4B9MA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-da dna lesion -thymine basepair in the post- insertion site.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9mA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9mA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9mA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9mA01
3CFRA 1S9EA 4L8RB 3HX0A 4M6WA 3SV4A 2R8JA 4P4PA 4CGFA 4DMNA 4KAZA 3OYGA 4F5QA 2BQ3A 3V4IA 3ISBA 2BCRA 4DOCA 4I29A 4ED0A 4R5PA 1KRPA 1Y88A 1WN7A 4CEOA 3Q8SB 1VRTA 3C23A 2KTQA 3AO4A 2P6RA 4OLAA 1ASUA 2P1JA 1DGSA 3QINA 4P2HA 3SJJA 3MEGA 1RDDA 4MFFA 3RJKA 5HRSA 4RU9A 1A5VA 3AU6A 3TAQA 1TAQA 5L9XA 2ZUBA 3ZSXA 4ZHRA 2HNZA 4R65A 5JS2A 3DRRA 4EP4A 4ECXA 4NXZA 8ICLA 3OYCA 4UBBA 2P6UA 4AH9A 3EY1A 4HVJA 4YD2A 4FLYA 1J54A 1ZQBA 2AJQA 4B8AB 2NRVA 5J2NA 2D5RA 3ZT0A 1IXRA 4YD1A 3GIJA 1NJZA 2Q0ZX 4C8MA 2BQRA 3CYMA 2HNDA 5KT3A 3HYFA 3C94A 4RQ6A 2I9GA 2MAXA 1HJRA 1RILA 4N41A 2ZJ5A 4QZ8A 4C8OA 2AQ4A 4CJ5A 9ICVA 2OYQA 4FO6A 1ZQIA 4LZDA 1S76D 5CZ1A 4N76A 3TAGA 1JXEA 1RDBA 3QZ7A 5DBBA 3RB4A 2HHUA 1S0OA 4M2YA 2IGIA 3ZSWA 5KFFA 4KV8A 3P1GA 3HP6A 3EPGA 3MAQA 4Z4FA 2X6SA 2Y1IA 1ZQTA 3AO2A 1ZBHA 3VQPA 3PW4A 2ETJA 5KFXA 3OS0A 4IKFA 3F73A 1LWFA 3KK2A 4CHNA 3CM6A 3AA2A 3H7IA 5SWMA 3EZ5A 3T5LA 2JEIA 4F4XA 1RDAA 2BANA 2GWSA 1BCOA 1ZQJA 3NH1A 7ICMA 2ZUDA 8ICPA 3TAMA 1QQCA 4MQ3A 3SUOA 2Z1HA 4AILC 3KLFA 3JSMA 4ECTA 3HO1A 3AUOA 5E41A 1YTUA 5DLGA 4QCLA 4DTSA 4AHSA 5HP1A 4CF9A 4M3WA 4I9QA 4CJ4A 1X9SA 2IHNA 2HNYA 3Q8KA 4FM1A 4CEFA 2FBVA 2V4QA 4QZEA 4X5VA 4DTMA 4I28A 3T1AA 4OGCA 2B6AA 1KCFA 3T5HA 3UQ2A 4F4WA 4Y1DA 2ZTEA 1I3AA 4PY5A 3S3OA 2DFLA 4J9LA 3AVHA 4F91B 4DSEA 3AA4A 1WCNA 3DYAA 3K5NA 2RDJA 2VWJA 8ICGA 1LW2A 3AVGA 4UQGA 3O3GA 4LD0A 1I39A 1XHZA 3KHHA 3LALA 4B9LA 4MEXA 4FJ9A 5KT2A 4NLKA 1JL2A 1K1QA 4HUEA 7ICRA 4B3OA 3HVTA 3AO5A 4I27A 5DQHA 3QIOA 1NK4A 2BDPA 4B8CA 1XSLA 7ICKA 2IHMA 3EYZA 1S6PA 5C5JA 1S1XA 2QKBA 5DBCA 3ASMA 5EWEA 8ICBA 3K2PA 1BCMA 5J2FA 3CG7A 4M3XA 2XC9A 4CEDA 2XRIA 1U48A 3V9WA 3RJEA 3RJJA 3PMLA 3SQ0A 2ASDA 1LV5A 4RW4A 1FKPA 4QW9A 1CZ9A 3ZSRA 5IIIA 3NDKA 4CFAA 2NRTA 4CFCA 1BPYA 3QLHA 2ISOA 3HWTA 2IDOA 4ECWA 1TKXA 1JXLA 4F4KA 4J9KA 9ICGA 4EBDA 3L3UA 2JEJA 3NH2A 3ISDA 4YNQA 2R8KA 5IINA 1ZJMA 3LWLA 4JV2A 1RTHA 4KPYA 3SYZA 2DFHA 4TQSA 4J2AA 4CJVA 2P5GA 4FJLA 4DU3A 4FJIA 5KI6A 3V6HA 2FMQA 1QHTA 2FBXA 3ETLA 2Z1JA 3BQ0A 5CZ2A 4KHYA 8ICHA 4XA5A 4Z4CA 4Q8FA 4C8NA 3LK9A 2Z1IA 4Z4HA 4YMNA 3RAXA 2AGOA 1C0MA 4PPXA 3HK2A 3MXIA 2IOCA 3H40A 4KLMA 1ZQDA 4CEZA 3LP3A 1XU4A 5HHHA 4KLEA 3AVBA 5J2PA 1C6VA 5D49A 1ZBIA 3PW2A 3ZCMA 2EHGA 5KT4A 1ZQCA 3Q8MA 2W9CB 4ELVA 4ELUA 5KT6A 4M9JA 3HPOA 1HQEA 2E6MA 3V72A 4CIEA 2GV9A 1ZETA 4CJLA 4Z6FA 5HNKA 4CERA 2HMIA 1RBSA 1WAFA 3ZSZA 3AVAA 7ICTA 1B92A 1RT4A 1T03A 2HW3A 3KHLA 3TI0A 9ICUA 5KG5A 3KHRA 4FVMA 4DG1A 1HJPA 1IH7A 1GOBA 5KG7A 1SKWA 4EP5A 3NF8A 1TKTA 1WLJA 3HJFA 1RTJA 5KFGA 5KTQA 2OPSA 4HUFA 5C24A 2A1JA 1NJYA 3HT3A 3HPHA 4FXDA 3ISNC 4LSNA 3L8BA 4I7FA 4FJ5A 1YVUA 4M41A 1JX4A 4NM1A 9ICOA 4DFPA 4N47A 3RJIA 2QXFA 4RNMA 3O3FA 3SPZA 1TV6A 1RT5A 8ICNA 4AHVA 3JPOA 5DGBA 5KFMA 5FRNA 4LY7A 8ICUA 5J2AA 5DKWA 4KRFA 2O4IA 4EYHB 8ICZA 3OGUA 3KLIA 5KFDA 4F3TA 1SL1A 5KRTA 9ICPA 5D3GA 1NK8A 4KLLA 4JV0A 4LZGA 3HXMA 3Q8LA 3DLRA 3SQ1A 4Z4GA 3VQ8A 2PI5A 2W9BB 2G8HA 1S1VA 3PW5A 5KGXA 1RZTA 5J2IA 4NY8A 2W9MA 1UWBA 1D8LA 2KZ3A 2DFEA 5KG1A 9ICFA 4FJ8A 1S1WA 4OLBA 4JRPA 3DMJA 5CR0A 3TQ1A 3U3YA 4PHEA 1RT3A 1QLNA 3OVNA 3PV8A 3LWMA 2F1HA 4Z0UA 3LP2A 4FJGA 1U47A 3M8QA 5JUMA 4I2DA 2FBTA 3EW9A 4O5BA 3V1QA 9ICEA 3MR2A 2JLEA 1LB2B 4F3OA 5J0SA 4PGXA 2PFPA 3NHGA 2X74A 3I0RA 2C2RA 2F8SA 4FS2A 4KTQA 1MU2A 3WNEA 4BACA 4KTWA 4DTRA 3QEWA 4DTUA 4OPJA 1RTIA 4NCBA 1NJXA 1JN3A 2BCQA 1RDCA 3BGRA 4CK2A 4GXIA 3TAFA 1ASVA 4YP3A 1S1TA 4LSLA 1XI1A 1ZQAA 1VSHA 3KLEA 1H38A 3ORYA 3DRPA 2BE2A 4B9UA 3SUPA 2VA3A 3AVLA 3LPUA 3L2VA 2EX3A 5DMRA 3RTVA 5CJ7A 4DOBA 1TVAA 4RUAA 4G1QA 2BCUA 3VA0A 5HRPA 3IHQB 2MUTB 9ICHA 5DB7A 4YR3A 2IBKA 3UXOA 1A77A 3GV7B 4AHTA 4LVSA 4IDKA 1SV5A 3C2KA 1KFSA 1R0AA 3ALYA 4HUGA 4PA1A 1LAVA 1C7YA 1MSWD 4WE1A 2DPIA 8ICKA 4Q43A 3L2WA 1NOZA 5BOMA 3T3FA 4MEYA 4YMMA 2ITGA 1BVSA 4M45A 4CJPA 4O3QA 4DSJA 4HCCA 3LANA 4I2CA 5KFYA 1UT8A 5KFKA 7ICUA 5L1JA 2V9WA 7ICNA 3HL8A 2PI4A 4BE0A 2Z1GA 1ZJNA 1C0UA 3AVKA 5KFRA 3SQ2A 3MDCA 3K4GA 1JLQA 2I5JA 4M3TA 4CK3A 2ZTDA 2PFOA 3GQCA 4B08A 4CGGA 1UT5A 4KLTA 3AO1A 9ICLA 4F4ZA 1RT1A 3K59A 3OSPA 3M8RA 1XC9A 4IG0A 4YFUA 4I9LA 5KT7A 1U45A 3GIIA 3MFHA 3ZSYA 4K8XA 2F8TA 4KB0A 3C1ZA 3AVMA 4ID5A 4O3NA 1SUQA 8ICJA 4F8RA 1Z26A 1VK0A 2YKMA 4MF2A 5FRMA 1BIUA 2JGUA 4QZDA 3C6UA 4JK1A 5J0WA 4ED1A 9ICCA 9ICNA 3K5LA 2G8UA 4KHNA 1WAJA 4F4YA 5DG8A 1EP4A 3CFOA 3ZSQA 7ICQA 3QEIA 2BCVA 5HHIA 1KVAA 1Q9YA 2NRZA 3VQEA 2F96A 4C8KA 5DK5A 5F9LA 5DLFA 4YG2A 4CJQA 4O4GA 2BHNA 3KD1E 1Y97A 4I2AA 1NKEA 4O0IA 4MF8A 3NGYA 3KKRA 5J2CA 4MFCA 3ZSOA 3OYFA 4K4HA 4RQ8A 3VQ7A 4DL6A 2YV0X 3ISCA 3M9MB 4I2GA 4IR1A 1LW0A 4AHRA 3KK1A 4ECSA 3L3VA 4RZRA 2W42A 4QWDA 2C22A 1NOYA 4W5NA 4JUZA 4QZIA 4IFYA 4J2DA 4NYNA 3KLHA 3N4MB 3KLGA 4YN4A 3LZJA 4FJHA 2Q3SA 1QSSA 5KG0A 3LDSA 5DDMA 3LZIA 4CHZA 1Q9XA 5J2MA 2B4JA 3E01A 4B9NA 3TARA 2AU0A 1T05A 4CGIA 1S77D 5J0PA 4PUOA 3B0XA 4F2SA 4W5QA 3V81A 4OKJA 4CE9A 1JIHA 3ZSVA 3THVA 3QEAZ 3D0PA 3B0YA 3T19A 4IQWA 8ICSA 3KHGA 2UVWA 2WTFA 1QE1A 1A76A 3VQ6A 4R66A 1BGXT 4PWDA 3I8DA 4RQ1A 3QO9A 4CJ3A 5JS1A 4KLJA 5TZVA 1RT7A 2XY8A 1N6QA 2OZMA 5J2KA 5IIJA 4RNNA 1CEZA 1TL3A 4MFBA 5KG3A 1VSDA 1KLNA 4CECA 4FZXC 3OYKA 1RXVA 3UIQA 1ZBLA 4CJTA 2C2DA 9ICBA 2XCPA 2JZBB 3RMCA 4DF8A 4QWBA 4M3YA 3RJGA 1LWEA 1YTAA 4O55A 4Z4EA 3G6YA 4EEYA 8ICFA 5EWGA 5IIOA 4F2RA 4OPKA 1B22A 3QEVA 4JV1A 3SCXA 1J5OA 1T3NA 2A1RA 4IR9A 4DTPA 5KFEA 1K6YA 4ECZA 4YMOA 3OJUA 3NF6A 3OYEA 3H8JA 1XWLA 4M9LA 4NYFA 2ZD1A 4RPZA 5F9NA 7ICJA 3ITHA 3IAYA 4Z6EA 2XGQA 3PR4A 3HSTB 3QNNA 4QWAA 3RH4A 1HNIA 4E7JA 1RYSA 1HUZA 2ZUCA 3RRGA 4DOAA 1ASWA 1PZNA 4NCGA 3TABA 4B9TA 4HHTA 3MXJA 3H08A 5KFPA 3C5GA 4DSIA 3QZ8A 3TANA 1SL0A 4PHAA 2OPRA 4PHDA 1VSMA 2F1IA 2D0BA 3VQAA 1KLMA 3RBEA 2HHXA 5J0RA 1KFDA 4DQIA 2OA8A 3ZT3A 4EZ6A 3IS9A 4DF4A 1HYZA 2ALZA 2W9CA 1KDHA 4I2BA 3PW7A 1C1AA 5K14A 3NF9A 3RH5A 4FBUA 4FK2A 3N97B 1L3TA 2UVVA 3UXPA 4FM0A 4XQ8A 4IRDA 4F5PA 3AVFA 3FYHA 8ICMA 3CM5A 2RN2A 3AVCA 9ICAA 4Q45A 1X2IA 1BQMA 2KQ2A 1IKYA 2XHBA 1BPEA 1T7PA 5DG7A 2FPLA 2RDIA 5IIKA 4KMUA 2M9NA 3SI8A 4W5TA 4I2EA 2BQUA 2G8FA 1ZQSA 2HB5A 4J9NA 3TAPA 4ECUA 3S3MA 1JMSA 4J9SA 5KFOA 5DQGA 3KKSA 1UOCA 5L1LA 2ZQBA 1XO1A 3T5JA 1FXXA 5DGAA 1D5AA 1BPZA 4KHSA 1KEJA 1X9WA 3QNOA 2OPPA 4UAYA 3DLBA 4DFJA 4KB1A 3WNHA 2DTUA 3UQ0A 1JLEA 4DTOA 4RQ7A 3JPTA 3L2UA 4NM2A 3MEEA 1Z00B 1JLBA 4F93B 2P5OA 2PYLA 2WOMA 8ICAA 5HP4A 2R8HA 1WSEA 4M9GA 1GOCA 4E19A 4NCAA 3DLGA 9ICKA 3HVRA 4GXJA 3C6TA 7ICGA 4PGYA 1UA0A 4HTUA 3QETA 2ZJAA 2AGPA 4O3RA 4KKOA 1C1BA 4DL5A 3B6OA 2W9BA 3QEXA 3JPRA 5KFIA 3OYNA 2BKEA 4E7IA 1S9GA 9ICWA 4UAZA 4N56A 1ZQXA 2YKNA 3IRXA 3H4DA 4QZHA 4O5CA 1ZQVA 4QAGA 4FLUA 3RBDA 5J0YA 1SKRA 5KFUA 4KN4A 3FDSA 4GXKA 4TQRA 1JLFA 3BQ2A 4UB4A 1BI4B 1EETA 4YFKA 3MECA 3JPQA 1K1SA 3C1YA 3K75D 3TFSA 4CGDA 1ZQZA 4J9PA 4F92B 4BXOB 4HCBA 4UB1A 1ZQRA 3GV5B 1NJWA 4PHPA 4F5OA 4B9MA 2VA8A 3VQ4A 4KHUA 5J2DA 4E1NA 2J6SA 1ZQLA 4QZ9A 4CJRA 1RPLA 2UVRA 4DQPA 2E4LA 1RBUA 4BE1A 3S3NA 3IM1A 3U6FA 4Q44A 5J0QA 2W8LA 2VG7A 3KIOA 4KFBA 3RRHA 4YXJA 3D45A 5KFWA 3ZD9A 4LH4A 1RXWA 4R8UB 3V6KA 1RYRA 3NGZA 4I2QA 5KRSA 1EX4A 3VQ9A 2F1JA 4KLOA 4E0DA 1ZQPA 3EPIA 3OS2A 4DEZA 3UXNA 3OYHA 5DB8A 1WSFA 4CESA 3G6VA 2FLNA 2MUTA 5KFQA 4YCXA 4RQ5A 4MFAA 2OZSA 3VQQA 4M3ZA 4GMJB 4DQRA 1Z3EB 4IQUA 4BDZA 2G8VA 1HYSA 3PX0A 3H8WA 3G0ZA 4EZ9A 5DB9A 1NK7A 3PVXA 4IQTA 4CEBA 1O1WA 3HW8A 1BPDA 3KK3A 4O44A 1ZQWA 2H5XA 4FLTA 4IRKA 3AA3A 2QK9A 9ICSA 1KFTA 7ICLA 4QOZB 1W0HA 3GIMA 9ICJA 2YNIA 2IC3A 4M04A 4FCYA 1ZYQA 5KT5A 5KFLA 3L2RA 4E7LA 5EOZA 2B21A 3V9SA 2W9AA 1D8YA 4RQ2A 2DY4A 3LAMA 4OKEA 4FJJA 4YR0A 4FS1A 1S1UA 2LSNA 3WNGA 4DFMA 4KLGA 4H4OA 4KO0A 4DWIA 2OPQA 2KZZA 1ZQNA 1L3SA 3MBYA 5FDLA 3VQBA 2KFZA 2VG6A 1T8EA 1ZQOA 1QSLA 4CFDA 4EBCA 1B9DA 1S10A 1W9HA 1A5XA 4CIGA 3NCIA 7ICOA 3AA5X 4BDYA 3RMDA 3O4QA 3DOLA 8ICEA 4E3SA 4CJUA 3SQ4A 1VSFA 2FC0A 5DB6A 4CGHA 1VSKA 2BPCA 3PO5A 1S5JA 3NH0A 1J53A 5J0TA 1TKZA 5L1IA 5CYMA 1S0NA 2VANA 8ICQA 3JPPA 1JLCA 3K58A 2ZTCA 3QEPA 5J0UA 1U04A 2BGGA 4YVZA 2FMPA 1CZBA 1D9DA 1RCHA 9ICXA 3ZD8A 5HLFA 2HHWA 4FJKA 4CHOA 4TURA 4BWMA 1F21A 2AGQA 1V9PA 5KG4A 1ITGA 3OS1A 3GIKA 4N5SA 3EWAA 3Q8PB 4ED6A 2RPIA 3V9ZA 4CGJA 3JPNA 3RB6A 3PX4A 1KVBA 2HHQA 3IG1A 4DO9A 1KVCA 3C21A 3LPTA 2R8IA 1UAXA 3QERA 3DOKA 2C28A 4QWEA 4F50A 4XUSA 4ED2A 4RW6A 2FPMA 4C8LA 2GUIA 1YT3A 4JWNA 4Q8EA 4Z6CA 2P66A 2LYHA 1T4GA 3UPQA 4CF2A 1ZBUA 1L3UA 3DRSA 1HPZA 4RW8A 2J6UA 4ICLA 2KZMA 1DTTA 4QZBA 4XRHA 4DQSA 9ICRA 4KN7A 2XCAA 1SKSA 2W8KA 5KFCA 4RPXA 3F9KA 4GVMA 1RBTA 2IS3A 1L5UA 4UAWA 2B5JA 4NLZA 1S6QA 5KFSA 4O9MA 2YHBA 4CJFA 4DTXA 1L3VA 7ICSA 4ELTA 5HMLA 3MEDA 4Z6DA 4IRCA 3ZDAA 3KJVA 4CHYA 4FLVA 4QZCA 4PH5A 4I2PA 2YNHA 3OHBA 2JZBA 7ICEA 5J29A 5CB1A 8ICYA 4PGQA 4M9NA 1BHLA 1HNVA 4UB3A 3PMNA 3VN5A 2D0CA 3NGDA 3AO3A 3C5FA 3MABA 3ZDEA 1BPBA 4FJNA 4NLGA 1HMVA 2A1SA 3RMBA 1DOQA 3ZDBA 4OJRA 4PQUA 4FW2A 1TV9A 1AROP 4FJ7A 2QKKA 3PW0A 4KLFA 1VSIA 3BQTA 3MR5A 4DTJA 2HHSA 3ZDDA 5HBMA 2UVUA 1WCLA 3V9UA 3CFPA 5HMMA 4YXMA 2O4GA 2KN7A 4DS4A 1QS4A 1MQ2A 5J2QA 5CY4A 4ED3A 2J6TA 3V9XA 4R63A 7ICHA 4CEEA 4CF0A 7ICFA 5SZTA 1TFRA 5CHGA 2FPKA 4H8KA 4J2BA 4FK4A 1WSIA 4M42A 5BOLA 1NKBA 4KTZA 4M6WB 5J0OA 8ICIA 3HPGA 3OYMA 2ASLA 1REVA 3AV9A 4ECQA 3RAQA 2OWOA 1TAUA 4OKKA 3G6XA 4JS4A 2XY7A 3BJYA 5J2HA 1NK5A 3VQDA 1S97A 4KLDA 3K5MA 2PFNA 3NFAA 1N48A 2BGWA 1S0VA 3U3GA 2PXIA 5I3UA 4DLGA 4O3PA 4DL3A 4CJWA 1BL3A 5KFZA 3MDAA 4E7KA 1N5YA 4I2HA 4IG3A 2WONA 4RW7A 4TSXA 3LP0A 3M9OB 3PY8A 2ATLA 3RJFA 1VSLA 3MR3A 5KFJA 1TGOA 4CIFA 4TUPA 2JEFA 1HQUA 4EBEA 1GOAA 3DLHA 1TK5A 4CEQA 4FLWA 2ZJ8A 8ICRA 3VA3A 5C42A 4AHCA 4QZGA 4KLUA 3P5JA 1Z00A 4I2JA 4OVLA 2IA6A 2G8WA 1QSYA 4E1MA 2ATQA 5C25A 5D46A 1ZQQA 1JXBA 8ICOA 1EKEA 4TUSA 3V1OA 9ICQA 1RNHA 5IIMA 3V7JA 9ICMA 1N56A 3M9NB 3QESA 1CUKA 4HYKA 2XY6A 3GV8B 5HROA 3GFKB 3QIPA 4FLZA 4K4IA 5KFBA 3OYAA 4FZYA 4O5KA 5J1EA 1BI4A 4W5OA 5KFTA 4O0JA 2XGPA 4P4MA 1CLQA 2PFQA 1A5WA 4ZH4A 4BXOA 3KTQA 4DU4A 4RPYA 4DSLA 4NLNA 4UB2A 4CJEA 1SZPA 1TL1A 5KGWA 2YNGA 4UBCA 4DLEA 4BGDA 3S9HA 4CJKA 3RJHA 5HRNA 3VQ5A 4DSFA 3ZT2A 4E89A 4RT3A 4J2EA 1CXUA 4ZTFA 1B9FA 3P83D 1NK9A 4OGEA 9ICIA 3KD5E 3SV3A 2BCSA 5FROA 4RW9A 4RUCA 2KW4A 3C2MA 3LP1A 3NGIA 3AU2A 4R8UA 4ECYA 4RG8A 3CQ8A 5EWFA 3VQCA 4KI6A 3AVJA 1CXQA 1TK8A 5DQIA 1B43A 1WNSA 4GW6A 3OYDA 8ICCA 3SNNA 4I2FA 1XSPA 4ECRA 4FZZA 4FJXA 3PUFA 3V1RA 5J0XA 5KG2A 3RWUA 4DSKA 3OYJA 1TK0A 3SUNA 4J9RA 1TVRA 4EYIB 1EXNA 2D0AA 3RH6A 4YQWA 5CP2A 1DLOA 4BDPA 4CHPA 1WSGA 2IMWP 5CA7A 3T5KA 1D9FA 3H8SA 3DLEA 4LH5A 1C0TA 1QTMA 3NTUA 1VSJA 1HUOA 3PX6A 5T7BA 3TAEA 4KHQA 4YR2A 3V7LA 2G8IA 2FLPA 3ZT4A 2NUBA 4BE2A 4CFBA 2BPFA 4M3UA 5J2BA 4CF1A 3MGHA 3DI6A 1ZQUA 4QZFA 4DL7A 3E2EA 1XSNA 4B9SA 1FKOA 2XY5A 4O5EA 1IO2A 1Q8IA 3AVIA 3B6PA 5DDYA 3GDXA 7ICVA 4M47A 3NBPA 4FLXA 3RB3A 7ICPA 2FLLA 2R7YA 3ZDCA 4ECVA 2FMSA 3C2LA 4RQ4A 2YNFA 3MFIA 4BWJA 2I1QA 2IAJA 3ULDA 1BISA 2NRWA 3PNCA 1ZQKA 3TR8A 4I2IA 1U4BA 2ISPA 4GC7A 5J2EA 1S0MA 1IKXA 2NRXA 3BQ1A 4CEAA 1COOA 2C2EA 1G15A 3C95A 3HP9A 1ZQHA 2KFNA 4E7HA 2DFFA 4W5RA 2G8KA 4ID1A 4QZAA 5IILA 2HHVA 4Z4IA 1S9FA 1JLAA 5I42A 4M0AA 4QWCA 1UA1A 1RT2A 2VG5A 1IKVA 3RB0A 2PYJA 5DBAA 1U9LA 1RTDA 1XS9D 4RT2A 5KFHA 1NOMA 3AVNA 2E6LA 4DL4A 3NF7A 4IQVA 3TFRA 1WSHA 4GLXA 4GC6A 3M8PA 3M8SA 1ZBFA 3NE6A 3V6DA 1IKWA 1IM4A 2VA2A 3NAEA 4M9HA 3JYTA 1KTQA 1JKHA 4ED7A 7ICIA 4K4GA 4KLQA 1KSPA 4DFKA 4DS5A 4J9OA 3HM9A 4XIUA 3RR7A 3OJSA 4DL2A 3L2QA 2BR0A 4J9MA 2ZE2A 3WNFA 1NK0A 1MQ3A 4Q5VA 1ZQFA 4IFVA 8ICWA 3PO4A 1X9MA 4KLSA 4O3SA 3I0SA 4JLHA 1HYVA 3BDPA 4K8ZA 1HRHA 1BQNA 4RQ0A 1BIZA 4KLHA 4AHUA 4KLIA 4UB5A 4FW1A 3O3HA 1NKCA 1WSJA 3V7KA 2XO7A 1ZQEA 3PR5B 1JL1A 4ZTJA 3OSNA 4O3OA 2ASJA 4DTNA 3Q8RB 1BPXA 2P51A 2RKIA 4JRQA 3MR6A 1ZQGA 9ICTA 4QW8A 3OHAA 3H4BA 1LAWA 8ICTA 1J9AA 2PY5A 3K5OA 4RQ3A 8ICXA 2HVIA 4DQQA 5CYQA 3FFIA 4KI4A 5KFAA 3SI6A 8ICVA 5KG6A 1MC8A 3LAKA 4P4OA 1Z25A 4G3IA 2PZSA 5D4BA 2A1JB 1RT6A 4FK0A 3MXMA 4FJMA 3SZ2A 4FBTA 2DPJA 1FK9A 1EXQA 4M3RA 4KITB 2HHTA 4KREA 5BPCA 2V4RA 5EU7A 4Y1CA 4KHWA 1LWCA 4TUQA 1XHXA 1TKDA 1RBRA 3MGIA 4IBNA 4CF8A 1VRUA 4H4MA 4J9QA 4CK1A 5L1KA 3QE9Y 4FYDA 4JS5A 3ZT1A 4JWMA 3RMAA 5J2GA 3SPYA 3SUQA 4FM2A 5CWRA 1JLGA 1ZQMA 3RR8A 2AQ0A 3O4NA 4RNOA 2BPGA 1IG9A 5DG9A 3V6JA 2X78A 4CHQA 4B9VA 1DTQA 3DLKA 3DM2A 3LDAA 4ED8A 1C1CA 2FBYA 1U49A 2JEGA 5HRRA 3QEBZ 3OYIA 5J2JA 3K57A 2X6NA 3OY9A 3GILA 1RBVA 3JPSA 4R64A 3Q8QB 2Y1JA 4F5RA 2R8GA 4Q0BA 2HVHA 1VSEA 2YHAA 3G10A 3A2FA 4DU1A 1NK6A 1SL2A 3OYLA 2VWKA 1ZQYA 2GBZA 3TWHA 1X1PA 2RF2A 5KFNA 4CJSA 3OYBA 5KFVA 4CCHA 4F5NA
chains in the Genus database with same CATH superfamily
3CFRA 1E4GT 4AYBD 4L8RB 4CZKA 2QWLA 3HX0A 4M6WA 1MU2B 4EK2A 4DMNA 3FNNA 1MWZA 2ZH7A 4KAIA 1EO1A 2O8CA 4DPTA 1JJ2R 1U0HA 1O6XA 2QKQA 4UOHA 1CPZA 2ROPA 4CNYA 1IV0A 2EC2A 4LSLB 3Q8SB 3CJSA 2CQ2A 3BF3A 3CP8A 1VQLS 2HHPA 3N79A 1ASUA 2P1JA 3SEOA 2LEAA 4C0ZA 4NLBA 3SJJA 1RDDA 3R5AA 4CDIA 1VC5A 1PK3A 2ZOMA 1KKHA 1XNQK 1TAQA 1WG8A 3K5PA 2ZUBA 4ZHRA 3ZSXA 5AK4A 3MURP 4XH5A 4ECXA 1TTHB 3NVKA 8ICLA 4OZLA 4KY3A 2P6UA 4HVJA 4ZLJA 4DV5K 2KT3A 1SV5B 1SJQA 3MCMA 4B8AB 4GO5X 3PNIA 3H3NO 2FI1A 1SBRA 2D5RA 4OLOA 1IXRA 3ZT0A 3JQKA 1RA7A 1NJZA 1FNMA 1FD2A 2BQRA 3CYMA 3HYFA 3W2VB 2WB4A 2NYHA 1X4GA 4CM2A 3PFOA 4I56A 1RKJA 5CZ1A 2FGOA 1OVQA 5AM2A 1C0UB 1RDBA 3BSAA 4YHHJ 1X0PA 2ZWOA 2A3VA 1FDAA 2HZAA 3MAQA 4Z4FA 4QU7A 4DR4F 1SJRA 3IGVA 4AYBC 3MCOA 5JVGQ 3VQPA 3PW4A 3M2RB 4IKFA 3KK2A 2U2FA 4Z2XA 1X40A 2WBMA 2PMZF 3L4BC 1YZ6A 3EZ5A 2LDIA 2ITMA 2KKHA 3U9ZA 4YB6A 1RDAA 3QFWA 3MZIA 4ZP8A 5BN8A 2CVEA 5AQJA 2GC8A 1SIWB 2CPZA 1NGBA 2F65A 2QWNA 2ZUDA 3MWTA 1VQ5N 1HHSA 4MQ3A 4Y65A 2HYIB 4IO9Q 3KLFA 1ZQ1C 1UPPA 3AUOA 1T95A 3HFZB 5GIPA 4DV2F 4DTSA 2K8GA 3GSDA 4CF9A 4M3WA 3C8YA 1RLCL 2LEBA 1NM1A 4CJ4A 1X9SA 4FWPA 1ZBSA 1P8GA 3CC7S 4CEFA 4ZLPA 3VGVA 4IO9L 2FHJD 1NLKL 3T1AA 4MAKA 3KK1B 2ASMA 2B6AA 5HATA 1I3AA 4PY5A 2DY9A 3OL7A 4J9LA 2YX1A 2UUAK 1N54B 2M0GB 4DSEA 3TVYA 4URSA 1FTRA 1B99A 5CR4A 2KFYA 1FHTA 2RDJA 3S8SA 2VWJA 5CCLA 2MGZA 3GFZA 3MM9A 4LBPA 3JAMU 1I39A 1JCFA 4B9LA 1HIYA 3HFVA 3T1HF 2QLBB 3VEZA 4NRTA 4WYWA 1DRZA 3V2UC 3VGKA 2XHCA 4I27A 1QE1B 2OEKA 2E2NA 2KHOA 1WUDA 4CZLA 7ICKA 2IHMA 3CJQA 2V2ZA 1NMDA 3EYZA 3ALRA 5C5JA 1S6PA 1YSJA 3OBWA 5EWEA 3SJHA 1TL3B 1FF2A 4J5OA 4MFBB 1BCMA 1IBLJ 3CG7A 4RU2A 3T1YF 2XRIA 4UB8U 1CJTB 1U48A 1NJIO 2OTLN 2E66A 1YG0A 3MPDA 3RGIA 5AICA 4RCHA 1FKPA 5IIIA 4WF9Q 4Y2AA 2DXFA 2IM2A 1UMJA 3D54A 2E9ZA 1MWKA 1BPYA 2AX1A 4USVA 1LWEB 2DRDA 3MMAB 2IDOA 4ECWA 5HP1B 1U1OA 1PK1A 1JXLA 3IFRA 3MGVA 2HNYB 2VD3A 3L3UA 2ZIUB 1TUGB 3AQEA 5RUBA 3NH2A 3CWJA 4WF9L 2BOPA 3ISDA 2R8KA 3CD0A 3R7SB 2MQNA 3LWLA 3G25A 1KHWA 4TQSA 4RQNA 3R9KA 4F26A 4CJVA 3OTQA 3A1YG 1D1UA 4IOAQ 2EK1A 2EEYA 3KUGA 5F0WA 8ICHA 5DZ6A 4XA5A 3E0FA 3T6BA 4Q8FA 2FZGB 3LK9A 4H54A 3T69A 4JK7A 3EDQB 4ED5A 2L5YA 2HOIA 1RI7A 4NCGB 4IOAL 4WFZA 2G5HB 5H1SV 2B43A 4H5WA 2O67A 4PPXA 3ETMA 2KYZA 3MMBB 3JAMO 4KLMA 3LP3A 3NS5A 1XU4A 3US5A 4KLEA 4C0BA 4ZLLA 1LKZA 3UMCA 3Q8MA 3IS9B 4ELVA 2W43A 2RQ5A 3TJAA 1ZETA 2QWOA 4CJLA 2VFVA 1AFJA 2LCWA 3Q23A 1RBSA 3QFHA 3OTOJ 1RT4A 4B3SF 1MDUB 9ICUA 2YKPA 3GJSB 4E98A 2QLWA 4FVMA 2GJFA 2I6WA 4PG5A 1QH9A 1WNEA 2KE7A 3FKBA 3HJFA 5KFGA 2OPSA 2W2PP 5C24A 1XMQF 3JTNA 2A1JA 2KVQE 5D15A 3UQSA 3HPHA 3WKBA 3OTCA 1WB9A 4LSNA 1LXNA 3VAMA 4NZ7A 1UVIA 3THTA 5F8JA 2DTJA 3L7UA 3GFHA 3K0JA 3QATA 1TV6A 1JLEB 1RT5A 2AEMA 2CNOB 4ZIWA 1NB2A 2FF6A 3A0BU 3MEEB 1JLBB 4LY7A 1AUDA 5J2AA 2ZZNA 2WOMB 4DPWA 2O4IA 5ALPA 8ICZA 3KLIA 1Q8BA 3A0HU 5KRTA 3TOQA 4P2XA 3N5BA 4KLLA 5KL8B 3HXMA 3QUQA 1RJJA 4KKOB 3UNYA 1OJ4A 1VQNN 4Z4GA 2DK2A 4CP5A 1S1VA 2G8HA 5BRDA 3W8PA 3PW5A 5KGXA 1DJ0A 4PPZA 1S9GB 3LDLA 3IRXB 1D8LA 2HSZA 4X62J 4OLBA 3QU4A 5CR0A 3G6EN 3D2SA 4OX9J 3U3YA 1QLNA 2CQGA 2F1HA 1EETB 4PL1A 4Z7CA 4A48A 4WIIA 1Z05A 3M8QA 1HKAA 2PFDA 2FVPA 2FBTA 4O5BA 1N5WA 1NZPA 4F3OA 1GFWB 3NHGA 1K0TA 2KI2A 1ELOA 2C2RA 2YH1A 1RWOB 1Q7YO 1MU2A 4BACA 4DTRA 3QEWA 4OPJA 1RISA 1PBUA 2RNEA 2QV6A 1NJXA 1Y0HA 4GXIA 1FRJA 3GPAA 2LECA 1U1NA 2GAHC 4YP3A 4OX7A 1Q81T 3O5BA 4LSLA 2IFXA 4RUBA 1VSHA 1RWWB 2F8MA 3ORYA 1NLVA 3H90A 4ZS6A 1B7YB 3O9QA 4B9UA 4WZMA 4NA1A 2VBYA 1FA0A 5LJ3Y 3AVLA 4KT0C 3L2VA 2KKPA 1EIYB 2X1GA 3ISZA 1IBLF 2XS5A 5CJ7A 4DOBA 3D3BJ 2Q31A 4ANCA 4LJXA 2P9SB 9ICHA 2VKRA 5DB7A 2IBKA 2W25A 3G8QA 3GV7B 1F9EB 3R1HA 4U7CA 4X4UA 2VC1A 2QWPA 2NO5A 4LF6F 3BS7A 1SV5A 2JWKA 3C2KA 5KPZA 4I67A 4HUGA 4O44B 1SC1B 2JH1A 4RBTA 1MSWD 2WMMA 4LR7A 2MKHA 3L09A 3W2VA 1W97L 2CIMA 5D4PA 2YNIB 1BVSA 2IC3B 4NWBA 4O3QA 4YORA 4DSJA 1UT8A 5LSOA 5KFKA 3ICXA 7ICUA 3NVMA 3LDPA 5ADXH 2PI4A 2Q0UA 1VBYA 1C0UA 4DV7J 5KFRA 2X7IA 4KH1B 5J8YA 1RHKB 4PKDB 4NWIA 4CK3A 2ZTDA 2AMCB 2PFOA 1K8AT 1HKBA 5FDLB 2CQHA 1X6JA 5E79U 4OMFG 2HBYB 1WEXA 9ICLA 4F4ZA 4A8XA 4FOIA 4DR2K 3G71S 2CGLA 2HQDA 3MPVA 2HVZA 3OSPA 2FTRA 2IVFB 3BGLA 3M8RA 3DDHA 1CQMA 4I9LA 3M2RA 4MKBA 4R25A 5AZJB 4K8XA 1OUQA 3W61A 1M90O 3TR5A 1VYAA 3C1ZA 3NVYA 3KYLA 2ZH2A 4JKEA 8ICJA 4F8RA 2MKSA 1VK0A 2YQEA 4MF2A 3OTOF 1BIUA 2JGUA 4QZDA 4AM7A 1UEUA 3FC9A 4KJIA 5J0WA 9ICNA 4AD6A 2G8UA 1WAJA 4F4YA 3OW2R 3QEIA 2BCVA 4DCHA 1YJRA 4PR6A 2NRZA 4B1YB 4IUFA 4C8KA 4DMZA 4KHPK 2G13A 2OEJA 4OYMA 4YG2A 4IO8A 1TZ0A 1VHIA 4OZ0A 1OH5A 1AXQA 4MF8A 2RVJA 4AXIA 1C4CA 4K5SA 4RL1A 3OYFA 1FDDA 5DM7Q 3LQVA 3T9ZA 4OZ1A 4ZVRB 4O8UA 2DHAA 2YV0X 3M9MB 3IG1B 3CDAA 3KK1A 1BUPA 3L6QA 3D6HB 4O4RA 1E6VB 2HIYA 5DM7L 4JUZA 4QZIA 1KVJA 3I5CA 4NYNA 1NUEA 3W5YA 4YN4A 3PFEA 5LMNJ 5AQNA 4V19S 5AR0A 5DDMA 4BRPA 2YX8A 3GMGA 2AU0A 3J8AA 3W1YC 2JDJA 3ID8A 1YHQS 2WF7A 2LP4A 4F2SA 1DTTB 3S01A 1T9XA 4JI2J 3T19A 4IQWA 2UVWA 3HHKA 1VIOA 1QE1A 2BABA 1A76A 2F1FA 3VQ6A 5AKZA 1NSKL 1BGXT 1UFKA 4OI4A 2FE9A 2B5JB 3VTHA 4X62F 1WC1A 4CJ3A 2WF8A 2WVFA 1IBMK 1RAHB 2OZMA 1TL3A 5IIJA 4OX9F 2DGUA 4MFBA 1VSDA 2ZZMA 5KQ8A 1RXVA 3UIQA 4CO3A 2L9DA 1Y3KA 1CJTA 4P0PB 2C2DA 3MN7A 4EWTA 4WKYA 1N5QA 3GONA 2OEHA 4I2PB 1TMJA 3D5MA 4KIAA 3N4PA 3RMCA 1K9MO 3ENAA 5FLXU 3RJGA 2G2YA 1LWEA 3CJRA 3MMAA 3G6YA 4P71A 5AKXA 3QT8A 8ICFA 2JSXA 4I68A 2CNLB 5IIOA 1NZAA 4B3MJ 4V19X 3QEVA 2CPIA 2ZIUA 2G0JA 2LQJA 4PYAA 3UMGA 1K6YA 2MZRA 5LY3A 4RNHA 1VISA 7ICJA 3IAYA 4Z6EA 4ZCMA 1ATRA 2J9DE 2ROEA 2P9CA 4QWAA 5HBMB 3RH4A 3CJ5A 2BH1A 1YBTA 5GAGU 3MUVP 1ASWA 1PZNA 4NCGA 5J2QB 3CDWA 1KQKA 3EJMA 4GV3A 3SCIE 2VFSA 2AYGA 2DBBA 3MMBA 2ZUAA 2LYVA 2OTLS 2I1RA 3QZ8A 1I1GA 1Z1BA 2OO4A 4QIEA 4PHDA 1YKWA 4DQIA 4KB7A 4DR3K 3IS9A 2XQCA 3D2EB 5KAIU 5F3XB 3P49B 3SQOP 3GBTA 4FK2A 3O44A 5AQPA 1PBAA 5ETLA 1ZD3A 5ALHA 2A3JA 4YOVA 1IQZA 1UCNA 3AVFA 3M7VA 3QUBA 5I3UB 3CM5A 4LF8J 3BEGB 2KQ2A 4USMA 1IXKA 3D6FB 2FPLA 3BYRA 5A0LA 4KMUA 3QGGA 4DV7F 4DFDA 4H4KC 2BQUA 2G8FA 4J9VA 1AT1B 1WC5A 2HB5A 1PVRA 4J9NA 3ATUA 4ECUA 1JMSA 4M63C 1KHVA 2IIHA 5DQGA 4NLSA 3VAIA 2BYCA 4CYUB 1S12A 4F3QA 1FXXA 4KHSA 1KEJA 4FFDA 1X9WA 2E9TA 1VQ4S 1RWMB 4DN9A 2DTUA 4WFYA 3UQ0A 1FNOA 1JLEA 4IQMA 3T6JA 3JPTA 3D9BA 1RWVB 3MEEA 4IKAA 1OY9A 1JLBA 1HX1A 4F93B 2WOMA 4C97A 1VQYA 3ZNJ1 3C19A 2CJBA 3C2PA 1WSEA 1Q82O 3BBFA 5C0YA 3PACA 4FYXB 2QN6B 5L9NA 1S4FA 2ZJAA 2UYTA 4O3RA 4KKOA 2A2CA 3WX4A 5K20B 2DYAA 2E8NA 2ZOFA 3ENQA 3OL8A 3OYNA 3VQSA 3AB4B 2V8PA 1S9GA 3FLCO 3KUEA 1SC4B 4YOWA 1ZQXA 4K25A 4MKAA 3IRXA 2YQ1A 2W03A 3NMUA 4NLYA 2K7JA 3RBDA 5J0YA 4DV0J 4CO2A 2N1RA 2N4CA 3S1TA 1BI4B 1EETA 2RRBA 3BQ7A 3LDQA 3HSZA 2HGMA 3K75D 2XYPB 4C7ZA 4F92B 1FE4A 4UB1A 1ZQRA 2NS1B 1NJWA 5LMNF 1LXJA 1QY7A 4KHUA 5J2DA 1PYSB 5ETKA 4F0MA 4ZN3A 3MCPA 2E4LA 3IM1A 1O08A 4Q7AA 3U6FA 5J0QA 2W8LA 2UXCK 4PZNA 2ZDOA 4RUHA 3QAUA 5DO2A 4BQZA 2Q36A 3CMEN 5HI7A 3D45A 3ZD9A 3O0FA 1UVLA 4LH4A 3NGZA 3OR2B 4FSVA 4RTFD 3HKWA 1KBRA 1HWLA 2BA9A 4P2SA 1J97A 4DEZA 4L73A 4CESA 2QEXS 5E3RA 2P9SA 2PSZA 4YCXA 3N5FA 2OZSA 1KTVA 4GMJB 2UUWA 4PRFA 1ZXOA 2LYBA 1HNZK 5DB9A 2JVOA 4CZMA 2X51A 2A6OA 4IWVA 3DLEB 4DR1K 1BPDA 1C0TB 4O44A 4FWOA 1ZQWA 3WHIA 4B3MF 1DQ8A 2H5XA 3PJ9A 1SXEA 2HFVA 4YOEA 4J7CA 1U02A 1FWPA 9ICJA 2YNIA 2IC3A 4JAXA 3PTWA 4E7LA 1N34J 1D8YA 2WSFC 3LAMA 2J4RA 1NGIA 3TTFA 4FJJA 2CZ4A 3NS6A 4FYVB 5AM4A 4DFMA 1SV4A 4KLGA 4DWIA 1ZD2P 4Y00A 3MBYA 5FDLA 2KFZA 3NWRA 2P9IB 1T8EA 5FJ4A 4ZIVA 2V7YA 4CIGA 4BDYA 4F72A 4DR7J 3DRYA 4E3SA 3SQ4A 2LMIA 2AD9A 2UUBJ 4GKKF 1M5HA 1N62A 1VSFA 4I2QB 2VICA 5AZJA 1QVGM 2VPZB 2QC3A 2NUHA 1CQNA 5I42B 2VQEK 3CC2S 1RT2B 8ICQA 1JQGA 2VG5B 5ALUA 1IKVB 3JPPA 2WVBA 5A0YB 5GADI 2W6KA 4K59A 4LF8F 2O8EB 3BGUA 2EWHA 1U04A 2BGGA 4X4TA 4YVZA 2FMPA 4TNOA 5LL6Z 2U1AA 1CZBA 1S72N 3WK6A 3OVSA 1RUSA 3ZZYA 4DPYA 3UCZP 3C28A 1FERA 2RJZA 1QZ6A 3JYTB 5LOQA 2AGQA 3IDWA 2BV3A 1WBBA 2EZZA 3AGRA 4N5SA 2FB0A 3EWAA 4DCOB 3PYDA 2RPIA 3DKDA 2DH8A 8AT1B 2ZE2B 4ZCLA 4FWSA 2G0AA 4RWXA 4LF4K 4CI0B 2Q66A 2ZC3A 2HMPA 3IG1A 5U47A 4DO9A 4KE5A 1E6VA 1N5SA 3LPTA 4WJBA 1UAXA 4MLHA 1VK8A 2NSCA 2NPFA 4QWEA 3N6NA 4X4RA 1PILA 5AKEA 4K42A 4FVUA 1ECWA 3HOTA 3NS1A 4C8LA 1KC8T 2HDOA 1XK8A 5D0HA 3OVAA 2P66A 2B9YA 3KZXA 1S57A 2KP7A 2YMLA 2RKIB 4QBUA 4HAIA 4YY3J 1HUXA 1ZBUA 2NXEA 3OBYA 3G87A 1DTTA 3MMCB 2YVSA 4CZJA 4QZBA 4DQSA 9ICRA 5ALGA 1TU0B 2XCAA 2BW2A 3J7YU 2M8DB 4RPXA 1RBTA 2MLYA 1RT6B 1REGX 2ZXIA 2B5JA 2DGSA 3IR5B 3LPEA 4DZDA 4DV0F 4O9MA 3PDNA 4OQJA 2IVPA 2YHBA 1LWCB 2H3GX 3RSEB 1L3VA 2CWXA 4P0PA 5HMLA 2VONA 3JSYA 4Z6DA 2IRUA 2K3KA 1PYOB 3TWZA 1IWGA 4I2PA 1KOOA 1MW7A 1GX5A 4ISGA 4OJPA 2JVRA 8ICYA 1BHLA 3JSBA 3MGJA 1LKYB 2QARB 2OM6A 4Y2XA 1DTQB 3DM2B 1BPBA 4FJNA 1B4FA 4NLGA 2Z58B 1DOQA 1IBKJ 1FJGF 3VF6A 2HQIA 2DGOA 6FD1A 4C1NK 3PHTA 3PW0A 4KLFA 1VSIA 3MR5A 4DTJA 2W7PA 3RJMB 2YTCA 3GZ7A 2HHSA 5HBMA 4WJ3B 2UVUA 3JSRA 4HDGA 4NJ8A 2NXJA 1Z6RA 4Q0BB 5J2QA 5H9FK 5CY4A 2J6TA 2M7SA 5HMXA 2A1AA 4YDUC 7ICFA 2ZGYA 4K41A 2EZYA 5AQUA 1PKUA 4M42A 1S9EB 5BOLA 1EB0A 1U8SA 4LF5F 3HPGA 2W04A 4IXCA 2OWOA 3D2EA 4JS4A 3G6XA 2MSNA 2XM3A 2H4YB 1KNZA 1C0FA 3V4IB 1XNQJ 3IMXA 2J76E 1S97A 1UAWA 3I82A 3K5MA 3J7ZO 4H5NA 3MAHA 3R6MA 1YJNN 1FESA 5T14A 1S0VA 3U3GA 2PXIA 5I3UA 4DLGA 3UCUP 1BL3A 4OZ5A 3NGTA 1GLDG 4DV5J 1M1KO 3DHWC 2HS4A 4CIOA 4JYAF 1U09A 3QB0A 2GW8A 1FRLA 3VEWA 4LRCA 1VC0A 3DRRB 3OXGA 3RJFA 5J1NA 4CYUA 4PXEA 4JI4K 2GTDA 1TGOA 2XLJA 1VFJA 2DGQA 1GOAA 4DR7F 2KKVA 3DLHA 1PAEX 4B1UB 4WYBA 2UUBF 1R27B 4FO0A 3CCZA 4BRAA 3LA0A 4DDFA 2HG4A 3P5JA 1KVIA 1UVJA 4F9OA 3G8TA 5AQSA 5T41A 4Q2LA 3AXMA 5AE1A 2Y1RI 3HI0A 3FUYA 1YAGA 2MQPA 3RVCA 1KEKA 2ATQA 5ETPA 2AHOB 4NPOA 2AH5A 5D46A 4YOYA 1RA6A 3ZXWA 1NG9A 2KXHA 1X5PA 4C3KA 1WI8A 3LDNA 4Y2CA 4B3TK 3TKAA 2P9GA 9ICMA 2V69A 5HSPA 3TA1A 3N28A 3R1LA 2XIDA 3UNGC 1CUKA 1RE1B 2IHR1 1YI2N 2XY6A 3GV8B 2BJ9A 3GFKB 2CH6A 1WUAA 2DNPA 2YKOA 3QJJA 2FYXA 4O5KA 1CJUB 1BI4A 4BREA 2VKZG 1TMMA 3WXIA 1X4BA 2MKYA 5D8HB 1A5WA 1F9HA 3ZZPA 2F8LA 3KTQA 4DU4A 4P7TA 4NLNA 2I7NA 5JMVA 2OHFA 2W3RA 1A0PA 3M7DA 3RJHA 3VQ5A 2ERRA 2F77X 4UASA 2O1PA 4OGEA 4UAVA 2XZDB 4ZVFA 3EDRB 3SV3A 2BCSA 2AT1B 5MLCV 2FHKA 1VR6A 3TRGA 3OD2A 3M30B 4C80A 5BPMA 3SMSA 4LRAA 4HACB 5KL1B 3RYLA 2VPYB 1XERA 3JSMB 3NGIA 4DUYK 1N0UA 4X64K 4H5RA 3OR2A 2XVTA 3D3CJ 3CQ8A 3THYB 5EWFA 3S7RA 4ZPDA 3OYDA 4TLQA 2WB1D 2DR9A 2P8IA 3V1RA 4HL9A 2B6GA 2NZCA 1WHXA 4EYIB 3I8BA 2HFSA 3P4UB 4YQWA 5CP2A 1G7CB 4CHPA 1WSGA 2IMWP 5TKWA 4K7QA 5ALQA 4KH5A 3DLEA 1ZM9A 1C0TA 1HW9A 1QTMA 4U7UD 3PX6A 1SCJB 5T7BA 4KHQA 3HHLB 5JMNA 5M1OA 5IC6B 3ZT4A 3QDKA 2NUBA 4CFBA 5AK3A 2OMOA 4CF1A 1ZQUA 1XN9A 1IBKF 2NXUA 4NYOA 4QZFA 4K4ZA 1IR0A 3CMES 4UUWA 2H9ZA 2RS2A 1OSCA 1IO2A 3B6PA 4EO6A 2P2CB 5DDYA 3DAWA 5ALEA 7ICVA 4OL8A 5HJXA 2Y8WA 1ROFA 2CWKA 5D0RA 2YX7A 3ZDCA 1S1XB 3WKAA 5EE0A 1NHUA 1N0VC 3C2LA 1YF5L 4BWJA 1W25A 5A2QU 2FJXA 4PEOA 4DJBA 4ERDA 4H03B 3PSIA 5CCMA 4DR4K 3UKUB 3TR8A 4I2IA 2P9IA 1RACB 5M1KA 2H3EB 4Y2RA 5ETTA 2M0NA 3QGPA 3BBCA 1YWXA 3GDQA 4JKBA 5ALOA 2KFNA 2KDOA 4CDGA 4LFAK 3FBFA 3JTOA 4W5RA 4DR6K 4ID1A 3R7NB 1N32F 3CSKA 2MQOA 1XNQF 4Z4IA 2IY5B 2BACA 4L3KA 3I56S 5I42A 4CM0A 1RTHB 1UA1A 1HBUB 1RT2A 2VG5A 1J2NA 1IKVA 5A0YA 2O8EA 5IV3A 1XUPO 1U9LA 2PKEA 1R7IA 2HVEA 5DDPC 2CAJA 3NF7A 2WB1C 1WSVA 3AH6A 2HIQA 4L74A 3O9SA 4GC6A 1UCVA 1IM4A 2VA2A 4JP8A 4K5RA 4G6VB 3JYTA 1KTQA 4KLQA 4DS5A 3HM9A 1VDVA 1SXDA 1KQGB 2EVZA 2YQ3A 3RR7A 3OJSA 2VOPA 1U0SA 2ABYA 1BNPA 2ZE2A 2ZBRA 2XLKA 2Z57B 1HR0K 3IM8A 1X9MA 3PEHA 2QMWA 1K47A 5HK4A 4JLHA 2WHOA 4L76A 1HYVA 3IWNC 1COKA 4CLKA 5HMZA 1BIZA 1KS2A 2YXLA 4KMOB 1ZQEA 3C3LA 3T1HK 3RAMA 2BKPA 4ZTJA 3OSNA 2E3TA 2DKXA 4O3OA 4BRMA 1WSRA 2H48B 3HLUA 2F9WA 4DV1F 2KLAA 2RKIA 2D74B 4DQQA 4NEZA 3CHWA 3MMCA 1MC8A 1BDGA 3Q2SC 3E8OA 3LAKA 3BYPA 1Z25A 2PZSA 3S41A 1RT6A 3AA8A 3SK3A 3HSDA 4NLCA 1R8AA 2OJ3A 4M3RA 2QWRA 3T1YK 4KITB 4I7FB 5BPCA 4C9DA 1LWCA 3GYXB 4TUQA 1XHXA 3NAHA 1CC7A 2CPEA 3UR3C 5GAHI 2BRKA 3BUZB 4WCEQ 2B0GA 3QE9Y 1R8PA 2F8KA 2A19A 4TN2A 1AA1B 4P10A 5J2GA 3FMWA 4FM2A 2YTUA 2A40A 3RR8A 4OX6A 1VQSA 4LVNP 1XR5A 2BPGA 4WCEL 1LKYA 1U24A 4EELA 2QARA 4ES3A 4CHQA 2ZH8A 1DTQA 5AQOA 4ILRA 1W2IA 3DM2A 1H1VA 4YMEA 3J7A1 1YJ9N 2KHDA 3TUIC 2UU9F 1U49A 3EVWA 5C7PA 1TR0A 2ACMA 2LQBA 2YMMA 4PXDA 3OYIA 1PC5A 1F0XA 5DJBA 2LBOA 2CVIA 1VQ7N 2QZ8A 2GVZB 4DCJB 4MLEA 3SBTA 3JS9A 1RU2A 4O0NA 4A8KA 3MM7B 4BC7A 1S1WB 2P6TA 4R64A 4F5RA 1KAZA 4CTAB 2DO0A 1DKGD 2MXYA 4Q0BA 1RT3B 2HPUA 3JB9k 3LP2B 4JHDA 4NB4A 3F2KA 2MRLA 1AW0A 2C3OA 2GBZA 4Y2QA 3HILA 1NCLA 1Y3JA 1UFWA 4CJSA 1FDNA 3CCJN 3G8SA 4C3MA 1S9EA 2NZTA 1RTIB 5H9EK 2BQ3A 2GCFA 3BH6B 4B3SK 2JFDA 3V4IA 1V3ZA 1Y00A 3HJEA 4WP9A 3HHEA 4DOCA 1K44A 1Y88A 3SAGA 2XO6A 3R5GA 1WN7A 4CEOA 3KLEB 5THWA 3DRPB 3AT1B 2KTQA 2FC8A 4JI6K 3CJ7A 2M3DA 1XMQK 4KH4A 3RJKA 3TADA 5IWAF 5HRSA 3LVVA 4R65A 5DS7A 4C7YA 2I38A 3DRRA 3NVZA 4EP4A 4NXZA 3OYCA 1IQTA 1YRUA 4FLYA 1XNRK 2JRZA 3BSOA 4G1IA 1ZQBA 4J90A 1UFLA 2YBVA 3R5JB 4BX9C 5ALVA 3C6HA 4YD1A 3GIJA 1VJQA 3UDEA 2Q0ZX 4A8WA 3PSFA 3QJPA 5B8HA 5KT3A 2ZKUA 4LRFA 2MAXA 1HJRA 1RILA 3ELHA 2IM1A 3F5TA 1WTFA 4BG8A 4QZ8A 4R79A 2AQ4A 4NOHA 1V97A 4DR2J 5AQTA 4CJ5A 1ZQIA 2QB0B 3ADAC 3NNAA 3HMJG 3RW6A 4N76A 3TYTA 4TLRA 3TA0A 5ALXA 2QYGA 2I2YA 4IEEA 1FWLA 2OSRA 3QZ7A 5DBBA 5LM7E 3RB4A 3DRXA 5AQRA 4PJ0U 1MWMA 2HHUA 2IGIA 5KFFA 3DGVA 2GIQA 3HP6A 4M95A 4A4JA 3AARA 2OH2A 1RT1B 2X6SA 2Y1IA 1ZQTA 5AM5A 3AO2A 1P9YA 1E3MA 1CJUA 1AUSL 1GLCG 4NXNK 1H3DA 4KHPJ 2R7SA 3AA2A 5DETA 5HR7A 1SUQB 3MD3A 5SWMA 2YKMB 3HD1A 2G9OA 4ZPAA 5CXTA 4IOCQ 3HSCA 1EP4B 4X65J 1BCOA 3NH1A 4FKYA 7ICMA 3ETOA 3RBZA 4US9A 1UKUA 3M30A 8ICPA 4ZCIA 4YS2A 1QQCA 4HACA 2BBEA 3SUOA 3Q22A 2Z1HA 3ZZOA 3JSMA 4AF1A 3HO1A 4O4GB 5KPTA 2IVMA 1YTUA 3BN7A 5ITHA 4IOCL 2N82B 1FFWB 4AHSA 2ASYA 1QQ6A 3THYA 1ZD4A 4I9QA 2E7XA 2W2OP 3CCES 1F44A 3CCRS 1QQOA 2V4QA 4X5VA 5ETMA 4DTMA 2OXOA 4I28A 2CQPA 4YUDA 1VQKN 4LF6K 3BDEA 1RWPB 1SXLA 3UQ2A 1R8CA 2ZM6K 4IFYB 3KLHB 3S3OA 2DFLA 1Q79A 4BC5A 3KLGB 4CZEA 1FO4A 3AA4A 4F4AA 1NGHA 8ICGA 3AVGA 1T05B 3O3GA 4QIWF 1ZAVA 2RQ4A 3J81j 1N8RT 3LALA 4FJ9A 5KT2A 1T9TA 2M5YA 3HHLA 4DN0A 1IBMJ 2MY7A 3HOSA 4HUEA 5AI9A 7ICRA 1IWAA 1H74A 5GAEU 1HLUA 3EXCX 5F41A 3ZO7A 3K89A 5GMKa 2VCPA 2OUGA 4NA3A 1NK4A 4NL9C 1GLJO 4PWDB 3H0MB 1XSLA 1KP6A 5D77A 2E8PA 1EKSA 2M52A 1NPKA 3KKAC 3QO9B 2QKBA 1S1XA 4CZIA 5C2FA 8ICBA 2CG8A 1NBEB 1HKGA 1GLFO 4FPBA 2JR5A 1O0PA 2XC9A 2PMZD 2ZNZA 3VZHA 3RJEA 3UKUA 5DDRC 1JI7A 3B4MA 1P27B 2LA4A 3F9MA 4QW9A 3ZSRA 3DEEA 3GTYX 1TE2A 4UB6U 3FZMA 4Y3CA 4CFCA 5HQMA 1Y5NB 2ISOA 2ZF5O 3M1VB 3CCVS 2GNKA 3SMZA 5JICA 1YJUA 4EBDA 3PHEA 2JEJA 1FTCA 4NMXA 4JV5K 5AXNA 1WHYA 1RTHA 1HBUA 4LF9F 4NRUA 3SYZA 2FHMA 2DFHA 3J80O 1RP5A 2P5GA 4FJLA 2W41A 1R8BA 4X4QA 3FFKB 2MHNA 3ETLA 3EGNA 4KHYA 4DR3J 2KRBA 4DX6A 2Z1IA 3TVKA 1JCEA 2W40A 2E2PA 1C0MA 4FVCA 4MIWA 2QFIA 3GIRA 5EGYA 3IGNA 4CEZA 1YJWN 3C46A 4CLLA 1C6VA 5D49A 1KLMB 1S48A 2EBEA 1ZBIA 1YX2A 2G1DA 3N7SC 1WOSA 4I6YA 2NXNA 5FPMA 2LLZA 3SQGB 2M8HA 3HPOA 2E6MA 2J9CA 3FE1A 4CIEA 2GV9A 3IBWA 3GE9A 3C65A 3WC0A 2VIXA 1LOUA 3ZSZA 3CULA 1W2BR 5K8OA 2WTUA 2HW3A 3TI0A 1WDTA 1BQMB 4DR2F 1IKYB 5L1MA 3OA9A 2CPRA 1NPRA 5KG7A 2EBGA 2RB7A 4Q2MA 5F8GA 4UY8T 3IUCA 1GLAG 2MY8A 3U9DA 5KTQA 4EIAA 3SR6A 2PMZC 3ILIA 1NJYA 1WG5A 2LA6A 4I7FA 4M41A 2FVRA 2OPPB 3D7SB 1K8KB 3CCWA 4NM1A 1X4FA 1R6YA 9ICOA 4NL5A 2QXFA 1H72C 1IIPA 1VHFA 2G2OA 4AHVA 4KHPF 3JPOA 2PE8A 1VQMS 3HTVA 2EDUA 3M5RA 3OGUA 5F8LA 5KFDA 4F3TA 3KNAA 2EZXA 5TISU 3QBXA 2YHXA 3QRQA 5BR8J 3SAFA 2R7WA 4X65F 2H54B 2JC1A 3Q8LA 1WUUA 2P6SA 2AZ1A 3QSYB 3OXFA 2BKOA 4BRLA 2GWKA 3MUMP 4K2XA 4ZVPB 1RZTA 3EGZA 3QRPA 1FVQA 2GVZA 1AZSB 2W9MA 5F3TA 2YKNB 3ZX0A 3P6YC 3CJTA 2KZ3A 3MM7A 2DFEA 3K0SA 9ICFA 4TKTA 1S1WA 2YWWA 4CTAA 3GCXP 4JRPA 1H73A 2CDRB 3FCVA 4DU7A 3SAHA 1RT3A 2WW8A 2D4WA 3VALA 3LWMA 2Z0GA 3GJTB 3LP2A 4NYZA 2QE5A 2UXCJ 3W9JA 2RQKA 2ZBQA 4I2DA 2F7TA 3V1QA 1ACMB 1GMUA 3A8EA 5J0SA 1FRMA 2ZBIA 3Q8UA 3O1BA 2F8SA 4FS2A 4KTWA 4AL6A 4MYTA 4J03A 1RTIA 4X4NA 3TW0A 2XG8A 2PGCA 1JN3A 1RDCA 2RP5A 1Q81O 2RAQA 4CK2A 2B51A 3W66A 2O5DA 4FWLA 1ZQAA 3KLEA 4K50A 3DRPA 2E5SA 5AQZA 2W11A 4BRIA 1VBZA 2G5IB 4XH4A 1HNZJ 3SUPA 4OYAA 4CRJA 3LPUA 3F5AA 1VC6A 4DR1J 1VQ9S 3RTVA 1TVAA 1UHUA 4ZVOB 3UVJB 2FDRA 3IHQB 2DITA 2E20A 1RAIB 5CA5A 2RLTA 2QL5B 4YR3A 1IV8A 1A77A 3N7RC 4AHTA 4MIAA 4EI2A 1HYSB 3UWTA 1G4CA 1UP1A 2X1BA 4FZMA 3H0PA 5LMUJ 3ALYA 3CC4N 1HWKA 2RH3A 4CZFA 3HZEA 3LH2S 4P2FA 3QMQA 1WWUA 2UUTA 3HM8A 3MHYA 2PN6A 3L2WA 4DV6K 1NOZA 2KJ9A 3HD2A 3T3FA 1PSDA 3AFGA 1IJFB 2ITGA 4ZMMA 2XLIA 1V85A 3H5XA 1WG1A 3SD7A 5KFYA 1NGAA 3POTB 5L1JA 5IXUA 3UE5A 5F8MA 7ICNA 2QB0A 3BF4A 4NLDA 3HL8A 2HWIA 4YOXA 4BE0A 2WSEC 2M70A 1ZJNA 4DR3F 2D3ZA 3AVKA 3CJAA 3NWGA 1K8AO 3SQ2A 3MDCA 4H4OB 4KO0B 3FEYB 3BKUA 2YWGA 1KQSR 3A8KA 3G86A 3HRGA 3B8HA 1XBWA 4MN4C 2YHWA 4BROA 2VG6B 1RHUB 2VQEJ 1RT1A 4A2AA 1KQFB 3K59A 1GAOA 1HI1A 5KT7A 4DKWA 3GIIA 3KDOA 6FDRA 4N8OA 1QCKA 2X3GA 2F8TA 3IP0A 5M1FA 2GOLA 4UY85 1M5VC 4O3NA 3M8WA 3F5EA 1SUQA 5CE3A 3VTIA 1Z26A 2YKMA 5CYMB 2ZXHA 5FRMA 1WKLA 4JK1A 4ED1A 2B9EA 2R2SA 3CFOA 1EP4A 4QYZK 4K43A 3ZSQA 2AF6A 5HHIA 3BPDA 1NPPA 3IXQA 4QR1A 3TTDA 1L6NA 3A3NB 5HLFB 1ZZNA 4A46A 4O4GA 2BHNA 5G5GA 1UETA 3GJQB 3I4PA 3KD1E 2Z2ZA 4IH5A 4I2AA 1NKEA 2HOEA 3GSIA 2C2KB 2NNWA 2NO4A 4CVNE 1BMQB 2BRLA 2GELA 4YOUA 1WEYA 3VQ7A 1B0PA 2Z2YB 2FJAB 2HBRB 3QMLA 4BG9A 4HI2A 2D6FC 1T3VA 4JI1F 1N5TA 4QWDA 1NOYA 1Y64A 4IFYA 3KLHA 3CCMS 2ZH1A 3N4MB 4ID8A 3KLGA 1JXVA 4FJHA 2XZWA 5KG0A 2LYAA 5ALKA 3LZIA 4CHZA 3O1WA 5JLHA 1T05A 5BR8F 2CRLA 1YTYA 4LFCK 2EFNA 1GXUA 4JB3A 4CLWA 1VQ8S 5AQGA 4RW8B 3B0XA 4W5QA 5EE1A 2J9EA 1SV0A 3L0QA 3ZSVA 3THVA 3D0PA 3BF1A 1YJTA 5EUHA 4WTOB 2RIJA 2IVYA 4PWDA 2NLXA 2Y1LB 3I8DA 3QICA 3ULHA 3QO9A 3JXUA 5HVGA 3CO0P 2YB1A 4UOCA 2QXLA 4L3NA 1CEZA 4USJC 3VC8A 1KLNA 1WBDA 2FJ6A 1A7GE 1Z4UA 2UXCF 3K8VA 9ICBA 3KMSA 3JQMA 4GKKK 1VQ6S 2YNHB 2JZBB 4DF8A 1HKCA 1HNVB 5ETRA 3M1VA 1YTAA 4Z4EA 2GO8A 1Z1VA 4PL7A 4EEYA 2XSJB 1N60A 2VBXA 4OPKA 2EFOA 3EKSA 1Q18A 2DGVA 2QSWA 3UKRB 3SCXA 1T3NA 3SMPA 3SSSA 5H9FJ 4BHQA 2VASA 5EVZA 4ECZA 3OJUA 3NF6A 3OYEA 3FBBA 1XWLA 3NKYA 3ENBA 4NYFA 3SIPB 4RPZA 5AKGA 5F9NA 1C2PA 1HNZF 3HSTB 5B66U 3QNNA 3G82B 4ZPBA 4CJ7A 1SQGA 4DR1F 5IC4B 2CG4A 3RRGA 2HGNA 4I0WA 1HJOA 4K4VA 3OL6A 4B9TA 3TABA 4HHTA 3H08A 4FPRA 2RD5C 2E2QA 3C5GA 3MOJB 4DSIA 1XTZA 1BWVA 2OCEA 1VSMA 4ILJA 4USHA 2D0BA 1KLMA 2HHXA 3BV8A 5LMUF 2OA8A 3VGUA 1TL7B 3H2UB 2KICA 4EZ6A 2HQCA 1REVB 3PW7A 1QAXA 3SQGA 3E9OA 5C2DA 3SXLA 1RBAA 4LREA 3NF9A 4FBUA 1E4FT 1T02A 4ZP7A 1L3TA 2YB4A 5IQ6A 5ALSA 4OYZA 4XQ8A 8ICMA 5ETVA 1SWVA 1WHWA 4JI4J 1X2IA 2DHHA 1BQMA 1P8ZA 3H2VE 1IKYA 2XHBA 1T7PA 4YB7A 1XEZA 2RDIA 1QM9A 1OY8A 1GK8A 4P72A 4RWTA 4W5TA 3F2BA 3AA9A 4I2EA 1DGKN 4LFBK 2CGJA 2VC0A 4DV0K 1ZBTA 1Y4ZB 3CCQN 1BNOA 4KBOA 3PCOB 1UOCA 2VIHA 2KJ8A 1N88A 1BPZA 2VQEF 2WF5A 2OPPA 4UAYA 1K8KA 3EXYA 3M6UA 2I6XA 5LSLA 3HHNB 2VJVA 1Q86T 2QA4G 1S59A 5C42B 4RQ7A 4NM2A 4QS8A 2BUPA 2HFOA 4B3TJ 4DB3A 3RZAA 4U7BA 2PYLA 4WQ5C 5AQIA 5HP4A 5FPEA 2R2TA 1QAYA 3HVRA 1IG8A 3O4WA 4PGYA 3NP5A 1FJGK 4LVOP 1O03A 2MMYA 2AGPA 3C0BA 2KKZA 2JC0A 4KHRA 3GWCA 4IH7A 4E7IA 2KL8A 4MK7A 2K60A 4UAZA 1AZSA 2YKNA 1VQON 1UW4A 4KYZA 1OQ3A 3QIPB 5KFUA 3T41A 5KOWA 2E1EA 2Y8YA 4FWKA 4NYPA 3JPQA 4J9PA 3VEOA 4UT4A 4BXOB 4LF5K 3IV6A 2Z56B 3H42A 3GV5B 2KSOB 4DUYJ 4X64J 4EGLA 2WAQF 2VA8A 3U02A 1IUJA 4E1NA 2J6SA 4PABA 4CJRA 1ATNA 2UVRA 2R7XA 5AQLA 2H3VA 2XMVA 2H3QA 4Q44A 1MA9B 1FX2A 1VMBA 3KIOA 4RW9B 1RK8A 2P9PB 3IN5A 5CZXA 4OJ1A 2OKQA 4I4BA 2ZOGA 5LXRA 4JYAK 2QW9A 1HPMA 1HWUA 4CBWA 2R42A 2N3LA 3GOIA 4KLOA 3AJDA 4E0DA 4WZQA 3AD9C 2DNRA 3EPIA 3UXNA 5DB8A 1OO0B 1JK9B 3UVJA 3G6VA 4RQ5A 3WQTA 3VQQA 3NCQA 4JK9A 2UUBK 3WIVA 1HYSA 3EZOA 3PX0A 3G0ZA 2XMUA 2P9UB 2QI2A 2AIRB 4Y2TA 1NK7A 4IQTA 4CEBA 2HRUA 4HWIA 5GAGI 3D2NA 1N2XA 3OTBA 1LVHA 2RHFA 4IRKA 2EC0A 5AK6A 1JMTA 1NAQA 1KFTA 1QUVA 2BZFA 3GIMA 3MN6A 4M04A 2LQ9A 4OYBA 4FCYA 5KFLA 3L2RA 2HBKA 2LEPA 5EOZA 4M5MA 3POTA 1OPIA 3NBPB 3ZTSA 5D78A 1DY3A 4JN4A 1UWAA 2FXUA 4YR0A 2JHEA 4LFAJ 2LSNA 2M88A 3M3ZA 3ILJA 7FDRA 4DR6J 4H4OA 4KO0A 3UD3P 3KWIA 3GYNA 3WK8A 4NA2A 1O5JA 3J80Y 2VG6A 1ZQOA 1QSLA 2L48A 3D6TB 4CFDA 4EBCA 1S10A 1A5XA 1IKXB 7ICOA 2WVEA 4UOGA 3RMDA 1GNKA 1CBKA 4CBUA 4CJUA 5C12A 3CCTA 3NNCA 3UM9A 1T9VA 4ES2A 2CRXA 3BP8A 2J7WA 2PMWA 3PM9A 3KWGA 1GXLA 5CYMA 2CJQA 3X1LB 4EHUA 5SUHA 2VANA 5CYJA 4A59A 4JI4F 3MDQA 3QEPA 2WF9A 5AI6A 3KZIU 3SBGA 5J0UA 4PAAA 2ADBA 1HR0J 3H1QA 2QT7A 4GY2B 5HJYA 4A8MP 5HLFA 4MIBA 2DXDA 3M8PB 3V6DB 2YX6A 1IKWB 3HSGA 4BGAA 3H5SA 5EY4A 1JKHB 3SCJE 4BRCA 1N61A 1SH2A 3VZIA 4RWWA 3GIKA 3CERA 4KR0B 3T1HJ 3Q8PB 1CVJA 4IJNA 3V9ZA 3H98A 4BC2A 1KQQA 2XWXA 1KVBA 3THPA 1GTEA 2MJNA 1SGGA 1NI3A 5AQKA 1FKAF 4C23A 4C8ZA 4B3TF 2QRRA 4I6WA 3QERA 1IBCB 5DM6Q 4OJ3A 4FF4A 1ITPA 1H2UX 3KOOA 5GMDA 1YXQA 3K9JA 2GUIA 4OCZA 4JWNA 4Q8EA 2DR7A 4NLTA 4IFEA 2J5AA 1NGDA 3T1YJ 2YWHA 1T4GA 3UPQA 2MZSA 5DM6L 4RW8A 1QAJA 3FFIB 4BRKA 1PO6A 1SKSA 5L46A 2L08A 5D4LA 3MPUB 2IS3A 4NZ0A 1ZM2A 2MZJA 3KMQA 4UAWA 4C6AA 1FK9B 5KFSA 1M90T 3IG5A 3WKDA 3A8IA 3QU2A 4OI6A 1S3XA 4IEIA 1U6ZA 2A18A 4H4MB 5AE3A 4JI7K 1UEKA 1RYUA 3A3PB 3M2UB 2G08A 1OSDA 2YNHA 1A9NB 2JZBA 4DUYF 4X64F 3PIPQ 2V2KA 5J29A 4IH6A 2YY6A 3E9LA 3L4IA 5HVFA 4M9NA 4NLPA 1HNVA 1N32K 3H5UA 5AKIA 2CKWA 2V8GA 3OFGA 2XSJA 3NGDA 1FEHA 3DLKB 3UKRA 2BOAA 3PIPL 5AKLA 1X4CA 2OMLA 4OJRA 4UTGA 3R8YA 1L7MA 3CCUS 1VQPN 1IN0A 2HS0A 4PZVA 4FJ7A 2QKKA 3JQJA 1MLAA 1D9AA 3G82A 3ZDDA 1ZRNA 1WCLA 3CFPA 3ID6A 3AEVA 2O4GA 4DS4A 5AXLA 5M2PA 1QS4A 3M6KA 5E3PA 1HBNB 2IDEA 5H9EJ 4QS9A 1PJ7A 4B3SJ 4ED3A 1I94J 2LKZA 2MLXA 1QJHA 1KD1T 3W63A 2POKA 2RF2B 2PFUA 1D8ZA 3MF5A 1EJ7L 2FPKA 4H8KA 4J2BA 2R4FA 4FK4A 4JI6J 2CPHA 4UATA 1TL7A 2GFFA 1HIWA 2ASLA 1REVA 5AQFA 3ZC4A 1XMQJ 4E1JA 4I64A 1XR6A 2XY7A 4HH0A 3AQFA 5CABA 2HFZA 4CT9A 1NK5A 3VQDA 4OJ5A 1GMWD 3AY9A 1G1XA 2IRYA 4DV1K 1OY6A 2CJKA 5A8RB 3V5RA 3DGPB 4GIBA 1VRTB 3CCLS 2Q0RA 4DL3A 1H6KX 4DL0C 3I87A 3MDAA 1XNRJ 3OVBA 4E7KA 4J91A 4LFAF 3QQCD 2ZWPA 4I2HA 3CD7A 3RUBL 5JVGL 4DR6F 1UQVA 1SAZA 5B0EA 2Y3YA 2HNZB 4PG8A 5LXYA 1VSLA 2Z8QA 4TUPA 1D8BA 2JEFA 1HLWA 5J1PA 2D3O1 3JS6A 3AD7C 2FVSA 1Y5LB 1HL6A 4FLWA 2QMUB 2ZJ8A 3VA3A 5J2NB 5C42A 4AHCA 4LSZB 5BPNA 1JJHA 2QGFB 1H7WA 2GJIA 4ZA1A 1CJVB 4ZP9A 1SQFA 4I2JA 4OVLA 2IA6A 2G8WA 2HNDB 1P1LA 3PJWA 4FYWB 4K4UA 2YWEA 4E1MA 8ICOA 2AYMA 5A8KB 2UU9K 3V1OA 5FIIA 3CIMA 1PYTA 4WYLA 1HR0F 4XDDA 2K2PA 4UZBA 1RNHA 2RILA 3V7JA 4NXNJ 3HKZF 3LPYA 4A5AA 4HHJA 2PIIA 5EN1A 3C7NB 3QESA 3DWLA 3FVYA 1QVFR 3JTPA 3QIPA 3TUPA 4FWQA 2RSQA 4K4IA 2KJWA 3CQXA 1IM6A 3B82A 2XGPA 2CPXA 4ZH4A 4BXOA 1LWFB 3F2CA 2APOA 1PG5B 2KSOA 2MPUA 4JBCA 3TEGA 4UB2A 5KGWA 2VKQA 2EG1A 3IR6B 3S9HA 2HBZB 1YRTA 3ZT2A 2GHWA 4E89A 2R7VA 4J2EA 2K4IA 2W1BA 2BANB 5AFUA 4ZTFA 1B9FA 2KVSA 9ICIA 2J0QD 5M1NA 3KD5E 4OJLA 4CGZA 3MI7X 4RW9A 5GADU 2KW4A 2P9PA 3TAMB 3ONNA 3C2MA 4LF6J 3KOAA 4F0KA 2JRSA 2D3DA 2ZM6J 1QTNB 4ECYA 3FQLA 3CRXA 4CLZA 4RG8A 5IWAK 1V38A 4KI6A 2FUG9 3LM2A 3SNNA 8ICCA 3GZFA 1XSPA 5BJRA 3TP2A 3GJRB 2OHDA 5J0XA 2G0CA 2M4MA 4PL2A 2AW0A 4U67Q 1TK0A 2QFJA 3OYJA 5LL6d 3SUNA 3RBXA 4GMKA 2KM8C 4NXMJ 1RQNA 2KU7A 1X0FA 1EXNA 2D0AA 1UJ4A 1APSA 4IDHA 5AZIB 5GMEA 2CN1A 4QZVB 3I55N 1RWUA 4M5IA 2KT5A 2P9UA 5CA7A 3DYAB 4U67L 1L3KA 3E3XA 1LW2B 3VENA 2EPIA 1YIJN 2V0NA 2G8IA 1BU6O 2FLPA 5H1SQ 3SEIA 3T79A 2BPFA 5KAFU 3VGLA 5J2BA 3VESA 4B3OB 4B9SA 1MN8A 1PGZA 2XY5A 3AVIA 4YB1P 2QA4N 1ULRA 3NBPA 4FLXA 3RB3A 7ICPA 2FLLA 5I4MA 5EDWA 1S5LU 5E33A 4ECVA 3MFIA 2FQQB 4GFJA 1I94F 2HK3A 3QYYA 3ULDA 4JV5J 2NRWA 2G07A 3PNCA 4QJFB 1ZQKA 1P1TA 2OYYA 1ZAXA 3ILOA 2ISPA 4GC7A 3QT6A 1WG4A 1IKXA 2NRXA 1Z19A 2CNNB 3BQ1A 1YVFA 4M5GA 4C0HA 1COOA 3MCSA 4JI6F 1QQ5A 2C2EA 1PUZA 3Q7BA 2B4VA 2BE7D 1RHMB 4TY8B 3C95A 1HI8A 4E7HA 2GJ2A 4M5HA 2DFFA 1TKXB 1AYEA 3U1LA 1DK2A 5B09A 4HTJA 4UW9A 4KBIA 1S9FA 4OJHA 4FWNA 3HBTA 1KWMA 3C16B 1S4EA 3ONQA 3VPZA 6AT1B 2PYJA 5A6PA 2H65B 1S6OA 1QQNA 5GAHP 4RT2A 2BEFA 1XNRF 4DL4A 1I3OB 1U6FA 1WSHA 4GLXA 3M8PA 1ZBFA 3V6DA 1IKWA 3H8YA 1UW9A 2IVNA 4M9HA 2K8BB 1JKHA 4ED7A 7ICIA 3UDCA 1HWJA 4DFKA 1OMSA 4USUA 1NNDA 1O8BA 3MCNA 3TUZC 2JJ4D 3L2QA 2BR0A 4WQ4A 3WNFA 3FJ2A 5J2PB 2KIVA 4M5LA 5AJ3J 3OUYB 4UW2A 4WP3A 2CQ3A 4KLSA 1RGVA 3RW7A 4W98A 4O3SA 3HSJA 4MK9A 1UZHA 4K8ZA 4U96A 4OV1A 3E51A 1HQEB 3E1YA 1B7FA 5GTIU 4KLIA 3CMQA 4FW1A 3O3HA 5D0GA 1NKCA 5AT1B 1ZRMA 2ZWHA 3V7KA 5BRFA 3PR5B 1JL1A 3IM9A 3R3TA 3C66A 4QR0A 2JXJA 1T03B 2ASJA 4ZCKA 4DTNA 2P51A 2DY1A 4AT1B 2RQCA 4QW8A 8ICTA 1J9AA 2PY5A 3DHXA 4RQ3A 3FFIA 1SPBP 3SI6A 4A57A 4H5VA 4NXNF 1TKTB 3P3DA 2AKWB 1L7OA 4WKRA 2E5LF 4P4OA 2WFAA 2M2BA 3CMAN 1GTHA 5K5MA 4FJMA 3FR0A 1FK9A 4KREA 1SVDA 2V4RA 5EU7A 4N77A 4Y1CA 3A5LC 5JU5A 3OV7A 3MGIA 4ANEA 1S79A 4H4MA 5B7WA 1JRPA 4JD2B 3M2UA 1IVZA 2CPFA 3SUQA 3LTOA 1ZQMA 4EX7A 1SJ3P 3O4NA 2NYVA 1H2VZ 2BXJA 3CD6N 1BE4A 4BR9A 1IG9A 1NU4A 3PYEA 2PMHA 5D3GB 2JX2A 4L3QA 4HEA9 5ALYA 4B9VA 3DLKA 4LF9K 3CCSS 2GS8A 2DR8A 5HRRA 2J9DA 2ZM6F 3K57A 1SJ4P 3WT0A 2CFXA 2KVCA 1ZAWA 5I3QA 1Q0NA 1N36J 1UWBB 3OY9A 3UN5A 1W2BM 1RBVA 4UF4A 3KXDA 2Y1JA 2DGWA 2LXUA 1VSEA 1S7IA 2YHAA 1HBNA 2OGUA 3CPWR 5F0XA 4NXMF 2IM3A 1FXLA 2HFUA 2VWKA 3TWHA 2RF2A 5KFNA 2CQDA 1N5XA 5KFVA 5AQVA 2EFPA 4CCHA 2Q3PA 2EW9A 2CQCA 3I0RB 2KIWA 4K4XA 3SV4A 4P4PA 4A8FA 3OYGA 3P8BB 3SSQA 5DDOC 2JMGA 3ISBA 2ZJRQ 3ILLA 1WF1A 5A8RA 5FPDA 1KKXA 1UTAA 3P45B 3FC4A 1R31A 2VFRA 3DGPA 4OV6A 1URJA 3D1QA 1VQPS 3GE1A 2XMAA 1VRTA 3F41A 3C23A 3AO4A 3WXLA 2BE2B 4OLAA 3GG0A 1QUPA 1DGSA 2VBWA 4BC4A 2ZJRL 1R6VA 3F56A 4ZLNA 3AU6A 4PKHA 1CRXA 1QDUB 2HNZA 2KO1A 4QR2A 4DV6J 4JV5F 5CHCB 2OLWA 4UBBA 5EX5A 4AH9A 3NASA 3EY1A 3IBCB 1DZ5A 4DPOA 2ALYB 3W3DA 1NZBA 2W24A 5J2NA 2BW7A 1VQLN 1FIQA 3V4MA 4E2FB 4AE5A 4C8MA 1EWQA 1CJVA 1WC3A 2HNDA 4X65K 2C2MB 1P7DA 1WI6A 5B0FA 3CQYA 3ZYYX 1S8OA 2I9GA 3U27A 4N41A 2ZJ5A 5A8KA 4C8OA 2JV3A 2BJ1A 1X5OA 2I5HA 2LU2A 2O8DB 2MJUA 2OYQA 9ICVA 2GX9A 4FO6A 2CPJA 2CXYA 2G1HA 4LZDA 4OIXA 1Q8LA 1JXEA 1BG3A 1P90A 2D1CA 2Y0SF 2HF3A 1FEZA 3TACB 2UXBK 4JI0F 5L39A 1JLQB 3J81O 2I5JB 3ZSWA 3C7NA 2H3IA 1OWXA 2Y9HA 2SXLA 3U8XA 3ZZ0A 3VQTA 2CZVC 3UDVA 5A76A 1VQ5S 2AA4A 5AJ3F 1GX6A 1NDKA 2RE1A 5B0AA 4LUBA 3IMQJ 1ZBHA 4QYZJ 4IG0B 2YHYA 3J7ZT 2IIRA 1WKJA 2YX4A 3LGNA 5KFXA 3OS0A 2KG0A 1RQLA 3F73A 1LWFA 1VIXA 1FFUA 4IOBA 2OIHA 2HWHA 4ID5B 2ACYA 4GVBB 2H5IB 3C6UB 1X31C 2BANA 1F2GA 4BR7A 3X3UA 2GWSA 3MMJA 3B6BA 2NLWA 3WX8A 5CQGA 4DXLA 2HOFA 3N6LA 2NSBA 3TAMA 2PO4A 1F9FA 2BM1A 4ECTA 2HBQB 2K3IA 1C4AA 5E41A 4QCLA 2F40A 2EQYA 5HP1A 2XEXA 1BWEA 5F2RA 2HNYA 4FM1A 4QZEA 4JKFA 2RDDA 4LFCJ 1S22A 2O8FB 3NNHA 1LW0B 4FP9A 5EXWA 1LFPA 4HLBA 4P52A 1KCFA 2ZH9A 3T5HA 5AZIA 3MR7A 5EE9A 4F4WA 4Y1DA 5E3AA 2NYIA 1KQSM 3AVHA 4GKJK 1WWVA 4FE3A 3DYAA 2JWNA 3K17A 4HT7A 2RU3A 3I96A 1LW2A 3UR0A 5BRHA 3E01B 3M8ZA 4LD0A 3KHHA 2DNMA 4FYYB 4MEXA 1LFWA 3F44A 1K1QA 4W4MA 4A2BA 4C4SA 3IAS9 3CC7N 1EQMA 4W90B 2UUCK 4Y2YA 3CJBA 3V81B 4B1ZA 2ZBPA 4B3OA 2E1AA 4WK1A 5DQHA 2QLXA 2RHKA 2MSSA 4GKKJ 1N36F 2BDPA 1Z1ZA 2JOQA 2NPIA 2WF6A 1QQMA 4ZJQA 2COLA 1RT7B 5DBCA 4XTTA 3ASMA 3K2PA 1OW5A 5J2FA 3PEJA 2YMPA 4CEDA 2CUYA 4WIQA 5ALNA 5AQHA 3CE8A 1GMVA 3SQ0A 2ASDA 3ISND 3QWUA 1NNEA 3R9PA 2IMOA 3M6XA 2GWJA 1CZ9A 3THXB 2A42A 2NRTA 1GQEA 4TY8A 2VL1A 4OYXA 1V3SA 3HWTA 3MD1A 2W7OA 1TKXA 2AJ2A 4F4KA 1HW8A 2JNJA 2EKNA 5K9FA 1J5OB 4BR5A 2A6AA 1KR4A 2LU1A 1ZM4A 3R3LA 3C16A 1LOTB 4LT6A 4YNQA 4JV2A 1QVGR 1XJWB 1TUVA 1UZDA 2W2MP 2FLOA 4YDDB 3V6HA 5HOOA 2FMQA 3WK5A 2QA4S 4CO1A 3ULEB 2Z1JA 4PXCA 3BSNA 5CZ2A 1BUXA 4LIWA 1RLDA 3M6WA 2F44A 3RF9A 3I28A 4HTLA 2YWFA 3VWSA 3R5CA