3N97B

Rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Combined structural model for a transcription activation assembly
rcsb
source organism Thermus aquaticus
molecule tags Gene regulation/dna
molecule keywords RNA polymerase sigma factor
total genus 21
structure length 75
sequence length 75
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3n97B00
2NRZA 2IBKA 4KLLA 4P4PA 8ICGA 4I29A 4EBCA 4BXOA 4DQRA 3IHQB 2W8KA 4B9TA 9ICRA 2BCSA 4PHDA 3KHLA 1T8EA 4M0AA 1TAQA 3OHAA 2MUTA 4YMNA 2R8IA 5J29A 1S0OA 3Q8MA 7ICVA 2ZJAA 2XCAA 4LZDA 1XO1A 3BQ0A 5KFRA 2MUTB 4J9LA 3G6VA 4YR2A 4JK1A 5KFNA 4FS2A 2KFZA 4F4ZA 2BPFA 3C2KA 3NTUA 3MDAA 2C2DA 1L3SA 9ICXA 3B0YA 4DF4A 5J0OA 5J2JA 1DOQA 2NRWA 1N56A 5CHGA 5BPCA 4F4WA 3RAXA 3BJYA 4F5PA 4I28A 4RT2A 8ICZA 1RYSA 4F4KA 3SI8A 4PH5A 2AQ0A 2JZBB 4C8KA 4F8RA 4YMMA 8ICOA 1TK8A 5J0SA 1EXNA 3RBDA 1RXVA 2JEIA 4DEZA 4KTQA 1Z00B 2BR0A 5IIKA 4C8MA 4BXOB 5KFZA 5KFMA 4YR0A 4TUSA 4DQPA 4UB1A 3SV4A 7ICRA 2UVWA 5KFHA 1Y88A 5KT2A 1Z00A 4UB5A 2Y1JA 4QWBA 3RH6A 5KFUA 3RRHA 1D8YA 4B9MA 5IIOA 3RJEA 3ZD9A 4RQ2A 4EEYA 1ZQBA 5KFVA 2XY5A 1ZQOA 2FMPA 4IQTA 5D49A 4M9JA 4YVZA 5F9LA 2F1JA 1IXRA 2DFLA 2XGPA 4GXJA 2ZTDA 4EZ9A 2XCPA 2FPMA 3MR6A 3LWMA 1BVSA 3HPOA 3PO4A 5J2HA 9ICLA 5F9NA 4QW8A 5J2DA 1NKCA 4RQ0A 4I2GA 3H8SA 1KDHA 3OHBA 4QWEA 8ICAA 1A76A 4QZAA 4M9GA 2KFNA 3UXNA 4R66A 1XS9D 5KFFA 4J9KA 1ZQHA 1XWLA 2JEFA 4F2RA 2IA6A 1L3TA 5KG3A 3TANA 5BOLA 4O5CA 4O3SA 5DB9A 5DB8A 3PR5B 8ICVA 3PNCA 5DLGA 5CA7A 3QEBZ 1SL2A 2F1HA 5DG9A 2HHQA 4DL5A 4YD2A 2W9BA 1ZETA 1QSSA 5KFWA 2J6UA 3ZDBA 5DDYA 3ISDA 1ZQWA 3AU6A 4ED1A 2BCVA 3UPQA 1TFRA 2PFNA 8ICKA 4QZDA 4DSLA 3UQ0A 3PO5A 3OJUA 5J0WA 2UVVA 4YXMA 4J9OA 2I1QA 3HP6A 1SKSA 1WCNA 4IRCA 4O5EA 7ICEA 4DLGA 4KLJA 3V6KA 4NM1A 3TARA 4QZBA 3UXOA 2AGPA 8ICPA 2BPGA 4ECZA 4RQ7A 3PX4A 5J0QA 4QZIA 1RPLA 3UXPA 3Q8RB 1S97A 3RJKA 4I2JA 4QZHA 3T3FA 5KFJA 3OGUA 9ICPA 3V7JA 1NOMA 4UQGA 4KN7A 4DQIA 1ZQVA 2FMSA 3RR7A 4JWMA 2UVRA 5DG8A 3GV7B 1ZQEA 1B43A 2ZUDA 1HJPA 2WTFA 3GIIA 3TFRA 4DFMA 1S77D 8ICLA 3H40A 2ALZA 3KTQA 5IIJA 3SV3A 3JPQA 3MGHA 1RZTA 4IQUA 4YCXA 1KFDA 3HT3A 4ECUA 4QW9A 5KFEA 2ISOA 2HHUA 3RJIA 2VA2A 4KMUA 4RQ8A 1ZQNA 4KLHA 4YP3A 9ICGA 4R8UA 5KFBA 5DB6A 4UB3A 2W9AA 4IRKA 1NK4A 4PGYA 1NK9A 1UT5A 3Q8PB 3H4BA 3PR4A 4F5QA 4RUAA 4MF2A 5DQHA 2PXIA 7ICHA 3KHHA 1ZQQA 1TKDA 4PGXA 5J2CA 3G6XA 1S0NA 2P6RA 1WCLA 5KFDA 4GC6A 2A1JA 4IR9A 3N4MB 8ICEA 1TVAA 2ZUBA 3B0XA 4UAYA 4GLXA 4RU9A 2J6TA 1ZQUA 2R8HA 5KT3A 3KHRA 2ATLA 4O3NA 3QZ8A 3TAPA 3RJFA 4RNMA 5D4BA 4M9HA 1ZQYA 2V9WA 5HMMA 4F5RA 2PI5A 5CJ7A 4ED7A 1X9SA 3GFKB 5KFYA 5CP2A 3MR2A 2DPJA 5KFSA 5KFTA 4Q8EA 1ZQGA 4NM2A 1UT8A 4MFFA 3EZ5A 4EYIB 2Q0ZX 3C1ZA 5DG7A 5IILA 4O9MA 3PX6A 5EWGA 1NK6A 3GIKA 2W8LA 4I2HA 5J2BA 5J2GA 5KFGA 2XY6A 1T7PA 1BPZA 1KTQA 9ICOA 3K75D 2XO7A 4KLSA 2HHVA 1KLNA 4NY8A 2JZBA 4MFCA 4RPYA 1U45A 5DQGA 4M47A 4ED0A 4RPZA 4K4HA 2ZUCA 2VANA 4XA5A 4YQWA 2BCQA 8ICFA 5DBCA 5KG2A 3JPSA 1D9FA 4RZRA 1L3UA 2HHTA 4Z6CA 1PZNA 4O3OA 1NK0A 4DWIA 4ZH4A 4BDPA 1DGSA 4KLOA 1U47A 3C23A 5KG5A 2R8JA 5KG6A 2W9CB 4ELUA 1BPEA 5IINA 1Z3EB 4I27A 7ICLA 4J9RA 2HHXA 1UA1A 2BQUA 1ZQJA 2PFQA 4QWCA 3FYHA 4TQRA 7ICPA 4I2FA 1S0VA 2KTQA 3H4DA 7ICNA 5DLFA 3PMNA 3PW0A 3TFSA 1NK5A 1TK5A 8ICNA 5D46A 2BGWA 4JV2A 3SZ2A 4GC7A 4RQ6A 1CEZA 4DOCA 8ICUA 3HX0A 2BDPA 4NXZA 5DDMA 9ICIA 3EYZA 2ZTEA 3BQ2A 4DSFA 1SKRA 1MQ3A 4F4XA 1T4GA 1ZJMA 1MC8A 4DFKA 3GQCA 2VA8A 4M6WA 1A77A 5J2AA 5CR0A 2ASJA 2AGQA 4DL2A 1KFSA 1ZQLA 3C21A 1NK7A 5HHIA 4YD1A 4C8LA 3BQTA 3G6YA 3OJSA 3JPNA 1BPYA 2AJQA 5KFAA 4TQSA 1JXLA 2ZTCA 3K4GA 5J2FA 7ICQA 5IIMA 3M8SA 4B9LA 2M9NA 5J2EA 3MBYA 3OSNA 4DSJA 3GIJA 8ICRA 8ICCA 4J9SA 4UBCA 4QZGA 4ELVA 9ICBA 3IM1A 1HUZA 3KHGA 1CUKA 4FBUA 4GXKA 4KLDA 4JUZA 1JN3A 5TZVA 4EBDA 2BQ3A 8ICMA 2IHNA 3T5LA 5KG7A 2FPLA 4QZFA 3MGIA 3BQ1A 3ZDAA 5KFIA 4KLEA 5KFQA 1TK0A 5J0YA 4LVSA 4DL7A 4TUQA 4NLZA 1K1SA 3M9NB 3QEAZ 9ICJA 2V4QA 4GXIA 2RDJA 4MEXA 2ZJ8A 5KFCA 3RJJA 7ICJA 7ICTA 5DGBA 2AU0A 4O3RA 4NLGA 4M6WB 3ZDEA 8ICYA 4ELTA 2HW3A 4RQ3A 2I9GA 4KLMA 1ZJNA 4ECVA 4EZ6A 2HVIA 3MDCA 3HW8A 9ICKA 3Q8LA 1ZQXA 4J9NA 4NLKA 5DB7A 2FLPA 9ICEA 3GIMA 8ICHA 3V6HA 4RNOA 4F50A 7ICIA 3LWLA 2KZMA 1BPBA 3GV5B 5KFPA 3TAQA 1QSLA 5HP4A 4F5OA 4MEYA 3LDAA 1BGXT 4RQ1A 3HWTA 3ORYA 5KT5A 4C8NA 3M9OB 5J2IA 3JPRA 3M8RA 1ZQIA 4M9LA 9ICMA 2BCRA 4M04A 4DFJA 2C2RA 4RT3A 2FLLA 2PFPA 4B9VA 3RRGA 4R65A 3MR5A 3TI0A 2AGOA 2GWSA 4PHPA 1XU4A 4F92B 4Q43A 4HYKA 4I2BA 1XSPA 4IQWA 3NGDA 4J9PA 3V72A 4JV1A 1U48A 3OSPA 4DL4A 5L1KA 4YMOA 3QZ7A 4DOBA 2BKEA 4P2HA 4B9SA 3PY8A 1B22A 3RH5A 7ICMA 3GILA 4DS4A 1U9LA 4YR3A 5EWEA 2KZ3A 4I2IA 3AU2A 5HMLA 4UB4A 2BQRA 4NLNA 1ZQCA 4B9NA 1JX4A 4FBTA 3MABA 4R8UB 2C28A 4M9NA 2JEGA 4KN4A 3RB4A 1ZQMA 3ZDCA 5KFKA 4YFKA 3ISCA 4KLIA 1RXWA 5KT6A 3RR8A 2H5XA 4DF8A 2FLNA 4BWJA 2AQ4A 3JPOA 5KT7A 4KLFA 9ICQA 5CWRA 4XRHA 3JPPA 1S76D 9ICFA 5CB1A 3RBEA 1XSLA 1MSWD 3RTVA 3PW7A 3EW9A 3LK9A 2IHMA 4ED3A 4QWAA 3TQ1A 1S9FA 3ZDDA 2KZZA 3C5GA 2R8KA 1RYRA 4PHAA 5KG4A 4DOAA 3THVA 1ZYQA 4E0DA 2PFOA 3FDSA 9ICSA 5KG1A 1TAUA 2VA3A 2ISPA 2FPKA 3T5HA 5J0XA 4ED2A 4RNNA 4RQ4A 1ZQAA 9ICHA 2ZJ5A 4JWNA 4DO9A 8ICWA 1LV5A 1C7YA 4QZ8A 3N97B 5J0RA 3RH4A 2ASDA 8ICIA 1KFTA 2W9MA 5J0PA 4M2YA 4DS5A 2OWOA 1SZPA 1JXEA 4PGQA 5JUMA 4CCHA 3E2EA 4I2AA 1JIHA 3RJGA 5L9XA 1X2IA 4Q45A 4DQQA 3MFIA 3MFHA 5J2KA 3V7KA 2IMWP 5HNKA 2V4RA 4F4YA 4DLEA 4J9QA 3Q8KA 4LZGA 3MR3A 4Z6FA 4DL3A 3JPTA 3ETLA 1XC9A 3PW2A 2XGQA 3H8WA 5DBAA 7ICKA 1KEJA 1SL1A 4BGDA 2UVUA 3AUOA 4C8OA 2NRTA 1SL0A 7ICFA 7ICGA 4X5VA 1L5UA 3C2MA 8ICSA 4ECXA 2Y1IA 7ICSA 3C5FA 4PHEA 2NRXA 2W9CA 4XUSA 4KLQA 1D8LA 4I2DA 4TURA 4FO6A 2XY7A 2F1IA 3Q8SB 5L1LA 4P4OA 3C1YA 3PW4A 4FS1A 1QSYA 4B9UA 9ICNA 4P4MA 4J9MA 1D9DA 4QZCA 4QZEA 4RQ5A 5J0UA 3V6JA 2JEJA 4O0IA 4UBBA 5KFXA 5HHHA 4F2SA 1SKWA 2LYHA 4MF8A 1BPDA 2KN7A 3RB0A 4DL6A 4G3IA 4DSEA 2PI4A 2MAXA 1XSNA 1ZQTA 5DQIA 4UB2A 2FMQA 1NJXA 3PW5A 2RDIA 3PV8A 1COOA 2BPCA 2R8GA 1QTMA 5KFOA 9ICUA 1IM4A 4DSIA 3M9MB 2P66A 4Q44A 5L1JA 4O3PA 3T5JA 1U4BA 2HHSA 9ICTA 1NJZA 5EOZA 1X9WA 1S10A 4R63A 4KLTA 1K1QA 1V9PA 4RPXA 4ECRA 4XQ8A 4Q8FA 5KFLA 3ZD8A 1KSPA 4I2EA 2XC9A 5L1IA 3QE9Y 1T3NA 4ECYA 2NRVA 1KRPA 4R64A 1H38A 5IIIA 5DKWA 8ICBA 4DSKA 7ICOA 5KT4A 4QWDA 4UAZA 9ICCA 5DGAA 8ICXA 4QZ9A 4BWMA 4Z6EA 1U49A 1NKEA 1ZQPA 3PVXA 4YG2A 4YXJA 1LB2B 4O3QA 1S0MA 4EYHB 3Q8QB 2W9BB 4RUCA 4F91B 5KG0A 1X9MA 4ECSA 4DQSA 2DPIA 4ECWA 2P6UA 4ECTA 3BDPA 1BPXA 4PPXA 9ICAA 1TV9A 4F3OA 4MFAA 4KLUA 1QLNA 4ECQA 1N48A 1NK8A 4I2CA 1HUOA 1AROP 3EWAA 3PMLA 4ED8A 1MQ2A 4Z6DA 5KTQA 4EBEA 2BCUA 4K4IA 4IRDA 1ZQSA 3ISBA 1ZQZA 5BOMA 4O5KA 8ICQA 4YN4A 9ICVA 3T5KA 1NKBA 4TUPA 4F5NA 1ZQRA 5EWFA 5J0TA 4IR1A 2HVHA 7ICUA 4DFPA 4IQVA 3PX0A 3GV8B 4F93B 3C2LA 2A1JB 1UA0A 2ASLA 2C2EA 8ICJA 9ICWA 1ZQDA 3V7LA 3RB3A 5C5JA 4K4GA 4JV0A 4KLGA 2J6SA 5DBBA 1NJWA 1ZQKA 1NJYA 2HHWA 2B21A 3SYZA 3GDXA 3EPGA 3H7IA 1JMSA 4KITB 2BHNA 1ZQFA 4ED6A 8ICTA 4UAWA 3RB6A 3EPIA 3UQ2A 3RJHA 3H8JA 3RAQA 2C22A 1L3VA
chains in the Genus database with same CATH superfamily
8ICGA 4EBCA 4DQRA 2LBOA 5AK4A 1TAQA 3OHAA 2E8NA 2MUTA 2R8IA 4CRXA 2E1FA 4FE3A 1XO1A 2G09A 2KJ9A 2MUTB 4P0PB 2VJ5A 4F4ZA 1L3SA 1ZD4A 5J2JA 2NRWA 1KKXA 5CHGA 3BJYA 4F5PA 5ALFA 4RT2A 4UB8U 1V85A 2AQ0A 1IV8A 3IDWA 2JZBB 4C8KA 3RBDA 1RXVA 1N5XA 3L5KA 3IV6A 1Z00B 5KFZA 4YR0A 4TUSA 2UVWA 5KT2A 1Z00A 4QWBA 1O03A 5KFUA 3HRDD 5IIOA 5AK3A 4OO1J 1DK3A 4M9JA 4YVZA 2F1JA 1IXRA 4EZ9A 2ZTDA 2XCPA 2FPMA 3FM9A 3MR6A 3KD3A 3H0MB 3N7RC 2YTUA 9ICLA 5F9NA 2ZIVB 1KDHA 4QWEA 3KKAC 1XS9D 4OD0A 5KG3A 4DFDA 5BOLA 4O3SA 2OYYA 4F71A 5DB8A 1YZ7A 4ACOA 5CA7A 1SL2A 2HHQA 2W9BA 3IG8A 2KG5A 3ZDBA 5AKYA 4UATA 3PZPA 3AU6A 2BCVA 3UPQA 8ICKA 2G5HB 4FZMA 4DSLA 3PO5A 3OJUA 5J0WA 2UVVA 1FO4A 3CP8A 4C7YA 3HP6A 3KKAA 1FIQA 4CE6A 3TARA 4OJ5A 5AIBA 4IL6U 8ICPA 4ECZA 3PX4A 1DXSA 5A0LA 3TADC 3QUTA 3OGUA 2HI0A 2YX8A 4JWMA 2G07A 5DG8A 1HJPA 1S77D 4Y2PA 5IIJA 2KICA 2GLEA 4YCXA 1KFDA 3E58A 2HHUA 1C20A 4KMUA 4IRKA 3QU2A 1MN8A 2B6GA 1UT5A 4F5QA 2PXIA 3KHHA 2P6RA 4GC6A 5KFDA 4CDGA 2A1JA 8ICEA 2R8HA 3QZ8A 5D4BA 1ZQYA 4F5RA 1N60A 4ED7A 5KFYA 2ESEA 2DPJA 4NLCA 4AP9A 4Q8EA 1JUDA 1V97A 2D8CA 5EWGA 4Y2VA 1S8OA 3PX6A 2XY6A 3K75D 2HHVA 1KLNA 4NY8A 4MFCA 4RPYA 2FI1A 4ED0A 4K4HA 4XA5A 8ICFA 3F2BA 4Z6CA 3S6JA 5ALZA 1DGSA 4KLOA 2CRXA 5ALKA 1BPEA 3BQ7A 5IINA 4IC9A 2ZIWB 7ICPA 2W7PA 1S0VA 1Z1VA 4BJQA 2K60A 4CF5A 2OCEA 4RQ6A 4DOCA 4NXZA 5DDMA 3EYZA 1T4GA 3SMVA 2VA8A 4M6WA 5AM4A 5J2AA 4DL2A 3H8MA 3G6YA 1RDFA 3OJSA 2MA1A 3JPNA 2AJQA 2KIVA 3QXGA 2LM1A 5J2EA 3OSNA 3SENA 3GIJA 4J9SA 4QZGA 2WF8A 5TZVA 3IP4B 4QZFA 3MGIA 3AEVA 4TUQA 4NLZA 3M9NB 1SV0C 5F3XB 9ICJA 2RDJA 2KVCA 4MEXA 7ICTA 2KSOB 5AICA 3CW2C 4KLMA 4ECVA 3MDCA 3HW8A 2W11A 2FLPA 2EAPA 5ALIA 4F50A 2KD1A 3TAQA 4RQ1A 5KT5A 5J2IA 3M9OB 1ZQIA 2W54A 2FLLA 4R65A 3MR5A 2W55A 4Q43A 2WAQF 3KZXA 4IQWA 3KOOA 1BNOA 2JMGA 3NS1A 4DL4A 3OSPA 3QZ7A 3PSFA 4DOBA 2BKEA 4EENA 2E8PA 7ICMA 4G9BA 3GILA 1U9LA 5AI4A 4YR3A 4UB4A 1ZQCA 4FBTA 2E8MA 3AMZA 4RQMA 3ISCA 3B9JA 3RR8A 2FLNA 5KT7A 4KLFA 4ZOHC 3ALRA 3JPPA 2AH5A 5CB1A 3PW7A 2KZZA 1ZRNA 3C5GA 2QKQA 5KG4A 2KMDA 5KG1A 4AYBF 2ISPA 2FPKA 4GFJA 2W7OA 9ICHA 2OM6A 2MU2A 3C28A 5GTIU 4KX3A 1C7YA 5J0RA 2ASDA 1KFTA 5J0PA 2AXTU 1JXEA 4CCHA 2WHEA 1X2IA 4DQQA 3MFIA 3M7DA 3V7KA 5HNKA 3CRXA 4DLEA 4LZGA 3ETLA 1XC9A 3SR6A 3PW2A 4NL9A 4IS7A 1QQ6A 3VCBA 1CRXA 1SL1A 2NRTA 1SL0A 7ICFA 3C2MA 8ICSA 1ZD3A 4XUSA 4TURA 4FO6A 2BDPA 5L1LA 1QSYA 4P4OA 3C1YA 2PKEA 3IRUA 4CF4A 1A0PA 3RB0A 1NI3A 2MAXA 1XSNA 1SV4A 2ZIXA 3PW5A 3NVZA 1IM4A 5L1JA 2HHSA 9ICTA 5EOZA 1S10A 2EZYA 3AN1A 5J8YC 2NYVA 4ECRA 2PMZF 5KFLA 2Q4TA 2KK0A 5DKWA 2K89A 1D8BA 4QWDA 2IOFA 4Z6EA 3HJEA 1J2MA 5G5GA 5L1MA 3Q8QB 4DQSA 2DPIA 2P6UA 3NRZA 1BPXA 4PPXA 9ICAA 1TV9A 4KLUA 4ECQA 4CF3A 4US8A 5KTQA 4IRDA 1SWVA 3T5KA 3WKCA 3MGVA 2HVHA 4IR1A 1PK1B 2RHFA 2A1JB 1L8LA 3MC1A 3RB3A 2JHDA 5KNIA 5G5HA 1T3QA 1ZOLA 1NJYA 2E8OA 3FC4A 1JMSA 4KITB 2HMXA 2E1EA 2GH1A 1FFVA 2FJ6A 2C22A 5AIAA 2QB0A 4P4PA 4I29A 3IHQB 2W8KA 9ICRA 2BCSA 4J03A 4PHDA 3KHLA 5J29A 3PSPA 1L8OA 2ZJAA 4LZDA 5KFRA 4J9LA 2KFZA 2BPFA 1WWVA 3MDAA 9ICXA 3KZIU 2WF6A 4DF4A 1DOQA 1N56A 4F4WA 3WK5A 5AM3A 8ICZA 4F4KA 4PH5A 2K8AA 2FE9A 8ICOA 2Y9UA 2JEIA 4DEZA 2F77X 4KTQA 5KFMA 7ICRA 4PJ0U 2K8CB 2Y1JA 3RH6A 1D8YA 4B9MA 2Y0SF 4FFDA 5GTHU 5KFVA 2XY5A 4UB6U 4EELA 4PZNA 2XGPA 1J97A 4PZOA 1BVSA 3HPOA 3PO4A 5ALDA 5J2HA 2GOLA 4FZLA 4RQ0A 3OHBA 4QZAA 4M9GA 3UXNA 4R66A 5ALEA 2HOFA 1ZQHA 1XWLA 2JEFA 5KL1B 4F2RA 3UM9A 2HBKA 3I28A 3PNCA 2F1HA 1WWUA 4DL5A 4YD2A 2F3NA 1ZQWA 4ED1A 3UMGA 2PFNA 2KJ8A 3UQ0A 2F8KA 4YXMA 5AKJA 3SD7A 1SKSA 1WCNA 1P7DA 4DLGA 1F0MA 2G0AA 4RQ7A 4QZIA 1WUDA 1S97A 4QZHA 5KFJA 4KN7A 4DQIA 2FMSA 1LKYB 2WTFA 8ICLA 3MGHA 4ECUA 1X40A 3RJIA 4KLHA 1ZQNA 3QU5A 1SIJA 3QUBA 4PGYA 5AK6A 3TADA 1X6JA 4O3MA 4UAYA 4GLXA 2O6KA 1DRGA 2ATLA 1B0XA 3TAPA 4Y2TA 2V9WA 2PI5A 5CJ7A 1RG6A 1X9SA 3GFKB 1AQ6A 4Y2SA 5ALUA 4QIWF 5ALJA 2MRLA 2QARB 3E0FA 1PVRA 4NM2A 5EE3A 4MFFA 3EZ5A 3C1ZA 2YMQA 1NK6A 5J2BA 5J2GA 5KFGA 2BZFA 4M47A 4RPZA 2BCQA 2VANA 3T79A 5DBCA 5KG2A 3JPSA 2GO7A 4CNQA 2HHTA 3M6KA 4BDPA 1RM6C 1U47A 4ELUA 5KG6A 4J9RA 1UA1A 2BQUA 2PFQA 4JMUA 3FYHA 4TQRA 5ALTA 2K4EA 5DLFA 3PMNA 1NK5A 8ICNA 3NVYA 1QQ7A 9ICIA 2ZTEA 4F4XA 4DFKA 1Z1BA 3GQCA 3K1ZA 2KSOA 1KFSA 2K4HA 2WF7A 2WF9A 3BQTA 1BPYA 5KFAA 2ZTCA 3K4GA 5AKZA 5J2FA 5IIMA 4B9LA 3MBYA 8ICCA 3F53A 3KHGA 4GXKA 2EDUA 8ICMA 3T5LA 2FPLA 3BQ1A 2OXOA 5KFIA 5KFQA 1TK0A 5AI8A 5J0YA 2VKQA 1K1SA 3RFAA 2HBLA 2V4QA 4GXIA 4QNLA 3RJJA 7ICJA 4O3RA 4NLGA 4C80A 1YT3A 2BDUA 9ICKA 4NLKA 5DB7A 3GIMA 8ICHA 4RNOA 5KFPA 2XVTA 3HWTA 3ORYA 1L7MA 9ICMA 4M04A 2C2RA 5ALXA 3O0FA 4PHPA 4KX5A 1N2XA 1Z4NA 1XSPA 3NGDA 4J9PA 2LYBA 4YMOA 4P2HA 2WB1F 4B9SA 2E5SA 3BS7A 4DS4A 2BQRA 4B9NA 3MABA 2JEGA 3RB4A 2XICA 1RXWA 3D6JA 1HIWA 4USAA 3JPOA 5CWRA 4XRHA 3BS5B 1S76D 3A0HU 3EW9A 2IHMA 4ED3A 4QWAA 4DOAA 3PSIA 3FDSA 2VA3A 4Y2RA 4ED2A 4RQ4A 3QNMA 1ZQAA 1N5WA 8ICWA 1LV5A 4QZ8A 2QARA 8ICIA 4M2YA 5JTIA 5ALVA 4DS5A 2KEYA 4U6PA 4KMOB 1SZPA 5JUMA 3RJGA 5L9XA 4Q45A 2IMWP 2V4RA 1J2NA 2JH7A 2HBMA 1UQVA 3MR3A 4Z6FA 4CGZA 4DL3A 4F72A 2MSNA 4P0QA 3FAHA 7ICKA 4BGDA 3AUOA 2F8LA 7ICGA 4NLBA 1VDVA 7ICSA 3D2QA 2NRXA 4I2DA 3QYPA 4FS1A 4QZCA 5J0UA 2JEJA 4UBBA 5HHHA 1ZD5A 5DQIA 2FMQA 2EZZA 4UARA 4NL9C 1X9XA 3PV8A 2BPCA 2R8GA 2HBJA 2VIXA 2CN1A 1K1QA 3BS5A 4RPXA 4Q8FA 3ZD8A 5L1IA 2LHTA 2RQ5A 5IIIA 8ICBA 1N61A 9ICCA 5ALGA 4QZ9A 3GU3A 4BWMA 1ZQPA 2Y9TA 4YG2A 1LB2B 4O3QA 1S0MA 4EYHB 2A19A 4RUCA 4F91B 3QUCA 3AL0B 5KG0A 1RQLA 1N62A 4ECSA 5EE0A 4ECWA 3BDPA 4F3OA 1QLNA 3BZCA 2AHOB 3EWAA 1MQ2A 4ED8A 1HUOA 2BCUA 5JRTA 4F5NA 1ZQRA 7ICUA 5AKEA 2K8BB 3AM9A 4IQVA 3SAGA 3C2LA 2EZXA 2WAQC 5AM0A 4KLGA 2J6SA 1NJWA 1ZQKA 3SYZA 2B21A 3EPGA 3OTQA 3H7IA 4FZNA 1ZQFA 4UAWA 4DCCA 5JU5A 2KIWA 4KLLA 1QH9A 5ALNA 2PMZC 1K5OA 1OW5A 3L4PA 3QUQA 1XO0A 4NWIA 2I6XA 4ICAA 2XCAA 2CPRA 2JH1A 1T94A 3G6VA 4JK1A 3TACB 3WU2U 2C2DA 3B0YA 3WK9A 5K4LA 2KKPA 4I28A 3RAXA 5AK5A 4EX7A 1RYSA 1URJA 4C4TA 4YMMA 1EXNA 1QCKA 2OH2A 5IIKA 4C8MA 4BXOB 1UCVA 4UB1A 3QU7A 3SV4A 2YQEA 2EAOA 2ES6A 1Y88A 3D2SA 2W3SA 3DEEA 3RRHA 3RJEA 3ZD9A 4RQ2A 4EEYA 2D3DA 1ZQBA 4IQTA 5D49A 5F9LA 3NVVA 3LWMA 1JALA 3F5AA 2LM4A 2DKXA 1A6SA 3ETRA 4QW8A 5J2DA 4I2GA 1OXJA 2EH9A 2DBYA 8ICAA 1A76A 5KFFA 4J9KA 3RF9A 2IA6A 4Y2UA 4O5CA 2YB1A 3PR5B 5KL8B 1ZETA 3KBBA 3ISDA 5AM1A 1TFRA 1UHUA 1X6IA 4IRCA 4KLJA 3V6KA 1IIPA 3UXOA 4QZBA 2HOIA 5AKHA 2BPGA 2LYAA 1YZ6A 5AI5A 3Q8RB 3RJKA 1L7OA 2W03A 4B6JA 9ICPA 1NOMA 1ZQVA 4HAIA 3GV7B 3GIIA 1KW4A 2ZUDA 5AI0A 3H40A 2ALZA 3KTQA 3KFUF 2VJ4A 1RZTA 1Q3VA 3C29A 3HT3A 4QW9A 1JI7A 1PVQA 9ICGA 2DQNB 4YP3A 4R8UA 2P35A 5DB6A 4UB3A 2W9AA 1NK4A 1NK9A 3Q8PB 2XI9A 1S5LU 5H2FU 4RUAA 4MF2A 1L7PA 5DQHA 7ICHA 5J2CA 1WCLA 4IR9A 2ZUBA 3B0XA 2J6TA 4RU9A 3NASA 1BNPA 5KT3A 3KHRA 3RJFA 4RNMA 4M9HA 3EUB2 5HMMA 3PSTA 1KBUA 2F44A 3AQEA 1VLBA 1ZQGA 3WKAA 2Q0ZX 4EYIB 5DG7A 5IILA 4O9MA 2A3VA 3GIKA 2WFAA 4C0ZA 1ZRMA 1DGJA 1T7PA 1BPZA 2XO7A 1TAMA 3BZKA 1KQQA 1U45A 2ZUCA 4YQWA 1M6YA 1D9FA 1L3UA 5AKKA 1NK0A 2G5IB 3C23A 5KG5A 2W9CB 1KN5A 4I27A 1Z3EB 2HHXA 3CYMA 2Y0SC 1ZQJA 3F2DA 5CEHA 3H4DA 3PW0A 3TFSA 5KAIU 4EEKA 3SZ2A 2DWQA 4GC7A 2LMRA 2QB0B 3BQ2A 3N7PD 4DSFA 1SKRA 3WK7A 1ZJMA 1MC8A 3CNHA 2G08A 2AGQA 1ZQLA 2F76X 3N7SC 3C21A 1RYUA 2JRZA 5HHIA 2ZIUA 1NZPA 4UW9A 4Y2XA 3M8SA 2M9NA 3ICXA 3J81j 4DSJA 8ICRA 4UBCA 4ELVA 9ICBA 3IM1A 4UASA 1CUKA 5TISU 4JUZA 1JN3A 3LVVA 2IHNA 5KG7A 1CI4A 2EANA 3ZDAA 4DL7A 2LI6A 3ZI4A 5ALQA 4UAVA 2ZJ8A 5KFCA 2AU0A 1ECWA 2YN4A 3ZDEA 4ELTA 4RQ3A 1ZQXA 2KZMA 5AHXA 7ICIA 3LWLA 4EX6A 1IG6A 4F5OA 4MEYA 1X66A 1BGXT 3LDAA 4M9LA 4C8NA 3JPRA 3M8RA 1WG8A 4DFJA 4RT3A 3I76A 2PFPA 4B9VA 2AGOA 2GWSA 4HYKA 3V72A 1Z4OA 1U48A 5L1KA 2DKZA 5AI6A 1B22A 3RH5A 1F44A 4MHVA 4I2IA 3AU2A 5HMLA 4NLNA 2KJ5A 1JX4A 4R8UB 2H3QA 4KN4A 1KL9A 4YFKA 5KT6A 4DF8A 4BWJA 9ICQA 3M6ZA 9ICFA 3RBEA 1MSWD 3RTVA 1XNSA 3I1YA 1ZYQA 2PFOA 9ICSA 5J0XA 4RNNA 1SGGA 1FFUA 1O08A 3AQFA 1PK1A 1X42A 3RH4A 1N63A 2OEHA 2OWOA 3E2EA 4I2AA 1JIHA 2A1AA 3MFHA 3Q8KA 4J9QA 1PVPA 3JPTA 2XGQA 4OJPA 5DBAA 4X5VA 4ECXA 4A8EA 4PHEA 4KLQA 1D8LA 2XY7A 2F1IA 2H3VA 3Q8SB 3PW4A 4P4MA 4J9MA 4RQ5A 4QZEA 3V6JA 5KAFU 5EE9A 4F2SA 2ZIVA 1SKWA 2LYHA 4MF8A 4DL6A 4G3IA 4DSEA 1ZQTA 4UB2A 3WK4A 2RDIA 1COOA 1QTMA 5KFOA 9ICUA 4DSIA 3M9MB 4O3PA 4KLTA 1V9PA 4P0PA 2ZIUB 4I2EA 1T3NA 4ECYA 2NRVA 2DUYA 4R64A 1H38A 1SWWA 7ICOA 4UAZA 4NV0A 1NKEA 3PVXA 4YXJA 2W9BB 3N28A 3R9KA 2G06A 3SAFA 4Y2JA 1COKA 5AKLA 1NK8A 3PMLA 5HR6A 2H3ZA 2W43A 4Z6DA 4K4IA 2K4IA 5BOMA 3ISBA 9ICVA 3OPXA 3D2NA 5EWFA 5J0TA 4DFPA 4P0QB 3GV8B 4F93B 1UA0A 9ICWA 8ICJA 3SAHA 5T14A 1ZQDA 2YY6A 3V7LA 4JV0A 5ALRA 3LVWA 5ALSA 5DBBA 2HHWA 2YMLA 2JV3A 2HOQA 5ALMA 2BHNA 3HILA 1Z19A 1GO3F 4ED6A 3RB6A 3EPIA 5AKIA 1L3VA 2NRZA 2IBKA 4BXOA 4B9TA 3NUQA 1T8EA 4M0AA 2ZXHA 3IG5A 4YMNA 2W04A 1S0OA 3Q8MA 3WK8A 7ICVA 2IOHA 4BUGA 3BQ0A 2OHFA 3L3FX 4YR2A 5KFNA 4FS2A 2LPEA 3C2KA 3NTUA 1L6NA 5J0OA 2KV2A 5BPCA 2L5YA 3SI8A 3DDHA 4F8RA 1TK8A 5J0SA 3ONNA 3SEIA 2BR0A 4JB3A 4DQPA 3QU4A 5KFHA 1SB3C 4UB5A 1ZQOA 2FMPA 2DGZA 2DFLA 4GXJA 2M0NA 2F2AB 1NKCA 5AKXA 1Q8KA 1SZHA 3H8SA 1ZD2P 5HR7A 2KFNA 2LKYA 4QJFB 3HKZF 1L3TA 3TANA 2JXJA 4WJ3B 5DB9A 8ICVA 2NO5A 5DLGA 3QEBZ 1LVHA 5DG9A 2HDOA 5E79U 1PK3A 2B0CA 1QSSA 5KFWA 2J6UA 4UAUA 5DDYA 4QZDA 3NRWA 2KNJA 4J9OA 2I1QA 5B66U 7ICEA 4O5EA 4C4SA 2KHQA 4NM1A 4C7ZA 2AGPA 3WKBA 5J0QA 1RPLA 3UXPA 1MA7A 4I2JA 2YB4A 3T3FA 2H3FA 1SXDA 3V7JA 3QX7A 4OCZA 4UQGA 2RRDA 3RR7A 2UVRA 1ZQEA 1B43A 3TFRA 4OJ6A 4DFMA 5ALLA 3SV3A 4GIBA 3JPQA 4IQUA 5ALOA 5KFEA 2ISOA 2VA2A 4RQ8A 5KFBA 3H4BA 3PR4A 4PL1A 3UMBA 2Z7JA 2HCFA 1ZQQA 1TKDA 4PGXA 1Q46A 3G6XA 1S0NA 3N4MB 1TVAA 1ZQUA 2DF4B 5EE1A 2KOBA 4O3NA 2EQYA 1F5SA 2NV3A 2WB1C 5CP2A 3MR2A 5KFSA 5KFTA 1UT8A 2W8LA 4I2HA 5FP0A 1DK2A 1KTQA 1RQNA 9ICOA 4KLSA 5AKGA 2JZBA 5C0YA 5DQGA 4BX9C 3IN5A 4U7CA 4RZRA 1PZNA 4O3OA 4DWIA 4ZH4A 2R8JA 2XIDA 3VC8A 7ICLA 4LJXA 4QWCA 2QB1A 4I2FA 2KTQA 7ICNA 1TK5A 5D46A 2BGWA 4JV2A 1CEZA 2KKVA 8ICUA 3HX0A 1MQ3A 2N1RA 1A77A 1SV0A 5CR0A 2ASJA 1NK7A 4YD1A 4C8LA 1V38A 4TQSA 1JXLA 1NNLA 7ICQA 2ZIWA 4Y2YA 1JRPA 2ZIXB 1TE2A 2KHVA 1HUZA 4FBUA 4KLDA 4EBDA 2BQ3A 1ZQ1C 2R18A 4KLEA 4LVSA 5ALPA 5B5EU 3QEAZ 5DGBA 3WKEA 3F5EA 4M6WB 5AM2A 8ICYA 2HW3A 2KE7A 4AYBC 2I9GA 1JROA 1ZJNA 3TKAA 4EZ6A 2HVIA 2ZG6A 3Q8LA 4RQNA 4J9NA 2IOFK 9ICEA 2ZXIA 1L7NA 3V6HA 2DL0A 1BPBA 4US9A 3GV5B 1VJ5A 1QSLA 5HP4A 2H3IA 5ALHA 1UPHA 2BCRA 3RRGA 3TI0A 3H0LB 3UMCA 1XU4A 4F92B 4I2BA 2JGAA 3GZFA 4JV1A 4C4RA 4NJ8A 3PY8A 4OJOA 5EWEA 2ODGA 2KZ3A 2WF5A 4M9NA 2C28A 1ZQMA 3ZDCA 5KFKA 4KLIA 3NVWA 2H5XA 5AI9A 2AQ4A 1QQ5A 5ALWA 1XSLA 5CRXA 3LK9A 3TQ1A 1S9FA 3LYSA 3ZDDA 2R8KA 1RYRA 4PHAA 2YMPA 3THVA 4E0DA 1TAUA 3T5HA 2ZJ5A 3F2CA 4DO9A 4JWNA 2HSZA 3N97B 3U26A 2W9MA 3H0RB 1PUZA 4PGQA 1ED1A 5J2KA 4F4YA 1FEZA 3DV9A 3M1YA 2KVSA 3H8WA 4Y2QA 1KEJA 2UVUA 4C8OA 1L5UA 5J8YA 2Y1IA 3C5FA 2W9CA 4B9UA 2E3TA 9ICNA 5AM5A 1D9DA 1Q3UA 2JR5A 4O0IA 5KFXA 3HKZC 2KN7A 1BPDA 2RP5A 2PI4A 3K1RB 4QIWC 1NJXA 1B4FA 2P66A 4Q44A 3T5JA 1U4BA 1NJZA 1SXEA 1X9WA 4R63A 4XQ8A 1KSPA 2XC9A 3QE9Y 1KRPA 2YMMA 2W3RA 4DSKA 5KT4A 2I5HA 5DGAA 8ICXA 1LKYA 1U49A 2FDRA 3QU9A 2RLTA 2KP7A 3SQIA 1NZBA 2NO4A 3ED5A 4PL2A 1X9MA 3WKDA 4ECTA 1OUQA 4MFAA 1N48A 2D6FC 4I2CA 1AROP 4EBEA 1ZQSA 4O5KA 1ZQZA 8ICQA 2QLTA 4YN4A 1NKBA 1HEKA 4TUPA 3WK6A 2K4PA 2EAMA 3PX0A 2ASLA 2C2EA 4K4GA 1WYGA 5C5JA 3A0BU 1ZXIA 2CXYA 5ALYA 3GDXA 8ICTA 3UQ2A 3RJHA 3H8JA 3RAQA 4OJLA
chains in the Genus database with same CATH topology
2NRZA 2IBKA 4KLLA 4P4PA 8ICGA 4I29A 4EBCA 4BXOA 4DQRA 3IHQB 2W8KA 4B9TA 9ICRA 2BCSA 4PHDA 3KHLA 1T8EA 4M0AA 1TAQA 3OHAA 2MUTA 4YMNA 2R8IA 5J29A 1S0OA 3Q8MA 7ICVA 2ZJAA 2XCAA 4LZDA 1XO1A 3BQ0A 5KFRA 2MUTB 4J9LA 3G6VA 4YR2A 4JK1A 5KFNA 4FS2A 2KFZA 4F4ZA 2BPFA 3C2KA 3NTUA 3MDAA 2C2DA 1L3SA 9ICXA 3B0YA 4DF4A 5J0OA 5J2JA 1DOQA 2NRWA 1N56A 5CHGA 5BPCA 4F4WA 3RAXA 3BJYA 4F5PA 4I28A 4RT2A 8ICZA 1RYSA 4F4KA 3SI8A 4PH5A 2AQ0A 2JZBB 4C8KA 4F8RA 4YMMA 8ICOA 1TK8A 5J0SA 1EXNA 3RBDA 1RXVA 2JEIA 4DEZA 4KTQA 1Z00B 2BR0A 5IIKA 4C8MA 4BXOB 5KFZA 5KFMA 4YR0A 4TUSA 4DQPA 4UB1A 3SV4A 7ICRA 2UVWA 5KFHA 1Y88A 5KT2A 1Z00A 4UB5A 2Y1JA 4QWBA 3RH6A 5KFUA 3RRHA 1D8YA 4B9MA 5IIOA 3RJEA 3ZD9A 4RQ2A 4EEYA 1ZQBA 5KFVA 2XY5A 1ZQOA 2FMPA 4IQTA 5D49A 4M9JA 4YVZA 5F9LA 2F1JA 1IXRA 2DFLA 2XGPA 4GXJA 2ZTDA 4EZ9A 2XCPA 2FPMA 3MR6A 3LWMA 1BVSA 3HPOA 3PO4A 5J2HA 9ICLA 5F9NA 4QW8A 5J2DA 1NKCA 4RQ0A 4I2GA 3H8SA 1KDHA 3OHBA 4QWEA 8ICAA 1A76A 4QZAA 4M9GA 2KFNA 3UXNA 4R66A 1XS9D 5KFFA 4J9KA 1ZQHA 1XWLA 2JEFA 4F2RA 2IA6A 1L3TA 5KG3A 3TANA 5BOLA 4O5CA 4O3SA 5DB9A 5DB8A 3PR5B 8ICVA 3PNCA 5DLGA 5CA7A 3QEBZ 1SL2A 2F1HA 5DG9A 2HHQA 4DL5A 4YD2A 2W9BA 1ZETA 1QSSA 5KFWA 2J6UA 3ZDBA 5DDYA 3ISDA 1ZQWA 3AU6A 4ED1A 2BCVA 3UPQA 1TFRA 2PFNA 8ICKA 4QZDA 4DSLA 3UQ0A 3PO5A 3OJUA 5J0WA 2UVVA 4YXMA 4J9OA 2I1QA 3HP6A 1SKSA 1WCNA 4IRCA 4O5EA 7ICEA 4DLGA 4KLJA 3V6KA 4NM1A 3TARA 4QZBA 3UXOA 2AGPA 8ICPA 2BPGA 4ECZA 4RQ7A 3PX4A 5J0QA 4QZIA 1RPLA 3UXPA 3Q8RB 1S97A 3RJKA 4I2JA 4QZHA 3T3FA 5KFJA 3OGUA 9ICPA 3V7JA 1NOMA 4UQGA 4KN7A 4DQIA 1ZQVA 2FMSA 3RR7A 4JWMA 2UVRA 5DG8A 3GV7B 1ZQEA 1B43A 2ZUDA 1HJPA 2WTFA 3GIIA 3TFRA 4DFMA 1S77D 8ICLA 3H40A 2ALZA 3KTQA 5IIJA 3SV3A 3JPQA 3MGHA 1RZTA 4IQUA 4YCXA 1KFDA 3HT3A 4ECUA 4QW9A 5KFEA 2ISOA 2HHUA 3RJIA 2VA2A 4KMUA 4RQ8A 1ZQNA 4KLHA 4YP3A 9ICGA 4R8UA 5KFBA 5DB6A 4UB3A 2W9AA 4IRKA 1NK4A 4PGYA 1NK9A 1UT5A 3Q8PB 3H4BA 3PR4A 4F5QA 4RUAA 4MF2A 5DQHA 2PXIA 7ICHA 3KHHA 1ZQQA 1TKDA 4PGXA 5J2CA 3G6XA 1S0NA 2P6RA 1WCLA 5KFDA 4GC6A 2A1JA 4IR9A 3N4MB 8ICEA 1TVAA 2ZUBA 3B0XA 4UAYA 4GLXA 4RU9A 2J6TA 1ZQUA 2R8HA 5KT3A 3KHRA 2ATLA 4O3NA 3QZ8A 3TAPA 3RJFA 4RNMA 5D4BA 4M9HA 1ZQYA 2V9WA 5HMMA 4F5RA 2PI5A 5CJ7A 4ED7A 1X9SA 3GFKB 5KFYA 5CP2A 3MR2A 2DPJA 5KFSA 5KFTA 4Q8EA 1ZQGA 4NM2A 1UT8A 4MFFA 3EZ5A 4EYIB 2Q0ZX 3C1ZA 5DG7A 5IILA 4O9MA 3PX6A 5EWGA 1NK6A 3GIKA 2W8LA 4I2HA 5J2BA 5J2GA 5KFGA 2XY6A 1T7PA 1BPZA 1KTQA 9ICOA 3K75D 2XO7A 4KLSA 2HHVA 1KLNA 4NY8A 2JZBA 4MFCA 4RPYA 1U45A 5DQGA 4M47A 4ED0A 4RPZA 4K4HA 2ZUCA 2VANA 4XA5A 4YQWA 2BCQA 8ICFA 5DBCA 5KG2A 3JPSA 1D9FA 4RZRA 1L3UA 2HHTA 4Z6CA 1PZNA 4O3OA 1NK0A 4DWIA 4ZH4A 4BDPA 1DGSA 4KLOA 1U47A 3C23A 5KG5A 2R8JA 5KG6A 2W9CB 4ELUA 1BPEA 5IINA 1Z3EB 4I27A 7ICLA 4J9RA 2HHXA 1UA1A 2BQUA 1ZQJA 2PFQA 4QWCA 3FYHA 4TQRA 7ICPA 4I2FA 1S0VA 2KTQA 3H4DA 7ICNA 5DLFA 3PMNA 3PW0A 3TFSA 1NK5A 1TK5A 8ICNA 5D46A 2BGWA 4JV2A 3SZ2A 4GC7A 4RQ6A 1CEZA 4DOCA 8ICUA 3HX0A 2BDPA 4NXZA 5DDMA 9ICIA 3EYZA 2ZTEA 3BQ2A 4DSFA 1SKRA 1MQ3A 4F4XA 1T4GA 1ZJMA 1MC8A 4DFKA 3GQCA 2VA8A 4M6WA 1A77A 5J2AA 5CR0A 2ASJA 2AGQA 4DL2A 1KFSA 1ZQLA 3C21A 1NK7A 5HHIA 4YD1A 4C8LA 3BQTA 3G6YA 3OJSA 3JPNA 1BPYA 2AJQA 5KFAA 4TQSA 1JXLA 2ZTCA 3K4GA 5J2FA 7ICQA 5IIMA 3M8SA 4B9LA 2M9NA 5J2EA 3MBYA 3OSNA 4DSJA 3GIJA 8ICRA 8ICCA 4J9SA 4UBCA 4QZGA 4ELVA 9ICBA 3IM1A 1HUZA 3KHGA 1CUKA 4FBUA 4GXKA 4KLDA 4JUZA 1JN3A 5TZVA 4EBDA 2BQ3A 8ICMA 2IHNA 3T5LA 5KG7A 2FPLA 4QZFA 3MGIA 3BQ1A 3ZDAA 5KFIA 4KLEA 5KFQA 1TK0A 5J0YA 4LVSA 4DL7A 4TUQA 4NLZA 1K1SA 3M9NB 3QEAZ 9ICJA 2V4QA 4GXIA 2RDJA 4MEXA 2ZJ8A 5KFCA 3RJJA 7ICJA 7ICTA 5DGBA 2AU0A 4O3RA 4NLGA 4M6WB 3ZDEA 8ICYA 4ELTA 2HW3A 4RQ3A 2I9GA 4KLMA 1ZJNA 4ECVA 4EZ6A 2HVIA 3MDCA 3HW8A 9ICKA 3Q8LA 1ZQXA 4J9NA 4NLKA 5DB7A 2FLPA 9ICEA 3GIMA 8ICHA 3V6HA 4RNOA 4F50A 7ICIA 3LWLA 2KZMA 1BPBA 3GV5B 5KFPA 3TAQA 1QSLA 5HP4A 4F5OA 4MEYA 3LDAA 1BGXT 4RQ1A 3HWTA 3ORYA 5KT5A 4C8NA 3M9OB 5J2IA 3JPRA 3M8RA 1ZQIA 4M9LA 9ICMA 2BCRA 4M04A 4DFJA 2C2RA 4RT3A 2FLLA 2PFPA 4B9VA 3RRGA 4R65A 3MR5A 3TI0A 2AGOA 2GWSA 4PHPA 1XU4A 4F92B 4Q43A 4HYKA 4I2BA 1XSPA 4IQWA 3NGDA 4J9PA 3V72A 4JV1A 1U48A 3OSPA 4DL4A 5L1KA 4YMOA 3QZ7A 4DOBA 2BKEA 4P2HA 4B9SA 3PY8A 1B22A 3RH5A 7ICMA 3GILA 4DS4A 1U9LA 4YR3A 5EWEA 2KZ3A 4I2IA 3AU2A 5HMLA 4UB4A 2BQRA 4NLNA 1ZQCA 4B9NA 1JX4A 4FBTA 3MABA 4R8UB 2C28A 4M9NA 2JEGA 4KN4A 3RB4A 1ZQMA 3ZDCA 5KFKA 4YFKA 3ISCA 4KLIA 1RXWA 5KT6A 3RR8A 2H5XA 4DF8A 2FLNA 4BWJA 2AQ4A 3JPOA 5KT7A 4KLFA 9ICQA 5CWRA 4XRHA 3JPPA 1S76D 9ICFA 5CB1A 3RBEA 1XSLA 1MSWD 3RTVA 3PW7A 3EW9A 3LK9A 2IHMA 4ED3A 4QWAA 3TQ1A 1S9FA 3ZDDA 2KZZA 3C5GA 2R8KA 1RYRA 4PHAA 5KG4A 4DOAA 3THVA 1ZYQA 4E0DA 2PFOA 3FDSA 9ICSA 5KG1A 1TAUA 2VA3A 2ISPA 2FPKA 3T5HA 5J0XA 4ED2A 4RNNA 4RQ4A 1ZQAA 9ICHA 2ZJ5A 4JWNA 4DO9A 8ICWA 1LV5A 1C7YA 4QZ8A 3N97B 5J0RA 3RH4A 2ASDA 8ICIA 1KFTA 2W9MA 5J0PA 4M2YA 4DS5A 2OWOA 1SZPA 1JXEA 4PGQA 5JUMA 4CCHA 3E2EA 4I2AA 1JIHA 3RJGA 5L9XA 1X2IA 4Q45A 4DQQA 3MFIA 3MFHA 5J2KA 3V7KA 2IMWP 5HNKA 2V4RA 4F4YA 4DLEA 4J9QA 3Q8KA 4LZGA 3MR3A 4Z6FA 4DL3A 3JPTA 3ETLA 1XC9A 3PW2A 2XGQA 3H8WA 5DBAA 7ICKA 1KEJA 1SL1A 4BGDA 2UVUA 3AUOA 4C8OA 2NRTA 1SL0A 7ICFA 7ICGA 4X5VA 1L5UA 3C2MA 8ICSA 4ECXA 2Y1IA 7ICSA 3C5FA 4PHEA 2NRXA 2W9CA 4XUSA 4KLQA 1D8LA 4I2DA 4TURA 4FO6A 2XY7A 2F1IA 3Q8SB 5L1LA 4P4OA 3C1YA 3PW4A 4FS1A 1QSYA 4B9UA 9ICNA 4P4MA 4J9MA 1D9DA 4QZCA 4QZEA 4RQ5A 5J0UA 3V6JA 2JEJA 4O0IA 4UBBA 5KFXA 5HHHA 4F2SA 1SKWA 2LYHA 4MF8A 1BPDA 2KN7A 3RB0A 4DL6A 4G3IA 4DSEA 2PI4A 2MAXA 1XSNA 1ZQTA 5DQIA 4UB2A 2FMQA 1NJXA 3PW5A 2RDIA 3PV8A 1COOA 2BPCA 2R8GA 1QTMA 5KFOA 9ICUA 1IM4A 4DSIA 3M9MB 2P66A 4Q44A 5L1JA 4O3PA 3T5JA 1U4BA 2HHSA 9ICTA 1NJZA 5EOZA 1X9WA 1S10A 4R63A 4KLTA 1K1QA 1V9PA 4RPXA 4ECRA 4XQ8A 4Q8FA 5KFLA 3ZD8A 1KSPA 4I2EA 2XC9A 5L1IA 3QE9Y 1T3NA 4ECYA 2NRVA 1KRPA 4R64A 1H38A 5IIIA 5DKWA 8ICBA 4DSKA 7ICOA 5KT4A 4QWDA 4UAZA 9ICCA 5DGAA 8ICXA 4QZ9A 4BWMA 4Z6EA 1U49A 1NKEA 1ZQPA 3PVXA 4YG2A 4YXJA 1LB2B 4O3QA 1S0MA 4EYHB 3Q8QB 2W9BB 4RUCA 4F91B 5KG0A 1X9MA 4ECSA 4DQSA 2DPIA 4ECWA 2P6UA 4ECTA 3BDPA 1BPXA 4PPXA 9ICAA 1TV9A 4F3OA 4MFAA 4KLUA 1QLNA 4ECQA 1N48A 1NK8A 4I2CA 1HUOA 1AROP 3EWAA 3PMLA 4ED8A 1MQ2A 4Z6DA 5KTQA 4EBEA 2BCUA 4K4IA 4IRDA 1ZQSA 3ISBA 1ZQZA 5BOMA 4O5KA 8ICQA 4YN4A 9ICVA 3T5KA 1NKBA 4TUPA 4F5NA 1ZQRA 5EWFA 5J0TA 4IR1A 2HVHA 7ICUA 4DFPA 4IQVA 3PX0A 3GV8B 4F93B 3C2LA 2A1JB 1UA0A 2ASLA 2C2EA 8ICJA 9ICWA 1ZQDA 3V7LA 3RB3A 5C5JA 4K4GA 4JV0A 4KLGA 2J6SA 5DBBA 1NJWA 1ZQKA 1NJYA 2HHWA 2B21A 3SYZA 3GDXA 3EPGA 3H7IA 1JMSA 4KITB 2BHNA 1ZQFA 4ED6A 8ICTA 4UAWA 3RB6A 3EPIA 3UQ2A 3RJHA 3H8JA 3RAQA 2C22A 1L3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRZ A;  2IBK A;  4KLL A;  4P4P A;  8ICG A;  4I29 A;  4EBC A;  4BXO A;  4DQR A;  3IHQ B;  2W8K A;  4B9T A;  9ICR A;  2BCS A;  4PHD A;  3KHL A;  1T8E A;  4M0A A;  1TAQ A;  3OHA A;  2MUT A;  4YMN A;  2R8I A;  5J29 A;  1S0O A;  3Q8M A;  7ICV A;  2ZJA A;  2XCA A;  4LZD A;  1XO1 A;  3BQ0 A;  5KFR A;  2MUT B;  4J9L A;  3G6V A;  4YR2 A;  4JK1 A;  5KFN A;  4FS2 A;  2KFZ A;  4F4Z A;  2BPF A;  3C2K A;  3NTU A;  3MDA A;  2C2D A;  1L3S A;  9ICX A;  3B0Y A;  4DF4 A;  5J0O A;  5J2J A;  1DOQ A;  2NRW A;  1N56 A;  5CHG A;  5BPC A;  4F4W A;  3RAX A;  3BJY A;  4F5P A;  4I28 A;  4RT2 A;  8ICZ A;  1RYS A;  4F4K A;  3SI8 A;  4PH5 A;  2AQ0 A;  2JZB B;  4C8K A;  4F8R A;  4YMM A;  8ICO A;  1TK8 A;  5J0S A;  1EXN A;  3RBD A;  1RXV A;  2JEI A;  4DEZ A;  4KTQ A;  1Z00 B;  2BR0 A;  5IIK A;  4C8M A;  4BXO B;  5KFZ A;  5KFM A;  4YR0 A;  4TUS A;  4DQP A;  4UB1 A;  3SV4 A;  7ICR A;  2UVW A;  5KFH A;  1Y88 A;  5KT2 A;  1Z00 A;  4UB5 A;  2Y1J A;  4QWB A;  3RH6 A;  5KFU A;  3RRH A;  1D8Y A;  4B9M A;  5IIO A;  3RJE A;  3ZD9 A;  4RQ2 A;  4EEY A;  1ZQB A;  5KFV A;  2XY5 A;  1ZQO A;  2FMP A;  4IQT A;  5D49 A;  4M9J A;  4YVZ A;  5F9L A;  2F1J A;  1IXR A;  2DFL A;  2XGP A;  4GXJ A;  2ZTD A;  4EZ9 A;  2XCP A;  2FPM A;  3MR6 A;  3LWM A;  1BVS A;  3HPO A;  3PO4 A;  5J2H A;  9ICL A;  5F9N A;  4QW8 A;  5J2D A;  1NKC A;  4RQ0 A;  4I2G A;  3H8S A;  1KDH A;  3OHB A;  4QWE A;  8ICA A;  1A76 A;  4QZA A;  4M9G A;  2KFN A;  3UXN A;  4R66 A;  1XS9 D;  5KFF A;  4J9K A;  1ZQH A;  1XWL A;  2JEF A;  4F2R A;  2IA6 A;  1L3T A;  5KG3 A;  3TAN A;  5BOL A;  4O5C A;  4O3S A;  5DB9 A;  5DB8 A;  3PR5 B;  8ICV A;  3PNC A;  5DLG A;  5CA7 A;  3QEB Z;  1SL2 A;  2F1H A;  5DG9 A;  2HHQ A;  4DL5 A;  4YD2 A;  2W9B A;  1ZET A;  1QSS A;  5KFW A;  2J6U A;  3ZDB A;  5DDY A;  3ISD A;  1ZQW A;  3AU6 A;  4ED1 A;  2BCV A;  3UPQ A;  1TFR A;  2PFN A;  8ICK A;  4QZD A;  4DSL A;  3UQ0 A;  3PO5 A;  3OJU A;  5J0W A;  2UVV A;  4YXM A;  4J9O A;  2I1Q A;  3HP6 A;  1SKS A;  1WCN A;  4IRC A;  4O5E A;  7ICE A;  4DLG A;  4KLJ A;  3V6K A;  4NM1 A;  3TAR A;  4QZB A;  3UXO A;  2AGP A;  8ICP A;  2BPG A;  4ECZ A;  4RQ7 A;  3PX4 A;  5J0Q A;  4QZI A;  1RPL A;  3UXP A;  3Q8R B;  1S97 A;  3RJK A;  4I2J A;  4QZH A;  3T3F A;  5KFJ A;  3OGU A;  9ICP A;  3V7J A;  1NOM A;  4UQG A;  4KN7 A;  4DQI A;  1ZQV A;  2FMS A;  3RR7 A;  4JWM A;  2UVR A;  5DG8 A;  3GV7 B;  1ZQE A;  1B43 A;  2ZUD A;  1HJP A;  2WTF A;  3GII A;  3TFR A;  4DFM A;  1S77 D;  8ICL A;  3H40 A;  2ALZ A;  3KTQ A;  5IIJ A;  3SV3 A;  3JPQ A;  3MGH A;  1RZT A;  4IQU A;  4YCX A;  1KFD A;  3HT3 A;  4ECU A;  4QW9 A;  5KFE A;  2ISO A;  2HHU A;  3RJI A;  2VA2 A;  4KMU A;  4RQ8 A;  1ZQN A;  4KLH A;  4YP3 A;  9ICG A;  4R8U A;  5KFB A;  5DB6 A;  4UB3 A;  2W9A A;  4IRK A;  1NK4 A;  4PGY A;  1NK9 A;  1UT5 A;  3Q8P B;  3H4B A;  3PR4 A;  4F5Q A;  4RUA A;  4MF2 A;  5DQH A;  2PXI A;  7ICH A;  3KHH A;  1ZQQ A;  1TKD A;  4PGX A;  5J2C A;  3G6X A;  1S0N A;  2P6R A;  1WCL A;  5KFD A;  4GC6 A;  2A1J A;  4IR9 A;  3N4M B;  8ICE A;  1TVA A;  2ZUB A;  3B0X A;  4UAY A;  4GLX A;  4RU9 A;  2J6T A;  1ZQU A;  2R8H A;  5KT3 A;  3KHR A;  2ATL A;  4O3N A;  3QZ8 A;  3TAP A;  3RJF A;  4RNM A;  5D4B A;  4M9H A;  1ZQY A;  2V9W A;  5HMM A;  4F5R A;  2PI5 A;  5CJ7 A;  4ED7 A;  1X9S A;  3GFK B;  5KFY A;  5CP2 A;  3MR2 A;  2DPJ A;  5KFS A;  5KFT A;  4Q8E A;  1ZQG A;  4NM2 A;  1UT8 A;  4MFF A;  3EZ5 A;  4EYI B;  2Q0Z X;  3C1Z A;  5DG7 A;  5IIL A;  4O9M A;  3PX6 A;  5EWG A;  1NK6 A;  3GIK A;  2W8L A;  4I2H A;  5J2B A;  5J2G A;  5KFG A;  2XY6 A;  1T7P A;  1BPZ A;  1KTQ A;  9ICO A;  3K75 D;  2XO7 A;  4KLS A;  2HHV A;  1KLN A;  4NY8 A;  2JZB A;  4MFC A;  4RPY A;  1U45 A;  5DQG A;  4M47 A;  4ED0 A;  4RPZ A;  4K4H A;  2ZUC A;  2VAN A;  4XA5 A;  4YQW A;  2BCQ A;  8ICF A;  5DBC A;  5KG2 A;  3JPS A;  1D9F A;  4RZR A;  1L3U A;  2HHT A;  4Z6C A;  1PZN A;  4O3O A;  1NK0 A;  4DWI A;  4ZH4 A;  4BDP A;  1DGS A;  4KLO A;  1U47 A;  3C23 A;  5KG5 A;  2R8J A;  5KG6 A;  2W9C B;  4ELU A;  1BPE A;  5IIN A;  1Z3E B;  4I27 A;  7ICL A;  4J9R A;  2HHX A;  1UA1 A;  2BQU A;  1ZQJ A;  2PFQ A;  4QWC A;  3FYH A;  4TQR A;  7ICP A;  4I2F A;  1S0V A;  2KTQ A;  3H4D A;  7ICN A;  5DLF A;  3PMN A;  3PW0 A;  3TFS A;  1NK5 A;  1TK5 A;  8ICN A;  5D46 A;  2BGW A;  4JV2 A;  3SZ2 A;  4GC7 A;  4RQ6 A;  1CEZ A;  4DOC A;  8ICU A;  3HX0 A;  2BDP A;  4NXZ A;  5DDM A;  9ICI A;  3EYZ A;  2ZTE A;  3BQ2 A;  4DSF A;  1SKR A;  1MQ3 A;  4F4X A;  1T4G A;  1ZJM A;  1MC8 A;  4DFK A;  3GQC A;  2VA8 A;  4M6W A;  1A77 A;  5J2A A;  5CR0 A;  2ASJ A;  2AGQ A;  4DL2 A;  1KFS A;  1ZQL A;  3C21 A;  1NK7 A;  5HHI A;  4YD1 A;  4C8L A;  3BQT A;  3G6Y A;  3OJS A;  3JPN A;  1BPY A;  2AJQ A;  5KFA A;  4TQS A;  1JXL A;  2ZTC A;  3K4G A;  5J2F A;  7ICQ A;  5IIM A;  3M8S A;  4B9L A;  2M9N A;  5J2E A;  3MBY A;  3OSN A;  4DSJ A;  3GIJ A;  8ICR A;  8ICC A;  4J9S A;  4UBC A;  4QZG A;  4ELV A;  9ICB A;  3IM1 A;  1HUZ A;  3KHG A;  1CUK A;  4FBU A;  4GXK A;  4KLD A;  4JUZ A;  1JN3 A;  5TZV A;  4EBD A;  2BQ3 A;  8ICM A;  2IHN A;  3T5L A;  5KG7 A;  2FPL A;  4QZF A;  3MGI A;  3BQ1 A;  3ZDA A;  5KFI A;  4KLE A;  5KFQ A;  1TK0 A;  5J0Y A;  4LVS A;  4DL7 A;  4TUQ A;  4NLZ A;  1K1S A;  3M9N B;  3QEA Z;  9ICJ A;  2V4Q A;  4GXI A;  2RDJ A;  4MEX A;  2ZJ8 A;  5KFC A;  3RJJ A;  7ICJ A;  7ICT A;  5DGB A;  2AU0 A;  4O3R A;  4NLG A;  4M6W B;  3ZDE A;  8ICY A;  4ELT A;  2HW3 A;  4RQ3 A;  2I9G A;  4KLM A;  1ZJN A;  4ECV A;  4EZ6 A;  2HVI A;  3MDC A;  3HW8 A;  9ICK A;  3Q8L A;  1ZQX A;  4J9N A;  4NLK A;  5DB7 A;  2FLP A;  9ICE A;  3GIM A;  8ICH A;  3V6H A;  4RNO A;  4F50 A;  7ICI A;  3LWL A;  2KZM A;  1BPB A;  3GV5 B;  5KFP A;  3TAQ A;  1QSL A;  5HP4 A;  4F5O A;  4MEY A;  3LDA A;  1BGX T;  4RQ1 A;  3HWT A;  3ORY A;  5KT5 A;  4C8N A;  3M9O B;  5J2I A;  3JPR A;  3M8R A;  1ZQI A;  4M9L A;  9ICM A;  2BCR A;  4M04 A;  4DFJ A;  2C2R A;  4RT3 A;  2FLL A;  2PFP A;  4B9V A;  3RRG A;  4R65 A;  3MR5 A;  3TI0 A;  2AGO A;  2GWS A;  4PHP A;  1XU4 A;  4F92 B;  4Q43 A;  4HYK A;  4I2B A;  1XSP A;  4IQW A;  3NGD A;  4J9P A;  3V72 A;  4JV1 A;  1U48 A;  3OSP A;  4DL4 A;  5L1K A;  4YMO A;  3QZ7 A;  4DOB A;  2BKE A;  4P2H A;  4B9S A;  3PY8 A;  1B22 A;  3RH5 A;  7ICM A;  3GIL A;  4DS4 A;  1U9L A;  4YR3 A;  5EWE A;  2KZ3 A;  4I2I A;  3AU2 A;  5HML A;  4UB4 A;  2BQR A;  4NLN A;  1ZQC A;  4B9N A;  1JX4 A;  4FBT A;  3MAB A;  4R8U B;  2C28 A;  4M9N A;  2JEG A;  4KN4 A;  3RB4 A;  1ZQM A;  3ZDC A;  5KFK A;  4YFK A;  3ISC A;  4KLI A;  1RXW A;  5KT6 A;  3RR8 A;  2H5X A;  4DF8 A;  2FLN A;  4BWJ A;  2AQ4 A;  3JPO A;  5KT7 A;  4KLF A;  9ICQ A;  5CWR A;  4XRH A;  3JPP A;  1S76 D;  9ICF A;  5CB1 A;  3RBE A;  1XSL A;  1MSW D;  3RTV A;  3PW7 A;  3EW9 A;  3LK9 A;  2IHM A;  4ED3 A;  4QWA A;  3TQ1 A;  1S9F A;  3ZDD A;  2KZZ A;  3C5G A;  2R8K A;  1RYR A;  4PHA A;  5KG4 A;  4DOA A;  3THV A;  1ZYQ A;  4E0D A;  2PFO A;  3FDS A;  9ICS A;  5KG1 A;  1TAU A;  2VA3 A;  2ISP A;  2FPK A;  3T5H A;  5J0X A;  4ED2 A;  4RNN A;  4RQ4 A;  1ZQA A;  9ICH A;  2ZJ5 A;  4JWN A;  4DO9 A;  8ICW A;  1LV5 A;  1C7Y A;  4QZ8 A;  3N97 B;  5J0R A;  3RH4 A;  2ASD A;  8ICI A;  1KFT A;  2W9M A;  5J0P A;  4M2Y A;  4DS5 A;  2OWO A;  1SZP A;  1JXE A;  4PGQ A;  5JUM A;  4CCH A;  3E2E A;  4I2A A;  1JIH A;  3RJG A;  5L9X A;  1X2I A;  4Q45 A;  4DQQ A;  3MFI A;  3MFH A;  5J2K A;  3V7K A;  2IMW P;  5HNK A;  2V4R A;  4F4Y A;  4DLE A;  4J9Q A;  3Q8K A;  4LZG A;  3MR3 A;  4Z6F A;  4DL3 A;  3JPT A;  3ETL A;  1XC9 A;  3PW2 A;  2XGQ A;  3H8W A;  5DBA A;  7ICK A;  1KEJ A;  1SL1 A;  4BGD A;  2UVU A;  3AUO A;  4C8O A;  2NRT A;  1SL0 A;  7ICF A;  7ICG A;  4X5V A;  1L5U A;  3C2M A;  8ICS A;  4ECX A;  2Y1I A;  7ICS A;  3C5F A;  4PHE A;  2NRX A;  2W9C A;  4XUS A;  4KLQ A;  1D8L A;  4I2D A;  4TUR A;  4FO6 A;  2XY7 A;  2F1I A;  3Q8S B;  5L1L A;  4P4O A;  3C1Y A;  3PW4 A;  4FS1 A;  1QSY A;  4B9U A;  9ICN A;  4P4M A;  4J9M A;  1D9D A;  4QZC A;  4QZE A;  4RQ5 A;  5J0U A;  3V6J A;  2JEJ A;  4O0I A;  4UBB A;  5KFX A;  5HHH A;  4F2S A;  1SKW A;  2LYH A;  4MF8 A;  1BPD A;  2KN7 A;  3RB0 A;  4DL6 A;  4G3I A;  4DSE A;  2PI4 A;  2MAX A;  1XSN A;  1ZQT A;  5DQI A;  4UB2 A;  2FMQ A;  1NJX A;  3PW5 A;  2RDI A;  3PV8 A;  1COO A;  2BPC A;  2R8G A;  1QTM A;  5KFO A;  9ICU A;  1IM4 A;  4DSI A;  3M9M B;  2P66 A;  4Q44 A;  5L1J A;  4O3P A;  3T5J A;  1U4B A;  2HHS A;  9ICT A;  1NJZ A;  5EOZ A;  1X9W A;  1S10 A;  4R63 A;  4KLT A;  1K1Q A;  1V9P A;  4RPX A;  4ECR A;  4XQ8 A;  4Q8F A;  5KFL A;  3ZD8 A;  1KSP A;  4I2E A;  2XC9 A;  5L1I A;  3QE9 Y;  1T3N A;  4ECY A;  2NRV A;  1KRP A;  4R64 A;  1H38 A;  5III A;  5DKW A;  8ICB A;  4DSK A;  7ICO A;  5KT4 A;  4QWD A;  4UAZ A;  9ICC A;  5DGA A;  8ICX A;  4QZ9 A;  4BWM A;  4Z6E A;  1U49 A;  1NKE A;  1ZQP A;  3PVX A;  4YG2 A;  4YXJ A;  1LB2 B;  4O3Q A;  1S0M A;  4EYH B;  3Q8Q B;  2W9B B;  4RUC A;  4F91 B;  5KG0 A;  1X9M A;  4ECS A;  4DQS A;  2DPI A;  4ECW A;  2P6U A;  4ECT A;  3BDP A;  1BPX A;  4PPX A;  9ICA A;  1TV9 A;  4F3O A;  4MFA A;  4KLU A;  1QLN A;  4ECQ A;  1N48 A;  1NK8 A;  4I2C A;  1HUO A;  1ARO P;  3EWA A;  3PML A;  4ED8 A;  1MQ2 A;  4Z6D A;  5KTQ A;  4EBE A;  2BCU A;  4K4I A;  4IRD A;  1ZQS A;  3ISB A;  1ZQZ A;  5BOM A;  4O5K A;  8ICQ A;  4YN4 A;  9ICV A;  3T5K A;  1NKB A;  4TUP A;  4F5N A;  1ZQR A;  5EWF A;  5J0T A;  4IR1 A;  2HVH A;  7ICU A;  4DFP A;  4IQV A;  3PX0 A;  3GV8 B;  4F93 B;  3C2L A;  2A1J B;  1UA0 A;  2ASL A;  2C2E A;  8ICJ A;  9ICW A;  1ZQD A;  3V7L A;  3RB3 A;  5C5J A;  4K4G A;  4JV0 A;  4KLG A;  2J6S A;  5DBB A;  1NJW A;  1ZQK A;  1NJY A;  2HHW A;  2B21 A;  3SYZ A;  3GDX A;  3EPG A;  3H7I A;  1JMS A;  4KIT B;  2BHN A;  1ZQF A;  4ED6 A;  8ICT A;  4UAW A;  3RB6 A;  3EPI A;  3UQ2 A;  3RJH A;  3H8J A;  3RAQ A;  2C22 A;  1L3V A; 
#chains in the Genus database with same CATH topology
 8ICG A;  4EBC A;  4DQR A;  2LBO A;  5AK4 A;  1TAQ A;  3OHA A;  2E8N A;  2MUT A;  2R8I A;  4CRX A;  2E1F A;  4FE3 A;  1XO1 A;  2G09 A;  2KJ9 A;  2MUT B;  4P0P B;  2VJ5 A;  4F4Z A;  1L3S A;  1ZD4 A;  5J2J A;  2NRW A;  1KKX A;  5CHG A;  3BJY A;  4F5P A;  5ALF A;  4RT2 A;  4UB8 U;  1V85 A;  2AQ0 A;  1IV8 A;  3IDW A;  2JZB B;  4C8K A;  3RBD A;  1RXV A;  1N5X A;  3L5K A;  3IV6 A;  1Z00 B;  5KFZ A;  4YR0 A;  4TUS A;  2UVW A;  5KT2 A;  1Z00 A;  4QWB A;  1O03 A;  5KFU A;  3HRD D;  5IIO A;  5AK3 A;  4OO1 J;  1DK3 A;  4M9J A;  4YVZ A;  2F1J A;  1IXR A;  4EZ9 A;  2ZTD A;  2XCP A;  2FPM A;  3FM9 A;  3MR6 A;  3KD3 A;  3H0M B;  3N7R C;  2YTU A;  9ICL A;  5F9N A;  2ZIV B;  1KDH A;  4QWE A;  3KKA C;  1XS9 D;  4OD0 A;  5KG3 A;  4DFD A;  5BOL A;  4O3S A;  2OYY A;  4F71 A;  5DB8 A;  1YZ7 A;  4ACO A;  5CA7 A;  1SL2 A;  2HHQ A;  2W9B A;  3IG8 A;  2KG5 A;  3ZDB A;  5AKY A;  4UAT A;  3PZP A;  3AU6 A;  2BCV A;  3UPQ A;  8ICK A;  2G5H B;  4FZM A;  4DSL A;  3PO5 A;  3OJU A;  5J0W A;  2UVV A;  1FO4 A;  3CP8 A;  4C7Y A;  3HP6 A;  3KKA A;  1FIQ A;  4CE6 A;  3TAR A;  4OJ5 A;  5AIB A;  4IL6 U;  8ICP A;  4ECZ A;  3PX4 A;  1DXS A;  5A0L A;  3TAD C;  3QUT A;  3OGU A;  2HI0 A;  2YX8 A;  4JWM A;  2G07 A;  5DG8 A;  1HJP A;  1S77 D;  4Y2P A;  5IIJ A;  2KIC A;  2GLE A;  4YCX A;  1KFD A;  3E58 A;  2HHU A;  1C20 A;  4KMU A;  4IRK A;  3QU2 A;  1MN8 A;  2B6G A;  1UT5 A;  4F5Q A;  2PXI A;  3KHH A;  2P6R A;  4GC6 A;  5KFD A;  4CDG A;  2A1J A;  8ICE A;  2R8H A;  3QZ8 A;  5D4B A;  1ZQY A;  4F5R A;  1N60 A;  4ED7 A;  5KFY A;  2ESE A;  2DPJ A;  4NLC A;  4AP9 A;  4Q8E A;  1JUD A;  1V97 A;  2D8C A;  5EWG A;  4Y2V A;  1S8O A;  3PX6 A;  2XY6 A;  3K75 D;  2HHV A;  1KLN A;  4NY8 A;  4MFC A;  4RPY A;  2FI1 A;  4ED0 A;  4K4H A;  4XA5 A;  8ICF A;  3F2B A;  4Z6C A;  3S6J A;  5ALZ A;  1DGS A;  4KLO A;  2CRX A;  5ALK A;  1BPE A;  3BQ7 A;  5IIN A;  4IC9 A;  2ZIW B;  7ICP A;  2W7P A;  1S0V A;  1Z1V A;  4BJQ A;  2K60 A;  4CF5 A;  2OCE A;  4RQ6 A;  4DOC A;  4NXZ A;  5DDM A;  3EYZ A;  1T4G A;  3SMV A;  2VA8 A;  4M6W A;  5AM4 A;  5J2A A;  4DL2 A;  3H8M A;  3G6Y A;  1RDF A;  3OJS A;  2MA1 A;  3JPN A;  2AJQ A;  2KIV A;  3QXG A;  2LM1 A;  5J2E A;  3OSN A;  3SEN A;  3GIJ A;  4J9S A;  4QZG A;  2WF8 A;  5TZV A;  3IP4 B;  4QZF A;  3MGI A;  3AEV A;  4TUQ A;  4NLZ A;  3M9N B;  1SV0 C;  5F3X B;  9ICJ A;  2RDJ A;  2KVC A;  4MEX A;  7ICT A;  2KSO B;  5AIC A;  3CW2 C;  4KLM A;  4ECV A;  3MDC A;  3HW8 A;  2W11 A;  2FLP A;  2EAP A;  5ALI A;  4F50 A;  2KD1 A;  3TAQ A;  4RQ1 A;  5KT5 A;  5J2I A;  3M9O B;  1ZQI A;  2W54 A;  2FLL A;  4R65 A;  3MR5 A;  2W55 A;  4Q43 A;  2WAQ F;  3KZX A;  4IQW A;  3KOO A;  1BNO A;  2JMG A;  3NS1 A;  4DL4 A;  3OSP A;  3QZ7 A;  3PSF A;  4DOB A;  2BKE A;  4EEN A;  2E8P A;  7ICM A;  4G9B A;  3GIL A;  1U9L A;  5AI4 A;  4YR3 A;  4UB4 A;  1ZQC A;  4FBT A;  2E8M A;  3AMZ A;  4RQM A;  3ISC A;  3B9J A;  3RR8 A;  2FLN A;  5KT7 A;  4KLF A;  4ZOH C;  3ALR A;  3JPP A;  2AH5 A;  5CB1 A;  3PW7 A;  2KZZ A;  1ZRN A;  3C5G A;  2QKQ A;  5KG4 A;  2KMD A;  5KG1 A;  4AYB F;  2ISP A;  2FPK A;  4GFJ A;  2W7O A;  9ICH A;  2OM6 A;  2MU2 A;  3C28 A;  5GTI U;  4KX3 A;  1C7Y A;  5J0R A;  2ASD A;  1KFT A;  5J0P A;  2AXT U;  1JXE A;  4CCH A;  2WHE A;  1X2I A;  4DQQ A;  3MFI A;  3M7D A;  3V7K A;  5HNK A;  3CRX A;  4DLE A;  4LZG A;  3ETL A;  1XC9 A;  3SR6 A;  3PW2 A;  4NL9 A;  4IS7 A;  1QQ6 A;  3VCB A;  1CRX A;  1SL1 A;  2NRT A;  1SL0 A;  7ICF A;  3C2M A;  8ICS A;  1ZD3 A;  4XUS A;  4TUR A;  4FO6 A;  2BDP A;  5L1L A;  1QSY A;  4P4O A;  3C1Y A;  2PKE A;  3IRU A;  4CF4 A;  1A0P A;  3RB0 A;  1NI3 A;  2MAX A;  1XSN A;  1SV4 A;  2ZIX A;  3PW5 A;  3NVZ A;  1IM4 A;  5L1J A;  2HHS A;  9ICT A;  5EOZ A;  1S10 A;  2EZY A;  3AN1 A;  5J8Y C;  2NYV A;  4ECR A;  2PMZ F;  5KFL A;  2Q4T A;  2KK0 A;  5DKW A;  2K89 A;  1D8B A;  4QWD A;  2IOF A;  4Z6E A;  3HJE A;  1J2M A;  5G5G A;  5L1M A;  3Q8Q B;  4DQS A;  2DPI A;  2P6U A;  3NRZ A;  1BPX A;  4PPX A;  9ICA A;  1TV9 A;  4KLU A;  4ECQ A;  4CF3 A;  4US8 A;  5KTQ A;  4IRD A;  1SWV A;  3T5K A;  3WKC A;  3MGV A;  2HVH A;  4IR1 A;  1PK1 B;  2RHF A;  2A1J B;  1L8L A;  3MC1 A;  3RB3 A;  2JHD A;  5KNI A;  5G5H A;  1T3Q A;  1ZOL A;  1NJY A;  2E8O A;  3FC4 A;  1JMS A;  4KIT B;  2HMX A;  2E1E A;  2GH1 A;  1FFV A;  2FJ6 A;  2C22 A;  5AIA A;  2QB0 A;  4P4P A;  4I29 A;  3IHQ B;  2W8K A;  9ICR A;  2BCS A;  4J03 A;  4PHD A;  3KHL A;  5J29 A;  3PSP A;  1L8O A;  2ZJA A;  4LZD A;  5KFR A;  4J9L A;  2KFZ A;  2BPF A;  1WWV A;  3MDA A;  9ICX A;  3KZI U;  2WF6 A;  4DF4 A;  1DOQ A;  1N56 A;  4F4W A;  3WK5 A;  5AM3 A;  8ICZ A;  4F4K A;  4PH5 A;  2K8A A;  2FE9 A;  8ICO A;  2Y9U A;  2JEI A;  4DEZ A;  2F77 X;  4KTQ A;  5KFM A;  7ICR A;  4PJ0 U;  2K8C B;  2Y1J A;  3RH6 A;  1D8Y A;  4B9M A;  2Y0S F;  4FFD A;  5GTH U;  5KFV A;  2XY5 A;  4UB6 U;  4EEL A;  4PZN A;  2XGP A;  1J97 A;  4PZO A;  1BVS A;  3HPO A;  3PO4 A;  5ALD A;  5J2H A;  2GOL A;  4FZL A;  4RQ0 A;  3OHB A;  4QZA A;  4M9G A;  3UXN A;  4R66 A;  5ALE A;  2HOF A;  1ZQH A;  1XWL A;  2JEF A;  5KL1 B;  4F2R A;  3UM9 A;  2HBK A;  3I28 A;  3PNC A;  2F1H A;  1WWU A;  4DL5 A;  4YD2 A;  2F3N A;  1ZQW A;  4ED1 A;  3UMG A;  2PFN A;  2KJ8 A;  3UQ0 A;  2F8K A;  4YXM A;  5AKJ A;  3SD7 A;  1SKS A;  1WCN A;  1P7D A;  4DLG A;  1F0M A;  2G0A A;  4RQ7 A;  4QZI A;  1WUD A;  1S97 A;  4QZH A;  5KFJ A;  4KN7 A;  4DQI A;  2FMS A;  1LKY B;  2WTF A;  8ICL A;  3MGH A;  4ECU A;  1X40 A;  3RJI A;  4KLH A;  1ZQN A;  3QU5 A;  1SIJ A;  3QUB A;  4PGY A;  5AK6 A;  3TAD A;  1X6J A;  4O3M A;  4UAY A;  4GLX A;  2O6K A;  1DRG A;  2ATL A;  1B0X A;  3TAP A;  4Y2T A;  2V9W A;  2PI5 A;  5CJ7 A;  1RG6 A;  1X9S A;  3GFK B;  1AQ6 A;  4Y2S A;  5ALU A;  4QIW F;  5ALJ A;  2MRL A;  2QAR B;  3E0F A;  1PVR A;  4NM2 A;  5EE3 A;  4MFF A;  3EZ5 A;  3C1Z A;  2YMQ A;  1NK6 A;  5J2B A;  5J2G A;  5KFG A;  2BZF A;  4M47 A;  4RPZ A;  2BCQ A;  2VAN A;  3T79 A;  5DBC A;  5KG2 A;  3JPS A;  2GO7 A;  4CNQ A;  2HHT A;  3M6K A;  4BDP A;  1RM6 C;  1U47 A;  4ELU A;  5KG6 A;  4J9R A;  1UA1 A;  2BQU A;  2PFQ A;  4JMU A;  3FYH A;  4TQR A;  5ALT A;  2K4E A;  5DLF A;  3PMN A;  1NK5 A;  8ICN A;  3NVY A;  1QQ7 A;  9ICI A;  2ZTE A;  4F4X A;  4DFK A;  1Z1B A;  3GQC A;  3K1Z A;  2KSO A;  1KFS A;  2K4H A;  2WF7 A;  2WF9 A;  3BQT A;  1BPY A;  5KFA A;  2ZTC A;  3K4G A;  5AKZ A;  5J2F A;  5IIM A;  4B9L A;  3MBY A;  8ICC A;  3F53 A;  3KHG A;  4GXK A;  2EDU A;  8ICM A;  3T5L A;  2FPL A;  3BQ1 A;  2OXO A;  5KFI A;  5KFQ A;  1TK0 A;  5AI8 A;  5J0Y A;  2VKQ A;  1K1S A;  3RFA A;  2HBL A;  2V4Q A;  4GXI A;  4QNL A;  3RJJ A;  7ICJ A;  4O3R A;  4NLG A;  4C80 A;  1YT3 A;  2BDU A;  9ICK A;  4NLK A;  5DB7 A;  3GIM A;  8ICH A;  4RNO A;  5KFP A;  2XVT A;  3HWT A;  3ORY A;  1L7M A;  9ICM A;  4M04 A;  2C2R A;  5ALX A;  3O0F A;  4PHP A;  4KX5 A;  1N2X A;  1Z4N A;  1XSP A;  3NGD A;  4J9P A;  2LYB A;  4YMO A;  4P2H A;  2WB1 F;  4B9S A;  2E5S A;  3BS7 A;  4DS4 A;  2BQR A;  4B9N A;  3MAB A;  2JEG A;  3RB4 A;  2XIC A;  1RXW A;  3D6J A;  1HIW A;  4USA A;  3JPO A;  5CWR A;  4XRH A;  3BS5 B;  1S76 D;  3A0H U;  3EW9 A;  2IHM A;  4ED3 A;  4QWA A;  4DOA A;  3PSI A;  3FDS A;  2VA3 A;  4Y2R A;  4ED2 A;  4RQ4 A;  3QNM A;  1ZQA A;  1N5W A;  8ICW A;  1LV5 A;  4QZ8 A;  2QAR A;  8ICI A;  4M2Y A;  5JTI A;  5ALV A;  4DS5 A;  2KEY A;  4U6P A;  4KMO B;  1SZP A;  5JUM A;  3RJG A;  5L9X A;  4Q45 A;  2IMW P;  2V4R A;  1J2N A;  2JH7 A;  2HBM A;  1UQV A;  3MR3 A;  4Z6F A;  4CGZ A;  4DL3 A;  4F72 A;  2MSN A;  4P0Q A;  3FAH A;  7ICK A;  4BGD A;  3AUO A;  2F8L A;  7ICG A;  4NLB A;  1VDV A;  7ICS A;  3D2Q A;  2NRX A;  4I2D A;  3QYP A;  4FS1 A;  4QZC A;  5J0U A;  2JEJ A;  4UBB A;  5HHH A;  1ZD5 A;  5DQI A;  2FMQ A;  2EZZ A;  4UAR A;  4NL9 C;  1X9X A;  3PV8 A;  2BPC A;  2R8G A;  2HBJ A;  2VIX A;  2CN1 A;  1K1Q A;  3BS5 A;  4RPX A;  4Q8F A;  3ZD8 A;  5L1I A;  2LHT A;  2RQ5 A;  5III A;  8ICB A;  1N61 A;  9ICC A;  5ALG A;  4QZ9 A;  3GU3 A;  4BWM A;  1ZQP A;  2Y9T A;  4YG2 A;  1LB2 B;  4O3Q A;  1S0M A;  4EYH B;  2A19 A;  4RUC A;  4F91 B;  3QUC A;  3AL0 B;  5KG0 A;  1RQL A;  1N62 A;  4ECS A;  5EE0 A;  4ECW A;  3BDP A;  4F3O A;  1QLN A;  3BZC A;  2AHO B;  3EWA A;  1MQ2 A;  4ED8 A;  1HUO A;  2BCU A;  5JRT A;  4F5N A;  1ZQR A;  7ICU A;  5AKE A;  2K8B B;  3AM9 A;  4IQV A;  3SAG A;  3C2L A;  2EZX A;  2WAQ C;  5AM0 A;  4KLG A;  2J6S A;  1NJW A;  1ZQK A;  3SYZ A;  2B21 A;  3EPG A;  3OTQ A;  3H7I A;  4FZN A;  1ZQF A;  4UAW A;  4DCC A;  5JU5 A;  2KIW A;  4KLL A;  1QH9 A;  5ALN A;  2PMZ C;  1K5O A;  1OW5 A;  3L4P A;  3QUQ A;  1XO0 A;  4NWI A;  2I6X A;  4ICA A;  2XCA A;  2CPR A;  2JH1 A;  1T94 A;  3G6V A;  4JK1 A;  3TAC B;  3WU2 U;  2C2D A;  3B0Y A;  3WK9 A;  5K4L A;  2KKP A;  4I28 A;  3RAX A;  5AK5 A;  4EX7 A;  1RYS A;  1URJ A;  4C4T A;  4YMM A;  1EXN A;  1QCK A;  2OH2 A;  5IIK A;  4C8M A;  4BXO B;  1UCV A;  4UB1 A;  3QU7 A;  3SV4 A;  2YQE A;  2EAO A;  2ES6 A;  1Y88 A;  3D2S A;  2W3S A;  3DEE A;  3RRH A;  3RJE A;  3ZD9 A;  4RQ2 A;  4EEY A;  2D3D A;  1ZQB A;  4IQT A;  5D49 A;  5F9L A;  3NVV A;  3LWM A;  1JAL A;  3F5A A;  2LM4 A;  2DKX A;  1A6S A;  3ETR A;  4QW8 A;  5J2D A;  4I2G A;  1OXJ A;  2EH9 A;  2DBY A;  8ICA A;  1A76 A;  5KFF A;  4J9K A;  3RF9 A;  2IA6 A;  4Y2U A;  4O5C A;  2YB1 A;  3PR5 B;  5KL8 B;  1ZET A;  3KBB A;  3ISD A;  5AM1 A;  1TFR A;  1UHU A;  1X6I A;  4IRC A;  4KLJ A;  3V6K A;  1IIP A;  3UXO A;  4QZB A;  2HOI A;  5AKH A;  2BPG A;  2LYA A;  1YZ6 A;  5AI5 A;  3Q8R B;  3RJK A;  1L7O A;  2W03 A;  4B6J A;  9ICP A;  1NOM A;  1ZQV A;  4HAI A;  3GV7 B;  3GII A;  1KW4 A;  2ZUD A;  5AI0 A;  3H40 A;  2ALZ A;  3KTQ A;  3KFU F;  2VJ4 A;  1RZT A;  1Q3V A;  3C29 A;  3HT3 A;  4QW9 A;  1JI7 A;  1PVQ A;  9ICG A;  2DQN B;  4YP3 A;  4R8U A;  2P35 A;  5DB6 A;  4UB3 A;  2W9A A;  1NK4 A;  1NK9 A;  3Q8P B;  2XI9 A;  1S5L U;  5H2F U;  4RUA A;  4MF2 A;  1L7P A;  5DQH A;  7ICH A;  5J2C A;  1WCL A;  4IR9 A;  2ZUB A;  3B0X A;  2J6T A;  4RU9 A;  3NAS A;  1BNP A;  5KT3 A;  3KHR A;  3RJF A;  4RNM A;  4M9H A;  3EUB 2;  5HMM A;  3PST A;  1KBU A;  2F44 A;  3AQE A;  1VLB A;  1ZQG A;  3WKA A;  2Q0Z X;  4EYI B;  5DG7 A;  5IIL A;  4O9M A;  2A3V A;  3GIK A;  2WFA A;  4C0Z A;  1ZRM A;  1DGJ A;  1T7P A;  1BPZ A;  2XO7 A;  1TAM A;  3BZK A;  1KQQ A;  1U45 A;  2ZUC A;  4YQW A;  1M6Y A;  1D9F A;  1L3U A;  5AKK A;  1NK0 A;  2G5I B;  3C23 A;  5KG5 A;  2W9C B;  1KN5 A;  4I27 A;  1Z3E B;  2HHX A;  3CYM A;  2Y0S C;  1ZQJ A;  3F2D A;  5CEH A;  3H4D A;  3PW0 A;  3TFS A;  5KAI U;  4EEK A;  3SZ2 A;  2DWQ A;  4GC7 A;  2LMR A;  2QB0 B;  3BQ2 A;  3N7P D;  4DSF A;  1SKR A;  3WK7 A;  1ZJM A;  1MC8 A;  3CNH A;  2G08 A;  2AGQ A;  1ZQL A;  2F76 X;  3N7S C;  3C21 A;  1RYU A;  2JRZ A;  5HHI A;  2ZIU A;  1NZP A;  4UW9 A;  4Y2X A;  3M8S A;  2M9N A;  3ICX A;  3J81 j;  4DSJ A;  8ICR A;  4UBC A;  4ELV A;  9ICB A;  3IM1 A;  4UAS A;  1CUK A;  5TIS U;  4JUZ A;  1JN3 A;  3LVV A;  2IHN A;  5KG7 A;  1CI4 A;  2EAN A;  3ZDA A;  4DL7 A;  2LI6 A;  3ZI4 A;  5ALQ A;  4UAV A;  2ZJ8 A;  5KFC A;  2AU0 A;  1ECW A;  2YN4 A;  3ZDE A;  4ELT A;  4RQ3 A;  1ZQX A;  2KZM A;  5AHX A;  7ICI A;  3LWL A;  4EX6 A;  1IG6 A;  4F5O A;  4MEY A;  1X66 A;  1BGX T;  3LDA A;  4M9L A;  4C8N A;  3JPR A;  3M8R A;  1WG8 A;  4DFJ A;  4RT3 A;  3I76 A;  2PFP A;  4B9V A;  2AGO A;  2GWS A;  4HYK A;  3V72 A;  1Z4O A;  1U48 A;  5L1K A;  2DKZ A;  5AI6 A;  1B22 A;  3RH5 A;  1F44 A;  4MHV A;  4I2I A;  3AU2 A;  5HML A;  4NLN A;  2KJ5 A;  1JX4 A;  4R8U B;  2H3Q A;  4KN4 A;  1KL9 A;  4YFK A;  5KT6 A;  4DF8 A;  4BWJ A;  9ICQ A;  3M6Z A;  9ICF A;  3RBE A;  1MSW D;  3RTV A;  1XNS A;  3I1Y A;  1ZYQ A;  2PFO A;  9ICS A;  5J0X A;  4RNN A;  1SGG A;  1FFU A;  1O08 A;  3AQF A;  1PK1 A;  1X42 A;  3RH4 A;  1N63 A;  2OEH A;  2OWO A;  3E2E A;  4I2A A;  1JIH A;  2A1A A;  3MFH A;  3Q8K A;  4J9Q A;  1PVP A;  3JPT A;  2XGQ A;  4OJP A;  5DBA A;  4X5V A;  4ECX A;  4A8E A;  4PHE A;  4KLQ A;  1D8L A;  2XY7 A;  2F1I A;  2H3V A;  3Q8S B;  3PW4 A;  4P4M A;  4J9M A;  4RQ5 A;  4QZE A;  3V6J A;  5KAF U;  5EE9 A;  4F2S A;  2ZIV A;  1SKW A;  2LYH A;  4MF8 A;  4DL6 A;  4G3I A;  4DSE A;  1ZQT A;  4UB2 A;  3WK4 A;  2RDI A;  1COO A;  1QTM A;  5KFO A;  9ICU A;  4DSI A;  3M9M B;  4O3P A;  4KLT A;  1V9P A;  4P0P A;  2ZIU B;  4I2E A;  1T3N A;  4ECY A;  2NRV A;  2DUY A;  4R64 A;  1H38 A;  1SWW A;  7ICO A;  4UAZ A;  4NV0 A;  1NKE A;  3PVX A;  4YXJ A;  2W9B B;  3N28 A;  3R9K A;  2G06 A;  3SAF A;  4Y2J A;  1COK A;  5AKL A;  1NK8 A;  3PML A;  5HR6 A;  2H3Z A;  2W43 A;  4Z6D A;  4K4I A;  2K4I A;  5BOM A;  3ISB A;  9ICV A;  3OPX A;  3D2N A;  5EWF A;  5J0T A;  4DFP A;  4P0Q B;  3GV8 B;  4F93 B;  1UA0 A;  9ICW A;  8ICJ A;  3SAH A;  5T14 A;  1ZQD A;  2YY6 A;  3V7L A;  4JV0 A;  5ALR A;  3LVW A;  5ALS A;  5DBB A;  2HHW A;  2YML A;  2JV3 A;  2HOQ A;  5ALM A;  2BHN A;  3HIL A;  1Z19 A;  1GO3 F;  4ED6 A;  3RB6 A;  3EPI A;  5AKI A;  1L3V A;  2NRZ A;  2IBK A;  4BXO A;  4B9T A;  3NUQ A;  1T8E A;  4M0A A;  2ZXH A;  3IG5 A;  4YMN A;  2W04 A;  1S0O A;  3Q8M A;  3WK8 A;  7ICV A;  2IOH A;  4BUG A;  3BQ0 A;  2OHF A;  3L3F X;  4YR2 A;  5KFN A;  4FS2 A;  2LPE A;  3C2K A;  3NTU A;  1L6N A;  5J0O A;  2KV2 A;  5BPC A;  2L5Y A;  3SI8 A;  3DDH A;  4F8R A;  1TK8 A;  5J0S A;  3ONN A;  3SEI A;  2BR0 A;  4JB3 A;  4DQP A;  3QU4 A;  5KFH A;  1SB3 C;  4UB5 A;  1ZQO A;  2FMP A;  2DGZ A;  2DFL A;  4GXJ A;  2M0N A;  2F2A B;  1NKC A;  5AKX A;  1Q8K A;  1SZH A;  3H8S A;  1ZD2 P;  5HR7 A;  2KFN A;  2LKY A;  4QJF B;  3HKZ F;  1L3T A;  3TAN A;  2JXJ A;  4WJ3 B;  5DB9 A;  8ICV A;  2NO5 A;  5DLG A;  3QEB Z;  1LVH A;  5DG9 A;  2HDO A;  5E79 U;  1PK3 A;  2B0C A;  1QSS A;  5KFW A;  2J6U A;  4UAU A;  5DDY A;  4QZD A;  3NRW A;  2KNJ A;  4J9O A;  2I1Q A;  5B66 U;  7ICE A;  4O5E A;  4C4S A;  2KHQ A;  4NM1 A;  4C7Z A;  2AGP A;  3WKB A;  5J0Q A;  1RPL A;  3UXP A;  1MA7 A;  4I2J A;  2YB4 A;  3T3F A;  2H3F A;  1SXD A;  3V7J A;  3QX7 A;  4OCZ A;  4UQG A;  2RRD A;  3RR7 A;  2UVR A;  1ZQE A;  1B43 A;  3TFR A;  4OJ6 A;  4DFM A;  5ALL A;  3SV3 A;  4GIB A;  3JPQ A;  4IQU A;  5ALO A;  5KFE A;  2ISO A;  2VA2 A;  4RQ8 A;  5KFB A;  3H4B A;  3PR4 A;  4PL1 A;  3UMB A;  2Z7J A;  2HCF A;  1ZQQ A;  1TKD A;  4PGX A;  1Q46 A;  3G6X A;  1S0N A;  3N4M B;  1TVA A;  1ZQU A;  2DF4 B;  5EE1 A;  2KOB A;  4O3N A;  2EQY A;  1F5S A;  2NV3 A;  2WB1 C;  5CP2 A;  3MR2 A;  5KFS A;  5KFT A;  1UT8 A;  2W8L A;  4I2H A;  5FP0 A;  1DK2 A;  1KTQ A;  1RQN A;  9ICO A;  4KLS A;  5AKG A;  2JZB A;  5C0Y A;  5DQG A;  4BX9 C;  3IN5 A;  4U7C A;  4RZR A;  1PZN A;  4O3O A;  4DWI A;  4ZH4 A;  2R8J A;  2XID A;  3VC8 A;  7ICL A;  4LJX A;  4QWC A;  2QB1 A;  4I2F A;  2KTQ A;  7ICN A;  1TK5 A;  5D46 A;  2BGW A;  4JV2 A;  1CEZ A;  2KKV A;  8ICU A;  3HX0 A;  1MQ3 A;  2N1R A;  1A77 A;  1SV0 A;  5CR0 A;  2ASJ A;  1NK7 A;  4YD1 A;  4C8L A;  1V38 A;  4TQS A;  1JXL A;  1NNL A;  7ICQ A;  2ZIW A;  4Y2Y A;  1JRP A;  2ZIX B;  1TE2 A;  2KHV A;  1HUZ A;  4FBU A;  4KLD A;  4EBD A;  2BQ3 A;  1ZQ1 C;  2R18 A;  4KLE A;  4LVS A;  5ALP A;  5B5E U;  3QEA Z;  5DGB A;  3WKE A;  3F5E A;  4M6W B;  5AM2 A;  8ICY A;  2HW3 A;  2KE7 A;  4AYB C;  2I9G A;  1JRO A;  1ZJN A;  3TKA A;  4EZ6 A;  2HVI A;  2ZG6 A;  3Q8L A;  4RQN A;  4J9N A;  2IOF K;  9ICE A;  2ZXI A;  1L7N A;  3V6H A;  2DL0 A;  1BPB A;  4US9 A;  3GV5 B;  1VJ5 A;  1QSL A;  5HP4 A;  2H3I A;  5ALH A;  1UPH A;  2BCR A;  3RRG A;  3TI0 A;  3H0L B;  3UMC A;  1XU4 A;  4F92 B;  4I2B A;  2JGA A;  3GZF A;  4JV1 A;  4C4R A;  4NJ8 A;  3PY8 A;  4OJO A;  5EWE A;  2ODG A;  2KZ3 A;  2WF5 A;  4M9N A;  2C28 A;  1ZQM A;  3ZDC A;  5KFK A;  4KLI A;  3NVW A;  2H5X A;  5AI9 A;  2AQ4 A;  1QQ5 A;  5ALW A;  1XSL A;  5CRX A;  3LK9 A;  3TQ1 A;  1S9F A;  3LYS A;  3ZDD A;  2R8K A;  1RYR A;  4PHA A;  2YMP A;  3THV A;  4E0D A;  1TAU A;  3T5H A;  2ZJ5 A;  3F2C A;  4DO9 A;  4JWN A;  2HSZ A;  3N97 B;  3U26 A;  2W9M A;  3H0R B;  1PUZ A;  4PGQ A;  1ED1 A;  5J2K A;  4F4Y A;  1FEZ A;  3DV9 A;  3M1Y A;  2KVS A;  3H8W A;  4Y2Q A;  1KEJ A;  2UVU A;  4C8O A;  1L5U A;  5J8Y A;  2Y1I A;  3C5F A;  2W9C A;  4B9U A;  2E3T A;  9ICN A;  5AM5 A;  1D9D A;  1Q3U A;  2JR5 A;  4O0I A;  5KFX A;  3HKZ C;  2KN7 A;  1BPD A;  2RP5 A;  2PI4 A;  3K1R B;  4QIW C;  1NJX A;  1B4F A;  2P66 A;  4Q44 A;  3T5J A;  1U4B A;  1NJZ A;  1SXE A;  1X9W A;  4R63 A;  4XQ8 A;  1KSP A;  2XC9 A;  3QE9 Y;  1KRP A;  2YMM A;  2W3R A;  4DSK A;  5KT4 A;  2I5H A;  5DGA A;  8ICX A;  1LKY A;  1U49 A;  2FDR A;  3QU9 A;  2RLT A;  2KP7 A;  3SQI A;  1NZB A;  2NO4 A;  3ED5 A;  4PL2 A;  1X9M A;  3WKD A;  4ECT A;  1OUQ A;  4MFA A;  1N48 A;  2D6F C;  4I2C A;  1ARO P;  4EBE A;  1ZQS A;  4O5K A;  1ZQZ A;  8ICQ A;  2QLT A;  4YN4 A;  1NKB A;  1HEK A;  4TUP A;  3WK6 A;  2K4P A;  2EAM A;  3PX0 A;  2ASL A;  2C2E A;  4K4G A;  1WYG A;  5C5J A;  3A0B U;  1ZXI A;  2CXY A;  5ALY A;  3GDX A;  8ICT A;  3UQ2 A;  3RJH A;  3H8J A;  3RAQ A;  4OJL A; 
#chains in the Genus database with same CATH homology
 2NRZ A;  2IBK A;  4KLL A;  4P4P A;  8ICG A;  4I29 A;  4EBC A;  4BXO A;  4DQR A;  3IHQ B;  2W8K A;  4B9T A;  9ICR A;  2BCS A;  4PHD A;  3KHL A;  1T8E A;  4M0A A;  1TAQ A;  3OHA A;  2MUT A;  4YMN A;  2R8I A;  5J29 A;  1S0O A;  3Q8M A;  7ICV A;  2ZJA A;  2XCA A;  4LZD A;  1XO1 A;  3BQ0 A;  5KFR A;  2MUT B;  4J9L A;  3G6V A;  4YR2 A;  4JK1 A;  5KFN A;  4FS2 A;  2KFZ A;  4F4Z A;  2BPF A;  3C2K A;  3NTU A;  3MDA A;  2C2D A;  1L3S A;  9ICX A;  3B0Y A;  4DF4 A;  5J0O A;  5J2J A;  1DOQ A;  2NRW A;  1N56 A;  5CHG A;  5BPC A;  4F4W A;  3RAX A;  3BJY A;  4F5P A;  4I28 A;  4RT2 A;  8ICZ A;  1RYS A;  4F4K A;  3SI8 A;  4PH5 A;  2AQ0 A;  2JZB B;  4C8K A;  4F8R A;  4YMM A;  8ICO A;  1TK8 A;  5J0S A;  1EXN A;  3RBD A;  1RXV A;  2JEI A;  4DEZ A;  4KTQ A;  1Z00 B;  2BR0 A;  5IIK A;  4C8M A;  4BXO B;  5KFZ A;  5KFM A;  4YR0 A;  4TUS A;  4DQP A;  4UB1 A;  3SV4 A;  7ICR A;  2UVW A;  5KFH A;  1Y88 A;  5KT2 A;  1Z00 A;  4UB5 A;  2Y1J A;  4QWB A;  3RH6 A;  5KFU A;  3RRH A;  1D8Y A;  4B9M A;  5IIO A;  3RJE A;  3ZD9 A;  4RQ2 A;  4EEY A;  1ZQB A;  5KFV A;  2XY5 A;  1ZQO A;  2FMP A;  4IQT A;  5D49 A;  4M9J A;  4YVZ A;  5F9L A;  2F1J A;  1IXR A;  2DFL A;  2XGP A;  4GXJ A;  2ZTD A;  4EZ9 A;  2XCP A;  2FPM A;  3MR6 A;  3LWM A;  1BVS A;  3HPO A;  3PO4 A;  5J2H A;  9ICL A;  5F9N A;  4QW8 A;  5J2D A;  1NKC A;  4RQ0 A;  4I2G A;  3H8S A;  1KDH A;  3OHB A;  4QWE A;  8ICA A;  1A76 A;  4QZA A;  4M9G A;  2KFN A;  3UXN A;  4R66 A;  1XS9 D;  5KFF A;  4J9K A;  1ZQH A;  1XWL A;  2JEF A;  4F2R A;  2IA6 A;  1L3T A;  5KG3 A;  3TAN A;  5BOL A;  4O5C A;  4O3S A;  5DB9 A;  5DB8 A;  3PR5 B;  8ICV A;  3PNC A;  5DLG A;  5CA7 A;  3QEB Z;  1SL2 A;  2F1H A;  5DG9 A;  2HHQ A;  4DL5 A;  4YD2 A;  2W9B A;  1ZET A;  1QSS A;  5KFW A;  2J6U A;  3ZDB A;  5DDY A;  3ISD A;  1ZQW A;  3AU6 A;  4ED1 A;  2BCV A;  3UPQ A;  1TFR A;  2PFN A;  8ICK A;  4QZD A;  4DSL A;  3UQ0 A;  3PO5 A;  3OJU A;  5J0W A;  2UVV A;  4YXM A;  4J9O A;  2I1Q A;  3HP6 A;  1SKS A;  1WCN A;  4IRC A;  4O5E A;  7ICE A;  4DLG A;  4KLJ A;  3V6K A;  4NM1 A;  3TAR A;  4QZB A;  3UXO A;  2AGP A;  8ICP A;  2BPG A;  4ECZ A;  4RQ7 A;  3PX4 A;  5J0Q A;  4QZI A;  1RPL A;  3UXP A;  3Q8R B;  1S97 A;  3RJK A;  4I2J A;  4QZH A;  3T3F A;  5KFJ A;  3OGU A;  9ICP A;  3V7J A;  1NOM A;  4UQG A;  4KN7 A;  4DQI A;  1ZQV A;  2FMS A;  3RR7 A;  4JWM A;  2UVR A;  5DG8 A;  3GV7 B;  1ZQE A;  1B43 A;  2ZUD A;  1HJP A;  2WTF A;  3GII A;  3TFR A;  4DFM A;  1S77 D;  8ICL A;  3H40 A;  2ALZ A;  3KTQ A;  5IIJ A;  3SV3 A;  3JPQ A;  3MGH A;  1RZT A;  4IQU A;  4YCX A;  1KFD A;  3HT3 A;  4ECU A;  4QW9 A;  5KFE A;  2ISO A;  2HHU A;  3RJI A;  2VA2 A;  4KMU A;  4RQ8 A;  1ZQN A;  4KLH A;  4YP3 A;  9ICG A;  4R8U A;  5KFB A;  5DB6 A;  4UB3 A;  2W9A A;  4IRK A;  1NK4 A;  4PGY A;  1NK9 A;  1UT5 A;  3Q8P B;  3H4B A;  3PR4 A;  4F5Q A;  4RUA A;  4MF2 A;  5DQH A;  2PXI A;  7ICH A;  3KHH A;  1ZQQ A;  1TKD A;  4PGX A;  5J2C A;  3G6X A;  1S0N A;  2P6R A;  1WCL A;  5KFD A;  4GC6 A;  2A1J A;  4IR9 A;  3N4M B;  8ICE A;  1TVA A;  2ZUB A;  3B0X A;  4UAY A;  4GLX A;  4RU9 A;  2J6T A;  1ZQU A;  2R8H A;  5KT3 A;  3KHR A;  2ATL A;  4O3N A;  3QZ8 A;  3TAP A;  3RJF A;  4RNM A;  5D4B A;  4M9H A;  1ZQY A;  2V9W A;  5HMM A;  4F5R A;  2PI5 A;  5CJ7 A;  4ED7 A;  1X9S A;  3GFK B;  5KFY A;  5CP2 A;  3MR2 A;  2DPJ A;  5KFS A;  5KFT A;  4Q8E A;  1ZQG A;  4NM2 A;  1UT8 A;  4MFF A;  3EZ5 A;  4EYI B;  2Q0Z X;  3C1Z A;  5DG7 A;  5IIL A;  4O9M A;  3PX6 A;  5EWG A;  1NK6 A;  3GIK A;  2W8L A;  4I2H A;  5J2B A;  5J2G A;  5KFG A;  2XY6 A;  1T7P A;  1BPZ A;  1KTQ A;  9ICO A;  3K75 D;  2XO7 A;  4KLS A;  2HHV A;  1KLN A;  4NY8 A;  2JZB A;  4MFC A;  4RPY A;  1U45 A;  5DQG A;  4M47 A;  4ED0 A;  4RPZ A;  4K4H A;  2ZUC A;  2VAN A;  4XA5 A;  4YQW A;  2BCQ A;  8ICF A;  5DBC A;  5KG2 A;  3JPS A;  1D9F A;  4RZR A;  1L3U A;  2HHT A;  4Z6C A;  1PZN A;  4O3O A;  1NK0 A;  4DWI A;  4ZH4 A;  4BDP A;  1DGS A;  4KLO A;  1U47 A;  3C23 A;  5KG5 A;  2R8J A;  5KG6 A;  2W9C B;  4ELU A;  1BPE A;  5IIN A;  1Z3E B;  4I27 A;  7ICL A;  4J9R A;  2HHX A;  1UA1 A;  2BQU A;  1ZQJ A;  2PFQ A;  4QWC A;  3FYH A;  4TQR A;  7ICP A;  4I2F A;  1S0V A;  2KTQ A;  3H4D A;  7ICN A;  5DLF A;  3PMN A;  3PW0 A;  3TFS A;  1NK5 A;  1TK5 A;  8ICN A;  5D46 A;  2BGW A;  4JV2 A;  3SZ2 A;  4GC7 A;  4RQ6 A;  1CEZ A;  4DOC A;  8ICU A;  3HX0 A;  2BDP A;  4NXZ A;  5DDM A;  9ICI A;  3EYZ A;  2ZTE A;  3BQ2 A;  4DSF A;  1SKR A;  1MQ3 A;  4F4X A;  1T4G A;  1ZJM A;  1MC8 A;  4DFK A;  3GQC A;  2VA8 A;  4M6W A;  1A77 A;  5J2A A;  5CR0 A;  2ASJ A;  2AGQ A;  4DL2 A;  1KFS A;  1ZQL A;  3C21 A;  1NK7 A;  5HHI A;  4YD1 A;  4C8L A;  3BQT A;  3G6Y A;  3OJS A;  3JPN A;  1BPY A;  2AJQ A;  5KFA A;  4TQS A;  1JXL A;  2ZTC A;  3K4G A;  5J2F A;  7ICQ A;  5IIM A;  3M8S A;  4B9L A;  2M9N A;  5J2E A;  3MBY A;  3OSN A;  4DSJ A;  3GIJ A;  8ICR A;  8ICC A;  4J9S A;  4UBC A;  4QZG A;  4ELV A;  9ICB A;  3IM1 A;  1HUZ A;  3KHG A;  1CUK A;  4FBU A;  4GXK A;  4KLD A;  4JUZ A;  1JN3 A;  5TZV A;  4EBD A;  2BQ3 A;  8ICM A;  2IHN A;  3T5L A;  5KG7 A;  2FPL A;  4QZF A;  3MGI A;  3BQ1 A;  3ZDA A;  5KFI A;  4KLE A;  5KFQ A;  1TK0 A;  5J0Y A;  4LVS A;  4DL7 A;  4TUQ A;  4NLZ A;  1K1S A;  3M9N B;  3QEA Z;  9ICJ A;  2V4Q A;  4GXI A;  2RDJ A;  4MEX A;  2ZJ8 A;  5KFC A;  3RJJ A;  7ICJ A;  7ICT A;  5DGB A;  2AU0 A;  4O3R A;  4NLG A;  4M6W B;  3ZDE A;  8ICY A;  4ELT A;  2HW3 A;  4RQ3 A;  2I9G A;  4KLM A;  1ZJN A;  4ECV A;  4EZ6 A;  2HVI A;  3MDC A;  3HW8 A;  9ICK A;  3Q8L A;  1ZQX A;  4J9N A;  4NLK A;  5DB7 A;  2FLP A;  9ICE A;  3GIM A;  8ICH A;  3V6H A;  4RNO A;  4F50 A;  7ICI A;  3LWL A;  2KZM A;  1BPB A;  3GV5 B;  5KFP A;  3TAQ A;  1QSL A;  5HP4 A;  4F5O A;  4MEY A;  3LDA A;  1BGX T;  4RQ1 A;  3HWT A;  3ORY A;  5KT5 A;  4C8N A;  3M9O B;  5J2I A;  3JPR A;  3M8R A;  1ZQI A;  4M9L A;  9ICM A;  2BCR A;  4M04 A;  4DFJ A;  2C2R A;  4RT3 A;  2FLL A;  2PFP A;  4B9V A;  3RRG A;  4R65 A;  3MR5 A;  3TI0 A;  2AGO A;  2GWS A;  4PHP A;  1XU4 A;  4F92 B;  4Q43 A;  4HYK A;  4I2B A;  1XSP A;  4IQW A;  3NGD A;  4J9P A;  3V72 A;  4JV1 A;  1U48 A;  3OSP A;  4DL4 A;  5L1K A;  4YMO A;  3QZ7 A;  4DOB A;  2BKE A;  4P2H A;  4B9S A;  3PY8 A;  1B22 A;  3RH5 A;  7ICM A;  3GIL A;  4DS4 A;  1U9L A;  4YR3 A;  5EWE A;  2KZ3 A;  4I2I A;  3AU2 A;  5HML A;  4UB4 A;  2BQR A;  4NLN A;  1ZQC A;  4B9N A;  1JX4 A;  4FBT A;  3MAB A;  4R8U B;  2C28 A;  4M9N A;  2JEG A;  4KN4 A;  3RB4 A;  1ZQM A;  3ZDC A;  5KFK A;  4YFK A;  3ISC A;  4KLI A;  1RXW A;  5KT6 A;  3RR8 A;  2H5X A;  4DF8 A;  2FLN A;  4BWJ A;  2AQ4 A;  3JPO A;  5KT7 A;  4KLF A;  9ICQ A;  5CWR A;  4XRH A;  3JPP A;  1S76 D;  9ICF A;  5CB1 A;  3RBE A;  1XSL A;  1MSW D;  3RTV A;  3PW7 A;  3EW9 A;  3LK9 A;  2IHM A;  4ED3 A;  4QWA A;  3TQ1 A;  1S9F A;  3ZDD A;  2KZZ A;  3C5G A;  2R8K A;  1RYR A;  4PHA A;  5KG4 A;  4DOA A;  3THV A;  1ZYQ A;  4E0D A;  2PFO A;  3FDS A;  9ICS A;  5KG1 A;  1TAU A;  2VA3 A;  2ISP A;  2FPK A;  3T5H A;  5J0X A;  4ED2 A;  4RNN A;  4RQ4 A;  1ZQA A;  9ICH A;  2ZJ5 A;  4JWN A;  4DO9 A;  8ICW A;  1LV5 A;  1C7Y A;  4QZ8 A;  3N97 B;  5J0R A;  3RH4 A;  2ASD A;  8ICI A;  1KFT A;  2W9M A;  5J0P A;  4M2Y A;  4DS5 A;  2OWO A;  1SZP A;  1JXE A;  4PGQ A;  5JUM A;  4CCH A;  3E2E A;  4I2A A;  1JIH A;  3RJG A;  5L9X A;  1X2I A;  4Q45 A;  4DQQ A;  3MFI A;  3MFH A;  5J2K A;  3V7K A;  2IMW P;  5HNK A;  2V4R A;  4F4Y A;  4DLE A;  4J9Q A;  3Q8K A;  4LZG A;  3MR3 A;  4Z6F A;  4DL3 A;  3JPT A;  3ETL A;  1XC9 A;  3PW2 A;  2XGQ A;  3H8W A;  5DBA A;  7ICK A;  1KEJ A;  1SL1 A;  4BGD A;  2UVU A;  3AUO A;  4C8O A;  2NRT A;  1SL0 A;  7ICF A;  7ICG A;  4X5V A;  1L5U A;  3C2M A;  8ICS A;  4ECX A;  2Y1I A;  7ICS A;  3C5F A;  4PHE A;  2NRX A;  2W9C A;  4XUS A;  4KLQ A;  1D8L A;  4I2D A;  4TUR A;  4FO6 A;  2XY7 A;  2F1I A;  3Q8S B;  5L1L A;  4P4O A;  3C1Y A;  3PW4 A;  4FS1 A;  1QSY A;  4B9U A;  9ICN A;  4P4M A;  4J9M A;  1D9D A;  4QZC A;  4QZE A;  4RQ5 A;  5J0U A;  3V6J A;  2JEJ A;  4O0I A;  4UBB A;  5KFX A;  5HHH A;  4F2S A;  1SKW A;  2LYH A;  4MF8 A;  1BPD A;  2KN7 A;  3RB0 A;  4DL6 A;  4G3I A;  4DSE A;  2PI4 A;  2MAX A;  1XSN A;  1ZQT A;  5DQI A;  4UB2 A;  2FMQ A;  1NJX A;  3PW5 A;  2RDI A;  3PV8 A;  1COO A;  2BPC A;  2R8G A;  1QTM A;  5KFO A;  9ICU A;  1IM4 A;  4DSI A;  3M9M B;  2P66 A;  4Q44 A;  5L1J A;  4O3P A;  3T5J A;  1U4B A;  2HHS A;  9ICT A;  1NJZ A;  5EOZ A;  1X9W A;  1S10 A;  4R63 A;  4KLT A;  1K1Q A;  1V9P A;  4RPX A;  4ECR A;  4XQ8 A;  4Q8F A;  5KFL A;  3ZD8 A;  1KSP A;  4I2E A;  2XC9 A;  5L1I A;  3QE9 Y;  1T3N A;  4ECY A;  2NRV A;  1KRP A;  4R64 A;  1H38 A;  5III A;  5DKW A;  8ICB A;  4DSK A;  7ICO A;  5KT4 A;  4QWD A;  4UAZ A;  9ICC A;  5DGA A;  8ICX A;  4QZ9 A;  4BWM A;  4Z6E A;  1U49 A;  1NKE A;  1ZQP A;  3PVX A;  4YG2 A;  4YXJ A;  1LB2 B;  4O3Q A;  1S0M A;  4EYH B;  3Q8Q B;  2W9B B;  4RUC A;  4F91 B;  5KG0 A;  1X9M A;  4ECS A;  4DQS A;  2DPI A;  4ECW A;  2P6U A;  4ECT A;  3BDP A;  1BPX A;  4PPX A;  9ICA A;  1TV9 A;  4F3O A;  4MFA A;  4KLU A;  1QLN A;  4ECQ A;  1N48 A;  1NK8 A;  4I2C A;  1HUO A;  1ARO P;  3EWA A;  3PML A;  4ED8 A;  1MQ2 A;  4Z6D A;  5KTQ A;  4EBE A;  2BCU A;  4K4I A;  4IRD A;  1ZQS A;  3ISB A;  1ZQZ A;  5BOM A;  4O5K A;  8ICQ A;  4YN4 A;  9ICV A;  3T5K A;  1NKB A;  4TUP A;  4F5N A;  1ZQR A;  5EWF A;  5J0T A;  4IR1 A;  2HVH A;  7ICU A;  4DFP A;  4IQV A;  3PX0 A;  3GV8 B;  4F93 B;  3C2L A;  2A1J B;  1UA0 A;  2ASL A;  2C2E A;  8ICJ A;  9ICW A;  1ZQD A;  3V7L A;  3RB3 A;  5C5J A;  4K4G A;  4JV0 A;  4KLG A;  2J6S A;  5DBB A;  1NJW A;  1ZQK A;  1NJY A;  2HHW A;  2B21 A;  3SYZ A;  3GDX A;  3EPG A;  3H7I A;  1JMS A;  4KIT B;  2BHN A;  1ZQF A;  4ED6 A;  8ICT A;  4UAW A;  3RB6 A;  3EPI A;  3UQ2 A;  3RJH A;  3H8J A;  3RAQ A;  2C22 A;  1L3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...