2B6GA

Rna recognition by the vts1 sam domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
NPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords 5'-R(*GP*GP*AP*GP*GP*CP*UP*CP*UP*GP*GP*CP*AP*GP*CP*UP*UP*UP*
publication title RNA recognition by the Vts1p SAM domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2b6gA00
2ESEA 2L5YA 2DKZA 1OW5A 5JRTA 5KNIA 1LKYB 4NL9A 3HILA 1COKA 2YTUA 3BS7A 1SXEA 2Y9TA 1V85A 2EANA 5JTIA 1WWVA 2E8OA 1UQVA 5J8YC 1SV4A 3SENA 3KKAC 2E8PA 2QB1A 3SEIA 3TADC 1X66A 2DL0A 4RQNA 2F8KA 5J8YA 3K1RB 2E8NA 2K60A 4NJ8A 3BQ7A 2B6GA 2E8MA 3KKAA 3TACB 2KG5A 2QARA 2D3DA 1OXJA 2LMRA 2EAPA 2KMDA 2KIVA 2KSOA 2QB0A 3TADA 1PK1A 4IS7A 1B0XA 1SXDA 2QKQA 2EAOA 1X40A 1KW4A 1SV0C 2KE7A 3IDWA 4RQMA 2GLEA 1JI7A 2F44A 2Y9UA 3BS5A 2F3NA 2K4PA 2LPEA 2QARB 1RG6A 2FE9A 2KSOB 2QB0B 4PZOA 1PK1B 5JU5A 2D8CA 1SGGA 1SV0A 1LKYA 4MHVA 1WWUA 2ES6A 2JV3A 4NL9C 1B4FA 1F0MA 1DXSA 2EAMA 1V38A 4PZNA 5F3XB 1X9XA 2DKXA 3BS5B 1UCVA 1PK3A 5L1MA 3H8MA 1Z1VA
chains in the Genus database with same CATH superfamily
3IG5A 4OJLA 2OCEA 3HX0A 2BDPA 1IIPA 3H4BA 2UVVA 1VDVA 5AI6A 3Q8MA 4ECWA 5KFNA 4CGZA 2HBJA 4C4SA 5J0WA 4QW9A 2FMSA 4EX7A 4P2HA 2HOQA 2P35A 3QU9A 4QZIA 4I2FA 3T5JA 8ICBA 4MFAA 3FM9A 7ICHA 2YX8A 4O0IA 1T8EA 1F44A 4PHEA 1RM6C 4AYBF 1NKCA 2R8IA 2XICA 3G6VA 4ELUA 4UB3A 3C1YA 4QIWC 1A77A 5ALMA 4KN4A 4KX5A 4QJFB 5J29A 4BDPA 4O3SA 5EOZA 3TQ1A 4F2SA 3MGIA 4PPXA 3ZI4A 2PFPA 2LMRA 3QU2A 1KRPA 8ICQA 1NKEA 5IIIA 3WKCA 1T94A 3IM1A 2JXJA 2NO4A 2JEGA 7ICUA 4O5EA 3RRHA 4YP3A 3HW8A 2W9CB 4O3OA 3V7JA 4BWMA 2Y9UA 1QSYA 4FZNA 4DF8A 2W8LA 3PW2A 3ZDEA 7ICGA 2NRVA 5HR7A 3HWTA 4TUPA 3WK8A 2D6FC 4RNOA 3QU4A 5IILA 4DL6A 4UAVA 3ISCA 7ICTA 5EWEA 2YN4A 2K4HA 1ZQAA 1TFRA 3H8MA 1X2IA 1BNPA 4C8MA 4F5QA 4DFKA 1UHUA 3LWLA 2HSZA 3UXPA 4YR0A 1SXEA 2OXOA 4O3QA 3AU2A 3M6ZA 5DBBA 2H3QA 4IRDA 4DOAA 5AHXA 1Z4NA 1JIHA 3VCBA 3D2QA 1CEZA 3K4GA 2I5HA 7ICPA 4BGDA 4GLXA 3H8JA 5J2GA 3C5FA 2QLTA 2YMPA 3WKAA 3JPPA 5ALHA 3KZXA 1XS9D 2GH1A 4ED7A 2F1JA 5KFRA 2XCPA 2KFNA 1MSWD 2UVUA 4Y2JA 2EDUA 3Q8SB 1KFSA 4RNMA 1T3QA 3QZ7A 4UB6U 1Q46A 1S10A 2AGPA 3KHGA 7ICVA 3D2NA 1N2XA 4CF4A 4X5VA 3UQ0A 1HIWA 3T5LA 1SXDA 5KG3A 1VLBA 3ETRA 1TV9A 3EYZA 2ZG6A 3RJGA 4ECZA 4R65A 8ICAA 5H2FU 3QXGA 1L5UA 2PXIA 4RQ7A 8ICNA 1EXNA 3EPIA 4DQIA 2FE9A 4C7YA 1N48A 2KSOB 4KLJA 2G06A 4EENA 5DQGA 1B4FA 4QZCA 4NLBA 3IP4B 2ODGA 3ALRA 9ICWA 1X6JA 3M6KA 4XQ8A 5J0UA 5F9LA 3AMZA 8ICYA 1S97A 5HHIA 2Y0SC 4YMNA 4YMOA 3RAQA 4RQ8A 3KZIU 1N56A 5KNIA 8ICHA 1LKYB 4KX3A 5KFLA 2W9AA 2IOHA 2G5IB 2F1IA 3PX0A 2Y9TA 3ICXA 4Y2XA 2ZIVA 3TFSA 1J2NA 1WWVA 5J0TA 4KMOB 1KTQA 2XO7A 3SAFA 4RPZA 1NK6A 4PHAA 8ICOA 3C1ZA 3F2DA 1XO1A 8ICJA 7ICIA 3J81j 3L5KA 1ZQIA 2BCQA 2VKQA 4UAUA 1V97A 2A1JA 4Q8FA 3N4MB 2VANA 2YMLA 4DQQA 4F5OA 1ZQVA 4BXOA 5D46A 5KFKA 3SV4A 3QUTA 1NI3A 1N61A 2W04A 4ECSA 2FLLA 5AM1A 1Z4OA 4M6WB 8ICSA 2F44A 1Q3UA 2ZJ5A 2F3NA 4KLDA 4M9NA 1JXLA 2RQ5A 5HNKA 3MBYA 4ED6A 5KT5A 2Z7JA 1X9MA 3MABA 2ALZA 4P0PA 1ZQHA 9ICCA 3GV8B 1K1SA 2WB1C 1NZPA 2HMXA 2LYAA 5KT4A 4F91B 4P0QB 4KLQA 5BOLA 4DL2A 5AIAA 4ECYA 4F50A 3PW5A 8ICGA 3H8SA 3V7LA 1PK3A 5KL8B 1Y88A 9ICAA 2LHTA 4F2RA 4KLEA 1CI4A 1V9PA 2VIXA 5ALZA 5KFTA 3NVVA 3AQFA 2HOIA 2BQRA 3AEVA 3QX7A 1S0VA 4DL4A 5IIOA 2E1FA 3MFHA 4ECTA 2XGPA 2M0NA 5KFIA 5J0QA 1LB2B 1ZQBA 1SWVA 5ALXA 5DG7A 1L8LA 4RT2A 1BVSA 3TKAA 3PW0A 3PMNA 2JR5A 1T4GA 2K8BB 2GO7A 2K8CB 1JROA 3OTQA 4C7ZA 1TK8A 3M8SA 3MR5A 4P4MA 3GQCA 1TE2A 5KFYA 3FYHA 3K1RB 4QZGA 9ICPA 4ELTA 2B6GA 3GIKA 2C28A 2HCFA 4UBCA 1JXEA 4TQRA 4R64A 3QUBA 9ICRA 1NJWA 2EAOA 7ICJA 2HHVA 4UB1A 1FFUA 4RZRA 4F4KA 7ICFA 1VJ5A 4QZDA 3MGVA 2ZTEA 2ASDA 4J9OA 2RDJA 3TFRA 3PV8A 3DV9A 4DLEA 1TK5A 5JU5A 1SGGA 2GOLA 2JV3A 3OHAA 5BOMA 2JZBA 2ZUCA 2XC9A 1BPDA 3ONNA 3THVA 2OYYA 1X9WA 5D4BA 2HHSA 5J0SA 2J6SA 3PMLA 4OJ6A 2DKXA 3BS5B 3Q8PB 3MGHA 4RQ1A 4QNLA 2LKYA 3NGDA 3PO4A 3Q8KA 3HKZF 1L3SA 4DFDA 9ICUA 2NRWA 5AICA 1SL2A 4DSLA 5HP4A 2C2EA 5CEHA 2FMPA 2HBLA 3PSFA 7ICEA 3Q8RB 3T3FA 4KLTA 2ISPA 1FIQA 1A6SA 4NM2A 5KFOA 4JMUA 8ICRA 1T3NA 1QQ6A 5DBCA 2ZUBA 3N97B 8ICZA 2JRZA 4IR9A 1ZQJA 3KHHA 5J2EA 3C29A 1BPYA 2W9MA 1Q8KA 4RPYA 4ICAA 1ECWA 3TACB 5EWGA 1ZQQA 4YR3A 5JUMA 1SWWA 1SZPA 1ZETA 2XGQA 4RUCA 4Q45A 4KLSA 2H5XA 4C8LA 1HJPA 4UQGA 2RP5A 4A8EA 3EUB2 2BPFA 3ISBA 2GLEA 3SV3A 3N28A 5J2HA 3QEBZ 2RHFA 1U48A 1ZQTA 2LYHA 3IN5A 2LYBA 9ICMA 3BDPA 1PVPA 5KFCA 1N62A 2MSNA 9ICHA 4RU9A 2CXYA 2WF5A 3H40A 1RDFA 3PSTA 1PZNA 4E0DA 3RJIA 3JPQA 2VA8A 1S5LU 5B66U 3M8RA 7ICQA 1QQ5A 5G5GA 2WF8A 3F5AA 4YD2A 1D9DA 1ZQKA 5ALPA 1SL0A 2L5YA 4OJ5A 1GO3F 4QW8A 4C4TA 4RQ3A 4USAA 2LM1A 1B22A 3PSPA 5AK5A 3LK9A 3FAHA 1HUZA 4DS4A 2PMZF 5DDYA 3PR5B 4OO1J 1DK2A 1Z19A 2AU0A 1NK9A 2V9WA 1ZQGA 5DQIA 3WK7A 5DLFA 4RQ0A 2VA3A 3RH5A 1U4BA 1ZQ1C 2WAQF 4TURA 4KLIA 2KD1A 2VJ5A 1J97A 4UAZA 5DGBA 1BGXT 3BZKA 2ZUDA 3A0HU 2R8KA 4DEZA 1URJA 4NY8A 3RB3A 1ZXIA 5AM3A 3KKAA 3MFIA 3GV5B 1U49A 4PGYA 2C2RA 4NM1A 5DB8A 5DKWA 5AKLA 3LWMA 3A0BU 2VA2A 1SKWA 4QZHA 4RPXA 2MUTA 4JB3A 1DGSA 3CRXA 2CPRA 3I76A 1RQLA 4Y2SA 2IHMA 4DSIA 2V4RA 2UVRA 4Y2TA 2YB1A 1ZQZA 3C28A 2BQUA 5L1LA 5DB7A 3SYZA 4DCCA 1ZOLA 4UW9A 1TAUA 2W9BA 2D8CA 1Z00B 1J2MA 9ICKA 2VJ4A 7ICMA 3E2EA 4DFPA 3M9MB 3QNMA 2KNJA 1V38A 2YY6A 4M04A 4DFMA 2KN7A 1X42A 4BX9C 1UCVA 2AGOA 2MA1A 3LVVA 3QE9Y 1K5OA 4O9MA 5KAIU 5KT3A 1NJZA 4XA5A 1KSPA 4MFFA 5AI4A 2ZIUA 4B9MA 3H4DA 4MF2A 4XRHA 4EEYA 1LV5A 2J6TA 2ZIWB 2IHNA 3ZDCA 3EWAA 3NVYA 5DB6A 5T14A 4KLMA 1YZ6A 1FO4A 5J2JA 3NRZA 1SV4A 2BPCA 4EBDA 1TAQA 2ASJA 5L1KA 1L3VA 2E8PA 4PHDA 1K1QA 2QB1A 1T7PA 4KLOA 3CNHA 2F8LA 2BDUA 2AQ0A 3H7IA 3C21A 3I1YA 4F3OA 3H8WA 2K60A 1L8OA 4PH5A 1IXRA 1XU4A 2XY5A 4BJQA 1XSLA 1UT8A 2ZIXB 3K75D 2DGZA 2KMDA 4NLNA 9ICVA 1QCKA 4MF8A 3RTVA 4NV0A 1SZHA 3MDCA 1NNLA 4DL7A 2BZFA 4ED3A 3T79A 2IA6A 5ALTA 2IMWP 1PVQA 1S0NA 3K1ZA 3GIJA 3IDWA 2HVIA 3RRGA 1BPEA 2P66A 4ELVA 3CW2C 4Z6DA 2HHUA 2K89A 5K4LA 8ICWA 3ZDDA 5AKEA 2AJQA 1KEJA 4RQ5A 2KKVA 4KMUA 5KFVA 5EWFA 5HR6A 3C2LA 2WF7A 4CF5A 3KOOA 2KICA 5J2AA 5ALUA 5KFEA 2M9NA 1Z1VA 4UATA 1L3UA 3KD3A 3PX4A 1ZD2P 2DWQA 4B6JA 4FFDA 3C2KA 3UMBA 5AK3A 3ORYA 3HRDD 5AK4A 1RZTA 4MEXA 4YN4A 5ALGA 3RB6A 3SQIA 1S77D 4QWCA 4YFKA 2YMQA 2E8OA 1UQVA 1D8BA 1S8OA 1A76A 4UB2A 2EZZA 1DK3A 1NJXA 7ICNA 1BPBA 3G6YA 4ECVA 3AL0B 4AYBC 2C2DA 3QU5A 2HDOA 3SAHA 3M9NB 3ZDBA 1NJYA 3T5KA 2HHXA 4Q44A 4YMMA 1FEZA 1B43A 4YR2A 1NK0A 7ICRA 4IQTA 3WKBA 1XWLA 4FZLA 3MC1A 2KTQA 2QARA 2D3DA 4ECXA 2EAPA 4NLGA 5AK6A 3KFUF 8ICKA 3WK4A 2I1QA 3D6JA 2FPLA 1PK1A 1QQ7A 2F2AB 2PI4A 2PKEA 2DPIA 3TARA 5L1JA 4CNQA 1X40A 3VC8A 1BNOA 3I28A 4FO6A 1TK0A 2LI6A 4MFCA 1WG8A 4Z6FA 4CE6A 4RUAA 2HW3A 4CCHA 9ICIA 3TI0A 2NRTA 2WF6A 4KTQA 2ZTCA 1QSSA 5F9NA 3IV6A 3M7DA 4F8RA 3UM9A 4O5KA 4J9NA 2KHQA 1ZD5A 2ATLA 3KHRA 3RJHA 5KFQA 2KJ5A 2BPGA 2ZJAA 4PZNA 1ZYQA 2EQYA 5ALRA 2R18A 2HOFA 2KZMA 4RQ4A 4F92B 3NASA 3T5HA 2XY7A 1OW5A 2W55A 4NL9A 2YQEA 1KQQA 3BS7A 3O0FA 4Y2YA 2XIDA 5KFXA 5BPCA 3PR4A 2WHEA 5AKYA 5J2IA 2A3VA 4JV2A 4IRCA 4HYKA 5J0PA 3JPTA 1ZQDA 4QZAA 2EZYA 3KKAC 2XCAA 1HUOA 4CRXA 5KG5A 1ZJMA 4DFJA 2KOBA 5AKKA 2I9GA 4O3PA 1UA1A 1AROP 2F76X 4U6PA 9ICTA 4I2GA 3C23A 2W03A 4O3NA 5J0OA 2WFAA 2K8AA 2QB0A 1RPLA 2XI9A 5KFPA 4KN7A 3PO5A 2KVCA 3HT3A 5CR0A 4DF4A 3NUQA 1ZRNA 2EZXA 5ALKA 4GIBA 3RR8A 4JV1A 1ZQPA 4FBUA 5EE9A 2F1HA 3RB4A 1ZRMA 5EE1A 3RJFA 9ICQA 4F5NA 4DQRA 1MA7A 4J9SA 2KK0A 4EYIB 5KG7A 2JEFA 3PY8A 2OM6A 2ZJ8A 4I27A 5KFBA 5KFMA 1ED1A 5F3XB 4JUZA 1YZ7A 5L1MA 2ASLA 2FPKA 5ALQA 4O5CA 5FP0A 1ZQOA 3E58A 2PFQA 7ICLA 1FFVA 4ECUA 1N60A 1L6NA 2B21A 4TQSA 4IQVA 2Q0ZX 5HMMA 3V6KA 1V85A 4P4OA 2HI0A 2BHNA 4OJPA 1KL9A 2IBKA 1KFTA 4I2CA 2OHFA 4DOBA 4US9A 3GU3A 5KFFA 5KFUA 4C8NA 4QZ9A 5GTHU 4PGXA 4PL1A 5KAFU 4DSJA 4QIWF 2ZIVB 1QSLA 8ICTA 2F8KA 3SR6A 5J8YA 4P4PA 3GDXA 3N7SC 2W9CA 1C7YA 1NK8A 4Q8EA 4F4ZA 2V4QA 4JV0A 2CN1A 4KLHA 4R8UA 3MDAA 1O03A 2KIWA 4J9KA 1JN3A 4UARA 1N5XA 1H38A 1JMSA 4I28A 4ED2A 4NLCA 2ZXIA 2BKEA 4M9HA 2EH9A 2P6UA 2A1JB 4RQMA 3DEEA 1KN5A 3GFKB 1ZQYA 1SKRA 4ZH4A 3UPQA 7ICKA 3OGUA 5DDMA 5DGAA 5HMLA 5AKXA 1L7PA 4FBTA 3UQ2A 2KZ3A 4BXOB 2K4EA 3B0XA 2BR0A 2IOFK 1RXVA 2ES6A 4ACOA 2G07A 1S9FA 5AKIA 4RQ6A 5J0RA 4I2IA 3JPNA 2MRLA 2E1EA 5AKJA 1D8YA 5ALNA 1ZQSA 3AU6A 1N5WA 2PI5A 5KL1B 1N63A 3KBBA 4B9UA 5AM4A 5JRTA 4P0PB 4B9NA 4I2DA 5J2BA 2Y1JA 1X6IA 3CYMA 8ICLA 2R8JA 4BWJA 3DDHA 3RBDA 1RXWA 4DSFA 2P6RA 2PFOA 2KHVA 3G6XA 4K4HA 1KBUA 4Y2UA 1S76D 3F2CA 1X66A 5AM2A 3PW7A 4QZ8A 4UB8U 5KG4A 8ICCA 5HHHA 2DQNB 5KFWA 2A19A 2BCUA 3SMVA 2JEIA 4UASA 1M6YA 3H0LB 2KSOA 3TADA 4IS7A 4K4IA 2G5HB 3BZCA 2E3TA 4TUSA 2RDIA 5AKHA 5D49A 4ZOHC 5ALDA 4OD0A 2W11A 2Y1IA 3V72A 4O3RA 2H3ZA 5J0YA 3C2MA 1DGJA 4JWNA 1ZD3A 3KHLA 4GC6A 2JEJA 1UT5A 5KFGA 1TAMA 5AM0A 1LKYA 4YVZA 1WWUA 4GXJA 3MR3A 3UXNA 2OH2A 2ZXHA 3BQ2A 4NL9C 3GIMA 5ALWA 4I2AA 1XO0A 4IC9A 5J2DA 4M9LA 4IQUA 1KDHA 3WU2U 5AI9A 3JPRA 5IINA 2Y0SF 2WF9A 3HKZC 3TAQA 3ED5A 3V7KA 1U47A 3HILA 2JZBB 3GZFA 2W7PA 1JRPA 2BQ3A 2HVHA 3RFAA 2R8HA 1MC8A 1BPZA 1ZD4A 4Y2VA 2JH7A 4ED8A 5AI8A 5KT7A 4J9QA 4EBEA 1ZQFA 5GTIU 2FMQA 2ZTDA 4M0AA 1L3TA 3NTUA 4UBBA 3OHBA 2FI1A 4ECQA 8ICIA 4FE3A 3M9OB 2XY6A 4M6WA 3Q8LA 5TZVA 4C8OA 4DLGA 4EEKA 2DPJA 1D8LA 2KG5A 4QWEA 8ICFA 4R8UB 1SIJA 4I29A 3OSNA 2LM4A 3E0FA 5G5HA 2AH5A 4LZGA 2BCSA 2C22A 4EELA 3H0RB 3NVWA 4P0QA 1SL1A 4JK1A 4PJ0U 2CRXA 3WK9A 1X9SA 4GFJA 3RJJA 4ED0A 4K4GA 3D2SA 3PNCA 3F2BA 4JWMA 3EPGA 3IHQB 5A0LA 3HJEA 4QZEA 4F4WA 2HBMA 3PW4A 2HBKA 2LBOA 4IRKA 4US8A 1WYGA 5AI0A 3F53A 1SV0A 4C80A 2WB1F 3AN1A 4LJXA 3RAXA 4RNNA 9ICLA 1OUQA 2W7OA 1ZQNA 4I2JA 1F0MA 2WTFA 4YQWA 4F4YA 5ALEA 5KTQA 1X9XA 1WCLA 2H3IA 5AKZA 3ZD8A 3MR2A 3V6HA 4EZ6A 1SB3C 4U7CA 2YMMA 4DSEA 2KZZA 4C0ZA 1Z3EB 1TVAA 3SD7A 3PVXA 2YTUA 2HHTA 4I2BA 2A1AA 4F93B 4KLLA 3MR6A 1UPHA 3FC4A 5L1IA 2EANA 2K4IA 3LYSA 4QZFA 2PMZC 3GILA 2J6UA 9ICNA 1ZQCA 1XSPA 5J8YC 4NLZA 4KLUA 3IRUA 3BQTA 4M9GA 4F5PA 3OJUA 3F5EA 2R8GA 1U9LA 5KFZA 2WAQC 4QWDA 3PSIA 1S0OA 1XSNA 4Z6CA 4C4RA 1WCNA 4J9LA 3RJEA 4FS1A 5C0YA 1F5SA 2DL0A 4HAIA 1XNSA 1ZQXA 3NRWA 4M9JA 1UA0A 4O3MA 5CB1A 9ICOA 1LVHA 4QZBA 3RH4A 4OCZA 3QU7A 3Q8QB 2MAXA 5KG6A 1PUZA 1OXJA 3ZDAA 2AGQA 1CUKA 5DQHA 4Y2QA 1B0XA 2QKQA 4FS2A 2NO5A 1TKDA 5L9XA 2FJ6A 4ECRA 1SKSA 5EE3A 2BCVA 1ZJNA 3M1YA 4QWBA 3BS5A 3N7RC 4YD1A 2B0CA 4OJOA 5EE0A 5ALJA 9ICJA 4F72A 2KEYA 4AP9A 4GC7A 2KFZA 4F4XA 3LDAA 2MUTB 2BCRA 3V6JA 3HPOA 4CF3A 4EYHB 8ICVA 4NWIA 1L7MA 3B9JA 3IG8A 2W9BB 4IR1A 5KG2A 2I6XA 1A0PA 4R66A 5AI5A 3RB0A 2NRXA 2DF4B 2KJ9A 4QWAA 2YB4A 4M2YA 3QEAZ 5JTIA 2G09A 2W3RA 1C20A 3PX6A 3AUOA 1NK5A 2JH1A 2OEHA 1NOMA 3SENA 2W54A 3PZPA 2ZIUB 3WKEA 2F77X 1NK7A 3TANA 1DOQA 5J2KA 3OJSA 3TADC 4I2EA 4Y2RA 1ZQLA 2O6KA 1P7DA 4RQNA 5AM5A 4KITB 2FLNA 3OPXA 5C5JA 2NYVA 2E8NA 2KVSA 5AIBA 2E8MA 1QLNA 4C8KA 4M47A 5ALLA 3ISDA 4LVSA 4UAYA 4DS5A 1XC9A 9ICXA 2W3SA 5KFHA 3OSPA 8ICUA 4WJ3B 4DWIA 3H0MB 1RYSA 1S0MA 9ICFA 3GV7B 4EBCA 2W8KA 4GXIA 5IIKA 5KFJA 3AQEA 9ICEA 5CP2A 2K4PA 4PHPA 2PFNA 4J9RA 4PGQA 5J0XA 5KT2A 5DB9A 4PZOA 1MQ2A 4DSKA 3HP6A 2ISOA 2XVTA 1AQ6A 4DO9A 3C5GA 3L3FX 4DQPA 4YXMA 1DXSA 4BUGA 3ZD9A 3SZ2A 2FLPA 1RQNA 4Q43A 4F71A 2KKPA 7ICSA 2IOFA 5DBAA 5DG9A 2Q4TA 2AQ4A 3QUCA 4YG2A 5ALSA 1Q3VA 1HEKA 3JPOA 2DBYA 4FZMA 3QUQA 2DFLA 1RYRA 2KJ8A 3RJKA 2JHDA 3QZ8A 1IG6A 3SI8A 1JUDA 3SAGA 1RYUA 4XUSA 4G9BA 5ALYA 2NV3A 1ZQEA 2N1RA 2NRZA 2UVWA 3UXOA 9ICGA 4UB4A 4UAWA 4PL2A 3TAPA 1NKBA 3S6JA 3FDSA 9ICSA 2RLTA 1Z00A 4R63A 4YCXA 1L7OA 5CRXA 2FDRA 1QTMA 2DUYA 1SV0C 1JX4A 4TUQA 4CDGA 9ICBA 4DOCA 3WK5A 5ALOA 5IIMA 1JI7A 5AKGA 1IM4A 2LPEA 2QARB 1RG6A 3AM9A 1D9FA 2JMGA 2RRDA 3RBEA 5CHGA 3EW9A 5J2FA 1PK1B 5TISU 8ICMA 5ALIA 4EX6A 4MHVA 3UMCA 4RQ2A 3RR7A 4UB5A 8ICEA 5KFAA 5KT6A 1JALA 5DG8A 2ZIWA 4IQWA 1O08A 3UMGA 4MEYA 3U26A 1COOA 3L4PA 2ESEA 2W43A 3NS1A 2DKZA 3BQ0A 2H3VA 1YT3A 5KG1A 1COKA 3QYPA 4DL3A 4J9PA 2MU2A 3WK6A 3WKDA 1Z1BA 4IL6U 2G08A 2G0AA 1MN8A 1ZQRA 5CA7A 5J2CA 1QH9A 1ZQWA 4F5RA 5CJ7A 5KFDA 1CRXA 4Y2PA 1ZQUA 1WUDA 1KLNA 4Z6EA 1KKXA 3B0YA 1DRGA 2ZIXA 2AHOB 1NZBA 3NVZA 5KG0A 2HHQA 2KV2A 3EZ5A 3SEIA 4G3IA 2KP7A 5ALVA 4YXJA 1IV8A 4NJ8A 3BQ7A 4EZ9A 3ETLA 4NXZA 2KIVA 1KFDA 3LVWA 2AXTU 2H3FA 2HHWA 4KLFA 4DL5A 4J9MA 2JGAA 4RT3A 4GXKA 4ED1A 1MQ3A 2OWOA 4B9TA 4LZDA 1KW4A 3GIIA 4J03A 2KE7A 1PVRA 2FPMA 3RF9A 8ICPA 3BQ1A 3KTQA 5E79U 3RH6A 3JPSA 2BGWA 2E5SA 5CWRA 1NK4A 5B5EU 1L7NA 2QB0B 1U45A 3R9KA 3BJYA 5ALFA 5DLGA 2GWSA 4NLKA 4B9SA 2EAMA 3N7PD 1ZQMA 1BPXA 4I2HA 5KFSA 4B9LA 4DQSA 5IIJA 4KLGA 7ICOA 8ICXA 4B9VA 3CP8A
chains in the Genus database with same CATH topology
2ESEA 2L5YA 2DKZA 1OW5A 5JRTA 5KNIA 1LKYB 4NL9A 3HILA 1COKA 2YTUA 3BS7A 1SXEA 2Y9TA 1V85A 2EANA 5JTIA 1WWVA 2E8OA 1UQVA 5J8YC 1SV4A 3SENA 3KKAC 2E8PA 2QB1A 3SEIA 3TADC 1X66A 2DL0A 4RQNA 2F8KA 5J8YA 3K1RB 2E8NA 2K60A 4NJ8A 3BQ7A 2B6GA 2E8MA 3KKAA 3TACB 2KG5A 2QARA 2D3DA 1OXJA 2LMRA 2EAPA 2KMDA 2KIVA 2KSOA 2QB0A 3TADA 1PK1A 4IS7A 1B0XA 1SXDA 2QKQA 2EAOA 1X40A 1KW4A 1SV0C 2KE7A 3IDWA 4RQMA 2GLEA 1JI7A 2F44A 2Y9UA 3BS5A 2F3NA 2K4PA 2LPEA 2QARB 1RG6A 2FE9A 2KSOB 2QB0B 4PZOA 1PK1B 5JU5A 2D8CA 1SGGA 1SV0A 1LKYA 4MHVA 1WWUA 2ES6A 2JV3A 4NL9C 1B4FA 1F0MA 1DXSA 2EAMA 1V38A 4PZNA 5F3XB 1X9XA 2DKXA 3BS5B 1UCVA 1PK3A 5L1MA 3H8MA 1Z1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESE A;  2L5Y A;  2DKZ A;  1OW5 A;  5JRT A;  5KNI A;  1LKY B;  4NL9 A;  3HIL A;  1COK A;  2YTU A;  3BS7 A;  1SXE A;  2Y9T A;  1V85 A;  2EAN A;  5JTI A;  1WWV A;  2E8O A;  1UQV A;  5J8Y C;  1SV4 A;  3SEN A;  3KKA C;  2E8P A;  2QB1 A;  3SEI A;  3TAD C;  1X66 A;  2DL0 A;  4RQN A;  2F8K A;  5J8Y A;  3K1R B;  2E8N A;  2K60 A;  4NJ8 A;  3BQ7 A;  2B6G A;  2E8M A;  3KKA A;  3TAC B;  2KG5 A;  2QAR A;  2D3D A;  1OXJ A;  2LMR A;  2EAP A;  2KMD A;  2KIV A;  2KSO A;  2QB0 A;  3TAD A;  1PK1 A;  4IS7 A;  1B0X A;  1SXD A;  2QKQ A;  2EAO A;  1X40 A;  1KW4 A;  1SV0 C;  2KE7 A;  3IDW A;  4RQM A;  2GLE A;  1JI7 A;  2F44 A;  2Y9U A;  3BS5 A;  2F3N A;  2K4P A;  2LPE A;  2QAR B;  1RG6 A;  2FE9 A;  2KSO B;  2QB0 B;  4PZO A;  1PK1 B;  5JU5 A;  2D8C A;  1SGG A;  1SV0 A;  1LKY A;  4MHV A;  1WWU A;  2ES6 A;  2JV3 A;  4NL9 C;  1B4F A;  1F0M A;  1DXS A;  2EAM A;  1V38 A;  4PZN A;  5F3X B;  1X9X A;  2DKX A;  3BS5 B;  1UCV A;  1PK3 A;  5L1M A;  3H8M A;  1Z1V A; 
#chains in the Genus database with same CATH topology
 3IG5 A;  4OJL A;  2OCE A;  3HX0 A;  2BDP A;  1IIP A;  3H4B A;  2UVV A;  1VDV A;  5AI6 A;  3Q8M A;  4ECW A;  5KFN A;  4CGZ A;  2HBJ A;  4C4S A;  5J0W A;  4QW9 A;  2FMS A;  4EX7 A;  4P2H A;  2HOQ A;  2P35 A;  3QU9 A;  4QZI A;  4I2F A;  3T5J A;  8ICB A;  4MFA A;  3FM9 A;  7ICH A;  2YX8 A;  4O0I A;  1T8E A;  1F44 A;  4PHE A;  1RM6 C;  4AYB F;  1NKC A;  2R8I A;  2XIC A;  3G6V A;  4ELU A;  4UB3 A;  3C1Y A;  4QIW C;  1A77 A;  5ALM A;  4KN4 A;  4KX5 A;  4QJF B;  5J29 A;  4BDP A;  4O3S A;  5EOZ A;  3TQ1 A;  4F2S A;  3MGI A;  4PPX A;  3ZI4 A;  2PFP A;  2LMR A;  3QU2 A;  1KRP A;  8ICQ A;  1NKE A;  5III A;  3WKC A;  1T94 A;  3IM1 A;  2JXJ A;  2NO4 A;  2JEG A;  7ICU A;  4O5E A;  3RRH A;  4YP3 A;  3HW8 A;  2W9C B;  4O3O A;  3V7J A;  4BWM A;  2Y9U A;  1QSY A;  4FZN A;  4DF8 A;  2W8L A;  3PW2 A;  3ZDE A;  7ICG A;  2NRV A;  5HR7 A;  3HWT A;  4TUP A;  3WK8 A;  2D6F C;  4RNO A;  3QU4 A;  5IIL A;  4DL6 A;  4UAV A;  3ISC A;  7ICT A;  5EWE A;  2YN4 A;  2K4H A;  1ZQA A;  1TFR A;  3H8M A;  1X2I A;  1BNP A;  4C8M A;  4F5Q A;  4DFK A;  1UHU A;  3LWL A;  2HSZ A;  3UXP A;  4YR0 A;  1SXE A;  2OXO A;  4O3Q A;  3AU2 A;  3M6Z A;  5DBB A;  2H3Q A;  4IRD A;  4DOA A;  5AHX A;  1Z4N A;  1JIH A;  3VCB A;  3D2Q A;  1CEZ A;  3K4G A;  2I5H A;  7ICP A;  4BGD A;  4GLX A;  3H8J A;  5J2G A;  3C5F A;  2QLT A;  2YMP A;  3WKA A;  3JPP A;  5ALH A;  3KZX A;  1XS9 D;  2GH1 A;  4ED7 A;  2F1J A;  5KFR A;  2XCP A;  2KFN A;  1MSW D;  2UVU A;  4Y2J A;  2EDU A;  3Q8S B;  1KFS A;  4RNM A;  1T3Q A;  3QZ7 A;  4UB6 U;  1Q46 A;  1S10 A;  2AGP A;  3KHG A;  7ICV A;  3D2N A;  1N2X A;  4CF4 A;  4X5V A;  3UQ0 A;  1HIW A;  3T5L A;  1SXD A;  5KG3 A;  1VLB A;  3ETR A;  1TV9 A;  3EYZ A;  2ZG6 A;  3RJG A;  4ECZ A;  4R65 A;  8ICA A;  5H2F U;  3QXG A;  1L5U A;  2PXI A;  4RQ7 A;  8ICN A;  1EXN A;  3EPI A;  4DQI A;  2FE9 A;  4C7Y A;  1N48 A;  2KSO B;  4KLJ A;  2G06 A;  4EEN A;  5DQG A;  1B4F A;  4QZC A;  4NLB A;  3IP4 B;  2ODG A;  3ALR A;  9ICW A;  1X6J A;  3M6K A;  4XQ8 A;  5J0U A;  5F9L A;  3AMZ A;  8ICY A;  1S97 A;  5HHI A;  2Y0S C;  4YMN A;  4YMO A;  3RAQ A;  4RQ8 A;  3KZI U;  1N56 A;  5KNI A;  8ICH A;  1LKY B;  4KX3 A;  5KFL A;  2W9A A;  2IOH A;  2G5I B;  2F1I A;  3PX0 A;  2Y9T A;  3ICX A;  4Y2X A;  2ZIV A;  3TFS A;  1J2N A;  1WWV A;  5J0T A;  4KMO B;  1KTQ A;  2XO7 A;  3SAF A;  4RPZ A;  1NK6 A;  4PHA A;  8ICO A;  3C1Z A;  3F2D A;  1XO1 A;  8ICJ A;  7ICI A;  3J81 j;  3L5K A;  1ZQI A;  2BCQ A;  2VKQ A;  4UAU A;  1V97 A;  2A1J A;  4Q8F A;  3N4M B;  2VAN A;  2YML A;  4DQQ A;  4F5O A;  1ZQV A;  4BXO A;  5D46 A;  5KFK A;  3SV4 A;  3QUT A;  1NI3 A;  1N61 A;  2W04 A;  4ECS A;  2FLL A;  5AM1 A;  1Z4O A;  4M6W B;  8ICS A;  2F44 A;  1Q3U A;  2ZJ5 A;  2F3N A;  4KLD A;  4M9N A;  1JXL A;  2RQ5 A;  5HNK A;  3MBY A;  4ED6 A;  5KT5 A;  2Z7J A;  1X9M A;  3MAB A;  2ALZ A;  4P0P A;  1ZQH A;  9ICC A;  3GV8 B;  1K1S A;  2WB1 C;  1NZP A;  2HMX A;  2LYA A;  5KT4 A;  4F91 B;  4P0Q B;  4KLQ A;  5BOL A;  4DL2 A;  5AIA A;  4ECY A;  4F50 A;  3PW5 A;  8ICG A;  3H8S A;  3V7L A;  1PK3 A;  5KL8 B;  1Y88 A;  9ICA A;  2LHT A;  4F2R A;  4KLE A;  1CI4 A;  1V9P A;  2VIX A;  5ALZ A;  5KFT A;  3NVV A;  3AQF A;  2HOI A;  2BQR A;  3AEV A;  3QX7 A;  1S0V A;  4DL4 A;  5IIO A;  2E1F A;  3MFH A;  4ECT A;  2XGP A;  2M0N A;  5KFI A;  5J0Q A;  1LB2 B;  1ZQB A;  1SWV A;  5ALX A;  5DG7 A;  1L8L A;  4RT2 A;  1BVS A;  3TKA A;  3PW0 A;  3PMN A;  2JR5 A;  1T4G A;  2K8B B;  2GO7 A;  2K8C B;  1JRO A;  3OTQ A;  4C7Z A;  1TK8 A;  3M8S A;  3MR5 A;  4P4M A;  3GQC A;  1TE2 A;  5KFY A;  3FYH A;  3K1R B;  4QZG A;  9ICP A;  4ELT A;  2B6G A;  3GIK A;  2C28 A;  2HCF A;  4UBC A;  1JXE A;  4TQR A;  4R64 A;  3QUB A;  9ICR A;  1NJW A;  2EAO A;  7ICJ A;  2HHV A;  4UB1 A;  1FFU A;  4RZR A;  4F4K A;  7ICF A;  1VJ5 A;  4QZD A;  3MGV A;  2ZTE A;  2ASD A;  4J9O A;  2RDJ A;  3TFR A;  3PV8 A;  3DV9 A;  4DLE A;  1TK5 A;  5JU5 A;  1SGG A;  2GOL A;  2JV3 A;  3OHA A;  5BOM A;  2JZB A;  2ZUC A;  2XC9 A;  1BPD A;  3ONN A;  3THV A;  2OYY A;  1X9W A;  5D4B A;  2HHS A;  5J0S A;  2J6S A;  3PML A;  4OJ6 A;  2DKX A;  3BS5 B;  3Q8P B;  3MGH A;  4RQ1 A;  4QNL A;  2LKY A;  3NGD A;  3PO4 A;  3Q8K A;  3HKZ F;  1L3S A;  4DFD A;  9ICU A;  2NRW A;  5AIC A;  1SL2 A;  4DSL A;  5HP4 A;  2C2E A;  5CEH A;  2FMP A;  2HBL A;  3PSF A;  7ICE A;  3Q8R B;  3T3F A;  4KLT A;  2ISP A;  1FIQ A;  1A6S A;  4NM2 A;  5KFO A;  4JMU A;  8ICR A;  1T3N A;  1QQ6 A;  5DBC A;  2ZUB A;  3N97 B;  8ICZ A;  2JRZ A;  4IR9 A;  1ZQJ A;  3KHH A;  5J2E A;  3C29 A;  1BPY A;  2W9M A;  1Q8K A;  4RPY A;  4ICA A;  1ECW A;  3TAC B;  5EWG A;  1ZQQ A;  4YR3 A;  5JUM A;  1SWW A;  1SZP A;  1ZET A;  2XGQ A;  4RUC A;  4Q45 A;  4KLS A;  2H5X A;  4C8L A;  1HJP A;  4UQG A;  2RP5 A;  4A8E A;  3EUB 2;  2BPF A;  3ISB A;  2GLE A;  3SV3 A;  3N28 A;  5J2H A;  3QEB Z;  2RHF A;  1U48 A;  1ZQT A;  2LYH A;  3IN5 A;  2LYB A;  9ICM A;  3BDP A;  1PVP A;  5KFC A;  1N62 A;  2MSN A;  9ICH A;  4RU9 A;  2CXY A;  2WF5 A;  3H40 A;  1RDF A;  3PST A;  1PZN A;  4E0D A;  3RJI A;  3JPQ A;  2VA8 A;  1S5L U;  5B66 U;  3M8R A;  7ICQ A;  1QQ5 A;  5G5G A;  2WF8 A;  3F5A A;  4YD2 A;  1D9D A;  1ZQK A;  5ALP A;  1SL0 A;  2L5Y A;  4OJ5 A;  1GO3 F;  4QW8 A;  4C4T A;  4RQ3 A;  4USA A;  2LM1 A;  1B22 A;  3PSP A;  5AK5 A;  3LK9 A;  3FAH A;  1HUZ A;  4DS4 A;  2PMZ F;  5DDY A;  3PR5 B;  4OO1 J;  1DK2 A;  1Z19 A;  2AU0 A;  1NK9 A;  2V9W A;  1ZQG A;  5DQI A;  3WK7 A;  5DLF A;  4RQ0 A;  2VA3 A;  3RH5 A;  1U4B A;  1ZQ1 C;  2WAQ F;  4TUR A;  4KLI A;  2KD1 A;  2VJ5 A;  1J97 A;  4UAZ A;  5DGB A;  1BGX T;  3BZK A;  2ZUD A;  3A0H U;  2R8K A;  4DEZ A;  1URJ A;  4NY8 A;  3RB3 A;  1ZXI A;  5AM3 A;  3KKA A;  3MFI A;  3GV5 B;  1U49 A;  4PGY A;  2C2R A;  4NM1 A;  5DB8 A;  5DKW A;  5AKL A;  3LWM A;  3A0B U;  2VA2 A;  1SKW A;  4QZH A;  4RPX A;  2MUT A;  4JB3 A;  1DGS A;  3CRX A;  2CPR A;  3I76 A;  1RQL A;  4Y2S A;  2IHM A;  4DSI A;  2V4R A;  2UVR A;  4Y2T A;  2YB1 A;  1ZQZ A;  3C28 A;  2BQU A;  5L1L A;  5DB7 A;  3SYZ A;  4DCC A;  1ZOL A;  4UW9 A;  1TAU A;  2W9B A;  2D8C A;  1Z00 B;  1J2M A;  9ICK A;  2VJ4 A;  7ICM A;  3E2E A;  4DFP A;  3M9M B;  3QNM A;  2KNJ A;  1V38 A;  2YY6 A;  4M04 A;  4DFM A;  2KN7 A;  1X42 A;  4BX9 C;  1UCV A;  2AGO A;  2MA1 A;  3LVV A;  3QE9 Y;  1K5O A;  4O9M A;  5KAI U;  5KT3 A;  1NJZ A;  4XA5 A;  1KSP A;  4MFF A;  5AI4 A;  2ZIU A;  4B9M A;  3H4D A;  4MF2 A;  4XRH A;  4EEY A;  1LV5 A;  2J6T A;  2ZIW B;  2IHN A;  3ZDC A;  3EWA A;  3NVY A;  5DB6 A;  5T14 A;  4KLM A;  1YZ6 A;  1FO4 A;  5J2J A;  3NRZ A;  1SV4 A;  2BPC A;  4EBD A;  1TAQ A;  2ASJ A;  5L1K A;  1L3V A;  2E8P A;  4PHD A;  1K1Q A;  2QB1 A;  1T7P A;  4KLO A;  3CNH A;  2F8L A;  2BDU A;  2AQ0 A;  3H7I A;  3C21 A;  3I1Y A;  4F3O A;  3H8W A;  2K60 A;  1L8O A;  4PH5 A;  1IXR A;  1XU4 A;  2XY5 A;  4BJQ A;  1XSL A;  1UT8 A;  2ZIX B;  3K75 D;  2DGZ A;  2KMD A;  4NLN A;  9ICV A;  1QCK A;  4MF8 A;  3RTV A;  4NV0 A;  1SZH A;  3MDC A;  1NNL A;  4DL7 A;  2BZF A;  4ED3 A;  3T79 A;  2IA6 A;  5ALT A;  2IMW P;  1PVQ A;  1S0N A;  3K1Z A;  3GIJ A;  3IDW A;  2HVI A;  3RRG A;  1BPE A;  2P66 A;  4ELV A;  3CW2 C;  4Z6D A;  2HHU A;  2K89 A;  5K4L A;  8ICW A;  3ZDD A;  5AKE A;  2AJQ A;  1KEJ A;  4RQ5 A;  2KKV A;  4KMU A;  5KFV A;  5EWF A;  5HR6 A;  3C2L A;  2WF7 A;  4CF5 A;  3KOO A;  2KIC A;  5J2A A;  5ALU A;  5KFE A;  2M9N A;  1Z1V A;  4UAT A;  1L3U A;  3KD3 A;  3PX4 A;  1ZD2 P;  2DWQ A;  4B6J A;  4FFD A;  3C2K A;  3UMB A;  5AK3 A;  3ORY A;  3HRD D;  5AK4 A;  1RZT A;  4MEX A;  4YN4 A;  5ALG A;  3RB6 A;  3SQI A;  1S77 D;  4QWC A;  4YFK A;  2YMQ A;  2E8O A;  1UQV A;  1D8B A;  1S8O A;  1A76 A;  4UB2 A;  2EZZ A;  1DK3 A;  1NJX A;  7ICN A;  1BPB A;  3G6Y A;  4ECV A;  3AL0 B;  4AYB C;  2C2D A;  3QU5 A;  2HDO A;  3SAH A;  3M9N B;  3ZDB A;  1NJY A;  3T5K A;  2HHX A;  4Q44 A;  4YMM A;  1FEZ A;  1B43 A;  4YR2 A;  1NK0 A;  7ICR A;  4IQT A;  3WKB A;  1XWL A;  4FZL A;  3MC1 A;  2KTQ A;  2QAR A;  2D3D A;  4ECX A;  2EAP A;  4NLG A;  5AK6 A;  3KFU F;  8ICK A;  3WK4 A;  2I1Q A;  3D6J A;  2FPL A;  1PK1 A;  1QQ7 A;  2F2A B;  2PI4 A;  2PKE A;  2DPI A;  3TAR A;  5L1J A;  4CNQ A;  1X40 A;  3VC8 A;  1BNO A;  3I28 A;  4FO6 A;  1TK0 A;  2LI6 A;  4MFC A;  1WG8 A;  4Z6F A;  4CE6 A;  4RUA A;  2HW3 A;  4CCH A;  9ICI A;  3TI0 A;  2NRT A;  2WF6 A;  4KTQ A;  2ZTC A;  1QSS A;  5F9N A;  3IV6 A;  3M7D A;  4F8R A;  3UM9 A;  4O5K A;  4J9N A;  2KHQ A;  1ZD5 A;  2ATL A;  3KHR A;  3RJH A;  5KFQ A;  2KJ5 A;  2BPG A;  2ZJA A;  4PZN A;  1ZYQ A;  2EQY A;  5ALR A;  2R18 A;  2HOF A;  2KZM A;  4RQ4 A;  4F92 B;  3NAS A;  3T5H A;  2XY7 A;  1OW5 A;  2W55 A;  4NL9 A;  2YQE A;  1KQQ A;  3BS7 A;  3O0F A;  4Y2Y A;  2XID A;  5KFX A;  5BPC A;  3PR4 A;  2WHE A;  5AKY A;  5J2I A;  2A3V A;  4JV2 A;  4IRC A;  4HYK A;  5J0P A;  3JPT A;  1ZQD A;  4QZA A;  2EZY A;  3KKA C;  2XCA A;  1HUO A;  4CRX A;  5KG5 A;  1ZJM A;  4DFJ A;  2KOB A;  5AKK A;  2I9G A;  4O3P A;  1UA1 A;  1ARO P;  2F76 X;  4U6P A;  9ICT A;  4I2G A;  3C23 A;  2W03 A;  4O3N A;  5J0O A;  2WFA A;  2K8A A;  2QB0 A;  1RPL A;  2XI9 A;  5KFP A;  4KN7 A;  3PO5 A;  2KVC A;  3HT3 A;  5CR0 A;  4DF4 A;  3NUQ A;  1ZRN A;  2EZX A;  5ALK A;  4GIB A;  3RR8 A;  4JV1 A;  1ZQP A;  4FBU A;  5EE9 A;  2F1H A;  3RB4 A;  1ZRM A;  5EE1 A;  3RJF A;  9ICQ A;  4F5N A;  4DQR A;  1MA7 A;  4J9S A;  2KK0 A;  4EYI B;  5KG7 A;  2JEF A;  3PY8 A;  2OM6 A;  2ZJ8 A;  4I27 A;  5KFB A;  5KFM A;  1ED1 A;  5F3X B;  4JUZ A;  1YZ7 A;  5L1M A;  2ASL A;  2FPK A;  5ALQ A;  4O5C A;  5FP0 A;  1ZQO A;  3E58 A;  2PFQ A;  7ICL A;  1FFV A;  4ECU A;  1N60 A;  1L6N A;  2B21 A;  4TQS A;  4IQV A;  2Q0Z X;  5HMM A;  3V6K A;  1V85 A;  4P4O A;  2HI0 A;  2BHN A;  4OJP A;  1KL9 A;  2IBK A;  1KFT A;  4I2C A;  2OHF A;  4DOB A;  4US9 A;  3GU3 A;  5KFF A;  5KFU A;  4C8N A;  4QZ9 A;  5GTH U;  4PGX A;  4PL1 A;  5KAF U;  4DSJ A;  4QIW F;  2ZIV B;  1QSL A;  8ICT A;  2F8K A;  3SR6 A;  5J8Y A;  4P4P A;  3GDX A;  3N7S C;  2W9C A;  1C7Y A;  1NK8 A;  4Q8E A;  4F4Z A;  2V4Q A;  4JV0 A;  2CN1 A;  4KLH A;  4R8U A;  3MDA A;  1O03 A;  2KIW A;  4J9K A;  1JN3 A;  4UAR A;  1N5X A;  1H38 A;  1JMS A;  4I28 A;  4ED2 A;  4NLC A;  2ZXI A;  2BKE A;  4M9H A;  2EH9 A;  2P6U A;  2A1J B;  4RQM A;  3DEE A;  1KN5 A;  3GFK B;  1ZQY A;  1SKR A;  4ZH4 A;  3UPQ A;  7ICK A;  3OGU A;  5DDM A;  5DGA A;  5HML A;  5AKX A;  1L7P A;  4FBT A;  3UQ2 A;  2KZ3 A;  4BXO B;  2K4E A;  3B0X A;  2BR0 A;  2IOF K;  1RXV A;  2ES6 A;  4ACO A;  2G07 A;  1S9F A;  5AKI A;  4RQ6 A;  5J0R A;  4I2I A;  3JPN A;  2MRL A;  2E1E A;  5AKJ A;  1D8Y A;  5ALN A;  1ZQS A;  3AU6 A;  1N5W A;  2PI5 A;  5KL1 B;  1N63 A;  3KBB A;  4B9U A;  5AM4 A;  5JRT A;  4P0P B;  4B9N A;  4I2D A;  5J2B A;  2Y1J A;  1X6I A;  3CYM A;  8ICL A;  2R8J A;  4BWJ A;  3DDH A;  3RBD A;  1RXW A;  4DSF A;  2P6R A;  2PFO A;  2KHV A;  3G6X A;  4K4H A;  1KBU A;  4Y2U A;  1S76 D;  3F2C A;  1X66 A;  5AM2 A;  3PW7 A;  4QZ8 A;  4UB8 U;  5KG4 A;  8ICC A;  5HHH A;  2DQN B;  5KFW A;  2A19 A;  2BCU A;  3SMV A;  2JEI A;  4UAS A;  1M6Y A;  3H0L B;  2KSO A;  3TAD A;  4IS7 A;  4K4I A;  2G5H B;  3BZC A;  2E3T A;  4TUS A;  2RDI A;  5AKH A;  5D49 A;  4ZOH C;  5ALD A;  4OD0 A;  2W11 A;  2Y1I A;  3V72 A;  4O3R A;  2H3Z A;  5J0Y A;  3C2M A;  1DGJ A;  4JWN A;  1ZD3 A;  3KHL A;  4GC6 A;  2JEJ A;  1UT5 A;  5KFG A;  1TAM A;  5AM0 A;  1LKY A;  4YVZ A;  1WWU A;  4GXJ A;  3MR3 A;  3UXN A;  2OH2 A;  2ZXH A;  3BQ2 A;  4NL9 C;  3GIM A;  5ALW A;  4I2A A;  1XO0 A;  4IC9 A;  5J2D A;  4M9L A;  4IQU A;  1KDH A;  3WU2 U;  5AI9 A;  3JPR A;  5IIN A;  2Y0S F;  2WF9 A;  3HKZ C;  3TAQ A;  3ED5 A;  3V7K A;  1U47 A;  3HIL A;  2JZB B;  3GZF A;  2W7P A;  1JRP A;  2BQ3 A;  2HVH A;  3RFA A;  2R8H A;  1MC8 A;  1BPZ A;  1ZD4 A;  4Y2V A;  2JH7 A;  4ED8 A;  5AI8 A;  5KT7 A;  4J9Q A;  4EBE A;  1ZQF A;  5GTI U;  2FMQ A;  2ZTD A;  4M0A A;  1L3T A;  3NTU A;  4UBB A;  3OHB A;  2FI1 A;  4ECQ A;  8ICI A;  4FE3 A;  3M9O B;  2XY6 A;  4M6W A;  3Q8L A;  5TZV A;  4C8O A;  4DLG A;  4EEK A;  2DPJ A;  1D8L A;  2KG5 A;  4QWE A;  8ICF A;  4R8U B;  1SIJ A;  4I29 A;  3OSN A;  2LM4 A;  3E0F A;  5G5H A;  2AH5 A;  4LZG A;  2BCS A;  2C22 A;  4EEL A;  3H0R B;  3NVW A;  4P0Q A;  1SL1 A;  4JK1 A;  4PJ0 U;  2CRX A;  3WK9 A;  1X9S A;  4GFJ A;  3RJJ A;  4ED0 A;  4K4G A;  3D2S A;  3PNC A;  3F2B A;  4JWM A;  3EPG A;  3IHQ B;  5A0L A;  3HJE A;  4QZE A;  4F4W A;  2HBM A;  3PW4 A;  2HBK A;  2LBO A;  4IRK A;  4US8 A;  1WYG A;  5AI0 A;  3F53 A;  1SV0 A;  4C80 A;  2WB1 F;  3AN1 A;  4LJX A;  3RAX A;  4RNN A;  9ICL A;  1OUQ A;  2W7O A;  1ZQN A;  4I2J A;  1F0M A;  2WTF A;  4YQW A;  4F4Y A;  5ALE A;  5KTQ A;  1X9X A;  1WCL A;  2H3I A;  5AKZ A;  3ZD8 A;  3MR2 A;  3V6H A;  4EZ6 A;  1SB3 C;  4U7C A;  2YMM A;  4DSE A;  2KZZ A;  4C0Z A;  1Z3E B;  1TVA A;  3SD7 A;  3PVX A;  2YTU A;  2HHT A;  4I2B A;  2A1A A;  4F93 B;  4KLL A;  3MR6 A;  1UPH A;  3FC4 A;  5L1I A;  2EAN A;  2K4I A;  3LYS A;  4QZF A;  2PMZ C;  3GIL A;  2J6U A;  9ICN A;  1ZQC A;  1XSP A;  5J8Y C;  4NLZ A;  4KLU A;  3IRU A;  3BQT A;  4M9G A;  4F5P A;  3OJU A;  3F5E A;  2R8G A;  1U9L A;  5KFZ A;  2WAQ C;  4QWD A;  3PSI A;  1S0O A;  1XSN A;  4Z6C A;  4C4R A;  1WCN A;  4J9L A;  3RJE A;  4FS1 A;  5C0Y A;  1F5S A;  2DL0 A;  4HAI A;  1XNS A;  1ZQX A;  3NRW A;  4M9J A;  1UA0 A;  4O3M A;  5CB1 A;  9ICO A;  1LVH A;  4QZB A;  3RH4 A;  4OCZ A;  3QU7 A;  3Q8Q B;  2MAX A;  5KG6 A;  1PUZ A;  1OXJ A;  3ZDA A;  2AGQ A;  1CUK A;  5DQH A;  4Y2Q A;  1B0X A;  2QKQ A;  4FS2 A;  2NO5 A;  1TKD A;  5L9X A;  2FJ6 A;  4ECR A;  1SKS A;  5EE3 A;  2BCV A;  1ZJN A;  3M1Y A;  4QWB A;  3BS5 A;  3N7R C;  4YD1 A;  2B0C A;  4OJO A;  5EE0 A;  5ALJ A;  9ICJ A;  4F72 A;  2KEY A;  4AP9 A;  4GC7 A;  2KFZ A;  4F4X A;  3LDA A;  2MUT B;  2BCR A;  3V6J A;  3HPO A;  4CF3 A;  4EYH B;  8ICV A;  4NWI A;  1L7M A;  3B9J A;  3IG8 A;  2W9B B;  4IR1 A;  5KG2 A;  2I6X A;  1A0P A;  4R66 A;  5AI5 A;  3RB0 A;  2NRX A;  2DF4 B;  2KJ9 A;  4QWA A;  2YB4 A;  4M2Y A;  3QEA Z;  5JTI A;  2G09 A;  2W3R A;  1C20 A;  3PX6 A;  3AUO A;  1NK5 A;  2JH1 A;  2OEH A;  1NOM A;  3SEN A;  2W54 A;  3PZP A;  2ZIU B;  3WKE A;  2F77 X;  1NK7 A;  3TAN A;  1DOQ A;  5J2K A;  3OJS A;  3TAD C;  4I2E A;  4Y2R A;  1ZQL A;  2O6K A;  1P7D A;  4RQN A;  5AM5 A;  4KIT B;  2FLN A;  3OPX A;  5C5J A;  2NYV A;  2E8N A;  2KVS A;  5AIB A;  2E8M A;  1QLN A;  4C8K A;  4M47 A;  5ALL A;  3ISD A;  4LVS A;  4UAY A;  4DS5 A;  1XC9 A;  9ICX A;  2W3S A;  5KFH A;  3OSP A;  8ICU A;  4WJ3 B;  4DWI A;  3H0M B;  1RYS A;  1S0M A;  9ICF A;  3GV7 B;  4EBC A;  2W8K A;  4GXI A;  5IIK A;  5KFJ A;  3AQE A;  9ICE A;  5CP2 A;  2K4P A;  4PHP A;  2PFN A;  4J9R A;  4PGQ A;  5J0X A;  5KT2 A;  5DB9 A;  4PZO A;  1MQ2 A;  4DSK A;  3HP6 A;  2ISO A;  2XVT A;  1AQ6 A;  4DO9 A;  3C5G A;  3L3F X;  4DQP A;  4YXM A;  1DXS A;  4BUG A;  3ZD9 A;  3SZ2 A;  2FLP A;  1RQN A;  4Q43 A;  4F71 A;  2KKP A;  7ICS A;  2IOF A;  5DBA A;  5DG9 A;  2Q4T A;  2AQ4 A;  3QUC A;  4YG2 A;  5ALS A;  1Q3V A;  1HEK A;  3JPO A;  2DBY A;  4FZM A;  3QUQ A;  2DFL A;  1RYR A;  2KJ8 A;  3RJK A;  2JHD A;  3QZ8 A;  1IG6 A;  3SI8 A;  1JUD A;  3SAG A;  1RYU A;  4XUS A;  4G9B A;  5ALY A;  2NV3 A;  1ZQE A;  2N1R A;  2NRZ A;  2UVW A;  3UXO A;  9ICG A;  4UB4 A;  4UAW A;  4PL2 A;  3TAP A;  1NKB A;  3S6J A;  3FDS A;  9ICS A;  2RLT A;  1Z00 A;  4R63 A;  4YCX A;  1L7O A;  5CRX A;  2FDR A;  1QTM A;  2DUY A;  1SV0 C;  1JX4 A;  4TUQ A;  4CDG A;  9ICB A;  4DOC A;  3WK5 A;  5ALO A;  5IIM A;  1JI7 A;  5AKG A;  1IM4 A;  2LPE A;  2QAR B;  1RG6 A;  3AM9 A;  1D9F A;  2JMG A;  2RRD A;  3RBE A;  5CHG A;  3EW9 A;  5J2F A;  1PK1 B;  5TIS U;  8ICM A;  5ALI A;  4EX6 A;  4MHV A;  3UMC A;  4RQ2 A;  3RR7 A;  4UB5 A;  8ICE A;  5KFA A;  5KT6 A;  1JAL A;  5DG8 A;  2ZIW A;  4IQW A;  1O08 A;  3UMG A;  4MEY A;  3U26 A;  1COO A;  3L4P A;  2ESE A;  2W43 A;  3NS1 A;  2DKZ A;  3BQ0 A;  2H3V A;  1YT3 A;  5KG1 A;  1COK A;  3QYP A;  4DL3 A;  4J9P A;  2MU2 A;  3WK6 A;  3WKD A;  1Z1B A;  4IL6 U;  2G08 A;  2G0A A;  1MN8 A;  1ZQR A;  5CA7 A;  5J2C A;  1QH9 A;  1ZQW A;  4F5R A;  5CJ7 A;  5KFD A;  1CRX A;  4Y2P A;  1ZQU A;  1WUD A;  1KLN A;  4Z6E A;  1KKX A;  3B0Y A;  1DRG A;  2ZIX A;  2AHO B;  1NZB A;  3NVZ A;  5KG0 A;  2HHQ A;  2KV2 A;  3EZ5 A;  3SEI A;  4G3I A;  2KP7 A;  5ALV A;  4YXJ A;  1IV8 A;  4NJ8 A;  3BQ7 A;  4EZ9 A;  3ETL A;  4NXZ A;  2KIV A;  1KFD A;  3LVW A;  2AXT U;  2H3F A;  2HHW A;  4KLF A;  4DL5 A;  4J9M A;  2JGA A;  4RT3 A;  4GXK A;  4ED1 A;  1MQ3 A;  2OWO A;  4B9T A;  4LZD A;  1KW4 A;  3GII A;  4J03 A;  2KE7 A;  1PVR A;  2FPM A;  3RF9 A;  8ICP A;  3BQ1 A;  3KTQ A;  5E79 U;  3RH6 A;  3JPS A;  2BGW A;  2E5S A;  5CWR A;  1NK4 A;  5B5E U;  1L7N A;  2QB0 B;  1U45 A;  3R9K A;  3BJY A;  5ALF A;  5DLG A;  2GWS A;  4NLK A;  4B9S A;  2EAM A;  3N7P D;  1ZQM A;  1BPX A;  4I2H A;  5KFS A;  4B9L A;  4DQS A;  5IIJ A;  4KLG A;  7ICO A;  8ICX A;  4B9V A;  3CP8 A; 
#chains in the Genus database with same CATH homology
 2ESE A;  2L5Y A;  2DKZ A;  1OW5 A;  5JRT A;  5KNI A;  1LKY B;  4NL9 A;  3HIL A;  1COK A;  2YTU A;  3BS7 A;  1SXE A;  2Y9T A;  1V85 A;  2EAN A;  5JTI A;  1WWV A;  2E8O A;  1UQV A;  5J8Y C;  1SV4 A;  3SEN A;  3KKA C;  2E8P A;  2QB1 A;  3SEI A;  3TAD C;  1X66 A;  2DL0 A;  4RQN A;  2F8K A;  5J8Y A;  3K1R B;  2E8N A;  2K60 A;  4NJ8 A;  3BQ7 A;  2B6G A;  2E8M A;  3KKA A;  3TAC B;  2KG5 A;  2QAR A;  2D3D A;  1OXJ A;  2LMR A;  2EAP A;  2KMD A;  2KIV A;  2KSO A;  2QB0 A;  3TAD A;  1PK1 A;  4IS7 A;  1B0X A;  1SXD A;  2QKQ A;  2EAO A;  1X40 A;  1KW4 A;  1SV0 C;  2KE7 A;  3IDW A;  4RQM A;  2GLE A;  1JI7 A;  2F44 A;  2Y9U A;  3BS5 A;  2F3N A;  2K4P A;  2LPE A;  2QAR B;  1RG6 A;  2FE9 A;  2KSO B;  2QB0 B;  4PZO A;  1PK1 B;  5JU5 A;  2D8C A;  1SGG A;  1SV0 A;  1LKY A;  4MHV A;  1WWU A;  2ES6 A;  2JV3 A;  4NL9 C;  1B4F A;  1F0M A;  1DXS A;  2EAM A;  1V38 A;  4PZN A;  5F3X B;  1X9X A;  2DKX A;  3BS5 B;  1UCV A;  1PK3 A;  5L1M A;  3H8M A;  1Z1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...