4B9LA

Structure of the high fidelity dna polymerase i with the oxidative formamidopyrimidine-da dna lesion in the pre-insertion site.
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 213
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9lA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9lA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9lA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9lA01
1RDDA 1MC8A 4C8OA 2IA6A 4DG1A 4ICLA 4RQ0A 3UQ0A 1BIZA 3OGUA 2RKIA 4DF8A 4OVLA 4N56A 9ICLA 4GMJB 4B9MA 4I2EA 3ZT0A 2G8FA 1ZBUA 3SV4A 4M3TA 3GIIA 3KIOA 3V6KA 4JV1A 5KFVA 5KTQA 3V9SA 4MEYA 3SI8A 4F92B 4ED7A 3VA3A 1ZQWA 2KFZA 3SZ2A 4DSJA 4I9LA 1T8EA 1LAVA 1JMSA 3V1QA 4PHPA 4YVZA 4I2IA 5IIIA 2FBXA 1NJXA 3ISBA 4F2RA 2PI4A 4J9KA 9ICHA 9ICGA 4DTRA 4DL4A 3OJUA 3KLFA 3RAQA 3K57A 2KW4A 3SCXA 5KFNA 1W0HA 4TSXA 5CZ1A 2RF2A 2R8KA 3DRPA 3DOLA 1MQ2A 3SQ4A 1YVUA 5L9XA 4QZBA 3PMNA 4LY7A 4DTXA 5DBCA 5EWGA 1U48A 3AVNA 3PW0A 3GIJA 4UB5A 4O3NA 3NF8A 4J2DA 4R66A 2BHNA 1ZBIA 4AHTA 4OKEA 1D8YA 5HRRA 4BDZA 3GV7B 3NGZA 4IFVA 8ICXA 4CJTA 2Z1GA 5JS2A 3ALYA 3MDCA 3V7LA 3MXIA 2XC9A 5IINA 1S0VA 1CEZA 4DSEA 4ED2A 2P5GA 4ELVA 3F73A 4IR9A 4ID1A 1SL2A 1VSLA 5J2MA 4AHRA 3PY8A 4ED6A 3TQ1A 3KD1E 4XUSA 2WOMA 8ICKA 3SUNA 3RMDA 3EWAA 4R8UA 5DGBA 2IS3A 7ICOA 4CECA 5FRNA 1SKWA 8ICTA 4CK2A 4J9RA 5IIOA 3HVTA 1ZBHA 4IRDA 3DOKA 4YD1A 3V9ZA 3HP6A 3MGIA 3EYZA 3ZSZA 3RB6A 5KFJA 2P6RA 4EBCA 4M9GA 3V6JA 4RNMA 2Z1HA 4XQ8A 1KLMA 4QOZB 2C2EA 4KLFA 1X9MA 3RB4A 4CEBA 4KITB 4E19A 3WNHA 1JKHA 4KRFA 4EEYA 1RTHA 2DFLA 3QZ8A 1RT4A 3Q8QB 3L2UA 1EETA 4CEDA 3K75D 2EX3A 4R64A 1BI4A 3PNCA 4FVMA 3JPTA 3MABA 3LZIA 3EZ5A 1EXQA 5J1EA 1BPYA 3CG7A 4CHYA 4YP3A 3ISDA 2VWJA 4KLSA 1ZQJA 1QS4A 1RDAA 1HNIA 3RRHA 1NJZA 1TKXA 5J29A 3HSTB 5KFKA 4Z4FA 4FYDA 4KLQA 5E41A 1BI4B 3AA2A 3ZT2A 2AGPA 3UXNA 3DLEA 4KKOA 4O4GA 3HJFA 4C8MA 4FCYA 1C0UA 2Y1IA 1XO1A 4RZRA 5F9LA 4HCCA 2BCQA 4CHQA 4K4GA 2F96A 5KFPA 4QW8A 5D4BA 2AQ4A 4LSLA 5CYQA 2E6LA 4RQ8A 4HUEA 3AA4A 5HROA 4GC7A 1S0OA 4HVJA 5HRNA 2FMQA 3PX6A 3LK9A 4F5OA 4M45A 1XS9D 9ICSA 4DTMA 3ZSXA 1MSWD 2UVWA 2ZUBA 4M9HA 4CGFA 2VWKA 4CFAA 3QERA 3Q8SB 4AH9A 2HHSA 3QIOA 2PZSA 3FYHA 3HP9A 4DLGA 3VQDA 4B9LA 2O4GA 4MFFA 2ZUCA 3WNFA 4IRKA 5T7BA 2ISPA 3NDKA 4I2QA 4HCBA 3AVBA 4EP4A 4CJQA 3N4MB 4CEEA 2KTQA 3HVRA 4O5KA 1EX4A 4FBTA 3PO4A 4TQRA 2KN7A 2AGOA 2ZQBA 2Z1IA 2BPFA 1HQEA 3RH4A 4RQ6A 3H7IA 1ASUA 4CJSA 1ZQKA 4E89A 5J0UA 1GOBA 3K2PA 3DMJA 1KFTA 2HB5A 1VSFA 1RBSA 4J9SA 4X5VA 2AGQA 4QZHA 1ZQVA 4GW6A 2GV9A 4E0DA 1TAQA 4ECUA 9ICMA 4NLKA 5CJ7A 3PW7A 4J9QA 3Q8PB 4I2CA 3HPOA 3DRSA 4CJFA 1Z00A 1BHLA 2R7YA 1QQCA 5J2DA 9ICFA 3ZSRA 4DQSA 1F21A 1WAFA 1YTAA 2UVUA 1JX4A 3C21A 4F91B 4ED3A 5TZVA 3QO9A 1SKSA 4FJ9A 3C5FA 1Z00B 1T3NA 4B9NA 3BDPA 2F1IA 3P5JA 5J0RA 2ZJAA 4UB1A 8ICUA 4UBCA 4TUSA 3OYHA 2FBTA 4Z4EA 3SPYA 3GIMA 3VN5A 1B43A 2IHNA 1N5YA 3NGIA 3QEBZ 1FK9A 2NRVA 3I8DA 2HHXA 2F8TA 1NKCA 5CB1A 3NAEA 3AVJA 4KHYA 4CHOA 5KRTA 3SNNA 2BCVA 4LSNA 4M9JA 4FK0A 1CZ9A 4M6WB 5KFYA 1JLFA 4M3WA 2W8LA 2Q0ZX 1L3VA 1RPLA 5CYMA 2ZJ8A 1JN3A 1TK5A 3SJJA 5KFLA 1BIUA 4Q45A 1X1PA 3B6OA 9ICWA 4ZTFA 2BANA 4IQWA 5J2HA 3HL8A 3V1OA 1MQ3A 1VSHA 2QKKA 5EWFA 3RH6A 1TKDA 2GUIA 3B6PA 1R0AA 2XO7A 4Z6EA 5KFGA 4GXIA 4CJKA 4RW9A 4OGCA 1XHXA 5J0WA 5KFFA 4Z4CA 1ZQZA 1ZQUA 3ZD8A 4ECZA 3TWHA 1S1UA 4W5RA 3V9WA 4B8CA 1ZQHA 1UT8A 2HVHA 2ASDA 2G8IA 4BDPA 4N47A 4LD0A 5KT7A 1RXVA 4I7FA 3PV8A 4KHNA 4Q44A 2PFPA 3C5GA 1HYVA 3HWTA 2JEJA 3RTVA 2FMPA 2YKNA 3MXMA 4Q43A 1Q9XA 4BWJA 2NRXA 2JGUA 3IG1A 3BQ1A 4M3RA 2WONA 1IH7A 2ZD1A 4F8RA 3TI0A 7ICMA 2F1HA 4NXZA 3T19A 2A1JA 3AVGA 1WSEA 2DPIA 2C2RA 8ICSA 2J6SA 3HXMA 3NHGA 4JRQA 4CHZA 4QZEA 5DLGA 4FZZA 5L1IA 1T4GA 3AO5A 4B9UA 1RTDA 4RT2A 3RJKA 3OYJA 4Y1CA 4YCXA 4ECSA 5J2IA 3THVA 4KLLA 2F8SA 3VQEA 3C2LA 4DTUA 8ICCA 3AVIA 2G8KA 4NLZA 4FBUA 1KVCA 1L3UA 1UWBA 1Z3EB 1KDHA 1ZETA 4EP5A 1Y88A 4I2GA 4PWDA 4P4OA 2IC3A 1QTMA 5L1LA 7ICTA 9ICPA 1W9HA 1RT1A 3H08A 2YKMA 2W9AA 4DTNA 2MUTA 2B21A 4FJ5A 3EPIA 5CZ2A 1L3TA 4KI6A 2OPSA 1RZTA 3JPNA 3VQ9A 3VA0A 1S6QA 4ECTA 2I5JA 2W9MA 4M9NA 1IXRA 5IIJA 1C6VA 4B9TA 4O3SA 4O5CA 1BPZA 1CXQA 4PHDA 4EYHB 3RMAA 4QZCA 2UVRA 1J9AA 4IRCA 1VSMA 1N6QA 1DTQA 4FJLA 5J0QA 4F4KA 5D49A 4KFBA 3N97B 4CJUA 4LH5A 4NM1A 4FM0A 8ICFA 1RT5A 5CHGA 1BPXA 3HPGA 4FJHA 3H4BA 5BOLA 3ISNC 3TAFA 4FZYA 4QWCA 3RR7A 1XU4A 2P1JA 9ICCA 2IBKA 4FLZA 5DKWA 1I3AA 1DTTA 2FLPA 3ZDBA 2OWOA 3B0XA 4HTUA 3ETLA 2ISOA 5KFUA 4KB1A 4I28A 1KCFA 2PI5A 5KFWA 3DI6A 1JL1A 2BCRA 4QW9A 3EPGA 4E7KA 3QEWA 4C8NA 2HW3A 4CESA 3ZSOA 4B8AB 4YNQA 3AA5X 2B6AA 2XCAA 1U9LA 2JZBB 1ZBLA 4OKKA 1SV5A 2G8HA 3RRGA 3NFAA 4CJ5A 2BDPA 4AHSA 3V9XA 1NOYA 5DB8A 4KLJA 7ICRA 4KREA 4DLEA 4CFDA 3OYBA 2GBZA 1C1CA 1ASWA 1IG9A 3RH5A 4JV0A 3KHHA 3ORYA 2KFNA 4PHAA 4PHEA 3AV9A 1J53A 4CF9A 3LDAA 1RBVA 3QZ7A 3OS0A 4QWEA 4YFUA 4L8RB 5DQGA 3SV3A 3FDSA 3ASMA 1ASVA 3MEGA 3BGRA 3ZD9A 5SWMA 1L5UA 4FM1A 2MAXA 3RJGA 2HHTA 1RYSA 4O3PA 4ED0A 5EWEA 4FZXC 4QCLA 1AROP 2OA8A 7ICFA 5J2PA 3O3HA 1SUQA 1ZQRA 3S3MA 9ICAA 2W9BB 3PW2A 4I2JA 3RB0A 1NJYA 1ZQTA 1TVAA 1LWCA 2PFNA 4M3UA 1JLGA 4CJEA 3T3FA 3NF7A 1NK5A 9ICXA 4ECXA 2E4LA 4QZIA 1A5XA 4B9VA 1JLEA 1D8LA 2WTFA 1HQUA 4AILC 3ITHA 2DPJA 3MAQA 3CFRA 5KG1A 2JEIA 3LDSA 4CGHA 2D0BA 4M0AA 1GOAA 4QZFA 2W9CB 2HHWA 1WSGA 1VSKA 3RAXA 3ZDCA 1RT2A 4RPZA 4B08A 4KLMA 1RTIA 1J54A 4DFMA 3OVNA 2BQUA 1L3SA 3EY1A 3AO2A 2D0CA 1B9DA 2A1RA 4FLWA 3TR8A 5J2BA 2XGPA 3GV5B 3TAEA 8ICLA 4F4ZA 3BQ2A 8ICYA 1CZBA 4AHUA 4FJJA 2ZTCA 1PZNA 5KFXA 1RT6A 5KG6A 2DFHA 1A5VA 3L2VA 4Z4IA 3Q8MA 3O4QA 1N48A 1VK0A 3IM1A 2XRIA 4OGEA 3AO4A 1TK0A 4O44A 2GWSA 4I2FA 4OLBA 3T5HA 1SL1A 5J0SA 4YR0A 1LV5A 5HHIA 3ZCMA 2X74A 4FJGA 3I0SA 3KK1A 3K59A 2JEGA 5D46A 4TQSA 2ZE2A 3MBYA 4BGDA 3G10A 4ZH4A 1TL3A 1EXNA 2KQ2A 2OPRA 4CK1A 4CGDA 3PR4A 4PH5A 5D3GA 4JV2A 3MR2A 4F4XA 1IM4A 5KG4A 4FLVA 4I2PA 4W5QA 7ICJA 5HMMA 3H8SA 3CFOA 4Z6DA 8ICMA 3RBEA 3BJYA 4BXOB 2FPMA 4DTOA 4YQWA 1BCMA 4CJ3A 3Q8LA 3QNNA 2DFFA 3AU2A 1ZQGA 5DDMA 2FMSA 1RILA 2BPCA 3KKRA 4O3RA 3CYMA 2EHGA 4ZHRA 2KZ3A 3L3UA 3PR5B 3OS2A 3V7JA 3KTQA 2RN2A 5J2KA 3E2EA 3H4DA 3K5MA 3SI6A 4FO6A 4JS5A 4KAZA 1KLNA 4J9LA 1D9FA 3DRRA 2R8HA 5KFTA 4DL7A 3OYFA 4LVSA 3LP3A 5KG2A 5DBBA 4Q5VA 5FRMA 1JLCA 4QZ9A 1Z25A 3ZDDA 4LH4A 3C1ZA 3C6TA 4UQGA 3O3GA 1RCHA 4BACA 2FPKA 2NRTA 1HMVA 4DOAA 1ZQBA 4FJNA 3RBDA 1U49A 1XC9A 3AUOA 5IIMA 3VQ6A 3NTUA 1BCOA 4CCHA 1QSLA 1HUOA 3PX4A 8ICVA 2ETJA 5J2NA 2OPQA 2VA8A 5KG0A 3JPOA 3D45A 4B9SA 4HYKA 4P4PA 4RQ7A 3LPTA 3QINA 2AU0A 4DU1A 3S9HA 3PW4A 3OYEA 3M9NB 4O0IA 2HNDA 4CGJA 2ALZA 4FLUA 4PGXA 3NGYA 2HHVA 1TVRA 4FK4A 4O55A 4KLGA 9ICQA 8ICQA 5KG3A 1HNVA 2FLNA 4FM2A 1ZQYA 3K58A 9ICOA 3VQAA 1LW0A 4CGGA 5KFRA 3L2RA 4M3YA 4DOBA 1TAUA 2LSNA 3NH1A 3KJVA 1DGSA 2HNYA 4BWMA 4KMUA 3C6UA 2J6TA 4P2HA 5DB9A 3NF9A 4ELUA 4UBBA 3G0ZA 3F9KA 5EOZA 1JLAA 4H4MA 3MEDA 3SQ1A 2ITGA 5DBAA 5KT2A 3KD5E 4F5PA 4J2BA 5CY4A 3AVCA 4RQ2A 1NOMA 4IQUA 4QZDA 3GIKA 4WE1A 2P6UA 1QLNA 4DS5A 3UXPA 4CHPA 3ZDAA 2RDIA 2X6NA 7ICSA 3SUPA 4O5EA 3DLKA 5J0OA 2R8IA 4CF1A 5DG8A 3DYAA 4KTQA 4JUZA 2YV0X 5CP2A 7ICNA 1ZQSA 1EP4A 3G6VA 4CEQA 4H4OA 3L2WA 1H38A 4FLYA 3JYTA 4RW7A 2IMWP 2XY5A 2FBVA 1S9EA 3I0RA 4EBEA 1TK8A 1VSJA 4FS2A 1ZQAA 4RT3A 4TUPA 4Q0BA 3PW5A 4FJIA 9ICNA 4FS1A 1DLOA 2PYLA 4DWIA 1WSFA 4DQQA 7ICHA 3IRXA 4M2YA 3D0PA 1BGXT 4DFPA 2YHAA 1S77D 1A76A 3LALA 4RNOA 2E6MA 8ICOA 1HJRA 3PMLA 5J2QA 1U4BA 4J2EA 4KLIA 3JPSA 4QZGA 3V81A 3RMCA 1B22A 4EZ6A 1UT5A 5KFMA 2YHBA 1WCNA 1TFRA 5DQIA 1ZQIA 5KRSA 4MFCA 3SQ2A 2NRWA 4YXMA 4IQVA 9ICBA 4MEXA 3E01A 5SZTA 4UAZA 3L8BA 4KHWA 5HRSA 3QEIA 1XHZA 2W42A 1X9WA 5KG7A 2HHQA 4CF2A 3QETA 2A1SA 4O5BA 2JLEA 5F9NA 4KTZA 2IGIA 2B5JA 3OSPA 1UA1A 4NY8A 3JPPA 1JLBA 1KEJA 8ICPA 3C2KA 3JPRA 2W8KA 3U3YA 1S1WA 3KHGA 4M42A 3CQ8A 2RDJA 3KHLA 3DLHA 4UB3A 1QSYA 3CM5A 4F5RA 4CF0A 3SYZA 4OKJA 1ZQEA 1RTJA 4UB2A 3OYIA 3IAYA 3ZT4A 5KT5A 4CEOA 3NF6A 5KFBA 1S9GA 3VQBA 5KT3A 2I9GA 1RDBA 3OYNA 2QXFA 1IKWA 5KT6A 7ICPA 2OZSA 4DQIA 4F4WA 3KK3A 3DLBA 2BGWA 4IBNA 3O4NA 5KFDA 3KLHA 2C28A 4GXKA 4OPKA 2PXIA 2X6SA 3VQCA 4YFKA 1VRUA 3HYFA 3CM6A 2YNIA 9ICKA 3AVKA 3HPHA 1GOCA 4YN4A 1REVA 2HMIA 2YNFA 2KZZA 3LP0A 2VANA 3EW9A 5I42A 3KLIA 3UXOA 4TUQA 1BPEA 2ASJA 2FLLA 4DL5A 1VSDA 3TAQA 2IHMA 4CGIA 3SPZA 1B9FA 4GXJA 1Y97A 3C1YA 3AO3A 4IKFA 4YMNA 3AO1A 8ICRA 4OJRA 3SUQA 4FJKA 2P51A 4E7LA 4YG2A 1K6YA 4J9PA 3HX0A 5DGAA 2DFEA 3OY9A 1NK9A 4NLGA 4IDKA 4J9NA 1RNHA 5IIKA 4MF8A 4F4YA 9ICTA 4FW2A 1SL0A 3LP1A 4DS4A 3MR3A 3MDAA 3RR8A 9ICIA 2BGGA 5KFEA 4TURA 3QEPA 4KHSA 4KN7A 4DMNA 3H8JA 4E1NA 1ZJNA 4P4MA 3U6FA 2V4QA 4KLDA 2VA2A 1NJWA 4F50A 3TFRA 1ZBFA 8ICIA 4B3OA 3KLEA 1CUKA 2BR0A 2ZTDA 2P5OA 3OS1A 3WNGA 1K1SA 3ZSVA 4RUCA 4XA5A 4RW6A 1XSNA 4K8XA 5DMRA 4KV8A 3Q8KA 3ISCA 3C23A 4I2BA 1Q8IA 3S3NA 4CEZA 2XGQA 2LYHA 4CJ4A 1MU2A 5HHHA 3SUOA 4RG8A 3UPQA 4FJ8A 3NCIA 3RMBA 5FROA 4CE9A 5DG7A 3RJIA 4DSIA 3QEAZ 4JS4A 5HBMA 1Q9YA 5JUMA 4J9MA 1NK0A 1ZQNA 1U45A 4E7JA 3PO5A 7ICLA 3T5LA 4RPXA 2G8WA 4BE0A 4IQTA 5CA7A 1IKYA 4O3QA 4YR3A 2KZMA 2XCPA 4KLHA 3M8RA 3K4GA 1A77A 4M41A 1ZQMA 2BCUA 5DG9A 3ZSYA 4FLTA 5HP1A 1BQMA 4KO0A 1TL1A 2A1JB 4KI4A 3M8QA 2IDOA 4DTJA 4EZ9A 1G15A 3TAGA 1HJPA 5HP4A 3M8PA 4YD2A 8ICEA 3KHRA 2NRZA 2HNZA 1X9SA 1C1AA 4W5OA 3IS9A 1DOQA 3JPQA 2BE2A 3P83D 4Q8EA 4FW1A 1LW2A 3L3VA 3WNEA 1JLQA 3RJEA 4XIUA 3T1AA 3V9UA 1C7YA 1TGOA 4I29A 5KFQA 7ICVA 1I39A 4DOCA 1RT3A 2YNGA 4JLHA 3IHQB 3TFSA 1S6PA 3NH0A 2XHBA 9ICEA 1WSHA 4IG0A 4NCBA 5J0PA 3V4IA 1S10A 4BE2A 4M9LA 4Z6FA 2JEFA 5EU7A 4F5QA 3QIPA 4NCGA 4ZTJA 4I2DA 1V9PA 4FJ7A 3VQ5A 3K5LA 3VQQA 4O3OA 3H40A 3RWUA 1S5JA 3DLRA 3B0YA 3OYAA 1BPBA 4DTSA 4NYFA 1J5OA 2BPGA 2VA3A 1NKBA 3NBPA 3S3OA 3DLGA 1TV6A 4ECYA 3AA3A 4RQ3A 4HUFA 4N5SA 2ZUDA 4RU9A 4M6WA 2FBYA 4RQ1A 4FXDA 4MFAA 1SKRA 2ATLA 5HNKA 1NOZA 4JK1A 3UIQA 1S1TA 2UVVA 4AHCA 2B4JA 1WLJA 4CFBA 4E7IA 2D0AA 2V9WA 3MEEA 3LWMA 4ECWA 2M9NA 4BE1A 8ICNA 4Q8FA 1C1BA 5BOMA 1S1VA 4FK2A 2F1JA 1VSIA 7ICGA 1WSIA 4DL2A 4GVMA 4Z6CA 4DU4A 5KFZA 1UA0A 2ATQA 4UB4A 1HPZA 3OSNA 4N41A 3RJHA 4LZGA 3RJFA 5J2GA 1BISA 3V6HA 4I2AA 4W5NA 7ICUA 4KHQA 3LZJA 4Y1DA 3ULDA 4QWBA 2JZBA 3QEXA 3HO1A 4DU3A 1Z26A 5J0YA 3ZSWA 1RBTA 4JWNA 3ZT3A 1ZQPA 4ED8A 1RT7A 5J0XA 3T5KA 1RYRA 9ICJA 5KG5A 1U47A 4CJVA 3OYCA 3MFHA 4UAWA 5IILA 2R8GA 2VG6A 5KI6A 9ICRA 3QLHA 5J2FA 4CJPA 3C95A 3AVLA 3OJSA 3MR6A 2P66A 4CIFA 4R65A 3LP2A 4H8KA 4F3OA 4ECQA 5KFOA 4M3XA 3DM2A 5KFIA 7ICQA 1WSJA 3CFPA 3QE9Y 2IAJA 1D5AA 4MF2A 5DDYA 1KSPA 4NLNA 4CK3A 4PUOA 1TKTA 4NYNA 2J6UA 1S76D 2OPPA 4C8KA 4KLTA 1KTQA 3O3FA 2G8VA 4G1QA 1XI1A 1BPDA 5KFHA 5L1JA 4FLXA 1ZJMA 2QKBA 4ED1A 8ICAA 3T5JA 3LWLA 4GLXA 4M47A 3JSMA 4CERA 2I1QA 4DF4A 1HUZA 3OYMA 2D5RA 3NE6A 1FXXA 1NK4A 1IKXA 4RW4A 3KLGA 2HVIA 4R5PA 3BQ0A 4PGQA 2AJQA 3NH2A 4KHUA 4YMMA 4KPYA 4RQ4A 1LWEA 3U3GA 3NGDA 2MUTB 5J2AA 3M8SA 3V6DA 1D9DA 1S0MA 4Z4HA 1LWFA 2Z1JA 1KVBA 4CF8A 3RB3A 1ZQDA 2Q3SA 4K4IA 3ZT1A 3LAKA 4I9QA 4XRHA 4FJMA 3AVMA 3TANA 4M04A 1S0NA 1QE1A 4J2AA 3P1GA 2IOCA 4F3TA 4ELTA 2VG7A 8ICBA 3Q8RB 3K5OA 3FFIA 4DSLA 2Y1JA 1BVSA 3KK2A 9ICUA 1RBUA 1HRHA 4CIGA 5JS1A 5HMLA 5KGWA 5J2JA 1N56A 2PYJA 4EYIB 4KTWA 1XSLA 2XY6A 2YNHA 4G3IA 4RQ5A 3GFKB 5BPCA 3TAPA 2DY4A 2H5XA 3GDXA 3RJJA 4QAGA 1K1QA 1KFDA 1RBRA 4KLUA 4MFBA 4HUGA 5CR0A 5J0TA 4DL6A 1X2IA 4IG3A 1BQNA 2C22A 4HHTA 5KGXA 4YR2A 4GC6A 8ICJA 8ICHA 1WCLA 4J9OA 1T7PA 3LANA 1IKVA 2O4IA 2PFOA 2VG5A 4RPYA 9ICVA 5C5JA 3VQ4A 3TAMA 3G6YA 1NKEA 4C8LA 5DQHA 4F5NA 4PPXA 3V7KA 4I27A 4CHNA 5L1KA 4R8UB 4QWAA 7ICEA 4O0JA 1LB2B 4F93B 4RNNA 4E3SA 1VRTA 3AVFA 3K5NA 4LZDA 5DB7A 1TV9A 8ICGA 4DFKA 1KVAA 2BQ3A 3OYDA 8ICWA 1RDCA 1RXWA 1JL2A 5HLFA 4NCAA 2FC0A 3VQ8A 3AVHA 3HK2A 3ZDEA 3QEVA 1CXUA 4ECRA 3L2QA 1XWLA 5J2EA 4ID5A 3UQ2A 3OHBA 4IR1A 3HT3A 1JXLA 4W5TA 4O9MA 4N76A 1SZPA 4DO9A 4OPJA 3H8WA 4RUAA 4DSFA 2ZTEA 5KT4A 2BKEA 3GILA 4QZAA 5DLFA 5I3UA 2QK9A 1NK6A 4DSKA 5DB6A 5C24A 1ZQQA 5DK5A 4ECVA 5C25A 4K4HA 2FPLA 1YTUA 1B92A 3QNOA 2G8UA 3VQ7A 2OZMA 4UAYA 3TARA 3HM9A 1EKEA 4CEAA 1QHTA 1FKPA 4CFCA 3LAMA 4DQRA 5KFCA 1ZQXA 4DTPA 5CWRA 4Z0UA 3M9OB 1XSPA 1ZQCA 3GV8B 7ICKA 1UOCA 4PY5A 1UAXA 1VSEA 2HHUA 4PA1A 3BQTA 1A5WA 4R63A 2RPIA 4I2HA 1TKZA 3MGHA 1ZYQA 1NK8A 1JXBA 4JRPA 5FDLA 4CJRA 2ZJ5A 1S9FA 1JIHA 4BXOA 3OYGA 2XY7A 1T05A 4KLOA 5J2CA 2NUBA 2R8JA 4DFJA 1U04A 4YXJA 1KFSA 2PY5A 4E1MA 5KFAA 1COOA 4MQ3A 4KLEA 4QWDA 4CJWA 4PQUA 3OHAA 2BCSA 1IO2A 1JXEA 3PVXA 3SQ0A 2X78A 1C0TA 5K14A 2OYQA 3V1RA 3MFIA 1T03A 1FKOA 3MECA 5KFSA 4M3ZA 1S97A 1WAJA 3OYKA 4YMOA 2ASLA 1C0MA 4JWMA 4NM2A 4CIEA 1NK7A 4E7HA 1HYSA 2C2DA 3HW8A 1QSSA 1ITGA 1ZQLA 2XY8A 3TABA 4DL3A 4KN4A 4IFYA 1HYZA 1KRPA 3MR5A 1S1XA 4F2SA 2AQ0A 4K8ZA 1ZQFA 5HRPA 3G6XA 1CLQA 3OYLA 4BDYA 4EBDA 3LPUA 4KB0A 4FJXA 1ZQOA 2W9CA 4DEZA 3C2MA 3VQPA 3QESA 4CJLA 3KKSA 3PUFA 4OLAA 4RW8A 8ICZA 1LAWA 4Z4GA 3GQCA 2BQRA 3A2FA 3C94A 3AVAA 7ICIA 2DTUA 1YT3A 3AU6A 3ZSQA 1WNSA 2V4RA 5C42A 1BL3A 4CEFA 2PFQA 4DQPA 4QZ8A 3V72A 3MXJA 3PX0A 3M9MB 4AHVA 2W9BA 1O1WA 4PGYA 1WN7A
chains in the Genus database with same CATH superfamily
1RDDA 5CCLA 4Y3CA 2IA6A 1EKSA 2JWKA 3KNAA 1VQKS 4LRFA 2LA4A 2G0JA 4OVLA 4AD6A 2HQCA 4HAIA 1B4SA 2DBBA 3O2IA 4B3MK 2Z30B 4KBOA 3X3UA 1VHIA 2AJ0A 1T03B 4UB8U 2MKIA 3KIOA 1K5OA 5KFVA 1FK9B 1D4XA 3LL3A 3VA3A 3FCWA 2E1YA 2KFZA 3AAPA 3VPZA 3OW2M 1X4BA 4NPOA 2E3TA 3J7YU 1LAVA 3BBCA 3FEXB 4I2IA 5IIIA 2H5IB 3OXFA 3CCMN 2IDLA 1NJXA 5KOXA 5AKZA 3QATA 3U9DA 3C14B 5L9NA 2PI4A 4J9KA 3MF5A 9ICGA 3T7ZA 1HWUA 1VQKN 2CA9A 2KW4A 3VEXA 3DDIA 2W2QP 5MAOA 2KO1A 1N61A 2RF2A 2CPHA 1Y10A 3DOLA 1S99A 3NVMA 1MQ2A 3RF9A 4ZIWA 4DOZA 2Q66A 1NB7A 3DXKA 3JAMY 1HWIA 2WVEA 1CJUB 1SZ2A 1SI9A 1U48A 3AXKA 4O3NA 1T94A 5AHXA 4HTJA 2PEBA 4R66A 3P49B 1PKUA 1ZBIA 4AHTA 2WK4A 3O9UA 4AYBF 1DTTB 1T6CA 4OKEA 1D8YA 5C24B 1QAYA 3MMCA 5HRRA 2YX6A 4RKUC 2HVEA 1QTNB 2DH7A 1YITN 4OZ1A 4RWXA 5L1MA 2MMYA 2Z1GA 4JI1F 4DUZK 2E20A 4MDBA 2RQKA 1HNWJ 1LOTB 5IINA 1S0VA 2QLJB 4DSEA 4ELVA 4BRHA 4IR9A 1HL6A 1L7PA 3L4BC 3P4UB 5J2MA 1P9YA 2XTJP 3KD1E 4XUSA 4U8VA 1N34J 1I94J 1X4DA 5DGBA 2IS3A 4JI8J 4DR1K 3CMQA 3RUBL 3PZPA 3SIPB 4YB1P 2NV3A 3HP6A 3EYZA 3WKAA 1RUSA 2KJVA 3ZEUB 5JVHQ 2C2EA 3NXZA 2LCWA 4BLGA 3RB4A 2YY3A 4CEBA 5GADP 4GO5X 4JNEA 5IQ6A 3MCMA 3TACB 3W8PA 3KZIU 1JKHA 5CHIA 1RTHA 4BR7A 3BPDA 4B1VA 2B51A 3IWLA 3QZ8A 3MN7A 1X9XA 1RT4A 1RZMA 4J90A 4M5HA 2QWLA 2OO4A 2EX3A 4X66K 1ITPA 3FZBA 2RHFA 3PNCA 1Q1KA 3EZ5A 5JMNA 1EXQA 2BJ9A 1BPYA 5T41A 3ISDA 5ETQA 3GLJA 4HVZA 4PL8A 4KLSA 3Q23A 4ZLNA 1HNIA 3RRHA 1NJZA 2PEHA 3HSTB 4Z4FA 4ZLJA 3C28A 3PM9A 5D8HB 4KLQA 2AMCB 2VODA 4PZVA 2P9GA 3TA0A 3ZT2A 2CWKA 1U2FA 4O4GA 3FCVA 2ZHBA 2VONA 3HJFA 4WTYA 4C8MA 1OS5A 2Y1IA 3TSPA 3I87A 1RWNB 1XMOF 1UHUA 3TO8A 4Y2SA 4WFNQ 5KFPA 2ZD1B 3A0BU 4HL9A 5D4BA 1DGKN 4LSLA 4L75A 3BSCA 1XQIA 5A8RB 4JI0F 5HOOA 2EKYA 2FXUA 4B1XB 3CPWR 3T6JA 4M94A 5E2QA 3GSDA 2FMQA 3PX6A 3OD2A 3PYEA 2XI3A 4LRCA 1ZD4A 1P6TA 4DTMA 1KNZA 4ACOA 2VFTA 1OYDA 2KH9A 2HQ3A 3CCES 3CC7S 2H54B 2W11A 1Y11A 3L7OA 3HP9A 2M88A 5M1PA 1RDRA 3PKMA 1NGDA 3IP4B 3L09A 4LF6F 1K8KA 4MFFA 4IRKA 4K7QA 4DV0J 3O1BA 3AVBA 3EICA 1K47A 4CJQA 3N4MB 4Z94A 3HVRA 1HYSB 1EX4A 3TJAA 1FFVA 2CDRB 2KN7A 3FSYA 3A3OB 4QYZK 2Z1IA 4JHDB 1HQEA 4ZCIA 2ZBRA 1GOBA 1KHWA 3LDLA 2P6SA 3GCXP 2H3ZA 3N7RC 4C7QA 1K44A 1RAOA 1C0TB 1FJGK 4FFDA 4LUBA 4J9SA 2AGQA 3D0GE 1V3SA 5CXTA 2QTDA 2DGXA 2GV9A 1R8AA 1TAQA 1BWVA 4DV3F 4JBCA 4NLKA 4J9QA 3M2VA 4DR1J 4NLCA 4IEEA 1CQNA 3R1HA 3DRSA 4WXOA 1BHLA 4Y0WA 1QQCA 3ZSRA 1F21A 4USTA 2ZBQA 2UVUA 2WBNA 5D4LA 3QO9A 3IBPA 1EQ0A 1Z00B 5HSPA 3E9PA 3DRSB 4DHVA 4NZ0A 1L8LA 4BRNA 3O9QA 1JROA 4UB1A 1JNZB 4BC2A 3M1VA 2VC0A 5GMKa 1U02A 3ENOA 1B43A 2KOBA 2IHNA 5DZ7A 1FKPB 1FK9A 4KAIA 1HI1A 1DKGD 3NAEA 2JOQA 4IL6U 3H2UB 5AQJA 4USHA 4LSNA 4B3MF 1IBCB 3E58A 1H3DA 1U0HA 2KHDA 3C8YA 2ZZNA 1SV4A 2ZJ8A 5GMDA 1VJQA 3SJJA 2CZ4A 2FZGB 1Q3VA 4A2AA 3B6BA 1YJVA 4IUFA 1SPBP 4ZTFA 4IQWA 3Q83A 2MQPA 1FO4A 5J2HA 1RLDA 1ZAVA 3WK7A 4I2QB 3AD8C 1VSHA 5IT9U 4OJ3A 4UW2A 2E44A 2XO7A 3W9HA 4GXIA 3HKZF 2GX9A 4CJKA 2LKZA 1XHXA 4Z4CA 1VRTB 3AMZA 1N32F 1VQ6S 1S1UA 3MM5A 1NGEA 4B8CA 1ICEB 1S6OA 4UTGA 4CWBA 3C7NB 1ZQHA 4LRDA 1UT8A 2BYCA 4PXBA 4FXWA 4RR5A 2FJBB 4N47A 3WXMB 1RXVA 1FJGF 3PV8A 2DRBA 2GO9A 2PFPA 4OYOA 3IGNA 4CLTA 2VUGA 1HYVA 4A46A 4LFBJ 4JKGB 4BWJA 5JTIA 4LF7F 2NRXA 3G6EN 4MIAA 2ZWHA 3BQ1A 1ATNA 2D0PA 2WONA 2IJNA 4IFYB 3Q24A 2F1HA 3KWGA 3T19A 2CQHA 2QL7B 1YG0A 1HKBA 1OUQA 2A1JA 3AVGA 1HWJA 2C2RA 2VPZB 3MD3A 2QKQA 4OYXA 3HXMA 5AM4A 2RB7A 1T4GA 2GAHC 3UDVA 1HR0F 1YXQA 1ZC6A 2ZH6A 4BVPA 5J2IA 3THVA 8ICCA 3T1HK 3HM8A 3BQ7A 4NLZA 5EE3A 4Q2MA 1KVCA 1Z3EB 1KKXA 3QU4A 5AQSA 2DO4A 4CLKA 2MY7A 1W7AA 2PDAA 2R7WA 4Z2XA 2A1BA 5L1LA 2HRUA 3J7YI 1ESVA 4C9DA 1W9HA 3H08A 3MN6A 3Q8YA 2YKMA 4ETXA 4P0QB 3P6YC 2GQQA 4FJ5A 2CXEA 3EPIA 1VQ5S 4KHPJ 1IJJA 2UUCF 3QWUA 1CJKB 5FDLB 2F9WA 1KLMB 4FZVA 2ROPA 3IDWA 3KJFB 4WYWA 3SMZA 1CULB 4RW4B 1YDLA 1U1OA 1FJGJ 3RGIA 1GH8A 2W9MA 4M9NA 3CW2C 5F0XA 1C6VA 4B9TA 4WK3A 1XTZA 3W5YA 2HSTA 1NDLA 5K8OA 2F8EX 3M2UB 3UD5A 4EYHB 3RMAA 4QZCA 3VOVA 2L3MA 1MROB 3CTRA 2GVDA 4FJLA 3JTNA 4F4KA 2NXUA 5D49A 2JVOA 5GIPA 4KFBA 4I6YA 2DNHA 2CG4A 2JV3A 4L3KA 1RT5A 1NGGA 1BPXA 2ZC3A 3HPGA 4FJHA 1WWHA 1MN9A 3H4BA 5D0EA 2OIHA 4FZYA 4K50A 3ZZUA 2WF8A 4QWCA 1XU4A 4EX7A 2IBKA 1I3AA 4MKAA 4D3GA 2F4VF 2OWOA 2RQ5A 4OV1A 1HHTP 1CVJA 3MI7X 4ZJLA 2OANA 4EWTA 4OZ5A 4IOCL 3EDRB 5KFWA 3DI6A 2BCRA 4QW9A 3MR7A 3ZNJ1 2JHDA 4NXMJ 1F2HA 3VGTA 4L73A 4E7KA 3QEWA 3PJWA 4CLPA 5K8PA 2Z2LA 1OH7A 4KGZB 3BO4A 4EIAA 5LXYA 3OUYA 1U9LA 2CUYA 3VAJA 3LW5C 4LIWA 3NFAA 2EZYA 3CJ8A 4Y2VA 3A5LC 5CRXA 2VFRA 2GW8A 1BQNB 4YOVA 5ETLA 4USMA 4IG3B 2DXEA 2FVPA 4BX9C 4WYBA 1NDPA 4F71A 5LSRA 4CZKA 5HN0A 4DV4K 1C1CA 3CF5Q 1IG9A 3RH5A 2E2OA 3KHHA 2IVFB 3QX7A 1UEVA 2CZ9A 4QWEA 4L8RB 3DRXA 3AL0B 1EZZB 2P9IB 1W26A 1RWOB 3SV3A 2IIRA 3FDSA 2QWNA 3MEGA 1R0BG 4U6PA 2HHTA 3EE9A 3FFIB 1RYSA 5JMVA 4NX9A 1JUDA 2WFAA 3DLGB 3W2WA 4YOTA 4XH4A 1M5KC 3I96A 3N6LA 1EQYA 3JQMA 2XIDA 4MK9A 3KUHA 2CJBA 4YB5A 1ZQRA 2IOFA 3ET6B 3M6UA 3RB0A 3D5MA 1CLFA 4AL5A 1TVAA 2UXCK 2C3PA 2J9CA 4B1WB 3V4IB 3T3FA 1C0FA 2E7WA 3UMBA 9ICXA 2E4LA 4IG0B 4B3SK 3OW2R 1ZRNA 4AILC 2V8PA 1QZ5A 4DX7A 2H4WB 3ZXWA 2AF6A 2BTFA 2DPJA 3S1TA 2WVCA 5KG1A 4UUXA 1GAOA 3LDSA 5CD4A 3F2BA 4M0AA 1GLBG 4QZFA 1JLQB 4CZJA 2E8AA 1WSGA 4NO7A 3C6HA 5T14A 1FWKA 1HW9A 1RT2A 3OVSA 2XI9A 1RU1A 4RPZA 1HI0P 1RTIA 2EWSA 5C12A 3W64A 1BOTO 1JJ4A 1B9DA 1KWMA 4I0WA 1FESA 2JC0A 3GV5B 4Y0FA 3M8QB 1VIXA 1GNKA 3G71N 5B0BA 4UASA 5KFXA 2DFHA 3PIPL 3LP2B 3OR1B 2I7PA 3DV9A 2GVZA 1AB8A 1YGYA 3TADC 3MECB 3IM1A 3JXUA 4AL6A 3CERA 2GWSA 4I2FA 3NASA 3T5HA 3D3CJ 3VEVA 1ZBSA 2UUAF 3US5A 3HZEA 2KJ5A 1WDTA 3JSRA 2YQ1A 3I0SA 1RKJA 1KQGB 2JHEA 1RAGB 4IZ9A 1YJTA 3CJBA 4AM6A 5AQGA 1NSPA 2OPRA 2Z0GA 1U1QA 2NRHA 4M63A 5HBMB 3PR4A 4PH5A 3MR2A 4F4XA 1IM4A 4JK7A 3W8GA 4WQ4C 4W5QA 1CRXA 3DRYA 2QG9B 4LBIA 3H8SA 1SJ1A 3CFOA 4Z6DA 3RBEA 2MHNA 2FPMA 1CPZA 3PFEA 1TL4A 3FRYA 1HJOA 1B99A 2XS7A 2V8HA 4RQMA 1ZQGA 2FMSA 1Z2LA 3D4JA 2B8QA 1XMOJ 3CYMA 2QX0A 2HBQB 2FJVA 5IM0A 4C4WA 3PJ9A 3OS2A 5J2KA 4LF4K 3E2EA 2V94A 3MK6A 2YCHA 4FO6A 3H6EA 4J9LA 2IVNA 2ADCA 5KFTA 3ISZA 4CLYA 4IO9L 5KG2A 1DXSA 1IUJA 4Q5VA 3ULEB 4UQGA 5DDRC 1RCHA 1KR4A 1G6BA 4IDKB 2CQ2A 3EN9A 4JI7J 4DOAA 2OGUA 2OMOA 1XC9A 3G86A 1KDNA 3AUOA 3BS5A 3VQ6A 2E5GA 3TPQA 4X4SA 3RAMA 3MGVA 3NTUA 4DX5A 4DCCA 2ERRA 2P6TA 3QUQA 1VQPS 2F3JA 4ISGA 1HUOA 3ADAC 3W66A 1NUEA 2WB1C 1MG7A 1QQ5A 3UPFA 4NLUA 4X64J 3JPOA 3NNHA 3FGUA 3ILIA 2RH3A 2IY5B 2ZIWA 3ZTOA 1RP5A 3EWGA 3PW4A 3CP8A 3M9NB 4O0IA 2ALZA 3M8PB 2HMIB 5LMNK 2JR5A 5JLHA 4ZPTR 2X51A 3RG6A 3ZETA 1L7NA 2YNIB 1HNVA 3THXA 1Y5LB 4WFBL 4FM2A 1KAZA 2EFNA 4C11B 1JLCB 1U26A 4AP9A 1IG8A 3WXIA 2ZIVB 1LW0A 4CGGA 1XNQK 5G0RA 3L2RA 4M3YA 4JP8A 5E3QA 5B8HA 1AA1B 1P8GA 2FD2A 4ZP9A 1IJEB 4AL7A 1X6IA 2M0NA 4P10A 2EI5A 5BR8F 3CJ5A 2J6TA 1YZ6A 5ETMA 4P2HA 2VGNA 4L74A 2DR5A 5DB9A 3MM7B 3NF9A 4KHPK 3D54A 5IM0B 1YJNS 3G0ZA 2DKXA 1YJUA 1JLAA 4H4MA 4X66F 4LFCF 2MZQA 1E6VB 7FDRA 4QOTA 1FERA 1OW5A 2EK1A 4UZBA 3GIKA 3AQPA 2KIWA 3C66A 4KV8B 4QS9A 4PQAA 3AA9A 3ZDAA 2X6NA 2C3YA 1YAGA 4NLBA 3MM9B 4TVAB 4MYUA 4OYMA 4DR7J 5DG8A 2B4VA 2YV0X 5CP2A 3CIMA 4ZITA 3F2DA 3SBGA 2CN1A 2UU9K 4H4OA 3D2NA 1O51A 4FLYA 3EZOA 4H54A 4RW7A 4FO0A 1PSDA 3FC9A 3U26A 4EBEA 1TK8A 3I0RA 5A6PA 4FS2A 1ZQAA 3TW0A 1MWMA 2ABYA 3IUCA 2KL8A 4Q0BA 3QPIA 4UOFA 4KGVB 2IIHA 1ZM2A 4DQQA 5KPZA 1CJVA 2H3GX 3V81B 4OX8A 3CCSS 4EO8A 3VTHA 3Q8VA 1A76A 3LALA 3UD4P 8ICOA 5HMWA 4RPFA 2RP5A 2MYFA 1X0FA 3RMCA 4GVBB 5CZVA 3GJTB 1F44A 2R7SA 4CT9A 2CGKA 4HDHA 5DQIA 1ZQIA 5EOYA 3CHWA 5KRSA 2LU1A 4EGLA 4P73A 3SQ2A 3LYSA 3OXLA 2B0GA 3PIOL 1SV0A 2W43A 3TRGA 1TL7B 2R7OA 3NNCA 3QEIA 1FVSA 2VIXA 1X9WA 2QARB 3KVGA 2HHQA 1GX5A 4CF2A 3QETA 3WEEA 4NXNF 4X64K 2AYMA 4XTTA 1ZPWX 2Y8YA 4CTAA 3MMVA 3I1YA 2KYXA 3KHGA 1EWQA 4M42A 3KHLA 2E8MA 4WK1A 1UW9A 3DLHA 3E9OA 1OPIA 4OJHA 1S1VB 2QMXA 2DNPA 2FJEB 2LM4A 5AR0A 2QEXN 2H5JB 3NVZA 4NRUA 3ALRA 3BZKA 4RCHA 4DX8H 3ZT4A 3UW1A 3M05A 4NLVA 3DLLQ 2HGNA 3MEGB 3G82A 3BREA 2NYIA 2I9GA 2GFFA 1FXLA 7ICPA 4G1IA 2KIVA 2BGWA 3P3DA 4WQ5C 3KLHA 2C28A 2PXIA 2X6SA 3UR0A 4Y2JA 2XICA 4KY3A 3PKYA 1R8CA 1VRUA 2X3GA 3HYFA 3G8SA 4YN4A 2V8VA 2G1HA 1WC4A 2YNFA 3HKZD 2ZIXA 4F25A 4OYWA 2YH1A 4DL5A 3VAHA 5F1XA 3TAQA 4FOIA 3H0RB 4P52A 3NCQA 2XSFA 1GXTA 2NYVA 1RT3B 2OTJN 4CGIA 4HT7A 4WZQA 3SPZA 3AA8A 2ZJPQ 4ER8A 4LFAJ 4GXJA 1Y97A 3C1YA 3JTPA 4IKFA 3CCQN 4YMNA 3VHQA 4OZLA 2VQFK 2POKA 5ADXA 3W62A 5K20B 3IS9B 2YXLA 2YKAA 4E7LA 2YWGA 3BS5B 3SXLA 2K2PA 4ED4A 4ILGB 4J9PA 3HX0A 2OHDA 1KN5A 3QFHA 1WKKA 3J80O 4IDKA 4PL7A 1S4FA 4J9NA 5IV4A 2B6GA 1Y9OA 2CPFA 3HVWA 3I31A 5EGYA 3D2SA 1SL0A 1ZOLA 2HFSA 3LP1A 2E5LJ 3IGVA 4EFHA 3MR3A 2HAIA 9ICIA 4KBIA 5KFEA 4DR7K 3QEPA 1YSJA 4KHSA 1VBXA 1QVGR 3H8JA 1ZJNA 3BO2A 2ZDOA 4P4MA 2E88A 1R31A 4HACB 2GVDB 1WI8A 3NKYA 2CJAA 1XMQK 1UZDA 2M52A 8ICIA 1RDFA 1X4CA 1OIAA 1NSKL 1CUKA 2BR0A 2AX0A 4U7UK 2AW0A 5EUHA 3OS1A 2P5OA 1PYTA 4PCQA 4XA5A 3CMEN 2CPZA 2QM1A 2MQQA 4F67A 1CS4B 3PXGa 2C2OB 1TL5A 2KG0A 3C23A 1Q8IA 3UFCX 4OZJA 4CJ4A 4KIAA 2H9ZA 1Y4ZB 4LFAF 4I2PB 4RG8A 4RLEA 3RJIA 4HHUA 3CCVN 4JS4A 4PWDB 5JUMA 4EHTA 1FRIA 1YWXA 1U45A 4E7JA 7ICLA 5HMYA 3N0VA 2E1EA 3KLEB 3IRUA 5CA7A 2JXJA 3C6UB 4C1NK 5CR4A 4FSVA 1WELA 1VJWA 3GIRA 1MLAA 2ZBIA 2H3VA 4BVOA 3GYXB 2PAVA 2LLZA 2NO5A 3R7SB 2R7QA 3ZSYA 5HQ8A 3NRZA 4FLTA 3MMBB 1QY7A 2ZM6K 4W90B 2A1JB 3CPWM 2P2CB 1YF5L 4ZPDA 4OZ0A 5AQRA 3TAGA 1NXIA 1QZ6A 1S59A 4NOHA 3W3SA 4NLWA 4A8SA 2NRZA 1JQGA 1X9SA 3CCEN 3THWB 4G9BA 4JKGA 3IS9A 2IVYA 1DOQA 1NMDA 3R8YA 1DFDA 3WNEA 3M30A 2GIRA 3CC4N 3V9UA 2KICA 4A4JA 1I39A 3VAGA 2YNGA 1ZS6A 4DR3J 3TFSA 3IHQB 2YKOA 4B3SF 9ICEA 3R5AA 3L6QA 3ILLA 5B0DA 2HWHA 1OH6A 5J0PA 3V4IA 1S10A 1FIQA 2LYAA 3U8XA 5A8WA 5RUBA 2WTUA 4ZTJA 3OFFA 3MCPA 1NLKL 3VEYA 1S7HA 3K5LA 3PDNA 3MDQA 3SCIE 1XNSA 1N34F 1I94F 3H45C 1BPBA 1N33J 4NYFA 3KLHB 2BPGA 3NBPA 1NKBA 2VOPA 1FFSB 3DLGA 4ECYA 2B7BB 4ZPCA 1OH5A 1CG2A 4RQ3A 3M3ZA 3HFZB 1NNDA 2OELA 4H5NA 1NWKA 1SKRA 4DUYJ 2F9JA 3PCOB 5F3TA 3WC2A 2B4JA 4J5OA 3LWMA 2YI1A 2ZKTA 2PFUA 5BOMA 1PJ6A 2F1JA 3VF6A 3F53A 3I56N 3NMRA 5ETOA 4DL2A 4GVMA 2GTDA 1UEUA 2CQCA 4RO0A 4DU4A 5KFZA 1HPZA 2K8BB 5J8YC 4PKGA 4N41A 3RJHA 3RJFA 5J2GA 3V6HA 4I2AA 4W5NA 7ICUA 3O44A 5BXIA 2KSOB 2MLYA 4GKKK 1WF2A 4OJ1A 2I5HA 4GY2B 2VJVA 1KOOA 1UZHA 1Z26A 3CC2N 2OM6A 4JWNA 1X3MA 5SUHA 1WSRA 2HFUA 2CWXA 4ED8A 1RT7A 3ATVA 1GLEG 4LF7J 4WWSA 4WCEQ 2CAJA 4GIBA 4CJVA 4JI5F 3MFHA 2O6KA 1N5TA 5ALTA 3QLHA 2VPXB 3DMJB 3AVLA 1O8BA 4CIFA 4CO3A 1XNQF 4H8KA 5FLXU 2M8DB 3MM8B 3AQEA 1HR0J 1RYUA 2F8LA 2M5YA 2IAJA 2MZJA 1RDWX 2G4BA 2YTCA 2DNRA 5AQVA 1M5OC 3ENQA 5BPNA 1KSPA 1XMBA 2J6UA 4C8KA 5AQWA 4NA3A 3HD1A 1YRXA 2MQOA 2G8VA 4G1QA 2K8CB 1U25A 3TR5A 1ZJMA 4URSA 4M8LA 3CF5L 5ALUA 8ICAA 4QS8A 2N82B 2I1QA 4FZMA 4DF4A 4JB3A 1NAQA 3DYAB 3UDLA 1KXPA 1FXXA 3RVCA 3KLGA 1CULA 1BWFO 5JXSA 2OKQA 1Z6RA 5D4NA 1RWPB 5LJWA 2Z7JA 2V2QA 4QIWF 1JLGB 2DF4B 4J91A 3WQPA 5J2AA 2KEYA 4HHHA 4LF8K 5A8KB 5AZIA 4CZCA 1KVBA 5AXKA 4CF8A 2PC6A 3IDHA 4B3RF 1TZ0A 5IFMA 3J81O 2G13A 3QB0A 4FJMA 4EELA 1TUWA 4KGKA 4PL1A 1S0NA 3BBBA 1YJ9S 3P1GA 2UP1A 1P1TA 1VI7A 1XIQA 8ICBA 3CCSN 3Q8RB 1IM6A 4WP3A 2YX1A 4GKJK 4DSLA 3NVVA 1BXNA 1K0VA 3LDNA 2AH5A 2HGLA 3KK2A 1RBUA 2DRAA 1HR0K 3IXQA 5JS1A 3SCLE 1N56A 4LR8A 2PYJA 3CCQS 4G3IA 2ZIVA 2OFHX 3R5DA 3GFKB 4ZKAA 1HKCA 4OI4A 3T6BA 2DCUB 4TLRA 4W98A 3GTYX 4Y2YA 2A10A 4G65A 3LTOA 1R27B 5A0YB 4MFBA 1NZAA 5E5NA 3HHDA 4CO2A 3I76A 4E8UA 1SJRA 4CRXA 1MA9B 1MMNA 2YVSA 4NEZA 4ENOA 2R7UA 2KXFA 4J9OA 1S6UA 1VHFA 2HFNA 2E1CA 3LANA 4H0PA 2O4IA 2VG5A 3A13A 4C0OC 4RPYA 9ICVA 1Q8KA 5HR7A 1OJ4A 3TAMA 3C7NA 1NKEA 4C8LA 2NXCA 3MX2A 3A0HU 4R8UB 3EXYA 1LB2B 4E3SA 3AVFA 4DFKA 1OY6A 4X4TA 3L9ZA 3AJ1A 5J2MB 4FL9A 4H5WA 3MXHP 4JK9A 2DY9A 2EC0A 1WHWA 2RE1A 4DV2F 1CXUA 4ECRA 5J2EA 1XMQJ 3W9IA 5AIBA 4JEPA 1NLVA 3HT3A 4L6V3 3M7VA 1G99A 4FVCA 2FJWA 4N76A 3ZTRA 3FAHA 2FQQB 4RUAA 4QZAA 4HI2A 1Q86O 3ID6A 1NK6A 4DSKA 5DB6A 1ZQQA 5DK5A 1F0MA 1DTQB 5BR8K 4K0KF 3EJMA 1YJ9N 4UAYA 3P5TL 3HM9A 4O5FA 5DDQC 1NU0A 2F5GA 4CFCA 2YTUA 4DTPA 3D2QA 4Q2LA 4Z0UA 4M5KA 5GAGU 1VQLS 1N33F 1HBMA 1GLLO 1B0XA 1TKZA 1ZYQA 2DNOA 1X7VA 3DGPA 3KWMA 1JXBA 4B1YB 1JIHA 4YOXA 2R9LA 1X6JA 5J2CA 3DU5A 2NUBA 2CXYA 2R8JA 1U04A 5ALSA 1VQ9N 2YHWA 3TZYA 3BGFA 1N36F 1KTVA 3TZZA 1IBKF 4QWDA 1WEZA 3WK8A 3MAAA 4A8EA 1RKIA 3OHAA 2BCSA 2W6KA 3PVXA 1ZOTA 1C0TA 2OYQA 5GAGI 5AQXA 5I9EB 1XERA 3MN5A 3MECA 3JQKA 4P72A 5F8IA 3OYKA 1NK7A 1FT8A 1HYSA 4E7HA 3SENA 2K1RB 1ZQLA 1RAJA 5ALYA 4DL3A 3KUEA 3MR5A 3W60A 4M5DA 1DT9A 1UFLA 2M2BA 1S1XA 3AY9A 4LIRA 1JB0C 4K8ZA 1ZQFA 2E5HA 3I4HX 1X60A 4OI3A 3JS6A 3LPUA 5HANA 3ELHA 2WB1D 2Y3YA 1ZQOA 2W9CA 2ZBPA 1HNWK 5GAEU 2EFPA 1Q7YT 4ZN3A 3X1LB 2HDOA 1F5CA 4RW8A 3HX9A 5HL7Q 3NS5A 5AQYA 1O03A 3A2FA 3AVAA 1N8RO 2P9PB 2YJEA 3GSIA 4RW9B 3ZSQA 4CEFA 3CD0A 2F4VJ 4DQPA 3PX0A 1S1XB 2BDUA 3FE1A 4AHVA 2W9BA 2P9NA 1O1WA 4PGYA 1WN7A 4PPZA 4YOYA 1MC8A 4OO1J 4X4UA 4NXMF 4A8YA 5LSLA 4C8OA 4DG1A 2BE7D 4RQ0A 5DDOC 2ZF5O 2O8FA 1VDVA 2J0QD 2ASOA 5CA5A 2Y8WA 2VHGA 1NI3A 5CYMB 3MTJA 1BLUA 3BUZB 3SCKE 3ZT0A 3ZTPA 2IJRA 3SV4A 1WOOA 4C4SA 3GIIA 3BZQA 2KJWA 1SIJA 2P9LB 4JV1A 4JKAA 4MEYA 2BJ3A 3JB9k 3SI8A 4X84A 4ED7A 4F92B 2P9SA 1PIEA 1ZQWA 2R7XA 1SQFA 1T8EA 5ALKA 3TTFA 3HOTA 4PHPA 4YVZA 3ENAA 4BR0A 4HI1A 4JI4J 4BC4A 4LFBK 2MB0B 4ILJA 4DTRA 4DL4A 5ADZA 2Y9UA 3KLFA 2VU5A 5T7LA 3RAQA 2BE9B 3DXSX 1KC8T 5F3ZA 5CZ1A 3N5BA 3A8YA 4DUYK 2ZNYA 3HMJG 5DRKA 3QU7A 3W5ZA 3U27A 3MPDA 3CT9A 4BC9A 1UCVA 4UB6U 4QZBA 3ENWA 1BMQB 2PGCA 5EWGA 1CC8A 3PW0A 1Q3UA 4A61A 2QB0A 4UB5A 2R7RA 1BUXA 4CLFA 3H0LB 3PSFA 4J2DA 4CVNE 3CMAN 2Q4TA 1QQNA 4K43A 2Q1NA 3D6MB 3EGVA 3FGVA 4UT4A 8ICXA 4JHDA 2MA1A 1J5EJ 2WSCC 4NA1A 2CGLA 4JI1K 4CLWA 1XR6A 3VQSA 3ALYA 1M0SA 2XMJA 4ZVFA 3MDCA 3QGIA 3O9RA 4V19S 2XC9A 1YBTA 3MMCB 2XZDB 2KJ8A 4ID1A 1SL2A 4I1TA 5E3PA 1N6QB 2G2ZA 1WF0A 3M8YA 3NUQA 2WOMA 8ICKA 3SUNA 7ICOA 2Q79A 4CK2A 2SXLA 2E1PA 5IIOA 3OTBA 4IRDA 3FEZA 4YD1A 1XR5A 3C15A 2G9OA 2XWYA 3MGIA 3GG0A 4EBCA 2ZH7A 1B70B 4M9GA 4DV4F 4CF4A 4RBVA 1KLMA 2QA1A 4QOZB 4KLFA 3FBCA 5ALFA 1X8DA 4E19A 1KBRA 1YLXA 2EFQA 2VICA 4K0KJ 3C14A 3VGSA 3G9CA 4NA2A 1JCEA 3Q8QB 3L2UA 4TY8A 4IWVA 1EETA 3K75D 4R64A 1BI4A 5HQMA 3H5YA 4FVMA 3JPTA 1PVPA 3H46O 3NAHA 5J1EA 5ALPA 2HVDA 3OTQA 5FJ4A 1QS4A 1HD1A 4IC9A 1WG1A 4X4VA 3GP9A 2KKZA 3J80U 3VGKA 2G07A 5LL6d 2RKIB 5J1EB 4DUZJ 5JJBA 2P9CA 1BI4B 3DLEA 1N36J 4FCYA 4HCCA 2BCQA 4KT0C 1RACB 2F96A 2KDOA 2D9PA 3QU2A 2MKCA 1WF1A 3V6DB 2AQ4A 3SEOA 3W2VA 3QRQA 4BRIA 1R89A 2HSZA 3CXCM 1KEKA 2CPXA 3PYGA 1S0OA 1RAEB 5HRNA 2D69A 2HK3A 9ICSA 4DMZA 3ZSXA 1MSWD 2UVWA 4M9HA 1JNRB 4CFAA 2WF7A 5K8NA 4AH9A 2GOLA 3QIOA 1VFJA 1VR6A 1PK3A 2ADBA 3KMQA 5MLCQ 2ZJQL 3EVMA 5KL1B 4YHHF 4B9LA 2O4GA 2H1YA 4CZEA 4B3TF 4ZDNA 1OVYA 2OPPB 4QR2A 3WNFA 3NDKA 2LYBA 4JI8K 4HCBA 1P7DA 4OLOA 2Y0SF 4PWWA 1KQKA 2KTQA 3D2WA 3ZC4A 4L72B 3HILA 2VQFJ 2DNLA 2DR7A 4K4SA 3H7IA 4RQ6A 3DGVA 2DR6A 4KH5A 2YMMA 4IO1A 3T1HF 3K2PA 1KFTA 2HB5A 1RBSA 2RRDA 2E1AA 2ROGA 3EZUA 1ZQVA 4XO0A 3IBWA 3VGMA 4UOHA 2ZDPA 4DV6K 1CJUA 9ICMA 4IQXA 2QWPA 1AT1B 2UUBK 1PYSB 3NGKA 5K5MA 1ZRMA 1YJ7A 2AYGA 2VJ4A 2VF3A 4DQSA 1X4EA 4URGA 4XPEA 1T05B 2QMWA 1YTAA 2DIUA 1LKZA 5T7LB 5AM1A 5EXWA 2I38A 1HPZB 4XEIA 1TKZB 3C5FA 5ALJA 3IRWP 1WKJA 5FPNA 4LFBF 4KRWA 4NLXA 4UBCA 2CQ0A 2FBTA 4RTFD 3MDFA 2YWKA 4ZA1A 1N5YA 3T79A 2COLA 1KD1O 2NRVA 2HBYB 2HHXA 2F8TA 2ZKUA 3T9NA 2P9LA 1N32K 4CHOA 4KB7A 4M9JA 4FK0A 1CZ9A 1JALA 4M6WB 5AK6A 2FYXA 1YHQS 3IWXA 2W8LA 1L3VA 5D15A 1LXJA 3KXDA 4CT8A 3UN3A 1TK5A 3SQIA 2IJFA 5AIAA 4Q45A 3H2LA 1X1PA 1S49A 3B6OA 1L6NA 2BANA 1YJWS 1J2VA 4ZCLA 3HL8A 1UETA 1LKYB 3JS9A 2RNEA 2E1FA 2P9NB 2J7WA 3V1OA 1MQ3A 2UU9J 1F5SA 3H5XA 2HBJA 3B6PA 4NCGB 1S4EA 4Z6EA 4H0VB 5HLFB 5KFGA 1YVFA 3UI3A 4NV0A 1VOMA 5C42B 4FVUA 3SBTA 1NZBA 4U7UD 1ZQZA 2J4RA 1NPPA 2W3SA 1AXQA 3I28A 4JYAF 4W5RA 2X1FA 5H2FU 4XK8C 3HHLA 1NBWA 2KI2A 3TEHB 3NS7B 4KHNA 2HBLA 4PR6A 3C5GA 4WFNL 2A3VA 3HWTA 2JEJA 2YKNA 4MIBA 2A6AA 4LSLB 1Q9XA 3MGJA 2JGUA 4C4RA 3V2UC 3ZZYA 3SSQA 1BNOA 4NLPA 3SDEB 1SCJB 4NXZA 4FNIA 1ULRA 3DLEB 2W01A 2ZVSA 2OEKA 4ZLLA 8ICSA 3MMBA 1BHNA 5JLFA 1X4GA 4DR2K 1HX1A 5L1IA 1RTDA 8AT1B 3RJKA 3J7Z5 3IA0A 5AFUH 1TKXB 4YCXA 3VC8A 4KLLA 4DTUA 2CQIA 3BR9A 4B17A 2LDIA 1LCUA 3LQVA 3IR7B 1L3UA 1RHMB 3D0IE 3HHEA 4CDGA 5KAKA 3CJ7A 1AUSL 4ZOSA 4DV7F 3G4SN 3UO0A 3O9SA 1N34K 1I94K 1Y88A 4TY8B 1LEOA 2Y0SC 1RT4B 2FGOA 9ICPA 1C4CA 3E3XA 5AZIB 3J7ZO 2NO4A 5JVGQ 1X4FA 4AYBC 1MU2B 3TJ8A 2W9AA 3WQTA 2MUTA 3CQYA 5CZ2A 5AZJA 1L3TA 2AD9A 1IJFB 4KI6A 5AK3A 1GLDG 3CJ4A 4W92B 2G5IB 4R5PB 3JPNA 3VQ9A 3VA0A 1JK9B 4ZMMA 3MUVP 3NL0A 3CD5A 5IIJA 5A6WA 2OEHA 3DU6A 3GU0A 1CXQA 3ETMA 4B3RJ 2MSNA 5BYQA 2UVRA 1VSMA 4F72A 4GVLA 4LREA 1MA7A 2H3EB 1VIOA 5J0QA 1SAZA 5AK5A 3N97B 4ES3A 5HK4A 2AHOB 3LP1B 1FEHA 2VDIA 1DEJA 3ISNC 3TAFA 4IFVB 2IRYA 4IJNA 2P1JA 3F5TA 9ICCA 4ZP8A 4FLZA 3DWLA 2ASYA 1DTTA 4RL1A 4DR2J 5GTIU 3TWZA 4HTUA 2ISOA 5KFUA 4AT1B 1KCFA 2PI5A 4A62A 4R0EA 1KVIA 2O8CA 3SAGA 3ULHA 2E7VA 4UY8T 1FRJA 3ZSOA 3AA5X 1PC5A 2XCAA 5M1OA 1A0OB 3DRPB 2JZBB 3QAUA 4OKKA 4Y2XA 2EZZA 4DR5K 4UOGA 4OZ3A 3V9XA 3KLFB 1SVDA 5G4DA 1SWWA 2IDEA 1TYQA 5DB8A 3W5XA 3R5JB 2OD6A 4XPCA 1AQ6A 4CFDA 3OYBA 1IV0A 1V9OA 4DZ6A 3R2CJ 3B4MA 3GDQA 1N5SA 2KFNA 2P9SB 1J53A 4CF9A 3LDAA 3WT0A 3G6ES 4BRCA 1G3OA 3CJAA 3CD6N 3BGRA 3ZD9A 1Q5VA 4FWMA 1H72C 4U9RA 1W7WA 1QQMA 3RJGA 2GJFA 1EB0A 2E8PA 1A6SA 3KKAC 4O3PA 4DR7F 3SLCA 4IDHA 4FZXC 1UVMA 4QCLA 2N7CA 5BN9A 1GMVA 5AJ3J 2BKNA 3E8OA 2OA8A 2YPZA 3TA1A 2HMXA 3O3HA 1WWVA 9ICAA 3NCPA 4BQLA 2V67A 3MMAB 4LF8F 1NJYA 2FY8A 1LWCA 4M3UA 2VBYA 5E7OB 4MKYA 2LQJA 2CJYB 1U24A 1UFKA 1RLCL 3ZZOA 3R97A 4S0MA 1A5XA 4B9VA 3DHWC 4K2XA 4KH1B 4PXCA 3KLGB 5ALXA 2QA4G 2CIMA 2AIRB 1PCAA 1R8HA 1GOAA 4NZ7A 1BG3A 2HHWA 1RWKB 2GV1A 3CIZA 2BE2B 3QGHA 3EUNA 2RRAA 2A5XA 5DM6L 1DRGA 4DFMA 3OVNA 4FF4A 1L3SA 5AKXA 1S12A 4DV6J 4LJMA 2A1RA 2DGQA 1RWXB 1T02A 1NEEA 3WZ0A 5AI5A 1PYOB 5ALWA 4OV6A 1RWVB 2FHMA 8ICYA 4ZVEA 4YY3F 1CZBA 3L4IA 4FJJA 5GTHU 4CI0B 1PZNA 2X1AA 3MCNA 1A5VA 4Z4IA 4Y2CA 1TMJA 2FHJA 4OGEA 3AO4A 2NUHA 4O44A 1NCLA 4YR0A 5H9EJ 5HHIA 3ZCMA 4JI5K 2HLUA 4CQ1A 2CQ1A 2DITA 2X74A 4FJGA 2V69A 2I2YA 3D2FB 4TQSA 3KK7A 5BR9A 2JX2A 3MBYA 3G10A 3UN5A 1TL3A 2Q6BA 4LF8J 2FB0A 3GCWP 1UKUA 2KQ2A 4CK1A 1WUDA 3CO0P 4I56A 5KG4A 4FLVA 2WVFA 4NL9C 4IOAL 1YITS 4H5TA 3F0NA 5F8GA 2CH5A 3BJYA 1K8AO 3H20A 3KG1A 1UPHA 2ACYA 2A19A 3C29A 4DTOA 3SK3A 2A42A 4L3NA 4CJ3A 4K59A 3AU2A 1YKWA 4DN9A 1QHAA 1FDAA 3GE9A 2ZH3A 2D4WA 1M90T 5HVFA 3KKRA 1DGJA 2ZM6J 4ZHRA 3R2DJ 2MY8A 1S1TB 3KTQA 2RN2A 3A8EA 4WFAL 1F60B 3SI6A 1IV8A 5E79U 4JS5A 1KLNA 3IMXA 3DRRA 3OYFA 2FVRA 3LP3A 2B0CA 1ZPVA 3OTCA 5DBBA 2DY1A 4MKVA 1Z25A 2ZG6A 3C6TA 3O3GA 4BACA 4NLOA 1SGGA 2NRTA 1DBDA 3ZX2A 1L7OA 3RBDA 1XNRJ 5ALRA 1RXOB 4LF6J 2RJZA 3UCZP 4OJLA 4A8KA 3KOOA 1FTRA 4ZVUB 3W7BA 3BM7A 2PD1A 4M5LA 2UXCJ 2NZTA 2CDQA 2W4DA 4P9SA 1U1NA 3SSSA 3G96A 3OTEA 4ZIVA 4ZJQA 2MGZA 2OCEA 4N77A 2MDAA 3KZBA 5H1SV 2XYGB 3A3NB 4HYKA 5ETPA 1RQNA 4IYQA 4O0NA 1XK8A 3D0HE 2JGAA 2HHHF 3LPTA 1VAZA 3QINA 3TSQA 4WCEL 5I42B 4DPYA 3R6LB 1R8BA 2HNDA 4FLUA 4FK4A 4KLGA 9ICQA 2P9UB 3BSOA 3NOGA 8ICQA 2O3DA 3OR2A 4BGBA 1LQ9A 2C3MA 1DZ5A 3AT1B 1VRQC 1C20A 1ZQ1C 2ZOMA 4DOBA 2VBXA 2WB1F 2DHGA 3DRRB 2HQIA 3QGGA 2VV5A 3KJVA 1N8RT 2HNYA 4KMUA 5EE9A 3C6UA 5LOQA 3KDOA 1L7MA 3GFHA 1WC0A 3G71S 1QE1B 4ELUA 4EK2A 3J7AN 1PUZA 1VQOS 3F9KA 1RWWB 4ZVQB 7AT1B 2ITGA 5LL6Z 3A5NC 3KD5E 4J2BA 5CY4A 4OL8A 1RQ0A 1LWFB 4HKQA 1NMEB 3AVCA 2B3TB 1VDHA 2UXCF 1NOMA 3PEJA 1R43A 4QZDA 3GG1A 2DIVA 4NXNJ 4BROA 3J7AP 1QLNA 1Y5IB 4DS5A 1FFWB 3N79A 3HKWA 4K4WA 2BJEA 3WK5A 7ICSA 3DLKA 3DYAA 4KTQA 4JUZA 1APSA 1VGYA 2NSBA 3RYLA 1ZQSA 2FHOB 4CEQA 1U2VA 4QJFB 2ZE2B 4DB3A 5AKLA 1Z1BA 3JYTA 2IMWP 2FBVA 1S9EA 2E8OA 4JI4K 4LC9B 3PW5A 3D9BA 3BKFA 3OV7A 3RW7A 4UARA 4FS1A 3NWRA 7ICHA 5TISU 1RT6B 1GEHA 5ETVA 5ALLA 4F7VA 1CC7A 2YHAA 1S77D 2RHSB 4RNOA 1WC1A 2E6MA 2FDNA 3PMLA 5J2QA 1U4BA 3V81A 1VQYA 4PG7A 1S72S 1UT5A 5KFMA 2YHBA 2CQBA 4X65F 3M6XA 2IVOA 3TSUA 4XDCA 4KX3A 2R4FA 1RTIB 1X5PA 4WFBQ 5M1NA 1S9EB 5BJRA 3JYTB 3OL7A 4IQVA 4CI6A 1RTZA 4UAZA 2VOOA 5HRSA 2DO0A 3GFYA 3MM9A 4J8FA 2A1SA 4TY9A 5F9NA 1A0PA 4OYBA 1NG9A 2IGIA 3S6EA 2LQ5A 4JV5F 1B0VA 5D4OA 3SFUA 4QIEA 4QU6A 4NY8A 3DC2A 3JPPA 1JLBA 3BV8A 3IAM9 4CP5A 2W8KA 1IXKA 1S1WA 1Q78A 1WG5A 1HBNB 3FBEA 3WKBA 1VK3A 2V4JB 1VQ4S 3S7RA 2GMJA 4DPWA 4UB3A 2VASA 4X4OA 4CF0A 3SYZA 2WSEC 1C0GA 1NM1A 2O8EA 4RQNA 4K41A 1N62A 4DKWA 1K9MT 1RTJA 2ZIUA 2GCFA 4G9ZA 1NNEA 4CEOA 3NF6A 2UUAK 5KFBA 2HOEA 3IMQJ 4NI2A 3VQBA 4WU3A 3C6AA 2MRLA 1YUWA 2QXFA 1IKWA 3PJXA 2FJDB 2OHFA 2ZH2A 4F4WA 1VK8A 3AODA 3DLBA 2KXHA 2AA4A 3M6ZA 4UZCA 3H1QA 4IBNA 5KFDA 3NGSA 4GXKA 2Q0RA 4OPKA 3FR0A 2J9EA 4Y2MA 4YFKA 3EX7B 1IBKJ 2YNIA 2YKPA 3HPHA 2ZJQQ 3B8HA 5GAHP 1T3VA 2HMIA 4FZLA 5ALEA 4BBYA 1PGZA 3FZ2A 5I42A 4FNHA 2KRBA 3KLIA 1BPEA 2ASJA 1O0PA 2B9XA 4ZPVR 2W40A 1S6PB 2IHMA 2RIJA 2A0FB 2ZOGA 2G09A 3U4LA 1VLYA 2HOQA 4DR5J 3O6QA 3QJPA 3AO3A 1IWAA 3E01B 3M30B 3ZNUA 3SUQA 3NRWA 4FJKA 1FXRA 2GLEA 2P51A 4QIWD 2D9OA 1DQ8A 4LR7A 2W4PA 1JI7A 2EAMA 4NLGA 4OI0A 4PG4A 2VWBA 4F4YA 2W41A 4FW2A 3BY5A 3HD2A 2VFVA 1R59O 2R2UA 1I5OB 3RR8A 3MDAA 3NNAA 2BGGA 2H5EA 2M7SA 4DMNA 4E1NA 4BUGA 2WVBA 3BO3A 3AGRA 5A0LA 4KLDA 3D67A 4FPIA 3DXBA 2GHWA 5AE1A 3OLBA 3O5TB 1RB0A 3KLEA 5E0OA 1ATSA 3ZFVA 3HHLC 1Y3JA 3ZSVA 5C0YA 3DLKB 5KPRA 3SMSA 1N32J 3ICXA 1E4FT 1Q0NA 2LQ9A 4BGAA 2K60A 3ISCA 3LF0A 3S3NA 2F63A 5F0WA 2O67A 2PE8A 5I4MA 3R6MA 3FLCO 4P74A 1YBAA 3UPQA 1WACA 4FJ8A 3NCIA 1QJHA 4DSIA 2LEPA 1Q18A 3PYDA 1Y64A 3EL2A 4XH1A 4J9MA 1FWLA 2HBZB 2LXFA 1H7WA 4H0YB 1BA0A 1UWBB 2FC9A 1NDCA 2UXDJ 4P6QA 2F8MA 2RQ4A 3KJVB 1V5VA 3R1LA 3VMFB 2ZJPL 4JI2J 2ZXHA 1A77A 4OJOA 1O08A 3GB0A 4P2FA 5DG9A 3AGKA 5HP1A 3OR2B 2A6MA 1IBLK 1O5JA 2HNDB 5ETSA 5ETRA 4MMOA 1C1AA 3CJCA 4ZPBA 5B66U 5IXUA 3JPQA 2BE2A 3K5PA 5HL7L 3I5AA 2CNKB 1LW2A 2AWZA 1TQLA 2DXDA 3IC1A 2HFZA 4XIUA 1VBZA 2CJ9A 1KQQA 1FJCA 2OUGA 1QQOA 4BRMA 4I29A 1K0TA 5HR6A 5J2NB 4CRJA 4DOCA 1RT3A 4JLHA 1Y0HA 2EAPA 1S6PA 3NH0A 1JLEB 1FNMA 1YIJN 2RRNA 4GV6A 3H5UA 3A1YG 4BE2A 4M9LA 7FD1A 3LP0B 3L0QA 3ED5A 2OTJS 4F5QA 2DNMA 4X65J 3QIPA 3W9JA 1WUUA 2EEYA 4JI6F 1RAAB 2WBMA 1HMVB 3FJ2A 1KQSR 3VQQA 5J2PB 1ELOA 2UXDF 4O3OA 3RWUA 1TFYA 1S5JA 3MEKA 3DLRA 2BANB 2J0SD 1T0TV 5A76A 1ILYA 3T69A 1VQMN 3S3OA 2H48B 5AQTA 5AQMA 4O8UA 3NGRA 1IQTA 1SH2A 3PFOA 3FRZA 3MTKA 2MZTA 1DY3A 1HD0A 2ESEA 1YI2S 5C2GA 1NOZA 4FF1A 2MZRA 3ID8A 4JK1A 3FKBA 2YPYA 4OJPA 2HBKA 3QT7A 4RX6A 4ES1A 1NSAA 2HKEA 2E29A 3OBIA 4YDUC 2CRLA 3MEEA 2BRKA 4F9OA 2M9NA 8ICNA 4Q8FA 5FD1A 4PKDB 1GT8A 4B02A 2JWLA 1S1VA 3FC4A 2V52B 5IC6B 1XR7A 1VSIA 3FBBA 3CCTA 4JI0K 2PT0A 1WOQA 4DV5K 1OVQA 1WOPA 3UVJB 1BISA 1JJCB 2EANA 5DETA 3GJQB 4Y1DA 3M2RA 2MKHA 2B5JB 3AOBA 4QWBA 3K17A 4PWUA 5AE2A 3DDKA 1YTYA 3HO1A 3QEXA 2DNZA 4C8YA 2QLWA 2E2QA 1XJWB 1ZQPA 1SC1B 3AOAA 3VVTA 4QBUA 1RBLA 3WIUA 5J0XA 3D2FA 3DI6B 4Y2PA 2WRMA 3CNQP 5AFUA 1U47A 3Q7CA 3ONQA 3LDPA 2R8GA 3D6TB 2VG6A 3TUPA 4CJPA 3RBXA 4N8OA 2J0XA 4FWQA 1RE1B 2PMWA 2RRBA 3K0JA 3MOZA 4F3OA 3CGIA 4ECQA 5J2QB 5AQPA 4M3XA 3LO3A 2CPEA 5KFIA 7ICQA 2HZCA 2VQEJ 4NXMK 3QE9Y 4DHYA 1D5AA 4WQ5A 3FFKB 5DDYA 2UYTA 4M7XA 3VALA 4NLNA 3HDSA 4PUOA 4NYNA 2VL1A 1KTQA 1WD6A 3G8TA 3D68A 4Q0BB 2DJWA 1Q81O 5L1JA 1KQSM 4ED1A 3I56S 1D1UA 3T5JA 2ASMA 4H4OB 2MPUA 2R2RA 4JI2K 1PBUA 1PJ7A 3UMGA 1HUZA 2KT2A 3AB2B 5FLXY 2D5RA 1N5VA 1F9FA 2E5SA 5GVQA 1Z05A 1IKXA 4QIFA 2HS3A 2HVIA 1VMBA 4CF5A 5ALHA 4PGQA 3NAIA 2QB1A 4DZDA 2GMLA 4KPYA 4RQ4A 3U3GA 4CE6A 3W2VB 4ICAA 4ID8A 4TKTA 1UEKA 3V6DA 1S0MA 2DL0A 4Z4HA 2XZTB 2YKMB 2Z1JA 4LRAA 1NGHA 4NRTA 3THTA 4K4IA 3ZT1A 4KKOB 5GINA 2IOCA 4ELTA 2HG4A 3K5OA 4Z7YA 1VQSA 4OHZA 4WJ3B 5G5HA 3RSEB 1X5OA 2YHXA 3WBZA 1HIYA 3RU0A 2XS2A 4GKJF 1PJ5A 2AJ2A 2VQEF 1VLBA 2VYPA 1V3ZA 4C3MA 1FEZA 4LMZA 5J2JA 4DCHA 3NS6A 4M5GA 1LW0B 4WF9Q 1XSLA 2XY6A 5D0RA 2YNHA 4RQ5A 4UUWA 5BPCA 3DN9A 2WF9A 2ZHAA 2HI0A 4C97A 2BA9A 3QNWB 4CO0A 1LK7A 4QAGA 3SDEA 1K1QA 1KFDA 1RBRA 2P9UA 4KLUA 4EUVA 3TEGA 2CQPA 4DL6A 3UDEA 2RAQA 2DGZA 5KPTA 2LPEA 4PKHA 1RBOB 3R7BB 3N4QA 4QR0A 1LOUA 3K7RA 1WCLA 4FPBA 2ATCB 3EM1A 1F3VA 5F8JA 5B0CA 4CBWA 1GO3F 2KV2A 2B6AB 3VQ4A 3DDHA 2OPQB 3VF2A 3G6YA 4JD2B 5DQHA 3HVTB 4PPXA 9ATCB 4I27A 1S1UB 2JMGA 4EAHD 7ICEA 4O0JA 3PEHA 4F93B 2HIYA 4LZDA 4DU7A 4K0KK 2BKPA 1AFJA 2BQ3A 2HF3A 2BUNA 4FPRA 8ICWA 2DH9A 5HLFA 4RNFA 5E33A 3MUMP 4AQYJ 1HLUA 3I5BA 3AVHA 2PMZC 1A6LA 3HK2A 1T9XA 5AI9A 3L2QA 4I68A 1XWLA 3BS9A 4O23A 2R2SA 3AB4B 3KLVA 1E6YA 3GWCA 4JKEA 3HSGA 1Q4RA 4GKJJ 1ZD2P 2VJ5A 3O5BA 1SZPA 4DO9A 1VQ5N 3H8WA 2VPWB 2BKEA 2LDYA 5F8MA 2E5JA 5I3UA 2QK9A 2DGVA 3E51A 4ECVA 2DGOA 4K4HA 3ZZZA 3VQ7A 1XNRK 5LJ5Y 2OZMA 1OY8A 1U2RA 4C8ZA 1N5YB 1NGJA 5CWRA 1RCXB 5IS2A 5K9FA 3QICA 1XSPA 2MQNA 2K3IA 1VSEA 2I5JB 1A5WA 1UQVA 4OI1A 1S6QB 4CH0S 5AXNA 2BOPA 5E3CA 1J97A 3HTVA 1S9FA 4BXOA 3W0LA 3U1MA 5AZJB 3OYGA 2OJ3A 4Y34A 5AQHA 2MKYA 1HARA 3D6FB 4PYDA 2CPJA 1D9AA 4DFJA 2AX1A 4DV5F 2VGMA 2QWQA 3KOAA 1KFSA 3DNCA 4E1MA 3M2VB 3EE8A 4ZP6A 4MQ3A 4KLEA 2A2DA 1KC8O 3I0SB 2GGPB 4DV6F 1RFQA 2X78A 1N4LA 3EGWB 3KKFA 5GAEI 2IRXA 1T03A 3MPVA 2E7XA 5KFSA 3I82A 4N8NA 4USAA 2DR8A 1WAJA 3PIOQ 3TVKA 1FXDA 2ASLA 4LT6A 4ANEA 4JWMA 4NM2A 3GG4A 1HHQA 2DCLA 2C2DA 5KQ8A 4BHQA 4KN4A 4CBXA 2QYGA 3SQGA 3S6JA 3OYLA 4OX9J 1MWZA 4HH1A 2F40A 2Z57B 1QAIA 3CDUA 4LR9A 4OJ6A 4CIOA 4FJXA 4L76A 4WQ4A 4DEZA 3F2KA 3VQPA 3MURP 3K9KA 4F0MA 2R7VA 3T1YJ 3KKSA 4M63C 3OL6A 4KR0B 4X2BA 2NLWA 4OLAA 1P9QC 2VKRA 2QFJA 8ICZA 1LAWA 4Z4GA 3GQCA 3NVKA 1CQMA 3MM6B 1ATRA 3O1LA 1UCNA 1N36K 2AZ1A 1FCAA 4Y2IA 3UE2A 4MLEA 5GAHU 1HNZF 4ZN1A 1BL3A 1NJIT 2PFQA 4OZ2A 1M5PC 1RSCA 2MJUA 3MMAA 1UPMB 2C2KB 2ZM6F 2E1MC 3OT9A 1LKYA 2D3O1 1M1HA 2OAUA 4A8XA 1HBUA 2A2CA 3OGUA 4DF8A 4N56A 1T9WA 4F3QA 5A2QY 3NOCA 4NWBA 9ICLA 4B9MA 4I2EA 1FKOB 2D7SA 3BEGB 4AXIA 1HQ2A 3SAHA 2P9IA 1JCFA 5DM7Q 3DAWA 2QRRA 4LVNP 2G0IA 2V0NA 4NMXA 4PQUB 3J81j 1N60A 5GAEP 1KAYA 3SZ2A 4DSJA 2KHCA 1WNEA 1HWLA 5EDWA 3V1QA 2FBXA 4CLLA 1QVGM 3ISBA 2AEMA 4CZMA 5JICA 4I69A 1RQLA 1EO1A 3EUB2 3CCJN 4RNHA 3W1YC 3K57A 2ES6A 3SCXA 2V7YA 3UNYA 4ISFA 4A47A 3VCBA 2R8KA 3DRPA 3R5GA 2OXOA 5AKIA 4H5RA 4FPAA 5L9XA 4U8YA 1SBRA 3PMNA 5AJ3F 3ATUA 4DTXA 5DBCA 2EPIA 3AVNA 2WOMB 5EE0A 2IFXA 3NF8A 4USUA 2BV3A 1MMDA 4BDZA 1IIPA 2LXUA 4DV1F 1Z4UA 5ALQA 1Y00A 3GV7B 3UKRA 4AUKA 4IFVA 4CJTA 5F8LA 1H0HB 2KHQA 5JS2A 4TU9A 2OSQA 4BCAA 1NBEB 1YJNN 3MXIA 3E1YA 1CEZA 3N6MA 2P5GA 2FVSA 4E1JA 1VHXA 5D78A 1VQ4N 3DXMB 4AXJA 2HQFA 1K8AT 3CWJA 3PY8A 3K1RB 2HQDA 2Z8QA 3TP2A 3JTOA 3IM9A 4NE9C 1SH0A 4X66J 3RMDA 4R8UA 2ASPA 4CECA 5FRNA 8ICTA 1YHQN 4HR2A 1ZBHA 1CI4A 4V19X 4JD2A 3TA2A 3V9ZA 5C10A 5BPLA 2P9KB 3ZSZA 4JAXA 5JVGL 4BY9C 3M6GA 1IKVB 2K3KA 3G2XA 2K4HA 3V6JA 4RNMA 5EHHA 2Z1HA 2EQYA 1NRKA 1X9MA 4DUYF 4KITB 4HT5A 2WF6A 3EVWA 1WC6A 3D1OA 1M1KO 4KRFA 1Q86T 3O8WA 4EEYA 2JL9A 2LQBA 4YHHJ 3BF3A 4CEDA 1T3QA 3BYRA 3MABA 3LZIA 4OMFG 3W63A 1U2CA 3CC4S 1T6DA 2VWJA 2WF5A 5E84A 1PAUB 2Z2ZA 1FRLA 5F8NA 5J29A 1KD1T 5I3PA 1AFIA 2HSEB 2R3VA 2KT3A 3BGLA 4LQ3A 3AA2A 3U02A 4LF5J 1D3WA 1C0UA 1KL9A 1MMLA 1XO1A 4RZRA 5F9LA 2WCXA 1GX6A 3P38A 4K4GA 4CO1A 4LFAK 3QU9A 5M1KA 1LWXA 2ALYB 1I6JA 2W04A 5CYQA 1ZBTA 4RQ8A 4KPCA 2KKHA 1D09B 4HUEA 3AA4A 4Y00A 2ZGZA 1VCTA 2GHVC 3HHLB 4M45A 3C15B 1I51B 2ZUBA 2LECA 2VWKA 4EMDA 1B4FA 3QERA 1SV0C 3H42A 3Q8SB 3CCVS 2ZVIA 2HHSA 3R9KA 2E2PA 2PZSA 3FYHA 3VAMA 3P96A 4QPTA 3FZLA 3AY0A 3N9UC 3LUYA 3QGPA 2ZUCA 1FO1A 2AZ3A 4I2QA 2YJFA 2YKQA 3U9ZA 4BC7A 4C1NI 4M7YA 3CXCR 2V8DA 3SEIA 1GLFO 2Q3PA 2AGOA 2OTLN 2BPFA 3C2PA 4BJQA 1H98A 1ASUA 4CJSA 1WJ9A 4E89A 3TQEA 4GKKJ 5LSOA