2WF6A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and aluminium tetrafluoride
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf6A01
1TJ4A 1RDFA 5AK3A 3SHQA 4XOUA 3QU5A 3QUTA 2WF6A 4QQFA 4Y2QA 2I34A 4J03A 4GIBA 3ET4A 5ALWA 2RARA 3MPOA 5AK4A 2YMQA 2P11A 4HGPA 3QUCA 1QQ5A 5AM3A 5AKKA 3EPRA 1ZD5A 2RB5A 2IOFK 3NIWA 3ZVLA 4HGNA 1YJ5A 3HYCA 4AS3A 2QLTA 4DW8A 4ZEVA 3WKBA 4UM7A 4J2TA 3D6JA 5AESA 3GYGA 3L8FA 3L8EA 3SKXA 3ZTWA 1RKQA 3A1CA 4XPZA 1Z4LA 3IRUA 2CFTA 4KNVA 4JDPA 2FEAA 3ZUPA 2FUCA 3NALA 3L8GA 2FPRA 4KX3A 3WK8A 5AVYA 5JJBA 1QQ6A 2RAVA 2C88A 5AVVA 1Z88A 1LTQA 5AW1A 3PCTA 3QU9A 3UMBA 1RC8A 5AW3A 4G63A 3E8MA 2BDEA 5ALZA 3UMGA 1O03A 2C4NA 3NUQA 2W11A 1K1EA 3EF1A 3N28A 3WK5A 2G07A 5ALPA 4DFDA 4EELA 4UMFA 4BX3A 2ZBEA 5AVSA 3B9RA 2R8XA 5AW9A 2ZBFA 4MUMA 2Q4RA 4OHFA 3QXGA 3KOOA 2IYEA 1RQLA 4BBJA 3ZU6A 5AW0A 4C4SA 2O2XA 3QX7A 3PGVA 5AW7A 3QYPA 1WPGA 3A3YA 5AVZA 3W5CA 1XP5A 3SF0A 2W4MA 5ALGA 4XE5A 1SWVA 2VKQA 5AKEA 3DDHA 4YCLA 5ALVA 1Q91A 5ALSA 4OD0A 5ALXA 4UU0A 4FE3A 4C4RA 5AICA 4UAUA 2B8EA 3DNPA 3KDPA 3QU7A 1Q92A 1VFPA 4UM5A 3SMVA 5AVXA 4RESA 5AI5A 1L7PA 5IT0A 4YIHA 2ODAA 1RLTA 3KD3A 1YMQA 3SD7A 1XPJA 4BKMA 3U7FB 2WF7A 3OCYA 4UATA 2YMLA 1RKUA 4PNHA 3I6BA 2I55A 2PR7A 3WKEA 2I7DA 5ALYA 1XVIA 2C9MA 5AKJA 1Z4PX 2AMYA 2YMMA 3E84A 4F71A 4UAVA 3R9KA 2NYVA 3OCWA 2MU1A 3E58A 5AKYA 3OPXA 1WZCA 4L6CA 3FGOA 5A3QA 3IB6A 3L8HA 3ONNA 4YCNA 4B6JA 4HAIA 1L7OA 4IG4A 4YGYA 4EX6A 5AKXA 2AH5A 1L8LA 2OM6A 3A1EA 3ZWKA 3WGUA 2WHEA 3U7EB 4KN8A 1VJ5A 3L1UA 3WKAA 1S2OA 3WK4A 2GFHA 2WF9A 5AVWA 2GHTA 4L6AA 4Y2XA 2ZBDA 2G08A 1FEZA 1QYIA 2YJ5A 4Y3UA 3L5KA 1RKVA 2OA0A 3QLEA 4Y2JA 3AR7A 4NWIA 4YH1A 4QJBA 3U19A 1U7OA 2WF8A 3KZXA 2ZBGA 5AM1A 1T5SA 1EK2A 4RETA 5ALJA 4NAVA 2FPXA 3BA6A 3DV9A 2C8LA 2OBBA 2CFRA 3J7TA 3PDWA 5A3RA 3N8GA 1LVHA 1Z4QA 3OCXA 1RPZA 3BWVA 1N9KA 4UMDA 1Z4KA 4E88A 4CNQA 5ALDA 2B0CA 3ZI4A 3FPSA 2I33A 3B8EA 5AK6A 2B82A 2JGAA 1YDFA 1RQNA 3L7YA 3FM9A 2IOFA 1NRWA 5AM2A 2GMWA 2YN4A 5AW5A 4CE6A 3DAOA 3PGLA 2FDRA 1L7MA 3WKDA 2HOQA 1U7PA 2ZOSA 5FP0A 2GHQA 5AW6A 4HYTA 3A1DA 3AR9A 1ZOLA 1SU4A 4EX7A 5AI9A 4UW9A 3KBBA 3W5BA 5T41A 4CF3A 2BDUA 1IWOA 3FPBA 3M9LA 2HX1A 2I54A 3N5KA 1Y8AA 2ZG6A 1ZD3A 3NANA 5AW4A 3L0BA 2EAUA 2YBDA 2YJ6A 5AIAA 3OCUA 2W43A 1U2SA 3ZTYA 3MC1A 1TJ5A 4NV0A 3WK7A 2X4DA 2WFAA 3W5AA 3M1YA 3U13A 5AKIA 2QYHA 2WF5A 3N07A 3U7GA 4EEKA 1L6RA 2NO4A 5AKZA 1RMYA 2IA5A 5AVRA 1T5TA 4G9BA 1U2TA 5ALQA 2FI1A 3FVVA 2JAOA 3R09A 1ZRNA 3CZ4A 5AHXA 4C4TA 2G80A 3F9RA 1RMQA 1TA0A 4Y2PA 2B30A 5AW2A 2R8ZA 2FPSA 4GXTA 2C8KA 3L1VA 1ZD2P 1CQZA 4OFZA 4AP9A 5A3SA 5ALHA 2RBKA 4YCMA 5AK5A 3WGVA 3CNHA 4BYGA 2Q5EA 5ALTA 5ALEA 1NF2A 1O08A 2JAUA 3P96A 5AI8A 2YFYA 1RLMA 3RFUA 4BNDB 4BX2A 2BY4A 4Y2VA 4HGQA 3B9BA 4NABA 1J8DA 2ZXEA 2G09A 1SWWA 3I28A 1L7NA 5ALOA 1QH9A 4I9FA 2B1RA 3QUQA 1Z4OA 2AGVA 2I6XA 3KC2A 5AM0A 2HCFA 1Z5GA 3K1ZA 3QU2A 3I1YA 5ALIA 3L0CA 4EENA 1KYTA 1TJ3A 2R8YA 3WK6A 2P9JA 2YMPA 5AI6A 1ZJJA 4Y2YA 5ALUA 1F5SA 1JUDA 2HI0A 2YJ4A 3NRJA 2HHLA 4KNWA 3U26A 3ZW7A 3ESQA 3R4CA 4ZEXA 4Y2TA 4YIKA 1Z4IA 3AR2A 4AS2A 2EATA 3QUBA 3NASA 4XQ0A 2JAWA 2HO4A 1X42A 2O9JA 3OCVA 3UMCA 3ET5A 1L8OA 4OCZA 1MH9A 3HLTA 5AVQA 2JARA 1ZS9A 3QNMA 1J97A 1WR8A 4NFLA 5AI4A 2EARA 3MN1A 1AQ6A 5AKHA 2NO5A 3E81A 2HF2A 2DQSA 2PQ0A 3AR3A 4FYPA 2FPWA 4KX5A 4Y2SA 2R8EA 5AM5A 4IFTA 1Z4NA 2YJ3A 3ZVNA 1Z4JA 3ZX4A 2CFSA 5E0OA 3WKCA 4UARA 4UASA 4BNDA 3OCZA 1U02A 2OYCA 4CF5A 1YV9A 4L57A 3FZQA 4CF4A 3OTQA 3U7HB 3AR6A 2GO7A 1RMTA 4UMEA 4DWOA 3NAMA 1CR6A 1ZRMA 2IOHA 5AKLA 2G06A 1WVIA 5ALRA 4UMVA 2P27A 2FPUA 4MWOA 3ZX5A 3UM9A 2B1QA 4BEWA 3I76A 3RF6A 1TE2A 5ALMA 5AI0A 4EZEA 3L0YA 3QGMA 3ZVMA 2FUEA 2MSNA 2G1AA 3S6JA 3N1UA 1Z5UA 1S8OA 1YS9A 1Z4MA 4F72A 5ALKA 1RLOA 5IT4A 3TLMA 1ZD4A 5ALFA 1RRCA 1EK1A 5AVUA 2CN1A 5IS2A 3AR8A 3IJ5A 3ESRA 4BEVA 4HGRA 1NNLA 3MMZA 1QQ7A 2D2VA 4FFDA 2HEGA 1PW5A 4UU1A 3WK9A 2MU2A 5ALNA 4BX0A 3W5DA 2G0AA 1YNSA 2WM8A 5ALLA 3AR4A 1VJRA 4DCCA 3ED5A 3EWIA 3SLRA 4O8CA 4I9GA 2HSZA 4ZEWA 2B8JA 1T9ZA 3VAYA 3QU4A 4KYTA 5AW8A 5AIBA 2AUTA 5AKGA 2Q4TA 2HF7A 4Y2UA 4H1WA 4HGOA 3EF0A 3ZWDA 2PKEA 1N8NA 3SKYA 2YY6A 5AVTA 5AM4A 4JB3A 2HDOA 2P69A 3AR5A 4Y2RA
chains in the Genus database with same CATH superfamily
3G0DA 3VZPA 4GKJB 3K1AB 3JR3A 4AJHA 3NH9A 4U5XA 1P1HA 2R2GA 2YNMA 5J1TB 1J5XA 1PR0A 4M53A 1PG0A 2QR3A 2X4IA 4YTEA 1JQKA 1NAHA 1TQ4A 5C8YB 2OVBA 3OFKA 5D4BA 4FMCF 4YRRA 3R0JA 1FA9A 3H4DA 3I6QA 2A86A 2JEZA 3D0OA 4NL9C 2A9PA 5C8VA 4QL3A 3QPVA 1B6TA 1LPBB 1E9FA 1S0MA 4PYMA 2FMFA 3THSA 3AC0A 1CQJA 5KU1A 3VZBA 2B20A 2RGWA 2Q9AA 3ANMA 9MHTA 5AVSA 4A73A 4D97A 2RG7A 3KOOA 5H4HA 2VNJA 8LDHA 3SDBA 5K3BA 1MIHA 1RWOA 1NKVA 4NG4A 1JHPA 3A1WA 2HHVA 3IDOA 5AVZA 4QU0A 3KHTA 3IMEA 1FU8A 3SY8A 1P9OA 5LOVB 3KDPA 3NAQA 4X6LA 1LBIA 1E0SA 1KKXA 3MBOA 4LXXA 4FOOA 1L5MA 1Z5WA 4KLCA 2YMMA 3G2QA 2VJPA 3JPOA 3VM6A 3LAWA 4L6CA 5IPFA 4LHVA 3FUXA 4MW0A 4LF4B 1G20A 1W4CA 5J8YC 1JEEA 3UB4A 2QKYA 3VV2A 2GKOA 5FX2A 4MUHA 3JWHA 2YC4C 5HIJA 4J9UE 3ZBUA 3LVVA 3KWJA 1R10A 4AJLA 2WTBA 1OE0A 1M1YB 2HIGA 5HEKA 1CB0A 1NI5A 1ADYA 1QV6A 3FW1A 4YBZA 2WUEA 1PZMA 1LWOA 1HYGA 2G7ZA 3PMNA 4RTMA 4ENPA 1BPBA 3LH5A 5DCUA 1VSBA 3EEFA 3MCZA 4BZZA 2HMTA 4R8UB 1J2NA 1QGZA 4F8EA 2DBVO 5I9TA 4YRLA 5EUBA 4UFNA 4EQ6A 3ZDBA 2ZJ2A 4ED9A 3LQQA 2IHKA 4BNTA 4FINA 5D84A 1L4GA 2YW2A 2ATCA 3DBVO 3VUFA 1U9CA 5DLDA 3MTJA 2EBFX 3ZTYA 4W99A 3RS5A 3H1AA 1C1XA 1S3FA 3IG5A 1KEEA 1Y34E 1VL6A 3EJ6A 1PCXA 3EGXB 1EU1A 3CZ4A 1QR2A 5KG1A 3D5EA 3K1TA 4OFWA 3FWKA 2WT9A 3CZMA 5CNJA 2X1HA 2PUJA 2CNLA 3L3BA 2O5EA 2HQSA 3B6KA 2HHQA 4I2HA 3I6MA 2ZIGA 4E5KA 2V4QA 1DS6A 2YR0A 4U2EA 2XE6A 5F7XA 3WRWA 4AUKA 3AOGA 3MJ4A 1TTTA 5AI6A 2JPDA 3GA5A 4R69A 1TK0A 3NRJA 3TLGB 3GRCA 3IT2A 1Q0HA 2H3EA 3QI2A 2HWWA 2XXBA 3T7JA 3DMRA 2BKUA 1X1QA 4JLMA 4S0ZA 3B78A 3D6TB 2JARA 4Z2AA 3QXJA 5A6SA 3LA8A 4DLLA 2C3MA 4NDAA 1WTCA 3K8OE 2IEYA 2YWFA 3V80A 3PNBA 3OLCX 1KVSA 1D2RA 8ICAA 1M67A 2Q5HA 3IV6A 1WUIS 4PINA 3HBNA 5IJ9A 2QTTA 1KEPA 4YJ3F 2FY8A 4XYEA 2WNHA 4G67A 2O1SA 4MP6A 1NVUQ 3WB0A 1GTG1 4JXJA 4BLRA 4JIMA 4C7KA 3ZDYB 3GFKB 1R3DA 4LJSA 3Q7RA 4PLWA 5CB4F 3KVRA 2AR7A 5JRDS 5HPYB 4QX6A 3C70A 5H02A 3PEYA 2V9PA 3X44A 1V5GA 3X2EA 4ZV7A 3BTVA 2XZDA 3WLPA 4G4IA 5CRIA 2NX2A 4U2BA 1T9ZA 1U8AA 3SQMA 3A6LA 3OSNA 4FZ3A 5BORA 5FWYA 3SXPA 2CBGA 4ENSA 4K3VA 1JU4A 3AH8A 3U4GA 2XD4A 2JGRA 4ZO7A 4YR9A 3AV3A 1DPFA 1E1LA 3BHMA 3ICWA 5D49A 5FOVA 4GIBA 3M8RA 2WUGA 5DX8A 1NV9A 3PA8A 1JFTA 5JAIA 1D1SA 2UYQA 3I5UA 1WG8A 5DKWA 4P0PA 4P0TA 3ZUPA 1JZQA 1NOJA 3KJXA 2C2KA 1F12A 1MAWA 4DL9A 3ZN2A 2D5LA 1TC2A 3EVDA 5E95A 1BDHA 3C74A 4H7HA 3L43A 2B0JA 1TCBA 5DISB 3OUZA 5K4AA 1XQXA 4IICA 5L51A 2Q5CA 4ETMA 1FDRA 4JOBA 4MUMA 1E1KA 1T9BA 2HU7A 3OLXA 5CB4A 5HE8A 4HAYA 1OUQA 4O1HA 3GNSA 4KUHA 5JAHA 1RJWA 1VOTA 3GJYA 4Q3LA 2H5LA 3S81A 4YPFA 1ZI6A 2H6EA 4FMDF 2C2HA 5CFRA 1WM1A 2E82A 3LMKA 4MA5A 3P0JA 1SZDA 4P0QB 3F3MA 3M9XA 1DC8A 2WMNB 1PLLA 5IT0A 4YIHA 4RD4A 3KQWA 1G19A 5ALYA 1JI3A 3MUOA 3TLKA 3CT6A 1DMRA 3BF7A 3I8OA 3EEQA 1NK9A 2VSFA 2AGQA 2B83A 2GYWA 2AXQA 3UB3A 2I99A 1X1AA 2PUAA 4P53A 4L73A 1IHDA 3ICCA 2A19A 4GP6A 5KVAA 2OORA 4K81B 4C8MA 4MUNA 4RH0A 3V00A 4S2EA 3BA6A 1EDEA 2A5FA 1SGWA 2QD2A 5FWDA 2I6FA 3GIJA 1LS6A 3OGUA 3NKFA 3RFAA 4EH1A 1AQYA 4GR9A 1AH2A 4FS1A 2COEA 4EP1A 3ILSA 3NOXA 4ACOA 3R9WA 4JI0B 3QMWA 4EX7A 2ILVA 3SVLA 4XDGA 3EMBA 2EAUA 1GN8A 4DG8A 3FYUB 1M9NA 4FSHA 2P9GA 1ZVQA 2HHUA 2B4AA 1NXXA 3L8DA 3U7QB 1W5AA 4OY3A 1YTLA 3FDZB 7ICTA 3FROA 5LA6F 3R09A 1W35A 3LFUA 5KYVA 1EJ6A 4Q18A 4Q4AA 4O4LF 2QRGA 1XHEA 3E8SA 5IBRA 1AV6A 1IVYA 3NBZC 2GX6A 3GOQA 1ZC3A 1EFLA 4BP3A 2BD0A 4MW5A 5GIPE 2K87A 3JQ7A 2CHFA 1TLFA 3STHA 1O97D 3AEKB 2CL6X 2PUWA 4QULA 3FYSA 4GOOD 2JEJA 3AJDA 1SOMA 3L8MA 2V7GA 2X7HA 4CKXA 5DX0A 3A9VA 1N9GB 2V7TA 2H52A 3AILA 2YMPA 1ZQHA 4TT8A 1PGQA 4WE3A 2W9AA 4LZNA 1JYFA 1YZUA 3G59A 2A4KA 2ONKA 1IATA 3ZU4A 4GLBA 4D45A 3E0QA 1YS6A 3RVNA 4DT1B 3VVLA 3Q3CA 2PSDA 1SKQA 2ISSD 3MJFA 1X0XA 3PE6A 4YYEA 3WLNA 5DW3A 1YK0A 3H5NA 4R0NA 3GIIA 1Z4JA 1LQ2A 5JT1A 1NPYA 4F6RB 5LKRA 4KNYA 1TGYA 3D7KA 3UZUA 4P54A 4Z4FA 4ZMRA 5FAXA 4K9LA 1E2HA 3RH6A 3BDVA 2H3ZA 5LA6A 1LFAA 2DVMA 5K0SA 2A57A 3CE9A 4O4LA 2OZLB 1HRDA 4UHDA 5JXHA 1PW5A 1GPAA 1FRZA 2PT9A 4XD2A 3VJKA 5LPNA 2O07A 2YH2A 2C4WA 5BNTA 2KV2A 4WXEA 3ZKWA 3CF0A 1GGNA 2RHGB 4U2CA 4B3CA 3LCUA 3D7LA 621PA 4WOPA 3U4QA 3G0GA 4XW2A 2UVWA 4BO9A 1IYZA 4ED0A 3QU5A 1YHNA 2BF4A 2X0RA 3PTAA 2VAWA 2JAXA 5F98A 4NMXB 4LF5B 1UM9A 3HUDA 3EXFB 4JL8A 4ERXA 3T94A 3KUDA 2JLXA 4JC5A 5K9ZA 4C0SA 4L4ZA 1W4AA 4D43A 4YV0A 4R98A 4BO2A 1T36A 4I9UA 5HILA 3DOCA 5AVVA 2PL3A 4LSMA 221PA 4D6XA 4YYZA 4KC0A 3NUQA 2QMEA 3EF1A 3V42A 2XJ9A 2K60A 3PC8A 4NLLA 2N3ZA 2XVAA 3IIKA 4L0MA 4OHCA 3PR1A 5WRFA 3ZHXA 1QRUA 4V0KA 1BD4A 2B4RO 1QYRA 1YS4A 1JG4A 1JSRA 1KP2A 1J8YF 2I4MA 2PZBA 4F4DA 3JAKA 1U1CA 4G23A 2ZUUA 2FRDA 2GBLA 3CWZA 4C08A 3MFIA 5COBA 1JH9A 1X1BA 3VFDA 4LS3A 2VEOA 4ENVA 4EB0A 1CUCA 2H2DA 4D46A 3CRW1 3HBFA 1R16A 5AKYA 2LKCA 1NJ2A 5FFMA 4WNAA 2B1IA 5TSDA 3KU4A 3VPCA 2O7VA 3E9DA 5LCXA 4V2IA 3NGXA 1PVRA 2HMVA 1S2OA 4F4WA 1E6LA 1EE2A 4ELVA 1FYWA 4JU9A 2CF5A 1H3EA 1BCRB 2WFMA 4L6IA 4DSKA 4RZHA 4WKOA 3A1FA 2BGMA 2VJCA 3QV1A 3K6JA 3N3BC 2X15A 1PUXA 1SPBS 2O2HA 5F12A 3KVNA 4J9NA 2GK6A 3LGXA 2A30A 1YUMA 1T0BA 4N65A 1MJFA 3UK7A 1ISFA 2J9FB 5TMEA 2JG3A 2IOFA 3M81A 3VH3A 2QL5A 1XDUA 4LTDA 3N6XA 1RHMA 1U28A 3MIZA 2OHHA 3AJAA 5AVKA 1WHTB 1I6LA 5FCDA 1UUFA 3TINA 5AIAA 4FC6A 3KHSA 4LJ4A 3M4JA 3FKQA 4H7PA 1VYVA 4TVBA 4MO2A 2WTMA 3OIWA 5H9VA 5M2QA 5DNVA 2G80A 1X0VA 3HN6A 4F2GA 4JP8A 4Q6WA 8ABPA 2PU7A 3RSHA 5KREA 4QNRA 2O2CA 1U5AA 1NBOA 4FILA 1SHUX 2ZR8A 1GLVA 4NP6A 1XTTA 1V3UA 9ICBA 2GCPA 4B6PA 3T3FA 2E1PA 4IGFA 2G8LA 2EP5A 2LIVA 2W7TA 4RPHA 2IZOA 4JSTA 3OIDA 3T0GA 1MOQA 5BW6B 3SN6A 2GWSA 1GOTA 2QN9A 1RZVA 4XTRA 4OM7A 1EWRA 4GDMA 3KUKA 5E4JA 4ALIA 3QE4A 1CUHA 1R5JA 3PTLA 4WW0A 1Z7YA 1H9BA 2WT8A 5JRJA 4XIFA 5AFSA 1J8FA 3ZX4A 5J2JA 1A98A 4D02A 3RFCA 2YNMC 1BWPA 4KGZA 4N18A 2O8VA 4WCFB 4FD3A 3DNMA 2Q9UA 1ZM7A 4F60A 3TJRA 5L7YA 3VU3A 5JXJA 2BQ3A 5TPWA 5T64A 3WWCA 2WHXA 2ONJA 3PGJA 3EVCA 2VAVA 4IW3B 4MA0A 1WZNA 4BQRA 4LNUA 4XWAA 4P4SB 1ECFA 3MTIA 5JASA 3TG2A 2BZ0A 1T4MA 1RQRA 5EMMA 1P0MA 1KMHA 2D3DA 1IN5A 1OXTA 5EN4A 1E59A 1A88A 1ODFA 2JGFA 3P0HA 3ZLTA 4MR7B 2NUTA 4H3HB 3PXAA 4ZEWA 3OTGA 5JDIC 4MB6A 4EHLA 4IIXA 1M6VB 4J0FA 4HAXA 4NMMA 2WVHA 2DSNA 4I0WB 4UU8A 2RJOA 1X8KA 1BS9A 3H2ZA 4PXYA 1RXIA 3K9QO 4Y1EA 4TN5A 5EERA 3KQNA 4A3SA 4PG4A 1EXVA 3RVSA 3C6XA 4RFSA 3IBCA 2QEQA 4I28A 1L7RA 1VKJA 2CCKA 3F6YA 3DXFA 3CXUA 5J0TA 1NNUA 1U31A 2O2EA 4I55B 1FFBA 1JR6A 2ZVQX 5H7XA 2NZVG 1J22A 4RK4A 1PJ2A 3CZ5A 2WQ6A 5HF6A 4B9LA 2H3VA 2D8MA 4FWIB 3M1AA 3WICA 5L6MB 4QYIA 3PI7A 4JX9A 4EBFA 1NONA 1J20A 2J46A 3C1YA 5E38A 4EDFA 3KJEA 2J9GA 4I4IA 3SQLA 1VL5A 4GHWA 4PC2A 3UUEA 4DLWA 2AOWA 4HDQB 1W1WA 4KQGA 4OLAA 1PK3A 4WN3A 1BRMA 1YZ6A 2Q5QA 1FYDA 2X4GA 4HTFB 2ODQA 4PS0A 3DXYA 1DDIA 1OBHA 3P9YA 4A9AA 1KMQA 5GADl 5LIRA 1GM5A 2F1JA 2ZYAA 3CW9A 4P81A 1Y9ZA 3JPRA 2DGDA 1VBMA 2YVAA 4RQ8A 3H3FA 4NCKA 1XTZA 4U9UA 4D9FA 5J47A 1V97A 3TLBA 3C23A 2P4HX 4N8SA 3L9XA 2WDZA 4N3CA 2ZSEA 3LT2A 2H85A 2OCKA 3GPBA 4RVUA 4FYVA 4WJZA 5HBRA 5KFZA 1V1RB 5LYYA 3ZG6A 4P32A 1NSTA 1BMDA 3ZE1B 3S2UA 4ECTA 4ITRC 1XZKA 3NFRA 4KAXA 4FYJA 1RZRD 4FSXA 2K4HA 1NXTA 5KWSA 4JJ4A 4F5EA 5EE1A 1QIEA 3PDWA 1QQBA 2AKEA 3RB4A 3NP7A 4NPAA 1K6XA 3GQBB 5ITSA 5T57A 2GAIA 1U3FA 1G2QA 1ZQPA 3O95A 1DFHA 2XTNA 4DF4A 2PY6A 1FNDA 1ZOLA 4JLVA 2SHKA 3L7OA 1YZHA 4O63O 5HM6A 3OKFA 4L8YA 1PT8A 1U5BB 2H1SA 1A69A 3O38A 2E5FA 2ZAOA 2NNLD 4CI9A 3IE2A 1DK2A 3HY3A 4WSOA 3E3AA 3R9XA 4N5IX 5IKEA 1C0LA 1R1DA 1HL7A 4NLNA 1GAEO 3PQFA 5KDDA 3PL5A 3KP1A 3BMNA 3BRSA 1Z7GA 5ALHA 1UR5A 5EIOA 1RRMA 3ZDRA 1VDVA 1WWKA 1CLUA 3RF7A 2GN4A 3T34A 1EG2A 1UOOA 1X9IA 3FFBA 3BD6A 1Z0FA 3I2FA 5JI3E 4F2PA 5EOZA 2P9JA 3KKEA 2O8CA 5JD4A 3PY8A 8ICWA 3N53A 4JYAB 2G63A 2O8BA 1V26A 1T0UA 3V2UA 1HXHA 4DCTA 4I2EA 2G17A 3OEWA 1TAMA 2WNIA 4GBMA 2AE1A 4ENRA 4MULA 3GLHB 2NV6A 5AKHA 2V55B 4DDKA 3TW0A 4P4PA 1H1LA 5T6BA 4UE2A 4M7OA 1TM2A 3QXSA 4BKUA 3T95A 4G0XA 2B5WA 3DTVB 3LWLA 1IN4A 2GN0A 3HFGA 4EG8A 1AX9A 1FYFA 3GC6A 4IQ4A 1DXSA 3PYXA 2FUEA 4RO0A 3EGWA 2P6UA 4ZTBA 5C5IA 2XZLA 4O5KA 4OL9A 4WZZA 5A0TA 1Z45A 4ON9A 1N5RA 3QELA 2BTQA 4A8JA 2HEGA 2QRPA 1GZ6A 3PGMA 2DFPA 2EDUA 2EZTA 3OZBA 1BPDA 4IUBS 2WWGA 3LOQA 3FMFA 3QUAA 4E4RA 1NHWA 2Q2OA 3QXXA 1E7YA 5JNVA 1T8EA 5JYBA 4Y2RA 4NOMA 3MQ2A 3QNUA 4DADA 4WECA 1DV2A 2HA0A 4KW7A 4HFRA 4Y2QA 3KTFA 1TZMA 1U0GA 3UGJA 3PLRA 1N60A 4QRIA 4S24A 4WBNF 4NL9A 1MV8A 3CIOA 1OXXK 3HRIA 4J07A 2O3TA 3QTLA 1H3FA 1CEYA 3LTEA 3KQLA 3HL0A 3MGAA 4O2BF 1Y8CA 4UXHA 1N25A 2EFJA 4Q12A 1H65A 4UHKA 3CGGA 1SEVA 2NN3C 2JFVA 1LZKA 1OLUB 2I4TA 3QVJA 3FOCA 4J6EA 3TBFA 3JZMA 2R7AA 1PR2A 1R15A 1B16A 2XR1A 4X63A 4RK7A 2Q0ZX 1ICIA 2AFIA 3FNFA 3UKOA 2E5SA 4I4TA 3IDWA 2ZI4A 3ORFA 3L4JA 2VHVA 4NS1A 2ZJBA 5ALVA 5ALSA 1SR8A 4C4RA 2PBRA 3SVTA 1D04A 1Q92A 3V2IA 3RTAA 1WEHA 4TROA 3N8HA 3CGWA 4YQEA 1QE3A 1N8TA 2OZVA 4CV0A 4M0UA 4CEJB 4D42A 2RH8A 3DVAB 3M3DA 3QZ8A 1KPHA 1FP1D 1H2BA 2F6RA 4KR9A 4DVJA 1OI3A 5BSVA 3KR0A 3PJFA 3PHIA 2R7KA 2J4DA 2ZLBA 3B6EA 3D7MA 4C0AC 4O4JA 4IZOA 3ZCXA 1N7IA 2Q62A 3HA7A 2V7EA 1SNYA 1URPA 2BMVA 4MMYB 2IZZA 5FULA 4DPLA 4ENQA 4L3VA 4OQPA 2BMWA 3IVCA 3ZY4A 2XCOA 5FFFA 5K8CA 2VRBA 2XMRA 1DOQA 3U62A 4CCWA 4CL3A 1T1EA 4UW9A 1TYZA 1JEJA 1O6ZA 3ONVA 3SV4A 3WC4A 1MC4A 5LD2B 3ASZA 2X4DA 4DDMA 2JFHA 1PQPA 4OHPA 1C8VB 1GZUA 4QO8A 3E2PA 1EUDA 2YXPX 5AVRA 5CM8B 4BKRA 3HFJA 1IJBA 2VHEA 5REQB 3LUAA 2HYDA 1EK5A 2ONCA 4MYRA 1OFGA 1A8UA 4AO7A 2QRZA 3VUEA 1U81A 4AWBA 1T3GA 4W7HA 3OD5A 3T52A 1SXJE 3QMVA 1WLSA 4KXWA 4AX8A 4BP9A 1II9A 4C8LA 2F8MA 3L07A 1IG6A 5TLSA 3P0EA 1DADA 1L9XA 1YR8A 2DKNA 4J0EA 5C7YA 1ABEA 1C8BA 3FVQA 4HZUA 5F1OA 3H1BA 3FFXA 2BGWA 4HWSA 4NCBA 2ORWA 1UBKS 2E0IA 1KFKB 2NACA 4FQ8A 4H4CA 2F59A 3GXOA 4M0FA 3OBBA 4DY4A 3ABZA 1ZJ5A 3EA5A 2VAMA 1YGPA 1THGA 4YRCA 4HMPA 1NVWQ 3PRJA 4UDNA 4D25A 2I3BA 3AERA 4PC6A 5E7QA 1VE5A 3R9IA 4HV4A 3PR3A 3GRZA 3CZAA 4ZIRB 2ZM5A 3DMFA 3S44A 2Z2IA 1ZD4A 3PI6A 3IMKA 5KHAA 3I1FA 2W6ID 4FIZA 4OBEA 4PQGA 3PC8C 4O2AB 4C1NA 2Q41A 5TEVA 3W6NA 4R8MA 1VLLA 4M99A 4B7CA 2YV5A 2Y2VA 3VTFA 3C3BA 1JAYA 3FNHA 2FRXA 3HCNA 4R7ZA 2BFDA 4ZRNA 1QZUA 2MCFA 1O96A 3MCVA 2E5WA 2P6NA 2GBLC 4F2RA 2Q0XA 2OPHA 5JARA 1CQWA 2HWXA 4CT4B 3U5ZB 2QM8A 4HDNB 1XAJA 3RJIA 1A4XA 2P11A 4C01A 1PZHA 2I8AA 4FW8A 4JP1A 4GS5A 5SYAA 1C7QA 4E3ZA 2QLNA 4KJZA 4BB0A 1HNZB 3WYEA 3MAJA 1Q11A 1O57A 2CLSA 1D2GA 2H8KA 4HFNA 3OU2A 2I1LA 3LX8A 4NJEB 4JI5B 3EZFA 2QTAA 1XXHB 4MW9A 3TFQA 1TQHA 5AW3A 4AC9A 5B58C 2HU2A 1VJGA 4IIFA 3GPCA 1F9AA 5J5CA 1UINA 3A4VA 1Y1QA 3NRZA 2ZB3A 6ABPA 1WYGA 3DOUA 2JEGA 2HDNB 2O4UX 2Y9TA 1EUYA 3IPXA 1FX1A 1WXQA 3QZ7A 5JR3A 2YL2A 3S28A 3VAAA 1T26A 4N9QA 3THXA 3I39X 2R65A 4CIDA 3N8IA 4DA4A 2XKBA 5GOTA 1MQ3A 5KL1B 2OHJA 4MKIA 3ILHA 4L85A 5KPDA 5C1BA 1CJKC 2YMLA 5CNMA 2RKOA 3IOMA 1COZA 1H4QA 3UAVA 2W04A 2WWVD 3R3HA 3SDSA 4Z2YA 2OP1A 2NYVA 1VTKA 1AKMA 3MRXA 3GZTB 4ALMA 3KVYA 2Q2WA 5HF5A 2AXEA 4RQBA 4ZGGA 1Q2XA 2FR1A 1W75A 4NC9A 2A4MA 4CIAA 1WBBA 4D0LB 4K6MA 5EJGA 3TGLA 2DPHA 3U7EB 1M34E 2WWHA 1JFLA 1ZM2A 3DWEX 4LOAA 2AG6A 5IH3A 4DLYA 4XGRA 4Q1FA 3GJ3A 4PGFA 5I7EA 2MSKA 1Q0TA 2IIPA 1CUEA 3B1KA 2IXBA 2ZRNA 3QFRA 3X1MA 2RBGA 1A96A 1R6XA 4CE6A 3ZV4A 1EFVB 2W55A 1VMEA 2EFHB 4CMJA 5IMSA 4IIGA 5EXDA 2QPOA 1N1GA 1J42A 2YJ6A 2AN9A 1SKBA 2W43A 2HXGA 1EFUA 4PL1A 2BISA 4GYJA 3FB1A 2CVOA 1OWMA 4QFDA 5BN1A 2H59A 4WLVA 3C6YA 3M1LA 4IIHA 3PLAE 4UB2A 2WFLA 2B6HA 1KVRA 4G6ZA 4ND5A 5EP2A 3WNDA 5SICE 1IOLA 2FWBA 3B9BA 4QUJA 3A28A 5ITWA 4UUQA 4CKEA 3DJFA 4A4DA 5T4HA 2WKWA 1XZAA 1KO1A 1Q20A 2DH5A 2KE5A 4DRZA 5K8IA 4KYUA 4QUIA 2PZGA 4ZYLA 5JNTA 5IC5A 1CZRA 2EATA 1L5NA 2Z8ZA 3A4LA 2JV3A 3N70A 4HDAA 4LC9A 1E79D 4BQPA 2VBGA 1WVGA 2P1RA 4JJ8A 3LCRA 3K70C 3Q3JB 2AR9A 1AXEA 5KDOA 1OX6A 4ZPJA 3R0QA 2OCEA 1ZRMA 4A6DA 1I6WA 1AV7A 3HVUA 4UNNA 3DEHA 1HBJA 3LI2A 1DOZA 4HBZA 2PV0A 2Q1WA 3VTZA 4LJAA 5ECWA 1ZMRA 2BM8A 3E0XA 4IR1A 3FJ1A 3S2IA 4Q3NA 4IDBA 2ORVA 4A7PA 5ALFA 1PWHA 2X9NA 2QUIA 1LLUA 1QGYA 4KDRA 4DQRA 3HKBA 3X1XA 1I4DD 2HK9A 4YCAA 4A27A 3LS2A 1Q1QA 2JJ1A 1ADFA 2VHCA 4DR2B 5KFRA 1I51A 2J3QA 2WVGA 3T4UA 3JYHA 1YQDA 2JLQA 3AJ9A 2XRZA 2K2WA 2X9GA 3TVDA 3LY8A 3COSA 2JZBB 4M1YA 4KQCA 1K4MA 4AMVA 2FQWA 4E32A 5CCBA 2X6RA 3NP9A 3IJEB 4JUFA 1B23P 4DFKA 3RJMA 4NE2A 3E23A 5JCXA 3O2SB 3HYCA 4AZ0A 4AJEA 2FOXA 1I1NA 2BDTA 2HLDD 1K8YB 4ARVA 2YV3A 5KIAA 3DAPA 1T0JB 1ESNA 3CEPB 1LI5A 2IA6A 3ZYZA 3VOBA 3LQRA 5HZKA 2OPBA 3SNKA 2PRKA 3WMXA 2E4YA 2FOLA 2MTBA 2R8KA 4LZAA 3N7TA 2R4QA 1KA9H 1VG8A 2LZ0A 4JP5A 3I09A 4YCJA 3MOGA 3F4LA 4CR8A 1X7ZA 1R0SA 1XD2A 2F77X 4L22A 1HEYA 2YY5A 2OILA 5JS1A 3UJAA 1TM5E 5E4FA 1NJ1A 5AKEA 1BFDA 2WIBA 5I8WA 5NULA 1L7PA 4FC7A 4OREX 3LPNA 3FUUA 3RAJA 3DP7A 2RAFA 4J7UA 5DI3B 4QU8A 3AW9A 3OCWA 4H7DA 5HHIA 1VE3A 1XN1A 2VQSA 2YKGA 3FGOA 2W9BB 1ZVVA 3L4BA 1JS1X 3NBYC 3O4RA 4PVDA 3I5MA 3SNHA 1ZK0A 3GDXA 1JN3A 1NY6A 2DQ4A 3IV9A 2ZS8A 1E0AA 3TADC 2Z2JA 2LGJA 3LVWA 4X20A 4LJYA 3AZQA 3C5GA 2JFOA 4KQ2A 4YQYA 8ICYA 1SCKA 4G1CA 2CXSA 1PDWA 5GINE 1J0EA 4LF9B 1N0VC 4L5BA 5JG7A 4NU0A 3BK7A 3PZPA 4EKYA 1INLA 4HYYA 4TTJA 5THKA 4QA9A 1SULA 1G291 4LISA 3LVFO 2J9RA 4F8YA 1L1FA 3F49S 3AXSA 5K0BA 3PPWA 1JVBA 5C1PA 3UGKA 2BCVA 2ZG6A 4JT4A 4HX5A 4IXNA 3UHOA 4NV0A 1D2AA 3TQ1A 2R7NA 3N2LA 4PJ0U 1L6RA 1ISHA 1YR7A 4RPKA 2I8LA 1XZBA 3EFHA 2FN4A 5F4ZA 3RVDA 4MQBA 1XTKA 4J0HA 2GAFA 2BP7A 4ED2A 4JBHA 4EUKA 1FFCA 2BH9A 1FCJA 3BWXA 5EZ5A 1B0PA 1TPYA 1SUCA 2UVDA 3E3NA 4QBFA 4C07A 2UZ1A 4J6FA 1QVAA 4A8JC 2KG5A 3UT0A 2EYQA 4F11A 4D3SA 2I2FA 4K46A 1L7QA 1GGFA 4YO8A 2GWHA 5DLYA 1PJLA 8ICRA 3ELWA 4HP8A 3NS1A 4UXJA 1SXIA 1ZP6A 2DR0A 4U7FA 3RC8A 4B75A 3A2KA 5KAIU 2W2KB 1X1CA 1H2RS 4MPDA 3BMOB 1EVQA 4U1RA 3LQFA 2AQ0A 4MI9A 4BFSA 4W1SA 3KOMA 4LRSB 1AROP 2NXCA 1X13A 4N5HX 7ICQA 4YT5A 3DMDA 2DHQA 1S3IA 1DX6A 4WLOA 1PJRA 5JSYA 1OH7A 1RE1A 2JGEA 3K9FC 3KHLA 2Q6OA 4BFXA 1DT3A 1BGWA 3LX4A 3DJYA 4EZEA 5J2UF 4Q7MB 1IEXA 3KKZA 5JDIA 3CCBA 5BSMA 3G5UA 3IDZA 3IQGX 4MQ6A 1BH2A 5ARCA 5KB3A 1CUVA 3QKSA 2J3IA 4KKXB 1YA6A 3D6AA 1Y1LA 4GXQA 1NNLA 4ZU1X 3R4VA 5BP7A 2KSQA 3OJCA 1SHJA 3DV0A 4XXHA 1JGTA 2CYCA 4TRRA 1TM7E 4KYTA 3QEBZ 5G0WA 1L4BA 1M0WA 4RHEA 5IH7A 4IRDA 2NUPB 2H1LA 1SHLA 2HRCA 5LN1A 1N78A 5IU6A 3EFOB 3KZ1E 1AMOA 2DFLA 4QW8A 3TR5A 4O4IF 3HCCA 1WW2A 3Q7IA 2GYYA 3NHBA 4NBLA 1WZEA 3ONFA 5G4KA 2H5XA 5KPJA 3KFVA 1TB4A 5K6RA 4EOGA 2AXPA 5FV4A 4ZQIA 3PENA 3WKBA 4EG4A 1VB5A 3ICXA 1Q83A 1UA0A 3TPFA 2GASA 3A1CA 3HWSA 1UPUA 3FIUA 3NPAA 4PSAA 4IH4A 3KYCB 3FF4A 1LNQA 3QVGB 3G85A 3K9WA 3AOEA 2C1XA 1E8MA 3PYMA 2QDKA 4BUJA 1JJIA 2X41A 3CE6A 2ID4A 2AFHE 5J2UA 1MG0A 1IPFA 1IUPA 5LJIA 2AMJA 4CQMD 3TMAA 2H65A 3GJ8A 2FZVA 1YL5A 4Q66C 3D0RA 5ELMA 1HY3A 4BDTA 1XQ6A 3D8UA 4MV6A 3L0ZA 3VSDA 4WMLA 1WCXA 3I01M 1HE3A 4C89A 2VQFB 1YMQA 3RHZA 3WYFA 3TZKA 4UBLA 3G2LA 3BFKA 1KARA 1XV5A 3OHPA 4L8FA 4JGGA 4NH0A 3B53X 2RSLA 4FJ1A 3A70A 4MS4A 2CXXA 3EVNA 2HSJA 1H69A 4O4IA 1J9ZA 3TD9A 1W49A 3KEFA 3W1VA 5G1NA 3U49A 1Y98A 1XZMA 1E3WA 4DKXA 2PT7A 4US2R 5KCZA 4XYBA 1W36B 4LRWA 1Z0SA 2IHVA 4MWEA 1YASA 4UTVA 2HV9A 3IERA 4OBXA 4ZJPA 3CXRA 4TUQA 3IALA 3W0LB 3AWDA 4XWGA 1J39A 3IIMA 1BKDR 4X54A 2PX4A 4OJLA 5AM1A 4AJPA 2IYQA 4BV3A 4MPRA 2ZVDA 3P27A 2OHGA 2JLRA 2EQAA 3PNQA 4CZ2A 2RB4A 8ICNA 4C3OB 3PX0A 2CRXA 5I3ZA 4KKVA 4AJKA 3S2ZA 5HYVA 1XPOA 1DKMA 3UPQA 1KRWA 1HEUA 2A84A 5F77A 1VE7A 4CLRA 1G20B 4XRGA 3UBTA 4ZHQB 1S9DA 4TTPA 3L7DA 5IANA 3HXMA 1JDUA 1HQDA 5EJ5A 4BUCA 3FLBA 2AXNA 2ZSBA 3U13A 4HS9A 3DHEA 2C07A 1P1KA 1QSSA 2X5XA 2HXSA 3QY9A 1V9LA 4RACA 5JAUA 3U39A 3OKPA 4DC9A 1XC7A 4OV6B 1VBNA 3NVZA 4DMLA 3JPWA 5C81A 3ZJTA 4TKUA 4BFYA 1WXWA 4NXZA 1GCAA 3CWQA 1Y9DA 1J7JA 4L4SA 1T9HA 2BRUA 4JODA 1Y7IA 3NVVA 2B4YA 1JYSA 1U0EA 4F46A 2B7LA 4R9VA 5BOMA 3KC2A 3T3OA 1T4CA 1L7XA 5EXPA 2VBFA 3FTEA 5KFIA 3CKMA 4WBXC 4BJHB 4RKFA 1KEEB 2OCDA 3FRHA 3OZVA 2WYIA 4U2DA 2C82A 2G9ZA 2XGGA 4UUBA 2V3CC 2GA8A 4XJXA 4CLOA 1CZNA 2PGNA 4PHTA 1RYNA 3RIEA 4RULA 3S5UA 4DJEC 2R1VB 2MT9A 9ICSA 3TXXA 1Z2AA 4IR9A 4MROA 3TIIA 2YX1A 1KZHA 3FNQA 1UC5B 2J5XA 1AKQA 3AU2A 2ZSJA 3G1UA 4YJ3A 3X0DA 5JYDA 4WHMA 4X62B 1XZDA 1IH8A 3RH5A 1HPLA 1FDSA 2GTHA 4M87A 2IX3A 3O3CA 2V4ZA 2C9DA 4U6QA 3QV2A 4NYMR 4PZAA 3NAZA 3MLEA 1B26A 1R9GA 2C99A 2FX3A 1Z26A 3SLKA 3DZIA 3ESRA 3RIMA 4GPIB 1SBHA 3L4EA 2XOKA 1P4SA 4BLWA 5A6SB 3W5DA 2KYRA 2BH2A 3I3OA 3MUFA 3V1KA 3V6JA 4PAGA 4B33A 5IJ9B 4LQ4A 1SKUA 4GI3A 5CEHA 4EBEA 4BWVA 4G5GA 4MGYR 1AN9A 2YJGA 1PS8A 3AWIA 2ZTHA 3O4FA 4HH1A 5CJPA 3CEAA 4TZTA 3GMIA 4XJVA 5F1PA 4HDMA 4RM3A 4MV1A 2OSBA 4RZUA 4DUGD 3FPEA 1S8AA 3PNMA 1OV6A 1E92A 4X6XA 4X71A 2VZ8A 1JDJA 4PV7A 5FWYB 1USVA 3LUGA 4U9HS 1CEZA 1GGMA 3RVKA 7ICRA 3CRMA 3BJIC 4AJ2A 4QREA 1E2UA 4GKVA 3ZY3A 4QXPA 4OGWA 2IUTA 1F7VA 2XT6A 1OBOA 1CRZA 1JIJA 3UK2A 4E5UA 1IEQA 4MJ3A 4QOEA 3DAFA 1N1MA 2X3UA 2XVZA 3WGOA 3LDFA 4RADA 3LUPA 4CR6A 5CA0F 2PIAA 2NNWB 3MM4A 4CRWB 3UJDA 3T1OA 1VDZA 3D8SA 1UF9A 3TQIA 3U4CA 3NDJA 3OQIA 1LUAA 4GZLA 2NZWA 4OEHA 4P84A 2Z9CA 2HSGA 2Z4TA 3IL2A 3T7IA 1N2HA 1DGSA 4PBRA 1NT2A 3KDAA 1PHPA 4XFJA 1O89A 2WMOB 2VUSA 5KOIA 1ODTC 2B5VA 2DMRA 5FNVB 1MX9A 2J3DA 2C2RA 1B3RA 5DYGA 5EPUA 3GEMA 2A1AA 2YASA 3DE5X 1Y33E 1ZSYA 4OYLA 1G3QA 1HFJA 3WQHA 1R6BX 3K6SA 3OJWA 1E98A 4I50F 1KO7A 4GZ6A 2EF1A 5ALDA 3PRHA 1Z17A 4Q39A 4ND4A 1H5UA 3F74A 1SO8A 1MC8A 5J3JA 1JR3D 3Q40A 1GKLA 5HR6A 2DSTA 1CDZA 2IH2A 1ISIA 4I1RA 5AW6A 3T3EA 3SZRA 3SAHA 3ZWNA 3T9FA 4I9NA 4B85A 2XBMA 5DDIP 2W9CA 1S01A 1D9XA 4DPMA 1M10A 3GRVA 3WK7A 3F6RA 2HD4A 3LO5A 2G76A 3F6PA 1PN3A 1QHSA 5EEHA 5JNUA 4M8SA 5JJCA 1JPVA 5ALQA 1AHHA 5F9NA 5CA0A 2ZUEA 3BMCA 3ZWAA 4OATA 4K03A 4PPFA 2WHPA 3QVLA 3BDIA 4UUAA 2ZPAA 4FMBB 2BM1A 2OMEA 2Q28A 4EI8A 5E7JA 5JTIA 1GZ5A 4MWGA 3A1SA 1U8CB 3RAFC 1NUUA 1PE0A 4TS9A 4NK5A 2QS9A 1JPNA 3FOWA 5EYPB 4WADA 1R5BA 5DH9A 3WK6A 4KFUA 3AQEA 1PR6A 3UMMA 1R3UA 3AK4A 3MERA 4IIJB 4R3NA 2VJLA 3MVEA 4UHBA 4E6EA 4XQ0A 2JBAA 4H18A 3M5PA 4RK1A 4GQAA 4Q4AB 2EARA 4B4UA 4ZFNA 5HQ3A 4YJFB 2RONA 4KX5A 5B6JA 3JQ7B 4GLOA 1TEHA 3PCRB 3D8HA 3JZFA 3NM5A 4XJSA 3MS2A 5EWMB 2XQJA 3ZDZB 5JD3A 4BEWA 3LU1A 1MFZA 1EP9A 4LKOA 4DSAA 5IXJA 3BL5A 1OLOA 1XS9D 2HNBA 3VHQA 2CXOA 3EFBA 3JSXA 5A0LA 5J1SB 5DEIA 5HKKD 3NWEA 2VHJA 4KODA 1YTUA 1H2XA 4FFWA 4QGBA 3KCQA 3A0RB 1Z19A 2AQ8A 2F67A 3I2GA 3IYLW 4DCOA 2UYHA 4KHPB 3MWLA 2Y1IA 5HMLA 4RH3A 3FDXA 3DF7A 2PFSA 2W6JA 4CR7A 2P40A 1UMCB 3USZA 1RCTE 4DMGA 1RS0A 3A9TA 4GOJA 4KVGA 4A0FA 4UB1A 2ZJ6A 2RB5A 3QVSA 4R54A 1GARA 2WSLA 3GMTA 4PGGA 3M7IA 4TLCA 1VIYA 2I1QA 3WK8A 3L4BC 3ZKWB 5J0XA 1SVKA 2GM5A 2WA2A 3CPSA 5EMJA 4RIEA 4K6OA 3Q8KA 2XEXA 4N39A 2Z08A 1NU6A 2ABWA 4JYPA 2VWQA 3G0CA 4BX3A 4DREA 1Q0ZA 1Z2OX 2JRCA 3GXBA 1JPJA 4WZBB 3E1SA 1CEXA 2Z83A 3ANNA 3HKEB 5E9QA 2A6PA 5AW7A 4OP2A 3JYPA 2QGNA 3DEAA 4L15A 2IPMA 5FUBA 4IBOA 4E51A 2KKVA 3DEIA 4N12A 2W6CX 3JARB 4CFZA 3CW8X 1U3WA 2AXTU 1V85A 1YR1A 2WSIA 1N4AA 3BWMA 1P9NA 1NK6A 1SFRA 3LYAA 3BN3A 4U0KA 2VDWB 1EPUA 1U45A 4AM8A 1Y88A 4EYKA 2HHWA 1I3LA 3C8HA 4CMAA 4EABA 3V7JA 4US1R 4G0PA 3RJ5A 2A7QA 1UKCA 3VHLB 2G5IB 1FRFS 3ZDDA 3TQCA 4EFMA 4EPRA 1A4RA 3A1EA 1PWXA 2VDUE 5L1KA 4GEKA 3WA7A 3K96A 3N8DA 3KT8A 1TK5A 4URXR 1YU6A 4ZVNA 5BMOA 4OQEA 2OKGA 5LZ2A 5DN9A 1KU0A 5DYIA 4RLFA 2IGBA 2Q6TA 1E0DA 5AHOA 1GG2A 4ZKDA 2E55A 4DHWA 3C1ZA 3JQAD 4RZQA 2GMWA 3WXMA 5JAOA 2IV2X 2F3UA 4BTVA 4CG0A 1XCMA 2NP7A 1PJZA 2D2FA 3ITNA 4K1LA 1JI0A 3PHCA 1HYQA 3CFYA 1TU0A 3AT1A 3F1KA 3B20A 5CYOA 5HA5A 1Z6XA 2HDWA 1W0JA 2VRNA 4YJGB 1K98A 4MDEA 3IDFA 3W5AA 2AJBA 1SXDA 2PUHA 1D4AA 4WK2B 2J7PA 3F7TA 3Q3IA 5JHGB 4P34A 5IIOA 3DUWA 2FSHA 4JJGA 4XB1A 4UUPA 1JB9A 4F4KA 9ICUA 4NHEA 3TNJA 1SC3A 1LQUA 3ZCQA 1KKUA 4JXKA 4O08A 4U00A 3BS4A 1Z5NA 5FL7D 4CM3A 2A88A 1Y6FA 3THOA 4MW6A 4EGSA 4FWTA 4BFUA 2A58A 3SQOA 2BBWA 2VSXA 2K89A 4KUGA 2A9OA 2PL5A 3IBFA 3JVEA 4MLZA 4GPTA 5LMUB 2FSPA 4BGVA 2CLCX 1BDBA 1T6XA 3QW2A 3Q8QB 1BQEA 4BL5A 3KQVA 3MJSA 4RVSA 2GJAA 3TXYA 2C95A 2IYYA 2JC3A 2VUUA 4QJFB 1AOXA 1R4ZA 1JSCA 2AR0A 2Y2UA 3IPAA 3IXMA 4K5QA 2GYVA 2E18A 3BEDA 4OO1J 4IXMA 3DO5A 1E1YA 3VSEA 2JFYA 1OLSB 4DOBA 4Z6EA 5LJLA 2CJPA 3BQTA 5A6VA 3ETEA 5GONF 3GNTA 4ZVMA 4XWOA 1P9LA 4HOYA 2IXEA 2WI8A 1DAGA 4YD1A 1O9BA 4NU6A 3AOEC 1LBQA 3EXG1 4KXXA 4ASUA 4LOJA 3MMZA 3VPBA 3L0IB 2IEIA 4RKWA 1YO6A 1KMMA 4Z0NA 1QYWA 5IDXA 1U2ZA 2W03A 4F12A 1KPGA 1DIOB 2HHHB 1N8NA 3L05A 1VIAA 3SC3A 4N47A 3M9NB 2CE2X 4HNVA 3HXOA 3JCZA 5B12A 1IY2A 2V6BA 4OH7A 8ICSA 4CIBA 4TMZA 5TPWB 2QL9A 2P3LA 5JYEA 5DSXA 5CD1A 3LBAA 2QTWB 4B6FA 4DLRA 2YICA 4NVRA 3KJHA 2R751 4N5MA 4K6KA 4B3HA 1BPXA 4TSFA 4E46A 2LW7A 4L4XA 1AUQA 1M1UA 3CLTC 1CRPA 1COKA 2R6CA 4IHQA 5A7HA 2K4PA 4QXQA 2CHVA 4X3CA 1QVWA 4GLXA 1NUAA 3ZOKA 5FLYA 3DONA 2ROQA 1M3SA 4D3YA 8ICQA 2W7OA 1Y5RA 2PMKA 5GONA 2XY4A 4Z9AA 1MP0A 1H42A 4JLWA 4QLAA 3Q4GA 4XASA 2RI0A 3RVRA 1RACA 1EXDA 5FJIA 4G4SP 1CE8B 1KY2A 2GARA 1V3TA 2CV2A 4DLBA 2VNIA 1PO7A 1F44A 2ZUBA 3KXPA 3H65A 1AKYA 1N2ZA 1R66A 4YJKA 4ZOLB 3U40A 2XCTB 5HWSA 1QH1B 2BPOA 3TADA 2WWFA 2YRWA 4R16A 1Q0RA 1P74A 5DNDA 4C43A 4HQOA 4IKPA 3EF3A 2NLOA 5EKXA 2W2LA 5JYCA 3GT3A 2ZUFA 3N2ZB 1L5KA 3RBEA 5CNKA 3GELA 3DLHA 3E3OA 4TS1A 4GLFA 4YPOA 4QUHA 1NG1A 4QJ5A 2BRUC 4JWNA 2J9ZB 2JH3A 2RGRA 3DEKA 2GVDC 2A7XA 2O2DA 3NZEA 5H3HA 3ZTTA 1FNMA 5CDFA 3U44A 2JD1A 3K35A 1LPNA 4PICA 4UQGA 4EZBA 1M8PA 1JG1A 2FDRA 2V5UA 1KTVA 4AMUA 2LDBA 1BEUB 4W7SA 5AJXA 4K2AA 5TT1A 5CIQA 1UBTS 1ZQCA 3IG8A 4PTZA 4LC1A 1KYIA 3AFOA 1MQSA 8MHTA 4KTVE 1NIJA 2A1TS 3SI7A 3DEYX 2CHUA 2NRTA 2OV1A 5AHXA 3EPHA 3T5PA 1CRWG 2OFPA 4NBUA 1E6WA 3HPRA 3LL4A 3A4IA 1PKXA 5K3OA 1Z28A 4F5RA 4RJIA 3P2EA 4V1CB 3R3ZA 3DWGA 2LHTA 3HHPA 3O9ZA 2EZ4A 4CUZA 2P9HA 4FLMA 3JD1A 5A0FA 5LWHA 3JYLA 4B2LA 1B0UA 3GVHA 3NC4A 2BFCB 4LGYA 2Z1DA 3B3GA 1QP8A 2C2YA 4P2GA 1EXWA 2JRLA 2CXYA 1AY0A 5H8WA 5JXIA 2PRIA 2QA5A 5F35A 2C00A 1G8JA 5KNCA 3AVWA 3FPGA 2YV2A 1ECCA 3JD3A 2ZWOA 2HOIA 2A0YA 3M9WA 4P4NA 3LDUA 4YAFA 5TEWA 3HWX1 3UJHA 3K32A 1BW9B 2I3ZA 2CXRA 2ISQA 1XQ1A 4CQNA 4YLGA 5C35A 2Q5JA 2A1TR 2QJWA 3RTDA 2ID8A 4XCVA 2FPMA 4IXDA 2DBYA 4V0QA 4RMNA 5FPPA 1TJPB 5DPMA 2QX4A 2FN3A 1YXMA 3I32A 2O8CB 5FORA 2ECOA 1L5WA 5BQOA 2PEZA 3VR6D 4PYIA 2XOXA 2PZEA 1UJ6A 5DQIA 1Z5UA 2QF7A 1UFVA 4IYJA 1XAHA 3TCNA 3V6KA 4WY5A 4MRPA 1A6SA 1G2OA 4OGFA 5KQGA 5ERGB 5LQAA 2VN8A 4D44A 5H2FU 4MDHA 3LIIA 5BPHA 1YFZA 2EG5A 1TIPA 1ZNQO 2ACKA 5J2IA 1LTKA 4IDEA 1RI2A 3RUEA 3IQWA 4NF2A 3WMFA 4CTJA 2PUVA 2H7XA 5EG5A 4LGMA 1S7CA 3TNLA 4WBNA 2ZANA 1L4MA 2KFZA 1XJ0A 1M8GA 3DOEA 1M2VA 4LYGA 1Q44A 5AM3A 4ZARA 3W3AD 1A2KC 2VYFA 3U5TA 4O2BA 4UBBA 3A9RA 1UBOS 2L18A 4YRDA 3W6PA 1UXJA 3HK2A 1Y3FE 3OZCA 2Z7JA 4C2BA 1KKLA 1Q7EA 2DP4E 4TMXA 4D57A 3JATB 2YHIB 3K7EA 4G0ZA 4R0VA 3W8RA 4B5LA 2I5PO 1O03A 2Y1JA 2QMHA 3ONDA 3KNZA 1U0SY 3EPPA 3KYJB 2C2XA 5KNDA 2WUVA 1C9EA 4IQGA 5THXA 1SBQA 4M46A 5EIBC 1D9FA 1IEWA 1ORDA 4DYDA 1VJ0A 3PGVA 2IDMA 5AHKA 2M1XA 5DGTA 1EA5A 2FF7A 1KI6A 5DB4A 3G8AA 2I7TA 4ATNA 5AI5A 2B3DA 2NU7A 3WYBA 1DARA 3AEUA 4G85A 3ZQUA 5G0VA 3JAMA 1G7SA 4IP0A 5T3UA 1HM5A 4IL6U 2C3UA 3R5XA 1QWOA 2ETVA 2NMVA 3CUUA 1JG6A 2UYYA 3C5EA 1K5HA 5EZYF 5FHQA 2YVUA 2I9KA 3KHUA 3AI7A 4QGGA 1ZJYA 4MH0R 3UOGA 1MB3A 1CF4A 4CL8A 5I7WA 1RI5A 1IBLB 1QRAA 2EEZA 2VEDA 2DFVA 4I4TB 4M9SA 1Y4ZA 3FPHA 3OIYA 1Z7WA 3WBKA 3V1LA 2Z6QA 5KYWA 5ULLA 4E2ZA 5G5HA 4TVSA 1ZI8A 2XI4A 1E2QA 1U1FA 1XA4A 2HTFA 4ROSA 2XF2A 1R64A 3COVA 3QX8A 1PNTA 2QUHA 2HSDA 1F0YA 5EJ8A 1NJ6A 2OGZA 4C21A 1Q3VA 3N0WA 1D9DA 5KSWB 3BE8A 1GVHA 4BOYA 2JHFA 3CX4A 2QWXA 3IN5A 5A5FA 4MLDA 1RLJA 3DFZA 3MTAA 3CCFA 4Z7NB 1XG5A 3V5NA 4O4JB 1MHPA 3G88A 4WV3A 3PS9A 9ICNA 2RGCA 4WBSA 2QR5A 3SV3A 2WJ6A 3H2BA 3T5TA 4DARA 1XZFA 3A1NA 2FZWA 1SCJA 5C2JB 4PIVA 5JU5A 4IZIA 2IHYA 5EZYA 3WIUA 3RAXA 1UFOA 1G8MA 3M82A 1X7YB 1XJQA 2K2QB 2RJNA 3QU2A 3EUB2 2VF5X 1VBKA 4Y2YA 2PO5A 1BX1A 5EA2A 1NQXA 3ZXSA 4YDQA 5DK4A 3A2NA 2HHSA 3DGEC 3FHOA 5FWNA 4BFTA 3I73A 4K2HA 1QHFA 1I7LA 2P67A 4FZMA 4EO4A 1MF7A 3JU3A 3NIFB 2P91A 1EXNA 3P9RA 2B9VA 1J2MA 3HFRA 4Q47A 3IVGA 1T7PA 1BO6A 2N42A 1EVKA 1HFWA 1HX7A 1T9DA 4MHOA 3EAFA 4RL6A 1AU9A 4F96A 5DASA 2XEDA 4KLIA 2CJXA 3OY7A 2OESA 3W77A 4DOCA 1U4BA 5FWXB 4WKGA 4HDRA 4MUJA 4MWOA 2BWJA 1SB9A 3R3UA 5IT5A 4URHA 3KKLA 3KEGA 4M9LA 2I2XB 1WMAA 1N5WA 1H1TA 2B98A 4FFDA 1CY2A 3V2GA 3ED5A 3FUTA 5CH5A 1RQ7A 4NNPA 3DQQA 1T3LA 5E2BA 1LGYA 4E5PA 2R6JA 1A2OA 2NO7A 5BWOA 1BDIA 3CZ9A 1K6JA 1N7JA 4JB3A 2NSHA 3V9AA 1OH5A 5KAFU 2K5UA 3D6UA 1I2CA 4MDYA 2RHJA 3VAZA 1SCUB 1PK9A 3LDAA 2J4CA 1BPYA 3F1LA 4AMBA 3E5HA 3KX2A 2J59A 1C0EA 1ML3A 2ZVJA 3DVQX 3AI2A 4GVXA 3ZVKA 3OFND 1MVOA 2V8OA 3PJGA 4L2IA 1R50A 3FTDA 1LKYA 3HXKA 4IIDA 1RJGA 1J49A 1QQ6A 2EKQA 4X97A 3CVUA 4EW2A 4PQRA 1UDAA 1XRJA 3H2JA 1OGJA 1TUGA 3EDQA 1BS1A 1ZK3A 1O96B 2EP8A 3BS5B 4BKOA 3ZD9A 1APBA 3B89A 4D9KA 3BGWA 2J6HA 3EWNA 2PWBA 1W29A 4FP9A 2OHVA 4DJFC 2FF5A 1CUKA 4K9PA 3RSOA 1GPMA 2X4LA 3GROA 2J9XB 2IH4A 5A9SA 3FZYA 4WWHA 3TZBA 2QRNA 4C88A 4ARCA 1T13A 1GAWA 2VYVA 1NR1A 1I0IA 1SVUA 4MW2A 4AL4A 4U4AA 2OEPA 5H83A 3MCUA 3GOHA 4KH1A 3TZLA 3ABOB 2G1KA 1M2GA 3HSYA 2BZSA 1ESZA 3V2HA 4QYMA 3BE5A 3STWA 4QASA 3SF8A 1GR1A 4LZJA 1TQ8A 4CM8B 4CTOA 4XQGA 3WFJA 3IURA 2ZB4A 3H0MB 4BVBA 2YQ4A 1ZQIA 5JS7A 4CM5A 4GOKA 2P30A 1M1ZA 4W5OA 6ADHA 4AROA 4OSEA 1K7SN 1VLMA 4OQMA 3EX7C 1IIBA 3BL8A 4O59O 3U16A 1IQPA 3EXHC 2A92A 3VPAA 3C16C 3G23A 5D3MB 1XTJA 2P5TB 2ZYHA 2IIBA 4B4WA 4JMUA 1PVVA 1CUFA 1C3EA 3HXQA 1OW5A 1T8YA 1U3GA 3RKUA 5M34A 2KJQA 4KQ9A 3SSAA 2VTKA 2Q0SA 2VCEA 2CLOB 4MUGA 4OXRA 1XCGB 4YK7A 4AY3A 3AR9A 3KZNA 3KBBA 4L74A 4EMTA 3V34A 3ZS8A 4EK9A 4Y9DA 3F9CA 1ZD3A 1SUEA 3C87A 4KXLA 1EXMA 3CRVA 2P0YA 3EEBA 4DG5A 1GP2A 1LDMA 3IPLA 3DBLB 3HDYA 3WLRA 4CETA 2Z5VA 1T5OA 3NXKA 3LYSA 5LZ7A 3C3WA 2QARB 4KLOA 1N1EA 3L1VA 2GPJA 1XCBA 1FDVA 3SSMA 4O3NA 2O19A 4D3XA 2V7PA 3P96A 5G3YA 5CUQA 4BV2A 3VNSA 4JL6A 1OW3B 3ETCA 4NYJR 3C29A 3HABA 1CVRA 4Q15A 1S5PA 3FUWA 3G0BA 4A0QA 5IW8A 3HE3A 13PKA 4RC9A 5CXQA 2AVDA 1Z22A 2GHRA 3RR8A 1ZMTA 2GLEA 4W7IA 3HCFA 1NN0A 5KOHA 1RKBA 4LYFA 4HGYA 2BHTA 4B48A 1C4KA 1NJGA 4ZHSA 4NS4A 5E7MA 3TDKA 2VP5A 4DMRA 3T9EA 3SJZA 1BYIA 2ZRLA 2PH7A 4RSMA 1RC1A 3O1HB 4Y7CA 1N9ZA 4NNJA 4LDNA 2WAOA 3O3NB 4Q9LA 3NHFA 1YDWA 3GP5A 3IQIX 3QX9A 2VF7A 4ALNA 4H27A 2D5AA 2ESRA 3P2OA 1NBME 3F46A 4ME6A 3P9XA 5KTMA 3BJEA 1KKMA 2BFFB 5BXQC 3MEQA 5K2OA 5CJ2A 4HCJA 2PGDA 3EBOA 5BN3B 1OWOA 1MC5A 4AMZA 2R0QC 4BASA 1T3ZA 1YWGO 1C3OB 1OA1A 2E3JA 4WUTA 3EEOA 5EE3A 3W4JA 3H9CA 2GN2A 2WSBA 4B32A 2HYIC 3ABIA 1BYUA 3K71B 3ZK7A 1XZGA 4DA0A 4N7JA 5E4YA 3I6ZA 3ZWDA 4WK4B 3UMJA 3IPCA 4OP1A 4WJKB 5IABA 4LRQA 2QZSA 4E4YA 1Y6QA 4FEAA 3S29A 4DZTA 2ZB7A 3CB2A 5LB4A 1GRQA 3VU9B 1PDVA 3RO7A 3F4BA 2VJMA 3QWBA 4EVSA 1NR7A 4KR2A 4US9A 5BPCA 5FBHA 1L5SA 4ALLA 1NNI1 2Y8EA 3DF9A 1RYSA 1U0BB 4P08A 4FFMA 3WB9A 2D0IA 1YQQA 4X1KB 1I30A 3OKAA 2QMUA 1LTQA 4IIEA 2NUBA 3RUIA 4N03A 3T5JA 2WG2A 2FW9A 5FLXA 3N9IA 2BDEA 2NZJA 3AIMA 1PBTA 1NRXA 4AIIA 1WWVA 2IYXA 2WB1C 4PZ0A 3RRMA 1UPCA 1E9VA 2ZBEA 3OOYA 4GKBA 4C76A 3QXGA 2CW5A 1H8HD 3H1FA 1X38A 1GPUA 3BAZA 3VH1A 1XWLA 4F2SA 2IPAB 1N6RA 3KUCA 4PHDA 4HLQB 3HKZF 5KQSA 3A3YA 4JXZA 4E2XA 5DEOA 5D87A 1YRLA 2Y05A 2P9EA 4Y1FA 4QFMA 4QO7A 3SMVA 1FXSA 1RLTA 2HREA 1KYYA 3LIPA 5MFZA 4JOCA 2RQ5A 3QE3A 2PX0A 3KHKA 3WJ1A 3RK4A 1N6PA 1XRSB 4M9UA 4EIWA 1AC5A 5A1TA 3DYBA 4GC5A 3G6YA 3DLCA 1E3IA 2NRXA 4BBZA 4H0NA 4Q44A 1CZKA 1KN5A 3RSFA 4IEIA 4N9WA 3DULA 3I1JA 2X77A 1DJQA 3PT5A 5HR7A 5EJMA 2IBKA 4WA8A 1DC3A 4Y9RA 1WIWA 2QL6A 3IUMA 2NRZA 1SVOA 3EXIA 2E49A 3OE7D 4QHSA 3R5KA 4CDRA 3C4QA 2JEIA 2YS7A 1EK2A 2E5LB 1SXJD 3PQ4A 1UPFA 1IUNA 2CDRA 4RMHA 4IIVA 1V2GA 4ZEOA 1U7HA 3GNLA 5B2EA 1W96A 2IOYA 2GH1A 1NVTA 1UODA 3OCJA 4GP7A 4JLNA 1RQNA 1ETUA 4J94A 4D9MA 3L7LA 5LQJA 1RLUA 1F0MA 4HYTA 4P33A 4R51A 4XM0A 1NOMA 4IDCA 4LZWA 4LXYA 2QTZA 5AW4A 3W8EA 1EFRD 5EI5A 1DWOA 4X8MA 3IX7A 1GL3A 4X20B 2NPIA 4EW6A 3BCHA 5LMNB 4D4GA 1AT1A 2ZROA 4EG6A 2CVFA 4PZYA 3FKSA 3H8WA 2P6RA 4Z9XA 4Z54A 5K3FA 3X1YA 4FCTA 1AURA 1KMIY 4JC8A 1OXJA 5JJIA 4BQSA 3CN9A 2JASA 4OFXA 3F5MA 4KMRA 3OIUA 2W22A 2HCBA 5AXAA 2E3TA 3E5NA 4D9GA 5ICGA 3GT7A 2AGVA 1VJDA 1P0QA 5LQSA 4QUEA 2FQ1A 3ESBA 1AZLA 2DB3A 3EOZA 1SCQA 2C3PA 3UKDA 4KNWA 2XH8A 5KNBD 4IQ0A 2Q3EA 3GZNB 2VR1A 3O4HA 2C2ZA 5BSUA 1CV2A 1UFQA 2UYCA 4NBNA 4R5MA 2DHEA 1BJTA 2MRLA 1V41E 3HW8A 5B1EA 2BZFA 2I5HA 4YXMA 2IHUA 4G86A 1AQ6A 3TVYA 2SBTA 2NO5A 2ZRDA 3PKJA 1M8KA 1II8B 2UVRA 2Q7OE 2RHFA 4F2DA 2BMJA 1RBZA 1OXBB 1Z5OA 3MINA 3S2EA 3LUJA 2Z2XA 3KAPA 4TQRA 2P5YA 3BC1A 3DWFA 2AMLA 4Q9DA 4XVCA 1CY6A 5LLTA 4FB5A 4RPIA 3OF3A 3GYBA 4LMAA 3C1OA 1RRCA 5M7EA 4N49A 1BFUA 3FLMA 1ZUNA 3ZD7A 1Z6YA 2QUKA 2AN3A 4DCCA 2OHXA 1E1CA 3AYZB 3H1TA 1KMNA 3T1VA 4R05A 4EEXA 4UC0A 3VC3A 1QO0D 1Q7BA 3FA2A 4PGHA 2P69A 5ELLA 3F7OA 1CQJB 4JV1A 4XKJA 1AQNA 4HWPA 5GJCA 2G3YA 4JQCA 1DJMA 2BTEA 2VDNB 4NRDA 1QZ3A 5CFZA 5CDGA 3RTEA 4JLAA 2OUIA 3IELA 1ZOSA 3F98A 2C4HA 3QKSB 4K0RA 1S2GA 4LJ5A 4O02B 1NX9A 2CHGA 1YUBA 1YI1A 2G9UA 3WLQA 2PT5A 1POXA 1EI9A 1F9EA 2Z09A 4FHDA 2QUZA 5E4TA 1GGHA 2OCPA 3GF4A 2WYHA 3H17A 3ZV6A 3CNBA 1KAEA 4RHFA 3TUIC 4IMIB 5KFDA 3GPIA 3PIDA 2WKSA 4BNUA 1E9AA 2JA1A 4OQXA 4G2NA 1KORA 2VRCA 5G4KB 2HZ7A 5FB3A 1JV2B 1HOXA 2DQZA 4Q5IA 3RJJA 3B7PA 1TD1A 3EVAA 2Y4OA 4BNVA 5ILQA 4UFOA 1BOOA 1U3TA 2Z30A 4FMCB 3GFRA 2VWGA 3O8CA 3R5JA 4PZNA 4BRUA 1KJWA 3DNPA 4OJMX 4RESA 3UA3A 4DEYA 4F38A 5DB9A 5KNCH 1UM8A 1GFWA 4GF5A 2VPZA 2GCOA 3OEYA 4WVFA 1QVVA 3BTSA 3KHHA 1YR9A 3BZCA 4IFBA 1ND5A 5J2UB 1YSCA 1THTA 2V9CA 3AUUA 1JEQA 3D0QA 4EQ6B 1X7GA 2Q5FA 3P19A 3F2CA 1G42A 4LRXA 2FWRA 3G2HA 1EUCA 3HN2A 1VJ5A 2H4ZA 1G2IA 5E9JA 2CLIB 1C1XB 3NT4A 1TMGE 2XXJA 4YRAA 3T79A 4DR3B 4ENUA 2R8OA 3TTSA 1PWZA 3C3XA 3CX6A 5BNWA 2HC9A 1XT6A 3AVXA 2X5NA 4WKCA 4DMMA 1YRAA 3SZLA 4V1CI 3IQXA 5MGBA 3IQEA 1CR2A 2WFZA 1JT2A 1WW3A 3B1VA 4YV7A 4IJMA 3ISTA 3WV5A 3A6GA 5KYGA 4RQNA 4NOKA 5DX1A 2G70A 2GEJA 1E3WB 5KS2A 1RQ2A 1SU4A 3X43A 1CY1A 1V11A 1QAOA 1XZ8A 3TOZA 4U3JA 2MR5A 4NE7A 2DKXA 5BQFA 1I94B 4MFCA 3GU3A 1U2TA 2R85A 3INTA 4GWGA 1O3YA 1DIAA 4HHEA 5FLEX 1AA6A 4JWTA 3E03A 5KWIA 3RRGA 3IT0A 1CQZA 5LB2A 4I5GA 3CY6A 3CURA 3DLBA 3EIUA 3CNHA 2WHYA 4ARAA 1S2IA 3LVQE 3Q8LA 1V3QE 4CVNA 1SQFA 3WWPA 3NIDB 3HEAA 3SENA 4X6YA 1ZVMA 3CVVA 8ICPA 3TZHA 3OZFA 3U0VA 1Z5GA 3B1JA 4NPHA 4F6CA 1NP3A 1WBDA 3Q11A 1V1MA 2A5DA 4TN1A 1I6MA 4TYNA 4BV8A 4JS0A 5AHWA 3TEJA 5KNDH 2FP3A 4JSYA 3MRSA 2QSYA 2WIFA 1WX1A 3NEYA 3QRWA 2YIDA 4Q48A 1A5TA 3CLRC 1OZHA 1PTKA 2PX3A 3UW1A 4E1BA 1MKYA 2O4CA 1N36B 2TRSB 2GR9A 3SS8A 1AKRA 4BNDA 3B1XA 3FUVA 3ZWBA 1NMEA 2SKCA 4QOHA 3Q7EA 4JLPA 1VSVA 1HMPA 3IUNA 1TVKA 2XWBF 3T1NA 1SCNE 3QKUA 4H77A 1SRRA 4YR2A 3NHWA 3K9NA 1OBVA 3AVPA 1IAQA 1CNFA 1MNAA 4IZ6A 1QR6A 4PIPA 1P73A 2O8NA 5CHGA 3S1AA 1U7WA 1M66A 5KFEA 5B7NA 4P0PB 4BVFA 1TC1A 5CP8A 1ZQZA 4MLCA 1KHHA 1NR5A 3KELA 5FR2A 4MV3A 4XDHA 1PT5A 2WQ7A 4YJ3B 4AS1A 2ISCA 1ZN2A 2QN8A 3U6KA 4IJWA 2C22A 5L9AA 3AW8A 5EMKA 3N0XA 4H17A 1COWD 4WCDA 5CB4B 1IZ9A 4E0DA 1XJCA 3DMHA 2DKZA 1CNEA 1RYFA 5GMOA 2J6SA 1U65A 2F4NA 5FPSA 4HF7A 2OFXA 1IPEA 1YB6A 1JSXA 3VKWA 1N2SA 3BF8A 4HPWA 4XLTA 3H5TA 1ZPDA 2PBLA 3W5JA 1I1OA 3GHHA 1XWWA 5JADA 1AHNA 4NZNA 3HU1A 3NBMA 1UEIA 2E48A 1JHZA 3OT1A 4XEUA 1C7JA 4ZPXA 3D5TA 3G6VA 2FUNB 1C30A 4KCGA 2RHHA 4AN1A 3WWDA 2QPLA 2PRJA 2ZBRA 2J5KA 3FY4A 2AOVA 1X86B 2V6JA 2W2NA 5EHQA 2AK2A 4FO6A 4QZ8A 1GFSA 5ALGA 1KQFA 3FJYA 4B3IA 1N48A 1EFPA 4INAA 5B1IA 4HH3C 3EEIA 2JK0A 3RB3A 1PI3A 1UXOA 2RRDA 4FBLA 3EE6A 3IEIA 1KJJA 2XTAA 1YZNA 5CW2A 3TOCA 3PNKA 4Z7QB 4MEXA 2HWYA 4DILA 3DZBA 3JQQA 4PG8A 3LHKA 2E8OA 4I1SA 3VR2D 1J6UA 1ZRSA 2HFKA 1UFRA 2IHNA 4GNKA 2JIZD 4GX0A 1LNZA 1YE5A 4OQYA 4PN7A 2RC5A 2VP9A 4GNRA 1K88A 4FMDB 1EHCA 4MWZA 2GCIA 1DKQA 2GJSA 4IDGA 1PYDA 5IF9A 1JWAB 5BSTA 1N56A 1E62A 3SYKA 5JJLA 4YPVA 1ONOA 2IYOA 5EFZA 4I50A 1IRIA 1GCIA 5JUWA 2D0PB 1KTIA 1RPZA 3ZQ4A 1GQOA 3WFZA 2QN3A 4GE3A 2FQXA 3LCVB 1MFPA 4YP7A 5I4IA 4M1SA 4B3XA 4EZIA 1AM4D 1TF2A 5L53A 5DHAA 4YRIA 1DIRA 4DNFA 4AKIA 5EVJA 3QEOA 2FSUA 3KE9A 1TK3A 2H2AA 2I3DA 1P60A 4NKRA 1RI3A 5EGSA 3MUEA 1X40A 5SY6A 1GU0A 3ADCA 5JDCC 4HEA1 4X84A 3GR6A 1KAOA 2Z8YA 2IPLA 5JPCA 1NF9A 4AJ1A 3NKLA 5A4KA 3ADOA 1Z63A 4LY0A 3IIIA 2V98A 5AI8A 4AU1A 1O87A 1YFLA 1BNOA 1AQUA 3F8SA 1JLLA 1E5QA 1IM2A 4LUCA 3ZV3A 4BO4A 3W2FA 4BC1A 4J0DA 4ZQGA 5E6UA 4PZUA 3VRHA 2HCFA 2A0KA 5FUWA 2Z6AA 1G5TA 2C58A 3H75A 3DPSA 3PX3A 1FLAA 4MV9A 4NDZA 3NBUA 2NVWA 5E6RA 5LA6B 3X1JA 3QUBA 1S0OA 3PPVA 4O4LB 1Q14A 3MGIA 1ECGA 4IXTA 3B0XA 3C3MA 1EE1A 2EAMA 5EKTA 1YOVA 2DJIA 1I2MA 1BMQA 2R8EA 1VZ3A 5JANA 3IIEA 3MR3A 4Z0PA 4GBGA 1D7OA 2BJHA 5DI9A 1QTMA 1QX3A 4JY7A 4V0ME 3U4QB 2PK3A 1U0OC 1JROA 3K0HA 1BE6A 2C2WA 2I78A 4A2PA 2QRQA 1EINA 1A9ZA 2QQGA 1Z29A 1RAFA 4G4JA 1UM9B 5B58T 4TTQA 4KZKA 3GDGA 2FXIA 3ZH9B 2VOJA 3V3KA 4AYWA 2CKDA 4X90A 2NQ2C 2VG8A 2C5HA 3BSSA 4DJDC 2HBKA 4WFIA 2QTFA 4EY3A 2HSWA 1T36B 1CZLA 1O5IA 2IP1A 2HBZA 5H0IA 4OKSA 4YDSA 2P2ZA 5AM4A 1WUYA 3IBSA 3DBRA 4OYHA 2PD6A 2BCRA 4JJFA 2UVUA 1FS6A 4EYOA 1CUSA 1T9AA 4B8YA 1QG6A 1NKCA 4LVUA 4OVKA 5CT4A 3K73O 3TFSA 1N8SA 1FVFA 2UUBB 3I23A 5M29A 3D4LA 4DL2A 1AO3A 4RFVA 4C7YA 2QLTA 1DBIA 3JAKB 1IB0A 1FQJA 2VA9A 2KHVA 1TU4A 3IIJA 4BP1A 4G0WA 1T2VA 5EVCA 4AJJA 4UVHA 3EH1A 5ICSA 1EBBA 3RJZA 2ZSAA 1Q57A 2I4OA 1L6NA 3IHTA 2M6KA 4S1VA 3COZA 1Y9AA 1DL5A 5U9CA 3CEMA 1RD4A 3BH7A 1D6SA 1QAQA 3KQSA 3ZE0B 1V6CA 1Z13A 3PSTA 1NBAA 2QX8A 4WNAB 3R7NA 4CMIA 1I7PA 1PJBA 3GLGA 4MUAA 4MHVA 2I9PA 1UT6A 3S99A 1I7QB 3TE6A 2A5LA 4M9NA 3LT0A 2QZPA 2FMTA 4AMYA 1AB5A 1GTZA 1JZTA 4IVRA 3AHIA 1CYDA 2J3JA 3DC2A 3T41A 5AICA 1W8IA 1QUFA 5KFTA 2VPTA 2ODAA 3LE8A 1G66A 2VUTA 3R76A 1VKZA 3WL3A 3HKZC 1XLTC 4GI1A 3A6ZA 2V45A 4F71A 1R4AA 5DYNA 5CB6A 4Q4JA 3CRNA 5EHZA 3TECE 3EXHA 3OTWA 2CHQA 2I2CA 3NYQA 4OHUA 1OJ7A 2H3QA 3RBDA 2Y6VA 1U9ZA 3SJUA 4ZCRA 3VNRA 1SH7A 3M49A 4Q4LA 1RZUA 3SK0A 3HBLA 1MX3A 2CY0A 1NDHA 3GEIA 2WICA 3SXUA 4DSJA 2CVPA 4OLJA 4AUNA 3ZHCA 4B6SA 5A05A 4HNGA 1NQAO 3PEVA 2ZVPX 4M4SA 3H83A 2CFRA 1LVHA 5IAGA 1EWYA 4DQUA 3CN7A 2XGQA 2CDBA 1HRKA 3U6BA 1NFQA 3EXEA 3UQ2A 5AM2A 4PBSA 1YKSA 4MAMA 2B7BA 3JVIA 2YWRA 4I46A 5KYYA 4EYHB 3DM5A 1NC3A 1NXSA 4D92A 4EA7A 4G1VA 3W5SA 3RAPR 4YRZA 3NJ4A 3FWZA 2QTHA 1JECA 2R60A 2RCYA 3ORHA 4EGCB 1XL0A 5HIAA 3HDJA 3K0CC 3MWYW 4MB0A 4M88A 5BWCA 3BPSA 2JRZA 1MOPA 2V7XA 2HM7A 2ZUCA 5K8LA 3NHSA 1JVNA 2H0QA 1QDEA 5BOSA 1B1AA 4F86A 3ZI7A 5AO9A 4D4LA 2G40A 4ZVSA 4HJXA 4GPBA 5C46F 4TTIA 3BICA 3KPVA 3GZ4A 4ETIA 5CAEA 4EAQA 5CEEA 2AZMA 2FAXA 1DCMA 4HFMA 3TAHA 4I2AA 1B0XA 4OF4A 4LNUB 1T5LA 3WDSA 1EWVA 1J97A 1E5VA 1KMHB 4X3PA 1LBEA 4QQKA 1DWPA 2WB1F 2NUTB 3HCRA 1HC7A 4O0MA 1WSWA 3V6LA 2BHNA 3JQGA 4MS3A 4OLHA 4WJLA 3LFHA 1E1QA 4FZRA 5IUNC 2Y0BA 3BRWA 3T7TA 1O5TA 1TO1E 5THQA 2EX1A 3UJ8A 1RPTA 3K70B 3LW7A 2GJ4A 1V6AA 3IHQB 1XHLA 4KE8A 4D9BA 2XDQA 3THYA 2QTRA 2D4AA 3KV1A 3HPOA 4YFKA 2MWMA 4RFSB 4G5FA 1KOJA 3HP6A 3VYWA 1SIWA 3I53A 3PDJA 4BLQA 1HORA 1FQKA 1C3JA 3RVJA 4O5CA 4KP7A 3I3SR 2ZJAA 1XSNA 2FEWB 1UWLA 1T34A 4EPWA 2QB1A 5J2GA 4XUEA 2NZ8A 3JRXA 2BCUA 3PJRA 3HR8A 3V33A 1GGVA 1Y9JA 2BFBA 2XUKA 2C2BA 4S04A 4K9KA 1FO4A 4QYIB 1GA6A 3C98A 2EOAA 1U3UA 2CYBA 4MVYA 2WTFA 4QT0A 1NWHA 3OT5A 1AIPA 4DA8A 4MYCA 3N0TA 5AUNB 4RV5A 4PLGA 3TGWA 3WAJA 2I0FA 2W6OA 2O2JA 2PI4A 3UGQA 5LL6P 2I4NA 3TTYA 1XEWX 2C7BA 1G6KA 3PSHA 1L8QA 2Y1WA 3T5BA 2GBIA 4MV7A 1QE0A 1RHKA 3MJHA 1FFDA 4TTRA 5MDHA 4PX9A 4DBVO 4M8LA 3HU2A 4DWVA 4WXRA 1XEXA 4PSDA 1HYHA 4ZRMA 4QZVA 1LLCA 5KT6A 1DFIA 3T7AA 3WS7A 5I47A 4H1UA 2XYVA 4C4XA 4DIFA 2QORA 1L5HA 1DQPA 4BO5A 3EOBI 1SOWA 4C3UA 1FU7A 3P9SA 2H5IA 2V7BA 3HL4A 3VKVA 2B4QA 1QRSA 1AHPA 1PNVA 2O0KA 3MTBA 4K9NA 3WA6A 1P1CA 2YZKA 1WABA 7ICOA 4ED7A 3MB5A 3QG5A 4BECA 2Y76A 3I2JA 1W9MA 1TYBE 1QZXA 1V35A 3EK2A 1DOAA 2J33A 2X2EA 2C9MA 1Z8DA 5F33A 2X14A 4JUZA 2FEKA 1BH6A 1RAGA 1E8DA 1Q17A 1H85A 3GZFA 1EWKA 2BLLA 1J07A 2AEEA 3OG9A 1N3YA 1PK8A 1QYCA 4ARZA 3L5KA 5DK6A 2RDJA 4XM1A 3TBKA 3OJSA 3R9XB 2NSDA 4P8RA 1C2TA 3LKVA 4KIUA 2NTVA 3F5SA 3G5TA 4RTQA 3BMNB 1ISJA 2FHPA 1KQGA 4BLUA 3F7NA 2PJUA 2R6AA 1NVDA 3HV2A 3L7YA 1WAMA 2F9MA 4REQA 4GVLA 4JJZA 4J9QA 1U7PA 5K2MA 3SI8A 2JR5A 4CM6A 2EJUA 2ZJ8A 4ARIA 4JQYA 2QV7A 4G3XA 1G1AA 2W6NA 2DFNA 3FWNA 1A5ZA 2ZSHA 4RQMA 4PFSA 1MT3A 1IWPB 2LE0A 1SB8A 4BRWA 2O8BB 3Q8WA 5DE3A 2PUCA 2PD3A 2F3PA 3C48A 3VR3D 3O2QB 5DGHA 4CM9D 5EJIA 4H3SA 4B44A 2FWPA 5CCDA 1HTBA 4XVHA 2P77A