4B9LA

Structure of the high fidelity dna polymerase i with the oxidative formamidopyrimidine-da dna lesion in the pre-insertion site.
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 213
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9lA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9lA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9lA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9lA01
4GC7A 3EW9A 2Z1JA 1JLBA 4KB0A 2RKIA 4W5QA 4IRKA 2GBZA 3V9UA 3DI6A 1NK6A 1ZQVA 4CEZA 4KB1A 1BIUA 1S97A 4Z0UA 4Q45A 3V4IA 1JLAA 2IS3A 4IQUA 4CEDA 4CFCA 3QO9A 4BWJA 1CUKA 4RW7A 8ICHA 4ZH4A 8ICFA 1K6YA 3AVAA 4F4ZA 4GC6A 3M9MB 3N4MB 1H38A 3GIJA 2AGOA 2W9CA 3JSMA 3V9SA 3QNOA 3OS2A 1IG9A 5HHHA 4FLWA 4E0DA 4OKKA 8ICQA 1U04A 3OY9A 4F5QA 4NM1A 3B6PA 5HRNA 2JEGA 1LAVA 4MFBA 1IM4A 1R0AA 4ECVA 4F4KA 1VSLA 9ICCA 2R7YA 1EP4A 3AO5A 1WAFA 3QERA 1DGSA 1MU2A 5HHIA 1ZQWA 5KFXA 1ZQBA 4YR0A 3ZSZA 2YNFA 1IKYA 4CHYA 2HNDA 5D46A 4J9KA 3F9KA 1SL2A 4M3YA 3LWMA 4WE1A 2G8KA 5KG1A 3RJGA 4O3NA 4HCCA 3KHHA 3JPSA 2XC9A 3L3VA 1QLNA 1BPZA 4Z4CA 3RJFA 1S1WA 2OZMA 8ICCA 5KFIA 3ZCMA 3ISCA 7ICMA 1C0UA 2R8IA 4DSIA 1C7YA 2R8GA 4B9UA 1ZQKA 2Z1HA 3DOLA 1KFTA 4I9LA 4ZTJA 4QAGA 4DFPA 4KLMA 3NGDA 2BCRA 4MEYA 3G6VA 2KFNA 3TAQA 1MQ3A 1T3NA 1NK8A 2XGPA 4CJTA 4EYIB 3K4GA 4CGJA 3NGZA 2YNGA 3GIIA 5CYQA 5KFCA 3HYFA 3H7IA 3RH4A 4TSXA 4CFAA 2BDPA 5KRTA 4FJHA 3LPTA 2VG5A 1RDBA 5CP2A 3PMNA 3TFRA 3O4NA 3RRGA 2BGWA 4GXJA 3PW0A 3OYIA 4CEAA 1BPBA 4PHEA 2W9BA 4CEFA 1Z00A 2JLEA 5DDMA 2F1JA 3OHAA 3LAMA 3MABA 3MDAA 4RQ2A 4RNOA 3Q8QB 2P5OA 4FLXA 3QEIA 4KHUA 1QSYA 5BPCA 2MUTA 4EBEA 4RQ6A 3IS9A 2W9BB 3CFOA 4QZAA 2HHXA 3LP3A 1Z00B 4O3RA 4R8UA 9ICWA 3DLEA 1K1SA 3KIOA 2MUTB 3RR7A 3V9XA 1GOBA 3K5OA 2F8TA 5KT4A 4R8UB 3K2PA 1Z3EB 1NKEA 4CIEA 2I5JA 4IQTA 7ICUA 3DMJA 3N97B 3EPIA 2PFPA 1D8LA 3LP1A 5HMLA 4RQ0A 4Z6DA 3DRSA 3LZIA 3M8RA 8ICTA 4FJ7A 1NJZA 5DMRA 4NLGA 3RB3A 5KG0A 1JXLA 2ZQBA 1KCFA 4TURA 3KK3A 3RJEA 4QWEA 4I29A 3OYHA 4OPKA 4JV2A 3VQQA 5D3GA 5HRSA 4KREA 3CM6A 4HCBA 4RNNA 3PMLA 8ICLA 4FK4A 3AVFA 3SQ0A 4ECRA 4DU3A 1ZQCA 8ICPA 2OZSA 1L3TA 5J2AA 2ITGA 5L1KA 4BXOA 4KLJA 2PXIA 2MAXA 3QNNA 5DK5A 3RB0A 4R64A 3BQ1A 3QEPA 5J0RA 3KKRA 5DBBA 4E19A 1FKOA 4NXZA 3MEEA 1YVUA 4KN4A 3OSNA 1EETA 5CYMA 8ICJA 1J54A 3V6HA 4CEOA 4NCAA 7ICGA 4ECQA 4FZXC 4ECZA 1ZBIA 2P66A 2VWJA 1XI1A 2M9NA 2NRWA 1ZQTA 1B9DA 3HPOA 3RMCA 4J9LA 3KD5E 3MGHA 3OYNA 3MBYA 3TAPA 1S1TA 2D0CA 4KMUA 4ZHRA 2PYLA 2QXFA 3FDSA 4KTZA 3QE9Y 3DYAA 4CJ4A 4Z4IA 4Q5VA 3TANA 5HP4A 2NUBA 3OYJA 4NLZA 4K8XA 1RDDA 4FXDA 1RT7A 1LW2A 3KD1E 2G8IA 4YMOA 5KT7A 3CG7A 3HVTA 2W8LA 4ECXA 4DSKA 4XUSA 3NCIA 3RMDA 2BGGA 3V6DA 4I9QA 1MC8A 4FW2A 1BPYA 3JPTA 1KTQA 2O4GA 3LP2A 4QZIA 2XGQA 1WSJA 1CZBA 3MXJA 1WSFA 1NOMA 4TUSA 2ASDA 4RPXA 4KLSA 3V6JA 2AJQA 1VSFA 3PX4A 3NE6A 3D0PA 3BQTA 4Q8EA 3K5MA 4CECA 3OYBA 4O5CA 5IIJA 2PY5A 1EXQA 2AQ4A 3HJFA 5KFAA 3C95A 3C1YA 1MSWD 3LDAA 4CJ3A 4PHAA 4JUZA 4DS4A 4ED2A 3BGRA 4C8MA 4DTOA 3GQCA 4OKEA 4QCLA 2IC3A 1ZQZA 4LZDA 1GOCA 5DLFA 1ASWA 4O4GA 1IO2A 2GWSA 3MXMA 3KHGA 3KK2A 2Q3SA 2HVHA 3UPQA 1B43A 3TQ1A 8ICEA 2VG7A 4M3UA 1J53A 5DB7A 4CJQA 1RILA 5K14A 4RW6A 2FLPA 4OVLA 5CY4A 1BPDA 1XSNA 4CGDA 4CJLA 2UVRA 3C5FA 1JL2A 3G6YA 5EWEA 3B0YA 1UOCA 3KLIA 4DS5A 4N47A 4CJPA 2C22A 5E41A 4QZBA 3JPPA 3RAQA 1O1WA 1WCNA 3PO5A 3PW2A 1ZQDA 1WNSA 4DL6A 3NHGA 2YKNA 4XA5A 4K4GA 5DGAA 1LWEA 3AU2A 4RT3A 1SL1A 4JWNA 7ICHA 2HMIA 1JXEA 2X6NA 2ATQA 8ICVA 4PGQA 4PPXA 3V72A 4Z6CA 1N5YA 3C23A 2P6UA 3AA2A 4DQQA 4NY8A 4KLOA 3PY8A 4IG0A 2IHMA 4DTUA 3ZSQA 5HRPA 2AGQA 2BR0A 4B9MA 4B9LA 2AGPA 2PFOA 9ICIA 1JXBA 5C24A 5KFJA 1JIHA 1VSMA 5HROA 1JLEA 5KFWA 4IQVA 3B6OA 4DSLA 1TVRA 4IG3A 2Z1IA 1T4GA 4F5OA 3MR5A 8ICMA 2YKMA 5DG8A 3RR8A 1YTAA 3V9WA 4ED0A 5EWGA 1VSJA 1D8YA 3MR2A 4UQGA 2JEFA 1CEZA 5BOLA 3SUQA 1AROP 3L3UA 5J1EA 2XHBA 3K75D 1N48A 3C2KA 4ECWA 4AHTA 4YMNA 1ZETA 1BI4A 5KFEA 1ZQJA 1ZBUA 4FO6A 3HL8A 4CFBA 4DTRA 5J0TA 1ZJMA 1NK0A 2OWOA 1RXVA 1LW0A 3QEWA 1N6QA 1BI4B 5J2GA 2F96A 2UVUA 8ICSA 3KLHA 1Y97A 7ICVA 1ZQLA 4E89A 5DG9A 5KFOA 1KVBA 4QZCA 1JL1A 4HTUA 3NH2A 3HP6A 4EBCA 2EHGA 2BQUA 1ZQYA 3NDKA 1JLGA 7ICLA 4YXJA 1FK9A 1JLCA 2IGIA 4FVMA 2E6LA 2NRTA 4NLNA 3S3NA 5L1JA 3OYCA 5KT5A 1S9FA 4KLHA 2KTQA 2E4LA 2LSNA 3DM2A 2HHQA 4FLYA 1ITGA 3I0RA 5JUMA 4C8NA 2W8KA 1ZQSA 4M9HA 1Q9YA 1SKWA 1TKDA 3OYDA 3PO4A 4M3WA 4I2QA 4O55A 4RU9A 5KRSA 3DOKA 2DFFA 5I3UA 4J9OA 3IG1A 2VA8A 4E7KA 4HUGA 4FJJA 5DB9A 4TUPA 2F1IA 3GIMA 3AVNA 2BE2A 3K57A 1XO1A 4M3TA 9ICXA 5IILA 1D9FA 4DTPA 3C2LA 4KO0A 5FDLA 1BPEA 1C0MA 4YG2A 3ZSWA 4I2JA 3SUPA 4XRHA 2FBXA 2ZJ8A 4F5PA 2HHWA 1T8EA 3GFKB 4BGDA 3MFHA 1RT4A 1HPZA 7ICTA 5DQGA 4J9RA 9ICBA 9ICAA 4RQ4A 3L8BA 9ICJA 2XCAA 4G3IA 2NRVA 2QK9A 3ULDA 2DPJA 5KFBA 4R65A 7ICNA 5CZ2A 3JPQA 4N41A 4F93B 1JKHA 1HJRA 5CZ1A 4F2SA 3H8JA 1X9SA 1ZQUA 3THVA 1ZQAA 4PH5A 1ZYQA 5J29A 3OGUA 1VSKA 4UB4A 3Q8MA 4CHZA 2P1JA 4FJKA 2W9CB 3L2UA 1FKPA 4YNQA 4EZ6A 2IMWP 1KEJA 4YR2A 1RDCA 3RAXA 4O3OA 4FJ5A 5DKWA 5DQHA 2VANA 4ED6A 2HHVA 4I2GA 2G8UA 4AHSA 5KG7A 4IQWA 3AVBA 5DB6A 3TAGA 3VQ8A 3H8SA 1FXXA 5KG2A 3RBDA 2Q0ZX 1TVAA 3AVHA 1S0MA 2W42A 1LV5A 3ZT3A 1HNIA 3VN5A 4CJ5A 4OGEA 4CGHA 3UIQA 3MR6A 1VRTA 4HYKA 3A2FA 3QIPA 3SV4A 1RTIA 5J0PA 5HMMA 5J2KA 1BIZA 1UWBA 4RW8A 4QZHA 3KHLA 2JEJA 7ICJA 3V1QA 1RBSA 5J0YA 3KHRA 1BHLA 3MAQA 4F50A 4KAZA 3VQAA 4KLLA 4R66A 4H4MA 8ICBA 4B9SA 4CFDA 3RRHA 1NK9A 3L2VA 2XRIA 4RW4A 3PX6A 2IA6A 1WSHA 4FJ9A 4KHQA 4ZTFA 1NK4A 4TUQA 4NCGA 1S77D 4I27A 4KLIA 3H4DA 1SL0A 1S1XA 2D0BA 3I8DA 1KFDA 4MFAA 3TAEA 3WNEA 1KFSA 4O3QA 3AVCA 3ZSOA 3S3MA 4MQ3A 2GUIA 3NFAA 2HHUA 4O3PA 2HW3A 5CA7A 1REVA 3Q8KA 4RNMA 3GILA 4FW1A 3LALA 3TR8A 3Q8LA 4HUFA 9ICEA 4M2YA 3LANA 4CGGA 2X74A 3G6XA 1RDAA 4LH4A 3PVXA 1NOYA 1S10A 2FLNA 4E7IA 4KI6A 1BPXA 4ECUA 3ZDBA 3NGIA 3AVGA 4LSNA 3LWLA 1I39A 4PHDA 1KDHA 4Z4EA 3HXMA 2B5JA 4M6WA 2X6SA 4PQUA 3VQ4A 4DL3A 1IKXA 2F1HA 8ICOA 1X1PA 3KJVA 3ZSVA 4AH9A 3ZT0A 3K5NA 5HBMA 2C28A 3ZDDA 4M6WB 2XY7A 1XS9D 4M45A 4CHPA 2FBTA 5KFRA 3AV9A 3M9OB 3T5HA 3QZ8A 1U47A 4ELVA 4DFJA 3ZSRA 3RH6A 1TK5A 2PI4A 4BDYA 1HJPA 4X5VA 4CIGA 4N76A 3TWHA 3RJKA 1QSLA 3ETLA 4BXOB 4F8RA 1RTDA 2JGUA 4OKJA 1XHZA 1S0OA 3FFIA 3MGIA 4GW6A 1S76D 4IDKA 3KLGA 4LVSA 1ZQFA 4UB3A 2YNHA 4DLGA 3SYZA 2A1JA 1ZQGA 1ZQIA 4RPZA 1XSLA 3SPYA 1UAXA 2ETJA 3T5JA 5J2QA 4JS5A 2A1JB 3CQ8A 2BHNA 3OSPA 2FMQA 4FLUA 3C6TA 4BACA 2PI5A 3OYFA 2OPPA 8ICGA 4BE2A 4DEZA 2FMPA 1S6QA 4W5RA 1ZQOA 1RBRA 4CEQA 3AO3A 4CERA 4KLEA 7ICPA 2PYJA 1TKTA 3MFIA 4FM1A 4Q44A 1TK8A 1IXRA 5HNKA 4CE9A 4HUEA 4PWDA 4KHYA 4Q43A 4B3OA 1BISA 4DQSA 4PUOA 4RPYA 3S3OA 3CFRA 4FJ8A 7ICSA 3VQ6A 3EY1A 2BKEA 4RQ8A 4Y1DA 1NKBA 5KFUA 4F3OA 4NCBA 3VQDA 3VQEA 4JLHA 3HSTB 3Q8PB 2XY5A 4F5RA 4DL5A 1XWLA 4XQ8A 1TFRA 1KVCA 4KLFA 1HQUA 5DG7A 1C1AA 2R8HA 5IINA 4O5EA 3V81A 1L3VA 1N56A 4C8OA 3LDSA 3GV8B 4J2DA 4BE1A 1RT6A 4Z4GA 2RDJA 4J9PA 4R63A 3IM1A 2OPQA 1VSDA 1PZNA 4DQIA 3HWTA 5FROA 4F5NA 3UQ2A 1ZBHA 3SUNA 8ICIA 3V7KA 2X78A 1TGOA 3ALYA 2PFQA 3P5JA 5DBAA 1SKRA 1BQMA 1VSEA 5EOZA 3Q8SB 4CJRA 4GMJB 4JV0A 5DGBA 1ASVA 1UA0A 1RXWA 8ICNA 2WOMA 4NYNA 3QEBZ 1S1UA 1V9PA 4FBUA 4FJMA 4M9GA 3MEDA 4KTQA 4F4XA 3OYEA 3PW4A 4IFYA 4J2AA 8ICYA 3NBPA 1HMVA 2A1SA 4QZ9A 4YP3A 4L8RB 4TQSA 1HYVA 5SWMA 4FBTA 1NOZA 2DPIA 4P2HA 5KGWA 5KFQA 3OYGA 3MXIA 2FPKA 3HVRA 5F9NA 3HX0A 4DOBA 8ICXA 4FCYA 3V6KA 1KLNA 3QESA 1W0HA 1Q8IA 4YQWA 4MF2A 2FMSA 3VQCA 4RG8A 4RW9A 4K4IA 5KTQA 2ATLA 5L1LA 2OA8A 4ED1A 4OGCA 3VQ5A 4PA1A 4PGXA 1TV6A 3HPHA 5KFNA 4DO9A 4DFKA 4M04A 2Y1IA 3O3HA 2ZTDA 3AO4A 4KKOA 5KT2A 9ICOA 1TKZA 1LWCA 2P51A 2WONA 3PNCA 2ZJAA 3LPUA 4I2FA 3T3FA 9ICTA 3K5LA 3RB6A 3QIOA 3ZSYA 1X9WA 2AU0A 4E3SA 3CFPA 1W9HA 3ZD8A 3MEGA 3TAFA 5KFFA 4ED7A 1RT2A 4DG1A 3TFSA 1L5UA 5J2FA 4I2AA 1KRPA 3CYMA 1UT5A 4FJLA 3LAKA 4IFVA 4KTWA 2NRZA 4EBDA 4IRDA 3RMBA 1ZBLA 4B9NA 4FK2A 9ICQA 4Y1CA 4I2IA 3UXOA 3VA0A 2JEIA 9ICNA 4M3ZA 1WN7A 2J6UA 5KG5A 1RT5A 3C5GA 2BPGA 1Y88A 4O9MA 5KFDA 3AVLA 2OYQA 9ICFA 4UB2A 4P4MA 3I0SA 4LH5A 4CJEA 5J2DA 5KG4A 4EEYA 2B4JA 5BOMA 3VQ7A 3O3GA 1CXQA 8ICUA 3L2RA 5DLGA 5KFLA 5KFVA 4ELTA 1DOQA 2R8KA 4I28A 3NGYA 4R5PA 7ICOA 2ASJA 4RQ5A 8ICWA 5CR0A 4DL7A 2HB5A 4K8ZA 2EX3A 1A5VA 4FS2A 5KFMA 2ZUCA 3UQ0A 4IRCA 2BQ3A 4MFCA 8ICAA 5KT3A 1RYSA 3T1AA 3HO1A 1VSHA 1ZJNA 4P4PA 3UXNA 4DOCA 3EZ5A 3V7JA 3E2EA 4O5BA 5KFSA 4CK1A 3SI6A 4FJGA 9ICGA 4I7FA 1DLOA 4KITB 4JS4A 1A77A 5KGXA 4O0IA 1HUOA 1U9LA 2HHSA 4KLGA 5IIOA 3AVMA 1NJXA 2QKKA 2ZTEA 1RYRA 3V1OA 4W5OA 2Z1GA 4E7HA 4BDZA 1U49A 3ZSXA 3AA4A 2BPCA 4M0AA 1HRHA 5KFPA 4DU4A 4PHPA 2UVVA 3VQPA 4CJSA 1TAQA 5J2JA 2G8VA 1QSSA 4CF8A 4F91B 4F4WA 4AHUA 2DY4A 4DTNA 3DLRA 5CJ7A 3SUOA 3PUFA 5J2EA 1ZQEA 2KW4A 4DTSA 5J2NA 3GDXA 4JK1A 1C1CA 2KFZA 1IKWA 3F73A 3RJJA 4B9VA 9ICSA 1BCOA 1JLQA 3KLEA 4KN7A 4J9NA 1D9DA 2YHBA 2FLLA 5C42A 3OYLA 4OLAA 1WSEA 4DQPA 2XO7A 4KV8A 3TAMA 5KI6A 1TL3A 4CEEA 3SPZA 1SV5A 3VQ9A 1BGXT 1ASUA 5EWFA 4UBCA 4H4OA 5IIKA 4DWIA 5HRRA 4UBBA 3H4BA 3SV3A 1QQCA 1RTJA 3OYMA 3AUOA 2ALZA 3AA5X 4KFBA 4CJFA 4I2CA 4KLQA 1SUQA 1S9EA 2KZZA 4FK0A 5KT6A 4QWCA 1NK7A 4RUCA 4IR9A 5CWRA 3ITHA 4EP5A 4DQRA 1A5XA 3KKSA 5TZVA 1QE1A 4MEXA 2ZJ5A 4YD1A 1ZBFA 3TARA 1RTHA 2ISOA 1RT1A 1TKXA 3EYZA 3IAYA 5J0OA 3SJJA 4HVJA 2IDOA 2FC0A 4RT2A 2ZUDA 4W5TA 4DL4A 1CZ9A 1X9MA 3C2MA 1DTQA 3ZDAA 2Y1JA 5KFZA 3NAEA 2HNZA 1EKEA 1S6PA 4LZGA 4CCHA 4EZ9A 4ED8A 2RDIA 4QZDA 3K59A 5J2IA 4CF1A 3LK9A 3B0XA 2ZUBA 9ICHA 2E6MA 5FRMA 4GLXA 4YMMA 1RNHA 1Z26A 3HPGA 3RB4A 2XY6A 2B21A 9ICMA 4M3XA 3RH5A 2I9GA 5JS1A 1RBVA 4B9TA 3PV8A 2DFLA 3C21A 1DTTA 4ELUA 3ZT1A 3TI0A 4GVMA 2DFHA 1B9FA 4FLTA 4Z6FA 4KLUA 2J6SA 5J0UA 3AVIA 3ZDCA 4H8KA 3T5LA 1LB2B 3ZDEA 3ISNC 7ICIA 4QZEA 5T7BA 4CJWA 2BQRA 2NRXA 4O5KA 2I1QA 4DLEA 2BPFA 4F4YA 1JX4A 4ICLA 3S9HA 4QWAA 2DTUA 1CXUA 1JMSA 5EU7A 3WNFA 3DRPA 1QTMA 2ZE2A 3NF9A 4DFMA 2KZMA 1HYZA 4F3TA 5J2BA 3C1ZA 3OVNA 4IKFA 1RPLA 3HM9A 1T7PA 4FLZA 4IBNA 4DSFA 3LZJA 4CF0A 4BDPA 3RJHA 3GIKA 3L2WA 1U45A 3ASMA 2RPIA 3VQBA 1B22A 4O44A 3OHBA 1IKVA 2D5RA 1B92A 4HHTA 4M42A 4M47A 4F92B 2UVWA 9ICLA 4Z6EA 4YFUA 5I42A 2P6RA 1WSGA 5KFTA 4UAYA 2FPMA 5DDYA 4QWBA 3H8WA 1EX4A 1J9AA 4DOAA 3KK1A 5L9XA 3M8PA 7ICRA 5C5JA 3BQ2A 2C2EA 4EP4A 1D5AA 5JS2A 3VA3A 4P4OA 4B08A 3H08A 4KHSA 2PZSA 2IHNA 1J5OA 1SZPA 1ZQRA 4E7JA 4CK3A 3OYKA 4JV1A 2O4IA 1XU4A 4JRPA 1TK0A 2F8SA 2YHAA 4E7LA 5KFGA 3NH0A 4KHWA 2KQ2A 4FLVA 4KLDA 3QZ7A 1RZTA 2ZD1A 1LWFA 1K1QA 4CHNA 1A76A 3AU6A 4RUAA 4TQRA 3GV5B 5IIIA 2OPSA 4J9SA 2G8HA 2B6AA 5KFHA 4BWMA 4JRQA 1L3UA 8ICRA 4M41A 2W9AA 3OS0A 3RMAA 4BE0A 3OJSA 3M8SA 3JYTA 1IH7A 4AHVA 1S1VA 4ID1A 4YN4A 4CJKA 2G8WA 3EWAA 4AHRA 8ICKA 2FBVA 3ZT4A 4QZFA 3V9ZA 3U3GA 4CJUA 1XHXA 3RJIA 1HQEA 1MQ2A 4N5SA 3DLKA 3PW5A 4FM2A 3PR5B 1KVAA 5J0WA 5J2HA 2BCSA 1HNVA 4QW8A 4NM2A 4I2PA 4J9MA 2IAJA 1T03A 4G1QA 1S0VA 5DB8A 4UB5A 3NTUA 4CGIA 4I2HA 4FJNA 1BQNA 1EXNA 4UAZA 4N56A 3NF6A 3T19A 3M9NB 4DL2A 3AVJA 4RQ3A 3QLHA 3JPRA 3WNHA 2VG6A 2W9MA 3C94A 2YV0X 4KHNA 3V1RA 3OYAA 3ISDA 5D4BA 5J2CA 4I2BA 1F21A 3BJYA 4DU1A 4M9NA 4KI4A 4Q8FA 3HK2A 3JPNA 5J0SA 2P5GA 1TV9A 9ICKA 7ICKA 4M9LA 4YXMA 5F9LA 3L2QA 4LSLA 3SQ1A 3IRXA 2BCQA 3HW8A 4NYFA 3FYHA 1C0TA 1Q9XA 3SI8A 4OJRA 4MF8A 3HT3A 2ZTCA 4O3SA 3GV7B 1QS4A 4I2EA 3NF7A 4LD0A 5C25A 4YR3A 4IR1A 3SQ4A 3BQ0A 2LYHA 2H5XA 1BCMA 1U4BA 1TL1A 1Z25A 4K4HA 1WAJA 2XY8A 4PY5A 1C1BA 1JLFA 3DLGA 4J9QA 3QINA 4B8AB 4Q0BA 1LAWA 4FZYA 4J2BA 8ICZA 1YTUA 4GXIA 3SCXA 5KG3A 3C6UA 4YCXA 2R8JA 1YT3A 1S5JA 2V9WA 4RQ7A 4M3RA 2ISPA 1CLQA 3LP0A 2C2RA 3U6FA 1T05A 1VK0A 4ID5A 2FPLA 2VWKA 1HUZA 3H40A 2D0AA 1L3SA 3AO2A 2RF2A 1WSIA 1JN3A 4UB1A 4M9JA 5DQIA 4CESA 1NJYA 3MECA 2AQ0A 5IIMA 1UT8A 3BDPA 3DLHA 2BCVA 1HYSA 4KRFA 1BL3A 3QEXA 4CK2A 5DBCA 5D49A 4NLKA 4FM0A 3AVKA 3SQ2A 1WCLA 4DTXA 3TABA 1TAUA 9ICPA 3ORYA 3PX0A 4RQ1A 2HVIA 4FJXA 3EPGA 1COOA 5J0XA 3OS1A 4LY7A 4AHCA 1ZQXA 2DFEA 9ICRA 2GV9A 2WTFA 2BCUA 4OPJA 5FRNA 9ICVA 1BVSA 9ICUA 4CIFA 7ICFA 4JWMA 5KFKA 3AA3A 4KLTA 4RZRA 4CF2A 2PFNA 4MFFA 1ZQNA 2HHTA 4Z4HA 1ZQQA 4EYHB 4CHQA 3MDCA 4DF4A 1GOAA 1NK5A 3AO1A 3G10A 1KLMA 1ZQMA 1VRUA 4YFKA 7ICQA 2J6TA 3KTQA 4YVZA 3P1GA 1RCHA 3IHQB 3D45A 4FJIA 2JZBA 1G15A 1KSPA 3V7LA 3NF8A 1RBTA 3ZD9A 3QEAZ 4DMNA 5J2PA 4FZZA 2KN7A 5KFYA 4GXKA 3QEVA 4QW9A 3CM5A 2JZBB 4B8CA 4DTJA 3KLFA 4OLBA 4QWDA 1XC9A 4QOZB 5SZTA 2V4RA 1NJWA 3P83D 5CB1A 1I3AA 4C8LA 3DRRA 4ECSA 4YD2A 4CGFA 1XSPA 3HP9A 4CHOA 4FS1A 5J2MA 1X2IA 5CHGA 1WLJA 3WNGA 3G0ZA 7ICEA 4AILC 3M8QA 2OPRA 3RBEA 4Z4FA 5HLFA 1U48A 1SKSA 4ED3A 3T5KA 4KPYA 2BANA 1A5WA 5HP1A 3DLBA 3RWUA 3PR4A 4DTMA 4QZGA 4CF9A 4PGYA 3SZ2A 1S0NA 3O3FA 2ASLA 2QKBA 4FYDA 3QETA 1ZQHA 2A1RA 1UA1A 3ISBA 2FBYA 3JPOA 4CJVA 3E01A 2HNYA 2KZ3A 3O4QA 2IOCA 1VSIA 1NKCA 3MR3A 4E1MA 2YNIA 4C8KA 3UXPA 5KG6A 4E1NA 2XCPA 4I2DA 4QZ8A 4F2RA 2V4QA 4DSJA 3ZT2A 1C6VA 2C2DA 2G8FA 2VA3A 4ECTA 3OJUA 3U3YA 1RT3A 4W5NA 5L1IA 3SNNA 4ECYA 4XIUA 4CEBA 3Q8RB 2VA2A 5J0QA 3RTVA 3PW7A 3NH1A 1QHTA 1ZQPA 1RBUA 4O0JA 2IBKA 4UAWA 3K58A 1S9GA 4J2EA 4DSEA 4DF8A 2RN2A
chains in the Genus database with same CATH superfamily
1QQ7A 4DCCA 4GC7A 5CH7B 4YHHF 2DXFA 3EVWA 2PFDA 1IIPA 1OKJA 4ZDNA 2Y8YA 1JLBB 2MQQA 2XULA 2IS3A 2NUHA 1JXVA 1NMNA 2ZVIA 4DV5J 4WQ5C 4OJGA 2GELA 1CC8A 1CUKA 3PFOA 4RW7A 8ICHA 4ZH4A 4CW7B 2KXNB 1JLAB 1K6YA 3ETRA 3A8IA 1DGKN 2D0OA 4USKA 3JSMA 1NCLA 4DV0K 5HHHA 4FLWA 4OZ0A 3P5TL 4FF2A 3OY9A 4NM1A 4DR4K 1Q7YO 2VIXA 3SXLA 2CXEA 3THXB 3SAHA 3CERA 2XYGB 1EP4A 1WAFA 1QE1B 3CVKA 1XR6A 5HANA 3CWJA 4ZVEA 1MU2A 1TKXB 1B0TA 4P0QB 1HBOB 2YNFA 1WF0A 3MOJB 2HNDA 2HGLA 3WIVA 4NXNF 3PDNA 4M3YA 3LWMA 2BEFA 3UPFA 2WAQC 5ADXA 4O3NA 1IKYB 3K8VA 3A5LC 1QLNA 3M6XA 5BRDA 1RYUA 4Z4CA 5IT9Y 2ZUAA 5KFIA 4J37A 4LREA 2GQQA 3CJSA 1YUWA 3SMVA 7ICMA 1P1TA 4LF4K 4YDUC 3MR7A 1C0UA 2R8IA 4UOCA 5AQHA 2R8GA 1ZQKA 5HR6A 4JI4F 5DM6L 4U7UK 3K17A 3N6LA 3QSIA 3C65A 2DHHA 4FP9A 3TAQA 3K2YA 1T3NA 1NK8A 3DOLB 1VLOA 2E2QA 3L5KA 3WQUA 3AGRA 3R8EA 2Y8WA 1EB0A 1S72N 2YNGA 5AKJA 4OL8A 2PO4A 1DEJA 2W7AA 1YF5L 4DV7K 4CFAA 3NCPA 2ROPA 5KRTA 2HKEA 4WKRA 1Y5LB 5CYQB 5DDQC 3PMNA 3TFRA 1OMSA 3RRGA 2D41A 1CJTA 4BC4A 4GXJA 3PW0A 3F5TA 3TQEA 4CEAA 1UFKA 3MAAB 3L95X 2JLEA 5DDMA 1WWHA 3HD2A 5ALWA 2F1JA 2RDDA 2W7OA 2P5OA 1WHXA 1UP1A 2MUTA 4EBEA 2W9BB 1TELA 3RVCA 4O3RA 4R8UA 2XTJP 3QMLA 3QT5A 4W90B 5BJRA 3K5OA 5IWAK 2E1CA 3CJ5A 1HHQA 4ID8A 1NKEA 1R6YA 3QXGA 3E3XA 4F0HA 4JI2F 4F26A 3FNNA 4Z6DA 3M8YA 3LVVA 4P74A 3T6JA 1HNWF 4DPYA 4GY2B 4C1NK 1WTBA 3AT1B 4EUVA 2IPOB 2CQIA 3KZBA 4BBYA 3L4PA 1N32J 1T6CA 3FSXA 2DJWA 1AUSL 4QWEA 1U1OA 2DBYA 5ALZA 3M3ZA 3NKYA 3OYHA 1R27B 4JV2A 3KK3B 5KL8B 5D3GA 5HRSA 1T9WA 3OTCA 4GVLA 3CHWA 4OHZA 3J7ZT 3AVFA 2DNHA 1A0PA 4RQMA 5ETQA 4ECRA 4H0VB 1FKAF 8ICPA 4BR9A 5HK4A 4BXOA 3IP0A 2KLAA 2P9KB 4KLJA 4C3KA 4AFFA 3NUQA 4A46A 3BQ1A 3ATUA 3GSIA 2Z8QA 1XNSA 1FESA 1FKOA 4ZCIA 3MEEA 1TYQB 3G82B 3DXSX 4DV2F 1YVUA 4BC3A 2OTLN 3OSNA 3D2SA 1EETA 8ICJA 1QTNB 4ICAA 1QCKA 3UCGA 2M9NA 2UU9J 2BE7D 3HPOA 1SXDA 4J9LA 2J9DA 4GKKF 3AY9A 4CNQA 2YH0A 4NEZA 3TO8A 3K9KA 3J7Z5 1GLBG 4EGLA 4KTZA 2IAJB 1FNMA 3AAWB 3TR5A 3QE9Y 5EE1A 2KKVA 1HNXF 4Z7CA 4I6YA 3DHXA 1RT7A 3AHPA 1HR0K 2ZM6J 1S7IA 3L7OA 2AJ1A 5KT7A 3N79A 2E1MC 3IBCB 1QVGR 2W8LA 4ECXA 4Y2SA 2XLJA 2F9TA 3RMDA 2BGGA 1NJIT 3V6DA 3HVTB 2VGNA 3WXKA 5DETA 2O4GA 5D15A 3LP2A 3CF5Q 5ALPA 2EEYA 3DLLL 4W98A 2KEYA 1NOMA 4TUSA 4CZHA 3FE1A 2LMIA 4QPTA 4Y3CA 3N6NA 4B3MF 3WXMB 5JJBA 3OVAA 4K0KJ 3WX8A 4X4PA 2MY8A 1UPHA 5IIJA 1NO8A 3MGJA 3P5BP 1KC8T 4GKJF 2R7SA 2AQ4A 2BUNA 3PJXA 1X0FA 3E1YA 4EK2A 4PHAA 4JUZA 3H5YA 4DS4A 3OVBA 4HTJA 4DTOA 4C8MA 3C3LA 4OKEA 1B99A 2IC3A 2BW7A 2CNLB 1Z4UA 1MA7A 1NDCA 5DLFA 3SENA 1I94K 1Q8LA 1RDWX 1L3KA 1ILYA 1B43A 2KVCA 2VG7A 4CJQA 3DXBA 4RW6A 2BKPA 2FLPA 4OVLA 3M2VB 3EEQA 1X66A 3B4DA 5B0FA 2VC1A 2AIRB 4DPOA 2D9OA 3H25A 2A18A 2RF2B 3C5FA 3M2UA 4ZITA 1RHRB 4K7QA 1WOOA 3MPUB 4Y6IA 5AQRA 1UOCA 3ET6B 2GAGC 1AYEA 1VQNS 2NXJA 2DT9A 4QZBA 2IJRA 3U9ZA 1K73T 1N36J 1MWKA 1FXDA 1X4FA 2E5LK 1R3NA 3MM7B 3GJRB 3KKAA 4LQ9A 3SR6A 3FR0A 2MQ8A 4UOHA 5DGAA 4USTA 2W6KA 1Q3VA 5C2GA 1QJHA 4ZJLA 2ATQA 8ICVA 3V72A 2DNKA 2P6UA 2ZJQQ 1FEZA 4BLGA 3NS6A 3LGMA 2HMIB 1NM2A 1I6JA 2AYMA 3ZSQA 2AGPA 2PFOA 9ICIA 1S99A 5C24A 1JIHA 1VSMA 4WK1A 3HSGA 4PCQA 4HLBA 4J8FA 4JYAJ 4WYWA 2FQQB 2OI2A 5EVZA 2YQEA 4IQVA 1HQ2A 3B6OA 4DSLA 1WEXA 4IG3A 3THPA 5I4MA 2DVIA 4V19X 2YQ1A 2PGCA 1FJGF 8ICMA 4DCOB 2B9EA 5DG8A 3HSDA 4ED0A 2EI5A 1S7HA 1TVRB 1D8YA 2EANA 4ZCKA 1RHQB 1TFYA 2NUUG 4A57A 1N54B 3N9UC 2O8CB 3LOUA 4A2AA 1T3QA 1DY3A 3C2KA 3GZ7A 4HI2A 4W92B 4IO9L 2QE5A 3PLAA 2Z56B 2YWGA 2OWOA 2H3IA 1RXVA 3TYTA 4MYUA 4M63A 2YX4A 5J2GA 2CQ0A 4JK7A 1WDTA 4Y0FA 1NUEA 2IOHA 3CCWA 4MJKA 2GJ2A 1RLCL 2DPNA 4DCJB 1VQKN 3W61A 3UN2A 1N4LA 3R9PA 4KH1B 3KLHB 3CQYA 1MWMA 4CLYA 2BQUA 3NDKA 1JLGA 7ICLA 4YXJA 1JLCA 1D09B 7FDRA 2GHVC 3BB5A 3VTIA 4H4KA 2L48A 2KTQA 2P9IA 3OTDA 1F9HA 3O1WA 3UW1A 4RQNA 3DU5A 4FLYA 3NS5A 3LM2A 1WORA 3DFEA 2KM8B 2LYVA 3QFWA 2XS5A 1SV4A 4JI5J 4M3WA 4I2QA 4DR3J 1IJJA 4O55A 4NLCA 4IO1A 5I3UA 3IG1A 3IR7B 3BBCA 4C0OC 4A62A 3QQCD 2PN6A 2C2MB 5K8OA 2P35A 3AVNA 2B8PA 4UASA 1PGZA 1IUJA 4CZJA 4FOIA 1RT3B 1XO1A 1M5SA 4KO0A 1SPBP 1C0MA 3SUPA 2FBXA 2HHWA 3Q2TC 2ZH5A 2PAVA 3GFKB 1U6ZA 2GS8A 3D6HB 2FY8A 3F0NA 3KWGA 9ICJA 3H6EA 4UB8U 1ATRA 2IFXA 5CYJA 2QK9A 2DPJA 1PG5B 1VCTA 1JKHA 4LF7K 5CZ1A 1SKUB 3OLAA 3V5RA 5F8JA 2YY6A 2MQMA 4ZJOA 2KJ8A 3U7JA 2ZOMA 1K44A 4WIQA 3CETA 4JBCA 4UB4A 3NMAA 1F44A 2CH6A 1NWKA 3FK4A 1FDAA 1PAUB 2HBQB 1VQ4S 4O3OA 2ZVSA 2VANA 3NOCA 3DDIA 1N61A 3M1VB 4KJIA 1YRUA 4LFAF 3AVBA 2C3PA 4O8UA 5DB6A 1ZPVA 4DV1K 4M8LA 3VQ8A 2RRNA 3UNGC 5A8RB 3C28A 2QO3A 5KG2A 2DL0A 1HWUA 1L8OA 1HNIA 2E3TA 2VIHA 3UIQA 4H0PA 4JMUA 3WX4A 3TUJC 4HYKA 2YKAA 2QV6A 3BZCA 3W9JA 4NLBA 4E1JA 1Z4NA 4IWVA 1U8WA 2RRDA 3KHLA 2ZIXA 4NLPA 2DKOB 2JEJA 7ICJA 3MAQA 3VQAA 3T69A 4R66A 3JXOA 5HJXA 8ICBA 5ALMA 2I2YA 3KNAA 3KG1A 3V4MA 2WBMA 2QA4G 2LDIA 2O8DB 4LFCF 2DITA 3FJ2A 1VQPS 4DR5K 4HACB 3CMES 2IYGA 2CRXA 2ABYA 3IDHA 4CI6A 1S72S 1WSHA 3ULEA 4FJ9A 1NK4A 2BYCA 4TUQA 4X62J 5GMKa 4B1WB 1CZAN 4KLIA 4WU2A 3H4DA 3R1XA 2D0BA 2X1FA 3TAEA 3E51A 2LA4A 2K8BB 1XMBA 4NCGB 2K1RB 2H5JB 3S3MA 1S1XB 5AKGA 1UVJA 2D6FC 2HHUA 2V67A 5CA7A 3HZEA 4JI8K 1YVFA 1GMUA 3GILA 2NO4A 4FW1A 5T7LA 2DGQA 2DHSA 3LALA 1NRKA 1R89A 2RS8A 4AQYJ 3HHLD 4JI0F 3ZX0A 4IOBA 1HD1A 3KUHA 3LANA 3D9BA 1NOYA 3C14A 3PKYA 1BPXA 4LF8K 4EHUA 4J7CA 3TWZA 1KD1T 4BRGA 1R6VA 1PC5A 4E98A 4ZPAA 1V9OA 4DR2K 5CE3A 4PHDA 2NPFA 2PA8D 1T9XA 4LSNB 1B3TA 1ZRNA 3R6LB 2Q66A 2E1RA 2FZKB 2J76E 5JRTA 1L7NA 2MZSA 5HBMA 2MZ1A 3CCUS 3EVOA 4CHPA 3KJVB 4OV6A 3QZ8A 2M5YA 5FLXY 2VF3A 5F0XA 3ZSRA 2NSCA 4P2XA 2OHFA 1QD1A 1FCAA 4BDYA 1SS6A 3KKFA 4X5VA 4N76A 2AH5A 4B9QA 3H90A 2QG9B 2MPUA 2JGUA 1XHZA 1S0OA 1F9EB 5AM3A 2XNQA 3VOVA 3A4TA 5IOLA 4LF4J 4V19S 1VQON 3KJQB 4DI6A 2E9RX 1BWVA 2QTWA 2F3JA 3MK6A 3R5CA 5AR0A 2MKYA 3CCJS 4RPZA 1HBMA 1OVQA 4G9BA 3SPYA 1AZSB 2ETJA 1G7CB 2F4VJ 4M5HA 1EARA 1U2CA 4BREA 2FMQA 1Q5VA 2YTCA 3OYFA 4DEZA 3ZZRA 1PKUA 1BQXA 1HWLA 2X1GA 4ZKAA 4DV7J 3C6TB 2W4DA 2WB1F 2PYJA 4NLUA 2NCKL 5IZHA 2M8HA 1G99A 1TK8A 3UQSA 5MLCV 3GTYX 4PWDA 1UPPA 2CPJA 4B3OA 3N4WA 4G1PA 4TU8A 1U1KA 3TA0A 5FPMA 4FJ8A 3ONQA 3VQ6A 4KHMA 2VQEK 4DV3J 4Y1DA 5KFUA 4F3OA 4KE5A 3EUNA 3VQDA 2Q0UA 4JLHA 2HIYA 4M5IA 3Q8PB 3AQPA 3BBBA 3GMGA 1S79A 5IWAJ 1U8SA 3OT9A 3AQOA 4FWPA 4ZA1A 1TFRA 3MM8B 2DIUA 3BGFA 4OJ5A 1RHJB 1Q0NA 2LXFA 2E88A 3IAS9 1ESVA 1IBMF 2EFNA 5ALKA 1WUUA 4BRMA 1DQ8A 3U9DA 4CBXA 2EWHA 3IM1A 2FVRA 1VSDA 3V81B 2MA1A 1ZBHA 3SUNA 2QIFA 8ICIA 3IWLA 3WZ0A 2RHFA 4Q7AA 5E3CA 3P5JA 2GOLA 1BQMA 4HEA9 2EZXA 5ETPA 5EOZA 3Q8SB 4K4TA 4GMJB 4O4GB 5DGBA 3VVTA 5BPLA 1UA0A 5LOQA 4PKIA 1RXWA 4DN0A 2IOFA 4NYNA 4RNHA 1SC4B 1S1UA 4PR6A 2GHWA 2WAQD 3UKUA 2ZIUA 2RUSA 3MEDA 2MSSA 4F4XA 4GVEA 4CNZA 4TQSA 1NOZA 5KFQA 3MXIA 4JB3A 4K50A 3FEZA 3HVRA 2A1AA 3NRZA 2Q79A 1JI7A 8ICXA 1HMVB 3NBPB 4FCYA 3V6KA 1KLNA 3MMCB 2DO0A 5BR8F 4USAA 4MF2A 3VV2B 2CVIA 2B3TB 1NHVA 4N8OA 2M2BA 3BSAA 1S57A 3J7YU 1FE4A 4L73A 4OGCA 4NJ8A 4X65F 4PGXA 1X4GA 4HL9A 5HVGA 1F2GA 5AM1A 4DFKA 3R5AA 1JB0C 5FPNA 3W8GA 3O3HA 2ZTDA 1H0HB 3AO4A 1YX2A 2MZJA 1TV6B 3NAHA 1OVYA 3A5OC 4HHHA 4Z37A 3VESA 2V51B 2HBLA 9ICTA 1XNQF 2CG8A 3DXKA 3ZSYA 4DPXA 4E3SA 2O8EA 4PXBA 1Z1BA 1WC1A 2E9TA 3ID6A 2J0QD 3WK7A 1W9HA 2VQFF 4Y00A 1W2BR 2EDUA 1GXLA 3TFSA 2QB0A 1L5UA 1ZZFA 4FJLA 3LAKA 4OZ1A 4KTWA 5ALDA 2R2SA 4EBDA 3W5ZA 3RMBA 4Y2RA 4FK2A 9ICQA 1X4HA 4I2IA 3VA0A 9ICNA 5L46A 2XMJA 3DU6A 3ETOA 5J1EB 1FFSB 1RT5A 3C5GA 4O9MA 5KFDA 1P7DA 4UB2A 4KX3A 1MDUB 4WXOA 4LH5A 5KG4A 2VPZB 4OX9J 1Q82O 3W2VA 2NPIA 4FN5A 3L2RA 3QGPA 4C9DA 3D2NA 2ZIWB 4R5PA 1A6LA 4H5NA 2COLA 2PIIA 1PK1B 2HB5A 2ZIVB 4K8ZA 4X66K 2O6KA 4OZJA 8ICAA 4MFCA 2XHCA 1V38A 5AQFA 2MZTA 1VQ8N 5KT3A 1J2VA 1RGIA 3HO1A 3SQOP 5DZ6A 3I56N 1FK9B 1RU1A 5ALGA 4HR2A 3K5PA 1RDRA 4FVCA 2XBPA 3SI6A 1ROFA 4I7FA 2CPIA 1Q8KA 2GVZA 1B4SA 1WC6A 3QFUA 4O0IA 4KLGA 1DLOB 2ZG6A 1N5TA 2ZTEA 2Z1GA 3T79A 3UN3A 3ENOA 2XWXA 3EM1A 1BUPA 2ZH1A 1YG0A 5KFPA 1X3MA 1IBLK 2JH1A 4PHPA 2L3MA 4OYIA 3QRPA 4FPAA 3HSCA 2Y0SF 3W9HA 3BSOA 1KVIA 6AT1B 2FHJD 3BH7B 2D3DA 1QAXA 4AHUA 2B4OA 2U2FA 4KGKA 5M1FA 5HMZA 1CPZA 1SI9A 2V68A 3NCQA 3DCAA 4QIWC 5J2EA 1ZQEA 4DTSA 3QAEA 4UZCA 3GDXA 3MM9B 4WFNQ 5AQMA 2DIVA 1U2VA 2J8SA 2V7YA 5DDRC 1SH3A 4YOEA 4IOCL 5J2NB 5E33A 1IKWB 2FLLA 4CH1A 3OYLA 2W43A 4ZJQA 3FUYA 1UEVA 2FSJA 3HHEA 3UKRA 1WSEA 5A2QY 2RNEA 1PYTA 2DKZA 5K8PA 1SV5A 3SEOA 1BGXT 3FRYA 2VODA 1ASUA 5AQZA 4QS7A 3SV3A 1HIYA 1RTJA 3OYMA 4KV8B 3TAMB 4KFBA 3AA5X 3OR1A 3HFVA 3J81j 4F71A 4I2CA 5CRXA 3F9MA 1FKPB 4K41A 4LRAA 1APSA 1V5IB 1NK7A 4RUCA 4P75A 4F4AA 4ZVOB 1QE1A 4BRAA 2J7KA 2ZJ5A 3TARA 3G6EN 1TKXA 2VDHA 3EYZA 3IAYA 5J0OA 3SJJA 4HVJA 5ALFA 4JI1J 2A3ZA 2IDOA 2FC0A 4W5TA 1RA7A 1WG5A 3ADAC 1X4CA 1DTQA 2KK0A 3ZDAA 3PZPA 4CH0S 3H3OB 2HNZA 2V4JB 4DHVA 5A8WB 2RDIA 2UUTA 3K59A 4CF1A 2F4FA 3LK9A 3B0XA 4OJOA 4U96A 2ZUBA 2FHOB 2OXOA 1S6PB 2PKEA 2D3OR 4GLXA 2LEAA 3UFCX 3ZZUA 2N7YA 3RB4A 2XY6A 1RE1B 2P6SA 4DUYK 1NI3A 2XYPB 1RBVA 2MLXA 2FJDB 2MEWA 5ETSA 5E7OB 3ZT1A 4Z6FA 1NZBA 4KLUA 2J6SA 5MLCQ 5J0UA 1SV0C 3ZDCA 1J2NA 3NRWA 1LB2B 4K4VA 1TR0A 4U8VA 3R8YA 4WQ5A 2HQCA 2IVMA 4GVBA 2DGZA 2YJFA 3GJQB 2L5YA 2LBOA 4QZEA 5T7BA 1D8ZA 4CJWA 1GLDG 2BQRA 2W2NP 4MO4A 3N4PA 1ZD3A 4K4SA 2RU9A 2I1QA 1DKGD 4F4YA 1JX4A 2Q6BA 1ZH5A 1KDNA 2VV5A 3DRPA 3MN9A 1Q95G 1QTMA 1JK9B 3CJKB 3I8BA 2CQ4A 1TUWA 4ICLB 4BR4A 3OTBA 1S48A 3PJ9A 5J2BA 2XMUA 2J0WA 3OVNA 1REVB 3BS5B 1T7PA 1PYOB 4B1YB 5H2FU 1DAXA 2XMTA 3L2WA 3QUTA 4RCHA 3ASMA 2RPIA 4X64K 2HWIA 4LF7J 3OHBA 2HK2A 1GNKA 2ZUGA 4M42A 1UVLA 4M47A 3VEXA 4UAYA 3H8WA 5L9XA 1FNOA 2WSFC 5D77A 4XEIA 4JKGB 4EP4A 3VA3A 2R2UA 4WFXA 1SJ3P 3Q8UA 4IH7A 2IHNA 2ZM6F 4E7JA 4CK3A 3N7PD 4PZOA 1VISA 1LKYA 2I5HA 3HKZC 4KHWA 2MYFA 1T11A 4DV1J 1UKUA 3I55S 2C42A 4ZPWR 1P27B 5AQOA 3BYRA 1VQMN 3D7EO 4QIWF 5AK6A 3GV5B 2H4WB 4P6QA 1GEHA 3BR9A 3H0PA 1L3UA 4M41A 1BU6O 2OPSB 4BRHA 1FXRA 3DRYA 4RWXA 4B1UB 4ID1A 2AV5A 3TADC 4NZ0A 2FIUA 3A13A 1VQLN 2BJEA 2DNRA 2FBVA 2EC2A 1RQLA 1YGYA 2GVDB 1C2PA 2CADA 3FCHA 4OJ1A 1GFWB 1RXOB 3GOIA 3S7RA 4N5SA 3WDOA 1IWAA 5AXMA 4WZMA 1KVAA 1HQEB 4NM2A 4C3MA 2YB4A 4N8NA 2IA0A 3DLKB 2ADCA 3ENBA 2IAJA 5AQTA 2W1BA 1R0BG 1S0VA 4QYZK 2PMWA 4NRUA 3AXKA 2HVDA 1UTAA 4H5RA 4CGIA 4RWTA 3HT0A 1VFJA 1I1GA 5IT9O 5F3TA 3T19A 4PL2A 5GINA 3O4WA 2E5IA 5ALHA 3JPRA 1SGGA 3C94A 2R7UA 3H42A 2YV0X 3TZXA 4DR7J 4PPZA 3V1RA 3ISDA 5EDWA 3QLHB 4I2BA 2BE9B 4DU1A 4M9NA 4KI4A 4Q8FA 2XZTB 2BTFA 1N36F 2P5GA 4X2BA 3GR1A 4LF8J 5L1MA 4WTOB 4Z94A 2UXCK 4X4QA 1SJRA 4C7YA 2ZH9A 3FYHA 3N6MA 3I87A 3SI8A 2OSQA 2OYYA 4OJRA 4BCAA 9RUBA 4LSLB 1QS4A 4LD0A 7AT1B 1HEKA 2XNRA 4IR1A 1X4BA 1RT6B 2DNGA 5AQQA 2LYHA 2H5XA 4I0WA 1BCMA 1FEHA 2Y0BB 4EIAA 1DURA 2UXDJ 4BRLA 4OHYA 1Z25A 4PY5A 4CYUA 1WELA 3GB0A 1RGVA 1JWWA 1NGBA 5E5NA 4JYAF 4NV0A 3EGNA 1RWVB 3C6UA 1OQ3A 4HDGA 4YCXA 4OJ3A 2R8JA 4Y2CA 1FDDA 4OIXA 2F8MA 3CCSS 2E20A 3FMWA 1Q81O 1T05A 4OZ3A 3U6FA 2V69A 2UUBJ 2FPLA 2I6WA 1HUZA 3H40A 3PEHA 1S5ZA 5BRFA 2HCFA 4ZS6A 5GAGU 2GFFA 2RF2A 2OTJN 4UB1A 2ZNYA 4CESA 3W9IA 4NL9A 4IH5A 1TAMA 4Z7YA 1UT8A 1FI4A 3BDPA 3MDFA 4OI4A 3DLHA 5KAKA 4KRFA 1BL3A 3QEXA 4IC9A 5DBCA 3MM7A 4RBTA 1HYSB 1H2UX 2HDOA 1RWMB 2CDRB 2D0PA 1ITPA 1E6VB 4FJXA 5J0XA 2H3FA 4QR1A 1GLLO 4JI7K 4ZP9A 2HVZA 3D2FB 9ICRA 2GV9A 4LFBK 4I1TA 4A8EA 1YITS 4DUZF 5IT9U 5KFKA 2V52B 4KLTA 1BA1A 4CF2A 5F0UA 2PFNA 2Y9TA 1ZQNA 4QS8A 1F5BA 4ETZA 5BYRA 4EYHB 3QBXA 3MDCA 4DF4A 1GOAA 2QX0A 3AO1A 4DR3F 2A2DA 4IOCQ 4LJMA 4EMDA 5AI9A 1RT2B 1X4EA 1UVNA 4IJAA 5F8GA 4X4RA 4YVZA 4WFZA 5C2DA 2EFOA 4FJIA 1GLFO 1KLMB 4JKDA 2OHDA 1LK7A 3MZIA 1B0PA 5E3QA 1G15A 3F5EA 1JNRB 2KIWA 1RBTA 1S4EA 2ZGYA 1JCGA 3ZETB 2KN7A 3ZC4A 3QEVA 2ZZNA 3CM5A 3CRXA 3KLFA 3SEIA 2YBVA 2VJ4A 3TZYA 2FJWA 2GO8A 2HBMA 2IVPA 2V4RA 3DOMB 2W4CA 3Q7CA 1HNZK 2A42A 1I3AA 2AX0A 3DRRA 4DJBA 3OFGA 4CGFA 1XSPA 3MPWA 4AE5A 4FS1A 2O8FB 2W6LA 3ENHA 3C7NA 4AILC 4OHWA 3RBEA 3OXGA 3OPKA 1U48A 1SKSA 3QSYB 1U1LA 2PEBA 2JFDA 2OPRB 1YLXA 2QMUB 2UUCK 5HLFB 3EN9A 3JXUA 3HD1A 2BRKA 3OXFA 4CF9A 4DV4K 4K2JA 1K8AT 4PGYA 5SUHA 1ZBSA 3ZTPA 5KPZA 3R27A 4XAKA 2Q6CA 3SJHA 1QQNA 2WF9A 4JKBA 2JWLA 2QWRA 4TY8B 2FBYA 4YOUA 3GR0A 2DGOA 1SIJA 4CJVA 3E01A 2EKYA 4OYZA 4CGZA 1PBAA 2NZTA 2GIFA 2DNNA 2R18A 2FZCB 2XG8A 4E1MA 2YNIA 3UXPA 5KG6A 3M32A 4FYYB 4P0PA 5EOYA 2B0CA 4DPWA 3TZZA 5AKZA 4M5DA 1JROA 2HF3A 4ECTA 2PMZD 3CDUA 3U3YA 4WIIA 1RT3A 1WBBA 4ECYA 4XIUA 1C20A 3QU5A 2HMPA 2GH1A 2VA2A 5J0QA 3EGVA 1QHTA 2XSJB 3A12A 2IBKA 1OY9A 2HI0A 1C4CA 1S9GA 2P9LB 4M94A 4DF8A 4JI3J 4BRFA 2E1PA 4OI2A 3EW9A 1TUUA 2Z1JA 2RKIA 3D66A 3MM5B 1NK6A 3BQ7A 3FBFA 4OQJA 4Z0UA 4BS2A 4Q45A 4MKBA 3V4IA 4A8XA 4CEDA 1MLAA 3QO9A 3ZZZA 1JJ2M 3DN9A 8ICFA 1SQFA 3VAHA 2AEMA 5JMNA 3M9MB 1Y10A 1NSPA 3U02A 4NYOA 1JUDA 3QNOA 2VKZG 4RW7B 3D2QA 1Z19A 3K9JA 4X62F 4E0DA 1ICEB 4U67Q 1XMQJ 1T9UA 3WXIA 2MRLA 1W26A 2JEGA 1LAVA 2HBKA 3WQTA 2G4BA 2RU3A 5LMUK 2LM1A 9ICCA 2R7YA 4DKWA 1WF1A 3CIPA 3QERA 3HZ6A 2G1DA 1T9VA 5HHIA 4YR0A 4AQYF 2LQ8A 2XMAA 1NEEA 1EP4B 4KH6A 1PK3A 4ISFA 3M6KA 4J9KA 1MU2B 4YY3J 4WE1A 2QFIA 2LYBA 3BSCA 5KG1A 1SQKA 2KHCA 3M7VA 2KVIA 1VOMA 3QBCA 3KHHA 2XC9A 2HNDB 3L3VA 2DF4B 1XN9A 5L38A 3RJFA 1S1WA 2OZMA 8ICCA 4WFAQ 4BROA 4ITSA 4I56A 3MN6A 3ISCA 1XQSC 3MDQA 5F8MA 2QLTA 2QLBB 4GV9A 3J7YP 3AN1A 5IS2A 3CXCR 1KFTA 2LKZA 1C0UB 1YHQN 3H5UA 1QH9A 2P9SA 4CJTA 3K4GA 1MW7A 1GK8A 2LU2A 4CM0A 1IBLJ 3D67A 5HR7A 2FJBB 2KHOA 5ALOA 1U0SA 3HYFA 4HTLA 4ZLPA 2PMHA 3FBBA 2YNGB 4FJHA 1P9QC 4YB7A 1UJ6A 2VPXB 2B7BB 2BABA 1BPBA 4CEFA 5LJVA 4RUHA 1Z00A 2E7WA 2ZNZA 3OHAA 3OQ2A 4UUXA 5B08A 3MURP 3LAMA 3MABA 2YPZA 1P8GA 3QJPA 4RNOA 2JRSA 3P4IA 1LEOA 4K59A 5BPCA 3IS9A 3LP3A 4ZPVR 1SBRA 3EUB2 2UUWA 1XEZA 3SIPB 1ATNA 2OEKA 1K1SA 5B0EA 3S1TA 4Y2UA 2ZOFA 2MUTB 5HQ8A 3V9XA 3KZIU 4OJPA 1GOBA 4KIAA 4ZLNA 3QIDA 3HULA 1ULRA 4O44B 2F4VF 4R8UB 1VQ5N 1CRXA 1Z3EB 4QU6A 3EPIA 5CXTA 4TVAB 5HMLA 3JQJA 4KY3A 3J81Y 3M8RA 1BWFO 4FJ7A 1HL6A 3CD6S 3A5NC 2ZQBA 2R7XA 1OUQA 4UQTA 2EH9A 4BRDA 3BKFA 3FQLA 2LP4A 5IV4A 1VRQC 4QQBA 4IDHA 5B66U 2B9XA 4IEEA 3W5XA 2VONA 1N60A 1URJA 4DV3F 3L3FX 3WK8A 4UF4A 4RNNA 3PMLA 3UD4P 3PIPL 2VKQA 2NLXA 1YI2N 3SQ0A 2MKCA 1FD8A 1L3TA 2KH9A 5L1KA 2BBEA 3MPYA 2KIVA 4FNIA 3OBYA 1PUZA 3NY0A 2HLUA 3RB0A 2D7SA 4UY8O 1LKZA 3QWPA 3QEPA 1TFWA 2DRAA 4E19A 4Y2AA 3I31A 1NSQA 2GMLA 3R2CJ 4KN4A 2ES6A 2ZH2A 3G71S 5ALJA 5CYMA 4ZLJA 3AQEA 3G96A 1J54A 3V6HA 4CEOA 1FKOB 3RW7A 5DS7A 2D8CA 2MGZA 3KOAA 4OHVA 3MEEB 1AZSA 2ATCB 2YWFA 3F41A 5CZVA 4FZXC 3AOBA 3TX8A 1ZZNA 5ALUA 3GE1A 1EETB 1MWQA 3RMCA 4KHPK 1BE4A 3TAPA 1S1TA 4ZHRA 5AI4A 3F56A 2PYLA 4CZMA 3FDSA 4EHTA 4ZN1A 4HDHA 1T03B 3DYAA 4CJ4A 3NNHA 2EBEA 4MAKA 4CLFA 4M95A 4NYZA 1HD0A 4NLZA 3OYJA 2HS0A 3CCMN 4K8XA 1RDDA 4FXDA 1DK3A 1YBAA 3QFPA 2CQGA 1NGJA 4FWOA 1NGIA 1Y3JA 3A8KA 4USHA 2CGKA 2FD2A 4XUSA 1XNRK 2B9YA 5HL7Q 3CDBA 2W24A 5F8LA 2E5HA 2G2YA 2AJ0A 4X64J 4QZIA 2OFHX 5HVHA 3HJEA 3QAUA 3V6DB 1CZBA 8AT1B 2YCHA 2PFUA 3V6JA 1OQ6A 2QA1A 3L4BC 3WKAA 3PX4A 3LP2B 4KH4A 3D0PA 2P9CA 4WQ4A 2E8NA 3PACA 3K5MA 3KJNB 4WCEQ 2EC0A 5G4DA 2PY5A 2U1AA 2AXTU 3HJFA 5KFAA 3C1YA 3I9V9 4BUGA 1HPMA 4CJ3A 4ED2A 1VDHA 3GQCA 3R3LA 3EE8A 1H73A 4CLTA 4WWSA 2ZBRA 4LF6K 4LR8A 1KN5A 3SSRA 2DR7A 4O4GA 2QB1A 4CLSA 3CT9A 2IC3B 3BBFA 2GWSA 2C3MA 3MXMA 3C0BA 1GQEA 3KK2A 2HVHA 4LF5J 3CJ1A 2M52A 8ICEA 4BJQA 1J53A 1SJ1A 2W3RA 1UJ4A 3BH6B 3E9LA 1BPDA 1LVHA 2BXJA 1XSNA 1R59O 2VG7B 1GMWA 4CJLA 3UDEA 4RW6B 2ZOGA 2KT5A 1Q3UA 3R5BA 3G6YA 5EWEA 1HWKA 3B0YA 4OX9F 5B5EU 1YJ9N 4DR1K 3KLIA 4DS5A 2QEXN 2CYYA 4CJPA 2QXLA 5E41A 2PA3A 4TNOA 1RACB 2RILA 4ATNA 3PO5A 1KVKA 4DL6A 1TL5A 4K4GA 2Q31A 4QYZJ 2QWMA 2QSFA 2VB6A 1LWEA 1SL1A 1ZRMA 2F7TA 2X6NA 4Z6CA 1N5YA 1ZA1B 4DQQA 2GC8A 4Q2MA 1HHTP 2IHMA 4DTUA 5HRPA 4B9LA 1JXBA 2A10A 2VU5A 4JK8A 2J4RA 3P8BB 4UT4A 2WBRA 4Y2JA 5C24B 2F9WA 3MR5A 2Y3YA 1ZTWA 2YKMA 2YWKA 1IQZA 4NO7A 3RR8A 1YTAA 2IBOA 4IG3B 2OELA 3MR2A 3MPVA 3PSPA 2WK4A 2UXCJ 5J1EA 1NDKA 2QA2A 5IT4A 2ZBCA 5B0AA 2XHBA 3MGVA 4RWWA 3TW0A 1ZETA 1XQIA 1ZBUA 4FSVA 3CJBA 1X9JA 3GCXP 1RA6A 4CFBA 3H20A 3ZO7A 4USMA 1URNA 1H72C 2ZBPA 2K3KA 1HWJA 2F96A 3UR3C 3EJMA 3NWRA 1WNEA 2F7VA 3VWSA 4FWQA 2ZIVA 5DZ7A 7ICVA 2F8LA 3CCEN 5DG9A 1UHUA 5KFOA 1HBNA 1KVBA 3HKZD 3HP6A 1VJ5A 2BRLA 1WSVA 4YN3B 2EHGA 2VJ5A 4KC5A 4USIA 2YX1A 3O5TB 2YHWA 1FK9A 2E2PA 4FVMA 2NRTA 2R2RA 4B3SJ 3CUNA 4CLZA 3B9JA 2LQJA 2DCLA 4YHHK 4ZMMA 3S3NA 2OMOA 3OYCA 1JLGB 2E4LA 3DM2A 1JLCB 4YOWA 1NU4A 2JX2A 2D74B 1QQOA 2UUAK 4C8NA 2W8KA 1ZQSA 2P9IB 1SKWA 3I5AA 3PO4A 2XWYA 2BOAA 1QM9A 3H5SA 5KRSA 3DOKA 2V50A 2VA8A 3EZWA 4HUGA 4JI1F 4I2QB 4FJJA 4DZ6A 4TUPA 3CJRA 1YDLA 2BE2A 4Y2VA 3IG1B 3EVMA 1N5XA 3I1YA 2RRAA 1Q7LB 1D9FA 4ZP8A 4JI7J 4AP9A 4F5PA 5U47A 3VTHA 3MM9A 1T8EA 3MFHA 1HHSA 1HPZA 7ICTA 4EAHD 4BC2A 9ICBA 3L8BA 5EE3A 2ZF5O 3S41A 5AJ3J 1YWXA 4LIRA 4G9ZA 5D4NA 4R65A 1ZAWA 1MMDA 3JPQA 2W40A 4B3TJ 4F93B 1FEEA 3H8JA 2NXNA 1X9SA 1ZQUA 2A19A 4PH5A 1Y4ZB 1H7XA 5J29A 3OGUA 1VSKA 1JKHB 5B09A 3CDEA 3LDPA 4C4WA 3DWLA 3UCZP 4FJKA 1JJ4A 3L2UA 3O0FA 1FKPA 4YNQA 4EZ6A 4HVZA 4JI4K 3EGWB 1K9MT 3RAXA 2OEHA 2W2MP 4FWKA 4FJ5A 5DKWA 4ED6A 4I2GA 2LM4A 3GYGA 4AHSA 2YTUA 4I6MA 4GNIA 5KG7A 5DM7Q 3HI9A 3ENWA 3TAGA 5AQVA 2KN4A 3H8SA 3VVUA 1O8BA 1D4XA 2DUYA 2Q0ZX 5AE1A 1S0MA 1LV5A 3ZT3A 3VN5A 5GAGP 4CJ5A 4DPUA 5A8WA 1PCAA 1S4FA 3MR6A 1VRTA 5D4PA 1PIEA 5ETLA 4IXCA 4DV4J 1K8AO 2GIQA 4DX5A 3SV4A 4OX7A 5J0PA 4Y2TA 5J2KA 3KG0A 4RW8A 2FVPA 3UI3A 3BUZB 4DMZA 1EQYA 2BUPA 4KAZA 1GX6A 4L3KA 2ZIXB 2D1CA 2F9DA 3RRHA 4QIFA 3CCQN 3Q23A 3L2VA 1FHTA 1YHQS 4JI2K 4DV1F 3PX6A 5G0RA 1L7OA 2E1ZA 4C3LA 4ZTFA 4WF9Q 2DR9A 1VJQA 4OYAA 2JJ4D 1VQ9S 1SL0A 1RBAA 3ULEB 1KFDA 1AT1B 2KJWA 3WNEA 4O3QA 1RAGB 1NH7A 3CJKA 2CJ9A 1U2FA 4MQ3A 3P96A 3M05A 4BRQA 4O3PA 1N8RT 1REVA 3G86A 3AAPA 2KHDA 4C23A 3TR8A 4JKCA 5DDOC 5B7WA 3KZXA 4M1KA 4RR5A 2FJ6A 4CGGA 3G6XA 2OEMA 3DGPA 1ZOLA 5T7LB 4KI6A 4FYXB 4AYBC 1ZTTA 4GMKA 3ZDBA 3QWUA 3NGIA 1WOQA 3C14B 4ILGB 4FL9A 2DNOA 2NREA 1KTVA 3LP1B 4Z4EA 1YJWN 4H5TA 1Z2ZA 1HA1A 1ZAXA 2FSNA 3Q89A 4K4UA 3PRDA 2D3ZA 4W4MA 4NLOA 3ZSVA 2MMYA 1WI8A 5LMUJ 3ZT0A 2XO6A 2DH9A 4GKKK 2C28A 1NG9A 5FJ4A 3ZDDA 4O3MA 3OD2A 1XS9D 1CJUB 3AFGA 4ZCMA 5HBMB 1DGJA 2CXYA 4DR7F 3AMZA 5B0BA 5EE0A 3PJWA 1HNXK 1EKSA 3RH6A 5CD4A 5A2QO 1FA0A 3VAKA 4ILJA 2CNKB 3ETLA 2QA4N 4F8RA 4TKTA 3VQTA 2AA4A 4OKJA 4ERDA 5AXNA 3FFIA 2KKHA 3MGIA 1U0HA 1S76D 4IDKA 1HARA 2LQ9A 2VZ9A 3BO2A 3AODA 4Y2YA 1SC6A 2PDAA 3QU9A 1BG3A 3C16A 5LMNJ 2A1JA 1Y11A 3CIZA 4K5RA 2NO5A 2OAUA 5HMWA 1N33F 2UXDF 3RF9A 3GFYA 5TISU 3GLJA 3IXQA 4HT7A 5ALYA 3LUYA 4FNHA 3NVWA 4JS5A 1RAEB 3OSPA 2BJ8A 1HBMB 2KMDA 1ZD2P 4BACA 2PI5A 3IRUA 5GMEA 2R3VA 8ICGA 4BE2A 3CCRS 4JI6K 1S6QA 4MIWA 2DTJA 4JV5J 4CEQA 4GKJK 3LDNA 4KLEA 4NB4A 3OL8A 3OFFA 1EQMA 2OANA 3IM8A 3CULA 2UUBF 4Q44A 4ZVSB 4A8OA 1U6BA 3ZNUA 4HUEA 1OH8A 5HMYA 1FFUA 2J5AA 3TJAA 1TL4A 1UZDA 1ACMB 4PUOA 4RPYA 2UXBK 2LLZA 2Z2ZA 3EY1A 3O9QA 1W7WA 3THWA 1O6XA 4B3OB 3F5AA 5KL1B 4MK9A 3VQEA 4RKUC 2Z7JA 3Q86A 3UN5A 4F5RA 4DL5A 3HCXA 1GLAG 3D6TB 2QARA 4FOEA 5ETOA 4XQ8A 2ALYB 3KVGA 2HOIA 1KVCA 4KLFA 1HQUA 1H3DA 2R8HA 3N5BA 5IINA 3MM6B 1L3VA 1N56A 4C8OA 4TY9A 2FVSA 3LDSA 3GV8B 3ZYYX 4J2DA 5HO4A 1RT6A 2RDJA 2YH1A 4J9PA 4R63A 2OPQA 1PZNA 3SCKE 4DQIA 1T02A 2WB1D 3TVZA 3BF3A 1S3XA 2E8MA 4FZVA 2X78A 1TGOA 3PYFA 5DBAA 2P9EA 3BM7A 2PBDA 3IGVA 4FWSA 2E7VA 1BQMB 2HFNA 4M5MA 1ASVA 5LL6Z 1LOUA 4C7QA 2WOMA 4NXMJ 1ZM9A 4DBQA 5A2QU 1V9PA 2Z0GA 2ILZA 3BR8A 2A2CA 1Y0HA 1N62A 4KTQA 3GDQA 3OYEA 4OX6A 8ICYA 4P7TA 1S1UB 3AL0B 4QZ9A 2ZIUB 3Q2SC 5SWMA 2Q3PA 4FBTA 2DD8S 5KNIA 3MEDB 1FJGK 2FPKA 4ZVUB 1IXKA 3C2PA 1S22A 1ZA2B 3QESA 4O5FA 3JS9A 1RI7A 1IJFB 3VQCA 4MYTA 5K9FA 2ATLA 1VQ6S 5L1LA 4IOAQ 4PA1A 2E5GA 3HKWA 3VEZA 4UZBA 2HS4A 1DHMA 3OL9A 5A0YA 4KKOA 1BHNA 1NM1A 2IVYA 4NEYA 1TKZA 2LCWA 4KHRA 5AQGA 1OSDA 5CHCB 4KH0B 2GX8A 3RB6A 1IR1A 2AU0A 1B7YB 5ALXA 2CJXB 5AQIA 3HHLC 5HROB 3DXKB 2CNNB 4LMZA 4ED7A 1RT2A 1JLEB 5J2FA 1UZHA 3ZNJ1 1M1KT 2Z30B 3CF5L 3QUCA 3BV8A 4BRCA 3TUZC 1YTYA 1ZBLA 1TU0B 2OH2A 2QB0B 5ALEA 1HLWA 4NLSA 4Y1CA 4K4WA 3N5FA 3VCBA 4F67A 2DH7A 1FFGB 1RZMA 5KG5A 4L76A 4NE9C 4A59A 1AFJA 1MN8A 3AVLA 2IVFB 3I33A 9ICFA 4P4MA 1ZBTA 3BGLA 1RT5B 3JSBA 2CA9A 2VKRA 4JI3F 3VQ7A 3UB5A 3O3GA 8ICUA 3ENQA 5M1KA 2K4PA 4DZDA 1KHWA 2K06A 2AEFA 4KQZA 1YJVA 3W2VB 4RQ5A 8ICWA 2QGFB 5GADU 1R8PA 1EJ7L 3UQ0A 2ZUCA 5BN8A 2CQDA 2RJZA 4FXWA 4Y2PA 3BREA 3U8XA 5F3ZA 2H5IB 2XSFA 3MMBB 3W1YC 2ZXIA 3W2WA 4P4PA 3UXNA 1YJRA 3EZ5A 1RQNA 1P1LA 2DNMA 1DJ0A 5KFSA 4O5BA 2QLXA 9ICGA 2L9NA 2XMMA 1XMQF 2BX6A 2MZQA 1O03A 2DB1A 1SIWB 1V3ZA 1A77A 3I0RB 5F3XB 2ADBA 2HHSA 1SWWA 4I7FB 5IIOA 3AVMA 5AQNA 2GVZB 1NJXA 2WBNA 2WUSA 3TEHB 2QWOA 4E7HA 3IP4B 3N4QA 2EFQA 3SFGA 5EY4A 4BDZA 3KK7A 3KFUF 3AA4A 5F2RA 4M0AA 1HRHA 4DU4A 1CJVA 6FDRA 5HJYA 1M5HA 3HJVA 1TAQA 5AIBA 4YY3F 3H45C 2DR8A 2RAQA 5LJ3Y 4RNFA 5IQQA 4F36A 5E79U 3H7HB 4CF8A 2P9NA 4F91B 3HDSA 2ZH8A 4LFAK 4DTNA 2A1BA 2ZJQL 3SUOA 1G6BA 1EHWA 1YJNN 4JK1A 1C1CA 3PTWA 3LH2S 2QW9A 3TVYA 2QN6B 1JLQA 4KN7A 4J9NA 1ELOA 4JKEA 5FP0A 3MTKA 4KB7A 1D9DA 3GFHA 4NMLA 3GE9A 1U2VB 4OLAA 3K0JA 4ZPTR 1YK9A 2KG0A 3AEVA 4DQPA 2XO7A 3DDKA 4CEEA 2JNJA 1IBLF 2WVBA 2WVFA 2R2TA 3UKRB 3THYA 5IT0A 2C2KB 2ALZA 3VF4A 4CJFA 1SV5B 4X4TA 1WKKA 1S9EA 3CMAS 1NGGA 3VGKA 2Y0SD 4QWCA 1RTJB 4EP5A 4LFCK 4KFBB 3OR1B 1UFLA 2X3GA 4JD2A 3ICXA 1X5TA 4C4SA 3KKSA 4NZ7A 5TZVA 2P9GA 3X1LB 1WOPA 4MEXA 3IDWA 5H9EJ 2W2PP 4QIGA 4ZN3A 1KNZA 3WKEA 2ISOA 1WBDA 5AT1B 4BR5A 3TTDA 3CDAA 4K2XA 2E2OA 4JP8A 2ZUDA 4OYXA 8ATCB 3VPZA 4PQAA 1UAWA 2KE7A 3NGRA 1QAIA 3KWMA 3BF4A 1RAOA 4ED8A 3QGHA 4DV6F 5J2IA 1DQ9A 1DTQB 2V8VA 2HNZB 4ED4A 1R8BA 5FRMA 4AL7A 1RTIB 3HZGA 2ACMA 2ZH3A 1Q86T 2M4MA 4JI0K 1H7WA 5THWA 2FJVA 2B21A 9ICMA 4M3XA 2Z2MA 2UUAJ 4NI2A 3CJTA 3PV8A 3NEKA 3T9NA 1VQSA 2DFLA 1DTTA 3A3NB 1VIXA 3TI0A 2MQNA 2DFHA 3CCQS 3ALRA 4FLTA 4ALZA 1HFEL 1MROA 1KAZA 3TUIC 4CQ1A 4FE3A 2HOQA 3UMCA 1RUSA 3ISNC 1U1QA 3CJAA 7ICIA 1U1NA 3ELHA 1T3VA 4DLEA 3CC4N 2BPFA 3QU4A 4GVBB 1KVJA 1C0GA 2XS2A 1F3FA 2DTUA 1CXUA 4YORA 2HSTA 3WNFA 5JVGL 3GWCA 2MHNA 1FTCA 3W7BA 1HYZA 3C1ZA 2K8GA 2HZCA 3DRPB 3LZJA 4CF0A 1M0SA 3GIKA 4UATA 3O9TA 5LXYA 3RG6A 4O44A 2IY5B 2MDAA 3C8YA 3I82A 2HZAA 4HAIA 4KGMA 4F92B 4CZFA 5BYSA 5KFTA 5ALRA 1HI8A 4R79A 2BACA 3KK1A 5C5JA 3NS1A 1KQQA 5JS2A 1BUXA 4KHSA 2E8AA 3H08A 2DO4A 2PZSA 4CTAA 2O1PA 1K9MO 2H3GX 3SSSA 4C80A 2C2ZB 3J7A1 1SZPA 1ZQRA 3U1NA 4JV1A 5L39A 1TK0A 1N34F 2HLTA 1B64A 1V4SA 3CPWM 4E7LA 1F1BB 2KQ2A 1L7PA 3T7ZA 4KLDA 2C2OB 3O80A 3JSYA 2KYZA 1XR5A 2B43A 2YX8A 2VFTA 4PKDB 4IH6A 3UNYA 3SMSA 1LKYB 2YMMA 1A76A 1UETA 1RDUA 3G2XA 3RGIA 3W60A 1W7AA 4J9SA 4NZ6A 2G8HA 1Q5YA 2VYPA 4FF3A 4BWMA 4JRQA 4OI1A 5IM0B 8ICRA 3RMAA 2JLGA 1IV0A 2GQCA 2F63A 2KT3A 1S1VA 2K3IA 3ZEUA 1JNZB 3WKDA 1JQGA 2NXUA 1QQMA 1YIJN 2J7UA 2I6XA 3MHYA 1KQSM 3ZLJA 3FKBA 4AL6A 3TVKA 3WIUA 3PW5A 3PR5B 3H2VE 5J0WA 2HFSA 2BCSA 1HNVA 2ZBQA 3EZOA 3D6FB 3H0RB 5A8KB 1IBMK 4CJ7A 1RWUA 1T03A 1N52B 3MUVP 4P2MA 4UB5A 3CCZA 4LF5F 2KRRA 3D2EA 3NNAA 4I2HA 4CO3A 1N5WA 4UW9A 3M6VA 4DL2A 2CJKA 4RQ3A 3W5YA 1V5VA 1FRMA 3MMJA 4M5NA 1FF2A 3KKAC 2W9MA 5AQYA 4MN4C 1GLJO 4KHNA 2FGOA 2WAQF 5GAGI 3IR5B 3HBTA 2MKJA 2QYCA 2DGXA 1TV9A 1NGDA 4LT6A 2AP6A 4M9LA 4ZP6A 2HBRB 4YXMA 3RFAA 5M1PA 3L2QA 5DDPC 4HKQA 2BCQA 3HW8A 1C0TA 1KQGB 2HHHJ 3CD5A 3UWTA 1B4FA 2ZTCA 3HSZA 4KYZA 5GAHU 4YUDA 4CO1A 1URRA 3IWXA 3NASA 2I7PA 1P8ZA 2EG1A 3SQ4A 1RKJA 4X4NA 5AKEA 2JGAA 2OGUA 1U4BA 1GTEA 4UOFA 3RW6A 4FWLA 4GKKJ 1WAJA 1WC0A 3DLGA 2FDRA 4B8AB 1LAWA 2PC6A 4X65K 2GWKA 4JNEA 1X8DA 4CYUB 1WJ9A 3RJMB 1OH6A 4YS2A 1YT3A 3TA2A 1S5JA 2MQLA 3I28A 1T6DA 3SLCA 2M70A 3C6UB 1UMJA 1XNQK 3UE2A 4A8FA 4QZVB 3UDCA 2VWKA 4M63C 3AO2A 3J81O 1T05B 9ATCB 2HFOA 2VQFK 1JN3A 5BREA 3EMTA 4UUWA 2WF6A 2L41A 4TU9A 2AMCB 5IIMA 1WHWA 2QWQA 4CO0A 1RSCA 3RBXA 2BCVA 1RQ0A 1P6TA 4CK2A 2XI9A 3AVKA 3SQ2A 4OYOA 4CLUA 1BOTO 2H3ZA 4X4SA 4DTXA 5C0YA 2RRBA 4RQ1A 4JI6J 3EPGA 1COOA 5LJ5Y 2JWNA 4RUBA 3M8WA 4F72A 3BPSP 4B3SF 2EQYA 3I32A 1ZQXA 2WTFA 1KONA 3M30A 3VGUA 2HURA 1Y5IB 2WF5A 3KDOA 7ICFA 2NSBA 1V85A 1UEKA 3Q83A 1XMOK 4MFFA 2DH8A 4ZIVA 2UXBJ 3FRZA 1NB7A 1WDDA 1ZQQA 3MXHP 3FLCO 2RQ4A 2ZZTA 2CWKA 1ZQMA 1VRUA 4XH4A 1FO1A 7ICQA 2J6TA 3IWNC 3KTQA 4J03A 3P1GA 1RCHA 1MG7A 4ES2A 4FZNA 2FZGB 1Q7YT 3P49B 1KSPA 3NF8A 4AYBD 3ZD9A 4DMNA 3QNMA 3FCVA 3I5CA 3MCSA 2FF6A 5KFYA 4C6AA 4CBUA 1RU2A 4QWDA 4QOZB 5ALQA 3PHTA 4JI7F 2Z58B 2E1EA 4ECSA 3I6PA 3KLFB 4YD2A 1N5SA 4MK8A 3HP9A 5J2MA 2NYIA 1X2IA 5AJ3F 1WLJA 2VWBA 3WNGA 3G0ZA 7ICEA 1WWUA 3DRRB 3M8QA 2KJVA 4GO5X 3TZWA 2GUPA 4B3TF 5DRKA 3T5KA 3C7NB 4KPYA 3IRWP 4H5WA 1A5WA 3PSTA 3RWUA 3PR4A 4QZGA 3HHDA 3NL0A 2R7TA 3ULHA 3VERA 2NYVA 3SZ2A 1S0NA 2UP1A 2QKBA 4IEIA 2KRBA 1FIQA 4J9VA 2A1RA 1UA1A 3ISBA 3ZZPA 2KI2A 3JPOA 1XR7A 3O08A 1EWRA 2GW8A 3J81U 3DAWA 3QGGA 2QM1A 1Q18A 1RLDA 1WTFA 4BVPA 3O4QA 5JLFA 3VGTA 2W7PA 1NKCA 3IC1A 5C12A 1HKCA 3D1OA 4C8KA 3E01B 4JAXA 4E1NA 1BWEA 4I2DA 3NLCA 4NA1A 2IJNA 2G8FA 2WF8A 1FRKA 2VA3A 1SQEA 2YNIB 3OJUA 4RL1A 3M32B 4P0PB 1VHFA 2KSOA 5L1IA 2QMXA 3Q8RB 3D68A 2ZBIA 4M5DB 5HQLA 5EN1A 3PW7A 4PABA 3NH1A 2V2VA 2O3DA 1NDLA 4IO8A 3VF0B 4UAWA 1ZPWX 3FZBA 4DV4F 2DXEA 2EAMA 2RN2A 1ZQ1C 2NQPA 2JRZA 3X3UA 2R4FA 1YJNS 4QU7A 3CQXA 4W5QA 4IRKA 2GBZA 3V9UA 3DI6A 5JVGQ 2CPHA 1S9GB 1AFIA 3AQFA 1ZQVA 1DQAA 4CEZA 4KB1A 2YKPA 2H3EB 3THTA 3KLEB 2RKIB 4CFCA 1KEKA 3CDWA 5CQGA 3G9CA 3V4IB 3AVAA 4F4ZA 1D3WA 3N4MB 1HKAA 1PYSB 2AGOA 3QO9B 1F9FA 1Q1KA 1J2MA 3V9SA 3H3NO 5HN0A 1IG9A 4OKKA 8ICQA 1RK8A 2MQOA 3QJJA 1U04A 4GV6A 3B6PA 3ZZOA 1FJ7A 2XICA 4MFBA 1T94A 2CQPA 1R0AA 1HX1A 3QFHA 4E2FB 4IL6U 1FFWB 4RBUA 5GIPA 2W3SA 1X0PA 4WP8A 4CO5A 1ZQWA 3VF6A 5KFXA 2EWSA 1ZQBA 3O6QA 3ZSZA 5AM5A 4CHYA 3ID8A 1SL2A 2A40A 2B4VA 2A6MA 2C3UA 4QYRA 1PAEX 4FZLA 2JHEA 2XVTA 3RJGA 4HCCA 2AWZA 3P3DA 3SSQA 2M0GB 3JPSA 4X4VA 1BDGA 3VGLA 1BPZA 2B4PA 4WE1B 3KXDA 1WG1A 2ASPA 5A0LA 3AJ1A 5GIOA 4MDBA 1S1WB 1PJ6A 4DSIA 2Z1HA 3MWTA 2QFJA 4ZTJA 1OJ4A 4QAGA 2OUGA 1CC7A 1TTHB 4KLMA 2BCRA 2KNJA 4EYIB 1ZXOA 3GIIA 1E3MA 4G65A 1SH2A 2P9SB 2MKIA 3H7IA 2CJYB 3RH4A 5ETRA 3UD5A 1OY6A 3QX7A 4KBIA 3LPTA 2VG5A 4ZVTB 3H8MA 5K8MA 4CLWA 4DU7A 3QT7A 3O4NA 2BGWA 3OYIA 2P5VA 3W0LA 4OYWA 4L72B 4RTFD 4MT1A 4ZCLA 3WK5A 4CF3A 3Q8VA 1GXTA 4BHQA 4WFNL 3Q8QB 3HF5A 2OCEA 4KHUA 1QSYA 1DT9A 1NZAA 2FC8A 4RQ6A 2CPYA 1HLUA 3CFOA 4QZAA 2HHXA 3VAGA 1Z00B 1RWPB 4MHVA 5LMNF 3UCUP 3DLEA 3O3LA 3RR7A 3IS9B 2ZITA 2RS2A 4ZK7M 1Q78A 5KT4A 2VFVA 4M5KA 2BJ3A 2LKYA 2EZYA 3DMJA 2K7KA 2PFPA 1D8LA 2HYIB 3LP1A 4JV5F 3DRSA 3LZIA 4FWMA 1OH7A 2B7CB 4NWIA 1NJZA 4CI0B 4OHXA 3RB3A 5ETVA 4DV0J 5KG0A 1JXLA 4YOXA 5GADP 2WB4A 3AAQA 1CG2A 4TYBA 4OJ6A 5CCLA 4DR4J 5GAEU 2Z2LA 3DKDA 4NLTA 1CJUA 2W55A 1RP5A 4B3RF 4I29A 3CJ9A 1JJHA 4K25A 2QL7B 4MH8A 2WRMA 2BH1A 3WKCA 2H3QA 4JKHA 3HM8A 4HCBA 3H2UB 4EEKA 5LY3A 1HI0P 3OTEA 1VBZA 1UW9A 3O9RA 4JKFA 3T6BA 4Y2KA 2N4CA 1IVZA 2DY1A 5DK5A 3LDOA 1NSAA 2HZVA 2HFZA 5K4LA 2HWHA 3U1MA 5J0RA 3KKRA 5DBBA 4EU0A 1FE0A 1E4GT 5ELZA 4MMOA 3QYYA 2PSZA 5KAFU 3HHKA 3FEXB 3JYTB 1Q86O 4PL1A 4C11A 1TMMA 7FD1A 4I6WA 4NCAA 7ICGA 2AZ3A 4ECQA 4A47A 4ECZA 1ZBIA 2P66A 2OTLS 1XI1A 1ZM4A 4OJLA 1FRJA 1ZQTA 4M7YA 5CYMB 5IC6B 3K1ZA 3KBBA 1KWMA 2MGZB 3KD5E 2PMZC 3W63A 2D0CA 2O67A 5F8HA 4KMUA 2QXFA 4ZVRB 3D54A 3O2IA 1VAZA 2QLFB 4ILLA 1S1TB 4Z4IA 4ZHRB 5HP4A 2NUBA 4NXMF 3OUYA 5AI5A 5EX3A 2ZDPA 2GJFA 2BMBA 4NA2A 2FB0A 3DYAB 3U1LA 1VLYA 5M2UA 3A1YG 2OD4A 4JYAK 2JC0A 1V6HA 4NYPA 1KQFB 1MC8A 1B7FA 1BPYA 1KTQA 2V0NA 2XGQA 4LF2A 1WSJA 5M1QA 3MXJA 2LA6A 1WSFA 4ZOHC 4KLSA 3D0HE 3ILJA 2AJQA 3PSIA 3L6QA 2IVOA 3MM6A 1BA0A 2KHVA 3BQTA 4HHUA 3BSNA 2LEPA 4U95A 4O5CA 2LYAA 2GTDA 4NX9A 4HT5A 3OW2R 4FYWB 4HH0A 3FC9A 2V5HG 3AJ2A 3VENA 2N3OA 5EX5A 4DL0C