2WF6A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and aluminium tetrafluoride
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf6A01
3RFUA 4L57A 3DAOA 1RQNA 2FPRA 2C9MA 1ZS9A 4G9BA 4BEWA 5AIBA 4EEKA 4YCNA 3WK7A 3L7YA 4RESA 3WKCA 3IRUA 2EAUA 1Z4IA 2BY4A 1TJ4A 1RDFA 3KD3A 2WF8A 2YMQA 1Z5UA 1U02A 4IG4A 1ZD3A 2Q4RA 4KNVA 2I34A 4DW8A 3WKAA 3F9RA 5AW3A 4UMDA 1F5SA 3AR7A 4AS3A 5ALYA 4PNHA 4OD0A 4C4SA 4UM5A 2PR7A 4BNDA 2I6XA 2YMPA 1Z4KA 3E81A 3HYCA 1ZRMA 1RMYA 3ED5A 4HGOA 4BX0A 4L6AA 4FYPA 2W4MA 2B1RA 3MMZA 2EARA 5A3RA 4OCZA 5AK5A 3IB6A 4CE6A 4CNQA 3S6JA 4YCLA 3MPOA 2WF5A 5ALKA 1Z4NA 4UM7A 4C4RA 2R8YA 5AM2A 1RLMA 3L0BA 2I55A 3ZX5A 3WK5A 2ZBGA 2HHLA 1ZD4A 4KX3A 3P96A 3L8GA 2W43A 3VAYA 3FVVA 5AVZA 4YCMA 2YJ4A 3OTQA 2C8KA 4Y2RA 3B9RA 3M1YA 4UAVA 2O2XA 1Q92A 1MH9A 3AR9A 1U7PA 3NAMA 4CF5A 5AK4A 2JAOA 3ONNA 2R8XA 5ALRA 1RMTA 3N8GA 3OCWA 2RARA 4GIBA 2BDEA 3L8FA 4I9FA 2EATA 1XVIA 4BX3A 2C88A 4BYGA 3WK4A 4Y2XA 3PCTA 3WK8A 1FEZA 2HOQA 2JARA 5ALZA 1WPGA 1U2SA 3FPBA 4Y2VA 2G80A 5T41A 3L8HA 5ALHA 4XPZA 5ALTA 1Q91A 2I7DA 1YNSA 3EWIA 5ALXA 1O08A 3PGLA 2CFSA 5AK3A 3FGOA 3U7FB 2R8EA 1U2TA 1LVHA 5IT0A 1AQ6A 2ZG6A 4NFLA 3BA6A 2P9JA 3NANA 2B1QA 3AR5A 3QYPA 4RETA 2PQ0A 3L8EA 1RQLA 1XPJA 5AW4A 3QU5A 5AKHA 3QU9A 3I28A 2G0AA 1EK1A 2FPWA 4YH1A 1X42A 2IYEA 1VJRA 5ALFA 2FPXA 2MU1A 1JUDA 4JDPA 1Z4PX 1T5TA 3NALA 1RKQA 2AUTA 2C4NA 5ALIA 2B8JA 1QH9A 4Y2PA 1ZRNA 1RKVA 2PKEA 5JJBA 3ET4A 3QNMA 4UW9A 3AR8A 3L1UA 2B82A 2ODAA 1TJ3A 3GYGA 1L7NA 2MSNA 3DNPA 4E88A 3U7GA 3CNHA 3SLRA 4OFZA 5AW9A 4Y2JA 1RKUA 3A1DA 3QUBA 4IFTA 5ALOA 1RLOA 5AW0A 2YJ3A 1QQ5A 3TLMA 2B8EA 5AW5A 1WVIA 3AR3A 1ZD5A 3SMVA 1L8LA 2YFYA 4ZEXA 3B8EA 5AM5A 1N9KA 1Z4QA 2I54A 5AM3A 2MU2A 2WF7A 4AS2A 2WHEA 3QLEA 3FM9A 5AI0A 3QU4A 5AKKA 1YMQA 2G06A 1SU4A 2NO5A 5AKYA 1L8OA 3A3YA 3E8MA 3N5KA 3EF1A 3ZWKA 1KYTA 3UMGA 3W5DA 2BDUA 3ZVNA 3ZVLA 1QYIA 4H1WA 5AVYA 4BBJA 4F72A 4QJBA 5AI5A 1NF2A 5ALUA 3FZQA 4Y3UA 3KZXA 3IJ5A 3WGVA 1YDFA 4O8CA 5AICA 2HI0A 1Z4MA 5AVQA 1L7OA 3I1YA 2NO4A 2RAVA 3SKXA 3WKBA 3SKYA 3W5CA 3L1VA 1L7MA 5A3SA 1Z4JA 5FP0A 3QGMA 3ZTWA 3NASA 4HGRA 3QU2A 3MN1A 3L0YA 5AHXA 1K1EA 2ZBDA 2YMMA 3SF0A 3CZ4A 1CR6A 3PDWA 2HF7A 4HAIA 3U19A 2GMWA 1Z4OA 3QX7A 5AI8A 4QQFA 3WKDA 2IOFA 3U7HB 1SWVA 1YV9A 2QYHA 3KDPA 2Q4TA 4YIHA 2GFHA 2GO7A 3I76A 2HX1A 5ALSA 3AR4A 5AW7A 3ESQA 2AH5A 4BNDB 3KBBA 5AVVA 3DV9A 1TJ5A 5AKIA 3N28A 4UMEA 3SHQA 4CF3A 1J8DA 2FUEA 5AM0A 2ZBFA 4EENA 4UATA 4EX6A 4GXTA 3L5KA 2AMYA 4NAVA 1IWOA 2RB5A 1T5SA 5ALDA 4CF4A 4EX7A 5AK6A 3R4CA 3ZX4A 1EK2A 2FPUA 5AVSA 3R09A 5ALGA 3OCUA 3WGUA 4L6CA 5AVRA 4Y2YA 2WM8A 4YIKA 1Y8AA 4EELA 2FUCA 2X4DA 1U7OA 4UU0A 1ZOLA 1RRCA 2JAWA 5AKLA 1T9ZA 3B9BA 5AW6A 2ZOSA 2Q5EA 4Y2UA 5AW2A 5AVUA 2YJ6A 2FI1A 4JB3A 3WK6A 1WZCA 3OPXA 4DWOA 5AI9A 3UMCA 5ALPA 4Y2QA 1RMQA 3U13A 2RBKA 5AKZA 3EF0A 3QXGA 2IOHA 4NV0A 3DDHA 5A3QA 3ZW7A 3QU7A 3KC2A 5ALNA 3OCZA 2FDRA 1Z4LA 2ZBEA 4XE5A 5AW1A 2QLTA 3D6JA 1PW5A 5ALMA 2HO4A 3A1CA 1RLTA 1L6RA 1ZJJA 3A1EA 4HGPA 2YBDA 5ALWA 3AR2A 3UMBA 1YJ5A 1TE2A 2CFRA 4ZEVA 3MC1A 3HLTA 2G07A 1N8NA 2FPSA 2HF2A 3EPRA 2O9JA 3ET5A 5AVWA 4KX5A 5E0OA 4AP9A 2G09A 5AKGA 2OYCA 1J97A 5IS2A 4DCCA 5AI4A 3E84A 2JAUA 2P69A 2HDOA 5AM4A 4HGQA 2IA5A 3QUTA 4YGYA 2G08A 3NRJA 3ZUPA 1VJ5A 4G63A 5AKJA 2R8ZA 2D2VA 3OCVA 4I9GA 2OA0A 3WKEA 2JGAA 2WF9A 4OHFA 3U26A 4Y2SA 1RPZA 1WR8A 2HEGA 4B6JA 3FPSA 1NNLA 1Z5GA 4NWIA 2GHTA 4HGNA 1TA0A 5AVTA 5ALQA 4UARA 5AVXA 3ZTYA 4J2TA 4BEVA 2G1AA 5AKXA 2W11A 3L0CA 4UASA 3R9KA 1S8OA 2CFTA 3E58A 2AGVA 3N07A 2YJ5A 4XOUA 2C8LA 2WFAA 2CN1A 5ALVA 5AIAA 3SD7A 3KOOA 5ALLA 1QQ6A 2I33A 1NRWA 3I6BA 4FE3A 2WF6A 3OCYA 3PGVA 5IT4A 2ZXEA 4NABA 5AKEA 4BX2A 1YS9A 3U7EB 3ZU6A 2FEAA 4UMVA 3QUCA 3RF6A 2P11A 2IOFK 3UM9A 2P27A 1RC8A 4Y2TA 1SWWA 3ZWDA 4UU1A 4MWOA 2OM6A 2HCFA 4UAUA 3BWVA 3N1UA 4XQ0A 2NYVA 2VKQA 5ALJA 4EZEA 1ZD2P 2B0CA 2B30A 4C4TA 4DFDA 3NUQA 1VFPA 4ZEWA 4BKMA 4J03A 3QUQA 1S2OA 4HYTA 1L7PA 5ALEA 3J7TA 4MUMA 5AESA 5AM1A 3ZVMA 2HSZA 3K1ZA 1Z88A 1LTQA 3WK9A 3ZI4A 2OBBA 3ESRA 2YN4A 2GHQA 4KN8A 2YMLA 4FFDA 4F71A 1QQ7A 4KYTA 3W5BA 2DQSA 3W5AA 4KNWA 2YY6A 4UMFA 3M9LA 1O03A 3OCXA 5AW8A 1CQZA 3NIWA 3AR6A 1XP5A 5AI6A
chains in the Genus database with same CATH superfamily
1YOVB 3ZW8A 2O1WA 4Q05A 2M6KA 1ZNWA 5C2JB 2Q2VA 4C5AA 2QLMA 3LLCA 4JBGA 2AZ4A 3KZVA 3QY9A 3TAPA 3MRSA 1S5PA 4RNMA 1XE3A 2HBQA 4BLUA 3MHTA 1EX1A 1YZ3A 4LYJA 2R87A 4WY5A 1B26A 4LRYA 4NONA 3M6KA 2GLEA 1Y9EA 3L7OA 1NUPA 1Q3HA 3MGCA 3ZOKA 3OEYA 2HFKA 1WDWB 2O23A 2W2QA 1R4ZA 4RELA 3SXUB 3VTAA 5JRJA 3U6KA 1D2MA 5DYYA 3QYJA 2X9NA 2JVIA 2VS1A 4JKOA 3H4MA 4REOA 1E2IA 5J0QA 5FBKA 3MTAA 3RC2A 5IZ4A 3HCDA 4BNKA 3QSYA 3TJRA 1TVEA 2VPXA 1Q1NA 4FNAA 3TEMA 3E9QA 1LKYA 1DDGA 1V1MB 2L19A 4F97A 3BL8A 2QJOA 2DKNA 2G9VA 3H8VA 3NH9A 4IIJA 4R1LA 1Z63A 2BJVA 4X92A 5TMBA 2JCSA 2PZBA 4RK4A 1MEJA 4C7BA 1RWXA 1Z2OX 2PWPA 3ILSA 3GEIA 5DU2A 1U0SY 2DYKA 4UUOA 5TMDA 4MUHA 1EA7A 4BMVA 2R84A 3H5VA 3NG1A 3EQ7A 3DR3A 3MJDA 4D57A 3RW9A 2JC3A 5JTIA 2JGMA 3BDIA 2YYSA 4D99A 2C28A 3R20A 1JTEA 1UA1A 1YR6A 4TL9A 5JV5A 1A2KC 3PQDA 5JYCA 4ZZ3A 1NR5A 4A03A 3C21A 1HE8B 4RTLA 5BUSA 1I51A 2IX3A 2DR3A 5BWBA 1A9XA 2IWRA 2XMCA 3ABOB 3NBQA 4H16A 4DIDA 3K6JA 1D2RA 1M1YA 4OK5A 3U1VA 3A1FA 4XIFA 4OI0A 5KMGA 2F48A 4H7IA 4ZEVA 2ZUFA 4N82A 4DNXA 2BR4A 3CX4A 5TPZA 4DZTA 2ZBGA 1MXHA 1B0XA 1XAHA 3GJXC 1L4UA 3PSAA 3TMKA 4PZDA 1JG1A 4MB0A 4RLSA 1ZEMA 2YRWA 4P4PA 3SCZA 1ISGA 5IDXA 3EOBI 3P27A 3E9NA 3JYLA 3OKAA 1HLGA 2CXSA 1NQUA 2PRJA 2CNKA 2ZE6A 4HNQA 4DRZA 2DFKB 3PQ7A 1TYZA 2JK1A 3ZEAA 1PJ4A 1MFZA 4MRRA 2IDKA 2VL7A 2LZ0A 5GGXA 3E3MA 5C4GB 2CNBA 1O95A 1L7RA 2JAOA 3KWMA 5A5FA 3EG9B 3RAXA 4PW0A 4BJ6A 5ALRA 3ASUA 4GSLA 4HL6A 4RY8A 4ZOHC 3TACB 1IY8A 3DO6A 4KQ1A 4GR4A 4B40A 1MRSA 2WSBA 2X1VA 1PL8A 4MUJA 1ZCZA 3Q0TA 1G1AA 4LTNA 3HKDB 3BRWA 4MI9A 2PUGA 4BUCA 1II0A 4DO9A 4WKNA 4JUBA 4OXIA 4Q7KA 3JU3A 1Q7EA 1VE1A 1JJIA 1P0CA 1R9GA 2JJQA 1I2BA 3JPYA 4AYWA 1V5WA 3PO5A 4J9LA 3LT0A 4KDCA 3FCCA 3UJCA 4C7VA 3EIWA 2D62A 2XCSB 4PRYA 4JGIA 1G20E 3ZLUA 5TEWA 1AURA 3DUFB 2OHHA 2DUWA 2E85A 1OFGA 1A71A 1KIMA 2FFRA 3HCPA 2AW5A 4JOCA 1C7QA 4FFLA 4OI1A 1MAAA 2GHRA 1SXEA 4AICA 1GA6A 2PPVA 3GRCA 3HKEA 3W2FA 1Q14A 1XZBA 3PPXA 4AFNA 1LVHA 5CBKA 5IT0A 5J2GA 1IHUA 2KHZA 3I9MA 3QEOA 3PNCA 2P9JA 1DHTA 1VRVA 4PYKA 3AR5A 3EOAI 3THRA 3PVCA 4QWEA 4P38A 5KQSA 2J3MA 2I2XB 1BD4A 3QU5A 4KLSA 5JU6A 4PC1A 1F2TB 2G0AA 3MWEA 1XT6A 1Q11A 3K0HA 4S1PA 4XB1A 4ASUD 1ZJYA 4UPEA 2G77B 3ENWA 3TQIA 1X14A 4UE6A 4X54A 1E3EA 5E79U 1WB6A 3MIZA 4Q45A 4G24A 5BOSA 4CEJB 2XT6A 3ND5A 1YQQA 2XAAA 2VRCA 1GZ5A 8ICJA 1EYZA 4E21A 5JAPA 3GGOA 4YP0A 5EL0A 1MZPA 2FLNA 2IKSA 2CSUA 2H31A 2OV8A 1II8B 4MSUA 1ZQOA 1AZWA 1OTYA 3PXBA 5EGSA 3V2HA 2HYIC 2JLAA 3FKQA 3LBYA 1QH9A 4PAMA 5JH7B 2OZPA 1HC7A 1TVKB 1LLDA 4M1KA 5I9SA 2PBRA 2XNJA 3A1UA 4ZVLA 2PKEA 4F4JA 3MAGA 1P6XA 2CUNA 3N2KA 5TY0A 5JJBA 2VDWB 2J4FA 2F1IA 3P7MA 1U2DC 4QTTB 3W9SA 3WIOA 1FS4A 2XMRA 1ABBA 1B8OA 2H06A 2NADA 3DUWA 1L7NA 4RM2A 3SF8B 1GL7A 2AJDA 3UTCA 1AGYA 1E4OA 3KSZO 4HQRA 2JHDA 1E3IA 4RD6A 4BQSA 5KFHA 1YBHA 4XM1A 3PIIA 4R65A 4QZAA 3CU5A 4ZTBA 3QUBA 4OKIA 3B5IA 4RJJA 1T3GA 2UZAA 3KKAA 1HR0B 3IGFA 5TQ0B 5KFOA 3F2VA 3NGXA 4LDJA 1HG0A 1JIQA 2VNIA 3AY3A 1VMDA 1C0EA 3DE6X 2EBFX 3W5UA 5B6IA 4Q1CA 4WBNA 1KMCA 3PR2B 4JZYA 3TRDA 1L8LA 4JBIA 3ZDQA 4P2GA 2WUGA 1BGXT 3PBKA 4NZ9A 4LHXA 2WF7A 2CMHA 3EPIA 1GPJA 2IYRA 1Z0SA 4JGBA 3S27A 2IHBA 5JBIA 3WWPA 1JTVA 2IV2X 4OX9Y 3UWDA 1A4XA 1T8RA 5D7BA 3R5SA 10MHA 3AI7A 4XUDA 4UBNA 1XO1A 5IBRA 4ZKEA 4BMNA 1JVBA 1A1VA 3PA6A 1JRLA 3VCBA 1CF9A 2P3QA 5D4BA 4IDDA 2CJPA 4ZMSA 1AKQA 2DULA 4NZNA 5MDHA 4YR0A 1XWLA 1BG6A 5KFLA 2QZPA 4OB8A 4X1IB 3RSZA 2KP7A 1K5HA 3NFYA 2EX0A 1WETA 2QBYA 3IIMA 1C9YA 4HWTA 8ICVA 2GCOA 5AVYA 2P9FA 3WLLA 1ZQNA 3MWGA 3QA3E 1I2AA 1QYXA 5FUYA 1E18A 2ZSBA 2HA2A 3A11A 3FGNA 3HNOA 4ELVA 4W5OA 1GZSA 1IQRA 1L2TA 2Z4RA 1V45E 3E05A 2WZDA 1LEHA 3PD7A 1NQTA 4OX9B 3WGVA 5KAPA 3K0AB 5AICA 2G25A 3GD7A 1Z4MA 3BQNB 3E9YA 1FMCA 4PICA 4LWZA 4Q4HA 5ILQA 1J25A 2PUHA 4ZFNA 3K0FB 2GN0A 3QUAA 4KAJA 2RKBA 4YQZA 3MTJA 1NVUQ 1ODTC 3EVDA 4DSNA 1NXTA 2E82A 4OHUA 4OO3A 4PN7A 3UQ2A 2DSNA 2AMLA 5KB3A 2C9OA 4RDHA 3JD1A 1E3MA 2DUJA 5CDHA 3OOHA 2Y6VA 4DWIA 3UCEA 2R18A 3NH6A 3VNUA 4KWEA 2I7VA 4Y2HA 2D0OB 2Q4DA 1IOWA 1C9JA 3G7UA 4JGGA 4J76A 5JVDF 3QU2A 1ZZGA 4HDNA 5K3FA 1PJSA 2ASJA 1APBA 3SHOA 1I94B 3R9WA 1X39A 4ZDIA 1OXSC 4OKSA 1IBRA 5E4FA 4A6EA 5A6SA 5C4IA 1H38A 4DLRA 1GQQA 4RZQA 1AMOA 5EJ8A 4MVJA 5L53A 1M0SA 2JBWA 3AXSA 1UMCB 3I34X 4YRRA 3JAMA 1LSOA 8ICZA 4IX1A 5CDFE 3TDKA 4ACAA 3LW7A 4TKMA 4AWXA 1EX7A 5K6AA 1CUYA 4J7UA 4F8JA 1SOVA 1QGAA 2PIDA 3NEAA 4G5SA 3U6BA 2BWJA 1L5QA 3HWX1 1KMHB 4LECA 3AVXA 1QFXA 3VPSA 3TIXB 1TIBA 4J4HA 3WGIA 3GOHA 3GHHA 1ZGZA 4FFRA 4E2XA 2AI3A 2CNWD 2IYSA 2VDOB 3RJEA 1AT1A 3FGPA 4Q9JA 4G84A 4M8KA 4DM4A 2R1VB 3BS7A 4ZAGA 3ZYZA 1ZOPA 1PL7A 4KNYA 4I2CA 4Y9TA 2V4ZA 4GWLA 5FFNA 2AMYA 4KVZA 5HHHA 2LDBA 3ACBA 4KRXA 1IWOA 1HG1A 1KJNA 3N7AA 3ZNOA 1Y3FE 4EX7A 1U2GC 5J63A 5IWCA 4NAUA 4TUYF 3JQGB 5F2EA 4JYAB 5M7EA 4NESA 5BR1A 4H4CA 1IULA 3I9V6 3EVCA 3R09A 2O52A 3RNLA 1CUGA 2O8BB 4E14A 3G2IA 1ADJA 2FZKA 5KOHB 2QN6A 4RGVA 2K6GA 2AU0A 2CGEA 4A8EA 4ZARA 1Y8AA 3JZMA 4WKOA 1XS9D 2JA2A 4NBVA 3HCWA 3AGQA 4KPGA 3QZ8A 1Q7RA 1G2IA 1M6VA 3G5UA 4LNHA 1OAOA 4QUIA 1GZ6A 3KJNA 5JNWA 2VYFA 1ZUWA 2R48A 4ZXPA 5FA8A 2QW0X 4OHOA 4Z6DA 3F46A 3ML1A 5AVUA 3COJA 2J9ZB 1UXOA 4F4XA 2JHCA 2NZJA 3A1TA 4GX5A 1O77A 1QZ3A 4ER3A 4F9FA 1NHGA 1MJGM 3RWBA 5AI9A 5KWSA 2BTOA 1YZUA 5ANRB 1D0IA 1PT6A 1SELA 4ZT3A 5GY7A 3VPCA 1KSPA 1JRPA 4A9AA 5KFJA 3B1XA 1DDIA 3PB3A 1E0SA 5CXUA 1UC9A 5A3QA 4WMLA 2UUCB 3I12A 3VKHA 1SULA 3O74A 2EVWX 2JAPA 2EFHB 1E98A 5FWXA 1ZUIA 3H2JA 3RJTA 4DUGA 4PBSA 1U28A 2OESA 1VL5A 3VNBA 4DM7A 1CP2A 3E3AA 1O94D 1SCKA 3E5HA 2J4CA 2R7LA 1E9BA 4P0TA 1QP4A 2RFLA 4G1FA 2JIQA 3Q10A 3B3FA 3KR2A 4BNNA 4M7PA 1RRVA 1SVWA 4K86A 5DLDA 5CB4A 1F4VA 1KWGA 3MSXA 2B83A 3RB3A 3MLEA 5DG9A 1X1DA 4ILKA 2AHOA 5FD8A 4JP8A 2EKZA 3TEJA 2BI4A 3HC7A 3O90A 4RKQA 4WECA 4WFIA 3ROZA 4BEBA 1JBEA 4JLWA 1YTUA 2FPSA 1COWD 3C3EA 3RUHA 5FNVB 1I7QB 1E64A 5CVVA 4FDVA 1C1DA 1HNNA 1J9GA 3QELA 1MOZA 3QMVA 2C5LA 4FYWA 4WKPA 5F3DA 1BNCA 1FE8A 1TU0A 2BEUA 4C6RA 1U0JA 4NICA 1XR3A 3I2IA 4A0RA 4CEHB 1W34A 1QWOA 3KPJA 1WCNA 1NG1A 4UUQA 4AZ0B 4DJEC 2ZUTA 5CB4F 1YDGA 3FAZA 5BT8A 2J8ZA 1UR5A 5FOVA 2G08A 5KYGA 4DCUA 3IAS6 3CVYA 1YR7A 1UKYA 3TJMA 1VC2A 4CEJA 5DX1A 2PEZA 1F0PA 2OKCA 5M5BA 1ZQKA 1NOKA 2KTQA 4D0RA 4QZDA 2W7OA 2HA3A 3EDMA 2RDJA 5HRUA 2O3SA 2SKDA 1ZW6A 3E9RA 2I1WA 1P60A 1QNLA 3AZPA 1ZCAA 3IERA 5JBNA 2OQIA 1WV0A 3FPSA 1R0XA 1EX6A 2L18A 1DKRA 1YCHA 3HWRA 3RRYA 2FPIB 5AJWA 4UTPA 1BDBA 1M3SA 1VLQA 4FP9A 1YIDA 2FCRA 4LRWA 3OZFA 2NXJA 4P3YA 4HADA 3R7DA 4CGYA 5KJCA 1GILA 4UAWA 1GG9A 8ICOA 3AYZB 1V5GA 4YQEA 1WZUA 4MVWA 4PC2A 2ZRLA 5A4JA 5H9WA 1XMQB 3GVPA 1BMQA 3DMHA 1BA2A 3WLIA 3GFVA 1H0RA 3TF5A 1B2RA 2N46A 1AB6A 3PKZA 3U3JA 1QGDA 3DW3X 1BJTA 3KKAC 1DJQA 1NXPA 3ZJ4A 2NUTB 2OLKA 1WNFA 3TYXA 3KEGA 1GV0A 2J30A 3R5HA 3WMRA 4CTJA 1PLJA 4M1MA 4YMMA 4AO8A 4K4IA 2EYQA 2GSWA 2HJSA 4G0PA 4B6SA 3LXXA 3IQZA 4DUPA 3STYA 2BAGA 3FRHA 3REOA 4G5YA 3QEJA 2AKYA 1JEJA 1SQ5A 2WJHA 4JKYA 5I4KA 4O4IA 2V45A 4UB1A 1XLTA 1P2SA 5KNBH 4IV0A 2BM9A 4B3IA 3I3OA 5BNFA 4V38A 3KWLA 3JPNA 1EPUA 3K2QA 2RBGA 2WVHA 4Q43A 2X0NA 4I6JA 1SD5A 2XIJA 1QB7A 1U2EA 4P98A 1X70A 2BR3A 3I37X 4D9BA 3D3JA 3L41A 4R6WA 4XWAA 3BXPA 1WL8A 2P0YA 2O8DA 2EWWA 2AMFA 3HB5X 1Z1BA 5JU5A 4CTNA 1SCAA 1UH5A 1I36A 2C2GA 3EH2A 3LPCA 2GVDC 3N1UA 3NGMA 2AG1A 2WBLC 5LJIA 2A9VA 2WYOA 2XKJE 3JPWA 4EGFA 4OXQA 1ECJA 3GU3A 5C53B 4X1OA 4YPFA 3HRKA 3X0DA 4FFBB 3TUZC 3ZDFA 2F62A 2XGPA 4IEIA 3BWEA 1U9CA 3F49S 4J75A 4RCZA 1N2JA 4YYEA 4AZVA 4EFNA 2IEYA 3E35A 4DOBA 3JR7A 4DN6A 3AFMA 1JLSA 5C1PA 2NUAB 2ZZMA 3GW8A 3ANTA 2FJPA 2BE7A 3V8MA 3W8DA 1YF3A 2P4EA 3NVWA 4PXSA 2QPLA 2WWFA 1TZKA 3OX2A 3B6JA 3T5JA 3VC2A 4M55A 3ESRA 2PL1A 3DNFA 3K8QA 5IJXA 4O2AA 1W44A 2VPYA 4ZTUB 2C8JA 2TYSB 3K2IA 2P79A 5DLEA 1KQFA 3GJYA 2XCLA 3SNHA 1FVHA 1XRPA 4Q4JB 4QE3A 4QO8A 3RYFA 3HDYA 2ZK7A 4F5DA 3OH8A 3O21A 4KLUA 4DMLA 2WZBA 4A0SA 3N58A 1XQ9A 4MUEA 4FMCB 7REQA 1DLJA 2Y76A 5KYXA 3NIWA 2FMFA 4Q4DA 3IP1A 3GRYA 3TCKA 3EDCA 2FR8C 1WEHA 4G9EA 1EM8A 4K9MA 4M21A 3RFUA 4DT1A 2XSZD 1Q3UA 4GYWA 3VSDA 1Z00A 3CUEF 4RENA 1JKJA 1W93A 4CKYA 2Z8YM 1WQ3A 1VHLA 4CKWA 1GQOA 1KQPA 2LE0A 3FVTA 3WKCA 4QDJA 4UXHA 1TXGA 5IU6A 4JXXA 4G89A 2RH8A 5GVRA 2O59A 2VTVA 5JLJA 4DQIA 3OQ1A 3GGSA 4V0KA 3UGKA 5HM8A 4B34A 4RTOA 4NDZA 3QE0A 4TZ0A 3X1JA 4ENQA 5FWXB 3Q8QB 1IEXA 4B09A 3HRIA 2BPCA 2YDXA 3Q0IA 4X95A 5C4MA 1P5RA 4HQLA 5KYVA 1S10A 3IR7A 4UB4A 1OA0A 4PNHA 4TM8A 5C1OA 4GZ6A 1RM4A 4OD0A 3DCYA 3O75A 1L4GA 4UREA 3V6MA 3PW7A 4XYBA 5BMVF 5T57A 4FOLA 2HRBA 3NWEA 1NVDA 2AS0A 3C6MA 4MH0R 2YNMD 4OQPA 4FS1A 5D85A 5C9ZA 2OV3A 4DR2B 4AJPA 5KYKA 2EWMA 1T13A 2VPWA 4RQ0A 2VH2A 2AL7A 4TT3D 3KOYA 1JW9B 2RMKA 5JQGB 3C5FA 3F73A 3DJYA 4DVJA 1IVNA 1E94E 5IJ9B 3EX7C 2KJ5A 3DL7A 2AEMA 3E5MA 4RH0A 1I30A 3AGPA 3LK9A 4UDXX 2VTDA 4LSWA 4GW3A 2PL3A 2XLCA 1FVFA 2N9UA 2QPOA 1QBGA 2QM3A 4C4PA 4AF6A 1OFHA 2OHGA 2PX8A 3DDZX 4BQIA 1TZJA 3IESA 4ND8B 2X8JB 4RVOA 4NEGA 3VZSA 2W7TA 4EECA 1KNQA 3NP9A 1RRKA 3DC2A 1ISPA 1LV8A 1XSPA 4HQKA 1Q21A 4L3WA 2HHWA 2PGIA 3UH1A 3IBGA 4Z4FA 1MEEA 2X2EA 1RXIA 3JATA 3N87A 4MR7A 4AUEA 1J8YF 4MFAA 1C7FA 2XDWA 3F6SA 3AVWA 1KVUA 2NACA 1AKWA 1M10A 1F48A 1P2DA 2QX8A 3O9ZA 4N65A 4FSHA 3T7RA 2PT6A 4F3RA 1PHPA 2HBMA 3ETJA 3F8TA 3VAYA 3MR2A 3G9XA 1GGVA 1XIVA 2JFQA 3WJAA 4TSKA 4ERXA 3IUBA 5DI3A 5J47A 3RJ9A 5FI5A 4O4LB 4UAVA 4QU9A 3VZQA 1PWZA 5HF8A 4W8GA 4GBMA 5C1IA 3SDZA 1Z3IX 3PJRA 3E3OA 1WKVA 2CVPA 1ODIA 3QVGA 5FWAA 1CZUA 2KS6A 1JR6A 4EM6A 3DEEA 5DG7A 3VR4A 2C2YA 4G6ZA 4N5HX 2G5IB 1RMTA 4M9UA 1YH3A 3OT1B 3VDMA 4CT0A 4ECWA 2RHHA 3QKRA 4AO6A 4EKDA 5HM6A 4GIBA 1Z6PA 4JQCA 4CL8A 1S8NA 1XHLA 2MSWA 4UDYX 3GEDA 5L6MB 3ZH9B 4QOGA 1YVPA 2ISCA 3WK8A 3I2JA 3HRDD 5H4GA 4RC9A 3JCZA 5JE8A 2GF0A 1C4KA 3GFKB 4MR9B 4AQ7A 2QZ9A 3I2GA 5KS2A 3NM5A 2E3JA 3D2SA 5B2FA 1SD2A 1V96A 3AUTA 4XOIA 3IO5A 1E1QA 5FRDA 4QEDA 1VE7A 2BF7A 4D4MA 4LYEA 5GQSA 5CVDA 1V8OA 4YRTA 4P4UA 2PFOA 1TPYA 4GLXA 3LI2A 4G1CA 4EUFA 4S05A 1L9KA 2EZTA 3OSNA 2WJAA 4MQMA 4OI2A 4DIBA 1YC2A 4MUGA 1BVSA 1ZA1A 3BDVA 2XCQA 1YCGA 2IJGX 4MA5A 1FNCA 1X1QA 1UZLA 4WD3A 2C83A 5TX7A 5TZVA 2AXNA 1EFUA 1JHAA 4HEA1 4M47A 1P81A 4M37A 2FG5A 4NFLA 5C8YA 4D6YA 3M4JA 3WFIA 1MV5A 4DR3B 2CNOA 3KO8A 3KXIA 3V4FA 2KZ3A 4CLEA 1RQLA 1K63A 2GCGA 3N05A 3QH4A 5TPWA 1S2DA 2ZTUA 4RF5A 3SDBA 5U4XA 2CV0A 4UAJA 5CITA 4OGLA 1GNPA 1LI7A 2HHVA 1QVVA 3IOBA 4X41A 4LXIA 2AOTB 1QE0A 5JQWA 5HQJA 4YG2A 3LZ6A 3PK0A 3NWPA 1IC6A 4O4LA 2GCOB 4Z9YA 2Q3HA 4PZEA 1CDEA 2ZR7A 4BFYA 1LPAB 1Z33A 1P29A 4PF1A 5E2IA 1ZJNA 2A58A 2PV7A 2ON6A 5EWMA 4UB3A 1LNZA 1FYDA 1WD7A 5FWYB 2JH9A 2XMDA 4FB4A 4QG3A 4ZTZB 1THTA 1G2QA 4PQGA 2NSDA 3CE9A 2I1QA 2CFCA 3AUFA 4IIXA 1ZRNA 2R8RA 3K16A 4DJFC 3GLIB 4I46A 2QRMA 5KKNB 1ECGA 2VRNA 2RH5A 1JNXX 3RAPR 4EKNB 1FO4A 3CR8A 3QX3A 2NUBA 2AG0A 5MFZA 4WVLA 1IEWA 3F96A 2E49A 1P6UA 2B82A 2QLJA 3PQCA 1CW2B 3STHA 3HVRA 1O97D 3OKCA 5AO9A 2JFPA 3WWYA 2PMKA 2XH8A 4I4TF 4UVEA 3LP5A 3L8MA 1KSJA 4LJ6A 5BQOA 4B35A 3AVYA 1Z9BA 3RHSA 3K71B 5DLGA 4C2BA 3DD1A 3VO1A 5IKXA 4FOPA 1YZFA 4N4AA 2YJ3A 4P3KA 4UEKA 1QQ5A 4BBPA 4YECA 5TQ0A 2I4TA 2AE2A 2YQ5A 2ZUUA 3FB1A 3DOOA 2P2DA 4O2BA 1HNZB 5JEDA 4IHJA 3GLVA 1XMXA 3DT6A 4PTZA 3QVWA 4Z9FA 3V00A 2JLQA 4DDMA 5B4VA 2F2AB 2I5HA 1QGUB 5D1NA 2YFYA 4JEIA 1M2OB 1P1FA 3EEFA 1IY2A 2IIBA 4HDSB 2EJVA 4ZP1A 4WCFC 3DOCA 3G2JA 1KDZA 1RS0A 4IUCS 1W5SA 1ZN2A 2II6A 2JFBA 2WHEA 4DIEA 1NRXA 1FJ2A 1YACA 3ZWMA 2IT1A 2KEYA 5FOTA 4N41A 5KFVA 1Z15A 3ZDDA 3RC9A 5C8ZA 4KP7A 2J5BA 4RT3A 3DE1X 4X24A 4ZOBA 3WLTA 2V9WA 1ACJA 2IUFA 3QMMA 1LTKA 2HSGA 1ZO8A 1NW4A 5KFCA 1CUXA 4TMFA 1V3QE 2NTNA 2WU8A 2PRSA 2EQYA 1IUOA 1A4RA 4HLQB 4IS2A 3DLBA 5F3WB 1E4EA 2X6QA 5FOSA 3B6MA 5DW3A 5J2TF 4C7KA 4RUCA 3CRZA 1LDBA 2H9YA 2GZAA 3CZ9A 3DS8A 2PEYA 2XV1A 3T9EA 2PKYX 4N12A 4OFWA 2W2KA 1GUDA 4IOMA 2NM0A 4NZYA 5EUQB 1V39A 621PA 4F86A 3K0EA 3GZFA 4YV0A 1YU9A 3LZDA 5E6SB 1GQFA 1V7QA 3A9TA 2PMCA 3A6EA 4QREA 1U0GA 3NLLA 3G1WA 4BWFB 3B89A 1EVZA 5A3SA 2LYAA 1HQKA 2BFCB 2GM9A 3KE9A 2WWGA 4ZAZA 4BNFA 5J2TB 4RTPA 3PR3A 2NV0A 4X45A 2MMCA 1E9CA 5G40A 3F4LA 4QOEA 3FH0A 3UANA 2FWBA 5PGMA 3ZWDA 5CR0A 2GBGA 1SHKA 1JLKA 3OZEA 3NASA 4HBZA 4P32A 4EJ6A 5JRDS 3IT2A 4XQ8A 5F9FA 2QUZA 3OA2A 4L02A 5A5EA 1GRCA 3PNYA 1PN3A 3EIHA 4DHEA 1HOTA 1Z37A 2N1BA 4M7WA 4NCIA 2WD7A 4DQPA 1CY4A 1FK8A 3MCUA 1D2CA 1P45A 2GMWA 4KL8S 4N18A 3TINA 4D1YA 4E6EA 2XXAB 3TAQA 1RE1A 5IM4A 3NPAA 3WKDA 1TUBB 3V1UA 1DAOA 1YV9A 2GH1A 2QSZA 3FY4A 3M9XA 1ZXIA 7ICTA 5DIZA 4GZ5A 1UEIA 4AC9A 1EXNA 1DAGA 3U9LA 1SK8A 1VBMA 8ICAA 2ZU0C 3PHBE 1A69A 3QI2A 1VE9A 1PJBA 4FT2A 3OC0A 4R6XA 1Y8CA 4UEJA 1RQ7A 1YCDA 2VBIA 5SV2A 1G0NA 3QPVA 1YT3A 1B0ZA 4O0IA 4TV8B 4YR3A 1ZETA 2F3RA 3EC7A 1KFKB 4PLPA 4BQFA 1UPXA 3ISCA 2H2HA 4FONA 1B8NA 1RPTA 4Z86A 5F77A 2PX3A 1VA5A 4NE2A 1UPBA 4IF4A 2XB8A 4XDZA 1TAQA 8ADHA 3P5BA 4URXR 1IRIA 5JYDA 2YUTA 3P2IA 2ZETA 4CPDA 4ZJUA 2OBNA 3TMAA 2F1RA 2XGSA 2QZZA 2H5EA 1WPRA 3HABA 4OLHA 5EPOA 3U4AA 3FA2A 4EHAA 1T94A 3AX6A 1G19A 2HLHA 1JEEA 2BJHA 2C2ZA 2IY9A 1EK2A 3CYMA 1HF3A 4DCVA 2P7HA 3OUUA 4CIDA 2FMTA 1Q77A 4RPZA 2Q3EA 5AJHA 1SKSA 1DX4A 1FYFA 1DXHA 4YUZA 5BWCA 1E9SA 1FLVA 2E4VA 4AJ9A 5KNDA 4WZAE 3E0FA 3JQ7A 3HJGA 4MRVA 3IEUA 5HDBB 4MPRA 4IQ0A 1FTNA 1WU8A 2HSEA 3EZ2A 3IMKA 5L3RA 3KUUA 3RK0A 4WKGA 1QH1A 2BGWA 1R3UA 2Z2YA 1XTUA 1NBIA 2EDCA 4GXQA 3AU8A 4Y2UA 4JB0A 4NH4A 5E9QA 4GVLA 2RHRA 2P40A 4OL0A 2DTXA 3DO8A 1TMGE 2B4RO 2JVJA 4I55B 4ZVRA 3WL8A 1VLJA 4COOA 1YZLA 3L8CA 3UUFA 4C0AC 1ZESA 3EEIA 4PWYA 3ZHUA 4RQ7A 3IPLA 4KLEA 2RJOA 4RK0A 5FPPA 4B0PA 2Q5JA 4L28A 2YIDA 4W99A 3PFFA 4MZDA 2ZCVA 2DFLA 4YPOA 5KSWB 3HZHA 2EL9A 2TMDA 3MWKA 4ZT4A 1ZGGA 8ICNA 1XNRB 7ICFA 5IMBA 3IHTA 4XPIB 5CA1B 3IVGA 2ZCJA 2H18A 2FJUA 4XE5A 1V11B 1K0FA 2ZBEA 3DFUA 3IUEA 3TD9A 3AETB 3NR2A 1KH2A 4M9QA 3EDYA 2CFIA 4FE4A 2P9YA 4E2YA 3QVGB 2DFDA 3M1IA 2DL0A 2VHCA 4Q4CA 3N7UA 4BRWA 1TGYA 3DQPA 4UB2A 3SFVA 4NBWA 5AUOB 3EZFA 3IM1A 2OV6A 2XVYA 3ONWA 3SM3A 2I3GA 3PQEA 3QMWA 4I8DA 4LVUA 3VBCA 2D6FA 4K87A 4R1SA 2WJ4A 3KLOA 4UHDA 4HDCA 1AUPA 3KVNA 2AHOB 4IRUB 4AZWA 4EYSA 2HCJB 1DRUA 4WLEA 1DTSA 3PFBA 4MFCA 2QUKA 2JD0A 2RONA 3X1ZA 4IRMA 1DARA 3L8DA 2KI5A 2GEVA 1H2WA 1NJ2A 1GSAA 2FN4A 3RJFA 2J9RA 3KS9A 2IK8A 3U80A 3OQPA 1OBVA 4G09A 5DEOA 3DWEX 4GKVA 4MKZA 4FW8A 3NX4A 2A6PA 1IMJA 3D7RA 3P9IA 5DM2A 2HPHA 3D1JA 4KE9A 1ZQAA 5CGZA 5FBQB 2ZRDA 5JZMA 1TD1A 1F06A 5AKJA 4DLNA 2ISOA 1RI1A 3AUUA 3C7AA 1HRDA 1C9DB 2RJNA 3ICVA 5DH9A 1U04A 3TTWA 5KTKA 4I9GA 3IVRA 2VHUA 2HPAA 3ZV4A 1C0PA 2EX1A 4NM1A 1JT9A 3ZWCA 1XMOB 3KLPX 4DJAA 2X1HA 1JHUA 3C5EA 1JDUA 4X1KB 3ICQB 1VL1A 2XT0A 4LF6B 5DCWA 4LQCA 3K15A 3VR6H 1LD3A 2IQIA 1WR8A 1YJ8A 2PDAA 2WHPB 3FVWA 4AJEA 4CIVA 4NWIA 1UQUA 1JMSA 1ZSNA 4K8OA 3RU7A 4J9OA 4B80A 1RYFA 4N0EA 3DFZA 1YB5A 3E27A 1QRTA 2KW5A 2AJLI 1O95C 2JGKA 3LSYA 1ZQUA 2V7QD 3B9PA 1Z5PA 3F1LA 3SIWA 4QBTA 3IULA 2ZWIA 4P6VF 1VJCA 4ZQIA 3WAKA 1JIVA 1IXKA 3B60A 4C04A 2GJSA 3QBEA 1GCGA 1L3VA 4YLEA 2CVOA 2PZMA 4WOBA 3T1VA 1BEZA 1W1UA 3SVLA 1EDBA 2SKCA 4MROA 3R1IA 2BFBA 4CG2A 4MTCA 3RIYA 4Q9HA 1M7BA 1NR7A 2BLNA 2UYQA 1D04A 1VIMA 1P1IA 3KKPA 2YASA 4MJ3A 4PPFA 1E5TA 1O94C 1CX9B 1WF3A 1KJ9A 3IILA 1A76A 4FBTA 3W3AA 4QGGA 3TW0A 4DAEA 9ABPA 4OOFA 1Z5NA 3RR7A 1ZH2A 1A5AB 2PUVA 2ZWAA 4BPRA 3DP9A 3U0BA 1JDZA 3T3MB 3B48A 4BEJA 2C5BA 2NTYC 4H7FA 2GF9A 4FS3A 2CVHA 4ZVQA 5FOXA 1EFPB 5EWLB 2HEIA 3SC4A 4BX2A 4EB0A 2H4XA 4JQYA 2XDYA 3ZU6A 1XWWA 1Z7WA 5F12A 1RJFA 4C0WA 4GG1A 4AMYA 3MRXA 5A4DA 2QUHA 4RH1A 1OVGA 3VYUB 4R81A 4J0CA 3QQ5A 1OAAA 1IM8A 5CCEA 4KR3A 5EESA 4DQLA 4M6WB 1SQFA 1LBTA 2NVBA 4DLYA 4D9EA 3NBXX 4DMHA 4XQ0A 4G65A 3FW1A 2WB1F 3BERA 3WWOA 5JDIA 4BNZA 4D81A 1PQ4A 2ZDGA 1M8PA 1SKUA 8ICKA 3LVBA 4XIGS 3C1YA 3LE8A 4B4KA 1U8CB 1YI1A 4DIOA 4A15A 4ZEWA 2Q5OA 1JN0A 3LHIA 3OLWA 1WUYA 5CUQA 4RACA 4YALA 3UMFA 1DAKA 4ZQEA 4BVJA 1B4DA 3N8DA 4BLQA 3SIXA 3C3WA 4CGZA 1USUA 4CMEC 1Z19A 3BM5A 4FBGA 1FFCA 5C1BA 3CF4G 2IGBA 3NHKA 3OE5A 1ZR4A 5K3FB 4DR7B 1KJ8A 1RBYA 2DLCX 3JWJA 2J6IA 3QKTA 1TDJA 4UAZA 1DKPA 1ONOA 1XWIA 2FHPA 3IAM1 1E7MA 1ORWA 1MENA 1RI5A 3PCRB 3HJNA 3O5AA 2NQ2C 3FCXA 5IHPA 3PWKA 5EG5A 3EBLA 3FR8A 4BMZA 3PJEA 4BMPB 3B12A 4LOLA 2F3QA 4RYLA 3NT4A 5AUQA 3GUZA 4CBVA 1TKRA 4CR6A 6Q21A 3W5AA 2AFIE 1MB3A 5KT5A 2YY6A 5FTNA 3SZGA 3U48A 4CJXA 4EY6A 2WAOA 3CNLA 4QZFA 2BFAA 1XD8A 1S2IA 2XVAA 4MB6A 3C5GA 3SZRA 4DL2A 2ZR8A 1Y5IA 5D00A 1P62B 2GOLA 2D1FA 1V1RA 1TU4A 4LWPA 4U5QA 2V98A 2B61A 3GJ6A 3IVXA 1U0FA 3GRVA 5CT4A 3RDPA 3SIRA 3ZZNA 1QZZA 2XO7A 1QKJA 1TM4E 4MV6A 3BL5A 4B85A 4DPKA 1TYAE 2NNLD 4DSFA 2D5LA 2YZKA 4TXNA 3KYCA 3OMWA 1TVMA 5JD6A 5ER9A 5EP3A 3C87A 3JYHA 1W75A 3VV3A 4ZHQF 2PMZC 4E5YA 2Q6IA 3L02A 4BNJA 4ND6A 1TJ4A 2O8FA 4NECA 4QU0A 3BHIA 4MA0A 1JZTA 3GUCA 5AT1A 2C0PA 1OPXA 3EARA 4KH0A 3F9RA 4PBRA 2XMGA 2PHZA 5A05A 3TMYA 2B20A 1JYSA 3AHIA 4OJQA 5ALYA 4ILEA 4RD2A 1OXKB 4YJHB 3LWBA 2BCEA 4I2DA 3RB0A 3DJFA 3O3NB 4D42A 2WYHA 4B9TA 3NFRA 2EV9A 3JVUA 4HLNA 4FI3C 3MEQA 4XJTA 2V4RA 1XXHE 2OFPA 2QSJA 2A57A 1IOLA 5KG2A 3BSSA 3AU6A 4X8HA 3HLYA 2JIRA 4O3OA 2G8NA 1PNOA 3UT5B 3ZOZA 5B5SA 4LCBA 1RPAA 3JAWB 3AF0A 4JI3B 1CRZA 3RRHA 1NUUA 2ONZA 1NBEA 4Q82A 3AQEA 1KI6A 3PUJA 3L7MA 4UEQA 2JFFA 1I3CA 4C1NA 1VYHA 3K5WA 2YC4C 5B3AA 2G0NA 1OIWA 5DBAA 4U7HA 1KFBB 3T0GA 3TTUA 3FMGA 4KO3S 3VC3A 1BWQA 1JAZA 1JHQA 2F8SA 3EFHA 4KQGA 2OO3A 3D2BA 4H31A 5F9LA 1QMGA 5DP1A 3RG2A 2H2DA 4PPGA 4BKPA 4R2HA 2G5CA 2CK3A 1FLNA 1NAIA 2EZ4A 2WR8A 4I19A 4LF9B 3PLNA 4DS3A 1DT5A 3CEJA 2JBHA 3U44A 1S0VA 1T1IA 3MG9A 2WNIA 2E4UA 2Z5GA 3F67A 3D4OA 4WNCA 3GXBA 5EZSA 4L2IB 4KODA 2RGWA 2HUPA 4LF4B 4KX3A 1X9MA 2DHRA 3GGJA 1Z39A 4X71A 1J7KA 3TOVA 3H0LB 3A05A 1YDHA 2NUPA 1Y7HA 3K9QO 3O4JA 3Q3HA 1KK3A 2PLFA 4UD2A 2DKOA 3TB4A 4D45A 5DFAA 4YCMA 5L40A 4X8MA 3GZNA 1N6KA 3G5MA 2DFTA 4UBJA 5EQDA 3VR2D 1OLOA 1J56A 4CIXA 4JC4A 4FBMA 4AQDA 3OWHA 4O59O 4BKQA 4NLLA 4ER6A 1S7GA 3AVPA 1JHYA 2Z6QA 1N7IA 4OBWA 4BGEA 3LT2A 4O4HA 2CLCX 1VIDA 2GRJA 4OPMA 4XYEA 7MDHA 4HTFA 1PD1A 1DC7A 2AJQA 5JCXA 4OMDA 3UGJA 4PHPA 2NTVA 4RHFA 1XU4A 3LYAA 4JEHA 5KG6A 4UBBA 1S5LU 4JOSA 3RRXA 1YZVA 2OCDA 4QTYA 4KSBA 4ZN6A 5FV4A 4I9FA 1XVIA 4GOJA 4I2EA 4JQZA 3GLSA 4L4ZA 3BSWA 4TTSA 3T4PA 4RJ2A 4HNTA 4FGZA 4I1PA 1EUQA 5B4TA 2QSUA 3Q7IA 1AK2A 5FPKA 2GWSA 1SUFA 1Z22A 2PBLA 3OCJA 5L3QA 1YZNA 1ZIYA 3I8OA 2VKTA 3EMKA 2QS9A 4GMKA 3H1GA 4UM8B 3ELWA 2QN3A 3S8YA 2DQNB 2QYOA 1ZQLA 3FJ1A 3CW2C 2HDHA 3UNXA 4HDMB 3PXXA 3W3AD 1SVNA 2GI4A 2GUWA 5AK3A 3MD9A 4FKZA 4JJFA 4CM9D 1TTTA 5BWLA 5IM4F 2ZR9A 5GM2A 1G7CA 2FPOA 1ZXXA 2HNBA 3MM4A 3KYDA 1PKEA 3QHQA 4KJXA 4TT8A 1EP3B 3L0PA 4M04A 1E9AA 3WYDA 1R10A 1OZAA 2FA9A 2QOEA 3QE2A 4XLTA 1P2TA 2FEOA 4MS1A 5DV9A 2OGUA 5JS1A 4BO5A 5I7SA 2PH5A 3W9YA 1Y1PA 2CRXA 2D5IA 2HBJA 5KKAA 4YN4A 1QJ4A 2ZI6A 4HG2A 1MTOA 1BFDA 1EZ4A 1U9IC 1WOMA 1B8PA 2OB2A 4QPNA 3RK1A 4OMFG 2ZIVB 2X0KA 3AFHA 4HAUA 4AMUA 1NT2A 1OLUA 1UPCA 1D2EA 4IP0A 1MNQA 3PWZA 3F4BA 4DLGA 1NJ1A 1BPBA 1VZ3A 5LXTF 1FFXB 1M0TA 1VIAA 2EF0A 4X6YA 1Z83A 1VLMA 2BMVA 5KFIA 2HSDA 3KQQA 1ZZEA 3DULA 3UC5A 3A9SA 5I4IA 1NXOA 2BDTA 3IBFA 5DK6A 3IQHX 3IUSA 4M0PA 4GGMX 1SBIA 3TQQA 3RR2A 1OASA 4E88A 1BDMA 3A9WA 3PYMA 5IDVA 3EZ7A 4OFZA 1TKDA 1E0KA 1U5BA 1Y1KE 4DM3A 4W5TA 1G3MA 2DBVO 2FGKA 2XEXA 5ALOA 1TJPB 1N56A 1P1HA 2WRZA 3FHCB 3O2QB 3OZRA 1YIOA 2XUHA 3EZNA 4RVSA 1IXRC 1EG7A 1ECPA 1QK4A 2XJ4A 4TTRA 4BO0A 4OL9A 3ZD7A 1S9HA 2YX1A 2Q1XA 3ZGOA 3UIEA 1V6AA 3KQKA 4DR4B 2OCYC 3B70A 4PHDA 4O5CA 1SPXA 3GQBA 3KAKA 4KLGA 1T1EA 1V8ZA 2GJ4A 1TM1E 2R3SA 2V6IA 1SUAA 2Y77A 3QHAA 4GP7A 1PS9A 1NTRA 1V1MA 5EWLA 4ECEA 3MQ2A 2EKQA 1C3JA 1I3KA 3QLEA 2C5EA 4M1OA 4Y7DA 4Z49A 3H4BA 7GPBA 1LS6A 2I3ZA 3NHSA 3QF4A 3IT3A 4DLWA 3TW8A 2B7CA 2QY6A 3MMXA 4G9GA 4BVEA 3JD3A 1QIGA 1LKZA 2DFNA 4R84A 1MGPA 4TKVB 4GICA 3UMGA 4HXEB 1PDWA 5IEJA 3QPAA 1ZOIA 4ECVA 2JB9A 5JVDB 5HZGA 2HA6A 4HWRA 3P9NA 2W4IA 1IUKA 1KAHA 1ZUNB 1NOJA 2HA5A 3PT9A 2K8CB 1TTPB 4F72A 3VO8A 1GTJ1 3DWGA 5DSXA 1SZCA 3L46A 1NP7A 5ALUA 4L76A 3DZGA 1DWUA 5G4LA 5HA5A 3KZXA 4LZZA 1NI5A 5DHUA 3EFEA 1YDFA 3LFHA 3RNOA 4PRZA 1ZQWA 3TH5A 3LQFA 1L7OA 1RXCA 3RAGA 1P19A 4HB4A 1XZHA 1PSWA 5F98A 4MV4A 4KR9A 2B69A 1CQPA 3FYTA 1XZJA 4AG6A 3UBTA 3OPQA 3O4VA 4WW0A 3GFQA 2K4PA 4B4OA 1PFUA 1T4CB 4N7JA 3HB4X 4EUSA 3QA9A 5DCLA 3SKYA 3JATB 1L8QA 2WYUA 3SX2A 1U1EA 4BO6A 1L5ZA 5BN4A 1TVAA 5KPDA 4XEHA 3FYSA 3EF3A 3B6ZA 1IB6A 4J3JA 1D6SA 5L45A 5IBQA 4IDAA 2WMOB 1MEOA 1B6TA 2BF4A 3WYEA 3RYTC 1GTG1 1Q1AA 3TW8B 4ENPA 5KO2A 1IZYA 2O7SA 1FS5A 5DWVA 4K9DA 4QRIA 4YAFA 5F2OA 1KO8A 3TUJC 1QFZA 2YVLA 3HJHA 4KXVA 4RGQA 3UK0A 3X3HA 3C23A 2VZ8A 1Y4UA 4BASA 4L5AA 1YZ6A 4IDGA 4K28A 3H3FA 4QUGA 5FUVA 1M72A 3TVYA 1JSLA 1VI5A 3MAJA 3WTBA 1P7ZA 1J0CA 4EG3A 1X13A 3FDJA 4PYJA 3HN7A 2OK7A 1T3QA 4M1YA 1XDZA 2HBLA 3DOUA 3WISA 2C20A 4LZNA 2YN2A 2R8HA 1SL1A 4QUEA 3MGIA 1YQEA 3CV3A 4H6PA 3E7PA 3WRVA 3UTDA 1TVKA 2DSTA 3B3QA 3BJIC 4MI1A 4YRFA 2XD9A 4QYTA 2PI4A 1JEAA 1E8DA 1MRNA 4LQ4A 1FTWA 3W2EA 3T1YB 2FUEA 5AM0A 2GPAA 2OMKA 3G79A 1ADBA 4IL6U 3A06A 4EENA 3HU2A 4K3UA 3RC7A 5CXQA 3GPCA 4C6TB 3D2LA 1GGKA 1OBFO 2PJDA 3F98A 5CYPA 2OAQ1 5GOZA 3W04A 4B81A 5KYYB 1T5SA 1YB2A 1UKAA 1KZGB 2AQ0A 2E48A 2FFBA 4G5HA 1KP9A 3L40A 2JDID 1MN8A 4OXNA 4PE5B 1ZM7A 4HPJB 1QK3A 4M8IA 2KV2A 5JS8A 3F2DA 4V1CB 1OI4A 2FR0A 4Q3AA 2BUCA 3CNNA 2P2SA 4HWSA 3OCUA 3EQZA 4MGEA 4NMMA 4TUQA 4IL5A 3TZQA 1YR1A 4CUJA 2ZDHA 3G82C 2BTEA 1NXXA 1TCBA 2PZEA 1DUVG 3RSSA 1JXOA 4OQYA 1Y7TA 1I7PA 2FHSA 4CM4A 1Q16A 4M60A 5FTLA 1Q2XA 1ZVKA 3KHTA 1EP2B 3AHGA 2HMWA 3L9XA 1ZQFA 3MJEA 4QZGA 1T9ZA 3PHGA 3ZWYA 7ICPA 1M34A 5AW2A 4RUAA 1JBQA 2A1UA 4FMCF 4GR5A 4Q0MA 4JIMA 1W4RA 2PNJA 5ALPA 1XCGB 4O3PA 3U13A 5JAUA 1W7AA 3L6BA 4DIUA 5JHHB 4YC7A 2J0SA 2VEDA 2HA0A 3EEQA 4BO7A 3LPLA 4LC1A 4YD2A 3EGDB 2PX2A 3HKCB 2G9NA 2Y1JA 4ZZ0A 2JANA 1XZLA 3FE2A 4KQWA 4BOYA 3DSRA 3LX4A 3AQ4A 1RYMA 2MSKA 3KC2A 1ZMOA 5ALNA 3ILHA 4DQRA 2DH6A 2JGDA 4FMBB 4TLEA 1UBOS 2C54A 4U9UA 5J2UB 1PR4A 4AY4A 1WVGA 3BXXA 3PMLA 3GH1A 4RHYA 2VAPA 3K1YA 4G36A 4JELA 3Q6MA 2JI7A 1M0WA 4WOJA 2XWPA 2WOOA 2YBDA 2PU5A 1UWLA 3VYSB 1FYVA 3GVCA 4QHTA 3WLJA 1QRSA 3OKFA 3QEMA 2QTLA 5FUWA 3MR5A 1XZAA 2W2OA 2O0LA 3PJFA 3S7TA 1UZMA 3U7QA 5JSKA 2ZJ7A 1V8FA 3TFSA 2ZTMA 3QFTA 1MKYA 2OORC 1S4MA 5B58T 5AVWA 5IABA 5KFTA 3O3OB 4WX2B 3DLHA 1Y63A 2DHCA 3AL0B 5IF3A 1XRRA 2JHAA 4TOIA 3S1AB 3WNZA 4XVCA 4ZCRA 5AM4A 2XIDA 1FDSA 4US9A 1JFFA 1FRVA 1GDHA 3OX4A 4NDAA 4QUBA 5CG1A 2VIIA 1ULBA 1XV5A 3M2PA 4WOKA 3QUTA 2VUIB 2IDZA 4I5FA 1N0VC 2QR3A 4WQMA 2HK8A 4CW7A 3AF6A 1PO7A 4NYIR 3VNAA 3O4RA 4OF4A 3HRHA 4EHLA 1DUSA 2L69A 2NOAA 2QXUA 3ZV7A 1IN5A 4KQFA 5E3HA 1ML4A 4CLDA 3MJRA 4TYPA 4LIPD 1K7CA 1RD4A 4PZUA 4UJ5A 1C3XA 1CG6A 1U8XX 2ENUA 4V0MA 3MS7A 1FP6A 2AQ4A 1JR3E 4I9UA 2ZRQA 4FYXA 4GNRA 5F7JA 4DLPA 3A7DA 3FZYA 1X40A 1UJ5A 2BN4A 1Z8FA 4PV7A 2ZYVX 1UOOA 4JUFA 3SYZA 4Y6OA 4QZBA 2Y4OA 3QWFA 5K0BA 5JSYA 2G1AA 5E6RB 1T3ZA 2YBEA 1MCZA 3I4CA 2FSUA 1AJEA 4DPMA 2CFTA 3ITDA 3THYA 4RVUA 4LYAA 1QO9A 4NJOA 2D0DA 3Q3JB 4H4EA 3O8CA 1U0BB 3RPEA 4RHXA 2IYOA 2XA9A 2Z4TA 1K1SA 1O9HA 1FNDA 3E7XA 3KOOA 2WD9A 4FX5A 5AJUA 3RKUA 2O54A 4M7OA 3DL0A 2FDCA 4GZMA 1U7XA 2QF7A 2WG2A 3DOJA 1CNFA 5LU9A 1B22A 1ORHA 3KYBA 4FD2A 2J09A 4LG1A 1W2GA 1G7SA 4REMA 4E09A 4ER7A 5HUJA 1BVRA 3V55A 2J33A 3ALRA 1ZMRA 3DVAA 5IZCA 4DZRA 5K4AA 3D3WB 2C95A 1KYVA 2MHCA 1YOVA 4WKCA 3ROMA 5FDFA 4GLOA 1CJKC 1U8TA 5AKEA 2O8FB 2B5VA 4MKIA 4RUKA 2FEKA 3WL4A 3KPWA 3QUCA 3RF6A 3T41A 1K7XB 3KQSA 3QP9A 1KVTA 1Z0JA 2IEZA 2BSAA 2JFYA 4K0RA 1R5BA 4AX8A 2PSFA 3CKYA 4M1WA 4CMIA 3WGQA 5G0SA 3VZRA 3ZGZA 4F5QA 1S1CA 5HIAA 4NLCA 4NU5A 2B0CA 2MDTA 2AJCA 2Y8EA 3LA8A 2JI9A 3HJRA 2Y93A 4OP3A 4UJ3A 1Y3IA 5BQ5A 3R7WA 4DF4A 5BXQC 5J2UF 4WEOA 1GR0A 1VFPA 4RK1A 3ETHA 2O0MA 2XB4A 2YXLA 2OHOA 4XGKA 2AQKA 4PC7A 3GL9A 3IEXA 5H70A 3ZCPA 1WMEA 4QBGB 4LVOA 4EHIA 2NIPA 4OAQA 4PAQA 2VYQA 3ER8A 5BN4B 2OD9A 4HDKA 4FFMA 4YAOA 2HSZA 1HDXA 3RUFA 1QFSA 1UQVA 2LKCA 2GBLC 3L06A 1Z88A 3QEKA 4Z0NA 4KVAA 1JZQA 4R9NA 4Z51A 1AHPA 5HCIA 4CCAA 1SU6A 2FWIA 2CDCA 2MTBA 1XF9A 3OM9A 4HQNA 5ETJA 4MW5A 4X8LA 3RVRA 3WO0A 3CZ5A 2WAQC 1XAJA 2RHGB 4KYTA 3DEYX 3A6ZA 5EFOA 1TF2A 4QC2A 3STXA 5D3QA 5HOQA 1UAGA 5G53C 1ODJA 3SHWA 4G0ZA 1KTVA 2R8JA 3OECA 3NHJA 5U9CA 2HN9A 4W1SA 5HOEA 2LI6A 4JB2A 2A3VA 4I2VA 4XB2A 3X1DA 5AI6A 1MVLA 5EXDA 2IPXA 3HVIA 2UZIR 3IDFA 2MSDB 4XFDA 3U81A 1FUIA 4B5LA 4D9MA 5CDGA 5JADA 1QKIA 3U3ZA 2FPRA 1P3Y1 2GAJA 2QGNA 5I9IA 1I7SB 1Y80A 5KFMA 3OC6A 5KTYA 5T4BA 1WSAA 4QFCA 1T8WA 1JDBC 1TMOA 5CLJA 2KJ9A 1DV2A 3LLSA 5BN1A 5BSWA 2H00A 3CJQA 5HTOA 2XMZA 3DHEA 1JQJC 1WLYA 2K4HA 4O8ZA 5DGCA 3T15A 1TTHA 1UDAA 1JIHA 1X2IA 4RU9A 3D7NA 4EVRA 3F6PA 4W8HA 2VAXA 5E9WA 4P3PA 2ZE8A 3TCNA 1B3BA 4UUNA 2H1CA 2H4ZA 2PYDA 2ALJA 5E4TA 4WK0B 1G6HA 4UTRA 4E12A 3LC2O 2ZPUA 5K0FA 2C2HA 2QWXA 3GLUA 2E37A 4X3CA 5FFMA 3VPFA 4UQOA 4F3YA 3VYWA 3BHJA 2PZLA 3LRXA 1WVMA 4OY3A 3T3IA 4DRXB 3W5JA 2GAAA 4ZGWA 2RGDA 2C96A 1ECWA 1SXHA 2IYWA 4G85A 4D4HA 1BC5A 5KT7A 3F74A 4LRQA 4BX0A 1OTXA 3CZMA 4G1MB 3TBFA 4BZXA 3QUSA 1MR3F 2JI8A 1Z2AA 3BFJA 4JA2A 4OKNA 1E7YA 1GIAA 4MQLA 3PLAE 2GCPA 2VVTA 1EFHA 1Z5VA 4J2OA 4RSRA 5FTJA 1J06A 4CE6A 1PK9A 3OFND 1JB9A 2YYYA 5HKKA 1YZGA 4F8YA 5JAHA 3QLJA 1XF1A 3Q7TA 4HWGA 1WCLA 1FFXA 1AD2A 2PKWA 3IPYA 4MNTA 1RSZA 4FZRA 3HSYA 1G64A 4EG5A 1N8SA 2WQ7A 2PRYA 1NVFA 2A1JA 4H27A 1AV6A 1LX6A 1IBCA 3OWXA 3RUPA 1HYBA 1G8SA 1OT5A 3MBIA 2R8YA 1WXIA 3P4UA 1KZHA 1RAGA 5HK8A 5CVTA 3DKRA 3MQFA 1EFRD 1FFDA 3KOZA 3CINA 1PNTA 1C41A 2ZJ0A 2ZSFA 2I4NA 3ID6C 3IUJA 4JLAA 4I2BA 2W3RA 2FWPA 4XWGA 3BG5A 4YDQA 2NU6A 1FW6A 4RMIA 3NVAA 2K5UA 2BFFB 4O4JA 4V3CA 4L9RA 5CEFA 1Z2EA 2DMRA 3ZDZB 1T5LA 2GJ9A 3Q15C 2ETXA 3D4LA 4Y2RA 1P9RA 1T6ZA 3TPZA 2D0PB 4CUZA 5HKAA 1QQAA 4KTTE 2FVYA 1UP4A 1PUXA 3REFA 2YS7A 1QJCA 1W0JD 2CUTA 3KK0A 4FYKA 3OIUA 2GHIA 4L3OA 4M9ZA 4YN3A 2BFMA 3DH0A 1SAYA 3FNFA 3RSOA 1FJXA 1R8XA 4AJ2A 3ONNA 2H5XA 2NXWA 2OYSA 4XGQA 1V41E 1KPHA 4KXXA 3PEFA 1TYCA 2WJ6A 1UT6A 5CP8A 4Z4CA 4MULA 1FFAA 1CUSA 3IJPA 1YA6A 3SQDA 1S3IA 5EKSA 1KDVA 1H93A 2HLPA 2QQEA 3KALA 1YCFA 4HWPA 1P1KA 2GS9A 3RS4A 4TYNA 1E5QA 3IAM6 2WLSA 3MTEA 3BGVA 3WYAA 4K8RB 3WHLA 1J24A 4URZR 1L5KA 3HY6A 1J70A 3S3TA 3WMEA 4J49A 1H6AA 2V1XA 3TANA 2XB6A 1IPFA 2PKQO 5LQSA 4YUXA 1XQWA 1PAUA 2IH5A 5CB0A 1DO2A 5EZ5A 2GD2A 4B6GA 2JVKA 1EJ2A 3EUWA 5J2JA 4KREA 1BS9A 2A33A 5AHOA 4K5QA 3ILXA 2B94A 3T3DA 4MDEA 2HRDA 4EJ2A 1NXQA 3A28A 2CFOA 4H9GA 2IYZA 2XUIA 1M74A 2W8ZA 3TXYA 5FBVB 4EL0A 2IHYA 1I4LD 1LDMA 3ECAA 3GT4A 1KH1A 2R6FA 3PX7A 3PXCX 3ER9A 3FF4A 4P86A 4XH9B 3SR4A 2GA8A 4XGRA 1OMOA 1OWLA 4PM4A 3QYAA 4EW1A 3ZS9A 1IHDA 3ZE1B 2YWHA 1SOUA 4TL7A 4WERA 1TKCA 3P45A 1NU8A 5B53A 3NBFA 5HS4A 4ARCA 1AM4D 5G5HA 3C5VA 3ZKWA 3QKSA 2NRWA 4UNSA 2E6KA 3JD4A 4LVNA 1SBQA 1W5FA 2R68A 3E03A 1A50B 5JH7A 2MSCB 3K94A 3PIRA 4R63A 1ZW1A 1QE3A 4R8VA 1N3BA 4YQWA 4RK5A 1BNOA 4RE6A 4RU1A 4ZVVA 4FEYA 5E1MA 1T5OA 4LXQA 2GBPA 2L0XA 2OD2A 8ICHA 3Q7RA 1U6JA 2PSEA 1EESA 4YXWA 4NATA 5L51A 2ONCA 3ZWWA 5L6LB 4KXYA 5J0OA 2Q21A 1YS1X 3OLQA 2W6NA 3CISA 4X6LA 3N4MB 3PQ5A 2JW5A 5BNTA 1DQZA 4IGAA 3WRXC 5L3SA 3IH5A 4ON9A 5LOVA 1K6JA 2EAOA 2K4IA 1JYFA 4OHZA 3HR4A 4YV7A 1Y3DE 4MCHA 4S1NA 4MPDA 4EI7A 2FZLA 4AJOA 1RRFA 1USWA 3MDCA 1DG9A 2E1FA 1B7GO 2O14A 4M88A 4U7JA 5JTTA 2YFKA 1CJCA 1OU0A 4KR2A 1OBHA 4E7PA 4MLCA 2W37A 5IIMA 4ELUA 2GYWA 1VHDA 4E1AA 1TAHA 1BJRE 2O7NA 3R6TA 4N01A 4FZJA 1F8UA 4U8GA 3N75A 3PV0A 3WQQA 2WQZA 1YBAA 4FXOA 4UNIA 1IY9A 3K4PA 1LPSA 1ZIOA 3PRHA 3W1WA 4CM8B 5KSYA 3I72A 1AG9A 5KL1B 1H9AA 1R8SA 1SL0A 4FWIB 5AOCA 1ZN9A 4ZVPA 4QKQA 3IKTA 4GI7A 2G5HB 3N2ZB 4TQGA 1T0UA 4X6XA 3H11A 2W42A 8ATCA 2QEQA 2A5YB 1HQDA 3OFSA 3MMPA 3PNOA 4NYJQ 2NP7A 3LPMA 3IKVA 1LGYA 5J2FA 1KY5A 2A4KA 2H29A 3QE3A 5JPCA 1KI7A 3M6FA 3N2LA 1I7LA 2VLIA 3AJEA 3OF5A 5FI3A 3ISDA 3EN0A 3F7TA 4MQ4A 4R9UC 8ICGA 4B82A 3G68A 5EXPA 2XADA 1CRWG 3F5AA 2B7LA 2EFEB 4G2NA 4B9VA 2YRXA 3MB8A 4F4FA 3RU9A 1AQLA 2BEVB 4KEAA 1NMSA 3O47A 4WGGA 3DZIA 2O2EA 3QSGA 2AN1A 1EVLA 1OVMA 3CN9A 1SXDA 4IJ5A 5MN4A 1C3OA 3FXAA 1QAMA 3HB1A 3CUUA 4QD3A 5BUZA 1UADA 5C34B 5DCUA 1A7JA 2EU8A 2FRVA 2O7VA 2PA3A 1UKEA 2CHVA 2ORED 3AL3A 5K0TA 2ZJ5A 5L8VA 3RV4A 1ACMA 3KQYA 1IRXA 4LXGA 4WIAA 4C2AA 3VSAA 3ND8A 5FF9A 3ABZA 4Z3DA 1SKYE 4EQ6A 3EGIA 4P2BA 4X5OA 9ICSA 2IBMA 4DFMA 4R2LA 1ZNQO 3W1VA 2ZRKA 1GPMA 3IKJA 2PQ6A 3P0EA 1JX6A 3ETDA 4IILA 4ZALA 2J0QA 4GC6A 1NLMA 3G2LA 4TWJA 2J5RA 2NZYA 2ZFUA 1DK2A 4X63A 2VQFB 3AW8A 1ZQSA 5BSHA 4QLBA 5G0WA 2O2SA 3ZS8A 5EHXA 1CB7A 1UKZA 3C4QA 3IS3A 1YRLA 3RSFA 3IJEB 1CR6A 1C9EA 2Q3JA 1YZHA 3CB2A 3HDVA 3I6YA 1J8FA 1E9VA 1VJGA 1JLHA 3OT4A 4MWEA 2ADMA 3TN7A 2XVXA 3AF4A 1RFLA 3A4MA 3HDQA 3R5JA 3FMFA 4KFCA 1Z6XA 2WTEA 4UB5A 3JQBA 4MX8A 3GIWA 4HQOA 3DTNA 4LX0A 4ARAA 4PLZA 3NVMB 4KFRA 2KVCA 3EFOB 3F5MA 3HI4A 3OQ6A 4QZEA 2Q4TA 2ZWOA 4N76A 3I2HA 4H1TA 2GO7A 4DV5B 3Q8SB 2G6TA 3OHMA 2GM4A 3EY9A 2Q9AA 3ESQA 3R24A 2IHNA 1U2GA 1RI4A 1UP6A 2AN9A 3IHQB 4Z9BA 4FKMA 4CEIA 1WXEA 4UMEA 5BOMA 3JD2A 3WNDA 3SBEA 1Q0RA 3TI9A 5BUQA 4JNKA 2A19A 4XUGB 2GJKA 2WYVA 3PC3A 1Y0BA 5EUMA 1WO8A 3CJTA 1ZVVA 5L4LA 2VP3A 4KDFA 3V6JA 2F1OA 2AWOA 5EZ6B 3C3YA 1QUEA 1NK0A 2OSVA 4B3TB 2PYZA 5JPIA 1XZFA 2IEIA 3H87A 4IHKA 4DCSA 5LQJA 3GDGA 4U39A 3QEAZ 1VLVA 2V6GA 1E3WA 1WDMA 1D6NA 1X15A 2NNWB 1A9ZA 1RM5A 2ZT6A 3G0OA 4JCOA 4LHYA 4OQFA 2C00A 3PDJA 1Y88A 5AVRA 2VXBA 3O4IA 4JLPA 1SVSA 1Z8NA 2IYXA 4C8KA 3INNA 4L72A 4FYYA 1CY2A 2IYAA 2R25B 4MQUA 2BP7B 5AXAA 4CMGA 2A0WA 1ZHFA 2PXAA 4MPPA 5TQVA 1W85B 1JG3A 1EGHA 2QP9X 1ZIDA 1U6KA 2I6QA 2J5QA 2IHUA 4OLJA 2YX8A 1XYYA 2VPQA 2E89A 4UFPA 3OJEA 2GLTA 1I3MA 1WZCA 3N2IA 5B55A 4TUYA 3GP3A 1EE1A 1QP0A 3VH3A 1P9NA 2BFOA 4QATA 3LKVA 3ME5A 2H1FA 2ALZA 2XCPA 4YRDA 5EYPA 3EF0A 4G97A 5H3HA 5BYBA 3VM6A 1LRKA 4NV0A 3BFVA 2P1RA 4PLHA 5JC1A 1VGRA 1BPYA 2CYAA 2UZ1B 3IUQA 3CNEA 2D74A 1RPNA 4MQ5A 2VCEA 3VOTA 3EXG1 2FUG1 1NC3A 2BM8A 3F5QA 5ITWA 5K0JA 2IVZA 4DEZA 3PNVA 5K5EA 2YFQA 3RB4A 2ZI7A 2A84A 3QFHA 1EK0A 5JWHA 5K0EA 1D8TA 2VHQA 1ZQYA 3BTOA 4G0OA 1PW5A 2J08A 2PWYA 3A1CA 3B1ZA 2CHQA 4R5MA 5D3MA 5GMOA 4Z5XA 1UPHA 5LLDA 1U31A 1UDRA 2D3DA 4B75A 3PUKA 3P0JA 3M4ZA 4PYQA 4DJ5X 1D1TA 4KGVA 3G0IA 4AJLA 3C29A 1SXJA 2I4OA 3FUXA 3E8SA 2R7MA 5HCUA 1KE1A 1FP2A 2Q1SA 3OZ7A 4AY2A 2JZCA 3FLEA 2F59A 4H7DA 3MC1A 3PD1A 4NZPA 1T8SA 1XJWA 3BIWA 1U8ZA 4G81A 1M2KA 4DMMA 2HTFA 2O9JA 2B2XA 1X80B 5EIEA 1M6HA 2R6AA 2VCHA 4FIZA 3AF3A 1GJRA 1UMBA 1E2MA 1M8JA 5A6SB 4GI5A 2HHUA 1TJNA 4QDKA 5GJBA 1VIYA 3VR0A 1E6WA 4YPVA 3VOSA 3VU3A 1T8EA 1J42A 1B1CA 3AETA 3CLSC 3KJHA 4NQRA 1WDLA 4RK7A 3H7AA 4DR5B 2X7XA 4YDRA 1VJ5A 4IQTA 2MSEB 3KL2A 5LR6A 3BOSA 3VR6D 3DD5A 4HDKB 3RFCA 3KSBC 3GPIA 5C3UA 4L8GA 1LVUA 3RSLA 3RODA 3OCVA 4NCNA 3RI3A 4HLDA 3AHDA 1V85A 2JGAA 3L7LA 4Q8FA 3ON5A 4TMVA 5A7HA 2VP5A 3DTVB 3MA0A 3PICA 1LW7A 3UK1A 2XGOA 3G0GA 5JDCA 3CLKA 1FU4A 3K3PA 5CLLA 4DDVA 5BW8A 2Q1YA 4CF7A 1JQDA 2FMKA 2XWSA 1W5EA 1QCDA 1GP2A 5EN4A 2FWRA 3UQYS 4LOIA 1Z5GA 2YVKA 1VG9B 2VDVE 5EIAA 3P32A 2WOJA 1A9QA 2XC9A 3LRPA 4OGGA 1GPNA 1K6EA 2FLKA 4RJTA 7YASA 5J4HA 2R751 1SPBS 4BEVA 5J2CA 4C0LA 4CMKA 4JV2A 1F3LA 3E9MA 5D2CA 2DP4E 2J1LA 2H48A 3DEJA 2AGVA 3E58A 1T8UA 1E7SA 4PY2A 2Y1IA 3NTUA 3NCHA 4HZGA 4Q7JB 1DCFA 4HLCA 3D2AA 3DO5A 3JVDA 2ZJ4A 4GE0A 5DGTA 3CVWA 4EVIA 5HGJA 4CM5A 8GPBA 1VE5A 3R3YA 1KAOA 4TKUB 4CKCA 5IKMA 3KHKA 4ED1A 9ICTA 1OFUA 1Y6JA 2GAOA 4IGFA 4P1ZA 4UOEA 2OV2A 2J0EA 3RIHA 1D8LA 5IT4A 4I6GA 2PS9A 3WWZA 4JLMA 4YJKA 3RROA 4B6PA 4RHUA 3MCAA 4KO1S 3G1TA 1AZTA 2RGEA 1YS9A 1DIHA 2XUZA 3OE7A 2FSGA 2JIPA 2PAFA 1L7DA 2QW8A 1H2EA 1ZP6A 1HETA 2EJCA 3T5CA 3EGWA 3REQB 1ISIA 3TQFA 1RC8A 3KLMX 1NJWA 3PUWA 3GCXA 2YN0A 4MKFA 1DGJA 1J2EA 1KR2A 5EP4A 1Z0AA 3FPGA 4ZH4A 2R6R1 3KKEA 4RHCA 4WZAB 4EEYA 1D5CA 3OPYB 1IONA 4JLBA 3TOZA 2VSYA 4W9MC 2LTAA 2QD3A 3EPKA 1JDNA 3AJRA 5CA1F 1DO8A 1FFWA 4FLMA 5JAQA 1T2CA 4J03A 4F5OA 2BHNA 2XCAA 1J2YA 1OZFA 3H8MA 1Y4SA 1YBVA 3E8XA 3LHKA 1LC3A 4UFOA 5CPFA 3GDWA 3NO4A 5ENZA 5FLYA 3DMFA 4ARBA 4MUMA 1DKQA 1DIBA 1SFRA 2OBXA 3ETCA 3V1KA 1QHEA 2L42A 2N75A 2IYFA 2Y0DA 3PO4A 2A1UB 1HXHA 1XFAA 4IJ6A 5EMHA 5IN4A 2Y1OA 2VHXA 3C39A 1N1EA 3K1TA 4QZHA 2DU8A 5KVQA 3ISBA 4TMXA 1CT9A 3RS5A 2PL5A 3A6HA 5JCPA 2A7XA 2VSQA 2PBZA 1NM5A 2GFQA 4BO3A 3ZY3A 5KTRA 3RUAA 4D5EA 2P6MA 2ZREA 3TSZA 3IT1A 3ZIAD 4B3CA 1CQZA 1JSZA 3FMPB 3FPEA 1N0WA 1W581 3JAWA 1F2TA 2XAUA 3HYLA 3KB8A 3L49A 3ZNQA 5BSKA 1J49A 4YCAA 3A6JA 5TS3A 1WSBA 4TQUS 5DHRA 2XQVA 4BFUA 1P7DA 1O9GA 1JMVA 1K6MA 2Z98A 4QQNA 3QVUA 5B1SA 3LDUA 4ENTA 3G0DA 3DAPA 1CETA 1NYTA 2HZ7A 3MCTA 1J4AA 3QVTA 4JC5A 4IDHA 1Q6ZA 1RAHA 2EAUA 3U39A 1EK5A 2BY4A 1G3QA 3LQKA 2NSYA 1U02A 4LGCA 4KUGA 2BMJA 4I2HA 1XD9A 3BK7A 4XVRA 5J2UA 3KEQA 4H7KA 4O4IB 3GPLA 1R5OA 4QO7A 1TAGA 2AW3A 1HIWA 1R4NA 2JFVA 3T12A 4AKTA 3QVVA 2B4QA 4LE0A 1NZBA 3ABQB 3PSPA 3D4NA 1V6CA 3C16C 1PJLA 4AIRA 4B0OA 4CKCB 2BFNA 5EIXA 2XDAA 4C4SA 1CIPA 4HEA6 1OBOA 2XD4A 3E9CA 5JRZA 1FF9A 1TKAA 5E8RA 3KSAC 4PU0A 1P1JA 9ICLA 2C7PA 3INTA 3MJSA 2QJRA 4OP1A 1RZTA 2ATXA 3QNWA 1LPBB 1FQJA 4P4LA 4TRMA 4F8RA 4QQKA 4XI9A 4RLQA 3ZGVA 1NKSA 1B2LA 4TX1A 3ZZUA 2NZ2A 1T10A 1BKDR 3DGFC 3DVLA 2QRLA 3WWCA 3GRKA 3LVQE 3MR3A 4KDRA 5A3RA 1UIRA 4ZD6A 1AUXA 2JRLA 5K4GA 2ASEA 3PDIB 5JCOC 2E8MA 2HRCA 4FHZA 4O2AF 1GGEA 2XIQA 3UAXA 1PT5A 4NE7A 1RRGA 3WLFA 1MF7A 5C80A 2C61A 2ID4A 4JYPA 3O31A 4EJFA 5B3KA 3FDSA 5EPEA 3IXLA 5EJ5A 2IYPA 1XU9A 4MW9A 4C4RA 3EZXA 4O6VA 2NSLA 3TSAA 1HY3A 1CJTC 1KU0A 3FJYA 4QGAA 3SJBA 1VLZA 4OQLA 1KPGA 2K87A 3MB5A 4Q39A 2PMEA 3CVVA 1FBNA 3HBLA 3KETA 4GX0A 3GLIA 5IM5A 3BMCB 1FXWF 2H4YA 2NTEA 1T2EA 1FW8A 3NONA 5GP1A 4F06A 1AGPA 1DZ3A 1OXXK 1ZCFA 2UVDA 3KKKA 3QI7A 1GPUA 1ZL2A 4UAGA 2NU9B 3NYQA 1ND6A 3S70A 2QSYA 1BMTA 1GA1A 2HFJA 2WSMA 3WSVA 2YIJA 5BW6B 4ZDJA 3H0KA 4J3NA 2Y0EA 3I3SR 4KIFA 5KNLA 4RZIA 3D7LA 2CMDA 2ZSJA 4Y9DA 4YRQA 1TAUA 5AK4A 4Q4AA 4ZYWA 1I9GA 3C3MA 4WTOA 1QMPA 2HK7A 3R8CA 3M8KA 3WB1A 1PT9A 3N70A 3P0IA 4R2IA 4WXPA 3IEPA 4YUWA 3G9QA 3ND9A 1RP1A 3ACCA 4PQYA 1JROA 2AQ8A 3JPRA 4MR9A 3O1LA 1SHLA 5DTIA 3QTLA 5L4SA 3AJ8A 3NHFA 1JHVA 2HOQA 5KPJA 1JJAA 3OSPA 3MOSA 1WSWA 3GEPA 1D2HA 2YQ4A 3KOMA 2QRJA 1Y6GA 2XUDA 3RTCA 3BWCA 4HN4B 1RJWA 4CETA 4IMJB 4BJ3A 4LV8B 1RRPA 1DO0A 5J0UA 3C1AA 1R6BX 4MB2A 4RV5A 5KINB 2HY7A 1QGOA 2Y1LA 2P66A 1EWVA 3H1PA 1XXHA 3H5OA 1YNSA 2O6KA 3G17A 5ALXA 4CI9A 3LWMA 3UXYA 4E5PA 4RIFA 1ONSA 1R0BA 1WDKA 2F43B 2H2IA 3WAGA 5BR8B 1M1XB 1JQLB 4I27A 5J43A 2WAQF 4ALLA 1KY3A 5INTA 3O8QB 2ZG6A 4HEHA 4L4SA 3CX6A 4ES6A 3KTDA 1GAWA 3BA6A 3CX8A 1KRXA 5LXTA 2PH1A 1GYQA 2AVNA 4NRDA 2PQ0A 4F2RA 2X8BA 2FUG6 1KJZA 2QRHA 4JC0A 3CXUA 1UDCA 3CH7A 2LKYA 3DOEA 2X76A 1LWOA 4U2EA 1AUVA 4JFRA 3JARA 2J9YB 3PF8A 1RABA 3M5DA 5T64A 1EINA 3Q1KA 3TXAA 2WIFA 5FTMA 4GP9A 3FHTA 1BN7A 1GQSA 4MAMA 3ZK8A 4TKVA 4RVFA 3TLAA 1C2TA 4I28A 2YCBA 5ALIA 1SCJA 2ZJ1A 4GRIA 1YAHA 4V3BA 4QOIA 4IIEA 4C03A 3GG9A 3AHCA 1L7EA 4HAVA 2R1TB 1XMIA 1K3UB 3H13A 4NY8A 1MO4A 1XSEA 2GNOA 3JQCA 3OZXA 3QF4B 3QPUA 5DHAA 4Z3KA 2WIAA 2EF1A 1HO3A 1W5TA 2I7TA 3QVJA 4D0SA 4YUYA 3ET4A 5E4JA 2HWXA 3D6HA 3OZWA 4GOND 5EJ4A 2VHJA 4CQLA 4RFLA 1DQSA 1CUJA 4IZHA 4TWRA 1EZ1A 4YJ3A 2VNAA 4J2TA 5FBWB 3IBSA 1A77A 2C2BA 3DMTC 4BXOB 3IV7A 3X2FA 4UTVA 4G0VA 4XEUA 2BSQA 4FK8A 3CF6R 2Z57A 2I80A 5F51A 2YTZA 3UKJA 2AD5A 1OH7A 2DE0X 1XKLA 3FOAA 4PYRA 1GLGA 1Z07A 4J1NA 3SZ3A 3PFIA 2I5PO 4B7UA 1CZOA 1H1TA 1M2VB 3PGA1 4DL5A 3L0OA 4I5IA 3CRW1 4WJLA 3PHIA 1ZD5A 3CLUC 3NIFB 1W88A 4ZVNA 4OHMA 1BKSB 2OMEA 3KEOA 3EZ6A 1R6UA 4QFDA 5GIOE 2WT9A 3U09A 1FBTA 4I5DA 1YR2A 1Z4QA 3HM2A 3L6OO 2HJRA 2BGUA 1LV7A 4K05A 4YRSA 3CUTA 4OJMX 1NKCA 2VJMB 3PTLA 3GMDA 1UWKA 3CP8A 5AI0A 2QL7A 3OTGA 4DLAA 2PUWA 2AUMA 5AKKA 2O7RA 4ZAFA 3W2HA 4R9VA 4EQ6B 4F2DA 1YS2X 3DAHA 2J0UA 1VJ1A 2C0CA 3E8MA 4C3ZA 3BE5A 3KTOA 4WFJA 4Q37A 5YASA 3V8BA 2FZCA 1RG6A 2PRZA 4IV8A 5CVUA 1L1QA 4M0MA 3WGYA 3ZWNA 2JA1A 2IIPA 3E22B 1CUBA 2R8PA 4IJMA 3ZVLA 4C3UA 2D4AA 1KZYC 3P2YA 4F4KA 5CH8A 5NULA 4EP1A 4YRCA 5HQTA 3BZKA 4TYQA 1QOQB 3O73A 1NF2A 1P9WA 2V7QA 4NNJA 2ZIWB 1Q7CA 4QDUA 5ULLA 5D3KA 4HGYA 3I0NA 3IHWA 4N8EA 5DHPA 4LY6A 4PSVA 1GFZA 5B7QA 3GQCA 2IE0A 3I1YA 3ZVRA 2SECE 1EI9A 2KKPA 1SVUA 3D7MA 2X0DA 4CYMA 1HNXB 3BDPA 3OX3A 2ECOA 4NBNA 4NBKA 1QQTA 3VKVA 4DY6A 2HNAA 2PTHA 5JCJD 2L5YA 1WZIA 3LQ2A 4D9FA 3PENA 1Z73A