1X66A 4IWVA 3KFUF 2QLXA 1X42A 2ITGA 3SAHA 2B9YA 2P9UB 4B6JA 3MGJA 4MTPA 1BLUA 5T41A 4J9UE 4FKXA 2C2RA 3DOMB 8ICTA 2F63A 2XGQA 1XUPO 1UZDA 1IIPA 2DQNB 4U67Q 4F4YA 4M45A 3SXLA 3MBYA 1IKXB 1HUOA 3UO0A 4YXJA 3SSRA 4P9SA 4FJ5A 2DNOA 1R0BG 3A8YA 1FEEA 2VG5A 4WKYA 2JVOA 5CY4A 5IZHA 3HF5A 4JWNA 3SUNA 2FLPA 2H3QA 2DBYA 2K8AA 1U1QA 1BA0A 1Q7LB 4MIAA 3KD5E 1T4GA 3KK2A 2ZWPA 5L1KA 4K42A 3D1HA 5BPNA 2QA4N 1XMQF 5EDWA 3F2CA 1FK9A 4OYPA 3PACA 1S10A 2E2PA 4H0XB 1U0HB 2IHMA 2CQBA 2J0XA 3HFKA 2FQQB 3C16A 5D4LA 5HAOA 1L3SA 5DS7A 4B3TK 1XC9A 2V8VA 1IG9A 5EN1A 2YMLA 5IIIA 4UAZA 2NUHA 5L9NA 5DK5A 2KIVA 3CJRA 2EG2A 3UM9A 5A0LA 1CQNA 4IQMA 2CWXA 2HHWA 1VRUA 3WIUA 4X4UA 3IFRA 4PKDB 1LWFA 3CO9A 3GOIA 4JI5K 4HWIA 2GO9A 3IRXA 4HTLA 3TZWA 4OVLA 5LMNJ 1K1SA 2O5DA 4WF9L 2QTWA 2RHKA 4RT3A 1X6IA 3HPHA 2KP7A 3CW2C 4NEYA 4BRGA 4EX6A 3R2CJ 3K8WA 5JLHA 1HQEB 1WEYA 1QQMA 2ZUBA 5KT4A 1GLEG 1IBLK 2ACMA 2YHAA 1VQ7N 4CZGA 2EW9A 1RB0A 3D2WA 2ZM6K 2IDOA 3J81O 2F77X 4M47A 4JI4K 3J80U 1RHKB 2M0GB 2YX4A 3CC7S 2VB6A 3SUQA 2HMPA 4RW4B 4H54A 3CD7A 2D74B 3PJWA 2J4RA 4ZVSB 2P9KB 5GMKa 3SBGA 2JLEA 5FP0A 3V4IA 2QX0A 2D0BA 3WK4A 2ITMA 3W5XA 3MAAB 4DR5K 2N4DA 1UVIA 1C0TA 2W54A 3VQ4A 2KSOA 5J2BA 2C2MB 3D67A 4M5JA 4RQ8A 3TEGA 3M1VA 2ZG6A 3FJ2A 1OY9A 3V1QA 4FFDA 2RMLA 4QW9A 5IINA 2JSXA 2RDIA 4ZA1A 7ICGA 4B9VA 1P8ZA 4FLVA 4LFCJ 4FBUA 2DK2A 1RYRA 5B08A 4FOIA 2HYIB 4HDHA 3EZWA 2RUGA 3A0HU 1CEZA 2W2QP 3D2EB 2KXHA 4QYZJ 2OKQA 3H90A 4V19S 1RDAA 5AK3A 3DLKA 4B9NA 1IN0A 3IUCA 3BGUA 4WJBA 4DHYA 2CPYA 2MJUA 2KJ8A 2BDUA 2KNJA 2I5JA 3G8TA 2D0CA 3CJ2A 4DV7K 3KLFA 4GFJA 4CM2A 4CJ7A 2O8FA 4HHJA 4DV0F 2VOPA 4KHWA 1A0PA 5ETPA 3LGHA 2ADBA 2QL5B 1CBKA 1UFKA 2MLXA 3NGRA 2V9WA 4ICAA 3PFEA 1LEOA 4HI1A 3GG4A 1AZSA 2W8KA 2B56A 3QNNA 3MUTP 3UD4P 4ZVHA 3VAKA 3D54A 3VQQA 1JLCA 3IS9B 2QLBB 3N01A 2ROPA 1ASUA 4AHRA 9ICVA 1NB2A 2B51A 4X2BA 4ZPTR 4WQ5A 1NSQA 2BJ7A 1YUWA 3UDCA 2XM3A 2DXDA 4CF8A 5JRTA 3H40A 4O8KA 1XWLA 3UQ2A 2X1GA 3TUJC 1NGFA 1VQPN 3A8EA 3IM9A 8ICXA 1FXXA 4DUYF 1UQVA 4QIVA 3GZFA 3ULHA 2QEXS 1KSPA 3M8ZA 1L3VA 1H7XA 1WNEA 2LSNA 4DV5F 2F5GA 3L2WA 1VQ5S 3SAGA 2E8OA 4ZPDA 4DX7A 3RRGA 7ICJA 3MN6A 2WF8A 1N34K 1S1UB 4MLHA 8ICLA 4A46A 5BYSA 2OYYA 2IIHA 3F5EA 2RLTA 1X4DA 4DPWA 2LQBA 3J7AP 1JLEB 2B7CB 1J27A 3RB6A 4FZMA 3DLGB 4KTWA 1NKEA 2C3YA 2XMKA 5F0WA 2BEFA 3M2UB 4FJHA 1XNQJ 1FEHA 5JMVA 8ICAA 4BDZA 4KLEA 1UL3A 3F2KA 3HDSA 3QSIA 2VJUA 4A61A 4DV2J 4NB4A 2W24A 1XBWA 2V63A 3OY9A 2ZJRL 1WAJA 5KG1A 5C2CA 4GO7X 5AQNA 3SEOA 1VDVA 5DB7A 4ZVTB 3R6GB 3R5CA 2EX3A 2RHQB 2VWBA 4J90A 3H8MA 2AJ4A 4UY8O 2DEJA 4G1QA 3W9JA 4JRQA 2ZUCA 5KG3A 4CEDA 3OYMA 2G07A 1X4BA 1DT9A 4N7TA 2EH9A 1SV4A 1ZOTA 5DZ7A 4X5VA 3C15B 2PMZC 4BQLA 3T3FA 3FEZA 1SC4B 1X31C 2IC3B 3IV6A 1FE4A 4AL6A 4LFAK 1S48A 3G9CA 2A18A 5CXTA 3PDNA 1LCUA 1VC6A 1NK4A 4LREA 4M3YA 4CT9A 2H3FA 4UB6U 2NREA 1IKVB 1TL7A 4IJNA 4Q44A 4A59A 1GLFO 1XEZA 5DG9A 1BQNA 2ZJ8A 3M32A 4FO6A 3W8GA 2DGSA 1DQAA 4BROA 1S9GB 5JMNA 4X64K 4BRKA 3HILA 4I2QA 2YX8A 2NSBA 4GKKF 1R8AA 3BF1A 1WHXA 2DCUB 2XI3A 4IH7A 3RAXA 4CLKA 1J9AA 2AD9A 3DRYA 3C29A 1YAGA 5C42A 2CG4A 4CHOA 4DS5A 2F8MA 1WEZA 3WKBA 1V4TA 3S1TA 1NM1A 5KAIU 2CQDA 1KQGB 1EETA 3ZT1A 4RW7A 1BVSA 1KOOA 3LZIA 2CNKB 4GMKA 2W9MA 2PXIA 3I5BA 4B9TA 5KFOA 2J7WA 1IXRA 2O67A 3DHXA 2DTJA 3RJMB 4KHSA 1Y9OA 3BB5A 1WBDA 2OPSB 3VTIA 2KT3A 4Y2CA 4ED3A 4LZDA 1YIJS 4CK1A 5AE1A 4RQ1A 2QWPA 3B6OA 2AQ4A 3SCLE 4UZCA 3Q8MA 2AWZA 3EJMA 4C0BA 4M94A 4R66A 3MEGA 2HNZA 3QBXA 1PAUB 4FYYB 2DH9A 3BQTA 5ALJA 3NUQA 3QUQA 5IIJA 2P9GA 1YLXA 4YY3J 5D0EA 4GV6A 4J9OA 2QZ8A 3T41A 3BYPA 3BKUA 4WZMA 2ZTCA 5J2IA 4KRWA 4QIWD 3JS9A 3DLEB 1VCTA 3R9KA 2D3OR 4CF0A 4O5CA 4Z4FA 2UUAJ 4O5EA 2V0NA 1TKXB 2CVIA 4CDGA 2PI4A 4KTZA 2ZHAA 1T44A 3V6HA 3TAPA 1S49A 2GC8A 4DPXA 4KC5A 2ZHBA 1RBUA 3US5A 4K8ZA 1FVSA 3PYEA 3AVKA 4KO0A 3EL2A 2MRLA 3D28A 1OPIA 1HNZJ 1N5YB 4C11B 4CO4A 5FPMA 3FCWA 3C0BA 2I8EA 5TISU 1LW0B 3R6MA 1YJ7A 4E98A 2FC8A 2K3KA 5ALKA 1QSYA 3NWGA 4XRHA 2BUPA 3OA9A 2AXTU 2WSCC 3M8PB 5HMWA 2WFBA 2H65B 3QPIA 1PK3A 2ZE2B 3U3GA 1C0UA 4M5NA 2V8PA 3OLBA 3OR1A 3BH7B 2JRZA 4Y2XA 4URSA 2N7YA 1ZPWX 2ACYA 4ZTJA 1NHVA 4UAVA 4IOAL 2ATLA 1PUZA 1N5QA 2DY4A 4EK2A 4LF5F 1T9VA 3D7EO 3FBCA 1KN5A 3WK6A 3BBCA 2J8SA 1WSGA 3DXKB 1QQ6A 1EQMA 4L3NA 1FFVA 4HAIA 2VD3A 1WSFA 4NA1A 2DHAA 2JXJA 1UJ6A 4FPIA 5HBMA 5J2EA 2OXOA 4NL5A 2RT3A 2VANA 1QVGM 3H4BA 1NK7A 3S6JA 5KRSA 1WC0A 1VFJA 1MSWD 9ICOA 5AJ3K 4H8KA 4KLTA 5J1EA 1YJ9N 4F04B 5TZVA 1X40A 1JXLA 4Y2MA 3TTCA 1VC0A 5H9FK 3R97A 5AQWA 4DV4K 1WUUA 3MPVA 4R5PA 2FVQA 4L6V3 4LF6F 3LM9A 7ICPA 4CE6A 1MN8A 2YJFA 3VA0A 8ICSA 4BC7A 2Z8QA 4KHYA 4KB1A 2IM1A 1FA0A 1U8WA 4CLLA 5HP4A 3TANA 3ENOA 3K5MA 2AJ1A 4JK9A 5MLCQ 4KHNA 2LYBA 1AQ6A 3GFHA 3CSKA 3QEBZ 1OS5A 3B4MA 4QOTA 1R3NA 4Y2JA 3V9SA 3RMAA 2PDAA 2ISOA 2PEHA 1GH8A 4O23A 2F65A 5ALFA 4DV3F 5KT6A 3W2WB 1GMWA 2W2PP 3M5RA 4Y6IA 2P6RA 5F8MA 4JKFA 1BIZA 3LP2B 2F9TA 4AHCA 4IO9Q 2ZJPL 3AVMA 4OV1A 3HM9A 5KFSA 4KBIA 3VQ6A 4F92B 2FPLA 2KYZA 3W5YA 3KHLA 2Z2ZA 4R63A 2GIRA 3JPNA 4CJFA 1P27B 2V2QA 2K2PA 1V97A 2ZXHA 4P0PA 2NXCA 2XG8A 3ULDA 3P1GA 1HNVB 1H72C 4QZ9A 1N33F 3TQ1A 3PW2A 4B1VA 1S72S 4YB5A 1VQON 3POTA 3QYYA 2DNZA 3MM9B 1U2VA 4DLGA 2ZUDA 2V7ZA 2RF2A 4WBFA 3MPDA 1N32K 4LF7F 1C4AA 3M6XA 4PHPA 1RBLA 1CRXA 1HJOA 3U02A 5LOQA 1D9FA 4PKHA 1VQLN 5HL7Q 2HFOA 3O9QA 1O51A 1JXBA 1ZM4A 2XIDA 3PW4A 3QFHA 3FM9A 2WHOA 3UKUA 2R2SA 4RQMA 4EP5A 5KFDA 4O44A 4ILHA 2V5HG 2OTLN 1O1WA 2HBKA 5AM3A 4P2MA 1UCNA 3I0RA 2KM8B 3MXIA 1A76A 4W5RA 3MOZA 1NK0A 3ZSVA 3V6JA 2HVDA 2DRAA 2VZ9A 2ABYA 1NHUA 3NE6A 4YOWA 3CCLS 1U4BA 4IOCL 8ICMA 3AVCA 1FD8A 1GT8A 5ALEA 4HL9A 2UVUA 3UCGA 4QS7A 2A6MA 4ZVFA 4WK3A 2WCXA 4I9LA 4BE2A 5B0FA 2X3DA 1SIZA 1ATSA 1RKJA 4J2AA 5E2QA 3ISCA 1DOQA 3JAMU 3MCPA 5AICA 4LBPA 1U04A 5AKXA 3CEDA 4ZOHC 2P2CB 4YHHK 4ISGA 2X1FA 1N6QA 3NGIA 3MM8B 4DQPA 4DLEA 1SKSA 4CGJA 2E5LJ 5GADP 4K0KF 2Z0GA 1R27B 2CVEA 3G87A 5K14B 3R8EA 1HWLA 2UUCK 5DB6A 2J7KA 4FK2A 3D2QA 4UAYA 2P9PB 3NY0A 2RP5A 2EEYA 3W2VB 3FGUA 5T7BA 4IKAA 3VEXA 5FDLB 3H25A 4FS1A 1AROP 4ILRA 4K4IA 4HVZA 1JXEA 3ISNC 1NBEB 2KO1A 4A8OA 3SFUA 4JI5J 2WC9A 1N54B 3S3OA 4NLVA 1RTDA 2NO5A 3RB4A 1VJQA 1Q9YA 3AD8C 4ECQA 2C2ZB 3SMVA 1T95A 1HI0P 5ALWA 3M05A 3QFPA 1M5PC 4CLSA 4G65A 3AN1A 3LWLA 4HH1A 4ID5A 5FROA 1FT8A 1T9XA 3OTOF 5AQXA 2BV3A 1KC8T 3Q7CA 3O9SA 1U1NA 5D4BA 4LQ9A 4K4TA 5EE1A 2XMTA 2HHHF 1NDPA 3LDLA 5KFFA 7ICFA 4LSLB 3ZETB 4MO5A 2GTDA 2G0AA 2HHVA 4JI4J 2RQCA 3HHLA 3PJ9A 3EGZA 5DGBA 1S0OA 4NI2A 3RJJA 1S77D 1WWVA 3HZGA 2P35A 2LYHA 4CQ1A 1D4XA 1D3WA 2Y9UA 2VIHA 3H4DA 3MDAA 4K4GA 2KJ5A 4KJIA 2H4YB 4AT1B 4QCLA 4ZVUB 2JDJA 1RXOB 4AFFA 1B3TA 9ICIA 2ILYA 3KLHA 4IEIA 3ZZZA 2VQEK 3TZZA 5HR7A 1Q0NA 2DR9A 3VENA 1I3AA 2Q0ZX 2NO4A 2HOIA 1ZD4A 3MXHP 4CK3A 1SQFA 4OYWA 3I56S 3GZ7A 4Z4GA 2YHXA 1KWMA 4YOEA 1NSPA 4RUHA 2FVSA 2H5JB 1UVKA 1WKLA 3K5LA 3AVNA 1ICEB 5K8MA 2FJWA 5IFMA 2KG1A 4Q5VA 1VBZA 1I94J 3Q22A 3DHWC 2HFUA 3M6WA 4B1YB 3R27A 2RSQA 3QU4A 1YBTA 1L7PA 3TWHA 4KGXB 3D3BJ 1X6JA 3K0JA 2HOEA 1B9DA 4TKTA 4GNIA 5SWMA 2WVDA 1RKIA 2K8CB 2B3TB 3VALA 4JD2A 5GADI 1U1RA 1MU2B 3QNWB 2BMBA 3LZJA 2GGPA 5E7OB 1F21A 5J8YA 3RAMA 4KGKA 1COKA 2QYGA 2FSJA 8ICOA 2EFNA 2EZZA 1ZBSA 4FJNA 3A0IX 2B5JB 1TAQA 1HYVA 3RFAA 2GMHA 1O5JA 3H8YA 1XO1A 4KLSA 5IILA 2DO4A 3LQVA 3NAIA 2KV2A 1RTHB 1Q3VA 4ILJA 3UNYA 4OLBA 2DGQA 3F9KA 5AIBA 1RTIB 3BN7A 2L9DA 2CQPA 5C10A 4G1IA 3CJKA 2KLAA 2XC9A 4BR4A 3AFGA 1RILA 1OYEA 3OVAA 4Y2IA 2G1HA 1B9FA 3I0SA 4X4PA 1KDHA 5AQGA 3VEVA 2E20A 3P83D 3MN9A 3AOCA 4LRBA 1KAYA 2JFDA 4W5NA 3MEDB 4AL5A 4RNNA 4RWWA 4LT6A 3KWGA 2FLOA 4PL7A 5KFXA 2ZH5A 3EW9A 1SGGA 2V8GA 1S6QB 4AXIA 1E3MA 3WU2U 2OHFA 3U8XA 2XHCA 4DQIA 9ICPA 3HT0A 2HLTA 2O8EB 3K2YA 1ZQNA 2KKPA 5HROB 2N3OA 1GAOA 4MJKA 1YJNN 1NG9A 1RWPB 2WF9A 1ZJMA 4E1MA 3SCIE 4LFAJ 2BQ3A 2A2DA 2AX1A 4HR2A 1OQ3A 5F8IA 2DNQA 3ICXA 4YD2A 4UB2A 3CXCR 1WD6A 1C1BB 4BS2A 4UB5A 5DQGA 3NCPA 8ICVA 2QA2A 1FEZA 7ICKA 3IGNA 3KLIA 3OR2B 2G0JA 3WHIA 2ZJRQ 3GDQA 2YQ3A 1ZQCA 3MGIA 2EK1A 3V81A 2K1RB 4JKCA 2RB7A 3O8WA 3Q8PB 3V7JA 5IV4A 2SXLA 2OEJA 3MM6A 3OUYA 4I28A 2EFGA 3ZZTA 4DR7J 4M3WA 2WF5A 3ELHA 4YOVA 4YB6A 1HBOA 2HIQA 4JS5A 3V9UA 2M7SA 2RE2A 5DLFA 3CDBA 2JEIA 1ZD2P 1U26A 3AO2A 4MIBA 2D1CA 2FHMA 3DRSA 5BYQA 4PGXA 3QGGA 4HLBA 3DC2A 3ZZ0A 4FS2A 2ZH7A 3IG5A 2ERRA 4RNFA 2ZBRA 1KTQA 3UMBA 2HBQB 3SCJE 3HKWA 4BRLA 1V5IB 4F26A 3VOVA 1WB9A 1KBUA 3NH0A 3NMUA 1SQGA 3SQOP 1UCVA 4Y2TA 5L39A 2YJEA 3TX8A 1Q86O 4EYHB 3U3YA 4O3RA 4EP4A 1ZQDA 3HHKA 3WXIA 5ALIA 2HGNA 3BKTA 1YJVA 1TKDA 1FF2A 4ZHRB 4M3XA 1P90A 4QZDA 3HMJG 4FWPA 2VIXA 4BREA 3H7HB 3TADC 4TXSA 3BPDA 2XYGB 3HHNB 4CIOA 5ETLA 1IKXA 4ED6A 4A8KA 2WTFA 2A2CA 5LXYA 1MDUB 3ZZOA 3TZXA 1QD1A 4J9VA 3JTOA 2QM1A 1HIYA 4C8OA 1TK0A 3B8HA 5C12A 1GX5A 5F9LA 1JJHA 1B7YB 2YNFA 1QZ6A 1X7VA 2X78A 1WJ9A 3CCUS 2D4WA 3C6AA 2A3VA 2VKZG 1AYEA 1HBMB 1HR0F 3VQDA 2DGWA 5MAOA 2P6UA 1ZBTA 3ZT3A 2F1HA 5AQMA 1U0HA 2DNNA 1FO1A 5FPNA 5HRNA 1MA7A 5BR9A 4ZOSA 3FSXA 3RJEA 5HQMA 4DQRA 1RM6C 2Q2RA 3ZX2A 4L3KA 2FJVA 5KFZA 2UZAA 3NDKA 3CD5A 1LV5A 4Y28C 4DJBA 1JLAB 3VCDA 1J6ZA 3I5CA 5KFBA 1EKRA 4A8WA 4C8KA 3R6LB 4ISEA 2G8WA 1RAEB 4PUOB 4NMLA 3CCVS 1FFGB 3QFWA 2ZH9A 2LVWA 2VDHA 1IBMJ 2GS8A 4I64A 2WB4A 2B9EA 4ZKAA 3NAHA 2IRYA 3TNVA 3QESA 3SIPB 4WQ4C 1RT7B 1L8OA 3A8IA 2Y8YA 4ZS6A 2MKIA 4WFYA 1QVGR 4LR8A 4CHNA 1XMQK 2YNIA 3QUBA 3V2UC 4FJJA 5AM0A 1NOMA 1HQEA 1C20A 4ED2A 4O0IA 3HKZC 5IWAJ 4KYZA 3WK5A 3OFHA 1RDBA 2ZJAA 1LW2B 3SENA 3QT5A 3F56A 3QJPA 4QPTA 1G7CB 3NH2A 4QZFA 5L46A 3Q8KA 3B9JA 1WKKA 1XNQF 2P66A 3BSCA 4P2FA 3MAQA 4K43A 4NCAA 1Q3UA 4DV4J 2DY9A 4RW4A 4C98A 5F8JA 3JS6A 1Z2ZA 5E3AA 4DV2F 2D3O1 4WZQA 2Z2YB 3ILIA 3TSPA 3L7PA 4IOAQ 3AH6A 2BCRA 3G10A 3MAAA 5HMZA 4WFAL 5A6PA 3GIRA 4ZITA 2IYGA 4OIXA 5KG0A 4ZCIA 5T7LB 4IR9A 4XPEA 4WCEQ 5AXNA 4J9MA 3CT9A 4R25A 5IT0A 2FPHX 3UN5A 2A6AA 4D3GA 1OKJA 4G3IA 4QOZB 1RE1B 3ED5A 2BW7A 3D2EA 3OHAA 2KZMA 2I7PA 2CQ1A 4I6WA 2YX7A 5GMEA 3WK8A 2GHPA 5CCLA 2WOMB 4BY9C 3SYZA 1Z19A 4QS8A 1KFSA 4E0DA 2BCSA 2PAVA 2YMMA 3AOBA 4BQZA 1DRGA 1Q81O 4WK1A 2MJNA 1E6YB 3LAKA 2F8HA 1NH8A 3VN5A 3RZAA 1RWOB 4BGDA 2L08A 4CO1A 3T1HJ 4KPYA 3H59A 4BRHA 1RA6A 3R5JB 4ISFA 4FWSA 3H1VX 3F5TA 4CEFA 2K4PA 1NMDA 2F4VK 4IQUA 4B3SF 4O3SA 1BPEA 3IS9A 3TACB 5C24B 2EKYA 3HVRA 1VBKA 2RQKA 1SV0C 4FJGA 3MOJB 3R5DA 4ECYA 2I9SA 2JZBB 1ZQIA 4TLRA 2G2ZA 1UMJA 3NFAA 4GC7A 1BXNA 3N7SC 5I3QA 4FWQA 3TEHB 2MYFA 3IR5B 2NPFA 1B4SA 4LFBJ 2R7OA 5D0RA 1WWHA 3OYBA 3C21A 2CH6A 3M6UA 1RT2B 2L9WA 3A5LC 4C8MA 3U1LA 2K8BB 4DV0K 1NSKL 1S1UA 1HNXF 1XMBA 2JHEA 3UVJB 3CC2S 4J9LA 1OQ6A 2PFQA 1N5WA 3KK1B 8ICKA 1ZYQA 1JLEA 3I9ZA 3FFKB 4CNQA 1Y88A 3DLGA 2KZZA 3G0ZA 4XIUA 3M2UA 3JQJA 2G5HB 4HTJA 3CF5Q 2PSZA 1F44A 3MZIA 2HVHA 2HMXA 5JTIA 4K4ZA 3FZ2A 1R6VA 4KLUA 4KV8B 6FDRA 3SJJA 4NCBA 4CFBA 2UUAF 2ZVSA 4YUDA 3QGHA 1WOOA 3BDEA 3B0YA 3C8YA 4QIWF 2VG6A 4RQ5A 1WSVA 4ID8A 4MK7A 1AXQA 5EWEA 4DUYK 1WC4A 3QIPA 2D1KA 3PVXA 5GTIU 9RUBA 4S0MA 2BM0A 4CM0A 1KFDA 5ETNA 1QAJA 1WSJA 3ZSZA 4DV5K 3RMCA 4E3SA 2IOFA 4O4GB 3KWIA 1HNZF 2UUCJ 3NS6A 5IIKA 1X0PA 4L8RB 3NVYA 3C15A 4M95A 1T03B 3DEEA 4JLHA 2DGTA 3QIDA 2UUWA 4L72B 1IWAA 1BY9A 2QEXN 1Q18A 3U1MA 3CWJA 3MUMP 3ZTQA 4PY5A 2KVSA 1VQ5N 2BYCA 2XSFA 2QV6A 2PFPA 2CNLB 4RBUA 2HS4A 3N97B 1CJVB 4DTPA 4ELVA 3HHDA 4IQVA 4K4SA 2D9OA 5K4LA 1IKVA 4HACB 1ZQWA 1YTUA 3K17A 5AI9A 3M6VA 1UOCA 1S9GA 3TVKA 2F8EX 3IN5A 1ZXOA 1RDFA 3I33A 4ED0A 1LAWA 4KLHA 3CCSN 3ZXWA 3BZQA 4OJRA 4LVNP 4FWNA 3F2BA 2V4QA 3ZT0A 1HHQA 4LF1A 4RJVA 2HAIA 5THWA 4X4SA 2WMMA 4WP3A 1OH7A 5E0OA 1RA7A 1REGX 1G2EA 2ZTEA 1DK2A 2OPRA 4J9NA 2L3MA 3I5AA 4E1JA 4H4MB 4Z4HA 1HBUB 4M5IA 4BRPA 2LCWA 1YTYA 2VA8A 1G4CA 1V6HA 3NASA 3KJFB 4IKFA 2OPSA 1QZ5A 3IHQB 1C6VA 2DPJA 3QSYB 4O5FA 7ICNA 1VBYA 3PRBA 2FZKB 3WNEA 3O5TB 4GVBB 3CCQN 3PW7A 2KHDA 1JLGB 1IG8A 2QA4G 1VHIA 1FXRA 2AJFE 1Q4RA 3R3LA 3C14B 4FLWA 1QHAA 3U26A 4H0OA 1RT1B 3HVWA 2FHOB 3KUHA 3HZEA 1SKWA 1HNWF 1R6YA 3KOOA 2O8CB 5AQJA 1NB7A 3MM5A 1ZD5A 1N8RO 3DLEA 3IDHA 8ATCB 3VGSA 1FKAF 2AA4A 2HI0A 2HQFA 1S6OA 1VQ8S 1S6PB 2G5IB 1R8BA 2I6XA 2GW8A 4EU0A 1UJ5A 4DV6F 2XWXA 2EAMA 1YTAA 2Z1JA 3DDHA 2VUGA 5D78A 1WG8A 9ICWA 4C11A 3CCRS 3OYFA 3AEVA 3LK9A 1K73O 3LA0A 1LW0A 1E4FT 1JLBB 1YJWS 4NLWA 2DXEA 4QS9A 4W4MA 3JXOA 3R7NB 5AFUH 2LFVA 2MZ1A 4RQ6A 1YIJN 5AQFA 1BWFO 1NPPA 2A3ZA 1L3KA 3I82A 2C42A 4OHZA 2ZE2A 3LVWA 1TAMA 2BUNA 5F1XA 1Q8LA 3GPAA 3GE1A 3QJJA 1WDTA 1VRTB 2ALYB 1TUYA 4P10A 4C8ZA 2R9LA 4O4RA 3DOLB 1HBNB 4KLQA 2JWKA 2QTDA 3J7A1 2EBGA 3N4PA 1X5SA 5GADU 4ANEA 4NLNA 1PC5A 2YB4A 5EWFA 4NZ6A 1A6SA 5L1IA 4R65A 2HFVA 4IXCA 5A8WB 4DSKA 3QBCA 3DXKA 2FJDB 2ISPA 2P9NB 2C3PA 2VBZA 2CPRA 2VASA 2YMPA 2V67A 4PHEA 1Z1ZA 4C48A 3T1YJ 3PJXA 3SUPA 2DPNA 2UXCJ 1L7OA 2W7PA 3DDKA 3BN4A 2G06A 4OI4A 4OGCA 1XN9A 4M5KA 3HD1A 5DB9A 1VHXA 3LDNA 2KK0A 2P9SB 3ZSOA 2FB0A 2OPQB 3NOGA 2UU9J 2MKCA 5GAEU 1RUSA 3CHWA 3LUYA 1TL5A 5JJBA 2Y9HA 4KGMA 4B3RJ 4PRFA 3CJQA 3IM1A 2AH5A 4LF9K 3IXQA 1IBCB 4AILC 2NRZA 2MKJA 1BHNA 1CC7A 5AFUA 4DOZA 3THXA 1DXSA 4ELTA 4UY85 1T05B 5HMMA 1ZQZA 3HJFA 1DLOB 3TW0A 4UOGA 2D0PA 2J9CA 1F1BB 3HSJA 2RD5C 2NRVA 1ZPVA 2Y0SC 1T8EA 5EU7A 5G5HA 3E01B 4KFBB 3V9XA 4RQNA 2D7SA 2E1RA 2QE5A 2XTJP 1CQMA 3PCOB 3G96A 2C2DA 5LMUJ 3SSQA 2F7TA 1WDDA 2DGVA 3E3XA 1XERA 5B0EA 1NHKL 3W2WA 5CH7B 1RHJB 2APOA 2R7TA 4ZK7M 1KVJA 4OGEA 2CPJA 4CERA 3LP2A 3AXMA 3H2UB 4JI5F 1QQOA 1B43A 2AP6A 3LP3A 3NXZA 1RAFB 3PW5A 5J2QB 2DF4B 2E66A 1JLQB 4LF6K 3W61A 4ICLA 2FVCA 4P0QB 3PKMA 3MECA 3PR4A 2BCQA 3KD3A 2PKEA 4CIFA 5F9NA 4JV0A 1SH0A 3NHGA 2CIMA 2J0QD 2HBJA 2Q97A 2DUYA 1W7WA 4JI4F 5BR8K 4A2BA 3CFRA 4X84A 4DX5A 4C0HA 3BBFA 2ZZMA 5KFVA 2YHBA 3SI6A 1RU1A 3QAEA 3K2PA 2FMPA 3QNMA 4EO6A 8ICFA 3I55N 4DR5F 4KH1B 4JI2K 3MEEB 1NK9A 4M9HA 1OJ4A 3AVAA 4I1TA 4ILLA 3VEOA 4CGFA 5CHGA 3C95A 4LD0A 3B54A 3AJ2A 1WF2A 3IDWA 1U49A 1YQHA 4DF4A 3NOCA 4ACOA 4DOCA 2NUUG 4OD0A 4UUXA 5CHIA 2ASPA 2Z30B 1OSCA 2ZBPA 1LWCB 2OUGA 3AJ1A 5HI7A 1WSIA 4UASA 3HX0A 5EGYA 1BPDA 7FDRA 1Z00B 2MSNA 1G3OA 1FKPB 2BZ2A 2XY5A 4MYTA 2ZUAA 4RW8B 3AT1B 3Q8UA 5DGAA 4N76A 3RJKA 4DV7F 3AM9A 2V8DA 2F1FA 4OX9K 2Y9TA 1S72N 2KXFA 1UT5A 1S6UA 2CQHA 4LR7A 1VMBA 3P45B 5J2GA 2P9LB 3UFCX 2JGAA 3KZIU 1XSLA 2RU3A 5K14A 1TMMA 1KTVA 2YH1A 4CGDA 1LAVA 3A1YG 4P71A 2P9PA 3W2VA 2WAQD 5FDLA 3HO1A 2E5HA 4ELUA 3A5OC 3O3HA 1AUDA 4F5PA 3VGVA 7ICHA 4P4MA 1FXDA 3R2DJ 2VQFK 1JL2A 4Q2MA 3RMBA 3ENBA 4TUSA 3DLLQ 4NLTA 5KAFU 1ZQLA 2I5JB 4B1ZA 2VONA 3UMGA 4P74A 3CCLN 1QQNA 4HCCA 3F9MA 5AKIA 1N34F 3P49B 2FSKA 1RXWA 3Q23A 1FKOB 4OYXA 7ICOA 4LSLA 3QETA 4FSVA 4P72A 2MHNA 1HLUA 1N61A 3HVTB 3KDOA 4FZYA 3WKDA 2DR6A 3H5YA 4CF5A 3X3UA 3MMBB 2UXDJ 1P9QC 1HMVB 1Y4ZB 1PJ5A 5IM0B 1ZD3A 3G2XA 4BWJA 3R3TA 2BW2A 3T19A 3LM2A 1TUUA 3KTQA 1LXNA 1CC8A 4CD1A 3JSYA 4YB1P 1BUXA 2ZEJA 1OW5A 3T1AA 5KFEA 3O80A 2VA3A 3ONNA 1X5TA 4OX6A 3I28A 5DKWA 1CJKB 2A0FB 2QWQA 5KGWA 1UEVA 1IO2A 2X74A 4BG9A 2HHHK 4OJOA 4DL5A 2EANA 3MD1A 1Z05A 4N41A 1JJ2M 2EAOA 3PX0A 3LPUA 3CTRA 5IIMA 2E1FA 2E9ZA 1IKYA 4LFAF 2YX1A 1N4LA 2KW4A 4F4AA 2ALZA 1KNZA 1SIJA 3C5FA 3LDQA 3EGWB 3QEPA 2C2EA 1ZC6A 2F7VA 1RCXB 2W03A 5FJ4A 3SQ1A 3WKEA 1KOHA 1RQNA 4WFAQ 3N6NA 2OTJS 4ZP6A 2F4VJ 5AQYA 3NLCA 3NCRA 4G1QB 3V7KA 4DR7F 2QC3A 4CZJA 4ZVQB 1NUEA 1NOYA 3MFHA 4CJRA 2F8KA 3VAJA 1VQMS 1MU2A 4MKYA 5IQ6A 2W01A 4EGLA 2A1JB 1MWYA 1LKZA 2Q6CA 2B5JA 1NZ8A 4EWTA 3ZD8A 2AU0A 3O9TA 3D6RA 3GWCA 1EB0A 5IT9U 1SPBP 1YT3A 1M5KC 2QLJB 4B3MJ 2CQ4A 4PL2A 1GMUA 4I2HA 1S97A 1RDCA 3I56N 2H3ZA 3IFEA 3O4WA 1UEKA 3JB9k 2ZH3A 3NVWA 5F0UA 1RQ0A 3ILLA 3ZZRA 3HRDD 4FN5A 1N36J 5DDQC 4XEIA 1K1QA 5C42B 3P6YC 3QGIA 5JVHQ 1ZQ1C 3PR5B 1OVQA 4DHVA 3CGIA 3TA2A 4RPZA 2EC2A 1Z26A 4TSXA 3MEDA 3T6JA 4I4BA 5HLFA 4DR4K 1M1HA 4M63A 4BR9A 1S1XB 3OPXA 1S6QA 2QN6B 2XS2A 5GVQA 4EIAA 4WWSA 4F0HA 2R7SA 1I51B 2R8KA 3AA5X 2EVZA 2E2QA 2O8EA 4F91B 3N28A 2YNGB 5HROA 1YI2S 4F4KA 1NO8A 2YI1A 5KT3A 2YKNB 2JWNA 4DPTA 1DQ9A 4PL8A 1UVLA 3SEIA 1RGIA 4FF3A 1RHUB 3T5LA 3LOUA 4QW8A 4JRPA 4I2FA 3QBWA 3SQ0A 2YMQA 1YRXA 4CEZA 4URQU 1C1BA 3B6BA 1ESVA 2FBVA 2F76X 4DWIA 3P96A 3NBPA 3OTQA 9ICHA 3IBWA 3CM5A 5AZJB 1C0FA 4O3OA 2JL9A 2K1RA 2OGUA 4ZJLA 1IBMF 2MSSA 2C3UA 5D77A 3ICLA 1EKEA 3J81j 5LL6Z 4F5NA 2IJFA 1PO6A 1WHYA 4KO0B 4K7QA 1Q7YO 4DU7A 2GX8A 3IM8A 4DZ6A 3C7NB 2QARA 1GTEA 5F3TA 4WU2A 4DU1A 3O9RA 4NLOA 4F25A 4PG5A 3D2FB 1Q95G 3HFZB 2XHBA 2YPZA 5CJ7A 2CQ3A 2M8DB 2HW3A 3KUGA 5IWAF 4MDAA 2ILZA 1YF5L 2V52B 3FQKA 1KS2A 2JZ5A 1MQ2A 3VZIA 5AJ3F 4TY8A 1BHLA 1C0UB 5HRSA 8ICQA 3FZFA 4OMFG 3S8SA 1RHMB 3VQBA 3JQKA 2GJ2A 2Z57B 2ASOA 2AV5A 2DYAA 4DV4F 4AF1A 2R8IA 3KD1E 2KKVA 2Q6BA 2G2YA 1T3NA 4UW2A 1HARA 4F0KA 4DU8A 4GV3A 4IG0B 3VQ7A 4U96A 3KKAA 5ALLA 1UKUA 4ZHRA 3QEXA 2ZGYA 1RWNB 3BQ0A 3ADAC 2OWOA 5TKYA 4CE9A 3AA3A 5LMNK 1F6TA 2JMGA 5B09A 4YVZA 4DFJA 2R18A 1NGCA 4CH0S 1S1VB 2V68A 2FSNA 1YJTA 2YQ0A 5IOLA 4CNZA 3OPKA 4CF3A 3OYGA 1MG7A 2Z1HA 4C23A 2XCPA 1SJ1A 5AR0A 4IFYA 2HHQA 3KLGB 3VCBA 3SK3A 5A2QY 1HBMA 3OL6A 2HURA 2FY1A 1K47A 2LXIA 5CD4A 4R5PB 3R7SB 4JAXA 4RR5A 3H8WA 4FL9A 1NLVA 1YJRA 2IHR1 4ZCKA 3J7Z5 3NCQA 3T1HF 4CLZA 3FFIB 1SZPA 3MR5A 1XU4A 1ZQJA 2FF6A 1S57A 3TJ8A 1JLAA 1PAEX 4KHUA 4Z7CA 1X9SA 4H5WA 3CPEA 1YVUA 1N32F 1NGHA 1HA1A 4PUOA 4LFCK 2HRUA 3KMSA 4H4KC 1F9HA 1N52B 2XNQA 4MK8A 3PUFA 3GCXP 3T6BA 4KKOA 2K06A 3H0PA 3CC4N 3JTNA 3D2SA 1QQ7A 3VF6A 4K5RA 3M9NB 1RT7A 4KAIA 3FMBA 1I3OB 4NLDA 4LFBF 2RE1A 2MGZB 2FHKA 3W62A 1S5LU 1NGGA 4I2PB 1JJCB 3MMCA 2VG7B 3NS5A 3FZMA 1Q82O 2HQIA 5IV3A 5JXSA 2ESEA 4A2AA 2KB2A 5B8HA 5AKZA 4FM2A 2I1QA 3UD5A 2C2OB 2AX0A 1K8KB 4DBQA 2YKMB 4J7CA 3CCUN 1X4HA 1H98A 3T9ZA 5LSOA 3HWTA 4F50A 4KLIA 1VK3A 4DSFA 3H20A 4LF9J 2EFQA 2HNYB 1T9TA 2QG9B 5C25B 3GTYX 2MKSA 3LYSA 4C8NA 3UN3A 3WXLA 2DKZA 2QMUB 2IDLA 3M30B 1N2XA 1R0AA 1UEUA 1V9OA 3D1OA 2QXFA 2MB0B 5T7LA 2V4RA 3R5GA 4HDGA 2OH2A 2G0IA 3EXCX 1F60B 3CCVN 1QQ5A 3JPSA 2UUBJ 2HB5A 4MK9A 1VQKS 5F3XB 5DZ6A 5AXLA 1MWZA 2IOFK 3NGYA 2UUCF 2NZCA 4DTRA 2MQPA 1JCEA 5BJRA 3Q8LA 1HNIB 3KG0A 2LM1A 4ZVGA 4ZVEA 4OJHA 3CJ8A 4WP9A 3KZBA 1ASVA 4DCHA 1BE4A 2WOMA 2UXBK 1FJCA 2ES6A 3AQEA 1WYGA 4FLYA 3C65A 2RDJA 5I42B 3QWPA 1TQLA 4JI8K 1VDHA 9ICLA 1SQKA 4C4RA 3W0LA 3Q0AA 3BREA 5IT9Y 2O6KA 1E6YA 3RJHA 3PLAA 4BJQA 2W41A 2XS5A 3WXMB 2R2UA 3K1RB 7ICEA 1M5SA 2PZSA 1ZQMA 1KR4A 2R7RA 1NWKA 3A13A 3C2LA 3HHLD 4NLRA 4Y1CA 4CNYA 3ITHB 4KLFA 3ENWA 5C24A 3Q8VA 4I6AA 3OL8A 1V5VA 4OZ2A 4LRAA 4C9DA 2QWLA 5F41A 5AIAA 4Z0UA 2EFPA 3CFPA 1JRPA 2JZBA 1VJWA 2AEJA 3ASMA 2K60A 5DQHA 2D9PA 5ALZA 5EOZA 4WE1B 4L74A 4RWTA 3RBDA 5J1NA 3EUB2 3KBBA 2ZHOA 3ZTRA 3CJ3A 4NPOA 4JI2J 2KJWA 3G86A 2GJIA 5IQQA 2FIUA 1IXKA 2V51B 4ER8A 2K8GA 4EBDA 1RT2A 1SB3C 2IDEA 3DXBA 1Q81T 4IH5A 5H1SV 1BD6A 3LDAA 1S1WB 4Z94A 3UVJA 1RWVB 1CPZA 3HJEA 1HKGA 3OL7A 2M88A 1T9YA 2ZUGA 3DOKA 3KK1A 1QVFR 2FZCB 3HI9A 2XO6A 3E9PA 4KH5A 1YVFA 2QL7B 5AK6A 4K2JA 4DG1B 1CVJA 2G8KA 2R4FA 3L4IA 1XC3A 4UB4A 3O3GA 4NEZA 1MMDA 3ZDEA 3HHLB 2BQUA 1D8BA 4KV8A 3D0GE 3L4QA 3TI0A 2VICA 1FRXA 5ALPA 5AQUA 2FGCA 2CZ9A 4F36A 3VAFA 4R0EA 1C7YA 1OVYA 3NL0A 4XDDA 2RS8A 4WIIA 2JH3A 3NCIA 4PKGA 5AE2A 3CCJN 3SCXA 3TOQA 2Z58B 4RQ4A 1IM4A 3H08A 4O4GA 2XYPB 5DDPC 1QLNA 4FVCA 2WB1C 3ZSWA 3PO4A 4RBVA 2IM0A 2JC1A 1T03A 5KG4A 1OIAA 1V3ZA 1NU0A 2BPCA 5HN0A 2FBXA 3UR3C 3PY8A 4U6PA 2LBOA 4J2EA 2KE7A 1FRJA 1RAAB 4YY3K 1NK6A 2VQFJ 4BXOA 4FVUA 3MR6A 3CC2N 3LTOA 2BCVA 2F9DA 5LSLA 2ZOGA 1CJVA 2M70A 3OBYA 2DRBA 1CG2A 4HACA 9ICXA 2GHVC 3UB5A 1UA1A 3B6PA 3UW1A 4E8UA 2ZIVB 1ZOLA 1QM9A 2MU2A 4M9JA 1QJHA 1RBOB 5HQLA 1F9EB 3VGTA 2GVZB 3EWAA 4EX7A 1IR1A 4DUZJ 1EARA 2A40A 2UYTA 2EDUA 2YKQA 3H2VE 3RVCA 3JSRA 1HNZK 1K9MT 4UB1A 4NL9A 3QU5A 4GXJA 4OX8A 2ZVIA 2FC9A 2UXCF 2PI5A 5GAHP 5J0WA 1NZBA 1ZTWA 2R7VA 3AO3A 2P6TA 4H4MA 3V72A 3CJ4A 3GILA 4HI2A 3BUZB 1B70B 2DGOA 2EWSA 3ZT2A 3SQ4A 5CA7A 1ZBLA 5BOLA 1SJRA 4BX9C 2YWHA 5GIPA 4ZCLA 1Q5YA 1TVAA 4B3RF 3RJIA 4GVBA 5M2PA 5F2RA 1JLGA 1HYSB 3GBTA 1JJ2R 2IVOA 3HM8A 5AM4A 4M04A 1TE2A 5ALRA 2YNHB 1RT1A 2LA4A 4NRUA 1UVMA 4HCBA 4M3TA 1TUVA 1B64A 1J2VA 3HP6A 3CJKB 1GXLA 2O8CA 5IIOA 3TKAA 1YJUA 1W25A 1F2GA 4YDUC 2J76E 4QIEA 5CYMB 3FLCO 2MKYA 1NGAA 1CZ9A 1QDUB 3I0SB 4M6WB 4ECUA 4M3RA 1KCFA 5J1PA 2BANB 4U8YA 3AXKA 3CNQP 3A3OB 5I9EB 1S6PA 3TUPA 3N4WA 4ZJOA 2HZVA 5LMUF 5HK4A 1RI7A 4CLFA 1VLOA 3OLAA 2ZITA 4ETXA 4EUVA 4Y34A 3W65A 4CHPA 2RJZA 3DNCA 2BE2B 3MMAB 4RLEA 3U4LA 3BGFA 3CCMS 5FLXU 3M6ZA 4WYLA 4WKRA 2C1EB 4RUBA 1ZQPA 5F3ZA 1JMSA 4PJ0U 4OI6A 2B0GA 2GIQA 1KFTA 1CLQA 8ICHA 1TL1B 1OUQA 3AV9A 3JPRA 5DDOC 1XR7A 2G2OA 4GC6A 2H51B 2KJVA 1N8RT 3WNHA 4DX6A 3N0VA 3LF0A 1Y10A 2WK4A 1L3UA 1VRTA 1W2IA 2W25A 3F73A 2VL1A 1U02A 2C2NA 1HBNA 2G9OA 3DOLA 1CS4B 1S0MA 3OVBA 1ZM3A 3QRRA 3CJBA 4X4OA 2DB1A 2KVCA 1U09A 3MR3A 2KH9A 2L48A 1HHSA 2MQQA 2VJ5A 4FYWB 1AW0A 1SH2A 5A8WA 5DJBA 3DLRA 2D5RA 2P9NA 1WORA 4FXWA 4CO2A 2HQDA 3MM6B 3GDXA 4CJTA 2AYBA 1K73T 4Z4CA 1F0MA 1ZQGA 1BI4B 2MKHA 1M1KO 5KFPA 4Y0FA 4TUPA 3OS1A 1VQNS 1KLNA 3OFEA 4KHMA 4BDPA 3KHGA 2PMWA 2JEJA 2P9SA 1VQ9S 5J2NB 2QA4S 2OPQA 3CCRN 1SUQB 1UPHA 4AL7A 3UQSA 3DDIA 5GAHI 4PQUB 3KKSA 1C1CB 5I3UB