2F76X

Solution structure of the m-pmv wild type matrix protein (p10)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
100
structure length
100
Chain Sequence
MGQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Core protein p10
publication title D-retrovirus morphogenetic switch driven by the targeting signal accessibility to Tctex-1 of dynein.
pubmed doi rcsb
source organism Simian retrovirus 1
total genus 30
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02337 Gag_p10 Retroviral GAG p10 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.490 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f76X00
2F76X 2F77X
chains in the Genus database with same CATH superfamily
1BVSA 1T3NA 3RJKA 4ECRA 3PVXA 7ICFA 1UQVA 1TVAA 7ICEA 4WJ3B 2ZIUA 4RPXA 2MU2A 5KG5A 5AKIA 2KN7A 5KFRA 4UARA 3M6KA 4NXZA 1ZQSA 4FBTA 4DL3A 3IHQB 2HSZA 2LM1A 3RB6A 2VJ4A 4ED0A 5F9LA 4CDGA 3PX4A 1ZQMA 3NASA 5KFKA 2QLTA 3TARA 1P7DA 4UB4A 1PK1B 4O3OA 2W43A 4QNLA 1U48A 1T94A 1Z00B 4NLCA 5ALHA 2KE7A 8ICTA 4NY8A 3UXNA 2WTFA 1SGGA 1CUKA 1ZD3A 4OJOA 1ZQQA 2YY6A 2HOQA 5J2FA 4C7YA 4QW9A 4XQ8A 1KFSA 1MA7A 3Q8RB 1D9DA 1K1QA 4B9VA 2XGPA 4RQ1A 4BUGA 4TURA 2DBYA 4NLKA 2LHTA 5KFFA 2QB0A 2ZIXB 2W3RA 4LVSA 2XY5A 3RAXA 4QIWF 4J9NA 3PW2A 2F3NA 4UB5A 3Q8QB 3RJIA 2OXOA 5J29A 4YG2A 3V7JA 4BXOB 3ALRA 4KLSA 2NV3A 4ED6A 3JPNA 4MHVA 3TQ1A 3QZ8A 4GFJA 2WF8A 5J2EA 3VCBA 2K4HA 5KTQA 4QJFB 5J2DA 3PMNA 9ICBA 1S5LU 2KFZA 7ICSA 1S97A 2ZJ5A 4UBCA 3H0RB 4YMOA 3M1YA 3SAGA 5J2JA 4C4TA 2JHDA 4DL4A 2FMQA 4MFAA 3PO5A 3IV6A 2PXIA 1YZ7A 3OTQA 1MSWD 4C8MA 4NLZA 2JRZA 3EWAA 4DWIA 1SL2A 2ES6A 2IOFA 3RJHA 1L3SA 4I2BA 4TUPA 4HYKA 2VIXA 3HWTA 2WFAA 2BR0A 3D2QA 3KKAA 1B43A 2M0NA 5KFTA 5CEHA 1N5WA 1Z3EB 1TK5A 3H0MB 5DBAA 4PHAA 2DF4B 2AGQA 1ZQHA 2KK0A 2NRVA 4PZOA 4YR3A 4KLGA 2HHUA 4ECYA 4F5OA 2RDIA 3TADA 8ICKA 5KT2A 4J9MA 5J0TA 1N60A 4DLEA 2AQ4A 5HHIA 2WAQF 3ZD9A 8ICHA 2D6FC 1F5SA 2ZG6A 5KAIU 2ASLA 1S77D 5KG7A 5J2BA 8ICAA 3CW2C 5AK6A 1JIHA 1N62A 5AHXA 2I1QA 4NLBA 5H2FU 5B66U 3UPQA 2W9BB 4FO6A 1MQ3A 2G5IB 3WK9A 4QWEA 5ALWA 5GTHU 2R8GA 4F4WA 2N1RA 2HBJA 7ICHA 2YN4A 2V9WA 2OCEA 2DWQA 5AI9A 2IBKA 3E2EA 1VDVA 1SV4A 2V4RA 2BDPA 4I27A 4RUAA 5AKZA 2W03A 3H7IA 5J2AA 2Q0ZX 2EAMA 3KZXA 4DL2A 4O5CA 4KLEA 3L5KA 1ZQDA 3IRUA 2BPCA 2W8KA 3JPQA 4PGQA 2FPLA 9ICNA 4JMUA 4QIWC 1V9PA 9ICOA 1BPEA 4DEZA 1N56A 4P4PA 5AKHA 4M9HA 4J9OA 4PGYA 3BQ2A 2VKQA 2ZIVB 3RBEA 4ZH4A 4Q44A 4KN4A 1UPHA 3EUB2 3TFRA 5CP2A 2OEHA 3QU2A 5DQHA 4NL9C 3C5GA 1RXWA 2BHNA 5D46A 2IOFK 2RDJA 1KDHA 7ICNA 1DK2A 4YR0A 5DB8A 4DLGA 4MEXA 1D8LA 2WF9A 3GDXA 3SENA 1ZYQA 5J0XA 7ICKA 4EYHB 3SMVA 5J0RA 4EBDA 5KL1B 1X6JA 2ZUCA 3PW7A 1A6SA 1SWVA 1X66A 3BS5B 4XA5A 4KMOB 4I2FA 5J0YA 4DS4A 1DGJA 7ICLA 1N61A 3EPGA 4ECVA 2ATLA 5KFXA 3LK9A 5J2IA 5ALLA 5ALMA 1WWVA 8ICNA 2XIDA 3HILA 3GU3A 4E0DA 4YP3A 5AIAA 3D6JA 2K4EA 3UQ2A 5HR6A 1Q46A 3DEEA 3TAQA 1TK8A 1BNOA 2XGQA 4KLDA 4ED3A 4NJ8A 2ASDA 4DFJA 4Q8EA 3A0BU 3C2LA 4DSEA 1XSPA 1WUDA 1UCVA 1ZQEA 2DFLA 1ZD5A 5AI5A 4QZ8A 2F44A 4PZNA 4MF2A 4O3SA 4NWIA 5L1KA 5ALOA 1ZD4A 1C20A 3PSTA 3KHLA 3O0FA 2ZTDA 1MC8A 4C8KA 7ICMA 5L1MA 2KSOB 1Z4OA 3FYHA 1Z1VA 7ICQA 1L3VA 2LYAA 2F2AB 5HP4A 3E58A 1X9MA 2W8LA 2A1AA 8ICIA 3JPTA 2ZJAA 3ZDCA 1L7OA 3PNCA 1B0XA 4GXKA 3HP6A 2JXJA 1MN8A 3GFKB 4K4IA 3NRWA 4QZBA 2FPKA 3K4GA 5DQIA 2F76X 5AKGA 1L8OA 1XS9D 1ZQ1C 4JK1A 5KFMA 1NZBA 1JX4A 2JR5A 1JUDA 3Q8PB 4KX5A 1SKWA 1HJPA 5KFQA 3DV9A 2EH9A 3IG5A 9ICAA 4DFMA 3IG8A 2JZBB 1S0OA 1QTMA 3H4BA 3THVA 2E8MA 8ICSA 4IQWA 2HHWA 4R8UB 4YFKA 2LBOA 4Y2UA 2QARA 2AGPA 3RRGA 1ZQZA 1PZNA 4FFDA 5DDMA 4I2CA 2R8JA 4QZGA 1UT8A 5KFHA 1NK9A 5IILA 1ZQPA 3BQ0A 1DGSA 4RQ5A 4IRCA 3C21A 2F1HA 4I2JA 2CXYA 4UB3A 1TAQA 2WF5A 8ICLA 5J0UA 4O3MA 1CRXA 9ICRA 5KFLA 2LPEA 2ISOA 2QB1A 4CF3A 4DCCA 4O0IA 3NVVA 2JH7A 3HPOA 9ICJA 2H3QA 5KT6A 1SWWA 1NJZA 3BZCA 4PH5A 1XWLA 4KN7A 3RB4A 5AI0A 2F8LA 1ZQIA 3BJYA 5KFDA 3MR5A 3PSFA 1ZQFA 1FFVA 1LKYA 4UAYA 3SEIA 2DKXA 4QWDA 1S0NA 3OHAA 1H38A 2I5HA 2LM4A 2YB4A 3RFAA 4KLTA 3N7RC 5KT3A 4RZRA 3T5JA 3UXOA 2EQYA 4DSIA 5F3XB 1QQ6A 3FC4A 2BCVA 3UQ0A 7ICUA 3NVYA 2KKPA 1HIWA 3IDWA 4RU9A 2YTUA 2MSNA 2G08A 2B21A 3PZPA 2D3DA 4ECQA 1ZQYA 1IG6A 5EE1A 4KLJA 2FDRA 2ZUDA 1JN3A 2C2DA 4P4MA 1ZQCA 1XO1A 4XUSA 1X2IA 3H8WA 2K4PA 1J2NA 4G3IA 5J8YA 5JUMA 1XU4A 2PFQA 1T3QA 1ZQOA 1L7MA 3B0XA 4B9TA 4NLNA 4OJPA 8ICWA 4QZFA 4J03A 4YR2A 2KP7A 4I29A 1DRGA 5KFNA 2XCPA 4X5VA 5DGAA 3RB3A 4M9JA 3ICXA 3B0YA 4TUSA 5CR0A 2JGAA 4Q45A 2JEFA 1T7PA 3CP8A 2BCUA 1OW5A 2W9MA 5L1JA 5AM4A 3PR4A 3U26A 4O3QA 4NLGA 3C1YA 5EE0A 3RR7A 3ZI4A 3KKAC 4ELUA 1X9SA 2KV2A 3EZ5A 3ZDEA 4ZOHC 2ZIWB 2A3VA 3H40A 2Y1JA 4M6WA 2ALZA 3Q8LA 2QB0B 2VA3A 2XY6A 4IS7A 4FE3A 3NRZA 1XSLA 3TADC 2HOIA 1J2MA 4GLXA 2NRZA 1ZQVA 1IXRA 1SZPA 2HHQA 4PHDA 1KFDA 1PVQA 2P6UA 4IRDA 4FS2A 2Y9UA 3BS7A 2MA1A 1S10A 2I6XA 3LVWA 4UQGA 4BDPA 1EXNA 1O08A 3HKZF 2FJ6A 5GTIU 4EEKA 3Q8SB 2PI4A 2D8CA 1L3UA 3GV8B 1S0VA 4TQRA 5A0LA 4DL5A 5CJ7A 5IIOA 3TFSA 3SI8A 1NK5A 4F5RA 2AJQA 1Z19A 5BOMA 5AKKA 1L8LA 5KFYA 3JPSA 2KNJA 3C1ZA 1LV5A 4F91B 2VJ5A 2NO4A 2XICA 2HVIA 3QUCA 3MBYA 2YQEA 4J9QA 2KZ3A 2EANA 2LYHA 1YT3A 3LYSA 4O5KA 4ECXA 2G5HB 2KIVA 1SL0A 7ICVA 2UVVA 4KLHA 5DGBA 1BPZA 1LVHA 3GZFA 4PPXA 1SZHA 5ALDA 4XRHA 2GO7A 2NRTA 4K4GA 4KLQA 1JMSA 5D49A 3QU9A 4O3NA 4IL6U 2E3TA 2WB1F 1ZQTA 2BCQA 3H8SA 4OO1J 4RQ2A 1A0PA 4M04A 4M9NA 7ICTA 5KT5A 1B4FA 5J0QA 2ZIXA 2RP5A 4DOBA 4GXIA 4U7CA 2E8OA 4ACOA 5DB6A 4YCXA 2HHTA 3QX7A 2WHEA 2W7PA 5KG3A 3RF9A 3T79A 1Z4NA 3MGVA 1XO0A 4O9MA 2NRXA 1FFUA 2ZTEA 3KFUF 2JV3A 2HHVA 5KFJA 4Y2PA 4FZMA 3RJGA 4CF5A 3KD3A 4Q8FA 2EZXA 3Q8KA 2R18A 4DFDA 3ZDAA 2P6RA 8ICVA 3SV3A 3I1YA 4MF8A 1UHUA 2A1JA 2KG5A 3BZKA 2LMRA 2BPFA 1B22A 4DSKA 5EE9A 3UMBA 3IM1A 1K1SA 3ZD8A 2AXTU 1X9WA 4U6PA 5J0PA 3EYZA 3KTQA 4IQTA 4UAVA 3M7DA 2EZZA 5EWEA 2W7OA 2KJ9A 4DOCA 2VA8A 1ZRMA 2KZZA 4UBBA 2IHNA 2G09A 3N7SC 3G6XA 3WK5A 3EW9A 3RB0A 2GWSA 1RM6C 1RZTA 3I28A 4M2YA 5ALSA 2PFOA 1RYRA 2F8KA 4DSJA 4I2DA 4CRXA 5KFSA 9ICFA 2RQ5A 1TFRA 3QYPA 5CB1A 1A76A 5AIBA 4RNOA 5J0OA 1ZQNA 3PSPA 3B9JA 1T4GA 5ALIA 1YZ6A 3PO4A 3GV7B 4Z6CA 4M9GA 3H4DA 2OHFA 4KLLA 8ICPA 3QU5A 4IR1A 3LDAA 2HOFA 4NM1A 4RPZA 2Q4TA 4RQ4A 1ZQGA 4Y2JA 8ICEA 2UVRA 7ICPA 1WG8A 9ICPA 4EEYA 1NJXA 3JPOA 5AKYA 1XSNA 1FIQA 2DKZA 4KTQA 9ICVA 1PVRA 2JEGA 3Q8MA 2Y0SF 1SIJA 2FLPA 1KFTA 4ELTA 3C23A 5DB7A 2FLNA 1NK7A 4EX7A 3QZ7A 4P2HA 4DQRA 3D2NA 3F2BA 2BDUA 4RQMA 1NK8A 1X6IA 5AM2A 3SV4A 5ALYA 4PL1A 4YVZA 1SV0A 3SQIA 5DKWA 4JV2A 1RDFA 2J6UA 4JUZA 3ISDA 5DBBA 4RPYA 5JRTA 1BPXA 2HMXA 1OXJA 4P0QA 1RXVA 4G9BA 2KD1A 1KQQA 1SB3C 4BX9C 9ICLA 5ALUA 2WAQC 4QZAA 5G5GA 2HBMA 5AI8A 4C8OA 5D4BA 3I76A 3IN5A 3T5KA 1HUZA 1ZJMA 1QLNA 4ECSA 4ICAA 1J97A 5AI4A 4F92B 1UA1A 1ZJNA 3K75D 2H3ZA 4RQ0A 2ISPA 3QXGA 4O3RA 4IC9A 2MUTA 2W9AA 2C22A 3SAHA 1O03A 4FS1A 2M9NA 1L6NA 4F5PA 4JWNA 1IM4A 4B9UA 3FAHA 4F5QA 4Y2SA 4RQ8A 2LYBA 5AKXA 4EYIB 4F5NA 4EZ6A 4OCZA 2QARB 3MDCA 1D8YA 4KITB 9ICSA 3C29A 3D2SA 2JEIA 5EOZA 4RT2A 2H5XA 3QU7A 4I2IA 4DFPA 2VA2A 1BGXT 4P0PA 2YX8A 1ZQWA 2EAPA 3PV8A 3F53A 5ALGA 4C8NA 5HMMA 2E8NA 2HHXA 4QZEA 3F5AA 3AL0B 1ZRNA 2PKEA 3MR6A 5J8YC 4J9PA 5KG0A 4DL6A 2O6KA 3WK8A 3KZIU 3PSIA 2LI6A 4CF4A 1ZQKA 4UAUA 3ZDBA 5KFWA 3F5EA 4YXMA 1NI3A 1RQLA 2V4QA 2NO5A 5DLGA 4GC6A 4R65A 3M9MB 4F72A 1LKYB 1WCNA 5DDYA 3QEBZ 2H3VA 4C8LA 3AN1A 3RR8A 5F9NA 3DDHA 3TACB 5KG6A 1ZQAA 5J2HA 3M6ZA 5KL8B 2Y0SC 5ALFA 3K1ZA 2CN1A 2VANA 3HT3A 1X9XA 4ECTA 1L3TA 3LWLA 3FDSA 5ALXA 2KHQA 4F3OA 4ECUA 2YMPA 3PY8A 1U9LA 4KX3A 3GIIA 5KFUA 3BQ1A 4I2GA 3H8JA 9ICTA 4J9LA 4QZCA 4Z6DA 4OD0A 2JEJA 1CI4A 1SXDA 1JRPA 3BDPA 2YB1A 1NKEA 1WCLA 5ALJA 4O3PA 5AKJA 5AI6A 4F4ZA 3TKAA 3WK4A 5BPCA 1BPDA 5J0WA 1M6YA 3FM9A 3HX0A 2JMGA 7ICOA 1Q8KA 1N48A 2PFPA 2W9CA 2G06A 4RQ7A 3T3FA 3RJEA 5AKEA 2DL0A 4ED1A 1U47A 3QNMA 2ZUBA 3RRHA 3AMZA 3N97B 2BGWA 1GO3F 5C0YA 4KLIA 4NV0A 1HEKA 1ZQUA 5ALTA 1QSSA 8ICRA 3NTUA 1QQ7A 3GIJA 4UB8U 2W55A 4Y2YA 4EBCA 1XC9A 2PI5A 3QUTA 3WKCA 1S8OA 2ZIUB 5B5EU 1CEZA 2KOBA 3AQFA 1N5XA 4QZ9A 5KT4A 2EZYA 4M6WB 4IR9A 2F77X 4UATA 4RNMA 4DOAA 4QWCA 1X40A 2KHVA 3V6HA 1TAMA 1FO4A 4RNNA 3WKEA 1KBUA 4HAIA 3ETLA 2AHOB 1HUOA 4LZGA 4KLUA 3T5LA 2HVHA 4JB3A 2OM6A 1ZQJA 3OJSA 3KHGA 2BQUA 9ICCA 1ZQXA 1JALA 4IQVA 1VLBA 8ICYA 5HHHA 1KW4A 5J2CA 2BKEA 2GLEA 2BPGA 4RT3A 3SR6A 5KFZA 1KSPA 4BJQA 2HDOA 5ALNA 2HW3A 1DOQA 5IIIA 2DQNB 8ICFA 5ALRA 1F44A 5IIJA 2BQ3A 3AU6A 5JTIA 5KG2A 5AM1A 4UB6U 4C4RA 3GIMA 5L1IA 4Q43A 1QH9A 9ICKA 3M8SA 1TV9A 5L1LA 4B9SA 4R63A 1NJWA 3J81j 1JROA 1KN5A 5ALPA 2XI9A 3PR5B 7ICGA 3RTVA 3LVVA 2G07A 2IHMA 1S0MA 2B0CA 5AM5A 5TZVA 5K4LA 5KNIA 3A0HU 1FEZA 4RQNA 4M0AA 3TI0A 5DG9A 5KG4A 4F8RA 3V6KA 2R8IA 4ELVA 2E1FA 3GIKA 5EE3A 9ICEA 1WYGA 4J9KA 1RYUA 2OH2A 2YMQA 1TE2A 2BQRA 1DXSA 2AQ0A 4I2HA 2ZIWA 2K4IA 5HNKA 2HCFA 1NK0A 3ISBA 3ZDDA 3L4PA 3CYMA 2ZJ8A 4PL2A 2UVUA 3MGHA 4TUQA 4FZLA 4AYBF 4M47A 4DL7A 1PK1A 4C4SA 1N63A 5IINA 8ICBA 1UT5A 2R8KA 1RQNA 1Z00A 5KFBA 4DFKA 3QUQA 5AM3A 2C28A 8ICQA 4LJXA 4UASA 1QSLA 3GILA 4Y2XA 1TKDA 3BQTA 4F4KA 3S6JA 4M9LA 2A19A 3WKDA 4P4OA 2DPIA 9ICHA 1UA0A 2EAOA 2A1JB 5L9XA 4F50A 2WF7A 4CE6A 4USAA 2HHSA 4F71A 3L3FX 4RQ3A 2IMWP 1NKBA 2FMPA 3RJFA 2G0AA 3H0LB 4B9MA 1LB2B 4LZDA 2PMZF 2KJ5A 4BXOA 3V7LA 5J2GA 1X42A 1OUQA 4O5EA 4DO9A 5DG8A 3SAFA 2Z7JA 2E8PA 1V85A 3ORYA 2NYVA 4ECZA 1TK0A 3M9NB 1JXLA 2J6TA 4GXJA 1L7NA 4OJ6A 3HJEA 3MFHA 3MGIA 1SV0C 4CGZA 5AK5A 2YMMA 3NUQA 1KRPA 1KLNA 4CNQA 5DQGA 3V72A 2OWOA 3V6JA 3RH6A 3NVWA 3PMLA 3UXPA 4B6JA 1PUZA 2AGOA 3ED5A 2K8CB 4EELA 2ZXHA 1BPYA 4YD2A 2UVWA 1AROP 1NNLA 1NZPA 3UMGA 4RUCA 5EWGA 3F2DA 4Y2QA 7ICJA 5T14A 1RPLA 2KZMA 3OGUA 3HKZC 1ECWA 1BNPA 9ICMA 4F4YA 2CPRA 2FLLA 3RBDA 1NJYA 4DQIA 2PFNA 4US9A 2K8AA 5CHGA 3TAPA 1Q3UA 3N28A 1KTQA 5CWRA 5HMLA 3F2CA 1ZXIA 4MEYA 5AK4A 3RJJA 4PHPA 1L7PA 3MDAA 2J6SA 1S9FA 3AM9A 1URJA 3GV5B 2C2EA 2BCSA 8ICUA 2QKQA 1D9FA 2NRWA 1ZQBA 3PX6A 2KICA 1T8EA 1QQ5A 3TANA 2R8HA 1RG6A 5EWFA 2KEYA 3C2MA 5BOLA 3VC8A 5CRXA 4AYBC 2KFNA 2L5YA 2W9BA 3QE9Y 2MAXA 4UAWA 3SD7A 3JPPA 4MFCA 4UAZA 3NS1A 4P0QB 1KL9A 5J2KA 5AICA 3SYZA 4JV0A 2WB1C 4PGXA 4DQSA 4F2RA 4ED7A 1MQ2A 2K89A 8ICZA 3MR3A 4PJ0U 4UB1A 3MR2A 5JU5A 3ONNA 1ZOLA 3M9OB 1TAUA 4Y2TA 9ICGA 2OYYA 9ICWA 3E0FA 2Y9TA 4B9NA 4BWMA 2K8BB 2MUTB 4YD1A 8ICCA 2RHFA 2KVSA 2ZIVA 2AU0A 2PMZC 2W04A 2HI0A 5KG1A 2XY7A 5C5JA 2GH1A 3UMCA 1F0MA 1PVPA 4R66A 4EX6A 5KT7A 3CRXA 4Z6FA 2HBLA 1JXEA 1Z1BA 2K60A 3WKAA 5AKLA 1Q3VA 8ICJA 1BPBA 4TQSA 4I2EA 4P0PB 2ASJA 4YMMA 5G5HA 1IIPA 4J9SA 4JV1A 5AK3A 5TISU 4KLMA 1K5OA 2C2RA 4CCHA 4IRKA 3BS5A 9ICIA 4YXJA 3PW4A 3G6YA 1IV8A 1COOA 2DUYA 3OPXA 3ETRA 3G6VA 1SKRA 2KIWA 3IP4B 9ICQA 4I2AA 4YMNA 3OJUA 2KJ8A 4Y2VA 2BCRA 3EPIA 4NM2A 5E79U 3RH5A 3AEVA 3AU2A 4OJ5A 1AQ6A 3WK6A 2FI1A 2H3IA 2KMDA 2WF6A 5DB9A 3KOOA 3RAQA 1RYSA 5KFGA 1COKA 5DBCA 3QU4A 2Y1IA 3N7PD 1QSYA 2E5SA 4EZ9A 2DGZA 2W11A 3HW8A 2W54A 2B6GA 1V38A 2P66A 2LKYA 2ZXIA 3OHBA 5IIMA 2FMSA 5IIKA 4UW9A 3PW5A 3C28A 4C7ZA 7ICIA 1D8BA 3BQ7A 4NL9A 1NOMA 1ZQLA 5KFOA 5J0SA 4JWMA 3OSPA 2ZTCA 3ISCA 4QWBA 3WK7A 5KFCA 1V97A 2W3SA 3AUOA 4DQQA 5CA7A 5KFVA 2BZFA 4FZNA 8ICOA 2KSOA 2KKVA 5ALEA 5HR7A 3C5FA 1ZQRA 4GC7A 2ESEA 4KLOA 3KBBA 4OJLA 4RQ6A 4ECWA 5ALQA 4B9LA 1S76D 4EENA 4QZDA 2CRXA 3M8RA 3OSNA 5DG7A 3WKBA 3SZ2A 3MABA 2W9CB 3C2KA 1L5UA 3HRDD 5ALKA 5ALVA 4FBUA 4A8EA 5ALZA 3R9KA 3H8MA 3GQCA 3RH4A 1SL1A 4C80A 7ICRA 2EDUA 3T5HA 4F4XA 2IOHA 2YMLA 2IA6A 2E1EA 4DF8A 4DSFA 4F93B 4ED8A 3V7KA 1XNSA 1A77A 4UB2A 1U4BA 2JZBA 1VJ5A 2XO7A 4R64A 3KHHA 4DF4A 4DQPA 2XC9A 1ZETA 2H3FA 1PK3A 4ED2A 4R8UA 1DK3A 4GIBA 4J9RA 1U45A 4DSLA 4IQUA 3NVZA 4QW8A 4QZHA 3QUBA 4AP9A 4BGDA 4KLFA 3NGDA 4K4HA 4PHEA 2RRDA 2JH1A 3KHRA 2XCAA 5DLFA 3LWMA 3PX0A 3PW0A 5AM0A 2HBKA 4QZIA 2ODGA 1SXEA 1NK6A 1KEJA 3MC1A 5KFPA 4I28A 2F1JA 2KVCA 1C7YA 5KFIA 4BWJA 3AQEA 8ICGA 2DPJA 1NKCA 2GOLA 1Y88A 2XVTA 2FE9A 4Z6EA 1ED1A 4F2SA 2KTQA 8ICXA 1N2XA 4KMUA 4QWAA 3UM9A 1JI7A 4US8A 8ICMA 9ICXA 2MRLA 2FPMA 2AH5A 1ZD2P 4YQWA 1SKSA 1WWUA 3CNHA 3QEAZ 1QCKA 5KFAA 3WU2U 3N4MB 3JPRA 4YN4A 4EBEA 5KFEA 2I9GA 3MFIA 9ICUA 4C0ZA 1NK4A 1KKXA 4DS5A 2F1IA 4Y2RA 2P35A 5FP0A 4MFFA 2RLTA 5KAFU 3K1RB 1U49A
chains in the Genus database with same CATH topology
2E1EA 2G06A 2KEYA 3F53A 3OPXA 2K4HA 2K4EA 2N1RA 1Z19A 2KIWA 2PMZF 3IP4B 2KJ5A 2HBJA 3VC8A 4QJFB 5HR6A 1XNSA 3DEEA 2XI9A 3F5AA 5CRXA 4AYBC 2KJ8A 3AL0B 1GO3F 5C0YA 4NV0A 1OUQA 1HEKA 2KNJA 3LVVA 3D2NA 2G07A 3H0RB 4WJ3B 3SAFA 2Z7JA 3F2BA 2W03A 2H3FA 2BDUA 3SAGA 4OJ5A 2JHDA 2VJ5A 2H3IA 2ZIUA 4P0QB 2XICA 3KZXA 4OJPA 4PL1A 4U6PA 1WUDA 3PSIA 3M6KA 3M7DA 3F5EA 3SQIA 1YT3A 2E1FA 1DRGA 4OJ6A 2W7OA 2ZIUB 2KJ9A 3LYSA 2WB1C 2G5HB 3ICXA 4JMUA 4QIWC 4O3MA 2OH2A 1CRXA 2JGAA 4CGZA 2VIXA 3N7PD 2VJ4A 3GZFA 4NWIA 2K89A 2KOBA 2G09A 2E5SA 3AQFA 1SZHA 2HMXA 3CP8A 3N7SC 2DGZA 3D2QA 4P0QA 4CDGA 2LKYA 3NUQA 2VKQA 2KD1A 2M0NA 2RRDA 2ZIVB 2JH1A 2K4IA 2ZIWA 2ZXIA 3ONNA 2F77X 3PSTA 3O0FA 4BX9C 3C28A 2OYYA 2H3VA 3E0FA 2KHVA 3H0MB 1D8BA 2WAQC 1TAMA 1P7DA 2JH7A 2DF4B 4QNLA 2KV2A 2K8CB 1UPHA 2ZXHA 2HBMA 3M6ZA 2ZIWB 2H3QA 2HBKA 2K8BB 2Y0SC 1T94A 4NLCA 5KL8B 3K1ZA 1KBUA 2A3VA 3IN5A 2CN1A 2F8LA 2WB1F 2LYAA 2F2AB 3CYMA 2RHFA 4ICAA 3F2DA 3PSFA 2OM6A 4PL2A 2KHQA 2KVCA 2ZIVA 5T14A 4CRXA 2PMZC 4FZLA 2W04A 4AYBF 4KX3A 4OO1J 4FE3A 2H3ZA 1A0PA 3AQEA 3HKZC 4FZNA 1ECWA 2GOLA 4OJOA 2GH1A 4IC9A 2KKVA 2HOQA 2XVTA 1PVPA 2HOIA 2CPRA 1ED1A 2WAQF 2ZIXA 5HR7A 2RP5A 3CRXA 2YB4A 3RFAA 3SAHA 3PSPA 1MA7A 4U7CA 3N7RC 3SMVA 1L6NA 3NRWA 5KL1B 2D6FC 2K8AA 4ACOA 2ZG6A 4BJQA 4BUGA 4OJLA 1Q3UA 2LHTA 1PVQA 2F76X 2HBLA 2YB1A 2ZIXB 2W7PA 1A6SA 2MRLA 1ZQ1C 4KMOB 3RF9A 3T79A 1Z1BA 1Q3VA 4QIWF 2MA1A 2DQNB 1NZBA 3MGVA 3F2CA 1XO0A 2LYBA 2HOFA 3LVWA 1F44A 2Q4TA 2CRXA 2KKPA 1HIWA 4P0PB 3HKZF 4KX5A 3KFUF 2OXOA 2G08A 1IIPA 3PZPA 4FZMA 3ALRA 3IG5A 1URJA 4C0ZA 4NLBA 2NV3A 3IG8A 4A8EA 5A0LA 3C29A 1PVRA 3L3FX 3D2SA 4GFJA 2Y0SF 2G0AA 3H0LB 2XIDA 2KICA 2R18A 2JMGA 3GU3A 2G5IB 4P0PA 2YX8A 3VCBA 2LBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F76 X;  2F77 X; 
#chains in the Genus database with same CATH topology
 1BVS A;  1T3N A;  3RJK A;  4ECR A;  3PVX A;  7ICF A;  1UQV A;  1TVA A;  7ICE A;  4WJ3 B;  2ZIU A;  4RPX A;  2MU2 A;  5KG5 A;  5AKI A;  2KN7 A;  5KFR A;  4UAR A;  3M6K A;  4NXZ A;  1ZQS A;  4FBT A;  4DL3 A;  3IHQ B;  2HSZ A;  2LM1 A;  3RB6 A;  2VJ4 A;  4ED0 A;  5F9L A;  4CDG A;  3PX4 A;  1ZQM A;  3NAS A;  5KFK A;  2QLT A;  3TAR A;  1P7D A;  4UB4 A;  1PK1 B;  4O3O A;  2W43 A;  4QNL A;  1U48 A;  1T94 A;  1Z00 B;  4NLC A;  5ALH A;  2KE7 A;  8ICT A;  4NY8 A;  3UXN A;  2WTF A;  1SGG A;  1CUK A;  1ZD3 A;  4OJO A;  1ZQQ A;  2YY6 A;  2HOQ A;  5J2F A;  4C7Y A;  4QW9 A;  4XQ8 A;  1KFS A;  1MA7 A;  3Q8R B;  1D9D A;  1K1Q A;  4B9V A;  2XGP A;  4RQ1 A;  4BUG A;  4TUR A;  2DBY A;  4NLK A;  2LHT A;  5KFF A;  2QB0 A;  2ZIX B;  2W3R A;  4LVS A;  2XY5 A;  3RAX A;  4QIW F;  4J9N A;  3PW2 A;  2F3N A;  4UB5 A;  3Q8Q B;  3RJI A;  2OXO A;  5J29 A;  4YG2 A;  3V7J A;  4BXO B;  3ALR A;  4KLS A;  2NV3 A;  4ED6 A;  3JPN A;  4MHV A;  3TQ1 A;  3QZ8 A;  4GFJ A;  2WF8 A;  5J2E A;  3VCB A;  2K4H A;  5KTQ A;  4QJF B;  5J2D A;  3PMN A;  9ICB A;  1S5L U;  2KFZ A;  7ICS A;  1S97 A;  2ZJ5 A;  4UBC A;  3H0R B;  4YMO A;  3M1Y A;  3SAG A;  5J2J A;  4C4T A;  2JHD A;  4DL4 A;  2FMQ A;  4MFA A;  3PO5 A;  3IV6 A;  2PXI A;  1YZ7 A;  3OTQ A;  1MSW D;  4C8M A;  4NLZ A;  2JRZ A;  3EWA A;  4DWI A;  1SL2 A;  2ES6 A;  2IOF A;  3RJH A;  1L3S A;  4I2B A;  4TUP A;  4HYK A;  2VIX A;  3HWT A;  2WFA A;  2BR0 A;  3D2Q A;  3KKA A;  1B43 A;  2M0N A;  5KFT A;  5CEH A;  1N5W A;  1Z3E B;  1TK5 A;  3H0M B;  5DBA A;  4PHA A;  2DF4 B;  2AGQ A;  1ZQH A;  2KK0 A;  2NRV A;  4PZO A;  4YR3 A;  4KLG A;  2HHU A;  4ECY A;  4F5O A;  2RDI A;  3TAD A;  8ICK A;  5KT2 A;  4J9M A;  5J0T A;  1N60 A;  4DLE A;  2AQ4 A;  5HHI A;  2WAQ F;  3ZD9 A;  8ICH A;  2D6F C;  1F5S A;  2ZG6 A;  5KAI U;  2ASL A;  1S77 D;  5KG7 A;  5J2B A;  8ICA A;  3CW2 C;  5AK6 A;  1JIH A;  1N62 A;  5AHX A;  2I1Q A;  4NLB A;  5H2F U;  5B66 U;  3UPQ A;  2W9B B;  4FO6 A;  1MQ3 A;  2G5I B;  3WK9 A;  4QWE A;  5ALW A;  5GTH U;  2R8G A;  4F4W A;  2N1R A;  2HBJ A;  7ICH A;  2YN4 A;  2V9W A;  2OCE A;  2DWQ A;  5AI9 A;  2IBK A;  3E2E A;  1VDV A;  1SV4 A;  2V4R A;  2BDP A;  4I27 A;  4RUA A;  5AKZ A;  2W03 A;  3H7I A;  5J2A A;  2Q0Z X;  2EAM A;  3KZX A;  4DL2 A;  4O5C A;  4KLE A;  3L5K A;  1ZQD A;  3IRU A;  2BPC A;  2W8K A;  3JPQ A;  4PGQ A;  2FPL A;  9ICN A;  4JMU A;  4QIW C;  1V9P A;  9ICO A;  1BPE A;  4DEZ A;  1N56 A;  4P4P A;  5AKH A;  4M9H A;  4J9O A;  4PGY A;  3BQ2 A;  2VKQ A;  2ZIV B;  3RBE A;  4ZH4 A;  4Q44 A;  4KN4 A;  1UPH A;  3EUB 2;  3TFR A;  5CP2 A;  2OEH A;  3QU2 A;  5DQH A;  4NL9 C;  3C5G A;  1RXW A;  2BHN A;  5D46 A;  2IOF K;  2RDJ A;  1KDH A;  7ICN A;  1DK2 A;  4YR0 A;  5DB8 A;  4DLG A;  4MEX A;  1D8L A;  2WF9 A;  3GDX A;  3SEN A;  1ZYQ A;  5J0X A;  7ICK A;  4EYH B;  3SMV A;  5J0R A;  4EBD A;  5KL1 B;  1X6J A;  2ZUC A;  3PW7 A;  1A6S A;  1SWV A;  1X66 A;  3BS5 B;  4XA5 A;  4KMO B;  4I2F A;  5J0Y A;  4DS4 A;  1DGJ A;  7ICL A;  1N61 A;  3EPG A;  4ECV A;  2ATL A;  5KFX A;  3LK9 A;  5J2I A;  5ALL A;  5ALM A;  1WWV A;  8ICN A;  2XID A;  3HIL A;  3GU3 A;  4E0D A;  4YP3 A;  5AIA A;  3D6J A;  2K4E A;  3UQ2 A;  5HR6 A;  1Q46 A;  3DEE A;  3TAQ A;  1TK8 A;  1BNO A;  2XGQ A;  4KLD A;  4ED3 A;  4NJ8 A;  2ASD A;  4DFJ A;  4Q8E A;  3A0B U;  3C2L A;  4DSE A;  1XSP A;  1WUD A;  1UCV A;  1ZQE A;  2DFL A;  1ZD5 A;  5AI5 A;  4QZ8 A;  2F44 A;  4PZN A;  4MF2 A;  4O3S A;  4NWI A;  5L1K A;  5ALO A;  1ZD4 A;  1C20 A;  3PST A;  3KHL A;  3O0F A;  2ZTD A;  1MC8 A;  4C8K A;  7ICM A;  5L1M A;  2KSO B;  1Z4O A;  3FYH A;  1Z1V A;  7ICQ A;  1L3V A;  2LYA A;  2F2A B;  5HP4 A;  3E58 A;  1X9M A;  2W8L A;  2A1A A;  8ICI A;  3JPT A;  2ZJA A;  3ZDC A;  1L7O A;  3PNC A;  1B0X A;  4GXK A;  3HP6 A;  2JXJ A;  1MN8 A;  3GFK B;  4K4I A;  3NRW A;  4QZB A;  2FPK A;  3K4G A;  5DQI A;  2F76 X;  5AKG A;  1L8O A;  1XS9 D;  1ZQ1 C;  4JK1 A;  5KFM A;  1NZB A;  1JX4 A;  2JR5 A;  1JUD A;  3Q8P B;  4KX5 A;  1SKW A;  1HJP A;  5KFQ A;  3DV9 A;  2EH9 A;  3IG5 A;  9ICA A;  4DFM A;  3IG8 A;  2JZB B;  1S0O A;  1QTM A;  3H4B A;  3THV A;  2E8M A;  8ICS A;  4IQW A;  2HHW A;  4R8U B;  4YFK A;  2LBO A;  4Y2U A;  2QAR A;  2AGP A;  3RRG A;  1ZQZ A;  1PZN A;  4FFD A;  5DDM A;  4I2C A;  2R8J A;  4QZG A;  1UT8 A;  5KFH A;  1NK9 A;  5IIL A;  1ZQP A;  3BQ0 A;  1DGS A;  4RQ5 A;  4IRC A;  3C21 A;  2F1H A;  4I2J A;  2CXY A;  4UB3 A;  1TAQ A;  2WF5 A;  8ICL A;  5J0U A;  4O3M A;  1CRX A;  9ICR A;  5KFL A;  2LPE A;  2ISO A;  2QB1 A;  4CF3 A;  4DCC A;  4O0I A;  3NVV A;  2JH7 A;  3HPO A;  9ICJ A;  2H3Q A;  5KT6 A;  1SWW A;  1NJZ A;  3BZC A;  4PH5 A;  1XWL A;  4KN7 A;  3RB4 A;  5AI0 A;  2F8L A;  1ZQI A;  3BJY A;  5KFD A;  3MR5 A;  3PSF A;  1ZQF A;  1FFV A;  1LKY A;  4UAY A;  3SEI A;  2DKX A;  4QWD A;  1S0N A;  3OHA A;  1H38 A;  2I5H A;  2LM4 A;  2YB4 A;  3RFA A;  4KLT A;  3N7R C;  5KT3 A;  4RZR A;  3T5J A;  3UXO A;  2EQY A;  4DSI A;  5F3X B;  1QQ6 A;  3FC4 A;  2BCV A;  3UQ0 A;  7ICU A;  3NVY A;  2KKP A;  1HIW A;  3IDW A;  4RU9 A;  2YTU A;  2MSN A;  2G08 A;  2B21 A;  3PZP A;  2D3D A;  4ECQ A;  1ZQY A;  1IG6 A;  5EE1 A;  4KLJ A;  2FDR A;  2ZUD A;  1JN3 A;  2C2D A;  4P4M A;  1ZQC A;  1XO1 A;  4XUS A;  1X2I A;  3H8W A;  2K4P A;  1J2N A;  4G3I A;  5J8Y A;  5JUM A;  1XU4 A;  2PFQ A;  1T3Q A;  1ZQO A;  1L7M A;  3B0X A;  4B9T A;  4NLN A;  4OJP A;  8ICW A;  4QZF A;  4J03 A;  4YR2 A;  2KP7 A;  4I29 A;  1DRG A;  5KFN A;  2XCP A;  4X5V A;  5DGA A;  3RB3 A;  4M9J A;  3ICX A;  3B0Y A;  4TUS A;  5CR0 A;  2JGA A;  4Q45 A;  2JEF A;  1T7P A;  3CP8 A;  2BCU A;  1OW5 A;  2W9M A;  5L1J A;  5AM4 A;  3PR4 A;  3U26 A;  4O3Q A;  4NLG A;  3C1Y A;  5EE0 A;  3RR7 A;  3ZI4 A;  3KKA C;  4ELU A;  1X9S A;  2KV2 A;  3EZ5 A;  3ZDE A;  4ZOH C;  2ZIW B;  2A3V A;  3H40 A;  2Y1J A;  4M6W A;  2ALZ A;  3Q8L A;  2QB0 B;  2VA3 A;  2XY6 A;  4IS7 A;  4FE3 A;  3NRZ A;  1XSL A;  3TAD C;  2HOI A;  1J2M A;  4GLX A;  2NRZ A;  1ZQV A;  1IXR A;  1SZP A;  2HHQ A;  4PHD A;  1KFD A;  1PVQ A;  2P6U A;  4IRD A;  4FS2 A;  2Y9U A;  3BS7 A;  2MA1 A;  1S10 A;  2I6X A;  3LVW A;  4UQG A;  4BDP A;  1EXN A;  1O08 A;  3HKZ F;  2FJ6 A;  5GTI U;  4EEK A;  3Q8S B;  2PI4 A;  2D8C A;  1L3U A;  3GV8 B;  1S0V A;  4TQR A;  5A0L A;  4DL5 A;  5CJ7 A;  5IIO A;  3TFS A;  3SI8 A;  1NK5 A;  4F5R A;  2AJQ A;  1Z19 A;  5BOM A;  5AKK A;  1L8L A;  5KFY A;  3JPS A;  2KNJ A;  3C1Z A;  1LV5 A;  4F91 B;  2VJ5 A;  2NO4 A;  2XIC A;  2HVI A;  3QUC A;  3MBY A;  2YQE A;  4J9Q A;  2KZ3 A;  2EAN A;  2LYH A;  1YT3 A;  3LYS A;  4O5K A;  4ECX A;  2G5H B;  2KIV A;  1SL0 A;  7ICV A;  2UVV A;  4KLH A;  5DGB A;  1BPZ A;  1LVH A;  3GZF A;  4PPX A;  1SZH A;  5ALD A;  4XRH A;  2GO7 A;  2NRT A;  4K4G A;  4KLQ A;  1JMS A;  5D49 A;  3QU9 A;  4O3N A;  4IL6 U;  2E3T A;  2WB1 F;  1ZQT A;  2BCQ A;  3H8S A;  4OO1 J;  4RQ2 A;  1A0P A;  4M04 A;  4M9N A;  7ICT A;  5KT5 A;  1B4F A;  5J0Q A;  2ZIX A;  2RP5 A;  4DOB A;  4GXI A;  4U7C A;  2E8O A;  4ACO A;  5DB6 A;  4YCX A;  2HHT A;  3QX7 A;  2WHE A;  2W7P A;  5KG3 A;  3RF9 A;  3T79 A;  1Z4N A;  3MGV A;  1XO0 A;  4O9M A;  2NRX A;  1FFU A;  2ZTE A;  3KFU F;  2JV3 A;  2HHV A;  5KFJ A;  4Y2P A;  4FZM A;  3RJG A;  4CF5 A;  3KD3 A;  4Q8F A;  2EZX A;  3Q8K A;  2R18 A;  4DFD A;  3ZDA A;  2P6R A;  8ICV A;  3SV3 A;  3I1Y A;  4MF8 A;  1UHU A;  2A1J A;  2KG5 A;  3BZK A;  2LMR A;  2BPF A;  1B22 A;  4DSK A;  5EE9 A;  3UMB A;  3IM1 A;  1K1S A;  3ZD8 A;  2AXT U;  1X9W A;  4U6P A;  5J0P A;  3EYZ A;  3KTQ A;  4IQT A;  4UAV A;  3M7D A;  2EZZ A;  5EWE A;  2W7O A;  2KJ9 A;  4DOC A;  2VA8 A;  1ZRM A;  2KZZ A;  4UBB A;  2IHN A;  2G09 A;  3N7S C;  3G6X A;  3WK5 A;  3EW9 A;  3RB0 A;  2GWS A;  1RM6 C;  1RZT A;  3I28 A;  4M2Y A;  5ALS A;  2PFO A;  1RYR A;  2F8K A;  4DSJ A;  4I2D A;  4CRX A;  5KFS A;  9ICF A;  2RQ5 A;  1TFR A;  3QYP A;  5CB1 A;  1A76 A;  5AIB A;  4RNO A;  5J0O A;  1ZQN A;  3PSP A;  3B9J A;  1T4G A;  5ALI A;  1YZ6 A;  3PO4 A;  3GV7 B;  4Z6C A;  4M9G A;  3H4D A;  2OHF A;  4KLL A;  8ICP A;  3QU5 A;  4IR1 A;  3LDA A;  2HOF A;  4NM1 A;  4RPZ A;  2Q4T A;  4RQ4 A;  1ZQG A;  4Y2J A;  8ICE A;  2UVR A;  7ICP A;  1WG8 A;  9ICP A;  4EEY A;  1NJX A;  3JPO A;  5AKY A;  1XSN A;  1FIQ A;  2DKZ A;  4KTQ A;  9ICV A;  1PVR A;  2JEG A;  3Q8M A;  2Y0S F;  1SIJ A;  2FLP A;  1KFT A;  4ELT A;  3C23 A;  5DB7 A;  2FLN A;  1NK7 A;  4EX7 A;  3QZ7 A;  4P2H A;  4DQR A;  3D2N A;  3F2B A;  2BDU A;  4RQM A;  1NK8 A;  1X6I A;  5AM2 A;  3SV4 A;  5ALY A;  4PL1 A;  4YVZ A;  1SV0 A;  3SQI A;  5DKW A;  4JV2 A;  1RDF A;  2J6U A;  4JUZ A;  3ISD A;  5DBB A;  4RPY A;  5JRT A;  1BPX A;  2HMX A;  1OXJ A;  4P0Q A;  1RXV A;  4G9B A;  2KD1 A;  1KQQ A;  1SB3 C;  4BX9 C;  9ICL A;  5ALU A;  2WAQ C;  4QZA A;  5G5G A;  2HBM A;  5AI8 A;  4C8O A;  5D4B A;  3I76 A;  3IN5 A;  3T5K A;  1HUZ A;  1ZJM A;  1QLN A;  4ECS A;  4ICA A;  1J97 A;  5AI4 A;  4F92 B;  1UA1 A;  1ZJN A;  3K75 D;  2H3Z A;  4RQ0 A;  2ISP A;  3QXG A;  4O3R A;  4IC9 A;  2MUT A;  2W9A A;  2C22 A;  3SAH A;  1O03 A;  4FS1 A;  2M9N A;  1L6N A;  4F5P A;  4JWN A;  1IM4 A;  4B9U A;  3FAH A;  4F5Q A;  4Y2S A;  4RQ8 A;  2LYB A;  5AKX A;  4EYI B;  4F5N A;  4EZ6 A;  4OCZ A;  2QAR B;  3MDC A;  1D8Y A;  4KIT B;  9ICS A;  3C29 A;  3D2S A;  2JEI A;  5EOZ A;  4RT2 A;  2H5X A;  3QU7 A;  4I2I A;  4DFP A;  2VA2 A;  1BGX T;  4P0P A;  2YX8 A;  1ZQW A;  2EAP A;  3PV8 A;  3F53 A;  5ALG A;  4C8N A;  5HMM A;  2E8N A;  2HHX A;  4QZE A;  3F5A A;  3AL0 B;  1ZRN A;  2PKE A;  3MR6 A;  5J8Y C;  4J9P A;  5KG0 A;  4DL6 A;  2O6K A;  3WK8 A;  3KZI U;  3PSI A;  2LI6 A;  4CF4 A;  1ZQK A;  4UAU A;  3ZDB A;  5KFW A;  3F5E A;  4YXM A;  1NI3 A;  1RQL A;  2V4Q A;  2NO5 A;  5DLG A;  4GC6 A;  4R65 A;  3M9M B;  4F72 A;  1LKY B;  1WCN A;  5DDY A;  3QEB Z;  2H3V A;  4C8L A;  3AN1 A;  3RR8 A;  5F9N A;  3DDH A;  3TAC B;  5KG6 A;  1ZQA A;  5J2H A;  3M6Z A;  5KL8 B;  2Y0S C;  5ALF A;  3K1Z A;  2CN1 A;  2VAN A;  3HT3 A;  1X9X A;  4ECT A;  1L3T A;  3LWL A;  3FDS A;  5ALX A;  2KHQ A;  4F3O A;  4ECU A;  2YMP A;  3PY8 A;  1U9L A;  4KX3 A;  3GII A;  5KFU A;  3BQ1 A;  4I2G A;  3H8J A;  9ICT A;  4J9L A;  4QZC A;  4Z6D A;  4OD0 A;  2JEJ A;  1CI4 A;  1SXD A;  1JRP A;  3BDP A;  2YB1 A;  1NKE A;  1WCL A;  5ALJ A;  4O3P A;  5AKJ A;  5AI6 A;  4F4Z A;  3TKA A;  3WK4 A;  5BPC A;  1BPD A;  5J0W A;  1M6Y A;  3FM9 A;  3HX0 A;  2JMG A;  7ICO A;  1Q8K A;  1N48 A;  2PFP A;  2W9C A;  2G06 A;  4RQ7 A;  3T3F A;  3RJE A;  5AKE A;  2DL0 A;  4ED1 A;  1U47 A;  3QNM A;  2ZUB A;  3RRH A;  3AMZ A;  3N97 B;  2BGW A;  1GO3 F;  5C0Y A;  4KLI A;  4NV0 A;  1HEK A;  1ZQU A;  5ALT A;  1QSS A;  8ICR A;  3NTU A;  1QQ7 A;  3GIJ A;  4UB8 U;  2W55 A;  4Y2Y A;  4EBC A;  1XC9 A;  2PI5 A;  3QUT A;  3WKC A;  1S8O A;  2ZIU B;  5B5E U;  1CEZ A;  2KOB A;  3AQF A;  1N5X A;  4QZ9 A;  5KT4 A;  2EZY A;  4M6W B;  4IR9 A;  2F77 X;  4UAT A;  4RNM A;  4DOA A;  4QWC A;  1X40 A;  2KHV A;  3V6H A;  1TAM A;  1FO4 A;  4RNN A;  3WKE A;  1KBU A;  4HAI A;  3ETL A;  2AHO B;  1HUO A;  4LZG A;  4KLU A;  3T5L A;  2HVH A;  4JB3 A;  2OM6 A;  1ZQJ A;  3OJS A;  3KHG A;  2BQU A;  9ICC A;  1ZQX A;  1JAL A;  4IQV A;  1VLB A;  8ICY A;  5HHH A;  1KW4 A;  5J2C A;  2BKE A;  2GLE A;  2BPG A;  4RT3 A;  3SR6 A;  5KFZ A;  1KSP A;  4BJQ A;  2HDO A;  5ALN A;  2HW3 A;  1DOQ A;  5III A;  2DQN B;  8ICF A;  5ALR A;  1F44 A;  5IIJ A;  2BQ3 A;  3AU6 A;  5JTI A;  5KG2 A;  5AM1 A;  4UB6 U;  4C4R A;  3GIM A;  5L1I A;  4Q43 A;  1QH9 A;  9ICK A;  3M8S A;  1TV9 A;  5L1L A;  4B9S A;  4R63 A;  1NJW A;  3J81 j;  1JRO A;  1KN5 A;  5ALP A;  2XI9 A;  3PR5 B;  7ICG A;  3RTV A;  3LVV A;  2G07 A;  2IHM A;  1S0M A;  2B0C A;  5AM5 A;  5TZV A;  5K4L A;  5KNI A;  3A0H U;  1FEZ A;  4RQN A;  4M0A A;  3TI0 A;  5DG9 A;  5KG4 A;  4F8R A;  3V6K A;  2R8I A;  4ELV A;  2E1F A;  3GIK A;  5EE3 A;  9ICE A;  1WYG A;  4J9K A;  1RYU A;  2OH2 A;  2YMQ A;  1TE2 A;  2BQR A;  1DXS A;  2AQ0 A;  4I2H A;  2ZIW A;  2K4I A;  5HNK A;  2HCF A;  1NK0 A;  3ISB A;  3ZDD A;  3L4P A;  3CYM A;  2ZJ8 A;  4PL2 A;  2UVU A;  3MGH A;  4TUQ A;  4FZL A;  4AYB F;  4M47 A;  4DL7 A;  1PK1 A;  4C4S A;  1N63 A;  5IIN A;  8ICB A;  1UT5 A;  2R8K A;  1RQN A;  1Z00 A;  5KFB A;  4DFK A;  3QUQ A;  5AM3 A;  2C28 A;  8ICQ A;  4LJX A;  4UAS A;  1QSL A;  3GIL A;  4Y2X A;  1TKD A;  3BQT A;  4F4K A;  3S6J A;  4M9L A;  2A19 A;  3WKD A;  4P4O A;  2DPI A;  9ICH A;  1UA0 A;  2EAO A;  2A1J B;  5L9X A;  4F50 A;  2WF7 A;  4CE6 A;  4USA A;  2HHS A;  4F71 A;  3L3F X;  4RQ3 A;  2IMW P;  1NKB A;  2FMP A;  3RJF A;  2G0A A;  3H0L B;  4B9M A;  1LB2 B;  4LZD A;  2PMZ F;  2KJ5 A;  4BXO A;  3V7L A;  5J2G A;  1X42 A;  1OUQ A;  4O5E A;  4DO9 A;  5DG8 A;  3SAF A;  2Z7J A;  2E8P A;  1V85 A;  3ORY A;  2NYV A;  4ECZ A;  1TK0 A;  3M9N B;  1JXL A;  2J6T A;  4GXJ A;  1L7N A;  4OJ6 A;  3HJE A;  3MFH A;  3MGI A;  1SV0 C;  4CGZ A;  5AK5 A;  2YMM A;  3NUQ A;  1KRP A;  1KLN A;  4CNQ A;  5DQG A;  3V72 A;  2OWO A;  3V6J A;  3RH6 A;  3NVW A;  3PML A;  3UXP A;  4B6J A;  1PUZ A;  2AGO A;  3ED5 A;  2K8C B;  4EEL A;  2ZXH A;  1BPY A;  4YD2 A;  2UVW A;  1ARO P;  1NNL A;  1NZP A;  3UMG A;  4RUC A;  5EWG A;  3F2D A;  4Y2Q A;  7ICJ A;  5T14 A;  1RPL A;  2KZM A;  3OGU A;  3HKZ C;  1ECW A;  1BNP A;  9ICM A;  4F4Y A;  2CPR A;  2FLL A;  3RBD A;  1NJY A;  4DQI A;  2PFN A;  4US9 A;  2K8A A;  5CHG A;  3TAP A;  1Q3U A;  3N28 A;  1KTQ A;  5CWR A;  5HML A;  3F2C A;  1ZXI A;  4MEY A;  5AK4 A;  3RJJ A;  4PHP A;  1L7P A;  3MDA A;  2J6S A;  1S9F A;  3AM9 A;  1URJ A;  3GV5 B;  2C2E A;  2BCS A;  8ICU A;  2QKQ A;  1D9F A;  2NRW A;  1ZQB A;  3PX6 A;  2KIC A;  1T8E A;  1QQ5 A;  3TAN A;  2R8H A;  1RG6 A;  5EWF A;  2KEY A;  3C2M A;  5BOL A;  3VC8 A;  5CRX A;  4AYB C;  2KFN A;  2L5Y A;  2W9B A;  3QE9 Y;  2MAX A;  4UAW A;  3SD7 A;  3JPP A;  4MFC A;  4UAZ A;  3NS1 A;  4P0Q B;  1KL9 A;  5J2K A;  5AIC A;  3SYZ A;  4JV0 A;  2WB1 C;  4PGX A;  4DQS A;  4F2R A;  4ED7 A;  1MQ2 A;  2K89 A;  8ICZ A;  3MR3 A;  4PJ0 U;  4UB1 A;  3MR2 A;  5JU5 A;  3ONN A;  1ZOL A;  3M9O B;  1TAU A;  4Y2T A;  9ICG A;  2OYY A;  9ICW A;  3E0F A;  2Y9T A;  4B9N A;  4BWM A;  2K8B B;  2MUT B;  4YD1 A;  8ICC A;  2RHF A;  2KVS A;  2ZIV A;  2AU0 A;  2PMZ C;  2W04 A;  2HI0 A;  5KG1 A;  2XY7 A;  5C5J A;  2GH1 A;  3UMC A;  1F0M A;  1PVP A;  4R66 A;  4EX6 A;  5KT7 A;  3CRX A;  4Z6F A;  2HBL A;  1JXE A;  1Z1B A;  2K60 A;  3WKA A;  5AKL A;  1Q3V A;  8ICJ A;  1BPB A;  4TQS A;  4I2E A;  4P0P B;  2ASJ A;  4YMM A;  5G5H A;  1IIP A;  4J9S A;  4JV1 A;  5AK3 A;  5TIS U;  4KLM A;  1K5O A;  2C2R A;  4CCH A;  4IRK A;  3BS5 A;  9ICI A;  4YXJ A;  3PW4 A;  3G6Y A;  1IV8 A;  1COO A;  2DUY A;  3OPX A;  3ETR A;  3G6V A;  1SKR A;  2KIW A;  3IP4 B;  9ICQ A;  4I2A A;  4YMN A;  3OJU A;  2KJ8 A;  4Y2V A;  2BCR A;  3EPI A;  4NM2 A;  5E79 U;  3RH5 A;  3AEV A;  3AU2 A;  4OJ5 A;  1AQ6 A;  3WK6 A;  2FI1 A;  2H3I A;  2KMD A;  2WF6 A;  5DB9 A;  3KOO A;  3RAQ A;  1RYS A;  5KFG A;  1COK A;  5DBC A;  3QU4 A;  2Y1I A;  3N7P D;  1QSY A;  2E5S A;  4EZ9 A;  2DGZ A;  2W11 A;  3HW8 A;  2W54 A;  2B6G A;  1V38 A;  2P66 A;  2LKY A;  2ZXI A;  3OHB A;  5IIM A;  2FMS A;  5IIK A;  4UW9 A;  3PW5 A;  3C28 A;  4C7Z A;  7ICI A;  1D8B A;  3BQ7 A;  4NL9 A;  1NOM A;  1ZQL A;  5KFO A;  5J0S A;  4JWM A;  3OSP A;  2ZTC A;  3ISC A;  4QWB A;  3WK7 A;  5KFC A;  1V97 A;  2W3S A;  3AUO A;  4DQQ A;  5CA7 A;  5KFV A;  2BZF A;  4FZN A;  8ICO A;  2KSO A;  2KKV A;  5ALE A;  5HR7 A;  3C5F A;  1ZQR A;  4GC7 A;  2ESE A;  4KLO A;  3KBB A;  4OJL A;  4RQ6 A;  4ECW A;  5ALQ A;  4B9L A;  1S76 D;  4EEN A;  4QZD A;  2CRX A;  3M8R A;  3OSN A;  5DG7 A;  3WKB A;  3SZ2 A;  3MAB A;  2W9C B;  3C2K A;  1L5U A;  3HRD D;  5ALK A;  5ALV A;  4FBU A;  4A8E A;  5ALZ A;  3R9K A;  3H8M A;  3GQC A;  3RH4 A;  1SL1 A;  4C80 A;  7ICR A;  2EDU A;  3T5H A;  4F4X A;  2IOH A;  2YML A;  2IA6 A;  2E1E A;  4DF8 A;  4DSF A;  4F93 B;  4ED8 A;  3V7K A;  1XNS A;  1A77 A;  4UB2 A;  1U4B A;  2JZB A;  1VJ5 A;  2XO7 A;  4R64 A;  3KHH A;  4DF4 A;  4DQP A;  2XC9 A;  1ZET A;  2H3F A;  1PK3 A;  4ED2 A;  4R8U A;  1DK3 A;  4GIB A;  4J9R A;  1U45 A;  4DSL A;  4IQU A;  3NVZ A;  4QW8 A;  4QZH A;  3QUB A;  4AP9 A;  4BGD A;  4KLF A;  3NGD A;  4K4H A;  4PHE A;  2RRD A;  2JH1 A;  3KHR A;  2XCA A;  5DLF A;  3LWM A;  3PX0 A;  3PW0 A;  5AM0 A;  2HBK A;  4QZI A;  2ODG A;  1SXE A;  1NK6 A;  1KEJ A;  3MC1 A;  5KFP A;  4I28 A;  2F1J A;  2KVC A;  1C7Y A;  5KFI A;  4BWJ A;  3AQE A;  8ICG A;  2DPJ A;  1NKC A;  2GOL A;  1Y88 A;  2XVT A;  2FE9 A;  4Z6E A;  1ED1 A;  4F2S A;  2KTQ A;  8ICX A;  1N2X A;  4KMU A;  4QWA A;  3UM9 A;  1JI7 A;  4US8 A;  8ICM A;  9ICX A;  2MRL A;  2FPM A;  2AH5 A;  1ZD2 P;  4YQW A;  1SKS A;  1WWU A;  3CNH A;  3QEA Z;  1QCK A;  5KFA A;  3WU2 U;  3N4M B;  3JPR A;  4YN4 A;  4EBE A;  5KFE A;  2I9G A;  3MFI A;  9ICU A;  4C0Z A;  1NK4 A;  1KKX A;  4DS5 A;  2F1I A;  4Y2R A;  2P35 A;  5FP0 A;  4MFF A;  2RLT A;  5KAF U;  3K1R B;  1U49 A; 
#chains in the Genus database with same CATH homology
 2E1E A;  2G06 A;  2KEY A;  3F53 A;  3OPX A;  2K4H A;  2K4E A;  2N1R A;  1Z19 A;  2KIW A;  2PMZ F;  3IP4 B;  2KJ5 A;  2HBJ A;  3VC8 A;  4QJF B;  5HR6 A;  1XNS A;  3DEE A;  2XI9 A;  3F5A A;  5CRX A;  4AYB C;  2KJ8 A;  3AL0 B;  1GO3 F;  5C0Y A;  4NV0 A;  1OUQ A;  1HEK A;  2KNJ A;  3LVV A;  3D2N A;  2G07 A;  3H0R B;  4WJ3 B;  3SAF A;  2Z7J A;  3F2B A;  2W03 A;  2H3F A;  2BDU A;  3SAG A;  4OJ5 A;  2JHD A;  2VJ5 A;  2H3I A;  2ZIU A;  4P0Q B;  2XIC A;  3KZX A;  4OJP A;  4PL1 A;  4U6P A;  1WUD A;  3PSI A;  3M6K A;  3M7D A;  3F5E A;  3SQI A;  1YT3 A;  2E1F A;  1DRG A;  4OJ6 A;  2W7O A;  2ZIU B;  2KJ9 A;  3LYS A;  2WB1 C;  2G5H B;  3ICX A;  4JMU A;  4QIW C;  4O3M A;  2OH2 A;  1CRX A;  2JGA A;  4CGZ A;  2VIX A;  3N7P D;  2VJ4 A;  3GZF A;  4NWI A;  2K89 A;  2KOB A;  2G09 A;  2E5S A;  3AQF A;  1SZH A;  2HMX A;  3CP8 A;  3N7S C;  2DGZ A;  3D2Q A;  4P0Q A;  4CDG A;  2LKY A;  3NUQ A;  2VKQ A;  2KD1 A;  2M0N A;  2RRD A;  2ZIV B;  2JH1 A;  2K4I A;  2ZIW A;  2ZXI A;  3ONN A;  2F77 X;  3PST A;  3O0F A;  4BX9 C;  3C28 A;  2OYY A;  2H3V A;  3E0F A;  2KHV A;  3H0M B;  1D8B A;  2WAQ C;  1TAM A;  1P7D A;  2JH7 A;  2DF4 B;  4QNL A;  2KV2 A;  2K8C B;  1UPH A;  2ZXH A;  2HBM A;  3M6Z A;  2ZIW B;  2H3Q A;  2HBK A;  2K8B B;  2Y0S C;  1T94 A;  4NLC A;  5KL8 B;  3K1Z A;  1KBU A;  2A3V A;  3IN5 A;  2CN1 A;  2F8L A;  2WB1 F;  2LYA A;  2F2A B;  3CYM A;  2RHF A;  4ICA A;  3F2D A;  3PSF A;  2OM6 A;  4PL2 A;  2KHQ A;  2KVC A;  2ZIV A;  5T14 A;  4CRX A;  2PMZ C;  4FZL A;  2W04 A;  4AYB F;  4KX3 A;  4OO1 J;  4FE3 A;  2H3Z A;  1A0P A;  3AQE A;  3HKZ C;  4FZN A;  1ECW A;  2GOL A;  4OJO A;  2GH1 A;  4IC9 A;  2KKV A;  2HOQ A;  2XVT A;  1PVP A;  2HOI A;  2CPR A;  1ED1 A;  2WAQ F;  2ZIX A;  5HR7 A;  2RP5 A;  3CRX A;  2YB4 A;  3RFA A;  3SAH A;  3PSP A;  1MA7 A;  4U7C A;  3N7R C;  3SMV A;  1L6N A;  3NRW A;  5KL1 B;  2D6F C;  2K8A A;  4ACO A;  2ZG6 A;  4BJQ A;  4BUG A;  4OJL A;  1Q3U A;  2LHT A;  1PVQ A;  2F76 X;  2HBL A;  2YB1 A;  2ZIX B;  2W7P A;  1A6S A;  2MRL A;  1ZQ1 C;  4KMO B;  3RF9 A;  3T79 A;  1Z1B A;  1Q3V A;  4QIW F;  2MA1 A;  2DQN B;  1NZB A;  3MGV A;  3F2C A;  1XO0 A;  2LYB A;  2HOF A;  3LVW A;  1F44 A;  2Q4T A;  2CRX A;  2KKP A;  1HIW A;  4P0P B;  3HKZ F;  4KX5 A;  3KFU F;  2OXO A;  2G08 A;  1IIP A;  3PZP A;  4FZM A;  3ALR A;  3IG5 A;  1URJ A;  4C0Z A;  4NLB A;  2NV3 A;  3IG8 A;  4A8E A;  5A0L A;  3C29 A;  1PVR A;  3L3F X;  3D2S A;  4GFJ A;  2Y0S F;  2G0A A;  3H0L B;  2XID A;  2KIC A;  2R18 A;  2JMG A;  3GU3 A;  2G5I B;  4P0P A;  2YX8 A;  3VCB A;  2LBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...