2F76X

Solution structure of the m-pmv wild type matrix protein (p10)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
100
structure length
100
Chain Sequence
b'MGQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Core protein p10
publication title D-retrovirus morphogenetic switch driven by the targeting signal accessibility to Tctex-1 of dynein.
pubmed doi rcsb
source organism Simian retrovirus 1
molecule tags Viral protein
total genus 30
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02337 Gag_p10 Retroviral GAG p10 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.490 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f76X00
2F76X 2F77X
chains in the Genus database with same CATH superfamily
9ICVA 4X5VA 2C22A 5C5JA 5KFEA 3OHAA 2JEGA 2F8LA 3VC8A 5DB8A 5ALJA 5F9LA 8ICAA 3LWLA 4C8OA 5HHHA 1S0MA 4R8UA 4QIWF 1JROA 4ED6A 2QLTA 4IQUA 4RPXA 1RPLA 4KMUA 2W04A 5HMLA 9ICJA 1FIQA 1HEKA 2MA1A 3K75D 2UVWA 5L1IA 5JU5A 5EE9A 2JZBB 2FLPA 2QB1A 3RB4A 2DKXA 1J2MA 3I28A 4YXMA 1L6NA 1D8YA 1TFRA 2ZIWA 1ZQOA 4KLGA 4EYHB 2LHTA 3MFIA 4JV1A 4OCZA 4RQ8A 3RAQA 1T7PA 5J0XA 3RH4A 3PO4A 3UPQA 5KFVA 9ICNA 4C0ZA 2G08A 5KFUA 5J2BA 4DSIA 4IQTA 4QZAA 3CW2C 3AN1A 2IHMA 1K1SA 5IIKA 5CR0A 5AKIA 4I2EA 4US9A 5ALNA 1SV4A 3LVWA 1TV9A 3MFHA 4UB8U 1NK7A 4MEYA 3AU2A 4F72A 3E2EA 4CF5A 1S8OA 2MUTA 3OJUA 1KFDA 1BNPA 2OHFA 3LYSA 3HP6A 5BOMA 5ALMA 2W9AA 3GV8B 7ICFA 4DLEA 2E3TA 1VJ5A 1N2XA 1UPHA 2AJQA 4EENA 3ZDCA 1IG6A 2R8JA 3ZD8A 3WK8A 4BDPA 3PX4A 1N62A 4UARA 2KKVA 1PUZA 3FYHA 4QWDA 1Q8KA 3ED5A 3K1RB 4YCXA 3RFAA 1Z3EB 4B9TA 3B0YA 5KFKA 5KFAA 3T5HA 4PL1A 4EX7A 1N48A 5DB7A 4Q43A 3NRZA 4B9VA 2LKYA 4CE6A 3ZDAA 4Z6CA 2KV2A 2PXIA 3I76A 4OD0A 1O03A 2M9NA 2J6TA 3RJEA 2W54A 3MDCA 4B9UA 3KKAC 4QZEA 5KFXA 4ECUA 4CNQA 4DL2A 2CRXA 2HSZA 4BWMA 4RUCA 4DF8A 2Y1IA 4UB4A 1KFSA 4BX9C 3OSNA 1NK6A 4JV2A 9ICRA 1QQ7A 4ECQA 4DOAA 4C7YA 2VA2A 3QX7A 2WF6A 2DUYA 5DDMA 2XO7A 2KHVA 3V7JA 1KEJA 2K60A 5KFQA 4RZRA 2JH7A 4LZGA 4B6JA 2GWSA 4ECYA 2HHUA 1NJXA 2EAMA 1IXRA 3GFKB 4RQ5A 3T5LA 3A0HU 2DF4B 3KHLA 2XVTA 2K89A 2BDUA 4K4GA 4Y2VA 1FFVA 5DLFA 7ICJA 1Z00A 5KG0A 2LMRA 3F2DA 3UXOA 1Q3UA 3KFUF 2KJ5A 2F76X 2YTUA 2DWQA 1HUZA 3VCBA 3EWAA 4C80A 3M7DA 4KLOA 2ZTEA 3PX0A 3LDAA 3AL0B 5AKKA 5KFBA 3NVYA 4EYIB 2W03A 5J2IA 4NJ8A 4OJOA 4NLZA 4RPYA 4F5RA 3MC1A 2W8KA 1S77D 2XY7A 5KFOA 3RH6A 3FC4A 2XGQA 3IM1A 1NK9A 2ESEA 2I1QA 2KICA 3UMBA 4KTQA 4RQNA 3BQTA 1ZQFA 3THVA 2KOBA 3V72A 4EELA 2WHEA 2ATLA 2KZMA 4J9OA 5CJ7A 7ICSA 4QWEA 3G6YA 1D8LA 5DKWA 1Y88A 2A19A 2YB4A 7ICHA 4PZOA 5J2CA 4J9PA 3WK5A 1BVSA 2F1HA 1NNLA 3BQ7A 4EBEA 1RYSA 5B5EU 4NLKA 1MQ3A 1KSPA 4CRXA 2JV3A 1SL0A 2WAQF 1S0VA 3RJFA 4BGDA 8ICGA 1N5XA 1L7OA 5DLGA 5AM0A 2ALZA 2H3QA 4KN4A 4F5OA 2F2AB 3QZ8A 1L3SA 2YMLA 5KG1A 2W43A 2UVUA 1ZQLA 2F1JA 3K1ZA 2BDPA 4PHDA 4KLEA 2ASDA 5C0YA 2BR0A 3RR8A 2A1AA 5AK3A 1NZPA 4KLHA 2IOHA 1JRPA 3OSPA 7ICVA 4EEYA 4FE3A 5DB6A 2FMPA 2IHNA 3TAPA 3WKDA 1GO3F 3QU7A 2W7PA 2D3DA 2E8OA 1C7YA 1T4GA 4PHPA 5DQIA 5KFNA 2LYHA 5IINA 5AM2A 2KZ3A 2VIXA 2LBOA 5DQGA 4QW9A 5KFCA 3ETLA 2ZJ5A 2BGWA 1L8LA 4RNNA 1ZQQA 1SKRA 2ZUBA 4OJPA 2BCSA 5KAFU 4B9MA 7ICLA 4I2FA 2DL0A 3L4PA 3N7RC 2G0AA 5KFRA 2NRZA 1JALA 5B66U 5GTIU 2H3ZA 5AI9A 4QZBA 4GC6A 1T94A 1URJA 5EE1A 3WU2U 4J9KA 1Z1BA 2EANA 1XU4A 1ZQBA 1X9MA 4F3OA 1JUDA 4OJ5A 4R8UB 2ZG6A 3OGUA 4UATA 3S6JA 8ICTA 5AIAA 9ICHA 4M6WA 2KJ8A 2CN1A 3RJIA 4ED2A 2DPJA 3Q8MA 4KLMA 3ZDDA 3T79A 4P0QA 5ALKA 4M2YA 3SD7A 2W3RA 4IRCA 4BXOA 2BCQA 1ZD4A 3FM9A 1NK0A 2ZIWB 4FZMA 1XO1A 1KKXA 8ICIA 3F2CA 2A1JA 4RT3A 4NL9C 2CPRA 3QUQA 5J0PA 2W9MA 2FLNA 2L5YA 9ICPA 2H5XA 2C2DA 4C8LA 2DKZA 2ES6A 3RRGA 4I2JA 1SV0A 8ICOA 4UB1A 2IMWP 3N7SC 1SIJA 4I2IA 3BZKA 5DBBA 1L7MA 2AXTU 4YR2A 4DFKA 1BNOA 2OH2A 1SL2A 5G5GA 3E58A 2I5HA 9ICTA 1QSLA 1JI7A 1NOMA 4P4PA 3MABA 2NYVA 1J2NA 4PZNA 3EW9A 2OCEA 1T8EA 2MUTB 2B0CA 2ISOA 8ICLA 3NVZA 3I1YA 5KFLA 2MAXA 1NKBA 3SI8A 3PSFA 4RQ3A 3SV4A 2A3VA 2P6UA 5D46A 2XC9A 4O3MA 4F71A 4KLTA 3L3FX 4TUQA 4ED7A 1ZQSA 1XSLA 4ELUA 1P7DA 4M0AA 2JMGA 3C5FA 1F5SA 3NTUA 2D6FC 3E0FA 1NJZA 1NKEA 4EZ9A 3A0BU 2KVSA 4QZGA 3KHHA 5EE0A 3BS5B 3H4DA 2HHXA 4YMNA 3GIIA 8ICMA 1X6JA 5HHIA 2Y0SC 4Z6DA 1OXJA 4DQIA 3QEAZ 1NI3A 4NLNA 3HRDD 3JPQA 2OYYA 2ZIVA 4GC7A 2I9GA 2K4HA 1SKSA 1ZQYA 3IG5A 3H0RB 3SAFA 4U7CA 2J6UA 1ZOLA 2FLLA 5ALHA 1F0MA 4MEXA 5AKJA 1X40A 5EWEA 4Y2TA 5D4BA 1X6IA 1PK3A 3AUOA 2Q0ZX 2DFLA 3L5KA 3UMGA 5KG5A 1N56A 4USAA 4DSJA 2ZIXA 2OEHA 5T14A 2HVIA 4GFJA 4NM1A 1COKA 2GO7A 3MDAA 3HJEA 3IDWA 1FFUA 4O3PA 5KFGA 5J2DA 4J03A 4ED3A 5KFYA 4QZDA 2DGZA 2F77X 1ZQKA 2KSOA 4R63A 3CP8A 1UCVA 2DBYA 5CRXA 3QYPA 4NLCA 3WKEA 4DL7A 1Z00B 3GQCA 2XIDA 4DOCA 1NK4A 3ZDEA 2EZXA 4O5KA 1ZRNA 4P2HA 1TK5A 2PFNA 3H8WA 3KHRA 3FAHA 3PO5A 2AQ0A 3UQ2A 3F2BA 1SZHA 4G3IA 4QWCA 5J29A 3SMVA 9ICEA 1S10A 1H38A 2XI9A 2G06A 3SYZA 3EPIA 4YD2A 1Z4NA 1WWVA 3PMNA 2QARA 4JK1A 2YQEA 3BJYA 9ICXA 3M9MB 5ALEA 5KFFA 1L7PA 7ICGA 9ICBA 1BPXA 3OTQA 1ZQPA 4DS5A 2NRVA 4K4HA 1PK1B 2FPKA 4C7ZA 2ZIUA 4TURA 2KEYA 3PR5B 2R8IA 3ZI4A 5KFMA 7ICQA 4Y2RA 2HBMA 3M6ZA 5J0SA 1SWVA 4C8NA 5DBAA 4KLQA 1UT8A 2W55A 2M0NA 3QU2A 1UHUA 2HOQA 1A0PA 2UVVA 1YT3A 4F5QA 4YMMA 3AQFA 4FZLA 5KT6A 1AQ6A 1KBUA 4RT2A 4JV0A 3KZXA 2FDRA 4J9RA 2CXYA 4QZHA 2KHQA 3H4BA 8ICHA 3V6KA 4O3QA 2IOFK 5CHGA 1WG8A 4JUZA 5AM4A 4O3SA 3JPPA 4ZH4A 2ZJAA 7ICTA 4DFDA 5J0UA 3F5EA 2HCFA 3H7IA 1D8BA 4MF8A 1UA1A 1WYGA 1LKYA 3MR2A 3H0LB 3TFSA 4TQSA 4J9NA 5AKGA 4Y2UA 3NVWA 5AI5A 8ICUA 2KFNA 2KP7A 3UQ0A 1DK3A 1QQ6A 1XC9A 3HX0A 4KX3A 1KRPA 1X42A 4OJLA 3UM9A 7ICUA 7ICIA 5KT4A 2WTFA 5ALOA 3ISDA 3WK4A 2K8BB 2LYAA 1WUDA 4YR0A 5H2FU 2P66A 2ASLA 3SAGA 2QB0A 5G5HA 2JEJA 1LB2B 3KTQA 4RQ7A 5KG3A 3QNMA 4HYKA 5KFJA 4I2GA 4LJXA 2HMXA 3IHQB 3G6VA 5ALPA 3N97B 2VA3A 3C2LA 4KLDA 3ISCA 4QW8A 5J2GA 4AP9A 3JPSA 5KL1B 3D6JA 1ZQEA 2BQUA 2A1JB 5A0LA 5DG9A 1MSWD 4DQSA 5F3XB 3DDHA 3D2SA 1DOQA 4BUGA 3RB0A 3HWTA 1RDFA 2ODGA 2W7OA 3MGHA 3GIJA 2PI4A 4DFMA 1NK8A 4DQRA 1KL9A 3SR6A 4QZFA 1JMSA 3TKAA 9ICKA 2QKQA 2YB1A 4DSFA 3PV8A 5ALTA 4KLUA 1S0OA 3RTVA 2JZBA 1DGJA 2EZZA 4RPZA 2F8KA 2HHVA 2VANA 4QWBA 5ALDA 3SV3A 2NRXA 2KVCA 8ICPA 4C4SA 4O5CA 1BPDA 2DPIA 4IR9A 4IRDA 3Q8RB 1KN5A 2Y0SF 3UXNA 5J8YA 2ZUDA 1KLNA 1L7NA 5HNKA 2IBKA 1NZBA 5EOZA 1L3TA 2JGAA 4Q8FA 5EWFA 5AKYA 4MFAA 5ALFA 8ICXA 4UBBA 1OW5A 5CB1A 2IA6A 3PW7A 2Z7JA 1X2IA 1N63A 3C28A 2RQ5A 9ICFA 3GV7B 2EZYA 2BZFA 1QQ5A 4Q8EA 4Y2YA 3IG8A 8ICRA 3MBYA 1SV0C 1ZRMA 5AK4A 2B6GA 2G07A 2BCUA 2NO5A 4NLGA 2HBJA 2ZIVB 9ICQA 1CEZA 5DDYA 4F5NA 4DSLA 7ICOA 4F4YA 4E0DA 1S97A 3QU5A 2LM4A 4C8KA 4P0PA 1ZQMA 2PFQA 4DO9A 2O6KA 1N5WA 5KT7A 3N7PD 5AI8A 3RB3A 5AK6A 4PGYA 2OXOA 8ICJA 1VDVA 4QZ8A 2XCAA 2G09A 5CWRA 2R8HA 2BQ3A 9ICUA 3Q8SB 4KLIA 1N61A 4F2SA 3WKAA 8ICKA 1DXSA 7ICMA 4M47A 1IIPA 2HHSA 3SZ2A 4I28A 4Y2JA 4PGQA 2KK0A 2PKEA 4UBCA 2YMPA 2HVHA 3PY8A 2KSOB 2KD1A 1A6SA 3IRUA 1JN3A 4PH5A 5AKEA 3M9OB 4FZNA 4PJ0U 1ECWA 1HJPA 5AM3A 4RQ4A 3AMZA 4QZ9A 2HHQA 5IIJA 2BPFA 3PX6A 3WK6A 3KD3A 9ICGA 4C8MA 4F8RA 4ECSA 2HOFA 2NO4A 3PMLA 1KFTA 3C2MA 1ZQIA 3BDPA 1RYUA 5DGBA 1CUKA 3QUCA 5ALZA 3PSIA 5KFDA 5J2EA 4HAIA 2FPLA 3CRXA 4UAYA 3GDXA 8ICCA 3GIMA 1RG6A 1V85A 4XRHA 4M9NA 4DQQA 1WCNA 3WKCA 4LZDA 4F4ZA 4KLLA 4UAVA 1DK2A 4YP3A 5J0TA 5KFTA 2EH9A 4R64A 1ED1A 1V38A 2E1EA 3J81j 3HW8A 4KLFA 5AICA 4XQ8A 5JUMA 3Q8KA 3U26A 3Q8QB 4O3OA 3AU6A 1ZQNA 1NJWA 4Q44A 3CNHA 2E5SA 2FI1A 4KLJA 3ALRA 2W9BA 2C2EA 2YMQA 2C2RA 8ICFA 2W11A 2MU2A 4UB5A 1T3QA 4DFJA 4O9MA 4B9SA 1ZYQA 4UB2A 8ICNA 4DSKA 2BKEA 3D2QA 4ED0A 1ZETA 5KG6A 4JWMA 4C4RA 5AI0A 1K1QA 5J2HA 4C4TA 3PW2A 3TANA 1HUOA 2AGQA 5ALWA 2OM6A 4IS7A 4NM2A 3TADA 3C2KA 3H8SA 3PNCA 2AGPA 3NGDA 1KW4A 3RH5A 3KBBA 1U49A 3JPTA 1XO0A 2JH1A 2JRZA 2HI0A 3C23A 2ZXIA 1C20A 9ICLA 4KLSA 3LK9A 1QTMA 2WF8A 1QLNA 5HP4A 2V4RA 3DEEA 5ALSA 1ZQCA 5KFHA 5HR6A 4YG2A 4FS2A 1L3VA 3RJKA 4JB3A 4ELTA 4QJFB 1RZTA 5J2KA 2JEIA 3RB6A 4WJ3B 4DS4A 3GILA 5J2JA 5BOLA 3ZDBA 3IN5A 5IIIA 4RU9A 4F4WA 4TUPA 1JX4A 8ICYA 3GU3A 2QB0B 1MQ2A 1V9PA 5KNIA 4I27A 4FBTA 2YX8A 5J0RA 4UAWA 5JRTA 2PFPA 2G5IB 3PR4A 5TISU 9ICSA 3C5GA 4GLXA 1DGSA 4EBDA 5KAIU 1SZPA 2BHNA 5IIOA 2F1IA 3HT3A 1RYRA 5D49A 1X9SA 4IR1A 5J0OA 3GIKA 4F4XA 4DF4A 5K4LA 4ELVA 2K4EA 1TK0A 4DLGA 3FDSA 4R66A 2E8MA 2EDUA 4NY8A 1SL1A 1RQLA 2GOLA 2D8CA 5AKZA 4I2DA 4DFPA 5AIBA 2WFAA 3OHBA 1TE2A 4IRKA 1D9DA 2HHTA 2P35A 1QSSA 3PSTA 1KTQA 3QU9A 3TACB 1QH9A 4ED1A 2KTQA 8ICBA 2PMZC 2Y1JA 2Q4TA 3JPNA 4QZIA 3ONNA 1BPBA 2VKQA 4YQWA 5DB9A 7ICNA 1XSPA 4M9LA 2RRDA 2ZXHA 3C21A 2E8NA 5IIMA 4ECWA 3EUB2 3AEVA 3TQ1A 4I2AA 4EBCA 5HMMA 1UA0A 4RNOA 1B22A 2LYBA 3EZ5A 1T3NA 4YD1A 5IILA 3QU4A 4AYBC 2GH1A 3N28A 2WB1C 4ECXA 2MSNA 2I6XA 5DQHA 3ISBA 4PL2A 2W9CA 2KNJA 2ZTDA 1RXVA 5BPCA 2HBKA 1SKWA 5J0QA 3HPOA 7ICPA 2BPGA 2VA8A 5AI4A 2J6SA 2BQRA 2KFZA 3M1YA 5DBCA 7ICKA 1B4FA 5KT2A 4OO1J 4G9BA 3C1ZA 1X66A 3MR5A 2R18A 1ZQWA 3MR6A 4FO6A 4UAUA 2UVRA 1EXNA 1TAMA 4PHAA 4CDGA 9ICAA 4GXKA 3PW5A 5KG2A 3M9NB 4GXIA 5TZVA 4ACOA 4J9QA 4F93B 4UW9A 1B0XA 1SXDA 4QWAA 1Z4OA 4JMUA 1BPEA 4P0PB 3RAXA 4XUSA 1A77A 3QUBA 3DV9A 5L1MA 2PI5A 3PZPA 2FE9A 4US8A 8ICWA 1S76D 1X9WA 2PFOA 5KFWA 1NJYA 1XSNA 4KN7A 4M04A 2AQ4A 2F3NA 2HHWA 3BS5A 5J8YC 3RR7A 3H40A 4Y2XA 1RM6C 5F9NA 3K4GA 4UB3A 3C1YA 5DG8A 1B43A 1KDHA 3GV5B 5KG7A 3OPXA 2NV3A 3RJHA 4YVZA 2DQNB 4M6WB 1ZQZA 4YN4A 3TAQA 1NK5A 2AH5A 1F44A 2K4PA 1BPYA 1TK8A 4DQPA 5DG7A 4P0QB 4YR3A 4BXOB 1N60A 9ICWA 2KG5A 3JPOA 2AGOA 2V9WA 5J0YA 4Q45A 3M8SA 2ZJ8A 1BPZA 3T5JA 3V6JA 3F53A 2KKPA 4KMOB 5ALLA 3Q8LA 4FBUA 4RQ1A 5CA7A 4A8EA 2EQYA 5ALQA 4RQ0A 1RQNA 2Y9UA 3RBDA 3ZD9A 5AKHA 2WF7A 3QUTA 2YMMA 5DGAA 2KZZA 3RRHA 4RUAA 8ICSA 1ZQXA 1FO4A 4DWIA 2ASJA 1Q3VA 3HKZC 4CF3A 4ECRA 5HR7A 3HILA 5ALYA 5JTIA 2JEFA 2R8KA 4CGZA 5KT5A 2WF5A 4JWNA 4Y2SA 4DSEA 2V4QA 4UASA 2JHDA 4J9LA 2W9BB 3QEBZ 1S0NA 8ICQA 1YZ7A 1TAQA 1L8OA 1PVPA 4ED8A 1WWUA 8ICEA 5KL8B 3WK9A 2P6RA 1COOA 3G6XA 5AKXA 2KIWA 2G5HB 3EYZA 2FJ6A 1ZQRA 1XS9D 1LV5A 4QIWC 4GIBA 1L5UA 4PPXA 5FP0A 2FMSA 1ZJNA 1XNSA 3D2NA 2LM1A 4B9NA 4CCHA 3KOOA 2ZUCA 4K4IA 1PK1A 3KKAA 2KIVA 4U6PA 1U47A 1HIWA 1Q46A 4LVSA 3ICXA 2K8AA 5GTHU 1NKCA 4MFFA 5AM1A 5KG4A 3BQ1A 2HOIA 2K8CB 4F91B 4R65A 3T3FA 2AU0A 5CP2A 3RJGA 5ALVA 1ZXIA 1TVAA 2ZTCA 2BCVA 1U48A 9ICCA 4DCCA 3SQIA 1JXLA 4UAZA 1AROP 4B9LA 3IP4B 5L1LA 4OJ6A 2H3IA 2OWOA 2JR5A 1ZQ1C 4DL4A 4O3NA 3SENA 4M9HA 4ECVA 4IC9A 4O3RA 3WKBA 1A76A 3BZCA 5J0WA 3TARA 1S9FA 1UT5A 4RQ2A 5KFZA 3RBEA 2KJ9A 4RQ6A 4KX5A 3M8RA 2XGPA 1IM4A 4MFCA 5KT3A 3C29A 1WCLA 5ALXA 4RNMA 1VLBA 2ZIXB 4ECTA 3B9JA 2NRWA 3KZIU 3O0FA 5J2AA 4NV0A 4PHEA 1ZQJA 1SWWA 3NS1A 2B21A 4TUSA 4DEZA 3BQ2A 3EPGA 3B0XA 2PMZF 4NXZA 1K5OA 5AI6A 4EX6A 4P4MA 2H3FA 1ZQGA 2EAOA 4Y2QA 2E1FA 2VJ4A 1PZNA 1ZQTA 3TADC 5EWGA 3F5AA 2F44A 1RXWA 2EAPA 3UXPA 1TAUA 1MN8A 3BS7A 2ISPA 9ICMA 4NWIA 5L9XA 1J97A 1ZQUA 1M6YA 4AYBF 3V7LA 2RHFA 2WF9A 4ZOHC 3AM9A 2MRLA 2WB1F 2BPCA 1ZQDA 2XCPA 1PVRA 9ICOA 2NRTA 1L3UA 5ALIA 3JPRA 4ICAA 2QARB 2FMQA 1ZQVA 4Z6EA 5ALUA 5EE3A 3MGIA 4DL6A 4M9JA 3OJSA 4UQGA 3PW4A 1IV8A 2W8LA 2W3SA 3NUQA 4YXJA 1ZQAA 5AHXA 1JIHA 2N1RA 2ZIUB 4Z6FA 4Y2PA 2KN7A 4CF4A 3QE9Y 4F5PA 2RLTA 4PGXA 3SAHA 1Z1VA 9ICIA 2IOFA 3GZFA 3M6KA 2W9CB 2R8GA 3H0MB 4F2RA 1V97A 1ZD5A 3H8JA 5AK5A 3RJJA 4IQVA 5ALGA 1SGGA 4ECZA 1U4BA 5KFPA 1CI4A 4QZCA 1ZD2P 1YZ6A 2YN4A 2YY6A 2GLEA 2K4IA 4TQRA 3NRWA 3PSPA 4KITB 3V6HA 3QZ7A 5KFIA 8ICVA 1S5LU 1X9XA 3NASA 2H3VA 4J9SA 1U45A 2FPMA 1O08A 2XY6A 2VJ5A 3MR3A 3LVVA 5AKLA 4I2HA 2JXJA 3RF9A 3WK7A 2LPEA 4M9GA 5L1KA 3ORYA 2HBLA 3QXGA 2E8PA 2KMDA 4BJQA 3LWMA 1UQVA 1Z19A 4O0IA 1U9LA 1D9FA 3Q8PB 4F92B 4DOBA 1LKYB 3SEIA 5KFSA 4RQMA 3KHGA 1MC8A 5CEHA 3T5KA 7ICEA 2XICA 8ICZA 3TI0A 2KE7A 1PVQA 1DRGA 4I29A 5ALRA 4NLBA 4F4KA 4QNLA 4UB6U 1OUQA 2AHOB 5L1JA 1ZD3A 3ETRA 2RP5A 2HW3A 4MHVA 4MF2A 4P4OA 2XY5A 2RDIA 4F50A 3H8MA 4EZ6A 3R9KA 7ICRA 5E79U 1CRXA 5KTQA 4I2BA 2RDJA 1FEZA 1BGXT 1XWLA 5AM5A 1LVHA 4DL3A 3UMCA 4O5EA 4YFKA 4XA5A 3PW0A 3N4MB 1SXEA 1MA7A 2LI6A 4EEKA 1QCKA 4NL9A 3IV6A 3MGVA 3TFRA 1TKDA 1KQQA 3HKZF 1ZQHA 2WAQC 4BWJA 4IL6U 4GXJA 4FFDA 2HDOA 4IQWA 1SB3C 4FS1A 3PVXA 3CYMA 2Y9TA 2BCRA 3V7KA 1QSYA 4J9MA 3BQ0A 1ZJMA 4I2CA 4YMOA 3AQEA 2C28A 1JXEA 3NVVA 4DL5A 5J2FA
chains in the Genus database with same CATH topology
3SAFA 3DEEA 2PMZF 4U7CA 2HOFA 3ONNA 1PVPA 2H3FA 2F8LA 2JGAA 2VJ5A 2VKQA 5KL8B 2HBMA 3LVVA 2E1FA 3VC8A 4FE3A 3M6ZA 5HR6A 2VJ4A 2KIWA 1UPHA 2G5HB 3F2DA 2RRDA 3RF9A 2ZXHA 1GO3F 3N7SC 1Q3UA 3KFUF 3F5AA 2HMXA 2W7PA 2KJ5A 3PSIA 2F76X 2M0NA 2Z7JA 2HBLA 4QJFB 2HOQA 4QIWC 3C28A 3VCBA 3CRXA 3M7DA 4WJ3B 4QIWF 1A0PA 2KKVA 4BJQA 1XNSA 2LYBA 3AL0B 3D2NA 1YT3A 2VIXA 3IG8A 4NWIA 5KL1B 1Z19A 2OH2A 3IN5A 2ZIXA 3OPXA 2NV3A 2LBOA 4AYBC 5T14A 3RFAA 2GH1A 3AQFA 2W03A 4GFJA 2W04A 2DQNB 4FZLA 4AYBF 4U6PA 2RHFA 4OJOA 2WB1C 1HIWA 4OJPA 1HEKA 2MA1A 3GU3A 3ICXA 4PL1A 5A0LA 1KBUA 2G07A 2K8AA 2MRLA 2G0AA 2WB1F 2XICA 3KZXA 3N7RC 4PL2A 1F44A 1PVQA 2HBJA 1DRGA 1ED1A 2KNJA 2ZIVB 2H3ZA 2LKYA 2HBKA 2HOIA 2DGZA 2KICA 2K8CB 2KHQA 2E1EA 2F77X 2KV2A 4NLBA 4QNLA 2YX8A 1PVRA 4P0QB 3D2SA 1L6NA 4BUGA 2G5IB 3CP8A 1OUQA 5CRXA 1T94A 1URJA 2ZIWA 4ICAA 4NLCA 2W7OA 2H3VA 2RP5A 2KOBA 5C0YA 3PSFA 1Z1BA 2A3VA 2XIDA 2LHTA 4P0PA 3F5EA 3SQIA 2DF4B 1CRXA 3IP4B 2CRXA 4O3MA 3N7PD 3NUQA 2E5SA 1D8BA 2BDUA 3ALRA 4OJ5A 4OO1J 2OXOA 3F53A 2ZG6A 3L3FX 4OJ6A 3F2BA 1SZHA 2KKPA 2H3IA 4KMOB 2N1RA 2R18A 2G09A 4BX9C 1P7DA 2YB4A 2JMGA 3H0LB 2ZIUB 1ZQ1C 3SMVA 4A8EA 2KJ8A 2CN1A 2YB1A 2D6FC 1MA7A 3E0FA 2XI9A 2G06A 4C0ZA 1TAMA 2G08A 4IC9A 1IIPA 2K4EA 4CDGA 3SAHA 3T79A 4P0QA 3MGVA 3D2QA 4KX3A 1Q3VA 3HKZC 3M6KA 3GZFA 4OJLA 2KVCA 3H0MB 4ACOA 2KHVA 3HKZF 2KJ9A 2WAQC 4KX5A 4CRXA 2KD1A 5HR7A 2GOLA 1A6SA 3CYMA 2WAQF 2Y0SC 2ZIWB 4FZMA 2JH7A 4FZNA 2OM6A 4CGZA 4JMUA 2K8BB 2Y0SF 1ECWA 2H3QA 3C29A 2LYAA 2F2AB 1WUDA 2ZIXB 3F2CA 3PSTA 4P0PB 3LVWA 2CPRA 2JHDA 2K4IA 3NRWA 3SAGA 3AQEA 3O0FA 3PSPA 4NV0A 1XO0A 2JH1A 2OYYA 3K1ZA 2ZIUA 2ZXIA 2ZIVA 3PZPA 2K4HA 2PMZC 3LYSA 2Q4TA 2KEYA 1NZBA 2XVTA 2K89A 3IG5A 3H0RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F76 X;  2F77 X; 
#chains in the Genus database with same CATH topology
 9ICV A;  4X5V A;  2C22 A;  5C5J A;  5KFE A;  3OHA A;  2JEG A;  2F8L A;  3VC8 A;  5DB8 A;  5ALJ A;  5F9L A;  8ICA A;  3LWL A;  4C8O A;  5HHH A;  1S0M A;  4R8U A;  4QIW F;  1JRO A;  4ED6 A;  2QLT A;  4IQU A;  4RPX A;  1RPL A;  4KMU A;  2W04 A;  5HML A;  9ICJ A;  1FIQ A;  1HEK A;  2MA1 A;  3K75 D;  2UVW A;  5L1I A;  5JU5 A;  5EE9 A;  2JZB B;  2FLP A;  2QB1 A;  3RB4 A;  2DKX A;  1J2M A;  3I28 A;  4YXM A;  1L6N A;  1D8Y A;  1TFR A;  2ZIW A;  1ZQO A;  4KLG A;  4EYH B;  2LHT A;  3MFI A;  4JV1 A;  4OCZ A;  4RQ8 A;  3RAQ A;  1T7P A;  5J0X A;  3RH4 A;  3PO4 A;  3UPQ A;  5KFV A;  9ICN A;  4C0Z A;  2G08 A;  5KFU A;  5J2B A;  4DSI A;  4IQT A;  4QZA A;  3CW2 C;  3AN1 A;  2IHM A;  1K1S A;  5IIK A;  5CR0 A;  5AKI A;  4I2E A;  4US9 A;  5ALN A;  1SV4 A;  3LVW A;  1TV9 A;  3MFH A;  4UB8 U;  1NK7 A;  4MEY A;  3AU2 A;  4F72 A;  3E2E A;  4CF5 A;  1S8O A;  2MUT A;  3OJU A;  1KFD A;  1BNP A;  2OHF A;  3LYS A;  3HP6 A;  5BOM A;  5ALM A;  2W9A A;  3GV8 B;  7ICF A;  4DLE A;  2E3T A;  1VJ5 A;  1N2X A;  1UPH A;  2AJQ A;  4EEN A;  3ZDC A;  1IG6 A;  2R8J A;  3ZD8 A;  3WK8 A;  4BDP A;  3PX4 A;  1N62 A;  4UAR A;  2KKV A;  1PUZ A;  3FYH A;  4QWD A;  1Q8K A;  3ED5 A;  3K1R B;  4YCX A;  3RFA A;  1Z3E B;  4B9T A;  3B0Y A;  5KFK A;  5KFA A;  3T5H A;  4PL1 A;  4EX7 A;  1N48 A;  5DB7 A;  4Q43 A;  3NRZ A;  4B9V A;  2LKY A;  4CE6 A;  3ZDA A;  4Z6C A;  2KV2 A;  2PXI A;  3I76 A;  4OD0 A;  1O03 A;  2M9N A;  2J6T A;  3RJE A;  2W54 A;  3MDC A;  4B9U A;  3KKA C;  4QZE A;  5KFX A;  4ECU A;  4CNQ A;  4DL2 A;  2CRX A;  2HSZ A;  4BWM A;  4RUC A;  4DF8 A;  2Y1I A;  4UB4 A;  1KFS A;  4BX9 C;  3OSN A;  1NK6 A;  4JV2 A;  9ICR A;  1QQ7 A;  4ECQ A;  4DOA A;  4C7Y A;  2VA2 A;  3QX7 A;  2WF6 A;  2DUY A;  5DDM A;  2XO7 A;  2KHV A;  3V7J A;  1KEJ A;  2K60 A;  5KFQ A;  4RZR A;  2JH7 A;  4LZG A;  4B6J A;  2GWS A;  4ECY A;  2HHU A;  1NJX A;  2EAM A;  1IXR A;  3GFK B;  4RQ5 A;  3T5L A;  3A0H U;  2DF4 B;  3KHL A;  2XVT A;  2K89 A;  2BDU A;  4K4G A;  4Y2V A;  1FFV A;  5DLF A;  7ICJ A;  1Z00 A;  5KG0 A;  2LMR A;  3F2D A;  3UXO A;  1Q3U A;  3KFU F;  2KJ5 A;  2F76 X;  2YTU A;  2DWQ A;  1HUZ A;  3VCB A;  3EWA A;  4C80 A;  3M7D A;  4KLO A;  2ZTE A;  3PX0 A;  3LDA A;  3AL0 B;  5AKK A;  5KFB A;  3NVY A;  4EYI B;  2W03 A;  5J2I A;  4NJ8 A;  4OJO A;  4NLZ A;  4RPY A;  4F5R A;  3MC1 A;  2W8K A;  1S77 D;  2XY7 A;  5KFO A;  3RH6 A;  3FC4 A;  2XGQ A;  3IM1 A;  1NK9 A;  2ESE A;  2I1Q A;  2KIC A;  3UMB A;  4KTQ A;  4RQN A;  3BQT A;  1ZQF A;  3THV A;  2KOB A;  3V72 A;  4EEL A;  2WHE A;  2ATL A;  2KZM A;  4J9O A;  5CJ7 A;  7ICS A;  4QWE A;  3G6Y A;  1D8L A;  5DKW A;  1Y88 A;  2A19 A;  2YB4 A;  7ICH A;  4PZO A;  5J2C A;  4J9P A;  3WK5 A;  1BVS A;  2F1H A;  1NNL A;  3BQ7 A;  4EBE A;  1RYS A;  5B5E U;  4NLK A;  1MQ3 A;  1KSP A;  4CRX A;  2JV3 A;  1SL0 A;  2WAQ F;  1S0V A;  3RJF A;  4BGD A;  8ICG A;  1N5X A;  1L7O A;  5DLG A;  5AM0 A;  2ALZ A;  2H3Q A;  4KN4 A;  4F5O A;  2F2A B;  3QZ8 A;  1L3S A;  2YML A;  5KG1 A;  2W43 A;  2UVU A;  1ZQL A;  2F1J A;  3K1Z A;  2BDP A;  4PHD A;  4KLE A;  2ASD A;  5C0Y A;  2BR0 A;  3RR8 A;  2A1A A;  5AK3 A;  1NZP A;  4KLH A;  2IOH A;  1JRP A;  3OSP A;  7ICV A;  4EEY A;  4FE3 A;  5DB6 A;  2FMP A;  2IHN A;  3TAP A;  3WKD A;  1GO3 F;  3QU7 A;  2W7P A;  2D3D A;  2E8O A;  1C7Y A;  1T4G A;  4PHP A;  5DQI A;  5KFN A;  2LYH A;  5IIN A;  5AM2 A;  2KZ3 A;  2VIX A;  2LBO A;  5DQG A;  4QW9 A;  5KFC A;  3ETL A;  2ZJ5 A;  2BGW A;  1L8L A;  4RNN A;  1ZQQ A;  1SKR A;  2ZUB A;  4OJP A;  2BCS A;  5KAF U;  4B9M A;  7ICL A;  4I2F A;  2DL0 A;  3L4P A;  3N7R C;  2G0A A;  5KFR A;  2NRZ A;  1JAL A;  5B66 U;  5GTI U;  2H3Z A;  5AI9 A;  4QZB A;  4GC6 A;  1T94 A;  1URJ A;  5EE1 A;  3WU2 U;  4J9K A;  1Z1B A;  2EAN A;  1XU4 A;  1ZQB A;  1X9M A;  4F3O A;  1JUD A;  4OJ5 A;  4R8U B;  2ZG6 A;  3OGU A;  4UAT A;  3S6J A;  8ICT A;  5AIA A;  9ICH A;  4M6W A;  2KJ8 A;  2CN1 A;  3RJI A;  4ED2 A;  2DPJ A;  3Q8M A;  4KLM A;  3ZDD A;  3T79 A;  4P0Q A;  5ALK A;  4M2Y A;  3SD7 A;  2W3R A;  4IRC A;  4BXO A;  2BCQ A;  1ZD4 A;  3FM9 A;  1NK0 A;  2ZIW B;  4FZM A;  1XO1 A;  1KKX A;  8ICI A;  3F2C A;  2A1J A;  4RT3 A;  4NL9 C;  2CPR A;  3QUQ A;  5J0P A;  2W9M A;  2FLN A;  2L5Y A;  9ICP A;  2H5X A;  2C2D A;  4C8L A;  2DKZ A;  2ES6 A;  3RRG A;  4I2J A;  1SV0 A;  8ICO A;  4UB1 A;  2IMW P;  3N7S C;  1SIJ A;  4I2I A;  3BZK A;  5DBB A;  1L7M A;  2AXT U;  4YR2 A;  4DFK A;  1BNO A;  2OH2 A;  1SL2 A;  5G5G A;  3E58 A;  2I5H A;  9ICT A;  1QSL A;  1JI7 A;  1NOM A;  4P4P A;  3MAB A;  2NYV A;  1J2N A;  4PZN A;  3EW9 A;  2OCE A;  1T8E A;  2MUT B;  2B0C A;  2ISO A;  8ICL A;  3NVZ A;  3I1Y A;  5KFL A;  2MAX A;  1NKB A;  3SI8 A;  3PSF A;  4RQ3 A;  3SV4 A;  2A3V A;  2P6U A;  5D46 A;  2XC9 A;  4O3M A;  4F71 A;  4KLT A;  3L3F X;  4TUQ A;  4ED7 A;  1ZQS A;  1XSL A;  4ELU A;  1P7D A;  4M0A A;  2JMG A;  3C5F A;  1F5S A;  3NTU A;  2D6F C;  3E0F A;  1NJZ A;  1NKE A;  4EZ9 A;  3A0B U;  2KVS A;  4QZG A;  3KHH A;  5EE0 A;  3BS5 B;  3H4D A;  2HHX A;  4YMN A;  3GII A;  8ICM A;  1X6J A;  5HHI A;  2Y0S C;  4Z6D A;  1OXJ A;  4DQI A;  3QEA Z;  1NI3 A;  4NLN A;  3HRD D;  3JPQ A;  2OYY A;  2ZIV A;  4GC7 A;  2I9G A;  2K4H A;  1SKS A;  1ZQY A;  3IG5 A;  3H0R B;  3SAF A;  4U7C A;  2J6U A;  1ZOL A;  2FLL A;  5ALH A;  1F0M A;  4MEX A;  5AKJ A;  1X40 A;  5EWE A;  4Y2T A;  5D4B A;  1X6I A;  1PK3 A;  3AUO A;  2Q0Z X;  2DFL A;  3L5K A;  3UMG A;  5KG5 A;  1N56 A;  4USA A;  4DSJ A;  2ZIX A;  2OEH A;  5T14 A;  2HVI A;  4GFJ A;  4NM1 A;  1COK A;  2GO7 A;  3MDA A;  3HJE A;  3IDW A;  1FFU A;  4O3P A;  5KFG A;  5J2D A;  4J03 A;  4ED3 A;  5KFY A;  4QZD A;  2DGZ A;  2F77 X;  1ZQK A;  2KSO A;  4R63 A;  3CP8 A;  1UCV A;  2DBY A;  5CRX A;  3QYP A;  4NLC A;  3WKE A;  4DL7 A;  1Z00 B;  3GQC A;  2XID A;  4DOC A;  1NK4 A;  3ZDE A;  2EZX A;  4O5K A;  1ZRN A;  4P2H A;  1TK5 A;  2PFN A;  3H8W A;  3KHR A;  3FAH A;  3PO5 A;  2AQ0 A;  3UQ2 A;  3F2B A;  1SZH A;  4G3I A;  4QWC A;  5J29 A;  3SMV A;  9ICE A;  1S10 A;  1H38 A;  2XI9 A;  2G06 A;  3SYZ A;  3EPI A;  4YD2 A;  1Z4N A;  1WWV A;  3PMN A;  2QAR A;  4JK1 A;  2YQE A;  3BJY A;  9ICX A;  3M9M B;  5ALE A;  5KFF A;  1L7P A;  7ICG A;  9ICB A;  1BPX A;  3OTQ A;  1ZQP A;  4DS5 A;  2NRV A;  4K4H A;  1PK1 B;  2FPK A;  4C7Z A;  2ZIU A;  4TUR A;  2KEY A;  3PR5 B;  2R8I A;  3ZI4 A;  5KFM A;  7ICQ A;  4Y2R A;  2HBM A;  3M6Z A;  5J0S A;  1SWV A;  4C8N A;  5DBA A;  4KLQ A;  1UT8 A;  2W55 A;  2M0N A;  3QU2 A;  1UHU A;  2HOQ A;  1A0P A;  2UVV A;  1YT3 A;  4F5Q A;  4YMM A;  3AQF A;  4FZL A;  5KT6 A;  1AQ6 A;  1KBU A;  4RT2 A;  4JV0 A;  3KZX A;  2FDR A;  4J9R A;  2CXY A;  4QZH A;  2KHQ A;  3H4B A;  8ICH A;  3V6K A;  4O3Q A;  2IOF K;  5CHG A;  1WG8 A;  4JUZ A;  5AM4 A;  4O3S A;  3JPP A;  4ZH4 A;  2ZJA A;  7ICT A;  4DFD A;  5J0U A;  3F5E A;  2HCF A;  3H7I A;  1D8B A;  4MF8 A;  1UA1 A;  1WYG A;  1LKY A;  3MR2 A;  3H0L B;  3TFS A;  4TQS A;  4J9N A;  5AKG A;  4Y2U A;  3NVW A;  5AI5 A;  8ICU A;  2KFN A;  2KP7 A;  3UQ0 A;  1DK3 A;  1QQ6 A;  1XC9 A;  3HX0 A;  4KX3 A;  1KRP A;  1X42 A;  4OJL A;  3UM9 A;  7ICU A;  7ICI A;  5KT4 A;  2WTF A;  5ALO A;  3ISD A;  3WK4 A;  2K8B B;  2LYA A;  1WUD A;  4YR0 A;  5H2F U;  2P66 A;  2ASL A;  3SAG A;  2QB0 A;  5G5H A;  2JEJ A;  1LB2 B;  3KTQ A;  4RQ7 A;  5KG3 A;  3QNM A;  4HYK A;  5KFJ A;  4I2G A;  4LJX A;  2HMX A;  3IHQ B;  3G6V A;  5ALP A;  3N97 B;  2VA3 A;  3C2L A;  4KLD A;  3ISC A;  4QW8 A;  5J2G A;  4AP9 A;  3JPS A;  5KL1 B;  3D6J A;  1ZQE A;  2BQU A;  2A1J B;  5A0L A;  5DG9 A;  1MSW D;  4DQS A;  5F3X B;  3DDH A;  3D2S A;  1DOQ A;  4BUG A;  3RB0 A;  3HWT A;  1RDF A;  2ODG A;  2W7O A;  3MGH A;  3GIJ A;  2PI4 A;  4DFM A;  1NK8 A;  4DQR A;  1KL9 A;  3SR6 A;  4QZF A;  1JMS A;  3TKA A;  9ICK A;  2QKQ A;  2YB1 A;  4DSF A;  3PV8 A;  5ALT A;  4KLU A;  1S0O A;  3RTV A;  2JZB A;  1DGJ A;  2EZZ A;  4RPZ A;  2F8K A;  2HHV A;  2VAN A;  4QWB A;  5ALD A;  3SV3 A;  2NRX A;  2KVC A;  8ICP A;  4C4S A;  4O5C A;  1BPD A;  2DPI A;  4IR9 A;  4IRD A;  3Q8R B;  1KN5 A;  2Y0S F;  3UXN A;  5J8Y A;  2ZUD A;  1KLN A;  1L7N A;  5HNK A;  2IBK A;  1NZB A;  5EOZ A;  1L3T A;  2JGA A;  4Q8F A;  5EWF A;  5AKY A;  4MFA A;  5ALF A;  8ICX A;  4UBB A;  1OW5 A;  5CB1 A;  2IA6 A;  3PW7 A;  2Z7J A;  1X2I A;  1N63 A;  3C28 A;  2RQ5 A;  9ICF A;  3GV7 B;  2EZY A;  2BZF A;  1QQ5 A;  4Q8E A;  4Y2Y A;  3IG8 A;  8ICR A;  3MBY A;  1SV0 C;  1ZRM A;  5AK4 A;  2B6G A;  2G07 A;  2BCU A;  2NO5 A;  4NLG A;  2HBJ A;  2ZIV B;  9ICQ A;  1CEZ A;  5DDY A;  4F5N A;  4DSL A;  7ICO A;  4F4Y A;  4E0D A;  1S97 A;  3QU5 A;  2LM4 A;  4C8K A;  4P0P A;  1ZQM A;  2PFQ A;  4DO9 A;  2O6K A;  1N5W A;  5KT7 A;  3N7P D;  5AI8 A;  3RB3 A;  5AK6 A;  4PGY A;  2OXO A;  8ICJ A;  1VDV A;  4QZ8 A;  2XCA A;  2G09 A;  5CWR A;  2R8H A;  2BQ3 A;  9ICU A;  3Q8S B;  4KLI A;  1N61 A;  4F2S A;  3WKA A;  8ICK A;  1DXS A;  7ICM A;  4M47 A;  1IIP A;  2HHS A;  3SZ2 A;  4I28 A;  4Y2J A;  4PGQ A;  2KK0 A;  2PKE A;  4UBC A;  2YMP A;  2HVH A;  3PY8 A;  2KSO B;  2KD1 A;  1A6S A;  3IRU A;  1JN3 A;  4PH5 A;  5AKE A;  3M9O B;  4FZN A;  4PJ0 U;  1ECW A;  1HJP A;  5AM3 A;  4RQ4 A;  3AMZ A;  4QZ9 A;  2HHQ A;  5IIJ A;  2BPF A;  3PX6 A;  3WK6 A;  3KD3 A;  9ICG A;  4C8M A;  4F8R A;  4ECS A;  2HOF A;  2NO4 A;  3PML A;  1KFT A;  3C2M A;  1ZQI A;  3BDP A;  1RYU A;  5DGB A;  1CUK A;  3QUC A;  5ALZ A;  3PSI A;  5KFD A;  5J2E A;  4HAI A;  2FPL A;  3CRX A;  4UAY A;  3GDX A;  8ICC A;  3GIM A;  1RG6 A;  1V85 A;  4XRH A;  4M9N A;  4DQQ A;  1WCN A;  3WKC A;  4LZD A;  4F4Z A;  4KLL A;  4UAV A;  1DK2 A;  4YP3 A;  5J0T A;  5KFT A;  2EH9 A;  4R64 A;  1ED1 A;  1V38 A;  2E1E A;  3J81 j;  3HW8 A;  4KLF A;  5AIC A;  4XQ8 A;  5JUM A;  3Q8K A;  3U26 A;  3Q8Q B;  4O3O A;  3AU6 A;  1ZQN A;  1NJW A;  4Q44 A;  3CNH A;  2E5S A;  2FI1 A;  4KLJ A;  3ALR A;  2W9B A;  2C2E A;  2YMQ A;  2C2R A;  8ICF A;  2W11 A;  2MU2 A;  4UB5 A;  1T3Q A;  4DFJ A;  4O9M A;  4B9S A;  1ZYQ A;  4UB2 A;  8ICN A;  4DSK A;  2BKE A;  3D2Q A;  4ED0 A;  1ZET A;  5KG6 A;  4JWM A;  4C4R A;  5AI0 A;  1K1Q A;  5J2H A;  4C4T A;  3PW2 A;  3TAN A;  1HUO A;  2AGQ A;  5ALW A;  2OM6 A;  4IS7 A;  4NM2 A;  3TAD A;  3C2K A;  3H8S A;  3PNC A;  2AGP A;  3NGD A;  1KW4 A;  3RH5 A;  3KBB A;  1U49 A;  3JPT A;  1XO0 A;  2JH1 A;  2JRZ A;  2HI0 A;  3C23 A;  2ZXI A;  1C20 A;  9ICL A;  4KLS A;  3LK9 A;  1QTM A;  2WF8 A;  1QLN A;  5HP4 A;  2V4R A;  3DEE A;  5ALS A;  1ZQC A;  5KFH A;  5HR6 A;  4YG2 A;  4FS2 A;  1L3V A;  3RJK A;  4JB3 A;  4ELT A;  4QJF B;  1RZT A;  5J2K A;  2JEI A;  3RB6 A;  4WJ3 B;  4DS4 A;  3GIL A;  5J2J A;  5BOL A;  3ZDB A;  3IN5 A;  5III A;  4RU9 A;  4F4W A;  4TUP A;  1JX4 A;  8ICY A;  3GU3 A;  2QB0 B;  1MQ2 A;  1V9P A;  5KNI A;  4I27 A;  4FBT A;  2YX8 A;  5J0R A;  4UAW A;  5JRT A;  2PFP A;  2G5I B;  3PR4 A;  5TIS U;  9ICS A;  3C5G A;  4GLX A;  1DGS A;  4EBD A;  5KAI U;  1SZP A;  2BHN A;  5IIO A;  2F1I A;  3HT3 A;  1RYR A;  5D49 A;  1X9S A;  4IR1 A;  5J0O A;  3GIK A;  4F4X A;  4DF4 A;  5K4L A;  4ELV A;  2K4E A;  1TK0 A;  4DLG A;  3FDS A;  4R66 A;  2E8M A;  2EDU A;  4NY8 A;  1SL1 A;  1RQL A;  2GOL A;  2D8C A;  5AKZ A;  4I2D A;  4DFP A;  5AIB A;  2WFA A;  3OHB A;  1TE2 A;  4IRK A;  1D9D A;  2HHT A;  2P35 A;  1QSS A;  3PST A;  1KTQ A;  3QU9 A;  3TAC B;  1QH9 A;  4ED1 A;  2KTQ A;  8ICB A;  2PMZ C;  2Y1J A;  2Q4T A;  3JPN A;  4QZI A;  3ONN A;  1BPB A;  2VKQ A;  4YQW A;  5DB9 A;  7ICN A;  1XSP A;  4M9L A;  2RRD A;  2ZXH A;  3C21 A;  2E8N A;  5IIM A;  4ECW A;  3EUB 2;  3AEV A;  3TQ1 A;  4I2A A;  4EBC A;  5HMM A;  1UA0 A;  4RNO A;  1B22 A;  2LYB A;  3EZ5 A;  1T3N A;  4YD1 A;  5IIL A;  3QU4 A;  4AYB C;  2GH1 A;  3N28 A;  2WB1 C;  4ECX A;  2MSN A;  2I6X A;  5DQH A;  3ISB A;  4PL2 A;  2W9C A;  2KNJ A;  2ZTD A;  1RXV A;  5BPC A;  2HBK A;  1SKW A;  5J0Q A;  3HPO A;  7ICP A;  2BPG A;  2VA8 A;  5AI4 A;  2J6S A;  2BQR A;  2KFZ A;  3M1Y A;  5DBC A;  7ICK A;  1B4F A;  5KT2 A;  4OO1 J;  4G9B A;  3C1Z A;  1X66 A;  3MR5 A;  2R18 A;  1ZQW A;  3MR6 A;  4FO6 A;  4UAU A;  2UVR A;  1EXN A;  1TAM A;  4PHA A;  4CDG A;  9ICA A;  4GXK A;  3PW5 A;  5KG2 A;  3M9N B;  4GXI A;  5TZV A;  4ACO A;  4J9Q A;  4F93 B;  4UW9 A;  1B0X A;  1SXD A;  4QWA A;  1Z4O A;  4JMU A;  1BPE A;  4P0P B;  3RAX A;  4XUS A;  1A77 A;  3QUB A;  3DV9 A;  5L1M A;  2PI5 A;  3PZP A;  2FE9 A;  4US8 A;  8ICW A;  1S76 D;  1X9W A;  2PFO A;  5KFW A;  1NJY A;  1XSN A;  4KN7 A;  4M04 A;  2AQ4 A;  2F3N A;  2HHW A;  3BS5 A;  5J8Y C;  3RR7 A;  3H40 A;  4Y2X A;  1RM6 C;  5F9N A;  3K4G A;  4UB3 A;  3C1Y A;  5DG8 A;  1B43 A;  1KDH A;  3GV5 B;  5KG7 A;  3OPX A;  2NV3 A;  3RJH A;  4YVZ A;  2DQN B;  4M6W B;  1ZQZ A;  4YN4 A;  3TAQ A;  1NK5 A;  2AH5 A;  1F44 A;  2K4P A;  1BPY A;  1TK8 A;  4DQP A;  5DG7 A;  4P0Q B;  4YR3 A;  4BXO B;  1N60 A;  9ICW A;  2KG5 A;  3JPO A;  2AGO A;  2V9W A;  5J0Y A;  4Q45 A;  3M8S A;  2ZJ8 A;  1BPZ A;  3T5J A;  3V6J A;  3F53 A;  2KKP A;  4KMO B;  5ALL A;  3Q8L A;  4FBU A;  4RQ1 A;  5CA7 A;  4A8E A;  2EQY A;  5ALQ A;  4RQ0 A;  1RQN A;  2Y9U A;  3RBD A;  3ZD9 A;  5AKH A;  2WF7 A;  3QUT A;  2YMM A;  5DGA A;  2KZZ A;  3RRH A;  4RUA A;  8ICS A;  1ZQX A;  1FO4 A;  4DWI A;  2ASJ A;  1Q3V A;  3HKZ C;  4CF3 A;  4ECR A;  5HR7 A;  3HIL A;  5ALY A;  5JTI A;  2JEF A;  2R8K A;  4CGZ A;  5KT5 A;  2WF5 A;  4JWN A;  4Y2S A;  4DSE A;  2V4Q A;  4UAS A;  2JHD A;  4J9L A;  2W9B B;  3QEB Z;  1S0N A;  8ICQ A;  1YZ7 A;  1TAQ A;  1L8O A;  1PVP A;  4ED8 A;  1WWU A;  8ICE A;  5KL8 B;  3WK9 A;  2P6R A;  1COO A;  3G6X A;  5AKX A;  2KIW A;  2G5H B;  3EYZ A;  2FJ6 A;  1ZQR A;  1XS9 D;  1LV5 A;  4QIW C;  4GIB A;  1L5U A;  4PPX A;  5FP0 A;  2FMS A;  1ZJN A;  1XNS A;  3D2N A;  2LM1 A;  4B9N A;  4CCH A;  3KOO A;  2ZUC A;  4K4I A;  1PK1 A;  3KKA A;  2KIV A;  4U6P A;  1U47 A;  1HIW A;  1Q46 A;  4LVS A;  3ICX A;  2K8A A;  5GTH U;  1NKC A;  4MFF A;  5AM1 A;  5KG4 A;  3BQ1 A;  2HOI A;  2K8C B;  4F91 B;  4R65 A;  3T3F A;  2AU0 A;  5CP2 A;  3RJG A;  5ALV A;  1ZXI A;  1TVA A;  2ZTC A;  2BCV A;  1U48 A;  9ICC A;  4DCC A;  3SQI A;  1JXL A;  4UAZ A;  1ARO P;  4B9L A;  3IP4 B;  5L1L A;  4OJ6 A;  2H3I A;  2OWO A;  2JR5 A;  1ZQ1 C;  4DL4 A;  4O3N A;  3SEN A;  4M9H A;  4ECV A;  4IC9 A;  4O3R A;  3WKB A;  1A76 A;  3BZC A;  5J0W A;  3TAR A;  1S9F A;  1UT5 A;  4RQ2 A;  5KFZ A;  3RBE A;  2KJ9 A;  4RQ6 A;  4KX5 A;  3M8R A;  2XGP A;  1IM4 A;  4MFC A;  5KT3 A;  3C29 A;  1WCL A;  5ALX A;  4RNM A;  1VLB A;  2ZIX B;  4ECT A;  3B9J A;  2NRW A;  3KZI U;  3O0F A;  5J2A A;  4NV0 A;  4PHE A;  1ZQJ A;  1SWW A;  3NS1 A;  2B21 A;  4TUS A;  4DEZ A;  3BQ2 A;  3EPG A;  3B0X A;  2PMZ F;  4NXZ A;  1K5O A;  5AI6 A;  4EX6 A;  4P4M A;  2H3F A;  1ZQG A;  2EAO A;  4Y2Q A;  2E1F A;  2VJ4 A;  1PZN A;  1ZQT A;  3TAD C;  5EWG A;  3F5A A;  2F44 A;  1RXW A;  2EAP A;  3UXP A;  1TAU A;  1MN8 A;  3BS7 A;  2ISP A;  9ICM A;  4NWI A;  5L9X A;  1J97 A;  1ZQU A;  1M6Y A;  4AYB F;  3V7L A;  2RHF A;  2WF9 A;  4ZOH C;  3AM9 A;  2MRL A;  2WB1 F;  2BPC A;  1ZQD A;  2XCP A;  1PVR A;  9ICO A;  2NRT A;  1L3U A;  5ALI A;  3JPR A;  4ICA A;  2QAR B;  2FMQ A;  1ZQV A;  4Z6E A;  5ALU A;  5EE3 A;  3MGI A;  4DL6 A;  4M9J A;  3OJS A;  4UQG A;  3PW4 A;  1IV8 A;  2W8L A;  2W3S A;  3NUQ A;  4YXJ A;  1ZQA A;  5AHX A;  1JIH A;  2N1R A;  2ZIU B;  4Z6F A;  4Y2P A;  2KN7 A;  4CF4 A;  3QE9 Y;  4F5P A;  2RLT A;  4PGX A;  3SAH A;  1Z1V A;  9ICI A;  2IOF A;  3GZF A;  3M6K A;  2W9C B;  2R8G A;  3H0M B;  4F2R A;  1V97 A;  1ZD5 A;  3H8J A;  5AK5 A;  3RJJ A;  4IQV A;  5ALG A;  1SGG A;  4ECZ A;  1U4B A;  5KFP A;  1CI4 A;  4QZC A;  1ZD2 P;  1YZ6 A;  2YN4 A;  2YY6 A;  2GLE A;  2K4I A;  4TQR A;  3NRW A;  3PSP A;  4KIT B;  3V6H A;  3QZ7 A;  5KFI A;  8ICV A;  1S5L U;  1X9X A;  3NAS A;  2H3V A;  4J9S A;  1U45 A;  2FPM A;  1O08 A;  2XY6 A;  2VJ5 A;  3MR3 A;  3LVV A;  5AKL A;  4I2H A;  2JXJ A;  3RF9 A;  3WK7 A;  2LPE A;  4M9G A;  5L1K A;  3ORY A;  2HBL A;  3QXG A;  2E8P A;  2KMD A;  4BJQ A;  3LWM A;  1UQV A;  1Z19 A;  4O0I A;  1U9L A;  1D9F A;  3Q8P B;  4F92 B;  4DOB A;  1LKY B;  3SEI A;  5KFS A;  4RQM A;  3KHG A;  1MC8 A;  5CEH A;  3T5K A;  7ICE A;  2XIC A;  8ICZ A;  3TI0 A;  2KE7 A;  1PVQ A;  1DRG A;  4I29 A;  5ALR A;  4NLB A;  4F4K A;  4QNL A;  4UB6 U;  1OUQ A;  2AHO B;  5L1J A;  1ZD3 A;  3ETR A;  2RP5 A;  2HW3 A;  4MHV A;  4MF2 A;  4P4O A;  2XY5 A;  2RDI A;  4F50 A;  3H8M A;  4EZ6 A;  3R9K A;  7ICR A;  5E79 U;  1CRX A;  5KTQ A;  4I2B A;  2RDJ A;  1FEZ A;  1BGX T;  1XWL A;  5AM5 A;  1LVH A;  4DL3 A;  3UMC A;  4O5E A;  4YFK A;  4XA5 A;  3PW0 A;  3N4M B;  1SXE A;  1MA7 A;  2LI6 A;  4EEK A;  1QCK A;  4NL9 A;  3IV6 A;  3MGV A;  3TFR A;  1TKD A;  1KQQ A;  3HKZ F;  1ZQH A;  2WAQ C;  4BWJ A;  4IL6 U;  4GXJ A;  4FFD A;  2HDO A;  4IQW A;  1SB3 C;  4FS1 A;  3PVX A;  3CYM A;  2Y9T A;  2BCR A;  3V7K A;  1QSY A;  4J9M A;  3BQ0 A;  1ZJM A;  4I2C A;  4YMO A;  3AQE A;  2C28 A;  1JXE A;  3NVV A;  4DL5 A;  5J2F A; 
#chains in the Genus database with same CATH homology
 3SAF A;  3DEE A;  2PMZ F;  4U7C A;  2HOF A;  3ONN A;  1PVP A;  2H3F A;  2F8L A;  2JGA A;  2VJ5 A;  2VKQ A;  5KL8 B;  2HBM A;  3LVV A;  2E1F A;  3VC8 A;  4FE3 A;  3M6Z A;  5HR6 A;  2VJ4 A;  2KIW A;  1UPH A;  2G5H B;  3F2D A;  2RRD A;  3RF9 A;  2ZXH A;  1GO3 F;  3N7S C;  1Q3U A;  3KFU F;  3F5A A;  2HMX A;  2W7P A;  2KJ5 A;  3PSI A;  2F76 X;  2M0N A;  2Z7J A;  2HBL A;  4QJF B;  2HOQ A;  4QIW C;  3C28 A;  3VCB A;  3CRX A;  3M7D A;  4WJ3 B;  4QIW F;  1A0P A;  2KKV A;  4BJQ A;  1XNS A;  2LYB A;  3AL0 B;  3D2N A;  1YT3 A;  2VIX A;  3IG8 A;  4NWI A;  5KL1 B;  1Z19 A;  2OH2 A;  3IN5 A;  2ZIX A;  3OPX A;  2NV3 A;  2LBO A;  4AYB C;  5T14 A;  3RFA A;  2GH1 A;  3AQF A;  2W03 A;  4GFJ A;  2W04 A;  2DQN B;  4FZL A;  4AYB F;  4U6P A;  2RHF A;  4OJO A;  2WB1 C;  1HIW A;  4OJP A;  1HEK A;  2MA1 A;  3GU3 A;  3ICX A;  4PL1 A;  5A0L A;  1KBU A;  2G07 A;  2K8A A;  2MRL A;  2G0A A;  2WB1 F;  2XIC A;  3KZX A;  3N7R C;  4PL2 A;  1F44 A;  1PVQ A;  2HBJ A;  1DRG A;  1ED1 A;  2KNJ A;  2ZIV B;  2H3Z A;  2LKY A;  2HBK A;  2HOI A;  2DGZ A;  2KIC A;  2K8C B;  2KHQ A;  2E1E A;  2F77 X;  2KV2 A;  4NLB A;  4QNL A;  2YX8 A;  1PVR A;  4P0Q B;  3D2S A;  1L6N A;  4BUG A;  2G5I B;  3CP8 A;  1OUQ A;  5CRX A;  1T94 A;  1URJ A;  2ZIW A;  4ICA A;  4NLC A;  2W7O A;  2H3V A;  2RP5 A;  2KOB A;  5C0Y A;  3PSF A;  1Z1B A;  2A3V A;  2XID A;  2LHT A;  4P0P A;  3F5E A;  3SQI A;  2DF4 B;  1CRX A;  3IP4 B;  2CRX A;  4O3M A;  3N7P D;  3NUQ A;  2E5S A;  1D8B A;  2BDU A;  3ALR A;  4OJ5 A;  4OO1 J;  2OXO A;  3F53 A;  2ZG6 A;  3L3F X;  4OJ6 A;  3F2B A;  1SZH A;  2KKP A;  2H3I A;  4KMO B;  2N1R A;  2R18 A;  2G09 A;  4BX9 C;  1P7D A;  2YB4 A;  2JMG A;  3H0L B;  2ZIU B;  1ZQ1 C;  3SMV A;  4A8E A;  2KJ8 A;  2CN1 A;  2YB1 A;  2D6F C;  1MA7 A;  3E0F A;  2XI9 A;  2G06 A;  4C0Z A;  1TAM A;  2G08 A;  4IC9 A;  1IIP A;  2K4E A;  4CDG A;  3SAH A;  3T79 A;  4P0Q A;  3MGV A;  3D2Q A;  4KX3 A;  1Q3V A;  3HKZ C;  3M6K A;  3GZF A;  4OJL A;  2KVC A;  3H0M B;  4ACO A;  2KHV A;  3HKZ F;  2KJ9 A;  2WAQ C;  4KX5 A;  4CRX A;  2KD1 A;  5HR7 A;  2GOL A;  1A6S A;  3CYM A;  2WAQ F;  2Y0S C;  2ZIW B;  4FZM A;  2JH7 A;  4FZN A;  2OM6 A;  4CGZ A;  4JMU A;  2K8B B;  2Y0S F;  1ECW A;  2H3Q A;  3C29 A;  2LYA A;  2F2A B;  1WUD A;  2ZIX B;  3F2C A;  3PST A;  4P0P B;  3LVW A;  2CPR A;  2JHD A;  2K4I A;  3NRW A;  3SAG A;  3AQE A;  3O0F A;  3PSP A;  4NV0 A;  1XO0 A;  2JH1 A;  2OYY A;  3K1Z A;  2ZIU A;  2ZXI A;  2ZIV A;  3PZP A;  2K4H A;  2PMZ C;  3LYS A;  2Q4T A;  2KEY A;  1NZB A;  2XVT A;  2K89 A;  3IG5 A;  3H0R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...