4C0ZA

The n-terminal domain of the streptococcus pyogenes pilus tip adhesin cpa
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
SVPNKQSSVQDYPWYGYDSYSKGYPDYSPLKTYHNLKVNLDGSKEYQAYCFNLTKHFPSKSDSVRSQWYKKLEGTNENFIKLADKPRIEDGQLQQNILRILYNGYPNDRNGIMKGIDPLNAILVTQNAIWYYTDSSYISDTSKAFQQEETDLKLDSQQLQLMRNALKRLINPKEVESLPNQVPANYQLSIFQSSDKTFQNLLSAEYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANCILLARY PROTEIN 2
publication title Structural Model for the Covalent Adhesion of the Streptococcus Pyogenes Pilus Through a Thioester Bond.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 68
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.480 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4c0zA02
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0zA01
4BUGA 5A0LA 2XICA 2XI9A 2XIDA 5A0GA 4C0ZA 5A0DA
chains in the Genus database with same CATH superfamily
4YMMA 1U06A 4DQRA 1SXEA 4ED3A 2EH9A 2PUKB 2JN0A 1K0XA 5ALJA 3K1RB 4F2SA 1G83A 3ZI4A 1EZZB 2P66A 4DSEA 2KEAA 3TAQA 4M75F 1NZ9A 2VWFA 2XCAA 3QXEB 1KG1A 3VS5A 3RUXA 2M0OA 5GAOn 2M51A 4QVDA 3GIIA 9ICKA 1M5Q1 1JB0E 1ZBXA 2OXOA 1NJIC 4B9NA 3QYGB 1TV9A 2DF6A 2LI6A 3G6XA 2FRYA 3JPNA 2QB1A 2P6UA 3T5LA 1CSKA 1QCOA 2KNBB 3M9OB 4M2YA 5ALZA 3JCMJ 3CCQA 1QQ6A 1YFNA 1ZSGA 4NL2A 1ZQUA 5GAN8 1ZUUA 3OYGA 5CK9A 5ALLA 2K8BB 1ZLMA 1L6NA 4F8RA 4PLIA 2EANA 2EYZA 3T5HA 4EBEA 4AYBC 3EG0A 1AWXA 2JH1A 3H8SA 4C0DB 2YHTA 3TAPA 3NTKA 1SL0A 3UQ0A 3L3FX 1N6AA 1DOQA 2CYZB 3MHXA 1W2BA 3VKIA 2PI4A 4NV0A 1SWVA 2DPJA 2DL7A 1MV0B 2DIGA 2C2RA 4C0ZA 3OB9A 4Q8EA 5AIAA 5KFQA 4ED1A 1VQ8A 2LVMA 1GO3F 1QH9A 5FP0A 4J9CA 2RQUA 3LWIA 1KQSP 4DOVA 1ZQRA 1P7DA 3PE0A 2FPKA 2G08A 4M6WA 2CPRA 5J0OA 3C29A 5IXBA 4F93B 3IQLA 4QZHA 1YN8A 3H8MA 3TKAA 4PLLA 3ASKA 2JUFA 1UGRB 1ZHIA 2W8KA 2VA2A 4KLGA 1NYFA 5KTQA 2PZ1A 2I9GA 4OJOA 1KC8U 3H7IA 4CE6A 2RHFA 1W1FA 2F5KA 4BXOA 1KJWA 5KYWA 3EAEA 1I5OB 4O3NA 1CEZA 4Z02A 2LRQA 3RERA 1R0BG 2OAUA 2HI0A 2HHTA 4J9DA 2MUTB 3KHGA 1M30A 4DS4A 1I5LA 2CH4W 2DL4A 1QP3A 1UTIA 2KJ9A 8ICEA 2ZCFB 1UT8A 2ZPGB 3BZKA 3MPUB 1RAAB 1EFNA 5DKWA 4DOCA 5J26A 3N28A 3SV3A 2J7IA 3GV7B 2FZCB 2O6KA 5GMKj 1FX7A 1A77A 3SMVA 3MEUA 5IIJA 4KN4A 4AFQC 1XO1A 3ETLA 5ALPA 1D0XA 2PMZC 2KD1A 3WVDB 3CCMA 2DVEA 5DG9A 1UGPB 5CKBA 4M7AB 1TH7A 4F7UE 1RXVA 3MGVA 5AK6A 2WF7A 4KX3A 2V8IA 3BW1A 2ZPIB 1VQ8Q 4UB1A 3LW5E 5J2HA 4Y2VA 1V9PA 2GGRA 8ICRA 1M6YA 4MEXA 1MMNA 3I5SA 2D8JA 3FB9A 9ICPA 2E6NA 3E2EA 5J2GA 2A08A 3RESA 3SV4A 3RB4A 3SWNA 2CH4A 4P0QB 3CCQT 5ALEA 1C20A 3OYYA 4X9DA 4JRQA 4D8KA 5KG0A 4KN7A 2ROLA 5AM2A 1UFFA 2V4RA 5AK4A 2W0ZA 2XHCA 1YBYA 5J0PA 2DFUA 4PJJA 3U26A 4J9SA 3SAHA 5CAIA 2HBKA 1XSNA 2ROTA 3HFOA 2MAXA 2L3QA 4LXCA 3PTAA 2DPPB 3MR3A 3X26B 2RQRA 5KT5A 4EYHB 2DTHA 1U1TA 1WJSA 3HFNA 4OMQA 5GAN4 5CWRA 4F16A 1BVSA 9ICEA 5IIMA 1XNSA 1OU8A 1UCVA 2ZJ8A 1YCYA 1QVGP 1QVGS 1N60A 3UPUA 1JU5C 4ZGEB 2VANA 4FT2A 5KG7A 5ECAA 2Y0SC 2W03A 4B9WA 4OGEA 1VQ8T 3ZD8A 4EDUA 5FROA 5GAN7 3EG9B 1HIWA 1VJ5A 1I07A 4RNOA 1FMKA 1RI9A 4O3MA 2KT8A 2DL0A 2LNHB 3M9MB 2FLPA 2Y1IA 3OBWA 5KFRA 1RYUA 2ZXHA 2W11A 1ZUKA 5KH6A 2V9WA 4TQSA 5KAIU 1XOVA 2QA4A 1CI4A 1XC9A 2GCXA 3DLLA 2KRNA 3BQTA 3S6WA 3RB6A 3ZL7C 5ALMA 1KDHA 3A8HB 3CPWP 3WVEB 3CPWS 3CCMQ 5B66U 3V7RA 4HYKA 2MWPA 3CMAA 3CC4A 4F72A 5JRTA 1J3TA 2LJ1A 1ZQFA 7ICIA 1ZQOA 5J2AA 3UXNA 1S10A 1YITA 5IXFA 4AP9A 1CKAA 3NFCA 2HHXA 1V76A 1NEGA 4IQUA 2NWMA 4I2DA 4JUVA 1J2MA 2X4XA 5HHHA 1TU0B 4QW9A 4Y2PA 4RQ3A 3D6JA 4AG2C 1VQ6A 3PSPA 1M8MA 2CT4A 3NRWA 5DB8A 4EX6A 3AL0B 1V29B 3LVWA 2JS2A 3PMIA 1E6HA 1YCSB 2RH2A 5DBAA 3QSUA 1N8RU 4UB2A 2OTJA 2QAZA 1DK3A 4DL6A 4UAZA 2AH5A 5J0RA 3X28B 1YHQA 2MPXC 5ALQA 2AXTU 4YCXA 4QZFA 4KMOB 3QDRB 4F4KA 3CCMT 2LJ0A 5KFJA 4MFCA 1KD1R 4PJOC 3GPLA 2G07A 3QDFA 5KG3A 5J2JA 1YWOA 3VS3A 2ABLA 5D46A 4FYYB 4PJ0U 4CC2A 4QIWC 3GILA 4F5QA 1UDLA 3H9NA 4TUPA 2RJDA 2X3XD 3EH1A 1Q3UA 1GFCA 2H8HA 1RUWA 4GXIA 3V7KA 2KHQA 3QJ6A 1SSHA 1TWBA 3V7CA 4ECUA 2H3QA 5AI5A 1Z3EB 1O08A 2LMRA 3OHBA 4RNNA 5DB6A 3M55A 4U6PA 2YRDA 2RRDA 1X9MA 2LT4A 4KGVB 2QA4Q 3KXTA 4QNLA 3RRGA 4DOAA 2X4WA 4PNOA 4AG1C 2CREA 4KTQA 2VVKA 3S3OA 4PJOE 3UM9A 2EYXA 4AYBF 3CC4Q 3M1YA 1TVAA 3WKAA 2WB1C 2DRKA 3QJYA 3FAHA 1T3LA 3G6EA 5GAMf 4GXJA 5E79U 3C2MA 4XK8E 9ICOA 3VJPA 2K6DA 4UB4A 4C5IA 4B9UA 5FRNA 4O6JA 2HHQA 3H0RB 4FYVB 3A8GB 4DBHA 1VQ6Q 5ALSA 9ICNA 3EH2A 4BE2A 3AQFA 4MF8A 5GJVB 2HOQA 1TUGB 9ICGA 3N4MB 2B86A 1IV8A 2IBKA 4M7AD 4EBDA 1OULA 1D0ZA 4JRIA 4F4ZA 3QUCA 3Q8QB 1BCOA 1Q81R 2XD0A 3PR5B 3KFUF 5HCKA 2LNVA 8ICKA 4XAXB 1BI0A 2AKKA 1Q7YU 2QA4T 2JEIA 1NJIU 2A0FB 4M77A 3L42A 1TE2A 2PKEA 3H8WA 4LJXA 4MEYA 2KKVA 3RMSA 2C22A 1K5OA 1TOVA 3CMAT 1PK3A 3JPRA 5J8YC 1V1CA 3ONNA 1YITT 3CYMA 4JDSA 4ZH4A 4UW9A 9ICHA 4F7UF 4JV1A 2W9BA 2KQWA 4JJDA 3R9KA 1C6VX 1UECA 1RLQC 2HVIA 1VQ6T 1PKTA 2RJCA 3EYZA 2RHXA 1RZTA 3BDUA 5AK3A 5J8YA 2EGAA 2O9VA 3V6HA 4NJ8A 2KRSA 4RTYA 2XO7A 1YJNA 3I5RA 1MA7A 2YQEA 1PCXA 3B0XA 2OTJT 4NL9C 4Q43A 3MR2A 1YHQT 3QU2A 4DSFA 4M77D 2QG9B 3GOXA 4DL3A 1A6SA 1ZQNA 3G6EQ 5AYFA 2PMZF 4GBQA 1LCKA 3TANA 5KFBA 2VXEA 7ICUA 3VV0A 5ALOA 1WI7A 4ED8A 1X6OA 3LWHA 4G9BA 1ZD3A 4P4OA 1IGQA 2K2VA 5DB9A 3A8MB 3RH5A 5A0LA 4P0PB 5KT4A 3FLGA 5F3XB 3SD4A 4DBRA 5GAOl 2GBQA 2NUPB 2EAYA 2QQ9A 1Q3VA 2JT4A 3UWNA 5CJ7A 1RYSA 1QWEA 4DL4A 2OHFA 2QYZA 5GAMd 3QU7A 3BZCA 3V8LA 3EG1A 1XS9D 3UDCA 1OX9A 2XC9A 2L3PA 2JVVA 1SV0C 2RI3A 1M1KC 3VS6A 4ECVA 4DBFA 3N5BB 4CF4A 5J0XA 1OZ3A 1LV5A 1KBUA 3WXMB 1NJWA 1JI7A 1N27A 3M53A 5KYYA 5ALVA 9ICRA 1K73R 2QI2A 2K5FA 4M75B 2VJ4A 5KFZA 3DEEA 2D1XA 4HCZA 1SV0A 2G09A 3FM9A 3PX0A 3RKWA 2YB4A 2BCSA 1UEBA 2DTIA 1XSLA 7ICTA 3RAXA 3RKXA 2W3SA 2J6TA 1L3TA 4NS5A 3OJSA 2JM9A 2HHUA 4E7HA 2WF6A 2KJ8A 4M9LA 2Y0SF 1FIQA 4LDWA 1KHCA 1ACMB 3RB0A 2BE9B 1KHIA 2KJ5A 1FEZA 4PJNA 3MBYA 4YR2A 4M77G 4EEKA 3PMTA 3WK4A 4EMKB 3SD7A 1NK0A 4BB7A 2DBYA 3NVZA 5KFAA 9ATCB 4QZAA 1W2BP 1N5XA 5G5HA 1BPYA 5IHNA 3NGPA 2P4TA 5J29A 9ICSA 2YLCA 4ECTA 2LBOA 5GAMh 1EXNA 3CRXA 2JEFA 2VXFA 1JJ2S 3WKEA 5DY9A 3PVLA 8ICGA 1SHFA 5J2CA 5EWFA 4GLXA 2HQEA 4DCCA 3E2UA 1COOA 8ICPA 9ICBA 3SQIA 2E5SA 3OA6A 5KFMA 2BCQA 8ICYA 2K57A 5EC7A 3QPHA 5KG2A 4C8QA 1UPHA 4ME7A 2NUTA 5HR7A 2LM4A 3VYHB 4XUSA 1YJNT 4QZ9A 2MA1A 3OSPA 2K60A 3BS5A 2QK0A 4QVZA 3ISBA 4DF8A 1ZQJA 1W4SA 5KCOA 2K8CB 4C0FA 5GAMg 1FMWA 2OEHA 1RLPC 3FDRA 3HW8A 3RNJA 4DQ2A 4AT1B 4KLQA 2ZG6A 5KFPA 4IS7A 2EFIA 4PJOF 1M3AA 2P6RA 3MABA 4GLMA 4BWMA 2C0OA 2EYWA 1WCNA 1BIBA 4PFPA 4QIWF 1ZRMA 5EE0A 1NLOC 1RAHB 4RTZA 4RQMA 3BJYA 3URGA 2DXCA 2LM1A 2KNJA 5GMKe 4M7DB 3D2NA 1W6XA 4OB1B 2QEXA 3S3NA 3V72A 1AT1B 1X2QA 1OI1A 4ANJA 2CRXA 3GV8B 2EVRA 4C4RA 1MGQA 4C8OA 4XQ3A 3WKCA 2OTLT 2KKPA 1K1ZA 1VOMA 2ZTDA 3ZBDA 1NE8A 2Z7JA 2HBMA 3UXOA 2D8CA 3ETRA 4KLOA 2KFNA 3RJHA 4RTWA 3PX6A 4NLNA 1K1SA 2X35A 2YRVA 5ALXA 1DRGA 1ZQTA 3V8KA 5CIUA 2WF9A 2GTJA 2WB1F 2HHSA 1K76A 1RAGB 2W43A 4O3OA 1ZQ1C 5GMKh 1BPBA 7ICHA 2F2AB 2DEQA 3HPWA 3I55Q 1TAUA 2GF7A 1YI2Q 4IRDA 2CP7A 5HHIA 1BK2A 2GQVA 1MN8A 4DOBA 4EZ9A 2LTOA 1FWZA 1PK1B 3WK6A 1X2IA 2K5IA 3RJJA 3X24B 3TI0A 3OYFA 3RJKA 2YMLA 3NPFA 3A0BU 4C5GA 4NLGA 4I2IA 8ICWA 2ZIXA 1MSWD 2EAOA 2P0PA 2W9CB 3CC7Q 1R77A 1L7NA 2EAPA 1H92A 1LB2B 5L8RE 2L3SA 4I2FA 2W7OA 5ALUA 2PVDB 1UQVA 5LJ3f 2WFAA 2R8JA 4JS4A 3CCEA 4ECSA 2PI5A 5IN1A 2DXBA 2XG8D 2LQWA 5EE3A 2QARB 1B7TA 4HA8A 4C8QG 5AI4A 2ZIVA 4UAWA 4F3OA 1ZOLA 2LYBA 3RDVA 3EGDA 3WK7A 1XNIA 1KLNA 3M0UA 3PFSA 4J9RA 2L2PA 4M75D 4HVVA 1L3UA 4R0KA 2HBPA 3G6VA 1M90C 3LWLA 4EYIB 4C92A 2COYA 5KFNA 1DK2A 4TURA 3JRZA 8ICJA 1A0NB 3CBMA 3PR4A 4PZOA 2KT1A 2H3IA 1KW4A 2I5HA 5AI0A 3M8RA 3LH0A 2HHVA 3FDSA 1U48A 1S0OA 1GXIE 2JZBA 2V8KA 4AFZC 3MCAB 4YVZA 4OVAA 2O01E 1QW1A 3VU3C 3QUBA 3EGXA 5ALRA 4RQ8A 4J83A 5F9LA 1VQLQ 1Y57A 1WHGA 1NK9A 3L2WA 1PVRA 5EG2A 1K9MC 2RK1A 2K4PA 3GZFA 3HRDD 3VC8A 4KH0B 4IUQA 2J6FA 4B9XA 2RHZA 4LUDA 2KG5A 1ZQMA 2QEXT 3OYNA 1NPPA 3CMEA 2B8AA 2FMSA 2JHDA 5I2SA 1YJWQ 2YT6A 5KFLA 5DG8A 2ZPHB 4J6YA 4J9MA 4XU3A 1ZQBA 1L3SA 1LKYB 5C5JA 3BQ1A 4J9FA 1ZQYA 2YUPA 4N4IA 3CCEQ 2GO7A 3PZPA 1PRLC 4HXJA 3H4DA 4R63A 3Q8SB 2LCSA 2BKDN 5CHGA 4QQDA 1IO6A 3I56A 4Q5WA 3KKAA 2HAXA 5ALFA 2XGQA 4PJMA 2ESEA 1VQ9A 4PL6A 3HTRA 4MZPA 2EQUA 2K9GA 1C0MA 5LJ3d 5GMKl 2DLPA 3HJEA 2E6ZA 3QYPA 1WQWA 3GNGA 4K4IA 4QT7A 1TUCA 4RTXA 5KYXB 3MDCA 3PT9A 2EYYA 2W9AA 4Y2YA 2A28A 1NZBA 1N8RC 5DQGA 2G0AA 1LJOA 1VQPA 4Z8AA 1ZD5A 5JU5A 2XMFA 3F5AA 3WU2U 1NK8A 3JCMf 4RUCA 4F14A 5DQHA 2DKXA 1JMSA 4M7DD 4Z89A 2C28A 2ZZDA 1RPLA 2ZIUA 2D9TA 1XO0A 1FXXA 3QXGA 3CCET 2RDIA 3SENA 2RHUA 3WK9A 4QZ8A 1M2VA 2JR5A 1FMVA 2QXFA 4IIOA 2FYKA 1RDFA 2RF0A 2LKYA 2QB0B 2C06A 4OMLA 4Z6DA 4C8QF 4E7JA 4DL5A 1M1KU 4ECQA 4OMFB 4C92G 2KK4A 4J9HA 1RAIB 2DZCA 2LHTA 4F4YA 4O5KA 3L2VA 5KT6A 1HUZA 4PGQA 3QZ5B 4K11A 5CCAA 1GL5A 1AQ6A 3A8OB 1VQOT 3CQTA 3VS7A 5J0TA 2AGOA 1UGSB 2QDLA 3BFMA 3WKBA 4R55A 3CCSA 2DNUA 1IREB 4GC7A 3ALRA 2XDPA 4IUTA 4RTTA 4PGYA 3PMLA 4CRXA 2O4XB 5GAN6 2R18A 1S8OA 1Z00B 1KQ1A 3REAB 3AM9A 4Z6EA 4OJ5A 4MMLA 1AD5A 1HXDA 2DILA 4XU2A 3ZFJA 4CI0C 1QSLA 4UARA 1NJYA 2CP0A 2XDDA 8ICCA 1PC0A 3M6KA 4UAYA 2EW3A 4BD3A 1VQ9Q 3OBYA 2X4YA 5DDMA 3EHQA 1T3SA 3PGGA 4F7UB 4K4HA 2EQMA 1G2BA 4QVCA 4YR0A 3G1JA 1ZQLA 4Y2JA 1OU9A 3CMET 1K4US 1TXQA 1VQPQ 2E1FA 4C8KA 5AI9A 1WJQA 2I2LA 2E10A 1WJRA 1DGJA 1Q7YC 4EMHA 5LJ3g 4RQ1A 1HJPA 4R8UB 4HVUA 4O5EA 3L2UA 4E7KA 4KLDA 3GDXA 4LD6A 1WCLA 4E0DA 4LDVA 3KOOA 3Q8LA 1YJ9A 4IR1A 4FM4B 1KFDA 5GAMj 9ICLA 3JCMW 5KG5A 4ZGDB 3I56T 4OJ6A 3E0FA 3PW0A 3JCMd 1IRXA 5L1KA 2QKQA 1SKSA 4FZLA 1NLPC 2CGHA 4J9BA 1MV3A 1JN3A 4DLGA 4JLGA 4IUVA 2NRWA 2JS0A 5KNIA 4FT4A 2XDBA 1NK4A 2KDSA 3VCBA 1PSFA 5KT3A 3CCSQ 1PHTA 3AT1B 2LZ6B 2BGWA 5HY6A 3IV6A 2Y1JA 5CRXA 1UHCA 2E1EA 3PY8A 3MEWA 4J9IA 1VQPT 4IQVA 4XA5A 1B3QA 2CUDA 2YWWA 2Y4XA 3A98A 2YUQA 5GMKi 2RQWA 1JJ2A 3PW2A 2KRMA 1B07A 1KIKA 1VIFA 8AT1B 4LVSA 2BZYA 2PU9B 2E12A 4RQ0A 2ZIWB 2KFZA 2NV3A 2HHWA 4XU1A 1K73U 3UF4A 2KMTA 2J6SA 2C2EA 4UBBA 1M1GA 3CD6A 1ZQWA 1Y96A 3BDLA 4JRKA 1QVFS 2IMWP 4QZDA 4O5CA 5KFVA 3RKYA 4E47A 2XGPA 4BI8B 4YMNA 2QQRA 4DL7A 7ICGA 4Y2XA 1WHLA 4LDYA 3JSCA 4Y91A 3CCST 3OW2S 5GJWB 2A1JB 4RT2A 3TU4K 1MQ2A 1L7MA 1AZGB 3G7ZA 4II1A 1YP5A 4RG2A 1K0SA 4IL6U 4HVWA 1EIFA 2YN4A 3CCQQ 1YT3A 1S72A 2KZ3A 4M0AA 3EFOB 2UVWA 5GANf 2E65A 4MDWA 4PFOA 3N7SC 3GIJA 4Y28E 1M9SA 4DQIA 2DL3A 1OPKA 3QEAZ 4F4XA 3HPOA 2NO4A 1BU1A 1I8FA 4IRKA 2B0CA 2P84A 2D0NA 5D6YA 5J0QA 2XICA 1TTHB 5EWGA 8ICHA 2VASA 4CNQA 1TUDA 2H3VA 5AKEA 3JCMg 1NG2A 3M0QA 3INZA 4KUDK 2CSIA 2RA2A 3SWNC 3BQ7A 2WHEA 4P5NA 1YNZA 2M9UA 2LCCA 2ZPFB 4LE9A 2D6FC 2CSQA 4LZGA 1VYTA 2LX7A 4ELZC 1YJ9T 1S0VA 5FLXE 2ZGWA 1H3ZA 2M02A 4BE0A 1FFUA 3HP9A 5DGBA 2CKKA 5D49A 4OB3B 3CD6Q 3BS7A 2RQTA 3JCMQ 1MMGA 4M9JA 4PL2A 1M90U 2HOIA 7ICLA 4HT8A 1ZQSA 2D6FA 5EWEA 1QTMA 1ZD2P 2E41A 2IVWA 2QASA 4PH5A 1T3NA 1ZBJA 5DLGA 1SZPA 2KR3A 2PNIA 7ICNA 1BBZA 3O5ZA 4GIBA 2BR0A 4C0DC 1Z1VA 4CCHA 1D8LA 2D3DA 1VQMT 1BNPA 1RYRA 2DAQA 2EZXA 2G5IB 1ZQAA 1B34B 1S1NA 1FYNA 1VQ4A 1K9MU 1S72Q 2RJFA 1KKXA 1ZQKA 2K3BA 2KSOB 8ICUA 4RTVA 5DM7R 4QQ6A 2DMOA 1LPLA 4OCZA 4YQWA 5L9XA 2LX9A 5EE9A 5J2KA 2V4QA 2WACA 4RNMA 2J05A 3TSZA 2FMQA 3CD6T 3LYIA 3QUIA 3B0YA 4RQ5A 4LZDA 1N63A 4N4GA 4UB8U 4A4HA 2K4YA 4ZTJA 1M8VA 1L7OA 2KVSA 5DBBA 4TUSA 5CQXA 5KYUB 2KBTA 1Y71A 2Y9TA 3G4SA 4B6MA 5GAN3 3IG5A 3ER0A 5G5GA 2LYAA 5KFKA 2IHMA 2HSPA 4F91B 4DS5A 5FRMA 1TSFA 4KLMA 1L3VA 3MGHA 2V1QA 1F1BB 1S72T 1X6GA 1ZJMA 2AGPA 2FPLA 2BPCA 3Q8KA 1ZJNA 3PX4A 3D2SA 4UB3A 2AQ4A 2A37A 3UA6A 3E19A 3V7SA 3JB9J 4I2AA 3I28A 1BIAA 1WNLA 2X9HA 2MUTA 3A1PA 3HWTA 1BPXA 2PVOB 5JUMA 4ED0A 4I2CA 2DXTA 2P0KA 4E7IA 4M78B 1OW5A 3QUTA 2GFUA 4FE3A 2WSFE 2ASDA 1FO4A 1BYMA 5CKDA 5CKEA 2YMMA 1VQ4Q 3AMZA 2OM6A 1F44A 3LGLA 3CP8A 3WKDA 1ZQEA 1WHKA 1RADB 2KK0A 5KT2A 1ABQA 1BB9A 4QW2A 4R56A 1S76D 5J0WA 3M8SA 2KSSA 1WQ7A 3R6NA 1OOTA 4J8OA 1VQKA 2Y4YA 4M7AA 8ICZA 1WXTA 2FPEA 3GP8A 2BCVA 4DQPA 1KQQA 5DBCA 1X75C 3D2QA 2F76X 2F44A 1F0MA 5GAOq 5AKYA 2COZA 2E8MA 1T4GA 2EZZA 3T5JA 2O2OA 4OMNA 1P92A 3CMAQ 4AMCA 4P0QA 4XTZA 4PHDA 1YITQ 3CXCA 4GC6A 1PD1A 5AM0A 5D4BA 2R8IA 5C0MA 4GY5A 4F4WA 1VQ4T 2CP3A 4O3RA 5GANg 2NRZA 2AGQA 4WJ3B 5LJ3j 4NY8A 1SRLA 2JTEA 4QZCA 4JUZA 8ICIA 4M77C 2RM4A 3QG1A 2F1LA 3ISCA 2XK0A 3QWYA 4F04B 4QZIA 1M27C 1UA1A 1X40A 4CC4B 2RQ5A 2OTJQ 3Q8RB 8ICSA 3N7PD 1YHQQ 4I2JA 4YMOA 3CC2A 4IKFA 1SPKA 5HNKA 2NRVA 2DA9A 1KN5A 3RFAA 4DSKA 4DSIA 2MYSA 3JB9D 1WFWA 1S9FA 5I11A 4BDYA 2L5QA 2H3FA 3IG8A 4FS1A 1SKUB 2PVGB 3EG9A 4KGXB 2KAFA 3M58A 3PNCA 3TQ7P 5KAFU 1GRIA 3G4ST 1MMAA 1KRPA 2V8JA 3GQCA 2MOXA 5DLOA 2FI1A 4Q8FA 1KTQA 5A2QE 1CUKA 2JMCA 2DTOA 2W55A 4PL1A 3GV5B 4M77E 2KIVA 2HDAA 1PNJA 1Z4NA 5BPCA 2WSCE 3H8ZA 1VQKQ 5AI6A 4A4GA 1G8XA 3HKZC 4MDXA 4J6WA 1NNLA 3DKMA 5KE3A 3ED5A 1KD1C 2HMXA 2C0IA 4KH1B 2H3EB 3ULRB 4NLKA 4ICAA 2YSQA 3VUBA 3PO4A 2PQWA 1UUEA 3N97B 5L23A 2KXDA 5EE1A 4X34A 1PVPA 5AIBA 1ZQXA 4OO1J 9ICIA 2OH2A 1TK8A 4F92B 2VIXA 5KFWA 5DLFA 1UE9A 3C12A 3CCUA 4QZBA 3PIOA 2YMQA 4PKCC 5LL6S 3C23A 4NM1A 1VQNT 4M7AG 2LCLA 3K4GA 1MC8A 1JROA 1AHJB 4NM2A 2AJQA 3TEEA 3PIPA 2XVTA 3JPOA 1URJA 4F5PA 2BQ3A 4QJFB 4PGXA 4F2RA 3CCVA 1AWOA 1R8OB 2UVVA 4J9LA 1VQKT 4IUUA 2G3RA 3JB9G 2E70A 2A19A 2HL3A 3CC2Q 2CZ7B 5CR2A 2HOFA 2E8NA 1ZD4A 3OYMA 4QWEA 4PHAA 2OTLA 3UQ2A 5AT1B 5L1LA 2IOFK 1U47A 3Q8MA 1QMCA 3HL8A 5AHXA 2ED0A 3DB4A 3THKA 4NXZA 5IINA 1IM4A 1YZ6A 2KROA 3H0IA 4UC4A 1WA7A 2HW3A 3DB3A 4FU6A 1X9SA 2EAMA 3J80E 9ICUA 2ASJA 5CQYA 5GAMe 1Q81C 2VA8A 5HMLA 2P4RA 2Q4TA 9ICVA 1XWLA 3I9QA 5AKXA 2AT1B 1D9DA 5JTIA 5KFCA 4JWNA 1HYOA 1DGSA 2XU8A 4X9CA 3RAQA 4M78D 4YD2A 2KI7A 4E7ZA 2KVCA 1K8AR 1WLPB 4DLEA 4R64A 3ZDEA 3JB9I 1YJNQ 3RIRA 5IILA 8ATCB 3T3FA 5J39A 2WF5A 1QVFA 3ZDBA 3CC2T 3PW7A 5KFUA 4BJQA 1OV3A 3MP6A 4U7CA 3OW2A 1WWUA 4NOYA 4DSJA 4FFDA 3CCUQ 2YX8A 4Y2QA 1KC8R 1JJ2P 1JRIA 2KMDA 3M5AA 2B21A 4C8QC 2KN7A 3AUOA 1WHJA 9ICMA 2DETA 2DJQA 4XRHA 2ENMA 2A36A 5GTHU 2P0QA 1Q82R 1VQNA 3EFSA 5A0DA 4B9MA 3EPIA 1UJ0A 2HQXA 3JCMP 3X20B 4Y2RA 3WK8A 1ZQCA 4KLSA 2DL5A 2OTLQ 3LWMA 3C28A 1KQ2A 1JXLA 1UGVA 1T0JA 2IPOB 7ICJA 5IIOA 4J9OA 3RB3A 5L1MA 2F8LA 3G71A 1JALA 2AHOB 1SIJA 1OQKA 1S0NA 2DPIA 2BTTA 4L5GA 3I35A 2L8DA 2DGZA 3EPGA 2I6XA 2F8KA 3EG2A 4LN2A 5M9OA 1QQ7A 2IA6A 4C8QE 1SF9A 4USAA 3SZ2A 2A3VA 4KBMB 1E6GA 1PM3A 2EDUA 5H2FU 2OWOA 2JTMA 3CCUT 4FYXB 4R66A 4M78G 1S77D 4KLUA 3LX7A 4MZTA 1ZXIA 2J6OA 1NK6A 2YUOA 4M7AF 1UGQB 1ZSZB 3KHRA 3C1ZA 2F2XA 3CCVT 4A4FA 4XTWA 1K73C 4RMOA 3K75D 1LVHA 3GLXA 4DEZA 5LJ5f 5AM1A 5A0GA 3EHRA 1Q86R 3VS2A 2KE7A 3ZDDA 2MMPA 2Z0WA 1WGSA 5ALKA 2IIMA 4QWCA 4ECWA 3A8LB 3VRYA 4KLLA 9ICAA 5B5EU 2BZFA 4P0PA 5AKHA 1G3WA 4P4PA 2BCUA 2NUPA 1D8YA 1LOJA 2JXBA 1Y7XA 3OTQA 2ZXIA 1K8AC 4B9TA 4RQNA 1ZQGA 2JNGA 4ATOA 4KGZB 3H6ZA 2COWA 5FU6C 3UPQA 4QZGA 4UB5A 4IR9A 5HP4A 3V6KA 1ECWA 4M4ZA 2JRZA 3NTHA 4O3PA 1T7PA 2IOHA 3GU3A 4OGCA 2BCRA 2LDMA 2ZUBA 2HD0A 2E8OA 4US9A 2AZSA 3CBOA 2YUNA 4WTOB 1ED1A 1UHUA 2L5YA 2MK5A 2ECZA 4EIKA 4C8LA 4M75A 4M77F 5KT7A 3KUFA 3F2CA 3E1SA 4N0AA 4MMKA 2K4EA 2FPMA 3ME9A 4RZRA 4YD1A 1JX4A 1XJWB 3PSTA 5AICA 3BQ0A 5KL1B 4LDUA 2DKZA 1T3QA 4B9SA 4ED7A 1IGUA 3H40A 5GAN5 3AU6A 4Q45A 1GCQA 1RXWA 4CGZA 5ALNA 2E3IA 5KFYA 2K7AA 1X27A 1SL2A 3OYDA 2C0TA 3L2RA 2DL8A 4EMKA 1EX4A 4KX5A 1OEBA 2RD1A 5IIIA 4C92C 3PO5A 3L2ZA 1BPDA 3C5FA 2RP5A 2KP7A 1CRXA 4JZ3A 5D7UA 2QEXQ 3KD3A 1D3BB 3BE3A 3E58A 5GANj 2G06A 5KYNA 4O5VA 1J97A 2KV2A 5ALTA 2MU2A 3HKZF 1U49A 4CC3A 4LDXA 2DFLA 1VQOA 3SAGA 2BUDA 4ESRA 4NLZA 3HKSA 5FW9A 4J9PA 3G71T 3OSVA 3EZ5A 4C4SA 2CT3A 2FVUA 2JXJA 1XSPA 1ZQZA 1MNEA 5LJ5d 1U8RA 2PXIA 1VYUA 2HMAA 4J9QA 2EZYA 1N62A 4C92E 3IP4B 2PFNA 1BI3A 1DXSA 4EPCA 4HAIA 2SEMA 7ICPA 2BHNA 2EGCA 1S0MA 2EJ9A 2QQSA 2E8PA 4RQ6A 1MMDA 4DF4A 4RKUE 1Q46A 3FYHA 3QU5A 2BQRA 1RL2A 4FS2A 1BI1A 2IHNA 2BQUA 2F69A 3TCJA 4OMPA 2NO5A 3CCLA 2LPEA 3KKAC 2XKOC 1OX8A 4A54A 1UHFA 5DB7A 4DFDA 2RK2A 3TFRA 9ICCA 2Y90A 4M7DA 1QWFA 1MUZA 3VS1A 2HBJA 4RCCA 1SWWA 1KFZA 4JK1A 2FLLA 1KD1U 4MF2A 2HNIA 8ICXA 3UA7A 4WCIA 5GAOm 2E4HA 3KBGA 3TREA 3VUZA 4M75G 3PSFA 1IZ6A 2VUBA 4IRCA 2H3ZA 4I28A 2DD4A 1RM6C 4F5NA 2ZUCA 1SGGA 5KL8B 1WIEA 5C6SA 1VQOQ 3FJPA 4OMOA 3F2BA 5DGAA 3M9QA 2EYQA 4ELUA 1JXOA 2EQYA 2HBWA 2EIFA 2I0NA 1X6BA 3CXCP 3GIMA 3CXCS 3H0HA 4PFZA 4KITB 4GXKA 4GLKA 4OB2B 1RQLA 1JBMA 1NJXA 1NJIR 1PK1A 1QSSA 2D8HA 4TQRA 2FRWA 3OYCA 2GLEA 1I4K1 4EZ6A 5LJ3e 4YR3A 4PJOB 1H3HA 2BPFA 4J9GA 4M6WB 3LVVA 4RPZA 3E9GA 1RACB 1VDVA 3H4BA 2W9CA 3CMEQ 3MFHA 5LJ5g 1D9FA 3OJUA 1VA7A 2JMAA 7ICFA 3SHWA 2KGTA 4ZN1A 2LQNA 3HP6A 1Z9QA 2DO3A 4B9LA 3META 2KIWA 3LH5A 4LD9K 2BKEA 2XIDA 4BXOB 2FEIA 5KYWB 3L2QA 3FJ5A 2QARA 4EELA 2DXUA 1QKWA 1Z9ZA 1Q81U 1TAMA 5KFXA 2H3JA 4FO6A 3OY9A 5LJ3h 2LC4A 3DLMA 4FYWB 5ALDA 1S97A 9ICTA 3I56Q 3OS5A 1WYXA 2JEGA 3DDHA 3SB2A 5AKLA 1QQJA 2DBKA 2MF2A 2YXYA 2M0YA 3M4GA 4P2HA 3IRUA 2KZZA 2ISPA 1NKCA 1G3SA 2CP5A 1I0CA 5KG6A 3PVXA 1N5WA 1NYGA 2EWNA 2JV3A 2W8LA 3V8JA 2RB6A 4UB6U 2DD5A 1Q8KA 1T94A 2FB7A 4ELYC 4M7DG 3REBB 1VIEA 4ECYA 5ALYA 2OAWA 4ZOHC 3VS0A 2KE9A 3CCLT 1IIPA 4RQ4A 4RUGA 5C0YA 2YDLA 2DUYA 1D0YA 4JS5A 4A8EA 4X1VA 2XY6A 3MC1A 3S6JA 1SKRA 4I27A 1GFDA 1B0XA 2XY7A 3H8JA 4C8NA 2CZ1B 5FU7C 1AOJA 1JO8A 3SWNB 3EWAA 3LLRA 1AWWA 3L1AA 1SB3C 2L0AA 3NGDA 2JTFA 1SHGA 2O31A 1LKYA 2DJZA 4ECXA 1ZUYA 3PW4A 2LT1A 4DQQA 4ORZA 1QLYA 4UAUA 4QWBA 1TG0A 2F1HA 4JJCA 5KE2A 2RDJA 3MP8A 1VYVA 1R0CB 1G3TA 3TVTA 3H0FA 1VQMA 4M9NA 2ESWA 1SSFA 4QWAA 4BY6C 5AI8A 1IXDA 3SEMA 4J5YA 4HCBA 3NVYA 2DYBA 3JCMe 5AKJA 1Z1BA 2P35A 1ZETA 4F71A 3H41A 5J2EA 4C5HA 2ZJ5A 4DOWA 4OB0B 3SAFA 2GTOA 3EGUA 3QWXX 1VQ9T 8ICVA 5CVIA 4F5OA 5KYXA 4BGDA 3RR6A 3RR8A 1XQHA 1HJDA 3N7RC 2KZMA 2W7PA 1VQ7A 1W70A 3HSBA 3NTUA 1QVFP 1G3YA 1TAQA 1NBEB 4C92F 2UVRA 2DK3A 2F3NA 2NYVA 2CS7A 4WF2A 3UATA 4C4TA 4P4MA 1T0HA 2VC8A 6AT1B 2GQIA 3RH6A 3UMGA 1K8AU 4L6V5 3V6JA 4XTYA 3OW2P 4ZN3A 2FE9A 3JCMh 5K4LA 1KQSS 3OPXA 2QB0A 2NRTA 1AWJA 1YJ9Q 2FDRA 3JCMX 1O03A 8ICNA 2DEUA 3PSIA 2R58A 2W3RA 3UXPA 1L8LA 2HCKA 3P8BB 2QDYB 4XTVA 5BOMA 3KHHA 1KFSA 3IN5A 2KY9A 2VGMA 2X3WD 3MEVA 2LQ8A 5HR6A 4GFJA 1D1AA 3QZ9B 3ZEHA 2DBMA 3EFRA 3TARA 2G6FX 4BWJA 5KFTA 3MGIA 4PPXA 4JMUA 2K3XA 7ICSA 2O4XA 2VYTA 1Q82U 1Z00A 2JGAA 3UT1A 1B4FA 4NL3A 1KFTA 2E64A 2KYBA 3JCMc 5IH2A 1VQMQ 2HSZA 4ELTA 1PRMC 2DIQA 2L3RA 3AHUA 4M7DF 2J06A 4JV0A 5KFHA 1NKEA 1NM7A 2JM8A 1IHWA 3R6OA 4CF5A 3RJEA 2IOFA 5KG1A 2CDTA 4ZGJB 5FWBA 4F7UA 3OS0A 2WTFA 3NMZC 3ZDAA 3DV9A 1M4ZA 3O8VA 1LNXA 3V7LA 2OI3A 3HRUA 3M0PA 3OYLA 3JPQA 1M3BA 1VLBA 5DDYA 1IXRA 4DFMA 2PFPA 1COKA 4L59A 1VQ7Q 4UATA 4R65A 3SFMA 2YMPA 3A0HU 4EMGA 4JB3A 3B9JA 4F5RA 2FJ6A 3FRNA 4XQ8A 4R8UA 1KSWA 4XU0A 4BE1A 5J0SA 4Z6CA 4I2BA 2VB6A 4IQWA 2OJ2A 4HCCA 1IHVA 7ICMA 4KLIA 3T9NA 2K5LA 1B22A 2YTUA 1KSPA 3GFKB 1Q86U 2BIVA 1Y07A 2PTKA 2JEJA 2RO0A 1JQQA 1L7PA 5KFSA 2F2WA 1UB4A 2AK5A 3OS2A 2W54A 2LQKA 4C7ZA 3OSNA 1ZX6A 5J0YA 4QWDA 3HX0A 5I2MA 1D1BA 4OP0A 1VQ7T 5GMKm 1YWPA 2F5TX 3M6ZA 1B43A 2KVQG 4FSSA 4DFPA 5GANd 3RBDA 1M2OA 5J0UA 2DKGA 3D7SB 3F2DA 2ZIWA 1OYXA 1X6JA 1WYGA 3QE9Y 4M77B 2QTVA 3HILA 4KMUA 5KFGA 4QQGA 2I1QA 2X51A 3S3MA 4O0IA 3K1ZA 1TFRA 3MFIA 7ICQA 4ZTFA 2HZYA 3UMCA 4CDGA 3GNFB 1SZHA 5CKFA 2AIRB 2BDUA 2HCFA 1ZA2B 4Y2TA 1FFVA 4NLCA 2W9BB 1NK7A 4CC7A 5DLQE 1SEMA 2DERA 4JLIA 2RI2A 1K9AA 5GANe 2G5HB 4Z6FA 4J03A 2J6UA 1JXMA 2A1JA 1X66A 2ATCB 3C95A 2PUOB 3X25B 2KICA 2EJGA 2RJEA 1ZYQA 2UVUA 4J9KA 1X9XA 2F77X 1ZQIA 5LJ5j 2BE7D 4F7UG 3EFOA 2BDPA 2ZJAA 1NK5A 3VS4A 5KFDA 2KYMA 1H641 4QZEA 4M7AC 4RPXA 1ZA1B 3AU2A 4E7LA 1BNOA 9ICWA 4OD0A 5T14A 3E9FA 4EENA 2FZGB 4UQGA 5GANh 3J81E 5ALWA 2R5AA 2X4JA 2CN1A 1WG8A 4YXMA 1OPLA 4E2FB 4M9HA 4KT0E 4MFAA 1NI3A 2CXYA 3C2KA 4RG8A 4JRPA 3Q8PB 9ICJA 1PD0A 4HKEA 4I2GA 4E6RA 3LYSA 1LVKA 3JPTA 1TK0A 1JIHA 5TZVA 3O0FA 2H5XA 2VA3A 3G4SQ 2GWSA 4BDZA 2QGFB 5D6WA 5HK0A 2YB1A 4M7AE 4NLBA 1QQ5A 5KYYB 5IAYA 3ORYA 4PJOA 1GBQA 1NOMA 2DVJA 2K4HA 5J3BA 3QEBZ 2BPGA 4KUIA 4XTXA 3C94A 4J9EA 2MAMA 1ZQVA 2FL7A 3OGUA 4M04A 4ECZA 2RHIA 4YP3A 1JEGA 1Z19A 3C4SA 2K2MA 2FPFA 1U9LA 1X43A 3SDZA 2EQJA 4UAVA 5BOLA 1B34A 1U1SA 4KULA 1M1KR 1ZQHA 4DEXA 1SG5A 3MP1A 1A76A 1RQNA 2KSOA 5AKGA 4B9VA 3M0RA 1NJZA 1RABB 4VUBA 4BACA 5CKHA 4V2SA 4OF1A 4O9MA 1WHMA 4PJOD 2CZ6B 5AM3A 5KG4A 4KLFA 3QBYA 5AK5A 4ECRA 3T5KA 8ICFA 2RPNA 3QO3A 9ICFA 3KTQA 4CRIA 1GBRA 2N1RA 1N9SA 2J6KA 4MZMA 4BI3A 1OXJA 2PFQA 2E1HA 1JXEA 4M9GA 4J7IA 5KYUA 3HHTB 2WAQC 1TKDA 2EQKA 3CEYA 2RLTA 4UBCA 4C8QB 3CC4T 2NUTB 2EGEA 1QSYA 1K1QA 2W9MA 3BS5B 4YTLA 2EQIA 4FIBA 1WUDA 3H0LB 8ICMA 1BPZA 2R8HA 8ICTA 1RAFB 2AQ0A 1V97A 1BGXT 4M78C 4X5VA 2QTXA 4I2EA 1U3OA 2JJ9A 1VQ5A 3NRZA 3OYJA 2JZ2A 2HL5C 3VYGA 4D6WA 1WXUA 3IHQB 4BX9C 4IURA 3PMNA 1ZQQA 2CUBA 2PFOA 4DEYA 3GIKA 4M78A 1O9SA 4JWMA 1U5SA 1PVQA 5IHIA 2DF4B 2HKQB 1OZ2A 4YFKA 1JUDA 1NPRA 4MHVA 3RBEA 3OSSC 4IIMA 8ICAA 2K79A 5GAOp 2LYHA 4J9NA 1IG6A 3G6ET 2RMOA 2DM1A 2L89A 2ODGA 4Y2SA 5CP2A 4PJOG 4NL9A 2KTQA 2QQAA 1J2NA 3M0TA 3A5ZB 4M78E 2KHVA 2ALZA 1X42A 1HD3A 1WZOA 4DFJA 3F70A 1JRPA 5IHKA 1YZ7A 3BQ2A 4EEYA 2XY5A 5HKCA 2Q0ZX 4JZ4A 4AFUC 3KZIU 1M3CA 2V26A 3C0CA 1PSEA 4FBUA 2VGNA 1CKBA 4J6XA 2YRCA 3JCMb 4F50A 4B6JA 3ISDA 1X6IA 1SKWA 4RTUA 3VRZA 1ABOA 4F17A 7ICRA 3CCJA 2MSNA 3L4PA 2MWOA 5KFEA 2FHDA 3EW9A 2KOBA 1UG1A 1GCPA 3OQ5A 2VKQA 1WPYA 3NHNA 5FU6B 3OYBA 4RQ7A 3GIBA 2GFAA 3RTVA 3LDAA 1D1CA 1I81A 5J2FA 2ZIXB 1E7OA 8ICOA 4EBCA 2HDOA 2ED1A 2W10A 1H38A 1KQSA 1N56A 4ACOA 1ZQPA 2B6GA 2DYIA 3HRSA 9ICXA 1C7YA 1VQ5Q 2JW4A 2NRXA 3TACB 1YIJA 1D09B 1NEBA 2CP6A 3FC4A 4RU9A 2ZTCA 3AN1A 5AM4A 4JJBA 3CCVQ 3C1YA 2LP5A 2AHJB 1N48A 2M9NA 1RG6A 2ZIVB 1SV4A 4I29A 2R5MA 1W2BS 5TISU 1ZQDA 1A0PA 3EGDB 3U23A 4DA4A 1X2KA 2QLTA 3AQEA 3QUQA 4M47A 1KK7A 1Q95G 2FZKB 3EG3A 1QP2A 2E3HA 4FW1A 3KZXA 4RCBA 5ALHA 2ZUDA 5AKZA 2AZVA 3QNMA 3TSWA 4C92B 3M57A 4FSXA 3C21A 3V7JA 3OHAA 2M16A 4A4KA 1HUOA 2AKLA 2ZPEB 2FG0A 4Q44A 2O9SA 3CNHA 3I55A 1YI2A 4BDPA 2OCEA 3NS1A 1QCFA 1VUBA 2MRLA 4FL6A 4J7FA 3J7AF 4Z88A 2JZBB 1VQ5T 1Y88A 4OMMA 3SI8A 3EGXB 4UASA 1MHNA 3IDWA 3CCJQ 2EKOA 2EBPA 3NVWA 1DJ7B 2M1HA 1PKSA 1TS9A 3KBBA 2R57A 5HK3A 2AU0A 4OJPA 4QKUA 1C1AA 1T8EA 2RHYA 3JB9F 3CC7A 1UA0A 3RF9A 1KL9A 2E3TA 5FWCA 5EOZA 1M90R 1BPEA 4DFKA 2DZ9A 3MKDA 3MR5A 2D0QB 3RRHA 4JV2A 3BY7A 4C5EA 4OJLA 3GBQA 3CCRA 1F5SA 1YIJQ 1NZPA 1WDXA 3QX7A 2MIOA 2A3LA 3F5EA 1X01A 3I76A 4IUPA 4JJNK 1IB8A 4DO9A 4O3SA 4C80A 1SL1A 2NLUA 4M75C 4TVRA 4C8QD 1VQNQ 4N0AC 3LK9A 3NASA 5KFIA 1RAEB 2SRCA 3CBPA 2R8GA 2KXCA 2YY6A 3QIIA 1K9MR 3CCJT 2ISOA 4ED2A 2EKHA 4HT9A 3QU9A 5F9NA 7ICOA 1KC8C 1GCQC 3G71Q 3MR6A 1X69A 2ASLA 7ICVA 2A7YA 4I2HA 2EPDA 1QVGA 5CEHA 8ICBA 1S5LU 5GAOr 4EMKC 3M56A 3JCMV 2BZ8A 1AROP 2QGGA 2QQBA 4KRTA 1Q82C 2E5QA 1D8BA 3SYZA 4MFFA 4NWIA 3I1YA 3KFVA 2DQNB 1VQLA 5J2DA 4M75E 3FC3A 3QKJA 3RJGA 3OS1A 1OUQA 2ZIUB 4O3QA 1X9WA 1YIJT 5J2BA 4PHPA 4FZMA 3NUQA 1AVZC 4CF3A 2EJFA 4N4HA 5KCHA 1M2VB 1ZQ1A 2DX1A 5ALGA 2HSEB 3J81j 1YJWA 2DWQA 4HCKA 3CPWA 3ZDCA 2DE0X 2Y9UA 3MDAA 4C0GA 1ZRNA 3EUB2 2GNCA 3ZD9A 1BKBA 3NTIA 3OYIA 2RNAA 2WAQF 2A1AA 3PV8A 2ES6A 4DBQA 4A53A 5AM5A 3JPSA 1N8RR 4RUAA 3CCRQ 3QHSA 5AKIA 1XTDA 4PK4A 1QKXA 3OYHA 2O88A 1SRMA 3I55T 1YI2T 2FO0A 3C5GA 4M78F 2OX7A 1Q86C 4YXJA 1PWTA 3HT3A 2JMGA 4YN4A 1N5ZA 3TQ1A 5KFFA 3TFSA 1KEJA 5CB1A 2WF8A 2DRMA 2LJ3A 3OMCA 3CW2C 3RH4A 3H0MB 4QW8A 3OMGA 1ZSZC 5I21A 4TUQA 4M7DC 3HRTA 3G6YA 1Y0MA 3KHLA 4KLHA 3CC7T 2KEYA 7ICKA 8ICQA 2K89A 5DG7A 3Q1JA 4A63B 5LJ5e 4AFSC 4YG2A 2GOLA 1QCKA 1TK5A 2IG0A 2CZ0B 1NKBA 1MNDA 1ZSZA 3OYEA 5HMMA 4DSLA 5CR0A 2VV5A 3MEAA 3CCRT 3MO8A 2YLBA 3SR6A 2NUZA 3JAME 2K8AA 1I1JA 4KLJA 2E5KA 2ZTEA 5I22A 2CP2A 4ZNXA 1PUZA 1L8OA 3JB9H 3PNWC 4LNPA 3RJFA 2HKNA 4E7SA 3THVA 4C92D 2HQHA 5GTIU 3PW5A 4C7YA 2C2DA 4M7DE 3M9NB 5IT9E 3RBBB 4BI4A 5LJ5h 2F2VA 3BDPA 1WXBA 3JV3A 4FCYA 3QZ7A 3L5KA 3F53A 4DQSA 2R8KA 2XCPA 5L1IA 1UJYA 2HEQA 2LMJA 5FU7B 4DL2A 2BZXA 4RQ2A 4ELVA 1U4BA 3RMQA 4FBTA 4FW2A 1Z4OA 4A4EA 4JPBW 3P8DA 4PJLA 1WWVA 1Q7YR 1U45A 4KLEA 1V38A 1H8KA 1QVPA 3FIFA 4FZNA 4Y92A 1VQLT 5IIKA 2W04A 5DQIA 3M4YA 3UMBA 4LUEA 4BUGA 1UT5A 5CO7A 3QU4A 5J2IA 1N9RA 1AEYA 2MCNA 2V1RA 3PVQA 4PHEA 3C2LA 4BY6B 4C8MA 4EX7A 3JPPA 1YJWT 2FMPA 3TADC 3GF5A 2MI6A 3AEVA 4D8DA 4Y2UA 4RPYA 1Y96B 1G5VA 2FLNA 4US8A 4K4GA 4IQTA 2HVHA 5GAN2 2ATLA 3OYKA 3CCLQ 5CA7A 1HSQA 2GH1A 1BI2A 3QZ8A 1L5UA 3SEIA 2K3YA 7AT1B 3OYAA 1ARKA 2ZAEA 4KLTA 1BCMA 2HBLA 3TADA 2WSEE 2NYSA 2RQVA 3QYHB 3P8HA 5L1JA 1D3BA 5D6XA 1AZEA 2M0NA 2VKNA 3CPFA 1N61A 3M7DA 4PZNA 1XU4A 3FEOA 5AKKA 5ALIA 2JOYA 1RI0A 1MQ3A 1V85A 2JH7A 2RN8A 2XI9A 2RI5A 1SXDA 4XTUA 1PG5B 1N2XA 2F1JA 4DWIA 2F1IA 1QCNA 3M59A 9ICQA 2FPDA 3ICXA 3M54A 3RJIA 5KFOA 4ED6A 2VJ5A 4RT3A 1QLNA 3MJXA 2OYYA 3M0SA 1HK9A 1PZNA 3NVVA 3RR7A 3LGFA 3WK5A 4G3IA 3T79A 1WX6A 1O75A 3IM1A 8ICLA 1M1FA 2ZPBB 2K4IA 4IC9A 1HEKA 1WHHA 7ICEA
chains in the Genus database with same CATH topology
2PUKB 2JN0A 4M75F 1NZ9A 3QXEB 1KG1A 3RUXA 2M0OA 5GAOn 4QVDA 1M5Q1 1JB0E 1ZBXA 2OXOA 1NJIC 3QYGB 3JCMJ 3CCQA 4NL2A 5GAN8 3OYGA 5CK9A 2K8BB 1L6NA 4PLIA 4AYBC 4C0DB 2JH1A 2YHTA 3NTKA 2CYZB 3L3FX 1N6AA 3MHXA 1W2BA 3VKIA 4NV0A 2DIGA 4C0ZA 3OB9A 1VQ8A 2LVMA 1GO3F 3LWIA 4DOVA 1P7DA 2G08A 2CPRA 3C29A 4PLLA 3ASKA 2JUFA 1UGRB 1ZHIA 4OJOA 1KC8U 2RHFA 2F5KA 3EAEA 4Z02A 3RERA 2LRQA 2OAUA 1I5LA 1QP3A 2KJ9A 2ZCFB 2ZPGB 5J26A 5GMKj 1FX7A 3SMVA 3MEUA 2PMZC 2KD1A 3WVDB 3CCMA 2DVEA 4M7AB 1UGPB 5CKBA 1TH7A 4F7UE 3MGVA 4KX3A 2V8IA 3BW1A 2ZPIB 3LW5E 3FB9A 2E6NA 3RESA 3SWNA 4P0QB 3CCQT 4X9DA 3OYYA 4JRQA 2XHCA 1YBYA 5CAIA 3SAHA 2HBKA 3HFOA 3PTAA 2DPPB 3X26B 3HFNA 2DTHA 1U1TA 1WJSA 5GAN4 1XNSA 1YCYA 1QVGS 3UPUA 4ZGEB 4FT2A 4B9WA 2Y0SC 2W03A 1VQ8T 4OGEA 4EDUA 5GAN7 5FROA 1HIWA 4O3MA 3OBWA 2ZXHA 5KH6A 1XOVA 2QA4A 2GCXA 3DLLA 3S6WA 3A8HB 3WVEB 3CPWS 3V7RA 2MWPA 3CMAA 3CC4A 1YITA 3NFCA 4JUVA 2X4XA 1VQ6A 3PSPA 3NRWA 3AL0B 1V29B 3LVWA 3PMIA 2RH2A 3QSUA 1N8RU 2OTJA 3X28B 1YHQA 4KMOB 3QDRB 3CCMT 4PJOC 3GPLA 2G07A 4QIWC 2RJDA 1Q3UA 3QJ6A 2KHQA 3V7CA 2H3QA 3M55A 4U6PA 2RRDA 2LT4A 3KXTA 4QNLA 2X4WA 4PNOA 3S3OA 4PJOE 4AYBF 2WB1C 3QJYA 3G6EA 5GAMf 4XK8E 3VJPA 4C5IA 5FRNA 4O6JA 3H0RB 3A8GB 4BE2A 3AQFA 2HOQA 4M7AD 4JRIA 2XD0A 3KFUF 2LNVA 4XAXB 1BI0A 1Q7YU 2QA4T 1NJIU 4M77A 3L42A 2KKVA 3RMSA 3CMAT 1YITT 3ONNA 3CYMA 4JDSA 4F7UF 2KQWA 1VQ6T 2RJCA 2RHXA 3BDUA 1YJNA 1MA7A 2OTJT 1YHQT 4M77D 3GOXA 1A6SA 5AYFA 2PMZF 2VXEA 3VV0A 1X6OA 3LWHA 2K2VA 3A8MB 5A0LA 4P0PB 3SD4A 3FLGA 5GAOl 2EAYA 2QQ9A 1Q3VA 3UWNA 5GAMd 3V8LA 3UDCA 2JVVA 2RI3A 1M1KC 3N5BB 1OZ3A 1KBUA 3WXMB 1N27A 3M53A 2QI2A 2K5FA 4M75B 2VJ4A 3G6ET 3DEEA 4HCZA 2G09A 3RKWA 2YB4A 1UEBA 2DTIA 3RKXA 4NS5A 4E7HA 2KJ8A 2Y0SF 4LDWA 1KHCA 1KHIA 2KJ5A 4M77G 3PMTA 4EMKB 4BB7A 2P4TA 2YLCA 2LBOA 5GAMh 3CRXA 2VXFA 1JJ2S 5DY9A 2HQEA 3SQIA 2E5SA 3OA6A 2K57A 3QPHA 4C8QA 1UPHA 4ME7A 5HR7A 3VYHB 1YJNT 2MA1A 4QVZA 1W4SA 5KCOA 2K8CB 4C0FA 5GAMg 3FDRA 4DQ2A 2ZG6A 2EFIA 4PJOF 1BIBA 4QIWF 3URGA 4M7DB 2DXCA 5GMKe 2KNJA 3S3NA 3D2NA 4OB1B 2QEXA 1OI1A 2CRXA 1MGQA 4XQ3A 2OTLT 2KKPA 3ZBDA 1NE8A 2Z7JA 2HBMA 2X35A 2YRVA 1DRGA 3V8KA 5CIUA 2WB1F 1ZQ1C 5GMKh 2F2AB 2DEQA 3HPWA 2GF7A 2GQVA 2LTOA 1FWZA 2K5IA 3X24B 3OYFA 4C5GA 2ZIXA 2P0PA 5L8RE 2W7OA 2PVDB 5LJ3f 4JS4A 3CCEA 5IN1A 2DXBA 2XG8D 4C8QG 4HA8A 2ZIVA 2LYBA 1XNIA 3PFSA 4M75D 1M90C 2HBPA 4C92A 3JRZA 3CBMA 2H3IA 3LH0A 1GXIE 2V8KA 3MCAB 4OVAA 2O01E 1QW1A 3VU3C 4J83A 3L2WA 1PVRA 5EG2A 1K9MC 2RK1A 3GZFA 3VC8A 4IUQA 4B9XA 2RHZA 2QEXT 3OYNA 1NPPA 3CMEA 2B8AA 2JHDA 5I2SA 2ZPHB 4J6YA 4XU3A 4N4IA 3PZPA 2BKDN 4QQDA 3I56A 4Q5WA 2HAXA 1VQ9A 4PL6A 4MZPA 2EQUA 5LJ3d 5GMKl 2E6ZA 1WQWA 3GNGA 3PT9A 1NZBA 1N8RC 2G0AA 1LJOA 1VQPA 3F5AA 3JCMf 4M7DD 2ZZDA 2ZIUA 2D9TA 1XO0A 1FXXA 3CCET 2RHUA 2QXFA 2FYKA 2C06A 2LKYA 4E7JA 4C8QF 1M1KU 4OMFB 4C92G 2KK4A 2DZCA 2LHTA 3L2VA 3QZ5B 5CCAA 3A8OB 1VQOT 1UGSB 3BFMA 4R55A 3CCSA 1IREB 2XDPA 3ALRA 4IUTA 4CRXA 2O4XB 5GAN6 2R18A 1KQ1A 4MMLA 3ZFJA 4OJ5A 4CI0C 1HXDA 4XU2A 2XDDA 3M6KA 4BD3A 3OBYA 2X4YA 3PGGA 4F7UB 2EQMA 4QVCA 3CMET 2E1FA 1WJQA 2I2LA 2E10A 1WJRA 1Q7YC 4EMHA 5LJ3g 3L2UA 4E7KA 4LD6A 4LDVA 1YJ9A 4FM4B 5GAMj 3JCMW 4ZGDB 3I56T 4OJ6A 3E0FA 3JCMd 1VQ9T 4FZLA 2CGHA 4JLGA 4IUVA 4FT4A 2XDBA 2KDSA 3VCBA 1PSFA 5HY6A 3MEWA 5CRXA 1VQPT 2E1EA 2Y4XA 5GMKi 1JJ2A 1VIFA 2PU9B 2E12A 2ZIWB 2NV3A 4XU1A 1K73U 2KMTA 1M1GA 3CD6A 1Y96A 3BDLA 4JRKA 1QVFS 3RKYA 4E47A 4BI8B 2QQRA 4LDYA 3OW2S 3JSCA 4Y91A 3CCST 3TU4K 3G7ZA 4II1A 4RG2A 1EIFA 1YT3A 1S72A 5GANf 2E65A 4MDWA 3N7SC 4Y28E 1M9SA 1I8FA 5D6YA 2XICA 2H3VA 3JCMg 3INZA 4KUDK 2RA2A 3SWNC 4P5NA 2M9UA 2LCCA 2ZPFB 2D6FC 4ELZC 1YJ9T 5FLXE 2ZGWA 1H3ZA 4BE0A 3HP9A 2CKKA 4OB3B 3JCMQ 4PJOB 4PL2A 1M90U 2HOIA 4HT8A 2D6FA 2E41A 2IVWA 4C0DC 1VQMT 2DAQA 2G5IB 1B34B 1VQ4A 1K9MU 2RJFA 5DM7R 4QQ6A 2LX9A 2WACA 3CD6T 3LYIA 3QUIA 4N4GA 4A4HA 2K4YA 4ZTJA 1M8VA 5CQXA 1Y71A 3G4SA 5GAN3 3IG5A 3ER0A 2LYAA 5FRMA 1S72T 3D2SA 3V7SA 3E19A 3JB9J 1BIAA 1WNLA 2PVOB 4E7IA 2DXTA 2P0KA 4M78B 2GFUA 4FE3A 2WSFE 1BYMA 5CKDA 5CKEA 2OM6A 1F44A 3LGLA 3CP8A 4QW2A 4R56A 2KSSA 1WQ7A 4J8OA 1VQKA 2Y4YA 4M7AA 3GP8A 1X75C 3D2QA 2F76X 5GAOq 1P92A 4P0QA 4XTZA 3CXCA 5C0MA 4GY5A 1VQ4T 5GANg 4WJ3B 5LJ3j 4M77C 2RM4A 3QG1A 2XK0A 3N7PD 3CC2A 4IKFA 3RFAA 3JB9D 4BDYA 2L5QA 2H3FA 3IG8A 2PVGB 2KAFA 3M58A 3G4ST 2V8JA 5DLOA 5A2QE 2DTOA 4PL1A 4M77E 2WSCE 3H8ZA 4A4GA 4MDXA 3HKZC 4J6WA 5KE3A 3DKMA 1KD1C 2HMXA 4ICAA 3VUBA 2PQWA 4X34A 1PVPA 4OO1J 2OH2A 2VIXA 3C12A 3CCUA 3PIOA 4PKCC 5LL6S 4M7AG 2LCLA 1AHJB 3TEEA 3PIPA 2XVTA 1URJA 3CCVA 4QJFB 1R8OB 1VQKT 4IUUA 2G3RA 3JB9G 2E70A 2CZ7B 5CR2A 2HOFA 3OYMA 2OTLA 3HL8A 3DB4A 4UC4A 3DB3A 4FU6A 3J80E 5CQYA 5GAMe 1Q81C 2Q4TA 2XU8A 4X9CA 4M78D 2KVCA 3JB9I 3RIRA 5J39A 1QVFA 3CC2T 4BJQA 3MP6A 4U7CA 3OW2A 4NOYA 2YX8A 1JRIA 3M5AA 4C8QC 2P0QA 1VQNA 3EFSA 5A0DA 3JCMP 2HQXA 3X20B 1KQ2A 3C28A 3G71A 2F8LA 4L5GA 2L8DA 2DGZA 5M9OA 4C8QE 2A3VA 4KBMB 2JTMA 3CCUT 4M78G 3LX7A 4MZTA 4M7AF 1UGQB 3CCVT 4A4FA 4XTWA 1K73C 4RMOA 3GLXA 5LJ5f 5A0GA 2MMPA 1WGSA 3A8LB 4P0PA 1G3WA 1LOJA 1Y7XA 2ZXIA 1K8AC 2JNGA 4ATOA 3H6ZA 5FU6C 1ECWA 3NTHA 3GU3A 4OGCA 2LDMA 3CBOA 2HD0A 1ED1A 4M75A 4M77F 3KUFA 3F2CA 3E1SA 4N0AA 4MMKA 2K4EA 3ME9A 3PSTA 4LDUA 5KL1B 5GAN5 4CGZA 3OYDA 3L2RA 4EMKA 4KX5A 2RD1A 4C92C 1VQNT 3L2ZA 1CRXA 2RP5A 1D3BB 5GANj 2G06A 4O5VA 2KV2A 3HKZF 4LDXA 1VQOA 3SAGA 2BUDA 3HKSA 3G71T 3OSVA 2FVUA 5LJ5d 1U8RA 4C92E 3IP4B 1BI3A 4EPCA 2EJ9A 2QQSA 4RKUE 1RL2A 1BI1A 2F69A 3TCJA 3CCLA 2XKOC 4A54A 2RK2A 2Y90A 4M7DA 2HBJA 4RCCA 1KD1U 2HNIA 5GAOm 3KBGA 3TREA 3VUZA 4M75G 3PSFA 1IZ6A 2VUBA 2H3ZA 2DD4A 5KL8B 5C6SA 3FJPA 3F2BA 3M9QA 2EYQA 2EIFA 3CXCS 4GLKA 4OB2B 1JBMA 3OYCA 1I4K1 5LJ3e 3LVVA 3E9GA 5LJ5g 4ZN1A 2DO3A 3META 2KIWA 4LD9K 2XIDA 3L2QA 2DXUA 1Q81U 1TAMA 2H3JA 3OY9A 5LJ3h 2LC4A 3DLMA 3OS5A 3SB2A 3M4GA 2MF2A 1G3SA 2EWNA 3V8JA 2RB6A 2DD5A 1T94A 2FB7A 4ELYC 4M7DG 1VIEA 3CCLT 1IIPA 5C0YA 4JS5A 4A8EA 2CZ1B 5FU7C 3SWNB 3LLRA 3L1AA 2JTFA 2DJZA 2LT1A 5KE2A 3MP8A 1G3TA 1VQMA 1SSFA 4BY6C 4J5YA 4HCBA 3JCMe 1Z1BA 4C5HA 4DOWA 4OB0B 3SAFA 5CVIA 1XQHA 3N7RC 2W7PA 1VQ7A 3HSBA 1G3YA 4C92F 2DK3A 4WF2A 2CS7A 2VC8A 1K8AU 4L6V5 4XTYA 4ZN3A 3JCMh 1KQSS 3OPXA 3JCMX 3PSIA 2R58A 3P8BB 2QDYB 4XTVA 2VGMA 3IN5A 2KY9A 3MEVA 2LQ8A 5HR6A 4GFJA 3QZ9B 3ZEHA 3EFRA 2K3XA 1Q82U 4JMUA 2VYTA 2O4XA 2JGAA 3UT1A 4NL3A 2E64A 3JCMc 3AHUA 2L3RA 2DIQA 4M7DF 3R6OA 4ZGJB 4F7UA 3OS0A 1M4ZA 3O8VA 1LNXA 3OYLA 3HRUA 4L59A 3SFMA 4EMGA 3FRNA 4XU0A 4BE1A 4HCCA 3T9NA 2K5LA 1Q86U 2BIVA 1Y07A 2RO0A 1UB4A 3OS2A 2LQKA 5I2MA 4OP0A 1VQ7T 5GMKm 2F5TX 3M6ZA 2KVQG 5GANd 2DKGA 3F2DA 2ZIWA 1OYXA 4M77B 4QQGA 3S3MA 3K1ZA 4ZTFA 4CDGA 3GNFB 1SZHA 5CKFA 2BDUA 4NLCA 5DLQE 4JLIA 2RI2A 5GANe 2G5HB 3X25B 3C95A 2PUOB 2KICA 2EJGA 2RJEA 2F77X 5LJ5j 4F7UG 1H641 4M7AC 4E7LA 5T14A 3E9FA 5GANh 3J81E 2R5AA 2X4JA 2CN1A 4KT0E 4RG8A 4JRPA 4HKEA 3LYSA 3O0FA 4BDZA 5D6WA 5HK0A 2YB1A 4M7AE 4NLBA 5IAYA 4PJOA 2K4HA 5J3BA 4KUIA 4XTXA 3C94A 2MAMA 2FL7A 2RHIA 1Z19A 3C4SA 3SDZA 2EQJA 1U1SA 1B34A 4KULA 3MP1A 4VUBA 4BACA 5CKHA 4V2SA 4OF1A 4PJOD 2CZ6B 3QBYA 3QO3A 4CRIA 2N1RA 1N9SA 4MZMA 4BI3A 2E1HA 4J7IA 3HHTB 2WAQC 2EQKA 3CEYA 4C8QB 3CC4T 4YTLA 4FIBA 1WUDA 3H0LB 4M78C 2QTXA 1VQ5A 3OYJA 2JZ2A 3VYGA 4D6WA 4BX9C 4IURA 4M78A 1O9SA 1PVQA 2DF4B 1OZ2A 1NPRA 5GAOp 3OSSC 2L89A 4PJOG 2QQAA 3A5ZB 4M78E 2KHVA 3F70A 5HKCA 1PSEA 2VGNA 4J6XA 3JCMb 3CCJA 2MWOA 2FHDA 2KOBA 3OQ5A 2VKQA 1WPYA 5FU6B 3OYBA 3GIBA 2GFAA 1I81A 2ZIXB 1KQSA 4ACOA 3HRSA 1YIJA 2AHJB 2ZIVB 2R5MA 1W2BS 1A0PA 4DA4A 3AQEA 1QP2A 4RCBA 3KZXA 4C92B 3M57A 4FSXA 4A4KA 2M16A 2ZPEB 3I55A 1YI2A 1VUBA 4FL6A 2MRLA 4J7FA 3J7AF 1VQ5T 1MHNA 2EKOA 1DJ7B 2M1HA 2R57A 5HK3A 4OJPA 2RHYA 3JB9F 3CC7A 3RF9A 2DZ9A 2D0QB 3BY7A 4C5EA 4OJLA 3CCRA 2A3LA 3F5EA 1X01A 4IUPA 4JJNK 4TVRA 2NLUA 4M75C 4C8QD 4N0AC 3CBPA 3QIIA 3CCJT 4HT9A 1KC8C 2A7YA 1QVGA 5GAOr 4EMKC 3M56A 3JCMV 2QQBA 1Q82C 2E5QA 1D8BA 4NWIA 2DQNB 1VQLA 4M75E 3FC3A 3QKJA 3OS1A 1OUQA 2ZIUB 1YIJT 4FZMA 3NUQA 2EJFA 4N4HA 5KCHA 1ZQ1A 1YJWA 3CPWA 4C0GA 1BKBA 3NTIA 3OYIA 2WAQF 4A53A 3QHSA 1XTDA 3OYHA 3I55T 1YI2T 4M78F 1Q86C 2JMGA 3OMCA 3H0MB 3OMGA 5I21A 4M7DC 3HRTA 3CC7T 2KEYA 2K89A 3Q1JA 5LJ5e 2GOLA 2IG0A 2CZ0B 3OYEA 2VV5A 3MEAA 3CCRT 3MO8A 2YLBA 3JAME 2K8AA 3JB9H 3PNWC 4C92D 4M7DE 5IT9E 4BI4A 5LJ5h 3F53A 5FU7B 3RMQA 4A4EA 3P8DA 1QVPA 3FIFA 4FZNA 1VQLT 2W04A 3M4YA 4BUGA 5CO7A 1N9RA 4BY6B 1YJWT 3GF5A 2MI6A 1Y96B 1G5VA 5GAN2 3OYKA 2GH1A 1BI2A 3OYAA 2K3YA 2HBLA 2WSEE 3QYHB 3P8HA 1D3BA 5D6XA 2M0NA 3CPFA 3M7DA 3FEOA 2JOYA 1RI0A 2JH7A 2XI9A 2RI5A 4XTUA 3M59A 3ICXA 3M54A 2VJ5A 2OYYA 1HK9A 3LGFA 3T79A 1O75A 2ZPBB 1M1FA 2K4IA 4IC9A 1HEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUG A;  5A0L A;  2XIC A;  2XI9 A;  2XID A;  5A0G A;  4C0Z A;  5A0D A; 
#chains in the Genus database with same CATH topology
 4YMM A;  1U06 A;  4DQR A;  1SXE A;  4ED3 A;  2EH9 A;  2PUK B;  2JN0 A;  1K0X A;  5ALJ A;  3K1R B;  4F2S A;  1G83 A;  3ZI4 A;  1EZZ B;  2P66 A;  4DSE A;  2KEA A;  3TAQ A;  4M75 F;  1NZ9 A;  2VWF A;  2XCA A;  3QXE B;  1KG1 A;  3VS5 A;  3RUX A;  2M0O A;  5GAO n;  2M51 A;  4QVD A;  3GII A;  9ICK A;  1M5Q 1;  1JB0 E;  1ZBX A;  2OXO A;  1NJI C;  4B9N A;  3QYG B;  1TV9 A;  2DF6 A;  2LI6 A;  3G6X A;  2FRY A;  3JPN A;  2QB1 A;  2P6U A;  3T5L A;  1CSK A;  1QCO A;  2KNB B;  3M9O B;  4M2Y A;  5ALZ A;  3JCM J;  3CCQ A;  1QQ6 A;  1YFN A;  1ZSG A;  4NL2 A;  1ZQU A;  5GAN 8;  1ZUU A;  3OYG A;  5CK9 A;  5ALL A;  2K8B B;  1ZLM A;  1L6N A;  4F8R A;  4PLI A;  2EAN A;  2EYZ A;  3T5H A;  4EBE A;  4AYB C;  3EG0 A;  1AWX A;  2JH1 A;  3H8S A;  4C0D B;  2YHT A;  3TAP A;  3NTK A;  1SL0 A;  3UQ0 A;  3L3F X;  1N6A A;  1DOQ A;  2CYZ B;  3MHX A;  1W2B A;  3VKI A;  2PI4 A;  4NV0 A;  1SWV A;  2DPJ A;  2DL7 A;  1MV0 B;  2DIG A;  2C2R A;  4C0Z A;  3OB9 A;  4Q8E A;  5AIA A;  5KFQ A;  4ED1 A;  1VQ8 A;  2LVM A;  1GO3 F;  1QH9 A;  5FP0 A;  4J9C A;  2RQU A;  3LWI A;  1KQS P;  4DOV A;  1ZQR A;  1P7D A;  3PE0 A;  2FPK A;  2G08 A;  4M6W A;  2CPR A;  5J0O A;  3C29 A;  5IXB A;  4F93 B;  3IQL A;  4QZH A;  1YN8 A;  3H8M A;  3TKA A;  4PLL A;  3ASK A;  2JUF A;  1UGR B;  1ZHI A;  2W8K A;  2VA2 A;  4KLG A;  1NYF A;  5KTQ A;  2PZ1 A;  2I9G A;  4OJO A;  1KC8 U;  3H7I A;  4CE6 A;  2RHF A;  1W1F A;  2F5K A;  4BXO A;  1KJW A;  5KYW A;  3EAE A;  1I5O B;  4O3N A;  1CEZ A;  4Z02 A;  2LRQ A;  3RER A;  1R0B G;  2OAU A;  2HI0 A;  2HHT A;  4J9D A;  2MUT B;  3KHG A;  1M30 A;  4DS4 A;  1I5L A;  2CH4 W;  2DL4 A;  1QP3 A;  1UTI A;  2KJ9 A;  8ICE A;  2ZCF B;  1UT8 A;  2ZPG B;  3BZK A;  3MPU B;  1RAA B;  1EFN A;  5DKW A;  4DOC A;  5J26 A;  3N28 A;  3SV3 A;  2J7I A;  3GV7 B;  2FZC B;  2O6K A;  5GMK j;  1FX7 A;  1A77 A;  3SMV A;  3MEU A;  5IIJ A;  4KN4 A;  4AFQ C;  1XO1 A;  3ETL A;  5ALP A;  1D0X A;  2PMZ C;  2KD1 A;  3WVD B;  3CCM A;  2DVE A;  5DG9 A;  1UGP B;  5CKB A;  4M7A B;  1TH7 A;  4F7U E;  1RXV A;  3MGV A;  5AK6 A;  2WF7 A;  4KX3 A;  2V8I A;  3BW1 A;  2ZPI B;  1VQ8 Q;  4UB1 A;  3LW5 E;  5J2H A;  4Y2V A;  1V9P A;  2GGR A;  8ICR A;  1M6Y A;  4MEX A;  1MMN A;  3I5S A;  2D8J A;  3FB9 A;  9ICP A;  2E6N A;  3E2E A;  5J2G A;  2A08 A;  3RES A;  3SV4 A;  3RB4 A;  3SWN A;  2CH4 A;  4P0Q B;  3CCQ T;  5ALE A;  1C20 A;  3OYY A;  4X9D A;  4JRQ A;  4D8K A;  5KG0 A;  4KN7 A;  2ROL A;  5AM2 A;  1UFF A;  2V4R A;  5AK4 A;  2W0Z A;  2XHC A;  1YBY A;  5J0P A;  2DFU A;  4PJJ A;  3U26 A;  4J9S A;  3SAH A;  5CAI A;  2HBK A;  1XSN A;  2ROT A;  3HFO A;  2MAX A;  2L3Q A;  4LXC A;  3PTA A;  2DPP B;  3MR3 A;  3X26 B;  2RQR A;  5KT5 A;  4EYH B;  2DTH A;  1U1T A;  1WJS A;  3HFN A;  4OMQ A;  5GAN 4;  5CWR A;  4F16 A;  1BVS A;  9ICE A;  5IIM A;  1XNS A;  1OU8 A;  1UCV A;  2ZJ8 A;  1YCY A;  1QVG P;  1QVG S;  1N60 A;  3UPU A;  1JU5 C;  4ZGE B;  2VAN A;  4FT2 A;  5KG7 A;  5ECA A;  2Y0S C;  2W03 A;  4B9W A;  4OGE A;  1VQ8 T;  3ZD8 A;  4EDU A;  5FRO A;  5GAN 7;  3EG9 B;  1HIW A;  1VJ5 A;  1I07 A;  4RNO A;  1FMK A;  1RI9 A;  4O3M A;  2KT8 A;  2DL0 A;  2LNH B;  3M9M B;  2FLP A;  2Y1I A;  3OBW A;  5KFR A;  1RYU A;  2ZXH A;  2W11 A;  1ZUK A;  5KH6 A;  2V9W A;  4TQS A;  5KAI U;  1XOV A;  2QA4 A;  1CI4 A;  1XC9 A;  2GCX A;  3DLL A;  2KRN A;  3BQT A;  3S6W A;  3RB6 A;  3ZL7 C;  5ALM A;  1KDH A;  3A8H B;  3CPW P;  3WVE B;  3CPW S;  3CCM Q;  5B66 U;  3V7R A;  4HYK A;  2MWP A;  3CMA A;  3CC4 A;  4F72 A;  5JRT A;  1J3T A;  2LJ1 A;  1ZQF A;  7ICI A;  1ZQO A;  5J2A A;  3UXN A;  1S10 A;  1YIT A;  5IXF A;  4AP9 A;  1CKA A;  3NFC A;  2HHX A;  1V76 A;  1NEG A;  4IQU A;  2NWM A;  4I2D A;  4JUV A;  1J2M A;  2X4X A;  5HHH A;  1TU0 B;  4QW9 A;  4Y2P A;  4RQ3 A;  3D6J A;  4AG2 C;  1VQ6 A;  3PSP A;  1M8M A;  2CT4 A;  3NRW A;  5DB8 A;  4EX6 A;  3AL0 B;  1V29 B;  3LVW A;  2JS2 A;  3PMI A;  1E6H A;  1YCS B;  2RH2 A;  5DBA A;  3QSU A;  1N8R U;  4UB2 A;  2OTJ A;  2QAZ A;  1DK3 A;  4DL6 A;  4UAZ A;  2AH5 A;  5J0R A;  3X28 B;  1YHQ A;  2MPX C;  5ALQ A;  2AXT U;  4YCX A;  4QZF A;  4KMO B;  3QDR B;  4F4K A;  3CCM T;  2LJ0 A;  5KFJ A;  4MFC A;  1KD1 R;  4PJO C;  3GPL A;  2G07 A;  3QDF A;  5KG3 A;  5J2J A;  1YWO A;  3VS3 A;  2ABL A;  5D46 A;  4FYY B;  4PJ0 U;  4CC2 A;  4QIW C;  3GIL A;  4F5Q A;  1UDL A;  3H9N A;  4TUP A;  2RJD A;  2X3X D;  3EH1 A;  1Q3U A;  1GFC A;  2H8H A;  1RUW A;  4GXI A;  3V7K A;  2KHQ A;  3QJ6 A;  1SSH A;  1TWB A;  3V7C A;  4ECU A;  2H3Q A;  5AI5 A;  1Z3E B;  1O08 A;  2LMR A;  3OHB A;  4RNN A;  5DB6 A;  3M55 A;  4U6P A;  2YRD A;  2RRD A;  1X9M A;  2LT4 A;  4KGV B;  2QA4 Q;  3KXT A;  4QNL A;  3RRG A;  4DOA A;  2X4W A;  4PNO A;  4AG1 C;  2CRE A;  4KTQ A;  2VVK A;  3S3O A;  4PJO E;  3UM9 A;  2EYX A;  4AYB F;  3CC4 Q;  3M1Y A;  1TVA A;  3WKA A;  2WB1 C;  2DRK A;  3QJY A;  3FAH A;  1T3L A;  3G6E A;  5GAM f;  4GXJ A;  5E79 U;  3C2M A;  4XK8 E;  9ICO A;  3VJP A;  2K6D A;  4UB4 A;  4C5I A;  4B9U A;  5FRN A;  4O6J A;  2HHQ A;  3H0R B;  4FYV B;  3A8G B;  4DBH A;  1VQ6 Q;  5ALS A;  9ICN A;  3EH2 A;  4BE2 A;  3AQF A;  4MF8 A;  5GJV B;  2HOQ A;  1TUG B;  9ICG A;  3N4M B;  2B86 A;  1IV8 A;  2IBK A;  4M7A D;  4EBD A;  1OUL A;  1D0Z A;  4JRI A;  4F4Z A;  3QUC A;  3Q8Q B;  1BCO A;  1Q81 R;  2XD0 A;  3PR5 B;  3KFU F;  5HCK A;  2LNV A;  8ICK A;  4XAX B;  1BI0 A;  2AKK A;  1Q7Y U;  2QA4 T;  2JEI A;  1NJI U;  2A0F B;  4M77 A;  3L42 A;  1TE2 A;  2PKE A;  3H8W A;  4LJX A;  4MEY A;  2KKV A;  3RMS A;  2C22 A;  1K5O A;  1TOV A;  3CMA T;  1PK3 A;  3JPR A;  5J8Y C;  1V1C A;  3ONN A;  1YIT T;  3CYM A;  4JDS A;  4ZH4 A;  4UW9 A;  9ICH A;  4F7U F;  4JV1 A;  2W9B A;  2KQW A;  4JJD A;  3R9K A;  1C6V X;  1UEC A;  1RLQ C;  2HVI A;  1VQ6 T;  1PKT A;  2RJC A;  3EYZ A;  2RHX A;  1RZT A;  3BDU A;  5AK3 A;  5J8Y A;  2EGA A;  2O9V A;  3V6H A;  4NJ8 A;  2KRS A;  4RTY A;  2XO7 A;  1YJN A;  3I5R A;  1MA7 A;  2YQE A;  1PCX A;  3B0X A;  2OTJ T;  4NL9 C;  4Q43 A;  3MR2 A;  1YHQ T;  3QU2 A;  4DSF A;  4M77 D;  2QG9 B;  3GOX A;  4DL3 A;  1A6S A;  1ZQN A;  3G6E Q;  5AYF A;  2PMZ F;  4GBQ A;  1LCK A;  3TAN A;  5KFB A;  2VXE A;  7ICU A;  3VV0 A;  5ALO A;  1WI7 A;  4ED8 A;  1X6O A;  3LWH A;  4G9B A;  1ZD3 A;  4P4O A;  1IGQ A;  2K2V A;  5DB9 A;  3A8M B;  3RH5 A;  5A0L A;  4P0P B;  5KT4 A;  3FLG A;  5F3X B;  3SD4 A;  4DBR A;  5GAO l;  2GBQ A;  2NUP B;  2EAY A;  2QQ9 A;  1Q3V A;  2JT4 A;  3UWN A;  5CJ7 A;  1RYS A;  1QWE A;  4DL4 A;  2OHF A;  2QYZ A;  5GAM d;  3QU7 A;  3BZC A;  3V8L A;  3EG1 A;  1XS9 D;  3UDC A;  1OX9 A;  2XC9 A;  2L3P A;  2JVV A;  1SV0 C;  2RI3 A;  1M1K C;  3VS6 A;  4ECV A;  4DBF A;  3N5B B;  4CF4 A;  5J0X A;  1OZ3 A;  1LV5 A;  1KBU A;  3WXM B;  1NJW A;  1JI7 A;  1N27 A;  3M53 A;  5KYY A;  5ALV A;  9ICR A;  1K73 R;  2QI2 A;  2K5F A;  4M75 B;  2VJ4 A;  5KFZ A;  3DEE A;  2D1X A;  4HCZ A;  1SV0 A;  2G09 A;  3FM9 A;  3PX0 A;  3RKW A;  2YB4 A;  2BCS A;  1UEB A;  2DTI A;  1XSL A;  7ICT A;  3RAX A;  3RKX A;  2W3S A;  2J6T A;  1L3T A;  4NS5 A;  3OJS A;  2JM9 A;  2HHU A;  4E7H A;  2WF6 A;  2KJ8 A;  4M9L A;  2Y0S F;  1FIQ A;  4LDW A;  1KHC A;  1ACM B;  3RB0 A;  2BE9 B;  1KHI A;  2KJ5 A;  1FEZ A;  4PJN A;  3MBY A;  4YR2 A;  4M77 G;  4EEK A;  3PMT A;  3WK4 A;  4EMK B;  3SD7 A;  1NK0 A;  4BB7 A;  2DBY A;  3NVZ A;  5KFA A;  9ATC B;  4QZA A;  1W2B P;  1N5X A;  5G5H A;  1BPY A;  5IHN A;  3NGP A;  2P4T A;  5J29 A;  9ICS A;  2YLC A;  4ECT A;  2LBO A;  5GAM h;  1EXN A;  3CRX A;  2JEF A;  2VXF A;  1JJ2 S;  3WKE A;  5DY9 A;  3PVL A;  8ICG A;  1SHF A;  5J2C A;  5EWF A;  4GLX A;  2HQE A;  4DCC A;  3E2U A;  1COO A;  8ICP A;  9ICB A;  3SQI A;  2E5S A;  3OA6 A;  5KFM A;  2BCQ A;  8ICY A;  2K57 A;  5EC7 A;  3QPH A;  5KG2 A;  4C8Q A;  1UPH A;  4ME7 A;  2NUT A;  5HR7 A;  2LM4 A;  3VYH B;  4XUS A;  1YJN T;  4QZ9 A;  2MA1 A;  3OSP A;  2K60 A;  3BS5 A;  2QK0 A;  4QVZ A;  3ISB A;  4DF8 A;  1ZQJ A;  1W4S A;  5KCO A;  2K8C B;  4C0F A;  5GAM g;  1FMW A;  2OEH A;  1RLP C;  3FDR A;  3HW8 A;  3RNJ A;  4DQ2 A;  4AT1 B;  4KLQ A;  2ZG6 A;  5KFP A;  4IS7 A;  2EFI A;  4PJO F;  1M3A A;  2P6R A;  3MAB A;  4GLM A;  4BWM A;  2C0O A;  2EYW A;  1WCN A;  1BIB A;  4PFP A;  4QIW F;  1ZRM A;  5EE0 A;  1NLO C;  1RAH B;  4RTZ A;  4RQM A;  3BJY A;  3URG A;  2DXC A;  2LM1 A;  2KNJ A;  5GMK e;  4M7D B;  3D2N A;  1W6X A;  4OB1 B;  2QEX A;  3S3N A;  3V72 A;  1AT1 B;  1X2Q A;  1OI1 A;  4ANJ A;  2CRX A;  3GV8 B;  2EVR A;  4C4R A;  1MGQ A;  4C8O A;  4XQ3 A;  3WKC A;  2OTL T;  2KKP A;  1K1Z A;  1VOM A;  2ZTD A;  3ZBD A;  1NE8 A;  2Z7J A;  2HBM A;  3UXO A;  2D8C A;  3ETR A;  4KLO A;  2KFN A;  3RJH A;  4RTW A;  3PX6 A;  4NLN A;  1K1S A;  2X35 A;  2YRV A;  5ALX A;  1DRG A;  1ZQT A;  3V8K A;  5CIU A;  2WF9 A;  2GTJ A;  2WB1 F;  2HHS A;  1K76 A;  1RAG B;  2W43 A;  4O3O A;  1ZQ1 C;  5GMK h;  1BPB A;  7ICH A;  2F2A B;  2DEQ A;  3HPW A;  3I55 Q;  1TAU A;  2GF7 A;  1YI2 Q;  4IRD A;  2CP7 A;  5HHI A;  1BK2 A;  2GQV A;  1MN8 A;  4DOB A;  4EZ9 A;  2LTO A;  1FWZ A;  1PK1 B;  3WK6 A;  1X2I A;  2K5I A;  3RJJ A;  3X24 B;  3TI0 A;  3OYF A;  3RJK A;  2YML A;  3NPF A;  3A0B U;  4C5G A;  4NLG A;  4I2I A;  8ICW A;  2ZIX A;  1MSW D;  2EAO A;  2P0P A;  2W9C B;  3CC7 Q;  1R77 A;  1L7N A;  2EAP A;  1H92 A;  1LB2 B;  5L8R E;  2L3S A;  4I2F A;  2W7O A;  5ALU A;  2PVD B;  1UQV A;  5LJ3 f;  2WFA A;  2R8J A;  4JS4 A;  3CCE A;  4ECS A;  2PI5 A;  5IN1 A;  2DXB A;  2XG8 D;  2LQW A;  5EE3 A;  2QAR B;  1B7T A;  4HA8 A;  4C8Q G;  5AI4 A;  2ZIV A;  4UAW A;  4F3O A;  1ZOL A;  2LYB A;  3RDV A;  3EGD A;  3WK7 A;  1XNI A;  1KLN A;  3M0U A;  3PFS A;  4J9R A;  2L2P A;  4M75 D;  4HVV A;  1L3U A;  4R0K A;  2HBP A;  3G6V A;  1M90 C;  3LWL A;  4EYI B;  4C92 A;  2COY A;  5KFN A;  1DK2 A;  4TUR A;  3JRZ A;  8ICJ A;  1A0N B;  3CBM A;  3PR4 A;  4PZO A;  2KT1 A;  2H3I A;  1KW4 A;  2I5H A;  5AI0 A;  3M8R A;  3LH0 A;  2HHV A;  3FDS A;  1U48 A;  1S0O A;  1GXI E;  2JZB A;  2V8K A;  4AFZ C;  3MCA B;  4YVZ A;  4OVA A;  2O01 E;  1QW1 A;  3VU3 C;  3QUB A;  3EGX A;  5ALR A;  4RQ8 A;  4J83 A;  5F9L A;  1VQL Q;  1Y57 A;  1WHG A;  1NK9 A;  3L2W A;  1PVR A;  5EG2 A;  1K9M C;  2RK1 A;  2K4P A;  3GZF A;  3HRD D;  3VC8 A;  4KH0 B;  4IUQ A;  2J6F A;  4B9X A;  2RHZ A;  4LUD A;  2KG5 A;  1ZQM A;  2QEX T;  3OYN A;  1NPP A;  3CME A;  2B8A A;  2FMS A;  2JHD A;  5I2S A;  1YJW Q;  2YT6 A;  5KFL A;  5DG8 A;  2ZPH B;  4J6Y A;  4J9M A;  4XU3 A;  1ZQB A;  1L3S A;  1LKY B;  5C5J A;  3BQ1 A;  4J9F A;  1ZQY A;  2YUP A;  4N4I A;  3CCE Q;  2GO7 A;  3PZP A;  1PRL C;  4HXJ A;  3H4D A;  4R63 A;  3Q8S B;  2LCS A;  2BKD N;  5CHG A;  4QQD A;  1IO6 A;  3I56 A;  4Q5W A;  3KKA A;  2HAX A;  5ALF A;  2XGQ A;  4PJM A;  2ESE A;  1VQ9 A;  4PL6 A;  3HTR A;  4MZP A;  2EQU A;  2K9G A;  1C0M A;  5LJ3 d;  5GMK l;  2DLP A;  3HJE A;  2E6Z A;  3QYP A;  1WQW A;  3GNG A;  4K4I A;  4QT7 A;  1TUC A;  4RTX A;  5KYX B;  3MDC A;  3PT9 A;  2EYY A;  2W9A A;  4Y2Y A;  2A28 A;  1NZB A;  1N8R C;  5DQG A;  2G0A A;  1LJO A;  1VQP A;  4Z8A A;  1ZD5 A;  5JU5 A;  2XMF A;  3F5A A;  3WU2 U;  1NK8 A;  3JCM f;  4RUC A;  4F14 A;  5DQH A;  2DKX A;  1JMS A;  4M7D D;  4Z89 A;  2C28 A;  2ZZD A;  1RPL A;  2ZIU A;  2D9T A;  1XO0 A;  1FXX A;  3QXG A;  3CCE T;  2RDI A;  3SEN A;  2RHU A;  3WK9 A;  4QZ8 A;  1M2V A;  2JR5 A;  1FMV A;  2QXF A;  4IIO A;  2FYK A;  1RDF A;  2RF0 A;  2LKY A;  2QB0 B;  2C06 A;  4OML A;  4Z6D A;  4C8Q F;  4E7J A;  4DL5 A;  1M1K U;  4ECQ A;  4OMF B;  4C92 G;  2KK4 A;  4J9H A;  1RAI B;  2DZC A;  2LHT A;  4F4Y A;  4O5K A;  3L2V A;  5KT6 A;  1HUZ A;  4PGQ A;  3QZ5 B;  4K11 A;  5CCA A;  1GL5 A;  1AQ6 A;  3A8O B;  1VQO T;  3CQT A;  3VS7 A;  5J0T A;  2AGO A;  1UGS B;  2QDL A;  3BFM A;  3WKB A;  4R55 A;  3CCS A;  2DNU A;  1IRE B;  4GC7 A;  3ALR A;  2XDP A;  4IUT A;  4RTT A;  4PGY A;  3PML A;  4CRX A;  2O4X B;  5GAN 6;  2R18 A;  1S8O A;  1Z00 B;  1KQ1 A;  3REA B;  3AM9 A;  4Z6E A;  4OJ5 A;  4MML A;  1AD5 A;  1HXD A;  2DIL A;  4XU2 A;  3ZFJ A;  4CI0 C;  1QSL A;  4UAR A;  1NJY A;  2CP0 A;  2XDD A;  8ICC A;  1PC0 A;  3M6K A;  4UAY A;  2EW3 A;  4BD3 A;  1VQ9 Q;  3OBY A;  2X4Y A;  5DDM A;  3EHQ A;  1T3S A;  3PGG A;  4F7U B;  4K4H A;  2EQM A;  1G2B A;  4QVC A;  4YR0 A;  3G1J A;  1ZQL A;  4Y2J A;  1OU9 A;  3CME T;  1K4U S;  1TXQ A;  1VQP Q;  2E1F A;  4C8K A;  5AI9 A;  1WJQ A;  2I2L A;  2E10 A;  1WJR A;  1DGJ A;  1Q7Y C;  4EMH A;  5LJ3 g;  4RQ1 A;  1HJP A;  4R8U B;  4HVU A;  4O5E A;  3L2U A;  4E7K A;  4KLD A;  3GDX A;  4LD6 A;  1WCL A;  4E0D A;  4LDV A;  3KOO A;  3Q8L A;  1YJ9 A;  4IR1 A;  4FM4 B;  1KFD A;  5GAM j;  9ICL A;  3JCM W;  5KG5 A;  4ZGD B;  3I56 T;  4OJ6 A;  3E0F A;  3PW0 A;  3JCM d;  1IRX A;  5L1K A;  2QKQ A;  1SKS A;  4FZL A;  1NLP C;  2CGH A;  4J9B A;  1MV3 A;  1JN3 A;  4DLG A;  4JLG A;  4IUV A;  2NRW A;  2JS0 A;  5KNI A;  4FT4 A;  2XDB A;  1NK4 A;  2KDS A;  3VCB A;  1PSF A;  5KT3 A;  3CCS Q;  1PHT A;  3AT1 B;  2LZ6 B;  2BGW A;  5HY6 A;  3IV6 A;  2Y1J A;  5CRX A;  1UHC A;  2E1E A;  3PY8 A;  3MEW A;  4J9I A;  1VQP T;  4IQV A;  4XA5 A;  1B3Q A;  2CUD A;  2YWW A;  2Y4X A;  3A98 A;  2YUQ A;  5GMK i;  2RQW A;  1JJ2 A;  3PW2 A;  2KRM A;  1B07 A;  1KIK A;  1VIF A;  8AT1 B;  4LVS A;  2BZY A;  2PU9 B;  2E12 A;  4RQ0 A;  2ZIW B;  2KFZ A;  2NV3 A;  2HHW A;  4XU1 A;  1K73 U;  3UF4 A;  2KMT A;  2J6S A;  2C2E A;  4UBB A;  1M1G A;  3CD6 A;  1ZQW A;  1Y96 A;  3BDL A;  4JRK A;  1QVF S;  2IMW P;  4QZD A;  4O5C A;  5KFV A;  3RKY A;  4E47 A;  2XGP A;  4BI8 B;  4YMN A;  2QQR A;  4DL7 A;  7ICG A;  4Y2X A;  1WHL A;  4LDY A;  3JSC A;  4Y91 A;  3CCS T;  3OW2 S;  5GJW B;  2A1J B;  4RT2 A;  3TU4 K;  1MQ2 A;  1L7M A;  1AZG B;  3G7Z A;  4II1 A;  1YP5 A;  4RG2 A;  1K0S A;  4IL6 U;  4HVW A;  1EIF A;  2YN4 A;  3CCQ Q;  1YT3 A;  1S72 A;  2KZ3 A;  4M0A A;  3EFO B;  2UVW A;  5GAN f;  2E65 A;  4MDW A;  4PFO A;  3N7S C;  3GIJ A;  4Y28 E;  1M9S A;  4DQI A;  2DL3 A;  1OPK A;  3QEA Z;  4F4X A;  3HPO A;  2NO4 A;  1BU1 A;  1I8F A;  4IRK A;  2B0C A;  2P84 A;  2D0N A;  5D6Y A;  5J0Q A;  2XIC A;  1TTH B;  5EWG A;  8ICH A;  2VAS A;  4CNQ A;  1TUD A;  2H3V A;  5AKE A;  3JCM g;  1NG2 A;  3M0Q A;  3INZ A;  4KUD K;  2CSI A;  2RA2 A;  3SWN C;  3BQ7 A;  2WHE A;  4P5N A;  1YNZ A;  2M9U A;  2LCC A;  2ZPF B;  4LE9 A;  2D6F C;  2CSQ A;  4LZG A;  1VYT A;  2LX7 A;  4ELZ C;  1YJ9 T;  1S0V A;  5FLX E;  2ZGW A;  1H3Z A;  2M02 A;  4BE0 A;  1FFU A;  3HP9 A;  5DGB A;  2CKK A;  5D49 A;  4OB3 B;  3CD6 Q;  3BS7 A;  2RQT A;  3JCM Q;  1MMG A;  4M9J A;  4PL2 A;  1M90 U;  2HOI A;  7ICL A;  4HT8 A;  1ZQS A;  2D6F A;  5EWE A;  1QTM A;  1ZD2 P;  2E41 A;  2IVW A;  2QAS A;  4PH5 A;  1T3N A;  1ZBJ A;  5DLG A;  1SZP A;  2KR3 A;  2PNI A;  7ICN A;  1BBZ A;  3O5Z A;  4GIB A;  2BR0 A;  4C0D C;  1Z1V A;  4CCH A;  1D8L A;  2D3D A;  1VQM T;  1BNP A;  1RYR A;  2DAQ A;  2EZX A;  2G5I B;  1ZQA A;  1B34 B;  1S1N A;  1FYN A;  1VQ4 A;  1K9M U;  1S72 Q;  2RJF A;  1KKX A;  1ZQK A;  2K3B A;  2KSO B;  8ICU A;  4RTV A;  5DM7 R;  4QQ6 A;  2DMO A;  1LPL A;  4OCZ A;  4YQW A;  5L9X A;  2LX9 A;  5EE9 A;  5J2K A;  2V4Q A;  2WAC A;  4RNM A;  2J05 A;  3TSZ A;  2FMQ A;  3CD6 T;  3LYI A;  3QUI A;  3B0Y A;  4RQ5 A;  4LZD A;  1N63 A;  4N4G A;  4UB8 U;  4A4H A;  2K4Y A;  4ZTJ A;  1M8V A;  1L7O A;  2KVS A;  5DBB A;  4TUS A;  5CQX A;  5KYU B;  2KBT A;  1Y71 A;  2Y9T A;  3G4S A;  4B6M A;  5GAN 3;  3IG5 A;  3ER0 A;  5G5G A;  2LYA A;  5KFK A;  2IHM A;  2HSP A;  4F91 B;  4DS5 A;  5FRM A;  1TSF A;  4KLM A;  1L3V A;  3MGH A;  2V1Q A;  1F1B B;  1S72 T;  1X6G A;  1ZJM A;  2AGP A;  2FPL A;  2BPC A;  3Q8K A;  1ZJN A;  3PX4 A;  3D2S A;  4UB3 A;  2AQ4 A;  2A37 A;  3UA6 A;  3E19 A;  3V7S A;  3JB9 J;  4I2A A;  3I28 A;  1BIA A;  1WNL A;  2X9H A;  2MUT A;  3A1P A;  3HWT A;  1BPX A;  2PVO B;  5JUM A;  4ED0 A;  4I2C A;  2DXT A;  2P0K A;  4E7I A;  4M78 B;  1OW5 A;  3QUT A;  2GFU A;  4FE3 A;  2WSF E;  2ASD A;  1FO4 A;  1BYM A;  5CKD A;  5CKE A;  2YMM A;  1VQ4 Q;  3AMZ A;  2OM6 A;  1F44 A;  3LGL A;  3CP8 A;  3WKD A;  1ZQE A;  1WHK A;  1RAD B;  2KK0 A;  5KT2 A;  1ABQ A;  1BB9 A;  4QW2 A;  4R56 A;  1S76 D;  5J0W A;  3M8S A;  2KSS A;  1WQ7 A;  3R6N A;  1OOT A;  4J8O A;  1VQK A;  2Y4Y A;  4M7A A;  8ICZ A;  1WXT A;  2FPE A;  3GP8 A;  2BCV A;  4DQP A;  1KQQ A;  5DBC A;  1X75 C;  3D2Q A;  2F76 X;  2F44 A;  1F0M A;  5GAO q;  5AKY A;  2COZ A;  2E8M A;  1T4G A;  2EZZ A;  3T5J A;  2O2O A;  4OMN A;  1P92 A;  3CMA Q;  4AMC A;  4P0Q A;  4XTZ A;  4PHD A;  1YIT Q;  3CXC A;  4GC6 A;  1PD1 A;  5AM0 A;  5D4B A;  2R8I A;  5C0M A;  4GY5 A;  4F4W A;  1VQ4 T;  2CP3 A;  4O3R A;  5GAN g;  2NRZ A;  2AGQ A;  4WJ3 B;  5LJ3 j;  4NY8 A;  1SRL A;  2JTE A;  4QZC A;  4JUZ A;  8ICI A;  4M77 C;  2RM4 A;  3QG1 A;  2F1L A;  3ISC A;  2XK0 A;  3QWY A;  4F04 B;  4QZI A;  1M27 C;  1UA1 A;  1X40 A;  4CC4 B;  2RQ5 A;  2OTJ Q;  3Q8R B;  8ICS A;  3N7P D;  1YHQ Q;  4I2J A;  4YMO A;  3CC2 A;  4IKF A;  1SPK A;  5HNK A;  2NRV A;  2DA9 A;  1KN5 A;  3RFA A;  4DSK A;  4DSI A;  2MYS A;  3JB9 D;  1WFW A;  1S9F A;  5I11 A;  4BDY A;  2L5Q A;  2H3F A;  3IG8 A;  4FS1 A;  1SKU B;  2PVG B;  3EG9 A;  4KGX B;  2KAF A;  3M58 A;  3PNC A;  3TQ7 P;  5KAF U;  1GRI A;  3G4S T;  1MMA A;  1KRP A;  2V8J A;  3GQC A;  2MOX A;  5DLO A;  2FI1 A;  4Q8F A;  1KTQ A;  5A2Q E;  1CUK A;  2JMC A;  2DTO A;  2W55 A;  4PL1 A;  3GV5 B;  4M77 E;  2KIV A;  2HDA A;  1PNJ A;  1Z4N A;  5BPC A;  2WSC E;  3H8Z A;  1VQK Q;  5AI6 A;  4A4G A;  1G8X A;  3HKZ C;  4MDX A;  4J6W A;  1NNL A;  3DKM A;  5KE3 A;  3ED5 A;  1KD1 C;  2HMX A;  2C0I A;  4KH1 B;  2H3E B;  3ULR B;  4NLK A;  4ICA A;  2YSQ A;  3VUB A;  3PO4 A;  2PQW A;  1UUE A;  3N97 B;  5L23 A;  2KXD A;  5EE1 A;  4X34 A;  1PVP A;  5AIB A;  1ZQX A;  4OO1 J;  9ICI A;  2OH2 A;  1TK8 A;  4F92 B;  2VIX A;  5KFW A;  5DLF A;  1UE9 A;  3C12 A;  3CCU A;  4QZB A;  3PIO A;  2YMQ A;  4PKC C;  5LL6 S;  3C23 A;  4NM1 A;  1VQN T;  4M7A G;  2LCL A;  3K4G A;  1MC8 A;  1JRO A;  1AHJ B;  4NM2 A;  2AJQ A;  3TEE A;  3PIP A;  2XVT A;  3JPO A;  1URJ A;  4F5P A;  2BQ3 A;  4QJF B;  4PGX A;  4F2R A;  3CCV A;  1AWO A;  1R8O B;  2UVV A;  4J9L A;  1VQK T;  4IUU A;  2G3R A;  3JB9 G;  2E70 A;  2A19 A;  2HL3 A;  3CC2 Q;  2CZ7 B;  5CR2 A;  2HOF A;  2E8N A;  1ZD4 A;  3OYM A;  4QWE A;  4PHA A;  2OTL A;  3UQ2 A;  5AT1 B;  5L1L A;  2IOF K;  1U47 A;  3Q8M A;  1QMC A;  3HL8 A;  5AHX A;  2ED0 A;  3DB4 A;  3THK A;  4NXZ A;  5IIN A;  1IM4 A;  1YZ6 A;  2KRO A;  3H0I A;  4UC4 A;  1WA7 A;  2HW3 A;  3DB3 A;  4FU6 A;  1X9S A;  2EAM A;  3J80 E;  9ICU A;  2ASJ A;  5CQY A;  5GAM e;  1Q81 C;  2VA8 A;  5HML A;  2P4R A;  2Q4T A;  9ICV A;  1XWL A;  3I9Q A;  5AKX A;  2AT1 B;  1D9D A;  5JTI A;  5KFC A;  4JWN A;  1HYO A;  1DGS A;  2XU8 A;  4X9C A;  3RAQ A;  4M78 D;  4YD2 A;  2KI7 A;  4E7Z A;  2KVC A;  1K8A R;  1WLP B;  4DLE A;  4R64 A;  3ZDE A;  3JB9 I;  1YJN Q;  3RIR A;  5IIL A;  8ATC B;  3T3F A;  5J39 A;  2WF5 A;  1QVF A;  3ZDB A;  3CC2 T;  3PW7 A;  5KFU A;  4BJQ A;  1OV3 A;  3MP6 A;  4U7C A;  3OW2 A;  1WWU A;  4NOY A;  4DSJ A;  4FFD A;  3CCU Q;  2YX8 A;  4Y2Q A;  1KC8 R;  1JJ2 P;  1JRI A;  2KMD A;  3M5A A;  2B21 A;  4C8Q C;  2KN7 A;  3AUO A;  1WHJ A;  9ICM A;  2DET A;  2DJQ A;  4XRH A;  2ENM A;  2A36 A;  5GTH U;  2P0Q A;  1Q82 R;  1VQN A;  3EFS A;  5A0D A;  4B9M A;  3EPI A;  1UJ0 A;  2HQX A;  3JCM P;  3X20 B;  4Y2R A;  3WK8 A;  1ZQC A;  4KLS A;  2DL5 A;  2OTL Q;  3LWM A;  3C28 A;  1KQ2 A;  1JXL A;  1UGV A;  1T0J A;  2IPO B;  7ICJ A;  5IIO A;  4J9O A;  3RB3 A;  5L1M A;  2F8L A;  3G71 A;  1JAL A;  2AHO B;  1SIJ A;  1OQK A;  1S0N A;  2DPI A;  2BTT A;  4L5G A;  3I35 A;  2L8D A;  2DGZ A;  3EPG A;  2I6X A;  2F8K A;  3EG2 A;  4LN2 A;  5M9O A;  1QQ7 A;  2IA6 A;  4C8Q E;  1SF9 A;  4USA A;  3SZ2 A;  2A3V A;  4KBM B;  1E6G A;  1PM3 A;  2EDU A;  5H2F U;  2OWO A;  2JTM A;  3CCU T;  4FYX B;  4R66 A;  4M78 G;  1S77 D;  4KLU A;  3LX7 A;  4MZT A;  1ZXI A;  2J6O A;  1NK6 A;  2YUO A;  4M7A F;  1UGQ B;  1ZSZ B;  3KHR A;  3C1Z A;  2F2X A;  3CCV T;  4A4F A;  4XTW A;  1K73 C;  4RMO A;  3K75 D;  1LVH A;  3GLX A;  4DEZ A;  5LJ5 f;  5AM1 A;  5A0G A;  3EHR A;  1Q86 R;  3VS2 A;  2KE7 A;  3ZDD A;  2MMP A;  2Z0W A;  1WGS A;  5ALK A;  2IIM A;  4QWC A;  4ECW A;  3A8L B;  3VRY A;  4KLL A;  9ICA A;  5B5E U;  2BZF A;  4P0P A;  5AKH A;  1G3W A;  4P4P A;  2BCU A;  2NUP A;  1D8Y A;  1LOJ A;  2JXB A;  1Y7X A;  3OTQ A;  2ZXI A;  1K8A C;  4B9T A;  4RQN A;  1ZQG A;  2JNG A;  4ATO A;  4KGZ B;  3H6Z A;  2COW A;  5FU6 C;  3UPQ A;  4QZG A;  4UB5 A;  4IR9 A;  5HP4 A;  3V6K A;  1ECW A;  4M4Z A;  2JRZ A;  3NTH A;  4O3P A;  1T7P A;  2IOH A;  3GU3 A;  4OGC A;  2BCR A;  2LDM A;  2ZUB A;  2HD0 A;  2E8O A;  4US9 A;  2AZS A;  3CBO A;  2YUN A;  4WTO B;  1ED1 A;  1UHU A;  2L5Y A;  2MK5 A;  2ECZ A;  4EIK A;  4C8L A;  4M75 A;  4M77 F;  5KT7 A;  3KUF A;  3F2C A;  3E1S A;  4N0A A;  4MMK A;  2K4E A;  2FPM A;  3ME9 A;  4RZR A;  4YD1 A;  1JX4 A;  1XJW B;  3PST A;  5AIC A;  3BQ0 A;  5KL1 B;  4LDU A;  2DKZ A;  1T3Q A;  4B9S A;  4ED7 A;  1IGU A;  3H40 A;  5GAN 5;  3AU6 A;  4Q45 A;  1GCQ A;  1RXW A;  4CGZ A;  5ALN A;  2E3I A;  5KFY A;  2K7A A;  1X27 A;  1SL2 A;  3OYD A;  2C0T A;  3L2R A;  2DL8 A;  4EMK A;  1EX4 A;  4KX5 A;  1OEB A;  2RD1 A;  5III A;  4C92 C;  3PO5 A;  3L2Z A;  1BPD A;  3C5F A;  2RP5 A;  2KP7 A;  1CRX A;  4JZ3 A;  5D7U A;  2QEX Q;  3KD3 A;  1D3B B;  3BE3 A;  3E58 A;  5GAN j;  2G06 A;  5KYN A;  4O5V A;  1J97 A;  2KV2 A;  5ALT A;  2MU2 A;  3HKZ F;  1U49 A;  4CC3 A;  4LDX A;  2DFL A;  1VQO A;  3SAG A;  2BUD A;  4ESR A;  4NLZ A;  3HKS A;  5FW9 A;  4J9P A;  3G71 T;  3OSV A;  3EZ5 A;  4C4S A;  2CT3 A;  2FVU A;  2JXJ A;  1XSP A;  1ZQZ A;  1MNE A;  5LJ5 d;  1U8R A;  2PXI A;  1VYU A;  2HMA A;  4J9Q A;  2EZY A;  1N62 A;  4C92 E;  3IP4 B;  2PFN A;  1BI3 A;  1DXS A;  4EPC A;  4HAI A;  2SEM A;  7ICP A;  2BHN A;  2EGC A;  1S0M A;  2EJ9 A;  2QQS A;  2E8P A;  4RQ6 A;  1MMD A;  4DF4 A;  4RKU E;  1Q46 A;  3FYH A;  3QU5 A;  2BQR A;  1RL2 A;  4FS2 A;  1BI1 A;  2IHN A;  2BQU A;  2F69 A;  3TCJ A;  4OMP A;  2NO5 A;  3CCL A;  2LPE A;  3KKA C;  2XKO C;  1OX8 A;  4A54 A;  1UHF A;  5DB7 A;  4DFD A;  2RK2 A;  3TFR A;  9ICC A;  2Y90 A;  4M7D A;  1QWF A;  1MUZ A;  3VS1 A;  2HBJ A;  4RCC A;  1SWW A;  1KFZ A;  4JK1 A;  2FLL A;  1KD1 U;  4MF2 A;  2HNI A;  8ICX A;  3UA7 A;  4WCI A;  5GAO m;  2E4H A;  3KBG A;  3TRE A;  3VUZ A;  4M75 G;  3PSF A;  1IZ6 A;  2VUB A;  4IRC A;  2H3Z A;  4I28 A;  2DD4 A;  1RM6 C;  4F5N A;  2ZUC A;  1SGG A;  5KL8 B;  1WIE A;  5C6S A;  1VQO Q;  3FJP A;  4OMO A;  3F2B A;  5DGA A;  3M9Q A;  2EYQ A;  4ELU A;  1JXO A;  2EQY A;  2HBW A;  2EIF A;  2I0N A;  1X6B A;  3CXC P;  3GIM A;  3CXC S;  3H0H A;  4PFZ A;  4KIT B;  4GXK A;  4GLK A;  4OB2 B;  1RQL A;  1JBM A;  1NJX A;  1NJI R;  1PK1 A;  1QSS A;  2D8H A;  4TQR A;  2FRW A;  3OYC A;  2GLE A;  1I4K 1;  4EZ6 A;  5LJ3 e;  4YR3 A;  4PJO B;  1H3H A;  2BPF A;  4J9G A;  4M6W B;  3LVV A;  4RPZ A;  3E9G A;  1RAC B;  1VDV A;  3H4B A;  2W9C A;  3CME Q;  3MFH A;  5LJ5 g;  1D9F A;  3OJU A;  1VA7 A;  2JMA A;  7ICF A;  3SHW A;  2KGT A;  4ZN1 A;  2LQN A;  3HP6 A;  1Z9Q A;  2DO3 A;  4B9L A;  3MET A;  2KIW A;  3LH5 A;  4LD9 K;  2BKE A;  2XID A;  4BXO B;  2FEI A;  5KYW B;  3L2Q A;  3FJ5 A;  2QAR A;  4EEL A;  2DXU A;  1QKW A;  1Z9Z A;  1Q81 U;  1TAM A;  5KFX A;  2H3J A;  4FO6 A;  3OY9 A;  5LJ3 h;  2LC4 A;  3DLM A;  4FYW B;  5ALD A;  1S97 A;  9ICT A;  3I56 Q;  3OS5 A;  1WYX A;  2JEG A;  3DDH A;  3SB2 A;  5AKL A;  1QQJ A;  2DBK A;  2MF2 A;  2YXY A;  2M0Y A;  3M4G A;  4P2H A;  3IRU A;  2KZZ A;  2ISP A;  1NKC A;  1G3S A;  2CP5 A;  1I0C A;  5KG6 A;  3PVX A;  1N5W A;  1NYG A;  2EWN A;  2JV3 A;  2W8L A;  3V8J A;  2RB6 A;  4UB6 U;  2DD5 A;  1Q8K A;  1T94 A;  2FB7 A;  4ELY C;  4M7D G;  3REB B;  1VIE A;  4ECY A;  5ALY A;  2OAW A;  4ZOH C;  3VS0 A;  2KE9 A;  3CCL T;  1IIP A;  4RQ4 A;  4RUG A;  5C0Y A;  2YDL A;  2DUY A;  1D0Y A;  4JS5 A;  4A8E A;  4X1V A;  2XY6 A;  3MC1 A;  3S6J A;  1SKR A;  4I27 A;  1GFD A;  1B0X A;  2XY7 A;  3H8J A;  4C8N A;  2CZ1 B;  5FU7 C;  1AOJ A;  1JO8 A;  3SWN B;  3EWA A;  3LLR A;  1AWW A;  3L1A A;  1SB3 C;  2L0A A;  3NGD A;  2JTF A;  1SHG A;  2O31 A;  1LKY A;  2DJZ A;  4ECX A;  1ZUY A;  3PW4 A;  2LT1 A;  4DQQ A;  4ORZ A;  1QLY A;  4UAU A;  4QWB A;  1TG0 A;  2F1H A;  4JJC A;  5KE2 A;  2RDJ A;  3MP8 A;  1VYV A;  1R0C B;  1G3T A;  3TVT A;  3H0F A;  1VQM A;  4M9N A;  2ESW A;  1SSF A;  4QWA A;  4BY6 C;  5AI8 A;  1IXD A;  3SEM A;  4J5Y A;  4HCB A;  3NVY A;  2DYB A;  3JCM e;  5AKJ A;  1Z1B A;  2P35 A;  1ZET A;  4F71 A;  3H41 A;  5J2E A;  4C5H A;  2ZJ5 A;  4DOW A;  4OB0 B;  3SAF A;  2GTO A;  3EGU A;  3QWX X;  1VQ9 T;  8ICV A;  5CVI A;  4F5O A;  5KYX A;  4BGD A;  3RR6 A;  3RR8 A;  1XQH A;  1HJD A;  3N7R C;  2KZM A;  2W7P A;  1VQ7 A;  1W70 A;  3HSB A;  3NTU A;  1QVF P;  1G3Y A;  1TAQ A;  1NBE B;  4C92 F;  2UVR A;  2DK3 A;  2F3N A;  2NYV A;  2CS7 A;  4WF2 A;  3UAT A;  4C4T A;  4P4M A;  1T0H A;  2VC8 A;  6AT1 B;  2GQI A;  3RH6 A;  3UMG A;  1K8A U;  4L6V 5;  3V6J A;  4XTY A;  3OW2 P;  4ZN3 A;  2FE9 A;  3JCM h;  5K4L A;  1KQS S;  3OPX A;  2QB0 A;  2NRT A;  1AWJ A;  1YJ9 Q;  2FDR A;  3JCM X;  1O03 A;  8ICN A;  2DEU A;  3PSI A;  2R58 A;  2W3R A;  3UXP A;  1L8L A;  2HCK A;  3P8B B;  2QDY B;  4XTV A;  5BOM A;  3KHH A;  1KFS A;  3IN5 A;  2KY9 A;  2VGM A;  2X3W D;  3MEV A;  2LQ8 A;  5HR6 A;  4GFJ A;  1D1A A;  3QZ9 B;  3ZEH A;  2DBM A;  3EFR A;  3TAR A;  2G6F X;  4BWJ A;  5KFT A;  3MGI A;  4PPX A;  4JMU A;  2K3X A;  7ICS A;  2O4X A;  2VYT A;  1Q82 U;  1Z00 A;  2JGA A;  3UT1 A;  1B4F A;  4NL3 A;  1KFT A;  2E64 A;  2KYB A;  3JCM c;  5IH2 A;  1VQM Q;  2HSZ A;  4ELT A;  1PRM C;  2DIQ A;  2L3R A;  3AHU A;  4M7D F;  2J06 A;  4JV0 A;  5KFH A;  1NKE A;  1NM7 A;  2JM8 A;  1IHW A;  3R6O A;  4CF5 A;  3RJE A;  2IOF A;  5KG1 A;  2CDT A;  4ZGJ B;  5FWB A;  4F7U A;  3OS0 A;  2WTF A;  3NMZ C;  3ZDA A;  3DV9 A;  1M4Z A;  3O8V A;  1LNX A;  3V7L A;  2OI3 A;  3HRU A;  3M0P A;  3OYL A;  3JPQ A;  1M3B A;  1VLB A;  5DDY A;  1IXR A;  4DFM A;  2PFP A;  1COK A;  4L59 A;  1VQ7 Q;  4UAT A;  4R65 A;  3SFM A;  2YMP A;  3A0H U;  4EMG A;  4JB3 A;  3B9J A;  4F5R A;  2FJ6 A;  3FRN A;  4XQ8 A;  4R8U A;  1KSW A;  4XU0 A;  4BE1 A;  5J0S A;  4Z6C A;  4I2B A;  2VB6 A;  4IQW A;  2OJ2 A;  4HCC A;  1IHV A;  7ICM A;  4KLI A;  3T9N A;  2K5L A;  1B22 A;  2YTU A;  1KSP A;  3GFK B;  1Q86 U;  2BIV A;  1Y07 A;  2PTK A;  2JEJ A;  2RO0 A;  1JQQ A;  1L7P A;  5KFS A;  2F2W A;  1UB4 A;  2AK5 A;  3OS2 A;  2W54 A;  2LQK A;  4C7Z A;  3OSN A;  1ZX6 A;  5J0Y A;  4QWD A;  3HX0 A;  5I2M A;  1D1B A;  4OP0 A;  1VQ7 T;  5GMK m;  1YWP A;  2F5T X;  3M6Z A;  1B43 A;  2KVQ G;  4FSS A;  4DFP A;  5GAN d;  3RBD A;  1M2O A;  5J0U A;  2DKG A;  3D7S B;  3F2D A;  2ZIW A;  1OYX A;  1X6J A;  1WYG A;  3QE9 Y;  4M77 B;  2QTV A;  3HIL A;  4KMU A;  5KFG A;  4QQG A;  2I1Q A;  2X51 A;  3S3M A;  4O0I A;  3K1Z A;  1TFR A;  3MFI A;  7ICQ A;  4ZTF A;  2HZY A;  3UMC A;  4CDG A;  3GNF B;  1SZH A;  5CKF A;  2AIR B;  2BDU A;  2HCF A;  1ZA2 B;  4Y2T A;  1FFV A;  4NLC A;  2W9B B;  1NK7 A;  4CC7 A;  5DLQ E;  1SEM A;  2DER A;  4JLI A;  2RI2 A;  1K9A A;  5GAN e;  2G5H B;  4Z6F A;  4J03 A;  2J6U A;  1JXM A;  2A1J A;  1X66 A;  2ATC B;  3C95 A;  2PUO B;  3X25 B;  2KIC A;  2EJG A;  2RJE A;  1ZYQ A;  2UVU A;  4J9K A;  1X9X A;  2F77 X;  1ZQI A;  5LJ5 j;  2BE7 D;  4F7U G;  3EFO A;  2BDP A;  2ZJA A;  1NK5 A;  3VS4 A;  5KFD A;  2KYM A;  1H64 1;  4QZE A;  4M7A C;  4RPX A;  1ZA1 B;  3AU2 A;  4E7L A;  1BNO A;  9ICW A;  4OD0 A;  5T14 A;  3E9F A;  4EEN A;  2FZG B;  4UQG A;  5GAN h;  3J81 E;  5ALW A;  2R5A A;  2X4J A;  2CN1 A;  1WG8 A;  4YXM A;  1OPL A;  4E2F B;  4M9H A;  4KT0 E;  4MFA A;  1NI3 A;  2CXY A;  3C2K A;  4RG8 A;  4JRP A;  3Q8P B;  9ICJ A;  1PD0 A;  4HKE A;  4I2G A;  4E6R A;  3LYS A;  1LVK A;  3JPT A;  1TK0 A;  1JIH A;  5TZV A;  3O0F A;  2H5X A;  2VA3 A;  3G4S Q;  2GWS A;  4BDZ A;  2QGF B;  5D6W A;  5HK0 A;  2YB1 A;  4M7A E;  4NLB A;  1QQ5 A;  5KYY B;  5IAY A;  3ORY A;  4PJO A;  1GBQ A;  1NOM A;  2DVJ A;  2K4H A;  5J3B A;  3QEB Z;  2BPG A;  4KUI A;  4XTX A;  3C94 A;  4J9E A;  2MAM A;  1ZQV A;  2FL7 A;  3OGU A;  4M04 A;  4ECZ A;  2RHI A;  4YP3 A;  1JEG A;  1Z19 A;  3C4S A;  2K2M A;  2FPF A;  1U9L A;  1X43 A;  3SDZ A;  2EQJ A;  4UAV A;  5BOL A;  1B34 A;  1U1S A;  4KUL A;  1M1K R;  1ZQH A;  4DEX A;  1SG5 A;  3MP1 A;  1A76 A;  1RQN A;  2KSO A;  5AKG A;  4B9V A;  3M0R A;  1NJZ A;  1RAB B;  4VUB A;  4BAC A;  5CKH A;  4V2S A;  4OF1 A;  4O9M A;  1WHM A;  4PJO D;  2CZ6 B;  5AM3 A;  5KG4 A;  4KLF A;  3QBY A;  5AK5 A;  4ECR A;  3T5K A;  8ICF A;  2RPN A;  3QO3 A;  9ICF A;  3KTQ A;  4CRI A;  1GBR A;  2N1R A;  1N9S A;  2J6K A;  4MZM A;  4BI3 A;  1OXJ A;  2PFQ A;  2E1H A;  1JXE A;  4M9G A;  4J7I A;  5KYU A;  3HHT B;  2WAQ C;  1TKD A;  2EQK A;  3CEY A;  2RLT A;  4UBC A;  4C8Q B;  3CC4 T;  2NUT B;  2EGE A;  1QSY A;  1K1Q A;  2W9M A;  3BS5 B;  4YTL A;  2EQI A;  4FIB A;  1WUD A;  3H0L B;  8ICM A;  1BPZ A;  2R8H A;  8ICT A;  1RAF B;  2AQ0 A;  1V97 A;  1BGX T;  4M78 C;  4X5V A;  2QTX A;  4I2E A;  1U3O A;  2JJ9 A;  1VQ5 A;  3NRZ A;  3OYJ A;  2JZ2 A;  2HL5 C;  3VYG A;  4D6W A;  1WXU A;  3IHQ B;  4BX9 C;  4IUR A;  3PMN A;  1ZQQ A;  2CUB A;  2PFO A;  4DEY A;  3GIK A;  4M78 A;  1O9S A;  4JWM A;  1U5S A;  1PVQ A;  5IHI A;  2DF4 B;  2HKQ B;  1OZ2 A;  4YFK A;  1JUD A;  1NPR A;  4MHV A;  3RBE A;  3OSS C;  4IIM A;  8ICA A;  2K79 A;  5GAO p;  2LYH A;  4J9N A;  1IG6 A;  3G6E T;  2RMO A;  2DM1 A;  2L89 A;  2ODG A;  4Y2S A;  5CP2 A;  4PJO G;  4NL9 A;  2KTQ A;  2QQA A;  1J2N A;  3M0T A;  3A5Z B;  4M78 E;  2KHV A;  2ALZ A;  1X42 A;  1HD3 A;  1WZO A;  4DFJ A;  3F70 A;  1JRP A;  5IHK A;  1YZ7 A;  3BQ2 A;  4EEY A;  2XY5 A;  5HKC A;  2Q0Z X;  4JZ4 A;  4AFU C;  3KZI U;  1M3C A;  2V26 A;  3C0C A;  1PSE A;  4FBU A;  2VGN A;  1CKB A;  4J6X A;  2YRC A;  3JCM b;  4F50 A;  4B6J A;  3ISD A;  1X6I A;  1SKW A;  4RTU A;  3VRZ A;  1ABO A;  4F17 A;  7ICR A;  3CCJ A;  2MSN A;  3L4P A;  2MWO A;  5KFE A;  2FHD A;  3EW9 A;  2KOB A;  1UG1 A;  1GCP A;  3OQ5 A;  2VKQ A;  1WPY A;  3NHN A;  5FU6 B;  3OYB A;  4RQ7 A;  3GIB A;  2GFA A;  3RTV A;  3LDA A;  1D1C A;  1I81 A;  5J2F A;  2ZIX B;  1E7O A;  8ICO A;  4EBC A;  2HDO A;  2ED1 A;  2W10 A;  1H38 A;  1KQS A;  1N56 A;  4ACO A;  1ZQP A;  2B6G A;  2DYI A;  3HRS A;  9ICX A;  1C7Y A;  1VQ5 Q;  2JW4 A;  2NRX A;  3TAC B;  1YIJ A;  1D09 B;  1NEB A;  2CP6 A;  3FC4 A;  4RU9 A;  2ZTC A;  3AN1 A;  5AM4 A;  4JJB A;  3CCV Q;  3C1Y A;  2LP5 A;  2AHJ B;  1N48 A;  2M9N A;  1RG6 A;  2ZIV B;  1SV4 A;  4I29 A;  2R5M A;  1W2B S;  5TIS U;  1ZQD A;  1A0P A;  3EGD B;  3U23 A;  4DA4 A;  1X2K A;  2QLT A;  3AQE A;  3QUQ A;  4M47 A;  1KK7 A;  1Q95 G;  2FZK B;  3EG3 A;  1QP2 A;  2E3H A;  4FW1 A;  3KZX A;  4RCB A;  5ALH A;  2ZUD A;  5AKZ A;  2AZV A;  3QNM A;  3TSW A;  4C92 B;  3M57 A;  4FSX A;  3C21 A;  3V7J A;  3OHA A;  2M16 A;  4A4K A;  1HUO A;  2AKL A;  2ZPE B;  2FG0 A;  4Q44 A;  2O9S A;  3CNH A;  3I55 A;  1YI2 A;  4BDP A;  2OCE A;  3NS1 A;  1QCF A;  1VUB A;  2MRL A;  4FL6 A;  4J7F A;  3J7A F;  4Z88 A;  2JZB B;  1VQ5 T;  1Y88 A;  4OMM A;  3SI8 A;  3EGX B;  4UAS A;  1MHN A;  3IDW A;  3CCJ Q;  2EKO A;  2EBP A;  3NVW A;  1DJ7 B;  2M1H A;  1PKS A;  1TS9 A;  3KBB A;  2R57 A;  5HK3 A;  2AU0 A;  4OJP A;  4QKU A;  1C1A A;  1T8E A;  2RHY A;  3JB9 F;  3CC7 A;  1UA0 A;  3RF9 A;  1KL9 A;  2E3T A;  5FWC A;  5EOZ A;  1M90 R;  1BPE A;  4DFK A;  2DZ9 A;  3MKD A;  3MR5 A;  2D0Q B;  3RRH A;  4JV2 A;  3BY7 A;  4C5E A;  4OJL A;  3GBQ A;  3CCR A;  1F5S A;  1YIJ Q;  1NZP A;  1WDX A;  3QX7 A;  2MIO A;  2A3L A;  3F5E A;  1X01 A;  3I76 A;  4IUP A;  4JJN K;  1IB8 A;  4DO9 A;  4O3S A;  4C80 A;  1SL1 A;  2NLU A;  4M75 C;  4TVR A;  4C8Q D;  1VQN Q;  4N0A C;  3LK9 A;  3NAS A;  5KFI A;  1RAE B;  2SRC A;  3CBP A;  2R8G A;  2KXC A;  2YY6 A;  3QII A;  1K9M R;  3CCJ T;  2ISO A;  4ED2 A;  2EKH A;  4HT9 A;  3QU9 A;  5F9N A;  7ICO A;  1KC8 C;  1GCQ C;  3G71 Q;  3MR6 A;  1X69 A;  2ASL A;  7ICV A;  2A7Y A;  4I2H A;  2EPD A;  1QVG A;  5CEH A;  8ICB A;  1S5L U;  5GAO r;  4EMK C;  3M56 A;  3JCM V;  2BZ8 A;  1ARO P;  2QGG A;  2QQB A;  4KRT A;  1Q82 C;  2E5Q A;  1D8B A;  3SYZ A;  4MFF A;  4NWI A;  3I1Y A;  3KFV A;  2DQN B;  1VQL A;  5J2D A;  4M75 E;  3FC3 A;  3QKJ A;  3RJG A;  3OS1 A;  1OUQ A;  2ZIU B;  4O3Q A;  1X9W A;  1YIJ T;  5J2B A;  4PHP A;  4FZM A;  3NUQ A;  1AVZ C;  4CF3 A;  2EJF A;  4N4H A;  5KCH A;  1M2V B;  1ZQ1 A;  2DX1 A;  5ALG A;  2HSE B;  3J81 j;  1YJW A;  2DWQ A;  4HCK A;  3CPW A;  3ZDC A;  2DE0 X;  2Y9U A;  3MDA A;  4C0G A;  1ZRN A;  3EUB 2;  2GNC A;  3ZD9 A;  1BKB A;  3NTI A;  3OYI A;  2RNA A;  2WAQ F;  2A1A A;  3PV8 A;  2ES6 A;  4DBQ A;  4A53 A;  5AM5 A;  3JPS A;  1N8R R;  4RUA A;  3CCR Q;  3QHS A;  5AKI A;  1XTD A;  4PK4 A;  1QKX A;  3OYH A;  2O88 A;  1SRM A;  3I55 T;  1YI2 T;  2FO0 A;  3C5G A;  4M78 F;  2OX7 A;  1Q86 C;  4YXJ A;  1PWT A;  3HT3 A;  2JMG A;  4YN4 A;  1N5Z A;  3TQ1 A;  5KFF A;  3TFS A;  1KEJ A;  5CB1 A;  2WF8 A;  2DRM A;  2LJ3 A;  3OMC A;  3CW2 C;  3RH4 A;  3H0M B;  4QW8 A;  3OMG A;  1ZSZ C;  5I21 A;  4TUQ A;  4M7D C;  3HRT A;  3G6Y A;  1Y0M A;  3KHL A;  4KLH A;  3CC7 T;  2KEY A;  7ICK A;  8ICQ A;  2K89 A;  5DG7 A;  3Q1J A;  4A63 B;  5LJ5 e;  4AFS C;  4YG2 A;  2GOL A;  1QCK A;  1TK5 A;  2IG0 A;  2CZ0 B;  1NKB A;  1MND A;  1ZSZ A;  3OYE A;  5HMM A;  4DSL A;  5CR0 A;  2VV5 A;  3MEA A;  3CCR T;  3MO8 A;  2YLB A;  3SR6 A;  2NUZ A;  3JAM E;  2K8A A;  1I1J A;  4KLJ A;  2E5K A;  2ZTE A;  5I22 A;  2CP2 A;  4ZNX A;  1PUZ A;  1L8O A;  3JB9 H;  3PNW C;  4LNP A;  3RJF A;  2HKN A;  4E7S A;  3THV A;  4C92 D;  2HQH A;  5GTI U;  3PW5 A;  4C7Y A;  2C2D A;  4M7D E;  3M9N B;  5IT9 E;  3RBB B;  4BI4 A;  5LJ5 h;  2F2V A;  3BDP A;  1WXB A;  3JV3 A;  4FCY A;  3QZ7 A;  3L5K A;  3F53 A;  4DQS A;  2R8K A;  2XCP A;  5L1I A;  1UJY A;  2HEQ A;  2LMJ A;  5FU7 B;  4DL2 A;  2BZX A;  4RQ2 A;  4ELV A;  1U4B A;  3RMQ A;  4FBT A;  4FW2 A;  1Z4O A;  4A4E A;  4JPB W;  3P8D A;  4PJL A;  1WWV A;  1Q7Y R;  1U45 A;  4KLE A;  1V38 A;  1H8K A;  1QVP A;  3FIF A;  4FZN A;  4Y92 A;  1VQL T;  5IIK A;  2W04 A;  5DQI A;  3M4Y A;  3UMB A;  4LUE A;  4BUG A;  1UT5 A;  5CO7 A;  3QU4 A;  5J2I A;  1N9R A;  1AEY A;  2MCN A;  2V1R A;  3PVQ A;  4PHE A;  3C2L A;  4BY6 B;  4C8M A;  4EX7 A;  3JPP A;  1YJW T;  2FMP A;  3TAD C;  3GF5 A;  2MI6 A;  3AEV A;  4D8D A;  4Y2U A;  4RPY A;  1Y96 B;  1G5V A;  2FLN A;  4US8 A;  4K4G A;  4IQT A;  2HVH A;  5GAN 2;  2ATL A;  3OYK A;  3CCL Q;  5CA7 A;  1HSQ A;  2GH1 A;  1BI2 A;  3QZ8 A;  1L5U A;  3SEI A;  2K3Y A;  7AT1 B;  3OYA A;  1ARK A;  2ZAE A;  4KLT A;  1BCM A;  2HBL A;  3TAD A;  2WSE E;  2NYS A;  2RQV A;  3QYH B;  3P8H A;  5L1J A;  1D3B A;  5D6X A;  1AZE A;  2M0N A;  2VKN A;  3CPF A;  1N61 A;  3M7D A;  4PZN A;  1XU4 A;  3FEO A;  5AKK A;  5ALI A;  2JOY A;  1RI0 A;  1MQ3 A;  1V85 A;  2JH7 A;  2RN8 A;  2XI9 A;  2RI5 A;  1SXD A;  4XTU A;  1PG5 B;  1N2X A;  2F1J A;  4DWI A;  2F1I A;  1QCN A;  3M59 A;  9ICQ A;  2FPD A;  3ICX A;  3M54 A;  3RJI A;  5KFO A;  4ED6 A;  2VJ5 A;  4RT3 A;  1QLN A;  3MJX A;  2OYY A;  3M0S A;  1HK9 A;  1PZN A;  3NVV A;  3RR7 A;  3LGF A;  3WK5 A;  4G3I A;  3T79 A;  1WX6 A;  1O75 A;  3IM1 A;  8ICL A;  1M1F A;  2ZPB B;  2K4I A;  4IC9 A;  1HEK A;  1WHH A;  7ICE A; 
#chains in the Genus database with same CATH homology
 2PUK B;  2JN0 A;  4M75 F;  1NZ9 A;  3QXE B;  1KG1 A;  3RUX A;  2M0O A;  5GAO n;  4QVD A;  1M5Q 1;  1JB0 E;  1ZBX A;  2OXO A;  1NJI C;  3QYG B;  3JCM J;  3CCQ A;  4NL2 A;  5GAN 8;  3OYG A;  5CK9 A;  2K8B B;  1L6N A;  4PLI A;  4AYB C;  4C0D B;  2JH1 A;  2YHT A;  3NTK A;  2CYZ B;  3L3F X;  1N6A A;  3MHX A;  1W2B A;  3VKI A;  4NV0 A;  2DIG A;  4C0Z A;  3OB9 A;  1VQ8 A;  2LVM A;  1GO3 F;  3LWI A;  4DOV A;  1P7D A;  2G08 A;  2CPR A;  3C29 A;  4PLL A;  3ASK A;  2JUF A;  1UGR B;  1ZHI A;  4OJO A;  1KC8 U;  2RHF A;  2F5K A;  3EAE A;  4Z02 A;  3RER A;  2LRQ A;  2OAU A;  1I5L A;  1QP3 A;  2KJ9 A;  2ZCF B;  2ZPG B;  5J26 A;  5GMK j;  1FX7 A;  3SMV A;  3MEU A;  2PMZ C;  2KD1 A;  3WVD B;  3CCM A;  2DVE A;  4M7A B;  1UGP B;  5CKB A;  1TH7 A;  4F7U E;  3MGV A;  4KX3 A;  2V8I A;  3BW1 A;  2ZPI B;  3LW5 E;  3FB9 A;  2E6N A;  3RES A;  3SWN A;  4P0Q B;  3CCQ T;  4X9D A;  3OYY A;  4JRQ A;  2XHC A;  1YBY A;  5CAI A;  3SAH A;  2HBK A;  3HFO A;  3PTA A;  2DPP B;  3X26 B;  3HFN A;  2DTH A;  1U1T A;  1WJS A;  5GAN 4;  1XNS A;  1YCY A;  1QVG S;  3UPU A;  4ZGE B;  4FT2 A;  4B9W A;  2Y0S C;  2W03 A;  1VQ8 T;  4OGE A;  4EDU A;  5GAN 7;  5FRO A;  1HIW A;  4O3M A;  3OBW A;  2ZXH A;  5KH6 A;  1XOV A;  2QA4 A;  2GCX A;  3DLL A;  3S6W A;  3A8H B;  3WVE B;  3CPW S;  3V7R A;  2MWP A;  3CMA A;  3CC4 A;  1YIT A;  3NFC A;  4JUV A;  2X4X A;  1VQ6 A;  3PSP A;  3NRW A;  3AL0 B;  1V29 B;  3LVW A;  3PMI A;  2RH2 A;  3QSU A;  1N8R U;  2OTJ A;  3X28 B;  1YHQ A;  4KMO B;  3QDR B;  3CCM T;  4PJO C;  3GPL A;  2G07 A;  4QIW C;  2RJD A;  1Q3U A;  3QJ6 A;  2KHQ A;  3V7C A;  2H3Q A;  3M55 A;  4U6P A;  2RRD A;  2LT4 A;  3KXT A;  4QNL A;  2X4W A;  4PNO A;  3S3O A;  4PJO E;  4AYB F;  2WB1 C;  3QJY A;  3G6E A;  5GAM f;  4XK8 E;  3VJP A;  4C5I A;  5FRN A;  4O6J A;  3H0R B;  3A8G B;  4BE2 A;  3AQF A;  2HOQ A;  4M7A D;  4JRI A;  2XD0 A;  3KFU F;  2LNV A;  4XAX B;  1BI0 A;  1Q7Y U;  2QA4 T;  1NJI U;  4M77 A;  3L42 A;  2KKV A;  3RMS A;  3CMA T;  1YIT T;  3ONN A;  3CYM A;  4JDS A;  4F7U F;  2KQW A;  1VQ6 T;  2RJC A;  2RHX A;  3BDU A;  1YJN A;  1MA7 A;  2OTJ T;  1YHQ T;  4M77 D;  3GOX A;  1A6S A;  5AYF A;  2PMZ F;  2VXE A;  3VV0 A;  1X6O A;  3LWH A;  2K2V A;  3A8M B;  5A0L A;  4P0P B;  3SD4 A;  3FLG A;  5GAO l;  2EAY A;  2QQ9 A;  1Q3V A;  3UWN A;  5GAM d;  3V8L A;  3UDC A;  2JVV A;  2RI3 A;  1M1K C;  3N5B B;  1OZ3 A;  1KBU A;  3WXM B;  1N27 A;  3M53 A;  2QI2 A;  2K5F A;  4M75 B;  2VJ4 A;  3G6E T;  3DEE A;  4HCZ A;  2G09 A;  3RKW A;  2YB4 A;  1UEB A;  2DTI A;  3RKX A;  4NS5 A;  4E7H A;  2KJ8 A;  2Y0S F;  4LDW A;  1KHC A;  1KHI A;  2KJ5 A;  4M77 G;  3PMT A;  4EMK B;  4BB7 A;  2P4T A;  2YLC A;  2LBO A;  5GAM h;  3CRX A;  2VXF A;  1JJ2 S;  5DY9 A;  2HQE A;  3SQI A;  2E5S A;  3OA6 A;  2K57 A;  3QPH A;  4C8Q A;  1UPH A;  4ME7 A;  5HR7 A;  3VYH B;  1YJN T;  2MA1 A;  4QVZ A;  1W4S A;  5KCO A;  2K8C B;  4C0F A;  5GAM g;  3FDR A;  4DQ2 A;  2ZG6 A;  2EFI A;  4PJO F;  1BIB A;  4QIW F;  3URG A;  4M7D B;  2DXC A;  5GMK e;  2KNJ A;  3S3N A;  3D2N A;  4OB1 B;  2QEX A;  1OI1 A;  2CRX A;  1MGQ A;  4XQ3 A;  2OTL T;  2KKP A;  3ZBD A;  1NE8 A;  2Z7J A;  2HBM A;  2X35 A;  2YRV A;  1DRG A;  3V8K A;  5CIU A;  2WB1 F;  1ZQ1 C;  5GMK h;  2F2A B;  2DEQ A;  3HPW A;  2GF7 A;  2GQV A;  2LTO A;  1FWZ A;  2K5I A;  3X24 B;  3OYF A;  4C5G A;  2ZIX A;  2P0P A;  5L8R E;  2W7O A;  2PVD B;  5LJ3 f;  4JS4 A;  3CCE A;  5IN1 A;  2DXB A;  2XG8 D;  4C8Q G;  4HA8 A;  2ZIV A;  2LYB A;  1XNI A;  3PFS A;  4M75 D;  1M90 C;  2HBP A;  4C92 A;  3JRZ A;  3CBM A;  2H3I A;  3LH0 A;  1GXI E;  2V8K A;  3MCA B;  4OVA A;  2O01 E;  1QW1 A;  3VU3 C;  4J83 A;  3L2W A;  1PVR A;  5EG2 A;  1K9M C;  2RK1 A;  3GZF A;  3VC8 A;  4IUQ A;  4B9X A;  2RHZ A;  2QEX T;  3OYN A;  1NPP A;  3CME A;  2B8A A;  2JHD A;  5I2S A;  2ZPH B;  4J6Y A;  4XU3 A;  4N4I A;  3PZP A;  2BKD N;  4QQD A;  3I56 A;  4Q5W A;  2HAX A;  1VQ9 A;  4PL6 A;  4MZP A;  2EQU A;  5LJ3 d;  5GMK l;  2E6Z A;  1WQW A;  3GNG A;  3PT9 A;  1NZB A;  1N8R C;  2G0A A;  1LJO A;  1VQP A;  3F5A A;  3JCM f;  4M7D D;  2ZZD A;  2ZIU A;  2D9T A;  1XO0 A;  1FXX A;  3CCE T;  2RHU A;  2QXF A;  2FYK A;  2C06 A;  2LKY A;  4E7J A;  4C8Q F;  1M1K U;  4OMF B;  4C92 G;  2KK4 A;  2DZC A;  2LHT A;  3L2V A;  3QZ5 B;  5CCA A;  3A8O B;  1VQO T;  1UGS B;  3BFM A;  4R55 A;  3CCS A;  1IRE B;  2XDP A;  3ALR A;  4IUT A;  4CRX A;  2O4X B;  5GAN 6;  2R18 A;  1KQ1 A;  4MML A;  3ZFJ A;  4OJ5 A;  4CI0 C;  1HXD A;  4XU2 A;  2XDD A;  3M6K A;  4BD3 A;  3OBY A;  2X4Y A;  3PGG A;  4F7U B;  2EQM A;  4QVC A;  3CME T;  2E1F A;  1WJQ A;  2I2L A;  2E10 A;  1WJR A;  1Q7Y C;  4EMH A;  5LJ3 g;  3L2U A;  4E7K A;  4LD6 A;  4LDV A;  1YJ9 A;  4FM4 B;  5GAM j;  3JCM W;  4ZGD B;  3I56 T;  4OJ6 A;  3E0F A;  3JCM d;  1VQ9 T;  4FZL A;  2CGH A;  4JLG A;  4IUV A;  4FT4 A;  2XDB A;  2KDS A;  3VCB A;  1PSF A;  5HY6 A;  3MEW A;  5CRX A;  1VQP T;  2E1E A;  2Y4X A;  5GMK i;  1JJ2 A;  1VIF A;  2PU9 B;  2E12 A;  2ZIW B;  2NV3 A;  4XU1 A;  1K73 U;  2KMT A;  1M1G A;  3CD6 A;  1Y96 A;  3BDL A;  4JRK A;  1QVF S;  3RKY A;  4E47 A;  4BI8 B;  2QQR A;  4LDY A;  3OW2 S;  3JSC A;  4Y91 A;  3CCS T;  3TU4 K;  3G7Z A;  4II1 A;  4RG2 A;  1EIF A;  1YT3 A;  1S72 A;  5GAN f;  2E65 A;  4MDW A;  3N7S C;  4Y28 E;  1M9S A;  1I8F A;  5D6Y A;  2XIC A;  2H3V A;  3JCM g;  3INZ A;  4KUD K;  2RA2 A;  3SWN C;  4P5N A;  2M9U A;  2LCC A;  2ZPF B;  2D6F C;  4ELZ C;  1YJ9 T;  5FLX E;  2ZGW A;  1H3Z A;  4BE0 A;  3HP9 A;  2CKK A;  4OB3 B;  3JCM Q;  4PJO B;  4PL2 A;  1M90 U;  2HOI A;  4HT8 A;  2D6F A;  2E41 A;  2IVW A;  4C0D C;  1VQM T;  2DAQ A;  2G5I B;  1B34 B;  1VQ4 A;  1K9M U;  2RJF A;  5DM7 R;  4QQ6 A;  2LX9 A;  2WAC A;  3CD6 T;  3LYI A;  3QUI A;  4N4G A;  4A4H A;  2K4Y A;  4ZTJ A;  1M8V A;  5CQX A;  1Y71 A;  3G4S A;  5GAN 3;  3IG5 A;  3ER0 A;  2LYA A;  5FRM A;  1S72 T;  3D2S A;  3V7S A;  3E19 A;  3JB9 J;  1BIA A;  1WNL A;  2PVO B;  4E7I A;  2DXT A;  2P0K A;  4M78 B;  2GFU A;  4FE3 A;  2WSF E;  1BYM A;  5CKD A;  5CKE A;  2OM6 A;  1F44 A;  3LGL A;  3CP8 A;  4QW2 A;  4R56 A;  2KSS A;  1WQ7 A;  4J8O A;  1VQK A;  2Y4Y A;  4M7A A;  3GP8 A;  1X75 C;  3D2Q A;  2F76 X;  5GAO q;  1P92 A;  4P0Q A;  4XTZ A;  3CXC A;  5C0M A;  4GY5 A;  1VQ4 T;  5GAN g;  4WJ3 B;  5LJ3 j;  4M77 C;  2RM4 A;  3QG1 A;  2XK0 A;  3N7P D;  3CC2 A;  4IKF A;  3RFA A;  3JB9 D;  4BDY A;  2L5Q A;  2H3F A;  3IG8 A;  2PVG B;  2KAF A;  3M58 A;  3G4S T;  2V8J A;  5DLO A;  5A2Q E;  2DTO A;  4PL1 A;  4M77 E;  2WSC E;  3H8Z A;  4A4G A;  4MDX A;  3HKZ C;  4J6W A;  5KE3 A;  3DKM A;  1KD1 C;  2HMX A;  4ICA A;  3VUB A;  2PQW A;  4X34 A;  1PVP A;  4OO1 J;  2OH2 A;  2VIX A;  3C12 A;  3CCU A;  3PIO A;  4PKC C;  5LL6 S;  4M7A G;  2LCL A;  1AHJ B;  3TEE A;  3PIP A;  2XVT A;  1URJ A;  3CCV A;  4QJF B;  1R8O B;  1VQK T;  4IUU A;  2G3R A;  3JB9 G;  2E70 A;  2CZ7 B;  5CR2 A;  2HOF A;  3OYM A;  2OTL A;  3HL8 A;  3DB4 A;  4UC4 A;  3DB3 A;  4FU6 A;  3J80 E;  5CQY A;  5GAM e;  1Q81 C;  2Q4T A;  2XU8 A;  4X9C A;  4M78 D;  2KVC A;  3JB9 I;  3RIR A;  5J39 A;  1QVF A;  3CC2 T;  4BJQ A;  3MP6 A;  4U7C A;  3OW2 A;  4NOY A;  2YX8 A;  1JRI A;  3M5A A;  4C8Q C;  2P0Q A;  1VQN A;  3EFS A;  5A0D A;  3JCM P;  2HQX A;  3X20 B;  1KQ2 A;  3C28 A;  3G71 A;  2F8L A;  4L5G A;  2L8D A;  2DGZ A;  5M9O A;  4C8Q E;  2A3V A;  4KBM B;  2JTM A;  3CCU T;  4M78 G;  3LX7 A;  4MZT A;  4M7A F;  1UGQ B;  3CCV T;  4A4F A;  4XTW A;  1K73 C;  4RMO A;  3GLX A;  5LJ5 f;  5A0G A;  2MMP A;  1WGS A;  3A8L B;  4P0P A;  1G3W A;  1LOJ A;  1Y7X A;  2ZXI A;  1K8A C;  2JNG A;  4ATO A;  3H6Z A;  5FU6 C;  1ECW A;  3NTH A;  3GU3 A;  4OGC A;  2LDM A;  3CBO A;  2HD0 A;  1ED1 A;  4M75 A;  4M77 F;  3KUF A;  3F2C A;  3E1S A;  4N0A A;  4MMK A;  2K4E A;  3ME9 A;  3PST A;  4LDU A;  5KL1 B;  5GAN 5;  4CGZ A;  3OYD A;  3L2R A;  4EMK A;  4KX5 A;  2RD1 A;  4C92 C;  1VQN T;  3L2Z A;  1CRX A;  2RP5 A;  1D3B B;  5GAN j;  2G06 A;  4O5V A;  2KV2 A;  3HKZ F;  4LDX A;  1VQO A;  3SAG A;  2BUD A;  3HKS A;  3G71 T;  3OSV A;  2FVU A;  5LJ5 d;  1U8R A;  4C92 E;  3IP4 B;  1BI3 A;  4EPC A;  2EJ9 A;  2QQS A;  4RKU E;  1RL2 A;  1BI1 A;  2F69 A;  3TCJ A;  3CCL A;  2XKO C;  4A54 A;  2RK2 A;  2Y90 A;  4M7D A;  2HBJ A;  4RCC A;  1KD1 U;  2HNI A;  5GAO m;  3KBG A;  3TRE A;  3VUZ A;  4M75 G;  3PSF A;  1IZ6 A;  2VUB A;  2H3Z A;  2DD4 A;  5KL8 B;  5C6S A;  3FJP A;  3F2B A;  3M9Q A;  2EYQ A;  2EIF A;  3CXC S;  4GLK A;  4OB2 B;  1JBM A;  3OYC A;  1I4K 1;  5LJ3 e;  3LVV A;  3E9G A;  5LJ5 g;  4ZN1 A;  2DO3 A;  3MET A;  2KIW A;  4LD9 K;  2XID A;  3L2Q A;  2DXU A;  1Q81 U;  1TAM A;  2H3J A;  3OY9 A;  5LJ3 h;  2LC4 A;  3DLM A;  3OS5 A;  3SB2 A;  3M4G A;  2MF2 A;  1G3S A;  2EWN A;  3V8J A;  2RB6 A;  2DD5 A;  1T94 A;  2FB7 A;  4ELY C;  4M7D G;  1VIE A;  3CCL T;  1IIP A;  5C0Y A;  4JS5 A;  4A8E A;  2CZ1 B;  5FU7 C;  3SWN B;  3LLR A;  3L1A A;  2JTF A;  2DJZ A;  2LT1 A;  5KE2 A;  3MP8 A;  1G3T A;  1VQM A;  1SSF A;  4BY6 C;  4J5Y A;  4HCB A;  3JCM e;  1Z1B A;  4C5H A;  4DOW A;  4OB0 B;  3SAF A;  5CVI A;  1XQH A;  3N7R C;  2W7P A;  1VQ7 A;  3HSB A;  1G3Y A;  4C92 F;  2DK3 A;  4WF2 A;  2CS7 A;  2VC8 A;  1K8A U;  4L6V 5;  4XTY A;  4ZN3 A;  3JCM h;  1KQS S;  3OPX A;  3JCM X;  3PSI A;  2R58 A;  3P8B B;  2QDY B;  4XTV A;  2VGM A;  3IN5 A;  2KY9 A;  3MEV A;  2LQ8 A;  5HR6 A;  4GFJ A;  3QZ9 B;  3ZEH A;  3EFR A;  2K3X A;  1Q82 U;  4JMU A;  2VYT A;  2O4X A;  2JGA A;  3UT1 A;  4NL3 A;  2E64 A;  3JCM c;  3AHU A;  2L3R A;  2DIQ A;  4M7D F;  3R6O A;  4ZGJ B;  4F7U A;  3OS0 A;  1M4Z A;  3O8V A;  1LNX A;  3OYL A;  3HRU A;  4L59 A;  3SFM A;  4EMG A;  3FRN A;  4XU0 A;  4BE1 A;  4HCC A;  3T9N A;  2K5L A;  1Q86 U;  2BIV A;  1Y07 A;  2RO0 A;  1UB4 A;  3OS2 A;  2LQK A;  5I2M A;  4OP0 A;  1VQ7 T;  5GMK m;  2F5T X;  3M6Z A;  2KVQ G;  5GAN d;  2DKG A;  3F2D A;  2ZIW A;  1OYX A;  4M77 B;  4QQG A;  3S3M A;  3K1Z A;  4ZTF A;  4CDG A;  3GNF B;  1SZH A;  5CKF A;  2BDU A;  4NLC A;  5DLQ E;  4JLI A;  2RI2 A;  5GAN e;  2G5H B;  3X25 B;  3C95 A;  2PUO B;  2KIC A;  2EJG A;  2RJE A;  2F77 X;  5LJ5 j;  4F7U G;  1H64 1;  4M7A C;  4E7L A;  5T14 A;  3E9F A;  5GAN h;  3J81 E;  2R5A A;  2X4J A;  2CN1 A;  4KT0 E;  4RG8 A;  4JRP A;  4HKE A;  3LYS A;  3O0F A;  4BDZ A;  5D6W A;  5HK0 A;  2YB1 A;  4M7A E;  4NLB A;  5IAY A;  4PJO A;  2K4H A;  5J3B A;  4KUI A;  4XTX A;  3C94 A;  2MAM A;  2FL7 A;  2RHI A;  1Z19 A;  3C4S A;  3SDZ A;  2EQJ A;  1U1S A;  1B34 A;  4KUL A;  3MP1 A;  4VUB A;  4BAC A;  5CKH A;  4V2S A;  4OF1 A;  4PJO D;  2CZ6 B;  3QBY A;  3QO3 A;  4CRI A;  2N1R A;  1N9S A;  4MZM A;  4BI3 A;  2E1H A;  4J7I A;  3HHT B;  2WAQ C;  2EQK A;  3CEY A;  4C8Q B;  3CC4 T;  4YTL A;  4FIB A;  1WUD A;  3H0L B;  4M78 C;  2QTX A;  1VQ5 A;  3OYJ A;  2JZ2 A;  3VYG A;  4D6W A;  4BX9 C;  4IUR A;  4M78 A;  1O9S A;  1PVQ A;  2DF4 B;  1OZ2 A;  1NPR A;  5GAO p;  3OSS C;  2L89 A;  4PJO G;  2QQA A;  3A5Z B;  4M78 E;  2KHV A;  3F70 A;  5HKC A;  1PSE A;  2VGN A;  4J6X A;  3JCM b;  3CCJ A;  2MWO A;  2FHD A;  2KOB A;  3OQ5 A;  2VKQ A;  1WPY A;  5FU6 B;  3OYB A;  3GIB A;  2GFA A;  1I81 A;  2ZIX B;  1KQS A;  4ACO A;  3HRS A;  1YIJ A;  2AHJ B;  2ZIV B;  2R5M A;  1W2B S;  1A0P A;  4DA4 A;  3AQE A;  1QP2 A;  4RCB A;  3KZX A;  4C92 B;  3M57 A;  4FSX A;  4A4K A;  2M16 A;  2ZPE B;  3I55 A;  1YI2 A;  1VUB A;  4FL6 A;  2MRL A;  4J7F A;  3J7A F;  1VQ5 T;  1MHN A;  2EKO A;  1DJ7 B;  2M1H A;  2R57 A;  5HK3 A;  4OJP A;  2RHY A;  3JB9 F;  3CC7 A;  3RF9 A;  2DZ9 A;  2D0Q B;  3BY7 A;  4C5E A;  4OJL A;  3CCR A;  2A3L A;  3F5E A;  1X01 A;  4IUP A;  4JJN K;  4TVR A;  2NLU A;  4M75 C;  4C8Q D;  4N0A C;  3CBP A;  3QII A;  3CCJ T;  4HT9 A;  1KC8 C;  2A7Y A;  1QVG A;  5GAO r;  4EMK C;  3M56 A;  3JCM V;  2QQB A;  1Q82 C;  2E5Q A;  1D8B A;  4NWI A;  2DQN B;  1VQL A;  4M75 E;  3FC3 A;  3QKJ A;  3OS1 A;  1OUQ A;  2ZIU B;  1YIJ T;  4FZM A;  3NUQ A;  2EJF A;  4N4H A;  5KCH A;  1ZQ1 A;  1YJW A;  3CPW A;  4C0G A;  1BKB A;  3NTI A;  3OYI A;  2WAQ F;  4A53 A;  3QHS A;  1XTD A;  3OYH A;  3I55 T;  1YI2 T;  4M78 F;  1Q86 C;  2JMG A;  3OMC A;  3H0M B;  3OMG A;  5I21 A;  4M7D C;  3HRT A;  3CC7 T;  2KEY A;  2K89 A;  3Q1J A;  5LJ5 e;  2GOL A;  2IG0 A;  2CZ0 B;  3OYE A;  2VV5 A;  3MEA A;  3CCR T;  3MO8 A;  2YLB A;  3JAM E;  2K8A A;  3JB9 H;  3PNW C;  4C92 D;  4M7D E;  5IT9 E;  4BI4 A;  5LJ5 h;  3F53 A;  5FU7 B;  3RMQ A;  4A4E A;  3P8D A;  1QVP A;  3FIF A;  4FZN A;  1VQL T;  2W04 A;  3M4Y A;  4BUG A;  5CO7 A;  1N9R A;  4BY6 B;  1YJW T;  3GF5 A;  2MI6 A;  1Y96 B;  1G5V A;  5GAN 2;  3OYK A;  2GH1 A;  1BI2 A;  3OYA A;  2K3Y A;  2HBL A;  2WSE E;  3QYH B;  3P8H A;  1D3B A;  5D6X A;  2M0N A;  3CPF A;  3M7D A;  3FEO A;  2JOY A;  1RI0 A;  2JH7 A;  2XI9 A;  2RI5 A;  4XTU A;  3M59 A;  3ICX A;  3M54 A;  2VJ5 A;  2OYY A;  1HK9 A;  3LGF A;  3T79 A;  1O75 A;  2ZPB B;  1M1F A;  2K4I A;  4IC9 A;  1HEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...