2F76X

Solution structure of the m-pmv wild type matrix protein (p10)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
100
structure length
100
Chain Sequence
MGQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title D-retrovirus morphogenetic switch driven by the targeting signal accessibility to Tctex-1 of dynein.
pubmed doi rcsb
source organism Simian retrovirus 1
molecule tags Viral protein
molecule keywords Core protein p10
total genus 30
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02337 Gag_p10 Retroviral GAG p10 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.490 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f76X00
2F77X 2F76X
chains in the Genus database with same CATH superfamily
5ALHA 4NY8A 4JUZA 2XIDA 3AQFA 3D2SA 3AQEA 4P0PB 1QQ6A 1QH9A 1ZD3A 4PPXA 5TZVA 4DS4A 1JMSA 3OHAA 4Y2SA 3T5JA 1ZQKA 1N5WA 3JPQA 3UXPA 3FYHA 4ICAA 4ED1A 4C4TA 2AJQA 1NK5A 5CHGA 3NASA 4C0ZA 3MGHA 4BDPA 4AYBC 1ZQDA 4DL3A 2YMPA 1ZQQA 3PSPA 4M04A 5AI0A 2W11A 3MGIA 2UVWA 5ALZA 4RPYA 1SXEA 3ZDEA 1L3UA 3WK9A 5KT5A 3KZIU 3IM1A 1Z4NA 4C8OA 1Q8KA 5KG4A 1S0NA 2W9AA 2OYYA 1UA0A 4Q8FA 4LVSA 4BGDA 4ZH4A 2EZZA 1ZQIA 2OHFA 1X40A 4F72A 5C5JA 5KFDA 5HHIA 1XU4A 5DLGA 5ALFA 1MN8A 1PVRA 2AH5A 1TFRA 1X6IA 2ZJ5A 3AMZA 3H40A 4R8UB 3EWAA 5DBCA 3PW5A 1SB3C 2KD1A 2DKZA 3H0LB 5AI9A 5EE0A 4F5RA 3WKAA 2HOFA 2QARB 4ED3A 5DB8A 8ICXA 3TQ1A 1N48A 3JPNA 2DF4B 1ZQNA 5J2IA 5D4BA 1RQNA 2PI5A 3IG8A 1WYGA 3QU4A 2R18A 2P6RA 3ALRA 3MFIA 1ZRNA 1N2XA 1ZQEA 8ICIA 5KFVA 2G09A 5L1IA 5KFJA 3KKAC 2DFLA 1PK3A 7ICTA 1TKDA 4I27A 1ZQUA 5J2DA 3RRGA 8ICVA 2F2AB 3RH5A 4DL5A 1K5OA 2WF8A 1KBUA 4KMUA 2WF9A 3BQTA 3F5EA 3CNHA 4Y2PA 4FE3A 5CEHA 1YT3A 5EWEA 4DEZA 3PY8A 4FZNA 3HP6A 3IHQB 3CP8A 5J8YC 1KN5A 2BKEA 2R8KA 4O9MA 7ICRA 9ICOA 4RQ4A 2A19A 2ISOA 5J2CA 3RB4A 4K4HA 4YVZA 4FS1A 3V7JA 1NKCA 3NVYA 1T7PA 4F3OA 2OWOA 1JN3A 9ICWA 2ZXHA 3C21A 4ELVA 3PMNA 4LJXA 3TFSA 4QJFB 2HCFA 2W03A 1L6NA 2YY6A 3HW8A 2F44A 4DL7A 3AU6A 1SIJA 4EENA 4MEXA 4RPXA 1KSPA 2EH9A 2LYHA 5HMLA 2KFZA 3RAXA 4QW9A 2ASDA 3WK7A 1B43A 4DFPA 2YB4A 2YMMA 5KFOA 5IINA 5TISU 4DFJA 4B9LA 4LZGA 3KFUF 2KJ9A 2NO4A 4YQWA 9ICVA 2YB1A 4B9TA 2KVSA 2K8BB 2KHVA 1U45A 4I2EA 5F3XB 5KFXA 2EQYA 2UVUA 5KT7A 4ED0A 1ZYQA 1BVSA 2KVCA 2W7PA 3QUBA 4QZFA 1COKA 3G6VA 1ZD5A 3S6JA 4UATA 5AKEA 5CR0A 2F8LA 1ZQAA 1TV9A 2W8LA 5AKJA 5J0XA 4RQMA 1YZ6A 1GO3F 4HYKA 2W04A 1MQ2A 2I9GA 1EXNA 4RT2A 1T4GA 2UVRA 1ZXIA 1ZQ1C 5CJ7A 2RDJA 4IRDA 2W8KA 1VLBA 2L5YA 3FC4A 2JEFA 4UAWA 3HJEA 9ICFA 4F4KA 2JGAA 3MR3A 4I2BA 4OD0A 2DKXA 5IILA 1U4BA 4BX9C 3Q8SB 1L3TA 3QE9Y 1ZQYA 1KL9A 3BQ1A 1MSWD 1MQ3A 5KFCA 3H0MB 4NL9A 2MUTB 3V72A 4IQWA 1D9DA 4F8RA 1FEZA 3HRDD 3GV5B 5KFKA 4RUAA 4ECYA 4UAUA 3TADC 2KIVA 4B9VA 5AIAA 4US8A 7ICGA 2W9BA 4JMUA 3MR6A 1LKYA 3V6JA 2CPRA 2NRXA 4NLCA 3L3FX 1SV0C 8ICWA 4J9KA 1NKEA 4PGXA 1QTMA 4ECWA 3M6ZA 2C2RA 3ZDBA 3GV7B 4R64A 1XWLA 2KE7A 1ECWA 1KW4A 4RPZA 5KNIA 4RNNA 1L8LA 8ICAA 5ALSA 4RQ7A 8ICRA 3ZD9A 2LBOA 4UARA 5EE3A 1KDHA 1TAUA 1BPDA 3AN1A 1U49A 3ZDCA 9ICRA 3RR8A 1ZQHA 5AKHA 2H3FA 1L7OA 4P0QB 3HX0A 5H2FU 3QEBZ 4PL2A 1ZRMA 2RHFA 4I2DA 5HHHA 3Q8MA 5DBBA 2E8OA 4KTQA 3AUOA 2OEHA 5AI6A 4R66A 2IOHA 4J9QA 3RAQA 2K4IA 2CN1A 4M47A 2KFNA 3BQ7A 1ZJNA 4MFAA 4DL2A 2BPGA 1X2IA 2K60A 1PK1B 4DSKA 3ZD8A 3EUB2 3LYSA 8ICZA 4UB6U 4C8KA 1ZQJA 9ICHA 5DKWA 2XY7A 1L7NA 2BHNA 4Z6FA 5KL8B 2RP5A 1D8BA 1UT5A 4PHDA 2K89A 4NV0A 5AIBA 3TACB 4PGYA 4PHEA 2HVHA 5ALYA 4I2GA 2WB1C 2AHOB 4KLHA 4NLBA 1PVQA 4BXOB 3HPOA 2JHDA 4F91B 1MA7A 4ECXA 7ICHA 4TUQA 3TI0A 5DG7A 5ALMA 3UMGA 4PZOA 3SENA 2LYBA 4MHVA 1RQLA 2Q4TA 3A0BU 1RYRA 3QU9A 4XA5A 2FLLA 1KFDA 1QQ7A 4IRCA 2E1EA 1ZQGA 4IR9A 1UQVA 5J0TA 8ICBA 5AICA 1AROP 1NK7A 2NV3A 2K4HA 4KLSA 4EELA 4RUCA 4RQ2A 2E5SA 4DFDA 2ZG6A 5KFSA 2IOFK 4ED6A 3RTVA 4YP3A 3JPOA 4KX3A 1NKBA 4GXIA 3KHRA 2R8JA 1WWUA 3N97B 4DO9A 7ICIA 4B9UA 5AI8A 3SD7A 3TAQA 5J8YA 2XY6A 1ZD4A 5CRXA 4O5KA 1KKXA 2WAQC 3C2LA 2KP7A 3WKEA 5ALQA 4OO1J 2MU2A 4QWDA 1BGXT 3GIMA 5ALTA 4RNOA 2A1AA 2ZIUA 4FFDA 2BPCA 3WKCA 3IDWA 2LM4A 2YN4A 3C2KA 5CWRA 3QU7A 3V7KA 3FAHA 1F5SA 1D8YA 3MR5A 1LV5A 8ICNA 3FM9A 1CUKA 3UXOA 1L7PA 9ICCA 5J0UA 2JEJA 2FPMA 1M6YA 2Y9UA 9ICMA 4GLXA 2K4PA 5KFTA 4Z6EA 3THVA 4CNQA 1WG8A 2KIWA 2WFAA 4KN4A 4KLDA 4QZGA 1OXJA 2EDUA 2W55A 2LI6A 4NLNA 1X9MA 2BCSA 2FDRA 4UB5A 2YQEA 3H4DA 3MFHA 4FZMA 4Y2XA 3KTQA 4ECZA 4US9A 2CXYA 3WK4A 2KG5A 1JIHA 4QZAA 1S0VA 4ELUA 2VIXA 3F2DA 5F9LA 3TAPA 4IS7A 4J9SA 5AM5A 3MR2A 2HOIA 5J2AA 4DQIA 2VJ4A 4QZBA 1ZQVA 4M0AA 4MF8A 2P35A 1JXEA 2F1IA 2FLNA 2VANA 1Z19A 5ALPA 5CP2A 4DQQA 2PFOA 4YMMA 2C2DA 4QNLA 2GWSA 5J0QA 5J2EA 3M9OB 4O0IA 2JZBA 1BPXA 1ZJMA 4NWIA 3JPPA 1V9PA 5DQGA 2HBMA 4C7ZA 4BWJA 3V6KA 5AKLA 1Z4OA 1L5UA 2ESEA 3KHGA 2CRXA 4QWBA 4LZDA 3OHBA 3UQ0A 4QZHA 5KG5A 8ICMA 5KFZA 3RBEA 4J9PA 3VC8A 1XO0A 1ZQTA 4TUPA 2EAOA 1IM4A 2XY5A 4I29A 2KTQA 3RR7A 4UB4A 9ICGA 3SAFA 3EW9A 8ICKA 2ZTEA 4UB3A 5AK6A 3UQ2A 1UA1A 4YFKA 3JPRA 1NK9A 2KKVA 1Q3VA 2B6GA 3D2QA 1DGSA 4GC7A 4ECSA 2ZIXA 5ALKA 3UPQA 1Z00B 3PR5B 2GO7A 4DWIA 3ISBA 3M9MB 1C20A 1PVPA 2I5HA 1J97A 2LHTA 3WKDA 2BDPA 1RM6C 4QIWC 4U6PA 5KFRA 3RJIA 2D3DA 1S5LU 1XSNA 3IRUA 3RJJA 2WF5A 4KLQA 1XSLA 1SZPA 1S0OA 1RYUA 2E3TA 2ZJ8A 4RT3A 5KFYA 4F5QA 1VDVA 1UCVA 4KLMA 5KG2A 1Z00A 2WTFA 4PHPA 2IOFA 1JROA 4B9NA 3F5AA 2PFNA 3M8RA 3BS5B 3KD3A 7ICMA 4QZ9A 1K1QA 4ED2A 3K1RB 2AQ4A 4PZNA 5J2BA 1QQ5A 2JEIA 5DB9A 2HHUA 4K4IA 2HW3A 4QZCA 5ALNA 4IC9A 4P4OA 1N62A 1OW5A 1SKSA 1TK5A 1JRPA 1L3SA 1Y88A 4PGQA 3BDPA 1O08A 4R63A 4YR0A 3B9JA 5J2JA 3GV8B 2NO5A 3ORYA 3UXNA 3T5HA 5DDMA 1T8EA 5B66U 3LVVA 3PW2A 3SMVA 4R65A 4F50A 7ICFA 5KG0A 4DL6A 5AKIA 5AI5A 1L3VA 2ZIVA 3UM9A 2KJ5A 3RJEA 4Q8EA 5JRTA 9ICLA 4QZDA 1NK6A 2WF7A 2H3QA 4QW8A 5KFEA 8ICFA 4OCZA 2ZTDA 1DRGA 3EPGA 2KICA 2JH1A 1S97A 3RJHA 2J6SA 2FPKA 5IIIA 9ICIA 1DXSA 4F93B 4BUGA 3QU2A 5AKKA 4JWMA 1TK0A 4GIBA 5C0YA 2FLPA 5HMMA 3WKBA 1FIQA 2M0NA 4OJLA 3M7DA 2NRZA 4TQRA 2DWQA 3ED5A 4J9OA 1QLNA 3TADA 4OJ5A 3K1ZA 5KFIA 3M8SA 2IA6A 4YMOA 4O3SA 1X9SA 1SV4A 2XC9A 2JEGA 1DOQA 4B9SA 5EE9A 5L1MA 4CRXA 1COOA 5KG6A 4YMNA 4TQSA 2XVTA 3PW4A 5AM3A 3E58A 1FFUA 2PFPA 3C1ZA 2YMQA 5J0PA 5HNKA 3SYZA 1KFTA 3H8JA 2F3NA 3F2BA 1RXWA 1X42A 3GIJA 4EZ9A 4KLOA 2HHWA 2ZIWA 9ICAA 4DQSA 2IHMA 4A8EA 4ELTA 3J81j 1J2MA 1XC9A 3PR4A 1Z3EB 1WWVA 2UVVA 4KLIA 4NLKA 1N5XA 2JH7A 1S76D 3NUQA 1RG6A 2PMZF 9ICPA 4KITB 1B4FA 1D8LA 2AGPA 2W54A 4UBCA 2VA2A 2IBKA 4M9HA 2J6TA 3LWLA 8ICOA 2MRLA 4DCCA 3MDAA 3SI8A 3QEAZ 1ZQXA 2ZIUB 4XRHA 4C8LA 1X66A 2ZJAA 3F2CA 1U48A 2FJ6A 2B21A 1CI4A 2AGQA 3BS5A 3QUTA 3IP4B 5ALEA 5GTHU 4Q43A 3KZXA 3N28A 4Y2YA 2YMLA 5AM0A 2QB1A 5AM2A 4C8NA 2KSOB 4OJPA 1PZNA 1A76A 7ICVA 4F5OA 1IV8A 5KAFU 4M9JA 3SZ2A 4I28A 2DGZA 4P2HA 2JXJA 3RJKA 2G5HB 2H5XA 1ZD2P 2BQ3A 4YCXA 4NL9C 2ASJA 4WJ3B 7ICOA 1VJ5A 4EX7A 4YN4A 3CYMA 2W9CB 1IG6A 8ICUA 4F4WA 2MUTA 3IG5A 2G06A 3D2NA 4XUSA 2RDIA 2XCPA 8ICQA 4RNMA 3G6YA 3PMLA 1BPBA 3F53A 3PSFA 4C7YA 1WUDA 4UB1A 5T14A 1RYSA 1A6SA 5ALGA 3T5LA 1BPZA 4DS5A 2BZFA 5JUMA 4TUSA 3QZ8A 2LYAA 5DQIA 1F0MA 5KT6A 4FO6A 4NLZA 5F9NA 1KEJA 4RZRA 4E0DA 1S77D 2R8HA 4KN7A 4C80A 1UT8A 3EZ5A 4UB8U 4EZ6A 2BCVA 3D6JA 1JXLA 5ALUA 3K75D 3BQ2A 3K4GA 2PFQA 2EZXA 4UAZA 1JX4A 1ZQZA 3SAHA 3V7LA 5K4LA 3HWTA 2OXOA 3QU5A 3BQ0A 9ICQA 1ZETA 1SL2A 4AP9A 2ALZA 1RZTA 5CA7A 2XI9A 5KFLA 3Q8LA 2VA3A 4PH5A 5DGBA 5DG9A 3MGVA 2HHVA 2ODGA 1KRPA 1O03A 1S10A 5A0LA 2N1RA 3HILA 5J0OA 3H0RB 4BXOA 4QIWF 5KFMA 3C28A 4QZEA 5ALOA 5ALVA 3I28A 3QYPA 3ISDA 1CRXA 4PHAA 2MA1A 5AM1A 4I2IA 3PO4A 4RU9A 2W9MA 5KFWA 4DQPA 2P66A 3PX6A 2F77X 3TKAA 3NGDA 2F1HA 2NRVA 1ZQSA 4KX5A 3E0FA 4DQRA 4PL1A 2AU0A 5JTIA 2ASLA 2FPLA 4KLEA 3KBBA 2I1QA 2HHTA 2O6KA 2K8CB 5E79U 1NK8A 4JWNA 2Y9TA 4O3PA 4I2AA 4ECVA 2V4RA 3I76A 2HOQA 5KFHA 3RFAA 1T3QA 2G07A 9ICSA 3LVWA 2WHEA 4YXJA 2Y1IA 3Q8RB 4PJ0U 2W9CA 5AKYA 1XNSA 1ZQFA 4DSLA 2JMGA 3GILA 2C22A 2XICA 3RF9A 8ICEA 1NZBA 2F8KA 2QLTA 1A77A 4JB3A 4NM2A 2R8GA 8ICCA 5DQHA 1J2NA 2LM1A 1JUDA 3IV6A 9ICXA 3QUCA 3SEIA 5BPCA 1PUZA 5B5EU 3GFKB 3M6KA 5J2HA 4QWCA 3EYZA 4J9MA 5EWGA 2XGPA 4DSEA 4F4YA 4UW9A 3LWMA 2H3ZA 4EEKA 2KZMA 2KSOA 1OUQA 3AL0B 1Z1VA 3OSNA 2DPIA 3PX4A 3BZCA 1SGGA 7ICQA 2K4EA 4DSFA 4MFFA 4DLEA 5HP4A 2HI0A 5KG3A 8ICYA 1SWVA 3AU2A 3QX7A 4DL4A 4TURA 1JALA 5DBAA 2HMXA 5ALIA 1NJYA 1FO4A 2HSZA 5CB1A 1C7YA 2C2EA 1L7MA 5KFNA 4GC6A 3SV3A 5DGAA 3PNCA 4CDGA 3H7IA 4Z6DA 2JZBB 3PO5A 3KKAA 2FI1A 4RQ6A 4DOAA 4RQ3A 1ZQCA 1HUZA 1DK2A 5AK4A 3TANA 5J0RA 3MABA 4DF4A 2EANA 3RRHA 5D49A 2D8CA 5ALDA 3C5FA 4OJOA 3WK8A 4O5EA 7ICUA 3BS7A 2ZIWB 4KLTA 2XCAA 2ZIXB 2YTUA 5EWFA 3GIKA 4P0QA 2Z7JA 3HKZC 4MFCA 3NS1A 2DPJA 3RBDA 2KZ3A 2RLTA 4NJ8A 2KMDA 5ALRA 1UPHA 4Y2RA 2ZXIA 3PX0A 5BOLA 3OTQA 1UHUA 3EPIA 2XO7A 4M6WA 2HHXA 3QNMA 1ZQPA 4DFMA 3DEEA 1X9XA 5IIKA 3OPXA 5L1LA 3M1YA 1LB2B 5AKZA 1S0MA 2ZIVB 5J2KA 4ECQA 4O3MA 4UAVA 3OJSA 4J9LA 3OSPA 5HR6A 3SV4A 3PSTA 4M9NA 2XGQA 3BZKA 3MBYA 4EBCA 2H3IA 2KN7A 2E8NA 3I1YA 2W3SA 3ZI4A 4DFKA 2W3RA 5J0YA 2JR5A 5L1KA 4DSIA 3KHHA 5KG7A 1BNPA 2BDUA 4Y2QA 4JV1A 1V97A 5KT4A 1QCKA 3H8WA 2B0CA 4RQNA 3G6XA 1H38A 4MF2A 5KTQA 2NRTA 4HAIA 4EBEA 2YX8A 4YR2A 3RB0A 1A0PA 4C8MA 1SZHA 1TAQA 2BCUA 2W43A 2OCEA 2BCRA 4DOCA 4B9MA 2ATLA 4I2HA 4FS2A 4C4SA 3PW7A 3V6HA 8ICSA 3N7PD 2HBKA 1B22A 2NRWA 4CE6A 4YD2A 3DDHA 3C5GA 1RPLA 3PZPA 1NK4A 4RQ8A 4R8UA 3JPTA 3C29A 4M9LA 1T3NA 5DB7A 5G5GA 3AEVA 2QKQA 4P4PA 1NZPA 1PK1A 4EYHB 2KKPA 1QSYA 5KFFA 4GFJA 4ECUA 3GDXA 2K8AA 4CGZA 4G9BA 1IXRA 4QWEA 2HHQA 4FBUA 1RDFA 3RJGA 4Y2TA 1NK0A 3RH4A 3LDAA 4GXKA 8ICLA 3O0FA 3TFRA 4ACOA 4CF5A 1D9FA 2PMZC 5KFAA 4O3OA 1TVAA 4OJ6A 3AM9A 4EEYA 5ALWA 3ETLA 3KOOA 1X6JA 2EAPA 2LPEA 3SR6A 5L1JA 5ALJA 3ONNA 2QB0A 5KFGA 4UASA 4Y2VA 4USAA 5AK5A 1WCNA 3PSIA 3R9KA 2RQ5A 2VKQA 5KL1B 4YD1A 1L8OA 1URJA 2OM6A 3PV8A 3Q8PB 2Y0SC 4Q45A 5AKXA 2NYVA 2WAQF 3B0XA 9ICTA 2AGOA 5J29A 5AM4A 2AXTU 3UMCA 4J03A 1JI7A 5KFQA 5IIJA 1HJPA 4JV2A 3RB3A 1KTQA 2G0AA 1QSLA 3TARA 3CW2C 4GXJA 4F5NA 4ED7A 4JV0A 5KG1A 4RQ0A 1SKRA 2HDOA 8ICJA 3B0YA 4U7CA 2V4QA 2PKEA 4NXZA 1SL0A 3JPSA 5HR7A 5KFPA 1NJWA 3GZFA 1ZQWA 2EAMA 4KLLA 4IRKA 1QSSA 1X9WA 2E1FA 3PVXA 2DL0A 4F4XA 4CF3A 3N7SC 2KK0A 4X5VA 9ICEA 1T94A 4YXMA 1NJZA 4F71A 2MAXA 5FP0A 3NVZA 8ICTA 4K4GA 4I2FA 3FDSA 7ICSA 2BGWA 4QWAA 3L4PA 1CEZA 2PXIA 1SWWA 2W9BB 3RJFA 2PI4A 3U26A 3NVWA 2KNJA 4QZIA 2KJ8A 4CCHA 3Q8KA 2JRZA 2M9NA 4UB2A 3Q8QB 4G3IA 1XO1A 1KQQA 3GQCA 5J0WA 2Y1JA 2D6FC 1ZQBA 1HUOA 4YG2A 1NJXA 4ED8A 1N61A 2LMRA 5EE1A 3N4MB 2H3VA 2I6XA 1ZQOA 5AKGA 2ISPA 3RB6A 1SV0A 2AQ0A 5KFBA 1HIWA 1DK3A 5AK3A 3H4BA 2MSNA 3QUQA 2A1JA 1MC8A 2E8PA 4O5CA 4ECRA 3VCBA 1SXDA 1NNLA 1NOMA 1DGJA 5EOZA 1BNOA 4NLGA 2V9WA 2KOBA 4O3RA 4KMOB 2OH2A 5GTIU 1N60A 1BPYA 1N63A 5ALXA 2J6UA 2KV2A 5J2GA 2E8MA 2P6UA 3WK5A 1XSPA 3HKZF 2JV3A 2GLEA 4M9GA 3OGUA 5KT3A 1LKYB 2F76X 4BJQA 3T3FA 4ECTA 4CF4A 4DOBA 4ZOHC 2RRDA 4RQ5A 5DDYA 2W7OA 1SKWA 3T79A 1YZ7A 4C4RA 2HBJA 1S8OA 2HVIA 4P0PA 3GU3A 3T5KA 1ZQRA 2GH1A 3ISCA 3RH6A 2BQUA 7ICPA 1BPEA 2A1JB 3A0HU 4F2RA 2DQNB 2DUYA 3SAGA 4IQVA 5ALLA 3IN5A 5DLFA 1ZOLA 2EZYA 4EX6A 5JU5A 3H8SA 2GOLA 1S9FA 2IHNA 4EYIB 2HBLA 2BPFA 2KEYA 3SQIA 1WCLA 1V85A 4QZ8A 4EBDA 8ICHA 2FMSA 3N7RC 5J0SA 1NI3A 1TE2A 4Z6CA 5J2FA 1P7DA 4FBTA 2HHSA 1Q3UA 1SL1A 1FFVA 3KHLA 1TAMA 4YR3A 2WB1F 5AI4A 5KT2A 1IIPA 2FMPA 4DLGA 2BCQA 3LK9A 5BOMA 2ZUBA 1KFSA 4AYBF 2A3VA 4IQTA 2VA8A 2ZUDA 2C28A 9ICBA 4F4ZA 4DSJA 7ICNA 3UMBA 5IIMA 3NTUA 3BJYA 5AHXA 4BWMA 1LVHA 4Y2UA 3NVVA 4FZLA 3ETRA 4RQ1A 4MEYA 3MC1A 4F92B 8ICPA 2G08A 2BQRA 3NRZA 2VJ5A 2KHQA 5KAIU 2BR0A 4B6JA 1HEKA 4F5PA 1B0XA 1AQ6A 1RXVA 3OJUA 1TK8A 1K1SA 4P4MA 2DBYA 2FMQA 2ES6A 3QXGA 5L9XA 1ZQMA 4KLJA 9ICJA 8ICGA 4J9RA 3CRXA 4DF8A 3E2EA 3ICXA 3MDCA 1V38A 2ZTCA 1ZQLA 4KLUA 2KZZA 5G5HA 5KFUA 3HT3A 4I2CA 4UAYA 4KLFA 3NRWA 4Y2JA 2Q0ZX 2ZUCA 2F1JA 1Q46A 2G5IB 3QZ7A 4NM1A 3L5KA 5DB6A 2IMWP 3DV9A 4J9NA 3C2MA 1KLNA 3ZDAA 9ICKA 2R8IA 2Y0SF 5IIOA 1U47A 1ED1A 2WF6A 4UQGA 1XS9D 1Z1BA 2LKYA 4M6WB 5DG8A 1N56A 4O3NA 4IL6U 4Q44A 3H8MA 3C1YA 2QARA 4KLGA 3C23A 3PW0A 1U9LA 4I2JA 9ICUA 2QB0B 4O3QA 1F44A 5D46A 4IQUA 4IR1A 7ICLA 4XQ8A 3WK6A 4M2YA 7ICEA 4F2SA 4UBBA 4JK1A 3M9NB 3ZDDA 7ICJA 9ICNA 3WU2U 3GIIA 2FE9A 7ICKA
chains in the Genus database with same CATH topology
4ACOA 2H3ZA 3SAGA 2PMZC 2M0NA 4O3MA 3H0RB 2KIWA 4OJLA 4QIWF 3M7DA 3CRXA 2DF4B 3IN5A 2XIDA 1ECWA 4OJPA 2LHTA 3AQFA 3C28A 1OUQA 4OJ6A 3AL0B 2KNJA 2E1EA 4QIWC 2KVCA 3ICXA 2W7PA 3D2SA 2KJ8A 5HR6A 3AQEA 4U6PA 4P0PB 3IG8A 4FZMA 3PSTA 2DGZA 4OJ5A 2R18A 3K1ZA 3ALRA 2K4EA 2G5HB 3ONNA 2GOLA 2LBOA 1CRXA 2H3IA 2F8LA 2NV3A 2K4HA 2MA1A 2G09A 2HBLA 4WJ3B 2KEYA 3SQIA 2VIXA 3NRWA 2D6FC 3F2DA 2F77X 3PSIA 2E5SA 4ICAA 4KX5A 1GO3F 3CYMA 2F2AB 2ZG6A 3E0FA 4CRXA 2BDUA 2VKQA 4PL1A 5KL1B 2HOIA 2HMXA 2H3VA 2W04A 2G5IB 1KBUA 1URJA 3IG5A 3N7RC 2OM6A 2VJ4A 2H3FA 2G06A 4P0QB 3D2NA 3F5EA 2XVTA 1P7DA 1HIWA 4PL2A 4C0ZA 4KX3A 2RHFA 4FE3A 4AYBC 2Y0SC 1Q3UA 1Z19A 1YT3A 4CDGA 2K8CB 2YX8A 2WAQF 1ZQ1C 1TAMA 3F5AA 3F53A 2K4IA 4FZNA 1A0PA 2Y0SF 3PSPA 2WB1F 2CN1A 3CP8A 3VCBA 3F2BA 3PSFA 1ED1A 1SZHA 4QNLA 1WUDA 1IIPA 2HOQA 5T14A 3RFAA 2G07A 1A6SA 1Z1BA 2ZIWA 3LVWA 2LKYA 2KOBA 4KMOB 2OH2A 4NWIA 4AYBF 2JGAA 2A3VA 5CRXA 2G0AA 3M6ZA 3N7PD 2HBMA 2WAQC 1XNSA 4IC9A 4A8EA 2HBKA 4OO1J 2LYAA 2KV2A 3LYSA 2OYYA 4BX9C 2CRXA 4OJOA 2JMGA 2XICA 2ZIUA 4U7CA 2ZXHA 2ZIWB 3RF9A 3PZPA 3HKZF 1NZBA 2ZIXB 3C29A 4QJFB 2JH7A 5KL8B 2RP5A 3H0MB 4P0QA 2Z7JA 3HKZC 3NUQA 1D8BA 2PMZF 2W03A 4FZLA 3VC8A 1XO0A 1L6NA 3LVVA 2K89A 1PVRA 2F76X 3SMVA 4BJQA 1F44A 5HR7A 3GZFA 4NV0A 3SAHA 2G08A 2KKPA 2VJ5A 2KHQA 2RRDA 2ZIVA 2E1FA 1UPHA 2KJ5A 2OXOA 2WB1C 2ZXIA 4GFJA 1HEKA 2W7OA 2MRLA 4NLBA 3SAFA 1PVQA 2H3QA 3N7SC 4JMUA 2K8AA 3T79A 4CGZA 2KD1A 2ZIUB 2KKVA 1Q3VA 2YB4A 2HBJA 2JHDA 2KICA 2JH1A 2XI9A 2CPRA 1T94A 1MA7A 1DRGA 3H0LB 3D2QA 4P0PA 4NLCA 3GU3A 3L3FX 3M6KA 2ZIXA 3F2CA 3DEEA 3KFUF 4BUGA 2GH1A 2KJ9A 2LYBA 3MGVA 3OPXA 3IP4B 2HOFA 2Q4TA 2YB1A 2ZIVB 5A0LA 3KZXA 2K8BB 3O0FA 2KHVA 5C0YA 2N1RA 2DQNB 1PVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F77 X;  2F76 X; 
#chains in the Genus database with same CATH topology
 5ALH A;  4NY8 A;  4JUZ A;  2XID A;  3AQF A;  3D2S A;  3AQE A;  4P0P B;  1QQ6 A;  1QH9 A;  1ZD3 A;  4PPX A;  5TZV A;  4DS4 A;  1JMS A;  3OHA A;  4Y2S A;  3T5J A;  1ZQK A;  1N5W A;  3JPQ A;  3UXP A;  3FYH A;  4ICA A;  4ED1 A;  4C4T A;  2AJQ A;  1NK5 A;  5CHG A;  3NAS A;  4C0Z A;  3MGH A;  4BDP A;  4AYB C;  1ZQD A;  4DL3 A;  2YMP A;  1ZQQ A;  3PSP A;  4M04 A;  5AI0 A;  2W11 A;  3MGI A;  2UVW A;  5ALZ A;  4RPY A;  1SXE A;  3ZDE A;  1L3U A;  3WK9 A;  5KT5 A;  3KZI U;  3IM1 A;  1Z4N A;  4C8O A;  1Q8K A;  5KG4 A;  1S0N A;  2W9A A;  2OYY A;  1UA0 A;  4Q8F A;  4LVS A;  4BGD A;  4ZH4 A;  2EZZ A;  1ZQI A;  2OHF A;  1X40 A;  4F72 A;  5C5J A;  5KFD A;  5HHI A;  1XU4 A;  5DLG A;  5ALF A;  1MN8 A;  1PVR A;  2AH5 A;  1TFR A;  1X6I A;  2ZJ5 A;  3AMZ A;  3H40 A;  4R8U B;  3EWA A;  5DBC A;  3PW5 A;  1SB3 C;  2KD1 A;  2DKZ A;  3H0L B;  5AI9 A;  5EE0 A;  4F5R A;  3WKA A;  2HOF A;  2QAR B;  4ED3 A;  5DB8 A;  8ICX A;  3TQ1 A;  1N48 A;  3JPN A;  2DF4 B;  1ZQN A;  5J2I A;  5D4B A;  1RQN A;  2PI5 A;  3IG8 A;  1WYG A;  3QU4 A;  2R18 A;  2P6R A;  3ALR A;  3MFI A;  1ZRN A;  1N2X A;  1ZQE A;  8ICI A;  5KFV A;  2G09 A;  5L1I A;  5KFJ A;  3KKA C;  2DFL A;  1PK3 A;  7ICT A;  1TKD A;  4I27 A;  1ZQU A;  5J2D A;  3RRG A;  8ICV A;  2F2A B;  3RH5 A;  4DL5 A;  1K5O A;  2WF8 A;  1KBU A;  4KMU A;  2WF9 A;  3BQT A;  3F5E A;  3CNH A;  4Y2P A;  4FE3 A;  5CEH A;  1YT3 A;  5EWE A;  4DEZ A;  3PY8 A;  4FZN A;  3HP6 A;  3IHQ B;  3CP8 A;  5J8Y C;  1KN5 A;  2BKE A;  2R8K A;  4O9M A;  7ICR A;  9ICO A;  4RQ4 A;  2A19 A;  2ISO A;  5J2C A;  3RB4 A;  4K4H A;  4YVZ A;  4FS1 A;  3V7J A;  1NKC A;  3NVY A;  1T7P A;  4F3O A;  2OWO A;  1JN3 A;  9ICW A;  2ZXH A;  3C21 A;  4ELV A;  3PMN A;  4LJX A;  3TFS A;  4QJF B;  2HCF A;  2W03 A;  1L6N A;  2YY6 A;  3HW8 A;  2F44 A;  4DL7 A;  3AU6 A;  1SIJ A;  4EEN A;  4MEX A;  4RPX A;  1KSP A;  2EH9 A;  2LYH A;  5HML A;  2KFZ A;  3RAX A;  4QW9 A;  2ASD A;  3WK7 A;  1B43 A;  4DFP A;  2YB4 A;  2YMM A;  5KFO A;  5IIN A;  5TIS U;  4DFJ A;  4B9L A;  4LZG A;  3KFU F;  2KJ9 A;  2NO4 A;  4YQW A;  9ICV A;  2YB1 A;  4B9T A;  2KVS A;  2K8B B;  2KHV A;  1U45 A;  4I2E A;  5F3X B;  5KFX A;  2EQY A;  2UVU A;  5KT7 A;  4ED0 A;  1ZYQ A;  1BVS A;  2KVC A;  2W7P A;  3QUB A;  4QZF A;  1COK A;  3G6V A;  1ZD5 A;  3S6J A;  4UAT A;  5AKE A;  5CR0 A;  2F8L A;  1ZQA A;  1TV9 A;  2W8L A;  5AKJ A;  5J0X A;  4RQM A;  1YZ6 A;  1GO3 F;  4HYK A;  2W04 A;  1MQ2 A;  2I9G A;  1EXN A;  4RT2 A;  1T4G A;  2UVR A;  1ZXI A;  1ZQ1 C;  5CJ7 A;  2RDJ A;  4IRD A;  2W8K A;  1VLB A;  2L5Y A;  3FC4 A;  2JEF A;  4UAW A;  3HJE A;  9ICF A;  4F4K A;  2JGA A;  3MR3 A;  4I2B A;  4OD0 A;  2DKX A;  5IIL A;  1U4B A;  4BX9 C;  3Q8S B;  1L3T A;  3QE9 Y;  1ZQY A;  1KL9 A;  3BQ1 A;  1MSW D;  1MQ3 A;  5KFC A;  3H0M B;  4NL9 A;  2MUT B;  3V72 A;  4IQW A;  1D9D A;  4F8R A;  1FEZ A;  3HRD D;  3GV5 B;  5KFK A;  4RUA A;  4ECY A;  4UAU A;  3TAD C;  2KIV A;  4B9V A;  5AIA A;  4US8 A;  7ICG A;  2W9B A;  4JMU A;  3MR6 A;  1LKY A;  3V6J A;  2CPR A;  2NRX A;  4NLC A;  3L3F X;  1SV0 C;  8ICW A;  4J9K A;  1NKE A;  4PGX A;  1QTM A;  4ECW A;  3M6Z A;  2C2R A;  3ZDB A;  3GV7 B;  4R64 A;  1XWL A;  2KE7 A;  1ECW A;  1KW4 A;  4RPZ A;  5KNI A;  4RNN A;  1L8L A;  8ICA A;  5ALS A;  4RQ7 A;  8ICR A;  3ZD9 A;  2LBO A;  4UAR A;  5EE3 A;  1KDH A;  1TAU A;  1BPD A;  3AN1 A;  1U49 A;  3ZDC A;  9ICR A;  3RR8 A;  1ZQH A;  5AKH A;  2H3F A;  1L7O A;  4P0Q B;  3HX0 A;  5H2F U;  3QEB Z;  4PL2 A;  1ZRM A;  2RHF A;  4I2D A;  5HHH A;  3Q8M A;  5DBB A;  2E8O A;  4KTQ A;  3AUO A;  2OEH A;  5AI6 A;  4R66 A;  2IOH A;  4J9Q A;  3RAQ A;  2K4I A;  2CN1 A;  4M47 A;  2KFN A;  3BQ7 A;  1ZJN A;  4MFA A;  4DL2 A;  2BPG A;  1X2I A;  2K60 A;  1PK1 B;  4DSK A;  3ZD8 A;  3EUB 2;  3LYS A;  8ICZ A;  4UB6 U;  4C8K A;  1ZQJ A;  9ICH A;  5DKW A;  2XY7 A;  1L7N A;  2BHN A;  4Z6F A;  5KL8 B;  2RP5 A;  1D8B A;  1UT5 A;  4PHD A;  2K89 A;  4NV0 A;  5AIB A;  3TAC B;  4PGY A;  4PHE A;  2HVH A;  5ALY A;  4I2G A;  2WB1 C;  2AHO B;  4KLH A;  4NLB A;  1PVQ A;  4BXO B;  3HPO A;  2JHD A;  4F91 B;  1MA7 A;  4ECX A;  7ICH A;  4TUQ A;  3TI0 A;  5DG7 A;  5ALM A;  3UMG A;  4PZO A;  3SEN A;  2LYB A;  4MHV A;  1RQL A;  2Q4T A;  3A0B U;  1RYR A;  3QU9 A;  4XA5 A;  2FLL A;  1KFD A;  1QQ7 A;  4IRC A;  2E1E A;  1ZQG A;  4IR9 A;  1UQV A;  5J0T A;  8ICB A;  5AIC A;  1ARO P;  1NK7 A;  2NV3 A;  2K4H A;  4KLS A;  4EEL A;  4RUC A;  4RQ2 A;  2E5S A;  4DFD A;  2ZG6 A;  5KFS A;  2IOF K;  4ED6 A;  3RTV A;  4YP3 A;  3JPO A;  4KX3 A;  1NKB A;  4GXI A;  3KHR A;  2R8J A;  1WWU A;  3N97 B;  4DO9 A;  7ICI A;  4B9U A;  5AI8 A;  3SD7 A;  3TAQ A;  5J8Y A;  2XY6 A;  1ZD4 A;  5CRX A;  4O5K A;  1KKX A;  2WAQ C;  3C2L A;  2KP7 A;  3WKE A;  5ALQ A;  4OO1 J;  2MU2 A;  4QWD A;  1BGX T;  3GIM A;  5ALT A;  4RNO A;  2A1A A;  2ZIU A;  4FFD A;  2BPC A;  3WKC A;  3IDW A;  2LM4 A;  2YN4 A;  3C2K A;  5CWR A;  3QU7 A;  3V7K A;  3FAH A;  1F5S A;  1D8Y A;  3MR5 A;  1LV5 A;  8ICN A;  3FM9 A;  1CUK A;  3UXO A;  1L7P A;  9ICC A;  5J0U A;  2JEJ A;  2FPM A;  1M6Y A;  2Y9U A;  9ICM A;  4GLX A;  2K4P A;  5KFT A;  4Z6E A;  3THV A;  4CNQ A;  1WG8 A;  2KIW A;  2WFA A;  4KN4 A;  4KLD A;  4QZG A;  1OXJ A;  2EDU A;  2W55 A;  2LI6 A;  4NLN A;  1X9M A;  2BCS A;  2FDR A;  4UB5 A;  2YQE A;  3H4D A;  3MFH A;  4FZM A;  4Y2X A;  3KTQ A;  4ECZ A;  4US9 A;  2CXY A;  3WK4 A;  2KG5 A;  1JIH A;  4QZA A;  1S0V A;  4ELU A;  2VIX A;  3F2D A;  5F9L A;  3TAP A;  4IS7 A;  4J9S A;  5AM5 A;  3MR2 A;  2HOI A;  5J2A A;  4DQI A;  2VJ4 A;  4QZB A;  1ZQV A;  4M0A A;  4MF8 A;  2P35 A;  1JXE A;  2F1I A;  2FLN A;  2VAN A;  1Z19 A;  5ALP A;  5CP2 A;  4DQQ A;  2PFO A;  4YMM A;  2C2D A;  4QNL A;  2GWS A;  5J0Q A;  5J2E A;  3M9O B;  4O0I A;  2JZB A;  1BPX A;  1ZJM A;  4NWI A;  3JPP A;  1V9P A;  5DQG A;  2HBM A;  4C7Z A;  4BWJ A;  3V6K A;  5AKL A;  1Z4O A;  1L5U A;  2ESE A;  3KHG A;  2CRX A;  4QWB A;  4LZD A;  3OHB A;  3UQ0 A;  4QZH A;  5KG5 A;  8ICM A;  5KFZ A;  3RBE A;  4J9P A;  3VC8 A;  1XO0 A;  1ZQT A;  4TUP A;  2EAO A;  1IM4 A;  2XY5 A;  4I29 A;  2KTQ A;  3RR7 A;  4UB4 A;  9ICG A;  3SAF A;  3EW9 A;  8ICK A;  2ZTE A;  4UB3 A;  5AK6 A;  3UQ2 A;  1UA1 A;  4YFK A;  3JPR A;  1NK9 A;  2KKV A;  1Q3V A;  2B6G A;  3D2Q A;  1DGS A;  4GC7 A;  4ECS A;  2ZIX A;  5ALK A;  3UPQ A;  1Z00 B;  3PR5 B;  2GO7 A;  4DWI A;  3ISB A;  3M9M B;  1C20 A;  1PVP A;  2I5H A;  1J97 A;  2LHT A;  3WKD A;  2BDP A;  1RM6 C;  4QIW C;  4U6P A;  5KFR A;  3RJI A;  2D3D A;  1S5L U;  1XSN A;  3IRU A;  3RJJ A;  2WF5 A;  4KLQ A;  1XSL A;  1SZP A;  1S0O A;  1RYU A;  2E3T A;  2ZJ8 A;  4RT3 A;  5KFY A;  4F5Q A;  1VDV A;  1UCV A;  4KLM A;  5KG2 A;  1Z00 A;  2WTF A;  4PHP A;  2IOF A;  1JRO A;  4B9N A;  3F5A A;  2PFN A;  3M8R A;  3BS5 B;  3KD3 A;  7ICM A;  4QZ9 A;  1K1Q A;  4ED2 A;  3K1R B;  2AQ4 A;  4PZN A;  5J2B A;  1QQ5 A;  2JEI A;  5DB9 A;  2HHU A;  4K4I A;  2HW3 A;  4QZC A;  5ALN A;  4IC9 A;  4P4O A;  1N62 A;  1OW5 A;  1SKS A;  1TK5 A;  1JRP A;  1L3S A;  1Y88 A;  4PGQ A;  3BDP A;  1O08 A;  4R63 A;  4YR0 A;  3B9J A;  5J2J A;  3GV8 B;  2NO5 A;  3ORY A;  3UXN A;  3T5H A;  5DDM A;  1T8E A;  5B66 U;  3LVV A;  3PW2 A;  3SMV A;  4R65 A;  4F50 A;  7ICF A;  5KG0 A;  4DL6 A;  5AKI A;  5AI5 A;  1L3V A;  2ZIV A;  3UM9 A;  2KJ5 A;  3RJE A;  4Q8E A;  5JRT A;  9ICL A;  4QZD A;  1NK6 A;  2WF7 A;  2H3Q A;  4QW8 A;  5KFE A;  8ICF A;  4OCZ A;  2ZTD A;  1DRG A;  3EPG A;  2KIC A;  2JH1 A;  1S97 A;  3RJH A;  2J6S A;  2FPK A;  5III A;  9ICI A;  1DXS A;  4F93 B;  4BUG A;  3QU2 A;  5AKK A;  4JWM A;  1TK0 A;  4GIB A;  5C0Y A;  2FLP A;  5HMM A;  3WKB A;  1FIQ A;  2M0N A;  4OJL A;  3M7D A;  2NRZ A;  4TQR A;  2DWQ A;  3ED5 A;  4J9O A;  1QLN A;  3TAD A;  4OJ5 A;  3K1Z A;  5KFI A;  3M8S A;  2IA6 A;  4YMO A;  4O3S A;  1X9S A;  1SV4 A;  2XC9 A;  2JEG A;  1DOQ A;  4B9S A;  5EE9 A;  5L1M A;  4CRX A;  1COO A;  5KG6 A;  4YMN A;  4TQS A;  2XVT A;  3PW4 A;  5AM3 A;  3E58 A;  1FFU A;  2PFP A;  3C1Z A;  2YMQ A;  5J0P A;  5HNK A;  3SYZ A;  1KFT A;  3H8J A;  2F3N A;  3F2B A;  1RXW A;  1X42 A;  3GIJ A;  4EZ9 A;  4KLO A;  2HHW A;  2ZIW A;  9ICA A;  4DQS A;  2IHM A;  4A8E A;  4ELT A;  3J81 j;  1J2M A;  1XC9 A;  3PR4 A;  1Z3E B;  1WWV A;  2UVV A;  4KLI A;  4NLK A;  1N5X A;  2JH7 A;  1S76 D;  3NUQ A;  1RG6 A;  2PMZ F;  9ICP A;  4KIT B;  1B4F A;  1D8L A;  2AGP A;  2W54 A;  4UBC A;  2VA2 A;  2IBK A;  4M9H A;  2J6T A;  3LWL A;  8ICO A;  2MRL A;  4DCC A;  3MDA A;  3SI8 A;  3QEA Z;  1ZQX A;  2ZIU B;  4XRH A;  4C8L A;  1X66 A;  2ZJA A;  3F2C A;  1U48 A;  2FJ6 A;  2B21 A;  1CI4 A;  2AGQ A;  3BS5 A;  3QUT A;  3IP4 B;  5ALE A;  5GTH U;  4Q43 A;  3KZX A;  3N28 A;  4Y2Y A;  2YML A;  5AM0 A;  2QB1 A;  5AM2 A;  4C8N A;  2KSO B;  4OJP A;  1PZN A;  1A76 A;  7ICV A;  4F5O A;  1IV8 A;  5KAF U;  4M9J A;  3SZ2 A;  4I28 A;  2DGZ A;  4P2H A;  2JXJ A;  3RJK A;  2G5H B;  2H5X A;  1ZD2 P;  2BQ3 A;  4YCX A;  4NL9 C;  2ASJ A;  4WJ3 B;  7ICO A;  1VJ5 A;  4EX7 A;  4YN4 A;  3CYM A;  2W9C B;  1IG6 A;  8ICU A;  4F4W A;  2MUT A;  3IG5 A;  2G06 A;  3D2N A;  4XUS A;  2RDI A;  2XCP A;  8ICQ A;  4RNM A;  3G6Y A;  3PML A;  1BPB A;  3F53 A;  3PSF A;  4C7Y A;  1WUD A;  4UB1 A;  5T14 A;  1RYS A;  1A6S A;  5ALG A;  3T5L A;  1BPZ A;  4DS5 A;  2BZF A;  5JUM A;  4TUS A;  3QZ8 A;  2LYA A;  5DQI A;  1F0M A;  5KT6 A;  4FO6 A;  4NLZ A;  5F9N A;  1KEJ A;  4RZR A;  4E0D A;  1S77 D;  2R8H A;  4KN7 A;  4C80 A;  1UT8 A;  3EZ5 A;  4UB8 U;  4EZ6 A;  2BCV A;  3D6J A;  1JXL A;  5ALU A;  3K75 D;  3BQ2 A;  3K4G A;  2PFQ A;  2EZX A;  4UAZ A;  1JX4 A;  1ZQZ A;  3SAH A;  3V7L A;  5K4L A;  3HWT A;  2OXO A;  3QU5 A;  3BQ0 A;  9ICQ A;  1ZET A;  1SL2 A;  4AP9 A;  2ALZ A;  1RZT A;  5CA7 A;  2XI9 A;  5KFL A;  3Q8L A;  2VA3 A;  4PH5 A;  5DGB A;  5DG9 A;  3MGV A;  2HHV A;  2ODG A;  1KRP A;  1O03 A;  1S10 A;  5A0L A;  2N1R A;  3HIL A;  5J0O A;  3H0R B;  4BXO A;  4QIW F;  5KFM A;  3C28 A;  4QZE A;  5ALO A;  5ALV A;  3I28 A;  3QYP A;  3ISD A;  1CRX A;  4PHA A;  2MA1 A;  5AM1 A;  4I2I A;  3PO4 A;  4RU9 A;  2W9M A;  5KFW A;  4DQP A;  2P66 A;  3PX6 A;  2F77 X;  3TKA A;  3NGD A;  2F1H A;  2NRV A;  1ZQS A;  4KX5 A;  3E0F A;  4DQR A;  4PL1 A;  2AU0 A;  5JTI A;  2ASL A;  2FPL A;  4KLE A;  3KBB A;  2I1Q A;  2HHT A;  2O6K A;  2K8C B;  5E79 U;  1NK8 A;  4JWN A;  2Y9T A;  4O3P A;  4I2A A;  4ECV A;  2V4R A;  3I76 A;  2HOQ A;  5KFH A;  3RFA A;  1T3Q A;  2G07 A;  9ICS A;  3LVW A;  2WHE A;  4YXJ A;  2Y1I A;  3Q8R B;  4PJ0 U;  2W9C A;  5AKY A;  1XNS A;  1ZQF A;  4DSL A;  2JMG A;  3GIL A;  2C22 A;  2XIC A;  3RF9 A;  8ICE A;  1NZB A;  2F8K A;  2QLT A;  1A77 A;  4JB3 A;  4NM2 A;  2R8G A;  8ICC A;  5DQH A;  1J2N A;  2LM1 A;  1JUD A;  3IV6 A;  9ICX A;  3QUC A;  3SEI A;  5BPC A;  1PUZ A;  5B5E U;  3GFK B;  3M6K A;  5J2H A;  4QWC A;  3EYZ A;  4J9M A;  5EWG A;  2XGP A;  4DSE A;  4F4Y A;  4UW9 A;  3LWM A;  2H3Z A;  4EEK A;  2KZM A;  2KSO A;  1OUQ A;  3AL0 B;  1Z1V A;  3OSN A;  2DPI A;  3PX4 A;  3BZC A;  1SGG A;  7ICQ A;  2K4E A;  4DSF A;  4MFF A;  4DLE A;  5HP4 A;  2HI0 A;  5KG3 A;  8ICY A;  1SWV A;  3AU2 A;  3QX7 A;  4DL4 A;  4TUR A;  1JAL A;  5DBA A;  2HMX A;  5ALI A;  1NJY A;  1FO4 A;  2HSZ A;  5CB1 A;  1C7Y A;  2C2E A;  1L7M A;  5KFN A;  4GC6 A;  3SV3 A;  5DGA A;  3PNC A;  4CDG A;  3H7I A;  4Z6D A;  2JZB B;  3PO5 A;  3KKA A;  2FI1 A;  4RQ6 A;  4DOA A;  4RQ3 A;  1ZQC A;  1HUZ A;  1DK2 A;  5AK4 A;  3TAN A;  5J0R A;  3MAB A;  4DF4 A;  2EAN A;  3RRH A;  5D49 A;  2D8C A;  5ALD A;  3C5F A;  4OJO A;  3WK8 A;  4O5E A;  7ICU A;  3BS7 A;  2ZIW B;  4KLT A;  2XCA A;  2ZIX B;  2YTU A;  5EWF A;  3GIK A;  4P0Q A;  2Z7J A;  3HKZ C;  4MFC A;  3NS1 A;  2DPJ A;  3RBD A;  2KZ3 A;  2RLT A;  4NJ8 A;  2KMD A;  5ALR A;  1UPH A;  4Y2R A;  2ZXI A;  3PX0 A;  5BOL A;  3OTQ A;  1UHU A;  3EPI A;  2XO7 A;  4M6W A;  2HHX A;  3QNM A;  1ZQP A;  4DFM A;  3DEE A;  1X9X A;  5IIK A;  3OPX A;  5L1L A;  3M1Y A;  1LB2 B;  5AKZ A;  1S0M A;  2ZIV B;  5J2K A;  4ECQ A;  4O3M A;  4UAV A;  3OJS A;  4J9L A;  3OSP A;  5HR6 A;  3SV4 A;  3PST A;  4M9N A;  2XGQ A;  3BZK A;  3MBY A;  4EBC A;  2H3I A;  2KN7 A;  2E8N A;  3I1Y A;  2W3S A;  3ZI4 A;  4DFK A;  2W3R A;  5J0Y A;  2JR5 A;  5L1K A;  4DSI A;  3KHH A;  5KG7 A;  1BNP A;  2BDU A;  4Y2Q A;  4JV1 A;  1V97 A;  5KT4 A;  1QCK A;  3H8W A;  2B0C A;  4RQN A;  3G6X A;  1H38 A;  4MF2 A;  5KTQ A;  2NRT A;  4HAI A;  4EBE A;  2YX8 A;  4YR2 A;  3RB0 A;  1A0P A;  4C8M A;  1SZH A;  1TAQ A;  2BCU A;  2W43 A;  2OCE A;  2BCR A;  4DOC A;  4B9M A;  2ATL A;  4I2H A;  4FS2 A;  4C4S A;  3PW7 A;  3V6H A;  8ICS A;  3N7P D;  2HBK A;  1B22 A;  2NRW A;  4CE6 A;  4YD2 A;  3DDH A;  3C5G A;  1RPL A;  3PZP A;  1NK4 A;  4RQ8 A;  4R8U A;  3JPT A;  3C29 A;  4M9L A;  1T3N A;  5DB7 A;  5G5G A;  3AEV A;  2QKQ A;  4P4P A;  1NZP A;  1PK1 A;  4EYH B;  2KKP A;  1QSY A;  5KFF A;  4GFJ A;  4ECU A;  3GDX A;  2K8A A;  4CGZ A;  4G9B A;  1IXR A;  4QWE A;  2HHQ A;  4FBU A;  1RDF A;  3RJG A;  4Y2T A;  1NK0 A;  3RH4 A;  3LDA A;  4GXK A;  8ICL A;  3O0F A;  3TFR A;  4ACO A;  4CF5 A;  1D9F A;  2PMZ C;  5KFA A;  4O3O A;  1TVA A;  4OJ6 A;  3AM9 A;  4EEY A;  5ALW A;  3ETL A;  3KOO A;  1X6J A;  2EAP A;  2LPE A;  3SR6 A;  5L1J A;  5ALJ A;  3ONN A;  2QB0 A;  5KFG A;  4UAS A;  4Y2V A;  4USA A;  5AK5 A;  1WCN A;  3PSI A;  3R9K A;  2RQ5 A;  2VKQ A;  5KL1 B;  4YD1 A;  1L8O A;  1URJ A;  2OM6 A;  3PV8 A;  3Q8P B;  2Y0S C;  4Q45 A;  5AKX A;  2NYV A;  2WAQ F;  3B0X A;  9ICT A;  2AGO A;  5J29 A;  5AM4 A;  2AXT U;  3UMC A;  4J03 A;  1JI7 A;  5KFQ A;  5IIJ A;  1HJP A;  4JV2 A;  3RB3 A;  1KTQ A;  2G0A A;  1QSL A;  3TAR A;  3CW2 C;  4GXJ A;  4F5N A;  4ED7 A;  4JV0 A;  5KG1 A;  4RQ0 A;  1SKR A;  2HDO A;  8ICJ A;  3B0Y A;  4U7C A;  2V4Q A;  2PKE A;  4NXZ A;  1SL0 A;  3JPS A;  5HR7 A;  5KFP A;  1NJW A;  3GZF A;  1ZQW A;  2EAM A;  4KLL A;  4IRK A;  1QSS A;  1X9W A;  2E1F A;  3PVX A;  2DL0 A;  4F4X A;  4CF3 A;  3N7S C;  2KK0 A;  4X5V A;  9ICE A;  1T94 A;  4YXM A;  1NJZ A;  4F71 A;  2MAX A;  5FP0 A;  3NVZ A;  8ICT A;  4K4G A;  4I2F A;  3FDS A;  7ICS A;  2BGW A;  4QWA A;  3L4P A;  1CEZ A;  2PXI A;  1SWW A;  2W9B B;  3RJF A;  2PI4 A;  3U26 A;  3NVW A;  2KNJ A;  4QZI A;  2KJ8 A;  4CCH A;  3Q8K A;  2JRZ A;  2M9N A;  4UB2 A;  3Q8Q B;  4G3I A;  1XO1 A;  1KQQ A;  3GQC A;  5J0W A;  2Y1J A;  2D6F C;  1ZQB A;  1HUO A;  4YG2 A;  1NJX A;  4ED8 A;  1N61 A;  2LMR A;  5EE1 A;  3N4M B;  2H3V A;  2I6X A;  1ZQO A;  5AKG A;  2ISP A;  3RB6 A;  1SV0 A;  2AQ0 A;  5KFB A;  1HIW A;  1DK3 A;  5AK3 A;  3H4B A;  2MSN A;  3QUQ A;  2A1J A;  1MC8 A;  2E8P A;  4O5C A;  4ECR A;  3VCB A;  1SXD A;  1NNL A;  1NOM A;  1DGJ A;  5EOZ A;  1BNO A;  4NLG A;  2V9W A;  2KOB A;  4O3R A;  4KMO B;  2OH2 A;  5GTI U;  1N60 A;  1BPY A;  1N63 A;  5ALX A;  2J6U A;  2KV2 A;  5J2G A;  2E8M A;  2P6U A;  3WK5 A;  1XSP A;  3HKZ F;  2JV3 A;  2GLE A;  4M9G A;  3OGU A;  5KT3 A;  1LKY B;  2F76 X;  4BJQ A;  3T3F A;  4ECT A;  4CF4 A;  4DOB A;  4ZOH C;  2RRD A;  4RQ5 A;  5DDY A;  2W7O A;  1SKW A;  3T79 A;  1YZ7 A;  4C4R A;  2HBJ A;  1S8O A;  2HVI A;  4P0P A;  3GU3 A;  3T5K A;  1ZQR A;  2GH1 A;  3ISC A;  3RH6 A;  2BQU A;  7ICP A;  1BPE A;  2A1J B;  3A0H U;  4F2R A;  2DQN B;  2DUY A;  3SAG A;  4IQV A;  5ALL A;  3IN5 A;  5DLF A;  1ZOL A;  2EZY A;  4EX6 A;  5JU5 A;  3H8S A;  2GOL A;  1S9F A;  2IHN A;  4EYI B;  2HBL A;  2BPF A;  2KEY A;  3SQI A;  1WCL A;  1V85 A;  4QZ8 A;  4EBD A;  8ICH A;  2FMS A;  3N7R C;  5J0S A;  1NI3 A;  1TE2 A;  4Z6C A;  5J2F A;  1P7D A;  4FBT A;  2HHS A;  1Q3U A;  1SL1 A;  1FFV A;  3KHL A;  1TAM A;  4YR3 A;  2WB1 F;  5AI4 A;  5KT2 A;  1IIP A;  2FMP A;  4DLG A;  2BCQ A;  3LK9 A;  5BOM A;  2ZUB A;  1KFS A;  4AYB F;  2A3V A;  4IQT A;  2VA8 A;  2ZUD A;  2C28 A;  9ICB A;  4F4Z A;  4DSJ A;  7ICN A;  3UMB A;  5IIM A;  3NTU A;  3BJY A;  5AHX A;  4BWM A;  1LVH A;  4Y2U A;  3NVV A;  4FZL A;  3ETR A;  4RQ1 A;  4MEY A;  3MC1 A;  4F92 B;  8ICP A;  2G08 A;  2BQR A;  3NRZ A;  2VJ5 A;  2KHQ A;  5KAI U;  2BR0 A;  4B6J A;  1HEK A;  4F5P A;  1B0X A;  1AQ6 A;  1RXV A;  3OJU A;  1TK8 A;  1K1S A;  4P4M A;  2DBY A;  2FMQ A;  2ES6 A;  3QXG A;  5L9X A;  1ZQM A;  4KLJ A;  9ICJ A;  8ICG A;  4J9R A;  3CRX A;  4DF8 A;  3E2E A;  3ICX A;  3MDC A;  1V38 A;  2ZTC A;  1ZQL A;  4KLU A;  2KZZ A;  5G5H A;  5KFU A;  3HT3 A;  4I2C A;  4UAY A;  4KLF A;  3NRW A;  4Y2J A;  2Q0Z X;  2ZUC A;  2F1J A;  1Q46 A;  2G5I B;  3QZ7 A;  4NM1 A;  3L5K A;  5DB6 A;  2IMW P;  3DV9 A;  4J9N A;  3C2M A;  1KLN A;  3ZDA A;  9ICK A;  2R8I A;  2Y0S F;  5IIO A;  1U47 A;  1ED1 A;  2WF6 A;  4UQG A;  1XS9 D;  1Z1B A;  2LKY A;  4M6W B;  5DG8 A;  1N56 A;  4O3N A;  4IL6 U;  4Q44 A;  3H8M A;  3C1Y A;  2QAR A;  4KLG A;  3C23 A;  3PW0 A;  1U9L A;  4I2J A;  9ICU A;  2QB0 B;  4O3Q A;  1F44 A;  5D46 A;  4IQU A;  4IR1 A;  7ICL A;  4XQ8 A;  3WK6 A;  4M2Y A;  7ICE A;  4F2S A;  4UBB A;  4JK1 A;  3M9N B;  3ZDD A;  7ICJ A;  9ICN A;  3WU2 U;  3GII A;  2FE9 A;  7ICK A; 
#chains in the Genus database with same CATH homology
 4ACO A;  2H3Z A;  3SAG A;  2PMZ C;  2M0N A;  4O3M A;  3H0R B;  2KIW A;  4OJL A;  4QIW F;  3M7D A;  3CRX A;  2DF4 B;  3IN5 A;  2XID A;  1ECW A;  4OJP A;  2LHT A;  3AQF A;  3C28 A;  1OUQ A;  4OJ6 A;  3AL0 B;  2KNJ A;  2E1E A;  4QIW C;  2KVC A;  3ICX A;  2W7P A;  3D2S A;  2KJ8 A;  5HR6 A;  3AQE A;  4U6P A;  4P0P B;  3IG8 A;  4FZM A;  3PST A;  2DGZ A;  4OJ5 A;  2R18 A;  3K1Z A;  3ALR A;  2K4E A;  2G5H B;  3ONN A;  2GOL A;  2LBO A;  1CRX A;  2H3I A;  2F8L A;  2NV3 A;  2K4H A;  2MA1 A;  2G09 A;  2HBL A;  4WJ3 B;  2KEY A;  3SQI A;  2VIX A;  3NRW A;  2D6F C;  3F2D A;  2F77 X;  3PSI A;  2E5S A;  4ICA A;  4KX5 A;  1GO3 F;  3CYM A;  2F2A B;  2ZG6 A;  3E0F A;  4CRX A;  2BDU A;  2VKQ A;  4PL1 A;  5KL1 B;  2HOI A;  2HMX A;  2H3V A;  2W04 A;  2G5I B;  1KBU A;  1URJ A;  3IG5 A;  3N7R C;  2OM6 A;  2VJ4 A;  2H3F A;  2G06 A;  4P0Q B;  3D2N A;  3F5E A;  2XVT A;  1P7D A;  1HIW A;  4PL2 A;  4C0Z A;  4KX3 A;  2RHF A;  4FE3 A;  4AYB C;  2Y0S C;  1Q3U A;  1Z19 A;  1YT3 A;  4CDG A;  2K8C B;  2YX8 A;  2WAQ F;  1ZQ1 C;  1TAM A;  3F5A A;  3F53 A;  2K4I A;  4FZN A;  1A0P A;  2Y0S F;  3PSP A;  2WB1 F;  2CN1 A;  3CP8 A;  3VCB A;  3F2B A;  3PSF A;  1ED1 A;  1SZH A;  4QNL A;  1WUD A;  1IIP A;  2HOQ A;  5T14 A;  3RFA A;  2G07 A;  1A6S A;  1Z1B A;  2ZIW A;  3LVW A;  2LKY A;  2KOB A;  4KMO B;  2OH2 A;  4NWI A;  4AYB F;  2JGA A;  2A3V A;  5CRX A;  2G0A A;  3M6Z A;  3N7P D;  2HBM A;  2WAQ C;  1XNS A;  4IC9 A;  4A8E A;  2HBK A;  4OO1 J;  2LYA A;  2KV2 A;  3LYS A;  2OYY A;  4BX9 C;  2CRX A;  4OJO A;  2JMG A;  2XIC A;  2ZIU A;  4U7C A;  2ZXH A;  2ZIW B;  3RF9 A;  3PZP A;  3HKZ F;  1NZB A;  2ZIX B;  3C29 A;  4QJF B;  2JH7 A;  5KL8 B;  2RP5 A;  3H0M B;  4P0Q A;  2Z7J A;  3HKZ C;  3NUQ A;  1D8B A;  2PMZ F;  2W03 A;  4FZL A;  3VC8 A;  1XO0 A;  1L6N A;  3LVV A;  2K89 A;  1PVR A;  2F76 X;  3SMV A;  4BJQ A;  1F44 A;  5HR7 A;  3GZF A;  4NV0 A;  3SAH A;  2G08 A;  2KKP A;  2VJ5 A;  2KHQ A;  2RRD A;  2ZIV A;  2E1F A;  1UPH A;  2KJ5 A;  2OXO A;  2WB1 C;  2ZXI A;  4GFJ A;  1HEK A;  2W7O A;  2MRL A;  4NLB A;  3SAF A;  1PVQ A;  2H3Q A;  3N7S C;  4JMU A;  2K8A A;  3T79 A;  4CGZ A;  2KD1 A;  2ZIU B;  2KKV A;  1Q3V A;  2YB4 A;  2HBJ A;  2JHD A;  2KIC A;  2JH1 A;  2XI9 A;  2CPR A;  1T94 A;  1MA7 A;  1DRG A;  3H0L B;  3D2Q A;  4P0P A;  4NLC A;  3GU3 A;  3L3F X;  3M6K A;  2ZIX A;  3F2C A;  3DEE A;  3KFU F;  4BUG A;  2GH1 A;  2KJ9 A;  2LYB A;  3MGV A;  3OPX A;  3IP4 B;  2HOF A;  2Q4T A;  2YB1 A;  2ZIV B;  5A0L A;  3KZX A;  2K8B B;  3O0F A;  2KHV A;  5C0Y A;  2N1R A;  2DQN B;  1PVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...