4B9MA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-da dna lesion -thymine basepair in the post- insertion site.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
molecule tags Transferase/dna
source organism Geobacillus stearothermophilus
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9mA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9mA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9mA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9mA01
1RTDA 4KLMA 1GOBA 2YNHA 3MFHA 3BGRA 3JPPA 4YNQA 5DDMA 2OZMA 1S1XA 7ICUA 1ZETA 2GV9A 3MBYA 5KFWA 2HVHA 4FJKA 4JK1A 2BQRA 2BQ3A 4KLIA 3MEEA 1C1AA 5J0OA 4FJJA 4RQ0A 3AO2A 4HUGA 4F4XA 2KFNA 3ZDCA 4J9MA 5J0QA 1BI4A 4CJUA 3F73A 1KSPA 4NY8A 7ICRA 2I9GA 4IBNA 3VQ4A 3NGZA 3F9KA 2QKKA 2F8TA 5KG7A 4RW7A 5KFPA 3QEXA 4W5TA 4O3RA 4DF8A 4Z4CA 1TL3A 3H8JA 4FJNA 4B8AB 5D4BA 4M3YA 4FZXC 3H4DA 7ICOA 4M45A 1NKEA 1JN3A 4KLLA 4EBDA 5KT4A 4CHQA 2KZMA 2ISOA 2HHUA 3T5LA 4DMNA 1HUOA 1WSEA 4AH9A 4DOCA 1IKWA 1JLCA 1BHLA 3BQ2A 4CHYA 4JUZA 2ATLA 8ICMA 4YR2A 1RBUA 1VSJA 3LALA 1SKSA 4E7HA 4QWDA 4MF2A 5FDLA 3KHHA 1S9EA 1SV5A 4W5OA 4KHSA 3PO4A 4O3QA 1C0MA 3AVFA 4ECZA 4DFKA 4KLHA 4RQ1A 4DG1A 4FZYA 1VRUA 3CM6A 5KFBA 3SV3A 4DF4A 1TKXA 4W5RA 2KN7A 1V9PA 4F5PA 3MGHA 4YG2A 2XCAA 2YHAA 3RJFA 3JPTA 2ASJA 1FKOA 4LSNA 3DOKA 4AHCA 4BXOB 1XHXA 5F9LA 3ZSOA 5J0PA 4I2CA 2IS3A 3OYLA 2UVRA 3PMNA 2VANA 3MXMA 2HHXA 1QHTA 8ICIA 2KQ2A 4YXMA 9ICXA 3RMCA 3Q8PB 1RTIA 1ZQWA 2YV0X 2ASDA 3OJUA 3PNCA 1CLQA 3SQ4A 4JRPA 7ICLA 1RDDA 1ASUA 3OSNA 3RR8A 4IQWA 3MFIA 2RN2A 1A5XA 3OYDA 3VQ9A 4I2JA 1BISA 4IRDA 1BCOA 1WSJA 3KJVA 4FM0A 4BACA 4FJ5A 1KDHA 1JXLA 3V4IA 3SQ1A 8ICRA 5KFCA 4QZDA 1X9SA 4NCBA 4TUQA 3M9OB 3GIIA 4M9HA 3H8SA 4F3TA 8ICWA 5J1EA 2H5XA 2C22A 4Q44A 4P4MA 1NJWA 3PW7A 4BE2A 1LWCA 4JS4A 3DLEA 4Y1DA 5J2BA 3EYZA 4CJSA 2HVIA 3HP6A 2PFPA 1ZQCA 4Z6FA 5IILA 3NH0A 4MEXA 4FM1A 3C21A 1RBRA 5DG8A 2A1JB 4M6WA 3OYGA 4JLHA 2XO7A 5DB9A 3BQ0A 1L3VA 4CF8A 1HYZA 3C5FA 1EP4A 2NRXA 1QQCA 4CGIA 4FLTA 5DQGA 3NGYA 3FYHA 1VSDA 2LSNA 3QZ7A 4KI6A 2AGPA 1KVAA 4PPXA 1HMVA 4O5KA 2BQUA 5KT2A 2AJQA 4CJWA 4CEOA 4ED1A 3VQPA 4F5NA 4E3SA 1XSNA 5DMRA 4AHVA 4OLBA 2F96A 1UA1A 4F8RA 3UQ0A 8ICBA 4O5CA 3DOLA 4YCXA 4C8NA 4IR9A 2YNFA 4RW4A 2NRVA 4N41A 1ZQHA 2PY5A 2D5RA 3K5OA 4H8KA 4OKKA 4RT3A 1RDAA 1S10A 3TAPA 2OZSA 5BOLA 1A76A 3ZSXA 2XGPA 2PFNA 3DM2A 1TKTA 3LANA 2BANA 2R8JA 3VQ6A 4ED8A 1L3TA 2B4JA 3SJJA 1ASVA 4IKFA 2F8SA 4O9MA 4QZGA 4GXIA 4TUPA 1SL2A 9ICAA 4YMMA 1Y97A 5TZVA 1NKCA 3GIJA 2BCUA 5JS1A 2W8KA 3Q8SB 1H38A 1S9GA 1W9HA 1JXBA 5HRPA 3HPGA 4CF1A 2G8FA 4ELUA 7ICIA 1MQ2A 1ZQGA 2HNYA 4M41A 1QE1A 3OYFA 2ZJAA 3RMDA 5D49A 5EWEA 4KLQA 4R63A 4R8UB 4ECUA 3C23A 5KFUA 4YD1A 1T05A 4H4OA 1DTTA 1Q8IA 4FJ7A 1KTQA 4DSJA 3HT3A 2HNDA 5J0WA 3M8RA 1QLNA 4OPKA 4LSLA 3QESA 2JEGA 1JLBA 3LK9A 2RKIA 3RB6A 4CHNA 4BE0A 3NH2A 4P4OA 1RZTA 4ZH4A 5CYQA 5KFMA 5KFRA 9ICCA 4FJHA 4F4ZA 4IRKA 4KLUA 2AGQA 1XSLA 1QSSA 4KN7A 3KHLA 4F5RA 2PI5A 3CG7A 9ICGA 4C8MA 9ICLA 2YNIA 1BPYA 5KGXA 2G8IA 1WSIA 3DLKA 2XRIA 4NLKA 4PQUA 1ZQJA 4F2SA 4KI4A 1I3AA 1TKZA 1Z25A 4N76A 4F2RA 2P51A 4KB0A 4PY5A 1N48A 4I27A 3SCXA 2BPFA 5KT6A 3NF7A 3GQCA 3QERA 4N47A 3TAMA 4XIUA 4CFCA 2JLEA 4IR1A 2V4RA 2P1JA 4OKJA 3L2RA 1XO1A 4Z4GA 9ICJA 4CJ4A 5HP4A 5KFFA 2JZBB 4FJ9A 3MEGA 2C2RA 4DFJA 3ITHA 2QK9A 3PR5B 7ICHA 4NXZA 1BQMA 4DL2A 1BCMA 3DRRA 4JV1A 9ICOA 2EHGA 3NF6A 3V9UA 5D3GA 2FPKA 4IQTA 3KK2A 4B9LA 3OYHA 5EOZA 3SUOA 2IDOA 1RTJA 2IGIA 2OYQA 4PGXA 1JLQA 2BHNA 4ECQA 5KG4A 3B0YA 3ISNC 3SI6A 4CF2A 3B6PA 1VSKA 2Q0ZX 4Z6EA 5CA7A 1XWLA 5DGAA 3TARA 2ZJ8A 3PY8A 1TK5A 3JPSA 1K1SA 4TSXA 2C2DA 2DPIA 1NJYA 2BPGA 5DBCA 2JZBA 1RCHA 5CYMA 2NRWA 2XCPA 1BVSA 4EYIB 4M3TA 4CIGA 2W9MA 3NBPA 2HB5A 4ED3A 5IIKA 1T03A 2VG5A 3TQ1A 1L5UA 4BDPA 2G8UA 2BGWA 4Q43A 4FJLA 3UPQA 8ICEA 1RYRA 1RT3A 4E1MA 4W5NA 1DTQA 3K59A 5DG7A 1JLFA 4RNNA 4GXJA 3MAQA 4ED2A 4IDKA 4BWJA 1KFSA 2V4QA 1WSFA 4J2EA 4EYHB 3RBDA 4TQSA 4BGDA 3K4GA 1S77D 1ZQTA 1S6QA 4CFDA 1ZQQA 3EWAA 3M8QA 2ZD1A 3G0ZA 5DKWA 4FCYA 5KFSA 2R7YA 3T5KA 8ICNA 8ICGA 4J9RA 3AVCA 4M6WB 4CEZA 3JPRA 7ICJA 1NK6A 5I42A 1UWBA 4JS5A 4HCCA 3UXNA 1IH7A 1TK0A 4RW8A 4CJKA 4CIFA 4YD2A 4NLZA 1WSGA 4DSLA 4ELVA 5D46A 3EW9A 1S76D 1NJZA 3PV8A 3HXMA 3JYTA 3HO1A 2OPQA 4OJRA 1BL3A 1N6QA 3V81A 7ICTA 3SQ2A 3QO9A 1EXNA 2AQ0A 4FO6A 3RB0A 4BDYA 1S1UA 4CF0A 3SI8A 4DWIA 1HJRA 5C24A 4O55A 2ZE2A 8ICOA 4O5BA 3MDAA 5J2QA 4KLOA 4Z4HA 5DB7A 3MABA 3ZD9A 2IMWP 3AVMA 2HMIA 2WOMA 3C5GA 3HVTA 3BQ1A 3ZT1A 9ICSA 4ECSA 7ICNA 1EX4A 3AVBA 4MFBA 3RMBA 4H4MA 4FJ8A 3QNOA 4B9NA 4E7JA 3UXPA 4JV2A 5C25A 5J2IA 4JRQA 4DS4A 3GIKA 3LAMA 1N5YA 5HROA 3TANA 3C95A 3JSMA 4AILC 1DOQA 3KLHA 2Y1IA 5IINA 2NUBA 4I29A 5EWGA 1SZPA 4DQPA 8ICKA 4DTJA 4FLXA 2R8HA 1D8YA 1L3UA 3QINA 3RAXA 2Z1JA 3UQ2A 1WCLA 3WNHA 4E7KA 4KTWA 2WTFA 4GLXA 2R8GA 3I0SA 4KKOA 4PGYA 5J2NA 4ECRA 4M3XA 4Z6DA 2HHSA 2W9AA 4CFBA 1BPXA 4QZ8A 1I39A 4DU1A 4P4PA 3PVXA 4DTSA 2QXFA 3RJJA 4KTQA 1WNSA 2RPIA 3SPZA 1NKBA 1HQEA 3NDKA 3VQDA 4KB1A 3H8WA 3ZSQA 1Z00A 4KAZA 1KRPA 2DFHA 2FBXA 3I0RA 3WNGA 4PHAA 4RQ2A 4I2IA 2BE2A 1RXWA 1TAUA 2GBZA 2MAXA 8ICJA 3MDCA 4FYDA 2Y1JA 3ISBA 4IRCA 1ZQLA 3DLHA 1EXQA 2KTQA 4FJGA 2ZUCA 4MFFA 4KREA 1ZQVA 3O3GA 5FRMA 3LDSA 3N4MB 9ICRA 3DLGA 1DGSA 9ICQA 3U6FA 3K5MA 4CERA 4CK2A 4I9LA 1BI4B 2X74A 4DOBA 4KLFA 4KMUA 1D9DA 3AO4A 1LAWA 2P6UA 5KFEA 1ZBLA 4KHWA 3CYMA 3GV5B 3BJYA 4M0AA 3K57A 2HHTA 4QZIA 3V6KA 4EZ9A 1LB2B 1ZQAA 3H08A 4CHPA 4EBEA 1ZBUA 5DG9A 3AVKA 3M9NB 1Z3EB 4IFYA 1S0VA 4KPYA 4J9LA 7ICGA 3OHBA 2I1QA 4DO9A 3S3MA 4RQ5A 1HJPA 4O3OA 2MUTA 4DQIA 1WAJA 4OPJA 2DY4A 3G6VA 1MU2A 4KO0A 4GW6A 5DBAA 3L3UA 4EZ6A 1JLAA 3ZSYA 3O3HA 4PGQA 4M9LA 1W0HA 4CF9A 1KCFA 4I2QA 2D0BA 5CJ7A 1S5JA 3AO3A 4FBTA 2ZJ5A 1YTAA 4Z4EA 1VSFA 5J2EA 3ALYA 1ZBFA 1HNIA 1QTMA 4KLDA 3JPQA 1RDCA 5KFAA 3ZSRA 3ZSVA 1ZQIA 1WSHA 4ZTFA 5HNKA 1TV6A 5HRNA 2IAJA 2X78A 1FXXA 1ZQFA 4YXJA 3QEBZ 2C28A 1LWEA 9ICBA 1U48A 1ZQNA 4O44A 4R64A 7ICFA 3M8SA 4QZFA 4J9NA 2IC3A 2XGQA 1NK0A 2WONA 2HHWA 4P2HA 8ICLA 3L2VA 3AVJA 3OS0A 5CR0A 8ICAA 3LP2A 3CFRA 1D5AA 3OYEA 5KFYA 4B3OA 1RDBA 4ED7A 4WE1A 3FFIA 3E2EA 1VSMA 2R8IA 4CHOA 4HTUA 5J2JA 9ICPA 3KK1A 1MC8A 3DI6A 4Z4IA 3IG1A 2DPJA 1J5OA 4E19A 4HUFA 2OPRA 7ICQA 3HPOA 3MXJA 4J9PA 2R8KA 1IKYA 4YVZA 3ASMA 4DFMA 3NHGA 2VWKA 1U04A 3TAQA 7ICVA 4NLNA 1U9LA 4DSKA 3VQ8A 3QEIA 4I2DA 2J6TA 9ICWA 5IIMA 3VA0A 3C1ZA 1B9DA 4DSIA 4IQUA 1Z26A 1VSIA 1TL1A 2V9WA 3RH5A 4CGFA 1Q9YA 4PH5A 2FBYA 3AVNA 4ECYA 3LAKA 2P5OA 4UBBA 2LYHA 3M8PA 4NYNA 1BPZA 3G6YA 4HHTA 1J9AA 4I7FA 2KZZA 2OPSA 2UVWA 3RJGA 4M3ZA 5J0XA 5HHIA 4AHTA 3SPYA 5KFKA 9ICFA 2BGGA 2PFOA 1RTHA 1S1TA 4RUCA 5IIIA 5L1JA 1ZJMA 1YVUA 4FW2A 5CWRA 1J54A 4O5EA 5HBMA 1BIZA 2PYJA 5KG1A 4M42A 1RYSA 3WNEA 1CZBA 4K8XA 1WCNA 4F91B 3L2QA 4TUSA 1F21A 4TURA 5DQIA 2C2EA 3UIQA 2BCVA 2DFLA 3HP9A 4E0DA 2F1JA 1S1VA 2FLLA 5IIJA 3DLRA 2BCSA 3Q8LA 2GUIA 9ICIA 1B92A 1LW0A 4FS2A 2RF2A 3C94A 3VA3A 2FPMA 4CCHA 1HPZA 9ICNA 1KEJA 5EWFA 4CEEA 1YTUA 4FLWA 4CJPA 1DLOA 2VG7A 4Z4FA 2PFQA 1N56A 4I9QA 4CGHA 2HW3A 4DQQA 3D0PA 3MR6A 3C6UA 3QNNA 3ZDBA 5KFZA 1EETA 3AO1A 3LZJA 3C2MA 3NAEA 2VA3A 5J2MA 1S0MA 4KRFA 2FBTA 4G3IA 3PW4A 3NFAA 3A2FA 3AU6A 4K4GA 4NLGA 4HYKA 5KGWA 4B8CA 4DL7A 4YQWA 4CECA 2A1SA 3H7IA 4PA1A 4ECXA 4FLZA 1X2IA 4YN4A 5J2CA 4R65A 2AGOA 4RG8A 3HVRA 3QLHA 4XRHA 4F50A 4I2PA 4KLEA 1KVCA 4QAGA 3GFKB 4EEYA 3RH4A 4CK3A 5CHGA 5SZTA 1TKDA 4N56A 4DL3A 3AUOA 1X9WA 5C5JA 1BPEA 1BQNA 4FLVA 5J2DA 3UXOA 3TABA 4YP3A 3M9MB 4RT2A 3P5JA 5C42A 4F93B 4I2AA 1RT2A 4L8RB 3QETA 4DU4A 1ZQZA 3ZSZA 4DLGA 1XC9A 1HRHA 3KHGA 1UA0A 4F4WA 4O0JA 8ICFA 3DMJA 2B6AA 4EP4A 4RNOA 4E89A 3CFOA 1ZQYA 1JKHA 1G15A 3ISDA 1RNHA 5DLGA 3S9HA 4OLAA 4I2FA 5J0TA 5KI6A 1S1WA 3QZ8A 4RUAA 3ETLA 4UB3A 4UAWA 9ICKA 3ZT4A 5DBBA 8ICXA 5DK5A 3SZ2A 4ECWA 3RJHA 5BOMA 1U47A 3MR5A 3V6DA 3AVIA 3OSPA 3AV9A 4UBCA 4IG3A 1JLEA 4YR0A 3KKRA 4DEZA 1HQUA 2BKEA 1HNVA 1D8LA 3AA2A 4B08A 2XY7A 1U45A 1ZQDA 4C8KA 3QE9Y 4KLSA 1RILA 2XY6A 4J2AA 2IOCA 3RB4A 3ZDDA 1EKEA 2W8LA 4F4KA 1ZQKA 1XSPA 3SUPA 5KG0A 5KFHA 3O4NA 4K4HA 1PZNA 3HW8A 3AA5X 4O3NA 4HVJA 5J2GA 3PW0A 4FLYA 5CZ1A 3Q8KA 2XC9A 1UOCA 3VQ5A 1SKWA 1VSEA 1BPBA 3SV4A 4RQ6A 5KFXA 1B22A 9ICTA 3OYIA 5KTQA 3H40A 1C7YA 3C6TA 4FM2A 1ZYQA 1LV5A 3PX6A 1NOMA 3EY1A 3OHAA 3TWHA 4FK2A 4DL6A 4QWAA 1WAFA 2E4LA 4DU3A 4FJIA 3ZD8A 4ED0A 1XHZA 1RXVA 3RWUA 5BPCA 1LAVA 1NK9A 2X6SA 3T3FA 5KG6A 3RTVA 3HK2A 4O3SA 3T1AA 4KLJA 4IFVA 4BWMA 4DSFA 4J9OA 1D9FA 4RQ3A 4KHUA 4NCGA 4B9SA 3H4BA 1TVRA 1ITGA 2OWOA 4CEFA 5KG3A 3OYCA 5DGBA 4B9MA 3KHRA 4FS1A 1X9MA 2HHVA 4CEAA 2YKNA 9ICVA 2W9BB 3KD1E 4M47A 3L3VA 3IM1A 2FLNA 1NK7A 2HHQA 1TVAA 4BXOA 3OYKA 4B9VA 2Z1HA 3RH6A 4KHNA 4NCAA 4EBCA 8ICHA 3RJEA 3LZIA 3MECA 3KLIA 1KLNA 3MXIA 3D45A 3VQ7A 1YT3A 3I8DA 4KITB 4Q8EA 1C0UA 1AROP 2RDIA 2ZTDA 1IO2A 4CGDA 3HX0A 8ICQA 4DTOA 1RBTA 4F4YA 3VQEA 2B21A 2JEJA 3PW2A 4Q0BA 4RQ4A 4CJLA 4ECTA 1ZJNA 4CIEA 1J53A 4F3OA 2W9BA 4DQSA 1JL1A 1CXQA 4RPYA 4YR3A 3VQCA 4F92B 4ZTJA 1T7PA 3ZCMA 3IRXA 4KLTA 7ICSA 4YMOA 4J9KA 3LDAA 5KRSA 3TAFA 5I3UA 1IKVA 5KFGA 1SL1A 4M04A 4C8OA 3OYAA 2QKBA 3Q8QB 4J2DA 3Q8MA 2GWSA 1CUKA 1MQ3A 1JXEA 3KLGA 1KFTA 3OS1A 3B6OA 3THVA 3OYMA 2D0AA 2YHBA 4O3PA 4PHEA 4QZCA 1JIHA 5EU7A 4CEBA 4MF8A 4CJRA 4NM2A 2VWJA 3JPNA 4DL4A 2FBVA 1A77A 1XU4A 3V1OA 2G8WA 3PR4A 2X6NA 3EPIA 4B9UA 5E41A 1ZQPA 5L9XA 4Z6CA 4C8LA 4DFPA 4W5QA 5KFQA 3AA3A 4ID5A 3OYJA 4AHSA 5L1KA 3IS9A 4UAZA 4M9NA 4R5PA 4DSEA 5DQHA 4E7LA 1KFDA 5HRSA 5J0RA 5F9NA 3TAGA 4B9TA 4DL5A 3OGUA 3RMAA 2ZTEA 4QZHA 8ICUA 1ZBIA 4QCLA 4UQGA 3S3OA 2FLPA 2E6LA 3K2PA 4I28A 1ZQXA 1BGXT 1ZQUA 4CHZA 5HMMA 1GOAA 1TAQA 5KFIA 2VA2A 4DLEA 3K75D 3HL8A 1RT5A 3P83D 4BDZA 1X1PA 3OVNA 1LWFA 3DLBA 3OJSA 2OA8A 3T5HA 1HYSA 1IG9A 4E1NA 4TQRA 4LD0A 5DB8A 4CESA 3VQAA 3PUFA 2PXIA 2A1RA 2W42A 1Z00B 1VRTA 2BPCA 3TFRA 2DTUA 4DTMA 2J6UA 1VSHA 2MUTB 2G8HA 1IKXA 1C6VA 2UVVA 3NF9A 1A5WA 5CZ2A 4G1QA 4M2YA 9ICMA 3V9WA 5DB6A 3LWMA 5KT5A 2BCRA 2KW4A 1ZQEA 1FK9A 4M9JA 3NCIA 4MFCA 1B9FA 4K4IA 3KIOA 3PX4A 3L2WA 3NTUA 3RR7A 4BE1A 1HYVA 2FMQA 4DTXA 1GOCA 4CJ5A 4LZGA 1RBVA 3PW5A 4KFBA 4Q5VA 4MEYA 3BDPA 3PMLA 2F1HA 2P66A 4DTPA 4ED6A 1NK8A 4IG0A 4FBUA 3IHQB 4LH4A 3AO5A 2NRZA 5J0UA 4R8UA 5KRTA 5DDYA 1JMSA 2FPLA 5SWMA 3QEVA 5J2AA 4YMNA 5J2FA 1CZ9A 5KG2A 3V6JA 4JWNA 3QEPA 1U4BA 4X5VA 2IHNA 5J2HA 4UB4A 4PUOA 3ZT2A 1ZQBA 2AQ4A 2BDPA 4PHDA 4QOZB 4I2HA 3QEWA 4QW9A 5KFVA 1UT5A 1BPDA 3CQ8A 3V6HA 1NK5A 4DQRA 2ZQBA 4GVMA 4UB2A 1CEZA 1VSLA 5L1IA 4JWMA 2E6MA 2YKMA 4FXDA 4FZZA 1ZQSA 5KFJA 5HLFA 1L3SA 4ICLA 4ELTA 4UB5A 3HWTA 4DTNA 1NK4A 4YFKA 5KT7A 1C1CA 3FDSA 2OPPA 4N5SA 4F5QA 3TAEA 4HCBA 1A5VA 2XY8A 2PYLA 4LY7A 5HRRA 3SNNA 2RDJA 4KV8A 5IIOA 1R0AA 1WN7A 3RBEA 3E01A 1JL2A 5J0SA 3T5JA 3ZSWA 3AU2A 1TK8A 4NM1A 1JLGA 2JEIA 2EX3A 1ASWA 3V9SA 3PO5A 3G10A 4AHRA 1NJXA 1QS4A 1Y88A 4OGCA 2G8KA 4RW9A 3U3GA 3DYAA 4RPZA 2BCQA 2PI4A 2FMPA 3K58A 4IQVA 4MFAA 1UAXA 5KFLA 1FKPA 3MEDA 4CE9A 3TFSA 1U49A 3S3NA 4OGEA 1T4GA 5CY4A 8ICPA 3LWLA 3OS2A 1COOA 7ICPA 2XY5A 3KLEA 3RB3A 3RJIA 4GXKA 4J2BA 4RW6A 3QIOA 3L8BA 3NGDA 2DFEA 5K14A 3BQTA 1C1BA 1B43A 3LP0A 3AVHA 3ZT0A 1MSWD 3NGIA 4CJTA 1ZQOA 3V7JA 3EPGA 5J29A 3SUNA 2IHMA 3EZ5A 4QWCA 5J2KA 1S6PA 4XA5A 3LPTA 4CEDA 4K8ZA 3ZT3A 4CK1A 2D0CA 8ICCA 4EP5A 2ZUBA 3NF8A 3OY9A 3HPHA 2KFZA 3OYNA 3K5LA 1KVBA 9ICEA 3MR3A 4J9QA 3AA4A 3VN5A 4RU9A 9ICUA 4PWDA 2B5JA 4KHQA 8ICTA 3O4QA 5J0YA 4ID1A 2W9CB 5FRNA 1IXRA 1CXUA 2Q3SA 3V72A 3MR2A 4M3RA 1O1WA 3B0XA 3RRHA 1SL0A 2UVUA 4QWBA 1VK0A 4R66A 4NYFA 3VQBA 3KD5E 1UT8A 4MQ3A 4YFUA 1WLJA 3V1RA 4LVSA 1QSYA 1RT6A 4O0IA 5CB1A 4CJVA 3AVAA 1NOYA 4CFAA 4CGJA 1S0OA 3C1YA 5KFNA 1S0NA 3V1QA 8ICZA 4CJQA 3V9ZA 4UB1A 1HUZA 1TFRA 3SQ0A 3GIMA 3HM9A 4FLUA 4QW8A 4OVLA 3GILA 2I5JA 2VA8A 3C2KA 4GC7A 3KTQA 2FMSA 1BIUA 3TI0A 3L2UA 2J6SA 3T19A 2FC0A 3V7KA 1JX4A 2ZUDA 2W9CA 4KN4A 2VG6A 1TV9A 4DOAA 1RT1A 1XS9D 3LP1A 4O4GA 1RPLA 4AHUA 4ECVA 3JPOA 4GC6A 1S9FA 1ZQRA 1NOZA 3G6XA 2NRTA 3CM5A 4CJ3A 4XUSA 3VQQA 1K1QA 5CP2A 3WNFA 3KLFA 3IAYA 4CEQA 4I2EA 4J9SA 3AVGA 3U3YA 5L1LA 5JUMA 4GMJB 4FJXA 5FROA 2F1IA 3DRSA 2M9NA 5KFDA 2ISPA 3PX0A 4FW1A 2ATQA 3SYZA 4FVMA 1QSLA 5JS2A 3AVLA 3KKSA 5HHHA 2IBKA 3V7LA 5T7BA 5J2PA 4XQ8A 2AU0A 3NE6A 2ALZA 1RT4A 4CJEA 4LZDA 8ICYA 4RQ7A 4FK4A 2KZ3A 2A1JA 2JEFA 2YNGA 4Y1CA 4QWEA 4Q8FA 4DTRA 4OKEA 3LPUA 3RRGA 4RZRA 4KLGA 5DLFA 3P1GA 3RJKA 5HMLA 2Z1GA 4QZAA 2PZSA 5KFOA 3HSTB 4PHPA 4F5OA 4QZBA 3ZDAA 2P6RA 2DFFA 4CGGA 3O3FA 3HYFA 3QEAZ 5HP1A 5KT3A 3LP3A 2IA6A 7ICMA 1K6YA 3N97B 4M9GA 8ICSA 4FJMA 2HNZA 1C0TA 3TR8A 1S97A 5KG5A 9ICHA 2XHBA 1RT7A 1REVA 4FK0A 4E7IA 3DRPA 2P5GA 4UAYA 3KK3A 4I2BA 4KTZA 1SUQA 7ICKA 4DS5A 2ASLA 4I2GA 1ZQMA 4HUEA 2BR0A 3ZDEA 3Q8RB 1Q9XA 8ICVA 1SKRA 3V9XA 1T8EA 4Q45A 1LW2A 4JV0A 4RPXA 3HJFA 3ISCA 3C2LA 1RBSA 1T3NA 4LH5A 3GDXA 1ZBHA 4Z0UA 4DTUA 3CFPA 2O4GA 4ZHRA 2G8VA 3RAQA 2ETJA 3NH1A 4RNMA 3MGIA 4RQ8A 4CJFA 5KFTA 3GV8B 2Z1IA 2O4IA 1XI1A 7ICEA 3QIPA 4QZ9A 1IM4A 3ORYA 4M3WA 4KHYA 3OYBA 2ITGA 3SUQA 3ULDA 1TGOA 3GV7B 1KLMA 2JGUA 2ZTCA 3K5NA 4QZEA 4M3UA
chains in the Genus database with same CATH superfamily
3LOUA 4HH0A 1ZTTA 1RTDA 1GQEA 2YNHA 1P9QC 4MDAA 2D69A 4YNQA 5ETRA 2OZMA 1ZETA 3MMVA 3MBYA 1RBOB 2JZ5A 5B09A 3AY0A 3KUHA 5HL7Q 3EGWB 3CC7N 5J0OA 2Z8QA 2G09A 5E3RA 4HUGA 4F4XA 1IJJA 5KAIU 3DAWA 4JI7J 5B7WA 4AT1B 2LXIA 4WFNL 4NY8A 7ICRA 2I9GA 4IBNA 1XNRJ 3TWZA 3M6WA 5KG7A 4RW7A 1OSCA 3QFWA 1U2FA 3S6JA 4W5TA 4O3RA 4DF8A 4Z4CA 2ZH3A 2PO4A 4P52A 1GLDG 4LT6A 1WB9A 5TKYA 3OTBA 2JV3A 4CW7B 3QNMA 4TU7A 2KZMA 4A62A 3AL0B 5GAEP 3HT0A 2OTLS 5ADXH 2FJEB 1HX1A 1WSEA 2BDUA 1Y10A 1JLCA 2W2QP 2RP5A 1VQ4S 4JI8J 5LJ5Y 1RBUA 3O9RA 1DQAA 4MF2A 5FDLA 4I6YA 2NLWA 3VGKA 4W5OA 3AVFA 3DLJA 4IJAA 4KLHA 2R18A 1UPHA 4AFFA 2LEPA 2NNWA 4PCQA 4W5RA 1S72S 2MSSA 5FPMA 1V9PA 4F5PA 3MGHA 3NGSA 4DR5J 2LYBA 1KHWA 1YSJA 4YG2A 3J81O 1B0PA 2OIHA 1BU6O 1FKOA 1UEUA 4ZOHC 4MAKA 3W3DA 2QL5B 3W2VB 1R8PA 4X4QA 4OX7A 5F9LA 1TUYA 3N5BA 4BBYA 2DXFA 1FJGK 3AD8C 3SMSA 4IO9Q 2QB0A 4WJBA 2L9NA 2YI1A 1M5KC 7AT1B 1QHTA 1YHQN 3N4WA 3MUMP 1Y7PA 4R79A 9ICXA 2CNNB 4KX5A 3IRXB 5IC4B 5FP0A 3SQ4A 7ICLA 2JFKA 1RDDA 2A19A 2P9NB 1VQ8N 1ASUA 4IQWA 1UTAA 2RN2A 4FKXA 1DLOB 3NGTA 3NS6A 3KJVA 3RGIA 2AD9A 1UQVA 4FPBA 5H9EJ 2AX0A 4UT4A 2CZ4A 1MWZA 5HOOA 4FWOA 1NNDA 4NCBA 2VPZB 3M9OB 3TX8A 4C2MA 3GIIA 1CQNA 4E2FB 3H8SA 3D4JA 8ICWA 3D7SB 4P4MA 2XMUA 3OTDA 1VBXA 3IWXA 4DR6F 1NPKA 2KKHA 4PKIA 2HHHJ 3KLHB 2UUWA 2MKJA 1ZD4A 3HP6A 2CPFA 1XN9A 2VPXB 4Z6FA 2ATCB 2P9GA 3NH0A 4MEXA 1U24A 1RBRA 3G71S 2A1JB 3QRQA 2CQ3A 4EI2A 2XO7A 2J4RA 2HFNA 4I2PB 4JHDB 4LC9B 5LJWA 1QQ5A 1HYZA 3SSQA 3TTDA 4DN0A 1QQCA 3L7OA 4CGIA 4I69A 4DV2K 4FLTA 3FYHA 3PM9A 1IBMJ 1VSDA 2JWLA 3QZ7A 2OEKA 3EDQB 1FTCA 3HSZA 1ZM4A 1KVAA 2IVPA 1HMVA 4FZVA 5HBMB 3WX4A 2AJQA 2C3YA 1Q7YT 4H0VB 1XSNA 5DMRA 3HBTA 3NVZA 3VEZA 2KK0A 4FOIA 1UA1A 2PE8A 3NP5A 5AI4A 3BKTA 2G0JA 1LW0B 3JTNA 1O8BA 1NPRA 2NRVA 1U1RA 3R5JB 2PY5A 3ZTSA 2HK2A 4CF5A 2PSZA 1OYDA 1IJEB 2MJUA 5BOLA 3FUYA 1WF1A 1DY3A 1RK8A 2WAQF 2XGPA 1JQGA 2R8JA 4NA1A 4JEPA 2EAMA 4RQNA 3VQ6A 4MH8A 2B4JA 3SJJA 1ASVA 4B9QA 2F8SA 4O9MA 3SDEB 4M63C 4KH6A 3G71N 2ZM6K 1Y97A 1NKCA 3GIJA 1S9GA 2KE7A 1JXBA 7FDRA 1IKXB 2VB6A 2QWLA 2O8CB 4DOZA 1JKHB 2O8BB 1F5AA 1HIYA 3DOLB 4ZVPB 2XIDA 2BE9B 1EZZB 5D49A 2P5VA 2ZUAA 4MMOA 4ECUA 1IQTA 5AZJB 3C23A 5KFUA 2FHOB 1U1LA 2UXCF 2ZDPA 4KBIA 1EX8A 3A1YG 3VEYA 4K4UA 3M8RA 2HCFA 2LEBA 4FPAA 3SJHA 4OPKA 4CZCA 2J8AA 1T9WA 2JEGA 1RAIB 1OVQA 3QGPA 2CZVC 2K89A 1O08A 4CHNA 4V19X 1ZXIA 3KK3B 4N8OA 5KFMA 3F5AA 4LF4F 2QM1A 4CNYA 3UR0A 2N1RA 3EUB2 3CDBA 4ANDA 3J7Z5 4F5RA 3ZZRA 1HLWA 5AQLA 3CG7A 2HNYB 3TA1A 3WQPA 9ICLA 1BPYA 5T7LA 5KGXA 1WSIA 2X3DA 1D9AA 2XRIA 1Z25A 3BBFA 1JB0C 3GFYA 2G2ZA 5AM3A 4KB0A 4CP5A 4PXCA 1N48A 2HQFA 3SCXA 4Y28C 3AQEA 3QERA 4JI8F 2ZC4A 1FD8A 1CSJA 3MEGB 2VFVA 4IR1A 3A8JA 3O2IA 3U1LA 4WFAQ 3PIOL 2PMZD 2RDDA 4ETZA 5KFFA 2KMDA 3GMGA 4DFJA 2QK9A 2FJVA 1XQSC 4Z2XA 3PR5B 2LA6A 3I56N 2DUYA 1BQMA 1HHSA 4TVAB 3DRRA 9ICOA 2ZBPA 3V9UA 1YZ7A 5D3GA 2XSJB 1CULB 2YPYA 1X5OA 2ASOA 3TA2A 4BREA 3MDFA 4WK3A 5KPZA 2I5HA 4BC9A 4CF2A 3A12A 4P71A 1XWLA 1M0SA 3TARA 2CFXA 5EXWA 1EWQA 2I7PA 3JPSA 3UO0A 4FN5A 1RTIB 1NJYA 2BPGA 5B0FA 1VQ9S 1RCHA 5EY4A 3M1FA 2HFSA 3QPIA 4K8RA 3WQUA 2W9MA 2KNJA 3NBPA 1J5EJ 5JJBA 4WXOA 4DV1K 5BPNA 3AA9A 2VG5A 4JI4F 3MPDA 4RUBA 4LF8F 4ETXA 3BM7A 2CPEA 1XNQF 1B99A 1Y64A 4BHQA 1FRXA 1RT3A 4W5NA 5F8NA 3O9UA 4DHYA 3FGUA 4BR2A 4GXJA 3IWNC 2CDRB 4BUGA 4OPHA 5AQFA 1W7AA 5FIIA 4ED2A 1WKJA 4DUTA 5FD1A 3RBDA 1FRKA 3N4QA 3FJ2A 1QY7A 4TQSA 4BGDA 1S77D 3H90A 2V9KA 3EWAA 1SQKA 5DKWA 4FCYA 5KFSA 2BRLA 8ICGA 4J9RA 3RF9A 3AVCA 5EVZA 2YHXA 3JPRA 4URSA 5I42A 4X62K 1S5ZA 4RW8A 4CJKA 1FWPA 4YD2A 3LPEA 4NLZA 3P6YC 3O8MA 3PV8A 1EP4B 1UWBB 2HQGA 4LRCA 1ULRA 3R6GB 1EETB 2WVFA 3UD3P 3V81A 1I94F 5ALLA 1EXNA 2AQ0A 4FO6A 3RB0A 2GAGC 1VDHA 4FWKA 1V85A 1HNZF 5F0XA 4JI0K 1N6QB 1E6YA 4O5BA 2PMHA 1QZ5A 3BGOP 4WFZA 2YQ1A 4ZVUB 5DB7A 3P4IA 3MABA 4N77A 1HR0J 3W3SA 1SB6A 4DV4J 3PEJA 4IKAA 2HMIA 4PYDA 2HQDA 5LY3A 2JC0A 1H7XA 3OL8A 4U7BA 9ICSA 1WDDA 4ECSA 3MPVA 4H5NA 5JMVA 2MZSA 2CPYA 4H5TA 2WMMA 4IWVA 4XPCA 2GWKA 4H4MA 1EWRA 4B9NA 4WPAA 1SJ4P 3UXPA 2HGNA 2HZVA 3HRDD 4JRQA 1T3QA 3GIKA 1N5YA 5HROA 2FDRA 3TANA 4W90B 3M2RA 4AILC 1YIJN 2FF6A 5IINA 2NUBA 3LUYA 2QN6B 2DF4B 1DARA 1Q81T 3RG6A 5I3UB 4K4VA 4FLXA 2HEKA 2R42A 5J2QB 2F5GA 4NLPA 1WCLA 1HBUA 4X65F 3AY9A 4NMXA 5AI9A 4IQMA 3BO2A 5AI6A 4NYOA 1JXVA 2APOA 4NL9A 4M3XA 1RA7A 1RDUA 1JMTA 1PSDA 1IR2A 1HBMA 3IGNA 4OZ2A 4CI6A 3SPZA 1NKBA 2AH5A 4KB1A 3DDNA 5I3QA 4NASA 1KRPA 2DFHA 3FZKA 2C1EB 3D2FB 1S3XA 3QT8A 4BC2A 3OD2A 1LXNA 2GQQA 5E7OB 3QAUA 2Q0UA 1RXWA 2GBZA 3B4MA 1VLOA 2EK6A 3UPFA 4HR2A 2HZAA 2J9DA 4DPOA 1PAUB 1YX2A 4MFFA 3B4DA 4JKDA 4KREA 1WHYA 3I82A 3NASA 3N4MB 4PUOB 9ICQA 1NGAA 4CERA 4CK2A 2KU7A 4MT1A 1IXKA 2DKXA 2X74A 3D1HA 1LAWA 3U8XA 2QL9B 1FW6A 2Z0GA 1S6OA 4MO5A 5L1MA 1K9MT 2XICA 4QZIA 3V6KA 4EAHD 2ODGA 2B6GA 1ZQAA 4CHPA 4PL8A 5AKHA 1TVRB 2GQCA 4LVNP 3ZC4A 2D1CA 4UARA 4IFYA 1OW5A 5AI8A 2BBEA 4J9LA 3GG4A 3QT6A 4CYUB 1U26A 3S3MA 1XNRK 4LF5J 3NRBA 5F3TA 4C3MA 1HJPA 1UPMB 2MUTA 2DY4A 2YHWA 2AKWB 2GIRA 3NS5A 2YWKA 2R7TA 3TTFA 3AOBA 2DNPA 2ZH4A 3L3UA 1JLAA 2IVMA 2EANA 3O3HA 1W0HA 4ZHRB 1IR1A 4C48A 4FBTA 3MMCB 2ZJ5A 4JYAF 2Q6BA 2FSKA 5LMUF 2G08A 1VSFA 3GG1A 2W6KA 2HNDB 5JRTA 4I68A 1HNIA 3BN4A 1M90T 1QTMA 4J91A 1VQKN 3H5YA 1VC6A 4H0XB 3D6MB 1X5SA 2ZUGA 4RWXA 4HWIA 3NOCA 2RVJA 1TV6A 4C8ZA 4K43A 2DNOA 5AZIA 2K1RB 4BR5A 2AYGA 4X62J 1ZPWX 4O44A 7ICFA 3HHDA 1CJTA 4KO0B 2M0NA 4URQU 1R7IA 2VIHA 3O6WA 3VGUA 3GPAA 2FGOA 3L2VA 5CR0A 3H0PA 3CFRA 3PJWA 4B3OA 1ZRNA 4OIXA 3FFIA 1VQPS 4CHOA 3D67A 1RQ0A 4FWLA 1K5OA 3TR5A 4OJ3A 1GMUA 2DPJA 1WSRA 2OPRA 1ZD5A 4AL7A 1U02A 4RW7B 1JJCB 2R8KA 2W2MP 2UUAJ 2UU9J 1R43A 2VU5A 2E1ZA 3DV9A 2B4PA 2KSOB 3ASMA 4ZCLA 3FM9A 2ADCA 2J0QD 3DXMB 1N33F 1OH7A 4QJVA 5AFUH 2ZWOA 2B4OA 2CG4A 2MQPA 1KQGB 3BZCA 1DK3A 3QEIA 4I2DA 2J6TA 5IIMA 3CB4A 3VA0A 3C1ZA 2VKRA 2YKAA 4IO1A 3NWRA 4DSIA 3B6BA 1TAMA 1JLCB 1Z26A 2WF8A 4NLWA 1NGBA 1TL1A 2CPXA 3RH5A 1YDLA 1RAJA 5FDLB 3FZ2A 2DRAA 3TEGA 3AXMA 3TZYA 2RF2B 1Q53A 4ECYA 3LAKA 2DGVA 3J7YU 2LMIA 2P5OA 5AQYA 3P38A 3R6MA 2KZZA 2OPSA 2H4WB 1S1TB 2FY1A 4B02A 4DCPB 3TZWA 5HHIA 4QIWD 3SPYA 3IGVA 1Z6RA 2X51A 3WBZA 5KOWA 1GLJO 3E58A 2A6MA 2YVSA 1RTHA 1D0EA 3D2QA 3BY5A 3W2VA 1ZJMA 1D3WA 3OBYA 1J54A 3FBCA 4O5EA 4GO7X 4UW2A 3EM1A 1RE1B 2FZCB 1NGGA 4K8XA 4F91B 1KTVA 3L2QA 4TUSA 4TURA 1DRZA 1N33J 2DFLA 2EAOA 1ZZFA 3EXCX 1V5IB 2RHQB 3MAAA 3M2VB 9ICIA 4FS2A 3TJ8A 3VA3A 3F2CA 2FPMA 4LF8K 2YTUA 4ISGA 2MTLA 4OI2A 4C4SA 4C9DA 3OLAA 3BN7A 5AIAA 1DLOA 3ETMA 4I9QA 3P39A 1XBWA 1BLUA 3D0PA 3AA8A 3ENWA 2OTLN 3ZDBA 2KT2A 5KFZA 1F2HA 2PIIA 1HBNA 2GNKA 4DR1F 3OW2R 2V68A 4BQLA 1S0MA 2CQPA 1WWUA 4ZA1A 3KYLA 5C24B 4U95A 2ZJQL 3NFAA 3A2FA 3AU6A 4BR7A 4B8CA 1RA6A 3R2CJ 3WK6A 3M1YA 4L73A 2O8EA 4NEYA 4CECA 3H7IA 5AQSA 1V9OA 3T9ZA 4P74A 5J2CA 4R65A 1N60A 3QJPA 1FDNA 3ULHA 4RG8A 3QLHA 2ROPA 1RDRA 4I2PA 4KLEA 4KC5A 4Y00A 3UN2A 2VKZG 4CK3A 3HSDA 5CHGA 4QIWF 3WXIA 3ZEUA 4BRIA 2ASPA 8ATCB 3AUOA 4YN3B 3OTQA 4GY2B 1BPEA 1YJNN 3TABA 4QYRA 1XMQF 4L8RB 2LQJA 1TKTB 1ZQZA 1NLVA 1C0TB 1XC9A 1IWGA 3CMAS 3W5ZA 1RB0A 3MMAB 1HRHA 3CIMA 5JXSA 1HNVB 4UOFA 2HRYA 1KAYA 1KOHA 2M9KA 2M8DB 2P9KB 3CERA 3MN7A 4EP4A 3HZEA 1R89A 2UP1A 2XZTB 4ZP8A 4E89A 1MN8A 1AFJA 1HR0K 5C2DA 2V69A 1KBUA 4FF4A 4KV8B 2E88A 5ETLA 3EZWA 5DLGA 4H5RA 4B3TJ 4OLAA 2E44A 4WKYA 4ILLA 5J0TA 5KI6A 4CJ7A 1B0VA 5LMNF 4UB3A 3BPSP 1RKIA 4ECWA 4CO4A 4CZFA 4ZVQB 1VRTB 3T6BA 3MR5A 3G8SA 4TY8A 3OSPA 4IO9L 3MD3A 4IG3A 1ZC6A 4ATNA 3OTOJ 1FCAA 1HQUA 2O8BA 2LVWA 2WF7A 1D8LA 3CW2C 3NLCA 4B08A 5BR8K 1OY9A 3QE9Y 5HQLA 1VR6A 2DNKA 3GE9A 4LJMA 5LMNJ 2WONB 4PKHA 3BZQA 5ALPA 1QVFR 1PK3A 4F4KA 3PG9A 2MQNA 5KFHA 4K4HA 1EB0A 4D3HA 3HW8A 2DR7A 1V3ZA 4BRMA 2QA4G 4NLRA 4HVJA 3ZX2A 3OTOF 2NZ4A 4FLYA 4IG0B 3MOJB 4OJHA 3AEVA 4Z94A 4BRKA 4RQ6A 2MA1A 5U47A 1NHVA 3SMVA 4RNFA 3HFKA 2GAHC 1SUQB 2DL0A 1L3KA 4DPYA 3A5OC 2RLTA 1C7YA 3WK9A 1LV5A 3DEEA 4IJNA 1FXRA 1NOMA 4Y6IA 3A5MC 4DUZJ 1PYSB 4DL6A 1ICEB 2YQ0A 4USIA 4URGA 1RXVA 3KLEB 5BPCA 2HOFA 5EE1A 4OJ1A 3NKYA 1NAQA 4G1IA 3M8QB 4PQAA 3HK2A 2YTCA 3T1AA 1H6KX 4DV4F 4OJOA 4DSFA 2YXLA 3V4MA 4EUVA 2ZVIA 1D9FA 1JWWA 4X4UA 4B9SA 4ZVGA 3H4BA 2OWOA 2C2KB 2OCEA 1JJ2R 3KHRA 3HRGA 2DNLA 4DV1F 2AJ2A 2W9BB 4MHVA 2MKHA 4NZ7A 3L3VA 2GCFA 2W43A 1J2MA 2FLNA 2HHQA 2N4DA 1TVAA 3ZNUA 4BXOA 2CG8A 1WC6A 3QUQA 1IVZA 2ZH1A 4NCAA 4EBCA 3ALRA 4PXDA 3HSJA 2V5HG 1UEKA 4R0JA 3MECA 5ALTA 3MXIA 1HUXA 4K0KJ 3I8DA 4BRNA 4WXWA 5AKLA 3IC1A 3BH7B 1LK7A 4CGDA 1N34J 1Z4UA 3TOQA 4KY3A 3R1XA 4CZLA 3VQEA 2B21A 2JEJA 4H5VA 3PYFA 4ZMMA 4CJLA 1T9YA 3ZZTA 4U6PA 4KX3A 3MMBA 4DR3F 2KV2A 3FSIA 3BDEA 1N32F 4YR3A 3MM7A 4ZTJA 4K4XA 1RT3B 1PAEX 4M5NA 1J5EK 1PVRA 3HULA 4QR0A 3OVBA 3SD7A 2ZIXA 4O5FA 3CF5L 4XH5A 4J9VA 4YMOA 1PILA 5KFGA 4M04A 2GWJA 3R7BB 2A10A 2PEBA 4AD6A 2UUBF 1CUKA 3QU4A 3HHNB 2XLIA 3AQPA 2AYMA 5L39A 1B70B 1KFTA 1S5LU 3THPA 3OS1A 3THVA 3CCMS 2KVIA 3SCKE 3CDEA 2WOMB 1JIHA 2PGCA 4CJRA 4NM2A 1MMLA 2FBVA 1A77A 4A8MP 3ZZUA 2NO4A 2IMOA 2X6NA 5C12A 3KUEA 1URNA 5C42B 1ZQPA 1MDUB 2E8OA 4R5PB 4W5QA 4DFPA 2RNEA 3AA3A 4ID5A 3HZGA 1NUEA 2UUCJ 1MROB 1ATRA 3W9HA 4BS2A 4M9NA 5LL6d 5JMNA 1RKJA 1HKAA 2E5GA 4E7LA 4H0YB 1FO4A 3KJQB 5HRSA 1OH8A 1HD0A 2C2MB 2LQ5A 3OGUA 3RMAA 1R8HA 4HACB 8ICUA 4ZS6A 2FJ6A 4UUWA 2HWHA 1Z05A 4OYPA 2NYVA 4I28A 4WCEQ 1YJVA 1BGXT 1T02A 3DLGB 4CLSA 5HMMA 3BPDA 1YVFA 5KFIA 3C0BA 3LM2A 1KVIA 4DLEA 3HL8A 3P83D 1Q16B 5J2MB 1S1WB 1X1PA 3OVNA 2YX6A 2L5YA 1CJKA 2VQEF 3CETA 3MTKA 1IG9A 1V38A 4J7CA 2RHSB 1WUUA 4A48A 4OCZA 2DJWA 1P7DA 3CCZA 5A8WA 2WBMA 3UFCX 2WB1C 2H3IA 3WKEA 1KKHA 1VSHA 1LVHA 1S1VB 4JYAK 3S8SA 3CJKA 4AXJA 2UVVA 2ZXIA 1MN7A 3DRYA 1HWUA 5CZ2A 3ENQA 4G1QA 4M2YA 4WQ5C 5GAEU 3QT5A 3DFEA 5DB6A 3KUGA 3LWMA 1RTZA 2BEFA 2C3OA 4X66J 4B3MF 3NCIA 2ZZMA 2VASA 5CHCB 1NGDA 3PX4A 2DT9A 3L2WA 3RR7A 3QU7A 1HYVA 2F8HA 4A4JA 5L38A 4JK7A 4DTXA 4DMZA 2EZXA 4CJ5A 1RBVA 3ENOA 3PW5A 1N62A 2W3RA 4U9RA 3SFUA 4LFBF 5IV4A 4JI6K 2P66A 2KJVA 4ED6A 4FBUA 4NJ8A 2NRZA 2R7OA 4AYBF 3GFZA 4DV0J 2Z7JA 2HDOA 3MM9B 5GTIU 5KRTA 1JMSA 3BH6B 3OTEA 3QGGA 2HZCA 3VF2A 1O03A 5SWMA 5D4LA 5D0GA 5J2FA 3ICXA 4MN4C 5KL8B 2V8DA 1M5SA 3J7YI 3D2NA 4PUOA 2P9EA 3MCAB 5CQGA 4PHDA 4QOZB 2V0NA 4RBVA 4CNZA 1N0VC 1BPDA 2KEYA 1NK5A 1SB3C 4X66F 5DZ6A 4B3MJ 4JWMA 3TYTA 2KJ8A 2NXNA 2YKMA 2H3ZA 4B3RF 4WF9Q 4ELTA 1TUWA 4DTNA 3U1MA 1NK4A 4AM7A 4MIBA 3PYDA 2H54B 3WXJA 1FFVA 4B1YB 4N5SA 2R7SA 4F5QA 4LFAJ 1ZM3A 4KGVB 1JLAB 4OD0A 2GMLA 2CZ9A 2MLZA 2IC3B 3BYPA 3IR7B 2RDJA 1HHQA 2GO8A 1VBYA 4H4OB 1R0AA 5FLXU 1WN7A 2MDAA 4CM0A 1CS4A 2ACYA 3QQCD 2DVIA 5F8LA 4IDHA 1DURA 3L7PA 1QS4A 2K8GA 4DG1B 1S6PB 3V4IB 4C6AA 2IDEA 3U3GA 3HDSA 4DR3J 4OV6A 1M1GA 4O44B 5AK3A 4WU2A 3L3FX 3D6RA 4H0TB 1UAXA 5KFLA 4IO8A 2V4JA 3EGZA 5FLXO 2ZIVB 1YAGA 2J0XA 3S3NA 2XS5A 3VGTA 2R7QA 3A8EA 4LRFA 3B8AX 3WK5A 3LWLA 4DV3J 1X31C 2E7WA 1COOA 4IOBA 3RJIA 2VJ5A 1XNSA 3FFIB 5ETKA 4OPAA 4AQYF 2YY6A 3D6FB 4RW6A 2BW7A 1B43A 4CVNE 3THWA 1KQQA 3GR1A 3TP2A 1I94K 1WOOA 3R1LA 1EKSA 5J29A 1C0FA 3G2XA 3VTIA 4QWCA 3A3OB 5AM5A 1L7MA 5E3PA 1TL3B 4WYBA 3E51A 1NWKA 3LPTA 4CEDA 4CK1A 3HHLD 3Q83A 1LFWA 8ICCA 3VAKA 4EHTA 3NF8A 3OY9A 1PIEA 3HPHA 2NO5A 3IXQA 3CXCR 3RFAA 4NLOA 5A0YB 4ID1A 4YOTA 1FEEA 4FFDA 5FRNA 3QGHA 4P10A 2J8SA 1S1UB 3JQKA 2UVUA 2N7YA 4MQ3A 4HAIA 4YFUA 4LVSA 2XEXA 2VHGA 4QIWC 3AVAA 3UKRB 4J37A 1NOYA 4CGJA 1S0NA 8ICZA 3F2BA 3OXFA 4CJQA 2QFJA 4UB1A 1RU1A 1L7OA 2W03A 1N5SA 4RO0A 5B5EU 3GIMA 3HM9A 4Y2UA 4I6MA 4QW8A 4OVLA 4B3RK 2I5JA 5ALDA 4KHMA 1R6YA 1BIUA 5BREA 3T41A 4LQ9A 1N36K 4C1NI 1JX4A 2W9CA 2PD1A 1TV9A 4P7TA 3D68A 4O4GA 1XR6A 4EGLA 1SGGA 3JPOA 1S9FA 1CG2A 3G6XA 4IQXA 4CJ3A 1XMOK 4XUSA 1PJ6A 2KG1A 4CO2A 1RT6B 1GH8A 5GVQA 3ETRA 4B17A 1YK9A 2OFGX 2HS0A 3ULEB 4WBFA 4Y65A 4US9A 1NGHA 3FVYA 5JUMA 2FSNA 2V51B 2BJ3A 5FROA 3SAGA 1NXIA 3L7UA 1UETA 3LDQA 2BACA 2M2BA 1IR0A 2AXTU 2UZAA 5KFDA 4JI6J 3BV8A 2O8FA 4KGZB 1HEKA 3WK7A 2N7CA 3J7AN 1QSLA 1HHTP 2XZWA 4HHHA 1OWXA 2W54A 4PYAA 2DHXA 2P9SA 2VDHA 1P6TA 4Y2AA 5HQ8A 2ALZA 2KZ3A 2Q31A 2W40A 2Y9UA 2MZJA 3WKAA 2YWWA 2VYPA 1HKBA 1FE0A 4BRLA 4QWEA 2QC3A 2KVSA 2QMXA 3ZI4A 5ALEA 3RRGA 3QAEA 2UUBK 1RP5A 2E8AA 2Z1GA 4QZAA 2CJQA 3RBZA 4EMDA 4PHPA 4JI1K 4LF4K 4F5OA 4QZBA 2BM1A 2AIRB 2DFFA 4CGGA 3O3FA 4AQYJ 2P9UA 2QW9A 2ZIUB 2DY1A 4QU7A 1XMQJ 3CJ1A 2ZBIA 1U1QA 1K6YA 3GZ7A 5I3PA 1RISA 2CQIA 1Z1VA 1C0TA 3K2YA 2QWNA 3TR8A 3O5BA 1S97A 4FK0A 4YY3F 3U26A 3PACA 2RQMA 3DRPA 4UAYA 2GIFA 2EZZA 4KTZA 3SCLE 3FFKB 1S49A 4DS5A 1ZQMA 4HUEA 3JAMO 1IBKK 2V63A 2MXYA 1SKRA 3GU3A 1T8EA 4Q45A 3D7EO 1LW2A 4JV0A 4RPXA 3HJFA 1T3NA 4MKVA 2ZNYA 2UXDJ 1SZHA 1RWNB 5B0GA 2O4GA 3MD1A 2MKKA 2G8VA 2VBXA 3MX5A 1S4FA 4DV7K 4KHPK 3MGIA 2VPWB 5J8YA 4M5JA 1UVIA 5HP1B 1XI1A 1WUAA 2C2OB 2KG5A 1WTBA 4LF8J 3UMBA 3WX8A 1IM4A 1CJUA 5BRHA 4Y0FA 4KHYA 3CQXA 3TUZC 2ITGA 3IMXA 3ULDA 1KLMA 2QG9B 4JKEA 2ZTCA 3O1LA 5AQOA 3CPWR 5M2PA 4EHUA 5M1FA 1BD6A 4KLMA 1IN0A 2BRKA 3J80Y 1RCOB 8RUCA 2WVBA 1GOBA 3MFHA 5DDMA 4QOTA 3KK2B 4C7QA 7ICUA 2R2TA 2GV9A 3MM6B 5JLHA 1PYTA 5KFWA 3O3LA 2JFDA 2C3MA 1XUPO 1LOUA 4OMFG 4NYZA 3THYA 3UCZP 1C1AA 1S1XB 4O4RA 2CQ2A 1S6QB 3L0QA 1GAOA 4FYVB 4DX6A 4CJUA 4BR9A 3Q2TC 4P75A 1ZM2A 5IS2A 1RHUB 1VQ6S 3VQ4A 4RPFA 2QKKA 2BJ9A 2F9TA 4RBTA 2F8TA 2V67A 3GFXA 3EZOA 2XMJA 3CSKA 3QEXA 3H46O 2QKQA 2KYXA 4WZQA 5FPEA 3ZFVA 4DR3K 4JB3A 2ZM6J 4M3YA 5D4BA 3HKZD 7ICOA 4LSNB 1JN3A 4KLLA 4H5WA 3GDQA 3W62A 3T5LA 4DR2K 3VR1A 2E1CA 1VS3A 4XEIA 4JNEA 4DOCA 2LKZA 2QZ8A 3MMJA 3L3CA 4CHYA 2EBGA 4CLYA 2GVZB 4OLOA 2DEIA 4QWDA 3O9QA 3KHHA 1S9EA 3PO4A 4O3QA 1C0MA 4Z7YA 2FC9A 4DFKA 4KPCA 1XQIA 3GWCA 2WF9A 4TXSA 4GKJJ 2KDOA 2RILA 1VRUA 2HYIB 3M8PB 3NMRA 4RW9B 2MGZB 1QH9A 3KG4A 5JVHL 3P96A 3QMLA 4BROA 1NSQA 2HFZA 2XCAA 4AXIA 3RJFA 4AQYK 3TZZA 3G87A 2D9PA 2OP5A 2XNQA 5DETA 4BXOB 1XHXA 3ELHA 5J0PA 2FVQA 2NZTA 2JRSA 4I2CA 1RWKB 2IS3A 3OYLA 2KP7A 1VQKS 2VD3A 2CQDA 3PMNA 3X1LB 3ZETB 3AAQA 1DJ0A 3E9LA 1WC4A 1ATNA 2HHXA 4DV0K 1BQXA 3O5TB 3N5FA 3CCJS 3AGRA 4OI6A 4BC4A 1XO0A 4YXMA 1QAXA 1ZQWA 4DPTA 2ASDA 3IG5A 1A0OB 3UWTA 1WSVA 3LL3A 2L9DA 3MPYA 1GX6A 3MFIA 5AE3A 5GAHP 4P0PB 4FJ5A 1JXLA 2W11A 5AQPA 3SQ1A 8ICRA 3AODA 1KAXA 3OFFA 4MFBB 4CNQA 3RW7A 4TUQA 3ZZZA 2JH1A 4M9HA 2ABYA 4F3TA 2C2NA 1NJWA 2KYZA 2HBQB 1FFGB 1E3MA 1LWCA 2OD4A 2MZTA 3DLEA 4Y1DA 2YWHA 2HVIA 2PFPA 1VQYA 3M1VB 2MJNA 4WQ5A 4JKGA 1KN6A 1RADB 1FFUA 4JHDA 4FM1A 3C21A 1IBLJ 4C3LA 4M6WA 2O5DA 4JD2A 2F40A 5BR8F 2Z4PA 4ZVFA 3BQ0A 2FZKB 4WIIA 1L3VA 2J0SD 1OY8A 3IV6A 2YQEA 3E66A 3IP0A 4ZCIA 5F8IA 3D3BJ 2YN4A 2LSNA 3QUCA 1OH5A 4CO5A 2AGPA 3MURP 1BQNB 2GW8A 5KT2A 1S99A 4CEOA 4DR1K 3F41A 4A2AA 1RHRB 3K1ZA 4OLBA 3U9DA 3J81j 2F96A 3U9ZA 2HK3A 4K2XA 4F8RA 3OA9A 8ICBA 3S01A 2VDIA 2MKIA 2HOQA 1J27A 2RHKA 3L6QA 1GXTA 2M88A 2Q36A 3TVKA 2J9CA 5JVHQ 4LFCJ 4RW4A 4H8KA 1HI1A 4OKKA 1VAZA 4OX9F 1RDAA 2EXUA 1M1KO 3W2WA 2OKQA 3TAPA 2DK2A 2OZSA 2K4PA 5ALYA 4NLVA 3F9MA 3CNQP 1HMVB 4NZ0A 3ILLA 4RCHA 2G4BA 3ZX0A 1NGEA 3VEWA 5JS1A 3Q8SB 1OS5A 5AQRA 3HPGA 5HRPA 3CJKB 3Q24A 2EWSA 2XNRA 1MQ2A 1A6LA 4G1QB 1ZQGA 1PGZA 3JS6A 3RMDA 3IBWA 1WTFA 4R63A 2C3PA 2GA7A 3GJSB 1T05A 3J80U 5LSRA 1YTYA 1S79A 3HILA 2BV3A 4HI2A 4DSJA 3UDEA 2GS8A 3HT3A 3DRSB 3W5YA 4CT8A 5J0WA 4DZDA 1OYEA 1NHKL 3M30B 1S48A 3DWLA 3VERA 2RKIA 1I6JA 4BE0A 3L4PA 4P4OA 3HLUA 3UCGA 1PK1B 5ITHA 3A8YA 4FF2A 5KFRA 4PL2A 4F4ZA 2CNKB 1FD2A 2KHQA 3DDHA 5K8NA 1E6VB 3KMQA 2O8CA 1XSLA 4YY3J 2PI5A 1JJ4A 2Z2ZA 1VBZA 4PQUA 4F2SA 2CQBA 3DU6A 2VV5A 2P51A 5AZJA 1FWKA 4QR2A 4I27A 1MA9B 2BPFA 1B3TA 2IIHA 4A2BA 2XI3A 2LQBA 4N47A 2W2OP 5GINA 3KVGA 3W9IA 1NSPA 4Y34A 3F2KA 1S4EA 2BJEA 1XO1A 2FXUA 4YY3K 4XTTA 3K9KA 1Q18A 1IG6A 4FJ9A 2JZBB 2W55A 2C2RA 3TA0A 3MCOA 3BQ7A 2E9ZA 5AQNA 4NXZA 3J81Y 4DL2A 3DXKB 4CZHA 1U2RA 1G1XA 2L41A 3CD7A 2RHFA 2QMWA 3NF6A 4XPEA 2QV6A 1X4EA 4IQTA 4GVBA 4K4YA 2BKOA 1YF5L 2LU2A 3OYHA 1J5EF 1QAIA 4IOCL 2IGIA 4NA2A 3VPZA 1JLFB 1JLQA 4DUZK 3D1OA 3SI6A 1KQSM 3RW6A 3KDOA 3CCQN 1BA0A 4JKFA 4CGZA 3RZAA 4H0OA 4JKCA 5CA7A 2XO6A 2HMPA 4YB6A 4CBUA 1TK5A 1K1SA 2J9EA 1ATSA 1HKGA 3E3XA 1R0BG 4ZITA 5H1SQ 2IYGA 4F67A 2NRWA 4AP9A 2XCPA 1AUDA 2IOHA 2MRLA 3EE8A 5B0DA 4WWSA 3VF4A 4PG5A 1NH8A 2OSRA 2ZBQA 2HB5A 2RD5C 1UL3A 3DNCA 5D3GB 3TQ1A 2D3OR 3D9BA 5AJ3K 2XSJA 1PG5B 4M5HA 8ICEA 4C11A 1R8CA 2NXEA 3M32B 2V4QA 4DPXA 1WSFA 3GYXB 4EYHB 2ZE2B 1ZA1B 1OO0B 3T9NA 5AE1A 4RBUA 3CXCM 3THWB 4IDKB 4M7YA 1TKXB 4X4TA 2R7YA 2B43A 1TL7B 4A8XA 2R7WA 2F3JA 3BEGB 3R7NB 3R9PA 4JN4A 4WFYA 1UWBA 1XMOF 4HCCA 1IH7A 3UD5A 2K2PA 4DSLA 5D46A 4IXCA 2YY3A 2CYYA 2N4CA 3NOGA 4JI2J 2GMJA 1FE4A 1WD6A 4NXMF 5TKWA 1N6QA 7ICTA 1E6YB 2DBYA 1S1UA 2Q43A 5LSOA 3SI8A 2RRBA 4DWIA 2PT0A 1TMJA 5F8GA 4O55A 2FE9A 3W66A 2HG4A 1RM6C 2I2YA 1U6ZA 3MDAA 3R5DA 2BZFA 3ILIA 2KJ9A 1WELA 1FO1A 4X65K 5AQJA 3OL9A 3C5GA 3HVTA 1VI7A 5ALHA 4CZGA 2XYGB 4GO5X 4C0BA 1SIJA 1BY9A 4GVLA 5I4MA 3O8WA 4KQZA 1UW4A 4FJ8A 3MUVP 4W98A 2KT5A 4JV2A 4F26A 2LPEA 3JAMU 2KOBA 3U7JA 3LAMA 2JLGA 2Z30B 3JSMA 4I6AA 4R25A 4HH1A 5B08A 2IJRA 4O4GB 4I29A 1HNWF 2DWQA 3UVJA 2BTFA 1HNXJ 8ICKA 1SJFA 2YX8A 3JXUA 5IM0B 3RAXA 5CH7B 3UQ2A 2XMVA 2Q1LA 3RJMB 1X3MA 4E7KA 2DGUA 4KTWA 2JNJA 1PO6A 4ANCA 4LFCK 2R8GA 3ULEA 4ZIVA 3NMAA 3K9JA 1TE2A 4KKOA 2EAPA 2OMOA 3KLGB 5J2NA 2CRXA 3QFHA 2L08A 5LMNK 1RT5B 4Z6DA 2XS2A 4MKAA 4CFBA 2YH0A 1WG4A 3H2VE 2Q6CA 3G96A 1V3SA 1V5VA 4KTQA 2O8FB 1WNSA 4X4PA 2RPIA 3TRGA 3NDKA 3VQDA 3DCAA 3ZSQA 1Z00A 4KAZA 3BBBA 1FRLA 2J7UA 2FBXA 2OH2A 1EJ7L 3CCVN 5J1EB 4CRJA 1RWVB 3HHLB 4I2IA 2BE2A 3CC4N 1RG6A 1UEVA 8ICJA 1RU2A 3MDCA 2XWXA 1FXLA 2MSNA 1ZQLA 3DLHA 1CJVB 1EXQA 1WOPA 3HMJG 4FJGA 1HNXF 1Z19A 2NPIA 2XM3A 3L4BC 2DGQA 3O3GA 3CHWA 2CJ9A 3K5MA 4DL0C 1Q8LA 4I9LA 1REGX 1BI4B 1SQEA 2A18A 4M7XA 1QVGR 2KVCA 1ZBLA 3CYMA 3B9JA 3GV5B 4M0AA 1XIQA 4YORA 5A2QU 2GJFA 2FPHX 4HT7A 4FL9A 4EBEA 2KHDA 2VFUA 3AVKA 3KD3A 1GXUA 4BLGA 4JI4K 4K4WA 2MKYA 1N5QA 2VF3A 3K8WA 2FHJA 1FIQA 4JI7K 3G6VA 2QE5A 4GW6A 4M5IA 2RU3A 5DBAA 1RWOB 2KHVA 4OX8A 3NNHA 4QYZJ 4DPWA 4XH4A 2HURA 1IM6A 3K5PA 3IAM9 2P9LB 3LDLA 4AM6A 2YNFB 3BGRB 3AO3A 3TACB 2N3OA 2F4FA 4KE5A 3U27A 1SV5B 1TV6B 2FF3B 4KLDA 3JPQA 1RDCA 3J80O 2FVRA 3IBPA 4OYZA 5GAGU 2DH7A 2QL7B 3CCMN 3GIRA 3VTHA 3C29A 1ZQIA 1VQ4N 2P9PA 3BR8A 2CPRA 3OXLA 3WEEB 1FXXA 4L74A 4UTGA 2H3FA 3E0FA 3QEBZ 3W1YC 1VC5A 2VC0A 9ICBA 3NBPB 1FRMA 4U96A 4ZCKA 3EVMA 4R64A 2BKPA 4H03B 2OTJN 2YMLA 2XGQA 1NK0A 3G4SN 5E3QA 5AK4A 3PSIA 5J1NA 2AF6A 3TW0A 3T6JA 3OYEA 5KFYA 1RDBA 4WE1A 1QHAA 4B3SJ 1TFWA 2B3TB 1OQ3A 5J2JA 9ICPA 3N79A 4M5MA 3JAMY 2I38A 3DI6A 1J5OA 3HPOA 3MXJA 4J9PA 2MSTA 4Q0BB 1IKYA 3T1HF 4CIOA 2DEJA 3UD4P 2VQEK 4H54A 2AA4A 4U67L 2QYGA 2OFHX 1ECWA 2PDAA 3TZXA 3TAQA 1KD1T 3RVCA 1AUSL 2HVZA 2FHJD 2H3GX 4NLNA 4HDHA 1H73A 4KSEB 4DSKA 1BE4A 5A0LA 2GLEA 2RS2A 4YB5A 3I5CA 1B9DA 2MZQA 1VSIA 2CGLA 2UUTA 2V9WA 4X64K 4ZJLA 1O0PA 3H1VX 4DB3A 3I76A 4CGFA 1Q9YA 1H72C 2WRMA 2FBYA 2OPSB 2UU9F 4DV7F 1XJWB 1DK2A 1NGFA 1VRUB 2LYHA 3M8PA 4UY85 3G6YA 1J9AA 3H2UB 4I7FA 4I6WA 2F8MA 1D8ZA 2BXJA 2RB7A 1MNEA 2FD2A 3J7A1 4BJQA 2PFOA 2EZYA 1JNRB 3QSYB 1RGIA 4RUCA 5IIIA 5L1JA 1H2VZ 4FW2A 2J76E 1MMNA 2NR0A 5KG1A 3DU5A 1Q81O 4Y2JA 2HLUA 5DQIA 3GJQB 2ZJPQ 4ZLJA 1YVNA 3UIQA 4FVCA 1VQ5N 2LI6A 3HP9A 4DX5A 4E0DA 1HBOB 1LKYA 1R6VA 3IM8A 1QUVA 3DLRA 1Z4NA 3Q8LA 3HCXA 2RF2A 5D0HA 3C94A 1HPZA 5T14A 2M5YA 4XDCA 5DJBA 5EWFA 2HOIA 4DZ6A 1YRTA 4ITSA 2WSCC 2PFQA 1N56A 3KWMA 2NQPA 4NA3A 1FRHA 3DC2A 1X40A 3C6UA 3MR6A 2HHPA 5THWA 3VAMA 5AFUA 2DD8S 2AV5A 3HFZB 4K41A 4CZKA 1WF2A 4UZBA 2IVNA 1U2VB 3H3OB 2VQFJ 4ID8A 3DLLL 2DY9A 1RWPB 1HYSB 1GK8A 2RE1A 3IBFB 1DTQB 4FZLA 4USUA 2CJKA 4K4GA 3N7RC 4OZLA 2Y8WA 2ZH8A 4DL7A 1S7IA 2J5AA 4PABA 4ECXA 2YNGB 2GO9A 4MKBA 4DR2J 1UAWA 2GHPA 4JV5F 2AGOA 5C2FA 4BQZA 3VZHA 5AQXA 4BC5A 4PR6A 2DKZA 4JI1J 4F50A 3GFKB 1NCLA 3QNWB 3RH4A 1RGVA 2AEJA 4BRPA 1FFSB 5SZTA 4V19S 4N56A 2FSJA 2HHHK 4RU2A 3NXZA 1X9WA 4FLVA 1BQNA 5J2DA 4ZVEA 3M9MB 2B51A 4A8QA 4RT2A 1N36F 5IT0A 5EN1A 4OZ5A 3ZSZA 2VG6B 1QCKA 3R9LA 3KDNA 2CH6A 9RUBA 1UA0A 2WB4A 1CI4A 2YB4A 1FVQA 2Y8YA 4O0JA 1X3NA 3DMJA 1N5XA 3MC1A 2KM8B 3G25A 4HHUA 4L76A 3BS5B 4KJIA 3VGLA 1YJNS 4F3QA 1BNPA 4I2FA 3ISZA 2WFBA 4O8UA 4FE3A 4KYZA 3HI0A 4DR4K 3P5BP 3F5TA 3EEQA 3GJTB 8ICXA 5DK5A 1PC5A 3BSCA 5C25B 3PXGa 3RJHA 1U47A 2GTDA 5G4DA 2RQ4A 4OJ5A 4FP9A 2KICA 3V6DA 5AQKA 3ZLJA 3AV9A 2ILYA 2A1BA 3OUYB 4YR0A 6FDRA 3KKRA 4UOCA 3CGIA 4WYLA 3F0NA 5LOQA 1HNVA 3WUHA 1RHKB 1SXLA 1NJIT 2PFUA 1ZQDA 5F1XA 2MY8A 3GE1A 5ALNA 3EICA 4CLLA 5AR0A 1FA0A 1BXNA 2XY6A 1Q1KA 2QO3A 5C2GA 4J2AA 3NRWA 3C6AA 4IOXA 1GMWA 1WG1A 3UDCA 1RDFA 4FSVA 5AXLA 5HJYA 4A8SA 1NHUA 2F4VK 1WOQA 2E1RA 2O8DB 3M30A 1DGJA 3PW0A 4CTAA 2GVDA 5M1QA 5CZ1A 2HIQA 4KBOA 4IOCQ 4LF4J 2XC9A 1UOCA 2OEMA 1SKWA 1BPBA 2G0CA 3D28A 4K59A 1B22A 9ICTA 1EAYC 5KTQA 4QIVA 3KFUF 3C6TA 3CQYA 1ZYQA 2IRUA 3EY1A 1ILYA 4PQUB 1K8AO 5K9FA 3OHAA 4ERDA 4FK2A 2FQQB 2VJVA 1Q86O 4QWAA 4GMKA 1WAFA 1UW9A 4FJIA 3ZD8A 2GV1A 2WVDA 1Q4RA 3T1YF 4AYBC 3N6MA 3TSPA 1NK9A 4F02A 1T11A 4J03A 1M5OC 2IAJB 5GAEI 1VQMN 3CF5Q 4DV0F 2YPZA 4ZJOA 1OY6A 4BWMA 5ADXA 2G13A 2UXBJ 2CQ4A 4IZ9A 2OMLA 4KHUA 3MM5B 4NI2A 1N88A 1K8KB 5E2QA 4B9MA 2HHVA 2YKNA 1VK8A 3KD1E 3QICA 2ZH2A 3C14B 3VZIA 1NK7A 3JYTB 4ZPTR 1JK9B 2Z1HA 3MCMA 2OXOA 4DXLA 2EK1A 3UM9A 8AT1B 1FERA 2L48A 1JALA 2AHOB 1NDKA 3KLIA 1KLNA 1DQ9A 2CXYA 3VQ7A 2EG1A 2CPDA 2GIQA 3CJ0A 3C3LA 4P2FA 2RDIA 1IO2A 3L9ZA 2GUPA 3HX0A 3M2VA 4F4YA 2VBZA 4WP8A 4LFAF 1A0PA 1F9FA 4DV2F 2OD6A 2WW8A 4F3OA 2W9BA 3ENAA 1RHJB 4RPYA 1B4FA 2HOEA 3D2EB 1BG3A 3AFGA 1NDPA 4F92B 4LRBA 4NXNF 4IL6U 3DOMA 4OYOA 1CRXA 3ZCMA 2NXUA 4Y2IA 3IRXA 1F5CA 7ICSA 3CC4S 3UKUB 3TAFA 5L8RC 1IKVA 1S72N 5IT9O 1W2BM 4JAXA 3OYAA 2WB1D 5K8OA 2QKBA 3Q8QB 5BYSA 1YI2S 3ILJA 2IOFK 3Q8MA 2O8EB 4K4ZA 2M52A 2YQ3A 3B78A 3KJVB 3O44A 2UXCJ 2P9CA 2UUCF 1W26A 3CCUS 3OYMA 2QA1A 3KZIU 4PHEA 2YWEA 4QZCA 5C7PA 1SJ3P 2E5HA 2CH5A 1VBKA 5B0EA 4CEBA 1T9UA 3JPNA 4DCOB 1XU4A 3V1OA 1K9MO 2G8WA 2GFFA 4I56A 3EPIA 5E41A 2CXEA 1NDCA 3W63A 2MKCA 2DO4A 3UCUP 2F9DA 4KMOB 5M2UA 5D4PA 4AHSA 4DFDA 4DSEA 4YDXA 3HJEA 2KD1A 5J0RA 1U0HA 4F36A 1E4FT 1FI4A 3TAGA 2KKVA 1X0FA 2DHSA 4NLQA 5BN8A 3JSYA 4UQGA 2FLPA 3R6LB 4DV6F 2E6LA 4JYAJ 1ZQUA 4CHZA 1GOAA 1U6FA 4OQJA 1UZDA 3M4XA 2DR5A 5AI5A 2VA2A 1B64A 4BDZA 3OJSA 4E1NA 3G9CA 3HVAA 3JSMB 3C15A 4I0WA 1URJA 2PXIA 5ETTA 3BO4A 3VAFA 1VRTA 1IQZA 2DGOA 4RR5A 5AKIA 1UHUA 4MLHA 4USJC 2DTUA 4DTMA 5GADI 4JI2K 2J6UA 1IV0A 2RJZA 1TMMA 3MM8B 5KT5A 4HACA 1KD1O 1JUDA 4M9JA 2MB0B 4MFCA 3KIOA 2UUCK 3NTUA 1BO5O 3OR1B 2FMQA 3QUTA 2VC1A 5GMEA 2WVEA 4Q5VA 3VQSA 4MEYA 5AICA 3BDPA 1E4GT 4A61A 3PMLA 4KFBB 4DTPA 1K44A 4IG0A 1PYOB 3EGNA 3IHQB 4DI6A 3AO5A 1HI8A 4UB6U 1RTDB 2ROGA 4LR9A 4UAVA 4IH5A 5J2AA 1TYQA 4AE5A 3ZT2A 2AQ4A 5LMUK 4I2HA 3QEWA 1N4LA 1X8DA 1UT5A 3IG1B 3CQ8A 3V6HA 3KJFB 2JWNA 2MQMA 4KIAA 2ZQBA 1CEZA 2MMYA 2ZKUA 2A42A 1SV0C 4FXDA 4CH7A 2E1PA 1ZQSA 3U02A 1QAJA 3AJ2A 1EO1A 4IH6A 1L3SA 4NX9A 3CC7S 2QLXA 5AKZA 4C4RA 4YFKA 2QB1A 2EVZA 2XSFA 1W2IA 1FKPB 1WEZA 3TAEA 2A3JA 4HCBA 2VODA 1R0AB 3MXHP 3C2PA 4H0PA 3DLLQ 2XTJP 3HM8A 1JJ2M 4BCAA 3SNNA 3SIPB 5IIOA 2JDJA 4K0KF 5J0SA 3MTJA 3AU2A 2XBPA 2QXLA 4NM1A 2K7JA 4RL1A 4ZIWA 3O4WA 1T9TA 2EX3A 1ASWA 4LUBA 1GLFO 3PO5A 3G10A 3VF6A 3KKAC 3FCHA 1RBAA 4QS8A 2G8KA 2OLWA 1WJ9A 2B7CB 1F0MA 2PA3A 2BCQA 1YJ9S 2FMPA 2KIVA 3I4PA 2XMMA 1VQPN 5FPDA 2KT3A 4ISFA 4CE9A 1DBDA 3QSIA 3MOZA 1Q0NA 3OS2A 4LBHA 2XY5A 4DUYK 3FZLA 3PJXA 4LF7K 4GXKA 3TPQA 1UMJA 1RAGB 1RQNA 1CS4B 3QIOA 2E9TA 3NGDA 2DFEA 3PFEA 3BQTA 5K14A 3FKBA 4JI7F 4JI0J 2F4VF 3AVHA 3C7NB 3V7JA 2NLXA 3EZ5A 2DCLA 5F3XB 3KOAA 5J2KA 1S6PA 2FYXA 5M1NA 2EFGA 3I56S 2D0CA 1GO3F 1RBLA 1VCTA 2YB1A 4LRAA 2KFYA 3H0LB 3FCVA 3QXGA 4NL9C 3SFGA 4M5DB 1OXJA 1Y5IB 3EE3A 1T95A 2MYFA 2X1AA 4PWDA 2CJBA 5DS7A 4PKDB 2B5JA 8ICTA 3TUIC 3PIOQ 5E79U 4WFAL 1KR4A 1MLAA 1CXUA 2DNQA 1HWJA 4F25A 4M3RA 3W9JA 2MHEA 3RRHA 1O1WA 2QT7A 4QU6A 4G6VB 4IUFA 4QWBA 2ZJPL 3ZTPA 3SCJE 3KD5E 3VQBA 1UT8A 4EO6A 3LGMA 5BRFA 1WLJA 3V1RA 4E1JA 1FEZA 2NS1B 3WIUA 5HMZA 4XAKA 1WBDA 1N63A 1NRKA 3C1YA 1ZXOA 3OR2A 2IIRA 5M1OA 4YUDA 1TFRA 2WB1F 3WXMB 3GILA 2DH8A 5A2QY 1ED1A 3FBFA 2E5SA 1PJ7A 3W7BA 3T19A 1A9NB 3V7KA 1XMQK 2ZUDA 4OYWA 4KN4A 1PBUA 1O13A 3TVYA 2CQCA 3N9UC 4AHUA 5E84A 1ZQRA 1NOZA 5H1SV 1X0PA 1K1QA 3WNFA 4KGXB 2E1MC 3PEHA 4YB1P 3BF1A 2KLAA 3AVGA 3U3YA 3H5XA 2F1IA 4NZ6A 3C6UB 4IFEA 2M9NA 4BRDA 3JSBA 4FW1A 1X4FA 3SYZA 5JS2A 2LDIA 1IIPA 4NRTA 3AVLA 4IEEA 2A3VA 1HWKA 1HJOA 3EUNA 2XMAA 3BO3A 4LZDA 4RQ7A 1SPBP 5T7LB 2JEFA 2YNGA 4P0QA 4MK7A 2WSFC 3Q7CA 4KH1B 2HMIB 2CIMA 3THXA 3D66A 1X4CA 2B6AB 5AXNA 1NMEB 3A0BU 2E2QA 3AQFA 3RJKA 3WT0A 1DEJA 4F3MA 2PZSA 3QATA 4ZVRB 2LA4A 1X9XA 5JVGQ 4H4MB 3QEAZ 4FF1A 2HGMA 2WBNA 3MK6A 2IA6A 2IFXA 1VQOS 3GB0A 2ZGYA 4OLPA 1F5SA 3N97B 1U1MA 2LQ9A 5HROB 3QWPA 4P73A 2HNZA 3H7HB 3GJRB 3PSTA 5GADP 1EARA 4E7IA 1EIYB 3KK3A 4JI5J 5G5HA 7ICKA 1NNEA 2BR0A 4DU8A 4K7QA 1KW4A 4JBCA 4PWWA 8ICVA 4DV5K 3LO3A 2ZH9A 1IG8A 3HKZF 1HNXK 2QX0A 3LH2S 1ZBHA 4Z0UA 4I2QB 1FDAA 3OTOK 2ETJA 3M6ZA 3ONQA 3WK4A 1NBWA 2UYTA 2POKA 4RQ8A 1FJ7A 4CJFA 5KFTA 3GV8B 3QRRA 4JP8A 2O4IA 2XYHB 7ICEA 4DR6J 3MWTA 3CJTA 2BX6A 4QZ9A 4M3WA 2AJ4A 1UVMA 3OYBA 3W0LA 2K60A 3SUQA 2VG5B 4X4NA 2HQCA 3K5NA 3UDVA 5ALSA 2CA9A 2EWHA 1S12A 2OEHA 5IXUA 4DDFA 2UXCK 4OO1J 2V7YA 3N01A 1S1XA 3BSAA 1LW2B 4CF4A 4FJKA 2BQ3A 2YMMA 1HNIB 1OH6A 3LP2B 1KS2A 4NYPA 3MEEA 4GVEA 1WBBA 4FJJA 3QJLA 4RQ0A 3ZNJ1 3AO2A 3R9KA 4ZP9A 3TQEA 3SBGA 3TX0A 5CHIA 5AQUA 4Q2MA 4X62F 3G82B 5AZIB 3CEDA 1NPPA 2R4FA 3HSGA 5EHHA 3F9KA 4ILGB 5KFPA 4EFHA 1TL3A 4DR7F 2F76X 4UASA 4O0NA 1HNWJ 2NXJA 1SWWA 2MLYA 5G0RA 4WFNQ 4FZXC 3H4DA 4M45A 1N32K 5CCMA 4EBDA 5KT4A 4V1Ak 2KI2A 3P8BB 5TISU 2ISOA 2HHUA 3V81B 5B0BA 2MQOA 2A41A 1FVSA 2ZZTA 1S9EB 3HSCA 4C3KA 1IKWA 3GSDA 5HI7A 1BHLA 1YBUA 2LMRA 2ATLA 8ICMA 2M7SA 4YR2A 1SKSA 2NYHA 3GYGA 1SQGA 4ECZA 2F77X 2G0IA 3H59A 4RQ1A 1HIWA 1QQ7A 4FZYA 3CM6A 5KFBA 3SV3A 4ES3A 4NI2B 2KN7A 3KJNB 4PL1A 5MAOA 4PWUA 3N28A 2F7TA 3JPTA 3IMQJ 2K1RA 2ASJA 4LF5F 1MWKA 4AUKA 4LSNA 4CF3A 3DOKA 2V2QA 1RTJB 1CJTB 3ZSOA 3NCQA 3FZMA 3I1YA 1AQ6A 2UVRA 1U0SA 3FMWA 2P9IA 1R8BA 5D0EA 2VANA 1IBCB 2CWXA 4USWA 5IT9U 2G5IB 1C1BB 3I8BA 3RMCA 3Q8PB 3DHWC 1O51A 2MY7A 5ALVA 4CM2A 2J9DE 2YX4A 3IBCB 3PNCA 3NNCA 4PRFA 1G2EA 4ENOA 1SKUB 2W4CA 2R2UA 4JRPA 4PG6A 1YJRA 4BR4A 3QIDA 3CJ9A 3OSNA 4B1ZA 1A5XA 1APSA 3OYDA 1BISA 4IRDA 1BCOA 3EN9A 2O6KA 2YMPA 1ZH5A 2H3VA 3WZ0A 2LU1A 3O1WA 5KFCA 4QZDA 1X9SA 3CNHA 1F0XA 1MMDA 1JI7A 1W25A 2ZJRL 3MEDB 3CMQA 2H5XA 1Z2LA 4Q44A 1GTEA 2KRBA 1V6HA 4R0EA 4OX9K 1ZD2P 3H98A 2JGAA 3PW7A 3Q8VA 5D77A 4BE2A 4DUZF 4ED5A 1QVFM 4JS4A 5EDWA 2RSQA 1VRQC 5J2BA 4JMUA 1ZQCA 5AKXA 5IILA 3W64A 3TADA 2HWTA 5C0YA 4X4OA 1KL9A 2RUSA 2CNOB 2K3KA 4ES2A 3MN9A 2PMZF 4JLHA 1JCFA 5DB9A 4ZJQA 3VAJA 4CF8A 2U2FA 4OYIA 3EWGA 1W7WA 4KI6A 5FPNA 2P35A 1ZAVA 4O5KA 1V97A 4CJWA 5C10A 4E3SA 3M2UB 3EXYA 4DHVA 1UVNA 3SAFA 3UQ0A 4O5CA 4PZVA 2I1RA 4JKGB 4YCXA 2XG8A 4UATA 1ZOTA 2ERRA 3IUCA 5BRDA 4N41A 1ZQHA 5AXKA 3EX7B 2D5RA 1NM2A 3K5OA 2HSTA 1SAZA 4B6JA 1S10A 2E1FA 3T1HJ 2WAQD 3ZX3A 2G2YA 1FKAF 1ITPA 4JI0F 4YDUC 3IFRA 4C8YA 3OBIA 5AQVA 2EFNA 1U1OA 3DM2A 1WWVA 2PFNA 2ZIWB 1TKTA 3LANA 2BANA 2CDQA 2HAIA 4RJVA 2E2NA 2F8EX 2XLJA 1L3TA 1VQNS 3FK4A 4IKFA 4GXIA 4G9ZA 1SL2A 9ICAA 3H5UA 3NGKA 1KBRA 1RWWB 1H38A 3IRWP 1NSAA 3ENVA 2XHWA 3KLVA 1VLBA 1ZRMA 4ELUA 3P31A 7ICIA 2AJ0A 4DBQA 5IZHA 1QE1A 3OYFA 2ZJAA 3H6EA 3MN6A 5EWEA 1VQSA 2OM6A 3IP4B 2HBRB 3O1BA 4R8UB 4CQ1A 3BS7A 1FEHA 1DTTA 1I3OB 1SS6A 2D41A 1Q8IA 2QSFA 4LBPA 3TAMB 5JU5A 5AQQA 2HNDA 1QLNA 1RFQA 3OW2M 7FD1A 3QESA 2EFOA 3W60A 1XTZA 4FZNA 5LM7E 4CZIA 2HRTA 2WZ1A 3RB6A 2WSEC 4ZH4A 4JKHA 4FJHA