2F76X

Solution structure of the m-pmv wild type matrix protein (p10)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
100
structure length
100
Chain Sequence
MGQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Core protein p10
publication title D-retrovirus morphogenetic switch driven by the targeting signal accessibility to Tctex-1 of dynein.
pubmed doi rcsb
source organism Simian retrovirus 1
molecule tags Viral protein
total genus 30
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02337 Gag_p10 Retroviral GAG p10 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.490 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f76X00
2F77X 2F76X
chains in the Genus database with same CATH superfamily
4F4ZA 4QZGA 4ACOA 3QUBA 2BQ3A 5AI0A 4J9OA 3KZIU 3C2LA 3MGIA 1U45A 2ASDA 1ZQRA 4BX9C 3PX6A 7ICKA 1D8BA 5AKKA 3RH4A 3RTVA 2PKEA 3ZDAA 1T3QA 3S6JA 3NGDA 1U4BA 2W9CA 3THVA 8ICBA 2E5SA 5KFEA 2FLLA 3LWMA 2WHEA 4IR1A 4I2EA 4I2FA 3VCBA 1FFVA 4PGXA 2W9BA 4YR2A 4PHEA 9ICTA 4RUAA 1PK3A 4BXOA 4C8KA 9ICPA 3H7IA 2A1JB 3WK9A 4QW9A 3TADC 3H0MB 1V9PA 3TQ1A 1D8YA 1ZQYA 4ELTA 1S9FA 2WAQC 3IG5A 2BKEA 5HMMA 1L7NA 1TK0A 1UCVA 5CB1A 1ZQCA 9ICOA 2HOIA 2EZZA 2YMMA 2F76X 4YG2A 2PI4A 4YQWA 2PFPA 9ICVA 2QB0A 1JX4A 2YTUA 2OYYA 3F2BA 3MFHA 2G5HB 4DFDA 1ZQVA 3GIMA 4F92B 1JI7A 2KSOB 1URJA 4MF2A 3B9JA 4KN4A 5DB9A 3RJHA 4B9VA 5ALFA 4RZRA 3ALRA 5AI5A 1KFTA 2KMDA 1UHUA 3C21A 5ALSA 4ICAA 1OXJA 2H3ZA 3K1RB 5KG1A 2OEHA 5KFHA 3FDSA 5AIAA 5KFQA 1Y88A 4DO9A 2F1IA 2YMLA 1ZQGA 4M9HA 3ZD9A 3RJFA 2CXYA 2KIWA 2D6FC 2W04A 4DQQA 1PVRA 5KFMA 5J0WA 4ZH4A 5D4BA 5F9LA 5BOLA 2PMZF 1PVPA 1Q3VA 4UASA 1SWWA 7ICLA 1DGSA 1L7OA 4YMNA 4F4WA 3E2EA 2JR5A 5ALQA 4KLGA 2F77X 5DDYA 1XWLA 3L4PA 3WKBA 2BPFA 2H3IA 2JXJA 3KKAC 4RQMA 3KHHA 4PL2A 1TVAA 3PO5A 4YN4A 2MA1A 4DL2A 4OJPA 3H8JA 1L7MA 3KKAA 3UMBA 2ZUDA 5CA7A 2AQ0A 3BS5B 2MAXA 2UVRA 2H3FA 4Z6FA 3C1ZA 5DB8A 4M04A 3PMLA 4J9MA 3HX0A 4F50A 1ZQSA 1B43A 3NVVA 4FBTA 1IIPA 4LZGA 2JH7A 4ECZA 4IL6U 1QQ5A 2XGPA 2RRDA 4X5VA 2ZUCA 5GTIU 4Y2RA 2DPJA 1ZD3A 5ALXA 1YZ7A 2KV2A 2EANA 3UXPA 1SV4A 3RH5A 1XSPA 4J9QA 3RRGA 2ES6A 2P66A 2BDUA 4FBUA 5G5HA 4DF8A 2ZIWA 2LM1A 3QUCA 2LYAA 2ZJ5A 1LKYB 2CPRA 3WKEA 1XO1A 2F3NA 2FE9A 4QZEA 4ED7A 4G3IA 1COOA 2MSNA 1ZQLA 4DL5A 1LV5A 2CRXA 4YMOA 2FMSA 1ZQDA 4Y2QA 2K8BB 2BCUA 4KLLA 3MR2A 2WF6A 1Q3UA 2KFZA 5J2KA 2FPMA 4DSLA 5L1KA 2WFAA 2NV3A 3RR7A 1QH9A 1RDFA 3OJUA 2UVWA 5CEHA 2G07A 1QTMA 2A3VA 2ODGA 2BR0A 5EE9A 4GLXA 4DF4A 5CP2A 4K4IA 5KT4A 5KFPA 5J2IA 3QEBZ 3UMCA 9ICUA 5AM3A 4DFPA 4QZ8A 5ALPA 3GFKB 1JUDA 3C23A 5DQHA 3D2SA 2NO4A 3M9NB 5T14A 4B9NA 4R66A 3TAQA 2IOHA 1B4FA 9ICLA 1NK9A 4C80A 3A0HU 2XY5A 4MFCA 3GZFA 2PXIA 2K4EA 2YB1A 5IILA 4QIWC 3RB0A 9ICXA 2JEJA 4RQ0A 9ICSA 3PO4A 5KT7A 1RG6A 4CF5A 5EE3A 3R9KA 3SI8A 1KFDA 1S0MA 3JPRA 1NK6A 4AYBF 2KN7A 2YX8A 3LDAA 2KJ5A 5J0RA 3SR6A 3PR4A 3M7DA 2W55A 1HJPA 3N7PD 2A1JA 5J2EA 4PPXA 1UT5A 3OSPA 1DRGA 1V38A 4EELA 4DWIA 2G5IB 1PVQA 5DB6A 5KG3A 4C7ZA 3M6KA 2IA6A 1ZD5A 8ICOA 1JRPA 3QUTA 1Z1BA 5D46A 3GV8B 2HI0A 2KZZA 2EAPA 1C20A 3CW2C 5TZVA 2K89A 4O3OA 2P6RA 7ICPA 5ALKA 3ZDCA 3ED5A 2G09A 5B66U 2AU0A 2BGWA 4JWNA 3GIIA 3V72A 1ED1A 4NJ8A 2LHTA 2KZ3A 2W11A 5KFCA 9ICHA 5AKYA 4C7YA 2KSOA 5AHXA 2F8KA 4USAA 1SZHA 5ALHA 5ALLA 1XC9A 2KTQA 2I1QA 3PX0A 5EE1A 2AQ4A 3V7LA 2WB1C 2WF8A 5L1IA 5DLFA 3BZKA 4KX5A 3FM9A 2KG5A 4J9KA 1SIJA 3B0YA 2FDRA 4RNNA 5DDMA 2A19A 9ICBA 7ICSA 2I6XA 4UB1A 2Q4TA 5J0OA 2MRLA 5AKIA 4JK1A 3T5JA 5KL1B 2IOFK 3SV3A 2KFNA 4HAIA 3UM9A 3ZI4A 4NLCA 2EAOA 2XCPA 1SXEA 3IHQB 1X6IA 3WKCA 1HEKA 5AM4A 4JWMA 1ZQQA 4FS1A 5KG2A 4PHPA 3UQ2A 1L8OA 3JPPA 3AN1A 5KFVA 5AKHA 2YN4A 4RUCA 1NKBA 5D49A 1PUZA 1ZETA 4DLEA 2G06A 4JMUA 2OHFA 3BS5A 5IIMA 3A0BU 2HBMA 3ORYA 5HP4A 4P4MA 1UQVA 2XCAA 3AU6A 2WF7A 4UW9A 2Y0SF 2IHNA 4B9TA 3HW8A 2ZG6A 5ALYA 1VLBA 4KMOB 4P0QB 2VA8A 3T3FA 4CE6A 4KLHA 2H3QA 1QLNA 2BCVA 1MC8A 4F93B 4O3PA 1SZPA 2DKXA 5J0QA 3GV7B 1X9WA 4QWBA 1GO3F 2AJQA 1SKRA 1U48A 2ASJA 1SV0C 3RRHA 3ISBA 4RPYA 3H40A 4NWIA 1LKYA 1NOMA 4AP9A 4DSKA 1BPDA 1SV0A 5KT3A 1UA1A 4F5QA 2ZTEA 4DOBA 3T5HA 3D6JA 2KJ9A 4EZ9A 3Q8SB 2DFLA 5AK3A 5KG6A 3JPOA 7ICFA 2WF5A 1ZQKA 4QZIA 2HBKA 3F53A 3L5KA 5JRTA 1ZQWA 4KMUA 3NVWA 2EAMA 4I27A 9ICEA 4YFKA 1N56A 8ICIA 2JEIA 8ICUA 2AGOA 4Y2XA 1ZQOA 4Z6EA 4Y2TA 2KOBA 4U7CA 1X9XA 3V7KA 3SAGA 1XO0A 3G6XA 7ICVA 5J2JA 2OCEA 4P4PA 4NM2A 1TAMA 2GOLA 4UARA 2ESEA 3WKAA 1BNPA 9ICCA 3DEEA 3TKAA 4TQRA 3H8SA 1Z19A 3HWTA 4NL9C 1DK2A 4FFDA 5GTHU 3FC4A 4UAZA 5KFDA 2A1AA 4NL9A 3PX4A 4Q8FA 4O9MA 4KLMA 2FMPA 4DSJA 5AI8A 4E0DA 4IRCA 3C1YA 1TK5A 2HHTA 2C2EA 2UVUA 5KFUA 2L5YA 2HDOA 4RQ5A 1TV9A 1ZXIA 2G0AA 3HKZF 4G9BA 3JPQA 1T94A 1BNOA 5J2DA 2XO7A 4F4XA 3NRWA 3RF9A 1NJYA 3D2NA 3NVZA 4I2DA 5KG5A 3EYZA 3J81j 2HBLA 4ECSA 2MUTB 1ZD2P 3LWLA 3PSFA 4O3SA 1PK1B 4Y2VA 1T4GA 4EX6A 2YMQA 2DKZA 1ZQZA 5H2FU 3SQIA 5E79U 1K1QA 4M0AA 3OPXA 4YCXA 4EENA 1KQQA 2IBKA 2LYBA 3QZ8A 8ICEA 4Q45A 3F2DA 3AMZA 1ZQBA 2KNJA 1Z4NA 1L3SA 4ED6A 3IV6A 4C4SA 4RU9A 2ISPA 5G5GA 1MQ2A 5KG0A 5J8YC 3C28A 4IC9A 4BGDA 2PI5A 1UPHA 5J29A 2N1RA 5DQIA 2D8CA 3TACB 2W9AA 2E8OA 4QZFA 2HHXA 2QARB 2EZXA 2KD1A 2B0CA 2EH9A 5J8YA 4O5KA 3SAHA 4DQIA 4O3RA 1B0XA 3SZ2A 2E8MA 4QWCA 2DGZA 1JMSA 3PSIA 8ICZA 1ZRNA 4M2YA 2E8NA 2YY6A 5ALGA 4J9PA 1NK7A 1T8EA 5L9XA 4R63A 4F71A 3TANA 1Z00B 1SXDA 1QCKA 4M6WB 3SD7A 3EZ5A 2WAQF 1ZQEA 4ED0A 2FPKA 2JH1A 5KFTA 1NK5A 4ED2A 1N62A 4Q44A 4FO6A 2W3SA 3TFRA 4UAYA 3NVYA 9ICRA 5HR6A 5KFOA 2F2AB 4YD2A 2R8HA 2PMZC 3HRDD 2W8LA 3QU7A 3N97B 1KL9A 4YP3A 4IQUA 4Q8EA 1NNLA 1SWVA 3IN5A 2D3DA 4EYHB 3FYHA 3HT3A 5JU5A 1AQ6A 3ETLA 1ZQJA 3RB3A 2BCRA 1ECWA 8ICSA 4R8UB 1FIQA 4P0QA 3TFSA 5KFWA 2W43A 8ICYA 4Y2PA 5KFKA 1WWUA 3MR3A 5CHGA 4ECVA 1NZPA 4ECQA 4F5RA 5AM5A 4UB8U 1L5UA 4DFJA 2I9GA 5AI4A 2ZJAA 2HHQA 5AIBA 2JV3A 4ED8A 3PMNA 3MR6A 4RQ8A 3RJIA 3Q8QB 4F5NA 2DF4B 4YXJA 3OGUA 7ICHA 4OJLA 1KKXA 3OJSA 4DSEA 1TAUA 1BPEA 3RAXA 1NI3A 1ZJMA 4F5OA 5L1MA 4MF8A 1HIWA 2FMQA 4CRXA 2DBYA 4TUPA 5KFAA 4P2HA 3EW9A 7ICUA 4GFJA 5A0LA 1B22A 3JPSA 3I28A 5ALJA 4FZMA 1A76A 5F3XB 3OHAA 4F4YA 3QX7A 1MQ3A 1P7DA 5HR7A 2NRTA 1UT8A 5DGBA 1OW5A 3TAPA 2HOQA 5BOMA 4TUSA 4KLSA 4LJXA 1K5OA 3CRXA 1RQLA 4GXKA 4EEYA 5DKWA 1COKA 4R65A 8ICAA 2ZTCA 1L7PA 1KW4A 3T5KA 4BUGA 3QU2A 5AK4A 1S10A 3ICXA 3WK6A 2JEGA 2W7PA 3C29A 3OSNA 1N61A 1TE2A 2E1EA 8ICTA 2IHMA 3M1YA 1T7PA 7ICEA 5AK6A 4O3QA 3AUOA 2EQYA 2ASLA 2BZFA 1L3UA 4KLFA 4RNMA 4OJ6A 4RQ2A 3FAHA 1SB3C 4Y2UA 3LVVA 4F2SA 2NRWA 1IXRA 3LVWA 7ICJA 2VIXA 5J0TA 2KJ8A 5J2GA 4QJFB 3MBYA 4CF4A 4YR0A 1X6JA 5EWFA 9ICFA 3GIKA 1SL2A 2ATLA 2MUTA 4IRKA 5IIKA 1X40A 5ALOA 1Z4OA 5KFXA 1PK1A 2FI1A 2LPEA 5JUMA 5J2AA 1BPXA 5ALDA 2FJ6A 2NRXA 3H8WA 3DDHA 3PY8A 1T3NA 4KLJA 2J6UA 4DL3A 3OTQA 3U26A 4I2BA 4C4RA 1Q46A 4KITB 4BWMA 2F44A 4KLDA 2Q0ZX 3H0LB 5KFSA 3BQTA 2F8LA 2F1JA 2OH2A 2DWQA 4QIWF 3CYMA 2VJ5A 3ISCA 5KAIU 4BDPA 1N63A 2QARA 5KT5A 3WK7A 2ZIVB 4PHDA 1FEZA 5ALEA 2XC9A 5TISU 4EX7A 1ZOLA 3AQEA 3GU3A 3L3FX 2G08A 4F91B 4HYKA 1Z00A 3V6JA 1CI4A 4FZNA 1X42A 2JGAA 4M6WA 3ISDA 3BQ7A 4KX3A 5C5JA 3HPOA 2BCQA 3F2CA 9ICJA 3SENA 3C2MA 4QW8A 3H0RB 4NLKA 5ALVA 1ZQFA 9ICQA 2QB1A 2H5XA 4GXIA 2CN1A 4I2GA 1DGJA 3KHLA 3LK9A 1EXNA 9ICWA 1X2IA 8ICVA 4TUQA 3SV4A 2Y9TA 4CGZA 4P0PB 3B0XA 4JV0A 5DBAA 5KL8B 2ZXIA 5KFIA 2WB1F 3M9MB 1X9MA 1KFSA 4R8UA 1ZD4A 1KEJA 4J9SA 5KG7A 1M6YA 1ZQHA 1N60A 5AM2A 2V9WA 1BPBA 5EE0A 4RQ7A 4J9LA 4DFKA 2VA2A 2BPGA 4UB3A 2KHVA 1XS9D 1WYGA 4I2IA 3TARA 5ALIA 3M8RA 1DXSA 2KP7A 3AQFA 4BJQA 1H38A 8ICPA 2Y1IA 4PH5A 4LZDA 3H8MA 2I5HA 2JEFA 3KD3A 4DEZA 1MN8A 1TK8A 4EBCA 1D9DA 4O5CA 2M9NA 3QU5A 4F72A 2W9MA 2PFNA 4OCZA 2R8IA 1LB2B 4RNOA 4US8A 2VA3A 3BJYA 4RQ6A 4B9MA 2C22A 4O0IA 2XGQA 3BDPA 3BQ2A 3EUB2 1NKCA 1JXLA 1SKSA 2HHUA 4O3NA 2C2RA 4QZAA 1D9FA 1N5XA 2VKQA 3SEIA 2ZIXB 2E8PA 5KNIA 1S76D 2RDJA 5KFNA 8ICNA 2JZBB 4Z6DA 5DBBA 1L8LA 1KLNA 3KZXA 2V4RA 5CJ7A 2GH1A 1J2MA 4UBBA 7ICMA 4I28A 4F8RA 2OXOA 2ALZA 4KLEA 2HVIA 1XSNA 3QUQA 4B9UA 4J9NA 5AM0A 9ICKA 3N7RC 3WU2U 5DQGA 3N7SC 4OD0A 3GILA 2AGQA 7ICGA 2R8KA 2JMGA 5AM1A 4ZOHC 4DFMA 2ZUBA 2YMPA 1D8LA 1FO4A 1WUDA 5J0YA 2FLNA 4RQ1A 3JPNA 3PSTA 4ED3A 5AICA 5AKGA 5HMLA 4ECYA 4DS5A 1DOQA 2NRZA 3BQ1A 2R8GA 8ICRA 4IQTA 1HUZA 4UB2A 4I2JA 2IOFA 5ALRA 1XNSA 3RJKA 4KN7A 1RYRA 3V6KA 3HP6A 4KLUA 1QQ6A 3K1ZA 2KICA 1TFRA 3PZPA 2HVHA 3PSPA 3RAQA 4NLNA 1JN3A 4PHAA 2FLPA 5KAFU 1Z1VA 2K8CB 4YR3A 3EWAA 1WCNA 5KFJA 3QNMA 5AKJA 3F5AA 2KVCA 3EPIA 3LYSA 3RR8A 3RFAA 5L1JA 1KDHA 1A77A 3O0FA 2RHFA 4GIBA 3PVXA 5ALNA 4KLIA 3NTUA 2RQ5A 3MR5A 2MU2A 4M9JA 4XA5A 4J9RA 2JRZA 4ECRA 1S77D 1S97A 3QE9Y 1DK3A 3AEVA 4QZDA 3UXOA 4C0ZA 3WK8A 4B6JA 8ICJA 4Q43A 1CEZA 2ZIVA 3DV9A 3ZDDA 2WTFA 4P4OA 1N5WA 2LMRA 3QXGA 2XVTA 3IDWA 3RJGA 3Q8PB 2ZTDA 8ICFA 1N48A 3UMGA 2K8AA 4NLGA 4Y2YA 4TQSA 3WK4A 9ICNA 4I2CA 4IQVA 3ZDBA 3OHBA 2O6KA 2RDIA 2DPIA 4GXJA 2HCFA 5J0UA 4PL1A 1L6NA 2NYVA 8ICGA 4C8LA 4FS2A 4WJ3B 1J2NA 2XICA 4JB3A 5J0XA 3TADA 4RT3A 2P35A 8ICXA 3NASA 4M47A 1WCLA 1A0PA 3K4GA 4Y2SA 2KK0A 1SL1A 8ICWA 5KFZA 3V6HA 1S0OA 4DL7A 4P0PA 5IINA 2DL0A 3N28A 3H4DA 5IIOA 4R64A 4J03A 3QZ7A 5L1LA 5AK5A 3KBBA 4C8NA 2BPCA 1MA7A 5DBCA 5F9NA 1KBUA 1BPZA 3BQ0A 1RZTA 5EWEA 4ECWA 5C0YA 5ALMA 2R18A 4QWAA 3M8SA 3MC1A 3MDAA 4ECXA 2KIVA 3KHRA 1U9LA 4K4GA 2XY7A 8ICCA 3Q8RB 4MEXA 4UB6U 3NUQA 3TI0A 3ZD8A 5DG9A 1XU4A 2FPLA 5ALUA 2W7OA 2BQRA 4NXZA 2BHNA 1SKWA 4DL6A 4QNLA 4EBDA 4RQ4A 1L3TA 5K4LA 5BPCA 3C2KA 1KRPA 5J2HA 4BWJA 4C4TA 2IMWP 3IM1A 2W03A 2J6SA 1ZQAA 3MGVA 1NK4A 1WG8A 2VJ4A 1IV8A 1V97A 4C8OA 1IG6A 3MFIA 5CRXA 2K4IA 4UB5A 5ALWA 4CF3A 4DLGA 1S0VA 4NLBA 4YVZA 2ZIXA 2YQEA 1OUQA 2JZBA 7ICTA 5ALTA 2Y9UA 1S5LU 4KTQA 5KFRA 5J0PA 1RYSA 4XRHA 2KKVA 1ZQTA 1ZJNA 1BVSA 8ICLA 3KFUF 1NJWA 3CNHA 3MABA 2NO5A 2V4QA 3PV8A 3GIJA 5KTQA 5IIJA 4NLZA 1ZQ1C 4DCCA 2PFOA 3QEAZ 1ZQPA 4C8MA 3GV5B 4I2AA 2HSZA 4QZHA 2OWOA 4CCHA 2HOFA 2NRVA 1C7YA 4OJ5A 2W54A 4A8EA 2QKQA 4DSFA 5KFGA 1YZ6A 2K4HA 2C28A 5DB7A 3G6VA 3CP8A 4KLTA 2HHVA 3BZCA 4M9LA 3ONNA 4CDGA 3C5FA 4M9GA 1ZQXA 2ZIUB 3H4BA 3JPTA 1HUOA 1ZQIA 3EPGA 5KFYA 4O5EA 3Q8LA 1CUKA 3F5EA 4I2HA 4Y2JA 4TURA 4IRDA 2KZMA 8ICMA 4JV2A 4NV0A 5FP0A 3IP4B 4EBEA 4PJ0U 3UQ0A 1NK8A 8ICKA 4RPXA 1KSPA 1ZQUA 4UAVA 4YD1A 2BCSA 4DOCA 3E58A 3ZDEA 4EZ6A 4AYBC 7ICRA 4UQGA 4ECUA 3PR5B 5KFFA 2W8KA 3NS1A 3M9OB 2AGPA 3V7JA 4ELUA 1L3VA 4DS4A 4ECTA 2BQUA 1IM4A 2JHDA 5EWGA 1YT3A 3K75D 4QWDA 1QSLA 2HMXA 5KFBA 4UAUA 4QZ9A 4EEKA 5AI6A 3T5LA 4F5PA 3KHGA 3IG8A 1J97A 4Z6CA 2QLTA 3RB6A 5AKLA 3RJJA 2DUYA 1QQ7A 1AROP 4ED1A 1A6SA 1BPYA 2Z7JA 1X66A 1NKEA 2LBOA 7ICIA 2EDUA 3PW5A 5J2BA 3RBEA 4NY8A 1SGGA 2C2DA 2W9CB 2J6TA 1S0NA 4OO1J 1MSWD 4MFFA 4MFAA 2E1FA 2EZYA 3RH6A 3RB4A 3AL0B 4NM1A 4GC7A 4US9A 3ETRA 1VDVA 5AI9A 4RPZA 4PGQA 4B9LA 3BS7A 2GLEA 2OM6A 4RT2A 4RQNA 1NJXA 2W9BB 9ICMA 4DQPA 2LYHA 1ZRMA 5EOZA 4BXOB 3C5GA 2AHOB 4IS7A 4KLQA 5KG4A 2RLTA 1CRXA 1VJ5A 1JALA 1TAQA 1O03A 2P6UA 2KE7A 3HJEA 5JTIA 2GO7A 3PW7A 2KHQA 8ICHA 2HHSA 2XIDA 3PNCA 5KT6A 2HHWA 2QB0B 2LKYA 4I29A 1JXEA 4DL4A 4UB4A 9ICAA 3UPQA 4DQRA 2UVVA 4UATA 4F2RA 4DOAA 5AKZA 4YXMA 2R8JA 4PGYA 2Y0SC 4O3MA 3Q8MA 2AXTU 3IRUA 5CWRA 2KVSA 5DLGA 3MDCA 3PW2A 7ICOA 1JROA 4LVSA 4JV1A 2H3VA 1PZNA 4DQSA 4FE3A 1ZQNA 1NJZA 2KKPA 1RXVA 4UBCA 2DQNB 2BDPA 4XQ8A 3N4MB 1U47A 1RYUA 5DG8A 1V85A 1RQNA 3GQCA 1NK0A 1WWVA 3SMVA 2HW3A 3T79A 1F5SA 2B6GA 1LVHA 4RQ3A 5KT2A 1ZYQA 4FZLA 4IR9A 4F4KA 8ICQA 4GC6A 3QU9A 5J2CA 4EYIB 1FFUA 5KFLA 3KOOA 4U6PA 5CR0A 4B9SA 1ZQMA 2LI6A 2GWSA 3RJEA 4QZBA 2K60A 4MHVA 1F0MA 3Q8KA 4CNQA 5HHIA 4DSIA 1N2XA 1XSLA 1O08A 3AU2A 4XUSA 4MEYA 2E3TA 2ISOA 2WF9A 2K4PA 3PW4A 1NZBA 2ZJ8A 5J2FA 2ZIUA 1SL0A 3VC8A 1JIHA 2F1HA 4IQWA 3M6ZA 2HBJA 3I76A 1KTQA 2VANA 5IIIA 3E0FA 4KLOA 2Y1JA 7ICNA 2ZIWB 1F44A 3SAFA 3SYZA 1S8OA 7ICQA 2ZXHA 3D2QA 3G6YA 5DGAA 1RPLA 2AH5A 5AKXA 2W3RA 4PZOA 1U49A 3I1YA 2YB4A 2XY6A 5B5EU 2RP5A 4JUZA 2XI9A 3NRZA 1QSSA 4K4HA 3UXNA 1Z3EB 3GDXA 3HKZC 3MGHA 3AM9A 1QSYA 3KTQA 4YMMA 2B21A 3HILA 4QZCA 4QWEA 3QU4A 3WK5A 5HHHA 4M9NA 9ICGA 1X9SA 3WKDA 4PZNA 5HNKA 2LM4A 3RBDA 2KEYA 1UA0A 1Q8KA 9ICIA 1RM6C 2PFQA 4UAWA 1K1SA 4ELVA 1KN5A 2M0NA 4OJOA 3PW0A 1TKDA 1BGXT 5DG7A 4F3OA 5J0SA 3QYPA 1RXWA 5AKEA 5ALZA
chains in the Genus database with same CATH topology
1DRGA 4P0PB 2G06A 2XVTA 2OXOA 3F5EA 4QNLA 2CPRA 4JMUA 2G5IB 2HBMA 3ALRA 1PVQA 5KL8B 4ACOA 2DGZA 3N7RC 3M6KA 2Y0SF 3PSIA 4ICAA 1CRXA 2H3ZA 2K8AA 2ZXIA 4NV0A 2WB1F 2CRXA 3N7SC 3IP4B 1HIWA 2K8BB 1Z1BA 4CRXA 4BX9C 4KX3A 2ZG6A 2JMGA 3RFAA 2W03A 1Q3UA 1D8BA 4KMOB 4P0QB 2KIWA 2K89A 2W04A 4GFJA 2KHQA 5A0LA 3MGVA 2D6FC 1PVRA 2WAQF 2VJ4A 2H3QA 2NV3A 2G09A 2JH1A 4AYBC 4PL1A 1WUDA 2XIDA 5CRXA 2K4IA 1L6NA 2E5SA 2LBOA 4FZMA 1PVPA 2PMZF 1Q3VA 3PSTA 1ED1A 2KHVA 2G07A 2LHTA 1NZBA 4NLBA 2G0AA 3H0LB 2A3VA 2HOIA 2F8LA 3HKZF 2ZIUA 2ZIXA 3VC8A 1P7DA 2OH2A 4WJ3B 5HR6A 1GO3F 2F2AB 1T94A 2LKYA 2VJ5A 2XICA 3CYMA 2F77X 4QIWF 2PMZC 1OUQA 3M6ZA 2HBJA 3AQFA 4BJQA 2H3IA 2HOQA 1A0PA 3NRWA 3RF9A 3VCBA 1SZHA 3CRXA 1XNSA 3E0FA 4PL2A 2KKVA 2Y0SC 5HR7A 3D2NA 4O3MA 2JHDA 3K1ZA 2ZIVB 2KICA 2WB1C 1YT3A 2MA1A 4P0PA 2ZIWB 4NWIA 4OJPA 3PZPA 3SAFA 1F44A 2HBLA 2HMXA 3KFUF 3PSPA 4KX5A 3IN5A 2ZXHA 3D2QA 3H0MB 4BUGA 3ICXA 3PSFA 2K8CB 2H3FA 3IG8A 2WAQC 2W7PA 3D2SA 3IG5A 2KJ9A 2H3VA 3AQEA 3GU3A 3L3FX 5T14A 3C29A 2E1EA 2G08A 1ECWA 4FE3A 1ZQ1C 3F5AA 2KVCA 1IIPA 1A6SA 2YB4A 3SAHA 2Z7JA 2KKPA 3LYSA 4P0QA 3SQIA 2Q4TA 2HBKA 2JGAA 3F53A 3OPXA 2RP5A 2JH7A 4FZNA 3GZFA 3O0FA 2RHFA 2F76X 2K4EA 2DQNB 2MRLA 2XI9A 2YB1A 1MA7A 1KBUA 2HOFA 3F2CA 3HKZC 2RRDA 4OJ5A 5KL1B 4QIWC 4A8EA 2LYBA 4CGZA 4NLCA 4OJ6A 2K4HA 3F2DA 5C0YA 3H0RB 4OO1J 3SMVA 2KV2A 2KNJA 2R18A 2KOBA 3T79A 4U7CA 3CP8A 3SAGA 1XO0A 2E1FA 2OYYA 3F2BA 3AL0B 3LVVA 4FZLA 1HEKA 3ONNA 4CDGA 2G5HB 2KEYA 2VKQA 4AYBF 2ZIUB 2YX8A 2ZIXB 4C0ZA 3NUQA 1TAMA 2GOLA 3LVWA 2BDUA 2KJ5A 3C28A 2VIXA 1URJA 2CN1A 2KJ8A 2DF4B 2M0NA 4IC9A 4OJOA 3M7DA 1UPHA 2OM6A 2ZIVA 4QJFB 3DEEA 2N1RA 4OJLA 2W7OA 2ZIWA 3KZXA 3N7PD 2GH1A 4U6PA 1Z19A 2KD1A 2LYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F77 X;  2F76 X; 
#chains in the Genus database with same CATH topology
 4F4Z A;  4QZG A;  4ACO A;  3QUB A;  2BQ3 A;  5AI0 A;  4J9O A;  3KZI U;  3C2L A;  3MGI A;  1U45 A;  2ASD A;  1ZQR A;  4BX9 C;  3PX6 A;  7ICK A;  1D8B A;  5AKK A;  3RH4 A;  3RTV A;  2PKE A;  3ZDA A;  1T3Q A;  3S6J A;  3NGD A;  1U4B A;  2W9C A;  3THV A;  8ICB A;  2E5S A;  5KFE A;  2FLL A;  3LWM A;  2WHE A;  4IR1 A;  4I2E A;  4I2F A;  3VCB A;  1FFV A;  4PGX A;  2W9B A;  4YR2 A;  4PHE A;  9ICT A;  4RUA A;  1PK3 A;  4BXO A;  4C8K A;  9ICP A;  3H7I A;  2A1J B;  3WK9 A;  4QW9 A;  3TAD C;  3H0M B;  1V9P A;  3TQ1 A;  1D8Y A;  1ZQY A;  4ELT A;  1S9F A;  2WAQ C;  3IG5 A;  2BKE A;  5HMM A;  1L7N A;  1TK0 A;  1UCV A;  5CB1 A;  1ZQC A;  9ICO A;  2HOI A;  2EZZ A;  2YMM A;  2F76 X;  4YG2 A;  2PI4 A;  4YQW A;  2PFP A;  9ICV A;  2QB0 A;  1JX4 A;  2YTU A;  2OYY A;  3F2B A;  3MFH A;  2G5H B;  4DFD A;  1ZQV A;  3GIM A;  4F92 B;  1JI7 A;  2KSO B;  1URJ A;  4MF2 A;  3B9J A;  4KN4 A;  5DB9 A;  3RJH A;  4B9V A;  5ALF A;  4RZR A;  3ALR A;  5AI5 A;  1KFT A;  2KMD A;  1UHU A;  3C21 A;  5ALS A;  4ICA A;  1OXJ A;  2H3Z A;  3K1R B;  5KG1 A;  2OEH A;  5KFH A;  3FDS A;  5AIA A;  5KFQ A;  1Y88 A;  4DO9 A;  2F1I A;  2YML A;  1ZQG A;  4M9H A;  3ZD9 A;  3RJF A;  2CXY A;  2KIW A;  2D6F C;  2W04 A;  4DQQ A;  1PVR A;  5KFM A;  5J0W A;  4ZH4 A;  5D4B A;  5F9L A;  5BOL A;  2PMZ F;  1PVP A;  1Q3V A;  4UAS A;  1SWW A;  7ICL A;  1DGS A;  1L7O A;  4YMN A;  4F4W A;  3E2E A;  2JR5 A;  5ALQ A;  4KLG A;  2F77 X;  5DDY A;  1XWL A;  3L4P A;  3WKB A;  2BPF A;  2H3I A;  2JXJ A;  3KKA C;  4RQM A;  3KHH A;  4PL2 A;  1TVA A;  3PO5 A;  4YN4 A;  2MA1 A;  4DL2 A;  4OJP A;  3H8J A;  1L7M A;  3KKA A;  3UMB A;  2ZUD A;  5CA7 A;  2AQ0 A;  3BS5 B;  2MAX A;  2UVR A;  2H3F A;  4Z6F A;  3C1Z A;  5DB8 A;  4M04 A;  3PML A;  4J9M A;  3HX0 A;  4F50 A;  1ZQS A;  1B43 A;  3NVV A;  4FBT A;  1IIP A;  4LZG A;  2JH7 A;  4ECZ A;  4IL6 U;  1QQ5 A;  2XGP A;  2RRD A;  4X5V A;  2ZUC A;  5GTI U;  4Y2R A;  2DPJ A;  1ZD3 A;  5ALX A;  1YZ7 A;  2KV2 A;  2EAN A;  3UXP A;  1SV4 A;  3RH5 A;  1XSP A;  4J9Q A;  3RRG A;  2ES6 A;  2P66 A;  2BDU A;  4FBU A;  5G5H A;  4DF8 A;  2ZIW A;  2LM1 A;  3QUC A;  2LYA A;  2ZJ5 A;  1LKY B;  2CPR A;  3WKE A;  1XO1 A;  2F3N A;  2FE9 A;  4QZE A;  4ED7 A;  4G3I A;  1COO A;  2MSN A;  1ZQL A;  4DL5 A;  1LV5 A;  2CRX A;  4YMO A;  2FMS A;  1ZQD A;  4Y2Q A;  2K8B B;  2BCU A;  4KLL A;  3MR2 A;  2WF6 A;  1Q3U A;  2KFZ A;  5J2K A;  2FPM A;  4DSL A;  5L1K A;  2WFA A;  2NV3 A;  3RR7 A;  1QH9 A;  1RDF A;  3OJU A;  2UVW A;  5CEH A;  2G07 A;  1QTM A;  2A3V A;  2ODG A;  2BR0 A;  5EE9 A;  4GLX A;  4DF4 A;  5CP2 A;  4K4I A;  5KT4 A;  5KFP A;  5J2I A;  3QEB Z;  3UMC A;  9ICU A;  5AM3 A;  4DFP A;  4QZ8 A;  5ALP A;  3GFK B;  1JUD A;  3C23 A;  5DQH A;  3D2S A;  2NO4 A;  3M9N B;  5T14 A;  4B9N A;  4R66 A;  3TAQ A;  2IOH A;  1B4F A;  9ICL A;  1NK9 A;  4C80 A;  3A0H U;  2XY5 A;  4MFC A;  3GZF A;  2PXI A;  2K4E A;  2YB1 A;  5IIL A;  4QIW C;  3RB0 A;  9ICX A;  2JEJ A;  4RQ0 A;  9ICS A;  3PO4 A;  5KT7 A;  1RG6 A;  4CF5 A;  5EE3 A;  3R9K A;  3SI8 A;  1KFD A;  1S0M A;  3JPR A;  1NK6 A;  4AYB F;  2KN7 A;  2YX8 A;  3LDA A;  2KJ5 A;  5J0R A;  3SR6 A;  3PR4 A;  3M7D A;  2W55 A;  1HJP A;  3N7P D;  2A1J A;  5J2E A;  4PPX A;  1UT5 A;  3OSP A;  1DRG A;  1V38 A;  4EEL A;  4DWI A;  2G5I B;  1PVQ A;  5DB6 A;  5KG3 A;  4C7Z A;  3M6K A;  2IA6 A;  1ZD5 A;  8ICO A;  1JRP A;  3QUT A;  1Z1B A;  5D46 A;  3GV8 B;  2HI0 A;  2KZZ A;  2EAP A;  1C20 A;  3CW2 C;  5TZV A;  2K89 A;  4O3O A;  2P6R A;  7ICP A;  5ALK A;  3ZDC A;  3ED5 A;  2G09 A;  5B66 U;  2AU0 A;  2BGW A;  4JWN A;  3GII A;  3V72 A;  1ED1 A;  4NJ8 A;  2LHT A;  2KZ3 A;  2W11 A;  5KFC A;  9ICH A;  5AKY A;  4C7Y A;  2KSO A;  5AHX A;  2F8K A;  4USA A;  1SZH A;  5ALH A;  5ALL A;  1XC9 A;  2KTQ A;  2I1Q A;  3PX0 A;  5EE1 A;  2AQ4 A;  3V7L A;  2WB1 C;  2WF8 A;  5L1I A;  5DLF A;  3BZK A;  4KX5 A;  3FM9 A;  2KG5 A;  4J9K A;  1SIJ A;  3B0Y A;  2FDR A;  4RNN A;  5DDM A;  2A19 A;  9ICB A;  7ICS A;  2I6X A;  4UB1 A;  2Q4T A;  5J0O A;  2MRL A;  5AKI A;  4JK1 A;  3T5J A;  5KL1 B;  2IOF K;  3SV3 A;  2KFN A;  4HAI A;  3UM9 A;  3ZI4 A;  4NLC A;  2EAO A;  2XCP A;  1SXE A;  3IHQ B;  1X6I A;  3WKC A;  1HEK A;  5AM4 A;  4JWM A;  1ZQQ A;  4FS1 A;  5KG2 A;  4PHP A;  3UQ2 A;  1L8O A;  3JPP A;  3AN1 A;  5KFV A;  5AKH A;  2YN4 A;  4RUC A;  1NKB A;  5D49 A;  1PUZ A;  1ZET A;  4DLE A;  2G06 A;  4JMU A;  2OHF A;  3BS5 A;  5IIM A;  3A0B U;  2HBM A;  3ORY A;  5HP4 A;  4P4M A;  1UQV A;  2XCA A;  3AU6 A;  2WF7 A;  4UW9 A;  2Y0S F;  2IHN A;  4B9T A;  3HW8 A;  2ZG6 A;  5ALY A;  1VLB A;  4KMO B;  4P0Q B;  2VA8 A;  3T3F A;  4CE6 A;  4KLH A;  2H3Q A;  1QLN A;  2BCV A;  1MC8 A;  4F93 B;  4O3P A;  1SZP A;  2DKX A;  5J0Q A;  3GV7 B;  1X9W A;  4QWB A;  1GO3 F;  2AJQ A;  1SKR A;  1U48 A;  2ASJ A;  1SV0 C;  3RRH A;  3ISB A;  4RPY A;  3H40 A;  4NWI A;  1LKY A;  1NOM A;  4AP9 A;  4DSK A;  1BPD A;  1SV0 A;  5KT3 A;  1UA1 A;  4F5Q A;  2ZTE A;  4DOB A;  3T5H A;  3D6J A;  2KJ9 A;  4EZ9 A;  3Q8S B;  2DFL A;  5AK3 A;  5KG6 A;  3JPO A;  7ICF A;  2WF5 A;  1ZQK A;  4QZI A;  2HBK A;  3F53 A;  3L5K A;  5JRT A;  1ZQW A;  4KMU A;  3NVW A;  2EAM A;  4I27 A;  9ICE A;  4YFK A;  1N56 A;  8ICI A;  2JEI A;  8ICU A;  2AGO A;  4Y2X A;  1ZQO A;  4Z6E A;  4Y2T A;  2KOB A;  4U7C A;  1X9X A;  3V7K A;  3SAG A;  1XO0 A;  3G6X A;  7ICV A;  5J2J A;  2OCE A;  4P4P A;  4NM2 A;  1TAM A;  2GOL A;  4UAR A;  2ESE A;  3WKA A;  1BNP A;  9ICC A;  3DEE A;  3TKA A;  4TQR A;  3H8S A;  1Z19 A;  3HWT A;  4NL9 C;  1DK2 A;  4FFD A;  5GTH U;  3FC4 A;  4UAZ A;  5KFD A;  2A1A A;  4NL9 A;  3PX4 A;  4Q8F A;  4O9M A;  4KLM A;  2FMP A;  4DSJ A;  5AI8 A;  4E0D A;  4IRC A;  3C1Y A;  1TK5 A;  2HHT A;  2C2E A;  2UVU A;  5KFU A;  2L5Y A;  2HDO A;  4RQ5 A;  1TV9 A;  1ZXI A;  2G0A A;  3HKZ F;  4G9B A;  3JPQ A;  1T94 A;  1BNO A;  5J2D A;  2XO7 A;  4F4X A;  3NRW A;  3RF9 A;  1NJY A;  3D2N A;  3NVZ A;  4I2D A;  5KG5 A;  3EYZ A;  3J81 j;  2HBL A;  4ECS A;  2MUT B;  1ZD2 P;  3LWL A;  3PSF A;  4O3S A;  1PK1 B;  4Y2V A;  1T4G A;  4EX6 A;  2YMQ A;  2DKZ A;  1ZQZ A;  5H2F U;  3SQI A;  5E79 U;  1K1Q A;  4M0A A;  3OPX A;  4YCX A;  4EEN A;  1KQQ A;  2IBK A;  2LYB A;  3QZ8 A;  8ICE A;  4Q45 A;  3F2D A;  3AMZ A;  1ZQB A;  2KNJ A;  1Z4N A;  1L3S A;  4ED6 A;  3IV6 A;  4C4S A;  4RU9 A;  2ISP A;  5G5G A;  1MQ2 A;  5KG0 A;  5J8Y C;  3C28 A;  4IC9 A;  4BGD A;  2PI5 A;  1UPH A;  5J29 A;  2N1R A;  5DQI A;  2D8C A;  3TAC B;  2W9A A;  2E8O A;  4QZF A;  2HHX A;  2QAR B;  2EZX A;  2KD1 A;  2B0C A;  2EH9 A;  5J8Y A;  4O5K A;  3SAH A;  4DQI A;  4O3R A;  1B0X A;  3SZ2 A;  2E8M A;  4QWC A;  2DGZ A;  1JMS A;  3PSI A;  8ICZ A;  1ZRN A;  4M2Y A;  2E8N A;  2YY6 A;  5ALG A;  4J9P A;  1NK7 A;  1T8E A;  5L9X A;  4R63 A;  4F71 A;  3TAN A;  1Z00 B;  1SXD A;  1QCK A;  4M6W B;  3SD7 A;  3EZ5 A;  2WAQ F;  1ZQE A;  4ED0 A;  2FPK A;  2JH1 A;  5KFT A;  1NK5 A;  4ED2 A;  1N62 A;  4Q44 A;  4FO6 A;  2W3S A;  3TFR A;  4UAY A;  3NVY A;  9ICR A;  5HR6 A;  5KFO A;  2F2A B;  4YD2 A;  2R8H A;  2PMZ C;  3HRD D;  2W8L A;  3QU7 A;  3N97 B;  1KL9 A;  4YP3 A;  4IQU A;  4Q8E A;  1NNL A;  1SWV A;  3IN5 A;  2D3D A;  4EYH B;  3FYH A;  3HT3 A;  5JU5 A;  1AQ6 A;  3ETL A;  1ZQJ A;  3RB3 A;  2BCR A;  1ECW A;  8ICS A;  4R8U B;  1FIQ A;  4P0Q A;  3TFS A;  5KFW A;  2W43 A;  8ICY A;  4Y2P A;  5KFK A;  1WWU A;  3MR3 A;  5CHG A;  4ECV A;  1NZP A;  4ECQ A;  4F5R A;  5AM5 A;  4UB8 U;  1L5U A;  4DFJ A;  2I9G A;  5AI4 A;  2ZJA A;  2HHQ A;  5AIB A;  2JV3 A;  4ED8 A;  3PMN A;  3MR6 A;  4RQ8 A;  3RJI A;  3Q8Q B;  4F5N A;  2DF4 B;  4YXJ A;  3OGU A;  7ICH A;  4OJL A;  1KKX A;  3OJS A;  4DSE A;  1TAU A;  1BPE A;  3RAX A;  1NI3 A;  1ZJM A;  4F5O A;  5L1M A;  4MF8 A;  1HIW A;  2FMQ A;  4CRX A;  2DBY A;  4TUP A;  5KFA A;  4P2H A;  3EW9 A;  7ICU A;  4GFJ A;  5A0L A;  1B22 A;  3JPS A;  3I28 A;  5ALJ A;  4FZM A;  1A76 A;  5F3X B;  3OHA A;  4F4Y A;  3QX7 A;  1MQ3 A;  1P7D A;  5HR7 A;  2NRT A;  1UT8 A;  5DGB A;  1OW5 A;  3TAP A;  2HOQ A;  5BOM A;  4TUS A;  4KLS A;  4LJX A;  1K5O A;  3CRX A;  1RQL A;  4GXK A;  4EEY A;  5DKW A;  1COK A;  4R65 A;  8ICA A;  2ZTC A;  1L7P A;  1KW4 A;  3T5K A;  4BUG A;  3QU2 A;  5AK4 A;  1S10 A;  3ICX A;  3WK6 A;  2JEG A;  2W7P A;  3C29 A;  3OSN A;  1N61 A;  1TE2 A;  2E1E A;  8ICT A;  2IHM A;  3M1Y A;  1T7P A;  7ICE A;  5AK6 A;  4O3Q A;  3AUO A;  2EQY A;  2ASL A;  2BZF A;  1L3U A;  4KLF A;  4RNM A;  4OJ6 A;  4RQ2 A;  3FAH A;  1SB3 C;  4Y2U A;  3LVV A;  4F2S A;  2NRW A;  1IXR A;  3LVW A;  7ICJ A;  2VIX A;  5J0T A;  2KJ8 A;  5J2G A;  4QJF B;  3MBY A;  4CF4 A;  4YR0 A;  1X6J A;  5EWF A;  9ICF A;  3GIK A;  1SL2 A;  2ATL A;  2MUT A;  4IRK A;  5IIK A;  1X40 A;  5ALO A;  1Z4O A;  5KFX A;  1PK1 A;  2FI1 A;  2LPE A;  5JUM A;  5J2A A;  1BPX A;  5ALD A;  2FJ6 A;  2NRX A;  3H8W A;  3DDH A;  3PY8 A;  1T3N A;  4KLJ A;  2J6U A;  4DL3 A;  3OTQ A;  3U26 A;  4I2B A;  4C4R A;  1Q46 A;  4KIT B;  4BWM A;  2F44 A;  4KLD A;  2Q0Z X;  3H0L B;  5KFS A;  3BQT A;  2F8L A;  2F1J A;  2OH2 A;  2DWQ A;  4QIW F;  3CYM A;  2VJ5 A;  3ISC A;  5KAI U;  4BDP A;  1N63 A;  2QAR A;  5KT5 A;  3WK7 A;  2ZIV B;  4PHD A;  1FEZ A;  5ALE A;  2XC9 A;  5TIS U;  4EX7 A;  1ZOL A;  3AQE A;  3GU3 A;  3L3F X;  2G08 A;  4F91 B;  4HYK A;  1Z00 A;  3V6J A;  1CI4 A;  4FZN A;  1X42 A;  2JGA A;  4M6W A;  3ISD A;  3BQ7 A;  4KX3 A;  5C5J A;  3HPO A;  2BCQ A;  3F2C A;  9ICJ A;  3SEN A;  3C2M A;  4QW8 A;  3H0R B;  4NLK A;  5ALV A;  1ZQF A;  9ICQ A;  2QB1 A;  2H5X A;  4GXI A;  2CN1 A;  4I2G A;  1DGJ A;  3KHL A;  3LK9 A;  1EXN A;  9ICW A;  1X2I A;  8ICV A;  4TUQ A;  3SV4 A;  2Y9T A;  4CGZ A;  4P0P B;  3B0X A;  4JV0 A;  5DBA A;  5KL8 B;  2ZXI A;  5KFI A;  2WB1 F;  3M9M B;  1X9M A;  1KFS A;  4R8U A;  1ZD4 A;  1KEJ A;  4J9S A;  5KG7 A;  1M6Y A;  1ZQH A;  1N60 A;  5AM2 A;  2V9W A;  1BPB A;  5EE0 A;  4RQ7 A;  4J9L A;  4DFK A;  2VA2 A;  2BPG A;  4UB3 A;  2KHV A;  1XS9 D;  1WYG A;  4I2I A;  3TAR A;  5ALI A;  3M8R A;  1DXS A;  2KP7 A;  3AQF A;  4BJQ A;  1H38 A;  8ICP A;  2Y1I A;  4PH5 A;  4LZD A;  3H8M A;  2I5H A;  2JEF A;  3KD3 A;  4DEZ A;  1MN8 A;  1TK8 A;  4EBC A;  1D9D A;  4O5C A;  2M9N A;  3QU5 A;  4F72 A;  2W9M A;  2PFN A;  4OCZ A;  2R8I A;  1LB2 B;  4RNO A;  4US8 A;  2VA3 A;  3BJY A;  4RQ6 A;  4B9M A;  2C22 A;  4O0I A;  2XGQ A;  3BDP A;  3BQ2 A;  3EUB 2;  1NKC A;  1JXL A;  1SKS A;  2HHU A;  4O3N A;  2C2R A;  4QZA A;  1D9F A;  1N5X A;  2VKQ A;  3SEI A;  2ZIX B;  2E8P A;  5KNI A;  1S76 D;  2RDJ A;  5KFN A;  8ICN A;  2JZB B;  4Z6D A;  5DBB A;  1L8L A;  1KLN A;  3KZX A;  2V4R A;  5CJ7 A;  2GH1 A;  1J2M A;  4UBB A;  7ICM A;  4I28 A;  4F8R A;  2OXO A;  2ALZ A;  4KLE A;  2HVI A;  1XSN A;  3QUQ A;  4B9U A;  4J9N A;  5AM0 A;  9ICK A;  3N7R C;  3WU2 U;  5DQG A;  3N7S C;  4OD0 A;  3GIL A;  2AGQ A;  7ICG A;  2R8K A;  2JMG A;  5AM1 A;  4ZOH C;  4DFM A;  2ZUB A;  2YMP A;  1D8L A;  1FO4 A;  1WUD A;  5J0Y A;  2FLN A;  4RQ1 A;  3JPN A;  3PST A;  4ED3 A;  5AIC A;  5AKG A;  5HML A;  4ECY A;  4DS5 A;  1DOQ A;  2NRZ A;  3BQ1 A;  2R8G A;  8ICR A;  4IQT A;  1HUZ A;  4UB2 A;  4I2J A;  2IOF A;  5ALR A;  1XNS A;  3RJK A;  4KN7 A;  1RYR A;  3V6K A;  3HP6 A;  4KLU A;  1QQ6 A;  3K1Z A;  2KIC A;  1TFR A;  3PZP A;  2HVH A;  3PSP A;  3RAQ A;  4NLN A;  1JN3 A;  4PHA A;  2FLP A;  5KAF U;  1Z1V A;  2K8C B;  4YR3 A;  3EWA A;  1WCN A;  5KFJ A;  3QNM A;  5AKJ A;  3F5A A;  2KVC A;  3EPI A;  3LYS A;  3RR8 A;  3RFA A;  5L1J A;  1KDH A;  1A77 A;  3O0F A;  2RHF A;  4GIB A;  3PVX A;  5ALN A;  4KLI A;  3NTU A;  2RQ5 A;  3MR5 A;  2MU2 A;  4M9J A;  4XA5 A;  4J9R A;  2JRZ A;  4ECR A;  1S77 D;  1S97 A;  3QE9 Y;  1DK3 A;  3AEV A;  4QZD A;  3UXO A;  4C0Z A;  3WK8 A;  4B6J A;  8ICJ A;  4Q43 A;  1CEZ A;  2ZIV A;  3DV9 A;  3ZDD A;  2WTF A;  4P4O A;  1N5W A;  2LMR A;  3QXG A;  2XVT A;  3IDW A;  3RJG A;  3Q8P B;  2ZTD A;  8ICF A;  1N48 A;  3UMG A;  2K8A A;  4NLG A;  4Y2Y A;  4TQS A;  3WK4 A;  9ICN A;  4I2C A;  4IQV A;  3ZDB A;  3OHB A;  2O6K A;  2RDI A;  2DPI A;  4GXJ A;  2HCF A;  5J0U A;  4PL1 A;  1L6N A;  2NYV A;  8ICG A;  4C8L A;  4FS2 A;  4WJ3 B;  1J2N A;  2XIC A;  4JB3 A;  5J0X A;  3TAD A;  4RT3 A;  2P35 A;  8ICX A;  3NAS A;  4M47 A;  1WCL A;  1A0P A;  3K4G A;  4Y2S A;  2KK0 A;  1SL1 A;  8ICW A;  5KFZ A;  3V6H A;  1S0O A;  4DL7 A;  4P0P A;  5IIN A;  2DL0 A;  3N28 A;  3H4D A;  5IIO A;  4R64 A;  4J03 A;  3QZ7 A;  5L1L A;  5AK5 A;  3KBB A;  4C8N A;  2BPC A;  1MA7 A;  5DBC A;  5F9N A;  1KBU A;  1BPZ A;  3BQ0 A;  1RZT A;  5EWE A;  4ECW A;  5C0Y A;  5ALM A;  2R18 A;  4QWA A;  3M8S A;  3MC1 A;  3MDA A;  4ECX A;  2KIV A;  3KHR A;  1U9L A;  4K4G A;  2XY7 A;  8ICC A;  3Q8R B;  4MEX A;  4UB6 U;  3NUQ A;  3TI0 A;  3ZD8 A;  5DG9 A;  1XU4 A;  2FPL A;  5ALU A;  2W7O A;  2BQR A;  4NXZ A;  2BHN A;  1SKW A;  4DL6 A;  4QNL A;  4EBD A;  4RQ4 A;  1L3T A;  5K4L A;  5BPC A;  3C2K A;  1KRP A;  5J2H A;  4BWJ A;  4C4T A;  2IMW P;  3IM1 A;  2W03 A;  2J6S A;  1ZQA A;  3MGV A;  1NK4 A;  1WG8 A;  2VJ4 A;  1IV8 A;  1V97 A;  4C8O A;  1IG6 A;  3MFI A;  5CRX A;  2K4I A;  4UB5 A;  5ALW A;  4CF3 A;  4DLG A;  1S0V A;  4NLB A;  4YVZ A;  2ZIX A;  2YQE A;  1OUQ A;  2JZB A;  7ICT A;  5ALT A;  2Y9U A;  1S5L U;  4KTQ A;  5KFR A;  5J0P A;  1RYS A;  4XRH A;  2KKV A;  1ZQT A;  1ZJN A;  1BVS A;  8ICL A;  3KFU F;  1NJW A;  3CNH A;  3MAB A;  2NO5 A;  2V4Q A;  3PV8 A;  3GIJ A;  5KTQ A;  5IIJ A;  4NLZ A;  1ZQ1 C;  4DCC A;  2PFO A;  3QEA Z;  1ZQP A;  4C8M A;  3GV5 B;  4I2A A;  2HSZ A;  4QZH A;  2OWO A;  4CCH A;  2HOF A;  2NRV A;  1C7Y A;  4OJ5 A;  2W54 A;  4A8E A;  2QKQ A;  4DSF A;  5KFG A;  1YZ6 A;  2K4H A;  2C28 A;  5DB7 A;  3G6V A;  3CP8 A;  4KLT A;  2HHV A;  3BZC A;  4M9L A;  3ONN A;  4CDG A;  3C5F A;  4M9G A;  1ZQX A;  2ZIU B;  3H4B A;  3JPT A;  1HUO A;  1ZQI A;  3EPG A;  5KFY A;  4O5E A;  3Q8L A;  1CUK A;  3F5E A;  4I2H A;  4Y2J A;  4TUR A;  4IRD A;  2KZM A;  8ICM A;  4JV2 A;  4NV0 A;  5FP0 A;  3IP4 B;  4EBE A;  4PJ0 U;  3UQ0 A;  1NK8 A;  8ICK A;  4RPX A;  1KSP A;  1ZQU A;  4UAV A;  4YD1 A;  2BCS A;  4DOC A;  3E58 A;  3ZDE A;  4EZ6 A;  4AYB C;  7ICR A;  4UQG A;  4ECU A;  3PR5 B;  5KFF A;  2W8K A;  3NS1 A;  3M9O B;  2AGP A;  3V7J A;  4ELU A;  1L3V A;  4DS4 A;  4ECT A;  2BQU A;  1IM4 A;  2JHD A;  5EWG A;  1YT3 A;  3K75 D;  4QWD A;  1QSL A;  2HMX A;  5KFB A;  4UAU A;  4QZ9 A;  4EEK A;  5AI6 A;  3T5L A;  4F5P A;  3KHG A;  3IG8 A;  1J97 A;  4Z6C A;  2QLT A;  3RB6 A;  5AKL A;  3RJJ A;  2DUY A;  1QQ7 A;  1ARO P;  4ED1 A;  1A6S A;  1BPY A;  2Z7J A;  1X66 A;  1NKE A;  2LBO A;  7ICI A;  2EDU A;  3PW5 A;  5J2B A;  3RBE A;  4NY8 A;  1SGG A;  2C2D A;  2W9C B;  2J6T A;  1S0N A;  4OO1 J;  1MSW D;  4MFF A;  4MFA A;  2E1F A;  2EZY A;  3RH6 A;  3RB4 A;  3AL0 B;  4NM1 A;  4GC7 A;  4US9 A;  3ETR A;  1VDV A;  5AI9 A;  4RPZ A;  4PGQ A;  4B9L A;  3BS7 A;  2GLE A;  2OM6 A;  4RT2 A;  4RQN A;  1NJX A;  2W9B B;  9ICM A;  4DQP A;  2LYH A;  1ZRM A;  5EOZ A;  4BXO B;  3C5G A;  2AHO B;  4IS7 A;  4KLQ A;  5KG4 A;  2RLT A;  1CRX A;  1VJ5 A;  1JAL A;  1TAQ A;  1O03 A;  2P6U A;  2KE7 A;  3HJE A;  5JTI A;  2GO7 A;  3PW7 A;  2KHQ A;  8ICH A;  2HHS A;  2XID A;  3PNC A;  5KT6 A;  2HHW A;  2QB0 B;  2LKY A;  4I29 A;  1JXE A;  4DL4 A;  4UB4 A;  9ICA A;  3UPQ A;  4DQR A;  2UVV A;  4UAT A;  4F2R A;  4DOA A;  5AKZ A;  4YXM A;  2R8J A;  4PGY A;  2Y0S C;  4O3M A;  3Q8M A;  2AXT U;  3IRU A;  5CWR A;  2KVS A;  5DLG A;  3MDC A;  3PW2 A;  7ICO A;  1JRO A;  4LVS A;  4JV1 A;  2H3V A;  1PZN A;  4DQS A;  4FE3 A;  1ZQN A;  1NJZ A;  2KKP A;  1RXV A;  4UBC A;  2DQN B;  2BDP A;  4XQ8 A;  3N4M B;  1U47 A;  1RYU A;  5DG8 A;  1V85 A;  1RQN A;  3GQC A;  1NK0 A;  1WWV A;  3SMV A;  2HW3 A;  3T79 A;  1F5S A;  2B6G A;  1LVH A;  4RQ3 A;  5KT2 A;  1ZYQ A;  4FZL A;  4IR9 A;  4F4K A;  8ICQ A;  4GC6 A;  3QU9 A;  5J2C A;  4EYI B;  1FFU A;  5KFL A;  3KOO A;  4U6P A;  5CR0 A;  4B9S A;  1ZQM A;  2LI6 A;  2GWS A;  3RJE A;  4QZB A;  2K60 A;  4MHV A;  1F0M A;  3Q8K A;  4CNQ A;  5HHI A;  4DSI A;  1N2X A;  1XSL A;  1O08 A;  3AU2 A;  4XUS A;  4MEY A;  2E3T A;  2ISO A;  2WF9 A;  2K4P A;  3PW4 A;  1NZB A;  2ZJ8 A;  5J2F A;  2ZIU A;  1SL0 A;  3VC8 A;  1JIH A;  2F1H A;  4IQW A;  3M6Z A;  2HBJ A;  3I76 A;  1KTQ A;  2VAN A;  5III A;  3E0F A;  4KLO A;  2Y1J A;  7ICN A;  2ZIW B;  1F44 A;  3SAF A;  3SYZ A;  1S8O A;  7ICQ A;  2ZXH A;  3D2Q A;  3G6Y A;  5DGA A;  1RPL A;  2AH5 A;  5AKX A;  2W3R A;  4PZO A;  1U49 A;  3I1Y A;  2YB4 A;  2XY6 A;  5B5E U;  2RP5 A;  4JUZ A;  2XI9 A;  3NRZ A;  1QSS A;  4K4H A;  3UXN A;  1Z3E B;  3GDX A;  3HKZ C;  3MGH A;  3AM9 A;  1QSY A;  3KTQ A;  4YMM A;  2B21 A;  3HIL A;  4QZC A;  4QWE A;  3QU4 A;  3WK5 A;  5HHH A;  4M9N A;  9ICG A;  1X9S A;  3WKD A;  4PZN A;  5HNK A;  2LM4 A;  3RBD A;  2KEY A;  1UA0 A;  1Q8K A;  9ICI A;  1RM6 C;  2PFQ A;  4UAW A;  1K1S A;  4ELV A;  1KN5 A;  2M0N A;  4OJO A;  3PW0 A;  1TKD A;  1BGX T;  5DG7 A;  4F3O A;  5J0S A;  3QYP A;  1RXW A;  5AKE A;  5ALZ A; 
#chains in the Genus database with same CATH homology
 1DRG A;  4P0P B;  2G06 A;  2XVT A;  2OXO A;  3F5E A;  4QNL A;  2CPR A;  4JMU A;  2G5I B;  2HBM A;  3ALR A;  1PVQ A;  5KL8 B;  4ACO A;  2DGZ A;  3N7R C;  3M6K A;  2Y0S F;  3PSI A;  4ICA A;  1CRX A;  2H3Z A;  2K8A A;  2ZXI A;  4NV0 A;  2WB1 F;  2CRX A;  3N7S C;  3IP4 B;  1HIW A;  2K8B B;  1Z1B A;  4CRX A;  4BX9 C;  4KX3 A;  2ZG6 A;  2JMG A;  3RFA A;  2W03 A;  1Q3U A;  1D8B A;  4KMO B;  4P0Q B;  2KIW A;  2K89 A;  2W04 A;  4GFJ A;  2KHQ A;  5A0L A;  3MGV A;  2D6F C;  1PVR A;  2WAQ F;  2VJ4 A;  2H3Q A;  2NV3 A;  2G09 A;  2JH1 A;  4AYB C;  4PL1 A;  1WUD A;  2XID A;  5CRX A;  2K4I A;  1L6N A;  2E5S A;  2LBO A;  4FZM A;  1PVP A;  2PMZ F;  1Q3V A;  3PST A;  1ED1 A;  2KHV A;  2G07 A;  2LHT A;  1NZB A;  4NLB A;  2G0A A;  3H0L B;  2A3V A;  2HOI A;  2F8L A;  3HKZ F;  2ZIU A;  2ZIX A;  3VC8 A;  1P7D A;  2OH2 A;  4WJ3 B;  5HR6 A;  1GO3 F;  2F2A B;  1T94 A;  2LKY A;  2VJ5 A;  2XIC A;  3CYM A;  2F77 X;  4QIW F;  2PMZ C;  1OUQ A;  3M6Z A;  2HBJ A;  3AQF A;  4BJQ A;  2H3I A;  2HOQ A;  1A0P A;  3NRW A;  3RF9 A;  3VCB A;  1SZH A;  3CRX A;  1XNS A;  3E0F A;  4PL2 A;  2KKV A;  2Y0S C;  5HR7 A;  3D2N A;  4O3M A;  2JHD A;  3K1Z A;  2ZIV B;  2KIC A;  2WB1 C;  1YT3 A;  2MA1 A;  4P0P A;  2ZIW B;  4NWI A;  4OJP A;  3PZP A;  3SAF A;  1F44 A;  2HBL A;  2HMX A;  3KFU F;  3PSP A;  4KX5 A;  3IN5 A;  2ZXH A;  3D2Q A;  3H0M B;  4BUG A;  3ICX A;  3PSF A;  2K8C B;  2H3F A;  3IG8 A;  2WAQ C;  2W7P A;  3D2S A;  3IG5 A;  2KJ9 A;  2H3V A;  3AQE A;  3GU3 A;  3L3F X;  5T14 A;  3C29 A;  2E1E A;  2G08 A;  1ECW A;  4FE3 A;  1ZQ1 C;  3F5A A;  2KVC A;  1IIP A;  1A6S A;  2YB4 A;  3SAH A;  2Z7J A;  2KKP A;  3LYS A;  4P0Q A;  3SQI A;  2Q4T A;  2HBK A;  2JGA A;  3F53 A;  3OPX A;  2RP5 A;  2JH7 A;  4FZN A;  3GZF A;  3O0F A;  2RHF A;  2F76 X;  2K4E A;  2DQN B;  2MRL A;  2XI9 A;  2YB1 A;  1MA7 A;  1KBU A;  2HOF A;  3F2C A;  3HKZ C;  2RRD A;  4OJ5 A;  5KL1 B;  4QIW C;  4A8E A;  2LYB A;  4CGZ A;  4NLC A;  4OJ6 A;  2K4H A;  3F2D A;  5C0Y A;  3H0R B;  4OO1 J;  3SMV A;  2KV2 A;  2KNJ A;  2R18 A;  2KOB A;  3T79 A;  4U7C A;  3CP8 A;  3SAG A;  1XO0 A;  2E1F A;  2OYY A;  3F2B A;  3AL0 B;  3LVV A;  4FZL A;  1HEK A;  3ONN A;  4CDG A;  2G5H B;  2KEY A;  2VKQ A;  4AYB F;  2ZIU B;  2YX8 A;  2ZIX B;  4C0Z A;  3NUQ A;  1TAM A;  2GOL A;  3LVW A;  2BDU A;  2KJ5 A;  3C28 A;  2VIX A;  1URJ A;  2CN1 A;  2KJ8 A;  2DF4 B;  2M0N A;  4IC9 A;  4OJO A;  3M7D A;  1UPH A;  2OM6 A;  2ZIV A;  4QJF B;  3DEE A;  2N1R A;  4OJL A;  2W7O A;  2ZIW A;  3KZX A;  3N7P D;  2GH1 A;  4U6P A;  1Z19 A;  2KD1 A;  2LYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...