4C0ZA

The n-terminal domain of the streptococcus pyogenes pilus tip adhesin cpa
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
SVPNKQSSVQDYPWYGYDSYSKGYPDYSPLKTYHNLKVNLDGSKEYQAYCFNLTKHFPSKSDSVRSQWYKKLEGTNENFIKLADKPRIEDGQLQQNILRILYNGYPNDRNGIMKGIDPLNAILVTQNAIWYYTDSSYISDTSKAFQQEETDLKLDSQQLQLMRNALKRLINPKEVESLPNQVPANYQLSIFQSSDKTFQNLLSAEYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANCILLARY PROTEIN 2
publication title Structural Model for the Covalent Adhesion of the Streptococcus Pyogenes Pilus Through a Thioester Bond.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 68
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.480 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4c0zA02
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0zA01
4BUGA 4C0ZA 5A0GA 2XIDA 2XICA 5A0LA 2XI9A 5A0DA
chains in the Genus database with same CATH superfamily
2LYAA 4XTZA 3BFMA 1OUQA 3ZDEA 5CKEA 1SKUB 2FDRA 7ICLA 4ICAA 2CZ6B 4EENA 5L1MA 1UA1A 3RJJA 2FPLA 4FS2A 4G9BA 1T0JA 4E47A 2F2AB 2Q4TA 2DAQA 1CUKA 4UC4A 4EMKB 4IL6U 3TACB 1TV9A 5F9LA 4FSSA 3SDZA 4BDPA 4M7AD 4Y91A 2IOHA 4OJ5A 2ODGA 2VC8A 3VS3A 4A4KA 4M7DC 4KLJA 4M75D 2HBJA 3S6JA 5GAN8 1HK9A 2FB7A 3JCMe 1LKYB 2BHNA 2ZIXB 4MHVA 1QP2A 4B6JA 3KHLA 1X2KA 4DL4A 1T8EA 5KAFU 2FLLA 4C92B 2OTLQ 5ALXA 5KFYA 4BGDA 3F2DA 1ZQLA 2BR0A 4D8KA 1VQKA 1QLNA 1VQPA 2LHTA 5A0GA 4KLHA 1Z4OA 2HKNA 1DJ7B 1WYGA 4JJNK 3OYMA 1T7PA 3QZ8A 1RYRA 8ICTA 4RKUE 4O3OA 4RTTA 1UHCA 1C20A 3ZI4A 1HXDA 4BI3A 2EVRA 2FLNA 4NLCA 3CC2Q 4FT2A 4OO1J 1M2OA 3JCMc 2L3SA 3E9GA 2JN0A 1ZSZB 4P0QA 2CT3A 3EH1A 2ZAEA 5CAIA 3RR7A 2RLTA 2CT4A 2J6KA 2AH5A 2NWMA 3TAQA 4FYWB 5DM7R 4LUDA 1WQWA 4PJOC 4M7AA 4BE1A 5AI5A 1AWXA 3L2QA 3BQ7A 1V29B 2FL7A 1Q86C 4Z8AA 3C23A 3JV3A 4M75A 4QVDA 4KGZB 1YT3A 5DLQE 4JPBW 3QU9A 2QEXQ 5E79U 2WB1F 2RO0A 5GMKh 2NLUA 1TTHB 3GIBA 4YR3A 2BCSA 1VQ7Q 2LM1A 3V7JA 4NV0A 1KSPA 2F2XA 3VU3C 4KN7A 1L7PA 4AMCA 2MCNA 5GAOm 3TQ1A 4YXJA 5KFDA 4DFJA 5AK4A 4M4ZA 1NK8A 2OXOA 2BKDN 2R8HA 1GXIE 4J9EA 4AT1B 3VS2A 5IHKA 2AHJB 2BIVA 4M78B 2R8KA 4JRIA 2FMQA 4QIWC 2CP5A 2FO0A 3IN5A 3HW8A 1BPEA 2JZBA 2HVIA 4JDSA 4M77G 4LDWA 4Z89A 4E7HA 2PFNA 4I2CA 1SGGA 3JCMd 1BPXA 1SB3C 5LL6S 4C8OA 2P6RA 4C8QE 2FVUA 3ZL7C 1HJPA 4JV0A 5GANg 2EAPA 5K4LA 4F4XA 2ZUDA 4FBUA 2HL5C 2K4EA 1KIKA 5FWCA 3PO5A 4P5NA 1RL2A 1ZRNA 2F5TX 3H41A 3MC1A 3OS2A 1RUWA 5ALVA 2I5HA 1MV0B 4F4WA 2HOIA 2QQSA 5KG5A 4M9HA 1Z9QA 4KLUA 2DILA 3ULRB 1RM6C 3V7LA 3SV4A 1WQ7A 5KFVA 8ICWA 1Q8KA 5GJWB 2V8JA 5HCKA 2KEYA 3EGDB 3M4GA 3MFIA 1X43A 1QWEA 3EW9A 1IHVA 4D6WA 9ICLA 1VQ9Q 2OM6A 1KSWA 3C1YA 3M58A 3GFKB 2RH2A 2LT1A 3L2RA 2P6UA 3ZDDA 4JWNA 1KC8R 2AQ0A 1G3WA 2F3NA 3N7RC 3U26A 1CKAA 2CP6A 4P2HA 1TSFA 2L3QA 4BY6B 5D7UA 4DQRA 4R8UA 4KBMB 3J7AF 2JMAA 4RG8A 2CN1A 5KT2A 2JGAA 8AT1B 4A4FA 5L9XA 2V1RA 7ICMA 3QUTA 3H4BA 2RQUA 3TADA 1PNJA 2CUBA 5GJVB 1YI2Q 2W7OA 1UB4A 1G3TA 4P0QB 3GIIA 2LZ6B 5DLOA 3E58A 1AZGB 4FW2A 3I35A 2YB1A 5J2CA 1L3VA 2RK1A 1Q46A 4HCBA 3DB4A 5AK3A 3RRGA 2KY9A 2KVQG 4E7JA 4DOVA 1VJ5A 3SI8A 4HYKA 1UGSB 1CRXA 1QQ5A 3CW2C 2XGPA 1XSNA 2RM4A 3HX0A 4RTYA 3OYNA 3CC4T 1X66A 2C2EA 3NFCA 2HCFA 5J2EA 1O75A 3J80E 3PX0A 1X6JA 1G2BA 5DDMA 4CGZA 4F4YA 4II1A 3RJKA 2KZ3A 2DXUA 2AKLA 1Y7XA 3PT9A 1WWUA 2EZZA 2JHDA 3RRHA 4EZ9A 4PGYA 3REBB 1U3OA 4XQ3A 1PK1A 1Z00A 3ICXA 2VVKA 3X28B 3G4SA 5DQHA 3TKAA 1UGPB 5IIKA 1SV0C 4ZNXA 1M3CA 5L1KA 2QLTA 3P8HA 2EAYA 4PL6A 3SD4A 3PW4A 4DSLA 4I2EA 5KG0A 4MFFA 1Z19A 3INZA 1T3QA 1ZOLA 2JOYA 3CCRT 2FJ6A 2CP2A 5GMKe 3IHQB 4QJFB 1A6SA 1MNDA 1T3LA 1YIJA 4K4GA 1M90R 4LDXA 2KICA 1IXRA 5J26A 3QWYA 3JCMg 5J0QA 2BQRA 1K73R 3BDUA 4OMOA 3CCJA 4KX5A 9ICBA 4YCXA 1B0XA 1KG1A 2H3QA 2W8LA 1K1SA 2EYXA 1QKXA 2O9VA 4DBFA 2BGWA 4Q45A 4F91B 2VA8A 1GFCA 1M9SA 1Y0MA 2RB6A 3UWNA 3VUZA 1TAMA 5KFSA 1PRLC 2DD5A 3CD6T 3ASKA 3JPQA 2DBKA 1BYMA 5GAOn 7ICFA 2G09A 3OYDA 3SWNC 3ZDBA 3ORYA 5J29A 3TANA 1ZJNA 4I2JA 2JEJA 1QVPA 1VQLA 2XMFA 4RT3A 1SL0A 3QG1A 4X9CA 3QYHB 2RDJA 4BB7A 4YD2A 2HL3A 4M78G 2KG5A 3I55Q 4OMPA 2KK0A 3BS7A 3L42A 2KFNA 3JCMV 1UG1A 2LJ3A 4NL9C 4PHDA 2JXBA 5KFUA 3F5EA 2J7IA 2VWFA 2ZPEB 3CC7A 4C7YA 9ICXA 1YN8A 1N5WA 1SKWA 8ICEA 3SZ2A 4DOAA 3EG9B 4FU6A 3DLLA 3KOOA 7AT1B 4R8UB 2FPMA 2FRYA 1OV3A 3OYLA 5EOZA 4QW9A 8ICNA 4KH0B 2RQVA 5M9OA 3DV9A 4RQ6A 4DF8A 3BDPA 1U4BA 5G5HA 1O03A 1M5Q1 1SZPA 4M9NA 3OYGA 3QKJA 4F14A 3QX7A 4KRTA 2WF5A 4QZHA 3EZ5A 5GAOr 1LOJA 4C5EA 2HHQA 1QWFA 3HHTB 1QMCA 1M8VA 4B9LA 1Z4NA 1DK2A 1JEGA 2DETA 1UFFA 1ZQFA 3HRTA 4ACOA 4OJPA 4M7DF 3QXEB 1ZXIA 1M1GA 2XICA 3P8BB 4B9UA 3N7SC 1JI7A 1N48A 5ALKA 2O31A 1A0NB 1RXWA 3WK4A 4RQ2A 1QTMA 2M16A 3TQ7P 1FEZA 1N8RU 3K1ZA 3T5LA 5KT7A 1UA0A 1PK1B 1RDFA 1Z00B 5KFWA 3UQ2A 1IB8A 2E65A 1JJ2S 3NRZA 4XTYA 1FX7A 2BUDA 2KEAA 1F44A 1DGSA 3WVDB 2OHFA 5GAOl 1I8FA 4F4KA 2O01E 1M1FA 1GFDA 2P0KA 2GH1A 2A37A 2XG8D 2HOQA 9ICOA 1QSYA 4OGEA 3CCQT 5J0SA 1D8BA 3A8OB 2P66A 2QK0A 1X2QA 4LXCA 1ZQBA 2YMLA 2FI1A 4NXZA 1L6NA 2R58A 4QZ9A 5GAMh 3BS5A 4RNNA 2CPRA 4J9GA 4XK8E 4PJOF 1JJ2A 4KGVB 1N60A 4X1VA 4GC6A 1LJOA 2HAXA 4M7AG 1H3HA 3MP6A 3GZFA 2K60A 5DB9A 1WNLA 2E5QA 2M9UA 3RB0A 4M75G 3EGXA 4F93B 3BQ1A 4C0GA 2E5KA 1IHWA 3LYSA 3MEWA 2YRDA 5IXBA 4J9RA 1TWBA 3Q8QB 2BPGA 5KFQA 2BQUA 4C8QD 2HQHA 2AGOA 4F04B 3FDRA 1UQVA 2GLEA 3K1RB 4IIMA 2KSOA 2LQKA 1TUDA 1KBUA 1ED1A 3E9FA 3H0IA 2J6SA 1H8KA 1OQKA 5LJ5h 1JB0E 5GANf 4QZCA 2SRCA 1YJ9A 2JTMA 3OYEA 2V9WA 4QIWF 1K8AU 1QVGP 1VOMA 1SWWA 4O3NA 1BVSA 1VDVA 2F2VA 4M9JA 4MFAA 4OD0A 1UT5A 3MR3A 4EBEA 1AEYA 2COZA 3HJEA 1GRIA 4JJDA 4QWCA 3JRZA 2PFPA 4GIBA 4QWAA 2GFAA 2MWOA 3RJGA 4EELA 5IIJA 1T0HA 3HL8A 1X40A 2C06A 2Z7JA 3RTVA 4R65A 4DL5A 3OMCA 5KFOA 3R6NA 4I27A 4OB0B 2HHTA 2FE9A 5IH2A 2K3XA 4PK4A 3TSZA 2A08A 3OSSC 2HVHA 3EPIA 3RBEA 4O5CA 1GCQA 4M7DE 4C8QA 2ZPBB 4ZN1A 2YLBA 5GANj 1U5SA 3V6HA 1OEBA 4C0DB 5AKGA 4DQSA 7ICPA 3M53A 3L2WA 2KD1A 1XSLA 1JRIA 4BDZA 4RPYA 2YN4A 1XO0A 4B9MA 4F5NA 2Y1IA 3G71A 3G4SQ 1T94A 1KK7A 2NYVA 3QJ6A 4ELTA 1BIBA 4C80A 4TURA 3JCMX 4KITB 2QTVA 2YLCA 2J6TA 1K4US 1GBRA 3MBYA 1IXDA 8ICHA 2F2WA 3BQ0A 1ZQ1C 4AFSC 4NS5A 5FW9A 4DEXA 5GMKi 3CCMQ 4RU9A 1VQ6A 1VLBA 5AKIA 5I11A 1YIJQ 5KFJA 2Z0WA 4Y2PA 2A3VA 2SEMA 5BOLA 2ZIWA 4DQ2A 1UECA 3CCJQ 5KYYA 8ICXA 3RH6A 1JALA 5J0TA 2XY5A 4VUBA 1BI3A 1UE9A 1VYVA 2AK5A 1TS9A 4ED8A 1YJWA 4R64A 4DO9A 1ZQMA 4P0PA 3EFSA 1QH9A 3QO3A 1NEBA 3BS5B 2MAXA 2BE9B 2FEIA 2PKEA 1JXLA 3K75D 3ZDAA 1VUBA 1ABQA 3UQ0A 3MGHA 4C8LA 1VQ4Q 2EQIA 1I07A 1Y57A 3CCEQ 5EC7A 2UVRA 2JH1A 1SKRA 1NKBA 2BZ8A 5DBCA 4X5VA 5IAYA 1FFVA 4US9A 3C2MA 1NJIC 5KFHA 9ICVA 3EGXB 1WHLA 1VQLQ 4JZ3A 3THVA 1COOA 4ED0A 5CB1A 2XO7A 2E5SA 1YZ6A 2RRDA 3MABA 2HHWA 2KGTA 2YSQA 4J9FA 5LJ3f 4E7KA 3M55A 1VQ8A 2KROA 4ZTJA 2C0IA 1YP5A 2FMPA 3M0SA 1FWZA 1RYSA 2PVOB 4O3QA 1OXJA 3UMGA 3HPWA 2IHMA 3KKAA 4FS1A 2D0NA 4EMKC 4YMMA 1YZ7A 4LN2A 2XHCA 3MGVA 3RJFA 2D9TA 3RJEA 5IXFA 2OTJA 4EBCA 3EHQA 1URJA 3JCMf 4C5HA 1JIHA 1JXEA 4OMMA 4QZ8A 1QP3A 1NK9A 1O08A 2CS7A 2WTFA 2C22A 1BCMA 1KD1C 3VV0A 5J2AA 3H0HA 4B9NA 1W2BS 4C92C 5DB6A 1ZA2B 3LGFA 4F7UG 3VS4A 1RADB 2B6GA 1K8AC 3CCVQ 1G5VA 3OYKA 4J9BA 2DPIA 2D6FA 4RTZA 4C5IA 3PO4A 2QGFB 3UA6A 1VQ9T 1KTQA 4UBBA 3HRDD 5LJ5e 1X75C 1RG6A 4DFPA 1G8XA 1WFWA 2YUPA 4BDYA 3C2LA 5HP4A 2D3DA 1VIFA 1W2BA 1D1BA 4O3SA 4CRIA 2JZ2A 3QUIA 3M0TA 3O0FA 1ZQDA 4DS4A 5KFAA 3IDWA 3TI0A 4DEZA 1ZSZC 3AHUA 4YXMA 1C7YA 4JWMA 4ESRA 3V6JA 4ECYA 5D6XA 1Q81R 3RB6A 9ICAA 2Y9TA 2VIXA 9ICRA 1ACMB 3RIRA 2FLPA 3VS7A 4ECQA 2LJ1A 1ZLMA 1WA7A 1TAUA 1H92A 4O0IA 1VQMT 3CCSA 2OAWA 4F7UE 4J6XA 1A0PA 3JSCA 3GF5A 5ALQA 3GV5B 3CCUT 4FYXB 4ED3A 2K8BB 1NJYA 5AKLA 1S72A 4DL3A 2EKHA 1XQHA 1KEJA 3M9OB 4KMOB 3RAXA 2DLPA 4I2IA 8ICMA 3BW1A 4DOWA 5KG2A 3CMAA 2HMAA 3KHRA 2ZIWB 3UA7A 3MPUB 1WCLA 1QCKA 4Y2SA 4PHPA 2ZPGB 1U9LA 5KYYB 4DFMA 3CP8A 2FPKA 5KYNA 1S0NA 1MMDA 2WACA 1PUZA 4KLGA 2DL5A 3RDVA 4P0PB 2ALZA 1S0VA 3G1JA 3SV3A 1X6BA 4Z6EA 3GPLA 5A0LA 4DBQA 4M9LA 3H0MB 5AK5A 2AT1B 3A8HB 4Y2RA 4RCCA 4C7ZA 4AP9A 3NVZA 2JT4A 3I56A 1P92A 1RAGB 3M9MB 2FPEA 4KUDK 3QU7A 1H3ZA 3V6KA 2VA2A 1ZRMA 4AYBC 4DS5A 4UARA 1R0CB 2IOFA 3P8DA 1YJ9Q 1Q3UA 2PQWA 1S10A 9ICWA 1RAAB 1S1NA 2BZXA 2I0NA 2K3BA 2RJCA 3MJXA 5IIIA 2H3VA 2D8HA 1B43A 3ZFJA 5LJ5d 4OMQA 4WCIA 1SKSA 4IR9A 4UQGA 4QW8A 3C4SA 4C4RA 4ED1A 1X6OA 4N0AA 5KE2A 2F5KA 2KV2A 3A0HU 4C8MA 3WU2U 1FO4A 1YFNA 4ECWA 4N4GA 2ZUCA 2DWQA 2M0NA 5GAN4 1NK6A 5KFNA 3LYIA 3C28A 4NJ8A 3ZBDA 2OI3A 3QWXX 4DCCA 3LDAA 2F1HA 1MA7A 3UPUA 2M51A 3G6EQ 4DWIA 8ICGA 1NPRA 3PV8A 3OYIA 2IVWA 1IG6A 3RBDA 4QQDA 2LCCA 4NM2A 1JUDA 3C21A 3GU3A 4OF1A 4E7LA 1OZ2A 1T3SA 5ALEA 3L3FX 4I2GA 3MCAB 3OBWA 4QNLA 4BY6C 4GXJA 3OS0A 3G71Q 2FRWA 1D8LA 3UT1A 4XA5A 3NVWA 3UM9A 2RJFA 1OZ3A 2H3ZA 4O5VA 4ZH4A 3I55T 3OGUA 3FB9A 2CKKA 5AKKA 3S3MA 4QZDA 1L5UA 5J0WA 3EG2A 1ZHIA 3NTHA 3ZEHA 3OS1A 4F3OA 1ZQXA 3I28A 5KTQA 4UASA 1TE2A 3M4YA 1K9MC 1VQ6Q 3MGIA 3M8RA 3T5JA 2AIRB 4FM4B 3RJHA 2BE7D 1L7NA 2KNBB 3JB9F 1ZJMA 2KJ8A 1KKXA 4QQ6A 2RDIA 3V72A 1TUGB 3PR4A 2HBMA 9ICIA 4CC2A 2H3FA 1YJNA 3PVQA 3TCJA 1P7DA 4AFUC 1KW4A 1QVFS 3RJIA 2K89A 4MZMA 1YJWQ 4M7DD 5C5JA 4IRDA 1Z3EB 1NZPA 1FFUA 1ZQTA 2E6NA 2W9AA 4NOYA 8ICQA 4P4OA 1YHQT 4V2SA 4ELUA 3OS5A 2X51A 4YVZA 4ZGJB 3LH5A 1HUOA 4M04A 2QB0B 1L3TA 4HKEA 5FU6B 2KHVA 3SB2A 1PZNA 4GC7A 2XD0A 4FZNA 3KUFA 2WFAA 3LWLA 3QEAZ 1D1CA 1RQLA 4J9HA 1QVFA 3PMLA 2J06A 1VQ8Q 2EPDA 5KG7A 1ZYQA 3FC4A 4MF2A 1KFSA 4C8QG 1WG8A 2Q0ZX 5HR6A 2LJ0A 5D6WA 3OW2S 1SRMA 4FIBA 3GOXA 2EGCA 2FG0A 5CWRA 4PFOA 5ALTA 3FC3A 3EPGA 2A19A 1NLPC 1D9FA 2MF2A 3NUQA 4O3PA 2OTJQ 1UEBA 3V8JA 1F0MA 2BZFA 2DE0X 1WXBA 4CF5A 4J9OA 3N5BB 1G83A 4J9LA 1GBQA 2HQEA 4M7DA 3CCLT 4IUQA 4R66A 1B4FA 3OW2A 5DGBA 2UVVA 1B22A 3JB9G 1FYNA 3LK9A 1CI4A 5ALRA 2HBKA 2UVUA 2HSEB 4J6YA 5LJ5g 2K4PA 2KJ5A 4YD1A 4J83A 3CPWP 3PX6A 2G6FX 4QW2A 2EFIA 2QQ9A 3Q8LA 4IQWA 2IHNA 1KHCA 5DB8A 4WF2A 1MMNA 5GMKj 1SHGA 2RMOA 3HTRA 3L5KA 2LMRA 4LE9A 2QXFA 1ZD4A 3BQTA 5J2FA 8ICOA 3T3FA 1AWJA 4I2HA 2EH9A 3MHXA 2JXJA 1WXTA 9ICPA 2MI6A 4Z88A 2YMMA 5KE3A 2BDPA 5KFIA 1ZD5A 2W9CA 1IGQA 2Y90A 2VJ5A 3IV6A 2CH4A 4IKFA 1BGXT 1B7TA 4OB3B 4CF4A 4LNPA 3WXMB 1IGUA 2LKYA 1MQ3A 4KLTA 2IMWP 3CCSQ 1MMAA 1PG5B 1M6YA 2E1HA 3TADC 2HSZA 4C4SA 1F1BB 4F5RA 4RPZA 5KL1B 3TFRA 2HDOA 1S72Q 2A0FB 1I5OB 1RPLA 2RHUA 1Q86R 3O8VA 2IPOB 2CGHA 3CMAQ 1X6GA 3ED5A 3GNFB 5I2MA 1M8MA 4Q8FA 2ZPHB 2PUKB 1XO1A 2YX8A 4YMNA 2RQRA 1QCFA 2Y4XA 4R56A 5DLFA 4GY5A 1L8OA 5L1JA 1CSKA 5ECAA 3VS1A 2XU8A 1WWVA 5AM4A 4C8KA 3C1ZA 3OQ5A 4PFPA 4C92F 2LYHA 4PHEA 4TUSA 2DF6A 2RI5A 2G07A 3EG1A 1TG0A 1X2IA 3PSIA 3A8LB 5AIBA 5D46A 3M0PA 4A63B 3I56Q 1WUDA 1PD0A 3H0RB 1VQ5T 2JVVA 3IG8A 1NZ9A 3SAFA 2D8CA 1WJRA 5KYWA 3UF4A 1NZBA 2W3RA 1UHFA 5IN1A 2QTXA 5AM2A 1D9DA 5J8YC 3SAHA 3I5SA 1FMWA 1YITT 4M7AB 3A8GB 3WK7A 1LVKA 5KFFA 1XU4A 5AM0A 2C0TA 3PFSA 5AT1B 5C0MA 1WCNA 2F76X 5KT5A 3EYZA 3HRSA 4M75B 4J03A 5GAN5 2AZSA 3PNCA 3TREA 3CCMT 1BNOA 2YUNA 5ALHA 3CYMA 3RESA 2H5XA 2NO4A 2DJQA 3M1YA 5KH6A 2XDDA 4A4GA 1ZBJA 3JPOA 3M6ZA 2K5IA 2X35A 2EYQA 4RTVA 4IR1A 2KMDA 4MMKA 3AL0B 4YQWA 2C28A 3QZ7A 3MR5A 5DG7A 1NPPA 2HDAA 5DBBA 5ALZA 3MDAA 3RMQA 5J2JA 5J2BA 3M8SA 2R8GA 5G5GA 4LVSA 2G08A 2H3EB 2DPJA 2M0OA 1VQ4T 5FRMA 2JZBB 3SAGA 2L5QA 3CMET 4UAYA 1S9FA 3AEVA 3QUBA 3CCET 2BPCA 2KZZA 3PY8A 2K4IA 1BKBA 5A0DA 1OX9A 5GAN2 3PTAA 2Y0SC 4A8EA 3OYCA 1S0OA 3RR8A 2DEQA 2MMPA 2EKOA 1KRPA 2R18A 1RQNA 4F7UA 1K76A 5AM3A 2PMZC 1QCOA 2E4HA 1N5ZA 1W6XA 1PVPA 1QQJA 1J3TA 5I22A 5JU5A 1Z1VA 2P4RA 2DXCA 2MOXA 1B3QA 2CZ0B 4JUVA 3SYZA 2DVEA 2KXDA 2W9CB 5DQGA 3M7DA 1VQOT 4EYHB 3QU5A 1PK3A 2DXBA 3ETRA 3FM9A 4AYBF 1LNXA 3HKZC 2VUBA 1JU5C 2CXYA 2NUZA 4J9PA 2YWWA 4EPCA 4YMOA 3MKDA 2VKNA 4IUVA 2LNVA 3V7CA 2N1RA 2DIQA 5DGAA 1YJNQ 5L1LA 2F8LA 4DSEA 4QWBA 2R5MA 1VQKQ 1BK2A 3X20B 5AKZA 1VQPQ 2ZGWA 5F3XB 4O6JA 3KHHA 3CC4A 4XTVA 1S76D 2ZJ8A 3CBOA 3ZDCA 3JAME 2MU2A 3CCVT 1NG2A 4C0DC 4UAZA 3KXTA 1ECWA 4QZAA 4C92E 2DK3A 3H4DA 1CKBA 3V8LA 3H7IA 2EDUA 4XAXB 2JEGA 2KRSA 4DF4A 2JV3A 2CZ7B 2GF7A 2ROTA 4J9SA 5D4BA 2YDLA 2WAQC 3HILA 4D8DA 4BUGA 5C0YA 3L2VA 4PGQA 4YR0A 4KLDA 4NWIA 4DQQA 2DTOA 8ICPA 1SV0A 4O5KA 1Y71A 1MGQA 5AKXA 3VS5A 4IUTA 4U6PA 4HVVA 4J9DA 3H9NA 4PJ0U 5CCAA 3CCRA 3WKDA 5KYWB 4UAUA 2L0AA 5JTIA 2QA4T 3H8SA 3PVXA 1DGJA 2PI4A 2DL8A 2RHIA 4ECZA 4K11A 1OYXA 3CEYA 2IOFK 2BCRA 1BIAA 1S77D 1E6GA 1Q82U 1SSFA 3WK8A 2JEIA 1E7OA 5EE3A 5EWFA 1D0YA 4EDUA 2CRXA 4YP3A 1C6VX 3RKXA 2ED0A 1DXSA 4OCZA 3EFOA 3CXCS 2ZJAA 2XIDA 3CD6A 2GTJA 4NY8A 2RHFA 4UB6U 7ICUA 4FCYA 3DKMA 3A5ZB 3NTUA 2RP5A 4KLMA 2ZIUA 4N4HA 9ATCB 7ICTA 3RR6A 4WJ3B 1WI7A 3RUXA 4RUCA 3QEBZ 4AG2C 3RERA 2LTOA 2F1JA 2WSCE 3JB9J 4DOCA 1RAEB 5L8RE 1IV8A 1BPYA 2KXCA 4JUZA 4I2BA 3CXCA 1BPDA 4NL9A 3Q8SB 1UJ0A 4X9DA 3UDCA 2JTFA 3V8KA 4YN4A 1VQNT 3WK5A 4F7UB 1NE8A 5FWBA 4KLEA 4C0FA 1UUEA 3UATA 5EWGA 1V9PA 2O6KA 5FP0A 2PI5A 5ALSA 2DTIA 2IBKA 4UAWA 1SG5A 2RQTA 4F2RA 2Y1JA 1OU9A 4CRXA 1SXEA 5J0PA 4B9TA 4GFJA 2HHSA 4JLGA 2CYZB 3I76A 5DQIA 2D1XA 4MEYA 8ICLA 3BJYA 1M1KU 2DFUA 1Q81U 4PJJA 2L3PA 2EYZA 2MK5A 3URGA 2LDMA 2JTEA 3SENA 1L3UA 1MSWD 1OU8A 3TSWA 3E0FA 5H2FU 1OX8A 2HCKA 2ESEA 2ENMA 2L5YA 1GCPA 1IZ6A 3G6ET 4JS4A 3FJ5A 2KIWA 4M7DG 1BNPA 1RLPC 9ICHA 3RH4A 2CH4W 1KN5A 1S97A 2L2PA 1I1JA 1PWTA 4F92B 4PZOA 5CKBA 5I2SA 5EE1A 2QI2A 2QDLA 5GAMj 1X69A 4Q5WA 2DERA 4JZ4A 5IILA 1X01A 1HEKA 4MFCA 2NV3A 5J0YA 5DKWA 5IINA 2A1JA 2RJEA 3SD7A 3OTQA 1WJSA 3THKA 5KFMA 4EMGA 1SZHA 2AQ4A 2D0QB 2LC4A 3VS6A 1HSQA 1VA7A 2LX7A 3JB9D 1Y88A 1SRLA 2GBQA 2JS0A 4DQIA 3REAB 5KCHA 3CCQA 3TARA 1ZD2P 1J2MA 5D49A 5CIUA 1QQ7A 1AVZC 2DA9A 1OI1A 2MWPA 4QT7A 1M4ZA 4QVCA 5IHIA 2KDSA 3J81j 3Q8RB 4PPXA 3PSTA 4UB2A 2CP3A 2PTKA 3M0UA 5BOMA 2VASA 4M77C 5GAN7 3JB9H 5LJ5j 4IUUA 3GIJA 1BI0A 2CP7A 4PH5A 2HNIA 2JM8A 4OGCA 3U23A 2HW3A 3BE3A 4XTWA 2ZTCA 2OTLT 5KFBA 4ECXA 3TEEA 4PNOA 1WPYA 4PJOG 2W54A 5KNIA 5CR2A 2OCEA 4CI0C 5HK0A 5ALNA 4E2FB 1KJWA 3OHAA 2YRCA 3MEUA 4OJOA 2FPFA 1U49A 2I2LA 4TUPA 2E8NA 2R57A 5DLGA 1L7OA 3OPXA 3ISCA 3DLMA 4XQ8A 3F2BA 4M9GA 2ZTEA 1Q82C 3HSBA 3CPFA 2RHYA 2H3JA 3CC2T 5AKJA 4J9NA 1Q7YU 2V1QA 4F5PA 2ZIUB 2OYYA 4QZIA 3NGPA 3TFSA 2O2OA 2LMJA 3VYGA 4ANJA 4DA4A 3JCMP 5CR0A 1V38A 3CBMA 5KFLA 5ALJA 3OYFA 4UB4A 1K1ZA 5B5EU 7ICJA 1BCOA 4EYIB 1LPLA 3KKAC 3QJYA 2I6XA 2EIFA 3H8WA 1XS9D 1N8RC 2QEXT 2QQBA 4J9KA 4PJOE 1H38A 1NKCA 1VQ7T 1PSFA 1JROA 5L23A 4FO6A 6AT1B 1RI0A 1I4K1 2DMOA 2HHXA 5ALGA 3D2NA 1D0ZA 2EWNA 3R6OA 4JRKA 1IIPA 4LDUA 1AZEA 4Y2QA 2G5IB 2RPNA 3TVTA 9ICEA 3CC4Q 2KBTA 2ZPFB 2DIGA 5DBAA 1LB2B 4DFKA 2E70A 4A4HA 3QUCA 3I5RA 1WLPB 3S3NA 3S6WA 2KI7A 2QGGA 3H0FA 4RQNA 3MFHA 1AT1B 2CSQA 2GTOA 2ZXIA 5EE9A 2YHTA 4ME7A 2KSOB 3CC7Q 1FXXA 1KFZA 2KHQA 3KHGA 3C95A 4B9XA 2F69A 5AI4A 4DSKA 5CEHA 4R63A 1M1KC 1Q95G 1JJ2P 2ASJA 5KYXA 1PSEA 3KZIU 5CJ7A 1OPLA 1X9XA 5GAMe 3HWTA 8ICIA 4LDVA 1T3NA 5EE0A 1RABB 4M47A 2A1JB 5DG8A 4ED6A 2ZG6A 1NK0A 2K2VA 3CCRQ 1UGRB 2Y0SF 2K57A 2G5HB 3OA6A 4XRHA 3T5KA 3AMZA 1NK4A 4KX3A 3EG0A 5A2QE 2DL0A 7ICOA 1SV4A 3LH0A 2PMZF 1X9MA 2G3RA 7ICKA 2FPDA 4KH1B 5LJ3h 4YG2A 4QZGA 2WSEE 3QZ5B 1QKWA 2NUTA 2A7YA 3C12A 5ALMA 4PL2A 3UXPA 2PZ1A 2EYYA 3SEIA 4KLFA 3TAPA 3PR5B 2K3YA 5IT9E 3PIOA 3HKZF 4JJCA 3AUOA 2HSPA 4DSJA 4C92D 2DD4A 3C94A 4B9VA 5CP2A 3CD6Q 4HT8A 5ALOA 5FU6C 1W70A 2BZYA 2X4YA 2KFZA 4C8QB 2O9SA 1K5OA 1X42A 2EQMA 2ZXHA 1UHUA 1UGQB 1WIEA 3OB9A 3NMZC 3VJPA 1RACB 1B07A 1D3BA 3H8ZA 1BBZA 2KNJA 2B86A 1V1CA 3QHSA 1NJIR 2EQKA 2OX7A 3S3OA 4R0KA 4RMOA 1JBMA 2JW4A 4OP0A 1NK5A 1OPKA 2KAFA 4AG1C 2VA3A 1HD3A 1WZOA 1YI2T 2WAQF 4G3IA 1XOVA 1WHMA 2X3WD 3BZKA 3HRUA 2KE7A 3OSPA 3C0CA 3LVWA 1N2XA 3G7ZA 3AQEA 4ED7A 3PW2A 3ME9A 2GCXA 2PUOB 3UMCA 2MSNA 4EEYA 2RA2A 4RTUA 5TISU 4I2DA 4PJNA 3UPQA 3C29A 4M78C 4ELZC 1OW5A 1Q7YC 2RQWA 2KP7A 1IRXA 3L4PA 4C92A 1AOJA 5GAMd 4CF3A 1KD1R 1C0MA 2DL4A 2HD0A 3PMNA 4JB3A 2J6UA 5AI8A 2XCPA 4Z02A 1KQQA 1PKSA 4PLIA 3IRUA 5KFTA 2YT6A 1K8AR 5D6YA 3JPPA 1NBEB 2EBPA 2IIMA 4PZNA 1VQ9A 4IQUA 2GWSA 3NVVA 2BCUA 1Q86U 5J2KA 1ZUYA 4CE6A 2E8OA 2P0PA 2PXIA 5KT6A 2QARA 3LVVA 1SEMA 5J0XA 3Q8KA 1N6AA 2AZVA 5GAOq 2DZCA 2K2MA 2RI2A 4US8A 1YNZA 2DEUA 4X34A 2YQEA 4DLEA 5KYXB 1VQMA 1KC8U 1XSPA 2K4HA 3CCQQ 3V7KA 1V97A 2DTHA 1VYUA 5GTIU 4C4TA 2NRTA 2XI9A 2W11A 4FFDA 1ZQPA 2RHZA 3CCUA 2ATCB 1UDLA 2D8JA 3MO8A 2ED1A 4UATA 1XC9A 2O4XA 3AN1A 4MF8A 2WF6A 2ASLA 2MAMA 2HHUA 1N27A 5AHXA 5FU7B 2F44A 2P84A 2DNUA 1RAFB 1ZQIA 4Z6FA 1VQKT 1MMGA 3ONNA 1FIQA 9ICTA 4EX6A 2JMCA 4UB3A 5HHHA 1W4SA 1VQPT 3DEEA 3K4GA 3KFVA 3QYPA 4LJXA 3M57A 4Y2TA 3GILA 4FZLA 2L89A 4KT0E 4TQSA 3SFMA 5J39A 2KR3A 3FYHA 1WXUA 2KQWA 2W55A 2V8KA 4FYYB 3PVLA 4BJQA 4TQRA 3OJSA 1ZQOA 2JM9A 1KFDA 4J9CA 2M9NA 5CKHA 5J0RA 1D3BB 2V8IA 1COKA 2BQ3A 3MEAA 4M7AC 5HMLA 4RQ3A 1TOVA 3E19A 3SEMA 5GAOp 3BY7A 4BE2A 2NRXA 4M75C 5AK6A 3CQTA 5EG2A 1WDXA 4F5OA 3KBGA 2X3XD 3SR6A 5LJ3e 5J2HA 2R8JA 2E10A 1TAQA 4IS7A 4GLXA 8ICJA 4QWDA 4JRPA 2ISOA 3HFNA 2EGAA 4ZTFA 1KQSP 5EWEA 5JUMA 3PZPA 1SL1A 2DXTA 2YXYA 3FRNA 4RT2A 1W2BP 2ESWA 8ICAA 4RQ5A 3L1AA 3EGDA 5AKEA 4O3MA 3B0XA 4EIKA 3M54A 1N63A 4B9SA 4O9MA 1BI2A 3GBQA 1D09B 3CBPA 1M90U 4RTWA 3N7PD 1AWOA 1U45A 2DF4B 1FMVA 1K73U 3WKAA 3AT1B 4M77F 1SIJA 9ICUA 2W10A 3HKSA 3NASA 3AM9A 2ABLA 4LD9K 4XU2A 3UXOA 4ECTA 1ARKA 2B8AA 4ORZA 3QZ9B 1QCNA 1I81A 4RQ7A 1YWPA 2GQIA 2HBPA 2LVMA 3I9QA 2E3IA 2EYWA 4UBCA 4EMHA 1ZQKA 4J8OA 5GAMg 3KBBA 9ICFA 1QQ6A 3I55A 4JS5A 4NL3A 4RNOA 1UGVA 2K5LA 3QU2A 1TVAA 2E3TA 5ALLA 2ZZDA 3B0YA 8ICZA 3BQ2A 5IIOA 1SXDA 1N56A 4A54A 1WHHA 2QARB 4PJOD 3WKCA 4LZGA 3NS1A 1UCVA 4BWJA 4NM1A 8ATCB 3CRXA 5JRTA 1AHJB 2DM1A 2VXEA 4GLMA 4BD3A 3Q8PB 5T14A 1K9MR 4JLIA 1L8LA 3QU4A 1MNEA 2M02A 2VV5A 3WVEB 3RH5A 2MIOA 1SHFA 2PNIA 4QWEA 4RQ1A 5J0OA 5CVIA 3ER0A 2CDTA 4OJLA 8ICYA 2W9BA 1YBYA 2R8IA 2ZCFB 1EZZB 2O4XB 1ZETA 4L6V5 4OMLA 1RZTA 2W7PA 3M56A 5DG9A 2PFOA 2GO7A 1D0XA 1TK0A 2KTQA 9ICQA 1IM4A 1SWVA 3IM1A 1RAHB 2W03A 2EJ9A 2W0ZA 3L2ZA 5LJ3d 4CC4B 4KLLA 1KFTA 1X6IA 4M0AA 1XNIA 3QPHA 1KC8C 4O3RA 3MEVA 5FRNA 2PU9B 3HT3A 1ZQNA 1TH7A 2DZ9A 1JXOA 2YMQA 4Y28E 1M2VA 4J7FA 4I29A 1OOTA 1PM3A 2JS2A 2ASDA 2A3LA 3RMSA 4QZBA 5KAIU 1U47A 1M3BA 1TUCA 4E7IA 2LRQA 2JUFA 1Q3VA 3TU4K 2J05A 2DPPB 4LD6A 4RUGA 2XCAA 4NLNA 1KQ1A 1QW1A 3A98A 5CKDA 2B0CA 2XY6A 3X26B 3KD3A 4C5GA 4PJOA 4QZFA 3META 3PIPA 5GAN6 3G6XA 4KLOA 4I28A 2FMSA 8ICSA 5HMMA 1MC8A 9ICGA 3FDSA 1ZQJA 4CCHA 1NLOC 1UTIA 2QQAA 2BTTA 4BX9C 3R9KA 4RG2A 3LWIA 1M3AA 3UXNA 9ICMA 1NYFA 2E3HA 1LVHA 4PKCC 4A53A 2P35A 2YB4A 2LI6A 5IIMA 5KFXA 3HP6A 2NRWA 3CCLA 3Q8MA 2QG9B 4DSFA 3SQIA 5KYUA 1J2NA 4XUSA 5CHGA 3WK9A 5AKYA 1GL5A 1V76A 2BDUA 3HPOA 7ICQA 2RD1A 3PX4A 5ALDA 1BPZA 3LWMA 2ROLA 4M77E 1YHQA 2EZYA 4TVRA 1KL9A 2JH7A 2FYKA 3PW7A 2AKKA 2KSSA 8ICVA 3PW5A 1NNLA 3NTKA 5DY9A 2QB1A 3G4ST 2OAUA 1AWWA 4NLBA 2W9MA 3JPTA 1K0SA 1G3SA 2RI3A 3AQFA 3VRYA 2EW3A 1NOMA 2DL7A 2FZGB 1RI9A 4PLLA 5KG3A 2GFUA 2RF0A 3RNJA 1M90C 4N4IA 3NVYA 3OYYA 3JB9I 2CP0A 5CA7A 2KIVA 2W04A 3EG9A 3PSFA 1ZQZA 5ALFA 4Q8EA 1K73C 4DL7A 1NJZA 5F9NA 4RZRA 1YIJT 2AXTU 2JEFA 2HBLA 5KG1A 4EEKA 1N9RA 2DBYA 1AROP 1VIEA 1VQMQ 3EHRA 3E2UA 3CCUQ 1ZQGA 3CCJT 4ECVA 2BCQA 3N97B 1O9SA 1PCXA 3D2SA 4DLGA 2WF7A 4M7DB 2KMTA 2KT8A 1QVFP 1TFRA 3HP9A 4HCKA 3OHBA 3M0RA 4YR2A 4UB5A 4NL2A 3OYHA 3RB4A 3SMVA 1BI1A 1EXNA 3VRZA 3JCMJ 2LNHB 2W9BB 4JMUA 4RPXA 2DRMA 1ABOA 2LQWA 2LX9A 2EANA 1WGSA 2BPFA 1YWOA 4YFKA 4I2FA 2X4JA 1E6HA 1K1QA 4USAA 5J0UA 3OJUA 4M78F 2H3IA 2PFQA 1VQLT 1OULA 3N4MB 2XC9A 4KLSA 1GO3F 2EAMA 4C92G 2KN7A 2F8KA 1NI3A 9ICJA 4KMUA 1VQ5A 2ZUBA 4XU3A 1M2VB 3RKYA 3CC7T 1RXVA 5LJ3g 3OW2P 1NKEA 1R77A 4CC3A 1QVGS 1T4GA 1ZQHA 2E12A 1KQ2A 1L3SA 1YITA 1PC0A 1XWLA 3VUBA 5J8YA 2L8DA 5KFGA 2O88A 3EGUA 4IUPA 4MEXA 4PJOB 3WK6A 2EGEA 5J2DA 4ZGDB 1A76A 1SL2A 2E6ZA 1JRPA 4B9WA 3CCMA 4DSIA 1F5SA 1I0CA 3EG3A 1UJYA 3M6KA 2ATLA 4Z6DA 2AGQA 5J2GA 1NEGA 3PE0A 3FIFA 2G0AA 2KRNA 4KGXB 3V7RA 2XY7A 2EQJA 4KUIA 3RB3A 4XTXA 3NTIA 1QVGA 1L7MA 3OYAA 1AQ6A 2DYIA 1U48A 4A4EA 3E1SA 5CRXA 2V4QA 1NJXA 2GGRA 2DL3A 2HKQB 5KYUB 3RKWA 1SF9A 5AIAA 2E1FA 9ICKA 3EH2A 1VQ4A 1TK5A 4B6MA 1PRMC 2LP5A 3CMEA 4HT9A 5KFEA 1WHJA 4MZTA 2V4RA 3CCEA 2WF8A 2B21A 4DL6A 2C2RA 1R8OB 3O5ZA 3PMIA 3IP4B 3VC8A 4IC9A 3ZD8A 4KTQA 2DQNB 3VS0A 3M9QA 4RQMA 2QDYB 2LCSA 2M1HA 1JN3A 1QSSA 4Z6CA 1BPBA 1NK7A 5KFRA 3OYBA 3OMGA 4C0ZA 4FL6A 4ZOHC 4GXIA 8ICBA 1FMKA 3VCBA 1VQOA 3FJPA 2KOBA 4HCZA 1WYXA 2JR5A 1PVQA 4J6WA 5KFPA 1ZQVA 3CNHA 2DO3A 3QBYA 1Z1BA 1S8OA 4M7AF 5KFCA 2IG0A 2K5FA 4OB1B 5TZVA 3MP1A 1EX4A 4BXOA 2DRKA 4M75F 3X24B 5GAN3 2F1LA 2BCVA 2KYMA 4FBTA 2YUOA 3SHWA 2HZYA 2DKXA 2DUYA 3H8JA 4BE0A 4EX7A 1S0MA 3M0QA 4Y2XA 4FSXA 1B34A 1YHQQ 2E64A 1QLYA 3KZXA 3SWNA 1PD1A 5GMKm 1KLNA 2NUPA 3CCVA 2AJQA 1MN8A 4M78E 2MUTA 4K4IA 3PMTA 3GNGA 4EZ6A 3RBBB 4DEYA 4PJLA 4M2YA 1Y96A 5BPCA 1JXMA 3QE9Y 2HI0A 2EJFA 5GAMf 1WHKA 1YJ9T 4EBDA 2EJGA 1WX6A 1BB9A 2OJ2A 2JRZA 5ALPA 5FROA 4DL2A 2FZKB 1ZA1B 3RFAA 3ALRA 1IO6A 1PKTA 2QA4A 2VB6A 2LBOA 4PL1A 4P4MA 4F72A 4UW9A 3LWHA 4UB1A 1H641 1LCKA 2MRLA 2DGZA 1X9SA 2XK0A 3QDFA 2FHDA 2QYZA 1A77A 3QYGB 5ALIA 1N62A 3MR2A 4E0DA 1NJIU 4CDGA 3G6YA 3E2EA 1VYTA 2RJDA 5LJ5f 3CCLQ 1YCYA 2KYBA 3PNWC 3ISDA 2EQYA 2KKVA 3NRWA 3WKBA 1GCQC 1PHTA 5KT4A 4C8QC 2QAZA 4IIOA 3LW5E 3FAHA 4OVAA 1HIWA 2LYBA 5AM1A 4XTUA 4K4HA 4JRQA 4PHAA 5DDYA 4J9IA 1ZQQA 4JJBA 4FE3A 2QASA 2RQ5A 2LT4A 1V85A 4IRKA 2I9GA 3BZCA 4LUEA 3G71T 4HCCA 7ICSA 1I5LA 3OYJA 2VJ4A 4HVUA 4F17A 4R55A 2HHVA 2HOFA 3C2KA 2L3RA 2NRZA 3GDXA 2AU0A 4F5QA 1U1TA 1XTDA 5CQXA 4BI4A 2I1QA 1KD1U 3WKEA 4RTXA 1N61A 2VGMA 4LDYA 4RQ0A 1VQ6T 1VQNA 3UMBA 4NLZA 5CK9A 1UPHA 7ICEA 5FLXE 1ZQSA 2ZIVA 5KFZA 4E6RA 4AFQC 1TXQA 4AFZC 4JK1A 2KT1A 5GANh 2OH2A 2RN8A 2A1AA 4XU0A 2A28A 2EQUA 1UT8A 2NO5A 2EZXA 3NPFA 4M7AE 2AHOB 4ED2A 8ICFA 4PGXA 3RAQA 1MUZA 4M75E 5HY6A 3JCMb 3LX7A 1YJWT 3A1PA 4CC7A 4RQ4A 2MYSA 4M77D 4BACA 2GQVA 2XGQA 5L1IA 3H0LB 3EFOB 2CREA 3PSPA 8ICCA 4BXOB 4KLQA 4UB8U 4J5YA 4XU1A 4M6WA 4TUQA 4GXKA 2PVGB 2DKZA 1JQQA 2YMPA 3G6EA 9ICCA 5AKHA 1TK8A 1B34B 3SWNB 1NJWA 2DBMA 2C2DA 2NUPB 4MDXA 1VQ8T 4GLKA 2MUTB 1Y07A 3IG5A 5AI6A 4ZGEB 4QQGA 1D8YA 1VQ5Q 5AICA 5J2IA 4L59A 3A8MB 7ICIA 2WB1C 1ZD3A 2WSFE 3NHNA 1Y96B 2KKPA 4BI8B 3AU2A 3BDLA 1ZQYA 2ISPA 1M30A 2G06A 2BKEA 2HQXA 4IQVA 1YITQ 2OTJT 2MA1A 4Y2UA 1EIFA 2HEQA 9ICNA 2K8CB 3T9NA 4QKUA 4RNMA 4OMNA 5HNKA 1JO8A 3KFUF 2K9GA 3QDRB 1ZX6A 1K9AA 4F7UF 2LCLA 5B66U 1NYGA 1NM7A 2E1EA 3C5GA 2OEHA 4M77A 4FZMA 5FU7C 7ICNA 4MZPA 5AI9A 4KLIA 7ICRA 2DX1A 4KN4A 2D6FC 3LLRA 3M59A 3QIIA 2OTLA 3GIMA 3H40A 1MHNA 5ALUA 4ZN3A 3CXCP 1R0BG 3VYHB 2ZTDA 5AM5A 2LQ8A 3F53A 4DQPA 3L2UA 2KRMA 1X27A 3ZD9A 4P4PA 4F2SA 1J97A 4Y2VA 2RHXA 2K7AA 2W8KA 5ALYA 3ISBA 3KTQA 3CMEQ 2WF9A 1RAIB 2KK4A 1Q81C 4F16A 2VXFA 3NGDA 3M9NB 2DFLA 2Y9UA 5KFKA 4MMLA 2LPEA 7ICHA 1MV3A 1ZQ1A 2OWOA 4NLKA 2JMGA 2KE9A 3CC2A 1Q82R 2KVSA 1MQ2A 3H8MA 2KVCA 4UAVA 4F4ZA 1DRGA 2HBWA 1S5LU 3AU6A 3GQCA 2NRVA 3CCST 4NLGA 5DB7A 5J3BA 1VQOQ 5HHIA 3MR6A 4DBHA 3J81E 1DOQA 5IHNA 2DYBA 1S72T 2KZMA 2QEXA 4U7CA 1ZQEA 4FT4A 2ZIVB 1VQ7A 1X9WA 3FLGA 4RCBA 1U06A 1N8RR 3CMAT 2CUDA 1HJDA 2MPXC 3GV7B 3GIKA 2LQNA 1KQSS 1AD5A 3F5AA 2JJ9A 5ALWA 1IREB 2ZPIB 1W1FA 5HR7A 2YRVA 1SSHA 3JCMh 1CEZA 5HK3A 4CNQA 3F70A 2DJZA 2DVJA 3MP8A 5AI0A 2K79A 1C1AA 3FEOA 5CKFA 1ZQCA 3JCMQ 2E41A 2K6DA 2IA6A 2XDPA 4ECSA 3RF9A 1K9MU 2J6FA 3OBYA 3Q1JA 1ZQWA 2R5AA 5KG6A 3M5AA 5LJ3j 4M6WB 3I56T 3T5HA 4F8RA 1N5XA 1M27C 2CSIA 3A0BU 2ES6A 4L5GA 1KQSA 4E7SA 3EUB2 2H8HA 2PVDB 2YY6A 2JNGA 3N28A 4F50A 3DB3A 4EMKA 2QKQA 2VGNA 5GANe 5CO7A 3MDCA 3V7SA 2XKOC 4OJ6A 1EFNA 3HFOA 1M1KR 1U8RA 3B9JA 3PW0A 1TKDA 2J6OA 2RK2A 2W3SA 2M0YA 2NYSA 2X9HA 3OSVA 5KG4A 2QA4Q 1HUZA 4N0AC 1TU0B 1LKYA 3QXGA 2ZIXA 2Y4YA 2COYA 2E8PA 1ZUUA 3D6JA 4WTOB 4RQ8A 5GMKl 3DDHA 3QNMA 1ZQAA 2COWA 1XNSA 1KDHA 1RYUA 1WHGA 2FZCB 3ETLA 3QUQA 1HYOA 2ECZA 2UVWA 3JCMW 2K8AA 2YTUA 4ECUA 2X4WA 4M77B 4M78D 2EAOA 1XJWB 5I21A 3CPWS 1Z9ZA 1PVRA 2QB0A 5C6SA 2F77X 7ICGA 7ICVA 3EWAA 4Q44A 1WJQA 2P0QA 2VANA 4O5EA 3F2CA 5GTHU 5KT3A 2VKQA 4J9MA 8ICRA 4F71A 5AYFA 1ZSZA 2DKGA 1SPKA 4LZDA 3T79A 1ZQRA 4KULA 1ZQUA 3EAEA 4PJMA 1RLQC 4Y92A 4PFZA 4Q43A 4HAIA 4ELYC 1JMSA 1N9SA 4YTLA 4MDWA 2HMXA 2K4YA 2W43A 4GBQA 1K0XA 2ZJ5A 3JPRA 3CPWA 4ELVA 8ICUA 3IQLA 4IRCA 1VQNQ 4HVWA 2VYTA 5KCOA 1YI2A 4DOBA 2QQRA 3GV8B 4QVZA 3D2QA 2CZ1B 4IURA 3QSUA 8ICKA 4QZEA 1U1SA 3OSNA 3PGGA 4OB2B 4RUAA 2GOLA 2XVTA 4JV1A 9ICSA 1G3YA 1KHIA 1ZUKA 3X25B 2C0OA 1QSLA 2RNAA 2XDBA 1YJNT 4ATOA 4E7ZA 1D1AA 4IQTA 4HXJA 2V26A 4C8NA 2AGPA 2NUTB 2GNCA 3JPSA 3D7SB 3C5FA 4Y2YA 4JV2A 4M78A 3GP8A 1LV5A 1ZBXA 4HA8A 5GANd 5CQYA 2X4XA 1JX4A 3GLXA 4I2AA 4FYVB 1BU1A 1Q7YR 2WHEA 4DBRA 3G6VA 1YCSB 3JPNA 2P4TA 4FW1A 3I1YA 2A36A 3LGLA 5HKCA 3OY9A 3VKIA 2KJ9A 4BWMA 4J7IA 2LM4A 1DK3A 3EFRA 2F1IA 2E8MA 4DFDA 4C8QF 3H6ZA 4ECRA 4OMFB 5KL8B 4Y2JA 4J9QA 1ZSGA 2YUQA
chains in the Genus database with same CATH topology
2LYAA 4XTZA 3BFMA 1OUQA 5CKEA 4ICAA 2CZ6B 4E47A 2F2AB 2Q4TA 2DAQA 4UC4A 4EMKB 3SDZA 4M7AD 4Y91A 4OJ5A 2VC8A 4A4KA 4M7DC 4M75D 2HBJA 5GAN8 1HK9A 2FB7A 3JCMe 2ZIXB 1QP2A 4C92B 3F2DA 1VQKA 1VQPA 2LHTA 5A0GA 1DJ7B 4JJNK 3OYMA 4RKUE 1HXDA 4BI3A 4NLCA 4FT2A 4OO1J 3JCMc 3E9GA 2JN0A 4P0QA 5CAIA 5DM7R 1WQWA 4PJOC 4M7AA 4BE1A 3L2QA 1V29B 2FL7A 1Q86C 4QVDA 4M75A 5DLQE 1YT3A 5GMKh 2WB1F 2RO0A 3GIBA 2NLUA 4NV0A 3VU3C 5GAOm 2OXOA 2BKDN 1GXIE 2AHJB 2BIVA 4M78B 4JRIA 4QIWC 3IN5A 4JDSA 4M77G 4LDWA 4E7HA 3JCMd 5LL6S 4C8QE 2FVUA 5GANg 2K4EA 4P5NA 1RL2A 2F5TX 3OS2A 2HOIA 2QQSA 1WQ7A 2V8JA 2KEYA 3M4GA 4D6WA 2OM6A 3M58A 2RH2A 2LT1A 3L2RA 1G3WA 3N7RC 4BY6B 4KBMB 3J7AF 4RG8A 2CN1A 2JGAA 4A4FA 2W7OA 1UB4A 1G3TA 4P0QB 5DLOA 2YB1A 2RK1A 4HCBA 3DB4A 2KY9A 2KVQG 4E7JA 4DOVA 1UGSB 1CRXA 2RM4A 3OYNA 3CC4T 3NFCA 1O75A 3J80E 4CGZA 4II1A 2DXUA 1Y7XA 3PT9A 2JHDA 4XQ3A 3ICXA 3X28B 3G4SA 1UGPB 3P8HA 2EAYA 4PL6A 3SD4A 1Z19A 2JOYA 3CCRT 5GMKe 4QJFB 1A6SA 1YIJA 4LDXA 2KICA 3JCMg 5J26A 3BDUA 3CCJA 4KX5A 1KG1A 2H3QA 1M9SA 3VUZA 2RB6A 3UWNA 1TAMA 2DD5A 3CD6T 3ASKA 1BYMA 5GAOn 3OYDA 2G09A 3SWNC 1QVPA 1VQLA 3QG1A 4X9CA 3QYHB 4BB7A 4M78G 3L42A 3JCMV 3F5EA 3CC7A 2ZPEB 3DLLA 4FU6A 3OYLA 5M9OA 1M5Q1 3OYGA 3QKJA 5GAOr 1LOJA 4C5EA 1M8VA 3HHTB 3HRTA 4ACOA 4OJPA 4M7DF 3QXEB 1M1GA 2XICA 3P8BB 3N7SC 2M16A 1N8RU 3K1ZA 2E65A 1JJ2S 4XTYA 1FX7A 2BUDA 1F44A 3WVDB 5GAOl 1I8FA 2O01E 1M1FA 2P0KA 2GH1A 2XG8D 4OGEA 2HOQA 3CCQT 1D8BA 3A8OB 1L6NA 2R58A 5GAMh 4XK8E 2CPRA 4PJOF 1JJ2A 1LJOA 2HAXA 4M7AG 3MP6A 3GZFA 1WNLA 2E5QA 2M9UA 4M75G 4C0GA 3LYSA 3MEWA 4C8QD 3FDRA 2LQKA 1KBUA 1ED1A 3E9FA 5LJ5h 1JB0E 5GANf 1YJ9A 2JTMA 3OYEA 4QIWF 1K8AU 3JRZA 2MWOA 2GFAA 3HL8A 2C06A 2Z7JA 3OMCA 4OB0B 2K3XA 3OSSC 4M7DE 4C8QA 2ZPBB 4ZN1A 2YLBA 5GANj 4C0DB 3L2WA 3M53A 1JRIA 2KD1A 4BDZA 1XO0A 3G71A 1T94A 3QJ6A 1BIBA 3JCMX 2YLCA 1ZQ1C 4NS5A 5GMKi 1VQ6A 2A3VA 2ZIWA 4DQ2A 4VUBA 1BI3A 1YJWA 4P0PA 3EFSA 3QO3A 1VUBA 2JH1A 5IAYA 1NJIC 2E5SA 2RRDA 4E7KA 5LJ3f 1VQ8A 3M55A 4ZTJA 1FWZA 2PVOB 3HPWA 4EMKC 2XHCA 3MGVA 2D9TA 2OTJA 1URJA 3JCMf 4C5HA 1QP3A 2CS7A 1KD1C 3VV0A 1W2BS 4C92C 3LGFA 4F7UG 1K8AC 1G5VA 3OYKA 2D6FA 4C5IA 1VQ9T 5LJ5e 1X75C 4BDYA 1VIFA 1W2BA 4CRIA 2JZ2A 3QUIA 3O0FA 3AHUA 5D6XA 2VIXA 3RIRA 1VQMT 3CCSA 4F7UE 4J6XA 1A0PA 3JSCA 3GF5A 3CCUT 2K8BB 1S72A 1XQHA 4KMOB 3BW1A 4DOWA 3CMAA 2ZIWB 2ZPGB 3CP8A 2WACA 4P0PB 3GPLA 5A0LA 3A8HB 3H0MB 4RCCA 3I56A 1P92A 4KUDK 1H3ZA 4AYBC 3P8DA 1Q3UA 2PQWA 2RJCA 2H3VA 3ZFJA 5LJ5d 3C4SA 1X6OA 4N0AA 5KE2A 2F5KA 2KV2A 4N4GA 2M0NA 5GAN4 3LYIA 3C28A 3ZBDA 1MA7A 3UPUA 1NPRA 3OYIA 2IVWA 4QQDA 2LCCA 3GU3A 4OF1A 4E7LA 1OZ2A 3L3FX 3MCAB 3OBWA 4BY6C 4QNLA 3OS0A 3UT1A 4O5VA 2RJFA 1OZ3A 2H3ZA 3I55T 3FB9A 2CKKA 3S3MA 3NTHA 1ZHIA 3ZEHA 3OS1A 1K9MC 3M4YA 4FM4B 3JB9F 2KJ8A 4QQ6A 2HBMA 2H3FA 1YJNA 3TCJA 1P7DA 1QVFS 4MZMA 2K89A 4M7DD 2E6NA 4NOYA 1YHQT 4V2SA 3OS5A 4ZGJB 4HKEA 5FU6B 2KHVA 3SB2A 2XD0A 4FZNA 3KUFA 1QVFA 4C8QG 5HR6A 5D6WA 3OW2S 4FIBA 3GOXA 3FC3A 2MF2A 3NUQA 1UEBA 3V8JA 3N5BB 2HQEA 4M7DA 3CCLT 4IUQA 3OW2A 3JB9G 2HBKA 4J6YA 5LJ5g 2KJ5A 4J83A 4QW2A 2EFIA 2QQ9A 1KHCA 4WF2A 5GMKj 2QXFA 3MHXA 2MI6A 5KE3A 2Y90A 2VJ5A 4IKFA 4OB3B 3WXMB 2LKYA 2E1HA 5KL1B 2RHUA 3O8VA 2CGHA 3GNFB 5I2MA 2ZPHB 2PUKB 2YX8A 2Y4XA 4R56A 4GY5A 2XU8A 3OQ5A 4C92F 2RI5A 2G07A 3A8LB 3PSIA 1WUDA 3H0RB 1VQ5T 2JVVA 3IG8A 1NZ9A 3SAFA 1WJRA 1NZBA 5IN1A 2QTXA 3SAHA 1YITT 4M7AB 3A8GB 3PFSA 5C0MA 2F76X 3HRSA 4M75B 5GAN5 3CCMT 3TREA 3CYMA 3RESA 5KH6A 2XDDA 4A4GA 3M6ZA 2K5IA 2X35A 2EYQA 4MMKA 3AL0B 1NPPA 3RMQA 2G08A 1VQ4T 2M0OA 5FRMA 2L5QA 3SAGA 3CMET 3CCET 1BKBA 3PTAA 2K4IA 5A0DA 5GAN2 2Y0SC 4A8EA 3OYCA 2DEQA 2MMPA 2EKOA 2R18A 4F7UA 2PMZC 1PVPA 2DXCA 2CZ0B 4JUVA 2DVEA 3M7DA 1VQOT 2DXBA 4AYBF 1LNXA 3HKZC 2VUBA 4EPCA 4IUVA 3V7CA 2LNVA 2N1RA 2DIQA 2F8LA 2R5MA 3X20B 2ZGWA 4O6JA 3CC4A 4XTVA 3CBOA 3JAME 3CCVT 4C0DC 3KXTA 1ECWA 4C92E 2DK3A 3V8LA 4XAXB 2CZ7B 2GF7A 2WAQC 4BUGA 5C0YA 3L2VA 4NWIA 2DTOA 1Y71A 1MGQA 4IUTA 4U6PA 5CCAA 3CCRA 2QA4T 2RHIA 1OYXA 3CEYA 1BIAA 1Q82U 1SSFA 4EDUA 2CRXA 3RKXA 3CXCS 2XIDA 3CD6A 2RHFA 3DKMA 3A5ZB 2RP5A 2ZIUA 4N4HA 4WJ3B 3RUXA 3RERA 2LTOA 2WSCE 3JB9J 5L8RE 3CXCA 4X9DA 3UDCA 2JTFA 3V8KA 1VQNT 4F7UB 1NE8A 4C0FA 2DTIA 4CRXA 4JLGA 4GFJA 2CYZB 1M1KU 1Q81U 3URGA 2LDMA 3E0FA 3G6ET 1IZ6A 4JS4A 4M7DG 2KIWA 5CKBA 5I2SA 5GAMj 2QI2A 4Q5WA 1X01A 1HEKA 2RJEA 2NV3A 1WJSA 4EMGA 1SZHA 2LC4A 2D0QB 3JB9D 5KCHA 3CCQA 5CIUA 1OI1A 2MWPA 4QVCA 1M4ZA 2KDSA 4M77C 3PSTA 5GAN7 3JB9H 5LJ5j 4IUUA 1BI0A 2HNIA 4OGCA 4XTWA 2OTLT 3TEEA 4PNOA 1WPYA 4PJOG 5CR2A 4CI0C 5HK0A 3MEUA 4OJOA 2I2LA 2R57A 3OPXA 3DLMA 3F2BA 1Q82C 3HSBA 3CPFA 2RHYA 2H3JA 3CC2T 1Q7YU 2ZIUB 2OYYA 3VYGA 4DA4A 3JCMP 3CBMA 3OYFA 3QJYA 2EIFA 1N8RC 2QEXT 2QQBA 4PJOE 1VQ7T 1PSFA 1RI0A 1I4K1 3D2NA 2EWNA 3R6OA 4JRKA 1IIPA 4LDUA 2G5IB 2ZPFB 2DIGA 2E70A 4A4HA 3S3NA 3S6WA 2YHTA 4ME7A 2ZXIA 1FXXA 2KHQA 3C95A 4B9XA 2F69A 1M1KC 1PSEA 5GAMe 4LDVA 2K2VA 2ZG6A 1UGRB 2Y0SF 2K57A 2G5HB 3OA6A 4KX3A 5A2QE 3LH0A 2PMZF 2G3RA 5LJ3h 2WSEE 3QZ5B 2A7YA 3C12A 4PL2A 2K3YA 5IT9E 3PIOA 3HKZF 4C92D 2DD4A 3C94A 4HT8A 5FU6C 4C8QB 2X4YA 2EQMA 2ZXHA 1UGQB 3OB9A 3VJPA 1D3BA 3H8ZA 2KNJA 3QHSA 2EQKA 3S3OA 4RMOA 1JBMA 4OP0A 2KAFA 1YI2T 2WAQF 1XOVA 3HRUA 3LVWA 3G7ZA 3AQEA 3ME9A 2GCXA 2PUOB 2RA2A 3C29A 4M78C 4ELZC 1Q7YC 4C92A 5GAMd 2HD0A 4Z02A 4PLIA 5D6YA 1VQ9A 1Q86U 2P0PA 3LVVA 1N6AA 5GAOq 2DZCA 2RI2A 4X34A 1VQMA 1KC8U 2K4HA 2DTHA 2RHZA 2XI9A 3CCUA 3MO8A 2O4XA 2MAMA 1N27A 5FU7B 1VQKT 3ONNA 1VQPT 1W4SA 3DEEA 3M57A 4KT0E 4FZLA 2L89A 3SFMA 5J39A 2KQWA 2V8KA 4BJQA 5CKHA 1D3BB 2V8IA 4M7AC 3MEAA 3E19A 5GAOp 3BY7A 4BE2A 4M75C 5EG2A 3KBGA 5LJ3e 2E10A 4JRPA 3HFNA 4ZTFA 3PZPA 2DXTA 3FRNA 3L1AA 4O3MA 3M54A 1BI2A 3CBPA 1M90U 3N7PD 2DF4B 1K73U 4M77F 3HKSA 4LD9K 4XU2A 2B8AA 3QZ9B 1I81A 2HBPA 2LVMA 4EMHA 4J8OA 5GAMg 3I55A 4JS5A 4NL3A 2K5LA 2ZZDA 4A54A 4PJOD 3CRXA 1AHJB 2VXEA 4BD3A 5T14A 4JLIA 2VV5A 3WVEB 5CVIA 3ER0A 4OJLA 1YBYA 2ZCFB 2O4XB 4L6V5 2W7PA 3M56A 3INZA 2EJ9A 3L2ZA 1YHQA 2W03A 5LJ3d 5FRNA 1XNIA 3QPHA 1KC8C 3MEVA 2PU9B 1TH7A 2DZ9A 4Y28E 4J7FA 3RMSA 2A3LA 4E7IA 2LRQA 2JUFA 1Q3VA 3TU4K 2DPPB 4LD6A 1QW1A 1KQ1A 5CKDA 3X26B 4C5GA 4PJOA 3META 3PIPA 5GAN6 2QQAA 4RG2A 4BX9C 3LWIA 4PKCC 4A53A 2YB4A 3CCLA 3SQIA 2BDUA 2RD1A 4M77E 4TVRA 2JH7A 2FYKA 2KSSA 3NTKA 5DY9A 3G4ST 2OAUA 4NLBA 1G3SA 2RI3A 3AQFA 4PLLA 2GFUA 1M90C 4N4IA 3JB9I 3OYYA 2W04A 3PSFA 1K73C 1YIJT 1N9RA 2HBLA 1VIEA 3CCJT 1O9SA 3D2SA 4M7DB 2KMTA 3HP9A 4NL2A 3OYHA 3SMVA 1BI1A 3JCMJ 4JMUA 2LX9A 1WGSA 2X4JA 4M78F 2H3IA 1VQLT 1GO3F 4C92G 1VQ5A 4XU3A 3RKYA 3CC7T 5LJ3g 1QVGS 2E12A 1KQ2A 1YITA 3VUBA 2L8DA 4IUPA 4PJOB 4ZGDB 2E6ZA 4B9WA 3CCMA 3M6KA 3FIFA 2G0AA 3V7RA 4KUIA 2EQJA 4XTXA 3NTIA 1QVGA 3OYAA 4A4EA 3E1SA 5CRXA 3RKWA 2E1FA 1VQ4A 3CMEA 4HT9A 4MZTA 3CCEA 1R8OB 3PMIA 3IP4B 3VC8A 4IC9A 2DQNB 3M9QA 2QDYB 2M1HA 3OYBA 3OMGA 4C0ZA 4FL6A 3VCBA 1VQOA 3FJPA 2KOBA 4HCZA 1PVQA 4J6WA 2DO3A 3QBYA 1Z1BA 4M7AF 2IG0A 2K5FA 4OB1B 3MP1A 4M75F 3X24B 5GAN3 4BE0A 4FSXA 1B34A 2E64A 3SWNA 3KZXA 5GMKm 3CCVA 4M78E 3PMTA 3GNGA 1Y96A 2EJFA 5GAMf 1YJ9T 2EJGA 5FROA 3RFAA 3ALRA 2QA4A 2LBOA 4PL1A 3LWHA 1H641 2MRLA 2DGZA 2XK0A 2FHDA 3QYGB 1NJIU 4CDGA 2RJDA 5LJ5f 1YCYA 3PNWC 2KKVA 3NRWA 4C8QC 3LW5E 4OVAA 1HIWA 2LYBA 4XTUA 4JRQA 4FE3A 2LT4A 3G71T 4HCCA 1I5LA 3OYJA 2VJ4A 4R55A 2HOFA 2L3RA 1U1TA 1XTDA 5CQXA 4BI4A 1KD1U 2VGMA 4LDYA 1VQ6T 1VQNA 5CK9A 1UPHA 5FLXE 2ZIVA 5GANh 2OH2A 4XU0A 2EQUA 4M7AE 4M75E 5HY6A 3JCMb 3LX7A 1YJWT 4M77D 4BACA 2GQVA 3H0LB 3PSPA 4J5YA 4XU1A 2PVGB 3G6EA 1B34B 3SWNB 4MDXA 1VQ8T 4GLKA 1Y07A 3IG5A 4ZGEB 4QQGA 4L59A 3A8MB 2WB1C 2WSFE 1Y96B 2KKPA 4BI8B 3BDLA 2G06A 2HQXA 2OTJT 2MA1A 1EIFA 2K8CB 3T9NA 3QDRB 3KFUF 4F7UF 2LCLA 2E1EA 4M77A 4FZMA 5FU7C 4MZPA 2D6FC 3M59A 3LLRA 3QIIA 2OTLA 1MHNA 4ZN3A 3VYHB 2LQ8A 3F53A 3L2UA 2RHXA 2KK4A 1Q81C 2VXFA 4MMLA 1ZQ1A 3CC2A 2JMGA 2KVCA 1DRGA 3CCST 5J3BA 3J81E 1S72T 2QEXA 4U7CA 4FT4A 2ZIVB 1VQ7A 3FLGA 4RCBA 3CMAT 1KQSS 3F5AA 2ZPIB 1IREB 5HR7A 2YRVA 3JCMh 5HK3A 3F70A 2DJZA 3MP8A 3FEOA 5CKFA 3JCMQ 2E41A 2XDPA 3RF9A 1K9MU 3OBYA 3Q1JA 2R5AA 3I56T 3M5AA 5LJ3j 4L5GA 1KQSA 2PVDB 2JNGA 3DB3A 4EMKA 2VGNA 5GANe 5CO7A 3V7SA 2XKOC 4OJ6A 3HFOA 1U8RA 3OSVA 2RK2A 4N0AC 2Y4YA 2ZIXA 5GMKl 1XNSA 3JCMW 2K8AA 2X4WA 4M77B 4M78D 5I21A 3CPWS 1PVRA 5C6SA 2F77X 1WJQA 2P0QA 3F2CA 2VKQA 5AYFA 2DKGA 3T79A 4KULA 3EAEA 4ELYC 1N9SA 4YTLA 4MDWA 2HMXA 2K4YA 3CPWA 2VYTA 5KCOA 1YI2A 2QQRA 4QVZA 3D2QA 2CZ1B 4IURA 3QSUA 1U1SA 3PGGA 4OB2B 2GOLA 2XVTA 3X25B 1G3YA 1KHIA 4ATOA 2XDBA 1YJNT 3GP8A 4M78A 1ZBXA 4HA8A 5GANd 5CQYA 2X4XA 3GLXA 2P4TA 3LGLA 5HKCA 3OY9A 3VKIA 2KJ9A 4J7IA 3EFRA 4C8QF 3H6ZA 4OMFB 5KL8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUG A;  4C0Z A;  5A0G A;  2XID A;  2XIC A;  5A0L A;  2XI9 A;  5A0D A; 
#chains in the Genus database with same CATH topology
 2LYA A;  4XTZ A;  3BFM A;  1OUQ A;  3ZDE A;  5CKE A;  1SKU B;  2FDR A;  7ICL A;  4ICA A;  2CZ6 B;  4EEN A;  5L1M A;  1UA1 A;  3RJJ A;  2FPL A;  4FS2 A;  4G9B A;  1T0J A;  4E47 A;  2F2A B;  2Q4T A;  2DAQ A;  1CUK A;  4UC4 A;  4EMK B;  4IL6 U;  3TAC B;  1TV9 A;  5F9L A;  4FSS A;  3SDZ A;  4BDP A;  4M7A D;  4Y91 A;  2IOH A;  4OJ5 A;  2ODG A;  2VC8 A;  3VS3 A;  4A4K A;  4M7D C;  4KLJ A;  4M75 D;  2HBJ A;  3S6J A;  5GAN 8;  1HK9 A;  2FB7 A;  3JCM e;  1LKY B;  2BHN A;  2ZIX B;  4MHV A;  1QP2 A;  4B6J A;  3KHL A;  1X2K A;  4DL4 A;  1T8E A;  5KAF U;  2FLL A;  4C92 B;  2OTL Q;  5ALX A;  5KFY A;  4BGD A;  3F2D A;  1ZQL A;  2BR0 A;  4D8K A;  1VQK A;  1QLN A;  1VQP A;  2LHT A;  5A0G A;  4KLH A;  1Z4O A;  2HKN A;  1DJ7 B;  1WYG A;  4JJN K;  3OYM A;  1T7P A;  3QZ8 A;  1RYR A;  8ICT A;  4RKU E;  4O3O A;  4RTT A;  1UHC A;  1C20 A;  3ZI4 A;  1HXD A;  4BI3 A;  2EVR A;  2FLN A;  4NLC A;  3CC2 Q;  4FT2 A;  4OO1 J;  1M2O A;  3JCM c;  2L3S A;  3E9G A;  2JN0 A;  1ZSZ B;  4P0Q A;  2CT3 A;  3EH1 A;  2ZAE A;  5CAI A;  3RR7 A;  2RLT A;  2CT4 A;  2J6K A;  2AH5 A;  2NWM A;  3TAQ A;  4FYW B;  5DM7 R;  4LUD A;  1WQW A;  4PJO C;  4M7A A;  4BE1 A;  5AI5 A;  1AWX A;  3L2Q A;  3BQ7 A;  1V29 B;  2FL7 A;  1Q86 C;  4Z8A A;  3C23 A;  3JV3 A;  4M75 A;  4QVD A;  4KGZ B;  1YT3 A;  5DLQ E;  4JPB W;  3QU9 A;  2QEX Q;  5E79 U;  2WB1 F;  2RO0 A;  5GMK h;  2NLU A;  1TTH B;  3GIB A;  4YR3 A;  2BCS A;  1VQ7 Q;  2LM1 A;  3V7J A;  4NV0 A;  1KSP A;  2F2X A;  3VU3 C;  4KN7 A;  1L7P A;  4AMC A;  2MCN A;  5GAO m;  3TQ1 A;  4YXJ A;  5KFD A;  4DFJ A;  5AK4 A;  4M4Z A;  1NK8 A;  2OXO A;  2BKD N;  2R8H A;  1GXI E;  4J9E A;  4AT1 B;  3VS2 A;  5IHK A;  2AHJ B;  2BIV A;  4M78 B;  2R8K A;  4JRI A;  2FMQ A;  4QIW C;  2CP5 A;  2FO0 A;  3IN5 A;  3HW8 A;  1BPE A;  2JZB A;  2HVI A;  4JDS A;  4M77 G;  4LDW A;  4Z89 A;  4E7H A;  2PFN A;  4I2C A;  1SGG A;  3JCM d;  1BPX A;  1SB3 C;  5LL6 S;  4C8O A;  2P6R A;  4C8Q E;  2FVU A;  3ZL7 C;  1HJP A;  4JV0 A;  5GAN g;  2EAP A;  5K4L A;  4F4X A;  2ZUD A;  4FBU A;  2HL5 C;  2K4E A;  1KIK A;  5FWC A;  3PO5 A;  4P5N A;  1RL2 A;  1ZRN A;  2F5T X;  3H41 A;  3MC1 A;  3OS2 A;  1RUW A;  5ALV A;  2I5H A;  1MV0 B;  4F4W A;  2HOI A;  2QQS A;  5KG5 A;  4M9H A;  1Z9Q A;  4KLU A;  2DIL A;  3ULR B;  1RM6 C;  3V7L A;  3SV4 A;  1WQ7 A;  5KFV A;  8ICW A;  1Q8K A;  5GJW B;  2V8J A;  5HCK A;  2KEY A;  3EGD B;  3M4G A;  3MFI A;  1X43 A;  1QWE A;  3EW9 A;  1IHV A;  4D6W A;  9ICL A;  1VQ9 Q;  2OM6 A;  1KSW A;  3C1Y A;  3M58 A;  3GFK B;  2RH2 A;  2LT1 A;  3L2R A;  2P6U A;  3ZDD A;  4JWN A;  1KC8 R;  2AQ0 A;  1G3W A;  2F3N A;  3N7R C;  3U26 A;  1CKA A;  2CP6 A;  4P2H A;  1TSF A;  2L3Q A;  4BY6 B;  5D7U A;  4DQR A;  4R8U A;  4KBM B;  3J7A F;  2JMA A;  4RG8 A;  2CN1 A;  5KT2 A;  2JGA A;  8AT1 B;  4A4F A;  5L9X A;  2V1R A;  7ICM A;  3QUT A;  3H4B A;  2RQU A;  3TAD A;  1PNJ A;  2CUB A;  5GJV B;  1YI2 Q;  2W7O A;  1UB4 A;  1G3T A;  4P0Q B;  3GII A;  2LZ6 B;  5DLO A;  3E58 A;  1AZG B;  4FW2 A;  3I35 A;  2YB1 A;  5J2C A;  1L3V A;  2RK1 A;  1Q46 A;  4HCB A;  3DB4 A;  5AK3 A;  3RRG A;  2KY9 A;  2KVQ G;  4E7J A;  4DOV A;  1VJ5 A;  3SI8 A;  4HYK A;  1UGS B;  1CRX A;  1QQ5 A;  3CW2 C;  2XGP A;  1XSN A;  2RM4 A;  3HX0 A;  4RTY A;  3OYN A;  3CC4 T;  1X66 A;  2C2E A;  3NFC A;  2HCF A;  5J2E A;  1O75 A;  3J80 E;  3PX0 A;  1X6J A;  1G2B A;  5DDM A;  4CGZ A;  4F4Y A;  4II1 A;  3RJK A;  2KZ3 A;  2DXU A;  2AKL A;  1Y7X A;  3PT9 A;  1WWU A;  2EZZ A;  2JHD A;  3RRH A;  4EZ9 A;  4PGY A;  3REB B;  1U3O A;  4XQ3 A;  1PK1 A;  1Z00 A;  3ICX A;  2VVK A;  3X28 B;  3G4S A;  5DQH A;  3TKA A;  1UGP B;  5IIK A;  1SV0 C;  4ZNX A;  1M3C A;  5L1K A;  2QLT A;  3P8H A;  2EAY A;  4PL6 A;  3SD4 A;  3PW4 A;  4DSL A;  4I2E A;  5KG0 A;  4MFF A;  1Z19 A;  3INZ A;  1T3Q A;  1ZOL A;  2JOY A;  3CCR T;  2FJ6 A;  2CP2 A;  5GMK e;  3IHQ B;  4QJF B;  1A6S A;  1MND A;  1T3L A;  1YIJ A;  4K4G A;  1M90 R;  4LDX A;  2KIC A;  1IXR A;  5J26 A;  3QWY A;  3JCM g;  5J0Q A;  2BQR A;  1K73 R;  3BDU A;  4OMO A;  3CCJ A;  4KX5 A;  9ICB A;  4YCX A;  1B0X A;  1KG1 A;  2H3Q A;  2W8L A;  1K1S A;  2EYX A;  1QKX A;  2O9V A;  4DBF A;  2BGW A;  4Q45 A;  4F91 B;  2VA8 A;  1GFC A;  1M9S A;  1Y0M A;  2RB6 A;  3UWN A;  3VUZ A;  1TAM A;  5KFS A;  1PRL C;  2DD5 A;  3CD6 T;  3ASK A;  3JPQ A;  2DBK A;  1BYM A;  5GAO n;  7ICF A;  2G09 A;  3OYD A;  3SWN C;  3ZDB A;  3ORY A;  5J29 A;  3TAN A;  1ZJN A;  4I2J A;  2JEJ A;  1QVP A;  1VQL A;  2XMF A;  4RT3 A;  1SL0 A;  3QG1 A;  4X9C A;  3QYH B;  2RDJ A;  4BB7 A;  4YD2 A;  2HL3 A;  4M78 G;  2KG5 A;  3I55 Q;  4OMP A;  2KK0 A;  3BS7 A;  3L42 A;  2KFN A;  3JCM V;  1UG1 A;  2LJ3 A;  4NL9 C;  4PHD A;  2JXB A;  5KFU A;  3F5E A;  2J7I A;  2VWF A;  2ZPE B;  3CC7 A;  4C7Y A;  9ICX A;  1YN8 A;  1N5W A;  1SKW A;  8ICE A;  3SZ2 A;  4DOA A;  3EG9 B;  4FU6 A;  3DLL A;  3KOO A;  7AT1 B;  4R8U B;  2FPM A;  2FRY A;  1OV3 A;  3OYL A;  5EOZ A;  4QW9 A;  8ICN A;  4KH0 B;  2RQV A;  5M9O A;  3DV9 A;  4RQ6 A;  4DF8 A;  3BDP A;  1U4B A;  5G5H A;  1O03 A;  1M5Q 1;  1SZP A;  4M9N A;  3OYG A;  3QKJ A;  4F14 A;  3QX7 A;  4KRT A;  2WF5 A;  4QZH A;  3EZ5 A;  5GAO r;  1LOJ A;  4C5E A;  2HHQ A;  1QWF A;  3HHT B;  1QMC A;  1M8V A;  4B9L A;  1Z4N A;  1DK2 A;  1JEG A;  2DET A;  1UFF A;  1ZQF A;  3HRT A;  4ACO A;  4OJP A;  4M7D F;  3QXE B;  1ZXI A;  1M1G A;  2XIC A;  3P8B B;  4B9U A;  3N7S C;  1JI7 A;  1N48 A;  5ALK A;  2O31 A;  1A0N B;  1RXW A;  3WK4 A;  4RQ2 A;  1QTM A;  2M16 A;  3TQ7 P;  1FEZ A;  1N8R U;  3K1Z A;  3T5L A;  5KT7 A;  1UA0 A;  1PK1 B;  1RDF A;  1Z00 B;  5KFW A;  3UQ2 A;  1IB8 A;  2E65 A;  1JJ2 S;  3NRZ A;  4XTY A;  1FX7 A;  2BUD A;  2KEA A;  1F44 A;  1DGS A;  3WVD B;  2OHF A;  5GAO l;  1I8F A;  4F4K A;  2O01 E;  1M1F A;  1GFD A;  2P0K A;  2GH1 A;  2A37 A;  2XG8 D;  2HOQ A;  9ICO A;  1QSY A;  4OGE A;  3CCQ T;  5J0S A;  1D8B A;  3A8O B;  2P66 A;  2QK0 A;  1X2Q A;  4LXC A;  1ZQB A;  2YML A;  2FI1 A;  4NXZ A;  1L6N A;  2R58 A;  4QZ9 A;  5GAM h;  3BS5 A;  4RNN A;  2CPR A;  4J9G A;  4XK8 E;  4PJO F;  1JJ2 A;  4KGV B;  1N60 A;  4X1V A;  4GC6 A;  1LJO A;  2HAX A;  4M7A G;  1H3H A;  3MP6 A;  3GZF A;  2K60 A;  5DB9 A;  1WNL A;  2E5Q A;  2M9U A;  3RB0 A;  4M75 G;  3EGX A;  4F93 B;  3BQ1 A;  4C0G A;  2E5K A;  1IHW A;  3LYS A;  3MEW A;  2YRD A;  5IXB A;  4J9R A;  1TWB A;  3Q8Q B;  2BPG A;  5KFQ A;  2BQU A;  4C8Q D;  2HQH A;  2AGO A;  4F04 B;  3FDR A;  1UQV A;  2GLE A;  3K1R B;  4IIM A;  2KSO A;  2LQK A;  1TUD A;  1KBU A;  1ED1 A;  3E9F A;  3H0I A;  2J6S A;  1H8K A;  1OQK A;  5LJ5 h;  1JB0 E;  5GAN f;  4QZC A;  2SRC A;  1YJ9 A;  2JTM A;  3OYE A;  2V9W A;  4QIW F;  1K8A U;  1QVG P;  1VOM A;  1SWW A;  4O3N A;  1BVS A;  1VDV A;  2F2V A;  4M9J A;  4MFA A;  4OD0 A;  1UT5 A;  3MR3 A;  4EBE A;  1AEY A;  2COZ A;  3HJE A;  1GRI A;  4JJD A;  4QWC A;  3JRZ A;  2PFP A;  4GIB A;  4QWA A;  2GFA A;  2MWO A;  3RJG A;  4EEL A;  5IIJ A;  1T0H A;  3HL8 A;  1X40 A;  2C06 A;  2Z7J A;  3RTV A;  4R65 A;  4DL5 A;  3OMC A;  5KFO A;  3R6N A;  4I27 A;  4OB0 B;  2HHT A;  2FE9 A;  5IH2 A;  2K3X A;  4PK4 A;  3TSZ A;  2A08 A;  3OSS C;  2HVH A;  3EPI A;  3RBE A;  4O5C A;  1GCQ A;  4M7D E;  4C8Q A;  2ZPB B;  4ZN1 A;  2YLB A;  5GAN j;  1U5S A;  3V6H A;  1OEB A;  4C0D B;  5AKG A;  4DQS A;  7ICP A;  3M53 A;  3L2W A;  2KD1 A;  1XSL A;  1JRI A;  4BDZ A;  4RPY A;  2YN4 A;  1XO0 A;  4B9M A;  4F5N A;  2Y1I A;  3G71 A;  3G4S Q;  1T94 A;  1KK7 A;  2NYV A;  3QJ6 A;  4ELT A;  1BIB A;  4C80 A;  4TUR A;  3JCM X;  4KIT B;  2QTV A;  2YLC A;  2J6T A;  1K4U S;  1GBR A;  3MBY A;  1IXD A;  8ICH A;  2F2W A;  3BQ0 A;  1ZQ1 C;  4AFS C;  4NS5 A;  5FW9 A;  4DEX A;  5GMK i;  3CCM Q;  4RU9 A;  1VQ6 A;  1VLB A;  5AKI A;  5I11 A;  1YIJ Q;  5KFJ A;  2Z0W A;  4Y2P A;  2A3V A;  2SEM A;  5BOL A;  2ZIW A;  4DQ2 A;  1UEC A;  3CCJ Q;  5KYY A;  8ICX A;  3RH6 A;  1JAL A;  5J0T A;  2XY5 A;  4VUB A;  1BI3 A;  1UE9 A;  1VYV A;  2AK5 A;  1TS9 A;  4ED8 A;  1YJW A;  4R64 A;  4DO9 A;  1ZQM A;  4P0P A;  3EFS A;  1QH9 A;  3QO3 A;  1NEB A;  3BS5 B;  2MAX A;  2BE9 B;  2FEI A;  2PKE A;  1JXL A;  3K75 D;  3ZDA A;  1VUB A;  1ABQ A;  3UQ0 A;  3MGH A;  4C8L A;  1VQ4 Q;  2EQI A;  1I07 A;  1Y57 A;  3CCE Q;  5EC7 A;  2UVR A;  2JH1 A;  1SKR A;  1NKB A;  2BZ8 A;  5DBC A;  4X5V A;  5IAY A;  1FFV A;  4US9 A;  3C2M A;  1NJI C;  5KFH A;  9ICV A;  3EGX B;  1WHL A;  1VQL Q;  4JZ3 A;  3THV A;  1COO A;  4ED0 A;  5CB1 A;  2XO7 A;  2E5S A;  1YZ6 A;  2RRD A;  3MAB A;  2HHW A;  2KGT A;  2YSQ A;  4J9F A;  5LJ3 f;  4E7K A;  3M55 A;  1VQ8 A;  2KRO A;  4ZTJ A;  2C0I A;  1YP5 A;  2FMP A;  3M0S A;  1FWZ A;  1RYS A;  2PVO B;  4O3Q A;  1OXJ A;  3UMG A;  3HPW A;  2IHM A;  3KKA A;  4FS1 A;  2D0N A;  4EMK C;  4YMM A;  1YZ7 A;  4LN2 A;  2XHC A;  3MGV A;  3RJF A;  2D9T A;  3RJE A;  5IXF A;  2OTJ A;  4EBC A;  3EHQ A;  1URJ A;  3JCM f;  4C5H A;  1JIH A;  1JXE A;  4OMM A;  4QZ8 A;  1QP3 A;  1NK9 A;  1O08 A;  2CS7 A;  2WTF A;  2C22 A;  1BCM A;  1KD1 C;  3VV0 A;  5J2A A;  3H0H A;  4B9N A;  1W2B S;  4C92 C;  5DB6 A;  1ZA2 B;  3LGF A;  4F7U G;  3VS4 A;  1RAD B;  2B6G A;  1K8A C;  3CCV Q;  1G5V A;  3OYK A;  4J9B A;  2DPI A;  2D6F A;  4RTZ A;  4C5I A;  3PO4 A;  2QGF B;  3UA6 A;  1VQ9 T;  1KTQ A;  4UBB A;  3HRD D;  5LJ5 e;  1X75 C;  1RG6 A;  4DFP A;  1G8X A;  1WFW A;  2YUP A;  4BDY A;  3C2L A;  5HP4 A;  2D3D A;  1VIF A;  1W2B A;  1D1B A;  4O3S A;  4CRI A;  2JZ2 A;  3QUI A;  3M0T A;  3O0F A;  1ZQD A;  4DS4 A;  5KFA A;  3IDW A;  3TI0 A;  4DEZ A;  1ZSZ C;  3AHU A;  4YXM A;  1C7Y A;  4JWM A;  4ESR A;  3V6J A;  4ECY A;  5D6X A;  1Q81 R;  3RB6 A;  9ICA A;  2Y9T A;  2VIX A;  9ICR A;  1ACM B;  3RIR A;  2FLP A;  3VS7 A;  4ECQ A;  2LJ1 A;  1ZLM A;  1WA7 A;  1TAU A;  1H92 A;  4O0I A;  1VQM T;  3CCS A;  2OAW A;  4F7U E;  4J6X A;  1A0P A;  3JSC A;  3GF5 A;  5ALQ A;  3GV5 B;  3CCU T;  4FYX B;  4ED3 A;  2K8B B;  1NJY A;  5AKL A;  1S72 A;  4DL3 A;  2EKH A;  1XQH A;  1KEJ A;  3M9O B;  4KMO B;  3RAX A;  2DLP A;  4I2I A;  8ICM A;  3BW1 A;  4DOW A;  5KG2 A;  3CMA A;  2HMA A;  3KHR A;  2ZIW B;  3UA7 A;  3MPU B;  1WCL A;  1QCK A;  4Y2S A;  4PHP A;  2ZPG B;  1U9L A;  5KYY B;  4DFM A;  3CP8 A;  2FPK A;  5KYN A;  1S0N A;  1MMD A;  2WAC A;  1PUZ A;  4KLG A;  2DL5 A;  3RDV A;  4P0P B;  2ALZ A;  1S0V A;  3G1J A;  3SV3 A;  1X6B A;  4Z6E A;  3GPL A;  5A0L A;  4DBQ A;  4M9L A;  3H0M B;  5AK5 A;  2AT1 B;  3A8H B;  4Y2R A;  4RCC A;  4C7Z A;  4AP9 A;  3NVZ A;  2JT4 A;  3I56 A;  1P92 A;  1RAG B;  3M9M B;  2FPE A;  4KUD K;  3QU7 A;  1H3Z A;  3V6K A;  2VA2 A;  1ZRM A;  4AYB C;  4DS5 A;  4UAR A;  1R0C B;  2IOF A;  3P8D A;  1YJ9 Q;  1Q3U A;  2PQW A;  1S10 A;  9ICW A;  1RAA B;  1S1N A;  2BZX A;  2I0N A;  2K3B A;  2RJC A;  3MJX A;  5III A;  2H3V A;  2D8H A;  1B43 A;  3ZFJ A;  5LJ5 d;  4OMQ A;  4WCI A;  1SKS A;  4IR9 A;  4UQG A;  4QW8 A;  3C4S A;  4C4R A;  4ED1 A;  1X6O A;  4N0A A;  5KE2 A;  2F5K A;  2KV2 A;  3A0H U;  4C8M A;  3WU2 U;  1FO4 A;  1YFN A;  4ECW A;  4N4G A;  2ZUC A;  2DWQ A;  2M0N A;  5GAN 4;  1NK6 A;  5KFN A;  3LYI A;  3C28 A;  4NJ8 A;  3ZBD A;  2OI3 A;  3QWX X;  4DCC A;  3LDA A;  2F1H A;  1MA7 A;  3UPU A;  2M51 A;  3G6E Q;  4DWI A;  8ICG A;  1NPR A;  3PV8 A;  3OYI A;  2IVW A;  1IG6 A;  3RBD A;  4QQD A;  2LCC A;  4NM2 A;  1JUD A;  3C21 A;  3GU3 A;  4OF1 A;  4E7L A;  1OZ2 A;  1T3S A;  5ALE A;  3L3F X;  4I2G A;  3MCA B;  3OBW A;  4QNL A;  4BY6 C;  4GXJ A;  3OS0 A;  3G71 Q;  2FRW A;  1D8L A;  3UT1 A;  4XA5 A;  3NVW A;  3UM9 A;  2RJF A;  1OZ3 A;  2H3Z A;  4O5V A;  4ZH4 A;  3I55 T;  3OGU A;  3FB9 A;  2CKK A;  5AKK A;  3S3M A;  4QZD A;  1L5U A;  5J0W A;  3EG2 A;  1ZHI A;  3NTH A;  3ZEH A;  3OS1 A;  4F3O A;  1ZQX A;  3I28 A;  5KTQ A;  4UAS A;  1TE2 A;  3M4Y A;  1K9M C;  1VQ6 Q;  3MGI A;  3M8R A;  3T5J A;  2AIR B;  4FM4 B;  3RJH A;  2BE7 D;  1L7N A;  2KNB B;  3JB9 F;  1ZJM A;  2KJ8 A;  1KKX A;  4QQ6 A;  2RDI A;  3V72 A;  1TUG B;  3PR4 A;  2HBM A;  9ICI A;  4CC2 A;  2H3F A;  1YJN A;  3PVQ A;  3TCJ A;  1P7D A;  4AFU C;  1KW4 A;  1QVF S;  3RJI A;  2K89 A;  4MZM A;  1YJW Q;  4M7D D;  5C5J A;  4IRD A;  1Z3E B;  1NZP A;  1FFU A;  1ZQT A;  2E6N A;  2W9A A;  4NOY A;  8ICQ A;  4P4O A;  1YHQ T;  4V2S A;  4ELU A;  3OS5 A;  2X51 A;  4YVZ A;  4ZGJ B;  3LH5 A;  1HUO A;  4M04 A;  2QB0 B;  1L3T A;  4HKE A;  5FU6 B;  2KHV A;  3SB2 A;  1PZN A;  4GC7 A;  2XD0 A;  4FZN A;  3KUF A;  2WFA A;  3LWL A;  3QEA Z;  1D1C A;  1RQL A;  4J9H A;  1QVF A;  3PML A;  2J06 A;  1VQ8 Q;  2EPD A;  5KG7 A;  1ZYQ A;  3FC4 A;  4MF2 A;  1KFS A;  4C8Q G;  1WG8 A;  2Q0Z X;  5HR6 A;  2LJ0 A;  5D6W A;  3OW2 S;  1SRM A;  4FIB A;  3GOX A;  2EGC A;  2FG0 A;  5CWR A;  4PFO A;  5ALT A;  3FC3 A;  3EPG A;  2A19 A;  1NLP C;  1D9F A;  2MF2 A;  3NUQ A;  4O3P A;  2OTJ Q;  1UEB A;  3V8J A;  1F0M A;  2BZF A;  2DE0 X;  1WXB A;  4CF5 A;  4J9O A;  3N5B B;  1G83 A;  4J9L A;  1GBQ A;  2HQE A;  4M7D A;  3CCL T;  4IUQ A;  4R66 A;  1B4F A;  3OW2 A;  5DGB A;  2UVV A;  1B22 A;  3JB9 G;  1FYN A;  3LK9 A;  1CI4 A;  5ALR A;  2HBK A;  2UVU A;  2HSE B;  4J6Y A;  5LJ5 g;  2K4P A;  2KJ5 A;  4YD1 A;  4J83 A;  3CPW P;  3PX6 A;  2G6F X;  4QW2 A;  2EFI A;  2QQ9 A;  3Q8L A;  4IQW A;  2IHN A;  1KHC A;  5DB8 A;  4WF2 A;  1MMN A;  5GMK j;  1SHG A;  2RMO A;  3HTR A;  3L5K A;  2LMR A;  4LE9 A;  2QXF A;  1ZD4 A;  3BQT A;  5J2F A;  8ICO A;  3T3F A;  1AWJ A;  4I2H A;  2EH9 A;  3MHX A;  2JXJ A;  1WXT A;  9ICP A;  2MI6 A;  4Z88 A;  2YMM A;  5KE3 A;  2BDP A;  5KFI A;  1ZD5 A;  2W9C A;  1IGQ A;  2Y90 A;  2VJ5 A;  3IV6 A;  2CH4 A;  4IKF A;  1BGX T;  1B7T A;  4OB3 B;  4CF4 A;  4LNP A;  3WXM B;  1IGU A;  2LKY A;  1MQ3 A;  4KLT A;  2IMW P;  3CCS Q;  1MMA A;  1PG5 B;  1M6Y A;  2E1H A;  3TAD C;  2HSZ A;  4C4S A;  1F1B B;  4F5R A;  4RPZ A;  5KL1 B;  3TFR A;  2HDO A;  1S72 Q;  2A0F B;  1I5O B;  1RPL A;  2RHU A;  1Q86 R;  3O8V A;  2IPO B;  2CGH A;  3CMA Q;  1X6G A;  3ED5 A;  3GNF B;  5I2M A;  1M8M A;  4Q8F A;  2ZPH B;  2PUK B;  1XO1 A;  2YX8 A;  4YMN A;  2RQR A;  1QCF A;  2Y4X A;  4R56 A;  5DLF A;  4GY5 A;  1L8O A;  5L1J A;  1CSK A;  5ECA A;  3VS1 A;  2XU8 A;  1WWV A;  5AM4 A;  4C8K A;  3C1Z A;  3OQ5 A;  4PFP A;  4C92 F;  2LYH A;  4PHE A;  4TUS A;  2DF6 A;  2RI5 A;  2G07 A;  3EG1 A;  1TG0 A;  1X2I A;  3PSI A;  3A8L B;  5AIB A;  5D46 A;  3M0P A;  4A63 B;  3I56 Q;  1WUD A;  1PD0 A;  3H0R B;  1VQ5 T;  2JVV A;  3IG8 A;  1NZ9 A;  3SAF A;  2D8C A;  1WJR A;  5KYW A;  3UF4 A;  1NZB A;  2W3R A;  1UHF A;  5IN1 A;  2QTX A;  5AM2 A;  1D9D A;  5J8Y C;  3SAH A;  3I5S A;  1FMW A;  1YIT T;  4M7A B;  3A8G B;  3WK7 A;  1LVK A;  5KFF A;  1XU4 A;  5AM0 A;  2C0T A;  3PFS A;  5AT1 B;  5C0M A;  1WCN A;  2F76 X;  5KT5 A;  3EYZ A;  3HRS A;  4M75 B;  4J03 A;  5GAN 5;  2AZS A;  3PNC A;  3TRE A;  3CCM T;  1BNO A;  2YUN A;  5ALH A;  3CYM A;  3RES A;  2H5X A;  2NO4 A;  2DJQ A;  3M1Y A;  5KH6 A;  2XDD A;  4A4G A;  1ZBJ A;  3JPO A;  3M6Z A;  2K5I A;  2X35 A;  2EYQ A;  4RTV A;  4IR1 A;  2KMD A;  4MMK A;  3AL0 B;  4YQW A;  2C28 A;  3QZ7 A;  3MR5 A;  5DG7 A;  1NPP A;  2HDA A;  5DBB A;  5ALZ A;  3MDA A;  3RMQ A;  5J2J A;  5J2B A;  3M8S A;  2R8G A;  5G5G A;  4LVS A;  2G08 A;  2H3E B;  2DPJ A;  2M0O A;  1VQ4 T;  5FRM A;  2JZB B;  3SAG A;  2L5Q A;  3CME T;  4UAY A;  1S9F A;  3AEV A;  3QUB A;  3CCE T;  2BPC A;  2KZZ A;  3PY8 A;  2K4I A;  1BKB A;  5A0D A;  1OX9 A;  5GAN 2;  3PTA A;  2Y0S C;  4A8E A;  3OYC A;  1S0O A;  3RR8 A;  2DEQ A;  2MMP A;  2EKO A;  1KRP A;  2R18 A;  1RQN A;  4F7U A;  1K76 A;  5AM3 A;  2PMZ C;  1QCO A;  2E4H A;  1N5Z A;  1W6X A;  1PVP A;  1QQJ A;  1J3T A;  5I22 A;  5JU5 A;  1Z1V A;  2P4R A;  2DXC A;  2MOX A;  1B3Q A;  2CZ0 B;  4JUV A;  3SYZ A;  2DVE A;  2KXD A;  2W9C B;  5DQG A;  3M7D A;  1VQO T;  4EYH B;  3QU5 A;  1PK3 A;  2DXB A;  3ETR A;  3FM9 A;  4AYB F;  1LNX A;  3HKZ C;  2VUB A;  1JU5 C;  2CXY A;  2NUZ A;  4J9P A;  2YWW A;  4EPC A;  4YMO A;  3MKD A;  2VKN A;  4IUV A;  2LNV A;  3V7C A;  2N1R A;  2DIQ A;  5DGA A;  1YJN Q;  5L1L A;  2F8L A;  4DSE A;  4QWB A;  2R5M A;  1VQK Q;  1BK2 A;  3X20 B;  5AKZ A;  1VQP Q;  2ZGW A;  5F3X B;  4O6J A;  3KHH A;  3CC4 A;  4XTV A;  1S76 D;  2ZJ8 A;  3CBO A;  3ZDC A;  3JAM E;  2MU2 A;  3CCV T;  1NG2 A;  4C0D C;  4UAZ A;  3KXT A;  1ECW A;  4QZA A;  4C92 E;  2DK3 A;  3H4D A;  1CKB A;  3V8L A;  3H7I A;  2EDU A;  4XAX B;  2JEG A;  2KRS A;  4DF4 A;  2JV3 A;  2CZ7 B;  2GF7 A;  2ROT A;  4J9S A;  5D4B A;  2YDL A;  2WAQ C;  3HIL A;  4D8D A;  4BUG A;  5C0Y A;  3L2V A;  4PGQ A;  4YR0 A;  4KLD A;  4NWI A;  4DQQ A;  2DTO A;  8ICP A;  1SV0 A;  4O5K A;  1Y71 A;  1MGQ A;  5AKX A;  3VS5 A;  4IUT A;  4U6P A;  4HVV A;  4J9D A;  3H9N A;  4PJ0 U;  5CCA A;  3CCR A;  3WKD A;  5KYW B;  4UAU A;  2L0A A;  5JTI A;  2QA4 T;  3H8S A;  3PVX A;  1DGJ A;  2PI4 A;  2DL8 A;  2RHI A;  4ECZ A;  4K11 A;  1OYX A;  3CEY A;  2IOF K;  2BCR A;  1BIA A;  1S77 D;  1E6G A;  1Q82 U;  1SSF A;  3WK8 A;  2JEI A;  1E7O A;  5EE3 A;  5EWF A;  1D0Y A;  4EDU A;  2CRX A;  4YP3 A;  1C6V X;  3RKX A;  2ED0 A;  1DXS A;  4OCZ A;  3EFO A;  3CXC S;  2ZJA A;  2XID A;  3CD6 A;  2GTJ A;  4NY8 A;  2RHF A;  4UB6 U;  7ICU A;  4FCY A;  3DKM A;  3A5Z B;  3NTU A;  2RP5 A;  4KLM A;  2ZIU A;  4N4H A;  9ATC B;  7ICT A;  3RR6 A;  4WJ3 B;  1WI7 A;  3RUX A;  4RUC A;  3QEB Z;  4AG2 C;  3RER A;  2LTO A;  2F1J A;  2WSC E;  3JB9 J;  4DOC A;  1RAE B;  5L8R E;  1IV8 A;  1BPY A;  2KXC A;  4JUZ A;  4I2B A;  3CXC A;  1BPD A;  4NL9 A;  3Q8S B;  1UJ0 A;  4X9D A;  3UDC A;  2JTF A;  3V8K A;  4YN4 A;  1VQN T;  3WK5 A;  4F7U B;  1NE8 A;  5FWB A;  4KLE A;  4C0F A;  1UUE A;  3UAT A;  5EWG A;  1V9P A;  2O6K A;  5FP0 A;  2PI5 A;  5ALS A;  2DTI A;  2IBK A;  4UAW A;  1SG5 A;  2RQT A;  4F2R A;  2Y1J A;  1OU9 A;  4CRX A;  1SXE A;  5J0P A;  4B9T A;  4GFJ A;  2HHS A;  4JLG A;  2CYZ B;  3I76 A;  5DQI A;  2D1X A;  4MEY A;  8ICL A;  3BJY A;  1M1K U;  2DFU A;  1Q81 U;  4PJJ A;  2L3P A;  2EYZ A;  2MK5 A;  3URG A;  2LDM A;  2JTE A;  3SEN A;  1L3U A;  1MSW D;  1OU8 A;  3TSW A;  3E0F A;  5H2F U;  1OX8 A;  2HCK A;  2ESE A;  2ENM A;  2L5Y A;  1GCP A;  1IZ6 A;  3G6E T;  4JS4 A;  3FJ5 A;  2KIW A;  4M7D G;  1BNP A;  1RLP C;  9ICH A;  3RH4 A;  2CH4 W;  1KN5 A;  1S97 A;  2L2P A;  1I1J A;  1PWT A;  4F92 B;  4PZO A;  5CKB A;  5I2S A;  5EE1 A;  2QI2 A;  2QDL A;  5GAM j;  1X69 A;  4Q5W A;  2DER A;  4JZ4 A;  5IIL A;  1X01 A;  1HEK A;  4MFC A;  2NV3 A;  5J0Y A;  5DKW A;  5IIN A;  2A1J A;  2RJE A;  3SD7 A;  3OTQ A;  1WJS A;  3THK A;  5KFM A;  4EMG A;  1SZH A;  2AQ4 A;  2D0Q B;  2LC4 A;  3VS6 A;  1HSQ A;  1VA7 A;  2LX7 A;  3JB9 D;  1Y88 A;  1SRL A;  2GBQ A;  2JS0 A;  4DQI A;  3REA B;  5KCH A;  3CCQ A;  3TAR A;  1ZD2 P;  1J2M A;  5D49 A;  5CIU A;  1QQ7 A;  1AVZ C;  2DA9 A;  1OI1 A;  2MWP A;  4QT7 A;  1M4Z A;  4QVC A;  5IHI A;  2KDS A;  3J81 j;  3Q8R B;  4PPX A;  3PST A;  4UB2 A;  2CP3 A;  2PTK A;  3M0U A;  5BOM A;  2VAS A;  4M77 C;  5GAN 7;  3JB9 H;  5LJ5 j;  4IUU A;  3GIJ A;  1BI0 A;  2CP7 A;  4PH5 A;  2HNI A;  2JM8 A;  4OGC A;  3U23 A;  2HW3 A;  3BE3 A;  4XTW A;  2ZTC A;  2OTL T;  5KFB A;  4ECX A;  3TEE A;  4PNO A;  1WPY A;  4PJO G;  2W54 A;  5KNI A;  5CR2 A;  2OCE A;  4CI0 C;  5HK0 A;  5ALN A;  4E2F B;  1KJW A;  3OHA A;  2YRC A;  3MEU A;  4OJO A;  2FPF A;  1U49 A;  2I2L A;  4TUP A;  2E8N A;  2R57 A;  5DLG A;  1L7O A;  3OPX A;  3ISC A;  3DLM A;  4XQ8 A;  3F2B A;  4M9G A;  2ZTE A;  1Q82 C;  3HSB A;  3CPF A;  2RHY A;  2H3J A;  3CC2 T;  5AKJ A;  4J9N A;  1Q7Y U;  2V1Q A;  4F5P A;  2ZIU B;  2OYY A;  4QZI A;  3NGP A;  3TFS A;  2O2O A;  2LMJ A;  3VYG A;  4ANJ A;  4DA4 A;  3JCM P;  5CR0 A;  1V38 A;  3CBM A;  5KFL A;  5ALJ A;  3OYF A;  4UB4 A;  1K1Z A;  5B5E U;  7ICJ A;  1BCO A;  4EYI B;  1LPL A;  3KKA C;  3QJY A;  2I6X A;  2EIF A;  3H8W A;  1XS9 D;  1N8R C;  2QEX T;  2QQB A;  4J9K A;  4PJO E;  1H38 A;  1NKC A;  1VQ7 T;  1PSF A;  1JRO A;  5L23 A;  4FO6 A;  6AT1 B;  1RI0 A;  1I4K 1;  2DMO A;  2HHX A;  5ALG A;  3D2N A;  1D0Z A;  2EWN A;  3R6O A;  4JRK A;  1IIP A;  4LDU A;  1AZE A;  4Y2Q A;  2G5I B;  2RPN A;  3TVT A;  9ICE A;  3CC4 Q;  2KBT A;  2ZPF B;  2DIG A;  5DBA A;  1LB2 B;  4DFK A;  2E70 A;  4A4H A;  3QUC A;  3I5R A;  1WLP B;  3S3N A;  3S6W A;  2KI7 A;  2QGG A;  3H0F A;  4RQN A;  3MFH A;  1AT1 B;  2CSQ A;  2GTO A;  2ZXI A;  5EE9 A;  2YHT A;  4ME7 A;  2KSO B;  3CC7 Q;  1FXX A;  1KFZ A;  2KHQ A;  3KHG A;  3C95 A;  4B9X A;  2F69 A;  5AI4 A;  4DSK A;  5CEH A;  4R63 A;  1M1K C;  1Q95 G;  1JJ2 P;  2ASJ A;  5KYX A;  1PSE A;  3KZI U;  5CJ7 A;  1OPL A;  1X9X A;  5GAM e;  3HWT A;  8ICI A;  4LDV A;  1T3N A;  5EE0 A;  1RAB B;  4M47 A;  2A1J B;  5DG8 A;  4ED6 A;  2ZG6 A;  1NK0 A;  2K2V A;  3CCR Q;  1UGR B;  2Y0S F;  2K57 A;  2G5H B;  3OA6 A;  4XRH A;  3T5K A;  3AMZ A;  1NK4 A;  4KX3 A;  3EG0 A;  5A2Q E;  2DL0 A;  7ICO A;  1SV4 A;  3LH0 A;  2PMZ F;  1X9M A;  2G3R A;  7ICK A;  2FPD A;  4KH1 B;  5LJ3 h;  4YG2 A;  4QZG A;  2WSE E;  3QZ5 B;  1QKW A;  2NUT A;  2A7Y A;  3C12 A;  5ALM A;  4PL2 A;  3UXP A;  2PZ1 A;  2EYY A;  3SEI A;  4KLF A;  3TAP A;  3PR5 B;  2K3Y A;  5IT9 E;  3PIO A;  3HKZ F;  4JJC A;  3AUO A;  2HSP A;  4DSJ A;  4C92 D;  2DD4 A;  3C94 A;  4B9V A;  5CP2 A;  3CD6 Q;  4HT8 A;  5ALO A;  5FU6 C;  1W70 A;  2BZY A;  2X4Y A;  2KFZ A;  4C8Q B;  2O9S A;  1K5O A;  1X42 A;  2EQM A;  2ZXH A;  1UHU A;  1UGQ B;  1WIE A;  3OB9 A;  3NMZ C;  3VJP A;  1RAC B;  1B07 A;  1D3B A;  3H8Z A;  1BBZ A;  2KNJ A;  2B86 A;  1V1C A;  3QHS A;  1NJI R;  2EQK A;  2OX7 A;  3S3O A;  4R0K A;  4RMO A;  1JBM A;  2JW4 A;  4OP0 A;  1NK5 A;  1OPK A;  2KAF A;  4AG1 C;  2VA3 A;  1HD3 A;  1WZO A;  1YI2 T;  2WAQ F;  4G3I A;  1XOV A;  1WHM A;  2X3W D;  3BZK A;  3HRU A;  2KE7 A;  3OSP A;  3C0C A;  3LVW A;  1N2X A;  3G7Z A;  3AQE A;  4ED7 A;  3PW2 A;  3ME9 A;  2GCX A;  2PUO B;  3UMC A;  2MSN A;  4EEY A;  2RA2 A;  4RTU A;  5TIS U;  4I2D A;  4PJN A;  3UPQ A;  3C29 A;  4M78 C;  4ELZ C;  1OW5 A;  1Q7Y C;  2RQW A;  2KP7 A;  1IRX A;  3L4P A;  4C92 A;  1AOJ A;  5GAM d;  4CF3 A;  1KD1 R;  1C0M A;  2DL4 A;  2HD0 A;  3PMN A;  4JB3 A;  2J6U A;  5AI8 A;  2XCP A;  4Z02 A;  1KQQ A;  1PKS A;  4PLI A;  3IRU A;  5KFT A;  2YT6 A;  1K8A R;  5D6Y A;  3JPP A;  1NBE B;  2EBP A;  2IIM A;  4PZN A;  1VQ9 A;  4IQU A;  2GWS A;  3NVV A;  2BCU A;  1Q86 U;  5J2K A;  1ZUY A;  4CE6 A;  2E8O A;  2P0P A;  2PXI A;  5KT6 A;  2QAR A;  3LVV A;  1SEM A;  5J0X A;  3Q8K A;  1N6A A;  2AZV A;  5GAO q;  2DZC A;  2K2M A;  2RI2 A;  4US8 A;  1YNZ A;  2DEU A;  4X34 A;  2YQE A;  4DLE A;  5KYX B;  1VQM A;  1KC8 U;  1XSP A;  2K4H A;  3CCQ Q;  3V7K A;  1V97 A;  2DTH A;  1VYU A;  5GTI U;  4C4T A;  2NRT A;  2XI9 A;  2W11 A;  4FFD A;  1ZQP A;  2RHZ A;  3CCU A;  2ATC B;  1UDL A;  2D8J A;  3MO8 A;  2ED1 A;  4UAT A;  1XC9 A;  2O4X A;  3AN1 A;  4MF8 A;  2WF6 A;  2ASL A;  2MAM A;  2HHU A;  1N27 A;  5AHX A;  5FU7 B;  2F44 A;  2P84 A;  2DNU A;  1RAF B;  1ZQI A;  4Z6F A;  1VQK T;  1MMG A;  3ONN A;  1FIQ A;  9ICT A;  4EX6 A;  2JMC A;  4UB3 A;  5HHH A;  1W4S A;  1VQP T;  3DEE A;  3K4G A;  3KFV A;  3QYP A;  4LJX A;  3M57 A;  4Y2T A;  3GIL A;  4FZL A;  2L89 A;  4KT0 E;  4TQS A;  3SFM A;  5J39 A;  2KR3 A;  3FYH A;  1WXU A;  2KQW A;  2W55 A;  2V8K A;  4FYY B;  3PVL A;  4BJQ A;  4TQR A;  3OJS A;  1ZQO A;  2JM9 A;  1KFD A;  4J9C A;  2M9N A;  5CKH A;  5J0R A;  1D3B B;  2V8I A;  1COK A;  2BQ3 A;  3MEA A;  4M7A C;  5HML A;  4RQ3 A;  1TOV A;  3E19 A;  3SEM A;  5GAO p;  3BY7 A;  4BE2 A;  2NRX A;  4M75 C;  5AK6 A;  3CQT A;  5EG2 A;  1WDX A;  4F5O A;  3KBG A;  2X3X D;  3SR6 A;  5LJ3 e;  5J2H A;  2R8J A;  2E10 A;  1TAQ A;  4IS7 A;  4GLX A;  8ICJ A;  4QWD A;  4JRP A;  2ISO A;  3HFN A;  2EGA A;  4ZTF A;  1KQS P;  5EWE A;  5JUM A;  3PZP A;  1SL1 A;  2DXT A;  2YXY A;  3FRN A;  4RT2 A;  1W2B P;  2ESW A;  8ICA A;  4RQ5 A;  3L1A A;  3EGD A;  5AKE A;  4O3M A;  3B0X A;  4EIK A;  3M54 A;  1N63 A;  4B9S A;  4O9M A;  1BI2 A;  3GBQ A;  1D09 B;  3CBP A;  1M90 U;  4RTW A;  3N7P D;  1AWO A;  1U45 A;  2DF4 B;  1FMV A;  1K73 U;  3WKA A;  3AT1 B;  4M77 F;  1SIJ A;  9ICU A;  2W10 A;  3HKS A;  3NAS A;  3AM9 A;  2ABL A;  4LD9 K;  4XU2 A;  3UXO A;  4ECT A;  1ARK A;  2B8A A;  4ORZ A;  3QZ9 B;  1QCN A;  1I81 A;  4RQ7 A;  1YWP A;  2GQI A;  2HBP A;  2LVM A;  3I9Q A;  2E3I A;  2EYW A;  4UBC A;  4EMH A;  1ZQK A;  4J8O A;  5GAM g;  3KBB A;  9ICF A;  1QQ6 A;  3I55 A;  4JS5 A;  4NL3 A;  4RNO A;  1UGV A;  2K5L A;  3QU2 A;  1TVA A;  2E3T A;  5ALL A;  2ZZD A;  3B0Y A;  8ICZ A;  3BQ2 A;  5IIO A;  1SXD A;  1N56 A;  4A54 A;  1WHH A;  2QAR B;  4PJO D;  3WKC A;  4LZG A;  3NS1 A;  1UCV A;  4BWJ A;  4NM1 A;  8ATC B;  3CRX A;  5JRT A;  1AHJ B;  2DM1 A;  2VXE A;  4GLM A;  4BD3 A;  3Q8P B;  5T14 A;  1K9M R;  4JLI A;  1L8L A;  3QU4 A;  1MNE A;  2M02 A;  2VV5 A;  3WVE B;  3RH5 A;  2MIO A;  1SHF A;  2PNI A;  4QWE A;  4RQ1 A;  5J0O A;  5CVI A;  3ER0 A;  2CDT A;  4OJL A;  8ICY A;  2W9B A;  1YBY A;  2R8I A;  2ZCF B;  1EZZ B;  2O4X B;  1ZET A;  4L6V 5;  4OML A;  1RZT A;  2W7P A;  3M56 A;  5DG9 A;  2PFO A;  2GO7 A;  1D0X A;  1TK0 A;  2KTQ A;  9ICQ A;  1IM4 A;  1SWV A;  3IM1 A;  1RAH B;  2W03 A;  2EJ9 A;  2W0Z A;  3L2Z A;  5LJ3 d;  4CC4 B;  4KLL A;  1KFT A;  1X6I A;  4M0A A;  1XNI A;  3QPH A;  1KC8 C;  4O3R A;  3MEV A;  5FRN A;  2PU9 B;  3HT3 A;  1ZQN A;  1TH7 A;  2DZ9 A;  1JXO A;  2YMQ A;  4Y28 E;  1M2V A;  4J7F A;  4I29 A;  1OOT A;  1PM3 A;  2JS2 A;  2ASD A;  2A3L A;  3RMS A;  4QZB A;  5KAI U;  1U47 A;  1M3B A;  1TUC A;  4E7I A;  2LRQ A;  2JUF A;  1Q3V A;  3TU4 K;  2J05 A;  2DPP B;  4LD6 A;  4RUG A;  2XCA A;  4NLN A;  1KQ1 A;  1QW1 A;  3A98 A;  5CKD A;  2B0C A;  2XY6 A;  3X26 B;  3KD3 A;  4C5G A;  4PJO A;  4QZF A;  3MET A;  3PIP A;  5GAN 6;  3G6X A;  4KLO A;  4I28 A;  2FMS A;  8ICS A;  5HMM A;  1MC8 A;  9ICG A;  3FDS A;  1ZQJ A;  4CCH A;  1NLO C;  1UTI A;  2QQA A;  2BTT A;  4BX9 C;  3R9K A;  4RG2 A;  3LWI A;  1M3A A;  3UXN A;  9ICM A;  1NYF A;  2E3H A;  1LVH A;  4PKC C;  4A53 A;  2P35 A;  2YB4 A;  2LI6 A;  5IIM A;  5KFX A;  3HP6 A;  2NRW A;  3CCL A;  3Q8M A;  2QG9 B;  4DSF A;  3SQI A;  5KYU A;  1J2N A;  4XUS A;  5CHG A;  3WK9 A;  5AKY A;  1GL5 A;  1V76 A;  2BDU A;  3HPO A;  7ICQ A;  2RD1 A;  3PX4 A;  5ALD A;  1BPZ A;  3LWM A;  2ROL A;  4M77 E;  1YHQ A;  2EZY A;  4TVR A;  1KL9 A;  2JH7 A;  2FYK A;  3PW7 A;  2AKK A;  2KSS A;  8ICV A;  3PW5 A;  1NNL A;  3NTK A;  5DY9 A;  2QB1 A;  3G4S T;  2OAU A;  1AWW A;  4NLB A;  2W9M A;  3JPT A;  1K0S A;  1G3S A;  2RI3 A;  3AQF A;  3VRY A;  2EW3 A;  1NOM A;  2DL7 A;  2FZG B;  1RI9 A;  4PLL A;  5KG3 A;  2GFU A;  2RF0 A;  3RNJ A;  1M90 C;  4N4I A;  3NVY A;  3OYY A;  3JB9 I;  2CP0 A;  5CA7 A;  2KIV A;  2W04 A;  3EG9 A;  3PSF A;  1ZQZ A;  5ALF A;  4Q8E A;  1K73 C;  4DL7 A;  1NJZ A;  5F9N A;  4RZR A;  1YIJ T;  2AXT U;  2JEF A;  2HBL A;  5KG1 A;  4EEK A;  1N9R A;  2DBY A;  1ARO P;  1VIE A;  1VQM Q;  3EHR A;  3E2U A;  3CCU Q;  1ZQG A;  3CCJ T;  4ECV A;  2BCQ A;  3N97 B;  1O9S A;  1PCX A;  3D2S A;  4DLG A;  2WF7 A;  4M7D B;  2KMT A;  2KT8 A;  1QVF P;  1TFR A;  3HP9 A;  4HCK A;  3OHB A;  3M0R A;  4YR2 A;  4UB5 A;  4NL2 A;  3OYH A;  3RB4 A;  3SMV A;  1BI1 A;  1EXN A;  3VRZ A;  3JCM J;  2LNH B;  2W9B B;  4JMU A;  4RPX A;  2DRM A;  1ABO A;  2LQW A;  2LX9 A;  2EAN A;  1WGS A;  2BPF A;  1YWO A;  4YFK A;  4I2F A;  2X4J A;  1E6H A;  1K1Q A;  4USA A;  5J0U A;  3OJU A;  4M78 F;  2H3I A;  2PFQ A;  1VQL T;  1OUL A;  3N4M B;  2XC9 A;  4KLS A;  1GO3 F;  2EAM A;  4C92 G;  2KN7 A;  2F8K A;  1NI3 A;  9ICJ A;  4KMU A;  1VQ5 A;  2ZUB A;  4XU3 A;  1M2V B;  3RKY A;  3CC7 T;  1RXV A;  5LJ3 g;  3OW2 P;  1NKE A;  1R77 A;  4CC3 A;  1QVG S;  1T4G A;  1ZQH A;  2E12 A;  1KQ2 A;  1L3S A;  1YIT A;  1PC0 A;  1XWL A;  3VUB A;  5J8Y A;  2L8D A;  5KFG A;  2O88 A;  3EGU A;  4IUP A;  4MEX A;  4PJO B;  3WK6 A;  2EGE A;  5J2D A;  4ZGD B;  1A76 A;  1SL2 A;  2E6Z A;  1JRP A;  4B9W A;  3CCM A;  4DSI A;  1F5S A;  1I0C A;  3EG3 A;  1UJY A;  3M6K A;  2ATL A;  4Z6D A;  2AGQ A;  5J2G A;  1NEG A;  3PE0 A;  3FIF A;  2G0A A;  2KRN A;  4KGX B;  3V7R A;  2XY7 A;  2EQJ A;  4KUI A;  3RB3 A;  4XTX A;  3NTI A;  1QVG A;  1L7M A;  3OYA A;  1AQ6 A;  2DYI A;  1U48 A;  4A4E A;  3E1S A;  5CRX A;  2V4Q A;  1NJX A;  2GGR A;  2DL3 A;  2HKQ B;  5KYU B;  3RKW A;  1SF9 A;  5AIA A;  2E1F A;  9ICK A;  3EH2 A;  1VQ4 A;  1TK5 A;  4B6M A;  1PRM C;  2LP5 A;  3CME A;  4HT9 A;  5KFE A;  1WHJ A;  4MZT A;  2V4R A;  3CCE A;  2WF8 A;  2B21 A;  4DL6 A;  2C2R A;  1R8O B;  3O5Z A;  3PMI A;  3IP4 B;  3VC8 A;  4IC9 A;  3ZD8 A;  4KTQ A;  2DQN B;  3VS0 A;  3M9Q A;  4RQM A;  2QDY B;  2LCS A;  2M1H A;  1JN3 A;  1QSS A;  4Z6C A;  1BPB A;  1NK7 A;  5KFR A;  3OYB A;  3OMG A;  4C0Z A;  4FL6 A;  4ZOH C;  4GXI A;  8ICB A;  1FMK A;  3VCB A;  1VQO A;  3FJP A;  2KOB A;  4HCZ A;  1WYX A;  2JR5 A;  1PVQ A;  4J6W A;  5KFP A;  1ZQV A;  3CNH A;  2DO3 A;  3QBY A;  1Z1B A;  1S8O A;  4M7A F;  5KFC A;  2IG0 A;  2K5F A;  4OB1 B;  5TZV A;  3MP1 A;  1EX4 A;  4BXO A;  2DRK A;  4M75 F;  3X24 B;  5GAN 3;  2F1L A;  2BCV A;  2KYM A;  4FBT A;  2YUO A;  3SHW A;  2HZY A;  2DKX A;  2DUY A;  3H8J A;  4BE0 A;  4EX7 A;  1S0M A;  3M0Q A;  4Y2X A;  4FSX A;  1B34 A;  1YHQ Q;  2E64 A;  1QLY A;  3KZX A;  3SWN A;  1PD1 A;  5GMK m;  1KLN A;  2NUP A;  3CCV A;  2AJQ A;  1MN8 A;  4M78 E;  2MUT A;  4K4I A;  3PMT A;  3GNG A;  4EZ6 A;  3RBB B;  4DEY A;  4PJL A;  4M2Y A;  1Y96 A;  5BPC A;  1JXM A;  3QE9 Y;  2HI0 A;  2EJF A;  5GAM f;  1WHK A;  1YJ9 T;  4EBD A;  2EJG A;  1WX6 A;  1BB9 A;  2OJ2 A;  2JRZ A;  5ALP A;  5FRO A;  4DL2 A;  2FZK B;  1ZA1 B;  3RFA A;  3ALR A;  1IO6 A;  1PKT A;  2QA4 A;  2VB6 A;  2LBO A;  4PL1 A;  4P4M A;  4F72 A;  4UW9 A;  3LWH A;  4UB1 A;  1H64 1;  1LCK A;  2MRL A;  2DGZ A;  1X9S A;  2XK0 A;  3QDF A;  2FHD A;  2QYZ A;  1A77 A;  3QYG B;  5ALI A;  1N62 A;  3MR2 A;  4E0D A;  1NJI U;  4CDG A;  3G6Y A;  3E2E A;  1VYT A;  2RJD A;  5LJ5 f;  3CCL Q;  1YCY A;  2KYB A;  3PNW C;  3ISD A;  2EQY A;  2KKV A;  3NRW A;  3WKB A;  1GCQ C;  1PHT A;  5KT4 A;  4C8Q C;  2QAZ A;  4IIO A;  3LW5 E;  3FAH A;  4OVA A;  1HIW A;  2LYB A;  5AM1 A;  4XTU A;  4K4H A;  4JRQ A;  4PHA A;  5DDY A;  4J9I A;  1ZQQ A;  4JJB A;  4FE3 A;  2QAS A;  2RQ5 A;  2LT4 A;  1V85 A;  4IRK A;  2I9G A;  3BZC A;  4LUE A;  3G71 T;  4HCC A;  7ICS A;  1I5L A;  3OYJ A;  2VJ4 A;  4HVU A;  4F17 A;  4R55 A;  2HHV A;  2HOF A;  3C2K A;  2L3R A;  2NRZ A;  3GDX A;  2AU0 A;  4F5Q A;  1U1T A;  1XTD A;  5CQX A;  4BI4 A;  2I1Q A;  1KD1 U;  3WKE A;  4RTX A;  1N61 A;  2VGM A;  4LDY A;  4RQ0 A;  1VQ6 T;  1VQN A;  3UMB A;  4NLZ A;  5CK9 A;  1UPH A;  7ICE A;  5FLX E;  1ZQS A;  2ZIV A;  5KFZ A;  4E6R A;  4AFQ C;  1TXQ A;  4AFZ C;  4JK1 A;  2KT1 A;  5GAN h;  2OH2 A;  2RN8 A;  2A1A A;  4XU0 A;  2A28 A;  2EQU A;  1UT8 A;  2NO5 A;  2EZX A;  3NPF A;  4M7A E;  2AHO B;  4ED2 A;  8ICF A;  4PGX A;  3RAQ A;  1MUZ A;  4M75 E;  5HY6 A;  3JCM b;  3LX7 A;  1YJW T;  3A1P A;  4CC7 A;  4RQ4 A;  2MYS A;  4M77 D;  4BAC A;  2GQV A;  2XGQ A;  5L1I A;  3H0L B;  3EFO B;  2CRE A;  3PSP A;  8ICC A;  4BXO B;  4KLQ A;  4UB8 U;  4J5Y A;  4XU1 A;  4M6W A;  4TUQ A;  4GXK A;  2PVG B;  2DKZ A;  1JQQ A;  2YMP A;  3G6E A;  9ICC A;  5AKH A;  1TK8 A;  1B34 B;  3SWN B;  1NJW A;  2DBM A;  2C2D A;  2NUP B;  4MDX A;  1VQ8 T;  4GLK A;  2MUT B;  1Y07 A;  3IG5 A;  5AI6 A;  4ZGE B;  4QQG A;  1D8Y A;  1VQ5 Q;  5AIC A;  5J2I A;  4L59 A;  3A8M B;  7ICI A;  2WB1 C;  1ZD3 A;  2WSF E;  3NHN A;  1Y96 B;  2KKP A;  4BI8 B;  3AU2 A;  3BDL A;  1ZQY A;  2ISP A;  1M30 A;  2G06 A;  2BKE A;  2HQX A;  4IQV A;  1YIT Q;  2OTJ T;  2MA1 A;  4Y2U A;  1EIF A;  2HEQ A;  9ICN A;  2K8C B;  3T9N A;  4QKU A;  4RNM A;  4OMN A;  5HNK A;  1JO8 A;  3KFU F;  2K9G A;  3QDR B;  1ZX6 A;  1K9A A;  4F7U F;  2LCL A;  5B66 U;  1NYG A;  1NM7 A;  2E1E A;  3C5G A;  2OEH A;  4M77 A;  4FZM A;  5FU7 C;  7ICN A;  4MZP A;  5AI9 A;  4KLI A;  7ICR A;  2DX1 A;  4KN4 A;  2D6F C;  3LLR A;  3M59 A;  3QII A;  2OTL A;  3GIM A;  3H40 A;  1MHN A;  5ALU A;  4ZN3 A;  3CXC P;  1R0B G;  3VYH B;  2ZTD A;  5AM5 A;  2LQ8 A;  3F53 A;  4DQP A;  3L2U A;  2KRM A;  1X27 A;  3ZD9 A;  4P4P A;  4F2S A;  1J97 A;  4Y2V A;  2RHX A;  2K7A A;  2W8K A;  5ALY A;  3ISB A;  3KTQ A;  3CME Q;  2WF9 A;  1RAI B;  2KK4 A;  1Q81 C;  4F16 A;  2VXF A;  3NGD A;  3M9N B;  2DFL A;  2Y9U A;  5KFK A;  4MML A;  2LPE A;  7ICH A;  1MV3 A;  1ZQ1 A;  2OWO A;  4NLK A;  2JMG A;  2KE9 A;  3CC2 A;  1Q82 R;  2KVS A;  1MQ2 A;  3H8M A;  2KVC A;  4UAV A;  4F4Z A;  1DRG A;  2HBW A;  1S5L U;  3AU6 A;  3GQC A;  2NRV A;  3CCS T;  4NLG A;  5DB7 A;  5J3B A;  1VQO Q;  5HHI A;  3MR6 A;  4DBH A;  3J81 E;  1DOQ A;  5IHN A;  2DYB A;  1S72 T;  2KZM A;  2QEX A;  4U7C A;  1ZQE A;  4FT4 A;  2ZIV B;  1VQ7 A;  1X9W A;  3FLG A;  4RCB A;  1U06 A;  1N8R R;  3CMA T;  2CUD A;  1HJD A;  2MPX C;  3GV7 B;  3GIK A;  2LQN A;  1KQS S;  1AD5 A;  3F5A A;  2JJ9 A;  5ALW A;  1IRE B;  2ZPI B;  1W1F A;  5HR7 A;  2YRV A;  1SSH A;  3JCM h;  1CEZ A;  5HK3 A;  4CNQ A;  3F70 A;  2DJZ A;  2DVJ A;  3MP8 A;  5AI0 A;  2K79 A;  1C1A A;  3FEO A;  5CKF A;  1ZQC A;  3JCM Q;  2E41 A;  2K6D A;  2IA6 A;  2XDP A;  4ECS A;  3RF9 A;  1K9M U;  2J6F A;  3OBY A;  3Q1J A;  1ZQW A;  2R5A A;  5KG6 A;  3M5A A;  5LJ3 j;  4M6W B;  3I56 T;  3T5H A;  4F8R A;  1N5X A;  1M27 C;  2CSI A;  3A0B U;  2ES6 A;  4L5G A;  1KQS A;  4E7S A;  3EUB 2;  2H8H A;  2PVD B;  2YY6 A;  2JNG A;  3N28 A;  4F50 A;  3DB3 A;  4EMK A;  2QKQ A;  2VGN A;  5GAN e;  5CO7 A;  3MDC A;  3V7S A;  2XKO C;  4OJ6 A;  1EFN A;  3HFO A;  1M1K R;  1U8R A;  3B9J A;  3PW0 A;  1TKD A;  2J6O A;  2RK2 A;  2W3S A;  2M0Y A;  2NYS A;  2X9H A;  3OSV A;  5KG4 A;  2QA4 Q;  1HUZ A;  4N0A C;  1TU0 B;  1LKY A;  3QXG A;  2ZIX A;  2Y4Y A;  2COY A;  2E8P A;  1ZUU A;  3D6J A;  4WTO B;  4RQ8 A;  5GMK l;  3DDH A;  3QNM A;  1ZQA A;  2COW A;  1XNS A;  1KDH A;  1RYU A;  1WHG A;  2FZC B;  3ETL A;  3QUQ A;  1HYO A;  2ECZ A;  2UVW A;  3JCM W;  2K8A A;  2YTU A;  4ECU A;  2X4W A;  4M77 B;  4M78 D;  2EAO A;  1XJW B;  5I21 A;  3CPW S;  1Z9Z A;  1PVR A;  2QB0 A;  5C6S A;  2F77 X;  7ICG A;  7ICV A;  3EWA A;  4Q44 A;  1WJQ A;  2P0Q A;  2VAN A;  4O5E A;  3F2C A;  5GTH U;  5KT3 A;  2VKQ A;  4J9M A;  8ICR A;  4F71 A;  5AYF A;  1ZSZ A;  2DKG A;  1SPK A;  4LZD A;  3T79 A;  1ZQR A;  4KUL A;  1ZQU A;  3EAE A;  4PJM A;  1RLQ C;  4Y92 A;  4PFZ A;  4Q43 A;  4HAI A;  4ELY C;  1JMS A;  1N9S A;  4YTL A;  4MDW A;  2HMX A;  2K4Y A;  2W43 A;  4GBQ A;  1K0X A;  2ZJ5 A;  3JPR A;  3CPW A;  4ELV A;  8ICU A;  3IQL A;  4IRC A;  1VQN Q;  4HVW A;  2VYT A;  5KCO A;  1YI2 A;  4DOB A;  2QQR A;  3GV8 B;  4QVZ A;  3D2Q A;  2CZ1 B;  4IUR A;  3QSU A;  8ICK A;  4QZE A;  1U1S A;  3OSN A;  3PGG A;  4OB2 B;  4RUA A;  2GOL A;  2XVT A;  4JV1 A;  9ICS A;  1G3Y A;  1KHI A;  1ZUK A;  3X25 B;  2C0O A;  1QSL A;  2RNA A;  2XDB A;  1YJN T;  4ATO A;  4E7Z A;  1D1A A;  4IQT A;  4HXJ A;  2V26 A;  4C8N A;  2AGP A;  2NUT B;  2GNC A;  3JPS A;  3D7S B;  3C5F A;  4Y2Y A;  4JV2 A;  4M78 A;  3GP8 A;  1LV5 A;  1ZBX A;  4HA8 A;  5GAN d;  5CQY A;  2X4X A;  1JX4 A;  3GLX A;  4I2A A;  4FYV B;  1BU1 A;  1Q7Y R;  2WHE A;  4DBR A;  3G6V A;  1YCS B;  3JPN A;  2P4T A;  4FW1 A;  3I1Y A;  2A36 A;  3LGL A;  5HKC A;  3OY9 A;  3VKI A;  2KJ9 A;  4BWM A;  4J7I A;  2LM4 A;  1DK3 A;  3EFR A;  2F1I A;  2E8M A;  4DFD A;  4C8Q F;  3H6Z A;  4ECR A;  4OMF B;  5KL8 B;  4Y2J A;  4J9Q A;  1ZSG A;  2YUQ A; 
#chains in the Genus database with same CATH homology
 2LYA A;  4XTZ A;  3BFM A;  1OUQ A;  5CKE A;  4ICA A;  2CZ6 B;  4E47 A;  2F2A B;  2Q4T A;  2DAQ A;  4UC4 A;  4EMK B;  3SDZ A;  4M7A D;  4Y91 A;  4OJ5 A;  2VC8 A;  4A4K A;  4M7D C;  4M75 D;  2HBJ A;  5GAN 8;  1HK9 A;  2FB7 A;  3JCM e;  2ZIX B;  1QP2 A;  4C92 B;  3F2D A;  1VQK A;  1VQP A;  2LHT A;  5A0G A;  1DJ7 B;  4JJN K;  3OYM A;  4RKU E;  1HXD A;  4BI3 A;  4NLC A;  4FT2 A;  4OO1 J;  3JCM c;  3E9G A;  2JN0 A;  4P0Q A;  5CAI A;  5DM7 R;  1WQW A;  4PJO C;  4M7A A;  4BE1 A;  3L2Q A;  1V29 B;  2FL7 A;  1Q86 C;  4QVD A;  4M75 A;  5DLQ E;  1YT3 A;  5GMK h;  2WB1 F;  2RO0 A;  3GIB A;  2NLU A;  4NV0 A;  3VU3 C;  5GAO m;  2OXO A;  2BKD N;  1GXI E;  2AHJ B;  2BIV A;  4M78 B;  4JRI A;  4QIW C;  3IN5 A;  4JDS A;  4M77 G;  4LDW A;  4E7H A;  3JCM d;  5LL6 S;  4C8Q E;  2FVU A;  5GAN g;  2K4E A;  4P5N A;  1RL2 A;  2F5T X;  3OS2 A;  2HOI A;  2QQS A;  1WQ7 A;  2V8J A;  2KEY A;  3M4G A;  4D6W A;  2OM6 A;  3M58 A;  2RH2 A;  2LT1 A;  3L2R A;  1G3W A;  3N7R C;  4BY6 B;  4KBM B;  3J7A F;  4RG8 A;  2CN1 A;  2JGA A;  4A4F A;  2W7O A;  1UB4 A;  1G3T A;  4P0Q B;  5DLO A;  2YB1 A;  2RK1 A;  4HCB A;  3DB4 A;  2KY9 A;  2KVQ G;  4E7J A;  4DOV A;  1UGS B;  1CRX A;  2RM4 A;  3OYN A;  3CC4 T;  3NFC A;  1O75 A;  3J80 E;  4CGZ A;  4II1 A;  2DXU A;  1Y7X A;  3PT9 A;  2JHD A;  4XQ3 A;  3ICX A;  3X28 B;  3G4S A;  1UGP B;  3P8H A;  2EAY A;  4PL6 A;  3SD4 A;  1Z19 A;  2JOY A;  3CCR T;  5GMK e;  4QJF B;  1A6S A;  1YIJ A;  4LDX A;  2KIC A;  3JCM g;  5J26 A;  3BDU A;  3CCJ A;  4KX5 A;  1KG1 A;  2H3Q A;  1M9S A;  3VUZ A;  2RB6 A;  3UWN A;  1TAM A;  2DD5 A;  3CD6 T;  3ASK A;  1BYM A;  5GAO n;  3OYD A;  2G09 A;  3SWN C;  1QVP A;  1VQL A;  3QG1 A;  4X9C A;  3QYH B;  4BB7 A;  4M78 G;  3L42 A;  3JCM V;  3F5E A;  3CC7 A;  2ZPE B;  3DLL A;  4FU6 A;  3OYL A;  5M9O A;  1M5Q 1;  3OYG A;  3QKJ A;  5GAO r;  1LOJ A;  4C5E A;  1M8V A;  3HHT B;  3HRT A;  4ACO A;  4OJP A;  4M7D F;  3QXE B;  1M1G A;  2XIC A;  3P8B B;  3N7S C;  2M16 A;  1N8R U;  3K1Z A;  2E65 A;  1JJ2 S;  4XTY A;  1FX7 A;  2BUD A;  1F44 A;  3WVD B;  5GAO l;  1I8F A;  2O01 E;  1M1F A;  2P0K A;  2GH1 A;  2XG8 D;  4OGE A;  2HOQ A;  3CCQ T;  1D8B A;  3A8O B;  1L6N A;  2R58 A;  5GAM h;  4XK8 E;  2CPR A;  4PJO F;  1JJ2 A;  1LJO A;  2HAX A;  4M7A G;  3MP6 A;  3GZF A;  1WNL A;  2E5Q A;  2M9U A;  4M75 G;  4C0G A;  3LYS A;  3MEW A;  4C8Q D;  3FDR A;  2LQK A;  1KBU A;  1ED1 A;  3E9F A;  5LJ5 h;  1JB0 E;  5GAN f;  1YJ9 A;  2JTM A;  3OYE A;  4QIW F;  1K8A U;  3JRZ A;  2MWO A;  2GFA A;  3HL8 A;  2C06 A;  2Z7J A;  3OMC A;  4OB0 B;  2K3X A;  3OSS C;  4M7D E;  4C8Q A;  2ZPB B;  4ZN1 A;  2YLB A;  5GAN j;  4C0D B;  3L2W A;  3M53 A;  1JRI A;  2KD1 A;  4BDZ A;  1XO0 A;  3G71 A;  1T94 A;  3QJ6 A;  1BIB A;  3JCM X;  2YLC A;  1ZQ1 C;  4NS5 A;  5GMK i;  1VQ6 A;  2A3V A;  2ZIW A;  4DQ2 A;  4VUB A;  1BI3 A;  1YJW A;  4P0P A;  3EFS A;  3QO3 A;  1VUB A;  2JH1 A;  5IAY A;  1NJI C;  2E5S A;  2RRD A;  4E7K A;  5LJ3 f;  1VQ8 A;  3M55 A;  4ZTJ A;  1FWZ A;  2PVO B;  3HPW A;  4EMK C;  2XHC A;  3MGV A;  2D9T A;  2OTJ A;  1URJ A;  3JCM f;  4C5H A;  1QP3 A;  2CS7 A;  1KD1 C;  3VV0 A;  1W2B S;  4C92 C;  3LGF A;  4F7U G;  1K8A C;  1G5V A;  3OYK A;  2D6F A;  4C5I A;  1VQ9 T;  5LJ5 e;  1X75 C;  4BDY A;  1VIF A;  1W2B A;  4CRI A;  2JZ2 A;  3QUI A;  3O0F A;  3AHU A;  5D6X A;  2VIX A;  3RIR A;  1VQM T;  3CCS A;  4F7U E;  4J6X A;  1A0P A;  3JSC A;  3GF5 A;  3CCU T;  2K8B B;  1S72 A;  1XQH A;  4KMO B;  3BW1 A;  4DOW A;  3CMA A;  2ZIW B;  2ZPG B;  3CP8 A;  2WAC A;  4P0P B;  3GPL A;  5A0L A;  3A8H B;  3H0M B;  4RCC A;  3I56 A;  1P92 A;  4KUD K;  1H3Z A;  4AYB C;  3P8D A;  1Q3U A;  2PQW A;  2RJC A;  2H3V A;  3ZFJ A;  5LJ5 d;  3C4S A;  1X6O A;  4N0A A;  5KE2 A;  2F5K A;  2KV2 A;  4N4G A;  2M0N A;  5GAN 4;  3LYI A;  3C28 A;  3ZBD A;  1MA7 A;  3UPU A;  1NPR A;  3OYI A;  2IVW A;  4QQD A;  2LCC A;  3GU3 A;  4OF1 A;  4E7L A;  1OZ2 A;  3L3F X;  3MCA B;  3OBW A;  4BY6 C;  4QNL A;  3OS0 A;  3UT1 A;  4O5V A;  2RJF A;  1OZ3 A;  2H3Z A;  3I55 T;  3FB9 A;  2CKK A;  3S3M A;  3NTH A;  1ZHI A;  3ZEH A;  3OS1 A;  1K9M C;  3M4Y A;  4FM4 B;  3JB9 F;  2KJ8 A;  4QQ6 A;  2HBM A;  2H3F A;  1YJN A;  3TCJ A;  1P7D A;  1QVF S;  4MZM A;  2K89 A;  4M7D D;  2E6N A;  4NOY A;  1YHQ T;  4V2S A;  3OS5 A;  4ZGJ B;  4HKE A;  5FU6 B;  2KHV A;  3SB2 A;  2XD0 A;  4FZN A;  3KUF A;  1QVF A;  4C8Q G;  5HR6 A;  5D6W A;  3OW2 S;  4FIB A;  3GOX A;  3FC3 A;  2MF2 A;  3NUQ A;  1UEB A;  3V8J A;  3N5B B;  2HQE A;  4M7D A;  3CCL T;  4IUQ A;  3OW2 A;  3JB9 G;  2HBK A;  4J6Y A;  5LJ5 g;  2KJ5 A;  4J83 A;  4QW2 A;  2EFI A;  2QQ9 A;  1KHC A;  4WF2 A;  5GMK j;  2QXF A;  3MHX A;  2MI6 A;  5KE3 A;  2Y90 A;  2VJ5 A;  4IKF A;  4OB3 B;  3WXM B;  2LKY A;  2E1H A;  5KL1 B;  2RHU A;  3O8V A;  2CGH A;  3GNF B;  5I2M A;  2ZPH B;  2PUK B;  2YX8 A;  2Y4X A;  4R56 A;  4GY5 A;  2XU8 A;  3OQ5 A;  4C92 F;  2RI5 A;  2G07 A;  3A8L B;  3PSI A;  1WUD A;  3H0R B;  1VQ5 T;  2JVV A;  3IG8 A;  1NZ9 A;  3SAF A;  1WJR A;  1NZB A;  5IN1 A;  2QTX A;  3SAH A;  1YIT T;  4M7A B;  3A8G B;  3PFS A;  5C0M A;  2F76 X;  3HRS A;  4M75 B;  5GAN 5;  3CCM T;  3TRE A;  3CYM A;  3RES A;  5KH6 A;  2XDD A;  4A4G A;  3M6Z A;  2K5I A;  2X35 A;  2EYQ A;  4MMK A;  3AL0 B;  1NPP A;  3RMQ A;  2G08 A;  1VQ4 T;  2M0O A;  5FRM A;  2L5Q A;  3SAG A;  3CME T;  3CCE T;  1BKB A;  3PTA A;  2K4I A;  5A0D A;  5GAN 2;  2Y0S C;  4A8E A;  3OYC A;  2DEQ A;  2MMP A;  2EKO A;  2R18 A;  4F7U A;  2PMZ C;  1PVP A;  2DXC A;  2CZ0 B;  4JUV A;  2DVE A;  3M7D A;  1VQO T;  2DXB A;  4AYB F;  1LNX A;  3HKZ C;  2VUB A;  4EPC A;  4IUV A;  3V7C A;  2LNV A;  2N1R A;  2DIQ A;  2F8L A;  2R5M A;  3X20 B;  2ZGW A;  4O6J A;  3CC4 A;  4XTV A;  3CBO A;  3JAM E;  3CCV T;  4C0D C;  3KXT A;  1ECW A;  4C92 E;  2DK3 A;  3V8L A;  4XAX B;  2CZ7 B;  2GF7 A;  2WAQ C;  4BUG A;  5C0Y A;  3L2V A;  4NWI A;  2DTO A;  1Y71 A;  1MGQ A;  4IUT A;  4U6P A;  5CCA A;  3CCR A;  2QA4 T;  2RHI A;  1OYX A;  3CEY A;  1BIA A;  1Q82 U;  1SSF A;  4EDU A;  2CRX A;  3RKX A;  3CXC S;  2XID A;  3CD6 A;  2RHF A;  3DKM A;  3A5Z B;  2RP5 A;  2ZIU A;  4N4H A;  4WJ3 B;  3RUX A;  3RER A;  2LTO A;  2WSC E;  3JB9 J;  5L8R E;  3CXC A;  4X9D A;  3UDC A;  2JTF A;  3V8K A;  1VQN T;  4F7U B;  1NE8 A;  4C0F A;  2DTI A;  4CRX A;  4JLG A;  4GFJ A;  2CYZ B;  1M1K U;  1Q81 U;  3URG A;  2LDM A;  3E0F A;  3G6E T;  1IZ6 A;  4JS4 A;  4M7D G;  2KIW A;  5CKB A;  5I2S A;  5GAM j;  2QI2 A;  4Q5W A;  1X01 A;  1HEK A;  2RJE A;  2NV3 A;  1WJS A;  4EMG A;  1SZH A;  2LC4 A;  2D0Q B;  3JB9 D;  5KCH A;  3CCQ A;  5CIU A;  1OI1 A;  2MWP A;  4QVC A;  1M4Z A;  2KDS A;  4M77 C;  3PST A;  5GAN 7;  3JB9 H;  5LJ5 j;  4IUU A;  1BI0 A;  2HNI A;  4OGC A;  4XTW A;  2OTL T;  3TEE A;  4PNO A;  1WPY A;  4PJO G;  5CR2 A;  4CI0 C;  5HK0 A;  3MEU A;  4OJO A;  2I2L A;  2R57 A;  3OPX A;  3DLM A;  3F2B A;  1Q82 C;  3HSB A;  3CPF A;  2RHY A;  2H3J A;  3CC2 T;  1Q7Y U;  2ZIU B;  2OYY A;  3VYG A;  4DA4 A;  3JCM P;  3CBM A;  3OYF A;  3QJY A;  2EIF A;  1N8R C;  2QEX T;  2QQB A;  4PJO E;  1VQ7 T;  1PSF A;  1RI0 A;  1I4K 1;  3D2N A;  2EWN A;  3R6O A;  4JRK A;  1IIP A;  4LDU A;  2G5I B;  2ZPF B;  2DIG A;  2E70 A;  4A4H A;  3S3N A;  3S6W A;  2YHT A;  4ME7 A;  2ZXI A;  1FXX A;  2KHQ A;  3C95 A;  4B9X A;  2F69 A;  1M1K C;  1PSE A;  5GAM e;  4LDV A;  2K2V A;  2ZG6 A;  1UGR B;  2Y0S F;  2K57 A;  2G5H B;  3OA6 A;  4KX3 A;  5A2Q E;  3LH0 A;  2PMZ F;  2G3R A;  5LJ3 h;  2WSE E;  3QZ5 B;  2A7Y A;  3C12 A;  4PL2 A;  2K3Y A;  5IT9 E;  3PIO A;  3HKZ F;  4C92 D;  2DD4 A;  3C94 A;  4HT8 A;  5FU6 C;  4C8Q B;  2X4Y A;  2EQM A;  2ZXH A;  1UGQ B;  3OB9 A;  3VJP A;  1D3B A;  3H8Z A;  2KNJ A;  3QHS A;  2EQK A;  3S3O A;  4RMO A;  1JBM A;  4OP0 A;  2KAF A;  1YI2 T;  2WAQ F;  1XOV A;  3HRU A;  3LVW A;  3G7Z A;  3AQE A;  3ME9 A;  2GCX A;  2PUO B;  2RA2 A;  3C29 A;  4M78 C;  4ELZ C;  1Q7Y C;  4C92 A;  5GAM d;  2HD0 A;  4Z02 A;  4PLI A;  5D6Y A;  1VQ9 A;  1Q86 U;  2P0P A;  3LVV A;  1N6A A;  5GAO q;  2DZC A;  2RI2 A;  4X34 A;  1VQM A;  1KC8 U;  2K4H A;  2DTH A;  2RHZ A;  2XI9 A;  3CCU A;  3MO8 A;  2O4X A;  2MAM A;  1N27 A;  5FU7 B;  1VQK T;  3ONN A;  1VQP T;  1W4S A;  3DEE A;  3M57 A;  4KT0 E;  4FZL A;  2L89 A;  3SFM A;  5J39 A;  2KQW A;  2V8K A;  4BJQ A;  5CKH A;  1D3B B;  2V8I A;  4M7A C;  3MEA A;  3E19 A;  5GAO p;  3BY7 A;  4BE2 A;  4M75 C;  5EG2 A;  3KBG A;  5LJ3 e;  2E10 A;  4JRP A;  3HFN A;  4ZTF A;  3PZP A;  2DXT A;  3FRN A;  3L1A A;  4O3M A;  3M54 A;  1BI2 A;  3CBP A;  1M90 U;  3N7P D;  2DF4 B;  1K73 U;  4M77 F;  3HKS A;  4LD9 K;  4XU2 A;  2B8A A;  3QZ9 B;  1I81 A;  2HBP A;  2LVM A;  4EMH A;  4J8O A;  5GAM g;  3I55 A;  4JS5 A;  4NL3 A;  2K5L A;  2ZZD A;  4A54 A;  4PJO D;  3CRX A;  1AHJ B;  2VXE A;  4BD3 A;  5T14 A;  4JLI A;  2VV5 A;  3WVE B;  5CVI A;  3ER0 A;  4OJL A;  1YBY A;  2ZCF B;  2O4X B;  4L6V 5;  2W7P A;  3M56 A;  3INZ A;  2EJ9 A;  3L2Z A;  1YHQ A;  2W03 A;  5LJ3 d;  5FRN A;  1XNI A;  3QPH A;  1KC8 C;  3MEV A;  2PU9 B;  1TH7 A;  2DZ9 A;  4Y28 E;  4J7F A;  3RMS A;  2A3L A;  4E7I A;  2LRQ A;  2JUF A;  1Q3V A;  3TU4 K;  2DPP B;  4LD6 A;  1QW1 A;  1KQ1 A;  5CKD A;  3X26 B;  4C5G A;  4PJO A;  3MET A;  3PIP A;  5GAN 6;  2QQA A;  4RG2 A;  4BX9 C;  3LWI A;  4PKC C;  4A53 A;  2YB4 A;  3CCL A;  3SQI A;  2BDU A;  2RD1 A;  4M77 E;  4TVR A;  2JH7 A;  2FYK A;  2KSS A;  3NTK A;  5DY9 A;  3G4S T;  2OAU A;  4NLB A;  1G3S A;  2RI3 A;  3AQF A;  4PLL A;  2GFU A;  1M90 C;  4N4I A;  3JB9 I;  3OYY A;  2W04 A;  3PSF A;  1K73 C;  1YIJ T;  1N9R A;  2HBL A;  1VIE A;  3CCJ T;  1O9S A;  3D2S A;  4M7D B;  2KMT A;  3HP9 A;  4NL2 A;  3OYH A;  3SMV A;  1BI1 A;  3JCM J;  4JMU A;  2LX9 A;  1WGS A;  2X4J A;  4M78 F;  2H3I A;  1VQL T;  1GO3 F;  4C92 G;  1VQ5 A;  4XU3 A;  3RKY A;  3CC7 T;  5LJ3 g;  1QVG S;  2E12 A;  1KQ2 A;  1YIT A;  3VUB A;  2L8D A;  4IUP A;  4PJO B;  4ZGD B;  2E6Z A;  4B9W A;  3CCM A;  3M6K A;  3FIF A;  2G0A A;  3V7R A;  4KUI A;  2EQJ A;  4XTX A;  3NTI A;  1QVG A;  3OYA A;  4A4E A;  3E1S A;  5CRX A;  3RKW A;  2E1F A;  1VQ4 A;  3CME A;  4HT9 A;  4MZT A;  3CCE A;  1R8O B;  3PMI A;  3IP4 B;  3VC8 A;  4IC9 A;  2DQN B;  3M9Q A;  2QDY B;  2M1H A;  3OYB A;  3OMG A;  4C0Z A;  4FL6 A;  3VCB A;  1VQO A;  3FJP A;  2KOB A;  4HCZ A;  1PVQ A;  4J6W A;  2DO3 A;  3QBY A;  1Z1B A;  4M7A F;  2IG0 A;  2K5F A;  4OB1 B;  3MP1 A;  4M75 F;  3X24 B;  5GAN 3;  4BE0 A;  4FSX A;  1B34 A;  2E64 A;  3SWN A;  3KZX A;  5GMK m;  3CCV A;  4M78 E;  3PMT A;  3GNG A;  1Y96 A;  2EJF A;  5GAM f;  1YJ9 T;  2EJG A;  5FRO A;  3RFA A;  3ALR A;  2QA4 A;  2LBO A;  4PL1 A;  3LWH A;  1H64 1;  2MRL A;  2DGZ A;  2XK0 A;  2FHD A;  3QYG B;  1NJI U;  4CDG A;  2RJD A;  5LJ5 f;  1YCY A;  3PNW C;  2KKV A;  3NRW A;  4C8Q C;  3LW5 E;  4OVA A;  1HIW A;  2LYB A;  4XTU A;  4JRQ A;  4FE3 A;  2LT4 A;  3G71 T;  4HCC A;  1I5L A;  3OYJ A;  2VJ4 A;  4R55 A;  2HOF A;  2L3R A;  1U1T A;  1XTD A;  5CQX A;  4BI4 A;  1KD1 U;  2VGM A;  4LDY A;  1VQ6 T;  1VQN A;  5CK9 A;  1UPH A;  5FLX E;  2ZIV A;  5GAN h;  2OH2 A;  4XU0 A;  2EQU A;  4M7A E;  4M75 E;  5HY6 A;  3JCM b;  3LX7 A;  1YJW T;  4M77 D;  4BAC A;  2GQV A;  3H0L B;  3PSP A;  4J5Y A;  4XU1 A;  2PVG B;  3G6E A;  1B34 B;  3SWN B;  4MDX A;  1VQ8 T;  4GLK A;  1Y07 A;  3IG5 A;  4ZGE B;  4QQG A;  4L59 A;  3A8M B;  2WB1 C;  2WSF E;  1Y96 B;  2KKP A;  4BI8 B;  3BDL A;  2G06 A;  2HQX A;  2OTJ T;  2MA1 A;  1EIF A;  2K8C B;  3T9N A;  3QDR B;  3KFU F;  4F7U F;  2LCL A;  2E1E A;  4M77 A;  4FZM A;  5FU7 C;  4MZP A;  2D6F C;  3M59 A;  3LLR A;  3QII A;  2OTL A;  1MHN A;  4ZN3 A;  3VYH B;  2LQ8 A;  3F53 A;  3L2U A;  2RHX A;  2KK4 A;  1Q81 C;  2VXF A;  4MML A;  1ZQ1 A;  3CC2 A;  2JMG A;  2KVC A;  1DRG A;  3CCS T;  5J3B A;  3J81 E;  1S72 T;  2QEX A;  4U7C A;  4FT4 A;  2ZIV B;  1VQ7 A;  3FLG A;  4RCB A;  3CMA T;  1KQS S;  3F5A A;  2ZPI B;  1IRE B;  5HR7 A;  2YRV A;  3JCM h;  5HK3 A;  3F70 A;  2DJZ A;  3MP8 A;  3FEO A;  5CKF A;  3JCM Q;  2E41 A;  2XDP A;  3RF9 A;  1K9M U;  3OBY A;  3Q1J A;  2R5A A;  3I56 T;  3M5A A;  5LJ3 j;  4L5G A;  1KQS A;  2PVD B;  2JNG A;  3DB3 A;  4EMK A;  2VGN A;  5GAN e;  5CO7 A;  3V7S A;  2XKO C;  4OJ6 A;  3HFO A;  1U8R A;  3OSV A;  2RK2 A;  4N0A C;  2Y4Y A;  2ZIX A;  5GMK l;  1XNS A;  3JCM W;  2K8A A;  2X4W A;  4M77 B;  4M78 D;  5I21 A;  3CPW S;  1PVR A;  5C6S A;  2F77 X;  1WJQ A;  2P0Q A;  3F2C A;  2VKQ A;  5AYF A;  2DKG A;  3T79 A;  4KUL A;  3EAE A;  4ELY C;  1N9S A;  4YTL A;  4MDW A;  2HMX A;  2K4Y A;  3CPW A;  2VYT A;  5KCO A;  1YI2 A;  2QQR A;  4QVZ A;  3D2Q A;  2CZ1 B;  4IUR A;  3QSU A;  1U1S A;  3PGG A;  4OB2 B;  2GOL A;  2XVT A;  3X25 B;  1G3Y A;  1KHI A;  4ATO A;  2XDB A;  1YJN T;  3GP8 A;  4M78 A;  1ZBX A;  4HA8 A;  5GAN d;  5CQY A;  2X4X A;  3GLX A;  2P4T A;  3LGL A;  5HKC A;  3OY9 A;  3VKI A;  2KJ9 A;  4J7I A;  3EFR A;  4C8Q F;  3H6Z A;  4OMF B;  5KL8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...