2B6GA

Rna recognition by the vts1 sam domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
b'NPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(*GP*GP*AP*GP*GP*CP*UP*CP*UP*GP*GP*CP*AP*GP*CP*UP*UP*UP*
publication title RNA recognition by the Vts1p SAM domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2b6gA00
1WWVA 2K4PA 1X40A 5KNIA 1PK3A 3BS5B 2E8NA 2QARB 1OW5A 5JU5A 2EAPA 5J8YA 2L5YA 2DKXA 2B6GA 2F44A 2YTUA 1SV0C 2QB0B 3KKAA 1SXDA 2EAMA 1B4FA 1UQVA 3TACB 2DKZA 3SENA 2KE7A 2GLEA 2EANA 2K60A 2KSOA 2ESEA 1F0MA 2D3DA 1RG6A 1UCVA 1DXSA 1PK1B 2KIVA 3HILA 1SV0A 4MHVA 1B0XA 2F3NA 1COKA 3H8MA 3BS5A 2F8KA 5JRTA 1SXEA 2E8PA 1LKYB 2LPEA 1V85A 2QKQA 3K1RB 1SGGA 2QB0A 3TADC 2DL0A 1Z1VA 4NJ8A 1OXJA 3BS7A 2Y9UA 4NL9C 5L1MA 2ES6A 1V38A 2E8OA 2FE9A 2D8CA 1JI7A 3SEIA 1X66A 2Y9TA 4RQNA 4IS7A 2QARA 1PK1A 3BQ7A 1X9XA 2LMRA 3IDWA 4PZNA 1SV4A 1WWUA 5J8YC 2QB1A 2KG5A 2KSOB 5F3XB 3TADA 2KMDA 2JV3A 3KKAC 2E8MA 5JTIA 1KW4A 4NL9A 4PZOA 1LKYA 4RQMA 2EAOA
chains in the Genus database with same CATH superfamily
1WWVA 5AI6A 3M7DA 3IRUA 4M6WA 5ALMA 4RNNA 1SL1A 2E8NA 2P6UA 5KFOA 2DUYA 2QARB 2KZMA 1HUOA 2L5YA 1KEJA 2UVWA 3RH6A 1U49A 3JPPA 1JX4A 3OSNA 4PHDA 4EEKA 1KSPA 9ICJA 1TV9A 4ICAA 2G08A 8ICHA 4Z6CA 3LDAA 1F0MA 4BWMA 2D3DA 1L7PA 3B0XA 8ICRA 1XO1A 5KAFU 1RDFA 5IIIA 4C4SA 2JR5A 2LYBA 2HMXA 4YMOA 1SIJA 2FMSA 2RHFA 2BCVA 9ICNA 1NI3A 5KT5A 5DQGA 1WCNA 5AK5A 2HHWA 4IRDA 1N63A 5DGBA 5DB9A 4I2AA 2OH2A 3JPQA 2VA8A 2NYVA 1ZQ1C 4EENA 1N48A 1Z1VA 4DWIA 4NJ8A 2ZJ8A 4DQSA 2YMMA 5KFVA 8ICTA 5KFDA 3F2CA 4F93B 3V7KA 4EELA 4EBCA 1N5XA 4DL2A 2BPGA 3BQ1A 5F3XB 1NJYA 2J6SA 1KLNA 5AK4A 3FAHA 2G5HB 2CN1A 4FZLA 5ALUA 1ZQKA 4F4XA 2DGZA 9ICRA 4CF4A 9ICLA 1T3QA 2YMQA 3Q8QB 5KNIA 3JPSA 3BS5B 4OJOA 4O3QA 4XRHA 3M9OB 4GXKA 3F2DA 1KKXA 4JV2A 3OHAA 4PH5A 4YXMA 3QUBA 3L5KA 3TARA 3F2BA 3F53A 4USAA 2G09A 2AGOA 3HRDD 2EAMA 1N5WA 1B4FA 1KFDA 4PHAA 2E5SA 4FO6A 1SZHA 5KL8B 1NZPA 4IQVA 5J2KA 4O0IA 1COOA 3MGVA 4Y2YA 3C2LA 4UB8U 4IR9A 4LJXA 5ALKA 1TAUA 4JWNA 4YFKA 5DDYA 4F4ZA 3QX7A 3SYZA 3LWMA 1ZQLA 2VKQA 2NRXA 5J0UA 2C2RA 4F4YA 2LHTA 3QEAZ 4GXIA 2HBKA 4QWAA 2P35A 5EE9A 3Q8PB 2DBYA 3RTVA 4KLSA 2KFNA 7ICJA 4NWIA 4OJ5A 2OYYA 1JXLA 4KLLA 3AMZA 7ICIA 3T5LA 4NV0A 4YMNA 2FJ6A 2FLNA 5AICA 3KFUF 3SEIA 2W11A 1GO3F 4RNMA 4G3IA 2V4RA 4RNOA 3LVWA 2K4IA 1KN5A 1N2XA 3IDWA 1QH9A 2KG5A 1AROP 3V72A 4QZAA 2KD1A 3BJYA 4M0AA 4RU9A 4YG2A 5JUMA 3RRGA 7ICLA 5CRXA 4ECVA 2KJ5A 1JALA 2ISPA 4CCHA 2FDRA 5DB7A 5J0QA 2AGQA 2DPJA 2DKXA 2H3QA 1NK5A 5J0PA 4DFMA 1JMSA 2F8LA 3C1YA 4GC7A 1QTMA 4MEXA 2B6GA 4FZMA 5KT7A 4EYIB 2DFLA 4EZ6A 1A77A 2DWQA 3QU2A 4B9NA 1ZQWA 4C7YA 3KKAA 4QWCA 5J2GA 3ZD9A 1FEZA 5KG1A 5DKWA 2JEIA 5ALEA 5DQIA 4BDPA 2F1HA 2W9BA 2JH7A 1Q3UA 2YB1A 5KFUA 4F5RA 3M6ZA 4TURA 4DSFA 4DSLA 2PFOA 3QXGA 5J0SA 2ZIUA 1P7DA 4DSJA 2AJQA 1A76A 4J9KA 1QQ7A 1Z1BA 2KZ3A 1S76D 3EWAA 2CXYA 8ICZA 3QU7A 4UB4A 4Q44A 2NO4A 5KT3A 5DG9A 7ICEA 2IHNA 2ZTEA 5KFJA 2FLPA 5J0RA 5AM4A 2UVUA 7ICVA 3DV9A 5B5EU 2AU0A 3IG8A 1XSPA 3IM1A 1ZQFA 3AL0B 4HYKA 4MFFA 5EE0A 9ICXA 1N62A 3Q8RB 1X9MA 4EEYA 1XSLA 3TKAA 2NV3A 3QEBZ 4I2GA 2Q4TA 2ZTCA 4KLMA 3PSFA 9ICVA 9ICIA 1UPHA 2YN4A 5KFBA 4ECZA 1QSYA 2JRZA 4CE6A 3HJEA 3UMCA 8ICSA 4QNLA 2V9WA 5GTHU 3WKEA 2W55A 2K4PA 9ICKA 1X40A 1FIQA 5H2FU 2ZJ5A 3J81j 3GZFA 1L3SA 1L5UA 3FDSA 3CW2C 4MF2A 3UXOA 2HDOA 5AKZA 1YZ6A 3QYPA 1J97A 2ZXHA 4UBBA 1VDVA 4NM1A 2HHXA 2WF7A 4RUAA 5HMLA 4LZDA 4UB1A 5DG7A 3EW9A 5DB8A 2NRZA 5ALIA 4DOBA 1PVRA 4I27A 3V6HA 1RYRA 4F92B 1S5LU 1ZQAA 4YVZA 4QZCA 4MHVA 1L7MA 1PUZA 3PSTA 5CR0A 4FS1A 2F77X 4P4MA 4QZGA 4TUPA 3BS5A 5KFZA 1SXEA 3RJGA 5HR6A 3GIJA 2YMLA 2HCFA 4OJLA 3B0YA 2VIXA 5AKIA 3AEVA 2BCUA 3KBBA 4C4TA 2OXOA 2H3IA 3RJEA 1T4GA 3RBDA 5KT2A 5KT6A 4ED8A 5KFCA 4DL7A 5CB1A 5CWRA 2A1JA 3RJHA 3H0MB 2Y9TA 1NZBA 3ISCA 3RR7A 1IG6A 4EZ9A 5AM2A 3N97B 4ECUA 1D9DA 4LZGA 3NVWA 4ECWA 4B9LA 3BZCA 3HPOA 2KP7A 2C28A 2JV3A 4DL5A 2MRLA 5ALSA 3KKAC 4PGXA 5ALJA 1WUDA 4ED1A 3ZDBA 1K5OA 2YX8A 1A6SA 4F5OA 4OJPA 4O3MA 1VJ5A 4M04A 4EBEA 3TAPA 4C8OA 4C8MA 1NK7A 5G5HA 1WG8A 4ECRA 2GO7A 3B9JA 4IQUA 4TQRA 1H38A 1S0VA 3RH5A 5AIBA 1RQNA 7ICQA 4C8LA 4Y2RA 3RR8A 5CA7A 2K4EA 1SXDA 2WF5A 2BDPA 3FM9A 3WK5A 2WHEA 3MFIA 3C29A 2JEGA 3O0FA 4NLCA 1ZRMA 2P66A 2W8LA 4BGDA 5AI8A 1URJA 2R8JA 3GILA 4Y2QA 4P0PB 2KJ8A 5CJ7A 4DEZA 2W54A 5AKHA 3HILA 3C1ZA 2BR0A 3WK9A 4TUQA 1SWVA 2C2DA 3EPIA 3TFRA 8ICIA 1K1QA 1B43A 2XGQA 4CF5A 3WK8A 4QZBA 3G6VA 4FS2A 4O5KA 1U9LA 4JK1A 3RRHA 1Z3EB 1SGGA 1HUZA 1NK8A 4Q8FA 9ICOA 3NUQA 2NO5A 2BKEA 4J9PA 5HP4A 2XCPA 5AKJA 3BS7A 4KLDA 5J2DA 3D2SA 3QUCA 4YR3A 3QZ8A 2ES6A 3MDCA 2D8CA 4KN4A 1NK0A 3SAHA 3WK4A 4B9SA 3OTQA 3C5FA 7ICTA 4PZNA 5EE3A 3GIKA 5J0TA 4F4KA 2ZUBA 3C5GA 4MFAA 1ZD5A 2OM6A 2XICA 2IOHA 4LVSA 1S77D 5ALNA 1WCLA 4NL9A 4PZOA 3KHRA 3PW0A 2PMZF 2EQYA 1ZQTA 2XO7A 2K8BB 3OPXA 5GTIU 5AHXA 2CRXA 1PZNA 4KLTA 2A3VA 1ZQDA 1F44A 1UQVA 3EYZA 5E79U 4GFJA 4ELTA 4UAUA 1BPYA 4CGZA 1DRGA 3PW2A 5AI0A 2KKPA 4UAVA 4QZEA 1RXWA 3M9NB 2R8KA 2G0AA 4KX3A 1FFUA 4F8RA 1PVQA 4J03A 4ACOA 4ZH4A 5DQHA 5KT4A 4RQ5A 3GV5B 2FLLA 2BCRA 3JPTA 2ZUCA 2GH1A 4F5QA 5J0WA 5ALRA 4J9MA 3DEEA 4I2JA 2W04A 1MN8A 5AI9A 5ALVA 2BHNA 2B21A 2G06A 3S6JA 4IRCA 1CEZA 2JEFA 3T5JA 3Q8SB 1JI7A 3V6JA 2HHTA 4M9HA 1BVSA 3IV6A 3RB6A 3CYMA 1WWUA 4OD0A 5AI5A 3CRXA 1RYUA 1ZQSA 3PSPA 1ZD2P 3HX0A 1JRPA 2E8MA 3GIIA 1TKDA 3RBEA 8ICEA 4I2FA 3NTUA 1L3UA 3SAGA 5AKYA 5AIAA 2XCAA 2KJ9A 2ALZA 5EWGA 3FYHA 3A0BU 1UA1A 3QU9A 4QWBA 4FE3A 1Q46A 4JB3A 8ICAA 1L8OA 3UM9A 2KIWA 1BNPA 4KN7A 3C2MA 3ALRA 3N4MB 4RUCA 1S0NA 4JMUA 5L9XA 4Q8EA 5BPCA 3RJJA 5J2CA 2KE7A 4YR2A 9ICTA 2MAXA 2KV2A 3MABA 4C8NA 1UA0A 5KFWA 4DFJA 3H8JA 3LYSA 2ASDA 3NVVA 1SL2A 1ECWA 4G9BA 4US8A 2OWOA 4ELUA 1RG6A 3HKZC 1TK0A 2W9AA 4UB2A 1TAQA 1SV0A 2KN7A 3SV4A 4NLGA 2JMGA 4DFDA 3PX0A 4KITB 4DQPA 1Z00B 1Q8KA 3H8MA 1SWWA 4Z6DA 1LKYB 2JGAA 3PR4A 9ICUA 2E3TA 2PMZC 4O5CA 2LBOA 2JZBB 1DK2A 3WK7A 4KLJA 2R8IA 4BJQA 2H3VA 3A0HU 1Z19A 2KVCA 4Y2TA 4OCZA 5J2AA 4NL9C 4QZ9A 3V7LA 1SL0A 7ICNA 4KLEA 2E8OA 1X9WA 1X6JA 4IS7A 1M6YA 4NY8A 4P0PA 5ALWA 3EUB2 5KFIA 5J29A 4HAIA 4RQ0A 2VJ5A 3TADA 5KFHA 4ECXA 1LV5A 3ISDA 3NVYA 4DQQA 1IXRA 1SZPA 4Z6EA 4ECTA 2Y1JA 2RP5A 2HVIA 3SMVA 4FBTA 3N7PD 2WF6A 4YXJA 5F9LA 3N7RC 2WF8A 3M8SA 2DF4B 4GIBA 1L8LA 5AK6A 1L7NA 4K4IA 3KZXA 1TAMA 4ED2A 1L3VA 1BPXA 4UARA 3VCBA 2G07A 1NNLA 1XO0A 7ICFA 5AM5A 4J9SA 1O03A 5DLFA 1IM4A 4DF8A 5KFYA 5B66U 5ALXA 1SKWA 2QLTA 4RQ6A 3NS1A 2F76X 4ED3A 2I1QA 4I2IA 2ATLA 3MR5A 2HBMA 9ICEA 1X9SA 4EX6A 2HI0A 2DQNB 4IRKA 2IA6A 1D8BA 4IQTA 4A8EA 5F9NA 2BPFA 1HJPA 2HBLA 2KK0A 7ICPA 2ZIWB 1Y88A 1UT5A 3QNMA 1S0OA 2NRWA 2BCSA 3KD3A 3K1RB 3PW5A 4O5EA 4C7ZA 2M0NA 1NK4A 1A0PA 4EBDA 4QWEA 5KFGA 3AUOA 4PJ0U 5DBCA 2HHUA 4PL1A 2XY5A 3QUTA 3QZ7A 2HBJA 2XI9A 3M6KA 4KLQA 2M9NA 1ZQHA 3N28A 4ECSA 3MDAA 3GU3A 2QARA 1SV4A 8ICVA 4P4PA 1O08A 3PV8A 2DPIA 2AHOB 4R65A 5L1KA 3ORYA 5TZVA 1JIHA 4BX9C 3MR6A 8ICBA 2ISOA 3THVA 3C23A 5C5JA 2BDUA 1BGXT 4KX5A 2G5IB 3RB3A 5JU5A 3H0LB 2LM1A 1ZQOA 1ZQUA 4Y2VA 1U48A 1DGJA 2IOFK 8ICNA 2EH9A 5ALTA 1TE2A 2PFNA 3GQCA 1SV0C 2EZXA 1BPBA 4RPZA 2C22A 1K1SA 7ICOA 3WKBA 4F5NA 3H7IA 2W43A 4BWJA 1T8EA 1NJXA 3PSIA 2EANA 2R18A 1MQ2A 3V6KA 2ESEA 4M6WB 4UBCA 4YD1A 4DL6A 5BOMA 1DXSA 4J9RA 4RPYA 4U7CA 5J2JA 5L1JA 5J2BA 4YP3A 4TQSA 8ICCA 2HOFA 9ICHA 4M47A 4KLUA 1FFVA 2KFZA 4QW9A 3KHGA 1TK5A 5IIKA 3I76A 1ZQRA 3K75D 2AQ4A 4RQ8A 2RLTA 3FC4A 4RQ4A 2XY7A 5KL1B 1IIPA 3MR2A 2K4HA 3TADC 4YMMA 2VJ4A 4UASA 3CP8A 3EPGA 1D8LA 3MC1A 5DDMA 4PGQA 1WYGA 3C2KA 4O3NA 4PHEA 3RJFA 4MF8A 7ICRA 5J2HA 4PL2A 3AQFA 1B22A 3QE9Y 3BQ7A 3RB0A 4F2RA 1JROA 3D2NA 4QZFA 3TI0A 3BDPA 1ZQVA 5EWFA 1Z00A 1TFRA 4QZHA 3M1YA 4QIWC 3PO5A 1LKYA 5KFTA 1ZJMA 9ICAA 5AM1A 5D49A 4RZRA 4OJ6A 3MGHA 4DLEA 3TQ1A 1OW5A 3G6YA 5J8YA 3IP4B 2Y1IA 2H5XA 4OO1J 2LYAA 2MUTB 3TAQA 2XVTA 2QB0B 2Y0SF 1ZOLA 3JPOA 5AI4A 2JXJA 3M9MB 3H4DA 4C8KA 2KKVA 5KFMA 1ZRNA 4XQ8A 1CUKA 4P4OA 5T14A 4KMUA 2OHFA 3ZDDA 4PGYA 2KIVA 2WAQC 3U26A 4DOCA 2J6TA 2FPMA 1ZQMA 3PMLA 2W9MA 2JH1A 3LVVA 5CEHA 4QZDA 4M9NA 1SB3C 3SQIA 1ZQYA 5AM3A 4ECYA 4DS5A 2LPEA 5AKXA 5ALYA 1HIWA 3ONNA 2NRVA 4CF3A 4YN4A 2A19A 1XWLA 2V4QA 4Y2JA 1NJZA 4RT3A 5IILA 2HOIA 1X66A 4UAWA 5FP0A 3UXNA 5HR7A 8ICFA 5J0YA 3KOOA 3SR6A 1Q3VA 1SKRA 1L6NA 2KMDA 4X5VA 4E0DA 2ZIWA 5ALPA 1ZQXA 8ICWA 2LI6A 3C21A 3ZD8A 4UATA 3HKZF 2MU2A 2BCQA 1PK3A 8ICUA 3GV8B 3HW8A 4QZIA 2ODGA 2GWSA 1N61A 2EDUA 5AKGA 5J0XA 5D4BA 1F5SA 2KOBA 2R8GA 4Y2SA 2I5HA 4ED6A 1V97A 3WK6A 3ZI4A 2UVVA 5ALFA 1X42A 3OJUA 3TACB 5A0LA 5J2IA 5KG6A 3KZIU 2P6RA 3T5HA 4J9NA 1NKBA 5KAIU 1ZQEA 8ICMA 2O6KA 1ZQZA 5KFEA 2K8CB 2PFQA 1JN3A 3NRWA 4YQWA 1BPDA 1U45A 3IHQB 5KG4A 1ZQGA 4C0ZA 2UVRA 1B0XA 4KTQA 1COKA 4IL6U 2N1RA 5AKLA 5ALOA 5ALLA 1QLNA 3G6XA 3WKDA 4DQRA 1ZJNA 3TANA 2BPCA 1V85A 3MFHA 4NXZA 2QKQA 4F4WA 2W7PA 4RT2A 5L1LA 4B6JA 4XA5A 3PW4A 4M2YA 3I1YA 4O3OA 4B9UA 4O3PA 4M9JA 3IN5A 4DLGA 4R8UB 4M9LA 1J2MA 4WJ3B 4QZ8A 3Q8KA 4DF4A 4YCXA 1LVHA 2IMWP 3D2QA 5KG2A 2AGPA 2Y0SC 1XC9A 8ICLA 4UB3A 1KRPA 2IBKA 4F72A 4K4HA 5J8YC 4ZOHC 4I2DA 4F3OA 1X2IA 2W3SA 3VC8A 4O3SA 4B9MA 1RQLA 2BQRA 4QW8A 5ALHA 3GV7B 4KLFA 1C20A 3KTQA 4DO9A 4RQMA 5J0OA 1ZQJA 2EAOA 4GLXA 1VLBA 3RAXA 2W3RA 4ED0A 4DL4A 1KBUA 4FZNA 1KDHA 1N60A 2EAPA 2E1FA 2ZJAA 4DFPA 3RH4A 5ALZA 2WTFA 5EWEA 2XC9A 3RAQA 3AQEA 2OCEA 3ZDCA 2AH5A 3UXPA 2HHVA 7ICUA 2YY6A 2KEYA 4KLHA 3QUQA 1MQ3A 1OUQA 2KVSA 5AKKA 4DL3A 4KLGA 4EX7A 2PKEA 2KTQA 1Z4NA 2KICA 9ICMA 2WFAA 1UHUA 3OHBA 2YB4A 4AP9A 4DFKA 1CRXA 2I6XA 5KG0A 4IC9A 5HHHA 2BQ3A 2F3NA 3Q8MA 4JWMA 2EZYA 1RYSA 1RZTA 2ZUDA 2OEHA 2HOQA 1IV8A 1MSWD 4J9QA 3MR3A 2HSZA 4I2BA 2MUTA 2NRTA 4Y2PA 3R9KA 1XU4A 5KG7A 2QB0A 3H8WA 1ZQQA 2XY6A 4JV1A 2K8AA 2ASLA 3H0RB 4DCCA 1YZ7A 4NLKA 2VANA 3AM9A 3L3FX 2XGPA 3AN1A 5J2FA 3RJIA 5EOZA 5IIMA 4RQNA 4R64A 3KHLA 5L1IA 2PI4A 4NLZA 1S10A 4DQIA 9ICFA 4R66A 1S0MA 5KFXA 3UMBA 5KFFA 2KSOB 5KFQA 4JV0A 4RQ7A 2RQ5A 2AXTU 1ZD4A 4I2HA 4P0QB 2A1JB 3OSPA 2LKYA 1ZQIA 4F71A 1RM6C 2HW3A 2ZXIA 3SV3A 1LB2B 3N7SC 5D46A 3PY8A 1PVPA 2H3ZA 3NRZA 2IHMA 5KFSA 1MC8A 4P2HA 2VA2A 4DSKA 5DB6A 3SENA 2RRDA 4DSIA 2GLEA 9ICCA 3WKAA 7ICSA 4Q45A 3TFSA 3PX6A 2ZIXB 1PK1B 4QWDA 1KTQA 2KNJA 1NKCA 3HT3A 8ICYA 1D9FA 2LYHA 5JRTA 2PXIA 1C7YA 1D8YA 1NK6A 3PZPA 2W7OA 4I2EA 4QIWF 4XUSA 5BOLA 1KQQA 3LK9A 4QJFB 2YQEA 1ZXIA 4KLIA 7ICGA 4IR1A 8ICJA 1RPLA 3ICXA 5AM0A 4J9LA 3IG5A 2WB1F 4U6PA 2W9CB 9ICGA 2FPKA 1FO4A 3F5AA 1RXVA 1J2NA 4RQ3A 3MGIA 4FBUA 8ICPA 5K4LA 4DSEA 5DBAA 5JTIA 2ZIVB 4C4RA 3BQTA 3PX4A 4YD2A 1X6IA 1QQ5A 1U47A 5DBBA 8ICXA 1AQ6A 1ZD3A 5AKEA 2WAQF 5ALQA 1ZQCA 1NKEA 2Z7JA 4R8UA 4F5PA 7ICHA 4BXOB 4I2CA 2YTUA 3HWTA 8ICGA 1DGSA 1JXEA 3ISBA 2BQUA 3UQ0A 3SAFA 1BPEA 2RDJA 4RPXA 3K1ZA 2FI1A 2ZTDA 2MSNA 1UCVA 2HHSA 3ZDAA 8ICQA 1QSLA 4K4GA 1TK8A 9ICWA 4ED7A 3UPQA 5IINA 5KTQA 2F1IA 3ETLA 3E2EA 2ASJA 1T3NA 2JHDA 3PW7A 1S97A 2K89A 5TISU 1BNOA 1NK9A 2DL0A 4FFDA 5EE1A 5J2EA 4CRXA 1OXJA 4Y2UA 2Y9UA 1KFSA 2BZFA 3PNCA 1V38A 4UAYA 1T7PA 3PO4A 8ICKA 2KHVA 5IIOA 1TVAA 2LMRA 3GDXA 4PHPA 7ICMA 4B9TA 3WU2U 1KL9A 2HVHA 4DOAA 4J9OA 1HEKA 1DOQA 2RDIA 3ETRA 2A1AA 4PPXA 2C2EA 4MFCA 4I29A 3AU2A 3BZKA 3NGDA 2W8KA 3Q8LA 7ICKA 5KFKA 1N56A 2F44A 4GC6A 5DGAA 1XSNA 2CPRA 3H40A 2LM4A 9ICBA 2DKZA 1T94A 4RQ2A 3D6JA 3V7JA 2K60A 1NOMA 2KSOA 4NLBA 3RFAA 8ICOA 3SD7A 2JZBA 2MA1A 4UB6U 4B9VA 5IIJA 2I9GA 4RQ1A 1ZQNA 2WB1C 2H3FA 4NM2A 4AYBF 4M9GA 1XS9D 3PR5B 4UAZA 3GFKB 4P0QA 5KFRA 2D6FC 3T79A 3QU5A 1V9PA 2F8KA 3C28A 2KHQA 2E8PA 3K4GA 4UW9A 3ZDEA 2F1JA 4KLOA 3WKCA 3PVXA 2Q0ZX 4CNQA 5KG5A 2WF9A 5CP2A 3SI8A 2J6UA 3JPNA 3E58A 4CDGA 1JUDA 5L1MA 1S8OA 3GIMA 1BPZA 4Y2XA 5HNKA 3T3FA 5G5GA 4F2SA 2GOLA 5HMMA 2ZIXA 1PK1A 3CNHA 1X9XA 2FPLA 4IQWA 4MEYA 1DK3A 5ALDA 3LWLA 1ZQPA 4BUGA 1U4BA 3JPRA 5KFNA 2BGWA 3E0FA 3RB4A 4ECQA 5KFAA 1ZETA 1XNSA 4UB5A 1L3TA 5DLGA 1ED1A 3EZ5A 3AU6A 3L4PA 3SZ2A 2E1EA 3MBYA 5DG8A 1MA7A 4KMOB 4Z6FA 1NJWA 3BQ0A 5CHGA 5HHIA 3HP6A 3M8RA 3UMGA 3NVZA 5KG3A 1EXNA 4UQGA 1SKSA 3H8SA 1QCKA 2W9CA 3H4BA 2KZZA 2B0CA 4US9A 1ZYQA 4F91B 4R63A 2JEJA 2IOFA 4GXJA 2AQ0A 1QQ6A 1S9FA 4NLNA 2ZIVA 3OJSA 3RF9A 5KFPA 9ICPA 4YR0A 4JUZA 2FMPA 3QU4A 1Z4OA 3F5EA 2F2AB 1YT3A 4Q43A 9ICSA 4BXOA 9ICQA 5KFLA 4ELVA 2PI5A 4TUSA 2R8HA 2HHQA 2XIDA 3T5KA 4DS4A 1KFTA 2FE9A 5ALGA 4I28A 1CI4A 4EYHB 3RJKA 4O9MA 2ZG6A 3DDHA 1L7OA 5C0YA 3KHHA 3ED5A 1QSSA 2QB1A 2FMQA 2W9BB 1ZQBA 3OGUA 1UT8A 2EZZA 3UQ2A 4O3RA 2YMPA 5AK3A 2PFPA 2VA3A 4C80A 2W03A 1KW4A 3I28A 3NASA 3PMNA 3BQ2A 2ZIUB 4F50A 4AYBC
chains in the Genus database with same CATH topology
1WWVA 2K4PA 1X40A 5KNIA 1PK3A 3BS5B 2E8NA 2QARB 1OW5A 5JU5A 2EAPA 5J8YA 2L5YA 2DKXA 2B6GA 2F44A 2YTUA 1SV0C 2QB0B 3KKAA 1SXDA 2EAMA 1B4FA 1UQVA 3TACB 2DKZA 3SENA 2KE7A 2GLEA 2EANA 2K60A 2KSOA 2ESEA 1F0MA 2D3DA 1RG6A 1UCVA 1DXSA 1PK1B 2KIVA 3HILA 1SV0A 4MHVA 1B0XA 2F3NA 1COKA 3H8MA 3BS5A 2F8KA 5JRTA 1SXEA 2E8PA 1LKYB 2LPEA 1V85A 2QKQA 3K1RB 1SGGA 2QB0A 3TADC 2DL0A 1Z1VA 4NJ8A 1OXJA 3BS7A 2Y9UA 4NL9C 5L1MA 2ES6A 1V38A 2E8OA 2FE9A 2D8CA 1JI7A 3SEIA 1X66A 2Y9TA 4RQNA 4IS7A 2QARA 1PK1A 3BQ7A 1X9XA 2LMRA 3IDWA 4PZNA 1SV4A 1WWUA 5J8YC 2QB1A 2KG5A 2KSOB 5F3XB 3TADA 2KMDA 2JV3A 3KKAC 2E8MA 5JTIA 1KW4A 4NL9A 4PZOA 1LKYA 4RQMA 2EAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWV A;  2K4P A;  1X40 A;  5KNI A;  1PK3 A;  3BS5 B;  2E8N A;  2QAR B;  1OW5 A;  5JU5 A;  2EAP A;  5J8Y A;  2L5Y A;  2DKX A;  2B6G A;  2F44 A;  2YTU A;  1SV0 C;  2QB0 B;  3KKA A;  1SXD A;  2EAM A;  1B4F A;  1UQV A;  3TAC B;  2DKZ A;  3SEN A;  2KE7 A;  2GLE A;  2EAN A;  2K60 A;  2KSO A;  2ESE A;  1F0M A;  2D3D A;  1RG6 A;  1UCV A;  1DXS A;  1PK1 B;  2KIV A;  3HIL A;  1SV0 A;  4MHV A;  1B0X A;  2F3N A;  1COK A;  3H8M A;  3BS5 A;  2F8K A;  5JRT A;  1SXE A;  2E8P A;  1LKY B;  2LPE A;  1V85 A;  2QKQ A;  3K1R B;  1SGG A;  2QB0 A;  3TAD C;  2DL0 A;  1Z1V A;  4NJ8 A;  1OXJ A;  3BS7 A;  2Y9U A;  4NL9 C;  5L1M A;  2ES6 A;  1V38 A;  2E8O A;  2FE9 A;  2D8C A;  1JI7 A;  3SEI A;  1X66 A;  2Y9T A;  4RQN A;  4IS7 A;  2QAR A;  1PK1 A;  3BQ7 A;  1X9X A;  2LMR A;  3IDW A;  4PZN A;  1SV4 A;  1WWU A;  5J8Y C;  2QB1 A;  2KG5 A;  2KSO B;  5F3X B;  3TAD A;  2KMD A;  2JV3 A;  3KKA C;  2E8M A;  5JTI A;  1KW4 A;  4NL9 A;  4PZO A;  1LKY A;  4RQM A;  2EAO A; 
#chains in the Genus database with same CATH topology
 1WWV A;  5AI6 A;  3M7D A;  3IRU A;  4M6W A;  5ALM A;  4RNN A;  1SL1 A;  2E8N A;  2P6U A;  5KFO A;  2DUY A;  2QAR B;  2KZM A;  1HUO A;  2L5Y A;  1KEJ A;  2UVW A;  3RH6 A;  1U49 A;  3JPP A;  1JX4 A;  3OSN A;  4PHD A;  4EEK A;  1KSP A;  9ICJ A;  1TV9 A;  4ICA A;  2G08 A;  8ICH A;  4Z6C A;  3LDA A;  1F0M A;  4BWM A;  2D3D A;  1L7P A;  3B0X A;  8ICR A;  1XO1 A;  5KAF U;  1RDF A;  5III A;  4C4S A;  2JR5 A;  2LYB A;  2HMX A;  4YMO A;  1SIJ A;  2FMS A;  2RHF A;  2BCV A;  9ICN A;  1NI3 A;  5KT5 A;  5DQG A;  1WCN A;  5AK5 A;  2HHW A;  4IRD A;  1N63 A;  5DGB A;  5DB9 A;  4I2A A;  2OH2 A;  3JPQ A;  2VA8 A;  2NYV A;  1ZQ1 C;  4EEN A;  1N48 A;  1Z1V A;  4DWI A;  4NJ8 A;  2ZJ8 A;  4DQS A;  2YMM A;  5KFV A;  8ICT A;  5KFD A;  3F2C A;  4F93 B;  3V7K A;  4EEL A;  4EBC A;  1N5X A;  4DL2 A;  2BPG A;  3BQ1 A;  5F3X B;  1NJY A;  2J6S A;  1KLN A;  5AK4 A;  3FAH A;  2G5H B;  2CN1 A;  4FZL A;  5ALU A;  1ZQK A;  4F4X A;  2DGZ A;  9ICR A;  4CF4 A;  9ICL A;  1T3Q A;  2YMQ A;  3Q8Q B;  5KNI A;  3JPS A;  3BS5 B;  4OJO A;  4O3Q A;  4XRH A;  3M9O B;  4GXK A;  3F2D A;  1KKX A;  4JV2 A;  3OHA A;  4PH5 A;  4YXM A;  3QUB A;  3L5K A;  3TAR A;  3F2B A;  3F53 A;  4USA A;  2G09 A;  2AGO A;  3HRD D;  2EAM A;  1N5W A;  1B4F A;  1KFD A;  4PHA A;  2E5S A;  4FO6 A;  1SZH A;  5KL8 B;  1NZP A;  4IQV A;  5J2K A;  4O0I A;  1COO A;  3MGV A;  4Y2Y A;  3C2L A;  4UB8 U;  4IR9 A;  4LJX A;  5ALK A;  1TAU A;  4JWN A;  4YFK A;  5DDY A;  4F4Z A;  3QX7 A;  3SYZ A;  3LWM A;  1ZQL A;  2VKQ A;  2NRX A;  5J0U A;  2C2R A;  4F4Y A;  2LHT A;  3QEA Z;  4GXI A;  2HBK A;  4QWA A;  2P35 A;  5EE9 A;  3Q8P B;  2DBY A;  3RTV A;  4KLS A;  2KFN A;  7ICJ A;  4NWI A;  4OJ5 A;  2OYY A;  1JXL A;  4KLL A;  3AMZ A;  7ICI A;  3T5L A;  4NV0 A;  4YMN A;  2FJ6 A;  2FLN A;  5AIC A;  3KFU F;  3SEI A;  2W11 A;  1GO3 F;  4RNM A;  4G3I A;  2V4R A;  4RNO A;  3LVW A;  2K4I A;  1KN5 A;  1N2X A;  3IDW A;  1QH9 A;  2KG5 A;  1ARO P;  3V72 A;  4QZA A;  2KD1 A;  3BJY A;  4M0A A;  4RU9 A;  4YG2 A;  5JUM A;  3RRG A;  7ICL A;  5CRX A;  4ECV A;  2KJ5 A;  1JAL A;  2ISP A;  4CCH A;  2FDR A;  5DB7 A;  5J0Q A;  2AGQ A;  2DPJ A;  2DKX A;  2H3Q A;  1NK5 A;  5J0P A;  4DFM A;  1JMS A;  2F8L A;  3C1Y A;  4GC7 A;  1QTM A;  4MEX A;  2B6G A;  4FZM A;  5KT7 A;  4EYI B;  2DFL A;  4EZ6 A;  1A77 A;  2DWQ A;  3QU2 A;  4B9N A;  1ZQW A;  4C7Y A;  3KKA A;  4QWC A;  5J2G A;  3ZD9 A;  1FEZ A;  5KG1 A;  5DKW A;  2JEI A;  5ALE A;  5DQI A;  4BDP A;  2F1H A;  2W9B A;  2JH7 A;  1Q3U A;  2YB1 A;  5KFU A;  4F5R A;  3M6Z A;  4TUR A;  4DSF A;  4DSL A;  2PFO A;  3QXG A;  5J0S A;  2ZIU A;  1P7D A;  4DSJ A;  2AJQ A;  1A76 A;  4J9K A;  1QQ7 A;  1Z1B A;  2KZ3 A;  1S76 D;  3EWA A;  2CXY A;  8ICZ A;  3QU7 A;  4UB4 A;  4Q44 A;  2NO4 A;  5KT3 A;  5DG9 A;  7ICE A;  2IHN A;  2ZTE A;  5KFJ A;  2FLP A;  5J0R A;  5AM4 A;  2UVU A;  7ICV A;  3DV9 A;  5B5E U;  2AU0 A;  3IG8 A;  1XSP A;  3IM1 A;  1ZQF A;  3AL0 B;  4HYK A;  4MFF A;  5EE0 A;  9ICX A;  1N62 A;  3Q8R B;  1X9M A;  4EEY A;  1XSL A;  3TKA A;  2NV3 A;  3QEB Z;  4I2G A;  2Q4T A;  2ZTC A;  4KLM A;  3PSF A;  9ICV A;  9ICI A;  1UPH A;  2YN4 A;  5KFB A;  4ECZ A;  1QSY A;  2JRZ A;  4CE6 A;  3HJE A;  3UMC A;  8ICS A;  4QNL A;  2V9W A;  5GTH U;  3WKE A;  2W55 A;  2K4P A;  9ICK A;  1X40 A;  1FIQ A;  5H2F U;  2ZJ5 A;  3J81 j;  3GZF A;  1L3S A;  1L5U A;  3FDS A;  3CW2 C;  4MF2 A;  3UXO A;  2HDO A;  5AKZ A;  1YZ6 A;  3QYP A;  1J97 A;  2ZXH A;  4UBB A;  1VDV A;  4NM1 A;  2HHX A;  2WF7 A;  4RUA A;  5HML A;  4LZD A;  4UB1 A;  5DG7 A;  3EW9 A;  5DB8 A;  2NRZ A;  5ALI A;  4DOB A;  1PVR A;  4I27 A;  3V6H A;  1RYR A;  4F92 B;  1S5L U;  1ZQA A;  4YVZ A;  4QZC A;  4MHV A;  1L7M A;  1PUZ A;  3PST A;  5CR0 A;  4FS1 A;  2F77 X;  4P4M A;  4QZG A;  4TUP A;  3BS5 A;  5KFZ A;  1SXE A;  3RJG A;  5HR6 A;  3GIJ A;  2YML A;  2HCF A;  4OJL A;  3B0Y A;  2VIX A;  5AKI A;  3AEV A;  2BCU A;  3KBB A;  4C4T A;  2OXO A;  2H3I A;  3RJE A;  1T4G A;  3RBD A;  5KT2 A;  5KT6 A;  4ED8 A;  5KFC A;  4DL7 A;  5CB1 A;  5CWR A;  2A1J A;  3RJH A;  3H0M B;  2Y9T A;  1NZB A;  3ISC A;  3RR7 A;  1IG6 A;  4EZ9 A;  5AM2 A;  3N97 B;  4ECU A;  1D9D A;  4LZG A;  3NVW A;  4ECW A;  4B9L A;  3BZC A;  3HPO A;  2KP7 A;  2C28 A;  2JV3 A;  4DL5 A;  2MRL A;  5ALS A;  3KKA C;  4PGX A;  5ALJ A;  1WUD A;  4ED1 A;  3ZDB A;  1K5O A;  2YX8 A;  1A6S A;  4F5O A;  4OJP A;  4O3M A;  1VJ5 A;  4M04 A;  4EBE A;  3TAP A;  4C8O A;  4C8M A;  1NK7 A;  5G5H A;  1WG8 A;  4ECR A;  2GO7 A;  3B9J A;  4IQU A;  4TQR A;  1H38 A;  1S0V A;  3RH5 A;  5AIB A;  1RQN A;  7ICQ A;  4C8L A;  4Y2R A;  3RR8 A;  5CA7 A;  2K4E A;  1SXD A;  2WF5 A;  2BDP A;  3FM9 A;  3WK5 A;  2WHE A;  3MFI A;  3C29 A;  2JEG A;  3O0F A;  4NLC A;  1ZRM A;  2P66 A;  2W8L A;  4BGD A;  5AI8 A;  1URJ A;  2R8J A;  3GIL A;  4Y2Q A;  4P0P B;  2KJ8 A;  5CJ7 A;  4DEZ A;  2W54 A;  5AKH A;  3HIL A;  3C1Z A;  2BR0 A;  3WK9 A;  4TUQ A;  1SWV A;  2C2D A;  3EPI A;  3TFR A;  8ICI A;  1K1Q A;  1B43 A;  2XGQ A;  4CF5 A;  3WK8 A;  4QZB A;  3G6V A;  4FS2 A;  4O5K A;  1U9L A;  4JK1 A;  3RRH A;  1Z3E B;  1SGG A;  1HUZ A;  1NK8 A;  4Q8F A;  9ICO A;  3NUQ A;  2NO5 A;  2BKE A;  4J9P A;  5HP4 A;  2XCP A;  5AKJ A;  3BS7 A;  4KLD A;  5J2D A;  3D2S A;  3QUC A;  4YR3 A;  3QZ8 A;  2ES6 A;  3MDC A;  2D8C A;  4KN4 A;  1NK0 A;  3SAH A;  3WK4 A;  4B9S A;  3OTQ A;  3C5F A;  7ICT A;  4PZN A;  5EE3 A;  3GIK A;  5J0T A;  4F4K A;  2ZUB A;  3C5G A;  4MFA A;  1ZD5 A;  2OM6 A;  2XIC A;  2IOH A;  4LVS A;  1S77 D;  5ALN A;  1WCL A;  4NL9 A;  4PZO A;  3KHR A;  3PW0 A;  2PMZ F;  2EQY A;  1ZQT A;  2XO7 A;  2K8B B;  3OPX A;  5GTI U;  5AHX A;  2CRX A;  1PZN A;  4KLT A;  2A3V A;  1ZQD A;  1F44 A;  1UQV A;  3EYZ A;  5E79 U;  4GFJ A;  4ELT A;  4UAU A;  1BPY A;  4CGZ A;  1DRG A;  3PW2 A;  5AI0 A;  2KKP A;  4UAV A;  4QZE A;  1RXW A;  3M9N B;  2R8K A;  2G0A A;  4KX3 A;  1FFU A;  4F8R A;  1PVQ A;  4J03 A;  4ACO A;  4ZH4 A;  5DQH A;  5KT4 A;  4RQ5 A;  3GV5 B;  2FLL A;  2BCR A;  3JPT A;  2ZUC A;  2GH1 A;  4F5Q A;  5J0W A;  5ALR A;  4J9M A;  3DEE A;  4I2J A;  2W04 A;  1MN8 A;  5AI9 A;  5ALV A;  2BHN A;  2B21 A;  2G06 A;  3S6J A;  4IRC A;  1CEZ A;  2JEF A;  3T5J A;  3Q8S B;  1JI7 A;  3V6J A;  2HHT A;  4M9H A;  1BVS A;  3IV6 A;  3RB6 A;  3CYM A;  1WWU A;  4OD0 A;  5AI5 A;  3CRX A;  1RYU A;  1ZQS A;  3PSP A;  1ZD2 P;  3HX0 A;  1JRP A;  2E8M A;  3GII A;  1TKD A;  3RBE A;  8ICE A;  4I2F A;  3NTU A;  1L3U A;  3SAG A;  5AKY A;  5AIA A;  2XCA A;  2KJ9 A;  2ALZ A;  5EWG A;  3FYH A;  3A0B U;  1UA1 A;  3QU9 A;  4QWB A;  4FE3 A;  1Q46 A;  4JB3 A;  8ICA A;  1L8O A;  3UM9 A;  2KIW A;  1BNP A;  4KN7 A;  3C2M A;  3ALR A;  3N4M B;  4RUC A;  1S0N A;  4JMU A;  5L9X A;  4Q8E A;  5BPC A;  3RJJ A;  5J2C A;  2KE7 A;  4YR2 A;  9ICT A;  2MAX A;  2KV2 A;  3MAB A;  4C8N A;  1UA0 A;  5KFW A;  4DFJ A;  3H8J A;  3LYS A;  2ASD A;  3NVV A;  1SL2 A;  1ECW A;  4G9B A;  4US8 A;  2OWO A;  4ELU A;  1RG6 A;  3HKZ C;  1TK0 A;  2W9A A;  4UB2 A;  1TAQ A;  1SV0 A;  2KN7 A;  3SV4 A;  4NLG A;  2JMG A;  4DFD A;  3PX0 A;  4KIT B;  4DQP A;  1Z00 B;  1Q8K A;  3H8M A;  1SWW A;  4Z6D A;  1LKY B;  2JGA A;  3PR4 A;  9ICU A;  2E3T A;  2PMZ C;  4O5C A;  2LBO A;  2JZB B;  1DK2 A;  3WK7 A;  4KLJ A;  2R8I A;  4BJQ A;  2H3V A;  3A0H U;  1Z19 A;  2KVC A;  4Y2T A;  4OCZ A;  5J2A A;  4NL9 C;  4QZ9 A;  3V7L A;  1SL0 A;  7ICN A;  4KLE A;  2E8O A;  1X9W A;  1X6J A;  4IS7 A;  1M6Y A;  4NY8 A;  4P0P A;  5ALW A;  3EUB 2;  5KFI A;  5J29 A;  4HAI A;  4RQ0 A;  2VJ5 A;  3TAD A;  5KFH A;  4ECX A;  1LV5 A;  3ISD A;  3NVY A;  4DQQ A;  1IXR A;  1SZP A;  4Z6E A;  4ECT A;  2Y1J A;  2RP5 A;  2HVI A;  3SMV A;  4FBT A;  3N7P D;  2WF6 A;  4YXJ A;  5F9L A;  3N7R C;  2WF8 A;  3M8S A;  2DF4 B;  4GIB A;  1L8L A;  5AK6 A;  1L7N A;  4K4I A;  3KZX A;  1TAM A;  4ED2 A;  1L3V A;  1BPX A;  4UAR A;  3VCB A;  2G07 A;  1NNL A;  1XO0 A;  7ICF A;  5AM5 A;  4J9S A;  1O03 A;  5DLF A;  1IM4 A;  4DF8 A;  5KFY A;  5B66 U;  5ALX A;  1SKW A;  2QLT A;  4RQ6 A;  3NS1 A;  2F76 X;  4ED3 A;  2I1Q A;  4I2I A;  2ATL A;  3MR5 A;  2HBM A;  9ICE A;  1X9S A;  4EX6 A;  2HI0 A;  2DQN B;  4IRK A;  2IA6 A;  1D8B A;  4IQT A;  4A8E A;  5F9N A;  2BPF A;  1HJP A;  2HBL A;  2KK0 A;  7ICP A;  2ZIW B;  1Y88 A;  1UT5 A;  3QNM A;  1S0O A;  2NRW A;  2BCS A;  3KD3 A;  3K1R B;  3PW5 A;  4O5E A;  4C7Z A;  2M0N A;  1NK4 A;  1A0P A;  4EBD A;  4QWE A;  5KFG A;  3AUO A;  4PJ0 U;  5DBC A;  2HHU A;  4PL1 A;  2XY5 A;  3QUT A;  3QZ7 A;  2HBJ A;  2XI9 A;  3M6K A;  4KLQ A;  2M9N A;  1ZQH A;  3N28 A;  4ECS A;  3MDA A;  3GU3 A;  2QAR A;  1SV4 A;  8ICV A;  4P4P A;  1O08 A;  3PV8 A;  2DPI A;  2AHO B;  4R65 A;  5L1K A;  3ORY A;  5TZV A;  1JIH A;  4BX9 C;  3MR6 A;  8ICB A;  2ISO A;  3THV A;  3C23 A;  5C5J A;  2BDU A;  1BGX T;  4KX5 A;  2G5I B;  3RB3 A;  5JU5 A;  3H0L B;  2LM1 A;  1ZQO A;  1ZQU A;  4Y2V A;  1U48 A;  1DGJ A;  2IOF K;  8ICN A;  2EH9 A;  5ALT A;  1TE2 A;  2PFN A;  3GQC A;  1SV0 C;  2EZX A;  1BPB A;  4RPZ A;  2C22 A;  1K1S A;  7ICO A;  3WKB A;  4F5N A;  3H7I A;  2W43 A;  4BWJ A;  1T8E A;  1NJX A;  3PSI A;  2EAN A;  2R18 A;  1MQ2 A;  3V6K A;  2ESE A;  4M6W B;  4UBC A;  4YD1 A;  4DL6 A;  5BOM A;  1DXS A;  4J9R A;  4RPY A;  4U7C A;  5J2J A;  5L1J A;  5J2B A;  4YP3 A;  4TQS A;  8ICC A;  2HOF A;  9ICH A;  4M47 A;  4KLU A;  1FFV A;  2KFZ A;  4QW9 A;  3KHG A;  1TK5 A;  5IIK A;  3I76 A;  1ZQR A;  3K75 D;  2AQ4 A;  4RQ8 A;  2RLT A;  3FC4 A;  4RQ4 A;  2XY7 A;  5KL1 B;  1IIP A;  3MR2 A;  2K4H A;  3TAD C;  4YMM A;  2VJ4 A;  4UAS A;  3CP8 A;  3EPG A;  1D8L A;  3MC1 A;  5DDM A;  4PGQ A;  1WYG A;  3C2K A;  4O3N A;  4PHE A;  3RJF A;  4MF8 A;  7ICR A;  5J2H A;  4PL2 A;  3AQF A;  1B22 A;  3QE9 Y;  3BQ7 A;  3RB0 A;  4F2R A;  1JRO A;  3D2N A;  4QZF A;  3TI0 A;  3BDP A;  1ZQV A;  5EWF A;  1Z00 A;  1TFR A;  4QZH A;  3M1Y A;  4QIW C;  3PO5 A;  1LKY A;  5KFT A;  1ZJM A;  9ICA A;  5AM1 A;  5D49 A;  4RZR A;  4OJ6 A;  3MGH A;  4DLE A;  3TQ1 A;  1OW5 A;  3G6Y A;  5J8Y A;  3IP4 B;  2Y1I A;  2H5X A;  4OO1 J;  2LYA A;  2MUT B;  3TAQ A;  2XVT A;  2QB0 B;  2Y0S F;  1ZOL A;  3JPO A;  5AI4 A;  2JXJ A;  3M9M B;  3H4D A;  4C8K A;  2KKV A;  5KFM A;  1ZRN A;  4XQ8 A;  1CUK A;  4P4O A;  5T14 A;  4KMU A;  2OHF A;  3ZDD A;  4PGY A;  2KIV A;  2WAQ C;  3U26 A;  4DOC A;  2J6T A;  2FPM A;  1ZQM A;  3PML A;  2W9M A;  2JH1 A;  3LVV A;  5CEH A;  4QZD A;  4M9N A;  1SB3 C;  3SQI A;  1ZQY A;  5AM3 A;  4ECY A;  4DS5 A;  2LPE A;  5AKX A;  5ALY A;  1HIW A;  3ONN A;  2NRV A;  4CF3 A;  4YN4 A;  2A19 A;  1XWL A;  2V4Q A;  4Y2J A;  1NJZ A;  4RT3 A;  5IIL A;  2HOI A;  1X66 A;  4UAW A;  5FP0 A;  3UXN A;  5HR7 A;  8ICF A;  5J0Y A;  3KOO A;  3SR6 A;  1Q3V A;  1SKR A;  1L6N A;  2KMD A;  4X5V A;  4E0D A;  2ZIW A;  5ALP A;  1ZQX A;  8ICW A;  2LI6 A;  3C21 A;  3ZD8 A;  4UAT A;  3HKZ F;  2MU2 A;  2BCQ A;  1PK3 A;  8ICU A;  3GV8 B;  3HW8 A;  4QZI A;  2ODG A;  2GWS A;  1N61 A;  2EDU A;  5AKG A;  5J0X A;  5D4B A;  1F5S A;  2KOB A;  2R8G A;  4Y2S A;  2I5H A;  4ED6 A;  1V97 A;  3WK6 A;  3ZI4 A;  2UVV A;  5ALF A;  1X42 A;  3OJU A;  3TAC B;  5A0L A;  5J2I A;  5KG6 A;  3KZI U;  2P6R A;  3T5H A;  4J9N A;  1NKB A;  5KAI U;  1ZQE A;  8ICM A;  2O6K A;  1ZQZ A;  5KFE A;  2K8C B;  2PFQ A;  1JN3 A;  3NRW A;  4YQW A;  1BPD A;  1U45 A;  3IHQ B;  5KG4 A;  1ZQG A;  4C0Z A;  2UVR A;  1B0X A;  4KTQ A;  1COK A;  4IL6 U;  2N1R A;  5AKL A;  5ALO A;  5ALL A;  1QLN A;  3G6X A;  3WKD A;  4DQR A;  1ZJN A;  3TAN A;  2BPC A;  1V85 A;  3MFH A;  4NXZ A;  2QKQ A;  4F4W A;  2W7P A;  4RT2 A;  5L1L A;  4B6J A;  4XA5 A;  3PW4 A;  4M2Y A;  3I1Y A;  4O3O A;  4B9U A;  4O3P A;  4M9J A;  3IN5 A;  4DLG A;  4R8U B;  4M9L A;  1J2M A;  4WJ3 B;  4QZ8 A;  3Q8K A;  4DF4 A;  4YCX A;  1LVH A;  2IMW P;  3D2Q A;  5KG2 A;  2AGP A;  2Y0S C;  1XC9 A;  8ICL A;  4UB3 A;  1KRP A;  2IBK A;  4F72 A;  4K4H A;  5J8Y C;  4ZOH C;  4I2D A;  4F3O A;  1X2I A;  2W3S A;  3VC8 A;  4O3S A;  4B9M A;  1RQL A;  2BQR A;  4QW8 A;  5ALH A;  3GV7 B;  4KLF A;  1C20 A;  3KTQ A;  4DO9 A;  4RQM A;  5J0O A;  1ZQJ A;  2EAO A;  4GLX A;  1VLB A;  3RAX A;  2W3R A;  4ED0 A;  4DL4 A;  1KBU A;  4FZN A;  1KDH A;  1N60 A;  2EAP A;  2E1F A;  2ZJA A;  4DFP A;  3RH4 A;  5ALZ A;  2WTF A;  5EWE A;  2XC9 A;  3RAQ A;  3AQE A;  2OCE A;  3ZDC A;  2AH5 A;  3UXP A;  2HHV A;  7ICU A;  2YY6 A;  2KEY A;  4KLH A;  3QUQ A;  1MQ3 A;  1OUQ A;  2KVS A;  5AKK A;  4DL3 A;  4KLG A;  4EX7 A;  2PKE A;  2KTQ A;  1Z4N A;  2KIC A;  9ICM A;  2WFA A;  1UHU A;  3OHB A;  2YB4 A;  4AP9 A;  4DFK A;  1CRX A;  2I6X A;  5KG0 A;  4IC9 A;  5HHH A;  2BQ3 A;  2F3N A;  3Q8M A;  4JWM A;  2EZY A;  1RYS A;  1RZT A;  2ZUD A;  2OEH A;  2HOQ A;  1IV8 A;  1MSW D;  4J9Q A;  3MR3 A;  2HSZ A;  4I2B A;  2MUT A;  2NRT A;  4Y2P A;  3R9K A;  1XU4 A;  5KG7 A;  2QB0 A;  3H8W A;  1ZQQ A;  2XY6 A;  4JV1 A;  2K8A A;  2ASL A;  3H0R B;  4DCC A;  1YZ7 A;  4NLK A;  2VAN A;  3AM9 A;  3L3F X;  2XGP A;  3AN1 A;  5J2F A;  3RJI A;  5EOZ A;  5IIM A;  4RQN A;  4R64 A;  3KHL A;  5L1I A;  2PI4 A;  4NLZ A;  1S10 A;  4DQI A;  9ICF A;  4R66 A;  1S0M A;  5KFX A;  3UMB A;  5KFF A;  2KSO B;  5KFQ A;  4JV0 A;  4RQ7 A;  2RQ5 A;  2AXT U;  1ZD4 A;  4I2H A;  4P0Q B;  2A1J B;  3OSP A;  2LKY A;  1ZQI A;  4F71 A;  1RM6 C;  2HW3 A;  2ZXI A;  3SV3 A;  1LB2 B;  3N7S C;  5D46 A;  3PY8 A;  1PVP A;  2H3Z A;  3NRZ A;  2IHM A;  5KFS A;  1MC8 A;  4P2H A;  2VA2 A;  4DSK A;  5DB6 A;  3SEN A;  2RRD A;  4DSI A;  2GLE A;  9ICC A;  3WKA A;  7ICS A;  4Q45 A;  3TFS A;  3PX6 A;  2ZIX B;  1PK1 B;  4QWD A;  1KTQ A;  2KNJ A;  1NKC A;  3HT3 A;  8ICY A;  1D9F A;  2LYH A;  5JRT A;  2PXI A;  1C7Y A;  1D8Y A;  1NK6 A;  3PZP A;  2W7O A;  4I2E A;  4QIW F;  4XUS A;  5BOL A;  1KQQ A;  3LK9 A;  4QJF B;  2YQE A;  1ZXI A;  4KLI A;  7ICG A;  4IR1 A;  8ICJ A;  1RPL A;  3ICX A;  5AM0 A;  4J9L A;  3IG5 A;  2WB1 F;  4U6P A;  2W9C B;  9ICG A;  2FPK A;  1FO4 A;  3F5A A;  1RXV A;  1J2N A;  4RQ3 A;  3MGI A;  4FBU A;  8ICP A;  5K4L A;  4DSE A;  5DBA A;  5JTI A;  2ZIV B;  4C4R A;  3BQT A;  3PX4 A;  4YD2 A;  1X6I A;  1QQ5 A;  1U47 A;  5DBB A;  8ICX A;  1AQ6 A;  1ZD3 A;  5AKE A;  2WAQ F;  5ALQ A;  1ZQC A;  1NKE A;  2Z7J A;  4R8U A;  4F5P A;  7ICH A;  4BXO B;  4I2C A;  2YTU A;  3HWT A;  8ICG A;  1DGS A;  1JXE A;  3ISB A;  2BQU A;  3UQ0 A;  3SAF A;  1BPE A;  2RDJ A;  4RPX A;  3K1Z A;  2FI1 A;  2ZTD A;  2MSN A;  1UCV A;  2HHS A;  3ZDA A;  8ICQ A;  1QSL A;  4K4G A;  1TK8 A;  9ICW A;  4ED7 A;  3UPQ A;  5IIN A;  5KTQ A;  2F1I A;  3ETL A;  3E2E A;  2ASJ A;  1T3N A;  2JHD A;  3PW7 A;  1S97 A;  2K89 A;  5TIS U;  1BNO A;  1NK9 A;  2DL0 A;  4FFD A;  5EE1 A;  5J2E A;  4CRX A;  1OXJ A;  4Y2U A;  2Y9U A;  1KFS A;  2BZF A;  3PNC A;  1V38 A;  4UAY A;  1T7P A;  3PO4 A;  8ICK A;  2KHV A;  5IIO A;  1TVA A;  2LMR A;  3GDX A;  4PHP A;  7ICM A;  4B9T A;  3WU2 U;  1KL9 A;  2HVH A;  4DOA A;  4J9O A;  1HEK A;  1DOQ A;  2RDI A;  3ETR A;  2A1A A;  4PPX A;  2C2E A;  4MFC A;  4I29 A;  3AU2 A;  3BZK A;  3NGD A;  2W8K A;  3Q8L A;  7ICK A;  5KFK A;  1N56 A;  2F44 A;  4GC6 A;  5DGA A;  1XSN A;  2CPR A;  3H40 A;  2LM4 A;  9ICB A;  2DKZ A;  1T94 A;  4RQ2 A;  3D6J A;  3V7J A;  2K60 A;  1NOM A;  2KSO A;  4NLB A;  3RFA A;  8ICO A;  3SD7 A;  2JZB A;  2MA1 A;  4UB6 U;  4B9V A;  5IIJ A;  2I9G A;  4RQ1 A;  1ZQN A;  2WB1 C;  2H3F A;  4NM2 A;  4AYB F;  4M9G A;  1XS9 D;  3PR5 B;  4UAZ A;  3GFK B;  4P0Q A;  5KFR A;  2D6F C;  3T79 A;  3QU5 A;  1V9P A;  2F8K A;  3C28 A;  2KHQ A;  2E8P A;  3K4G A;  4UW9 A;  3ZDE A;  2F1J A;  4KLO A;  3WKC A;  3PVX A;  2Q0Z X;  4CNQ A;  5KG5 A;  2WF9 A;  5CP2 A;  3SI8 A;  2J6U A;  3JPN A;  3E58 A;  4CDG A;  1JUD A;  5L1M A;  1S8O A;  3GIM A;  1BPZ A;  4Y2X A;  5HNK A;  3T3F A;  5G5G A;  4F2S A;  2GOL A;  5HMM A;  2ZIX A;  1PK1 A;  3CNH A;  1X9X A;  2FPL A;  4IQW A;  4MEY A;  1DK3 A;  5ALD A;  3LWL A;  1ZQP A;  4BUG A;  1U4B A;  3JPR A;  5KFN A;  2BGW A;  3E0F A;  3RB4 A;  4ECQ A;  5KFA A;  1ZET A;  1XNS A;  4UB5 A;  1L3T A;  5DLG A;  1ED1 A;  3EZ5 A;  3AU6 A;  3L4P A;  3SZ2 A;  2E1E A;  3MBY A;  5DG8 A;  1MA7 A;  4KMO B;  4Z6F A;  1NJW A;  3BQ0 A;  5CHG A;  5HHI A;  3HP6 A;  3M8R A;  3UMG A;  3NVZ A;  5KG3 A;  1EXN A;  4UQG A;  1SKS A;  3H8S A;  1QCK A;  2W9C A;  3H4B A;  2KZZ A;  2B0C A;  4US9 A;  1ZYQ A;  4F91 B;  4R63 A;  2JEJ A;  2IOF A;  4GXJ A;  2AQ0 A;  1QQ6 A;  1S9F A;  4NLN A;  2ZIV A;  3OJS A;  3RF9 A;  5KFP A;  9ICP A;  4YR0 A;  4JUZ A;  2FMP A;  3QU4 A;  1Z4O A;  3F5E A;  2F2A B;  1YT3 A;  4Q43 A;  9ICS A;  4BXO A;  9ICQ A;  5KFL A;  4ELV A;  2PI5 A;  4TUS A;  2R8H A;  2HHQ A;  2XID A;  3T5K A;  4DS4 A;  1KFT A;  2FE9 A;  5ALG A;  4I28 A;  1CI4 A;  4EYH B;  3RJK A;  4O9M A;  2ZG6 A;  3DDH A;  1L7O A;  5C0Y A;  3KHH A;  3ED5 A;  1QSS A;  2QB1 A;  2FMQ A;  2W9B B;  1ZQB A;  3OGU A;  1UT8 A;  2EZZ A;  3UQ2 A;  4O3R A;  2YMP A;  5AK3 A;  2PFP A;  2VA3 A;  4C80 A;  2W03 A;  1KW4 A;  3I28 A;  3NAS A;  3PMN A;  3BQ2 A;  2ZIU B;  4F50 A;  4AYB C; 
#chains in the Genus database with same CATH homology
 1WWV A;  2K4P A;  1X40 A;  5KNI A;  1PK3 A;  3BS5 B;  2E8N A;  2QAR B;  1OW5 A;  5JU5 A;  2EAP A;  5J8Y A;  2L5Y A;  2DKX A;  2B6G A;  2F44 A;  2YTU A;  1SV0 C;  2QB0 B;  3KKA A;  1SXD A;  2EAM A;  1B4F A;  1UQV A;  3TAC B;  2DKZ A;  3SEN A;  2KE7 A;  2GLE A;  2EAN A;  2K60 A;  2KSO A;  2ESE A;  1F0M A;  2D3D A;  1RG6 A;  1UCV A;  1DXS A;  1PK1 B;  2KIV A;  3HIL A;  1SV0 A;  4MHV A;  1B0X A;  2F3N A;  1COK A;  3H8M A;  3BS5 A;  2F8K A;  5JRT A;  1SXE A;  2E8P A;  1LKY B;  2LPE A;  1V85 A;  2QKQ A;  3K1R B;  1SGG A;  2QB0 A;  3TAD C;  2DL0 A;  1Z1V A;  4NJ8 A;  1OXJ A;  3BS7 A;  2Y9U A;  4NL9 C;  5L1M A;  2ES6 A;  1V38 A;  2E8O A;  2FE9 A;  2D8C A;  1JI7 A;  3SEI A;  1X66 A;  2Y9T A;  4RQN A;  4IS7 A;  2QAR A;  1PK1 A;  3BQ7 A;  1X9X A;  2LMR A;  3IDW A;  4PZN A;  1SV4 A;  1WWU A;  5J8Y C;  2QB1 A;  2KG5 A;  2KSO B;  5F3X B;  3TAD A;  2KMD A;  2JV3 A;  3KKA C;  2E8M A;  5JTI A;  1KW4 A;  4NL9 A;  4PZO A;  1LKY A;  4RQM A;  2EAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...