4C0ZA

The n-terminal domain of the streptococcus pyogenes pilus tip adhesin cpa
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
SVPNKQSSVQDYPWYGYDSYSKGYPDYSPLKTYHNLKVNLDGSKEYQAYCFNLTKHFPSKSDSVRSQWYKKLEGTNENFIKLADKPRIEDGQLQQNILRILYNGYPNDRNGIMKGIDPLNAILVTQNAIWYYTDSSYISDTSKAFQQEETDLKLDSQQLQLMRNALKRLINPKEVESLPNQVPANYQLSIFQSSDKTFQNLLSAEYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords ANCILLARY PROTEIN 2
publication title Structural Model for the Covalent Adhesion of the Streptococcus Pyogenes Pilus Through a Thioester Bond.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 68
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.480 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4c0zA02
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0zA01
2XI9A 5A0DA 4BUGA 4C0ZA 5A0LA 5A0GA 2XICA 2XIDA
chains in the Genus database with same CATH superfamily
4UB6U 2K79A 4LE9A 1ZOLA 1NK5A 2DKZA 1FEZA 4ZH4A 5DG7A 4JV2A 5EE9A 1U8RA 1HYOA 4M4ZA 1S1NA 4F2RA 1H92A 3NVVA 5FU6C 1VA7A 2FHDA 3EFSA 1E6HA 3QJ6A 1D1AA 4QWBA 1W70A 3BS5A 1U47A 2WHEA 3M0RA 5KFSA 1WXTA 2ZIVA 1Q81R 2E65A 1FO4A 1KN5A 3KHHA 2DILA 2E10A 5DB7A 3UF4A 2FYKA 4EBEA 4EBDA 2ZPBB 1SHGA 4N4HA 1IXDA 1L7PA 4R65A 5DGBA 4M78E 2DL5A 2KDSA 9ICWA 2ZGWA 2WB1C 4QJFB 5KAIU 2RM4A 5JTIA 1FXXA 4PFPA 3PMLA 1Q82R 1NK9A 1QCKA 1FX7A 4PZNA 4DL5A 3I76A 2R8HA 1A6SA 4HVVA 4DFMA 1B07A 2VXFA 5CA7A 2B8AA 4L59A 9ICRA 2VUBA 1CRXA 3G7ZA 4J9EA 4DEYA 3Q8QB 2CSQA 4IR1A 2F1LA 3OYAA 5KYUA 3TQ7P 3SWNB 1ZQEA 5J39A 1ZHIA 3JCMP 3OB9A 7ICLA 3BFMA 4EMKA 4XTUA 2AT1B 5AHXA 3PIPA 4M7DA 3NHNA 2JZBB 5GAN2 1T7PA 3JCMh 4PJOF 4BE1A 9ICEA 3NTUA 1U3OA 2BKDN 4J9KA 4KX3A 4PGYA 1JXEA 4R8UB 2BHNA 5J0OA 3GIJA 4M75C 4XTYA 2FMSA 1PKSA 4I27A 1YJ9T 2SRCA 3HTRA 3OYCA 2MAXA 1C1AA 2QQAA 2E8MA 3PNWC 2G06A 4M7DD 2BCUA 2HHUA 2DBKA 2EYQA 1QP2A 2PVOB 5KFNA 5CR0A 2RHYA 3SI8A 1K5OA 3L4PA 3TADC 2MAMA 4GLMA 4PFZA 2HW3A 2K3BA 2JJ9A 2AKKA 3V8JA 3UXNA 4M77F 1QH9A 2VA2A 8ICRA 1RAEB 3FAHA 2HCKA 3WK9A 1N8RR 4JB3A 1C7YA 1UGRB 3C29A 1YJ9Q 1G83A 5GMKh 4U7CA 1NLOC 2XGPA 3ZDCA 4LDYA 1BPYA 3ZDAA 2JMAA 3V6HA 2RH2A 4KLTA 3OS2A 2E8OA 4AG1C 4Q8FA 2HVHA 1JROA 2E8NA 4ELTA 3SB2A 5KFTA 3L5KA 3CCSA 1M90U 1DGSA 3MC1A 3ZDEA 2J7IA 4C8MA 2UVWA 1P92A 2KT8A 5J2HA 1PK1A 2E8PA 5KG0A 7ICQA 2ZIUA 1ZA1B 5J8YC 2C0IA 3D2SA 4TQRA 2P84A 3FDSA 5L8RE 2M51A 3QZ9B 2NWMA 2RHZA 3M55A 5CQXA 4RT2A 3MCAB 2F1JA 2EZZA 5ALZA 4P0QB 1TTHB 4UQGA 2I5HA 2LM4A 2O88A 3CCLA 2CUBA 5KYXB 3RB6A 2LZ6B 3BZCA 1B0XA 4WJ3B 3WVEB 4US9A 5CHGA 1RL2A 5J2CA 3C2LA 4J9RA 3ZEHA 3OSVA 3MO8A 3ZL7C 2OM6A 3LVWA 4RPYA 1KC8C 3LYSA 1X40A 2DYIA 4QQGA 3URGA 4B9MA 1MV3A 1K9AA 2LQNA 4C92B 5IHKA 1VQ5T 5KFWA 2RQ5A 4F4XA 2CGHA 3QKJA 4JS4A 4IUVA 2RF0A 2WF7A 2YQEA 3CCEQ 2DTOA 2XDBA 2PVGB 3JCMV 1ZD3A 2NRXA 2EZYA 2HOIA 2HOQA 1D0ZA 5KG6A 2KRMA 5IIKA 2KE9A 2CSIA 2XI9A 3LH5A 2ZUDA 3H0MB 3KD3A 3M6ZA 3JB9I 3L2QA 4DA4A 2JMGA 1ZSZA 4ESRA 1N2XA 3GV5B 1NKEA 3WKBA 1G3SA 2E6NA 4WTOB 4I29A 3H8ZA 2HD0A 2DZ9A 1VQ5Q 1DXSA 2GTOA 1VQNA 9ICCA 4Y2XA 2JW4A 1WX6A 3UATA 4C8QC 2EAOA 4F17A 2KIVA 4XU0A 4MMLA 2WSEE 2FZGB 1D0YA 1C0MA 2YUPA 4FYYB 5KCHA 4CCHA 1UA1A 1NJZA 2YLCA 1K73R 1X27A 2X4YA 5HY6A 2QASA 5FWCA 2K5LA 2NUPB 1IB8A 4EPCA 5FRNA 5FU6B 1I1JA 2KP7A 2R8IA 4PZOA 5KFGA 2HHXA 3AU2A 5GAOr 1RACB 5GANh 1YHQT 3L2ZA 3RUXA 1RXVA 5AI5A 4RTUA 4OJLA 1Q86R 5IT9E 1OX8A 2VKNA 4O3RA 3OY9A 4KITB 2DL0A 1VOMA 3CCMT 1MA7A 1S8OA 3I56A 2LP5A 2ROTA 4C92G 1G3TA 3CPWS 2VYTA 1UHFA 4RMOA 3H0FA 1W6XA 3AEVA 2GNCA 1BVSA 3NRWA 3NVYA 4C4SA 2GFAA 3VS0A 2W9MA 2EPDA 9ICAA 1WXUA 2FLNA 4P0PB 1Q81U 2P66A 2R8JA 1YHQQ 1EZZB 2LTOA 3M8SA 4QKUA 5AKKA 3H9NA 4Z02A 4QWCA 4AP9A 5DGAA 1M30A 3CCMQ 2LNVA 2V9WA 4TUQA 2LCCA 4AFQC 1BU1A 3PX4A 3PSPA 1B7TA 2VXEA 2PU9B 5AIBA 2F2XA 1Q82U 3QYGB 4KLOA 2K5FA 4QQ6A 3GV8B 4RUCA 1W2BS 3OTQA 1N6AA 2HQHA 1MUZA 2PNIA 4NLNA 1WFWA 1X69A 4I2HA 1VQOT 5ALXA 2VC8A 3JCMg 2DBYA 4N4GA 1IREB 4XU2A 1ZQFA 3I1YA 2BE9B 3JCMJ 2OH2A 2JM9A 4C5IA 4M75B 5IIIA 3V8LA 1RAGB 1V29B 1ZQMA 4YN4A 1ACMB 1URJA 8AT1B 2K8CB 3EH1A 4PL6A 4I2CA 1N56A 8ICIA 4QZGA 2RQRA 2EDUA 5CIUA 4U6PA 3VRZA 3QO3A 5GAOm 9ICVA 1RZTA 1L5UA 3BDUA 3CCUA 1H3HA 1RI9A 2KMTA 2AXTU 2J6OA 2MIOA 8ICFA 1AD5A 1UUEA 3CCRA 2YTUA 1VQOQ 2H8HA 3TSZA 1MV0B 5D6WA 1SSHA 1I07A 1D3BB 4IS7A 3N7PD 2LQWA 3FJ5A 5LJ3f 8ICZA 5KYNA 5KFYA 1BI2A 1SL0A 5AKIA 3AHUA 3VS1A 3L3FX 4B6MA 3LYIA 1XNSA 5DBCA 4QZ8A 2JOYA 3CCST 1R0CB 2IOFA 2WF8A 4HT8A 1ZQYA 1M2VA 1N8RU 2PI5A 5KAFU 2JR5A 3LDAA 3BQ0A 4F4YA 3MP6A 2QTXA 1GCQA 4RZRA 2IBKA 2ZIWB 1RUWA 3IQLA 4DOAA 1K8AC 2XU8A 2RJEA 2PFNA 3CCLT 1TOVA 2GQIA 3H8JA 4ECQA 2JRZA 2QYZA 2YUOA 5BOMA 4DFJA 4IRCA 2RQVA 4X9CA 1SXEA 2EANA 3HHTB 3QWYA 5GAMh 3CCSQ 1NJIU 2KYMA 3CQTA 3BQ1A 3TFRA 2G08A 1D09B 1WYGA 1UB4A 5IINA 4MDXA 2IG0A 3L1AA 4J5YA 3A8MB 2RP5A 2HSEB 3DDHA 3KZXA 4C8KA 4I2FA 2A37A 2RQUA 3F53A 1NM7A 8ICLA 3NVZA 3RKWA 2DPJA 4B9SA 4PK4A 4QWDA 4M7AA 3CCLQ 3EAEA 4DOBA 2FI1A 4YD2A 3TFSA 4RG2A 3TQ1A 1YI2A 2IOFK 2JH7A 4PHEA 1PSFA 4J9LA 2H3IA 4C4TA 1ZETA 2DIQA 3VS5A 2HVIA 2E5SA 4QW2A 3PZPA 3L2WA 1YZ7A 4E0DA 1IXRA 3MEUA 1KQ1A 3PMNA 1N9RA 4M78C 5AT1B 4ZTJA 2KJ8A 3WK7A 1NG2A 1M4ZA 3UWNA 1VQNT 4AYBC 5KFAA 2DL7A 3QX7A 4ZGDB 5ALEA 4C8QB 4M7AD 3EGUA 1H38A 3CMEA 3EZ5A 2AH5A 3M4YA 1KD1C 9ICUA 3G6VA 1XOVA 5KG4A 4QT7A 8ICAA 1WIEA 1W4SA 3LWLA 4MZMA 4RPZA 3LWMA 2HHWA 3WKAA 3T79A 5J2EA 1BBZA 2OHFA 4BWJA 4DBHA 5KFDA 1WCLA 3QU7A 5J0UA 3JPOA 3VUBA 7AT1B 1I5LA 2BPGA 1LKYB 1VYTA 2JVVA 1VQNQ 4CRXA 4AFZC 3GU3A 1LJOA 4C8OA 1YZ6A 5F9NA 4XUSA 4J9BA 2HNIA 4XTXA 5GANg 1M3CA 3JCMc 4YP3A 2W04A 3VRYA 3U26A 2DTHA 1T3QA 3GZFA 3JPNA 1IV8A 3GQCA 1K73U 5J0XA 2YMPA 2YRVA 3OYIA 2D3DA 1YJNT 4PLLA 2YT6A 4QZEA 1JIHA 4FYXB 1TFRA 3MGVA 3MR5A 4GC7A 1S9FA 1IZ6A 1MC8A 4OB3B 1T8EA 4M9LA 1JMSA 3BS7A 4Y91A 1Q86U 1NYFA 2V4QA 4ECSA 2V8JA 4Y2UA 2AQ0A 1QQ5A 4Y2TA 1QSSA 3F5EA 4DSKA 3G71A 2RHFA 5I22A 4MEYA 3M57A 3A8GB 2NRVA 4F5QA 5FU7C 1X6JA 2WSCE 4PJJA 5I2SA 4PJOG 5LJ3j 3M1YA 4DEZA 3JCMe 5GAOn 1K9MR 3SV3A 4DQRA 2CH4W 2HSZA 1E6GA 4F3OA 8ICMA 3EG9A 4GLKA 3GP8A 3RKXA 1YJNQ 1ZQDA 2VB6A 3DKMA 5AI9A 2QB0A 1R77A 2W9BA 1UHCA 3GIBA 3X24B 4IQTA 3TCJA 1WI7A 4TUPA 4X5VA 4F4WA 2JM8A 2KI7A 3UPUA 5ALTA 3LGFA 3MPUB 2W11A 4RUAA 3E9FA 4JZ4A 1ZQIA 2KVCA 2GOLA 2MOXA 3C95A 5I21A 4LXCA 1WHMA 2DZCA 2A1JB 3DB4A 2G09A 2FB7A 4NWIA 4O3NA 3RBEA 2JV3A 1X6GA 5KFBA 3A8LB 3WK8A 3PVQA 4PL1A 1RADB 2IPOB 3OYJA 2KEAA 3CCUT 2MWPA 5GMKe 4N4IA 1ZQNA 3THVA 4M2YA 2CP6A 3QIIA 4KH0B 4JWMA 3CCRT 4YXMA 4RQ4A 3JCMd 4JV0A 1FFVA 4FS2A 4V2SA 1AZEA 4KMUA 2CT4A 1S77D 3SYZA 1X9WA 3F2DA 3PO4A 3IV6A 3F2CA 2V8KA 4NLCA 3RJFA 2ENMA 2QXFA 3KHGA 3WXMB 5EE0A 3M0UA 2IVWA 4ECTA 3NGDA 4DSEA 1QVFA 1OUQA 3CCUQ 2D0QB 8ICQA 2E1HA 1V97A 6AT1B 4D6WA 4CI0C 3CCRQ 1TK8A 4UB2A 2YB1A 4RNMA 2FPEA 2L3QA 1NK6A 7ICTA 5FROA 3BW1A 4IUQA 4K11A 1ABQA 2M9NA 2H3JA 3OSNA 5IXBA 2HBPA 4RQMA 5FWBA 4NL9A 1ZQWA 3GFKB 1MMGA 3JPPA 1VQMT 4F5NA 1V76A 3N4MB 4KT0E 2DEUA 4PJOE 2ZTEA 1SG5A 2PXIA 5CEHA 4M04A 1PK3A 2ATCB 5A0GA 2WAQC 3OYKA 3IRUA 2ED0A 2QGGA 1IGUA 4RCCA 1JRIA 2KEYA 4UB4A 2KZZA 4NLBA 4DFDA 2ZIUB 3PMTA 5HHHA 2DXCA 3THKA 1XWLA 5AK3A 5GAMg 2QEXA 4Z6EA 4ECUA 5LJ5h 4M7DG 2Y1IA 2QTVA 3EHRA 2P4RA 3R6OA 4NV0A 2E3HA 2C06A 1I4K1 2PMZC 3RB3A 4E7JA 4OF1A 1Z4OA 2E4HA 4QIWF 1TUGB 1VQMQ 7ICPA 2XGQA 3AN1A 2EGCA 2F1HA 2KRSA 1YI2T 4C4RA 4ED0A 2WSFE 2ASJA 3GIMA 1BIAA 1Z4NA 4DF4A 5GAN7 1ZQBA 3E58A 4LJXA 1F44A 5C6SA 2COZA 2H3EB 5ALIA 1H3ZA 4OGCA 4DL3A 1KSWA 1YJ9A 4A63B 2Y0SC 2PUOB 1GFDA 4EENA 4GXKA 4UARA 1SV0C 3ISBA 4OMLA 2YLBA 4FYVB 4BI4A 1KQ2A 1UGVA 4DQ2A 1LNXA 4UAUA 2W7PA 2GTJA 2R8KA 3L42A 3SHWA 5GANe 1YWPA 5CKBA 4LZGA 1WPYA 3FLGA 4Q5WA 5I11A 3KBGA 4F7UA 5FLXE 3VC8A 3B0XA 3IHQB 5J2BA 4BI3A 2M16A 1F5SA 1UHUA 3MR6A 3TADA 5F9LA 1G3YA 5HCKA 2F69A 5DQGA 2LMJA 2Q4TA 3RKYA 5IH2A 4QVDA 1WJRA 3GDXA 1UGQB 3WKCA 1AVZC 2EQYA 3G6EQ 5GAOp 1G3WA 1X9MA 4DBFA 3CBMA 2ZCFB 4XU3A 2IMWP 4ATOA 3NGPA 3F2BA 2KMDA 4MEXA 3Q8PB 2KJ5A 5KFEA 5AI6A 3SFMA 2ALZA 1FIQA 1Y0MA 2CDTA 3OYYA 1VDVA 1A0NB 2ISPA 2QQ9A 4DQQA 2MWOA 4UAYA 5AM4A 4NLZA 1IHVA 5K4LA 5HMLA 4LDVA 2KK0A 2DEQA 4M7DE 2DRMA 3UMCA 4DF8A 2EVRA 5AKEA 4UAVA 5ECAA 3G71T 2JEFA 1M1FA 2K60A 5AKHA 2OJ2A 5J8YA 5GANd 3CCEA 2P35A 1NLPC 1L8LA 4PH5A 1AZGB 2CP0A 5HP4A 5FU7B 2W3SA 2QGFB 3V8KA 1SKWA 5ALUA 9ATCB 4UAZA 5KFKA 2WB1F 5KFRA 2KKVA 9ICTA 4ELZC 2LYBA 4M6WA 4FU6A 3HRDD 4PJ0U 2XCPA 3C4SA 1T0JA 2HBLA 4IQVA 2VGMA 4C92C 5JRTA 1VQ5A 2NUTA 3A0BU 1B34B 1D9FA 1YP5A 1G8XA 3RB0A 1X6BA 2JXBA 4HYKA 2QARA 4ANJA 1JXLA 4F72A 5J0PA 1S0NA 1N5WA 1SIJA 2IHMA 4GBQA 2DK3A 4II1A 3J7AF 4DSIA 3V7CA 3M58A 1ZQXA 1Z1VA 4KTQA 1ZLMA 2YWWA 1NPPA 2FJ6A 2CZ7B 4O5VA 5CWRA 2JGAA 2YB4A 3IM1A 4F5OA 3KFUF 1Q46A 2LT4A 2KD1A 5LL6S 4F04B 3PR4A 1M9SA 4O3PA 4FS1A 5DB8A 4ECRA 2IHNA 1R8OB 5GTIU 2RHIA 4M9HA 1YCYA 3I28A 2DRKA 4I28A 2RLTA 7ICOA 4J9IA 4ZGEB 3TACB 4JS5A 3E2UA 5CKEA 4B6JA 2MK5A 3ZI4A 2AHOB 4M77A 1D1BA 1MQ3A 1Y96A 3JPTA 4HCBA 3ICXA 4KMOB 3M59A 4F7UF 8ICWA 3VS4A 3NFCA 1SKRA 3SQIA 3K1RB 2L5YA 3QU2A 1Q3VA 2BZYA 3S6JA 4JWNA 4KGZB 3RMSA 1T4GA 5J29A 5DBBA 3M54A 1M8VA 3MR3A 1YHQA 3FIFA 2L3PA 4NLKA 2K9GA 2COYA 4M77D 4DEXA 3EG2A 2E70A 1Q7YC 3CCMA 4RCBA 2K5IA 1VQ4T 5GAMe 1WYXA 2EQJA 3ZD9A 2FLPA 9ICHA 4CC4B 2EQKA 4YMMA 1KIKA 2EAYA 3BZKA 1U9LA 4BXOA 3TKAA 3RH6A 2X3XD 4AG2C 3PVLA 1F1BB 2YUQA 3CXCA 2DETA 1M2VB 3RERA 1BPZA 4KGVB 5KT4A 2ED1A 2FPDA 1Z00A 1TAUA 2RD1A 3I55T 2FPFA 3LVVA 3FRNA 3QBYA 3I5RA 2DL4A 2QEXT 1M8MA 3UPQA 1AWOA 3BQTA 5LJ5g 2O4XB 1VQ4Q 3OPXA 3PTAA 2EYXA 2CN1A 3A1PA 4M0AA 4TVRA 1XQHA 3GPLA 5L1LA 4P4MA 1OZ2A 2BQUA 1TAMA 1QQ6A 1KFZA 5ALPA 3FB9A 1PVRA 5D4BA 2LX9A 2AK5A 4NOYA 4KN4A 4Q43A 3I55Q 2ZAEA 4JRQA 1QQ7A 2BTTA 5GAMd 1RG6A 3H4BA 2UVRA 2QEXQ 1VQOA 4N0AC 1T0HA 3O8VA 2FLLA 3HRSA 2RQWA 4UASA 2W9CA 2K3YA 3MKDA 3QDFA 3OYLA 1X6OA 1HIWA 5KFVA 1RAHB 1SZHA 3VS6A 2ASDA 3M9OB 2NRZA 4F4KA 3C1ZA 1OW5A 3RH4A 3CCVT 3EWAA 2XIDA 3B9JA 5CVIA 4VUBA 2FPMA 3CP8A 5J0SA 2KOBA 2F44A 2DXTA 4I2DA 2PQWA 3TEEA 5AM3A 1T3LA 4FSXA 2W55A 2RN8A 2ZG6A 2EKHA 3ED5A 9ICNA 4C8QF 3PNCA 2XO7A 1ZUYA 3A98A 3DB3A 4XU1A 1N5ZA 2IIMA 2ISOA 4YFKA 2KY9A 4R63A 3UXPA 3CCVQ 8ICPA 4PJLA 3RJIA 3OBYA 1XO1A 1KTQA 2RPNA 1OYXA 1CSKA 2PFOA 4A53A 3HFOA 4GY5A 3OBWA 4A4KA 2GO7A 4OO1J 1WNLA 1ZD4A 1I81A 1L3VA 1UJYA 2GF7A 4TURA 1NJIR 3AT1B 3QYHB 5FP0A 3IN5A 4ECWA 4QWEA 3T5KA 1ZQ1C 2CPRA 2WF6A 2NO4A 1S10A 1X42A 4Y2VA 1DRGA 3P8DA 3CCET 2IOHA 4F91B 3HX0A 1M1KC 1UFFA 5DLGA 2EH9A 2R58A 2RJCA 1VQ8T 1SEMA 3RJHA 1RLQC 2LJ0A 4ICAA 2KJ9A 2DBMA 4M7AG 5AK5A 2OYYA 1XTDA 5HR6A 4QW9A 1PC0A 1KQSA 4FW1A 1BCMA 5A0LA 2AHJB 4PNOA 4YVZA 4ZNXA 1YCSB 4DCCA 3OYGA 4IC9A 3TANA 1JXOA 2ZIXB 2E12A 2A0FB 3ZD8A 4GLXA 2X3WD 5KFFA 2AKLA 1M2OA 2LX7A 2ODGA 2UVUA 3SAGA 3HILA 3OYDA 1CUKA 4YXJA 3RB4A 4Q8EA 2KV2A 1OPLA 3C12A 4XK8E 4E7ZA 1VQ8Q 3KKAC 3KHLA 1TUDA 1TK0A 3MJXA 4O9MA 4CC2A 4EMGA 5J2IA 1SHFA 2LRQA 2F8KA 2E3TA 4PLIA 2OX7A 3QU5A 4KLSA 2KQWA 4J9PA 2A08A 1NKCA 3OMGA 4EEKA 5KFMA 2CP3A 3CCQT 1JJ2S 4PJOC 4KRTA 2KSOB 2ZJ5A 1PKTA 4ECYA 2K8BB 3HKZC 2MA1A 1FMKA 4YMNA 5CP2A 5B5EU 1ZSGA 3R6NA 4FO6A 4DOVA 3JPSA 4DS5A 4PKCC 4Y2RA 5ALJA 4P4OA 1JU5C 3A8HB 1P7DA 3JB9H 4JPBW 2JEGA 4JRPA 1AHJB 1D1CA 5EE3A 5A2QE 2DO3A 1S72Q 4AFSC 2LYHA 3CCQQ 4YD1A 1NOMA 2VANA 3G6YA 4Z6DA 2D6FA 4C5EA 4KLLA 1Z19A 4I2JA 4KUDK 2ZXHA 4QZCA 4UB8U 3EHQA 1QWFA 4RTVA 3SR6A 9ICGA 3M4GA 4KLEA 3JCMW 2DFUA 3V7LA 3V6KA 2AGQA 2RO0A 2BDUA 2BGWA 2KSSA 5LJ5e 4C8NA 1TKDA 3MGIA 2ZZDA 1YJNA 4KLMA 4DL4A 1DK2A 3META 2RK1A 2ZJ8A 1ZA2B 4M7AE 1UQVA 2DNUA 1PSEA 2RDJA 3I35A 3ALRA 5D7UA 2HOFA 4RQ1A 3RF9A 1X43A 3G1JA 2F2VA 3C5FA 3VS3A 3IDWA 3WKDA 4HA8A 4DL2A 2DPPB 2F5TX 1NYGA 3H0HA 4LVSA 3CC7T 5KYYA 2W43A 4KLIA 4M9JA 2KAFA 4WF2A 2X35A 5ALYA 4I2EA 1WHGA 2CZ0B 3VCBA 2X4XA 3P8HA 4PL2A 3QXGA 5CQYA 2OEHA 3UA7A 1VQ6A 4NY8A 3PX0A 1Q81C 1VJ5A 3H0RB 5DQHA 4EYHB 2B6GA 2D9TA 1B43A 2VASA 1B4FA 5LJ5d 1JJ2P 3M0QA 4UB3A 1UA0A 1TK5A 1NZBA 1YFNA 3EGXA 4EMKC 3CC7Q 4I2GA 3RH5A 3K75D 3CC2A 2YRCA 2QQRA 4FW2A 4M7DC 1Q82C 3QZ7A 2PVDB 5BPCA 4X34A 5C5JA 3ZBDA 3BDPA 1SF9A 5B66U 3FC4A 1NK7A 2WF5A 1WXBA 3GIIA 1HK9A 2Z0WA 3PR5B 5KFCA 5AKGA 2E5QA 1Z9QA 4IIMA 4M78F 2LC4A 1WHJA 1MMNA 2HDOA 3NASA 3RRGA 2K4EA 4AYBF 1N62A 1O08A 1U45A 2V26A 2HMXA 1ZXIA 2YRDA 3ULRB 1UT5A 4RTXA 5EWGA 3Q8RB 3JCMX 5AKZA 4X9DA 3HFNA 3QXEB 1OQKA 4DLEA 4LDWA 2PFPA 2KFZA 4RTZA 1QQJA 1WDXA 2EQIA 4QZDA 2NO5A 1IGQA 3CPWA 4LD9K 4FL6A 1RDFA 5DBAA 1TS9A 4BY6C 3QWXX 4OCZA 4ED6A 2EKOA 3RIRA 2QA4Q 5GTHU 8ICTA 1PWTA 4HVUA 5GAN4 3QYPA 1WQWA 1VQMA 2P6UA 5J26A 2G3RA 4M9NA 5EE1A 4RT3A 2YUNA 2EIFA 1XS9D 4IR9A 4OB1B 4FCYA 3OSPA 1NKBA 5AKYA 4E7SA 2K4PA 4IQWA 2P0QA 1VUBA 2YMMA 1N8RC 2RJFA 4FZLA 3CC4T 3QUCA 1OU8A 4J9HA 3ETRA 1Q8KA 1MN8A 1OXJA 4RQ2A 4J9SA 1XSPA 1SRMA 3EGDB 1W2BA 2DA9A 2ZUCA 2RA2A 3T5HA 1CEZA 3OYBA 2AJQA 3O0FA 1K1ZA 4PHAA 2DM1A 1ECWA 1F0MA 1QSLA 3TI0A 1T3NA 8ICVA 2MMPA 4C0ZA 4C0DC 5J2JA 9ICIA 1TWBA 1UECA 3SWNA 2KIWA 4E6RA 4C7ZA 1QWEA 1ZUKA 3JCMf 3IG5A 1C6VX 1M3AA 8ICGA 3SENA 2RRDA 1QVGS 3G4ST 2ZUBA 3CC4Q 3WKEA 2CRXA 2VA3A 1HUZA 1QCNA 3TAQA 2JZBA 4PJOB 2C0TA 3NTKA 1ZQOA 4F7UG 3D2QA 1U5SA 5IIMA 1XO0A 2KBTA 1MNEA 4Z88A 3UMBA 3SAFA 5ALLA 5EWFA 3G6EA 4A4FA 1VYVA 3C2MA 3CMAA 2GH1A 1IIPA 1I0CA 2G07A 2A7YA 1SPKA 2DVJA 3CW2C 4B9TA 4IIOA 1KG1A 1X75C 4ED8A 2HQXA 3G4SQ 2F1IA 1KHIA 2CKKA 5ALNA 2ESWA 4Q44A 2XY5A 1UPHA 5HHIA 2L89A 4OMMA 5GAOl 1ZQJA 1PNJA 5KYWB 1YN8A 3EG3A 1L3TA 2XDPA 4FSSA 2MU2A 4QZAA 5AK4A 8ICEA 4HAIA 3CYMA 4PGXA 1PRLC 1IO6A 2LMRA 2RI3A 1SRLA 3UT1A 5KH6A 4HT9A 3S3NA 4YCXA 3OW2A 2ROLA 3UMGA 2ATLA 4IURA 1CKBA 4L6V5 1WQ7A 4OMOA 4E2FB 3HJEA 2OXOA 1J2MA 3BS5B 4P4PA 2K7AA 2RI5A 1ZQUA 4KLUA 4F8RA 2KKPA 2ZIVB 3JPRA 8ICJA 1L7OA 2BIVA 5KFQA 2V1QA 1KSPA 3QUIA 3P8BB 1RYRA 2O6KA 3TSWA 3ONNA 4G9BA 3M7DA 3PW2A 2LDMA 4A54A 1NEBA 5KCOA 3PW7A 4ACOA 4P0QA 2QK0A 5EC7A 3H8WA 4R55A 2WAQF 1OZ3A 5CAIA 5KYXA 2C2RA 4BB7A 3PE0A 1D9DA 2R18A 4DSFA 3LH0A 1AOJA 2P4TA 1Q86C 2WACA 4A4GA 1VQ6T 3EW9A 3PVXA 5KG3A 1QVGP 2P0KA 3SEIA 1XNIA 1WCNA 3OGUA 2HCFA 4IRDA 4DOWA 4F7UE 5KYUB 2KG5A 5J2GA 2PMZF 5DLQE 4C92A 4EMKB 1V85A 4RTWA 3CC2T 3PW4A 1SKSA 1RXWA 2FZCB 2K4YA 4M7DB 3DLLA 4K4IA 4M77G 3QU9A 2L8DA 2NV3A 2HZYA 1MHNA 1RAAB 2QB1A 3RJEA 3DEEA 4O5KA 1VQ6Q 1BPEA 3LWHA 4EEYA 4KLQA 3JB9D 4UATA 3CCJQ 4ELYC 2Y0SF 2FPKA 2KK4A 3VU3C 4Z89A 5DB9A 3DV9A 5J0QA 2B0CA 2KNBB 5D6XA 1Y88A 3CC2Q 1V1CA 5ALOA 4JUVA 1TUCA 1CI4A 1GCPA 4AFUC 1VQLT 1EX4A 5D6YA 3MR2A 3RAQA 3GNFB 4DFPA 2GCXA 2RMOA 5AKLA 2CZ6B 1N63A 1FWZA 2JTFA 1S0MA 4KLJA 3CEYA 2VJ4A 4EELA 5GANf 3NRZA 5JUMA 7ICGA 3RJKA 1COKA 2LCLA 4IRKA 1ZD2P 4MFCA 2DD5A 2NUPA 1SZPA 1AEYA 4BY6B 4F2SA 5KE3A 5ALSA 1VQ4A 3BJYA 2NLUA 4ED2A 3J81E 2DYBA 4BACA 2FE9A 3ETLA 1BI0A 1JQQA 4US8A 4GFJA 1ZX6A 4DSJA 2RNAA 4IUPA 3H7IA 1VQLQ 3UQ2A 3BQ7A 4DL6A 4ELVA 2VV5A 3C28A 3GBQA 3H4DA 4J7IA 1QVFP 4XTVA 4CF3A 1PK1B 3QJYA 3I55A 4E7LA 1W1FA 3MP1A 4XTWA 2W10A 4EYIB 4FT2A 3T9NA 8ICCA 1GCQC 1ZQLA 4J9OA 3NTHA 2BZFA 1C20A 2DL8A 2G5HB 5ALMA 1N48A 4BI8B 1JEGA 2DKXA 4KX5A 2HHTA 9ICJA 1SL1A 4A4HA 2C2DA 2MUTA 4P0PA 3EPGA 1X01A 3J80E 1ZYQA 2JT4A 7ICFA 5GMKj 1N5XA 4NJ8A 4B9LA 5EG2A 3DLMA 3NTIA 1QTMA 1NE8A 3R9KA 2WF9A 1PUZA 5ALVA 2DTIA 4C0DB 2FG0A 4NL2A 4M77E 3KFVA 4RKUE 2X4WA 3REBB 3V7SA 2BCRA 1VQPA 3MDCA 3E0FA 3SDZA 2HHVA 4C92F 2D8CA 2PZ1A 3JB9F 1KDHA 5DB6A 2AIRB 1PD0A 4Q45A 3RAXA 4NXZA 2O2OA 2F2WA 7ICHA 3REAB 1YITT 4M7AC 2DX1A 2WTFA 3OS5A 2F76X 5EOZA 1LB2B 4Y2QA 1Q3UA 1WWVA 2EYZA 3JSCA 3G6ET 4ZTFA 3CCVA 2A3LA 3PSIA 2FL7A 2M9UA 2P0PA 2RJDA 4M75A 3QZ8A 2BCSA 2OAWA 2HQEA 3CMAT 4C0FA 1AWWA 8ICKA 4JZ3A 1ZSZB 2JXJA 2DMOA 1XSNA 1ZRNA 2HL3A 1DK3A 2ZXIA 3QUQA 3F5AA 1U1SA 5HR7A 3RMQA 2GGRA 1RABB 1U48A 2OTJA 1LVKA 1TU0B 1YITQ 4LDXA 1IHWA 4M75D 3OA6A 5ALRA 1JI7A 3MFHA 1S97A 1D3BA 3C0CA 4J03A 3LX7A 2QKQA 1WLPB 4ZN1A 3CMAQ 5AK6A 4OVAA 5FW9A 2J06A 3PIOA 2O31A 2JHDA 4RTYA 3VS7A 1M1KR 2H3ZA 2XICA 1NJYA 1RQLA 1A76A 3PFSA 1TVAA 1KRPA 4K4GA 2EBPA 1KW4A 3KBBA 3KHRA 3FYHA 1ZUUA 2M0YA 1QLYA 1KC8R 2EAMA 4F71A 4EDUA 3A0HU 2DFLA 2OTLT 3OMCA 4FYWB 5C0MA 2LJ1A 2DXBA 2ZIWA 4JLIA 1VQ8A 5GAMf 1GO3F 1YBYA 2FZKB 5AI8A 3QPHA 3H0IA 1WZOA 9ICKA 2ECZA 3X20B 2CUDA 2HL5C 8ICOA 4DLGA 2XVTA 4LDUA 5DDYA 5CJ7A 5IILA 4MF2A 4XAXB 3QU4A 4O3QA 1D0XA 1RAIB 2EGEA 1AWXA 9ICLA 5KE2A 5BOLA 4F50A 3H40A 5GANj 2ZTDA 4Y92A 2NYVA 1U49A 1JO8A 5I2MA 2OTLQ 4HCKA 2BQ3A 3RNJA 2CS7A 2KXDA 1BNPA 1RYUA 2NRTA 3VYHB 4KLHA 2X4JA 4C80A 2EAPA 1ZRMA 4J83A 1ZQVA 1D8BA 2Z7JA 5KFLA 2L0AA 3L2VA 1BK2A 2KHQA 1S0VA 2R5MA 3OYMA 1S72A 5J0YA 3KKAA 3CCQA 3TVTA 5DM7R 2BZ8A 4UC4A 4XA5A 4J9MA 3RTVA 3ME9A 2DQNB 2KT1A 2VIXA 3F70A 1K9MC 4M75F 4RQ0A 5ALHA 3NPFA 3T5LA 4OJPA 3SMVA 3ASKA 3OYFA 3AQEA 2JNGA 4C8QA 4IQUA 3MFIA 5L9XA 2AGPA 4AT1B 2LI6A 2CZ1B 1UT8A 1KL9A 1FYNA 2MF2A 1NZPA 3HT3A 5KT3A 2CXYA 2YHTA 2JN0A 1YIJA 4ORZA 3V72A 4M9GA 7ICVA 5HMMA 4KLGA 3Q1JA 4FBUA 4RQ5A 2PI4A 2I9GA 1LKYA 3Q8SB 4O3OA 3M0SA 4C8QD 4CC3A 3HP6A 4TUSA 2ES6A 2DAQA 4OD0A 3HPWA 5J2DA 5LJ3h 1PVQA 4EX7A 4MZTA 2JEJA 2KVSA 1RPLA 3TAPA 4UAWA 2DPIA 1UGPB 5L23A 4LUEA 5KFPA 4LUDA 2DF4B 1PRMC 3A5ZB 3E19A 4PGQA 1S0OA 5IHIA 3VJPA 2B21A 4NL9C 3NS1A 3PY8A 1T3SA 2HAXA 2QLTA 3CC7A 3BY7A 1ZD5A 4F4ZA 1IRXA 1EFNA 4HXJA 2V8IA 5KTQA 2JEIA 1O03A 3CXCP 1EXNA 4Y2PA 1UTIA 8ICHA 1OULA 5AIAA 4B9NA 3OYEA 4B9VA 4IKFA 5HNKA 5KT7A 3EFRA 2W3RA 1LOJA 2DKGA 4JRKA 1VQPT 2MSNA 1M6YA 1PD1A 4KULA 2BCVA 2JS0A 3OHBA 2AZVA 1VQ7T 5C0YA 5KFUA 3OYNA 3CRXA 2ZJAA 1ZQTA 1SKUB 4F93B 4M7AB 3FJPA 4IUUA 3CBOA 3OJSA 2JUFA 1ZQZA 1KQSS 3EPIA 4ECXA 1NNLA 4RQ7A 5J2AA 5GAMj 3NMZC 4J7FA 2KFNA 2W8KA 2RHXA 3D2NA 2A1JA 4OJOA 1RI0A 4ZN3A 2X51A 4JUZA 3M6KA 2ZTCA 2RHUA 1VQPQ 5KFZA 2HBMA 9ICPA 5AM2A 1ZQQA 1LPLA 5AKXA 2QG9B 3I5SA 5KG2A 4IUTA 2LHTA 4RUGA 2QA4A 4DFKA 3S3MA 9ICXA 1VQ7Q 3WK4A 1ZQKA 3HKZF 1K1QA 2OTJT 3LW5E 1J2NA 4A8EA 1B22A 2R57A 4PJNA 3VYGA 3M9MB 1PHTA 3HP9A 2BQRA 2KTQA 3EH2A 4BX9C 4FM4B 4ED3A 2RB6A 1I5OB 5KG7A 5CO7A 1K8AR 3EUB2 9ICOA 2PUKB 1M3BA 1H8KA 1SXDA 4KLFA 2PFQA 4EBCA 2J6SA 7ICEA 2L2PA 4DQSA 5KL8B 2QI2A 1V38A 4R66A 3AM9A 2EQUA 3GILA 2Y4XA 4Z6FA 2K57A 2OTJQ 2DIGA 4XTZA 2AU0A 4JLGA 4NS5A 2LPEA 1OX9A 3UDCA 2FEIA 2ZPIB 3CD6T 1M1KU 3SV4A 5HK3A 4ZGJB 1D8YA 2BPCA 2XY7A 3RJJA 1X2IA 1ZQRA 2K4IA 1HEKA 3ZFJA 4CRIA 4E7HA 1M90C 2FMPA 2J05A 5LJ5f 2L3SA 1Y07A 2YSQA 1PZNA 2JS2A 4A4EA 3CC4A 4IL6U 1L3UA 3ER0A 1KC8U 3D7SB 3IP4B 4NL3A 1MGQA 1TG0A 1KFDA 4PHDA 3QEBZ 2JTEA 1BIBA 4LD6A 4C5GA 2N1RA 2HKNA 3EG9B 3WVDB 3CD6Q 3HPOA 1TH7A 2JH1A 4G3IA 2KGTA 2QB0B 2QQBA 3D6JA 4F16A 2W9BB 1KQSP 3K1ZA 4YR3A 2XCAA 5DLFA 2A3VA 5KL1B 1KD1R 3G4SA 1JX4A 2FRYA 2O01E 1S72T 2I0NA 3AL0B 4GC6A 4RNOA 3BDLA 4DL7A 4BD3A 2IA6A 4UBBA 2BZXA 1RM6C 1EIFA 1QKXA 4F14A 5KT6A 5GAN8 1MSWD 4P5NA 3HW8A 2DJQA 2OAUA 5JU5A 4P2HA 3C21A 1PM3A 4M78A 1QMCA 4C5HA 3VUZA 3QSUA 3ISDA 4OJ5A 4M7DF 4DS4A 5J0RA 5CKDA 2K8AA 2C28A 4XRHA 2R8GA 4LZDA 4DQIA 5D46A 1HJDA 3EYZA 1S76D 5T14A 1PG5B 3OHAA 1KK7A 1B3QA 1ZBJA 2EJFA 3PW5A 4J9QA 3X28B 4ED7A 2ABLA 5ALDA 3MGHA 1QCFA 4RTTA 1VQ9A 4F5PA 1Q95G 2KZ3A 1YIJT 4RQ8A 4M77C 4M78D 5CB1A 2KR3A 4NM2A 1NBEB 2HMAA 3QNMA 2XY6A 1BKBA 3JRZA 3L2RA 2CP5A 2YX8A 4QVZA 1M1GA 8ICSA 3H6ZA 3KXTA 5KNIA 2BE7D 1TSFA 4MMKA 2Y90A 2JTMA 3EFOA 5IN1A 7ICNA 1OEBA 5LJ3g 4BE2A 3INZA 3FM9A 3TREA 3T3FA 2EGAA 3C5GA 1GXIE 3PGGA 3M8RA 4FIBA 5GAN6 1U4BA 1YIJQ 3UM9A 3H8SA 4E47A 1NPRA 1KBUA 5KFOA 7ICMA 3BE3A 3H41A 1N60A 2P6RA 7ICIA 5L1MA 1JUDA 1OPKA 1G5VA 2LM1A 3VV0A 3MP8A 5DLOA 4R0KA 3BQ2A 4USAA 1YNZA 3KUFA 2VWFA 2H3FA 4YMOA 3HWTA 2J6FA 3JB9G 4MFFA 5AI0A 5ALFA 3E2EA 3HSBA 1BPBA 3AU6A 2X9HA 1DOQA 2KVQG 3JAME 9ICBA 3C2KA 1ZQHA 1I8FA 3N7SC 3M5AA 3FC3A 2M1HA 2MUTB 4KGXB 3GLXA 2ESEA 4AMCA 1XSLA 2A28A 3CCJA 4MDWA 4YG2A 3NUQA 9ICMA 1WUDA 1B34A 4D8DA 1JJ2A 1Y57A 2D8HA 4FZNA 3RRHA 1JXMA 1VIFA 3PX6A 3PSFA 1ZJMA 1ED1A 5HK0A 2GBQA 3QG1A 1WA7A 2E6ZA 3JCMQ 1X9XA 5DG9A 4I2AA 2E3IA 2CH4A 2VVKA 1A0PA 4JK1A 4C0GA 2MYSA 5LJ5j 1KEJA 4BWMA 2W0ZA 4UB1A 3PMIA 1L8OA 2HI0A 3Q8LA 4ECZA 3E9GA 3M53A 1SGGA 4L5GA 2COWA 1N9SA 9ICFA 5IHNA 3X25B 5GAN3 2QA4T 5AI4A 4KN7A 1KLNA 3B0YA 4HVWA 3V7RA 4M47A 2NRWA 3SD7A 2W8LA 1FMVA 2EQMA 2V4RA 2DF6A 3VKIA 1VQLA 4OMQA 4OJ6A 5L1IA 4F7UB 4BDPA 1YT3A 5CRXA 1X9SA 2LYAA 5J2FA 2FMQA 4FZMA 2AZSA 3QDRB 4Y28E 4QVCA 4E7KA 3OQ5A 2Y9UA 3EG0A 1RLPC 3V7JA 1VYUA 2YN4A 5GMKi 1ABOA 2LKYA 2XC9A 4YTLA 3PT9A 2KXCA 1QKWA 2H3QA 2DE0X 2OI3A 3RR6A 1K8AU 2KE7A 2KROA 1WWUA 3RESA 2VJ5A 2EJGA 4OMFB 3WK6A 5EWEA 4I2BA 2QDYB 4C92E 4EZ6A 4O5EA 2DUYA 3S6WA 3CPWP 1HUOA 4OB0B 5F3XB 1GBQA 2EYYA 4KH1B 2H5XA 3N28A 1QVPA 1RYSA 1NK4A 1ZQSA 4JJNK 3H0LB 2C0OA 3CPFA 5IAYA 3G6XA 4DBRA 3RBBB 1BNOA 3MEAA 2K2VA 3NVWA 3CBPA 4J6YA 3H8MA 5GAOq 3OW2S 4OMPA 1AROP 2V1RA 1K0XA 2O4XA 1UCVA 2HBJA 2Q0ZX 4JRIA 4RG8A 1OOTA 4RQ6A 3N7RC 4O0IA 7ICRA 4M6WB 4QZIA 3WU2U 1NJIC 1BYMA 4M75G 2XK0A 1R0BG 4QZHA 2NUTB 4KLDA 4J6XA 1W2BP 2QAZA 1BCOA 4BDZA 2L5QA 4FFDA 2RDIA 2QARB 2EWNA 5DQIA 4JMUA 1YITA 3RR8A 1MNDA 9ICQA 4QZFA 4R8UA 3GNGA 3AQFA 1IM4A 2XMFA 1NJWA 1KD1U 1QCOA 2YMLA 5G5HA 1SV0A 3OJUA 4GXIA 2YDLA 4JJDA 4OMNA 1ZSZC 3MABA 2FPLA 2J6KA 4J9FA 4B9XA 2QDLA 1SWVA 3OSSC 2DVEA 1YJWA 5GJVB 5AM0A 4MF8A 2KHVA 2CT3A 2JMCA 1VQ9T 1TE2A 5CCAA 5LJ3e 4M77B 1N27A 4PJMA 4J9CA 1Y96B 5KG5A 4ME7A 1NK8A 5AICA 2QQSA 2HEQA 3ORYA 3HRUA 1Y71A 3O5ZA 2KRNA 4DQPA 4CNQA 5FRMA 2ASLA 5GJWB 5DG8A 2H3VA 4PHPA 2PTKA 4BGDA 2LQKA 1FFUA 2D6FC 1GRIA 2E1EA 3M0TA 1L7MA 4ELUA 4Y2SA 4DBQA 2C22A 1VQ9Q 1X6IA 1GFCA 3FDRA 4XQ3A 1VQKA 3OS0A 3J81j 4DO9A 4OB2B 2DWQA 2OTLA 2FVUA 2KN7A 2ZPHB 2VA8A 4BXOB 1X2KA 4JJBA 4LNPA 1JN3A 1WJQA 4C7YA 1QVFS 3UA6A 2J6UA 5DDMA 4JDSA 3PW0A 3I56T 1K73C 5J2KA 3Q8KA 3OW2P 1DGJA 4GXJA 1Z00B 2EW3A 4UB5A 1UEBA 3EG1A 3GF5A 5L1JA 3L2UA 2ZPFB 2F2AB 5LJ3d 4NM1A 3OYHA 3GV7B 1PCXA 3N5BB 1JBMA 2D0NA 3HL8A 4J6WA 4M75E 2M02A 2G0AA 4DWIA 1BPDA 2HHSA 1NK0A 5CK9A 1TAQA 1K0SA 4J9NA 3IG8A 2BUDA 3N97B 2D1XA 3HKSA 2K89A 1QVGA 3LK9A 3CCJT 7ICUA 2ZIXA 5TZVA 1H641 4MHVA 5AKJA 4E7IA 4J8OA 4UW9A 3I56Q 3UQ0A 1SL2A 3WK5A 4K4HA 3AUOA 1TXQA 1ZQAA 2YXYA 2HHQA 4C8QG 2XHCA 4MFAA 4QZ9A 4UBCA 2C2EA 4FT4A 3GOXA 5GAN5 1QP3A 5AM1A 4LN2A 5IXFA 2W9CB 1K76A 3C23A 2HSPA 4PFOA 1XC9A 4O6JA 1OU9A 4RQNA 4O5CA 1U1TA 4JV1A 2PKEA 4C92D 1BPXA 4EIKA 2W9AA 4QZBA 3M56A 8ATCB 4M7AF 3SAHA 2KSOA 2F3NA 4ZOHC 2Y4YA 1UE9A 3SEMA 4B9UA 1WHLA 2G6FX 1WG8A 2AGOA 2XDDA 2Y9TA 1Q7YR 4EZ9A 1SWWA 5KFIA 3PO5A 3FEOA 3MEWA 1BI1A 1KJWA 2I2LA 2J6TA 2EYWA 4XQ8A 1L3SA 3RDVA 1Z3EB 2GWSA 1V9PA 2BKEA 8ICNA 2W03A 3QUBA 5GMKm 4RU9A 2YY6A 2RQTA 4OP0A 2W7OA 4CC7A 1QSYA 3M0PA 2MI6A 2A1AA 4F5RA 2M0OA 5KYWA 3ISCA 2BDPA 3QUTA 1G2BA 2W54A 3V7KA 1HJPA 4O3MA 1AQ6A 3MEVA 3HRTA 2LBOA 2LCSA 5HKCA 1NI3A 2L3RA 3U23A 3VS2A 1XJWB 2I1QA 5D49A 2KICA 4DOCA 2HBKA 2GLEA 1M27C 2M0NA 4KUIA 1XU4A 4B9WA 2KYBA 4EX6A 1N61A 4RNNA 4DSLA 1X66A 1K1SA 4D8KA 3AMZA 2A36A 1J3TA 5AYFA 1BB9A 1PVPA 1U06A 5DY9A 4BUGA 1DJ7B 5KT2A 1ZJNA 1ARKA 1ZQPA 5M9OA 1UGSB 1RAFB 4KBMB 4OGEA 1MQ2A 2K3XA 4CDGA 4HCZA 2NYSA 4I2IA 3K4GA 2DGZA 8ICXA 3TU4K 1UJ0A 4NLGA 2GQVA 3KZIU 4Z8AA 2RK2A 3ZDDA 3JV3A 2WFAA 1HD3A 1OV3A 1QW1A 3JCMb 2LJ3A 1KFSA 2XD0A 3LGLA 4C8QE 2EZXA 4BE0A 3T5JA 2VKQA 3LLRA 5IIJA 2OWOA 2CP2A 2MPXC 2LNHB 1VQ7A 1SB3C 3MHXA 3CNHA 1WJSA 4CE6A 2LT1A 4N0AA 7ICJA 4PPXA 2VGNA 2DERA 3SWNC 1WHKA 1Z1BA 1MMDA 5KFHA 2AQ4A 1D8LA 4HKEA 2K4HA 4Y2JA 3JPQA 1SSFA 4BDYA 5H2FU 5J0TA 4ECVA 2HKQB 2K6DA 3RJGA 1L7NA 1MMAA 7ICSA 3C94A 3RR7A 4EMHA 1COOA 1JB0E 1K4US 2MCNA 1QLNA 2EJ9A 2HBWA 5KT5A 1YJWT 1Y7XA 5KFJA 3S3OA 2D8JA 2DJZA 4F92B 1RQNA 4M78B 1NEGA 8ICBA 1HSQA 2E64A 4J9DA 5CR2A 2ZPGB 1O75A 1JRPA 5AM5A 3QHSA 3M9NB 5IIOA 4Y2YA 5CKFA 1WGSA 3CMET 3RFAA 4TQSA 1VLBA 5J0WA 3PV8A 5G5GA 8ICUA 1OI1A 1YI2Q 3X26B 1O9SA 4ED1A 4CF4A 5CKHA 1NJXA 4Z6CA 8ICYA 2E1FA 4CGZA 1KFTA 1S5LU 4RPXA 2UVVA 2DLPA 4QWAA 2DL3A 1UG1A 2LVMA 2SEMA 1YJWQ 1M90R 4FE3A 1YWOA 5TISU 1BI3A 3M9QA 5DKWA 2B86A 2O9VA 2NUZA 1VQKT 4RQ3A 2ZPEB 1WHHA 5A0DA 7ICKA 4WCIA 2XG8D 3CMEQ 5GMKl 3V6JA 3CD6A 2XKOC 1ZQGA 3EFOB 4JJCA 3OS1A 1ZQ1A 3UXOA 3QE9Y 2YMQA 2EFIA 3RBDA 3KOOA 4QQDA 5KFXA 2FO0A 2HDAA 3KTQA 4MZPA 1IG6A 1Z9ZA 3ZDBA 4BJQA 2E41A 2I6XA 2F5KA 2MRLA 1AWJA 1T94A 1CKAA 1JALA 5ALQA 1AT1B 1VQKQ 5KYYB 4YQWA 1KQQA 2LQ8A 1J97A 2CP7A 3EGDA 4FBTA 2A19A 3CXCS 3QEAZ 1L6NA 2RI2A 2CREA 2JZ2A 4QIWC 5L1KA 3SZ2A 9ICSA 2Y1JA 1X2QA 1VIEA 4M78G 5ALKA 4X1VA 1GBRA 1HXDA 4O3SA 3MBYA 4R64A 1GL5A 4QNLA 2FDRA 1LVHA 1ZBXA 1UDLA 1KKXA 5ALGA 4R56A 3A8OB 5J3BA 1A77A 2F77X 2KNJA 3C1YA 3GIKA 3EGXB 2OCEA 1TV9A 2DXUA 3G71Q 4PJOA 1LCKA 1K9MU 2G5IB 4YR2A 3E1SA 2O9SA 2FRWA 5ALWA 1NZ9A 3SD4A 2BR0A 3LWIA 3I9QA 3PSTA 4J9GA 1LV5A 4CF5A 3TARA 2GFUA 1FMWA 4HCCA 4QW8A 3QZ5B 1SV4A 1M5Q1 2R5AA 2CYZB 1BGXT 3MDAA 2E5KA 4C8LA 3JB9J 5E79U 4PJOD 2F8LA 5KG1A 4GIBA 2KZMA 2BPFA 1KHCA 2DD4A 2K2MA 3Q8MA 1Q7YU 1E7OA 4YR0A 2BCQA 1ZQCA
chains in the Genus database with same CATH topology
1U8RA 5FU6C 2FHDA 3EFSA 3QJ6A 2ZIVA 2E65A 2E10A 2FYKA 2ZPBB 4N4HA 4M78E 2KDSA 2ZGWA 2WB1C 4QJFB 2RM4A 1FXXA 1FX7A 1A6SA 2VXFA 2B8AA 4L59A 2VUBA 1CRXA 3G7ZA 3OYAA 3SWNB 5J39A 1ZHIA 3JCMP 3OB9A 3BFMA 4EMKA 4XTUA 3PIPA 4M7DA 5GAN2 3JCMh 4PJOF 4BE1A 2BKDN 4KX3A 4M75C 4XTYA 1YJ9T 3OYCA 2QQAA 3PNWC 2G06A 4M7DD 2EYQA 1QP2A 2PVOB 2RHYA 2MAMA 3V8JA 4M77F 1UGRB 3C29A 5GMKh 4U7CA 4LDYA 2RH2A 3OS2A 3SB2A 3CCSA 1M90U 1P92A 2ZIUA 3D2SA 5L8RE 3QZ9B 2RHZA 3M55A 5CQXA 3MCAB 4P0QB 3CCLA 4WJ3B 3WVEB 1RL2A 3ZEHA 3OSVA 3MO8A 2OM6A 3LVWA 1KC8C 3LYSA 4QQGA 3URGA 4C92B 1VQ5T 2CGHA 4JS4A 3QKJA 4IUVA 2XDBA 2DTOA 2PVGB 3JCMV 2HOIA 2HOQA 2XI9A 3H0MB 3M6ZA 3JB9I 3L2QA 4DA4A 2JMGA 2E6NA 1G3SA 3H8ZA 2HD0A 2DZ9A 1VQNA 4C8QC 4XU0A 4MMLA 2WSEE 5KCHA 2YLCA 2X4YA 5HY6A 2K5LA 4EPCA 5FRNA 5FU6B 5GAOr 5GANh 1YHQT 3L2ZA 3RUXA 4OJLA 5IT9E 3OY9A 3CCMT 1MA7A 3I56A 4C92G 1G3TA 3CPWS 2VYTA 4RMOA 3NRWA 2GFAA 4P0PB 1Q81U 2LTOA 4Z02A 2LNVA 2LCCA 3PSPA 2VXEA 2PU9B 1Q82U 3QYGB 2K5FA 4QQ6A 1W2BS 1N6AA 1VQOT 2VC8A 3JCMg 4N4GA 1IREB 4XU2A 3JCMJ 2OH2A 4C5IA 4M75B 3V8LA 1V29B 1URJA 2K8CB 4PL6A 5CIUA 4U6PA 3QO3A 5GAOm 3CCUA 3BDUA 2KMTA 3CCRA 5D6WA 1D3BB 3N7PD 5LJ3f 1BI2A 3AHUA 3L3FX 3LYIA 1XNSA 2JOYA 3CCST 4HT8A 1N8RU 3MP6A 2QTXA 2ZIWB 1K8AC 2XU8A 2RJEA 3CCLT 4X9CA 3HHTB 5GAMh 1NJIU 2G08A 1UB4A 4MDXA 2IG0A 3L1AA 4J5YA 3A8MB 2RP5A 3KZXA 3F53A 3RKWA 4M7AA 3EAEA 4RG2A 1YI2A 2JH7A 1PSFA 2H3IA 2DIQA 2E5SA 4QW2A 3PZPA 3L2WA 3MEUA 1KQ1A 1N9RA 4M78C 4ZTJA 2KJ8A 3UWNA 1M4ZA 1VQNT 4AYBC 4ZGDB 4C8QB 4M7AD 3CMEA 3M4YA 1KD1C 1XOVA 1W4SA 4MZMA 3T79A 3VUBA 1I5LA 2JVVA 4CRXA 3GU3A 1LJOA 5GANg 2HNIA 4XTXA 3JCMc 2W04A 2DTHA 3GZFA 1K73U 2YRVA 3OYIA 1YJNT 4PLLA 3MGVA 1IZ6A 4OB3B 1Q86U 4Y91A 2V8JA 3G71A 3F5EA 2RHFA 3M57A 3A8GB 5FU7C 2WSCE 5I2SA 4PJOG 5LJ3j 3JCMe 5GAOn 3GP8A 4GLKA 3RKXA 3DKMA 3GIBA 3X24B 3TCJA 3UPUA 3LGFA 3E9FA 2KVCA 2GOLA 5I21A 3C95A 2DZCA 3DB4A 2G09A 2FB7A 4NWIA 3A8LB 4PL1A 3OYJA 3CCUT 2MWPA 5GMKe 4N4IA 3QIIA 3CCRT 3JCMd 4V2SA 3F2DA 3F2CA 2V8KA 4NLCA 2QXFA 3WXMB 2IVWA 1QVFA 1OUQA 2D0QB 2E1HA 4D6WA 4CI0C 2YB1A 5FROA 3BW1A 4IUQA 2H3JA 2HBPA 1VQMT 4KT0E 4PJOE 5A0GA 3OYLA 3OYKA 2WAQC 4RCCA 1JRIA 2KEYA 4NLBA 3PMTA 2ZIUB 2DXCA 5GAMg 2QEXA 4M7DG 5LJ5h 3R6OA 4NV0A 2C06A 1I4K1 2PMZC 4E7JA 4OF1A 4QIWF 1YI2T 2WSFE 1BIAA 5GAN7 1F44A 1H3ZA 4OGCA 1YJ9A 2Y0SC 2PUOB 1KQ2A 4BI4A 2YLBA 4DQ2A 1LNXA 2W7PA 3L42A 5GANe 5CKBA 1WPYA 3FLGA 4Q5WA 3KBGA 4F7UA 5FLXE 3VC8A 4BI3A 2M16A 1G3YA 2F69A 2Q4TA 3RKYA 4QVDA 1WJRA 1UGQB 5GAOp 1G3WA 3CBMA 2ZCFB 4XU3A 4ATOA 3F2BA 2KJ5A 3SFMA 3OYYA 2QQ9A 2MWOA 4LDVA 2DEQA 4M7DE 3G71T 1M1FA 5GANd 3CCEA 5FU7B 3V8KA 2WB1F 2KKVA 4ELZC 2LYBA 4FU6A 3C4SA 2HBLA 4C92C 2VGMA 1VQ5A 1B34B 2DK3A 4II1A 3J7AF 3V7CA 3M58A 1NPPA 2CZ7B 4O5VA 2JGAA 5LL6S 2YB4A 3KFUF 2LT4A 2KD1A 1M9SA 1R8OB 2RHIA 1YCYA 4ZGEB 4JS5A 5CKEA 4M77A 1Y96A 4HCBA 3ICXA 4KMOB 3M59A 4F7UF 3NFCA 3SQIA 1Q3VA 3RMSA 3M54A 1M8VA 1YHQA 3FIFA 4M77D 1Q7YC 2E70A 3CCMA 4RCBA 2K5IA 1VQ4T 5GAMe 2EQJA 2EQKA 2EAYA 3CXCA 3RERA 2RD1A 3I55T 3LVVA 3FRNA 3QBYA 2QEXT 5LJ5g 2O4XB 3OPXA 3PTAA 2CN1A 4TVRA 1XQHA 3GPLA 1OZ2A 1TAMA 3FB9A 1PVRA 2LX9A 4NOYA 4JRQA 5GAMd 1VQOA 4N0AC 3O8VA 3HRSA 2K3YA 1X6OA 1HIWA 1SZHA 3CCVT 2XIDA 5CVIA 4VUBA 3CP8A 2KOBA 2DXTA 2PQWA 3TEEA 4FSXA 2ZG6A 4C8QF 3DB3A 4XU1A 2KY9A 3OBYA 1OYXA 4A53A 3HFOA 4GY5A 3OBWA 4A4KA 4OO1J 1WNLA 1I81A 2GF7A 3QYHB 3IN5A 1ZQ1C 2CPRA 1DRGA 3P8DA 3CCET 1M1KC 2R58A 1VQ8T 2RJCA 4ICAA 2KJ9A 4M7AG 2OYYA 1XTDA 5HR6A 1KQSA 5A0LA 2AHJB 4PNOA 3OYGA 4IC9A 2ZIXB 2E12A 3SAGA 3OYDA 4XK8E 2KV2A 3C12A 4EMGA 2LRQA 4PLIA 2KQWA 3CCQT 4PJOC 3OMGA 1JJ2S 2K8BB 3HKZC 2MA1A 4DOVA 4PKCC 3A8HB 1P7DA 3JB9H 4JRPA 1AHJB 5A2QE 2DO3A 2D6FA 4C5EA 1Z19A 4KUDK 2ZXHA 3M4GA 3JCMW 2RO0A 2BDUA 2KSSA 5LJ5e 2ZZDA 1YJNA 3META 2RK1A 4M7AE 1PSEA 3ALRA 2HOFA 3RF9A 4HA8A 2DPPB 2F5TX 3CC7T 2KAFA 4WF2A 2X35A 2CZ0B 3VCBA 2X4XA 3P8HA 4PL2A 5CQYA 1VQ6A 1Q81C 3H0RB 2D9TA 5LJ5d 1NZBA 4EMKC 3CC2A 2QQRA 4M7DC 1Q82C 2PVDB 4X34A 3ZBDA 1HK9A 2E5QA 4M78F 2LC4A 2K4EA 4AYBF 2HMXA 3JCMX 4X9DA 3HFNA 3QXEB 4LDWA 3CPWA 4LD9K 4FL6A 4BY6C 2EKOA 3RIRA 5GAN4 1WQWA 1VQMA 5J26A 2G3RA 2EIFA 4OB1B 2P0QA 1VUBA 1N8RC 2RJFA 4FZLA 3CC4T 1W2BA 2RA2A 3OYBA 3O0FA 1ECWA 2MMPA 4C0ZA 4C0DC 3SWNA 2KIWA 3JCMf 3IG5A 2RRDA 1QVGS 3G4ST 2CRXA 4PJOB 3NTKA 4F7UG 3D2QA 1XO0A 3SAFA 3G6EA 4A4FA 3CMAA 2GH1A 1IIPA 2G07A 2A7YA 1KG1A 1X75C 2HQXA 1KHIA 2CKKA 1UPHA 2L89A 5GAOl 2XDPA 3CYMA 2RI3A 3UT1A 5KH6A 4HT9A 3S3NA 3OW2A 4IURA 4L6V5 1WQ7A 2OXOA 2RI5A 2KKPA 2ZIVB 2BIVA 3QUIA 3P8BB 3ONNA 3M7DA 2LDMA 4A54A 5KCOA 4ACOA 4P0QA 4R55A 2WAQF 1OZ3A 5CAIA 4BB7A 2R18A 3LH0A 2P4TA 1Q86C 2WACA 4A4GA 1VQ6T 2P0KA 1XNIA 4DOWA 4F7UE 5DLQE 2PMZF 4C92A 4EMKB 3CC2T 2K4YA 4M7DB 3DLLA 4M77G 2L8DA 2NV3A 1MHNA 3DEEA 3LWHA 3JB9D 4ELYC 2Y0SF 2KK4A 3VU3C 5D6XA 4JUVA 1VQLT 5D6YA 3GNFB 2GCXA 2CZ6B 2JTFA 1FWZA 3CEYA 2VJ4A 5GANf 2LCLA 2DD5A 4BY6B 5KE3A 1VQ4A 2NLUA 3J81E 4BACA 1BI0A 4GFJA 4IUPA 2VV5A 3C28A 4J7IA 4XTVA 3QJYA 3I55A 4E7LA 3MP1A 4XTWA 4FT2A 3T9NA 3NTHA 4BI8B 2G5HB 4KX5A 4A4HA 4P0PA 1X01A 3J80E 5GMKj 5EG2A 3DLMA 3NTIA 1NE8A 2DTIA 4C0DB 4NL2A 4M77E 4RKUE 2X4WA 3V7SA 1VQPA 3SDZA 3E0FA 4C92F 3JB9F 4M7AC 1YITT 3OS5A 2F76X 4ZTFA 1Q3UA 3G6ET 3JSCA 3CCVA 2A3LA 3PSIA 2FL7A 2M9UA 2P0PA 2RJDA 4M75A 3CMAT 2HQEA 4C0FA 2ZXIA 3F5AA 1U1SA 5HR7A 3RMQA 2OTJA 4LDXA 4M75D 3OA6A 1D3BA 3LX7A 4ZN1A 4OVAA 3PIOA 2JHDA 2H3ZA 2XICA 3PFSA 4EDUA 2OTLT 3OMCA 5C0MA 2DXBA 2ZIWA 4JLIA 1VQ8A 5GAMf 1GO3F 1YBYA 3QPHA 3X20B 2XVTA 4LDUA 4XAXB 5KE2A 5GANj 5I2MA 2CS7A 3VYHB 2X4JA 4J83A 1D8BA 2Z7JA 3L2VA 2KHQA 3OYMA 2R5MA 1S72A 3CCQA 5DM7R 4UC4A 3ME9A 2DQNB 2VIXA 3F70A 1K9MC 4M75F 4OJPA 3SMVA 3ASKA 3OYFA 3AQEA 2JNGA 4C8QA 2CZ1B 2MF2A 2YHTA 2JN0A 1YIJA 3Q1JA 5C6SA 4C8QD 2DAQA 3HPWA 5LJ3h 1PVQA 4MZTA 1UGPB 2DF4B 3A5ZB 3E19A 3VJPA 2HAXA 3CC7A 3BY7A 2V8IA 3OYEA 4IKFA 3EFRA 1LOJA 2DKGA 4JRKA 1VQPT 4KULA 1VQ7T 5C0YA 3OYNA 3CRXA 4M7AB 3FJPA 4IUUA 3CBOA 1KQSS 2JUFA 5GAMj 4J7FA 2RHXA 3D2NA 4OJOA 1RI0A 4ZN3A 3M6KA 2RHUA 2HBMA 3S3MA 4IUTA 2LHTA 2QA4A 3HKZF 2OTJT 3LW5E 2R57A 4A8EA 3VYGA 3HP9A 4BX9C 4FM4B 2RB6A 5CO7A 2PUKB 5KL8B 2QI2A 2EQUA 2Y4XA 2K57A 2DIGA 4XTZA 4JLGA 4NS5A 3UDCA 2ZPIB 3CD6T 1M1KU 5HK3A 4ZGJB 3ZFJA 2K4IA 1HEKA 4CRIA 4E7HA 1M90C 5LJ5f 1Y07A 3CC4A 4A4EA 3ER0A 1KC8U 3IP4B 4NL3A 1MGQA 1BIBA 4LD6A 4C5GA 2N1RA 3WVDB 1TH7A 2JH1A 2QQBA 3K1ZA 2A3VA 5KL1B 3G4SA 2O01E 1S72T 3AL0B 3BDLA 4BD3A 1EIFA 5GAN8 4P5NA 2OAUA 4M78A 4C5HA 3VUZA 3QSUA 4OJ5A 4M7DF 5CKDA 2K8AA 5T14A 2EJFA 3X28B 1VQ9A 1YIJT 4M77C 4M78D 1BKBA 3JRZA 3L2RA 2YX8A 4QVZA 1M1GA 3H6ZA 3KXTA 4MMKA 2Y90A 2JTMA 5IN1A 5LJ3g 4BE2A 3INZA 3TREA 1GXIE 3PGGA 4FIBA 5GAN6 4E47A 1NPRA 1KBUA 1G5VA 3VV0A 3MP8A 5DLOA 3KUFA 2H3FA 3JB9G 3HSBA 2KVQG 3JAME 1I8FA 3M5AA 3N7SC 3FC3A 2M1HA 3GLXA 3CCJA 4MDWA 3NUQA 1WUDA 1B34A 1JJ2A 4FZNA 1VIFA 3PSFA 1ED1A 5HK0A 3QG1A 3JCMQ 2E6ZA 1A0PA 4C0GA 5LJ5j 3PMIA 3E9GA 3M53A 4L5GA 1N9SA 3X25B 5GAN3 2QA4T 3V7RA 2EQMA 3VKIA 1VQLA 4OJ6A 4F7UB 1YT3A 5CRXA 2LYAA 4FZMA 4QVCA 3QDRB 4Y28E 4E7KA 3OQ5A 5GMKi 2LKYA 4YTLA 3PT9A 2H3QA 1K8AU 3RESA 2VJ5A 2EJGA 4OMFB 2QDYB 4C92E 3S6WA 4OB0B 1QVPA 4JJNK 3H0LB 3CPFA 5IAYA 3MEAA 2K2VA 3CBPA 4J6YA 5GAOq 3OW2S 2O4XA 2HBJA 4JRIA 4RG8A 3N7RC 1NJIC 1BYMA 4M75G 2XK0A 4J6XA 4BDZA 2L5QA 2EWNA 4JMUA 1YITA 3GNGA 3AQFA 1KD1U 4B9XA 3OSSC 2DVEA 1YJWA 2KHVA 1VQ9T 5CCAA 5LJ3e 4M77B 1N27A 1Y96B 4ME7A 2QQSA 3HRUA 1Y71A 5FRMA 2H3VA 2LQKA 2D6FC 2E1EA 4XQ3A 3FDRA 1VQKA 3OS0A 4OB2B 2OTLA 2FVUA 2ZPHB 1WJQA 1QVFS 1K73C 4JDSA 3I56T 1UEBA 3GF5A 3L2UA 2ZPFB 2F2AB 5LJ3d 3OYHA 3N5BB 1JBMA 3HL8A 4J6WA 4M75E 2G0AA 5CK9A 3IG8A 2BUDA 3HKSA 2K89A 1QVGA 3CCJT 2ZIXA 1H641 4E7IA 4J8OA 4C8QG 2XHCA 4FT4A 3GOXA 5GAN5 1QP3A 4O6JA 1U1TA 4C92D 3M56A 4M7AF 3SAHA 2Y4YA 2XDDA 3MEWA 3FEOA 1BI1A 2I2LA 2W03A 5GMKm 4OP0A 2W7OA 2MI6A 2M0OA 4O3MA 3MEVA 3HRTA 2LBOA 5HKCA 2L3RA 2KICA 2HBKA 2M0NA 4KUIA 4B9WA 5AYFA 5DY9A 1PVPA 4BUGA 1DJ7B 5M9OA 1UGSB 4OGEA 4KBMB 2K3XA 4CDGA 4HCZA 2DGZA 3TU4K 2GQVA 2RK2A 1QW1A 3JCMb 2XD0A 3LGLA 4C8QE 4BE0A 2VKQA 3LLRA 1VQ7A 3MHXA 1WJSA 2LT1A 4N0AA 2VGNA 3SWNC 1Z1BA 4HKEA 2K4HA 1SSFA 4BDYA 3C94A 4EMHA 1JB0E 2EJ9A 1YJWT 1Y7XA 3S3OA 2DJZA 4M78B 2E64A 5CR2A 2ZPGB 1O75A 3QHSA 5CKFA 1WGSA 3CMET 3RFAA 1OI1A 3X26B 1O9SA 5CKHA 2E1FA 4CGZA 2LVMA 4FE3A 1BI3A 3M9QA 1VQKT 2ZPEB 5A0DA 2XG8D 5GMKl 3CD6A 2XKOC 3OS1A 1ZQ1A 2EFIA 4QQDA 4MZPA 4BJQA 2E41A 2F5KA 2MRLA 1T94A 2LQ8A 3CXCS 1L6NA 2RI2A 2JZ2A 4QIWC 1VIEA 4M78G 1HXDA 4QNLA 1ZBXA 4R56A 3A8OB 5J3BA 2F77X 2KNJA 2DXUA 4PJOA 1K9MU 2G5IB 3E1SA 1NZ9A 3SD4A 3LWIA 3PSTA 2GFUA 4HCCA 3QZ5B 1M5Q1 2R5AA 2CYZB 3JB9J 4PJOD 2F8LA 1KHCA 2DD4A 1Q7YU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XI9 A;  5A0D A;  4BUG A;  4C0Z A;  5A0L A;  5A0G A;  2XIC A;  2XID A; 
#chains in the Genus database with same CATH topology
 4UB6 U;  2K79 A;  4LE9 A;  1ZOL A;  1NK5 A;  2DKZ A;  1FEZ A;  4ZH4 A;  5DG7 A;  4JV2 A;  5EE9 A;  1U8R A;  1HYO A;  4M4Z A;  1S1N A;  4F2R A;  1H92 A;  3NVV A;  5FU6 C;  1VA7 A;  2FHD A;  3EFS A;  1E6H A;  3QJ6 A;  1D1A A;  4QWB A;  1W70 A;  3BS5 A;  1U47 A;  2WHE A;  3M0R A;  5KFS A;  1WXT A;  2ZIV A;  1Q81 R;  2E65 A;  1FO4 A;  1KN5 A;  3KHH A;  2DIL A;  2E10 A;  5DB7 A;  3UF4 A;  2FYK A;  4EBE A;  4EBD A;  2ZPB B;  1SHG A;  4N4H A;  1IXD A;  1L7P A;  4R65 A;  5DGB A;  4M78 E;  2DL5 A;  2KDS A;  9ICW A;  2ZGW A;  2WB1 C;  4QJF B;  5KAI U;  2RM4 A;  5JTI A;  1FXX A;  4PFP A;  3PML A;  1Q82 R;  1NK9 A;  1QCK A;  1FX7 A;  4PZN A;  4DL5 A;  3I76 A;  2R8H A;  1A6S A;  4HVV A;  4DFM A;  1B07 A;  2VXF A;  5CA7 A;  2B8A A;  4L59 A;  9ICR A;  2VUB A;  1CRX A;  3G7Z A;  4J9E A;  4DEY A;  3Q8Q B;  2CSQ A;  4IR1 A;  2F1L A;  3OYA A;  5KYU A;  3TQ7 P;  3SWN B;  1ZQE A;  5J39 A;  1ZHI A;  3JCM P;  3OB9 A;  7ICL A;  3BFM A;  4EMK A;  4XTU A;  2AT1 B;  5AHX A;  3PIP A;  4M7D A;  3NHN A;  2JZB B;  5GAN 2;  1T7P A;  3JCM h;  4PJO F;  4BE1 A;  9ICE A;  3NTU A;  1U3O A;  2BKD N;  4J9K A;  4KX3 A;  4PGY A;  1JXE A;  4R8U B;  2BHN A;  5J0O A;  3GIJ A;  4M75 C;  4XTY A;  2FMS A;  1PKS A;  4I27 A;  1YJ9 T;  2SRC A;  3HTR A;  3OYC A;  2MAX A;  1C1A A;  2QQA A;  2E8M A;  3PNW C;  2G06 A;  4M7D D;  2BCU A;  2HHU A;  2DBK A;  2EYQ A;  1QP2 A;  2PVO B;  5KFN A;  5CR0 A;  2RHY A;  3SI8 A;  1K5O A;  3L4P A;  3TAD C;  2MAM A;  4GLM A;  4PFZ A;  2HW3 A;  2K3B A;  2JJ9 A;  2AKK A;  3V8J A;  3UXN A;  4M77 F;  1QH9 A;  2VA2 A;  8ICR A;  1RAE B;  3FAH A;  2HCK A;  3WK9 A;  1N8R R;  4JB3 A;  1C7Y A;  1UGR B;  3C29 A;  1YJ9 Q;  1G83 A;  5GMK h;  4U7C A;  1NLO C;  2XGP A;  3ZDC A;  4LDY A;  1BPY A;  3ZDA A;  2JMA A;  3V6H A;  2RH2 A;  4KLT A;  3OS2 A;  2E8O A;  4AG1 C;  4Q8F A;  2HVH A;  1JRO A;  2E8N A;  4ELT A;  3SB2 A;  5KFT A;  3L5K A;  3CCS A;  1M90 U;  1DGS A;  3MC1 A;  3ZDE A;  2J7I A;  4C8M A;  2UVW A;  1P92 A;  2KT8 A;  5J2H A;  1PK1 A;  2E8P A;  5KG0 A;  7ICQ A;  2ZIU A;  1ZA1 B;  5J8Y C;  2C0I A;  3D2S A;  4TQR A;  2P84 A;  3FDS A;  5L8R E;  2M51 A;  3QZ9 B;  2NWM A;  2RHZ A;  3M55 A;  5CQX A;  4RT2 A;  3MCA B;  2F1J A;  2EZZ A;  5ALZ A;  4P0Q B;  1TTH B;  4UQG A;  2I5H A;  2LM4 A;  2O88 A;  3CCL A;  2CUB A;  5KYX B;  3RB6 A;  2LZ6 B;  3BZC A;  1B0X A;  4WJ3 B;  3WVE B;  4US9 A;  5CHG A;  1RL2 A;  5J2C A;  3C2L A;  4J9R A;  3ZEH A;  3OSV A;  3MO8 A;  3ZL7 C;  2OM6 A;  3LVW A;  4RPY A;  1KC8 C;  3LYS A;  1X40 A;  2DYI A;  4QQG A;  3URG A;  4B9M A;  1MV3 A;  1K9A A;  2LQN A;  4C92 B;  5IHK A;  1VQ5 T;  5KFW A;  2RQ5 A;  4F4X A;  2CGH A;  3QKJ A;  4JS4 A;  4IUV A;  2RF0 A;  2WF7 A;  2YQE A;  3CCE Q;  2DTO A;  2XDB A;  2PVG B;  3JCM V;  1ZD3 A;  2NRX A;  2EZY A;  2HOI A;  2HOQ A;  1D0Z A;  5KG6 A;  2KRM A;  5IIK A;  2KE9 A;  2CSI A;  2XI9 A;  3LH5 A;  2ZUD A;  3H0M B;  3KD3 A;  3M6Z A;  3JB9 I;  3L2Q A;  4DA4 A;  2JMG A;  1ZSZ A;  4ESR A;  1N2X A;  3GV5 B;  1NKE A;  3WKB A;  1G3S A;  2E6N A;  4WTO B;  4I29 A;  3H8Z A;  2HD0 A;  2DZ9 A;  1VQ5 Q;  1DXS A;  2GTO A;  1VQN A;  9ICC A;  4Y2X A;  2JW4 A;  1WX6 A;  3UAT A;  4C8Q C;  2EAO A;  4F17 A;  2KIV A;  4XU0 A;  4MML A;  2WSE E;  2FZG B;  1D0Y A;  1C0M A;  2YUP A;  4FYY B;  5KCH A;  4CCH A;  1UA1 A;  1NJZ A;  2YLC A;  1K73 R;  1X27 A;  2X4Y A;  5HY6 A;  2QAS A;  5FWC A;  2K5L A;  2NUP B;  1IB8 A;  4EPC A;  5FRN A;  5FU6 B;  1I1J A;  2KP7 A;  2R8I A;  4PZO A;  5KFG A;  2HHX A;  3AU2 A;  5GAO r;  1RAC B;  5GAN h;  1YHQ T;  3L2Z A;  3RUX A;  1RXV A;  5AI5 A;  4RTU A;  4OJL A;  1Q86 R;  5IT9 E;  1OX8 A;  2VKN A;  4O3R A;  3OY9 A;  4KIT B;  2DL0 A;  1VOM A;  3CCM T;  1MA7 A;  1S8O A;  3I56 A;  2LP5 A;  2ROT A;  4C92 G;  1G3T A;  3CPW S;  2VYT A;  1UHF A;  4RMO A;  3H0F A;  1W6X A;  3AEV A;  2GNC A;  1BVS A;  3NRW A;  3NVY A;  4C4S A;  2GFA A;  3VS0 A;  2W9M A;  2EPD A;  9ICA A;  1WXU A;  2FLN A;  4P0P B;  1Q81 U;  2P66 A;  2R8J A;  1YHQ Q;  1EZZ B;  2LTO A;  3M8S A;  4QKU A;  5AKK A;  3H9N A;  4Z02 A;  4QWC A;  4AP9 A;  5DGA A;  1M30 A;  3CCM Q;  2LNV A;  2V9W A;  4TUQ A;  2LCC A;  4AFQ C;  1BU1 A;  3PX4 A;  3PSP A;  1B7T A;  2VXE A;  2PU9 B;  5AIB A;  2F2X A;  1Q82 U;  3QYG B;  4KLO A;  2K5F A;  4QQ6 A;  3GV8 B;  4RUC A;  1W2B S;  3OTQ A;  1N6A A;  2HQH A;  1MUZ A;  2PNI A;  4NLN A;  1WFW A;  1X69 A;  4I2H A;  1VQO T;  5ALX A;  2VC8 A;  3JCM g;  2DBY A;  4N4G A;  1IRE B;  4XU2 A;  1ZQF A;  3I1Y A;  2BE9 B;  3JCM J;  2OH2 A;  2JM9 A;  4C5I A;  4M75 B;  5III A;  3V8L A;  1RAG B;  1V29 B;  1ZQM A;  4YN4 A;  1ACM B;  1URJ A;  8AT1 B;  2K8C B;  3EH1 A;  4PL6 A;  4I2C A;  1N56 A;  8ICI A;  4QZG A;  2RQR A;  2EDU A;  5CIU A;  4U6P A;  3VRZ A;  3QO3 A;  5GAO m;  9ICV A;  1RZT A;  1L5U A;  3BDU A;  3CCU A;  1H3H A;  1RI9 A;  2KMT A;  2AXT U;  2J6O A;  2MIO A;  8ICF A;  1AD5 A;  1UUE A;  3CCR A;  2YTU A;  1VQO Q;  2H8H A;  3TSZ A;  1MV0 B;  5D6W A;  1SSH A;  1I07 A;  1D3B B;  4IS7 A;  3N7P D;  2LQW A;  3FJ5 A;  5LJ3 f;  8ICZ A;  5KYN A;  5KFY A;  1BI2 A;  1SL0 A;  5AKI A;  3AHU A;  3VS1 A;  3L3F X;  4B6M A;  3LYI A;  1XNS A;  5DBC A;  4QZ8 A;  2JOY A;  3CCS T;  1R0C B;  2IOF A;  2WF8 A;  4HT8 A;  1ZQY A;  1M2V A;  1N8R U;  2PI5 A;  5KAF U;  2JR5 A;  3LDA A;  3BQ0 A;  4F4Y A;  3MP6 A;  2QTX A;  1GCQ A;  4RZR A;  2IBK A;  2ZIW B;  1RUW A;  3IQL A;  4DOA A;  1K8A C;  2XU8 A;  2RJE A;  2PFN A;  3CCL T;  1TOV A;  2GQI A;  3H8J A;  4ECQ A;  2JRZ A;  2QYZ A;  2YUO A;  5BOM A;  4DFJ A;  4IRC A;  2RQV A;  4X9C A;  1SXE A;  2EAN A;  3HHT B;  3QWY A;  5GAM h;  3CCS Q;  1NJI U;  2KYM A;  3CQT A;  3BQ1 A;  3TFR A;  2G08 A;  1D09 B;  1WYG A;  1UB4 A;  5IIN A;  4MDX A;  2IG0 A;  3L1A A;  4J5Y A;  3A8M B;  2RP5 A;  2HSE B;  3DDH A;  3KZX A;  4C8K A;  4I2F A;  2A37 A;  2RQU A;  3F53 A;  1NM7 A;  8ICL A;  3NVZ A;  3RKW A;  2DPJ A;  4B9S A;  4PK4 A;  4QWD A;  4M7A A;  3CCL Q;  3EAE A;  4DOB A;  2FI1 A;  4YD2 A;  3TFS A;  4RG2 A;  3TQ1 A;  1YI2 A;  2IOF K;  2JH7 A;  4PHE A;  1PSF A;  4J9L A;  2H3I A;  4C4T A;  1ZET A;  2DIQ A;  3VS5 A;  2HVI A;  2E5S A;  4QW2 A;  3PZP A;  3L2W A;  1YZ7 A;  4E0D A;  1IXR A;  3MEU A;  1KQ1 A;  3PMN A;  1N9R A;  4M78 C;  5AT1 B;  4ZTJ A;  2KJ8 A;  3WK7 A;  1NG2 A;  1M4Z A;  3UWN A;  1VQN T;  4AYB C;  5KFA A;  2DL7 A;  3QX7 A;  4ZGD B;  5ALE A;  4C8Q B;  4M7A D;  3EGU A;  1H38 A;  3CME A;  3EZ5 A;  2AH5 A;  3M4Y A;  1KD1 C;  9ICU A;  3G6V A;  1XOV A;  5KG4 A;  4QT7 A;  8ICA A;  1WIE A;  1W4S A;  3LWL A;  4MZM A;  4RPZ A;  3LWM A;  2HHW A;  3WKA A;  3T79 A;  5J2E A;  1BBZ A;  2OHF A;  4BWJ A;  4DBH A;  5KFD A;  1WCL A;  3QU7 A;  5J0U A;  3JPO A;  3VUB A;  7AT1 B;  1I5L A;  2BPG A;  1LKY B;  1VYT A;  2JVV A;  1VQN Q;  4CRX A;  4AFZ C;  3GU3 A;  1LJO A;  4C8O A;  1YZ6 A;  5F9N A;  4XUS A;  4J9B A;  2HNI A;  4XTX A;  5GAN g;  1M3C A;  3JCM c;  4YP3 A;  2W04 A;  3VRY A;  3U26 A;  2DTH A;  1T3Q A;  3GZF A;  3JPN A;  1IV8 A;  3GQC A;  1K73 U;  5J0X A;  2YMP A;  2YRV A;  3OYI A;  2D3D A;  1YJN T;  4PLL A;  2YT6 A;  4QZE A;  1JIH A;  4FYX B;  1TFR A;  3MGV A;  3MR5 A;  4GC7 A;  1S9F A;  1IZ6 A;  1MC8 A;  4OB3 B;  1T8E A;  4M9L A;  1JMS A;  3BS7 A;  4Y91 A;  1Q86 U;  1NYF A;  2V4Q A;  4ECS A;  2V8J A;  4Y2U A;  2AQ0 A;  1QQ5 A;  4Y2T A;  1QSS A;  3F5E A;  4DSK A;  3G71 A;  2RHF A;  5I22 A;  4MEY A;  3M57 A;  3A8G B;  2NRV A;  4F5Q A;  5FU7 C;  1X6J A;  2WSC E;  4PJJ A;  5I2S A;  4PJO G;  5LJ3 j;  3M1Y A;  4DEZ A;  3JCM e;  5GAO n;  1K9M R;  3SV3 A;  4DQR A;  2CH4 W;  2HSZ A;  1E6G A;  4F3O A;  8ICM A;  3EG9 A;  4GLK A;  3GP8 A;  3RKX A;  1YJN Q;  1ZQD A;  2VB6 A;  3DKM A;  5AI9 A;  2QB0 A;  1R77 A;  2W9B A;  1UHC A;  3GIB A;  3X24 B;  4IQT A;  3TCJ A;  1WI7 A;  4TUP A;  4X5V A;  4F4W A;  2JM8 A;  2KI7 A;  3UPU A;  5ALT A;  3LGF A;  3MPU B;  2W11 A;  4RUA A;  3E9F A;  4JZ4 A;  1ZQI A;  2KVC A;  2GOL A;  2MOX A;  3C95 A;  5I21 A;  4LXC A;  1WHM A;  2DZC A;  2A1J B;  3DB4 A;  2G09 A;  2FB7 A;  4NWI A;  4O3N A;  3RBE A;  2JV3 A;  1X6G A;  5KFB A;  3A8L B;  3WK8 A;  3PVQ A;  4PL1 A;  1RAD B;  2IPO B;  3OYJ A;  2KEA A;  3CCU T;  2MWP A;  5GMK e;  4N4I A;  1ZQN A;  3THV A;  4M2Y A;  2CP6 A;  3QII A;  4KH0 B;  4JWM A;  3CCR T;  4YXM A;  4RQ4 A;  3JCM d;  4JV0 A;  1FFV A;  4FS2 A;  4V2S A;  1AZE A;  4KMU A;  2CT4 A;  1S77 D;  3SYZ A;  1X9W A;  3F2D A;  3PO4 A;  3IV6 A;  3F2C A;  2V8K A;  4NLC A;  3RJF A;  2ENM A;  2QXF A;  3KHG A;  3WXM B;  5EE0 A;  3M0U A;  2IVW A;  4ECT A;  3NGD A;  4DSE A;  1QVF A;  1OUQ A;  3CCU Q;  2D0Q B;  8ICQ A;  2E1H A;  1V97 A;  6AT1 B;  4D6W A;  4CI0 C;  3CCR Q;  1TK8 A;  4UB2 A;  2YB1 A;  4RNM A;  2FPE A;  2L3Q A;  1NK6 A;  7ICT A;  5FRO A;  3BW1 A;  4IUQ A;  4K11 A;  1ABQ A;  2M9N A;  2H3J A;  3OSN A;  5IXB A;  2HBP A;  4RQM A;  5FWB A;  4NL9 A;  1ZQW A;  3GFK B;  1MMG A;  3JPP A;  1VQM T;  4F5N A;  1V76 A;  3N4M B;  4KT0 E;  2DEU A;  4PJO E;  2ZTE A;  1SG5 A;  2PXI A;  5CEH A;  4M04 A;  1PK3 A;  2ATC B;  5A0G A;  2WAQ C;  3OYK A;  3IRU A;  2ED0 A;  2QGG A;  1IGU A;  4RCC A;  1JRI A;  2KEY A;  4UB4 A;  2KZZ A;  4NLB A;  4DFD A;  2ZIU B;  3PMT A;  5HHH A;  2DXC A;  3THK A;  1XWL A;  5AK3 A;  5GAM g;  2QEX A;  4Z6E A;  4ECU A;  5LJ5 h;  4M7D G;  2Y1I A;  2QTV A;  3EHR A;  2P4R A;  3R6O A;  4NV0 A;  2E3H A;  2C06 A;  1I4K 1;  2PMZ C;  3RB3 A;  4E7J A;  4OF1 A;  1Z4O A;  2E4H A;  4QIW F;  1TUG B;  1VQM Q;  7ICP A;  2XGQ A;  3AN1 A;  2EGC A;  2F1H A;  2KRS A;  1YI2 T;  4C4R A;  4ED0 A;  2WSF E;  2ASJ A;  3GIM A;  1BIA A;  1Z4N A;  4DF4 A;  5GAN 7;  1ZQB A;  3E58 A;  4LJX A;  1F44 A;  5C6S A;  2COZ A;  2H3E B;  5ALI A;  1H3Z A;  4OGC A;  4DL3 A;  1KSW A;  1YJ9 A;  4A63 B;  2Y0S C;  2PUO B;  1GFD A;  4EEN A;  4GXK A;  4UAR A;  1SV0 C;  3ISB A;  4OML A;  2YLB A;  4FYV B;  4BI4 A;  1KQ2 A;  1UGV A;  4DQ2 A;  1LNX A;  4UAU A;  2W7P A;  2GTJ A;  2R8K A;  3L42 A;  3SHW A;  5GAN e;  1YWP A;  5CKB A;  4LZG A;  1WPY A;  3FLG A;  4Q5W A;  5I11 A;  3KBG A;  4F7U A;  5FLX E;  3VC8 A;  3B0X A;  3IHQ B;  5J2B A;  4BI3 A;  2M16 A;  1F5S A;  1UHU A;  3MR6 A;  3TAD A;  5F9L A;  1G3Y A;  5HCK A;  2F69 A;  5DQG A;  2LMJ A;  2Q4T A;  3RKY A;  5IH2 A;  4QVD A;  1WJR A;  3GDX A;  1UGQ B;  3WKC A;  1AVZ C;  2EQY A;  3G6E Q;  5GAO p;  1G3W A;  1X9M A;  4DBF A;  3CBM A;  2ZCF B;  4XU3 A;  2IMW P;  4ATO A;  3NGP A;  3F2B A;  2KMD A;  4MEX A;  3Q8P B;  2KJ5 A;  5KFE A;  5AI6 A;  3SFM A;  2ALZ A;  1FIQ A;  1Y0M A;  2CDT A;  3OYY A;  1VDV A;  1A0N B;  2ISP A;  2QQ9 A;  4DQQ A;  2MWO A;  4UAY A;  5AM4 A;  4NLZ A;  1IHV A;  5K4L A;  5HML A;  4LDV A;  2KK0 A;  2DEQ A;  4M7D E;  2DRM A;  3UMC A;  4DF8 A;  2EVR A;  5AKE A;  4UAV A;  5ECA A;  3G71 T;  2JEF A;  1M1F A;  2K60 A;  5AKH A;  2OJ2 A;  5J8Y A;  5GAN d;  3CCE A;  2P35 A;  1NLP C;  1L8L A;  4PH5 A;  1AZG B;  2CP0 A;  5HP4 A;  5FU7 B;  2W3S A;  2QGF B;  3V8K A;  1SKW A;  5ALU A;  9ATC B;  4UAZ A;  5KFK A;  2WB1 F;  5KFR A;  2KKV A;  9ICT A;  4ELZ C;  2LYB A;  4M6W A;  4FU6 A;  3HRD D;  4PJ0 U;  2XCP A;  3C4S A;  1T0J A;  2HBL A;  4IQV A;  2VGM A;  4C92 C;  5JRT A;  1VQ5 A;  2NUT A;  3A0B U;  1B34 B;  1D9F A;  1YP5 A;  1G8X A;  3RB0 A;  1X6B A;  2JXB A;  4HYK A;  2QAR A;  4ANJ A;  1JXL A;  4F72 A;  5J0P A;  1S0N A;  1N5W A;  1SIJ A;  2IHM A;  4GBQ A;  2DK3 A;  4II1 A;  3J7A F;  4DSI A;  3V7C A;  3M58 A;  1ZQX A;  1Z1V A;  4KTQ A;  1ZLM A;  2YWW A;  1NPP A;  2FJ6 A;  2CZ7 B;  4O5V A;  5CWR A;  2JGA A;  2YB4 A;  3IM1 A;  4F5O A;  3KFU F;  1Q46 A;  2LT4 A;  2KD1 A;  5LL6 S;  4F04 B;  3PR4 A;  1M9S A;  4O3P A;  4FS1 A;  5DB8 A;  4ECR A;  2IHN A;  1R8O B;  5GTI U;  2RHI A;  4M9H A;  1YCY A;  3I28 A;  2DRK A;  4I28 A;  2RLT A;  7ICO A;  4J9I A;  4ZGE B;  3TAC B;  4JS5 A;  3E2U A;  5CKE A;  4B6J A;  2MK5 A;  3ZI4 A;  2AHO B;  4M77 A;  1D1B A;  1MQ3 A;  1Y96 A;  3JPT A;  4HCB A;  3ICX A;  4KMO B;  3M59 A;  4F7U F;  8ICW A;  3VS4 A;  3NFC A;  1SKR A;  3SQI A;  3K1R B;  2L5Y A;  3QU2 A;  1Q3V A;  2BZY A;  3S6J A;  4JWN A;  4KGZ B;  3RMS A;  1T4G A;  5J29 A;  5DBB A;  3M54 A;  1M8V A;  3MR3 A;  1YHQ A;  3FIF A;  2L3P A;  4NLK A;  2K9G A;  2COY A;  4M77 D;  4DEX A;  3EG2 A;  2E70 A;  1Q7Y C;  3CCM A;  4RCB A;  2K5I A;  1VQ4 T;  5GAM e;  1WYX A;  2EQJ A;  3ZD9 A;  2FLP A;  9ICH A;  4CC4 B;  2EQK A;  4YMM A;  1KIK A;  2EAY A;  3BZK A;  1U9L A;  4BXO A;  3TKA A;  3RH6 A;  2X3X D;  4AG2 C;  3PVL A;  1F1B B;  2YUQ A;  3CXC A;  2DET A;  1M2V B;  3RER A;  1BPZ A;  4KGV B;  5KT4 A;  2ED1 A;  2FPD A;  1Z00 A;  1TAU A;  2RD1 A;  3I55 T;  2FPF A;  3LVV A;  3FRN A;  3QBY A;  3I5R A;  2DL4 A;  2QEX T;  1M8M A;  3UPQ A;  1AWO A;  3BQT A;  5LJ5 g;  2O4X B;  1VQ4 Q;  3OPX A;  3PTA A;  2EYX A;  2CN1 A;  3A1P A;  4M0A A;  4TVR A;  1XQH A;  3GPL A;  5L1L A;  4P4M A;  1OZ2 A;  2BQU A;  1TAM A;  1QQ6 A;  1KFZ A;  5ALP A;  3FB9 A;  1PVR A;  5D4B A;  2LX9 A;  2AK5 A;  4NOY A;  4KN4 A;  4Q43 A;  3I55 Q;  2ZAE A;  4JRQ A;  1QQ7 A;  2BTT A;  5GAM d;  1RG6 A;  3H4B A;  2UVR A;  2QEX Q;  1VQO A;  4N0A C;  1T0H A;  3O8V A;  2FLL A;  3HRS A;  2RQW A;  4UAS A;  2W9C A;  2K3Y A;  3MKD A;  3QDF A;  3OYL A;  1X6O A;  1HIW A;  5KFV A;  1RAH B;  1SZH A;  3VS6 A;  2ASD A;  3M9O B;  2NRZ A;  4F4K A;  3C1Z A;  1OW5 A;  3RH4 A;  3CCV T;  3EWA A;  2XID A;  3B9J A;  5CVI A;  4VUB A;  2FPM A;  3CP8 A;  5J0S A;  2KOB A;  2F44 A;  2DXT A;  4I2D A;  2PQW A;  3TEE A;  5AM3 A;  1T3L A;  4FSX A;  2W55 A;  2RN8 A;  2ZG6 A;  2EKH A;  3ED5 A;  9ICN A;  4C8Q F;  3PNC A;  2XO7 A;  1ZUY A;  3A98 A;  3DB3 A;  4XU1 A;  1N5Z A;  2IIM A;  2ISO A;  4YFK A;  2KY9 A;  4R63 A;  3UXP A;  3CCV Q;  8ICP A;  4PJL A;  3RJI A;  3OBY A;  1XO1 A;  1KTQ A;  2RPN A;  1OYX A;  1CSK A;  2PFO A;  4A53 A;  3HFO A;  4GY5 A;  3OBW A;  4A4K A;  2GO7 A;  4OO1 J;  1WNL A;  1ZD4 A;  1I81 A;  1L3V A;  1UJY A;  2GF7 A;  4TUR A;  1NJI R;  3AT1 B;  3QYH B;  5FP0 A;  3IN5 A;  4ECW A;  4QWE A;  3T5K A;  1ZQ1 C;  2CPR A;  2WF6 A;  2NO4 A;  1S10 A;  1X42 A;  4Y2V A;  1DRG A;  3P8D A;  3CCE T;  2IOH A;  4F91 B;  3HX0 A;  1M1K C;  1UFF A;  5DLG A;  2EH9 A;  2R58 A;  2RJC A;  1VQ8 T;  1SEM A;  3RJH A;  1RLQ C;  2LJ0 A;  4ICA A;  2KJ9 A;  2DBM A;  4M7A G;  5AK5 A;  2OYY A;  1XTD A;  5HR6 A;  4QW9 A;  1PC0 A;  1KQS A;  4FW1 A;  1BCM A;  5A0L A;  2AHJ B;  4PNO A;  4YVZ A;  4ZNX A;  1YCS B;  4DCC A;  3OYG A;  4IC9 A;  3TAN A;  1JXO A;  2ZIX B;  2E12 A;  2A0F B;  3ZD8 A;  4GLX A;  2X3W D;  5KFF A;  2AKL A;  1M2O A;  2LX7 A;  2ODG A;  2UVU A;  3SAG A;  3HIL A;  3OYD A;  1CUK A;  4YXJ A;  3RB4 A;  4Q8E A;  2KV2 A;  1OPL A;  3C12 A;  4XK8 E;  4E7Z A;  1VQ8 Q;  3KKA C;  3KHL A;  1TUD A;  1TK0 A;  3MJX A;  4O9M A;  4CC2 A;  4EMG A;  5J2I A;  1SHF A;  2LRQ A;  2F8K A;  2E3T A;  4PLI A;  2OX7 A;  3QU5 A;  4KLS A;  2KQW A;  4J9P A;  2A08 A;  1NKC A;  3OMG A;  4EEK A;  5KFM A;  2CP3 A;  3CCQ T;  1JJ2 S;  4PJO C;  4KRT A;  2KSO B;  2ZJ5 A;  1PKT A;  4ECY A;  2K8B B;  3HKZ C;  2MA1 A;  1FMK A;  4YMN A;  5CP2 A;  5B5E U;  1ZSG A;  3R6N A;  4FO6 A;  4DOV A;  3JPS A;  4DS5 A;  4PKC C;  4Y2R A;  5ALJ A;  4P4O A;  1JU5 C;  3A8H B;  1P7D A;  3JB9 H;  4JPB W;  2JEG A;  4JRP A;  1AHJ B;  1D1C A;  5EE3 A;  5A2Q E;  2DO3 A;  1S72 Q;  4AFS C;  2LYH A;  3CCQ Q;  4YD1 A;  1NOM A;  2VAN A;  3G6Y A;  4Z6D A;  2D6F A;  4C5E A;  4KLL A;  1Z19 A;  4I2J A;  4KUD K;  2ZXH A;  4QZC A;  4UB8 U;  3EHQ A;  1QWF A;  4RTV A;  3SR6 A;  9ICG A;  3M4G A;  4KLE A;  3JCM W;  2DFU A;  3V7L A;  3V6K A;  2AGQ A;  2RO0 A;  2BDU A;  2BGW A;  2KSS A;  5LJ5 e;  4C8N A;  1TKD A;  3MGI A;  2ZZD A;  1YJN A;  4KLM A;  4DL4 A;  1DK2 A;  3MET A;  2RK1 A;  2ZJ8 A;  1ZA2 B;  4M7A E;  1UQV A;  2DNU A;  1PSE A;  2RDJ A;  3I35 A;  3ALR A;  5D7U A;  2HOF A;  4RQ1 A;  3RF9 A;  1X43 A;  3G1J A;  2F2V A;  3C5F A;  3VS3 A;  3IDW A;  3WKD A;  4HA8 A;  4DL2 A;  2DPP B;  2F5T X;  1NYG A;  3H0H A;  4LVS A;  3CC7 T;  5KYY A;  2W43 A;  4KLI A;  4M9J A;  2KAF A;  4WF2 A;  2X35 A;  5ALY A;  4I2E A;  1WHG A;  2CZ0 B;  3VCB A;  2X4X A;  3P8H A;  4PL2 A;  3QXG A;  5CQY A;  2OEH A;  3UA7 A;  1VQ6 A;  4NY8 A;  3PX0 A;  1Q81 C;  1VJ5 A;  3H0R B;  5DQH A;  4EYH B;  2B6G A;  2D9T A;  1B43 A;  2VAS A;  1B4F A;  5LJ5 d;  1JJ2 P;  3M0Q A;  4UB3 A;  1UA0 A;  1TK5 A;  1NZB A;  1YFN A;  3EGX A;  4EMK C;  3CC7 Q;  4I2G A;  3RH5 A;  3K75 D;  3CC2 A;  2YRC A;  2QQR A;  4FW2 A;  4M7D C;  1Q82 C;  3QZ7 A;  2PVD B;  5BPC A;  4X34 A;  5C5J A;  3ZBD A;  3BDP A;  1SF9 A;  5B66 U;  3FC4 A;  1NK7 A;  2WF5 A;  1WXB A;  3GII A;  1HK9 A;  2Z0W A;  3PR5 B;  5KFC A;  5AKG A;  2E5Q A;  1Z9Q A;  4IIM A;  4M78 F;  2LC4 A;  1WHJ A;  1MMN A;  2HDO A;  3NAS A;  3RRG A;  2K4E A;  4AYB F;  1N62 A;  1O08 A;  1U45 A;  2V26 A;  2HMX A;  1ZXI A;  2YRD A;  3ULR B;  1UT5 A;  4RTX A;  5EWG A;  3Q8R B;  3JCM X;  5AKZ A;  4X9D A;  3HFN A;  3QXE B;  1OQK A;  4DLE A;  4LDW A;  2PFP A;  2KFZ A;  4RTZ A;  1QQJ A;  1WDX A;  2EQI A;  4QZD A;  2NO5 A;  1IGQ A;  3CPW A;  4LD9 K;  4FL6 A;  1RDF A;  5DBA A;  1TS9 A;  4BY6 C;  3QWX X;  4OCZ A;  4ED6 A;  2EKO A;  3RIR A;  2QA4 Q;  5GTH U;  8ICT A;  1PWT A;  4HVU A;  5GAN 4;  3QYP A;  1WQW A;  1VQM A;  2P6U A;  5J26 A;  2G3R A;  4M9N A;  5EE1 A;  4RT3 A;  2YUN A;  2EIF A;  1XS9 D;  4IR9 A;  4OB1 B;  4FCY A;  3OSP A;  1NKB A;  5AKY A;  4E7S A;  2K4P A;  4IQW A;  2P0Q A;  1VUB A;  2YMM A;  1N8R C;  2RJF A;  4FZL A;  3CC4 T;  3QUC A;  1OU8 A;  4J9H A;  3ETR A;  1Q8K A;  1MN8 A;  1OXJ A;  4RQ2 A;  4J9S A;  1XSP A;  1SRM A;  3EGD B;  1W2B A;  2DA9 A;  2ZUC A;  2RA2 A;  3T5H A;  1CEZ A;  3OYB A;  2AJQ A;  3O0F A;  1K1Z A;  4PHA A;  2DM1 A;  1ECW A;  1F0M A;  1QSL A;  3TI0 A;  1T3N A;  8ICV A;  2MMP A;  4C0Z A;  4C0D C;  5J2J A;  9ICI A;  1TWB A;  1UEC A;  3SWN A;  2KIW A;  4E6R A;  4C7Z A;  1QWE A;  1ZUK A;  3JCM f;  3IG5 A;  1C6V X;  1M3A A;  8ICG A;  3SEN A;  2RRD A;  1QVG S;  3G4S T;  2ZUB A;  3CC4 Q;  3WKE A;  2CRX A;  2VA3 A;  1HUZ A;  1QCN A;  3TAQ A;  2JZB A;  4PJO B;  2C0T A;  3NTK A;  1ZQO A;  4F7U G;  3D2Q A;  1U5S A;  5IIM A;  1XO0 A;  2KBT A;  1MNE A;  4Z88 A;  3UMB A;  3SAF A;  5ALL A;  5EWF A;  3G6E A;  4A4F A;  1VYV A;  3C2M A;  3CMA A;  2GH1 A;  1IIP A;  1I0C A;  2G07 A;  2A7Y A;  1SPK A;  2DVJ A;  3CW2 C;  4B9T A;  4IIO A;  1KG1 A;  1X75 C;  4ED8 A;  2HQX A;  3G4S Q;  2F1I A;  1KHI A;  2CKK A;  5ALN A;  2ESW A;  4Q44 A;  2XY5 A;  1UPH A;  5HHI A;  2L89 A;  4OMM A;  5GAO l;  1ZQJ A;  1PNJ A;  5KYW B;  1YN8 A;  3EG3 A;  1L3T A;  2XDP A;  4FSS A;  2MU2 A;  4QZA A;  5AK4 A;  8ICE A;  4HAI A;  3CYM A;  4PGX A;  1PRL C;  1IO6 A;  2LMR A;  2RI3 A;  1SRL A;  3UT1 A;  5KH6 A;  4HT9 A;  3S3N A;  4YCX A;  3OW2 A;  2ROL A;  3UMG A;  2ATL A;  4IUR A;  1CKB A;  4L6V 5;  1WQ7 A;  4OMO A;  4E2F B;  3HJE A;  2OXO A;  1J2M A;  3BS5 B;  4P4P A;  2K7A A;  2RI5 A;  1ZQU A;  4KLU A;  4F8R A;  2KKP A;  2ZIV B;  3JPR A;  8ICJ A;  1L7O A;  2BIV A;  5KFQ A;  2V1Q A;  1KSP A;  3QUI A;  3P8B B;  1RYR A;  2O6K A;  3TSW A;  3ONN A;  4G9B A;  3M7D A;  3PW2 A;  2LDM A;  4A54 A;  1NEB A;  5KCO A;  3PW7 A;  4ACO A;  4P0Q A;  2QK0 A;  5EC7 A;  3H8W A;  4R55 A;  2WAQ F;  1OZ3 A;  5CAI A;  5KYX A;  2C2R A;  4BB7 A;  3PE0 A;  1D9D A;  2R18 A;  4DSF A;  3LH0 A;  1AOJ A;  2P4T A;  1Q86 C;  2WAC A;  4A4G A;  1VQ6 T;  3EW9 A;  3PVX A;  5KG3 A;  1QVG P;  2P0K A;  3SEI A;  1XNI A;  1WCN A;  3OGU A;  2HCF A;  4IRD A;  4DOW A;  4F7U E;  5KYU B;  2KG5 A;  5J2G A;  2PMZ F;  5DLQ E;  4C92 A;  4EMK B;  1V85 A;  4RTW A;  3CC2 T;  3PW4 A;  1SKS A;  1RXW A;  2FZC B;  2K4Y A;  4M7D B;  3DLL A;  4K4I A;  4M77 G;  3QU9 A;  2L8D A;  2NV3 A;  2HZY A;  1MHN A;  1RAA B;  2QB1 A;  3RJE A;  3DEE A;  4O5K A;  1VQ6 Q;  1BPE A;  3LWH A;  4EEY A;  4KLQ A;  3JB9 D;  4UAT A;  3CCJ Q;  4ELY C;  2Y0S F;  2FPK A;  2KK4 A;  3VU3 C;  4Z89 A;  5DB9 A;  3DV9 A;  5J0Q A;  2B0C A;  2KNB B;  5D6X A;  1Y88 A;  3CC2 Q;  1V1C A;  5ALO A;  4JUV A;  1TUC A;  1CI4 A;  1GCP A;  4AFU C;  1VQL T;  1EX4 A;  5D6Y A;  3MR2 A;  3RAQ A;  3GNF B;  4DFP A;  2GCX A;  2RMO A;  5AKL A;  2CZ6 B;  1N63 A;  1FWZ A;  2JTF A;  1S0M A;  4KLJ A;  3CEY A;  2VJ4 A;  4EEL A;  5GAN f;  3NRZ A;  5JUM A;  7ICG A;  3RJK A;  1COK A;  2LCL A;  4IRK A;  1ZD2 P;  4MFC A;  2DD5 A;  2NUP A;  1SZP A;  1AEY A;  4BY6 B;  4F2S A;  5KE3 A;  5ALS A;  1VQ4 A;  3BJY A;  2NLU A;  4ED2 A;  3J81 E;  2DYB A;  4BAC A;  2FE9 A;  3ETL A;  1BI0 A;  1JQQ A;  4US8 A;  4GFJ A;  1ZX6 A;  4DSJ A;  2RNA A;  4IUP A;  3H7I A;  1VQL Q;  3UQ2 A;  3BQ7 A;  4DL6 A;  4ELV A;  2VV5 A;  3C28 A;  3GBQ A;  3H4D A;  4J7I A;  1QVF P;  4XTV A;  4CF3 A;  1PK1 B;  3QJY A;  3I55 A;  4E7L A;  1W1F A;  3MP1 A;  4XTW A;  2W10 A;  4EYI B;  4FT2 A;  3T9N A;  8ICC A;  1GCQ C;  1ZQL A;  4J9O A;  3NTH A;  2BZF A;  1C20 A;  2DL8 A;  2G5H B;  5ALM A;  1N48 A;  4BI8 B;  1JEG A;  2DKX A;  4KX5 A;  2HHT A;  9ICJ A;  1SL1 A;  4A4H A;  2C2D A;  2MUT A;  4P0P A;  3EPG A;  1X01 A;  3J80 E;  1ZYQ A;  2JT4 A;  7ICF A;  5GMK j;  1N5X A;  4NJ8 A;  4B9L A;  5EG2 A;  3DLM A;  3NTI A;  1QTM A;  1NE8 A;  3R9K A;  2WF9 A;  1PUZ A;  5ALV A;  2DTI A;  4C0D B;  2FG0 A;  4NL2 A;  4M77 E;  3KFV A;  4RKU E;  2X4W A;  3REB B;  3V7S A;  2BCR A;  1VQP A;  3MDC A;  3E0F A;  3SDZ A;  2HHV A;  4C92 F;  2D8C A;  2PZ1 A;  3JB9 F;  1KDH A;  5DB6 A;  2AIR B;  1PD0 A;  4Q45 A;  3RAX A;  4NXZ A;  2O2O A;  2F2W A;  7ICH A;  3REA B;  1YIT T;  4M7A C;  2DX1 A;  2WTF A;  3OS5 A;  2F76 X;  5EOZ A;  1LB2 B;  4Y2Q A;  1Q3U A;  1WWV A;  2EYZ A;  3JSC A;  3G6E T;  4ZTF A;  3CCV A;  2A3L A;  3PSI A;  2FL7 A;  2M9U A;  2P0P A;  2RJD A;  4M75 A;  3QZ8 A;  2BCS A;  2OAW A;  2HQE A;  3CMA T;  4C0F A;  1AWW A;  8ICK A;  4JZ3 A;  1ZSZ B;  2JXJ A;  2DMO A;  1XSN A;  1ZRN A;  2HL3 A;  1DK3 A;  2ZXI A;  3QUQ A;  3F5A A;  1U1S A;  5HR7 A;  3RMQ A;  2GGR A;  1RAB B;  1U48 A;  2OTJ A;  1LVK A;  1TU0 B;  1YIT Q;  4LDX A;  1IHW A;  4M75 D;  3OA6 A;  5ALR A;  1JI7 A;  3MFH A;  1S97 A;  1D3B A;  3C0C A;  4J03 A;  3LX7 A;  2QKQ A;  1WLP B;  4ZN1 A;  3CMA Q;  5AK6 A;  4OVA A;  5FW9 A;  2J06 A;  3PIO A;  2O31 A;  2JHD A;  4RTY A;  3VS7 A;  1M1K R;  2H3Z A;  2XIC A;  1NJY A;  1RQL A;  1A76 A;  3PFS A;  1TVA A;  1KRP A;  4K4G A;  2EBP A;  1KW4 A;  3KBB A;  3KHR A;  3FYH A;  1ZUU A;  2M0Y A;  1QLY A;  1KC8 R;  2EAM A;  4F71 A;  4EDU A;  3A0H U;  2DFL A;  2OTL T;  3OMC A;  4FYW B;  5C0M A;  2LJ1 A;  2DXB A;  2ZIW A;  4JLI A;  1VQ8 A;  5GAM f;  1GO3 F;  1YBY A;  2FZK B;  5AI8 A;  3QPH A;  3H0I A;  1WZO A;  9ICK A;  2ECZ A;  3X20 B;  2CUD A;  2HL5 C;  8ICO A;  4DLG A;  2XVT A;  4LDU A;  5DDY A;  5CJ7 A;  5IIL A;  4MF2 A;  4XAX B;  3QU4 A;  4O3Q A;  1D0X A;  1RAI B;  2EGE A;  1AWX A;  9ICL A;  5KE2 A;  5BOL A;  4F50 A;  3H40 A;  5GAN j;  2ZTD A;  4Y92 A;  2NYV A;  1U49 A;  1JO8 A;  5I2M A;  2OTL Q;  4HCK A;  2BQ3 A;  3RNJ A;  2CS7 A;  2KXD A;  1BNP A;  1RYU A;  2NRT A;  3VYH B;  4KLH A;  2X4J A;  4C80 A;  2EAP A;  1ZRM A;  4J83 A;  1ZQV A;  1D8B A;  2Z7J A;  5KFL A;  2L0A A;  3L2V A;  1BK2 A;  2KHQ A;  1S0V A;  2R5M A;  3OYM A;  1S72 A;  5J0Y A;  3KKA A;  3CCQ A;  3TVT A;  5DM7 R;  2BZ8 A;  4UC4 A;  4XA5 A;  4J9M A;  3RTV A;  3ME9 A;  2DQN B;  2KT1 A;  2VIX A;  3F70 A;  1K9M C;  4M75 F;  4RQ0 A;  5ALH A;  3NPF A;  3T5L A;  4OJP A;  3SMV A;  3ASK A;  3OYF A;  3AQE A;  2JNG A;  4C8Q A;  4IQU A;  3MFI A;  5L9X A;  2AGP A;  4AT1 B;  2LI6 A;  2CZ1 B;  1UT8 A;  1KL9 A;  1FYN A;  2MF2 A;  1NZP A;  3HT3 A;  5KT3 A;  2CXY A;  2YHT A;  2JN0 A;  1YIJ A;  4ORZ A;  3V72 A;  4M9G A;  7ICV A;  5HMM A;  4KLG A;  3Q1J A;  4FBU A;  4RQ5 A;  2PI4 A;  2I9G A;  1LKY A;  3Q8S B;  4O3O A;  3M0S A;  4C8Q D;  4CC3 A;  3HP6 A;  4TUS A;  2ES6 A;  2DAQ A;  4OD0 A;  3HPW A;  5J2D A;  5LJ3 h;  1PVQ A;  4EX7 A;  4MZT A;  2JEJ A;  2KVS A;  1RPL A;  3TAP A;  4UAW A;  2DPI A;  1UGP B;  5L23 A;  4LUE A;  5KFP A;  4LUD A;  2DF4 B;  1PRM C;  3A5Z B;  3E19 A;  4PGQ A;  1S0O A;  5IHI A;  3VJP A;  2B21 A;  4NL9 C;  3NS1 A;  3PY8 A;  1T3S A;  2HAX A;  2QLT A;  3CC7 A;  3BY7 A;  1ZD5 A;  4F4Z A;  1IRX A;  1EFN A;  4HXJ A;  2V8I A;  5KTQ A;  2JEI A;  1O03 A;  3CXC P;  1EXN A;  4Y2P A;  1UTI A;  8ICH A;  1OUL A;  5AIA A;  4B9N A;  3OYE A;  4B9V A;  4IKF A;  5HNK A;  5KT7 A;  3EFR A;  2W3R A;  1LOJ A;  2DKG A;  4JRK A;  1VQP T;  2MSN A;  1M6Y A;  1PD1 A;  4KUL A;  2BCV A;  2JS0 A;  3OHB A;  2AZV A;  1VQ7 T;  5C0Y A;  5KFU A;  3OYN A;  3CRX A;  2ZJA A;  1ZQT A;  1SKU B;  4F93 B;  4M7A B;  3FJP A;  4IUU A;  3CBO A;  3OJS A;  2JUF A;  1ZQZ A;  1KQS S;  3EPI A;  4ECX A;  1NNL A;  4RQ7 A;  5J2A A;  5GAM j;  3NMZ C;  4J7F A;  2KFN A;  2W8K A;  2RHX A;  3D2N A;  2A1J A;  4OJO A;  1RI0 A;  4ZN3 A;  2X51 A;  4JUZ A;  3M6K A;  2ZTC A;  2RHU A;  1VQP Q;  5KFZ A;  2HBM A;  9ICP A;  5AM2 A;  1ZQQ A;  1LPL A;  5AKX A;  2QG9 B;  3I5S A;  5KG2 A;  4IUT A;  2LHT A;  4RUG A;  2QA4 A;  4DFK A;  3S3M A;  9ICX A;  1VQ7 Q;  3WK4 A;  1ZQK A;  3HKZ F;  1K1Q A;  2OTJ T;  3LW5 E;  1J2N A;  4A8E A;  1B22 A;  2R57 A;  4PJN A;  3VYG A;  3M9M B;  1PHT A;  3HP9 A;  2BQR A;  2KTQ A;  3EH2 A;  4BX9 C;  4FM4 B;  4ED3 A;  2RB6 A;  1I5O B;  5KG7 A;  5CO7 A;  1K8A R;  3EUB 2;  9ICO A;  2PUK B;  1M3B A;  1H8K A;  1SXD A;  4KLF A;  2PFQ A;  4EBC A;  2J6S A;  7ICE A;  2L2P A;  4DQS A;  5KL8 B;  2QI2 A;  1V38 A;  4R66 A;  3AM9 A;  2EQU A;  3GIL A;  2Y4X A;  4Z6F A;  2K57 A;  2OTJ Q;  2DIG A;  4XTZ A;  2AU0 A;  4JLG A;  4NS5 A;  2LPE A;  1OX9 A;  3UDC A;  2FEI A;  2ZPI B;  3CD6 T;  1M1K U;  3SV4 A;  5HK3 A;  4ZGJ B;  1D8Y A;  2BPC A;  2XY7 A;  3RJJ A;  1X2I A;  1ZQR A;  2K4I A;  1HEK A;  3ZFJ A;  4CRI A;  4E7H A;  1M90 C;  2FMP A;  2J05 A;  5LJ5 f;  2L3S A;  1Y07 A;  2YSQ A;  1PZN A;  2JS2 A;  4A4E A;  3CC4 A;  4IL6 U;  1L3U A;  3ER0 A;  1KC8 U;  3D7S B;  3IP4 B;  4NL3 A;  1MGQ A;  1TG0 A;  1KFD A;  4PHD A;  3QEB Z;  2JTE A;  1BIB A;  4LD6 A;  4C5G A;  2N1R A;  2HKN A;  3EG9 B;  3WVD B;  3CD6 Q;  3HPO A;  1TH7 A;  2JH1 A;  4G3I A;  2KGT A;  2QB0 B;  2QQB A;  3D6J A;  4F16 A;  2W9B B;  1KQS P;  3K1Z A;  4YR3 A;  2XCA A;  5DLF A;  2A3V A;  5KL1 B;  1KD1 R;  3G4S A;  1JX4 A;  2FRY A;  2O01 E;  1S72 T;  2I0N A;  3AL0 B;  4GC6 A;  4RNO A;  3BDL A;  4DL7 A;  4BD3 A;  2IA6 A;  4UBB A;  2BZX A;  1RM6 C;  1EIF A;  1QKX A;  4F14 A;  5KT6 A;  5GAN 8;  1MSW D;  4P5N A;  3HW8 A;  2DJQ A;  2OAU A;  5JU5 A;  4P2H A;  3C21 A;  1PM3 A;  4M78 A;  1QMC A;  4C5H A;  3VUZ A;  3QSU A;  3ISD A;  4OJ5 A;  4M7D F;  4DS4 A;  5J0R A;  5CKD A;  2K8A A;  2C28 A;  4XRH A;  2R8G A;  4LZD A;  4DQI A;  5D46 A;  1HJD A;  3EYZ A;  1S76 D;  5T14 A;  1PG5 B;  3OHA A;  1KK7 A;  1B3Q A;  1ZBJ A;  2EJF A;  3PW5 A;  4J9Q A;  3X28 B;  4ED7 A;  2ABL A;  5ALD A;  3MGH A;  1QCF A;  4RTT A;  1VQ9 A;  4F5P A;  1Q95 G;  2KZ3 A;  1YIJ T;  4RQ8 A;  4M77 C;  4M78 D;  5CB1 A;  2KR3 A;  4NM2 A;  1NBE B;  2HMA A;  3QNM A;  2XY6 A;  1BKB A;  3JRZ A;  3L2R A;  2CP5 A;  2YX8 A;  4QVZ A;  1M1G A;  8ICS A;  3H6Z A;  3KXT A;  5KNI A;  2BE7 D;  1TSF A;  4MMK A;  2Y90 A;  2JTM A;  3EFO A;  5IN1 A;  7ICN A;  1OEB A;  5LJ3 g;  4BE2 A;  3INZ A;  3FM9 A;  3TRE A;  3T3F A;  2EGA A;  3C5G A;  1GXI E;  3PGG A;  3M8R A;  4FIB A;  5GAN 6;  1U4B A;  1YIJ Q;  3UM9 A;  3H8S A;  4E47 A;  1NPR A;  1KBU A;  5KFO A;  7ICM A;  3BE3 A;  3H41 A;  1N60 A;  2P6R A;  7ICI A;  5L1M A;  1JUD A;  1OPK A;  1G5V A;  2LM1 A;  3VV0 A;  3MP8 A;  5DLO A;  4R0K A;  3BQ2 A;  4USA A;  1YNZ A;  3KUF A;  2VWF A;  2H3F A;  4YMO A;  3HWT A;  2J6F A;  3JB9 G;  4MFF A;  5AI0 A;  5ALF A;  3E2E A;  3HSB A;  1BPB A;  3AU6 A;  2X9H A;  1DOQ A;  2KVQ G;  3JAM E;  9ICB A;  3C2K A;  1ZQH A;  1I8F A;  3N7S C;  3M5A A;  3FC3 A;  2M1H A;  2MUT B;  4KGX B;  3GLX A;  2ESE A;  4AMC A;  1XSL A;  2A28 A;  3CCJ A;  4MDW A;  4YG2 A;  3NUQ A;  9ICM A;  1WUD A;  1B34 A;  4D8D A;  1JJ2 A;  1Y57 A;  2D8H A;  4FZN A;  3RRH A;  1JXM A;  1VIF A;  3PX6 A;  3PSF A;  1ZJM A;  1ED1 A;  5HK0 A;  2GBQ A;  3QG1 A;  1WA7 A;  2E6Z A;  3JCM Q;  1X9X A;  5DG9 A;  4I2A A;  2E3I A;  2CH4 A;  2VVK A;  1A0P A;  4JK1 A;  4C0G A;  2MYS A;  5LJ5 j;  1KEJ A;  4BWM A;  2W0Z A;  4UB1 A;  3PMI A;  1L8O A;  2HI0 A;  3Q8L A;  4ECZ A;  3E9G A;  3M53 A;  1SGG A;  4L5G A;  2COW A;  1N9S A;  9ICF A;  5IHN A;  3X25 B;  5GAN 3;  2QA4 T;  5AI4 A;  4KN7 A;  1KLN A;  3B0Y A;  4HVW A;  3V7R A;  4M47 A;  2NRW A;  3SD7 A;  2W8L A;  1FMV A;  2EQM A;  2V4R A;  2DF6 A;  3VKI A;  1VQL A;  4OMQ A;  4OJ6 A;  5L1I A;  4F7U B;  4BDP A;  1YT3 A;  5CRX A;  1X9S A;  2LYA A;  5J2F A;  2FMQ A;  4FZM A;  2AZS A;  3QDR B;  4Y28 E;  4QVC A;  4E7K A;  3OQ5 A;  2Y9U A;  3EG0 A;  1RLP C;  3V7J A;  1VYU A;  2YN4 A;  5GMK i;  1ABO A;  2LKY A;  2XC9 A;  4YTL A;  3PT9 A;  2KXC A;  1QKW A;  2H3Q A;  2DE0 X;  2OI3 A;  3RR6 A;  1K8A U;  2KE7 A;  2KRO A;  1WWU A;  3RES A;  2VJ5 A;  2EJG A;  4OMF B;  3WK6 A;  5EWE A;  4I2B A;  2QDY B;  4C92 E;  4EZ6 A;  4O5E A;  2DUY A;  3S6W A;  3CPW P;  1HUO A;  4OB0 B;  5F3X B;  1GBQ A;  2EYY A;  4KH1 B;  2H5X A;  3N28 A;  1QVP A;  1RYS A;  1NK4 A;  1ZQS A;  4JJN K;  3H0L B;  2C0O A;  3CPF A;  5IAY A;  3G6X A;  4DBR A;  3RBB B;  1BNO A;  3MEA A;  2K2V A;  3NVW A;  3CBP A;  4J6Y A;  3H8M A;  5GAO q;  3OW2 S;  4OMP A;  1ARO P;  2V1R A;  1K0X A;  2O4X A;  1UCV A;  2HBJ A;  2Q0Z X;  4JRI A;  4RG8 A;  1OOT A;  4RQ6 A;  3N7R C;  4O0I A;  7ICR A;  4M6W B;  4QZI A;  3WU2 U;  1NJI C;  1BYM A;  4M75 G;  2XK0 A;  1R0B G;  4QZH A;  2NUT B;  4KLD A;  4J6X A;  1W2B P;  2QAZ A;  1BCO A;  4BDZ A;  2L5Q A;  4FFD A;  2RDI A;  2QAR B;  2EWN A;  5DQI A;  4JMU A;  1YIT A;  3RR8 A;  1MND A;  9ICQ A;  4QZF A;  4R8U A;  3GNG A;  3AQF A;  1IM4 A;  2XMF A;  1NJW A;  1KD1 U;  1QCO A;  2YML A;  5G5H A;  1SV0 A;  3OJU A;  4GXI A;  2YDL A;  4JJD A;  4OMN A;  1ZSZ C;  3MAB A;  2FPL A;  2J6K A;  4J9F A;  4B9X A;  2QDL A;  1SWV A;  3OSS C;  2DVE A;  1YJW A;  5GJV B;  5AM0 A;  4MF8 A;  2KHV A;  2CT3 A;  2JMC A;  1VQ9 T;  1TE2 A;  5CCA A;  5LJ3 e;  4M77 B;  1N27 A;  4PJM A;  4J9C A;  1Y96 B;  5KG5 A;  4ME7 A;  1NK8 A;  5AIC A;  2QQS A;  2HEQ A;  3ORY A;  3HRU A;  1Y71 A;  3O5Z A;  2KRN A;  4DQP A;  4CNQ A;  5FRM A;  2ASL A;  5GJW B;  5DG8 A;  2H3V A;  4PHP A;  2PTK A;  4BGD A;  2LQK A;  1FFU A;  2D6F C;  1GRI A;  2E1E A;  3M0T A;  1L7M A;  4ELU A;  4Y2S A;  4DBQ A;  2C22 A;  1VQ9 Q;  1X6I A;  1GFC A;  3FDR A;  4XQ3 A;  1VQK A;  3OS0 A;  3J81 j;  4DO9 A;  4OB2 B;  2DWQ A;  2OTL A;  2FVU A;  2KN7 A;  2ZPH B;  2VA8 A;  4BXO B;  1X2K A;  4JJB A;  4LNP A;  1JN3 A;  1WJQ A;  4C7Y A;  1QVF S;  3UA6 A;  2J6U A;  5DDM A;  4JDS A;  3PW0 A;  3I56 T;  1K73 C;  5J2K A;  3Q8K A;  3OW2 P;  1DGJ A;  4GXJ A;  1Z00 B;  2EW3 A;  4UB5 A;  1UEB A;  3EG1 A;  3GF5 A;  5L1J A;  3L2U A;  2ZPF B;  2F2A B;  5LJ3 d;  4NM1 A;  3OYH A;  3GV7 B;  1PCX A;  3N5B B;  1JBM A;  2D0N A;  3HL8 A;  4J6W A;  4M75 E;  2M02 A;  2G0A A;  4DWI A;  1BPD A;  2HHS A;  1NK0 A;  5CK9 A;  1TAQ A;  1K0S A;  4J9N A;  3IG8 A;  2BUD A;  3N97 B;  2D1X A;  3HKS A;  2K89 A;  1QVG A;  3LK9 A;  3CCJ T;  7ICU A;  2ZIX A;  5TZV A;  1H64 1;  4MHV A;  5AKJ A;  4E7I A;  4J8O A;  4UW9 A;  3I56 Q;  3UQ0 A;  1SL2 A;  3WK5 A;  4K4H A;  3AUO A;  1TXQ A;  1ZQA A;  2YXY A;  2HHQ A;  4C8Q G;  2XHC A;  4MFA A;  4QZ9 A;  4UBC A;  2C2E A;  4FT4 A;  3GOX A;  5GAN 5;  1QP3 A;  5AM1 A;  4LN2 A;  5IXF A;  2W9C B;  1K76 A;  3C23 A;  2HSP A;  4PFO A;  1XC9 A;  4O6J A;  1OU9 A;  4RQN A;  4O5C A;  1U1T A;  4JV1 A;  2PKE A;  4C92 D;  1BPX A;  4EIK A;  2W9A A;  4QZB A;  3M56 A;  8ATC B;  4M7A F;  3SAH A;  2KSO A;  2F3N A;  4ZOH C;  2Y4Y A;  1UE9 A;  3SEM A;  4B9U A;  1WHL A;  2G6F X;  1WG8 A;  2AGO A;  2XDD A;  2Y9T A;  1Q7Y R;  4EZ9 A;  1SWW A;  5KFI A;  3PO5 A;  3FEO A;  3MEW A;  1BI1 A;  1KJW A;  2I2L A;  2J6T A;  2EYW A;  4XQ8 A;  1L3S A;  3RDV A;  1Z3E B;  2GWS A;  1V9P A;  2BKE A;  8ICN A;  2W03 A;  3QUB A;  5GMK m;  4RU9 A;  2YY6 A;  2RQT A;  4OP0 A;  2W7O A;  4CC7 A;  1QSY A;  3M0P A;  2MI6 A;  2A1A A;  4F5R A;  2M0O A;  5KYW A;  3ISC A;  2BDP A;  3QUT A;  1G2B A;  2W54 A;  3V7K A;  1HJP A;  4O3M A;  1AQ6 A;  3MEV A;  3HRT A;  2LBO A;  2LCS A;  5HKC A;  1NI3 A;  2L3R A;  3U23 A;  3VS2 A;  1XJW B;  2I1Q A;  5D49 A;  2KIC A;  4DOC A;  2HBK A;  2GLE A;  1M27 C;  2M0N A;  4KUI A;  1XU4 A;  4B9W A;  2KYB A;  4EX6 A;  1N61 A;  4RNN A;  4DSL A;  1X66 A;  1K1S A;  4D8K A;  3AMZ A;  2A36 A;  1J3T A;  5AYF A;  1BB9 A;  1PVP A;  1U06 A;  5DY9 A;  4BUG A;  1DJ7 B;  5KT2 A;  1ZJN A;  1ARK A;  1ZQP A;  5M9O A;  1UGS B;  1RAF B;  4KBM B;  4OGE A;  1MQ2 A;  2K3X A;  4CDG A;  4HCZ A;  2NYS A;  4I2I A;  3K4G A;  2DGZ A;  8ICX A;  3TU4 K;  1UJ0 A;  4NLG A;  2GQV A;  3KZI U;  4Z8A A;  2RK2 A;  3ZDD A;  3JV3 A;  2WFA A;  1HD3 A;  1OV3 A;  1QW1 A;  3JCM b;  2LJ3 A;  1KFS A;  2XD0 A;  3LGL A;  4C8Q E;  2EZX A;  4BE0 A;  3T5J A;  2VKQ A;  3LLR A;  5IIJ A;  2OWO A;  2CP2 A;  2MPX C;  2LNH B;  1VQ7 A;  1SB3 C;  3MHX A;  3CNH A;  1WJS A;  4CE6 A;  2LT1 A;  4N0A A;  7ICJ A;  4PPX A;  2VGN A;  2DER A;  3SWN C;  1WHK A;  1Z1B A;  1MMD A;  5KFH A;  2AQ4 A;  1D8L A;  4HKE A;  2K4H A;  4Y2J A;  3JPQ A;  1SSF A;  4BDY A;  5H2F U;  5J0T A;  4ECV A;  2HKQ B;  2K6D A;  3RJG A;  1L7N A;  1MMA A;  7ICS A;  3C94 A;  3RR7 A;  4EMH A;  1COO A;  1JB0 E;  1K4U S;  2MCN A;  1QLN A;  2EJ9 A;  2HBW A;  5KT5 A;  1YJW T;  1Y7X A;  5KFJ A;  3S3O A;  2D8J A;  2DJZ A;  4F92 B;  1RQN A;  4M78 B;  1NEG A;  8ICB A;  1HSQ A;  2E64 A;  4J9D A;  5CR2 A;  2ZPG B;  1O75 A;  1JRP A;  5AM5 A;  3QHS A;  3M9N B;  5IIO A;  4Y2Y A;  5CKF A;  1WGS A;  3CME T;  3RFA A;  4TQS A;  1VLB A;  5J0W A;  3PV8 A;  5G5G A;  8ICU A;  1OI1 A;  1YI2 Q;  3X26 B;  1O9S A;  4ED1 A;  4CF4 A;  5CKH A;  1NJX A;  4Z6C A;  8ICY A;  2E1F A;  4CGZ A;  1KFT A;  1S5L U;  4RPX A;  2UVV A;  2DLP A;  4QWA A;  2DL3 A;  1UG1 A;  2LVM A;  2SEM A;  1YJW Q;  1M90 R;  4FE3 A;  1YWO A;  5TIS U;  1BI3 A;  3M9Q A;  5DKW A;  2B86 A;  2O9V A;  2NUZ A;  1VQK T;  4RQ3 A;  2ZPE B;  1WHH A;  5A0D A;  7ICK A;  4WCI A;  2XG8 D;  3CME Q;  5GMK l;  3V6J A;  3CD6 A;  2XKO C;  1ZQG A;  3EFO B;  4JJC A;  3OS1 A;  1ZQ1 A;  3UXO A;  3QE9 Y;  2YMQ A;  2EFI A;  3RBD A;  3KOO A;  4QQD A;  5KFX A;  2FO0 A;  2HDA A;  3KTQ A;  4MZP A;  1IG6 A;  1Z9Z A;  3ZDB A;  4BJQ A;  2E41 A;  2I6X A;  2F5K A;  2MRL A;  1AWJ A;  1T94 A;  1CKA A;  1JAL A;  5ALQ A;  1AT1 B;  1VQK Q;  5KYY B;  4YQW A;  1KQQ A;  2LQ8 A;  1J97 A;  2CP7 A;  3EGD A;  4FBT A;  2A19 A;  3CXC S;  3QEA Z;  1L6N A;  2RI2 A;  2CRE A;  2JZ2 A;  4QIW C;  5L1K A;  3SZ2 A;  9ICS A;  2Y1J A;  1X2Q A;  1VIE A;  4M78 G;  5ALK A;  4X1V A;  1GBR A;  1HXD A;  4O3S A;  3MBY A;  4R64 A;  1GL5 A;  4QNL A;  2FDR A;  1LVH A;  1ZBX A;  1UDL A;  1KKX A;  5ALG A;  4R56 A;  3A8O B;  5J3B A;  1A77 A;  2F77 X;  2KNJ A;  3C1Y A;  3GIK A;  3EGX B;  2OCE A;  1TV9 A;  2DXU A;  3G71 Q;  4PJO A;  1LCK A;  1K9M U;  2G5I B;  4YR2 A;  3E1S A;  2O9S A;  2FRW A;  5ALW A;  1NZ9 A;  3SD4 A;  2BR0 A;  3LWI A;  3I9Q A;  3PST A;  4J9G A;  1LV5 A;  4CF5 A;  3TAR A;  2GFU A;  1FMW A;  4HCC A;  4QW8 A;  3QZ5 B;  1SV4 A;  1M5Q 1;  2R5A A;  2CYZ B;  1BGX T;  3MDA A;  2E5K A;  4C8L A;  3JB9 J;  5E79 U;  4PJO D;  2F8L A;  5KG1 A;  4GIB A;  2KZM A;  2BPF A;  1KHC A;  2DD4 A;  2K2M A;  3Q8M A;  1Q7Y U;  1E7O A;  4YR0 A;  2BCQ A;  1ZQC A; 
#chains in the Genus database with same CATH homology
 1U8R A;  5FU6 C;  2FHD A;  3EFS A;  3QJ6 A;  2ZIV A;  2E65 A;  2E10 A;  2FYK A;  2ZPB B;  4N4H A;  4M78 E;  2KDS A;  2ZGW A;  2WB1 C;  4QJF B;  2RM4 A;  1FXX A;  1FX7 A;  1A6S A;  2VXF A;  2B8A A;  4L59 A;  2VUB A;  1CRX A;  3G7Z A;  3OYA A;  3SWN B;  5J39 A;  1ZHI A;  3JCM P;  3OB9 A;  3BFM A;  4EMK A;  4XTU A;  3PIP A;  4M7D A;  5GAN 2;  3JCM h;  4PJO F;  4BE1 A;  2BKD N;  4KX3 A;  4M75 C;  4XTY A;  1YJ9 T;  3OYC A;  2QQA A;  3PNW C;  2G06 A;  4M7D D;  2EYQ A;  1QP2 A;  2PVO B;  2RHY A;  2MAM A;  3V8J A;  4M77 F;  1UGR B;  3C29 A;  5GMK h;  4U7C A;  4LDY A;  2RH2 A;  3OS2 A;  3SB2 A;  3CCS A;  1M90 U;  1P92 A;  2ZIU A;  3D2S A;  5L8R E;  3QZ9 B;  2RHZ A;  3M55 A;  5CQX A;  3MCA B;  4P0Q B;  3CCL A;  4WJ3 B;  3WVE B;  1RL2 A;  3ZEH A;  3OSV A;  3MO8 A;  2OM6 A;  3LVW A;  1KC8 C;  3LYS A;  4QQG A;  3URG A;  4C92 B;  1VQ5 T;  2CGH A;  4JS4 A;  3QKJ A;  4IUV A;  2XDB A;  2DTO A;  2PVG B;  3JCM V;  2HOI A;  2HOQ A;  2XI9 A;  3H0M B;  3M6Z A;  3JB9 I;  3L2Q A;  4DA4 A;  2JMG A;  2E6N A;  1G3S A;  3H8Z A;  2HD0 A;  2DZ9 A;  1VQN A;  4C8Q C;  4XU0 A;  4MML A;  2WSE E;  5KCH A;  2YLC A;  2X4Y A;  5HY6 A;  2K5L A;  4EPC A;  5FRN A;  5FU6 B;  5GAO r;  5GAN h;  1YHQ T;  3L2Z A;  3RUX A;  4OJL A;  5IT9 E;  3OY9 A;  3CCM T;  1MA7 A;  3I56 A;  4C92 G;  1G3T A;  3CPW S;  2VYT A;  4RMO A;  3NRW A;  2GFA A;  4P0P B;  1Q81 U;  2LTO A;  4Z02 A;  2LNV A;  2LCC A;  3PSP A;  2VXE A;  2PU9 B;  1Q82 U;  3QYG B;  2K5F A;  4QQ6 A;  1W2B S;  1N6A A;  1VQO T;  2VC8 A;  3JCM g;  4N4G A;  1IRE B;  4XU2 A;  3JCM J;  2OH2 A;  4C5I A;  4M75 B;  3V8L A;  1V29 B;  1URJ A;  2K8C B;  4PL6 A;  5CIU A;  4U6P A;  3QO3 A;  5GAO m;  3CCU A;  3BDU A;  2KMT A;  3CCR A;  5D6W A;  1D3B B;  3N7P D;  5LJ3 f;  1BI2 A;  3AHU A;  3L3F X;  3LYI A;  1XNS A;  2JOY A;  3CCS T;  4HT8 A;  1N8R U;  3MP6 A;  2QTX A;  2ZIW B;  1K8A C;  2XU8 A;  2RJE A;  3CCL T;  4X9C A;  3HHT B;  5GAM h;  1NJI U;  2G08 A;  1UB4 A;  4MDX A;  2IG0 A;  3L1A A;  4J5Y A;  3A8M B;  2RP5 A;  3KZX A;  3F53 A;  3RKW A;  4M7A A;  3EAE A;  4RG2 A;  1YI2 A;  2JH7 A;  1PSF A;  2H3I A;  2DIQ A;  2E5S A;  4QW2 A;  3PZP A;  3L2W A;  3MEU A;  1KQ1 A;  1N9R A;  4M78 C;  4ZTJ A;  2KJ8 A;  3UWN A;  1M4Z A;  1VQN T;  4AYB C;  4ZGD B;  4C8Q B;  4M7A D;  3CME A;  3M4Y A;  1KD1 C;  1XOV A;  1W4S A;  4MZM A;  3T79 A;  3VUB A;  1I5L A;  2JVV A;  4CRX A;  3GU3 A;  1LJO A;  5GAN g;  2HNI A;  4XTX A;  3JCM c;  2W04 A;  2DTH A;  3GZF A;  1K73 U;  2YRV A;  3OYI A;  1YJN T;  4PLL A;  3MGV A;  1IZ6 A;  4OB3 B;  1Q86 U;  4Y91 A;  2V8J A;  3G71 A;  3F5E A;  2RHF A;  3M57 A;  3A8G B;  5FU7 C;  2WSC E;  5I2S A;  4PJO G;  5LJ3 j;  3JCM e;  5GAO n;  3GP8 A;  4GLK A;  3RKX A;  3DKM A;  3GIB A;  3X24 B;  3TCJ A;  3UPU A;  3LGF A;  3E9F A;  2KVC A;  2GOL A;  5I21 A;  3C95 A;  2DZC A;  3DB4 A;  2G09 A;  2FB7 A;  4NWI A;  3A8L B;  4PL1 A;  3OYJ A;  3CCU T;  2MWP A;  5GMK e;  4N4I A;  3QII A;  3CCR T;  3JCM d;  4V2S A;  3F2D A;  3F2C A;  2V8K A;  4NLC A;  2QXF A;  3WXM B;  2IVW A;  1QVF A;  1OUQ A;  2D0Q B;  2E1H A;  4D6W A;  4CI0 C;  2YB1 A;  5FRO A;  3BW1 A;  4IUQ A;  2H3J A;  2HBP A;  1VQM T;  4KT0 E;  4PJO E;  5A0G A;  3OYL A;  3OYK A;  2WAQ C;  4RCC A;  1JRI A;  2KEY A;  4NLB A;  3PMT A;  2ZIU B;  2DXC A;  5GAM g;  2QEX A;  4M7D G;  5LJ5 h;  3R6O A;  4NV0 A;  2C06 A;  1I4K 1;  2PMZ C;  4E7J A;  4OF1 A;  4QIW F;  1YI2 T;  2WSF E;  1BIA A;  5GAN 7;  1F44 A;  1H3Z A;  4OGC A;  1YJ9 A;  2Y0S C;  2PUO B;  1KQ2 A;  4BI4 A;  2YLB A;  4DQ2 A;  1LNX A;  2W7P A;  3L42 A;  5GAN e;  5CKB A;  1WPY A;  3FLG A;  4Q5W A;  3KBG A;  4F7U A;  5FLX E;  3VC8 A;  4BI3 A;  2M16 A;  1G3Y A;  2F69 A;  2Q4T A;  3RKY A;  4QVD A;  1WJR A;  1UGQ B;  5GAO p;  1G3W A;  3CBM A;  2ZCF B;  4XU3 A;  4ATO A;  3F2B A;  2KJ5 A;  3SFM A;  3OYY A;  2QQ9 A;  2MWO A;  4LDV A;  2DEQ A;  4M7D E;  3G71 T;  1M1F A;  5GAN d;  3CCE A;  5FU7 B;  3V8K A;  2WB1 F;  2KKV A;  4ELZ C;  2LYB A;  4FU6 A;  3C4S A;  2HBL A;  4C92 C;  2VGM A;  1VQ5 A;  1B34 B;  2DK3 A;  4II1 A;  3J7A F;  3V7C A;  3M58 A;  1NPP A;  2CZ7 B;  4O5V A;  2JGA A;  5LL6 S;  2YB4 A;  3KFU F;  2LT4 A;  2KD1 A;  1M9S A;  1R8O B;  2RHI A;  1YCY A;  4ZGE B;  4JS5 A;  5CKE A;  4M77 A;  1Y96 A;  4HCB A;  3ICX A;  4KMO B;  3M59 A;  4F7U F;  3NFC A;  3SQI A;  1Q3V A;  3RMS A;  3M54 A;  1M8V A;  1YHQ A;  3FIF A;  4M77 D;  1Q7Y C;  2E70 A;  3CCM A;  4RCB A;  2K5I A;  1VQ4 T;  5GAM e;  2EQJ A;  2EQK A;  2EAY A;  3CXC A;  3RER A;  2RD1 A;  3I55 T;  3LVV A;  3FRN A;  3QBY A;  2QEX T;  5LJ5 g;  2O4X B;  3OPX A;  3PTA A;  2CN1 A;  4TVR A;  1XQH A;  3GPL A;  1OZ2 A;  1TAM A;  3FB9 A;  1PVR A;  2LX9 A;  4NOY A;  4JRQ A;  5GAM d;  1VQO A;  4N0A C;  3O8V A;  3HRS A;  2K3Y A;  1X6O A;  1HIW A;  1SZH A;  3CCV T;  2XID A;  5CVI A;  4VUB A;  3CP8 A;  2KOB A;  2DXT A;  2PQW A;  3TEE A;  4FSX A;  2ZG6 A;  4C8Q F;  3DB3 A;  4XU1 A;  2KY9 A;  3OBY A;  1OYX A;  4A53 A;  3HFO A;  4GY5 A;  3OBW A;  4A4K A;  4OO1 J;  1WNL A;  1I81 A;  2GF7 A;  3QYH B;  3IN5 A;  1ZQ1 C;  2CPR A;  1DRG A;  3P8D A;  3CCE T;  1M1K C;  2R58 A;  1VQ8 T;  2RJC A;  4ICA A;  2KJ9 A;  4M7A G;  2OYY A;  1XTD A;  5HR6 A;  1KQS A;  5A0L A;  2AHJ B;  4PNO A;  3OYG A;  4IC9 A;  2ZIX B;  2E12 A;  3SAG A;  3OYD A;  4XK8 E;  2KV2 A;  3C12 A;  4EMG A;  2LRQ A;  4PLI A;  2KQW A;  3CCQ T;  4PJO C;  3OMG A;  1JJ2 S;  2K8B B;  3HKZ C;  2MA1 A;  4DOV A;  4PKC C;  3A8H B;  1P7D A;  3JB9 H;  4JRP A;  1AHJ B;  5A2Q E;  2DO3 A;  2D6F A;  4C5E A;  1Z19 A;  4KUD K;  2ZXH A;  3M4G A;  3JCM W;  2RO0 A;  2BDU A;  2KSS A;  5LJ5 e;  2ZZD A;  1YJN A;  3MET A;  2RK1 A;  4M7A E;  1PSE A;  3ALR A;  2HOF A;  3RF9 A;  4HA8 A;  2DPP B;  2F5T X;  3CC7 T;  2KAF A;  4WF2 A;  2X35 A;  2CZ0 B;  3VCB A;  2X4X A;  3P8H A;  4PL2 A;  5CQY A;  1VQ6 A;  1Q81 C;  3H0R B;  2D9T A;  5LJ5 d;  1NZB A;  4EMK C;  3CC2 A;  2QQR A;  4M7D C;  1Q82 C;  2PVD B;  4X34 A;  3ZBD A;  1HK9 A;  2E5Q A;  4M78 F;  2LC4 A;  2K4E A;  4AYB F;  2HMX A;  3JCM X;  4X9D A;  3HFN A;  3QXE B;  4LDW A;  3CPW A;  4LD9 K;  4FL6 A;  4BY6 C;  2EKO A;  3RIR A;  5GAN 4;  1WQW A;  1VQM A;  5J26 A;  2G3R A;  2EIF A;  4OB1 B;  2P0Q A;  1VUB A;  1N8R C;  2RJF A;  4FZL A;  3CC4 T;  1W2B A;  2RA2 A;  3OYB A;  3O0F A;  1ECW A;  2MMP A;  4C0Z A;  4C0D C;  3SWN A;  2KIW A;  3JCM f;  3IG5 A;  2RRD A;  1QVG S;  3G4S T;  2CRX A;  4PJO B;  3NTK A;  4F7U G;  3D2Q A;  1XO0 A;  3SAF A;  3G6E A;  4A4F A;  3CMA A;  2GH1 A;  1IIP A;  2G07 A;  2A7Y A;  1KG1 A;  1X75 C;  2HQX A;  1KHI A;  2CKK A;  1UPH A;  2L89 A;  5GAO l;  2XDP A;  3CYM A;  2RI3 A;  3UT1 A;  5KH6 A;  4HT9 A;  3S3N A;  3OW2 A;  4IUR A;  4L6V 5;  1WQ7 A;  2OXO A;  2RI5 A;  2KKP A;  2ZIV B;  2BIV A;  3QUI A;  3P8B B;  3ONN A;  3M7D A;  2LDM A;  4A54 A;  5KCO A;  4ACO A;  4P0Q A;  4R55 A;  2WAQ F;  1OZ3 A;  5CAI A;  4BB7 A;  2R18 A;  3LH0 A;  2P4T A;  1Q86 C;  2WAC A;  4A4G A;  1VQ6 T;  2P0K A;  1XNI A;  4DOW A;  4F7U E;  5DLQ E;  2PMZ F;  4C92 A;  4EMK B;  3CC2 T;  2K4Y A;  4M7D B;  3DLL A;  4M77 G;  2L8D A;  2NV3 A;  1MHN A;  3DEE A;  3LWH A;  3JB9 D;  4ELY C;  2Y0S F;  2KK4 A;  3VU3 C;  5D6X A;  4JUV A;  1VQL T;  5D6Y A;  3GNF B;  2GCX A;  2CZ6 B;  2JTF A;  1FWZ A;  3CEY A;  2VJ4 A;  5GAN f;  2LCL A;  2DD5 A;  4BY6 B;  5KE3 A;  1VQ4 A;  2NLU A;  3J81 E;  4BAC A;  1BI0 A;  4GFJ A;  4IUP A;  2VV5 A;  3C28 A;  4J7I A;  4XTV A;  3QJY A;  3I55 A;  4E7L A;  3MP1 A;  4XTW A;  4FT2 A;  3T9N A;  3NTH A;  4BI8 B;  2G5H B;  4KX5 A;  4A4H A;  4P0P A;  1X01 A;  3J80 E;  5GMK j;  5EG2 A;  3DLM A;  3NTI A;  1NE8 A;  2DTI A;  4C0D B;  4NL2 A;  4M77 E;  4RKU E;  2X4W A;  3V7S A;  1VQP A;  3SDZ A;  3E0F A;  4C92 F;  3JB9 F;  4M7A C;  1YIT T;  3OS5 A;  2F76 X;  4ZTF A;  1Q3U A;  3G6E T;  3JSC A;  3CCV A;  2A3L A;  3PSI A;  2FL7 A;  2M9U A;  2P0P A;  2RJD A;  4M75 A;  3CMA T;  2HQE A;  4C0F A;  2ZXI A;  3F5A A;  1U1S A;  5HR7 A;  3RMQ A;  2OTJ A;  4LDX A;  4M75 D;  3OA6 A;  1D3B A;  3LX7 A;  4ZN1 A;  4OVA A;  3PIO A;  2JHD A;  2H3Z A;  2XIC A;  3PFS A;  4EDU A;  2OTL T;  3OMC A;  5C0M A;  2DXB A;  2ZIW A;  4JLI A;  1VQ8 A;  5GAM f;  1GO3 F;  1YBY A;  3QPH A;  3X20 B;  2XVT A;  4LDU A;  4XAX B;  5KE2 A;  5GAN j;  5I2M A;  2CS7 A;  3VYH B;  2X4J A;  4J83 A;  1D8B A;  2Z7J A;  3L2V A;  2KHQ A;  3OYM A;  2R5M A;  1S72 A;  3CCQ A;  5DM7 R;  4UC4 A;  3ME9 A;  2DQN B;  2VIX A;  3F70 A;  1K9M C;  4M75 F;  4OJP A;  3SMV A;  3ASK A;  3OYF A;  3AQE A;  2JNG A;  4C8Q A;  2CZ1 B;  2MF2 A;  2YHT A;  2JN0 A;  1YIJ A;  3Q1J A;  5C6S A;  4C8Q D;  2DAQ A;  3HPW A;  5LJ3 h;  1PVQ A;  4MZT A;  1UGP B;  2DF4 B;  3A5Z B;  3E19 A;  3VJP A;  2HAX A;  3CC7 A;  3BY7 A;  2V8I A;  3OYE A;  4IKF A;  3EFR A;  1LOJ A;  2DKG A;  4JRK A;  1VQP T;  4KUL A;  1VQ7 T;  5C0Y A;  3OYN A;  3CRX A;  4M7A B;  3FJP A;  4IUU A;  3CBO A;  1KQS S;  2JUF A;  5GAM j;  4J7F A;  2RHX A;  3D2N A;  4OJO A;  1RI0 A;  4ZN3 A;  3M6K A;  2RHU A;  2HBM A;  3S3M A;  4IUT A;  2LHT A;  2QA4 A;  3HKZ F;  2OTJ T;  3LW5 E;  2R57 A;  4A8E A;  3VYG A;  3HP9 A;  4BX9 C;  4FM4 B;  2RB6 A;  5CO7 A;  2PUK B;  5KL8 B;  2QI2 A;  2EQU A;  2Y4X A;  2K57 A;  2DIG A;  4XTZ A;  4JLG A;  4NS5 A;  3UDC A;  2ZPI B;  3CD6 T;  1M1K U;  5HK3 A;  4ZGJ B;  3ZFJ A;  2K4I A;  1HEK A;  4CRI A;  4E7H A;  1M90 C;  5LJ5 f;  1Y07 A;  3CC4 A;  4A4E A;  3ER0 A;  1KC8 U;  3IP4 B;  4NL3 A;  1MGQ A;  1BIB A;  4LD6 A;  4C5G A;  2N1R A;  3WVD B;  1TH7 A;  2JH1 A;  2QQB A;  3K1Z A;  2A3V A;  5KL1 B;  3G4S A;  2O01 E;  1S72 T;  3AL0 B;  3BDL A;  4BD3 A;  1EIF A;  5GAN 8;  4P5N A;  2OAU A;  4M78 A;  4C5H A;  3VUZ A;  3QSU A;  4OJ5 A;  4M7D F;  5CKD A;  2K8A A;  5T14 A;  2EJF A;  3X28 B;  1VQ9 A;  1YIJ T;  4M77 C;  4M78 D;  1BKB A;  3JRZ A;  3L2R A;  2YX8 A;  4QVZ A;  1M1G A;  3H6Z A;  3KXT A;  4MMK A;  2Y90 A;  2JTM A;  5IN1 A;  5LJ3 g;  4BE2 A;  3INZ A;  3TRE A;  1GXI E;  3PGG A;  4FIB A;  5GAN 6;  4E47 A;  1NPR A;  1KBU A;  1G5V A;  3VV0 A;  3MP8 A;  5DLO A;  3KUF A;  2H3F A;  3JB9 G;  3HSB A;  2KVQ G;  3JAM E;  1I8F A;  3M5A A;  3N7S C;  3FC3 A;  2M1H A;  3GLX A;  3CCJ A;  4MDW A;  3NUQ A;  1WUD A;  1B34 A;  1JJ2 A;  4FZN A;  1VIF A;  3PSF A;  1ED1 A;  5HK0 A;  3QG1 A;  3JCM Q;  2E6Z A;  1A0P A;  4C0G A;  5LJ5 j;  3PMI A;  3E9G A;  3M53 A;  4L5G A;  1N9S A;  3X25 B;  5GAN 3;  2QA4 T;  3V7R A;  2EQM A;  3VKI A;  1VQL A;  4OJ6 A;  4F7U B;  1YT3 A;  5CRX A;  2LYA A;  4FZM A;  4QVC A;  3QDR B;  4Y28 E;  4E7K A;  3OQ5 A;  5GMK i;  2LKY A;  4YTL A;  3PT9 A;  2H3Q A;  1K8A U;  3RES A;  2VJ5 A;  2EJG A;  4OMF B;  2QDY B;  4C92 E;  3S6W A;  4OB0 B;  1QVP A;  4JJN K;  3H0L B;  3CPF A;  5IAY A;  3MEA A;  2K2V A;  3CBP A;  4J6Y A;  5GAO q;  3OW2 S;  2O4X A;  2HBJ A;  4JRI A;  4RG8 A;  3N7R C;  1NJI C;  1BYM A;  4M75 G;  2XK0 A;  4J6X A;  4BDZ A;  2L5Q A;  2EWN A;  4JMU A;  1YIT A;  3GNG A;  3AQF A;  1KD1 U;  4B9X A;  3OSS C;  2DVE A;  1YJW A;  2KHV A;  1VQ9 T;  5CCA A;  5LJ3 e;  4M77 B;  1N27 A;  1Y96 B;  4ME7 A;  2QQS A;  3HRU A;  1Y71 A;  5FRM A;  2H3V A;  2LQK A;  2D6F C;  2E1E A;  4XQ3 A;  3FDR A;  1VQK A;  3OS0 A;  4OB2 B;  2OTL A;  2FVU A;  2ZPH B;  1WJQ A;  1QVF S;  1K73 C;  4JDS A;  3I56 T;  1UEB A;  3GF5 A;  3L2U A;  2ZPF B;  2F2A B;  5LJ3 d;  3OYH A;  3N5B B;  1JBM A;  3HL8 A;  4J6W A;  4M75 E;  2G0A A;  5CK9 A;  3IG8 A;  2BUD A;  3HKS A;  2K89 A;  1QVG A;  3CCJ T;  2ZIX A;  1H64 1;  4E7I A;  4J8O A;  4C8Q G;  2XHC A;  4FT4 A;  3GOX A;  5GAN 5;  1QP3 A;  4O6J A;  1U1T A;  4C92 D;  3M56 A;  4M7A F;  3SAH A;  2Y4Y A;  2XDD A;  3MEW A;  3FEO A;  1BI1 A;  2I2L A;  2W03 A;  5GMK m;  4OP0 A;  2W7O A;  2MI6 A;  2M0O A;  4O3M A;  3MEV A;  3HRT A;  2LBO A;  5HKC A;  2L3R A;  2KIC A;  2HBK A;  2M0N A;  4KUI A;  4B9W A;  5AYF A;  5DY9 A;  1PVP A;  4BUG A;  1DJ7 B;  5M9O A;  1UGS B;  4OGE A;  4KBM B;  2K3X A;  4CDG A;  4HCZ A;  2DGZ A;  3TU4 K;  2GQV A;  2RK2 A;  1QW1 A;  3JCM b;  2XD0 A;  3LGL A;  4C8Q E;  4BE0 A;  2VKQ A;  3LLR A;  1VQ7 A;  3MHX A;  1WJS A;  2LT1 A;  4N0A A;  2VGN A;  3SWN C;  1Z1B A;  4HKE A;  2K4H A;  1SSF A;  4BDY A;  3C94 A;  4EMH A;  1JB0 E;  2EJ9 A;  1YJW T;  1Y7X A;  3S3O A;  2DJZ A;  4M78 B;  2E64 A;  5CR2 A;  2ZPG B;  1O75 A;  3QHS A;  5CKF A;  1WGS A;  3CME T;  3RFA A;  1OI1 A;  3X26 B;  1O9S A;  5CKH A;  2E1F A;  4CGZ A;  2LVM A;  4FE3 A;  1BI3 A;  3M9Q A;  1VQK T;  2ZPE B;  5A0D A;  2XG8 D;  5GMK l;  3CD6 A;  2XKO C;  3OS1 A;  1ZQ1 A;  2EFI A;  4QQD A;  4MZP A;  4BJQ A;  2E41 A;  2F5K A;  2MRL A;  1T94 A;  2LQ8 A;  3CXC S;  1L6N A;  2RI2 A;  2JZ2 A;  4QIW C;  1VIE A;  4M78 G;  1HXD A;  4QNL A;  1ZBX A;  4R56 A;  3A8O B;  5J3B A;  2F77 X;  2KNJ A;  2DXU A;  4PJO A;  1K9M U;  2G5I B;  3E1S A;  1NZ9 A;  3SD4 A;  3LWI A;  3PST A;  2GFU A;  4HCC A;  3QZ5 B;  1M5Q 1;  2R5A A;  2CYZ B;  3JB9 J;  4PJO D;  2F8L A;  1KHC A;  2DD4 A;  1Q7Y U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...