2WF6A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and aluminium tetrafluoride
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf6A01
5AI6A 3L8EA 2NO4A 5ALEA 3PGLA 1L6RA 3N1UA 5AM0A 4BNDA 5ALLA 3UMBA 4C4TA 3N5KA 1CQZA 3QLEA 2HDOA 1MH9A 5AKGA 5AM2A 2B8JA 2IOFA 3ET5A 1NF2A 2RARA 3L0BA 4Y2TA 4H1WA 2B8EA 4EENA 3F9RA 1Z4IA 4L6AA 1XPJA 5ALNA 1AQ6A 3L5KA 4XE5A 3SKXA 3AR6A 4Y2RA 1YNSA 5AKXA 3OTQA 3L0CA 2FPWA 3SMVA 4UMVA 5AIAA 4IG4A 3WKCA 5AI0A 4OFZA 2ZBFA 3MC1A 3A1EA 5JJBA 2JGAA 3ET4A 5AKEA 4ZEWA 2I33A 3WK6A 4EX7A 2HF7A 4IFTA 4KNWA 2PKEA 5ALDA 4KNVA 3N28A 2YMPA 4OCZA 1Y8AA 1PW5A 5AVSA 5AW9A 3N8GA 2I55A 5ALQA 4DW8A 3S6JA 3MMZA 4PNHA 3B9RA 2G06A 2DQSA 4HGOA 1EK2A 2JAWA 4FFDA 1TE2A 1Z4OA 2YFYA 2B1QA 2ZXEA 1Q91A 5AK4A 3OCZA 3N07A 4HAIA 2PR7A 3ZTWA 5ALGA 3U7HB 5ALMA 3AR4A 3U7GA 3UM9A 2ZBDA 4C4SA 3R4CA 4HYTA 3AR5A 2OM6A 4BEWA 3ZVMA 5AKHA 3KBBA 5AVRA 3D6JA 1QH9A 1S8OA 4L6CA 3EWIA 3RF6A 5AIBA 4UU1A 2AMYA 2IYEA 5AW5A 1WPGA 4NV0A 4EX6A 1N8NA 2Q4TA 1Q92A 3E8MA 4YCNA 2CFRA 5A3QA 3FZQA 3CNHA 4J2TA 4CF5A 2R8ZA 3SHQA 5ALUA 3L1VA 2FDRA 4MWOA 1T5TA 1RDFA 1ZD4A 2G1AA 5IS2A 3WK4A 2G0AA 5ALOA 2CFSA 2YJ3A 5AVXA 2IOFK 4YCLA 4UARA 1XVIA 2YN4A 1Z4NA 1U2TA 5ALRA 3R9KA 2BDEA 2OBBA 4AP9A 1QYIA 3UMCA 2WF9A 4Y2UA 3NAMA 3QNMA 5ALZA 4Y2VA 1QQ6A 3EF0A 4J03A 3WK9A 3PDWA 4FYPA 3I6BA 5AW3A 1O08A 3KC2A 3ZU6A 2G09A 3KD3A 4DWOA 5AICA 2EARA 4OD0A 2MSNA 2HSZA 3MPOA 1QQ7A 3W5DA 5A3SA 2HCFA 1L7NA 3EF1A 2C88A 1K1EA 1QQ5A 4I9FA 5ALWA 3CZ4A 4Y2XA 4CF4A 2HO4A 1ZRMA 2NO5A 1SU4A 3OCWA 4C4RA 5E0OA 4ZEXA 3L8GA 5AM1A 5AM5A 2RAVA 1L7OA 2WF7A 1T5SA 2FPUA 4UASA 1Z4LA 1JUDA 4YIKA 2P27A 2OYCA 2G08A 5ALKA 3DAOA 4BNDB 4HGRA 4KN8A 3NUQA 1YS9A 4G9BA 3U26A 5AKIA 1EK1A 2HX1A 3UMGA 1YV9A 2C9MA 2FUCA 3U19A 4YIHA 2YMQA 1Z4MA 5AW8A 1YJ5A 1ZD5A 2I7DA 3QYPA 3W5CA 3WKEA 1Z4PX 2GFHA 4BX2A 4XQ0A 5AW7A 5AVWA 3PGVA 2WM8A 3R09A 3FPSA 3QUCA 4Y2PA 2R8YA 3AR7A 2C8LA 3ZTYA 2W11A 2HI0A 2ZBEA 5AI9A 3TLMA 2B30A 1U7OA 2IA5A 2GHQA 4UM5A 3WK8A 1RKQA 3QUTA 3HLTA 5ALYA 1Z88A 2R8EA 3NANA 4NFLA 4UAUA 4JDPA 4YCMA 3QX7A 3DNPA 4BX0A 5AVTA 4XOUA 2YJ6A 3M9LA 4Y2SA 3OCXA 5AI5A 1RMQA 3NIWA 4UM7A 3QU2A 2HOQA 3KDPA 3QU9A 4DCCA 4FE3A 3I28A 2WFAA 1VJ5A 1RRCA 4AS3A 3QU4A 4Y2JA 2HF2A 5AVZA 3E84A 3ZW7A 4NABA 1Z5UA 5AESA 2QYHA 4G63A 5AKJA 5ALXA 4I9GA 3W5AA 4E88A 3GYGA 4BYGA 3KOOA 3AR2A 3EPRA 3U13A 5AVYA 4BKMA 2YJ4A 1U7PA 2I54A 3P96A 1RMYA 2ZOSA 5AVVA 1IWOA 2P11A 5AK5A 2G07A 1RKUA 3WGVA 1L7MA 4KX3A 3ED5A 2BY4A 1ZS9A 3J7TA 3NRJA 4OHFA 2EATA 4HGQA 4Y2QA 1TA0A 1YMQA 3A3YA 4RESA 1WVIA 3SF0A 5AVUA 1YDFA 2HEGA 1WR8A 2I6XA 1LVHA 4RETA 3W5BA 1Z4JA 5ALFA 2NYVA 1TJ5A 3B9BA 5AW6A 1WZCA 5AI8A 4KX5A 3ZI4A 3K1ZA 5ALTA 2C4NA 5AM4A 5AM3A 1RMTA 3WKDA 1U2SA 1ZD2P 2GO7A 1S2OA 1XP5A 2MU1A 2IOHA 3FGOA 2AH5A 1TJ4A 2G80A 5AW4A 5ALJA 2R8XA 2HHLA 2FPSA 4F72A 3U7FB 1FEZA 2YMMA 5AKLA 1L8LA 4QQFA 2FPXA 2JAOA 3IRUA 3BWVA 3QUQA 2VKQA 5ALHA 2OA0A 3FPBA 3QU7A 4CE6A 4EEKA 3AR8A 2B82A 4EELA 2O2XA 2GMWA 4NWIA 4Y2YA 1NNLA 2WHEA 4BBJA 4JB3A 5ALVA 3FM9A 1Z5GA 1LTQA 3RFUA 2RBKA 1TJ3A 1Z4QA 3DDHA 2PQ0A 1F5SA 2W43A 3ZWDA 3ZX5A 4YGYA 1ZD3A 4Y3UA 1ZOLA 1Z4KA 3I1YA 3ESQA 2WF8A 3B8EA 3OCVA 4HGNA 1CR6A 2MU2A 3ONNA 5T41A 4UATA 2B1RA 3DV9A 1VFPA 3WGUA 1RQNA 1VJRA 4XPZA 1N9KA 2FUEA 1RPZA 4AS2A 2P9JA 3VAYA 3IB6A 3KZXA 3MN1A 3L7YA 3E81A 5AW0A 2YBDA 1RQLA 3SKYA 5ALIA 4DFDA 1L7PA 3QXGA 2YMLA 3ESRA 3QUBA 3I76A 2D2VA 4UU0A 2GHTA 4MUMA 2ZBGA 3SLRA 2CFTA 1RKVA 2AGVA 3ZVLA 2EAUA 5AI4A 3L8HA 4ZEVA 5AK3A 4YH1A 2ODAA 1J97A 2YJ5A 2CN1A 1L8OA 4HGPA 3L0YA 4UW9A 4CF3A 3M1YA 4QJBA 3A1DA 1SWWA 4GIBA 1RLMA 5AKZA 4GXTA 1SWVA 5AKYA 3OPXA 5AVQA 1ZRNA 1RLTA 3L8FA 2C8KA 4CNQA 5ALSA 3ZWKA 2WF6A 2W4MA 5A3RA 5FP0A 1RC8A 1ZJJA 4UAVA 2ZG6A 1X42A 1O03A 3HYCA 5AW1A 2YY6A 5AKKA 5AHXA 2RB5A 3L1UA 2P69A 3U7EB 3WKAA 3PCTA 4F71A 5IT4A 2B0CA 2FI1A 3A1CA 1RLOA 4EZEA 3OCYA 1KYTA 4O8CA 2Q4RA 2JARA 1J8DA 4KYTA 4UMFA 5ALPA 3QU5A 4BX3A 3WKBA 3FVVA 4UMDA 3OCUA 4NAVA 2I34A 2Q5EA 3E58A 3WK5A 1U02A 3AR9A 3ZX4A 3NALA 4L57A 2FPRA 4B6JA 4BEVA 4UMEA 3ZUPA 1T9ZA 2X4DA 2WF5A 3BA6A 2O9JA 3AR3A 2AUTA 3NASA 5IT0A 3ZVNA 2FEAA 3SD7A 3QGMA 2JAUA 3IJ5A 2QLTA 2BDUA 5AW2A 3WK7A 1NRWA 5AK6A
chains in the Genus database with same CATH superfamily
3MFQA 3V8VA 3N1UA 2ZT6A 1SGGA 3LYSA 5CBPB 3ET5A 1EGHA 2AOWA 4PZPA 1CY4A 2JR5A 5JZMA 2HYDA 4DQXA 3CUWA 4EENA 7ICPA 1JG3A 2Z6QA 3UKJA 3C7AA 1R9GA 2B92A 3IOCA 2PUWA 3MWYW 5JYBA 1QE0A 4JVSB 3TQRA 1AS2A 3WGQA 4ED9A 2F77X 5SYAA 2HV9A 2ZQYA 2C2OA 1Z16A 3ZWMA 3MMZA 421PA 2I9KA 4WDRA 3BXPA 3UK6A 2BBTA 2WU8A 3JYOA 4MI9A 4YQZA 5LQSA 3M49A 2Q6KA 4J07A 4TN5A 4DL9A 2IS4A 3N86A 3I9MA 1V47A 1Q50A 1OWPA 2J3DA 1SXDA 1X9IA 1JEDA 1OLUB 1W5TA 3I9V1 1Q16A 1YA6A 4EAAA 2JIRA 1KNXA 3SEAA 3FUCA 4P3YA 2HBQA 1JB9A 4F8RA 3GCGA 5B57C 4I1IA 4L8WB 5AW3A 1M9NA 4OD0A 2V9PA 1YL6A 4O6VA 2HSEA 5JSYA 1Z0ZA 1DEAA 3KZVA 4NJOA 5CVVA 5JFOA 3VKUA 1F20A 2JLBA 3VYSB 4ND2A 4Y6PA 4TXNA 2JKVA 2DWPA 4H0NA 1K5DA 3TZKA 2B0JA 1AKQA 3DE5X 4Q4AA 5IZ4A 2KQUA 2WPNA 1Z15A 5U4QA 3ISDA 4RAOA 5JVDA 3SQDA 4CDMA 3FPGA 3TG8A 4QZ9A 1Z2NX 2YFHA 1Z6QA 1AKWA 1RACA 2PS1A 3LCJA 4S04A 3X1ZA 3QF4A 2ZXIA 3HV0A 2D1SA 4IDNA 4IH4A 2XF8A 2GEJA 5KFTA 2C5BA 4LXQA 4AULA 4X85A 2L69A 1JFFA 5C4IA 4RK5A 4RTNA 1GG9A 1HT0A 1QO0A 3KO8A 5IKEA 1N2GA 1KQGA 4QTXA 2EIXA 4ROTA 1BW9B 3JV7A 5ICGA 2ZOSA 4QG7A 4KX3A 1AJEA 1T8PA 3EIQA 2YJZA 4OIFA 4QREA 3TRHA 4KHPB 4HEQA 3MGHA 3NUGA 2JGRA 5GONB 3ZHUA 2W2KA 1ZD2P 3H9EO 4C1NA 1AQYA 4M1QA 1GITA 4B7AA 2QF7A 3G88A 4Q01A 5BV7A 4M7PA 2RLTA 3B6KA 1GQOA 2Y1DA 4Y6LA 3R40A 3FYTA 4PHAA 4NWIA 5DGTA 1A9ZA 1U0EA 4MZXA 3PR4A 4BJQA 4QEZA 4GC7A 4NLKA 1ZIPA 2CVFA 2I6UA 2IEAA 2XKBA 4EZ6A 3T06B 2EFCB 4BNIA 2BKEA 1HE8B 5HJEA 1A5SB 5KSWB 2V98A 2CUTA 2ZYWX 1K0UA 1VFPA 3ULKA 2H48A 4DB4A 1B7GO 2OVBA 4DOCA 1HFEL 4KVFA 2VPYA 5LBTA 1GGEA 1Z0SA 3HWX1 1ZWKA 3H1PA 2B99A 2CYCA 1TW2A 5DB4A 3LQYA 2OXFA 5J23A 4W5HA 1R6TA 3B3JA 3A1SA 1W87A 4QJBA 3ZDBA 4XA5A 4TT3D 4NCAA 3ZBTA 3EMBA 5JCZA 1ADYA 1V35A 2ZRCA 1EWTA 3K0EA 3GI1A 5CT5A 3Q5EA 4BV8A 1G21A 1UEXC 1UPXA 3MQ4A 2YWBA 3RT1A 3UNXA 1QHHB 1IG3A 3PUZA 4ZT2A 4QNNA 2COUA 4LVSA 4P4SB 1VCIA 1ORDA 3I37X 4I08A 2IIQA 2PZMA 3GEMA 4F4ZA 3LCMA 3LT0A 1L9KA 2YXLA 3F2IA 4JLVA 1QMGA 2C1XA 3KKEA 5DYIA 3PNVA 2D5AA 3IDOA 1X3SA 3S28A 5LKRA 1IOZA 2QLTA 2BT4A 2ZRHA 4P34A 3KHKA 3UMBA 4REOA 2VDKB 3CX4A 1ZK0A 2GASA 1NZFA 3MZ0A 1I3LA 4GX1A 3GDGA 5FUYA 3EXEB 5K3SA 1QIFA 1CEYA 1ZOSA 4TKVA 4B4WA 5CA0B 2IU0A 3ZLJA 3ZV7A 5FBHA 4KOAA 2IYPA 5AVKA 3HLYA 1SVLA 1W4CA 4QECA 3TTYA 4FMBB 3FPHA 2ACWA 3NRWA 5HTKA 5KSPA 2GXQA 5DTEA 4FFDA 2OE2A 1ABBA 3AHIA 4GOJA 1WB5A 4PHFA 3OCZA 3R20A 5THXA 3U7HB 4OK5A 1T9GR 2HQSA 3E9YA 4IDGA 3QIAA 2AZ4A 2AR0A 1E3TA 2Q2VA 3CLRC 2GTIA 1UODA 3DM5A 3N8DA 4X00A 1LBSA 3GT3A 2XVYA 3SHWA 4IS3A 3CGGA 3PXBA 3L1KA 4RVOA 4EY3A 3LP6A 3AU6A 2FE1A 4OB8A 4MV6A 1L5KA 1XD8A 4OSOA 1MF7A 2FMQA 3I72A 5ALRA 5ICSA 2OO3A 3LPMA 3WGYA 2NMVA 1RM5A 1KSPA 1S5LU 4W5JA 2XWBF 1P9WA 1V16B 3CVJA 3T52A 2CXOA 5A3SA 1CVIA 1U63A 2AJQA 3OCWA 2BUBA 3OE5A 3R3YA 3V9PA 1M6WA 1JJBA 2EYUA 3DKVA 4RKFA 5DM70 1KO4A 1MIHA 4MWDA 3T95A 3FRHA 2C61A 4KKXB 4YR2A 3JSXA 4C0WA 1BXZA 4TVBA 1WF3A 4JMLA 3O2NA 3TNFA 4B4VA 1YC5A 3SFVA 2M2IA 3P0RA 4PO1A 3EVNA 4GYKA 3W2EA 5C81A 3FPSA 3JY6A 3LLSA 3NONA 3A1UA 2XB4A 1X14A 2IIVA 2XSZD 2W7TA 5E1MA 5COAA 4BKRA 3M9LA 2FWPA 1KY5A 5IJ0B 1JWAB 5DOZA 4IRCA 4D0NA 3BT7A 3E35A 3KAPA 3KU1A 1HZZC 3K1JA 3PW0A 5GQSA 2VT6A 4RF2A 3CINA 3UA3A 7ICIA 2NV0A 2GAFA 5J1SB 1BN7A 1FS5A 1GPJA 2K8CB 1FRVA 1GYPA 3ZHBA 1Z4JA 4PR3A 4F2SA 3CEHA 5M34A 3SKVA 5BV2P 4WXEA 3QLVC 4KFUA 5GGYA 3VR4A 3FPEA 4OTZA 2DJIA 4EHHA 2O8EA 2BEUB 3QV1A 1U81A 5ECDA 4FW9A 5TJHA 3QKUA 2E2WA 3O4IA 3KHSA 1KZHA 3DFUA 3JRXA 1BXKA 3G89A 3BWVA 1G8HA 4I50A 2OA0A 5I7FA 1D0IA 3CF0A 1XKLA 4PYMA 4B9TA 3IILA 4CU2A 3EUAA 5IZCA 4GLBA 3AKDA 5K0TA 5IK2D 2CDBA 2I6FA 4YRDA 4N7JA 3GZNB 4IIYA 3A31A 4Y3UA 4P31A 2Q3CA 1RZRD 1JH8A 1XZNA 4FJ1A 2EW1A 3GG2A 1SQ5A 5ABPA 1PK1A 3KXKA 2B1RA 1IOLA 3EXIB 1FYVA 1A04A 3L43A 1CR1A 1Q0PA 1ZQRA 4R16A 3TDMA 3HO8A 4TTIA 1UCFA 3EGDB 2XD9A 1ZK4A 5EKUA 4IZ6A 4IRXA 1ZISA 1US8A 1JA0A 1OA1A 2B2NA 5HUHA 2GF0A 1E9CA 1DO8A 4R2IA 4FNOA 2LHTA 1BJRE 1PZXA 1D03A 4E5YA 1NKSA 2CFOA 2XUAA 2J85A 1Q7GA 3JQAD 1YU9A 4MUKA 1RI3A 3G49A 3CURA 4UB4A 4FLMA 1RQGA 5ENVA 4C4PA 2IYQA 1JLLB 1PFYA 2FZ4A 3MTDA 4HQ0A 1B0AA 5KVQA 4PINA 3DZGA 3R5SA 2A92A 4M37A 3P9XA 1I7PA 1G8KA 2WJAA 5GY7A 3KDAA 5JU6A 2NZUG 3MRSA 5AUQA 2E0IA 1H8HA 3DMDA 1WQ4A 4OYHA 4LTDA 4KLQA 1HKHA 4CQMA 1P45A 1TYZA 1UQRA 2TMDA 3KQWA 2Q2WA 4EH1A 3MWGA 3GEGA 1XSNA 5FTWA 2DWCA 1FXUA 3H9UA 2WG1A 4GWLA 4GWKA 5CG2A 1YVPA 3IB3A 4CWAA 4WWHA 2P2CA 2RGWA 2OL4A 3COSA 1CRXA 1BX3A 1THGA 2HWKA 4F4IA 4TQAA 3JAKA 2I33A 1KYXA 2YWGA 1N0HA 4BLTA 6Q21A 3HI4A 2AFVA 2FNAA 1O95A 4L4RA 2R8JA 1N8TA 1R0CA 2Z5GA 3FCEA 4MV4A 3M4YA 1E2PA 1AKVA 9ICXA 4F91B 4KNYA 3OQ1A 4ZYWA 1PF7E 4QTTB 3RIGA 4L4SA 1B4FA 4M9QA 1YB4A 4DPMA 4ZZ3A 4WZAA 4NICA 2PUHA 1ZSYA 1E3WA 2P3QA 1P7VA 1WEHA 2NTJA 4V1CA 4B6RA 4AD8A 3NV7A 2V4UA 4MSUA 4UB8U 5CP8A 2QZ9A 1UEJA 4PHTA 2I03A 5I48A 1M2OB 2X8WA 4L27A 4P38A 4UARA 3OT1B 4E14A 1LRLA 4Z1MD 4L0CA 4COOA 4JCCA 4WN9A 1SZDA 2ZUSA 2XICA 4IY1A 3ROPA 5DK4A 4ARBA 1JN3A 3K70B 1ISMA 3ZZ0A 2UKDA 1R0RE 5F23A 1MKYA 2W54A 4UBBA 2LDBA 3IUBA 4E15A 4ZP1A 2C4KA 1NZJA 1PR1A 5JS7A 3T5JA 1YDGA 3FCCA 2H4HA 3EH1A 1OKKA 4ECYA 2QVZX 1QIHA 3QE0A 4ZALA 5JY6A 1KY2A 5L4SA 5KFHA 2QKQA 2HA3A 4JL8A 1M0EA 1O1YA 1N9GB 1EWKA 4IGFA 2JJ8A 2BFFB 2CSUA 4UM9D 4R2LA 2JFBA 2F4NA 2IA5A 2QRVB 5LJIA 1CHNA 1U98A 1PZMA 3NEJA 2AN1A 2YJ6A 3VDRA 4BNJA 4QLOA 4KLMA 1NBAA 1PK7A 4NVRA 4DJEC 1RE0A 2ZBQA 1M6HA 3NRCA 1W88A 2Y1CA 2DT8A 3E9QA 2JGFA 4C2UA 2P79A 5AUNB 2HSJA 3C15C 3U80A 3NC1C 3H2HA 3RTGA 1IY9A 3NPMA 3QKSB 5D5QA 2ICAA 4D4HA 2GBGA 4KLDA 1I5RA 4HAUA 2D2XA 2I6XA 2E55A 3KSZO 4DQVA 2P0AA 2RD2A 4B5LA 1YTUA 2C82A 5KVCA 2HHCA 4RTQA 1QIJA 1U2EA 2VDOB 3C29A 4UFPA 5TQ2B 2FPSA 4POAA 2W9CA 2A0YA 2FPXA 4FZ3A 2VTBA 2OG1A 3DFZA 3MBIA 5CDHA 1HDOA 4GBGA 2HCBA 4OBXA 3H05A 1CC1S 3WRVA 4QWCA 3T79A 1Q6ZA 3PFFA 2FSVC 1C9JA 4JV2A 1JIIA 4HWKA 3AUTA 1DEHA 1X0XA 3FFXA 4CBVA 4OMFG 1SCUA 2BR5A 2AMVA 1YB1A 2O0HA 3BJMA 5CT6A 2GRUA 4M3NA 4EF5A 2WMOB 1HETA 1IY8A 5L45A 4MJ7A 1LLUA 3NCTA 4GI3A 4DWJA 5E6RA 1CS0A 3NKFA 2IV7A 4NYJR 1DAIA 1XU7A 4KDCA 3VU9B 4O4JF 1HL3A 1KNQA 1W75A 2QX7A 4NJMA 4P81A 1U49A 3BJRA 1SR8A 2VDJA 3C85A 1CU1A 4HG2A 4O3QA 1PJ8A 3DBRA 2J0UA 4HUQB 4FZVA 4OREX 5K0LA 1S7GA 2XXJA 3EPLA 1F2UA 5KG4A 1IFXA 2FWBA 1DBRA 3CCCA 3I53A 1L9XA 3GGPA 4OI0A 1DDGA 3K31A 2V6IA 2QARB 1J8VA 1POWA 3OCJA 1H2ZA 2CF6A 2ECKA 4ZT4A 3CF2A 2NQ2C 1N56A 4BE7B 2N1RA 5JMPA 4DR4B 2BP7A 1GSIA 3ZHTA 1KO5A 5E4FA 3EXG1 4WKNA 3ELBA 5KFCA 3T3NA 3ZUPA 4GR9A 4BX8A 1DQNA 4MUAA 3DCNA 1CQWA 1M2GA 2OEPA 2VZLA 3LKBA 1SU8A 1I0ZA 4F6RA 3SYLA 2UXDB 3FHJA 1TK0A 1SURA 3N8KA 1AQ6A 1YZVA 2PUBA 4LXYA 1TEVA 1MAVA 2Z08A 1Y7IA 3D8BA 1H2WA 1E9DA 1NBME 5K3FB 4RC9A 4M99A 4JS0A 3DKKA 4TQGA 4EAQA 2HRZA 3KE9A 1XV5A 2FN7A 1B0UA 1ZI8A 4EGJA 1XN4A 4KH1A 3U3KA 3GLFE 5JCOA 1GCUA 5HQ3A 2O1SA 3WP1B 3UXNA 3R6GA 1LK5A 1WCYA 4UBIA 2WJPA 2XNCA 1M1NA 1HE1C 1LCIA 1A7JA 4KLEA 1YVRA 2QRJA 2FLNA 3MJTA 5CITA 3WK4A 1GDHA 2CBXA 4JUCA 4JJ7A 2C0CA 4C4YA 4G07A 2WTAA 1TZBA 1JEAA 4JROA 4QYIB 5BMVA 1RYUA 1OZHA 3ETRA 4A26A 1QOPB 4F46A 5FOUA 2NV6A 4F4HA 3ILHA 1UC9A 4PQRA 3KD3A 2XT6A 3K2EA 4TT3A 1G55A 4QFCA 2RKWA 2PRYA 2NZYA 8ICNA 2AG0A 4UOQA 3D4IA 1P8JA 3R8FA 4HRAA 2C42A 4LNUA 2FEWB 3FSGA 1JZSA 4WT7A 4GMFA 2H1IA 1NSFA 1Y1SA 4HH1A 4OGLA 2QB1A 2OXRA 2ZRKA 2V0GA 3M4JA 1P3DA 1KMQA 4CTJA 1AN9A 2P27A 2OYCA 4BNUA 2Y76A 1IMOA 1MORA 3O4VA 4X6XA 2ATXA 5HKOA 1SH7A 4HJRA 4WTOA 5K0EA 1P4HA 4QHSA 4QPNA 2Z2ZA 4QPJC 3OKFA 4KUEA 4C4XA 3GFGA 2GWSA 2DETA 4HQRA 5KS2A 3FROA 1KIFA 4WRRA 2WVAA 5L4NA 2UZ1A 1DHRA 1NF3A 3KQTA 2JI6A 1LJLA 5LCXA 5G1OA 2AC4A 4DDMA 4GXJA 5KX5F 3Q3VA 3KQYA 1UPCA 2BGRA 1YHNA 2FEOA 4KBGA 2P9CA 4FGJA 4Y2GA 1WHSB 1ZUNA 3AFNA 3VC1A 4QIWC 1MX9A 1WR8A 4WXHA 3AIIA 1WZCA 1AXEA 2YIMA 1WU8A 4DLAA 4M76B 3QEJA 4IQVA 5EMLA 3HKZF 4RDHA 4AY2A 3DMRA 1C1XA 2ZUTA 4HDNB 1Y6FA 3GFRA 4KLFA 2QGFA 5HHTA 3NEPX 3ZDAA 2CCGA 2F9MA 1M6YA 1ZKDA 1XQ1A 3WRWA 3M8RA 4TMXA 2VHJA 2WF8A 3RAQA 3RKUA 5EY5B 3GZTB 5CLJA 2P75A 4LISA 4G5QA 5FLXA 2AGOA 2LWIA 3U7QB 1UXGA 3ECSA 3TJZA 2X58A 3KQNA 3IAS1 3K0CA 5IZCC 3KTDA 3SR0A 3IVAA 2F67A 4MQFA 3D6MA 4EKDA 5EUQB 4ZEVA 3A1TA 4XQ8A 1ZXIA 3T1QA 2VPWA 3CVWA 1NYRA 3HR7A 4HZIA 1H38A 4MK4A 3LUHA 3PD1A 3PJFA 4XIGS 2FLWA 2XMGA 4KLIA 3A1CA 5L1JA 2YVUA 3A04A 3GFVA 2VJMA 4LOIA 3HR8A 5DK6A 1GCAA 5D1NA 1AUVA 4M49A 1E1LA 4NAVA 5LMNB 4JUFA 1I36A 1D0SA 1IXRA 2XSZA 1VMKA 3TECE 4PO8A 5C8XA 1HFJA 4O3RA 1LEHA 2QX6A 5D8DA 5FTMA 5K4AA 3IBCA 2PX4A 2GO1A 4HJXA 3IE2A 1S9FA 4A0GA 1J9ZA 4AWBA 2VUUA 3CKLA 1DSSG 4TT8A 3GIJA 1G19A 2F3NA 2XGQA 4ERXA 5TPZD 4DRXB 2E1PA 1OFGA 4DDTA 3SPXA 4L6AA 3GHHA 3JAWA 5IPFA 1V7ZA 3DEJA 2JD1A 3F8SA 2BE7A 4UTXA 4MPTA 5KFGA 3PW5A 5TEWA 1NHWA 5EMJA 3DL2A 2VPPA 4J91A 4MRSA 1J2EA 4D8XA 3HB4X 2HL6A 3A05A 1NW3A 2YZMA 1MAWA 2GZ2A 1AHPA 4U6QA 3LQ4A 4EO7A 4EMSA 5EG5A 4IJQA 3QY0A 3S6JA 1NW5A 4B33A 2MSDB 4HBGA 3QI7A 4RCVA 3W6UA 4UUBA 3QE2A 1OXTA 1Y1LA 2Q1WA 1E9AA 4NBVA 5EP4A 4JELA 4ZXPA 1I7LA 5TVKA 2WE7A 4KH0A 3OVMA 4OJOA 5FFNA 3SJZA 3GZFA 2UZ4A 4Q21A 3STUA 3ZDEA 5BUCA 4YJFB 1CQJA 2XLBA 3SZGA 3VV2A 4BFZA 1QFSA 2KVSA 3IKMB 1D1PA 2OOKA 3Q7PA 5ARCA 1U99A 4D9HA 2PT5A 4BQNA 1E8MA 1HT2E 1FTGA 4JLMA 3R7FA 3JQAA 5ALWA 4OM7A 1O97C 2H4ZA 4PZUA 5C35A 1URPA 2I4OA 1OASA 3JQ8B 3MS7A 4MINA 4PZNA 1SCIA 2CXXA 4A73A 1FJXA 2O2HA 1JL3A 2VDNB 1JSRA 3VHLB 1E3JA 2VT2A 3DAOA 5EJ4A 1UH5A 1KPGA 3AEQA 3AVOA 2KD1A 4RFVA 2A1TR 4BOYA 1BHSA 3Q12A 3C6YA 5AQ1A 3X1JA 2R62A 2Q3DA 4Q15A 3L7MA 3THYB 5ITZB 3SM3A 2B35A 1XJ0A 2O23A 3HDHA 3U81A 1DADA 5D6OA 4M0FA 3UTCA 1PP4A 2QGZA 5KWJA 2AG6A 3IQWA 2ASLA 3RGWS 3RJZA 2Z5LA 5J0SA 4RZQA 4CODB 4BBPA 4HMOA 2REQB 2PKWA 2EH9A 1CS4C 2ZSEA 1VJ5A 1YR7A 1W52X 2I6QA 4NY8A 3FDJA 3D3JA 1W0KA 5J0OA 1GPBA 4E5PA 1TM1E 2IBMA 5IAOA 2J7KA 3AWDA 1XVTA 1U0NA 3TZLA 1NOJA 4Z4FA 1YZUA 2K8AA 3O0DA 5KC9A 1EJBA 1U0RA 2YWRA 1UBGA 4EARA 5KYYA 1WXFA 4CG0A 3HM9A 4YP3A 1TO2E 1UC8A 4EY8A 1E6UA 4P22A 1KH1A 1L5NA 4LFAB 2QN1A 4E2YA 2QW8A 5F9LA 1HT1E 3H1EA 5DN9A 4LW8A 3IL2A 1K2WA 3SAJA 2ZXFA 1F5SA 1G5IA 4ENRA 4HSEA 2OWDA 2BGTA 3AL2A 3PGXA 4WBNA 4ZI7A 1PEDA 1DINA 2R9VA 4QU0A 4ALLA 5K6TA 2M6KA 4N5MA 1SC3A 4UATA 3SYZA 1NHGA 4WZBB 3D3WB 3NHBA 2K7FA 4R98A 5A06A 3BQTA 3MT8A 1JHZA 4YMHA 4UU0A 3RTBA 3FF4A 4U6PA 4C7ZA 1MQ2A 3GEHA 1EEHA 5CNMA 1K1SA 1J1ZA 3IUJA 1KY3A 3ZY2A 3NWEA 4FQ5A 4DYHA 3HUEA 2BHRA 2O2SA 4E5UA 5A5EA 5E4TA 3BSFA 3GELA 4PC1A 3ASUA 1ADFA 2EKDA 1R1DA 5FNVF 2XEXA 2YCLA 4N1AA 5KFRA 4GPEA 3F5EA 1TO1E 4NLCA 1XTQA 5DE3A 3KXDA 4B6GA 4LZJA 2OCYC 1XWWA 4HADA 3FNRA 4I1YA 3HRIA 1Y8QA 2NYUA 2FLPA 3AR3A 3GRVA 1U9IC 3ADOA 3IEUA 2OCXA 4IH9A 1SOWA 1UQUA 2WJJA 3IUYA 3FJOA 2K2WA 3MWDB 4C4TA 1T6BY 2VA9A 3AETB 3DAYA 3SXUB 4RGBA 2MTBA 5JLAA 4EF6A 1M1YE 2QYSA 2OV4A 4GXKA 1JEQB 3VH1A 3NRBA 4BS9A 4CCSA 3VPBA 1R4NA 4Y1RB 1CF9A 2FQXA 4BMVA 2ZJ6A 2YYZA 4DJAA 1GXSB 3ESYA 1RQRA 3S1AB 4TYYA 1XBTA 1FW8A 3TRKA 4AECA 1C30B 4C0SA 4IH1A 2E6UX 3K0AA 2AVNA 3ROMA 1UFVA 2I2FA 3NTRA 1TVCA 2WJYA 1D09A 1Z37A 1DEOA 1QHFA 4MPRA 3S2YA 2ZSIA 2AKYA 5COBA 4N5NA 2A58A 3H2YA 5TV2A 3VI3B 4TMVA 4GXRA 1RZVA 3P9CA 1RDFA 4QBFA 3CMMA 4PY2A 3IDSA 1EXMA 2OAEA 5TY0A 2ZT7A 4L5YA 1NVTA 5TQJA 3OQPA 2IHJA 3NWPA 4PL1A 1JHUA 3IBGA 3R3SA 3G7UA 4MR9B 4Y2VA 4WA8A 3D2QA 4I5GA 3F53A 3UT0A 3BD6A 2AN9A 4DWOA 3RWOA 2FGKA 2NSYA 3V6MA 3ILYA 4NI5A 1G20A 4ZPXA 4LVOA 3G2NA 2WSBA 2V3VA 3C45A 4ZQBA 3HCNA 4AG6A 5J58A 1DXOA 1HYEA 2WF7A 4DCVA 2FPUA 3MCTA 3ICXA 1DO0A 3I52A 1OD6A 2O1EA 4EZ9A 3KT3A 4R9NA 5FOSA 1GQSA 4MARA 5HHHA 3EULA 1X9SA 1TIKA 1V6AA 3VVCA 3ETNA 4X6YA 5DTIA 3CV3A 1CJCA 4Z49A 1RWWA 3RAGA 1BCRA 2V5UA 4P3XA 3KR9A 3EK2A 1NJ6A 1ZJWA 1F60A 4WINA 4XQCA 1FXWA 4NZOA 5F3WB 1DQZA 3L6OO 1VGVA 3ZLUA 3PSIA 3L8ZA 4IIJF 3DBLB 4AJOA 3WB9A 3VPSA 4UEKA 3H0KA 2P41A 3M6WA 4TURA 5CK4A 3RFAA 1GTL1 2GEUA 3TJMA 1HUZA 9ICHA 1OX4A 4ED0A 2XADA 1EYZA 3W2HA 1GEEA 3B7WA 4E7PA 4U2FA 2ZI7A 4WA7A 4N3BA 3P9RA 3SAHA 3M89A 2H2GA 1OZGA 3M2PA 4EG5A 3ACDA 1NVVQ 2JAOA 1C0PA 2ZBUA 2YZGA 2OAGA 4O1MA 2XUGA 3HCWA 1PJCA 3BDVA 2C20A 3W5SA 7ICRA 2BKLA 3VHQA 2A19A 1GV1A 2VJNA 3O8QA 4BN5A 2PWZA 3GDOA 1SBIA 1J9EA 5E0KB 1MB4A 4BDPA 4DGQA 1ZR2A 5TMDA 1DCFA 4RHXA 2ET6A 1ZQBA 1LW7A 2VP9A 4C8NA 3W5VA 4D9JA 4GNKA 3HBLA 2W8ZA 2Q1XA 3PPIA 2WAQF 1YO6A 4RMJA 4MHVA 4AWXA 2FHSA 3FTDA 5G0WA 3CVYA 5SICE 1L3UA 1C29B 5IC5A 4QVIA 2CLOB 3RC9A 2IEBA 1T4DA 2B36A 4DLNA 2YJ5A 1C9KA 4UW9A 4UJ5A 1TFRA 4LSWA 1UFRA 4D9MA 2QE6A 5J43A 3R7DA 4JODA 2EZZA 3FFAA 4K9RA 3DQPA 2PCLA 1A76A 2JARA 4V0MA 1DL5A 2C3OA 3K0CC 1E8NA 1QHIA 2P9QA 4RD2A 2IE0A 3VNUA 1G7CA 8ICSA 3FPLA 1V71A 4BEVA 3TTXA 3Q3CA 3IQXA 3BD9A 3W78A 4C3ZA 1RKBA 3HWWA 3DXXA 4A15A 3TFOA 1U94A 2ZRFA 3CLUD 1S77D 2W00A 1J09A 4DQPA 3C7CB 5E3JA 4JVLA 3KYDB 1KDYA 3AY0A 6ABPA 3SMQA 4HAVA 1WULS 1GTJ1 2B8JA 1V2HE 3HJRA 4OJKA 4TZTA 3DDNA 1KQNA 3UWOA 2V9WA 1IXRC 4GP9A 1M3SA 2B9VA 5H8WA 4YDSA 3JQ7B 2DFDA 3L0CA 1YBFA 1NXTA 1LX7A 5AIAA 1GGJA 1KBOA 2XNSA 2W83A 2Y9UA 1MZVA 1JDJA 1EUQA 2NUTB 4FZRA 1M2KA 3DPUA 1U0JA 2RGAA 1SVMA 2Z5VA 3K4HA 3MWJA 4IF6A 2NPOA 3C21A 2BEWA 1SA0A 2CNDA 4AM8A 1UBNA 2QMEA 1IULA 5J2AA 5JTIA 2GK4A 2ZI9A 4QJFB 1H8HD 2XI9A 5E6UB 3G8DA 3V4FA 2PEYA 4CQMD 1PZEA 4Y9UA 5BOLA 2ID4A 4IWXA 1MENA 5KJFA 4F1KA 1RBZA 2DKNA 1NX6A 3LPAA 3R9KA 1T2DA 3RVBA 3DMPA 5ADHA 2BJVA 3V7LA 1GNTA 1I4EB 3D8HA 3RDPA 4WBXC 3C41J 1RZ3A 4I9FA 2ZK7A 4UEQA 1LPSA 3QPCA 2Z6AA 2FRVA 3VJLA 1AB6A 4JL6A 3GMIA 1V45E 3QOXA 4TL6A 4XYEA 1B23P 5LP6F 2C4VA 4XM0A 4X41A 1JROA 2LCQA 1U7ZA 3Q0TA 1DJOA 1AGNA 1YHZA 1LDEA 1Y6RA 3LBHA 1TK5A 1ZQMA 2G6BA 2R6HA 4RM3A 1GTMA 1WPQA 3BGSA 1QRAA 3HBJA 2C04A 1Q6YA 1XZKA 4QPZA 2DECA 1KYYA 1QGDA 5D4BA 2FKAA 1U2GC 4JNCA 5G4KA 3KKAC 4PLWA 3NVAA 5TPZA 4Y2SA 1HUOA 1Q17A 3TZCA 1OIWA 3QU9A 2BM0A 2HF2A 1H5UA 2X5NA 5AESA 1E3LA 3C1AA 4PLFA 1L5GB 1BE8A 4LSMA 5T14A 2I4RA 3F5DA 1E58A 3LQQA 1HOXA 1IG0A 1L7MA 4NH0A 1D1SA 4MYCA 1YI8A 4EM6A 3JQRA 5CH3A 2ZAMA 1TQ2A 4UB3A 1A9SA 3LUFA 4RMIA 3FH0A 3T5KA 5ULLA 1F17A 4K9DA 3RW9A 1F8YA 5J2TF 1GRVA 3RTAA 4UTVA 2WWHA 2ECQA 1BMTA 3IMEA 3OTWA 4ELVA 1DAFA 1ZINA 3JPYA 4DLEA 3Q6MA 4WOBA 4EB3A 4FSXA 4F38A 4YLYA 4KE6A 4YP5A 3PB3A 1A7KA 4O25A 3H42B 3CCFA 4CEIB 4ENUA 2V54A 5H70A 3F3KA 3HXMA 2FGJA 3O31A 4DLPA 3E53A 3ECCA 2HHAA 1QKJA 2PKXA 3A2MA 3KKMA 4AMZA 5IANA 2P9JA 3KZXA 1HDCA 2VUIB 1ZW6A 3UVEA 3R1IA 2JGNA 2GA9A 1Q19A 2ADOA 3V9AA 2ZSAA 2KP7A 2Q0HA 4FBUA 5EGNA 4QSMA 4ZAYA 3C8DA 2GCOA 6REQB 2DPIA 3IOYA 7ICEA 5FYDA 2JVIA 4PPYA 5EJ2A 4EPVA 3RS2A 3NT4A 1H3NA 1HOTA 4Z2YA 4DLKA 2AKAB 1A9TA 3ZDZB 3NBAA 5E95A 1KW4A 1TMGE 1DIBA 1A98A 4YR3A 1O8CA 2QBYB 3F2CA 1H2RS 1GFZA 2VAVA 2GCNA 2CSXA 2ZG6A 3U4MA 5A0VA 2PBZA 1R4MB 3U31A 1R3UA 3JYNA 3RRGA 1ND5A 2ZI5A 4AG5A 2DYKA 4J0HA 3R3HA 2MHCA 1K9VF 5L7WA 3GJ3A 1BE6A 3H5RA 4C9BA 1J56A 1FUIA 4NDZA 4DQ0A 3N97B 2YKGA 3E0QA 2WWRA 2F3UA 1MOSA 3TLGA 3IYLW 5F64A 1KVTA 3FRIA 8AT1A 3M4ZA 3IODA 4BO4A 4YMNA 4BB0A 2C3PA 5J4YA 3K9WA 2CZQA 3N59A 5J2UA 5LR6A 4BN4A 2GLUA 1JR6A 1VI6A 5FBRB 3CYFA 2WKWA 3Q0IA 1QFYA 2HAEA 2OZVA 2OECA 2PKRA 3C3EA 5J2BA 2WYUA 1Q0TA 4FDAA 3EFOB 3PQ7A 1N6LA 3BDIA 2AK3A 4O9MA 4M1MA 3OPYI 4GYYA 2WYOA 3ZCTA 4O4JB 5DBCA 1U8FO 1YB7A 2LR0A 4RV5A 2Y4OA 3SG0A 4KRGA 5B7QA 4MPPA 1FP7A 1RAFA 1HX7A 4DMMA 1DUVG 5EYPA 4WGFA 3CLSD 3OJWA 1EIWA 2BI4A 4KN7A 5J4KA 4UHDA 1SPBS 3O3MB 1UJBA 5SZHB 4U39A 3L0PA 1NFFA 3UT6A 4EA6A 3IVXA 1JMKC 5CDGA 1WP9A 4D3XA 1SD5A 2HDNB 4YAIA 1GD1O 2RCNA 1T8RA 1S0UA 5KFOA 2QV7A 1P9LA 4NQZA 3NHYA 4I2GA 1TECE 3IDFA 5JQWA 2WQ6A 1QQ5A 3PE4A 4IOMA 1U8ZA 4M54A 4RZXA 3JTMA 2ONZA 1KU6A 2NO6A 2DMRA 4K6KA 4RJ2A 4NHOA 1TVKA 3TQOA 3UOGA 5CXUA 4I1PA 1QIEA 4EJSB 3QVGB 2PE5A 1L1QA 3O8CA 3GCXA 4ZQHA 3PDUA 3WQSB 1M2EA 4WDQA 3X2EA 1VGQA 5HP4A 2FZ5A 1YA8A 3ISTA 4N82A 3BE8A 4HZUA 1ZA1A 3ZCPA 2V4ZA 3HB9A 4TM8A 5IKOA 5EC8A 4CETA 3ND9A 4QFMA 5JOQA 4Y6OA 1MSWD 3IEXA 2E18A 1QH1A 1YOVB 2IXAA 1WZ2A 3DOEA 3AESB 4H4CA 2W11A 1YRWA 2Q6IA 4XB1A 1YE8A 3BXZA 2JLRA 3TRDA 2GHIA 4HXYA 3KDPA 1SO8A 2V4MA 3KP1A 3C5VA 4URXR 2VL7A 3AHGA 3ZWBA 1B73A 1D8TA 5ALXA 4HKTA 4RMHA 4TTJA 4Z9XA 2W2NA 4GKKB 1ESEA 3C6XA 3FSGD 1FCJA 1JA9A 4WUTA 2JFZA 3SBOA 2ASDA 4U7JA 4ARAA 1JKFA 3G0BA 4A2QA 2QKYA 1KSJA 4NXMB 1FW6A 2E8NA 3N70A 1U1FA 1AKEA 4N3NA 4XX0B 2YDYA 4G5XA 3TAXA 1W48A 2NZVG 4BUGA 5EXEA 5JPIA 1BO6A 4QQ8A 1NE7A 4R0NA 4MS4B 4DMCA 4CKXA 4KMOB 1Z5GA 3PPXA 3GD5A 3NYRA 3ONWA 4QC2A 2J3IA 1DPFA 5AO9A 4X3CA 3IELA 1C8LA 2FMIA 1Z4KA 4AT1A 1W94A 2JK1A 3WFZA 2F76X 1BPBA 1BN6A 1EB8A 1X70A 1JEOA 2WA1A 3S2IA 2OAQ1 1XTRA 3WGUA 1DAEA 2UZIR 2VHVA 1N48A 2AHRA 3PC6A 1IUOA 4F5OA 3KOUA 2VJ4A 2WUVA 4UDOA 3B1FA 4NK4A 4FZLA 4FDTA 3E7WA 3Q6NA 3U0BA 2KB0A 1F1JA 4YMGA 4P33A 3OE1A 1SKUA 3VO9A 2A30A 2H4WA 1QP7A 1AMNA 1NKVA 1IXYA 2QRHA 3SN6A 2Y6UA 5CGZA 3Q0EA 1ZMXA 4UDYX 3RS9A 3GGJA 3ZQ4A 2EWVA 4B0OA 3LGAA 1P2FA 5JD4A 4CLOA 5KX5B 1BQEA 2O3UA 1KR2A 8LDHA 3L6RA 4EJFA 3SX4A 2LV8A 3BL5A 4NFSA 3K96A 1WMBA 4GEGA 2Q6TA 3VNVA 3OU7A 3ZXIA 1RLJA 2UUBB 5CFPA 4GOXA 2TRSB 3H5IA 4N40A 3FVVA 1SUFA 1CY0A 4X8OA 2FSHA 1I9CA 5DBAA 1X7YA 1S2NA 4R1NA 2NZ8A 4NE7A 4YMVA 2IMWP 3GJXC 3EOZA 4LHVA 1JDBC 3CNOA 2BJHA 4J0QA 3WK7A 1NRWA 3PK0A 3OJUA 4TKUA 3GUVA 4HDQB 2X9NA 4IHJA 4GZMA 4O0MA 4N9WA 3Q85A 2XEDA 2CNKA 1Q1ZA 3SKXA 2CCJA 4XARA 4HQFA 4C7OB 3I45A 3E4DA 3PQDA 5LJLA 3Q8PB 1PE0A 2HTEA 4QAJA 4XFKA 2ZAOA 1HF3A 2IKSA 1B00A 2FX2A 1EJ2A 3ONFA 3CPHA 1Z35A 1EWRA 3O8DA 1LFDB 1OJLA 2Z2YA 2ILTA 1RBQA 1OPRA 1EFDN 3FB1A 3H83A 1Z7YA 2W7PA 1KJYA 2YQ5A 1LSOA 1PZGA 1E2UA 2FPPA 4YXJA 4D92A 4G86A 3RUFA 5J1TB 1EX1A 4USAA 1DGQA 3E8MA 5H02A 1KXJA 1OXKB 4EFMA 4FB4A 4R2HA 5CYOA 1SHJA 3KUKA 4MDFA 1QPGA 3DBIA 2ZIUB 1J6UA 4FYHA 4G84A 3H3FA 3RS5A 3QJGA 4PZOA 4PHEA 1FFXA 2EG5A 1IZ9A 1W2WB 3WIOA 3CN7A 5L1IA 4I9UA 2G09A 2IYFA 2QD3A 1YS4A 2MSNA 1ZN8A 4B45A 1U6IA 3NOQA 4R1MA 4HB2A 1BNCA 2LE0A 1T2VA 2RHMA 2WZDA 3L1JA 2AG5A 1FF9A 3DB2A 4CR6A 3RR2A 3PEEA 2HO4A 2QVLA 4G5HA 4NZNA 4EBBA 3ZHXA 2P6RA 3O73A 1E5XA 1V41E 2DSTA 3IAAA 1AMUA 1ENOA 2IHZA 2ABWA 4HDSA 3C3AA 4MVJD 1UOEA 3SX0A 1TCCA 3P8ZA 4ER6A 1CUBA 5BR1A 2R6R1 2CT8A 2O4CA 3UC5A 9ICCA 2PXCA 3Q40A 3PFCA 2DOKA 3M6MD 5BN5B 5B4TA 4QZAA 1W34A 3F6YA 1PQ4A 2C1EA 4XPIA 3F71A 3N2EA 4S1WA 2EBWA 3Q5GA 4COKA 4OQXA 1ML3A 4D4GA 4M8NE 4OB7A 3T94A 4M47A 4QWBA 4ESEA 4HRVA 3PVZA 4M60A 2EW2A 4HN9A 4JBGA 2AOVA 1W9HA 1XTKA 3I8SA 2IV2X 3K09C 4RTRA 3A3PA 3HCFA 3RUEA 3Q8WA 1P80A 1LK7A 1QYVA 3QVOA 3CM0A 5BV8A 2QJRA 4YCJA 1F2DA 4QQFA 3RRMA 2QI9C 5LMCA 5DI9A 1BNOA 4K9QA 4OLAA 2QZZA 4KR2A 2R86A 4NBWA 3I32A 4Y8VA 1JR4A 2YXDA 4QZCA 1M2VA 4J9SA 1GPH1 1RP7A 1DXHA 1X2EA 2WM2A 4OA5A 4LC9A 3GJ5A 1CYDA 4J7XA 4B71A 2Z2IA 4TM7A 2VR1A 1SOUA 1DBQA 4S1OA 4RELA 1PJ2A 3GZJA 1W0KD 5LA6A 4D9EA 3IMGA 1WYGA 2PY6A 4D6YA 2FP3A 3HCOA 4P35A 3HYNA 4HWPA 1I2AA 3VC2A 3ECAA 5KNBH 1E3DA 4QDZA 4HFMA 2P62A 4Z7JA 3QNUA 2YWFA 3EEIA 1V8ZA 3LD9A 1XXHA 1DEKA 1TZJA 3TTUA 4LC0A 3ZD6A 3JD3A 3RU7A 4MLZA 2OYYA 3QA9A 3TSZA 4WUVA 3JWIA 2SECE 4HEJA 1KI6A 3OCYA 2CXQA 4ETIA 3ROEA 1PSDA 4RVNA 3FZGA 3EGEA 4DA6A 3TFSA 1GPUA 4US1R 1GJRA 1DC5A 2PKCA 2Y2UA 4LOJA 1WKBA 1E92A 1T1JA 3ZVNA 5DH9A 3PUKA 1FRNA 4QHTA 3LH5A 4CW7A 2ZUEA 2ZT5A 3CBGA 2VK8A 5F4ZA 1RHMA 1T5IA 4JVMA 4BFVA 1LH0A 4XVHA 4P83A 3M2TA 2CRXA 4UC0A 4H08A 7ICMA 4FYKA 3ENNA 2OORA 2W58A 3NHKA 3V1LA 1YUNA 1YVDA 2KN7A 1F8XA 3QELB 1HEYA 2H1SA 1W1WA 1QFZA 3CX6A 4YRLA 4DWIA 1RAIA 3C6KA 3RSSA 5JJBA 4D9IA 3S81A 1QLJA 1Z6YA 3TAHA 1G2QA 3UQ2A 3IAM1 3H8MA 2UAGA 3UAOA 2P91A 5CCXA 5ICCA 4GMXA 1K0FA 2IA6A 3MUEA 1ONSA 4KXMA 1RXIA 5IM5A 4M9SA 4EVRA 1OFIA 5KQSA 1ZETA 2E7ZA 2Q6VA 3L7CA 1TJYA 3W2TA 1JEYA 5KHOC 4HYTA 2WKRA 1NVMB 1KZ4A 5KNDD 1R2QA 3ADBA 1RW4A 1XRMA 4CF5A 2BFNA 1LB1B 4PYJA 5L51A 5FNVB 1NI5A 5KFIA 1KDZA 2G8NA 5F7ZA 3CZ9A 1PNOA 1IQUA 4ZVLA 3C74A 4UB1A 2QNRA 3QEAZ 4LMRA 1KKLA 1XF9A 5KT2A 3GD7A 4ISBA 2MOKA 7ICKA 4P82A 1DLIA 4P0PB 4UB6U 4UBOA 2QZPA 3Q7EA 1FIUA 4C7JA 1U7TA 1CZUA 3TRJA 4HNSA 2W5UA 1W85A 2Q0XA 2Q5CA 4BWVA 2QAJA 4AJKA 2FN3A 5F1PA 2G08A 5J2JA 4TXHA 5HRAA 2OQVA 5G0VA 4YIHA 5TF4A 3LBAA 1V4NA 2V1UA 3OD1A 2F8TA 1W73A 4JHLA 3VZSA 4RQ6A 3OT4A 1ZGHA 2J0EA 2HQOA 1K06A 4F3RA 2OTCA 3M9NB 3EIEA 5IDYA 4GZ3A 2YWJA 3KJIA 1XU9A 1FP4B 4OOEA 1E9SA 1ENYA 2PUDA 3H84A 2QYHA 5AKJA 4OYYA 2ODEA 3LRXA 2G70A 4G0YA 3FMPB 1T5OA 1UM9A 3B0YA 3MELA 2OCDA 3S99A 3F46A 1VL8A 3KXPA 3L07A 3J7TA 2FRXA 2Q29A 1H2YA 2BKXA 4LWOA 5I01A 2YWXA 1E3QA 1MLDA 3T5PA 2PD3A 1IN7A 1NONA 1SC4A 1C20A 3MTGA 4UNSA 4QBIA 1DIGA 3H6HA 1N5OX 4FQ8A 4GNRA 1E1YA 4UBJA 4RJJA 4BNVA 2C4WA 4URVR 4BUJA 1M8JA 4PWYA 4LS3A 1HPLA 5BVGA 1NNUA 3E9CA 1GPYA 1ZD3A 2X76A 2JDID 2RKOA 4J0KA 1CUXA 4QNMA 4KXUA 3F5QA 2A1UA 4UHJA 2WFMA 1MGOA 4MJ3A 1AZLA 3G0HA 1RR6A 3OE4A 1RYNA 2YHAA 1ILEA 2KLBA 1GNLA 3BL8A 3HY3A 3AJDA 4OHXA 4X44A 2EFGA 4HX9A 3M1YA 2BEJA 3ZK9A 3U4GA 3SS9X 5AVQA 1E94E 4IIJB 4NG5A 2AZTA 3QWFA 4MIKA 1OXXK 1E4OA 4CV0A 4PN3A 1T6ZA 3L79A 2EGUA 2XB2A 3K20A 1X86B 3RTDA 5EXTA 2J3QA 5BSWA 1M74A 3OLYA 1L3IA 4NYJQ 4QA9A 4ZAVA 4D4MA 1C1HA 2CY0A 3KQQA 1TUIA 3TQHA 7ICJA 4WE3A 4WCFA 3AUYA 4U2KA 2KHZA 3Q5DA 4RNCA 5IF3A 4E2WA 2HW8A 5MF6A 5EQFA 5HDQA 2GI4A 4N8DA 1KJJA 1WUDA 4L0MA 5JMTA 4ELTA 5J2DA 5G4LA 3BXEA 2INGX 2BFEA 4PSKA 4ERNA 4Y2RA 3KPVA 1JDZA 1GOTA 4I2EA 3N87A 4UMVA 1O9GA 1ST3A 1I5OA 5SYMA 2CBGA 4XWGA 2P6MA 3WBKA 3RU9A 5A5FA 4OF4A 4EX7A 2VRWA 2CCKA 3BC1A 5L1LA 2WWGA 2UVUA 4GKJB 1CVRA 1JVSA 1W6RA 2J4FA 2HUNA 4LYHA 3GEDA 1K88A 3DDWA 4JQYA 1NN5A 5K8CA 5MHTA 4GICA 4O5OA 3UMFA 2ZZMA 1LDNA 1Z06A 2XMBA 3PWSA 3CPEA 2R2AA 4FX5A 3REOA 4DG5A 1J2UA 3PQ4A 1QO7A 2WNSA 4YRBA 3DG9A 2AJLI 1CD5A 3CX7A 1V4BA 1CETA 5D6NA 1S0NA 1RJFA 3ACBA 3NH9A 4UAZA 3QEOA 4GI1A 5ECYA 3VZQA 3PNYA 1VE6A 1L7QA 4Z0HO 2VJ5A 3FVWA 1LJUA 1IUPA 3K0FB 1GQFA 3PDWA 4FYPA 1CW2B 4ZYYA 1CUZA 2OP1A 5LYJA 3M7IA 3K9HA 3W5DA 4CMAA 3N2KA 3ELDA 4B9UA 1R66A 1D3AA 1G3IA 2PCJA 1H5QA 4CN9A 1PYGA 3RAXA 1W19A 2CVOA 3PEWA 2X0IA 3GJQA 1FTQA 1XZMA 1HM5A 1M8KA 3AQEA 3VUEA 1DVRA 1XSEA 3FVTA 4IEIA 4KN9S 1W36B 4D6XA 1FSSA 2G1KA 4YR7A 1YQXA 5DT9A 1JHDA 2V5AA 2Q9UA 2JH3A 8ICZA 1HKUA 4QZEA 5HUJA 2FUCA 2QV0A 3KPJA 4AKGA 2ZIWB 3QYPA 3EASA 1IHOA 2V74B 4DQUA 2RGBA 3GNLA 4TUYF 1Z07A 3A3KA 1L5OA 3HLTA 1UP4A 3IMKA 5D49A 4XWAA 2Q9AA 1HDXA 5KSZA 5EXDA 1TFUA 4UUPA 4HVCA 3GGGA 4BFYA 3N0RA 3HJNA 4MROA 2JAQA 3EE6A 3FOCA 4FDLA 4BECA 4BP3A 1BMFA 4WK6A 1EP2B 4RDIA 4QZIA 3KQPA 1LDYA 4BFCA 1SXIA 1TU4A 1LU9A 4JI6B 4O2BA 2XOKD 1NY6A 1RRGA 2XT0A 4BB9A 1DHTA 3KTAA 2FRDA 3BMCB 5CEFA 5H0IA 2FWJA 2J0SA 3F6CA 1ZNQO 4BLPA 1L8LA 9ICJA 3DR3A 2OQIA 3ZDQA 1CV2A 3TX6A 1M8PA 1OF1A 2H5XA 2UVVA 1AHIA 1DWQA 3RSCA 5JDIA 8ICLA 4ILKA 2EU8A 2LW7A 2D00A 5LP6B 1Y48E 1I24A 1HY3A 1MEJA 4Y9SA 1ISRA 4QYTA 3FOFC 1G38A 1RIIA 5C1IA 3T5MA 4AJ2A 3Q1LA 4AJ9A 2H2DA 1TF5A 4RL6A 4GC6A 3A9SA 3H1TA 4EGAA 1QORA 2HU5A 3F0TA 3D6NB 3W1WA 1QVAA 1FVHA 2GUWA 1E1RD 5BWNA 3OECA 1X80B 3BHNA 1QG2A 1RLMA 4WZAE 1TZKA 4PGHA 4RGVA 4MVJA 2KLHA 2ONKA 1QVRA 2DUJA 2QJFA 3WNZA 2YZNA 1W25A 1WZIA 3ASZA 2AFHA 2CLEB 1O95C 2CLKB 2VXCA 4KYTA 2ZBPA 1OI7A 4ZO7A 2AU0A 4ITVA 1KA9H 1J07A 4MVCA 2X8JA 4DSZA 4EEYA 1IIBA 3UF0A 4ARSA 2B6NA 1CEQA 1R6AA 2IFTA 1DKPA 3H4IA 2JATA 4EG8A 3AXTA 1PWYE 5J2TB 1SKYB 2ZJ7A 2HHXA 2LKCA 1Q46A 2C97A 3NT2A 3LWNA 4GXIA 4DG8A 2ES4A 2RE8A 3K05A 2JLAA 3HXKA 4B9EA 5H3HA 3FLAA 1YNSA 1H6BA 2XXBA 3ADCA 4D9KA 4DJFC 4PRLA 1F7UA 4PHPA 2FMPA 4ESHA 4B84A 2XMCA 4NLLA 4BRWA 4K9SA 3MDCA 2HHUA 3P52A 2WWYA 2G04A 3OQIB 4OHZA 3TANA 1JEJA 3EYZA 2ZRDA 2NRZA 1RZUA 1FNCA 2GZSA 3WGGA 2OORC 2M32A 1UMCB 9ICNA 3ELYA 1OIXA 1DFIA 1KTVA 1JXAA 4Q4HA 4CV3A 3KBBA 1A1SA 3P9PA 2IYEA 4KO3S 3LC0A 4L4UA 5AW5A 3LRPA 4YCNA 4M46A 4KP7A 4YQEA 5J2HA 2H7VA 3NBYC 3DVRX 2KYRA 4Q3DA 4FBMA 1ZHOA 2YB1A 1DARA 3L3FX 5ALOA 5CX1A 4CYMA 2FY8A 3K9FC 3ADPA 1J70A 1U2TA 3K75D 1C0KA 1FNDA 3ZQKA 3FJYA 1FZQA 5KDLA 3R9XB 4X20A 1R37A 5CPBA 1FYEA 5AOBA 4E3WA 3F7NA 5DMHA 4PEVA 2A8YA 1EWYA 2PPLA 4C4RA 4RZRA 4X7BA 4DMGA 4DC0A 3R44A 3FZYA 1ESDA 2WJ4A 2WYWA 5IMSA 1VM6A 3MINA 2FZCA 4IJ5A 5CM2Z 2PFKA 3ADDA 1GRQA 4N6NA 1XSLA 1I8TA 4F0JA 2EVWX 1OT3A 2GEBA 4XX1A 2XQFA 1IVSA 3O6VA 5DG9A 1EVZA 2PWAA 3KHGA 1VP3A 3C7DB 3AQFA 4M9HA 4ZVQA 4BL5A 4IOLA 3MS2A 3OO1A 2XF2A 2YOGA 5AI9A 4X8LA 4P5DA 1FDVA 4EKNB 2BSAA 3BQMB 4IO1A 4OBEA 4XTCS 3B9JA 1DBVO 2AGPA 1RRKA 3NS1A 3HPQA 1W29A 5KHLB 4RUCA 4RL4A 5KJ1A 2X22A 4HWRA 5EMKA 2I4TA 4TQRA 2GB4A 3RJGA 3AVPA 1TIPA 2WVHA 3EDOA 5KYXB 3RIEA 2D8CA 1SCJA 4TTQA 4FBTA 4FEGA 2B61A 1W581 4RT2A 3NORA 1NZPA 2GNAA 4CU5A 1U7HA 4FCVA 1RC0A 1EAYA 2EZ4A 3H2JA 3T5DA 3WMWA 4RVDA 5JASA 3KOWA 5H4GA 1VBFA 3B9BA 1LBTA 2Y0CA 2Q45A 1M73E 3HZZA 4F6CA 3LHIA 1S2OA 5L95A 3CXRA 4JK3A 1KQPA 3EISA 1MRSA 2D1QA 4DUPA 5D84A 2B34A 4KB5A 1DP4A 5DMXA 5KNDA 3B7GA 2JD2A 4E31A 3LK7A 4GQBA 1LI7A 2HXYA 4XDZA 2O2EA 4IEEA 3S44A 4D8VA 4EHFA 5FTKA 3RADC 4J0DA 3JVIA 1U4BA 3A25A 1XZEA 1O9BA 3T1HB 4MRMB 4ND6A 3NBXX 1RWPA 2RFLA 3PXEA 3CLSC 3BK7A 1BXRA 3R4VA 5AW0A 1K4YA 2AF4C 1RYMA 4XIIA 5JT1A 3ZQ6A 4ZU1X 1U1DA 3RRNA 1H42A 3C7KA 4DNQA 3LWDA 1UPBA 3SIPA 1E32A 4YVZA 1XROA 4JOQA 3E1KA 2JJMA 3CH5A 1EMDA 4C7VA 4KDFA 5LUBA 1RLUA 3OC0A 3O26A 2IUFA 4XSHA 4LZOA 3NR2A 3ZV6A 2J4CA 2BM8A 5C0YA 4I81A 3RTVA 5ADVA 4RIHA 4ZOAA 5F77A 2GHRA 1E2LA 1P4RA 3A9CA 5HKAA 3DOOA 1EVIA 4MX8A 3VH2A 1OV4A 2R5WA 1PNQA 3WYGA 3H7AA 3EVZA 5JCOC 2QQFA 5CA7A 3PNOA 5I8PA 2AI3A 1G5QA 2Y66A 3HRHA 2MWMA 1BPDA 2BHNA 3KEMA 4C06A 3MUFA 4GM0A 5IT9A 3L0BA 5J4LA 2O1WA 1TAHA 4I5DA 2GILA 2B3DA 2HBRA 4F1JA 4EYOA 1P2TA 4GX5A 4G6ZA 1ISSA 4TYWA 1H2XA 3UXYA 4ZCTA 3QPWA 4PGQA 1JE0A 1XN1A 4S0XA 1N6HA 2P9EA 1NGSA 3K3PA 4TXMA 1OI2A 3MGGA 1KPHA 3KBOA 2VPTA 3KAQA 4LF9B 2JDIA 3ZY6A 3B12A 2QRGA 3T54A 3WHKA 3CO0S 4FMCF 4IV5A 1JLRA 4P98A 4CRXA 3OX1A 4MA5A 3OOHA 3HGTA 3KT8A 5IJ9A 3K0BA 3RS0A 4N76A 3IHWA 2ZSJA 4KQWA 4U3JB 2R6GA 5F9MA 2XMZA 2PUVA 3FNFA 3MB8A 3BPSA 4J6FA 3GH3A 5D86A 1GO2A 2FUKA 1Q21A 2XYHA 2QORA 4FYVA 4LOLA 3F6PA 5KTTA 2C2RA 3PGJA 4BNKA 5E1DA 4AY5A 1FMTA 5JQGF 4YCAA 1PFUA 4U1RA 3H5AA 4NECA 3F9CA 3PDHA 3VSEA 4N5IX 1JI7A 3OFJA 4ZMRA 3M4NA 4EPWA 4DLZA 4HAWA 3OM1A 3G5UA 4NOLA 1LC0A 1GT6A 4ND8B 3WE7A 3KNZA 4EBFA 4BX9A 3VO2A 1P1RA 2JS7A 1P1BA 5B5EU 2GR9A 2I8LA 1K6EA 4QOFA 5J9FA 3PGVA 2SNIE 1UEIA 3ZTYA 3RRBA 1UK6A 5EZQA 2FFHA 2P1ZA 2BF7A 2E5LB 1BCSA 3HKCB 3RNOA 3QX7A 1SUCA 3WO1A 1X1EA 2GZAA 1M5TA 2C96A 2P2DA 3IPLA 3UWKA 3HRKA 3QX9A 3BQNB 4R6WA 2IVZA 3R0JA 5L8VA 3ETEA 5JD3A 5CB1A 3VZDA 1BHO1 2I9PA 4R8RA 4WZZA 1ECFA 1C4WA 3PA8A 5DM2A 1TAMA 4ON9A 4H7IA 3BFJA 1J5PA 4M1KA 4IWNA 4KITB 3ORFA 1XYVA 4WSOA 4HEA1 3V7YA 3QOFA 3WGJA 1FPMA 3FE2A 2BTEA 2HN9A 4XDGA 5BW4A 5AI8A 1KFBB 1AIPA 1MBZA 1I80A 4WL0A 3ZV4A 3IEIA 3OF3A 1IYZA 4Q1CA 2V7GA 3OLVA 1Y3FE 3OZGA 4MAAA 4Q02A 4OBWA 2QN3A 2WWVD 2R3SA 4B79A 2QD2A 3H5NA 3HA5A 2GN1A 3A32A 1FSZA 2FRDC 2HU2A 4Q44A 1FX0A 2LRHA 1EUCB 3A6PC 2H1WA 4TYMA 1GQYA 2ZRQA 3IIIA 4DPLA 1FS6A 4R8MA 4G36A 5REQB 2PZBA 2Z4RA 3UMSA 3PR1A 3GQBA 5L4LA 3E1GA 3WGIA 3H2ZA 8ICHA 3KKZA 1ETUA 5KOHB 1UBFA 5JDIC 1FFGA 2ZANA 3OQHA 4JI5B 2DR0A 3SF8A 4MJLA 1ZP6A 3OSPA 1EFAA 1DMSA 2PX3A 1FRZA 5H1YA 1KBZA 1N2OA 1ZU5A 4XLTA 5C52B 1N2CA 5C1OA 3TLYA 2FYTA 4K6OA 4DSLA 3FIUA 1AQJA 4JLSA 4ER0A 1C1DA 4B3RB 1XRQA 2V4RA 1CUCA 3Q7QA 3IKJA 2VF2A 4IUCS 4Q6BA 1WCLA 3D2LA 3CPSA 3PKJA 1T4MA 4AZWA 1V11A 5HF5A 2PXHA 3RBAA 3GT0A 4AZ0A 5LN1A 2BBWA 4FFLA 2GYWA 3U4QB 2H52A 3NTVA 3OZXA 4FOLA 1HEUA 3JPOA 2QLNA 1KF0A 3SEQA 1F0MA 3LBFA 1V26A 2WFZA 7ICVA 1P29A 4AN0A 2XOKA 3PI7A 4MW5A 4K6HA 1WW8A 4BE9A 2F1OA 4D44A 2TS1A 2R6AA 5EWJA 3W7VA 1RXVA 2OV6A 3SOPA 5DRTA 4RZSA 3AFIA 2NIPA 4ECSA 3IIJA 3LRTA 4RU1A 1AKRA 3KQKA 4YUVA 1RHJA 2CHFA 3DOUA 4IIDA 3TBFA 2Q7OE 1GZ7A 3KTQA 2B8NA 3KS9A 1IJFA 4CMIA 1MQ3A 4H3HB 1RXUA 3UM9A 1Y42X 3NDPA 5KDOA 2PKQO 2D3WA 2BVNA 3USES 4KREA 2OHGA 2O50A 3ANSA 2G17A 2RGUA 4ZJYA 2PZEA 3UFXA 3GGOA 1S3FA 1CLEA 4N65A 4WKOA 5IT5A 2Z58A 3OFSA 5HUQA 2HMVA 4OV6B 1E1RA 5KL8B 3IQIX 4XLZA 2F7SA 3KC2A 4FKMA 4KL8S 4J1SA 4ZMBA 3KDSE 3INNA 2OLJA 2A2ZA 3CSUA 5FWDA 1PFWA 3O4JA 4RLSA 2PYZA 4GC9A 3ZJ5A 5AM5A 5D3ZA 1YONA 3WYEA 5B66U 4NCKA 1AKNA 1I3CA 3F49S 1V3QE 5A0TA 3USZA 1MOZA 2YV5A 4E6EA 2H8KA 1BXGB 3NS7A 1KN5A 1EK1A 5I4CA 1ECJA 4UJ3A 3I2HA 1JF8A 1SXPA 3JZDA 4B48A 4D57A 1JU3A 5CNJA 5KG6A 5DYYA 3IVGA 3OJSA 1ZQVA 3L0DA 3H2GA 3ABOB 5HKBA 1NN1A 3D4PA 4DV4B 1RKQA 5HRCA 4F93B 2O8BA 5AVTA 4XOUA 4TWZA 2BGGA 2K5UA 521PA 4GGMX 1E2BA 2FMHA 5IMBA 4EFNA 5MFZA 5EE1A 2C8VA 3BTSA 3GVXA 3JPTA 2VN8A 1RAGA 3SXJA 721PA 3FDSA 5AVUA 3HFJA 2J6UA 1KEZA 2IHMA 4MV3A 4DMRA 5LQNA 3N2NA 2UVQA 2ZCJA 5FPKA 3C3YA 4RKEA 4L9RA 2X8AA 1TUEA 4DT1B 4I55A 4JSRA 1OLSB 1HG1A 3OFND 4EYHB 1BVRA 2KHVA 4G1CA 4EEKA 1S3SA 1XD2A 2NU9A 2AHOB 3GN1A 3K71B 3T12A 1VIVA 5KG2A 1T7PA 1UJ5A 3VH3A 2W43A 1QF9A 4PIVA 4UVHA 4PO9A 1XRLA 4US2R 2YX1A 4NAUA 4B9NA 5DTRA 3TPZA 1ZJMA 1YA4A 2X1VA 3NT5A 4QFDA 1JQBA 5TSDA 2YXNA 1Z45A 2ISSD 2YWHA 1R8QA 4PPQA 1KYVA 4QUKA 2A9VA 3HKEB 3X0DA 5C18A 3P2KA 1MC4A 4JCOA 3QUBA 2DHQA 4MR7B 3UANA 3RT7A 4GQIA 2V7TA 4CHGA 5JC1A 1IIPA 3THSA 4JWNA 4IQGA 5FWXA 3U1VA 3U37A 1WB4A 2FETA 4RMNA 4QO8A 2GT1A 1M2JA 3FYUB 3UG6A 4MYDA 1MO2A 5CLFA 2C9ZA 2F9LA 4PIPA 3N58A 3O3NB 1SBTA 3QY9A 3HUUA 4AW9A 5ER9A 3INTA 4LZGA 4G89A 4I8XA 4P84A 2BCSA 1NQVA 5THQA 3ICWA 5EE5B 1U02A 3AR9A 3FMFA 3VKHA 4UUAA 3EZNA 4AYBF 1RJDA 2QRZA 2JEIA 2C2DA 2Z8YA 3NTXA 1E9BA 5EJ8A 2Y9PB 1L4LA 3IJ5A 1QF7A 3CZ5A 4LJXA 4UTRA 4A16A 5LIPA 2WJIA 3OLCX 2HA6A 1P7ZA 3OF2A 3LPLA 3FWYA 4IDPA 1ZXXA 1P0FA 3ID6C 5JDCA 3HDGA 4HS4A 2YH2A 1LV5A 3G2HA 4O3OA 3TXAA 4V2IA 1YDEA 5KUTA 3QE9Y 4Q7MB 2VCHA 2Y1FA 1EUDA 3VCBA 3UQZA 1CIPA 4Y30A 3UJBA 1SVUA 1ZIXA 3WKCA 2FJPA 3P26A 3IKTA 2EQBA 2Z3ZA 4X6UA 1W4RA 4KO1S 4YJHB 1PJQA 3ZWXA 4BKQA 1NT2A 1TF2A 1L4BA 4MW6A 2PMDA 2RH4A 1G8SA 4KLRA 1XZDA 5CT9A 4QU9A 1CUAA 3GLKA 4G0NA 2ZBDA 3W6ZA 3W6OA 1PK8A 2R1VA 3QJYA 1YR3A 3LYUA 4EB6A 5JV5A 4FFBB 3FUWA 1VLZA 5CTJA 1XQWA 2ZTVA 2WV9A 1TU0A 4BVHA 2ZUDA 1F0KA 4MWOA 2RHOA 9ICFA 2CZCA 1VLBA 1RI2A 2Y1IA 4OUDB 3OWXA 2TMYA 4WAUA 3ZE1B 1DPGA 1E6KA 3BCSA 5HMLA 1BFKA 2DQYA 1I4LD 4ER3A 2AJCA 1FUUA 3U4IA 4DLUA 4RK7A 1QCKA 2D59A 1T3SA 1NG1A 3EDQA 1G66A 2Y0SC 1EGAA 5AJHA 3ENKA 2LDXA 2FPLA 2MSCB 4FBGA 4NY1A 5AKIA 5EFZA 4NNOA 1PGNA 1CKEA 2Q3LA 2GPAA 3IPXA 3JQQA 1FVOA 3JVDA 4MHTA 4O3NA 3R0IA 3I04A 3HCDA 3CLTD 3R09A 2G71A 1J0DA 2W48A 1V7QA 4IXWA 4MEAA 3KJXA 2IHTA 1TRHA 3EAQA 2I22A 3WGOA 4BX9C 1E1QD 4AF8A 3B13B 1T9CA 3DVAB 5IULC 1YZNA 2JFYA 4OJ6A 1Z0DA 2JIZD 2A94A 4IM7A 3BGWA 1WCIB 4QAQA 2QB0B 4F5QA 1QKIA 2F4VB 1OU4A 1RKUA 2EATA 4GUDA 4B3BA 5JWOA 3FCUB 1KDPA 2NPFA 1IPHA 4OXIA 2AJDA 4Q00A 2NYRA 3LIIA 3Q2KA 4OJTA 4CKEA 1Y3BE 3CWQA 1YQWA 3OPYB 4JJEA 3MYYA 1APBA 2AZDA 5ES4B 4YXWD 4HXEB 2VDLB 1WUYA 3CX3A 5E2IA 2XUFA 1C3OB 1JGTA 3K16A 3QUQA 1DEXA 3FB4A 2MSKA 1YS7A 4MVJM 2IYTA 4WJZA 4MQ4A 3ESXA 6PFKA 3V4ZA 3EFBA 4KPUA 5HILA 2V1XA 3O4FA 1NK8A 2O5VA 2L19A 3AIOA 5JS2A 5B2FA 4ZICA 3ONNA 2I29A 1YS1X 3FAKA 4TZKA 5MDHA 1RAHA 1CQIA 1IN4A 1VJ1A 1W5AA 3IP9A 1BMFD 1PTJA 5KMGA 4G8BA 3HB1A 4TUYB 1FB5A 621PA 4II7A 1GP2A 5L7TA 2O2JA 4RCYA 1ZKMA 1L5FA 1IQPA 1I01A 4IDDA 1T29A 3GL9A 2QMUA 2IDMA 4LXGA 3RVKA 2UXBB 2FWIA 3NAQA 1Y6JA 4L16A 4QICA 1CNMA 2PFOA 3ABQB 3GLHB 4I4IA 3TZHA 3UWPA 2B2CA 3A58B 4J2HA 1Z6XA 3QU5A 1VJ0A 2GZMA 3FNHA 2KFZA 2FW9A 2C0QA 4D74A 3RVMA 1KFCB 3MTAA 1NN0A 1OGJA 2EF0A 3OIGA 2HNBA 2O8CB 3EYAA 1OWOA 1U0OC 4TN1A 2XX3A 2DPLA 5KFUA 1IL0A 4QEKA 3PR5B 4JYAB 4U6NA 5HGJA 4J3FA 7ICNA 2CMHA 4RQ4A 4PL2A 4ZI5A 3CVVA 4R05A 3FUXA 4UVGA 2W8KA 2A9OA 2QMHA 4TV8A 2Y05A 5DO9A 1NYQA 4DTIA 4I2FA 2QR2A 8ICXA 4X1KB 4O4LA 3GAAA 5HVNA 3K8QA 3KSMA 1NMQA 2XCPA 2IH2A 2X42A 2PV7A 3OEYA 5AOVA 2D06A 2GCGA 3TOXA 3ZWOA 1BJTA 2HJHA 3B5JA 3JALA 4G4GA 4LXHA 4EI7A 3H18A 1WDTA 1WWVA 3FWNA 3ZNPA 1JS1X 1XD9A 3UCEA 4MEYA 3GOQA 1DMRA 2VBFA 1BWQA 3JASB 5DYTA 4BYMA 1FYXA 2O20A 2I4IA 3CE9A 5A6SA 2MCFA 1A9XB 1C3JA 5KSYA 1U3WA 2E4AA 5K01A 2XNDD 1FY2A 2CGEA 4DF4A 5CW2A 3V42A 5GV8A 1AXGA 4D82A 2VWPA 4MYSA 3DM9B 3C2KA 4YRRA 1X7ZB 1P74A 2VHYA 2NRTA 4BE4A 1W49A 2A78A 2H6EA 3RH5A 4FEYA 2G5PA 3AL3A 2R4QA 4ID3A 3FDZA 2C9CA 3K4QA 3L0ZA 4BNDB 4DLVA 1HI9A 4OXKA 4AMUA 4X61A 2WWFA 4KODA 1WDWB 4H59A 4GSYA 4RXTA 1RPJA 1MIOB 3N05A 1NY5A 4O33A 1Z3CA 4G4IA 4FOSA 5FQNA 3LWBA 3U2QA 2MR6A 3KZKA 1MABA 2HZBA 4RVGA 3TL2A 3ZW8A 1ZOOA 2QN6A 3LECA 4FYWA 4IFBA 3T7RA 3ZGXA 4ACAA 4IIBA 4CKWA 1S96A 2R1TB 2OG2A 2CV2A 3WQQA 3LCUA 3NDIA 4YUZA 3ZCXA 1K5OA 3CXUA 1L5HA 5CJ2A 3CY6A 2EKZA 2H2IA 4QVKA 4JT2A 1NJWA 1NC3A 1IWOA 1QYRA 1E96A 3AEXA 1RRPA 2A9KA 3SSOA 3RB6A 5T57A 1E1NA 1Q8KA 1UBEA 3STXA 3AHCA 2REBA 2QU7A 1M6VA 2XIQA 1RPNA 3Q7IA 3HH8A 2VAWA 2RAFA 1Z38A 4IIHA 1BG6A 1KVUA 4IUYA 5HA5A 2HCRA 5D01A 2VBGA 4FHEA 1J2JA 4K28A 2W6OA 3OZBA 8ICYA 3OTIA 4KXWA 4HQLA 5CDYA 3WLFA 2IYVA 2Q3JA 2WB1C 1FQWA 2G76A 3IHQB 3T5LA 2JGDB 1Y89A 4KQ1A 1TT7A 1L4EA 1I4TD 4IF4A 5KOIA 3OQJA 4GE3A 3LHDA 3IP7A 1K63A 2HC9A 4Z4GA 3RRFA 3F67A 4C5BA 4AKHA 4AYXA 2ZS9A 1EJ6A 1QV9A 1ZYQA 1TGYA 1HR0B 3OIYA 1W6UA 1N2SA 2B5OA 2HJSA 3GVCA 3Q9SA 4Q3BA 4CF3A 3KKNA 1Z5VA 3PSPA 3GIMA 1NSTA 1VIYA 2BCJQ 5JS8A 1RYHA 5IBPA 5T4HA 3DYIA 2X0EA 3X1WA 1AX9A 8ICFA 1Z2CA 4XGNA 2XYVA 1SV0A 5TGTA 1ZCBA 1GAQA 1KYTA 2Q4RA 4GL2A 2ZITA 2LKDA 3T3EA 1NUSA 3CLVA 3MR6A 3C2QA 3SYRA 5JAUA 4CVNA 2QTCA 2HSGA 3E15A 4W63A 4A6XA 2XY5A 1R4ZA 1U2RA 3E3AA 2EZYA 1B2LA 4LPSA 1P4GA 4K0RA 2OHFA 3RSQA 4DV2B 1DZ3A 1ZOIA 1WXGA 1U0BB 2W2QA 2EHJA 1VSQA 1DQYA 4NMWA 3BS7A 3KX2A 2RARA 2QJTA 4R54A 4XXHA 5TJ9A 3G82C 3C3KA 3E23A 2E5FA 3F9RA 2XLCA 1ZLYA 1T15A 1QGYA 3FI9A 1NW4A 2MSEB 1O6BA 3A8TA 3GJRA 1O5TA 1G5RA 1UR5A 4IFEA 5BXYA 4EATA 4DILA 1Y9EA 2X19A 3RJKA 3OFNA 1ZQKA 2BFMA 2QQGA 5JDCC 1Z0AA 2FG5A 5BSEA 4PYKA 4D7AA 1GU7A 1IEQA 1YFZA 1YT3A 2QPAA 2MUTA 2JJQA 2ZXHA 4L6CA 1A97A 3LXMA 2PU5A 4UEOA 4WK2B 1QLHA 3X1XA 3TW8A 4W5WA 5B7GA 1VJCA 4U2DA 1JBEA 4TQUS 1M1UA 2CFCA 1YFJA 5DHAA 1X94A 4B9SA 1G21E 4BU0A 4BJ1A 3G5TA 4G1BA 4W7SA 4DFKA 5EJEA 2OPHA 1KAHA 1DWOA 4LJKA 1JIQA 1XHLA 4FT4A 1G3QA 2QUKA 2XMQA 2MINA 4N0EA 1EEXB 4OK6A 3AFGA 4H7FA 3WTBA 2FSIA 4GOND 2QIPA 2CL6X 3B1JA 5IH7A 4WLOA 1VG1A 1ZMRA 1K8RA 1NJ8A 3EG5A 2OYRA 2FPGA 3UN1A 3I2KA 1X1DA 2XOEA 1YZYA 2WAOA 2XECA 2ZVPX 1WNFA 2GVDC 1RI4A 1QUEA 2VNAA 3LLMA 4N41A 4MI6A 4NONA 5FA5A 2BEVA 3QUAA 4FS2A 5DU2A 5DVZA 4UM5A 3TFWA 3NP9A 3MCZA 1R6BX 5F5LA 1BVYF 1QCYA 4M9CA 4TVKA 1C9EA 1T36B 3R3XA 2CUKA 5F4BA 5L3SB 2FSPA 4NABA 5LP1A 4FMCB 4BLRA 3G23A 1SOMA 5GPBA 2DHRA 4PLGA 4BYGA 5F21A 2PWYA 5AJWA 4FILA 5B12A 4IJWA 5HZKA 1ABFA 3UJ9A 1G291 4ECXA 1GPWB 2GOLA 1F38A 4GKVA 4ZREA 1VB5A 4FINA 1TYAE 1YI1A 5BW5A 2GDJA 4I36A 4YY3B 5CP2A 5NLLA 3VKFA 5FH9A 2BW0A 1PL6A 2WFLB 1BRTA 1XMPA 5JQGB 1WM1A 1FLAA 2GMWA 1X9WA 3EGOA 4ECVA 1D4AA 1NXQA 3IE1A 2AR9A 2BGMA 3NYWA 2YS6A 3KU4A 4BMPB 3RSFA 1GKKA 1U65A 3K30A 2R96A 5DB7A 5IAJA 4IIEA 1CTQA 2AFIB 2GDZA 1L5ZA 4Q9AA 4B9LA 4CXMA 2Q9BA 1HA3A 1K89A 4RZIA 1UUFA 4FUQA 3QW4B 5CB6A 1IM2A 3IQEA 3D0OA 3MJCA 3Q8SB 4RCZA 4N03A 2IHUA 2XUOA 2KEYA 3I5UA 3RHZA 1TT5A 1Q1BA 1JIKA 1GAEO 4C43A 5FHRA 3NJ4A 1YQTA 5B58T 2ZM5A 3JD1A 1XRRA 3GIWA 1GGMA 4I14A 2X5OA 2VRNA 1KMNA 5AOAA 2NU7B 3Q3EA 4U02A 3QVXA 1PTJC 1DTWB 3Q4GA 4FC6A 1TM4E 3R7WA 5FORA 3RREA 2ORYA 3IO5A 2QUHA 2KMLA 3A27A 1EM8A 1PDOA 3U9SA 4JL5A 4RK0A 1JMYA 2KIVA 4UMEA 3ADKA 1R64A 4PW0A 1TTPB 1E1QA 1Z00B 1E2MA 1U5BB 1TF7A 2JIZA 1P73A 4QOHA 1ZN9A 3IDAA 4KN4A 5KCZA 1DV2A 5JSZA 1FRFS 2V55B 1RWKA 4YAOA 4U7HA 5KTKA 3AEUB 5LBUA 1MO3A 1QTMA 3OZ7A 4ESOA 3CRRA 4PX9A 4I1OA 1A9OA 3RTEA 3HE3A 4KMMA 1NYTA 2UYOA 4YXWA 1CVLA 2KIWA 2OY0A 1J0EA 1XRSB 2FK7A 2I3AA 2B4KA 1M0WA 4RXMA 2PKEA 4CQLA 1ZQUA 4RU9A 4RQ0A 1Z39A 3OSZA 3JPSA 2ZSUA 2LBOA 1OJ7A 1V1JA 2C83A 2W2PA 2WUDA 1TKCA 2A4KA 2J59A 3PTZA 2OV3A 1OOEA 1TMOA 1A4IA 1JQKA 1OCEA 1WTCA 3ZJTA 4EHDA 2A86A 5JO9A 2WLSA 3O8BA 4B6OA 5BMOA 2XKKA 2Q4TA 3V7JA 1ADJA 1BEZA 1XZLA 2XCIA 1DQRA 1PD1A 1OXMA 4NJEA 3CLUC 4F8EA 2FJ6A 3RYCB 2HD4A 4Z3OA 3U9TA 2ZI4A 2YN4A 3EC1A 1QYIA 5KPDA 3W9SA 1W2HA 4Y0AA 5FJJA 5KFDA 1PCXA 4WY5A 3OA0A 4N6GA 3ROKA 1E7RA 2BGNA 2VCYA 1X7WA 2I2AA 2WJZB 4REQA 4N5LA 1K1EA 1T2FA 7REQA 5A04A 2HWYA 4M0AA 3CUUA 3ORQA 4QZHA 1Q1EA 1SG9A 5AM1A 3D7KA 1USVA 5TQ0A 3GARA 4ZHSA 1I5EA 3ZK8A 4E5VA 4JOBA 4PVCA 3OHPA 1CDEA 4UQOA 1UAAA 4CM9D 4UBCA 4EYKA 3CEMA 4DDUA 1JILA 4A0HA 2XRZA 4QUJA 3OJLA 2DGDA 3BRWD 3DS8A 3GBVA 1IXKA 4YUWA 1WD7A 1PVQA 4MDYA 2FG7C 1NQXA 4CM4A 3HEBA 2UU9B 3R5XA 3M5PA 4I19A 5M7EA 5FV7A 3MQ2A 4ZJZA 1JV2B