4DS5A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mg2+
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 207
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds5A01
1RXWA 1JLBA 1BQMA 1IM4A 4B9UA 4F5PA 9ICNA 4DTXA 3QEVA 3VQCA 3JPOA 3AUOA 3OYDA 9ICRA 2BQRA 4KLDA 1KFDA 8ICHA 2JLEA 3V9SA 3PNCA 3TAFA 2BCQA 1S1XA 3PX0A 4PA1A 3HJFA 3P5JA 1KEJA 4M41A 1LWFA 3MEDA 2NRTA 4I2EA 4E0DA 2G8UA 3CM6A 3QZ7A 1VSLA 3UXPA 4YCXA 4BE0A 4AHRA 3NGDA 3MFHA 3AA2A 4IQUA 4KB0A 3DM2A 3CQ8A 4O5KA 1KFTA 3DLHA 2C2EA 1HUOA 2VG7A 1S10A 2FC0A 4QZBA 4RQ4A 4KI6A 4NXZA 3KKSA 3QLHA 1XSPA 3HM9A 1N5YA 2DFEA 4Q5VA 2W9CB 1K1SA 4NLGA 7ICMA 5KG5A 4DSJA 3OHBA 4PH5A 3Q8PB 5J0QA 9ICCA 3ZSRA 8ICSA 5HRSA 1RT4A 1O1WA 1BISA 1T03A 3ETLA 1ZQHA 2DFFA 3QEPA 3H8JA 1F21A 3RB4A 3EPIA 2FBVA 5J0TA 1XO1A 5IILA 3NAEA 3TWHA 4Z4EA 4ZTJA 1C1CA 3FYHA 2B21A 7ICFA 1GOAA 4ICLA 3ORYA 1NJZA 2HW3A 3VQ4A 4FVMA 3V1QA 1J9AA 4OVLA 4NYNA 3RH6A 3NHGA 3QZ8A 4RT3A 2W9CA 3RJKA 8ICJA 3K2PA 3M8RA 1SL1A 4CGHA 4Z6FA 5J1EA 1RT7A 4UAZA 4EP5A 2RKIA 3EW9A 2PXIA 4ECWA 3T1AA 5KGXA 4FJJA 4Z4IA 1B92A 2P5GA 2RN2A 4DF8A 3L2QA 5DBCA 5L1KA 4HCBA 1TK8A 3OS1A 1BPDA 2KTQA 4IQVA 3ZSWA 3ZSVA 3V9WA 8ICWA 3RMBA 4IBNA 3S3NA 4F91B 5L1JA 3MEEA 1HYSA 2F1JA 2IDOA 3V7JA 2XHBA 4J9QA 4KHUA 3JSMA 4FJHA 2KN7A 4I9LA 1QSYA 5KG4A 9ICFA 4JV0A 4UQGA 3OYGA 1C0TA 3DI6A 1FKOA 4KMUA 1C1AA 1X1PA 4HUEA 2X6SA 5J2BA 2DY4A 2A1JB 3IAYA 3LWLA 1JN3A 1ZQSA 4ECVA 4JWMA 2KZZA 3KLIA 8ICKA 4C8NA 3GIIA 2I5JA 3PY8A 1MC8A 3THVA 5CB1A 4BDYA 4FS2A 4CJVA 4DTSA 3RMDA 5DG8A 3PW0A 1ASUA 5J0WA 4RQ8A 1U48A 2JEFA 4AHSA 1QLNA 4KV8A 3S9HA 2C28A 1XU4A 3SPYA 2HHTA 2Z1JA 2BKEA 3RAQA 5EWFA 5KFPA 5KFGA 5KFZA 4O0JA 3GV7B 3AA3A 4LSLA 4W5QA 4QZDA 4FJIA 3AVMA 2GV9A 3OY9A 4RG8A 4AHVA 4CFAA 3T5LA 4FK2A 2PFQA 1NOZA 4F2RA 1A5VA 2XRIA 4F4ZA 1TAUA 3U3YA 5KFVA 3O3GA 2G8KA 4I27A 4RQ0A 4L8RB 3NF6A 3O3FA 3MFIA 3V6KA 1HQEA 5DG9A 3AVFA 4GW6A 1RBVA 2LYHA 3HT3A 2QK9A 5KTQA 4KLLA 5J0YA 1ZETA 4QZHA 4ECUA 3MXIA 4DSEA 4RQ6A 2F1IA 4KHSA 5JS2A 5DK5A 3QNOA 1RDCA 2GBZA 4RQ1A 1EX4A 2JEGA 3VQEA 2R8JA 4FZZA 3PVXA 3OYAA 2P6RA 2LSNA 2AQ4A 4M3YA 3LK9A 3L8BA 4ECZA 2OA8A 5KT4A 5KFSA 1C0UA 2RPIA 4ID1A 1BGXT 1UWBA 2FBYA 5KG0A 4EZ9A 5J29A 4FBUA 1RCHA 4F92B 2IC3A 4M0AA 2C2RA 4I28A 4ED3A 4DU1A 1JLAA 1NJWA 3MABA 2F96A 4ID5A 2ATQA 2XY7A 1BI4B 9ICLA 1RT5A 1B22A 4UB4A 4XQ8A 1SUQA 3OJSA 4DWIA 1DLOA 3VQ8A 2IHNA 1ZQRA 4F3TA 5J2IA 4KN7A 5KG3A 4M42A 1X2IA 2ZTEA 1T05A 7ICUA 1SZPA 4B9SA 4MEXA 4TSXA 4EBDA 2P6UA 3H4BA 1FKPA 3SQ0A 4ECXA 3DLRA 5HHHA 3K5MA 5F9NA 2DFHA 4F3OA 2OZMA 9ICBA 4DQSA 5J2EA 1ZQFA 4R63A 4B3OA 4Z0UA 3E01A 1W9HA 1S5JA 4FLYA 1SKWA 5KFYA 4FLTA 3V9ZA 4J9MA 4AILC 1S0NA 3C5FA 3O3HA 1S0MA 5I42A 1BI4A 3WNEA 5J0RA 1C1BA 1BPYA 4DG1A 1D9FA 4KTQA 4M04A 4G3IA 4CFBA 2BGGA 4AHTA 2ZJ5A 4IR9A 4BE1A 3OGUA 1IKXA 1XHZA 4BDZA 2J6SA 3ALYA 1IKVA 3TABA 4J9SA 4QCLA 1A5XA 2NRWA 1LWEA 4K4IA 1EP4A 2HMIA 2ZQBA 4CERA 4RQ2A 5IIKA 3QEAZ 5JUMA 4DOAA 1ZQNA 2ETJA 2PZSA 4HUGA 5BPCA 4M3WA 1ZQEA 4FW2A 4ECQA 3KIOA 4KHNA 2OPPA 4QWDA 4J2DA 1VSFA 4E89A 3TAQA 4M45A 2AGPA 4QWBA 4DTUA 1BVSA 4ECYA 4AHUA 2B6AA 5TZVA 2QKKA 4FM2A 4EBEA 1JXLA 4F2SA 2JZBA 5J0XA 4EBCA 7ICQA 4CFDA 7ICTA 4CK3A 1TL1A 2VWKA 3K5NA 2VANA 1ZQIA 3OYEA 3QNNA 3AA4A 3MXMA 4XA5A 1YTUA 2BDPA 4TQRA 4F4YA 4DL7A 1TV9A 3RJEA 4JRQA 3LALA 5CZ1A 3NGYA 3TAGA 4G1QA 4CF9A 4E1MA 1UAXA 4E3SA 1KRPA 9ICJA 1N56A 1S9EA 2I9GA 8ICLA 1JLEA 3OHAA 2IOCA 4OGEA 3ZT2A 9ICIA 2D5RA 1LAWA 4PPXA 2R8KA 4I2BA 4E7LA 3T5KA 4LH4A 4ED6A 1TK5A 3L2RA 2HHUA 4BGDA 4M9LA 3V72A 4F4WA 2HHQA 3ZSQA 4DL5A 4KPYA 2PI4A 1S0VA 4DS4A 1S0OA 5J2AA 4CHOA 5KFUA 4YR2A 3AO4A 4JRPA 4DL2A 1WSGA 9ICTA 2FBTA 4YD2A 3HPOA 4UB5A 4I2AA 2IS3A 1IG9A 3SV3A 3SUOA 4YMMA 3LDSA 4OKEA 5IIMA 4KLMA 2PYLA 4DOBA 5D3GA 1KSPA 1JMSA 5IIJA 4X5VA 3V1RA 3NDKA 4F5NA 3CYMA 5KFKA 3RB3A 4FO6A 4RPYA 2FMPA 3MEGA 4BE2A 5HMLA 1L3VA 5J0PA 3K5LA 2KQ2A 8ICNA 3PW7A 4RPZA 8ICYA 3BQTA 2QKBA 3NF8A 1MQ2A 2FMQA 1UA1A 2DPJA 3RR8A 3BQ1A 1WCNA 4IQTA 1WAFA 4C8OA 4CJKA 5CYQA 3SPZA 3RJJA 3HW8A 4KO0A 4KREA 2GWSA 4DTPA 4CJSA 2BPFA 1K1QA 1BL3A 4XUSA 4FXDA 4MF2A 4CJPA 4F93B 5J0UA 1BQNA 3I0SA 3QE9Y 4PHPA 3CM5A 2AGOA 4ZH4A 4CEBA 2VA2A 1TVAA 4M3XA 4DU3A 4Z6CA 5DB9A 2KW4A 2XY6A 2XCAA 4K4GA 1B9FA 3HVTA 1TKTA 3PW5A 3RRHA 3AO1A 5KG7A 1Z25A 5EWEA 5HNKA 4QZFA 4RW9A 4I2CA 4PWDA 2W8KA 4RW6A 1VSMA 5J2GA 3LAMA 4UBBA 4O4GA 3TI0A 4N56A 4KLFA 3KK1A 3EYZA 4DFKA 3VA0A 2XGQA 4CESA 5KFMA 3GQCA 2JEIA 1RT3A 1TGOA 4I7FA 4NCBA 4IDKA 4YVZA 3MDCA 4F4KA 4TUSA 4J9RA 2P66A 2PFNA 1WSFA 3MGHA 4KTZA 4KTWA 3VQ7A 5KRSA 2VA8A 1BPBA 3VA3A 3OVNA 3RJGA 4GC6A 2C22A 1VRTA 1CEZA 3C94A 1NK4A 4CJFA 4E1NA 4OPKA 3ZD8A 4YR0A 7ICKA 1XI1A 1TK0A 1JLQA 4CEEA 2YV0X 2E6MA 4QW8A 4MFFA 3LP0A 1IXRA 3M9NB 5J2NA 2IA6A 1RYSA 2JGUA 4O5EA 2F8SA 1U49A 2A1RA 3T5HA 2Z1GA 3ZDAA 4JS5A 3SUQA 4KHQA 4KRFA 5DQGA 4N5SA 3HWTA 2HHSA 4HVJA 3QESA 5HBMA 1RYRA 3AVLA 3GIKA 2ISPA 1HYVA 1UT8A 1HUZA 3M8SA 3AVAA 1ZQXA 1NJXA 5KT3A 3H08A 3MAQA 1BPXA 1LWCA 4CEOA 4DO9A 3C2LA 4CF8A 2HHWA 1D8YA 3MXJA 3JPRA 3SJJA 2E6LA 1ZBHA 3C1YA 4UB3A 3OYHA 4W5TA 1TKZA 4UBCA 5J0SA 4XIUA 4JV2A 3GV5B 3PX6A 4F5OA 3G0ZA 4DFPA 4Q0BA 5EOZA 1RBUA 4YFKA 4O5CA 9ICHA 4XRHA 1NK8A 3DRSA 2XY5A 2BCVA 8ICZA 3GDXA 3VQ9A 1X9MA 4C8KA 3K75D 3LAKA 4DQPA 3CFOA 3MECA 1WCLA 2BCUA 4GC7A 4QZAA 4PGQA 4FK0A 2PYJA 1ZQDA 3WNFA 5DB8A 1NK0A 1HPZA 3TAEA 3LDAA 1J53A 3EZ5A 3T19A 3QERA 2OWOA 4QWEA 3KK2A 4YFUA 2R8IA 4KLOA 1L5UA 1T4GA 4YP3A 2QXFA 3Q8RB 3P83D 2G8VA 4DFMA 3SV4A 3C1ZA 8ICXA 5HRRA 3ITHA 1I39A 3NF9A 2FPLA 3O4NA 2X6NA 2VA3A 2W9MA 1TAQA 3Q8QB 1C0MA 5I3UA 1EXQA 4HHTA 3B0XA 4RUAA 4RUCA 8ICCA 1VK0A 1SL0A 4J9KA 5C24A 4HUFA 1Z00B 4FS1A 4M6WB 1X9SA 3V6DA 3V6HA 2B4JA 2AJQA 4I2IA 4R65A 5IINA 4H8KA 3DLEA 4ED1A 4FLWA 1AROP 4CHYA 3KD5E 1MU2A 2ZTDA 4CGIA 4OLBA 1ZQGA 3NFAA 4I2JA 4M9GA 4CEQA 2ASJA 2R7YA 3HXMA 1ZQYA 1S1TA 5FRMA 5KFEA 3LANA 4FJMA 4J9PA 1REVA 3PX4A 4GVMA 4B8AB 7ICIA 4C8LA 4NY8A 2HNZA 1RZTA 9ICAA 3QEWA 4Y1DA 4NM1A 2YNIA 2ASDA 2IAJA 3M8PA 1TFRA 1WLJA 1HJRA 2FMSA 1ZYQA 2ZTCA 3N4MB 2UVVA 1NOMA 3AU6A 3KLGA 2YHBA 4CE9A 2ASLA 1Z00A 1T3NA 5HLFA 1VSJA 3KHHA 4YMOA 1K6YA 5KT2A 7ICOA 4M6WA 2A1JA 3ZDCA 1U04A 1HRHA 3OYKA 5KFNA 4FM1A 8ICTA 3JPNA 3B0YA 4BXOB 3L2WA 8ICQA 5C5JA 3QEIA 1RPLA 3HVRA 2OPSA 3OS2A 4IRCA 4OKJA 1KTQA 2AQ0A 3NE6A 5KFWA 1V9PA 5KFBA 2WTFA 4CIGA 4LY7A 2RF2A 4K8XA 4CGFA 4FLZA 1QQCA 3V9XA 3LP2A 5J2JA 3OYMA 4FJNA 1ZQJA 4CIEA 3S3OA 3S3MA 2VG5A 1S1WA 3QIPA 3RTVA 1ASVA 3OSNA 4M47A 4N47A 3OYNA 3UQ2A 3ZT4A 2J6UA 7ICSA 3AVJA 1XS9D 4O9MA 2BR0A 4FJ5A 1Q9XA 2KZMA 3AVGA 4KFBA 1J5OA 4BWJA 5J0OA 9ICUA 1RTJA 1VSEA 3OJUA 3A2FA 3JPTA 2G8HA 1J54A 5CR0A 4O3NA 3HK2A 4KN4A 5DLGA 1ZQBA 4M3RA 3AVNA 3OS0A 4BXOA 4FCYA 2Q3SA 2NRXA 4DTNA 1ZBIA 5C42A 1S76D 2W9BB 4RPXA 4CJ3A 4R66A 8ICBA 5DB6A 7ICGA 1WN7A 8ICOA 5KFHA 5DKWA 4F8RA 1SKSA 4FK4A 4LZDA 3TFRA 3V6JA 2W42A 4IR1A 1VSHA 5KG1A 3ZSYA 4QZGA 3LPTA 1LB2B 2FPKA 1KVBA 3SI8A 1U9LA 7ICPA 1KCFA 3OYBA 3NH0A 5E41A 4KLIA 3LWMA 3UQ0A 3OYIA 3ZSXA 4DTRA 3V7LA 1XSNA 4FJLA 3PR4A 4RNNA 1ZQAA 2BE2A 9ICGA 3ZSZA 4GXKA 4J2AA 3C5GA 3MBYA 1JLGA 1JXBA 3DOKA 2W9BA 4CJTA 3G6YA 4EZ6A 5CA7A 7ICHA 2PFPA 1QSLA 2D0AA 1VRUA 3KHRA 1RT1A 3ZT3A 5CJ7A 2BQUA 2ZJAA 1HYZA 4LH5A 2Y1JA 4CJRA 4W5NA 4O44A 4B9LA 3G6VA 4E7KA 3AA5X 9ICQA 2ZUBA 2V4QA 4TURA 3IG1A 4ED2A 4P4MA 5CY4A 4I2FA 2HB5A 5FRNA 4ECRA 5HP4A 4GLXA 3HL8A 3Q8SB 3AVHA 4CGDA 1RT2A 3LPUA 3UPQA 3V1OA 4B9TA 4PHDA 4FZXC 5KFIA 1ZQVA 2XY8A 3RJHA 2HHVA 4OGCA 5DQIA 3BJYA 3RBEA 3NCIA 2VWJA 3BQ0A 3U3GA 5DGBA 3VQ6A 3QETA 9ICEA 4O3RA 5KFTA 3DLGA 2DTUA 4DTMA 4NCGA 9ICPA 1BIUA 9ICXA 2D0CA 3DMJA 3DLKA 4OKKA 3KTQA 1UOCA 3GFKB 3DRPA 4J2BA 3G10A 4DQIA 5J2DA 1T8EA 5HP1A 3KKRA 4F50A 4IFVA 4P4PA 3RR7A 1RBTA 1QSSA 1ZQZA 4MFCA 2V9WA 3NGZA 3DLBA 3HSTB 5FROA 1TVRA 5JS1A 3V7KA 4KLHA 3SUPA 1XHXA 4F5QA 2X74A 3PO5A 3RH4A 2Z1IA 4CJLA 2WOMA 5T7BA 4NYFA 5KT6A 4RW8A 3WNGA 3ISBA 4DSKA 4RW7A 4DL4A 1UT5A 4ECSA 3IHQB 3RH5A 3QEBZ 1ZQMA 3SQ4A 2G8IA 3U6FA 3TARA 4IFYA 8ICGA 3OYCA 2ALZA 3B6OA 3AVBA 2ZUCA 2IHMA 1PZNA 4Z4GA 5KFFA 2ZUDA 7ICEA 3P1GA 4GMJB 2P51A 4IRKA 4CF2A 2Y1IA 3QEXA 4FM0A 4GXIA 5KFQA 1H38A 4Z6EA 1NOYA 3MDAA 4M9NA 3QO9A 3KLFA 5KFRA 4PGXA 5CP2A 1CXUA 2P1JA 3D0PA 5KG6A 5EWGA 1NK9A 3BDPA 2PI5A 3AVCA 4YN4A 4P4OA 4B9MA 5KI6A 2PY5A 4MEYA 4EYHB 3AVKA 4B9VA 4Y1CA 4RQ7A 3TAMA 8ICAA 5CYMA 1COOA 4PGYA 4FLVA 4JUZA 5L1LA 1RBRA 1WSEA 3C2KA 2BPCA 3ISNC 3KHLA 5FDLA 4FJXA 3PW4A 4Z4FA 1XC9A 1TKXA 4QW9A 4TUPA 1ZQOA 3JPPA 2ATLA 3VN5A 4PY5A 8ICIA 2G8WA 1A5WA 4LVSA 1KVCA 3SI6A 4M3TA 1IKWA 5DMRA 3VQQA 4CJ5A 1FXXA 1VSIA 1U47A 3FDSA 4QZIA 3TR8A 4FJ9A 2KFNA 3NTUA 3SQ2A 2OZSA 4QOZB 2YNFA 3IM1A 1HMVA 4ED7A 2D0BA 4CJUA 1Z3EB 1HNIA 4CIFA 1ASWA 3MR3A 2R8HA 4I29A 4BACA 3ZSOA 3M8QA 2KZ3A 2OPQA 2V4RA 3KK3A 4K8ZA 1L3TA 4Q8EA 2I1QA 5CZ2A 1CXQA 3Q8KA 4H4OA 5KRTA 1S6PA 1KLNA 2VG6A 4FZYA 3V9UA 4CJEA 2UVUA 3VQDA 1JL2A 8ICUA 3HPGA 4RNOA 5DGAA 1NKCA 3I0RA 2JEJA 1Y88A 2P5OA 1VSDA 3LP1A 1JX4A 4PUOA 4LD0A 2BHNA 4YD1A 1NKEA 5J2PA 4Z4CA 3H40A 4OLAA 3JYTA 3L3VA 3GIMA 4IG0A 4NM2A 1ZQKA 5HRNA 4FYDA 4EP4A 4DFJA 3DYAA 1Q9YA 4ELTA 1Q8IA 3HP9A 3RJFA 5KG2A 4YR3A 5BOMA 4F5RA 5J2CA 2UVRA 4YXJA 4FBTA 2OYQA 1BIZA 3K59A 1CUKA 1QHTA 4DL3A 3M9OB 3ZDDA 5KFDA 1RDAA 4P2HA 3PR5B 1YTAA 3Q8LA 4MFAA 3AO5A 2MAXA 4TQSA 4Q45A 4LZGA 2F1HA 1KFSA 4QAGA 1ZJMA 3OYLA 2HHXA 1NKBA 4E7IA 4CFCA 7ICVA 7ICRA 5KFCA 3WNHA 2B5JA 3H8SA 3PMNA 4CK2A 3TANA 2W9AA 1CLQA 9ICVA 5D46A 4DQQA 4KHYA 3KLEA 9ICKA 4PHAA 5J2HA 4ED0A 4DEZA 5SWMA 3SZ2A 1NK6A 4KAZA 8ICEA 3ULDA 2ISOA 1RT6A 3K5OA 3SUNA 4EEYA 7ICJA 1WAJA 3ISDA 4ZHRA 1BPEA 3TQ1A 4J9OA 4NCAA 4O55A 3VQBA 3RMCA 4FLUA 4JWNA 3C95A 4YQWA 8ICFA 5DDYA 4R5PA 1BHLA 4ECTA 1JIHA 3H7IA 4DL6A 3LP3A 1UA0A 4ELUA 3KD1E 2FLLA 8ICRA 2ITGA 3TFSA 2GUIA 3L2UA 3FFIA 1IKYA 3ZT0A 3PMLA 3UIQA 5KFXA 2H5XA 3JPQA 3DRRA 4MF8A 1D5AA 3TAPA 1GOBA 4RQ3A 4JLHA 9ICMA 4QZ9A 7ICNA 4CHNA 4HCCA 4DSLA 1U4BA 3C6TA 3KJVA 3UXNA 4KLUA 1S9FA 3ZT1A 4I2GA 4YNQA 3ZDEA 4CJQA 1TV6A 4CK1A 4CJWA 1ZQLA 4ELVA 4KITB 3PO4A 4KLGA 2BCRA 4CF0A 2OPRA 1RTIA 4NLNA 4QZ8A 1LAVA 3VQPA 1RTHA 4KKOA 5KT5A 1WSHA 1BPZA 3RB6A 4DLEA 3HO1A 1RBSA 1TKDA 4N41A 2PFOA 2IGIA 3CG7A 1X9WA 4GXJA 2XCPA 1ZQPA 4DTJA 3QIOA 5SZTA 4J9LA 1A77A 4N76A 4UB2A 2G8FA 2YNHA 3T5JA 4OJRA 3GILA 8ICVA 2W8LA 2Z1HA 1S6QA 2HVIA 1S1UA 5L1IA 3B6PA 4O5BA 5DBAA 3GIJA 4NLZA 2ZD1A 3O4QA 4UAYA 2UVWA 8ICMA 4B8CA 1DTQA 4FLXA 4DMNA 1HQUA 4PQUA 3G6XA 3HYFA 3DOLA 5J2FA 4Z4HA 4KLTA 3AO2A 3L3UA 4AHCA 5KGWA 3SNNA 1JKHA 1ZJNA 2IMWP 4E7HA 2HNYA 2J6TA 3Q8MA 3D45A 3JPSA 4F4XA 4KLQA 1RTDA 3RBDA 4YG2A 1ZQCA 3C6UA 4KHWA 4IQWA 2R8GA 4BWMA 5HHIA 4DQRA 4M2YA 1BCMA 3K58A 3NGIA 3N97B 4B08A 4M9JA 4DU4A 1NK7A 2FBXA 1RNHA 4QWCA 1KDHA 4YXMA 4KB1A 5DDMA 4I2DA 1RDBA 3HPHA 2FLNA 5D4BA 1SV5A 3BGRA 3EY1A 1A76A 2BCSA 5BOLA 1L3UA 1DTTA 1Z26A 1S77D 3NF7A 5F9LA 1QE1A 4BDPA 1ZBUA 3NH2A 2YHAA 8ICPA 1YT3A 4KLEA 4PHEA 3PV8A 1D9DA 5CHGA 4M3UA 1WNSA 4CJ4A 2FPMA 1CZBA 5KFAA 1WSJA 3F73A 3V81A 2X78A 3VQAA 2A1SA 3AU2A 4Q43A 4DF4A 4KLJA 4E19A 2AGQA 2YNGA 4O3PA 2YKMA 4J2EA 4K4HA 2F8TA 3L2VA 4HTUA 4CECA 1ZBLA 3BQ2A 3I8DA 1JL1A 4CF1A 4RZRA 5DG7A 1TL3A 4CHZA 4M3ZA 1ZQTA 1DGSA 1WSIA 2JZBB 5J2MA 4M9HA 4MFBA 5CWRA 1QS4A 3ZD9A 4O0IA 4FJKA 1Y97A 1T7PA 1JXEA 2E4LA 1FK9A 1B43A 2BGWA 5C25A 3HP6A 4W5RA 4O3QA 3ZCMA 1LV5A 1HJPA 1S97A 4DSFA 5HRPA 5KFOA 4FW1A 9ICWA 1EETA 4CGGA 4DTOA 4TUQA 4I2PA 2MUTB 5EU7A 1RILA 5IIOA 4WE1A 3E2EA 1DOQA 3AV9A 2DPIA 3RMAA 1JLCA 3OSPA 1HNVA 4R8UB 2BANA 4Q44A 1U45A 5DBBA 1SL2A 3M9MB 4RNMA 3V4IA 1B9DA 2O4GA 4CGJA 4RQ5A 3MGIA 3AVIA 2FLPA 3HX0A 1GOCA 3ASMA 3IS9A 4RW4A 5HROA 4LSNA 3PUFA 4IKFA 1KVAA 3UXOA 1JLFA 3IRXA 1IH7A 4O3SA 4JS4A 4I9QA 3MR2A 3EPGA 1NJYA 1ZQWA 4ED8A 3RB0A 3SYZA 3C2MA 1ZQUA 1SKRA 5K14A 4CEDA 2YKNA 4MQ3A 5KT7A 3LZIA 4UAWA 5IIIA 5HMMA 1VSKA 2ZJ8A 9ICSA 4FJGA 4NLKA 1IO2A 2O4IA 4CHQA 1D8LA 1I3AA 4Q8FA 4DS5A 4QWAA 1C6VA 5DB7A 2NRVA 4YMNA 2MUTA 2EHGA 2XO7A 4J9NA 5DLFA 4UB1A 4W5OA 4OPJA 5DQHA 1C7YA 2HVHA 3CFRA 5KFLA 4CHPA 4RT2A 4IRDA 2IBKA 5D49A 1CZ9A 4R8UA 4EYIB 1N6QA 4KI4A 2Q0ZX 1XSLA 1KLMA 4H4MA 4DSIA 3QINA 1MQ3A 2RDIA 4CEFA 4JV1A 1ITGA 3H8WA 1BCOA 3EWAA 2ZE2A 1L3SA 4CEAA 4JK1A 3C23A 3AO3A 4O3OA 2KFZA 3F9KA 4IG3A 3MR6A 3RWUA 3KHGA 2BQ3A 3VQ5A 4FJ8A 2NUBA 1QTMA 4DOCA 7ICLA 4R64A 1S1VA 1ZQQA 1W0HA 3LZJA 4I2HA 1N48A 2NRZA 4QZCA 4I2QA 4AH9A 4B9NA 4E7JA 1EKEA 3RJIA 2DFLA 2HNDA 3RRGA 4CCHA 3SQ1A 3ISCA 3ZDBA 9ICOA 1RXVA 4FJ7A 2RDJA 4C8MA 4KLSA 4HYKA 5KFJA 3RAXA 2BPGA 5L9XA 3MR5A 4Z6DA 1NK5A 3SCXA 1RDDA 3OYJA 1LW0A 3K57A 2C2DA 4ZTFA 1MSWD 4CEZA 4DLGA 1S9GA 3NH1A 4QZEA 3GV8B 3CFPA 3OYFA 2XGPA 1R0AA 2EX3A 2M9NA 3T3FA 4RU9A 1LW2A 2AU0A 1EXNA 3KLHA 5J2KA 1ZBFA 3H4DA 5J2QA 3C21A 2WONA 1G15A 3K4GA 1XWLA 3NBPA 2XC9A 1YVUA 3PW2A
chains in the Genus database with same CATH superfamily
3UCZP 3MR7A 1RXWA 3ZNJ1 2IM0A 1Y5IB 1WUUA 3I31A 1WUAA 2F4VK 2E5GA 5DM6L 2F8MA 3M2RB 4DV2F 2YQEA 2UUBK 4DTXA 1NUEA 5J8YA 3VQCA 3QEVA 2DJWA 1H7WA 5AXNA 4WYWA 9ICRA 2BQRA 2E2QA 5DRKA 5DETA 2DL0A 4RLEA 2XYPB 3D6TB 3PX0A 2B6GA 3HJFA 2KD1A 2AEMA 5JMNA 1B3TA 2IBOA 4E0DA 4Y0WA 3C66A 2G8UA 3ZEUB 3MM5A 3QZ7A 4UY8O 1CLFA 4LF5F 4IQUA 2FJVA 3S01A 4NLVA 4O5KA 2F5GA 3F0NA 4ICLB 3WIVA 5AM3A 2VHGA 3DLHA 2C2EA 1HUOA 2NLWA 2VG7A 4BRAA 1S10A 2AYGA 5AE2A 3VALA 4KRWA 1JUDA 1J2VA 1VAZA 5AKXA 4UOCA 5L39A 4C9DA 1WG4A 2MQOA 2GGPB 3PKYA 3UFCX 3TNVA 1VQKN 2W9CB 1U8WA 4Y2SA 2LVWA 1SV0C 4DR3F 4NI2B 3H6EA 4WKYA 5AJ3K 1X66A 1VHFA 9ICCA 4FWKA 4LFCJ 4JK9A 4C2MA 2B4OA 4NEZA 3J81U 1BISA 4YY3K 1ZQHA 1ED1A 1HNZJ 2IYGA 4DR4J 2EPIA 3H8JA 1F21A 3ILIA 1O6XA 3CXCR 1X3NA 3EPIA 2GO8A 3RBZA 1DQ9A 1V3ZA 2OEJA 4A8FA 2K89A 2HHPA 4FOEA 4HLBA 4MLEA 4FWRA 1IBMF 2Q6BA 1HYSB 2G07A 1GOAA 1NJZA 1ZAVA 2HW3A 3VQ4A 2KT2A 3HI9A 4FVMA 3IA0A 4CTAA 1IJJA 2RE1A 1VQ8N 1FKOB 3LUYA 2ILZA 3KHYA 1VLOA 2PA3A 4NZ0A 1NGJA 2YTCA 4CF4A 4U7UD 5AQQA 4OCZA 4Z6FA 3EGNA 4RCHA 3PIPQ 3CNQP 3BSCA 4YDUA 2JWLA 4EP5A 2CWKA 2RKIA 1IBLJ 4DV0F 4Z4IA 1ELOA 4OJHA 3TSQA 2Q79A 2I5JB 2WZ1A 4C11B 5DBCA 4CBUA 2CJ9A 3HD2A 2D0PA 8ICWA 4OX7A 1NM2A 4KV8B 1Q81T 4NLRA 5E5NA 1QH9A 1J5EJ 4O8KA 3P6YC 1VRQC 3EO3A 1XEZA 2APOA 3JSMA 5CZVA 1XR5A 3WKAA 1QSYA 1N5VA 4UQGA 3OYGA 1C0TA 4KMUA 5L9NA 4HUEA 3UN2A 2ZJRQ 2HHHK 2X6SA 2GC8A 4PWWA 3NAIA 4CZKA 4IH7A 2P9GA 4WFNL 3VZHA 4PRFA 8ICKA 5EE0A 4MJKA 1D0EA 1GXUA 4ISGA 2M8DB 4U7UK 3L95X 1L8OA 3THVA 2DVIA 1NZBA 2OSRA 4BG9A 3RMDA 1ASUA 1U1RA 1Q7LB 2JEFA 5EX5A 4QIWF 1RTZA 4GV6A 4BQZA 2J9DA 3SPYA 5AK6A 2BKEA 4QBUA 5AI4A 5E3AA 3GV7B 5GAHP 2FVQA 4LSLA 1Z4UA 4W5QA 3PG9A 4OX9J 1FTRA 3TJ8A 2E5IA 3CCUS 3ULEA 2PFQA 2V2QA 2B8QA 2V6AA 4DUZJ 2XRIA 3M6ZA 1JLAB 1WF0A 4ZK7M 2QA4N 4US9A 2F2AB 4L8RB 2FSKA 1RT5B 3AVFA 5DG9A 3UN5A 1DLOB 2JNJA 5KTQA 1KQFB 4ZOHC 3LVVA 2G5HB 2CN1A 1C0FA 5A8WB 3SDEB 3T9ZA 4P2SA 1KQSR 1UAWA 3IBFB 2VFRA 1FIQA 2FTRA 4LF8K 4BRPA 4FZZA 3VR1A 2P6RA 1FKPB 2AQ4A 3C7NB 1OXJA 2HFSA 2MY7A 1WACA 1VQON 3BS9A 4PEOA 4CZFA 2CADA 1SXLA 2GWJA 2BOAA 2ZXHA 2VASA 4I64A 4J03A 3QRPA 2D3DA 3UVJB 1T3VA 2Y0SC 2ZITA 1Y3JA 2M2BA 4JHDB 3UDVA 1I94K 2F96A 1BI4B 9ICLA 2MKCA 2QG9B 2PE8A 3ISND 3RFAA 1SUQA 4LF7J 2IHNA 2CNKB 1PYOB 4F3TA 3T41A 4P2FA 5KG3A 2JSXA 4M42A 1X2IA 1F5AA 2RS8A 3FE1A 3O1LA 3QFUA 1LWEB 1EP4B 3HULA 1RP5A 1TUVA 4DR5F 4TSXA 4A57A 2M88A 1R6VA 3ZTQA 4Y2PA 1IV0A 2IRYA 3K5MA 4ZCIA 2DFHA 4W90B 9ICBA 1U8SA 1GLDG 5J2EA 4OI1A 4TYBA 1YJTA 4B3OA 2E2NA 3CF5Q 3BSNA 2CXYA 2CZ9A 2YY6A 2GVDA 3AM9A 4J9MA 2JGAA 5C7PA 2ATCB 1PC5A 2Z4PA 1RBLA 4H03B 3O3HA 2E7VA 2FHOB 5I42A 1TL1B 3N28A 2CGJA 1FX4A 3H0PA 1UCVA 1C1BA 1YDLA 1X6JA 3G8SA 4RNHA 4CFBA 4OYAA 4AHTA 2ZJ5A 2HQ3A 4WFAQ 3OGUA 4BDZA 1XNRF 3ZX3A 2VDIA 4J9SA 1IR1A 5JICA 4G1QB 2PKEA 4CERA 2HVDA 5EE3A 4X65F 4BVOA 3VQSA 4M3WA 1JLEB 3W3DA 4FW2A 1JK9B 3Q0AA 2HDOA 4QWDA 2QWQA 5LOQA 1VSFA 4E89A 3TAQA 4M45A 5T7LA 4DTUA 3DKDA 2B6AA 2CG8A 3D4JA 4F2SA 3EGVA 2JZBA 2MQMA 3ZFVA 7ICQA 4MN4C 4B1VA 2YY3A 2VWKA 3AH6A 1YJ9N 3QNNA 1HBOA 3CCSN 3MXMA 1B99A 4IOXA 3JAMU 4TQRA 3PSIA 4ZP7A 2LXUA 4CLZA 1F1BB 3LALA 1IQZA 5CZ1A 4CF9A 3UD4P 1AA1B 3N6LA 3TA2A 4YB1P 1ICEB 1UAXA 1KRPA 2GMHA 2Y8YA 2ALYB 9ICJA 5HMXA 2V2VA 4BY9C 8ICLA 4C3LA 1N36J 5ELZA 4JK7A 2GAHC 3W2WB 3FUYA 4CJ7A 4L76A 4P0QA 3KLFB 4KGKA 2ROEA 4EENA 4LSZB 2BTFA 3KUGA 3MMJA 3MMCB 2WAQC 3ZSQA 4DL5A 4F25A 2XMUA 4ILHA 2Q36A 2VIXA 2HF4A 4YR2A 4BGAA 1LXNA 2DK2A 1ZPVA 2I9SA 3HPOA 1WHYA 3PIOL 2IS3A 2YKAA 1U6FA 3SV3A 3FRYA 4OKEA 5IIMA 4BRIA 2XICA 3ELHA 4H54A 2HS3A 5K8PA 2QWLA 2X3DA 1KSPA 4DR7F 2PFFB 1JMSA 2P9PB 1YRXA 4F5NA 3CYMA 3U1NA 3ID8A 2E8AA 2DCUB 2YHYA 1O51A 1S99A 3HVTB 1OY6A 3WC0A 2OAUA 3K5LA 2KQ2A 8ICNA 5RUBA 4A8YA 3QGGA 1HPMA 4RPZA 3ETRA 2J0QD 2QKBA 1HEKA 2WF9A 3NF8A 3NWGA 2LFVA 3KK1B 3KK7A 1MQ2A 1UA1A 4IQTA 1T44A 2L5YA 4KHRA 1V97A 1ECWA 1H73A 4I7FB 2HS0A 3P8BB 4C8OA 2JL9A 1GXLA 3L09A 5CYQA 2XWYA 1WHWA 2C1EB 4KREA 4PPDA 2VG6B 3O6QA 4DTPA 4CJSA 1WG1A 1BL3A 3U9DA 9ATCB 1OMSA 1GEHA 3CETA 1VRTB 4F93B 1L7OA 5J0UA 2CG4A 3I0SA 5HQ8A 4NV0A 2K8GA 1LEOA 4F3MA 2AGOA 1Z1ZA 5AQUA 3LGNA 2JHDA 2VA2A 1FRHA 1H1VA 5J2NB 4CLPA 2L9NA 2PFDA 5J2PB 3CMAS 3RRHA 1NGBA 4Y2YA 4RW9A 2MSTA 3C16B 1PG5B 3MURP 2GH1A 2KG5A 4RQNA 4O4GA 4PYAA 4U8VA 1N5SA 4CESA 2GAGC 3GQCA 1YIJN 4A8SA 5ALQA 5HBMB 1RT3A 2UXCJ 1XQSC 1JNZB 3U02A 1C2PA 4NCBA 4IDKA 4ZIVA 1Y5LB 3MDCA 4TUSA 3ALRA 3CIZA 5F0XA 4RO0A 3ZX0A 4CH7A 3EEQA 3MGHA 1TMMA 4JI1F 4HKQA 3VA3A 2C22A 1NGIA 4OPKA 7ICKA 4H0YB 4NLXA 1TK0A 1JLQA 3LP0A 2OO4A 4CRJA 3M9NB 2YMQA 2IA6A 4Q0BB 3R8YA 2KHVA 2PBDA 2F8SA 2XZTB 4CO0A 4OYMA 1X42A 2P9KA 4CO2A 2P9SA 4KRFA 3E0FA 4PG4A 4N5SA 5AQNA 3J80O 4NPOA 1DKGD 2V94A 4HVJA 3QESA 4FZNA 2JOQA 3QXGA 1G2EA 2HAFA 1HUZA 2G2YA 3M8SA 3DEEA 3SBMA 4DR2J 4Y2JA 3CIPA 1HPZB 5KT3A 3U1MA 4F4AA 1FEZA 4BR4A 3VVUA 4F36A 1KVJA 1UWAA 3R7BB 4DO9A 2E8NA 1T6CA 2JR5A 2LECA 1D8YA 4JEPA 4OQJA 3C1YA 4PL1A 1TKZA 2E1YA 2YX1A 2ZZNA 5J0SA 3BYRA 3PX6A 4HHUA 3G0ZA 1BWFO 5AI8A 5EOZA 1RBUA 1NEEA 1RSCA 3EWGA 4XRHA 1HKBA 2UUTA 1NK8A 3CJ1A 3DRSA 4WJBA 2XY5A 3NS6A 2W7OA 1K8KA 3LGMA 3LAKA 1ZS6A 4OHXA 4YHHJ 1WCLA 3AA9A 4QZAA 4FK0A 4PJ0U 1RDRA 2PYJA 5DB8A 1NK0A 2QB0B 3NY0A 1KHVA 2MHNA 1AFIA 1J53A 2YH1A 5A0YB 3ETMA 4JI7J 4HACB 4KLOA 1W7AA 1REVB 2UXBJ 1T4GA 2G8VA 3SV4A 5HRRA 1Q95G 3BZQA 3SSQA 3EZOA 3R5CA 2GIFA 1WUDA 1YBUA 2W9MA 1TAQA 2YB4A 1C0MA 4DR1K 4HHHA 1VISA 4EAHD 2UU9K 4RUAA 2QWMA 5K8NA 5C24A 3KLGB 1KD1O 1WB9A 3D68A 1N33J 1R0CB 3IXQA 3OR1A 1FVSA 5THWA 2CJKA 2B4JA 2K1RA 4UAVA 4LF1A 4RX6A 1ZRNA 5IT9O 4M5JA 4CGIA 3NFAA 4P7VA 3CD0A 3R9KA 4I2JA 4B3TF 1FXDA 3VTHA 3MTKA 3HXMA 4Y2QA 2DGTA 1JJ4A 2ZIXA 5FRMA 1ZA1B 2WFAA 1JKHB 3CUNA 4NE9C 3ONQA 3AOCA 2XS7A 1RDWX 3LP2B 2ZBCA 4MMOA 3EVMA 2ZWHA 5CD4H 3QEWA 1HNWK 2YNIA 1Q86O 3QICA 2VG5B 3QIPB 2KIVA 4BR2A 2FMSA 3HSDA 1MG7A 2WB1D 4Y3CA 1CPZA 4DUYJ 1Z00A 1CI4A 4KFBB 4CI6A 5HLFA 2HZVA 1VSJA 4YMOA 1UVJA 1RTJB 3W8GA 5KT2A 4M6WA 1HRHA 5A76A 3OYKA 3H1VX 2RQMA 4FM1A 1N5WA 4BXOB 3MTJA 1K73T 4USAA 2XQCA 3D7SB 2QWRA 1B0VA 2U1AA 4JI6K 3OS2A 4OKJA 2ZH9A 2BYCA 2AQ0A 1V9PA 2XI3A 1O0PA 1KEKA 4LY7A 4JI5F 3HMJG 1GMWD 4E2FB 4FLZA 2UUCF 1XMQK 1IUJA 2K06A 2V67A 5J2JA 4Y6IA 1IIPA 3KG1A 1NM1A 5CCLA 2VZ9A 4F71A 4CVNE 3D6FB 3HSCA 4CIEA 3S3OA 1VHXA 3S3MA 3VCBA 4U9RA 2FB0A 4M47A 2HVZA 2ES6A 4FJ5A 1Q9XA 2I38A 3RBXA 2F4VF 1UZHA 1F9FA 4OPHA 3A2FA 3JPTA 2XMWA 3DGPB 1M5KC 3DNCA 3BREA 2YHWA 3BPSP 3HBTA 4DX6A 3OS0A 2ZC4A 4FCYA 2XI2A 3CC2S 5C2DA 4CE6A 1XMOK 5C42A 2WF8A 1RBOB 2F8HA 1JLGB 1YJUA 4RPXA 4OJGA 4CJ3A 1RHJB 3VAHA 3QWUA 3A5OC 1VQ5S 1SBRA 7ICGA 3AOBA 2Q6CA 3KXDA 2XYHB 2YX4A 4ZP9A 3C7NA 5CCMA 4O44B 3GSIA 4J90A 4ERDA 2P9UB 2RRNA 5C25B 5J8YC 2GS8A 3HSZA 3ZSYA 1NGHA 3LM2A 1BQXA 5FPMA 3UVJA 1UPPA 2FPKA 1YZ6A 4FWSA 4I2PB 1U9LA 1RT2B 3NH0A 1VMBA 1YQHA 1FEHA 3C28A 4FJLA 3PR4A 4RNNA 3ZSZA 3KKAC 5M2PA 2RH3A 3MBYA 1YSJA 2W9BA 1JLFB 4EZ6A 7ICHA 4CNYA 2ZWOA 2W25A 1VIOA 3DLKB 3A5MC 1VRUA 1YJNN 3UKUB 3G8TA 2O8DB 3ZT3A 5CJ7A 5GIPA 1YJWN 2FPHX 2ZBRA 4CJRA 3G6VA 3E9LA 2UXDF 4TURA 1IVZA 4WCEL 5CY4A 4I2FA 2HB5A 3SSSA 5FRNA 4O0NA 4KGMA 4ECRA 3Q8SB 4CGDA 5DM6Q 2ZBPA 4JI8K 3UPQA 3V1OA 4B9TA 1GAOA 1SQEA 1SWVA 2XY8A 4OZ1A 2YQ1A 2N7YA 2MLYA 5ETRA 1MA7A 2HOQA 1ATSA 3MN6A 2YWHA 2VB6A 2A0FB 3AARA 2Q1LA 3QFPA 4GKJJ 1GLCG 2GELA 3CC7S 2DTUA 5C15A 3SBGA 2JHEA 4NCGA 5LM7E 3C29A 1BIUA 9ICXA 3GFKB 4NLOA 1T8EA 2MHEA 2VU5A 2IA0A 3L3CA 4IOBA 4F50A 2WVBA 3RR7A 1YG0A 1RBTA 1QSSA 4P9SA 2W04A 5G5GA 2HEKA 3NGZA 3FEZA 4OMFG 5AK5A 4YDUC 3V7KA 1S1VB 3J7AN 2ZEJA 3D1HA 2DHGA 1XHXA 1NLVA 3M1FA 1U0SA 5BR8K 3RH4A 2Z1IA 3B8AX 1N32F 3DGVA 2CQ1A 3O44A 2GJFA 3TAMB 4KAIA 5CA5A 5CYMB 2WF6A 5HATA 2G8IA 4IQXA 4IFYA 5D0EA 3B6OA 2H3VA 3O1BA 2IHMA 3KZIU 2JWNA 1PZNA 4Z4GA 1D09B 4BJQA 4FYXB 2SXLA 1CRXA 5CYJA 3T1HJ 8AT1B 4GMJB 3F2CA 1IKWB 2LA6A 3W2WA 4IRKA 4FM0A 1WSVA 4OX8A 5F8LA 3LDNA 2KSOA 3KLFA 3QO9A 2HI0A 5KFRA 3PCOB 3TR5A 5CP2A 4C0OC 3D0PA 5EWGA 3THTA 1HNIB 4YN4A 2CGLA 4B9MA 2M3DA 2OFHX 5BYRA 1YWXA 1VJWA 1RK8A 3M8QB 2CQPA 3CJBA 3OFEA 2WFBA 4JUZA 5L1LA 1RBRA 1WSEA 4O8UA 3B4DA 4LRAA 2BPCA 4JB8B 3KHLA 3BN4A 5FDLA 5HANA 2JRZA 3IV6A 5IXUA 5GAHI 5CR4A 4MT1A 3JPPA 4WK1A 5E0OA 2C2OB 2VFTA 8ICIA 4H4KA 1V5VA 1KVCA 3E3XA 2BJ9A 2P9PA 1FXXA 2QARA 1U47A 3U7JA 3J81Y 3LP1B 1MA9B 4WZQA 4JB3A 3CSKA 2IFXA 3D1QA 3SQ2A 2OZSA 4DV5F 1MMNA 2V9KA 2D0BA 4G65A 1NI3A 4DR6K 4IG0B 4US8A 1Z3EB 1RWOB 3QATA 2MKIA 2MJUA 4CIFA 3MR3A 4CD1A 2R8HA 2HRTA 2VFUA 1TELA 2V68A 2WHEA 1HNXJ 4WFNQ 1G99A 2O66A 2V4RA 3GG1A 2OFGX 2OMOA 3MCPA 2DGWA 5CZ2A 1CXQA 2IVPA 1S6PA 2VG6A 4YOUA 1NG9A 4MK7A 4QYZJ 3AJ1A 4LFAF 5LXRA 2I6XA 8ICUA 5DGAA 1NKCA 5AQVA 2P5OA 3BF3A 1UMJA 4OJ3A 6AT1B 5JVHL 5AK3A 1FXRA 5J2PA 4OLAA 4Z4CA 3H40A 4OZ2A 3L3VA 1FNMA 5HRNA 4V19J 4EP4A 3R5DA 4ISFA 4ELTA 2UYTA 3HP9A 2W7AA 3PXGa 4CF3A 1UVNA 4YXJA 3PM9A 1BIZA 4ZCKA 4DL3A 5MLCV 1WHXA 3EUNA 4B17A 2ZM6J 2FVCA 3VF4A 4DMZA 3AAWB 4P2HA 4TLQA 3DXMB 3PR5B 1YTAA 3Q8LA 4MFAA 2KLAA 3ID6A 5MAOA 4LZGA 4TY8A 2F1HA 4C0ZA 4QAGA 3I5AA 1GNKA 3KOOA 3M8ZA 3MPDA 1TTHB 1EWQA 4URQU 4E7IA 3IM8A 3FFIB 3JS6A 3BZKA 4M1KA 3MX5A 4LUBA 2ASYA 1HD1A 2H3IA 4JYAK 3QGIA 1U2VB 1CLQA 3VEVA 9ICVA 2CWXA 4KHYA 1HNZK 3KLEA 4DR4K 1OS5A 1P9QC 1OH7A 4PHAA 5DDPC 3X1LB 4DEZA 4P6QA 1J97A 3ULDA 3SUNA 1HJOA 2ZC3A 2PMZF 1QUVA 4AFFA 3CQXA 2CPJA 1S3XA 1TV6B 3BEGB 4J9OA 4NCAA 4O55A 1VC5A 1FJEB 4FLUA 1VIXA 1M5HA 4A5BA 2WVCA 3I9ZA 2ZKUA 1QUPA 2LM4A 3FMWA 1NNLA 5FD1A 2ZWPA 3NXZA 2DD8S 5JLFA 2RJZA 4BHQA 3OTDA 1OJ4A 1G1XA 2WBNA 1IKYA 2EXUA 3FSXA 4FE3A 1SI9A 4OHVA 2U2FA 4FYWB 3NS1A 2ZG6A 2QT7A 3MK6A 2NRHA 3JPQA 3IR6B 1GOBA 4FPRA 4JD2B 2IM2A 4QZ9A 1S1UB 3GMGA 5K5MA 4CHNA 4DSLA 1U4BA 3CD6S 3KJVA 3P5BP 3UXNA 2UUAJ 3ZT1A 4GV3A 2QB0A 1HQUB 4YNQA 5A0YA 4CK1A 5EX0A 4DV4K 1VQPN 4KITB 2YQ0A 4HACA 4QZ8A 5EHHA 1RTHA 1Y7PA 1SB6A 3M8YA 2VKRA 3BS7A 2FIUA 2HNYB 1P1TA 4C0HA 2VPWB 4N41A 2O8EB 2YPZA 2PFOA 3KOAA 1HKAA 4OI6A 4Y28C 2XBPA 2G8FA 2YNHA 2HIYA 1NNDA 5BPLA 3T5JA 5DS7A 5AM2A 5KOXA 3H2UB 8ICVA 2W8LA 2Z1HA 3SMPA 1X4EA 2RLTA 3MMBB 1W2BM 2YPYA 3B6PA 1L6NA 3GWCA 4O5BA 5DBAA 3C19A 1C0UB 2XMTA 4DMNA 3P45B 1RHRB 5J2FA 2D41A 5ADXH 3WDOA 1JI7A 2AKWB 4Z37A 3NVMA 3AO2A 3J8AA 3L3UA 1DTTB 1LOUA 4AHCA 4P2XA 4ZVFA 4OX9K 1JKHA 1QE1B 4A2AA 3I1YA 3Q8MA 3P49B 3SCIE 3D45A 1CJVB 3JPSA 2VDHA 1EQYA 1TAMA 5M2UA 4DCOB 1RTDA 4EMDA 1WKLA 2KT5A 2QA1A 2CNLB 1WYGA 3FZLA 4DQRA 1Z1BA 1ZC6A 3HHDA 3EE8A 3PZPA 4BS2A 4XH4A 4B08A 4UF4A 1VQ7N 1NK7A 1X9XA 4QYRA 1MNEA 3WXMB 2ROGA 4QQBA 2AJ0A 2YKMB 2QEXS 2YI1A 4KB1A 3MCSA 5KPZA 1RAOA 3P96A 1GLLO 2W24A 2BX6A 5D4BA 2ZVSA 2DRDA 1T3QA 3EY1A 1KOHA 1QZ6A 2BCSA 4OL8A 4MFBB 4BDPA 3PV8A 3DXKA 1FK9B 4G9BA 2OHDA 1WNSA 2F1FA 3JAMY 1CZBA 3F73A 3VQAA 1Q82O 1XIQA 3C15B 3GCXP 3AU2A 4LF7K 5AZJB 4IO8A 1FRJA 3I56S 2I5HA 2AGQA 2LXIA 2YNGA 3DGPA 2A10A 1T9TA 4LBPA 1JLCB 3HFVA 3TUIC 1M1GA 1YBAA 3RUBL 4HTUA 5AI6A 2XM3A 5AM0A 2GZOA 2POKA 5AFUH 1PBUA 4K4VA 4CT8A 3QRQA 1ILYA 3BF4A 4RW4B 4LSNB 1WSIA 3N0VA 3IRXB 2H5JB 3ATUA 4M9HA 5F8HA 5CWRA 3TO8A 1J6ZA 3ZD9A 1A7GE 4I6YA 5K14B 1SC3B 1TFYA 3H98A 2AT1B 1T9VA 2BGWA 3H42A 3PFOA 5C25A 4O3QA 2RE2A 3M1VB 1LV5A 1HJPA 2KL8A 2EAPA 2AJ1A 5KFOA 3EVOA 3PSTA 2D7SA 2CH5A 4I2PA 2BJDA 4C7ZA 1SKUB 5HVHA 5IIOA 1DOQA 3FCHA 2V51B 3RMAA 3OSPA 2IVFB 1HNVA 3VAJA 5FPDA 1H7XA 3HRDD 5DBBA 1SL2A 4DHVA 1TP7A 3M9MB 2HPUA 4QOTA 2MGZB 1B9DA 2O4GA 2F9DA 3AVIA 3MGIA 3O1WA 2FLPA 4H4MB 3HX0A 3ASMA 3IS9A 5HROA 1X4AA 1JLFA 3Q7BA 4O3SA 3MR2A 3RB0A 2H3FA 3VV2B 1HBNB 4PKGA 2Y0SF 3C14A 2EKNA 2NPIA 5KT7A 4MQ3A 1M90O 4JI4J 2D9PA 1IBKF 5HMMA 5SUHA 2ZJ8A 4B3MF 5IQ6A 5LMNK 2O4IA 2Y3YA 2RIJA 3ZZYA 3D66A 5FLXU 4QWAA 5GMDA 3A3PB 3QJJA 4ZVUB 1QM9A 4WJ3B 4OPJA 1C7YA 3CFRA 4CHPA 2G9OA 1Y64A 2HNDB 1AB8A 1HBMA 2YJFA 5D49A 4R8UA 1PVRA 1N8RT 2DYAA 3QFWA 2YBVA 2Q0ZX 3TACB 4C4WA 4LBIA 3H5YA 1N63A 3CJ5A 1WDTA 3CEDA 4KR0B 2OTLN 2LDIA 3M30B 3ZETA 3MN5A 3F2BA 3HM8A 2YN4A 2VD3A 2ZE2A 4A2BA 5JLHA 4NLUA 1NNEA 4GIBA 1RWPB 3EKSA 3FZMA 3R97A 1OYEA 3RWUA 4LIRA 1X4CA 3VQ5A 1SZ2A 5J2QB 4PZNA 2WONB 4J7CA 3LF0A 1S1VA 1W0HA 4I2HA 3UO0A 4AYBD 4AH9A 3RJIA 5IM0A 5IWAJ 5CRXA 3SCLE 3ZDBA 9ICOA 4CYUB 3SMVA 1JLBB 3GYGA 4FJ7A 2B51A 3QMLA 2H9ZA 4C8MA 2QRRA 4QS9A 3N5BA 4OYXA 3QGHA 2BPGA 3X3UA 5L9XA 2FF3B 3MR5A 4Z6DA 2H3QA 2B7BB 4RBVA 2XSJB 2D1KA 3OYJA 4JI6F 3NH1A 1UEVA 5E7OB 3CGIA 5D78A 3VF0B 1VQLS 2EX3A 1XMQF 2ROPA 1RA7A 2ZIVB 1TZ0A 3IFEA 3DU5A 3MEDB 1LW2A 3OTBA 2VQFJ 2FVRA 4K4TA 2DO4A 4Y65A 3DM2B 2XZDB 3M7DA 4LJMA 2PSZA 4YN3B 4OHZA 4TN2A 4YB6A 2NUHA 4Z94A 1IJEB 2Q43A 3W9JA 3TWZA 3JSYA 3QPIA 1ZD5A 4F5PA 2MZJA 2ZHAA 1CJKA 3QLHB 3CDEA 4RBUA 9ICNA 1NHVA 1N5YB 5FIIA 1S12A 8ICHA 3AY9A 3V9SA 4LF9K 4CZIA 2A3VA 1S1XA 2KYXA 4NXNK 5KPRA 1KEJA 2AF6A 1WF1A 1RT4B 2WAQF 1O03A 1AYEA 3GJTB 1T03B 1LWFA 1G3OA 1VI7A 2NRTA 1DGKN 3RZAA 3ZXWA 5CZXA 1NJIT 3NGDA 2N7CA 1UZDA 1UJ4A 4CDIA 2OI2A 5AM4A 3CQ8A 1C1CB 1LFWA 3GJQB 2F9WA 1FRIA 2X51A 1KFTA 4URSA 2QWOA 2V52B 3HSGA 3DHXA 2V69A 4EGLA 4QZBA 3EJMA 3ZTSA 1FKAF 4KI6A 2G0AA 2LPEA 2KVCA 5AJ3J 4WU3A 1PCAA 3OFFA 3W65A 4DDFA 4NLGA 5KG5A 1QAIA 1FE0A 2ZJQL 3OHBA 4OHWA 1RT7B 1LVHA 5J0QA 4LF6F 3E8OA 3EXCX 8ICSA 1DRGA 1ZXOA 3QNWB 2WK4A 3ETLA 2DFFA 1FWPA 5B7WA 5J1PA 3FZHA 4OJ5A 5AT1B 4GO7X 4Y2TA 4R25A 3CC4N 4DR2K 2F7TA 3NAEA 2KEYA 1TR0A 3FKBA 3R5AA 1X8DA 2QO3A 4X62K 2R7RA 2B21A 3D0HE 5AQSA 2E9ZA 1KAYA 5CHIA 1NSPA 2FC8A 3GZFA 1U25A 4K5SA 3V1QA 4OYIA 2H4WB 1J9AA 7FD1A 2CVIA 3GONA 3E9PA 4NYNA 1Q8LA 3T1YJ 1X3MA 4B9QA 2LDYA 1AW0A 1ZM4A 8ICJA 1F0XA 3NKYA 4ISEA 2CAJA 2W43A 2LP4A 3I8BA 4Y2RA 5J1EA 4UAZA 3EW9A 3R2DJ 2PXIA 3T1AA 4FJJA 1D9AA 1B92A 2EC0A 1FNXH 4LVOP 3MM8B 2J8SA 4YHHK 3L2QA 4CM2A 1S59A 2NYIA 2DNZA 4W4MA 1BPDA 2KTQA 2DRAA 3ZSVA 2FHKA 1U26A 3MXHP 1U2VA 5BJRA 4F91B 1A0OB 2GTDA 2KNJA 3MEEA 4OI4A 3B78A 5F8IA 4JI7K 4J9QA 2HHHJ 3MUTP 4KHUA 2QB1A 3ENAA 1WWUA 4X66F 2KN7A 4FJHA 1NDKA 3OLAA 4I9LA 1UP1A 5KG4A 3HSJA 9ICFA 2ZHBA 1RKJA 3DI6A 1HKCA 2F3JA 4WK3A 2V4JB 2JFDA 1NDLA 1D3WA 2P9EA 2LU2A 4L6V3 1N61A 5ALHA 1JN3A 4QIFA 3KLIA 4NYPA 1N33K 1HQEB 4C8NA 2OHFA 1PGZA 1PYTA 4AP9A 3HHLA 4PXBA 1VQ6N 3MWTA 2DR6A 1JRPA 3DOMB 3ZZZA 3BUZB 1RAGB 2KJ9A 1V3RA 4X4SA 4DTSA 2QKQA 5DG8A 3PW0A 1VLBA 4B3SK 4K8RA 1ZD3A 3P5TL 2NSCA 2D3O1 4J9UE 2Y0BB 1O5JA 3RAQA 5EWFA 4PXCA 3Q22A 4CZCA 5KFGA 1GH8A 1BC6A 5DM7L 1UWBB 3LA0A 3A0IX 1B4FA 3FEXB 4AHVA 4FK2A 1F3VA 1NOZA 5B5EU 1Q46A 3DCAA 3U3YA 5ALMA 4CZMA 4ID5B 3BPDA 4BR5A 2DH8A 2Z7JA 1EKRA 4RQ0A 2V7YA 5C2FA 2C3OA 3MFIA 3V6KA 2EH9A 1RBVA 3FMBA 3HVAA 2QK9A 4BLGA 2HCFA 1EX8A 1SH0A 2AW0A 5J0YA 1ZETA 4LF8J 3IN5A 3O4WA 4QZHA 2E5LF 2MDAA 4ECUA 2LCWA 3O5TB 4L3QA 5DK5A 5ALRA 2AYEA 3QNOA 1RDCA 2CJBA 2JEGA 1PKUA 4M5DA 3PVXA 3HKZD 1QVFM 3MMBA 4M3YA 3QNMA 4OYWA 3L8BA 2OA8A 1HHSA 2G4BA 5KT4A 2VBYA 4C4RA 1C0UA 4XDCA 1I94J 4LMZA 3QU4A 4ID1A 1BGXT 3NAHA 4FBUA 1S79A 4NMLA 5J1NA 4ED3A 4HDHA 2EWSA 4KIAA 2HS4A 1OKJA 2KO1A 3H3NO 2YKOA 4DG1B 5ALZA 4DCJB 2E2PA 4B1YB 3OVBA 2IHR1 1IKVB 2ZTEA 1T05A 1F60B 7ICUA 2EG1A 1SZPA 3R8EA 2HMIB 5LMUK 2VKZG 3I32A 4FZVA 3C6AA 4KC5A 4JKBA 4EUVA 3WEEB 5F9NA 1Q79A 4KBOA 3CW2C 1K44A 1YITN 2A3ZA 4Z0UA 1T9UA 3E01A 1KVIA 4LC9B 4FLYA 1DQ8A 4ZLPA 2P2CB 3V9ZA 1S0NA 2XEXA 2RU3A 1IJFB 2MY8A 4ZPBA 1VGYA 2QLBB 1BPYA 5I4MA 3TJAA 2HQGA 4KTQA 4M04A 4G3IA 1CZAN 2CPZA 4PXDA 2BGGA 5GAGU 4C97A 5B0AA 2K3IA 1IKXA 1F5SA 1VQKS 2V8HA 2I7NA 1RUSA 4QCLA 3PRVA 3BBCA 4K4IA 1FFGB 3TA1A 1Q5YA 5KQDA 3I55N 2NUUG 5IIKA 3QEAZ 3THYB 4LFCF 1ZQNA 1HD0A 4MHVA 5BPCA 1JXVA 1ZQEA 3H5UA 4BRHA 1NLKL 4ECQA 4NLBA 4DR4F 4L75A 2BOPA 4J2DA 2AGPA 2B0CA 4DV0J 2G5IB 2NZTA 4U95A 4BRDA 3GLJA 2QKKA 2DRBA 5HL7L 3J7Z5 5J0XA 3THWA 3KFWX 3H45C 5ALDA 2O8FB 2A6AA 1FESA 4QIEA 4BC9A 4ILLA 2CQDA 3K9KA 2RQCA 4XA5A 2BDPA 1VQ8S 2O01C 3WX4A 1N88A 2NNWA 4PABA 1FRXA 2M0NA 1TV9A 3RJEA 4JRQA 2YKQA 3NGYA 4CWBA 4E98A 1IBLF 3D2NA 5CD4A 1N56A 4GKJK 2I9GA 3KWMA 3AA8A 4NLDA 1MMDA 4K25A 2MQ8A 4BRLA 3POTA 2D5RA 4PPXA 3PJ9A 3BKTA 2GW8A 3IGNA 3R9PA 4LH4A 2EVZA 3ZZRA 5HK4A 4CH1A 2PA8D 4C6AA 1TK5A 2ZVIA 4BGDA 4M9LA 4DL0C 3BKUA 1J5EF 1GX6A 1FW6A 4DS4A 2FXUA 3W5ZA 4LF4K 1EJ7L 5KFUA 4KE5A 2XLJA 4JRPA 1SS6A 4IQMA 4DL2A 1WSGA 3FC9A 3CCZA 9ICTA 2DNNA 2AXTU 1N34K 3A13A 2E1MC 2JC1A 1KKHA 5C10A 3WK8A 4MYUA 4NZ6A 2JWKA 1IG9A 4EWTA 3CO9A 2G0CA 2BZFA 2YTUA 1MMLA 2FE9A 5D3GA 3W7BA 3TX0A 3KMQA 4AL6A 4X5VA 3V1RA 1JJ2M 2Q31A 2QFIA 3HZ6A 4RPYA 4NA3A 3MEGA 4BE2A 5HMLA 1L3VA 5J0PA 2KN4A 4JI2F 1N5TA 4DU7A 5H9EK 4RW6B 3UCUP 3ENOA 1WCNA 3BBFA 3OTEA 1BMQB 2H1YA 2WF5A 4DFDA 3GU0A 4DUZF 4KO0A 5AKJA 3BO4A 2VL1A 3D6JA 4HI2A 4DV7K 2QA4S 2NLXA 3ULHA 3KVGA 4FXDA 1RWKB 2KVQE 1FFWB 4AM6A 4MF2A 2VCPA 2CDRB 3H90A 2HOEA 2FJWA 4ZH4A 1YRUA 1M1HA 1IBCB 1KL9A 4DU3A 1RYUA 5DB9A 3B54A 1AT1B 3GZ7A 2XCAA 3OTOK 4K4GA 4QIVA 1REGX 2H48B 2YWWA 5KG7A 1Z25A 4QZFA 4KQZA 4I2CA 4PWDA 2N4DA 3ZO7A 1F3FA 3DYAB 2CJAA 4UBBA 1VQOS 1YJRA 5KFMA 3PSFA 3I96A 2AX0A 4IO9L 1S22A 1Q53A 5BN8A 3CD5A 1VR6A 3VEYA 1IN0A 1P8GA 3VEXA 1S72N 4PKIA 3UI3A 3R2CJ 2QI2A 4P52A 2P66A 4F0HA 1LWCB 1U0HB 1UFLA 2CQ2A 3J81O 4D3GA 1HNXK 4KTZA 4UUWA 4KTWA 2BJ7A 3VQ7A 2VA8A 1RWWB 3RJGA 1CEZA 1GLJO 3ZD8A 1YXQA 1SJRA 1OY9A 2RHKA 2YH0A 4QYZK 3W5XA 2P5VA 3FZ2A 5JTIA 2QFJA 4M7XA 5A8KA 2MQLA 3ZDAA 4NB4A 3T6JA 1WTBA 1U1KA 3W62A 3HJVA 5BRHA 2K4EA 2R7QA 3WQUA 3NWRA 3RSEA 3AQFA 1ZQXA 1NJXA 3H08A 3MAQA 5HVGA 1N0UA 4CBXA 1M5SA 1KS2A 4XH1A 1TL4A 1PBAA 3KK2B 1PVPA 1SIZA 3C2LA 2HHWA 5IOLA 2ZM6K 2KMDA 3V5RA 4X64J 1RHMB 3GG4A 3VOVA 4UB3A 3C3LA 1NB2A 4W5TA 1F44A 3W66A 4XIUA 3PACA 4JV2A 3GV5B 4F5OA 5I3UB 1IWAA 4DFPA 5AHXA 4O5CA 4RUHA 3ET6B 2LM1A 2KJVA 4O4RA 4X4UA 5EOYA 3CPEA 1X9MA 4C8KA 1LKZA 1BUPA 3K75D 2ZH8A 4NXMF 3MECA 3UW1A 3DLLL 4PGQA 5CH7B 3PFEA 4K4UA 3VEZA 2VBWA 3LYSA 2R4FA 3PNIA 3DLEB 3VGMA 3TAEA 1MU2B 1CQNA 3T19A 3QERA 3FAHA 4YOVA 3KMSA 2NXEA 3H5SA 1Z6RA 4YFUA 2R8IA 1B0PA 1KC8O 2OPRB 3LPEA 1YJ9S 4DR1J 1L5UA 1Z4OA 2UU9J 2QXFA 3CD7A 2P9IB 1V85A 3M1YA 3ITHA 1XUPO 1I39A 3NF9A 2FPLA 3O4NA 2VA3A 3SQGA 4HL9A 1Z4NA 2YWGA 4NL9A 3SBTA 3TOQA 4Y2AA 5H9FK 3M8PB 1WSRA 2HFNA 1EXQA 4HHTA 2C3YA 3B0XA 1NDCA 2OEKA 3HLUA 1GMWA 5GVQA 5EN1A 3CT9A 1RAEB 3GIRA 2DNGA 3ATVA 4EFHA 4F02A 1N36F 3W2VB 3W8PA 4I6MB 2HGMA 3UB5A 3CB4A 2V2KA 3KKFA 3L7OA 5IINA 4L74A 4K0KK 2HSTA 4ED1A 3EICA 1AROP 4AXJA 5EGYA 3SIPB 1RA6A 2ZTDA 3QBXA 1UVIA 3WBZA 1FFUA 4GMKA 4ES1A 2R7YA 5D77A 3CJCA 1HNWJ 4LRFA 1S1TA 3N4QA 4EO8A 2RF2B 5DO2A 4WYLA 7ICIA 4FF3A 3FSYA 3A3OB 4NY8A 2P9LA 9ICAA 3O8WA 4GVBB 4FYVB 4Y1DA 4NM1A 2FJ6A 2M4MA 2JX2A 3GOIA 1WLJA 1T95A 1HJRA 3GBTA 3NRZA 2FJDB 2EFNA 1ZYQA 1U1OA 1XNQK 2UVVA 3HOTA 3IR5B 2ASLA 1T3NA 2ZIWA 1K6YA 3W64A 5G5HA 1O13A 2ZOFA 4AQYJ 2F8LA 3SEOA 3W9IA 1RGIA 4M5HA 3B0YA 4ZPWR 4AL5A 4LF2A 3L2WA 3IMXA 4A59A 1VOMA 3QEIA 3GYXB 3DOMA 2OPSA 4WFBL 2FLOA 5AQOA 1RG6A 5KFBA 3GU3A 5F2RA 4CIGA 1S5LU 3CMAN 2G2ZA 4DHYA 3H7HB 1QQCA 1R8BA 5F41A 1T11A 5AQRA 2ZF5O 1S1WA 2J5AA 4Y2IA 3RTVA 2MSSA 3N6MA 3IDWA 2CUYA 4N47A 3OYNA 5JVGQ 1EKSA 1MW7A 4DPXA 1E6VA 2J6UA 3IBCB 2K7KA 5D6GA 3AVJA 1XS9D 5AIBA 2KZMA 5BPNA 5J0OA 5BYQA 3BN7A 1VSEA 1NH8A 3N7RC 4OD0A 3OXLA 2G8HA 1XMOJ 3PYEA 2ACYA 5CR0A 4OZJA 5ITHA 3N5FA 3BBBA 4FWLA 4EK2A 1U2RA 3G9CA 4JP8A 3WXKA 2NRXA 3QJPA 1YHQN 1S76D 4IO1A 2MLZA 4LR9A 5E3PA 1YIJS 4C48A 1QQOA 8ICBA 2OIHA 1JJHA 2UXCF 8ICOA 4RR5A 1ZTWA 2JDJA 3TFRA 3IG1B 2LQ5A 4IR1A 3L6QA 2NXUA 5IV4A 3FBEA 3FZFA 3IP0A 5FLXY 7ICPA 4FPIA 3OYBA 1AFJA 2NZCA 2Z2LA 1KD1T 1V5IB 5E41A 3UQ0A 2HBZB 3FM9A 4WIQA 5KL1B 1SC6A 1UQVA 2BE9B 1O08A 2BE2A 1ZQAA 3J7ZO 9ICGA 2QXLA 4UUXA 4GXKA 2O6KA 3JAMO 3C5GA 1UFWA 4V19S 1JXBA 4OJ1A 3G6YA 3DLGB 4JAXA 4GKKK 4JI0F 1QSLA 1KAZA 3ONNA 4JKGA 3DMJB 4OX6A 1DFDA 1CS4A 3DRPB 4KX5A 5IFMA 4C4TA 3KHRA 4DV3J 1HYZA 4FWMA 5HP1B 2Y1JA 8RUCA 3E58A 3UD3P 1B64A 2CJQA 1SQKA 5ETSA 4E7KA 1IM6A 9ICQA 1UKUA 1U09A 1U1PA 4OI2A 1Q86T 4ZP8A 4GLXA 3HL8A 4NYZA 3AVHA 4UZBA 3OW2R 3DDKA 2E1AA 5KFIA 2EFQA 4MIWA 3QGPA 4USHA 2HHVA 2VODA 2Y9UA 3EDRB 4OGCA 2L9WA 2ZDPA 4RW8B 2Q2RA 1WC3A 4RW7B 5AKLA 2B43A 3RBEA 4HTLA 2VWJA 2HGLA 2RRDA 4CO1A 3BQ0A 4DCPB 4FO0A 3U3GA 5DGBA 2NYVA 4YHHF 4O3RA 4ZCMA 1SC4B 2HFZA 9ICPA 2I7PA 1UJ5A 3DXBA 3A0HU 3IG5A 3IGVA 2EAOA 4UW2A 2ZJPQ 4BRGA 4PG6A 3VCDA 4A48A 3HT0A 3GYNA 2BDUA 1N62A 3KKRA 4IFVA 3VAFA 2H54B 2KU7A 3MUMP 3MM6B 4JI7F 1NGGA 3SQIA 3O08A 3IAS9 5BR8J 4PWUA 3DC2A 2UXBF 3JB9k 1E4FT 2Q97A 5JS1A 1RWMB 4JI4K 4B3TJ 1FRKA 3WQTA 2X74A 3PO5A 5ALLA 3EGZA 2NZ4A 3G82B 3RRKA 2WOMA 1H2VZ 3WNGA 3K17A 5JRTA 5ADXA 3Q7CA 1NSKL 3RH5A 2WTUA 3FR0A 1ZQMA 2IOFK 5ADZA 3TARA 3MPYA 1MROA 3M2UB 1YF5L 3MAAB 2W03A 2ALZA 5ALGA 3AVBA 2ZUCA 4WYBA 1N54B 1TKXB 3UDEA 1ZAXA 4Y2VA 5KFFA 1FRMA 3MM7B 4CLFA 3HVWA 2X1FA 1QVGM 2Y1IA 2V8DA 5KFQA 1H38A 4Z6EA 1NOYA 5BN9A 4PGXA 1RADB 5ALVA 2J0XA 3AVCA 1FHTA 2KVSA 1X4HA 4P4OA 3SK3A 4EYHB 4B9VA 3OR2B 3D2FA 2Z2MA 2ZNZA 3VGKA 2JLFA 2J7KA 3MDQA 5DDRC 1OH5A 2IJNA 2QSWA 3MOJB 2J0SD 1XK8A 3KK3B 4DUYF 2JH1A 3C2KA 1S48A 3ISNC 1WG5A 4QPTA 4N8OA 2MEWA 1M6YA 5KAKA 2G13A 3CCJN 3PW4A 4AM7A 2VQEK 4MKVA 1XC9A 4TUPA 3NGTA 2DY1A 2ATLA 3VN5A 3MMAA 3IUCA 4PY5A 2VGMA 5DMRA 1SQFA 3VQQA 4D3HA 4WF9Q 1SZHA 1ZZNA 5GADP 2NV3A 2J8AA 3TR8A 3GE1A 1NPKA 4QOZB 2YNFA 3MOZA 1Q7YT 5LJ5Y 2C2NA 3JYTB 1IR2A 1R8CA 3WC2A 1IV8A 1NSAA 1OW5A 1ASWA 1L8LA 3J7A1 2IVYA 2W2QP 2KZ3A 2IM1A 2F40A 2OPQA 4IOAL 5AFUA 1R89A 1TUUA 3RF9A 3VEOA 2QMWA 2RHFA 3Q23A 5AQGA 2CPIA 1E6YA 4Q2LA 2BABA 4IL6U 2DHSA 1JL2A 2BMBA 5FJ4A 3D28A 3I0RA 4FNIA 1Y88A 2W55A 5IZHA 4HTIA 1TU0B 3ED5A 1QY7A 1SXDA 2D74B 2BHNA 2B5JB 2W4DA 1TYQB 5DM7Q 1ZQKA 3KKAA 5HOOA 3DYAA 3GFXA 1Q9YA 2B9YA 1Q8IA 3PHEA 4YR3A 1FO4A 1H72C 2DEIA 3AY0A 2UVRA 3L3FX 4FBTA 2OYQA 1U7LA 3K59A 1CUKA 2AEJA 1FDNA 3M9OB 1RWUA 2CPHA 4NL5A 2DR9A 3R3TA 5KFDA 2GA7A 1U0HA 3CJKB 3R6LB 3DAWA 3GB0A 2P8IA 3BEXA 4JI3K 3FCVA 2DIVA 4WQ4A 3AO5A 3EL2A 4TQSA 1URRA 3BR8A 1ZJMA 4JYAJ 3QU7A 3PJWA 4CFCA 2QL9B 2FHJD 2W7PA 7ICVA 3LDQA 1RDFA 3B6BA 3WNHA 3H8SA 3KNAA 2DXDA 4C4SA 4KSEB 3KD3A 3FNNA 4KHPJ 4GVEA 2D3ZA 2HYIB 5EX3A 2B9WA 5LSRA 5AXLA 5J2HA 4ED0A 3SZ2A 4ID8A 3BGUA 8ICEA 1BHNA 3C6TB 2ISOA 4C1NI 1WAJA 3ISDA 3PRDA 1BPEA 2AV5A 4USMA 3TQ1A 1VQ4N 4BROA 3VQBA 4IOCL 1X0PA 3RMCA 1VFJA 3C95A 4DCHA 5DDYA 3D2EB 1ZQ1C 1BHLA 1RTIB 3H7IA 1W25A 4DL6A 1ZA2B 4DPTA 2BKPA 2FLLA 3T1YK 1VJQA 8ICRA 4JOUA 5TISU 3M2VB 3TFSA 4NLPA 1LKYB 1Q18A 4GKJF 4HAIA 3T69A 3L2UA 4FZLA 4BX9C 1WWVA 1N32J 3NCPA 3JSRA 3HCXA 4TXSA 4OV1A 1CC7A 2H5XA 1U1QA 3DRRA 1D5AA 2HIQA 3CJ0A 4JKCA 1S6QB 3DV9A 4DV4J 1TL7B 3M5RA 2ZD1B 3CCEN 5KAIU 4KLUA 1KW4A 3T6BA 5F8GA 2DR8A 1DTQB 4TU8A 2QMXA 2XLIA 4CJQA 1KQKA 4WQ5A 1UEKA 4Y2UA 3PO4A 1C4CA 1EO1A 2KKVA 2BCRA 1CC8A 4CF0A 2OPRA 3FRZA 2VPYB 4KKOA 4M8LA 3HHNB 5ETKA 3WXIA 3RB6A 1APSA 1KXPA 3HO1A 1TKDA 3VGUA 1HR0K 5AZIB 5HR7A 3C6UB 1X9WA 4GXJA 1ZBTA 3CERA 1ZQPA 2W11A 5AIAA 4DTJA 3QIOA 4N76A 3BGLA 4OJRA 3T1HF 1OPZA 2QMUB 2DR5A 4I6MA 3F53A 2LA4A 4NLZA 3TEHB 5ALIA 1NO8A 8ICMA 4B8CA 4FLXA 5IC6B 4PQUA 3DOLA 2N3LA 3FZBA 2X1GA 3AAPA 2WC9A 4KLTA 2G06A 4CZEA 2YX6A 2EFOA 4QU6A 2E1RA 4L3KA 5KGWA 5G0RA 5HAOA 2O8BA 1ATRA 5D15A 1HUXA 4GVBA 5BR9A 4MIAA 4F4XA 4YG2A 3CMQA 1ZQCA 2D69A 2MZSA 4KHWA 1T6DA 4IQWA 1VQYA 4BWMA 5HHIA 3UMGA 2FF6A 1A9NB 1BCMA 3K58A 3NGIA 2KH9A 2Y8WA 4M9JA 3OTCA 1KKXA 2PFUA 1RNHA 4MKYA 4XEIA 2IJRA 4YDXA 4DXLA 4I2DA 3CJSA 4UOGA 3THXA 1HI8A 1ZXIA 3HPHA 4DV2K 5LSOA 1XR6A 2CPXA 3OVSA 1Y00A 1SV5A 3BGRA 2HRYA 5C2CA 1X0FA 1FFVA 3PIPL 3OL6A 1Z26A 1DQAA 5A2QU 1HNXF 5F9LA 1R8HA 3NOCA 3NH2A 4MKAA 2PT0A 4CO3A 1D9DA 5CHGA 2DNRA 5HJXA 4M3UA 4FPBA 4CJ4A 2FPMA 3H2LA 2IPOB 2ZIUA 3VC8A 3MCNA 1UTAA 4DPOA 3O9RA 1S49A 4KJIA 3TJ9A 3VESA 4WE1B 4O3PA 2C42A 3G25A 1R43A 1B0XA 3ZZPA 4J2EA 4K4HA 2D9OA 2OPPB 4HH1A 3TVYA 2F8TA 3L2VA 2EG2A 5D0GA 2VBZA 3V4IB 3BQ2A 3I8DA 2ZJRL 2K8AA 4TKTA 2HSZA 4RZRA 5B0BA 5DG7A 4DR3K 1DGSA 1SH3A 4NLWA 5J2MA 2GX8A 2NXJA 4PYDA 1EZZB 2OEMA 3CRXA 3VF2A 1T7PA 2E4LA 2ZM6F 3MN7A 1B43A 5AQMA 4WFYA 2EZYA 4K50A 4W5RA 1B7FA 3NMRA 2HOFA 2LKZA 4FKXA 4DV1F 2LYAA 4LT6A 4CGGA 1IBMK 4K41A 5IS2A 2MUTB 3E2EA 4XDDA 3AV9A 2BUNA 5F0UA 2DPIA 5AI5A 1O8BA 4FNHA 4PR6A 3MM9B 2NYHA 4Q44A 3N6NA 4ZJOA 1CJTB 2OJ3A 1VC0A 1GLBG 2K8CB 4BR7A 1FNOA 1KLMB 4IKFA 4ED5A 4ACOA 3UXOA 3BSOA 4H5WA 1NJYA 1SCJB 1CULA 2YXLA 4U8YA 4DV0K 3C2MA 2YWEA 1ZQUA 1SKRA 3I33A 4QIWD 5LMNJ 2E20A 2VJ5A 2YKNA 3LZIA 4UAWA 4M5GA 2W2PP 3ZX2A 4FJGA 4P0PB 4X84A 5LL6Z 1D8LA 2R7TA 1HBUA 1XMBA 3THPA 2GIRA 2WB1C 1KAXA 2E5SA 4I2QB 2XO7A 4JKFA 5DLFA 4UB1A 3T7ZA 4C98A 4RT2A 4I68A 3B4MA 3EZUA 1CZ9A 2CJXB 2HQCA 4EYIB 5A8RB 3UM9A 2DGVA 3ZI4A 3QUBA 2GO7A 3W61A 4IEEA 3ISZA 4DSIA 3OQ2A 5F8JA 3CCVN 3QINA 1MQ3A 5I9EB 3TEGA 4FFDA 5GAEU 2UUWA 3TSUA 2RDIA 4C23A 2NO5A 4NL9C 2QZ8A 1S9GB 2CRXA 2UUAF 5ALKA 2KHCA 2CZVC 3Q8UA 3A8YA 1R0AB 1L3SA 5DZ6A 1FJGJ 1AZSA 3C23A 1VQPS 1K47A 1S5ZA 2KK0A 4B3RF 4ZA1A 3MR6A 2DXFA 2WUSA 1S7IA 4DOCA 1JQGA 3RJMB 3K8WA 3A3NB 1BQNB 4QZCA 4BCAA 3GFZA 5ALTA 3NL0A 1Q3UA 2EANA 3SQ1A 3PYGA 2W41A 1Q16B 3NGKA 4PG8A 3CF5L 3DLLQ 4CIOA 1K9MT 3EXYA 2GHWA 3SCXA 2CNNB 1RHUB 1RDDA 2MKYA 3M2UA 1OUQA 1LW0A 3K57A 4NLCA 4WWSA 1MSWD 4CEZA 4DLGA 2DWQA 2W01A 3MCOA 2Z2ZA 3TUJC 2FYXA 1FA0A 4OZLA 1VQMN 1MLAA 2XGPA 2DKZA 2O8CA 2ADBA 1IR0A 3UNGC 1RQ0A 1RAHB 1IG8A 1H6KX 3N79A 3S6JA 2WSFC 3KLHA 2MLXA 1ZBFA 3FGVA 4ZPVR 2KJWA 2DNPA 2CDQA 2CQIA 3NBPA 1ZM9A 4URGA 2LEAA 1CBKA 2BUPA 4P4MA 2EC2A 4CW7B 2VG7B 3M6KA 4QR2A 4IXCA 3GTYX 1BQMA 2W3SA 4Z2XA 4LF9J 5KAFU 4B9UA 3F9MA 1HQ2A 3K8VA 3ENQA 5EE1A 3H3OB 1NMDA 4NXNJ 3JS9A 1VQ7S 4U67Q 3JPOA 3OYDA 4KLDA 1KFDA 3VGSA 3PNCA 3NNHA 1T3OA 3TAFA 1GK8A 3P4IA 4PA1A 1ZAWA 4AD6A 4B6JA 3NG8A 1KTVA 3MUVP 3WKEA 2K4HA 2JVRA 3EE9A 3TKAA 4ZJLA 5EUHA 2HSEB 1TUYA 1M90T 3CM6A 1VSLA 3UXPA 4DR5K 4BE0A 4AHRA 3AA2A 2CQ3A 2WCXA 2VFSA 3Q86A 2AMCB 3SAFA 4MDBA 4IEIA 4BRQA 2WB4A 1NRKA 2ZOGA 1P7DA 1EARA 2FC0A 3DDHA 4LRDA 4USWA 4RQ4A 4IJNA 3IO1A 4NXZA 3FBCA 4IH5A 2EQYA 2K4IA 4CTAB 4GFJA 1OQ6A 2FJEB 3M2RA 3EKUA 1XSPA 3HM9A 2I1RA 1VDVA 1ZOTA 7ICMA 3A8KA 4XAKA 4WFBQ 4PH5A 2I2YA 3NS7B 2HKEA 2RKIB 3ZSRA 3AGKA 5HRSA 2BRLA 5AKKA 5HMWA 3PSPA 2ADCA 4NRUA 1XN9A 4X62J 2CVEA 1FFSB 2RQ5A 3ZEUA 2FBVA 3MWBA 1XO1A 2JLGA 1TYQA 5IILA 1NHUA 3CXCM 3CJAA 3TWHA 1JMTA 2RD5C 3FYHA 2DGUA 7ICFA 4CLWA 4BR0A 4ICLA 3ORYA 1RGVA 4DUTA 5BRDA 4X64K 3PYDA 4KH5A 4ITSA 3MPUB 4CLYA 1C0TB 3RH6A 3CJKA 3HI0A 2GGPA 3GDQA 1RM6C 1FJCA 4ETXA 3RJKA 2W9CA 1IBKJ 5AQPA 1VQ9N 3M8RA 4LBHA 4B1UB 4TYAA 3MEKA 3V6DB 4NI2A 4Y34A 2PAVA 2IIRA 3IDHA 4TY9A 4FF4A 3MN9A 2P9CA 1SB3C 4PCQA 3QAUA 1AUDA 2QTDA 3NS5A 2GQQA 1NGEA 3OS1A 4FF2A 1PUZA 4IQVA 3RAMA 1HHTP 2IVNA 3RMBA 4IBNA 3L9ZA 1WOOA 3T9NA 5LJWA 2G0IA 1XTZA 4USKA 1HYSA 4JI4F 2B9EA 2XHBA 1MN9A 2PN6A 3LM9A 1KONA 4KB7A 3CCWA 2HQIA 1G6BA 4JV0A 4K43A 1FKOA 1C1AA 3ULEB 1X1PA 4ILRA 5J2BA 2CZ4A 3GSDA 1Q4RA 2DY4A 4FWQA 3O3LA 3IAYA 3AD7C 5HI7A 3CCMN 1ZQSA 4JWMA 4ECVA 2KZZA 3VAIA 4W98A 3GIIA 4B3SJ 2I5JA 3PY8A 4CDGA 4C11A 4A8EA 2OTLS 1C4AA 1R31A 5CB1A 4ES2A 4FS2A 4CJVA 1WJ9A 1WOPA 3GG0A 5J0WA 1R6YA 3LOUA 4CI0B 1QLNA 1QAYA 3MAHA 4KV8A 3S9HA 4DR7K 1VC6A 1YBTA 1XU4A 1NPPA 4CQ1A 1FF2A 2V8PA 2Z1JA 5KFPA 2R42A 5H2FU 2R7XA 4O0JA 3BGOP 1WEXA 3AA3A 4F3QA 2E5HA 4FJIA 3AVMA 2AJFE 4RG8A 4CFAA 3T5LA 4CRXA 4J5OA 1A5VA 3LGHA 5IWAF 1LCUA 4XK8C 3O3GA 2DGSA 4I27A 1NWKA 4BVPA 7FDRA 3NF6A 1YTYA 1X4GA 2HK3A 4GW6A 2PMWA 3I82A 3L5KA 1M5OC 3OD2A 4AQYK 2E1CA 4ZITA 2V2ZA 3MXIA 3CJ2A 1SH2A 4RQ6A 2F1IA 3KWGA 2GQCA 5JS2A 2ZHOA 2GBZA 1X4DA 3SEIA 4K2XA 2PMHA 3OYAA 2ZH4A 1KQSM 1N8RO 4ECZA 2HMXA 4O5FA 2C3UA 4HH0A 4LFBF 2ZXIA 3LQVA 2VQFF 2FBYA 3SJHA 3CMEN 4B3OB 3QYYA 5BYSA 5J29A 5FPNA 2C2RA 2GVDB 4I28A 4DU1A 1JLAA 1U1LA 3OVAA 2UUBF 5GADI 1XR7A 2VOOA 3G71N 2XY7A 3CVKA 1C1BB 1RT5A 4UB4A 2DNLA 1DLOA 4DWIA 3VQ8A 5F8NA 2GNKA