4C0ZA

The n-terminal domain of the streptococcus pyogenes pilus tip adhesin cpa
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
SVPNKQSSVQDYPWYGYDSYSKGYPDYSPLKTYHNLKVNLDGSKEYQAYCFNLTKHFPSKSDSVRSQWYKKLEGTNENFIKLADKPRIEDGQLQQNILRILYNGYPNDRNGIMKGIDPLNAILVTQNAIWYYTDSSYISDTSKAFQQEETDLKLDSQQLQLMRNALKRLINPKEVESLPNQVPANYQLSIFQSSDKTFQNLLSAEYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Model for the Covalent Adhesion of the Streptococcus Pyogenes Pilus Through a Thioester Bond.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
molecule keywords ANCILLARY PROTEIN 2
total genus 68
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.480 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4c0zA02
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0zA01
5A0GA 2XI9A 5A0DA 4C0ZA 2XIDA 5A0LA 4BUGA 2XICA
chains in the Genus database with same CATH superfamily
2KZZA 4RT2A 3WKEA 1VQPT 4BXOA 4B9MA 1QKWA 1X6GA 4FFDA 1BVSA 1COKA 2D9TA 4V2SA 4DEXA 2VB6A 3RJGA 5HMLA 2EIFA 2Z7JA 4KLUA 1VQ6Q 1BCOA 1LJOA 2EJFA 4RCCA 2EYYA 4C8QB 1ZSGA 2EJGA 2GTOA 1T3NA 2BCQA 2V4RA 2DF6A 4F2RA 1QVGS 4J9RA 4UB6U 3WKBA 1QSLA 5FU7B 5FW9A 1R77A 3VS3A 2AHOB 2YRDA 3ZDCA 2LMRA 2JZBA 4M4ZA 4EMGA 2CS7A 3QZ8A 2LNHB 2KVSA 1VLBA 2GWSA 4C4RA 2ALZA 5HHIA 4PKCC 3OYIA 1A77A 1B07A 4X1VA 1WJQA 2DZCA 3RKYA 4J5YA 2HHVA 4F4YA 3PIOA 5ALXA 2AXTU 3PW0A 5KT7A 3MR3A 4XU3A 2ECZA 2B0CA 1VQ6T 3H0MB 2X51A 2DL5A 4IUVA 3PFSA 7AT1B 5J0XA 3C2LA 1IIPA 3HRDD 5EWGA 5AM5A 3F53A 3T9NA 1WI7A 1PVRA 3CCSQ 4GLXA 2IMWP 3H6ZA 1JEGA 2ZIWB 3Q8SB 3C94A 1UCVA 2O2OA 4F4ZA 4C5EA 1LVHA 2LYHA 4FYXB 1EFNA 2O9SA 2P35A 3OY9A 4PHDA 3H8MA 1XOVA 2G6FX 1L3SA 4OB1B 5GANf 3N7SC 1U45A 2NUTA 3CCUQ 3GIBA 5KAFU 3ISBA 2L3RA 1M3CA 3AEVA 4O3RA 3A8HB 4BUGA 3C12A 4Y2XA 3H4BA 4DL4A 1IREB 2LDMA 4M9GA 2JUFA 3V7LA 3ZFJA 1WCNA 2ZIXA 4CRXA 5L1LA 2B6GA 5CJ7A 2CT4A 2M02A 9ICCA 3E9GA 5AI4A 3RBEA 9ICWA 1JXEA 3RFAA 3QG1A 1BPBA 2KR3A 2DRKA 1WGSA 4DWIA 2EGCA 2HL5C 1N8RC 8ICEA 2GQVA 2RM4A 4EPCA 3M56A 3GDXA 1AWOA 4RQNA 5KT2A 2QYZA 4QZ8A 1AZGB 1WXTA 1ZQYA 4DQ2A 1MMDA 3RJIA 3I56A 9ICNA 4KLIA 4O9MA 4FW1A 3G4SA 1BPXA 3BS5A 2LRQA 5CQXA 3PNCA 5L1IA 1ZQKA 1BPEA 1QWFA 2O01E 5IIOA 1UTIA 2K6DA 3CCJQ 1GL5A 5AK4A 2OTLQ 2VV5A 3QXGA 4PJOA 2OJ2A 4YCXA 3M1YA 5D46A 2DPPB 5DY9A 5HKCA 2OTJQ 2KMTA 1AHJB 3I55T 3T5JA 2RNAA 4K4HA 1Q3VA 3NMZC 4BI4A 5KG5A 2NYVA 1HJPA 2EQMA 3PMNA 3ISDA 1YT3A 5AKYA 3G6VA 2ISPA 1NI3A 4Y2QA 2RQTA 3OW2P 2W03A 1NK0A 4OP0A 4MHVA 1FIQA 3G71A 1LB2B 4O5KA 1MUZA 5GANj 1S10A 2ZTEA 4Z6FA 4M9LA 4HVUA 1ZQVA 2K60A 3RAQA 2K5LA 1KQSS 2AJQA 1JUDA 1R0CB 4RNNA 4QW2A 2Y9TA 2N1RA 1XQHA 3VJPA 1G3TA 2B8AA 4M78A 3EFOA 4DA4A 2HEQA 9ICVA 4IQTA 3G6ET 4QZFA 5DQHA 9ICQA 5ALWA 2V9WA 1E7OA 1OI1A 2BE9B 5J0PA 2L3PA 1VQ7A 5J2FA 2DTHA 9ICRA 4KGZB 1R0BG 1V9PA 4QWDA 4A53A 3NRZA 1OU9A 3GNFB 4JJDA 3I9QA 2ZIUA 2E4HA 3E19A 3UXOA 5A0DA 5J39A 5GMKe 3TFSA 3ED5A 1VOMA 3KHHA 2XMFA 4X34A 2D3DA 1VDVA 4DEYA 5ALEA 4RCBA 1K8AC 1KKXA 4XU0A 1Q8KA 4PZOA 5C6SA 4EMHA 1OW5A 2BCVA 5AK3A 1NLPC 1UFFA 5ALQA 2DX1A 5KE3A 3CW2C 1ZQNA 5GJWB 5GAN3 5IN1A 2HHQA 3Q8KA 4TUSA 2AU0A 3GIJA 1K73R 1O08A 5KT3A 1QW1A 3L2RA 1QVFP 2A0FB 3D6JA 1Q46A 2Y4YA 2MI6A 1IB8A 2HBWA 4ELTA 4IR9A 4O0IA 1DRGA 8ICJA 3ZDEA 5J0OA 1FMWA 2QTVA 3Q8RB 4OMPA 2DUYA 4ELZC 3JB9F 1ZQFA 4B9TA 2O31A 1VQOQ 8ICWA 2FLPA 1HYOA 5AKJA 2AGOA 2EJ9A 4F5QA 5KFVA 5AYFA 2CN1A 5KFRA 2ZZDA 5FWBA 2RJEA 3EPIA 8ICYA 2NRVA 4QIWC 1TOVA 2G0AA 1VYUA 1TS9A 3CMET 3JSCA 5AKZA 4K11A 1GO3F 4AG2C 4RUCA 1MV3A 3KFVA 2DF4B 5CKEA 4M7DG 2DL7A 3HHTB 2W9BA 3L2ZA 3CC4T 4EIKA 3CD6T 4YFKA 1AVZC 2C2DA 2EGEA 3OW2S 1I5LA 3HFOA 2A36A 1K73U 1NG2A 4Q5WA 1VQ5Q 1QCFA 5KFNA 2YHTA 1K9MU 3JCMd 1KC8R 1KC8C 4I28A 1HEKA 1IV8A 4JUZA 4C8OA 3FDRA 3O8VA 2E6ZA 1U9LA 4DOAA 4A4HA 3CCRQ 3M8RA 2A28A 3S3MA 3QU5A 1LOJA 3LYIA 4PGXA 4B9LA 5CP2A 3CCUT 1S1NA 2HOQA 2P84A 3X24B 4J6YA 5GAN8 1J2MA 4C7YA 4MF8A 4Q8EA 5KG6A 4C8QG 5AI0A 1N9RA 4RMOA 2YB4A 4YD1A 4IKFA 4KITB 4K4GA 2ZUBA 2D0NA 3C0CA 4QQGA 5ALYA 2W43A 2HHSA 2KBTA 4MMLA 1KLNA 4DFJA 1H3HA 5J2AA 4YN4A 5FU7C 3CBPA 2DXTA 1L8OA 2JR5A 2KE9A 5L1MA 4Z89A 1RI9A 2EDUA 4F5OA 1QQ5A 2CSQA 4DQRA 4P0PA 3U23A 3NVYA 5AIAA 5KFAA 3MDAA 5KT6A 1PSFA 3B9JA 1K73C 3OJSA 1HD3A 2LQ8A 3JB9I 3SYZA 4A4EA 1N6AA 4ME7A 4HCZA 4OB0B 1H92A 1Q81U 3BZCA 4BACA 3OJUA 4F14A 3RMQA 3S6JA 1ZETA 3R6NA 3VS6A 3K1RB 4JS5A 4DQQA 3UXNA 2DBYA 1CKBA 3MBYA 2FPMA 4RQMA 1D1CA 4M47A 2Y0SC 5AICA 1Y7XA 2JS0A 5KYUA 4AFQC 3B0YA 1VIFA 3E1SA 4C4TA 5JUMA 1UGSB 2M9NA 2EVRA 1OQKA 4C7ZA 2P0KA 2CPRA 1TK0A 3SI8A 2F2WA 3V7RA 1PD1A 3MEAA 4QWCA 1XJWB 1X2QA 4E7ZA 2E8OA 5IXFA 3D2QA 2H3QA 2F2XA 3HWTA 1QTMA 4GXKA 5BPCA 1RXWA 2JTEA 4J9DA 4J9CA 4GIBA 2COYA 3QDFA 3QDRB 4LD6A 5GAMe 4ECUA 3UPUA 5KFIA 1NYGA 2D1XA 3I56Q 5J0YA 2CP0A 2GF7A 4F91B 1IZ6A 1RADB 2ISOA 1BB9A 4M75D 4QW9A 3V7KA 2QARA 2YUOA 4M75E 4J9KA 3BQ0A 4GY5A 4KUDK 4NXZA 5DB7A 4DSKA 2K7AA 1RAAB 1SF9A 4M7AG 2E5KA 2KN7A 3M4GA 4PH5A 4M9HA 1T4GA 4EBDA 5IXBA 4F7UG 5KFSA 4RTWA 4C5GA 2ROLA 3T79A 2ZPBB 1D9DA 2PZ1A 3OQ5A 2PVGB 1U3OA 3WKCA 2Y9UA 1TAMA 3JB9G 2QDYB 4JRPA 1KQQA 1IM4A 1VQLQ 1ZD4A 3SAGA 3MHXA 1NK9A 2K4YA 3PVLA 4C8KA 2DBKA 4F5RA 5CQYA 1VQOT 3Q8PB 2ED1A 3CXCS 4C0GA 4CF3A 2JMCA 4M9NA 4KLMA 1YJWA 4YTLA 5KG3A 1C0MA 3TSWA 4C4SA 3LH5A 2QQAA 4O3MA 3OPXA 1Q95G 1DGJA 2PI5A 2K89A 3LVWA 4PFOA 3MEUA 3EGXB 2HVIA 3T5LA 1T94A 1NYFA 3MJXA 3LWLA 3VUBA 2QA4T 2H5XA 4J9IA 4DSJA 2QGGA 9ICUA 1NJWA 4CNQA 2ASLA 1F1BB 3RJKA 2W9MA 1VIEA 3M9MB 1AT1B 2KKPA 2ED0A 3Q8MA 4QVDA 2BKEA 4AYBC 2DEUA 3C5GA 7ICJA 4B9XA 1M90U 3PIPA 4E7IA 3NVZA 1K8AU 1TWBA 5DGBA 2C0OA 2RK1A 1RAIB 2G08A 1ZQHA 4PFZA 4JS4A 4LDUA 4XTVA 3F70A 2KQWA 4Q8FA 1SL2A 3EGDB 1UA1A 4F7UE 7ICGA 1D1BA 4QVZA 4KH1B 2A08A 5KFYA 2C2EA 2F2VA 4FE3A 1UE9A 1S72T 2FPKA 1JX4A 4KMUA 2R8GA 2KEYA 1XSPA 1WHHA 2DXBA 1VA7A 1WHKA 4ECYA 5EE0A 5CEHA 2ZPIB 5KH6A 1ZQEA 2KSOA 2O88A 2DO3A 3PVXA 1KTQA 5CKDA 2RI2A 3SZ2A 4FZNA 3NHNA 2QEXT 3OS5A 4UAYA 4PJOD 3D2NA 3IG5A 1ZQDA 1S9FA 3G6XA 1KSWA 3SWNC 4TVRA 2VJ4A 2YUQA 3BFMA 3EHQA 4IIMA 2MAXA 5ALGA 1WXBA 4J7FA 1YWOA 2RQVA 2A1AA 2I6XA 2HHXA 2JEJA 1SIJA 1OV3A 4ORZA 1VQNA 5KYUB 5KFMA 3PT9A 1NM7A 3GF5A 2EWNA 3V8LA 4MDWA 3KFUF 1WHMA 4IL6U 3ORYA 3CRXA 4ECVA 5D6XA 3FC3A 2RD1A 1KQ1A 3NS1A 1M8VA 3GZFA 2KJ8A 3BDPA 2AKLA 7ICIA 1ZSZC 2UVVA 8ICAA 3PR4A 4Y2TA 3HW8A 2HKNA 4P0QA 1L7NA 2FPLA 2W7PA 2W54A 2Y0SF 1M27C 1WPYA 4KTQA 4EX6A 3HKZC 2AKKA 4JJNK 1VQPA 1VQ9A 1L3UA 2YMLA 5HY6A 1DOQA 4EZ9A 2LX7A 2ATCB 3X28B 2PFQA 5GAMj 4ACOA 2GO7A 2FPDA 3OB9A 4B9NA 2DXUA 1RLPC 8ICLA 3CCEA 1U1SA 4PPXA 3EGUA 1NZ9A 2DL8A 3JCMV 4F7UF 2EQUA 2KY9A 1ZSZA 4P5NA 1JJ2A 2YB1A 2VASA 2VA2A 4MF2A 4DOWA 1ZOLA 3EZ5A 5AM4A 3SWNB 2X35A 2DKGA 2WAQF 2PFPA 1TUDA 4C8QC 4UB1A 4J9LA 4OB2B 1M2VA 5ALIA 2RB6A 4BGDA 4UBCA 1H3ZA 4QZEA 5IIMA 1YHQT 1YJNT 3NASA 4EBEA 5HR7A 2KI7A 2RI3A 4ED0A 3L1AA 2KK0A 4M6WA 2YT6A 3A98A 2QA4A 4GXJA 4YD2A 1T3SA 2R8HA 9ICBA 3HL8A 3MGHA 5DBBA 2FYKA 4KLSA 2BCSA 4F5NA 4M9JA 1NJIR 2LCLA 1VQMT 4RTYA 4C5IA 1URJA 2DL3A 2H3JA 3SAFA 1UGVA 1AQ6A 4PJMA 5DLFA 3HRUA 5FWCA 1A76A 4F7UB 3QU7A 2F1LA 3UDCA 4F2SA 4M77F 5GANg 4C80A 2E12A 2J6OA 2MUTA 2BUDA 2CH4W 4KGXB 5J0TA 1K9MR 1OX8A 1VYVA 4C0FA 4C8QD 4VUBA 3M0RA 2QQSA 2RHYA 8ICQA 7ICNA 4HCBA 1WHLA 2B86A 3TVTA 2RI5A 2HBLA 1QCKA 4ED8A 3OYEA 2H3VA 4E7LA 2MSNA 1KD1C 4A4FA 4DBHA 3PZPA 4RNMA 1UB4A 1C1AA 1L5UA 1LKYA 1X9WA 1QKXA 1ZLMA 3GV7B 4JZ3A 1KSPA 2C2RA 1N61A 1S0MA 2YLCA 5LJ3g 4IRCA 4PJNA 2E3TA 2DK3A 9ICLA 2HQXA 1O9SA 3H7IA 2DJZA 1AD5A 1B34A 2PVOB 3HP6A 4CI0C 3CCLT 5D6WA 1L7PA 2EYWA 4N4HA 4AFZC 1OX9A 4A54A 1YZ7A 4IQVA 1ZBXA 4F92B 1UA0A 2DEQA 3CBOA 2M0YA 1M90R 5DGAA 2NUPB 4QNLA 5F3XB 1Z1BA 2NRWA 9ICPA 4JJBA 3TCJA 1QVFA 4BJQA 5CRXA 4HAIA 4C8NA 4B6JA 3H4DA 3CCQT 1VQ5T 1H641 3MFHA 1V76A 3L4PA 1X9XA 1TVAA 3CC7Q 2BIVA 4G9BA 4YVZA 4F17A 3N7RC 2SEMA 2OAWA 3IQLA 1IXRA 3LDAA 2YXYA 1PK1B 2YDLA 5ALFA 1YJ9T 2V8KA 1SV4A 3EH2A 2JMGA 2RDIA 2YMQA 1L6NA 1WQWA 2Y1IA 2DJQA 3CCJT 3RJFA 4CCHA 3VRZA 4X9DA 1G2BA 2Y90A 4PJJA 3UA7A 2ZPHB 1YJWT 3HKZF 4ZH4A 2X3XD 4MMKA 1H8KA 2QLTA 1EX4A 4ESRA 5CCAA 4F93B 4M2YA 3GU3A 1BI1A 3FIFA 1HXDA 9ICKA 1O75A 1Z4NA 4DO9A 1VQKT 2DERA 1QLNA 1W2BP 2DKZA 1KL9A 1RACB 2KP7A 4K4IA 5ALKA 4FS1A 4FBUA 3RH6A 2YRVA 5HK3A 1ZSZB 4PHAA 3CPFA 3CC2T 2HHWA 4LE9A 4M78F 3INZA 1ZRNA 5D4BA 2F5KA 2QKQA 2J6FA 4J9GA 4E7KA 5ALHA 3QYGB 1NOMA 4UB2A 2BZFA 1JB0E 2DKXA 5AKIA 3SR6A 4KH0B 3FM9A 4E7SA 5JU5A 2COZA 5KFDA 1ZQTA 5IHIA 4EYHB 2RHIA 1YP5A 3DEEA 2JH1A 2RJFA 5AI6A 2RHXA 1DK2A 3V7JA 5ALOA 9ICOA 4RUGA 1M4ZA 5KCOA 1IG6A 2WF9A 3MR6A 4DL2A 3ALRA 3OYNA 5GMKj 1C6VX 2BKDN 3EHRA 5KFGA 4XK8E 3CCSA 1ACMB 1L7OA 2QB0A 2AT1B 3C29A 3HSBA 1KFSA 1CSKA 1V1CA 1ZA2B 1ZD3A 1D0XA 3DB3A 3SB2A 5GMKi 1SWWA 1LKYB 4NL3A 1GCQC 2BZXA 2XO7A 3L42A 4BWMA 3EWAA 4CE6A 3JPQA 3OHBA 1WLPB 2E3IA 4QZAA 4RG8A 3DKMA 3A0BU 2R57A 4A8EA 1JJ2S 2MK5A 1TAUA 3C1ZA 2KKVA 4F5PA 5C5JA 1C7YA 4C92E 2V8IA 2CZ1B 1KQ2A 3BJYA 1KFZA 4MZPA 1MQ3A 5LJ5g 3TACB 5AKLA 5AK5A 3H9NA 2GH1A 2HDOA 2HBKA 3QX7A 1M8MA 1PKSA 2DE0X 1WJSA 3RERA 4J9SA 2DYBA 4R63A 3F2CA 9ICXA 3JB9H 3A8GB 2CDTA 2PFOA 2EFIA 1OUQA 4J03A 2ZJAA 5J2KA 4O5CA 4M75B 5LJ3d 2MAMA 1KDHA 1RAFB 1VQ4Q 1IGUA 3C23A 4GBQA 4DLGA 4MFAA 3PX6A 4RQ0A 3CCQQ 4E47A 1OOTA 2RQRA 4OGCA 1XTDA 4I2EA 3E9FA 4IR1A 5ALPA 5LJ5j 5HP4A 1BI3A 4I2CA 3VYHB 2VANA 9ICIA 1AOJA 1AWWA 3NGPA 4I27A 4ZTJA 3CXCP 5KFXA 1JROA 2FZGB 3RJJA 1QSSA 3BY7A 4C8LA 2EAMA 3RBBB 1IRXA 1WDXA 2JXBA 9ATCB 4IC9A 4PK4A 4NL2A 2JEIA 1YFNA 4ATOA 1K0SA 4AMCA 4Y2SA 3QJ6A 4I2AA 1BK2A 2P66A 3GIIA 3KBGA 3PY8A 3HT3A 1U48A 3BS7A 8ICGA 1RUWA 3CP8A 1X69A 2K57A 3ETLA 3PX4A 1JALA 2AIRB 3KBBA 5ALUA 2LT1A 2UVWA 1VQKQ 5KFOA 1K5OA 2K2MA 9ICMA 1X2IA 3RRGA 1Y96A 4L59A 1T8EA 1TAQA 2A37A 5D6YA 5GTIU 4C92F 2VKQA 2ZG6A 1UGPB 3CCEQ 3M5AA 5CKHA 1QSYA 2AH5A 2RQ5A 3I1YA 1MNDA 1SG5A 4TUPA 3CEYA 3EPGA 4MEXA 3R6OA 1VQMA 2I5HA 4PGYA 1JIHA 4UATA 1RYRA 1YNZA 2KDSA 3PMTA 3DV9A 1UG1A 4ANJA 1ZQXA 4FW2A 3E58A 1K1SA 1BNOA 1XNSA 2C0TA 1BGXT 4IURA 4DBFA 1QCOA 1L8LA 4E7HA 2DD4A 1BKBA 2E5QA 3QYHB 3EG1A 4XTXA 1ZQZA 3QEAZ 4J6WA 4FZMA 4PJOC 4RG2A 2FPEA 2JT4A 4NL9C 3C2KA 4ED1A 1HUOA 4BDZA 4EMKB 1VQ8T 2K5IA 2EKHA 5T14A 4LDWA 3OYAA 2KNJA 3O0FA 2HCKA 2HOIA 1SZHA 1WCLA 3ZEHA 2KSSA 1V38A 2OWOA 3M9NB 1EXNA 3V8JA 3OYGA 4C92B 4JB3A 4YMOA 3PW7A 1LPLA 1G3YA 1VQ7Q 4O3SA 1ZYQA 3EFRA 3CC7T 2NUPA 2LQKA 4M7AF 1XNIA 5DDYA 3TANA 4J9QA 3RH4A 5EWFA 4HCKA 5IAYA 2KIVA 5KFQA 1OYXA 1XWLA 3MKDA 4M7AC 3D2SA 2CSIA 2BCRA 1G3SA 3OYDA 5ALTA 5DG8A 1GFCA 3THKA 1NK7A 1T0JA 4PJLA 1VYTA 5KG7A 2LYAA 4I2FA 3SV4A 2L8DA 1I1JA 1FO4A 2DPIA 3SAHA 1RXVA 2FMSA 4QZBA 2OX7A 3RAXA 4KBMB 5BOMA 4Q45A 4J9HA 4QKUA 4F4KA 2RHFA 5J0UA 4CGZA 2QGFB 4L5GA 1V97A 4AT1B 2GTJA 2WSEE 2YWWA 7ICLA 4TQSA 3JPOA 1MQ2A 4LXCA 5GAOr 1JXLA 3LWMA 4JUVA 5KG1A 1RAGB 1KW4A 3CBMA 4TUQA 3TADC 1TU0B 3TREA 2RJDA 2PNIA 3WKDA 3WK5A 3M59A 4AFUC 4IUPA 5KFLA 1NJYA 2HD0A 2DYIA 3NTKA 2YLBA 2KGTA 2JM8A 3RJHA 5TZVA 1WIEA 3BQ2A 4RPZA 1KHCA 2K8CB 3WK9A 4M78E 1WA7A 2RRDA 3OYCA 5LJ3e 4AYBF 3THVA 5HK0A 4HCCA 3JB9D 5I11A 4P4MA 3UMCA 3JAME 2G06A 2ZUDA 1C20A 1XU4A 2GQIA 1SRMA 4BWJA 3RESA 1MMAA 2EQJA 4KLOA 4NM2A 5B66U 1E6HA 1WFWA 1N8RU 5KNIA 4UB4A 1RYUA 2OXOA 5HNKA 2LC4A 4LUDA 3P8HA 3UT1A 3OHAA 7ICUA 3MEVA 3R9KA 2W9AA 5KFJA 3FJPA 3GNGA 5AKXA 4PHEA 3S3NA 5KFKA 2ESEA 4KT0E 3META 3MABA 1JBMA 1JQQA 1ABOA 7ICQA 1S72Q 2KHQA 4F3OA 2LVMA 2JEGA 1E6GA 3DDHA 1I5OB 4DOBA 4Z6EA 2GGRA 5KTQA 5GANe 4DSLA 5DLOA 4M75G 1CEZA 2RJCA 2K5FA 2OTLA 2WFAA 3CCST 2H3IA 4FM4B 2DMOA 3X25B 1D09B 4YG2A 4CF4A 1D3BA 2AZSA 2E8PA 3SMVA 3A8MB 2HAXA 4IS7A 2KIWA 4JRIA 3FEOA 2EQIA 1RQLA 2D8JA 3GPLA 2DWQA 4HKEA 1GCPA 4IUUA 3WVDB 2KZ3A 4J9BA 2O4XB 3KXTA 2BQRA 4B9UA 3JCMg 4Y91A 1NNLA 2EQYA 3KHGA 2CP7A 1ED1A 3A0HU 2K9GA 2VUBA 3QJYA 2XDBA 2PFNA 4P4PA 1YJWQ 3LW5E 3OW2A 3C21A 2RQUA 4JK1A 2WTFA 3FJ5A 4OGEA 3TU4K 2HMXA 3JPPA 2XKOC 2I0NA 5E79U 5GAOq 1M6YA 2IVWA 3OSSC 5C0MA 2ES6A 5A0GA 3CCLQ 4ED2A 1NK8A 3URGA 1ZQUA 4FSXA 1HJDA 4NJ8A 2X3WD 1ZX6A 3RRHA 3PO5A 8ICKA 1X6OA 3KZXA 1CI4A 4DS5A 4JV2A 2X4XA 4ECQA 4R8UB 1K9MC 1SXDA 5EWEA 4CC4B 1KD1R 2KVQG 1JXMA 5JTIA 5EG2A 3PW2A 4XU2A 5CKBA 2J6SA 4Q44A 1TG0A 5L23A 2MUTB 1ZQRA 5KFTA 1SXEA 2IBKA 4I2HA 1BI0A 1PRLC 4QIWF 2W11A 3PW5A 4UBBA 4C0DB 3M0PA 5ALZA 5KL1B 1NJIC 3HPOA 7ICMA 5B5EU 2YRCA 3QZ5B 2VXFA 3DLLA 1U4BA 3I28A 2GCXA 4RQ2A 4XQ3A 1VQ6A 2YMMA 4GLMA 4QZDA 4DCCA 2FPFA 3AQFA 8ICVA 1U8RA 4OJ5A 4OMMA 1BNPA 1ZD5A 3JPSA 1RQNA 4J9EA 3GP8A 2KEAA 1NJIU 1PKTA 2PUOB 4QQ6A 2AGPA 1M1KR 1OPLA 4F04B 4R8UA 1PNJA 2XI9A 4DQPA 1D0YA 5LJ3j 3GOXA 1W6XA 3G71T 3E0FA 8ICCA 1T3QA 2GNCA 4DOCA 1X9MA 2KK4A 9ICGA 2JNGA 3MP8A 9ICHA 4HVVA 2E6NA 2HOFA 5GAN4 1NK4A 2BPCA 2K8AA 2WF5A 2YX8A 1M30A 1R8OB 1CUKA 2A1JA 2W7OA 1QVPA 1VQ8A 1UHUA 4OMOA 2RP5A 2HVHA 4F8RA 1LNXA 3WK7A 4M0AA 8ICHA 1JRIA 3M55A 1PWTA 2DD5A 1VUBA 3OYYA 2WAQC 5DBCA 2BCUA 1SL0A 3QBYA 8ICFA 1K9AA 2AK5A 1K1ZA 4M7DD 1JRPA 4OMFB 4JRKA 4ECZA 2F69A 4XTYA 3MC1A 3LVVA 3FRNA 3IV6A 3CD6Q 3CC7A 1RG6A 3PSTA 4LNPA 2FG0A 4B9WA 2QAZA 4NS5A 3T5HA 3C4SA 1A6SA 2VWFA 1A0NB 3QEBZ 2E8NA 3RH5A 1NE8A 3A1PA 3K75D 4ICAA 3OSNA 1RYSA 5CB1A 1X2KA 5CA7A 1B0XA 2DFLA 3K4GA 5KFPA 3MDCA 5DKWA 3M0SA 3VRYA 1Q7YC 2EZZA 1ZQLA 2W9BB 3VS0A 2FMQA 2RF0A 5J2EA 2CT3A 5J2DA 2DVEA 5I2MA 2E1FA 2CZ7B 1SKUB 1TUCA 3I35A 1VQLT 3UATA 4HT8A 4M78B 1PZNA 3WXMB 3JCMW 5LJ5e 1M9SA 2DAQA 1GCQA 2ENMA 2KV2A 3QUQA 4FSSA 1TE2A 2FI1A 2XICA 4MFFA 2BPGA 4JZ4A 4YXJA 4BE0A 3GLXA 5D7UA 4PL1A 4PNOA 3UQ2A 2EBPA 2HZYA 4OB3B 1WWVA 3PSFA 2JHDA 3ZDDA 5ALRA 3QUIA 4OMQA 2DZ9A 3T3FA 3VCBA 4DLEA 4Z6CA 1I07A 4KMOB 3RB6A 1DJ7B 3TFRA 2E5SA 1WHJA 4QZ9A 4EZ6A 1QCNA 2CYZB 4LD9K 2RHZA 1VQ8Q 1IXDA 4FS2A 2XU8A 5AM0A 2YUNA 3WK8A 3CCET 2LT4A 3V8KA 4ELYC 2WB1F 2LI6A 2DNUA 2CP3A 4ED3A 5KYXB 2F1HA 4R56A 4J9MA 2HHTA 2YTUA 1FMKA 3OS2A 3BDLA 3M57A 2OI3A 2CZ6B 4ZN1A 1ZHIA 2H3ZA 3JCMc 3SEIA 4F16A 3GFKB 3QIIA 5ALSA 4YR3A 5CHGA 1DXSA 3UMBA 3KUFA 5KYWB 1VQ5A 3VS4A 1M90C 1Z00B 4YR0A 3C28A 3B0XA 7ICTA 2CH4A 2OEHA 3HTRA 8ICUA 1AEYA 1KD1U 1A0PA 4M7DB 4G3IA 1HK9A 2K4EA 2XY6A 3ASKA 1YI2T 5KAIU 2X4JA 4UAZA 3LLRA 1PHTA 2DIGA 3CMAA 3UF4A 1Z00A 5BOLA 3ICXA 2VGMA 7ICHA 1LVKA 2XVTA 4FT2A 3VYGA 4I2JA 1D8LA 3OYLA 1G3WA 1YJ9A 3H0RB 2A1JB 1F5SA 1QQ6A 3PVQA 1ZQCA 1FXXA 3JRZA 5J0SA 3ZI4A 3L5KA 1BPDA 1VQNQ 3AUOA 1MN8A 2KSOB 3EGXA 3P8DA 1PSEA 4KLFA 2KT8A 2KT1A 2KICA 2L2PA 2D8HA 5J3BA 3RNJA 1NKCA 1RDFA 1KG1A 1WX6A 4YMNA 3EG0A 2JZBB 2UVRA 4KLJA 1ZQQA 1VQKA 3VUZA 4KN7A 1Z3EB 3D7SB 2CP2A 3I55A 1YCYA 2HI0A 2I1QA 2D0QB 1TSFA 1NK6A 4EMKA 5GAN2 1G83A 4BE1A 2D6FA 4LZGA 4J6XA 1X66A 4QZIA 1U49A 4C92C 3UMGA 3SFMA 1SKRA 2J05A 1V85A 1S5LU 3UM9A 2A7YA 4RZRA 4RU9A 2RQWA 3F2BA 3JCMe 2ZTCA 3BQTA 1BI2A 3M58A 5GAMd 5AT1B 3QU4A 2XC9A 1W4SA 2B21A 3PSIA 5EOZA 7ICRA 3MGIA 3N97B 5GAN5 1Q82R 2L89A 1N62A 3RR8A 4OD0A 5KFZA 3PMLA 1FYNA 3HX0A 3MFIA 2KRSA 4X9CA 5CWRA 4R64A 4O3PA 5KL8B 4OMNA 2YMPA 2G09A 2F44A 2W10A 3CC4A 3OYKA 3TEEA 3CD6A 3MR2A 4IQWA 4ZGJB 1ZXIA 4I2GA 3OMCA 3HJEA 1JN3A 2FLNA 1YBYA 4C8QF 3CCQA 2E8MA 3EFSA 1MA7A 4BI8B 5AI9A 4Y2UA 3WVEB 2WSFE 3TADA 2HHUA 2ZIUB 3TAQA 3G71Q 4DSEA 5I2SA 5DQIA 1T7PA 2W8KA 3F5EA 4KLQA 3EW9A 1Q86U 4R66A 4BY6B 2RN8A 3IRUA 1FX7A 4Y2YA 8ICTA 4UB8U 3I56T 2M0OA 5I22A 2MU2A 1MHNA 3BW1A 2ROTA 3JB9J 4UARA 4P0QB 5EE1A 3PX0A 4ECXA 4Y2PA 5AI5A 3CQTA 3JPRA 3HRTA 4PLIA 3UPQA 2GFUA 3T5KA 3IG8A 2EZYA 1MNEA 3C1YA 5J0WA 3TARA 4KLEA 4QQDA 3PTAA 1ABQA 1Q81R 2GBQA 3M7DA 2ZPGB 3UXPA 1ZD2P 3Q8LA 1M3BA 5KFEA 4DFPA 4ZGEB 2FB7A 4EMKC 4PZNA 1YIJQ 3JCMQ 1D8BA 2LCSA 4TQRA 5DG9A 4MZMA 9ICSA 4NY8A 4C92A 2XIDA 4Z6DA 3C95A 1RI0A 1ZQ1A 4AG1C 5DLQE 5AKEA 1V29B 2JOYA 2DBMA 4F71A 2NWMA 2ZAEA 3OSPA 2ZPEB 3IHQB 1X75C 1MGQA 1GBQA 5GAOn 2X4WA 1M1KU 2RO0A 2LP5A 3M54A 2G07A 2QB0B 2F77X 4ED7A 4LVSA 1NPRA 4N4IA 5LJ3h 4M04A 4KLHA 4B9VA 2E10A 1WZOA 4ZGDB 3AU2A 4EDUA 3CCLA 3KD3A 2CUBA 3AHUA 4NL9A 2MMPA 2W55A 4PGQA 3H0FA 2XDDA 1U5SA 9ICFA 3SWNA 3JCMf 1UT8A 2ZJ5A 4NM1A 3E2EA 8ICXA 2YSQA 2L3QA 3PMIA 8ICZA 3G6EA 5GANd 3V7SA 1VQ7T 4PHPA 4O3OA 2LJ3A 5IIKA 5KFCA 1ZUKA 5IIJA 1HUZA 1D1AA 5DG7A 4DS4A 2FRWA 1GFDA 2ABLA 4DFKA 5GMKl 4I2DA 1IHVA 1VQLA 3RR6A 2L3SA 3A5ZB 4PL2A 1YITA 2ATLA 4QWBA 1BPYA 3RTVA 3QHSA 4I2IA 3M0UA 5HHHA 1Y57A 1B43A 4XA5A 1ZQOA 2QB1A 2E64A 4LDVA 1WXUA 2NO4A 2ZIVB 3OYMA 2MYSA 2ZGWA 4DFMA 4LN2A 2HL3A 2WF7A 4OJ6A 3OYBA 4FBTA 2X9HA 2KOBA 5AKKA 2VJ5A 4TURA 3AMZA 7ICSA 7ICEA 2OTJT 2O6KA 2BQ3A 1P92A 2MWOA 1S0OA 4DL7A 1N9SA 4MZTA 4YR2A 1Y71A 1B22A 5L8RE 1DK3A 1PK1A 4DL6A 1VQPQ 2KROA 1WWUA 3KZIU 3ZDBA 5EE9A 1QP3A 3NTIA 1M1GA 3HKSA 3PW4A 4RQ3A 3RB0A 3MPUB 2F8KA 4XTWA 4US8A 1YCSB 2KRMA 4KGVB 2GLEA 1SHGA 1JU5C 4KUIA 2EAOA 4O3NA 2AHJB 4PJ0U 4HVWA 2J7IA 3VS2A 8ATCB 5CIUA 2XCPA 4XQ8A 2KYBA 1YIJA 5ALNA 2LJ1A 2JV3A 1QQ7A 2LKYA 3NVWA 1N48A 2DTIA 3CYMA 3NUQA 4M7AE 2MPXC 3QUTA 1WHGA 1N5WA 4RTUA 3N5BB 2WSCE 2BTTA 1N5ZA 5CR0A 1LCKA 3A8OB 1Q86R 4M75F 2R58A 1WQ7A 2RH2A 4Z02A 4PJOG 4E2FB 1IGQA 4JV1A 4KLTA 2KAFA 3L2QA 3TKAA 4M78C 2L5YA 1NKEA 2FL7A 3X26B 2FZKB 3U26A 4C5HA 1SHFA 2EYXA 4EELA 3DB4A 1JXOA 1VQ4A 4FIBA 2HBMA 3WU2U 3OS1A 2CXYA 1AWXA 2XHCA 4RTVA 4OF1A 5KYNA 4HYKA 8ICIA 5J2BA 4PL6A 7ICPA 3VV0A 2RA2A 2BGWA 3PE0A 1XC9A 4CRIA 3EG3A 1ZA1B 3S3OA 2V26A 4Y2VA 2P4TA 2IOHA 5K4LA 5AM1A 1TKDA 4EBCA 2QQRA 1D0ZA 4ECRA 2OYYA 3K1ZA 1X6IA 1OEBA 5AKHA 2K3XA 1ZBJA 2F1JA 3QU9A 5FU6B 1OPKA 3SD7A 5KFBA 2IPOB 2P0PA 5KT4A 3OBYA 2LBOA 2JTMA 4FCYA 4P4OA 3M8SA 2QK0A 5IHKA 2EKOA 2M9UA 5J2CA 2G5HB 5CK9A 3CCRA 3MP1A 3KOOA 1L3TA 2MA1A 3LK9A 8ICRA 2ZIXB 1GXIE 4CC2A 2IOFA 4UC4A 2VGNA 4RTZA 2DIQA 2FO0A 2DPJA 2PI4A 2PTKA 2VKNA 2W3SA 3UWNA 3O5ZA 3AM9A 2ASJA 2EAYA 5KFFA 5J26A 3AN1A 3V72A 5AM3A 1ZQPA 4F4XA 7ICVA 2LQWA 2LQNA 2LTOA 3HPWA 4JV0A 4OJLA 1TTHB 4YXMA 3NPFA 2K4HA 1PVPA 4FT4A 3GBQA 3CCVT 5LJ5d 1SWVA 1WG8A 5GJVB 1BYMA 2QEXA 3NTUA 1Q7YR 4LUEA 5KT5A 2KJ5A 1VQMQ 5ALVA 4JLGA 2KVCA 1NZPA 4WCIA 1Q3UA 3QUBA 3ME9A 3JCMh 1F44A 3QE9Y 3EG9A 4CC3A 2PMZF 3JPTA 1TFRA 5L1KA 3KKAA 4RT3A 1QP2A 2IG0A 5KCHA 3NVVA 3KHLA 4DL5A 4XTZA 3REAB 1JO8A 4L6V5 5KYXA 5A2QE 2DLPA 1SSFA 3G7ZA 3L2UA 3M9QA 3CCMA 1F0MA 1KEJA 2EH9A 3FDSA 1KFDA 4M77A 4O6JA 3QYPA 4M7AB 3SV3A 1I4K1 3KHRA 2J06A 5GAN6 1B34B 3GIMA 2W04A 1NKBA 1ZQIA 3F5AA 5ECAA 2QG9B 3H8JA 4M7DA 5KFHA 1OULA 1S8OA 4RUAA 5A0LA 2UVUA 4NLKA 1WYXA 4QZGA 1BIBA 1N8RR 1Q7YU 2YN4A 2BZ8A 5KG2A 3OBWA 4RQ6A 4GC7A 1B4FA 2KRNA 5GAOp 2DXCA 4ELUA 1B7TA 1G5VA 4EEYA 5DDMA 2W9CA 2WB1C 3VS1A 5F9LA 3SHWA 8ICBA 2G3RA 3AQEA 2KZMA 2JJ9A 1SRLA 2GFAA 4LZDA 2JVVA 4PLLA 3QWXX 2XK0A 4FU6A 4ECTA 4U6PA 2W8LA 1UPHA 3VS5A 2ZIWA 2FMPA 1UQVA 2NRTA 3G1JA 3BZKA 1N56A 2DQNB 2MF2A 2QQBA 5GAMh 1YJNA 4IRKA 2JM9A 4MDXA 8ICOA 1KC8U 2FE9A 2KXCA 2NO5A 5KFUA 1I0CA 2FRYA 3OA6A 1SL1A 4FL6A 4RNOA 3MEWA 2JGAA 2G5IB 4RQ7A 1SKSA 4NWIA 2F76X 3LH0A 2KFNA 4MFCA 4NLBA 5GAOm 1X43A 1VQNT 1BPZA 1EIFA 2VIXA 1U1TA 1ZQAA 5AM2A 2IA6A 1KJWA 2COWA 2CUDA 4OCZA 3GV8B 1MMGA 3CCJA 5I21A 2AGQA 4Z88A 3BQ1A 5H2FU 4DF8A 4LDXA 4ZTFA 1ARKA 4UAUA 9ICJA 4NLGA 4A4GA 4NOYA 2E3HA 4WF2A 3CCRT 4BE2A 4HT9A 4WJ3B 2PKEA 3TQ7P 2DGZA 3IN5A 2BPFA 2RHUA 1TXQA 1LV5A 2H3EB 2C28A 3ETRA 4M7DC 1W1FA 2KMDA 3V6KA 3VU3C 1PVQA 4BI3A 5CR2A 8ICMA 4FZLA 4ELVA 3CC2A 4RQ5A 4ECWA 1I81A 1ZQSA 1SB3C 3SD4A 3LWIA 1YIJT 2RDJA 1D3BB 3A8LB 2MOXA 2R18A 4RQ4A 1KHIA 4OJPA 4F50A 2RK2A 4Y2JA 1M1FA 2DILA 1TUGB 2HSEB 4ED6A 2LZ6B 2E70A 3HRSA 3ZL7C 3J80E 4KULA 4D8KA 2MRLA 2EYZA 2DFUA 1KN5A 4RQ1A 4CF5A 3GQCA 3NTHA 4FYYB 5CAIA 3ONNA 1N5XA 3JV3A 3OS0A 3G4SQ 4M6WB 3NFCA 5IH2A 4AFSC 2EPDA 1K4US 5DB9A 2O9VA 5TISU 2HNIA 3UA6A 4RTTA 2VYTA 4J9PA 1NJXA 3H8WA 3RMSA 4QWAA 1XS9D 5FRMA 2ZXHA 3TQ1A 3HILA 3N4MB 2FLLA 4XAXB 3GILA 1YHQA 1QWEA 3QO3A 4LJXA 1M2OA 2VVKA 1X6BA 2SRCA 4DQIA 3MP6A 1L7MA 3QWYA 1VJ5A 4P2HA 4PFPA 1S77D 3CCUA 2DTOA 3CPWS 3J81j 3FYHA 3RB4A 4BXOB 2CP6A 4EYIB 3OSVA 3G4ST 2Y1JA 3CMEQ 4M7AA 3PO4A 1J3TA 1NZBA 4JMUA 4BY6C 4Y28E 3QUCA 2XGQA 5GAMf 2K3BA 4X5VA 2C0IA 2BHNA 2K2VA 1VQ4T 3ZD8A 3LYSA 2W0ZA 3FC4A 2D6FC 4PJOB 3BQ7A 2FHDA 2E65A 2NUZA 1MC8A 4ZNXA 3CMAQ 2HQHA 3M4YA 4KX5A 1X6JA 4UAVA 1FEZA 4F72A 1NJZA 3EGDA 4J83A 3H0IA 4IQUA 4P0PB 3H41A 1ZRMA 1XSNA 2LHTA 1UJYA 2F5TX 1ECWA 4CC7A 2KE7A 4RKUE 1COOA 1Z1VA 1JI7A 2EW3A 2W9CB 1RZTA 3WKAA 3MR5A 3OYJA 4NV0A 2Q0ZX 3PV8A 5ALMA 5LJ3f 3QKJA 4XRHA 3M6ZA 2ZJ8A 2JRZA 1N60A 2KD1A 4R0KA 4IRDA 2M51A 2ZXIA 4D6WA 1RAEB 2CRXA 3X20B 2PMZC 4DBRA 4E0DA 1G8XA 2KJ9A 2JMAA 1K76A 2K4IA 3JPNA 1FWZA 4DFDA 4USAA 1RL2A 2E41A 8ICPA 5DB6A 2AQ4A 1QVFS 5J8YC 2XD0A 4M77G 4B9SA 1WJRA 4J7IA 4JRQA 1W2BS 1TK8A 2EGAA 3IP4B 4DSFA 4M7AD 5FP0A 4HXJA 2QTXA 5J2HA 1T0HA 1NEBA 1Z19A 1KRPA 1U47A 1X01A 5CO7A 3OYFA 2R8IA 1PCXA 2HQEA 5IIIA 2K3YA 2VXEA 2BDUA 1NLOC 2MWPA 5ALLA 1SZPA 1ZQJA 4LDYA 2O4XA 2XY7A 5DLGA 2BDPA 2LM4A 4C8MA 2E1HA 4C92D 3CCMT 2RLTA 4XTUA 3TAPA 4YQWA 3J81E 2OCEA 4DEZA 1RM6C 1OZ3A 1XO1A 1WNLA 5GMKh 4IIOA 3CXCA 3AL0B 1M3AA 4KLDA 1AWJA 5FROA 3H0HA 5HR6A 3JCMJ 1YZ6A 3NGDA 4RTXA 2AQ0A 3BE3A 4YP3A 2VA3A 2QA4Q 2L0AA 4BX9C 2P6RA 1PK3A 1N27A 4ZN3A 2ZUCA 2H8HA 5KG0A 1OU8A 4C0ZA 4ECSA 2LJ0A 4UB3A 1JJ2P 2JH7A 1H38A 2HKQB 2DA9A 1TK5A 4JDSA 2PQWA 4QW8A 5IILA 5FRNA 5L9XA 8AT1B 3ER0A 3OMGA 4GFJA 3C2MA 1BBZA 1PRMC 3M53A 3JCMX 3QSUA 5J8YA 4DQSA 2ODGA 5ALJA 1M1KC 4NLNA 2EYQA 3CMEA 3PSPA 1Q81C 2XGPA 2I2LA 2QDLA 4UB5A 1I8FA 4N4GA 1YI2A 1W70A 1K1QA 1OXJA 2PUKB 3EUB2 4M77E 3M6KA 1RABB 3M0TA 3VC8A 5J0QA 2XY5A 4QZCA 2IHMA 1QMCA 1J97A 2EZXA 1WUDA 3ZBDA 4RPXA 2PU9B 3AT1B 1YHQQ 4Z8AA 4BD3A 2DL4A 4C92G 1VQOA 1NK5A 1YITQ 2AZVA 1QVGP 3P8BB 2M1HA 4QT7A 5J2JA 4F4WA 3EYZA 3CCVQ 3Q1JA 2EQKA 2F2AB 2EAPA 2LX9A 1CRXA 3RB3A 5FLXE 1UGRB 4J9OA 1BCMA 2P4RA 4Y92A 1NPPA 2HCFA 1FFVA 1KK7A 2V1RA 2V1QA 3VS7A 4NLZA 1RAHB 5IINA 3UQ0A 3NRWA 2IOFK 4M77D 1Q86C 4DSIA 5LJ5h 3Q8QB 4KLGA 2Z0WA 1EZZB 3GIKA 1S0VA 2LPEA 3LGLA 3M9OB 4EX7A 1TH7A 4MEYA 3QXEB 1XSLA 1ZUYA 4FO6A 1RLQC 1SEMA 5G5GA 4UASA 5AIBA 2GOLA 4BB7A 3BDUA 4JWMA 3WK4A 1ZQ1C 1GRIA 4II1A 1MMNA 2KNBB 1K8AR 2JS2A 2JTFA 4NLCA 2XG8D 1BU1A 3TSZA 3N7PD 2JEFA 3FLGA 3AU6A 4DL3A 2ESWA 3RKXA 4PJOE 3REBB 4ZOHC 1Y88A 4AP9A 3IM1A 4XU1A 4PJOF 3OYHA 4EENA 3CPWA 4RPYA 5J0RA 2F1IA 4OO1J 1TV9A 4C8QA 2D8CA 1Y07A 2JXJA 2HSPA 2WF8A 1Z4OA 7ICKA 2KTQA 1RPLA 4DOVA 1FMVA 2NLUA 1U06A 4JJCA 1S72A 3I5RA 5M9OA 4KX3A 4XUSA 8ICNA 5DB8A 1QQJA 1IO6A 3V6JA 2Y4XA 2WHEA 1CKAA 2P0QA 2EANA 1GBRA 5KFWA 5CVIA 3SDZA 2DETA 3CMAT 2R5MA 4QWEA 2XCAA 2ZIVA 2ZCFB 2IHNA 5F9NA 1M5Q1 3GV5B 5EC7A 4J8OA 1NEGA 4UW9A 3RUXA 2BR0A 4CDGA 2NUTB 2KXDA 2R5AA 2DM1A 1WYGA 2KG5A 4BDPA 1Z9QA 2ASDA 4U7CA 2FEIA 3FB9A 3RDVA 3OTQA 5GAOl 2K79A 2OTJA 3ZDAA 3RBDA 3LGFA 4EEKA 3I76A 3H0LB 3EG9B 1ZJMA 5HMMA 4YMMA 3G6YA 1XO0A 1FFUA 2BZYA 2QASA 1PM3A 3I5SA 2HDAA 5J2GA 3JCMP 1K0XA 3H8ZA 1W2BA 1T3LA 4QJFB 1Q82U 1S97A 2CP5A 5HCKA 4OVAA 4JWNA 3L3FX 4FYVB 8ICSA 1SPKA 4J9FA 1MV0B 1JMSA 5DM7R 1PD0A 3V7CA 5DBAA 1X27A 2M0NA 1UGQB 5J29A 4M77B 4R55A 3ISCA 2QQ9A 3I55Q 2KFZA 2KYMA 2PVDB 3VKIA 2IIMA 1D9FA 1X9SA 4A4KA 3HP9A 1M2VB 7ICOA 2HBPA 3HFNA 2HMAA 5GAMg 4C8QE 3JCMb 3MCAB 3L2WA 5FU6C 4M78D 9ICAA 3PNWC 3CPWP 3CCMQ 5L1JA 3EH1A 4N0AA 4M77C 1YJNQ 1DGSA 1ZQMA 1N63A 2LNVA 2WF6A 2RMOA 4O5VA 3RKWA 4C0DC 2ZPFB 3CC4Q 2YQEA 4KLLA 2JN0A 2F3NA 3EG2A 5KYYA 2XDPA 3MO8A 3C5FA 2MIOA 3S6WA 4WTOB 1N2XA 3QNMA 4HA8A 3QZ7A 3H8SA 7ICFA 3KTQA 1X40A 2DVJA 3IDWA 1UDLA 2OM6A 2X4YA 3N28A 3V6HA 3G6EQ 3QU2A 2A3LA 3EAEA 2HBJA 4F7UA 3PR5B 2QXFA 5ALDA 2Q4TA 1SSHA 5G5HA 2BQUA 1SV0C 2CGHA 3LX7A 3WK6A 2LMJA 2A3VA 2YY6A 9ICTA 2HSZA 4JPBW 1KFTA 2OTLT 2F8LA 5DQGA 3SQIA 2V8JA 1MSWD 1VQ9Q 2MCNA 2P6UA 3RJEA 1AROP 4IUQA 5AHXA 1ZQBA 3M0QA 2KHVA 5JRTA 4D8DA 1QVGA 2LM1A 4FYWB 3QZ9B 2OHFA 4Q43A 5GANh 4E6RA 3OGUA 1IHWA 4E7JA 4BDYA 1QH9A 2NRXA 4US9A 1ZQWA 4QVCA 1BIAA 3CNHA 1OZ2A 2DL0A 3PGGA 2QARB 2JZ2A 2LYBA 1YI2Q 1Y0MA 1YJ9Q 4O5EA 3RR7A 2VC8A 2PXIA 3TI0A 4DF4A 1ZJNA 1J2NA 3RIRA 4Y2RA 4RQ8A 3EFOB 4QZHA 1HSQA 2QI2A 2FVUA 1UJ0A 4M7DF 5LJ5f 1QLYA 3MGVA 4UAWA 1VQ9T 4I2BA 1Z9ZA 4JLIA 3SENA 1PC0A 2CREA 2W3RA 1PG5B 5GMKm 2ZTDA 3CCVA 2I9GA 2FDRA 2QEXQ 2A19A 3F2DA 3FAHA 3QPHA 5KYYB 2H3FA 1S76D 1SGGA 3RF9A 4M75C 4IUTA 1O03A 2DRMA 5AI8A 5IT9E 1D8YA 1UUEA 4J9NA 4OMLA 4GC6A 4B6MA 2WACA 5EE3A 5CKFA 4A63B 2HW3A 1B3QA 5GAN7 3L2VA 1KIKA 2RPNA 2OH2A 1YITT 1KQSP 2L5QA 1YWPA 1X42A 2JW4A 1SV0A 1KBUA 4GLKA 9ICEA 3H40A 5KG4A 1UHFA 5GTHU 1P7DA 5LL6S 1S0NA 2NYSA 2NV3A 1ZQGA 5IHNA 3DLMA 2R8JA 1UEBA 2V4QA 5AKGA 1UHCA 1KQSA 5KE2A 2FZCB 2C22A 2J6UA 3KKAC 6AT1B 4M78G 1L3VA 1NBEB 3J7AF 2R8KA 2VA8A 5D49A 1YN8A 1AZEA 1ZUUA 2FJ6A 1Y96B 4UQGA 1SKWA 3CC2Q 3ZD9A 2J6TA 4R65A 4N0AC 1UECA 3SEMA 2NRZA 2K8BB 4GXIA 2M16A 4O3QA 1HIWA 2YUPA 2C06A 3E2UA 2E1EA 4I29A 2CZ0B 5KYWA 1PUZA 4DBQA 2CKKA 4OJOA 2OAUA 5AK6A 2J6KA 4M75A 5J2IA 3BS5B 3LWHA 1Q82C 4KRTA 2K4PA 4KN4A 3ULRB 4M7DE 1UT5A 5C0YA 2LCCA 2BE7D
chains in the Genus database with same CATH topology
1VQPT 2D9TA 4V2SA 2EIFA 2Z7JA 1LJOA 2EJFA 4RCCA 4C8QB 2EJGA 1QVGS 5FU7B 4EMGA 2CS7A 4PKCC 3OYIA 3RKYA 1WJQA 2DZCA 4J5YA 3PIOA 4XU3A 1VQ6T 3H0MB 4IUVA 3PFSA 1IIPA 3F53A 3T9NA 1PVRA 3H6ZA 2ZIWB 3C94A 4C5EA 3OY9A 4OB1B 1XOVA 5GANf 3N7SC 3GIBA 2L3RA 3A8HB 4BUGA 3C12A 2LDMA 1IREB 2JUFA 3ZFJA 2ZIXA 4CRXA 3E9GA 3RFAA 3QG1A 1WGSA 1N8RC 2GQVA 2RM4A 4EPCA 3M56A 4DQ2A 3I56A 3G4SA 2LRQA 5CQXA 2O01E 2VV5A 4PJOA 2DPPB 5DY9A 5HKCA 2KMTA 1AHJB 3I55T 1Q3VA 4BI4A 2EQMA 1YT3A 2W03A 4OP0A 3G71A 5GANj 2K5LA 1KQSS 4QW2A 2N1RA 1XQHA 3VJPA 1G3TA 2B8AA 4M78A 4DA4A 3G6ET 1VQ7A 1OI1A 2DTHA 4A53A 3GNFB 2ZIUA 3E19A 5J39A 5A0DA 5GMKe 4X34A 4RCBA 1K8AC 4XU0A 5C6SA 4EMHA 5KE3A 5GAN3 5IN1A 1QW1A 3L2RA 2Y4YA 2MI6A 1DRGA 4ELZC 3JB9F 2EJ9A 5AYFA 2CN1A 2ZZDA 2RJEA 4QIWC 2G0AA 3CMET 3JSCA 1GO3F 2DF4B 5CKEA 4M7DG 3HHTB 3L2ZA 3CC4T 3CD6T 3OW2S 1I5LA 3HFOA 1K73U 4Q5WA 2YHTA 1K9MU 3JCMd 1KC8C 1HEKA 3FDRA 3O8VA 2E6ZA 4A4HA 3S3MA 1LOJA 3LYIA 3CCUT 2HOQA 3X24B 4J6YA 5GAN8 4C8QG 1N9RA 4RMOA 2YB4A 4IKFA 4QQGA 4MMLA 5FU7C 3CBPA 2DXTA 4P0PA 1PSFA 1K73C 2LQ8A 3JB9I 4A4EA 1N6AA 4ME7A 4HCZA 4OB0B 1Q81U 4BACA 3RMQA 4JS5A 2Y0SC 1Y7XA 1VIFA 3E1SA 1UGSB 2P0KA 2CPRA 3V7RA 3MEAA 3D2QA 2H3QA 3QDRB 5GAMe 4LD6A 3UPUA 2GF7A 1IZ6A 4M75D 4M75E 4KUDK 4GY5A 4M7AG 3M4GA 4F7UG 4C5GA 3T79A 2ZPBB 3OQ5A 2PVGB 1TAMA 3JB9G 2QDYB 4JRPA 3SAGA 3MHXA 2K4YA 5CQYA 1VQOT 3CXCS 4C0GA 1YJWA 4YTLA 2QQAA 4O3MA 3OPXA 2K89A 3LVWA 3MEUA 1T94A 3VUBA 2QA4T 1VIEA 2KKPA 4QVDA 4AYBC 4B9XA 1M90U 3PIPA 4E7IA 1K8AU 2RK1A 2G08A 4JS4A 4LDUA 4XTVA 3F70A 2KQWA 4F7UE 4QVZA 4FE3A 1S72T 2KEYA 2DXBA 2ZPIB 5KH6A 2DO3A 5CKDA 2RI2A 4FZNA 2QEXT 3OS5A 4PJOD 3D2NA 3IG5A 3SWNC 4TVRA 2VJ4A 3BFMA 4J7FA 1VQNA 3PT9A 3GF5A 2EWNA 3V8LA 4MDWA 3KFUF 3CRXA 5D6XA 3FC3A 2RD1A 1KQ1A 1M8VA 3GZFA 2KJ8A 4P0QA 2W7PA 2Y0SF 1WPYA 3HKZC 4JJNK 1VQPA 1VQ9A 5HY6A 3X28B 5GAMj 4ACOA 3OB9A 2DXUA 3CCEA 1U1SA 1NZ9A 3JCMV 4F7UF 2EQUA 2KY9A 4P5NA 1JJ2A 2YB1A 4DOWA 3SWNB 2X35A 2DKGA 2WAQF 4C8QC 4OB2B 2RB6A 1H3ZA 1YHQT 1YJNT 5HR7A 2RI3A 3L1AA 2QA4A 3HL8A 2FYKA 2LCLA 1VQMT 4C5IA 1URJA 2H3JA 3SAFA 3HRUA 4F7UB 3UDCA 4M77F 5GANg 2E12A 2BUDA 4C0FA 4C8QD 4VUBA 2QQSA 2RHYA 4HCBA 2RI5A 2HBLA 3OYEA 4E7LA 2H3VA 1KD1C 4A4FA 3PZPA 1UB4A 2YLCA 5LJ3g 2DK3A 2HQXA 1O9SA 2DJZA 1B34A 2PVOB 4CI0C 3CCLT 5D6WA 4N4HA 4A54A 1ZBXA 2DEQA 3CBOA 4QNLA 1Z1BA 3TCJA 1QVFA 4BJQA 5CRXA 3CCQT 1VQ5T 1H641 2BIVA 3N7RC 1YJ9T 2V8KA 2JMGA 1L6NA 1WQWA 3CCJT 4X9DA 2Y90A 2ZPHB 1YJWT 3HKZF 4MMKA 5CCAA 3GU3A 1BI1A 3FIFA 1HXDA 1O75A 1VQKT 2YRVA 5HK3A 3CPFA 3CC2T 4M78F 3INZA 2F5KA 4E7KA 3QYGB 1JB0E 2RHIA 3DEEA 2JH1A 2RJFA 2RHXA 1M4ZA 5KCOA 3ALRA 3OYNA 5GMKj 4XK8E 2BKDN 3CCSA 3C29A 3HSBA 3DB3A 3SB2A 5GMKi 4NL3A 3L42A 4RG8A 3DKMA 2R57A 4A8EA 1JJ2S 2KKVA 4C92E 2V8IA 2CZ1B 1KQ2A 4MZPA 5LJ5g 2GH1A 2HBKA 1WJSA 3RERA 3F2CA 3JB9H 3A8GB 2EFIA 1OUQA 4M75B 5LJ3d 2MAMA 4E47A 4OGCA 1XTDA 3E9FA 5LJ5j 1BI3A 3VYHB 4ZTJA 3BY7A 4IC9A 4NL2A 4ATOA 3QJ6A 3KBGA 3CP8A 2K57A 2LT1A 1Y96A 4L59A 5D6YA 4C92F 2VKQA 2ZG6A 1UGPB 3M5AA 5CKHA 3CEYA 3R6OA 1VQMA 2KDSA 3PMTA 1XNSA 4IURA 4E7HA 2DD4A 1BKBA 2E5QA 3QYHB 4XTXA 4J6WA 4FZMA 4PJOC 4RG2A 4BDZA 4EMKB 1VQ8T 2K5IA 5T14A 4LDWA 3OYAA 2KNJA 3O0FA 2HOIA 1SZHA 3ZEHA 2KSSA 3V8JA 3OYGA 4C92B 1G3YA 3EFRA 3CC7T 2LQKA 4M7AF 1XNIA 5IAYA 1OYXA 4M7AC 3D2SA 1G3SA 3OYDA 2LYAA 2L8DA 3SAHA 4KBMB 4L5GA 2RHFA 4CGZA 2WSEE 5GAOr 4JUVA 3CBMA 3TREA 2RJDA 3M59A 4IUPA 2HD0A 3NTKA 2YLBA 1KHCA 2K8CB 4M78E 2RRDA 3OYCA 5LJ3e 4AYBF 5HK0A 4HCCA 3JB9D 3JAME 2G06A 3RESA 2EQJA 1N8RU 2OXOA 2LC4A 3P8HA 3UT1A 3MEVA 3FJPA 3GNGA 3S3NA 4KT0E 3META 1JBMA 2KHQA 2LVMA 5DLOA 5GANe 4M75G 2RJCA 2K5FA 2OTLA 3CCST 2H3IA 4FM4B 3X25B 1D3BA 3SMVA 3A8MB 2HAXA 2KIWA 4JRIA 3FEOA 3GPLA 4HKEA 4IUUA 3WVDB 2O4XB 3KXTA 3JCMg 4Y91A 3QJYA 1ED1A 2VUBA 2XDBA 3LW5E 3OW2A 4OGEA 3TU4K 2HMXA 2XKOC 5GAOq 2IVWA 3OSSC 5C0MA 5A0GA 3URGA 4FSXA 2X4XA 1X6OA 3KZXA 1K9MC 2KVQG 5EG2A 5CKBA 4XU2A 1BI0A 4QIWF 4C0DB 1NJIC 5KL1B 3QZ5B 2VXFA 3DLLA 2GCXA 4XQ3A 1VQ6A 3AQFA 1U8RA 4OJ5A 3GP8A 1NJIU 2PUOB 4QQ6A 2XI9A 3GOXA 5LJ3j 3G71T 3E0FA 2KK4A 2JNGA 3MP8A 2E6NA 2HOFA 5GAN4 2K8AA 2YX8A 1R8OB 2W7OA 1QVPA 1VQ8A 2RP5A 1LNXA 3M55A 1JRIA 2DD5A 3OYYA 1VUBA 3QBYA 2WAQC 4M7DD 4OMFB 4JRKA 2F69A 4XTYA 3LVVA 3FRNA 3CC7A 3PSTA 4B9WA 4NS5A 3C4SA 1A6SA 1NE8A 4ICAA 1Q7YC 5I2MA 2DVEA 2E1FA 2CZ7B 1VQLT 4HT8A 4M78B 3WXMB 3JCMW 5LJ5e 1M9SA 2DAQA 2KV2A 2XICA 4BE0A 3GLXA 4PL1A 4PNOA 4OB3B 3PSFA 2JHDA 3QUIA 2DZ9A 3VCBA 4KMOB 1DJ7B 2E5SA 2CYZB 4LD9K 2RHZA 2XU8A 3CCET 2LT4A 3V8KA 4ELYC 2WB1F 4R56A 3OS2A 3BDLA 3M57A 2CZ6B 4ZN1A 1ZHIA 2H3ZA 3JCMc 3QIIA 3KUFA 1VQ5A 1M90C 3C28A 1KD1U 1A0PA 4M7DB 1HK9A 2K4EA 3ASKA 1YI2T 2X4JA 3LLRA 3CMAA 2DIGA 2VGMA 3ICXA 3VYGA 2XVTA 4FT2A 3OYLA 1G3WA 1YJ9A 3H0RB 1FXXA 3JRZA 3P8DA 1PSEA 2KICA 5J3BA 1KG1A 1VQKA 3VUZA 3I55A 1YCYA 2D0QB 5GAN2 4EMKA 4BE1A 2D6FA 4J6XA 4C92C 3SFMA 2A7YA 3F2BA 3JCMe 1BI2A 3M58A 5GAMd 1W4SA 3PSIA 5GAN5 2L89A 4X9CA 5KL8B 2G09A 3CC4A 3OYKA 3TEEA 3CD6A 4ZGJB 3OMCA 3CCQA 1YBYA 4C8QF 3EFSA 1MA7A 4BI8B 3WVEB 2WSFE 2ZIUB 5I2SA 3F5EA 1Q86U 4BY6B 1FX7A 3I56T 2M0OA 1MHNA 3BW1A 3JB9J 4P0QB 3HRTA 4PLIA 2GFUA 3IG8A 4QQDA 3PTAA 3M7DA 2ZPGB 4ZGEB 2FB7A 4EMKC 3JCMQ 1D8BA 4MZMA 4C92A 2XIDA 3C95A 1RI0A 1ZQ1A 5DLQE 1V29B 2JOYA 2ZPEB 1X75C 1MGQA 5GAOn 2X4WA 1M1KU 2RO0A 3M54A 2G07A 1NPRA 2F77X 4N4IA 5LJ3h 2E10A 4ZGDB 4EDUA 3CCLA 3AHUA 2MMPA 2XDDA 3SWNA 3JCMf 3PMIA 3G6EA 5GANd 3V7SA 1VQ7T 5GMKl 1VQLA 3A5ZB 4PL2A 1YITA 3QHSA 2E64A 4LDVA 2ZIVB 3OYMA 2ZGWA 4OJ6A 3OYBA 2KOBA 2VJ5A 2OTJT 1P92A 2MWOA 1N9SA 4MZTA 1Y71A 5L8RE 1QP3A 3NTIA 1M1GA 3HKSA 4XTWA 4KUIA 2AHJB 5CIUA 1YIJA 2LKYA 2DTIA 3CYMA 3NUQA 4M7AE 3N5BB 2WSCE 3A8OB 4M75F 2R58A 1WQ7A 2RH2A 4Z02A 4PJOG 2KAFA 3L2QA 4M78C 2FL7A 3X26B 4C5HA 3DB4A 1VQ4A 4FIBA 2HBMA 3OS1A 2XHCA 4OF1A 4PL6A 3VV0A 2RA2A 4CRIA 3S3OA 2P4TA 2QQRA 2OYYA 3K1ZA 2K3XA 5FU6B 2P0PA 3OBYA 2LBOA 2JTMA 2EKOA 2M9UA 5CK9A 2G5HB 3CCRA 3MP1A 2MA1A 2ZIXB 1GXIE 4UC4A 2VGNA 2DIQA 3UWNA 2EAYA 5J26A 2LTOA 3HPWA 4OJLA 2K4HA 1PVPA 4FT4A 3CCVT 5LJ5d 1BYMA 2QEXA 2KJ5A 4JLGA 2KVCA 1Q3UA 3ME9A 3JCMh 1F44A 2PMZF 1QP2A 2IG0A 5KCHA 4XTZA 4L6V5 5A2QE 1SSFA 3G7ZA 3L2UA 3M9QA 3CCMA 4M77A 4O6JA 4M7AB 1I4K1 5GAN6 1B34B 2W04A 3F5AA 4M7DA 5A0LA 1BIBA 1Q7YU 3OBWA 5GAOp 2DXCA 1G5VA 2WB1C 2G3RA 3AQEA 2GFAA 2JVVA 4PLLA 2XK0A 4FU6A 4U6PA 1UPHA 2ZIWA 2DQNB 2MF2A 2QQBA 5GAMh 1YJNA 4MDXA 1KC8U 3OA6A 4FL6A 3MEWA 2JGAA 2G5IB 4NWIA 2F76X 3LH0A 4NLBA 5GAOm 1VQNT 1EIFA 4ZTFA 2VIXA 1U1TA 3J7AF 3CCJA 5I21A 4LDXA 4A4GA 4NOYA 3CCRT 4WF2A 4BE2A 4HT9A 4WJ3B 2DGZA 3IN5A 2RHUA 4M7DC 3VU3C 1PVQA 4BI3A 5CR2A 4FZLA 3CC2A 1I81A 3SD4A 3LWIA 1YIJT 1D3BB 3A8LB 2R18A 1KHIA 4OJPA 2RK2A 1M1FA 3HRSA 2E70A 3J80E 4KULA 2MRLA 3NTHA 3OS0A 5CAIA 3ONNA 3NFCA 2HNIA 2VYTA 3RMSA 5FRMA 2ZXHA 4XAXB 1YHQA 3QO3A 3MP6A 3CCUA 2DTOA 3CPWS 3G4ST 3OSVA 4M7AA 1NZBA 4JMUA 4BY6C 4Y28E 5GAMf 2K2VA 1VQ4T 3LYSA 2D6FC 4PJOB 2FHDA 2E65A 3M4YA 4KX5A 4J83A 4P0PB 2LHTA 2F5TX 1ECWA 4RKUE 3OYJA 4NV0A 5LJ3f 3QKJA 3M6ZA 2KD1A 2ZXIA 4D6WA 2CRXA 3X20B 2PMZC 2KJ9A 2K4IA 1FWZA 1RL2A 1QVFS 2E41A 2XD0A 4M77G 1WJRA 4J7IA 4JRQA 1W2BS 3IP4B 4M7AD 2QTXA 1Z19A 1X01A 5CO7A 3OYFA 2HQEA 2K3YA 2VXEA 2BDUA 2MWPA 4LDYA 2O4XA 2E1HA 4C92D 3CCMT 4XTUA 3J81E 1OZ3A 1WNLA 5GMKh 3CXCA 3AL0B 5FROA 5HR6A 3JCMJ 4BX9C 1N27A 4ZN3A 4C0ZA 2JH7A 4JDSA 2PQWA 5FRNA 3ER0A 3OMGA 4GFJA 3M53A 3JCMX 3QSUA 1M1KC 2EYQA 3CMEA 1Q81C 3PSPA 2I2LA 4N4GA 1I8FA 1YI2A 2PUKB 4M77E 3M6KA 3VC8A 1WUDA 3ZBDA 2PU9B 4BD3A 4C92G 1VQOA 3P8BB 2M1HA 3Q1JA 2EQKA 2F2AB 2LX9A 1CRXA 5FLXE 1UGRB 1NPPA 3NRWA 1Q86C 4M77D 5LJ5h 3LGLA 1TH7A 3QXEB 2GOLA 4BB7A 3BDUA 1ZQ1C 4II1A 2JTFA 4NLCA 2XG8D 3N7PD 3FLGA 3RKXA 4PJOE 4XU1A 4PJOF 3OYHA 3CPWA 4OO1J 4C8QA 1Y07A 4DOVA 2NLUA 1S72A 5M9OA 4KX3A 2Y4XA 2P0QA 5CVIA 3CMAT 3SDZA 2R5MA 2ZIVA 2ZCFB 1M5Q1 4J8OA 3RUXA 4CDGA 2R5AA 3FB9A 4U7CA 2OTJA 5GAOl 3LGFA 3H0LB 1XO0A 3JCMP 3H8ZA 1W2BA 4QJFB 1Q82U 4OVAA 3L3FX 5DM7R 3V7CA 2M0NA 1UGQB 4M77B 4R55A 2QQ9A 3VKIA 2PVDB 4A4KA 3HP9A 2HBPA 3HFNA 5GAMg 4C8QE 3JCMb 3MCAB 3L2WA 5FU6C 4M78D 3PNWC 4N0AA 4M77C 2LNVA 4O5VA 3RKWA 4C0DC 2ZPFB 2JN0A 2XDPA 3MO8A 3S6WA 4HA8A 2OM6A 2X4YA 2A3LA 3EAEA 2HBJA 4F7UA 2QXFA 2Q4TA 2CGHA 3LX7A 2A3VA 2OTLT 2F8LA 3SQIA 2V8JA 4IUQA 2KHVA 1QVGA 3QZ9B 5GANh 4E7JA 4BDYA 4QVCA 1BIAA 1OZ2A 3PGGA 2JZ2A 2LYBA 2VC8A 3RIRA 2QI2A 2FVUA 4M7DF 5LJ5f 3MGVA 1VQ9T 4JLIA 5GMKm 3CCVA 3F2DA 3QPHA 2H3FA 3RF9A 4M75C 4IUTA 5IT9E 2WACA 5CKFA 5GAN7 3L2VA 2OH2A 1YITT 2L5QA 1KBUA 4GLKA 1P7DA 5LL6S 2NV3A 3DLMA 1UEBA 1KQSA 5KE2A 4M78G 1Y96B 4N0AC 2K8BB 2M16A 1HIWA 2C06A 2E1EA 2CZ0B 2CKKA 4OJOA 2OAUA 4M75A 3LWHA 1Q82C 4M7DE 5C0YA 2LCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A0G A;  2XI9 A;  5A0D A;  4C0Z A;  2XID A;  5A0L A;  4BUG A;  2XIC A; 
#chains in the Genus database with same CATH topology
 2KZZ A;  4RT2 A;  3WKE A;  1VQP T;  4BXO A;  4B9M A;  1QKW A;  1X6G A;  4FFD A;  1BVS A;  1COK A;  2D9T A;  4V2S A;  4DEX A;  2VB6 A;  3RJG A;  5HML A;  2EIF A;  2Z7J A;  4KLU A;  1VQ6 Q;  1BCO A;  1LJO A;  2EJF A;  4RCC A;  2EYY A;  4C8Q B;  1ZSG A;  2EJG A;  2GTO A;  1T3N A;  2BCQ A;  2V4R A;  2DF6 A;  4F2R A;  1QVG S;  4J9R A;  4UB6 U;  3WKB A;  1QSL A;  5FU7 B;  5FW9 A;  1R77 A;  3VS3 A;  2AHO B;  2YRD A;  3ZDC A;  2LMR A;  2JZB A;  4M4Z A;  4EMG A;  2CS7 A;  3QZ8 A;  2LNH B;  2KVS A;  1VLB A;  2GWS A;  4C4R A;  2ALZ A;  5HHI A;  4PKC C;  3OYI A;  1A77 A;  1B07 A;  4X1V A;  1WJQ A;  2DZC A;  3RKY A;  4J5Y A;  2HHV A;  4F4Y A;  3PIO A;  5ALX A;  2AXT U;  3PW0 A;  5KT7 A;  3MR3 A;  4XU3 A;  2ECZ A;  2B0C A;  1VQ6 T;  3H0M B;  2X51 A;  2DL5 A;  4IUV A;  3PFS A;  7AT1 B;  5J0X A;  3C2L A;  1IIP A;  3HRD D;  5EWG A;  5AM5 A;  3F53 A;  3T9N A;  1WI7 A;  1PVR A;  3CCS Q;  4GLX A;  2IMW P;  3H6Z A;  1JEG A;  2ZIW B;  3Q8S B;  3C94 A;  1UCV A;  2O2O A;  4F4Z A;  4C5E A;  1LVH A;  2LYH A;  4FYX B;  1EFN A;  2O9S A;  2P35 A;  3OY9 A;  4PHD A;  3H8M A;  1XOV A;  2G6F X;  1L3S A;  4OB1 B;  5GAN f;  3N7S C;  1U45 A;  2NUT A;  3CCU Q;  3GIB A;  5KAF U;  3ISB A;  2L3R A;  1M3C A;  3AEV A;  4O3R A;  3A8H B;  4BUG A;  3C12 A;  4Y2X A;  3H4B A;  4DL4 A;  1IRE B;  2LDM A;  4M9G A;  2JUF A;  3V7L A;  3ZFJ A;  1WCN A;  2ZIX A;  4CRX A;  5L1L A;  2B6G A;  5CJ7 A;  2CT4 A;  2M02 A;  9ICC A;  3E9G A;  5AI4 A;  3RBE A;  9ICW A;  1JXE A;  3RFA A;  3QG1 A;  1BPB A;  2KR3 A;  2DRK A;  1WGS A;  4DWI A;  2EGC A;  2HL5 C;  1N8R C;  8ICE A;  2GQV A;  2RM4 A;  4EPC A;  3M56 A;  3GDX A;  1AWO A;  4RQN A;  5KT2 A;  2QYZ A;  4QZ8 A;  1AZG B;  1WXT A;  1ZQY A;  4DQ2 A;  1MMD A;  3RJI A;  3I56 A;  9ICN A;  4KLI A;  4O9M A;  4FW1 A;  3G4S A;  1BPX A;  3BS5 A;  2LRQ A;  5CQX A;  3PNC A;  5L1I A;  1ZQK A;  1BPE A;  1QWF A;  2O01 E;  5IIO A;  1UTI A;  2K6D A;  3CCJ Q;  1GL5 A;  5AK4 A;  2OTL Q;  2VV5 A;  3QXG A;  4PJO A;  2OJ2 A;  4YCX A;  3M1Y A;  5D46 A;  2DPP B;  5DY9 A;  5HKC A;  2OTJ Q;  2KMT A;  1AHJ B;  3I55 T;  3T5J A;  2RNA A;  4K4H A;  1Q3V A;  3NMZ C;  4BI4 A;  5KG5 A;  2NYV A;  1HJP A;  2EQM A;  3PMN A;  3ISD A;  1YT3 A;  5AKY A;  3G6V A;  2ISP A;  1NI3 A;  4Y2Q A;  2RQT A;  3OW2 P;  2W03 A;  1NK0 A;  4OP0 A;  4MHV A;  1FIQ A;  3G71 A;  1LB2 B;  4O5K A;  1MUZ A;  5GAN j;  1S10 A;  2ZTE A;  4Z6F A;  4M9L A;  4HVU A;  1ZQV A;  2K60 A;  3RAQ A;  2K5L A;  1KQS S;  2AJQ A;  1JUD A;  1R0C B;  4RNN A;  4QW2 A;  2Y9T A;  2N1R A;  1XQH A;  3VJP A;  1G3T A;  2B8A A;  4M78 A;  3EFO A;  4DA4 A;  2HEQ A;  9ICV A;  4IQT A;  3G6E T;  4QZF A;  5DQH A;  9ICQ A;  5ALW A;  2V9W A;  1E7O A;  1OI1 A;  2BE9 B;  5J0P A;  2L3P A;  1VQ7 A;  5J2F A;  2DTH A;  9ICR A;  4KGZ B;  1R0B G;  1V9P A;  4QWD A;  4A53 A;  3NRZ A;  1OU9 A;  3GNF B;  4JJD A;  3I9Q A;  2ZIU A;  2E4H A;  3E19 A;  3UXO A;  5A0D A;  5J39 A;  5GMK e;  3TFS A;  3ED5 A;  1VOM A;  3KHH A;  2XMF A;  4X34 A;  2D3D A;  1VDV A;  4DEY A;  5ALE A;  4RCB A;  1K8A C;  1KKX A;  4XU0 A;  1Q8K A;  4PZO A;  5C6S A;  4EMH A;  1OW5 A;  2BCV A;  5AK3 A;  1NLP C;  1UFF A;  5ALQ A;  2DX1 A;  5KE3 A;  3CW2 C;  1ZQN A;  5GJW B;  5GAN 3;  5IN1 A;  2HHQ A;  3Q8K A;  4TUS A;  2AU0 A;  3GIJ A;  1K73 R;  1O08 A;  5KT3 A;  1QW1 A;  3L2R A;  1QVF P;  2A0F B;  3D6J A;  1Q46 A;  2Y4Y A;  2MI6 A;  1IB8 A;  2HBW A;  4ELT A;  4IR9 A;  4O0I A;  1DRG A;  8ICJ A;  3ZDE A;  5J0O A;  1FMW A;  2QTV A;  3Q8R B;  4OMP A;  2DUY A;  4ELZ C;  3JB9 F;  1ZQF A;  4B9T A;  2O31 A;  1VQO Q;  8ICW A;  2FLP A;  1HYO A;  5AKJ A;  2AGO A;  2EJ9 A;  4F5Q A;  5KFV A;  5AYF A;  2CN1 A;  5KFR A;  2ZZD A;  5FWB A;  2RJE A;  3EPI A;  8ICY A;  2NRV A;  4QIW C;  1TOV A;  2G0A A;  1VYU A;  1TS9 A;  3CME T;  3JSC A;  5AKZ A;  4K11 A;  1GO3 F;  4AG2 C;  4RUC A;  1MV3 A;  3KFV A;  2DF4 B;  5CKE A;  4M7D G;  2DL7 A;  3HHT B;  2W9B A;  3L2Z A;  3CC4 T;  4EIK A;  3CD6 T;  4YFK A;  1AVZ C;  2C2D A;  2EGE A;  3OW2 S;  1I5L A;  3HFO A;  2A36 A;  1K73 U;  1NG2 A;  4Q5W A;  1VQ5 Q;  1QCF A;  5KFN A;  2YHT A;  1K9M U;  3JCM d;  1KC8 R;  1KC8 C;  4I28 A;  1HEK A;  1IV8 A;  4JUZ A;  4C8O A;  3FDR A;  3O8V A;  2E6Z A;  1U9L A;  4DOA A;  4A4H A;  3CCR Q;  3M8R A;  2A28 A;  3S3M A;  3QU5 A;  1LOJ A;  3LYI A;  4PGX A;  4B9L A;  5CP2 A;  3CCU T;  1S1N A;  2HOQ A;  2P84 A;  3X24 B;  4J6Y A;  5GAN 8;  1J2M A;  4C7Y A;  4MF8 A;  4Q8E A;  5KG6 A;  4C8Q G;  5AI0 A;  1N9R A;  4RMO A;  2YB4 A;  4YD1 A;  4IKF A;  4KIT B;  4K4G A;  2ZUB A;  2D0N A;  3C0C A;  4QQG A;  5ALY A;  2W43 A;  2HHS A;  2KBT A;  4MML A;  1KLN A;  4DFJ A;  1H3H A;  5J2A A;  4YN4 A;  5FU7 C;  3CBP A;  2DXT A;  1L8O A;  2JR5 A;  2KE9 A;  5L1M A;  4Z89 A;  1RI9 A;  2EDU A;  4F5O A;  1QQ5 A;  2CSQ A;  4DQR A;  4P0P A;  3U23 A;  3NVY A;  5AIA A;  5KFA A;  3MDA A;  5KT6 A;  1PSF A;  3B9J A;  1K73 C;  3OJS A;  1HD3 A;  2LQ8 A;  3JB9 I;  3SYZ A;  4A4E A;  1N6A A;  4ME7 A;  4HCZ A;  4OB0 B;  1H92 A;  1Q81 U;  3BZC A;  4BAC A;  3OJU A;  4F14 A;  3RMQ A;  3S6J A;  1ZET A;  3R6N A;  3VS6 A;  3K1R B;  4JS5 A;  4DQQ A;  3UXN A;  2DBY A;  1CKB A;  3MBY A;  2FPM A;  4RQM A;  1D1C A;  4M47 A;  2Y0S C;  5AIC A;  1Y7X A;  2JS0 A;  5KYU A;  4AFQ C;  3B0Y A;  1VIF A;  3E1S A;  4C4T A;  5JUM A;  1UGS B;  2M9N A;  2EVR A;  1OQK A;  4C7Z A;  2P0K A;  2CPR A;  1TK0 A;  3SI8 A;  2F2W A;  3V7R A;  1PD1 A;  3MEA A;  4QWC A;  1XJW B;  1X2Q A;  4E7Z A;  2E8O A;  5IXF A;  3D2Q A;  2H3Q A;  2F2X A;  3HWT A;  1QTM A;  4GXK A;  5BPC A;  1RXW A;  2JTE A;  4J9D A;  4J9C A;  4GIB A;  2COY A;  3QDF A;  3QDR B;  4LD6 A;  5GAM e;  4ECU A;  3UPU A;  5KFI A;  1NYG A;  2D1X A;  3I56 Q;  5J0Y A;  2CP0 A;  2GF7 A;  4F91 B;  1IZ6 A;  1RAD B;  2ISO A;  1BB9 A;  4M75 D;  4QW9 A;  3V7K A;  2QAR A;  2YUO A;  4M75 E;  4J9K A;  3BQ0 A;  4GY5 A;  4KUD K;  4NXZ A;  5DB7 A;  4DSK A;  2K7A A;  1RAA B;  1SF9 A;  4M7A G;  2E5K A;  2KN7 A;  3M4G A;  4PH5 A;  4M9H A;  1T4G A;  4EBD A;  5IXB A;  4F7U G;  5KFS A;  4RTW A;  4C5G A;  2ROL A;  3T79 A;  2ZPB B;  1D9D A;  2PZ1 A;  3OQ5 A;  2PVG B;  1U3O A;  3WKC A;  2Y9U A;  1TAM A;  3JB9 G;  2QDY B;  4JRP A;  1KQQ A;  1IM4 A;  1VQL Q;  1ZD4 A;  3SAG A;  3MHX A;  1NK9 A;  2K4Y A;  3PVL A;  4C8K A;  2DBK A;  4F5R A;  5CQY A;  1VQO T;  3Q8P B;  2ED1 A;  3CXC S;  4C0G A;  4CF3 A;  2JMC A;  4M9N A;  4KLM A;  1YJW A;  4YTL A;  5KG3 A;  1C0M A;  3TSW A;  4C4S A;  3LH5 A;  2QQA A;  4O3M A;  3OPX A;  1Q95 G;  1DGJ A;  2PI5 A;  2K89 A;  3LVW A;  4PFO A;  3MEU A;  3EGX B;  2HVI A;  3T5L A;  1T94 A;  1NYF A;  3MJX A;  3LWL A;  3VUB A;  2QA4 T;  2H5X A;  4J9I A;  4DSJ A;  2QGG A;  9ICU A;  1NJW A;  4CNQ A;  2ASL A;  1F1B B;  3RJK A;  2W9M A;  1VIE A;  3M9M B;  1AT1 B;  2KKP A;  2ED0 A;  3Q8M A;  4QVD A;  2BKE A;  4AYB C;  2DEU A;  3C5G A;  7ICJ A;  4B9X A;  1M90 U;  3PIP A;  4E7I A;  3NVZ A;  1K8A U;  1TWB A;  5DGB A;  2C0O A;  2RK1 A;  1RAI B;  2G08 A;  1ZQH A;  4PFZ A;  4JS4 A;  4LDU A;  4XTV A;  3F70 A;  2KQW A;  4Q8F A;  1SL2 A;  3EGD B;  1UA1 A;  4F7U E;  7ICG A;  1D1B A;  4QVZ A;  4KH1 B;  2A08 A;  5KFY A;  2C2E A;  2F2V A;  4FE3 A;  1UE9 A;  1S72 T;  2FPK A;  1JX4 A;  4KMU A;  2R8G A;  2KEY A;  1XSP A;  1WHH A;  2DXB A;  1VA7 A;  1WHK A;  4ECY A;  5EE0 A;  5CEH A;  2ZPI B;  5KH6 A;  1ZQE A;  2KSO A;  2O88 A;  2DO3 A;  3PVX A;  1KTQ A;  5CKD A;  2RI2 A;  3SZ2 A;  4FZN A;  3NHN A;  2QEX T;  3OS5 A;  4UAY A;  4PJO D;  3D2N A;  3IG5 A;  1ZQD A;  1S9F A;  3G6X A;  1KSW A;  3SWN C;  4TVR A;  2VJ4 A;  2YUQ A;  3BFM A;  3EHQ A;  4IIM A;  2MAX A;  5ALG A;  1WXB A;  4J7F A;  1YWO A;  2RQV A;  2A1A A;  2I6X A;  2HHX A;  2JEJ A;  1SIJ A;  1OV3 A;  4ORZ A;  1VQN A;  5KYU B;  5KFM A;  3PT9 A;  1NM7 A;  3GF5 A;  2EWN A;  3V8L A;  4MDW A;  3KFU F;  1WHM A;  4IL6 U;  3ORY A;  3CRX A;  4ECV A;  5D6X A;  3FC3 A;  2RD1 A;  1KQ1 A;  3NS1 A;  1M8V A;  3GZF A;  2KJ8 A;  3BDP A;  2AKL A;  7ICI A;  1ZSZ C;  2UVV A;  8ICA A;  3PR4 A;  4Y2T A;  3HW8 A;  2HKN A;  4P0Q A;  1L7N A;  2FPL A;  2W7P A;  2W54 A;  2Y0S F;  1M27 C;  1WPY A;  4KTQ A;  4EX6 A;  3HKZ C;  2AKK A;  4JJN K;  1VQP A;  1VQ9 A;  1L3U A;  2YML A;  5HY6 A;  1DOQ A;  4EZ9 A;  2LX7 A;  2ATC B;  3X28 B;  2PFQ A;  5GAM j;  4ACO A;  2GO7 A;  2FPD A;  3OB9 A;  4B9N A;  2DXU A;  1RLP C;  8ICL A;  3CCE A;  1U1S A;  4PPX A;  3EGU A;  1NZ9 A;  2DL8 A;  3JCM V;  4F7U F;  2EQU A;  2KY9 A;  1ZSZ A;  4P5N A;  1JJ2 A;  2YB1 A;  2VAS A;  2VA2 A;  4MF2 A;  4DOW A;  1ZOL A;  3EZ5 A;  5AM4 A;  3SWN B;  2X35 A;  2DKG A;  2WAQ F;  2PFP A;  1TUD A;  4C8Q C;  4UB1 A;  4J9L A;  4OB2 B;  1M2V A;  5ALI A;  2RB6 A;  4BGD A;  4UBC A;  1H3Z A;  4QZE A;  5IIM A;  1YHQ T;  1YJN T;  3NAS A;  4EBE A;  5HR7 A;  2KI7 A;  2RI3 A;  4ED0 A;  3L1A A;  2KK0 A;  4M6W A;  2YT6 A;  3A98 A;  2QA4 A;  4GXJ A;  4YD2 A;  1T3S A;  2R8H A;  9ICB A;  3HL8 A;  3MGH A;  5DBB A;  2FYK A;  4KLS A;  2BCS A;  4F5N A;  4M9J A;  1NJI R;  2LCL A;  1VQM T;  4RTY A;  4C5I A;  1URJ A;  2DL3 A;  2H3J A;  3SAF A;  1UGV A;  1AQ6 A;  4PJM A;  5DLF A;  3HRU A;  5FWC A;  1A76 A;  4F7U B;  3QU7 A;  2F1L A;  3UDC A;  4F2S A;  4M77 F;  5GAN g;  4C80 A;  2E12 A;  2J6O A;  2MUT A;  2BUD A;  2CH4 W;  4KGX B;  5J0T A;  1K9M R;  1OX8 A;  1VYV A;  4C0F A;  4C8Q D;  4VUB A;  3M0R A;  2QQS A;  2RHY A;  8ICQ A;  7ICN A;  4HCB A;  1WHL A;  2B86 A;  3TVT A;  2RI5 A;  2HBL A;  1QCK A;  4ED8 A;  3OYE A;  2H3V A;  4E7L A;  2MSN A;  1KD1 C;  4A4F A;  4DBH A;  3PZP A;  4RNM A;  1UB4 A;  1C1A A;  1L5U A;  1LKY A;  1X9W A;  1QKX A;  1ZLM A;  3GV7 B;  4JZ3 A;  1KSP A;  2C2R A;  1N61 A;  1S0M A;  2YLC A;  5LJ3 g;  4IRC A;  4PJN A;  2E3T A;  2DK3 A;  9ICL A;  2HQX A;  1O9S A;  3H7I A;  2DJZ A;  1AD5 A;  1B34 A;  2PVO B;  3HP6 A;  4CI0 C;  3CCL T;  5D6W A;  1L7P A;  2EYW A;  4N4H A;  4AFZ C;  1OX9 A;  4A54 A;  1YZ7 A;  4IQV A;  1ZBX A;  4F92 B;  1UA0 A;  2DEQ A;  3CBO A;  2M0Y A;  1M90 R;  5DGA A;  2NUP B;  4QNL A;  5F3X B;  1Z1B A;  2NRW A;  9ICP A;  4JJB A;  3TCJ A;  1QVF A;  4BJQ A;  5CRX A;  4HAI A;  4C8N A;  4B6J A;  3H4D A;  3CCQ T;  1VQ5 T;  1H64 1;  3MFH A;  1V76 A;  3L4P A;  1X9X A;  1TVA A;  3CC7 Q;  2BIV A;  4G9B A;  4YVZ A;  4F17 A;  3N7R C;  2SEM A;  2OAW A;  3IQL A;  1IXR A;  3LDA A;  2YXY A;  1PK1 B;  2YDL A;  5ALF A;  1YJ9 T;  2V8K A;  1SV4 A;  3EH2 A;  2JMG A;  2RDI A;  2YMQ A;  1L6N A;  1WQW A;  2Y1I A;  2DJQ A;  3CCJ T;  3RJF A;  4CCH A;  3VRZ A;  4X9D A;  1G2B A;  2Y90 A;  4PJJ A;  3UA7 A;  2ZPH B;  1YJW T;  3HKZ F;  4ZH4 A;  2X3X D;  4MMK A;  1H8K A;  2QLT A;  1EX4 A;  4ESR A;  5CCA A;  4F93 B;  4M2Y A;  3GU3 A;  1BI1 A;  3FIF A;  1HXD A;  9ICK A;  1O75 A;  1Z4N A;  4DO9 A;  1VQK T;  2DER A;  1QLN A;  1W2B P;  2DKZ A;  1KL9 A;  1RAC B;  2KP7 A;  4K4I A;  5ALK A;  4FS1 A;  4FBU A;  3RH6 A;  2YRV A;  5HK3 A;  1ZSZ B;  4PHA A;  3CPF A;  3CC2 T;  2HHW A;  4LE9 A;  4M78 F;  3INZ A;  1ZRN A;  5D4B A;  2F5K A;  2QKQ A;  2J6F A;  4J9G A;  4E7K A;  5ALH A;  3QYG B;  1NOM A;  4UB2 A;  2BZF A;  1JB0 E;  2DKX A;  5AKI A;  3SR6 A;  4KH0 B;  3FM9 A;  4E7S A;  5JU5 A;  2COZ A;  5KFD A;  1ZQT A;  5IHI A;  4EYH B;  2RHI A;  1YP5 A;  3DEE A;  2JH1 A;  2RJF A;  5AI6 A;  2RHX A;  1DK2 A;  3V7J A;  5ALO A;  9ICO A;  4RUG A;  1M4Z A;  5KCO A;  1IG6 A;  2WF9 A;  3MR6 A;  4DL2 A;  3ALR A;  3OYN A;  5GMK j;  1C6V X;  2BKD N;  3EHR A;  5KFG A;  4XK8 E;  3CCS A;  1ACM B;  1L7O A;  2QB0 A;  2AT1 B;  3C29 A;  3HSB A;  1KFS A;  1CSK A;  1V1C A;  1ZA2 B;  1ZD3 A;  1D0X A;  3DB3 A;  3SB2 A;  5GMK i;  1SWW A;  1LKY B;  4NL3 A;  1GCQ C;  2BZX A;  2XO7 A;  3L42 A;  4BWM A;  3EWA A;  4CE6 A;  3JPQ A;  3OHB A;  1WLP B;  2E3I A;  4QZA A;  4RG8 A;  3DKM A;  3A0B U;  2R57 A;  4A8E A;  1JJ2 S;  2MK5 A;  1TAU A;  3C1Z A;  2KKV A;  4F5P A;  5C5J A;  1C7Y A;  4C92 E;  2V8I A;  2CZ1 B;  1KQ2 A;  3BJY A;  1KFZ A;  4MZP A;  1MQ3 A;  5LJ5 g;  3TAC B;  5AKL A;  5AK5 A;  3H9N A;  2GH1 A;  2HDO A;  2HBK A;  3QX7 A;  1M8M A;  1PKS A;  2DE0 X;  1WJS A;  3RER A;  4J9S A;  2DYB A;  4R63 A;  3F2C A;  9ICX A;  3JB9 H;  3A8G B;  2CDT A;  2PFO A;  2EFI A;  1OUQ A;  4J03 A;  2ZJA A;  5J2K A;  4O5C A;  4M75 B;  5LJ3 d;  2MAM A;  1KDH A;  1RAF B;  1VQ4 Q;  1IGU A;  3C23 A;  4GBQ A;  4DLG A;  4MFA A;  3PX6 A;  4RQ0 A;  3CCQ Q;  4E47 A;  1OOT A;  2RQR A;  4OGC A;  1XTD A;  4I2E A;  3E9F A;  4IR1 A;  5ALP A;  5LJ5 j;  5HP4 A;  1BI3 A;  4I2C A;  3VYH B;  2VAN A;  9ICI A;  1AOJ A;  1AWW A;  3NGP A;  4I27 A;  4ZTJ A;  3CXC P;  5KFX A;  1JRO A;  2FZG B;  3RJJ A;  1QSS A;  3BY7 A;  4C8L A;  2EAM A;  3RBB B;  1IRX A;  1WDX A;  2JXB A;  9ATC B;  4IC9 A;  4PK4 A;  4NL2 A;  2JEI A;  1YFN A;  4ATO A;  1K0S A;  4AMC A;  4Y2S A;  3QJ6 A;  4I2A A;  1BK2 A;  2P66 A;  3GII A;  3KBG A;  3PY8 A;  3HT3 A;  1U48 A;  3BS7 A;  8ICG A;  1RUW A;  3CP8 A;  1X69 A;  2K57 A;  3ETL A;  3PX4 A;  1JAL A;  2AIR B;  3KBB A;  5ALU A;  2LT1 A;  2UVW A;  1VQK Q;  5KFO A;  1K5O A;  2K2M A;  9ICM A;  1X2I A;  3RRG A;  1Y96 A;  4L59 A;  1T8E A;  1TAQ A;  2A37 A;  5D6Y A;  5GTI U;  4C92 F;  2VKQ A;  2ZG6 A;  1UGP B;  3CCE Q;  3M5A A;  5CKH A;  1QSY A;  2AH5 A;  2RQ5 A;  3I1Y A;  1MND A;  1SG5 A;  4TUP A;  3CEY A;  3EPG A;  4MEX A;  3R6O A;  1VQM A;  2I5H A;  4PGY A;  1JIH A;  4UAT A;  1RYR A;  1YNZ A;  2KDS A;  3PMT A;  3DV9 A;  1UG1 A;  4ANJ A;  1ZQX A;  4FW2 A;  3E58 A;  1K1S A;  1BNO A;  1XNS A;  2C0T A;  1BGX T;  4IUR A;  4DBF A;  1QCO A;  1L8L A;  4E7H A;  2DD4 A;  1BKB A;  2E5Q A;  3QYH B;  3EG1 A;  4XTX A;  1ZQZ A;  3QEA Z;  4J6W A;  4FZM A;  4PJO C;  4RG2 A;  2FPE A;  2JT4 A;  4NL9 C;  3C2K A;  4ED1 A;  1HUO A;  4BDZ A;  4EMK B;  1VQ8 T;  2K5I A;  2EKH A;  5T14 A;  4LDW A;  3OYA A;  2KNJ A;  3O0F A;  2HCK A;  2HOI A;  1SZH A;  1WCL A;  3ZEH A;  2KSS A;  1V38 A;  2OWO A;  3M9N B;  1EXN A;  3V8J A;  3OYG A;  4C92 B;  4JB3 A;  4YMO A;  3PW7 A;  1LPL A;  1G3Y A;  1VQ7 Q;  4O3S A;  1ZYQ A;  3EFR A;  3CC7 T;  2NUP A;  2LQK A;  4M7A F;  1XNI A;  5DDY A;  3TAN A;  4J9Q A;  3RH4 A;  5EWF A;  4HCK A;  5IAY A;  2KIV A;  5KFQ A;  1OYX A;  1XWL A;  3MKD A;  4M7A C;  3D2S A;  2CSI A;  2BCR A;  1G3S A;  3OYD A;  5ALT A;  5DG8 A;  1GFC A;  3THK A;  1NK7 A;  1T0J A;  4PJL A;  1VYT A;  5KG7 A;  2LYA A;  4I2F A;  3SV4 A;  2L8D A;  1I1J A;  1FO4 A;  2DPI A;  3SAH A;  1RXV A;  2FMS A;  4QZB A;  2OX7 A;  3RAX A;  4KBM B;  5BOM A;  4Q45 A;  4J9H A;  4QKU A;  4F4K A;  2RHF A;  5J0U A;  4CGZ A;  2QGF B;  4L5G A;  1V97 A;  4AT1 B;  2GTJ A;  2WSE E;  2YWW A;  7ICL A;  4TQS A;  3JPO A;  1MQ2 A;  4LXC A;  5GAO r;  1JXL A;  3LWM A;  4JUV A;  5KG1 A;  1RAG B;  1KW4 A;  3CBM A;  4TUQ A;  3TAD C;  1TU0 B;  3TRE A;  2RJD A;  2PNI A;  3WKD A;  3WK5 A;  3M59 A;  4AFU C;  4IUP A;  5KFL A;  1NJY A;  2HD0 A;  2DYI A;  3NTK A;  2YLB A;  2KGT A;  2JM8 A;  3RJH A;  5TZV A;  1WIE A;  3BQ2 A;  4RPZ A;  1KHC A;  2K8C B;  3WK9 A;  4M78 E;  1WA7 A;  2RRD A;  3OYC A;  5LJ3 e;  4AYB F;  3THV A;  5HK0 A;  4HCC A;  3JB9 D;  5I11 A;  4P4M A;  3UMC A;  3JAM E;  2G06 A;  2ZUD A;  1C20 A;  1XU4 A;  2GQI A;  1SRM A;  4BWJ A;  3RES A;  1MMA A;  2EQJ A;  4KLO A;  4NM2 A;  5B66 U;  1E6H A;  1WFW A;  1N8R U;  5KNI A;  4UB4 A;  1RYU A;  2OXO A;  5HNK A;  2LC4 A;  4LUD A;  3P8H A;  3UT1 A;  3OHA A;  7ICU A;  3MEV A;  3R9K A;  2W9A A;  5KFJ A;  3FJP A;  3GNG A;  5AKX A;  4PHE A;  3S3N A;  5KFK A;  2ESE A;  4KT0 E;  3MET A;  3MAB A;  1JBM A;  1JQQ A;  1ABO A;  7ICQ A;  1S72 Q;  2KHQ A;  4F3O A;  2LVM A;  2JEG A;  1E6G A;  3DDH A;  1I5O B;  4DOB A;  4Z6E A;  2GGR A;  5KTQ A;  5GAN e;  4DSL A;  5DLO A;  4M75 G;  1CEZ A;  2RJC A;  2K5F A;  2OTL A;  2WFA A;  3CCS T;  2H3I A;  4FM4 B;  2DMO A;  3X25 B;  1D09 B;  4YG2 A;  4CF4 A;  1D3B A;  2AZS A;  2E8P A;  3SMV A;  3A8M B;  2HAX A;  4IS7 A;  2KIW A;  4JRI A;  3FEO A;  2EQI A;  1RQL A;  2D8J A;  3GPL A;  2DWQ A;  4HKE A;  1GCP A;  4IUU A;  3WVD B;  2KZ3 A;  4J9B A;  2O4X B;  3KXT A;  2BQR A;  4B9U A;  3JCM g;  4Y91 A;  1NNL A;  2EQY A;  3KHG A;  2CP7 A;  1ED1 A;  3A0H U;  2K9G A;  2VUB A;  3QJY A;  2XDB A;  2PFN A;  4P4P A;  1YJW Q;  3LW5 E;  3OW2 A;  3C21 A;  2RQU A;  4JK1 A;  2WTF A;  3FJ5 A;  4OGE A;  3TU4 K;  2HMX A;  3JPP A;  2XKO C;  2I0N A;  5E79 U;  5GAO q;  1M6Y A;  2IVW A;  3OSS C;  5C0M A;  2ES6 A;  5A0G A;  3CCL Q;  4ED2 A;  1NK8 A;  3URG A;  1ZQU A;  4FSX A;  1HJD A;  4NJ8 A;  2X3W D;  1ZX6 A;  3RRH A;  3PO5 A;  8ICK A;  1X6O A;  3KZX A;  1CI4 A;  4DS5 A;  4JV2 A;  2X4X A;  4ECQ A;  4R8U B;  1K9M C;  1SXD A;  5EWE A;  4CC4 B;  1KD1 R;  2KVQ G;  1JXM A;  5JTI A;  5EG2 A;  3PW2 A;  4XU2 A;  5CKB A;  2J6S A;  4Q44 A;  1TG0 A;  5L23 A;  2MUT B;  1ZQR A;  5KFT A;  1SXE A;  2IBK A;  4I2H A;  1BI0 A;  1PRL C;  4QIW F;  2W11 A;  3PW5 A;  4UBB A;  4C0D B;  3M0P A;  5ALZ A;  5KL1 B;  1NJI C;  3HPO A;  7ICM A;  5B5E U;  2YRC A;  3QZ5 B;  2VXF A;  3DLL A;  1U4B A;  3I28 A;  2GCX A;  4RQ2 A;  4XQ3 A;  1VQ6 A;  2YMM A;  4GLM A;  4QZD A;  4DCC A;  2FPF A;  3AQF A;  8ICV A;  1U8R A;  4OJ5 A;  4OMM A;  1BNP A;  1ZD5 A;  3JPS A;  1RQN A;  4J9E A;  3GP8 A;  2KEA A;  1NJI U;  1PKT A;  2PUO B;  4QQ6 A;  2AGP A;  1M1K R;  1OPL A;  4F04 B;  4R8U A;  1PNJ A;  2XI9 A;  4DQP A;  1D0Y A;  5LJ3 j;  3GOX A;  1W6X A;  3G71 T;  3E0F A;  8ICC A;  1T3Q A;  2GNC A;  4DOC A;  1X9M A;  2KK4 A;  9ICG A;  2JNG A;  3MP8 A;  9ICH A;  4HVV A;  2E6N A;  2HOF A;  5GAN 4;  1NK4 A;  2BPC A;  2K8A A;  2WF5 A;  2YX8 A;  1M30 A;  1R8O B;  1CUK A;  2A1J A;  2W7O A;  1QVP A;  1VQ8 A;  1UHU A;  4OMO A;  2RP5 A;  2HVH A;  4F8R A;  1LNX A;  3WK7 A;  4M0A A;  8ICH A;  1JRI A;  3M55 A;  1PWT A;  2DD5 A;  1VUB A;  3OYY A;  2WAQ C;  5DBC A;  2BCU A;  1SL0 A;  3QBY A;  8ICF A;  1K9A A;  2AK5 A;  1K1Z A;  4M7D D;  1JRP A;  4OMF B;  4JRK A;  4ECZ A;  2F69 A;  4XTY A;  3MC1 A;  3LVV A;  3FRN A;  3IV6 A;  3CD6 Q;  3CC7 A;  1RG6 A;  3PST A;  4LNP A;  2FG0 A;  4B9W A;  2QAZ A;  4NS5 A;  3T5H A;  3C4S A;  1A6S A;  2VWF A;  1A0N B;  3QEB Z;  2E8N A;  3RH5 A;  1NE8 A;  3A1P A;  3K75 D;  4ICA A;  3OSN A;  1RYS A;  5CB1 A;  1X2K A;  5CA7 A;  1B0X A;  2DFL A;  3K4G A;  5KFP A;  3MDC A;  5DKW A;  3M0S A;  3VRY A;  1Q7Y C;  2EZZ A;  1ZQL A;  2W9B B;  3VS0 A;  2FMQ A;  2RF0 A;  5J2E A;  2CT3 A;  5J2D A;  2DVE A;  5I2M A;  2E1F A;  2CZ7 B;  1SKU B;  1TUC A;  3I35 A;  1VQL T;  3UAT A;  4HT8 A;  4M78 B;  1PZN A;  3WXM B;  3JCM W;  5LJ5 e;  1M9S A;  2DAQ A;  1GCQ A;  2ENM A;  2KV2 A;  3QUQ A;  4FSS A;  1TE2 A;  2FI1 A;  2XIC A;  4MFF A;  2BPG A;  4JZ4 A;  4YXJ A;  4BE0 A;  3GLX A;  5D7U A;  4PL1 A;  4PNO A;  3UQ2 A;  2EBP A;  2HZY A;  4OB3 B;  1WWV A;  3PSF A;  2JHD A;  3ZDD A;  5ALR A;  3QUI A;  4OMQ A;  2DZ9 A;  3T3F A;  3VCB A;  4DLE A;  4Z6C A;  1I07 A;  4KMO B;  3RB6 A;  1DJ7 B;  3TFR A;  2E5S A;  1WHJ A;  4QZ9 A;  4EZ6 A;  1QCN A;  2CYZ B;  4LD9 K;  2RHZ A;  1VQ8 Q;  1IXD A;  4FS2 A;  2XU8 A;  5AM0 A;  2YUN A;  3WK8 A;  3CCE T;  2LT4 A;  3V8K A;  4ELY C;  2WB1 F;  2LI6 A;  2DNU A;  2CP3 A;  4ED3 A;  5KYX B;  2F1H A;  4R56 A;  4J9M A;  2HHT A;  2YTU A;  1FMK A;  3OS2 A;  3BDL A;  3M57 A;  2OI3 A;  2CZ6 B;  4ZN1 A;  1ZHI A;  2H3Z A;  3JCM c;  3SEI A;  4F16 A;  3GFK B;  3QII A;  5ALS A;  4YR3 A;  5CHG A;  1DXS A;  3UMB A;  3KUF A;  5KYW B;  1VQ5 A;  3VS4 A;  1M90 C;  1Z00 B;  4YR0 A;  3C28 A;  3B0X A;  7ICT A;  2CH4 A;  2OEH A;  3HTR A;  8ICU A;  1AEY A;  1KD1 U;  1A0P A;  4M7D B;  4G3I A;  1HK9 A;  2K4E A;  2XY6 A;  3ASK A;  1YI2 T;  5KAI U;  2X4J A;  4UAZ A;  3LLR A;  1PHT A;  2DIG A;  3CMA A;  3UF4 A;  1Z00 A;  5BOL A;  3ICX A;  2VGM A;  7ICH A;  1LVK A;  2XVT A;  4FT2 A;  3VYG A;  4I2J A;  1D8L A;  3OYL A;  1G3W A;  1YJ9 A;  3H0R B;  2A1J B;  1F5S A;  1QQ6 A;  3PVQ A;  1ZQC A;  1FXX A;  3JRZ A;  5J0S A;  3ZI4 A;  3L5K A;  1BPD A;  1VQN Q;  3AUO A;  1MN8 A;  2KSO B;  3EGX A;  3P8D A;  1PSE A;  4KLF A;  2KT8 A;  2KT1 A;  2KIC A;  2L2P A;  2D8H A;  5J3B A;  3RNJ A;  1NKC A;  1RDF A;  1KG1 A;  1WX6 A;  4YMN A;  3EG0 A;  2JZB B;  2UVR A;  4KLJ A;  1ZQQ A;  1VQK A;  3VUZ A;  4KN7 A;  1Z3E B;  3D7S B;  2CP2 A;  3I55 A;  1YCY A;  2HI0 A;  2I1Q A;  2D0Q B;  1TSF A;  1NK6 A;  4EMK A;  5GAN 2;  1G83 A;  4BE1 A;  2D6F A;  4LZG A;  4J6X A;  1X66 A;  4QZI A;  1U49 A;  4C92 C;  3UMG A;  3SFM A;  1SKR A;  2J05 A;  1V85 A;  1S5L U;  3UM9 A;  2A7Y A;  4RZR A;  4RU9 A;  2RQW A;  3F2B A;  3JCM e;  2ZTC A;  3BQT A;  1BI2 A;  3M58 A;  5GAM d;  5AT1 B;  3QU4 A;  2XC9 A;  1W4S A;  2B21 A;  3PSI A;  5EOZ A;  7ICR A;  3MGI A;  3N97 B;  5GAN 5;  1Q82 R;  2L89 A;  1N62 A;  3RR8 A;  4OD0 A;  5KFZ A;  3PML A;  1FYN A;  3HX0 A;  3MFI A;  2KRS A;  4X9C A;  5CWR A;  4R64 A;  4O3P A;  5KL8 B;  4OMN A;  2YMP A;  2G09 A;  2F44 A;  2W10 A;  3CC4 A;  3OYK A;  3TEE A;  3CD6 A;  3MR2 A;  4IQW A;  4ZGJ B;  1ZXI A;  4I2G A;  3OMC A;  3HJE A;  1JN3 A;  2FLN A;  1YBY A;  4C8Q F;  3CCQ A;  2E8M A;  3EFS A;  1MA7 A;  4BI8 B;  5AI9 A;  4Y2U A;  3WVE B;  2WSF E;  3TAD A;  2HHU A;  2ZIU B;  3TAQ A;  3G71 Q;  4DSE A;  5I2S A;  5DQI A;  1T7P A;  2W8K A;  3F5E A;  4KLQ A;  3EW9 A;  1Q86 U;  4R66 A;  4BY6 B;  2RN8 A;  3IRU A;  1FX7 A;  4Y2Y A;  8ICT A;  4UB8 U;  3I56 T;  2M0O A;  5I22 A;  2MU2 A;  1MHN A;  3BW1 A;  2ROT A;  3JB9 J;  4UAR A;  4P0Q B;  5EE1 A;  3PX0 A;  4ECX A;  4Y2P A;  5AI5 A;  3CQT A;  3JPR A;  3HRT A;  4PLI A;  3UPQ A;  2GFU A;  3T5K A;  3IG8 A;  2EZY A;  1MNE A;  3C1Y A;  5J0W A;  3TAR A;  4KLE A;  4QQD A;  3PTA A;  1ABQ A;  1Q81 R;  2GBQ A;  3M7D A;  2ZPG B;  3UXP A;  1ZD2 P;  3Q8L A;  1M3B A;  5KFE A;  4DFP A;  4ZGE B;  2FB7 A;  4EMK C;  4PZN A;  1YIJ Q;  3JCM Q;  1D8B A;  2LCS A;  4TQR A;  5DG9 A;  4MZM A;  9ICS A;  4NY8 A;  4C92 A;  2XID A;  4Z6D A;  3C95 A;  1RI0 A;  1ZQ1 A;  4AG1 C;  5DLQ E;  5AKE A;  1V29 B;  2JOY A;  2DBM A;  4F71 A;  2NWM A;  2ZAE A;  3OSP A;  2ZPE B;  3IHQ B;  1X75 C;  1MGQ A;  1GBQ A;  5GAO n;  2X4W A;  1M1K U;  2RO0 A;  2LP5 A;  3M54 A;  2G07 A;  2QB0 B;  2F77 X;  4ED7 A;  4LVS A;  1NPR A;  4N4I A;  5LJ3 h;  4M04 A;  4KLH A;  4B9V A;  2E10 A;  1WZO A;  4ZGD B;  3AU2 A;  4EDU A;  3CCL A;  3KD3 A;  2CUB A;  3AHU A;  4NL9 A;  2MMP A;  2W55 A;  4PGQ A;  3H0F A;  2XDD A;  1U5S A;  9ICF A;  3SWN A;  3JCM f;  1UT8 A;  2ZJ5 A;  4NM1 A;  3E2E A;  8ICX A;  2YSQ A;  2L3Q A;  3PMI A;  8ICZ A;  3G6E A;  5GAN d;  3V7S A;  1VQ7 T;  4PHP A;  4O3O A;  2LJ3 A;  5IIK A;  5KFC A;  1ZUK A;  5IIJ A;  1HUZ A;  1D1A A;  5DG7 A;  4DS4 A;  2FRW A;  1GFD A;  2ABL A;  4DFK A;  5GMK l;  4I2D A;  1IHV A;  1VQL A;  3RR6 A;  2L3S A;  3A5Z B;  4PL2 A;  1YIT A;  2ATL A;  4QWB A;  1BPY A;  3RTV A;  3QHS A;  4I2I A;  3M0U A;  5HHH A;  1Y57 A;  1B43 A;  4XA5 A;  1ZQO A;  2QB1 A;  2E64 A;  4LDV A;  1WXU A;  2NO4 A;  2ZIV B;  3OYM A;  2MYS A;  2ZGW A;  4DFM A;  4LN2 A;  2HL3 A;  2WF7 A;  4OJ6 A;  3OYB A;  4FBT A;  2X9H A;  2KOB A;  5AKK A;  2VJ5 A;  4TUR A;  3AMZ A;  7ICS A;  7ICE A;  2OTJ T;  2O6K A;  2BQ3 A;  1P92 A;  2MWO A;  1S0O A;  4DL7 A;  1N9S A;  4MZT A;  4YR2 A;  1Y71 A;  1B22 A;  5L8R E;  1DK3 A;  1PK1 A;  4DL6 A;  1VQP Q;  2KRO A;  1WWU A;  3KZI U;  3ZDB A;  5EE9 A;  1QP3 A;  3NTI A;  1M1G A;  3HKS A;  3PW4 A;  4RQ3 A;  3RB0 A;  3MPU B;  2F8K A;  4XTW A;  4US8 A;  1YCS B;  2KRM A;  4KGV B;  2GLE A;  1SHG A;  1JU5 C;  4KUI A;  2EAO A;  4O3N A;  2AHJ B;  4PJ0 U;  4HVW A;  2J7I A;  3VS2 A;  8ATC B;  5CIU A;  2XCP A;  4XQ8 A;  2KYB A;  1YIJ A;  5ALN A;  2LJ1 A;  2JV3 A;  1QQ7 A;  2LKY A;  3NVW A;  1N48 A;  2DTI A;  3CYM A;  3NUQ A;  4M7A E;  2MPX C;  3QUT A;  1WHG A;  1N5W A;  4RTU A;  3N5B B;  2WSC E;  2BTT A;  1N5Z A;  5CR0 A;  1LCK A;  3A8O B;  1Q86 R;  4M75 F;  2R58 A;  1WQ7 A;  2RH2 A;  4Z02 A;  4PJO G;  4E2F B;  1IGQ A;  4JV1 A;  4KLT A;  2KAF A;  3L2Q A;  3TKA A;  4M78 C;  2L5Y A;  1NKE A;  2FL7 A;  3X26 B;  2FZK B;  3U26 A;  4C5H A;  1SHF A;  2EYX A;  4EEL A;  3DB4 A;  1JXO A;  1VQ4 A;  4FIB A;  2HBM A;  3WU2 U;  3OS1 A;  2CXY A;  1AWX A;  2XHC A;  4RTV A;  4OF1 A;  5KYN A;  4HYK A;  8ICI A;  5J2B A;  4PL6 A;  7ICP A;  3VV0 A;  2RA2 A;  2BGW A;  3PE0 A;  1XC9 A;  4CRI A;  3EG3 A;  1ZA1 B;  3S3O A;  2V26 A;  4Y2V A;  2P4T A;  2IOH A;  5K4L A;  5AM1 A;  1TKD A;  4EBC A;  2QQR A;  1D0Z A;  4ECR A;  2OYY A;  3K1Z A;  1X6I A;  1OEB A;  5AKH A;  2K3X A;  1ZBJ A;  2F1J A;  3QU9 A;  5FU6 B;  1OPK A;  3SD7 A;  5KFB A;  2IPO B;  2P0P A;  5KT4 A;  3OBY A;  2LBO A;  2JTM A;  4FCY A;  4P4O A;  3M8S A;  2QK0 A;  5IHK A;  2EKO A;  2M9U A;  5J2C A;  2G5H B;  5CK9 A;  3CCR A;  3MP1 A;  3KOO A;  1L3T A;  2MA1 A;  3LK9 A;  8ICR A;  2ZIX B;  1GXI E;  4CC2 A;  2IOF A;  4UC4 A;  2VGN A;  4RTZ A;  2DIQ A;  2FO0 A;  2DPJ A;  2PI4 A;  2PTK A;  2VKN A;  2W3S A;  3UWN A;  3O5Z A;  3AM9 A;  2ASJ A;  2EAY A;  5KFF A;  5J26 A;  3AN1 A;  3V72 A;  5AM3 A;  1ZQP A;  4F4X A;  7ICV A;  2LQW A;  2LQN A;  2LTO A;  3HPW A;  4JV0 A;  4OJL A;  1TTH B;  4YXM A;  3NPF A;  2K4H A;  1PVP A;  4FT4 A;  3GBQ A;  3CCV T;  5LJ5 d;  1SWV A;  1WG8 A;  5GJV B;  1BYM A;  2QEX A;  3NTU A;  1Q7Y R;  4LUE A;  5KT5 A;  2KJ5 A;  1VQM Q;  5ALV A;  4JLG A;  2KVC A;  1NZP A;  4WCI A;  1Q3U A;  3QUB A;  3ME9 A;  3JCM h;  1F44 A;  3QE9 Y;  3EG9 A;  4CC3 A;  2PMZ F;  3JPT A;  1TFR A;  5L1K A;  3KKA A;  4RT3 A;  1QP2 A;  2IG0 A;  5KCH A;  3NVV A;  3KHL A;  4DL5 A;  4XTZ A;  3REA B;  1JO8 A;  4L6V 5;  5KYX A;  5A2Q E;  2DLP A;  1SSF A;  3G7Z A;  3L2U A;  3M9Q A;  3CCM A;  1F0M A;  1KEJ A;  2EH9 A;  3FDS A;  1KFD A;  4M77 A;  4O6J A;  3QYP A;  4M7A B;  3SV3 A;  1I4K 1;  3KHR A;  2J06 A;  5GAN 6;  1B34 B;  3GIM A;  2W04 A;  1NKB A;  1ZQI A;  3F5A A;  5ECA A;  2QG9 B;  3H8J A;  4M7D A;  5KFH A;  1OUL A;  1S8O A;  4RUA A;  5A0L A;  2UVU A;  4NLK A;  1WYX A;  4QZG A;  1BIB A;  1N8R R;  1Q7Y U;  2YN4 A;  2BZ8 A;  5KG2 A;  3OBW A;  4RQ6 A;  4GC7 A;  1B4F A;  2KRN A;  5GAO p;  2DXC A;  4ELU A;  1B7T A;  1G5V A;  4EEY A;  5DDM A;  2W9C A;  2WB1 C;  3VS1 A;  5F9L A;  3SHW A;  8ICB A;  2G3R A;  3AQE A;  2KZM A;  2JJ9 A;  1SRL A;  2GFA A;  4LZD A;  2JVV A;  4PLL A;  3QWX X;  2XK0 A;  4FU6 A;  4ECT A;  4U6P A;  2W8L A;  1UPH A;  3VS5 A;  2ZIW A;  2FMP A;  1UQV A;  2NRT A;  3G1J A;  3BZK A;  1N56 A;  2DQN B;  2MF2 A;  2QQB A;  5GAM h;  1YJN A;  4IRK A;  2JM9 A;  4MDX A;  8ICO A;  1KC8 U;  2FE9 A;  2KXC A;  2NO5 A;  5KFU A;  1I0C A;  2FRY A;  3OA6 A;  1SL1 A;  4FL6 A;  4RNO A;  3MEW A;  2JGA A;  2G5I B;  4RQ7 A;  1SKS A;  4NWI A;  2F76 X;  3LH0 A;  2KFN A;  4MFC A;  4NLB A;  5GAO m;  1X43 A;  1VQN T;  1BPZ A;  1EIF A;  2VIX A;  1U1T A;  1ZQA A;  5AM2 A;  2IA6 A;  1KJW A;  2COW A;  2CUD A;  4OCZ A;  3GV8 B;  1MMG A;  3CCJ A;  5I21 A;  2AGQ A;  4Z88 A;  3BQ1 A;  5H2F U;  4DF8 A;  4LDX A;  4ZTF A;  1ARK A;  4UAU A;  9ICJ A;  4NLG A;  4A4G A;  4NOY A;  2E3H A;  4WF2 A;  3CCR T;  4BE2 A;  4HT9 A;  4WJ3 B;  2PKE A;  3TQ7 P;  2DGZ A;  3IN5 A;  2BPF A;  2RHU A;  1TXQ A;  1LV5 A;  2H3E B;  2C28 A;  3ETR A;  4M7D C;  1W1F A;  2KMD A;  3V6K A;  3VU3 C;  1PVQ A;  4BI3 A;  5CR2 A;  8ICM A;  4FZL A;  4ELV A;  3CC2 A;  4RQ5 A;  4ECW A;  1I81 A;  1ZQS A;  1SB3 C;  3SD4 A;  3LWI A;  1YIJ T;  2RDJ A;  1D3B B;  3A8L B;  2MOX A;  2R18 A;  4RQ4 A;  1KHI A;  4OJP A;  4F50 A;  2RK2 A;  4Y2J A;  1M1F A;  2DIL A;  1TUG B;  2HSE B;  4ED6 A;  2LZ6 B;  2E70 A;  3HRS A;  3ZL7 C;  3J80 E;  4KUL A;  4D8K A;  2MRL A;  2EYZ A;  2DFU A;  1KN5 A;  4RQ1 A;  4CF5 A;  3GQC A;  3NTH A;  4FYY B;  5CAI A;  3ONN A;  1N5X A;  3JV3 A;  3OS0 A;  3G4S Q;  4M6W B;  3NFC A;  5IH2 A;  4AFS C;  2EPD A;  1K4U S;  5DB9 A;  2O9V A;  5TIS U;  2HNI A;  3UA6 A;  4RTT A;  2VYT A;  4J9P A;  1NJX A;  3H8W A;  3RMS A;  4QWA A;  1XS9 D;  5FRM A;  2ZXH A;  3TQ1 A;  3HIL A;  3N4M B;  2FLL A;  4XAX B;  3GIL A;  1YHQ A;  1QWE A;  3QO3 A;  4LJX A;  1M2O A;  2VVK A;  1X6B A;  2SRC A;  4DQI A;  3MP6 A;  1L7M A;  3QWY A;  1VJ5 A;  4P2H A;  4PFP A;  1S77 D;  3CCU A;  2DTO A;  3CPW S;  3J81 j;  3FYH A;  3RB4 A;  4BXO B;  2CP6 A;  4EYI B;  3OSV A;  3G4S T;  2Y1J A;  3CME Q;  4M7A A;  3PO4 A;  1J3T A;  1NZB A;  4JMU A;  4BY6 C;  4Y28 E;  3QUC A;  2XGQ A;  5GAM f;  2K3B A;  4X5V A;  2C0I A;  2BHN A;  2K2V A;  1VQ4 T;  3ZD8 A;  3LYS A;  2W0Z A;  3FC4 A;  2D6F C;  4PJO B;  3BQ7 A;  2FHD A;  2E65 A;  2NUZ A;  1MC8 A;  4ZNX A;  3CMA Q;  2HQH A;  3M4Y A;  4KX5 A;  1X6J A;  4UAV A;  1FEZ A;  4F72 A;  1NJZ A;  3EGD A;  4J83 A;  3H0I A;  4IQU A;  4P0P B;  3H41 A;  1ZRM A;  1XSN A;  2LHT A;  1UJY A;  2F5T X;  1ECW A;  4CC7 A;  2KE7 A;  4RKU E;  1COO A;  1Z1V A;  1JI7 A;  2EW3 A;  2W9C B;  1RZT A;  3WKA A;  3MR5 A;  3OYJ A;  4NV0 A;  2Q0Z X;  3PV8 A;  5ALM A;  5LJ3 f;  3QKJ A;  4XRH A;  3M6Z A;  2ZJ8 A;  2JRZ A;  1N60 A;  2KD1 A;  4R0K A;  4IRD A;  2M51 A;  2ZXI A;  4D6W A;  1RAE B;  2CRX A;  3X20 B;  2PMZ C;  4DBR A;  4E0D A;  1G8X A;  2KJ9 A;  2JMA A;  1K76 A;  2K4I A;  3JPN A;  1FWZ A;  4DFD A;  4USA A;  1RL2 A;  2E41 A;  8ICP A;  5DB6 A;  2AQ4 A;  1QVF S;  5J8Y C;  2XD0 A;  4M77 G;  4B9S A;  1WJR A;  4J7I A;  4JRQ A;  1W2B S;  1TK8 A;  2EGA A;  3IP4 B;  4DSF A;  4M7A D;  5FP0 A;  4HXJ A;  2QTX A;  5J2H A;  1T0H A;  1NEB A;  1Z19 A;  1KRP A;  1U47 A;  1X01 A;  5CO7 A;  3OYF A;  2R8I A;  1PCX A;  2HQE A;  5III A;  2K3Y A;  2VXE A;  2BDU A;  1NLO C;  2MWP A;  5ALL A;  1SZP A;  1ZQJ A;  4LDY A;  2O4X A;  2XY7 A;  5DLG A;  2BDP A;  2LM4 A;  4C8M A;  2E1H A;  4C92 D;  3CCM T;  2RLT A;  4XTU A;  3TAP A;  4YQW A;  3J81 E;  2OCE A;  4DEZ A;  1RM6 C;  1OZ3 A;  1XO1 A;  1WNL A;  5GMK h;  4IIO A;  3CXC A;  3AL0 B;  1M3A A;  4KLD A;  1AWJ A;  5FRO A;  3H0H A;  5HR6 A;  3JCM J;  1YZ6 A;  3NGD A;  4RTX A;  2AQ0 A;  3BE3 A;  4YP3 A;  2VA3 A;  2QA4 Q;  2L0A A;  4BX9 C;  2P6R A;  1PK3 A;  1N27 A;  4ZN3 A;  2ZUC A;  2H8H A;  5KG0 A;  1OU8 A;  4C0Z A;  4ECS A;  2LJ0 A;  4UB3 A;  1JJ2 P;  2JH7 A;  1H38 A;  2HKQ B;  2DA9 A;  1TK5 A;  4JDS A;  2PQW A;  4QW8 A;  5IIL A;  5FRN A;  5L9X A;  8AT1 B;  3ER0 A;  3OMG A;  4GFJ A;  3C2M A;  1BBZ A;  1PRM C;  3M53 A;  3JCM X;  3QSU A;  5J8Y A;  4DQS A;  2ODG A;  5ALJ A;  1M1K C;  4NLN A;  2EYQ A;  3CME A;  3PSP A;  1Q81 C;  2XGP A;  2I2L A;  2QDL A;  4UB5 A;  1I8F A;  4N4G A;  1YI2 A;  1W70 A;  1K1Q A;  1OXJ A;  2PUK B;  3EUB 2;  4M77 E;  3M6K A;  1RAB B;  3M0T A;  3VC8 A;  5J0Q A;  2XY5 A;  4QZC A;  2IHM A;  1QMC A;  1J97 A;  2EZX A;  1WUD A;  3ZBD A;  4RPX A;  2PU9 B;  3AT1 B;  1YHQ Q;  4Z8A A;  4BD3 A;  2DL4 A;  4C92 G;  1VQO A;  1NK5 A;  1YIT Q;  2AZV A;  1QVG P;  3P8B B;  2M1H A;  4QT7 A;  5J2J A;  4F4W A;  3EYZ A;  3CCV Q;  3Q1J A;  2EQK A;  2F2A B;  2EAP A;  2LX9 A;  1CRX A;  3RB3 A;  5FLX E;  1UGR B;  4J9O A;  1BCM A;  2P4R A;  4Y92 A;  1NPP A;  2HCF A;  1FFV A;  1KK7 A;  2V1R A;  2V1Q A;  3VS7 A;  4NLZ A;  1RAH B;  5IIN A;  3UQ0 A;  3NRW A;  2IOF K;  4M77 D;  1Q86 C;  4DSI A;  5LJ5 h;  3Q8Q B;  4KLG A;  2Z0W A;  1EZZ B;  3GIK A;  1S0V A;  2LPE A;  3LGL A;  3M9O B;  4EX7 A;  1TH7 A;  4MEY A;  3QXE B;  1XSL A;  1ZUY A;  4FO6 A;  1RLQ C;  1SEM A;  5G5G A;  4UAS A;  5AIB A;  2GOL A;  4BB7 A;  3BDU A;  4JWM A;  3WK4 A;  1ZQ1 C;  1GRI A;  4II1 A;  1MMN A;  2KNB B;  1K8A R;  2JS2 A;  2JTF A;  4NLC A;  2XG8 D;  1BU1 A;  3TSZ A;  3N7P D;  2JEF A;  3FLG A;  3AU6 A;  4DL3 A;  2ESW A;  3RKX A;  4PJO E;  3REB B;  4ZOH C;  1Y88 A;  4AP9 A;  3IM1 A;  4XU1 A;  4PJO F;  3OYH A;  4EEN A;  3CPW A;  4RPY A;  5J0R A;  2F1I A;  4OO1 J;  1TV9 A;  4C8Q A;  2D8C A;  1Y07 A;  2JXJ A;  2HSP A;  2WF8 A;  1Z4O A;  7ICK A;  2KTQ A;  1RPL A;  4DOV A;  1FMV A;  2NLU A;  1U06 A;  4JJC A;  1S72 A;  3I5R A;  5M9O A;  4KX3 A;  4XUS A;  8ICN A;  5DB8 A;  1QQJ A;  1IO6 A;  3V6J A;  2Y4X A;  2WHE A;  1CKA A;  2P0Q A;  2EAN A;  1GBR A;  5KFW A;  5CVI A;  3SDZ A;  2DET A;  3CMA T;  2R5M A;  4QWE A;  2XCA A;  2ZIV A;  2ZCF B;  2IHN A;  5F9N A;  1M5Q 1;  3GV5 B;  5EC7 A;  4J8O A;  1NEG A;  4UW9 A;  3RUX A;  2BR0 A;  4CDG A;  2NUT B;  2KXD A;  2R5A A;  2DM1 A;  1WYG A;  2KG5 A;  4BDP A;  1Z9Q A;  2ASD A;  4U7C A;  2FEI A;  3FB9 A;  3RDV A;  3OTQ A;  5GAO l;  2K79 A;  2OTJ A;  3ZDA A;  3RBD A;  3LGF A;  4EEK A;  3I76 A;  3H0L B;  3EG9 B;  1ZJM A;  5HMM A;  4YMM A;  3G6Y A;  1XO0 A;  1FFU A;  2BZY A;  2QAS A;  1PM3 A;  3I5S A;  2HDA A;  5J2G A;  3JCM P;  1K0X A;  3H8Z A;  1W2B A;  1T3L A;  4QJF B;  1Q82 U;  1S97 A;  2CP5 A;  5HCK A;  4OVA A;  4JWN A;  3L3F X;  4FYV B;  8ICS A;  1SPK A;  4J9F A;  1MV0 B;  1JMS A;  5DM7 R;  1PD0 A;  3V7C A;  5DBA A;  1X27 A;  2M0N A;  1UGQ B;  5J29 A;  4M77 B;  4R55 A;  3ISC A;  2QQ9 A;  3I55 Q;  2KFZ A;  2KYM A;  2PVD B;  3VKI A;  2IIM A;  1D9F A;  1X9S A;  4A4K A;  3HP9 A;  1M2V B;  7ICO A;  2HBP A;  3HFN A;  2HMA A;  5GAM g;  4C8Q E;  3JCM b;  3MCA B;  3L2W A;  5FU6 C;  4M78 D;  9ICA A;  3PNW C;  3CPW P;  3CCM Q;  5L1J A;  3EH1 A;  4N0A A;  4M77 C;  1YJN Q;  1DGS A;  1ZQM A;  1N63 A;  2LNV A;  2WF6 A;  2RMO A;  4O5V A;  3RKW A;  4C0D C;  2ZPF B;  3CC4 Q;  2YQE A;  4KLL A;  2JN0 A;  2F3N A;  3EG2 A;  5KYY A;  2XDP A;  3MO8 A;  3C5F A;  2MIO A;  3S6W A;  4WTO B;  1N2X A;  3QNM A;  4HA8 A;  3QZ7 A;  3H8S A;  7ICF A;  3KTQ A;  1X40 A;  2DVJ A;  3IDW A;  1UDL A;  2OM6 A;  2X4Y A;  3N28 A;  3V6H A;  3G6E Q;  3QU2 A;  2A3L A;  3EAE A;  2HBJ A;  4F7U A;  3PR5 B;  2QXF A;  5ALD A;  2Q4T A;  1SSH A;  5G5H A;  2BQU A;  1SV0 C;  2CGH A;  3LX7 A;  3WK6 A;  2LMJ A;  2A3V A;  2YY6 A;  9ICT A;  2HSZ A;  4JPB W;  1KFT A;  2OTL T;  2F8L A;  5DQG A;  3SQI A;  2V8J A;  1MSW D;  1VQ9 Q;  2MCN A;  2P6U A;  3RJE A;  1ARO P;  4IUQ A;  5AHX A;  1ZQB A;  3M0Q A;  2KHV A;  5JRT A;  4D8D A;  1QVG A;  2LM1 A;  4FYW B;  3QZ9 B;  2OHF A;  4Q43 A;  5GAN h;  4E6R A;  3OGU A;  1IHW A;  4E7J A;  4BDY A;  1QH9 A;  2NRX A;  4US9 A;  1ZQW A;  4QVC A;  1BIA A;  3CNH A;  1OZ2 A;  2DL0 A;  3PGG A;  2QAR B;  2JZ2 A;  2LYB A;  1YI2 Q;  1Y0M A;  1YJ9 Q;  4O5E A;  3RR7 A;  2VC8 A;  2PXI A;  3TI0 A;  4DF4 A;  1ZJN A;  1J2N A;  3RIR A;  4Y2R A;  4RQ8 A;  3EFO B;  4QZH A;  1HSQ A;  2QI2 A;  2FVU A;  1UJ0 A;  4M7D F;  5LJ5 f;  1QLY A;  3MGV A;  4UAW A;  1VQ9 T;  4I2B A;  1Z9Z A;  4JLI A;  3SEN A;  1PC0 A;  2CRE A;  2W3R A;  1PG5 B;  5GMK m;  2ZTD A;  3CCV A;  2I9G A;  2FDR A;  2QEX Q;  2A19 A;  3F2D A;  3FAH A;  3QPH A;  5KYY B;  2H3F A;  1S76 D;  1SGG A;  3RF9 A;  4M75 C;  4IUT A;  1O03 A;  2DRM A;  5AI8 A;  5IT9 E;  1D8Y A;  1UUE A;  4J9N A;  4OML A;  4GC6 A;  4B6M A;  2WAC A;  5EE3 A;  5CKF A;  4A63 B;  2HW3 A;  1B3Q A;  5GAN 7;  3L2V A;  1KIK A;  2RPN A;  2OH2 A;  1YIT T;  1KQS P;  2L5Q A;  1YWP A;  1X42 A;  2JW4 A;  1SV0 A;  1KBU A;  4GLK A;  9ICE A;  3H40 A;  5KG4 A;  1UHF A;  5GTH U;  1P7D A;  5LL6 S;  1S0N A;  2NYS A;  2NV3 A;  1ZQG A;  5IHN A;  3DLM A;  2R8J A;  1UEB A;  2V4Q A;  5AKG A;  1UHC A;  1KQS A;  5KE2 A;  2FZC B;  2C22 A;  2J6U A;  3KKA C;  6AT1 B;  4M78 G;  1L3V A;  1NBE B;  3J7A F;  2R8K A;  2VA8 A;  5D49 A;  1YN8 A;  1AZE A;  1ZUU A;  2FJ6 A;  1Y96 B;  4UQG A;  1SKW A;  3CC2 Q;  3ZD9 A;  2J6T A;  4R65 A;  4N0A C;  1UEC A;  3SEM A;  2NRZ A;  2K8B B;  4GXI A;  2M16 A;  4O3Q A;  1HIW A;  2YUP A;  2C06 A;  3E2U A;  2E1E A;  4I29 A;  2CZ0 B;  5KYW A;  1PUZ A;  4DBQ A;  2CKK A;  4OJO A;  2OAU A;  5AK6 A;  2J6K A;  4M75 A;  5J2I A;  3BS5 B;  3LWH A;  1Q82 C;  4KRT A;  2K4P A;  4KN4 A;  3ULR B;  4M7D E;  1UT5 A;  5C0Y A;  2LCC A;  2BE7 D; 
#chains in the Genus database with same CATH homology
 1VQP T;  2D9T A;  4V2S A;  2EIF A;  2Z7J A;  1LJO A;  2EJF A;  4RCC A;  4C8Q B;  2EJG A;  1QVG S;  5FU7 B;  4EMG A;  2CS7 A;  4PKC C;  3OYI A;  3RKY A;  1WJQ A;  2DZC A;  4J5Y A;  3PIO A;  4XU3 A;  1VQ6 T;  3H0M B;  4IUV A;  3PFS A;  1IIP A;  3F53 A;  3T9N A;  1PVR A;  3H6Z A;  2ZIW B;  3C94 A;  4C5E A;  3OY9 A;  4OB1 B;  1XOV A;  5GAN f;  3N7S C;  3GIB A;  2L3R A;  3A8H B;  4BUG A;  3C12 A;  2LDM A;  1IRE B;  2JUF A;  3ZFJ A;  2ZIX A;  4CRX A;  3E9G A;  3RFA A;  3QG1 A;  1WGS A;  1N8R C;  2GQV A;  2RM4 A;  4EPC A;  3M56 A;  4DQ2 A;  3I56 A;  3G4S A;  2LRQ A;  5CQX A;  2O01 E;  2VV5 A;  4PJO A;  2DPP B;  5DY9 A;  5HKC A;  2KMT A;  1AHJ B;  3I55 T;  1Q3V A;  4BI4 A;  2EQM A;  1YT3 A;  2W03 A;  4OP0 A;  3G71 A;  5GAN j;  2K5L A;  1KQS S;  4QW2 A;  2N1R A;  1XQH A;  3VJP A;  1G3T A;  2B8A A;  4M78 A;  4DA4 A;  3G6E T;  1VQ7 A;  1OI1 A;  2DTH A;  4A53 A;  3GNF B;  2ZIU A;  3E19 A;  5J39 A;  5A0D A;  5GMK e;  4X34 A;  4RCB A;  1K8A C;  4XU0 A;  5C6S A;  4EMH A;  5KE3 A;  5GAN 3;  5IN1 A;  1QW1 A;  3L2R A;  2Y4Y A;  2MI6 A;  1DRG A;  4ELZ C;  3JB9 F;  2EJ9 A;  5AYF A;  2CN1 A;  2ZZD A;  2RJE A;  4QIW C;  2G0A A;  3CME T;  3JSC A;  1GO3 F;  2DF4 B;  5CKE A;  4M7D G;  3HHT B;  3L2Z A;  3CC4 T;  3CD6 T;  3OW2 S;  1I5L A;  3HFO A;  1K73 U;  4Q5W A;  2YHT A;  1K9M U;  3JCM d;  1KC8 C;  1HEK A;  3FDR A;  3O8V A;  2E6Z A;  4A4H A;  3S3M A;  1LOJ A;  3LYI A;  3CCU T;  2HOQ A;  3X24 B;  4J6Y A;  5GAN 8;  4C8Q G;  1N9R A;  4RMO A;  2YB4 A;  4IKF A;  4QQG A;  4MML A;  5FU7 C;  3CBP A;  2DXT A;  4P0P A;  1PSF A;  1K73 C;  2LQ8 A;  3JB9 I;  4A4E A;  1N6A A;  4ME7 A;  4HCZ A;  4OB0 B;  1Q81 U;  4BAC A;  3RMQ A;  4JS5 A;  2Y0S C;  1Y7X A;  1VIF A;  3E1S A;  1UGS B;  2P0K A;  2CPR A;  3V7R A;  3MEA A;  3D2Q A;  2H3Q A;  3QDR B;  5GAM e;  4LD6 A;  3UPU A;  2GF7 A;  1IZ6 A;  4M75 D;  4M75 E;  4KUD K;  4GY5 A;  4M7A G;  3M4G A;  4F7U G;  4C5G A;  3T79 A;  2ZPB B;  3OQ5 A;  2PVG B;  1TAM A;  3JB9 G;  2QDY B;  4JRP A;  3SAG A;  3MHX A;  2K4Y A;  5CQY A;  1VQO T;  3CXC S;  4C0G A;  1YJW A;  4YTL A;  2QQA A;  4O3M A;  3OPX A;  2K89 A;  3LVW A;  3MEU A;  1T94 A;  3VUB A;  2QA4 T;  1VIE A;  2KKP A;  4QVD A;  4AYB C;  4B9X A;  1M90 U;  3PIP A;  4E7I A;  1K8A U;  2RK1 A;  2G08 A;  4JS4 A;  4LDU A;  4XTV A;  3F70 A;  2KQW A;  4F7U E;  4QVZ A;  4FE3 A;  1S72 T;  2KEY A;  2DXB A;  2ZPI B;  5KH6 A;  2DO3 A;  5CKD A;  2RI2 A;  4FZN A;  2QEX T;  3OS5 A;  4PJO D;  3D2N A;  3IG5 A;  3SWN C;  4TVR A;  2VJ4 A;  3BFM A;  4J7F A;  1VQN A;  3PT9 A;  3GF5 A;  2EWN A;  3V8L A;  4MDW A;  3KFU F;  3CRX A;  5D6X A;  3FC3 A;  2RD1 A;  1KQ1 A;  1M8V A;  3GZF A;  2KJ8 A;  4P0Q A;  2W7P A;  2Y0S F;  1WPY A;  3HKZ C;  4JJN K;  1VQP A;  1VQ9 A;  5HY6 A;  3X28 B;  5GAM j;  4ACO A;  3OB9 A;  2DXU A;  3CCE A;  1U1S A;  1NZ9 A;  3JCM V;  4F7U F;  2EQU A;  2KY9 A;  4P5N A;  1JJ2 A;  2YB1 A;  4DOW A;  3SWN B;  2X35 A;  2DKG A;  2WAQ F;  4C8Q C;  4OB2 B;  2RB6 A;  1H3Z A;  1YHQ T;  1YJN T;  5HR7 A;  2RI3 A;  3L1A A;  2QA4 A;  3HL8 A;  2FYK A;  2LCL A;  1VQM T;  4C5I A;  1URJ A;  2H3J A;  3SAF A;  3HRU A;  4F7U B;  3UDC A;  4M77 F;  5GAN g;  2E12 A;  2BUD A;  4C0F A;  4C8Q D;  4VUB A;  2QQS A;  2RHY A;  4HCB A;  2RI5 A;  2HBL A;  3OYE A;  4E7L A;  2H3V A;  1KD1 C;  4A4F A;  3PZP A;  1UB4 A;  2YLC A;  5LJ3 g;  2DK3 A;  2HQX A;  1O9S A;  2DJZ A;  1B34 A;  2PVO B;  4CI0 C;  3CCL T;  5D6W A;  4N4H A;  4A54 A;  1ZBX A;  2DEQ A;  3CBO A;  4QNL A;  1Z1B A;  3TCJ A;  1QVF A;  4BJQ A;  5CRX A;  3CCQ T;  1VQ5 T;  1H64 1;  2BIV A;  3N7R C;  1YJ9 T;  2V8K A;  2JMG A;  1L6N A;  1WQW A;  3CCJ T;  4X9D A;  2Y90 A;  2ZPH B;  1YJW T;  3HKZ F;  4MMK A;  5CCA A;  3GU3 A;  1BI1 A;  3FIF A;  1HXD A;  1O75 A;  1VQK T;  2YRV A;  5HK3 A;  3CPF A;  3CC2 T;  4M78 F;  3INZ A;  2F5K A;  4E7K A;  3QYG B;  1JB0 E;  2RHI A;  3DEE A;  2JH1 A;  2RJF A;  2RHX A;  1M4Z A;  5KCO A;  3ALR A;  3OYN A;  5GMK j;  4XK8 E;  2BKD N;  3CCS A;  3C29 A;  3HSB A;  3DB3 A;  3SB2 A;  5GMK i;  4NL3 A;  3L42 A;  4RG8 A;  3DKM A;  2R57 A;  4A8E A;  1JJ2 S;  2KKV A;  4C92 E;  2V8I A;  2CZ1 B;  1KQ2 A;  4MZP A;  5LJ5 g;  2GH1 A;  2HBK A;  1WJS A;  3RER A;  3F2C A;  3JB9 H;  3A8G B;  2EFI A;  1OUQ A;  4M75 B;  5LJ3 d;  2MAM A;  4E47 A;  4OGC A;  1XTD A;  3E9F A;  5LJ5 j;  1BI3 A;  3VYH B;  4ZTJ A;  3BY7 A;  4IC9 A;  4NL2 A;  4ATO A;  3QJ6 A;  3KBG A;  3CP8 A;  2K57 A;  2LT1 A;  1Y96 A;  4L59 A;  5D6Y A;  4C92 F;  2VKQ A;  2ZG6 A;  1UGP B;  3M5A A;  5CKH A;  3CEY A;  3R6O A;  1VQM A;  2KDS A;  3PMT A;  1XNS A;  4IUR A;  4E7H A;  2DD4 A;  1BKB A;  2E5Q A;  3QYH B;  4XTX A;  4J6W A;  4FZM A;  4PJO C;  4RG2 A;  4BDZ A;  4EMK B;  1VQ8 T;  2K5I A;  5T14 A;  4LDW A;  3OYA A;  2KNJ A;  3O0F A;  2HOI A;  1SZH A;  3ZEH A;  2KSS A;  3V8J A;  3OYG A;  4C92 B;  1G3Y A;  3EFR A;  3CC7 T;  2LQK A;  4M7A F;  1XNI A;  5IAY A;  1OYX A;  4M7A C;  3D2S A;  1G3S A;  3OYD A;  2LYA A;  2L8D A;  3SAH A;  4KBM B;  4L5G A;  2RHF A;  4CGZ A;  2WSE E;  5GAO r;  4JUV A;  3CBM A;  3TRE A;  2RJD A;  3M59 A;  4IUP A;  2HD0 A;  3NTK A;  2YLB A;  1KHC A;  2K8C B;  4M78 E;  2RRD A;  3OYC A;  5LJ3 e;  4AYB F;  5HK0 A;  4HCC A;  3JB9 D;  3JAM E;  2G06 A;  3RES A;  2EQJ A;  1N8R U;  2OXO A;  2LC4 A;  3P8H A;  3UT1 A;  3MEV A;  3FJP A;  3GNG A;  3S3N A;  4KT0 E;  3MET A;  1JBM A;  2KHQ A;  2LVM A;  5DLO A;  5GAN e;  4M75 G;  2RJC A;  2K5F A;  2OTL A;  3CCS T;  2H3I A;  4FM4 B;  3X25 B;  1D3B A;  3SMV A;  3A8M B;  2HAX A;  2KIW A;  4JRI A;  3FEO A;  3GPL A;  4HKE A;  4IUU A;  3WVD B;  2O4X B;  3KXT A;  3JCM g;  4Y91 A;  3QJY A;  1ED1 A;  2VUB A;  2XDB A;  3LW5 E;  3OW2 A;  4OGE A;  3TU4 K;  2HMX A;  2XKO C;  5GAO q;  2IVW A;  3OSS C;  5C0M A;  5A0G A;  3URG A;  4FSX A;  2X4X A;  1X6O A;  3KZX A;  1K9M C;  2KVQ G;  5EG2 A;  5CKB A;  4XU2 A;  1BI0 A;  4QIW F;  4C0D B;  1NJI C;  5KL1 B;  3QZ5 B;  2VXF A;  3DLL A;  2GCX A;  4XQ3 A;  1VQ6 A;  3AQF A;  1U8R A;  4OJ5 A;  3GP8 A;  1NJI U;  2PUO B;  4QQ6 A;  2XI9 A;  3GOX A;  5LJ3 j;  3G71 T;  3E0F A;  2KK4 A;  2JNG A;  3MP8 A;  2E6N A;  2HOF A;  5GAN 4;  2K8A A;  2YX8 A;  1R8O B;  2W7O A;  1QVP A;  1VQ8 A;  2RP5 A;  1LNX A;  3M55 A;  1JRI A;  2DD5 A;  3OYY A;  1VUB A;  3QBY A;  2WAQ C;  4M7D D;  4OMF B;  4JRK A;  2F69 A;  4XTY A;  3LVV A;  3FRN A;  3CC7 A;  3PST A;  4B9W A;  4NS5 A;  3C4S A;  1A6S A;  1NE8 A;  4ICA A;  1Q7Y C;  5I2M A;  2DVE A;  2E1F A;  2CZ7 B;  1VQL T;  4HT8 A;  4M78 B;  3WXM B;  3JCM W;  5LJ5 e;  1M9S A;  2DAQ A;  2KV2 A;  2XIC A;  4BE0 A;  3GLX A;  4PL1 A;  4PNO A;  4OB3 B;  3PSF A;  2JHD A;  3QUI A;  2DZ9 A;  3VCB A;  4KMO B;  1DJ7 B;  2E5S A;  2CYZ B;  4LD9 K;  2RHZ A;  2XU8 A;  3CCE T;  2LT4 A;  3V8K A;  4ELY C;  2WB1 F;  4R56 A;  3OS2 A;  3BDL A;  3M57 A;  2CZ6 B;  4ZN1 A;  1ZHI A;  2H3Z A;  3JCM c;  3QII A;  3KUF A;  1VQ5 A;  1M90 C;  3C28 A;  1KD1 U;  1A0P A;  4M7D B;  1HK9 A;  2K4E A;  3ASK A;  1YI2 T;  2X4J A;  3LLR A;  3CMA A;  2DIG A;  2VGM A;  3ICX A;  3VYG A;  2XVT A;  4FT2 A;  3OYL A;  1G3W A;  1YJ9 A;  3H0R B;  1FXX A;  3JRZ A;  3P8D A;  1PSE A;  2KIC A;  5J3B A;  1KG1 A;  1VQK A;  3VUZ A;  3I55 A;  1YCY A;  2D0Q B;  5GAN 2;  4EMK A;  4BE1 A;  2D6F A;  4J6X A;  4C92 C;  3SFM A;  2A7Y A;  3F2B A;  3JCM e;  1BI2 A;  3M58 A;  5GAM d;  1W4S A;  3PSI A;  5GAN 5;  2L89 A;  4X9C A;  5KL8 B;  2G09 A;  3CC4 A;  3OYK A;  3TEE A;  3CD6 A;  4ZGJ B;  3OMC A;  3CCQ A;  1YBY A;  4C8Q F;  3EFS A;  1MA7 A;  4BI8 B;  3WVE B;  2WSF E;  2ZIU B;  5I2S A;  3F5E A;  1Q86 U;  4BY6 B;  1FX7 A;  3I56 T;  2M0O A;  1MHN A;  3BW1 A;  3JB9 J;  4P0Q B;  3HRT A;  4PLI A;  2GFU A;  3IG8 A;  4QQD A;  3PTA A;  3M7D A;  2ZPG B;  4ZGE B;  2FB7 A;  4EMK C;  3JCM Q;  1D8B A;  4MZM A;  4C92 A;  2XID A;  3C95 A;  1RI0 A;  1ZQ1 A;  5DLQ E;  1V29 B;  2JOY A;  2ZPE B;  1X75 C;  1MGQ A;  5GAO n;  2X4W A;  1M1K U;  2RO0 A;  3M54 A;  2G07 A;  1NPR A;  2F77 X;  4N4I A;  5LJ3 h;  2E10 A;  4ZGD B;  4EDU A;  3CCL A;  3AHU A;  2MMP A;  2XDD A;  3SWN A;  3JCM f;  3PMI A;  3G6E A;  5GAN d;  3V7S A;  1VQ7 T;  5GMK l;  1VQL A;  3A5Z B;  4PL2 A;  1YIT A;  3QHS A;  2E64 A;  4LDV A;  2ZIV B;  3OYM A;  2ZGW A;  4OJ6 A;  3OYB A;  2KOB A;  2VJ5 A;  2OTJ T;  1P92 A;  2MWO A;  1N9S A;  4MZT A;  1Y71 A;  5L8R E;  1QP3 A;  3NTI A;  1M1G A;  3HKS A;  4XTW A;  4KUI A;  2AHJ B;  5CIU A;  1YIJ A;  2LKY A;  2DTI A;  3CYM A;  3NUQ A;  4M7A E;  3N5B B;  2WSC E;  3A8O B;  4M75 F;  2R58 A;  1WQ7 A;  2RH2 A;  4Z02 A;  4PJO G;  2KAF A;  3L2Q A;  4M78 C;  2FL7 A;  3X26 B;  4C5H A;  3DB4 A;  1VQ4 A;  4FIB A;  2HBM A;  3OS1 A;  2XHC A;  4OF1 A;  4PL6 A;  3VV0 A;  2RA2 A;  4CRI A;  3S3O A;  2P4T A;  2QQR A;  2OYY A;  3K1Z A;  2K3X A;  5FU6 B;  2P0P A;  3OBY A;  2LBO A;  2JTM A;  2EKO A;  2M9U A;  5CK9 A;  2G5H B;  3CCR A;  3MP1 A;  2MA1 A;  2ZIX B;  1GXI E;  4UC4 A;  2VGN A;  2DIQ A;  3UWN A;  2EAY A;  5J26 A;  2LTO A;  3HPW A;  4OJL A;  2K4H A;  1PVP A;  4FT4 A;  3CCV T;  5LJ5 d;  1BYM A;  2QEX A;  2KJ5 A;  4JLG A;  2KVC A;  1Q3U A;  3ME9 A;  3JCM h;  1F44 A;  2PMZ F;  1QP2 A;  2IG0 A;  5KCH A;  4XTZ A;  4L6V 5;  5A2Q E;  1SSF A;  3G7Z A;  3L2U A;  3M9Q A;  3CCM A;  4M77 A;  4O6J A;  4M7A B;  1I4K 1;  5GAN 6;  1B34 B;  2W04 A;  3F5A A;  4M7D A;  5A0L A;  1BIB A;  1Q7Y U;  3OBW A;  5GAO p;  2DXC A;  1G5V A;  2WB1 C;  2G3R A;  3AQE A;  2GFA A;  2JVV A;  4PLL A;  2XK0 A;  4FU6 A;  4U6P A;  1UPH A;  2ZIW A;  2DQN B;  2MF2 A;  2QQB A;  5GAM h;  1YJN A;  4MDX A;  1KC8 U;  3OA6 A;  4FL6 A;  3MEW A;  2JGA A;  2G5I B;  4NWI A;  2F76 X;  3LH0 A;  4NLB A;  5GAO m;  1VQN T;  1EIF A;  4ZTF A;  2VIX A;  1U1T A;  3J7A F;  3CCJ A;  5I21 A;  4LDX A;  4A4G A;  4NOY A;  3CCR T;  4WF2 A;  4BE2 A;  4HT9 A;  4WJ3 B;  2DGZ A;  3IN5 A;  2RHU A;  4M7D C;  3VU3 C;  1PVQ A;  4BI3 A;  5CR2 A;  4FZL A;  3CC2 A;  1I81 A;  3SD4 A;  3LWI A;  1YIJ T;  1D3B B;  3A8L B;  2R18 A;  1KHI A;  4OJP A;  2RK2 A;  1M1F A;  3HRS A;  2E70 A;  3J80 E;  4KUL A;  2MRL A;  3NTH A;  3OS0 A;  5CAI A;  3ONN A;  3NFC A;  2HNI A;  2VYT A;  3RMS A;  5FRM A;  2ZXH A;  4XAX B;  1YHQ A;  3QO3 A;  3MP6 A;  3CCU A;  2DTO A;  3CPW S;  3G4S T;  3OSV A;  4M7A A;  1NZB A;  4JMU A;  4BY6 C;  4Y28 E;  5GAM f;  2K2V A;  1VQ4 T;  3LYS A;  2D6F C;  4PJO B;  2FHD A;  2E65 A;  3M4Y A;  4KX5 A;  4J83 A;  4P0P B;  2LHT A;  2F5T X;  1ECW A;  4RKU E;  3OYJ A;  4NV0 A;  5LJ3 f;  3QKJ A;  3M6Z A;  2KD1 A;  2ZXI A;  4D6W A;  2CRX A;  3X20 B;  2PMZ C;  2KJ9 A;  2K4I A;  1FWZ A;  1RL2 A;  1QVF S;  2E41 A;  2XD0 A;  4M77 G;  1WJR A;  4J7I A;  4JRQ A;  1W2B S;  3IP4 B;  4M7A D;  2QTX A;  1Z19 A;  1X01 A;  5CO7 A;  3OYF A;  2HQE A;  2K3Y A;  2VXE A;  2BDU A;  2MWP A;  4LDY A;  2O4X A;  2E1H A;  4C92 D;  3CCM T;  4XTU A;  3J81 E;  1OZ3 A;  1WNL A;  5GMK h;  3CXC A;  3AL0 B;  5FRO A;  5HR6 A;  3JCM J;  4BX9 C;  1N27 A;  4ZN3 A;  4C0Z A;  2JH7 A;  4JDS A;  2PQW A;  5FRN A;  3ER0 A;  3OMG A;  4GFJ A;  3M53 A;  3JCM X;  3QSU A;  1M1K C;  2EYQ A;  3CME A;  1Q81 C;  3PSP A;  2I2L A;  4N4G A;  1I8F A;  1YI2 A;  2PUK B;  4M77 E;  3M6K A;  3VC8 A;  1WUD A;  3ZBD A;  2PU9 B;  4BD3 A;  4C92 G;  1VQO A;  3P8B B;  2M1H A;  3Q1J A;  2EQK A;  2F2A B;  2LX9 A;  1CRX A;  5FLX E;  1UGR B;  1NPP A;  3NRW A;  1Q86 C;  4M77 D;  5LJ5 h;  3LGL A;  1TH7 A;  3QXE B;  2GOL A;  4BB7 A;  3BDU A;  1ZQ1 C;  4II1 A;  2JTF A;  4NLC A;  2XG8 D;  3N7P D;  3FLG A;  3RKX A;  4PJO E;  4XU1 A;  4PJO F;  3OYH A;  3CPW A;  4OO1 J;  4C8Q A;  1Y07 A;  4DOV A;  2NLU A;  1S72 A;  5M9O A;  4KX3 A;  2Y4X A;  2P0Q A;  5CVI A;  3CMA T;  3SDZ A;  2R5M A;  2ZIV A;  2ZCF B;  1M5Q 1;  4J8O A;  3RUX A;  4CDG A;  2R5A A;  3FB9 A;  4U7C A;  2OTJ A;  5GAO l;  3LGF A;  3H0L B;  1XO0 A;  3JCM P;  3H8Z A;  1W2B A;  4QJF B;  1Q82 U;  4OVA A;  3L3F X;  5DM7 R;  3V7C A;  2M0N A;  1UGQ B;  4M77 B;  4R55 A;  2QQ9 A;  3VKI A;  2PVD B;  4A4K A;  3HP9 A;  2HBP A;  3HFN A;  5GAM g;  4C8Q E;  3JCM b;  3MCA B;  3L2W A;  5FU6 C;  4M78 D;  3PNW C;  4N0A A;  4M77 C;  2LNV A;  4O5V A;  3RKW A;  4C0D C;  2ZPF B;  2JN0 A;  2XDP A;  3MO8 A;  3S6W A;  4HA8 A;  2OM6 A;  2X4Y A;  2A3L A;  3EAE A;  2HBJ A;  4F7U A;  2QXF A;  2Q4T A;  2CGH A;  3LX7 A;  2A3V A;  2OTL T;  2F8L A;  3SQI A;  2V8J A;  4IUQ A;  2KHV A;  1QVG A;  3QZ9 B;  5GAN h;  4E7J A;  4BDY A;  4QVC A;  1BIA A;  1OZ2 A;  3PGG A;  2JZ2 A;  2LYB A;  2VC8 A;  3RIR A;  2QI2 A;  2FVU A;  4M7D F;  5LJ5 f;  3MGV A;  1VQ9 T;  4JLI A;  5GMK m;  3CCV A;  3F2D A;  3QPH A;  2H3F A;  3RF9 A;  4M75 C;  4IUT A;  5IT9 E;  2WAC A;  5CKF A;  5GAN 7;  3L2V A;  2OH2 A;  1YIT T;  2L5Q A;  1KBU A;  4GLK A;  1P7D A;  5LL6 S;  2NV3 A;  3DLM A;  1UEB A;  1KQS A;  5KE2 A;  4M78 G;  1Y96 B;  4N0A C;  2K8B B;  2M16 A;  1HIW A;  2C06 A;  2E1E A;  2CZ0 B;  2CKK A;  4OJO A;  2OAU A;  4M75 A;  3LWH A;  1Q82 C;  4M7D E;  5C0Y A;  2LCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...