2F76X

Solution structure of the m-pmv wild type matrix protein (p10)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
100
structure length
100
Chain Sequence
MGQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title D-retrovirus morphogenetic switch driven by the targeting signal accessibility to Tctex-1 of dynein.
pubmed doi rcsb
source organism Simian retrovirus 1
molecule tags Viral protein
molecule keywords Core protein p10
total genus 30
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02337 Gag_p10 Retroviral GAG p10 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.490 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f76X00
2F77X 2F76X
chains in the Genus database with same CATH superfamily
1ZQZA 4B9NA 4DOAA 4J9LA 3HKZC 2HHXA 2BDPA 5E79U 9ICLA 4UAZA 3LVWA 3OGUA 4TURA 3NVYA 3IG8A 3RR8A 2A1JB 3RJKA 1ZQYA 4ECTA 2ISOA 5ALDA 4KLQA 3IV6A 2XY7A 2R8KA 1KQQA 2J6TA 2HSZA 3PW7A 1TAUA 2XO7A 3QZ7A 4JV0A 1Z4NA 4QWBA 4YP3A 4IRCA 3MGVA 1B43A 4ELVA 3SYZA 3T79A 3PVXA 1M6YA 1SZHA 3RH5A 1RQLA 4US8A 3N28A 2GOLA 2KSOA 4PGQA 2YTUA 1RZTA 2IOFK 2K60A 1ZQDA 4XQ8A 3QU4A 2RRDA 1XO1A 4C8OA 4QZ8A 4B9MA 2BPGA 1CEZA 2DQNB 9ICJA 1SL2A 2HBJA 2F3NA 4I2FA 5ALMA 1ZD4A 2L5YA 3NGDA 1ZXIA 8ICSA 2P6RA 2AJQA 3IG5A 5CP2A 8ICEA 4P0PA 5IIJA 4EEYA 3HT3A 2YB4A 5TISU 5AKYA 3B0YA 4KLSA 8ICLA 4O3PA 2H5XA 3UMCA 4G9BA 2E8NA 2MSNA 3RH4A 9ICCA 4GC6A 2H3FA 4UB2A 1YZ7A 4O3SA 1ZQLA 3H8MA 5KFQA 2DBYA 2E5SA 3KKAA 3EWAA 2K4IA 1J2NA 4F50A 4QZBA 2DFLA 5AI4A 1RYSA 3C29A 4I2IA 2PFNA 4GXKA 1BPYA 3F2DA 2ZXIA 2XI9A 4YD2A 3QEAZ 3BQ0A 3Q8KA 1U9LA 1Y88A 2KHQA 4FZLA 3EPGA 7ICOA 2Y0SC 4K4IA 2WFAA 5J0UA 3SZ2A 1ZQEA 2HMXA 9ICKA 2KVCA 4RQMA 3RH6A 3RB6A 3WK9A 5J8YA 1FFVA 4UAUA 4CGZA 1ZQOA 1NK4A 9ICBA 5DQHA 3H0RB 1TKDA 1U47A 4O5CA 3G6YA 1ZD5A 3PW2A 1NZPA 4CF3A 4CCHA 4KMUA 9ICSA 4F4XA 4YMOA 4ZOHC 4DL3A 2IHMA 4BXOB 3U26A 2DWQA 2W3SA 2LHTA 1UT8A 3H40A 3OJUA 4JWMA 2XCAA 1L5UA 1KDHA 3CP8A 2NO5A 2RQ5A 3D2NA 3GIKA 2W9CA 2EZZA 2D8CA 3HPOA 4FBTA 1S10A 1WUDA 4DL2A 1N56A 1KFTA 2PI4A 3EW9A 1IM4A 5AK4A 2HHTA 1BNPA 4EZ6A 4UW9A 1L7NA 4B6JA 4PJ0U 1NK8A 1QTMA 2W9CB 4DFPA 3I28A 4Y2SA 2CRXA 2JEIA 3A0HU 5AKZA 3GV5B 4QWDA 1T3QA 4RQ2A 2AQ4A 3M8SA 4JWNA 3C21A 2D6FC 1V38A 3DDHA 2OCEA 4UAYA 3SV4A 3Q8SB 5EE9A 3V6KA 2V9WA 5KFNA 3SD7A 4QIWC 3C5FA 3Q8LA 4QZGA 4K4GA 2HBMA 3HP6A 3F53A 5CEHA 5CB1A 4HAIA 2NO4A 2WF5A 2YQEA 5AM3A 3BS5B 4OD0A 3Q8PB 4F91B 2K8CB 2W9AA 1OUQA 5DKWA 4J03A 2EAMA 2PMZF 1TVAA 1OW5A 3HILA 2HHQA 9ICGA 1ZQSA 1BPBA 5L1IA 4IQTA 3KHHA 3QU2A 5J2DA 3PO4A 3LWLA 2R18A 4RPXA 2ISPA 2JHDA 2M9NA 1N2XA 4Q45A 3V7JA 4BWMA 4P4PA 4RQ1A 1EXNA 2I6XA 4Y2XA 9ICPA 1KFDA 3QE9Y 5AKXA 1KTQA 5JTIA 1JX4A 1UPHA 4EELA 2MUTB 3RJEA 5AIBA 2KE7A 4P4OA 2P6UA 4IR1A 3JPNA 1ZQAA 4QZIA 1LKYA 2EAPA 1DXSA 1XC9A 5ALUA 4PGYA 5IIIA 2K4EA 1Z1VA 4EENA 4DSEA 3GIIA 2R8JA 4ED0A 1A77A 4KLUA 4DS4A 5J8YC 3JPRA 3SI8A 5KT5A 4GLXA 2ZJAA 3KBBA 3QXGA 1U49A 3ZDEA 4EBCA 3AU6A 2WAQF 1DGSA 2IOHA 5DQIA 2G09A 5D46A 3WKEA 2W8KA 1FFUA 4I2DA 1Q3VA 3IM1A 5ALYA 1DK3A 1S8OA 2JH7A 4B9VA 4DQSA 7ICTA 1D8YA 2DUYA 5ALSA 5GTHU 5KG2A 1PVQA 2WTFA 1X9MA 3JPSA 1SKSA 1X9XA 3UXPA 3RBDA 7ICSA 2ZIXA 5EE3A 1ZQBA 3Q8MA 4F5QA 3PX0A 1IIPA 4DL5A 5J2JA 4I2JA 8ICTA 3H7IA 2NV3A 4QZ9A 1NJYA 1DOQA 2H3QA 3M7DA 5L9XA 2PFOA 2ZIXB 2IA6A 2GO7A 3QUTA 2EAOA 4O0IA 2G06A 4GC7A 2BCVA 3NASA 4KLEA 5EE0A 4KN7A 1RM6C 2XC9A 4R64A 4M0AA 3TANA 2KJ8A 5KFXA 3PSFA 1B4FA 5H2FU 4UAWA 4KN4A 1YZ6A 3RFAA 5HP4A 1QSYA 1VJ5A 2C2EA 4LVSA 1Z1BA 2WHEA 4FZNA 1DK2A 1Q3UA 3UQ2A 3QU7A 5DQGA 3ZDCA 4DO9A 3NVZA 1BPEA 2BCSA 1Z4OA 4M9LA 4RQ0A 1XU4A 2GH1A 2LMRA 2EQYA 4OJ5A 4J9KA 4C7YA 3PV8A 2C28A 1RPLA 3T5JA 3G6XA 8ICOA 2IBKA 4UARA 3ONNA 2NRZA 2J6UA 1PK3A 3C1ZA 2ZTDA 5J2GA 4FE3A 2PFPA 5ALVA 4YCXA 3V7KA 1J97A 3BS7A 5IIMA 3C5GA 1JRPA 3H8JA 4RNMA 2KOBA 3MR6A 9ICFA 3PSIA 4ECRA 1HIWA 5HHHA 2W43A 5C5JA 4EZ9A 4QZEA 4DSKA 2KHVA 2RP5A 4AYBF 4M2YA 2LI6A 5JU5A 1SGGA 1QSLA 2FE9A 9ICOA 5DG7A 1ZQ1C 5CR0A 5EWFA 2HI0A 4FBUA 3THVA 1XSLA 5AM2A 2IOFA 4UQGA 1KKXA 5KFMA 2QLTA 3J81j 2ODGA 2YMMA 1NJXA 4QWCA 1S0MA 2BGWA 4DOBA 1ZQKA 3M6ZA 5AKIA 3GILA 4ED6A 3E0FA 1ZD3A 1RXVA 8ICCA 1OXJA 4NY8A 2MUTA 3BQ7A 1ZJMA 5J0RA 2WB1C 3CRXA 4BWJA 1X40A 4MHVA 1BGXT 5AK5A 1V85A 1N5XA 3NVWA 4YQWA 4BUGA 4US9A 5ALQA 4KLHA 1NNLA 2WF9A 2H3ZA 1TE2A 5KFVA 8ICMA 1L7PA 1QQ7A 2DPJA 4M6WB 1TV9A 2GWSA 2OYYA 1VLBA 3RB3A 4PL1A 2F1JA 3ALRA 4YFKA 5KG0A 2KZZA 3F5AA 4R63A 4QNLA 3ZDBA 3IDWA 4O3MA 5EWGA 5GTIU 1U4BA 3A0BU 1XNSA 4RZRA 1MSWD 3TFSA 2B21A 2XCPA 5TZVA 1UT5A 1QH9A 1BVSA 2UVWA 4F72A 3AL0B 2F76X 5KFPA 3MGHA 3MGIA 4UB5A 5KFIA 5AM1A 2KTQA 4J9QA 3AN1A 4XUSA 2KIWA 5D49A 3FC4A 1RXWA 1SKWA 4JK1A 2ASDA 5DGBA 4MEYA 4PH5A 5DB6A 1KRPA 2ZIUA 2ESEA 3G6VA 3Q8QB 2KKPA 3MC1A 2R8GA 2H3IA 2KJ9A 1BPZA 7ICIA 2WF8A 4UB1A 2KMDA 3WKAA 1Z00B 3OHBA 5AKKA 3MABA 5F3XB 4NLZA 3C28A 2BPFA 2BPCA 1MN8A 2KKVA 5D4BA 4DFKA 3N7SC 4I27A 7ICGA 3TADC 1D9FA 1Z00A 2QARA 5CA7A 2BCQA 2WB1F 1ZQPA 2G08A 5ALWA 1NJWA 5ALGA 4OJ6A 3RJJA 1WWUA 4MF8A 4J9PA 2WF6A 1KN5A 2LYAA 2F77X 1ZQGA 3NRWA 1RYRA 4OO1J 3ORYA 3WK4A 2BCRA 4NLKA 3N4MB 2HVHA 3EUB2 7ICNA 3AMZA 5KG6A 4YXJA 5AI8A 2FLPA 5IIOA 1JN3A 1NKCA 5IILA 1SXDA 2XIDA 2EH9A 4C0ZA 1KEJA 2BCUA 4KLMA 2K8BB 2Y1IA 4WJ3B 1GO3F 2VA8A 1A6SA 8ICWA 3WKBA 5KG4A 5ALEA 1URJA 1TAMA 4C8NA 4QW9A 1XS9D 4BJQA 5AK6A 4DSLA 2HHUA 4DF8A 3M1YA 3H0MB 2QB0B 3BQTA 1B22A 2HDOA 2FJ6A 3AQEA 4Q43A 3ETRA 1L8LA 2ZUDA 1X9WA 5KFBA 3IHQB 3GV8B 4P2HA 8ICFA 1UA1A 1LKYB 4UB8U 4GIBA 4C8MA 4USAA 4RQ8A 3K1RB 4HYKA 3PX6A 1V97A 5IINA 5DG9A 2DL0A 2JV3A 5KT2A 5KG7A 2V4RA 5EE1A 2NRVA 3ICXA 3QNMA 1ZQTA 4RPYA 5KT3A 3OHAA 1BPDA 4DSIA 1S97A 8ICIA 3EYZA 1ZETA 5KFOA 3TACB 2HBKA 5AICA 1DGJA 3SMVA 2JEGA 9ICTA 4M6WA 4TQSA 2FLLA 3L3FX 5B5EU 4C4RA 4F5PA 1ZQNA 4RUAA 5AM4A 4UBCA 8ICJA 5CJ7A 4Y2RA 4RPZA 3D2SA 2OXOA 3N97B 4YG2A 3PO5A 3GIJA 5J2IA 4NLBA 1A0PA 3FDSA 2W55A 3N7PD 1MQ2A 4ECWA 4YXMA 5IIKA 4O9MA 3BDPA 1AQ6A 2EDUA 4F93B 3FYHA 1RYUA 1JMSA 5AM0A 4F4KA 2UVUA 4CNQA 1SWVA 2DKXA 4FFDA 5ALIA 4Q8EA 8ICXA 3NTUA 2YX8A 3H8SA 2VJ4A 4C8KA 3EPIA 2BZFA 1QSSA 5KFLA 4DQRA 3ISCA 4EX7A 4KLDA 3RTVA 4RNOA 3ISDA 3OSPA 3BZKA 5J0XA 4EBDA 1ZQRA 4QW8A 3JPQA 3NVVA 5AKJA 4PZOA 3PR4A 4DL7A 3QYPA 3UPQA 3TARA 3Q8RB 1ZOLA 4Z6FA 2MA1A 4O3OA 2XGPA 1QCKA 2KFZA 3QUCA 4PZNA 5ALHA 2MU2A 1IG6A 1WCLA 4OJLA 2N1RA 3RRHA 1QLNA 5BPCA 2LBOA 4RNNA 2A19A 1S0OA 1HJPA 4C80A 5DDMA 1X6IA 5KG3A 4B9SA 3MBYA 5HNKA 3NUQA 4YR0A 3M9NB 3PR5B 5L1LA 1TK0A 4YMNA 4PHPA 4XRHA 2OM6A 4OJPA 1T3NA 2NRWA 1CI4A 2AGPA 4R8UA 5ALXA 4ECYA 2C2RA 4NLGA 1D9DA 3LVVA 2RDJA 2K8AA 4IR9A 2Y9TA 2W9BB 4UB4A 3M9MB 2PMZC 4QZAA 9ICNA 2KG5A 2Y9UA 1KLNA 5AKHA 4OCZA 3TAPA 1ED1A 2F8KA 3BZCA 2HW3A 2NYVA 4R65A 4GXIA 8ICRA 2ZIUB 2ZG6A 3I1YA 1X42A 1ZQMA 3I76A 5ALJA 2ZTEA 1ZQVA 2CXYA 5KAIU 4EYHB 1PK1A 4AP9A 2JXJA 5ALTA 5KG1A 8ICHA 4NWIA 3SQIA 3HW8A 1JXEA 3V6HA 4I28A 3B9JA 7ICRA 2BQUA 5C0YA 1D8LA 4ED3A 2VANA 4DLGA 2OWOA 3OPXA 8ICNA 4ZH4A 9ICXA 4NXZA 1KSPA 4Y2UA 2XVTA 4PL2A 5KFAA 5KFGA 1N62A 1L3SA 2KK0A 1XSPA 2HOQA 3V72A 8ICBA 3LWMA 3F2CA 2CN1A 3RF9A 1WYGA 2IMWP 2K4PA 3PW0A 4YVZA 2C2DA 4F8RA 4CF4A 1Q8KA 4FZMA 4NV0A 3JPOA 1K5OA 2AXTU 1FIQA 1S5LU 1CRXA 1ZYQA 2C22A 1QQ5A 8ICGA 3AM9A 2F2AB 4Q44A 5KNIA 5KFZA 1ZRNA 4QZCA 2Y1JA 3H4DA 2ZJ5A 4NJ8A 5DB7A 2KD1A 1N60A 1L7OA 3EZ5A 4KTQA 7ICHA 2Q4TA 4PHAA 5K4LA 4B9TA 3UM9A 3TAQA 3K1ZA 1NOMA 2JZBA 2JR5A 4XA5A 3PW5A 2P35A 9ICEA 2G0AA 2JMGA 5J0OA 3WK7A 2Y0SF 2KJ5A 5F9LA 4ELTA 1SV0C 3TADA 3VC8A 1L3VA 4KX5A 4NLNA 5DB8A 2JH1A 1LB2B 5J2AA 2GLEA 1O03A 3SAHA 3F5EA 5HHIA 5J0SA 3ED5A 5AM5A 5ALFA 1NZBA 4M9GA 5KFDA 3QUQA 1NK7A 2VJ5A 5KT4A 3SR6A 2D3DA 8ICKA 1B0XA 4K4HA 2FI1A 1MQ3A 4QZDA 1NK6A 2HOFA 4RQ3A 5CHGA 4JV1A 1Z3EB 2E8PA 4Y2QA 3MR3A 3MDCA 3SAFA 3TQ1A 4DFJA 1JUDA 2WF7A 3H8WA 3KHLA 2A1AA 1MA7A 2FPKA 3B0XA 4G3IA 5G5HA 3RBEA 3SEIA 3L5KA 1X66A 3C2KA 2ZUBA 2YMPA 2RDIA 4KLLA 4MFAA 2DPIA 4M04A 2Q0ZX 2AGQA 2HCFA 4NL9C 4IC9A 2FPLA 1HEKA 3H4BA 5FP0A 2F44A 2W3RA 4DF4A 4M9JA 4PHEA 4UAVA 1WWVA 1C20A 1SL0A 4LJXA 4RQ6A 1C7YA 1HUZA 5AK3A 2DF4B 1T94A 8ICYA 2I1QA 4F4ZA 5AI0A 2HBLA 1AROP 2O6KA 2W7OA 2M0NA 3HKZF 5J2FA 3MFIA 4I2BA 2XY5A 4CE6A 1L6NA 2KSOB 7ICJA 4UBBA 1UQVA 2LYHA 2KFNA 4C4SA 5L1KA 5KFEA 1PK1B 4YN4A 2ZIVA 2W9BA 4RUCA 2KNJA 3HJEA 1L3TA 1X6JA 3GFKB 7ICQA 2I9GA 5KL8B 3ISBA 7ICPA 2LPEA 2NRXA 2EZYA 4DLEA 4YR3A 1XWLA 4X5VA 5KFKA 5ALLA 4F4WA 7ICLA 3RB4A 4NM2A 4B9UA 3E2EA 4E0DA 3UQ0A 1ZQIA 3CNHA 5B66U 3RAQA 5J2HA 4DL6A 5J2BA 4QWAA 2ATLA 4IS7A 4C4TA 1ZQWA 3S6JA 3QX7A 4AYBC 4J9SA 2JGAA 3KFUF 4UATA 4EX6A 8ICPA 5J29A 4RT3A 5CWRA 4RQ7A 1KBUA 3T3FA 2AH5A 2MAXA 2LYBA 2IHNA 2OH2A 4M47A 1JIHA 1IV8A 5G5GA 1JI7A 3T5KA 4LZGA 5KFWA 2BDUA 4FO6A 4C7ZA 4IQVA 9ICMA 4I2AA 5KFTA 3BS5A 4P0QB 2JZBB 2EANA 2ASLA 3IP4B 3C23A 3KHRA 4QJFB 2VA3A 2KV2A 4F2SA 2BQ3A 4JB3A 2BR0A 4PGXA 1X9SA 1L7MA 5JUMA 2ALZA 4ECVA 5DLGA 8ICZA 1L3UA 2W11A 1CUKA 2EZXA 1SKRA 2YY6A 2OHFA 4M9HA 1P7DA 4KITB 1S0VA 3WK5A 2KICA 4ACOA 3IN5A 4O3NA 2FMPA 4Y2YA 3BQ2A 1ZQUA 3D2QA 5AHXA 4ED7A 2B0CA 3UMBA 5F9NA 2KZ3A 3QU5A 4J9NA 4ECSA 3LDAA 4DFDA 3DV9A 4Y2PA 4KLGA 1NKBA 5JRTA 2VA2A 3TI0A 3WK6A 3RJGA 1ZQXA 4FS2A 3LYSA 3GIMA 1F0MA 3PSPA 2B6GA 1U45A 3WU2U 1PVPA 3V7LA 2FDRA 3N7RC 4TQRA 4KLFA 3L4PA 2RLTA 3R9KA 1N61A 4DSJA 1ZRMA 9ICIA 3OJSA 1T8EA 2CPRA 9ICRA 3PMLA 4IRKA 3E58A 3M8RA 4IL6U 5ALZA 2BQRA 1SXEA 1N48A 2QB1A 4P0QA 5DG8A 4OJOA 3JPTA 3UXNA 5DBCA 7ICMA 4Q8FA 3T5HA 5ALRA 3RJFA 2OEHA 1SL1A 8ICVA 2ZXHA 5HR7A 2WAQC 4CDGA 5J0PA 8ICAA 2QARB 4Y2JA 3K4GA 2FLNA 2LM1A 5J0WA 1ZQHA 4I2EA 1ZJNA 2H3VA 4JMUA 4O5EA 3H0LB 5AKGA 3QEBZ 4DCCA 3KD3A 1IXRA 1LVHA 5KT6A 5J2CA 3IRUA 4JUZA 4DFMA 3KKAC 5BOLA 3GZFA 5HMMA 4YD1A 1COKA 1NJZA 2E3TA 5ALNA 4UB6U 3UMGA 5AI6A 1SV0A 4RU9A 2JEFA 8ICQA 3JPPA 9ICWA 2VKQA 4EBEA 3HRDD 2KEYA 3WK8A 1WG8A 9ICUA 1KFSA 5KFHA 3MDAA 4O5KA 7ICUA 1PUZA 2ZIWB 2KIVA 1ZD2P 1T4GA 3NRZA 4F5RA 3SV3A 3ZD8A 4GXJA 3RRGA 1HUOA 2AU0A 4YR2A 2JEJA 3PMNA 3ZDAA 1SB3C 1SWWA 3LK9A 4P0PB 2F1HA 5KL1B 3KZXA 4LZDA 3T5LA 1TAQA 1Z19A 4IRDA 4DQQA 4F92B 3PW4A 1JXLA 5KFUA 9ICAA 4KX3A 5ALPA 3OSNA 2YMLA 4QZFA 2J6SA 3SAGA 2XICA 4A8EA 3RAXA 2NRTA 1JALA 2R8HA 2XY6A 5DDYA 2W54A 4DQPA 4PPXA 1ZQQA 2FMQA 7ICKA 4U7CA 2HHWA 7ICFA 2PFQA 4C8LA 3KHGA 1ZQCA 1ECWA 2AHOB 4MF2A 2BHNA 3AU2A 4ECZA 3PNCA 2KN7A 2V4QA 2A1JA 5J0QA 4QIWF 1NKEA 2KVSA 1ZQJA 3ZI4A 1UA0A 4Y2VA 4I2CA 3OTQA 1S9FA 3GV7B 5DLFA 2DGZA 4RQ4A 3KTQA 2HHVA 1KL9A 4RQNA 2AGOA 1UCVA 1ZQFA 4O3RA 3GU3A 2PKEA 4ECQA 2P66A 1PVRA 3BQ1A 4BGDA 9ICVA 5KFYA 1QQ6A 4I2HA 5KFRA 2YB1A 2E8MA 2F1IA 5KFFA 3PY8A 3MR2A 2HOIA 1WCNA 4B9LA 2HHSA 1D8BA 2LKYA 5J2KA 3FM9A 4TUQA 3D6JA 2ZTCA 4J9MA 4ECXA 4ECUA 2RHFA 2I5HA 3RB0A 4KLIA 3WKCA 1Q46A 3PZPA 3PX4A 2G5IB 5KG5A 4KMOB 2W03A 2R8IA 5KTQA 3NS1A 1N63A 1SV4A 1K1QA 3F2BA 1BPXA 3ETLA 5HR6A 5KT7A 3C2LA 5AI9A 2HVIA 1TK8A 4UASA 5J0YA 2KP7A 3M6KA 2G07A 5L1MA 4KLOA 4QWEA 1S76D 3DEEA 4NLCA 2W8LA 1X2IA 1F44A 2FPMA 5T14A 3ZDDA 4RT2A 2Z7JA 4F4YA 2PXIA 2W9MA 1O08A 2UVRA 5AKEA 3UXOA 4F2RA 5KFCA 2VIXA 5DBBA 1DRGA 3M9OB 4DS5A 4DWIA 9ICQA 2G5HB 4ED1A 4GFJA 1VDVA 4IQWA 3AQFA 5EOZA 2AQ0A 2W04A 3C1YA 3C2MA 1KW4A 8ICUA 2ES6A 5KFJA 3MR5A 1PZNA 3MFHA 1YT3A 5A0LA 2E1EA 5AI5A 1COOA 4M9NA 3AUOA 2PI5A 3V6JA 3KZIU 3CYMA 1XSNA 3PSTA 4MFFA 4O3QA 4TUSA 2JRZA 4J9OA 4EYIB 4DL4A 3KOOA 4F5NA 4NM1A 1SIJA 4UB3A 3QZ8A 4Y2TA 1BNOA 4R66A 1JROA 5DB9A 2ASJA 3RJHA 3HX0A 4MEXA 1LV5A 2XGQA 2KZMA 4Z6DA 7ICVA 4DOCA 1UHUA 4R8UB 4Z6CA 3QU9A 2E8OA 1A76A 1K1SA 3CW2C 4ELUA 2YMQA 2YN4A 4NL9A 3ZD9A 2K89A 5EWEA 4IQUA 3FAHA 1NI3A 1XO0A 1H38A 2FMSA 5AIAA 3WKDA 4ED2A 2ZIWA 4U6PA 1NK5A 2UVVA 4QZHA 1N5WA 3VCBA 1J2MA 2LM4A 4F71A 1T7PA 1TK5A 4YMMA 1RQNA 1NK9A 5DGAA 4DEZA 1SZPA 2ZUCA 3O0FA 2QKQA 1RG6A 4BXOA 4F5OA 2E1FA 1FEZA 3K75D 5KAFU 2ZIVB 1MC8A 3TFRA 5J2EA 2QB0A 5HMLA 1U48A 5BOMA 4BX9C 4KLTA 4FS1A 2K4HA 5AKLA 4JV2A 4PHDA 1L8OA 3HWTA 2W7PA 4KLJA 2DKZA 4I2GA 5L1JA 1V9PA 4P4MA 1NK0A 3RJIA 4MFCA 5KFSA 2F8LA 5CRXA 3RR7A 3TKAA 1TFRA 4ICAA 3BJYA 3QUBA 1S77D 4DQIA 2BKEA 1RDFA 2ZJ8A 4EEKA 3AEVA 5ALKA 4Z6EA 7ICEA 4BDPA 4I29A 4F3OA 4DSFA 4TUPA 1F5SA 5J0TA 4CRXA 2MRLA 1FO4A 5DBAA 9ICHA 5ALOA 2A3VA 3SENA 4ED8A 4RQ5A 3GDXA 1S0NA 3GQCA 4CF5A 4J9RA
chains in the Genus database with same CATH topology
3L3FX 2LYBA 3NRWA 3C29A 1Z1BA 3M6KA 2G07A 2OH2A 4OO1J 4P0QA 4FZNA 4IC9A 3DEEA 1Q3UA 2D6FC 3HKZC 4NLCA 3F2DA 2OM6A 1HEKA 4KX3A 4BUGA 4OJPA 2K89A 2ZXIA 2XICA 4OJOA 4A8EA 3SAGA 4QIWC 2XI9A 1F44A 3D2SA 3LVWA 2OXOA 2H3ZA 2KD1A 2BDUA 3IG8A 5T14A 1XO0A 2HBMA 2KHQA 4FZLA 4NLBA 1A0PA 3LVVA 2K8AA 2GH1A 2OYYA 4OJ5A 2Y0SC 2Z7JA 4PL1A 3ALRA 2PMZC 2WAQF 2ZIWA 2ZXHA 2Q4TA 3F53A 2XIDA 4P0QB 4U6PA 3N7PD 3F5AA 3IP4B 2G09A 5HR7A 2WAQC 4C0ZA 4CDGA 2HMXA 3VCBA 4U7CA 4QNLA 3K1ZA 4O3MA 1ED1A 2K8CB 2K8BB 4QJFB 2KV2A 2KVCA 3ONNA 1GO3F 1XNSA 1OUQA 4WJ3B 1ECWA 2G0AA 2VIXA 1A6SA 1DRGA 2DF4B 2JMGA 1Q3VA 1T94A 2H3VA 2PMZF 4JMUA 2ZIUB 2ZG6A 3O0FA 4QIWF 2Y0SF 2KJ5A 3MGVA 4CGZA 4FE3A 3H0LB 3VC8A 3AL0B 2F76X 3T79A 2G5HB 4KX5A 1URJA 1TAMA 2E1FA 2JH7A 2JH1A 1SZHA 3H0RB 2HBLA 2ZIVB 3SAHA 2KOBA 2YX8A 2DGZA 3F5EA 4GFJA 4NWIA 3AQFA 2VJ4A 3PSIA 3SQIA 4BJQA 2W7OA 2GOLA 2W04A 1PVQA 2M0NA 1P7DA 1HIWA 3HKZF 2KICA 4ACOA 3IN5A 1NZBA 2KIWA 3GZFA 3H0MB 4BX9C 1L6NA 2KHVA 3GU3A 2ZIXA 2RRDA 1PVRA 2RP5A 4AYBF 3AQEA 5C0YA 2R18A 2VJ5A 2ZIUA 3D2QA 2K4HA 2JHDA 2KKPA 1IIPA 2YB1A 2DQNB 2HBJA 2H3IA 1YT3A 2KJ9A 2ZIVA 2W7PA 2HOIA 5A0LA 1ZQ1C 2E1EA 2KNJA 2NV3A 3OPXA 1D8BA 2LHTA 5KL8B 2HOFA 2MA1A 2VKQA 2LKYA 2XVTA 4PL2A 2KEYA 2F8LA 3IG5A 3CYMA 2H3QA 3M7DA 5CRXA 3CP8A 3PSTA 3D2NA 4P0PA 2ZIXB 1UPHA 2HOQA 2RHFA 3SAFA 4ICAA 2YB4A 3C28A 3F2CA 2CN1A 1MA7A 2G06A 2ZIWB 3RF9A 4OJLA 3LYSA 2KKVA 2N1RA 3PZPA 2G5IB 1WUDA 3PSPA 4KMOB 3ICXA 3N7SC 3M6ZA 2LBOA 2W03A 1PVPA 4FZMA 4NV0A 2H3FA 2KJ8A 2WB1F 3PSFA 3N7RC 1CRXA 2G08A 3E0FA 4AYBC 4OJ6A 2JGAA 3F2BA 4CRXA 3KFUF 2E5SA 2MRLA 4P0PB 5HR6A 2HBKA 2K4EA 5KL1B 3SMVA 3KZXA 2WB1C 3NUQA 2A3VA 3CRXA 2CPRA 3RFAA 2CRXA 1Z19A 2F2AB 2K4IA 2LYAA 2F77X 1KBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F77 X;  2F76 X; 
#chains in the Genus database with same CATH topology
 1ZQZ A;  4B9N A;  4DOA A;  4J9L A;  3HKZ C;  2HHX A;  2BDP A;  5E79 U;  9ICL A;  4UAZ A;  3LVW A;  3OGU A;  4TUR A;  3NVY A;  3IG8 A;  3RR8 A;  2A1J B;  3RJK A;  1ZQY A;  4ECT A;  2ISO A;  5ALD A;  4KLQ A;  3IV6 A;  2XY7 A;  2R8K A;  1KQQ A;  2J6T A;  2HSZ A;  3PW7 A;  1TAU A;  2XO7 A;  3QZ7 A;  4JV0 A;  1Z4N A;  4QWB A;  4YP3 A;  4IRC A;  3MGV A;  1B43 A;  4ELV A;  3SYZ A;  3T79 A;  3PVX A;  1M6Y A;  1SZH A;  3RH5 A;  1RQL A;  4US8 A;  3N28 A;  2GOL A;  2KSO A;  4PGQ A;  2YTU A;  1RZT A;  2IOF K;  2K60 A;  1ZQD A;  4XQ8 A;  3QU4 A;  2RRD A;  1XO1 A;  4C8O A;  4QZ8 A;  4B9M A;  2BPG A;  1CEZ A;  2DQN B;  9ICJ A;  1SL2 A;  2HBJ A;  2F3N A;  4I2F A;  5ALM A;  1ZD4 A;  2L5Y A;  3NGD A;  1ZXI A;  8ICS A;  2P6R A;  2AJQ A;  3IG5 A;  5CP2 A;  8ICE A;  4P0P A;  5IIJ A;  4EEY A;  3HT3 A;  2YB4 A;  5TIS U;  5AKY A;  3B0Y A;  4KLS A;  8ICL A;  4O3P A;  2H5X A;  3UMC A;  4G9B A;  2E8N A;  2MSN A;  3RH4 A;  9ICC A;  4GC6 A;  2H3F A;  4UB2 A;  1YZ7 A;  4O3S A;  1ZQL A;  3H8M A;  5KFQ A;  2DBY A;  2E5S A;  3KKA A;  3EWA A;  2K4I A;  1J2N A;  4F50 A;  4QZB A;  2DFL A;  5AI4 A;  1RYS A;  3C29 A;  4I2I A;  2PFN A;  4GXK A;  1BPY A;  3F2D A;  2ZXI A;  2XI9 A;  4YD2 A;  3QEA Z;  3BQ0 A;  3Q8K A;  1U9L A;  1Y88 A;  2KHQ A;  4FZL A;  3EPG A;  7ICO A;  2Y0S C;  4K4I A;  2WFA A;  5J0U A;  3SZ2 A;  1ZQE A;  2HMX A;  9ICK A;  2KVC A;  4RQM A;  3RH6 A;  3RB6 A;  3WK9 A;  5J8Y A;  1FFV A;  4UAU A;  4CGZ A;  1ZQO A;  1NK4 A;  9ICB A;  5DQH A;  3H0R B;  1TKD A;  1U47 A;  4O5C A;  3G6Y A;  1ZD5 A;  3PW2 A;  1NZP A;  4CF3 A;  4CCH A;  4KMU A;  9ICS A;  4F4X A;  4YMO A;  4ZOH C;  4DL3 A;  2IHM A;  4BXO B;  3U26 A;  2DWQ A;  2W3S A;  2LHT A;  1UT8 A;  3H40 A;  3OJU A;  4JWM A;  2XCA A;  1L5U A;  1KDH A;  3CP8 A;  2NO5 A;  2RQ5 A;  3D2N A;  3GIK A;  2W9C A;  2EZZ A;  2D8C A;  3HPO A;  4FBT A;  1S10 A;  1WUD A;  4DL2 A;  1N56 A;  1KFT A;  2PI4 A;  3EW9 A;  1IM4 A;  5AK4 A;  2HHT A;  1BNP A;  4EZ6 A;  4UW9 A;  1L7N A;  4B6J A;  4PJ0 U;  1NK8 A;  1QTM A;  2W9C B;  4DFP A;  3I28 A;  4Y2S A;  2CRX A;  2JEI A;  3A0H U;  5AKZ A;  3GV5 B;  4QWD A;  1T3Q A;  4RQ2 A;  2AQ4 A;  3M8S A;  4JWN A;  3C21 A;  2D6F C;  1V38 A;  3DDH A;  2OCE A;  4UAY A;  3SV4 A;  3Q8S B;  5EE9 A;  3V6K A;  2V9W A;  5KFN A;  3SD7 A;  4QIW C;  3C5F A;  3Q8L A;  4QZG A;  4K4G A;  2HBM A;  3HP6 A;  3F53 A;  5CEH A;  5CB1 A;  4HAI A;  2NO4 A;  2WF5 A;  2YQE A;  5AM3 A;  3BS5 B;  4OD0 A;  3Q8P B;  4F91 B;  2K8C B;  2W9A A;  1OUQ A;  5DKW A;  4J03 A;  2EAM A;  2PMZ F;  1TVA A;  1OW5 A;  3HIL A;  2HHQ A;  9ICG A;  1ZQS A;  1BPB A;  5L1I A;  4IQT A;  3KHH A;  3QU2 A;  5J2D A;  3PO4 A;  3LWL A;  2R18 A;  4RPX A;  2ISP A;  2JHD A;  2M9N A;  1N2X A;  4Q45 A;  3V7J A;  4BWM A;  4P4P A;  4RQ1 A;  1EXN A;  2I6X A;  4Y2X A;  9ICP A;  1KFD A;  3QE9 Y;  5AKX A;  1KTQ A;  5JTI A;  1JX4 A;  1UPH A;  4EEL A;  2MUT B;  3RJE A;  5AIB A;  2KE7 A;  4P4O A;  2P6U A;  4IR1 A;  3JPN A;  1ZQA A;  4QZI A;  1LKY A;  2EAP A;  1DXS A;  1XC9 A;  5ALU A;  4PGY A;  5III A;  2K4E A;  1Z1V A;  4EEN A;  4DSE A;  3GII A;  2R8J A;  4ED0 A;  1A77 A;  4KLU A;  4DS4 A;  5J8Y C;  3JPR A;  3SI8 A;  5KT5 A;  4GLX A;  2ZJA A;  3KBB A;  3QXG A;  1U49 A;  3ZDE A;  4EBC A;  3AU6 A;  2WAQ F;  1DGS A;  2IOH A;  5DQI A;  2G09 A;  5D46 A;  3WKE A;  2W8K A;  1FFU A;  4I2D A;  1Q3V A;  3IM1 A;  5ALY A;  1DK3 A;  1S8O A;  2JH7 A;  4B9V A;  4DQS A;  7ICT A;  1D8Y A;  2DUY A;  5ALS A;  5GTH U;  5KG2 A;  1PVQ A;  2WTF A;  1X9M A;  3JPS A;  1SKS A;  1X9X A;  3UXP A;  3RBD A;  7ICS A;  2ZIX A;  5EE3 A;  1ZQB A;  3Q8M A;  4F5Q A;  3PX0 A;  1IIP A;  4DL5 A;  5J2J A;  4I2J A;  8ICT A;  3H7I A;  2NV3 A;  4QZ9 A;  1NJY A;  1DOQ A;  2H3Q A;  3M7D A;  5L9X A;  2PFO A;  2ZIX B;  2IA6 A;  2GO7 A;  3QUT A;  2EAO A;  4O0I A;  2G06 A;  4GC7 A;  2BCV A;  3NAS A;  4KLE A;  5EE0 A;  4KN7 A;  1RM6 C;  2XC9 A;  4R64 A;  4M0A A;  3TAN A;  2KJ8 A;  5KFX A;  3PSF A;  1B4F A;  5H2F U;  4UAW A;  4KN4 A;  1YZ6 A;  3RFA A;  5HP4 A;  1QSY A;  1VJ5 A;  2C2E A;  4LVS A;  1Z1B A;  2WHE A;  4FZN A;  1DK2 A;  1Q3U A;  3UQ2 A;  3QU7 A;  5DQG A;  3ZDC A;  4DO9 A;  3NVZ A;  1BPE A;  2BCS A;  1Z4O A;  4M9L A;  4RQ0 A;  1XU4 A;  2GH1 A;  2LMR A;  2EQY A;  4OJ5 A;  4J9K A;  4C7Y A;  3PV8 A;  2C28 A;  1RPL A;  3T5J A;  3G6X A;  8ICO A;  2IBK A;  4UAR A;  3ONN A;  2NRZ A;  2J6U A;  1PK3 A;  3C1Z A;  2ZTD A;  5J2G A;  4FE3 A;  2PFP A;  5ALV A;  4YCX A;  3V7K A;  1J97 A;  3BS7 A;  5IIM A;  3C5G A;  1JRP A;  3H8J A;  4RNM A;  2KOB A;  3MR6 A;  9ICF A;  3PSI A;  4ECR A;  1HIW A;  5HHH A;  2W43 A;  5C5J A;  4EZ9 A;  4QZE A;  4DSK A;  2KHV A;  2RP5 A;  4AYB F;  4M2Y A;  2LI6 A;  5JU5 A;  1SGG A;  1QSL A;  2FE9 A;  9ICO A;  5DG7 A;  1ZQ1 C;  5CR0 A;  5EWF A;  2HI0 A;  4FBU A;  3THV A;  1XSL A;  5AM2 A;  2IOF A;  4UQG A;  1KKX A;  5KFM A;  2QLT A;  3J81 j;  2ODG A;  2YMM A;  1NJX A;  4QWC A;  1S0M A;  2BGW A;  4DOB A;  1ZQK A;  3M6Z A;  5AKI A;  3GIL A;  4ED6 A;  3E0F A;  1ZD3 A;  1RXV A;  8ICC A;  1OXJ A;  4NY8 A;  2MUT A;  3BQ7 A;  1ZJM A;  5J0R A;  2WB1 C;  3CRX A;  4BWJ A;  1X40 A;  4MHV A;  1BGX T;  5AK5 A;  1V85 A;  1N5X A;  3NVW A;  4YQW A;  4BUG A;  4US9 A;  5ALQ A;  4KLH A;  1NNL A;  2WF9 A;  2H3Z A;  1TE2 A;  5KFV A;  8ICM A;  1L7P A;  1QQ7 A;  2DPJ A;  4M6W B;  1TV9 A;  2GWS A;  2OYY A;  1VLB A;  3RB3 A;  4PL1 A;  2F1J A;  3ALR A;  4YFK A;  5KG0 A;  2KZZ A;  3F5A A;  4R63 A;  4QNL A;  3ZDB A;  3IDW A;  4O3M A;  5EWG A;  5GTI U;  1U4B A;  3A0B U;  1XNS A;  4RZR A;  1MSW D;  3TFS A;  2B21 A;  2XCP A;  5TZV A;  1UT5 A;  1QH9 A;  1BVS A;  2UVW A;  4F72 A;  3AL0 B;  2F76 X;  5KFP A;  3MGH A;  3MGI A;  4UB5 A;  5KFI A;  5AM1 A;  2KTQ A;  4J9Q A;  3AN1 A;  4XUS A;  2KIW A;  5D49 A;  3FC4 A;  1RXW A;  1SKW A;  4JK1 A;  2ASD A;  5DGB A;  4MEY A;  4PH5 A;  5DB6 A;  1KRP A;  2ZIU A;  2ESE A;  3G6V A;  3Q8Q B;  2KKP A;  3MC1 A;  2R8G A;  2H3I A;  2KJ9 A;  1BPZ A;  7ICI A;  2WF8 A;  4UB1 A;  2KMD A;  3WKA A;  1Z00 B;  3OHB A;  5AKK A;  3MAB A;  5F3X B;  4NLZ A;  3C28 A;  2BPF A;  2BPC A;  1MN8 A;  2KKV A;  5D4B A;  4DFK A;  3N7S C;  4I27 A;  7ICG A;  3TAD C;  1D9F A;  1Z00 A;  2QAR A;  5CA7 A;  2BCQ A;  2WB1 F;  1ZQP A;  2G08 A;  5ALW A;  1NJW A;  5ALG A;  4OJ6 A;  3RJJ A;  1WWU A;  4MF8 A;  4J9P A;  2WF6 A;  1KN5 A;  2LYA A;  2F77 X;  1ZQG A;  3NRW A;  1RYR A;  4OO1 J;  3ORY A;  3WK4 A;  2BCR A;  4NLK A;  3N4M B;  2HVH A;  3EUB 2;  7ICN A;  3AMZ A;  5KG6 A;  4YXJ A;  5AI8 A;  2FLP A;  5IIO A;  1JN3 A;  1NKC A;  5IIL A;  1SXD A;  2XID A;  2EH9 A;  4C0Z A;  1KEJ A;  2BCU A;  4KLM A;  2K8B B;  2Y1I A;  4WJ3 B;  1GO3 F;  2VA8 A;  1A6S A;  8ICW A;  3WKB A;  5KG4 A;  5ALE A;  1URJ A;  1TAM A;  4C8N A;  4QW9 A;  1XS9 D;  4BJQ A;  5AK6 A;  4DSL A;  2HHU A;  4DF8 A;  3M1Y A;  3H0M B;  2QB0 B;  3BQT A;  1B22 A;  2HDO A;  2FJ6 A;  3AQE A;  4Q43 A;  3ETR A;  1L8L A;  2ZUD A;  1X9W A;  5KFB A;  3IHQ B;  3GV8 B;  4P2H A;  8ICF A;  1UA1 A;  1LKY B;  4UB8 U;  4GIB A;  4C8M A;  4USA A;  4RQ8 A;  3K1R B;  4HYK A;  3PX6 A;  1V97 A;  5IIN A;  5DG9 A;  2DL0 A;  2JV3 A;  5KT2 A;  5KG7 A;  2V4R A;  5EE1 A;  2NRV A;  3ICX A;  3QNM A;  1ZQT A;  4RPY A;  5KT3 A;  3OHA A;  1BPD A;  4DSI A;  1S97 A;  8ICI A;  3EYZ A;  1ZET A;  5KFO A;  3TAC B;  2HBK A;  5AIC A;  1DGJ A;  3SMV A;  2JEG A;  9ICT A;  4M6W A;  4TQS A;  2FLL A;  3L3F X;  5B5E U;  4C4R A;  4F5P A;  1ZQN A;  4RUA A;  5AM4 A;  4UBC A;  8ICJ A;  5CJ7 A;  4Y2R A;  4RPZ A;  3D2S A;  2OXO A;  3N97 B;  4YG2 A;  3PO5 A;  3GIJ A;  5J2I A;  4NLB A;  1A0P A;  3FDS A;  2W55 A;  3N7P D;  1MQ2 A;  4ECW A;  4YXM A;  5IIK A;  4O9M A;  3BDP A;  1AQ6 A;  2EDU A;  4F93 B;  3FYH A;  1RYU A;  1JMS A;  5AM0 A;  4F4K A;  2UVU A;  4CNQ A;  1SWV A;  2DKX A;  4FFD A;  5ALI A;  4Q8E A;  8ICX A;  3NTU A;  2YX8 A;  3H8S A;  2VJ4 A;  4C8K A;  3EPI A;  2BZF A;  1QSS A;  5KFL A;  4DQR A;  3ISC A;  4EX7 A;  4KLD A;  3RTV A;  4RNO A;  3ISD A;  3OSP A;  3BZK A;  5J0X A;  4EBD A;  1ZQR A;  4QW8 A;  3JPQ A;  3NVV A;  5AKJ A;  4PZO A;  3PR4 A;  4DL7 A;  3QYP A;  3UPQ A;  3TAR A;  3Q8R B;  1ZOL A;  4Z6F A;  2MA1 A;  4O3O A;  2XGP A;  1QCK A;  2KFZ A;  3QUC A;  4PZN A;  5ALH A;  2MU2 A;  1IG6 A;  1WCL A;  4OJL A;  2N1R A;  3RRH A;  1QLN A;  5BPC A;  2LBO A;  4RNN A;  2A19 A;  1S0O A;  1HJP A;  4C80 A;  5DDM A;  1X6I A;  5KG3 A;  4B9S A;  3MBY A;  5HNK A;  3NUQ A;  4YR0 A;  3M9N B;  3PR5 B;  5L1L A;  1TK0 A;  4YMN A;  4PHP A;  4XRH A;  2OM6 A;  4OJP A;  1T3N A;  2NRW A;  1CI4 A;  2AGP A;  4R8U A;  5ALX A;  4ECY A;  2C2R A;  4NLG A;  1D9D A;  3LVV A;  2RDJ A;  2K8A A;  4IR9 A;  2Y9T A;  2W9B B;  4UB4 A;  3M9M B;  2PMZ C;  4QZA A;  9ICN A;  2KG5 A;  2Y9U A;  1KLN A;  5AKH A;  4OCZ A;  3TAP A;  1ED1 A;  2F8K A;  3BZC A;  2HW3 A;  2NYV A;  4R65 A;  4GXI A;  8ICR A;  2ZIU B;  2ZG6 A;  3I1Y A;  1X42 A;  1ZQM A;  3I76 A;  5ALJ A;  2ZTE A;  1ZQV A;  2CXY A;  5KAI U;  4EYH B;  1PK1 A;  4AP9 A;  2JXJ A;  5ALT A;  5KG1 A;  8ICH A;  4NWI A;  3SQI A;  3HW8 A;  1JXE A;  3V6H A;  4I28 A;  3B9J A;  7ICR A;  2BQU A;  5C0Y A;  1D8L A;  4ED3 A;  2VAN A;  4DLG A;  2OWO A;  3OPX A;  8ICN A;  4ZH4 A;  9ICX A;  4NXZ A;  1KSP A;  4Y2U A;  2XVT A;  4PL2 A;  5KFA A;  5KFG A;  1N62 A;  1L3S A;  2KK0 A;  1XSP A;  2HOQ A;  3V72 A;  8ICB A;  3LWM A;  3F2C A;  2CN1 A;  3RF9 A;  1WYG A;  2IMW P;  2K4P A;  3PW0 A;  4YVZ A;  2C2D A;  4F8R A;  4CF4 A;  1Q8K A;  4FZM A;  4NV0 A;  3JPO A;  1K5O A;  2AXT U;  1FIQ A;  1S5L U;  1CRX A;  1ZYQ A;  2C22 A;  1QQ5 A;  8ICG A;  3AM9 A;  2F2A B;  4Q44 A;  5KNI A;  5KFZ A;  1ZRN A;  4QZC A;  2Y1J A;  3H4D A;  2ZJ5 A;  4NJ8 A;  5DB7 A;  2KD1 A;  1N60 A;  1L7O A;  3EZ5 A;  4KTQ A;  7ICH A;  2Q4T A;  4PHA A;  5K4L A;  4B9T A;  3UM9 A;  3TAQ A;  3K1Z A;  1NOM A;  2JZB A;  2JR5 A;  4XA5 A;  3PW5 A;  2P35 A;  9ICE A;  2G0A A;  2JMG A;  5J0O A;  3WK7 A;  2Y0S F;  2KJ5 A;  5F9L A;  4ELT A;  1SV0 C;  3TAD A;  3VC8 A;  1L3V A;  4KX5 A;  4NLN A;  5DB8 A;  2JH1 A;  1LB2 B;  5J2A A;  2GLE A;  1O03 A;  3SAH A;  3F5E A;  5HHI A;  5J0S A;  3ED5 A;  5AM5 A;  5ALF A;  1NZB A;  4M9G A;  5KFD A;  3QUQ A;  1NK7 A;  2VJ5 A;  5KT4 A;  3SR6 A;  2D3D A;  8ICK A;  1B0X A;  4K4H A;  2FI1 A;  1MQ3 A;  4QZD A;  1NK6 A;  2HOF A;  4RQ3 A;  5CHG A;  4JV1 A;  1Z3E B;  2E8P A;  4Y2Q A;  3MR3 A;  3MDC A;  3SAF A;  3TQ1 A;  4DFJ A;  1JUD A;  2WF7 A;  3H8W A;  3KHL A;  2A1A A;  1MA7 A;  2FPK A;  3B0X A;  4G3I A;  5G5H A;  3RBE A;  3SEI A;  3L5K A;  1X66 A;  3C2K A;  2ZUB A;  2YMP A;  2RDI A;  4KLL A;  4MFA A;  2DPI A;  4M04 A;  2Q0Z X;  2AGQ A;  2HCF A;  4NL9 C;  4IC9 A;  2FPL A;  1HEK A;  3H4B A;  5FP0 A;  2F44 A;  2W3R A;  4DF4 A;  4M9J A;  4PHE A;  4UAV A;  1WWV A;  1C20 A;  1SL0 A;  4LJX A;  4RQ6 A;  1C7Y A;  1HUZ A;  5AK3 A;  2DF4 B;  1T94 A;  8ICY A;  2I1Q A;  4F4Z A;  5AI0 A;  2HBL A;  1ARO P;  2O6K A;  2W7O A;  2M0N A;  3HKZ F;  5J2F A;  3MFI A;  4I2B A;  2XY5 A;  4CE6 A;  1L6N A;  2KSO B;  7ICJ A;  4UBB A;  1UQV A;  2LYH A;  2KFN A;  4C4S A;  5L1K A;  5KFE A;  1PK1 B;  4YN4 A;  2ZIV A;  2W9B A;  4RUC A;  2KNJ A;  3HJE A;  1L3T A;  1X6J A;  3GFK B;  7ICQ A;  2I9G A;  5KL8 B;  3ISB A;  7ICP A;  2LPE A;  2NRX A;  2EZY A;  4DLE A;  4YR3 A;  1XWL A;  4X5V A;  5KFK A;  5ALL A;  4F4W A;  7ICL A;  3RB4 A;  4NM2 A;  4B9U A;  3E2E A;  4E0D A;  3UQ0 A;  1ZQI A;  3CNH A;  5B66 U;  3RAQ A;  5J2H A;  4DL6 A;  5J2B A;  4QWA A;  2ATL A;  4IS7 A;  4C4T A;  1ZQW A;  3S6J A;  3QX7 A;  4AYB C;  4J9S A;  2JGA A;  3KFU F;  4UAT A;  4EX6 A;  8ICP A;  5J29 A;  4RT3 A;  5CWR A;  4RQ7 A;  1KBU A;  3T3F A;  2AH5 A;  2MAX A;  2LYB A;  2IHN A;  2OH2 A;  4M47 A;  1JIH A;  1IV8 A;  5G5G A;  1JI7 A;  3T5K A;  4LZG A;  5KFW A;  2BDU A;  4FO6 A;  4C7Z A;  4IQV A;  9ICM A;  4I2A A;  5KFT A;  3BS5 A;  4P0Q B;  2JZB B;  2EAN A;  2ASL A;  3IP4 B;  3C23 A;  3KHR A;  4QJF B;  2VA3 A;  2KV2 A;  4F2S A;  2BQ3 A;  4JB3 A;  2BR0 A;  4PGX A;  1X9S A;  1L7M A;  5JUM A;  2ALZ A;  4ECV A;  5DLG A;  8ICZ A;  1L3U A;  2W11 A;  1CUK A;  2EZX A;  1SKR A;  2YY6 A;  2OHF A;  4M9H A;  1P7D A;  4KIT B;  1S0V A;  3WK5 A;  2KIC A;  4ACO A;  3IN5 A;  4O3N A;  2FMP A;  4Y2Y A;  3BQ2 A;  1ZQU A;  3D2Q A;  5AHX A;  4ED7 A;  2B0C A;  3UMB A;  5F9N A;  2KZ3 A;  3QU5 A;  4J9N A;  4ECS A;  3LDA A;  4DFD A;  3DV9 A;  4Y2P A;  4KLG A;  1NKB A;  5JRT A;  2VA2 A;  3TI0 A;  3WK6 A;  3RJG A;  1ZQX A;  4FS2 A;  3LYS A;  3GIM A;  1F0M A;  3PSP A;  2B6G A;  1U45 A;  3WU2 U;  1PVP A;  3V7L A;  2FDR A;  3N7R C;  4TQR A;  4KLF A;  3L4P A;  2RLT A;  3R9K A;  1N61 A;  4DSJ A;  1ZRM A;  9ICI A;  3OJS A;  1T8E A;  2CPR A;  9ICR A;  3PML A;  4IRK A;  3E58 A;  3M8R A;  4IL6 U;  5ALZ A;  2BQR A;  1SXE A;  1N48 A;  2QB1 A;  4P0Q A;  5DG8 A;  4OJO A;  3JPT A;  3UXN A;  5DBC A;  7ICM A;  4Q8F A;  3T5H A;  5ALR A;  3RJF A;  2OEH A;  1SL1 A;  8ICV A;  2ZXH A;  5HR7 A;  2WAQ C;  4CDG A;  5J0P A;  8ICA A;  2QAR B;  4Y2J A;  3K4G A;  2FLN A;  2LM1 A;  5J0W A;  1ZQH A;  4I2E A;  1ZJN A;  2H3V A;  4JMU A;  4O5E A;  3H0L B;  5AKG A;  3QEB Z;  4DCC A;  3KD3 A;  1IXR A;  1LVH A;  5KT6 A;  5J2C A;  3IRU A;  4JUZ A;  4DFM A;  3KKA C;  5BOL A;  3GZF A;  5HMM A;  4YD1 A;  1COK A;  1NJZ A;  2E3T A;  5ALN A;  4UB6 U;  3UMG A;  5AI6 A;  1SV0 A;  4RU9 A;  2JEF A;  8ICQ A;  3JPP A;  9ICW A;  2VKQ A;  4EBE A;  3HRD D;  2KEY A;  3WK8 A;  1WG8 A;  9ICU A;  1KFS A;  5KFH A;  3MDA A;  4O5K A;  7ICU A;  1PUZ A;  2ZIW B;  2KIV A;  1ZD2 P;  1T4G A;  3NRZ A;  4F5R A;  3SV3 A;  3ZD8 A;  4GXJ A;  3RRG A;  1HUO A;  2AU0 A;  4YR2 A;  2JEJ A;  3PMN A;  3ZDA A;  1SB3 C;  1SWW A;  3LK9 A;  4P0P B;  2F1H A;  5KL1 B;  3KZX A;  4LZD A;  3T5L A;  1TAQ A;  1Z19 A;  4IRD A;  4DQQ A;  4F92 B;  3PW4 A;  1JXL A;  5KFU A;  9ICA A;  4KX3 A;  5ALP A;  3OSN A;  2YML A;  4QZF A;  2J6S A;  3SAG A;  2XIC A;  4A8E A;  3RAX A;  2NRT A;  1JAL A;  2R8H A;  2XY6 A;  5DDY A;  2W54 A;  4DQP A;  4PPX A;  1ZQQ A;  2FMQ A;  7ICK A;  4U7C A;  2HHW A;  7ICF A;  2PFQ A;  4C8L A;  3KHG A;  1ZQC A;  1ECW A;  2AHO B;  4MF2 A;  2BHN A;  3AU2 A;  4ECZ A;  3PNC A;  2KN7 A;  2V4Q A;  2A1J A;  5J0Q A;  4QIW F;  1NKE A;  2KVS A;  1ZQJ A;  3ZI4 A;  1UA0 A;  4Y2V A;  4I2C A;  3OTQ A;  1S9F A;  3GV7 B;  5DLF A;  2DGZ A;  4RQ4 A;  3KTQ A;  2HHV A;  1KL9 A;  4RQN A;  2AGO A;  1UCV A;  1ZQF A;  4O3R A;  3GU3 A;  2PKE A;  4ECQ A;  2P66 A;  1PVR A;  3BQ1 A;  4BGD A;  9ICV A;  5KFY A;  1QQ6 A;  4I2H A;  5KFR A;  2YB1 A;  2E8M A;  2F1I A;  5KFF A;  3PY8 A;  3MR2 A;  2HOI A;  1WCN A;  4B9L A;  2HHS A;  1D8B A;  2LKY A;  5J2K A;  3FM9 A;  4TUQ A;  3D6J A;  2ZTC A;  4J9M A;  4ECX A;  4ECU A;  2RHF A;  2I5H A;  3RB0 A;  4KLI A;  3WKC A;  1Q46 A;  3PZP A;  3PX4 A;  2G5I B;  5KG5 A;  4KMO B;  2W03 A;  2R8I A;  5KTQ A;  3NS1 A;  1N63 A;  1SV4 A;  1K1Q A;  3F2B A;  1BPX A;  3ETL A;  5HR6 A;  5KT7 A;  3C2L A;  5AI9 A;  2HVI A;  1TK8 A;  4UAS A;  5J0Y A;  2KP7 A;  3M6K A;  2G07 A;  5L1M A;  4KLO A;  4QWE A;  1S76 D;  3DEE A;  4NLC A;  2W8L A;  1X2I A;  1F44 A;  2FPM A;  5T14 A;  3ZDD A;  4RT2 A;  2Z7J A;  4F4Y A;  2PXI A;  2W9M A;  1O08 A;  2UVR A;  5AKE A;  3UXO A;  4F2R A;  5KFC A;  2VIX A;  5DBB A;  1DRG A;  3M9O B;  4DS5 A;  4DWI A;  9ICQ A;  2G5H B;  4ED1 A;  4GFJ A;  1VDV A;  4IQW A;  3AQF A;  5EOZ A;  2AQ0 A;  2W04 A;  3C1Y A;  3C2M A;  1KW4 A;  8ICU A;  2ES6 A;  5KFJ A;  3MR5 A;  1PZN A;  3MFH A;  1YT3 A;  5A0L A;  2E1E A;  5AI5 A;  1COO A;  4M9N A;  3AUO A;  2PI5 A;  3V6J A;  3KZI U;  3CYM A;  1XSN A;  3PST A;  4MFF A;  4O3Q A;  4TUS A;  2JRZ A;  4J9O A;  4EYI B;  4DL4 A;  3KOO A;  4F5N A;  4NM1 A;  1SIJ A;  4UB3 A;  3QZ8 A;  4Y2T A;  1BNO A;  4R66 A;  1JRO A;  5DB9 A;  2ASJ A;  3RJH A;  3HX0 A;  4MEX A;  1LV5 A;  2XGQ A;  2KZM A;  4Z6D A;  7ICV A;  4DOC A;  1UHU A;  4R8U B;  4Z6C A;  3QU9 A;  2E8O A;  1A76 A;  1K1S A;  3CW2 C;  4ELU A;  2YMQ A;  2YN4 A;  4NL9 A;  3ZD9 A;  2K89 A;  5EWE A;  4IQU A;  3FAH A;  1NI3 A;  1XO0 A;  1H38 A;  2FMS A;  5AIA A;  3WKD A;  4ED2 A;  2ZIW A;  4U6P A;  1NK5 A;  2UVV A;  4QZH A;  1N5W A;  3VCB A;  1J2M A;  2LM4 A;  4F71 A;  1T7P A;  1TK5 A;  4YMM A;  1RQN A;  1NK9 A;  5DGA A;  4DEZ A;  1SZP A;  2ZUC A;  3O0F A;  2QKQ A;  1RG6 A;  4BXO A;  4F5O A;  2E1F A;  1FEZ A;  3K75 D;  5KAF U;  2ZIV B;  1MC8 A;  3TFR A;  5J2E A;  2QB0 A;  5HML A;  1U48 A;  5BOM A;  4BX9 C;  4KLT A;  4FS1 A;  2K4H A;  5AKL A;  4JV2 A;  4PHD A;  1L8O A;  3HWT A;  2W7P A;  4KLJ A;  2DKZ A;  4I2G A;  5L1J A;  1V9P A;  4P4M A;  1NK0 A;  3RJI A;  4MFC A;  5KFS A;  2F8L A;  5CRX A;  3RR7 A;  3TKA A;  1TFR A;  4ICA A;  3BJY A;  3QUB A;  1S77 D;  4DQI A;  2BKE A;  1RDF A;  2ZJ8 A;  4EEK A;  3AEV A;  5ALK A;  4Z6E A;  7ICE A;  4BDP A;  4I29 A;  4F3O A;  4DSF A;  4TUP A;  1F5S A;  5J0T A;  4CRX A;  2MRL A;  1FO4 A;  5DBA A;  9ICH A;  5ALO A;  2A3V A;  3SEN A;  4ED8 A;  4RQ5 A;  3GDX A;  1S0N A;  3GQC A;  4CF5 A;  4J9R A; 
#chains in the Genus database with same CATH homology
 3L3F X;  2LYB A;  3NRW A;  3C29 A;  1Z1B A;  3M6K A;  2G07 A;  2OH2 A;  4OO1 J;  4P0Q A;  4FZN A;  4IC9 A;  3DEE A;  1Q3U A;  2D6F C;  3HKZ C;  4NLC A;  3F2D A;  2OM6 A;  1HEK A;  4KX3 A;  4BUG A;  4OJP A;  2K89 A;  2ZXI A;  2XIC A;  4OJO A;  4A8E A;  3SAG A;  4QIW C;  2XI9 A;  1F44 A;  3D2S A;  3LVW A;  2OXO A;  2H3Z A;  2KD1 A;  2BDU A;  3IG8 A;  5T14 A;  1XO0 A;  2HBM A;  2KHQ A;  4FZL A;  4NLB A;  1A0P A;  3LVV A;  2K8A A;  2GH1 A;  2OYY A;  4OJ5 A;  2Y0S C;  2Z7J A;  4PL1 A;  3ALR A;  2PMZ C;  2WAQ F;  2ZIW A;  2ZXH A;  2Q4T A;  3F53 A;  2XID A;  4P0Q B;  4U6P A;  3N7P D;  3F5A A;  3IP4 B;  2G09 A;  5HR7 A;  2WAQ C;  4C0Z A;  4CDG A;  2HMX A;  3VCB A;  4U7C A;  4QNL A;  3K1Z A;  4O3M A;  1ED1 A;  2K8C B;  2K8B B;  4QJF B;  2KV2 A;  2KVC A;  3ONN A;  1GO3 F;  1XNS A;  1OUQ A;  4WJ3 B;  1ECW A;  2G0A A;  2VIX A;  1A6S A;  1DRG A;  2DF4 B;  2JMG A;  1Q3V A;  1T94 A;  2H3V A;  2PMZ F;  4JMU A;  2ZIU B;  2ZG6 A;  3O0F A;  4QIW F;  2Y0S F;  2KJ5 A;  3MGV A;  4CGZ A;  4FE3 A;  3H0L B;  3VC8 A;  3AL0 B;  2F76 X;  3T79 A;  2G5H B;  4KX5 A;  1URJ A;  1TAM A;  2E1F A;  2JH7 A;  2JH1 A;  1SZH A;  3H0R B;  2HBL A;  2ZIV B;  3SAH A;  2KOB A;  2YX8 A;  2DGZ A;  3F5E A;  4GFJ A;  4NWI A;  3AQF A;  2VJ4 A;  3PSI A;  3SQI A;  4BJQ A;  2W7O A;  2GOL A;  2W04 A;  1PVQ A;  2M0N A;  1P7D A;  1HIW A;  3HKZ F;  2KIC A;  4ACO A;  3IN5 A;  1NZB A;  2KIW A;  3GZF A;  3H0M B;  4BX9 C;  1L6N A;  2KHV A;  3GU3 A;  2ZIX A;  2RRD A;  1PVR A;  2RP5 A;  4AYB F;  3AQE A;  5C0Y A;  2R18 A;  2VJ5 A;  2ZIU A;  3D2Q A;  2K4H A;  2JHD A;  2KKP A;  1IIP A;  2YB1 A;  2DQN B;  2HBJ A;  2H3I A;  1YT3 A;  2KJ9 A;  2ZIV A;  2W7P A;  2HOI A;  5A0L A;  1ZQ1 C;  2E1E A;  2KNJ A;  2NV3 A;  3OPX A;  1D8B A;  2LHT A;  5KL8 B;  2HOF A;  2MA1 A;  2VKQ A;  2LKY A;  2XVT A;  4PL2 A;  2KEY A;  2F8L A;  3IG5 A;  3CYM A;  2H3Q A;  3M7D A;  5CRX A;  3CP8 A;  3PST A;  3D2N A;  4P0P A;  2ZIX B;  1UPH A;  2HOQ A;  2RHF A;  3SAF A;  4ICA A;  2YB4 A;  3C28 A;  3F2C A;  2CN1 A;  1MA7 A;  2G06 A;  2ZIW B;  3RF9 A;  4OJL A;  3LYS A;  2KKV A;  2N1R A;  3PZP A;  2G5I B;  1WUD A;  3PSP A;  4KMO B;  3ICX A;  3N7S C;  3M6Z A;  2LBO A;  2W03 A;  1PVP A;  4FZM A;  4NV0 A;  2H3F A;  2KJ8 A;  2WB1 F;  3PSF A;  3N7R C;  1CRX A;  2G08 A;  3E0F A;  4AYB C;  4OJ6 A;  2JGA A;  3F2B A;  4CRX A;  3KFU F;  2E5S A;  2MRL A;  4P0P B;  5HR6 A;  2HBK A;  2K4E A;  5KL1 B;  3SMV A;  3KZX A;  2WB1 C;  3NUQ A;  2A3V A;  3CRX A;  2CPR A;  3RFA A;  2CRX A;  1Z19 A;  2F2A B;  2K4I A;  2LYA A;  2F77 X;  1KBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...