4B9MA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-da dna lesion -thymine basepair in the post- insertion site.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9mA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9mA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9mA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9mA01
1BHLA 9ICWA 3HP6A 4EBEA 4M9HA 1TVAA 3K59A 1D9FA 2V4QA 2JEIA 5KG3A 4KHWA 2BPCA 1UOCA 3QEPA 3FYHA 4QZBA 4LVSA 4ED7A 4DQPA 3OS1A 4F2RA 4UBCA 1U47A 4RW6A 2NRWA 4TURA 4ECRA 2FLNA 4K4GA 1QSLA 5KT7A 3AU2A 1ZQNA 3ZSZA 1TL1A 1BI4B 4B8AB 4RUAA 1K1SA 1ZQCA 4X5VA 4YR2A 3KD5E 3MXMA 1JLFA 4C8NA 4QZ9A 8ICQA 4CJSA 3PX6A 2XC9A 5D3GA 4YG2A 4DL6A 4G3IA 3ORYA 2KZ3A 4I2IA 4F2SA 4DTOA 5HHHA 1KCFA 4YP3A 3VA0A 4RNMA 3LANA 3V1OA 2OA8A 1L3SA 3HX0A 3I0SA 3ZDAA 1QSYA 1BPXA 4PA1A 4CJFA 3QE9Y 4CHOA 5L9XA 2R8KA 3RH5A 1SV5A 5KG7A 1ZQXA 3L3VA 1C0UA 1Z3EB 5KFTA 4CEFA 1VSLA 4NLNA 1WSIA 1IKXA 3HXMA 4Z4EA 3I8DA 2RDIA 1W9HA 3F9KA 4W5RA 4NM1A 1RBVA 2BR0A 1S5JA 4B9SA 3HM9A 4FLVA 3DLKA 1A5VA 3AVBA 5J2HA 3MEEA 5C24A 8ICXA 7ICQA 3AVAA 7ICSA 3TANA 3NGZA 2W9CA 1H38A 1HYSA 3IHQB 3QZ8A 9ICTA 1HNVA 4KO0A 2YNHA 4I2GA 2Y1JA 3EZ5A 2VWKA 7ICJA 3NGDA 1JX4A 3TWHA 3O3FA 1B43A 1YVUA 1WLJA 5J0XA 1BISA 2BCUA 4MEYA 8ICLA 3ZCMA 4IR9A 2UVWA 3C6TA 4FS2A 4BWMA 4PY5A 3GFKB 3IS9A 4FJ9A 3SCXA 4B9NA 1JLAA 4CFDA 3MR3A 1S1WA 7ICLA 3BQ1A 4CJLA 3QZ7A 4BXOB 2A1JB 1VRUA 4F4KA 3GQCA 3LDSA 4K8ZA 4DLEA 4FJIA 3OSPA 1RPLA 1MU2A 5IIJA 5KTQA 3CYMA 2ZE2A 2EHGA 3LAMA 1JLCA 4FM2A 4PQUA 2PI4A 3V9ZA 1YT3A 4O5KA 1NK7A 5T7BA 2IA6A 2HNDA 4QZCA 4DLGA 2EX3A 3OJUA 2JEGA 4CIEA 3ZT4A 3MFHA 4FK4A 3RJEA 1N5YA 2ISPA 5F9NA 5FRNA 4JV1A 5IIIA 4BACA 1KVCA 1NK8A 7ICVA 1XC9A 4CGDA 1SL0A 3LDAA 4F5OA 1HQUA 9ICRA 3AUOA 3RMCA 4I2JA 2JEJA 3LP2A 3ZT1A 2W8LA 3RR7A 1HYZA 4J2EA 3M8PA 1ASUA 4UB5A 5BOLA 3MR5A 2B4JA 2IS3A 4M3RA 4CJ5A 4DG1A 2Z1GA 4I2BA 2W9BA 4UBBA 1CLQA 8ICAA 4CGFA 4JRPA 3IRXA 2ASLA 2BDPA 1S0VA 4NM2A 4LH5A 3OYKA 3UQ0A 3V9SA 3EPGA 1XSNA 1ZQBA 1PZNA 4O3RA 9ICHA 3G6YA 1FKOA 1RTJA 1BPEA 2AJQA 1RXVA 4PHEA 4GXKA 4JLHA 1ZQYA 2FMSA 4DSFA 1TKTA 1JLQA 5DB6A 4OPJA 1HYVA 4C8OA 4CEBA 3KHRA 4CJQA 4ECXA 3T5HA 3RRHA 4F93B 3T5LA 4YMOA 4ECWA 3LPTA 3MEDA 1UAXA 2H5XA 1ZQIA 4QZEA 4CJWA 4DFPA 4FJ7A 4XRHA 5J0YA 1RDDA 1J54A 2YV0X 3H08A 2P51A 1R0AA 4M9LA 5KFMA 5CY4A 2BPFA 3WNGA 1TFRA 4KFBA 2Z1HA 5K14A 3RH6A 4ZH4A 4CF0A 1RT5A 3OYCA 3Q8KA 1S77D 1JN3A 2DTUA 4IKFA 4I9LA 1B9DA 1IKVA 3VQ5A 4W5NA 5J0TA 3G6XA 4CGHA 1RT2A 4DL3A 1ZQMA 4BDPA 1RDCA 2MUTA 4G1QA 4HUGA 1K1QA 5KFFA 9ICCA 7ICPA 4CHQA 4GMJB 4PWDA 3C1YA 4CEAA 4DTXA 3UXPA 5CHGA 3G10A 3JPPA 1RYRA 4F5QA 1T03A 3V6JA 4RPXA 4DS5A 4TQSA 3U3YA 3CFRA 5KT4A 4DS4A 5KFYA 2VA3A 3PY8A 1Z00A 4Q44A 4QZFA 4DWIA 5DGBA 2HHUA 4TSXA 4CHZA 4MFFA 4M45A 4HYKA 2JLEA 1ZQAA 3M9MB 4CEOA 4C8MA 5J2KA 2BPGA 3L2VA 3MXIA 1UT8A 2KFNA 4Z4HA 4CIGA 1S9EA 2AQ0A 3PMLA 4AHUA 4M3XA 5D46A 4LSNA 3S3MA 3EW9A 3RH4A 2PXIA 4YFKA 2G8UA 3C94A 2XO7A 2C22A 3SUQA 2R8GA 1JLGA 4DTJA 3L3UA 5IIKA 2P1JA 4F5RA 4J2DA 2IGIA 4ELVA 1KFSA 4DF4A 2ZJ5A 3JPQA 9ICOA 5HHIA 2OPRA 3LAKA 3DM2A 4BDYA 1RBRA 4PUOA 3N97B 8ICJA 3NF9A 4ICLA 4IFVA 2BE2A 4CE9A 5DBAA 4IRCA 4CEEA 3SUOA 3GIIA 2E6LA 4O3OA 8ICBA 1RT1A 4CF9A 4H4OA 2C2EA 1RDBA 1X9SA 4GW6A 3RB0A 1S9GA 4NYFA 3SUPA 1KLNA 4Q8FA 5CJ7A 1KEJA 4DO9A 3D0PA 3M8QA 3QEWA 4ED3A 3VQ8A 4Z6CA 4GVMA 2ZTCA 2AGQA 4FW2A 4XQ8A 4IQWA 3F73A 1SUQA 5EOZA 4IQVA 3BJYA 1XHXA 1WAFA 4YR3A 2HB5A 3V6DA 2J6UA 4YN4A 3LPUA 7ICUA 2ITGA 3NGYA 1REVA 3UPQA 1I39A 5DKWA 1RBUA 3H40A 3ZDDA 4NCGA 4XUSA 3T1AA 3THVA 5KFDA 3JPTA 7ICIA 4KI6A 2KTQA 3PR5B 4RQ8A 4EP4A 3PW2A 3P83D 3TR8A 4M47A 4YMNA 4E7HA 4UAWA 2IMWP 5DK5A 2HHWA 2OPSA 2UVVA 1SL1A 4W5QA 3NH1A 9ICFA 3GIMA 4OPKA 2Y1IA 4AHVA 5J0QA 2ZJ8A 5BPCA 4FK2A 3ZSQA 3NTUA 3VN5A 2ZQBA 4NY8A 5I42A 3ZDCA 4IRDA 3ULDA 8ICIA 4ECZA 3T19A 4CHNA 4UAYA 4DQQA 2VA2A 4FLUA 4KRFA 4KB0A 1RBTA 1ZQKA 4KLQA 3LWLA 3TFRA 1HJRA 4F5PA 4HCBA 5C25A 4JS5A 5KG1A 1MQ3A 3V1QA 4OGEA 3AA5X 3RJJA 1VSFA 3VA3A 4CHYA 1DGSA 4H8KA 4CGIA 1X9MA 3TAGA 5DG8A 1IM4A 3KLFA 4E1MA 4AH9A 1WNSA 3AVMA 1TGOA 3SZ2A 3B6OA 4QZDA 3V7JA 3ITHA 4DEZA 4KLHA 1TV9A 2KZZA 2E6MA 4FYDA 4CFAA 1TK5A 3NE6A 2QK9A 1ZQEA 1ZQRA 2BCRA 3B0YA 4K4HA 3QO9A 5DDMA 4QW8A 2W42A 3Q8MA 2BCSA 4CFCA 3V7LA 1LV5A 4FJMA 1ZQQA 1U48A 3VQAA 2IDOA 1Q9YA 5HBMA 5CYQA 4TUQA 1A5WA 3FDSA 3TAMA 4F4ZA 1VSHA 1D8LA 9ICKA 4CFBA 4FJLA 2XY8A 2P6RA 8ICPA 3BGRA 5J2EA 3JPSA 1KRPA 2ZUBA 4M9GA 5HRPA 1ZBHA 2P5GA 4I28A 4DTRA 2OZSA 1S0MA 1ZQGA 3RB6A 4F4YA 1EX4A 3NDKA 2XY5A 4J9LA 4QWEA 3OYBA 1EKEA 4DTPA 3AVJA 4CK2A 1S6QA 1QE1A 1EXNA 1W0HA 3PO4A 4I2DA 1ZQSA 2RPIA 4UB4A 1NJZA 1IH7A 4Q43A 5HRSA 5DG7A 1D8YA 4OKKA 3AO3A 3MGIA 4ECVA 4IDKA 1MQ2A 3MABA 3OHBA 3L2RA 3UXNA 2FBVA 3LWMA 1VSIA 3M9NB 1LWCA 3ZSYA 4ZTJA 3WNHA 2AGPA 4QW9A 3FFIA 4BE0A 4KHYA 5DB9A 4ED2A 3DMJA 1S1TA 5J0WA 9ICSA 1NK4A 4OGCA 1T4GA 3SI6A 2G8VA 2AGOA 4CK1A 5EWGA 2AQ4A 3V4IA 1A77A 3QETA 1Y88A 1SKWA 5J1EA 2RF2A 5HP1A 3Q8PB 3O3HA 3K5MA 7ICMA 2X6NA 8ICCA 4DU3A 4MFBA 3NH0A 8ICHA 5HNKA 5IILA 5EWFA 4DU4A 1C0MA 4RU9A 1JIHA 4RW9A 5DBBA 3B0XA 3GV7B 3PMNA 4DOCA 3MECA 3RJFA 5J2DA 2FBXA 3KKRA 2FBYA 1AROP 3HWTA 3KKSA 4ELTA 1F21A 2ZTEA 2D5RA 2KW4A 4DSLA 3SQ1A 4O4GA 2YNFA 4KLSA 5CYMA 2HHVA 3VQQA 3QNOA 4F50A 1NJYA 3CFPA 3V6HA 4P4OA 4F92B 2OPPA 2PY5A 3KIOA 2DFEA 4KHQA 1ZQDA 4GXIA 5KG6A 4Q8EA 4B9MA 9ICVA 2O4GA 1NK0A 1ASVA 5CA7A 4DTSA 3HK2A 3KTQA 3DLHA 4ECQA 2YKMA 1TKXA 3CM6A 3JYTA 2DFFA 4MFAA 1U49A 3TAFA 1BCOA 1RTHA 4CJEA 1IG9A 4LZGA 1X9WA 5KFLA 1TKDA 4O3PA 2DFLA 3QEVA 1RT3A 3AVHA 4M41A 3UQ2A 1Z00B 2BGWA 3TABA 5FDLA 1LAVA 2JZBA 3Q8LA 3OY9A 4LD0A 3U6FA 3C95A 4IBNA 3DOLA 4IFYA 1DOQA 1BPZA 4MEXA 5KI6A 8ICKA 2NRVA 5KFXA 4J9KA 4E1NA 2KN7A 1T3NA 1UA1A 3NHGA 1ZQTA 3QEIA 2PFPA 4DU1A 2XY6A 5DQGA 1VRTA 1ZYQA 4RG8A 4UB3A 2F1IA 4J9NA 7ICRA 3TAEA 1B92A 1ZBLA 3V7KA 4RUCA 1A5XA 4W5OA 9ICEA 5L1IA 4RQ2A 3LZIA 4KKOA 4I29A 1LW2A 3ASMA 3OYHA 3IAYA 4J9OA 3HSTB 3H8JA 3NBPA 2W9AA 1HUZA 5KFZA 5DDYA 4DFMA 1TVRA 4F3TA 4H4MA 4ECSA 2UVUA 2ISOA 2B21A 3H8WA 1S0NA 5KG0A 1ZBFA 4JUZA 4QWBA 5EWEA 3CFOA 2RDJA 5CZ2A 1ZQPA 4Z6EA 4MFCA 3VQ9A 4UB2A 5DB8A 3L8BA 1TK0A 4Z4CA 5KT2A 3DLRA 7ICEA 1C1CA 5KG2A 2F1JA 1TKZA 3T5JA 2PFQA 1VSJA 2YHAA 1HQEA 4RW4A 5J2AA 4NYNA 4CEZA 4O0IA 4CJVA 3S9HA 3GV5B 2KFZA 4QZGA 1TK8A 2ZUCA 4J2BA 1JMSA 2FPMA 3BDPA 3K5NA 5KRTA 1ZQOA 4FXDA 2X6SA 2YHBA 5HRRA 1QS4A 2DY4A 4DOAA 3C6UA 3QESA 5J2IA 2F1HA 4CECA 1WCLA 7ICTA 4EYHB 3N4MB 1ZJMA 3M8RA 1TAUA 1JLEA 4JRQA 5J0PA 3SV4A 3L2UA 3QEAZ 4FBTA 5F9LA 4NXZA 1XS9D 2R8HA 2IOCA 3ETLA 1RT6A 2XGQA 4Q0BA 1N6QA 2C2RA 1VK0A 1KFTA 2ETJA 4HTUA 4CF1A 4O9MA 5KFWA 5FRMA 1CZBA 3UXOA 4CJTA 2XY7A 4DL5A 1B22A 9ICXA 4YR0A 3OYNA 4F4XA 5J2NA 3C5GA 4KTWA 2XCPA 3RMBA 4NLKA 1XU4A 1BQMA 4M3TA 4K8XA 4CIFA 2G8FA 4ZTFA 3KLEA 4PH5A 2WONA 1NOMA 3GIKA 3O4QA 3JPRA 5KGWA 4CHPA 4XIUA 4E3SA 1JL1A 1HNIA 3PVXA 4LSLA 4YFUA 4DSKA 2AU0A 1JKHA 1WSFA 3K5OA 3C2MA 1RZTA 4QAGA 3ZDBA 4O3NA 4R8UB 5EU7A 4HVJA 5J0UA 5CZ1A 4FJHA 2IHMA 3HPOA 4DQSA 1LWFA 4IG3A 3SI8A 1RTIA 4BE2A 1ZQFA 3QIPA 1XSLA 5I3UA 2BQUA 4UB1A 4IRKA 3G6VA 5J29A 2F96A 4TQRA 1S1VA 3EPIA 1NJXA 7ICOA 3OVNA 1KVBA 3CM5A 4IQUA 4KLMA 1HJPA 4CF8A 4EZ9A 4P4PA 4JWMA 1J5OA 4FLTA 4KLUA 2VG7A 2XHBA 1ZQLA 1NK6A 2V9WA 4RQ0A 3O4NA 2BQRA 2FPKA 1RXWA 4CJRA 2NRXA 3GDXA 4F3OA 4QOZB 1ZBUA 3V9XA 4BDZA 2YKNA 1QQCA 5KFGA 1HUOA 1C7YA 3TFSA 2FPLA 5KFNA 1IKWA 5J2QA 2KQ2A 4E19A 3BQ2A 2VWJA 1C0TA 8ICZA 4AHTA 2JEFA 3E2EA 2PFOA 2BKEA 1XHZA 3MAQA 5J2FA 1T05A 3RJHA 5KFAA 5DLFA 3AA3A 4KN4A 3ZT2A 4GXJA 1LB2B 3CQ8A 3OYFA 2HNZA 1LWEA 4IG0A 1S1UA 3TAQA 3HPGA 3GIJA 2PYJA 3E01A 1EETA 2ZUDA 4KITB 3AVFA 4M9JA 2G8IA 5KG5A 4M6WA 1L5UA 2VG5A 4TUSA 3RTVA 3MXJA 5J2JA 3LZJA 4CK3A 3PW4A 4R63A 4CEQA 2HHSA 3JSMA 2ATQA 2LYHA 3C2KA 1UWBA 1S9FA 4JV2A 3WNFA 3SNNA 3PW0A 4I2EA 8ICFA 3MR6A 8ICVA 3MDAA 4QCLA 4NLZA 2WTFA 7ICNA 4NLGA 3H8SA 4KMUA 3OYAA 3AVKA 5J0SA 3OGUA 1DTTA 1G15A 2PI5A 3H7IA 4R65A 4FJ5A 3OYJA 4NCAA 1ZBIA 3HYFA 4B8CA 1JXLA 4M3WA 3KK1A 3JPOA 3DLBA 4O0JA 2A1SA 2X74A 3KK2A 3SPZA 1RILA 2P66A 2RKIA 3GV8B 2W9CB 3T5KA 1ZQJA 3EYZA 4B9UA 1COOA 4FBUA 4FZYA 1KVAA 1RCHA 4FLYA 4E7IA 5IIOA 2YNGA 1S76D 4C8LA 3V72A 3VQDA 4FJJA 2BGGA 4GLXA 4KLLA 2KZMA 7ICHA 2ATLA 2BANA 1MC8A 5J0RA 3C23A 3BQTA 4Z0UA 1XO1A 3C2LA 4DF8A 4O44A 2P6UA 3SV3A 1HPZA 4JS4A 5C42A 4Z4IA 2Q0ZX 3Q8RB 4IR1A 1HRHA 3VQ7A 9ICGA 4J9RA 3V1RA 4HHTA 1VSKA 9ICAA 8ICOA 2FLLA 1MSWD 1ZQWA 9ICJA 3QINA 2JZBB 4UQGA 4O3QA 5J2CA 3AVNA 4KLTA 2PYLA 3ZDEA 4YXJA 5KFUA 8ICWA 2W8KA 1B9FA 1X1PA 1ASWA 2G8KA 1QHTA 4RQ1A 5KT6A 1WSEA 4ECUA 1SKSA 3SUNA 8ICGA 1BPYA 1JLBA 2XCAA 4CCHA 3G0ZA 3ZT3A 1HMVA 4CGJA 3KHHA 4E7LA 1N48A 2ZD1A 3Q8SB 8ICUA 3NH2A 1SZPA 4E89A 3KK3A 4O5BA 1A76A 8ICYA 4Z6FA 1Q8IA 3ISBA 4KLEA 4KLGA 4Y1DA 5KFCA 4B9VA 3MGHA 9ICNA 2QXFA 4CEDA 3ZSRA 4L8RB 4KLIA 1TAQA 1WSHA 4RT2A 5HP4A 1FK9A 4O55A 2IBKA 3AA4A 5KG4A 3MR2A 1BIUA 5DGAA 2B5JA 4F5NA 4FJGA 3RMDA 5L1JA 4RPYA 3RB3A 1KSPA 1CXQA 9ICMA 3T3FA 1GOBA 2W9BB 3KD1E 2HVHA 4RW7A 3NF6A 4B08A 2PFNA 1WN7A 3TQ1A 2FMQA 4PHDA 4KLDA 3OYGA 4NCBA 3RJIA 4I9QA 2LSNA 3RRGA 4I7FA 1CZ9A 4DQIA 4YQWA 3HJFA 4RT3A 4EBDA 4RPZA 4GC7A 3NCIA 4M2YA 3C21A 2BHNA 7ICKA 3IM1A 5TZVA 3AU6A 4R5PA 3QNNA 4I2AA 4ID1A 3ISDA 2NUBA 3PO5A 4EBCA 2ZTDA 4KHNA 4KI4A 4FLWA 1TV6A 2IC3A 4LY7A 4ED1A 4KN7A 8ICSA 3QIOA 2C28A 4B9TA 1XSPA 5KFQA 5KFKA 4E7JA 2NRZA 3TAPA 3RWUA 1NKCA 4KLFA 1KLMA 3AO4A 5KFBA 5JUMA 3MFIA 1UT5A 4HUEA 4KLOA 4MQ3A 1TL3A 3PX4A 4M9NA 1S97A 3CG7A 4I2PA 1J53A 4CERA 2GBZA 1IO2A 1Z26A 2FLPA 1N56A 3KLIA 4FJXA 3P1GA 1S0OA 1WSJA 4DL4A 3OJSA 2MUTB 5KGXA 4ECYA 4E0DA 3NGIA 4KV8A 5KFJA 1XI1A 2G8WA 3VQPA 2J6SA 1BPBA 2BCQA 4PGYA 5J0OA 4R64A 4I2QA 8ICMA 1RNHA 4FM0A 4Z4FA 1ZQVA 2GV9A 3LP0A 5HMMA 1S6PA 3Q8QB 3HL8A 2FBTA 4M42A 4OLAA 5KFVA 5IIMA 4QZAA 4QWCA 1Y97A 4DOBA 1VSMA 4JK1A 4Y1CA 2HVIA 3S3NA 4PGXA 3ZSVA 1ITGA 1C1AA 4RW8A 3QERA 4DFKA 4F8RA 3NF7A 2G8HA 1T8EA 4WE1A 1V9PA 5CR0A 9ICPA 3VQEA 4ED8A 1NOYA 4EZ6A 1Q9XA 4B3OA 2XGPA 5HMLA 4RQ4A 3OYLA 2HMIA 3V6KA 3M8SA 4KB1A 4CJPA 4O5CA 4N41A 4DTNA 4O5EA 3LALA 3EWAA 4RNOA 3L2QA 4LZDA 4FM1A 1O1WA 2JGUA 7ICGA 3OYIA 1U9LA 4W5TA 4CJUA 3EY1A 1LAWA 1U04A 4KHUA 2ASJA 1U4BA 8ICRA 5KFSA 3DRSA 3PX0A 1YTAA 4CJKA 5E41A 4EYIB 9ICIA 4PHAA 3OYEA 3HPHA 4Q5VA 1S10A 4FLXA 3KLHA 3VQCA 4FCYA 5J2GA 8ICNA 1I3AA 4C8KA 1BI4A 3VQ4A 4UAZA 2P5OA 5DQIA 4HCCA 4CJ4A 1Z25A 4QWDA 1D5AA 4RQ5A 3M9OB 4EP5A 4ED6A 8ICEA 2VG6A 5FROA 4PPXA 1WSGA 5D4BA 4M3ZA 5DBCA 4YXMA 1K6YA 1YTUA 3KHGA 5DQHA 3A2FA 3PW7A 3PR4A 5SZTA 3RJKA 4DFJA 3LP3A 2O4IA 3SQ2A 4RNNA 2NRTA 1U45A 4KREA 3K4GA 2DFHA 4JWNA 3PUFA 4DMNA 4RQ3A 4TUPA 2GWSA 3L2WA 3ZD8A 1QSSA 5CWRA 3H4BA 1BCMA 3P5JA 4FZXC 1RT7A 4YD1A 3HT3A 3QEXA 4M6WB 2I5JA 2HHQA 5CB1A 2W9MA 4OJRA 1ZQUA 4RZRA 2RN2A 4FJKA 4QZ8A 1NKBA 4PHPA 3NF8A 2OWOA 3LP1A 3K58A 1IXRA 1VSEA 1VSDA 3VQBA 3RAQA 5KFEA 4B9LA 1FKPA 5IINA 5L1LA 1CEZA 2BQ3A 3H4DA 2HW3A 4K4IA 4J9QA 4ECTA 4FK0A 4LH4A 4OKJA 5HROA 4N76A 4P2HA 1L3VA 3PNCA 3NAEA 2ALZA 1L3UA 4N47A 2X78A 3DRPA 3DYAA 4O3SA 3IG1A 3AV9A 3VQ6A 4M0AA 3SQ0A 4OVLA 1BGXT 3AO2A 4Z4GA 4N5SA 3OS0A 4ED0A 1BQNA 4BWJA 1CXUA 4OLBA 3V81A 2D0CA 5J2PA 2A1RA 1GOAA 1CUKA 9ICQA 4I27A 3K2PA 2XRIA 3ZT0A 4CF2A 4FVMA 2WOMA 4AHRA 1L3TA 2A1JA 4BXOA 4I2CA 8ICTA 4FZZA 4KTQA 4R66A 4ID5A 3QLHA 1WCNA 5KFPA 3GILA 3C5FA 4YNQA 3HVTA 4FLZA 5L1KA 5KT3A 4FJ8A 3AVIA 1X2IA 4F91B 3OS2A 3OSNA 5CP2A 3RR8A 4FW1A 3HP9A 3I0RA 3AVLA 1D9DA 3ISNC 4DQRA 4JV0A 4J9PA 3SJJA 4RQ6A 4J9MA 1DTQA 1RTDA 5KT5A 1ZQHA 2OPQA 1NK5A 2DPIA 4ZHRA 4EEYA 3V9UA 4MF2A 2R7YA 3UIQA 3DLGA 2OZMA 1XWLA 3RBDA 2D0BA 4DL7A 5HLFA 2QKKA 4I2HA 3RB4A 3SYZA 4XA5A 3KHLA 2Z1IA 4J2AA 2VANA 2QKBA 5D49A 1J9AA 1NOZA 5KFOA 3AO5A 3NFAA 2F8TA 4KPYA 4QZHA 9ICUA 3QEBZ 3ZD9A 4P4MA 2R8JA 1JXBA 5JS2A 2BCVA 4I2FA 3OYDA 4YD2A 3DI6A 4FO6A 2IAJA 4DSJA 5DMRA 3ZSXA 5J2BA 4KTZA 1RDAA 3AVGA 3OYMA 4YVZA 5KFHA 2ZJAA 2GUIA 4N56A 1C6VA 1WAJA 1BIZA 1KDHA 1IKYA 3DOKA 2DPJA 2I1QA 1JL2A 1SL2A 2YNIA 3PV8A 5DLGA 3HO1A 3HVRA 2HHTA 4KLJA 2B6AA 3KLGA 1ZJNA 1EXQA 4AHCA 3O3GA 3MDCA 3S3OA 3K75D 4QWAA 3AA2A 4KHSA 3ISCA 3SQ4A 3ZSOA 1RYSA 1BVSA 5KFRA 3K5LA 1ZETA 4HUFA 5KFIA 4M04A 1GOCA 4M3UA 3JPNA 4IQTA 3BQ0A 9ICLA 3OHAA 4AILC 2M9NA 2Z1JA 3B6PA 3TI0A 3RJGA 1EP4A 2UVRA 2OYQA 1NK9A 5JS1A 2IHNA 3WNEA 2MAXA 2HHXA 3PW5A 1NKEA 4J9SA 1UA0A 3AVCA 4BGDA 3ZSWA 4KAZA 4PGQA 3AO1A 1S1XA 5BOMA 3C1ZA 5DG9A 4DTUA 1C1BA 1RT4A 2HNYA 1KTQA 4YMMA 2PZSA 1SKRA 3DLEA 5C5JA 4DTMA 4Q45A 4RQ7A 4CGGA 5KRSA 1KFDA 1BPDA 7ICFA 4AHSA 3SPYA 3D45A 2D0AA 2V4RA 3DRRA 9ICBA 1NJWA 3MEGA 3LK9A 1RBSA 4F4WA 1LW0A 2R8IA 2FMPA 4FS1A 2J6TA 4E7KA 2VA8A 3HW8A 4DSEA 4DL2A 3ALYA 4OKEA 2E4LA 1ZQZA 4M3YA 1T7PA 3TARA 1QLNA 1FXXA 2I9GA 2C2DA 2ASDA 4MF8A 1DLOA 2FC0A 4BE1A 5J2MA 2F8SA 3RBEA 4FJNA 1QTMA 1BL3A 1JXEA 5SWMA 4R8UA 4YCXA 4CESA 3RMAA 3K57A 2Q3SA 5DB7A 4DSIA 4Z6DA 4QZIA 3RAXA 4GC6A 4CJ3A 3U3GA 3MBYA 5HRNA 3KJVA 3V9WA 4ELUA
chains in the Genus database with same CATH superfamily
2HBMA 4EBEA 4ALZA 2YTUA 1W97L 3AY9A 4WK1A 1D9FA 1JCGA 4BR7A 2JEIA 3QWPA 2YWKA 4PL1A 1UOCA 2K8GA 1LXNA 2NUHA 4QNLA 3FYHA 1SJQA 4DR2K 4ED7A 2K89A 2BKOA 2QO3A 2BDUA 3NWGA 3DRSB 2JXJA 4K4YA 5G4DA 2FSJA 4ECRA 1L6NA 4JKBA 2HHHF 3BEGB 4HR2A 4UB6U 4DPTA 4F3QA 3LDLA 1ZQNA 3KLHB 2HWIA 4CI6A 2QB0A 3M8ZA 1TL1A 4CZFA 2ZHBA 3LTOA 5DM6Q 3BR9A 4C8NA 1PYSB 3CC7N 1NLKL 2B4OA 4MT1A 3WX8A 3PX6A 3V5RA 1VQYA 3CCQS 4I2IA 4RWXA 1FEHA 1RFQA 2LXFA 4P73A 4RNMA 4OYMA 4QIWD 2H5JB 1L3SA 1N5XA 3H8MA 3ISZA 2OXOA 3OXLA 1X3NA 4RW4B 1BPXA 2FGOA 2KJ8A 4JI5F 2XMWA 1V4TA 4G1IA 3RH5A 1SV5A 4QS7A 4NJ8A 3M7VA 5ALUA 5KG7A 2J9CA 1M6YA 2E7XA 4B1XB 4CEFA 1HWUA 1WC6A 3F53A 2O8DA 2DBYA 4CZCA 4NLNA 1NPRA 1IG6A 1WSIA 2KDOA 1VQ5N 2AYGA 2JJ4D 4U96A 2RDIA 2P9PA 1WC4A 3BS5A 4A8XA 4AP9A 4ERDA 4D3HA 3HI0A 4B1UB 4Y0WA 3DLKA 2MQLA 1A5VA 3AVBA 5HROB 2MQ8A 4A62A 3QMQA 5HQMA 2W9CA 2I7PA 1HYSA 3QZ8A 1VISA 2YNHA 3U02A 3EZ5A 4CDIA 2P9KA 1FEZA 1V3ZA 2G9OA 1B43A 2A41A 5J0XA 1BISA 4MEYA 2UV8A 4IR9A 1XMQJ 2J8AA 4JB3A 2ROPA 3AA9A 5J2PB 4CF4A 4H03B 3L09A 1VS3A 4X4NA 4C4WA 3CPWR 3MR3A 2FSNA 1Q5VA 5IS2A 3ILJA 3BQ1A 1HNIB 1NBWA 1PBUA 2XBPA 2UZAA 1Y7PA 2WOMB 3R1XA 2HBZB 4B3TJ 3W9JA 3GQCA 1QZ5A 1FNMA 1HR0K 4RBVA 4LF5K 4KT0C 2O66A 1NU0A 2CQ4A 1R0CB 2AZ1A 2WAQC 3THWA 3IXQA 4ID5B 3OBYA 5KTQA 2ZJRL 3ZZ0A 4A8QA 5I3UB 5LJVA 4AYBF 1KONA 1DHMA 2GIRA 1Z4UA 1JLCA 2DH8A 2JOQA 2PI4A 5C15A 4O5KA 2VUGA 3BV8A 3TQEA 4G65A 2QSWA 2CADA 5A8WB 4JV5J 3D2SA 2Q3PA 4RQMA 3OL8A 3CF5L 1N5YA 2ISPA 5F9NA 1RAEB 4QIFA 4K25A 3UN3A 5FRNA 4HKQA 1E6VB 3CD6N 3FBEA 1KVCA 3LDAA 4LJXA 4KB7A 4UB8U 2FVRA 3AUOA 3RMCA 1IKWB 1UPHA 2H1YA 3RR7A 2CQHA 1P1TA 1MROB 2WW4A 2H3ZA 5U47A 2LU2A 2D41A 3TTDA 4MIWA 5CZXA 3VVUA 4DCHA 3PJXA 3IRXA 3R7SB 3HHNB 4FZLA 1SIZA 3OYKA 3UQ0A 2IM3A 3E1YA 3V9SA 2A2DA 1ZA1B 2B0GA 1KP6A 1GLAG 1PZNA 5AI8A 9ICHA 1U0HA 1LVHA 2W2NP 1RTJA 4A46A 5LOQA 3CDEA 1RB0A 2I1RA 1RXVA 3QX7A 2PGCA 2V5HG 2E1RA 1E6YB 1W7WA 1JLQA 1KVJA 1HYVA 4C8OA 4DV6J 4CEBA 2NXNA 1CJTB 3RRHA 4BG8A 3MEDA 1UAXA 1ZQIA 2GOLA 4FJ7A 2FY8A 1D1UA 2YWHA 2B43A 1J54A 2YV0X 3VR1A 3OXGA 3QXGA 4M9LA 3WIVA 3M3ZA 2V2VA 1YQHA 4KFBA 4K4TA 4US8A 4DV2J 2G5IB 4KSEB 4ZH4A 2QARB 5E2QA 3KJFB 5C7PA 4LF7J 3OYCA 3Q8KA 1YZ7A 3FZMA 2ADCA 4LFCF 1G1XA 1YJTA 1IKVA 4YOUA 5F8NA 1YI2N 1KKHA 3IR6B 3AB4B 2E8AA 2VDHA 4QS9A 9ICCA 3THYB 1X4DA 5LMNK 2HVDA 7ICPA 2HOQA 2CJXB 3AM9A 3C1YA 4CEAA 4A2BA 4DTXA 2EC0A 2ZVSA 4F5QA 1C2PA 1H2TZ 3J7Z5 1DZ5A 1P6TA 4TQSA 5F41A 2LM1A 2DH7A 3CFRA 1KBUA 2QYCA 3GLJA 2BANB 1A7GE 5IT4A 3ZZYA 1R8PA 4JI5K 1RBOB 1T9TA 4A8SA 5DGBA 2HHUA 4TSXA 2B7CB 2G4BA 4MFFA 2M3DA 4HYKA 2J9EA 1ZQAA 3MGVA 4I68A 5G5GA 3N01A 3L2VA 3MXIA 1UT8A 4J9UE 2A19A 3CHWA 4X4UA 4DB3A 1GLLO 1S9EA 4QIGA 3PMLA 4M3XA 3D0IE 2AX1A 2ZWOA 4NYZA 3AODA 3L7OA 3EW9A 2DXEA 3KZBA 3C94A 2XO7A 2WCXA 4X4PA 1K47A 5J8YA 1JLGA 4DTJA 5IIKA 1KWMA 2P1JA 4F5RA 2A2CA 4WFBL 1JLBB 1F3VA 4DF4A 5GMKa 1H2UX 2VB6A 4CLTA 4XTTA 2OUGA 2QA4G 2ZIVA 4PJ0U 2I8EA 3DM2A 2YI1A 2E29A 3TWZA 3VAHA 3N97B 4WFAL 2VOOA 4ICLA 4IFVA 2BE2A 4ZCIA 1Q82T 3C16B 4AM6A 4NL5A 4QR0A 3VCDA 2G1HA 4H4OA 3BGFA 3D2QA 3CCUS 1KC8T 3I1YA 1QAIA 3ZYYX 1PJ5A 3M32A 2K8CB 3NVVA 2KG1A 4DO9A 1Q86T 5AM5A 3M8QA 1FDBA 3VALA 3D0PA 5BYRA 5ALMA 1W25A 3H2LA 2LQ8A 1XQSC 1FESA 4JK7A 2EI5A 2IHR1 1K44A 3DOMA 1NH8A 3F73A 1SUQA 5JVGQ 1RLDA 4I7FB 2J6UA 2F44A 3HZGA 4YN4A 5KAFU 5AI5A 2NLXA 2ESEA 3TZWA 4OD0A 4ZP8A 5FIIA 3UO0A 2H65B 3I0SB 3TEGA 3WK6A 1RBUA 3H40A 3ZDDA 4Y2XA 2XMKA 4NCGA 4USWA 4P2MA 1TE2A 3THVA 4C1NI 5H1SQ 2KVSA 7ICIA 4KI6A 2WZ1A 3IGNA 4TLQA 4WZQA 2KTQA 3PW2A 3C15B 2HQGA 3QGHA 2OPSA 3EZOA 4CIOA 2D69A 3NH1A 3RVCA 1F0XA 4FNHA 1NHUA 3D3CJ 4P2XA 2Y9HA 4LUBA 4WYWA 1NM2A 3R6LB 4NY8A 4IRDA 1KLMB 1RWXB 2C3YA 4C7ZA 5B0BA 5IQ6A 3AJ2A 1TL3B 4A8YA 4KB0A 4BRNA 3ED5A 4PG4A 2RU9A 1BA1A 1D3WA 4F5PA 3BBCA 3EXYA 3CERA 3CMQA 4RWWA 1OSCA 3V1QA 2FF3B 1SB6A 3RJJA 1DGSA 4H8KA 1BLUA 3ENWA 1X9MA 1DXSA 2ZWPA 2WB1C 1QAYA 1IM4A 3KKAA 2Y9UA 3M2VA 2QYGA 3N5BA 4FPRA 3UN5A 4AH9A 3MWBA 2Y0SF 1TGOA 1R8BA 3SQOP 5M1NA 5C10A 4QZDA 4LC9B 3ITHA 3DXSX 2E6MA 1D8BA 1DGJA 4CFAA 4F26A 3R3TA 4QOTA 4JB8B 2QK9A 1LQ9A 5G0RA 1FFSB 3QO9A 1T9UA 2ZHOA 2BCSA 4BHQA 4YMEA 3SQIA 3AJ1A 3V7LA 2V8PA 1LV5A 3F5AA 2GMLA 3UQSA 1CI4A 2IDOA 1Q9YA 3LPEA 3NP5A 5AQYA 1AW0A 4JBCA 2OTJS 1QAXA 4JKGA 4F0HA 2CJYB 3OTCA 1VSHA 9ICKA 4CFBA 2RHSB 3I82A 5EE1A 4X64J 9ATCB 3HSCA 3FSIA 2GHPA 3IBCB 2UUAJ 5J2EA 3ILLA 3JSRA 4LFCK 2R2TA 1HBMB 2P5GA 4I28A 2OZSA 4V1Ak 1Q53A 5GAGI 1S0MA 2I9SA 1KOOA 1ZQGA 3RB6A 4Y2RA 2XY5A 5AI9A 2QWRA 4QWEA 4H54A 4P7TA 3POTB 2G06A 1O6XA 2IM2A 1C4CA 2YBVA 4NLXA 1XMOJ 3AVJA 1S6QA 4C7YA 4I2DA 1ZQSA 5IV3A 3CJ7A 4UB4A 2IM1A 2Y1RI 3N6MA 1Y0HA 5GIOA 1P90A 5K8OA 1HARA 3AO3A 4GVEA 3D2FB 2IOFK 1GLJO 1ZD2P 5ALDA 4FVUA 3MABA 3OHBA 2VG6B 1FJCA 2HFVA 3UXNA 3LWMA 4X4OA 4EENA 1U2RA 2D3UA 4PPDA 5EE3A 4MTPA 1OY6A 4ZTJA 1B7FA 4QW9A 3BZQA 1CVJA 3BY5A 4B1VA 4BQZA 3WUHA 2LXUA 2GH1A 1DFDA 1S1TA 3G96A 3O9SA 1T4GA 3SI6A 1NBEB 2G8VA 4HI1A 5EWGA 5AM4A 1Y88A 3CJ8A 3DXKB 4FWSA 1SKWA 5J1EA 3MN6A 5F1XA 1S7IA 1CBKA 3O3HA 3A3PB 4DU3A 2MZSA 1KQKA 5HNKA 2DJWA 1QHAA 5EWFA 4DU4A 2X3DA 2KHVA 2G1DA 1SV4A 2OSQA 3B0XA 3GV7B 3ONNA 5RUBA 4HHUA 3N9UC 2HBQB 3CQXA 1F21A 2XQCA 2VGNA 1O13A 3Q7BA 3H2UB 5J8YC 1NJIO 1FRLA 4O4GA 4HTIA 4R0EA 3K7RA 1ILYA 1RXOB 3CCMN 5ITHA 3UDCA 1H3DA 2M8HA 1NGGA 2DNOA 5HANA 5A6WA 2PY5A 3KIOA 2EAMA 1R3NA 2DVIA 1ZQDA 2E7WA 3MOJB 4GXIA 5KG6A 3ZZUA 1ZH5A 1EKRA 1N63A 1NMNA 4M5MA 4GFJA 2CQ3A 2HBLA 1ZM4A 4ILHA 1RKIA 2D1CA 3G86A 4FPIA 2DNHA 4NLBA 4ECQA 1BXNA 3TEHB 4MFAA 1U49A 3TAFA 3VZHA 4DFDA 4NA2A 3UMGA 1PGZA 4A8FA 2A6OA 2EEYA 1RT3A 3AVHA 4M41A 3CP8A 3CJ5A 3KMQA 1Z00B 3M8YA 1M5KC 1YJ9N 1FJ7A 3I56S 4K4UA 2ZIWA 4IQMA 5HSPA 4LD0A 2JRSA 4IFYA 4PPZA 2MJUA 3M05A 4J9KA 1TMMA 3AXKA 1DGKN 1B0XA 2KN7A 2E5LJ 1WF0A 4JNEA 3QEIA 1U1RA 2H3VA 4R25A 5M2UA 2MDAA 1VRTA 4LSNB 3CF5Q 1VQMS 2F1IA 2OLWA 1VLBA 2QN6B 1P1LA 1B92A 4DR5F 4EELA 2B6GA 1A5XA 1HR0J 5JVHQ 4W5OA 3X3UA 1EKSA 4G6VB 3LZIA 5AQVA 4I29A 4TYBA 1N34J 1ZS6A 2JVRA 2QWMA 1X4AA 4ZVFA 3IAYA 1VQ8N 4J9OA 3DI6B 1JMTA 3NBPA 4WBFA 4FF4A 2W9AA 5BRDA 3FCVA 2Q6BA 1TVRA 1RUSA 3DHWC 3H8WA 3WU2U 5MLCV 1S0NA 1FI4A 3CFOA 5E3QA 4KH1B 4LQ9A 2DCUB 2H3QA 1ZQPA 4BRLA 2DKOB 3GU0A 7FDRA 4UB2A 4IQXA 2LP4A 1N0UA 4HHHA 4Z4CA 1WC0A 4ED5A 7ICEA 3DAWA 2UUTA 4C6AA 1VSJA 4RW4A 5GAHI 4BVOA 1VBKA 4JI1F 4CLYA 3OVBA 2ZUCA 1FTRA 2UXDJ 2FPMA 2M88A 1REVB 5KRTA 5B0FA 3E8OA 1ZQOA 5AKLA 4FXDA 5HRRA 1QS4A 2DY4A 2GCFA 2VC1A 2F1HA 4CECA 3IRUA 2E2OA 1RI7A 1HIWA 1UQVA 3M8RA 4DBQA 3L2UA 4FBTA 3K89A 3ETLA 3RBZA 4AE5A 4YS2A 2XGQA 2OIHA 2IYIA 1C1BB 3ADAC 2ZF5O 2Q97A 3R2CJ 3VOVA 2QB1A 1J2VA 3CJBA 4CF1A 1CZBA 3UXOA 1IM6A 4CJTA 3UDEA 5M2RA 5B0AA 3O5TB 4OMFG 4OYXA 3OYNA 4EU0A 4OHWA 4NLWA 3NGRA 1FE0A 3RMBA 1B0PA 2HK3A 2B9YA 2OMLA 2HHHJ 4USMA 1S4EA 3KLFB 4C4RA 2XMAA 4CIFA 2GX9A 2H4YB 1XO0A 2DHAA 3NS5A 1A6SA 3VAMA 1G4CA 4CHPA 4E3SA 3SDEB 4XIUA 2ASOA 3VCBA 5E3AA 1HNIA 4ZOHC 3PVXA 1WSFA 3M30B 3C29A 1RZTA 1WBBA 3GP9A 1PAEX 4I6MB 1K73O 3HPOA 1NGDA 2DGVA 3J7ZT 1HNZF 1LWFA 4IG3A 3SI8A 2W4PA 3ELHA 1Q5YA 5E0OA 2V63A 4CI0B 1XSLA 5HBMB 5I3UA 3MCOA 1TYQB 4UB1A 2XSJB 3G6VA 4LFBK 1QDUB 2YHXA 2BM1A 1JALA 5IV4A 4JI5J 4DI6A 1NGEA 4KLMA 1HJPA 3TSPA 4CF8A 4JWMA 1J5OA 1KC8O 1TAMA 4J03A 3QUTA 1ZQLA 2V9WA 4MLHA 2MY8A 1GMUA 2PD1A 5HMZA 2PC6A 4WFAQ 4YOVA 1E6VA 1RXWA 3GDXA 1URRA 3J8AA 4QOZB 5ALFA 3V9XA 4BDZA 1QQCA 2W2PP 5KFGA 3M7DA 3UM9A 3TFSA 1IKWA 4P72A 3FSXA 2RS8A 3BQ2A 3FMWA 1C0TA 4H5VA 1UJ4A 4AHTA 5ETOA 2BKEA 2HQFA 4LR9A 4ATNA 5J2FA 3CQYA 1ZRNA 5KFAA 1JLFB 3SEOA 3UKUB 3I4HX 3FZBA 3ZT2A 1HBUB 3OTQA 1VQ6N 3CQ8A 2DRDA 4DUYF 1WG4A 2PMZF 1ZM9A 4IG0A 4QPXA 1S1UA 1GLEG 3D9BA 2HQ3A 4FOEA 3GIJA 1WC1A 4I6WA 1G6BA 2ZDOA 2V9KA 2DL0A 2DYAA 3AVFA 3MCMA 1IQTA 1WC3A 4IFEA 4UOHA 1IR1A 1B7YB 3FUYA 4TUSA 2CDRB 1S49A 1E6YA 1LKYB 3FMBA 3S8SA 4P52A 4USKA 5C2FA 1Q79A 2VJ4A 4C23A 4AF1A 5K4LA 4DR5K 4JV2A 3WNFA 3PW0A 4I2EA 3FZHA 1HI0P 4RW9B 2C3PA 3MR6A 4BX9C 2JX2A 2W2MP 1T95A 5E26A 2X1AA 4KMUA 3OYAA 5B8HA 5AE3A 2PI5A 4DUTA 2IYGA 4OQJA 1FJGF 1ZBIA 3HYFA 2RRNA 4ZLLA 2GQQA 5M1KA 5CYMB 2W24A 3MAAA 4NXMK 1ELOA 1OPZA 2DRAA 4FWKA 4K5RA 3THYA 3C7NB 2B9EA 2R7OA 2CPIA 3W7BA 4KX5A 1HNVB 4KO0B 2B8PA 4FZYA 5EXWA 1KVAA 1RCHA 4E7IA 3M4XA 2D4WA 3V72A 2BEFA 1XNQK 2KZMA 3NOCA 4KY3A 1UVKA 1PCAA 3UR3C 2BANA 5B5EU 3C23A 2GC8A 3IR7B 2BACA 1JLAB 2P6UA 2GZOA 2D0OA 4JS4A 3PSIA 1RHKB 1TZ0A 3QU5A 1BC6A 4J9RA 4HHTA 2V2ZA 4FPAA 4I64A 2Q0UA 3KNGA 2M5YA 4YUDA 4I67A 8ICOA 5FDLB 4MO5A 9ICJA 5J2CA 4NOHA 5CCLA 4KE5A 2PYLA 5GADP 5LJ3Y 4EHTA 4K5SA 2OFGX 4PRFA 4HT7A 2O1PA 3K1ZA 3BREA 4Y2VA 5F3TA 1F9HA 3SQGA 5HMXA 3OV7A 4WCEL 2LA6A 1JLBA 4FF3A 3ZT3A 2JMGA 1KQGB 1Y3JA 3I33A 3KHHA 4E7LA 1AB8A 3THPA 4BRQA 8ICUA 3LM2A 1SZPA 1R0BG 1A76A 2ZH4A 2YVSA 2MRLA 1J97A 1ZTTA 3PEJA 2PO4A 4KLEA 4KKOB 3MGHA 9ICNA 3C16A 4DV1F 3ZSRA 3T41A 1TAQA 3QFPA 4ACOA 1WSHA 2YMQA 4PG6A 3AA4A 5JLHA 2ZGYA 3KOOA 4ZVUB 1GXTA 4CLSA 3RMDA 3FBBA 4RPYA 3CCJN 3D1OA 2NQPA 3D67A 4B1ZA 1WDDA 2H9ZA 4BRPA 5M1OA 2D3O1 3OYGA 3QGIA 3SCLE 4I7FA 2WBRA 1SJ3P 1HNZK 1CZ9A 1IBCB 3L6QA 3L3CA 3BKUA 4LSZB 4ILLA 3IM1A 4QJFB 2ZH2A 2GX8A 4IJAA 1TKTB 3BYPA 2VFUA 2IBOA 3QNNA 3OTBA 4ID1A 4FWPA 3A8YA 4A2AA 2NUBA 2HVEA 3PO5A 1QQNA 3LDNA 5I4MA 3W2WB 4U67L 2ZTDA 1N88A 3QFWA 4LY7A 3C6UB 3SAFA 3N4PA 4ISEA 3A8JA 1R0AB 4Y34A 8ICSA 1X5OA 2C28A 2QG9B 5KFQA 4E7JA 4UOFA 4UUXA 2XZWA 1KLMA 2VF3A 3ZX3A 5JUMA 4KLOA 1TL3A 3PX4A 3CG7A 1FW6A 2BABA 4Y65A 4CZKA 2FLPA 1RT2B 4JAXA 1FTCA 1N56A 4YORA 3P1GA 3D6JA 4XAKA 3OJSA 1N6QB 2KXNB 4KH5A 3O44A 3VHQA 4WKYA 4OZ5A 1UZDA 4JN4A 5KFJA 4JI6K 2ZDPA 4DPXA 2G8WA 3VQPA 2J6SA 5A2QY 4DUYK 4PGYA 3NGTA 1T03B 1Q7YT 4R64A 2OEKA 4HTLA 1WI6A 3NNCA 4CNZA 4DCCA 4X2BA 2CG8A 1LK5A 1NU4A 3WXLA 3O9RA 1BQMB 4OLAA 2MZTA 2ZOGA 5AJ3F 4QZAA 2C2NA 2KICA 3P5TL 4OX6A 1Y97A 4DOBA 1VSMA 4JK1A 4AYBD 3KFWX 1WG1A 2HVIA 4U8VA 2XI2A 3SFUA 3ZSVA 2MKKA 4F8RA 1BWFO 3NF7A 3OR2B 4TU7A 3CB4A 1G7CB 2XMJA 2NRRA 5HATA 3OD2A 9ICPA 3BR8A 2YY3A 3CCES 2R7VA 4EZ6A 2XGPA 3I28A 1Z2ZA 2NYIA 4RQ4A 4PR6A 3PIPQ 1FJGK 4DTNA 4O5EA 3EWAA 1WHYA 1HNWF 4Y28C 4LZDA 3PRVA 1ECWA 3CW2C 2EKNA 5CR4A 3CJ1A 1HBMA 3WXKA 1RQ0A 1U04A 1T6DA 1U4BA 8ICRA 2B7BB 3POTA 2VBWA 4H4KA 1O03A 2OPRB 1OIAA 4CJKA 4FDFA 4DPOA 3CCRS 9ICIA 3OYEA 1S10A 2KNJA 5D0RA 3VQCA 1PBAA 2DY1A 5J2GA 1BI4A 5AQFA 4UAZA 4QWDA 3E0FA 1D5AA 4EP5A 3D2FA 1HD0A 5M1QA 2K2PA 2VG6A 4OJ3A 2JC1A 3D1QA 3A12A 1K6YA 3KHGA 4PZOA 2E8MA 1T05B 1L7PA 5SZTA 1QD1A 2W40A 3DHXA 4DFJA 1HBNA 3U8XA 2IRYA 3SSRA 2HGLA 2E1MC 3JB9k 1B99A 4KREA 1U45A 2HNZB 4NL9A 3O4WA 3V6DB 2DFHA 4Y0FA 2IVPA 4JWNA 1Y5IB 3DXKA 4DMNA 4RQ3A 4TUPA 3ULHA 3P49B 2KO1A 2XI9A 4KHPF 5CWRA 3H4BA 1BCMA 3F5EA 3VENA 2JSXA 1RT7A 3V2UC 4YD1A 1EQYA 1FDAA 2DNLA 4M6WB 2CQ2A 2D3DA 1ZQUA 4ZJOA 2IPOB 2FHJD 1K9MO 4FJKA 2UUWA 4QZ8A 3HI9A 3MTKA 1X31C 4BCAA 3NF8A 1OO0B 5KL8B 1VSDA 3BQ7A 5CABA 2KG0A 4JI0F 2A10A 5D0GA 5IINA 4WF9L 1CEZA 1XTZA 4DV1K 4K4IA 3CNHA 2HURA 5HL7Q 1DTTB 4RR5A 5AXLA 2ALZA 1QJHA 5KPTA 4JKDA 2DH9A 2XS5A 4Y2AA 5K8NA 3HCXA 3TU5A 1VQPN 1P7DA 3RSEA 3AV9A 3VQ6A 4M0AA 4OVLA 4Z4GA 5HN0A 2R3VA 3C14B 4EO8A 1WSRA 2V94A 1N0VC 4O4RA 4BWJA 1S59A 5ELZA 2F4VK 2I6XA 1SJ4P 3J7ZO 2A1RA 2YNGB 2XRIA 3IP4B 4MO4A 4DX6A 4J5OA 3BUZB 1BA0A 2IMOA 1N5VA 2BJ3A 1Z4NA 5C42B 4W92B 2YJEA 3G82A 2MKJA 4H5NA 2IDEA 3W66A 1CLFA 2UP1A 3HVTA 2MTLA 4F91B 5CP2A 1D9DA 2P35A 2DR7A 4RQ6A 4PQAA 1RTDA 3OFFA 4DV4F 2QLFB 1NK5A 2DPIA 2Y8YA 4ZA1A 3V9UA 3UIQA 1XWLA 5HLFA 4DL7A 1HNXF 1DAXA 3HHLD 3SYZA 1EQMA 3KHLA 4PAAA 1NM1A 3OTOF 2QKBA 3E9LA 2OKQA 5KFOA 3TUPA 5H9EK 1U1KA 3O8WA 1RQNA 1QE1B 3NFAA 1RBAA 2A0FB 5FLXU 3QEBZ 2R8JA 5JS2A 3HKZF 2M7SA 3MURP 1YF5L 3DI6A 4FO6A 5CHCB 1BWVA 2IAJA 5DMRA 1KD1O 3ZSXA 1TL5A 3K17A 2KB2A 1DK3A 4JHDB 5E3PA 1Q81O 2ZJAA 3IWNC 1FK9B 2G13A 4LRDA 3FC4A 5AJ3K 4N56A 1KDHA 1TUWA 2V8DA 1JRPA 3O1BA 2BH1A 2DB1A 3GE9A 3CNQP 1RWOB 2HHTA 4KLJA 4PL8A 4F0MA 2PEBA 3V4IB 1ATNA 3MOZA 1OSDA 1W2BR 4ZVEA 5AXMA 2GUPA 4CM2A 3H46O 4OHXA 2OHDA 1RYSA 2OI2A 5KFRA 3K5LA 1HNWK 2J9DA 1AYEA 4HWIA 3IC1A 4CQ1A 3TP2A 2M9NA 1VQ4S 2Z2LA 2OYQA 4TXSA 5JS1A 1QQ5A 5ADXH 2HHXA 4M63A 3H3NO 1UA0A 3AVCA 4OV1A 4LIRA 4DR3F 2I38A 1FWPA 2XHCA 3R8EA 1C1BA 2HNYA 1YIJS 4H4KC 5F0UA 3NAHA 1FX4A 2KVQE 3VF6A 1Q1KA 2GAGC 3M6UA 3D2WA 1KFDA 4DR5J 3KLIB 2Y0BB 2KJ5A 4J91A 4WYLA 2MKIA 4LRCA 2KJWA 2E44A 3KK7A 2HPUA 1FFGB 1WHXA 3LK9A 1RBSA 1SV0A 3S41A 4FS1A 2YKMB 3C19A 4TU8A 2J6TA 1F2GA 3JTPA 5CQGA 4DSEA 2LEAA 2E4LA 1ZQZA 3TARA 1FXXA 1Z1ZA 2AIRB 4YOTA 2VJVA 4KHPK 5GAEU 5EN1A 3SDEA 2VZ9A 5JICA 2D9PA 3LF0A 2PEHA 1IN0A 1JXEA 3D0GE 5SWMA 2QA4N 4C80A 2LECA 1Q95G 3DOLB 3TZYA 5DB7A 4RW8B 4DSIA 2KHOA 1U2VA 5H2FU 3OBIA 4PHTX 3S7RA 3C6HA 4GC6A 4JI0K 2UXBJ 2V4JB 2XSJA 2MQMA 4CBWA 1S5ZA 3V9WA 3D7EO 2CKWA 2BKPA 4M9HA 4WCEQ 5BYSA 4JI1J 4IO8A 2DR8A 3FJ2A 5DO2A 1UTAA 3QEPA 2AA4A 2O8FA 4Y2MA 2A1AA 3KWMA 3FZKA 1H74A 2AH5A 1U47A 2RMLA 2E9RX 3O2IA 3BKFA 3TX8A 4YHHF 4FZNA 4TURA 1WEXA 4EI2A 3FFKB 2A5XA 2ZIXA 2DITA 3ZSZA 4JI8J 5D0HA 3K9KA 4H4MB 4PABA 1VDVA 3EGWB 4X5VA 2WVFA 3MXMA 2E8OA 2EWHA 1JLFA 1WTFA 5JTIA 2FHJA 4CJSA 1K8KB 1HBUA 3IR5B 3F2KA 3NVKA 5KNIA 3ET6A 4YG2A 4G3IA 1BDGA 4F2SA 3JAMY 3BO2A 2LEPA 4WFZA 3SSSA 3VA0A 2CG4A 3NEKA 4LF4K 1T3OA 3GFZA 3HX0A 4CJFA 3QE9Y 2DGSA 5CXTA 4CHOA 5L9XA 2V68A 1Q0NA 4XPCA 4DV4K 1GFWB 3L3VA 1C0UA 1Z3EB 3AGKA 1LXJA 1FERA 1HNXK 3R9KA 2HAIA 1VC5A 2VIHA 2HGMA 3IBPA 2KT2A 2DO0A 2MSSA 4QU6A 1FVSA 3HXMA 2AYBA 1KEKA 3K0SA 2MEWA 2Z58B 2WVBA 4RLEA 5B09A 1VHXA 4W5RA 4NM1A 1RBVA 1NSAA 1S5JA 3HM9A 1U24A 4JKHA 1FXDA 3AAPA 2XLJA 3OLBA 7ICQA 3AVAA 7ICSA 1FO4A 3TANA 1NNDA 1UJ5A 1PVPA 1PJ6A 1RAHB 2HDOA 1HNVA 4KO0A 5J2NB 4I2GA 6AT1B 2VWKA 4DPWA 2IFXA 1JX4A 3I5CA 1X6IA 4YY3F 2BKNA 3EVMA 5B0EA 3ZCMA 1IV0A 1BQNB 2AP6A 2DNPA 3C6TA 4BWMA 3M2RB 4DQ8A 1GH8A 2OM6A 4FFDA 4MYUA 3SCXA 4B9NA 1JLAA 2HRTA 2ZXIA 4OHYA 3ENOA 4CBUA 1J2NA 4AXIA 2ACMA 4OJLA 1IUJA 1PKUA 7ICLA 3HHLA 3VAIA 2GMHA 2R9LA 3QZ7A 4X4SA 3OW2R 4ZVHA 1U26A 4F4KA 3HLUA 4ZP7A 2Q79A 1KS2A 1HPMA 4K8ZA 4DUYJ 2F9TA 3VPZA 1YJ7A 2KU7A 1RPLA 4MDBA 2PDAA 3CMEN 5IIJA 4BS2A 2CQIA 5BN8A 2KYXA 2KK0A 4JI2F 3W64A 2EHGA 4BRHA 3F5TA 3LAMA 2EZZA 2QV6A 3D54A 1CRXA 3V9ZA 1YT3A 3NMRA 2RRAA 1NK7A 4DR3K 1HLWA 1TUVA 2GO9A 2EX3A 3OJUA 2C3UA 4KGMA 3ZT4A 3MFHA 3RJEA 1FWKA 1JCEA 4C48A 1UVJA 2ZJQL 5IIIA 1I5OB 3GCWP 3CC4N 3S6JA 2F8KA 2R7QA 1XC9A 3H7HB 4KQZA 4CGDA 1OY8A 5A8KB 1FJGJ 3CO9A 4I2JA 2JEJA 3ZZTA 2W8LA 1HYZA 4J2EA 3L7PA 5H9FJ 3H5UA 4ZK7M 5BOLA 4UZCA 3FK4A 5D4NA 1N8RT 2HZCA 2RVJA 5IT9U 2YX8A 4DG1A 3SBGA 1VHIA 4UBBA 1CLQA 2EFQA 2BJ9A 3HFZB 3PRBA 4IZ9A 3NL0A 1LFWA 4CF3A 2IJNA 4J90A 4LH5A 4WPAA 3EPGA 1EETB 4CLPA 2YNIB 2DHSA 3G6YA 1RDWX 3KLGB 4K4WA 4EFAC 1XEZA 4OI1A 3UMBA 2BYCA 4FF1A 1Z2LA 1TKTA 5DB6A 4OPJA 4UT4A 1WF2A 1NDKA 2W6KA 4CJQA 2G0IA 4YMOA 4ECWA 4QZEA 3UD5A 5J0YA 1PK3A 1PYOB 1RDDA 4HTJA 2XS7A 4WF9Q 1R0AA 2Z0GA 3EEQA 2V6AA 2XMTA 1EP4B 4BY9C 5KFMA 2ROEA 2BPFA 4YHHK 4H0XB 2BTFA 1TFRA 3WNGA 1VMBA 1N2XA 3RH6A 2JRZA 1GX5A 3CC7S 3PIOQ 3MX5A 1Q78A 1S77D 4AQYF 2VH7A 2K4PA 5J0TA 3MM8B 4CGHA 2WBNA 1RT2A 1ZQMA 4IH5A 4HUGA 4UTGA 3R7NB 5AZIB 2EFPA 3DLEB 4GMJB 2ZOMA 4PWDA 4IOCL 5IM0B 3JPPA 3MTJA 1RYRA 1T03A 1UVIA 2VQEF 2ZIUA 4OCZA 3MM9A 3VV2B 4DV1J 3MEGB 1HWLA 2FJ6A 1KR4A 2H5IB 4L73A 5GIPA 3T1YJ 4ETZA 2R7WA 1HPZB 4K4XA 4RX6A 1F5BA 3DNCA 1VQ5S 3M9MB 2HWHA 4CEOA 3W9IA 3R8YA 5TISU 2DEJA 2JFKA 3FLCO 2NXEA 1PIEA 2KL8A 3GZ7A 3UVJB 4NO7A 1FX2A 2EK6A 3CJTA 3VGUA 4Z4HA 1RTZA 4CIGA 2WFBA 4NWIA 2RILA 2ILYA 1RZMA 3R97A 3Q7CA 3CC2N 3Q86A 2Q66A 2PXIA 4YFKA 2VBXA 3TOQA 2G8UA 4I6YA 3J7YI 3AMZA 2C22A 2LA4A 5F3ZA 3SUQA 2R8GA 1M90O 3B82A 3UWTA 1X4BA 2IGIA 4ELVA 1KFSA 2ZJ5A 1VBXA 1TUUA 2OPRA 1P9QC 4KYZA 2Z57B 4BUGA 4NLPA 4PKDB 3L5KA 1EJ7L 4EK2A 3A0IX 1OS5A 4USVA 1F60B 4YY3K 2HEKA 5DBAA 2Y3YA 4KRWA 1N33K 2E6LA 1RT1A 3G25A 1UFKA 1RDBA 2FDNA 2LMRA 2IRUA 3RGIA 2V8HA 2AEMA 4C4SA 3RB0A 1S9GA 4UY85 3ZO7A 5GAEP 1TL1B 3SUPA 1KLNA 4DCJB 4Q8FA 1KEJA 3QEWA 4RW7B 3VQ8A 4CZHA 4GVMA 2ZTCA 4FW2A 1YHQN 1SKUB 2E5GA 4XQ8A 4IQWA 4XK8C 5EOZA 4IQVA 3PEHA 3BJYA 2FXUA 1GNKA 1WAFA 1FFWB 4YR3A 3V6DA 2QA2A 4K42A 1WB9A 3LPUA 2A3ZA 7ICUA 2ATCB 3HOSA 1PG5B 4U8YA 1I39A 1R8AA 2MA1A 4Y2YA 1C4AA 2IDLA 4XUSA 2DNQA 5KFDA 3HMJG 4DX5A 1SV5B 4YDUC 2YWWA 4EP4A 4AD6A 2PAVA 4M47A 4YMNA 3TR8A 2RLTA 1KNZA 3AOBA 5DK5A 1MA7A 2B4PA 1ATRA 4WFNL 3U26A 3GIMA 4OPKA 1V4SA 2Y1IA 5C0YA 5BPCA 1VHFA 4FK2A 2U2FA 1WBDA 3DV9A 3ZSQA 3VN5A 2ZQBA 2KEYA 5I42A 4USIA 1U1NA 3BS5B 4UAYA 4WQ4C 3BGLA 5ALJA 4FLUA 3A8KA 3LWLA 1Y5LB 5C25A 5KG1A 3DLKB 2DGUA 4OGEA 2W4DA 1ZRMA 2RU3A 4CGIA 5HO4A 1HYSB 2HHPA 4OYIA 3NRZA 3AVMA 4FO0A 3FBCA 1P9YA 2GW8A 2P9KB 4BR5A 5D78A 4GO5X 3GFXA 4DEZA 3LL3A 1TK5A 1VLOA 3WIUA 4DKWA 5HR6A 2GVZA 3TKAA 2DUYA 4K4HA 2W42A 2CFXA 3ZFVA 1MWYA 2FZCB 5F8JA 1QM9A 2QX0A 1U48A 3VQAA 3HBTA 2LYAA 3D6HB 1HX1A 4TUQA 1A5WA 4L3KA 4ZPVR 3VEOA 3TAMA 3EUNA 5LT5A 2Y0SC 1D8LA 4OHZA 3THWB 2VDIA 2O8BA 4FJLA 2O8EB 2YY6A 5D15A 2HF3A 2EXUA 5HVGA 8ICPA 2UU9J 1V97A 1KRPA 1JLCB 4AQYK 3TSUA 4WK3A 5HRPA 4CNQA 3HZEA 3KZIU 1YUWA 4DTRA 4XH4A 1MWZA 1JK9B 4F4YA 4ZJLA 2QWLA 4H0VB 4CD3A 2IVOA 4FF2A 1Q8KA 1RWWB 1BUPA 4XDDA 1QE1A 1A9NB 1NJZA 2W54A 4JI0J 3UMCA 2I0XA 2Y9TA 3GYGA 2UV8G 2VQEK 4AUKA 5DG7A 2F76X 1D8YA 2UUCF 3NCQA 1REGX 4ECVA 2WW8A 4JHDA 1MQ2A 2V7ZA 1Q18A 1FRXA 1TFWA 4JD2B 3M9NB 1NH7A 2AGPA 3HVAA 4TY8A 4Z7YA 3QT6A 2KFYA 2WVCA 3CJ4A 3VEXA 2AGOA 4DR4F 4IC9A 3IRXB 3SD7A 1A77A 3V4IA 3WKDA 3UPFA 2XNRA 2RF2A 1U0HB 5HP1A 2PKEA 4YDXA 4WP8A 3WKCA 5EX3A 3K5MA 4NLVA 1CG2A 8ICCA 3NH0A 8ICHA 2XHWA 1T02A 4Z2XA 5IILA 3JXUA 1OKJA 1C0MA 2XWYA 3C66A 5ETKA 3GOIA 1JLQB 1JIHA 5DBBA 3ZTPA 4DOCA 2IVFB 5D4OA 3EVWA 2IJFA 2AWZA 4B3SF 2ZH9A 5J2DA 2P9SB 3MEDB 1T6CA 3NGSA 5L1MA 2KT5A 1AROP 3HWTA 5AI0A 2KMDA 4M5GA 1U6ZA 2ZTEA 1FT8A 3MEKA 4I69A 3CD5A 1DT9A 3SQ1A 2F63A 3CCWA 2HHVA 3VQQA 4KFBB 1W2BM 1R8CA 3CFPA 5ETTA 4DCOB 3MPDA 4P4OA 5DJBA 1R27B 2OPPA 2VFSA 3AJDA 3CCZA 2BM0A 3L95X 5TKYA 4WKRA 3OTOJ 3H0LB 5AQXA 2R7SA 2O4GA 4FWRA 2BJEA 1OH5A 4DTSA 4C8YA 3KTQA 2LM4A 3OL9A 2YKMA 4A5BA 3PG9A 1RTHA 2NYHA 1U8WA 1X7VA 2H3FA 2PIIA 2PE8A 2ZG6A 4QBUA 2XVTA 1N36F 4O3PA 2DFLA 2E5SA 2VIXA 3CCUN 1EWQA 3UQ2A 4CO0A 4LBIA 5LL6d 5ALKA 3QFUA 4CRJA 1IIPA 3WXIA 1A6LA 4NX9A 4LF8J 3DOLA 4IYQA 1DOQA 1BPZA 1FXRA 4MEXA 3QATA 5KI6A 3MPWA 3MD1A 5KFXA 2CZ9A 2FHOB 3IFRA 4GY2B 3VTHA 5AE2A 1T3NA 2HKEA 3SK3A 4PL2A 3N5FA 1KN6A 2CNNB 1VQLN 1WG5A 5DQGA 1KDNA 5ALVA 1HBOB 2MPUA 1GEHA 1ZBSA 1NGBA 7ICRA 1ZBLA 1JLGB 3V7KA 4GMKA 3R5AA 3CIZA 3ID8A 5A6PA 1KQSR 1RG6A 5ETPA 1D09B 3OXFA 2HBYB 3NMUA 1LW2A 3BH7B 4OX9F 3ASMA 2ZIVB 1RGIA 3DM2B 3CJ3A 2DCLA 3EJMA 1F5SA 2NS1B 4ICLB 3J81U 5CA5A 2BE2B 3DCAA 4DFMA 3QJJA 4H4MA 4DR3J 4JYAF 2J76E 3QBXA 4QWBA 1Q7LB 3DDHA 1HKBA 3EDRB 5CZ2A 4GVBA 4MHVA 1LOUA 3M32B 3VQ9A 3DU5A 1K8AO 5DB8A 4G9ZA 3RU0A 4EGLA 3L8BA 1TK0A 1GTHA 2C3MA 3J7A1 3DLRA 2B6AB 3SAHA 1C1CA 2W7OA 3DOMB 3KXDA 3ZI4A 3T5JA 1SUQB 2WRMA 4CO3A 2PFQA 4F02A 4NYNA 3S9HA 3GV5B 2KFZA 1PVQA 4QZGA 3IBFB 1YXQA 3EO3A 1DK2A 2FC9A 3BDPA 4RUHA 3K5NA 2BRKA 3GR1A 2RT3A 3DDIA 2X6SA 4S0MA 1RADB 1WCLA 7ICTA 2W3RA 2H48B 3N4MB 2YMLA 3N6NA 1TAUA 1I3OB 2HSZA 5D4PA 5J0PA 3SV4A 2EANA 2EAOA 2PSZA 1QY7A 3VQTA 2R8HA 1XK8A 1B0TA 3NG8A 2UUCK 1RHUB 2LBOA 5CE3A 1VK0A 4L3NA 4YN3B 1KFTA 4HTUA 3VEZA 8ATCB 5KFWA 2M4MA 3HVWA 3R5JB 1B22A 1ZD4A 4IJNA 5AKXA 5L9NA 9ICXA 4IOCQ 2VBZA 5J2NA 1VJWA 3ALRA 3C5GA 1KVIA 2XCPA 4R0JA 2FJXA 1FDNA 1RWMB 4OJPA 4YHHJ 4F71A 4DR4K 4DV0F 4M3TA 4IEEA 3M2RA 3G6EN 4CH1A 4K0KF 3JTOA 3TA0A 5KQDA 4Z94A 3AEVA 1O08A 2MQPA 3VGSA 5BRHA 4PH5A 4HEA9 3ITHB 2D6FC 2WONA 5KGWA 3JPRA 3A3OB 2H51B 5J2MB 2AJ4A 3F0NA 5G0RB 5KPRA 3K5OA 1W7AA 3C2MA 2L41A 1UVLA 3QO9B 4QAGA 1NSQA 4O3NA 4R8UB 1F3FA 5CZ1A 2EVZA 2IHMA 3CCMS 4FJHA 4B3SK 1NZPA 4ES1A 2GO7A 3D2NA 3SCIE 3H98A 4O3MA 4JKGB 5AIAA 2F96A 3LVWA 4QU7A 4DV3F 4TQRA 4ZPCA 3EPIA 1NJXA 7ICOA 3NY0A 3CM5A 4IQUA 3BS7A 1NGCA 5AI6A 1S6UA 1JWWA 4P4PA 1HD1A 3U1MA 4KLUA 3BSCA 4NWBA 2XHBA 2EDUA 2EFOA 4K4ZA 2J0SD 3ULEB 1Z4OA 2BQRA 2NO4A 5A0YA 2F7VA 3SMSA 3LYSA 1JNRB 1FXLA 1ZBUA 2EWSA 4X65F 5CZVA 3WEEA 1S6QB 2YH0A 3TUZC 1CC7A 2GAHC 4CM0A 2F1FA 5A8KA 1C7YA 1A0OB 1YJ9S 2MQNA 3JQMA 2CPJA 3JTNA 2P9LA 2JEFA 3MN9A 2A40A 3MAQA 3MXHP 2DK2A 2AXTU 1X5TA 5DLFA 2PMHA 3AA3A 3F2CA 4KN4A 4GXJA 3IP0A 3Q8YA 1MMNA 5C2GA 5CEHA 4CW7B 1LWEA 4UZBA 4YOXA 2RQ5A 3TAQA 2KH9A 3E01A 1EETA 3W9HA 1FRHA 2ZXHA 1AA1B 2ZUDA 3D68A 4KITB 2F7TA 3CJ0A 4UATA 4LRBA 5KG5A 1L5UA 5JVGL 4UY8T 3MR7A 2GV1A 3EGVA 4DR6F 1VQOS 3LZJA 3PW4A 2GWKA 3WC2A 4CEQA 3AQOA 2PA8D 3ZZPA 1R8HA 1VQ8S 2WB1F 3QAEA 4AFFA 3SNNA 1R6VA 2JHEA 2PMZC 4HAIA 5AQJA 1TELA 2RP5A 4LF5F 3MDAA 4QR2A 4QCLA 4NLZA 2QMXA 7ICNA 4NLGA 3H8SA 1EZZB 3AVKA 5J0SA 1B70B 4OX9K 2RSQA 1G15A 4EMDA 1MA9B 4JI2J 4FJ5A 3KLVA 2AP1A 4NCAA 4Y2JA 5EUHA 2LCWA 4O4GB 4B3RK 1JXLA 3UE5A 3JPOA 4JYAK 2A1SA 3KK2A 1EB0A 4FXVA 1RILA 5BR8F 2P66A 1J6ZA 2E1ZA 4NZ7A 5AZIA 1BO5O 3QBCA 2DISA 5AICA 1COOA 2BV3A 3QUCA 2U1AA 4DX7A 2HVZA 1B4FA 3OFEA 4NLDA 2ZBIA 2D3ZA 3QT5A 4JI4F 5J0RA 3IS9B 5BPNA 5AQSA 3A5NC 3C2LA 3HM8A 3MUMP 4O44A 3SV3A 1N5TA 1HPZA 3Q8RB 3PNIA 4ZVGA 2QA1A 2FZGB 3HILA 1RT3B 1NAQA 3US5A 1K0TA 4F72A 2A42A 3UVJA 2FLLA 1ZQWA 3QINA 2CYYA 4OI2A 2ZIWB 2E2PA 4B3MK 4UQGA 1PVRA 2DGOA 4TN2A 3ZDEA 4IFYB 2ZE2B 3R6MA 2W8KA 1UVMA 4KGVB 3CJCA 3NCPA 3L7UA 4A8EA 3GJTB 2X1GA 5IC6B 4H5WA 1WSEA 3R6GB 4O5FA 4F4AA 3S1TA 4WQ5A 1BPYA 3H90A 1OH8A 4X62F 4CCHA 3G0ZA 1VRTB 5LXRA 1HMVA 2ZD1A 2ZKTA 1IWAA 3KK3A 4MMOA 3BP8A 1UW9A 2UYTA 2JWNA 3ISBA 3MWTA 2A3JA 4KLGA 4JEPA 4X66K 1AQ6A 4B9VA 1RBLA 3UFCX 1X4EA 3TTCA 1WOPA 3UD3P 3RF9A 2LYBA 1XQIA 3KD3A 2NSCA 4BRCA 4DV0K 3NBPB 4K0KK 2QLXA 4AQYJ 1N32K 1RWPB 1TVRB 5E7OB 4F5NA 1KSPA 2FUG9 4A48A 3T3FA 3QDKA 2W9BB 2HVHA 4IKAA 4RW7A 1S22A 1SZHA 3NF6A 2PFNA 1O8BA 1WN7A 3TQ1A 3PSFA 5LMNF 2FMQA 4PHDA 3AY0A 4KLDA 4NCBA 4I4BA 4I9QA 2FJAB 3RRGA 4RJVA 2VQEJ 2HWTA 1J2MA 4YQWA 3B6BA 2LQ9A 2E88A 4RT3A 4J8FA 4DR1K 3NCIA 4GV6A 4DV3K 2DGZA 2CZ4A 5TZVA 3I6PA 5F2RA 1IBKF 3FSYA 3TTFA 3M5RA 4I2AA 3LA0A 2RUGA 4IL6U 3ISDA 2VICA 4EBCA 5E84A 4RBTA 4KHNA 1U1PA 5KL1B 4QZVB 4CZMA 3PCOB 4IXCA 4X65K 3TAPA 1VJ5A 3AO4A 5KFBA 1UPMB 2VBYA 3NS7B 3KFUF 1UT5A 1BG3A 1VQ6S 1HUXA 1WSVA 2FI1A 4MQ3A 3QJLA 1S97A 4I2PA 1OXJA 1QVFR 2GBZA 1V6HA 1Z26A 2GGPB 1S0OA 2CQ1A 3PJWA 2HSTA 3WKAA 2CZVC 5KGXA 2EW9A 1HHQA 3NGIA 4KV8A 3HSDA 3GZFA 3CJKB 3T6BA 3TJAA 4CLLA 2EH9A 4OI3A 1BPBA 2BCQA 3GSDA 1GLCG 2P6SA 2RH3A 3ILIA 2HIQA 3CCVN 2WUSA 8ICMA 1RNHA 2WBMA 1S72N 4P74A 1KVKA 2GV9A 1G2EA 3A1YG 5HMMA 5T14A 2XNQA 3Q8QB 2FBTA 2W43A 2QWNA 2K3IA 4QWCA 3LH2S 3GTYX 4DR6K 1YRUA 3S3NA 5DDOC 4XPEA 4PGXA 1YJVA 3V4MA 4BGAA 3CULA 3GJSB 3L4BC 1IBLK 3IA0A 2D3OR 1T8EA 3H5SA 4WE1A 1V9PA 4ED8A 1CQMA 2YPZA 2ZFHA 3I8BA 1Q9XA 3CJSA 3QYYA 3GG1A 4BRIA 2EBGA 3OYLA 1LWFB 4IG3B 5ALZA 2HMIA 2KSOA 3M8SA 4CJPA 5A2QO 4O5CA 2O8EA 3MM6A 3N4WA 3VWSA 4NA1A 4ZVTB 1WDTA 2VQFJ 3OYIA 5D6GA 1U9LA 4E98A 3DDKA 3J81j 3CD0A 3EY1A 3D0HE 1WHVA 4DN9A 1S57A 3KZXA 3O9QA 1B3TA 3UCZP 2ASJA 1FJEB 5BR8K 4C9DA 1J5OB 1X4HA 1YTAA 1H0HB 4PUOB 1V3RA 3IN5A 2HLTA 1RGVA 5JVHL 2DBBA 5LSOA 1CJKA 4PWWA 4IH6A 4KR0B 4MN4C 3M9OB 3L0QA 4ED6A 4JI4K 3WX4A 5A0LA 4DZ6A 5FROA 3MMCA 5D4BA 2XB2D 3QAUA 4JD2A 3WQUA 4M3ZA 1CC8A 1C0TB 5GTHU 2BA9A 2HQIA 1L7MA 1MLAA 2Q1LA 2ILZA 4ZVOB 1RM6C 2O4IA 4QR1A 1YDLA 3W3SA 2W55A 2VFVA 2K4EA 4IG0B 5FPEA 1S1UB 3O0FA 2R18A 2X1BA 3PUFA 5B66U 2LQJA 4IDHA 3ZD8A 3UCGA 1QSSA 1DRZA 4FZXC 3HT3A 3KG1A 1WG8A 5CB1A 1O5JA 3P5BP 4KH6A 1SVDA 1GAOA 1VRQC 4X62K 4RZRA 3WC0A 4ES3A 1XR6A 1KOHA 2HQCA 1WUAA 1U2FA 2Z2MA 1NKBA 1ZOLA 3KHYA 2X1FA 2P9SA 3LP1A 3RBXA 2X3GA 3KBBA 3VQBA 3RAQA 5KFEA 1FKPA 1VQKN 2E5HA 3E58A 2WHOA 3ILOA 3CCJS 2NSBA 5ETNA 3IDHA 3MGJA 4ECTA 4LIWA 4FK0A 4OKJA 1JI7A 3ISND 3GDQA 1L3VA 3QYPA 4P2FA 3K2YA 2ERRA 4Y2QA 4O3SA 4HLBA 2D9OA 2D1KA 3MAAB 3MMAA 2A1BA 3DWLA 4US9A 1SCJB 2AV5A 4KPCA 4ER8A 4WZMA 4ZMMA 2AHOB 2RQCA 1CXUA 4OYWA 4CZLA 3V81A 2D0CA 3HJEA 2R2RA 4LJMA 1N60A 1J27A 1CUKA 9ICQA 1Y64A 2AKWB 2VL1A 1YJNN 1JQGA 1L3TA 2A1JA 4BXOA 3AARA 2YKAA 4I2CA 4Y2IA 1IBKK 1QCKA 1URJA 1VQ9N 4KX3A 4ILRA 3MN7A 4RNFA 1X40A 3GILA 3C5FA 2Q6CA 2FVCA 4YNQA 5L8RC 4BVPA 4FLZA 5F8LA 5L1KA 3NMAA 3OS2A 3OSNA 2OTLS 4V19X 3NRWA 4JV0A 4J9MA 3CT9A 5KT5A 1XR7A 1ZQHA 2OPQA 2DPNA 3WXJA 4MF2A 4H0OA 2R7YA 4C11B 3G87A 1HBOA 2OZMA 1F9EB 2W3SA 3FKBA 3SQGB 2D0BA 4I2HA 4XA5A 4J2AA 2VANA 5D49A 1YVNA 2K4HA 2LPEA 4B3SJ 2F8TA 1WNEA 4QZHA 9ICUA 1NGHA 3ZD9A 4OJ1A 4RQNA 3LO3A 4DSJA 3U1NA 1VOMA 4JI7F 3PLAA 2O8CB 3W2VA 3FQKA 3AVGA 3M1FA 3UB5A 3HT0A 1OQ3A 2BXJA 3H0PA 4UY8O 3EGNA 2ZM6J 2GUIA 5BPMA 1C6VA 2P9IB 5F8MA 3TADA 3CPEA 3W5ZA 2CQDA 1BIZA 1IKYA 3FFIB 2DPJA 4H5TA 2JGAA 2I6WA 3WKEA 3CO0P 1JL2A 1PK1A 4K4VA 1M1KT 3HO1A 3HVRA 2B6AA 2LKZA 3D4JA 4D3GA 2OD4A 3O3GA 1RA7A 3S3OA 1VCTA 3AA2A 2F8EX 5G5HA 1R89A 1M5OC 4JV5F 3SQ4A 1BVSA 2XZTB 1N36J 5F3XB 3ZEUB 4M04A 1YZ6A 2RUSA 4IWVA 1GOCA 1SJRA 1MN7A 4P71A 2PT0A 3SR6A 2KP7A 4USAA 5GVQA 3W62A 3KG4A 1NSKL 3CMAS 3EUB2 2IHNA 3HF5A 3WNEA 2MAXA 1SAZA 3J7AN 2DHXA 2CXYA 3HDSA 2KKHA 1WF1A 1S1XA 1WUDA 1SC4B 4DTUA 1KTQA 2KLAA 3CWJA 3ETOA 5C5JA 1DKGD 3ZTOA 2ZH1A 3QICA 1BPDA 3KKFA 2NZTA 4AHSA 2CUYA 3EVOA 3VESA 2HBRB 2VPXB 9ICBA 1X42A 1NJWA 4OX9J 1LW0A 1IBMJ 3GIRA 2KG5A 3VF2A 3JYTB 5AK6A 4BC5A 2IOHA 1YITN 1KAYA 1T7PA 4C97A 1QLNA 2C1EB 4OYOA 2ASDA 2KE7A 2QJ3A 4BE1A 3CDWA 2F9DA 4QJVA 4DHYA 5J2MA 4CYUA 3RBEA 4FJNA 4ISGA 1QTMA 3R5CA 1BL3A 3QNWB 4R8UA 5F0XA 1EQ0A 3D7SB 4RU2A 4DV2F 2B9WA 3RJMB 4QZIA 2XZDB 1LFPA 4LF7F 4AL7A 3MBYA 3KJVA 2E1PA 1BHLA 2DT9A 1TVAA 1VQPS 2V4QA 1M5PC 5KG3A 2A18A 3A3NB 4OJOA 3EDQB 2QLBB 3O5BA 2B51A 2KIVA 3DRXA 1VDHA 3BN7A 2IJRA 1VFJA 3ULEA 1RAGB 3BB5A 3MDFA 3C46A 4F2RA 4UBCA 5LY3A 2VV5A 4RW6A 1ZPWX 2RDDA 3TNVA 4M5JA 2FLNA 1BNOA 3A5LC 1QSLA 3AU2A 2YQ3A 1U2CA 3BSOA 4ZN1A 2YH1A 1BI4B 4B8AB 1K1SA 4FWMA 3KD5E 1T9XA 2VGMA 2E5IA 4QZ9A 3MM5B 1SH0A 5DRKA 1RP5A 5CD4H 3SMZA 2XC9A 5D3GA 3DFEA 3ICXA 4JK8A 2E7VA 4DR2J 4DL6A 2HYIB 3ORYA 2KZ3A 4HACA 2JHDA 5D4LA 2RIJA 5DDPC 3GJRB 3G9CA 1HBNB 1T11A 1VC6A 5BN9A 4USUA 1TQLA 4KBIA 3QMLA 3QRQA 4NMXA 1KAZA 4YDDB 1TR0A 1ZQXA 3NKYA 3AQFA 5FD1A 3DXMB 1RT7B 1YJUA 4LF1A 1VAZA 3TVZA 1WTBA 2JVOA 4Y2TA 2IM0A 4ZVSB 4RNHA 1K0VA 2L48A 1NEEA 1XMQK 3H5XA 2JNJA 1JB0C 4K2XA 2DGTA 3I8DA 4PG7A 2ASYA 2WAQD 2ZUGA 1W9HA 4CO4A 3JAMO 2KN4A 3F9KA 4JI7K 4DV3J 3UN2A 5GADU 3IDWA 4LFBF 5FLXY 4Q0BB 2HOIA 2V34A 1OVQA 3MEEA 5C24A 8ICXA 2MSTA 1S79A 1H6KX 2JLFA 2CVEA 1H38A 3W3DA 1Q8LA 3IHQB 4L3QA 2Y1JA 4QIWC 3Q89A 3ZZOA 3RSEB 8RUCA 3TWHA 5ADXA 2MMYA 2BCUA 1RYUA 5LSRA 5FJ4A 8ICLA 1U1OA 2EPIA 3MMBA 4USTA 4OLPA 4PY5A 3GFKB 2V69A 3IS9A 4WTYA 1I94F 1DARA 3I9V9 4JV5K 2PN6A 3Q2TC 1KL9A 1G99A 4B9QA 4CJLA 1H98A 4LSLB 1FFUA 1VRUA 4XDCA 4CLZA 1JKHB 3ZTQA 3IWXA 3LDSA 5AKJA 1JCFA 3D3BJ 2W03A 4FJIA 1MU2A 2K8AA 2DIVA 3G82B 4UQTA 2F8MA 3KMSA 4H0PA 1T94A 3QIPB 2DNRA 2ZE2A 3HVTB 2LKYA 4PQUA 2XO6A 5AQIA 2HBKA 4CTAA 2VKZG 4NEYA 2AX0A 3AAQA 3O08A 4FKYA 2XM3A 5T7BA 2IA6A 4CH0S 4DR6J 1RTDB 2KJVA 3PIPL 3D1HA 2VG7B 4FK4A 1NNEA 2QM1A 2FLOA 2HFUA 3CGIA 3NAIA 1OH6A 2PFDA 3W8GA 1RHQB 5HLFB 5I9EB 4BACA 4DMZA 5KOWA 5E79U 4LF5J 3W1YC 3TSQA 4QS8A 3ETRA 2YKNB 1SL0A 2JWLA 1HQUA 4F5OA 4JI3F 1WKLA 5AQNA 3ZT1A 1ZOTA 5GINA 1RWVB 3KG0A 2OFHX 3QT7A 2IAJB 1NMEB 4M5LA 4DV6K 3M8PA 1HWKA 4JKEA 4UB5A 2AW0A 2QA4S 3MR5A 1SWVA 2ZKUA 3LM9A 4M3RA 2ZHAA 4CJ5A 2Z1GA 2KI2A 5MAOA 4NXMF 2W9BA 4K8RA 1YK9A 2FYXA 2YQ0A 4CGFA 2MY7A 1MN8A 2KKVA 4NM2A 3GG4A 4YB5A 3GL1A 3KKAC 1SH2A 3MUTP 1NUEA 5AQLA 4X64F 1VQNN 1ZQBA 3H2VE 4DV2K 5EE9A 4O3RA 3UNYA 1FKOA 2UUAF 1Y10A 1XNQF 4LF7K 4Q7AA 4XH5A 4JI4J 4JLHA 2FMSA 3PYFA 3PTWA 4K4SA 3IWLA 3M6ZA 2YMPA 4N77A 3KHRA 2BZ2A 4ECXA 3T5HA 4WIQA