2WF6A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and aluminium tetrafluoride
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf6A01
2Q4RA 1U2SA 1Q92A 4KN8A 5AKGA 1TJ4A 2P9JA 4G9BA 4J03A 5ALGA 3PCTA 3L8HA 4KNVA 5AKEA 3I6BA 3DDHA 5IS2A 3ZVLA 1WZCA 3IRUA 3MC1A 1Z88A 4EENA 3OCZA 4MUMA 2CN1A 5ALJA 5AKHA 4UASA 2WM8A 1L7OA 2FDRA 1Z4IA 4BEVA 2JAWA 2PR7A 2YJ5A 3L8EA 5ALYA 4ZEWA 2B1RA 2EARA 1KYTA 2IA5A 3SF0A 4OCZA 3NUQA 3QGMA 2DQSA 2GFHA 4UARA 2MU2A 5A3SA 1ZD2P 3SLRA 2YBDA 1Z5UA 2AH5A 2BDUA 1J8DA 1XP5A 1S8OA 1QQ7A 3KBBA 3WK6A 4EEKA 2HCFA 3R9KA 3PGVA 2YMMA 4Y3UA 3SHQA 2YJ6A 4UMVA 3WKDA 1L7MA 4C4TA 2AUTA 1LVHA 3L0BA 3QXGA 2P11A 3B9BA 3NASA 5AKXA 3A1DA 3QU2A 5AI8A 5AVZA 4EZEA 3SKYA 5AW3A 4DWOA 4YIHA 4FE3A 3DAOA 1LTQA 5A3QA 1Z4OA 2G1AA 2FPUA 3ZX5A 2IOFK 1F5SA 2HO4A 3ZW7A 4CNQA 1O03A 3L1UA 3SD7A 2C8KA 2ZG6A 2IOHA 3WK4A 4BKMA 2OM6A 2R8XA 3OCUA 5ALSA 4RETA 1U2TA 3NIWA 4YCMA 4XPZA 2C88A 4KX5A 1RPZA 3SMVA 4UMDA 2FUCA 1WVIA 5ALVA 3ZVMA 4J2TA 2WF6A 3U7EB 2AMYA 5T41A 1RLOA 5AKZA 1Z4KA 3WK8A 2ODAA 5AW2A 2NYVA 2GMWA 2I6XA 3WKAA 3EPRA 1ZS9A 3FGOA 4L57A 3UM9A 1QQ5A 4XE5A 4AS2A 2Q4TA 1NF2A 1RKQA 2JGAA 5AVWA 3U19A 1S2OA 5ALWA 1TJ3A 1RKUA 1Z5GA 2FPXA 2YN4A 5AM0A 2IYEA 3PDWA 3QLEA 3NAMA 4I9GA 3UMBA 5AW4A 1Z4QA 4BX3A 3CNHA 1Z4JA 4IG4A 1O08A 4HGQA 3W5BA 1QQ6A 5AI6A 4F72A 4I9FA 3WK9A 3RFUA 3OCWA 3CZ4A 5AK5A 3NALA 2C9MA 5AW8A 2ZBEA 1ZD4A 3WKBA 3DV9A 3A1CA 1RMQA 2WFAA 3R09A 3AR8A 1NRWA 1T5SA 4E88A 2RBKA 4BEWA 5AVYA 2YJ4A 3B8EA 3R4CA 1J97A 2YMLA 3RF6A 4EX6A 2HF7A 2HHLA 4Y2PA 5AVQA 3QYPA 1FEZA 2B30A 3OCYA 2HI0A 4JB3A 3N1UA 1ZD3A 3AR5A 5ALKA 1RQNA 2OA0A 3FZQA 4Y2JA 5AM4A 5AW9A 2ZBDA 2B8EA 5AK6A 4NV0A 5AK4A 3FM9A 5ALZA 2RB5A 2FPRA 3L1VA 4AS3A 5IT0A 4HGOA 2MU1A 3ESQA 3TLMA 2G80A 3QUQA 5AVUA 2WF5A 3QU4A 1PW5A 4UM7A 4QQFA 3L0CA 2HEGA 4BNDA 4C4SA 2B1QA 4NABA 4UAVA 4DCCA 2Q5EA 3M9LA 4RESA 3N8GA 2JAUA 1RLMA 2R8ZA 3EWIA 2GHTA 4BYGA 5ALDA 4QJBA 1ZRMA 3J7TA 5ALQA 3L8GA 5ALTA 5ALMA 3E8MA 2YJ3A 1U02A 4CF5A 1WR8A 5JJBA 1SWWA 2QLTA 3KOOA 3FVVA 3ZI4A 3EF1A 3I1YA 4Y2YA 5ALRA 4GXTA 3OCXA 1ZJJA 3SKXA 3MN1A 2O9JA 3QUCA 3QU7A 5AKKA 1VFPA 2R8EA 3KZXA 4NAVA 3A3YA 2GO7A 1TJ5A 3FPSA 3KC2A 5ALUA 1T5TA 4Y2RA 1RDFA 5AKLA 2ZBGA 4HAIA 4HGNA 3ZWKA 2WF8A 2FEAA 2R8YA 2FPWA 4B6JA 5A3RA 3NRJA 2I55A 1ZOLA 1Q91A 3ZTWA 1XVIA 5AM2A 3VAYA 1AQ6A 1X42A 2B82A 1U7PA 3QUTA 2C8LA 2ZXEA 4CF4A 2O2XA 3K1ZA 3QUBA 2W11A 2QYHA 4XOUA 1Z4NA 1T9ZA 3AR2A 2HSZA 2WF9A 1XPJA 5AW7A 5AM1A 4FFDA 3QX7A 3E81A 5AVXA 3IJ5A 3OPXA 3AR6A 2W43A 1K1EA 4G63A 1VJ5A 3MPOA 2JARA 2I34A 3W5DA 5AI5A 5AM5A 2CFSA 4DW8A 1Z4PX 4KX3A 3AR3A 4UM5A 1YDFA 2CFRA 4UW9A 4BNDB 1NNLA 3L7YA 1VJRA 3ZU6A 4DFDA 4Y2TA 5AIBA 3EF0A 1CR6A 4HYTA 5ALLA 1Y8AA 3L0YA 2C4NA 1TE2A 3FPBA 4UMEA 2G06A 1RQLA 4OD0A 4YIKA 5ALFA 4GIBA 5AVSA 3I28A 3WK5A 1TA0A 3ED5A 3L5KA 3I76A 3P96A 3ZUPA 1EK1A 1RKVA 1L7PA 4UU0A 1SU4A 5ALIA 3W5AA 1L8LA 2G09A 2HOQA 2ZBFA 2P27A 2G07A 1RLTA 5AK3A 4H1WA 3U13A 5E0OA 3KD3A 4Y2VA 3ZVNA 5AKJA 4YCNA 3U26A 3AR7A 3OCVA 1Z4LA 2W4MA 3WK7A 2G08A 2RAVA 2X4DA 5AW1A 5AKYA 1YNSA 4BX2A 3HLTA 2FUEA 4UU1A 3ONNA 3W5CA 3ZX4A 1N9KA 2MSNA 2I54A 4KYTA 4Y2UA 3PGLA 3AR4A 5ALNA 1N8NA 1L7NA 4FYPA 3BA6A 1RMYA 2HDOA 3OTQA 2NO5A 3A1EA 5AW0A 2JAOA 4ZEVA 3HYCA 3F9RA 5ALXA 1L6RA 5ALOA 2YY6A 5AICA 5IT4A 1CQZA 5AIAA 3ESRA 5AI0A 3N07A 4ZEXA 2GHQA 5AW6A 1RC8A 2EAUA 3UMGA 4Y2XA 2HX1A 4Y2SA 3NANA 5AVRA 4EELA 2NO4A 1YS9A 4L6AA 3QNMA 1RRCA 3D6JA 3S6JA 3ET4A 2OYCA 1MH9A 5AI9A 3UMCA 4C4RA 2P69A 1WPGA 2YFYA 3E84A 3M1YA 4AP9A 3GYGA 5AM3A 3U7FB 2D2VA 3QU5A 3KDPA 3WGUA 2YMPA 5ALHA 4YCLA 2PQ0A 3B9RA 4OFZA 3BWVA 1YMQA 4OHFA 5ALEA 4HGPA 3AR9A 4O8CA 4L6CA 2BY4A 1JUDA 3DNPA 3U7GA 1QYIA 4KNWA 4EX7A 4CE6A 3E58A 4F71A 3ET5A 4NWIA 2B8JA 5AHXA 3L8FA 4BX0A 4BBJA 4XQ0A 3WGVA 5AVTA 2RARA 1QH9A 4UMFA 2I33A 1ZD5A 2WHEA 3QU9A 2WF7A 2YMQA 2EATA 1EK2A 4HGRA 2AGVA 2FI1A 2PKEA 5ALPA 4PNHA 1Z4MA 4YGYA 5AW5A 2G0AA 2B0CA 4UAUA 3MMZA 2VKQA 3ZTYA 4Y2QA 5AKIA 1SWVA 1L8OA 1YJ5A 1U7OA 4IFTA 5AI4A 3WKCA 2HF2A 1IWOA 2ZOSA 4UATA 2CFTA 3N28A 2FPSA 5AVVA 4JDPA 3N5KA 1RMTA 3WKEA 5AESA 2OBBA 3ZWDA 2I7DA 1YV9A 3IB6A 1ZRNA 4YH1A 4MWOA 2BDEA 4NFLA 3U7HB 4CF3A 2IOFA 5FP0A
chains in the Genus database with same CATH superfamily
3I9V1 4HV4A 1I24A 4RCYA 2IIVA 4RQ4A 1PV4A 1Z1BA 2DGZA 3NDJA 1KAEA 1CXZA 4GZLA 1U4NA 4NZPA 2H0QA 3KPVA 5ALJA 2B25A 4LOJA 5JLJA 2WMOB 2PAFA 4ESEA 5DYYA 3PNPA 3E0FA 1KY4A 1S02A 4ZEWA 3W8RA 5BWLA 3UWPA 3OHAA 5M2QA 3JQFC 5DMXA 3DHYA 2BTQB 2UV8A 2OY0A 1X86B 4DT1B 3DZCA 5BN3B 1Z6XA 1Q1QA 1P0IA 2PU7A 1E60A 5EWMB 1KYIA 2GLXA 4EMUA 1SKBA 3DBHB 1HF3A 3L1UA 3DLPX 2H4WA 4EG0A 2F1HA 1E18A 3BD6A 2NGRA 4NARA 3IUPA 3U7EB 4KYUA 3VJKA 4P3NA 2J4FA 4LF7B 1U8UA 1ZS9A 4IHAA 2B6HA 4KWEA 4MMYB 4QZAA 3WLLA 4H1VA 4DLVA 3P9XA 3PPIA 4IR1A 3TRFA 2ZWAA 3G68A 4NE2A 2OYRA 3MR3A 1V6SA 5JNWA 2C2MA 5F3DA 1MNAA 3EGXA 1N2HA 2BBWA 5A4KA 3AHFA 3KJGA 2XMSA 3KEMA 3N7RC 3GIJA 3T7RA 1V43A 2HCRA 3BJMA 1C80A 1H85A 4OI2A 1TW2A 4M89A 5JWOA 5B5EU 3PFGA 3IELA 1NVVQ 2B4RO 3OCYA 1R8XA 2F8LA 3CUWA 3HDVA 1P2SA 1WSDA 1NVFA 1C20A 1GZSA 1P7DA 1JYEA 2J9ZB 2RB5A 4KB5A 3MFIA 4OOEA 4LSWA 5AVUA 5LQAA 3C6XA 2WF5A 3P45A 4WINA 2VP2A 4MULA 3RS9A 4F3KA 4X45A 2HB6A 1U5CA 5L1MA 4A27A 3JVEA 3V7KA 2QRQA 2C22A 1JEQB 3WLKX 2I2DA 1IBSA 5DP2A 2DAPA 3ZZ0A 4NLCA 5BW8A 5IDWA 2ZSIA 5EI5A 1PTJC 2V7VA 1E5DA 4HPWA 4MRNA 4YJGB 4UDYX 2Z1NA 1KPIA 1TU0A 7ABPA 3L77A 1QHIA 4X54A 4TGLA 4N5MA 1OFUA 2Z09A 1NQVA 1MC5A 1UBUS 3I4CA 3OIWA 3W4KA 2J6CA 4OUKX 4WKBA 4LSZA 4RQ0A 2B9EA 4UZSA 4I4TB 1ISIA 2WMYA 2ETXA 1ZOOA 5KTMA 4JVOA 2ZT6A 3GFKB 1TM5E 1GL6A 3E2EA 3PSIA 3RH5A 5HIMA 1L3TA 4EO9A 4YJFA 3KR9A 4M9CA 4IV5A 4LFCB 4EFKA 2KIWA 1YI0A 5ESXA 4AI6A 3V7NA 4NKRA 1XQ9A 3ZS9A 3ROMA 2P9BA 1B73A 5F51A 5JYDA 1O9GA 1JQDA 4URZR 2PMEA 3V1MA 3EDQA 4TUSA 4FM9A 2V4UA 2FR8C 5KVAA 1FO4A 4AJOA 2W55A 4XQEA 5CBPB 2QROA 1SUSA 5TZVA 4RPIA 2Q3HA 2BR3A 2ZS9A 3GLFA 2MIIA 2GETA 4ZKEA 2I7VA 5K51A 3LFTA 2Z2YA 3DF7A 3RV3A 3GAFA 2GEJA 3CEJA 4RNCA 2O8FA 1MA7A 1R9JA 2PWYA 1PI3A 4KOAA 4QG3A 3P2KA 4V0ME 3WB0A 3K0AA 1VPEA 4DFMA 2EBUA 2CYCA 5KTNA 3COPA 2MR5A 1S8NA 3PPWA 4LJYA 2NAPA 2KBFA 3P2MA 2YWGA 4D56A 1ZJYA 4DR3B 5B6JA 4DZZA 3W1EA 4UBOA 4DR7B 2KWIA 3TW8A 1XD8A 4JJ8A 2IHVA 1DOQA 1OZGA 2OLJA 3W90A 4RD4A 2XMGA 3TKAA 2QRJA 5AI4A 1JZTA 3R8XA 4BAGA 1A9SA 4KFRA 3N5KA 2REQA 2BHNA 2H3HA 4C4ZA 3F2VA 1ZRNA 3DULA 4FMBB 1THGA 3HM2A 3DDHA 1ENZA 3PW5A 1IZZA 3B1KA 8ICLA 3ZE1B 5FWYA 4AXXA 1DBRA 3LD9A 3WLOA 3GDOA 2HCTA 1CIPA 2IEBA 1JJVA 4DHEA 2PH7A 2JC3A 3D4IA 4C8OA 3M5PA 1E1QA 2NTJA 4LECA 4E31A 2YJ6A 3AM4A 3MJEA 1JJFA 4IDOA 1JQLB 1HG0A 4NJ8A 5DGIA 3NWBA 2FCRA 1AKTA 3QITA 1EUCA 4RD1A 3OEEA 1M74A 2G9UA 2JLWA 5ALSA 4F5PA 1N0IA 4UJ5A 5BNWA 1SULA 4GX5A 1OC4A 1L5VA 3A6DA 1RD4A 2AEJA 3F8TA 5TY0A 2K4MA 1ZHFA 3GV8B 4BLTA 3ZGXA 1I7LA 3GRFA 4RXTA 1KVUA 2R2GA 3LWLA 1CWUA 2JBWA 2Z8YA 3DKRA 5TPZD 3W5BA 1WWVA 4LXHA 3H9BA 3UH1A 1PGJA 2H63A 1T4BA 3AXTA 2H0RA 1DE0A 4CR7A 4LHYA 4ZZ1A 2H1SA 1VDMA 5BOVA 4CG3A 1Z5OA 3LDAA 1KTQA 1ZD3A 2I67A 4TV8B 4W9NA 3GVIA 1WW8A 1BOFA 3IG8A 5AVJA 5JWHA 4OHOA 4D57A 4OGWA 3WRYA 4LX0A 3BQTA 2J6BA 2ZIGA 1G98A 2NNWB 4X85A 5B2EA 3IA2A 4N0DA 3F5SA 2PKWA 4C7MA 4RJKA 3C98A 3EWIA 3O2NA 1N3YA 1ZRMA 4B4UA 4ZZ3A 3FI0A 1L5SA 4Y6QA 1V1RA 3UJHA 4CF5A 2EGGA 3ECAA 1H2XA 5EMLA 1RZ3A 3GRYA 3IQWA 3EF1A 2HW3A 4YRMA 4XB1A 1GL3A 1W2GA 1GCUA 1LVGA 2DHRA 2J3DA 4IIHA 3I2JA 1M6VA 5H70A 2XDQA 3R7LA 1NM5C 1HRKA 2EKPA 5JNTA 1K89A 4P54A 5DLYA 5K0TA 1P2VA 2IZ5A 3GFFA 1N5IA 3GJ0A 4RK4A 5GJBA 4X7PA 1Z7BA 2FQXA 3L2OB 3WV5A 4IS7A 4S1NA 1WL8A 2QUZA 4JJGA 4LG1A 5JDCC 4UW9A 2IMWP 4DSEA 3E2IA 3RAPR 2GBGA 4MRRA 3AU9A 3IVRA 4KMRA 1O0SA 3PT9A 1G21A 2Q9BA 4KN4A 4PPYA 2VDWB 4LF9B 1TUBA 4G5GA 4PYMA 1FYVA 1THTA 1QX3A 1X8KA 5IHXA 3F2DA 4ZODA 3QNUA 4B2LA 3G23A 3THYA 1CDZA 4O3FA 5IVPA 1ZQSA 4ZOEA 5P21A 1J20A 2AKAB 2XUAA 1K97A 2X76A 2CL7X 1YS7A 4KYTA 1TCUA 2WIFA 5AW0A 2EBHX 3H0CA 1WUYA 1H8EA 1E2QA 2B2NA 1XQ6A 3C1ZA 2DFDA 5DM1A 1EXMA 1PZEA 2PKCA 4R68A 5DTMA 3AC0A 1NNEA 1ECWA 4M76B 4CEHA 1LJ8A 2P7HA 1BA3A 4UDXX 2Y8EA 1W9HA 4LVOA 1EX6A 4H7PA 5CA7A 3GJSA 4MYSA 3TG8A 4UAGA 3KPYA 2ZBVA 3VR6H 2ZSUA 3I2FA 3M4ZA 3GUVA 2JPDA 1O87A 1LZLA 3CF2A 3WLFA 1JSLA 3X3HA 4TRJA 2JAQA 4KK3A 4ZYWA 4JGGA 4UBCA 3IE0A 1JWLA 3OQOA 5EZ5A 3M6KA 1A97A 1I2MA 5D7BA 2JV3A 4WXYB 3WLMA 3U49A 2ZKLA 2Z2IA 1JL3A 1PVQA 4X61A 3HVIA 4U3JA 1P2UA 1X7XA 1Z7YA 3S2EA 5JANA 3ID6C 4PTYA 1HYBA 2OO5A 3FOWA 3GOQA 3HXMA 4JQOA 1U2SA 5KIAA 4E12A 1CEXA 3S7ZA 3UATA 3NCHA 3RC2A 1Z7EA 1OJ7A 2XMDA 3ESXA 4A8EA 1K3UB 1BOOA 4JSTA 2H59A 2O05A 4FQ7A 1SNYA 4B31A 3T1NA 5IEJA 1RC0A 2VSFA 2DQSA 2Y76A 4X24A 4ABYA 2PNJA 2QRUA 2DF4B 2P4HX 3NJ4A 3LHSA 3PUXA 3LPLA 4QYWA 1UXHA 3FPEA 1U2QA 3C7AA 3BH6A 5KSOA 1E0DA 4XX1A 4WBXC 2EDUA 1F5SA 3J81j 2O4UX 4PHHA 1P5HA 2HRBA 4PLWA 1K6JA 3PDIA 2BM8A 4RIFA 3G85A 3LPNA 3DEIA 2NRZA 2O8BA 1ODLA 3EEFA 3ADKA 4OBBA 2FUCA 5ALVA 3ZVMA 4O59O 4EG6A 1UJBA 2J3HA 3L8MA 5JUWA 1EVQA 4B81A 4CEIB 1V96A 2BEWA 3PFHA 4MVJM 4F04A 5DM70 2IH5A 5AW8A 3S27A 4GNRA 3INYA 5ISMA 3FIJA 1SCKA 1P8JA 2DYKA 4R66A 1C0EA 2GXAA 2Q28A 3GLKA 3MT7A 4OH7A 4NK4A 4MCHA 5NLLA 2ZKIA 1KDZA 2CJWB 4RHFA 5CNJA 1V3VA 4GC9A 1C29B 3FZGA 2YXDA 3PP8A 3UMMA 2ZYRA 1J0DA 2EYQA 1JFLA 4J7CA 2DB3A 1RE0A 2GO1A 1Z8DA 1Q22A 4KO3S 2HHJA 4BYGA 1Q12A 4I9UA 1EGVB 2G72A 4BUCA 5CYGA 1BKSB 4NHEA 4W5OA 1KFBB 2O2SA 2CLSA 3CF0A 4Y2YA 1Y1QA 3NH9A 1ZQTA 1LX7A 3DR3A 4WCFA 4N3BA 3MD0A 5J0RA 5J9FA 1EJ6A 3DKVA 4HAOA 3GQVA 2YRWA 1U9ZA 1J5PA 3VV3A 4B9VA 1COWD 1SXJC 4PQEA 3O8NA 5E2IA 4X91A 4MUXA 1TM7E 2HBYA 2P78A 1TZMA 3ZGLA 1VPDA 1LQUA 4KO2S 1JT2A 1GO3F 3ZZNA 3HEAA 1FTNA 1XTSA 2RK4A 4FZVA 4LY9A 4QXMA 3BFPA 3I5UA 4QBGB 4MPDA 4X7RA 1KQ3A 4OMCA 3UNXA 3D2NA 3L0YA 3OTIA 1TV9A 3VR3A 3IHKA 1A9QA 1UQTA 2ZRGA 4RQ6A 5D4BA 1NONA 1IUPA 4O4LB 2BCVA 3BWYA 3OFKA 1XA0A 3WLIA 5IAGA 2ZRLA 5KOHA 4OUDA 5CVCA 3Q0IA 3HPRA 3NBXX 2RG7A 1MGPA 4TVSA 3LZCA 5BUQA 2BAGA 4BRWA 3TAHA 1Z0KA 2H7YA 9ICWA 3ZY5A 2CFCA 3SOZA 4WZAB 2FN4A 4DDTA 2H1VA 2AFIA 3OECA 5JSKA 4M46A 1KK3A 2HO5A 1FMFA 4KXVA 1JKXA 3DAYA 2UU9B 4D82A 1NQXA 5FBHA 3H1EA 5JCXA 1AMOA 5IANA 3FTDA 3EIOA 4DDVA 2M6SA 2ZYIA 1PEAA 3TIVA 3AR9A 1GQFA 4JC8A 1VIVA 1OROA 3DM5A 2QAGC 3CC8A 2WWYA 1QZUA 3MCUA 1PS8A 1N0HA 3C48A 2WVJA 3HUFA 2HT6A 2QW8A 2FTKE 3VCBA 1O94A 3QU9A 2JAPA 2R60A 1OXMA 3K9NA 2EYUA 5CXSA 4B7XA 2HJWA 3J81A 4U4AA 3RSHA 1LB1B 5CXUA 4HB0A 5J29A 4QYTA 1XTQA 4PRZA 3RVMA 4I4IA 3MBYA 3D6NB 1XMVA 1ULZA 1VL0A 2MJLA 3HKEA 2W70A 2E6KA 3OSUA 3BSYA 3N86A 5CVDA 2XGSA 3UQYS 2XUZA 5JS1A 1E4EB 5DKWA 3CRNA 4K40A 2C5FA 4LF4B 2XA9A 4CW7A 2W6MA 4KUGA 2PE5A 3DEAA 2XITA 1ATZA 4QQRA 3FH0A 3MJTA 2JHGA 4LBVA 1HLPA 2WYIA 2GFHA 2EQ5A 2CE7A 1B3BA 2JH9A 2WIAA 4QZEA 3AKCA 5DGHA 5AKXA 5AW3A 1ZJNA 4LHZA 4O4JB 2LCFA 1R74A 4GOKA 5IFLA 3BD7A 4J1NA 3AQIA 1QH8A 2H5EA 2OM6A 2VK4A 1XTZA 3FPKA 5FO0A 1ZX1A 5K3FB 5FNVF 5JCOA 5EUCA 7AT1A 1UBTS 4CIBA 3ELUA 2AU0A 3C7KA 4TQGA 1C81A 4JU9A 3C8MA 4RBNA 1QR2A 2G9VA 3C87A 2JJQA 4UTZA 2PFGA 1FU7A 1YQGA 4QVIA 2V3CC 2YIDA 8ICAA 4ALKA 3S8MA 3K70B 2BPOA 2OGSA 3GGSA 5CPBA 3K0FA 5KQSA 3U3DA 3AU6A 3V8BA 3ZE9A 1LKYB 3IKJA 4DAOA 4KVFA 1H5NA 3BKXA 2P62A 3EQ9A 3JY6A 4LKOA 4YCDA 1KNXA 2ZUCA 2M6KA 4PLHA 3QYAA 2PBRA 4DM3A 4TZKA 4UE2A 3G2HA 4IIVA 2XWPA 4IDHA 1ZM9A 3UOWA 3VDXA 3K75D 5JO9A 3BC1A 3ZVKA 2G80A 5CDYA 3AX6A 4DR1B 5BSGA 4R9SA 2CNBA 3BXZA 8ICTA 3SAHA 2NU6A 2JD0A 4IRXA 1B43A 2IFTA 3B7WA 3VR2D 2VC2B 5IMSA 4P34A 4ED9A 4FQ8A 3M5WA 2V6BA 3LA8A 2R8YA 4KKVA 2ZDQA 4OBXA 2QG9A 3SR4A 4IJWA 1U04A 3VAYA 3SHFA 4QPNA 3K1ZA 2W11A 2C77A 2PVPA 3OZEA 3GJRA 3L7BA 5C9ZA 1DB3A 3U5TA 1EHIA 1GGNA 5J2AA 3GIMA 1UHUA 2JFBA 5FH9A 4OEHA 1JE0A 1J2RA 1FFXB 1FP4B 3AFGA 2KM1A 3SBDA 3ZV4A 2I65A 5CIQA 2PXXA 3FKSD 3GX1A 3TSCA 1NVVR 1QG4A 1KGDA 3DZFA 2BN4A 5AMXA 4Q9DA 1HQYE 2FMSA 3AQ4A 1XEFA 5I4IA 3UTDA 2I03A 3VNRA 1UKVY 2ZRNA 1TEHA 3O9ZA 3BL5A 2X0FA 4DR4B 4J43A 2I2XB 5ED4A 3NYWA 2UXCB 4O0MA 5T4FA 3PJFA 4JQCA 1Q1BA 3AHDA 4KYIB 4JP2A 1OFUX 4RU1A 1R4MB 4HFRA 1YT3A 3RYIA 4C7KA 3LQQA 3ANMA 2B4AA 5KQPA 5KTSA 4IKPA 3PGA1 2HX1A 4W9RA 1SMKA 3K9FC 2J7PA 1DIAA 5AM3A 2DFKB 1JMSA 1PU2A 1NVKA 2WB1C 2R8KA 1CT9A 2YZMA 5A5EA 4QVGA 5TARA 1UBSB 2GCGA 3DP9A 1LGYA 4URUR 2C0QA 3NAQA 4U7PB 4K0KB 5LWHA 5JSQA 3I5YA 4N5IX 2E5LB 1Y5IA 3O2SB 4R5MA 5DWDA 4CFZA 4DNFA 1FSPA 4EW1A 3LK9A 4I1PA 4PTLA 1KI1A 3S1AA 4BQNA 5AVVA 2C94A 3WMWA 3AM1A 4W5TA 3OQIA 3N8HA 2MSWA 4ZCLA 5HA5A 1FX0A 3BMCB 3HS3A 2FLVA 3RSSA 4BC0A 1DJNA 5BN5A 2QLMA 3OKPA 5KNLA 3H2GA 3CZMA 5B58C 3TE7A 1W1IA 4BO3A 2ASEA 3KV3O 2B7LA 4AU1A 1FK8A 1Y6QA 1JAZA 1OW5A 3KSUA 1E7YA 1W25A 3C45A 4TSFD 3I9MA 4ESVA 3DEFA 3GEIA 5FO1A 1FZTA 5AOVA 1CS0A 4QU9A 3TJMA 1VSUA 2FPGB 4R40A 1ZJZA 4QQNA 5FUBA 3QBEA 4MUGA 1B8PA 2VUTA 1VIMA 3DGEC 1P5FA 5SZKB 3LBIA 1YQWA 1ZK1A 1X13A 3KXKA 2XF8A 4UUNA 1QU3A 4BKMA 3U60B 4P83A 1F2UA 4CIXA 3HILA 2J41A 1XVUA 3ZC3A 2NV0A 5D3MB 3PV8A 4ARUA 3GPIA 4A0FA 5E8RA 3AJEA 2X6TA 1UIMA 3U19A 2ZXHA 4H6PA 3OPQA 4D79A 1EVYA 3JARA 5K7SA 2BHRA 4WBNA 1ZQUA 3EBOA 4LW8A 1N1MA 3SC2B 2A4KA 4M1YA 1JJBA 5IPFA 5KQLA 2ZXUA 2FEKA 1E4VA 2L42A 5LP6F 4PZPA 5AO9A 1FDIA 3LUJA 4S24A 4DBVO 3D54D 1E3JA 1YQ9A 3TSOA 2RJ3A 3TLMA 2K4PA 1E9SA 2ZAIA 1WIWA 4CCYB 4MUJA 2OXCA 2QM0A 4EKGA 2FRDC 1RR6A 3N97B 3P9NA 3ABQB 5KFUA 4OQNA 4NYMQ 1H3NA 3ME5A 3VU0A 3F97A 2IHUA 1A0PA 1I80A 1RTTA 3SKXA 5HKAA 3QUCA 1NPTO 4LQDA 1ZIDA 1NU8A 3FKQA 1WU7A 3TZEA 3PIRA 2V6IA 2YOFA 5HGJA 1ADYA 3CCBA 4JBNA 1WB9A 2F59A 1M1ZA 2PZJA 2SKEA 4PL2A 1N5JA 4LDQA 4PQYA 3RPEA 4Q12A 2A1UB 3OQNA 3CIFA 1XLVA 1G55A 4OFBA 2Y93A 4AF7A 1CERA 3AUYA 4D46A 1RSZA 2G7MC 1V39A 3V4SA 3CH4B 1HWYA 4XRGA 2VSOA 4RGQA 4OM7A 3NHMA 4DQVA 3RVBA 1PR1A 1ABEA 1A5ZA 4L85A 4M6WA 1FUKA 1RU3A 3WK5A 3SV3A 3FMVA 4FX2A 2VHZA 4C0QC 3FAZA 2V6MA 3B2QA 1ZK3A 4WESB 3IAXA 1SC4A 5BVGA 2QTBA 5CFZA 3JQGB 3KB2A 3SZ3A 4NBUA 5DEIA 2BM1A 3TFSA 1KYVA 3M4YA 2ON6A 1ZVQA 1VLBA 3D4BA 3GEEA 3GGCA 2QZZA 2NRXA 1LH0A 4AWXA 3W9YA 4MVJA 1E3MA 4MRMB 1EUYA 4UXHA 2HLDA 5KDLA 4HFNA 2GCOB 2IDZA 4MWBA 1N63A 2DWCA 1G20B 4I2VA 1AX9A 3L0SA 3ZIUA 1EWKA 2OAP1 4G1BA 1R0XA 4FU0A 2O8CA 1BWPA 2JJ2A 3G9UA 4XEUA 3DZGA 4DQLA 2K4EA 1ZGAA 2B1JA 1LTKA 4UHEA 3L8FA 4XQ0A 4YRGA 4P0QA 3MGIA 1V7ZA 2A5YB 2ISSD 4O4IB 5T4HA 4PXSA 3VZRA 1IBMB 1JG7A 4TV9B 2VDUE 2F3NA 1KEWA 2VANA 4EH1A 3K8YA 2XYHA 3QVVA 3H9QA 3KHLA 4BPBA 3L06A 3R7SA 2XHEA 1FNBA 1S0UA 1EM6A 3G6KA 3R24A 1RWPA 4J0IA 3ZVRA 4NAUA 4I1YA 4EQ6A 4KUHA 4ZK6A 1DXHA 2QX8A 4I2AA 2X9QA 1IEXA 2NV6A 4RKQA 2A86A 2WU3A 3TZ6A 4QZ9A 2ZFUA 2Z04A 4YAFA 3ZYZA 2QP9X 4DCMA 3M7DA 2WM8A 4QW8A 1ZM2A 4R1QA 3AHEA 1QTMA 2C3PA 4DSKA 4JI1B 4WKGA 5A1JA 3K53A 2WAXA 2CVFA 2D59A 2IY7A 3CNEA 1WDWB 3FGPA 3QU2A 1XJ0A 4OYLA 3EIHA 3T8YA 3ZU4A 4D8UA 3LQ2A 4EZ6A 1X2EA 3HCOA 1RXIA 3BQ2A 3TB4A 5EPUA 3H1FA 5HK8A 3MBOA 4RGVA 2PSHA 4F4WA 4MP8A 5CW1A 4YJ3F 1L4UA 1P2DA 4V0SA 3MMPA 3CVJA 4BX9A 4KQEA 4MV6A 2GRJA 3I34X 2BQ3A 2XLCA 4Z0NA 3WKAA 3H5NA 5LSAA 3BJYA 2R62A 4U2KA 1G3QA 3OE5A 1GO2A 5KI6A 3MGHA 4BWVA 3FFXA 2P90A 3WIVA 5YASA 1V5EA 1O6BA 3GFTA 5GVSA 3QSGA 2YFQA 5JAPA 3CUSA 1JFFA 3GP8A 3HVUA 2FSIA 2AXEA 4HWTA 5AVQA 3KQLA 3WMGA 4MQUA 2F62A 4N6GA 4UVHA 3JATA 2VYFA 1CNMA 4PZZA 1GEGA 5IT0A 2CL0X 2MHCA 4YRPA 2R44A 4Z9XA 1GGFA 1XHEA 4JK3A 5K8JB 8ICHA 1JLLB 4WDQA 3GVPA 5FBVB 4RYLA 5CFOA 2HBLA 2O3RA 1Y4UA 2XTNA 4OQXA 3FSGD 2VP0A 1E1CA 4OJOA 1K1SA 3PA8A 4YO7A 3Q1KA 4RVOA 2NV2B 5ESDA 2G88A 2P65A 3ILSA 4YBRA 1XCJA 1Y8ZA 1X7ZB 2W42A 2XQIA 2J67A 4DV4B 5L7YA 3T4XA 4UVIA 4JLVA 4WE3A 2FMKA 1ICIA 2V4MA 3HPOA 2EFGA 2QW1A 1GRVA 4WK4B 1W4AA 1RADA 4Z3OA 2CLKB 1WP9A 4DMFA 4FBLA 3VHXB 4GQAA 2A4MA 1YDGA 3M3DA 2AL7A 2F48A 4LJRA 1W6RA 3S55A 2D5LA 4GMDA 3ISBA 1GZDA 5EUQB 1K6MA 1EWQA 1HO3A 5IKMA 1B42A 3UVEA 2V3WA 4QELA 1OWOA 3I76A 2ONJA 3ZUPA 3GRCA 2LCQA 2O3SA 2J0UA 3G9ZA 4Y6SA 5T6BA 1U5BA 4CQMD 1KQQA 4MKHA 1Z4LA 3F7NA 3O8QA 4BO2A 2G08A 2PK3A 2C61A 4RE6A 9ICMA 2BQUA 5IJZA 5G0SA 3V1LA 5CVVA 3PGLA 3IESA 2BMAA 1IBLB 1N9GB 1LBTA 3EC2A 1YZVA 4OQDA 3NOQA 1SVUA 2EWWA 1KSJA 3QYFA 1Z68A 4XTCS 2BUCA 4BNKA 3BQMB 2D0PB 4ZZIA 2FQYA 4EG7A 1OX5A 1T5DX 4U0JA 2OYCA 2IK8A 4BNGA 1JAHA 1UAYA 3UKJA 5JFTA 1Z35A 3PC6A 1ZN9A 1JUDA 2JFPA 5JD4A 4IMJB 2CV0A 1S89A 4BBJA 4C0LA 2UYOA 2O23A 3LQ4A 4F4JA 2GF2A 1OLSA 1H2EA 1DU4A 3K9BA 2FMPA 4PNHA 2H2AA 2PQ6A 2CXPA 2B0CA 4EB0A 3WFIA 1YJ5A 3IAEA 3FRJA 1NTRA 1SVLA 3C3AA 2KIVA 1A8IA 4BASA 2LCIA 3GW8A 4ZOLF 4AS1A 3VYWA 1PJRA 3A3PA 3ZEIA 3DZDA 5TIIA 4G0MA 3GAZA 1DKPA 5K09A 2G9NA 1X7WA 4ZC8A 5K8LA 4IZ6A 5IUNC 1CY8A 3PQ6A 5E2AA 2AZ4A 3JQBA 5JPDA 4TRNA 5IZ4A 2EARA 4IGEA 2ZVJA 2BDUA 1B26A 3QXXA 3L46A 2F67A 4JR2A 2Q0ZX 3ROZA 2HJ9A 2O2JA 4R83A 1KKMA 2H2GA 1KYZA 4W1QA 2VJAA 2F55A 1Q2XA 2DE0X 4HUTA 2C5EA 1N2BA 2DJ5A 1XU4A 4JN6B 1CQPA 3S40A 3KEGA 2OK7A 5FL7A 1PQYA 4F9FA 1MN6A 5DHPA 3GLGB 3K8ZA 1CULC 3R75A 1IWPB 1DZIA 1NBEA 4IXNA 3UQ2A 4L5BA 2DVMA 1KO7A 2XGPA 1S2MA 5CDTA 4B6QA 1SRRA 5TMEA 5DB7A 1SC6A 1RI3A 2W9AA 2CBZA 5F1OA 3OZFA 4YCSA 3AF6A 1OCEA 3WGIA 2BGIA 4E1AA 4UZFA 4ZO8A 2QTVB 3IAS6 3A0HU 2O8EB 3AEZA 2YJ4A 4WOCA 4GGOA 1ZZEA 3H0MB 3K31A 1E32A 2Y9MB 5J1TB 1X7YA 2IUEA 3RD5A 1XNGA 1RYRA 2CLFB 1D9ZA 1CR2A 1WBBA 3WHLA 5LNK1 4UOQA 2ZBDA 4W7IA 4IOJA 4N6NA 1E2BA 4Q4AA 2JCBA 2C5BA 2NYAA 4XDYA 1GITA 1T4DA 1QF9A 3HQ4O 2ZIVB 4MUEA 5F5LA 1Z8NA 1Y34E 2BJVA 3RC1A 4DUPA 2QX4A 4EYKA 2ALZA 4L9RA 3UWDA 3BZWA 2ZUSA 3AEUA 1QTIA 1T5TA 4UHDA 1CUDA 1KFJB 2CLOB 4RVFA 3V1TC 1N6NA 1Q91A 3QI2A 1ZQ1C 4BYMA 4AF6A 2I66A 1GQRA 4DFPA 3DB1A 3HU1A 4Y1GA 3KQTA 1GNSA 3H4TA 5BSFA 5J5AA 2JIMA 5EE3A 3EISA 1WCIB 1GSOA 1XJWA 1LFAA 3SICE 3RAJA 1GNVA 3DWFA 1XTIA 4UC0A 2BFAA 5A03A 1E5VA 2QI9F 4LJXA 3GB9A 1E92A 2QU7A 2AN4A 3V2HA 2IY9A 2W9BA 1L5WA 1ZI6A 2V58A 2PUGA 4MWZA 5HYVA 3ZV6A 4LXIA 2R4TA 5HQTA 4KRGA 5E6UA 3RR8A 3BH0A 1FDVA 3W5AA 1L3VA 3GDXA 2BEJA 5DULA 4DBLC 3MMNA 3EXHA 2YZ2A 1YE5A 1UKBA 1SL2A 1NJ1A 3IPXA 1KMHB 3L7KA 3CG0A 3AP2A 1R0LA 2AEMA 3SEFA 4IEFB 2EZTA 1HE8B 1XPRA 1RMYA 1IJFA 3QLJA 2IYYA 3EGDA 5KVQA 3R3XA 1MB9A 1P9RA 1TLTA 1XEXA 4K9SA 1E3DA 4IF6A 4GOLD 1E6MA 1M2KA 3D2QA 3EC7A 2BGTA 3T5AA 1JQJC 4GPIB 4RMHA 2QN9A 2VDNB 3PXUA 5DBAA 4IIUA 1DELA 4RTLA 1R0WA 5J2TB 5K8VA 4AMYA 2EIHA 1US8B 2ATEA 3R4VA 1FA9A 4A73A 5A05A 2IEYA 3KHSA 3MGBA 3SQLA 1IAQA 4ZCMA 2YV3A 1U4BA 3H83A 2H4JA 4N49A 1NGSA 3FXAA 2VH5R 5DWVA 2X2PA 1RHKA 1V85A 3CO0S 3N6XA 5IP5A 2QY9A 2R6FA 3FBWA 3U0VA 1LF5A 1PO7A 4I8IA 3NORA 2QTCA 3IEIA 3QOXA 3MZ0A 3K1JA 4IDEA 3LKVA 2P9JA 4ND1A 4Z2YA 4QIWC 1JDPA 3RKRA 4KE6A 2WG1A 4J6FA 2QL6A 2JFYA 4GP6A 5FPTA 3CRMA 3KJZA 2FDRA 4EF5A 3MJDA 1CD5A 2FLPA 4O5CA 2PQ2A 2C5SA 1I51A 1ZCFA 4GM4A 3M6LA 5EE5B 2IBSA 3SF8A 1KZYC 3V1KA 3JQAA 3ZH9B 4ZALA 3BDPA 2XUOA 2DG2A 1TIPA 4B3GA 2H85A 4B2YA 1ZI8A 4WH0A 4YD2A 1SPXA 2QGFA 2OBXA 2AHOB 2CE2X 1O03A 1E3WA 4Q16A 2IHBA 4CN8A 4WRRA 1FTQA 3AEKB 4BQEA 2PCLA 1OA0A 1WDKA 3MILA 4AMUA 4AG6A 4NP6A 3FCCA 1XAGA 3NIDB 3TI0A 1B6TA 4YQFA 5KVSA 1AB5A 3LC2O 3IS3A 4R2XA 4HQFA 1D03A 1V1MB 3PWZA 1TJPB 2N3ZA 1NKVA 4MYTA 2ASLA 2NACA 4Y0VA 2CHVA 1K1QA 3PVSA 3R5KA 4D9MA 5JS8A 1NMEA 1OI2A 5HM6A 1XRMA 3HZZA 2HA2A 1Q0RA 3U48A 4HR7A 1XUOA 3RVPA 5I7HA 1U9IC 1Z73A 2WRZA 1DAHA 1XC7A 2IDKA 4NTZA 3ED1A 5CAEB 3LGSA 2FZVA 4L15A 4MV8A 3EVNA 2IYTA 3L93A 3HWRA 3RFFA 2R8JA 2FZ4A 1QIEA 1R5NA 2Q4DA 2PS1A 4A8TA 2RKWA 2ZUWA 3M9XA 2XCRB 5DBEX 3JR3A 1RWWA 3KZCA 1U8ZA 1L9XA 3VNBA 1XJCA 1EKXA 3KT8A 1HOTA 2CDRA 5A0VA 2W0SA 3JXEA 3NVDA 2LR0A 3M3HA 4C0WA 1H5QA 1JHMA 2EW2A 4HGNA 1LSOA 4IQVA 4WN9A 4KR0A 2F1RA 4MRPA 3ST7A 3KLBA 4Z4FA 4LIPD 4TXHA 3KSZO 4AIRA 4N5HX 4AKSA 3NONA 5IBQA 4ZI7A 3CV3A 4JR1A 1A9YA 2AV6A 3ICQB 3QWHA 2FFHA 5MDHA 1X8JA 3PXBA 1OB5A 4JASB 2BGWA 4QGSA 1P81A 3V9PA 2V7XA 2RHDA 4P4LA 4Q7QA 1GZ7A 1JR2A 3RAQA 3FOBA 1RLUA 4M0FA 4NSNA 3ZWOA 4I81A 5EMNA 1IY2A 4MWSA 4Q18A 1WF3A 3ER9A 4H3KB 5ALFA 5A4AA 3GRKA 2YHIA 3RC7A 3VU1A 1TAMA 1UZAA 3T3OA 4B6EA 2A9QA 2GH1A 1SBZA 2PT6A 3M6AA 5G53C 1XWWA 5EUBA 1P4GA 1D8LA 3EB9A 4FNMA 5KYVA 5DYTA 4NQZA 4RZXA 2DTXA 3BEDA 5EMKA 5DB4A 3DTVA 4NYMR 2OV4A 4PCVA 2ZYAA 1YNSA 1EWTA 4X90A 4AKHA 1T0PA 5DSZA 3KFVA 3C70A 4MIKA 3SN6A 2QAIA 1RRKA 4KXFB 2IRWA 4N47A 4COOA 4DR6B 1NBHA 5LA6B 4KXQA 2NO0A 1FP6A 3EPGA 5TQVA 2BPFA 1MF7A 4EG3A 4RQ3A 5CCXA 3N8KA 3AIOA 4HUQA 4B4DA 1KBUA 5F7XA 1XRQA 4TYMA 2QGZA 5KJ6A 2G9QA 5IJ9B 3CRW1 3N5CA 4EQZA 3I8SA 4FOTA 4DJDC 4FYVA 4U8HA 4DLGA 2ZZNA 4ZI3A 1X9XA 2AC4A 2ACKA 1TA9A 4G1CA 1NP6A 1DKOA 1W1UA 3BDVA 4CMIB 4EX7A 1YDHA 3PFWO 3O91A 5FWDA 3RFVA 5G5HA 4A36A 2C4MA 2V9PA 2XWBF 1G6OA 3ZZUA 3THWB 4K8RB 5L51A 2XOXA 4HX9A 2TMKA 4CKEA 2NO6A 1G8GA 3FNQA 2CUNA 2HUNA 1U6IA 4KSYA 1D2NA 2OLEA 5LCXA 4WY8A 5HF5A 4E09A 2QENA 1G4AE 8OHMA 3RSZA 4ECRA 2BBTA 3DPUA 2IS6A 1B2LA 2Q6TA 4MF2A 5T4BA 1Q0ZA 3W5HA 3RAGA 3VRHA 2CWDA 1A9TA 1XD9A 4ZO4A 5JQGB 5L3VA 3G6VA 5EIAA 1F8GA 2I0FA 4Q66C 1C7RA 4HRAA 1KGSA 5TRTA 4N82A 2VT3A 1T3GA 3BN3A 3V1YA 2X8LA 4RZQA 8ICMA 1SIWA 2H1LA 3PF8A 4JUIA 5BUCA 2YIMA 3ZJ5A 3OT4A 1TZJA 3DE7X 3SZRA 3H2JA 4JENA 3CZ9A 5AVZA 2CXXA 1LTQA 1MORA 1WF6A 5DT2A 1NHGA 4D96A 2WNSA 4CNQA 4F8RA 4ICAA 3AESB 3EH2A 2Q8NA 3GGPA 5SY6A 3NIWA 3RS7A 1P4JA 5K3DA 4WDRA 3OLWA 3OE4A 2G67A 1YTLA 4D25A 1ZQWA 4Q02A 4CLOA 4Y1FA 3OM8A 1N8TA 4WXPA 5CIWA 1MVLA 1WABA 2MYPA 1TJ3A 3N8DA 5HBRA 3NWPA 4YPOA 1Z0DA 5CJJA 3VVCA 1WZIA 1NXSA 3QIVA 4JVSB 2XSZA 3G5LA 1EQAA 4NBTA 4EY6A 4YV2A 1GCGA 3AVXA 2X42A 2G0NA 5P8WA 1D8AA 5DN9A 3UK7A 5JRTA 2O1WA 4XCVA 4H7KA 1IM4A 4ZVOA 1RXCA 3SIWA 1NVGA 2AFRA 3GT0A 4LJLA 2Q99A 1MT3A 1JU3A 1O97C 1KLNA 3F6EX 5I7WA 2CJFA 4S2UA 2QV7A 5G41A 2RHJA 4ZVQA 5BOSB 2VF5X 5ULLA 1OY1A 2X9VA 3ULKA 3Q8WA 4YAEA 2DFVA 1OV6A 1FUEA 1QIHA 3ZJYA 2WG2A 1KSGA 3BSWA 1M6EX 5BSRA 2ENUA 4OXQA 1MX5A 4CUKA 2WIBA 4XGIA 1BA2A 4O2RA 3IQZA 5B1EA 5CFNA 1NZFA 5EJ8A 1IONA 4G5RA 4CI9A 2VYND 5FUMA 3AI7A 4QZFA 4WD3A 4Q3DA 4B0OA 2WDZA 3C4JA 5EXEA 3BM5A 3HRIA 1XNJA 3BHIA 2YDXA 3UMFA 3S8EA 4Z9BA 1QGED 1VB5A 2W6ZA 1AURA 1BHJA 1U0JA 5CT8A 3G0CA 1Z38A 2OZEA 1P2FA 5LQCA 4BNDB 2C2RA 2ZJAA 2ANBA 2A84A 3KWJA 2QZSA 4YUYA 1QYXA 3R6GA 3VDMA 1XSNA 3QW2A 2A8YA 2JHCA 1EM8A 4P4PA 1KOJA 1USIA 2Y1OA 1J4AA 3HM9A 2PKRA 2UZ0A 4E5MA 4Z2AA 1MV8A 4P0TA 2QL9A 3E7PA 2F64A 3UAOA 3GELA 1XBTA 2WICA 3ABZA 3MMXA 4N12A 3DKKA 3RJZA 1UMDB 3ITNA 2OB2A 2GN2A 1VL6A 2JLZA 5MFPA 1QDEA 2RFLA 1CJCA 3KD2A 1W4LA 3K2BA 2FW7A 3DDWA 3DEJA 2YHAA 3UAVA 3CCFA 1P19A 1J1ZA 2BLLA 1ADJA 4Z49A 2ECPA 1JBKA 2ATLA 3V2GA 3PVZA 3WBJA 1CJBA 2XVAA 2P5UA 3A8TA 2B20A 4DZTA 2CL6X 4XWWA 2PS9A 3IDZA 3RK4A 4S1WA 2UZ4A 4RH0A 5FJJA 4P2GA 2BUBA 5DHAA 3THXA 4HNSA 3AOEA 4QYMA 4BU1A 2FP4B 1CUHA 4HXYA 3BZKA 3WGVA 2QWXA 1RXUA 2QRGA 2VRBA 1E2MA 3V6HA 2GD6A 5LQRA 1ZD5A 2GN0A 4L74A 2VYQA 2ZRAA 4O3SA 3FCOA 1U3WA 1KK2A 1UBNA 4YCAA 3V8NA 4QWAA 1BDMA 2C82A 4YV0A 4JCOA 1SC1A 3CFYA 1KZ7B 3Q7TA 2V8BA 4JLDA 3OQJA 4YD1A 5AKEA 3PKZA 3HXPA 5JVDF 5DB6A 4UHHA 1ETUA 1MKYA 1Z4IA 4G8CA 5AOAA 1C7YA 3FVTA 4RIHA 2B1RA 2Q46A 3U6BA 4B8YA 4WLUA 4GI7A 1QO0D 4HX2A 2XWQA 4UBJA 4KLNA 2BHSA 1VXOA 2C4WA 2YWJA 3KEOA 1UEJA 3AFMA 3DEYX 2D6FC 4QPJC 4YDHB 1TW3A 3W8DA 4E4RA 4YCXA 1E7SA 3EPHA 3DL0A 3RI3A 3IPYA 4A8JB 3O8OB 4B87A 1XS9D 1P1RA 1S2GA 2V7QA 4MW2A 1ZVKA 1U2TA 1QG6A 2IPMA 2WIGA 2C29D 1DJLA 4P2HA 1SUEA 1OKKD 1KFEB 2H31A 5IVIA 2EEPA 1BPXA 3MRTA 4BMPB 2OSVA 3MUFA 4AKGA 1W93A 1BXKA 4J3JA 2XUPA 3DOJA 4I2FA 4DLKA 4XFKA 4ACAA 5AK5A 2TYSB 4AJPA 4CU2A 4Q9NA 4OI1A 3GCGA 4WFIA 4TLDA 1MAHA 3WWZA 2LZ0A 4DV1B 1Z15A 4R9NA 1IUOA 3VKWA 5CEEA 3G0OA 4ZARA 4DCNA 3C3EA 2PUAA 4JB3A 4TMTA 1BD3A 1BGVA 4E94A 1SEPA 4FDTA 1UKZA 3O90A 1X9WA 1NQUA 2HK6A 3G2QA 4U7CA 1VA4A 4RF4A 3WLPA 4EHIA 3SI7A 3C5WP 2XTZA 4DM4A 4XWKA 3RRGA 1ZICA 4ZVMA 3QEMB 2WR8A 1DADA 5ALQA 4P0PB 3MELA 3E8MA 1C3OB 1L7AA 2D0IA 3KR0A 1M8GA 5FUVA 3NKFA 5REQA 4MK4A 2UUAB 1SXPA 3GR6A 3NHPA 2G63A 2QRLA 1EFPA 1OI3A 2RQ5A 3FYCA 4K9PA 5JV5A 5A3RA 4B44A 1TM3E 4HFJA 2XRMA 1QB8A 1KY2A 1WSBA 1RZTA 3ICPA 5TVKA 3D4LA 2QYHA 3KP1A 3C8DA 3GWGA 3DUFB 4RJTA 4MV9A 3BQ1A 4LDAA 1V48A 3G6YA 1BPDA 4F6RA 3O1HB 1Y8RA 4ETWA 1BMQA 4DS5A 1F51E 2ZJ7A 1MC4A 1WUJS 2IHMA 3FN4A 2BEVA 2ZRHA 1S0MA 3GZNA 3BAFA 3GMSA 1N60A 5K0NA 5EMJA 3PR3A 2I1VB 1EZZA 3OI7A 1EVJA 1NOIA 1QNFA 3TRDA 4YRFA 2PMZC 3EVAA 4WERA 3ECSA 4MYDA 3QYJA 5AXAA 4LZAA 2P6PA 3QK7A 3ONFA 2E18A 1AD2A 1ODFA 1K5OA 2ZJ1A 1Q0HA 4X3PA 2YV4A 3I2HA 2AOUB 3EA4A 4MZDA 2F3TA 2BGMA 4ZK2A 8ICJA 3OCJA 1NX6A 1N2JA 1ODIA 4TQUS 3E4DA 4D80A 2VL7A 1BEEA 2W9CA 4Y2SA 3MAJA 3P2JA 3ZHQA 3FYUC 3E84A 1IQ0A 3K0KA 2J3JA 3L8YA 3KTFA 3QKRB 1HFJA 5JROA 3AV0B 2RBGA 1XLWA 2VJ5A 5CH3A 4C7JA 5KT7A 3KTAA 5EWEA 2MRLA 2K8AA 1W52X 5GMOA 2DHQA 4KQWA 3MWEB 1WU8A 2FG6C 5T7BA 4LNUB 2VUIB 2QQEA 3FAKA 1KFCB 1X9IA 3AMZA 5H80A 4AO8A 1B0XA 1TRHA 3L05A 2HF2A 4LC9A 1UQRA 2K8CB 1TRKA 5J4HA 3H8MA 1L3SA 1VRVA 2BGRA 3GAMA 3EZ9A 2IOFA 2FSVC 1F60A 1VL1A 3RBEA 4C6TB 1YR8A 1OPXA 1U94A 3IKLA 3TQOA 1JH9A 3HN7A 2D8CA 2ZBUA 5C35A 5EIBC 1MT0A 1NJSA 3NKLA 3P20A 2PWPA 1TQHA 1SKMA 2YFHA 5J4YA 4YMWA 2KLBA 1HT2E 4HO1X 3NVYA 2GKSA 2EHDA 2FOLA 4RGBA 1RYZA 2YZKA 5DDIP 2IA5A 5DYWA 2YBDA 4E3ZA 4B3SB 3T3EA 3MRSA 1L5UA 4PX3A 1JECA 2GPBA 4A1FA 3T35A 2I3DA 5AH0A 2RGNA 2XBLA 3NI2A 3D7MA 1HX7A 8ICSA 2HHHB 3LG2A 1RQGA 4LJKA 1WW2A 1B00A 4C2TA 4ES6A 4JV5B 1MJGM 3MTGA 1CRZA 4DLBA 2QIPA 1U1IA 4NV1A 4GW3A 4UMDA 1E2FA 1Z2AA 2X13A 4MRVA 4KIWA 4Y0AA 1ECCA 3ZXSA 3BMQA 5KWVA 1IHOA 4JJIA 2NAFA 4KO4S 3A6FA 4H7JA 4KXLA 4B6RA 1QG0A 3ASYA 4CKBB 3OUUA 1TTPB 1GL7A 3FOCA 2BVNA 4LVCA 4PHFA 4FKMA 1KC1A 1PZGA 2JJYA 3TK1A 4KLEA 4GKBA 4KI7A 4RHTA 2P6UA 2VQEB 1C1XA 1OZ0A 3GBSA 1GPUA 3DZBA 2VLBA 4QLAA 1Z16A 5DXJA 2YJNA 5HIIA 3DLAA 1NU6A 1FYEA 1O89A 1OXBB 2XOKD 2ZS7A 2BFOA 3FCEA 3QU4A 4HAXA 5H02A 1T0IA 2OOSA 1VFNA 4DCCA 2Z2KA 4KGZA 3K4GA 2HU8A 2ZB8A 4JJ6A 4NI5A 5G4KA 1ND5A 3M7IA 2PM8A 4WVLA 3AJRA 9ICAA 3WLHA 1LC0A 1TYAE 2RHOA 2Q1YA 3OA2A 1P1JA 1P1FA 2YL2A 1Q6ZA 1QP8A 1JIQA 1PZMA 3Q1LA 4Q7MB 4M4SA 1XPJA 1NNUA 3N9IA 4RNNA 3AR6A 4DYVA 2JIZD 1KQPA 3D5TA 3WJAA 3OETA 1KJQA 2K89A 2IZ6A 4CDGA 2I2BA 1BN7A 1K5HA 4ANFA 1Q16A 5KNBD 1KAMA 1KMCA 3BILA 2GRAA 1AS2A 3GCWA 1UZLA 1T6YA 4LE0A 5A9SB 4EHLA 3KYCB 1N5WA 3A6HA 4R8VA 1JU4A 1BEUB 3UGKA 3STTA 5IZCC 2NQ2C 5I7AA 4BNZA 1GYRA 3G82C 4GZ6A 4RF3A 1HE5A 3VR5D 4RPZA 5AP9A 1MG5A 3W2EA 1V41E 4PHAA 5KG2A 5FTMA 4FYMA 1TKBA 5AW1A 1XF9A 3DE2X 1MXHA 1JI0A 4A6EA 3U1TA 2YHUA 3AR4A 2ISOA 5KL8B 4Q9LA 1IOWA 3JWPA 4TUYB 4KBYA 2VNHA 2QVYX 1CUEA 1EB9A 4Q7EA 3CGWA 1G8YA 1P62B 1AO0A 4OQEA 1QH1B 4QZBA 1BWSA 2GHRA 4RTSA 3QPAA 2OV8A 2CHGA 3KKOA 3BIFA 4FD3A 1PQUA 3II6X 3H13A 4GWKA 4CQLA 3WGLA 1QBKC 4QUAA 3GH1A 4PQGA 3TQHA 1Z13A 3FNRA 2V5AA 3IG5A 3ZIAA 1W4BA 1W49A 1J2JA 1KDYA 4ZT4A 4DQSA 4J29A 4YDRA 4FMCF 3PK0A 4MARA 3NGDA 2JA2A 4DWVA 2VZ8A 5AW5A 1GQQA 4LOHA 2QVZX 4LGVA 1R9NA 3PQ7A 1IWOA 3EAQA 3C1AA 4UATA 4JA0A 1RCFA 1NUPA 1XN4A 1VL5A 4INJA 2LDBA 1PYOA 4JUDX 4RZIA 1QXSA 2Z8XA 4EY5A 1YA4A 1P80A 2H08A 4QC2A 5K8TA 4QYXA 3TL6A 5KKCA 3F74A 2MMCA 1ZSNA 1EP3B 4FI3C 3TZLA 1JLHA 1HKUA 2RHBA 1CY0A 1YFZA 1HH4A 3EF3A 4JMPA 1FL9A 1MQSA 5EERA 4NENB 1JMYA 2PV7A 3P0IA 3MS2A 4QWCA 2MYTA 1E3SA 3NKVA 3CVXA 4OJYA 3UW3A 5SYMA 1RAIA 5GP1A 1GZ4A 1O9HA 3L18A 4ZGBA 4PGGA 1TAHA 2LM1A 3GLSA 2VPQA 1QRUA 3MBKA 4JUCA 2Y0SF 3HXKA 1DIBA 2JNWA 1WVIA 1EHCA 4NBLA 3JQ9A 3STYA 3B38A 4X92A 1E0JA 1SHKA 1YCDA 4I4CA 3SJZA 2DP4E 4WBNF 4ECAA 3FYHA 1J7KA 4KWHA 5GPBA 1G64A 4IG4A 3HJFA 1U31A 4RSGA 4GVLA 5E6SB 2J45A 2B5VA 2OBMA 4Z1OA 5ITVA 4CM4A 1YJ8A 1M6WA 3QJYA 3TXYA 3C21A 3HKDB 4KMOB 3QG5A 1CQIB 3AF4A 1X1DA 4N8SA 4EDFA 2C2BA 1IIRA 1ZXBA 1HSZA 2QTGA 4AY6A 3VR6A 3PNBA 5KMGB 3PJGA 2X0RA 2R6CA 3HCNA 5LIPA 2XNKA 5BQOA 4XYBA 4NATA 1KPGA 4HS4A 5KT2A 1IXSB 2W8KA 4LXUA 4RVHA 5J4LA 4MVJG 2GHTA 3SC4A 3BJIC 2WT8A 4PYOA 4QTTB 2W7OA 3CVYA 3ZDBA 2C42A 1PLKA 3LGAA 1UBKS 3LBHA 7ICVA 1PLJA 3L49A 5CJ2A 5AOCA 4AYBF 4KXUA 2E1FA 1IHUA 2IW3A 4ASUA 1A82A 2JATA 1I2BA 3KUUA 1AS3A 1W73A 2ALJA 3BYZA 3EQ6A 1ULTA 4IIJB 2FEOA 1PK1B 4CMEC 4AROA 3T61A 3VXKA 5H81A 3E9DA 1FYDA 3NQ41 3L6UA 2O2CA 3CINA 3UIEA 5AI5A 2C58A 1TK9A 1H0KA 1DKNA 3C24A 2PT9A 1YDEA 6REQB 2J7KA 4UFNA 3QY0A 1Q7RA 3KLPX 3FPCA 3PHIA 3GK3A 1KR5A 1BRTA 3OCCA 3EMVA 3A9SA 1J0CA 2OMEA 4N8EA 2YW9A 3O8CA 1OBHA 2H54A 2WHRA 4X60A 3T0FA 4B9UA 3VSAA 4EMSA 3NOOA 3HCBA 1B8OA 1MLDA 2OGTA 2YCLA 1LEHA 2XQGA 1PUIA 1XRJA 3WA7A 2IS4A 4GPEA 4PPFA 2GTIA 1AU9A 2AZDA 4D5EA 2R8RA 1P5JA 4K5QA 3PDJA 3GIIA 1L5NA 2W3RA 2CD7A 4CM8A 1NW7A 5A04A 1QMPA 2W4IA 2XQFA 4MJ3A 3KKQA 4XKJA 5TVGA 5EG5A 2C2YA 3A2NA 3OIVA 1W88B 4KQ9A 3ZXUB 5BVHB 5DNWA 4CCHA 1UUFA 1XZJA 1JKFA 1ZQRA 1PS0A 1QSYA 2ZTSA 4YASA 4E5PA 3F53A 4M8NE 1OR8A 1H42A 4UNQA 4KAFA 1T3LA 1CV2A 3AW8A 4RF5A 3O0TA 4UCXA 1FJXA 1XIVA 1XDZA 1M34B 2ZT7A 2FLWA 3ZY6A 4IUDS 1IUNA 1YL5A 3PR5B 3CUKA 5GVRA 1SXJD 3NC0C 1BJRE 1R37A 2RARA 1Y3BE 2ADMA 3HZRA 3Q0EA 1ECBA 1G66A 4M0UA 2RGAA 2ATXA 4UAUA 4J0JA 3G1TA 4KQXA 1H65A 1P0PA 4Z6CA 2I99A 1TADA 4LVUA 1VMDA 1LNZA 3TRKA 5JYEA 2Y2UA 3PNVA 4CF3A 1WKVA 2BCJQ 3O92A 4OQLA 3U37A 1X14A 4I6JA 4GEGA 2ODNA 3LVRE 2C7VA 1EGQA 1W8DA 3GV5B 1CKEA 3B3JA 1Z88A 2AJQA 3D43A 4JFRA 4PW0A 3NWOA 4Z6EA 4NG5A 4RSHA 1QS0A 2J32A 4RYDA 2Q4BA 3I01M 4FMDF 5EHNA 4OJTA 3DVRX 4CMKA 1TQ2A 5DNEA 2C97A 1ULSA 2IH2A 3W4JA 2ROQA 3V00A 3C85A 1VKHA 5HKOA 1T3NA 3IP1A 4M1QA 3AK4A 3SEAA 3U31A 4FE3A 3L9WA 3EIXA 1VPWA 3I2YX 3BFVA 1JPVA 1Z29A 2P40A 2BTOA 2QLNA 2PGNA 4JKYA 1X70A 1GGKA 1BHQ1 4DPLA 4D4LA 1MDFA 3F98A 2VUSA 1TZKA 4L4SA 2QU8A 3BXXA 2ZRMA 2B99A 3ACBA 4R98A 2CXOA 3CS3A 1XSPA 3B5JA 2CF5A 5M7EA 1HEYA 1QPBA 1G4UR 2IJGX 4LWPA 4D9HA 1YVPA 1MEEA 3FLAA 4X6XA 1N3LA 2X19A 1CSEE 2DSTA 5GJVC 2LW7A 3ADPA 1FRFS 5FUQA 3IHQB 4RUCA 3P9SA 1MAVA 1G19A 3LLMA 2IEDA 3JPNA 3PLNA 4EPVA 3NIGB 1WPQA 4MEAA 3KCQA 1RYBA 1NW9B 1NI5A 7ICNA 5JWRA 1N7JA 4RY9A 1IG3A 3WVNA 1PWYE 4NLGA 4E22A 5J59A 4C80A 1R4AA 4E1VA 1I0IA 1TO6A 4YI5A 3OCXA 4K9DA 1JU9A 4UUQA 3CKMA 5LXTA 4F2PA 2OFXA 1HGXA 4CM9D 5DPMA 2WAAA 1PVRA 1CK4A 1FNNA 3RTVA 2P1RA 3CNLA 3NMUF 4CHGA 4K4HA 1KI4A 2O2ZA 2WFMA 5JYCA 4O4HA 4OV6B 1QSGA 5AW7A 1GZHB 4FFDA 4INZA 1PZNA 4MWTA 3TLGB 2HHTA 4CV2A 2YTZA 5IBCA 3PMLA 2C2GA 3BE8A 1OAOC 2XXAA 4RDCA 1TIKA 4E5DA 1MH1A 5J8YA 1NIJA 4OI4A 3N2NA 4QUGA 2Q3JA 5IT5A 3QE2A 5CNKA 3KZOA 1T2VA 5I48A 3VISA 3H4DA 3IUMA 1FFVA 5I9BA 2XMQA 1DFGA 1N2CE 2FR1A 4YY3B 3EFBA 3O84A 2AMJA 4ZVVA 2ZRFA 1MJNA 3UB3A 1DPFA 1QP0A 1MJGA 3GY0A 2CKDA 1TO1E 3MG9A 1I5OA 5KFJA 2GPTA 5CPFA 5UKDA 1XGKA 2WNHA 1Q1GA 4RPGA 1F4LA 3T7DA 1HSOA 1LK0A 2CYBA 4I2GA 2LM4A 4XIJA 1E64A 3IP8A 3OZAA 1PDVA 1ZNQO 2AGQA 3E27A 3CKYA 4M2YA 4IGIA 5LBIA 3BDIA 1DKRA 4X1YB 2VHCA 1RRMA 1J2MA 3VYTB 4DMRA 1XG5A 3QNMA 5HUQA 2MSEB 1TKRA 3OP4A 1P60A 4GPAA 5KVVA 2ODBA 2ERYA 2X0NA 3ASUA 2WU8A 1NYLA 3SM3A 1VCOA 1FCJA 1T5OA 1PV1A 2PKQP 4HRYA 3NVKI 3WHKA 4NWIA 3FBTA 3LCMA 4DCOA 4HZUB 5JH7B 2QN1A 5JPIA 3PB3A 5TGZA 1EDOA 3USES 4S1TA 4P7FA 1BNCA 1TCAA 4BQSA 1K5GA 2H17A 1DTWA 1V4NA 1OBVA 4FMPA 3UYKA 2BH9A 2H1WA 1KWGA 3G3EA 1U0LA 5G40A 1PL7A 1COOA 3ZPXA 1LQTA 5EWLA 2X3FA 4B3MB 1JIUA 3RB4A 3T7AA 4KQKA 4F12A 3OTOB 1W0KD 2WSBA 4HGYA 1HY3A 3TR5A 1TK5A 2LGJA 1ZONA 4M21A 1I3KA 1XNQB 1EDEA 2R5NA 3ZW9A 1HDOA 4F3NA 1P72A 2B21A 1X9HA 1X9SA 2H2FA 4UB5A 4DFJA 4R8LA 4M55A 4QZDA 2GEDA 1PNTA 4DV3B 2R18A 1QFZA 2WQZA 2WK1A 1TZBA 3I2IA 2PUHA 2GT1A 1CP3A 4MJXA 1UA1A 1TK3A 3CYMA 3I3OA 2N75A 1Z17A 3H1PA 4BB6A 5FHRA 3KKPA 4ZT3A 1NDUA 1WMSA 3SKYA 4YIHA 2P9CA 4M0CA 3KQSA 4FE4A 4MUAA 3KYJB 1ZR4A 1RIIA 1QE5A 5FI5A 2G70A 2CCGA 3QKSA 4B7AA 2ERXA 1TGYA 3WSTA 1P7YA 2Q0HA 4EVSA 1CUIA 2E55A 1CTQA 2W6OA 1PJTA 5FBWB 3L6DA 5K0EA 4R1LA 5DEOA 3KWFA 4XIFA 1LLFA 3I58A 1JA9A 4YP5A 5DNVA 5EINA 3SQDA 3FYSA 5AUQA 1O96B 2XCPA 4KIFA 4BNJA 1EX1A 3BJZA 4KLCA 1UCFA 4AJIA 3KJXA 4E7PA 4S1VA 1SXIA 1K3FA 2H18A 2P5TB 4CL2A 3AG5A 3HBNA 2QT9A 4TMYA 1VKJA 1P29A 4R2WA 1X0VA 1ZCBA 2BFBB 3E2MA 4EKYA 3EXFA 1FJGB 4DCSA 4CQMB 3QLVC 3MVEA 4R3WA 1ZMRA 2GEUA 3LK6A 1KI6B 1F2TA 3N0XA 4D4KA 1DK3A 1JVBA 3Q3CA 2V7EA 2NT3A 2W9MA 3IOCA 3WL8A 1DKQA 4Q4JA 2PUWA 1ZCJA 4EYOA 2R6JA 1PE0A 2Y92A 3KB1A 3ZJVA 4DUGA 2C83A 4R05A 4X1KA 3P5BA 4U63A 3SBEA 4FFWA 1S1CA 3E8XA 3DOUA 5L40A 4P36A 1E4OA 5INTA 3GPCA 4E4TA 2DSNA 2WTUA 4IV0A 4CF4A 3VU9B 2XT0A 3RU7A 1YZHA 2C54A 4YREA 3ZWVA 2IYRA 4GP9A 2SHKA 1AUVA 4YCJA 1CZLA 4HB3A 1SKAA 3G2JA 1JH8A 5JAHA 2DT8A 2QIOA 3G9TA 3IAFA 5D1NA 2MR6A 1NVDA 1A2KC 1W59A 4QT4A 1X8XA 2IYNA 4DR2B 1Y8AA 1BVUA 4HEA1 3QPUA 4L0CA 3GVXA 5IJ0A 5E0KB 4I2EA 4CXMA 5E1OA 3OZWA 3NETA 5IWCA 3C16C 4O3PA 2O8DA 2ZYVX 1BH6A 2JBAB 2FPPA 3IBCA 3VU8A 3W8NA 5J47A 1CRLA 5CRIA 1N7HA 4LJ4A 3KYDB 1GRNA 4OSPA 3U26A 3P2EA 3DMHA 3WLSA 2R8IA 1RPTA 3UGQA 3ONNA 2HJSA 3FMPB 5IKOA 1Q0LA 3EDMA 3P5SA 1PN3A 3L3FX 5K0SA 1GZ6A 3GT7A 5E7MA 1IZ9A 2WWXA 1I8TA 1MDBA 3R5TA 4BGUA 4I2JA 4TQSA 2GJKA 2E21A 3D6JA 5CLHA 5IASA 3SSAA 3T5HA 2FRXA 5K3SA 4QRIA 4MJLA 1WHTB 2ZAOA 1T36A 4TMWA 4WLNA 1DZ3A 2MOKA 4BMCA 2FUG1 1G5IA 2WBLC 3L0OA 4ONEA 3AJ8A 2GBLC 3CVVA 1N6IA 1LV8A 2JRZA 2NNLD 3V5NA 4C14A 3RW9A 2J33A 4Z4EA 3PUKA 4HBZA 2XDWA 2DUJA 2L19A 4KQGA 5CGQB 2W03A 4PFJA 2XXJA 1WZEA 1D5CA 4R2IA 4ZDJA 1MR3F 5ER6A 3QKWA 1GCOA 4DOCA 3QELB 3AN1A 3EG5A 4X6LA 4GG1A 5CVUA 2CXUA 3H5IA 2WIDA 4NZOA 2KHVA 3WY9A 2QUKA 1AMUA 5JW6A 1RZRD 2ACVA 4JC0A 1O5TA 4Y1RA 2VT7A 3BTOA 3RB3A 4QAQA 3I9V6 3N2ZB 1E79D 3OHSX 5LYJA 8ICFA 4BO8A 3WLRA 1ZQLA 1AQYA 1QZZA 2QN3A 4WXEA 1U9LA 4PICA 2YX1A 2Y68A 5GV8A 3IFSA 5DYIA 2DPHA 2NU7A 3JPTA 5DQIA 1JZSA 1QC5B 3TX6A 3F47A 1TAGA 3U39A 3WYEA 2CLCX 4D1YA 3UUEA 3FCAA 3I64A 3O74A 3HFRA 4O5AA 2CHUA 1LDBA 4RKRA 1POWA 3R2JA 5DHQA 4O0IA 3BCUA 3NRCA 1IM5A 3QY9A 2NSYA 4X8OA 1GTMA 1OILA 1OYOA 4JH0A 3E5MA 2ZDGA 2RGBA 1JEYA 4FNAA 4CLRB 3MQ4A 4KRXA 4WY2A 1XALA 5BV2P 1E2NA 1HRDA 2JR5A 4CT5A 2ZTLA 4AZ0B 2ZANA 4DIBA 4FHGA 1S4MA 2BFEB 2CNWA 4BNTA 1VHDA 4RLSA 1CQJA 4XD7A 4QUJA 3NALA 4MS1A 3W5JA 4K9QA 1L5FA 5BW4A 3I9FA 3Q2IA 1WD7A 1D4AA 1VJCA 4ND6A 5HP4A 1AHIA 1KRHA 1EFVB 3EG9A 1RJFA 4EBFA 4GBED 2CZGA 3K4QA 4Y2JA 3B3QA 1NL3A 4C03A 3T1VA 4KQ1A 4IUCS 2XBUA 2CUZA 5KYUA 4BBZA 3VZQA 2YJGA 3ZLBA 4YQEA 4H08A 4HN2A 3AFIA 3GC6A 2OWDA 5DN6A 4QBIA 1E2HA 2G04A 5DF1A 2W2NA 3E9YA 2PX0A 1ARZA 4YQYA 4RL6A 4R7GA 4GQIA 5THKA 1ZQVA 3T3NA 1CNFA 5A0LA 3VKFA 1QHGA 3TUZC 4HLCA 1H6BA 2CYAA 4QWMA 1M1NA 3DEZA 4ML3A 4EM6A 2RGUA 2WJVA 4LHWA 1Q46A 4RVNA 1PSDA 4ZI7F 2I55A 3GD7A 1ZOLA 1D1SA 4ED6A 3LSTA 2WZCA 2P9YA 4BKQA 2FKAA 4G0QA 4I14A 3U7IA 1RXSA 2HMYB 5H59A 3BF7A 1E2KA 3GG2A 3R23A 3I01A 1VJRA 4Q03A 1RYNA 2R97A 1EP1B 2O3UA 4ALMA 4XWAA 4BKRA 3CSUA 1Y3FE 3DCNA 1GUFA 3FUCA 5CA0A 5DI9A 3I28A 4R1NA 3RB8A 4AJNA 2A3NA 5EYPB 1GTRA 3L3BA 1FXSA 1UC5B 5TISU 3ELYA 4EI9A 1T9GS 4H1WA 4ARZA 5JHGB 5CITA 5G0UA 1Q84A 1JG4A 4G9GA 4JZYA 2YCBA 2FE4A 3KTOA 4MW0A 3C1UA 4BL5A 4ENVA 4FYPA 1D04A 3OUZA 4L02A 1AKWA 3JQ8B 3RC9A 3EXAA 1HYHA 3WXMA 2HKIA 5JXHA 2Z2JA 2HLPA 3FKJA 1G0OA 4RZ2A 2YUTA 4GMFA 4EPTA 2W2KA 3E61A 3EZ7A 5A5DA 5BYBA 3CM0A 2XCLA 3GMTA 2D2VA 1DAMA 1F7UA 3OQ6A 3U4QA 5FFMA 1O54A 3S2IA 3FB4A 5I5EA 2QMQA 3OPMA 2J6HA 1AJEA 3E8SA 1D8TA 5BQXA 4Q1VA 4PC3A 2WTEA 3KT0A 2JI8A 4NZYA 1CYDA 1M6HA 2L17A 3H17A 4BFWA 3CUYA 3OM9A 2NV3A 2AGVA 4G37A 4CG0A 1H2ZA 2RSLA 4BNHA 4LYJA 4TYNA 1NMYA 1L8OA 2YIJA 2G4VA 4XLLA 4TT8A 4M3NA 1CJVC 4XCXA 1UWKA 3NIFB 1EFUA 1B76A 4RNDB 1JQAA 3MAAC 5CW2A 4TYQA 4YT8A 4NFLA 1ISRA 1DEXA 2G7ZA 1GUYA 2I4TA 5EL0A 2CCJA 4CI0B 3NHFA 2NPOA 3DD1A 3RH6A 3A27A 4E70A 4Z86A 1XMJA 1XJQA 3EEIA 1I2CA 4CWAA 4G4SP 4ZN6A 4BATA 3SF0A 4ZWNA 3PNSA 4BZWA 2QB0A 3EZXA 2VJQA 1OTXA 4O2AA 4BFZA 1GN9A 2Q3MA 3CNOA 4LN1A 2B34A 4EJFA 5BSMA 4F46A 3B5IA 2NO9A 3A6KA 2ODEA 1ZXXA 5L4LA 5DO9A 5IAKA 3PGKA 3VVBA 1BWQA 3F6RA 1K4MA 2EJVA 1XZGA 2QD5A 4KE8A 4EATA 1JLMA 3CTMA 4FHCA 2ZRKA 4EB6B 2VSYA 3RWOA 2XMRA 4LA4A 3UBMA 5DT9A 1WZ2A 3L0IB 3L7JA 2GMWA 4RPCA 1T6NA 1Y8QA 1P75A 1ZYUA 2OHJA 3JPPA 2NU8A 1XTKA 1KS2A 2PU5A 2OBYA 3U1VA 2BFFA 3M82A 2C7OA 4BMSA 1QQ6A 4PC2A 1FSGA 3PW2A 2C9MA 3FG9A 4E32A 4JXJA 3KHTA 3HDYA 2VBIA 3SU8A 3HYRA 3CW2A 3HWX1 1V9PA 3I1IA 2AJBA 2GF9A 2EKQA 3HE3A 3W4IA 3SC6A 3H4VA 1NR5A 3LDGA 4K9KA 1ZBDA 4J2OA 1LXCA 1BDJA 1ORRA 5K4AA 1NVAA 4C3OB 2ORVA 2BP7A 4MTLA 4GMGA 1EXWA 4ZAYA 5JMPA 2W54A 1D5WA 4V03A 421PA 3AV3A 5CD1A 5HKKA 3OC6A 2V96A 3N39C 1UJNA 3A3KA 1K8ZB 5BT9A 1M2VA 4Q19A 1NWHA 4LZZA 4FYKA 4V3CA 4OXNA 1JXLA 1YRHA 1YK1A 2GKOA 4W5QA 4WZAE 4XWGA 3HW8A 4ZPXA 3QWIA 2REOA 3SQMA 3ZQUA 1W5TA 1JDSA 1UM9A 5CHEA 3JPYA 3THRA 4QT0A 1GAWA 3D3WB 3C4QA 2IYUA 1RBQA 1MB2A 2XB8A 1HXHA 5JJ5A 4FYIA 2F3QA 3A4LA 4A6PA 4HL6A 2JIBA 4FQ5A 1ZU4A 1RJDA 4FS3A 5HE9A 4H77A 2NMVA 3LTEA 4JT9A 3GJ6A 3M3PA 1ZVMA 4V1CI 4PZ9A 1EK0A 4C7BA 3WWEA 1J25A 2I29A 5IYZA 2G06A 3LWNA 4C8NA 4J7UA 3NR2A 2MINA 3ILHA 4IQGA 5KTPA 3KOMA 1T2EA 1DO2A 3ZDEA 5BR4A 4GPD1 3H9CA 4IS3A 4PQRA 5TT0A 1XZQA 2DPGA 3V80A 3V1UA 1J2YA 3GIWA 1UPBA 5F5NA 2W8ZA 4RACA 3GEDA 2VXCA 4DARA 4BFYA 4RDIA 1SIUA 3S7TA 4D81A 3PUZA 1T94A 4PG6A 4KH1A 2NVUA 3AINA 4FFMA 4UULA 1KRXA 5ENVA 4ZEXA 2H7XA 3LUBA 5I9IA 5F9LA 3T95A 2P8SA 5D85A 1NG1A 1P44A 3KG2A 2EC5A 3EXIB 1EUQA 1F8UA 3RRNA 3M4NA 5FI0B 5KAPA 2PQ0A 5HS6A 4LY6A 2VYVA 4DQKA 3ZLJA 3C39A 1OGIA 3LOPA 3EHDA 2OZLB 1Y5MA 5KBYA 1L4EA 2JZCA 1KKLA 5EKUA 4RSMA 5AHXA 1AOXA 1P74A 2J3EA 2NUTB 2ZI7A 3HSSA 2VTDA 1GA4A 1DCTA 1AKMA 1F9EA 3DDOA 4YXWD 1K75A 4HPXB 4YMGA 3K1AA 3PYLA 1MMFB 4I99A 2XNDD 3OESA 4YFYA 1SWVA 4BZZA 2XZLA 4IZIA 1SM4A 5ITWA 4EHNA 4LSGA 3GFRA 2IYPA 5IM4A 1Z00A 4HWSA 1WXGA 3RJFA 5I7RA 5FP0A 4E5SA 1Y4DE 2JVKA 4PZEA 2ONCA 3MJVA 2AOTA 2OM2A 3QBJA 1VHWA 2DXIA 4BZPA 2BCQA 2W2PA 3DWGA 2H7VA 3PQ4A 2C99A 3K16A 4UD2A 3MINA 4Q1DA 3PEUA 3NUQA 2BDTA 1DBSA 4UB6U 2V5VA 4D3XA 3JYPA 4E46A 3A1UA 4NOMA 3DYBA 4RK1A 4DEZA 2WFLA 2BJWA 4ELUA 4GOJA 3IP5A 1PHPA 3KU4A 2FSPA 2DBQA 1BDIA 3NT5A 2PZMA 2N1MA 1MZPA 1Y33E 4NE7A 3Q3GE 1UWVA 1MQ2A 2RHCA 1GSIA 3LCUA 1JDUA 5A9TA 2CXNA 1Z9BA 3ELWA 5B53A 1ACLA 1HA3A 2KKPA 1ONBA 1QVAA 4U7GA 1YH3A 1IVNA 4MPTA 1XMIA 3PZPA 1RWNA 1U9YA 4HDKB 2Q4TA 1YQTA 2IKSA 3STVA 1T9KA 3DAFA 1QTRA 4ZHQA 3V8VA 1H66A 3EDYA 4C0ZA 3P4YA 4YUXA 1YRQA 1KJIA 1JR4A 2PMFA 5FRDA 2BLNA 5CH5A 3PDCA 1F0NA 3HWWA 1U4SA 3PR2B 1V9LA 1QG2A 5BWNA 3PE4A 3ICOA 4MR9A 4C8KA 2BKUA 2DBZA 2UYCA 3MR2A 1ZCZA 4ND8B 4EA8A 1QJCA 3AB7A 2PSFA 3BHNA 3IMCA 3OWXA 2QT1A 4AZ3B 3PRHA 4NABA 5G1OA 1XYYA 3TTTA 8ICNA 3ESYA 3I61A 2QTWB 4ROTA 4NS1A 3CRVA 3I1YA 3BCHA 3SI8A 2Z9CA 1V97A 5IJAA 3W77A 1Y1KE 3C2MA 1YJXA 4DCUA 1AUQA 4IQFA 1M2WA 1VZ2A 3SVTA 2PLFA 4MR7A 3NG1A 4MVYA 4PHDA 1M2EA 3HH8A 2K60A 5I7EA 4B4KA 2JLVA 3C1YA 2IYZA 3H5OA 4MB0A 2QZ4A 5F52A 4M8LA 3FNGA 3M6UA 5IABA 3L84A 2IE0A 1TYBE 1ZPDA 3UQ0A 3LAWA 2GCIA 4H31A 1NHWA 3QWBA 1V11B 3NFYA 5DRYA 2O6LA 4D8WA 2CBGA 2JFFA 1DC8A 3KEQA 4RIIA 5PNTA 3REQB 5AHWA 1ZGGA 3EX7C 5CT5A 2W2LA 1V6CA 5TMBA 3KVOA 2FN7A 3E15A 4PF1A 2ZBFA 3OD5A 3FMFA 2GTHA 4ZOBA 2R7MA 5T8KC 1MQ9A 2W4MA 3HTXA 1U81A 3E1SA 2W2QA 4B83A 1W0JD 1ZK2A 3FRHA 3T1HB 4OLHA 2AUNA 3B78A 1LDNA 3QVUA 1ZQIA 2I7XA 3NGMA 3UW1A 4EMTA 4C7OB 3TPCA 1U6KA 1RAEA 3BB1A 3ZJTA 1OV4A 3SAGA 1EI9A 2BI4A 3QV2A 3TKLA 1YOVB 4YTEA 5TF4A 1ITZA 3LC7O 1A71A 3E23A 4Z1MA 1TGVA 4CL3A 3M9WA 1VKRA 4I4NA 2BKVA 4YMVA 4LOKA 1PJ4A 3A6ZA 1FQJA 5HJEA 3H11A 2X8JB 2A5JA 4G5SA 4N6OA 4Q7KA 3ZWBA 4UQPA 1GAXA 1O1YA 1YR6A 4X64B 2PGAA 3S2UA 5FNZA 2QM8A 2GBFA 3FPHA 5ESWA 2WT9A 2GN1A 4W5WA 5JXGA 4YRTA 3CX3A 1S76D 3RFCA 2ZRJA 3F2BA 2X2OA 5JOQA 4JHXA 4KV7A 1Z6PA 2M2IA 3M6WA 4XA8A 1II8B 3AL2A 3OPYI 4MF8A 2VA8A 3N2LA 4D9CA 5KYNA 3D6UA 3K3PA 2XIJA 4U2GA 4MDEA 1DAKA 2VQ3A 1NNI1 4YWHA 2FXVA 3A3OA 1I4DD 4C4YA 1PK9A 2P75A 3I6BA 4R2LA 3VI3B 3D6MA 4WGGA 4KRFA 4ZQCB 4QZHA 4J9LA 3G7UA 1OVGA 3VPDA 1Z6AA 3HT3A 3L1HA 3PEVA 4NE9A 1KI8A 5JARA 3N2GB 4AL4A 3K2IA 1VC2A 5IAJA 3ZHBA 1SD2A 2W37A 3E22A 4EJ0A 2ID9A 4JUBA 4YAGA 1EP9A 3ZX5A 4BNXA 3AUOA 4RCVA 2I1LA 1RPAA 4A9AA 3QI7A 5A6SA 2W71A 1SKYB 4DXAA 4QEKA 2OCEA 2AG5A 4DL4A 1RXEA 3HX0A 3VJLA 5BRNA 4KLTA 4I5IA 3RJHA 4FOSA 4C3UA 4D8YA 1ZQCA 1KBOA 4MICA 1CUAA 1FBTA 1BHO1 2ZVPX 1RP7A 3SWWA 1CX9B 4EUNA 3GBVA 1XKQA 3K35A 3VTFA 2H92A 2WZDA 1PKXA 3CLTC 1B4DA 4PLYA 4CMHA 1Z63A 4LOAA 3EEYA 9ICRA 4IIFA 3TQTA 4I9FA 4J4HA 1JIIA 1SA0B 5BORA 3UJ3X 5EWGA 1ZW1A 3O31A 4MIYA 5FWAA 3IERA 3A9CA 4KWTA 2RBKA 5HM8A 2XV1A 3CJQA 1CPYA 1X94A 2EJCA 5LU9A 1AZTA 5JRZA 1PJBA 3HB4X 1DT5A 1S10A 4L2IA 1O6ZA 1UFOA 1VE9A 5ALZA 4FJ2A 1AE1A 2NO1A 2FK8A 1W46A 3QUQA 2JKVA 1IQPA 2JG3A 4AP5A 4GECA 2EF0A 5TJ9A 4TKUB 4QJBA 2O0JA 3Q7IA 5FF9A 3BE6A 4I8XA 1T6BY 4LHEA 3URMA 4LHXA 1W9MA 2PKQO 4TKVA 1JFVA 2YIVX 3NV7A 2JGNA 3NB0A 3MT8A 4GKJB 3ZLTA 4BLWA 1YBFA 4A8HA 5F12A 1OXSC 2IOYA 5CB4B 2R4QA 2YXPX 5BMVA 4N3CA 2C95A 4B80A 3VH4A 4JXXA 2GAOA 2QJWA 2QTRA 5K5EA 2QVXX 4JWMA 1G20E 5DBFA 4TURA