4B9MA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-da dna lesion -thymine basepair in the post- insertion site.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9mA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9mA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9mA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9mA01
3VQEA 2KFZA 5EWGA 4O3QA 4LH4A 4P4MA 4F2RA 3HPOA 3V9XA 4KLMA 1L3UA 1F21A 2C2EA 4E3SA 5KFGA 3LWLA 1O1WA 5J0TA 3AVAA 1RT5A 1RXVA 2C2DA 5CA7A 1N6QA 3OYGA 4KN4A 1Q8IA 1KSPA 3OJUA 3OYJA 4XA5A 4DF8A 3V9SA 1I39A 1HJPA 4YMOA 4M3ZA 4OVLA 2ZUCA 4LH5A 3KK2A 1RNHA 4CK2A 1ZQLA 4M45A 4NY8A 4CIEA 2XCAA 5KGWA 5HLFA 9ICFA 3QZ7A 1XSPA 2A1JA 4PGXA 4KKOA 4ED1A 5KFRA 1ZQKA 3EYZA 3ZT2A 4J9MA 3RH5A 4DQSA 2ITGA 1U45A 3QIOA 4G1QA 5D46A 1HNIA 5J0UA 4ID5A 4R66A 3U6FA 4CEEA 3PUFA 4Z4CA 4E89A 4Q5VA 1EKEA 2F1JA 3HPGA 3RWUA 5CWRA 3IM1A 1BPEA 4N47A 1ZQFA 4YN4A 1S0OA 1HRHA 4EYIB 4DF4A 4KHYA 3PMNA 1CUKA 3RMBA 4CJFA 9ICCA 4FJGA 4RT3A 2JZBA 4M04A 3L2WA 4DL6A 4DL4A 3SPYA 1EXNA 4CHNA 4F5NA 1ZQRA 3ZSXA 4FJLA 5J0SA 5HRNA 5DB9A 2R8GA 5HRSA 1SZPA 7ICUA 4YVZA 4IRDA 4KMUA 4LVSA 1LV5A 5J1EA 4B9SA 2PY5A 3TQ1A 4H4MA 4RG8A 3F9KA 1TAQA 4TUPA 2IHNA 1S76D 3VQ4A 1JL1A 3MR5A 1UAXA 2BGWA 3V6KA 2P51A 3ZT3A 4CGHA 4M42A 3GILA 3VQDA 1LB2B 4FJJA 3PNCA 4OPJA 1U49A 3LDSA 1T05A 1IKWA 4R8UB 2I9GA 4CGFA 4DL2A 5KFZA 4QZHA 3MFHA 1VSFA 1FXXA 1S6QA 1ZJNA 2Y1JA 2WOMA 4P4PA 3LZIA 1RBVA 3VQBA 3FYHA 3OY9A 1TL1A 3FDSA 3OJSA 4KLJA 5L1IA 5KRTA 2O4GA 4DSLA 3C2LA 4GXJA 3OYAA 4KLDA 2V4RA 1ZBUA 8ICGA 4CJVA 1UT5A 3MEGA 4Z6FA 4DOAA 4N41A 5KFQA 4ELUA 3NF8A 1JLBA 2FBYA 4DL5A 3AUOA 4HUGA 1ASWA 3AVGA 3GV7B 4MEYA 4CEQA 4J9SA 2ZTDA 4O3RA 4CF8A 4JLHA 1BPDA 3TARA 3RRHA 1VSJA 1JX4A 3G6YA 2O4IA 4DQRA 3BQ2A 3T3FA 9ICHA 1RDBA 4NLKA 4BXOB 1RTJA 3KK3A 1JIHA 4YXMA 1ZQGA 2P5GA 3AVBA 4I2BA 4F4YA 2BCRA 1SL2A 2YV0X 1LW0A 4BDYA 4CERA 1VSEA 4IQTA 9ICPA 4KFBA 1KCFA 2X78A 4XQ8A 1ZETA 2RPIA 1HNVA 3GQCA 1KVCA 3H8SA 2F96A 2Z1JA 7ICFA 1PZNA 1T8EA 3GV8B 4PY5A 1GOCA 4M3TA 4CJPA 1WCNA 8ICJA 4FS1A 4FM0A 4E0DA 3QNOA 2DPJA 4E7JA 3HW8A 3LWMA 1VRTA 5J2QA 2DTUA 5IIOA 1NK7A 2IGIA 3P1GA 1EETA 4J2DA 4IFYA 3C5GA 3PX0A 1L5UA 2JEIA 3QEXA 1IG9A 4YXJA 5HMMA 4EP4A 5HROA 1BIZA 3HJFA 1D9DA 3KD5E 4TUQA 3V6DA 8ICSA 4R5PA 4XIUA 2NUBA 5KFJA 4RPXA 2G8FA 1S10A 3MR3A 3AO5A 1Y88A 5KG1A 4AH9A 4O5BA 4M3XA 3TAMA 4XUSA 4Z4HA 2D5RA 4YQWA 5BPCA 8ICIA 3VQQA 4PHDA 5HMLA 3V7LA 1WAJA 3ISNC 3BJYA 4BWJA 4H8KA 2W9CB 1FKOA 3B6PA 4M9JA 1SKSA 1XS9D 3RB0A 3CM5A 4KN7A 4DSEA 1IXRA 7ICMA 2FLPA 3HM9A 3OYBA 4MFAA 4O55A 3NGYA 3HSTB 1XC9A 4CF2A 1NJYA 3L2UA 3NGIA 9ICIA 4KLGA 3UQ0A 2HHQA 3IG1A 5JS2A 1HUZA 4CEFA 4X5VA 4NCGA 3OYLA 5J29A 4KI6A 4M41A 4CESA 1RBUA 1REVA 3G10A 2X6SA 4B8AB 3TANA 3KLHA 4JRPA 4KV8A 3HP9A 3S3NA 3NFAA 4LY7A 3Q8LA 4C8OA 3PO4A 3QEAZ 4I2PA 3P83D 4CF0A 5KFSA 1XO1A 4DTSA 1BHLA 5CZ1A 3PW0A 2PFQA 2XGPA 2XHBA 4KPYA 3LALA 2OWOA 2ISOA 1A76A 5J2JA 1WSFA 3C6TA 3K58A 4M47A 4F50A 4Z4IA 1JLAA 1KTQA 4KAZA 4M2YA 2ASJA 4DFJA 1NJXA 4KREA 4DL7A 4ECWA 4QWEA 4RNOA 1B9FA 3NE6A 4RQ8A 2DFHA 5L1JA 1ZQUA 1ZQWA 2FPLA 4ED7A 4J9OA 3C94A 3HWTA 1WNSA 1GOBA 9ICWA 1I3AA 1U4BA 1BVSA 2IA6A 4CJTA 1COOA 7ICTA 3NH2A 1LWCA 3RJFA 3CFRA 1VSMA 2VWJA 3QEVA 4CK3A 9ICUA 5FRNA 1WCLA 3ZT0A 2C2RA 3RAXA 4ELTA 1Z25A 4M3WA 2RKIA 5BOMA 2W8KA 3JPOA 2UVRA 4KLFA 3KLEA 1ZQZA 4KLUA 1WSGA 2Z1HA 3L3UA 1BPBA 4O0JA 1D8YA 3V4IA 1BPXA 4N76A 2BQ3A 3RTVA 1K6YA 3AA3A 2WONA 3IS9A 3SZ2A 1IKVA 5KFYA 3B6OA 2W42A 3V7KA 1S97A 4M3RA 3RMDA 3L3VA 4M9LA 1DGSA 1S9GA 1XWLA 2JEJA 4FJXA 2Q3SA 4CJ5A 4GC6A 5J2CA 9ICAA 2B5JA 3F73A 4KI4A 4CHQA 3OYEA 1BQMA 2W9BA 2AU0A 2P6RA 3AVMA 3K75D 2GV9A 4KHSA 5KFTA 4PH5A 2M9NA 4KRFA 4O3NA 5J2PA 2HNZA 3GIMA 4CCHA 1VSLA 4CJWA 3NCIA 1B9DA 3PW5A 4OKJA 3DLHA 3BQTA 4RW9A 2R8IA 2OZSA 2P1JA 1XSLA 5DB6A 2BCUA 1KRPA 4YG2A 3PR5B 2AJQA 4ZHRA 4DU1A 2B4JA 4CF1A 2VA3A 2LYHA 3NH0A 2W9AA 1B92A 3AU6A 4CGGA 4DL3A 8ICRA 2W9MA 1QTMA 5KFOA 2EX3A 2G8VA 3C6UA 5CYQA 3AA5X 2GUIA 3EW9A 3K5LA 5IIKA 2A1JB 2IMWP 4NLGA 1VSHA 2DPIA 3SV3A 2BQUA 3K2PA 4FXDA 2FC0A 3K4GA 2ZD1A 4F93B 3PR4A 2HB5A 2BHNA 1KLMA 2ETJA 2F1IA 2XY6A 1A77A 5KG0A 9ICRA 4PWDA 1LWEA 4O5EA 3OSNA 1KFDA 5KRSA 4RQ6A 3AA2A 4HYKA 4QW8A 7ICIA 3IAYA 4J2EA 4Q8EA 1UA1A 3MBYA 5HNKA 1KDHA 1BI4A 3AV9A 2X74A 5DB8A 3NF9A 1NOMA 2YNIA 1L3SA 5J0WA 8ICYA 5FRMA 1Z00A 3H8WA 5EOZA 2ALZA 3O4QA 3ZSYA 2ASLA 5J2BA 7ICHA 4C8LA 3VQPA 3RJHA 3ZDEA 4C8NA 3LP1A 4O3OA 2HHXA 3WNEA 3ZT1A 1BPYA 4QZAA 1TKXA 4RW4A 1C1BA 4UB4A 2ZJ8A 4CJSA 1CZ9A 9ICKA 3LP0A 1BQNA 8ICKA 4YMNA 4H4OA 4CHOA 3T1AA 5KFUA 2PYJA 4AHSA 4KHQA 3DLGA 1NKEA 1TKZA 2FBXA 5HRPA 3V6JA 4EZ6A 7ICEA 5I3UA 4HHTA 2PFOA 1WSHA 3OS1A 4B9LA 2ISPA 4J9LA 4J9QA 5J2FA 1ZQIA 1J9AA 1EP4A 3OYNA 8ICBA 3ALYA 4O0IA 3G6XA 4GC7A 7ICPA 1ZBIA 2ASDA 4Z6EA 4AHCA 1MQ3A 1RYRA 3UIQA 4ZTFA 5KI6A 1VK0A 4RZRA 3MEDA 4CEOA 3H4DA 4FJKA 4Q44A 3SV4A 4MF2A 3SNNA 3AVKA 1QSLA 3MECA 1C1CA 4GVMA 3CQ8A 4JS5A 1YTUA 4DEZA 7ICKA 2Y1IA 3KD1E 2NRXA 3OYDA 3E01A 4CJEA 1RDDA 4RQ0A 4DFMA 3EPIA 2BGGA 3Q8KA 5D49A 3AVLA 1JLEA 3MGHA 4I2AA 4NCAA 1RTDA 1BISA 2LSNA 4FS2A 5KFPA 4RQ5A 4KHWA 4KLLA 4FJ7A 3HK2A 5KG7A 5KFHA 5CJ7A 3KHHA 4I7FA 4KO0A 3KK1A 4QWAA 2WTFA 3TFSA 3HX0A 1RXWA 4O4GA 4FW1A 4IBNA 4IRKA 2ZTCA 4FLZA 4ECSA 3PW7A 1TVAA 2VANA 3DRSA 3QEWA 3T19A 4UB1A 9ICTA 4F91B 2F1HA 5KT5A 2AQ4A 1S0NA 2YNHA 1U48A 4CFCA 4I2IA 4M9HA 4Z4GA 2R8HA 1KFTA 4NYNA 2PZSA 1RT4A 5KT7A 4QCLA 5EWEA 2A1RA 4YD2A 4QWBA 1W0HA 4QZ8A 2PXIA 4HCBA 1RT1A 2BDPA 2HHSA 2HW3A 1VRUA 3RH4A 1X9WA 4DOCA 2QKBA 4ECZA 1MU2A 1XU4A 4M6WA 5DBCA 3DOKA 3QINA 3SI8A 1RT7A 5DBBA 2HHTA 3V7JA 1QQCA 2KZZA 9ICBA 2IBKA 3OYIA 3RAQA 4PPXA 4B9VA 3NGDA 3EZ5A 3ZT4A 5KT6A 3U3GA 3QIPA 9ICQA 3OYFA 2IOCA 4ECRA 2OPQA 2JEGA 4IR9A 4I2JA 4F4KA 8ICNA 2FMQA 8ICMA 2IDOA 2BANA 5J2GA 4E7HA 4FLYA 4K8XA 1N48A 5EU7A 3N97B 4M3UA 4CJRA 1WAFA 3KIOA 4ECQA 2OYQA 1VSDA 5DB7A 5DLFA 3S3MA 1KLNA 1C0TA 3L2QA 4DMNA 2KTQA 1RDAA 1NK8A 4UBCA 4PHAA 3WNFA 4R63A 3V9WA 1HQUA 3HXMA 1FK9A 1T03A 9ICNA 3LANA 2JLEA 4W5NA 4DSKA 3SUOA 3GIKA 3LAMA 1MSWD 3VQ9A 1QHTA 5CR0A 2VA8A 4YR3A 2E6LA 2OA8A 1BIUA 3NAEA 1TAUA 2D0AA 4BDZA 4CHPA 2BPGA 5J0RA 1IO2A 3M8PA 4J9KA 3OYCA 3M8SA 3K5NA 4E1NA 8ICFA 3PV8A 4KLTA 2YNFA 4WE1A 8ICTA 4K4GA 4ECYA 4DTOA 1CEZA 2NRVA 5KT3A 4I2FA 1WN7A 4DSFA 1S1VA 9ICVA 3V1RA 3TAEA 9ICLA 4RW8A 3SQ0A 1BCMA 4CEZA 4OLBA 3ORYA 4BACA 3HP6A 1NOYA 3KHLA 4O5CA 1NK9A 5DLGA 1ZQOA 4I2EA 3MFIA 2ZE2A 1ITGA 3I8DA 9ICEA 1RBSA 1T3NA 5L9XA 3KTQA 4F92B 4QZDA 3WNGA 4AILC 3MDAA 1NKBA 4KTWA 1A5WA 4CEDA 5DBAA 4FJMA 3N4MB 4EBDA 2BQRA 4YR2A 4IKFA 5EWFA 1BGXT 1DTQA 5TZVA 7ICSA 4ED8A 1HYSA 5L1LA 3OSPA 4FJHA 2BE2A 1ASUA 3RMAA 2BR0A 5FDLA 4DTUA 9ICSA 3QESA 3M9OB 4DTJA 3QETA 3MAQA 3LK9A 4I2CA 3KJVA 4CE9A 5DMRA 4UB2A 2PFPA 1RT3A 3KLGA 3L2RA 4FLUA 1C7YA 4Z6CA 1TK5A 3M8QA 1RTIA 4W5OA 5IINA 4IQUA 3QE9Y 4EZ9A 4DU4A 1HQEA 4CEAA 5FROA 4EYHB 5BOLA 5HRRA 2F8TA 3JPNA 4CECA 2RN2A 2YHBA 4R65A 3KHGA 3T5LA 2J6TA 2XC9A 3VQ5A 4E1MA 2A1SA 4Q43A 1DLOA 1AROP 3DM2A 4I2DA 4QZGA 5CB1A 3RMCA 3IHQB 4F2SA 4XRHA 3QEPA 3SQ2A 5KT4A 1CXUA 4YCXA 3PO5A 1ZQNA 1WLJA 2PFNA 4KLOA 2KN7A 4GXKA 3DLRA 3ZSWA 1S1TA 4DS4A 3SUNA 4FW2A 3AVJA 4E7KA 5KFEA 3NH1A 3RB3A 3DRPA 1CXQA 7ICVA 4GW6A 4BE0A 2GBZA 1S0VA 1KVBA 2G8UA 3AA4A 4L8RB 4HUFA 2HHWA 5CZ2A 5C24A 4LD0A 4PA1A 2ZQBA 3O3HA 3KLFA 1C0UA 2PI4A 3ETLA 2IHMA 2RF2A 3DMJA 4CJKA 3B0YA 3UPQA 4G3IA 1CZBA 4DU3A 4P4OA 5KFWA 3TABA 4RQ2A 1EXQA 4JV1A 3QEBZ 4TURA 3MXMA 1TKDA 4RUCA 2UVVA 4CIFA 1Z26A 3EY1A 3ZD9A 4M3YA 1IM4A 4GMJB 2R8JA 4NLZA 1BCOA 2QK9A 4QWCA 2I1QA 2C22A 5J2NA 2R7YA 1Z00B 1C6VA 2ATLA 5J0OA 4I2QA 2G8HA 2IC3A 4M0AA 4MFCA 4DS5A 4J9RA 4DFKA 2RDIA 1S1UA 4GXIA 4M9NA 4JWMA 1L3TA 8ICAA 3CYMA 4NM1A 4ECUA 3GV5B 2FBTA 4QW9A 2FMSA 5KG2A 1A5XA 4QZEA 3MEEA 4QZBA 4ED3A 4QOZB 4RQ7A 1ZQSA 4CFDA 4B9NA 3C2MA 1WSEA 4Q0BA 3OHBA 1D9FA 4N5SA 5J2IA 4FYDA 7ICOA 1RTHA 4CK1A 4K4HA 3VQ6A 4JS4A 1J53A 3NDKA 5HHIA 1C1AA 5KG5A 4JV2A 4PHPA 2ATQA 4RQ3A 1Q9YA 3HT3A 1JL2A 8ICVA 5KFFA 1B22A 5SZTA 3O4NA 3ZD8A 1TFRA 3VQAA 3GDXA 2KW4A 3C1YA 4MF8A 5KGXA 2XGQA 4QZCA 4DO9A 1VSIA 4AHTA 4J9PA 2XY7A 3HVTA 1S1XA 3PW2A 4FLTA 2FMPA 3ISBA 5J2EA 1NKCA 3PW4A 3DLKA 4B08A 3H7IA 3LZJA 5CYMA 4QZFA 3BQ0A 1KVAA 3TWHA 1NJWA 2FBVA 3KKSA 1DOQA 3T5KA 4J2AA 3JYTA 4FZZA 3E2EA 5C25A 2MUTA 3RJIA 4RNNA 5KG3A 2DFLA 2BCQA 3MR6A 2YKNA 4IRCA 4IR1A 2VG6A 4HTUA 3RR8A 4FJ8A 3NTUA 2FLLA 4CGIA 1LW2A 1S5JA 1IH7A 2KQ2A 2NRZA 4HVJA 5KFLA 3HYFA 4CJLA 4CIGA 3UXPA 4MEXA 4OKEA 4DSIA 2XRIA 4C8MA 8ICEA 3HO1A 5J0PA 3VQ7A 4EP5A 3OS0A 2JZBB 2HHUA 3I0RA 2G8IA 2KFNA 4FK4A 2D0CA 1QSSA 4R64A 4F4XA 3C2KA 4F8RA 1NJZA 1CLQA 4K4IA 1S9FA 4I28A 1TV9A 3HPHA 1LWFA 2HNDA 1NOZA 1U9LA 1IKXA 3HL8A 3G6VA 3WNHA 5IIJA 4ZH4A 1T4GA 4QAGA 3Q8MA 4NXZA 3ASMA 4UB3A 1NK6A 1RILA 3V72A 1YVUA 4JV0A 1D8LA 3LP3A 2R8KA 2AQ0A 4CJQA 2AGOA 3JPQA 3Q8QB 3MXIA 5SWMA 4W5RA 5F9NA 3JPRA 2OPPA 1RT2A 5K14A 3RJJA 3TAGA 1S1WA 4YR0A 2X6NA 3QEIA 2E4LA 4OLAA 3MGIA 1RPLA 1HYVA 3L8BA 4RPYA 4MQ3A 3V81A 3VA3A 1TKTA 3SPZA 3RJGA 4OGEA 3T5JA 1W9HA 1ZQBA 1ZQJA 1TGOA 1LAWA 4O9MA 4OJRA 4EBEA 4M6WB 1N5YA 3D45A 3QZ8A 1KFSA 5CHGA 2P5OA 1Y97A 3MXJA 5KFDA 2ZJAA 1XSNA 2OZMA 1XI1A 3BDPA 3CFOA 5D4BA 8ICZA 3ISDA 4I27A 3RRGA 4FM1A 2QXFA 1SL1A 4AHRA 3H40A 1QLNA 5DGBA 4B3OA 4LZDA 5DKWA 3Q8RB 4DQIA 1YTAA 5KG4A 4CJ3A 4QZ9A 2VG5A 3D0PA 3DLBA 4E7LA 4OGCA 4DFPA 2ZTEA 4BE1A 4BDPA 1ZBHA 3ZCMA 1ZBLA 1Q9XA 2BCSA 4QWDA 3LPUA 3VQCA 1N56A 4NCBA 4TQRA 3AO1A 2IS3A 5JS1A 4J9NA 4F4WA 1X2IA 7ICRA 1ZQEA 2PYLA 3H08A 4IG0A 1JN3A 5KFCA 3H4BA 3V6HA 4NLNA 3ZSVA 4DLEA 4Y1CA 2F8SA 7ICQA 3BGRA 4Q45A 2V9WA 4FVMA 8ICPA 4I29A 2HVIA 2IAJA 4J2BA 4CHZA 4ECVA 1JLGA 3KHRA 4FZYA 5IIIA 1ZQAA 4O3SA 4CEBA 2UVUA 3K5OA 3K5MA 1JXLA 4TSXA 4Z4EA 3THVA 4P2HA 2MAXA 3OGUA 8ICCA 3JPPA 1ZQCA 2AGQA 1RYSA 2NRWA 1X9SA 1J5OA 1S0MA 4FCYA 1KEJA 4FK2A 3EWAA 4IFVA 4EBCA 4Z4FA 1R0AA 5J2MA 3CM6A 1NK4A 5KG6A 4KLSA 3AO2A 4KTZA 2GWSA 3L2VA 1BL3A 2D0BA 3QO9A 4W5QA 4O5KA 4HCCA 5CY4A 2ZUBA 8ICXA 2B6AA 3FFIA 4LZGA 3IRXA 2BPCA 1BPZA 1J54A 1JXEA 3NF7A 1RDCA 4KITB 1U04A 4DOBA 4FLXA 2XY8A 3KKRA 3ZSOA 4YFKA 3ISCA 1LAVA 5JUMA 5D3GA 1HMVA 1TK0A 1MC8A 1QSYA 1TVRA 4E7IA 3LPTA 4BE2A 8ICHA 5HBMA 1H38A 1ZQHA 4YP3A 2YKMA 5C5JA 4DQQA 3SI6A 2W8LA 3S3OA 1A5VA 1RZTA 5J2HA 4C8KA 3BQ1A 5HP1A 1UT8A 5KT2A 1G15A 1JLFA 1ZYQA 3C21A 4YMMA 5DG7A 4ICLA 4YFUA 4F3OA 1ZQXA 5J2KA 4F5OA 1ZQTA 4RW6A 4F5RA 4RNMA 4QZIA 3UQ2A 3LAKA 8ICWA 5DDMA 9ICXA 3H8JA 1MQ2A 1X1PA 1ZJMA 3SYZA 4KLEA 3TAFA 3K57A 3OHAA 3M8RA 1X9MA 4PGQA 4FLWA 3VA0A 4CGDA 5IILA 3AVFA 5DGAA 5KFVA 3ZDBA 1GOAA 4UQGA 5DQIA 3OYMA 1K1QA 4KHUA 4UB5A 2RDJA 3MDCA 3GIIA 1UOCA 1SKWA 3OVNA 4R8UA 2C28A 3AU2A 1TL3A 3RR7A 2NRTA 4ECTA 3DOLA 4PQUA 1ZQVA 3NF6A 5KFIA 3VQ8A 4ED6A 2G8WA 9ICOA 5T7BA 4RU9A 1XHXA 5F9LA 9ICJA 4N56A 1TK8A 4Q8FA 1FKPA 4I9LA 2JGUA 2BKEA 3MR2A 4B8CA 3DRRA 3QERA 1HJRA 3CG7A 3AVHA 3C23A 3QNNA 4PUOA 2KZMA 4FJ5A 9ICGA 4FJIA 4ZTJA 5J0YA 4UAYA 4JUZA 2HHVA 5E41A 4BXOA 2KZ3A 3O3GA 4KB1A 2HVHA 5IIMA 4FO6A 4CFAA 5CP2A 3P5JA 1T7PA 4DLGA 8ICOA 4I9QA 4GLXA 1SKRA 2YNGA 3I0SA 4DSJA 2P6UA 4YD1A 3S9HA 3SCXA 3DLEA 4HUEA 3TI0A 2I5JA 3QLHA 4LSLA 2W9BB 4OKKA 3K59A 5J0QA 3V9UA 2FPMA 4F4ZA 2OPRA 4MFBA 7ICLA 4CF9A 5C42A 4KHNA 2V4QA 2OPSA 3AVIA 1HPZA 1QS4A 2DY4A 4RQ1A 2VWKA 1YT3A 3SJJA 4CJUA 4EEYA 1V9PA 1NK0A 3OYHA 5I42A 4I2GA 1C0MA 4K8ZA 2E6MA 5KTQA 3OS2A 3TAQA 4OPKA 1U47A 1SL0A 9ICMA 3TR8A 3LDAA 4TUSA 4DTNA 4B9TA 2EHGA 2HNYA 4E19A 2ZUDA 3RB6A 3ZSZA 1IKYA 5DDYA 4DTXA 2BCVA 4FM2A 3B0XA 3AVNA 3JSMA 2QKKA 4F5PA 3RJKA 3U3YA 2XCPA 1VSKA 2AGPA 4FJ9A 3DI6A 5DK5A 3V9ZA 4Z6DA 3AO4A 4IQVA 3ZSRA 4IQWA 3M9MB 3LP2A 3ULDA 2MUTB 4JWNA 3TFRA 2VG7A 5L1KA 4DQPA 4IDKA 3SQ1A 2W9CA 1S6PA 5KFBA 3PY8A 2G8KA 5KFXA 4TQSA 5J2DA 4UAWA 3DYAA 1BI4B 1Z3EB 4ED2A 7ICGA 4JK1A 4RT2A 2BPFA 4AHUA 3ZSQA 4MFFA 3MABA 5KFKA 1ZQMA 2ZJ5A 1RBRA 3C95A 5KFNA 3JPTA 3RBEA 3GFKB 1ZQYA 5DQHA 3ZDAA 4CGJA 5DG9A 1ZQPA 4FK0A 3SQ4A 2XY5A 4LSNA 3V1OA 7ICNA 3NBPA 2YHAA 4ED0A 3T5HA 4O3PA 3Q8SB 5DQGA 1JLCA 2JEFA 1QE1A 4NYFA 3NHGA 4NM2A 1JLQA 1EX4A 3G0ZA 3RH6A 3JPSA 4DTRA 2XO7A 1ZQQA 3SUPA 4DTMA 8ICLA 1RCHA 1JMSA 2Q0ZX 5KFMA 4FJNA 2H5XA 3Q8PB 4Z0UA 3PX6A 4CJ4A 4RUAA 3VN5A 4KLQA 4RPZA 2FPKA 4IG3A 2HMIA 5KFAA 4M9GA 4FLVA 4DG1A 3ITHA 3O3FA 3AO3A 2P66A 4PGYA 4ELVA 5J2AA 4B9MA 4B9UA 4DTPA 2DFEA 4CHYA 1L3VA 4BWMA 3SUQA 1S9EA 1D5AA 4CFBA 1WSIA 3PVXA 8ICUA 3PX4A 4I2HA 1TV6A 4KTQA 1RBTA 4RQ4A 4FBTA 1RT6A 1JXBA 4DWIA 3NGZA 3UXNA 1HUOA 1NK5A 1SUQA 1HYZA 4F3TA 2PI5A 2B21A 5J0XA 3OYKA 2UVWA 1DTTA 2J6UA 1UA0A 1UWBA 4KB0A 3V1QA 1B43A 3GIJA 1ZQDA 3RJEA 4ECXA 5HP4A 3C5FA 3M9NB 3ZDCA 1ASVA 2J6SA 3AVCA 4ID1A 4O44A 3UXOA 3A2FA 3CFPA 1ZBFA 3EPGA 4UAZA 4Y1DA 3PMLA 4YNQA 2Z1IA 8ICQA 7ICJA 3KLIA 3TAPA 4AHVA 3C1ZA 1WSJA 4PHEA 4FBUA 1K1SA 2DFFA 3ZDDA 3HVRA 5HHHA 3RB4A 4KLIA 2FLNA 1S77D 4UBBA 4BGDA 1SV5A 3RBDA 4KLHA 4FZXC 4RW7A 4W5TA 4JRQA 4F5QA 2Z1GA 2VA2A 1XHZA 5DG8A 1JKHA
chains in the Genus database with same CATH superfamily
4WFNL 5EUHA 2KFZA 1FEEA 2EZXA 4O3QA 2BVZA 4LH4A 2DH7A 3GP9A 3R7NB 4F2RA 3L4PA 2MGZB 1UVIA 1K8KB 2AX1A 3GCXP 3ET6B 4BGAA 1L3UA 1VHFA 3RW7A 3OTOF 1HKAA 5KFGA 3LWLA 4ZPDA 3AVAA 3ZX3A 4NYPA 4C8ZA 1F2GA 1N6QA 4EIAA 3QRRA 3M6ZA 4OZJA 4IFVB 2XQCA 5J2MB 2HBLA 3MCSA 2A1BA 4M3ZA 3NLCA 4OVLA 4LH5A 4DUYK 4CK2A 4NY8A 2XCAA 1HUXA 1WYGA 4BC3A 3H20A 4OLPA 5GINA 3EICA 3QWPA 4KKOA 4OCZA 4PGXA 3BEXA 2IJRA 4GKKK 1ZQKA 2OPQB 1OS5A 4K2XA 3SCLE 2LDYA 3FFIB 2BBEA 3ZZOA 1HHSA 2ITGA 3QIOA 4G1QA 3TZXA 4QJFB 3JSBA 2PC6A 4CEEA 9ATCB 4Z4CA 1VGYA 2F8EX 2KKPA 2I1RA 3HPGA 1HJOA 4YN4A 3K8WA 4Y2RA 1QQ7A 1S0OA 1X4AA 5F8GA 1DHMA 2QT7A 3BGFA 4KH1B 3RW6A 3WXLA 4DF4A 2QLJB 2MKYA 2FVCA 3RMBA 3CDBA 1Y3KA 5GADP 5BRDA 3MM5A 1LCUA 1WC5A 2KU7A 3FGVA 5HP1B 3SPYA 2IA0A 1KBRA 1SZ2A 4NZ0A 1EXNA 4NLOA 2XWXA 4F7VA 4M63C 5J0SA 3P8BB 5HRNA 2QWPA 4YVZA 2R7UA 4IRDA 3A3NB 1RJJA 3VTIA 1NG9A 1LV5A 4DV6J 4B9SA 2K4HA 4WP9A 1M5OC 4RG8A 4IO9Q 2CQ1A 4TUPA 2IHNA 1JJ4A 3HFVA 1VBZA 3MR5A 3V6KA 4OYWA 1P90A 1WELA 3M05A 5G5HA 3GILA 1K0TA 3PNCA 4OFZA 3CF5L 4FPRA 3AJDA 2IVNA 2GV1A 1B0TA 4R8UB 1SPBP 2I9GA 4DL2A 1HBMB 4RW8B 2AH5A 1SH2A 1FXXA 1Q7YO 1F3FA 4P4PA 4TN2A 2YI1A 2GQQA 2MSNA 3D2EB 3T1YF 5IV3A 1RBVA 3M6WA 1HW9A 2HBYB 3FDSA 3OJSA 3BO3A 5L1IA 5KRTA 4KLDA 4PXEA 3G71N 2V8DA 4CJVA 1UT5A 2O8DA 3CCZA 4DOAA 3AM9A 2ILYA 3NG8A 3X3UA 3EKUA 2MKHA 5BN9A 4DL5A 4XTTA 5ALGA 3BB5A 1RHJB 2ZTDA 2KMDA 1IV8A 4FXVA 1SAZA 2RH3A 1JX4A 2X51A 4FWQA 1N2XA 1IG8A 2F8KA 4BXOB 1WBBA 5CZXA 3NGRA 2IVPA 3KVGA 2RHQB 2QO3A 4YXMA 2BE2B 3QX7A 3AVBA 3GR1A 4ILJA 3HI0A 4DUTA 3ED5A 3H2UB 3ILOA 1YKWA 2IJFA 4CERA 1K9MO 4JHDB 3ZC4A 2HOIA 2YNGB 4KH0B 4ZLJA 3FAHA 3CJ0A 4O23A 2V2VA 4O4RA 1ZETA 2ROPA 2V68A 3CMQA 2DR9A 3H8SA 3R5JB 4FWOA 2Z1JA 4B3TK 1T8EA 1RISA 4DX7A 2KOBA 3LDNA 1V85A 1Z05A 3RBZA 3ZETA 1DLOB 4UAUA 3HW8A 5J2QA 2DTUA 4ETXA 1NK7A 3CERA 2IGIA 3P1GA 1EETA 3FQLA 5AQTA 2JEIA 2FJVA 4ZP8A 5I4MA 4YXJA 5HMMA 4EP4A 5AQVA 5HROA 1BIZA 3CJ4A 1JQGA 3V6DA 2KM8C 4KGVB 4JI8J 4RPXA 2GJIA 2L41A 4A8QA 2CH6A 2AKWB 2P6SA 5KG1A 4FDFA 2RQMA 3KLFB 3SENA 4O5BA 2YH1A 2HI0A 2CQ0A 2JX2A 1ROFA 3TA2A 1VQYA 5BPMA 2KXHA 2D5RA 3H25A 2QWLA 3RJMB 8ICIA 3GIRA 4MTPA 1NB7A 3CCES 3VQQA 3LP2B 5HMLA 4UB8U 4WIQA 1WAJA 5AQUA 1ZD2P 4ZVQB 3OR2B 2CJKA 2CPHA 3C6AA 1SXLA 2W54A 4JYAK 1OPIA 5ADXA 3P39A 1KAYA 2DGSA 1Y3JA 1QJHA 1IXRA 2FLPA 3OYBA 3NGYA 8AT1B 1NJYA 3UE5A 3O1BA 3O1LA 2EI5A 5EGYA 1B4FA 1HUZA 4NCGA 1BE4A 1N8RO 3LDQA 4WIIA 2XMUA 2JH1A 1WSVA 3NVVA 2J0WA 3DN9A 4DCPB 4NLXA 3G10A 1CC8A 3AHPA 1KQQA 1RDUA 1Y5LB 3GBTA 2DY1A 3U9DA 4OIXA 3QGIA 4NI2A 4C8OA 3PO4A 4EFHA 2WFBA 1D4XA 1WF0A 5F0UA 4QS8A 4CF0A 2Y8WA 5H2FU 3HKZD 2O8CB 2KM8B 3BO2A 4JI6J 1KVJA 3BBBA 1RWXB 3LALA 2OWOA 4WU2A 1CRXA 2YY6A 4A8EA 3D1OA 2ISOA 3WEEA 1UW9A 3A13A 3ITHB 5D0HA 2FGOA 3C6TA 2ZF5O 2AYGA 1ILYA 1JUDA 3GOIA 1PUZA 2Q31A 1JLAA 1KTQA 2IOFK 2DVIA 4M2YA 4DFJA 2ZBPA 2DTJA 4PZNA 1ZQ1C 4DL7A 4ECWA 1OW5A 4QWEA 4RNOA 2F4VJ 2DFHA 5HR6A 1ZQUA 5CA5A 3C94A 1N60A 1GOBA 9ICWA 3FZ2A 4TKTA 4DPXA 1LWCA 3CFRA 1DBDA 4LR8A 5DDOC 3ZYYX 5JU5A 9ICUA 2U1AA 4GVBB 3RAXA 2XTJP 4FE3A 5GAHU 4M3WA 3OVSA 2JLFA 2VGNA 5ADXH 1LW2B 1K73T 3LW5C 3W61A 1VQ9N 2XNRA 4ZJQA 4O44B 4IH5A 5SUHA 3IMXA 4CBUA 4N76A 1OUQA 2VIHA 3IS9A 2W42A 2ZVSA 2B9WA 2DEJA 1NMNA 3I4HX 3PHTA 5IT9U 4BC9A 1ZTWA 2CJBA 1DGSA 4A8YA 4FJXA 2GX8A 3HM8A 5TKWA 2UU9J 3GU3A 4GC6A 2KG1A 3TA1A 4CHQA 4LF2A 2DT9A 2EBGA 1WG8A 3K75D 5AHXA 5AZIB 2WZ1A 2VFRA 5GADI 3CE8A 2EZZA 2CQBA 3N79A 4B02A 3SCIE 4LRDA 1WUUA 5BRHA 4I68A 3NCIA 4WP8A 1B9DA 1U0HA 4WYBA 4XK8C 2WK4A 1UWAA 1XSLA 1S72N 5DB6A 4Y2YA 4BJQA 2RQKA 3L7OA 4CF1A 2VA3A 2LYHA 5RUBA 2H3ZA 2W9MA 1MWKA 2EX3A 2G8VA 5CYQA 4TY9A 4H0PA 2EWHA 3EW9A 4NLGA 1NZPA 1YZ6A 1QAIA 2FVRA 3K2PA 4FXDA 1OY8A 2ZD1A 3SCKE 2VUGA 3LDLA 2JGAA 3W66A 1KLMA 1TYQB 2F1IA 2XY6A 2QWRA 4OJOA 3A0IX 5KG0A 4O5EA 2GWKA 3O0FA 3FZLA 3IAYA 3G25A 4Q8EA 1UA1A 2QA4N 1Z4NA 4B3TF 2ZWOA 1BI4A 2UXCF 2YCHA 3VEYA 1X6IA 3OLBA 2YNIA 1L3SA 4AD6A 5L8RC 4C9DA 3O4QA 2DGQA 2ASLA 5A8RB 1FJCA 3RJHA 1Y5IB 3TP2A 2V8GA 4QOTA 1NU0A 4QIVA 2ZH3A 1BPYA 1TKXA 3OTQA 4ICAA 2ZJPL 4QZVB 1DQ8A 1FJGK 2QWNA 3FCVA 4UB4A 2ZM6F 4CJSA 3IMQJ 3R6LB 9ICKA 2VOPA 2MY8A 4DCCA 2ZGYA 3MZIA 3CC7S 4KHQA 2GQCA 1TKZA 1JCEA 5HRPA 1NU4A 2D9OA 4WFNQ 5EOYA 3THXA 4AYBF 5I3UA 4C0OC 2HURA 2XMAA 2CQPA 4BR9A 5E3CA 2CDRB 4FF2A 4J9LA 4J9QA 1KP6A 1ZQIA 1J9AA 1IKWB 1EP4A 3HJEA 3ALYA 2BUNA 1ZBIA 2ZVIA 4Z6EA 4AHCA 2UXDJ 4JYAF 5BREA 2Z30B 2Q2RA 5IWAJ 4Y2PA 4A48A 1VK0A 4AP9A 3MEDA 4P0PB 2L08A 3H4DA 4FJKA 2AJFE 4LREA 2RHSB 1S79A 3CJSA 2N3OA 4FZMA 2E9ZA 3LA0A 4MF2A 3MECA 1C1CA 1XMOJ 1WTFA 1YRXA 4NMLA 3GG0A 2V7YA 2NRXA 1JLBB 1TVRB 3E01A 4HEA9 4O3MA 3BS5B 1P9YA 1NUEA 2XHCA 4DFMA 4IFEA 3QT6A 1JLEA 4NCAA 3HZGA 4CM2A 1VQ8N 4RQ5A 1MN7A 1RGVA 4KIAA 2UUBK 4KHWA 3HK2A 5KG7A 4DCJB 3QATA 1B64A 3KHHA 4I7FA 4QWAA 1RXWA 2QMUB 1CZAN 1LW0B 3JQMA 2ZTCA 3P4UB 3H5XA 4FLZA 1RA7A 4B1XB 3RSEA 2VANA 3T19A 2RS8A 2E5LK 4UB1A 2QYCA 9ICTA 1ITPA 2RE1A 2YNHA 2NPIA 4O5FA 4FO0A 4I2IA 4M9HA 3MWTA 5L1MA 1HFEL 3LL3A 4EO6A 3I56S 3VZIA 1FT8A 2EDUA 2DGOA 1UZHA 5KT7A 4QCLA 5EWEA 3BUZB 3R3TA 2I9SA 1X0PA 2GVDB 3HSGA 4YD2A 2W43A 1VOMA 3SMVA 4QZ8A 4DFDA 2PXIA 2BDPA 3GU0A 2P9SA 4M5LA 2I2YA 3H1QA 3DDHA 4ENOA 1KONA 3ETRA 2O8EB 3I28A 2AT1B 3NRWA 3PYDA 1Q8KA 2VQFK 1XU4A 2P9CA 3KKAA 3I6PA 3QINA 3SI8A 5GAGU 2VKZG 3V7JA 1X4EA 1YVNA 3U3GA 9ICQA 4IJAA 4OHXA 4IR9A 3IKMA 2VJUA 4F4KA 4GIBA 3ZXWA 3P5TL 2BANA 3WDOA 5J2GA 2CIMA 5K5MA 3HSCA 3L7UA 5EU7A 1X3NA 3CMEN 2N1RA 5H9EJ 2ZJRL 1WAFA 3WKAA 3KIOA 3TSPA 3TYTA 4ECQA 1S5ZA 2D1CA 1TR0A 1OKJA 2OYQA 5DB7A 1HLUA 2EFVA 3F41A 4DR5K 2ROGA 4BY9C 3FBEA 2KTQA 1N34J 3J8AA 1NK8A 4UBCA 4MIWA 4DPWA 2MRLA 3W64A 4USVA 2RB7A 1HQUA 4E2FB 5DZ7A 3UW1A 1XK8A 2KRRA 3NGTA 1HLWA 3GIKA 1VQLN 1MSWD 3OL8A 1JJ2M 4MFBB 2VA8A 2ZOFA 3JXUA 4YR3A 2OA8A 1BIUA 2CXEA 1TAUA 5AQNA 3J80Y 1WBDA 1KAZA 4BCAA 4HI1A 4CF3A 2P9KA 1Q86O 2L48A 1IO2A 2YX1A 2OANA 5AXLA 4DZDA 3M8SA 3K5NA 3SSSA 5B0GA 1YDLA 4KLTA 3OR1B 2YNFA 3MCPA 4WE1A 8ICTA 1N5SA 2ZNYA 1N54B 4DV4J 4UY8T 2V4JB 4X4SA 4DR6J 1WN7A 1X31C 9ICVA 1M1KO 3HDSA 1G1XA 3JQKA 5LT5A 5FPNA 3DXKB 4CBWA 4EUVA 3KHLA 5HL7L 4O5CA 2OXOA 1YITS 3HSZA 3MGVA 3PJXA 3DI6B 1BDGA 4WYWA 4MYTA 1XMBA 2E44A 2Y1RI 4CBXA 3MM8B 4UF4A 4KB7A 2D74B 3CCSS 2HFOA 1T3NA 4CRXA 5L9XA 3D28A 1DFDA 1IBKJ 1UHUA 4F92B 1U0SA 4QZDA 1IXKA 2L9WA 3WNGA 4IDKB 1FJGF 4CEDA 4LFAF 3EVOA 3SCJE 2BQRA 4KQZA 1UFLA 3TZWA 4JMUA 4DUZJ 5EWFA 4UTGA 5TZVA 3DOMB 2K8BB 2PSZA 2YH0A 3SD7A 5L1LA 3FCWA 2NS1B 3RMAA 4OZ2A 1SJ3P 2VQEK 5FDLA 2YHXA 4DTUA 4PKHA 1U25A 2ZZNA 4JI1J 1UFWA 2GZOA 3MAQA 3LK9A 3I4PA 2DK2A 4CE9A 2PFPA 2B5JB 2WCXA 3WC2A 3Q7BA 1C7YA 4Z6CA 1TK5A 1H2UX 2Q79A 2EWSA 4Y28C 3JXOA 1HQEA 1YIJN 4DZ6A 5FROA 2R7VA 4KSEB 4MN4C 4IG3B 4BVPA 3M2UA 2A5XA 2PMWA 4EAHD 4RW9B 2VB6A 4E1MA 2A1SA 3UVJA 3NVYA 3W2VB 3DM2A 3THYB 3DXMB 5CB1A 4WQ5A 1KC8O 1SB3C 4F2SA 1EX8A 4XRHA 4ZHRB 4USTA 1ZQNA 3NY0A 2HFVA 3T6JA 3HSJA 1OH6A 4YMEA 3VENA 2XS7A 5LY3A 4ES1A 2UUBF 2LPEA 4MMOA 7ICVA 4BE0A 4I6YA 4OHWA 2KHQA 1U2VB 1KVBA 3OTCA 2NO5A 2GMHA 2HHWA 2ZOMA 1R3NA 2IOFA 4Z7YA 3Q23A 1FO4A 4PA1A 4HACB 2E1YA 2PI4A 3ETLA 2Y0SF 2IHMA 4FWKA 3THWA 4CJKA 3UPQA 4G3IA 1CZBA 2JWKA 1LWEB 5KFWA 3HCXA 2HQIA 2CPZA 3H2VE 2WAQF 1JB0C 3MXMA 4BBYA 3K0JA 4M5KA 3AGRA 2UVVA 1Z26A 1YJVA 3EY1A 4GMJB 2EFNA 4NLZA 4UB6U 3VAGA 1Y0HA 2E1RA 4CZGA 3J81O 5J2NA 2R7YA 2V94A 2ATLA 1H6KX 2VPYB 3K1RB 3ATVA 1UPMB 4J9RA 2YX7A 1ZXOA 3GR0A 1YLXA 1K0VA 2P9UA 2KT3A 2HWIA 3MMJA 1DRGA 4M9NA 3P96A 5DETA 2DNOA 3LP1B 8ICAA 2VQFF 1C2PA 4NM1A 5C12A 3GV5B 2ZEJA 1A5XA 2KIVA 5DM6Q 4RW4B 2YWFA 3O9SA 3MEEA 5CYJA 4ED3A 3GSIA 4QOZB 1H2TZ 4OJHA 2H3GX 2GMLA 4ANEA 5JLHA 2CNLB 4K5SA 4USKA 1AA1B 3VVTA 3CHWA 3DLGB 1T9YA 4GVEA 3MM9B 2XSFA 2DBYA 3C15A 2PFFB 1HX1A 1PKUA 4JV2A 4PHPA 1DY3A 3L5KA 3PDNA 2XWYA 4WZQA 1B22A 1ZAWA 1QDUB 2DR8A 3ZD8A 1RZMA 3C1YA 2WMMA 2VBZA 1GQEA 2FSJA 1V4TA 1J97A 4QZCA 5ETNA 3TX0A 1N32K 4J9PA 3FNNA 4DR5F 3PW2A 2H5EA 3KJNB 4MT1A 2LYAA 5J2EA 4UUXA 1ZA2B 1CULA 2K4EA 5CYMA 3BQ7A 4QZFA 4RJVA 2DNKA 4CO3A 2EZYA 1DOQA 3G82A 3E2EA 3DV9A 5C2FA 1HI0P 5C25A 2MUTA 4GVLA 2JZ5A 2WBMA 2N7CA 2HYIB 2P9IB 4NLUA 4IR1A 4HTUA 3MPUB 4V19J 3RR8A 2BE7D 2FLLA 2H54B 3UDLA 1N52B 4CGIA 3SMSA 2G5IB 1XJWB 5KFLA 3C7NB 1YJ7A 4L76A 3EX7B 4MEXA 5AI9A 1RAAB 3WQPA 4OKEA 4UW2A 4C8MA 1RTDB 1E4GT 5J0PA 4EP5A 3OS0A 1IJFB 4B1ZA 3C2KA 2KHOA 3ZZTA 4DPOA 5B5EU 1LWFA 3PIPQ 4U8YA 1IKXA 1FXDA 4N8OA 4ZH4A 2RT3A 5MLCQ 3BZKA 2ZDPA 2FHOB 3KZBA 4H4MB 2NZ4A 3ULHA 2DCLA 4ZVEA 3VHQA 3V72A 1Q3UA 1YVUA 2HBJA 3LP3A 4UOHA 1SZHA 3N4PA 4X4PA 2OPPA 5K14A 3RJJA 1IBMK 3VETA 3FEZA 3TAGA 3OUYA 1S1WA 4YR0A 1P8ZA 2G09A 3PFOA 1RT1B 1QUVA 1HYVA 4G65A 4JKAA 4MQ3A 4RPFA 1DK3A 1SJFA 3SPZA 3FC4A 1S7IA 3SQGA 3T5JA 1UL3A 5AK3A 1LAWA 3M8YA 3SFUA 1GLJO 3T1HJ 1WEYA 2XMTA 3VCDA 4E1JA 2G9OA 4C11A 3FEYB 2OHFA 3U4LA 1AUSL 1HA1A 3J81Y 3L9ZA 2HFNA 4J5OA 5M1FA 2UUCF 2O66A 3EGNA 3TUJC 2CN1A 1XSNA 2OZMA 3BDPA 4CI0B 2VQEF 1PBUA 1GMWD 2MZRA 2MQOA 1T9WA 5HN0A 2OEMA 3AD7C 4B3OA 3Q8RB 2EAMA 1RDFA 2VG5A 4BQZA 4E7LA 2ZTEA 1TUVA 3OW2R 1TU0B 4CZLA 1CJUB 1ATSA 3FVYA 2FJAB 4DQ8A 4F4WA 1YBTA 3F5AA 1JN3A 5KFCA 3H4BA 2O8FB 2JV3A 2LYBA 4FL9A 4NLNA 2YVSA 2G2OA 4K4UA 3QNMA 4U8VA 2AJ0A 8ICPA 2ZWPA 3C19A 4DV1K 4CHZA 4ECVA 3GJTB 4B17A 1JLGA 1N36K 4N77A 2RDDA 5IIIA 4HKQA 1ZQAA 4LBPA 4O3SA 2GMJA 4X4UA 4CEBA 2V2KA 3K5MA 2MGZA 4IJNA 3ZX0A 1K8KA 3ET6A 4KC5A 4OLOA 1T94A 2AGQA 1RYSA 2J4RA 1ZZNA 1S0MA 2Y9TA 1C0GA 1KEJA 2CFXA 4BRPA 4IFVA 1V3ZA 4CLFA 1R0AA 5J2MA 4IFYB 5C10A 4JI2K 4P71A 2C2NA 1P9QC 2K89A 3P3DA 2AD9A 1F0MA 2GWSA 3BREA 4LIRA 4IUFA 3L2VA 4KHMA 2D0BA 3QO9A 3M6UA 5F8LA 2DXFA 4O5KA 2QE5A 4FYXB 4YB6A 2YTCA 4URGA 2B6AA 3QU9A 3GSDA 3FFIA 5ALXA 2MY7A 2W7OA 1BPZA 3J7ZT 4V19S 3PRDA 2C3OA 1J54A 4WF9L 3CO0P 2IVMA 4DOBA 4OJ6A 2EQYA 2XS5A 4ZPCA 1QM9A 4LF4J 2JWLA 2P2CB 4E7IA 4Y2KA 3TQEA 4NLBA 3AT1B 1ZQHA 1GXUA 4YP3A 2HWHA 1M0SA 1RK8A 1X5SA 3MCAB 3SI6A 2W8LA 3UN2A 5ALNA 4KRWA 2WW4A 4C0HA 2W3RA 3ZLJA 2FZGB 1QVGM 5HP1A 3R2DJ 3NOGA 4XPEA 3SIPB 2RVJA 4CIOA 4NXMF 4F3OA 1ZQXA 4EX7A 5J2KA 4F5OA 1WUAA 1TUUA 2A0FB 4QZIA 2WF6A 3UQ2A 3KJVB 1X1PA 3SYZA 4KLEA 1V97A 1N32F 4PGQA 3O80A 1QQOA 4CGDA 1NGFA 4X65F 3LVWA 3OQ2A 1MWZA 4JI0J 4CH7A 2Q6CA 4UQGA 5DQIA 1RTIB 4RBUA 2E9RX 2VFVA 4DR4J 3D0HE 3Q2TC 1SV4A 1UOCA 4ZIWA 3GJRB 1DEJA 4R8UA 2HK2A 4DR2K 1U6ZA 1HBMA 2FZCB 4H4KC 1IBLJ 4OYZA 3RR7A 4M5HA 5B66U 5J1PA 5KNIA 3DDIA 3KLVA 1FI4A 4IOCL 3AODA 1FFWB 7AT1B 1MWYA 3KWIA 3CCUS 1RAFB 4K4VA 3DDNA 3EE3A 3VQ8A 2CPDA 4ED6A 9ICOA 2LXFA 2OUGA 3KZXA 5F8MA 9ICJA 4N56A 4WBFA 3DRPB 1V3RA 2GFFA 4PPDA 2B9EA 1TK8A 4Q8FA 1EO1A 5C24B 4I9LA 1X0FA 5HL7Q 3LF0A 3CCRN 2QA2A 3QERA 1HJRA 3C23A 3QNNA 2JJ4D 1C0UB 2QWQA 2FUG9 9ICGA 3IAS9 2RF2B 2R7RA 4M63A 2KKHA 5J0YA 2LA6A 1AQ6A 5ALUA 3GYXB 3RBXA 2LM4A 3I5BA 4BXOA 2HVHA 4Y2QA 3A0HU 1NPPA 1IM6A 1IBMF 2EXUA 4I9QA 3D2NA 4CZCA 4DUYJ 2W03A 4I2QB 5T41A 2YNGA 4DSJA 2LCWA 3AL0B 3CNQP 3JTOA 3UB5A 4ZPVR 2NNWA 3TO8A 2JC1A 3NRBA 4JNEA 2W9BB 4GKKJ 3DHXA 3JSYA 1CJTA 2XI2A 7ICLA 2GAGC 3MTJA 1CJVB 4LT6A 4LRCA 4WPAA 3US5A 1QS4A 5B7WA 3WKCA 4NA3A 4CJUA 2CQCA 3ZTRA 4CTAB 2V7ZA 2RUSA 1YHQS 1HKBA 4OPKA 3CD6S 2ZBQA 3TR8A 4U67Q 3ADAC 5HR7A 4DTNA 1G99A 3VALA 3AD9C 5A8KB 3MX5A 3NWRA 2ZUDA 5DDYA 4PYAA 2QSFA 2P35A 4FM2A 3U3YA 4ZPTR 3CJ1A 3W9IA 3RYLA 4A46A 1S1XB 1BWEA 3ENAA 4A47A 4DV7F 3CUNA 3BYPA 5IS2A 2IRUA 3GG1A 1CC7A 1LFWA 4Z6DA 1L8LA 2OELA 4J9VA 4YS2A 3JYTB 3ZSRA 3LP2A 4NXNK 1KQSM 3TFRA 5L1KA 4DV1F 2CYYA 2G8KA 5KFXA 1GLDG 5A2QO 1W7WA 2KKVA 1Z3EB 4MK8A 2V2ZA 4ED2A 4CGZA 2UXBJ 1NB2A 2M0GB 5GMEA 3SLCA 5KFKA 1P1TA 1WHYA 2ZJ5A 4DV3K 2A41A 5KFNA 3JPTA 3MXHP 5EX5A 3ALRA 5DQHA 3MM6B 5B0BA 4PWWA 1I6JA 2ASPA 3CJCA 1ZQPA 1LWXA 2VWBA 4DV5F 4ED0A 3T5HA 1HNWK 3IRWP 2HNDB 1JI7A 2BX6A 3NHGA 4NM2A 2MKIA 3D3BJ 3JPSA 3LP0B 4Y0WA 3N5BA 1ZQQA 1Z4OA 5U47A 4PG4A 4DTMA 1E6YB 3SQOP 1BNOA 4A61A 1S57A 2Q0ZX 5KFMA 3D0GE 2O8CA 4CJ4A 3VN5A 1MMNA 4FWRA 3B54A 1HWKA 3ETMA 1RYUA 3MHYA 2IVYA 4ZVOB 3ITHA 3O3FA 4LVOP 3AO3A 1LKZA 4PRFA 2JL9A 2A10A 1U6BA 5DO2A 4CHYA 1TKTB 2PFDA 5BR9A 4BWMA 3SUQA 1D5AA 3F5EA 4IH6A 3PVXA 8ICUA 2NYVA 4I2HA 4KTQA 4KBOA 4RQ4A 4OJ5A 2MU2A 3NGZA 3SSQA 1NK5A 2B7CB 1FNXH 3T9NA 2GWJA 2D9PA 3FZBA 3CCMS 1E6VB 4XDCA 4GVBA 3S6EA 4KB0A 1B43A 5E2QA 3G96A 3I55N 2YJEA 2WVFA 1VQ7N 1KR4A 2E88A 3OVBA 3M9NB 3ZDCA 4ANDA 4FYVB 1ASVA 1SQKA 3KXDA 4V19X 4O44A 1KWMA 3ILJA 3Q0AA 1SJRA 1JMTA 2YQ3A 1QQNA 4YNQA 2C2OB 7ICJA 2VF3A 4FBUA 1K1SA 3FC9A 3HVRA 4IG0B 4ISGA 4BRDA 4DR2F 1N0VC 4FNHA 5KPZA 2GQ2A 3CWJA 1SV5A 1Z1VA 4KLHA 4C3MA 3KUGA 5AQZA 4PG8A 4W5TA 3HF5A 2DR7A 4F5QA 4JRQA 5LMUF 3MMVA 1EZZB 4L74A 3O9RA 3G8SA 3AQFA 3VQEA 2KVQE 2MEWA 2DHGA 2PEHA 2ZDOA 3MM7B 4P4MA 3DRXA 3ZZ0A 3HPOA 2EK6A 3V9XA 3OFFA 4WQ4C 2W2OP 5B09A 1F21A 3PRBA 3AQOA 4E3SA 2YX4A 5GAEU 2MQMA 4CLPA 2KJVA 1RXVA 1Q8IA 3OJUA 5A2QY 1Q81O 3OYJA 4XA5A 4GFJA 1I39A 1RHUB 1FERA 2ZUCA 2QI2A 4JK7A 3KK2A 3U8XA 4GO7X 1Q1KA 1ZQLA 3M30B 1QQMA 4M45A 4CIEA 2BV3A 3MD3A 5D0EA 5KGWA 5ALOA 3PZPA 5AM1A 5AR0A 9ICFA 1XSPA 1S3XA 3Q89A 4PYDA 5ADZA 1VK3A 2A19A 3AEVA 3ZT2A 4CT9A 2PMHA 3IRXB 4CH0S 5J0UA 5B08A 2ZZTA 2ZH1A 2NUHA 4H5VA 3U6FA 1NSKL 4E89A 1VFJA 2CPJA 3AQPA 3RWUA 1D3WA 2B4UA 2B51A 3IM1A 5M1NA 1IG6A 1WKLA 4NJ8A 2PD1A 1HRHA 2B56A 1B7YB 3VESA 1C0TB 3FCHA 3OPKA 2GJFA 4CJFA 1XC3A 1RHRB 2K60A 3M3ZA 3UI3A 3CTRA 2OAUA 5A8RA 3EDQB 3NS7B 2JZBA 1RAHB 4B3SK 3W63A 2ZJQL 3NMUA 5K8NA 1MNEA 4ICLB 3UNGC 1U1PA 2R8GA 1SZPA 7ICUA 4JV5K 1T02A 1O8BA 4FXWA 4LVSA 1QVGR 4KHPJ 1OSCA 4QU7A 5AKJA 5CZVA 5J1EA 2DYAA 2PY5A 3TQ1A 4Y2JA 3F9KA 1TAQA 2ILZA 3VQ4A 1X4BA 2ODGA 3C0BA 1NZ8A 1UAXA 4CGHA 3ZT3A 4QYZK 4M42A 4QIGA 1I3OB 2QV6A 4USMA 4ZPBA 2DQNB 4FJJA 4DV6F 3RGIA 1FJEB 2XMVA 4NXNF 1N5QA 1U49A 1IKWA 2BKPA 4RWXA 1KS2A 4QZHA 3MFHA 1S6QA 3TVZA 1F60B 1TL3B 1IWGA 2P9LB 4PKGA 2Y1JA 2KXFA 1D8BA 1HBOB 5DM7Q 2ACYA 2QJ3A 1AXQA 3PKYA 5A6WA 2F7TA 2E8AA 4JB8B 3VQBA 3OY9A 4A2BA 4DV3F 3N01A 2JHDA 1SKUB 3OYAA 3C2LA 1RWMB 2UV8G 1ZBUA 2LXUA 5M2PA 4N41A 4L3NA 5AQIA 3NF8A 1JLBA 4W98A 4HTIA 1TELA 3BS5A 4LF9K 4PUOB 4KJIA 3AVGA 3S41A 4UZCA 3RAMA 3IFRA 2J7UA 4J9SA 1HWUA 3IWLA 3P5BP 4CZJA 4B1VA 2IVFB 1T44A 1BPDA 3RRHA 1ZM3A 4B1YB 2XI3A 3F0NA 4YOUA 1JNRB 5ALDA 2O4IA 3T3FA 3BQ2A 1RDBA 2J9EA 3VF0B 1ZQGA 7FD1A 2P5GA 4F4YA 2XYPB 2V51B 3FKBA 2YV0X 3TSQA 2ATCB 3ZZZA 1LW0A 3MPDA 2D0OA 5LXRA 5HSPA 3JQJA 9ICPA 1FRHA 2MXYA 1QD1A 5AQYA 2YB1A 3KLGB 3HTVA 3QLHB 5AE2A 3M8QB 3GQCA 1KVCA 1GMWA 3RG6A 1PZNA 3N7SC 1G6BA 2BXJA 4PY5A 2GVDA 3SMZA 2OPSB 3AFGA 1HNZK 1HPZB 1Q95G 4M3TA 1WDDA 4XO0A 8ICJA 1IR2A 1SC3B 1WC1A 3QNOA 5HATA 4KMOB 4E7JA 2O8EA 2LEPA 2L9DA 5H1SV 1N33K 3CPEA 3C5GA 1WHWA 1L5UA 1S1TB 3HJFA 3D6MB 4TUQA 3T41A 3VCBA 2ZITA 8ICSA 4A8WA 3QSIA 3OL7A 2W7AA 5KFJA 1YXQA 2G8FA 1S10A 3ZZUA 5AQGA 3OFGA 1WEXA 2F65A 3FQKA 1Y88A 3VEVA 3TAMA 4USHA 1U2FA 4Z4HA 2KHCA 4WFXA 4MO4A 4PHDA 1RU1A 1S22A 3HKWA 3LM9A 3ISNC 4BWJA 4H8KA 4BC4A 1CJKA 2MTLA 1FKOA 1QTNB 1GXTA 1IJJA 5DZ6A 1SKSA 2CQGA 5LMNK 3H3NO 1XS9D 3RB0A 2HOQA 1ULRA 3H5UA 2B0CA 4CD1A 7ICMA 2Y3YA 4HHUA 4MFAA 3HSTB 2IC3B 4KLGA 3UQ0A 2DGXA 3IG1A 1M5SA 1U1NA 5JS2A 3OYLA 1S1UB 1RU2A 4M41A 4CESA 2MB0B 3F44A 1NHVA 2WBRA 4JAXA 2FY8A 5AI4A 3QFPA 2YXLA 1JLCB 2CWXA 4P2SA 1GEHA 3TANA 4CDGA 1JLQB 4OHZA 3HP9A 3S3NA 3NFAA 1UMJA 3PSTA 3CULA 4LY7A 3E9PA 4HAIA 4I2PA 1RKIA 3P83D 1RWOB 1VIOA 3AXMA 5KFSA 2XI9A 1OSDA 3X1LB 2WB1D 1M5PC 3PW0A 2BACA 4PHTX 2AHOB 1X7VA 4PZVA 3OR1A 1HD0A 4BRQA 1Y4ZB 3H59A 1BD6A 2HFSA 2HMIB 2FJEB 4B3MK 2V4JA 4DG1B 2MKSA 3MOJB 2FZKB 2KH9A 3CQXA 2G08A 4I6MB 4F67A 4F50A 3DXKA 4PL8A 5AKLA 1C4AA 2JXJA 5HVFA 1NJXA 1OH5A 3H3OB 3KYLA 3K1ZA 4RQ8A 3M2VB 2B43A 3UCUP 4IL6U 3HWTA 3PYGA 1WNSA 4JI5K 1U4BA 3NGKA 4XH1A 3W5ZA 1BVSA 4CJTA 4B3RK 1COOA 2E5LJ 1VSMA 3QEVA 2A3ZA 4K4XA 1QVFM 3BF1A 4AQYK 3IG5A 2F4VF 3ZT0A 2DEIA 1UWBB 4ELTA 3M1VB 3CEDA 6FD1A 1BO5O 1KEKA 2UVRA 1CI4A 1ZQZA 4J9UE 3HBTA 3VEXA 4O0JA 4NYOA 4U96A 1X5TA 1LQ9A 3DOMA 3AA3A 1T9VA 2WONA 3SZ2A 3B6OA 1X4FA 2GW8A 4OD0A 1R89A 2W4CA 4OZLA 4X4OA 4M9LA 1F3VA 2WSCC 3CJBA 3SBTA 4BR5A 1Q18A 3ZZRA 5J2CA 9ICAA 4M5DB 2B5JA 3F73A 5JLFA 1Q4RA 3ICLA 3B8HA 4RW7B 4WKRA 4F02A 3EM1A 1EKSA 1T3VA 4MDBA 2GV9A 1JKHB 3IA0A 5KFTA 4PH5A 2M9NA 4LJXA 1J2NA 4CCHA 1X5PA 1VSLA 2EVZA 3R7SB 5K9FA 1SXEA 2ZIVA 5CRXA 3CRXA 2ES6A 2K8GA 5IC4B 1U2RA 2IYGA 2WVEA 3A8JA 4RW9A 4L72B 5DDRC 2OZSA 2P1JA 3W2VA 3DXMA 4WCEQ 2W6LA 3OHRA 1RT5B 4YG2A 4ZHRA 4DU1A 2G07A 1KD1T 4LF9F 2B4JA 2W9AA 1RA6A 3NASA 1WI6A 3AOAA 3AU6A 8ICRA 3POTA 1U2VA 2KXNB 3QFUA 2P9NB 3K5LA 2X7IA 2IMWP 2QW9A 3AD8C 3SV3A 2BQUA 4PQAA 5AXKA 3Q8UA 1QY7A 4OI4A 3PR4A 2GO9A 1VQMN 1HNIB 4ZMMA 2BHNA 4ID5B 1ED1A 4DR1K 5HQLA 1A77A 4ZA1A 4RBTA 3G86A 1LWEA 1KFDA 4EELA 4HYKA 4QW8A 4I69A 2DR5A 3KOAA 3H1VX 3BP8A 2M8HA 4DHYA 4A4JA 2VKQA 5K8MA 3CPWR 4GKJK 1F5CA 4CF4A 3EZUA 1HQ2A 2YWHA 2HQFA 3M8ZA 3HRDD 1ICEB 5J0WA 1N63A 3O2IA 5FRMA 4DV4K 2D3UA 4URQU 5AQMA 4R0JA 1M5HA 1MMDA 5J2BA 4C8LA 2LLZA 3FEXB 1AZSB 2NUUG 3ZDEA 3LP1A 1Y7PA 1GO3F 1N33F 3ZT1A 1ZM4A 1KN6A 4RW4A 4ATNA 2ZJ8A 1X3MA 4LFBK 8ICKA 1FNOA 3A8KA 2F1FA 1YQHA 4H4OA 4LFCK 3DLGA 1NKEA 2FBXA 1RAJA 3MM9A 3V6JA 4M5GA 4JEPA 4EZ6A 2VDHA 7ICEA 3R7BB 3T7ZA 4HHTA 2PFOA 3Q7CA 4Y2XA 1NDCA 1CS4A 5J2FA 1FVSA 4ZLPA 2HMPA 1T05B 4JBCA 4PKIA 1D09B 4D3GA 4O0IA 3G6XA 2KK0A 5EN1A 4MIAA 4GC7A 3BKTA 2ASDA 2OEJA 1MQ3A 1PGZA 3UIQA 1Y10A 2VQEJ 3D7EO 2HMXA 3IR7B 4FN5A 5KI6A 4RWTA 4RZRA 4A8XA 2SXLA 5KAIU 4QR0A 5M1KA 4LR9A 4Q44A 2E8OA 2RU9A 3I5CA 3CJ8A 1X40A 1QSLA 4PABA 3H46O 5D4LA 4LF6K 2P9IA 7ICKA 1HMVB 3PACA 1V3SA 1ELOA 4LQ3A 2GCFA 3AVLA 5AKZA 4I2AA 3PHEA 1RTDA 1XMOF 1BISA 2LSNA 4FS2A 2O6KA 1NBEB 1YSJA 1WC0A 4FYYB 3KK3B 4YOXA 2M7SA 8RUCA 2G0CA 3TUPA 2E1EA 2WTFA 1KNZA 4B3MF 3PW7A 1Q53A 1TVAA 3AXKA 1ZBTA 5AZJB 1QAJA 3HOSA 1RWUA 1QCKA 2F7VA 2Y0BB 1K8AO 2ZJQQ 1S0NA 2DNYA 1HNVB 4Z4GA 1LVHA 2NR0A 1R27B 2AEJA 4NYNA 3IR6B 4JI7K 4URSA 4DV0K 1RBAA 1ZZFA 2GHVC 1WG5A 2A1RA 2OSQA 4QWBA 2FE9A 1RT1A 1TFWA 2HW3A 4C97A 3EKSA 1KQKA 1MU2A 3ZTOA 3HOTA 5DBBA 1EWRA 3G71S 1QQCA 1V4SA 3OYIA 2IBKA 4L3QA 2LYVA 4HH1A 5GAHP 4U7UK 2CNKB 3EZ5A 3UR3C 4R5PB 4YOYA 3QIPA 2AMCB 2IPOB 1ZD4A 1UPHA 3I5AA 1YK9A 2QGFB 2P9PB 5KOWA 2FMQA 4NL5A 8ICMA 4DX6A 2IDOA 4C4WA 4A8MP 4FLYA 4CZHA 1RBLA 4I1TA 2XIDA 3HHLC 4M3UA 3FZKA 2Q36A 1DURA 3HHKA 5ALVA 1OH7A 3DLLQ 1R31A 4Y6IA 1WI8A 3N6LA 1GTEA 2BW2A 3H5SA 5F3XB 3ZEUA 5CEHA 3L2QA 1VJ5A 2FJDB 1EAYC 1FKAF 1WC3A 4R63A 1UEUA 3OBYA 3LH2S 1J2VA 9ICNA 1N32J 3TTFA 3DLEB 2H5IB 2WB4A 2HIYA 1SJ4P 4I4BA 1YI2N 4BR2A 1REVB 2JHEA 1U8SA 5CR0A 3WKBA 3A12A 3NAEA 3KLHB 4HHHA 2D0AA 4BDZA 4KYZA 4ZCMA 2BPGA 2ZH9A 2PMZC 5J0RA 1M5VC 2DRBA 4M5IA 1Q82T 4DR7J 3NAHA 2JWNA 4NLQA 2E7WA 3N7PD 2C2KB 8ICFA 1VHIA 4WJBA 2UUTA 1NBWA 4C4SA 4FF3A 3PV8A 3IR5B 2QARB 3DHWC 4OHVA 4DTOA 2IIRA 1VBXA 5KT3A 4I2FA 2GX9A 2LMIA 3R5GA 2HNYB 1S1VA 3V1RA 3CJ5A 3TAEA 4K59A 1X4CA 2CPEA 2DNLA 4GKJF 4DCHA 1ZPVA 3JSMB 2PEBA 3ORYA 3MOZA 4BACA 2IMOA 3HHLB 2IM3A 2K1RB 3O6WA 2DUYA 1KKXA 5DLGA 2FIUA 4DV4F 2F3JA 4EEKA 1ZQOA 4DR6F 4I2EA 2D6FC 1YITN 2CQDA 3HRGA 3W0LA 1ITGA 1O13A 1REGX 3EO3A 3RVCA 2VG7B 1N4LA 1VQ5N 4DR3K 1XUPO 3D2FB 2OMLA 1NKBA 1A5WA 5DBAA 2XO6A 4CI6A 2KG0A 1FRIA 1IBMJ 4LFBF 4ZP6A 1QVFR 3KLEB 2X3DA 2GO8A 1VC6A 3OFHA 3EXYA 1IBKF 4IKFA 5BYRA 3D9BA 3V4IB 2CJXB 2UUAK 1VQON 1HYSA 3BH6B 4FJHA 1RHQB 3ISND 3M6KA 2BR0A 3QBXA 4FWLA 2PFUA 9ICSA 2DXEA 3M9OB 4ID8A 1PYSB 1S9GB 4DDFA 4DUZF 4HTLA 3P45B 3QETA 1ZD5A 3KJVA 5JVGL 5FJ4A 4UB2A 2DNRA 4TYBA 2COLA 1BQMB 2J0SD 4P6QA 2GIFA 3GCWP 2FQQB 4NB4A 5BYSA 3MN7A 1RTIA 2CNNB 4W5OA 4Y2IA 4EZ9A 2OD6A 4AUKA 4K41A 4DU4A 3BSNA 4JI1F 3MAAA 2F8TA 3JPNA 4DXLA 3GFYA 3G87A 2RN2A 2YHBA 3KHGA 3T5LA 2J6TA 1YBAA 2AWZA 4US9A 2NXJA 4Q43A 4LF6F 1UEVA 1AROP 2V67A 4QZGA 3IHQB 1XNQK 3ENVA 3QUCA 3SQ2A 5KT4A 1OY6A 1CXUA 4YCXA 3D1HA 5KOXA 1FX2A 4GXKA 3SK3A 4K2JA 4FW2A 4NO7A 1RT6B 3AVJA 2HZCA 3ZTPA 3DRPA 2OP5A 3C6UB 1P27B 2DY9A 2KSOB 5FPEA 1S0VA 4L8RB 4HUFA 2Z56B 5B8HA 4LF5K 5C24A 4OX8A 4DV1J 4LD0A 2FHKA 3M2RB 1N36J 3VEZA 2FC8A 4KGKA 1C0UA 2FVPA 2RF2A 2KE7A 2FB0A 3QT7A 1RWPB 3B0YA 5ALFA 2LXIA 4PWDB 3HILA 3TABA 4RQ2A 2L5YA 4WFBL 2EPIA 1H1VA 3QEBZ 2XYHB 4JI7F 4DV0F 4MKAA 4MKBA 4F72A 2R8JA 1WSRA 1B0VA 5ELZA 2I1QA 2B9YA 2C22A 2DIVA 1Z00B 4JI2J 2CRXA 2OHDA 2I5HA 2ZOGA 4I2QA 2XZDB 5L46A 1KOHA 4J90A 4DFKA 2RDIA 3N9UC 3LVVA 4CO0A 4GXIA 3A3PB 1L3TA 5D78A 4HR2A 2EC0A 1LKYB 3IC1A 2FMSA 1EQMA 4H4KA 5ALRA 5EE9A 1YJWS 1CJVA 4ZVFA 3I8BA 4QZBA 4A8KA 3TTCA 1F5SA 3UFCX 4Q0BA 1BHNA 2XMKA 4ACOA 5J2IA 4CTAA 7ICOA 4JS4A 1J53A 2J8AA 1C1AA 2ASMA 3VERA 2DIUA 4QPXA 2WSFC 2XMJA 2ATQA 2W2NP 3R97A 5A8KA 3O4NA 4AM7A 4KGMA 3MN5A 1SXDA 2B4PA 3GDXA 2B8QA 3FRZA 1QHAA 3PLAA 2MDAA 2QWMA 4KKOB 2IOHA 3SSRA 2XY7A 4RNFA 1S1XA 5AJ3K 4FLTA 2FMPA 3ISBA 2DH8A 3PW4A 1KKHA 4B08A 5CCMA 3LZJA 3VGKA 2LP4A 4WFAL 4F3QA 2CZVC 4J2AA 3JYTA 2F63A 2MZTA 3RJIA 2QA4S 2W1BA 2DNMA 3U26A 5KG3A 3GDQA 3CNHA 2UV8A 3PM9A 3FE1A 2VG6A 5GAHI 3MPYA 4FWMA 2OFHX 3TADC 1IH7A 2KQ2A 2NRZA 4HVJA 1WF1A 2HCFA 1TE2A 4IC9A 3VZHA 4CIGA 1L7OA 3HVWA 3UXPA 2ZH2A 8ICEA 3N7RC 3PSPA 3MM5B 2MQQA 3MM6A 1XIQA 2H48B 1Z1ZA 1IBLK 1VS3A 1M5KC 1S8OA 3KK1B 3W8PA 4F8RA 1ZBSA 1I5OB 3H42A 4JB3A 1S9FA 2E1CA 4O4GB 5A6PA 2HNDA 3NEKA 4NLTA 3G6VA 3TSUA 1T4GA 4W90B 1OIAA 4QAGA 2E5JA 2HEKA 3Q8MA 4LVNP 4NXZA 3I9V9 1E6YA 2G1DA 4CJQA 2AGOA 3JPQA 3Q8QB 3MXIA 4EO8A 1RT4B 2IVOA 2E1FA 2F77X 2YN4A 1T9UA 4BQLA 1COKA 3QEIA 2E4LA 3MGIA 4OYMA 1RPLA 2BJDA 1VRUB 2Y9UA 2G0JA 3QB0A 2Q4TA 1TKTA 3MF5A 2ZKTA 3CDUA 2RE2A 1TGOA 3J80U 2BJ1A 4O9MA 1NZAA 4EBEA 4TY8B 3D45A 1QUPA 2WHEA 1KFSA 1R59O 3A5MC 2UUAF 1WACA 4YOEA 2P5OA 2WFAA 5KFDA 1XR5A 5D4BA 4NPOA 4QIWC 8ICZA 3T1HF 1UVNA 4FM1A 1FWPA 4Y2UA 1WWUA 2QXFA 2JFDA 3H0PA 2R18A 5DGBA 3QFHA 1NM1A 2PKEA 1TUWA 3VGUA 4QZ9A 2MYFA 4CJ3A 4U95A 4BDPA 2DRAA 4NX9A 3ZCMA 1ZBLA 5AM5A 1NJIT 3EVMA 1YJ9N 1MA9B 3LPUA 3CCLS 1MG7A 4TQRA 3CJAA 1RTZA 5JS1A 1X2IA 7ICRA 1ZQEA 3BDEA 1U1QA 1Z2LA 3GB0A 3H08A 4IG0A 2N82B 2HZAA 2HLUA 4NRUA 4C8YA 3WK4A 3R2CJ 2QC3A 3NGSA 3H2LA 2VZ9A 2OIHA 4DLEA 1FK9B 1KQGB 3IM8A 3PIOQ 4J7CA 7ICQA 4FVMA 1LK7A 1TL4A 2GNKA 4JI3J 4M5MA 2M8DB 2VBWA 4JI4K 2RS2A 4FZYA 1Q3VA 3MM7A 3TA0A 4X4VA 3CP8A 2UVUA 3THVA 2JFKA 5D8HB 2IM0A 3K0SA 3F2CA 3OBWA 5EXWA 4NXNJ 8ICCA 4PL1A 2V6AA 2ZUAA 5ETOA 4DOZA 2KJ9A 4K4TA 3PEJA 1BLUA 1XR7A 2D41A 3EWAA 1NPKA 2BW7A 9RUBA 1VQ4S 3CI5A 2UXBK 5E3QA 1X9JA 1OYEA 4KY3A 4KLSA 3AO2A 4DV3J 1VLBA 2R7WA 5HROB 4KTZA 5LM7E 2CDQA 3RU0A 5F2RA 1NDLA 1HNWJ 1VI7A 3WBZA 3IRXA 1KVIA 5E84A 2EC2A 1JXEA 3RRKA 3NF7A 1RAEB 1SV0A 4IS7A 4KITB 5B0DA 4LRAA 4FLXA 3I9ZA 1R8PA 1NEEA 4YFKA 5JUMA 5AT1B 4Y0FA 1Q8BA 1RBOB 5KAKA 4FVCA 1SJQA 2KDOA 4FWNA 1HHTP 2IHR1 1Z19A 5C5JA 1MDUB 4DQQA 2A2DA 3L3CA 1F0XA 2CADA 3S3OA 1RZTA 5J2HA 2OTJN 1DTQB 4YOWA 3BQ1A 4ER8A 4LF4F 2FPHX 3W9JA 2BOPA 5AM0A 3HHLD 3E51A 5DG7A 4NLWA 4ICLA 4YFUA 1IUJA 4H5NA 4ZVHA 4RQNA 2W4PA 4F5RA 3G6EN 1OWXA 1RABB 5F3ZA 2DGVA 4USWA 4E98A 2ZZMA 2KD1A 2ROEA 3ATUA 3K57A 4FLWA 4US8A 3VA0A 5IILA 1RT3B 3AVFA 1IR0A 5KFVA 3ZDBA 2CGKA 1RWNB 1GOAA 3ZNJ1 2CQIA 4BRIA 2CPXA 1BMQB 4UB5A 2RDJA 2LKYA 2E1ZA 2IJNA 1WF2A 3ZNUA 3WEEB 2C28A 2KT5A 3AU2A 4JI0F 3ZFVA 1T6CA 4X62K 4NLCA 5HMYA 3BYRA 2PMZD 1TL3A 1UTAA 5I3PA 2KYZA 1HBOA 4ILGB 2I8EA 1SC4B 2MQNA 4DR4F 2XSJB 1KTVA 3IBCB 2QKQA 3I32A 2ZGZA 3GFHA 1RHMB 2G8WA 4P0QA 1NGIA 5T7BA 2AW0A 2W04A 4RQMA 5F9LA 1LWCB 1IBLF 5A8WB 4OI1A 3D6TB 2F3NA 1FKPA 2BKEA 3MR2A 2M0NA 3SJHA 3ZX2A 4UOGA 1RWVB 3CG7A 4AXJA 5CCLA 2VDIA 4PUOA 3DMJB 3ULEB 3OXGA 4LRFA 4ZTJA 4UAYA 5LJ5Y 2QRRA 5LL6Z 2HGLA 2KZ3A 3NNHA 2W2PP 2R2TA 3F2BA 2XZWA 3UO0A 4CFAA 1IQTA 1EARA 1SQGA 2ADCA 3DXBA 5D15A 3P5JA 3CIZA 3F9MA 4PXDA 8ICOA 5FLXO 1HEKA 3WK7A 1SKRA 1RQNA 2VPZB 3OL6A 2P6UA 1RHKB 3S9HA 3SCXA 4HDGA 3LTOA 1N5TA 5CR4A 4HUEA 3QLHA 4LSLA 1MLAA 3W65A 1YIJS 4OKKA 1RLCL 3R6GB 5FIIA 3KUHA 1RE1B 2FPMA 2D4WA 2OPRA 3M32A 4DUYF 2CJYB 1NPRA 1BUXA 1TL7B 4RO0A 2OPSA 1YJUA 4BREA 1HPZA 2K4IA 1K44A 5L9NA 1U1OA 3GZFA 3L0QA 5IM0A 3K5PA 4GKKF 4IQMA 3SJJA 5LSRA 2NXUA 4IOAQ 3O8MA 1NK0A 1V9PA 2BM1A 3BZCA 3D3CJ 3TOQA 2QYGA 2E6MA 2GS8A 1IR1A 3OS2A 1SL0A 5J8YC 5ALWA 4BUGA 3BGLA 1YHQN 4E19A 2ZIXA 3RB6A 3TR5A 2XBPA 2K3KA 4J91A 1GMVA 5HMZA 4B3SJ 3C66A 2HHPA 2FHJD 2QKKA 3FK4A 3UKUB 4X66K 2RRDA 2E2NA 2AGPA 2XB2D 4JV5J 4OX7A 4RU2A 1O0PA 1S7HA 3MWPA 1CVJA 2J7WA 4KHPK 3AJ2A 3J7YU 5G0RB 4AXIA 3AO4A 2VL1A 4IQVA 2L3MA 5KQDA 3A4TA 1BXNA 1VR6A 2BUPA 1K73O 2K4PA 2HVEA 1BC6A 2MZQA 1DZ5A 2BYCA 4QYZJ 2YKNB 4UAWA 5J2DA 4ZVUB 1BI4B 1HHQA 4JK1A 1ZD3A 2YNIB 4AHUA 2M5YA 2Q1LA 3ZSQA 3MABA 1ZQMA 3CIMA 1RBRA 3C95A 5DDQC 4FOIA 5BR8K 1XO0A 3GFKB 1T11A 2AA4A 5LSLA 3I0RB 3WQUA 5DG9A 1YZ7A 3SQ4A 4LSNA 4L6V3 5M2RA 1RQLA 2UXBF 2LMRA 3T9ZA 4O3PA 1JLCA 1XMQJ 2QTDA 2YB4A 2JEFA 2D3DA 1JLQA 3RH6A 2OLWA 4DTRA 3QMQA 5CH7B 1URRA 8ICLA 3W5XA 1MN9A 1RCHA 1JMSA 2W24A 1NSQA 1XQSC 5AQHA 2H5XA 4RUAA 1B3TA 4LF9J 3QAUA 5FPDA 4HL9A 1DAXA 4M94A 2A40A 2CAJA 1RT2B 1Z1BA 2HMIA 3E1YA 4FLVA 1JALA 4DG1A 2KB2A 4BVOA 1EP4B 4R25A 2P66A 1O5JA 5J2AA 3UD4P 5IOLA 4I6MA 1UP1A 1X9XA 4IWVA 5AQJA 1L3VA 2VH7A 1TFYA 2QMWA 4TU7A 1UVLA 1APSA 3A0BU 2MKJA 1U24A 3R8EA 1FTRA 1OJ4A 3PX4A 3M2VA 3MN6A 1KDNA 1RBTA 1N5YB 2E8NA 3N28A 2LQ9A 4DWIA 5FLXY 3EXCX 5ALQA 2PBDA 1SUQA 5FPMA 3Q86A 2AP6A 2B21A 3MECB 4OZ3A 3SDEB 2ZIUB 4FKYA 2FJ6A 1UWBA 3CCMN 3E01B 3PYEA 4PCQA 3BY5A 2YQ1A 3M1VA 1T9TA 5AXMA 3RJEA 5HP4A 3OT9A 4QYRA 1HNZJ 2BZFA 1IWAA 2EKNA 4U9RA 1JLEB 2J6SA 3AVCA 4ID1A 4DV2K 3TNVA 1PK1A 2Q0RA 3EPGA 4FPAA 2DITA 3PMLA 2WC9A 3FZMA 5JICA 8ICQA 3TAPA 2HHHK 1RAGB 1WSJA 2W7PA 2P9GA 1L6NA 1N33J 3MN9A 2WW8A 3HLUA 2Z0GA 3O9UA 4KLIA 1EB0A 4L75A 4X62F 2N3LA 1HPMA 1SQFA 5AQPA 4BGDA 1KQFB 4Y2VA 3RBDA 4M5DA 4U7BA 3M5RA 4RW7A 2WTUA 2QLFB 2VA2A 1JKHA 3JAMO 5EWGA 5ALPA 2VCPA 3EUNA 3DGPB 4KLMA 2YHWA 4YORA 3AOBA 1QH9A 3ILIA 2BJ8A 4OI2A 1RT5A 1PAEX 5HI7A 3CJKA 2C2DA 3LM2A 5CA7A 3OD2A 1UAWA 3OYGA 4CT8A 1T6DA 4KN4A 5LMNJ 1PCAA 2DF4B 2M3DA 1V38A 4K4SA 3QUQA 1HJPA 1EQYA 1RNHA 3SBGA 2DKOB 3AARA 2ITMA 1E4FT 2P9NA 1CPZA 3QZ7A 3CJTA 1R0BG 5GMKa 2XLKA 1JRPA 5I3QA 3BGUA 4P73A 3EYZA 5JMNA 3RH5A 4CZFA 1KAXA 4DQSA 4MKYA 4C1NI 1HNIA 3CDWA 3ID8A 4I56A 4ID5A 1FF2A 4R66A 3AH6A 4EFAC 1RG6A 1EKEA 3GYNA 1BPEA 3A8EA 1ZQFA 3AAWB 1YJTA 3MMCB 3K9JA 4QIWD 4EYIB 3NRZA 5E7OB 2C3MA 4BRCA 5HBMB 4B3MJ 4KHYA 2RHKA 5M1PA 2NLWA 2CGJA 1YRTA 3PRVA 2DNZA 4X2BA 2AYBA 1OYDA 3QYYA 1HQUB 2QMXA 4RT3A 4M04A 4IO9L 1Q5VA 1AZSA 3NGUA 3PSFA 5AKHA 4OPHA 2PAVA 2KL8A 4CHNA 1OH8A 3ZSXA 4FJLA 4WFYA 4RW6B 4E8UA 5HRSA 2K2PA 4JI5J 4KMUA 4B3RJ 3QAEA 5KAFU 5E3PA 1WHXA 1R7IA 1HNXJ 2KYXA 4AQYJ 3FMWA 2RSQA 1JCFA 1JL1A 1WB9A 5HMXA 4ED4A 2BGWA 2P51A 1NGCA 4KHPF 1LB2B 2BJEA 2UP1A 4W92B 4NLYA 4OPJA 2H3QA 1P7DA 2J9DE 1T05A 3LDSA 2ZC4A 3C14B 4YOVA 2KIWA 1VSFA 3UQSA 3CDAA 1ZJNA 3AA9A 5D4NA 4OQJA 4PQUB 3W5YA 2NV3A 1VAZA 2IFXA 3IN5A 3CD5A 3CF5Q 3FYHA 3AN1A 1TL1A 4KLJA 4CE6A 2O4GA 4DSLA 4GXJA 2HRTA 1U6FA 5HANA 2ADBA 2RLTA 4CW7B 2MKCA 3IWXA 3ZZPA 4EHUA 5KFQA 3KG0A 4P2FA 4ELUA 3OW2M 2FBYA 3AUOA 2MZSA 1ASWA 5AQXA 3JAMY 5MLCV 4O3RA 1SJ1A 3BGOP 4CVNE 4ILLA 3TARA 4FSVA 3JTPA 3G6YA 4DQRA 9ICHA 3DDKA 4NLKA 1NHUA 1RTJA 3KK3A 3MCMA 2VGMA 4OZNA 5D4PA 2H3VA 1VRQC 1MN8A 4I2BA 2QB0A 4IDHA 1SL2A 2FDRA 4BDYA 1IBCB 3TJ8A 2YMMA 1VSEA 3I0SB 1NGJA 4ZS6A 5AZJA 1KCFA 2E66A 4NWIA 3EJMA 4XQ8A 2RRNA 2I5JB 2CPYA 1HNVA 2V8PA 2YTUA 1ACMB 4BC2A 4HLBA 4B1WB 1WUDA 3TU5A 7ICFA 1M90T 5C42B 3GTYX 5H9FJ 3KHYA 2VU5A 2QLTA 1GOCA 2HQGA 4DR1J 2BMBA 5G5GA 1I94K 4CJPA 3M2UB 4QR1A 3HKZF 3W1YC 3GMGA 5AQFA 5KPRA 5GTHU 3UVJB 3W62A 5KPTA 3UCZP 3QU5A 5I42B 3LWMA 4UY8O 4GKJJ 5AM2A 1OQ3A 5J1NA 2DJWA 4GV9A 5ALMA 4LC9B 3PX0A 5ALEA 2QA4G 4LF7K 2NXNA 1Y9OA 1BA1A 4Y00A 1IKYB 4AL6A 3KD5E 3CCWA 2NSCA 4R5PA