4B9LA

Structure of the high fidelity dna polymerase i with the oxidative formamidopyrimidine-da dna lesion in the pre-insertion site.
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 213
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9lA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9lA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9lA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9lA01
4IFVA 3QNOA 4AHRA 4E0DA 3Q8LA 3UQ2A 4IRKA 4NM1A 1RDAA 1TK8A 4UBCA 3GV5B 4B08A 3K5LA 5J2QA 1BPDA 3KK2A 5CA7A 4IDKA 3H8JA 5K14A 4Y1CA 1J53A 4W5RA 4ECVA 4QZAA 2HHXA 1SL1A 5KFJA 3RH4A 4OGEA 4N47A 1YVUA 3AO1A 2M9NA 4R8UB 3S9HA 1BCMA 4J2AA 4Q5VA 1YT3A 2XY6A 2BHNA 2UVWA 3H8SA 4ECTA 2G8UA 5J0SA 4M2YA 1WNSA 1QLNA 5KFEA 1I39A 4DU3A 4FJKA 3K59A 3FFIA 2KZ3A 1KVCA 4DU1A 3JPOA 4YXMA 3PUFA 1EXQA 1RZTA 4F93B 2O4IA 1VRUA 2D0CA 4IRDA 4BACA 3ZDEA 5F9NA 3JPPA 4K4IA 3KK3A 1CZBA 3GIKA 3S3OA 3UPQA 1RYRA 3AVLA 4DTPA 9ICWA 1WCNA 3TANA 4DFJA 2BANA 3LP0A 4QZEA 2C22A 1KLMA 4KTQA 1C0UA 1HYSA 3MEEA 3DYAA 1L5UA 3PW4A 3Q8MA 3Q8QB 3RMCA 2HHUA 1S1VA 4RNNA 3MDAA 4E1MA 1J54A 4J2EA 5DDMA 4YFUA 1BI4A 5FROA 3VQPA 1RXVA 5FRNA 8ICQA 4CJ5A 4CGHA 3K2PA 1JXEA 5HHIA 1Z26A 3A2FA 3DMJA 3OHAA 4KLHA 4F91B 5KG5A 5DQGA 5DG7A 4ECSA 4FK0A 1TAQA 4Z4GA 4ECRA 3FDSA 3MFIA 3QO9A 3HP6A 4PWDA 4ZTJA 3P1GA 5KT3A 5J0YA 4CHOA 1UA0A 1JLCA 2RPIA 4Q44A 2HHTA 3OYLA 3AO3A 2UVUA 4DFMA 3EYZA 3HPGA 3UXPA 3MR5A 1VSHA 4M6WA 4KLUA 3HT3A 3AVHA 5DK5A 4CGDA 3CYMA 4EBDA 1N56A 1A77A 3WNHA 1S97A 3ZT3A 4RW7A 3HX0A 4HCCA 5KFDA 3ULDA 2PFOA 2H5XA 1C1BA 4QZCA 4PY5A 1GOBA 4CJEA 4EP5A 3TI0A 4FS2A 4TUQA 3OY9A 3M8SA 4CEBA 2W9AA 2DTUA 3O3HA 1BGXT 3PVXA 3CM5A 2B21A 3PW7A 1RBRA 1QHTA 4MF2A 4O3QA 4KN7A 1S1UA 3THVA 5KG7A 4P4PA 1C1CA 4M9NA 4CF8A 4I2FA 4M0AA 1Z25A 5KT5A 1LV5A 3VQCA 4I2JA 4RW9A 2HMIA 2ISOA 3AVBA 4R63A 3MXIA 2FMQA 5D4BA 2AGQA 9ICOA 4R65A 1W9HA 3EWAA 1SL0A 3MFHA 3LAMA 4DQSA 1LW2A 4DMNA 4ED0A 3ZT2A 4PGQA 2E4LA 1NOZA 3GDXA 2PYLA 3VQBA 4CERA 2A1RA 5CP2A 2P5OA 4H8KA 3ZDDA 4CHNA 3Q8PB 3RJEA 1VSDA 2XRIA 4BXOA 4E7HA 5DB8A 4QWAA 2ZUDA 3AVJA 5J2KA 3RMBA 4BE0A 1VSFA 5KG3A 3OYAA 3ETLA 2WTFA 1TGOA 4ECUA 3AA4A 1ZQIA 4E19A 1J9AA 3MGHA 1NJYA 1ZQQA 8ICHA 3RH5A 4YD1A 4KLLA 4BE1A 3TABA 3UXNA 1MSWD 4PPXA 1QE1A 2B6AA 1RNHA 4C8KA 4HUGA 1VSIA 4E7KA 7ICVA 2R8HA 4TQRA 3MXJA 2OWOA 3QINA 1UA1A 3RRHA 3AV9A 4CE9A 3AVMA 4PHDA 4UB4A 8ICIA 4M47A 4ECZA 4O3RA 3TFRA 2UVVA 1RDDA 5KFVA 3V7KA 1LB2B 7ICTA 4C8MA 1NK4A 1NJXA 1DTQA 4CJLA 4JS4A 3OYJA 3IHQB 5HRPA 5KFPA 2Z1GA 3RH6A 4FO6A 3LWLA 3I0RA 3LP1A 1H38A 4YFKA 2DFEA 3V9ZA 4CEDA 1HJPA 1WSGA 2F96A 4DQQA 1T3NA 1K1QA 1S76D 4CCHA 5CYQA 2PI5A 3ISBA 1D8YA 2DY4A 4BWJA 1WSHA 2I9GA 3QLHA 3BDPA 5J2FA 2KW4A 1I3AA 5L1LA 2D5RA 1N6QA 1ZYQA 2JZBB 5KFXA 2ASLA 3UXOA 4RT3A 4KLTA 2BCQA 4CHPA 1TV6A 4R66A 3T3FA 2PZSA 4FW2A 1IH7A 2P66A 4E7JA 3AVCA 3QZ7A 1RXWA 5J29A 3O4NA 3OYEA 5CB1A 3OJSA 3BJYA 4YR0A 4M3TA 2XHBA 4B9TA 2NRXA 3RB0A 7ICOA 1Q9XA 3HK2A 5SWMA 2KZZA 3AO5A 3I0SA 3SI6A 4DL7A 4FJNA 2F1HA 3SNNA 4FJHA 2ZQBA 4DL3A 4PQUA 4J2DA 3HW8A 4QW9A 1KEJA 1JXLA 3M8QA 3QIOA 4M3WA 5HHHA 4FZYA 2ZTCA 4AILC 3KLHA 1IG9A 1ZQJA 3SPZA 1ZQRA 8ICVA 4CFCA 4YP3A 1KSPA 3GIMA 4YMMA 3T1AA 3KKSA 5KTQA 3ZDAA 2IMWP 1VSMA 1C6VA 2ZTEA 1ZETA 4GC7A 1BQMA 4O44A 2OPSA 2PYJA 4DQRA 1WAFA 3B0YA 9ICQA 4LSLA 3HVRA 2RN2A 4EYHB 4CIFA 3RMDA 4FM1A 1S9FA 2FMSA 3ZDCA 1LWEA 4KLDA 4ZTFA 3RMAA 3JYTA 1S0NA 4NLNA 3AVKA 4W5TA 4E89A 1AROP 3GILA 2DFLA 4KLGA 3V7JA 4DFKA 3KIOA 2FC0A 1BPYA 3G6YA 4J9MA 4FM0A 4LSNA 4B8AB 4KV8A 5L1KA 4ED8A 2J6SA 2YV0X 3C1YA 3RJIA 3CG7A 4QZGA 3HVTA 3JSMA 4KLQA 4FLYA 1JL1A 3LDSA 4M9GA 1T4GA 2G8HA 4FJ5A 3ZT0A 4ED3A 1VK0A 4IQUA 4W5QA 1RT7A 4KHUA 4LD0A 4Z4FA 4J9OA 2FPMA 4MEYA 3OS0A 4CESA 4DTUA 3RWUA 3L8BA 3KHLA 2BCVA 3Q8SB 2VG5A 5CY4A 4I2BA 4HHTA 3EY1A 3K58A 3TR8A 2HHQA 4YD2A 1U49A 1S9GA 2X6NA 4O5BA 4F4XA 3RJKA 3Q8RB 4F4KA 1JX4A 1XS9D 1TVAA 3S3NA 4I27A 5D49A 8ICAA 5KT7A 1SZPA 3EW9A 1HNVA 2I5JA 4KLIA 1ZJNA 4IQVA 3K5OA 2V4RA 2BGGA 3LZJA 1XWLA 3ZCMA 5C42A 3LWMA 4CIGA 5KRTA 8ICYA 9ICKA 5C25A 4DTSA 1WN7A 4O9MA 1XI1A 4R8UA 4HYKA 3GFKB 3F9KA 2GV9A 4MQ3A 3EPIA 4KHWA 5DBCA 5J0RA 3PX6A 4TUSA 2P6RA 2JEIA 1C1AA 2VA2A 4DTRA 3NH2A 4UBBA 1HUZA 1QQCA 3ORYA 4NCGA 1RTHA 3PW2A 2HNDA 2BGWA 1UWBA 2X78A 5KFAA 4FS1A 2C2RA 1ZQGA 4CJQA 5J0OA 4B9MA 2JLEA 5J1EA 4FK2A 2PFNA 5KFCA 1TK0A 3T5LA 1RBTA 2XGPA 4F5PA 1NKCA 3M9NB 3TAGA 3DLBA 4KHYA 2G8IA 3V6HA 5IIKA 3NF8A 2E6MA 5KFOA 3D45A 3IAYA 3OYFA 4RW6A 9ICRA 3CFOA 3SV4A 4ZHRA 3MR2A 1ZJMA 3G6VA 2B5JA 1RTIA 3OYMA 2BPFA 1ZQBA 2Z1IA 4QWCA 4Z4CA 2P51A 3HPOA 8ICKA 4B8CA 1COOA 4MFAA 4I2CA 3OSNA 1XSNA 5DBBA 4ID5A 3QEAZ 1TV9A 4O3SA 4KLMA 4FJGA 3ZD9A 1Y88A 2W9BB 3NHGA 4FLVA 1Z00B 3M9MB 3NGDA 3V6KA 4HUFA 1CUKA 4F2RA 3ZSRA 4J9PA 2Q3SA 2E6LA 2YNHA 3P5JA 4CEAA 4NCAA 1ZQUA 4F50A 3WNGA 5T7BA 5IILA 3AVFA 4DTOA 1JL2A 3AU6A 4KI6A 7ICGA 1DGSA 2F1IA 3C2KA 4FBUA 4M9LA 3O3FA 3AVNA 2JEGA 5KGWA 4W5NA 3OYKA 1VSJA 4QOZB 3RJGA 5CHGA 2LSNA 3HYFA 4E3SA 3NE6A 2NUBA 4FBTA 3SQ2A 1CZ9A 1ASUA 3RB6A 2XY5A 1EX4A 1HYVA 5J2BA 4PGXA 4O0IA 1CXUA 4CJFA 4M3XA 2BKEA 3UQ0A 2ASJA 5FRMA 4GXKA 2EHGA 4TQSA 2MUTA 5EWGA 4PGYA 2HNZA 1L3SA 1QSSA 1S10A 5DGAA 1XSLA 3QEVA 3GV7B 2VWJA 5CZ1A 3ZDBA 5L1IA 4FLWA 5DBAA 4QZFA 2YNIA 9ICHA 9ICLA 4NLKA 5I42A 4NYFA 4DLEA 2X6SA 3ZSQA 1S77D 1RT1A 4EBEA 4RPZA 4DWIA 5HP4A 4RNMA 4F5RA 2G8FA 2AQ0A 2HNYA 1NKEA 1RBVA 1S6QA 1XO1A 2NRVA 5KFZA 2DPJA 2ATQA 4KPYA 2NRWA 4UAZA 2AGOA 5EWEA 1VSEA 3L2UA 1D8LA 4DO9A 3OSPA 4RPXA 4KO0A 3QNNA 4M9JA 2RF2A 4YCXA 5KG4A 5KG1A 1IXRA 5J2DA 4DQPA 1ZQWA 5BOMA 4Z6CA 2R7YA 3V9XA 4NXZA 3AU2A 5HP1A 4M3ZA 1ZBUA 4BGDA 2ATLA 2IA6A 3K5NA 3OGUA 4CJRA 2ITGA 4RNOA 4Z4EA 1X1PA 4FLTA 4AHVA 4Q43A 4KI4A 3DI6A 4OJRA 4E1NA 4I2GA 2VANA 5DB9A 2P6UA 4CFBA 4EEYA 3L2WA 5KFQA 1D9DA 2PXIA 4I29A 3QERA 5DKWA 4GMJB 1ZBIA 3PMLA 4CIEA 4TUPA 1JKHA 1Y97A 3NGIA 5KFTA 1ASVA 3MDCA 3MGIA 2VWKA 5KI6A 1EXNA 2I1QA 4F92B 3C95A 4RQ7A 4LH4A 4BDZA 3V4IA 3TAPA 4M3YA 4CJWA 3LANA 4FJIA 4ED1A 1U45A 2G8KA 2Y1JA 5IIJA 3N97B 1BQNA 1S6PA 3G10A 4FM2A 4OLBA 3MR6A 3AA5X 4Q45A 3OJUA 2R8IA 4B9LA 2OZSA 4YN4A 2FLLA 9ICIA 1LWFA 2OPRA 4QZ9A 5KFUA 4P4MA 4DFPA 3PX0A 4CHQA 1BPEA 1BI4B 4RZRA 2IS3A 4M04A 2O4GA 5HRSA 3EPGA 4J9KA 4E7LA 1U4BA 8ICGA 3QEXA 4C8NA 1S1XA 1ZQLA 3RRGA 3ISCA 4QW8A 9ICGA 4DLGA 2RKIA 3BQ2A 2KFZA 1A5XA 1BHLA 2HW3A 5L1JA 4CGJA 2W8KA 2JZBA 3VA3A 3LK9A 3IRXA 3QIPA 4CEFA 3PV8A 4QWBA 4Z6DA 1ZBLA 7ICEA 4YR2A 4HVJA 3ASMA 4KB1A 5KT2A 4JLHA 2W9CB 4Z6EA 3PW0A 4CF0A 5IINA 3VQDA 4J2BA 4CJKA 1ZQEA 3H7IA 4DTNA 3AO2A 4ZH4A 1JIHA 2BCSA 3ZSWA 9ICVA 3V6JA 3VQ8A 1ZQSA 4DL2A 4E7IA 3SQ4A 2FMPA 1MU2A 4PHAA 3EZ5A 1HPZA 1XHXA 1N5YA 1ZQHA 2Q0ZX 2Y1IA 3V9WA 1KVAA 4F2SA 5IIMA 1S9EA 1ZQPA 5DB7A 4NY8A 2XY7A 4NCBA 3H4DA 2IOCA 2YNGA 2QKKA 1TK5A 3VQ9A 8ICTA 1A76A 4BE2A 5EWFA 4F4YA 3SQ0A 1O1WA 3DRPA 3C5FA 2F1JA 3C94A 5DGBA 4O5KA 1RT4A 2P1JA 1XHZA 3HO1A 1TL1A 3BQ1A 1ZQMA 5KFMA 3T5KA 3AUOA 4PHEA 4KAZA 2D0BA 3DRRA 3M8PA 3HM9A 4J9SA 2IGIA 4DS4A 7ICKA 1IKXA 4DL4A 4FVMA 4M45A 1ZQOA 4AHTA 4XIUA 3C6TA 3LDAA 4I2PA 1V9PA 4QZ8A 4ED7A 9ICJA 4OVLA 1HUOA 3H40A 5KFNA 2VG6A 5C5JA 3GIIA 8ICJA 5KFBA 5I3UA 1NK5A 5J2GA 2HHWA 2B4JA 3ZT1A 4TURA 5J0UA 5J2JA 3KK1A 5KG6A 1RTJA 4L8RB 4B3OA 4EZ9A 1TKXA 1FKOA 2C2EA 1FXXA 2BR0A 4FZXC 3OVNA 4OPKA 4ED2A 3IM1A 1UOCA 1XC9A 5KFSA 5J2EA 3KJVA 3SQ1A 1B22A 1SKRA 1JLBA 2YKNA 2ZJAA 2KQ2A 2XO7A 2BPGA 4C8OA 2MAXA 1F21A 4W5OA 4AHSA 2UVRA 7ICQA 4IFYA 2FBYA 1NOYA 4C8LA 3VQ4A 3RR7A 1K1SA 1R0AA 3NDKA 3AO4A 3B0XA 4EBCA 4JK1A 4KLFA 2R8KA 7ICRA 2ETJA 5L9XA 4KHNA 4HUEA 1CXQA 4QZBA 5KG0A 3RAQA 3DLGA 4WE1A 3OS1A 4RPYA 4FLXA 3MR3A 3QEIA 3NF9A 2PFPA 3KHRA 2BCUA 4CJ3A 4Q8EA 3L2QA 1ZQNA 3O3GA 4ED6A 4GXIA 1A5VA 3P83D 4DTXA 4I9LA 1ITGA 4FXDA 5KT4A 3DOLA 1HNIA 1TL3A 9ICXA 1WSFA 1HQUA 4F5OA 2IHNA 3DRSA 9ICNA 1Z3EB 1LW0A 5DQHA 1IKWA 4LZGA 4P2HA 4QAGA 3U3YA 1HQEA 1YTAA 4H4OA 4QWEA 3LALA 4ECWA 1UT5A 1RT5A 4ID1A 4KLEA 1S0MA 3N4MB 4CHYA 1YTUA 4DL6A 3NGZA 1W0HA 5J2IA 4ICLA 4KITB 5KFYA 4YMOA 1WSEA 4MF8A 1KDHA 1ZQFA 2Z1HA 2W42A 5CJ7A 2EX3A 4KHSA 8ICOA 4QZDA 4DOAA 3V72A 1SKSA 3MECA 7ICUA 4RQ5A 1FKPA 3V9SA 1RYSA 4ECYA 1QSLA 1KRPA 4JV1A 4PUOA 8ICZA 3RAXA 2JEFA 2XCAA 3MXMA 1ZQTA 4NYNA 2W9BA 4DEZA 1Z00A 4J9RA 2WONA 4JRPA 4M9HA 3ZSXA 4OLAA 2HHSA 3RBDA 3FYHA 1MQ3A 3DM2A 4XRHA 4QCLA 2XGQA 3E01A 3TAFA 4F5QA 7ICSA 4RU9A 5KFFA 2W8LA 4CF9A 4DSIA 4O3OA 3KLFA 2A1JB 3NAEA 2YKMA 2DPIA 2OPPA 4CFDA 4ECQA 3I8DA 3HJFA 4QWDA 9ICSA 2JGUA 3L3UA 4OKEA 2GBZA 3NFAA 4ECXA 3WNFA 3C1ZA 3DLHA 4YXJA 1X9SA 4DL5A 1RT3A 4FCYA 4OKJA 2FBTA 1L3VA 1TKTA 1L3UA 4GC6A 2FBVA 3H08A 3ZT4A 1NKBA 3QE9Y 4NLZA 1T03A 4CJUA 1KFTA 1C0MA 3L2VA 4KFBA 1IKYA 3MEGA 4FK4A 4IQWA 1LWCA 3MABA 3ZD8A 4KRFA 2KN7A 8ICMA 1K6YA 4H4MA 8ICSA 1U47A 1JLFA 3U3GA 4PHPA 1CEZA 3S3MA 4K8ZA 3RTVA 4F3OA 1B9DA 4CGIA 1U04A 3QZ8A 3OYBA 2A1SA 3KHGA 4XA5A 5KG2A 3KKRA 3ITHA 3MBYA 4F4ZA 4FZZA 1NK0A 3TQ1A 3ZSZA 5JS2A 3SJJA 5J2NA 3M9OB 1S1TA 5JUMA 4CF2A 4UB1A 4Q0BA 1UT8A 4N56A 1FK9A 4O55A 4RG8A 3RJFA 2HVHA 4CGFA 4CEQA 1ZQZA 4KKOA 4KLJA 4J9QA 2ZUBA 1HMVA 4I9QA 3ISNC 4KTWA 5DDYA 2HHVA 3K4GA 3SUOA 4DS5A 1HYZA 2F8SA 2ZTDA 2BCRA 4GVMA 8ICRA 2XCPA 4YG2A 4AHCA 1NK9A 4KTZA 4O0JA 2HVIA 3K5MA 4UQGA 5KFIA 4CJSA 1WAJA 3SUQA 4F4WA 3PNCA 2R8JA 1TAUA 1GOAA 2VG7A 1RT2A 3C6UA 3C2LA 4UB3A 1N48A 3QETA 5E41A 1VRTA 5HRRA 1BIZA 2J6TA 1SKWA 2OPQA 3TAQA 3HPHA 4CK3A 3OYNA 1BCOA 3LPUA 3PX4A 4MFBA 4R64A 4RW4A 4N76A 2ALZA 1B9FA 4DSFA 4O3PA 1KFSA 5KFKA 3UIQA 4O3NA 4M3UA 3MAQA 5J0TA 2FPKA 4FJLA 4O5CA 4B9NA 4HCBA 7ICPA 3NCIA 2HB5A 2BQ3A 4BWMA 3AVAA 5HBMA 4FYDA 3M8RA 1RT6A 4LZDA 1NOMA 2DFFA 4B9SA 1X9WA 3RB3A 2KTQA 7ICLA 3AA3A 2FPLA 4F3TA 2ZJ8A 4M41A 4J9LA 1BIUA 3V1OA 2Z1JA 1NJWA 1S5JA 4K4GA 5EU7A 3G6XA 1J5OA 1BPXA 4RQ8A 4IR1A 4KLOA 2IDOA 3JPRA 5J0XA 5J2PA 2FLPA 3E2EA 4RQ6A 4I2AA 3ZSVA 3IS9A 5HLFA 1XU4A 1WSIA 2FBXA 5KGXA 2LYHA 4RT2A 5KRSA 3LP2A 3V81A 4GXJA 4DTMA 3KHHA 3ZSYA 3AVGA 4N5SA 4DSJA 1NK7A 3SZ2A 7ICFA 3G0ZA 3VA0A 4EYIB 1BL3A 4DTJA 1HRHA 2BPCA 3NH0A 1TVRA 1D9FA 4P4OA 3OS2A 3T19A 3SPYA 5D3GA 8ICNA 2W9CA 2C28A 7ICHA 1REVA 8ICCA 2MUTB 3KLGA 9ICTA 4CEOA 1T8EA 1MQ2A 3VQ5A 4CJPA 5J0QA 3KLIA 1DOQA 1TKDA 3IG1A 4XUSA 5HROA 3QEPA 3V1QA 5IIOA 3CFRA 1KFDA 4HTUA 4EZ6A 4R5PA 4OPJA 3PW5A 4ELUA 2YNFA 4CEZA 4IG0A 3B6PA 4UAYA 4I2HA 4I28A 3SI8A 3RR8A 4JWMA 3BQ0A 1RCHA 2X74A 1ZQYA 1RDBA 4UB5A 4M3RA 1X9MA 4N41A 4RQ2A 3TWHA 8ICBA 3DOKA 3PO4A 3DLRA 2ZUCA 5EOZA 1RBSA 2IAJA 2OA8A 5HMMA 4DU4A 4GW6A 4G1QA 4FLUA 4KN4A 3T5JA 1KLNA 2J6UA 3OYGA 4RQ1A 5J0WA 4JV2A 5HNKA 2GWSA 2BDPA 5DMRA 4G3IA 3VQAA 1JN3A 1WCLA 9ICPA 1B43A 1A5WA 2OZMA 4PH5A 8ICLA 4CEEA 4FJ8A 7ICMA 4DQIA 4J9NA 2ZD1A 4M6WB 1JXBA 4K8XA 1S1WA 4X5VA 4F8RA 2QXFA 2AGPA 5KFLA 2QK9A 4IBNA 4FJJA 2C2DA 1ZQVA 3QESA 4IKFA 5HRNA 3JPNA 4OGCA 5DLFA 4NM2A 1ZQDA 1MC8A 1SL2A 2V4QA 4JV0A 1QTMA 7ICNA 5J2HA 4IG3A 9ICFA 4CHZA 4DSEA 3B6OA 2G8VA 4CECA 2NRZA 3C21A 8ICXA 3PR4A 1QSYA 1CLQA 2XY8A 1B92A 1VSLA 1BISA 2AQ4A 5J2CA 5CZ2A 4KLSA 5KFGA 3TFSA 2KFNA 5TZVA 1ASWA 5KT6A 4DF4A 1HJRA 1WSJA 3V1RA 2FLNA 8ICWA 1NJZA 2BQUA 4OKKA 4K4HA 3MEDA 4TSXA 3KLEA 3Q8KA 3H8WA 4CK1A 3AVIA 1WLJA 4BDPA 3OHBA 1S0OA 1IM4A 7ICIA 4YQWA 4YVZA 1ZQCA 7ICJA 3RJHA 5KFRA 2QKBA 1U9LA 1ZQXA 1ZQKA 5DQIA 3VQQA 2ISPA 1BPZA 3V7LA 4IR9A 1ZBFA 4AH9A 3K75D 4BXOB 3O4QA 1IKVA 3KD1E 3CQ8A 3NF7A 5DG8A 2PY5A 4KREA 2IBKA 3WNEA 3RB4A 3SUNA 2XC9A 5JS1A 4YMNA 3BQTA 9ICUA 2D0AA 3HWTA 1NK6A 3LZIA 4LH5A 3DLKA 3DLEA 4UB2A 4FJMA 4Z0UA 4Y1DA 2AU0A 3TAMA 4MFCA 2ZE2A 1C7YA 3AA2A 1VSKA 1Q8IA 1JLAA 2R8GA 4YR3A 4Z6FA 3VN5A 2W9MA 8ICPA 3QEBZ 3TARA 1ZBHA 1G15A 3PY8A 2JEJA 5CYMA 3JPTA 3NTUA 1ZQAA 4I2EA 4F5NA 1UAXA 1RTDA 4RUCA 4FJ9A 4RUAA 5SZTA 3SV3A 3GV8B 2GUIA 4Z4HA 5HMLA 2F8TA 1Q9YA 4KMUA 3OYCA 1KVBA 3OYIA 3V6DA 5FDLA 1IO2A 4CFAA 4QZIA 2VA8A 5KFHA 4FLZA 3PO5A 1QS4A 2DFHA 4DOBA 9ICAA 1KTQA 1RBUA 4XQ8A 3CFPA 4B9UA 2YHBA 4IRCA 3ALYA 4JRQA 8ICEA 2BE2A 2OYQA 3CM6A 2ASDA 1SUQA 2PI4A 4ELTA 1NK8A 3NBPA 5IIIA 2RDJA 2A1JA 4GLXA 2P5GA 1LAVA 1EP4A 4LY7A 4KHQA 1C0TA 4EP4A 3KD5E 4CJTA 4Q8FA 4MEXA 2IHMA 3SYZA 1T7PA 3HSTB 3NH1A 3PR5B 3V9UA 4DG1A 4FW1A 3JPQA 1T05A 2PFQA 1D5AA 3C23A 5DB6A 1BPBA 3L2RA 9ICCA 9ICBA 3ZSOA 1XSPA 1EKEA 2G8WA 4YNQA 4B9VA 1TFRA 3VQ7A 4QZHA 3OYDA 4ELVA 3GQCA 3GIJA 4Z4IA 3PMNA 1GOCA 1BVSA 4MFFA 2BQRA 3D0PA 4M42A 5C24A 4LVSA 1JLEA 4CF1A 1L3TA 3QEWA 3NF6A 1TKZA 5D46A 5DG9A 5J0PA 3U6FA 4I2IA 5BOLA 3T5HA 4RW8A 4CGGA 4UAWA 3HL8A 1X2IA 3LPTA 1DTTA 1RILA 3TAEA 3SUPA 1S0VA 5KFWA 1JLGA 3BGRA 4DSLA 3H4BA 4JWNA 9ICMA 1PZNA 2IC3A 3HP9A 4FJ7A 1RDCA 4I7FA 4DSKA 3RJJA 4JUZA 3OYHA 3RBEA 4I2QA 3C2MA 1RPLA 1JMSA 2V9WA 5BPCA 4IQTA 3K57A 1SV5A 9ICEA 1KCFA 2WOMA 4RQ3A 1U48A 4O5EA 8ICUA 4RQ4A 4FJXA 4DOCA 4JS5A 4PA1A 2NRTA 2YHAA 2ZJ5A 5J2AA 2AJQA 3C5GA 8ICFA 4CJVA 3VQEA 4I2DA 4NLGA 5J2MA 5F9LA 2RDIA 5CWRA 3NGYA 3HXMA 2VA3A 4CK2A 3SCXA 3VQ6A 4RQ0A 1EETA 3KTQA 4O4GA 3JPSA 4KB0A 3LP3A 3L3VA 4CJ4A 1DLOA 3ISDA 2KZMA 3LAKA 4DF8A 4BDYA 3F73A 1LAWA 5DLGA 4AHUA 5CR0A 1JLQA
chains in the Genus database with same CATH superfamily
1VQYA 5IQ6A 3FEXB 4AHRA 4R25A 2XS7A 1PILA 4CZKA 1S9GB 3Q8LA 5DDQC 4IRKA 2G2ZA 2YKPA 5T14A 3EVWA 4LBHA 4X66K 2HMPA 3CF5Q 1FD8A 4USAA 1TK8A 5IT9O 2UXCK 3K5LA 4GKJK 1BPDA 4K25A 2DY9A 3UM9A 2I5JB 3KXDA 5CA7A 3UE5A 4U8VA 2D74B 1SL1A 5KFJA 4OGEA 4N47A 1YVUA 1F44A 3AO1A 2W6LA 1OXJA 2HURA 1HR0K 2H3IA 1RHMB 2LPEA 2EDUA 1YT3A 2XY6A 3BZCA 3F5AA 1QUPA 1N5VA 1N5WA 3H8SA 4ECTA 3FKBA 5J0SA 4RCHA 1RTHB 1YRUA 4ZCKA 3CGIA 5A0LA 3DKDA 4LBPA 3V5RA 3K59A 3AA8A 3JSRA 4DU1A 3JPOA 2Z2YB 2GFFA 5J1EB 1RKIA 2HQDA 1RZTA 4F93B 1KKHA 2O4IA 2GJIA 2JSXA 2V8HA 3CCES 4DV1J 1N0VC 4QIVA 3GFHA 5HMZA 3JPPA 1CZBA 3KJNB 4NXNJ 3GIKA 1HNZJ 1HX1A 4WTYA 3S3OA 4GRSA 4JI4F 4LF2A 3UPQA 5DDPC 4DTPA 2B5JB 1RTIB 3R5CA 4EI2A 2PD1A 3G82B 4FNIA 2DGQA 1B0XA 3CPWM 3CJ8A 4X62F 1JLFB 3ZZZA 1JRPA 1UPPA 4ID5B 1ZRMA 3SCJE 4ZP7A 4K59A 4CO3A 2RRDA 3O2IA 1X4FA 2E1YA 2JWNA 3MAHA 1D09B 2WW8A 1WWHA 2V2VA 4CRXA 5E3AA 5TISU 1BI4A 3NGRA 3VQPA 1KHVA 2IDEA 1F5BA 3H8YA 3M3ZA 2OCEA 4CGHA 4DR3F 2JMGA 3OHAA 4KLHA 3QICA 4F91B 3K9JA 1AQ6A 3H0RB 1B4SA 1CRXA 4Z4GA 1TAQA 4ECRA 3AOCA 3MFIA 1WOPA 1U1OA 3IRUA 2FZCB 4CHOA 1NGFA 2OMLA 2D41A 4BC5A 5GADP 2RPIA 4Q44A 3OYLA 3P4IA 4DFMA 1N33J 3SCLE 3S6JA 3UXPA 4LF6F 4GVBA 1NCLA 1VSHA 4M6WA 4KLUA 1H7XA 3UW1A 2HHHK 2VCPA 3CYMA 3ENBA 4EBDA 2APOA 3M6XA 3MMAA 2CXYA 2YTUA 2BZFA 1A77A 3MX2A 2R2TA 3ULDA 1TMMA 3FZ2A 1C1BA 4JI3J 4MO5A 4L6V3 1GOBA 2X3GA 1ESVA 4FS2A 1SXLA 4DUZK 3MMCB 3D2EA 2OIHA 4CEBA 2W9AA 5FPMA 4IOCQ 1VS3A 3PW7A 1RBRA 3HHEA 1QHTA 3NASA 3UVJA 2C3OA 4PJ0U 1PYOB 1Q53A 1N2XA 1T11A 1WG4A 2K4EA 5KG7A 3FGUA 5LM7E 1GEHA 1YJ9S 2H3QA 1KONA 3G6ES 1LV5A 3VQCA 2B9YA 3PDNA 3VQTA 1PC5A 1U1LA 2YQ3A 2ISOA 4ZDNA 4KHPF 1ZPWX 3MXIA 3D0GE 1J97A 3EWAA 4HTIA 3N01A 1K0VA 1LW2A 3DWLA 2JXJA 3N4PA 4ED0A 3ZT2A 1VRQC 2EK1A 4C11A 2PYLA 3VQBA 2WF5A 4CERA 2BV3A 4QBUA 2AYBA 3DI6B 2HRUA 2P5OA 2N7YA 1CG2A 2XRIA 1HKAA 2A2DA 4BXOA 4E7HA 3TVZA 2J9EA 4WIQA 2ZUDA 2RB7A 5GADI 3UDLA 3RMBA 4BE0A 2XLIA 1SAZA 1D4XA 1GX5A 3AA4A 2E7XA 2UV8G 1NJYA 1VQ5N 2C2NA 4Z7YA 8ICHA 1X4DA 3E66A 4YB6A 4OX9K 2IPOB 3DXSX 1OH8A 3HFVA 3UCGA 2CZ4A 3BF3A 4BRLA 4C8KA 4DR4K 5KOWA 1NXIA 4H0XB 1MMDA 1RXOB 4TQRA 3G4SS 3JB9k 4C3MA 3EN9A 1UA1A 3RRHA 3CC7S 3QSIA 2QG9B 4M47A 3FZBA 4O3RA 4DPUA 2UVVA 2DNRA 3I55S 1SIJA 4X65K 7ICTA 1BQNB 3J7ZO 4C8MA 1NK4A 1UFWA 4FZLA 2BJ3A 5CHCB 1F1BB 4FWLA 4CO1A 4DL0C 3OYJA 5HRPA 2OPRB 3ZYYX 1QQNA 4DV3F 1GXUA 2DTJA 1YZ7A 3LP1A 4WF9L 3CB4A 3D6HB 4YFKA 1N36K 4F72A 3CCRN 1HJPA 2F96A 4DQQA 2BW2A 3TJ8A 4ZPVR 4WJ3B 5C2DA 3SQGA 3ISBA 3WK4A 1QVGM 4U96A 1KTVA 1X66A 3LPEA 2KW4A 1I3AA 3HRDD 4P75A 4OX7A 1C2PA 3L3FX 1P27B 4JKAA 2GMLA 1BA0A 3QFUA 4EELA 3CCWA 1ZM3A 3PYDA 3H2VE 1NMNA 2NCKL 2ZD1B 4QR1A 3T3FA 3OTOJ 4X4VA 1QUVA 4IWVA 5LXRA 5D77A 4ZLPA 3WKAA 1N5SA 3AVCA 4ISEA 4WZMA 4V19J 1RXWA 5J29A 2EFNA 3H5SA 4BR5A 1VC6A 4YR0A 1NM2A 4M3TA 3WX4A 5B0EA 3K9KA 4MO4A 3NEKA 2WHEA 2F76X 1MU2B 2JHEA 5F1XA 4BRDA 1OPIA 4KQZA 3IG8A 4QIWC 3US5A 1SI9A 4WQ5A 4MK8A 1ZM9A 2ZTCA 1U25A 2Z58B 2ZC4A 3AD8C 4J9UE 3SMSA 2W7OA 5C2FA 3TUIC 2DGWA 1P9QC 5KTQA 4CT9A 2YHXA 2LQ9A 3OXFA 2BA9A 3DRPB 1VSMA 1C6VA 2ZTEA 1ACMB 1BQMA 5JU5A 4F04B 2OPSA 1BOTO 1RT4B 4AQYF 2CQIA 2MQNA 3B0YA 4DR7J 3HX9A 1J5EJ 5U47A 4JYAK 3RMDA 1YK9A 4USUA 1KN5A 5F3TA 1IKXB 4KLDA 1CJUA 4ZTFA 3DDIA 3UCUP 3P96A 5EX3A 1AROP 3GILA 4CM0A 3WIVA 3V7JA 1SS6A 2N3LA 3G6EN 4O23A 1BPYA 4OI6A 3RBXA 2GQCA 3R7SB 4JI8J 5LSOA 2R7UA 2HBYB 2VG6B 4NEYA 3NGTA 3N4QA 4G9BA 5I3UB 2WVDA 2X1FA 1QJHA 1S12A 3CG7A 4QZGA 3JSMA 4FLYA 1T4GA 2DEJA 2HIYA 3W2WA 3IRWP 4FJ5A 2LBOA 3OR2A 4B3OB 2CAJA 3ZT0A 3KWGA 2HBZB 2WSCC 3SBGA 1TKXB 5B08A 3WXLA 4LD0A 2FPMA 1WG1A 2HWHA 1G99A 1IXKA 3Q8SB 3NNAA 3KJVB 5KL1B 1Y00A 2QLBB 1T9YA 3QSYB 4C4SA 3EY1A 2AJ2A 1S9GA 2MGZB 1NHKL 5ALXA 2ZH3A 4W90B 1J2VA 1L7OA 4UW2A 2AEJA 2LU2A 3UN3A 5RUBA 1R0AB 1CI4A 3EW9A 1F9FA 2I5JA 1DKGD 5LSRA 2V4RA 2ZHOA 5FDLB 1E4GT 4JKDA 3CC7N 3LZJA 4WE1B 1M90O 3ZCMA 4OI1A 3KK7A 5KRTA 3I55N 8ICYA 2V7ZA 3BPSP 1HWKA 4O9MA 1WN7A 1XI1A 4F0HA 2KK0A 5LMNF 4HYKA 1YSJA 1VI7A 3LM2A 2OANA 2CQDA 2EWSA 4MQ3A 1JJ2R 2NXNA 3DGVA 4LFAF 4TUSA 1SUQB 2D8CA 5EE9A 3ORYA 2DHAA 2F5GA 1RTHA 1TL3B 2O8CB 2VJ5A 4OZ3A 2QWQA 1UWBA 4FS1A 3AD7C 4WP8A 2Y9HA 4B9MA 2YKQA 4FWQA 4DG1B 2PFUA 5J1EA 2PFFB 1MA9B 5KFCA 5HMYA 3O8MA 1TK0A 4H4OB 3M8ZA 4F5PA 2MZ1A 2QFJA 2E5IA 3M9NB 2VBYA 3HJVA 3DLBA 2BRKA 3V6HA 4RX6A 5IIKA 2O1PA 5KFOA 5B09A 1PK1B 2UXBK 2FI1A 4Y34A 3RVCA 1SVDA 3SV4A 3OYMA 3G6VA 2B5JA 1RTIA 3HZGA 1ZQBA 4JHDB 3WEEB 4Z4CA 3HPOA 8ICKA 1FESA 2QKQA 1FKPB 1COOA 2KVSA 1F6TA 4G1IA 3JTOA 5DBBA 4ID5A 4OD0A 1TV9A 2VFTA 4KLMA 2F8HA 4FJGA 4CNQA 1NGAA 2DXFA 1R59O 5AQYA 1JJ2M 1YF5L 1KBRA 1HPMA 2Q3SA 3G25A 4P52A 2CA9A 3BS5B 3UFCX 4A8OA 3PIOQ 2Q4TA 3NUQA 5M2PA 5IILA 1OVYA 4PRFA 2YY3A 1YZ6A 1JL2A 3FBFA 1RAIB 4OYXA 1IG6A 2UU9K 4WQ5C 3I6PA 3O3FA 2JEGA 1J27A 3A8YA 1VLOA 1AZSB 3MDQA 3KG0A 4FFDA 3MWTA 1FA0A 1P1LA 2AEFA 1UCVA 1FNMA 1HFEL 2NUBA 4FBTA 1MW7A 3CMQA 1WEXA 2EW9A 1ZD5A 2ZJRL 4M3XA 2ASJA 4DV2K 4OI4A 5D4OA 4Y2SA 2DKZA 1TKTB 3DAWA 4TQSA 3MAAA 1WKJA 1X40A 3OFHA 2YCHA 1T03B 2HNZA 4BR7A 1WD6A 4RKUC 1L3SA 4DV5F 2ES6A 1IBKF 4P0PB 3UCZP 5AI9A 4NLOA 1XSLA 5HAOA 3QEVA 3ZDBA 1EZZB 4FLWA 5AKGA 2FHJD 1JLQB 2RHSB 4LMZA 1WHWA 5EX0A 3EE3A 2LMIA 1S77D 4EBEA 3ITHB 3QGIA 4RPZA 2ZIXB 4F5RA 2AQ0A 2HNYA 1NKEA 1VIOA 2CJAA 2NRVA 4PYAA 2DPJA 4KPYA 5ALHA 4P2FA 2NRWA 4UAZA 3OW2R 1S1TB 3E9PA 1FFWB 4EX7A 1UVKA 2ASMA 3M2UB 4M9JA 4LF7K 2KJ5A 3R2CJ 5AK6A 1N32J 1HD0A 5J2DA 4YB5A 2CG8A 4JV5F 5BOMA 1HMVB 2R7YA 3D2FB 3AU2A 4WPAA 3CD7A 1Q18A 3OGUA 4B3RK 4ZPCA 4XK8C 3CD6N 4G6VB 4CDGA 2KT3A 2GQQA 1S5LU 3KBBA 4KI4A 3DI6A 2UZAA 2UYTA 4CH7A 1PK3A 4QS9A 4ANCA 3IV6A 4MHVA 1O0PA 2DNLA 2VANA 2CPIA 3WKEA 4DR1F 3EVOA 3EM1A 3PJXA 2X3DA 3L2WA 1RWUA 1VRTB 1L8LA 4DXLA 4JI6J 4L73A 5A2QY 3T6BA 4YY3J 2LQBA 5ALVA 1X0PA 3C8YA 4MFBB 2ILZA 3MMBB 3NGIA 5KFTA 3G8TA 3TNVA 2GUPA 2VWKA 3ICLA 2I1QA 2VUGA 5K8PA 3OW2M 4O8UA 5BR8J 1NSQA 2BJDA 4CWBA 2ZIWA 4CNYA 2P9NA 1N63A 3G71N 1AYEA 3E0FA 4CJWA 2Y1JA 5IIJA 3MEEB 3DYAB 5HQLA 1BQNA 2WCXA 5AQNA 4EENA 1QQ7A 4OLBA 3MR6A 2DHHA 1F3VA 3R6MA 3K0SA 4B9LA 3W3SA 3P5TL 4YN4A 4N7TA 1S1VB 1LWFA 2OPRA 4P4MA 2DITA 2FJBB 2OH2A 2F8MA 1FRXA 3W1YC 3NNHA 2O4GA 5HOOA 4J9KA 2BZ2A 1WSRA 3WUHA 2HG4A 3WK6A 4PWDB 4DLGA 3A0IX 2HPUA 3H3OB 5LMUF 2FVRA 3IRXA 1KC8O 4CEFA 3PV8A 4FPAA 3KZXA 4LVNP 5KT2A 5HSPA 2UUBK 2WBRA 3R5GA 3JSYA 3DOMB 3VQDA 4CVNE 4M8LA 4J2BA 1VJ5A 3OA9A 1ZOLA 4RWWA 2I8EA 3KLIB 3F53A 3H7IA 1HJOA 5HR7A 4K42A 3AO2A 4ZH4A 3ID8A 4KT0C 3HSDA 2HFSA 2OD4A 2QWNA 1MU2A 4FWSA 2MQMA 5LJ3Y 3J80Y 2ZGYA 1RAAB 3IBWA 2XULA 1KQKA 3FEZA 5IIMA 2GW8A 1ZQPA 4NCBA 1K73O 3H4DA 2IOCA 3VF6A 2VONA 5BPLA 2J8SA 1A76A 4BE2A 2B6GA 4HDHA 3MPDA 3RU0A 3DRPA 1FTCA 2BOPA 1R8BA 4KHMA 5CYJA 1RT4A 2P1JA 1XHZA 5G4DA 4U7BA 3HO1A 5ITHA 4F7VA 1Y0HA 5G0RB 5KFMA 3T5KA 5AQFA 4JI0K 4LBIA 5K20B 1BG3A 2GIFA 4ALZA 3T7ZA 1IKXA 7ICKA 5B0GA 1ZQOA 3KJFB 4KHRA 4MYUA 3MOZA 4CZFA 1VQ9N 1PIEA 1I3OB 4ED7A 9ICJA 3UKRB 4K0KF 2VG6A 3U26A 8ICJA 5I3UA 1APSA 5C0YA 4DR6K 1B99A 2L08A 4NEZA 5GADU 3IMQJ 1HHSA 1BHNA 5TKWA 5J0UA 4HH1A 2UXDJ 4B3OA 1VQON 3C29A 3JAMY 1TKXA 4YB7A 4CZJA 2OTJS 5A6WA 3VF4A 3RFAA 1KW4A 4IG3B 2C2EA 4FZXC 2E8PA 3RZAA 3H0LB 4EEKA 1T6CA 3IM1A 2LYBA 1OJ4A 4AT1B 1XC9A 5J2EA 3KJVA 1OUQA 3ZZRA 3T1HJ 4J37A 3HZ6A 1KQSM 2MAXA 1XNRK 2MGZA 3P31A 4JK7A 3D2SA 1ZBSA 5MAOA 2XHWA 5HVHA 3MEDB 5K5MA 2M7SA 3D1QA 3G86A 1R0AA 3NDKA 3B0XA 3I0RB 7ICRA 2DNNA 4KHNA 4B02A 2A40A 3M6UA 2EZYA 3RAQA 4WE1A 2ZBQA 1JCFA 4ED4A 2QYCA 3TJAA 5H1SV 3NF9A 5CYQB 4O3MA 1S59A 2BCUA 2XG8A 5AKXA 1XK8A 2C3MA 5KQ8A 4Q8EA 3IN5A 4N8NA 4JKHA 3P83D 4DTXA 2P9IB 3ADAC 1TL3A 1PBAA 1BNPA 1HQUA 4F5OA 2IHNA 2W4CA 3QQCD 3ZTPA 2IHR1 3M6GA 1TV6B 1SIZA 1Z3EB 4FNHA 3P39A 4JP8A 1Z2ZA 2IY5B 4OPHA 4YOVA 4QAGA 4NPOA 3CJBA 4DV1F 3QGGA 4H4OA 2IYGA 2KM8B 3LALA 3TAMB 1NMEB 4Y2IA 5AFUA 4GO5X 4NXNF 3QMQA 4ID1A 2DNMA 1NNDA 2UUAJ 4CHYA 1YTUA 4DL6A 4D3HA 3CJTA 2Z1HA 4B3TF 1B3TA 1H73A 4WFAL 4JHDA 3WEEA 3BBCA 1FKPA 3I4PA 1VBXA 3O0FA 4ECYA 1FRLA 4PUOA 2JEFA 1ZQTA 4S0MA 4NYNA 4DEZA 1HNXF 3V6DB 2JZ5A 4OLAA 2HHSA 2EI5A 3RBDA 2E8OA 2E29A 3DM2A 2XGQA 4H0OA 1WSVA 3BS5A 2B8QA 3I9ZA 2HVZA 4YDXA 3FUYA 2DH9A 1N52B 3M1FA 4CD3A 2W8LA 4CF9A 2CYYA 3ZTRA 3NBPB 1WYGA 2A1JB 3CQXA 2DPIA 2J0XA 3KWMA 5CXTA 1X0FA 4ECQA 4UB8U 4A61A 3QT5A 2D9OA 3HJFA 4NZ6A 4QWDA 3DU6A 1M1GA 4DPTA 2JGUA 4OJ3A 2RQ5A 1F3FA 3L3UA 1AXQA 5E7OB 2HFZA 1NRKA 1Z05A 1TKTA 4GC6A 4LUBA 3NS5A 4F26A 5B0FA 2ZF5O 3ZT4A 2RILA 2RS2A 3TJ9A 3ZO7A 1T03A 6FD1A 3ET6B 3M8YA 3SXLA 1U1NA 5IS2A 3MM6B 4P0PA 1YJTA 1YRTA 3I56S 4IQWA 4KRFA 3MABA 3ZD8A 4NYZA 2KN7A 3N4WA 8ICMA 1K6YA 1U47A 3THYB 4TU9A 3WXKA 2AHOB 3JQKA 3KOOA 3RTVA 4FE3A 4IFEA 2M3DA 4BCAA 4PKHA 4K4UA 2W2PP 3CJ5A 1U04A 2JGAA 3OYBA 3CCTA 3VGTA 2IVYA 3CXCR 3KHGA 3NCRA 4GY2B 1K8AO 1GLBG 5IWAK 3ITHA 3SK3A 4JAXA 2ZIXA 3MBYA 4F4ZA 1YJRA 4FZZA 4QS8A 2ZH5A 3TEGA 4I7FB 2ZH9A 3SJJA 3M9OB 1S1TA 2E66A 4UB1A 1NH8A 1ED1A 1UT8A 5D0EA 4N56A 1DURA 3M2UA 1HNVB 1N34J 3F2KA 2QA1A 3FMWA 1ZQZA 2W55A 3AQFA 4J9QA 1VQLS 1HMVA 2G1DA 3ISNC 2QB1A 4KTWA 5IZHA 3D2FA 2BJ8A 4C7QA 3K4GA 1BY9A 1N5TA 7FDRA 4LSZB 5HVFA 4XO0A 2QARB 2XCPA 3IAM9 2FTRA 3ZX2A 5J2MB 4NL5A 1WAJA 2F4VF 1L7MA 2VG7A 3J81j 1PYSB 3E8OA 2E9ZA 3A8KA 2AYMA 3W9IA 3B82A 5CE3A 1PJ6A 1VRTA 3TTCA 1DLOB 2M8DB 1Q4RA 2OPQA 4H4KC 2QE5A 1SJ3P 4US8A 4MFBA 2ZITA 5KFKA 4M3UA 2DGVA 5J0TA 1TUWA 2FPKA 4O5CA 3NCIA 2N4CA 2G0AA 1HBUB 3V2UC 1ATSA 1AT1B 2O8DB 3M8RA 4DBQA 1NOMA 2DFFA 2GELA 3R8EA 3RB3A 2KTQA 1Z1BA 7ICLA 4DR2F 4FZNA 3FCVA 4M41A 4J9LA 3IFEA 1IN0A 1S5JA 3C14A 3MI7X 3W63A 1BPXA 3O80A 4IR1A 4KLOA 4ICAA 5M1FA 4X66J 4ZK7M 2LU1A 5AKJA 2XS2A 3CPEA 4RQ6A 5IV4A 2UXCJ 4GKJJ 3NMUA 1XU4A 5ALDA 3ZZOA 4R0EA 4DR5K 2DIUA 3KNGA 2E44A 4A8QA 3BGLA 3SZ2A 7ICFA 3CJ2A 4OJLA 1HR0J 2D0PA 9RUBA 2PN6A 2Z2MA 4BC9A 3SSQA 3OLBA 5BRHA 1D9FA 2CFXA 3NL0A 3NVWA 3FZKA 8ICNA 2YXLA 2C28A 1REVA 8ICCA 1DEJA 2MUTB 4KBOA 5GTIU 4CEOA 3BGOP 3KK3B 3KLIA 1GFWB 4XUSA 5HROA 1FJCA 3QGPA 3B8AX 3CFRA 3FJ2A 2BANB 1GMWA 2RQMA 3MF5A 1NLKL 2FJVA 4TLQA 4I2HA 4I28A 3J8AA 5IV3A 3SAHA 1RBAA 3OHRA 2G07A 5H9FK 1RCHA 5KAKA 1ZQYA 1CJKB 4QYZK 1RT1B 1C4AA 1X9MA 3TWHA 3DOKA 1V9OA 1VDVA 2EKNA 1E4FT 3I56N 2OA8A 1FXDA 3DMJB 5J1PA 3GZ7A 4LIRA 1ROFA 1YDLA 2KXHA 3UR0A 2CGKA 1RWWB 3I1YA 3GG1A 1SH3A 4DI6A 2ZM6F 3VCBA 2J6UA 2F8LA 3AHPA 5J0WA 1HW8A 2HFOA 4JV2A 4ES1A 2GWSA 3ZETB 3OTBA 4I69A 1BWEA 3MUMP 2FDNA 4JI2F 1B43A 4PH5A 2NSBA 4BC7A 1XMOF 4DQIA 4J9NA 1IM6A 3BSNA 2Q6CA 4JI5F 2MJNA 3U4LA 1Z6RA 4FJJA 2KRRA 4NZ7A 1VQLN 1S48A 1H74A 4NM2A 2G0CA 3POTB 2FVCA 4IZ9A 3D0IE 2CNNB 4GV6A 2MQLA 4YUDA 1SL2A 5GMEA 4LFCF 3UDVA 2W3SA 3NAIA 3S41A 2LXFA 3KJQB 4IG3A 3UNGC 9ICFA 2XTJP 3KG1A 4DSEA 2HHHJ 4CHZA 2FB0A 2K7JA 4BX9C 2KO1A 1YGYA 2J4RA 4M1KA 2CQHA 1F5AA 2J8AA 1NWKA 1NDPA 3PR4A 2DWQA 2CJYB 1VSLA 3K1RB 5J2CA 2L9NA 2DH7A 3M30B 4Y0WA 3M6KA 5A2QO 5CZ2A 4DUZJ 3CDEA 2K1RB 3U9DA 4E98A 3TFSA 2KFNA 5KT6A 4DF4A 4RW9B 1IBMF 8ICWA 4Q2MA 3MEDA 3Q8KA 3EGWB 4TY9A 2XICA 4HH0A 3O5TB 5AM1A 1NG9A 2Z4PA 2B8PA 4YQWA 2E2OA 3I28A 1R8HA 1ZQCA 4AYBD 3OPKA 5CD4A 4KX3A 5KFRA 1XO0A 1HBMB 2QKBA 1BWVA 4IH6A 4ZPAA 2OFHX 1A6SA 1FFVA 3MM9B 5DQIA 4OZNA 2GCFA 2AP1A 3V7LA 5GVQA 2RKIB 4NA1A 2RU3A 1QQOA 1GMVA 2ZDPA 1TL4A 3RRKA 2ZKTA 1IJJA 2P9IA 4FYWB 4DUYF 3CCUS 1EX8A 4IUFA 2IBKA 1HLWA 1U1QA 3RB4A 2KRBA 4YMNA 2J0SD 2VGNA 3HI0A 4UB2A 1K47A 2P9LA 2W4DA 3U8XA 3AA9A 2MLZA 1Q7YO 3TAMA 1Q8IA 4YR3A 1HNWK 3VN5A 4PG7A 4N77A 3CDUA 3PY8A 4OX9J 3PRBA 1HPZB 1N5YB 3JPTA 1T44A 2P9SB 4GVLA 1RAOA 1RAGB 2GVZA 4DR4J 4RUAA 5SZTA 1RDWX 1CSJA 1X4AA 5ETNA 4P71A 4Z4HA 2E9RX 3OYCA 1KVBA 1PVQA 2ZBPA 4QJFB 2L48A 4KBIA 5JLHA 1TYQB 3OYIA 3V6DA 3P45B 1IO2A 4CFAA 2HMXA 4QZIA 4X65J 5I9EB 5KFHA 5AQHA 1CQNA 3O5BA 1D3WA 1O08A 2HAFA 3FSYA 4ISFA 4DOBA 1X5SA 3J80O 3F2CA 3CFPA 3NVKA 2OSQA 3HLUA 2QMXA 4KMOB 3TX0A 4C4WA 1RWPB 2PI4A 3QFWA 4USWA 1N36J 3NBPA 5IIIA 1XMQK 2A1JA 4GLXA 1FF2A 1M5VC 1GLJO 1LAVA 4DN0A 4NWBA 4WQ4C 3CCQS 1N54B 3C6TB 3MR7A 4EP4A 4IH5A 5AXLA 2QL7B 1CBKA 3NH1A 4M5HA 3V9UA 1JXVA 4FW1A 3JPQA 1H7WA 5FPEA 1RSCA 2RT3A 2B7CB 3L2RA 9ICCA 9ICBA 1JMTA 4YNQA 4B9VA 3M6VA 3E51A 3VQ7A 2OTLN 4Z4IA 3PMNA 3KNAA 4U95A 2BOAA 2HLTA 4CF1A 5LJVA 3ICXA 2K8CB 1YBAA 3MM6A 3NF6A 5D46A 5J0PA 3M8QB 2FSKA 4PR6A 3VGVA 3THYA 3SFUA 4EHUA 5BOLA 2B9WA 2RUGA 2UV8A 4P73A 3HL8A 2M8HA 3BUZB 2F7TA 2W03A 2YMLA 1S0VA 4ZIWA 4A8WA 3TZZA 4I6MB 3BGRA 4ZP8A 3ENHA 1RDCA 4O44B 4I7FA 2Y8YA 4ZVGA 4DSKA 3RBEA 4IJNA 9ATCB 1RPLA 4CT8A 1TU0B 1XNSA 2D0OA 2C3YA 1N4LA 2VPZB 4OYZA 2HKEA 3C66A 2VQEK 3BYRA 3AJ2A 2RE1A 4OI3A 2Y3YA 2E2QA 3M7DA 3MK6A 1PVPA 4CLSA 2MZTA 1OO0B 1HI8A 3ZFVA 4WFZA 4DOCA 1BUXA 4PG4A 5AM4A 4LSNB 2AJQA 4JYAJ 3C5GA 5AQIA 3DLLL 8ICFA 5J2MA 2YN4A 2PE8A 5CWRA 3NGYA 2VA3A 3SCXA 3VQ6A 3GTYX 4WK1A 4RQ0A 2RDDA 2PA8D 4FYVB 1RT7B 3JPSA 5JVGL 3AN1A 4KB0A 3LP3A 1WI6A 1DLOA 2CVIA 2JHDA 3OL7A 4DV6F 1RWOB 4DF8A 1ITPA 4ILGB 3F73A 3QRQA 2NYIA 2VG5B 3JS9A 2XIDA 3CCUN 1VJQA 2H51B 2HIQA 4KH1B 3CJSA 3QNOA 4DV0F 3QRRA 2CGJA 1HBUA 4E0DA 4RPFA 1RKJA 3H0PA 4NM1A 1VQMS 2O8DA 4X4NA 4M5IA 4GKKK 3N79A 2W2QP 3H2UB 1U2VA 1AA1B 3Q83A 1J6ZA 3IDHA 4K4ZA 4DHYA 2KM8C 2DT9A 2DPNA 4NOHA 3FC4A 3TVKA 3HZEA 2EAPA 5K14A 3ETOA 1SH0A 2HHXA 1F2HA 2WF7A 2ALYB 4P2MA 1JJHA 4EU0A 3DCAA 5HN0A 1SB6A 5GAHP 2BHNA 4J5OA 1J2MA 4FYYB 2A41A 3KLFB 3KDOA 4M2YA 4Y2JA 4U7UK 1QLNA 1HBOB 4B3MK 2I1RA 4FJKA 1S6UA 3FFIA 2KZ3A 2KNJA 1KVCA 4FWRA 1TL7B 2ZJQQ 4I67A 1LKZA 3QMLA 4YXMA 2P5VA 3NWGA 2KIVA 3MGVA 1VRUA 3BN4A 4BACA 4DCHA 3G8QA 4K4IA 1Q3UA 3KK3A 5K8OA 2MY8A 2A42A 3AVLA 1IKYB 4Z2XA 3MEGB 3TANA 2BANA 2D1KA 1RWKB 2I6XA 1KLMA 1OSCA 1M5SA 3PW4A 4CO4A 2AZ3A 2UXBJ 3Q8QB 1HWJA 1Q8BA 2IVPA 5H2FU 4Y2RA 4RLEA 2HHUA 5EOYA 2LYAA 1J54A 4AXJA 1S3XA 3THTA 1G3OA 1RXVA 4CJ5A 5J2NB 2ATCB 3AJDA 2W3RA 3K2PA 2YI1A 5B0BA 3DMJA 3A2FA 1UJ6A 1DY3A 3O9TA 2QMWA 2CG4A 2CJKA 3PFEA 1CULA 4M5NA 2MSSA 3UDCA 4KKOB 1WOSA 3HP6A 2N4DA 1RCXB 4ZTJA 1GLFO 1VHIA 3DDHA 5KT3A 3N28A 2XZDB 2RRNA 3CO9A 2MMYA 5AK5A 3HKZF 5EE0A 2V4JA 4ZVTB 2HHTA 4Y65A 3M2VA 2UU9J 3EYZA 3GJSB 1YAGA 5AKEA 1LKYB 2QWLA 4JI4K 1C0FA 3MR5A 5KNIA 5DK5A 3AVHA 5AM3A 1HKCA 4X62K 3UDEA 4CGDA 2GGPB 4OQJA 2NS1B 5J8YA 2WB1C 3WNHA 1RBOB 3ZT3A 2XWYA 3HX0A 4HCCA 5KFDA 1LOTB 3OTEA 4PY5A 2JDJA 5I3PA 4FF3A 4DV2J 1V5VA 3TI0A 2IM3A 4P0QB 3JSBA 4G65A 2HZCA 2XYHB 3OY9A 3M8SA 1I1GA 2E5GA 5GAGP 1NDCA 1VQNS 3PVXA 4DR3K 3UMCA 3CCLS 1X60A 2OELA 3BZQA 5IXUA 1MWYA 4GVEA 2A18A 4PXBA 1U1RA 3THVA 4HI1A 4JNEA 4M9NA 4CF8A 4LQ3A 5KT5A 3R9LA 3BV8A 4RW9A 1FFGB 2GMHA 3IFRA 2JR5A 5HJYA 4R63A 3VTIA 2VC0A 2AGQA 4KYZA 1VQ8N 3CCZA 4LF6K 1N5QA 4ZJQA 4GNIA 1SL0A 2AF6A 1SJFA 1HBMA 2HRTA 3BZKA 2R42A 4PGQA 2J5AA 5G5HA 1RE1B 3BKTA 4C4TA 3MM9A 3BO2A 5HLFB 4LF7J 4MYTA 4OHVA 4ZIVA 5DB8A 4QWAA 5J2KA 3Q7BA 4ZCIA 3QJJA 5KG3A 4MJKA 3E9OA 2J9CA 1TGOA 4ECUA 1ZQIA 4E19A 1J9AA 3NRZA 1ZQQA 4B3RJ 2GVDA 1LOUA 4A8FA 4QZVB 4KLLA 3RW7A 4BE1A 1YBUA 4AYBC 4X64F 3NMAA 3NWRA 5AM2A 3ZLJA 4CLKA 2M52A 2W04A 1PJ5A 2EXUA 3L7PA 1OPZA 2NQPA 1VSIA 1R43A 4E7KA 2R8HA 5GINA 4B9QA 3MXJA 2QN6B 4CE9A 4KHPK 4AXIA 3AAQA 4F02A 3SJHA 1NDLA 5GAGI 1RDDA 1N60A 1JK9B 3MCAB 1LB2B 1RWMB 2P9SA 1K8KB 4YDUC 3IHQB 2AX1A 2VPWB 3RH6A 4FO6A 1H38A 5KAFU 1TYQA 2QLFB 2IAJB 2KSOA 1VJWA 2DFEA 1BDGA 5A76A 3A5OC 1OW5A 1GMUA 4LJXA 3LGNA 1RG6A 2U2FA 3CIPA 4P72A 2PI5A 1V3ZA 3EE9A 2DY4A 1VQPS 1O5JA 5C7PA 1WSHA 3VGSA 2I9GA 1U0HB 1YX2A 1QVFM 3OR1B 2OHDA 3QAUA 4LF5J 2YKAA 1WG8A 4FVUA 4ZKAA 4ZLNA 4C4RA 3LGHA 3MDFA 3CJ9A 2W2OP 4ZOSA 4BRQA 2ZOMA 3QZ7A 4BVPA 1AW0A 4HAIA 2Y9UA 1ZPVA 4FWKA 4NWIA 5AR0A 2XHBA 7ICOA 5DM6L 3HK2A 2KZZA 3R5JB 5IM0B 4FJNA 3SNNA 2V8DA 2DGUA 3CC4N 3P38A 4DV3K 4J2DA 2UUBJ 5DETA 5JVHQ 3HW8A 1VQKN 4QW9A 3TU5A 4M5DB 1JXLA 2EFGA 3M8QA 5HI7A 1YJNS 3O44A 5F0UA 1YVNA 3GU3A 1BE4A 3O3LA 1X3MA 4NV0A 4ZCMA 1ZQJA 3SPZA 2QEXN 4WKRA 1KSPA 3GIMA 2M0NA 2LQ5A 2MKKA 4I6MA 2C2MB 1ZZNA 4BRHA 3KKSA 5LL6d 3ZDAA 3N7PD 2IMWP 5AQOA 4O44A 2EAOA 1T3VA 3Q22A 9ICQA 3HVRA 1TL1B 1TP7A 1VIXA 3EICA 2VKQA 2GO8A 3O1LA 4FM1A 2XMKA 2HBRB 2FMSA 3ZDCA 2WSEC 1V4SA 3JQJA 2X1GA 3RMAA 4NI2B 2FUG9 2E5SA 4M5KA 3W2VB 2W11A 4KLGA 3D66A 4I2PB 2YH1A 2FC0A 3OBYA 4LSNA 3DXMB 4KV8A 2NR0A 4ED8A 1P8GA 1WHVA 2HQGA 2YV0X 4JI0J 3C1YA 3R5BA 2B9XA 2RE2A 1X9XA 5L1MA 1JL1A 1PVRA 4PHTX 2QRRA 3K7RA 3ZC4A 4ACOA 2D7SA 2OMOA 5ALJA 1BUPA 1H2UX 2V0NA 4WP9A 2IFXA 3UWTA 1VMBA 8ATCB 4W5QA 1RT7A 4W98A 1FKOB 5BRFA 4DDFA 4MEYA 3EMTA 3OS0A 2R7RA 2QWRA 4CESA 1GLEG 2WVCA 4DTUA 4DR6J 3L8BA 3TADA 1UFKA 2K8AA 2VG5A 4FKYA 2QXLA 1IBLF 3MUTP 5HR6A 4AQYK 1NGGA 2YKNB 4HHTA 2W4PA 4C0ZA 2E2NA 3TR8A 2NO4A 2PKEA 2X6NA 4O5BA 1RBLA 4IOXA 4YOEA 4LR8A 1RTDB 1FRIA 1S22A 3Q8RB 3JQMA 3OLAA 3R6GB 4C97A 1NNEA 2X1BA 5AZJA 2DGXA 1SZPA 3BF1A 2MRLA 2KHCA 3G2XA 2D3UA 2IJRA 4CF5A 4C0BA 1XNRJ 2BGGA 2WAQF 2YWEA 3BGUA 3LWMA 4PKDB 4DTSA 3RG6A 2CQGA 1R8PA 4CZEA 1DXSA 3GFKB 1FXLA 4OYMA 2GV9A 1VR6A 2GTDA 5DBCA 2CJBA 4NRTA 5J0RA 3PX6A 1Y5IB 2NYHA 4UBBA 1HUZA 1QQCA 5F8NA 3PYFA 3N9UC 4PEOA 1HBOA 1M1KT 4Y0FA 3PW2A 2NLXA 1YIJN 3DRSB 2C2RA 1VQ7S 1ATNA 1ZQGA 1TL7A 2LCWA 2KEYA 3ZTOA 3J7A1 3NLCA 2PFNA 4J7CA 2Q97A 4RBTA 3N7SC 4KHYA 2G8IA 4Y2YA 1GTHA 3NF8A 2E6MA 3D45A 3EGVA 2AH5A 5C24B 5B0CA 3CFOA 4ZHRA 3MR2A 1ZJMA 1WHYA 1DQ9A 2F9JA 2H3EB 2P51A 4CH1A 2VASA 3LA0A 3QEAZ 1KR4A 5LMNK 2E8AA 1NBEB 3NHGA 4AFFA 4U67L 3UNYA 3BR9A 4LFAK 4HUFA 1CUKA 4DU8A 4BLGA 3FSIA 2Y0SF 1TELA 3P5JA 4CEAA 1IUJA 1ZQUA 5CZVA 4F50A 4QIGA 4GO7X 3AVFA 3H8MA 3FRYA 2DF4B 2QWMA 3AU6A 3ZX3A 4KI6A 7ICGA 2JL9A 2B9EA 1DGSA 2F65A 4M9LA 2O6KA 3CWJA 4JB8B 3AVNA 2E5LF 3T69A 5E84A 5KGWA 1Z4NA 1SV5B 3OYKA 3OPXA 5ALWA 1NM1A 2J7KA 5KOXA 3HYFA 1GO3F 4E3SA 4K4YA 1CZ9A 1HYVA 5E79U 4PGXA 3TACB 3CDWA 1CXUA 1LKYA 3UQ0A 3E3XA 3WKCA 3I82A 5IC6B 4ILRA 1JROA 5ALGA 2EHGA 4ANDA 4A62A 2QC3A 1FJEB 2YJEA 1K9MT 4ISGA 2QLJB 4B1XB 3VV2B 4CIOA 2K3IA 3SAGA 1KS2A 1R89A 5ALZA 3Q89A 5BJRA 4WFAQ 4P0QA 2BE7D 2VWJA 2PMZF 4A8EA 9ICHA 1JCGA 3A3PB 3ZTQA 1YWXA 2X6SA 1LWXA 3ZSQA 2ZFHA 5HP4A 1RBVA 2ATQA 2W2NP 5EWEA 1Y3JA 1CJVB 2KH9A 3DV9A 4Q0BB 5JLFA 2FQQB 1YHQS 1NGHA 1RI7A 1FK9B 2FVPA 2RF2A 1NHUA 3WKDA 4YCXA 2RH3A 5AZIA 1T6DA 5KG1A 5IWAJ 4DQPA 4HR2A 1SBRA 1FJGJ 1T3QA 1E6VA 3EO3A 2R7WA 1EQ0A 5I3QA 5E2QA 2RQKA 4M3ZA 4BGDA 2RUSA 4URSA 2EAMA 2ATLA 3T6JA 3K5NA 4OZLA 4HHHA 2X1AA 1RM6C 3VWSA 2BM0A 4Z4EA 5F8HA 2XI9A 3CC2S 4FLTA 1KOHA 4AHVA 4DV5K 1YTYA 1IBKK 3J7Z5 4ID8A 3RBZA 2ZNYA 1RT2B 4QR2A 4B1WB 1GLAG 3C6UB 3AEVA 1R3NA 4CFBA 1KD1T 2VV5A 5KFQA 3LDQA 4EO6A 5DKWA 2ERRA 4GMJB 2FVQA 1ZBIA 4CIEA 4PZNA 3OVAA 1Y97A 4OJHA 4YHHF 1ASVA 2X7IA 3ZX0A 3MGIA 3QNMA 3QU7A 3C95A 2FHMA 1ZH5A 4RQ7A 2A5XA 2V5HG 3V4IA 3EXYA 1R8CA 3OBWA 3S6EA 4LF8F 1NU4A 1FFUA 2H54B 4WYBA 2POKA 3M5RA 4Z94A 3UI3A 2KVQE 3P5BP 3N97B 4JV5K 3GWCA 2E1EA 3G10A 4FM2A 4TU7A 2OZSA 1Q86O 9ICIA 1J5OB 4IEEA 2RU9A 4DFPA 4KY3A 4NE9C 2A19A 4CHQA 1BI4B 4M04A 4K5RA 5J2PB 1S5ZA 2KKPA 4E7LA 3FMBA 2YH0A 4L76A 4DR1K 3IC1A 4H0VB 4ZVUB 1ZQLA 1W26A 3RRGA 3ISCA 2CPJA 3V81B 2DXDA 5ALSA 9ICGA 1U0HA 3IM8A 3OL6A 2KFZA 1NUEA 5HK4A 3Q8VA 2IOFA 5L1JA 3OR1A 5LOQA 3KVGA 4CGJA 2W8KA 2V94A 1XBWA 3VA3A 1VYAA 3QIPA 2H5IB 3A3NB 2QZ8A 2RHKA 2YHYA 2EEYA 1ZBLA 1TVRB 3ULEA 4HVJA 3PSFA 5D3GB 4DR5J 2W9CB 4CF0A 1RB0A 3MMAB 2J0WA 2RNEA 3L4PA 9ICVA 4DU7A 1XQSC 1MN9A 1ZQSA 4DX6A 4UZBA 3VQ8A 5IM0A 3MUVP 1WB9A 4IG0B 4PHAA 4OX8A 1ZQHA 1Y9OA 2WSFC 3D2EB 3V9WA 1KVAA 2Q79A 4MKAA 4HVZA 3T79A 2D1CA 4NY8A 2XY7A 2QWPA 1SQKA 1VOMA 4E1JA 4CLYA 3UVJB 4JKBA 5HL7Q 3NMRA 3OL8A 3TZXA 3UR3C 4XEIA 1WBBA 2AIRB 2ROGA 2CADA 3VEZA 1RTZA 2K3KA 2C3PA 2DBBA 1VLBA 4HEA9 2MY7A 5LMUK 5H9FJ 1UMJA 4OZ0A 4QYZJ 1TL1A 1HI0P 1FD2A 3SMVA 2CRXA 4QNLA 1GXTA 1LW2B 5EXWA 4DS4A 2ZJPL 4DL4A 5CCLA 4FVMA 3GYNA 4NI2A 3W2VA 4YEAA 3LDAA 4I2PA 1V9PA 3OD2A 4PWWA 3N6MA 4QZ8A 2V7YA 2XYGB 1VQ6S 1S1WB 3WK7A 3H40A 5KFNA 3IP4B 3GIIA 5KFBA 1TE2A 4ITSA 2C42A 3LPYA 2XWXA 1NK5A 3ZT1A 1LFWA 5T7LA 2JH1A 5J2JA 2JC0A 2YB1A 3N5FA 3QU5A 4CLPA 4J9VA 1C0GA 4CZLA 3ZZYA 1OY9A 1FKOA 4X4RA 3ZEUA 3OVNA 4CJ7A 4OPKA 4MIBA 3IMXA 5ALEA 1UOCA 5KFSA 2NXJA 3SAFA 2EZZA 1W2IA 1U6BA 1WACA 5E0OA 2YKNA 3T1YF 2ZJAA 2DRDA 1X3NA 2XO7A 3AQEA 3JTNA 3W9HA 3CQYA 2HOIA 4W5OA 2Z2LA 1MMLA 2FJWA 2FBYA 2UUCF 2QW9A 1NOYA 3VQ4A 2VQFF 3BP8A 3OFGA 1LNQA 4WBFA 3A12A 3U7JA 4QIEA 1NNLA 3BREA 2Z56B 4X4SA 4JK1A 3LP1B 2ETJA 3R1HA 3IAS9 3LQVA 4HUEA 4QZBA 5IC4B 5E5NA 4C7ZA 4ZVQB 1OMSA 2XB2D 2H48B 4K0KK 4FLXA 4JK9A 1RU1A 1QZ5A 1FKAF 4MH8A 5JJBA 4QS7A 3KHRA 4PL1A 4I68A 3TZYA 3GG4A 5LXYA 1QQ5A 1FDNA 2CNOB 2P2CB 4IQMA 3K5PA 1SKUB 3J7YP 2KL8A 3O3GA 3RYLA 4GXIA 3A8EA 2KDOA 2V9KA 1OIAA 3C28A 3SCKE 2ADCA 9ICXA 3DRSA 4C8YA 4A5AA 1SWVA 2B43A 5AKIA 2KFYA 4P2HA 2D4WA 3O9UA 3CERA 2E7VA 3DGPA 1YTAA 4QWEA 4HTLA 2ZE2B 4GV3A 1JLAB 4ECWA 3J7ZT 3CSKA 5M1OA 2L5YA 2EK6A 4KLEA 1S0MA 5AE1A 1W0HA 2KKZA 5J2IA 4KGKA 1P90A 2OO4A 5D6GA 4YMOA 4MF8A 5CYMB 2JVRA 3V72A 4M95A 4FDFA 4BRGA 2FGCA 3V9SA 4JEPA 1HNWJ 5ETQA 2YWWA 3RAXA 1E3MA 3MXMA 4TVAB 3TQEA 3PG9A 4C1NI 2MKYA 1GLLO 1ZA2B 2LYVA 1ZZFA 4XRHA 2YY6A 2LXIA 1M1HA 1Q79A 2WTUA 3AT1B 3SSRA 1SXDA 3ATVA 4FWNA 4JI7F 1TAMA 3J7AP 3M05A 1CJUB 3FSXA 1U26A 3BGFA 1FDAA 4DV1K 1UHUA 1X5TA 5HVGA 1TTHB 2MKHA 9ICSA 4NL9C 3DXKB 3J7YI 1SIWB 1MWQA 5EGYA 2I7PA 4OKEA 1SQEA 2GBZA 3NFAA 1RA7A 3C1ZA 5AFUH 2QX0A 1U6ZA 1RT3A 3GMGA 4FCYA 4B3TK 1K5OA 1XMQJ 2FBTA 3SEOA 3W2WB 3ZZ0A 2FBVA 2JFKA 1NKBA 5KL8B 2MZJA 4NLZA 1KKXA 2Q1NA 3PIPQ 4DHVA 2M70A 4DX8H 4FK4A 2DCLA 1VQ6N 2FJXA 2GJ2A 1HNXK 2M2BA 3U3GA 4PHPA 2BVZA 3S3MA 4RW8B 3GG0A 4F3OA 2GZOA 1B9DA 3ILJA 4LT6A 3QZ8A 4EFHA 3SQIA 2OUGA 3D28A 2B4OA 5A8RB 4BRNA 4YS2A 2MJUA 4M5LA 3M32A 3VZHA 1NK0A 2IC3B 5M1KA 2NXEA 4NLYA 4YN3B 3HI9A 5JUMA 4CF2A 1CJVA 4Q0BA 2CPXA 4XH5A 2JV3A 4K43A 3CCSN 1FK9A 3LVWA 2ZZTA 5DZ6A 5H9EK 4O55A 3A0HU 3RJFA 2HVHA 3WZ0A 3MPVA 5EN1A 3ENWA 3MCNA 4CGFA 1SC1B 4K2XA 3VZIA 2IA0A 4I9QA 3TA1A 5DDYA 2HHVA 4C2MA 3H1QA 3SUOA 1HYZA 3AD9C 1SWWA 1YITN 4GVMA 3FNNA 3TOQA 4YG2A 3HHLB 4DPWA 5AIAA 3D0HE 4JB3A 3K5MA 2VQEJ 5KFIA 3E58A 4CJSA 3W7BA 4ZPDA 2CQ3A 2R8JA 4YMEA 1RT2A 4K8RA 4OYWA 1UWBB 3C6UA 3O1WA 4BR0A 4UB3A 1N48A 1GX6A 2Z57B 4O4GB 4UOHA 1BIZA 3QT7A 1YJUA 2YBVA 3GFZA 1SKWA 1M6YA 3AXMA 3HPHA 4CK3A 1BCOA 1NDKA 4R64A 4N76A 3O9QA 3HOSA 1B9FA 3UIQA 4O3NA 4BR2A 4EUVA 2RQCA 1OWXA 1SC3B 3GP9A 7ICPA 2HB5A 3D6RA 2E9TA 1AUSL 3F9MA 2HS3A 1EAYC 1M90T 4B9SA 1RQ0A 1NSPA 2ZIUA 4Q7AA 3EWGA 2FPLA 1U1PA 2E88A 2ZJ8A 4WU2A 3GBTA 4IDKB 3Q7CA 3G6XA 1J5OA 5ALIA 4RQ8A 2F4VK 4GKKJ 3JPRA 5J0XA 5J2PA 2FLPA 2EWHA 1ATRA 3E2EA 4I2AA 2XLJA 3OL9A 4ED5A 2HHPA 1CPZA 3IS9A 4HLBA 4DZ6A 2KHVA 2LYHA 5KRSA 1HEKA 3V81A 1G2EA 3CW2C 1FERA 3DLLQ 3ZSYA 4JKEA 4LF5F 4F36A 1NK7A 4NLBA 1RHKB 4RTFD 3CCVN 1TVRA 2E5HA 1S72S 4CZMA 4CZCA 1KEKA 5D3GA 2ASYA 2W9CA 2MYFA 1RGIA 3BBFA 3PCOB 3SDEB 3MAAB 4CRJA 3VQ5A 3N5BA 1URNA 4CJPA 1DOQA 1TKDA 5CHIA 4BBYA 2HNZB 3AQOA 4DR2K 4DCPB 1BQXA 3DHXA 4EZ6A 2NZCA 1LK5A 4NXMF 1WDDA 2VIXA 3LP0B 1YI2N 2G08A 4IG0A 2VBWA 2YMPA 2JVOA 1XR7A 3NOCA 1C0UB 3WIUA 3CCJN 4PG6A 1B0TA 2DK2A 3BQ0A 4NLTA 3PLAA 2GHPA 1RADB 1ZD2P 2XQCA 4N41A 4RQ2A 4C8ZA 2HNYB 1A6LA 4DV7F 5L46A 5M2UA 3BH7B 1RBSA 3L4QA 1NLVA 5BR9A 4M5GA 4GW6A 2CZ9A 1T9UA 2MQQA 1QM9A 3T5JA 3QFHA 4FWOA 4LFBJ 4NLPA 3WK8A 3OYGA 3PM9A 1YG0A 1JB0C 5HQ8A 5DS7A 5HNKA 2BDPA 2LQJA 1JLCB 4BJQA 2E20A 4JI1J 1GLDG 4CLWA 3HHLD 2EANA 4IS7A 4O5FA 1A5WA 3W0LA 2ZH6A 5AKKA 2CRLA 1S1WA 4OPAA 4F8RA 2AGPA 1N0UA 2CNLB 2QK9A 3D9BA 2IYIA 2BMBA 3JPNA 5HMWA 4OGCA 5DLFA 3HKWA 3EE8A 4RW7B 1ZQDA 4USTA 4JI4J 2B56A 3H1VX 4A8KA 1QTMA 3B6OA 3CP8A 2MTLA 4KIAA 2NRZA 2EKYA 4UOFA 2LM1A 2GJFA 2ZIWB 2P9NB 3VQSA 3FRZA 1B92A 5FD1A 2Q2RA 2ZM6K 2AQ4A 1UZDA 4O0NA 4JKFA 3QU9A 5KFGA 4CBXA 3CCEN 5TZVA 1HKGA 5AICA 2OGUA 4LRAA 3AB2B 1G1XA 3V1RA 5LL6Z 2FLNA 4DR3J 2M0GB 1WKLA 1NJZA 4OKKA 4K4HA 4TSXA 1LWFB 3GYGA 1V5IB 4CK1A 3AVIA 1WLJA 4JI2K 2VC1A 1S0OA 3SBMA 4LRDA 1XMOK 1TUYA 1DK3A 1VQ4S 4JI5K 3U02A 2LHTA 2EVZA 3KYLA 4DCCA 5ALKA 4IKAA 1R6VA 4XPEA 4RU2A 1BPZA 5CABA 2GHVC 1ZBFA 1FWLA 2W1BA 4AH9A 3O4QA 4CZGA 4LFCK 1PUZA 4LF6J 1JALA 2VODA 1B70B 2MHNA 2DUYA 2VPYB 4Y3CA 3IRXB 3WNEA 5JS1A 3HWTA 1NK6A 3CJ3A 3ZNJ1 5SUHA 1ZM4A 1NGBA 3DLEA 4PL8A 2CJ9A 4Y1DA 2B6AB 1N8RO 2DXEA 4OJ6A 2R7QA 2MZSA 3D4JA 4QIWF 2ZE2A 3AA2A 2Q0UA 1JLAA 5ALTA 1AB8A 3L4IA 4WZQA 8ICPA 1IBMK 1ZXOA 1ZBHA 1G15A 4PWUA 5CYMA 1S72N 1DTQB 3C16B 2I0XA 2G5IB 2HS4A 4RWXA 3VMFB 3GL1A 2F8TA 5HMLA 1Q9YA 4URGA 1SZ2A 3W8GA 4KHPJ 3EDQB 5CD4H 4ZMMA 3D2WA 2VA8A 2CPFA 1L7NA 1Y4ZB 3PIOL 3M1YA 1QS4A 2RD5C 4FN5A 1KTQA 4XQ8A 4DUYK 2RQ4A 3Q2TC 1KC8T 2VZ9A 3VGLA 2ZBIA 2KVIA 3QLHB 5B7WA 4DV4F 2QLTA 3D1HA 3CM6A 4OJ1A 1QH9A 4X4OA 4ILLA 3L5KA 2UP1A 3I5CA 4ELTA 4IOAQ 1ZD3A 4F0MA 3WBZA 2P5GA 4AF1A 3IO1A 4LY7A 4KHQA 1C0TA 2EG1A 3BSAA 1YJ9N 1HARA 4CJTA 3QUQA 2CQPA 1T7PA 3DXKA 2VL1A 3QGHA 2G2OA 2PFQA 4YDDB 1D5AA 1RA6A 1RDFA 1X6JA 1BPBA 1ZM2A 5AM5A 2QLXA 1XSPA 1EKEA 2G8WA 1SV4A 2WRMA 1NHVA 5A2QU 1NPKA 3I0SB 1NGJA 2HBQB 3A3OB 1GOCA 5AJ3J 1K73T 3D0PA 1UQVA 3VAMA 5EVZA 2QV6A 4ZJOA 3QEWA 3IM9A 3D3CJ 3Q2SC 1C20A 4I2IA 4RW8A 3QYPA 4ER8A 3LPTA 2EBEA 3ILIA 3SUPA 5A8RA 3F5TA 2FIUA 1P1TA 1KXPA 1MWZA 4DV3J 4DSLA 1R0BG 9ICMA 1PZNA 2IC3A 1ICEB 4FJ7A 2AWZA 4DKWA 2HGNA 4V1Ak 3H5YA 1Z19A 4JUZA 1KOOA 3JXUA 3DU5A 4OZ1A 2WZ1A 1WC6A 4CTAA 4AD6A 3G4SN 1FJGF 1FHTA 5BPCA 4IQTA 2W6KA 1MNEA 1KCFA 2A6OA 3JYTB 1IWAA 2DNYA 1WELA 2WFBA 4DN9A 4RQ4A 1KDNA 4PA1A 2YHAA 2ZJ5A 2QT7A 1XN9A 4KRWA 5J2AA 4BRMA 1CS4A 3VF0B 3HHLA 3SSSA 2XZTB 2NRHA 4I2DA 2IOFK 5F9LA 2RDIA 1X42A 4MDBA 1VQ4N 2YX6A 4ZVEA 4LF9F 1HQUB 4CK2A 2E5JA 2VPXB 5DM6Q 1RWXB 3KTQA 4O4GA 3TVYA 5LJ5Y 1CJTB 4CJ4A 2AV5A 3MWBA 3LAKA 3WDOA 3FVYA 4BC2A 3S01A 1LAWA 5DLGA 4UATA 1UPHA 3KFUF 4LF1A 4AHUA 1F0MA 3ATUA 1CQMA 5BYQA 5D0HA 3J80U 3UQ2A 2FE9A 4AM6A 5AI6A 2VU5A 3W9JA 5B8HA 2O66A 5F8IA 1L8OA 5A8WA 4PUOB 2Q6BA 4B08A 3EL2A 1MG7A 4AQYJ 1OVQA 1Z4OA 3KK2A 4MIWA 1ILYA 5ALQA 2AJFE 4IDKA 3H8JA 6FDRA 4Y1CA 4W5RA 1A7GE 1VK8A 3VCDA 5C42B 3RH4A 1SCJB 4I56A 4OYOA 3DM2B 2M9NA 3S9HA 1OH6A 1BCMA 3IBPA 2HFUA 1NMDA 2FSNA 4Q5VA 4WFNL 3HMJG 4X2BA 1LQ9A 1TFYA 3BO4A 4U7UD 4N8OA 2UVWA 5F0WA 2G8UA 3OT9A 3VAHA 2GHWA 5KFEA 3WHIA 3J81U 1I39A 4DU3A 4WYLA 4DV6K 3W62A 3DC2A 4HHJA 4LRFA 3RSEA 1Y64A 3J7YU 1JUDA 1NZ8A 3QBCA 1AFIA 1I94F 4ILHA 4DV0K 4A46A 2RP5A 2WVFA 3PSIA 4IRDA 1XNQF 3V4MA 3SDEA 5F9NA 2EH9A 2O8EB 1KNZA 3JAMU 2DEIA 2OKQA 3NS1A 4B17A 3VEYA 1SV0A 3EGNA 4RW6B 5ALLA 1RYRA 2IOHA 9ICWA 4PXEA 1WCNA 4DFJA 3LP0A 3SMPA 1S4FA 2C22A 1BNOA 1C0UA 1BMQB 3O6WA 1Q81O 1S4EA 1L5UA 1Z4UA 3ISND 3Q8MA 4AM7A 1XERA 3NVVA 2V34A 1MMNA 3RMCA 3BKFA 4P9SA 4RNNA 2NNWA 3THWB 2AA4A 3I32A 4MTPA 2LXUA 2ILYA 1JXEA 2LA4A 4LF4F 5HHIA 2RIJA 1Z26A 5IT4A 2DR8A 2PC6A 5KG5A 3FBBA 1S7HA 5EDWA 4ECSA 1XC3A 4LFAJ 5AM0A 3GE9A 2M4MA 3W60A 5J0YA 4H5RA 4H03B 2DVIA 1P6TA 3H5UA 1JLCA 2F1FA 1YJ7A 4DPXA 5ETLA 5F8GA 2UVUA 2AYGA 2QTDA 1ULRA 2DD8S 3PXGa 4KH5A 3QU4A 1R27B 3P6YC 4X4UA 3D7SB 2BW7A 3Q86A 3KOAA 1V3SA 4TYAA 1IR1A 3N6LA 2VG7B 2NXCA 2PAVA 1CC8A 4ZVPB 2V2QA 1HIYA 1S97A 4CDIA 4RW7A 2VD3A 3SBTA 2HBMA 2OPQB 2H5XA 4TY8A 3CMES 1K8AT 4EP5A 3W5XA 4TUQA 2VJ4A 3I4HX 4H0YB 3A5MC 2FVSA 3O3HA 3HHLC 4P7VA 4WCEL 2C3UA 1F5SA 4EMDA 2JRSA 4MF2A 4O3QA 4KN7A 1X4HA 3D67A 2A3ZA 1S6QB 4Y2CA 3UE2A 3OQ2A 4F0KA 1C1CA 1R7IA 1UVIA 4I6AA 5ETKA 4M0AA 3UMGA 1Z25A 2FJAB 2QYGA 2HMIA 4EWTA 5ETTA 3AVBA 4BR9A 3C14B 5D4BA 5ALFA 1SGGA 9ICOA 1FT8A 4R65A 3HHNB 1W9HA 2PFDA 3MFHA 4DQSA 2PBDA 5HP1B 5GAEU 1RAJA 2NUUG 1NJIO 1NOZA 3GDXA 3O4WA 4ZVSB 1B64A 4FO0A 3ZDDA 4CHNA 1VSDA 2BKPA 2BJ1A 4JBCA 3KWIA 4ZVOB 1T0TV 4NMXA 1VSFA 3ETLA 4OZ5A 2WTFA 3MGHA 3RH5A 3HJEA 4DV5J 4BG8A 3HFKA 2QLWA 1IBKJ 1REVB 3L7UA 1U7LA 1MSWD 4PPXA 2V8VA 2P9KB 3H45C 3AM9A 2B6AA 1RNHA 5HROB 5ETSA 7ICVA 4WU3A 3RJMB 3QINA 2R2SA