4C0ZA

The n-terminal domain of the streptococcus pyogenes pilus tip adhesin cpa
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
SVPNKQSSVQDYPWYGYDSYSKGYPDYSPLKTYHNLKVNLDGSKEYQAYCFNLTKHFPSKSDSVRSQWYKKLEGTNENFIKLADKPRIEDGQLQQNILRILYNGYPNDRNGIMKGIDPLNAILVTQNAIWYYTDSSYISDTSKAFQQEETDLKLDSQQLQLMRNALKRLINPKEVESLPNQVPANYQLSIFQSSDKTFQNLLSAEYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Model for the Covalent Adhesion of the Streptococcus Pyogenes Pilus Through a Thioester Bond.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
molecule keywords ANCILLARY PROTEIN 2
total genus 68
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.480 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4c0zA02
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0zA01
4BUGA 5A0DA 5A0LA 2XICA 2XIDA 2XI9A 5A0GA 4C0ZA
chains in the Genus database with same CATH superfamily
3E9FA 4BI3A 1UQVA 4F5RA 1HUOA 1VYUA 3UQ2A 5DLGA 3R6NA 3AN1A 2HBMA 4P4PA 1WLPB 1HK9A 2H3EB 2E5KA 2QTVA 1VQPT 5H2FU 2RI5A 1WDXA 5EWEA 1YJWT 3SDZA 1LPLA 4HVUA 1T3SA 1BNOA 2F2XA 5KFEA 3E58A 1TFRA 1WGSA 5FU7C 3K1RB 2ZXHA 2E8OA 1ZQIA 2JH7A 3MP6A 3S3MA 2M0OA 4G9BA 4YD1A 3QUTA 4IUVA 1LKYB 1ZQOA 1M8VA 2BZ8A 3MDCA 4FT4A 1QSSA 2LJ3A 2EJGA 3BS7A 1Q3VA 2M0YA 2JV3A 3C2LA 1C1AA 4AG2C 4JUVA 1SB3C 2H8HA 4CCHA 3EGDA 3JCMJ 1KSWA 2I2LA 4RPZA 2ZCFB 3R9KA 3MGIA 4QQ6A 1GRIA 1ZQAA 4JK1A 3V8KA 4RQ1A 4I2IA 4JWNA 1ZA1B 3ZDEA 1K73R 4YTLA 2X3XD 3BQ2A 1RXWA 2JTMA 3JB9F 4R55A 5GAN4 3HHTB 1BBZA 1UGRB 3CMAA 2XO7A 1X2QA 2VXFA 5DB9A 4Y2YA 3SAGA 3RB6A 2DUYA 4D8KA 4QZDA 3L2VA 5KFRA 3NTIA 4X5VA 4DO9A 1FO4A 1ZRMA 2VA2A 7ICJA 3WK9A 5LJ5f 2A1JA 1Z1BA 1N8RU 1M90R 1DRGA 1WHJA 2KKVA 2HCFA 2VV5A 2DM1A 3OHBA 2CREA 3C2MA 1MGQA 5CQXA 4KLOA 3I55Q 2EQUA 5CWRA 2EZXA 5KFMA 3S6WA 4J5YA 4OGEA 4CC4B 4ECVA 4DEXA 1DOQA 1N61A 3ZI4A 4F5NA 4DQQA 1W6XA 1NJZA 3S3OA 2KICA 1KQSS 3UATA 1ZQKA 3TADC 3CC2A 3V7SA 4ZGEB 3OYAA 1PD1A 4JRKA 1RAAB 1KIKA 4P5NA 5DQIA 5L1IA 5GAMh 2MAMA 4FSXA 5KTQA 1JXOA 1UJ0A 1K8AU 1ZQYA 4YR0A 4C0FA 4IQWA 2HL5C 2LPEA 4I2CA 1N5ZA 4CNQA 5KFBA 4DL5A 2MWOA 3UMBA 4C92C 3GPLA 4M75D 4WF2A 5M9OA 1Z4NA 3QU7A 1MQ2A 2QKQA 3AL0B 1QP3A 2Y9UA 2JS2A 1YIJQ 2RN8A 3OS5A 1JUDA 3SEIA 3PMIA 2RDIA 1NK8A 3LWHA 2A3LA 3E2UA 4EMKA 4C4SA 4FBTA 3CMEQ 1K4US 2DL7A 1AEYA 3SYZA 2VWFA 2BDPA 4ECXA 2XHCA 5GJWB 2EQJA 3IP4B 1IXRA 2YXYA 4DF4A 4R8UA 2KZ3A 2GBQA 5ALMA 1X2KA 2L3PA 3MBYA 2RQVA 3I5RA 3GIJA 8ICGA 1M9SA 4NL2A 4ZH4A 3CCVA 1ZQQA 3ME9A 3G6VA 2DRKA 4GC6A 5AT1B 4PJNA 1WYXA 1YWPA 2XC9A 1VA7A 2O01E 3VS3A 4QWEA 5GANg 4NV0A 4ZNXA 3SB2A 3VS0A 1VQ6T 2W9BB 2HNIA 4XTWA 5GMKe 4IIOA 1T3LA 2H5XA 2XY7A 5J0XA 4J9RA 2WSFE 2OWOA 4LD9K 9ICBA 4PLIA 3KUFA 4V2SA 3H7IA 3A8MB 1T7PA 2M1HA 4KLJA 1SIJA 3ER0A 1BPBA 4NWIA 4RQ7A 5KFOA 2A08A 5ALPA 3B0XA 1ABQA 1Q7YU 2K5LA 1KG1A 1M8MA 1Q46A 3LYIA 3PVXA 1Y0MA 4XU3A 3VC8A 2FMPA 5GAMg 4J6XA 1VQMT 2YTUA 1N6AA 3BQ0A 1NKBA 5L1MA 5EWFA 2E1HA 1S9FA 1JXLA 3PNCA 7ICSA 3QHSA 4B6MA 2EQMA 1EZZB 3GZFA 1D9FA 3Q8RB 1VQLA 1L7NA 3LDAA 2BQ3A 4Y2TA 2C2EA 4OMFB 5KFKA 5ALJA 4F4XA 2EZZA 1BI2A 4KBMB 2W54A 3OS1A 1YJNT 1M5Q1 3G6EA 2RF0A 2ASLA 4RQ4A 3JPSA 2EH9A 2LM4A 1ZD3A 3JCMh 1QKXA 3LWMA 4M9NA 1PM3A 1IIPA 1N5XA 5BOMA 4PHPA 4J9DA 4OMOA 9ICPA 4U7CA 2FZKB 2X4YA 1XQHA 3V8LA 2YSQA 2MMPA 2BR0A 1Q82C 4BE1A 5LJ5j 3IDWA 1VQ8A 1ZA2B 4BI8B 1YI2T 1X75C 2BUDA 1KKXA 2JEIA 3EG3A 3QYHB 4UB2A 1VQKT 3PMLA 4KTQA 5T14A 1QQJA 4M78F 1TOVA 4R64A 3VS2A 4MDXA 1ZQTA 1G3TA 4FZNA 1V9PA 5KFJA 2EVRA 1RADB 4Y2XA 2HD0A 1R77A 3CCST 5IIKA 4QZBA 1ZQGA 5KG4A 5C5JA 3U26A 2P0QA 3QDFA 3PX0A 1GBQA 2H3FA 1QH9A 1B0XA 2JGAA 1M4ZA 2ZPGB 4J6WA 1K73U 5AM2A 1VQ8Q 3HFOA 4BACA 1RYSA 1UCVA 2V1RA 4FFDA 3NVWA 2DWQA 3UXNA 4C80A 2FLLA 2IBKA 3H0IA 5D49A 1Q3UA 2KT8A 2LC4A 5ALSA 9ICWA 2FB7A 1QVFA 1O08A 1VQOA 3EGXA 5FRMA 3LYSA 2PVGB 2LM1A 4RNNA 1ZRNA 4IR9A 3HRSA 5KT7A 2HZYA 5GAN3 3CMAQ 1WHLA 3FC4A 5ALIA 1NJWA 1LJOA 4OD0A 5CKHA 4M75A 1V38A 2P35A 4IS7A 5CEHA 5DQGA 1VQLQ 5J0QA 1ZXIA 4PZOA 1R8OB 3M9QA 2DXCA 3A8GB 1VQPA 3EFSA 4PH5A 2COWA 4DSIA 3UQ0A 1CRXA 3CCJQ 3RJFA 1WHKA 3QO3A 2HL3A 1ZQBA 4FZLA 3D2SA 2D8CA 5ALNA 4II1A 7ICVA 3H0LB 2XCPA 3LH5A 4USAA 1S0NA 3PMTA 1KFSA 2OTJT 2F69A 5F9NA 1Z1VA 1MC8A 3P8HA 4PKCC 1KQ2A 2VKQA 2KG5A 2BE9B 3CC7A 4UATA 4EYHB 2E6NA 2G06A 3ONNA 4J9KA 1YJNQ 3FEOA 4RQ0A 2KVSA 1M2VB 1NZ9A 2MIOA 4AG1C 4UB3A 1U45A 5J0UA 2DVEA 1M6YA 1K8AC 4MHVA 2LHTA 1Z19A 4PJ0U 4UB1A 3EG0A 1VQ5T 3VYHB 2KHQA 3SAHA 1O75A 3M55A 4OMLA 4O3MA 5B5EU 3OTQA 5ALFA 1M1FA 1LVKA 3NTKA 5HMMA 3NTHA 1S77D 1KQSA 3IQLA 2HHSA 1TTHB 3SENA 3OSPA 9ICVA 2A0FB 5GAN6 2KRSA 2MUTA 4JB3A 1K1SA 5L1KA 2AGQA 4PLLA 2I5HA 4PZNA 3CCVT 1S72A 4AYBF 2BGWA 5AK3A 4J9GA 2NLUA 4OJ5A 3CC4T 1X43A 3MC1A 2J6TA 1ZETA 1B34B 1TS9A 2G08A 2LQNA 5DB7A 3DB4A 5KFLA 4FS1A 2QYZA 2K2VA 3GILA 1OQKA 4TUPA 3BDLA 3RKXA 1RG6A 2QA4T 4ZN1A 4KLMA 2BKEA 1HD3A 1NZPA 2PUOB 5FWCA 2KKPA 1X6IA 3D6JA 4BI4A 2R5MA 4UW9A 4F16A 4RNMA 1D8BA 3TU4K 5AI0A 5KYWB 4B9UA 5GTHU 3A8LB 3MEVA 1J2MA 3JB9I 4BY6B 1SL2A 1D1CA 1UGSB 3Q8MA 3ALRA 5A0LA 3SFMA 2AT1B 3FDRA 3OYBA 3X26B 3HRTA 3PIOA 4O5EA 1HEKA 7ICPA 5KCOA 5I21A 4DEYA 4RQ5A 4F7UG 3PE0A 3Q8KA 3UPQA 3CEYA 5AI6A 1UT5A 3M0RA 2Y4XA 2A1JB 1W2BP 2FMQA 3HP6A 1IXDA 4KLFA 3CW2C 1A0NB 2OYYA 3EG1A 3UXOA 3OYMA 4BWMA 2ZJ5A 8ICZA 3NGDA 2K5IA 1GXIE 5IILA 1Y96B 1PSFA 3OYJA 2LKYA 4OB0B 4ACOA 4M7DC 4BDPA 4BDZA 4LDXA 1JX4A 2DF6A 1VQ4A 4MFAA 2EAYA 1G8XA 4F17A 1KK7A 4IR1A 2RJFA 2E8MA 4YMMA 4WTOB 2CZ0B 4PJJA 4YXMA 3G4ST 1YITT 2WHEA 2G5IB 4Z8AA 2RJCA 1SZHA 2LP5A 4M7DD 1AWJA 4US9A 4PGYA 1NLOC 2EFIA 5DDYA 7AT1B 2VGNA 4NLCA 3NMZC 3OBWA 3ZL7C 2Q0ZX 3C1ZA 5KFQA 5KG5A 2PQWA 1BIBA 3V7JA 1I5LA 5ALOA 5EC7A 4E6RA 4C8MA 3PGGA 8ICMA 3WVDB 2K8AA 4RTUA 1XTDA 2FYKA 4E7JA 2BCUA 1QMCA 2EAMA 3M9MB 3RAQA 4DL4A 3TARA 2GNCA 4AFQC 3QIIA 3G71T 3SAFA 4EMKB 4NLZA 4QZ9A 4DBHA 3KBGA 1VQ7A 3CBMA 4HKEA 3EHRA 1XSNA 1K0SA 3OYLA 4ED3A 2PFNA 4ECRA 3TADA 1BIAA 1YCSB 3KBBA 2Y1IA 3QG1A 3EPIA 4RG2A 4NJ8A 1UGPB 2CH4A 2W3RA 4QZEA 1ZHIA 1SSHA 1Z9QA 4ED1A 1XNSA 4DBRA 5HMLA 2JM9A 3NGPA 3WKCA 9ICKA 5DKWA 4Y2PA 1L3TA 1IO6A 1AWWA 3VRZA 5J8YC 2P4TA 2OTLA 2BZFA 2KOBA 2PFOA 1QCNA 1JJ2S 3GP8A 2Y0SC 2EBPA 1M1KC 3AHUA 2HQEA 4J9OA 2C06A 2LYBA 4HYKA 4NY8A 2FZCB 5AHXA 4QQGA 2A28A 4M9LA 2P6RA 3K4GA 5ALDA 4RG8A 4RKUE 4LVSA 9ICOA 4EZ9A 3CRXA 4PFOA 4MMKA 1YBYA 2VIXA 4I2EA 3QJYA 2FPDA 1I5OB 3C95A 4YN4A 2SRCA 2M51A 5GMKm 3H6ZA 3EGXB 3RMQA 2YY6A 2OX7A 2ROLA 2X35A 3QWYA 2ASDA 3C0CA 1WWUA 3EZ5A 5HK0A 5KFXA 4KLQA 4JMUA 2YX8A 3D2NA 1X69A 2W03A 2RDJA 2GWSA 1SV4A 2VVKA 7ICHA 2XIDA 2MOXA 4PL1A 3VS6A 4QKUA 2HBLA 5D4BA 1KW4A 2DBMA 1QP2A 3JB9G 3B0YA 5K4LA 1BPZA 4LUDA 2KE9A 4BXOB 4M75F 1SV0C 4A4GA 4HA8A 1X6JA 2DQNB 5HNKA 1VIEA 3QUIA 1SV0A 1JXMA 1BU1A 1N56A 3OYKA 5KFIA 1N62A 2H3IA 3L2RA 2E8PA 1XNIA 5KYYB 4KH1B 2HEQA 2EANA 1AD5A 4ZGDB 4C0DC 1K1QA 2LI6A 2WACA 3VS7A 2KE7A 2A3VA 2P4RA 4Q44A 4BUGA 1WX6A 1SEMA 5D6YA 3ZDDA 2KV2A 1KJWA 4JS4A 2K4PA 2GQIA 4GXIA 4Z6FA 4EX6A 5J0YA 4Y91A 4C92B 2RQRA 3TI0A 1DJ7B 1V85A 3SZ2A 2CP3A 1R0CB 1VYVA 2ZPIB 2HQHA 1IM4A 3NRWA 4DS5A 5A0DA 4XAXB 3CPWS 4DOBA 2C2DA 3G4SA 3DLLA 2KN7A 2H3JA 1WZOA 2DKZA 3V6KA 2I1QA 4F50A 1D1BA 3NRZA 1V1CA 4KLSA 2ZJAA 2JT4A 5HY6A 4GLMA 2E3IA 1X42A 2ZIWB 4IUPA 4QW8A 2QB0B 4JJBA 1KQSP 4DL2A 1MNDA 3CCJT 4HT8A 2QGFB 1QQ5A 5GAN5 2DZCA 3HKZC 3RERA 1E6HA 1I8FA 1QVFS 3C1YA 4UARA 4O3SA 2JTFA 4F3OA 2RQWA 5KFTA 4QIWF 5AKGA 5CO7A 2VA8A 2ZUCA 2RHXA 5D46A 4FT2A 1KC8C 1Y7XA 3QPHA 9ICAA 1BB9A 1KRPA 2HKNA 2IVWA 4EMHA 2RM4A 4A63B 2EW3A 4Y2RA 5AM5A 1WXBA 5KYUB 2YDLA 5DM7R 4RTXA 5GAN8 1ABOA 2D1XA 3A5ZB 1IGQA 2WB1C 4Y2QA 5J2FA 1VQ5Q 1FFVA 4DOAA 1FMVA 1D8LA 4NLNA 2XU8A 1AZGB 2KP7A 2FO0A 3CC2Q 3JPOA 5J29A 3TAQA 1ZQJA 1S76D 2KTQA 3M6ZA 2R58A 3ZDCA 3C2KA 1K9AA 1AHJB 2E5QA 1ZUUA 2WFAA 3OBYA 2ZXIA 3HL8A 5L9XA 4BJQA 4RT2A 3PW5A 2W9MA 3PSFA 1ZQXA 1GFDA 1N60A 5DDMA 1PK1B 3T5HA 4F7UE 3IV6A 1J97A 4R65A 1MMAA 4ANJA 4OP0A 3OYDA 4M7AC 2KBTA 1PK3A 2VA3A 2A36A 1YJ9Q 3CCUQ 4KLUA 1YJWA 1JRIA 4YMNA 1KSPA 4E2FB 1U47A 1RL2A 1BVSA 4DOCA 5GAN7 3L4PA 1T8EA 5KG0A 1UEBA 3GDXA 1RXVA 2GH1A 1S1NA 3JAME 2KI7A 3LGLA 2BIVA 3UXPA 3H0MB 1ZQNA 1GO3F 5ALLA 1WG8A 1VDVA 5ALKA 1NYGA 2ABLA 4C0GA 3ORYA 2AIRB 2YMQA 3RKYA 3MPUB 3DV9A 2IOFK 2AGOA 5AIAA 2KVCA 3INZA 3KXTA 4E7HA 9ICEA 3A98A 1X9WA 2ZPHB 4O5VA 2NUPA 4B9TA 3SR6A 3KKAA 5FLXE 2K89A 2JRZA 1JI7A 4YP3A 4RUGA 5FWBA 1QLNA 1ZQRA 2EQYA 4RPYA 4R0KA 5C6SA 4ED7A 5KYXB 2K57A 3LH0A 4N0AA 5CA7A 1VQMQ 1RDFA 1QW1A 4J9CA 3UF4A 3CCRQ 2E6ZA 5J2IA 1ZX6A 2KAFA 4M75C 3SEMA 2K3BA 4A4FA 2CDTA 2FPEA 2FZGB 3QXEB 1K0XA 9ICMA 1EIFA 3M9OB 4M4ZA 2DL5A 2VUBA 1RLQC 5J2CA 2BZYA 1ARKA 4C0ZA 2L5QA 3HX0A 4J7FA 4O0IA 3WK7A 2RLTA 5BOLA 3EPGA 4Q45A 2PU9B 1K73C 1PKSA 3KZXA 4LDYA 1BNPA 3JCMX 4FSSA 3CP8A 1WHMA 4O6JA 4DQ2A 2DA9A 1YITQ 4F93B 1XU4A 4YR2A 2R8KA 4YFKA 4I28A 1FFUA 1OX8A 4MFCA 3BW1A 5I2SA 2DRMA 7ICQA 3NFCA 1SXDA 1M27C 2W55A 2VGMA 2OM6A 1V76A 4F5OA 9ICNA 3CD6A 4L6V5 3URGA 3C4SA 4FM4B 1V97A 2EJFA 2MU2A 3GOXA 2MPXC 1AWOA 2O2OA 2BCSA 2ZPFB 2OXOA 5AKYA 2DETA 2JTEA 1X01A 3OW2A 1VQ7T 4F5QA 1X66A 7ICOA 1W70A 2C0TA 4ORZA 2QAZA 5KFWA 3AT1B 1GL5A 2K6DA 1VQKA 3J81E 3GLXA 2DGZA 2LNHB 2RK1A 3L2UA 2NYVA 3N7PD 5EOZA 3EFOB 5KE3A 2OHFA 4QQDA 1VQ8T 3RRGA 1Y96A 2JR5A 1T4GA 1AOJA 2FLPA 1ZJMA 2OH2A 1A0PA 2B0CA 2ZIWA 2HSPA 3LK9A 2CZ7B 4DOWA 4TVRA 1Q81R 2PI4A 1RYRA 4ELVA 4AFUC 1Y88A 1BK2A 4BB7A 1BCOA 3TQ7P 3JCMg 2RHUA 1NK6A 1WHGA 3KTQA 2E41A 1NEGA 2DK3A 1H641 4QZAA 1UDLA 3GFKB 2X9HA 2FDRA 3CCQA 1P92A 3CMET 1RYUA 1PVQA 1IRXA 7ICLA 4HCCA 4GIBA 1D8YA 2JMCA 8ATCB 4MEYA 1SL1A 4OVAA 3OYCA 5JU5A 1OXJA 2E5SA 3H8MA 4CF3A 2V26A 4MZPA 4Q43A 4PGQA 5J0TA 2CP2A 4J8OA 4KLDA 3WVEB 4ED2A 4FYVB 8ICXA 2DEQA 1EX4A 4IL6U 4OMMA 2QDYB 2YUNA 4MZTA 1Q82R 3RF9A 1ZQPA 1OEBA 1D0XA 8ICLA 1KD1C 4IKFA 2PTKA 1UPHA 5ALGA 2HCKA 2LMJA 4O3PA 3QYGB 8ICKA 3LVWA 4M75E 5LJ3h 2ODGA 2QQ9A 2I6XA 4NXZA 3RH6A 1GCPA 1O03A 1R0BG 2RO0A 4G3IA 3RJIA 4XK8E 3I35A 4M7AF 7ICEA 6AT1B 4GLKA 1IHVA 1OOTA 2G0AA 3PT9A 5AK6A 4OO1J 9ICSA 3EH1A 4DBFA 1WQWA 4KX5A 2R8GA 5ALHA 4J9LA 3FM9A 2K3XA 1ZD5A 4Y92A 3X25B 1FXXA 3GNGA 1W2BS 3UMGA 3SV4A 3CPWA 1NKCA 1AT1B 4QVZA 1QQ7A 5HHHA 4KUDK 8ICAA 1TWBA 2LX7A 3L5KA 2KMTA 3RMSA 4ELZC 1BGXT 3OQ5A 2AJQA 3QEBZ 1VQ5A 3U23A 4RTVA 3M7DA 2SEMA 4C8QC 5ALXA 2ZIXA 3KHRA 3JCMb 2CSIA 2OCEA 3BJYA 3OW2S 3EG9B 1MUZA 4LE9A 1NPPA 2EZYA 2LMRA 3CNHA 4KMOB 2DTOA 4RTTA 4F7UB 1UHUA 4M7DG 4CGZA 2ES6A 2YQEA 4B6JA 3V72A 2JVVA 2KSOA 2ZTDA 4JJDA 3I9QA 5KG2A 2DLPA 4M77E 1Y57A 2AZSA 1CUKA 1PZNA 3CMEA 1NOMA 2GFUA 1SWWA 2KRMA 1RAEB 3RNJA 3UA7A 2HW3A 4UBCA 1D0YA 1RUWA 3REAB 3QEAZ 3H0HA 4AFZC 3CCSA 1Q81C 4F91B 5KYNA 8ICNA 4PFZA 3PO5A 2DIQA 3THKA 2F5KA 2D8HA 1G3SA 5DQHA 4K4IA 4NL9A 2LQKA 2CP7A 8ICSA 4PJOE 4LZGA 3MR5A 2WF6A 3V8JA 4O3QA 1ZQLA 4QWDA 1Z00B 4O9MA 4DQSA 2BCRA 4I2FA 2F1JA 2YUOA 2NUZA 3HILA 3FYHA 1VQNA 3QSUA 3JPTA 1WUDA 1ZQSA 1T0JA 2L5YA 1NG2A 4JRPA 4QZHA 2K60A 3Q8PB 5KG1A 5B66U 2KMDA 1FMKA 4RTWA 1N9SA 3EGDB 3HKZF 3FJPA 1X9XA 4CRXA 2OAUA 2NUTB 4AP9A 2HBPA 3TKAA 3CMAT 3SHWA 2ZG6A 3M8SA 5J26A 3KHGA 1HYOA 2QB1A 2CT4A 1BPYA 4PJOA 1NM7A 2LZ6B 4X34A 2XGQA 2KZZA 4RZRA 3SWNA 2CKKA 2RHZA 5KYUA 1NK4A 2K4HA 3FDSA 2YRCA 2F8LA 1NYFA 2BPCA 2H3ZA 1WPYA 1LB2B 1L7PA 2LYHA 5HHIA 1TK0A 2YMLA 1U48A 1M2OA 3CXCS 3C5FA 1WWVA 2RI3A 2GTJA 8ICEA 4CDGA 1S0VA 2HKQB 4CC2A 4B9MA 4YXJA 2OEHA 3F2CA 1QKWA 3M54A 3MP8A 4QNLA 4KGVB 1F1BB 3G6XA 3PW4A 5IN1A 1IV8A 4QWAA 5KFUA 3QUCA 1T0HA 1XSLA 3M6KA 4DS4A 3LLRA 3QBYA 3CXCA 2FI1A 2P84A 2FJ6A 1ZYQA 2DL0A 1PSEA 2OJ2A 4PJOG 4Q5WA 2R8HA 5JUMA 3EYZA 1AWXA 4I2AA 4IQUA 1T94A 1KFTA 2J7IA 2K3YA 3CCMT 1G2BA 5IHNA 2YUQA 4E7LA 1Y71A 2QEXQ 1X27A 3F53A 4JV1A 3PVLA 3DEEA 1UGVA 4MFFA 5J2BA 1KBUA 2MCNA 2YLBA 3JB9J 2NRXA 3WU2U 4Q8EA 2EGEA 3VS4A 2GOLA 2EYYA 5CR2A 3CYMA 2NRZA 2O88A 3P8BB 1K5OA 4HAIA 4JV0A 3RBEA 1CEZA 4LDUA 2C22A 5L23A 5AKEA 1YHQT 1UFFA 1WI7A 4R8UB 3IN5A 5DLQE 3T9NA 4D8DA 1JJ2A 1H92A 3IRUA 1W4SA 3I56Q 1L5UA 2K4YA 4KLEA 3CCQT 2E8NA 1K9MU 3RJGA 2AQ4A 2FHDA 4NOYA 1ED1A 1SKSA 4ECZA 5AKIA 4C7YA 2QA4A 3K75D 1SZPA 4AYBC 4DL7A 2RHYA 4J9MA 4RCBA 3RJEA 1N63A 1BPXA 4MZMA 2W9BA 4FYXB 2YN4A 4QZGA 4KULA 3JCMW 2N1RA 2HOIA 4MEXA 3PSIA 3N5BB 1OUQA 4IRCA 4P0QB 1M90U 2K8BB 4IC9A 4KITB 1VQ9Q 2WF5A 2BQRA 2B6GA 2DF4B 1Z4OA 2A1AA 2XGPA 1I0CA 3A0BU 4ELTA 1VUBA 3A1PA 3KKAC 4B9LA 3G1JA 4F7UA 3HRDD 4J9IA 4JZ3A 1DK2A 2YB4A 5ALRA 1KDHA 1ZQVA 2XI9A 2RHFA 3PZPA 5L1LA 4DCCA 3VU3C 5CQYA 3KFUF 1SGGA 2V8JA 1YIJT 2W43A 4PPXA 1KD1R 1LVHA 3PSPA 5KFAA 4RT3A 4DLGA 1U49A 1K8AR 3CD6T 2X51A 1ECWA 2OAWA 5F9LA 2Z7JA 1MN8A 1GFCA 3Q8QB 4J9FA 5A0GA 2DD5A 4A54A 3BZKA 3PW2A 2DYIA 3CC7T 4IQVA 1NLPC 4OB3B 2A7YA 3QU4A 4M7AA 5KCHA 4I27A 2EGAA 4R63A 3H9NA 3H4DA 2FPMA 3RESA 3PMNA 5C0MA 3HWTA 3H4BA 1QCFA 1ZLMA 3C94A 7ICNA 1HSQA 2FE9A 5TZVA 3BE3A 1GBRA 1S0MA 3OYHA 2A37A 2PMZC 3H8SA 1TVAA 5IINA 2LCLA 2CRXA 1RZTA 2Y4YA 4A4EA 3RAXA 2IG0A 2YRDA 1SWVA 2GCXA 1YJ9A 4F04B 4C8QG 1TAQA 1RPLA 2MF2A 1OZ2A 2HMAA 2D6FC 2XKOC 4IUQA 4C0DB 1AROP 1F0MA 2D6FA 3AMZA 4RQMA 9ICIA 2EIFA 4ATOA 1F5SA 1X40A 1COOA 2K7AA 1XWLA 3AM9A 3VRYA 3D2QA 3RFAA 4M7DE 4M7AG 4GBQA 3TCJA 4EX7A 9ICUA 3HP9A 1L8LA 1ZQ1C 1S97A 2E3TA 3AQEA 9ICLA 2BQUA 5KFZA 4F4KA 4PL2A 2CH4W 2WSEE 3CCEA 2PKEA 2L3RA 2BE7D 3V6JA 1U1TA 5J0RA 1KD1U 4RUCA 1VQNQ 4KH0B 3WKDA 2O9SA 2R18A 1OZ3A 3RBBB 1VQLT 3X20B 3CCEQ 1B34A 2X4WA 1XOVA 2QEXA 1L3VA 2YWWA 4DFPA 1KHIA 3K1ZA 4KGZB 3LWIA 3FB9A 3VUZA 2NRTA 7ICFA 2ZPEB 4C5IA 3O8VA 9ICJA 4M77D 3OJSA 3VUBA 1IG6A 1H38A 3OB9A 1NNLA 4J9HA 1TU0B 2M16A 3KHHA 2RB6A 2X4JA 3MGHA 4I2BA 4M75G 2CT3A 2C28A 5J0OA 2G5HB 2P0KA 4J7IA 5GANd 5KT5A 4XTZA 3M57A 1OV3A 1C6VX 5LJ5h 5HR6A 2QDLA 4ICAA 1TUCA 4N4IA 3BS5A 4PJOD 3L2ZA 3MR3A 3TAPA 2LT1A 4GY5A 1S72Q 2PMZF 4UAWA 1AZEA 3C21A 4PJOF 2RQUA 4MDWA 2PZ1A 1BPEA 1D3BB 3WK5A 2FG0A 1KN5A 3CBPA 2AHOB 4RQ3A 4LZDA 3HT3A 3N7RC 5ALTA 2JS0A 4M78D 3J80E 1ZSZB 4OB2B 1SL0A 4C92G 4EELA 1HJDA 3H40A 4QT7A 5ALZA 1IB8A 5CK9A 3CCVQ 2MUTB 1WYGA 1XO0A 4E0DA 2DBYA 5FU6C 4TQRA 2QQSA 4PFPA 3GIMA 4Q8FA 3OPXA 2AGPA 5AM3A 1M1KU 2DE0X 3S6JA 2GTOA 1KQQA 4F2SA 4IUUA 4RNOA 4C92F 2DPPB 2YMPA 3WKAA 3N7SC 3UMCA 1JIHA 2YB1A 4IRKA 3RB3A 4JJCA 4J9QA 3LWLA 2KXCA 1KC8U 1RI9A 5GAMf 3UM9A 1KFDA 1ZOLA 1OX9A 4QZFA 2RQ5A 5AIBA 2VANA 9ICTA 5DY9A 5GMKi 5GAMj 4JRQA 1KQ1A 1RAFB 2KHVA 4X9DA 1RAIB 1UHCA 4BD3A 4RMOA 2RH2A 5GANh 2LCSA 4K4GA 1WJSA 1UT8A 4OCZA 4P0PA 2LQWA 3PIPA 3KZIU 1JRPA 5HP4A 3TSZA 5ALUA 1WCLA 1QCKA 4N4HA 4C8LA 2XVTA 1KEJA 1JB0E 3P8DA 4C8KA 1E6GA 3E1SA 2GO7A 3I28A 3M0SA 4YD2A 2W9CB 1H8KA 3MO8A 4AFSC 3ICXA 1WXTA 1XSPA 5IXFA 3RH4A 1I07A 5GAOn 4DSLA 2V1QA 5EWGA 3GIKA 1BI3A 3SV3A 4M77B 2HSEB 4M04A 4IURA 4BXOA 1BI0A 4J83A 4EIKA 4QVDA 1Q7YR 1VQ7Q 3JV3A 1Z00A 3M5AA 1SRLA 4JRIA 5DBAA 4RTYA 1J2NA 2ESEA 5J2EA 2E65A 5J2KA 5J3BA 5I22A 5LJ3e 2V8IA 1PKTA 3OSNA 4Z02A 5KYYA 2GFAA 5CKFA 2BHNA 1RQLA 1D0ZA 2KYMA 3CCLT 4RTZA 4BDYA 4IIMA 2E1FA 2DXTA 4KT0E 3V7LA 3CPWP 1VQ4Q 1JN3A 1TUGB 2MRLA 4EPCA 8ICVA 3CCMQ 2F44A 3OMGA 5ALEA 1OYXA 1F44A 3PVQA 2RRDA 4C8QE 1CKAA 2DL8A 1LOJA 2L89A 3CQTA 2P66A 4DF8A 2ZUDA 1I4K1 4F7UF 1U8RA 1ZQWA 3VCBA 2ZIVA 2E4HA 1ZQHA 2NRVA 4LNPA 3AQFA 1L3SA 1L7MA 1TV9A 4B9SA 5AI9A 2IHNA 2CYZB 1WHHA 3PV8A 1JQQA 3G6EQ 1I1JA 1ZSZC 2KT1A 5FRNA 5ECAA 2QARA 1L8OA 2KJ8A 1JROA 3E0FA 4E7KA 2LRQA 1KTQA 5GAMe 2G3RA 4ZTFA 3T5KA 2XMFA 2KXDA 1QWEA 3JCMQ 4FIBA 4RUAA 1TK8A 1RI0A 2EJ9A 1RABB 3JSCA 4J9SA 3QJ6A 4A53A 2E3HA 4JUZA 1O9SA 3A8HB 3QUQA 4DSJA 3TACB 3ZD8A 3IHQB 3F2BA 4EBDA 1SXEA 4Z6DA 5KAIU 2O4XB 3EFRA 4Z88A 1COKA 2O9VA 4LDVA 5CAIA 2FRYA 2P6UA 2RJEA 3HW8A 3M58A 1HIWA 5ALYA 3RIRA 4M9JA 2DTIA 2HI0A 3M53A 3PX4A 2OTLT 2E64A 2AQ0A 8ICJA 1WJRA 3UA6A 5AYFA 1UTIA 3Q1JA 1TK5A 3RJHA 3OYNA 2XDPA 4TQSA 2RJDA 4M0AA 2IIMA 3M56A 2YUPA 3KHLA 2C2RA 1VQPQ 2F1LA 2F76X 4EMGA 2HAXA 3HTRA 1NK5A 2CP0A 1G3YA 5LJ3f 2NWMA 1D9DA 3H41A 5KFCA 4DQIA 2QGGA 3HJEA 1ZSZA 3MR6A 3M0UA 4C5EA 1K76A 5LJ3d 1DGSA 3M1YA 3GIIA 3T79A 2XICA 3H0RB 2R8JA 2GF7A 1G3WA 4KUIA 3I55A 5AKJA 3OSVA 8ICHA 1VQ4T 4M78B 2WF9A 1QVGS 4EENA 3RDVA 5G5GA 1QQ6A 2AKKA 2JMGA 3PR5B 4BGDA 3WK6A 3OYIA 3UPUA 2AXTU 1QVFP 4M9HA 4EMKC 3FLGA 3J81j 1RLPC 5GAN2 4YVZA 4Y28E 3EAEA 2IOFA 1TKDA 3MEAA 1A6SA 7ICKA 4TURA 2HHVA 2VYTA 4YG2A 4J9NA 2LT4A 3CCLA 5IAYA 2BZXA 2PFPA 3TVTA 2RMOA 1FYNA 1WQ7A 2R8IA 2HHQA 3G6ET 2PI5A 1B7TA 3C23A 3AUOA 2ZJ8A 1D3BA 3R6OA 3JPNA 1S10A 5IHKA 3PW7A 4CE6A 4PJOC 1PWTA 5KFGA 5EE3A 4RQ6A 3RR8A 4Y2JA 4M78E 3IG5A 5D7UA 3OS0A 8ICUA 2KJ9A 2VXEA 2H3VA 1NPRA 4PNOA 1OI1A 1VQOQ 1B4FA 2W9CA 2D8JA 3PR4A 3RBDA 2D0NA 1OU9A 1BKBA 2Y90A 2ALZA 1JALA 1X9SA 1MV0B 3M8RA 3REBB 3QYPA 1QTMA 3H0FA 5GMKj 5JRTA 4M77A 2ISOA 4M9GA 4HCZA 1J3TA 5KFVA 2YHTA 4M77C 4HCBA 4JLGA 4XA5A 1NJIC 4EBCA 4ECQA 4DSFA 7ICGA 2HDOA 1SRMA 4BWJA 3MEWA 1WA7A 1YWOA 3BDPA 1PRMC 4JS5A 2J6OA 2OTLQ 5J2DA 1YN8A 2ATLA 5CKEA 2Q4TA 4UAZA 1WNLA 3KD3A 2ZIUB 2J6UA 4ELUA 2KFZA 4UBBA 2WF7A 2HOFA 2COZA 4C92A 1Z3EB 1U4BA 4ECWA 2V4QA 2BCVA 3OYGA 1ZQUA 4HT9A 1M1KR 3N28A 1ZQFA 2LJ1A 1L7OA 4Y2UA 2WTFA 3SMVA 2LTOA 2ROTA 3BS5B 1JO8A 3PNWC 1S72T 4B9NA 2XG8D 2MYSA 2QTXA 4KGXB 1M3CA 2IMWP 2V9WA 3GU3A 2F8KA 3OA6A 4B9WA 1YI2Q 4FW2A 4UB4A 4OF1A 5E79U 2Y9TA 3NASA 2V8KA 1YHQA 2ASJA 2KNJA 3GV8B 5JTIA 8ICFA 2CGHA 2XK0A 4NS5A 3FAHA 1SKUB 4RCCA 1LKYA 7ICUA 1YJWQ 3C12A 2RHIA 5KE2A 1SHFA 4E7SA 1FEZA 5EE0A 4JDSA 2JUFA 4KLGA 2AK5A 2G07A 5FU6B 2DAQA 5LJ3j 4M7AD 1B07A 3V7CA 1PK1A 3OW2P 3QZ9B 4J6YA 4XU2A 3OY9A 2KDSA 3CC4A 1SG5A 3BQTA 2HBKA 1S0OA 2CS7A 4GXJA 3OSSC 2X4XA 4ECUA 4O5KA 5DGBA 2XDDA 4C8QD 1K9MC 1ZD4A 2CZ1B 4DL3A 5KG6A 5LJ5g 8ICQA 1ZUKA 5KG7A 3KOOA 3V7KA 5KAFU 4C4RA 4FS2A 3FRNA 2KGTA 1NI3A 1YCYA 2JOYA 2KROA 4M47A 3META 4M77G 4O3RA 1SPKA 4ELYC 1VQ9T 1N8RC 2KVQG 4KN4A 8ICOA 1OU8A 1ZQEA 2KYBA 1FMWA 1HXDA 2ZGWA 2W8LA 4I2JA 2W0ZA 2RD1A 2QXFA 1QVGP 5GMKl 2XD0A 5DB8A 2IPOB 1DGJA 3G71A 3CC2T 5DLOA 1ZD2P 4XQ3A 4I2DA 4F5PA 5KFHA 2F77X 4F4WA 2ZAEA 1LCKA 5EE9A 3X24B 3RTVA 3E19A 3SD4A 1U1SA 2BKDN 1YI2A 5J2GA 2J6KA 2J06A 4RPXA 2HHUA 4OMNA 1NEBA 9ICQA 1M1GA 2KZMA 5LL6S 4NLKA 2I9GA 4A4KA 5CRXA 1I81A 2K79A 2JXJA 3NS1A 4GLXA 2K9GA 4UB6U 2ZIXB 3TEEA 2KIWA 3CCLQ 3PFSA 3QZ8A 2PXIA 4R56A 2KD1A 3T3FA 1IZ6A 4NM2A 1Q86R 3ETRA 1MMNA 2PUKB 1NK9A 2CUDA 1XC9A 5GTIU 4ED6A 1PD0A 2DL4A 1U5SA 5GMKh 2KJ5A 4I29A 1UA1A 1OPKA 3JRZA 3TANA 3OYEA 2M9NA 3I5SA 1M3BA 1VJ5A 2KSOB 3WKEA 4FW1A 2IHMA 3OJUA 3LX7A 4N4GA 2M9UA 2MA1A 2JZ2A 4ECSA 5DBBA 4F4YA 1M3AA 5BPCA 2DXUA 5CKBA 3NVZA 5KYXA 8ICYA 3QKJA 1SSFA 2K4IA 1N2XA 3EHQA 4IRDA 5KH6A 4I2HA 5HCKA 4F2RA 2VJ4A 2UVRA 4C8OA 1UE9A 3EH2A 4QW9A 2K5FA 2FPFA 9ICHA 2HBWA 4C92D 2QARB 8ICPA 5G5HA 4K11A 4KLTA 3JPRA 2F2WA 4Z89A 2YT6A 2KK0A 3L3FX 4J9EA 1VQ6Q 1QWFA 2WAQC 3NPFA 3QU9A 2DPJA 4DFKA 1NJXA 4NL3A 2R5AA 3M4YA 5CIUA 1E7OA 1JJ2P 2Y0SF 1YZ6A 2KFNA 2PVOB 4DA4A 2ZUBA 2HOQA 2NUTA 4GXKA 2O4XA 2EKOA 3LW5E 1Q86U 2D9TA 3N4MB 3RH5A 5AM0A 4R66A 5J2AA 5KFDA 3VJPA 3DKMA 1SF9A 2RP5A 1QVGA 2EAPA 4GC7A 2R57A 4A4HA 3THVA 4FU6A 3H8ZA 1YJNA 3SWNB 1VQ6A 3IG8A 2FPLA 3MHXA 9ICXA 1NKEA 4OB1B 4QZ8A 4M7DA 2EWNA 3E9GA 2DXBA 2HDAA 1WFWA 3EFOA 4XTXA 1EXNA 2GQVA 1KHCA 1X2IA 4OJPA 5J2HA 1Q8KA 3ISDA 5AKXA 3CC4Q 2QI2A 4A8EA 1XS9D 1WCNA 4EEYA 1X6GA 3WK4A 4JPBW 3BFMA 1FWZA 5AI8A 2FEIA 4JZ4A 3RB4A 3NUQA 2K4EA 3EUB2 4M6WB 3Q8LA 3OS2A 2EYXA 4Y2SA 1K1ZA 4OMQA 4PJMA 3JCMc 2HVIA 2L2PA 3QXGA 3PTAA 3MABA 1MMDA 4RQ8A 3ZD9A 1KC8R 4M77F 5DB6A 1ZBJA 2EKHA 8ICWA 3HRUA 4MF8A 2VKNA 4FO6A 4UC4A 2LNVA 3H8WA 2D3DA 5KFFA 3TFRA 4PL6A 2FMSA 3Q8SB 1HUZA 5KFSA 4Y2VA 2K8CB 4UB8U 4PHEA 3DB3A 9ATCB 2L8DA 4FYYB 5GJVB 2F2AB 4QJFB 3O0FA 1X6OA 5GAOq 2W3SA 1FX7A 4F8RA 1ZQCA 5DG8A 4ESRA 4B9VA 2J6FA 4PJLA 5CR0A 3CCQQ 3PW0A 4L5GA 3D7SB 4ZN3A 5LJ3g 5GAOl 3ASKA 5LJ5d 4EBEA 3G6YA 1OW5A 2FLNA 4NL9C 2BPFA 4FZMA 3ZBDA 2DBKA 5HKCA 5GAMd 3JCMf 2V4RA 1PUZA 1VQOT 2KNBB 3TSWA 1BYMA 1C0MA 2O31A 9ICGA 2KEAA 3PX6A 4ED0A 1T3NA 2L3SA 1N48A 3NVYA 4BE0A 3L2WA 5J8YA 5KT4A 2HHTA 2DERA 3AU6A 1KLNA 3BY7A 4YR3A 5ALQA 4ZGJB 4KLLA 2VASA 4X9CA 1ZQDA 1N5WA 5J0SA 2GLEA 2ISPA 1VQ9A 1QVPA 1RQNA 2EQIA 2ZIUA 1IREB 5KFYA 4UAUA 4TUQA 5KYWA 1BCMA 3NHNA 5IH2A 2L3QA 4WJ3B 1VQKQ 4FL6A 4US8A 3CD6Q 4PGXA 1DK3A 2MI6A 4LD6A 4WCIA 2M0NA 2EGCA 3G71Q 3ZEHA 2C0OA 4PJOB 1CI4A 4LN2A 1PHTA 2DFLA 3PY8A 1T3QA 1CKBA 1NK7A 1W2BA 4P4MA 4CF5A 5GANf 1TSFA 2K2MA 4EDUA 2DNUA 3BQ7A 1JU5C 2E10A 3GF5A 1RAGB 2EQKA 3JPPA 1YJ9T 5IIJA 2KQWA 3KFVA 1JBMA 1UHFA 4DLEA 3AEVA 2F5TX 2KR3A 4OMPA 5GANj 2KRNA 5FU7B 3QU5A 3ED5A 3RJJA 3ZFJA 2JZBB 1IHWA 1NE8A 4QWCA 4M7AB 1VQMA 4QW2A 2KK4A 5IT9E 1Q81U 3QZ7A 2FPKA 2DO3A 5I2MA 1N27A 4XTVA 4F72A 2EYZA 3N97B 2RQTA 4M78C 5AK5A 5AM4A 4XRHA 1Q95G 2WSCE 5AM1A 2A19A 3HKSA 5FROA 5AKLA 5FW9A 3VV0A 2QA4Q 4C8QB 5I11A 5DG7A 5KT2A 2ZZDA 2DVJA 3F5AA 1KL9A 3SWNC 1TG0A 1ZJNA 2FRWA 4XU0A 3JCMe 5J2JA 1U3OA 5KFPA 4KLHA 4Z6CA 3C5GA 4ME7A 2L0AA 2JJ9A 3M0PA 4DFDA 1B43A 4IUTA 2BTTA 7ICIA 4MF2A 3VS5A 5GAOr 1S8OA 2W11A 1A77A 2EAOA 2KEYA 5CJ7A 3M59A 4O3OA 3HFNA 3EWAA 1L3UA 4OJOA 2JNGA 1AVZC 3OMCA 4OJLA 4FYWB 1UUEA 4F71A 3QNMA 2PFQA 1UB4A 1GCQC 1TXQA 3M9NB 4OGCA 1PNJA 4LXCA 3F5EA 3JCMV 2G09A 1RACB 3GIBA 3M0QA 3L42A 3V6HA 4DFMA 2HSZA 2WF8A 4J9PA 2W7PA 3BZCA 4JWMA 3EG2A 1QCOA 3OYYA 1JEGA 3V7RA 1MQ3A 1YITA 5FP0A 2VB6A 2DTHA 5L8RE 3GV5B 2JEFA 1PCXA 2LCCA 4VUBA 2DKXA 4DQRA 1TE2A 3TREA 2HQXA 4LDWA 3HPWA 3BDUA 2PVDB 4JLIA 2JHDA 1S5LU 1WJQA 4DFJA 4P0QA 1MMGA 3H8JA 4UASA 3RKWA 2NYSA 5GANe 1QLYA 3VKIA 2ED0A 1AQ6A 4ECTA 5AKKA 1EFNA 1Z9ZA 4ZOHC 4D6WA 3QWXX 3DLMA 4F14A 5DG9A 3G7ZA 4M7DB 5EE1A 4ED8A 5AKHA 3CCJA 4DEZA 5IXBA 4Z6EA 2DD4A 4M78G 5J0PA 5F3XB 1MSWD 1URJA 2RPNA 2CP6A 3RUXA 1ZQZA 2HHWA 2LBOA 2QB0A 4RU9A 4L59A 3I56A 5KNIA 3RJKA 4DOVA 1GCQA 3CCSQ 4M7DF 4DQPA 3BQ1A 5KT6A 2HBJA 1LNXA 2PNIA 1D09B 3DDHA 2ATCB 3SD7A 2QK0A 3L2QA 1ZSGA 4I2GA 4C4TA 1MNEA 3PO4A 2AHJB 2RI2A 3CCUT 4C8QF 5HK3A 3VYGA 2F3NA 3ISCA 2F1IA 4DL6A 2RNAA 4UAYA 4PHDA 1IGUA 4NM1A 2QQAA 2UVUA 4CRIA 1PG5B 2DX1A 2BCQA 2W7OA 2E12A 3UDCA 2VJ5A 3ISBA 4QZCA 4DSKA 3QDRB 5AK4A 1SKWA 4XQ8A 3ZDBA 2NV3A 5EG2A 5GAOp 2DEUA 5AICA 3ULRB 1UGQB 2ZPBB 1N8RR 2JEJA 2YLCA 3WKBA 3HPOA 2JMAA 3LVVA 5KFNA 3OHAA 4DSEA 2QQRA 3QX7A 2ESWA 2DMOA 3AU2A 3WXMB 1ZQ1A 2GGRA 2J6SA 5ALVA 5GAOm 4FCYA 2MWPA 4AT1B 2JW4A 3CCRT 1X9MA 3I1YA 4EZ6A 1ZBXA 2NUPB 4E7IA 3GBQA 2EYQA 3SQIA 2WAQF 3B9JA 1MA7A 2ECZA 2F1HA 2WB1F 2QQBA 3JCMP 1SKRA 2P0PA 1UG1A 1VQNT 4QWBA 3GNFB 2IOHA 5AI5A 4P4OA 1YZ7A 2KY9A 4X1VA 4EYIB 1RAHB 3JB9D 4RQ2A 2JN0A 3UWNA 3F2DA 2E1EA 4MMLA 2JZBA 3QU2A 3QZ5B 5CHGA 2DJQA 8ICRA 4YMOA 4BE2A 1PVPA 5DGAA 4M6WA 1MHNA 1PVRA 1NZBA 1Q82U 2B86A 3NVVA 3ZDAA 5CB1A 3UT1A 4P2HA 3MEUA 1YP5A 2LQ8A 2VC8A 4JJNK 1QSLA 2CZ6B 1N9RA 3S3NA 4C92E 2JEGA 2DILA 4KMUA 2J05A 4P0PB 1BI1A 2B21A 2CUBA 3TQ1A 5AKZA 1TAUA 2O6KA 2NO4A 5CP2A 1M90C 2BPGA 2HMXA 4EEKA 1B3QA 1OPLA 3C29A 5CKDA 4E47A 2ZIVB 2W04A 4PHAA 3JCMd 5D6WA 4UB5A 4AMCA 2XY6A 3IM1A 1UECA 5KL1B 2ZTCA 1P7DA 2ED1A 2QEXT 1K9MR 4QIWC 4LUEA 2EYWA 3GV7B 8AT1B 4UQGA 2F2VA 5IHIA 7ICTA 5CCAA 1ZUYA 5C0YA 2C0IA 1WIEA 5AI4A 1M30A 5IIOA 4HVVA 5CVIA 3MCAB 2DJZA 1PC0A 1BPDA 1YFNA 2MK5A 1YHQQ 1HJPA 8ICIA 2BDUA 5IIMA 2LYAA 4BX9C 3I56T 3OGUA 3GQCA 2IA6A 4RQNA 4IQTA 3A0HU 2Y1JA 4CI0C 4XTUA 2CXYA 2UVWA 2HVHA 3WK8A 4KLIA 1G83A 1PRLC 1L6NA 1VOMA 3MKDA 1JMSA 4J9BA 4C7ZA 5KL8B 4HVWA 1SHGA 4K4HA 2Z0WA 1NK0A 3CBOA 3EW9A 2XCAA 1XJWB 2DIGA 3CCRA 2CSQA 2EPDA 1H3HA 1WXUA 5KG3A 2DPIA 4XTYA 1UJYA 5J0WA 3O5ZA 1U9LA 3TFSA 5TISU 4HXJA 3G4SQ 1TUDA 5ALWA 2YMMA 2DZ9A 4KX3A 3T5LA 4KRTA 2YRVA 4M75B 4UAVA 2E70A 2EDUA 3JPQA 2AU0A 3RB0A 2FVUA 4XUSA 4XU1A 1TAMA 3QUBA 7ICMA 2DL3A 4ECYA 2NO5A 4O3NA 1Q7YC 1NJIR 1KFZA 2COYA 3M4GA 9ICCA 3A8OB 1ACMB 4C5GA 1VIFA 4GFJA 5HR7A 1LV5A 2XY5A 2CP5A 1Y07A 3MDAA 1DXSA 2RA2A 3HSBA 1A76A 3MR2A 2UVVA 4FE3A 4M2YA 1V29B 4NLGA 4U6PA 1X6BA 3CCUA 3I76A 1B22A 3NTUA 1NBEB 1JXEA 8ICTA 1YIJA 1NJIU 3E2EA 2FL7A 2QG9B 8ICCA 4N0AC 1G5VA 4C8NA 3CC7Q 4DBQA 3MJXA 2H3QA 2LVMA 1H3ZA 3FJ5A 4QVCA 2JXBA 3EG9A 4ZTJA 2AH5A 2LX9A 7ICRA 2DYBA 2OI3A 5IIIA 5KT3A 4CC3A 1VLBA 3EGUA 3RR7A 1TH7A 4CC7A 1OULA 4BY6C 4LJXA 2HHXA 3SI8A 4F92B 3QE9Y 1CSKA 3CXCP 2XDBA 1ZQMA 2JM8A 3F70A 4B9XA 2KIVA 1VYTA 5A2QE 2QLTA 2MAXA 8ICBA 4E7ZA 3M0TA 4DWIA 2I0NA 1C7YA 4JV2A 2D0QB 5DBCA 3RRHA 4F4ZA 2ENMA 2RK2A 2M02A 1FIQA 1QSYA 2W9AA 3OYFA 1RM6C 3LGFA 4OJ6A 2NRWA 4YQWA 2AKLA 4KN7A 3JB9H 5DLFA 1MV3A 4M78A 5LJ5e 2MSNA 1Q86C 5L1JA 2DFUA 3J7AF 4YCXA 2W8KA 2OTJQ 3T5JA 4HCKA 2DKGA 3FC3A 4FBUA 3MFIA 3I55T 1W1FA 4PK4A 2JH1A 1UA0A 9ICFA 1U06A 2LJ0A 2CPRA 3MFHA 1YNZA 3C28A 3FIFA 2CN1A 3VS1A 1YT3A 3L1AA 2LDMA 1M2VA 4C8QA 2X3WD 5J39A 4C5HA 2QASA 3RR6A 2G6FX 3CCET 1NJYA 2ZTEA 3MP1A 2B8AA 3X28B 4QZIA 2AZVA 2KSSA 1D1AA 1C20A 4M7AE 3MGVA 4CF4A 4TUSA 2W10A 3ETLA 4NLBA 1XO1A 5D6XA 9ICRA 3CCMA 2OTJA 4J03A 3CPFA 3PSTA 4O5CA
chains in the Genus database with same CATH topology
3E9FA 4BI3A 2HBMA 1VQPT 1HK9A 2RI5A 1YJWT 3SDZA 1WGSA 5FU7C 2ZXHA 2JH7A 3MP6A 3S3MA 2M0OA 4IUVA 1M8VA 4FT4A 2EJGA 1Q3VA 4JUVA 3JCMJ 2I2LA 2ZCFB 4QQ6A 3V8KA 4YTLA 2JTMA 3JB9F 4R55A 5GAN4 3HHTB 1UGRB 3CMAA 2VXFA 3SAGA 3L2VA 3NTIA 5LJ5f 1N8RU 1Z1BA 1DRGA 2KKVA 2VV5A 1MGQA 5CQXA 2EQUA 3S6WA 4J5YA 4OGEA 3S3OA 1KQSS 2KICA 3CC2A 3V7SA 4ZGEB 3OYAA 4JRKA 4P5NA 5GAMh 2MAMA 4FSXA 1K8AU 4C0FA 2MWOA 4C92C 3GPLA 4M75D 4WF2A 5M9OA 3AL0B 1QP3A 3OS5A 3PMIA 3LWHA 2A3LA 4EMKA 2XHCA 2EQJA 3IP4B 4NL2A 1M9SA 3CCVA 3ME9A 2O01E 5GANg 4NV0A 3SB2A 1VQ6T 2HNIA 4XTWA 5GMKe 2WSFE 4LD9K 4PLIA 3KUFA 4V2SA 3A8MB 2M1HA 3ER0A 4NWIA 1Q7YU 2K5LA 1KG1A 4XU3A 3LYIA 3VC8A 5GAMg 4J6XA 1VQMT 1N6AA 3QHSA 2E1HA 2EQMA 3GZFA 1VQLA 4OMFB 4KBMB 3OS1A 1BI2A 1YJNT 1M5Q1 3G6EA 3JCMh 1IIPA 4U7CA 2X4YA 1XQHA 3V8LA 2MMPA 1Q82C 4BE1A 5LJ5j 1VQ8A 4BI8B 1YI2T 1X75C 2BUDA 3QYHB 1VQKT 5T14A 4M78F 4MDXA 1G3TA 4FZNA 2HD0A 3CCST 2P0QA 2H3FA 1M4ZA 2ZPGB 2JGAA 4J6WA 1K73U 3HFOA 4BACA 1Q3UA 2LC4A 2FB7A 1QVFA 1VQOA 5FRMA 3LYSA 2PVGB 3HRSA 5GAN3 1LJOA 5CKHA 4M75A 1R8OB 3M9QA 2DXCA 3A8GB 1VQPA 3EFSA 1CRXA 3QO3A 4FZLA 3D2SA 4II1A 3H0LB 3PMTA 2OTJT 2F69A 3P8HA 4PKCC 1KQ2A 2VKQA 3CC7A 2E6NA 2G06A 3ONNA 3FEOA 1NZ9A 2DVEA 1K8AC 2LHTA 1Z19A 1VQ5T 3VYHB 2KHQA 3SAHA 1O75A 3M55A 4O3MA 1M1FA 3NTKA 3NTHA 1KQSA 5GAN6 4PLLA 3CCVT 1S72A 4AYBF 2NLUA 4OJ5A 3CC4T 1B34B 2G08A 3DB4A 2K2VA 3BDLA 2QA4T 3RKXA 4ZN1A 2PUOB 4BI4A 2KKPA 2R5MA 1D8BA 3TU4K 3A8LB 3MEVA 3JB9I 4BY6B 1UGSB 3SFMA 3ALRA 5A0LA 3FDRA 3OYBA 3X26B 3HRTA 3PIOA 1HEKA 5KCOA 5I21A 4F7UG 3CEYA 2Y4XA 2OYYA 3OYMA 2K5IA 1GXIE 1Y96B 1PSFA 3OYJA 2LKYA 4OB0B 4ACOA 4M7DC 4BDZA 4LDXA 1VQ4A 2EAYA 2RJFA 2CZ0B 3G4ST 1YITT 2G5IB 2RJCA 1SZHA 4M7DD 2EFIA 2VGNA 4NLCA 3OBWA 2PQWA 1I5LA 1BIBA 3PGGA 3WVDB 2K8AA 1XTDA 2FYKA 4E7JA 3QIIA 3G71T 3SAFA 4EMKB 1VQ7A 3KBGA 3CBMA 4HKEA 3OYLA 1BIAA 3QG1A 4RG2A 1UGPB 1ZHIA 1XNSA 2P4TA 2OTLA 2KOBA 1JJ2S 3GP8A 2Y0SC 1M1KC 3AHUA 2HQEA 2C06A 2LYBA 4QQGA 4RG8A 4RKUE 3CRXA 4MMKA 1YBYA 2VIXA 3QJYA 3C95A 5GMKm 3H6ZA 3RMQA 2X35A 5HK0A 4JMUA 2YX8A 3D2NA 2W03A 2XIDA 4PL1A 2HBLA 1QP2A 3JB9G 4M75F 4A4GA 4HA8A 2DQNB 3QUIA 1VIEA 3OYKA 2H3IA 3L2RA 1XNIA 4ZGDB 4C0DC 2WACA 2A3VA 4BUGA 5D6YA 2KV2A 4JS4A 4Y91A 4C92B 1DJ7B 2ZPIB 3NRWA 5A0DA 4XAXB 3CPWS 3G4SA 3DLLA 2H3JA 5HY6A 4IUPA 2ZIWB 3CCJT 4HT8A 5GAN5 2DZCA 3HKZC 3RERA 1I8FA 1QVFS 2JTFA 4QIWF 5CO7A 2RHXA 4FT2A 1KC8C 1Y7XA 3QPHA 2IVWA 4EMHA 2RM4A 5GAN8 5DM7R 3A5ZB 2WB1C 2XU8A 3M6ZA 2R58A 1AHJB 2E5QA 3OBYA 2ZXIA 3HL8A 4BJQA 3PSFA 4F7UE 4OP0A 3OYDA 4M7AC 1YJWA 1JRIA 1RL2A 5GAN7 1UEBA 2GH1A 3JAME 3LGLA 2BIVA 3H0MB 1GO3F 4C0GA 3RKYA 2KVCA 3INZA 3KXTA 4E7HA 2ZPHB 4O5VA 5FLXE 2K89A 5C6SA 2K57A 3LH0A 4N0AA 1QW1A 2E6ZA 4M75C 2KAFA 4A4FA 3QXEB 1EIFA 2VUBA 4C0ZA 2L5QA 4J7FA 2PU9B 1K73C 3KZXA 4LDYA 3JCMX 3CP8A 4DQ2A 4O6JA 5I2SA 3BW1A 3NFCA 2VGMA 2OM6A 3CD6A 4L6V5 3URGA 3C4SA 4FM4B 2EJFA 3GOXA 2ZPFB 2OXOA 1X01A 3OW2A 1VQ7T 1VQKA 3J81E 3GLXA 2DGZA 2RK1A 3L2UA 3N7PD 5KE3A 4QQDA 1VQ8T 1Y96A 2OH2A 1A0PA 2ZIWA 4DOWA 2CZ7B 4TVRA 4BB7A 3JCMg 2RHUA 2E41A 2DK3A 1H641 3CCQA 1P92A 3CMET 1PVQA 4HCCA 3OYCA 4OVAA 2E5SA 4MZPA 4J8OA 3WVEB 2DEQA 2QDYB 4MZTA 3RF9A 4IKFA 1KD1C 1UPHA 3QYGB 5LJ3h 3LVWA 4M75E 2QQ9A 4XK8E 2RO0A 4M7AF 4GLKA 3PT9A 2G0AA 4OO1J 1WQWA 4KX5A 2K3XA 3X25B 1FXXA 3GNGA 1W2BS 3CPWA 4QVZA 4KUDK 2KMTA 3RMSA 4ELZC 3OQ5A 1VQ5A 3M7DA 4C8QC 2ZIXA 3JCMb 3OW2S 1NPPA 4F7UB 2DTOA 4KMOB 4M7DG 4CGZA 2JVVA 4M77E 3CMEA 2GFUA 3CCSA 1Q81C 2DIQA 2F5KA 1G3SA 2LQKA 4PJOE 3V8JA 1VQNA 3QSUA 1WUDA 4JRPA 1N9SA 3FJPA 3HKZF 4CRXA 2OAUA 2HBPA 3CMAT 2ZG6A 5J26A 4PJOA 4X34A 3SWNA 2CKKA 2RHZA 2K4HA 2F8LA 2H3ZA 1WPYA 3CXCS 2RI3A 4CDGA 3M54A 3F2CA 3MP8A 4QNLA 5IN1A 3M6KA 3LLRA 3QBYA 3CXCA 1PSEA 4PJOG 4Q5WA 1T94A 2K3YA 3CCMT 4E7LA 1Y71A 3F53A 3DEEA 1KBUA 2YLBA 3JB9J 2GOLA 5CR2A 3CYMA 3P8BB 4LDUA 1YHQT 1JJ2A 3T9NA 3IN5A 5DLQE 1W4SA 2K4YA 3CCQT 1K9MU 2FHDA 4NOYA 1ED1A 2QA4A 4AYBC 2RHYA 4RCBA 4MZMA 4KULA 3JCMW 2N1RA 2HOIA 3PSIA 3N5BB 1OUQA 4P0QB 1M90U 2K8BB 4IC9A 2DF4B 1VUBA 4F7UA 2YB4A 2XI9A 2RHFA 3PZPA 3VU3C 5CQYA 3KFUF 1YIJT 2V8JA 3PSPA 3CD6T 1ECWA 2Z7JA 5A0GA 2DD5A 4A54A 3CC7T 4OB3B 2A7YA 4M7AA 5KCHA 3RESA 5C0MA 2XDBA 3C94A 3OYHA 2PMZC 2LCLA 2CRXA 2Y4YA 4A4EA 2IG0A 2GCXA 1YJ9A 4C8QG 2MF2A 1OZ2A 2D6FC 2XKOC 4IUQA 4C0DB 2D6FA 4ATOA 2EIFA 3D2QA 3RFAA 4M7DE 4M7AG 3TCJA 3HP9A 1ZQ1C 3AQEA 2WSEE 3CCEA 4PL2A 2L3RA 1KD1U 1U1TA 2R18A 1OZ3A 1VQLT 3X20B 1B34A 2X4WA 1XOVA 2QEXA 1KHIA 3K1ZA 3LWIA 3FB9A 3VUZA 2ZPEB 4C5IA 3O8VA 4M77D 3VUBA 3OB9A 2M16A 2RB6A 2X4JA 4M75G 2P0KA 4J7IA 2G5HB 5GANd 4XTZA 3M57A 5LJ5h 5HR6A 4ICAA 4N4IA 4PJOD 3L2ZA 4GY5A 2LT1A 2PMZF 4PJOF 4MDWA 1D3BB 3CBPA 3N7RC 4M78D 3J80E 4OB2B 4C92G 5CK9A 1XO0A 5FU6C 2QQSA 3OPXA 1M1KU 4IUUA 4C92F 2DPPB 3N7SC 2YB1A 1KC8U 5GAMf 5DY9A 5GMKi 5GAMj 4JRQA 1KQ1A 2KHVA 4X9DA 4BD3A 4RMOA 2RH2A 5GANh 1WJSA 4P0PA 3PIPA 4N4HA 2XVTA 1JB0E 3P8DA 3E1SA 3MO8A 3ICXA 5GAOn 1BI3A 4M77B 4IURA 1BI0A 4QVDA 4J83A 3M5AA 4JRIA 2E65A 5J3BA 5LJ3e 2V8IA 4Z02A 2GFAA 5CKFA 4BDYA 3CCLT 4KT0E 2E1FA 2DXTA 2MRLA 4EPCA 3OMGA 1OYXA 1F44A 2RRDA 4C8QE 1LOJA 2L89A 1I4K1 4F7UF 1U8RA 3VCBA 2ZIVA 3AQFA 2CYZB 5FRNA 2KJ8A 3E0FA 4E7KA 2LRQA 5GAMe 2G3RA 4ZTFA 3JCMQ 4FIBA 1RI0A 2EJ9A 3JSCA 3QJ6A 4A53A 1O9SA 3A8HB 3F2BA 2O4XB 3EFRA 4LDVA 5CAIA 2RJEA 3M58A 1HIWA 3RIRA 2DTIA 3M53A 2OTLT 2E64A 1WJRA 5AYFA 3Q1JA 3OYNA 2XDPA 2RJDA 3M56A 2F76X 4EMGA 2HAXA 1G3YA 5LJ3f 3CPFA 4C5EA 5LJ3d 3T79A 2XICA 3H0RB 2GF7A 3I55A 1G3WA 4KUIA 3OSVA 1VQ4T 4M78B 1QVGS 2JMGA 3OYIA 3UPUA 4EMKC 3FLGA 5GAN2 4Y28E 3EAEA 3MEAA 1A6SA 2VYTA 2LT4A 3CCLA 5IAYA 1WQ7A 3G6ET 3R6OA 1D3BA 4PJOC 4M78E 3IG5A 3OS0A 2VXEA 2KJ9A 2H3VA 1NPRA 4PNOA 1OI1A 1BKBA 2Y90A 5GMKj 4M77A 4HCZA 2YHTA 4M77C 4HCBA 4JLGA 1NJIC 3MEWA 4JS5A 5CKEA 2Q4TA 1WNLA 2ZIUB 2HOFA 4C92A 3OYGA 4HT9A 3SMVA 2LTOA 3PNWC 1S72T 2XG8D 2QTXA 3GU3A 3OA6A 4B9WA 4OF1A 2V8KA 1YHQA 2KNJA 2CGHA 2XK0A 4NS5A 4RCCA 3C12A 2RHIA 5KE2A 4JDSA 2JUFA 2G07A 5FU6B 2DAQA 5LJ3j 4M7AD 3V7CA 3QZ9B 4J6YA 4XU2A 3OY9A 2KDSA 3CC4A 2HBKA 2CS7A 3OSSC 2X4XA 2XDDA 4C8QD 1K9MC 2CZ1B 5LJ5g 3FRNA 1YCYA 2JOYA 3META 4M77G 4ELYC 1VQ9T 1N8RC 2KVQG 1HXDA 2ZGWA 2RD1A 2QXFA 2XD0A 5GMKl 3G71A 3CC2T 5DLOA 4XQ3A 2F77X 3X24B 3E19A 3SD4A 1U1SA 2BKDN 1YI2A 1M1GA 5LL6S 4A4KA 5CRXA 1I81A 3TEEA 2ZIXB 2KIWA 3PFSA 4R56A 2KD1A 1IZ6A 2PUKB 5GMKh 2KJ5A 3JRZA 3OYEA 3LX7A 4N4GA 2M9UA 2MA1A 2JZ2A 2DXUA 5CKBA 3QKJA 1SSFA 2K4IA 5KH6A 2VJ4A 2K5FA 4C92D 3L3FX 2WAQC 4NL3A 2R5AA 3M4YA 5CIUA 2Y0SF 2PVOB 4DA4A 2HOQA 3PSTA 2O4XA 2EKOA 3LW5E 1Q86U 2D9TA 3VJPA 3DKMA 1QVGA 2RP5A 2R57A 4A4HA 4FU6A 3H8ZA 1YJNA 3SWNB 1VQ6A 3IG8A 3MHXA 4OB1B 4M7DA 2EWNA 3E9GA 2DXBA 4XTXA 2GQVA 1KHCA 4OJPA 2QI2A 4A8EA 3BFMA 1FWZA 3NUQA 2K4EA 3OS2A 3JCMc 3PTAA 4M77F 3HRUA 4UC4A 2LNVA 4PL6A 2K8CB 3DB3A 2L8DA 2F2AB 4QJFB 3O0FA 1X6OA 5GAOq 1FX7A 4L5GA 4ZN3A 5LJ3g 5GAOl 3ASKA 5LJ5d 4FZMA 3ZBDA 5HKCA 5GAMd 3JCMf 1VQOT 1BYMA 4BE0A 3L2WA 3BY7A 4ZGJB 4X9CA 1VQ9A 1QVPA 2ZIUA 1IREB 4WJ3B 4FL6A 4LD6A 2MI6A 2M0NA 3ZEHA 4PJOB 1W2BA 5GANf 4EDUA 2E10A 3GF5A 2EQKA 1YJ9T 2KQWA 1JBMA 2F5TX 5GANj 5FU7B 3ZFJA 1NE8A 4M7AB 1VQMA 4QW2A 2KK4A 5IT9E 1Q81U 2DO3A 5I2MA 1N27A 4XTVA 4M78C 2WSCE 3HKSA 5FROA 3VV0A 4C8QB 2ZZDA 3F5AA 3SWNC 4XU0A 3JCMe 4ME7A 4IUTA 5GAOr 2KEYA 3M59A 3HFNA 4OJOA 2JNGA 3OMCA 4OJLA 1UB4A 4OGCA 3F5EA 3JCMV 2G09A 3GIBA 3L42A 2W7PA 3OYYA 3V7RA 1YITA 2DTHA 5L8RE 2LCCA 4VUBA 3TREA 2HQXA 4LDWA 3HPWA 3BDUA 2PVDB 4JLIA 2JHDA 1WJQA 4P0QA 3RKWA 5GANe 3VKIA 4D6WA 3DLMA 3G7ZA 4M7DB 3CCJA 2DD4A 4M78G 1URJA 3RUXA 4L59A 2LBOA 3I56A 4M7DF 1LNXA 2HBJA 3L2QA 2RI2A 2AHJB 3CCUT 4C8QF 5HK3A 3VYGA 2QQAA 4CRIA 2E12A 2W7OA 3UDCA 2VJ5A 3QDRB 5EG2A 2NV3A 5GAOp 1UGQB 2ZPBB 2YLCA 3LVVA 2QQRA 3WXMB 1ZQ1A 5GAOm 2MWPA 3CCRT 1ZBXA 4E7IA 2EYQA 3SQIA 2WAQF 1MA7A 2WB1F 2QQBA 3JCMP 2P0PA 1VQNT 3GNFB 2KY9A 3JB9D 2JN0A 3UWNA 3F2DA 2E1EA 4MMLA 3QZ5B 4BE2A 1PVPA 1MHNA 1PVRA 1NZBA 1Q82U 3UT1A 3MEUA 2LQ8A 2VC8A 4JJNK 2CZ6B 1N9RA 3S3NA 4C92E 4P0PB 1BI1A 1M90C 2HMXA 3C29A 5CKDA 4E47A 2ZIVB 2W04A 3JCMd 5D6WA 5KL1B 1P7DA 2QEXT 4QIWC 5CCAA 5C0YA 5CVIA 3MCAB 2DJZA 2BDUA 2LYAA 4BX9C 3I56T 4CI0C 4XTUA 1L6NA 5KL8B 3CBOA 2DIGA 3CCRA 4XTYA 2DZ9A 4KX3A 2YRVA 4M75B 2E70A 2FVUA 4XU1A 1TAMA 1Q7YC 3M4GA 3A8OB 4C5GA 1VIFA 4GFJA 5HR7A 3HSBA 1Y07A 2RA2A 4FE3A 1V29B 4U6PA 3CCUA 1YIJA 1NJIU 2FL7A 4N0AC 1G5VA 2H3QA 2LVMA 1H3ZA 4QVCA 4ZTJA 2LX9A 1TH7A 4BY6C 3F70A 4B9XA 5A2QE 2D0QB 2RK2A 3OYFA 3LGFA 4OJ6A 3JB9H 4M78A 5LJ5e 1Q86C 3J7AF 2DKGA 3FC3A 3I55T 2JH1A 2CPRA 3C28A 3FIFA 2CN1A 1YT3A 3L1AA 2LDMA 4C8QA 5J39A 4C5HA 3CCET 3MP1A 2B8AA 2KSSA 4M7AE 3MGVA 5D6XA 3CCMA 4NLBA 2OTJA 4DOVA 3X28B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUG A;  5A0D A;  5A0L A;  2XIC A;  2XID A;  2XI9 A;  5A0G A;  4C0Z A; 
#chains in the Genus database with same CATH topology
 3E9F A;  4BI3 A;  1UQV A;  4F5R A;  1HUO A;  1VYU A;  3UQ2 A;  5DLG A;  3R6N A;  3AN1 A;  2HBM A;  4P4P A;  1WLP B;  1HK9 A;  2H3E B;  2E5K A;  2QTV A;  1VQP T;  5H2F U;  2RI5 A;  1WDX A;  5EWE A;  1YJW T;  3SDZ A;  1LPL A;  4HVU A;  1T3S A;  1BNO A;  2F2X A;  5KFE A;  3E58 A;  1TFR A;  1WGS A;  5FU7 C;  3K1R B;  2ZXH A;  2E8O A;  1ZQI A;  2JH7 A;  3MP6 A;  3S3M A;  2M0O A;  4G9B A;  4YD1 A;  3QUT A;  4IUV A;  1LKY B;  1ZQO A;  1M8V A;  2BZ8 A;  3MDC A;  4FT4 A;  1QSS A;  2LJ3 A;  2EJG A;  3BS7 A;  1Q3V A;  2M0Y A;  2JV3 A;  3C2L A;  1C1A A;  4AG2 C;  4JUV A;  1SB3 C;  2H8H A;  4CCH A;  3EGD A;  3JCM J;  1KSW A;  2I2L A;  4RPZ A;  2ZCF B;  3R9K A;  3MGI A;  4QQ6 A;  1GRI A;  1ZQA A;  4JK1 A;  3V8K A;  4RQ1 A;  4I2I A;  4JWN A;  1ZA1 B;  3ZDE A;  1K73 R;  4YTL A;  2X3X D;  3BQ2 A;  1RXW A;  2JTM A;  3JB9 F;  4R55 A;  5GAN 4;  3HHT B;  1BBZ A;  1UGR B;  3CMA A;  2XO7 A;  1X2Q A;  2VXF A;  5DB9 A;  4Y2Y A;  3SAG A;  3RB6 A;  2DUY A;  4D8K A;  4QZD A;  3L2V A;  5KFR A;  3NTI A;  4X5V A;  4DO9 A;  1FO4 A;  1ZRM A;  2VA2 A;  7ICJ A;  3WK9 A;  5LJ5 f;  2A1J A;  1Z1B A;  1N8R U;  1M90 R;  1DRG A;  1WHJ A;  2KKV A;  2HCF A;  2VV5 A;  2DM1 A;  3OHB A;  2CRE A;  3C2M A;  1MGQ A;  5CQX A;  4KLO A;  3I55 Q;  2EQU A;  5CWR A;  2EZX A;  5KFM A;  3S6W A;  4J5Y A;  4OGE A;  4CC4 B;  4ECV A;  4DEX A;  1DOQ A;  1N61 A;  3ZI4 A;  4F5N A;  4DQQ A;  1W6X A;  1NJZ A;  3S3O A;  2KIC A;  1KQS S;  3UAT A;  1ZQK A;  3TAD C;  3CC2 A;  3V7S A;  4ZGE B;  3OYA A;  1PD1 A;  4JRK A;  1RAA B;  1KIK A;  4P5N A;  5DQI A;  5L1I A;  5GAM h;  2MAM A;  4FSX A;  5KTQ A;  1JXO A;  1UJ0 A;  1K8A U;  1ZQY A;  4YR0 A;  4C0F A;  4IQW A;  2HL5 C;  2LPE A;  4I2C A;  1N5Z A;  4CNQ A;  5KFB A;  4DL5 A;  2MWO A;  3UMB A;  4C92 C;  3GPL A;  4M75 D;  4WF2 A;  5M9O A;  1Z4N A;  3QU7 A;  1MQ2 A;  2QKQ A;  3AL0 B;  1QP3 A;  2Y9U A;  2JS2 A;  1YIJ Q;  2RN8 A;  3OS5 A;  1JUD A;  3SEI A;  3PMI A;  2RDI A;  1NK8 A;  3LWH A;  2A3L A;  3E2U A;  4EMK A;  4C4S A;  4FBT A;  3CME Q;  1K4U S;  2DL7 A;  1AEY A;  3SYZ A;  2VWF A;  2BDP A;  4ECX A;  2XHC A;  5GJW B;  2EQJ A;  3IP4 B;  1IXR A;  2YXY A;  4DF4 A;  4R8U A;  2KZ3 A;  2GBQ A;  5ALM A;  1X2K A;  2L3P A;  3MBY A;  2RQV A;  3I5R A;  3GIJ A;  8ICG A;  1M9S A;  4NL2 A;  4ZH4 A;  3CCV A;  1ZQQ A;  3ME9 A;  3G6V A;  2DRK A;  4GC6 A;  5AT1 B;  4PJN A;  1WYX A;  1YWP A;  2XC9 A;  1VA7 A;  2O01 E;  3VS3 A;  4QWE A;  5GAN g;  4NV0 A;  4ZNX A;  3SB2 A;  3VS0 A;  1VQ6 T;  2W9B B;  2HNI A;  4XTW A;  5GMK e;  4IIO A;  1T3L A;  2H5X A;  2XY7 A;  5J0X A;  4J9R A;  2WSF E;  2OWO A;  4LD9 K;  9ICB A;  4PLI A;  3KUF A;  4V2S A;  3H7I A;  3A8M B;  1T7P A;  2M1H A;  4KLJ A;  1SIJ A;  3ER0 A;  1BPB A;  4NWI A;  4RQ7 A;  5KFO A;  2A08 A;  5ALP A;  3B0X A;  1ABQ A;  1Q7Y U;  2K5L A;  1KG1 A;  1M8M A;  1Q46 A;  3LYI A;  3PVX A;  1Y0M A;  4XU3 A;  3VC8 A;  2FMP A;  5GAM g;  4J6X A;  1VQM T;  2YTU A;  1N6A A;  3BQ0 A;  1NKB A;  5L1M A;  5EWF A;  2E1H A;  1S9F A;  1JXL A;  3PNC A;  7ICS A;  3QHS A;  4B6M A;  2EQM A;  1EZZ B;  3GZF A;  1D9F A;  3Q8R B;  1VQL A;  1L7N A;  3LDA A;  2BQ3 A;  4Y2T A;  2C2E A;  4OMF B;  5KFK A;  5ALJ A;  4F4X A;  2EZZ A;  1BI2 A;  4KBM B;  2W54 A;  3OS1 A;  1YJN T;  1M5Q 1;  3G6E A;  2RF0 A;  2ASL A;  4RQ4 A;  3JPS A;  2EH9 A;  2LM4 A;  1ZD3 A;  3JCM h;  1QKX A;  3LWM A;  4M9N A;  1PM3 A;  1IIP A;  1N5X A;  5BOM A;  4PHP A;  4J9D A;  4OMO A;  9ICP A;  4U7C A;  2FZK B;  2X4Y A;  1XQH A;  3V8L A;  2YSQ A;  2MMP A;  2BR0 A;  1Q82 C;  4BE1 A;  5LJ5 j;  3IDW A;  1VQ8 A;  1ZA2 B;  4BI8 B;  1YI2 T;  1X75 C;  2BUD A;  1KKX A;  2JEI A;  3EG3 A;  3QYH B;  4UB2 A;  1VQK T;  3PML A;  4KTQ A;  5T14 A;  1QQJ A;  4M78 F;  1TOV A;  4R64 A;  3VS2 A;  4MDX A;  1ZQT A;  1G3T A;  4FZN A;  1V9P A;  5KFJ A;  2EVR A;  1RAD B;  4Y2X A;  2HD0 A;  1R77 A;  3CCS T;  5IIK A;  4QZB A;  1ZQG A;  5KG4 A;  5C5J A;  3U26 A;  2P0Q A;  3QDF A;  3PX0 A;  1GBQ A;  2H3F A;  1QH9 A;  1B0X A;  2JGA A;  1M4Z A;  2ZPG B;  4J6W A;  1K73 U;  5AM2 A;  1VQ8 Q;  3HFO A;  4BAC A;  1RYS A;  1UCV A;  2V1R A;  4FFD A;  3NVW A;  2DWQ A;  3UXN A;  4C80 A;  2FLL A;  2IBK A;  3H0I A;  5D49 A;  1Q3U A;  2KT8 A;  2LC4 A;  5ALS A;  9ICW A;  2FB7 A;  1QVF A;  1O08 A;  1VQO A;  3EGX A;  5FRM A;  3LYS A;  2PVG B;  2LM1 A;  4RNN A;  1ZRN A;  4IR9 A;  3HRS A;  5KT7 A;  2HZY A;  5GAN 3;  3CMA Q;  1WHL A;  3FC4 A;  5ALI A;  1NJW A;  1LJO A;  4OD0 A;  5CKH A;  4M75 A;  1V38 A;  2P35 A;  4IS7 A;  5CEH A;  5DQG A;  1VQL Q;  5J0Q A;  1ZXI A;  4PZO A;  1R8O B;  3M9Q A;  2DXC A;  3A8G B;  1VQP A;  3EFS A;  4PH5 A;  2COW A;  4DSI A;  3UQ0 A;  1CRX A;  3CCJ Q;  3RJF A;  1WHK A;  3QO3 A;  2HL3 A;  1ZQB A;  4FZL A;  3D2S A;  2D8C A;  5ALN A;  4II1 A;  7ICV A;  3H0L B;  2XCP A;  3LH5 A;  4USA A;  1S0N A;  3PMT A;  1KFS A;  2OTJ T;  2F69 A;  5F9N A;  1Z1V A;  1MC8 A;  3P8H A;  4PKC C;  1KQ2 A;  2VKQ A;  2KG5 A;  2BE9 B;  3CC7 A;  4UAT A;  4EYH B;  2E6N A;  2G06 A;  3ONN A;  4J9K A;  1YJN Q;  3FEO A;  4RQ0 A;  2KVS A;  1M2V B;  1NZ9 A;  2MIO A;  4AG1 C;  4UB3 A;  1U45 A;  5J0U A;  2DVE A;  1M6Y A;  1K8A C;  4MHV A;  2LHT A;  1Z19 A;  4PJ0 U;  4UB1 A;  3EG0 A;  1VQ5 T;  3VYH B;  2KHQ A;  3SAH A;  1O75 A;  3M55 A;  4OML A;  4O3M A;  5B5E U;  3OTQ A;  5ALF A;  1M1F A;  1LVK A;  3NTK A;  5HMM A;  3NTH A;  1S77 D;  1KQS A;  3IQL A;  2HHS A;  1TTH B;  3SEN A;  3OSP A;  9ICV A;  2A0F B;  5GAN 6;  2KRS A;  2MUT A;  4JB3 A;  1K1S A;  5L1K A;  2AGQ A;  4PLL A;  2I5H A;  4PZN A;  3CCV T;  1S72 A;  4AYB F;  2BGW A;  5AK3 A;  4J9G A;  2NLU A;  4OJ5 A;  3CC4 T;  1X43 A;  3MC1 A;  2J6T A;  1ZET A;  1B34 B;  1TS9 A;  2G08 A;  2LQN A;  5DB7 A;  3DB4 A;  5KFL A;  4FS1 A;  2QYZ A;  2K2V A;  3GIL A;  1OQK A;  4TUP A;  3BDL A;  3RKX A;  1RG6 A;  2QA4 T;  4ZN1 A;  4KLM A;  2BKE A;  1HD3 A;  1NZP A;  2PUO B;  5FWC A;  2KKP A;  1X6I A;  3D6J A;  4BI4 A;  2R5M A;  4UW9 A;  4F16 A;  4RNM A;  1D8B A;  3TU4 K;  5AI0 A;  5KYW B;  4B9U A;  5GTH U;  3A8L B;  3MEV A;  1J2M A;  3JB9 I;  4BY6 B;  1SL2 A;  1D1C A;  1UGS B;  3Q8M A;  3ALR A;  5A0L A;  3SFM A;  2AT1 B;  3FDR A;  3OYB A;  3X26 B;  3HRT A;  3PIO A;  4O5E A;  1HEK A;  7ICP A;  5KCO A;  5I21 A;  4DEY A;  4RQ5 A;  4F7U G;  3PE0 A;  3Q8K A;  3UPQ A;  3CEY A;  5AI6 A;  1UT5 A;  3M0R A;  2Y4X A;  2A1J B;  1W2B P;  2FMQ A;  3HP6 A;  1IXD A;  4KLF A;  3CW2 C;  1A0N B;  2OYY A;  3EG1 A;  3UXO A;  3OYM A;  4BWM A;  2ZJ5 A;  8ICZ A;  3NGD A;  2K5I A;  1GXI E;  5IIL A;  1Y96 B;  1PSF A;  3OYJ A;  2LKY A;  4OB0 B;  4ACO A;  4M7D C;  4BDP A;  4BDZ A;  4LDX A;  1JX4 A;  2DF6 A;  1VQ4 A;  4MFA A;  2EAY A;  1G8X A;  4F17 A;  1KK7 A;  4IR1 A;  2RJF A;  2E8M A;  4YMM A;  4WTO B;  2CZ0 B;  4PJJ A;  4YXM A;  3G4S T;  1YIT T;  2WHE A;  2G5I B;  4Z8A A;  2RJC A;  1SZH A;  2LP5 A;  4M7D D;  1AWJ A;  4US9 A;  4PGY A;  1NLO C;  2EFI A;  5DDY A;  7AT1 B;  2VGN A;  4NLC A;  3NMZ C;  3OBW A;  3ZL7 C;  2Q0Z X;  3C1Z A;  5KFQ A;  5KG5 A;  2PQW A;  1BIB A;  3V7J A;  1I5L A;  5ALO A;  5EC7 A;  4E6R A;  4C8M A;  3PGG A;  8ICM A;  3WVD B;  2K8A A;  4RTU A;  1XTD A;  2FYK A;  4E7J A;  2BCU A;  1QMC A;  2EAM A;  3M9M B;  3RAQ A;  4DL4 A;  3TAR A;  2GNC A;  4AFQ C;  3QII A;  3G71 T;  3SAF A;  4EMK B;  4NLZ A;  4QZ9 A;  4DBH A;  3KBG A;  1VQ7 A;  3CBM A;  4HKE A;  3EHR A;  1XSN A;  1K0S A;  3OYL A;  4ED3 A;  2PFN A;  4ECR A;  3TAD A;  1BIA A;  1YCS B;  3KBB A;  2Y1I A;  3QG1 A;  3EPI A;  4RG2 A;  4NJ8 A;  1UGP B;  2CH4 A;  2W3R A;  4QZE A;  1ZHI A;  1SSH A;  1Z9Q A;  4ED1 A;  1XNS A;  4DBR A;  5HML A;  2JM9 A;  3NGP A;  3WKC A;  9ICK A;  5DKW A;  4Y2P A;  1L3T A;  1IO6 A;  1AWW A;  3VRZ A;  5J8Y C;  2P4T A;  2OTL A;  2BZF A;  2KOB A;  2PFO A;  1QCN A;  1JJ2 S;  3GP8 A;  2Y0S C;  2EBP A;  1M1K C;  3AHU A;  2HQE A;  4J9O A;  2C06 A;  2LYB A;  4HYK A;  4NY8 A;  2FZC B;  5AHX A;  4QQG A;  2A28 A;  4M9L A;  2P6R A;  3K4G A;  5ALD A;  4RG8 A;  4RKU E;  4LVS A;  9ICO A;  4EZ9 A;  3CRX A;  4PFO A;  4MMK A;  1YBY A;  2VIX A;  4I2E A;  3QJY A;  2FPD A;  1I5O B;  3C95 A;  4YN4 A;  2SRC A;  2M51 A;  5GMK m;  3H6Z A;  3EGX B;  3RMQ A;  2YY6 A;  2OX7 A;  2ROL A;  2X35 A;  3QWY A;  2ASD A;  3C0C A;  1WWU A;  3EZ5 A;  5HK0 A;  5KFX A;  4KLQ A;  4JMU A;  2YX8 A;  3D2N A;  1X69 A;  2W03 A;  2RDJ A;  2GWS A;  1SV4 A;  2VVK A;  7ICH A;  2XID A;  2MOX A;  4PL1 A;  3VS6 A;  4QKU A;  2HBL A;  5D4B A;  1KW4 A;  2DBM A;  1QP2 A;  3JB9 G;  3B0Y A;  5K4L A;  1BPZ A;  4LUD A;  2KE9 A;  4BXO B;  4M75 F;  1SV0 C;  4A4G A;  4HA8 A;  1X6J A;  2DQN B;  5HNK A;  1VIE A;  3QUI A;  1SV0 A;  1JXM A;  1BU1 A;  1N56 A;  3OYK A;  5KFI A;  1N62 A;  2H3I A;  3L2R A;  2E8P A;  1XNI A;  5KYY B;  4KH1 B;  2HEQ A;  2EAN A;  1AD5 A;  4ZGD B;  4C0D C;  1K1Q A;  2LI6 A;  2WAC A;  3VS7 A;  2KE7 A;  2A3V A;  2P4R A;  4Q44 A;  4BUG A;  1WX6 A;  1SEM A;  5D6Y A;  3ZDD A;  2KV2 A;  1KJW A;  4JS4 A;  2K4P A;  2GQI A;  4GXI A;  4Z6F A;  4EX6 A;  5J0Y A;  4Y91 A;  4C92 B;  2RQR A;  3TI0 A;  1DJ7 B;  1V85 A;  3SZ2 A;  2CP3 A;  1R0C B;  1VYV A;  2ZPI B;  2HQH A;  1IM4 A;  3NRW A;  4DS5 A;  5A0D A;  4XAX B;  3CPW S;  4DOB A;  2C2D A;  3G4S A;  3DLL A;  2KN7 A;  2H3J A;  1WZO A;  2DKZ A;  3V6K A;  2I1Q A;  4F50 A;  1D1B A;  3NRZ A;  1V1C A;  4KLS A;  2ZJA A;  2JT4 A;  5HY6 A;  4GLM A;  2E3I A;  1X42 A;  2ZIW B;  4IUP A;  4QW8 A;  2QB0 B;  4JJB A;  1KQS P;  4DL2 A;  1MND A;  3CCJ T;  4HT8 A;  2QGF B;  1QQ5 A;  5GAN 5;  2DZC A;  3HKZ C;  3RER A;  1E6H A;  1I8F A;  1QVF S;  3C1Y A;  4UAR A;  4O3S A;  2JTF A;  4F3O A;  2RQW A;  5KFT A;  4QIW F;  5AKG A;  5CO7 A;  2VA8 A;  2ZUC A;  2RHX A;  5D46 A;  4FT2 A;  1KC8 C;  1Y7X A;  3QPH A;  9ICA A;  1BB9 A;  1KRP A;  2HKN A;  2IVW A;  4EMH A;  2RM4 A;  4A63 B;  2EW3 A;  4Y2R A;  5AM5 A;  1WXB A;  5KYU B;  2YDL A;  5DM7 R;  4RTX A;  5GAN 8;  1ABO A;  2D1X A;  3A5Z B;  1IGQ A;  2WB1 C;  4Y2Q A;  5J2F A;  1VQ5 Q;  1FFV A;  4DOA A;  1FMV A;  1D8L A;  4NLN A;  2XU8 A;  1AZG B;  2KP7 A;  2FO0 A;  3CC2 Q;  3JPO A;  5J29 A;  3TAQ A;  1ZQJ A;  1S76 D;  2KTQ A;  3M6Z A;  2R58 A;  3ZDC A;  3C2K A;  1K9A A;  1AHJ B;  2E5Q A;  1ZUU A;  2WFA A;  3OBY A;  2ZXI A;  3HL8 A;  5L9X A;  4BJQ A;  4RT2 A;  3PW5 A;  2W9M A;  3PSF A;  1ZQX A;  1GFD A;  1N60 A;  5DDM A;  1PK1 B;  3T5H A;  4F7U E;  3IV6 A;  1J97 A;  4R65 A;  1MMA A;  4ANJ A;  4OP0 A;  3OYD A;  4M7A C;  2KBT A;  1PK3 A;  2VA3 A;  2A36 A;  1YJ9 Q;  3CCU Q;  4KLU A;  1YJW A;  1JRI A;  4YMN A;  1KSP A;  4E2F B;  1U47 A;  1RL2 A;  1BVS A;  4DOC A;  5GAN 7;  3L4P A;  1T8E A;  5KG0 A;  1UEB A;  3GDX A;  1RXV A;  2GH1 A;  1S1N A;  3JAM E;  2KI7 A;  3LGL A;  2BIV A;  3UXP A;  3H0M B;  1ZQN A;  1GO3 F;  5ALL A;  1WG8 A;  1VDV A;  5ALK A;  1NYG A;  2ABL A;  4C0G A;  3ORY A;  2AIR B;  2YMQ A;  3RKY A;  3MPU B;  3DV9 A;  2IOF K;  2AGO A;  5AIA A;  2KVC A;  3INZ A;  3KXT A;  4E7H A;  9ICE A;  3A98 A;  1X9W A;  2ZPH B;  4O5V A;  2NUP A;  4B9T A;  3SR6 A;  3KKA A;  5FLX E;  2K89 A;  2JRZ A;  1JI7 A;  4YP3 A;  4RUG A;  5FWB A;  1QLN A;  1ZQR A;  2EQY A;  4RPY A;  4R0K A;  5C6S A;  4ED7 A;  5KYX B;  2K57 A;  3LH0 A;  4N0A A;  5CA7 A;  1VQM Q;  1RDF A;  1QW1 A;  4J9C A;  3UF4 A;  3CCR Q;  2E6Z A;  5J2I A;  1ZX6 A;  2KAF A;  4M75 C;  3SEM A;  2K3B A;  4A4F A;  2CDT A;  2FPE A;  2FZG B;  3QXE B;  1K0X A;  9ICM A;  1EIF A;  3M9O B;  4M4Z A;  2DL5 A;  2VUB A;  1RLQ C;  5J2C A;  2BZY A;  1ARK A;  4C0Z A;  2L5Q A;  3HX0 A;  4J7F A;  4O0I A;  3WK7 A;  2RLT A;  5BOL A;  3EPG A;  4Q45 A;  2PU9 B;  1K73 C;  1PKS A;  3KZX A;  4LDY A;  1BNP A;  3JCM X;  4FSS A;  3CP8 A;  1WHM A;  4O6J A;  4DQ2 A;  2DA9 A;  1YIT Q;  4F93 B;  1XU4 A;  4YR2 A;  2R8K A;  4YFK A;  4I28 A;  1FFU A;  1OX8 A;  4MFC A;  3BW1 A;  5I2S A;  2DRM A;  7ICQ A;  3NFC A;  1SXD A;  1M27 C;  2W55 A;  2VGM A;  2OM6 A;  1V76 A;  4F5O A;  9ICN A;  3CD6 A;  4L6V 5;  3URG A;  3C4S A;  4FM4 B;  1V97 A;  2EJF A;  2MU2 A;  3GOX A;  2MPX C;  1AWO A;  2O2O A;  2BCS A;  2ZPF B;  2OXO A;  5AKY A;  2DET A;  2JTE A;  1X01 A;  3OW2 A;  1VQ7 T;  4F5Q A;  1X66 A;  7ICO A;  1W70 A;  2C0T A;  4ORZ A;  2QAZ A;  5KFW A;  3AT1 B;  1GL5 A;  2K6D A;  1VQK A;  3J81 E;  3GLX A;  2DGZ A;  2LNH B;  2RK1 A;  3L2U A;  2NYV A;  3N7P D;  5EOZ A;  3EFO B;  5KE3 A;  2OHF A;  4QQD A;  1VQ8 T;  3RRG A;  1Y96 A;  2JR5 A;  1T4G A;  1AOJ A;  2FLP A;  1ZJM A;  2OH2 A;  1A0P A;  2B0C A;  2ZIW A;  2HSP A;  3LK9 A;  2CZ7 B;  4DOW A;  4TVR A;  1Q81 R;  2PI4 A;  1RYR A;  4ELV A;  4AFU C;  1Y88 A;  1BK2 A;  4BB7 A;  1BCO A;  3TQ7 P;  3JCM g;  2RHU A;  1NK6 A;  1WHG A;  3KTQ A;  2E41 A;  1NEG A;  2DK3 A;  1H64 1;  4QZA A;  1UDL A;  3GFK B;  2X9H A;  2FDR A;  3CCQ A;  1P92 A;  3CME T;  1RYU A;  1PVQ A;  1IRX A;  7ICL A;  4HCC A;  4GIB A;  1D8Y A;  2JMC A;  8ATC B;  4MEY A;  1SL1 A;  4OVA A;  3OYC A;  5JU5 A;  1OXJ A;  2E5S A;  3H8M A;  4CF3 A;  2V26 A;  4MZP A;  4Q43 A;  4PGQ A;  5J0T A;  2CP2 A;  4J8O A;  4KLD A;  3WVE B;  4ED2 A;  4FYV B;  8ICX A;  2DEQ A;  1EX4 A;  4IL6 U;  4OMM A;  2QDY B;  2YUN A;  4MZT A;  1Q82 R;  3RF9 A;  1ZQP A;  1OEB A;  1D0X A;  8ICL A;  1KD1 C;  4IKF A;  2PTK A;  1UPH A;  5ALG A;  2HCK A;  2LMJ A;  4O3P A;  3QYG B;  8ICK A;  3LVW A;  4M75 E;  5LJ3 h;  2ODG A;  2QQ9 A;  2I6X A;  4NXZ A;  3RH6 A;  1GCP A;  1O03 A;  1R0B G;  2RO0 A;  4G3I A;  3RJI A;  4XK8 E;  3I35 A;  4M7A F;  7ICE A;  6AT1 B;  4GLK A;  1IHV A;  1OOT A;  2G0A A;  3PT9 A;  5AK6 A;  4OO1 J;  9ICS A;  3EH1 A;  4DBF A;  1WQW A;  4KX5 A;  2R8G A;  5ALH A;  4J9L A;  3FM9 A;  2K3X A;  1ZD5 A;  4Y92 A;  3X25 B;  1FXX A;  3GNG A;  1W2B S;  3UMG A;  3SV4 A;  3CPW A;  1NKC A;  1AT1 B;  4QVZ A;  1QQ7 A;  5HHH A;  4KUD K;  8ICA A;  1TWB A;  2LX7 A;  3L5K A;  2KMT A;  3RMS A;  4ELZ C;  1BGX T;  3OQ5 A;  2AJQ A;  3QEB Z;  1VQ5 A;  3U23 A;  4RTV A;  3M7D A;  2SEM A;  4C8Q C;  5ALX A;  2ZIX A;  3KHR A;  3JCM b;  2CSI A;  2OCE A;  3BJY A;  3OW2 S;  3EG9 B;  1MUZ A;  4LE9 A;  1NPP A;  2EZY A;  2LMR A;  3CNH A;  4KMO B;  2DTO A;  4RTT A;  4F7U B;  1UHU A;  4M7D G;  4CGZ A;  2ES6 A;  2YQE A;  4B6J A;  3V72 A;  2JVV A;  2KSO A;  2ZTD A;  4JJD A;  3I9Q A;  5KG2 A;  2DLP A;  4M77 E;  1Y57 A;  2AZS A;  1CUK A;  1PZN A;  3CME A;  1NOM A;  2GFU A;  1SWW A;  2KRM A;  1RAE B;  3RNJ A;  3UA7 A;  2HW3 A;  4UBC A;  1D0Y A;  1RUW A;  3REA B;  3QEA Z;  3H0H A;  4AFZ C;  3CCS A;  1Q81 C;  4F91 B;  5KYN A;  8ICN A;  4PFZ A;  3PO5 A;  2DIQ A;  3THK A;  2F5K A;  2D8H A;  1G3S A;  5DQH A;  4K4I A;  4NL9 A;  2LQK A;  2CP7 A;  8ICS A;  4PJO E;  4LZG A;  3MR5 A;  2WF6 A;  3V8J A;  4O3Q A;  1ZQL A;  4QWD A;  1Z00 B;  4O9M A;  4DQS A;  2BCR A;  4I2F A;  2F1J A;  2YUO A;  2NUZ A;  3HIL A;  3FYH A;  1VQN A;  3QSU A;  3JPT A;  1WUD A;  1ZQS A;  1T0J A;  2L5Y A;  1NG2 A;  4JRP A;  4QZH A;  2K60 A;  3Q8P B;  5KG1 A;  5B66 U;  2KMD A;  1FMK A;  4RTW A;  1N9S A;  3EGD B;  3HKZ F;  3FJP A;  1X9X A;  4CRX A;  2OAU A;  2NUT B;  4AP9 A;  2HBP A;  3TKA A;  3CMA T;  3SHW A;  2ZG6 A;  3M8S A;  5J26 A;  3KHG A;  1HYO A;  2QB1 A;  2CT4 A;  1BPY A;  4PJO A;  1NM7 A;  2LZ6 B;  4X34 A;  2XGQ A;  2KZZ A;  4RZR A;  3SWN A;  2CKK A;  2RHZ A;  5KYU A;  1NK4 A;  2K4H A;  3FDS A;  2YRC A;  2F8L A;  1NYF A;  2BPC A;  2H3Z A;  1WPY A;  1LB2 B;  1L7P A;  2LYH A;  5HHI A;  1TK0 A;  2YML A;  1U48 A;  1M2O A;  3CXC S;  3C5F A;  1WWV A;  2RI3 A;  2GTJ A;  8ICE A;  4CDG A;  1S0V A;  2HKQ B;  4CC2 A;  4B9M A;  4YXJ A;  2OEH A;  3F2C A;  1QKW A;  3M54 A;  3MP8 A;  4QNL A;  4KGV B;  1F1B B;  3G6X A;  3PW4 A;  5IN1 A;  1IV8 A;  4QWA A;  5KFU A;  3QUC A;  1T0H A;  1XSL A;  3M6K A;  4DS4 A;  3LLR A;  3QBY A;  3CXC A;  2FI1 A;  2P84 A;  2FJ6 A;  1ZYQ A;  2DL0 A;  1PSE A;  2OJ2 A;  4PJO G;  4Q5W A;  2R8H A;  5JUM A;  3EYZ A;  1AWX A;  4I2A A;  4IQU A;  1T94 A;  1KFT A;  2J7I A;  2K3Y A;  3CCM T;  1G2B A;  5IHN A;  2YUQ A;  4E7L A;  1Y71 A;  2QEX Q;  1X27 A;  3F53 A;  4JV1 A;  3PVL A;  3DEE A;  1UGV A;  4MFF A;  5J2B A;  1KBU A;  2MCN A;  2YLB A;  3JB9 J;  2NRX A;  3WU2 U;  4Q8E A;  2EGE A;  3VS4 A;  2GOL A;  2EYY A;  5CR2 A;  3CYM A;  2NRZ A;  2O88 A;  3P8B B;  1K5O A;  4HAI A;  4JV0 A;  3RBE A;  1CEZ A;  4LDU A;  2C22 A;  5L23 A;  5AKE A;  1YHQ T;  1UFF A;  1WI7 A;  4R8U B;  3IN5 A;  5DLQ E;  3T9N A;  4D8D A;  1JJ2 A;  1H92 A;  3IRU A;  1W4S A;  3I56 Q;  1L5U A;  2K4Y A;  4KLE A;  3CCQ T;  2E8N A;  1K9M U;  3RJG A;  2AQ4 A;  2FHD A;  4NOY A;  1ED1 A;  1SKS A;  4ECZ A;  5AKI A;  4C7Y A;  2QA4 A;  3K75 D;  1SZP A;  4AYB C;  4DL7 A;  2RHY A;  4J9M A;  4RCB A;  3RJE A;  1N63 A;  1BPX A;  4MZM A;  2W9B A;  4FYX B;  2YN4 A;  4QZG A;  4KUL A;  3JCM W;  2N1R A;  2HOI A;  4MEX A;  3PSI A;  3N5B B;  1OUQ A;  4IRC A;  4P0Q B;  1M90 U;  2K8B B;  4IC9 A;  4KIT B;  1VQ9 Q;  2WF5 A;  2BQR A;  2B6G A;  2DF4 B;  1Z4O A;  2A1A A;  2XGP A;  1I0C A;  3A0B U;  4ELT A;  1VUB A;  3A1P A;  3KKA C;  4B9L A;  3G1J A;  4F7U A;  3HRD D;  4J9I A;  4JZ3 A;  1DK2 A;  2YB4 A;  5ALR A;  1KDH A;  1ZQV A;  2XI9 A;  2RHF A;  3PZP A;  5L1L A;  4DCC A;  3VU3 C;  5CQY A;  3KFU F;  1SGG A;  2V8J A;  1YIJ T;  2W43 A;  4PPX A;  1KD1 R;  1LVH A;  3PSP A;  5KFA A;  4RT3 A;  4DLG A;  1U49 A;  1K8A R;  3CD6 T;  2X51 A;  1ECW A;  2OAW A;  5F9L A;  2Z7J A;  1MN8 A;  1GFC A;  3Q8Q B;  4J9F A;  5A0G A;  2DD5 A;  4A54 A;  3BZK A;  3PW2 A;  2DYI A;  3CC7 T;  4IQV A;  1NLP C;  4OB3 B;  2A7Y A;  3QU4 A;  4M7A A;  5KCH A;  4I27 A;  2EGA A;  4R63 A;  3H9N A;  3H4D A;  2FPM A;  3RES A;  3PMN A;  5C0M A;  3HWT A;  3H4B A;  1QCF A;  1ZLM A;  3C94 A;  7ICN A;  1HSQ A;  2FE9 A;  5TZV A;  3BE3 A;  1GBR A;  1S0M A;  3OYH A;  2A37 A;  2PMZ C;  3H8S A;  1TVA A;  5IIN A;  2LCL A;  2CRX A;  1RZT A;  2Y4Y A;  4A4E A;  3RAX A;  2IG0 A;  2YRD A;  1SWV A;  2GCX A;  1YJ9 A;  4F04 B;  4C8Q G;  1TAQ A;  1RPL A;  2MF2 A;  1OZ2 A;  2HMA A;  2D6F C;  2XKO C;  4IUQ A;  4C0D B;  1ARO P;  1F0M A;  2D6F A;  3AMZ A;  4RQM A;  9ICI A;  2EIF A;  4ATO A;  1F5S A;  1X40 A;  1COO A;  2K7A A;  1XWL A;  3AM9 A;  3VRY A;  3D2Q A;  3RFA A;  4M7D E;  4M7A G;  4GBQ A;  3TCJ A;  4EX7 A;  9ICU A;  3HP9 A;  1L8L A;  1ZQ1 C;  1S97 A;  2E3T A;  3AQE A;  9ICL A;  2BQU A;  5KFZ A;  4F4K A;  4PL2 A;  2CH4 W;  2WSE E;  3CCE A;  2PKE A;  2L3R A;  2BE7 D;  3V6J A;  1U1T A;  5J0R A;  1KD1 U;  4RUC A;  1VQN Q;  4KH0 B;  3WKD A;  2O9S A;  2R18 A;  1OZ3 A;  3RBB B;  1VQL T;  3X20 B;  3CCE Q;  1B34 A;  2X4W A;  1XOV A;  2QEX A;  1L3V A;  2YWW A;  4DFP A;  1KHI A;  3K1Z A;  4KGZ B;  3LWI A;  3FB9 A;  3VUZ A;  2NRT A;  7ICF A;  2ZPE B;  4C5I A;  3O8V A;  9ICJ A;  4M77 D;  3OJS A;  3VUB A;  1IG6 A;  1H38 A;  3OB9 A;  1NNL A;  4J9H A;  1TU0 B;  2M16 A;  3KHH A;  2RB6 A;  2X4J A;  3MGH A;  4I2B A;  4M75 G;  2CT3 A;  2C28 A;  5J0O A;  2G5H B;  2P0K A;  4J7I A;  5GAN d;  5KT5 A;  4XTZ A;  3M57 A;  1OV3 A;  1C6V X;  5LJ5 h;  5HR6 A;  2QDL A;  4ICA A;  1TUC A;  4N4I A;  3BS5 A;  4PJO D;  3L2Z A;  3MR3 A;  3TAP A;  2LT1 A;  4GY5 A;  1S72 Q;  2PMZ F;  4UAW A;  1AZE A;  3C21 A;  4PJO F;  2RQU A;  4MDW A;  2PZ1 A;  1BPE A;  1D3B B;  3WK5 A;  2FG0 A;  1KN5 A;  3CBP A;  2AHO B;  4RQ3 A;  4LZD A;  3HT3 A;  3N7R C;  5ALT A;  2JS0 A;  4M78 D;  3J80 E;  1ZSZ B;  4OB2 B;  1SL0 A;  4C92 G;  4EEL A;  1HJD A;  3H40 A;  4QT7 A;  5ALZ A;  1IB8 A;  5CK9 A;  3CCV Q;  2MUT B;  1WYG A;  1XO0 A;  4E0D A;  2DBY A;  5FU6 C;  4TQR A;  2QQS A;  4PFP A;  3GIM A;  4Q8F A;  3OPX A;  2AGP A;  5AM3 A;  1M1K U;  2DE0 X;  3S6J A;  2GTO A;  1KQQ A;  4F2S A;  4IUU A;  4RNO A;  4C92 F;  2DPP B;  2YMP A;  3WKA A;  3N7S C;  3UMC A;  1JIH A;  2YB1 A;  4IRK A;  3RB3 A;  4JJC A;  4J9Q A;  3LWL A;  2KXC A;  1KC8 U;  1RI9 A;  5GAM f;  3UM9 A;  1KFD A;  1ZOL A;  1OX9 A;  4QZF A;  2RQ5 A;  5AIB A;  2VAN A;  9ICT A;  5DY9 A;  5GMK i;  5GAM j;  4JRQ A;  1KQ1 A;  1RAF B;  2KHV A;  4X9D A;  1RAI B;  1UHC A;  4BD3 A;  4RMO A;  2RH2 A;  5GAN h;  2LCS A;  4K4G A;  1WJS A;  1UT8 A;  4OCZ A;  4P0P A;  2LQW A;  3PIP A;  3KZI U;  1JRP A;  5HP4 A;  3TSZ A;  5ALU A;  1WCL A;  1QCK A;  4N4H A;  4C8L A;  2XVT A;  1KEJ A;  1JB0 E;  3P8D A;  4C8K A;  1E6G A;  3E1S A;  2GO7 A;  3I28 A;  3M0S A;  4YD2 A;  2W9C B;  1H8K A;  3MO8 A;  4AFS C;  3ICX A;  1WXT A;  1XSP A;  5IXF A;  3RH4 A;  1I07 A;  5GAO n;  4DSL A;  2V1Q A;  5EWG A;  3GIK A;  1BI3 A;  3SV3 A;  4M77 B;  2HSE B;  4M04 A;  4IUR A;  4BXO A;  1BI0 A;  4J83 A;  4EIK A;  4QVD A;  1Q7Y R;  1VQ7 Q;  3JV3 A;  1Z00 A;  3M5A A;  1SRL A;  4JRI A;  5DBA A;  4RTY A;  1J2N A;  2ESE A;  5J2E A;  2E65 A;  5J2K A;  5J3B A;  5I22 A;  5LJ3 e;  2V8I A;  1PKT A;  3OSN A;  4Z02 A;  5KYY A;  2GFA A;  5CKF A;  2BHN A;  1RQL A;  1D0Z A;  2KYM A;  3CCL T;  4RTZ A;  4BDY A;  4IIM A;  2E1F A;  2DXT A;  4KT0 E;  3V7L A;  3CPW P;  1VQ4 Q;  1JN3 A;  1TUG B;  2MRL A;  4EPC A;  8ICV A;  3CCM Q;  2F44 A;  3OMG A;  5ALE A;  1OYX A;  1F44 A;  3PVQ A;  2RRD A;  4C8Q E;  1CKA A;  2DL8 A;  1LOJ A;  2L89 A;  3CQT A;  2P66 A;  4DF8 A;  2ZUD A;  1I4K 1;  4F7U F;  1U8R A;  1ZQW A;  3VCB A;  2ZIV A;  2E4H A;  1ZQH A;  2NRV A;  4LNP A;  3AQF A;  1L3S A;  1L7M A;  1TV9 A;  4B9S A;  5AI9 A;  2IHN A;  2CYZ B;  1WHH A;  3PV8 A;  1JQQ A;  3G6E Q;  1I1J A;  1ZSZ C;  2KT1 A;  5FRN A;  5ECA A;  2QAR A;  1L8O A;  2KJ8 A;  1JRO A;  3E0F A;  4E7K A;  2LRQ A;  1KTQ A;  5GAM e;  2G3R A;  4ZTF A;  3T5K A;  2XMF A;  2KXD A;  1QWE A;  3JCM Q;  4FIB A;  4RUA A;  1TK8 A;  1RI0 A;  2EJ9 A;  1RAB B;  3JSC A;  4J9S A;  3QJ6 A;  4A53 A;  2E3H A;  4JUZ A;  1O9S A;  3A8H B;  3QUQ A;  4DSJ A;  3TAC B;  3ZD8 A;  3IHQ B;  3F2B A;  4EBD A;  1SXE A;  4Z6D A;  5KAI U;  2O4X B;  3EFR A;  4Z88 A;  1COK A;  2O9V A;  4LDV A;  5CAI A;  2FRY A;  2P6U A;  2RJE A;  3HW8 A;  3M58 A;  1HIW A;  5ALY A;  3RIR A;  4M9J A;  2DTI A;  2HI0 A;  3M53 A;  3PX4 A;  2OTL T;  2E64 A;  2AQ0 A;  8ICJ A;  1WJR A;  3UA6 A;  5AYF A;  1UTI A;  3Q1J A;  1TK5 A;  3RJH A;  3OYN A;  2XDP A;  4TQS A;  2RJD A;  4M0A A;  2IIM A;  3M56 A;  2YUP A;  3KHL A;  2C2R A;  1VQP Q;  2F1L A;  2F76 X;  4EMG A;  2HAX A;  3HTR A;  1NK5 A;  2CP0 A;  1G3Y A;  5LJ3 f;  2NWM A;  1D9D A;  3H41 A;  5KFC A;  4DQI A;  2QGG A;  3HJE A;  1ZSZ A;  3MR6 A;  3M0U A;  4C5E A;  1K76 A;  5LJ3 d;  1DGS A;  3M1Y A;  3GII A;  3T79 A;  2XIC A;  3H0R B;  2R8J A;  2GF7 A;  1G3W A;  4KUI A;  3I55 A;  5AKJ A;  3OSV A;  8ICH A;  1VQ4 T;  4M78 B;  2WF9 A;  1QVG S;  4EEN A;  3RDV A;  5G5G A;  1QQ6 A;  2AKK A;  2JMG A;  3PR5 B;  4BGD A;  3WK6 A;  3OYI A;  3UPU A;  2AXT U;  1QVF P;  4M9H A;  4EMK C;  3FLG A;  3J81 j;  1RLP C;  5GAN 2;  4YVZ A;  4Y28 E;  3EAE A;  2IOF A;  1TKD A;  3MEA A;  1A6S A;  7ICK A;  4TUR A;  2HHV A;  2VYT A;  4YG2 A;  4J9N A;  2LT4 A;  3CCL A;  5IAY A;  2BZX A;  2PFP A;  3TVT A;  2RMO A;  1FYN A;  1WQ7 A;  2R8I A;  2HHQ A;  3G6E T;  2PI5 A;  1B7T A;  3C23 A;  3AUO A;  2ZJ8 A;  1D3B A;  3R6O A;  3JPN A;  1S10 A;  5IHK A;  3PW7 A;  4CE6 A;  4PJO C;  1PWT A;  5KFG A;  5EE3 A;  4RQ6 A;  3RR8 A;  4Y2J A;  4M78 E;  3IG5 A;  5D7U A;  3OS0 A;  8ICU A;  2KJ9 A;  2VXE A;  2H3V A;  1NPR A;  4PNO A;  1OI1 A;  1VQO Q;  1B4F A;  2W9C A;  2D8J A;  3PR4 A;  3RBD A;  2D0N A;  1OU9 A;  1BKB A;  2Y90 A;  2ALZ A;  1JAL A;  1X9S A;  1MV0 B;  3M8R A;  3REB B;  3QYP A;  1QTM A;  3H0F A;  5GMK j;  5JRT A;  4M77 A;  2ISO A;  4M9G A;  4HCZ A;  1J3T A;  5KFV A;  2YHT A;  4M77 C;  4HCB A;  4JLG A;  4XA5 A;  1NJI C;  4EBC A;  4ECQ A;  4DSF A;  7ICG A;  2HDO A;  1SRM A;  4BWJ A;  3MEW A;  1WA7 A;  1YWO A;  3BDP A;  1PRM C;  4JS5 A;  2J6O A;  2OTL Q;  5J2D A;  1YN8 A;  2ATL A;  5CKE A;  2Q4T A;  4UAZ A;  1WNL A;  3KD3 A;  2ZIU B;  2J6U A;  4ELU A;  2KFZ A;  4UBB A;  2WF7 A;  2HOF A;  2COZ A;  4C92 A;  1Z3E B;  1U4B A;  4ECW A;  2V4Q A;  2BCV A;  3OYG A;  1ZQU A;  4HT9 A;  1M1K R;  3N28 A;  1ZQF A;  2LJ1 A;  1L7O A;  4Y2U A;  2WTF A;  3SMV A;  2LTO A;  2ROT A;  3BS5 B;  1JO8 A;  3PNW C;  1S72 T;  4B9N A;  2XG8 D;  2MYS A;  2QTX A;  4KGX B;  1M3C A;  2IMW P;  2V9W A;  3GU3 A;  2F8K A;  3OA6 A;  4B9W A;  1YI2 Q;  4FW2 A;  4UB4 A;  4OF1 A;  5E79 U;  2Y9T A;  3NAS A;  2V8K A;  1YHQ A;  2ASJ A;  2KNJ A;  3GV8 B;  5JTI A;  8ICF A;  2CGH A;  2XK0 A;  4NS5 A;  3FAH A;  1SKU B;  4RCC A;  1LKY A;  7ICU A;  1YJW Q;  3C12 A;  2RHI A;  5KE2 A;  1SHF A;  4E7S A;  1FEZ A;  5EE0 A;  4JDS A;  2JUF A;  4KLG A;  2AK5 A;  2G07 A;  5FU6 B;  2DAQ A;  5LJ3 j;  4M7A D;  1B07 A;  3V7C A;  1PK1 A;  3OW2 P;  3QZ9 B;  4J6Y A;  4XU2 A;  3OY9 A;  2KDS A;  3CC4 A;  1SG5 A;  3BQT A;  2HBK A;  1S0O A;  2CS7 A;  4GXJ A;  3OSS C;  2X4X A;  4ECU A;  4O5K A;  5DGB A;  2XDD A;  4C8Q D;  1K9M C;  1ZD4 A;  2CZ1 B;  4DL3 A;  5KG6 A;  5LJ5 g;  8ICQ A;  1ZUK A;  5KG7 A;  3KOO A;  3V7K A;  5KAF U;  4C4R A;  4FS2 A;  3FRN A;  2KGT A;  1NI3 A;  1YCY A;  2JOY A;  2KRO A;  4M47 A;  3MET A;  4M77 G;  4O3R A;  1SPK A;  4ELY C;  1VQ9 T;  1N8R C;  2KVQ G;  4KN4 A;  8ICO A;  1OU8 A;  1ZQE A;  2KYB A;  1FMW A;  1HXD A;  2ZGW A;  2W8L A;  4I2J A;  2W0Z A;  2RD1 A;  2QXF A;  1QVG P;  5GMK l;  2XD0 A;  5DB8 A;  2IPO B;  1DGJ A;  3G71 A;  3CC2 T;  5DLO A;  1ZD2 P;  4XQ3 A;  4I2D A;  4F5P A;  5KFH A;  2F77 X;  4F4W A;  2ZAE A;  1LCK A;  5EE9 A;  3X24 B;  3RTV A;  3E19 A;  3SD4 A;  1U1S A;  2BKD N;  1YI2 A;  5J2G A;  2J6K A;  2J06 A;  4RPX A;  2HHU A;  4OMN A;  1NEB A;  9ICQ A;  1M1G A;  2KZM A;  5LL6 S;  4NLK A;  2I9G A;  4A4K A;  5CRX A;  1I81 A;  2K79 A;  2JXJ A;  3NS1 A;  4GLX A;  2K9G A;  4UB6 U;  2ZIX B;  3TEE A;  2KIW A;  3CCL Q;  3PFS A;  3QZ8 A;  2PXI A;  4R56 A;  2KD1 A;  3T3F A;  1IZ6 A;  4NM2 A;  1Q86 R;  3ETR A;  1MMN A;  2PUK B;  1NK9 A;  2CUD A;  1XC9 A;  5GTI U;  4ED6 A;  1PD0 A;  2DL4 A;  1U5S A;  5GMK h;  2KJ5 A;  4I29 A;  1UA1 A;  1OPK A;  3JRZ A;  3TAN A;  3OYE A;  2M9N A;  3I5S A;  1M3B A;  1VJ5 A;  2KSO B;  3WKE A;  4FW1 A;  2IHM A;  3OJU A;  3LX7 A;  4N4G A;  2M9U A;  2MA1 A;  2JZ2 A;  4ECS A;  5DBB A;  4F4Y A;  1M3A A;  5BPC A;  2DXU A;  5CKB A;  3NVZ A;  5KYX A;  8ICY A;  3QKJ A;  1SSF A;  2K4I A;  1N2X A;  3EHQ A;  4IRD A;  5KH6 A;  4I2H A;  5HCK A;  4F2R A;  2VJ4 A;  2UVR A;  4C8O A;  1UE9 A;  3EH2 A;  4QW9 A;  2K5F A;  2FPF A;  9ICH A;  2HBW A;  4C92 D;  2QAR B;  8ICP A;  5G5H A;  4K11 A;  4KLT A;  3JPR A;  2F2W A;  4Z89 A;  2YT6 A;  2KK0 A;  3L3F X;  4J9E A;  1VQ6 Q;  1QWF A;  2WAQ C;  3NPF A;  3QU9 A;  2DPJ A;  4DFK A;  1NJX A;  4NL3 A;  2R5A A;  3M4Y A;  5CIU A;  1E7O A;  1JJ2 P;  2Y0S F;  1YZ6 A;  2KFN A;  2PVO B;  4DA4 A;  2ZUB A;  2HOQ A;  2NUT A;  4GXK A;  2O4X A;  2EKO A;  3LW5 E;  1Q86 U;  2D9T A;  3N4M B;  3RH5 A;  5AM0 A;  4R66 A;  5J2A A;  5KFD A;  3VJP A;  3DKM A;  1SF9 A;  2RP5 A;  1QVG A;  2EAP A;  4GC7 A;  2R57 A;  4A4H A;  3THV A;  4FU6 A;  3H8Z A;  1YJN A;  3SWN B;  1VQ6 A;  3IG8 A;  2FPL A;  3MHX A;  9ICX A;  1NKE A;  4OB1 B;  4QZ8 A;  4M7D A;  2EWN A;  3E9G A;  2DXB A;  2HDA A;  1WFW A;  3EFO A;  4XTX A;  1EXN A;  2GQV A;  1KHC A;  1X2I A;  4OJP A;  5J2H A;  1Q8K A;  3ISD A;  5AKX A;  3CC4 Q;  2QI2 A;  4A8E A;  1XS9 D;  1WCN A;  4EEY A;  1X6G A;  3WK4 A;  4JPB W;  3BFM A;  1FWZ A;  5AI8 A;  2FEI A;  4JZ4 A;  3RB4 A;  3NUQ A;  2K4E A;  3EUB 2;  4M6W B;  3Q8L A;  3OS2 A;  2EYX A;  4Y2S A;  1K1Z A;  4OMQ A;  4PJM A;  3JCM c;  2HVI A;  2L2P A;  3QXG A;  3PTA A;  3MAB A;  1MMD A;  4RQ8 A;  3ZD9 A;  1KC8 R;  4M77 F;  5DB6 A;  1ZBJ A;  2EKH A;  8ICW A;  3HRU A;  4MF8 A;  2VKN A;  4FO6 A;  4UC4 A;  2LNV A;  3H8W A;  2D3D A;  5KFF A;  3TFR A;  4PL6 A;  2FMS A;  3Q8S B;  1HUZ A;  5KFS A;  4Y2V A;  2K8C B;  4UB8 U;  4PHE A;  3DB3 A;  9ATC B;  2L8D A;  4FYY B;  5GJV B;  2F2A B;  4QJF B;  3O0F A;  1X6O A;  5GAO q;  2W3S A;  1FX7 A;  4F8R A;  1ZQC A;  5DG8 A;  4ESR A;  4B9V A;  2J6F A;  4PJL A;  5CR0 A;  3CCQ Q;  3PW0 A;  4L5G A;  3D7S B;  4ZN3 A;  5LJ3 g;  5GAO l;  3ASK A;  5LJ5 d;  4EBE A;  3G6Y A;  1OW5 A;  2FLN A;  4NL9 C;  2BPF A;  4FZM A;  3ZBD A;  2DBK A;  5HKC A;  5GAM d;  3JCM f;  2V4R A;  1PUZ A;  1VQO T;  2KNB B;  3TSW A;  1BYM A;  1C0M A;  2O31 A;  9ICG A;  2KEA A;  3PX6 A;  4ED0 A;  1T3N A;  2L3S A;  1N48 A;  3NVY A;  4BE0 A;  3L2W A;  5J8Y A;  5KT4 A;  2HHT A;  2DER A;  3AU6 A;  1KLN A;  3BY7 A;  4YR3 A;  5ALQ A;  4ZGJ B;  4KLL A;  2VAS A;  4X9C A;  1ZQD A;  1N5W A;  5J0S A;  2GLE A;  2ISP A;  1VQ9 A;  1QVP A;  1RQN A;  2EQI A;  2ZIU A;  1IRE B;  5KFY A;  4UAU A;  4TUQ A;  5KYW A;  1BCM A;  3NHN A;  5IH2 A;  2L3Q A;  4WJ3 B;  1VQK Q;  4FL6 A;  4US8 A;  3CD6 Q;  4PGX A;  1DK3 A;  2MI6 A;  4LD6 A;  4WCI A;  2M0N A;  2EGC A;  3G71 Q;  3ZEH A;  2C0O A;  4PJO B;  1CI4 A;  4LN2 A;  1PHT A;  2DFL A;  3PY8 A;  1T3Q A;  1CKB A;  1NK7 A;  1W2B A;  4P4M A;  4CF5 A;  5GAN f;  1TSF A;  2K2M A;  4EDU A;  2DNU A;  3BQ7 A;  1JU5 C;  2E10 A;  3GF5 A;  1RAG B;  2EQK A;  3JPP A;  1YJ9 T;  5IIJ A;  2KQW A;  3KFV A;  1JBM A;  1UHF A;  4DLE A;  3AEV A;  2F5T X;  2KR3 A;  4OMP A;  5GAN j;  2KRN A;  5FU7 B;  3QU5 A;  3ED5 A;  3RJJ A;  3ZFJ A;  2JZB B;  1IHW A;  1NE8 A;  4QWC A;  4M7A B;  1VQM A;  4QW2 A;  2KK4 A;  5IT9 E;  1Q81 U;  3QZ7 A;  2FPK A;  2DO3 A;  5I2M A;  1N27 A;  4XTV A;  4F72 A;  2EYZ A;  3N97 B;  2RQT A;  4M78 C;  5AK5 A;  5AM4 A;  4XRH A;  1Q95 G;  2WSC E;  5AM1 A;  2A19 A;  3HKS A;  5FRO A;  5AKL A;  5FW9 A;  3VV0 A;  2QA4 Q;  4C8Q B;  5I11 A;  5DG7 A;  5KT2 A;  2ZZD A;  2DVJ A;  3F5A A;  1KL9 A;  3SWN C;  1TG0 A;  1ZJN A;  2FRW A;  4XU0 A;  3JCM e;  5J2J A;  1U3O A;  5KFP A;  4KLH A;  4Z6C A;  3C5G A;  4ME7 A;  2L0A A;  2JJ9 A;  3M0P A;  4DFD A;  1B43 A;  4IUT A;  2BTT A;  7ICI A;  4MF2 A;  3VS5 A;  5GAO r;  1S8O A;  2W11 A;  1A77 A;  2EAO A;  2KEY A;  5CJ7 A;  3M59 A;  4O3O A;  3HFN A;  3EWA A;  1L3U A;  4OJO A;  2JNG A;  1AVZ C;  3OMC A;  4OJL A;  4FYW B;  1UUE A;  4F71 A;  3QNM A;  2PFQ A;  1UB4 A;  1GCQ C;  1TXQ A;  3M9N B;  4OGC A;  1PNJ A;  4LXC A;  3F5E A;  3JCM V;  2G09 A;  1RAC B;  3GIB A;  3M0Q A;  3L42 A;  3V6H A;  4DFM A;  2HSZ A;  2WF8 A;  4J9P A;  2W7P A;  3BZC A;  4JWM A;  3EG2 A;  1QCO A;  3OYY A;  1JEG A;  3V7R A;  1MQ3 A;  1YIT A;  5FP0 A;  2VB6 A;  2DTH A;  5L8R E;  3GV5 B;  2JEF A;  1PCX A;  2LCC A;  4VUB A;  2DKX A;  4DQR A;  1TE2 A;  3TRE A;  2HQX A;  4LDW A;  3HPW A;  3BDU A;  2PVD B;  4JLI A;  2JHD A;  1S5L U;  1WJQ A;  4DFJ A;  4P0Q A;  1MMG A;  3H8J A;  4UAS A;  3RKW A;  2NYS A;  5GAN e;  1QLY A;  3VKI A;  2ED0 A;  1AQ6 A;  4ECT A;  5AKK A;  1EFN A;  1Z9Z A;  4ZOH C;  4D6W A;  3QWX X;  3DLM A;  4F14 A;  5DG9 A;  3G7Z A;  4M7D B;  5EE1 A;  4ED8 A;  5AKH A;  3CCJ A;  4DEZ A;  5IXB A;  4Z6E A;  2DD4 A;  4M78 G;  5J0P A;  5F3X B;  1MSW D;  1URJ A;  2RPN A;  2CP6 A;  3RUX A;  1ZQZ A;  2HHW A;  2LBO A;  2QB0 A;  4RU9 A;  4L59 A;  3I56 A;  5KNI A;  3RJK A;  4DOV A;  1GCQ A;  3CCS Q;  4M7D F;  4DQP A;  3BQ1 A;  5KT6 A;  2HBJ A;  1LNX A;  2PNI A;  1D09 B;  3DDH A;  2ATC B;  3SD7 A;  2QK0 A;  3L2Q A;  1ZSG A;  4I2G A;  4C4T A;  1MNE A;  3PO4 A;  2AHJ B;  2RI2 A;  3CCU T;  4C8Q F;  5HK3 A;  3VYG A;  2F3N A;  3ISC A;  2F1I A;  4DL6 A;  2RNA A;  4UAY A;  4PHD A;  1IGU A;  4NM1 A;  2QQA A;  2UVU A;  4CRI A;  1PG5 B;  2DX1 A;  2BCQ A;  2W7O A;  2E12 A;  3UDC A;  2VJ5 A;  3ISB A;  4QZC A;  4DSK A;  3QDR B;  5AK4 A;  1SKW A;  4XQ8 A;  3ZDB A;  2NV3 A;  5EG2 A;  5GAO p;  2DEU A;  5AIC A;  3ULR B;  1UGQ B;  2ZPB B;  1N8R R;  2JEJ A;  2YLC A;  3WKB A;  3HPO A;  2JMA A;  3LVV A;  5KFN A;  3OHA A;  4DSE A;  2QQR A;  3QX7 A;  2ESW A;  2DMO A;  3AU2 A;  3WXM B;  1ZQ1 A;  2GGR A;  2J6S A;  5ALV A;  5GAO m;  4FCY A;  2MWP A;  4AT1 B;  2JW4 A;  3CCR T;  1X9M A;  3I1Y A;  4EZ6 A;  1ZBX A;  2NUP B;  4E7I A;  3GBQ A;  2EYQ A;  3SQI A;  2WAQ F;  3B9J A;  1MA7 A;  2ECZ A;  2F1H A;  2WB1 F;  2QQB A;  3JCM P;  1SKR A;  2P0P A;  1UG1 A;  1VQN T;  4QWB A;  3GNF B;  2IOH A;  5AI5 A;  4P4O A;  1YZ7 A;  2KY9 A;  4X1V A;  4EYI B;  1RAH B;  3JB9 D;  4RQ2 A;  2JN0 A;  3UWN A;  3F2D A;  2E1E A;  4MML A;  2JZB A;  3QU2 A;  3QZ5 B;  5CHG A;  2DJQ A;  8ICR A;  4YMO A;  4BE2 A;  1PVP A;  5DGA A;  4M6W A;  1MHN A;  1PVR A;  1NZB A;  1Q82 U;  2B86 A;  3NVV A;  3ZDA A;  5CB1 A;  3UT1 A;  4P2H A;  3MEU A;  1YP5 A;  2LQ8 A;  2VC8 A;  4JJN K;  1QSL A;  2CZ6 B;  1N9R A;  3S3N A;  4C92 E;  2JEG A;  2DIL A;  4KMU A;  2J05 A;  4P0P B;  1BI1 A;  2B21 A;  2CUB A;  3TQ1 A;  5AKZ A;  1TAU A;  2O6K A;  2NO4 A;  5CP2 A;  1M90 C;  2BPG A;  2HMX A;  4EEK A;  1B3Q A;  1OPL A;  3C29 A;  5CKD A;  4E47 A;  2ZIV B;  2W04 A;  4PHA A;  3JCM d;  5D6W A;  4UB5 A;  4AMC A;  2XY6 A;  3IM1 A;  1UEC A;  5KL1 B;  2ZTC A;  1P7D A;  2ED1 A;  2QEX T;  1K9M R;  4QIW C;  4LUE A;  2EYW A;  3GV7 B;  8AT1 B;  4UQG A;  2F2V A;  5IHI A;  7ICT A;  5CCA A;  1ZUY A;  5C0Y A;  2C0I A;  1WIE A;  5AI4 A;  1M30 A;  5IIO A;  4HVV A;  5CVI A;  3MCA B;  2DJZ A;  1PC0 A;  1BPD A;  1YFN A;  2MK5 A;  1YHQ Q;  1HJP A;  8ICI A;  2BDU A;  5IIM A;  2LYA A;  4BX9 C;  3I56 T;  3OGU A;  3GQC A;  2IA6 A;  4RQN A;  4IQT A;  3A0H U;  2Y1J A;  4CI0 C;  4XTU A;  2CXY A;  2UVW A;  2HVH A;  3WK8 A;  4KLI A;  1G83 A;  1PRL C;  1L6N A;  1VOM A;  3MKD A;  1JMS A;  4J9B A;  4C7Z A;  5KL8 B;  4HVW A;  1SHG A;  4K4H A;  2Z0W A;  1NK0 A;  3CBO A;  3EW9 A;  2XCA A;  1XJW B;  2DIG A;  3CCR A;  2CSQ A;  2EPD A;  1H3H A;  1WXU A;  5KG3 A;  2DPI A;  4XTY A;  1UJY A;  5J0W A;  3O5Z A;  1U9L A;  3TFS A;  5TIS U;  4HXJ A;  3G4S Q;  1TUD A;  5ALW A;  2YMM A;  2DZ9 A;  4KX3 A;  3T5L A;  4KRT A;  2YRV A;  4M75 B;  4UAV A;  2E70 A;  2EDU A;  3JPQ A;  2AU0 A;  3RB0 A;  2FVU A;  4XUS A;  4XU1 A;  1TAM A;  3QUB A;  7ICM A;  2DL3 A;  4ECY A;  2NO5 A;  4O3N A;  1Q7Y C;  1NJI R;  1KFZ A;  2COY A;  3M4G A;  9ICC A;  3A8O B;  1ACM B;  4C5G A;  1VIF A;  4GFJ A;  5HR7 A;  1LV5 A;  2XY5 A;  2CP5 A;  1Y07 A;  3MDA A;  1DXS A;  2RA2 A;  3HSB A;  1A76 A;  3MR2 A;  2UVV A;  4FE3 A;  4M2Y A;  1V29 B;  4NLG A;  4U6P A;  1X6B A;  3CCU A;  3I76 A;  1B22 A;  3NTU A;  1NBE B;  1JXE A;  8ICT A;  1YIJ A;  1NJI U;  3E2E A;  2FL7 A;  2QG9 B;  8ICC A;  4N0A C;  1G5V A;  4C8N A;  3CC7 Q;  4DBQ A;  3MJX A;  2H3Q A;  2LVM A;  1H3Z A;  3FJ5 A;  4QVC A;  2JXB A;  3EG9 A;  4ZTJ A;  2AH5 A;  2LX9 A;  7ICR A;  2DYB A;  2OI3 A;  5III A;  5KT3 A;  4CC3 A;  1VLB A;  3EGU A;  3RR7 A;  1TH7 A;  4CC7 A;  1OUL A;  4BY6 C;  4LJX A;  2HHX A;  3SI8 A;  4F92 B;  3QE9 Y;  1CSK A;  3CXC P;  2XDB A;  1ZQM A;  2JM8 A;  3F70 A;  4B9X A;  2KIV A;  1VYT A;  5A2Q E;  2QLT A;  2MAX A;  8ICB A;  4E7Z A;  3M0T A;  4DWI A;  2I0N A;  1C7Y A;  4JV2 A;  2D0Q B;  5DBC A;  3RRH A;  4F4Z A;  2ENM A;  2RK2 A;  2M02 A;  1FIQ A;  1QSY A;  2W9A A;  3OYF A;  1RM6 C;  3LGF A;  4OJ6 A;  2NRW A;  4YQW A;  2AKL A;  4KN7 A;  3JB9 H;  5DLF A;  1MV3 A;  4M78 A;  5LJ5 e;  2MSN A;  1Q86 C;  5L1J A;  2DFU A;  3J7A F;  4YCX A;  2W8K A;  2OTJ Q;  3T5J A;  4HCK A;  2DKG A;  3FC3 A;  4FBU A;  3MFI A;  3I55 T;  1W1F A;  4PK4 A;  2JH1 A;  1UA0 A;  9ICF A;  1U06 A;  2LJ0 A;  2CPR A;  3MFH A;  1YNZ A;  3C28 A;  3FIF A;  2CN1 A;  3VS1 A;  1YT3 A;  3L1A A;  2LDM A;  1M2V A;  4C8Q A;  2X3W D;  5J39 A;  4C5H A;  2QAS A;  3RR6 A;  2G6F X;  3CCE T;  1NJY A;  2ZTE A;  3MP1 A;  2B8A A;  3X28 B;  4QZI A;  2AZV A;  2KSS A;  1D1A A;  1C20 A;  4M7A E;  3MGV A;  4CF4 A;  4TUS A;  2W10 A;  3ETL A;  4NLB A;  1XO1 A;  5D6X A;  9ICR A;  3CCM A;  2OTJ A;  4J03 A;  3CPF A;  3PST A;  4O5C A; 
#chains in the Genus database with same CATH homology
 3E9F A;  4BI3 A;  2HBM A;  1VQP T;  1HK9 A;  2RI5 A;  1YJW T;  3SDZ A;  1WGS A;  5FU7 C;  2ZXH A;  2JH7 A;  3MP6 A;  3S3M A;  2M0O A;  4IUV A;  1M8V A;  4FT4 A;  2EJG A;  1Q3V A;  4JUV A;  3JCM J;  2I2L A;  2ZCF B;  4QQ6 A;  3V8K A;  4YTL A;  2JTM A;  3JB9 F;  4R55 A;  5GAN 4;  3HHT B;  1UGR B;  3CMA A;  2VXF A;  3SAG A;  3L2V A;  3NTI A;  5LJ5 f;  1N8R U;  1Z1B A;  1DRG A;  2KKV A;  2VV5 A;  1MGQ A;  5CQX A;  2EQU A;  3S6W A;  4J5Y A;  4OGE A;  3S3O A;  1KQS S;  2KIC A;  3CC2 A;  3V7S A;  4ZGE B;  3OYA A;  4JRK A;  4P5N A;  5GAM h;  2MAM A;  4FSX A;  1K8A U;  4C0F A;  2MWO A;  4C92 C;  3GPL A;  4M75 D;  4WF2 A;  5M9O A;  3AL0 B;  1QP3 A;  3OS5 A;  3PMI A;  3LWH A;  2A3L A;  4EMK A;  2XHC A;  2EQJ A;  3IP4 B;  4NL2 A;  1M9S A;  3CCV A;  3ME9 A;  2O01 E;  5GAN g;  4NV0 A;  3SB2 A;  1VQ6 T;  2HNI A;  4XTW A;  5GMK e;  2WSF E;  4LD9 K;  4PLI A;  3KUF A;  4V2S A;  3A8M B;  2M1H A;  3ER0 A;  4NWI A;  1Q7Y U;  2K5L A;  1KG1 A;  4XU3 A;  3LYI A;  3VC8 A;  5GAM g;  4J6X A;  1VQM T;  1N6A A;  3QHS A;  2E1H A;  2EQM A;  3GZF A;  1VQL A;  4OMF B;  4KBM B;  3OS1 A;  1BI2 A;  1YJN T;  1M5Q 1;  3G6E A;  3JCM h;  1IIP A;  4U7C A;  2X4Y A;  1XQH A;  3V8L A;  2MMP A;  1Q82 C;  4BE1 A;  5LJ5 j;  1VQ8 A;  4BI8 B;  1YI2 T;  1X75 C;  2BUD A;  3QYH B;  1VQK T;  5T14 A;  4M78 F;  4MDX A;  1G3T A;  4FZN A;  2HD0 A;  3CCS T;  2P0Q A;  2H3F A;  1M4Z A;  2ZPG B;  2JGA A;  4J6W A;  1K73 U;  3HFO A;  4BAC A;  1Q3U A;  2LC4 A;  2FB7 A;  1QVF A;  1VQO A;  5FRM A;  3LYS A;  2PVG B;  3HRS A;  5GAN 3;  1LJO A;  5CKH A;  4M75 A;  1R8O B;  3M9Q A;  2DXC A;  3A8G B;  1VQP A;  3EFS A;  1CRX A;  3QO3 A;  4FZL A;  3D2S A;  4II1 A;  3H0L B;  3PMT A;  2OTJ T;  2F69 A;  3P8H A;  4PKC C;  1KQ2 A;  2VKQ A;  3CC7 A;  2E6N A;  2G06 A;  3ONN A;  3FEO A;  1NZ9 A;  2DVE A;  1K8A C;  2LHT A;  1Z19 A;  1VQ5 T;  3VYH B;  2KHQ A;  3SAH A;  1O75 A;  3M55 A;  4O3M A;  1M1F A;  3NTK A;  3NTH A;  1KQS A;  5GAN 6;  4PLL A;  3CCV T;  1S72 A;  4AYB F;  2NLU A;  4OJ5 A;  3CC4 T;  1B34 B;  2G08 A;  3DB4 A;  2K2V A;  3BDL A;  2QA4 T;  3RKX A;  4ZN1 A;  2PUO B;  4BI4 A;  2KKP A;  2R5M A;  1D8B A;  3TU4 K;  3A8L B;  3MEV A;  3JB9 I;  4BY6 B;  1UGS B;  3SFM A;  3ALR A;  5A0L A;  3FDR A;  3OYB A;  3X26 B;  3HRT A;  3PIO A;  1HEK A;  5KCO A;  5I21 A;  4F7U G;  3CEY A;  2Y4X A;  2OYY A;  3OYM A;  2K5I A;  1GXI E;  1Y96 B;  1PSF A;  3OYJ A;  2LKY A;  4OB0 B;  4ACO A;  4M7D C;  4BDZ A;  4LDX A;  1VQ4 A;  2EAY A;  2RJF A;  2CZ0 B;  3G4S T;  1YIT T;  2G5I B;  2RJC A;  1SZH A;  4M7D D;  2EFI A;  2VGN A;  4NLC A;  3OBW A;  2PQW A;  1I5L A;  1BIB A;  3PGG A;  3WVD B;  2K8A A;  1XTD A;  2FYK A;  4E7J A;  3QII A;  3G71 T;  3SAF A;  4EMK B;  1VQ7 A;  3KBG A;  3CBM A;  4HKE A;  3OYL A;  1BIA A;  3QG1 A;  4RG2 A;  1UGP B;  1ZHI A;  1XNS A;  2P4T A;  2OTL A;  2KOB A;  1JJ2 S;  3GP8 A;  2Y0S C;  1M1K C;  3AHU A;  2HQE A;  2C06 A;  2LYB A;  4QQG A;  4RG8 A;  4RKU E;  3CRX A;  4MMK A;  1YBY A;  2VIX A;  3QJY A;  3C95 A;  5GMK m;  3H6Z A;  3RMQ A;  2X35 A;  5HK0 A;  4JMU A;  2YX8 A;  3D2N A;  2W03 A;  2XID A;  4PL1 A;  2HBL A;  1QP2 A;  3JB9 G;  4M75 F;  4A4G A;  4HA8 A;  2DQN B;  3QUI A;  1VIE A;  3OYK A;  2H3I A;  3L2R A;  1XNI A;  4ZGD B;  4C0D C;  2WAC A;  2A3V A;  4BUG A;  5D6Y A;  2KV2 A;  4JS4 A;  4Y91 A;  4C92 B;  1DJ7 B;  2ZPI B;  3NRW A;  5A0D A;  4XAX B;  3CPW S;  3G4S A;  3DLL A;  2H3J A;  5HY6 A;  4IUP A;  2ZIW B;  3CCJ T;  4HT8 A;  5GAN 5;  2DZC A;  3HKZ C;  3RER A;  1I8F A;  1QVF S;  2JTF A;  4QIW F;  5CO7 A;  2RHX A;  4FT2 A;  1KC8 C;  1Y7X A;  3QPH A;  2IVW A;  4EMH A;  2RM4 A;  5GAN 8;  5DM7 R;  3A5Z B;  2WB1 C;  2XU8 A;  3M6Z A;  2R58 A;  1AHJ B;  2E5Q A;  3OBY A;  2ZXI A;  3HL8 A;  4BJQ A;  3PSF A;  4F7U E;  4OP0 A;  3OYD A;  4M7A C;  1YJW A;  1JRI A;  1RL2 A;  5GAN 7;  1UEB A;  2GH1 A;  3JAM E;  3LGL A;  2BIV A;  3H0M B;  1GO3 F;  4C0G A;  3RKY A;  2KVC A;  3INZ A;  3KXT A;  4E7H A;  2ZPH B;  4O5V A;  5FLX E;  2K89 A;  5C6S A;  2K57 A;  3LH0 A;  4N0A A;  1QW1 A;  2E6Z A;  4M75 C;  2KAF A;  4A4F A;  3QXE B;  1EIF A;  2VUB A;  4C0Z A;  2L5Q A;  4J7F A;  2PU9 B;  1K73 C;  3KZX A;  4LDY A;  3JCM X;  3CP8 A;  4DQ2 A;  4O6J A;  5I2S A;  3BW1 A;  3NFC A;  2VGM A;  2OM6 A;  3CD6 A;  4L6V 5;  3URG A;  3C4S A;  4FM4 B;  2EJF A;  3GOX A;  2ZPF B;  2OXO A;  1X01 A;  3OW2 A;  1VQ7 T;  1VQK A;  3J81 E;  3GLX A;  2DGZ A;  2RK1 A;  3L2U A;  3N7P D;  5KE3 A;  4QQD A;  1VQ8 T;  1Y96 A;  2OH2 A;  1A0P A;  2ZIW A;  4DOW A;  2CZ7 B;  4TVR A;  4BB7 A;  3JCM g;  2RHU A;  2E41 A;  2DK3 A;  1H64 1;  3CCQ A;  1P92 A;  3CME T;  1PVQ A;  4HCC A;  3OYC A;  4OVA A;  2E5S A;  4MZP A;  4J8O A;  3WVE B;  2DEQ A;  2QDY B;  4MZT A;  3RF9 A;  4IKF A;  1KD1 C;  1UPH A;  3QYG B;  5LJ3 h;  3LVW A;  4M75 E;  2QQ9 A;  4XK8 E;  2RO0 A;  4M7A F;  4GLK A;  3PT9 A;  2G0A A;  4OO1 J;  1WQW A;  4KX5 A;  2K3X A;  3X25 B;  1FXX A;  3GNG A;  1W2B S;  3CPW A;  4QVZ A;  4KUD K;  2KMT A;  3RMS A;  4ELZ C;  3OQ5 A;  1VQ5 A;  3M7D A;  4C8Q C;  2ZIX A;  3JCM b;  3OW2 S;  1NPP A;  4F7U B;  2DTO A;  4KMO B;  4M7D G;  4CGZ A;  2JVV A;  4M77 E;  3CME A;  2GFU A;  3CCS A;  1Q81 C;  2DIQ A;  2F5K A;  1G3S A;  2LQK A;  4PJO E;  3V8J A;  1VQN A;  3QSU A;  1WUD A;  4JRP A;  1N9S A;  3FJP A;  3HKZ F;  4CRX A;  2OAU A;  2HBP A;  3CMA T;  2ZG6 A;  5J26 A;  4PJO A;  4X34 A;  3SWN A;  2CKK A;  2RHZ A;  2K4H A;  2F8L A;  2H3Z A;  1WPY A;  3CXC S;  2RI3 A;  4CDG A;  3M54 A;  3F2C A;  3MP8 A;  4QNL A;  5IN1 A;  3M6K A;  3LLR A;  3QBY A;  3CXC A;  1PSE A;  4PJO G;  4Q5W A;  1T94 A;  2K3Y A;  3CCM T;  4E7L A;  1Y71 A;  3F53 A;  3DEE A;  1KBU A;  2YLB A;  3JB9 J;  2GOL A;  5CR2 A;  3CYM A;  3P8B B;  4LDU A;  1YHQ T;  1JJ2 A;  3T9N A;  3IN5 A;  5DLQ E;  1W4S A;  2K4Y A;  3CCQ T;  1K9M U;  2FHD A;  4NOY A;  1ED1 A;  2QA4 A;  4AYB C;  2RHY A;  4RCB A;  4MZM A;  4KUL A;  3JCM W;  2N1R A;  2HOI A;  3PSI A;  3N5B B;  1OUQ A;  4P0Q B;  1M90 U;  2K8B B;  4IC9 A;  2DF4 B;  1VUB A;  4F7U A;  2YB4 A;  2XI9 A;  2RHF A;  3PZP A;  3VU3 C;  5CQY A;  3KFU F;  1YIJ T;  2V8J A;  3PSP A;  3CD6 T;  1ECW A;  2Z7J A;  5A0G A;  2DD5 A;  4A54 A;  3CC7 T;  4OB3 B;  2A7Y A;  4M7A A;  5KCH A;  3RES A;  5C0M A;  2XDB A;  3C94 A;  3OYH A;  2PMZ C;  2LCL A;  2CRX A;  2Y4Y A;  4A4E A;  2IG0 A;  2GCX A;  1YJ9 A;  4C8Q G;  2MF2 A;  1OZ2 A;  2D6F C;  2XKO C;  4IUQ A;  4C0D B;  2D6F A;  4ATO A;  2EIF A;  3D2Q A;  3RFA A;  4M7D E;  4M7A G;  3TCJ A;  3HP9 A;  1ZQ1 C;  3AQE A;  2WSE E;  3CCE A;  4PL2 A;  2L3R A;  1KD1 U;  1U1T A;  2R18 A;  1OZ3 A;  1VQL T;  3X20 B;  1B34 A;  2X4W A;  1XOV A;  2QEX A;  1KHI A;  3K1Z A;  3LWI A;  3FB9 A;  3VUZ A;  2ZPE B;  4C5I A;  3O8V A;  4M77 D;  3VUB A;  3OB9 A;  2M16 A;  2RB6 A;  2X4J A;  4M75 G;  2P0K A;  4J7I A;  2G5H B;  5GAN d;  4XTZ A;  3M57 A;  5LJ5 h;  5HR6 A;  4ICA A;  4N4I A;  4PJO D;  3L2Z A;  4GY5 A;  2LT1 A;  2PMZ F;  4PJO F;  4MDW A;  1D3B B;  3CBP A;  3N7R C;  4M78 D;  3J80 E;  4OB2 B;  4C92 G;  5CK9 A;  1XO0 A;  5FU6 C;  2QQS A;  3OPX A;  1M1K U;  4IUU A;  4C92 F;  2DPP B;  3N7S C;  2YB1 A;  1KC8 U;  5GAM f;  5DY9 A;  5GMK i;  5GAM j;  4JRQ A;  1KQ1 A;  2KHV A;  4X9D A;  4BD3 A;  4RMO A;  2RH2 A;  5GAN h;  1WJS A;  4P0P A;  3PIP A;  4N4H A;  2XVT A;  1JB0 E;  3P8D A;  3E1S A;  3MO8 A;  3ICX A;  5GAO n;  1BI3 A;  4M77 B;  4IUR A;  1BI0 A;  4QVD A;  4J83 A;  3M5A A;  4JRI A;  2E65 A;  5J3B A;  5LJ3 e;  2V8I A;  4Z02 A;  2GFA A;  5CKF A;  4BDY A;  3CCL T;  4KT0 E;  2E1F A;  2DXT A;  2MRL A;  4EPC A;  3OMG A;  1OYX A;  1F44 A;  2RRD A;  4C8Q E;  1LOJ A;  2L89 A;  1I4K 1;  4F7U F;  1U8R A;  3VCB A;  2ZIV A;  3AQF A;  2CYZ B;  5FRN A;  2KJ8 A;  3E0F A;  4E7K A;  2LRQ A;  5GAM e;  2G3R A;  4ZTF A;  3JCM Q;  4FIB A;  1RI0 A;  2EJ9 A;  3JSC A;  3QJ6 A;  4A53 A;  1O9S A;  3A8H B;  3F2B A;  2O4X B;  3EFR A;  4LDV A;  5CAI A;  2RJE A;  3M58 A;  1HIW A;  3RIR A;  2DTI A;  3M53 A;  2OTL T;  2E64 A;  1WJR A;  5AYF A;  3Q1J A;  3OYN A;  2XDP A;  2RJD A;  3M56 A;  2F76 X;  4EMG A;  2HAX A;  1G3Y A;  5LJ3 f;  3CPF A;  4C5E A;  5LJ3 d;  3T79 A;  2XIC A;  3H0R B;  2GF7 A;  3I55 A;  1G3W A;  4KUI A;  3OSV A;  1VQ4 T;  4M78 B;  1QVG S;  2JMG A;  3OYI A;  3UPU A;  4EMK C;  3FLG A;  5GAN 2;  4Y28 E;  3EAE A;  3MEA A;  1A6S A;  2VYT A;  2LT4 A;  3CCL A;  5IAY A;  1WQ7 A;  3G6E T;  3R6O A;  1D3B A;  4PJO C;  4M78 E;  3IG5 A;  3OS0 A;  2VXE A;  2KJ9 A;  2H3V A;  1NPR A;  4PNO A;  1OI1 A;  1BKB A;  2Y90 A;  5GMK j;  4M77 A;  4HCZ A;  2YHT A;  4M77 C;  4HCB A;  4JLG A;  1NJI C;  3MEW A;  4JS5 A;  5CKE A;  2Q4T A;  1WNL A;  2ZIU B;  2HOF A;  4C92 A;  3OYG A;  4HT9 A;  3SMV A;  2LTO A;  3PNW C;  1S72 T;  2XG8 D;  2QTX A;  3GU3 A;  3OA6 A;  4B9W A;  4OF1 A;  2V8K A;  1YHQ A;  2KNJ A;  2CGH A;  2XK0 A;  4NS5 A;  4RCC A;  3C12 A;  2RHI A;  5KE2 A;  4JDS A;  2JUF A;  2G07 A;  5FU6 B;  2DAQ A;  5LJ3 j;  4M7A D;  3V7C A;  3QZ9 B;  4J6Y A;  4XU2 A;  3OY9 A;  2KDS A;  3CC4 A;  2HBK A;  2CS7 A;  3OSS C;  2X4X A;  2XDD A;  4C8Q D;  1K9M C;  2CZ1 B;  5LJ5 g;  3FRN A;  1YCY A;  2JOY A;  3MET A;  4M77 G;  4ELY C;  1VQ9 T;  1N8R C;  2KVQ G;  1HXD A;  2ZGW A;  2RD1 A;  2QXF A;  2XD0 A;  5GMK l;  3G71 A;  3CC2 T;  5DLO A;  4XQ3 A;  2F77 X;  3X24 B;  3E19 A;  3SD4 A;  1U1S A;  2BKD N;  1YI2 A;  1M1G A;  5LL6 S;  4A4K A;  5CRX A;  1I81 A;  3TEE A;  2ZIX B;  2KIW A;  3PFS A;  4R56 A;  2KD1 A;  1IZ6 A;  2PUK B;  5GMK h;  2KJ5 A;  3JRZ A;  3OYE A;  3LX7 A;  4N4G A;  2M9U A;  2MA1 A;  2JZ2 A;  2DXU A;  5CKB A;  3QKJ A;  1SSF A;  2K4I A;  5KH6 A;  2VJ4 A;  2K5F A;  4C92 D;  3L3F X;  2WAQ C;  4NL3 A;  2R5A A;  3M4Y A;  5CIU A;  2Y0S F;  2PVO B;  4DA4 A;  2HOQ A;  3PST A;  2O4X A;  2EKO A;  3LW5 E;  1Q86 U;  2D9T A;  3VJP A;  3DKM A;  1QVG A;  2RP5 A;  2R57 A;  4A4H A;  4FU6 A;  3H8Z A;  1YJN A;  3SWN B;  1VQ6 A;  3IG8 A;  3MHX A;  4OB1 B;  4M7D A;  2EWN A;  3E9G A;  2DXB A;  4XTX A;  2GQV A;  1KHC A;  4OJP A;  2QI2 A;  4A8E A;  3BFM A;  1FWZ A;  3NUQ A;  2K4E A;  3OS2 A;  3JCM c;  3PTA A;  4M77 F;  3HRU A;  4UC4 A;  2LNV A;  4PL6 A;  2K8C B;  3DB3 A;  2L8D A;  2F2A B;  4QJF B;  3O0F A;  1X6O A;  5GAO q;  1FX7 A;  4L5G A;  4ZN3 A;  5LJ3 g;  5GAO l;  3ASK A;  5LJ5 d;  4FZM A;  3ZBD A;  5HKC A;  5GAM d;  3JCM f;  1VQO T;  1BYM A;  4BE0 A;  3L2W A;  3BY7 A;  4ZGJ B;  4X9C A;  1VQ9 A;  1QVP A;  2ZIU A;  1IRE B;  4WJ3 B;  4FL6 A;  4LD6 A;  2MI6 A;  2M0N A;  3ZEH A;  4PJO B;  1W2B A;  5GAN f;  4EDU A;  2E10 A;  3GF5 A;  2EQK A;  1YJ9 T;  2KQW A;  1JBM A;  2F5T X;  5GAN j;  5FU7 B;  3ZFJ A;  1NE8 A;  4M7A B;  1VQM A;  4QW2 A;  2KK4 A;  5IT9 E;  1Q81 U;  2DO3 A;  5I2M A;  1N27 A;  4XTV A;  4M78 C;  2WSC E;  3HKS A;  5FRO A;  3VV0 A;  4C8Q B;  2ZZD A;  3F5A A;  3SWN C;  4XU0 A;  3JCM e;  4ME7 A;  4IUT A;  5GAO r;  2KEY A;  3M59 A;  3HFN A;  4OJO A;  2JNG A;  3OMC A;  4OJL A;  1UB4 A;  4OGC A;  3F5E A;  3JCM V;  2G09 A;  3GIB A;  3L42 A;  2W7P A;  3OYY A;  3V7R A;  1YIT A;  2DTH A;  5L8R E;  2LCC A;  4VUB A;  3TRE A;  2HQX A;  4LDW A;  3HPW A;  3BDU A;  2PVD B;  4JLI A;  2JHD A;  1WJQ A;  4P0Q A;  3RKW A;  5GAN e;  3VKI A;  4D6W A;  3DLM A;  3G7Z A;  4M7D B;  3CCJ A;  2DD4 A;  4M78 G;  1URJ A;  3RUX A;  4L59 A;  2LBO A;  3I56 A;  4M7D F;  1LNX A;  2HBJ A;  3L2Q A;  2RI2 A;  2AHJ B;  3CCU T;  4C8Q F;  5HK3 A;  3VYG A;  2QQA A;  4CRI A;  2E12 A;  2W7O A;  3UDC A;  2VJ5 A;  3QDR B;  5EG2 A;  2NV3 A;  5GAO p;  1UGQ B;  2ZPB B;  2YLC A;  3LVV A;  2QQR A;  3WXM B;  1ZQ1 A;  5GAO m;  2MWP A;  3CCR T;  1ZBX A;  4E7I A;  2EYQ A;  3SQI A;  2WAQ F;  1MA7 A;  2WB1 F;  2QQB A;  3JCM P;  2P0P A;  1VQN T;  3GNF B;  2KY9 A;  3JB9 D;  2JN0 A;  3UWN A;  3F2D A;  2E1E A;  4MML A;  3QZ5 B;  4BE2 A;  1PVP A;  1MHN A;  1PVR A;  1NZB A;  1Q82 U;  3UT1 A;  3MEU A;  2LQ8 A;  2VC8 A;  4JJN K;  2CZ6 B;  1N9R A;  3S3N A;  4C92 E;  4P0P B;  1BI1 A;  1M90 C;  2HMX A;  3C29 A;  5CKD A;  4E47 A;  2ZIV B;  2W04 A;  3JCM d;  5D6W A;  5KL1 B;  1P7D A;  2QEX T;  4QIW C;  5CCA A;  5C0Y A;  5CVI A;  3MCA B;  2DJZ A;  2BDU A;  2LYA A;  4BX9 C;  3I56 T;  4CI0 C;  4XTU A;  1L6N A;  5KL8 B;  3CBO A;  2DIG A;  3CCR A;  4XTY A;  2DZ9 A;  4KX3 A;  2YRV A;  4M75 B;  2E70 A;  2FVU A;  4XU1 A;  1TAM A;  1Q7Y C;  3M4G A;  3A8O B;  4C5G A;  1VIF A;  4GFJ A;  5HR7 A;  3HSB A;  1Y07 A;  2RA2 A;  4FE3 A;  1V29 B;  4U6P A;  3CCU A;  1YIJ A;  1NJI U;  2FL7 A;  4N0A C;  1G5V A;  2H3Q A;  2LVM A;  1H3Z A;  4QVC A;  4ZTJ A;  2LX9 A;  1TH7 A;  4BY6 C;  3F70 A;  4B9X A;  5A2Q E;  2D0Q B;  2RK2 A;  3OYF A;  3LGF A;  4OJ6 A;  3JB9 H;  4M78 A;  5LJ5 e;  1Q86 C;  3J7A F;  2DKG A;  3FC3 A;  3I55 T;  2JH1 A;  2CPR A;  3C28 A;  3FIF A;  2CN1 A;  1YT3 A;  3L1A A;  2LDM A;  4C8Q A;  5J39 A;  4C5H A;  3CCE T;  3MP1 A;  2B8A A;  2KSS A;  4M7A E;  3MGV A;  5D6X A;  3CCM A;  4NLB A;  2OTJ A;  4DOV A;  3X28 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...