2WF6A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and aluminium tetrafluoride
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf6A01
4PNHA 1L8LA 1N9KA 1RC8A 4UASA 2FI1A 2I6XA 3OTQA 1O08A 4UU0A 2IOFK 2P27A 2FPSA 3WGUA 1RKVA 2HF2A 3RF6A 2PKEA 4EEKA 2B1RA 4Y2UA 2R8ZA 5AVTA 4EENA 1K1EA 3UMCA 4Y2JA 2R8XA 4Y2YA 3U7HB 1Q92A 4QQFA 2CFTA 3HLTA 4EX6A 3QLEA 1U2TA 2WF7A 3WKDA 3L0YA 3QU9A 3ZTWA 1TJ3A 5ALLA 3ZX4A 1QYIA 4UM7A 4NV0A 5AIBA 4OHFA 2CFRA 4HGRA 2YMLA 3NANA 2G06A 4YCMA 4Y2TA 3KC2A 3QXGA 1L7MA 2YY6A 3OPXA 3ZUPA 5AW2A 3ESRA 2FUCA 3U19A 2AUTA 3WK7A 2G09A 2WFAA 2RBKA 3B9RA 4HYTA 4L6CA 1TJ5A 1ZRNA 1SU4A 3ESQA 5ALDA 4Y2XA 5ALMA 1RLOA 2JAOA 4OFZA 3RFUA 3DNPA 2OBBA 2CFSA 1XVIA 5ALKA 1RQNA 5AI0A 2JARA 1J97A 3ZTYA 5AK5A 4L6AA 3PGVA 5AW4A 2IOHA 5FP0A 2YBDA 2W11A 2DQSA 4XQ0A 1MH9A 4H1WA 5AVZA 5AM4A 3WKCA 4BKMA 3OCYA 2P11A 4YH1A 4DW8A 3NALA 5AVYA 1VJ5A 3KOOA 1Z4MA 3L8FA 3SHQA 2HEGA 1VFPA 4Y2PA 4O8CA 3U26A 4G63A 1YMQA 2C88A 3DDHA 3QGMA 3F9RA 1YS9A 4CE6A 1Z88A 3ZU6A 5ALRA 1NF2A 1RRCA 1RKUA 4UARA 5AKGA 2AH5A 4NAVA 2B82A 2W43A 4RESA 3WK5A 1J8DA 2MU2A 1SWVA 2NO5A 4FE3A 1Z4KA 2IA5A 2ZBGA 4L57A 5AK4A 4HGNA 5AI4A 4HAIA 3AR8A 4QJBA 2FPUA 3A3YA 3EF0A 4MWOA 1S8OA 2WF5A 2O9JA 4Y2SA 5AVSA 1N8NA 1IWOA 5ALPA 2IYEA 2YJ5A 4BNDA 1CQZA 2YMMA 3QUCA 4OD0A 5ALVA 1QQ6A 5ALUA 4C4TA 2IOFA 5E0OA 5AW3A 1Q91A 1KYTA 2P69A 3N5KA 3FVVA 5AICA 5AKEA 3CNHA 2G0AA 3AR9A 4XOUA 5AKXA 2GHQA 4KX5A 3VAYA 3AR5A 3ZX5A 5T41A 1VJRA 3ED5A 2X4DA 1ZS9A 3FZQA 5AM1A 3W5CA 3PGLA 2G80A 2FPRA 5AI8A 3W5AA 3A1EA 3UM9A 2RB5A 4Y2QA 3E84A 3ZVLA 2B8EA 5AKZA 5AIAA 4YIKA 1Z5UA 2WF8A 1L6RA 3N07A 3WK9A 3E8MA 3M1YA 2EATA 3ET4A 4UU1A 3W5BA 2O2XA 2ZBDA 2ZBFA 5AKYA 5ALYA 2EARA 2HX1A 1T5TA 4MUMA 3QUTA 3ZVMA 1O03A 2WHEA 3NAMA 2C9MA 5AKLA 2C4NA 5IT4A 4NFLA 4CF4A 3WK4A 4J03A 3ET5A 5ALEA 3L0BA 3MMZA 2NYVA 5AESA 1YV9A 5AKIA 3WKAA 4BX0A 5ALOA 3L8GA 3SLRA 2OYCA 2GFHA 5AM0A 3OCXA 1RMTA 2C8LA 3A1CA 1WPGA 4FYPA 1JUDA 2B30A 4IG4A 4UMVA 1Z4IA 3U7EB 1RLMA 5ALHA 3SF0A 5JJBA 3PDWA 4Y2VA 3FPSA 4BEVA 1Z4PX 1ZOLA 2GHTA 3L1VA 5AI6A 3OCWA 4BEWA 1T9ZA 4Y3UA 1LVHA 5AKKA 2GMWA 2I55A 3OCZA 4KYTA 3QU4A 5ALQA 3WK8A 3B8EA 1F5SA 3SD7A 2JGAA 4UAVA 4I9GA 3I28A 3I76A 2FUEA 5ALTA 2AMYA 4XPZA 4AS2A 1ZD2P 3EF1A 2EAUA 2OM6A 3K1ZA 3N1UA 2R8EA 3L8EA 4GXTA 2CN1A 3D6JA 1L8OA 1QQ7A 2VKQA 3UMBA 3SMVA 1TE2A 3I6BA 5AVRA 5AM2A 3BWVA 5AKJA 2I54A 4DWOA 3FPBA 1RMYA 2HHLA 2Q4TA 5AVQA 5ALIA 4KNVA 4AS3A 2W4MA 1U2SA 3R09A 1RQLA 4UMDA 1AQ6A 3AR7A 2RARA 4B6JA 4G9BA 1U7PA 1WVIA 2YJ4A 4IFTA 3AR2A 3AR3A 3N28A 4YCLA 3IRUA 2BY4A 3OCUA 4HGQA 4BBJA 2WM8A 1U7OA 2FPXA 3WK6A 2Q5EA 3SKYA 2R8YA 2JAUA 1YDFA 5AI5A 2FPWA 1Z4QA 4HGOA 1L7OA 2HI0A 3DAOA 5AK6A 5AHXA 4UMFA 1WR8A 4OCZA 5AW7A 1RLTA 1ZJJA 3KDPA 3KBBA 4BX3A 4DCCA 2P9JA 5AW0A 3NASA 1XP5A 2B0CA 3WKEA 3M9LA 4F72A 4Y2RA 3MC1A 2G07A 3FM9A 1Z4OA 1T5SA 5AVUA 4C4RA 3EWIA 4BX2A 3FGOA 1ZD3A 1L7NA 5AI9A 3SKXA 3QUBA 3PCTA 3IB6A 4UW9A 4JDPA 5AW9A 1NRWA 2YJ3A 5A3SA 4AP9A 2YMPA 4CF5A 2RAVA 1QH9A 5ALXA 4DFDA 2ZG6A 4EX7A 2YFYA 4NWIA 4FFDA 5AW5A 3WKBA 2B8JA 1LTQA 3NUQA 4KN8A 4HGPA 4I9FA 1Z4NA 2YMQA 4NABA 5AK3A 3R9KA 4GIBA 3KD3A 1ZRMA 4ZEVA 2WF6A 2QLTA 3KZXA 5ALSA 2YN4A 5ALWA 2YJ6A 2WF9A 3QU2A 1SWWA 5AW1A 4ZEXA 3WGVA 1Z4JA 2HOQA 3ZWKA 3MN1A 3QYPA 3ZI4A 3L7YA 1RPZA 3NIWA 5IS2A 5ALNA 2PQ0A 5AM5A 2ZXEA 2I34A 1NNLA 1TA0A 2MSNA 1ZD4A 2B1QA 3ONNA 1CR6A 1YJ5A 5AM3A 3B9BA 3NRJA 1FEZA 3ZWDA 3QU7A 4F71A 2C8KA 5AVXA 3W5DA 2ZOSA 3E81A 5AKHA 2FDRA 2HCFA 2AGVA 3IJ5A 1RKQA 2ZBEA 3OCVA 5A3QA 2NO4A 1PW5A 4UM5A 5ALGA 4KX3A 1U02A 3A1DA 3AR6A 4KNWA 4YIHA 3U7FB 3ZVNA 2I7DA 1YNSA 4J2TA 3CZ4A 2I33A 1Y8AA 2HSZA 4CNQA 3QNMA 4CF3A 1Z5GA 3U13A 2HF7A 3L8HA 5IT0A 1EK2A 4UAUA 3L0CA 3QU5A 4EZEA 2JAWA 2Q4RA 4JB3A 4UMEA 1XPJA 1QQ5A 4YCNA 1L7PA 2D2VA 2QYHA 3ZW7A 1X42A 2G08A 2ODAA 3MPOA 4YGYA 1EK1A 4E88A 5ALFA 3N8GA 3HYCA 2GO7A 3DV9A 1Z4LA 3GYGA 3QX7A 3UMGA 2MU1A 3L1UA 3BA6A 3I1YA 1RMQA 3QUQA 5AVVA 5ALJA 2OA0A 1S2OA 2HDOA 2HO4A 1ZD5A 5AW6A 3U7GA 3R4CA 3TLMA 5AVWA 5ALZA 4RETA 5AW8A 4XE5A 4UATA 2G1AA 3AR4A 4EELA 5A3RA 3P96A 2FEAA 4BYGA 2BDUA 3EPRA 2PR7A 4ZEWA 1TJ4A 4C4SA 2BDEA 3E58A 1WZCA 4BNDB 1RDFA 3J7TA 3L5KA 3S6JA
chains in the Genus database with same CATH superfamily
3L7JA 3ER8A 4YV1A 7ICJA 3C16C 3IALA 3VVBA 1VL2A 4UJ3A 1H1TA 5KNBA 1MVNA 1W30A 2RH8A 2ZT5A 4W8OA 5IKMA 5FBLB 3JASB 3RTGA 3OTQA 4AJIA 2R5WA 1O08A 2QPAA 3ZHYA 2QMQA 3OJCA 1EP3B 1OXTA 3QA9A 3ICQB 2W2KA 2JVJA 2GDZA 1YBVA 3EMKA 2XEDA 5IM5A 3WHIA 2DHQA 2HW3A 1VIMA 3P2MA 4C7YA 4IFEA 3BQ2A 4U7GA 3UWPA 3ZCQA 5IMBA 3VPCA 1DC5A 2PL9A 4NDNE 4OKSA 3GJ5A 8AT1A 1UKZA 2UYOA 2YHIB 2GO1A 4QW9A 4RC9A 3CYFA 4DJJA 4AQYB 3NHBA 1S02A 1NJ1A 3GC6A 3AFGA 3OUTA 3P8ZA 4JVSB 4Q5IA 2X8WA 4RE6A 5CVVA 4YMGA 5LXTB 4JEIA 2H1HA 3EW7A 3OWOA 4MVJG 2J0SA 2XY7A 3TACB 4P4UA 4Y2JA 2OC4A 2V3VA 2F3NA 1OUQA 4JXJA 4KXVA 4RANA 4JB0A 6REQB 1DTWA 4JVOA 5JTTA 2V6JA 3ESDA 5DVZA 1T3TA 2NVUA 5CJ2A 2E8OA 4DQQA 1CQJA 1ZI6A 4TYQA 4JI1B 5B7NA 4RMJA 3ZTWA 1TTPB 4CKCB 1AZLA 3HB0A 3JD2A 1IRXA 2ZTCA 2RFLA 4LSMA 3BL5A 2CRXA 2C03A 3CNNA 1L5GB 3ENQA 3AF0A 3HYTA 2XMCA 3BMNB 3GNLA 2B61A 3K71B 1TYAE 2W93A 4QELA 1K9VF 1NR5A 4Y2TA 4BXOA 1IQUA 1AG9A 2O5RA 3FNEA 2YY6A 2Q0QA 2Q3DA 4LHSA 3U6KA 2TS1A 1YC5A 5DXJA 3DR5A 3HJTA 5G1PA 2Z2IA 3W3AD 1P0QA 3IMFA 4PRZA 2ZWPA 1VPVA 4RGBA 1KVRA 2JIBA 1ZAKA 4IRUB 5DTRA 4RS4A 3MEQA 1PSDA 3NX4A 3UWOA 1YFLA 3LDFA 4R01A 4J94A 4KPUA 1KN5A 1D9XA 1PK9A 1XZPA 2VHUA 2WE7A 1FFCA 2EIXA 4KAFA 3O21A 4KUHA 2FUKA 5ENZA 4LWZA 1IPEA 1AJEA 3RS2A 1NZDA 1U65A 5DF1A 4BS9A 2XB9A 2QLJA 5F35A 4O5CA 4Q3KA 4UNNA 4ZU1X 3NHMA 1GD1O 1TUEA 4RPZA 4A9AA 4DCTA 5LVAA 4L6AA 3PGVA 4EKNB 1HF3A 2CXTA 2DHDA 4YA6A 4O3RA 3KVNA 1CJVC 4HWSA 1BPYA 4GYYA 4II2A 5CGQB 1LV5A 3OCYA 3RS4A 1TK5A 2DHRA 4IDOA 1NUPA 2WSBA 3NALA 2CF5A 2HREA 3GJ7A 1ZUNB 2AQKA 1YC2A 3OJXA 3KOOA 3ANMA 3PDCA 3QP9A 4LDRA 4QJ4A 3SLGA 4LAFA 2PFNA 2C77A 3FKJA 5F9FA 2ZWAA 3BHMA 2J9RA 3RTDA 3T5KA 2WICA 2C88A 4CMKA 3TG8A 4PSVA 4QJIA 4KO1S 5IULC 5GM2A 3TDNA 4FCTA 1DX9A 2FKNA 4IWYA 5KWVA 2WUWE 4E32A 4LJRA 3D5TA 1E64A 1RRCA 4M87A 4NFHA 1U0OC 1T8PA 3GCXA 2AH5A 4H1VA 4MCHA 5DM4A 2FEPA 3ZDRA 5HKKD 3PZPA 3OM9A 1BSVA 1J8DA 1CRQA 4I55F 3EPJA 2FJUA 3MB8A 4GOKA 1Z4KA 1GSOA 5J2KA 4RQ2A 1LPSA 2Q8PA 4FYKA 4LRUA 4EITA 1N0WA 2OV1A 3V72A 4G1VA 4MCIA 4DF8A 3LDAA 2VBGA 5DTIA 1QZZA 1ZIYA 3NYWA 3NVZA 3AQ4A 1TFUA 2OBXA 3QNUA 4FYXA 1T2CA 4N40A 5JNUA 3TZKA 3AEQB 1IWOA 1MJ5A 3F1KA 1JIIA 2MSCB 2X76A 3I52A 1U3TA 2B36A 3QG5A 4H9GA 1E96A 2Z4SA 4S1TA 5CLQA 5E3IA 3W2GA 3KJNA 5BNWA 1JIKA 1W85A 3QUCA 2ZCVA 3RAGA 2A14A 2FVXA 3A6FA 1QQ6A 5ALUA 2J3LA 2HJHA 2YBEA 3HWSA 2RD2A 3FNGA 4C7OA 1X2BA 1QGUB 3NM4A 2I1QA 2J5KA 1Q91A 3DBIA 3SIXA 4YJ2A 1QTQA 2Z43A 1DGSA 1SIWA 2X9QA 4FB4A 5EIEA 3JQ8B 4ETMA 4EYOA 3IPLA 4MCAA 3DT8A 1SA0B 5A62A 5FORA 3ZKWB 3ZX5A 2NTNA 5GZ3A 2ZSIA 2V7EA 2ZJAA 4B9LA 2JAHA 2NUAB 2QP4A 4TN5A 3OT1A 4DADA 4EF6A 1D1TA 1YUMA 1MJNA 2C5EA 2REQA 3KOZA 1ZGCA 4C4XA 5B36A 1RHKA 3RFCA 4CMEA 3CSDA 2BEKA 4KLGA 2V4MA 4YC7A 1DAEA 1EGHA 1SPXA 1YQDA 4M1YA 1NW8A 1YZ3A 2CMGA 4DUGA 3CV3A 1BYIA 1O6BA 4FINA 1C1XB 3EVCA 3I5XA 2P3QA 1TM4E 1UQRA 5GZ1A 1AZTA 2O2XA 3HVRA 3RRMA 1Q1ZA 5LA6B 3TM5A 2OYYA 1G291 3PQ4A 3LUPA 2CZCA 3I2KA 5IJ9B 1VL8A 1LD3A 1KTIA 5EZYA 5BNIA 5C1DA 1R50A 2B9EA 3DZDA 3P9CA 2PBLA 4MSUA 1GQQA 4F5EA 3MMZA 5IK2D 5AHRA 4EFKA 3O3CA 2J4DA 4B09A 3QJYA 4KAXA 1X8JA 2Z2JA 2H3FA 1L5KA 1OU0A 5BW8A 3AFHA 1LNZA 2B8TA 3VC2A 1T13A 1Q1AA 1XSNA 3DGEC 4C3VA 4A8PA 2XYQA 1IBCA 2XWSA 1XQVA 4KXWA 2KLHA 5CG1A 2DERA 5KFQA 2RHCA 1WW2A 3JVVA 1KAHA 3GAZA 3KQWA 3WNQA 3DOEA 3T7TA 5KFHA 1GPBA 3TB6A 3RSQA 1H3EA 1PV2A 2VJQA 2DPHA 3DZJA 2QMOA 3PNKA 1Q0TA 4HWTA 5KS2A 1PR4A 3U4GA 4G23A 2ANCA 3KUDA 4Y9RA 3TTYA 5ICGA 5JADA 3U7EB 3E9QA 2FY8A 4NESA 2DHEA 3MLEA 4Q1EA 1SL1A 3FGPA 4YRPA 1XDZA 4DSUA 4D4IA 1WW8A 2DG2A 1F0YA 3CJTA 3VOTA 4I2NA 2VJPA 3DDUA 3T5LA 1PQYA 4EPTA 3QEJA 3PITA 1EXMA 2P9HA 2BE7A 2XF8A 3G6WA 4HAUA 4PONA 4YRMA 1KZ4A 4R8UA 3GIKA 1C7FA 1A69A 4E31A 1M54A 3WLLA 1UPCA 3FBTA 5B12A 3NTRA 2GMWA 4JJEA 1XSEA 5FT9A 3S28A 5AHKA 2QVCA 4P54A 4LOJA 4EECA 1EFTA 4Z4QA 4B3JA 4P84A 4GLFA 3LX8A 4MV1A 5JTUA 3WLQA 3KE8A 2H08A 3R7WA 2PFOA 4DBLC 1Q0RA 1Z2CA 1BS9A 2D3WA 2RAFA 3UBMA 3CONA 1BXGA 3L6EA 3L4BC 3HGTA 3BQ0A 1M2JA 1N5KA 1YR2A 1T4DA 1WG8A 3KKOA 4IX9A 4AS2A 4R31A 4AAYA 2VQEB 5A9TA 1R74A 3CLHA 3NJ8A 3OM0A 4E5UA 3U7RA 2IHTA 1QQ7A 2XCRB 2CYCA 1R7RA 8ICPA 4JHLA 1GSIA 1RJDA 1TF2A 4IC9A 3F53A 1HEUA 1U0SY 1SG0A 1DIHA 1LBIA 3NWOA 4S24A 3BWMA 1IBLB 3F0TA 4MRRA 5FCDA 5FUQA 4PGXA 1PGNA 2JFGA 5JXHA 4DA9A 2F9MA 8ICAA 1BKYA 1KDTA 4HLUC 4LBZA 4M60A 5TF4A 1D4OA 4KNVA 4HXYA 2JGEA 2VHTA 3IVXA 2JAPA 4Z2YA 3NZEA 1CUCA 3R09A 4DYVA 3KSRA 5KHOC 2H11A 4MW6A 4Y0AA 2KG5A 1GHTA 1AXEA 2RGDA 4KG7A 4B3DA 3UTCA 2RARA 4MWEA 2YJ4A 4Z9AA 2W4QA 4FOLA 4B0PA 2ZSAA 1RC0A 3ZQ4A 4F84A 5BP7A 2IDZA 2Z56A 2GD1O 4XB6B 3V8QA 1O5TA 2FPXA 3DWIA 3ON5A 4W1RA 3CUEF 1QORA 1MEEA 3TRDA 4MWTA 4GKAA 1GTL1 1USGA 3LLSA 1Y7HA 4LDNA 4ZK2A 2EBWA 1YJQA 5EEGA 3SQOA 5GMOA 2Q7OE 3EXFB 1C7ZA 3H2IA 1Z4QA 3IOEA 3LHFA 3RIEA 4BMDA 1YA6A 3F7OA 3UHFA 3GQVA 1SOAA 2LKYA 3K53A 1I80A 4WASA 1UKAA 1JI0A 1RLTA 3G5MA 3H8VA 1E1LA 4XGQA 4XIYA 1YOVB 1RWXA 2XUQA 4BB5A 2B25A 3LHIA 1R9NA 4PX3A 3ZNNA 2H2AA 3K2EA 1I5EA 3I2GA 3CUUA 4IEEA 1ZQEA 5F78A 5K1ZA 1W5TA 1MQ8B 2XTZA 1OFTA 3ZH2A 3W5VA 3BHIA 3TLEA 3RUEA 3IEPA 5K8UA 3OQ6A 3PQCA 1AZWA 4NR0A 1TCCA 4Y67A 4WNCA 5K0LA 1V39A 3WIOA 4MMZB 3SSMA 3LTNC 3IODA 4C4RA 1NW7A 3SQXA 1Q1NA 3GY0A 2E4WA 3VC3A 4QTUB 4XZ3A 1ZD3A 1XDGA 3A4NA 3KR1A 3OUUA 4O5OA 1L3IA 1NAHA 2IRWA 4CM6A 2IYFA 3FOEC 4XA5A 3TE6A 5A4IS 4Q4HA 3RSZA 5E1BA 5EUQB 1ISFA 4RFSB 1ZOOA 1AH2A 4N01A 5CVCA 3C3MA 3OG9A 2WTEA 1DL5A 1W47A 4K03A 1ARZA 1IMJA 2VJCA 3RWMB 2H1OA 1Z2PX 2DFPA 1EGQA 5EG5A 2ZPUA 2YFYA 1AK1A 1A9XB 1NASA 3VR6D 4NENB 4X60A 2AKEA 4ZDWA 3C2LA 1SQ0A 1JKXA 1HDGO 5HR5A 5JALA 1PWZA 2BFNA 3I9KA 2ODWA 2C59A 4NABA 4EHFA 2AJ8A 4ESHA 2CLHB 1P6UA 2B1JA 2DPYA 5CLLA 3N9IA 2PS1A 2WDZA 1AUPA 1PJQA 4ZIRA 3WXMA 1SV0C 4GIBA 3Q8XB 1N62A 1P4GA 4IXTA 4R81A 4EYSA 3A4VA 5IVDA 3TAUA 5FADA 4BLVA 4CM7A 4HFRA 3RI3A 2PO5A 3OWHA 4U7PB 4ARZB 4RTMA 1JR3D 4OIFA 4QDXA 4DR6B 1HDEA 5H02A 5JU6A 4PR0A 3BT7A 2O8CB 3PB3A 2A4KA 4DDKA 2PM8A 1RYYA 9ATCA 5YASA 1D2EA 2ORIA 3KSZO 4EY8A 1EX7A 3K6SB 5KYXB 3EIFA 2XB8A 4P38A 3MJFA 2Q3HA 3PXDA 2W2NA 1GITA 1ID8A 4NL4H 3D3KA 3W3ZB 2ZXEA 2PLFA 4L27A 5FOWA 1PJTA 1UXHA 3D2AA 5I4KA 4IO0A 4QATA 1QFSA 2NO7A 3RIXA 1YFZA 2EAPA 2GEBA 2O14A 4FGSA 1M2VA 3K0HA 2CYBA 2X15A 3COZA 1RHMA 5ICMA 4FW8A 3VI4B 2E55A 1VG9B 1KMMA 2QN1A 3CUWA 4PLPA 3RS0A 4TKZA 2PSSA 2YRXA 4ZH4A 5HHIA 1R0LA 1G7TA 3GZTB 3PBKA 4BQRA 3ZZ0A 4PXSA 3TX6A 3Q8KA 2FOIA 1Z8DA 2QE7D 3NRJA 4GP9A 3TFRA 4JOSA 1DHRA 3JQBA 4KB5A 4CKZA 1C3OA 2Q4EA 2Q49A 3R7DA 3ZDYB 3ZWDA 4CMBA 2IE8A 2PX4A 4PLZA 1CUXA 3K1JA 1XMQB 4IRDA 2VHXA 1IWBB 1VPEA 2OXIA 4R2IA 2FSIA 2WIKA 2ZT8A 4BQOA 1OASA 2DPXA 5KI6A 2EBHX 2ZI4A 3EK2A 4LV6A 4WLOA 1E9FA 5FL3A 4MFAA 4R83A 4TX1A 4DYHA 1Y8QA 3GV7B 2AGVA 1DEHA 1XD2B 2EW8A 2RAPA 4MUGA 1YFJA 3O4GA 2GEVA 2CUZA 1IQ0A 2ZIZA 4TMFA 2GLXA 1A76A 1E3WA 1TCUA 1PW5A 2EZ8A 4TRRA 3UC5A 4AWXA 3C39A 5A04A 1P61B 2IYUA 4FC7A 5EE9A 3EZ6A 1K5DA 2PWBA 2ID7A 3T3GA 4WCFA 1U2DC 2F4VB 3TX2A 4ECVA 1EX6A 3I5MA 3P71T 4AJOA 3FSJX 4MPRA 4W82A 3PFBA 2PMDA 4C4YA 4RTKA 5B3LA 1GG5A 4ITRC 3TKYA 1Q0UA 3O95A 4FN5A 1DAIA 5LU9A 1RRMA 3QEMA 4G1EB 4BE7B 1VJ0A 1Y3DE 4UB2A 4DWOA 5KTYA 4N8EA 4IJUA 1RYBA 2QM0A 1KJQA 3HFSA 1X7YB 3FAKA 2KB0A 3Q7RA 5KG3A 1MV8A 2BR4A 1VJGA 2ZRHA 4G26A 3WLAA 1CY0A 4B33A 3ADOA 4FM9A 1C8LA 2HHQA 1JA1A 2WTXA 3QXCA 3O84A 2G08A 4G3IA 4XEHA 5TJ9A 4PIVA 4BC1A 3ZLJA 1GR1A 2XUKA 4GOJA 3Q12A 5KSWB 3GLHA 3V4SA 4X71A 2C07A 3MR5A 2BKVA 4CEIB 1NBOA 4QPNA 2XNDA 3IBSA 3ZV5A 3MQ4A 3WHKA 1IONA 5C4MA 1DC8A 3D6HA 5FUMA 2H2FA 2KJQA 4ZYWA 1OWNA 3I04M 4ARCA 4YX9A 3GV5B 2YDYA 4N03A 4RHYA 1FFBA 4ZWNA 1AM4D 1TDJA 2P65A 3IIJA 4F8JA 2D13A 3KB1A 4DCVA 3QX7A 3L1UA 2KJ9A 4GM1A 3SX0A 3EUWA 3PC8C 4H0FA 3T5AA 2M6SA 1Y6GA 4F8RA 1RM5A 5EZQA 4C80A 4IF6A 4BLOA 4RHEA 1SKSA 1RQ2A 1XCBA 3UYKA 4YR2A 4ZAWA 4OYRA 3IAUA 5EQDA 1PL7A 3K09C 3EE6A 5KTOA 4CPDA 1GXSA 2O3UA 3N75A 2QQGA 2UVVA 3Q87B 4LGYA 3DFKA 1XLWA 1VI2A 1SVKA 4PC6A 2FXIA 4EJ0A 1NX6A 2IYZA 3RQIA 3G5AA 1X6VA 4KPYA 3EXG1 1HZZC 4EELA 3I39X 1RPNA 2VPPA 1LS6A 1YZGA 4TRNA 2QQ0A 2BDUA 1HDZA 2JHAA 4FQ8A 4ZARA 2F3TA 5JDCC 4TQSA 2EZUA 4ZEWA 3ISCA 3AT1A 3JAKB 3N76A 4KWTA 2XMQA 1KOFA 4Y98A 3GLQA 5EIOA 5I8PA 2HC9A 2NZ2A 5KX5B 2ET6A 3I4FA 2KIVA 4QYIB 4G0QA 5H4HA 3TOCA 4UHJA 5JYEA 2YYAA 2QJTA 3L82B 4PNHA 3ZE7A 4YDQA 5DI3A 6LDHA 4YJDA 1UKCA 4ER6A 2ISSD 3F5SA 4DNXA 4HNVA 3M4ZA 2XCAA 4AMGA 5KFKA 4RIHA 2XQIA 4D8VA 5HTKA 5F98A 5L6MB 3ZXXA 3UJ3X 2YQEA 5ESXA 1XA0A 2AR0A 3IDQA 3MA0A 5EJGA 3UBTA 1NW9B 1JHQA 3TSZA 1TQ6A 2MAXA 2C9OA 3FNHA 3N74A 4KWIA 4LZAA 3FDIA 4WW0A 4TMTA 3KLMX 5HDBB 4ZT4A 3U7QB 4FOPA 5I8WA 5J0YA 1BX3A 1FZQA 4A2CA 4BZXA 1IL0A 3WGIA 2VF8A 4BDSA 4P80A 2CF6A 2F9LA 4X8HA 4MRSA 3K0CC 4BNWA 1ZEMA 1HR0B 4X6UA 3NBZC 4LY9A 4KYUA 1PWHA 4DT1B 2DGDA 2GM4A 1XWLA 2VZEA 3SC4A 4CT4B 1GSAA 4F0JA 4FB5A 3RRGA 1P2TA 5JHGB 1NNEA 5E1OA 1SVOA 2LIPA 4YUZA 4Q1DA 2UZIR 3HLTA 1E94E 4K9SA 4R1OA 4RSGA 3RU7A 4M8KA 4XIGS 4EKEA 1NONA 3S8EA 2CXNA 1F4VA 4BUJA 1TEZA 3R3WA 3I9LA 1JVSA 4TZKA 3CRXA 3F6RA 1DIAA 3ZOZA 3AKDA 1IM5A 3PUHA 3KZMA 1E2KA 3CLUC 3REQA 2K4MA 1FLDA 3ZXIA 2H8KA 1CEXA 1Y1LA 2Y4OA 2W37A 3GN2A 3LLUA 2VIIA 4EBCA 2RGWA 7ICGA 3JYLA 3RT1A 2Y1LA 4RA9B 3L7IA 3C3BA 3QE2A 2GJ4A 4KHZA 5D5HA 5JAUA 4FT2A 3PGJA 3K4HA 3DFIA 4HWRA 4S05A 4MQFA 4KFRA 4BKOA 1SU4A 4FD3A 1RLOA 2RHFA 4FEYA 4AG5A 1YQGA 1E1YA 4DR1B 4JYPA 3KETA 3GWZA 2C5HA 2ZVPX 4I4TF 1XP8A 2WTNA 3TOXA 4J9LA 1FXSA 2GN9A 1RP1A 3VPAA 3WBBA 4ALLA 3ZYCA 1TYBE 3OOJA 4LVOA 1CQJB 2YFHA 2J9FB 2I29A 3VC8A 3RFVA 3U61B 1CR2A 4DCSA 3BSWA 1EGMB 1NATA 1O96B 5AW4A 2UYHA 3B38A 1N75A 5F9LA 3VU8A 3Q0IA 5KNIA 1RHRA 4CT0A 4MYCA 4PO3X 1LEHA 1VJ5A 2F8MA 3H5VA 4E0BA 1FVOA 1ZZGA 1LW6E 1TEVA 5HUHA 2QP9X 1LVUA 2Y27A 5FNVB 3EXHB 1E99A 2JASA 3DAHA 2ZM6B 3MELA 3EAQA 4DREA 2JCXA 2EHDA 2Y93A 5CGZA 4ARBA 4EATA 2FP4B 4ACOA 5KFSA 4KWHA 9ICCA 4DYDA 5ESWA 1P3Y1 4R69A 5I4IA 2IPMA 4F2HA 4UARA 5D49A 5B4TA 2IGBA 3DB2A 3AF2A 3AOGA 3KSUA 3W06A 2QARA 4B45A 1QGDA 2FFQA 2J5QA 3ABRB 5F21A 5F7OA 5JSZA 3K0SA 2BT4A 4ND3A 4NSNA 4BO9A 4I50B 1PD0A 7REQB 4H7EA 1J1ZA 4IJ6A 1NYQA 5ITWA 5DG8A 4TRMA 3FC4A 1Y7PA 4HGNA 2GPWA 2FG7C 4ZQFA 1K3FA 1XDUA 1O97D 2NZWA 5CR0A 1ZCZA 2HA5A 4FGZA 4JI7B 1ILWA 1XEXA 1YJXA 2X0KA 3ASYA 3HV2A 4U3JB 4Y1GA 4ZQBA 4HO1X 2O8BA 3BM5A 4N39A 4U2DA 5E6UB 1MFZA 3DTVD 2IYEA 3FNFA 2P9ZA 4JIGA 1CQZA 1LV7A 2YWDA 3VX4A 1BRMA 2J9ZB 4CJXA 5KSOA 2PKRA 1IXSB 3AVUA 5EHXA 4OJYA 3FHTA 5KFTA 4PHEA 4M9RA 5C8YA 2QXTA 1ZH6A 3P2EA 3HB9A 1TC2A 3G49A 3NYIA 5J2CA 3FPCA 5LBUA 5B4VA 5CCXA 4FEEA 5JJKA 2P69A 2QRUA 1KPIA 1LQUA 1TRHA 3LMKA 4FLFA 5CH5A 3VXKA 5KOJB 3ORQA 1N7HA 1T15A 3B3AA 2R62A 3WAKA 5CBPA 2CHQA 3KQKA 3T5BA 4C2UA 1L5NA 1VGRA 3ED5A 4HAVA 5FULA 4JY7A 3HPRA 3RLIA 3U3MA 2FPRA 3WLJA 2ZYDA 4NHOA 3NFYA 3B1VA 2VWPA 1DFIA 3ES9A 1XEWY 4E2ZA 5JSFA 8ICQA 6CHYA 1N7IA 9ICFA 3ZVLA 3IM1A 1NXWA 5GPBA 4O4IA 3SIWA 3FLEA 3SY8A 2V58A 4BNJA 4BYMA 3BQ7A 2QV0A 3CW8X 4HX9A 1G2QA 1XVTA 3AEKB 4GZ6A 3NAZA 2WTUA 1IHPA 3QWBA 5AKYA 3HBAA 5A9RA 3E03A 4UTZA 2YJTD 4ZVUA 2WHEA 2F8LA 2BJWA 5CM2Z 8ICWA 1I6WA 5BN5A 3TTUA 2WSYB 2XA9A 3KKZA 1II9A 3OPMA 4C03A 1UDWA 2EFJA 3GGCA 4E4YA 3RKSA 1FO4A 4QLOA 4CN9A 4NG5A 3CO5A 4RD2A 2Q3EA 4DTCA 3ET5A 5ALEA 2HIAA 5IWCA 2ZTVA 3KQNA 1UC9A 2CBXA 1R64A 2VSOA 4OXIA 1A1VA 1Z16A 3BGIA 1B6TA 3GEBA 2MTBA 3PPXA 1Z0FA 3HCWA 4JVNA 3WG9A 4LJAA 4NFYA 5BW4A 4BGVA 3P9ZA 5C37A 3TF5A 3GDWA 4AI6A 4AUNA 2CD9A 4UUBA 1YJAA 3EUAA 4ZRNA 3ZGXA 5J4KA 3L18A 5J8YA 2R8HA 3NRBA 5WRFA 3T3NA 3OCXA 2JH1A 4GUAA 1TJNA 5K09A 3J80A 1PI3A 4IG9A 4BKRA 2R11A 2QN2A 3D8TA 2OO3A 4HUJA 2KI5A 1I1OA 5HRUA 1GUAA 1ACJA 1V9CA 5EMMA 1YZUA 1KAOA 2XE4A 4XDYA 5K6RA 2V6FA 2GJSA 3PDWA 5EESA 2EFGA 1P18A 1ZOLA 2JD0A 4P32A 4CFSA 5L51A 5GJCA 3P0EA 2PT7A 2W98A 4YUXA 3W0LB 1JJBA 1PIWA 4ZRDA 2O7NA 3TG2A 4TLCA 2VJKA 3HFRA 3NKFA 2KSOB 2BSAA 2OT3B 3NW9A 1PJZA 2FZGA 1U4SA 2FZWA 3CX7A 3UWKA 4KYTA 4HDSA 1FJXA 2HRBA 3WFIA 1Q1QA 4PYIA 2C54A 3N0RA 5AVOA 3S8YA 1GRCA 2OCLA 3A26A 1V5FA 5HR6A 4R8RA 1M34A 4B73A 4OJMX 4HDCA 1XPUA 1OAKA 2JH7A 2NXEA 3G9QA 3HB4X 1BMDA 5JYBA 4HXFB 4DV5B 4R8LA 3H7AA 3ZWAA 1AXRA 2XTNA 4M0LA 4TL7A 1ZNQO 5DBOA 3CH6A 1LJUA 4MLDA 5J2UB 4FSHA 2FW8A 1Z0ZA 2W6IA 2ZE8A 2MSLA 2W7PA 1QV6A 1J39A 2E7ZA 2OV2A 1TCAA 2ZAIA 1N48A 1EU1A 3F1LA 4ZOBA 1JAZA 4A6XA 1URJA 2W2KB 2R8EA 2WKWA 4WCDA 3UMJA 2IYTA 4GZMA 1RXWA 4NF2A 2BRUC 2VKQA 1GGFA 1G3RA 1N9GB 4O33A 4MK4A 1B7GO 5AVRA 1IM8A 4DWJA 2NT4A 4ATNA 4JKIA 2QUAA 4ZYZA 4D4HA 4DIDA 2ODTX 1ZH8A 1HGXA 2FR0A 2PL5A 1TK2A 3CLTC 4GDMA 4NEHB 4EKIA 2E1FA 4AS3A 1Z0SA 3BRCA 3UK0A 4JUFA 5HVNA 4UMDA 4KZKA 4O63O 4EO9A 1HFJA 8ICNA 1OLSB 1U8CB 3TUZC 4RQUA 4PZZA 1J33A 3I6ZA 3UXNA 2FQWA 1U47A 1LJLA 4MI3A 3U3JA 4CKEA 2AI2A 4YCLA 4O2RA 2WTMA 2XO7A 4D99A 3Q0EA 3AUJB 1NK7A 3R7WB 4V3CA 7ICUA 2N47A 5DGAA 4CKCA 3A1NA 1UP4A 1YBMA 2DU8A 4NE9A 2R8YA 3QPCA 1OA0A 3AVQA 3RIHA 1R6UA 1COWA 2X5KO 5AI5A 1FTYA 1WD7A 2GS9A 3DKKA 2YHUA 3LT0A 1JPUA 5TRTA 4CLOA 5I9IA 2CK3D 4FZNA 3LOPA 1E0KA 1X8KA 1ECLA 1ZU4A 3HADA 3LCVB 5AUOB 3RBEA 4KLFA 1Z7WA 3CB4A 2WFLA 1DAHA 1JEQB 1XQ1A 1BWRA 3O2JA 4JLUA 4K3UA 2JJYA 3PG5A 1DUSA 2AKAB 4X91A 2WIFA 3A9UA 1GDTA 2WB4A 5CT6A 3ZE0B 3CM0A 1QVVA 1X87A 2HA0A 3PRJA 1DMSA 2VEOA 5EWJB 4WBNF 1IU9A 5CX1A 4HN4B 1RSZA 1KAQA 1NW5A 3A9SA 4RIFA 4QWCA 1HNZB 3GARA 2UUPA 2W6MA 3VPDA 2B1GA 2PKWA 1JQJC 1ZW1A 2BFEB 2DPMA 2G72A 2ZSHA 4RCVA 4B4OA 2Q5QA 3SHOA 4R3NA 9ICUA 3R75A 1H4SA 2O2SA 1PTJA 1Z4OA 1OY1A 1X9HA 2FPIB 2CJFA 1NHGA 3CFYA 3G88A 3CUYA 1FJHA 2A57A 3MS7A 4JP5A 3FGOA 1V4BA 1KKUA 4Q4JA 1E66A 1RABA 2B69A 4RJIA 5TXGA 4Q37A 4D9NA 1KE2A 4IO1A 3PW5A 2HDWA 3MTBA 4HAXA 1TAHA 4OK3A 5CDSA 1NVDA 3IB6A 2BVNA 2OHJA 3QFHA 4HGYA 4PAGA 3JWJA 3LPNA 5K8LA 2FMHA 4B35A 4F1JA 3WC4A 2A0XA 3KEQA 2E9SA 2WJPA 1HE2A 2JH9A 1PVQA 2RAVA 2HADA 4M0PA 3GGPA 2JKZA 4OQNA 2RI6A 4ZTUB 3WWDA 2O52A 4I2VA 4NWIA 3HNOA 4FNGA 4JLSA 3BSSA 4EHAA 4WXMA 4KW7A 1O6CA 2OSVA 5FBZA 1P8AA 4E5VA 3NVDA 1JIUA 1UBGA 3H9BA 3INTA 5F5NA 3R0JA 4WFKA 5D1NA 4ZI2A 2PU5A 2XNKA 5AOVA 4BECA 1IZ9A 1JHAA 5I51A 2XXBA 2F55A 2IH2A 5CVDA 2MUTB 3F67A 3C8DA 2XKAA 3V6JA 3HU5A 5CB4A 3O4FA 3WQRA 2H2DA 1ZQHA 1C1XA 3DLCA 2YHSA 2I0FA 4YBZA 3RHZA 1WBDA 5FUBA 4KSCA 5G4LA 4GKVA 4I3HA 1Z06A 1E5XA 3FCYA 1GPH1 2C20A 4TQGA 4BNYA 1SBQA 3A1FA 4P3OA 3C7AA 5HKAA 3U56A 1KC3A 5IJ9A 4QWDA 4RTPA 4BX8A 2XY6A 2WKRA 4KR6A 3CX3A 5AJHA 3E6AA 4LF5B 1QRRA 2ZKIA 4D0SA 2P3SA 4M1MA 1X15A 3NVWA 1GCUA 3NNDA 1Q50A 3ZWVA 1NY5A 3LSYA 3ZBUA 1U2PA 2HOQA 4N5LA 4QUIA 2FW0A 4BVKA 4P83A 3IQEA 2ZJ6A 5KFFA 2UAGA 1H38A 2IXGA 2WYVA 4AKHA 2MYPA 4B0OA 4U0JA 5DLGA 2ZP1A 4BB9A 1ONPA 1TA0A 3URKA 2WAQF 2ZJYA 3AHFA 2ASJA 2PUCA 5HYVA 2VTBA 1N32B 3OP1A 2HDNB 1N9ZA 1JB1A 3EH1A 2C4HA 3LQYA 3OPVA 2NTVA 3DFUA 3FZYA 1BU8A 4Q7EA 3R7BA 4AICA 1T6XA 2YYYA 4P53A 2XECA 3KUCA 4Z4IA 1FSPA 2OQRA 1YT3A 3PP8A 4XRHA 4IIYA 4EG6A 3DVLA 4GMXA 2XE8A 4TKLA 4ZIRB 4PNPA 4LJXA 3PE4A 2QZPA 2R84A 3DL2A 4GMGA 4B79A 1A8PA 5CLJA 3ZCVA 3L6UA 1FTSA 2Y1DA 3PCRB 1LDMA 2DPIA 2SKDA 4Q4DA 3HU2A 2UVRA 3Q5EA 4KQ6A 4MYRA 4BL5A 1AUOA 5EWGA 4PO1A 3WLOA 5E38A 5K0NA 2VTVA 4GXNA 4C43A 2ZJ1A 1IOZA 3GMTA 1NK5A 2HCFA 1A82A 1SEVA 2DTEA 1U7XA 1U31A 3BXZA 4JR1A 4Z0HO 1WKVA 4B71A 2J0EA 4DSJA 3GRPA 3SYMA 1JKMA 2RGYA 2NO4A 1P9OA 2OB2A 2QX9A 4Q66C 2ZRPA 3TW8A 4OJOA 3U7FB 4KR3A 4M0EA 4RAQA 1VMIA 1E6WA 3G8CA 3JWHA 2LYAA 2PUAA 8ICHA 4RNMA 4IIJA 3RHFA 1RYEA 3HL4A 4QZHA 2CKMA 4UHKA 5FQNA 5A4KA 2JJMA 2Q5CA 1X2EA 4V24A 3WGQA 1I6LA 1FTQA 5TMBA 2VTDA 1D0SA 1NMXA 2HH9A 2II6A 2Y8EA 3EVEA 4KGZA 4IX1A 4R1PA 5ERGB 1QQ5A 2FAXA 5TVGA 4GBJA 4GP7A 4RELA 1XDDA 3MINB 4CQMD 9ICXA 1Z6ZA 2FMSA 1P72A 4FMDB 5TB5A 2Y68A 4W99A 3TTWA 1A4XA 3K4PA 5DDYA 2UZ1B 3RSGA 3AYZB 1AQUA 3WMGA 3N5CA 1VA5A 2C3MA 1U0NA 3PLRA 1NP7A 1YK1A 3DE7X 1VDZA 1J24A 3F4BA 1EWKA 4RD4A 3ZEAA 4QM7A 1WABA 4MUJA 4CTJA 2NUTB 5F76A 3SXUA 3TD6A 4CM8B 3GJRA 2HBLA 3LGSA 1JHYA 1TZ2A 1V11B 3CINA 3U4AA 4KTQA 2IHYA 2ZTMA 5AVKA 3ICXA 1GKUB 1JG4A 1UBUS 3MOGA 3ESCA 3ZWCA 5IT9A 3O1HB 3PXBA 2PV0A 5AUNB 2GESA 2HHSA 5F7JA 4A2QA 4GYJA 4Z6EA 2FE9A 1QS0B 4DM7A 5AW8A 2LM1A 2X5NA 1NMEA 2GBLC 3I8XA 3OU6A 1IG3A 5AH0A 3U2QA 2YY5A 5CA7A 1E6CA 4AG3A 5EJ6A 3M5DA 4X24A 1SMKA 2QKYA 2XGSA 3ISVA 4JLNA 4XGIA 3UUEA 4OLBA 5A0TA 2LCFA 3A3PA 1MJFA 4FGWA 1CJCA 2M2IA 2J8ZA 2Z9CA 3VYRB 1TYEB 1P2FA 4ENVA 3WQQA 5JS8A 1BPDA 3ENWA 3RBVA 3KJGA 5J2EA 2NO9A 3TSAA 4HVLA 2FW6A 4QZGA 1W94A 2V5AA 3PWSA 4Z1MD 1Z62A 3WDKA 1DKMA 1W4CA 1GVNB 1RQ7A 4D81A 2J85A 3D6TB 1U3CA 2KJ5A 1QMPA 2AZ4A 3G2QA 4TQ9A 4UQPA 4ARIA 2JEGA 4DLPA 3L7NA 4PWYA 3AY6A 3FWPA 2QJWA 4KTVE 4W7HA 4PLGA 1ZUD1 2Y66A 1WZ2A 2KHQA 1OREA 4Q18A 4EBDA 1U28C 3B52X 3DAYA 5REQA 4OU5A 3VDXA 3C3CA 2GCGA 2QMHA 5F2EA 4MQEB 2R8BA 1L1FA 1DQYA 5MGBA 2A86A 2E4VA 3QI7A 3QFFA 4QWEA 5L1IA 3VYVA 1XZDA 1ENOA 4R66A 4FGJA 4KFSA 4FXPA 2A0KA 4KO3S 4AECA 3NXSA 4TTJA 4GC9A 3OGUA 3O38A 2K89A 3DV0B 4MKHA 1WHTB 3Q8MA 5IEBA 5C53B 2WOOA 1ODLA 1XU9A 5EJMA 3O3OB 2PSDA 1H3FA 4QAJA 1CJKC 7ICQA 3TZEA 2XSZA 4MX8A 3O7MA 1KXZA 4L3OA 4RD0A 4FZRA 2Q9UA 3CLRD 5LZ7A 3C6ZA 3N7PD 1DV2A 4QTYA 5CDFA 4QQFA 4G2TA 1SOWA 3EMDA 4X65B 2JGDB 3EQ8A 4Z6DA 4LDZA 4NJEA 1QNLA 1AX9A 1KMQA 3C45A 1R8XA 3UT6A 2ROQA 3GGGA 2ACEA 4QDJA 2K4HA 3NU1A 2I7XA 2X2OA 4AKSA 4NBTA 3A4LA 2FRDC 4ECSA 4B80A 3DT9A 4CLEA 1WZNA 4EB0A 1YXMA 4QXMA 4I1IA 3SFZA 5KT2A 4K6GA 1U7TA 4KH1A 2IHKA 4MUKA 4MYSA 4D41A 4RW0A 5CFLA 2O8CA 5FOVA 1KLNA 4YR3A 1OFGA 3V4VB 3QOWA 3IHQB 1TD9A 3F74A 3Q9SA 4HWPA 4NU0A 5E9QA 1L7MA 4HQKA 2V7XA 2HPAA 3R8FA 3JARB 1V9LA 4EMUA 1DFGA 1U0GA 2OENG 5LDGA 4YT4A 4NATA 1VYVA 4GPIB 2XI9A 1L3SA 4HTFA 4JB8A 5COAA 1TJ5A 2Q0SA 5L3RA 1ZRNA 3D9QX 3NGMA 1Z73A 4K87A 1NA5A 1LFAA 1NQTA 1RBMA 2YH2A 1M2VB 4LGVA 4KLSA 1SBIA 1TI7A 2AT1A 2JC3A 5EERA 3TTTA 3V46A 2IYWA 3C6QA 4ND4A 1H4QA 4DR7B 4ZMRA 1Z0UA 2W2LA 3FUWA 1QSLA 2ALZA 4U2EA 5HS6A 2IWRA 3WVNA 2P5TB 1LJ8A 3E4CA 3AFNA 4NENA 2Z58A 1EVQA 3CMMA 3GRFA 1V8ZA 1YVRA 3RW9A 2XXJA 2GYUA 2YBDA 1QIEA 3BGSA 1TAMA 1T8WA 1RBYA 1XR3A 5HTOA 2PDAA 1IZZA 3ANSA 2UVQA 4RKFA 3CPSA 5C8VA 2XIQA 4PL2A 2I4TA 3ZXUB 1JE1A 4OI2A 3RJTA 2O2HA 2HKIA 5AVYA 2JZBB 2W03A 1TLTA 1HFKA 2YNMC 3CXUA 3QVTA 3W6PA 5K0JA 5EPUA 2ZE6A 3SHQA 3LT2A 3U44B 3MGAA 1ISPA 3K75D 6AT1A 1F2UB 1L4NA 3LU1A 1QUFA 2EZ4A 3WV5A 1YRHA 1NI4B 1Y4UA 3ZXYA 4OTZA 4Q0MA 1WIWA 4MR9A 3R23A 4C0JA 4DLXA 4PN3A 3P45A 1JHZA 2JKYA 3R3HA 5EC8A 4BWYA 2JFHA 3RS5A 1AGNA 4G67A 5FYQA 4CIXA 5KG5A 4CM5A 3OJEA 1BJKA 3ROEA 2OD7A 4CIBA 4DS4A 2XUZA 1M73E 1RYDA 4R9VA 5C1PA 4Y2GA 1GN9A 4O5KA 1RYFA 2Q5FA 3PQ5A 3W79A 2HWYA 2ZJ2A 4K1XA 3SE0A 3WB0A 2Y99A 4B75A 1I2DA 2Z5GA 3OPQA 4YXWD 4L5JA 4UNPA 3KO8A 4B6RA 5BOLA 1JDUA 1JSCA 3FMFA 3BJIC 1A2OA 3NTVA 4AFNA 1O96A 1S8OA 3Q7QA 3ELWA 1SB8A 3KYIB 1I7SB 2DQNB 4PHDA 2F48A 1F8YA 2A84A 4JOCA 1C7JA 2ZUWA 1V4NA 4AZWA 4I8DA 4NDAA 3KT6A 3V7KA 3QBEA 1JPJA 1ZK1A 4Q8FA 4GOXA 4QNLA 2HN9A 1EAYA 3NHAA 5L1LA 3GA5A 3ONWA 2ZB4A 1XVLA 3GLKA 4BGIA 2FLNA 1WTAA 1ZNXA 5AICA 1G59A 5CB8A 1ST3A 4MAAA 4K9LA 1J07A 4O2AB 5H3LA 3BDVA 5ILQA 1AUVA 2X0DA 2FG6C 1G9TA 4WADA 3WL8A 1M0EA 6NULA 2Y0EA 1D7AA 4QECA 4POOA 1E4VA 1ECFA 1EX1A 2F67A 4KDRA 4WXRA 4EY5A 1P44A 4D8YA 2PPVA 3OI7A 1OX4B 2FRDA 2CV2A 3HCCA 5B2EA 1QYWA 2HXYA 1XRLA 2O48X 1UXGA 2P30A 5DTJA 3RUDA 1P2DA 3W2IA 2I1WA 3AHEA 3ET4A 3W5BA 1KIMA 1XD9A 2A9PA 5HW0A 2KNJA 3EVBA 4AROA 1UBRS 4PYNA 1NFRA 1THZA 1QYVA 4C7JA 1M5RA 3IA2A 5JCJA 4Q01A 3KUUA 1QVWA 3B36A 3ORHA 3G0GA 3QQPA 2R00C 4WKCA 3V1TC 5G3YA 3VU3A 2HEIA 3BEOA 5GP1A 5C8ZA 4NFLA 1DWOA 3KQOA 5CHYA 2WJYA 2Q0XA 4N0MA 1FXUA 1YRAA 2V6MA 2HOIA 2FMXA 3A37A 1WKBA 2AF3C 4KRGA 3IP5A 4OJQA 3SR0A 1R12A 2C9CA 3ENZA 5D51S 3QKIA 5JSZB 1YUNA 1F7UA 1L9XA 3IESA 5KWEA 2FPPB 1ZXBA 3OQOA 3OP4A 4A0FA 4N6OA 5AM0A 4DC9A 1VTKA 3H04A 3IE1A 4JV5B 1CUYA 3GBVA 2I65A 2NZVG 4ZALA 5SY4A 4TVSA 5KKCA 4AY5A 5IBRA 2JLSA 1O95A 1VHDA 5C1BA 4E21A 2P4UA 3EG9B 3MWEB 3GRKA 4RHXA 3VZCA 3U49A 3C1YA 1TKDA 2R5FA 1GZ5A 5E4FA 5AYVA 3RVKA 4AMVA 2WWGA 1IFXA 4BB0A 1S8NA 1TD1A 2NUPA 3N2KA 5I7AA 1EK0A 2IIQA 2K7ZA 2E37A 2JFUA 2XVYA 2YQ5A 1ISJA 1J0DA 1QO0D 1XFAA 1UFQA 2P2LA 2YVAA 5KVQA 1NVBA 2PMKA 3BFJA 3UV3A 3VSCA 3VSDA 2QL7A 3QF4B 3RIYA 2O8EA 1NULA 1CYDA 2I55A 3ASZA 1GEGA 2GAAA 2GAJA 4AMBA 4BWMA 2J3MA 4D9MA 5L9AA 2FPPA 2H7VA 1VPWA 1F5SA 2H4HA 4ER5A 1CZUA 1A5BB 2VRNA 3UAVA 5BWBA 1NTOA 3C1OA 3I37X 1N1EA 3DFFA 3BF8A 2QI9F 3JQBC 4AZ0A 2ZXUA 1ENPA 2PLNA 1NKTA 3A14A 4PQRA 2CJYA 3F6YA 2XKBA 3PX2A 1ITZA 2G77B 4NLCA 2FSHA 3QELB 3OAAD 4M8LA 3ZXSA 4NHEA 3ZK7A 4V1CB 1GPJA 3B85A 1C1DA 1OIXA 1MG0A 3D3JA 4LRSB 4PZEA 5EKDA 3ZU5A 3I62A 5EP2A 3CYMA 1W9HA 4IDEA 4O29A 4R1UA 4CU2A 5FDFA 2RP5A 1HO3A 3D6JA 1V25A 2V9ZA 1OYWA 3GNSA 3LY9A 3H65A 4IH1A 4JBWA 1A27A 2GLTA 4P3NA 2PAFA 5ARBA 1TM7E 3BWVA 5T8KA 3ZV6A 2GASA 2I2FA 2JJ2A 4JSRA 4LWQA 2XDAA 4HZUB 5HOEA 1JT9A 4B3TB 5HKBA 3K70B 2J9FA 4PRYA 3EFOB 3FYUA 5FXMA 4LY3A 2KSOA 1CUAA 2GD0A 1ZI9A 3THOA 3ERCA 4MJLA 1UDXA 2BEVA 4JAVC 4G9BA 1WVIA 3D7NA 4Y8VA 3RVOA 3FDXA 3WSWA 5LR6A 3TIFA 4Z8YA 4F3YA 2H00A 2C2ZA 2PXAA 4KKVA 2PRKA 1N5RA 4IFTA 4IJVA 4CMAA 1VBKA 1JFLA 4F5YA 2XMGA 1ZQFA 2ZUDA 1C1DB 3O9VA 3TWOA 1BXRB 4BO7A 2Q4BA 4QJ3A 3DBLA 3RTCA 4BO3A 1F0NA 2O50A 3JU3A 3RASA 5DXFA 4ZD6A 4G1FA 1CQWA 5JROA 4YRTA 1W0JA 1S5LU 2V6GA 1CULC 1NOIA 4H16A 1GT91 4MMXB 5AHXA 2Q5LA 2RC6A 1N6HA 1PFVA 4HAWA 4YY3B 3HJFA 1E6MA 5GJWC 2JLYA 1FDIA 4AWAA 2C84A 3JQPA 1LY1A 2PMWB 2AJCA 2QARB 2DZDA 2GFQA 4HX5A 3A9TA 3MS4A 3H4VA 4JU9A 4AJLA 3GJ3A 1SM4A 1Y1TA 2C2DA 1VHJA 1UPAA 3PUYA 3KBBA 3KXKA 3HP4A 3Q9LA 3HK2A 4BO2A 4RGVA 1U9IC 1OQAA 3VQTA 3RAXA 3Q1KA 1E0SA 1HC7A 3S2ZA 3OQBA 3QOXA 1W59A 2OSBA 4RPGA 4DLSA 4WRRA 4IP0A 4NZPA 1KO5A 1LXCA 2G82A 1RE1A 4LZPA 4ZVVA 1K7FB 3NONA 1NXVA 1QG2A 4IFBA 3U4IA 4IS2A 4TYNA 4CKBA 3NIDB 2DBQA 4BXOB 1S8FA 1BXRA 3SSNA 4UBBA 2Y1WA 1NN3A 3NVAA 3TGLA 9MHTA 3GEEA 3QPDA 1PAUA 4HX2A 4ZOQI 2RGNA 1QO9A 3VVCA 1ISSA 3GEDA 1TLFA 4MUEA 4QOGA 1ACLA 1Q7GA 4J2OA 2JJ1D 3GLHE 3F96A 3L3BA 4R1TA 4DA6A 3HVIA 3N58A 3CCBA 3MFQA 5KOJA 1CY2A 1P9RA 2OGZA 1QH9A 1M1XB 4PGHA 1UDCA 2SKEA 4Z5XA 1F8XA 1PTKA 2A1AA 3QPBA 5TT0A 3LV8A 2CEKA 2O0HA 3FKSA 4G0YA 3VKGA 4I8XA 2A9OA 2JZCA 2XBLA 4GMFA 3WB1A 4GEGA 3EAGA 4HP8A 2VA8A 1TO1E 3PHJA 3QWAA 4EQZA 1LBQA 4XVCA 1BDMA 2MMCA 1P7PA 4L2IA 1UZUA 2BFEA 3MJRA 3WICA 1W34A 2O2DA 3AEKA 1ZJMA 4H4DA 2QT0A 5CM8B 4YRQA 3GNTA 4LWPA 2HAEA 2FPIA 1KQNA 2WBLC 2KEYA 4RKEA 4UCQA 3N53A 5KWIA 1RM0A 1LFDB 1KNQA 3KKAA 3MJCA 2YN4A 4MGKR 3K9QO 2QIPA 3AKCA 4OYLA 3U4MA 121PA 2NG1A 3NB0A 1SQ6A 3I72A 3LVWA 3QEKA 5TQ0B 3WGVA 4TUQA 5IC5A 1A7KA 1RI1A 1VCIA 2D74A 2ZIGA 3A6ZA 3OOHA 4EQ6B 1GAXA 2GF0A 1B43A 3HUEA 5THKA 3ZQJA 3CKKA 1QWSA 2O4CA 2ID4A 3V97A 2Z57A 4QVKA 4RJLA 3QNWA 4O2LA 4OQFA 5CHGA 3AEVA 3CNLA 2HIMA 5JS6A 3INGA 4M7RA 4HYEA 4QSMA 2Q6LA 5LIPA 2R5NA 3RFTA 1QHYA 4UDXX 5FBHA 1E2FA 5EJ7A 1T35A 2Q1SA 4QGFA 2O07A 4ZI7A 5L4LA 1F48A 2O20A 1YO6A 4CETA 3D2LA 3N70A 4KLRA 3E9DA 3W8EA 3ZBQA 1BGXT 4DV6B 1A95A 4P0PB 1FP7A 2VPIA 2HCTA 3U9SA 2ZTUA 3M6VA 4G65A 5LMNB 3Q98A 1DMRA 1OBCA 1HI9A 3RH5A 1YB4A 5K7SA 4HDNA 2PNJA 2H92A 2PQ2A 1LV8A 3KT3A 4UB6U 1ZQJA 3EFHA 1SA0A 3E0QA 1L5HB 4FI3C 4D9KA 3FAHA 1T9AA 4C6TA 2ZROA 3CURA 2VANA 5KJFA 1BE1A 1HG1A 4KLOA 4PSDA 2PUJA 1KP9A 2E4YA 3D6VA 3K94A 3QW2A 5ALGA 4I36A 2ZJ5A 3HCBA 4KNWA 3PZRA 3WYCA 4RZRA 1WU8A 2G1KA 3OA2A 3V4LA 4Q03A 1J06A 1EFVB 3VHXB 4JK3A 3LRPA 5EYPA 4FMCB 2NZYA 1Z22A 2VCYA 2XODA 3BZCA 3O8OB 4M36A 5DT9A 5JEDA 2ORVA 4PYLA 4LJ4A 3ZE9A 5LYJB 1MO4A 1LK5A 3KTOA 2H5IA 3KYDB 4K8RB 1UDAA 1N2GA 5J5AA 2PWYA 3LI2A 4OI1A 1H66A 2J3KA 4K4GA 1L7VC 3UK2A 4GZ5A 3SG0A 4JL8A 4EARA 1C5KA 2ZDQA 1PVPA 4DMFA 4MIOA 3OE1A 1N9GA 1Q7TA 9ICGA 3DCNA 1KDVA 2LRHA 4HDOB 3DL7A 1OGJA 3RJ5A 2QQ5A 3KKPA 1BKDR 3QEAZ 4C8OA 1EFUA 1KJ8A 1U7WA 2QTLA 5EGNA 4FFBB 1G6KA 2IEDA 3UJ6A 1VA4A 1ZKDA 2VRCA 2FPOA 4M1QA 4OXKA 3RABA 2EAOA 1O7JA 1US8A 1R37A 1RC1A 3EFEA 3HS3A 3LT4A 2FSGA 1DDGA 4RK6A 4BX2A 4C88A 5HHHA 3H2BA 3AHIA 3ABSB 3DMNA 3QHAA 3S70A 3V8VA 5KTPA 1QPZA 1BX1A 1BEUB 5CYOA 2VPQA 4RY2A 5JQWA 1PYOA 3FHCB 3ANLA 3DC2A 4HNAA 5KQGA 1W1WA 1VP9A 2FDCA 1UK9A 4ZCTA 821PA 1S3IA 4AY4A 3QPUA 2OMKA 3NUGA 3LHDA 4E07A 4QQ8A 5AVVA 1QXSA 4G8BA 4O1MA 4DC1A 1OSNA 1UZAA 2DLNA 3KVYA 4WMLA 3U7GA 2QRQA 1S89A 1Z36A 3GUCA 3QLVC 4A6DA 1S0VA 3WSVA 4D6YA 1ZSVA 1USVA 5AVWA 1CRPA 1NBIA 3I32A 4RK1A 1CDOA 1NI5A 2KZZA 2ECFA 5J2FA 1WOYA 7ICLA 2GKOA 5NULA 2BWJA 1RKXA 2FLVA 1LSJA 4CV0A 1SR8A 2X2EA 3NRWA 1ES9A 2G28A 2V7VA 3P96A 4OVKA 3CVWA 4I2BA 4L74A 2OHFA 2O23A 1EFCA 5ICSA 3CW2A 1P77A 2PJDA 2P5SA 2F17A 1RAEA 1HQCA 4YRIA 1YIOA 1WUKS 4X9XA 2BGGA 1SKWA 3PTLA 5A0FA 2LD4A 1WZCA 3BH6A 3KTQA 1VRCA 1SB3C 3DPSA 2GZDA 4N5HX 1DV1A 4RHTA 2YR0A 4MW9A 3LFUA 2K2WA 4G01B 2ZU0C 4R41A 1R0WA 5EJ4A 1FPMA 1BKSB 2PXXA 2AMVA 2Y67A 4S0ZA 3VR6A 4F2PA 1T36A 4MP8A 5J0SA 1YL7A 3MERA 2A5JA 4L8YA 2VTEA 4LQ4A 3L7LA 4N0DA 1AMUA 4US2R 2PHZA 2G5CA 1P9LA 1Q1BA 1RKVA 1TZCA 2GCNA 2HJVA 2XNHA 3DKVA 3C29A 1FB5A 3NBMA 1RXUA 2GETA 2PLRA 2PKEA 4HJRA 4I55A 4D96A 5KYNA 5CX4A 1I94B 2O0KA 1XTRA 4DCPA 2YC4C 4W6ZA 5KEIA 2JLZA 5JISA 1G8MA 1SD5A 1OB2A 4E70A 1YZYA 4TVBA 4US8A 1DJQA 1T5HX 2PD3A 3DYIA 5JPIA 2ZTHA 2C0PA 2VJLA 4J90A 5BV2P 1TU3A 5HKKA 2VXOA 1CY6A 2XOEA 1EVIA 3ELBA 3WYFA 3O8RA 4HVTA 3LQQA 3CW2C 4UVDA 1B6SA 3GELA 1GAQA 4Q39A 3HXMA 1RWOA 7ICSA 4Q8EA 1G21E 4F5NA 3KZNA 1M6YA 4GLLA 4HNQA 4K2AA 2E1EA 3WP0A 4JVMA 3JQDA 5J2UF 2EQYA 1G2PA 2H1VA 1GQFA 4PBRA 3W9SA 1U2TA 3ZZTA 3EWNA 3WO0A 1D4ZA 1T8EA 3SNHA 1J00A 2OC9A 8ICYA 2CLSA 4K3VA 5HRAA 4LGMA 4ZZ1A 1GGJA 3FNRA 3TI0A 1KGDA 1E7QA 2XSZD 5H68A 2VLIA 4QT4A 3GZFA 5HK9A 3C3XA 1GKIA 4YCMA 2JJ8A 5IJXA 2UZ4A 2JLUA 4P08A 2QE6A 3ZUPA 4CEJA 4W6QA 3G2NA 4OL9A 4FFMA 3DTVB 3AV0B 3U0BA 1M8KA 4BWFB 2C7BA 4DJDC 1RFGE 1RZRA 3WFZA 1D2MA 4QUBA 1TK9A 4INAA 5LBTA 2ODGA 4G5YA 4F5RA 1J56A 1ZJ4A 2YASA 5FBKA 3DAFA 4JKOA 4GI5A 4Q3AA 1HNWB 5CD1A 3ZHVA 3RH6A 5H70A 5K45A 5JC8A 5KCMA 1H6CA 3VNBA 4ERNA 1NRXA 1P81A 3IJEB 2C42A 1M2HA 2IBTA 4RVOA 4U6QA 3SX4A 4RZQA 9ABPA 5KT5A 1NAIA 2Q6OA 3PMLA 2XJ4A 3TQOA 3PNBA 3YASA 5LU8A 5LL6P 3RB8A 5IG2A 4DNFA 4F2DA 4A2WA 2C5FA 5F3WB 1YFKA 3SVTA 2DLCX 1HLPA 4WVFA 2IOHA 4TTSA 5F64A 5DNEA 3PW4A 2I76A 2KLBA 2FPGB 4Y7DA 2AFIE 1UBFA 3M6MD 1DX4A 4RJKA 1JQ3A 1ZCBA 4A5OA 4F4IA 4PLVA 2LUOA 1B0XA 1P31A 2HEGA 5J40A 2ONCA 3IPCA 5DYNA 4EB6B 2XCPA 1MD9A 1TTQB 3AB8A 4ABTA 1Z6YA 2ZRAA 1Z74A 1J23A 5I9NA 3F2CA 2WSSA 4JXXA 1KI6B 1T9BA 4HNRA 2EJUA 1ZICA 3KFLA 3VR3D 4P5DA 1E79A 1OTXA 5A5EA 4EO4A 4HD8A 4BJHB 2QTMA 1OR8A 1FDSA 3BD6A 1EFHA 1OLUB 2Q29A 3OURA 2X3YA 5JFOA 1FFXB 2AEMA 2C00A 3HYRA 4O4JB 5FI1B 3S2YA 1FSFA 3WGTA 1ZISA 3LZ6A 1Q7RA 5DP1A 3VR3A 1GWNA 2XWPA 4G85A 4JBYA 4FW9A 2M6LA 2I6TA 2WMYA 1JA9A 2JBWA 3L04A 3V4PB 3I92A 2ZSBA 1YB7A 5G4KA 1UEJA 1Y8RA 3OE7A 5IJZA 4HAIA 3BK1A 2N75A 3QIVA 4B4KA 3C2MA 1SK9A 4OX9B 1CVRA 2Q9AA 2P9EA 3S8MA 4DCGA 1IG0A 1V8OA 3NFRA 5KYUA 4DQXA 3SLKA 2WWXA 4QJ5A 2Y6VA 3WGOA 3KJZA 3PNOA 1L4HA 4Q6BA 4C0LA 3R9XB 3UK6A 2IU0A 1U9ZA 2D5IA 5B6JA 1TKBA 4IQTA 1Q7BA 4P36A 3W8NA 2X58A 4C4TA 2IC5A 2NUTA 4DLVA 1J90A 3JATA 1YUBA 2AX3A 2RHDA 4GL4A 2EP7A 5BPHA 3O03A 5C4IA 4Z0TA 3EEIA 4WZBB 2G0AA 1YGPA 1RU3A 3QXHA 4L08A 5CFRA 4YACA 4M46A 4WEQA 3TS1A 4R5MA 5T41A 1H2YA 1YQXA 4KI0A 4KLUA 2VF5X 3QFCA 3RR7A 4G97A 2IPXA 5IK2A 3CEHA 1UJCA 3A1EA 4CLXA 3CJRA 5KCZA 3JQRA 2PUWA 3PX7A 1W6RA 4Q34A 1X39A 3M34A 5M5BA 5AD1A 3ZWYA 4GQIA 3QM1A 4OFXA 3LYSA 5KFOA 3IOYA 4KFTA 3LUHA 1E3LA 2WSLA 3E8MA 3N2ZB 1QIKA 3H0KA 3LBNA 4JELA 2ZZNA 4R9NA 4K6MA 1ESCA 4INJA 4UHHA 3B9JA 3VNUA 1EE9A 2WW8A 2XYHA 4EY4A 2GKSA 2C94A 4TXJA 4RD1A 1C7QA 2V55B 3QTLA 4JS0A 5E2AA 2H3ZA 4A16A 2E5LB 1BHQ1 4BX9C 3B6MA 3OLCX 4IZHA 4MDEA 1IN8A 3NBKA 2I3ZA 4YQFA 5HIJA 2GDJA 3LC2O 1XZJA 1IJEA 4FZJA 1PJ3A 4FDTA 4DLKA 2VTKA 5JO0A 3MWFA 3UKJA 2NYVA 1MQAA 3HY4A 4UREA 3WV4A 1V1RB 3DZCA 4F38A 5AESA 3AKYA 3KVRA 1XN4A 4ZO4A 5SZIA 4X1KA 1WDWB 2X41A 1GCGA 2BFDA 1ONNA 3HYSA 1T2EA 2AN3A 2NPIA 3PX0A 1X0VA 3F6BX 3SXUB 5HQTA 4EVIA 2KIWA 4RFLA 2BFWA 4N7RA 2ZZKA 4E12A 4ETIA 2BZSA 3NQ41 2Q4OA 1NT2A 4GX2A 4MV5A 3U7IA 3VH4A 5EUBA 4QBTA 1C7EA 5DQIA 3C7KA 2O2GA 5I5GA 1WUHS 2Q0HA 2VDWA 1JUDA 3G68A 4Q7MB 2ZIXB 4E2XA 3F3SA 3TZBA 5KFXA 4F1KA 1TIBA 3L4PA 1U2EA 1XELA 5JIBA 5IRCD 4QUGA 1J5EB 3FPSA 4LXYA 3O82A 1B8VA 4DIFA 3M9WA 2X23A 2XPCA 3W05A 3BX1A 2QSYA 2BE9A 2VDJA 3L1VA 4K5QA 3UB3A 2BN4A 4J4TA 2FPKA 4P3YA 3U09A 2EOAA 2XDQA 2G8LA 4F86A 2KFZA 4MDFA 3W78A 4ECTA 2XXAA 2XEXA 1BPXA 1NMZA 2B4KA 1J8VA 2DSNA 1ACMA 2ZR7A 2DTXA 2HVIA 1DZ3A 1T9DA 3I4LA 1EWRA 3A2NA 3OH8A 1PVRA 3PXAA 4IBOA 2ECPA 2H6EA 2W0SA 5E1DA 1B14A 3HQ4O 4XEUA 2QTWB 3QU4A 2QGNA 5JCXA 1QU2A 3TDKA 1TTHA 2JGMA 2Z1MA 3MD0A 3MJHA 2XX3A 4XB2A 4HUQB 4ZJYA 1DT5A 2GSDA 3AINA 4C7XA 3I76A 4WCFB 5LWHA 2AFHB 3O9ZA 4ND5A 1UZNA 2P9BA 3A05A 4JQSA 4DA8A 3LKBA 5DLYA 5KOIA 4NM2A 2YVKA 3CVXA 2OEPA 4B3SB 2HMSA 3NH6A 4F60A 4KGXA 3NV9A 3WP1B 2KICA 2VQ3A 2QUKA 3ROFA 1NBME 4AF7A 4DR5B 4NL9A 3L8CA 1Y88A 1YH3A 1XHLA 5K3EA 3W9BA 3EEFA 2R65A 3LQKA 4QYIA 1SL2A 1VP3A 3ZDBA 4EF4A 3PMNA 1LC0A 1CIPA 2Z4RA 3AH8A 2FWAA 4ZA2A 2QBYB 1BRTA 1Y80A 1N5OX 3QVMA 2J7PA 5AVQA 5BWOA 1H2XA 4Q9IA 1V1JA 3M2TA 4C8KA 2AB0A 4N54A 1E3SA 1NHWA 4QPZA 1DINA 1MNAA 1KZHA 4CMCA 2QVYX 1JMYA 1R1DA 5BRJA 2R96A 2GBPA 3PRYA 1IV8A 1G17A 1H94A 2FZ5A 1VIYA 1YL5A 2GM3A 3LGXA 3QYJA 4S3MA 4CL8A 4Q1AA 4K86A 2IZ7A 4BWJA 2QD4A 3W04A 5CDGA 4OX9Y 1WXIA 3R9IA 5HSGA 5CLGA 3H40A 1G5PA 4IEIA 5HIMA 1P0FA 1VE1A 4WKOA 1D9ZA 3SKYA 4ZHQB 4NLLA 4J9MA 1HPLA 1BE0A 4LX8A 1JQKA 2EKZA 5C35A 2BAGA 3T1NA 2H1SA 2WYIA 2P7HA 2CUKA 3D8UA 3FNQA 2AE1A 2WY2D 4G4GA 2P2SA 4B2PA 2PN1A 3JPRA 1ZK4A 2QLMA 4N5NA 4G56A 4CUZA 1M2FA 1OZ0A 3NBFA 1XIVA 3I6QA 4IWNA 4P7KA 4D92A 3TXYA 2EVWX 4FMBB 3K9FC 3I64A 3QY0A 4FPXA 4MHOA 5AVJA 5JZOA 2OCKA 1EI9A 2J4FA 4OEHA 1ZQIA 1O95D 5KINB 5BSRA 4DV7B 2AEEA 3HKBA 1I7QB 1DRVA 4RPIA 4INOA 1PJ2A 1GGMA 2JANA 1MOSA 2PZBA 1J6UA 4R0NA 1RWPA 3ZD7A 1U0LA 1WNTA 3KS9A 4ZZ0A 4IHJB 1PK1A 3WLNA 3ANXA 2WUFA 4Q15A 4O3NA 4JUDX 3A1WA 3NTXA 3ORSA 3E2IA 2PMEA 1VSTA 3AWDA 1CG6A 3KLOA 5B3AA 4OHKA 4BFUA 2W6NA 2XNDD 3KQVA 1PUXA 2W9BA 1F51E 1Y33E 3NO4A 3G2MA 1BX0A 3GFKB 4FC6A 3SYZA 1KPHA 1GPKA 1FVXA 1EKXA 1I10A 3ABIA 3EXG2 3PI6A 4OPMA 4DJFC 1P4RA 1LU9A 1S5PA 3OO0A 4NM1A 2LGJA 1I0LA 2FSPA 2QYOA 2BR5A 4K9NA 4N8SA 3SYLA 5JSHA 1ZO8A 5KWJA 3HO1A 1QGAA 1QBGA 4MVJH 1NK0A 4EA9A 1J8QA 4KQEA 4QC2A 3IO3A 1PR1A 3IR5A 1JG6A 5CB6A 4CI9A 1XNHA 1LA2A 2WKSA 2NSYA 4J9NA 2Z83A 2YMQA 1OXXK 1OPRA 5JCPA 2ZXHA 4QBGB 3I4CA 3RS3A 1ZYUA 3MLBA 1JSXA 1QC5A 1SOVA 4EG1A 1TNDA 5ADUS 1X9XA 3H5AA 1XEWX 4JT9A 3UWMA 5JMOA 3M81A 1F2DA 5ICFA 2XCUA 4Y9SA 2PL1A 3O8BA 2PEZA 4UE3S 5CA1F 3L7CA 1GTSA 1M3SA 2WF9A 2WTBA 4TVOA 1X3LA 5IINA 1JH8A 1SWWA 4MMYB 4GHWA 1L8XA 2C99A 3QMPA 3RTEA 3SNKA 1EE2A 1N5JA 2WG2A 3EVDA 1QHEA 3ZQ6A 1VLMA 2QNRA 1FIUA 2BKUA 1BVYF 2DF8A 3ALRA 1O5IA 4G24A 3QYPA 3ZI4A 3TLZA 3UMSA 3ZJVA 4JIMA 4LXQA 4X44A 2J0VA 1E2BA 1T7PA 3OIYA 5K6TA 1G20A 1PNTA 2HHAA 2VPWA 3PRHA 4DBLE 1JFFA 3FTQA 3K0FB 3MT7A 4WERA 3KE9A 2W6OA 2J46A 1R9GA 4DV0B 1YRYE 2BHRA 1ZCAA 3EZFA 4WKGA 2C2GA 4YJHA 2A8YA 2VA9A 3GVCA 3V48A 1LKYA 4LV8B 1YZLA 5AXBA 2J3EA 2JJ1A 3N6RA 3LWBA 5H9VA 3M5PA 3M7IA 2GN6A 3MGBA 3IHLA 1T3SA 2RI1A 3F4KA 3VNRA 4EAQA 3DV2A 4BKQA 4NEQA 4NMLA 4RXMA 1HY3A 2BBSA 2DUMA 2QXYA 4NYMR 4F71A 4WZBE 2OWOA 1FMJA 2JK0A 4JJZA 3M6ZA 2XNSA 1P1FA 2ZOSA 4HH0A 4Z86A 5TDHA 3RYIB 4ZFNA 1I13A 3C6MA 3K09A 1XZHA 4ZO7A 2R2GA 4TWZA 5TQ2B 3RVDA 1E2PA 1WB5A 2J32A 1JKJA 4ZTZB 5B7GA 2W6JA 2IV2X 2HF9A 2FW1A 3WB9A 3HCNA 4JBGA 1F2VA 3CNEA 4FX5A 4JLDA 4XGRA 3M9MB 2FWMX 2FWRA 4LJYA 3I2HA 3RSFA 1BIFA 2ILVA 1L8AA 3Q8RB 4DIUA 2W2OA 2CL0X 2J59A 4CKWA 3RCBA 1ZUWA 3RROA 2DBRA 5DXAA 1FNCA 1GY8A 4CNQA 2AL7A 3EUB2 1H8HD 2Y71A 2VI5A 5FFNA 5K3CA 2DWQA 2YUTA 5SICE 4A6PA 4AF6A 1SZCA 5BN1A 2X42A 1RVDA 2YXLA 4MRPA 8LDHA 4ZI7B 5BYBA 3ANYB 3JTEA 1JEDA 2BBWA 3L0CA 4P0QA 1KS2A 7ICNA 1AKUA 1UZMA 2ID9A 4X1OA 4ZOLA 1MO2A 2C96A 2N9UA 4MP3A 5DNCA 3V55A 1JDBB 1QTRA 4QTXA 3CB2A 1BJTA 1J7KA 3ZGYA 4EP1A 4RPYA 4YN3A 1T8UA 3PUJA 4MVJE 4RGQA 5MN6A 2JFPA 4MI6A 3T5HA 4QDUA 4YGYA 4E88A 2V65A 4C7MA 5F5XA 5DSXA 2KBEA 2WB2A 2DAPA 4M0UA 1QMGA 4R1QA 4KPGA 5FLEX 5F1OA 4E7PA 2XE6A 4MEAA 4NS1A 5ILOA 2CXSA 4CKWB 5BYJA 3RRYA 4RQ7A 1V16B 4LHWA 2J6HA 1YT5A 3I6MA 4LQLA 4PS0A 3Q11A 3STXA 4EHIA 3GVHA 2H1FA 3Q3GE 2HRQA 5CCBA 5KVAA 2YXNA 1QK3A 1WEHA 1GRRA 1IN4A 3NBYC 4P6VF 4TLLB 3QUQA 1BHSA 1IRIA 3K20A 1ZI8A 4PINA 1KDYA 4A6EA 3AU9A 1I33A 5AJVB 1SV0A 3ZCSA 3JASA 2CNOA 2YWRA 2ATEA 4MXDA 4R16A 3R74A 1FTNA 3REOA 2HLNA 1FYEA 3H1FA 1X9MA 2V4RA 3JAWA 1VCHA 4HDMB 3LBIA 4RETA 3SCZA 3ZV7A 5I4BA 5IZCC 1YS1X 2QRVA 3K6JA 4GPTA 5EJ2A 4DJTA 1JKFA 1H4TA 1ADFA 5COBA 2IV3A 4ENWA 3ASUA 3K31A 3BS7A 2Y05A 4OLAA 1CY7A 2QA5A 3AIKA 2FN7A 3FUXA 3ZDEA 4XWWA 3E8SA 1UBTS 3D7SA 4EVRA 1RWQA 2MRLA 1EWTA 1WKCA 4I08A 4WN9B 4NCNA 1URPA 1Y3AA 4ZOAA 3W9YA 5DIZA 3HP6A 2H3QA 3PR3A 3R7NA 3ZDFA 5IJWA 1BH2A 2HBRA 5TEVA 1O0BA 2HWWA 5DI9A 1FQKA 5BOMA 1AQLA 1S76D 3Q8LA 3DSRA 4CKBB 1VSVA 3JVUA 3H4DA 3OZUA 5EHGA 3VJMA 1ZQCA 1N9KA 3E0XA 1BFDA 3IPYA 3ZDDA 3GUYA 3QITA 4G4IA 5E3HA 4BFWA 1B2RA 1XS9D 2GB4A 4JN6B 1R0YA 1PWYE 4BVEA 3H0LB 4PLTA 2BPGA 1NK8A 1P6XA 2Q3MA 1IUNA 4IS7A 2FPSA 4M1OA 2QN6A 1NQUA 4L78A 5EZYB 1QH0A 1YNOA 1ECWA 3KQPA 4S1WA 4XJSA 3NEYA 4GC7A 1QKKA 3AMZA 3HCDA 3V4OA 1OH5A 4IJQA 4J9PA 1ZQOA 4Q4AA 4Z6KA 4KAJA 4U7DA 4FFPA 4MO9A 1QHHA 1ZGHA 4B9MA 1JJFA 4UDNA 3IT1A 5ITZA 4C0XA 3VSBA 3OHMA 3CLVA 1BOOA 3SEFA 2FB9A 3I83A 1A5TA 1FC0A 5HKLA 3U7HB 1Q92A 5K3BA 1EBFA 1VJ1A 4DOAA 4HC4A 4JI8B 2HQBA 1CHNA 3H0MB 1UBJS 4Y1RB 1QLJA 1B42A 1U0BB 3RV4A 5T4FA 3G2PA 1WCYA 4RSMA 3B1XA 2FSVA 1HORA 3KZVA 4NV0A 4DS3A 3M8KA 4RPXA 4QW8A 3DP7A 2QG6A 4L4ZA 4EKYA 4X1YB 1Q0SA 5A9SB 2AGQA 1U80A 4DPLA 3AL0B 3QXGA 3DS8A 2ZFUA 3OPXA 4TSFD 4D0NA 3HTXA 1GFIA 2F00A 2I7TA 2W2PA 1Z0DA 2BMVA 3ESRA 4FGUA 3GU3A 3VNQA 2JH3A 9ICBA 4XIIA 1OGIA 1Z37A 2WTAA 3BIJA 5EA2A 5EWJA 1KY4A 3C3KA 4EKGA 1XZKA 3UY4A 3PD1A 2G9NA 3UMVA 3K2BA 2PBZA 1KJJA 2FCAA 4I5DA 5AO9A 2QYTA 2CBGA 3SGLA 3MTDA 5LCXA 3VBEA 3C21A 4QNMA 2PR2A 4H7HA 5CEEA 4RVDA 5IN5A 3P7MA 5G0TA 1G2IA 3GLTA 5T6BA 1RZTA 2VJNA 4YUAA 3RR8A 2JAQA 3BREA 3ZTYA 4JJKA 3CE6A 1DBPA 1G8JA 4NVRA 1GTZA 3VBCA 4U4AA 1NN5A 2GBFA 4XYEA 1FSZA 4ABYA 3QA3E 4PVDA 4BKMA 4NLBA 4O3OA 1ZM7A 4L07A 5J63A 4HNTA 1QF7A 3GMDA 4KCGA 5LC1A 4CIVA 1RT9A 1WMDA 2WMNB 1HE3A 1NL3A 2C9YA 1GO3F 3I34X 4PYMA 3W4JA 2B6NA 4YRKA 1V5GA 1IZYA 4Y2PA 5KJ1A 4OO3A 5AJXA 3HCEA 3OVMA 4O8CA 3JPPA 2H9YA 1ZVKA 4ZCIA 3K92A 2E2WA 4WNYA 1YQWA 1YMQA 4JP8A 3B1JA 3E22A 4IDDA 2CNKA 1KJZA 4MPPA 5F9NA 1PX0A 3R6GA 1KEZA 4ARAA 4N0QA 3RC2A 3KQQA 4M6WB 7MHTA 4PPQA 5I7OA 3C1AA 3CN9A 3A28A 3DCJA 2A5LA 2PUHA 2A9QA 2Q41A 3PR2B 1C9JA 1IATA 4X61A 1KH1A 2XUPA 4LW8A 5F2KA 3QX9A 2OL4A 2QORA 1ZWLA 3N2LA 2H5LA 4FILA 8ICBA 1VKOA 1BHO1 3D1VA 3IUMA 1ZIOA 4RSRA 4L28A 4RAOA 5AHWA 2YOGA 4JBIA 3ADBA 3N0WA 4ZAXA 1DCKA 4O4HA 3OMLA 1Z08A 4MWOA 2WPDD 4JJIA 4OYHA 5EMNA 3UQ0A 1E1NA 3L07A 2G9VA 1RRVA 5FPTA 3NCHA 4KLMA 5LZ9A 1B8UA 5C5JA 3GYBA 3O83A 2GZ2A 4E4TA 1E3DA 4HY3A 3RAJA 4J4HA 1JRPA 2AGPA 4YUVA 2OQVA 1JXLA 4JCOA 1IPFA 1ULTA 1ZC3A 4KLZA 4TXMA 5FTMA 5T5QA 5BV7A 2DBVO 1ZRHA 1W36D 4RTLA 2D5BA 2GKGA 1S7CA 3DE0X 3ECSA 4H35A 2ZAGA 5CVJA 4DVGA 1XDBA 4QEZA 3KQSA 2ISPA 4AO6A 3PEWA 1DWQA 2UVWA 1YK0A 3DO8A 3DVSX 1L5HA 2Z1NA 2BV3A 3WJ7A 2ZYIA 2X4DA 2XWBF 5F5LA 3GFBA 1FRFS 4DXAA 5F73A 1A9ZA 4H7FA 1ZMOA 2G80A 4EKDA 3W5CA 1F17A 1NOJA 2HRRA 4BBAA 2XZTA 4M0AA 1MRSA 4Y2QA 3FHLA 5BSFA 1KFJB 2YXPX 1P5FA 3HWRA 1T24A 2C5GA 3BWDD 3Q7SA 4HB4A 1CRZA 4YIKA 1S2MA 4L75A 2A3VA 3CLKA 3MDAA 4HS9A 3THYB 3IKJA 1E4EB 3EGEA 1A0OA 1HWYA 3HNPA 3H4IA 2BM9A 2NO1A 3VO8A 1Q0PA 1XMPA 3IFSA 1J49A 2R1UA 1SC3A 4Z7OB 4ZCPA 2AD1A 1C7IA 2IYAA 2R6HA 3U17A 3RT7A 3ZVMA 3GUVA 4PHTA 4B84A 1SU6A 9ICTA 5AKLA 2GBIA 2X4IA 3M6AA 1BYUA 4YECA 4I1RA 1KOJA 2QRZA 3AYXB 4LIPD 5EZSA 5IPFA 3VVMA 1JJ7A 4MARA 3GLIA 2VXBA 3U9LA 4ETNA 1DGJA 2BI8A 1NU6A 5K2OA 3B6ZA 4DTIA 2B0JA 1YVPA 1CV2A 5CJJA 2W0MA 3RRNA 4DIMA 5EPOA 2V6BA 8ICTA 2RH5A 3LUCA 4AJ4A 4TUPA 1DXHA 3E0FA 3EDRA 2HHXA 4OP2A 3THYA 1QOQB 1T3QA 3DE2X 4WKBA 5L3SB 4OJPA 4K4HA 4IR9A 1G6OA 4L0MA 3OHAA 1KK0A 1KQQA 2AE2A 1BA3A 4LZOA 5G5GA 1GTVA 4Q3CA 1ZETA 3WTCA 1B6RA 1IVYA 2OV3A 2W55A 3VO1A 5I9BA 4IG4A 3CRNA 1UMDB 4UMVA 1AB6A 4GUDA 1Z5ZA 4I4NA