4B9LA

Structure of the high fidelity dna polymerase i with the oxidative formamidopyrimidine-da dna lesion in the pre-insertion site.
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 213
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9lA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9lA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9lA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9lA01
3TR8A 3QZ7A 1B22A 5CR0A 4FLZA 3TAPA 5SZTA 4AH9A 3MDAA 2HHXA 2C28A 4BDZA 1ZBFA 1RT3A 2XC9A 3BQTA 2OPRA 5KT6A 4EP4A 4N47A 3SYZA 4J2DA 4RQ0A 1N48A 2DPJA 3LK9A 3ITHA 4O9MA 2P1JA 5KFSA 4DU4A 7ICLA 1HNIA 3PX4A 4MFFA 3JPQA 2AU0A 4O5EA 4Z4EA 3LZIA 3RBEA 4RT2A 2AJQA 3HVRA 4R65A 3KK1A 1S9FA 3ZSZA 3NTUA 9ICAA 2FPMA 3VQDA 4DL7A 5J2MA 4HUGA 3TARA 3VQ4A 3RJEA 5KT4A 3MEGA 4DTUA 3KD5E 4DU1A 3HK2A 4Z0UA 1ZQAA 4KHWA 4M2YA 1T05A 2Z1IA 2BKEA 4GXKA 3OYEA 4JWMA 4XRHA 4ID1A 4OPKA 5L9XA 3SI8A 2W9MA 1RTIA 4EYHB 4FZZA 3VQ7A 4B9LA 2BPFA 5J2FA 4DEZA 4RNNA 4HCCA 3MGIA 2BPCA 3H8WA 2VWJA 4ELUA 5D49A 5DBBA 3MABA 5KFKA 4KLFA 4MFBA 5C24A 1JKHA 3DOKA 4DOAA 2Q0ZX 2RDIA 3KTQA 4CIFA 8ICLA 3KHLA 4DSEA 3ZDBA 4I29A 2W9CA 4RQ8A 3QEPA 1SZPA 1WSEA 3PMNA 5CY4A 5IIJA 3LWMA 5HROA 5KG5A 2HVIA 1XHXA 4O3SA 2FLLA 3T3FA 8ICKA 5KGWA 3V4IA 5FRNA 2FC0A 4Z4GA 5KFCA 2OPSA 4X5VA 3QIPA 3AVBA 3C6UA 4M3TA 5KFAA 5I3UA 5KFNA 2C2EA 4JV1A 4F3TA 1HQEA 2XO7A 3VQEA 2BCQA 2R8KA 4CJRA 4M04A 5F9NA 3OJUA 1DTQA 4NYNA 5J2AA 4E19A 2R7YA 3NGIA 3PMLA 1TAQA 4PUOA 1WNSA 4CGHA 1JLEA 5DQIA 3KJVA 5J1EA 4FLXA 5DB9A 1QSSA 2HHQA 8ICJA 1IKYA 3L8BA 3SV4A 5DG9A 4YP3A 5BOMA 3HX0A 3LDSA 8ICMA 1EX4A 4YMMA 5KFVA 3ZT2A 1ZQXA 3ZSXA 2IHNA 3C21A 3DMJA 3RB0A 4CF0A 2GBZA 1KFTA 1XHZA 2OA8A 3QO9A 3NF6A 2HHUA 2UVWA 4E0DA 3LP0A 4QWEA 4GXIA 1I3AA 4I2PA 2DFEA 2YHAA 1L3UA 4KHQA 4W5RA 3GIJA 4M3WA 3TAQA 9ICNA 2Q3SA 4CHYA 1DOQA 3NAEA 2W9BA 1LB2B 4ED0A 4BACA 4DS4A 2FMQA 3SQ1A 2HHTA 1VSIA 1L3VA 3L2UA 4CE9A 5HP1A 3AVGA 3GV5B 1S0VA 3ULDA 5T7BA 3G6VA 3SJJA 2HW3A 2VWKA 5KFTA 4KHNA 2GWSA 4ECXA 1YTUA 4KMUA 1D8LA 4H4OA 1L5UA 2RDJA 2BDPA 4UBCA 4ED8A 3TWHA 1C1BA 3OSNA 4O3QA 1KVBA 4QOZB 3QEWA 1TVRA 2BR0A 4JWNA 7ICUA 1ZQCA 1BI4B 1S6PA 1HYVA 2HHWA 4LSNA 3U3YA 5KRTA 7ICVA 4IFVA 4CK1A 1EETA 4KN7A 1JIHA 4RPXA 4I2FA 1A5WA 2XGPA 3ISNC 3OYNA 4Q44A 5DGBA 1BIZA 4ECSA 1LAVA 2IOCA 1JLQA 2ZTCA 2BQUA 3VQQA 1U04A 2AGPA 3BJYA 3SUOA 3O3FA 3HPGA 4FW2A 4B9NA 1ZETA 2ITGA 4IRCA 4DOBA 4YFKA 3SQ0A 4I27A 8ICCA 3AO4A 3AO5A 4CIEA 2YNIA 4K4GA 1Z00A 4CHQA 3EPIA 1BQMA 2KFNA 3C1ZA 4FJ7A 3RAXA 3ZT1A 5J2QA 3ETLA 4N41A 4FK0A 1ZQVA 4NCGA 4CFCA 3P5JA 4LH4A 1ZQMA 4RQ3A 5F9LA 4R64A 4RPZA 2OPPA 2NRTA 3C95A 4CGJA 4CEQA 2R8GA 5C5JA 1TK0A 3LZJA 4EBCA 4YG2A 3NH0A 4P2HA 3T5HA 4IRDA 2IAJA 4NM1A 4W5TA 4E7HA 1BHLA 4TSXA 4NM2A 3V1QA 3VQBA 5KFXA 1Q9YA 2KFZA 5J0XA 4FJJA 2F1JA 3PW7A 5J2GA 3I0RA 1RTDA 4FLVA 3RB3A 4C8NA 1D9FA 5DLFA 1T8EA 4CF2A 4DSJA 2PI5A 3JYTA 4EZ6A 3WNEA 3S3NA 4FXDA 4DL4A 9ICMA 3Q8QB 4DU3A 4IQVA 2ZE2A 1C1CA 5KFYA 3B0YA 1HUZA 4DWIA 4FLTA 3H4BA 4I2BA 1L3TA 2VG5A 4DTOA 1RXWA 4DS5A 1G15A 4ED6A 4Q8EA 4YQWA 2ZJAA 4LH5A 4KB1A 1VSDA 4F8RA 4J9NA 1RT1A 4EP5A 4DTSA 4TQSA 5J0OA 3H4DA 2G8VA 1KFSA 1KRPA 2R8IA 4KHSA 2ETJA 4MF8A 3P83D 4OJRA 3EW9A 4XUSA 1S1VA 3L2QA 3NF7A 3M8RA 3MFHA 1ZQBA 5IIKA 8ICOA 1MU2A 1WCLA 4I9LA 1KSPA 3QESA 2UVUA 1KVCA 2VA2A 4DO9A 4CHOA 3Q8SB 4OKKA 4GVMA 1SKRA 1Z00B 4I2QA 5DB8A 1S9GA 3T19A 1N6QA 4FM2A 4YXMA 8ICNA 3AV9A 4FLUA 4F50A 3JPNA 2XY7A 1LWFA 3UXOA 2O4IA 4DSKA 5DMRA 3NF9A 4DQSA 1VK0A 1JXLA 3QNNA 2FLPA 3E2EA 1HJPA 1HUOA 1HYZA 4B8CA 1RDCA 4H4MA 2XGQA 4R5PA 3HW8A 2PY5A 1SL0A 3TAFA 7ICQA 5J0PA 1C0TA 2YNGA 4JUZA 7ICEA 4C8MA 4CFDA 3HSTB 4IKFA 4ECVA 4UB1A 4FVMA 4M9JA 3LALA 5IIOA 4M6WB 4Z4HA 1U45A 2EX3A 4KLHA 1EXQA 5KFLA 1ZQQA 2I1QA 4FBTA 4CESA 3H08A 3M9NB 4M3XA 4DSFA 3NH2A 3EPGA 4NLKA 3RR8A 4CGFA 5CYMA 4I2GA 4QZ9A 3G0ZA 2QK9A 4YD2A 2MUTA 4CEOA 3DYAA 3K4GA 3EY1A 8ICQA 5KFFA 3JPPA 1C6VA 5CA7A 8ICYA 4EYIB 5EU7A 1A5XA 3ZSWA 5L1JA 4OKJA 1RYSA 5HRSA 4J9LA 2I5JA 4TUPA 5J0QA 4KI6A 1ZBIA 5TZVA 1JL1A 1HPZA 3WNFA 1XU4A 1DGSA 4DQQA 3VQPA 2ZJ5A 4IR1A 2DFHA 2DFLA 3OYJA 4W5OA 4P4OA 5KFOA 2JEGA 1EKEA 3PVXA 5J0YA 2PYJA 5SWMA 2JEIA 1ZJNA 3PO5A 2RF2A 4NLGA 1JN3A 3RH6A 4R66A 3DLBA 5HHHA 5J0WA 5JS2A 8ICIA 3C6TA 3OS0A 3KD1E 3ISBA 1BPYA 3OY9A 2YV0X 1GOBA 1TGOA 4KV8A 1JLGA 3B0XA 5DKWA 4UAZA 4F4KA 1UT8A 3NF8A 1QE1A 2GV9A 4M42A 3EYZA 1RBUA 5BPCA 1JLFA 5DK5A 4QW8A 3HXMA 3C2LA 5HRPA 1ZQYA 1S0MA 4Z6FA 4O5KA 9ICSA 3O4QA 2YNFA 4IBNA 3QERA 1MSWD 5JS1A 3EWAA 4ECZA 2Y1IA 1BVSA 1KEJA 4F5QA 3QEXA 2WONA 3RWUA 3C5GA 4AHCA 3K2PA 1XSNA 4KFBA 4KAZA 4ED1A 5KFDA 9ICWA 7ICJA 4O3RA 3Q8PB 5D46A 1WSHA 4YR2A 2ASLA 2JEFA 3CFPA 4O0JA 3AVAA 4CHNA 3QE9Y 1IKXA 3A2FA 2A1SA 1W9HA 9ICEA 1RBTA 3AO1A 4E1MA 3MGHA 8ICGA 4FLWA 1HJRA 3JPOA 5KFJA 2W9CB 3NBPA 4DL2A 1LW0A 7ICRA 3ZCMA 4IQTA 2PFNA 1YTAA 2E4LA 2H5XA 8ICXA 3SI6A 4RQ5A 4CGGA 3AU2A 1NK5A 4ECQA 1S1WA 1C0MA 3JSMA 1ZQOA 3OYKA 5IIIA 4DTPA 4CFBA 2JLEA 4QZCA 4CJ4A 5HMMA 8ICBA 4DFMA 4UAYA 1ZYQA 4QW9A 3MAQA 1NK7A 1S10A 1RT4A 1LW2A 3NHGA 3GFKB 4Q45A 4YNQA 2ZJ8A 4ICLA 1S0OA 1J53A 1SKWA 1U4BA 4RQ4A 2WTFA 2UVRA 5DQGA 4IQWA 2LSNA 3AVKA 3IM1A 1SV5A 2IHMA 2B4JA 5DBAA 4CF8A 9ICTA 1AROP 4DG1A 9ICGA 5KTQA 4IQUA 4ELVA 8ICEA 4FZYA 1RILA 2OZMA 3GQCA 4JLHA 3HPOA 4KLSA 4NXZA 4FJNA 5EOZA 3DLKA 2YNHA 4BWMA 3GILA 1QLNA 3KHHA 3AO3A 3M9MB 3CFRA 3RH4A 3NFAA 2G8UA 1NKBA 2YKNA 3ZSRA 1KTQA 4O5CA 2PXIA 4CCHA 3AVHA 4CJEA 3OYLA 5FROA 2IGIA 2G8HA 1B92A 3TAEA 2KQ2A 5I42A 4ED2A 4BDPA 4K4IA 2X6SA 3T1AA 1D5AA 8ICHA 1IKWA 4RQ7A 5FDLA 1MC8A 4E7JA 4LZGA 3U3GA 8ICFA 4B3OA 1RBVA 3QIOA 4DFKA 1X9SA 4J9KA 9ICIA 2PYLA 1QTMA 3NGYA 1ZJMA 3M9OB 1CZBA 4ECYA 3K5OA 3NE6A 3TQ1A 2V9WA 2NRVA 3OYCA 1NK6A 2MUTB 5HLFA 4YMOA 2BQRA 2PI4A 3NGZA 4JRPA 1J9AA 4F5NA 4I28A 4FJ8A 4O5BA 4PHPA 1ZQGA 9ICXA 2F8SA 3HWTA 1RXVA 4DL3A 3RH5A 1NJXA 4LD0A 2XCPA 4IR9A 1ZQKA 4KLEA 4DQIA 4UB3A 3Q8RB 1GOCA 1BISA 4J2BA 2AQ0A 4ECUA 1TKDA 7ICKA 3RRHA 4PY5A 2D0BA 4FK2A 1VSHA 1UA0A 5D4BA 4DF8A 4E3SA 4NCBA 2M9NA 4F5PA 5CYQA 4FJ5A 2W9BB 4IG3A 2A1RA 1NK4A 3T5JA 4JV2A 5J2JA 4B9TA 4I2EA 4KLIA 4DMNA 1U48A 5L1KA 4Z6EA 4CIGA 3RTVA 4M6WA 3V9UA 4J2AA 4KLMA 3AO2A 4LSLA 3UPQA 3L2WA 3OYGA 4C8LA 3DRSA 4CECA 2F1IA 1A77A 3TFRA 4E7KA 1TKZA 4JS4A 4M3YA 4O3OA 1VSEA 1ASVA 3PO4A 1ZQUA 2ASJA 2HB5A 4P4PA 2JZBB 3AU6A 4CJKA 4E7LA 2KN7A 1REVA 5KG3A 1WAFA 2NUBA 4KTZA 2I9GA 4YFUA 4R63A 3LPUA 5KGXA 5HBMA 4KLOA 3OYHA 3C23A 3VA3A 1R0AA 2FBXA 1SL1A 3V7KA 4FJGA 2ATQA 3DI6A 4CJQA 3TFSA 3V9WA 1TKXA 1RT5A 1T3NA 4G1QA 8ICZA 4R8UB 1QSYA 2F8TA 4TUQA 4F91B 3G10A 1A5VA 3RJIA 5CZ2A 2D0AA 4QWAA 2ZUDA 4EBDA 4HVJA 4QZ8A 1Z26A 1SUQA 4PHAA 5DDYA 5KT2A 5J2BA 2BCRA 4F2SA 1CXQA 2RN2A 1ZBUA 2J6SA 1C7YA 1KDHA 3PR4A 1RBRA 4ZTFA 3RMBA 4QZHA 1RTHA 1Q8IA 4JV0A 4CGDA 4DFPA 4B9SA 2QKBA 4O4GA 4QWBA 4M47A 1VSFA 4L8RB 4OGEA 4ECTA 4IDKA 1WN7A 1CEZA 2DTUA 1COOA 3F73A 2WOMA 1LAWA 2VG7A 5KT7A 1B9DA 2BANA 1ZQSA 4AHRA 3LP2A 4QZBA 1S9EA 3ZDDA 7ICNA 3OYAA 3AA2A 2NRWA 1ZQZA 3ZD9A 5KG2A 1ITGA 4DQRA 4AHVA 5BOLA 3AVMA 7ICIA 4Z4CA 2XY6A 3SUQA 3WNHA 4AHSA 4KB0A 5D3GA 4RUCA 2JZBA 2IS3A 2PFPA 1W0HA 4Z6DA 3BGRA 3HL8A 2AGQA 3PW2A 3OYIA 3Q8KA 5KFIA 4C8OA 4RW8A 3AVNA 4E89A 1TAUA 4XIUA 2OPQA 1HRHA 4CEZA 3ZDEA 4YMNA 2DFFA 4M9LA 4DOCA 1ZBLA 3VQ5A 4KTQA 3S3OA 1B9FA 4F4XA 3MXIA 4I2IA 1T03A 8ICUA 3RJJA 3L2VA 1WLJA 3ISDA 3TANA 2XY8A 3V1OA 3LP1A 3NGDA 4UB5A 4CJFA 3MXJA 4TQRA 1CZ9A 4I2AA 9ICOA 2ZUCA 3M8PA 1ZQIA 4O55A 3SV3A 4M9HA 5KRSA 2FBTA 1ZQNA 3QEVA 9ICLA 1NOMA 1V9PA 4FBUA 2VA8A 1RDBA 2ZQBA 5J0TA 1ZQEA 3K58A 9ICHA 4FZXC 4KLDA 5KFBA 4F4YA 5KT3A 3K5NA 2BCUA 2OWOA 2XY5A 4YR3A 3LAMA 1JXBA 3HP9A 9ICKA 2FPKA 4DL5A 2V4RA 3BQ1A 2C2RA 1CXUA 1H38A 3HYFA 1CLQA 5DLGA 9ICQA 2BGWA 2ALZA 2BQ3A 2PZSA 1HYSA 2E6LA 4KRFA 3HPHA 3OYFA 4UQGA 2ISPA 3OYBA 1HMVA 1RDAA 4OLAA 4HYKA 3V72A 3H8JA 5DGAA 2FPLA 4KHUA 1UAXA 2R8HA 1ASWA 4PHEA 4B9VA 1TKTA 4Y1CA 3SNNA 4C8KA 4J9QA 3JPRA 4B08A 4YD1A 2D5RA 2A1JB 2ASDA 1X2IA 3SUNA 5J29A 3AUOA 4O0IA 4J9PA 2Y1JA 1BIUA 2AQ4A 1S5JA 5J2IA 2IA6A 1RTJA 2HNDA 4QZDA 1NK0A 4QAGA 5J0SA 3FFIA 4RQ6A 1NJWA 2BCSA 1XO1A 3VA0A 1JLBA 2G8FA 3V6HA 1NKEA 3E01A 3SPYA 3IRXA 1WAJA 3SQ2A 4MF2A 1HNVA 1L3SA 3H40A 4CEAA 1VRTA 1XS9D 1JX4A 3FYHA 4FJKA 4J9SA 1BCOA 3MR6A 5KG1A 3SPZA 1VRUA 5HMLA 2KZMA 3TI0A 5KT5A 3MR5A 4F4WA 2RKIA 1GOAA 3C2MA 1DLOA 4CEBA 1TV9A 4O3PA 4OLBA 3KLGA 2P51A 2BCVA 4CF1A 2DPIA 1SL2A 5L1IA 3OYMA 1UT5A 1RCHA 3IS9A 2O4GA 4RW7A 5DG8A 2W9AA 3OGUA 7ICGA 3F9KA 1Q9XA 4OVLA 4DFJA 1FKPA 1VSKA 4KLUA 4Q43A 3GIIA 2VG6A 1BQNA 2YHBA 2KZZA 3ZT0A 4KLJA 3RB4A 2NRZA 5J0UA 3L3VA 4N5SA 1TL3A 3CM5A 3JPTA 4OGCA 3KKRA 5KFZA 1WCNA 1HQUA 4M3ZA 4FJXA 5KFQA 2ISOA 4BDYA 4QZIA 1TK5A 3RB6A 3NH1A 4AHTA 2KW4A 1Y97A 3CFOA 1TK8A 4G3IA 3SQ4A 3H8SA 4JK1A 4F93B 2IMWP 1KCFA 3RRGA 4LZDA 3PW4A 3RMAA 1O1WA 4F2RA 3GV7B 4KO0A 4M9GA 4QZGA 3RJFA 3BDPA 2KZ3A 1RT6A 1K6YA 4I9QA 3RBDA 5CWRA 4K8XA 1RZTA 5DQHA 4QWDA 3ZT3A 3V81A 2XRIA 4RZRA 3AA4A 1S1TA 2G8IA 4PA1A 5K14A 4EZ9A 2KTQA 4O44A 3DLEA 4FJ9A 4KKOA 2MAXA 4CHZA 4CEEA 3PX6A 1ZQRA 2BE2A 1DTTA 2X78A 4J9OA 4CJWA 3H7IA 3QETA 4CHPA 7ICPA 2QKKA 1VSMA 2B6AA 1KLMA 4ELTA 3K59A 3SZ2A 4MFAA 1NK8A 2RPIA 4WE1A 1RNHA 1RT2A 1A76A 1IH7A 1UOCA 2ZTEA 3T5KA 1T4GA 3Q8MA 1SKSA 2G8KA 4FO6A 3PW0A 4RQ2A 4HUEA 1NOZA 3LAKA 3O4NA 4HHTA 3PV8A 3ZSQA 3PW5A 2R8JA 2HNZA 3MFIA 1C1AA 3VN5A 1X9MA 3M8QA 3RAQA 4DTMA 4KPYA 3KLFA 4YVZA 1NJYA 3S9HA 1KLNA 4FM1A 3C5FA 3MBYA 3DLGA 3NDKA 4QZEA 3C2KA 4J2EA 1RDDA 9ICRA 3N97B 4CF9A 4UAWA 1XSLA 4DSIA 2P6UA 3LP3A 2HNYA 5IINA 3THVA 7ICSA 3QEBZ 2NRXA 3RJHA 4KLTA 4RW9A 1WSGA 1JXEA 5EWFA 3PNCA 4KTWA 1F21A 1D8YA 3WNGA 3L2RA 4DTXA 5J2KA 3CYMA 2HVHA 5HRNA 4I2CA 3G6XA 3K5LA 7ICFA 4CEFA 7ICMA 4OKEA 4E1NA 3IG1A 4YR0A 4B9MA 1U49A 1ZQLA 2X74A 4KN4A 3JPSA 4FJMA 3IAYA 4FYDA 4E7IA 3V6JA 1JLCA 1QQCA 1BI4A 5EWGA 1PZNA 5CHGA 3RR7A 5KFRA 4PGYA 4MQ3A 3ZSOA 4H8KA 3C1YA 1S1UA 4CJPA 3MEEA 3QEIA 1NJZA 4PHDA 1UA1A 4LVSA 3PY8A 3NCIA 1MQ2A 4PPXA 4QZFA 1WSFA 3CQ8A 1K1QA 4J9RA 8ICSA 2ZUBA 1NOYA 9ICCA 1BPZA 3Q8LA 4BE0A 3DRPA 3QNOA 4PGXA 4W5QA 4DL6A 4XA5A 5C42A 4FJLA 4GW6A 3VQCA 5J2HA 1QS4A 3V7LA 2OYQA 5KFMA 4MEXA 8ICTA 3B6PA 2E6MA 4YN4A 4CJSA 4EEYA 1LWCA 8ICRA 1RBSA 4BGDA 2HHSA 1S97A 1KFDA 3AVIA 5CJ7A 4YXJA 5KG4A 5J0RA 1NK9A 7ICOA 4QZAA 1BPDA 4JRQA 4CFAA 4CEDA 1ZQDA 3GV8B 1LWEA 1D9DA 4BWJA 2HHVA 4PH5A 3DLHA 2F96A 2GUIA 4NY8A 1J54A 3PR5B 3UQ0A 5HRRA 1Z3EB 2FMSA 4FCYA 3LDAA 4Q5VA 3GIMA 2FLNA 2W42A 1FXXA 2FBVA 2J6TA 2X6NA 3V9ZA 3ZT4A 2P6RA 2B21A 3N4MB 3DM2A 4NCAA 2QXFA 3B6OA 4FS2A 4I2HA 4TURA 3U6FA 1IG9A 4IG0A 1TL1A 3DOLA 1YT3A 4HUFA 4DLGA 3VQAA 4KLGA 1QSLA 4IFYA 1IXRA 3O3GA 1B43A 1ZQWA 1JL2A 2ATLA 3OJSA 4CK3A 1RYRA 4GLXA 5CP2A 5CB1A 3VQ9A 4ED3A 1IO2A 3LWLA 2D0CA 1IKVA 9ICBA 4CJLA 4UB4A 7ICHA 3OSPA 3SCXA 9ICJA 4B8AB 1BGXT 3KIOA 3VQ6A 3MEDA 5IILA 5HHIA 4GXJA 1XSPA 2YKMA 4RW6A 3FDSA 4ECWA 3AVJA 1S77D 3KHRA 1VSJA 1N5YA 4F3OA 1EP4A 8ICWA 3UXNA 4Z4FA 3ASMA 4R8UA 4LY7A 1Y88A 2XHBA 2ZTDA 4FLYA 3DLRA 1JLAA 4GMJB 1ZQJA 5E41A 3PX0A 4ZTJA 3KHGA 4OPJA 3BQ2A 4UBBA 3RJKA 4PGQA 2F1HA 4FJHA 2C2DA 3IHQB 2G8WA 5KI6A 3MDCA 5J2PA 4Q0BA 1BCMA 4HTUA 4ZH4A 2VA3A 4K8ZA 2HMIA 1XI1A 1CUKA 2IC3A 3BQ0A 5J2CA 3KKSA 4KLLA 4DSLA 1KVAA 1MQ3A 4ECRA 3V6KA 1TVAA 3VQ8A 2IBKA 3ORYA 3AVFA 3ZDAA 3LANA 1S6QA 4FK4A 2IDOA 3ZDCA 3MECA 3S3MA 2P66A 4FM0A 1BPXA 2W8LA 3AVLA 2Z1GA 4BE1A 4CJTA 3HJFA 4CGIA 3HVTA 4RUAA 1T7PA 1JMSA 8ICAA 4TUSA 3QZ8A 2JEJA 1N56A 4AHUA 5KFPA 4RG8A 1RT7A 5KG6A 5KFHA 3L3UA 3V7JA 4J9MA 3RMDA 9ICUA 1Z25A 4UB2A 4MFCA 3HT3A 5KFUA 3MXMA 3RMCA 2V4QA 1ZQHA 4M45A 3ZSVA 4Y1DA 4PWDA 1S0NA 1I39A 3V6DA 1C0UA 3UIQA 3TAGA 3RJGA 5JUMA 4CERA 4W5NA 1TV6A 2FBYA 4M3UA 4DTRA 1FKOA 2J6UA 2ZD1A 1K1SA 1J5OA 3G6YA 4IRKA 5KFGA 4CJ3A 5IIMA 2PFOA 4I2JA 2A1JA 4DLEA 4QCLA 4K4HA 4M3RA 2AGOA 3V9SA 3TABA 3D45A 4KITB 4RQ1A 1X9WA 5HNKA 5FRMA 4FJIA 4RNOA 5J2DA 4GC6A 2P5GA 3GIKA 4M0AA 4O3NA 1FK9A 1NKCA 2BHNA 2DY4A 2FMPA 3PUFA 4ZHRA 5DB7A 2Z1HA 3I8DA 4BE2A 3TAMA 4NLNA 3OS2A 3K57A 1ZBHA 5DB6A 4YCXA 2XCAA 5HP4A 2BPGA 3EZ5A 3CM6A 5J2NA 2PFQA 3KK3A 4KREA 1XC9A 3AA3A 8ICPA 5C25A 1X1PA 4EBEA 1QHTA 1S76D 4CJVA 3KLEA 3CG7A 4KHYA 3HP6A 4NYFA 5KFEA 2EHGA 4I7FA 1ZQFA 3OS1A 2C22A 2P5OA 4GC7A 4F5OA 4RT3A 4XQ8A 9ICVA 2LYHA 2OZSA 1BPBA 1BL3A 4FS1A 4KI4A 4I2DA 4N76A 1UWBA 4HCBA 4FW1A 4QWCA 3I0SA 4RW4A 4F5RA 2JGUA 1LV5A 4AILC 5DBCA 9ICFA 5KG0A 4NLZA 2VANA 3UXPA 4F4ZA 3OVNA 1RPLA 4JS5A 1ASUA 4Z6CA 5KG7A 3QLHA 3KLHA 3P1GA 3DRRA 4MEYA 3AA5X 3LPTA 1TFRA 5J2EA 4BXOB 4RPYA 2Z1JA 1ZQPA 3QEAZ 3D0PA 4DTNA 4CJUA 1VSLA 3ZD8A 1ZQTA 3OHAA 3UQ2A 4Q8FA 3MR2A 4ID5A 4M41A 4PQUA 4CK2A 1U47A 2BGGA 3V1RA 1XWLA 4RU9A 2W8KA 3ZSYA 3GDXA 3C94A 4DTJA 4DF4A 3ALYA 1IM4A 5KFWA 4CJ5A 3O3HA 3KLIA 4P4MA 5DDMA 4RNMA 4DQPA 3K75D 4M9NA 7ICTA 1EXNA 3QINA 4ED7A 5L1LA 3HM9A 3HO1A 1YVUA 3OHBA 5EWEA 3V9XA 5CZ1A 4F92B 3AVCA 3SUPA 1WSJA 4N56A 1S1XA 3K5MA 1WSIA 1BPEA 3M8SA 3OYDA 3MR3A 3T5LA 4BXOA 4KLQA 4B9UA 2B5JA 4Z4IA 5DG7A 1U9LA 3KK2A 3ISCA 8ICVA 2UVVA 9ICPA
chains in the Genus database with same CATH superfamily
5ALNA 3TR8A 1ZM2A 4PG8A 3HHLD 1ESVA 2QA1A 4AH9A 2C3YA 4CLTA 4BDZA 1OUQA 3MTJA 5LY3A 5KT6A 4MIBA 4CWBA 2DPJA 3RF9A 2AEMA 4CO4A 4DU4A 3C2PA 5E26A 1HEKA 3PX4A 3AHPA 3A12A 3ZFVA 4DUZF 5ETVA 4U7UD 4Y3CA 4RT2A 3OL9A 4BQLA 1TL7A 3NTUA 2FPMA 3VQDA 1M5SA 4HUGA 2DNKA 2QLTA 4IJAA 2Q3PA 5GAHP 3KD5E 4DU1A 3UB5A 4Z0UA 2W3SA 5AE1A 2LA6A 4I67A 1HHQA 3OYEA 1KC8T 3KJFB 3ZZYA 1WF2A 3S6EA 1RTIA 5F0UA 3LGMA 5K4LA 5CRXA 2BPFA 4USUA 1T94A 5J2FA 4RNNA 4HCCA 2C2MB 5ETRA 2OMLA 5AQPA 3EEQA 1QE1B 4ELUA 5K8OA 5KFKA 3A3OB 2V8PA 3H2VE 4BR2A 4MFBA 4BRIA 1B7FA 2Q0ZX 2MKKA 3F2KA 4O0NA 2HWHA 4BLGA 4USTA 1NLKL 4OX9F 5HL7L 3PFOA 4DSEA 4I29A 4FZMA 1S12A 2W9CA 1NPPA 1Y0HA 4JI5J 4JYAK 1Q82T 4RQ8A 4QR1A 3UNYA 3HILA 3FZMA 1WSEA 2MQQA 5G0RB 2HVIA 3G87A 3DXSX 4OQJA 1C2PA 3T3FA 1EAYC 1Q7YO 4FWKA 2FC0A 1DK2A 4X5VA 2X7IA 3FUYA 4M3TA 3WIUA 2RRNA 4JV1A 2IRYA 2PEBA 5FP0A 3OJUA 5J2AA 2ZIVB 2E9RX 2Z8QA 5C2DA 3VQTA 1TAQA 1N8RO 3THPA 1WNSA 4DOZA 4FN5A 2APOA 5AFUH 4H0XB 5J1EA 3QRPA 4FLXA 5AK4A 2HK2A 3THTA 5DB9A 3C7NB 1MMNA 2HHQA 3DLJA 2D7SA 4JV5F 5DG9A 2WF8A 4YP3A 2HBMA 4XEIA 3LDSA 8ICMA 4X4VA 2GH1A 4BJQA 1HYSB 4F9OA 3ZT2A 1ZQXA 2HFZA 1ELOA 1FO4A 4FKYA 3C21A 3DMJA 5L1MA 4CF0A 1HNWK 4NWBA 3N6MA 2AX0A 4QS9A 3I56S 2OA8A 1JCEA 2CQBA 2Z4PA 3QO9A 4K5RA 2HHUA 1UZHA 4CO2A 4UF4A 4QWEA 4L72B 2IJNA 1ATNA 1B70B 2YHAA 4KHQA 1HIYA 3M7VA 3SBTA 5HR7A 4XTTA 3TAQA 4OYMA 3VGLA 4UY85 3MOZA 1PCAA 3D2QA 3TZYA 1IIPA 1R8PA 1UTAA 3L2UA 2HNYB 4CE9A 5HP1A 3NVVA 3TNVA 3G6VA 5ETLA 2ZNYA 1RWPB 5KFTA 1C20A 2VPWB 2R2TA 2XI9A 4C80A 3HFZB 4A8MP 3FZLA 3I1YA 1V4TA 1O8BA 1ZD2P 1C1BA 3OSNA 5AJ3F 3D1QA 1KVBA 4LRAA 2HHWA 3O44A 5KRTA 5KL1B 3H0MB 1ATSA 2UUBJ 3A4TA 1M5KC 4WP3A 1JIHA 4RPXA 1A5WA 4Q44A 2K8AA 2C2NA 5DGBA 3M2RA 1J27A 2IOCA 3VF4A 1X5TA 3ETOA 2BQUA 2VGMA 4AE5A 5E3RA 1U1RA 2D0PA 2AGPA 4FW2A 2HK3A 3SSSA 3EZUA 1VQKS 1RHJB 4DV2F 4IRCA 2V4JB 3AJ1A 4I27A 1HBMB 3CCLN 2VQFF 3AO4A 3NGSA 3LVWA 3WK4A 4P0QB 1R8AA 4UY8O 5CR4A 3Q86A 1XNRJ 4H0PA 1FF2A 5LSRA 4CHQA 1N4LA 1BO5O 3PSFA 3VF2A 4FDFA 1Y4ZB 2YNIB 2B5JB 4ERDA 4LQ9A 3IBPA 1ZQVA 2BBEA 4RW8B 1PK1B 4P6QA 1KKXA 4DV3F 2CZ9A 3MMCA 4RPZA 2OPPA 5C10A 4CGJA 1QD1A 4EBCA 4YG2A 3TOQA 1VQYA 2B9XA 3IR5B 3VQBA 3CCLS 3V1QA 2HHHK 5H9FJ 1Q9YA 5J0XA 2F1JA 3OTDA 4LBIA 1RTDA 2XS2A 3ZNUA 4C8NA 5L39A 1T8EA 1O5JA 2F9JA 4WFBQ 5AQKA 4FPBA 3ADAC 3WNEA 3EVMA 3S3NA 4RW6B 2W55A 4IQVA 1R0CB 4JKAA 4ZIVA 3LYSA 2X1GA 2MTLA 5ITHA 1U2FA 3O6WA 1RXWA 1YHQS 5AR0A 4ED6A 1S1TB 2D3DA 1RHKB 4QJFB 5E7OB 1CI4A 3MPWA 1VSDA 3D3CJ 4A2BA 1OMSA 2F4VK 1H2UX 4EP5A 3CCSN 5J0OA 1ZA2B 2G8VA 2YX8A 4FP9A 5AQUA 1KRPA 2ZDOA 4KHSA 3JB9k 1GAOA 3P83D 3EW9A 4XUSA 3S1TA 2PMZD 3HI0A 1C1BB 3NF7A 4TYBA 4ZCLA 4J91A 2DKZA 1UEVA 2RLTA 3QGIA 1YVNA 3ZZUA 3I5CA 2VODA 3EGZA 1Y11A 4CHOA 4BREA 4OKKA 4GVMA 2CWKA 3U7JA 1Z00B 1T3OA 3T19A 1PAEX 2O01C 5ALQA 1HW8A 3FMWA 5C42B 4LSZB 1WTFA 1T44A 4F0MA 1FE4A 4NYOA 2W25A 3SSRA 1LWFB 3H5XA 4LF8K 4DL0C 3QNNA 2KHQA 1HJPA 2VDIA 1OQ6A 4B8CA 2WF9A 4H4MA 4R5PA 2PY5A 1YJWS 3PRDA 7ICQA 5BYRA 5J0PA 4LF6F 4X2BA 4IO9L 4CFDA 5ALSA 2OPSB 4WP8A 2QLBB 5TKYA 1U45A 4LREA 1ICEB 2PFFB 5KFLA 2AWZA 4CESA 1PC4A 5J2NB 4M3XA 4DSFA 3JAMO 2VUGA 3QU4A 2F65A 4Z94A 3E9LA 4I2GA 3CC4N 3G0ZA 1I5OB 2PD1A 1NWKA 4Y2MA 3VAFA 1A6SA 3HT0A 4Y2CA 1C6VA 5B08A 2CQ1A 3P4IA 3EZOA 5HRSA 3OR1B 2I5JA 2F7TA 4X4OA 1JL1A 3WNFA 2DFLA 3OYJA 3HMJG 4P4OA 5KFOA 3MDQA 5ADXA 1EKEA 3PVXA 4BC4A 3HI9A 2IVNA 5J2MB 3PO5A 1N0VC 2RF2A 4NLGA 3RH6A 3DLBA 2K4EA 3MN7A 1U2VA 1VQSA 3I33A 2K7JA 3KLFB 4DR4K 1XR7A 3KD1E 2IM3A 3B4DA 1GOBA 2G1DA 3DOMB 3TVYA 4F4KA 4NXNK 3C66A 1QE1A 3ZTQA 3O9TA 2GV9A 4JI2F 4YOUA 2D1CA 5DK5A 1S0MA 4Z6FA 1RT3B 2J4RA 1KAYA 1KEKA 3MM8B 2YNFA 1RTZA 1MSWD 3EWAA 2ZIXB 3CD0A 4OYZA 1BVSA 1NM1A 2DKOB 4IWVA 3B54A 3C5GA 4UZCA 3R2DJ 4XH4A 4KAZA 2D1KA 1Q8BA 3R2CJ 4O3RA 1TL7B 5K8PA 1WSHA 3AEVA 2KEYA 3RW7A 1A6LA 3A8EA 5AM5A 7FDRA 3AVAA 2KT3A 4CHNA 3QE9Y 1JALA 1N52B 3P6YC 1IXKA 2EAPA 4M5MA 5DM6Q 2OH2A 1VMBA 2RSQA 4K8RA 5B09A 1IQZA 8ICGA 2XMJA 2ZOGA 3NVZA 3JPOA 3I4PA 4DR6J 4OZJA 3O9SA 1LOTB 1LW0A 4CDIA 3DDIA 4IQTA 2VFVA 1MWMA 8ICXA 1Q79A 3SI6A 4RQ5A 4CGGA 4FF2A 4ECQA 3JSMA 3BGFA 4IG0B 3O9UA 3OYKA 5IIIA 2JLEA 4QZCA 8ICBA 4DFMA 1EP4B 3M8PB 3PIOL 1XNQK 2E2NA 3X1LB 1NGEA 1RT4B 1NK7A 2KV2A 3SJHA 2K60A 1RGVA 3Q8UA 4DR5J 4GY2B 4YNQA 2ZJ8A 2K8BB 5ETOA 1J53A 3QNMA 2GMJA 1H1VA 2WONB 4EX7A 1FDNA 2HLTA 3ATVA 3QLHB 2UVRA 4UW2A 3IM1A 4JV5J 2B4JA 2OTJS 4YORA 5DBAA 1RWUA 9ICTA 3NBPB 4DG1A 1SPBP 5K8NA 3P45B 5KTQA 1K0VA 1CBKA 4ELVA 3AXMA 4A5AA 2B51A 1RILA 3GQCA 4ZJLA 3WZ0A 2OPPB 4WQ4C 2MHEA 4NXZA 1Q0NA 5F3TA 3N9UC 1FRIA 4BWMA 2AJ1A 3T1HJ 1PK1A 4OI0A 2Q1NA 2ZHOA 1ZOLA 2DGVA 3NFAA 1RLDA 2HBKA 3MZIA 4JOUA 2UUBK 2RHQB 2YKNA 4LIRA 4LSLB 3ZSRA 4KFBB 4HDGA 3VEOA 3AVHA 5FROA 1GNKA 2G8HA 2ZBCA 3TAEA 2N82B 1UVNA 3ID6A 5LJ3Y 3KK3B 1D5AA 8ICHA 3O8MA 3HOSA 4FPRA 3P38A 2G0IA 1NDLA 2HQFA 8ICFA 4B3OA 3HCXA 3QIOA 3ID8A 4J9KA 2MJUA 2CZVC 1SXEA 1JROA 1CZBA 3GZFA 4ZPVR 5LMNJ 3TQ1A 3QWUA 1NK6A 2R9LA 5HLFA 2BQRA 1XBWA 2WAQD 2FJWA 4DR1J 5ETPA 3MX5A 3S41A 2O8DA 4PHPA 4DQ8A 4U96A 4LFCK 1HIWA 3DAWA 3D1HA 1VHIA 1NGHA 3QUBA 2F9WA 1NJXA 4HR2A 5AKYA 1ZD4A 1AA1B 4IR9A 4KLEA 3GYXB 3Q8RB 1WDTA 4AM7A 5C2FA 1TUGB 2PGCA 2LU2A 4ECUA 1JUDA 2B4OA 1X9JA 3W2VB 5D4NA 2X1AA 1Q82O 4ZVSB 1UA0A 1AW0A 3Q23A 5D4BA 3M30A 2F77X 5AQQA 2QLFB 5U47A 3T5JA 4F25A 3KKFA 3H25A 4HEA9 1FX4A 4B9TA 3UKUB 4AFFA 4A8QA 1U48A 3JTNA 1W25A 2BEFA 4M6WA 3J7ZO 4J2AA 3HRDD 3AO2A 3PCOB 2CJ9A 2AX1A 1FVSA 2AYEA 2Z2LA 4CECA 1VBXA 5BRHA 4PWDB 2QA4G 5K20B 4M3YA 5C25B 2BDUA 3MN5A 4MYUA 4A8FA 4P4PA 2JZBB 1QVFM 5ALRA 1REVA 3J80O 2ROPA 2B8PA 2VV5A 4WQ5C 2GVZA 4CNZA 4X4SA 2CADA 4KLOA 3MMAB 1R0AA 2FBXA 1QAIA 4BHQA 2ZOFA 5HI7A 4FJGA 2UUAJ 1TKXA 3Q0AA 3UPFA 3T1HF 3I55S 8ICZA 4C3MA 3UMCA 2F8TA 1KN6A 3TTFA 1RTIB 4WFZA 2G2YA 1N5YB 3G10A 5B5EU 1MROA 3RJIA 1NGAA 1MN7A 4IL6U 4QZ8A 2F63A 1YJVA 2ZJRL 1WSRA 2XNQA 2QLJB 2HMIB 3CIZA 1DRGA 1C7YA 3PR4A 5RUBA 1RBRA 2B9YA 2A40A 4PL1A 3IBWA 3IWXA 1WHYA 5B0AA 4ZLPA 3J7Z5 2QLXA 2CWXA 4Q2LA 1GMUA 4I68A 4DV4K 2CGLA 5AI4A 4G9ZA 2CZ4A 2CJBA 3M3ZA 4C3KA 2JRZA 1EARA 4B3OB 3D67A 4DR1F 1COOA 1C0FA 4DR2F 2BANA 1WI6A 1ZQSA 1WEXA 4AHRA 1X6IA 1S9EA 2NRWA 3ZXWA 2OEKA 4GV9A 1ZQZA 3WIVA 2G4BA 2QARB 3ZD9A 2RIJA 3QU7A 2IDLA 2LA4A 2FY8A 3TJ8A 1HNZF 3WNHA 3ICXA 4C98A 2KJ9A 1RU1A 2KHOA 1KQSR 5AXMA 4OPAA 5KNIA 5LMUF 3OYIA 1RKIA 3Q8KA 4I64A 2GO8A 1TAUA 4XIUA 1FRJA 1RTHB 4CEZA 1T0TV 2DFFA 3AQOA 4M9LA 4DOCA 2GOLA 3FZFA 3BB5A 5I3PA 1OH5A 2QL5B 4F4XA 3CETA 1NSAA 4NL5A 4TU9A 2N4DA 2F8LA 2VPZB 2PMZC 5F8NA 3FZHA 2JRSA 4NLXA 3NGDA 4CBUA 2RS2A 4UB6U 1EKSA 3T6BA 3M8PA 1DURA 4O55A 3SV3A 4M9HA 5IV4A 2FBTA 1O6XA 3WXKA 1B3TA 3QEVA 9ICLA 1V9PA 2QLWA 3KFUF 2UV8G 1UVLA 4QJVA 1SJRA 4R0JA 1RDBA 2LVWA 2BA9A 3GIRA 3K58A 3IXQA 3FBEA 9ICHA 3JXOA 3H42A 3K5NA 1VQ8N 4YR3A 2ZC4A 3LAMA 3FQLA 3LDOA 2UP1A 3OQ2A 1CVJA 3LH2S 2V4RA 3R5AA 3TACB 2H51B 4URGA 3CD7A 1NGBA 5FLXU 3OTOJ 2DHSA 4LF5F 2BQ3A 3FZKA 1NLVA 4E1JA 2XNRA 1BC6A 2SXLA 1VIOA 1DY3A 5ETMA 2LQ5A 4OJ5A 3OYBA 3SAGA 5H1SV 4CD1A 3BO2A 2AJ2A 1HMVA 1L3KA 4OYIA 2J8AA 1GXLA 4WFNQ 5F3ZA 4KHUA 5AFUA 2R8HA 1WD6A 4PHEA 3TP2A 2EAOA 1DK3A 3HZGA 5KPZA 2D6FC 2BYCA 4Y2QA 2D5RA 3EL2A 3W3DA 2ASDA 2PIIA 1P8ZA 2LEBA 3CDBA 3SUNA 3IM8A 1T9UA 3OTEA 3M8QB 3J80Y 1NDPA 4EELA 1M5VC 1SIJA 1C0GA 3P31A 3AD9C 3SQGA 1TUVA 2G5IB 3QFUA 5IT9O 4HDHA 2ADBA 4RQ6A 3GMGA 1JLBA 2G8FA 3BF1A 1NKEA 4JYAF 4WFAL 1ZRMA 3BGUA 2UUWA 3HX9A 4CQ1A 3RW6A 1HNVA 1L3SA 4CEAA 2ERRA 2E7XA 3CCMS 4FJKA 2AZ1A 4N8OA 3MGJA 3MR6A 3SPZA 1VRUA 4JI8F 3MOJB 3LP1B 3D0HE 1Y5LB 4ZPWR 1KVIA 2LYVA 2RKIA 3TTCA 2RNEA 4JBCA 4X64J 1U1OA 2AW0A 4I4BA 1GMVA 4XAKA 1RDFA 3KLGA 1G4CA 1VJWA 1SL2A 5L1IA 2E1RA 2O6KA 3AM9A 2GEMA 1IBKF 2O4GA 4I6WA 4ZVPB 2W9AA 3OW2M 1IBKJ 2HFVA 3M5RA 1RA7A 4OVLA 1EB0A 4JI8J 4X84A 4GVBA 3HULA 3ENWA 1P6TA 4WTYA 2YHBA 4LMZA 3QB0A 4WJ3B 3ZT0A 4KLJA 4LR8A 4ZPAA 3HBTA 3RB4A 1VDHA 3L3VA 2V2ZA 3ZNJ1 4CP5A 1S59A 3KKRA 3RAMA 1HQUA 1F5SA 1HNXJ 3KNGA 3K9JA 3M6KA 1Q81T 4AHTA 1DQ9A 4BR5A 4A62A 3CFOA 2CJAA 3DHWC 4IDKB 3L4IA 3MX2A 3H8SA 5AKEA 3ETMA 2CNKB 2V5HG 1HBOA 3L6QA 4FPIA 3T6JA 5M1KA 3IDWA 4WFXA 1XTZA 3BDPA 1K6YA 4I9QA 3B4MA 4OZNA 3C6TB 4RZRA 3TU5A 1S1TA 2VJ5A 3CULA 2UXBK 2RVJA 3DLEA 2MAXA 1R3NA 4WPAA 2P9IB 4X64K 5L46A 1ZQRA 2QE5A 1VQ4S 5F8JA 3GDQA 4YB6A 3IKMA 2X78A 4J9OA 5EY4A 5BRDA 2EWHA 2DH8A 4IOBA 1E6VB 1M90O 2B6AA 2XHCA 3HTVA 4FF4A 4C48A 3GONA 5CZVA 3A0BU 4HTJA 5LMUK 5LOQA 2FJXA 3NAIA 4ZPBA 4CD3A 1A76A 2MKYA 3FE1A 2HLUA 2WK4A 2G8KA 4RQ2A 3MMBA 3MMCB 1ZC6A 2RDDA 3DOLB 3KYLA 3VN5A 2FJEB 1X9MA 4QZVB 3M8QA 3W2WA 3RAQA 4DTMA 4CLSA 1NJYA 4DUYF 1PJ5A 4YUDA 3S9HA 3O9QA 2XSJA 2Y8WA 2P9KA 4FM1A 2HQ3A 5HMWA 4EK2A 3NDKA 2NXUA 5GIPA 4J2EA 3GE9A 9ICRA 1M1KT 4C3LA 4KH4A 3Q83A 2OD6A 4YY3F 3LP3A 3H2LA 1IKYB 4DX6A 4P2FA 2BW2A 3VAIA 7ICSA 2UU9J 3GU0A 2NRXA 1PBUA 4RW9A 2V69A 5IWAJ 2O8BA 2DRBA 3G4SS 4ILMA 4E8UA 2NYIA 2MLYA 4PPDA 1D8YA 3NRZA 1HR0K 2HGLA 4JI0F 4BG9A 2VKRA 1ZZFA 3CYMA 1I51B 2CIMA 3G6XA 3T1YF 2ZVIA 1Q46A 1XMBA 1RADB 3F0NA 2M70A 3QSIA 1FFWB 1ZQLA 1LWCB 4EEKA 2X74A 2NSBA 2LEAA 3JPSA 1H74A 4ITSA 5M1OA 5EWGA 4LF5K 2HWTA 5AK5A 3C46A 2V34A 5E3CA 4F71A 1FWLA 4PGYA 4TXSA 1HLUA 2POKA 3C1YA 3SDEA 3CC2S 2XB2D 3WBZA 4ZHRB 1TTHB 1LEOA 1D0EA 1LNQA 4LF7J 1UA1A 2YX1A 4MKVA 4LVSA 4QU7A 4U8VA 1NCLA 3DYAB 4PPXA 1WSFA 4OZ5A 3MMJA 4ZPCA 3QJPA 1AZSB 1F3FA 1AUDA 9ICCA 1BPZA 2KVIA 3IFRA 2HEKA 4FO0A 4PGXA 2YCHA 4W5QA 4XA5A 5EVZA 3KG4A 2IVMA 2KIWA 3R5CA 4GW6A 3AD8C 5J2HA 2E1EA 3SSQA 4EEYA 3QNWB 4CBWA 3VMFB 4HAIA 4H5NA 4J03A 1UKUA 3S8SA 4USWA 3PHEA 1U6ZA 2HHSA 1MU2B 1KAXA 1S97A 1KFDA 3DLLQ 1IBLJ 5CJ7A 4JI5K 4USKA 4GIBA 3AOBA 3TSPA 3IN5A 1NK9A 4NA1A 4FZVA 4MDBA 3GV8B 5C24B 1LWEA 2KL8A 4BWJA 2HURA 3H90A 4PH5A 3DLHA 3KWGA 3CNQP 1APSA 2V63A 3UQ0A 1J54A 5HRRA 2Q79A 3J80U 1WBBA 3I96A 1GK8A 3N7PD 4NX9A 4WU3A 3GIMA 1ECWA 1FTCA 1YSJA 3BREA 3OV7A 2W42A 4E2FB 1FXXA 2AT1B 4ILRA 2GQ2A 1PYOB 2QFIA 2HBQB 4LVOP 2W40A 3DM2A 4H0OA 2EBEA 3B6OA 1N5VA 3VGMA 4TURA 1WKLA 1K8AO 1Y64A 1TL1A 4HUFA 4DLGA 4AUKA 4KLGA 1YZ6A 1RXOB 1YI2S 3MAHA 3O3GA 4CZFA 6FDRA 5KQ8A 3OJSA 2YXLA 4R0EA 2J76E 5CP2A 3VQ9A 4DPXA 3C6AA 1DLOB 4LF8J 3QYYA 1UCNA 3LWLA 2D0CA 1RWKB 2HYIB 3DDHA 3ENQA 4LF6J 1S7IA 3ZTOA 4LSNB 3UN3A 1HWIA 4UB4A 4UOGA 3SCXA 5GAEU 2F3NA 3LO3A 5A8KB 1UJ5A 3M1VA 3MEDA 2R7OA 1K8KA 2NXCA 2WB4A 2ZM6F 3ZC4A 2YKMA 2JV3A 3FDSA 2O67A 3O1BA 3WQPA 3VEXA 1BG3A 2Z56B 1U1PA 4F3OA 1N5YA 2YKMB 3L95X 3UXNA 4OYOA 2QWQA 2B7BB 4O3MA 1Y88A 3U02A 3VV2B 2ZTDA 2PA3A 3NNHA 1CQMA 1ZQJA 1AYEA 3ENBA 2GZOA 4K2XA 3PX0A 3MCSA 4OPJA 3CB4A 3BQ2A 5C7PA 2JH1A 2UUAK 2F1HA 2MZTA 3FQKA 3I55N 5K8MA 1B64A 1KOOA 1X5SA 3ZEUB 5M2UA 3JSBA 5KI6A 4YS2A 4JK7A 1RTJB 4PZVA 4HTUA 4K8ZA 1P7DA 1URJA 5J2CA 2LM1A 2MDAA 1PAUB 3KKSA 4GRSA 2WMMA 4DUZJ 3E0FA 4ECRA 8RUCA 2LYBA 2CUYA 2IBKA 5D78A 5K9FA 2IYIA 5L38A 4FFDA 1S6QA 4ETZA 1KVJA 3MECA 3S3MA 1BPXA 1R31A 2QI2A 3J7YI 4AYBF 3AVLA 1H3DA 5FJ4A 4DHVA 1HPZB 3HVTA 4CGIA 4CO0A 1TQLA 4M5GA 4TUSA 3TKAA 3QZ8A 3E9PA 2JEJA 2ZBIA 1U0HA 5L9NA 4J9MA 2FE9A 3PYEA 4FNIA 4KJIA 1GLAG 2JH7A 4QBUA 1Q7LB 1S0NA 4HHUA 1U0SA 4IH7A 1NZPA 3V6DA 3QIPB 4DV5K 4DV0F 3TAGA 4CERA 4W5NA 1PVQA 1Y10A 3W9HA 4FOIA 4ED5A 3GBTA 5KFGA 2MLZA 2YH1A 1FXLA 2ILZA 2PMHA 3KKAA 2RHKA 4DLEA 2BKOA 4LRDA 4K4HA 2O8DB 2OAUA 4C0ZA 1X9WA 4X62F 4ANCA 4FJIA 5FPMA 1TUWA 3VAMA 2C1EB 5J2DA 5KOXA 2HRTA 3QUQA 2P5GA 1WOPA 4M0AA 3ULEA 1ZTWA 3US5A 1N61A 2DY4A 1FFUA 2W01A 3CJKB 1R43A 1DGJA 4ZHRA 2HOIA 3K57A 4DV4F 3VZHA 2XYPB 3I0SB 3CM6A 3HRGA 2PFQA 4PPZA 3KK3A 1XC9A 4DV2J 4UUWA 3AA3A 1WACA 2H1YA 4EBEA 4OZ0A 3MEGB 1QHTA 1X5OA 1S76D 3O8WA 5ALJA 3A5NC 3VGVA 1NHVA 3HP6A 1Q8KA 5KFEA 2EC2A 4I7FB 2C22A 2P5OA 4X66K 4XQ8A 4MK9A 5A76A 4A8YA 4KI4A 2D3UA 2BUNA 3F44A 4KB7A 4N76A 1VFJA 3D2EB 3F53A 4QWCA 5CD4H 1RWOB 3PSPA 2JGUA 4NLZA 2CPYA 3TUPA 1P9YA 1Q4RA 2VANA 3OVNA 2U2FA 1ASUA 4P73A 4JI3K 1RE1B 1S5LU 4KE5A 3EDRB 3QLHA 1SXLA 3UO0A 1SVDA 1F0MA 1S9GB 2F4FA 1DTQB 2MYFA 4BXOB 4RPYA 2W2NP 4QIVA 1O0PA 3UQ2A 1S5ZA 3A5MC 3J7AP 4JEPA 4F04B 1YXQA 2KOBA 1T05B 5HO4A 2ZGZA 5F8MA 4B1YB 3V1RA 2FVQA 4LR7A 4F67A 5BN9A 4BRHA 3WKEA 2ZZMA 1YRXA 4NV0A 4DTJA 1CPZA 4DF4A 2CYYA 2F3JA 4CJ5A 2Z0GA 4TY8A 4OHVA 2XICA 3KLIA 3SBMA 2CJKA 3THXB 2HGMA 2P9LA 4J8FA 1JLAB 1EXNA 4ED7A 1HBOB 3MM6A 2KH9A 4KX3A 2B9EA 3MR7A 4K2JA 1ZM9A 4OI6A 3V9XA 3L4PA 2YKOA 3VEVA 3SUPA 4WFNL 2UZAA 3G8QA 4HH0A 3VF0B 2KK0A 2IFXA 3SFUA 3M8SA 3MR3A 2AD9A 3BS5A 1HNXF 3MCAB 1RAIB 2JNJA 3ISCA 3HD2A 3SQOP 3THYA 4IUFA 1SC1B 1T03B 4KT0C 1SZHA 5CR0A 3H5SA 1RUSA 3TEHB 2VG7B 4F4AA 2HHXA 1U02A 2DVIA 1RT3A 3BQTA 4EP4A 3SYZA 4J2DA 1ROFA 4AQYK 4AT1B 4RQ0A 3LGHA 4WK3A 3LK9A 1SIZA 3ITHA 1HNIB 2P1JA 3VEWA 5KFSA 3T7ZA 2D9PA 3ULHA 3GG0A 1B99A 7ICLA 4JKGB 1HNIA 4MFFA 2F4VF 3IA0A 4Y2JA 2WBNA 2J0SD 4U7CA 2C3UA 3LZIA 2H48B 4RR5A 3HSCA 2A1AA 3ZSZA 1HX1A 2Y9TA 2XZTB 2NSCA 5J2MA 4JI5F 3BPSP 3VQ4A 3THYB 5KT4A 3HK2A 1U26A 1FW6A 4GXKA 4WXOA 4QS7A 4RUBA 2HZAA 2ZF5O 1DQ8A 2MLXA 5L9XA 5FPNA 4EYHB 4FZZA 3VQ7A 3R9LA 4NLUA 3MGIA 2YTCA 2ITMA 2W3RA 5D49A 4C9DA 3MABA 1WOOA 1UZDA 2KRBA 3DOKA 4DOAA 2OKQA 2P9SB 2YMQA 4CIFA 1NEEA 3OHRA 3BGOP 3KLIB 4B3TK 3NP5A 1X4BA 4TY8B 3QEPA 2BJDA 4P7VA 1VQ7S 1J2MA 3PMNA 5LL6Z 3QMQA 4Z37A 1Q16B 5KGWA 2BE9B 2RD5C 2OPSA 4RL1A 2ATCB 3AVBA 5KFAA 1SBRA 3SMZA 4YOTA 4ACOA 2WVBA 2Z30B 2VBZA 2AMCB 4CDGA 5F9NA 1REGX 5CA5A 1DTQA 1PIEA 4EGLA 4NYNA 1NGDA 2QA2A 2R7YA 2RQ5A 2B4PA 2PFUA 1N54B 2ZITA 3K0SA 4RPFA 4L74A 1YGYA 4CGHA 3KJVB 1WKKA 3W1YC 2RJZA 1LVHA 4Y2XA 1SH0A 3UQSA 3SQGB 4BR4A 5IZHA 4CLZA 4B3SF 5BOMA 3HX0A 1DRZA 3WXLA 1V4SA 1FXDA 3T79A 5FLXO 1OIAA 4Y2VA 3TA1A 4P0PB 4CT8A 4TU8A 1N34F 2RE2A 3GJSB 1XHZA 1RQLA 1RK8A 2W2MP 4JI1J 3IRUA 3NF6A 2K2PA 1Z4UA 2IVYA 3VQSA 3PLAA 2NLWA 4I2PA 2DFEA 1L3UA 4W5RA 3GIJA 1SGGA 4MIWA 2Q3SA 4PL7A 4CHYA 2Y1LB 3NAEA 2QZ8A 2W9BA 4A48A 2LM4A 3I31A 3SQ1A 5AK6A 2PKEA 3BN7A 1LQ9A 4OYPA 2VBXA 2E1CA 1I94K 1VSIA 3BEXA 1CRXA 4CVNE 3ULEB 3ULDA 5AKHA 4USIA 2NPIA 3SJJA 2OXOA 4DFDA 4D3HA 3KFWX 2HSZA 2GW8A 2GWSA 1LW2B 2WSFC 4WFBL 2BMBA 4PAAA 1CULA 4ZMMA 2R7XA 1S72N 2BDPA 3BF3A 4UBCA 3NMUA 2K8CB 4O44B 5ALLA 2VC1A 1RTDB 3UE5A 2BR0A 4JWNA 7ICUA 1ZQCA 2HBRB 1HYVA 4A8KA 3PEHA 4IFVA 4ZK7M 4OHWA 3EE8A 3C65A 1EETA 1VC5A 8ATCB 3UCGA 3V81B 1RCXB 4DV2K 1RT1B 2XGPA 3OYNA 5IM0A 1YDLA 1K47A 1WYGA 4ECSA 5I3QA 3GL1A 1JLQA 2G13A 2EFGA 1U04A 3EN9A 3BJYA 3JQKA 3FEZA 3UD3P 3GCWP 2ITGA 1ZETA 4DOBA 4YFKA 1YQHA 4K25A 3LVVA 3AO5A 1SKUB 5AQZA 2YNIA 2MGZA 3B8AX 3EPIA 1S6QB 4ISGA 4DUZK 4FZLA 3RAXA 2IOFK 2G2ZA 5J2QA 1HKCA 3J7YP 2IIHA 1VAZA 4CIOA 1ATRA 4FK0A 5T7LB 4KHPK 4IS7A 4CZJA 3ICLA 2VPXB 4RQ3A 4LQ3A 3U8XA 2DNLA 4MIAA 4CEQA 2R8GA 2V7YA 5C5JA 1K9MO 2MZJA 5ELZA 3MCOA 1O51A 2IAJA 4B3SJ 5BPMA 3EE9A 1BNOA 3J7YU 2IJFA 5KFXA 5AZJB 4HI2A 3PW7A 3G96A 1KLMB 4CYUA 4JKCA 4P10A 1HNXK 3MHYA 3KK2B 2F2AB 2PI5A 3ONNA 4EZ6A 1BQNB 2V6AA 3GG1A 4URQU 5JICA 9ICMA 3Q8QB 2GHVC 2ZE2A 1C1CA 4W92B 5KFYA 5A8KA 3B0YA 4NZ0A 1WG4A 4I2BA 2JWKA 4DTOA 1S6UA 2CQ0A 1TKXB 1IBKK 1VI7A 2K1RB 2KD1A 4DX8H 4KB1A 4JI2J 1IG6A 4LF4K 3WUHA 2VDHA 2XI2A 2WBRA 4NXNJ 2Q1LA 2R8IA 4U7BA 4PG5A 5A8RB 4WYBA 2VC0A 4NA3A 1S1VA 2G06A 1RACB 2N4CA 3KWIA 4K43A 1WCLA 4I9LA 1GLBG 1Q5YA 1KVCA 3K2YA 3O4WA 1JJCB 3BZCA 3F5EA 4DO9A 1SXDA 4O5FA 4PKIA 1XMQF 3D2NA 2L41A 1KAZA 1TKTB 4I2QA 1UCVA 3PZPA 4FM2A 4CH1A 4FLUA 1JK9B 1UFWA 4F50A 3JPNA 3VR1A 4LF6K 2JLFA 4DSKA 5DMRA 1JLFB 2B8QA 2OFHX 3E2EA 1YJUA 4MHVA 1HUOA 4MT1A 2L5YA 1RDCA 1MN9A 5KAFU 2MZRA 5AM3A 3FKBA 1SL0A 3TAFA 5AT1B 2XVTA 1YJ9S 2CJYB 2IY5B 4X64F 7ICEA 4GFJA 3HSTB 4FVMA 1AFJA 3MGVA 4M9JA 2K06A 3KLEB 4M6WB 1S1VB 3G71S 3S6JA 4KLHA 4L75A 4YB5A 2DPNA 2BUPA 2FXUA 1UJ4A 2O8CB 2FJ6A 2QFJA 2W54A 3H08A 3NS1A 3DU6A 3NH2A 3VVUA 3RR8A 2CG4A 2COLA 3PKYA 4CGFA 3N28A 5CYMA 4P52A 4YN3B 1AQ6A 3A5LC 2QK9A 5HLFB 3DYAA 3K4GA 8ICQA 2A6MA 5KFFA 2YY6A 4US8A 4EYIB 4DMZA 1A5XA 1GLDG 5L1JA 4OKJA 1RYSA 1JMTA 2QMWA 4J9LA 2FHJA 1VK8A 1M0SA 2XTJP 1DGSA 3LL3A 4IR1A 2NYVA 5LSOA 1B0XA 5AXKA 1N34K 3IDHA 1LOUA 5SWMA 4JI7K 4PWWA 1AUSL 1ZJNA 3VEZA 1JN3A 3M32B 1YF5L 2WVCA 3H45C 5LSLA 3A8YA 3FZ2A 3OPXA 2FZGB 3G6ES 1BWEA 1CJKB 2KYXA 1JLGA 2C3MA 2KIVA 3CXCM 3EYZA 3A8JA 2IBOA 2N3OA 1WOQA 3HXMA 3C2LA 3U4LA 1ZQYA 2BKPA 1P8GA 3QERA 4AQYJ 2DGSA 2KVCA 2QB1A 4ECZA 3VWSA 2R7TA 2YJEA 2WONA 4PL8A 3CCUN 1RAHB 4NPOA 3QJLA 1X4HA 4OCZA 1YTYA 3ZZ0A 3LOUA 2CXEA 4KFBA 4JK8A 3OL8A 5KFDA 4JK9A 4WF9L 2B56A 5D46A 3VEYA 3JS9A 3QBWA 4GKKK 4JHDA 1U1MA 2IC3B 2V0NA 1WBDA 4O0JA 2FYXA 3NASA 1CSJA 3PYGA 2V8HA 5G5HA 1IKXA 9ICEA 4K4TA 2WF7A 3ZZRA 4E1MA 4G6VB 3MGHA 4B3SK 1HNZK 4KGMA 1HJRA 1YBTA 2D9OA 3LPYA 4IXCA 5KFJA 4RKUC 3NBPA 4V19J 4IOCL 2H3IA 4DCHA 2QGFB 2E5HA 2E4LA 2H5XA 4OPHA 3HKZF 1VQKN 3EVWA 1NK5A 1S1WA 1YK9A 1C0MA 1ZQOA 1R89A 2UXCJ 4DTPA 4GNIA 4YOYA 1R27B 2Z58B 1N88A 3NWGA 4USVA 1BE4A 4OYXA 4QW9A 3ENOA 1S10A 3EE3A 1RT4A 1LW2A 2QWNA 2GIRA 1OVQA 3F2BA 2KKPA 4Q45A 2B6GA 2WB1D 2VONA 1Z4NA 1SS6A 4DU8A 4ICLA 2DGUA 4YOEA 2A18A 4RQ4A 4ALZA 3PIPQ 5HATA 4X66F 2LSNA 4OJ6A 1SV5A 2RRAA 2IRUA 1FA0A 4OV6A 3A3PB 1A7GE 4OYBA 4BY9C 1YBAA 3MF5A 4JLHA 2EZYA 3POTA 3Q24A 2HOEA 2VWBA 3DLKA 2YNHA 4CRXA 2NPFA 3L7OA 2CQCA 4ZJQA 1GTHA 2OPRB 3U1NA 4M63A 4FSVA 1X42A 2YB4A 1NKBA 3GCXP 2E66A 2HCFA 3OPKA 4QIGA 4CCHA 3OYLA 5A0YB 2RE1A 3V4MA 2EWSA 4DV5J 5I42A 2R7SA 2HRUA 1X4CA 4BDPA 2X6SA 3T1AA 4LF2A 4RQ7A 4JI8K 4DPYA 1TE2A 3U3GA 3Q7CA 1RBVA 1VQ5S 3O80A 4DFKA 3BSNA 5AIAA 9ICIA 2XSFA 4ZJOA 1JCFA 2W6KA 3NGYA 2KG0A 5ALUA 4ZS6A 1IN0A 5J8YC 1ACMB 4ZP9A 2NRVA 3V2UC 2MU2A 2IJRA 2NV3A 3BEGB 3KLGB 4V1Ak 4FJ8A 1EIYB 1H2TZ 2W6LA 2F8SA 4KHPF 3HWTA 2R3VA 1RXVA 4M7YA 4DL3A 3RH5A 4UW9A 1NH7A 3H0RB 1NZ8A 2HI0A 4PXDA 1G7CB 2XCPA 2BOPA 1ZQKA 3W63A 1HWUA 2HG4A 4H0TB 2ZVSA 4LF9K 2LXFA 2R7UA 4ANDA 4ZLNA 4KH5A 3CERA 5A0LA 4FK2A 3BO3A 2RU9A 1JWWA 1GLEG 1AB8A 3FCHA 2M9NA 2AYMA 3QPIA 4FWMA 4QNLA 1RWVB 4G1IA 3JSRA 3R3LA 4JI4K 3W9IA 2P9UB 1U8WA 4IOXA 2DNHA 3IO1A 1UVIA 1T95A 2FZCB 4WP9A 1X4EA 2DY9A 5L1KA 4Z6EA 4CIGA 4UZBA 1WC4A 1RGIA 4Q2MA 1K5OA 3V9UA 4KLMA 3OFFA 3UR3C 1GXTA 3L2WA 2E7WA 4FYVB 2F1IA 1ZA1B 1A77A 1RP5A 4UB8U 2MQNA 4DCCA 3ZTRA 4C0OC 3V4IB 1WC1A 3RJMB 2N1RA 2GS8A 4JKGA 4K0KK 1VSEA 1ASVA 3NGRA 1ZQUA 2HB5A 2GAGC 4E7LA 2P9NB 3H5YA 2DNMA 3UDEA 5KG3A 4OX9J 5D3GB 1WAFA 5G4DA 3BPDA 3NEKA 4JYAJ 7AT1B 3D6RA 4MLEA 3LPUA 1YJTA 5HBMA 3OYHA 3VA3A 5D0HA 3CJ5A 3WKAA 2W24A 3DI6A 2ZXHA 4MMOA 3TFSA 3V9WA 1XMQK 1RT5A 3ZZOA 2GV1A 2A19A 2EI5A 1M5PC 1BDGA 1DTTB 4PG6A 3GU3A 2EC0A 1KHVA 3AAWB 3IBFB 4IO8A 4C7ZA 1V38A 2MY7A 2NXJA 4PHAA 4X65F 2VF3A 2YNHB 3CCVN 5J2BA 3Q2SC 4ETXA 1ZZNA 2BCRA 4F2SA 1CXQA 1ZBUA 1KP6A 5H2FU 3VCBA 4W4MA 4ZTFA 2DEIA 5A6PA 2VKQA 2R7RA 4Y2IA 1RT6B 2OSRA 2J0WA 3CIPA 1FDAA 4DFPA 4ZITA 1TR0A 2UXDK 2VB6A 4CO3A 4CLPA 4ILJA 2PBDA 4QWBA 5AQLA 4L8RB 4NLWA 1V3ZA 4OGEA 4ECTA 5GAGU 3JSYA 3BYPA 1WN7A 1CEZA 2EKNA 2DTUA 5DDRC 3F73A 2XMAA 1J2VA 3RBZA 3FCVA 3RSEA 1H7XA 4LFAK 4JKBA 2ZJPQ 5ALPA 1X8DA 3AA2A 1XERA 1RHUB 2O3DA 5JLFA 5BOLA 3AVMA 2XY6A 5HVGA 4CBXA 4AHSA 2YQEA 4ES1A 3QU9A 4RUCA 2EBGA 4WBFA 3RZAA 2PFPA 1W0HA 4Z6DA 3P49B 1YHQN 3A0HU 1JLGB 5KFIA 4C8OA 4RW8A 3HKZD 3QMLA 3ZDEA 3PEJA 1U2RA 4YMNA 3QQCD 4L3NA 2R18A 1RKJA 2GWJA 3G86A 4UT4A 4V19S 2UU9K 4KTQA 4H5WA 2J8SA 2QWMA 2A41A 3MXIA 4I2IA 2NS1B 1B4FA 3RJJA 4DV3K 4U9RA 3P5BP 1WI8A 2JJ4D 2GQCA 2QO3A 3FEYB 3ISDA 2E5JA 4MK7A 2XY8A 3NKYA 3QBXA 4OD0A 2WCXA 3FRZA 4OYAA 1RISA 4LRBA 4I2AA 9ICOA 5HJXA 1CZ9A 2V4JA 4KQZA 3O0FA 4MH8A 2F8KA 2RUGA 2VG6B 3CJ9A 1TL5A 4FKXA 1XN9A 4M95A 4TY9A 2EFNA 4NJ8A 1NHUA 3KLHB 3PSIA 2N3LA 2N7YA 5F0XA 1BY9A 1V3SA 3EUNA 2VA8A 2ZIUA 3AGRA 3BR9A 3M2RB 4M94A 5EX5A 4NXMF 2ZQBA 5J0TA 1R7IA 2A3VA 3T69A 3LDPA 1BOTO 2CQ2A 2PN6A 2AF6A 2XY5A 4ZP7A 1JXBA 9ICKA 3NGKA 5LT5A 2JC0A 3TW0A 5BR9A 4DL5A 2YKPA 5F8IA 2WHOA 3SXLA 5ALVA 1H38A 4Y34A 5DLGA 3D1OA 3GZ7A 5F41A 1YUWA 1HYSA 2E6LA 1TFWA 3HPHA 2MJNA 5ETQA 3CJQA 3E51A 4ZPTR 3MMAA 3MEEB 2CPZA 1G1XA 1HWKA 3CHWA 4OLAA 2W43A 4BGAA 5DGAA 2AH5A 1HI0P 2FPLA 1F9HA 3BS9A 3G25A 1UAXA 1REVB 2OSQA 4OI4A 1X40A 2PE8A 2Y1RI 1UPHA 4B9VA 1TKTA 3VOVA 3SNNA 3D2SA 4LBHA 5DRKA 4J9QA 1QAXA 2LXIA 4A59A 2CVEA 3TPQA 4BVOA 3CVKA 5HN0A 3JAMU 3SLCA 1X2IA 5J29A 4O0IA 4J9PA 2G9OA 2DGXA 1UQVA 2MKHA 4B02A 2RMLA 4JN4A 4M5KA 1RTJA 3D6HB 4ZCMA 1L7PA 4QZDA 2DEJA 3U9ZA 2QW9A 2CNNB 4H54A 2Y8YA 3P96A 3C29A 2VJVA 1HFEL 3KOAA 2YN4A 3E01A 2E9TA 2XLIA 3SPYA 4ISFA 3SQ2A 4CW7B 3R5BA 1EHWA 1OW5A 4LF9J 2OLWA 1SH3A 4M5NA 4FPAA 4DHYA 2CGJA 2KZMA 1C4AA 2ZWOA 3KLVA 1SV4A 2O8FB 4HWIA 4F4WA 2YY3A 1ZPVA 4DPOA 2LQJA 1JLCB 5A0YA 1MMLA 2ODGA 3NOGA 1VQLN 3IP0A 3C2MA 4CZEA 2VQEJ 1K0TA 1DLOA 4H0VB 2UXBJ 2YNGB 3X3UA 5HL7Q 3GWCA 3GTYX 2P51A 3AQFA 2DPIA 4CO5A 2LU1A 4LF4J 4BROA 2FHJD 3HHEA 1RCHA 1ZAWA 1ZPWX 3OGUA 2Q97A 3F9KA 4K0KJ 1FKPA 3U26A 5GMDA 1NB7A 2WVFA 4DV1F 3GIIA 2VG6A 2ZE2B 3QXGA 1BQNA 2VOOA 2QWOA 3CJRA 5J0UA 3DXKA 1U6FA 4HH1A 3JPTA 5KFZA 3M8WA 1LWXA 4RNFA 5KFQA 1YIJS 4WCEL 1HKGA 3NS7B 3HSJA 3QDKA 5AZJA 2ZH6A 4B17A 3NH1A 2ZJPL 4WIQA 3D6FB 2DR7A 2QA4S 1W2IA 2CQGA 1KCFA 2OTJN 2YBVA 1ZXIA 3RRGA 3VHQA 3RMAA 2NO4A 1O1WA 2WZ1A 5A6WA 1SJ4P 3RJFA 3RYLA 4NLDA 1RZTA 4QWDA 5T7LA 5JVGQ 2FPHX 3V81A 1E4FT 2KFYA 1GLJO 3AA4A 2P2CB 5I9EB 4A57A 4NLRA 4UASA 2E5IA 1VLBA 4EZ9A 2AEFA 2FGCA 2KTQA 4O44A 3E9OA 1HPMA 4BRNA 1IV8A 4KKOA 4NXMK 4QIEA 2L9DA 4OLPA 4CEEA 1YJ7A 3J81U 2BE2A 4JD2A 3AL0B 3HFVA 1OH7A 3H1QA 4C0HA 4CHPA 2KJWA 2QKKA 1VSMA 3OVSA 1UVMA 3JSMB 1XO0A 1UPPA 2CDQA 2ZWHA 3WDOA 3K59A 4UARA 3H0PA 1VQNN 4MFAA 1NK8A 2HS4A 3WEEA 1HLWA 2BJ8A 1F60B 4CO1A 1RNHA 4KH6A 5T41A 2KB2A 3W7BA 2ZTEA 4FWNA 1EETB 3NS5A 1ILYA 4DU7A 4HUEA 1TYQA 3LAKA 4GKKJ 3TUJC 3O4NA 2UU9F 2CH6A 3ZSQA 4Z7CA 4CLFA 2GJIA 4OJPA 3GR0A 3IWNC 1A9NB 2QSWA 3R3TA 4YVZA 1V5IB 1KLNA 1F44A 1PVRA 1B0TA 3MBYA 4LF1A 4RJVA 1HL6A 4UAWA 4QYZK 2YHXA 4DSIA 2C2OB 4X62J 2VQFJ 2XI3A 4WK1A 3I9V9 4BQZA 1NU4A 3RJHA 2W7AA 5EE1A 4KLTA 2MQ8A 4QR0A 1J6ZA 2GGPA 2W11A 1WSGA 1JXEA 1AT1B 4RW9B 1FTRA 1TZ0A 2FHKA 1W26A 1F21A 3HSGA 1N6QB 2JC1A 1HNZJ 2HVHA 1FRLA 1R6VA 4I2CA 3G4SN 1T3VA 1DEJA 4C6AA 3K5LA 7ICFA 4CEFA 7ICMA 3AB2B 2Z2YB 4L3KA 3CRXA 3IAS9 4YR0A 4I0WA 2LEPA 1RFQA 2XSJB 5AQRA 3UVJA 1U49A 4BC3A 4KN4A 4HACB 1JLCA 1BI4A 3BQ7A 3TJAA 1PZNA 2QWRA 3CTRA 2O8FA 3RR7A 5KFRA 2V9KA 4FYXB 4KAIA 4P2XA 4DV7F 1JJ4A 3B78A 4IO1A 4KGVB 5ALEA 2KSOB 1EQ0A 2FDNA 4HL9A 3NMAA 3OR1A 4H03B 1T6CA 4CJPA 2R2SA 2H5EA 3QEIA 2P9SA 3NWRA 4DR3F 3NCIA 3E01B 4YB7A 4DR2J 2ZXIA 4Y2KA 2CKWA 2HWIA 2HZVA 4NEYA 3MI7X 1K1QA 2ZUBA 4ZVQB 4USAA 2LHTA 2HDOA 1NOYA 5ALKA 4MO5A 4IH6A 5KAKA 1F5BA 3QNOA 2HQGA 4FJLA 4YDUA 3DLEB 1QS4A 2OYQA 5KFMA 2X3DA 3B6PA 3L7UA 2E6MA 4CJSA 3DN9A 4BS2A 3DLGB 4CF4A 4J90A 8ICRA 2KHVA 3D9BA 3UD5A 4BGDA 3LUYA 4R79A 4YXJA 1Y7PA 4QZAA 4JRQA 4CFAA 3KZBA 1D9DA 1X60A 5E5NA 4OZLA 3KNAA 2HHVA 1RT7B 4NA2A 3CE8A 3EDQB 2F96A 5FIIA 5CABA 2GUIA 4NY8A 2DITA 1NXIA 3MWTA 4LT6A 4B1WB 1Z3EB 4JKEA 4Q5VA 2D74B 2MQPA 4NASA 3H20A 3OLAA 4DV0J 3KBBA 2IVOA 1TL4A 3WK6A 3CJ8A 4YHHJ 2FBVA 2B4UA 2HF3A 1COKA 2X6NA 2RS8A 2CPHA 1HQUB 4GV3A 4R25A 4PJ0U 2RQCA 3QFPA 2ZIWB 3NAHA 3CJSA 4ZP8A 2WOMB 4N8NA 2LDYA 2JVOA 4FS2A 2BZFA 4QIWD 4D3GA 2J7UA 4I2HA 4FWPA 3U6FA 1Z1VA 4YOXA 4CYUB 1WKJA 3RGIA 2ZH3A 5ALTA 4RBTA 1B43A 2A10A 1WNEA 3ZYYX 3QFHA 4GLXA 2RP5A 1IO2A 4N7TA 3G82B 4KO0B 3F56A 3BV8A 3D7EO 1IJEB 4CJLA 4UOFA 3OSPA 2LECA 2HQCA 3I56N 1IJJA 4WCEQ 3KVGA 3KIOA 3VQ6A 3IV6A 4GXJA 1XSPA 2MZ1A 4NLBA 4RW6A 2E8AA 3CJ7A 5GADP 4ECWA 2AJFE 3KHRA 3H1VX 1FEZA 2XLJA 2AP1A 2IVPA 8ICWA 4Y2PA 2F44A 4LY7A 3GP9A 4ZVGA 1PGZA 4ZVRB 4OMFG 5MLCV 3GPAA 2I9SA 4CZMA 2GO7A 1JLAA 1FX2A 3SCIE 2DGOA 5E41A 2XMMA 1X0FA 4ZTJA 3OTBA 2KVSA 5DETA 4OHXA 4NLYA 2EW9A 2BH1A 2MKSA 5CZXA 3D28A 2J9CA 3ZETB 5HQLA 2M52A 1N5TA 2VA3A 3J81j 2GVDB 2VCPA 2M9KA 2FHMA 2EK6A 1TKZB 1CUKA 2IC3A 2LPEA 5AQOA 2K4IA 4KGZB 1NGJA 3JAMY 3ENAA 3AB4B 2V8VA 3ZDAA 1FD2A 2JMGA 1MA9B 1IWGA 3ZDCA 3QICA 4M7XA 3F9MA 2GHPA 2KRRA 1X0PA 2CRXA 2QMUB 4RUAA 4DV1K 1T7PA 2DGTA 3G6EN 4OIXA 3LDQA 3CJKA 4AHUA 3MURP 5KFPA 4PXCA 2E5LK 5KG6A 2XBPA 9ICUA 3CCES 3HT3A 3MXMA 3G8TA 3NRWA 1FFSB 2IA0A 4Y1DA 3ZSVA 4C0BA 4ZKAA 1I94F 1VQMN 2IM2A 3NGTA 3ELHA 1C0UA 4AL6A 1NNEA 2OMOA 4QQBA 1PJ7A 4H5TA 5JUMA 1Y3JA 4Z2XA 1LK7A 2KT2A 3DCAA 4DTRA 2J6UA 5E3AA 4PZNA 3G6YA 4IRKA 1N60A 1VC0A 2PFOA 3IFEA 1Q1KA 2ASMA 3WHIA 2V7ZA 2A1JA 4BUGA 4NLPA 4M3RA 4ES2A 4F7VA 3AXKA 3D45A 4KITB 4RQ1A 1C0TB 3PJWA 4Y0FA 3C15B 4B1UB 4RNOA 2C3PA 1RT5B 2EFVA 5HP1B 2E2QA 4KY3A 5CAAA 5DB7A 3I8DA 3G71N 4BE2A 2DR6A 3MM5A 1S4EA 3TAMA 2WVDA 4ENOA 3FFIB 4CH7A 5HP4A 4Y2TA 4U7UK 5EUHA 5KL8B 4KREA 2ZKUA 2FHOB 1K9MT 1X1PA 1TELA 1WSVA 2E44A 3DLLL 2VU5A 3D68A 4CJVA 3KLEA 2KXHA 1RLCL 1Q78A 4K4VA 3BYRA 1PYTA 3NVKA 1DJ0A 1QM9A 3D2FB 3IG1B 2BE7D 3WXMB 4RT3A 1RB0A 4X4UA 2A5XA 5FPDA 3H2UB 5J1NA 4FS1A 1CS4A 3W8GA 4HCBA 5BJRA 4ICAA 1U0HB 1SQFA 2ZKTA 3CDAA 1PVPA 4AILC 5DBCA 3AFGA 1CQNA 3TA0A 2D3OR 3UXPA 1KQFB 3LDLA 2QARA 5AK3A 2KE7A 1PBAA 3KD3A 4RWTA 3DRRA 4WQ4A 2DUYA 3WX8A 2MEWA 1ZQPA 3QEAZ 3D0PA 3N6LA 5ETKA 1ZQTA 3OHAA 4KC5A 5HMXA 3ONQA 1S1XB 3UWTA 2M8DB 4WIIA 4M41A 1KD1O 2BKNA 2HNZB 3RVCA 5K14B 2MKJA 1WG8A 3VF6A 2BJEA 3OBWA 3C94A 1U25A 1YAGA 3AODA 3S7RA 3H3OB 4P4MA 1VBZA 4RNMA 3KG1A 4DQPA 3K75D 3F2DA 3QINA 3RRKA 1CJUB 3EXYA 3MM9A 8AT1B 1TL1B 5EE3A 3FC4A 1SQKA 1WEYA 5CZ1A 4DN0A 5ADXH 4Q7AA 4N56A 1S1XA 1N5QA 2H4WB 1N33K 3QU2A 3HVWA 1WSIA 4UQTA 1FWPA 1N34J 3CW2C 3T5LA 3QT7A 3J81O 3MEDB 1K8KB 4Z4IA 4URSA 5DG7A 3R6LB 3KK2A 3MUMP 8ICVA 3IBCB 2UVVA 2KDOA 5HK4A 4P75A 1QUPA 3TAPA 1TL3B 2BVZA 3LQVA 3I9ZA 3MDAA 3OVAA 4RTFD 2C28A 1ZBFA 4USHA 2OPRA 1HW9A 3R5JB 1MWQA 3CCUS 5MLCQ 2DTJA 2NR0A 2IPOB 4O9MA 3HJVA 3OTCA 1IBCB 3JPQA 2AU0A 4O5EA 1NDCA 2HSEB 4XH5A 4Z4EA 1LKYB 5GTHU 3TYTA 3RBEA 3HVRA 4R65A 4A61A 2HAIA 3O6QA 1X4GA 4M5DB 1FESA 1XNSA 2QSFA 1Q8LA 3OFGA 3RJEA 2M0GB 2FY1A 3W60A 1XMOJ 2OELA 1ZQAA 2Q43A 4M2YA 1T05A 1RAAB 3MCMA 2BKEA 2GA7A 2GUPA 4XRHA 4ID1A 4DV0K 4OPKA 3SI8A 1UPMB 3I32A 2W41A 3P39A 3H8WA 2DXFA 2VWJA 3M30B 2HBJA 4J7CA 2FJAB 5DBBA 3RBXA 4KLFA 2O8EA 1JLQB 4X4TA 5C24A 1JKHA 1L8LA 3QU5A 1BA0A 3L9ZA 8ICLA 1T9VA 2FTRA 2U1AA 2ZM6J 1FT8A 1IBLK 3R5GA 1DGKN 1SZPA 1QY7A 1D4XA 4CTAB 5CY4A 5IIJA 2VQEF 4IFYB 5HROA 4IKAA 4NOHA 4O3SA 2V51B 8ICKA 4UAUA 2ZNZA 2HFSA 2HMXA 2R42A 5KFCA 1T9XA 1VDVA 4BRQA 3DRSB 1S6OA 5JMNA 5I3UA 1TFYA 5KFNA 3HZEA 5IQQA 4F3TA 1RU2A 1HQEA 2KM8B 2NQPA 2BCQA 2R8KA 2OJ3A 4UOHA 4M04A 3H5UA 1T9WA 4G1QB 3NGIA 2CH5A 1WELA 4NLQA 2DY1A 3P3DA 4PUOA 4IH5A 3CD6N 5SUHA 3P8BB 3SDEB 3WK8A 3SMVA 1J2NA 1JLEA 5DQIA 3DJCA 5J8YA 1X9XA 1H6KX 2P9PB 1FJ7A 2P9PA 2J7KA 1RJJA 3KUEA 4ZLLA 1VQ6N 2FUG9 3HHDA 8ICJA 4UY8T 1G99A 3HLUA 1IKYA 1FKAF 4DKWA 2M3DA 3QFWA 3MD3A 1CJKA 4FVCA 2JOQA 4YMMA 5KFVA 1MA7A 2ZFHA 2IHNA 3PYFA 3RB0A 3I82A 1E6YA 1JNRB 4Y28C 2EDUA 1KFTA 2GBZA 5DM7Q 3H98A 5AXNA 5BREA 2YQ1A 1WG1A 4E0DA 2PSZA 2V2KA 3LP0A 2NREA 5GAHU 1HR0J 1Q95G 1I3AA 1N2XA 3B8HA 4M3WA 1UW4A 1DOQA 5LJ5Y 4BACA 4ED0A 1NMEB 4DR3J 3H59A 4WZQA 3IR7B 2HHTA 1JKHB 1L3VA 1NZBA 2M88A 3UMBA 3D7SB 5ADZA 1FK9B 3FBCA 5AJ3K 3AVGA 3DKDA 1X3NA 2FJBB 5T7BA 2R7VA 1YJNN 4KIAA 2MB0B 2VKZG 1ZRNA 2HW3A 2VWKA 4QYRA 4KHNA 2QT7A 4KMUA 1D8LA 1QQ6A 1L5UA 4H4OA 5B0EA 1W7AA 4TLRA 4ED8A 3TWHA 4QOZB 3QEWA 5HJYA 2GX9A 2FVSA 3U3YA 7ICVA 1T11A 3MMBB 5E84A 1TV6B 4CK1A 2FVPA 2VBWA 3EJMA 2LCWA 2M5YA 4WF9Q 4I2FA 3C8YA 3L0QA 3M2VB 3OBIA 2R7WA 3LM9A 5AQWA 1S49A 2DNPA 3DXMA 2W4CA 4ZVTB 2JL9A 2ZTCA 1YRUA 4F3QA 3VQQA 5CE3A 2PC6A 3O2IA 2PT0A 3CXCR 3SUOA 3O3FA 4DZDA 4NE9C 2Q0UA 5LL6d 4IDHA 4DV6K 3SQ0A 3MCNA 8ICCA 4TLQA 1U09A 4LUBA 1NUEA 3BZQA 2KLAA 3CMEN 2YX6A 2M4MA 1BQMB 3ZT1A 3ETLA 4N41A 1VQNS 4KYZA 1N8RT 4HT5A 4OJ1A 1NPKA 1I94J 4CFCA 4LH4A 1ZQMA 5F9LA 4R64A 1FRKA 4DV6J 3LW5C