4DS5A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mg2+
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 207
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds5A01
3ISNC 4RQ6A 1BCOA 2IHMA 9ICTA 3KJVA 2P66A 1NK0A 4QZIA 3OGUA 4J2DA 3VQCA 1RTIA 1RT3A 4NLZA 4K4GA 3SQ0A 3ZDDA 4ED7A 5DBBA 1Y88A 5J2DA 1S0NA 4PY5A 2QXFA 3SUNA 3KLHA 3K5MA 5EWEA 4YR3A 5DQIA 3P83D 5KFTA 3M9MB 2KZMA 1BPDA 3C1ZA 2B5JA 4L8RB 4KHSA 4PHAA 5KFIA 3JPNA 1Z26A 2BCUA 5DLFA 1ZBLA 2HHUA 5D46A 1TK5A 7ICMA 2J6SA 8ICZA 4ED8A 8ICVA 4CHPA 4QWCA 4CJSA 4YCXA 3HT3A 5KFQA 3ZT3A 3ZSOA 4CJ4A 4RNNA 9ICPA 1KEJA 3OYNA 1RBVA 4HTUA 1JN3A 1BPEA 2BDPA 4CF0A 2Q0ZX 5CA7A 1FXXA 4YD2A 5KGXA 4ECUA 4FBTA 3CFPA 4CJWA 3LPUA 1N48A 3AO1A 4XA5A 2RN2A 4RT3A 5J0OA 1QTMA 3OYGA 4MFBA 3BQ2A 3UXOA 4ELTA 5CZ2A 4KPYA 4F4YA 4ZTJA 2NRVA 4WE1A 1H38A 1CUKA 2GWSA 1A76A 4ECSA 3GV7B 3H08A 4GMJB 4YMNA 5E41A 2EHGA 2WOMA 3PW4A 2HMIA 1A77A 3MDCA 1RDCA 5J2GA 2BCVA 1NK5A 8ICQA 2G8FA 2YKMA 1EKEA 4G1QA 3ZD9A 3C94A 3QETA 4OVLA 4DSKA 4QZBA 2PY5A 3CFRA 5J2PA 5DB7A 4OPKA 4XUSA 4JLHA 4DS5A 3ZT2A 3NBPA 2XY6A 4JRPA 4BE0A 3NGDA 3E2EA 5J2MA 2HVHA 4UBCA 2VG5A 4RW4A 2ZJAA 2FPKA 3PY8A 1NK4A 4RUCA 4XQ8A 4X5VA 4E7HA 3KLGA 3RAQA 2OPPA 2ITGA 1D9FA 1JL2A 1RBSA 1S9FA 7ICPA 3Q8MA 4OGCA 3WNEA 3LALA 1W0HA 4EZ6A 4YXMA 9ICSA 2OYQA 4ICLA 1LAVA 1SL1A 1NKBA 5CB1A 4I2DA 3SV3A 1HJRA 1S1TA 9ICKA 4I29A 4KLFA 4RPZA 1U49A 4O44A 5HNKA 3RJGA 1WAJA 1Q9XA 2ZUCA 1ZBIA 4O3NA 2XY5A 4DF8A 2KFNA 3IG1A 2NRWA 1BQNA 3BQ0A 3K75D 4NLKA 1LWCA 8ICFA 4FM1A 3O3GA 1S76D 1C6VA 4MEXA 1ZQKA 4F3TA 2VA2A 4KTQA 3UQ2A 4KITB 4B9SA 1KFDA 8ICPA 1HPZA 1VSLA 3CQ8A 3QIPA 4YQWA 1VSDA 4JWMA 3VQPA 2VA8A 1C1CA 1B22A 1HNIA 3NTUA 2ASLA 2PXIA 5L1IA 5IIMA 4KTWA 4YFKA 3ZT4A 4E1MA 2PFPA 5DBCA 4CE9A 3L2QA 3V72A 3L3UA 2XY7A 4Z6CA 4IG3A 2HNZA 2C2DA 4QZEA 4DOAA 5JS2A 4R63A 4CGIA 2VWKA 1RT1A 1ZQQA 4RQ4A 4DQPA 4QOZB 4DSLA 5KFLA 3Q8RB 1HQEA 3IM1A 1SKRA 3C5FA 3BDPA 1S10A 4M2YA 1UT5A 4CGHA 4K4IA 4EP4A 4FJ7A 3PX0A 5DB8A 4C8MA 5KFJA 3RH4A 3K2PA 1RYSA 3OYEA 1IXRA 5J2QA 4TUSA 1DTQA 9ICIA 3OYFA 4NCAA 4QZHA 3MAQA 4NLNA 1WSGA 3MEEA 1KFTA 5DG8A 4ED6A 2B6AA 3FFIA 5J0XA 5L1JA 4RUAA 3T19A 3LP0A 1BI4A 4Z6EA 4B9NA 2KTQA 1O1WA 5DGAA 3SUPA 4O5EA 4YVZA 3MR5A 7ICFA 1N56A 3VQ4A 4BXOB 4M47A 1X9MA 3SPZA 4ECQA 3MFIA 3AVFA 5KI6A 1BPYA 8ICYA 3RMBA 3OYAA 4O9MA 3TARA 2BQ3A 4R66A 4LZDA 1KVAA 4JS5A 4CHNA 4FJHA 5KT3A 1GOBA 3T5LA 2HHTA 3TQ1A 1ZQLA 3GV5B 4F4XA 1KDHA 3H8WA 3VA0A 3QEIA 4FW1A 4ELUA 1S6PA 1VSKA 4PHEA 9ICOA 3OYBA 4ECYA 5DB9A 4CECA 3F9KA 1EXQA 4P4OA 4DSFA 4DMNA 2YNIA 3S3NA 4CHQA 4J9NA 1CLQA 1WN7A 3OYKA 4HUGA 3C23A 4CEQA 5KFMA 2OZMA 4F2RA 2DFFA 3JPSA 3LWMA 4GVMA 3G0ZA 2C2EA 4M3WA 2BQRA 4ED2A 3T5KA 2X78A 2G8WA 2AQ4A 1LV5A 3BQTA 2KFZA 4FJ8A 3ISBA 4CJTA 2KW4A 1JLBA 4FLUA 2R8JA 5FDLA 3VQ9A 4YMMA 1X1PA 1D9DA 5KT7A 4CF2A 4C8KA 4I2EA 2YV0X 5KFZA 3D0PA 3O4NA 2XCPA 3PR4A 2RDJA 3MGIA 4CJUA 1L5UA 1KLMA 2YHBA 5J0SA 4I2GA 4FJXA 2HHVA 3AO5A 3QEXA 4PGQA 3KHHA 4DS4A 8ICUA 5HBMA 7ICKA 3OYHA 5KFSA 8ICBA 5KFVA 4HUEA 1WCLA 2KQ2A 4Z4CA 5KG7A 2MUTA 3K5OA 4QZGA 2I5JA 4C8NA 5DDYA 1Z3EB 5HRSA 1WSFA 4IKFA 4M9HA 2VG6A 3KHGA 3AVCA 4KLGA 3PMLA 1JMSA 3MBYA 2O4GA 3Q8QB 5KRTA 2JEGA 3MEGA 1ZQYA 3TAFA 4QW9A 4C8LA 4YP3A 3NH2A 5J2FA 4GW6A 3T5HA 4HHTA 4KLIA 4I2AA 4Q8FA 3B0XA 4I9QA 4GLXA 1EETA 3MGHA 4RW9A 9ICBA 1RT5A 2ASJA 3AO3A 4DTJA 8ICXA 4CEZA 3BJYA 1RTDA 3UIQA 5IIKA 3H4DA 1KFSA 3THVA 3ZSYA 1IG9A 3NF6A 4PHPA 5KFDA 4YFUA 2PFQA 5HMMA 3V6JA 2JGUA 3QNNA 4DFKA 1Z00B 4J9OA 1FKOA 1D8LA 1G15A 3RR8A 4RQ0A 3ZT1A 3ISDA 3V7JA 2BPCA 2HNDA 2XCAA 4FJNA 3RBEA 2P51A 2V4RA 3ASMA 1AROP 2HHXA 1WSHA 4YXJA 3MEDA 4DL4A 4YN4A 5KG6A 4Q43A 4CEDA 1Q9YA 1VSHA 2F96A 3GILA 1D8YA 4M9JA 3GIMA 1WSIA 5IIJA 2G8VA 1S1UA 2M9NA 3LZJA 3OHAA 9ICWA 4KLTA 4AHCA 3C2KA 2RF2A 4F4ZA 4QWEA 9ICFA 2F1JA 3N4MB 3RJEA 4HCBA 4CJPA 2QK9A 1IKWA 1RYRA 3HXMA 2C28A 4ECWA 4RT2A 3T5JA 3LDSA 4KN4A 4AHSA 3K59A 1S1VA 3LANA 4IQUA 1WNSA 1UA1A 3V9WA 4E7KA 2R8GA 3V6HA 5DK5A 2ZJ5A 4B08A 4AILC 1TK8A 4JWNA 3L3VA 1RILA 4FK4A 4FLVA 3VQAA 2LYHA 4RW7A 3AVNA 1CZ9A 3TAEA 4IR1A 3SNNA 3PR5B 1JIHA 1RXVA 3DLKA 4Z6DA 2XGQA 4W5RA 1BHLA 4N41A 2W9MA 3EPIA 4DOBA 5CYQA 1VSMA 3SZ2A 4ECZA 1ZQIA 4F5QA 3VQ7A 1B92A 3PO4A 2FC0A 4CK3A 1I3AA 1W9HA 5IIOA 3NHGA 5D3GA 4E89A 2YKNA 4F5NA 2J6UA 2XHBA 3NF7A 1CZBA 3V1RA 1HQUA 4GXJA 3QEBZ 1UT8A 3SCXA 4GXIA 1TVRA 2UVRA 5CY4A 3NE6A 3QEAZ 4KLDA 3NH1A 1ITGA 3C1YA 5J2KA 1LWFA 3GIIA 7ICOA 4M45A 2BGGA 4IRKA 5I3UA 3RWUA 3TFSA 2DFLA 8ICKA 4QZ9A 5HP4A 1JLFA 4I27A 3OYLA 1WCNA 5KFEA 4BDYA 1BI4B 3P1GA 4KO0A 2KZ3A 4QZ8A 2NRTA 3H4BA 1EP4A 4UQGA 1NOMA 4M6WB 4RQ8A 5CYMA 1WSEA 4CFBA 2Q3SA 4NCBA 3SYZA 3V7KA 5HRRA 1ZQJA 4AHTA 4PA1A 2V4QA 1BCMA 4ID1A 1ASWA 1C1BA 3KIOA 2QKBA 3AO4A 3IRXA 2DPJA 4FM2A 4IRDA 3QEVA 1BGXT 3RJKA 4J9MA 1B43A 3O4QA 3JPTA 2A1RA 4DU4A 4R8UA 5KFNA 4DQRA 2ZTEA 3M8PA 4B3OA 1ZQGA 3KK3A 4KI6A 1XSLA 4EBCA 1RT4A 4I28A 3L8BA 4RQ3A 5J2CA 3JPOA 2BQUA 1S6QA 4Q45A 3HK2A 3TABA 5KTQA 5IIIA 3OYIA 1IKYA 1S5JA 3V81A 4FJIA 4FM0A 4FLWA 2ZTCA 4KLQA 3JPRA 5KGWA 2FLPA 4J9PA 4DWIA 2W9CB 5DB6A 3RB6A 4F4WA 2G8HA 7ICTA 2RPIA 9ICRA 1RNHA 5BOLA 1RXWA 4E7JA 4CJLA 4CF9A 4NM2A 7ICJA 1WSJA 5C42A 3TAGA 4KFBA 1KTQA 5DG9A 1JLGA 1JLAA 4GXKA 4TUQA 4M04A 4OPJA 1ZQUA 5J1EA 2ALZA 1RT6A 5HP1A 2Y1IA 3AA2A 4GC6A 4F4KA 4DTOA 2HW3A 1A5WA 4KHQA 3ZDEA 3CFOA 4CK2A 4TQRA 3PW5A 3K57A 3PV8A 5HHHA 3K58A 4IR9A 2BHNA 4DQSA 4R65A 1K1QA 9ICGA 2HHSA 3LZIA 4Z4IA 1YTAA 4QCLA 4DFJA 1HUZA 4YR0A 2G8UA 3AVGA 3ZSVA 4PGYA 4RQ5A 3M8RA 4PQUA 5KFBA 4J9QA 4FJJA 4M3ZA 1N6QA 2XC9A 2FMQA 5IILA 2Z1JA 3LP1A 4Z0UA 2IDOA 2FBXA 3AV9A 1KVBA 4CEAA 4BXOA 3MABA 1T03A 4KHWA 5D49A 3QZ8A 2W42A 1MQ2A 4YMOA 1ZQEA 2IBKA 4P4MA 7ICGA 8ICLA 1KCFA 4CJFA 4CFDA 4KV8A 4I2HA 5CP2A 2G8IA 1JXLA 3ZDAA 4UB5A 1XS9D 4I2BA 5C24A 3AU6A 1UAXA 3VA3A 5J2NA 2DY4A 1CXUA 4M42A 3MXJA 1ZQWA 8ICRA 2OWOA 1HUOA 5KFXA 4DO9A 1BPBA 4DU3A 3RAXA 3HVTA 1V9PA 5L1LA 4LVSA 1U9LA 3ZSWA 4FJMA 2GV9A 1RCHA 2D0CA 3KD1E 3ETLA 3ZCMA 2P6RA 4MFFA 2Z1GA 3T3FA 4JK1A 3K5LA 4KHNA 2UVUA 5SWMA 4CEFA 1SUQA 1ZJNA 4N5SA 3Q8SB 3DM2A 2FLNA 4JV0A 1RBTA 3SQ1A 3V9UA 1U45A 3PO5A 3AVIA 3DOKA 3M8QA 1JL1A 4P4PA 4OLBA 4ED1A 1RBRA 4DTRA 3U3YA 4BGDA 4EYHB 4P2HA 3RBDA 3IAYA 3NAEA 2P5OA 3OSPA 5J2JA 2W9CA 3NF8A 1KLNA 4CFCA 4DSJA 4JS4A 1HYZA 4FO6A 4F5PA 1QQCA 4KLUA 1IO2A 5CHGA 4DSIA 3PW7A 1BPZA 1XHZA 3MECA 1ZQHA 4ZHRA 1L3SA 3OHBA 1TKZA 3WNFA 3ISCA 4FS2A 4FJ5A 3HPHA 1QSYA 2ATLA 3GQCA 4DTNA 1BPXA 2F1HA 3QESA 3TI0A 3TAQA 3LP3A 4DU1A 3HW8A 2PYJA 4Q5VA 1ZBHA 4J2EA 1SZPA 8ICSA 5BOMA 8ICCA 1RDBA 2IMWP 4CJ3A 2YHAA 4ID5A 5KFYA 3SPYA 4DQQA 2RDIA 5J2AA 4W5NA 3OY9A 1MQ3A 4KLSA 3E01A 4DOCA 3H8SA 5J0QA 9ICQA 3QO9A 3Q8KA 3AVJA 4B9MA 5KFFA 4N76A 4RZRA 3L2WA 4KMUA 3DLRA 5KG3A 3DLHA 3AA5X 1A5XA 2P5GA 2W9BA 3PW2A 2IA6A 4JUZA 5DDMA 4M41A 3SI6A 1SKSA 1ZBFA 1CXQA 4F8RA 4Y1DA 7ICVA 4RQ1A 5KG0A 4O3SA 1RTJA 4E0DA 5T7BA 1L3UA 3ITHA 4DL7A 2ISPA 4F92B 1K6YA 4CEOA 4NYFA 4QWDA 3G6XA 4NXZA 3OS0A 3RMCA 4FW2A 3HSTB 4DTXA 2F8SA 3HVRA 4I2JA 1GOCA 5KFCA 4RPXA 5J0WA 1VRUA 1XWLA 1T05A 5FRMA 4M6WA 1XI1A 4AH9A 1IKXA 1TFRA 1HYVA 4J9SA 3EW9A 4RW6A 1K1SA 9ICMA 3VN5A 1QSSA 5JS1A 1J9AA 2BGWA 4QZAA 3KLIA 1NKEA 2HHQA 3OYJA 4PH5A 1SV5A 4ECTA 5J2IA 4AHVA 3OYDA 4CGGA 3B6PA 4B9UA 4O5KA 2Z1HA 4MEYA 4UB4A 4CJRA 3DOLA 3TFRA 3VQ8A 3OJUA 3C6TA 4O3QA 1RTHA 4ED3A 1NKCA 5D4BA 4J2BA 4UB1A 3LK9A 4K4HA 4DLGA 2JLEA 1XU4A 4H4MA 2D0AA 2DTUA 2ISOA 4FBUA 7ICSA 2JZBB 4KB1A 1KVCA 2DFHA 7ICQA 5K14A 4DFPA 4RNMA 4DEZA 3EWAA 3QIOA 1Q8IA 3KHRA 1LW0A 2DPIA 2ZQBA 2R8IA 1BIUA 5KRSA 4K8XA 1JXBA 5FRNA 4HVJA 4KHUA 1Z00A 1ZQBA 2EX3A 3U3GA 5CZ1A 4EYIB 4I9LA 4FJKA 9ICXA 1LB2B 3AA3A 4J9RA 1CEZA 4F5RA 3OYCA 1U4BA 4BE2A 4DL3A 4OKKA 4CERA 2PI5A 1BL3A 8ICHA 3GFKB 4FYDA 5KFAA 3NH0A 4I2CA 3EY1A 5CR0A 4FZYA 4C8OA 1JXEA 2RKIA 5JUMA 1VK0A 4M3XA 4FK2A 5J29A 2ZJ8A 2ETJA 1MU2A 4AHUA 3AVHA 1VSIA 5J2BA 2OPSA 2IC3A 3VQ6A 3AVBA 4O3RA 3WNHA 4BDZA 4UBBA 1BVSA 3IHQB 4MF8A 3PVXA 3V6KA 1S9GA 4YG2A 1C0UA 1SL0A 5F9NA 4CGJA 1N5YA 2NRZA 4FLYA 4R64A 3NFAA 5HRNA 2YNHA 2W8LA 3QZ7A 5DBAA 4DG1A 4ECRA 2AGPA 2B4JA 5SZTA 2J6TA 2IGIA 3KK1A 3DLGA 1NJXA 4EZ9A 1QE1A 3QINA 4W5TA 3DRSA 1JLEA 7ICEA 3B6OA 3OJSA 4Q44A 3IS9A 1TVAA 3V6DA 7ICLA 3B0YA 1COOA 5HROA 4CJEA 2C2RA 2OPQA 3WNGA 3ZT0A 1ZQAA 1KSPA 4Z4HA 3PMNA 4LY7A 4NCGA 2FMPA 4O5CA 4KLMA 3U6FA 4CIEA 4FXDA 5KT4A 3RJIA 3AU2A 1NJZA 4H4OA 5DKWA 2BKEA 3C6UA 1T7PA 1ZQTA 1IKVA 1TGOA 1XHXA 4KKOA 3DLBA 1X9WA 3MXMA 3V7LA 4XRHA 3ZDCA 3V4IA 4IRCA 2P1JA 5DLGA 4RPYA 1L3TA 3RJFA 5EWGA 7ICRA 4Z4GA 4CF8A 3ZD8A 3LPTA 3VQ5A 2IAJA 1B9FA 3VQQA 4ECVA 4NY8A 1NK6A 2IHNA 5HMLA 3PX6A 3LDAA 5KFUA 4QW8A 2I1QA 3D45A 3KD5E 3HO1A 4QZDA 1TAUA 4ECXA 4EBEA 4CIGA 2ZUBA 2BR0A 3LP2A 5KFWA 4Q0BA 4MFCA 2D0BA 1ZQOA 8ICGA 1JKHA 4CIFA 3ZSZA 4PHDA 4MFAA 5F9LA 4BDPA 4LH5A 2ZE2A 4G3IA 1S77D 5HHIA 4FLZA 3EZ5A 2FMSA 4CESA 3SI8A 3HPGA 1FK9A 5KG4A 1TAQA 2UVWA 3CM6A 3I0RA 3BQ1A 4DFMA 4KLEA 2DFEA 3LWLA 4I2QA 5TZVA 4LD0A 3LAKA 2LSNA 5J0UA 3K5NA 4KB0A 2PYLA 4FLTA 4DTUA 8ICJA 4K8ZA 1RT7A 4OLAA 3MDAA 3I0SA 3QNOA 3UPQA 4FVMA 4O55A 3OS2A 4IQTA 1DTTA 3SUQA 2BPFA 3L2UA 5KFGA 3UXNA 3GIJA 1DGSA 3RB3A 2D5RA 2GUIA 3MR6A 5CJ7A 4MQ3A 3G10A 8ICTA 4QWBA 4CJKA 4BWJA 3V9XA 4DLEA 2W8KA 4AHRA 3RJHA 8ICWA 3TAMA 1MC8A 3H40A 3M9NB 1SKWA 4FZXC 3HP6A 4N56A 5DQGA 1F21A 2A1JB 1ZQDA 3UQ0A 4MF2A 2FBVA 4F5OA 5KFKA 1HNVA 3MR2A 4PWDA 2G8KA 2V9WA 2VA3A 1U04A 4LH4A 4W5QA 5CWRA 1DLOA 4R8UB 3G6YA 1REVA 1XSNA 3QERA 2O4IA 3SJJA 4IQWA 1PZNA 4DL2A 3F73A 1IH7A 3Q8LA 1VSFA 4M3TA 3QE9Y 2UVVA 3T1AA 3ALYA 1TV9A 3DRRA 2AQ0A 4B9LA 2E4LA 5L1KA 4BACA 3M8SA 4F91B 1YVUA 4UB2A 4OKEA 3ZSRA 1S1WA 4FJLA 4HCCA 4QZCA 1ZYQA 3HP9A 5FROA 1NK8A 1ZQNA 1BQMA 3NF9A 1MSWD 4Z6FA 4O3PA 3GV8B 1C1AA 1XSPA 2BCSA 2E6LA 3L2VA 1FKPA 5J0PA 8ICAA 4KN7A 4RQ7A 2W9BB 2BANA 1JX4A 3RH6A 1WLJA 3SUOA 5J0TA 4CEEA 3M9OB 2BCRA 1S0MA 2AU0A 2XGPA 5KG2A 4CEBA 1C0MA 4KREA 4IFYA 2BCQA 4M3UA 3CYMA 4O4GA 8ICMA 2R7YA 4I2FA 3RMAA 3NGYA 3DRPA 4Y1CA 2C22A 4B8CA 2X6NA 4NYNA 4CHOA 1D5AA 4CHYA 8ICEA 1VSEA 2FPLA 3FYHA 2X6SA 4F93B 3RR7A 3HPOA 2PFOA 1BIZA 4FLXA 3VQEA 2PZSA 3SQ2A 3EYZA 2A1SA 1XO1A 3OS1A 3TWHA 3KHLA 2HNYA 2WONA 4CCHA 4W5OA 1HMVA 2Y1JA 5J2HA 4IBNA 1S97A 4KHYA 3AUOA 9ICVA 5I42A 1ZQZA 3JPQA 4CGFA 3A2FA 1TV6A 3N97B 7ICUA 3H8JA 9ICEA 2PI4A 5L9XA 2BE2A 1RT2A 4DSEA 8ICOA 3MFHA 1J5OA 4TQSA 3ZSQA 1ASUA 1ZBUA 4M9NA 1WAFA 4F50A 2ZTDA 1X2IA 1S0OA 3ZDBA 9ICNA 2AGOA 3HL8A 3BGRA 2MAXA 5J0YA 3V9ZA 3H7IA 1NJYA 3AA4A 4XIUA 4ELVA 1TKTA 1KRPA 2ZD1A 4RU9A 3TR8A 2FBTA 4ED0A 1U48A 4E3SA 2FLLA 2PFNA 3AVAA 3S9HA 2YNGA 4CK1A 4J9KA 1VSJA 3OYMA 3NGIA 3JPPA 3RRGA 9ICCA 4E7IA 1C7YA 4M3RA 3QLHA 4DL5A 4Q8EA 4NLGA 4IG0A 9ICLA 4EBDA 8ICNA 4OGEA 5DG7A 1QLNA 5KT6A 3K4GA 1I39A 2FPMA 3OVNA 2GBZA 4OKJA 1RBUA 2KN7A 3C5GA 4CFAA 4CGDA 1QS4A 2OZSA 4UAWA 1T8EA 1ZQCA 3RJJA 4RG8A 2OPRA 1RZTA 3DLEA 1UWBA 5IINA 2ASDA 1UOCA 3GDXA 4FCYA 1NJWA 5C5JA 5EU7A 4CHZA 1HYSA 3AVLA 4FK0A 4B9VA 4KLOA 4KI4A 4YD1A 2OA8A 4I7FA 4M9LA 3RB0A 1HJPA 1T4GA 4O0IA 1ASVA 4FS1A 1R0AA 3FDSA 4JV1A 3L2RA 3PNCA 4LSLA 4Z4EA 4CJ5A 3ULDA 3VQDA 1NK7A 4KRFA 1QHTA 4TSXA 3MXIA 3SV4A 3QEPA 2IOCA 1T3NA 1RPLA 2AJQA 3LAMA 4M9GA 1SL2A 2XRIA 1LAWA 4B9TA 4M0AA 3JSMA 5J0RA 4KLHA 4IDKA 4O0JA 2R8KA 2Z1IA 4DTSA 1JLCA 5DMRA 1S0VA 3C2MA 1ZQXA 2ATQA 4KLJA 4CJVA 3CG7A 1S1XA 3S3MA 2BPGA 3QEWA 2H5XA 4E7LA 3DYAA 4KTZA 4DL6A 1ZETA 1TK0A 1EX4A 1XC9A 1HRHA 1Z25A 1TL1A 3KKRA 4R5PA 3RTVA 5DGBA 4BE1A 4RNOA 2HHWA 4DTPA 2P6UA 1L3VA 3Q8PB 4FZZA 2NRXA 4J9LA 3MR3A 4GC7A 3KKSA 1S9EA 4CF1A 5KFHA 4EEYA 3P5JA 4O5BA 4J2AA 1LWEA 2R8HA 2F8TA 1RDAA 3TAPA 3KLFA 3OSNA 1Y97A 3DMJA 4IFVA 3TANA 3C95A 1J53A 4I2PA 3JYTA 3PX4A 5KFOA 4RW8A 7ICNA 2AGQA 7ICIA 1NOZA 1C0TA 3DI6A 3G6VA 3HX0A 4FJGA 2WTFA 2XY8A 1YTUA 2A1JA 4TURA 2B21A 4F2SA 1RDDA 9ICJA 1NOYA 4PGXA 4PPXA 1ZQPA 3V1OA 4QZFA 4O3OA 2JEFA 3UXPA 1IM4A 3S3OA 2NUBA 3RH5A 2I9GA 2HVIA 2YNFA 3AVKA 4B8AB 4UAZA 4YNQA 1GOAA 5EWFA 4ZTFA 2KZZA 4H8KA 4QAGA 2XO7A 1ZQSA 3PW0A 2W9AA 1ZQFA 3HJFA 5HRPA 1ZQVA 3AO2A 5BPCA 5KFPA 5KT5A 4NM1A 1TL3A 5HLFA 3HM9A 4HYKA 3V9SA 4KLLA 4DF4A 1VRTA 3KK2A 3NDKA 3EPGA 3GIKA 2JZBA 1JLQA 4F3OA 5EOZA 4N47A 2F1IA 3RB4A 4DQIA 3KLEA 4LZGA 2JEJA 4KAZA 2VWJA 2HB5A 2E6MA 4JV2A 1QSLA 4IQVA 1BISA 4RQ2A 4ZH4A 1U47A 9ICHA 3C21A 2VANA 5DQHA 4UB3A 1A5VA 4BWMA 2FBYA 1B9DA 3O3FA 3I8DA 3RMDA 1ZJMA 7ICHA 3NGZA 1J54A 3CM5A 4E1NA 4M3YA 4OJRA 8ICIA 3VQBA 3AVMA 5KFRA 5J2EA 3SQ4A 5KG5A 4YR2A 4UAYA 9ICUA 3ZSXA 1TKDA 1UA0A 4PUOA 5KT2A 3O3HA 4I2IA 4HUFA 2IS3A 1NK9A 2JEIA 1TKXA 9ICAA 3KTQA 3RRHA 3NCIA 5KG1A 3PUFA 1X9SA 3C2LA 1ZQRA 3V1QA 2MUTB 4EP5A 4CJQA 4JRQA 2VG7A 4TUPA 2ZUDA 1DOQA 4QWAA 3HYFA 3HWTA 4LSNA 1YT3A 2X74A 1ZQMA 5C25A 4E19A 1LW2A 4Z4FA 4FJ9A 1EXNA 3ORYA 4DTMA 2QKKA
chains in the Genus database with same CATH superfamily
4RQ6A 4GV3A 3KJVA 4LSZB 2P66A 1NK0A 2IBOA 1O6XA 5E0OA 3SCLE 3ZDDA 2UV8G 4ED7A 1Y88A 1KNZA 1S0NA 4PY5A 4WP8A 2Q4TA 1RUSA 3TWZA 2DGVA 3A5MC 3VGVA 3M9MB 1BPDA 3C1ZA 3H20A 2B5JA 2LM1A 4L8RB 4PHAA 4ILGB 1B4SA 1Z26A 3J80O 4K2JA 2UXCJ 4FN5A 1ZBLA 1KLMB 2YPZA 2HHUA 7ICMA 2NXEA 4F72A 4ED8A 4Y0WA 1JB0C 5B0FA 2ZGYA 4CHPA 1K73T 2ZGZA 2Z2ZA 3KFUF 3ZSOA 1DZ5A 1KEJA 2FVCA 4WXOA 5AQGA 1BPEA 3WUHA 2NO4A 3GG0A 2KJ5A 3M2VA 5AZIB 1FXXA 2CIMA 5KGXA 5DETA 5AKYA 1PIEA 1C0FA 4X4RA 3H3OB 2YQ0A 4B3TK 4F3QA 5E3QA 2K60A 4CJWA 5G4DA 3WKEA 3AO1A 2ZKTA 4JBCA 2J4RA 4MFBA 3BQ2A 3U1MA 4KPYA 2CPJA 3UDLA 2NRVA 1CUKA 1A76A 2H54B 3ZXWA 3GV7B 2L9NA 5E41A 1CBKA 2A40A 5F8JA 4I7FB 3P3DA 4H0VB 8ATCB 4ZA1A 2Y8YA 1RDCA 1H2VZ 2AMCB 1HBUA 1QZ5A 2XLKA 3C94A 4OVLA 4DSKA 2F9TA 5IQ6A 2VGNA 2VICA 5AKGA 1IV0A 3T1YJ 4RUBA 4DS5A 2XY6A 4AD6A 2E29A 5I3UB 3FUYA 4K4SA 2HVHA 1FJ7A 1MW7A 3PY8A 2LEPA 1NK4A 5A8KB 4TY8A 4XQ8A 4F02A 3KLGA 1Y00A 1FCAA 4YY3K 3E1YA 4JD2B 4FP9A 3TTFA 1D9FA 1RBSA 4JI4K 4QPXA 2DH9A 3LDLA 3IWNC 4OLPA 5D15A 1VS3A 2G1HA 9ICSA 4ICLA 2IM1A 1SL1A 1NKBA 2V6AA 3Q0AA 3WEEB 2FIUA 2L9DA 3CCVS 1OPZA 1HR0J 4B9QA 2CJBA 2QFJA 3CC7N 3KUHA 1GXTA 3BREA 3CI5A 2V8HA 3RJGA 2ZUCA 4OYBA 2F4VJ 4ZVUB 2P9PA 3LA0A 5MAOA 4CTAB 3VAIA 2E1CA 2Q6CA 1UFLA 1SZ2A 2NRWA 1FKPB 8ICFA 3OBIA 3O3GA 1S76D 1UPHA 5AKZA 4IQMA 4F3TA 2W2QP 4GKKF 3VWSA 4KTQA 3T7ZA 4CWBA 1FD8A 1V5VA 3J7YP 3HHDA 3CP8A 2B9WA 3O8MA 4YQWA 4DV6F 2UXBK 2VA8A 1FXLA 1HNIA 2ASLA 3VVUA 5DM6Q 4GO7X 2KXHA 1XNRF 4CD3A 2NZCA 2PFPA 5DBCA 2NREA 5ADXA 4H5VA 4IG3A 3KJNB 1FXRA 2A0FB 3DU6A 2HNZA 2PT0A 2C2DA 2HHHF 3IWXA 3T6BA 2PMZC 4H5RA 2DNKA 1G6BA 3MPVA 2EWSA 3P4IA 2FGOA 4HDGA 3HX9A 5I9EB 3O0FA 3VEXA 1SKRA 3C5FA 3BDPA 2KYXA 1S10A 1UQVA 3PSFA 1VCTA 4K4IA 5DB8A 4X65K 5KFJA 4WYBA 3K2PA 3I96A 1BUPA 4A5AA 2OMOA 3OHRA 1IXRA 4ALZA 4EEKA 4P74A 5L39A 2HBQB 3EN9A 9ICIA 3J7Z5 1JALA 1WSGA 3MEEA 2XNRA 4HL9A 2DR5A 2B6AA 4A57A 2JL9A 2MDAA 2V7YA 4RUAA 1BI4A 3P5TL 1Q7YO 3OVAA 1BA1A 2WFBA 3SUPA 2YTUA 3CCVN 3ULEB 3MR5A 4Y34A 2HWIA 3CMEN 3HI9A 4ZN3A 3RFAA 2DY9A 4O9MA 3TARA 4ISEA 3NBPB 3D7SB 2KG0A 4KGZB 3K0SA 1FTRA 1W2IA 4B1UB 2GO8A 3M8PB 5KT3A 2ZM6J 4K41A 1O8BA 2RMLA 4ZKAA 3T5LA 2VBZA 1ZQLA 1S79A 4F4XA 1T05B 4FYVB 5GTIU 2N7CA 1HFEL 1OSCA 1Q3UA 4IG3B 3H8WA 4K0KJ 2OCEA 3LPYA 2M2BA 1GLBG 3UE2A 4UOHA 3F9MA 4PHEA 5HMWA 3SDEB 3V4MA 5E79U 3W2WB 2GIFA 4KJIA 5DB9A 3W65A 4DSFA 5B0DA 3CC2N 3BS5B 3CJ2A 2YNIA 5ALFA 3I5BA 3S3NA 4DBQA 5JXSA 4C1NI 1W2BR 1WN7A 3OYKA 5GAHP 1SWVA 3AJDA 5BREA 2G9OA 2DFFA 4YOXA 4M3WA 3T5KA 1HPMA 2RHSB 4PCQA 3MM5B 2RHKA 3FZKA 2KFZA 3ISBA 2E9RX 4OZ5A 3Q8VA 1VHXA 2VBYA 1MMDA 1CJUB 4GY2B 2QA1A 1NHKL 3BZCA 4FZNA 2ZH7A 2MZJA 4H0YB 4CF2A 4C8KA 4U67Q 4UY8T 1U2VA 3BYPA 1IQZA 3GE9A 3HT0A 1F3FA 1GLCG 4NLQA 2HSZA 3C16B 1H6KX 1RDRA 1Z1ZA 3KWGA 2NXNA 3MM6B 1QQMA 4I2GA 3AO5A 3RSEB 4RW7B 5AKXA 4JI5K 4A59A 5HBMA 3IP0A 5KFSA 3AQPA 3H6EA 1A0OB 1PVPA 4Z4CA 1T6CA 3K5OA 2Y1RI 2GFFA 2XMTA 4IKFA 1RCOB 2VG6A 4Y2QA 2VC1A 3KHGA 1XQSC 3PFOA 1EKRA 3FFIB 5KRTA 4QW9A 1NZAA 1C4CA 3NH2A 2B4UA 3D66A 1RWVB 1HIWA 2H3EB 5AQKA 1NSPA 4NA3A 4MLHA 4YOUA 2FC8A 4JK7A 1QAYA 3SEOA 2F9WA 3NAHA 3BJYA 4EK2A 1SQFA 3VALA 4PAAA 3NF6A 1CS4A 4PHPA 2QWMA 5CQGA 3DKDA 4E2FB 2ZVSA 1LNQA 2H5EA 3QU7A 4WU3A 1ZH5A 3V6JA 4RW8B 3QNNA 3BZKA 2PA3A 4ZVFA 1FKOA 2KG5A 2MQ8A 4RQ0A 3RJMB 3W63A 2XCAA 2RAQA 1YHQS 3CCJS 1K44A 4JI8F 1PO6A 4F36A 1FKOB 3ASMA 2VFSA 4GNIA 4YN4A 3ZX0A 1Q9YA 4PYAA 1NZBA 3TSQA 1OY6A 3KZXA 2F96A 2IDLA 1D8YA 4B3OB 4DUZF 1T9YA 2EPIA 3C2PA 3OV7A 3OHAA 9ICWA 2LXUA 2YH1A 3C2KA 2RF2A 2BE7D 4O4RA 4QWEA 3B8HA 1R6VA 3N4MB 2GQQA 5D6GA 2F1FA 5AQSA 1IKWA 5ALJA 1RYRA 2QK9A 2OGUA 3DLEB 2KHQA 1P1TA 4AHSA 3QBXA 1JLBB 4IQUA 2AEMA 3CJKA 3CCTA 3ILJA 4KR0B 3CQYA 4QYRA 3CERA 4IH5A 4NLXA 1H2TZ 1HI1A 2RS8A 2ZWPA 4NEYA 2Z30B 1TK8A 4JWNA 2ZJPQ 1DARA 3S8SA 5LSOA 1WBDA 4QS7A 4FK4A 3W1YC 4FLVA 1C20A 4RW7A 4DPWA 1CZ9A 2G4BA 1FO1A 1JIHA 1NPRA 2XGQA 2HVDA 5ALMA 3SENA 3UMGA 1BHLA 5C0YA 4N41A 4P73A 4X4PA 3SZ2A 4DV3J 2IYIA 3W9JA 3OFGA 2QTWA 4DJBA 2LDYA 2GEMA 2HLTA 2QM1A 1W9HA 1WD6A 2OI2A 2J6UA 3DRYA 4Z7CA 4F04B 4ETZA 2BRKA 3KJVB 1M6YA 1TVRA 2WHOA 2UVRA 5H9EK 2CG8A 7ICOA 4M45A 1N5XA 4XDDA 4UY85 2ZHBA 2BGGA 4IRKA 2YKAA 5I3UA 2JWNA 5ALKA 2HF4A 4QZ9A 5HP4A 2CDQA 1KL9A 2B6AB 2E7WA 4B3TJ 2K89A 2HK3A 4CBXA 4BDYA 3JQKA 2X1AA 5U47A 4TNOA 2MQMA 5JICA 4OI1A 4KO0A 5EDWA 2W2NP 3IA0A 2K2PA 5GAHI 2HBZB 3ILIA 1WSEA 4DV5J 2RDDA 3SYZA 3KKAC 4GKJF 4P2XA 2V4QA 5IQQA 5AQIA 1C1BA 2QKBA 3AO4A 3IRXA 3UWTA 2KB2A 2RRDA 5M2RA 1BGXT 4CLKA 1RM6C 3RJKA 1MDUB 4DU4A 3A5LC 4R8UA 2ZTEA 4K4ZA 2OEMA 1ZQGA 3L8BA 4I28A 5CR4A 2ZIVB 3JPOA 1S6QA 4GVLA 3DOMB 1UAWA 1SZHA 1U6FA 4XK8C 3B4DA 4HTIA 3GBTA 2V2KA 1S4FA 5KTQA 5IIIA 4L72B 1URNA 3OYIA 1S5JA 1B7YB 1X4CA 1YX2A 4FLWA 1HKCA 3UR0A 4WK1A 4OYZA 3UI3A 1X4EA 4J9PA 3DC2A 5IM0A 2BJDA 3M7VA 1VQ4S 1YHQN 4NMXA 2RPIA 2G08A 9ICRA 4X64K 3HJEA 3AAQA 2JHEA 3SLCA 3DM2B 5DM6L 4CF9A 4NM2A 7ICJA 3H5UA 2DRAA 2QLTA 3TAGA 2BX6A 1G3OA 3NOGA 2GHVC 3SQOP 1JLAA 5GADU 2IPOB 3AM9A 1U6BA 4OPJA 1ZQUA 1RT6A 3AA2A 2RIJA 2KIVA 2EAPA 4TU9A 2WMMA 3ZDEA 3CFOA 3L4IA 3QT5A 5E3AA 3BY5A 5EOYA 1VQPS 1QH9A 1XNRJ 2HBRB 4B3RJ 4LFAF 3AXKA 5HHHA 3AAWB 1NLVA 1YGYA 2XI3A 1K9MT 3LF0A 3O1BA 2HHSA 2VYPA 2D6FC 4WZMA 1YTAA 1N34F 4DFJA 3AVGA 4PGYA 4B1YB 3H0RB 1S8OA 4P7TA 2L48A 1R7IA 3G82A 3C6HA 3KZBA 3D6JA 3M6XA 4FJJA 2FMQA 1ZAWA 2FE9A 5CRXA 2CFXA 1W7AA 2HI0A 2GGPA 1WF1A 2RLTA 2HOFA 1DTTB 3V2UC 3WKBA 3Q89A 1Z19A 1WEYA 1CJKA 1J27A 4RTFD 3CNHA 2FJAB 2IBKA 4P71A 4MJKA 4CFDA 2Q6BA 1WSRA 1EX8A 2FY8A 4PG5A 3ZDAA 1XS9D 3ZTOA 5C24A 3THWB 2ZUAA 4HT5A 4U95A 1XNQJ 2G2YA 1NRKA 5J2NA 2DY4A 3BS7A 5EE9A 3MXJA 1ZQWA 2F77X 4KV8B 4DR1F 5KFXA 4K4WA 3RAXA 5CAAA 2CJKA 4LVSA 3GONA 4HHJA 4RPFA 1NGAA 1I3OB 2GV9A 1X4FA 2IFXA 2MQLA 4AFFA 2CQGA 3GU3A 2G06A 2EG1A 4UAVA 4FZLA 4BC2A 3JSRA 4KHNA 4YDUC 2Z2YB 1U0SA 1XMQJ 4TYAA 1AUSL 4LF2A 1SAZA 1BQNB 2VU5A 3J81U 1FDBA 1RBTA 2ZJQQ 3AVIA 3M8QA 4DUYF 1JL1A 2MJUA 4P4PA 3CIZA 1R0BG 4DUYK 4OLBA 4ED1A 2WW4A 3MCOA 4M5IA 4OV1A 2XB2D 4LF8J 5J2JA 2CNKB 4CFCA 3QIPB 1R43A 4KLUA 1CULB 3EVOA 1OY8A 2DIVA 2NSBA 3R27A 3NL0A 2MKCA 3H3NO 3SJHA 4Y2MA 3MECA 1ZQHA 3ISCA 2VFUA 2IYGA 2Y0SD 1SS6A 3VGMA 1KHWA 1GAOA 1YI2S 2MXYA 1BPXA 4PUOB 2F3NA 1M1KT 4DQ8A 4DU1A 3HW8A 3QFUA 5BOMA 3PIPL 3GYXB 5KFYA 2ZG6A 3OXFA 5CYQB 5AQHA 3CJ7A 4JI0K 1YRXA 5SUHA 1MQ3A 4KLSA 5BJRA 4PYDA 4DOCA 4F0HA 4UW2A 3ZZOA 1ZAVA 4RBTA 1YUWA 4N76A 2R7QA 3AQFA 5GAGU 3L2WA 4KMUA 3DLRA 4FNIA 2CWXA 3ITHB 1BD6A 4K7QA 1X8DA 2PA8D 4CYUB 4JUZA 2E1MC 3CJTA 4FE3A 1Z2ZA 5LMNK 4Y1DA 3M6UA 4RQ1A 2I38A 2X3GA 4O3SA 4Y6IA 2ACYA 3FLCO 5T7BA 3KLFB 1QQNA 1L3UA 5HANA 3QYPA 3ITHA 2BH1A 4F92B 1UWAA 2ROGA 4KHPF 2ZM6K 3DCAA 3D1QA 3KG1A 3G6XA 4NXZA 3OS0A 4DV4K 5AK3A 3HVRA 4I2JA 2V67A 1FFVA 5J1EB 4I6MB 2B9YA 2IRYA 3IS9B 1NGCA 2WVCA 4M6WA 1WUAA 4AH9A 1XI1A 3FKBA 2D3ZA 2WB1F 3EW9A 4RW6A 1N2XA 9ICMA 2B8QA 4PWWA 2KP7A 2CRXA 3BO3A 3N7SC 2RQKA 4C0OC 4QZAA 1L7OA 4PXCA 1NKEA 2HHQA 5BR9A 1SV5A 4ECTA 5J2IA 2JDJA 2Z1HA 4BRQA 4UB4A 4EU0A 2WF7A 3C6TA 4O3QA 4BRDA 1I1GA 4J2BA 1JMTA 4UB1A 1XU4A 1F9HA 1HW9A 3GSDA 5THWA 4JI5J 2MEWA 3OA9A 7ICSA 1OSDA 2JZBB 1KQQA 4KB1A 3QAUA 3KK2B 2YJFA 1FX2A 3EWAA 2C3OA 1Q8IA 3QIOA 3KHRA 3QFPA 3P96A 2VONA 2JHDA 1JXBA 1C2PA 2ZHAA 5HN0A 4KHUA 1H98A 4NLWA 1RKIA 2Q1NA 5CZ1A 4HWIA 5EX0A 1XR5A 2X1GA 2E5IA 1RLDA 3GMGA 2YX1A 4MDBA 3W0LA 2CQ4A 3OVBA 1NPPA 2QWRA 4OHVA 1DJ0A 2M88A 5GAGI 2HPUA 1E4GT 3OYCA 2XSFA 2HDOA 1U4BA 3O3LA 2ZVIA 4BE2A 1X31C 1NSKL 4AYBC 1D3WA 2VQEJ 2OSQA 4PRFA 4FYDA 2H5IB 3G6EN 4GV6A 1EQYA 5BRHA 4USMA 1Y10A 4C0BA 3EY1A 2A10A 3T41A 1WF2A 1X4BA 5JUMA 1HKBA 4M3XA 2JLGA 1CPZA 4JMUA 2CQ1A 2GA7A 1HA1A 3J7AP 3VQ6A 1G99A 3AVBA 5ALQA 2XIDA 3BGOP 2G2ZA 4UBBA 5HVHA 5T7LA 2KD1A 4MF8A 2ZUGA 4RL1A 2XMAA 4CGJA 2IJRA 4ZPTR 3CCMS 3HD1A 2EFQA 2NRZA 4FLYA 4CH1A 1RT7B 4X62F 3T69A 1MWKA 1P8ZA 5A6PA 4CIOA 4ZJQA 2B4OA 4DG1A 2AGPA 1V3ZA 3G8QA 5BN8A 2B0GA 2IGIA 3R5AA 2QWQA 4NWBA 4P7VA 4CO5A 5D78A 2P35A 3VAGA 2OTJS 4OZ3A 4EFAC 2ZOMA 2IM3A 4DR3K 4P0QB 2IA0A 1V6HA 5IOLA 4LF4J 7ICLA 3VGSA 3TPQA 2YHWA 3B0YA 1COOA 4ZHRB 1VQON 2C2RA 2V8DA 1X4DA 2QYCA 2M8DB 1ZQAA 4WTOB 1HHTP 3PMNA 4NCGA 2FMPA 4CIEA 4FWRA 2CGKA 3RJIA 3UKRA 4K42A 4NX9A 1SJFA 4HI1A 1H7WA 4JI6K 1R8PA 2DNLA 1K0VA 3N4WA 4MLEA 1T7PA 4MKVA 2VHGA 3THYB 1QCKA 3MMJA 4IRCA 5DLGA 3RJFA 3BR8A 7ICRA 2ZIWB 3M1VA 4XTTA 3R6GB 3AAPA 2GX9A 4ECVA 2J9DE 4NY8A 1PC4A 2ZIUB 2VFTA 4IQXA 5EVZA 4M63C 2B4PA 5HMLA 2XZWA 3PX6A 3W8GA 5KFUA 5M1QA 2J76E 1V3RA 4DPXA 3R6MA 4DV3K 1VBXA 4Q2MA 3PTWA 3D45A 3KD5E 3HO1A 3DNCA 4ECXA 4L76A 1SC1B 1KQFB 4CZIA 1ZQOA 4CIFA 3ZSZA 3CMQA 1PBAA 4PHDA 4O23A 4KSEB 2WAQD 3BN4A 3BGUA 5IT9Y 1TMJA 2ZE2A 3R7SB 5HHIA 3EZ5A 3A0IX 4LQ9A 1IBKJ 4JI3K 3CCES 3SI8A 1OQ3A 2RRNA 3OBWA 2KM8C 2DKXA 9ATCB 3B82A 3DXSX 3PG9A 1TAQA 4JI2F 3M5RA 2Y9HA 2QARB 5TZVA 1U2RA 4CH0S 3KK3B 1KP6A 3K5NA 2NR0A 1KC8O 3HVAA 4OHYA 3MOZA 1GFWB 1F1BB 2GQCA 3CCWA 4K8ZA 3OTOK 3P38A 4OLAA 4USIA 4WIQA 1P7DA 4ZP9A 4DV7K 4Y2AA 3UFCX 4CJ7A 3QNOA 3UPQA 4FVMA 1FI4A 1NNDA 3I33A 2OMLA 1XQIA 3L2UA 1DGSA 5AQUA 4WWSA 4YB7A 2VJVA 4LFBK 4C4SA 1IKYB 3VF6A 4CJKA 3V9XA 4AHRA 3RJHA 3BS9A 3NOCA 4ILHA 1JJ4A 1EP4B 5HL7Q 3WKAA 4EX6A 4FZXC 3HP6A 3HHLC 5KPTA 3POTA 2YN4A 2KT5A 2YHXA 2A1JB 2U1AA 1N5WA 3UQ0A 4UAUA 2Y9UA 5KFKA 4ISFA 1GMVA 3PJXA 3IN5A 5FPDA 4QIWC 2VA3A 4W5QA 2FJWA 1Y11A 2WZ1A 4PL7A 1HPZB 4O5FA 2O4IA 1UL3A 3SJJA 1JLEB 1PZNA 4DL2A 2MYFA 1WKKA 4M3TA 3IFEA 3T1AA 3TR5A 6FD1A 3AOCA 3CJ8A 2R9LA 4BACA 1N33K 4OZ1A 5AFUA 2QB1A 1AFIA 4C80A 3WEEA 4P9SA 3H1VX 4OKEA 1S1WA 2UUAF 1ZYQA 3BR9A 3E66A 3TADC 1O5JA 2QJ3A 4BS2A 1MSWD 2BE2B 5B66U 1FRXA 1ZRNA 3GV8B 1G2EA 3ICXA 4A8QA 3HHLD 1A6LA 5J0PA 1JQGA 2W9BB 4U67L 1NJIO 1FRJA 3DXBA 2FJBB 1CJTB 1RQNA 2ZH1A 5J0TA 2P9UB 2BKPA 2OH2A 4H4KA 1IVZA 1MN7A 3Q2SC 2EKNA 2ADCA 4KREA 4IOBA 1SVDA 4O4GA 3OFHA 2E8MA 2R7YA 2RP5A 2BJEA 3NRZA 3TTCA 1QVGM 4V19X 4A62A 4FVUA 1VBYA 2C22A 1NGBA 2KK0A 4NYNA 4CHOA 4OYWA 3A8EA 2ODGA 4QIWD 1VSEA 4I67A 3NGRA 1T0TV 3RR7A 3SMPA 3J7A1 1BIZA 2NYVA 3M4XA 3H8YA 3EYZA 4DXLA 2A1SA 4BR0A 1XO1A 2RJZA 3OS1A 4MFBB 2V69A 3TWHA 1W25A 4BRNA 4ACOA 2HNYA 4Y2JA 3MUTP 2WW8A 1RBAA 2DNZA 3AUOA 9ICVA 1ZQZA 3JPQA 2F3JA 3A2FA 1NMEB 3N97B 1YJWN 1RDFA 3H8JA 1M1HA 3W2WA 2LHTA 4R5PB 5L9XA 2K06A 4K5SA 4DSEA 1VHFA 3MFHA 2KJ8A 3QX7A 3R1XA 3OL8A 4QPTA 1AFJA 2HBMA 1ASUA 1ZBUA 3WT0A 1OO0B 4A48A 1P9YA 1X2IA 3BQ7A 3GZFA 2M0NA 4P52A 1IBKF 1K8KB 5ETOA 1FFGB 4C3KA 5JLFA 3O6WA 5LMUK 1RAOA 1GLLO 4ELVA 2BJ1A 4RU9A 3VQSA 1U09A 3VCBA 4E3SA 2FLLA 5DZ7A 1TKZB 3PZPA 2YNGA 1F60B 3HSDA 1VSJA 3NGIA 1C0TB 1ZM9A 5CH7B 9ICCA 5ADXH 1SV0C 3R1HA 1VMBA 3F5EA 4CLPA 4TU7A 1TL3B 4IS7A 1P9QC 3CDEA 3E9LA 4V1Ak 5KAKA 4CZJA 4RR5A 4OGEA 1EKSA 2WVDA 1NB7A 3OVNA 2FD2A 2YBVA 3ENVA 3B78A 2E5SA 4CFAA 1VLYA 2OZSA 1ZQCA 3H42A 2DNPA 2YNFB 2ZKUA 1M1KO 3S7RA 5IINA 1UOCA 4FCYA 3NGUA 3BO4A 1C0UB 3KKAA 4CHZA 3WK9A 5ALVA 2WOMB 2CKWA 4FK0A 1CJUA 4RNFA 4DR4K 1XIQA 2XVTA 4KI4A 5JVGL 3PM9A 2MA1A 2M4MA 1W7WA 1OIAA 2JVRA 4FOEA 2E1FA 4M9LA 2ABYA 4Y2XA 1SI9A 3RB0A 4WBFA 1HJPA 2A3VA 1T4GA 4O0IA 4FS1A 2HVEA 1T03B 4Y2UA 4LSLA 4O0NA 3TSUA 3R8EA 3ULDA 3AL0B 3BEXA 3VQDA 3QWPA 5ETKA 4DR7F 1HNIB 3MXIA 2FSJA 1T3NA 2XEXA 2WBMA 3W2VB 2W55A 4F0KA 4BRCA 2F8KA 4US9A 3QDKA 4M9GA 1OH7A 2UXDJ 2GJIA 4KLHA 1RWWB 2Z1IA 2DEIA 2O8FB 4MH8A 5DMRA 2ATQA 1RAAB 1D1UA 4B3SF 1Y3KA 3S3MA 1HNZK 3M2RB 4E7LA 1YJVA 1X60A 1W2BM 1M0SA 5HQLA 1ZETA 3BSNA 4CD1A 4BC5A 1EX4A 3T1HJ 3TZYA 4BE1A 2NSCA 2PD1A 3AD9C 3KLHB 3T1HF 3UCUP 2PIIA 2HZVA 3G87A 1R89A 3P45B 3MXHP 4RKUC 4FZZA 1GLAG 3ATVA 1UJ4A 2IIHA 2RB7A 5AI6A 1RTHB 3QUQA 1U24A 4EEYA 1RTIB 1WELA 3P5JA 4O5BA 1LWEA 2F8TA 4OHXA 3TAPA 4HEA9 1XNQK 1Y97A 4RWTA 2HFSA 3D9BA 3JS6A 4WP9A 3PX4A 5KFOA 4LBIA 2AGQA 1F2GA 2UXDK 5B0AA 3G6VA 4USVA 4YOEA 3QU4A 3SD7A 2WTFA 1WNEA 2OPQB 3PHTA 4X65F 3FGVA 2RVJA 3QRRA 2NRHA 1HHQA 2E1AA 2HFNA 4ZS6A 4NCGB 2DWQA 4TY9A 2VFVA 1RDDA 3L7PA 4PGXA 2CPEA 3KOOA 1RU2A 3Q7BA 3BO2A 1IM4A 3K8VA 2NUBA 3A5NC 3W62A 3RH5A 3NCQA 4JHDA 5M1FA 4TYBA 3AVKA 4B8AB 1T95A 1WC4A 4LF8K 2LA6A 5EWFA 4Z2XA 2KZZA 1HWKA 4H8KA 5AM0A 2HFUA 4NRUA 1FJGK 1ZA2B 2Q31A 5HRPA 5KFPA 1PJ5A 4IOCQ 4NM1A 5HLFA 4P2FA 4KLLA 4CO1A 4MAKA 4IUFA 3B9JA 2ZC4A 1HI0P 1RE1B 1JCEA 4WF9L 2F1IA 3BKFA 2YMQA 4LZGA 4URSA 1TFYA 2EC2A 2HB5A 2E6MA 3VENA 4RW4B 1ZA1B 2B4VA 2Y1LB 4BQZA 4RQ2A 3T79A 4A8KA 4FWOA 3CCLS 3HJVA 3RMDA 1GH8A 3AVMA 2L5YA 3EX7B 4UAYA 2BW7A 3HILA 1TKDA 2HIQA 4PUOA 1X40A 5KT2A 3O3HA 1NSAA 2N82B 2IS3A 4AL5A 3SAHA 2JEIA 9ICAA 3C0BA 1LW2B 2F9JA 2QZ8A 2G09A 2B51A 1VQ5S 2XM3A 4EP5A 2VPXB 3OQ2A 1WI8A 1R6YA 1Q0NA 3QUCA 4LSNA 2PMWA 4GKKK 1YT3A 1G4CA 1VR6A 5JMVA 1QDUB 2EZZA 1WC3A 4ZLJA 4E19A 2W6KA 1VQ8S 2YPYA 1LKYA 2V8VA 4DCJB 4NLVA 9ICTA 3A0BU 1KAYA 2D3DA 4DUTA 3O08A 1VDHA 1RISA 4J2DA 1HMVB 2A1BA 1F3VA 3VQCA 4DV6K 1S6QB 1W26A 5JLHA 2KICA 4BG8A 5J2DA 1QE1B 3I5CA 1YRTA 4P0QA 1SXDA 4NXNJ 1WWHA 1NO8A 4KHSA 1RU1A 4GO5X 2BCUA 5DLFA 1VHIA 3L4BC 5D46A 1TK5A 2J6SA 4C4RA 4Z37A 4QWCA 5KFQA 1Q7YT 2KO1A 1GQEA 4CJ4A 2LMIA 9ICPA 3OYNA 4CVNE 2R7SA 1KAXA 3HZ6A 1BO5O 3D1OA 2BJ9A 1ZD5A 5H2FU 4A8SA 2GUPA 4ECUA 2NZTA 2CQIA 2DH8A 2XO6A 1XMOJ 3LUYA 4QIEA 4XA5A 4URQU 5B0GA 4P75A 1QTMA 3OYGA 3UXOA 1RXOB 2O5DA 2ZIVA 4WE1A 1H38A 2GWSA 3L09A 4GMJB 2EHGA 3VERA 2MSTA 4B02A 2DO0A 1KR4A 4ZLLA 3D5MA 4B17A 3VMFB 4PG7A 2HQCA 2RE2A 3PEHA 4J5OA 3ENWA 3MM8B 1SGGA 2E8PA 3MDCA 4DV1K 1RAHB 4KGMA 2A19A 3OTQA 2C2KB 2XMJA 2FVPA 8ICQA 2G8FA 2JRSA 1RHUB 2YKMA 1EKEA 1GNKA 4QZBA 5C42B 4JI1K 2PY5A 2LXFA 4CM0A 4ISGA 5DB7A 4JAXA 2FB0A 2DVIA 3ZT2A 1U1NA 3CF5Q 3NBPA 4RQNA 2V34A 2HNDB 2ZH9A 4P6QA 3AMZA 2N7YA 3WC0A 1SIJA 2ZDPA 2VQEK 3MF5A 3MCPA 2VG5A 2ZJAA 4QS9A 2BACA 1FERA 4Y2VA 4MHVA 4FYWB 3H25A 5LJVA 1Z1BA 4C3MA 2ITGA 2UUBF 4J9VA 1JL2A 1HARA 3UVJA 4AM7A 2E2PA 3Q8MA 3FM9A 4BR7A 4ZVSB 2C1EB 2HNYB 4NRTA 4GKJJ 4NXMF 4LC9B 5CB1A 1QQ5A 2LQ8A 4BG9A 2OM6A 1L7NA 2G2OA 3I56N 3SV3A 2CGLA 5AQZA 2LM4A 2AH5A 4U7UK 2A6OA 1MWQA 4EIAA 2DB1A 1KBRA 1HWJA 3GCXP 3R5JB 4YB5A 4JI0F 5BR8J 1E6YA 4PPZA 5HNKA 2QC3A 2K3IA 5IT9O 3OTOJ 1LOTB 3NVKA 3IRUA 5GAGP 2KFNA 1BQNA 3BQ0A 3VHQA 2QLJB 1J5EJ 1RB0A 4MEXA 1Q1KA 4X4UA 2ZWOA 2LI6A 4OI2A 2VA2A 3EO3A 3UQ2A 4KITB 5E26A 2FHMA 2BANB 1KFDA 8ICPA 3MX2A 1VSLA 2PDAA 2R7WA 4A8MP 2MLYA 4JWMA 3VQPA 2H65B 4JI2J 1B22A 3NTUA 4KTWA 5HR7A 1Q5YA 2LBOA 5DRKA 4US8A 1AXQA 4NZ7A 3OLAA 2K7KA 3JXUA 2XY7A 4Z6CA 2QRRA 2WFAA 3SIPB 2IRXA 4R63A 2WF9A 4U9RA 1ZQQA 2YWWA 4HDHA 4ILRA 4OHWA 4WE1B 1Q16B 3MN6A 1HQEA 3IM1A 3KJFB 2LQJA 1U1LA 1H72C 1JCGA 4EP4A 2QN6B 4FJ7A 3CDAA 3BF3A 4C8MA 2WVBA 5A8WB 3RH4A 2BZ2A 3KWMA 1RYSA 3OYEA 3N01A 2VIHA 4WFYA 5J2QA 2HYIB 3OYFA 4QZHA 3MAQA 4H5WA 1KFTA 2XLIA 3LVVA 3H98A 2QEXN 4IH7A 2QLXA 1S9EB 1WHYA 4ED6A 2KLAA 3ELHA 2IVPA 3D0HE 4X4TA 3T19A 2O8DA 1LK7A 2VB6A 2RQ5A 2KTQA 1O1WA 4K5RA 1I6JA 4O5EA 3SFGA 2DGUA 1HBUB 4GIBA 1WHWA 7ICFA 4IZ9A 1N56A 3VQ4A 4BXOB 5K8NA 2XS5A 2QWOA 3MC1A 3ID6A 3AVFA 1BPYA 3PLAA 2V4JA 4UOCA 3QMQA 5LL6Z 1U1MA 2WBRA 2RILA 3CCRS 2BQ3A 3L7OA 1UVNA 2XWYA 1KVAA 1V38A 2WSCC 1GOBA 3D0IE 2E1EA 1KKHA 1N88A 3SBMA 3FBEA 2V4JB 2KIWA 3H5YA 3G9CA 1RBLA 2DGXA 2QG9B 3U8XA 5T7LB 2VUGA 4C3LA 1SQEA 4CECA 3F9KA 4P4OA 1V4SA 4DMNA 1FW6A 2W43A 4J9NA 3GL1A 3BYRA 4ANEA 2EI5A 4ZMMA 2E8AA 4HUGA 4O8UA 3C23A 3R7NB 1F6TA 4ZPWR 1TL5A 3FCWA 1E4FT 4L73A 3PJWA 4GVMA 2BQRA 2IAJB 2AQ4A 5AK6A 3GFZA 1NJIT 4FJ8A 2BKOA 5DDOC 4NMLA 2XMMA 5ETRA 5HR6A 4DUZK 2VQEF 2OELA 5FDLA 5AKHA 4GV9A 4YMMA 1X1PA 5GIOA 2V94A 5KT7A 2KVIA 1GMWA 2JC0A 3K2YA 5CEHA 3D0PA 4HHUA 3DDHA 4JI1F 1ULRA 1J2MA 3DXKA 2E3TA 1REVB 4USTA 3SQGB 3O4NA 3NNCA 2RDJA 1L5UA 1KLMA 1WDTA 2D3O1 4NO7A 3QEXA 2A42A 1TAMA 3KHHA 4IEIA 3PEJA 1MROB 2XG8A 3AHPA 3I31A 3KWIA 4ENOA 5FLXO 2ZWHA 5A76A 1WCLA 2QA4S 1NGDA 3LOUA 3UCZP 3OL9A 3R9KA 2MUTA 4UT4A 4TKTA 4C8NA 3P8BB 2CRLA 5DDYA 3OXGA 3G2XA 5HRSA 4OX9F 2C2OB 4LBHA 3AVCA 4KLGA 4LR8A 3W8PA 1JMSA 3MEGA 2C3MA 1P6TA 1VQLN 1NSQA 4JYAJ 4GW6A 1CS4B 3T5HA 5JVGQ 4I2AA 3G86A 3SSRA 5J1NA 4Q8FA 4I9QA 2AHOB 2F63A 3UKUA 3E58A 2BJ8A 3QO9B 5EXWA 3MGHA 1FRHA 4UASA 8ICXA 3H4DA 2AZ1A 5D4LA 4BRIA 3ZSYA 3MGVA 4CF4A 2ZHOA 2HSTA 1ZQ1C 4KX3A 5HMMA 2QW9A 3VTIA 2MKIA 4BRGA 2NRRA 1VIXA 2Y3YA 1NM2A 3VEZA 3LPEA 5BYSA 3CJ5A 3QSIA 3CJ4A 3MMVA 3CCUS 2D9OA 4A5BA 1KC8T 3RBEA 2HKEA 5F8LA 1KBUA 5KOXA 2IOFK 5HROB 2XQCA 3Q86A 4Y2SA 1WSHA 5K8OA 1QD1A 4Q43A 3FGUA 1G7CB 1VSHA 2RKIB 4WFZA 2J9EA 1BWVA 5ALRA 3GIMA 2F7VA 2G8VA 2R3VA 4KLTA 4NYOA 4AHCA 4RWWA 2AEFA 2IVOA 4F4ZA 4E98A 3D67A 2F1JA 3O5TB 4CJPA 4DU7A 2GGPB 1PK1B 3T5JA 1S1UB 4KN4A 3QNWB 1S1VA 2YKQA 1WOQA 4NB4A 1WNSA 2G0JA 1EB0A 4M63A 2R8GA 3V6HA 1OUQA 4YB1P 5AXLA 5DK5A 2ZJ5A 4FWNA 2GLEA 1WTBA 3W61A 2K4HA 1P27B 2HLUA 2E66A 1NDKA 2KN4A 1EZZB 2LQ5A 4Z7YA 4J7CA 1L3KA 3ZEUA 3HKWA 4JI6F 1NMNA 3FJ2A 3P39A 4NL9A 1V85A 1RXVA 3DLKA 4FWSA 1FWPA 3ILOA 2NXJA 2GVDB 2XICA 4Y0FA 4QIGA 4DOBA 1VSMA 3N28A 2EANA 1RK8A 1NGEA 4ECZA 2F2AB 2JFDA 5HP1B 1SJ3P 2GX8A 3D2FB 1B92A 2QX0A 5IT4A 3AB2B 5D3GA 2GS8A 4F5NA 4M5KA 1DGKN 2XHBA 4CLFA 4V19J 3A8JA 1U8WA 1LKZA 2KYZA 2W04A 4KC5A 5M1NA 4H0PA 3WX4A 4CLUA 3KNAA 2Z58B 2Y0SC 4C48A 1HX1A 3JXOA 3J81Y 4G6VB 2MKSA 1RWMB 5H9FK 1U1PA 4LFAK 3VEWA 1HQUB 1W97L 1V97A 3C7NB 3RWUA 3VESA 3A8IA 3OR2B 1TVRB 3PJ9A 4BJQA 2W1BA 1FHTA 1YITN 3THWA 2FF3B 3MD3A 5A0YA 1CULA 3O9TA 2UUBJ 1BI4B 3P1GA 3MN7A 2NRTA 1NOMA 4Y2CA 4RQ8A 3US5A 5HRRA 1DEJA 5AQNA 2YY6A 3NVYA 1KS2A 1Q8LA 3EZOA 1BCMA 4KGKA 1YI2N 2QLBB 2V68A 1F0MA 1C4AA 1EQ0A 5BXIA 1U7LA 3G4SS 4IRDA 1FE4A 2HK2A 2DHHA 4ZJLA 2YHYA 3DGVA 1NDLA 4DV0F 2N1RA 2GNKA 4IXCA 5E3PA 1RQ0A 2NXUA 4KI6A 5HSPA 3Q24A 3W66A 3H2VE 3UPFA 1Z1VA 3MCAB 2OLWA 5J2CA 3GFXA 2BQUA 4USJC 3MPUB 3A5OC 4A8EA 3SDEA 5T14A 1KDNA 5KL1B 1IKYA 3KG0A 3V81A 2WF5A 4FM0A 2VKQA 1DTQB 3JPRA 3DOLB 4PKIA 4BC3A 2JVOA 2FLPA 1XTZA 3AD7C 4DWIA 3OBYA 2W9CB 3MWTA 2X7IA 2G07A 2G8HA 8RUCA 4USAA 4B3RK 2LXIA 3NVVA 1Q82T 4B3RF 2R7XA 4BX9C 3AQEA 3PHEA 1VQ6S 4Q2LA 2R7RA 4KH1B 2ZD1B 4OZNA 2VJ4A 5C42A 3CJQA 4KFBA 3BH6B 4JN4A 5DG9A 1JLGA 1IBCB 1CLFA 5CD4A 1SQKA 4TUQA 4LF8F 4DR3J 2P2CB 1QUVA 3K1ZA 2ALZA 5J1EA 4I6MA 2WB1D 2Y1IA 2XI2A 4FFDA 3O80A 4DTOA 3WIVA 2HW3A 1EWQA 4MKBA 4LUBA 2HRYA 2QYGA 1P1LA 1NZPA 4KH6A 3W9HA 3PW5A 1SKUB 4BR5A 2OO4A 3K58A 4IR9A 4V19S 4EUVA 5GAEP 4R65A 2F7TA 9ICGA 1D0EA 3KXDA 3ZZUA 1IJJA 3S01A 1MA9B 2VL1A 4XEIA 2OD6A 2NLWA 1HNXJ 1RWPB 2PC6A 3M8RA 4NEZA 2F4VF 2ROEA 3QGIA 4M3ZA 4ZPBA 2XC9A 2W4CA 4ZVOB 4DR1J 2OUGA 3ZC4A 1JXVA 2Z1JA 5HI7A 2A6MA 1VQ4N 2FBXA 4DR6F 5IWAF 3AV9A 4OZ0A 3R6LB 1T03A 2XYPB 4N8OA 1RT2B 1PGZA 3IDWA 2HGNA 4YMOA 4WJBA 2CZ9A 8ICLA 3ZZYA 2O3DA 4B3MF 4CJFA 3L3CA 2ZH3A 1XNSA 5CP2A 2BZFA 1JXLA 4UB5A 1MA7A 4KFBB 1JJHA 3O9SA 2KEYA 3AU6A 4M5JA 2BOPA 3C28A 1UAXA 3MM7A 4JI8K 1I51B 3G96A 2DHSA 2LA4A 2OWOA 2ZXHA 2MLXA 4KHMA 2NNWA 4PZVA 1LOUA 1BPBA 4DU3A 5TISU 3HVTA 4DV4J 4OO1J 3CCUN 5JTIA 1X9XA 3ZSWA 4ZVQB 4FJMA 2D0CA 1ZBSA 2Q1LA 3KD1E 3KFWX 3I0SB 5LMNF 1TQLA 3L0QA 4NZ0A 1HBNB 3K5LA 1M5VC 3FRYA 4CEFA 1FRLA 1OH5A 2FQQB 1SUQA 1T9XA 3C29A 3Q8SB 2FLNA 2MPUA 1S22A 3SQ1A 3VF4A 3H0LB 3DOKA 5A2QY 3J7ZT 3PYGA 1RBRA 2YX7A 4M7XA 2O8DB 4BGDA 2ZZTA 4GRSA 2W9CA 3NF8A 1KLNA 4JS4A 1JLFB 2FY1A 2PFFB 1HYZA 4F5PA 5EE0A 1CJTA 1IO2A 4DSIA 3V6DB 3FZFA 2RU9A 3QMLA 2EDUA 4AYBD 1TKZA 5ETPA 2P9SA 4TU8A 3MAHA 1RDUA 1JLGB 1QSYA 1PKUA 2QWLA 2YVSA 1ZXIA 4OI0A 3QESA 3TAQA 3LP3A 1ZTWA 1RQLA 2G1DA 4Q5VA 2O8BB 2ADBA 1ZBHA 4J2EA 8ICSA 2M3DA 8ICCA 2AJFE 4WU2A 4JNEA 2IMWP 1D4XA 1N6QB 2MGZA 1BDGA 2RDIA 4CZLA 4W5NA 3CJ3A 3E01A 4CLYA 3DYAB 1HYSB 2WC9A 3P4UB 9ICQA 3CVKA 4K59A 4CLZA 2KXNB 3CJCA 4B9MA 2J0WA 3N7RC 5D3GB 4L3KA 1YQHA 3KK7A 2PFUA 5I42B 3CCSN 1ZS6A 2IA6A 1ZBFA 1ZPVA 1OVYA 3HTVA 2CPRA 2DITA 1JK9B 2CPHA 5KG0A 3HRGA 5C15A 4E0DA 4LF4K 3GIRA 1K6YA 1K5OA 4AT1B 1WI6A 2CJXB 5F3ZA 5LT5A 3PRBA 3PNIA 2GAHC 2QEXS 1AYEA 3UDEA 1WG4A 1HR0K 4EENA 2CA9A 3HSTB 4DTXA 3DRPB 3CMAN 1NHVA 1U2FA 2H3QA 1GOCA 5J0WA 1XWLA 3CD0A 1T05A 5HBMB 1IKXA 4XDCA 5LMUF 2J9DA 1HYVA 2ZOGA 1QSSA 1C1BB 4DX6A 4WFBQ 2A3JA 1YVFA 1KVKA 3OYJA 5ALYA 2IRUA 4AHVA 3ISZA 4CGGA 3UKRB 4MEYA 3TVKA 3DOLA 3M2UA 3VQ8A 5B0EA 3OJUA 3K5PA 2DK2A 5D4BA 1ZC6A 1YG0A 3OL6A 4NWIA 5B5EU 2UYTA 2GIRA 4H4MA 2D0AA 4FBUA 2HEKA 2LU1A 1KOOA 3Q22A 1KVCA 1ATSA 2PEHA 3AH6A 5FIIA 3MEEB 2YJEA 2WRMA 5IWAJ 2CNOB 3IP4B 4KGVB 2V9KA 4CLLA 4H0OA 3A0HU 1XBWA 4J90A 2YQ3A 4K8XA 5C12A 3DOKB 3HZEA 2GC8A 2BOAA 3U3GA 4LIRA 3GJSB 4UARA 4X4VA 9ICXA 3IWLA 3M30A 2WAQF 2YMPA 2ZXIA 4MMOA 4ICAA 1MWYA 4I2QB 2HS0A 4PWUA 1U1RA 3H46O 3F2BA 2XULA 4KHPK 4LQ3A 5CE3A 2VGMA 8ICHA 1HKAA 1A6SA 2KXFA 2RNEA 1U8SA 2R4FA 3VF2A 4FZYA 3HKZC 1JXEA 4C8OA 1YBAA 4FK2A 1MU2A 4DHVA 4AHUA 5HMYA 5J2BA 1VQYA 2OPSA 1VSIA 1HWLA 3WQUA 4DZDA 3ENHA 4MYUA 1VGYA 3ICLA 2HGLA 4FO0A 1BVSA 3PVXA 1S9GA 3B8AX 5D4PA 2QMWA 1XMBA 1N5YA 4M5LA 2LYAA 3D2NA 1KTVA 4BBYA 4R64A 1CJVA 3QWUA 3VAHA 4BRPA 2YNHA 2W8LA 1DK3A 5I3QA 4DV7J 2D7SA 1XR6A 2KOBA 4ECRA 4GKJK 5SZTA 2KKZA 2J6TA 2R7OA 2CNLB 2Q36A 4WF9Q 2E8NA 3QINA 4W5TA 3J8AA 4IJNA 5HQMA 2J9CA 4DPOA 3L95X 2NYIA 2VIXA 3IS9A 3JYTB 3O4WA 3G25A 2DF4B 1J97A 1RAFB 5AI8A 3ZT0A 5LMNJ 1KSPA 4HTJA 4DR6J 4O5CA 3U6FA 5HOOA 1BXNA 5H9FJ 1FRMA 3HHLB 3AU2A 1LQ9A 1Y64A 1Q81O 3W64A 1ZQTA 1PK1A 2OKQA 2VASA 2P9EA 1HIYA 3M05A 5HMXA 5BR8K 1Y5IB 3V7LA 3ZDCA 1Q86O 1UCVA 5IC4B 5CCMA 4Z4GA 2V2QA 3NY0A 2A41A 1RACB 2E5LF 2CPYA 5AI0A 2E44A 2D1KA 1NK6A 3LDAA 4GMKA 4C7YA 1RWKB 4PXEA 2GMLA 2H4WB 2PMZD 1CJVB 4YOTA 2KT2A 4QW8A 3M30B 1JCFA 3ZTSA 2ZNZA 3DU5A 3CCZA 3BKTA 3FSXA 4WKYA 4CIGA 4DG1B 3S41A 2I6XA 2ZUBA 2B7BB 1QQ6A 4G1IA 5KFWA 1NU4A 1XUPO 3DLKB 2D0BA 3NMUA 2J7UA 5ALZA 4MFAA 4YORA 3CETA 1YJ7A 5D0RA 1HNXF 3NRBA 3OTDA 1S77D 4FLZA 4CESA 1FK9A 1DGJA 3I0RA 3UD3P 3LAKA 3MK6A 1OXJA 4KB0A 2MU2A 4FL9A 4WFAL 4FLTA 4DTUA 8ICJA 2D8CA 2DBYA 4M1KA 3AGKA 4R0JA 3I0SA 3MM8A 1N62A 2EBEA 4A8WA 2WBNA 2DKZA 2BKNA 4JYAK 4BGAA 4O55A 1PYSB 4IQTA 1B4FA 3SUQA 2U2FA 5KFGA 5AM1A 2DL0A 2PKEA 3RB3A 5E5NA 4LF7F 1RTDB 2W40A 2XHCA 2A2CA 4HTLA 4H5TA 4Y00A 4BWJA 3FBBA 3GR0A 2W8KA 3QBCA 3R5CA 2GW8A 4JI6J 2FHKA 5IXUA 1HEKA 5AQLA 3M9NB 3PIPQ 2IOHA 1XNQF 5DQGA 4TY8B 5IM0B 1F21A 3HRDD 1L8LA 2FBVA 3IGNA 3R9PA 3LYSA 1QUPA 2V9WA 3NS5A 3NXZA 1U04A 2RS2A 4X62K 4AP9A 3G6YA 1REVA 3SQGA 1T3VA 1XSNA 3QERA 5IFMA 4KX5A 4MO5A 2YY3A 4ZVEA 1TYQA 2F44A 3CCEN 1T6DA 3SXLA 1TKXB 2XBPA 2HCFA 3QE9Y 2UVVA 1TV9A 3MX5A 2E4LA 4CH7A 3IFRA 3M8SA 2GHWA 2NV3A 3FRZA 2XMVA 2W4DA 1Y7PA 4F4AA 1YVUA 2DXDA 2H3IA 3ZSRA 1ZD3A 5K9FA 4CNZA 1FFUA 4FJLA 1YJ9N 2LFVA 5H1SV 2WSFC 4Y2TA 1NK8A 3EXYA 1BHNA 1EJ7L 3M8YA 3R1LA 2FVQA 1QHAA 3NEKA 4O3PA 3TEHB 4PL1A 1RT3B 1NGJA 3MEGB 3DJCA 1N61A 1F2HA 4IDHA 1JUDA 4M5MA 4DR4F 5RUBA 2UUCK 1XSPA 2BCSA 2E6LA 5K4LA 2P9CA 3N6LA 1RDWX 2BANA 3MMBA 4JKAA 3WDOA 3PFEA 1ATNA 3SUOA 2BCRA 1S0MA 4FNHA 3UNYA 5KG2A 4ZLNA 5HMZA 3WBZA 1VC5A 5JJBA 4IFYA 2BJ7A 5T41A 1N5VA 2CPXA 3MCNA 2YX4A 3BEGB 4LFBF 1X0PA 2E1PA 4I2FA 2ZC3A 2DEJA 4F25A 3QIDA 1A0PA 3LH2S 1Q82O 4LF6J 4Y1CA 1O51A 1WUDA 1IBMJ 3KNGA 2QB0B 4EAHD 3U26A 4FWKA 8ICEA 3D68A 2FGCA 2ASYA 3N5FA 8AT1B 3UO0A 4FLXA 2PZSA 2M8HA 4RWXA 3M6KA 2LP4A 2Q3PA 5A8RA 5ETVA 2KDOA 2UUBK 2WONA 1IR0A 1SV5B 2UUCF 1HMVA 2CQBA 2Y1JA 1J5OB 4IBNA 3GSIA 2NZ4A 4KHYA 4DOZA 1RP5A 4RLEA 4CZMA 2GMHA 4CGFA 2QL5B 2YQEA 3CTRA 3JAMO 1YJRA 2D1CA 1RT2A 3CCRN 3X1LB 3DHXA 4UOFA 2IY5B 3LM9A 1FKAF 1IBLJ 2LYVA 3BDEA 4G9ZA 1CQMA 2ZBCA 1HBOB 2R2TA 1WAFA 4F50A 4CTAA 3AQOA 1Q81T 3PKMA 3BGRA 5J0YA 1SBRA 3H7IA 2R7UA 4DCOB 3AA4A 1F9FA 5D4OA 4L6V3 2ZD1A 3E51A 3ETMA 4ED0A 3FC4A 2FI1A 2IMOA 1N36F 2JFKA 3OYMA 1OQ6A 2H3ZA 2PGCA 2ZE2B 2DNNA 3LM2A 2EVZA 1BQMB 3DXMB 1C7YA 4CBWA 4DR2F 3QLHA 3R5GA 1S7HA 4Q8EA 4NLGA 5F0WA 2Q97A 5ALXA 3BBCA 3FBFA 1NMDA 3KUEA 5J1PA 5KT6A 1RBUA 2XMWA 2ZH6A 3MOJB 2VDIA 1FFWB 3GU0A 5ELZA 1GMUA 5AICA 3U7JA 5C5JA 4URGA 5EU7A 2UXDF 3AVLA 2IIRA 4KLOA 2X3DA 1P90A 3N0VA 3UKUB 5E33A 2K8GA 4I7FA 4KAIA 1UEVA 3LP1B 2MY8A 2Y9TA 1ASVA 3ILLA 1R0AA 2AJ0A 4JV1A 3KHYA 3L2RA 3W5YA 4FDFA 3O9RA 4BREA 4PKGA 1NK7A 3HHNB 3UVJB 1O08A 5L1MA 4F3MA 2IOCA 4JI3J 2AJQA 2G0CA 2MQPA 2LVWA 1YZ6A 4XAKA 2DNHA 3LAMA 4XO0A 3UNGC 4TXSA 1LAWA 5ALIA 4B9TA 4M0AA 5A8RB 4IO9Q 5A8KA 3UN2A 5ALLA 2LPEA 5HQ8A 5AFUH 3J7YU 3IMQJ 1PYTA 3ET6B 3CEDA 1JLCA 2YWHA 1S0VA 3C2MA 2RU3A 2PEBA 3CHWA 1IKXB 3ZZZA 1S1XA 4M5DA 1DY3A 2H5XA 3DYAA 4KTZA 2CGJA 5AJ3J 4OQJA 1S6PB 3F2CA 1HRHA 1Z25A 4FWLA 2EWHA 3HSCA 4R5PA 4LFBJ 3RTVA 4KBIA 1RADB 2E9ZA 3D2QA 1L3VA 1SB3C 3Q8PB 3OTCA 4J9LA 3MR3A 2NPIA 3MN9A 4R25A 1T9WA 2Y0BB 2OEKA 4OIXA 1RDAA 4EX7A 1LW0B 3OSNA 1RGIA 2GHPA 3VEYA 2WK4A 4ILLA 1RLCL 4RW8A 7ICNA 1OW5A 3MM5A 2C2ZB 3OTOF 4IC9A 3TAMB 1C0TA 4LFCK 3HX0A 2XYHB 4QIVA 4RJVA 3OUYB 3S1TA 2BMBA 4I6YA 3O5BA 5AQTA 4OL8A 3CNQP 1NBWA 1ZXOA 4AL7A 2A1JA 4MTPA 2W2OP 5LM7E 2B21A 9ICJA 4PPXA 4JI4J 5AQRA 2ROPA 4DPUA 4CLWA 3B6BA 2CXYA 2WF8A 3S3OA 2L41A 2Z57B 3D1HA 2WCXA 1IN0A 2I9GA 1YAGA 3CULA 3A12A 3TVZA 3TUPA 3EVMA 3THYA 4UAZA 3J80U 2ZZNA 1GOAA 4MK9A 3TNVA 2OEHA 2VQFJ 3UQSA 3PW0A 4ZPVR 1S1XB 1ZQFA 1U2CA 2GMJA 1KHVA 2WF6A 3V9SA 4FZVA 1VRTA 1AB8A 3KK2A 1FFSB 4I69A 2O8CB 2EK1A 2KVQE 4BUGA 3GIKA 2JZBA 1JLQA 2OTJN 4F3OA 5EOZA 3CDUA 2HMIB 3RB4A 4NLYA 3C15A 3KMQA 4KAZA 4YN3B 3ZFVA 1QSLA 4IQVA 5L8RC 1MNEA 5K5MA 2M7SA 3K9JA 3C21A 3D6TB 1B0VA 3PXGa 5DQHA 3P31A 4BWMA 2CG4A 3I8DA 3O3FA 5ALDA 1U1KA 1T3QA 5EN1A 1J54A 1FT8A 3TRGA 4OZLA 1XJWB 3CM5A 4M3YA 1PBUA 4NI2A 1J2NA 3VQBA 1F44A 4P0PB 4WCEL 5KFRA 2E5GA 2DIUA 1FESA 3SQ4A 4ZPCA 2CJQA 4YR2A 3ET6A 4LSLB 9ICUA 4ZITA 1UA0A 4LFCJ 4KGXB 1IXKA 3AN1A 4HUFA 1NK9A 2EH9A 4PG8A 3RRHA 2PE8A 5KG1A 3VR1A 1M90O 2OTLN 3C2LA 1ZQRA 3TKAA 3V1QA 3BS5A 4CJQA 2VG7A 5AIAA 2EBGA 1DOQA 1G1XA 3RF9A 2L3MA 1V5IB 2YWKA 1LW2A 4Z4FA 2C42A 4FJ9A 1EXNA 3MMAA 2QKKA 1HKGA 2IHMA 4EO6A 2UXBF 2E1ZA 2P6SA 3DGPA 4NLZA 1SH2A 4DR3F 3SQ0A 1XNRK 3POTB 5C2DA 2QXFA 1FXDA 3M6ZA 3K5MA 2WB1C 5DQIA 3P83D 5KFTA 1PJ6A 5HVFA 4NLRA 1TUWA 1BU6O 5KFIA 3JPNA 1X3MA 1ZOTA 2FJDB 3I55S 8ICZA 5DDRC 1SXLA 8ICVA 1YJUA 4WQ5C 4FF2A 1TUUA 4JB8B 4CJSA 3I4HX 4R0EA 2DCUB 3ZT3A 4RNNA 2WUSA 2H9ZA 1RBVA 1NGIA 2Q0ZX 2YKPA 2ZEJA 4FBTA 1HNZF 3SAGA 2EFVA 2VPWB 2JSXA 3LPUA 1N48A 2P8IA 2RN2A 2OFGX 2Q2RA 4RT3A 5AQOA 1V9OA 4OJ3A 4ELTA 5CZ2A 1VQ7N 4F4YA 2DR8A 4IOCL 3GCWP 4BRLA 2WOMA 1WYGA 1SV4A 2IVFB 4EFHA 3PW4A 2Q66A 2HMIA 1A77A 4C7QA 3BGLA 1PVQA 1WJ9A 2XMUA 7FDRA 5FPEA 5J2GA 2BCVA 4CNQA 1JRPA 5ETLA 4G1QA 1M5HA 3QUBA 2ILYA 3CB4A 4OPKA 4XUSA 4JLHA 4D3HA 5C2GA 4BE0A 3NGDA 3E2EA 5J2MA 1Y9OA 4Y2RA 3VAKA 2FPKA 4FF3A 4X5VA 4E7HA 2V52B 3A3PB 2VG7B 4WFXA 1SXEA 2OPPA 3DN9A 2YWFA 1S9FA 1GX5A 1VI7A 4Y2IA 4IH6A 4CF5A 3IR6B 3WNEA 2EFNA 1IR1A 3LALA 1W0HA 4C0HA 2R7VA 3BP8A 4DHYA 4YXMA 1EAYC 1Q3VA 4DR2J 2OYQA 5M1KA 2ZJQL 1CVJA 4I2DA 1WTFA 5F3XB 1LEOA 3WX8A 4LF5K 4C8ZA 3GWCA 3J81O 1IWAA 4A2BA 1A7GE 4YOVA 1L8OA 2V5HG 4OYMA 3H2UB 4M7YA 1S1TA 2O6KA 2LEBA 9ICKA 1VQLS 4I29A 4KLFA 5F1XA 1RWUA 1U49A 1QVFM 4AQYF 4ILJA 1R8HA 1SJRA 1HNWK 3FZLA 1WAJA 1TZ0A 2YWEA 1Q9XA 4DL0C 1ZBIA 4O3NA 2XY5A 3OW2M 3CE8A 3CCSS 4DF8A 2EG2A 3IG1A 3FC9A 3QGPA 2FJVA 5F3TA 3IBPA 3K75D 4NLKA 2QA4N 1BNPA 4ZVHA 4ED5A 3A8YA 3PDNA 2E2NA 2KKHA 4B9SA 1DXSA 3V5RA 2DGOA 1FNXH 4IWVA 4OV6A 1HPZA 4PWDB 5AM3A 3QIPA 2ZITA 1HD1A 4KB7A 1C1CA 2F8LA 4WQ4A 2PXIA 5IIMA 3IGVA 3VVTA 4YFKA 4I1TA 1WKJA 3W2VA 3W3SA 3ZT4A 4AQYJ 2NQPA 4E1MA 4C2MA 3L2QA 2H3GX 2EFPA 3L7UA 4LF5F 1TE2A 4TN2A 3DDIA 3LL3A 5BYRA 1JI7A 4DOAA 4F7VA 4K4YA 4CGIA 3FMBA 1RT1A 4QOZB 4U6PA 4FZMA 4DSLA 1X5OA 5KFLA 4YDUA 1T44A 4KH0B 3EMTA 1R31A 4M2YA 1UT5A 4CGHA 2UUCJ 4EI2A 3PX0A 1WOSA 4QIFA 3ZZRA 4Y2YA 5LXYA 1BG3A 2PN6A 2KVSA 4DMZA 1B7FA 4TUSA 3BBFA 3Q8UA 4I56A 4NLNA 4CE6A 3GP9A 1IBLK 3X3UA 2JWLA 3UE5A 3DGPB 4ITSA 1S59A 2OHFA 4OLOA 3FFIA 2K4PA 4Y65A 4LF6F