4C0ZA

The n-terminal domain of the streptococcus pyogenes pilus tip adhesin cpa
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
b'SVPNKQSSVQDYPWYGYDSYSKGYPDYSPLKTYHNLKVNLDGSKEYQAYCFNLTKHFPSKSDSVRSQWYKKLEGTNENFIKLADKPRIEDGQLQQNILRILYNGYPNDRNGIMKGIDPLNAILVTQNAIWYYTDSSYISDTSKAFQQEETDLKLDSQQLQLMRNALKRLINPKEVESLPNQVPANYQLSIFQSSDKTFQNLLSAEYVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANCILLARY PROTEIN 2
publication title Structural Model for the Covalent Adhesion of the Streptococcus Pyogenes Pilus Through a Thioester Bond.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 68
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.480 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4c0zA02
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0zA01
5A0LA 5A0GA 4BUGA 2XI9A 2XICA 4C0ZA 2XIDA 5A0DA
chains in the Genus database with same CATH superfamily
2RH2A 4N0AC 4MZMA 3S3OA 4EMKB 1AVZC 2GH1A 2QDYB 4M9GA 2W7OA 2XCAA 1ZQAA 1ZQTA 2E1EA 2DM1A 4M75B 4MDXA 2VB6A 5GAN3 2RF0A 1N63A 2DKGA 3QXGA 2ED1A 4UATA 4C0FA 4I27A 3JCMP 5GAOp 1C6VX 1R8OB 3HL8A 2MIOA 3HRUA 3MR3A 1N61A 4KLFA 4J7IA 2LJ0A 3MEAA 4RG2A 3S3MA 2HCKA 5GAOr 5TZVA 2M0NA 4RNMA 2AGQA 4C4SA 8ICFA 1UJ0A 4JUVA 3TFRA 3DEEA 5GAMh 4MHVA 5KT3A 2JXBA 4Q45A 1MHNA 2ZXIA 2M0OA 1E6HA 3EFSA 4WCIA 4FW2A 2I6XA 4JK1A 3CQTA 1L7NA 1V85A 2EAYA 1VUBA 2EQUA 3FB9A 4KT0E 4OO1J 1N27A 1ZQWA 5LJ5g 1NK5A 1Q7YR 4KLEA 2DZ9A 1URJA 2MUTA 3J81j 4FO6A 2KYBA 3I55T 4CC4B 2K3YA 8AT1B 1GRIA 3X20B 2R8KA 1YI2T 1F0MA 4MEXA 1NJIC 2OXOA 5AK6A 1ZUKA 4FL6A 1K8AR 2W43A 1B0XA 1FMVA 2EGAA 1K73U 4IL6U 2BE7D 2JJ9A 1KIKA 2LM1A 1VLBA 1PKTA 1EIFA 1NM7A 1SKSA 3QHSA 2OTLQ 1YP5A 3T5JA 2YUQA 1M2VB 1AWJA 1PSFA 5HMLA 2HSPA 3GILA 4AFZC 4RT3A 1KD1U 5KFLA 3CC7T 1VQ4T 1KQ2A 3HPOA 4C8QD 4ELYC 4Y2UA 5GANh 3S3NA 4EX7A 3ZL7C 1WHLA 1UGVA 2RQ5A 1YJWA 2P6UA 8ICSA 2A37A 2GQIA 3AL0B 1S1NA 2ESEA 1M1FA 1MUZA 2XG8D 3CCJA 2KZMA 1R77A 3CCET 1IXRA 4XRHA 2H3VA 1ZD3A 3B9JA 4GBQA 1IGUA 4MFFA 4MFAA 1LVKA 4GY5A 5FRNA 3ER0A 3CMAQ 2DBMA 1ZYQA 1KFZA 1YJNA 3IG8A 4M78A 3QEBZ 2J6UA 5AKXA 4IRCA 1I81A 2RQRA 2EPDA 3TFSA 4NM2A 1HXDA 1B7TA 3E2EA 2AKKA 3EFOA 2K7AA 2BR0A 2A19A 2JZBA 1TE2A 3G1JA 1BI3A 2LQNA 1QKXA 4KLHA 1UECA 2KVCA 2KNBB 5KYUA 4GFJA 3THVA 3PT9A 2EJFA 2B8AA 3JB9H 3CCMA 1YN8A 1WXUA 3L2WA 2KVSA 5KFEA 1W70A 2JXJA 4UAUA 1TWBA 1M90U 3G6EQ 1WHJA 1M3BA 1BCOA 4M75E 1P7DA 5DQGA 1VQKA 3WKCA 4DFJA 2R57A 1FIQA 3NVZA 2E10A 2G5IB 4QQGA 1B22A 3GNGA 4Q44A 2OWOA 4PHAA 4EX6A 4UBCA 5HMMA 1VQ7A 3LWIA 1D1CA 2ZJAA 7ICMA 1QCOA 2Y9TA 1QWFA 3QU2A 2FG0A 9ICBA 3OBYA 1DXSA 3UT1A 2H3IA 4E7SA 5L1JA 2JH1A 1LVHA 4IQTA 1W1FA 1Q82R 2DL8A 2KP7A 1KFDA 3PMNA 2D0QB 4ED0A 3VJPA 1VQ5Q 4OB1B 3UA7A 3MFHA 2M16A 5DM7R 3F2DA 2EGCA 2NYSA 3H0MB 3E1SA 5LJ5d 3RAXA 4Y2JA 3N7PD 4OMFB 3EZ5A 4IC9A 2WSCE 2QB1A 4I2JA 1UJYA 1SL1A 1Q8KA 2ALZA 2PQWA 4RTVA 3AUOA 1AD5A 4C7YA 2W8LA 3RR6A 1KFTA 3SDZA 4F4KA 3RMQA 1NJWA 3QZ5B 5KFBA 4M75C 1DGSA 3JPQA 4F5PA 2JW4A 3Q8SB 2Y4YA 4IUQA 3PX4A 4CF4A 2NRVA 3FRNA 4BACA 1ECWA 1D8YA 1VOMA 3G4SQ 1BK2A 3QIIA 3R6OA 4UB4A 4F7UB 2QQ9A 4Z6CA 3GF5A 4O3QA 2F5KA 2K6DA 4M7DF 3GBQA 3I56Q 1T3NA 1VIEA 2CSQA 5KFIA 1G8XA 1XSNA 4US8A 2E6ZA 1X66A 1RABB 2VV5A 4RKUE 2YWWA 4LZGA 2ECZA 1SGGA 2YUNA 2FPFA 1N2XA 5I2MA 3OYIA 1CSKA 3KBBA 2MA1A 3LVWA 4F5QA 9ICWA 1YWOA 2OTJT 2NUTA 2WF6A 1ZQDA 2E12A 1SSHA 2W0ZA 1WYGA 1I0CA 1WPYA 4C4TA 4YR3A 2M02A 2RK2A 4P2HA 4LD6A 2X9HA 3P8DA 4PJJA 3QDFA 5CKBA 5J0PA 1OW5A 3WU2U 5KG0A 2ZCFB 4DS4A 1VYUA 2F5TX 3RERA 4GIBA 3QPHA 1IRXA 3HJEA 4IQUA 1ZQCA 4QZHA 4TURA 2JNGA 1OQKA 5HK0A 1SKRA 1UHFA 1X42A 5CQXA 3OS1A 1S8OA 3H41A 2HHVA 5AM0A 4DF4A 2J6KA 2DE0X 4BUGA 5KYNA 4RQ6A 5FW9A 1BPDA 2RQUA 5A2QE 4HT8A 3PTAA 1S97A 1KSPA 1X27A 4JS4A 3SAGA 1PSEA 3ORYA 1KFSA 2ES6A 4BJQA 3C12A 1YITA 1QCKA 4FZNA 1GL5A 1PK1B 2JEJA 1X9WA 2RQVA 1WWUA 1YHQQ 2AZSA 5AM1A 3ZDAA 3EUB2 2K3BA 7ICRA 1WNLA 4E7ZA 3C28A 1RXVA 1LKYA 1VQ9A 4IR9A 3PW4A 1V97A 5KYWA 4JV1A 5CRXA 3OYBA 1YT3A 4OJOA 3L4PA 2HDOA 5J2JA 4F2SA 1GXIE 4ZH4A 3L2ZA 5AKEA 2FYKA 4JPBW 5GAOl 3QEAZ 3PSTA 3OSPA 5LJ5e 1BIBA 4JLIA 2Z7JA 4XTUA 2PU9B 2AGPA 3HTRA 1ZQJA 1WHMA 2DPJA 2E65A 2LMJA 1AQ6A 1J2NA 1KN5A 4C0GA 1K8AU 2W9BA 3NGPA 4OMPA 1J2MA 2RRDA 1GBQA 1KSWA 2GFAA 4QT7A 1N48A 4OJ6A 2M51A 4RTXA 5ALTA 2XIDA 2J6TA 2LPEA 1QCFA 3MDAA 1HUOA 7ICTA 2KEAA 2OCEA 1KBUA 3OA6A 1CUKA 1W2BS 3RBEA 4M7DA 1AT1B 7ICJA 3V8KA 4YXMA 1NK9A 3RJJA 2KSOB 1JRIA 3CNHA 2JVVA 5LJ5f 2F1LA 4JRIA 1NJIR 3EG3A 4EBEA 2X3WD 2ZIXB 2JTMA 4QQ6A 5AIAA 5CB1A 4F7UE 2RI5A 1GBRA 3CCSA 5CCAA 2EDUA 1B3QA 3QZ7A 1UB4A 3UMGA 1WXTA 1Q46A 3K75D 1VQ8Q 1X6BA 3X26B 1T94A 2F1JA 3PGGA 4F5RA 1N5WA 2DL3A 4Y2RA 1UA1A 1D3BA 3BJYA 5LJ3j 5CA7A 4MDWA 1DK3A 4OVAA 3RJEA 4K11A 4UAYA 4IQWA 4B9UA 3VRZA 2DD4A 3TU4K 2FPKA 5ALUA 2FZKB 2NUPB 4FT2A 2DBYA 4AG2C 3RJHA 3V6KA 3PMLA 4CC2A 1ZHIA 1PRMC 4KUIA 4XU0A 2A3VA 3ISBA 1RACB 1NBEB 2E6NA 4Z6FA 2ENMA 2DO3A 3UXNA 1ZA2B 2F1IA 5DB6A 2VXEA 2XCPA 5DBCA 2IOHA 1IM4A 3J81E 9ICFA 4P0QA 4LNPA 3WK9A 5BPCA 5JU5A 2L89A 1U45A 4C7ZA 2KVQG 1ZD2P 4YMNA 2DEQA 3OYCA 1YZ6A 3ISCA 4BD3A 1G3SA 3G6YA 2RHUA 4JJCA 3FJPA 4YCXA 5CKEA 1SPKA 3CMEQ 4C0ZA 3ZDCA 1RAFB 1K0XA 2W8KA 1XOVA 4J03A 3CMAT 4RZRA 5EWEA 4OMMA 3EGDA 4E2FB 2Y4XA 2JT4A 3ZI4A 5HR7A 3FEOA 3TSWA 4KX3A 4JWMA 1TU0B 5D7UA 2LZ6B 3CCLT 2HSEB 4IURA 2DNUA 3OQ5A 1YIJQ 1S72Q 1L7MA 2PVOB 2KXDA 2VASA 3G71A 2PZ1A 3M53A 1UCVA 3QU5A 4RPZA 1ZQBA 2LRQA 3JCMg 4QZ9A 1L3SA 1SEMA 2QEXA 4C5HA 2WAQF 3NTUA 5DG9A 3RB4A 5KG7A 2DFUA 4FM4B 3SEMA 1FYNA 4J9DA 1S0NA 3PVXA 1SKWA 4J9SA 4Z6EA 4PJOG 1X75C 1ZUUA 4DFDA 3BQ2A 1QQJA 4EBDA 2WF5A 1XJWB 4PZNA 5CWRA 3RJFA 2FPDA 4J9GA 4KGXB 1RADB 1MQ2A 2PFNA 1P92A 3CPWA 2ZJ5A 2C0IA 4C8QA 3SMVA 1VQPA 3GIIA 3I76A 4XQ8A 2HBPA 5LJ3d 1ZQZA 2ZZDA 4HA8A 4B9WA 2BCRA 4RNOA 2HHQA 2HKQB 3C2LA 3VCBA 3QUCA 2XGQA 4OB2B 2KK0A 1RAAB 8ICWA 1F1BB 3PW2A 1ZQVA 1VQ5T 2HHWA 1VQNT 4UASA 4Z02A 2J6OA 3OYDA 1JALA 1Q3VA 1T4GA 2A28A 2RMOA 5J0SA 4IUUA 2YB4A 3RJKA 2KIWA 3OSNA 2K57A 1U8RA 3Q8PB 2R5MA 4QZDA 3SV4A 5FROA 3K1RB 3F53A 3RRHA 1IIPA 5C0YA 2HNIA 2VGMA 1VQOQ 4N4HA 1CKBA 2QARA 2MWOA 4FIBA 1X2IA 1BI0A 3T3FA 1ZJMA 2A3LA 3TI0A 9ICKA 3VKIA 3PIPA 1MGQA 5J2CA 3PX0A 3MC1A 5GMKi 1AZGB 2A1JB 3UDCA 5GMKm 4K4IA 1AZEA 2A1AA 4KLIA 3B0YA 3H0IA 2IIMA 1JJ2A 1T3QA 4J9HA 1TG0A 1NEGA 4GXIA 3WKAA 2PVDB 1A6SA 1O9SA 4M7DC 2C28A 1D9DA 4YR0A 5KG3A 3OJUA 3KTQA 5D6YA 2COZA 1H92A 1VQMA 3DB4A 4C92G 3CCQA 2VWFA 3CBMA 1MMDA 2D1XA 2YXYA 2QB0B 3UMCA 1NPPA 5AI8A 1Z19A 8ICOA 5L9XA 8ICAA 4M77G 4D8DA 2DKZA 4C8NA 1IB8A 3C1YA 1QVFP 1SG5A 5GAN7 1K9AA 1ZLMA 2PMZC 4QNLA 5DQIA 2K5IA 3BS5A 2AQ0A 1FMWA 3JB9G 1YJ9Q 4ECUA 2F8KA 4QZAA 4DL7A 4PHPA 2ZTCA 3PE0A 4WJ3B 1AWOA 3CD6Q 5KE3A 3MEVA 2W55A 5T14A 4Q8FA 3CCVQ 4RTTA 4PFOA 4D8KA 3PSIA 3CYMA 4RUGA 4N0AA 2CT3A 5DKWA 3V8LA 4QZGA 4OB0B 2RM4A 4R66A 3JCMh 5L8RE 2E3IA 3RAQA 4WF2A 4DBFA 4J8OA 4OGCA 1B34A 1PUZA 3CC4A 4N4IA 2LYBA 1PVRA 2JTEA 1AWWA 4GLKA 9ICPA 4PFZA 1H3HA 2K9GA 4O5KA 1VYVA 4A4HA 3FLGA 2KQWA 2HW3A 2BDUA 1G3YA 1NI3A 1AHJB 1LOJA 2G07A 2KRSA 3CPWS 5A0LA 3HKSA 1TUCA 4QZFA 1X01A 4I2CA 4OMLA 1RI9A 2DIQA 3F5EA 3TACB 1NZBA 2E1HA 5C5JA 4QZCA 2GQVA 2I2LA 4DQRA 4UB8U 4RQ4A 5DY9A 3ZDBA 1Y96A 4G9BA 3BW1A 1D1BA 2JMCA 2R58A 5CP2A 5AKJA 4RQ8A 2FO0A 3SB2A 1LCKA 4V2SA 3C0CA 4J9MA 3VUBA 1R0CB 1SV4A 1PVPA 1PD0A 2J05A 3N5BB 3UXOA 3VYGA 1HUZA 4B9SA 3AN1A 1ZQRA 2H8HA 1WI7A 5AIBA 5KYYA 1MSWD 3FIFA 2MCNA 2HHUA 5AKHA 2BZ8A 4JZ4A 1TAUA 1JXEA 1ZQMA 2I5HA 3FC3A 1DGJA 4M75F 1M1KC 2ZJ8A 2YMLA 2CDTA 4ICAA 5EC7A 3BZKA 2C22A 2BZYA 3U23A 3ZBDA 2GTOA 2DTOA 3AU2A 1RAHB 2CP3A 4YMMA 3A8MB 1V9PA 4P0PB 1JJ2S 4PJOB 2YRVA 2DXTA 4NLCA 3OS0A 4NLGA 5GAN6 7ICLA 2IPOB 2ROTA 4PK4A 5IXBA 5AK5A 3QUTA 3LK9A 4JDSA 5ALVA 1ZETA 1M5Q1 5IAYA 3RUXA 4RT2A 2PUKB 5GMKh 3VS4A 3RF9A 2CZ1B 2MK5A 2DBKA 4O5VA 2XI9A 8ICZA 1U5SA 1TV9A 1IREB 4X9DA 2XGPA 3GIBA 5F9LA 1UEBA 4RPYA 4AYBC 2E8OA 2QQRA 5FU6B 4C8QC 2IG0A 3CCJQ 3TAQA 5GAN4 4ATOA 4DSLA 4X34A 3EYZA 2F69A 4A53A 5DB8A 1Z9ZA 1X69A 2OAWA 3OMCA 2DVEA 4KUDK 2YUPA 1ED1A 1QQ5A 5D49A 1NEBA 3NPFA 1QVGP 5ALYA 3K4GA 1KC8U 2RQTA 4AFUC 4YD1A 4DCCA 1WJSA 2O4XB 2HI0A 2KIVA 3BDUA 3V72A 4GLXA 1D8BA 1T3SA 2BZXA 5DB9A 2L3PA 4XTWA 5GAMj 2FL7A 4BE2A 1KL9A 3A8OB 8ICTA 2PFPA 3RDVA 1RLQC 4EMGA 1L3UA 2MF2A 3NHNA 2M9NA 2ZPEB 4I28A 5J2DA 5KAFU 2QXFA 3CCMQ 2LHTA 1OUQA 4NY8A 3RH4A 1XNSA 5IIMA 4F93B 2KRNA 4ECZA 4MZPA 4ESRA 2ZIVA 2GBQA 1QP2A 1KQ1A 2G3RA 5GANg 2EYZA 2ZPGB 4CE6A 5KG5A 1JXLA 1KTQA 4I2HA 3TEEA 3I55A 1VQ6Q 3T5LA 5G5HA 1JUDA 1U4BA 4M78G 3QDRB 1YI2A 4C92B 1QH9A 2O2OA 1VQ7Q 2EGEA 4YP3A 2FJ6A 3I1YA 3QE9Y 1SKUB 2K2MA 3O5ZA 2JTFA 2L2PA 4M77B 1EFNA 2RLTA 3GV7B 4JJNK 5EE3A 2O9VA 2HBJA 4DWIA 1X6IA 2XDPA 3GQCA 2JM8A 3CW2C 3L1AA 4M75A 2AXTU 5HP4A 2XKOC 1WFWA 4J9FA 3CC7A 3AMZA 3EHQA 1Z9QA 1VQ4A 1AROP 2RHZA 3PIOA 3CBPA 1ZBXA 1HEKA 3VV0A 3RR8A 4F17A 3JCMc 4NJ8A 4OF1A 2BTTA 5KFTA 1WX6A 1K1SA 1SWWA 2A08A 5ALIA 3KBGA 3RMSA 3X25B 4OJPA 4PHEA 4E7HA 3RNJA 2PTKA 4JJBA 1KQSP 2KEYA 3CCEA 2AZVA 1PG5B 1G83A 1K4US 2Y0SF 4DSJA 2GTJA 2KKVA 2RD1A 1ZD5A 2KI7A 3D7SB 3HSBA 3JB9J 2RN8A 5J26A 4CNQA 8ICRA 1ZSGA 4IUPA 1V1CA 3FAHA 3HFNA 2R8IA 2E3HA 2ZGWA 3OS5A 4ZGEB 1S0MA 1WYXA 4KX5A 3M58A 1M3AA 2F2WA 2HOIA 1Z00B 4FBUA 4USAA 3KKAC 2FLNA 1NOMA 1S10A 1L3VA 2DL7A 5GAMd 4HCBA 2ZUDA 2DF4B 2IHNA 5IIIA 3KZXA 3LDAA 1UA0A 2ZXHA 2BKDN 3SD4A 1N60A 1VQOT 4BWMA 4RG8A 1BNOA 3TARA 1S0OA 2IOFK 5B5EU 7ICFA 3M6ZA 1CEZA 1M2VA 2GCXA 3H8ZA 2QAZA 3FC4A 4DFKA 1ZSZB 3GP8A 1QW1A 2KJ8A 5IINA 1PM3A 2F1HA 5DQHA 1RAGB 2VA2A 1W6XA 2HOQA 4QZIA 4TUSA 1OPLA 2VJ4A 4PJNA 3CCUQ 3JCMW 2DERA 2HQEA 5LJ5j 2W3SA 3QZ9B 4IQVA 3RESA 4LDXA 3WK8A 2YTUA 4X9CA 3PO4A 1S77D 2W10A 3CXCP 1BYMA 2C06A 1XQHA 3LYSA 4FYWB 4ME7A 5E79U 1D0ZA 4U7CA 2W04A 3M0PA 1HYOA 5KYXA 2PXIA 3BQ0A 3PNWC 3Q8LA 4E47A 3J7AF 1BI1A 4E7KA 1B4FA 1COKA 5KFQA 4OJLA 1WJQA 3EGXB 1VQ9Q 4P4MA 4GC7A 5G5GA 2ASDA 4JB3A 3TAPA 5FU7B 2FMQA 2X3XD 1ZXIA 4C92E 5CKFA 3EG2A 3CCVT 1D8LA 1OX8A 1S5LU 1WUDA 2MUTB 2UVWA 4VUBA 8ICXA 2DXCA 1YWPA 2O01E 4XU1A 2KFZA 4PLLA 2K4EA 2JV3A 1SHGA 1TAQA 7ICNA 3META 2B6GA 1JQQA 2CN1A 1BPEA 2Q4TA 3MKDA 3PFSA 2NV3A 2DXBA 3MP6A 5IN1A 1OU8A 5EE0A 4CRXA 1BGXT 8ICKA 4J7FA 5KFAA 3QWXX 4JMUA 2OTJA 3NVVA 3M56A 4US9A 2JR5A 1QTMA 3NTKA 1KG1A 2FMPA 4DF8A 5ALMA 3QU4A 3JRZA 4BE1A 2HBKA 3Q8QB 5J2IA 2LX9A 2MPXC 2IVWA 1UGQB 3CRXA 1M1KR 2GFUA 1TK0A 1EXNA 3CCSQ 3VS2A 4DQSA 4C92C 2MMPA 2W9MA 3RIRA 2QQBA 4IR1A 2I9GA 4ECRA 4IRDA 3TQ7P 2D9TA 5GAMe 3OYNA 3UPQA 2ASJA 3RKYA 5M9OA 4DFPA 4EENA 4UC4A 5FWBA 3QUQA 1Y88A 5J0YA 2QI2A 1WZOA 2XY6A 4M78B 4MMLA 4BX9C 4DQIA 4F16A 2V1RA 3F70A 5KFDA 3IN5A 1N5XA 2DYBA 3OYMA 5AKIA 1KC8C 3PNCA 5J3BA 2JGAA 5AI5A 3H4DA 2EH9A 2JZBB 2E5KA 1JRPA 2KICA 2YRCA 5ECAA 3SYZA 3V7SA 4F7UA 4YXJA 2KE9A 1LJOA 1RYSA 3A5ZB 1FFUA 4QZEA 1BU1A 1JI7A 2BIVA 2DA9A 3L2UA 1SZPA 5DB7A 2YX8A 4Z88A 5GAMf 4J9LA 4EMKC 4R55A 2HSZA 4XTXA 1XWLA 1WWVA 4XQ3A 4UB2A 2D0NA 1KQQA 2L5QA 3SFMA 2QGGA 2P66A 4NL2A 2HVIA 2DFLA 2IMWP 3MHXA 2FPMA 2R8GA 4B9LA 5B66U 3CC2T 5FP0A 1NYFA 5GANe 5IIOA 1TK5A 4C8OA 4R56A 3PO5A 1BIAA 3I5SA 2YUOA 3M9QA 1BPXA 3HRTA 2GLEA 3HP9A 5KTQA 2K4PA 2Y9UA 4M7AD 3NMZC 2PMZF 2ATLA 2H3JA 4UBBA 1D09B 4YD2A 2HBWA 3QX7A 4KN7A 4RMOA 1K9MC 4QZ8A 4ZTJA 2FHDA 6AT1B 2LI6A 3GU3A 2W7PA 5ALWA 2XHCA 1H8KA 3OYYA 2AQ4A 1ZSZC 1ZQGA 3KXTA 5GANf 1M2OA 5IHKA 4PJOD 1R0BG 2XU8A 1KLNA 2QLTA 1PK1A 2KSSA 5EE1A 3KFVA 4KLQA 2KOBA 4ECXA 2EWNA 1ZJNA 4A4GA 1IHWA 1A0NB 4O3PA 1C1AA 1YNZA 3Q1JA 3URGA 1XC9A 3JCMb 1YBYA 1WCNA 5ALSA 3A0BU 2FPLA 3H8WA 4MF2A 7ICQA 4LDVA 5CR2A 3EHRA 3K1ZA 3RKWA 3C1ZA 1VQ6T 5ALJA 4ZN3A 4C5EA 1ARKA 2CKKA 2JZ2A 1Q86C 1KHCA 3LWMA 3RB0A 2BDPA 1NNLA 2ZPHB 2LMRA 1TAMA 4DSEA 1N5ZA 1Y71A 1NKCA 2NUTB 3JPTA 4OGEA 1VQPQ 4ELVA 1HSQA 4NLNA 4KH0B 3AQEA 1VQLQ 3OHAA 4ELTA 1K1QA 2WB1C 1WHHA 7ICHA 2JUFA 5J0OA 2M9UA 1UGPB 2GOLA 1L7PA 4KULA 4FS2A 1UPHA 5EOZA 3NRWA 4DOWA 5J39A 2BQ3A 4AT1B 3CCRQ 2KSOA 2QKQA 4OCZA 1WLPB 4U6PA 4FZLA 1L6NA 5GAN5 5GMKl 2I1QA 3HKZC 4EEKA 2W9CA 1NKEA 5J8YC 4YVZA 5D6XA 2YLCA 1JN3A 1AEYA 3CP8A 4QW9A 1M4ZA 2EYQA 3CMAA 2B86A 1RAEB 3HFOA 4J6XA 4R8UA 4XTVA 2XK0A 5CO7A 4A4EA 4C92D 4J6YA 3SEIA 1X40A 2MAMA 5FLXE 3CCLA 4M77D 2Y0SC 1WA7A 3I28A 2X4YA 2WFAA 2ZIWB 2LC4A 2KZZA 3UPUA 3JB9D 3AHUA 4K4HA 3LX7A 2D8JA 4GXJA 2LCCA 3ZEHA 1BCMA 1VQMQ 4BE0A 4AYBF 1ZQXA 5KAIU 1H641 2DJZA 3CCQQ 4C8QF 1G5VA 4DA4A 3A8HB 1X6OA 1UG1A 2NRWA 2OEHA 4AMCA 4PNOA 3MO8A 1IXDA 3PVLA 1OV3A 2DXUA 1IGQA 4DBHA 1TVAA 2EJ9A 3OMGA 5DG7A 4RUCA 2X4XA 3JSCA 5AI0A 3BDPA 1TUDA 2FVUA 3IQLA 4QQDA 4PJMA 5GAN8 5EE9A 3H9NA 3CCUT 4DSIA 3WKDA 9ICHA 5KFKA 2LJ1A 3UQ2A 1OYXA 3LVVA 3E9FA 1QVFA 1QP3A 1UTIA 1QQ6A 3L5KA 1L8OA 1QMCA 2OTLT 2CPRA 1M1KU 2W9AA 3SZ2A 3KHLA 1VQ5A 1ZQ1C 4C5GA 1VQNA 3H4BA 4F50A 1K1ZA 4IUTA 2YB1A 2E64A 4LUDA 5KCHA 4DL3A 1W2BP 2C0TA 5KFXA 1Y07A 4E7IA 4EYHB 4NOYA 5KFFA 9ICIA 4RCCA 1L8LA 1NJZA 3NFCA 2XY5A 3MGIA 1PVQA 2PKEA 2AT1B 2LBOA 1G2BA 2KBTA 1I1JA 2JOYA 3E19A 1CI4A 4AFQC 1ZQNA 2E3TA 1BB9A 2YSQA 4DBRA 2OAUA 2P0KA 5AK4A 4Y2QA 4J9NA 4B9XA 4KLOA 1MV0B 4BY6B 2O6KA 2OH2A 4UB5A 3AM9A 3C94A 4M7AG 1WG8A 4IRKA 4J5YA 2E5SA 3OHBA 1X9SA 4Y2SA 3JCMQ 3BE3A 5KFOA 2HHSA 4LDWA 2ZIUB 2WTFA 2FRYA 3QUBA 3RH5A 3M7DA 1OZ3A 2LT4A 3M54A 4JWNA 1KC8R 3MP1A 1NZPA 3O8VA 1ZQYA 1JROA 3KHRA 4K4GA 1BI2A 2F8LA 4KTQA 3G6ET 3ZDEA 3N7RC 4P0QB 3IP4B 4F3OA 2YDLA 3SAFA 1ZQKA 1XNIA 4BI3A 5I11A 4ELZC 1Z3EB 2UVVA 3A8GB 4EIKA 5C0MA 5CHGA 1SL0A 2C2DA 2KXCA 4C0DB 4TQSA 4F72A 2R5AA 2EAOA 3PW0A 3ISDA 3EG9B 2L3RA 4ED7A 4FSXA 2ZAEA 3OYKA 2EZZA 2LNVA 2HL5C 4Y28E 2HBLA 2XO7A 3MABA 8ICYA 1B07A 5F3XB 3EGDB 4CC3A 7ICSA 1NK4A 1XTDA 2K5FA 2PI5A 3I9QA 3UA6A 4FBTA 5AICA 4LVSA 2HD0A 2QK0A 3OSSC 8ICBA 1X2KA 9ICXA 1MNDA 2OI3A 3ICXA 3HRSA 3T79A 4B9TA 2JHDA 3BQTA 1GCQC 4OD0A 2A1JA 3HT3A 3GLXA 3N28A 4KLLA 5LJ3h 4J9QA 1K9MR 1FO4A 4F4XA 1QVFS 4KMUA 3KFUF 5KE2A 4PJ0U 3E9GA 4TUQA 3UQ0A 2JMGA 2R8JA 2P6RA 2LYHA 1UGSB 4JRQA 3G4ST 1UGRB 2H5XA 4J9KA 4PL6A 2WHEA 1X9MA 3UMBA 4Z8AA 2D8HA 5L1MA 2QB0A 4M47A 4QZBA 3I56T 5IH2A 4QJFB 5KFUA 1JBMA 1QVGA 1O08A 5KFCA 2COYA 3DB3A 2DWQA 2BKEA 4RQNA 2LQWA 4M78D 2YRDA 4HAIA 4O3OA 4UAVA 4PGYA 2BPFA 3TSZA 2OHFA 8ICCA 1MN8A 1MMGA 2ZPIB 4EEYA 2BPCA 4EPCA 3M8SA 2JEIA 1KW4A 2LTOA 4YQWA 3PR4A 2W54A 2X51A 2K4HA 3F2BA 5AM2A 2QA4Q 4Z6DA 3E58A 4QVDA 4FS1A 1Q86R 4E6RA 1YI2Q 1X43A 1TUGB 3C2KA 3R9KA 3QXEB 3OSVA 1KRPA 1IZ6A 4LN2A 4QWBA 4B9VA 1JEGA 4DEZA 4DOCA 1GFCA 5GMKj 2F77X 3ASKA 1N8RU 4CC7A 3SI8A 2HKNA 4KGZB 4QWDA 4DS5A 4BDZA 3UM9A 4KLSA 3VS1A 4FSSA 3HX0A 2RDJA 4BXOA 3M57A 4O6JA 4RQ0A 4UQGA 3QZ8A 1OPKA 4FYXB 2XC9A 4L59A 3CC7Q 4RQMA 3JCMd 3M1YA 1VQ4Q 3JPRA 4KRTA 3QYHB 1UDLA 1XO0A 2EIFA 1RAIB 5AKKA 8ICLA 4A4FA 4BI8B 1YHQT 2DAQA 1SL2A 2BCVA 1JB0E 2E41A 4RUAA 1FEZA 3HW8A 3JAME 3SQIA 3KKAA 2MWPA 4O3NA 1VQLT 4ECWA 3JPNA 5CAIA 4C92F 1PK3A 2NO5A 5JTIA 2ZG6A 5ALHA 1RG6A 2ESWA 3S6WA 1D0XA 4B6JA 2QTXA 3RRGA 3HP6A 3LW5E 2Z0WA 3WVEB 5AYFA 3BS5B 2FI1A 4DLGA 3GNFB 2OM6A 2A0FB 1KQSA 3CCRT 2M1HA 1QWEA 2LM4A 1F5SA 3TCJA 2AHOB 1C0MA 3F2CA 4DBQA 1FMKA 3SR6A 4OMQA 4I2FA 2E8PA 3BS7A 8ICQA 3ETLA 2VKQA 2AGOA 2CGHA 3EPGA 5DBAA 2EKHA 4M7AB 2EQYA 2DF6A 3L2RA 2CP5A 4ED8A 1M1GA 5HCKA 1Z1BA 2KRMA 1ZA1B 1MNEA 2QQSA 3KHHA 7ICEA 1QVGS 4ZTFA 5ALDA 5K4LA 2HHTA 1PCXA 3D2SA 2O88A 3J80E 1T7PA 1YIJA 4HKEA 1X6GA 3OYFA 3M0SA 1U1SA 5CK9A 2QTVA 2B21A 3T9NA 1VQ8T 3GV8B 4Y2PA 4ACOA 2AJQA 4LUEA 1CKAA 2GNCA 1UHCA 1G3TA 5L1IA 2PUOB 3BQ7A 7ICUA 2RQWA 1YJWQ 2E70A 4IS7A 2JM9A 2W03A 1E6GA 3WKEA 3OGUA 2I0NA 3MR6A 3CXCA 2K8CB 8ATCB 3M0RA 4I2EA 3SWNB 3WK5A 3NRZA 2EFIA 5DLQE 2NO4A 3FM9A 2UVUA 4F5OA 3AU6A 3PW7A 2HEQA 2HQXA 5J2EA 1YJNQ 5AKYA 3JCMe 3ME9A 4Y2VA 2CRXA 2M0YA 5KNIA 1XSPA 3NTIA 1TOVA 3FJ5A 3M4YA 4NLBA 1ABOA 4LD9K 2KV2A 4NV0A 3ONNA 4UAWA 3THKA 1SF9A 3C5FA 4M6WB 1D0YA 3M6KA 2CP6A 2ZUBA 2OTJQ 4C92A 5ALFA 3JCMJ 4AP9A 4BDPA 2JH7A 2FLLA 1RLPC 3CMET 2WSEE 4TVRA 2CP7A 1TFRA 1VQOA 3JCMf 2LDMA 2DRKA 1VQKQ 4C80A 2HHXA 2KYMA 1WDXA 3OY9A 2WB1F 1X2QA 2JS0A 1KQSS 4IKFA 4ECQA 3G6VA 2EJGA 3MGVA 1XSLA 5ALOA 4CGZA 1HK9A 2KGTA 2QDLA 2NWMA 4HVWA 2IOFA 1S72T 2HL3A 4HT9A 3OW2P 1K9MU 2KHQA 4KLJA 1N6AA 2CT4A 2GWSA 2IHMA 2H3EB 4EMKA 5GANj 8ICPA 3GOXA 4KH1B 4IIOA 3BDLA 4DL5A 1MV3A 3RTVA 5AT1B 4DEXA 3GV5B 3TREA 1TK8A 3HKZF 1DK2A 4EMHA 4B9NA 4M7AE 2R8HA 1UUEA 2J6SA 2RA2A 1BPZA 1SSFA 3X28B 5J29A 1L3TA 1ACMB 4F4ZA 3TADC 5H2FU 3O0FA 4I2IA 2C0OA 2D6FC 1Q81C 1WCLA 4Y2TA 3CCVA 2G09A 8ICVA 4EELA 4UB1A 4E0DA 3PMTA 4PJOE 4P5NA 2YHTA 3OPXA 1TTHB 5GMKe 2ZTDA 1I5OB 1Q86U 2F3NA 4F5NA 3RFAA 2MU2A 9ICVA 1U3OA 9ICLA 2RHYA 4L5GA 4DFMA 3QO3A 2CXYA 5ALPA 3H0FA 4A8EA 1NJXA 1K5OA 2CREA 2DMOA 5DLOA 2V8JA 3UATA 1MC8A 3KOOA 1JIHA 1ZSZA 4PKCC 5KFJA 7AT1B 3CXCS 2X4JA 5J0XA 3RR7A 1U49A 1JX4A 3D6JA 3Q8KA 5GTHU 4ANJA 1F44A 2AU0A 5DLFA 1HIWA 3SENA 2EYWA 4Q8EA 3PR5B 4UB6U 3ZD8A 2LJ3A 2DRMA 2JEGA 4WTOB 1RYRA 1N8RC 4M7AC 4DOVA 5HNKA 2CZ0B 4KN4A 2FMSA 3MGHA 2JEFA 9ICGA 4GLMA 3AEVA 4M0AA 2FPEA 4O9MA 2KHVA 3MP8A 5KFVA 2VJ5A 4DSFA 9ICTA 4E7JA 4RPXA 7ICPA 4OMOA 3PW5A 9ICNA 4QKUA 4F7UF 1TXQA 2E4HA 3DLLA 2K3XA 2LX7A 1Z4NA 5FWCA 4PJOC 4UARA 1SXEA 4MEYA 4M2YA 4R65A 1ZQSA 5KL1B 5JUMA 4RTZA 4ECSA 3EGXA 1ZQPA 1ZD4A 2D8CA 2Q0ZX 5A0DA 1GFDA 3PVQA 2PFOA 1X6JA 3G7ZA 3FDSA 3TQ1A 2EQJA 2XDDA 2EKOA 3H8JA 4NL9C 3OYJA 3OYHA 3P8BB 4KGVB 2F44A 2QA4T 2LVMA 2VKNA 1YITQ 1NZ9A 2K4YA 5KFPA 3LH0A 1WIEA 5FU6C 4KITB 3S6JA 5GANd 3QKJA 3WKBA 4M04A 1YJ9T 3OS2A 3C4SA 5J0RA 3H7IA 2LCLA 3SWNC 2G06A 2KMDA 9ATCB 5CKDA 3CD6T 4O5CA 2YQEA 1ZQIA 4F04B 3DKMA 1J97A 3L3FX 3CBOA 5KT2A 2BQRA 1S0VA 3IDWA 4J9PA 4M77E 4J6WA 1ZQEA 2JRZA 5J8YA 5KT5A 2ABLA 5HY6A 1B43A 9ICEA 3CC2A 5KG6A 1RL2A 4I2DA 3QYPA 3MJXA 1UT5A 2RHIA 5LL6S 1FXXA 3M4GA 2A7YA 2HMAA 1PRLC 2DKXA 2E8MA 4YMOA 2DLPA 2RI3A 1YZ7A 5KL8B 2BZFA 2KTQA 1BKBA 1Q95G 2MOXA 2P0PA 3A1PA 1YIJT 3GPLA 9ICJA 2ODGA 2CYZB 2V9WA 5KYXB 2QASA 3M0TA 2ZPBB 2D3DA 1NK7A 4BB7A 2RJCA 3LGFA 2BPGA 1D1AA 5J2KA 3CCLQ 2FDRA 9ICCA 4XUSA 3RB3A 2LQKA 3MEWA 4J9IA 3FYHA 8ICGA 3PZPA 4M77C 2K8BB 1PZNA 4FFDA 1WHKA 3ZFJA 4IUVA 2L8DA 1ZUYA 2KT1A 1NPRA 2G0AA 2DJQA 2EW3A 3OYAA 4J83A 2DQNB 2PNIA 3LYIA 2CS7A 2E8NA 1RPLA 5ALEA 1ZQQA 4G3IA 1W4SA 2AKLA 4M9LA 2L3QA 3KD3A 2BQUA 3EAEA 3I35A 3EFOB 4XK8E 4JRKA 2KD1A 5CEHA 5KFSA 2QGFB 2XD0A 1VQ6A 3EW9A 4KLMA 3ED5A 3MCAB 4M7DG 2E1FA 3NUQA 2K2VA 5KYUB 3PMIA 1ZQHA 4FZMA 1N9SA 4OB3B 1ZQ1A 4NLKA 1ZRMA 2W11A 3KHGA 2KK4A 3EWAA 2EVRA 2LQ8A 4QVCA 2KKPA 2K79A 1KHIA 1M8MA 4QW8A 3VS3A 4RNNA 1A0PA 4ED3A 2AIRB 1T0HA 3LWLA 1NYGA 1RQNA 2DGZA 4C8LA 1M6YA 2BUDA 5CR0A 2BGWA 1VQNQ 1J3TA 5LJ5h 2RJEA 4IIMA 2L5YA 3TKAA 8ICJA 1YJWT 3QSUA 1DJ7B 2GGRA 3NS1A 1WHGA 2Y1IA 4Y92A 1WQWA 1PWTA 3CCJT 4A63B 3PY8A 4I2GA 5HK3A 5HR6A 3VS0A 2X35A 1TSFA 1WGSA 1N62A 2E5QA 3I5RA 3WK4A 3C95A 2CP2A 3EG1A 1TH7A 2LYAA 1PC0A 1W2BA 3BY7A 1YJNT 5KG1A 2DIGA 2VYTA 1I4K1 2C2RA 1NK0A 4BWJA 4YFKA 3H0LB 1NE8A 4QIWC 2G6FX 2J06A 4KMOB 4Y91A 3N97B 2RPNA 3QU9A 1ZQFA 3NVWA 3MR2A 4NXZA 3NVYA 1O75A 2RJFA 5A0GA 2P0QA 2DTHA 3G71Q 4F4WA 5KT7A 4NLZA 4PZOA 2WSFE 4LE9A 5AKZA 3CCMT 3RBBB 1SV0A 2VIXA 5KT4A 4PFPA 4HXJA 4PLIA 2QEXQ 4XU3A 2BCSA 3M8RA 3MFIA 1EX4A 3Q8RB 2L0AA 3AT1B 3JV3A 1DOQA 5L1LA 2DPIA 1Y7XA 2EANA 2Y1JA 4F2RA 1VQKT 2G08A 3U26A 3GIJA 5D6WA 3RBDA 2IA6A 2BHNA 3C21A 1OU9A 1I8FA 2FE9A 1ZQLA 4J9BA 4OMNA 2K4IA 3V7JA 4CI0C 4LJXA 3V7LA 1PD1A 2GO7A 3OYLA 5FU7C 2J6FA 1VQ7T 9ICSA 3IHQB 5J0QA 2O9SA 5GAN2 4RQ5A 3CCUA 1Q81R 3EH2A 2AHJB 5C6SA 4QWEA 3D2NA 1GCQA 7ICOA 3EFRA 1WXBA 5TISU 4O3RA 2OTLA 1V38A 5HHHA 2NRZA 4DL4A 4ELUA 2YLBA 4YR2A 1JXMA 4M78E 5AI4A 2F2VA 1JXOA 2HCFA 2UVRA 8ICHA 2DEUA 2F2XA 7ICVA 2H3QA 2RJDA 4EBCA 2ATCB 3H0HA 2EQMA 2ZIXA 1Q3UA 1RM6C 4YG2A 1NJYA 2A36A 4II1A 2P4RA 3IM1A 2KJ5A 2ZIWA 3M55A 1N8RR 3BQ1A 2XICA 4DOBA 3MDCA 1Y0MA 5AM3A 5AI9A 1Q7YU 1DRGA 4QWAA 5BOMA 1MQ3A 3TVTA 4C8QG 4F14A 5GAOq 3BFMA 2F2AB 5ALRA 5BOLA 3V8JA 2KZ3A 1GO3F 2LNHB 5GJVB 1QQ7A 3MEUA 3VU3C 3M5AA 4O3SA 2DL0A 4JS5A 2MAXA 2V26A 4Q5WA 1IHVA 1LKYB 4DL6A 4B9MA 5KYWB 5CQYA 5JRTA 1KK7A 8ICMA 3B0XA 1M3CA 2NUPA 1K73C 4M78C 3TANA 4DO9A 3PV8A 2ED0A 1JMSA 2VANA 2MYSA 5GAOn 3L2VA 2LT1A 2AH5A 2N1RA 3JPOA 2V4RA 1K0SA 4JV2A 1QLNA 5F9NA 3H40A 1BNPA 2V8IA 3EGUA 3WVDB 9ICRA 2W9BB 3G6EA 1FX7A 2LCSA 2FZCB 4FU6A 3JPSA 3N4MB 1CRXA 4YTLA 1KD1C 4F92B 3C29A 4I2BA 2XY7A 5LJ3g 3DLMA 1SXDA 2YMPA 2W9CB 1C7YA 1IV8A 4E7LA 4P4PA 3H6ZA 3RB6A 4I2AA 5DDMA 1OX9A 2HQHA 4L6V5 4M7DB 1U48A 4PPXA 1N9RA 2RHFA 3HILA 4M9NA 4ZGJB 2EYXA 3C2MA 1NG2A 3DV9A 4R8UB 1T0JA 5DLGA 3EH1A 5IT9E 5DDYA 3CC4Q 1YITT 4R0KA 2XDBA 3OYGA 2DL5A 5AM4A 5IHIA 4Q43A 2KE7A 4HVUA 1XS9D 1QLYA 3AQFA 1RZTA 4M75D 2COWA 2JS2A 5KFHA 1VQ9T 5DGBA 2P4TA 1BPBA 4KLTA 4LDUA 4HCZA 2XVTA 2PFQA 5CVIA 2ZIUA 1JO8A 4CDGA 5CKHA 2CUBA 3P8HA 1D3BB 2P84A 4ZGDB 3G4SA 1UE9A 4ZNXA 4GC6A 5IHNA 1VDVA 2W3RA 3RJIA 1AOJA 1Y57A 3WXMB 1OEBA 1M90C 2KNJA 2CZ6B 3I56A 5HHIA 1YCSB 3LGLA 4F71A 1SIJA 2HMXA 2K5LA 4DOAA 1M30A 3V6HA 4A54A 1V76A 1MA7A 1LB2B 3QYGB 4ECVA 5ALZA 5EG2A 2ZUCA 3HHTB 4X5VA 3EG9A 2LP5A 1Q82U 4NM1A 1I5LA 1MMNA 4FYVB 2NRXA 4FW1A 3UXPA 5KFMA 5EWGA 2CP0A 9ICQA 4XTZA 1XO1A 3DDHA 4I29A 4PL2A 5KT6A 1TS9A 1M27C 1E7OA 3WK6A 1S76D 1T3LA 1C20A 2L3SA 4RTWA 3REBB 3CCST 4C8KA 1UHUA 1SV0C 4DQPA 1V29B 3MPUB 4BI4A 4F4YA 1ABQA 3GFKB 4R64A 2DD5A 4PGQA 4F8RA 2VGNA 3V7RA 2CUDA 4AG1C 4XA5A 4RU9A 4M9JA 2X4WA 3M0UA 4OJ5A 1QSLA 1OI1A 3GZFA 4C8MA 3UF4A 3JB9I 3M9OB 1LPLA 4OP0A 4M7AF 2ISOA 2KJ9A 3QNMA 4DEYA 2DVJA 5AKGA 2RNAA 3QG1A 1A76A 1KKXA 1YHQA 4GXKA 1ZRNA 4YN4A 2P35A 5L1KA 1RUWA 4PH5A 3VC8A 9ICOA 4HVVA 1K76A 2VC8A 1VQLA 4JLGA 2DYIA 2HBMA 2EAPA 1PHTA 4RQ1A 3INZA 4Y2XA 2RI2A 1OOTA 1O03A 2NRTA 2KY9A 4PJOF 3Q8MA 4M7DE 4RCBA 4JUZA 1BVSA 5KFRA 1KJWA 3JPPA 2RDIA 2EQIA 3HPWA 2EZYA 4MF8A 5IXFA 1WQ7A 4AFSC 4BDYA 4D6WA 4PGXA 4CCHA 2RHXA 3CCRA 1SWVA 5KFGA 2SEMA 5D46A 3A8LB 4ORZA 4RQ2A 1KEJA 3ZDDA 2R18A 4C8QB 3SV3A 4JRPA 1Q81U 3JCMX 4NL3A 3V7CA 3GDXA 3VS6A 1Z4OA 3FDRA 1A77A 4XTYA 3H8MA 3IG5A 5GAOm 5KFWA 4ED6A 3I55Q 4B6MA 3RH6A 7ICKA 2DL4A 3EG0A 1G3WA 2CSIA 2ASLA 3VS7A 2NUZA 2KMTA 3NTHA 4ECTA 2MSNA 4ED1A 1HJDA 4MMKA 2OJ2A 8ICNA 2CH4A 2EYYA 3HWTA 4QW2A 3D2QA 4ECYA 2WF7A 2BCQA 2CZ7B 3G71T 5GTIU 2OYYA 2QARB 3E2UA 5IILA 3TADA 2O31A 4X1VA 2QEXT 1KDHA 3JCMV 4FE3A 1COOA 1AWXA 2KG5A 1U1TA 2FZGB 1OZ2A 1VQ8A 5FRMA 8ICEA 1Q7YC 2VA8A 5AI6A 2D6FA 2EAMA 2MI6A 7ICIA 3OW2A 1SHFA 4JV0A 2KN7A 3MR5A 4O5EA 3NGDA 3NASA 2VVKA 8ICIA 5J2GA 3GIMA 5J2FA 2QYZA 1FWZA 2IBKA 1VIFA 2ZPFB 1K8AC 3UWNA 2YMMA 3CCEQ 1VQPT 5KFYA 4UW9A 4RQ3A 4KLGA 2QG9B 4CF3A 5KFNA 1OULA 2RB6A 3ZD9A 2RK1A 1BPYA 3T5KA 1TKDA 1VA7A 5KG4A 4PL1A 1T8EA 1M8VA 1ZX6A 4M77F 1SRMA 4J9RA 1N56A 4M7AA 2KFNA 1NJIU 4LXCA 1ZQOA 1PKSA 4ZOHC 4BY6C 3JB9F 1SB3C 4M75G 2FLPA 2HZYA 9ICUA 5DBBA 1S9FA 5DG8A 5ALNA 5J0TA 3QJYA 3ETRA 3M9NB 1EZZB 1K73R 5AM5A 3OB9A 5LJ3e 4BXOB 4P4OA 3QUIA 4FCYA 4P0PA 2RO0A 3OYEA 5ALKA 2DZCA 2JMAA 2KR3A 4PJOA 1L7OA 3PSPA 5I2SA 4EZ9A 4CRIA 3CMEA 4Y2YA 4PJLA 1OXJA 2HOFA 4LZDA 1B34B 3RKXA 3ALRA 8ICUA 4EDUA 4O0IA 4NWIA 3ULRB 1KD1R 4NL9A 3OJSA 2G5HB 3T5HA 4KLUA 3KUFA 3N7SC 4C0DC 1YFNA 1RI0A 4R63A 4MFCA 2NLUA 3F5AA 1VYTA 2VA3A 3EPIA 1S72A 1QVPA 5LJ3f 4A4KA 2YN4A 2DK3A 3SWNA 4C8QE 1ZOLA 1QKWA 1VQMT 2GF7A 3CCQT 1NLPC 1IO6A 2FB7A 4M4ZA 1NK6A 2DPPB 3CPWP 3V7KA 2O4XA 1HJPA 2PVGB 1L5UA 2KROA 3H0RB 1Y96B 4RTYA 4FT4A 4XU2A 2C2EA 4KLDA 1PNJA 3VRYA 5EWFA 2XMFA 3X24B 4HYKA 3A98A 3QWYA 9ICAA 1JU5C 4O3MA 1LNXA 2H3ZA 3HRDD 2QQAA 1RQLA 2DX1A 4M6WA 5CIUA 4QWCA 4ED2A 1ZQUA 2EZXA 4QIWF 1ZBJA 5I21A 5ALXA 1RYUA 5KYYB 1QSSA 2H3FA 2K8AA 4UAZA 2VUBA 2F76X 2ROLA 2V4QA 1H38A 4JZ3A 3SHWA 2PI4A 3CC2Q 1Q82C 1LV5A 4HCCA 3QU7A 3KZIU 1NKBA 4HCKA 1M90R 4J9OA 5ALQA 1U06A 3CC4T 3OW2S 2ISPA 5GAMg 5HKCA 5AKLA 1GCPA 2JN0A 3OBWA 1MMAA 4F91B 5GJWB 1UQVA 5J0UA 3LH5A 4EYIB 5KG2A 3CEYA 3GIKA 2Y90A 2MRLA 4DLEA 1FFVA 2WF8A 4M9HA 2HDAA 5KH6A 1RXWA 1M9SA 4M77A 9ICMA 2LKYA 5ALLA 2NYVA 3SD7A 2J7IA 5CJ7A 1JJ2P 4RQ7A 3OTQA 3VYHB 4N4GA 4UB3A 2DILA 3MBYA 2K89A 3CPFA 5AK3A 1QSYA 3VS5A 4BGDA 4QVZA 2EQKA 2FEIA 4KBMB 7ICGA 1RDFA 1U9LA 4M7DD 2K60A 3QJ6A 2WF9A 1IG6A 1UT8A 1VJ5A 4DL2A 3G6XA 3C5GA 1X9XA 3IRUA 3PSFA 2KAFA 5D4BA 2SRCA 3M9MB 5AHXA 5KCOA 2BCUA 4DQQA 5L23A 4EZ6A 1BBZA 2VXFA 2HAXA 4J9EA 2YMQA 4PHDA 1Z1VA 5KFZA 2KT8A 2EBPA 4TUPA 2V1QA 4LDYA 3V6JA 2HVHA 1SRLA 2BE9B 4J9CA 4RTUA 5I22A 2B0CA 2ZTEA 2WACA 1NK8A 2DTIA 2QA4A 4DQ2A 3VUZA 3E0FA 1UFFA 2YT6A 2CH4W 2DUYA 4DSKA 4JJDA 1YJ9A 2DETA 4C4RA 3H8SA 3SAHA 1Z00A 4FYYB 3L42A 3M59A 3CD6A 2V8KA 3IV6A 5IIJA 3WK7A 3RJGA 1I07A 2ZIVB 1WJRA 1SZHA 1YCYA 1XU4A 4C5IA 2RP5A 5J2AA 1H3ZA 3R6NA 4MZTA 3A0HU 4Z89A 4NS5A 2YY6A 5J2BA 5J2HA 4ZN1A 3REAB 3PX6A 4M78F 5ALGA 3BZCA 1U47A 4CF5A 2OX7A 4TQRA 2FRWA 3QBYA 3LWHA 5J0WA 1NLOC 1QCNA 2KDSA 2AK5A 5DGAA 1D9FA 4XAXB 3LLRA 3L2QA 2WAQC 5IIKA 4F7UG 3C23A 3M0QA 1HD3A
chains in the Genus database with same CATH topology
2RH2A 4N0AC 4MZMA 3S3OA 4EMKB 2GH1A 2QDYB 2W7OA 4M75B 2E1EA 4MDXA 5GAN3 2DKGA 4C0FA 3JCMP 5GAOp 1R8OB 3HL8A 3HRUA 4J7IA 3S3MA 3MEAA 4RG2A 5GAOr 2M0NA 4JUVA 3DEEA 5GAMh 2M0OA 1MHNA 2ZXIA 3EFSA 2EQUA 3FB9A 2EAYA 1VUBA 4KT0E 4OO1J 1N27A 5LJ5g 2DZ9A 1URJA 3I55T 2K3YA 3X20B 1YI2T 1NJIC 2OXOA 4FL6A 1K73U 1EIFA 3QHSA 1PSFA 1KD1U 3CC7T 1KQ2A 1VQ4T 4C8QD 4ELYC 5GANh 3S3NA 1YJWA 3AL0B 1M1FA 3CCJA 2XG8D 3CCET 2H3VA 4GY5A 5FRNA 3ER0A 1YJNA 3IG8A 4M78A 1I81A 1HXDA 1BI3A 2KVCA 4GFJA 2EJFA 2B8AA 3JB9H 3CCMA 3L2WA 1M90U 4M75E 1P7DA 1VQKA 2R57A 2E10A 2G5IB 4QQGA 3GNGA 1VQ7A 3LWIA 3PT9A 3OBYA 3UT1A 2H3IA 2JH1A 2D0QB 3VJPA 4OB1B 2M16A 5DM7R 3F2DA 3H0MB 3E1SA 5LJ5d 3N7PD 4OMFB 4IC9A 2WSCE 2PQWA 3SDZA 3RMQA 3QZ5B 4M75C 4IUQA 2Y4YA 3FRNA 4BACA 1ECWA 3QIIA 3R6OA 4F7UB 2QQ9A 3GF5A 2F5KA 4M7DF 1VIEA 2E6ZA 2VV5A 4RKUE 5I2MA 3OYIA 2MA1A 3LVWA 2OTJT 2E12A 2RK2A 1WPYA 4LD6A 3P8DA 5CKBA 2ZCFB 3RERA 2F5TX 3QPHA 2JNGA 5HK0A 5CQXA 3OS1A 4BUGA 4HT8A 5A2QE 3PTAA 4JS4A 3SAGA 1PSEA 4BJQA 3C12A 1YITA 4FZNA 1WNLA 3C28A 1VQ9A 3OYBA 5CRXA 1YT3A 4OJOA 1GXIE 3L2ZA 2FYKA 5GAOl 3PSTA 5LJ5e 1BIBA 4JLIA 2Z7JA 4XTUA 2PU9B 2E65A 4C0GA 1K8AU 2RRDA 2GFAA 4OJ6A 2XIDA 3OA6A 1KBUA 1W2BS 4M7DA 3V8KA 1JRIA 2JVVA 5LJ5f 4JRIA 2ZIXB 2JTMA 4QQ6A 4F7UE 2RI5A 3CCSA 5CCAA 1UB4A 3X26B 1T94A 3PGGA 1D3BA 5LJ3j 4MDWA 4OVAA 2DD4A 3TU4K 4FT2A 1ZHIA 4KUIA 4XU0A 2A3VA 2E6NA 2DO3A 2VXEA 3J81E 4P0QA 2L89A 2KVQG 2DEQA 3OYCA 4BD3A 1G3SA 2RHUA 3FJPA 5CKEA 4C0ZA 1XOVA 3CMAT 2Y4XA 5HR7A 3FEOA 4KX3A 3CCLT 4IURA 3OQ5A 2PVOB 3G71A 3M53A 2LRQA 3JCMg 2QEXA 4R56A 2WAQF 4FM4B 4C5HA 4PJOG 1X75C 1P92A 3CPWA 4C8QA 3SMVA 1VQPA 2HBPA 5LJ3d 2ZZDA 4B9WA 4HA8A 3VCBA 4OB2B 1VQ5T 1VQNT 4Z02A 3OYDA 1Q3VA 4IUUA 2YB4A 2KIWA 2K57A 1U8RA 2R5MA 5FROA 3F53A 1IIPA 5C0YA 2HNIA 2VGMA 4N4HA 2MWOA 4FIBA 1BI0A 2A3LA 3VKIA 3PIPA 1MGQA 5GMKi 3UDCA 5GMKm 1JJ2A 2PVDB 1A6SA 1O9SA 4M7DC 5D6YA 1VQMA 3DB4A 4C92G 3CCQA 3CBMA 1NPPA 4M77G 1Z19A 5GAN7 2PMZC 4QNLA 2K5IA 3JB9G 4WJ3B 5KE3A 3MEVA 5T14A 3PSIA 3CYMA 4N0AA 3V8LA 4OB0B 2RM4A 3JCMh 5L8RE 4WF2A 4J8OA 4OGCA 1B34A 3CC4A 4N4IA 2LYBA 1PVRA 4GLKA 4A4HA 3FLGA 2KQWA 2BDUA 1G3YA 1AHJB 1LOJA 2G07A 3CPWS 5A0LA 3HKSA 1X01A 2DIQA 3F5EA 1NZBA 2E1HA 2GQVA 2I2LA 5DY9A 1Y96A 3BW1A 2R58A 3SB2A 4V2SA 3VUBA 1PVPA 3N5BB 3VYGA 3FIFA 3FC3A 4M75F 1M1KC 4ICAA 3ZBDA 2DTOA 3A8MB 4P0PB 1JJ2S 4PJOB 2YRVA 2DXTA 4NLCA 3OS0A 5GAN6 4JDSA 1M5Q1 5IAYA 3RUXA 2PUKB 5GMKh 3RF9A 2CZ1B 4O5VA 2XI9A 4X9DA 1IREB 3GIBA 1UEBA 4AYBC 2QQRA 5FU6B 4C8QC 2IG0A 4ATOA 5GAN4 4X34A 2F69A 4A53A 3OMCA 2DVEA 4KUDK 1ED1A 1KC8U 2O4XB 1WJSA 3BDUA 1D8BA 5GAMj 4BE2A 4XTWA 2FL7A 3A8OB 4EMGA 2MF2A 2ZPEB 2QXFA 2LHTA 1OUQA 1XNSA 4MZPA 2ZIVA 1QP2A 1KQ1A 2G3RA 5GANg 2ZPGB 3TEEA 3I55A 4M78G 3QDRB 1YI2A 4C92B 1YIJT 2JTFA 4M77B 4JJNK 2HBJA 2XDPA 3L1AA 4M75A 2XKOC 3CC7A 1VQ4A 2RHZA 3PIOA 3CBPA 1ZBXA 1HEKA 3VV0A 3JCMc 4OF1A 3KBGA 3X25B 3RMSA 4OJPA 4E7HA 2KEYA 3CCEA 2Y0SF 2KKVA 2RD1A 3HSBA 3JB9J 5J26A 4IUPA 3HFNA 2ZGWA 3OS5A 4ZGEB 4KX5A 3M58A 2HOIA 5GAMd 4HCBA 2DF4B 3KZXA 3SD4A 2ZXHA 2BKDN 1VQOT 4RG8A 3M6ZA 2GCXA 3H8ZA 3GP8A 1QW1A 2KJ8A 2HOQA 2VJ4A 3JCMW 2HQEA 5LJ5j 3QZ9B 3RESA 4LDXA 4X9CA 1BYMA 2C06A 1XQHA 3LYSA 4ME7A 4U7CA 2W04A 3PNWC 4E47A 3J7AF 1BI1A 4E7KA 4OJLA 1WJQA 5FU7B 4C92E 5CKFA 3CCVT 4VUBA 1WUDA 2DXCA 2O01E 4XU1A 4PLLA 2K4EA 3META 2CN1A 2Q4TA 3PFSA 2NV3A 2DXBA 3MP6A 5IN1A 4CRXA 4J7FA 4JMUA 2OTJA 3M56A 1KG1A 3NTKA 3JRZA 4BE1A 2HBKA 2LX9A 2IVWA 1UGQB 3CRXA 2GFUA 4C92C 2MMPA 3RIRA 2QQBA 2D9TA 5GAMe 3OYNA 3RKYA 5M9OA 4UC4A 2QI2A 4M78B 4MMLA 4BX9C 3F70A 3IN5A 3OYMA 1KC8C 5J3BA 2JGAA 2KICA 3V7SA 4F7UA 1LJOA 3A5ZB 2BIVA 3L2UA 2YX8A 5GAMf 4R55A 4EMKC 4XTXA 4XQ3A 2L5QA 3SFMA 4NL2A 3MHXA 3CC2T 5GANe 1BIAA 3M9QA 3HRTA 3HP9A 4M7AD 2PMZF 2H3JA 1K9MC 4RMOA 4ZTJA 2FHDA 3GU3A 2W7PA 2XHCA 3OYYA 3KXTA 5GANf 4PJOD 2XU8A 2KSSA 2KOBA 2EWNA 4A4GA 3Q1JA 3URGA 3JCMb 1YBYA 4LDVA 5CR2A 3K1ZA 3RKWA 1VQ6T 4ZN3A 4C5EA 2CKKA 2JZ2A 1Q86C 1KHCA 2ZPHB 1TAMA 1Y71A 4OGEA 3AQEA 2WB1C 2JUFA 2M9UA 1UGPB 2GOLA 4KULA 1UPHA 3NRWA 4DOWA 5J39A 4U6PA 4FZLA 1L6NA 5GAN5 5GMKl 3HKZC 5D6XA 2YLCA 3CP8A 1M4ZA 2EYQA 3CMAA 3HFOA 4C92D 4A4EA 4J6XA 2XK0A 4XTVA 5CO7A 4J6YA 2MAMA 5FLXE 3CCLA 4M77D 2Y0SC 2X4YA 2ZIWB 2LC4A 3UPUA 3JB9D 3AHUA 3LX7A 2LCCA 3ZEHA 4BE0A 4AYBF 1H641 2DJZA 4C8QF 1G5VA 4DA4A 3A8HB 1X6OA 4PNOA 3MO8A 2DXUA 2EJ9A 3OMGA 2X4XA 3JSCA 2FVUA 4QQDA 5GAN8 3CCUT 1OYXA 3LVVA 3E9FA 1QVFA 1QP3A 2OTLT 2CPRA 1M1KU 1VQ5A 1ZQ1C 4C5GA 1VQNA 4IUTA 2YB1A 2E64A 5KCHA 1Y07A 4E7IA 4NOYA 4RCCA 3NFCA 1PVQA 2LBOA 3E19A 2JOYA 2OAUA 2P0KA 4B9XA 4BY6B 2OH2A 3C94A 4M7AG 4J5YA 2E5SA 3JCMQ 4LDWA 2ZIUB 3M7DA 1OZ3A 2LT4A 3M54A 3MP1A 3O8VA 1BI2A 2F8LA 3G6ET 3N7RC 4P0QB 3IP4B 3SAFA 1XNIA 4BI3A 4ELZC 3A8GB 5C0MA 4C0DB 2R5AA 2L3RA 4FSXA 3OYKA 2LNVA 4Y28E 2HBLA 1XTDA 2K5FA 2HD0A 3OSSC 3HRSA 3ICXA 3T79A 2JHDA 3GLXA 5LJ3h 1QVFS 3KFUF 5KE2A 3E9GA 1UGSB 2JMGA 4JRQA 3G4ST 1UGRB 4PL6A 3I56T 4QJFB 1JBMA 1QVGA 3DB3A 4M78D 2ZPIB 4EPCA 2LTOA 2K4HA 3F2BA 4QVDA 3QXEB 3OSVA 1IZ6A 5GMKj 2F77X 3ASKA 1N8RU 4BDZA 3M57A 4O6JA 4L59A 3JCMd 3QYHB 1XO0A 2EIFA 4A4FA 4BI8B 1YHQT 2DAQA 1JB0E 2E41A 3JAME 3SQIA 1VQLT 2MWPA 5CAIA 4C92F 2ZG6A 3S6WA 2QTXA 3LW5E 3WVEB 5AYFA 3GNFB 2OM6A 1KQSA 3CCRT 2M1HA 3TCJA 3F2CA 2CGHA 2VKQA 4M7AB 3L2RA 1M1GA 1Z1BA 2QQSA 1QVGS 4ZTFA 3D2SA 3J80E 1YIJA 4HKEA 3OYFA 1U1SA 5CK9A 3T9NA 1VQ8T 4ACOA 1G3TA 2PUOB 2E70A 2W03A 3CXCA 2K8CB 3SWNB 2EFIA 5DLQE 2HQXA 3JCMe 3ME9A 2CRXA 3NTIA 3M4YA 4LD9K 4NLBA 2KV2A 4NV0A 3ONNA 3M6KA 4C92A 3JCMJ 2JH7A 3CMET 2WSEE 4TVRA 1VQOA 3JCMf 2LDMA 3OY9A 2WB1F 1KQSS 4IKFA 2EJGA 3MGVA 4CGZA 1HK9A 4HT9A 1S72T 1K9MU 2KHQA 1N6AA 5GANj 4EMKA 3GOXA 3BDLA 3TREA 3HKZF 4EMHA 4M7AE 2RA2A 1SSFA 3X28B 3O0FA 2D6FC 1Q81C 3CCVA 2G09A 3PMTA 4PJOE 4P5NA 2YHTA 3OPXA 5GMKe 1Q86U 3RFAA 2RHYA 4L5GA 3QO3A 4A8EA 5DLOA 2V8JA 3CXCS 4PKCC 2X4JA 1F44A 1HIWA 1N8RC 4M7AC 4DOVA 2CZ0B 3MP8A 2KHVA 2VJ5A 4E7JA 4F7UF 3DLLA 2K3XA 4PJOC 5KL1B 5A0DA 3G7ZA 2EQJA 2XDDA 2EKOA 3OYJA 3OYHA 3P8BB 2QA4T 2LVMA 1NZ9A 2K4YA 3LH0A 5FU6C 5GANd 3QKJA 1YJ9T 3OS2A 3C4SA 2LCLA 3SWNC 2G06A 5CKDA 3CD6T 3DKMA 3CBOA 3L3FX 4M77E 4J6WA 5HY6A 3CC2A 1RL2A 2RHIA 5LL6S 1FXXA 3M4GA 2A7YA 2RI3A 1BKBA 5KL8B 2P0PA 3GPLA 2CYZB 2ZPBB 4BB7A 2RJCA 3LGFA 2LQKA 3MEWA 3PZPA 4M77C 2K8BB 3ZFJA 4IUVA 2L8DA 1NPRA 2G0AA 3OYAA 4J83A 2DQNB 3LYIA 2CS7A 1W4SA 4XK8E 3EAEA 4JRKA 2KD1A 2XD0A 1VQ6A 4M7DG 3MCAB 2E1FA 3NUQA 2K2VA 3PMIA 4FZMA 1N9SA 4OB3B 1ZQ1A 2KK4A 2LQ8A 4QVCA 2KKPA 1KHIA 1A0PA 2DGZA 2BUDA 5LJ5h 2RJEA 1YJWT 3QSUA 1DJ7B 1WQWA 3CCJT 5HK3A 5HR6A 2X35A 1WGSA 2E5QA 3C95A 1TH7A 2LYAA 1W2BA 3BY7A 1YJNT 2DIGA 2VYTA 1I4K1 3H0LB 1NE8A 4QIWC 4Y91A 4KMOB 1O75A 2RJFA 5A0GA 2P0QA 2DTHA 2WSFE 3CCMT 2VIXA 4PLIA 4XU3A 1Y7XA 1VQKT 2G08A 5D6WA 1I8FA 2K4IA 4CI0C 3OYLA 5FU7C 1VQ7T 5GAN2 3CCUA 2AHJB 5C6SA 3D2NA 3EFRA 2OTLA 2YLBA 4M78E 2H3QA 2RJDA 2EQMA 2ZIXA 1Q3UA 4II1A 2KJ5A 2ZIWA 3M55A 2XICA 1Q7YU 1DRGA 4C8QG 5GAOq 3BFMA 2F2AB 3V8JA 1GO3F 3MEUA 3VU3C 3M5AA 4JS5A 4Q5WA 5CQYA 1K73C 4M78C 3L2VA 5GAOn 2LT1A 2N1RA 3WVDB 3G6EA 2V8IA 1FX7A 4FU6A 1KD1C 1CRXA 4YTLA 3C29A 5LJ3g 3DLMA 4E7LA 3H6ZA 4L6V5 4M7DB 1N9RA 2RHFA 4ZGJB 5IT9E 1YITT 2XDBA 3OYGA 3AQFA 4M75D 1VQ9T 2P4TA 4LDUA 4HCZA 2XVTA 5CVIA 2ZIUA 4CDGA 5CKHA 3P8HA 4ZGDB 1D3BB 3G4SA 3WXMB 1M90C 2KNJA 2CZ6B 3I56A 3LGLA 2K5LA 2HMXA 4A54A 1MA7A 3QYGB 5EG2A 3HHTB 1Q82U 1I5LA 4XTZA 4PL2A 3CCST 1V29B 4BI4A 2DD5A 2VGNA 3V7RA 2X4WA 4OJ5A 1OI1A 3GZFA 3JB9I 4OP0A 4M7AF 2KJ9A 3QG1A 1YHQA 3VC8A 2VC8A 1VQLA 4JLGA 2HBMA 3INZA 2RI2A 2KY9A 4PJOF 4M7DE 4RCBA 4BDYA 3HPWA 1WQ7A 4D6WA 2RHXA 3CCRA 3A8LB 2R18A 4C8QB 4JRPA 1Q81U 3JCMX 4NL3A 3V7CA 3FDRA 4XTYA 3IG5A 5GAOm 1G3WA 2KMTA 3NTHA 4MMKA 4QW2A 3D2QA 2CZ7B 3G71T 2OYYA 2QEXT 3JCMV 4FE3A 1U1TA 1OZ2A 1VQ8A 5FRMA 1Q7YC 2D6FA 2MI6A 3OW2A 1FWZA 1VIFA 2ZPFB 1K8AC 3UWNA 1VQPT 2RB6A 2RK1A 4PL1A 1M8VA 4M77F 4M7AA 1NJIU 4BY6C 3JB9F 4M75G 3QJYA 3OB9A 5LJ3e 3QUIA 4P0PA 2RO0A 3OYEA 2DZCA 4PJOA 3PSPA 5I2SA 4CRIA 3CMEA 2HOFA 1B34B 3RKXA 3ALRA 4EDUA 4NWIA 2G5HB 3KUFA 3N7SC 4C0DC 1RI0A 2NLUA 3F5AA 1S72A 1QVPA 5LJ3f 4A4KA 2DK3A 3SWNA 4C8QE 1VQMT 2GF7A 3CCQT 2FB7A 2DPPB 2O4XA 2PVGB 3H0RB 1Y96B 4FT4A 4XU2A 3X24B 4O3MA 1LNXA 2H3ZA 2QQAA 5CIUA 5I21A 4QIWF 2H3FA 2K8AA 2VUBA 2F76X 1Q82C 4HCCA 3CC4T 3OW2S 5GAMg 5HKCA 3OBWA 2JN0A 3CEYA 2Y90A 2MRLA 5KH6A 1M9SA 4M77A 2LKYA 3VYHB 4N4GA 2K89A 3CPFA 4QVZA 2EQKA 4KBMB 4M7DD 3QJ6A 3PSFA 2KAFA 5KCOA 2VXFA 2HAXA 4LDYA 2WACA 2QA4A 2DTIA 4DQ2A 3VUZA 3E0FA 1YJ9A 3SAHA 3L42A 3M59A 3CD6A 2V8KA 2ZIVB 1WJRA 1SZHA 1YCYA 4C5IA 2RP5A 1H3ZA 4MZTA 4NS5A 4ZN1A 4M78F 3LWHA 3QBYA 2KDSA 4XAXB 3LLRA 3L2QA 2WAQC 4F7UG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A0L A;  5A0G A;  4BUG A;  2XI9 A;  2XIC A;  4C0Z A;  2XID A;  5A0D A; 
#chains in the Genus database with same CATH topology
 2RH2 A;  4N0A C;  4MZM A;  3S3O A;  4EMK B;  1AVZ C;  2GH1 A;  2QDY B;  4M9G A;  2W7O A;  2XCA A;  1ZQA A;  1ZQT A;  2E1E A;  2DM1 A;  4M75 B;  4MDX A;  2VB6 A;  5GAN 3;  2RF0 A;  1N63 A;  2DKG A;  3QXG A;  2ED1 A;  4UAT A;  4C0F A;  4I27 A;  3JCM P;  5GAO p;  1C6V X;  1R8O B;  3HL8 A;  2MIO A;  3HRU A;  3MR3 A;  1N61 A;  4KLF A;  4J7I A;  2LJ0 A;  3MEA A;  4RG2 A;  3S3M A;  2HCK A;  5GAO r;  5TZV A;  2M0N A;  4RNM A;  2AGQ A;  4C4S A;  8ICF A;  1UJ0 A;  4JUV A;  3TFR A;  3DEE A;  5GAM h;  4MHV A;  5KT3 A;  2JXB A;  4Q45 A;  1MHN A;  2ZXI A;  2M0O A;  1E6H A;  3EFS A;  4WCI A;  4FW2 A;  2I6X A;  4JK1 A;  3CQT A;  1L7N A;  1V85 A;  2EAY A;  1VUB A;  2EQU A;  3FB9 A;  4KT0 E;  4OO1 J;  1N27 A;  1ZQW A;  5LJ5 g;  1NK5 A;  1Q7Y R;  4KLE A;  2DZ9 A;  1URJ A;  2MUT A;  3J81 j;  4FO6 A;  2KYB A;  3I55 T;  4CC4 B;  2K3Y A;  8AT1 B;  1GRI A;  3X20 B;  2R8K A;  1YI2 T;  1F0M A;  4MEX A;  1NJI C;  2OXO A;  5AK6 A;  1ZUK A;  4FL6 A;  1K8A R;  2W43 A;  1B0X A;  1FMV A;  2EGA A;  1K73 U;  4IL6 U;  2BE7 D;  2JJ9 A;  1KIK A;  2LM1 A;  1VLB A;  1PKT A;  1EIF A;  1NM7 A;  1SKS A;  3QHS A;  2OTL Q;  1YP5 A;  3T5J A;  2YUQ A;  1M2V B;  1AWJ A;  1PSF A;  5HML A;  2HSP A;  3GIL A;  4AFZ C;  4RT3 A;  1KD1 U;  5KFL A;  3CC7 T;  1VQ4 T;  1KQ2 A;  3HPO A;  4C8Q D;  4ELY C;  4Y2U A;  5GAN h;  3S3N A;  4EX7 A;  3ZL7 C;  1WHL A;  1UGV A;  2RQ5 A;  1YJW A;  2P6U A;  8ICS A;  2A37 A;  2GQI A;  3AL0 B;  1S1N A;  2ESE A;  1M1F A;  1MUZ A;  2XG8 D;  3CCJ A;  2KZM A;  1R77 A;  3CCE T;  1IXR A;  4XRH A;  2H3V A;  1ZD3 A;  3B9J A;  4GBQ A;  1IGU A;  4MFF A;  4MFA A;  1LVK A;  4GY5 A;  5FRN A;  3ER0 A;  3CMA Q;  2DBM A;  1ZYQ A;  1KFZ A;  1YJN A;  3IG8 A;  4M78 A;  3QEB Z;  2J6U A;  5AKX A;  4IRC A;  1I81 A;  2RQR A;  2EPD A;  3TFS A;  4NM2 A;  1HXD A;  1B7T A;  3E2E A;  2AKK A;  3EFO A;  2K7A A;  2BR0 A;  2A19 A;  2JZB A;  1TE2 A;  3G1J A;  1BI3 A;  2LQN A;  1QKX A;  4KLH A;  1UEC A;  2KVC A;  2KNB B;  5KYU A;  4GFJ A;  3THV A;  3PT9 A;  2EJF A;  2B8A A;  3JB9 H;  3CCM A;  1YN8 A;  1WXU A;  3L2W A;  2KVS A;  5KFE A;  1W70 A;  2JXJ A;  4UAU A;  1TWB A;  1M90 U;  3G6E Q;  1WHJ A;  1M3B A;  1BCO A;  4M75 E;  1P7D A;  5DQG A;  1VQK A;  3WKC A;  4DFJ A;  2R57 A;  1FIQ A;  3NVZ A;  2E10 A;  2G5I B;  4QQG A;  1B22 A;  3GNG A;  4Q44 A;  2OWO A;  4PHA A;  4EX6 A;  4UBC A;  5HMM A;  1VQ7 A;  3LWI A;  1D1C A;  2ZJA A;  7ICM A;  1QCO A;  2Y9T A;  1QWF A;  3QU2 A;  2FG0 A;  9ICB A;  3OBY A;  1DXS A;  3UT1 A;  2H3I A;  4E7S A;  5L1J A;  2JH1 A;  1LVH A;  4IQT A;  1W1F A;  1Q82 R;  2DL8 A;  2KP7 A;  1KFD A;  3PMN A;  2D0Q B;  4ED0 A;  3VJP A;  1VQ5 Q;  4OB1 B;  3UA7 A;  3MFH A;  2M16 A;  5DM7 R;  3F2D A;  2EGC A;  2NYS A;  3H0M B;  3E1S A;  5LJ5 d;  3RAX A;  4Y2J A;  3N7P D;  4OMF B;  3EZ5 A;  4IC9 A;  2WSC E;  2QB1 A;  4I2J A;  1UJY A;  1SL1 A;  1Q8K A;  2ALZ A;  2PQW A;  4RTV A;  3AUO A;  1AD5 A;  4C7Y A;  2W8L A;  3RR6 A;  1KFT A;  3SDZ A;  4F4K A;  3RMQ A;  1NJW A;  3QZ5 B;  5KFB A;  4M75 C;  1DGS A;  3JPQ A;  4F5P A;  2JW4 A;  3Q8S B;  2Y4Y A;  4IUQ A;  3PX4 A;  4CF4 A;  2NRV A;  3FRN A;  4BAC A;  1ECW A;  1D8Y A;  1VOM A;  3G4S Q;  1BK2 A;  3QII A;  3R6O A;  4UB4 A;  4F7U B;  2QQ9 A;  4Z6C A;  3GF5 A;  4O3Q A;  2F5K A;  2K6D A;  4M7D F;  3GBQ A;  3I56 Q;  1T3N A;  1VIE A;  2CSQ A;  5KFI A;  1G8X A;  1XSN A;  4US8 A;  2E6Z A;  1X66 A;  1RAB B;  2VV5 A;  4RKU E;  2YWW A;  4LZG A;  2ECZ A;  1SGG A;  2YUN A;  2FPF A;  1N2X A;  5I2M A;  3OYI A;  1CSK A;  3KBB A;  2MA1 A;  3LVW A;  4F5Q A;  9ICW A;  1YWO A;  2OTJ T;  2NUT A;  2WF6 A;  1ZQD A;  2E12 A;  1SSH A;  2W0Z A;  1WYG A;  1I0C A;  1WPY A;  4C4T A;  4YR3 A;  2M02 A;  2RK2 A;  4P2H A;  4LD6 A;  2X9H A;  3P8D A;  4PJJ A;  3QDF A;  5CKB A;  5J0P A;  1OW5 A;  3WU2 U;  5KG0 A;  2ZCF B;  4DS4 A;  1VYU A;  2F5T X;  3RER A;  4GIB A;  3QPH A;  1IRX A;  3HJE A;  4IQU A;  1ZQC A;  4QZH A;  4TUR A;  2JNG A;  1OQK A;  5HK0 A;  1SKR A;  1UHF A;  1X42 A;  5CQX A;  3OS1 A;  1S8O A;  3H41 A;  2HHV A;  5AM0 A;  4DF4 A;  2J6K A;  2DE0 X;  4BUG A;  5KYN A;  4RQ6 A;  5FW9 A;  1BPD A;  2RQU A;  5A2Q E;  4HT8 A;  3PTA A;  1S97 A;  1KSP A;  1X27 A;  4JS4 A;  3SAG A;  1PSE A;  3ORY A;  1KFS A;  2ES6 A;  4BJQ A;  3C12 A;  1YIT A;  1QCK A;  4FZN A;  1GL5 A;  1PK1 B;  2JEJ A;  1X9W A;  2RQV A;  1WWU A;  1YHQ Q;  2AZS A;  5AM1 A;  3ZDA A;  3EUB 2;  2K3B A;  7ICR A;  1WNL A;  4E7Z A;  3C28 A;  1RXV A;  1LKY A;  1VQ9 A;  4IR9 A;  3PW4 A;  1V97 A;  5KYW A;  4JV1 A;  5CRX A;  3OYB A;  1YT3 A;  4OJO A;  3L4P A;  2HDO A;  5J2J A;  4F2S A;  1GXI E;  4ZH4 A;  3L2Z A;  5AKE A;  2FYK A;  4JPB W;  5GAO l;  3QEA Z;  3PST A;  3OSP A;  5LJ5 e;  1BIB A;  4JLI A;  2Z7J A;  4XTU A;  2PU9 B;  2AGP A;  3HTR A;  1ZQJ A;  1WHM A;  2DPJ A;  2E65 A;  2LMJ A;  1AQ6 A;  1J2N A;  1KN5 A;  4C0G A;  1K8A U;  2W9B A;  3NGP A;  4OMP A;  1J2M A;  2RRD A;  1GBQ A;  1KSW A;  2GFA A;  4QT7 A;  1N48 A;  4OJ6 A;  2M51 A;  4RTX A;  5ALT A;  2XID A;  2J6T A;  2LPE A;  1QCF A;  3MDA A;  1HUO A;  7ICT A;  2KEA A;  2OCE A;  1KBU A;  3OA6 A;  1CUK A;  1W2B S;  3RBE A;  4M7D A;  1AT1 B;  7ICJ A;  3V8K A;  4YXM A;  1NK9 A;  3RJJ A;  2KSO B;  1JRI A;  3CNH A;  2JVV A;  5LJ5 f;  2F1L A;  4JRI A;  1NJI R;  3EG3 A;  4EBE A;  2X3W D;  2ZIX B;  2JTM A;  4QQ6 A;  5AIA A;  5CB1 A;  4F7U E;  2RI5 A;  1GBR A;  3CCS A;  5CCA A;  2EDU A;  1B3Q A;  3QZ7 A;  1UB4 A;  3UMG A;  1WXT A;  1Q46 A;  3K75 D;  1VQ8 Q;  1X6B A;  3X26 B;  1T94 A;  2F1J A;  3PGG A;  4F5R A;  1N5W A;  2DL3 A;  4Y2R A;  1UA1 A;  1D3B A;  3BJY A;  5LJ3 j;  5CA7 A;  4MDW A;  1DK3 A;  4OVA A;  3RJE A;  4K11 A;  4UAY A;  4IQW A;  4B9U A;  3VRZ A;  2DD4 A;  3TU4 K;  2FPK A;  5ALU A;  2FZK B;  2NUP B;  4FT2 A;  2DBY A;  4AG2 C;  3RJH A;  3V6K A;  3PML A;  4CC2 A;  1ZHI A;  1PRM C;  4KUI A;  4XU0 A;  2A3V A;  3ISB A;  1RAC B;  1NBE B;  2E6N A;  4Z6F A;  2ENM A;  2DO3 A;  3UXN A;  1ZA2 B;  2F1I A;  5DB6 A;  2VXE A;  2XCP A;  5DBC A;  2IOH A;  1IM4 A;  3J81 E;  9ICF A;  4P0Q A;  4LNP A;  3WK9 A;  5BPC A;  5JU5 A;  2L89 A;  1U45 A;  4C7Z A;  2KVQ G;  1ZD2 P;  4YMN A;  2DEQ A;  3OYC A;  1YZ6 A;  3ISC A;  4BD3 A;  1G3S A;  3G6Y A;  2RHU A;  4JJC A;  3FJP A;  4YCX A;  5CKE A;  1SPK A;  3CME Q;  4C0Z A;  3ZDC A;  1RAF B;  1K0X A;  2W8K A;  1XOV A;  4J03 A;  3CMA T;  4RZR A;  5EWE A;  4OMM A;  3EGD A;  4E2F B;  2Y4X A;  2JT4 A;  3ZI4 A;  5HR7 A;  3FEO A;  3TSW A;  4KX3 A;  4JWM A;  1TU0 B;  5D7U A;  2LZ6 B;  3CCL T;  2HSE B;  4IUR A;  2DNU A;  3OQ5 A;  1YIJ Q;  1S72 Q;  1L7M A;  2PVO B;  2KXD A;  2VAS A;  3G71 A;  2PZ1 A;  3M53 A;  1UCV A;  3QU5 A;  4RPZ A;  1ZQB A;  2LRQ A;  3JCM g;  4QZ9 A;  1L3S A;  1SEM A;  2QEX A;  4C5H A;  2WAQ F;  3NTU A;  5DG9 A;  3RB4 A;  5KG7 A;  2DFU A;  4FM4 B;  3SEM A;  1FYN A;  4J9D A;  1S0N A;  3PVX A;  1SKW A;  4J9S A;  4Z6E A;  4PJO G;  1X75 C;  1ZUU A;  4DFD A;  3BQ2 A;  1QQJ A;  4EBD A;  2WF5 A;  1XJW B;  4PZN A;  5CWR A;  3RJF A;  2FPD A;  4J9G A;  4KGX B;  1RAD B;  1MQ2 A;  2PFN A;  1P92 A;  3CPW A;  2ZJ5 A;  2C0I A;  4C8Q A;  3SMV A;  1VQP A;  3GII A;  3I76 A;  4XQ8 A;  2HBP A;  5LJ3 d;  1ZQZ A;  2ZZD A;  4HA8 A;  4B9W A;  2BCR A;  4RNO A;  2HHQ A;  2HKQ B;  3C2L A;  3VCB A;  3QUC A;  2XGQ A;  4OB2 B;  2KK0 A;  1RAA B;  8ICW A;  1F1B B;  3PW2 A;  1ZQV A;  1VQ5 T;  2HHW A;  1VQN T;  4UAS A;  4Z02 A;  2J6O A;  3OYD A;  1JAL A;  1Q3V A;  1T4G A;  2A28 A;  2RMO A;  5J0S A;  4IUU A;  2YB4 A;  3RJK A;  2KIW A;  3OSN A;  2K57 A;  1U8R A;  3Q8P B;  2R5M A;  4QZD A;  3SV4 A;  5FRO A;  3K1R B;  3F53 A;  3RRH A;  1IIP A;  5C0Y A;  2HNI A;  2VGM A;  1VQO Q;  4N4H A;  1CKB A;  2QAR A;  2MWO A;  4FIB A;  1X2I A;  1BI0 A;  3T3F A;  1ZJM A;  2A3L A;  3TI0 A;  9ICK A;  3VKI A;  3PIP A;  1MGQ A;  5J2C A;  3PX0 A;  3MC1 A;  5GMK i;  1AZG B;  2A1J B;  3UDC A;  5GMK m;  4K4I A;  1AZE A;  2A1A A;  4KLI A;  3B0Y A;  3H0I A;  2IIM A;  1JJ2 A;  1T3Q A;  4J9H A;  1TG0 A;  1NEG A;  4GXI A;  3WKA A;  2PVD B;  1A6S A;  1O9S A;  4M7D C;  2C28 A;  1D9D A;  4YR0 A;  5KG3 A;  3OJU A;  3KTQ A;  5D6Y A;  2COZ A;  1H92 A;  1VQM A;  3DB4 A;  4C92 G;  3CCQ A;  2VWF A;  3CBM A;  1MMD A;  2D1X A;  2YXY A;  2QB0 B;  3UMC A;  1NPP A;  5AI8 A;  1Z19 A;  8ICO A;  5L9X A;  8ICA A;  4M77 G;  4D8D A;  2DKZ A;  4C8N A;  1IB8 A;  3C1Y A;  1QVF P;  1SG5 A;  5GAN 7;  1K9A A;  1ZLM A;  2PMZ C;  4QNL A;  5DQI A;  2K5I A;  3BS5 A;  2AQ0 A;  1FMW A;  3JB9 G;  1YJ9 Q;  4ECU A;  2F8K A;  4QZA A;  4DL7 A;  4PHP A;  2ZTC A;  3PE0 A;  4WJ3 B;  1AWO A;  3CD6 Q;  5KE3 A;  3MEV A;  2W55 A;  5T14 A;  4Q8F A;  3CCV Q;  4RTT A;  4PFO A;  4D8K A;  3PSI A;  3CYM A;  4RUG A;  4N0A A;  2CT3 A;  5DKW A;  3V8L A;  4QZG A;  4OB0 B;  2RM4 A;  4R66 A;  3JCM h;  5L8R E;  2E3I A;  3RAQ A;  4WF2 A;  4DBF A;  4J8O A;  4OGC A;  1B34 A;  1PUZ A;  3CC4 A;  4N4I A;  2LYB A;  1PVR A;  2JTE A;  1AWW A;  4GLK A;  9ICP A;  4PFZ A;  1H3H A;  2K9G A;  4O5K A;  1VYV A;  4A4H A;  3FLG A;  2KQW A;  2HW3 A;  2BDU A;  1G3Y A;  1NI3 A;  1AHJ B;  1LOJ A;  2G07 A;  2KRS A;  3CPW S;  5A0L A;  3HKS A;  1TUC A;  4QZF A;  1X01 A;  4I2C A;  4OML A;  1RI9 A;  2DIQ A;  3F5E A;  3TAC B;  1NZB A;  2E1H A;  5C5J A;  4QZC A;  2GQV A;  2I2L A;  4DQR A;  4UB8 U;  4RQ4 A;  5DY9 A;  3ZDB A;  1Y96 A;  4G9B A;  3BW1 A;  1D1B A;  2JMC A;  2R58 A;  5CP2 A;  5AKJ A;  4RQ8 A;  2FO0 A;  3SB2 A;  1LCK A;  4V2S A;  3C0C A;  4J9M A;  3VUB A;  1R0C B;  1SV4 A;  1PVP A;  1PD0 A;  2J05 A;  3N5B B;  3UXO A;  3VYG A;  1HUZ A;  4B9S A;  3AN1 A;  1ZQR A;  2H8H A;  1WI7 A;  5AIB A;  5KYY A;  1MSW D;  3FIF A;  2MCN A;  2HHU A;  5AKH A;  2BZ8 A;  4JZ4 A;  1TAU A;  1JXE A;  1ZQM A;  2I5H A;  3FC3 A;  1DGJ A;  4M75 F;  1M1K C;  2ZJ8 A;  2YML A;  2CDT A;  4ICA A;  5EC7 A;  3BZK A;  2C22 A;  2BZY A;  3U23 A;  3ZBD A;  2GTO A;  2DTO A;  3AU2 A;  1RAH B;  2CP3 A;  4YMM A;  3A8M B;  1V9P A;  4P0P B;  1JJ2 S;  4PJO B;  2YRV A;  2DXT A;  4NLC A;  3OS0 A;  4NLG A;  5GAN 6;  7ICL A;  2IPO B;  2ROT A;  4PK4 A;  5IXB A;  5AK5 A;  3QUT A;  3LK9 A;  4JDS A;  5ALV A;  1ZET A;  1M5Q 1;  5IAY A;  3RUX A;  4RT2 A;  2PUK B;  5GMK h;  3VS4 A;  3RF9 A;  2CZ1 B;  2MK5 A;  2DBK A;  4O5V A;  2XI9 A;  8ICZ A;  1U5S A;  1TV9 A;  1IRE B;  4X9D A;  2XGP A;  3GIB A;  5F9L A;  1UEB A;  4RPY A;  4AYB C;  2E8O A;  2QQR A;  5FU6 B;  4C8Q C;  2IG0 A;  3CCJ Q;  3TAQ A;  5GAN 4;  4ATO A;  4DSL A;  4X34 A;  3EYZ A;  2F69 A;  4A53 A;  5DB8 A;  1Z9Z A;  1X69 A;  2OAW A;  3OMC A;  2DVE A;  4KUD K;  2YUP A;  1ED1 A;  1QQ5 A;  5D49 A;  1NEB A;  3NPF A;  1QVG P;  5ALY A;  3K4G A;  1KC8 U;  2RQT A;  4AFU C;  4YD1 A;  4DCC A;  1WJS A;  2O4X B;  2HI0 A;  2KIV A;  3BDU A;  3V72 A;  4GLX A;  1D8B A;  1T3S A;  2BZX A;  5DB9 A;  2L3P A;  4XTW A;  5GAM j;  2FL7 A;  4BE2 A;  1KL9 A;  3A8O B;  8ICT A;  2PFP A;  3RDV A;  1RLQ C;  4EMG A;  1L3U A;  2MF2 A;  3NHN A;  2M9N A;  2ZPE B;  4I28 A;  5J2D A;  5KAF U;  2QXF A;  3CCM Q;  2LHT A;  1OUQ A;  4NY8 A;  3RH4 A;  1XNS A;  5IIM A;  4F93 B;  2KRN A;  4ECZ A;  4MZP A;  4ESR A;  2ZIV A;  2GBQ A;  1QP2 A;  1KQ1 A;  2G3R A;  5GAN g;  2EYZ A;  2ZPG B;  4CE6 A;  5KG5 A;  1JXL A;  1KTQ A;  4I2H A;  3TEE A;  3I55 A;  1VQ6 Q;  3T5L A;  5G5H A;  1JUD A;  1U4B A;  4M78 G;  3QDR B;  1YI2 A;  4C92 B;  1QH9 A;  2O2O A;  1VQ7 Q;  2EGE A;  4YP3 A;  2FJ6 A;  3I1Y A;  3QE9 Y;  1SKU B;  2K2M A;  3O5Z A;  2JTF A;  2L2P A;  4M77 B;  1EFN A;  2RLT A;  3GV7 B;  4JJN K;  5EE3 A;  2O9V A;  2HBJ A;  4DWI A;  1X6I A;  2XDP A;  3GQC A;  2JM8 A;  3CW2 C;  3L1A A;  4M75 A;  2AXT U;  5HP4 A;  2XKO C;  1WFW A;  4J9F A;  3CC7 A;  3AMZ A;  3EHQ A;  1Z9Q A;  1VQ4 A;  1ARO P;  2RHZ A;  3PIO A;  3CBP A;  1ZBX A;  1HEK A;  3VV0 A;  3RR8 A;  4F17 A;  3JCM c;  4NJ8 A;  4OF1 A;  2BTT A;  5KFT A;  1WX6 A;  1K1S A;  1SWW A;  2A08 A;  5ALI A;  3KBG A;  3RMS A;  3X25 B;  4OJP A;  4PHE A;  4E7H A;  3RNJ A;  2PTK A;  4JJB A;  1KQS P;  2KEY A;  3CCE A;  2AZV A;  1PG5 B;  1G83 A;  1K4U S;  2Y0S F;  4DSJ A;  2GTJ A;  2KKV A;  2RD1 A;  1ZD5 A;  2KI7 A;  3D7S B;  3HSB A;  3JB9 J;  2RN8 A;  5J26 A;  4CNQ A;  8ICR A;  1ZSG A;  4IUP A;  1V1C A;  3FAH A;  3HFN A;  2R8I A;  2E3H A;  2ZGW A;  3OS5 A;  4ZGE B;  1S0M A;  1WYX A;  4KX5 A;  3M58 A;  1M3A A;  2F2W A;  2HOI A;  1Z00 B;  4FBU A;  4USA A;  3KKA C;  2FLN A;  1NOM A;  1S10 A;  1L3V A;  2DL7 A;  5GAM d;  4HCB A;  2ZUD A;  2DF4 B;  2IHN A;  5III A;  3KZX A;  3LDA A;  1UA0 A;  2ZXH A;  2BKD N;  3SD4 A;  1N60 A;  1VQO T;  4BWM A;  4RG8 A;  1BNO A;  3TAR A;  1S0O A;  2IOF K;  5B5E U;  7ICF A;  3M6Z A;  1CEZ A;  1M2V A;  2GCX A;  3H8Z A;  2QAZ A;  3FC4 A;  4DFK A;  1ZSZ B;  3GP8 A;  1QW1 A;  2KJ8 A;  5IIN A;  1PM3 A;  2F1H A;  5DQH A;  1RAG B;  2VA2 A;  1W6X A;  2HOQ A;  4QZI A;  4TUS A;  1OPL A;  2VJ4 A;  4PJN A;  3CCU Q;  3JCM W;  2DER A;  2HQE A;  5LJ5 j;  2W3S A;  3QZ9 B;  4IQV A;  3RES A;  4LDX A;  3WK8 A;  2YTU A;  4X9C A;  3PO4 A;  1S77 D;  2W10 A;  3CXC P;  1BYM A;  2C06 A;  1XQH A;  3LYS A;  4FYW B;  4ME7 A;  5E79 U;  1D0Z A;  4U7C A;  2W04 A;  3M0P A;  1HYO A;  5KYX A;  2PXI A;  3BQ0 A;  3PNW C;  3Q8L A;  4E47 A;  3J7A F;  1BI1 A;  4E7K A;  1B4F A;  1COK A;  5KFQ A;  4OJL A;  1WJQ A;  3EGX B;  1VQ9 Q;  4P4M A;  4GC7 A;  5G5G A;  2ASD A;  4JB3 A;  3TAP A;  5FU7 B;  2FMQ A;  2X3X D;  1ZXI A;  4C92 E;  5CKF A;  3EG2 A;  3CCV T;  1D8L A;  1OX8 A;  1S5L U;  1WUD A;  2MUT B;  2UVW A;  4VUB A;  8ICX A;  2DXC A;  1YWP A;  2O01 E;  4XU1 A;  2KFZ A;  4PLL A;  2K4E A;  2JV3 A;  1SHG A;  1TAQ A;  7ICN A;  3MET A;  2B6G A;  1JQQ A;  2CN1 A;  1BPE A;  2Q4T A;  3MKD A;  3PFS A;  2NV3 A;  2DXB A;  3MP6 A;  5IN1 A;  1OU8 A;  5EE0 A;  4CRX A;  1BGX T;  8ICK A;  4J7F A;  5KFA A;  3QWX X;  4JMU A;  2OTJ A;  3NVV A;  3M56 A;  4US9 A;  2JR5 A;  1QTM A;  3NTK A;  1KG1 A;  2FMP A;  4DF8 A;  5ALM A;  3QU4 A;  3JRZ A;  4BE1 A;  2HBK A;  3Q8Q B;  5J2I A;  2LX9 A;  2MPX C;  2IVW A;  1UGQ B;  3CRX A;  1M1K R;  2GFU A;  1TK0 A;  1EXN A;  3CCS Q;  3VS2 A;  4DQS A;  4C92 C;  2MMP A;  2W9M A;  3RIR A;  2QQB A;  4IR1 A;  2I9G A;  4ECR A;  4IRD A;  3TQ7 P;  2D9T A;  5GAM e;  3OYN A;  3UPQ A;  2ASJ A;  3RKY A;  5M9O A;  4DFP A;  4EEN A;  4UC4 A;  5FWB A;  3QUQ A;  1Y88 A;  5J0Y A;  2QI2 A;  1WZO A;  2XY6 A;  4M78 B;  4MML A;  4BX9 C;  4DQI A;  4F16 A;  2V1R A;  3F70 A;  5KFD A;  3IN5 A;  1N5X A;  2DYB A;  3OYM A;  5AKI A;  1KC8 C;  3PNC A;  5J3B A;  2JGA A;  5AI5 A;  3H4D A;  2EH9 A;  2JZB B;  2E5K A;  1JRP A;  2KIC A;  2YRC A;  5ECA A;  3SYZ A;  3V7S A;  4F7U A;  4YXJ A;  2KE9 A;  1LJO A;  1RYS A;  3A5Z B;  1FFU A;  4QZE A;  1BU1 A;  1JI7 A;  2BIV A;  2DA9 A;  3L2U A;  1SZP A;  5DB7 A;  2YX8 A;  4Z88 A;  5GAM f;  4J9L A;  4EMK C;  4R55 A;  2HSZ A;  4XTX A;  1XWL A;  1WWV A;  4XQ3 A;  4UB2 A;  2D0N A;  1KQQ A;  2L5Q A;  3SFM A;  2QGG A;  2P66 A;  4NL2 A;  2HVI A;  2DFL A;  2IMW P;  3MHX A;  2FPM A;  2R8G A;  4B9L A;  5B66 U;  3CC2 T;  5FP0 A;  1NYF A;  5GAN e;  5IIO A;  1TK5 A;  4C8O A;  4R56 A;  3PO5 A;  1BIA A;  3I5S A;  2YUO A;  3M9Q A;  1BPX A;  3HRT A;  2GLE A;  3HP9 A;  5KTQ A;  2K4P A;  2Y9U A;  4M7A D;  3NMZ C;  2PMZ F;  2ATL A;  2H3J A;  4UBB A;  1D09 B;  4YD2 A;  2HBW A;  3QX7 A;  4KN7 A;  4RMO A;  1K9M C;  4QZ8 A;  4ZTJ A;  2FHD A;  6AT1 B;  2LI6 A;  3GU3 A;  2W7P A;  5ALW A;  2XHC A;  1H8K A;  3OYY A;  2AQ4 A;  1ZSZ C;  1ZQG A;  3KXT A;  5GAN f;  1M2O A;  5IHK A;  4PJO D;  1R0B G;  2XU8 A;  1KLN A;  2QLT A;  1PK1 A;  2KSS A;  5EE1 A;  3KFV A;  4KLQ A;  2KOB A;  4ECX A;  2EWN A;  1ZJN A;  4A4G A;  1IHW A;  1A0N B;  4O3P A;  1C1A A;  1YNZ A;  3Q1J A;  3URG A;  1XC9 A;  3JCM b;  1YBY A;  1WCN A;  5ALS A;  3A0B U;  2FPL A;  3H8W A;  4MF2 A;  7ICQ A;  4LDV A;  5CR2 A;  3EHR A;  3K1Z A;  3RKW A;  3C1Z A;  1VQ6 T;  5ALJ A;  4ZN3 A;  4C5E A;  1ARK A;  2CKK A;  2JZ2 A;  1Q86 C;  1KHC A;  3LWM A;  3RB0 A;  2BDP A;  1NNL A;  2ZPH B;  2LMR A;  1TAM A;  4DSE A;  1N5Z A;  1Y71 A;  1NKC A;  2NUT B;  3JPT A;  4OGE A;  1VQP Q;  4ELV A;  1HSQ A;  4NLN A;  4KH0 B;  3AQE A;  1VQL Q;  3OHA A;  4ELT A;  1K1Q A;  2WB1 C;  1WHH A;  7ICH A;  2JUF A;  5J0O A;  2M9U A;  1UGP B;  2GOL A;  1L7P A;  4KUL A;  4FS2 A;  1UPH A;  5EOZ A;  3NRW A;  4DOW A;  5J39 A;  2BQ3 A;  4AT1 B;  3CCR Q;  2KSO A;  2QKQ A;  4OCZ A;  1WLP B;  4U6P A;  4FZL A;  1L6N A;  5GAN 5;  5GMK l;  2I1Q A;  3HKZ C;  4EEK A;  2W9C A;  1NKE A;  5J8Y C;  4YVZ A;  5D6X A;  2YLC A;  1JN3 A;  1AEY A;  3CP8 A;  4QW9 A;  1M4Z A;  2EYQ A;  3CMA A;  2B86 A;  1RAE B;  3HFO A;  4J6X A;  4R8U A;  4XTV A;  2XK0 A;  5CO7 A;  4A4E A;  4C92 D;  4J6Y A;  3SEI A;  1X40 A;  2MAM A;  5FLX E;  3CCL A;  4M77 D;  2Y0S C;  1WA7 A;  3I28 A;  2X4Y A;  2WFA A;  2ZIW B;  2LC4 A;  2KZZ A;  3UPU A;  3JB9 D;  3AHU A;  4K4H A;  3LX7 A;  2D8J A;  4GXJ A;  2LCC A;  3ZEH A;  1BCM A;  1VQM Q;  4BE0 A;  4AYB F;  1ZQX A;  5KAI U;  1H64 1;  2DJZ A;  3CCQ Q;  4C8Q F;  1G5V A;  4DA4 A;  3A8H B;  1X6O A;  1UG1 A;  2NRW A;  2OEH A;  4AMC A;  4PNO A;  3MO8 A;  1IXD A;  3PVL A;  1OV3 A;  2DXU A;  1IGQ A;  4DBH A;  1TVA A;  2EJ9 A;  3OMG A;  5DG7 A;  4RUC A;  2X4X A;  3JSC A;  5AI0 A;  3BDP A;  1TUD A;  2FVU A;  3IQL A;  4QQD A;  4PJM A;  5GAN 8;  5EE9 A;  3H9N A;  3CCU T;  4DSI A;  3WKD A;  9ICH A;  5KFK A;  2LJ1 A;  3UQ2 A;  1OYX A;  3LVV A;  3E9F A;  1QVF A;  1QP3 A;  1UTI A;  1QQ6 A;  3L5K A;  1L8O A;  1QMC A;  2OTL T;  2CPR A;  1M1K U;  2W9A A;  3SZ2 A;  3KHL A;  1VQ5 A;  1ZQ1 C;  4C5G A;  1VQN A;  3H4B A;  4F50 A;  1K1Z A;  4IUT A;  2YB1 A;  2E64 A;  4LUD A;  5KCH A;  4DL3 A;  1W2B P;  2C0T A;  5KFX A;  1Y07 A;  4E7I A;  4EYH B;  4NOY A;  5KFF A;  9ICI A;  4RCC A;  1L8L A;  1NJZ A;  3NFC A;  2XY5 A;  3MGI A;  1PVQ A;  2PKE A;  2AT1 B;  2LBO A;  1G2B A;  2KBT A;  1I1J A;  2JOY A;  3E19 A;  1CI4 A;  4AFQ C;  1ZQN A;  2E3T A;  1BB9 A;  2YSQ A;  4DBR A;  2OAU A;  2P0K A;  5AK4 A;  4Y2Q A;  4J9N A;  4B9X A;  4KLO A;  1MV0 B;  4BY6 B;  2O6K A;  2OH2 A;  4UB5 A;  3AM9 A;  3C94 A;  4M7A G;  1WG8 A;  4IRK A;  4J5Y A;  2E5S A;  3OHB A;  1X9S A;  4Y2S A;  3JCM Q;  3BE3 A;  5KFO A;  2HHS A;  4LDW A;  2ZIU B;  2WTF A;  2FRY A;  3QUB A;  3RH5 A;  3M7D A;  1OZ3 A;  2LT4 A;  3M54 A;  4JWN A;  1KC8 R;  3MP1 A;  1NZP A;  3O8V A;  1ZQY A;  1JRO A;  3KHR A;  4K4G A;  1BI2 A;  2F8L A;  4KTQ A;  3G6E T;  3ZDE A;  3N7R C;  4P0Q B;  3IP4 B;  4F3O A;  2YDL A;  3SAF A;  1ZQK A;  1XNI A;  4BI3 A;  5I11 A;  4ELZ C;  1Z3E B;  2UVV A;  3A8G B;  4EIK A;  5C0M A;  5CHG A;  1SL0 A;  2C2D A;  2KXC A;  4C0D B;  4TQS A;  4F72 A;  2R5A A;  2EAO A;  3PW0 A;  3ISD A;  3EG9 B;  2L3R A;  4ED7 A;  4FSX A;  2ZAE A;  3OYK A;  2EZZ A;  2LNV A;  2HL5 C;  4Y28 E;  2HBL A;  2XO7 A;  3MAB A;  8ICY A;  1B07 A;  5F3X B;  3EGD B;  4CC3 A;  7ICS A;  1NK4 A;  1XTD A;  2K5F A;  2PI5 A;  3I9Q A;  3UA6 A;  4FBT A;  5AIC A;  4LVS A;  2HD0 A;  2QK0 A;  3OSS C;  8ICB A;  1X2K A;  9ICX A;  1MND A;  2OI3 A;  3ICX A;  3HRS A;  3T79 A;  4B9T A;  2JHD A;  3BQT A;  1GCQ C;  4OD0 A;  2A1J A;  3HT3 A;  3GLX A;  3N28 A;  4KLL A;  5LJ3 h;  4J9Q A;  1K9M R;  1FO4 A;  4F4X A;  1QVF S;  4KMU A;  3KFU F;  5KE2 A;  4PJ0 U;  3E9G A;  4TUQ A;  3UQ0 A;  2JMG A;  2R8J A;  2P6R A;  2LYH A;  1UGS B;  4JRQ A;  3G4S T;  1UGR B;  2H5X A;  4J9K A;  4PL6 A;  2WHE A;  1X9M A;  3UMB A;  4Z8A A;  2D8H A;  5L1M A;  2QB0 A;  4M47 A;  4QZB A;  3I56 T;  5IH2 A;  4QJF B;  5KFU A;  1JBM A;  1QVG A;  1O08 A;  5KFC A;  2COY A;  3DB3 A;  2DWQ A;  2BKE A;  4RQN A;  2LQW A;  4M78 D;  2YRD A;  4HAI A;  4O3O A;  4UAV A;  4PGY A;  2BPF A;  3TSZ A;  2OHF A;  8ICC A;  1MN8 A;  1MMG A;  2ZPI B;  4EEY A;  2BPC A;  4EPC A;  3M8S A;  2JEI A;  1KW4 A;  2LTO A;  4YQW A;  3PR4 A;  2W54 A;  2X51 A;  2K4H A;  3F2B A;  5AM2 A;  2QA4 Q;  4Z6D A;  3E58 A;  4QVD A;  4FS1 A;  1Q86 R;  4E6R A;  1YI2 Q;  1X43 A;  1TUG B;  3C2K A;  3R9K A;  3QXE B;  3OSV A;  1KRP A;  1IZ6 A;  4LN2 A;  4QWB A;  4B9V A;  1JEG A;  4DEZ A;  4DOC A;  1GFC A;  5GMK j;  2F77 X;  3ASK A;  1N8R U;  4CC7 A;  3SI8 A;  2HKN A;  4KGZ B;  4QWD A;  4DS5 A;  4BDZ A;  3UM9 A;  4KLS A;  3VS1 A;  4FSS A;  3HX0 A;  2RDJ A;  4BXO A;  3M57 A;  4O6J A;  4RQ0 A;  4UQG A;  3QZ8 A;  1OPK A;  4FYX B;  2XC9 A;  4L59 A;  3CC7 Q;  4RQM A;  3JCM d;  3M1Y A;  1VQ4 Q;  3JPR A;  4KRT A;  3QYH B;  1UDL A;  1XO0 A;  2EIF A;  1RAI B;  5AKK A;  8ICL A;  4A4F A;  4BI8 B;  1YHQ T;  2DAQ A;  1SL2 A;  2BCV A;  1JB0 E;  2E41 A;  4RUA A;  1FEZ A;  3HW8 A;  3JAM E;  3SQI A;  3KKA A;  2MWP A;  4O3N A;  1VQL T;  4ECW A;  3JPN A;  5CAI A;  4C92 F;  1PK3 A;  2NO5 A;  5JTI A;  2ZG6 A;  5ALH A;  1RG6 A;  2ESW A;  3S6W A;  1D0X A;  4B6J A;  2QTX A;  3RRG A;  3HP6 A;  3LW5 E;  2Z0W A;  3WVE B;  5AYF A;  3BS5 B;  2FI1 A;  4DLG A;  3GNF B;  2OM6 A;  2A0F B;  1KQS A;  3CCR T;  2M1H A;  1QWE A;  2LM4 A;  1F5S A;  3TCJ A;  2AHO B;  1C0M A;  3F2C A;  4DBQ A;  1FMK A;  3SR6 A;  4OMQ A;  4I2F A;  2E8P A;  3BS7 A;  8ICQ A;  3ETL A;  2VKQ A;  2AGO A;  2CGH A;  3EPG A;  5DBA A;  2EKH A;  4M7A B;  2EQY A;  2DF6 A;  3L2R A;  2CP5 A;  4ED8 A;  1M1G A;  5HCK A;  1Z1B A;  2KRM A;  1ZA1 B;  1MNE A;  2QQS A;  3KHH A;  7ICE A;  1QVG S;  4ZTF A;  5ALD A;  5K4L A;  2HHT A;  1PCX A;  3D2S A;  2O88 A;  3J80 E;  1T7P A;  1YIJ A;  4HKE A;  1X6G A;  3OYF A;  3M0S A;  1U1S A;  5CK9 A;  2QTV A;  2B21 A;  3T9N A;  1VQ8 T;  3GV8 B;  4Y2P A;  4ACO A;  2AJQ A;  4LUE A;  1CKA A;  2GNC A;  1UHC A;  1G3T A;  5L1I A;  2PUO B;  3BQ7 A;  7ICU A;  2RQW A;  1YJW Q;  2E70 A;  4IS7 A;  2JM9 A;  2W03 A;  1E6G A;  3WKE A;  3OGU A;  2I0N A;  3MR6 A;  3CXC A;  2K8C B;  8ATC B;  3M0R A;  4I2E A;  3SWN B;  3WK5 A;  3NRZ A;  2EFI A;  5DLQ E;  2NO4 A;  3FM9 A;  2UVU A;  4F5O A;  3AU6 A;  3PW7 A;  2HEQ A;  2HQX A;  5J2E A;  1YJN Q;  5AKY A;  3JCM e;  3ME9 A;  4Y2V A;  2CRX A;  2M0Y A;  5KNI A;  1XSP A;  3NTI A;  1TOV A;  3FJ5 A;  3M4Y A;  4NLB A;  1ABO A;  4LD9 K;  2KV2 A;  4NV0 A;  3ONN A;  4UAW A;  3THK A;  1SF9 A;  3C5F A;  4M6W B;  1D0Y A;  3M6K A;  2CP6 A;  2ZUB A;  2OTJ Q;  4C92 A;  5ALF A;  3JCM J;  4AP9 A;  4BDP A;  2JH7 A;  2FLL A;  1RLP C;  3CME T;  2WSE E;  4TVR A;  2CP7 A;  1TFR A;  1VQO A;  3JCM f;  2LDM A;  2DRK A;  1VQK Q;  4C80 A;  2HHX A;  2KYM A;  1WDX A;  3OY9 A;  2WB1 F;  1X2Q A;  2JS0 A;  1KQS S;  4IKF A;  4ECQ A;  3G6V A;  2EJG A;  3MGV A;  1XSL A;  5ALO A;  4CGZ A;  1HK9 A;  2KGT A;  2QDL A;  2NWM A;  4HVW A;  2IOF A;  1S72 T;  2HL3 A;  4HT9 A;  3OW2 P;  1K9M U;  2KHQ A;  4KLJ A;  1N6A A;  2CT4 A;  2GWS A;  2IHM A;  2H3E B;  4EMK A;  5GAN j;  8ICP A;  3GOX A;  4KH1 B;  4IIO A;  3BDL A;  4DL5 A;  1MV3 A;  3RTV A;  5AT1 B;  4DEX A;  3GV5 B;  3TRE A;  1TK8 A;  3HKZ F;  1DK2 A;  4EMH A;  4B9N A;  4M7A E;  2R8H A;  1UUE A;  2J6S A;  2RA2 A;  1BPZ A;  1SSF A;  3X28 B;  5J29 A;  1L3T A;  1ACM B;  4F4Z A;  3TAD C;  5H2F U;  3O0F A;  4I2I A;  2C0O A;  2D6F C;  1Q81 C;  1WCL A;  4Y2T A;  3CCV A;  2G09 A;  8ICV A;  4EEL A;  4UB1 A;  4E0D A;  3PMT A;  4PJO E;  4P5N A;  2YHT A;  3OPX A;  1TTH B;  5GMK e;  2ZTD A;  1I5O B;  1Q86 U;  2F3N A;  4F5N A;  3RFA A;  2MU2 A;  9ICV A;  1U3O A;  9ICL A;  2RHY A;  4L5G A;  4DFM A;  3QO3 A;  2CXY A;  5ALP A;  3H0F A;  4A8E A;  1NJX A;  1K5O A;  2CRE A;  2DMO A;  5DLO A;  2V8J A;  3UAT A;  1MC8 A;  3KOO A;  1JIH A;  1ZSZ A;  4PKC C;  5KFJ A;  7AT1 B;  3CXC S;  2X4J A;  5J0X A;  3RR7 A;  1U49 A;  1JX4 A;  3D6J A;  3Q8K A;  5GTH U;  4ANJ A;  1F44 A;  2AU0 A;  5DLF A;  1HIW A;  3SEN A;  2EYW A;  4Q8E A;  3PR5 B;  4UB6 U;  3ZD8 A;  2LJ3 A;  2DRM A;  2JEG A;  4WTO B;  1RYR A;  1N8R C;  4M7A C;  4DOV A;  5HNK A;  2CZ0 B;  4KN4 A;  2FMS A;  3MGH A;  2JEF A;  9ICG A;  4GLM A;  3AEV A;  4M0A A;  2FPE A;  4O9M A;  2KHV A;  3MP8 A;  5KFV A;  2VJ5 A;  4DSF A;  9ICT A;  4E7J A;  4RPX A;  7ICP A;  4OMO A;  3PW5 A;  9ICN A;  4QKU A;  4F7U F;  1TXQ A;  2E4H A;  3DLL A;  2K3X A;  2LX7 A;  1Z4N A;  5FWC A;  4PJO C;  4UAR A;  1SXE A;  4MEY A;  4M2Y A;  4R65 A;  1ZQS A;  5KL1 B;  5JUM A;  4RTZ A;  4ECS A;  3EGX A;  1ZQP A;  1ZD4 A;  2D8C A;  2Q0Z X;  5A0D A;  1GFD A;  3PVQ A;  2PFO A;  1X6J A;  3G7Z A;  3FDS A;  3TQ1 A;  2EQJ A;  2XDD A;  2EKO A;  3H8J A;  4NL9 C;  3OYJ A;  3OYH A;  3P8B B;  4KGV B;  2F44 A;  2QA4 T;  2LVM A;  2VKN A;  1YIT Q;  1NZ9 A;  2K4Y A;  5KFP A;  3LH0 A;  1WIE A;  5FU6 C;  4KIT B;  3S6J A;  5GAN d;  3QKJ A;  3WKB A;  4M04 A;  1YJ9 T;  3OS2 A;  3C4S A;  5J0R A;  3H7I A;  2LCL A;  3SWN C;  2G06 A;  2KMD A;  9ATC B;  5CKD A;  3CD6 T;  4O5C A;  2YQE A;  1ZQI A;  4F04 B;  3DKM A;  1J97 A;  3L3F X;  3CBO A;  5KT2 A;  2BQR A;  1S0V A;  3IDW A;  4J9P A;  4M77 E;  4J6W A;  1ZQE A;  2JRZ A;  5J8Y A;  5KT5 A;  2ABL A;  5HY6 A;  1B43 A;  9ICE A;  3CC2 A;  5KG6 A;  1RL2 A;  4I2D A;  3QYP A;  3MJX A;  1UT5 A;  2RHI A;  5LL6 S;  1FXX A;  3M4G A;  2A7Y A;  2HMA A;  1PRL C;  2DKX A;  2E8M A;  4YMO A;  2DLP A;  2RI3 A;  1YZ7 A;  5KL8 B;  2BZF A;  2KTQ A;  1BKB A;  1Q95 G;  2MOX A;  2P0P A;  3A1P A;  1YIJ T;  3GPL A;  9ICJ A;  2ODG A;  2CYZ B;  2V9W A;  5KYX B;  2QAS A;  3M0T A;  2ZPB B;  2D3D A;  1NK7 A;  4BB7 A;  2RJC A;  3LGF A;  2BPG A;  1D1A A;  5J2K A;  3CCL Q;  2FDR A;  9ICC A;  4XUS A;  3RB3 A;  2LQK A;  3MEW A;  4J9I A;  3FYH A;  8ICG A;  3PZP A;  4M77 C;  2K8B B;  1PZN A;  4FFD A;  1WHK A;  3ZFJ A;  4IUV A;  2L8D A;  1ZUY A;  2KT1 A;  1NPR A;  2G0A A;  2DJQ A;  2EW3 A;  3OYA A;  4J83 A;  2DQN B;  2PNI A;  3LYI A;  2CS7 A;  2E8N A;  1RPL A;  5ALE A;  1ZQQ A;  4G3I A;  1W4S A;  2AKL A;  4M9L A;  2L3Q A;  3KD3 A;  2BQU A;  3EAE A;  3I35 A;  3EFO B;  4XK8 E;  4JRK A;  2KD1 A;  5CEH A;  5KFS A;  2QGF B;  2XD0 A;  1VQ6 A;  3EW9 A;  4KLM A;  3ED5 A;  3MCA B;  4M7D G;  2E1F A;  3NUQ A;  2K2V A;  5KYU B;  3PMI A;  1ZQH A;  4FZM A;  1N9S A;  4OB3 B;  1ZQ1 A;  4NLK A;  1ZRM A;  2W11 A;  3KHG A;  2KK4 A;  3EWA A;  2EVR A;  2LQ8 A;  4QVC A;  2KKP A;  2K79 A;  1KHI A;  1M8M A;  4QW8 A;  3VS3 A;  4RNN A;  1A0P A;  4ED3 A;  2AIR B;  1T0H A;  3LWL A;  1NYG A;  1RQN A;  2DGZ A;  4C8L A;  1M6Y A;  2BUD A;  5CR0 A;  2BGW A;  1VQN Q;  1J3T A;  5LJ5 h;  2RJE A;  4IIM A;  2L5Y A;  3TKA A;  8ICJ A;  1YJW T;  3QSU A;  1DJ7 B;  2GGR A;  3NS1 A;  1WHG A;  2Y1I A;  4Y92 A;  1WQW A;  1PWT A;  3CCJ T;  4A63 B;  3PY8 A;  4I2G A;  5HK3 A;  5HR6 A;  3VS0 A;  2X35 A;  1TSF A;  1WGS A;  1N62 A;  2E5Q A;  3I5R A;  3WK4 A;  3C95 A;  2CP2 A;  3EG1 A;  1TH7 A;  2LYA A;  1PC0 A;  1W2B A;  3BY7 A;  1YJN T;  5KG1 A;  2DIG A;  2VYT A;  1I4K 1;  2C2R A;  1NK0 A;  4BWJ A;  4YFK A;  3H0L B;  1NE8 A;  4QIW C;  2G6F X;  2J06 A;  4KMO B;  4Y91 A;  3N97 B;  2RPN A;  3QU9 A;  1ZQF A;  3NVW A;  3MR2 A;  4NXZ A;  3NVY A;  1O75 A;  2RJF A;  5A0G A;  2P0Q A;  2DTH A;  3G71 Q;  4F4W A;  5KT7 A;  4NLZ A;  4PZO A;  2WSF E;  4LE9 A;  5AKZ A;  3CCM T;  3RBB B;  1SV0 A;  2VIX A;  5KT4 A;  4PFP A;  4HXJ A;  4PLI A;  2QEX Q;  4XU3 A;  2BCS A;  3M8R A;  3MFI A;  1EX4 A;  3Q8R B;  2L0A A;  3AT1 B;  3JV3 A;  1DOQ A;  5L1L A;  2DPI A;  1Y7X A;  2EAN A;  2Y1J A;  4F2R A;  1VQK T;  2G08 A;  3U26 A;  3GIJ A;  5D6W A;  3RBD A;  2IA6 A;  2BHN A;  3C21 A;  1OU9 A;  1I8F A;  2FE9 A;  1ZQL A;  4J9B A;  4OMN A;  2K4I A;  3V7J A;  4CI0 C;  4LJX A;  3V7L A;  1PD1 A;  2GO7 A;  3OYL A;  5FU7 C;  2J6F A;  1VQ7 T;  9ICS A;  3IHQ B;  5J0Q A;  2O9S A;  5GAN 2;  4RQ5 A;  3CCU A;  1Q81 R;  3EH2 A;  2AHJ B;  5C6S A;  4QWE A;  3D2N A;  1GCQ A;  7ICO A;  3EFR A;  1WXB A;  5TIS U;  4O3R A;  2OTL A;  1V38 A;  5HHH A;  2NRZ A;  4DL4 A;  4ELU A;  2YLB A;  4YR2 A;  1JXM A;  4M78 E;  5AI4 A;  2F2V A;  1JXO A;  2HCF A;  2UVR A;  8ICH A;  2DEU A;  2F2X A;  7ICV A;  2H3Q A;  2RJD A;  4EBC A;  2ATC B;  3H0H A;  2EQM A;  2ZIX A;  1Q3U A;  1RM6 C;  4YG2 A;  1NJY A;  2A36 A;  4II1 A;  2P4R A;  3IM1 A;  2KJ5 A;  2ZIW A;  3M55 A;  1N8R R;  3BQ1 A;  2XIC A;  4DOB A;  3MDC A;  1Y0M A;  5AM3 A;  5AI9 A;  1Q7Y U;  1DRG A;  4QWA A;  5BOM A;  1MQ3 A;  3TVT A;  4C8Q G;  4F14 A;  5GAO q;  3BFM A;  2F2A B;  5ALR A;  5BOL A;  3V8J A;  2KZ3 A;  1GO3 F;  2LNH B;  5GJV B;  1QQ7 A;  3MEU A;  3VU3 C;  3M5A A;  4O3S A;  2DL0 A;  4JS5 A;  2MAX A;  2V26 A;  4Q5W A;  1IHV A;  1LKY B;  4DL6 A;  4B9M A;  5KYW B;  5CQY A;  5JRT A;  1KK7 A;  8ICM A;  3B0X A;  1M3C A;  2NUP A;  1K73 C;  4M78 C;  3TAN A;  4DO9 A;  3PV8 A;  2ED0 A;  1JMS A;  2VAN A;  2MYS A;  5GAO n;  3L2V A;  2LT1 A;  2AH5 A;  2N1R A;  3JPO A;  2V4R A;  1K0S A;  4JV2 A;  1QLN A;  5F9N A;  3H40 A;  1BNP A;  2V8I A;  3EGU A;  3WVD B;  9ICR A;  2W9B B;  3G6E A;  1FX7 A;  2LCS A;  2FZC B;  4FU6 A;  3JPS A;  3N4M B;  1CRX A;  4YTL A;  1KD1 C;  4F92 B;  3C29 A;  4I2B A;  2XY7 A;  5LJ3 g;  3DLM A;  1SXD A;  2YMP A;  2W9C B;  1C7Y A;  1IV8 A;  4E7L A;  4P4P A;  3H6Z A;  3RB6 A;  4I2A A;  5DDM A;  1OX9 A;  2HQH A;  4L6V 5;  4M7D B;  1U48 A;  4PPX A;  1N9R A;  2RHF A;  3HIL A;  4M9N A;  4ZGJ B;  2EYX A;  3C2M A;  1NG2 A;  3DV9 A;  4R8U B;  1T0J A;  5DLG A;  3EH1 A;  5IT9 E;  5DDY A;  3CC4 Q;  1YIT T;  4R0K A;  2XDB A;  3OYG A;  2DL5 A;  5AM4 A;  5IHI A;  4Q43 A;  2KE7 A;  4HVU A;  1XS9 D;  1QLY A;  3AQF A;  1RZT A;  4M75 D;  2COW A;  2JS2 A;  5KFH A;  1VQ9 T;  5DGB A;  2P4T A;  1BPB A;  4KLT A;  4LDU A;  4HCZ A;  2XVT A;  2PFQ A;  5CVI A;  2ZIU A;  1JO8 A;  4CDG A;  5CKH A;  2CUB A;  3P8H A;  1D3B B;  2P84 A;  4ZGD B;  3G4S A;  1UE9 A;  4ZNX A;  4GC6 A;  5IHN A;  1VDV A;  2W3R A;  3RJI A;  1AOJ A;  1Y57 A;  3WXM B;  1OEB A;  1M90 C;  2KNJ A;  2CZ6 B;  3I56 A;  5HHI A;  1YCS B;  3LGL A;  4F71 A;  1SIJ A;  2HMX A;  2K5L A;  4DOA A;  1M30 A;  3V6H A;  4A54 A;  1V76 A;  1MA7 A;  1LB2 B;  3QYG B;  4ECV A;  5ALZ A;  5EG2 A;  2ZUC A;  3HHT B;  4X5V A;  3EG9 A;  2LP5 A;  1Q82 U;  4NM1 A;  1I5L A;  1MMN A;  4FYV B;  2NRX A;  4FW1 A;  3UXP A;  5KFM A;  5EWG A;  2CP0 A;  9ICQ A;  4XTZ A;  1XO1 A;  3DDH A;  4I29 A;  4PL2 A;  5KT6 A;  1TS9 A;  1M27 C;  1E7O A;  3WK6 A;  1S76 D;  1T3L A;  1C20 A;  2L3S A;  4RTW A;  3REB B;  3CCS T;  4C8K A;  1UHU A;  1SV0 C;  4DQP A;  1V29 B;  3MPU B;  4BI4 A;  4F4Y A;  1ABQ A;  3GFK B;  4R64 A;  2DD5 A;  4PGQ A;  4F8R A;  2VGN A;  3V7R A;  2CUD A;  4AG1 C;  4XA5 A;  4RU9 A;  4M9J A;  2X4W A;  3M0U A;  4OJ5 A;  1QSL A;  1OI1 A;  3GZF A;  4C8M A;  3UF4 A;  3JB9 I;  3M9O B;  1LPL A;  4OP0 A;  4M7A F;  2ISO A;  2KJ9 A;  3QNM A;  4DEY A;  2DVJ A;  5AKG A;  2RNA A;  3QG1 A;  1A76 A;  1KKX A;  1YHQ A;  4GXK A;  1ZRN A;  4YN4 A;  2P35 A;  5L1K A;  1RUW A;  4PH5 A;  3VC8 A;  9ICO A;  4HVV A;  1K76 A;  2VC8 A;  1VQL A;  4JLG A;  2DYI A;  2HBM A;  2EAP A;  1PHT A;  4RQ1 A;  3INZ A;  4Y2X A;  2RI2 A;  1OOT A;  1O03 A;  2NRT A;  2KY9 A;  4PJO F;  3Q8M A;  4M7D E;  4RCB A;  4JUZ A;  1BVS A;  5KFR A;  1KJW A;  3JPP A;  2RDI A;  2EQI A;  3HPW A;  2EZY A;  4MF8 A;  5IXF A;  1WQ7 A;  4AFS C;  4BDY A;  4D6W A;  4PGX A;  4CCH A;  2RHX A;  3CCR A;  1SWV A;  5KFG A;  2SEM A;  5D46 A;  3A8L B;  4ORZ A;  4RQ2 A;  1KEJ A;  3ZDD A;  2R18 A;  4C8Q B;  3SV3 A;  4JRP A;  1Q81 U;  3JCM X;  4NL3 A;  3V7C A;  3GDX A;  3VS6 A;  1Z4O A;  3FDR A;  1A77 A;  4XTY A;  3H8M A;  3IG5 A;  5GAO m;  5KFW A;  4ED6 A;  3I55 Q;  4B6M A;  3RH6 A;  7ICK A;  2DL4 A;  3EG0 A;  1G3W A;  2CSI A;  2ASL A;  3VS7 A;  2NUZ A;  2KMT A;  3NTH A;  4ECT A;  2MSN A;  4ED1 A;  1HJD A;  4MMK A;  2OJ2 A;  8ICN A;  2CH4 A;  2EYY A;  3HWT A;  4QW2 A;  3D2Q A;  4ECY A;  2WF7 A;  2BCQ A;  2CZ7 B;  3G71 T;  5GTI U;  2OYY A;  2QAR B;  3E2U A;  5IIL A;  3TAD A;  2O31 A;  4X1V A;  2QEX T;  1KDH A;  3JCM V;  4FE3 A;  1COO A;  1AWX A;  2KG5 A;  1U1T A;  2FZG B;  1OZ2 A;  1VQ8 A;  5FRM A;  8ICE A;  1Q7Y C;  2VA8 A;  5AI6 A;  2D6F A;  2EAM A;  2MI6 A;  7ICI A;  3OW2 A;  1SHF A;  4JV0 A;  2KN7 A;  3MR5 A;  4O5E A;  3NGD A;  3NAS A;  2VVK A;  8ICI A;  5J2G A;  3GIM A;  5J2F A;  2QYZ A;  1FWZ A;  2IBK A;  1VIF A;  2ZPF B;  1K8A C;  3UWN A;  2YMM A;  3CCE Q;  1VQP T;  5KFY A;  4UW9 A;  4RQ3 A;  4KLG A;  2QG9 B;  4CF3 A;  5KFN A;  1OUL A;  2RB6 A;  3ZD9 A;  2RK1 A;  1BPY A;  3T5K A;  1TKD A;  1VA7 A;  5KG4 A;  4PL1 A;  1T8E A;  1M8V A;  1ZX6 A;  4M77 F;  1SRM A;  4J9R A;  1N56 A;  4M7A A;  2KFN A;  1NJI U;  4LXC A;  1ZQO A;  1PKS A;  4ZOH C;  4BY6 C;  3JB9 F;  1SB3 C;  4M75 G;  2FLP A;  2HZY A;  9ICU A;  5DBB A;  1S9F A;  5DG8 A;  5ALN A;  5J0T A;  3QJY A;  3ETR A;  3M9N B;  1EZZ B;  1K73 R;  5AM5 A;  3OB9 A;  5LJ3 e;  4BXO B;  4P4O A;  3QUI A;  4FCY A;  4P0P A;  2RO0 A;  3OYE A;  5ALK A;  2DZC A;  2JMA A;  2KR3 A;  4PJO A;  1L7O A;  3PSP A;  5I2S A;  4EZ9 A;  4CRI A;  3CME A;  4Y2Y A;  4PJL A;  1OXJ A;  2HOF A;  4LZD A;  1B34 B;  3RKX A;  3ALR A;  8ICU A;  4EDU A;  4O0I A;  4NWI A;  3ULR B;  1KD1 R;  4NL9 A;  3OJS A;  2G5H B;  3T5H A;  4KLU A;  3KUF A;  3N7S C;  4C0D C;  1YFN A;  1RI0 A;  4R63 A;  4MFC A;  2NLU A;  3F5A A;  1VYT A;  2VA3 A;  3EPI A;  1S72 A;  1QVP A;  5LJ3 f;  4A4K A;  2YN4 A;  2DK3 A;  3SWN A;  4C8Q E;  1ZOL A;  1QKW A;  1VQM T;  2GF7 A;  3CCQ T;  1NLP C;  1IO6 A;  2FB7 A;  4M4Z A;  1NK6 A;  2DPP B;  3CPW P;  3V7K A;  2O4X A;  1HJP A;  2PVG B;  1L5U A;  2KRO A;  3H0R B;  1Y96 B;  4RTY A;  4FT4 A;  4XU2 A;  2C2E A;  4KLD A;  1PNJ A;  3VRY A;  5EWF A;  2XMF A;  3X24 B;  4HYK A;  3A98 A;  3QWY A;  9ICA A;  1JU5 C;  4O3M A;  1LNX A;  2H3Z A;  3HRD D;  2QQA A;  1RQL A;  2DX1 A;  4M6W A;  5CIU A;  4QWC A;  4ED2 A;  1ZQU A;  2EZX A;  4QIW F;  1ZBJ A;  5I21 A;  5ALX A;  1RYU A;  5KYY B;  1QSS A;  2H3F A;  2K8A A;  4UAZ A;  2VUB A;  2F76 X;  2ROL A;  2V4Q A;  1H38 A;  4JZ3 A;  3SHW A;  2PI4 A;  3CC2 Q;  1Q82 C;  1LV5 A;  4HCC A;  3QU7 A;  3KZI U;  1NKB A;  4HCK A;  1M90 R;  4J9O A;  5ALQ A;  1U06 A;  3CC4 T;  3OW2 S;  2ISP A;  5GAM g;  5HKC A;  5AKL A;  1GCP A;  2JN0 A;  3OBW A;  1MMA A;  4F91 B;  5GJW B;  1UQV A;  5J0U A;  3LH5 A;  4EYI B;  5KG2 A;  3CEY A;  3GIK A;  2Y90 A;  2MRL A;  4DLE A;  1FFV A;  2WF8 A;  4M9H A;  2HDA A;  5KH6 A;  1RXW A;  1M9S A;  4M77 A;  9ICM A;  2LKY A;  5ALL A;  2NYV A;  3SD7 A;  2J7I A;  5CJ7 A;  1JJ2 P;  4RQ7 A;  3OTQ A;  3VYH B;  4N4G A;  4UB3 A;  2DIL A;  3MBY A;  2K89 A;  3CPF A;  5AK3 A;  1QSY A;  3VS5 A;  4BGD A;  4QVZ A;  2EQK A;  2FEI A;  4KBM B;  7ICG A;  1RDF A;  1U9L A;  4M7D D;  2K60 A;  3QJ6 A;  2WF9 A;  1IG6 A;  1UT8 A;  1VJ5 A;  4DL2 A;  3G6X A;  3C5G A;  1X9X A;  3IRU A;  3PSF A;  2KAF A;  5D4B A;  2SRC A;  3M9M B;  5AHX A;  5KCO A;  2BCU A;  4DQQ A;  5L23 A;  4EZ6 A;  1BBZ A;  2VXF A;  2HAX A;  4J9E A;  2YMQ A;  4PHD A;  1Z1V A;  5KFZ A;  2KT8 A;  2EBP A;  4TUP A;  2V1Q A;  4LDY A;  3V6J A;  2HVH A;  1SRL A;  2BE9 B;  4J9C A;  4RTU A;  5I22 A;  2B0C A;  2ZTE A;  2WAC A;  1NK8 A;  2DTI A;  2QA4 A;  4DQ2 A;  3VUZ A;  3E0F A;  1UFF A;  2YT6 A;  2CH4 W;  2DUY A;  4DSK A;  4JJD A;  1YJ9 A;  2DET A;  4C4R A;  3H8S A;  3SAH A;  1Z00 A;  4FYY B;  3L42 A;  3M59 A;  3CD6 A;  2V8K A;  3IV6 A;  5IIJ A;  3WK7 A;  3RJG A;  1I07 A;  2ZIV B;  1WJR A;  1SZH A;  1YCY A;  1XU4 A;  4C5I A;  2RP5 A;  5J2A A;  1H3Z A;  3R6N A;  4MZT A;  3A0H U;  4Z89 A;  4NS5 A;  2YY6 A;  5J2B A;  5J2H A;  4ZN1 A;  3REA B;  3PX6 A;  4M78 F;  5ALG A;  3BZC A;  1U47 A;  4CF5 A;  2OX7 A;  4TQR A;  2FRW A;  3QBY A;  3LWH A;  5J0W A;  1NLO C;  1QCN A;  2KDS A;  2AK5 A;  5DGA A;  1D9F A;  4XAX B;  3LLR A;  3L2Q A;  2WAQ C;  5IIK A;  4F7U G;  3C23 A;  3M0Q A;  1HD3 A; 
#chains in the Genus database with same CATH homology
 2RH2 A;  4N0A C;  4MZM A;  3S3O A;  4EMK B;  2GH1 A;  2QDY B;  2W7O A;  4M75 B;  2E1E A;  4MDX A;  5GAN 3;  2DKG A;  4C0F A;  3JCM P;  5GAO p;  1R8O B;  3HL8 A;  3HRU A;  4J7I A;  3S3M A;  3MEA A;  4RG2 A;  5GAO r;  2M0N A;  4JUV A;  3DEE A;  5GAM h;  2M0O A;  1MHN A;  2ZXI A;  3EFS A;  2EQU A;  3FB9 A;  2EAY A;  1VUB A;  4KT0 E;  4OO1 J;  1N27 A;  5LJ5 g;  2DZ9 A;  1URJ A;  3I55 T;  2K3Y A;  3X20 B;  1YI2 T;  1NJI C;  2OXO A;  4FL6 A;  1K73 U;  1EIF A;  3QHS A;  1PSF A;  1KD1 U;  3CC7 T;  1KQ2 A;  1VQ4 T;  4C8Q D;  4ELY C;  5GAN h;  3S3N A;  1YJW A;  3AL0 B;  1M1F A;  3CCJ A;  2XG8 D;  3CCE T;  2H3V A;  4GY5 A;  5FRN A;  3ER0 A;  1YJN A;  3IG8 A;  4M78 A;  1I81 A;  1HXD A;  1BI3 A;  2KVC A;  4GFJ A;  2EJF A;  2B8A A;  3JB9 H;  3CCM A;  3L2W A;  1M90 U;  4M75 E;  1P7D A;  1VQK A;  2R57 A;  2E10 A;  2G5I B;  4QQG A;  3GNG A;  1VQ7 A;  3LWI A;  3PT9 A;  3OBY A;  3UT1 A;  2H3I A;  2JH1 A;  2D0Q B;  3VJP A;  4OB1 B;  2M16 A;  5DM7 R;  3F2D A;  3H0M B;  3E1S A;  5LJ5 d;  3N7P D;  4OMF B;  4IC9 A;  2WSC E;  2PQW A;  3SDZ A;  3RMQ A;  3QZ5 B;  4M75 C;  4IUQ A;  2Y4Y A;  3FRN A;  4BAC A;  1ECW A;  3QII A;  3R6O A;  4F7U B;  2QQ9 A;  3GF5 A;  2F5K A;  4M7D F;  1VIE A;  2E6Z A;  2VV5 A;  4RKU E;  5I2M A;  3OYI A;  2MA1 A;  3LVW A;  2OTJ T;  2E12 A;  2RK2 A;  1WPY A;  4LD6 A;  3P8D A;  5CKB A;  2ZCF B;  3RER A;  2F5T X;  3QPH A;  2JNG A;  5HK0 A;  5CQX A;  3OS1 A;  4BUG A;  4HT8 A;  5A2Q E;  3PTA A;  4JS4 A;  3SAG A;  1PSE A;  4BJQ A;  3C12 A;  1YIT A;  4FZN A;  1WNL A;  3C28 A;  1VQ9 A;  3OYB A;  5CRX A;  1YT3 A;  4OJO A;  1GXI E;  3L2Z A;  2FYK A;  5GAO l;  3PST A;  5LJ5 e;  1BIB A;  4JLI A;  2Z7J A;  4XTU A;  2PU9 B;  2E65 A;  4C0G A;  1K8A U;  2RRD A;  2GFA A;  4OJ6 A;  2XID A;  3OA6 A;  1KBU A;  1W2B S;  4M7D A;  3V8K A;  1JRI A;  2JVV A;  5LJ5 f;  4JRI A;  2ZIX B;  2JTM A;  4QQ6 A;  4F7U E;  2RI5 A;  3CCS A;  5CCA A;  1UB4 A;  3X26 B;  1T94 A;  3PGG A;  1D3B A;  5LJ3 j;  4MDW A;  4OVA A;  2DD4 A;  3TU4 K;  4FT2 A;  1ZHI A;  4KUI A;  4XU0 A;  2A3V A;  2E6N A;  2DO3 A;  2VXE A;  3J81 E;  4P0Q A;  2L89 A;  2KVQ G;  2DEQ A;  3OYC A;  4BD3 A;  1G3S A;  2RHU A;  3FJP A;  5CKE A;  4C0Z A;  1XOV A;  3CMA T;  2Y4X A;  5HR7 A;  3FEO A;  4KX3 A;  3CCL T;  4IUR A;  3OQ5 A;  2PVO B;  3G71 A;  3M53 A;  2LRQ A;  3JCM g;  2QEX A;  4R56 A;  2WAQ F;  4FM4 B;  4C5H A;  4PJO G;  1X75 C;  1P92 A;  3CPW A;  4C8Q A;  3SMV A;  1VQP A;  2HBP A;  5LJ3 d;  2ZZD A;  4B9W A;  4HA8 A;  3VCB A;  4OB2 B;  1VQ5 T;  1VQN T;  4Z02 A;  3OYD A;  1Q3V A;  4IUU A;  2YB4 A;  2KIW A;  2K57 A;  1U8R A;  2R5M A;  5FRO A;  3F53 A;  1IIP A;  5C0Y A;  2HNI A;  2VGM A;  4N4H A;  2MWO A;  4FIB A;  1BI0 A;  2A3L A;  3VKI A;  3PIP A;  1MGQ A;  5GMK i;  3UDC A;  5GMK m;  1JJ2 A;  2PVD B;  1A6S A;  1O9S A;  4M7D C;  5D6Y A;  1VQM A;  3DB4 A;  4C92 G;  3CCQ A;  3CBM A;  1NPP A;  4M77 G;  1Z19 A;  5GAN 7;  2PMZ C;  4QNL A;  2K5I A;  3JB9 G;  4WJ3 B;  5KE3 A;  3MEV A;  5T14 A;  3PSI A;  3CYM A;  4N0A A;  3V8L A;  4OB0 B;  2RM4 A;  3JCM h;  5L8R E;  4WF2 A;  4J8O A;  4OGC A;  1B34 A;  3CC4 A;  4N4I A;  2LYB A;  1PVR A;  4GLK A;  4A4H A;  3FLG A;  2KQW A;  2BDU A;  1G3Y A;  1AHJ B;  1LOJ A;  2G07 A;  3CPW S;  5A0L A;  3HKS A;  1X01 A;  2DIQ A;  3F5E A;  1NZB A;  2E1H A;  2GQV A;  2I2L A;  5DY9 A;  1Y96 A;  3BW1 A;  2R58 A;  3SB2 A;  4V2S A;  3VUB A;  1PVP A;  3N5B B;  3VYG A;  3FIF A;  3FC3 A;  4M75 F;  1M1K C;  4ICA A;  3ZBD A;  2DTO A;  3A8M B;  4P0P B;  1JJ2 S;  4PJO B;  2YRV A;  2DXT A;  4NLC A;  3OS0 A;  5GAN 6;  4JDS A;  1M5Q 1;  5IAY A;  3RUX A;  2PUK B;  5GMK h;  3RF9 A;  2CZ1 B;  4O5V A;  2XI9 A;  4X9D A;  1IRE B;  3GIB A;  1UEB A;  4AYB C;  2QQR A;  5FU6 B;  4C8Q C;  2IG0 A;  4ATO A;  5GAN 4;  4X34 A;  2F69 A;  4A53 A;  3OMC A;  2DVE A;  4KUD K;  1ED1 A;  1KC8 U;  2O4X B;  1WJS A;  3BDU A;  1D8B A;  5GAM j;  4BE2 A;  4XTW A;  2FL7 A;  3A8O B;  4EMG A;  2MF2 A;  2ZPE B;  2QXF A;  2LHT A;  1OUQ A;  1XNS A;  4MZP A;  2ZIV A;  1QP2 A;  1KQ1 A;  2G3R A;  5GAN g;  2ZPG B;  3TEE A;  3I55 A;  4M78 G;  3QDR B;  1YI2 A;  4C92 B;  1YIJ T;  2JTF A;  4M77 B;  4JJN K;  2HBJ A;  2XDP A;  3L1A A;  4M75 A;  2XKO C;  3CC7 A;  1VQ4 A;  2RHZ A;  3PIO A;  3CBP A;  1ZBX A;  1HEK A;  3VV0 A;  3JCM c;  4OF1 A;  3KBG A;  3X25 B;  3RMS A;  4OJP A;  4E7H A;  2KEY A;  3CCE A;  2Y0S F;  2KKV A;  2RD1 A;  3HSB A;  3JB9 J;  5J26 A;  4IUP A;  3HFN A;  2ZGW A;  3OS5 A;  4ZGE B;  4KX5 A;  3M58 A;  2HOI A;  5GAM d;  4HCB A;  2DF4 B;  3KZX A;  3SD4 A;  2ZXH A;  2BKD N;  1VQO T;  4RG8 A;  3M6Z A;  2GCX A;  3H8Z A;  3GP8 A;  1QW1 A;  2KJ8 A;  2HOQ A;  2VJ4 A;  3JCM W;  2HQE A;  5LJ5 j;  3QZ9 B;  3RES A;  4LDX A;  4X9C A;  1BYM A;  2C06 A;  1XQH A;  3LYS A;  4ME7 A;  4U7C A;  2W04 A;  3PNW C;  4E47 A;  3J7A F;  1BI1 A;  4E7K A;  4OJL A;  1WJQ A;  5FU7 B;  4C92 E;  5CKF A;  3CCV T;  4VUB A;  1WUD A;  2DXC A;  2O01 E;  4XU1 A;  4PLL A;  2K4E A;  3MET A;  2CN1 A;  2Q4T A;  3PFS A;  2NV3 A;  2DXB A;  3MP6 A;  5IN1 A;  4CRX A;  4J7F A;  4JMU A;  2OTJ A;  3M56 A;  1KG1 A;  3NTK A;  3JRZ A;  4BE1 A;  2HBK A;  2LX9 A;  2IVW A;  1UGQ B;  3CRX A;  2GFU A;  4C92 C;  2MMP A;  3RIR A;  2QQB A;  2D9T A;  5GAM e;  3OYN A;  3RKY A;  5M9O A;  4UC4 A;  2QI2 A;  4M78 B;  4MML A;  4BX9 C;  3F70 A;  3IN5 A;  3OYM A;  1KC8 C;  5J3B A;  2JGA A;  2KIC A;  3V7S A;  4F7U A;  1LJO A;  3A5Z B;  2BIV A;  3L2U A;  2YX8 A;  5GAM f;  4R55 A;  4EMK C;  4XTX A;  4XQ3 A;  2L5Q A;  3SFM A;  4NL2 A;  3MHX A;  3CC2 T;  5GAN e;  1BIA A;  3M9Q A;  3HRT A;  3HP9 A;  4M7A D;  2PMZ F;  2H3J A;  1K9M C;  4RMO A;  4ZTJ A;  2FHD A;  3GU3 A;  2W7P A;  2XHC A;  3OYY A;  3KXT A;  5GAN f;  4PJO D;  2XU8 A;  2KSS A;  2KOB A;  2EWN A;  4A4G A;  3Q1J A;  3URG A;  3JCM b;  1YBY A;  4LDV A;  5CR2 A;  3K1Z A;  3RKW A;  1VQ6 T;  4ZN3 A;  4C5E A;  2CKK A;  2JZ2 A;  1Q86 C;  1KHC A;  2ZPH B;  1TAM A;  1Y71 A;  4OGE A;  3AQE A;  2WB1 C;  2JUF A;  2M9U A;  1UGP B;  2GOL A;  4KUL A;  1UPH A;  3NRW A;  4DOW A;  5J39 A;  4U6P A;  4FZL A;  1L6N A;  5GAN 5;  5GMK l;  3HKZ C;  5D6X A;  2YLC A;  3CP8 A;  1M4Z A;  2EYQ A;  3CMA A;  3HFO A;  4C92 D;  4A4E A;  4J6X A;  2XK0 A;  4XTV A;  5CO7 A;  4J6Y A;  2MAM A;  5FLX E;  3CCL A;  4M77 D;  2Y0S C;  2X4Y A;  2ZIW B;  2LC4 A;  3UPU A;  3JB9 D;  3AHU A;  3LX7 A;  2LCC A;  3ZEH A;  4BE0 A;  4AYB F;  1H64 1;  2DJZ A;  4C8Q F;  1G5V A;  4DA4 A;  3A8H B;  1X6O A;  4PNO A;  3MO8 A;  2DXU A;  2EJ9 A;  3OMG A;  2X4X A;  3JSC A;  2FVU A;  4QQD A;  5GAN 8;  3CCU T;  1OYX A;  3LVV A;  3E9F A;  1QVF A;  1QP3 A;  2OTL T;  2CPR A;  1M1K U;  1VQ5 A;  1ZQ1 C;  4C5G A;  1VQN A;  4IUT A;  2YB1 A;  2E64 A;  5KCH A;  1Y07 A;  4E7I A;  4NOY A;  4RCC A;  3NFC A;  1PVQ A;  2LBO A;  3E19 A;  2JOY A;  2OAU A;  2P0K A;  4B9X A;  4BY6 B;  2OH2 A;  3C94 A;  4M7A G;  4J5Y A;  2E5S A;  3JCM Q;  4LDW A;  2ZIU B;  3M7D A;  1OZ3 A;  2LT4 A;  3M54 A;  3MP1 A;  3O8V A;  1BI2 A;  2F8L A;  3G6E T;  3N7R C;  4P0Q B;  3IP4 B;  3SAF A;  1XNI A;  4BI3 A;  4ELZ C;  3A8G B;  5C0M A;  4C0D B;  2R5A A;  2L3R A;  4FSX A;  3OYK A;  2LNV A;  4Y28 E;  2HBL A;  1XTD A;  2K5F A;  2HD0 A;  3OSS C;  3HRS A;  3ICX A;  3T79 A;  2JHD A;  3GLX A;  5LJ3 h;  1QVF S;  3KFU F;  5KE2 A;  3E9G A;  1UGS B;  2JMG A;  4JRQ A;  3G4S T;  1UGR B;  4PL6 A;  3I56 T;  4QJF B;  1JBM A;  1QVG A;  3DB3 A;  4M78 D;  2ZPI B;  4EPC A;  2LTO A;  2K4H A;  3F2B A;  4QVD A;  3QXE B;  3OSV A;  1IZ6 A;  5GMK j;  2F77 X;  3ASK A;  1N8R U;  4BDZ A;  3M57 A;  4O6J A;  4L59 A;  3JCM d;  3QYH B;  1XO0 A;  2EIF A;  4A4F A;  4BI8 B;  1YHQ T;  2DAQ A;  1JB0 E;  2E41 A;  3JAM E;  3SQI A;  1VQL T;  2MWP A;  5CAI A;  4C92 F;  2ZG6 A;  3S6W A;  2QTX A;  3LW5 E;  3WVE B;  5AYF A;  3GNF B;  2OM6 A;  1KQS A;  3CCR T;  2M1H A;  3TCJ A;  3F2C A;  2CGH A;  2VKQ A;  4M7A B;  3L2R A;  1M1G A;  1Z1B A;  2QQS A;  1QVG S;  4ZTF A;  3D2S A;  3J80 E;  1YIJ A;  4HKE A;  3OYF A;  1U1S A;  5CK9 A;  3T9N A;  1VQ8 T;  4ACO A;  1G3T A;  2PUO B;  2E70 A;  2W03 A;  3CXC A;  2K8C B;  3SWN B;  2EFI A;  5DLQ E;  2HQX A;  3JCM e;  3ME9 A;  2CRX A;  3NTI A;  3M4Y A;  4LD9 K;  4NLB A;  2KV2 A;  4NV0 A;  3ONN A;  3M6K A;  4C92 A;  3JCM J;  2JH7 A;  3CME T;  2WSE E;  4TVR A;  1VQO A;  3JCM f;  2LDM A;  3OY9 A;  2WB1 F;  1KQS S;  4IKF A;  2EJG A;  3MGV A;  4CGZ A;  1HK9 A;  4HT9 A;  1S72 T;  1K9M U;  2KHQ A;  1N6A A;  5GAN j;  4EMK A;  3GOX A;  3BDL A;  3TRE A;  3HKZ F;  4EMH A;  4M7A E;  2RA2 A;  1SSF A;  3X28 B;  3O0F A;  2D6F C;  1Q81 C;  3CCV A;  2G09 A;  3PMT A;  4PJO E;  4P5N A;  2YHT A;  3OPX A;  5GMK e;  1Q86 U;  3RFA A;  2RHY A;  4L5G A;  3QO3 A;  4A8E A;  5DLO A;  2V8J A;  3CXC S;  4PKC C;  2X4J A;  1F44 A;  1HIW A;  1N8R C;  4M7A C;  4DOV A;  2CZ0 B;  3MP8 A;  2KHV A;  2VJ5 A;  4E7J A;  4F7U F;  3DLL A;  2K3X A;  4PJO C;  5KL1 B;  5A0D A;  3G7Z A;  2EQJ A;  2XDD A;  2EKO A;  3OYJ A;  3OYH A;  3P8B B;  2QA4 T;  2LVM A;  1NZ9 A;  2K4Y A;  3LH0 A;  5FU6 C;  5GAN d;  3QKJ A;  1YJ9 T;  3OS2 A;  3C4S A;  2LCL A;  3SWN C;  2G06 A;  5CKD A;  3CD6 T;  3DKM A;  3CBO A;  3L3F X;  4M77 E;  4J6W A;  5HY6 A;  3CC2 A;  1RL2 A;  2RHI A;  5LL6 S;  1FXX A;  3M4G A;  2A7Y A;  2RI3 A;  1BKB A;  5KL8 B;  2P0P A;  3GPL A;  2CYZ B;  2ZPB B;  4BB7 A;  2RJC A;  3LGF A;  2LQK A;  3MEW A;  3PZP A;  4M77 C;  2K8B B;  3ZFJ A;  4IUV A;  2L8D A;  1NPR A;  2G0A A;  3OYA A;  4J83 A;  2DQN B;  3LYI A;  2CS7 A;  1W4S A;  4XK8 E;  3EAE A;  4JRK A;  2KD1 A;  2XD0 A;  1VQ6 A;  4M7D G;  3MCA B;  2E1F A;  3NUQ A;  2K2V A;  3PMI A;  4FZM A;  1N9S A;  4OB3 B;  1ZQ1 A;  2KK4 A;  2LQ8 A;  4QVC A;  2KKP A;  1KHI A;  1A0P A;  2DGZ A;  2BUD A;  5LJ5 h;  2RJE A;  1YJW T;  3QSU A;  1DJ7 B;  1WQW A;  3CCJ T;  5HK3 A;  5HR6 A;  2X35 A;  1WGS A;  2E5Q A;  3C95 A;  1TH7 A;  2LYA A;  1W2B A;  3BY7 A;  1YJN T;  2DIG A;  2VYT A;  1I4K 1;  3H0L B;  1NE8 A;  4QIW C;  4Y91 A;  4KMO B;  1O75 A;  2RJF A;  5A0G A;  2P0Q A;  2DTH A;  2WSF E;  3CCM T;  2VIX A;  4PLI A;  4XU3 A;  1Y7X A;  1VQK T;  2G08 A;  5D6W A;  1I8F A;  2K4I A;  4CI0 C;  3OYL A;  5FU7 C;  1VQ7 T;  5GAN 2;  3CCU A;  2AHJ B;  5C6S A;  3D2N A;  3EFR A;  2OTL A;  2YLB A;  4M78 E;  2H3Q A;  2RJD A;  2EQM A;  2ZIX A;  1Q3U A;  4II1 A;  2KJ5 A;  2ZIW A;  3M55 A;  2XIC A;  1Q7Y U;  1DRG A;  4C8Q G;  5GAO q;  3BFM A;  2F2A B;  3V8J A;  1GO3 F;  3MEU A;  3VU3 C;  3M5A A;  4JS5 A;  4Q5W A;  5CQY A;  1K73 C;  4M78 C;  3L2V A;  5GAO n;  2LT1 A;  2N1R A;  3WVD B;  3G6E A;  2V8I A;  1FX7 A;  4FU6 A;  1KD1 C;  1CRX A;  4YTL A;  3C29 A;  5LJ3 g;  3DLM A;  4E7L A;  3H6Z A;  4L6V 5;  4M7D B;  1N9R A;  2RHF A;  4ZGJ B;  5IT9 E;  1YIT T;  2XDB A;  3OYG A;  3AQF A;  4M75 D;  1VQ9 T;  2P4T A;  4LDU A;  4HCZ A;  2XVT A;  5CVI A;  2ZIU A;  4CDG A;  5CKH A;  3P8H A;  4ZGD B;  1D3B B;  3G4S A;  3WXM B;  1M90 C;  2KNJ A;  2CZ6 B;  3I56 A;  3LGL A;  2K5L A;  2HMX A;  4A54 A;  1MA7 A;  3QYG B;  5EG2 A;  3HHT B;  1Q82 U;  1I5L A;  4XTZ A;  4PL2 A;  3CCS T;  1V29 B;  4BI4 A;  2DD5 A;  2VGN A;  3V7R A;  2X4W A;  4OJ5 A;  1OI1 A;  3GZF A;  3JB9 I;  4OP0 A;  4M7A F;  2KJ9 A;  3QG1 A;  1YHQ A;  3VC8 A;  2VC8 A;  1VQL A;  4JLG A;  2HBM A;  3INZ A;  2RI2 A;  2KY9 A;  4PJO F;  4M7D E;  4RCB A;  4BDY A;  3HPW A;  1WQ7 A;  4D6W A;  2RHX A;  3CCR A;  3A8L B;  2R18 A;  4C8Q B;  4JRP A;  1Q81 U;  3JCM X;  4NL3 A;  3V7C A;  3FDR A;  4XTY A;  3IG5 A;  5GAO m;  1G3W A;  2KMT A;  3NTH A;  4MMK A;  4QW2 A;  3D2Q A;  2CZ7 B;  3G71 T;  2OYY A;  2QEX T;  3JCM V;  4FE3 A;  1U1T A;  1OZ2 A;  1VQ8 A;  5FRM A;  1Q7Y C;  2D6F A;  2MI6 A;  3OW2 A;  1FWZ A;  1VIF A;  2ZPF B;  1K8A C;  3UWN A;  1VQP T;  2RB6 A;  2RK1 A;  4PL1 A;  1M8V A;  4M77 F;  4M7A A;  1NJI U;  4BY6 C;  3JB9 F;  4M75 G;  3QJY A;  3OB9 A;  5LJ3 e;  3QUI A;  4P0P A;  2RO0 A;  3OYE A;  2DZC A;  4PJO A;  3PSP A;  5I2S A;  4CRI A;  3CME A;  2HOF A;  1B34 B;  3RKX A;  3ALR A;  4EDU A;  4NWI A;  2G5H B;  3KUF A;  3N7S C;  4C0D C;  1RI0 A;  2NLU A;  3F5A A;  1S72 A;  1QVP A;  5LJ3 f;  4A4K A;  2DK3 A;  3SWN A;  4C8Q E;  1VQM T;  2GF7 A;  3CCQ T;  2FB7 A;  2DPP B;  2O4X A;  2PVG B;  3H0R B;  1Y96 B;  4FT4 A;  4XU2 A;  3X24 B;  4O3M A;  1LNX A;  2H3Z A;  2QQA A;  5CIU A;  5I21 A;  4QIW F;  2H3F A;  2K8A A;  2VUB A;  2F76 X;  1Q82 C;  4HCC A;  3CC4 T;  3OW2 S;  5GAM g;  5HKC A;  3OBW A;  2JN0 A;  3CEY A;  2Y90 A;  2MRL A;  5KH6 A;  1M9S A;  4M77 A;  2LKY A;  3VYH B;  4N4G A;  2K89 A;  3CPF A;  4QVZ A;  2EQK A;  4KBM B;  4M7D D;  3QJ6 A;  3PSF A;  2KAF A;  5KCO A;  2VXF A;  2HAX A;  4LDY A;  2WAC A;  2QA4 A;  2DTI A;  4DQ2 A;  3VUZ A;  3E0F A;  1YJ9 A;  3SAH A;  3L42 A;  3M59 A;  3CD6 A;  2V8K A;  2ZIV B;  1WJR A;  1SZH A;  1YCY A;  4C5I A;  2RP5 A;  1H3Z A;  4MZT A;  4NS5 A;  4ZN1 A;  4M78 F;  3LWH A;  3QBY A;  2KDS A;  4XAX B;  3LLR A;  3L2Q A;  2WAQ C;  4F7U G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...