2WF6A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and aluminium tetrafluoride
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf6A01
2RBKA 4JDPA 2FPRA 5AW3A 1U2SA 2YJ3A 2O9JA 3NUQA 5AW5A 3TLMA 5AKYA 4B6JA 2B82A 2YY6A 5ALYA 3OCWA 4DW8A 1YMQA 2HSZA 1Q91A 3KBBA 4HGOA 5ALEA 1CR6A 2B8JA 2C4NA 3M9LA 3IB6A 4Y2SA 4Y2JA 4UMEA 3WK7A 3U13A 4XQ0A 3QNMA 1U2TA 3D6JA 2ZOSA 3N07A 3NRJA 5AVVA 5AVXA 3KC2A 1RQLA 3E58A 3QX7A 3CZ4A 2JAWA 3DNPA 2WF8A 2RARA 5AKEA 3R09A 3WK8A 4EELA 4OHFA 2AGVA 3N28A 5AK4A 3VAYA 3KD3A 3CNHA 5AW8A 4KNVA 3E8MA 2G08A 3I6BA 4XE5A 3OCYA 1NF2A 3PDWA 2PKEA 1YV9A 2CFRA 2B30A 4BEVA 2Q4RA 3SLRA 4NFLA 5IT0A 4BEWA 5AW7A 3UMGA 3ZVMA 5AKZA 3HYCA 2I7DA 1SWVA 3ZU6A 2I55A 2RB5A 2ODAA 4FYPA 2G80A 1RQNA 3MC1A 1RKUA 2EARA 1J97A 3FGOA 2FEAA 2HF2A 3EF1A 3UM9A 5AICA 2G1AA 3ZWDA 5AM5A 1SWWA 4FFDA 4YIKA 4EZEA 4YCMA 1L6RA 4CNQA 2AMYA 1YJ5A 3QUCA 3B9RA 2AUTA 2G0AA 4L57A 2GHTA 4UASA 2BDUA 4ZEVA 3ZVLA 4E88A 2WHEA 4Y2XA 3U19A 4BNDA 1AQ6A 1XP5A 2ZG6A 3NASA 4KN8A 3ZWKA 4Y2TA 4HGNA 5AK6A 2FPXA 1RMYA 2YMPA 3NALA 4ZEWA 5A3SA 3EWIA 5AVRA 3PCTA 2G06A 2R8YA 2I54A 5AI9A 4JB3A 4Y3UA 2IA5A 3IJ5A 3B9BA 4CE6A 4NWIA 1LVHA 3MN1A 2JGAA 3SHQA 2FDRA 5AI6A 4BBJA 2YJ4A 1ZOLA 2MU2A 5ALKA 4HAIA 5AKKA 2FPWA 3ZVNA 3N8GA 4Y2VA 1RDFA 1Z4LA 3L8HA 3L8FA 1U7PA 2C8LA 5AKHA 2OBBA 1ZJJA 4EENA 1NNLA 2HO4A 4C4TA 1ZD5A 2YFYA 3B8EA 3SKYA 5ALOA 4BX2A 4CF3A 4CF4A 2B1QA 1VFPA 5AM4A 5AW0A 2QLTA 2W4MA 5AVSA 3ONNA 3A1DA 2Q5EA 2ZBDA 4PNHA 1XPJA 1FEZA 2IYEA 3WKBA 2GFHA 2R8EA 2ZBEA 3WK4A 1Z4QA 2HEGA 4AP9A 3AR4A 1LTQA 1L8LA 3FPSA 3UMBA 2CFSA 4Y2RA 4Y2QA 4DFDA 1L7MA 3RFUA 3QLEA 5A3QA 1Z5GA 1RPZA 4J2TA 1Z5UA 4UAUA 3N1UA 4DWOA 3OCUA 3SKXA 2O2XA 4GIBA 4AS2A 2BY4A 1X42A 3MMZA 5ALTA 5FP0A 1Z88A 3KDPA 2WM8A 1L8OA 4RESA 4YCNA 5ALNA 1S2OA 5JJBA 3ZTYA 5ALFA 3I76A 2R8ZA 3A3YA 4IG4A 3KZXA 3L1VA 5ALHA 1ZS9A 2OM6A 4OFZA 1T9ZA 3L8GA 5ALWA 1VJRA 3I1YA 2C9MA 3L8EA 3SF0A 3ZUPA 3DAOA 3WKCA 3PGLA 4KYTA 5IT4A 1WZCA 4MUMA 1WVIA 5ALZA 1RMQA 2I33A 2HX1A 4EX7A 5ALXA 2WF9A 2P11A 3OCVA 4UMFA 5T41A 3ZX4A 1Z4JA 1Z4OA 2IOHA 2C88A 5AKJA 4O8CA 4H1WA 1TJ3A 4RETA 3WKEA 2G09A 2OYCA 4Y2PA 1Y8AA 1VJ5A 2HF7A 4BX3A 4KX3A 1O03A 4OCZA 1RKVA 4XPZA 5AESA 1TE2A 5ALSA 5AVWA 1ZD4A 2QYHA 4YCLA 5AKIA 5AW4A 5AM3A 4UAVA 3QUBA 3QXGA 4FE3A 4Y2YA 2GO7A 5AK5A 2FI1A 3P96A 4UU1A 2AH5A 4J03A 1K1EA 2X4DA 1Z4NA 1N8NA 4L6AA 3L7YA 5ALPA 4AS3A 3WK6A 2YMMA 4BKMA 1L7NA 5AIBA 4Y2UA 3F9RA 2C8KA 3ED5A 1QQ5A 4NABA 2B0CA 1SU4A 4UM7A 3W5AA 2YJ5A 1XVIA 3W5CA 1T5TA 3L0BA 3ZX5A 5AM1A 2VKQA 3EPRA 3AR5A 2HOQA 3J7TA 3AR6A 3PGVA 4DCCA 1ZD3A 2HI0A 5AW2A 2WF6A 1RLTA 3AR7A 2NO4A 4UU0A 1Z4KA 2B8EA 3K1ZA 3U7HB 2JAUA 3L0CA 3L0YA 3QU7A 2FPUA 4UMDA 2HCFA 2HDOA 2NO5A 2P9JA 3DDHA 5AHXA 4GXTA 3R4CA 5AVUA 5AW9A 5AK3A 1U02A 4YIHA 5ALGA 1Z4PX 1MH9A 4BNDB 4G9BA 1Z4IA 1WPGA 1ZRMA 3ZW7A 1KYTA 1RKQA 3NAMA 2FPSA 2B1RA 2HHLA 3E81A 4HGQA 5AW1A 3BWVA 3AR3A 3N5KA 2GMWA 1N9KA 2ZXEA 4YGYA 3WKAA 3WK9A 1TJ5A 5AI0A 4EEKA 1PW5A 2JAOA 2JARA 4IFTA 4NAVA 1EK1A 2W11A 3AR2A 4EX6A 3U26A 5IS2A 2I6XA 1RRCA 2YN4A 4CF5A 2MSNA 3AR8A 2NYVA 3WGUA 5AM0A 3W5DA 5AI8A 1RMTA 2GHQA 5ALJA 2D2VA 3DV9A 3ET5A 3QGMA 4BYGA 1RLOA 5ALQA 2RAVA 4UATA 4YH1A 3FPBA 4C4RA 5ALLA 1F5SA 2PR7A 3SD7A 1YDFA 1QQ7A 3IRUA 3WK5A 3EF0A 1L7OA 3GYGA 2WFAA 2CFTA 3A1CA 4UMVA 3I28A 1TJ4A 4ZEXA 5AVYA 2YMLA 2R8XA 1QH9A 5AI4A 4UW9A 1S8OA 1QYIA 4F71A 4BX0A 1U7OA 2W43A 3W5BA 4NV0A 4KNWA 4C4SA 1J8DA 1QQ6A 4HGRA 3UMCA 2FUCA 2P27A 3RF6A 3QU5A 2YBDA 3U7GA 4HGPA 5ALUA 2P69A 2ZBFA 3KOOA 3L5KA 1CQZA 5AIAA 5ALMA 1Q92A 4L6CA 3ZI4A 1O08A 4UARA 5AKLA 3WKDA 1WR8A 2I34A 4QJBA 1ZRNA 5AI5A 2YJ6A 1NRWA 3OCZA 2ZBGA 4QQFA 1IWOA 2FUEA 3QUQA 3U7FB 3FM9A 3S6JA 2BDEA 2G07A 4UM5A 5A3RA 1RLMA 3L1UA 3WGVA 5AVQA 3ESQA 3BA6A 1YNSA 2EATA 5ALDA 3OPXA 3MPOA 4MWOA 5ALRA 5AKXA 4KX5A 1L7PA 3ESRA 4HYTA 2PQ0A 4XOUA 3FVVA 3NIWA 3QU9A 1T5SA 5ALVA 4I9FA 3R9KA 2OA0A 2IOFA 3SMVA 4OD0A 5E0OA 5AW6A 5AKGA 3QUTA 1RC8A 4G63A 3QYPA 1TA0A 3OTQA 1YS9A 2CN1A 2EAUA 5AVZA 3ET4A 1JUDA 2YMQA 3A1EA 3E84A 5ALIA 3M1YA 2DQSA 5AVTA 3QU2A 3U7EB 4I9GA 2WF5A 3ZTWA 2IOFK 1EK2A 5AM2A 4F72A 2MU1A 3NANA 3FZQA 1Z4MA 3OCXA 3AR9A 3QU4A 2WF7A 3HLTA 2Q4TA 1ZD2P
chains in the Genus database with same CATH superfamily
1ZD9A 3DTVB 2NVUA 3VTZA 5C5DA 4B6JA 2IC5A 1AKUA 5ALYA 1Y8RA 4NQRA 1FXWA 2WAQC 1XQ9A 4A8PA 1L3VA 5KNBA 4W99A 1QAOA 2ZQ5A 7ICTA 1RAGA 3GOHA 2AZXA 1H5QA 5I4IA 1M2VB 3LP8A 4GEKA 4UHBA 5KMGA 5DW3A 2A5LA 5EJFA 5JNVA 1G4AE 4JUFA 2BQRA 4KRFA 2YFHA 4P4UA 2BFCB 1R37A 5KNIA 4ECVA 4IGKA 3RT9A 4IS3A 4UXJA 1P18A 3WFIA 5FTKA 5ILQA 2KD1A 5H80A 1U9IA 3TQOA 3HKDA 4EJ6A 4KKVA 2Q5HA 4QOFA 1HLDA 4PZAA 4KMSA 5TPWB 2EP7A 1YOVA 5BQPA 4Q9HA 4OAPA 3T1NA 5EOVA 1OX6A 4MV8A 4MUEA 1HFEL 1AROP 2XUHA 3V3TA 1AKWA 1RYHA 2R4UA 4RK1A 2VC2B 1J2YA 4N5HX 3SWWA 5A0FA 5IM4A 2SKCA 2XWQA 3CUKA 3C3DA 1ISIA 4J0IA 16PKA 1SKYB 2AC4A 4PFKA 4XR9A 1R8XA 3UBTA 2QDXA 4MKFA 4IGFA 2RFLA 3GN1A 4FCWA 4JFRA 1FFAA 4R7TA 2J5KA 5J5AA 4J2OA 4TWZA 2ZUVA 2IPMA 1DRGA 2ZBDA 3GFTA 3EZLA 4WLUA 4QUHA 2Q99A 2XVXA 4NQZA 4HWGA 4G67A 4EFKA 3EVGA 1JFRA 3L0ZA 3M3DA 1ST2A 4NLKA 1QHYA 1D3AA 3H0KA 2WU8A 2P9HA 1Q0LA 1UMCB 3FPJA 1N2ZA 4YAEA 2ZUEA 1WZNA 5CJ2A 5FLEX 4RELA 3A4IA 4EO7A 3OJEA 1RWXA 4WDQA 3D4OA 2WJ3A 3PEFA 5EZSA 3RUPA 3E1KA 4A0QA 1HFJA 4B9LA 3T38A 2OZVA 4QRDA 2OXEA 4I2CA 4X3PA 3H16A 3JSXA 4P1ZA 5BQOA 1E1NA 4N0MA 1IB0A 1TK9A 2EKBA 2PUJA 4GBGA 5HCNA 3KT8A 2YUIA 4KLGA 5CGQB 2VTBB 2CLDX 3VNQA 2R6AA 4OJYA 4XM0A 1M1YB 1KEEA 1FPMA 4TL6A 1IMOA 4U9UA 3DEAA 3TXXA 2DWUA 4WY2A 5CMLA 1QF7A 4KO1S 1Z5VA 3V48A 4HWPA 4MAAA 3AH8A 1U4NA 1IIPA 3ROZA 3QPUA 3PRKE 3S81A 3R4CA 2ALZA 3SIPA 3WOHA 4M54A 1A6SA 3GEPA 3X2SA 4PEVA 2CVFA 3AFNA 1OFUX 3TPFA 3CP8A 3IUEA 2RH5A 2QN7A 4YGYA 3C8ZA 1TZ2A 4LSWA 2QZZA 1RRCA 3QVLA 1PR9A 1IY2A 4EG4A 4CL2A 2CLSA 4R1QA 3HQ4O 3A0HU 1XN4A 3EEQA 3SMQA 1JI3A 1JXAA 1J2UA 2HPVA 1A2KC 2C5AA 4HQFA 5LQSA 3NO4A 2WG0A 4YJKA 4CLHA 2ZSKA 4JXZA 4HOYA 1YHYA 1XROA 4HGPA 3WVNA 1PIWA 5AIAA 1T3LA 3EW7A 2YC2C 2UDPA 4WJZA 1PRYA 3OJFA 1DFIA 3GFFA 1LB2B 1V8DA 4BFWA 4EFLA 3G8AA 3OQ6A 3MCAA 4W5RA 2FUKA 4RK4A 1Y4DE 4Z8XA 5ESRA 2O2JA 1FP7A 5G5HA 2AX3A 2ZM5A 2XT6A 4BMZA 4IG9A 4RMGA 4G0UA 1H6DA 1O97D 1YE3A 2IOFK 1DJNA 5TMPA 3F2BA 1Z73A 3HC7A 1J1IA 5GTHU 1SXJC 4TTQA 3BT7A 4EBCA 3WBBA 3LD9A 1M2KA 2P4SA 1ZWKA 3N2KA 4FLEA 1KZ7B 2I6TA 3O9MA 4TMZA 1KFBB 2GVNA 3SDZA 4B32A 1T1SA 1F60A 4IF4A 4Z49A 3A58B 1WHSB 4W82A 5CNKA 2HSJA 1QG2A 4C2UA 3QTBA 5IJXA 2ZYIA 4RPXA 1KP9A 4QWBA 4PAOA 4KSBA 1THGA 4IOMA 3VKFA 1FUUA 4RZXA 1JHYA 1SULA 1O58A 4JLKA 4QZGA 2QUBA 4EW1A 4B6FA 4A7PA 4K88A 3QA9A 1IOWA 1SOAA 1NQWA 1D2RA 2RHBA 4G3IA 1Y34E 3JU3A 1NHGA 4RGYA 2VT3A 4EZEA 4MWGA 1P77A 1VRVA 4XDYA 1RZRD 1IZ8A 3NI2A 4FK8A 1E5VA 4KN8A 5AHRA 1VP3A 4BB5A 4KLEA 2DF4B 2J3EA 4R69A 4GE0A 1LNQA 3BGSA 1FPQA 1DEKA 1TA9A 1SV0A 3QLTA 1TO2E 4WNCA 1QGUA 3F5AA 4B6RA 1FFBA 5EJ4A 2PL5A 3OLQA 4A27A 4Y6LA 3I53A 3GY0A 3O8BA 2O0LA 4CV0A 4XB6B 3ZKWB 3DFMA 1GTZA 3L6EA 1HFKA 3TS1A 4P81A 1GT91 2PXCA 3BJZA 3FMFA 3P2EA 2BKAA 3C3YA 3GJZA 1JBEA 1ZR4A 3AUYA 4EZ9A 4XQ9A 3AEZA 4QFBA 2PGXA 4P34A 2C8JA 2IU0A 4F6LA 5CFLA 2XMPA 4IYRA 3V9AA 1COOA 4TWBA 1R9GA 1C29B 4H6VA 1UEXC 3IIIA 2QM8A 4Z1MA 4B4KA 4E70A 1NK7A 1WDMA 3FR8A 1GZ5A 4QXOA 4IJQA 1T36B 5BOLA 1LV7A 4KLFA 4YXWA 2LNDA 4IP0A 2F44A 1DINA 3LY7A 1BDMA 1UKEA 1AQLA 1M72A 2XUJA 3E1SA 4GC6A 1O03A 1TE2A 2BZFA 5EGSA 3MWEB 4YR7A 1WXXA 4AWXA 4N3CA 1S76D 1ULAA 1DZIA 2WWFA 3KKZA 2A9QA 4M36A 4QUJA 4JJ7A 2VUTA 3TSCA 4IUCS 2D62A 3PE6A 2XJ9A 3ICQB 5KTNA 2PXAA 1GFSA 2V8BA 1WPRA 3G23A 3U81A 2V6FA 1IZZA 1S3IA 4P7FA 3REQA 4AUEA 1SUAA 3KOXA 1CWUA 2HFKA 4DT1A 4DIFA 3VPSA 1JYFA 2YHIB 2DT8A 1ANKA 2D1RA 5CP2A 4C7MA 3H5AA 1USIA 2W2LA 1ODIA 1FVOA 2DQYA 4J49A 2XXAA 1TU0A 3LUFA 3GRCA 2Z6AA 4QZ8A 1TU4A 4BY9E 5LC1A 1X9HA 2X6QA 2CNOA 2PWYA 4RPKA 3GJTA 1F06A 2PGNA 3HB9A 4S0XA 5E7IA 1SXHA 3QZ8A 1LZKA 4MUBA 4XTCS 1JR6A 5JV5A 4ALNA 2GJ9A 2A0WA 4OL0A 4IDDA 2ZTCA 1PF7E 2F9MA 1MVNA 2FMXA 4TUYB 3AK4A 3TD2A 1MO2A 2PTGA 2XT0A 3GYGA 4B9TA 1Y3FE 1N5MA 5CCBA 5EIOA 1IXZA 3D2AA 3FVWA 1AUOA 4X7RA 2AWOA 2HU5A 3L49A 2XA1A 4MLDA 3M9OB 4RVHA 3BMXA 4FXPA 1T1JA 4C78A 5JQGB 4GPIB 3K70C 1X6VA 5KFKA 1FLDA 1U2GA 2A59A 2VPWA 3IAM6 1FTYA 3BSFA 5ALVA 3LGXA 4CR8A 1TA0A 2Y93A 2I22A 4FLMA 1GPMA 4YFVA 4KTQA 1AF7A 3CX4A 4B43A 4E0DA 4JK1A 1UBOS 3SSMA 1B14A 2VQ6A 4PX9A 2IIVA 3RYIB 2JFFA 4Q7LA 4LMPA 1NVVQ 5ILGA 1KS9A 3GIJA 1TM5E 4ZIRB 1V8OA 4FQ8A 1OXUA 4IUYA 1QGDA 4YLEA 2A0FA 2ISSD 4BAGA 1Z0SA 2QMEA 1R5NA 2GNPA 1B6TA 2CDRA 5L3SB 4ZDIA 4DDKA 1WO8A 2D2XA 1UK8A 4RBNA 3DOFA 4R6XA 3R8XA 5BSWA 4LJ8A 4M60A 2BKUA 2VP3A 2H9YA 3EWNA 5G0WA 3CX6A 2D1FA 1BS2A 4F2GA 4EB0A 4MKGA 3SLRA 1NFRA 4P82A 3LHIA 2M98A 2PGLA 4Q93A 2EU8A 1Y5RA 3W2TA 2XNJA 4FGSA 4C14A 1UJ6A 5AJZA 1OGJA 3UGQA 4KPGA 3GLSA 3ZE6A 1LJ8A 2HF8A 3OIDA 1AO3A 2FSUA 1QG6A 1DX4A 3H5WA 3KHLA 4PO3X 4EG3A 1ULUA 1GA6A 1TEVA 4IIEA 1EZZA 4QLBA 4Y9DA 1AM4D 1ULBA 3GC6A 2JD1A 1ZXXA 4DNOA 7ICHA 2JDIA 3BTSA 3CTMA 3T9EA 4RTKA 2OCLA 4NZZA 2GARA 2ZRNA 1NW7A 2AD5A 3IMCA 4KSYA 3MEQA 1I24A 1PP4A 3U4AA 1H5UA 4LXHA 1JLLB 1Z82A 3FCEA 2F3NA 4JSYA 2O8DA 3Q2OA 2KS6A 1KVUA 1A95A 1CZOA 2FW6A 4S1OA 4IL6U 2JJMA 3ESYA 4Y6SA 1YZVA 1DQSA 5LMNB 3LFHA 4OXRA 1SR8A 4BX8A 3A9TA 1LI7A 3PUVA 2G9NA 3O26A 5U9CA 1JJFA 3NH6A 2BP7A 3O84A 1B8PA 3OZVA 5BP7A 5BN4A 1JEDA 5DYIA 1R9JA 1RYYA 1MEOA 4GMXA 4YRQA 5I9IA 3W9UA 3GF4A 2BSAA 3EVCA 3VSEA 4YR2A 2B4QA 3F7NA 3VH1A 4MI9A 3AERA 5BO5A 1AZSC 4K40A 1Q77A 2RHWA 4OQ4A 3O38A 1L3UA 2GPTA 4JOBA 1B8OA 3EA0A 1E0KA 5BSFA 4GMDA 5FYDA 3CCFA 3CLVA 4J03A 4V03A 1JQ3A 4I7EA 2QX4A 3WK6A 4PLFA 3LQQA 1AHHA 4MVCA 1ETHA 4F21A 2JIPA 4RSMA 1VSTA 3AZOA 3S7ZA 4CYMA 4D6XA 3PT9A 4JYPA 4EPYA 3LPLA 3CH6A 2QP4A 2XHEA 1NV9A 3EVAA 3T1QA 3KT3A 1FIQA 3IXLA 4MDYA 2PD3A 2P9TA 1FW8A 1M2WA 2HHXA 1GSAA 5DCYA 2A4KA 4H0CA 2A9VA 5C5EA 3FYUA 2HDNB 5L6MB 3PZPA 3BWCA 2P67A 1E0DA 3OE4A 4QUIA 5AI0A 1LBIA 3FDXA 2FW1A 3QHAA 5LZ8A 3HV0A 2LIPA 3QA3E 3PU6A 3W7BA 4ML3A 1GVHA 1F5SA 4GXRA 4POOA 3D7NA 3WRXC 2YWEA 3I92A 1MQ2A 1CQWA 3O74A 3TM4A 3D4IA 2ZIWA 1QH1A 4CR7A 4G37A 2A92A 3HJEA 1ZNXA 4QFCA 3R8CA 3H9JA 3G0BA 2JD2A 1E3WB 2WSLA 4LHYA 4B4OA 5F52A 5KTPA 3PXAA 3QUQA 1W25A 5DULA 1NYRA 3OX3A 4ASUA 1QZZA 3AFMA 2EATA 1IVSA 3FXAA 2NXCA 2WFZA 1W30A 1VPTA 4RFVA 2FFQA 4JLJA 4FMDB 3VPAA 4GKKB 3KZ1E 1X1QA 4HDKA 3CU5A 2WEKA 4TLEA 3NANA 5EIBD 4ED8A 5FBWB 2WV7A 2ZKLA 3A6LA 1YRBA 4JP3A 1MAAA 3AUFA 1KTQA 3GCGA 1FP4A 1XVAA 3G7NA 3VR5D 2C4NA 4NY8A 2GZ1A 1DWPA 2IS1A 1M9NA 4Q9NA 4FYXA 3LBIA 1CUDA 2OWOA 2E4AA 1F1JA 3JATB 5LBIA 1I2BA 2ZBPA 4MIOA 5IEBA 1GXSA 5J0QA 3LHFA 5JVDB 3G6YA 1FLAA 1IBLB 1YKFA 2GN6A 2H17A 1L5LA 2LXNA 4BO2A 3P0RA 1N2BA 2LV8A 2L19A 1ZR2A 3QIVA 4UFPA 1V47A 2PWAA 4PXYA 1JHPA 5IWAB 2F7SA 1XJWA 3VZQA 1KI9A 2YVKA 3DGEC 4FEGA 5B7PA 1UA1A 1WMDA 3E22A 3GUZA 1VJTA 3JWEA 5IC4A 3A26A 1GPWB 3E9MA 5K20A 2W4QA 4PSCA 1J0BA 4G26A 3OTWA 2C42A 1RQRA 3FTEA 1ICIA 4LXYA 1YBHA 3H6KA 3HYRA 1TUEA 3VI3B 4IQ0A 2O57A 3O4IA 3B8HA 2ZYHA 3O4VA 3ZQ6A 1LK7A 2ZSAA 1GZHB 2GERA 1C20A 1OXJA 3HKCA 1A82A 3IEXA 5K7SA 2G82A 4L22A 4I55A 4M9NA 3VJMA 4DIKA 5ALOA 5HQ3A 1DEAA 5INTA 4X84A 2Q4EA 5D01A 4O2AA 3PFCA 2KSQA 1SCKA 5FH9A 1B6SA 3SC6A 4KLIA 2HCTA 1H9AA 3KB6A 2X2OA 3FCUB 2HKIA 5FAXA 2X0FA 3QTLA 2H1IA 3RBZA 4C8LA 1RBZA 5A2GA 1ZN2A 4Q3BA 4RESA 2BFEB 1V7QA 2P9QA 2AN3A 2PD6A 2Q9AA 2BR5A 1ZJ4A 3AY6A 5REQB 4Z6DA 3ZZ0A 1TGYA 2AOTB 2OQVA 1FBNA 3PQ7A 2EGUA 1T2AA 4PC7A 1TT5B 2HX1A 1VJ1A 1KDZA 3MIIA 3LYLA 4R2XA 4M0EA 221PA 3WGMA 4KWEA 7MDHA 3A4LA 1A0PA 1CFZA 4XPZA 2VTEA 2DVMA 3VHXB 3BK7A 2YC4C 2JFQA 1GKUB 3QYFA 3FWYA 4IIVA 3KSMA 5JECA 1Q22A 3T1YB 1M5UA 1X7XA 2BGKA 4LJRA 4Y2UA 1FTQA 1WZIA 4LGMA 5LP6A 3R9IA 4JJAA 1XRNA 2NZ8A 5A0LA 2KLBA 4LVSA 5CVDA 3RSQA 3ICXA 2NO4A 3F8WA 1XZFA 1LGYA 1E7MA 3TLJA 4OHVA 5BPCA 4NL9A 1DT5A 1V3QE 5BQ3A 1XNGA 1AU9A 1U0EA 5ECGC 5AK3A 2E87A 4IDBA 1GAQA 2QD5A 3T5CA 4IIXA 2I2DA 3U1TA 2ZB4A 4U6NA 1TFUA 3KTOA 1ZBDA 5BV0A 3ZE1B 4F5YA 4NAVA 2HW8A 1JKMA 1FTNA 4L7QA 4YK7A 2HLDA 4C6TB 2F8LA 2PSFA 4LG1A 4GT1A 2YWGA 4QTUB 1RPTA 2D8CA 1NAIA 2G5GX 4CI0B 2NXEA 5EMKA 2WYOA 4AD8A 3B6EA 1R5BA 3MQ4A 1ZIXA 5JALA 4GBMA 1X1AA 2XLCA 4LOAA 1MHPA 4A0HA 9ICCA 3BIOA 2YXPX 2CK3A 3HJAA 1Q1GA 4Q39A 5TLSA 1C7RA 4ENWA 3S27A 3HP4A 5B5EU 2LDBA 3VC1A 3PHBE 3L1UA 1OIWA 3MBKA 2IP1A 4HK4A 8ICYA 4LWZA 5EQFA 4HQ0A 3ROGA 2I4MA 1P2GA 4M6WA 3UA4A 4GU5A 4ZH4A 2P9ZA 3WTBA 2Z98A 1Q0QA 4CG3A 4DNFA 3BE6A 2Q1TA 2UVQA 1EFPA 4KO4S 3HXLA 1MNAA 3BRSA 2BISA 1JTVA 2Q7XA 2IIBA 1YO6A 2CWWA 3I58A 4Q1FA 1JJBA 3QXSA 2NSHA 5AJWA 1EBUA 4K46A 3D4NA 4EY6A 3RS2A 3OEWA 3OLYA 3ZE0B 4BC0A 2PUAA 4CEJA 1N5RA 3LLCA 2H54A 1THMA 1N32B 1LBHA 3SENA 4OA5A 3LV8A 4DG5A 2XSZD 1TPYA 3MTGA 4GGMX 4ND3A 1NVXQ 2QTCA 2J41A 2CXHA 3BS4A 1GPYA 3DVRX 1KEKA 3CNHA 3LWZA 5IG2A 2NU9A 1RSZA 2ATIA 3N8IA 3K09C 3V1YA 2KJ5A 2J3MA 2FWNA 4ACAA 2EARA 4C03A 3AVVA 3VZDA 1FTWA 1PU2A 4UAWA 1KKUA 4IXTA 3ZWAA 4WK4B 1IM8A 1L1EA 2JJ1D 3ZLJA 5I5EA 2GM5A 2BM1A 3BZBA 4FX5A 4POAA 3B3GA 4LHZA 4ER5A 3FUTA 3L84A 4LYHA 4ZT2A 3W6PA 4CGZA 1E4EB 2APJA 3F2DA 5JAUA 2HBYA 1XE3A 4IRDA 3U40A 1MRSA 1M75A 3LXUX 4JIGA 2O2DA 2HHQA 3VZRA 4FC7A 1P17A 4CKYA 1Q11A 3B6IA 3LNTA 2FKNA 2PGDA 3ZHRA 1MJNA 3O93A 5T4HA 2LYHA 5BUCA 4R5HA 2XOXA 2QD1A 3UMBA 2DPHA 1IH8A 1ZMOA 1PNTA 3MWKA 5B1HA 3ZKAA 1RLIA 4QPDA 4CODB 3K9WA 1KQNA 4EYKA 2O8FA 3FMIA 2Q6TA 4IM7A 4V0OA 1IN7A 4F5NA 4KEAA 3FIJA 2IYOA 1BS1A 3JQGB 5C32A 2PV7A 2C2OA 3A32A 2H1LA 3PIIA 4OTZA 3I1YA 1QE3A 8ICJA 5KYUA 1EE9A 1XZIA 3VPFA 3E1GA 3D6MA 1IATA 3M6AA 1X7GA 2AOUA 5KG1A 3EODA 2I7CA 2EW1A 4EG0A 5T4FA 3KR0A 2FMQA 3CKMA 3LDFA 3L41A 3SZLA 4W8GA 3RFFA 4K9NA 5DCWA 4YJHA 4DVJA 2I3GA 4ZC1A 2J9YB 3AGQA 4G0XA 4L6AA 4ZYZA 3E3AA 2AXQA 3HN7A 5KWSA 1D1SA 2VJ5A 1GAWA 4MHOA 1YR9A 1H2FA 4MYRA 3L4JA 8ICHA 1QQTA 1Y3IA 2R86A 3KPJA 2ATXA 3L40A 1PQUA 1HURA 4RANA 4PAQA 4UEWA 5IJ9B 3L0YA 3ICCA 1VE5A 5F3DA 3OIUA 1KZ9A 5DG7A 3EIUA 1EJ0A 2R6FA 1ZQWA 3SY8A 1D04A 3NOQA 1AB6A 3D0OA 3GEHA 4TS3A 1RKQA 3JSAA 1MOPA 2D2EA 4X1KB 1U28A 3AR8A 5CLFA 4BFTA 4RSRA 1Q7EA 4EYIB 5CYPA 1US8B 3PJGA 5JDCC 4ARZA 2LRHA 1U9LA 5H3LA 1YJXA 1P5FA 3AU9A 3MJ4A 4BUJA 2CMKA 2D0DA 4WESB 1QC5B 4M1ZA 3BK1A 3NWPA 4JJFA 4NL4H 2DGZA 2IZZA 2DR3A 1EZ1A 2VDLB 2QTNA 2VCHA 4B79A 3PGKA 4YRTA 3MPOA 3RTBA 2VYVD 2GEJA 1X9SA 4P0PA 2IHVA 4ZANA 1RC8A 3HX0A 4X7BA 2BFCA 3GA7A 2GAJA 3KIPA 1JDSA 1JDZA 4FYIA 4D3ZA 2FLVA 1FMFA 2B8NA 5K0JA 1IIRA 2GFQA 3L7BA 4GZLA 3UC5A 3W06A 4BO7A 3KJZA 4EMBA 4W5JA 2AMJA 2H5JA 3IPXA 2A3RA 2QLFA 2DFTA 4FDTA 5IH7A 5IIOA 4I50A 3OCWA 5KFJA 5J2IA 3T6KA 3KZVA 3RR8A 1KBUA 2DPGA 2HVIA 1M1XB 1AS3A 5I7RA 2Q6KA 4QJ5A 3O4JA 4RUAA 1P6UA 1PHRA 1N6OA 2NYRA 1A5TA 1FX1A 5JZBA 4K8RB 1N61A 1RPNA 1I7DA 4ENPA 3WGIA 1H66A 4P53A 5CCEA 3CF4G 1PV4A 2CFRA 2Q3MA 3P9ZA 1QFZA 9ICBA 5JZMA 1WUKS 2QQEA 1ZHOA 2WA2A 3PQ3A 4UXIA 4NE7A 2QU8A 8ICCA 2FSPA 2E82A 4S35A 5KC8A 4JJ4A 2C58A 3NORA 2G3YA 2FWPA 1XQ1A 3GNTA 1TQ8A 1GG5A 5I7UA 3FMOB 2GN0A 4FHEA 2BEWB 4H7PA 1XSPA 2IWRA 4BB9A 2ONJA 2A3NA 4GX2A 4QGFA 3GUUA 3IMFA 2CC2A 3UG7A 8ICRA 1B26A 3BM5A 1NUQA 2K8AA 1V85A 2K8CB 2Z5FA 1QMGA 1ZC3A 2XOKA 1DXHA 3VAZA 1XRMA 4LXUA 3B1KA 2RH8A 4FR2A 1V5FA 3A4YA 4ZJUA 4Y30A 3FDIA 4CF3A 2AFVA 4U7CA 5DM4A 1YFJA 1IZ0A 1R4NB 4TYMA 3BXOA 4JP5A 4RPGA 4AKHA 5BNWA 2IUFA 3SG0A 4Z0PA 4JGBA 4QDKA 3LX6A 4RPIA 3A1FA 1B0AA 4EY3A 1ZN8A 1TGVA 4I1VA 1KFCB 3DFZA 2AF3C 2VTBA 1ZIYA 3FYHA 5K8VA 5DHQA 5JH7F 1M1YA 1SG0A 3FGNA 5KFPA 4EPWA 1PR4A 4DMKA 3ZD9A 3DAPA 3HUEA 4HXEB 4B5LA 3AHGA 2RC5A 1XZKA 4RGBA 3ZX4A 4FYWA 4A8TA 1E5DA 4RNMA 5AT1A 2G09A 1HJPA 4OQMA 4OXNA 1KJYA 2OV3A 1NJGA 2AE1A 3DTNA 3MD0A 1LRJA 4W6QA 1T94A 4DJDC 5T4BA 4M1TA 4U02A 3TLZA 2SBTA 5C4GB 2AXTU 3KQOA 3T5DA 1KRHA 3LUCA 3OLZA 3EX7C 1UT5A 4RULA 3H5OA 1ZQLA 2G04A 1BH2A 1YKGA 5K6RA 1NXXA 2XUGA 1CJCA 3B70A 1T25A 4FDLA 3NC1C 1DJMA 2VOEA 4UD6A 1SOWA 2HMVA 1URPA 1A8HA 4B47A 2H2HA 2IUSA 3AIKA 3FOEC 2D6FC 4AY3A 1N5DA 2PX0A 3KCQA 4EB8A 4HNUA 2KSOA 1N2SA 3HBLA 4H4EA 4NKRA 5K0ZA 1NA5A 4XIJA 1JDBC 3A10A 5AJTA 2WHQA 1L8AA 4DQXA 5EIXA 4FE7A 2ID8A 4NOLA 3CW2A 1F2TB 2JH8A 4ZYVA 4IR9A 2YYYA 1EBBA 4ZVUA 5AW1A 5BURA 2IXGA 3CRVA 2IHUA 3K8ZA 4OOEA 4EYOA 3Q8KA 3DOUA 2B6GA 3I04A 4CF5A 4UQOA 3SAFA 4G8CA 2P1ZA 1BE1A 3IOMA 4NYJQ 3AL0C 3MILA 4MV5A 5H4HA 1HZJA 3SFZA 4HYQA 1CQIA 4JU9A 4YAKA 3CM0A 3RIXA 1L5KA 3K2BA 4D99A 3CUEF 1W75A 4RPCA 4J3NA 2QM7A 3MXOA 1MGOA 3B2NA 4CCHA 3N8KA 2ZYWX 4JA2A 3DF9A 4KLLA 2QUJA 2G36A 4WZAB 3WGVA 4KNYA 3SS8A 5GTIU 1HL7A 4LVUA 1DUSA 5E0OA 3WV5A 1UMBB 5C18A 3EUEA 4Z51A 1N6PA 2Z1NA 2NOAA 2OCPA 3MTBA 3R1IA 4HNRA 3U7QB 4RKYA 5CA7A 2J3QA 4LA4A 3NUQA 1XIVA 3CLUD 2J45A 1AO0A 8ADHA 1EINA 4Y6QA 3M82A 3EPPA 1PEYA 1T3SA 2Q5JA 2FLKA 3NKFA 5EXTA 2Y05A 2ATLA 4AJ4A 5TMEA 3KO8A 1HTTA 4FTWA 1E2PA 2XMZA 1IZ9A 1ICEA 4ZO4A 2ACVA 4DLEA 2NU7A 1U0GA 1Z83A 3GLFB 3ITEA 5FBVB 3LUHA 2YHAA 5DB4A 3PD1A 1UMKA 3IILA 4GZ5A 1GEEA 4IDEA 2H48A 3DAYA 5DLYA 2NLOA 3NIBA 1OKKA 4HSGA 2YOHA 4MUNA 4BQPA 2WPDA 4ILEA 2X9GA 2OENG 4RLHA 4BEBA 2X6RA 1Q0SA 3OZ7A 4E88A 2OQRA 1JEEA 2QG4A 3I1JA 4GR5A 4U9IS 3OHBA 2TYSB 1FE8A 2CEAA 1ZQVA 3HG7A 4U7WA 3CA8A 4X66B 5TQ2B 3SC2B 2ZI3A 1IBSA 1QKIA 2IA5A 4L9WA 1XLTA 5H7XA 3OEEA 4YJ3B 4HAOA 3VPCA 3RSLA 1DHTA 3PUJA 3K05A 3S1LA 3A7EA 3RKSA 1IHUA 3ND5A 1T36A 3IUMA 1L4LA 2P0EA 1X39A 1YQQA 1VMIA 2ORED 2FMFA 3KHRA 5AM4A 3TLCA 3IH5A 4Q18A 5HUHA 1JN3A 1GIAA 4DA7A 4EJSC 1SG6A 3R20A 4GWKA 1SXJE 3AI7A 5I3CA 1CRXA 2C3UA 3CF4A 3UANA 1ISGA 4J4HA 3ZK7A 3MWEA 1M0SA 4YREA 1N7GA 4ZHQB 3NYRA 3ZWVA 1RJFA 2PDAA 3BWDD 1YCDA 3F78A 4XD7A 1RQXA 1QOZA 4KXFB 3F5FA 1I3NA 1BE6A 1G5RA 3KOZA 1G0OA 4CTJA 4Y0AA 3QFHA 2JIZD 1IV8A 1E3DA 1IUKA 4P4TA 2XVAA 5KT3A 4K2AA 1F0YA 3TQ1A 1VGQA 2YHIA 4YMVA 2OH2A 4ND4A 3R5XA 5BMVA 2DBQA 4FYHA 2PV0A 2BSXA 2QN3A 4TQAA 1DAFA 3H1EA 4G5XA 4QDJA 2P2GA 3KNZA 4ZAZA 1N4AA 4UJ3A 3NEAA 4HGYA 3W9BA 3SE0A 1EB9A 3EPJA 3MERA 3AKYA 4Z2YA 1ZH2A 5ENDA 1RQ2A 2XB6A 1LDNA 4F4JA 1E94E 1S01A 9ICNA 3T5LA 3W04A 3IV9A 3KWFA 4RKEA 4GOND 4Z6KA 3AVTA 3BCHA 4L8VA 3RQIA 4EZ6A 2EQ5A 4CN8A 4ECEA 4EK9A 3KSDO 4QEDA 3UK6A 2GK6A 2PGAA 3KKMA 5G53C 2XVYA 3A3PA 1KXJA 1Z5WA 5E9WA 5J8YA 2JARA 4IFTA 1KO7A 3MJDA 5T8KA 4X1IB 4QSHA 5GJWC 1TCBA 1HE8B 4QW8A 2EFGA 5J23A 5CYGA 2QHXA 2C78A 4ZRDA 3V4ZA 2GQ0A 3U39A 4NZOA 2B4YA 1L5RA 2V1UA 2KLHA 3AEKB 4QAJA 5IJWA 3RYIA 4DCJA 4R3NA 4CETA 1Z39A 3GI1A 5I3ZA 2Y92A 4F4KA 1S4QA 2AR9A 1F3LA 2COKA 3Q7EA 4ZIRA 3OCZA 1IUPA 2QMQA 2GCOA 4MVJM 2CKDA 1WTCA 1IPHA 3F47A 2QN6A 1ZVKA 1E8MA 5K03A 1O6FA 2AI3A 2ZJAA 2AFRA 4HVAA 4K6HA 2IOFA 5F77A 1FOEB 5C7OO 1PUJA 1N3IA 2V7XA 3IQHX 5ALIA 2O05A 5D87A 3QEBZ 5ETJA 5TF0A 1C3OB 3KQNA 1EIZA 1BQ4A 3AR9A 3RGGA 4GZ3A 2VP4A 2Y0CA 3QBDA 4WL0A 4S2EA 4AF6A 1IM2A 2E8OA 4CMIA 1KOLA 1SNYA 5JROA 1RIIA 4RC9A 4B3TB 5KSZA 3KELA 4KIGA 1QOPB 4NNPA 4K8OA 3QVWA 3UAYA 3OCJA 1MDBA 5DOVA 4BV8A 4X20B 1KSGA 1W5TA 4UNRA 2D5IA 4A15A 3NBYC 3OIVA 5JCOC 3N28A 1OTYA 4FX2A 3KD3A 2VJAA 2F43B 2OCAA 5BSTA 3ECAA 1AGNA 4KQGA 3QJ5A 3RFCA 3VNVA 3A1NA 2Q1UA 4QW9A 2FLPA 4AO7A 3EW9A 1JQ5A 4U2FA 1KYIA 4TSFA 2FPLA 1JLLA 4AYXA 4F97A 3CO5A 3THYA 3VU8A 3C6ZA 6GPBA 3LH5A 4HBGA 1QGYA 4QX6A 1TI7A 3PHHA 5KFMA 1NKBA 5CDSA 3QP9A 2GK4A 4JIMA 1U2PA 4Y2XA 2WWIA 4X0EA 4AQDA 1XP5A 4KGZA 4DV1B 3L6UA 2PJRA 3V8RA 2ZSEA 5F1KA 3PJFA 4PO1A 2Y8EA 1D2EA 3JYHA 3EJWA 5LN1A 2Q3FA 2ZYTX 1IBRA 3TB6A 3OZCA 1QHHB 4RK6A 1WPXA 5CA0A 5IKOA 4ZOCA 2QROA 2YJ4A 3P97A 1ZOLA 1NXSA 2D13A 3ZVNA 1U0SY 3PXBA 4MWTA 5H9WA 2KHQA 3QKWA 4F8EA 1FDTA 2Q5CA 1IBMB 4J0EA 3EXIB 4YCBA 4TVOA 3TKYA 2AZMA 2ZM6B 4XWAA 3GEBA 5DT2A 5KT6A 2VR1A 1Y7HA 1PJ4A 4CQLB 4CQNA 3EGDA 3T7SA 1XTTA 3IHWA 3G5MA 2PD4A 2I2AA 5JJBA 4YRIA 1TZJA 1HETA 4E13A 4US9A 1YZHA 1JZTA 3CXRA 2G1KA 1NFFA 1VJRA 2PL3A 4P38A 5IKMA 2XZPA 2P3QA 4BVAA 2CBXA 1Z4JA 4NXZA 5CCXA 5TISU 4D2IA 2PO5A 3NNNA 3E2IA 2REOA 3U4CA 4RZSA 3AV3A 1J21A 5CH5A 4ZCMA 2ERYA 2RI0A 1XCGB 3LKVA 3F3SA 4M8KA 2ZJ1A 5LZ7A 3VZSA 3N5CA 1F9AA 5B1EA 4FCTA 4YP6A 5KL1B 1Z63A 4B71A 4HT3B 4RU9A 2OMEA 4ECSA 4L08A 3WRYA 1QB8A 3WB2A 3QNWA 1RM6C 2XCOA 2SKEA 3KUKA 2OOKA 3AL2A 4ZRNA 4UAYA 1XQ6A 3QU7A 3GZJA 1QFXA 1V5GA 4D1YA 5KFCA 3BN3A 4DSEA 1LF0A 4ABYA 1XC7A 4PPFA 3RUIA 1P81A 3T5AA 1MCZA 2H2FA 1ZEMA 3LKDA 2ZYDA 3T8YA 5IKEA 2AG0A 5F1YA 4U00A 3B6KA 5DSZA 3FLEA 4HDMB 1NQOA 5D7BA 3PFWO 1MB0A 1TJ5A 1UBFA 3CISA 4FN5A 4CCYA 1ZQJA 2W11A 5JTTA 5EQTA 2AFIE 3Q8WA 3TSZA 2VPPA 3VNUA 1NBWB 4L0DA 3FTNA 1J0AA 4IDHA 4UATA 1XCMA 5TVGA 4BDPA 3GP3A 1YHNA 4Y1EA 1QH9A 2V96A 4HGRA 2FUCA 2H1FA 1CZNA 3VU9B 4YUWA 1TADA 4J1NA 1J8QA 4HWSA 4OB7A 1R6BX 4IGIA 4QJBA 5KHAA 3LT2A 4J3FA 5P8WA 4RDXA 2OSVA 3JATA 3SYKA 3NZEA 4G5YA 4RE6A 2IXAA 2XUOA 5DN6A 2WU3A 3LRTA 3TNJA 2IYNA 3ZQKA 1WOYA 3GJ0A 4MS4A 4A23A 2PFOA 1N62A 2YIMA 1DKUA 1JFFB 2A9JA 2IITA 2XCUA 3GEDA 1Z08A 2CNNA 3E0XA 3BJIC 3C6BA 1OHHD 4EJ0A 2JCVA 4Q4HA 1DMSA 3T5KA 1WUIS 3OJXA 1RI1A 5THQA 3ZHBA 2NPIA 2BE7A 5PNTA 5ICMA 1YZFA 3EMKA 4CMCA 4F9FA 5NULA 4YT2A 2XE8A 5CA1F 4DM3A 5KKCA 3DVAA 1T2NA 1RT9A 1E59A 2GH1A 3U13A 4KPFC 1A72A 3CUTA 8ICBA 3ABSB 4DZZA 1NSFA 3X1WA 4ZYTA 2ZETA 4G86A 5AK4A 3C87A 3EQZA 4GNRA 4AN1A 1C1HA 5DM0A 3WYCA 3PIDA 3NDJA 3LHSA 4O3OA 3U09A 3R5JA 3H1FA 3CZPA 1NM5A 5JWHA 3RJIA 4ZCSA 3LBYA 1HEIA 3B1ZA 3WWYA 3SHTA 1WLSA 3I9LA 4GDMA 3K6KA 5HTOA 1RADA 5A9TA 2UVDA 4LHSA 4IIUA 3QFFA 2GEFA 4XVRA 4CQMD 3K4HA 1OU0A 2G9UA 3T7IA 4DMMA 3NUZA 1G7SA 2TMKA 5EAIA 2YMPA 1EH5A 5B6IA 4MTCA 3JR7A 4TL8A 1UK9A 2BFEA 4D41A 1MB4A 3RJEA 4NH4A 4LF6B 5REQA 3BBPA 3WZLA 5THKA 4DOAA 3K9CA 2C5BA 4XA8A 2YFQA 3CKLA 2IYSA 1U1FA 5FTMA 1A7KA 2X2PA 5J2AA 3GFVA 4RHFA 3DL0A 4IF6A 2ZJ2A 4Q4DA 2A86A 2XEXA 1GLNA 5CTJA 2W9AA 4ZXPA 4BKUA 1KF0A 4KRXA 3FZGA 1QAQA 4FXOA 2PVCA 5SICE 4A16A 1MIOB 1FRZA 3VHXA 4BO3A 2EIXA 1NYLA 4XCXA 4IX1A 1PTJA 1JJVA 3FNQA 3WGKA 4F5PA 1WAMA 4RKRA 3JQ6A 3JZDA 3C7CB 4MINA 1L8OA 2OR3A 3IHLA 4ZVOA 4IHJA 5ABPA 2Q27A 5LQUA 1OZAA 2EFJA 3E9EA 4LGYA 1UQTA 1XEWY 1EP3B 1BTOA 4OL9A 2VWHA 2YKGA 4QT4A 1IDN1 3USZA 2QY6A 3KQYA 1U4SA 4N8SA 4L74A 3V6HA 4OPMA 5ANRB 1RU3A 3D1JA 3KB1A 3NW9A 3WLFA 5F5XA 2X7JA 4QWMA 2EERA 1VG0B 4E7OA 3ZHCA 3U6BA 1WNFA 3UCFA 4YY3B 3MF4A 1QQ5A 3K8QA 1BCSA 2JCYA 5M29A 1D9XA 2BLLA 4FOSA 3MS2A 4CDNA 4M8SA 1GRRA 3K9QO 3PVSA 3MOSA 5I51A 1I9CA 5CM9C 3ZR4B 4IOLA 1XA3A 4BNHA 3WAGA 1O6BA 1A2BA 4MUGA 2G7MC 1UBSB 4D4LA 1QV7A 4Q45A 5FOSA 3DMNA 3KPYA 1K0UA 1JU9A 5DG8A 1W88B 2H9IA 3MJSA 1ZEJA 2VL7A 1BVSA 2ZBVA 3ER6A 4WCFB 3TCKA 4F50A 3LWLA 1T6XA 1DWOA 2HBKA 2HBRA 2IMWP 1YDWA 4CRWB 4PVCA 5I7FA 4MPDA 2OBLA 4EDFA 3E0FA 5D1HA 2ZKIA 3TR5A 1OFUA 1Z33A 5HMMA 1WXEA 5MN5A 3R6GA 5HXAA 3AQ4A 2OHHA 1W94A 3PUKA 4BNZA 2WU1A 5EIWA 2EBHX 4UE6A 1J22A 4TRNA 1W4BA 2QB0B 4E11A 2ZYVX 1G2QA 2DTEA 1XB2A 1ECPA 4DLNA 2FGKA 4JU8A 1PT9A 3H18A 2QPLA 4AJ9A 1X7HA 2KBEA 3ZY4A 4Q4CA 1CUBA 2RHOA 2X9VA 4OYRA 1W73A 1X8JA 2V5VA 1NTRA 3R2JA 3L8DA 4DSUA 1ODSA 4C0JA 1VE6A 1E58A 1O95A 3VM6A 2JGJA 3IG5A 5KYWB 4QZVA 3QELA 3HXTA 2BN4A 2R7LA 1SC3A 3EZ2A 4U3JB 3CW9A 1MENA 5DP1A 3C5WP 2EVWX 3MB5A 1X8LA 1L9KA 4Y2SA 3DBLB 1G20E 4YJ2B 4ME6A 5BYJA 3FLAA 3QW2A 2VF7A 3EA5A 1F4VA 2JEZA 4EA9A 7ICUA 1E4EA 5HE8A 2XAAA 3H6HA 4UCXA 2BM8A 3IPRA 3KEOA 1IQUA 3D0QA 1UUFA 1ZVMA 2LW7A 4ZYUA 1QO7A 2B35A 2XYQA 1ZOSA 4RQ1A 2W7TA 1M2FA 3SR3A 3H9UA 1Q3KA 1H2ZA 4E12A 4JX9A 1OU4A 3JQ7B 1D4AA 5FV7A 3ES9A 4EPTA 1CBUA 2WIDA 1TIPA 4GVPA 3ZWDA 4KQ1A 3G7SA 1VMKA 1EM8B 4HRYA 3PQEA 4KLOA 3BGWA 1GL3A 1UH5A 4NCJA 3UXNA 5JAOA 3LFUA 4K7JA 1XHFA 1X19A 4N39A 1H94A 3ULKA 4BQEA 1MQ8B 2Z5LA 1WL8A 4LX8A 3VMFA 3JQGA 3TLEA 2VPYA 1YAJA 2HA6A 2VPTA 3R40A 4C9BA 4C2TA 3UEOA 3PZBA 4TTVA 9ICHA 3FVTA 1BO6A 1VP9A 1GCOA 5EWLB 1E3LA 121PA 4Z5XA 1YASA 2WPNA 2WYVA 2UZ0A 3R77A 1F3OA 4JS0A 3C85A 2JW5A 3QKSA 3WIVA 4TT3A 3C3XA 3RROA 2FHSA 3H5TA 4DBLE 2AZTA 2P2CA 1EFKA 3G85A 1XS9D 3FPSA 2JGMA 3M6XA 4DSAA 1TO1E 2BFWA 1A71A 1P7CA 2ISQA 2WM9B 4AS2A 4TLLB 4DPKA 2IQIA 3PFIA 3V80A 2NTEA 5JDIA 1MABA 2ZTEA 3JVDA 1K4YA 3RJFA 5ALFA 3MMNA 4UAGA 4GYWA 4LFAB 1MJGA 1KS2A 1PK7A 1ETUA 3IMEA 3CNBA 1RWMA 1RW4A 3ZZMA 2WG2A 3KU4A 2X3YA 3JARA 3K7EA 4C3UA 4W9MC 4YP7A 1LUAA 1OB5A 4P3YA 4B3XA 4WFJA 1KMIY 4YUAA 3IE1A 3MAGA 4N5IX 4TMTA 4YCLA 3NHFA 5AVJA 4A0GA 2QRLA 3UAGA 2XW6A 4X1KA 1RIFA 2H1HA 2A5YB 4MMZB 2W0SA 4ETNA 1JF8A 4MR9B 4UB3A 1P5RA 1KI8A 1S96A 1CR1A 1E9RA 4U7TB 3U4QB 5AD1A 1PFKA 4M04A 1QS0B 2H0RA 3RTVA 3DDZX 1BNCA 3JWJA 1FFCA 4GNKA 3FOBA 1QC5A 1XZMA 4D26A 4D5GA 1LPOA 2VHWA 4X97A 3I2KA 3U80A 1JS1X 3LYHA 2OORC 3MYRA 3TR6A 3T7JA 1JNYA 1SOMA 4ZZIA 4OK5A 2OCDA 2IK8A 2SCUB 4HDRA 3C3KA 1Q17A 2NU8B 3D6UA 4BO9A 1CW2B 4YXFA 4NLCA 2W7OA 2ISPA 3S5UA 3Q4GA 1QO0D 1SHLA 4CLOB 4JI7B 2OKCA 2TECE 2XUQA 2M6KA 3FPCA 4DDUA 1J99A 4ZCRA 4LV6A 1GTG1 1P74A 1E3IA 3U7FB 5KAPA 1ZAKA 5I01A 4XYLA 1LDGA 8ICTA 2GETA 1QP8A 4DL5A 6ABPA 5CR9A 3W77A 4JYCA 3V8QA 1W7AA 3QXCA 5CLLA 1P4SA 3ORQA 4BB6A 5JC8A 2JJQA 5E2BA 3P19A 5CBPA 4YRKA 1BFDA 3AM3A 4Q9DA 2PRIA 1CUFA 4DYHA 1Q0UA 4DQPA 2DQZA 4F4HA 2N1BA 2Z6UA 4TVKA 1X7DA 4P4OA 2XTJA 2QPTA 1FU4A 3NFRA 3A6EA 4R8UB 1ZCBA 2W6ZA 4G65A 3M9LA 4RUCA 2ZW9A 3PW2A 4FGKA 5D00A 5C1PA 4MLPA 4ARCA 5D49A 1CLEA 2VBGA 1D9ZA 2AU0A 1UPUA 5FRDA 4UCWA 1QBKC 1Z8HA 2EKQA 3W2IA 1J2JA 5JO9A 3N53A 4MEBA 3RB3A 1EUZA 3D54D 2CMDA 3GNLA 3W5IA 4DJAA 1U6JA 1OLXA 2NTJA 2A0KA 4HDAA 1ZX1A 2WM3A 4I5GA 2C4VA 3ONEA 1UC8A 3FOFC 5JCJA 4DEXA 1QO9A 2P40A 4M9JA 4W9NA 2HXYA 5KX5A 4K0KB 1B4DA 4ZOLF 4DREA 4Y2TA 1M2GA 3NT2A 5AOAA 4G25A 3IVGA 4HR7A 1BQ3A 4HB3A 6YASA 4EATA 3O90A 5FI5A 3HJHA 4P2BA 4EVQA 4MVJE 2XR1A 1KQPA 3HCFA 1XDUA 3L9WA 3GPLA 5ED4A 2YJNA 2VJKA 3TZ6A 4XSHA 3HB0A 1R6XA 2ZTHA 3URKA 4B40A 4ED7A 4F56A 4CF4A 2JS7A 3GK3A 1SCNE 2OQIA 1A9TA 2GEUA 1T8TA 4B9EA 2DG2A 3AUJB 2VPQA 4IRKA 3IRVA 4I4NA 2QW8A 4U8GA 1CJTC 5KFHA 5FFMA 2QXYA 9ICGA 2QA5A 4MP3A 1I32A 4OU4A 1ZG3A 5CGZA 4OSEA 1Z2AA 3CMCO 1WMEA 2C5LA 1Z88A 1VDVA 2NNWB 4KITB 1M3SA 2ZEJA 3BRCA 4AW9A 4CQJA 3K31A 2E85A 1RZVA 3WADA 4XJSA 2IOHA 1Z0FA 2C2DA 4BJ3A 3OBIA 4XR4A 1F2TA 1JLHA 2CUNA 2QZJA 1M7HA 2OB1A 4KP7A 3MWGA 3RUAA 1LTHR 1MFZA 3SQMA 2QE7D 2AH5A 3OX2A 3CEPB 4UZSA 3KWMA 3KYDA 5KKAA 3TLBA 4YECA 1NW5A 3U56A 2FSVC 4OQPA 2AJTA 1XTJA 1B0UA 1E5QA 2PS9A 3CRW1 3TYXA 2OO7A 4DBLC 2OBNA 1SCDA 5EMNA 3P5BA 2P9JA 2FE4A 3UQYS 2EDAA 4PZEA 4M38A 3OQJA 2FUNB 2V0CA 5KDLA 4MOWA 1TCVA 3A4NA 3HUTA 1FFYA 2A67A 1NRXA 1U7HA 1B2LA 4F2HA 3FNHA 3JX9A 1P7ZA 3G5UA 2ASJA 2F3UA 4ZQEA 2I4NA 2ASVA 3JQCA 5KNBH 5P21A 1ZK1A 5JG7A 4FT2A 2ZBQA 3LOPA 2GPJA 2G4VA 3QXXA 3AI2A 3GUCA 3GZNB 1WJGA 3UK2A 1QZXA 1TQ4A 4MNTA 5DHTA 1G17A 1H0HA 4DA6A 1XZCA 4V0KA 2WNSA 1TTPB 2QNRA 4ZZ3A 2CJYA 1O94D 4QZFA 4M49A 1CR0A 4MW7A 1JAZA 3JQPA 5HQTA 2FHPA 1QFMA 2FW9A 2JI4A 2OV6A 4E5DA 3SAHA 4FJ2A 3DQQA 3K5WA 4LI0A 4LRXA 5AKLA 3DBHB 1LLCA 3VYUB 2CLOB 2DEUA 2FB9A 1X3SA 3ONFA 1LB1B 2F1KA 3HL4A 3RJGA 1Z00B 3ZGYA 2YYZA 3QU9A 2MSCB 3IG8A 1UWKA 2EZXA 4R2KA 4M9HA 3PPXA 1CY1A 5KPJA 3TDKA 3G1TA 2E4VA 2D06A 4O1IA 2N1MA 4MFCA 2UYQA 4DG9A 2YZMA 1UA0A 1L4BA 1X70A 4EY4A 2MYNA 4E1BA 2QE6A 2QM0A 1B1CA 4PW0A 4YAOA 2GESA 4PLVA 1JPUA 3IDZA 2BCJQ 2WWXA 3VVBA 4ISBA 2X4IA 2CFCA 2X4GA 3OC6A 3PXUA 3QBVA 1LQUA 3J81A 4Z54A 2GZRA 4XWYA 1N6NA 3K0CC 4IXDA 1DO8A 3KKAA 4YP0A 1U4BA 1YTUA 1YZGA 3UHPA 1DLJA 3KAJA 5DOZA 4FHGA 4BGIA 4F2PA 3BQ9A 4KN7A 4M2LA 3SC2A 4AMBA 1JNXX 3LZ6A 1H2BA 1KR5A 3QSYA 1QIJA 4YJ3A 2LBOA 1N6LA 1RBYA 3TH5A 3U3ZA 4UCQA 3IS3A 3RF9A 4HLQB 3GWGA 1V16B 1U81A 3C48A 4N5DA 5DHFA 1OVGA 4D79A 1BNOA 2OXRA 1TZMA 5K6AC 4XX0A 2CDBA 4R1NA 4AZ0B 3R3HA 1XMJA 4KWCA 1NR7A 4KB5A 5BOVA 2HK6A 3PYLA 1HT1E 3KS9A 3JQFA 3CUVA 1DAMA 4WA7A 2QVLA 3I39X 4ZHQA 3EUWA 3OFKA 2Y27A 3DHYA 4DDVA 3DZ8A 4NFYA 4CL3A 2OL4A 1TU3A 3OT5A 3TJZA 3WNQA 2FDRA 1KPHA 5KTYA 5F7ZA 1NULA 3TQHA 5E1MA 2H7YA 3CR8A 2LUOA 5C8YF 3MS4A 1XPJA 3GIDA 1EG2A 2DBYA 3DDNA 3GIMA 4IIDA 2ZJ6A 3ZCRA 2G9ZA 2FEWB 4UPVA 2BZGA 1MPXA 3V6KA 3Q5EA 2VDJA 4JENA 5DHAA 4FB5A 4ERXA 4XJXA 2GEVA 2TMGA 5CEFA 2YWBA 3TX6A 4YRDA 3QG5A 3CG4A 3PR4A 3R3VA 2Q1YA 1HH4A 4LBZA 5CVVA 3EUAA 4MWEA 4UVDA 3DV0A 3AHCA 3TACB 4MUMA 1J20A 5T41A 2PGOA 3DTVA 4EA8A 1ZI6A 1UBLS 4NU0A 3GT0A 1A7UA 4MP8A 1VHWA 4FGLA 1CEYA 5E3IA 3OQHA 5HQJA 4CF6A 5BUQA 2FG7C 2G6BA 3ASVA 3ZH2A 4YV1A 4M7WA 1M2VA 5KFEA 3JQ9A 1N1MA 4BQQA 4X1IA 1XC9A 5ALPA 3RRHA 1ODFA 2WQ7A 1HUOA 2FQXA 5BR7A 4BLTA 2F3QA 3PQ6A 3ZE8A 1W36D 2FPPB 2VSYA 2WUFA 1YVPA 5K0GA 2Z8YM 3AR6A 4C3VA 4KQMA 4EFMA 1NOJA 3U7HB 4M9SA 4JN6B 2RDIA 3KTAB 3AEKA 4LWOA 3HVKA 2DX7A 4D9HA 4JEIA 4AJEA 1RD4A 2QM3A 4A8JB 5JFGA 3SM9A 1ZQCA 3LQRA 3PK0A 4FD2A 5TPWA 7ICLA 3K0EA 4GZ6A 5CLIA 3GV8B 5CT9A 2GN8A 2F8KA 1C3XA 4MI1A 4BX9A 1UT6A 3VTKA 2C2BA 3DDSA 8ICLA 1ZQKA 2K87A 1NLFA 2FUG6 5GOTA 4BGEA 2R84A 3EDCA 1SZPA 1VMEA 2IX9A 4KVZA 4BZPA 4M89A 2KX7A 3AUTA 4LZGA 1OBFO 4XEHA 4U1RA 3WK5A 4MQLA 5IT5A 4EG7A 4UW9A 4JWMA 3GGOA 5DDIP 1GGEA 3BOSA 4FZ3A 2O3TA 2KN7A 3ANMA 4EHDA 3CVXA 4FW8A 1Y9DA 1P2BA 1NXVA 5HHIA 2KE7A 5KFLA 2HMXA 4C0AC 4W1PA 2DKNA 4ED0A 3A37A 2PJUA 2P66A 2G5PA 1KMQA 2J7KA 3UV6A 3ZHVA 1V8FA 2JZBB 2HHAA 4RQBA 1EA5A 3E35A 2JJ8A 1BHQ1 1XA4A 2HIMA 3NM4A 1GFWA 3C7KA 5EKXA 1T3NA 4QQKA 2GN2A 3K96A 3TNDA 3ND9A 3WLKX 1UMCA 1DAPA 4BMSA 1K6JA 1QK4A 5K3DA 1N33B 1TAGA 2DFLA 1TVKB 2FPRA 2IUYA 1YZQA 1G8PA 2ZIVB 4LFBB 1UF9A 4DV2B 1MAHA 4ZCIA 2FQWA 4JB2A 3SVLA 3V32A 4BWFB 3RU9A 3D8HA 5DRYA 3ZUGA 2QPOA 3AV0B 1QE0A 4PLZA 3ZWWA 2B8TA 2Y6UA 2H51A 3BD7A 4J8PA 1MVOA 4U7PB 3DXFA 3C5VA 4WXYB 4EGJA 4NCBA 3I37X 3AUSA 1EBFA 2VZ9A 1GQFA 3TL2A 4II2A 4PXSA 2DWQA 1SBQA 2Y9UA 4OP2A 5E8RA 2DFNA 2ANBA 4IEEA 5GGYA 2O3SA 3ZCUA 5JNLA 4URZR 5HZMA 3C74A 2UYYA 4F9EA 1QGOA 4ZT3A 1Z38A 1DRUA 3H9QA 4N0EA 4BP1A 3BGVA 1GNLA 1ZW1A 2JBAB 3RK1A 1KVQA 3EXIA 4JSRA 3KDSE 4IIYA 4YCMA 2CF6A 4XOIA 2QN2A 1NMSA 1UMDB 1K4MA 4XGRA 4UC0A 1D6JA 4CQLA 1QYDA 4EGSA 3O47A 5TPZA 1Y1KE 4XVQA 4BMCA 2H3IA 1QFSA 3DLPX 2EP5A 2J08A 3SF8B 3KQSA 3TPCA 1RYMA 3N2EA 1RXIA 2JGAA 4MTLA 4X94A 3VSDA 1F38A 3JTMA 3OX1A 1ZJJA 2CHUA 4A8EA 3I73A 3CZ5A 3NIDB 4AYBF 4QU8A 5FKJA 4ZN6A 2GLTA 2A0UA 1UJCA 4WOPA 4F12A 2DF8A 3VI4B 5IW8A 4ECXA 2VJMB 3AG5A 2D00A 2WU0A 1T9GR 3ZD6A 5H3HA 1EWVA 3QVGB 2WD7B 3JQBC 3V9PA 3IVMA 2IE0A 3MR3A 2F1OA 1PQ4A 4FZLA 4O02B 4HTFB 1FNSA 1Y3DE 2AG8A 2YFKA 1J9ZA 2I5PO 2CE7A 2C3YA 3HADA 2Z1DA 2CUKA 4JGIA 3O8CA 1QHSA 3R3XA 3WLQA 1PKXA 2RDMA 4DIBA 4PNEA 5KFAA 4JBLA 4D42A 3R6DA 4AG3A 2WF9A 1DFGA 4CMKA 5KFZA 2IW1A 3OZSA 4MVXA 5K8CA 1ECWA 2KEYA 3OETA 3VHLB 1ZONA 3UHOA 2GCEA 2GUWA 1WHSA 4HDMA 1KMCA 3RU3A 2VQEB 2QSJA 4RH0A 3U49A 2CD9A 1GV0A 2OFOA 4DDWA 4U39A 2Y3IA 1BMFA 2N0SA 3NFYA 3BXXA 4F4IA 4UM7A 1BKYA 8GPBA 5GJCA 4XI9A 4DCCA 4OGWA 5EEGA 3LWBA 1GGNA 4JUIA 3AG6A 1LBTA 1Q83A 5EPOA 2HCFA 1Q0HA 1VLQA 1L3BA 1C9YA 1GT6A 3IAS6 1Z4PX 2CMFA 1ZOIA 1TKRA 3WFZA 5HBGA 3KQKA 4B7CA 1PZMA 4B4DA 1ABBA 4M0UA 4B8ZA 4A3SA 3LHDA 3VC3A 3JV7A 3PP8A 6AT1A 3PC8A 1LSSA 4D3XA 3MG9A 4EB6B 2HPAA 1JFFA 2YB4A 1K1SA 1T8PA 4PSDA 3I34X 3CH5A 3TW4A 1KU0A 1P44A 3IYLW 1SCJA 4ID9A 3HWSA 2CFIA 1D09A 4GDFA 4U7HA 3ZKWA 3PHCA 1PS9A 1KZ4A 2DCMA 2QX8A 5F1PA 4QQFA 4TLBA 4HZIA 2IGBA 4MB0A 3V8VA 2Y0PA 1RLMA 2LZ0A 1YNSA 2LDXA 3H7AA 5BSVA 3S2ZA 8AT1A 1ZBQA 3ME5A 1OFHA 2XLBA 4TWIA 1WV0A 4BO5A 2IS6A 3B1VA 2GJSA 4KN6A 1G55A 3EBOA 1UL1X 3Q8XB 2W5UA 4MR7B 1GUZA 5JPIA 2Y2UA 3FUUA 2WABA 2Q4TA 3OFNA 2OG1A 1ZK3A 4JJ8A 1VBMA 1VIVA 2FCRA 2JGLA 2WTBA 3TQTA 4G24A 1YCHA 5KNDA 1A8PA 3PR1A 4MH0R 1FSGA 1AB5A 5U4XA 3PXDA 4P4GA 1X1CA 3IV6A 2BR3A 3RIEA 4I9NA 1QHEA 4U8HA 2HRCA 3FUWA 4JVMA 3PHGA 2V9ZA 1Z12A 3THVA 2GZSA 1RNLA 3VDQA 3RBVA 1OI7A 3EJ6A 2PYZA 3WY9A 3PG5A 1EFHA 5FB3A 1U8UA 5A4KA 2DKXA 3S99A 1YBMA 5G4KB 3FFWA 1RKUA 2I91A 4ZT7A 3KB2A 1ZJYA 2NXWA 4YV7A 1XTIA 1V39A 5EZ6B 1ISFA 4KIUA 4M21A 3RVSA 4A10A 4KFCA 3KVNA 3H8WA 4EUSA 3FPFA 4FHFA 1NXOA 4R05A 4HNSA 1KC3A 4EBFA 1S3GA 2QR5A 4HAZA 4RTNA 5JQWA 2XUAA 3ADBA 3K1TA 3K70B 3S0JA 1BW9B 4EGFA 4F46A 3AUUA 2PX2A 3CR7A 4J75A 3HILA 4B2YA 5AI6A 4EEYA 1HO3A 1CUAA 5CJJA 4UEQA 2PK3A 1O57A 4TUYA 4C6RA 4W4TA 3UJBA 4N82A 1UDCA 1D8BA 1L7EA 1E61A 3IB3A 2DE0X 3WHKA 4KYVA 4PLCA 4F11A 4G0VA 7ICGA 2K7ZA 1DL5A 2IF2A 4M99A 1EVLA 2IE8A 4F92B 1BPYA 3HXMA 3FHTA 1QDLB 1TF5A 4L50A 1N2GA 1G0NA 4A9AA 4D0NA 4LEIA 5JQGA 3NC4A 1JSXA 1NR1A 4P83A 4L78A 5HWSA 2C7VA 4PZYA 1U90A 1V9LA 4JASB 4C89A 4JVSB 5EI5A 2HQ1A 1GQRA 4DQIA 2DGDA 4B6SA 1UQRA 5BSHA 3K2QA 5HMLA 4BP8A 1JIQA 2GT1A 4F9TA 1VL5A 3I45A 3GFSA 3MR6A 3LLSA 3IAUA 4DANA 3U9TA 5BV8A 1ZCZA 3KHTA 5I5GA 1XRSB 4RZIA 4OSOA 3OA2A 5G02A 4DR5B 2B2NA 1W88A 3AM9A 2FSHA 2I2WA 2PO7A 2G1UA 5L3SA 4WNAB 3S40A 4HTAA 2YIDA 4B44A 3D6TB 3EPRA 3B5JA 2R5WA 4PC1A 1WXIA 3D81A 4IJWA 3PQFA 2W9BB 1T6ZA 2MYPA 1YCGA 3FAZA 4UU0A 5A1TA 2K4PA 4DQLA 4TS4A 7AT1A 2H1CA 2P3SA 3KX2A 4ISCA 1VLVA 2PXXA 1E9CA 4CV3A 3Q7QA 2QB0A 3C2QA 5IULC 2ZTMA 5HKLA 2L2QA 4QAQA 1PJZA 3C1YA 1IMJA 3RT1A 5BMOA 2YV5A 2VRWA 4MLZA 5HF5A 1FYEA 3WGUA 4I36A 3NHKA 2WIAA 4XUSA 1X86B 3JVVA 1WU7A 3ILHA 3PYMA 2ZXFA 5IJAA 3LRXA 1F2DA 5BYAA 1DK3A 1U48A 6CHYA 5KYWA 4EL0A 2HEIA 5IHPA 4GR9A 1NBME 1HQDA 5GM1A 3QY9A 1C30B 4U3JA 4MIEA 3I2FA 3EGXB 1JH8A 5JAIA 4HEA1 4M0FA 4QARA 1KORA 1S5LU 4DL7A 2NGRA 3IAFA 2X9LA 3T1OA 3DZKA 5CM8B 4PONA 3Q3IA 4YJ2A 3ESQA 3SIRA 2ODWA 1W87A 2FPOA 1ENOA 3GBVA 3KVYA 3PF8A 4RWZA 4ITRC 3NTVA 3REGA 2O5VA 3ETEA 1PO7A 3FF4A 2CDAA 3MHPA 4Z4QA 4QWWA 4GYKA 1FQOA 5DWVA 1YR1A 4RX1A 1ZQUA 3IFSA 2AMVA 3HLTA 4C01A 1TXGA 4UBBA 4PRZA 1DAGA 3BQ1A 2UAGA 4CWAA 3REFA 3QPDA 3SCZA 1EM8A 3R5FA 2HF9A 5KZMB 4BMOB 5F78A 4I50F 1C1DB 1DC5A 1RAHA 4TTTS 2VT7A 1PGPA 3ZDBA 3D6JA 2RGAA 2W70A 3KC2A 2YV4A 1DOZA 2QJFA 1L5HB 4NSNA 3WHIA 5CK5A 1YI8A 2OXCA 4EY5A 3EAFA 1KI6B 1HDXA 1SJ9A 3H8VA 3HGQA 4NC9A 4XE5A 5ECDA 4E5VA 4EI9A 3PWKA 2FOIA 4PQGA 2LHTA 4IQWA 1AUPA 2C03A 3IT0A 4G0WA 5EWLA 4BFLA 2EBWA 3R7DA 3IXQA 3D8TA 1NVGA 2J6HA 3GJ8A 1UC9A 5AICA 3V4PB 4ND5A 5KYXB 4EBEA 1U2DA 4HDSB 1JZQA 1ODTC 3TW0A 2Z56A 3B5IA 1F48A 3P9XA 1UCFA 3LVWA 4PN3A 4DUYB 2GXQA 4EZBA 1DXOA 3V3KA 3TL6A 5A3SA 3TTSA 1OT5A 5KTTA 4RL6A 2WIKA 1B8UA 3PDUA 2QTFA 4JB3A 5J2KA 2OG2A 2E9SA 1CZKA 3FUVA 3RO7A 1D1PA 4BBJA 3CY6A 3WB1A 3KUUA 3VDNB 4NATA 1RP1A 2YOGA 1UOOA 2A35A 3O4RA 5DXAA 3H6GA 1DVRA 4XIIA 2ZB2A 1AXEA 1G5HA 2Z4RA 2WUWE 4CM7A 3M9MB 1IVYA 3F46A 3COYA 2H1WA 1S0VA 1E3WA 2PMCA 1E2EA 1IN5A 4UAUA 2M9MA 2GDZA 4N0PA 1PS0A 1FW6A 4HQOA 4JL5A 3M4JA 3FBGA 1TUGA 1V7CA 2PS3A 3M1IA 4OP1A 1E7RA 4K6KA 1TJNA 2Q7OE 3DE3X 9ICOA 4ESVA 4TQRA 3IOYA 2HHHB 4D9EA 2B98A 2IV3A 2EZ9A 3U4QA 2E3JA 1NR5A 3KLBA 4IRMA 3L7MA 3EPLA 5FADA 5FF9A 4FIZA 4C7OB 2OBYA 4JAVC 2VNJA 2J0VA 4UXHA 4CM9D 2QORA 5JADA 2CCJA 3BWEA 1OF1A 3EVBA 5DTEA 1PZEA 2WIFA 3IBFA 1U3VA 3QEMB 2UVRA 1IM5A 3IOEA 1DELA 3FSEA 3O1LA 4B2LA 5KJ6A 4L3WA 4PVDA 1VIAA 4JBHA 1JI0A 5J29A 3NBAA 3BWXA 2AJQA 2X4DA 2ZU6A 3NWEA 2VDRB 1BKSB 2NU8A 5LJIA 2YX1A 1N77A 3M9XA 1Z8NA 4PAMA 1QHFA 5C0OE 1P3Y1 5JVDA 1JROA 1ENZA 1U1GA 3ZVRA 1XNQB 1PFQA 4J7XA 2HI0A 1GY8A 1R0ZA 2FGJA 2YXEA 3L01A 4GYYA 3G6WA 2AE2A 4Q19A 9ICFA 1UPHA 1X0VA 4MDEA 2I1WA 2BDTA 5KWJA 2OLEA 1XGKA 1XQXA 3P0HA 3AWIA 3OFSA 2QW1A 2QUAA 3UNXA 5TQ0B 1FMCA 5EWJB 4GFJA 2VH1A 1QLHA 4P6VF 4GX1A 5F21A 1CZLA 3HKZC 3SV3A 1QCZA 1TQHA 3AL3A 1KGDA 2QP3A 3F3MA 4JY7A 4BX0A 2FLLA 1J5XA 4BMNA 2VJQA 1K68A 2ID7A 1FK8A 1H8HA 4MV0A 4BWGA 4LRWA 1A5AB 3Q7RA 4O3MA 1IWPB 1ECJA 4JBYA 3R6TA 2JV3A 2E1RA 4L75A 3W5SA 1S02A 7ICNA 1AKTA 5L3QB 3HP7A 1DQPA 2WAAA 3HR8A 5F98A 2CHGA 1PUXA 5COAA 4X44A 3EXEB 3QUTA 4L0CA 4PCAA 1N7JA 4WHMA 3DE5X 3ADPA 2CN1A 3L92A 1B2RA 2HHJA 3LU1A 2XQIA 4PTZA 4DHEA 2NT4A 1ZK4A 1JIIA 2AOTA 4OLJA 1JR3D 4XQEA 2HY7A 3ZNNA 1TT5A 2HMUA 2ZSBA 2J9ZB 2Z4SA 2WVHA 1G9SA 3WNBA 2ZRDA 1I4DD 1YBFA 3HJGA 3Q9NA 5C34B 1LBSA 3H5NA 3RWOA 3NHRA 4S1TA 1P1IA 4FS1A 2WA1A 4LZPA 3P2KA 4O5AA 2AI2A 2C07A 5DB9A 3BUSA 3E48A 5E9QA 3RSHA 5EIAA 3R76A 3BGOS 4FFWA 2GXAA 1SHTX 2OV4A 3VX3A 1RQNA 1R0LA 4UU7A 3ADCA 2VA9A 4Z3DA 4L9SA 2E8PA 4AP6A 3CVWA 1R74A 2YJTD 1TT7A 4WXPA 2HCRA 2ZUTA 3EPHA 1GAJA 3H13A 4LOLA 4DKJA 1MTZA 4PZPA 3KDAA 5LYJF 4CG0A 3FG9A 3R3SA 4C6TA 3HVJA 2Q3EA 3F5DA 4Z4HA 3QWAA 2C1XA 3D2LA 4NG5A 3GIKA 2R7AA 4QWCA 4M9CA 3ZJ4A 3UMSA 1ZFNA 5CIWA 3B3QA 1BMTA 3NDRA 4F5ZA 2PBZA 1Z4QA 1L4MA 2FCAA 2QTGA 2DSTA 5D6NA 5DRTA 1CVIA 2XF8A 3OY2A 4NYIQ 3L1JA 3GGGA 4WOCA 2GRUA 3TSAA 3PQDA 3L7OA 1MXFA 4IH9A 2QJWA 3LVBA 4CEIB 2IHBA 2D4AA 3SBEA 3TSYA 4CHGA 1SUPA 3G2QA 1I6KA 1E0SA 4YRAA 5EGNA 5B7QA 3VR6A 4AF8A 3KLOA 1QMPA 4JOSA 4F45A 3PICA 1JLRA 5A9SB 1CT9A 5DBEX 1EDBA 3KP1A 1FUEA 2HF7A 3V4LA 3ZG6A 2X0DA 3BMOB 5IUKC 5AVWA 1M33A 3NRBA 2R8RA 1R0YA 2NAFA 3F3KA 4BASA 3JVIA 4D4JA 4B87A 2X4LA 4J90A 3R3JA 4BN0A 3KJFA 1E6MA 1ZD8A 3COVA 3SQDA 4KE8A 5L9XA 3CEMA 1PGJA 4D45A 2Y0DA 3E7WA 2OFPA 3RHZA 2CXYA 1NOMA 4XVCA 3IAHA 1MC1A 1PFUA 4HXFB 3L7CA 3BXEA 4QJIA 1Y1TA 4D0SA 2EG5A 2HPHA 1NKSA 2O3QA 1TTTA 1T35A 4B9VA 1J09A 3E81A 3S7TA 1Z00A 2VJDA 1FXWF 3LIPA 1YQWA 1GGJA 5AM0A 3V55A 5FPKA 1RCUA 2H6EA 2GR9A 1VDZA 2YOFA 3RAXA 3VR2A 4HNHA 1XNSA 4KQJA 3N0RA 1AS0A 2WSSA 2CW5A 4OQXA 5HM8A 5FR2A 4YJDA 2REQB 3RBDA 2CNWA 3OSPA 1JBKA 5K51A 4JKIA 3GCXA 2VAXA 1VMAA 1UBEA 1ML4A 4OQNA 4ENRA 3C24A 2HJSA 2FN3A 2X19A 4RQAA 3ZIDA 2BEVB 3FB1A 1ZOOA 3NJRA 4K6CA 4UNSA 3RJKA 4TN5A 4B4VA 2WD8A 3WMWA 4R84A 4LXIA 2WUEA 1X7WB 5CW1A 1SC4A 4KLSA 3GPBA 2ZDHA 3RBAA 3BD9A 3VH4A 3IBYA 1RPLA 1R6TA 1GL6A 2MCFA 4O25A 4IJUA 5A3JA 5IM4F 5LWQA 1Z4MA 3MWLA 3PRHA 1SOUA 1JN0A 3TQQA 1ZQXA 3GAFA 5KFOA 3H4DA 1QK3A 4BNUA 3SNKA 2DETA 1NKTA 1GQQA 4KAJA 2RH9B 3E2MA 5EE3A 2HQSA 2NRVA 3NHMA 4AZ0A 2PCJA 3C41J 2AYXA 1S6YA 5JAHA 4BVKA 5IINA 9ABPA 2WTFA 4CM8B 4M0DA 2B3DA 4IVNA 2HMWA 1BAPA 4DSTA 5KB3A 5DN9A 1U7DA 1E2FA 4DLPA 2UV8A 1UK6A 3Q5DA 3H2KA 4KLTA 5B57C 5AWFC 1SXEA 3N7PD 4B6EA 3RC8A 4UB1A 4BMXA 2Z09A 1KA9H 1NJZA 2ZWPA 1WUTA 4XD2A 3AEUB 1G6KA 4B3IA 1X66A 3B1YA 4DFPA 2D5BA 4KVGA 1LRLA 1QYXA 2FWIA 5IJ9A 2C61A 3EF1A 4GI7A 4NV1A 4YIKA 2FX2A 5G40A 3E3LA 3U17A 3C2LA 5JS2A 3SFVA 1ST3A 2H11A 1PVVA 3ENKA 3ICPA 3RJ9A 3ROPA 3TB4A 5BSKA 3X1JA 1S97A 4LOIA 2BBTA 5L7YA 1VPEA 3DF7A 4HAIA 2BCUA 5F9MA 1E60A 1US8A 2YIJA 1KVTA 4UE2A 3GJQA 3ADOA 4PGFA 4EW3A 4RT3A 3DHNA 4DSLA 4HC4A 1LV5A 5ERXA 4ZQHA 4WESA 3WKBA 5DTMA 3TZQA 5ELLA 1A5ZA 2H2DA 2GAAA 3OMXA 1PVRA 5J1TB 3AO0B 2BBWA 2C3PA 4GVXA 1UXJA 3DOHA 4KOAA 5JPDA 3CONA 3S5JA 4PFQA 4YQWA 3NWOA 1EAYA 3BD6A 3UW1A 4NLZA 4I5EA 1J0CA 2K2WA 2HW3A 3WBFA 5EEHA 2CL6X 1ZQEA 2ECFA 3KKQA 8ICUA 1XL1A 3KTAA 4FMCB 3KXKA 1V5IA 4O5KA 4Q0MA 4UOZA 5ENZA 4A8JA 1U11A 4ZZ1A 4MA5A 3C5HA 3UCEA 5LU9A 4YC7A 4DLBA 4P80A 3HRKA 3VOBA 3SICE 4D97A 1FFUA 1RE0A 4E08A 2IPLA 2ZREA 4WH0A 1ZH6A 1D2CA 3MJRA 1IHDA 2C2RA 1BX3A 5AJXA 2VJNA 2JFOA 2QKYA 2WMOB 1CUUA 5C9ZA 5GV7A 4C2BA 2JAQA 1TF7A 1DDGA 2FA9A 4ATNA 3FTCA 4R83A 2Q62A 2VJPA 2ZIZA 1ZVJA 4ZDWA 4JQSA 2QV0A 4EOGA 3R3ZA 5M34A 5H2FU 4DOBA 1LFDB 2JD0A 4EPRA 1AZWA 1ORIA 2ES6A 3IEIA 2QMUA 1YQ9A 1CZUA 3CTPA 4CLXA 2FX3A 2DECA 1QYWA 1PDWA 3G6KA 3ZDRA 2QVBA 2DUYA 4NOMA 3C2MA 2DYKA 3GH3A 3ZNQA 2Q6LA 2BEWA 3G2HA 1XEAA 3OESA 3OU2A 1O8CA 1OAOA 2IUUA 2A7XA 2Q2OA 1XTZA 3OQOA 3N2YA 3UFBA 1YRYE 1V4NA 4BKOA 5A4JA 4C6HA 2Z3ZA 4PLYA 4OAQA 2J6CA 3UB2A 3KZKA 2C2MA 1IY8A 2I66A 1J8DA 1U0HC 3W3AA 3T41A 4KACA 4J9RA 1I7LA 5ALMA 4JI0B 2ZIVA 1ESZA 1NVMB 4YD1A 2HIGA 3LVRE 4WEQA 1R4NA 4TXNA 3UAZA 1DG3A 1K97A 3UC9A 1UKZA 3QVKA 4IJKA 3M6MD 2QUZA 5J4HA 1QSYA 1PJCA 1F0PA 3MK31 5A3VA 1DDIA 4G09A 4HDNB 2OA0A 3NHZA 3NC0C 2HIHA 1UEIA 2QZSA 2ZCUA 5KYGA 3DOJA 1JQAA 3H83A 3U1VA 1XRPA 1SUEA 4YRFA 1JV2B 5LQKA 9ICUA 1Q14A 5F9LA 1UJMA 4HUTA 2O5CA 2ODEA 4DLRA 1Z36A 4CRXA 3OU6A 2Q0HA 1MPTA 2OYSA 4R51A 4I99A 4MUFA 4Y18A 2HFJA 5A04A 2JBAA 3CSSA 3IP5A 1Q95A 4YRMA 1W1UA 2NZUG 1I4LD 1UMDA 2PSSA 2L69A 3O0FA 4K6MA 2BDPA 1JTEA 3BZCA 2R60A 3TL3A 1RQLA 3TQCA 3UJHA 1MH1A 2V1XA 4F3TA 4BNMA 1WMFA 1KK2A 5H8WA 3UGJA 4KNVA 4GC7A 4TRJA 1YHZA 2R1VB 1Q50A 5D5QA 1SBTA 2NV2B 4BKPA 4O3QA 4HWOA 2RGBA 3NS1A 3LXRA 2EAOA 5LYYA 1NXTA 1K4KA 2Y0SF 1NVTA 5IK2A 1ABFA 4L02A 2JVJA 4FGJA 2IH2A 2P90A 3FCYA 1SB8A 2VJMA 3RJMA 1W5BA 1AOXA 3HU3A 3PHLA 1V2GA 4WKPA 4FQ5A 4ZVNA 2X2EA 4H08A 3OE7A 3EFBA 3WV4A 4YAJA 1DADA 2O0JA 3ZLUA 4DYVA 3MN1A 1KGSA 1QP0A 4LZLA 3HN2A 1NYTA 1W46A 1ZU5A 1D2GA 4LE2A 5K8UA 4D96A 1UC4B 5J2UB 1JGTA 2XCQA 4MF8A 4DCPA 1RAAA 4OMFG 3B48A 1D4ZA 2VJ4A 2KJQA 1YT3A 2I8AA 5A0VA 2UUAB 2TSYB 2Z4TA 4AU1A 1L7MA 1FFEA 3K53A 4X9XA 3UTCA 4WZAA 1W1WA 3PHJA 3Q3VA 4FLFA 3VR3A 3OIFA 1NZDA 5IJ0B 2HM7A 4UBJA 8ATCA 1UMBA 2ZJ7A 2HBLA 2VDMB 1A8UA 2P9GA 2NP7A 1PR3A 2Q8QA 3U7QA 2O5EA 4KR3A 3Q7IA 4RQ3A 4DS3A 3RVOA 1C9EA 1G4HA 1PGQA 4Q6WA 3LG2A 5KFBA 2PSEA 2O59A 2MSKA 1RKBA 3LY5A 3BS7A 4IRCA 1A88A 1LV8A 1UBJS 4YCDA 1KFKB 1CNFA 3NVYA 2Z2XA 5F7OA 2YRWA 3L79A 1G8GA 4HN2A 2DUUA 1COWA 5AM3A