2F76X

Solution structure of the m-pmv wild type matrix protein (p10)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
100
structure length
100
Chain Sequence
MGQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Core protein p10
publication title D-retrovirus morphogenetic switch driven by the targeting signal accessibility to Tctex-1 of dynein.
pubmed doi rcsb
source organism Simian retrovirus 1
molecule tags Viral protein
total genus 30
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02337 Gag_p10 Retroviral GAG p10 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.490 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f76X00
2F76X 2F77X
chains in the Genus database with same CATH superfamily
4QZFA 3QEAZ 4O3QA 4DSLA 1ZQBA 1T3QA 4LVSA 1X9WA 4QZGA 2EAPA 4LZDA 1ZXIA 5L1LA 2W54A 5DB6A 2UVWA 1F0MA 5GTHU 2RDIA 5AKGA 4Q8EA 4GXJA 1KQQA 3I28A 4UAUA 3RRHA 1KKXA 2NRWA 3TANA 3H7IA 1QQ7A 2HW3A 1LKYA 3QUTA 4O5EA 3MR2A 4NXZA 1DGSA 4PJ0U 1JX4A 1N61A 2KMDA 3RJJA 1QSLA 4X5VA 4CE6A 3JPQA 2H5XA 4RNMA 4GIBA 1OXJA 2LPEA 4DCCA 4IR9A 4I2DA 4QWAA 3V7JA 5J8YA 5KFEA 1ZQMA 5KFKA 3FAHA 2W3SA 2K60A 3OPXA 2E8MA 4KLLA 2ATLA 5HMMA 4F92B 4KTQA 5IIKA 3F5AA 4OJ6A 1JROA 5ALSA 2W9BB 3M9OB 5KFJA 5ALHA 1N60A 4O5CA 2KJ5A 1NJXA 3H0MB 3LWMA 2LM1A 2OEHA 4Y2QA 1HEKA 3RB3A 2KSOB 1UT8A 2LM4A 9ICKA 9ICGA 5F9NA 1SKSA 1A77A 2OXOA 3HX0A 1Z1VA 1RPLA 5ALXA 5CRXA 2YB1A 1SL1A 3PY8A 2DWQA 2FMQA 2O6KA 2BHNA 3WK9A 4UB1A 2JEFA 1IM4A 4USAA 4QZ9A 2Z7JA 5KFXA 3Q8MA 4QWDA 3L4PA 2DQNB 4YR2A 2HHXA 2Y0SF 4EBCA 4KLMA 8ICCA 3SAFA 4DS5A 5DBBA 1U9LA 3D2SA 3KOOA 3EPIA 2KIWA 4QZ8A 4MF2A 4P0QB 4DFKA 1NK5A 2JEGA 3LWLA 5KFSA 5DB8A 3RTVA 5KFWA 5ALOA 3C2MA 5D4BA 4DL5A 2IOFA 2CPRA 2JRZA 2NO5A 2W7OA 7ICVA 3PSIA 2J6TA 3TAQA 2HBKA 5AI5A 1HJPA 1L7PA 1BPYA 2KZZA 3H4BA 5KFAA 3WKCA 3SZ2A 3FDSA 1ZRNA 3F53A 4P4OA 5L1KA 5J0XA 4BGDA 3BQ2A 7ICUA 4JUZA 3HKZC 3Q8KA 1XSPA 1TFRA 2DL0A 5KFPA 2W9CB 3Q8RB 4TQSA 2ZUDA 4XRHA 4B9VA 4KX3A 3MGIA 4BJQA 5D46A 3L3FX 1BVSA 1S10A 2LHTA 3TI0A 4GXIA 2ZXHA 3SENA 1Z19A 1OUQA 2C2DA 1YZ6A 3IG8A 2HOQA 5J0TA 2K4IA 2ZIVA 2H3FA 1PVQA 5J0UA 4ED6A 2PFOA 1L8OA 2EZYA 5CA7A 2C2EA 4JV1A 2UVRA 1D9FA 1U49A 1U48A 3ONNA 2LBOA 2BPCA 4RPZA 1MQ2A 3QU5A 3V72A 5KFDA 3H40A 9ICJA 5JU5A 4IQUA 1ZQKA 2AH5A 9ICWA 2YMLA 3Q8PB 4I2FA 2VA8A 3PR5B 3C21A 4ELVA 4RQ2A 4JV2A 4FS1A 3PW2A 5AM5A 1CEZA 3C5FA 1X9SA 2E1FA 4TQRA 2DPIA 5L1IA 4I2JA 3FYHA 4RZRA 3PZPA 5EWGA 2BQ3A 1D8LA 2EQYA 3TFSA 3WKAA 5JRTA 5J0PA 2LYBA 4P0PB 5TZVA 2AJQA 4M0AA 3GIIA 1BPEA 2QB0B 3GILA 2K89A 4DQSA 2PI4A 5DQIA 1ZJNA 5AIBA 1S0NA 4NM1A 1X9XA 4BWJA 2W9BA 3CW2C 4YD1A 4EYIB 2C2RA 4KLDA 3T5JA 3KHHA 4DLGA 5KFYA 2XY6A 2BQUA 3GIJA 2KICA 2I6XA 2KK0A 4EX6A 4UBBA 4Y2YA 3H8MA 4KLUA 1ZQJA 1S77D 1DK2A 4J9SA 4UB2A 4BXOA 1NK6A 1TK8A 4UB3A 4C8LA 5J2CA 2DUYA 4F91B 1BNOA 1FFVA 4DEZA 4EZ9A 3BQTA 1RXVA 2F8KA 3ETRA 3MR3A 1XSNA 9ICCA 1C7YA 1ZQPA 2BZFA 1Y88A 1ZQLA 4I2HA 2MSNA 5IIOA 5AKEA 2M9NA 4C8NA 2QARA 3EZ5A 3AU2A 2HVHA 5EWFA 5IINA 2G5IB 3RBDA 4ED3A 3O0FA 4DLEA 2ZG6A 4FS2A 2YMPA 4DSEA 2YMQA 2R8HA 2ZXIA 3D2NA 5AM1A 2WF5A 4JWMA 3G6YA 4Y2TA 5C5JA 1HUOA 1RZTA 4I28A 1TK5A 4ECYA 3HWTA 1XNSA 4C7ZA 1MQ3A 1O03A 5J2BA 4RQ5A 2HHVA 3L5KA 2OHFA 2V4QA 2HHUA 3JPPA 2JMGA 4G3IA 1KBUA 1LV5A 1X6IA 5J2HA 2W9CA 4NLZA 5KL1B 3PV8A 4J9QA 4I2BA 4P4MA 2RDJA 5DBAA 3F2DA 4I2GA 4ECVA 4J9LA 4ECSA 3ZDBA 1L3SA 2IOFK 3OGUA 3QU7A 2W8LA 2VJ4A 2JEIA 2F2AB 1KLNA 2LMRA 4J9RA 4UATA 2YMMA 1JALA 4YFKA 4IR1A 3WKBA 4JWNA 1J2MA 3ALRA 4QZDA 4DQPA 9ICVA 4F5RA 4DL6A 4K4HA 2PKEA 3KHLA 4C4TA 2FDRA 2RLTA 1U47A 1FO4A 2KE7A 3C5GA 4LZGA 3ZI4A 4F5PA 3HPOA 4UB8U 1B0XA 3PSFA 5B5EU 3RJHA 3UQ0A 3PW5A 2HCFA 4Q8FA 2BCSA 5J29A 3AMZA 5DKWA 2EAMA 3IHQB 5A0LA 4UAWA 3RBEA 4JMUA 1FIQA 2D8CA 5J2KA 2W11A 2B6GA 4YXMA 2IHNA 8ICLA 4M6WB 2FMPA 2W43A 2NRXA 4I2CA 4F5QA 5KFTA 3C2KA 4P0PA 3M6KA 2R18A 1LVHA 4YCXA 1JN3A 4F93B 4KLGA 3BS5B 2HDOA 1PVRA 4RT3A 2P66A 1H38A 7ICRA 3A0HU 5AKIA 2A19A 1ZQYA 2PFQA 1N62A 4EX7A 3WK8A 2H3VA 4QJFB 3PSTA 2D6FC 3BDPA 3M9NB 4GFJA 3KTQA 1DOQA 4Y2SA 1TVAA 3B9JA 3PMLA 4PGQA 3MDCA 2BCRA 1WWVA 2G09A 4OCZA 5L1MA 5GTIU 2BGWA 1PVPA 2ALZA 3C23A 2AQ0A 1J2NA 1TKDA 3KKAC 1UQVA 2WF8A 2K8AA 3WK6A 5KFMA 5HNKA 2HHQA 4PGYA 3IN5A 3ISDA 5CEHA 2WF6A 4CF5A 1CI4A 2Y1JA 2G0AA 2J6UA 4DSJA 3QE9Y 2FJ6A 2HMXA 1TAUA 2DFLA 4DFPA 2H3QA 2E3TA 3HKZF 4YVZA 1XS9D 4PHDA 3V7KA 4F4KA 8ICMA 4QZEA 3IM1A 2W8KA 5AI9A 3GDXA 1ZJMA 4CF3A 4IRDA 2WFAA 3TQ1A 5JUMA 4I2IA 5L9XA 9ICUA 2B21A 2KKPA 3ISCA 1SZPA 2F1HA 5C0YA 2Q0ZX 2FLLA 8ICGA 4AYBC 1L7OA 1TE2A 4EEYA 2ZIVB 1V9PA 4ED2A 2VJ5A 1K1QA 2JEJA 2DPJA 2BDUA 4ED1A 3FM9A 1KTQA 1F44A 4C80A 1JXEA 3CYMA 5IIIA 3TADA 1B43A 4YN4A 3N7PD 8ICOA 2F1JA 3MDAA 3OSNA 4NLGA 4M2YA 1AROP 3RR7A 2XY7A 1IIPA 2KIVA 7ICNA 4EEKA 1ZQCA 4ACOA 2JH7A 4RQMA 3TAPA 4QWBA 3EWAA 3AL0B 3LVVA 1SWVA 5CR0A 4GC7A 2DF4B 4UAVA 2I1QA 2A1JB 1DGJA 4C8OA 1VJ5A 4DFJA 1KN5A 3PX4A 4PPXA 1NKBA 3NGDA 4RT2A 5HHHA 2R8GA 4RPYA 3T5HA 2EANA 5HR6A 3QNMA 1WWUA 3H8WA 4C8MA 1BPXA 5J2AA 1ZD5A 2EH9A 5AKXA 3MGVA 8ICUA 1N5XA 3C2LA 2FLPA 3R9KA 3GIKA 3TADC 4ED8A 2PI5A 4M6WA 3ZDAA 1XC9A 3RB6A 4JK1A 2GOLA 4KMUA 3F5EA 1UA1A 5KFZA 2MAXA 3BS5A 3N7RC 2F8LA 5ALRA 4BXOB 3M9MB 9ICAA 2ASJA 2HI0A 1FFUA 3SAHA 1ZQAA 4UW9A 5KFIA 1N2XA 4QZIA 3I1YA 5KT4A 2UVUA 4NLCA 4U6PA 9ICXA 5ALZA 4J9OA 4FZLA 3SR6A 2H3IA 4MFCA 1L3UA 3QZ7A 2NYVA 4F72A 3E58A 2QARB 4EBDA 1ZQ1C 4PL2A 5ALLA 1A0PA 5ALYA 1SGGA 2W9AA 3AM9A 2ZUCA 2BPGA 4QWEA 1QQ6A 1X66A 4I29A 1NJWA 2Y9TA 1MSWD 4RPXA 3V7LA 1JI7A 1RYSA 1L8LA 2EZXA 4R63A 1JXLA 1ZQOA 5KT6A 3BQ7A 3LK9A 3NVYA 2AU0A 3JPRA 3K1RB 3SV4A 1PK1B 5EE9A 5AM2A 4DOBA 1RG6A 4RQ6A 3SMVA 4FBUA 1JMSA 3THVA 4ED0A 4MFFA 3PW0A 4B9NA 4P4PA 3RB0A 3MGHA 1A76A 1Z1BA 1SV4A 1YZ7A 5J2IA 2R8JA 4FZMA 1UCVA 2ISOA 1WCLA 2FPLA 3QEBZ 4CRXA 1QSYA 1NJZA 2KHQA 3DEEA 3DV9A 3MR6A 2FPMA 3AQFA 5CP2A 4FE3A 2LI6A 5BOLA 1VLBA 5KFQA 3J81j 5KG3A 2HHWA 3G6XA 5KAFU 2MA1A 5G5HA 4KLSA 1ZETA 4PZNA 4LJXA 4R65A 2RHFA 2WHEA 4BX9C 1Q3VA 2JH1A 8ICPA 1VDVA 4UAZA 1ZD3A 2XVTA 3VC8A 4PHPA 3E0FA 1F5SA 2BKEA 4DQRA 1ZQDA 2HHTA 4O0IA 4XUSA 2DGZA 1RM6C 3F2CA 1S0OA 4ICAA 5J0WA 5KFLA 7ICOA 4YMMA 5KG0A 7ICTA 4IQTA 3PW7A 2XIDA 3C1ZA 3S6JA 4YXJA 8ICKA 2A1JA 2KHVA 2RQ5A 2E8NA 4RQ1A 5AKZA 5AKHA 4ZOHC 3KD3A 8ICJA 5ALMA 3M1YA 5DGAA 1T3NA 5BOMA 5ALGA 4F4WA 3GQCA 4RQ8A 1X2IA 5DG7A 5CJ7A 1D8YA 5KFRA 2AQ4A 5KFFA 3MR5A 1ZQEA 2IHMA 4C4SA 4BUGA 4RQNA 5ALJA 1S0MA 5DQHA 1RQLA 8ICHA 1ZQRA 1D8BA 2LYHA 5ALEA 2MUTB 5EE0A 3WKDA 2V9WA 5DBCA 2W3RA 3OJSA 3ZD8A 2F3NA 2W04A 4DQQA 4Z6DA 2G5HB 3SQIA 4DFDA 4O3OA 3GV8B 5F3XB 3RAXA 4M9HA 3OHAA 1SZHA 1V97A 4Y2VA 1DXSA 1YT3A 5KNIA 2E5SA 2ES6A 1Z3EB 1X6JA 5J2DA 3OTQA 3LYSA 2ESEA 2UVVA 4QZCA 2BQRA 9ICOA 1KRPA 2AHOB 4YD2A 3M7DA 3B0YA 4E0DA 4I2EA 1ZQUA 3PO4A 4TUPA 4NLBA 2EZZA 3SYZA 5FP0A 5ALPA 3RR8A 4KLIA 1ZQVA 1COOA 1MN8A 2KD1A 1ZQIA 3HP6A 5ALFA 9ICLA 2NRTA 2W9MA 3PNCA 3Q8QB 3SV3A 4KN4A 3PMNA 4IRKA 3T79A 3K4GA 4IS7A 3SD7A 5J0YA 2L5YA 4AYBF 8ICVA 1NKEA 3H8SA 1EXNA 7ICGA 2OCEA 1PK1A 2PFPA 3JPSA 1QTMA 4O5KA 5AM0A 2KJ8A 4F3OA 2FMSA 1SV0A 2ZJ8A 5ALDA 3HILA 3IDWA 5KG6A 5KG7A 5KL8B 2WF9A 3V6HA 1DK3A 5HMLA 4EYHB 2VANA 4RNNA 5KT7A 4FZNA 1KSPA 4RUAA 3UXPA 3OJUA 4K4GA 3T5LA 4ECZA 4KITB 2XCPA 3D6JA 1GO3F 1XO0A 4HAIA 3IG5A 1P7DA 2WB1C 5F9LA 2F77X 1N56A 3UXNA 8ICIA 4OO1J 4DF4A 4C0ZA 1L7NA 4DQIA 2WTFA 2FLNA 5AIAA 3BZKA 2QLTA 3H0LB 5AK6A 1SKWA 4KLJA 3QU9A 1HUZA 2V4RA 2JXJA 7ICJA 3GV7B 4J9MA 4UASA 2KOBA 7ICKA 3V6JA 4DOCA 2FPKA 7ICIA 2OM6A 4KN7A 1N48A 4UQGA 2LKYA 4NWIA 3AN1A 4U7CA 1SV0C 3KKAA 4JB3A 3PW4A 1T8EA 2P6UA 1S8OA 4ECUA 7ICMA 3CNHA 5KAIU 3KZIU 5ALKA 1KL9A 3QZ8A 3ORYA 3AQEA 5AICA 1ZQXA 2IOHA 3KHRA 3TKAA 4QWCA 4YR3A 5CHGA 5J0QA 2E8OA 1M6YA 4C8KA 3GZFA 2KN7A 1S5LU 4KLTA 4M9LA 4NLNA 4RUCA 4F4ZA 1ZQNA 3ED5A 5J0SA 2FI1A 1RYRA 5TISU 8ICFA 2ZTCA 4F2SA 1KDHA 2MUTA 3M6ZA 1TK0A 1ED1A 2AGPA 5IIJA 9ICFA 3E2EA 4MF8A 1XO1A 4R66A 2JGAA 4DSIA 1JUDA 5J2GA 4Z6CA 2E8PA 2ZIUB 4UB4A 1V85A 3H4DA 2P6RA 4DFMA 2JHDA 4QZHA 9ICNA 3NRWA 5DB7A 3A0BU 3EYZA 4RQ4A 3HW8A 3NVZA 2MU2A 2K4EA 4Y2RA 5ALWA 4F8RA 5J2JA 4US9A 3H0RB 4DL3A 1KFTA 1PZNA 2ISPA 9ICPA 4YR0A 4ECWA 1ZQHA 3T3FA 1L3TA 4DF8A 2ZJAA 3TFRA 2CRXA 4O3MA 3F2BA 1S97A 4M9JA 4C7YA 2VKQA 1QCKA 1BPZA 2B0CA 3SI8A 1RQNA 7ICHA 1ZRMA 2YB4A 3NRZA 3UPQA 3RJKA 1TAQA 4CDGA 4PHEA 2AGQA 4IQVA 2VA2A 3RJIA 3BS7A 2RP5A 8ICQA 1QH9A 2W03A 2BPFA 5DLFA 3N28A 3EPGA 4B6JA 3G6VA 4EENA 1B22A 4KLHA 1NK0A 2BCVA 3RH4A 5J0RA 4UBCA 3RAQA 1PUZA 2E1EA 1LB2B 5DDYA 1Z00B 1ZQSA 4QZAA 3B0XA 2EDUA 3MBYA 2A3VA 3JPOA 4MEXA 1S76D 2PXIA 2FE9A 1SXEA 1L5UA 3IRUA 2K8BB 2HOIA 1X40A 3GFKB 4Q45A 1NZBA 4Q43A 2AGOA 3UMCA 2HBLA 2W55A 2HOFA 4R64A 2G07A 3UXOA 5EWEA 1T94A 1Q46A 3CP8A 1T4GA 9ICBA 2XY5A 7ICFA 1IV8A 4Y2UA 3Q8LA 3RJFA 2PMZC 4KLFA 8ICXA 2K4PA 3NTUA 3RFAA 5AKYA 8ICTA 4O3PA 1COKA 4FFDA 2BCUA 4EBEA 4DL7A 5DG8A 4DWIA 1X9MA 3WK4A 4IQWA 5AM4A 1AQ6A 4CCHA 5ALUA 3AUOA 4KLEA 5ALQA 5KG4A 3PR4A 1S9FA 5E79U 2IBKA 4F4YA 1DRGA 4YMNA 3QUQA 1WUDA 9ICIA 2HVIA 5AI8A 3QU2A 2Q4TA 5KT3A 9ICHA 5ALNA 1NJYA 3N4MB 5AI0A 4NM2A 3RH5A 5HR7A 8ICNA 3SEIA 4O3RA 4XQ8A 2WAQF 2KTQA 1BNPA 3CRXA 4M04A 4R8UB 1D9DA 4RQ7A 4QIWC 4KLOA 3MFHA 2ZIUA 2KZ3A 5AKLA 4ECTA 4O3SA 3NASA 1BPBA 4TUQA 3UQ2A 1UT5A 1ZD2P 2DKXA 1MC8A 2KNJA 1XSLA 1SWWA 1UHUA 2ODGA 3GV5B 4YP3A 1BGXT 1SIJA 5J8YC 4PZOA 2HHSA 4UB5A 4M9NA 2BR0A 2ASLA 1T7PA 1KFSA 3RH6A 9ICQA 2BDPA 2QKQA 5KG1A 3PX6A 2GH1A 3WU2U 5H2FU 3Q8SB 5DDMA 5AI6A 5KFHA 5KFNA 1WYGA 5HP4A 4QZBA 1N5WA 5KFBA 1L3VA 7ICSA 4F71A 2KVSA 1SKRA 4NV0A 4QW9A 1S0VA 3D2QA 5EOZA 4MHVA 1IXRA 1BPDA 5AK4A 2VA3A 2Y1IA 3UM9A 4F4XA 5AI4A 4JV0A 1UPHA 3GIMA 5EE1A 1ZQTA 2WB1F 3EW9A 4GC6A 2YY6A 2I9GA 2JZBB 1L7MA 4RNOA 2ZTEA 5IILA 3OHBA 3K1ZA 5KT2A 2ZUBA 5BPCA 5DGBA 4DS4A 1CUKA 5J0OA 5DQGA 2K8CB 5EE3A 1ZYQA 3T5KA 2QB1A 4YMOA 4F50A 4DSFA 1V38A 1Z4NA 5KG2A 8ICEA 1FEZA 3QUCA 1Z00A 3NUQA 4G9BA 4RU9A 4ECXA 4WJ3B 1MA7A 2KV2A 1ZQQA 2VIXA 2WF7A 2J6SA 5DLGA 1L6NA 4I2AA 3RJEA 1Q8KA 5CB1A 4DL4A 8ICAA 9ICTA 5D49A 4KX5A 3ZD9A 2KG5A 2DBYA 5K4LA 5AM3A 3RRGA 2CN1A 2ASDA 3MC1A 4IL6U 3QYPA 4J9KA 3QUBA 2R8KA 5J2EA 2HBMA 1A6SA 2I5HA 3KHGA 3V6KA 2YQEA 4B9MA 3ZDEA 2N1RA 1WCNA 4EELA 1QQ5A 5KFUA 5CWRA 3ETLA 4YG2A 2HSZA 3BZCA 4Y2XA 5ALIA 3BJYA 2GO7A 3KBBA 4Y2PA 3N7SC 4F5NA 2G08A 3H8JA 2DKZA 3TACB 5J2FA 4NJ8A 2XC9A 3IP4B 3U26A 4OJPA 1NK9A 4TUSA 1ZOLA 1JIHA 4B9TA 1QLNA 1O08A 1QSSA 1WG8A 2GLEA 4DO9A 1NZPA 1XU4A 1N63A 5G5GA 1ZQGA 8ICWA 4R8UA 3UMGA 1TV9A 2KSOA 2G06A 2WAQC 4DOAA 1J97A 4AP9A 3RF9A 4PH5A 4TURA 3I76A 3GU3A 2IA6A 1SB3C 2LYAA 4ELUA 4FBTA 2KKVA 2R8IA 1SXDA 3NS1A 3AEVA 3JPTA 3IV6A 2ZIWB 3PVXA 1KFDA 1NOMA 4ZH4A 2OWOA 8ICRA 2ZIXB 3C28A 4NL9A 2CXYA 4OJOA 5KFCA 3HT3A 4QW8A 2F1IA 2Y0SC 3FC4A 1OW5A 4DSKA 4P0QA 2XI9A 2W7PA 2P35A 3C1YA 3LVWA 4Z6FA 4ECRA 8ICZA 1UA0A 3DDHA 3HJEA 5AK5A 2XO7A 2NRZA 4YQWA 4UARA 3ZDDA 1NI3A 3M8RA 1CRXA 5KTQA 1NK8A 2KFNA 4Z6EA 1SL2A 4QNLA 8ICSA 4Q44A 2H3ZA 2HBJA 4CGZA 1ECWA 2JZBA 2AXTU 4CNQA 3WK5A 4FO6A 2YX8A 5KT5A 1U45A 4OJ5A 4EZ6A 1ZQWA 3QU4A 3HRDD 2GWSA 4IRCA 1C20A 5DB9A 5L1JA 4KLQA 5AK3A 3OSPA 2RRDA 3BQ0A 4BDPA 3SAGA 4A8EA 4NL9C 1ZQFA 2C28A 4MEYA 3M8SA 1K1SA 2PMZF 1LKYB 2XGQA 3KZXA 5DG9A 5ALVA 4ED7A 4O9MA 3ICXA 2NRVA 2KVCA 5AHXA 5KFGA 2JV3A 4PHAA 1TAMA 1NK4A 2XCAA 4B9LA 4GLXA 2ZTDA 9ICMA 3KFUF 2KEYA 5ALTA 2YN4A 3TARA 1HIWA 4UAYA 5B66U 3RB4A 4HYKA 2XICA 3BQ1A 2XGPA 2M0NA 3N97B 5KFOA 4F2RA 4XA5A 2C22A 4J9NA 4IC9A 9ICEA 2Y9UA 7ICPA 2KZMA 2YTUA 1RXWA 2F44A 2EAOA 1B4FA 4ECQA 4M47A 3EUB2 1NK7A 4M9GA 5T14A 1KEJA 4QIWF 4Y2JA 3JPNA 8ICBA 1URJA 1X42A 3PX0A 2QB0A 1NNLA 3RJGA 4OJLA 2K4HA 5HHIA 2OH2A 4DL2A 4NY8A 7ICQA 2JR5A 5AKKA 4F5OA 9ICRA 1U4BA 2A1AA 5AKJA 4US8A 4B9UA 2D3DA 1K5OA 4J9PA 3PO5A 3MFIA 4ELTA 3WKEA 4PGXA 3PSPA 3C29A 7ICLA 1ZQZA 3NVVA 3UMBA 2MRLA 1IG6A 4GXKA 4RQ3A 4C4RA 2KJ9A 4BWMA 4PL1A 1RYUA 2NO4A 2NV3A 3QX7A 7ICEA 2ZIWA 2KP7A 4MFAA 2PFNA 9ICSA 5JTIA 5KG5A 2ZJ5A 3MABA 4B9SA 4J03A 4NLKA 2ZIXA 4KMOB 4I27A 8ICYA 4P2HA 4O3NA 3ISBA 3WK7A 2IMWP 1SL0A 2F76X 1JRPA 1Q3UA 4UB6U 4K4IA 3ZDCA 1ZD4A 4RQ0A 5KFVA 1XWLA 1PK3A 4OD0A 3NVWA 2KFZA 1NKCA 3VCBA 1RDFA 2BCQA 3AU6A 1KW4A 5IIMA 2OYYA 1Z4OA 3QXGA 3K75D 4CF4A 3LDAA
chains in the Genus database with same CATH topology
4CRXA 4OO1J 1T94A 2KHQA 3DEEA 5CRXA 2YB1A 3AQFA 2K4EA 2N1RA 3CP8A 4C0ZA 4FE3A 1SZHA 5A0LA 4JMUA 4OJLA 1YT3A 2GOLA 3F5EA 2E5SA 3H0RB 2Z7JA 2G5IB 3H0LB 2MA1A 1CRXA 2KKPA 3O0FA 2K4HA 4NV0A 2OH2A 2ZG6A 2RHFA 5C0YA 2DQNB 2PMZC 3D2QA 3LYSA 3N7SC 4QNLA 3N7RC 2JH1A 4BX9C 2F8LA 2G08A 1Q3VA 2H3ZA 2HBJA 2Y0SF 2ZXIA 4CGZA 3RFAA 4AYBC 2KOBA 1ECWA 3D2NA 2CRXA 3SAHA 3M7DA 2ZIVB 2YX8A 3SAFA 4O3MA 3IP4B 2XVTA 1UPHA 3F2BA 2VJ5A 4P0PA 2E1FA 3VC8A 4OJPA 3M6KA 4OJ5A 4NLBA 3E0FA 2OM6A 3D2SA 2VKQA 2KIWA 2LKYA 4P0QB 2R18A 2WB1F 2BDUA 4NWIA 3PZPA 3PSPA 4U7CA 1PVRA 1XNSA 2KD1A 1F44A 3CYMA 3C29A 2DGZA 4NLCA 1DRGA 4U6PA 3N7PD 2RRDA 3F2CA 2CPRA 2LYBA 4FZLA 2YB4A 4ICAA 1WUDA 3SAGA 2MRLA 2H3IA 3K1ZA 2W7OA 4P0PB 3PSIA 3AQEA 2H3VA 4A8EA 2HBKA 2JMGA 3PSTA 4QJFB 2Q4TA 2D6FC 1KBUA 4GFJA 1ZQ1C 2G06A 4PL2A 2KJ9A 4CDGA 3T79A 2PMZF 4PL1A 1A0PA 2XIDA 5HR7A 2WAQC 5KL1B 2K89A 2K8CB 2NV3A 2ZIWA 3RF9A 1IIPA 4AYBF 3KZXA 3GU3A 3F53A 3F2DA 2KHVA 2LYAA 2WAQF 2RP5A 2W03A 3GZFA 3ICXA 2KKVA 3HKZC 3CRXA 2G09A 3NUQA 4ACOA 4WJ3B 3OPXA 2KVCA 2ZIXA 2JH7A 2VJ4A 4KMOB 1MA7A 4QIWC 2KJ8A 2KICA 2KV2A 1PVPA 2VIXA 2F2AB 3LVVA 3AL0B 1L6NA 2ZIWB 2DF4B 2ZIUA 4KX3A 1TAMA 4BJQA 3L3FX 2F76X 3F5AA 4OJ6A 2LHTA 1Q3UA 2K8AA 2E1EA 2ZXHA 3M6ZA 3KFUF 2KEYA 5KL8B 1Z19A 1OUQA 1ED1A 3IN5A 2KJ5A 1HIWA 2ZIXB 3H0MB 3C28A 3IG8A 2HOQA 4KX5A 2K4IA 3ALRA 3SMVA 2XICA 2A3VA 2G0AA 2JGAA 2ZIVA 2H3FA 2M0NA 4OJOA 4BUGA 1PVQA 2G07A 5HR6A 2ZIUB 2KNJA 4FZNA 2Y0SC 4IC9A 2CN1A 1HEKA 4P0QA 2K8BB 2HMXA 2XI9A 2HOIA 3VCBA 1D8BA 1Z1BA 1GO3F 2JHDA 2W7PA 2H3QA 1XO0A 3IG5A 3HKZF 2W04A 3PSFA 3MGVA 4FZMA 3NRWA 3ONNA 1NZBA 1URJA 2LBOA 1P7DA 2OYYA 3LVWA 2HBMA 2WB1C 2OXOA 2G5HB 4QIWF 2HBLA 5T14A 2HOFA 3SQIA 1A6SA 2GH1A 2F77X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F76 X;  2F77 X; 
#chains in the Genus database with same CATH topology
 4QZF A;  3QEA Z;  4O3Q A;  4DSL A;  1ZQB A;  1T3Q A;  4LVS A;  1X9W A;  4QZG A;  2EAP A;  4LZD A;  1ZXI A;  5L1L A;  2W54 A;  5DB6 A;  2UVW A;  1F0M A;  5GTH U;  2RDI A;  5AKG A;  4Q8E A;  4GXJ A;  1KQQ A;  3I28 A;  4UAU A;  3RRH A;  1KKX A;  2NRW A;  3TAN A;  3H7I A;  1QQ7 A;  2HW3 A;  1LKY A;  3QUT A;  4O5E A;  3MR2 A;  4NXZ A;  1DGS A;  4PJ0 U;  1JX4 A;  1N61 A;  2KMD A;  3RJJ A;  1QSL A;  4X5V A;  4CE6 A;  3JPQ A;  2H5X A;  4RNM A;  4GIB A;  1OXJ A;  2LPE A;  4DCC A;  4IR9 A;  4I2D A;  4QWA A;  3V7J A;  5J8Y A;  5KFE A;  1ZQM A;  5KFK A;  3FAH A;  2W3S A;  2K60 A;  3OPX A;  2E8M A;  4KLL A;  2ATL A;  5HMM A;  4F92 B;  4KTQ A;  5IIK A;  3F5A A;  4OJ6 A;  1JRO A;  5ALS A;  2W9B B;  3M9O B;  5KFJ A;  5ALH A;  1N60 A;  4O5C A;  2KJ5 A;  1NJX A;  3H0M B;  3LWM A;  2LM1 A;  2OEH A;  4Y2Q A;  1HEK A;  3RB3 A;  2KSO B;  1UT8 A;  2LM4 A;  9ICK A;  9ICG A;  5F9N A;  1SKS A;  1A77 A;  2OXO A;  3HX0 A;  1Z1V A;  1RPL A;  5ALX A;  5CRX A;  2YB1 A;  1SL1 A;  3PY8 A;  2DWQ A;  2FMQ A;  2O6K A;  2BHN A;  3WK9 A;  4UB1 A;  2JEF A;  1IM4 A;  4USA A;  4QZ9 A;  2Z7J A;  5KFX A;  3Q8M A;  4QWD A;  3L4P A;  2DQN B;  4YR2 A;  2HHX A;  2Y0S F;  4EBC A;  4KLM A;  8ICC A;  3SAF A;  4DS5 A;  5DBB A;  1U9L A;  3D2S A;  3KOO A;  3EPI A;  2KIW A;  4QZ8 A;  4MF2 A;  4P0Q B;  4DFK A;  1NK5 A;  2JEG A;  3LWL A;  5KFS A;  5DB8 A;  3RTV A;  5KFW A;  5ALO A;  3C2M A;  5D4B A;  4DL5 A;  2IOF A;  2CPR A;  2JRZ A;  2NO5 A;  2W7O A;  7ICV A;  3PSI A;  2J6T A;  3TAQ A;  2HBK A;  5AI5 A;  1HJP A;  1L7P A;  1BPY A;  2KZZ A;  3H4B A;  5KFA A;  3WKC A;  3SZ2 A;  3FDS A;  1ZRN A;  3F53 A;  4P4O A;  5L1K A;  5J0X A;  4BGD A;  3BQ2 A;  7ICU A;  4JUZ A;  3HKZ C;  3Q8K A;  1XSP A;  1TFR A;  2DL0 A;  5KFP A;  2W9C B;  3Q8R B;  4TQS A;  2ZUD A;  4XRH A;  4B9V A;  4KX3 A;  3MGI A;  4BJQ A;  5D46 A;  3L3F X;  1BVS A;  1S10 A;  2LHT A;  3TI0 A;  4GXI A;  2ZXH A;  3SEN A;  1Z19 A;  1OUQ A;  2C2D A;  1YZ6 A;  3IG8 A;  2HOQ A;  5J0T A;  2K4I A;  2ZIV A;  2H3F A;  1PVQ A;  5J0U A;  4ED6 A;  2PFO A;  1L8O A;  2EZY A;  5CA7 A;  2C2E A;  4JV1 A;  2UVR A;  1D9F A;  1U49 A;  1U48 A;  3ONN A;  2LBO A;  2BPC A;  4RPZ A;  1MQ2 A;  3QU5 A;  3V72 A;  5KFD A;  3H40 A;  9ICJ A;  5JU5 A;  4IQU A;  1ZQK A;  2AH5 A;  9ICW A;  2YML A;  3Q8P B;  4I2F A;  2VA8 A;  3PR5 B;  3C21 A;  4ELV A;  4RQ2 A;  4JV2 A;  4FS1 A;  3PW2 A;  5AM5 A;  1CEZ A;  3C5F A;  1X9S A;  2E1F A;  4TQR A;  2DPI A;  5L1I A;  4I2J A;  3FYH A;  4RZR A;  3PZP A;  5EWG A;  2BQ3 A;  1D8L A;  2EQY A;  3TFS A;  3WKA A;  5JRT A;  5J0P A;  2LYB A;  4P0P B;  5TZV A;  2AJQ A;  4M0A A;  3GII A;  1BPE A;  2QB0 B;  3GIL A;  2K89 A;  4DQS A;  2PI4 A;  5DQI A;  1ZJN A;  5AIB A;  1S0N A;  4NM1 A;  1X9X A;  4BWJ A;  2W9B A;  3CW2 C;  4YD1 A;  4EYI B;  2C2R A;  4KLD A;  3T5J A;  3KHH A;  4DLG A;  5KFY A;  2XY6 A;  2BQU A;  3GIJ A;  2KIC A;  2I6X A;  2KK0 A;  4EX6 A;  4UBB A;  4Y2Y A;  3H8M A;  4KLU A;  1ZQJ A;  1S77 D;  1DK2 A;  4J9S A;  4UB2 A;  4BXO A;  1NK6 A;  1TK8 A;  4UB3 A;  4C8L A;  5J2C A;  2DUY A;  4F91 B;  1BNO A;  1FFV A;  4DEZ A;  4EZ9 A;  3BQT A;  1RXV A;  2F8K A;  3ETR A;  3MR3 A;  1XSN A;  9ICC A;  1C7Y A;  1ZQP A;  2BZF A;  1Y88 A;  1ZQL A;  4I2H A;  2MSN A;  5IIO A;  5AKE A;  2M9N A;  4C8N A;  2QAR A;  3EZ5 A;  3AU2 A;  2HVH A;  5EWF A;  5IIN A;  2G5I B;  3RBD A;  4ED3 A;  3O0F A;  4DLE A;  2ZG6 A;  4FS2 A;  2YMP A;  4DSE A;  2YMQ A;  2R8H A;  2ZXI A;  3D2N A;  5AM1 A;  2WF5 A;  4JWM A;  3G6Y A;  4Y2T A;  5C5J A;  1HUO A;  1RZT A;  4I28 A;  1TK5 A;  4ECY A;  3HWT A;  1XNS A;  4C7Z A;  1MQ3 A;  1O03 A;  5J2B A;  4RQ5 A;  2HHV A;  3L5K A;  2OHF A;  2V4Q A;  2HHU A;  3JPP A;  2JMG A;  4G3I A;  1KBU A;  1LV5 A;  1X6I A;  5J2H A;  2W9C A;  4NLZ A;  5KL1 B;  3PV8 A;  4J9Q A;  4I2B A;  4P4M A;  2RDJ A;  5DBA A;  3F2D A;  4I2G A;  4ECV A;  4J9L A;  4ECS A;  3ZDB A;  1L3S A;  2IOF K;  3OGU A;  3QU7 A;  2W8L A;  2VJ4 A;  2JEI A;  2F2A B;  1KLN A;  2LMR A;  4J9R A;  4UAT A;  2YMM A;  1JAL A;  4YFK A;  4IR1 A;  3WKB A;  4JWN A;  1J2M A;  3ALR A;  4QZD A;  4DQP A;  9ICV A;  4F5R A;  4DL6 A;  4K4H A;  2PKE A;  3KHL A;  4C4T A;  2FDR A;  2RLT A;  1U47 A;  1FO4 A;  2KE7 A;  3C5G A;  4LZG A;  3ZI4 A;  4F5P A;  3HPO A;  4UB8 U;  1B0X A;  3PSF A;  5B5E U;  3RJH A;  3UQ0 A;  3PW5 A;  2HCF A;  4Q8F A;  2BCS A;  5J29 A;  3AMZ A;  5DKW A;  2EAM A;  3IHQ B;  5A0L A;  4UAW A;  3RBE A;  4JMU A;  1FIQ A;  2D8C A;  5J2K A;  2W11 A;  2B6G A;  4YXM A;  2IHN A;  8ICL A;  4M6W B;  2FMP A;  2W43 A;  2NRX A;  4I2C A;  4F5Q A;  5KFT A;  3C2K A;  4P0P A;  3M6K A;  2R18 A;  1LVH A;  4YCX A;  1JN3 A;  4F93 B;  4KLG A;  3BS5 B;  2HDO A;  1PVR A;  4RT3 A;  2P66 A;  1H38 A;  7ICR A;  3A0H U;  5AKI A;  2A19 A;  1ZQY A;  2PFQ A;  1N62 A;  4EX7 A;  3WK8 A;  2H3V A;  4QJF B;  3PST A;  2D6F C;  3BDP A;  3M9N B;  4GFJ A;  3KTQ A;  1DOQ A;  4Y2S A;  1TVA A;  3B9J A;  3PML A;  4PGQ A;  3MDC A;  2BCR A;  1WWV A;  2G09 A;  4OCZ A;  5L1M A;  5GTI U;  2BGW A;  1PVP A;  2ALZ A;  3C23 A;  2AQ0 A;  1J2N A;  1TKD A;  3KKA C;  1UQV A;  2WF8 A;  2K8A A;  3WK6 A;  5KFM A;  5HNK A;  2HHQ A;  4PGY A;  3IN5 A;  3ISD A;  5CEH A;  2WF6 A;  4CF5 A;  1CI4 A;  2Y1J A;  2G0A A;  2J6U A;  4DSJ A;  3QE9 Y;  2FJ6 A;  2HMX A;  1TAU A;  2DFL A;  4DFP A;  2H3Q A;  2E3T A;  3HKZ F;  4YVZ A;  1XS9 D;  4PHD A;  3V7K A;  4F4K A;  8ICM A;  4QZE A;  3IM1 A;  2W8K A;  5AI9 A;  3GDX A;  1ZJM A;  4CF3 A;  4IRD A;  2WFA A;  3TQ1 A;  5JUM A;  4I2I A;  5L9X A;  9ICU A;  2B21 A;  2KKP A;  3ISC A;  1SZP A;  2F1H A;  5C0Y A;  2Q0Z X;  2FLL A;  8ICG A;  4AYB C;  1L7O A;  1TE2 A;  4EEY A;  2ZIV B;  1V9P A;  4ED2 A;  2VJ5 A;  1K1Q A;  2JEJ A;  2DPJ A;  2BDU A;  4ED1 A;  3FM9 A;  1KTQ A;  1F44 A;  4C80 A;  1JXE A;  3CYM A;  5III A;  3TAD A;  1B43 A;  4YN4 A;  3N7P D;  8ICO A;  2F1J A;  3MDA A;  3OSN A;  4NLG A;  4M2Y A;  1ARO P;  3RR7 A;  2XY7 A;  1IIP A;  2KIV A;  7ICN A;  4EEK A;  1ZQC A;  4ACO A;  2JH7 A;  4RQM A;  3TAP A;  4QWB A;  3EWA A;  3AL0 B;  3LVV A;  1SWV A;  5CR0 A;  4GC7 A;  2DF4 B;  4UAV A;  2I1Q A;  2A1J B;  1DGJ A;  4C8O A;  1VJ5 A;  4DFJ A;  1KN5 A;  3PX4 A;  4PPX A;  1NKB A;  3NGD A;  4RT2 A;  5HHH A;  2R8G A;  4RPY A;  3T5H A;  2EAN A;  5HR6 A;  3QNM A;  1WWU A;  3H8W A;  4C8M A;  1BPX A;  5J2A A;  1ZD5 A;  2EH9 A;  5AKX A;  3MGV A;  8ICU A;  1N5X A;  3C2L A;  2FLP A;  3R9K A;  3GIK A;  3TAD C;  4ED8 A;  2PI5 A;  4M6W A;  3ZDA A;  1XC9 A;  3RB6 A;  4JK1 A;  2GOL A;  4KMU A;  3F5E A;  1UA1 A;  5KFZ A;  2MAX A;  3BS5 A;  3N7R C;  2F8L A;  5ALR A;  4BXO B;  3M9M B;  9ICA A;  2ASJ A;  2HI0 A;  1FFU A;  3SAH A;  1ZQA A;  4UW9 A;  5KFI A;  1N2X A;  4QZI A;  3I1Y A;  5KT4 A;  2UVU A;  4NLC A;  4U6P A;  9ICX A;  5ALZ A;  4J9O A;  4FZL A;  3SR6 A;  2H3I A;  4MFC A;  1L3U A;  3QZ7 A;  2NYV A;  4F72 A;  3E58 A;  2QAR B;  4EBD A;  1ZQ1 C;  4PL2 A;  5ALL A;  1A0P A;  5ALY A;  1SGG A;  2W9A A;  3AM9 A;  2ZUC A;  2BPG A;  4QWE A;  1QQ6 A;  1X66 A;  4I29 A;  1NJW A;  2Y9T A;  1MSW D;  4RPX A;  3V7L A;  1JI7 A;  1RYS A;  1L8L A;  2EZX A;  4R63 A;  1JXL A;  1ZQO A;  5KT6 A;  3BQ7 A;  3LK9 A;  3NVY A;  2AU0 A;  3JPR A;  3K1R B;  3SV4 A;  1PK1 B;  5EE9 A;  5AM2 A;  4DOB A;  1RG6 A;  4RQ6 A;  3SMV A;  4FBU A;  1JMS A;  3THV A;  4ED0 A;  4MFF A;  3PW0 A;  4B9N A;  4P4P A;  3RB0 A;  3MGH A;  1A76 A;  1Z1B A;  1SV4 A;  1YZ7 A;  5J2I A;  2R8J A;  4FZM A;  1UCV A;  2ISO A;  1WCL A;  2FPL A;  3QEB Z;  4CRX A;  1QSY A;  1NJZ A;  2KHQ A;  3DEE A;  3DV9 A;  3MR6 A;  2FPM A;  3AQF A;  5CP2 A;  4FE3 A;  2LI6 A;  5BOL A;  1VLB A;  5KFQ A;  3J81 j;  5KG3 A;  2HHW A;  3G6X A;  5KAF U;  2MA1 A;  5G5H A;  4KLS A;  1ZET A;  4PZN A;  4LJX A;  4R65 A;  2RHF A;  2WHE A;  4BX9 C;  1Q3V A;  2JH1 A;  8ICP A;  1VDV A;  4UAZ A;  1ZD3 A;  2XVT A;  3VC8 A;  4PHP A;  3E0F A;  1F5S A;  2BKE A;  4DQR A;  1ZQD A;  2HHT A;  4O0I A;  4XUS A;  2DGZ A;  1RM6 C;  3F2C A;  1S0O A;  4ICA A;  5J0W A;  5KFL A;  7ICO A;  4YMM A;  5KG0 A;  7ICT A;  4IQT A;  3PW7 A;  2XID A;  3C1Z A;  3S6J A;  4YXJ A;  8ICK A;  2A1J A;  2KHV A;  2RQ5 A;  2E8N A;  4RQ1 A;  5AKZ A;  5AKH A;  4ZOH C;  3KD3 A;  8ICJ A;  5ALM A;  3M1Y A;  5DGA A;  1T3N A;  5BOM A;  5ALG A;  4F4W A;  3GQC A;  4RQ8 A;  1X2I A;  5DG7 A;  5CJ7 A;  1D8Y A;  5KFR A;  2AQ4 A;  5KFF A;  3MR5 A;  1ZQE A;  2IHM A;  4C4S A;  4BUG A;  4RQN A;  5ALJ A;  1S0M A;  5DQH A;  1RQL A;  8ICH A;  1ZQR A;  1D8B A;  2LYH A;  5ALE A;  2MUT B;  5EE0 A;  3WKD A;  2V9W A;  5DBC A;  2W3R A;  3OJS A;  3ZD8 A;  2F3N A;  2W04 A;  4DQQ A;  4Z6D A;  2G5H B;  3SQI A;  4DFD A;  4O3O A;  3GV8 B;  5F3X B;  3RAX A;  4M9H A;  3OHA A;  1SZH A;  1V97 A;  4Y2V A;  1DXS A;  1YT3 A;  5KNI A;  2E5S A;  2ES6 A;  1Z3E B;  1X6J A;  5J2D A;  3OTQ A;  3LYS A;  2ESE A;  2UVV A;  4QZC A;  2BQR A;  9ICO A;  1KRP A;  2AHO B;  4YD2 A;  3M7D A;  3B0Y A;  4E0D A;  4I2E A;  1ZQU A;  3PO4 A;  4TUP A;  4NLB A;  2EZZ A;  3SYZ A;  5FP0 A;  5ALP A;  3RR8 A;  4KLI A;  1ZQV A;  1COO A;  1MN8 A;  2KD1 A;  1ZQI A;  3HP6 A;  5ALF A;  9ICL A;  2NRT A;  2W9M A;  3PNC A;  3Q8Q B;  3SV3 A;  4KN4 A;  3PMN A;  4IRK A;  3T79 A;  3K4G A;  4IS7 A;  3SD7 A;  5J0Y A;  2L5Y A;  4AYB F;  8ICV A;  1NKE A;  3H8S A;  1EXN A;  7ICG A;  2OCE A;  1PK1 A;  2PFP A;  3JPS A;  1QTM A;  4O5K A;  5AM0 A;  2KJ8 A;  4F3O A;  2FMS A;  1SV0 A;  2ZJ8 A;  5ALD A;  3HIL A;  3IDW A;  5KG6 A;  5KG7 A;  5KL8 B;  2WF9 A;  3V6H A;  1DK3 A;  5HML A;  4EYH B;  2VAN A;  4RNN A;  5KT7 A;  4FZN A;  1KSP A;  4RUA A;  3UXP A;  3OJU A;  4K4G A;  3T5L A;  4ECZ A;  4KIT B;  2XCP A;  3D6J A;  1GO3 F;  1XO0 A;  4HAI A;  3IG5 A;  1P7D A;  2WB1 C;  5F9L A;  2F77 X;  1N56 A;  3UXN A;  8ICI A;  4OO1 J;  4DF4 A;  4C0Z A;  1L7N A;  4DQI A;  2WTF A;  2FLN A;  5AIA A;  3BZK A;  2QLT A;  3H0L B;  5AK6 A;  1SKW A;  4KLJ A;  3QU9 A;  1HUZ A;  2V4R A;  2JXJ A;  7ICJ A;  3GV7 B;  4J9M A;  4UAS A;  2KOB A;  7ICK A;  3V6J A;  4DOC A;  2FPK A;  7ICI A;  2OM6 A;  4KN7 A;  1N48 A;  4UQG A;  2LKY A;  4NWI A;  3AN1 A;  4U7C A;  1SV0 C;  3KKA A;  4JB3 A;  3PW4 A;  1T8E A;  2P6U A;  1S8O A;  4ECU A;  7ICM A;  3CNH A;  5KAI U;  3KZI U;  5ALK A;  1KL9 A;  3QZ8 A;  3ORY A;  3AQE A;  5AIC A;  1ZQX A;  2IOH A;  3KHR A;  3TKA A;  4QWC A;  4YR3 A;  5CHG A;  5J0Q A;  2E8O A;  1M6Y A;  4C8K A;  3GZF A;  2KN7 A;  1S5L U;  4KLT A;  4M9L A;  4NLN A;  4RUC A;  4F4Z A;  1ZQN A;  3ED5 A;  5J0S A;  2FI1 A;  1RYR A;  5TIS U;  8ICF A;  2ZTC A;  4F2S A;  1KDH A;  2MUT A;  3M6Z A;  1TK0 A;  1ED1 A;  2AGP A;  5IIJ A;  9ICF A;  3E2E A;  4MF8 A;  1XO1 A;  4R66 A;  2JGA A;  4DSI A;  1JUD A;  5J2G A;  4Z6C A;  2E8P A;  2ZIU B;  4UB4 A;  1V85 A;  3H4D A;  2P6R A;  4DFM A;  2JHD A;  4QZH A;  9ICN A;  3NRW A;  5DB7 A;  3A0B U;  3EYZ A;  4RQ4 A;  3HW8 A;  3NVZ A;  2MU2 A;  2K4E A;  4Y2R A;  5ALW A;  4F8R A;  5J2J A;  4US9 A;  3H0R B;  4DL3 A;  1KFT A;  1PZN A;  2ISP A;  9ICP A;  4YR0 A;  4ECW A;  1ZQH A;  3T3F A;  1L3T A;  4DF8 A;  2ZJA A;  3TFR A;  2CRX A;  4O3M A;  3F2B A;  1S97 A;  4M9J A;  4C7Y A;  2VKQ A;  1QCK A;  1BPZ A;  2B0C A;  3SI8 A;  1RQN A;  7ICH A;  1ZRM A;  2YB4 A;  3NRZ A;  3UPQ A;  3RJK A;  1TAQ A;  4CDG A;  4PHE A;  2AGQ A;  4IQV A;  2VA2 A;  3RJI A;  3BS7 A;  2RP5 A;  8ICQ A;  1QH9 A;  2W03 A;  2BPF A;  5DLF A;  3N28 A;  3EPG A;  4B6J A;  3G6V A;  4EEN A;  1B22 A;  4KLH A;  1NK0 A;  2BCV A;  3RH4 A;  5J0R A;  4UBC A;  3RAQ A;  1PUZ A;  2E1E A;  1LB2 B;  5DDY A;  1Z00 B;  1ZQS A;  4QZA A;  3B0X A;  2EDU A;  3MBY A;  2A3V A;  3JPO A;  4MEX A;  1S76 D;  2PXI A;  2FE9 A;  1SXE A;  1L5U A;  3IRU A;  2K8B B;  2HOI A;  1X40 A;  3GFK B;  4Q45 A;  1NZB A;  4Q43 A;  2AGO A;  3UMC A;  2HBL A;  2W55 A;  2HOF A;  4R64 A;  2G07 A;  3UXO A;  5EWE A;  1T94 A;  1Q46 A;  3CP8 A;  1T4G A;  9ICB A;  2XY5 A;  7ICF A;  1IV8 A;  4Y2U A;  3Q8L A;  3RJF A;  2PMZ C;  4KLF A;  8ICX A;  2K4P A;  3NTU A;  3RFA A;  5AKY A;  8ICT A;  4O3P A;  1COK A;  4FFD A;  2BCU A;  4EBE A;  4DL7 A;  5DG8 A;  4DWI A;  1X9M A;  3WK4 A;  4IQW A;  5AM4 A;  1AQ6 A;  4CCH A;  5ALU A;  3AUO A;  4KLE A;  5ALQ A;  5KG4 A;  3PR4 A;  1S9F A;  5E79 U;  2IBK A;  4F4Y A;  1DRG A;  4YMN A;  3QUQ A;  1WUD A;  9ICI A;  2HVI A;  5AI8 A;  3QU2 A;  2Q4T A;  5KT3 A;  9ICH A;  5ALN A;  1NJY A;  3N4M B;  5AI0 A;  4NM2 A;  3RH5 A;  5HR7 A;  8ICN A;  3SEI A;  4O3R A;  4XQ8 A;  2WAQ F;  2KTQ A;  1BNP A;  3CRX A;  4M04 A;  4R8U B;  1D9D A;  4RQ7 A;  4QIW C;  4KLO A;  3MFH A;  2ZIU A;  2KZ3 A;  5AKL A;  4ECT A;  4O3S A;  3NAS A;  1BPB A;  4TUQ A;  3UQ2 A;  1UT5 A;  1ZD2 P;  2DKX A;  1MC8 A;  2KNJ A;  1XSL A;  1SWW A;  1UHU A;  2ODG A;  3GV5 B;  4YP3 A;  1BGX T;  1SIJ A;  5J8Y C;  4PZO A;  2HHS A;  4UB5 A;  4M9N A;  2BR0 A;  2ASL A;  1T7P A;  1KFS A;  3RH6 A;  9ICQ A;  2BDP A;  2QKQ A;  5KG1 A;  3PX6 A;  2GH1 A;  3WU2 U;  5H2F U;  3Q8S B;  5DDM A;  5AI6 A;  5KFH A;  5KFN A;  1WYG A;  5HP4 A;  4QZB A;  1N5W A;  5KFB A;  1L3V A;  7ICS A;  4F71 A;  2KVS A;  1SKR A;  4NV0 A;  4QW9 A;  1S0V A;  3D2Q A;  5EOZ A;  4MHV A;  1IXR A;  1BPD A;  5AK4 A;  2VA3 A;  2Y1I A;  3UM9 A;  4F4X A;  5AI4 A;  4JV0 A;  1UPH A;  3GIM A;  5EE1 A;  1ZQT A;  2WB1 F;  3EW9 A;  4GC6 A;  2YY6 A;  2I9G A;  2JZB B;  1L7M A;  4RNO A;  2ZTE A;  5IIL A;  3OHB A;  3K1Z A;  5KT2 A;  2ZUB A;  5BPC A;  5DGB A;  4DS4 A;  1CUK A;  5J0O A;  5DQG A;  2K8C B;  5EE3 A;  1ZYQ A;  3T5K A;  2QB1 A;  4YMO A;  4F50 A;  4DSF A;  1V38 A;  1Z4N A;  5KG2 A;  8ICE A;  1FEZ A;  3QUC A;  1Z00 A;  3NUQ A;  4G9B A;  4RU9 A;  4ECX A;  4WJ3 B;  1MA7 A;  2KV2 A;  1ZQQ A;  2VIX A;  2WF7 A;  2J6S A;  5DLG A;  1L6N A;  4I2A A;  3RJE A;  1Q8K A;  5CB1 A;  4DL4 A;  8ICA A;  9ICT A;  5D49 A;  4KX5 A;  3ZD9 A;  2KG5 A;  2DBY A;  5K4L A;  5AM3 A;  3RRG A;  2CN1 A;  2ASD A;  3MC1 A;  4IL6 U;  3QYP A;  4J9K A;  3QUB A;  2R8K A;  5J2E A;  2HBM A;  1A6S A;  2I5H A;  3KHG A;  3V6K A;  2YQE A;  4B9M A;  3ZDE A;  2N1R A;  1WCN A;  4EEL A;  1QQ5 A;  5KFU A;  5CWR A;  3ETL A;  4YG2 A;  2HSZ A;  3BZC A;  4Y2X A;  5ALI A;  3BJY A;  2GO7 A;  3KBB A;  4Y2P A;  3N7S C;  4F5N A;  2G08 A;  3H8J A;  2DKZ A;  3TAC B;  5J2F A;  4NJ8 A;  2XC9 A;  3IP4 B;  3U26 A;  4OJP A;  1NK9 A;  4TUS A;  1ZOL A;  1JIH A;  4B9T A;  1QLN A;  1O08 A;  1QSS A;  1WG8 A;  2GLE A;  4DO9 A;  1NZP A;  1XU4 A;  1N63 A;  5G5G A;  1ZQG A;  8ICW A;  4R8U A;  3UMG A;  1TV9 A;  2KSO A;  2G06 A;  2WAQ C;  4DOA A;  1J97 A;  4AP9 A;  3RF9 A;  4PH5 A;  4TUR A;  3I76 A;  3GU3 A;  2IA6 A;  1SB3 C;  2LYA A;  4ELU A;  4FBT A;  2KKV A;  2R8I A;  1SXD A;  3NS1 A;  3AEV A;  3JPT A;  3IV6 A;  2ZIW B;  3PVX A;  1KFD A;  1NOM A;  4ZH4 A;  2OWO A;  8ICR A;  2ZIX B;  3C28 A;  4NL9 A;  2CXY A;  4OJO A;  5KFC A;  3HT3 A;  4QW8 A;  2F1I A;  2Y0S C;  3FC4 A;  1OW5 A;  4DSK A;  4P0Q A;  2XI9 A;  2W7P A;  2P35 A;  3C1Y A;  3LVW A;  4Z6F A;  4ECR A;  8ICZ A;  1UA0 A;  3DDH A;  3HJE A;  5AK5 A;  2XO7 A;  2NRZ A;  4YQW A;  4UAR A;  3ZDD A;  1NI3 A;  3M8R A;  1CRX A;  5KTQ A;  1NK8 A;  2KFN A;  4Z6E A;  1SL2 A;  4QNL A;  8ICS A;  4Q44 A;  2H3Z A;  2HBJ A;  4CGZ A;  1ECW A;  2JZB A;  2AXT U;  4CNQ A;  3WK5 A;  4FO6 A;  2YX8 A;  5KT5 A;  1U45 A;  4OJ5 A;  4EZ6 A;  1ZQW A;  3QU4 A;  3HRD D;  2GWS A;  4IRC A;  1C20 A;  5DB9 A;  5L1J A;  4KLQ A;  5AK3 A;  3OSP A;  2RRD A;  3BQ0 A;  4BDP A;  3SAG A;  4A8E A;  4NL9 C;  1ZQF A;  2C28 A;  4MEY A;  3M8S A;  1K1S A;  2PMZ F;  1LKY B;  2XGQ A;  3KZX A;  5DG9 A;  5ALV A;  4ED7 A;  4O9M A;  3ICX A;  2NRV A;  2KVC A;  5AHX A;  5KFG A;  2JV3 A;  4PHA A;  1TAM A;  1NK4 A;  2XCA A;  4B9L A;  4GLX A;  2ZTD A;  9ICM A;  3KFU F;  2KEY A;  5ALT A;  2YN4 A;  3TAR A;  1HIW A;  4UAY A;  5B66 U;  3RB4 A;  4HYK A;  2XIC A;  3BQ1 A;  2XGP A;  2M0N A;  3N97 B;  5KFO A;  4F2R A;  4XA5 A;  2C22 A;  4J9N A;  4IC9 A;  9ICE A;  2Y9U A;  7ICP A;  2KZM A;  2YTU A;  1RXW A;  2F44 A;  2EAO A;  1B4F A;  4ECQ A;  4M47 A;  3EUB 2;  1NK7 A;  4M9G A;  5T14 A;  1KEJ A;  4QIW F;  4Y2J A;  3JPN A;  8ICB A;  1URJ A;  1X42 A;  3PX0 A;  2QB0 A;  1NNL A;  3RJG A;  4OJL A;  2K4H A;  5HHI A;  2OH2 A;  4DL2 A;  4NY8 A;  7ICQ A;  2JR5 A;  5AKK A;  4F5O A;  9ICR A;  1U4B A;  2A1A A;  5AKJ A;  4US8 A;  4B9U A;  2D3D A;  1K5O A;  4J9P A;  3PO5 A;  3MFI A;  4ELT A;  3WKE A;  4PGX A;  3PSP A;  3C29 A;  7ICL A;  1ZQZ A;  3NVV A;  3UMB A;  2MRL A;  1IG6 A;  4GXK A;  4RQ3 A;  4C4R A;  2KJ9 A;  4BWM A;  4PL1 A;  1RYU A;  2NO4 A;  2NV3 A;  3QX7 A;  7ICE A;  2ZIW A;  2KP7 A;  4MFA A;  2PFN A;  9ICS A;  5JTI A;  5KG5 A;  2ZJ5 A;  3MAB A;  4B9S A;  4J03 A;  4NLK A;  2ZIX A;  4KMO B;  4I27 A;  8ICY A;  4P2H A;  4O3N A;  3ISB A;  3WK7 A;  2IMW P;  1SL0 A;  2F76 X;  1JRP A;  1Q3U A;  4UB6 U;  4K4I A;  3ZDC A;  1ZD4 A;  4RQ0 A;  5KFV A;  1XWL A;  1PK3 A;  4OD0 A;  3NVW A;  2KFZ A;  1NKC A;  3VCB A;  1RDF A;  2BCQ A;  3AU6 A;  1KW4 A;  5IIM A;  2OYY A;  1Z4O A;  3QXG A;  3K75 D;  4CF4 A;  3LDA A; 
#chains in the Genus database with same CATH homology
 4CRX A;  4OO1 J;  1T94 A;  2KHQ A;  3DEE A;  5CRX A;  2YB1 A;  3AQF A;  2K4E A;  2N1R A;  3CP8 A;  4C0Z A;  4FE3 A;  1SZH A;  5A0L A;  4JMU A;  4OJL A;  1YT3 A;  2GOL A;  3F5E A;  2E5S A;  3H0R B;  2Z7J A;  2G5I B;  3H0L B;  2MA1 A;  1CRX A;  2KKP A;  3O0F A;  2K4H A;  4NV0 A;  2OH2 A;  2ZG6 A;  2RHF A;  5C0Y A;  2DQN B;  2PMZ C;  3D2Q A;  3LYS A;  3N7S C;  4QNL A;  3N7R C;  2JH1 A;  4BX9 C;  2F8L A;  2G08 A;  1Q3V A;  2H3Z A;  2HBJ A;  2Y0S F;  2ZXI A;  4CGZ A;  3RFA A;  4AYB C;  2KOB A;  1ECW A;  3D2N A;  2CRX A;  3SAH A;  3M7D A;  2ZIV B;  2YX8 A;  3SAF A;  4O3M A;  3IP4 B;  2XVT A;  1UPH A;  3F2B A;  2VJ5 A;  4P0P A;  2E1F A;  3VC8 A;  4OJP A;  3M6K A;  4OJ5 A;  4NLB A;  3E0F A;  2OM6 A;  3D2S A;  2VKQ A;  2KIW A;  2LKY A;  4P0Q B;  2R18 A;  2WB1 F;  2BDU A;  4NWI A;  3PZP A;  3PSP A;  4U7C A;  1PVR A;  1XNS A;  2KD1 A;  1F44 A;  3CYM A;  3C29 A;  2DGZ A;  4NLC A;  1DRG A;  4U6P A;  3N7P D;  2RRD A;  3F2C A;  2CPR A;  2LYB A;  4FZL A;  2YB4 A;  4ICA A;  1WUD A;  3SAG A;  2MRL A;  2H3I A;  3K1Z A;  2W7O A;  4P0P B;  3PSI A;  3AQE A;  2H3V A;  4A8E A;  2HBK A;  2JMG A;  3PST A;  4QJF B;  2Q4T A;  2D6F C;  1KBU A;  4GFJ A;  1ZQ1 C;  2G06 A;  4PL2 A;  2KJ9 A;  4CDG A;  3T79 A;  2PMZ F;  4PL1 A;  1A0P A;  2XID A;  5HR7 A;  2WAQ C;  5KL1 B;  2K89 A;  2K8C B;  2NV3 A;  2ZIW A;  3RF9 A;  1IIP A;  4AYB F;  3KZX A;  3GU3 A;  3F53 A;  3F2D A;  2KHV A;  2LYA A;  2WAQ F;  2RP5 A;  2W03 A;  3GZF A;  3ICX A;  2KKV A;  3HKZ C;  3CRX A;  2G09 A;  3NUQ A;  4ACO A;  4WJ3 B;  3OPX A;  2KVC A;  2ZIX A;  2JH7 A;  2VJ4 A;  4KMO B;  1MA7 A;  4QIW C;  2KJ8 A;  2KIC A;  2KV2 A;  1PVP A;  2VIX A;  2F2A B;  3LVV A;  3AL0 B;  1L6N A;  2ZIW B;  2DF4 B;  2ZIU A;  4KX3 A;  1TAM A;  4BJQ A;  3L3F X;  2F76 X;  3F5A A;  4OJ6 A;  2LHT A;  1Q3U A;  2K8A A;  2E1E A;  2ZXH A;  3M6Z A;  3KFU F;  2KEY A;  5KL8 B;  1Z19 A;  1OUQ A;  1ED1 A;  3IN5 A;  2KJ5 A;  1HIW A;  2ZIX B;  3H0M B;  3C28 A;  3IG8 A;  2HOQ A;  4KX5 A;  2K4I A;  3ALR A;  3SMV A;  2XIC A;  2A3V A;  2G0A A;  2JGA A;  2ZIV A;  2H3F A;  2M0N A;  4OJO A;  4BUG A;  1PVQ A;  2G07 A;  5HR6 A;  2ZIU B;  2KNJ A;  4FZN A;  2Y0S C;  4IC9 A;  2CN1 A;  1HEK A;  4P0Q A;  2K8B B;  2HMX A;  2XI9 A;  2HOI A;  3VCB A;  1D8B A;  1Z1B A;  1GO3 F;  2JHD A;  2W7P A;  2H3Q A;  1XO0 A;  3IG5 A;  3HKZ F;  2W04 A;  3PSF A;  3MGV A;  4FZM A;  3NRW A;  3ONN A;  1NZB A;  1URJ A;  2LBO A;  1P7D A;  2OYY A;  3LVW A;  2HBM A;  2WB1 C;  2OXO A;  2G5H B;  4QIW F;  2HBL A;  5T14 A;  2HOF A;  3SQI A;  1A6S A;  2GH1 A;  2F77 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...