2B6GA

Rna recognition by the vts1 sam domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
NPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title RNA recognition by the Vts1p SAM domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords 5'-R(*GP*GP*AP*GP*GP*CP*UP*CP*UP*GP*GP*CP*AP*GP*CP*UP*UP*UP*
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2b6gA00
4PZOA 1WWVA 2EAOA 2GLEA 1PK3A 1X9XA 4NJ8A 1DXSA 2D8CA 2E8MA 2Y9TA 5J8YC 2KIVA 2LPEA 5JRTA 3KKAC 1V85A 4NL9A 1B0XA 1SGGA 3SENA 2KG5A 2YTUA 1SXEA 5KNIA 4NL9C 1WWUA 2K4PA 1PK1B 4IS7A 2LMRA 4MHVA 5JTIA 1UCVA 1KW4A 1LKYA 1V38A 2E8OA 1SV0A 1F0MA 2Y9UA 2EAMA 2QARA 4PZNA 2KMDA 2ES6A 3BS5A 2FE9A 3K1RB 3TADC 2QB0A 1OW5A 3H8MA 3IDWA 4RQMA 1LKYB 1B4FA 3BS7A 2JV3A 2QB1A 2F3NA 2QARB 1SV4A 3SEIA 1JI7A 2F44A 2DKZA 2KE7A 1X40A 2ESEA 2QB0B 2B6GA 3BQ7A 1RG6A 3HILA 3TACB 2K60A 5JU5A 1OXJA 2F8KA 5F3XB 1COKA 1UQVA 2QKQA 2E8PA 2D3DA 2KSOB 1PK1A 1SV0C 1X66A 2L5YA 4RQNA 2KSOA 1SXDA 2E8NA 3KKAA 5L1MA 3TADA 5J8YA 2EAPA 2EANA 2DKXA 1Z1VA 2DL0A 3BS5B
chains in the Genus database with same CATH superfamily
1NK0A 2KKPA 1DOQA 2BGWA 5EWFA 2IMWP 1ZQHA 2HHTA 3V7JA 4C4RA 4ECXA 1T3QA 1BPXA 2Q0ZX 4WJ3B 2W8KA 2YMPA 4QWAA 1N2XA 1JXEA 2K8BB 8ICMA 4IS7A 1UCVA 3Q8RB 1F0MA 4PHDA 3GIJA 4G3IA 1KFTA 4ECUA 1RYRA 5BOLA 2JEFA 4OO1J 4DFKA 3JPSA 2BQRA 3UQ0A 1CUKA 5DBCA 2ALZA 1ZQQA 2H3QA 4M6WB 4RQ8A 5DG8A 3DEEA 5DKWA 4EEYA 1A0PA 7ICJA 8ICJA 3UPQA 2N1RA 4Y2VA 3HRDD 2ATLA 5ALQA 4ED3A 4CNQA 1RYUA 3MFIA 2H5XA 4QZAA 3V7KA 5KG6A 4BGDA 5HR6A 5ALMA 2G08A 4QW8A 2DUYA 2ZIWB 5KT4A 2CRXA 4RQ2A 4LZGA 3OPXA 1N5WA 5KFMA 2BQUA 4PHEA 2JRZA 2F1JA 4FZNA 5B5EU 2AGQA 2FLPA 3RRGA 2OCEA 4MFFA 2WF7A 3PX4A 3NVYA 3NGDA 2KFZA 2P6RA 1XO1A 3MGHA 5DB9A 5AI9A 3D2QA 4YFKA 4RT3A 3IG8A 5HMMA 5CB1A 2ZXHA 4NJ8A 3ETRA 3M9MB 1D9FA 4YCXA 3C23A 4IQTA 1SGGA 4O5KA 4XUSA 4NM1A 2OEHA 3ZDEA 2VIXA 3EPIA 2Y1IA 4F91B 3QX7A 5KL1B 2HOFA 4P0QB 2JGAA 1VLBA 2H3IA 1L8OA 2HHUA 1ZJNA 2EAMA 4Q43A 1S76D 2PXIA 3KZIU 1ZQAA 3MR5A 1D8LA 3T3FA 4OCZA 3TADC 4PHAA 3WK7A 5TZVA 5KG5A 5AM1A 4RUAA 3PNCA 1KFDA 3TQ1A 4KLLA 4NLZA 4FBUA 1ZQVA 2EH9A 4Y2SA 9ICEA 1SV4A 2AJQA 4QIWF 2HOQA 3OHAA 2CPRA 1JI7A 5ALHA 3PX0A 1JIHA 4O3MA 4IRCA 2B6GA 8ICHA 3JPRA 3TANA 9ICQA 4EELA 3UMGA 8ICAA 9ICGA 4DSJA 4F5OA 2JEIA 2B21A 5J0PA 2IOFK 2V9WA 4O3RA 3QZ7A 3LWLA 4RPYA 1NZBA 3PSTA 3RJGA 5J29A 3UXPA 2W8LA 2W03A 2KSOA 2M0NA 5KFIA 7ICTA 4F92B 2PMZC 2FJ6A 8ICRA 2ZJAA 1ZD4A 3ZDCA 1JRPA 1UA0A 4TUQA 2G07A 4Q44A 3UQ2A 1ZQXA 4TQSA 1RZTA 2I9GA 4TURA 4E0DA 9ICIA 5KFYA 1QSLA 1K1QA 3H0MB 3Q8MA 2EDUA 2C2EA 1UT8A 5J8YC 2BDUA 2ZIXA 3HX0A 2LPEA 5JRTA 1S97A 1URJA 2BCVA 3BQ1A 3NRZA 2HHSA 3V7LA 3MDAA 4QWBA 1HUZA 4JMUA 3EWAA 2BPCA 4XA5A 3KFUF 3PO5A 2C28A 5AK5A 1KRPA 1LKYA 4ED8A 1RXWA 1S8OA 2A19A 2VJ5A 2ODGA 1SKRA 1PZNA 9ICAA 9ICFA 3A0BU 1QH9A 3MGVA 1CRXA 4ECRA 1K1SA 4PZNA 4NY8A 1TAQA 4P2HA 3UMCA 2LM1A 7ICUA 4QZGA 5BOMA 4YVZA 3SMVA 2BR0A 3FC4A 4M47A 1L7OA 3B0YA 5J0OA 1BPZA 8ICSA 4IQUA 4F72A 5ALVA 1A77A 2EZXA 1IG6A 3BQ2A 4PPXA 3GILA 3H8JA 4F3OA 1KEJA 2DGZA 2JMGA 3IG5A 2LKYA 4IQVA 4O3NA 3H7IA 4J9SA 4JK1A 4DL5A 5IIOA 1OXJA 4RPZA 2KZ3A 5KFVA 5F3XB 3HJEA 2KZMA 5AKYA 1DGJA 2G06A 3RR8A 3NVWA 4P0QA 4JB3A 5KFOA 3WKEA 2RDJA 2EQYA 2WF6A 4ELVA 1RQNA 2KEYA 4BX9C 1Z1VA 2XGQA 2W11A 4UB6U 3C28A 3KTQA 2DPIA 3WKAA 3F5AA 3HPOA 2ISOA 2JH7A 2DFLA 5L1IA 3PSFA 4R63A 4KLJA 4I2FA 4FE3A 4Y2UA 4DLEA 7ICPA 1V85A 4I28A 1YZ6A 2KK0A 5E79U 3B0XA 5KFJA 2KN7A 4PGYA 5DBBA 1KN5A 1U45A 4F2RA 3H8WA 4MHVA 1ZD5A 4UB3A 5CHGA 3RB3A 2BQ3A 2XI9A 1XSNA 4C7ZA 2QARA 2FI1A 4I2JA 2EZZA 4ED2A 2NRXA 4GC7A 5HR7A 3GFKB 4EYIB 3E2EA 5IIIA 4RNNA 4DO9A 4QZEA 2UVWA 4EZ9A 5EWGA 5KFSA 2HDOA 4KMOB 5DG9A 5J2GA 4C80A 2AH5A 2KHQA 4BDPA 1ZQOA 1L3SA 1DK2A 1NNLA 4I2AA 1NKEA 1ZQPA 4PGXA 4EX7A 2F44A 2KTQA 1FFVA 1N56A 4M9HA 2ZUCA 1WG8A 1IM4A 2V4QA 1J97A 3S6JA 1JALA 3OGUA 2F8KA 4QWDA 3K4GA 2HVIA 9ICPA 1HIWA 3THVA 2RQ5A 3KBBA 4F50A 3RH5A 5KG3A 2AQ0A 3NTUA 2P66A 3SAGA 2KD1A 2RP5A 3IM1A 4C0ZA 9ICTA 2F8LA 1JN3A 1V9PA 1ZQWA 5J2FA 3IN5A 4JWMA 4IL6U 8ICPA 4G9BA 4KLOA 4OJ5A 2P35A 4O5CA 1BPEA 1S10A 5ALFA 4OJOA 4GC6A 2XY6A 4YD2A 3F2DA 4NL9C 3O0FA 4XRHA 2WB1F 4RPXA 2LMRA 2F1HA 3CYMA 2YMMA 4RQ5A 4YG2A 5ALTA 5L1JA 4FS1A 4J03A 2FMQA 2IOFA 4I2CA 4YXMA 2PFOA 3AQFA 4DOBA 2VA3A 4C4TA 8ICVA 3JPTA 3IDWA 2IHNA 1QSSA 3JPNA 4B9MA 2BPFA 1ZRNA 2YB1A 5KT3A 3FM9A 3AM9A 4DF8A 3QU4A 5ALPA 4Y2TA 2NRTA 4P4OA 1ZQTA 4BXOB 3F5EA 3QEAZ 4IR9A 4KITB 2AGOA 4RQ4A 3MR2A 5ALLA 4I27A 4F71A 2K60A 2OYYA 4ECTA 2ZJ8A 4NLCA 3MGIA 3AQEA 4MEXA 2FPMA 4DLGA 2KICA 5KFHA 1COKA 3RBDA 3EUB2 5DDMA 1IIPA 2E1FA 4J9OA 2MUTB 1LVHA 2P6UA 2AU0A 4UAVA 4US8A 5FP0A 2W9BA 4UB4A 3K1ZA 1S77D 1T8EA 5ALYA 2K8AA 4I29A 2DBYA 1SZHA 5KT2A 3N7RC 4MFCA 4KLUA 4M2YA 5ALEA 2HVHA 3OTQA 1NK5A 5DLGA 2BPGA 3QE9Y 1Q8KA 1X2IA 2EZYA 3AN1A 4ZOHC 8ICGA 4DSKA 5D4BA 5K4LA 1TK0A 2Y9TA 5JUMA 8ICZA 1YZ7A 1XU4A 4UB1A 4NM2A 4C8NA 4CCHA 2VA2A 1SIJA 4FO6A 2AHOB 4YQWA 4TQRA 1PVQA 4UBBA 5AM2A 1Q3UA 2HCFA 1SL2A 1FEZA 1X9WA 2B0CA 3RH6A 3PV8A 2W9CB 3LVWA 2G5HB 5L1KA 1Z4NA 3HP6A 3PZPA 2NO5A 2FLNA 9ICJA 4HAIA 4UASA 1ZQUA 5EE1A 2FE9A 9ICCA 5KFLA 2YMQA 1L7PA 4GFJA 4R66A 3TI0A 2Y0SC 4RQMA 2MA1A 4KLMA 1PUZA 3WKCA 2JV3A 2QB1A 5AI6A 5KG7A 2I1QA 3GV7B 3RRHA 5DB8A 4MF8A 1AQ6A 1C20A 2MRLA 2ASJA 4UATA 7ICGA 1DK3A 3SD7A 3RJHA 1BPDA 3H40A 1XNSA 1CI4A 3LYSA 2FMSA 8ICNA 1SV0C 2NO4A 5KL8B 1FIQA 4UQGA 4UAUA 4I2IA 4QZBA 1AROP 2VA8A 5L1MA 5AKZA 5KG0A 2EAPA 1L5UA 3D2NA 1NJYA 3ISBA 3AL0B 3QNMA 1Q3VA 2FDRA 3C1ZA 9ICBA 2DWQA 4LJXA 4US9A 2KVCA 2ZTCA 5KFXA 5IIKA 4QZ9A 4J9PA 1A76A 5EE3A 2IA6A 7ICVA 1UHUA 2AXTU 2JR5A 4LVSA 2R18A 3MC1A 5CWRA 4O9MA 3PMNA 3T5LA 4ECWA 4KX3A 1NJZA 1WWUA 3C1YA 3RJEA 3KD3A 4A8EA 1ZQRA 3QUCA 5CP2A 3QU7A 4NLBA 1S5LU 1XSLA 1V38A 9ICMA 5AI8A 7ICEA 3QYPA 2W7OA 4BUGA 3M1YA 4C7YA 4Q45A 7ICFA 2XY7A 1BVSA 3GDXA 4DS5A 1RM6C 2Y0SF 3RTVA 4GXKA 1QTMA 3H4BA 3SAFA 2FPLA 1MQ2A 2QB0A 1U49A 2G0AA 4ECSA 2G5IB 4CF3A 3HKZC 3RB0A 2K8CB 4RQ7A 5KFAA 2JZBB 4BWJA 4UBCA 5D46A 3UXNA 2C2RA 3KHRA 2WAQF 5ALUA 4Z6DA 2KFNA 3BQ7A 4I2HA 4FZMA 1GO3F 5KFUA 9ICXA 2WF9A 1ZETA 3L5KA 1MSWD 5AKEA 1ZQIA 4AYBF 5KFGA 3QUTA 5ALSA 3OJUA 5A0LA 3BQ0A 3HKZF 4EBDA 3TFSA 2AGPA 8ICXA 5J2AA 3BDPA 1MQ3A 5DB6A 3KKAA 4MF2A 5HNKA 3WK9A 1JMSA 3PW5A 4UARA 1L6NA 5ALOA 2LYHA 1NJWA 3IP4B 4RQ6A 4ED0A 3PW4A 3PW0A 3PR4A 3V6KA 4QZHA 2DPJA 1SL0A 1PK3A 2JXJA 1ZQLA 2E8MA 4BJQA 2XCAA 5IINA 4IR1A 1TFRA 2HBLA 5BPCA 5CRXA 1RQLA 2K4IA 4IC9A 4KLTA 5AICA 5KFFA 1C7YA 3K75D 3KHGA 4DSFA 5AHXA 4J9QA 3J81j 2E8OA 5KG1A 2ZIXB 3U26A 2W43A 3WK8A 4B9VA 4CE6A 3H0RB 4M9LA 4DFJA 4B9LA 4M9NA 3ICXA 3R9KA 1ZQDA 1O08A 1ZQKA 3NRWA 3NUQA 1LKYB 4Y2JA 1VJ5A 1ZD2P 1D9DA 1TE2A 4OJPA 2PKEA 3IRUA 2HBJA 2BCSA 8ICLA 1RG6A 4YP3A 2E5SA 3PW7A 2E1EA 3N97B 2W04A 1N62A 1F44A 7ICOA 4DEZA 4J9MA 4B9TA 1ECWA 3LDAA 5AI4A 2WTFA 4NLNA 3ED5A 2LBOA 1XWLA 1MC8A 4M04A 4DFPA 2MSNA 2ZIWA 7ICQA 2EANA 3PR5B 2RDIA 4CF5A 2HHXA 3PSIA 5B66U 2KZZA 3ORYA 1L7MA 4R65A 1S0MA 2HHVA 4ED1A 1DXSA 4J9LA 1TAMA 3KZXA 2JZBA 2A1JA 3C2LA 4EZ6A 1B0XA 1X42A 3M8SA 3CNHA 5AKGA 3H8SA 5KNIA 5T14A 4GIBA 5DGBA 3JPOA 1Z1BA 8ICWA 1ZQSA 4UAZA 4YR3A 1TK8A 3Q8KA 1S0VA 2PFQA 7ICRA 4B9UA 4RNMA 2Y9UA 3RFAA 3RJIA 1T94A 2VANA 1QQ5A 4F4YA 4QZCA 2HSZA 3PX6A 2ZG6A 5AM4A 7ICLA 4NLKA 1SKWA 4F5PA 1Q46A 2LM4A 1X6IA 5J2JA 4KLHA 2ZXIA 4I2EA 4QZ8A 2QARB 5J2BA 1V97A 4RNOA 3LVVA 2KJ9A 4ECYA 4O3PA 4DL6A 2YQEA 4DQSA 4CRXA 2LYAA 3ALRA 3ZDAA 9ICLA 1QLNA 3FYHA 4ELUA 3IV6A 1UQVA 1N63A 1JXLA 3L3FX 5DQHA 2R8KA 3RAXA 4KLFA 5KAFU 3ZD9A 3QUBA 3ONNA 3B9JA 4JWNA 2NRZA 3T5KA 1B22A 4J9KA 4R8UA 4DF4A 2DKXA 1TAUA 4DQRA 3GIMA 3MR3A 2HW3A 1ZOLA 3WK4A 2JH1A 3ISDA 2MAXA 4ELTA 1ZD3A 4FFDA 1ZXIA 4USAA 4EX6A 4IRDA 2D8CA 4OD0A 3MBYA 5CEHA 4ED6A 8ICTA 2HOIA 4RUCA 5GTHU 5J0WA 4HYKA 1ZQYA 5AKXA 2ZUDA 5DB7A 4JV0A 4DOCA 4CDGA 1QQ6A 4M6WA 1T3NA 2W55A 4KLGA 2KNJA 2WB1C 1QCKA 2BDPA 4B9SA 4QNLA 1M6YA 4NWIA 3BS7A 3UMBA 2RHFA 1KDHA 1D8BA 4KMUA 3QU2A 3PVXA 2A3VA 3C2KA 3Q8LA 2KOBA 3ETLA 4IQWA 2F77X 2KE7A 1U47A 2IOHA 3ZD8A 3HILA 3DDHA 4YMOA 3TACB 5L1LA 2BHNA 2A1JB 1J2MA 3EW9A 1HJPA 3QU5A 1Z00B 5J2HA 8ICKA 4ACOA 7ICKA 2ZIUA 3KOOA 4QZIA 1A6SA 5AKLA 2Q4TA 5L9XA 5J0QA 4OJ6A 5C0YA 1ZQ1C 4UB5A 3MDCA 3Q8QB 1XSPA 5EWEA 3D6JA 1QQ7A 4DQIA 2HBMA 2MUTA 4DCCA 9ICOA 5EE9A 4AYBC 2GLEA 3VCBA 3Q8PB 2W9MA 4Z6FA 2ZTDA 5HHHA 1LV5A 3SENA 2C22A 1F5SA 3HW8A 3HWTA 1NJXA 5G5HA 3WK6A 4C4SA 2WF8A 4C8OA 2GOLA 4GXIA 2H3FA 1L3VA 2C2DA 4QJFB 1SV0A 2UVRA 1KL9A 2KJ8A 2KKVA 4F4KA 4M9GA 2F2AB 4ED7A 2ES6A 3JPQA 2LYBA 3F53A 5ALWA 3BS5A 3K1RB 4PGQA 1XC9A 4O3SA 5J0XA 3G6YA 1B4FA 2W9CA 4CGZA 5KFCA 1ZQCA 2PFPA 4K4GA 5F9NA 5ALIA 5J0UA 3M9OB 1UT5A 2G09A 3DV9A 3I1YA 3HT3A 2CXYA 1NOMA 4PL2A 1ED1A 8ICOA 4P0PB 4EBCA 1VDVA 5J2EA 4F4XA 4M0AA 2ASDA 1JUDA 4EEKA 5JU5A 1ZQMA 4KN7A 3VC8A 2GO7A 1N61A 2QKQA 5KG2A 1KFSA 4Z6EA 1D8YA 3OJSA 4KTQA 2LHTA 4QZFA 1SXDA 2E8NA 3V6JA 3EZ5A 9ICKA 4KX5A 4XQ8A 3M6KA 4ECQA 5CA7A 4MFAA 4KLQA 4Q8FA 1BPBA 8ICFA 4R8UB 2ZIVB 1X6JA 2OM6A 1H38A 2HHQA 2YB4A 9ICNA 3GIIA 1SKSA 4UW9A 1DRGA 1KQQA 3RB6A 1ZQNA 4GLXA 2W9AA 1RYSA 1U9LA 1IV8A 2F76X 3KKAC 4F5QA 5AI0A 4O5EA 3M7DA 3SV4A 2KG5A 1SXEA 1NKCA 5J2KA 3SI8A 4Y2QA 3IHQB 1PK1B 5DG7A 1S9FA 8ICBA 3NVVA 5EE0A 9ICRA 4TUSA 2MU2A 1NZPA 1Z00A 1T7PA 2Y1JA 3F2BA 4CF4A 5AKIA 1N60A 1FO4A 4I2GA 2WF5A 2PMZF 5J2IA 3SQIA 1NK8A 1WYGA 2YX8A 3FDSA 1BPYA 3RJFA 3GIKA 4DOAA 1NK4A 5ALDA 2R8JA 3N4MB 8ICUA 5KFWA 2V4RA 2QB0B 1KKXA 4DFDA 2NRWA 2BCUA 1N48A 2ZUBA 4EENA 4NXZA 3D2SA 1RPLA 3CW2C 4I2BA 5J2DA 2K89A 2R8HA 3C21A 2XGPA 5ALXA 2XICA 9ICUA 1SB3C 4BXOA 2XY5A 2D3DA 3OHBA 2W3RA 4JV1A 3MFHA 1ZQBA 4Z6CA 3E58A 3RF9A 3MR6A 1WCNA 4NLGA 3QZ8A 1RXVA 3LK9A 1UPHA 2FMPA 1KLNA 4DSEA 1ZQZA 4YR0A 2JEJA 3NS1A 1WCLA 4DL2A 2DL0A 3WU2U 3BS5B 4RQ3A 5KT6A 3TARA 1L3UA 3AUOA 1CEZA 3TAPA 4YD1A 2HMXA 1T4GA 2J6UA 7ICMA 4YMMA 4U6PA 2XCPA 1L3TA 2J6TA 4B6JA 3BJYA 3M6ZA 1BGXT 3OSNA 2DQNB 2ZTEA 3JPPA 5AM5A 1KSPA 3F2CA 3ZDDA 1PVPA 3H4DA 4F4ZA 4RZRA 5EOZA 5CR0A 1KW4A 4X5VA 5ALZA 4K4HA 1WUDA 3UM9A 2HHWA 3C29A 4NV0A 1S0OA 2FPKA 2HBKA 2KMDA 2D6FC 5AI5A 1TVAA 2WAQC 1LB2B 3FAHA 2FLLA 1B43A 4C8LA 2WHEA 5D49A 2ZIVA 4F2SA 3SEIA 1SZPA 4DSLA 4EBEA 4KN4A 4Q8EA 2BCQA 3RB4A 4QZDA 4Y2XA 5HP4A 4P0PA 5DLFA 3EPGA 3V6HA 3T79A 1SWVA 3UXOA 1RDFA 9ICHA 4C8MA 2I5HA 2BZFA 4DL3A 5KFNA 5KFRA 3AU6A 1PK1A 1X66A 2PI5A 5J0SA 5H2FU 2OWOA 5HHIA 2UVUA 3T5JA 5IIMA 4F4WA 1JROA 5DBAA 3SYZA 4OJLA 5J8YA 4LZDA 4KLIA 1COOA 5C5JA 5G5GA 3TFRA 8ICQA 5J0YA 9ICSA 3PW2A 1FFUA 2XVTA 5IILA 1P7DA 5CJ7A 1WWVA 3BQTA 4O0IA 5AK4A 8ICYA 3ZDBA 2ASLA 1SL1A 3L4PA 3KHLA 1L7NA 1IXRA 4U7CA 7ICNA 2R8IA 3SV3A 3ZI4A 1Z3EB 3QU9A 5KFQA 3BZCA 2JEGA 4ICAA 5KT7A 5KAIU 3MABA 3SR6A 1NKBA 3BZKA 8ICIA 4RQ1A 2NV3A 4Y2RA 2OXOA 4KLEA 3EYZA 3G6VA 5AM3A 5KFDA 4ECZA 1ZQGA 1Z19A 1U4BA 4PJ0U 5KFKA 4AP9A 5F9LA 2CN1A 4UB8U 4YR2A 3GV8B 5AK6A 5KFZA 1XO0A 4FZLA 2F3NA 4F93B 4DFMA 2J6SA 1TKDA 4DQPA 1NK7A 2E3TA 3KHHA 1X40A 4TUPA 2ESEA 4C8KA 5AKHA 1BNPA 1HUOA 4DSIA 2HI0A 4F5NA 1ZJMA 1PVRA 5J0RA 4RU9A 2H3VA 2KP7A 2OH2A 4PHPA 5AKKA 2W54A 3PY8A 5KT5A 5ALGA 2E8PA 4RQNA 5HMLA 4P4PA 4QW9A 1ZYQA 1N5XA 1TV9A 3N7PD 2JHDA 5DDYA 2M9NA 3TKAA 4J9RA 4DS4A 2NRVA 3V72A 3A0HU 4PZOA 4F5RA 9ICVA 4I2DA 1ZQFA 5ALRA 5KG4A 4EYHB 5ALNA 2YTUA 2YY6A 3RJJA 2PFNA 4PH5A 4GXJA 3C2MA 3SAHA 4K4IA 4ECVA 3G6XA 5DGAA 3C5FA 3M8RA 5KFBA 9ICWA 2A1AA 3QXGA 7ICHA 1MA7A 4DL4A 4Y2PA 5J2CA 3RH4A 1L8LA 4PL1A 2KJ5A 4M9JA 4BWMA 1MN8A 2O6KA 1NI3A 3CP8A 3AU2A 3NVZA 2PI4A 3H8MA 2YN4A 1BNOA 5KTQA 4KLDA 3M9NB 1HEKA 5DQIA 3Q8SB 3RAQA 4QWEA 2W7PA 1ZRMA 3RR7A 5GTIU 3C5GA 3H0LB 2DF4B 1X9MA 2XC9A 3I76A 3T5HA 3LWMA 4YXJA 3AMZA 1Z4OA 3AEVA 4Y2YA 4QWCA 4YMNA 4JV2A 1ZQJA 2BKEA 3N7SC 5KFEA 1K5OA 5KFPA 5ALKA 1SWWA 4FBTA 1YT3A 2IBKA 3ISCA 4JUZA 3TADA 2GH1A 2KVSA 5AKJA 4RT2A 2IHMA 4MEYA 2LI6A 2XIDA 8ICEA 4UB2A 2ZIUB 4O3QA 2ISPA 2GWSA 1O03A 2EAOA 3GV5B 3RBEA 1X9XA 4ZH4A 2YMLA 3QEBZ 2OHFA 3TAQA 3OSPA 1JX4A 2KIVA 1UA1A 3GZFA 1X9SA 1EXNA 2K4EA 4NL9A 4F8RA 2KV2A 5KFTA 3SZ2A 1S0NA 2I6XA 2K4PA 3E0FA 1U48A 5AIBA 5JTIA 4IRKA 3GQCA 1OUQA 3NASA 2QLTA 1KBUA 1NK6A 4P4MA 3PO4A 3QUQA 2VJ4A 2WFAA 4QIWC 4UAYA 5TISU 2RLTA 3WK5A 7ICSA 1OW5A 2UVVA 3WKDA 4O3OA 4FS2A 4B9NA 4DWIA 5AK3A 3PSPA 1KTQA 4RQ0A 2VKQA 5DQGA 2RRDA 2NYVA 4YN4A 5J0TA 2DKZA 3WKBA 2H3ZA 4DL7A 2R8GA 3GU3A 3N28A 2W3SA 5AIAA 4DQQA 7ICIA 2KHVA 1QSYA 3PMLA 2W9BB 2AQ4A 5AM0A 8ICCA 1DGSA 3I28A 1NK9A 2KSOB 2Z7JA 2L5YA 4J9NA 2K4HA 4UAWA 2BCRA 1J2NA 4R64A 5ALJA 2XO7A 1ZQEA 2KIWA 4KLSA 1Y88A 3RJKA 5IIJA 3CRXA 2F1IA 1XS9D 2ZJ5A 1TK5A
chains in the Genus database with same CATH topology
4PZOA 1WWVA 2EAOA 2GLEA 1PK3A 1X9XA 4NJ8A 1DXSA 2D8CA 2E8MA 2Y9TA 5J8YC 2KIVA 2LPEA 5JRTA 3KKAC 1V85A 4NL9A 1B0XA 1SGGA 3SENA 2KG5A 2YTUA 1SXEA 5KNIA 4NL9C 1WWUA 2K4PA 1PK1B 4IS7A 2LMRA 4MHVA 5JTIA 1UCVA 1KW4A 1LKYA 1V38A 2E8OA 1SV0A 1F0MA 2Y9UA 2EAMA 2QARA 4PZNA 2KMDA 2ES6A 3BS5A 2FE9A 3K1RB 3TADC 2QB0A 1OW5A 3H8MA 3IDWA 4RQMA 1LKYB 1B4FA 3BS7A 2JV3A 2QB1A 2F3NA 2QARB 1SV4A 3SEIA 1JI7A 2F44A 2DKZA 2KE7A 1X40A 2ESEA 2QB0B 2B6GA 3BQ7A 1RG6A 3HILA 3TACB 2K60A 5JU5A 1OXJA 2F8KA 5F3XB 1COKA 1UQVA 2QKQA 2E8PA 2D3DA 2KSOB 1PK1A 1SV0C 1X66A 2L5YA 4RQNA 2KSOA 1SXDA 2E8NA 3KKAA 5L1MA 3TADA 5J8YA 2EAPA 2EANA 2DKXA 1Z1VA 2DL0A 3BS5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZO A;  1WWV A;  2EAO A;  2GLE A;  1PK3 A;  1X9X A;  4NJ8 A;  1DXS A;  2D8C A;  2E8M A;  2Y9T A;  5J8Y C;  2KIV A;  2LPE A;  5JRT A;  3KKA C;  1V85 A;  4NL9 A;  1B0X A;  1SGG A;  3SEN A;  2KG5 A;  2YTU A;  1SXE A;  5KNI A;  4NL9 C;  1WWU A;  2K4P A;  1PK1 B;  4IS7 A;  2LMR A;  4MHV A;  5JTI A;  1UCV A;  1KW4 A;  1LKY A;  1V38 A;  2E8O A;  1SV0 A;  1F0M A;  2Y9U A;  2EAM A;  2QAR A;  4PZN A;  2KMD A;  2ES6 A;  3BS5 A;  2FE9 A;  3K1R B;  3TAD C;  2QB0 A;  1OW5 A;  3H8M A;  3IDW A;  4RQM A;  1LKY B;  1B4F A;  3BS7 A;  2JV3 A;  2QB1 A;  2F3N A;  2QAR B;  1SV4 A;  3SEI A;  1JI7 A;  2F44 A;  2DKZ A;  2KE7 A;  1X40 A;  2ESE A;  2QB0 B;  2B6G A;  3BQ7 A;  1RG6 A;  3HIL A;  3TAC B;  2K60 A;  5JU5 A;  1OXJ A;  2F8K A;  5F3X B;  1COK A;  1UQV A;  2QKQ A;  2E8P A;  2D3D A;  2KSO B;  1PK1 A;  1SV0 C;  1X66 A;  2L5Y A;  4RQN A;  2KSO A;  1SXD A;  2E8N A;  3KKA A;  5L1M A;  3TAD A;  5J8Y A;  2EAP A;  2EAN A;  2DKX A;  1Z1V A;  2DL0 A;  3BS5 B; 
#chains in the Genus database with same CATH topology
 1NK0 A;  2KKP A;  1DOQ A;  2BGW A;  5EWF A;  2IMW P;  1ZQH A;  2HHT A;  3V7J A;  4C4R A;  4ECX A;  1T3Q A;  1BPX A;  2Q0Z X;  4WJ3 B;  2W8K A;  2YMP A;  4QWA A;  1N2X A;  1JXE A;  2K8B B;  8ICM A;  4IS7 A;  1UCV A;  3Q8R B;  1F0M A;  4PHD A;  3GIJ A;  4G3I A;  1KFT A;  4ECU A;  1RYR A;  5BOL A;  2JEF A;  4OO1 J;  4DFK A;  3JPS A;  2BQR A;  3UQ0 A;  1CUK A;  5DBC A;  2ALZ A;  1ZQQ A;  2H3Q A;  4M6W B;  4RQ8 A;  5DG8 A;  3DEE A;  5DKW A;  4EEY A;  1A0P A;  7ICJ A;  8ICJ A;  3UPQ A;  2N1R A;  4Y2V A;  3HRD D;  2ATL A;  5ALQ A;  4ED3 A;  4CNQ A;  1RYU A;  3MFI A;  2H5X A;  4QZA A;  3V7K A;  5KG6 A;  4BGD A;  5HR6 A;  5ALM A;  2G08 A;  4QW8 A;  2DUY A;  2ZIW B;  5KT4 A;  2CRX A;  4RQ2 A;  4LZG A;  3OPX A;  1N5W A;  5KFM A;  2BQU A;  4PHE A;  2JRZ A;  2F1J A;  4FZN A;  5B5E U;  2AGQ A;  2FLP A;  3RRG A;  2OCE A;  4MFF A;  2WF7 A;  3PX4 A;  3NVY A;  3NGD A;  2KFZ A;  2P6R A;  1XO1 A;  3MGH A;  5DB9 A;  5AI9 A;  3D2Q A;  4YFK A;  4RT3 A;  3IG8 A;  5HMM A;  5CB1 A;  2ZXH A;  4NJ8 A;  3ETR A;  3M9M B;  1D9F A;  4YCX A;  3C23 A;  4IQT A;  1SGG A;  4O5K A;  4XUS A;  4NM1 A;  2OEH A;  3ZDE A;  2VIX A;  3EPI A;  2Y1I A;  4F91 B;  3QX7 A;  5KL1 B;  2HOF A;  4P0Q B;  2JGA A;  1VLB A;  2H3I A;  1L8O A;  2HHU A;  1ZJN A;  2EAM A;  4Q43 A;  1S76 D;  2PXI A;  3KZI U;  1ZQA A;  3MR5 A;  1D8L A;  3T3F A;  4OCZ A;  3TAD C;  4PHA A;  3WK7 A;  5TZV A;  5KG5 A;  5AM1 A;  4RUA A;  3PNC A;  1KFD A;  3TQ1 A;  4KLL A;  4NLZ A;  4FBU A;  1ZQV A;  2EH9 A;  4Y2S A;  9ICE A;  1SV4 A;  2AJQ A;  4QIW F;  2HOQ A;  3OHA A;  2CPR A;  1JI7 A;  5ALH A;  3PX0 A;  1JIH A;  4O3M A;  4IRC A;  2B6G A;  8ICH A;  3JPR A;  3TAN A;  9ICQ A;  4EEL A;  3UMG A;  8ICA A;  9ICG A;  4DSJ A;  4F5O A;  2JEI A;  2B21 A;  5J0P A;  2IOF K;  2V9W A;  4O3R A;  3QZ7 A;  3LWL A;  4RPY A;  1NZB A;  3PST A;  3RJG A;  5J29 A;  3UXP A;  2W8L A;  2W03 A;  2KSO A;  2M0N A;  5KFI A;  7ICT A;  4F92 B;  2PMZ C;  2FJ6 A;  8ICR A;  2ZJA A;  1ZD4 A;  3ZDC A;  1JRP A;  1UA0 A;  4TUQ A;  2G07 A;  4Q44 A;  3UQ2 A;  1ZQX A;  4TQS A;  1RZT A;  2I9G A;  4TUR A;  4E0D A;  9ICI A;  5KFY A;  1QSL A;  1K1Q A;  3H0M B;  3Q8M A;  2EDU A;  2C2E A;  1UT8 A;  5J8Y C;  2BDU A;  2ZIX A;  3HX0 A;  2LPE A;  5JRT A;  1S97 A;  1URJ A;  2BCV A;  3BQ1 A;  3NRZ A;  2HHS A;  3V7L A;  3MDA A;  4QWB A;  1HUZ A;  4JMU A;  3EWA A;  2BPC A;  4XA5 A;  3KFU F;  3PO5 A;  2C28 A;  5AK5 A;  1KRP A;  1LKY A;  4ED8 A;  1RXW A;  1S8O A;  2A19 A;  2VJ5 A;  2ODG A;  1SKR A;  1PZN A;  9ICA A;  9ICF A;  3A0B U;  1QH9 A;  3MGV A;  1CRX A;  4ECR A;  1K1S A;  4PZN A;  4NY8 A;  1TAQ A;  4P2H A;  3UMC A;  2LM1 A;  7ICU A;  4QZG A;  5BOM A;  4YVZ A;  3SMV A;  2BR0 A;  3FC4 A;  4M47 A;  1L7O A;  3B0Y A;  5J0O A;  1BPZ A;  8ICS A;  4IQU A;  4F72 A;  5ALV A;  1A77 A;  2EZX A;  1IG6 A;  3BQ2 A;  4PPX A;  3GIL A;  3H8J A;  4F3O A;  1KEJ A;  2DGZ A;  2JMG A;  3IG5 A;  2LKY A;  4IQV A;  4O3N A;  3H7I A;  4J9S A;  4JK1 A;  4DL5 A;  5IIO A;  1OXJ A;  4RPZ A;  2KZ3 A;  5KFV A;  5F3X B;  3HJE A;  2KZM A;  5AKY A;  1DGJ A;  2G06 A;  3RR8 A;  3NVW A;  4P0Q A;  4JB3 A;  5KFO A;  3WKE A;  2RDJ A;  2EQY A;  2WF6 A;  4ELV A;  1RQN A;  2KEY A;  4BX9 C;  1Z1V A;  2XGQ A;  2W11 A;  4UB6 U;  3C28 A;  3KTQ A;  2DPI A;  3WKA A;  3F5A A;  3HPO A;  2ISO A;  2JH7 A;  2DFL A;  5L1I A;  3PSF A;  4R63 A;  4KLJ A;  4I2F A;  4FE3 A;  4Y2U A;  4DLE A;  7ICP A;  1V85 A;  4I28 A;  1YZ6 A;  2KK0 A;  5E79 U;  3B0X A;  5KFJ A;  2KN7 A;  4PGY A;  5DBB A;  1KN5 A;  1U45 A;  4F2R A;  3H8W A;  4MHV A;  1ZD5 A;  4UB3 A;  5CHG A;  3RB3 A;  2BQ3 A;  2XI9 A;  1XSN A;  4C7Z A;  2QAR A;  2FI1 A;  4I2J A;  2EZZ A;  4ED2 A;  2NRX A;  4GC7 A;  5HR7 A;  3GFK B;  4EYI B;  3E2E A;  5III A;  4RNN A;  4DO9 A;  4QZE A;  2UVW A;  4EZ9 A;  5EWG A;  5KFS A;  2HDO A;  4KMO B;  5DG9 A;  5J2G A;  4C80 A;  2AH5 A;  2KHQ A;  4BDP A;  1ZQO A;  1L3S A;  1DK2 A;  1NNL A;  4I2A A;  1NKE A;  1ZQP A;  4PGX A;  4EX7 A;  2F44 A;  2KTQ A;  1FFV A;  1N56 A;  4M9H A;  2ZUC A;  1WG8 A;  1IM4 A;  2V4Q A;  1J97 A;  3S6J A;  1JAL A;  3OGU A;  2F8K A;  4QWD A;  3K4G A;  2HVI A;  9ICP A;  1HIW A;  3THV A;  2RQ5 A;  3KBB A;  4F50 A;  3RH5 A;  5KG3 A;  2AQ0 A;  3NTU A;  2P66 A;  3SAG A;  2KD1 A;  2RP5 A;  3IM1 A;  4C0Z A;  9ICT A;  2F8L A;  1JN3 A;  1V9P A;  1ZQW A;  5J2F A;  3IN5 A;  4JWM A;  4IL6 U;  8ICP A;  4G9B A;  4KLO A;  4OJ5 A;  2P35 A;  4O5C A;  1BPE A;  1S10 A;  5ALF A;  4OJO A;  4GC6 A;  2XY6 A;  4YD2 A;  3F2D A;  4NL9 C;  3O0F A;  4XRH A;  2WB1 F;  4RPX A;  2LMR A;  2F1H A;  3CYM A;  2YMM A;  4RQ5 A;  4YG2 A;  5ALT A;  5L1J A;  4FS1 A;  4J03 A;  2FMQ A;  2IOF A;  4I2C A;  4YXM A;  2PFO A;  3AQF A;  4DOB A;  2VA3 A;  4C4T A;  8ICV A;  3JPT A;  3IDW A;  2IHN A;  1QSS A;  3JPN A;  4B9M A;  2BPF A;  1ZRN A;  2YB1 A;  5KT3 A;  3FM9 A;  3AM9 A;  4DF8 A;  3QU4 A;  5ALP A;  4Y2T A;  2NRT A;  4P4O A;  1ZQT A;  4BXO B;  3F5E A;  3QEA Z;  4IR9 A;  4KIT B;  2AGO A;  4RQ4 A;  3MR2 A;  5ALL A;  4I27 A;  4F71 A;  2K60 A;  2OYY A;  4ECT A;  2ZJ8 A;  4NLC A;  3MGI A;  3AQE A;  4MEX A;  2FPM A;  4DLG A;  2KIC A;  5KFH A;  1COK A;  3RBD A;  3EUB 2;  5DDM A;  1IIP A;  2E1F A;  4J9O A;  2MUT B;  1LVH A;  2P6U A;  2AU0 A;  4UAV A;  4US8 A;  5FP0 A;  2W9B A;  4UB4 A;  3K1Z A;  1S77 D;  1T8E A;  5ALY A;  2K8A A;  4I29 A;  2DBY A;  1SZH A;  5KT2 A;  3N7R C;  4MFC A;  4KLU A;  4M2Y A;  5ALE A;  2HVH A;  3OTQ A;  1NK5 A;  5DLG A;  2BPG A;  3QE9 Y;  1Q8K A;  1X2I A;  2EZY A;  3AN1 A;  4ZOH C;  8ICG A;  4DSK A;  5D4B A;  5K4L A;  1TK0 A;  2Y9T A;  5JUM A;  8ICZ A;  1YZ7 A;  1XU4 A;  4UB1 A;  4NM2 A;  4C8N A;  4CCH A;  2VA2 A;  1SIJ A;  4FO6 A;  2AHO B;  4YQW A;  4TQR A;  1PVQ A;  4UBB A;  5AM2 A;  1Q3U A;  2HCF A;  1SL2 A;  1FEZ A;  1X9W A;  2B0C A;  3RH6 A;  3PV8 A;  2W9C B;  3LVW A;  2G5H B;  5L1K A;  1Z4N A;  3HP6 A;  3PZP A;  2NO5 A;  2FLN A;  9ICJ A;  4HAI A;  4UAS A;  1ZQU A;  5EE1 A;  2FE9 A;  9ICC A;  5KFL A;  2YMQ A;  1L7P A;  4GFJ A;  4R66 A;  3TI0 A;  2Y0S C;  4RQM A;  2MA1 A;  4KLM A;  1PUZ A;  3WKC A;  2JV3 A;  2QB1 A;  5AI6 A;  5KG7 A;  2I1Q A;  3GV7 B;  3RRH A;  5DB8 A;  4MF8 A;  1AQ6 A;  1C20 A;  2MRL A;  2ASJ A;  4UAT A;  7ICG A;  1DK3 A;  3SD7 A;  3RJH A;  1BPD A;  3H40 A;  1XNS A;  1CI4 A;  3LYS A;  2FMS A;  8ICN A;  1SV0 C;  2NO4 A;  5KL8 B;  1FIQ A;  4UQG A;  4UAU A;  4I2I A;  4QZB A;  1ARO P;  2VA8 A;  5L1M A;  5AKZ A;  5KG0 A;  2EAP A;  1L5U A;  3D2N A;  1NJY A;  3ISB A;  3AL0 B;  3QNM A;  1Q3V A;  2FDR A;  3C1Z A;  9ICB A;  2DWQ A;  4LJX A;  4US9 A;  2KVC A;  2ZTC A;  5KFX A;  5IIK A;  4QZ9 A;  4J9P A;  1A76 A;  5EE3 A;  2IA6 A;  7ICV A;  1UHU A;  2AXT U;  2JR5 A;  4LVS A;  2R18 A;  3MC1 A;  5CWR A;  4O9M A;  3PMN A;  3T5L A;  4ECW A;  4KX3 A;  1NJZ A;  1WWU A;  3C1Y A;  3RJE A;  3KD3 A;  4A8E A;  1ZQR A;  3QUC A;  5CP2 A;  3QU7 A;  4NLB A;  1S5L U;  1XSL A;  1V38 A;  9ICM A;  5AI8 A;  7ICE A;  3QYP A;  2W7O A;  4BUG A;  3M1Y A;  4C7Y A;  4Q45 A;  7ICF A;  2XY7 A;  1BVS A;  3GDX A;  4DS5 A;  1RM6 C;  2Y0S F;  3RTV A;  4GXK A;  1QTM A;  3H4B A;  3SAF A;  2FPL A;  1MQ2 A;  2QB0 A;  1U49 A;  2G0A A;  4ECS A;  2G5I B;  4CF3 A;  3HKZ C;  3RB0 A;  2K8C B;  4RQ7 A;  5KFA A;  2JZB B;  4BWJ A;  4UBC A;  5D46 A;  3UXN A;  2C2R A;  3KHR A;  2WAQ F;  5ALU A;  4Z6D A;  2KFN A;  3BQ7 A;  4I2H A;  4FZM A;  1GO3 F;  5KFU A;  9ICX A;  2WF9 A;  1ZET A;  3L5K A;  1MSW D;  5AKE A;  1ZQI A;  4AYB F;  5KFG A;  3QUT A;  5ALS A;  3OJU A;  5A0L A;  3BQ0 A;  3HKZ F;  4EBD A;  3TFS A;  2AGP A;  8ICX A;  5J2A A;  3BDP A;  1MQ3 A;  5DB6 A;  3KKA A;  4MF2 A;  5HNK A;  3WK9 A;  1JMS A;  3PW5 A;  4UAR A;  1L6N A;  5ALO A;  2LYH A;  1NJW A;  3IP4 B;  4RQ6 A;  4ED0 A;  3PW4 A;  3PW0 A;  3PR4 A;  3V6K A;  4QZH A;  2DPJ A;  1SL0 A;  1PK3 A;  2JXJ A;  1ZQL A;  2E8M A;  4BJQ A;  2XCA A;  5IIN A;  4IR1 A;  1TFR A;  2HBL A;  5BPC A;  5CRX A;  1RQL A;  2K4I A;  4IC9 A;  4KLT A;  5AIC A;  5KFF A;  1C7Y A;  3K75 D;  3KHG A;  4DSF A;  5AHX A;  4J9Q A;  3J81 j;  2E8O A;  5KG1 A;  2ZIX B;  3U26 A;  2W43 A;  3WK8 A;  4B9V A;  4CE6 A;  3H0R B;  4M9L A;  4DFJ A;  4B9L A;  4M9N A;  3ICX A;  3R9K A;  1ZQD A;  1O08 A;  1ZQK A;  3NRW A;  3NUQ A;  1LKY B;  4Y2J A;  1VJ5 A;  1ZD2 P;  1D9D A;  1TE2 A;  4OJP A;  2PKE A;  3IRU A;  2HBJ A;  2BCS A;  8ICL A;  1RG6 A;  4YP3 A;  2E5S A;  3PW7 A;  2E1E A;  3N97 B;  2W04 A;  1N62 A;  1F44 A;  7ICO A;  4DEZ A;  4J9M A;  4B9T A;  1ECW A;  3LDA A;  5AI4 A;  2WTF A;  4NLN A;  3ED5 A;  2LBO A;  1XWL A;  1MC8 A;  4M04 A;  4DFP A;  2MSN A;  2ZIW A;  7ICQ A;  2EAN A;  3PR5 B;  2RDI A;  4CF5 A;  2HHX A;  3PSI A;  5B66 U;  2KZZ A;  3ORY A;  1L7M A;  4R65 A;  1S0M A;  2HHV A;  4ED1 A;  1DXS A;  4J9L A;  1TAM A;  3KZX A;  2JZB A;  2A1J A;  3C2L A;  4EZ6 A;  1B0X A;  1X42 A;  3M8S A;  3CNH A;  5AKG A;  3H8S A;  5KNI A;  5T14 A;  4GIB A;  5DGB A;  3JPO A;  1Z1B A;  8ICW A;  1ZQS A;  4UAZ A;  4YR3 A;  1TK8 A;  3Q8K A;  1S0V A;  2PFQ A;  7ICR A;  4B9U A;  4RNM A;  2Y9U A;  3RFA A;  3RJI A;  1T94 A;  2VAN A;  1QQ5 A;  4F4Y A;  4QZC A;  2HSZ A;  3PX6 A;  2ZG6 A;  5AM4 A;  7ICL A;  4NLK A;  1SKW A;  4F5P A;  1Q46 A;  2LM4 A;  1X6I A;  5J2J A;  4KLH A;  2ZXI A;  4I2E A;  4QZ8 A;  2QAR B;  5J2B A;  1V97 A;  4RNO A;  3LVV A;  2KJ9 A;  4ECY A;  4O3P A;  4DL6 A;  2YQE A;  4DQS A;  4CRX A;  2LYA A;  3ALR A;  3ZDA A;  9ICL A;  1QLN A;  3FYH A;  4ELU A;  3IV6 A;  1UQV A;  1N63 A;  1JXL A;  3L3F X;  5DQH A;  2R8K A;  3RAX A;  4KLF A;  5KAF U;  3ZD9 A;  3QUB A;  3ONN A;  3B9J A;  4JWN A;  2NRZ A;  3T5K A;  1B22 A;  4J9K A;  4R8U A;  4DF4 A;  2DKX A;  1TAU A;  4DQR A;  3GIM A;  3MR3 A;  2HW3 A;  1ZOL A;  3WK4 A;  2JH1 A;  3ISD A;  2MAX A;  4ELT A;  1ZD3 A;  4FFD A;  1ZXI A;  4USA A;  4EX6 A;  4IRD A;  2D8C A;  4OD0 A;  3MBY A;  5CEH A;  4ED6 A;  8ICT A;  2HOI A;  4RUC A;  5GTH U;  5J0W A;  4HYK A;  1ZQY A;  5AKX A;  2ZUD A;  5DB7 A;  4JV0 A;  4DOC A;  4CDG A;  1QQ6 A;  4M6W A;  1T3N A;  2W55 A;  4KLG A;  2KNJ A;  2WB1 C;  1QCK A;  2BDP A;  4B9S A;  4QNL A;  1M6Y A;  4NWI A;  3BS7 A;  3UMB A;  2RHF A;  1KDH A;  1D8B A;  4KMU A;  3QU2 A;  3PVX A;  2A3V A;  3C2K A;  3Q8L A;  2KOB A;  3ETL A;  4IQW A;  2F77 X;  2KE7 A;  1U47 A;  2IOH A;  3ZD8 A;  3HIL A;  3DDH A;  4YMO A;  3TAC B;  5L1L A;  2BHN A;  2A1J B;  1J2M A;  3EW9 A;  1HJP A;  3QU5 A;  1Z00 B;  5J2H A;  8ICK A;  4ACO A;  7ICK A;  2ZIU A;  3KOO A;  4QZI A;  1A6S A;  5AKL A;  2Q4T A;  5L9X A;  5J0Q A;  4OJ6 A;  5C0Y A;  1ZQ1 C;  4UB5 A;  3MDC A;  3Q8Q B;  1XSP A;  5EWE A;  3D6J A;  1QQ7 A;  4DQI A;  2HBM A;  2MUT A;  4DCC A;  9ICO A;  5EE9 A;  4AYB C;  2GLE A;  3VCB A;  3Q8P B;  2W9M A;  4Z6F A;  2ZTD A;  5HHH A;  1LV5 A;  3SEN A;  2C22 A;  1F5S A;  3HW8 A;  3HWT A;  1NJX A;  5G5H A;  3WK6 A;  4C4S A;  2WF8 A;  4C8O A;  2GOL A;  4GXI A;  2H3F A;  1L3V A;  2C2D A;  4QJF B;  1SV0 A;  2UVR A;  1KL9 A;  2KJ8 A;  2KKV A;  4F4K A;  4M9G A;  2F2A B;  4ED7 A;  2ES6 A;  3JPQ A;  2LYB A;  3F53 A;  5ALW A;  3BS5 A;  3K1R B;  4PGQ A;  1XC9 A;  4O3S A;  5J0X A;  3G6Y A;  1B4F A;  2W9C A;  4CGZ A;  5KFC A;  1ZQC A;  2PFP A;  4K4G A;  5F9N A;  5ALI A;  5J0U A;  3M9O B;  1UT5 A;  2G09 A;  3DV9 A;  3I1Y A;  3HT3 A;  2CXY A;  1NOM A;  4PL2 A;  1ED1 A;  8ICO A;  4P0P B;  4EBC A;  1VDV A;  5J2E A;  4F4X A;  4M0A A;  2ASD A;  1JUD A;  4EEK A;  5JU5 A;  1ZQM A;  4KN7 A;  3VC8 A;  2GO7 A;  1N61 A;  2QKQ A;  5KG2 A;  1KFS A;  4Z6E A;  1D8Y A;  3OJS A;  4KTQ A;  2LHT A;  4QZF A;  1SXD A;  2E8N A;  3V6J A;  3EZ5 A;  9ICK A;  4KX5 A;  4XQ8 A;  3M6K A;  4ECQ A;  5CA7 A;  4MFA A;  4KLQ A;  4Q8F A;  1BPB A;  8ICF A;  4R8U B;  2ZIV B;  1X6J A;  2OM6 A;  1H38 A;  2HHQ A;  2YB4 A;  9ICN A;  3GII A;  1SKS A;  4UW9 A;  1DRG A;  1KQQ A;  3RB6 A;  1ZQN A;  4GLX A;  2W9A A;  1RYS A;  1U9L A;  1IV8 A;  2F76 X;  3KKA C;  4F5Q A;  5AI0 A;  4O5E A;  3M7D A;  3SV4 A;  2KG5 A;  1SXE A;  1NKC A;  5J2K A;  3SI8 A;  4Y2Q A;  3IHQ B;  1PK1 B;  5DG7 A;  1S9F A;  8ICB A;  3NVV A;  5EE0 A;  9ICR A;  4TUS A;  2MU2 A;  1NZP A;  1Z00 A;  1T7P A;  2Y1J A;  3F2B A;  4CF4 A;  5AKI A;  1N60 A;  1FO4 A;  4I2G A;  2WF5 A;  2PMZ F;  5J2I A;  3SQI A;  1NK8 A;  1WYG A;  2YX8 A;  3FDS A;  1BPY A;  3RJF A;  3GIK A;  4DOA A;  1NK4 A;  5ALD A;  2R8J A;  3N4M B;  8ICU A;  5KFW A;  2V4R A;  2QB0 B;  1KKX A;  4DFD A;  2NRW A;  2BCU A;  1N48 A;  2ZUB A;  4EEN A;  4NXZ A;  3D2S A;  1RPL A;  3CW2 C;  4I2B A;  5J2D A;  2K89 A;  2R8H A;  3C21 A;  2XGP A;  5ALX A;  2XIC A;  9ICU A;  1SB3 C;  4BXO A;  2XY5 A;  2D3D A;  3OHB A;  2W3R A;  4JV1 A;  3MFH A;  1ZQB A;  4Z6C A;  3E58 A;  3RF9 A;  3MR6 A;  1WCN A;  4NLG A;  3QZ8 A;  1RXV A;  3LK9 A;  1UPH A;  2FMP A;  1KLN A;  4DSE A;  1ZQZ A;  4YR0 A;  2JEJ A;  3NS1 A;  1WCL A;  4DL2 A;  2DL0 A;  3WU2 U;  3BS5 B;  4RQ3 A;  5KT6 A;  3TAR A;  1L3U A;  3AUO A;  1CEZ A;  3TAP A;  4YD1 A;  2HMX A;  1T4G A;  2J6U A;  7ICM A;  4YMM A;  4U6P A;  2XCP A;  1L3T A;  2J6T A;  4B6J A;  3BJY A;  3M6Z A;  1BGX T;  3OSN A;  2DQN B;  2ZTE A;  3JPP A;  5AM5 A;  1KSP A;  3F2C A;  3ZDD A;  1PVP A;  3H4D A;  4F4Z A;  4RZR A;  5EOZ A;  5CR0 A;  1KW4 A;  4X5V A;  5ALZ A;  4K4H A;  1WUD A;  3UM9 A;  2HHW A;  3C29 A;  4NV0 A;  1S0O A;  2FPK A;  2HBK A;  2KMD A;  2D6F C;  5AI5 A;  1TVA A;  2WAQ C;  1LB2 B;  3FAH A;  2FLL A;  1B43 A;  4C8L A;  2WHE A;  5D49 A;  2ZIV A;  4F2S A;  3SEI A;  1SZP A;  4DSL A;  4EBE A;  4KN4 A;  4Q8E A;  2BCQ A;  3RB4 A;  4QZD A;  4Y2X A;  5HP4 A;  4P0P A;  5DLF A;  3EPG A;  3V6H A;  3T79 A;  1SWV A;  3UXO A;  1RDF A;  9ICH A;  4C8M A;  2I5H A;  2BZF A;  4DL3 A;  5KFN A;  5KFR A;  3AU6 A;  1PK1 A;  1X66 A;  2PI5 A;  5J0S A;  5H2F U;  2OWO A;  5HHI A;  2UVU A;  3T5J A;  5IIM A;  4F4W A;  1JRO A;  5DBA A;  3SYZ A;  4OJL A;  5J8Y A;  4LZD A;  4KLI A;  1COO A;  5C5J A;  5G5G A;  3TFR A;  8ICQ A;  5J0Y A;  9ICS A;  3PW2 A;  1FFU A;  2XVT A;  5IIL A;  1P7D A;  5CJ7 A;  1WWV A;  3BQT A;  4O0I A;  5AK4 A;  8ICY A;  3ZDB A;  2ASL A;  1SL1 A;  3L4P A;  3KHL A;  1L7N A;  1IXR A;  4U7C A;  7ICN A;  2R8I A;  3SV3 A;  3ZI4 A;  1Z3E B;  3QU9 A;  5KFQ A;  3BZC A;  2JEG A;  4ICA A;  5KT7 A;  5KAI U;  3MAB A;  3SR6 A;  1NKB A;  3BZK A;  8ICI A;  4RQ1 A;  2NV3 A;  4Y2R A;  2OXO A;  4KLE A;  3EYZ A;  3G6V A;  5AM3 A;  5KFD A;  4ECZ A;  1ZQG A;  1Z19 A;  1U4B A;  4PJ0 U;  5KFK A;  4AP9 A;  5F9L A;  2CN1 A;  4UB8 U;  4YR2 A;  3GV8 B;  5AK6 A;  5KFZ A;  1XO0 A;  4FZL A;  2F3N A;  4F93 B;  4DFM A;  2J6S A;  1TKD A;  4DQP A;  1NK7 A;  2E3T A;  3KHH A;  1X40 A;  4TUP A;  2ESE A;  4C8K A;  5AKH A;  1BNP A;  1HUO A;  4DSI A;  2HI0 A;  4F5N A;  1ZJM A;  1PVR A;  5J0R A;  4RU9 A;  2H3V A;  2KP7 A;  2OH2 A;  4PHP A;  5AKK A;  2W54 A;  3PY8 A;  5KT5 A;  5ALG A;  2E8P A;  4RQN A;  5HML A;  4P4P A;  4QW9 A;  1ZYQ A;  1N5X A;  1TV9 A;  3N7P D;  2JHD A;  5DDY A;  2M9N A;  3TKA A;  4J9R A;  4DS4 A;  2NRV A;  3V72 A;  3A0H U;  4PZO A;  4F5R A;  9ICV A;  4I2D A;  1ZQF A;  5ALR A;  5KG4 A;  4EYH B;  5ALN A;  2YTU A;  2YY6 A;  3RJJ A;  2PFN A;  4PH5 A;  4GXJ A;  3C2M A;  3SAH A;  4K4I A;  4ECV A;  3G6X A;  5DGA A;  3C5F A;  3M8R A;  5KFB A;  9ICW A;  2A1A A;  3QXG A;  7ICH A;  1MA7 A;  4DL4 A;  4Y2P A;  5J2C A;  3RH4 A;  1L8L A;  4PL1 A;  2KJ5 A;  4M9J A;  4BWM A;  1MN8 A;  2O6K A;  1NI3 A;  3CP8 A;  3AU2 A;  3NVZ A;  2PI4 A;  3H8M A;  2YN4 A;  1BNO A;  5KTQ A;  4KLD A;  3M9N B;  1HEK A;  5DQI A;  3Q8S B;  3RAQ A;  4QWE A;  2W7P A;  1ZRM A;  3RR7 A;  5GTI U;  3C5G A;  3H0L B;  2DF4 B;  1X9M A;  2XC9 A;  3I76 A;  3T5H A;  3LWM A;  4YXJ A;  3AMZ A;  1Z4O A;  3AEV A;  4Y2Y A;  4QWC A;  4YMN A;  4JV2 A;  1ZQJ A;  2BKE A;  3N7S C;  5KFE A;  1K5O A;  5KFP A;  5ALK A;  1SWW A;  4FBT A;  1YT3 A;  2IBK A;  3ISC A;  4JUZ A;  3TAD A;  2GH1 A;  2KVS A;  5AKJ A;  4RT2 A;  2IHM A;  4MEY A;  2LI6 A;  2XID A;  8ICE A;  4UB2 A;  2ZIU B;  4O3Q A;  2ISP A;  2GWS A;  1O03 A;  2EAO A;  3GV5 B;  3RBE A;  1X9X A;  4ZH4 A;  2YML A;  3QEB Z;  2OHF A;  3TAQ A;  3OSP A;  1JX4 A;  2KIV A;  1UA1 A;  3GZF A;  1X9S A;  1EXN A;  2K4E A;  4NL9 A;  4F8R A;  2KV2 A;  5KFT A;  3SZ2 A;  1S0N A;  2I6X A;  2K4P A;  3E0F A;  1U48 A;  5AIB A;  5JTI A;  4IRK A;  3GQC A;  1OUQ A;  3NAS A;  2QLT A;  1KBU A;  1NK6 A;  4P4M A;  3PO4 A;  3QUQ A;  2VJ4 A;  2WFA A;  4QIW C;  4UAY A;  5TIS U;  2RLT A;  3WK5 A;  7ICS A;  1OW5 A;  2UVV A;  3WKD A;  4O3O A;  4FS2 A;  4B9N A;  4DWI A;  5AK3 A;  3PSP A;  1KTQ A;  4RQ0 A;  2VKQ A;  5DQG A;  2RRD A;  2NYV A;  4YN4 A;  5J0T A;  2DKZ A;  3WKB A;  2H3Z A;  4DL7 A;  2R8G A;  3GU3 A;  3N28 A;  2W3S A;  5AIA A;  4DQQ A;  7ICI A;  2KHV A;  1QSY A;  3PML A;  2W9B B;  2AQ4 A;  5AM0 A;  8ICC A;  1DGS A;  3I28 A;  1NK9 A;  2KSO B;  2Z7J A;  2L5Y A;  4J9N A;  2K4H A;  4UAW A;  2BCR A;  1J2N A;  4R64 A;  5ALJ A;  2XO7 A;  1ZQE A;  2KIW A;  4KLS A;  1Y88 A;  3RJK A;  5IIJ A;  3CRX A;  2F1I A;  1XS9 D;  2ZJ5 A;  1TK5 A; 
#chains in the Genus database with same CATH homology
 4PZO A;  1WWV A;  2EAO A;  2GLE A;  1PK3 A;  1X9X A;  4NJ8 A;  1DXS A;  2D8C A;  2E8M A;  2Y9T A;  5J8Y C;  2KIV A;  2LPE A;  5JRT A;  3KKA C;  1V85 A;  4NL9 A;  1B0X A;  1SGG A;  3SEN A;  2KG5 A;  2YTU A;  1SXE A;  5KNI A;  4NL9 C;  1WWU A;  2K4P A;  1PK1 B;  4IS7 A;  2LMR A;  4MHV A;  5JTI A;  1UCV A;  1KW4 A;  1LKY A;  1V38 A;  2E8O A;  1SV0 A;  1F0M A;  2Y9U A;  2EAM A;  2QAR A;  4PZN A;  2KMD A;  2ES6 A;  3BS5 A;  2FE9 A;  3K1R B;  3TAD C;  2QB0 A;  1OW5 A;  3H8M A;  3IDW A;  4RQM A;  1LKY B;  1B4F A;  3BS7 A;  2JV3 A;  2QB1 A;  2F3N A;  2QAR B;  1SV4 A;  3SEI A;  1JI7 A;  2F44 A;  2DKZ A;  2KE7 A;  1X40 A;  2ESE A;  2QB0 B;  2B6G A;  3BQ7 A;  1RG6 A;  3HIL A;  3TAC B;  2K60 A;  5JU5 A;  1OXJ A;  2F8K A;  5F3X B;  1COK A;  1UQV A;  2QKQ A;  2E8P A;  2D3D A;  2KSO B;  1PK1 A;  1SV0 C;  1X66 A;  2L5Y A;  4RQN A;  2KSO A;  1SXD A;  2E8N A;  3KKA A;  5L1M A;  3TAD A;  5J8Y A;  2EAP A;  2EAN A;  2DKX A;  1Z1V A;  2DL0 A;  3BS5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...