3N97B

Rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
b'DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase sigma factor
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Thermus aquaticus
molecule tags Gene regulation/dna
total genus 21
structure length 75
sequence length 75
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3n97B00
1ZETA 7ICMA 1RPLA 4KLJA 4Q44A 1ZQHA 4KLOA 8ICLA 4KLFA 4M6WA 3AUOA 3PW0A 4NLZA 3V6KA 3RAQA 3ZDEA 4LZDA 4R65A 3H4BA 4X5VA 4DFKA 4ED2A 7ICNA 3GDXA 1JXEA 4I2JA 4QZAA 8ICRA 1BGXT 5KFHA 4PGYA 2P6RA 1KDHA 8ICMA 1HJPA 2ZUCA 4KN4A 4TQRA 1SZPA 1NK6A 2J6UA 3IHQB 4UQGA 3PW4A 2MAXA 3MDAA 4ED3A 2OWOA 5KFGA 3K4GA 3T5JA 1S0VA 3T3FA 3E2EA 3HPOA 5J2CA 3UPQA 4MEXA 2BCUA 2NRZA 3RTVA 1U4BA 5C5JA 2DPIA 1CEZA 4Z6CA 1AROP 1KRPA 7ICUA 5IIKA 4UB2A 4QZIA 4FBTA 4KLLA 4KLSA 5DGAA 4NM2A 4ECSA 4DSLA 4JV0A 5TZVA 5JUMA 4O0IA 2ISPA 3RJKA 3EYZA 9ICTA 3HX0A 4MEYA 1KSPA 4F91B 4Q43A 2XY7A 3KHRA 9ICCA 1WCLA 4M9LA 2ZTDA 3UXPA 1MQ2A 4DQSA 3TQ1A 1S77D 3ZDCA 2FLNA 2PI4A 1JMSA 8ICPA 4RQ2A 4DFJA 4NM1A 4PGQA 4DO9A 4MF2A 1ZQQA 1KLNA 4IR1A 2M9NA 4KTQA 3V6JA 4ED0A 2XCPA 2VA2A 3GIMA 3ZDDA 9ICNA 3JPRA 5D49A 1D9DA 4RT3A 5J2BA 4DOAA 2NRTA 4KLUA 3AU6A 5KFRA 1NK9A 2I9GA 5KT4A 4QZCA 1TAQA 4YMNA 1ZQYA 3PW7A 1RXVA 2JZBB 2DFLA 4TQSA 3MBYA 3Q8LA 3UXNA 4YN4A 3JPSA 1TKDA 2NRWA 1TFRA 4O3PA 4PPXA 5KFNA 2Q0ZX 4F50A 3QE9Y 1K1SA 1Z00B 4Q45A 4F5OA 3MFHA 1X9SA 4DSIA 4EBCA 5KG0A 4DWIA 4TUQA 3LWLA 4F5NA 4GC7A 5J0XA 3M9NB 2Y1IA 3TAQA 1JXLA 1A77A 4K4GA 5HMLA 3PR5B 4YR0A 4F5QA 4QZDA 5HNKA 1BVSA 4YMMA 4DEZA 3RBDA 3Q8MA 2IHNA 4GLXA 3BQ1A 2VANA 4DFMA 1K1QA 5DDMA 1U9LA 3OSNA 3JPNA 4YQWA 4KLEA 3GV7B 1XSLA 2ALZA 1V9PA 3KTQA 3RJFA 9ICUA 4JWMA 8ICGA 5KFPA 2XGPA 4DS5A 3JPOA 4F8RA 1ZQJA 1XC9A 3PMNA 2JEGA 2HHTA 3K75D 4M6WB 1NKBA 1ZJMA 4BXOA 1XO1A 1ZQIA 3NTUA 2JEIA 1L5UA 1BPXA 9ICEA 7ICJA 5D4BA 3PW5A 4YD1A 4DLGA 3GIIA 4RPYA 9ICLA 8ICZA 4O5EA 4QZFA 3M8RA 4DL5A 2BPCA 2J6TA 5L1KA 2HVHA 2H5XA 2UVWA 5CR0A 4M9JA 4IQTA 2A1JA 2Y1JA 2MUTA 4FO6A 4GXKA 3RJJA 1ZQFA 2FMPA 4I2IA 5L1JA 1ZQAA 4TUSA 4ECZA 5KFSA 3V7JA 2BCVA 5J2AA 4FS2A 1RXWA 2ASLA 3TARA 4P4PA 5EWGA 5KG4A 1TK8A 5CP2A 4IQVA 1BPEA 2AGPA 1NKCA 4Q8EA 1JN3A 4KLHA 3JPQA 2PXIA 1BPYA 2HW3A 4QWCA 7ICLA 8ICOA 1HUOA 4C8NA 3RB0A 3C1ZA 2V4RA 3RH6A 2XC9A 5KFBA 4QZGA 5DG7A 1NK4A 5KFZA 5KFLA 2W9AA 3B0YA 4IR9A 8ICUA 5J2GA 3PO4A 1ZQTA 2W9MA 5IILA 4O3NA 5KFYA 2HHQA 4R63A 7ICEA 2IMWP 5DDYA 4IQUA 2C2RA 1T3NA 2FLLA 5J0SA 4UBBA 1NKEA 4ED8A 8ICQA 3Q8KA 5HMMA 1KFSA 4EZ6A 4I2HA 4M47A 1A76A 1B43A 2C2DA 3MABA 3G6XA 2BPGA 1LV5A 4UB4A 4YXMA 3ZD9A 2W9CA 1BPBA 1NK8A 3RR7A 4E0DA 3C23A 3RRGA 5DLFA 4ED6A 1S0OA 4EZ9A 2V4QA 4M04A 1KEJA 4ECRA 4CCHA 5DLGA 5J0YA 4RPZA 3NGDA 3ETLA 3Q8QB 3C5GA 4EBDA 2XGQA 3KHGA 3GV8B 3N97B 1UA1A 4YCXA 3PV8A 5KT3A 3RBEA 5IIOA 5DB8A 1JX4A 1ZQNA 2BDPA 2HHSA 2V9WA 7ICHA 4P2HA 4PHPA 4DL6A 2R8HA 5J0PA 1NOMA 3N4MB 5DKWA 2BPFA 4I2FA 2ZUDA 3MR2A 4RQ7A 5KFJA 3C2LA 5IIJA 4PH5A 4LVSA 4F5RA 3BQ0A 2IBKA 4F3OA 3ISCA 1DGSA 1Y88A 3M9MB 4I2EA 4R64A 3SYZA 3QZ8A 4NLNA 3HWTA 2IHMA 3AU2A 2KFZA 4KLQA 3QZ7A 1ZQEA 9ICSA 2KN7A 1QSYA 4I29A 9ICQA 4ECXA 7ICFA 3GFKB 1H38A 5DQIA 2A1JB 5J2FA 3GIJA 2MUTB 1ZQSA 4RQ6A 3G6VA 2DPJA 2ZTEA 3HT3A 2PI5A 1SL0A 4NXZA 3C2KA 5KFCA 1HUZA 2BCQA 4I2GA 3TFRA 1NJYA 2ZUBA 5CWRA 2BHNA 4KMUA 5BOLA 4C8OA 4O3RA 3PX0A 3SV4A 1LB2B 3PY8A 3M9OB 3UXOA 4TUPA 2GWSA 4BWJA 3QEAZ 2C28A 3RRHA 4DQQA 2C22A 4F92B 9ICMA 2AGQA 3T5KA 2BCSA 4R8UB 1ZQDA 8ICCA 1RZTA 4XUSA 5F9NA 4F4KA 4KLGA 4C8LA 8ICTA 3MR3A 5DG9A 9ICJA 4PHAA 7ICRA 5KFMA 5DGBA 4RU9A 3MR5A 4XRHA 4RNOA 1N48A 3SI8A 4I2AA 5CJ7A 4M9NA 1ZQMA 9ICGA 4NLKA 4F4ZA 4J9MA 4BDPA 1ZQWA 5J2JA 4GC6A 4ED1A 4DF8A 5EOZA 3MFIA 2JEFA 4YD2A 1SL2A 3B0XA 7ICKA 4O9MA 1EXNA 5J0TA 2ASJA 4RQ5A 3IM1A 3ZDAA 5KG1A 4KLTA 1WCNA 4F4YA 4Q8FA 4JWNA 5KFVA 5BOMA 4PHDA 3QEBZ 4B9NA 5J2DA 1C7YA 3KHLA 1L3TA 1U47A 1T7PA 2P6UA 2W9CB 5KFKA 4DL4A 2KZMA 1KFTA 5J29A 4R66A 4B9LA 4ECUA 2BKEA 4QZBA 4DSFA 9ICAA 3BDPA 1KFDA 3MDCA 4BGDA 2KZZA 3PR4A 1PZNA 4DQIA 1MSWD 5DBAA 4RNNA 7ICVA 1QLNA 1NK7A 8ICSA 2AJQA 2VA8A 2W8LA 2FMQA 2UVUA 4FS1A 2KZ3A 3V7KA 1ZQZA 4QZ9A 3RH4A 4M2YA 4UBCA 2ATLA 2KFNA 4C8KA 1ZQBA 2BR0A 4BWMA 4ELTA 2KTQA 5DB9A 7ICIA 3RH5A 4YVZA 2BQUA 1XSPA 2FLPA 4QWAA 5HP4A 4KLMA 3OJSA 2ISOA 2WTFA 1S97A 3ZD8A 1ZQVA 5KT5A 5KFTA 1N56A 4QWEA 4DL3A 1NJWA 2B21A 1TK5A 5DQGA 2PFQA 3PO5A 4B9MA 7ICQA 5IINA 3H8SA 1S10A 2I1QA 4F5PA 4K4HA 2PFOA 3C21A 5HHIA 9ICIA 2JZBA 3C1YA 4F4XA 5J0QA 5J2IA 5J0OA 3T5LA 3RAXA 2AU0A 4YXJA 4QZEA 2AGOA 2J6SA 4JV2A 8ICXA 5KFDA 5L1IA 1S76D 4M9HA 4UB1A 1Z00A 3Q8RB 4ZH4A 4RUAA 4ECYA 1SKWA 4I2BA 2FPLA 4Z6FA 4F2SA 4I27A 4JV1A 2R8IA 2P66A 5IIIA 1RYSA 3EWAA 4ELUA 5KTQA 4I2DA 2C2EA 2BCRA 1ZQRA 1ZJNA 1MQ3A 4KLIA 3G6YA 1NJZA 9ICWA 2F1HA 1S9FA 4RPXA 3PX4A 1SL1A 1XS9D 5KG5A 1ZQKA 1ZQOA 5KFQA 4KITB 4QWBA 1IM4A 5J0RA 1MC8A 2AQ4A 2JEJA 4DOBA 3EW9A 2VA3A 2IA6A 1S0NA 5DB6A 5J0WA 3OSPA 3H40A 1CUKA 4J9RA 2HVIA 4MF8A 3T5HA 4DF4A 4XQ8A 4YP3A 3TI0A 2LYHA 5DQHA 4RQ3A 5EWEA 5D46A 4RT2A 3MGHA 4DOCA 4EEYA 4HYKA 1TK0A 1D8YA 4GXIA 1UT5A 7ICOA 5IIMA 2AQ0A 1BPDA 4BXOB 3MGIA 5DBCA 4JUZA 4I2CA 2HHWA 4J9NA 9ICRA 1NJXA 3BJYA 3TAPA 4UAZA 4QZHA 2W8KA 1ZQXA 1ZQCA 4DSKA 4J9PA 1COOA 2R8KA 3GILA 3PMLA 3RR8A 8ICAA 4IRDA 3MR6A 2ASDA 3C5FA 3TANA 5KT6A 1ZQUA 3GQCA 4MFAA 4O3OA 5J2HA 8ICKA 5CB1A 3H4DA 4RZRA 5KFEA 4C8MA 1ZQLA 9ICFA 3Q8SB 4J9QA 3TFSA 1UT8A 5KT7A 4NLGA 4QW8A 1XU4A 5DB7A 1SKRA 5EWFA 4J9OA 2W9BA 9ICXA 5J2EA 3V6HA 3V7LA 1L3SA 2PFNA 5F9LA 1SKSA 9ICHA 1X2IA 1XWLA 1QTMA 1QSLA 5HHHA 1IXRA 5KFFA 4KLDA 7ICTA 1ZQGA 3PVXA 3RJGA 7ICSA 5KG7A 4Z6DA 3JPTA 3FDSA 1ZQPA 4QW9A 8ICYA 4YR3A 2HHXA 4MFFA 8ICIA 4O5KA 1U49A 4QZ8A 3ISDA 4DSJA 4KN7A 5DG8A 1Z3EB 1NK0A 4IRCA 4P4MA 3H8JA 3EZ5A 4DS4A 3RB6A 5L9XA 5KT2A 3BQ2A 4B9TA 4FBUA 3OGUA 5KG2A 2RDIA 2NRXA 9ICVA 3JPPA 4EBEA 4ECVA 1KTQA 4LZGA 3KHHA 7ICGA 5CHGA 3GV5B 1TAUA 5KFOA 4UAYA 4DL2A 8ICNA 2F1IA 5KG6A 4G3IA 8ICHA 4F4WA 1T4GA 3OHBA 4XA5A 5J0UA 3PX6A 2XCAA 2FMSA 3LWMA 8ICVA 2RDJA 7ICPA 4RUCA 1BPZA 5CA7A 4J9LA 5KFAA 5KG3A 2XY6A 3Q8PB 3PNCA 4J9SA 4JK1A 1TV9A 3HP6A 4F2RA 4YG2A 4UB5A 2BQ3A 3GIKA 1L3VA 8ICEA 2R8GA 4RQ0A 4RQ1A 3ZDBA 4ECQA 3RB3A 5DBBA 5L1LA 4EYHB 8ICWA 4Z6EA 3OHAA 2XY5A 1T8EA 5KFXA 5J2KA 1TVAA 4B9SA 4K4IA 4M9GA 2BGWA 2ZJAA 1D9FA 2ZJ5A 3ISBA 2UVVA 3BQTA 2R8JA 3ORYA 4P4OA 4ED7A 4NY8A 4J9KA 9ICOA 1U45A 1JIHA 4IQWA 4DSEA 1X9MA 3V72A 4DL7A 3UQ2A 4DQPA 4I28A 8ICBA 2UVRA 5KFWA 4YR2A 4DQRA 2NRVA 4UAWA 2ZTCA 1ZYQA 1S0MA 1DOQA 1L3UA 2PFPA 4O5CA 1RYRA 1B22A 3H8WA 1D8LA 4DFPA 3UQ0A 4O3SA 3PW2A 4PGXA 3THVA 4TURA 3LK9A 4YMOA 9ICPA 8ICFA 3SV3A 2F1JA 3RB4A 4IRKA 4PHEA 3RJHA 1UA0A 4O3QA 3EPIA 4RQ4A 4B9VA 2W9BB 2HHVA 3C2MA 3FYHA 4YFKA 1XSNA 4EYIB 5KFIA 3SZ2A 3RJIA 9ICKA 4R8UA 3EPGA 1QSSA 1X9WA 3LDAA 5BPCA 8ICJA 2FPKA 4ELVA 2BQRA 4DLEA 3H7IA 3M8SA 1U48A 4UB3A 2FPMA 4RQ8A 4ECWA 4M0AA 2ZJ8A 4QWDA 3RJEA 4MFCA 9ICBA 2HHUA 4GXJA 3HW8A 3OJUA 1NK5A 4ECTA 5KFUA 2XO7A 4RNMA 4F93B 4B9UA
chains in the Genus database with same CATH superfamily
5AK4A 7ICMA 4KLJA 2PMZF 4KLFA 3AUOA 5ALTA 4NLZA 1FFVA 3ZDEA 3RAQA 4LZDA 3H4BA 4X5VA 3KKAA 4DFKA 2LHTA 1TE2A 4PGYA 2FDRA 3PSPA 2KNJA 1HJPA 1S8OA 3GZFA 5B66U 1NK6A 2J6UA 3IHQB 2RLTA 2F77X 5ALXA 2HOIA 1N5WA 5KFGA 2KG5A 3K4GA 1S0VA 3T3FA 2IOFA 4MEXA 3RTVA 4Z6CA 2Z7JA 5IIKA 4UB2A 5AI4A 3I28A 4JV0A 2E8PA 4MEYA 1KSPA 9ICCA 3UXPA 1JI7A 3ZDCA 3A0HU 4DFJA 4MF2A 5ALFA 4IR1A 5J2BA 2NRTA 3AU6A 2I9GA 5KT4A 2OWOA 2JZBB 2DFLA 3IRUA 3MBYA 3UXNA 4YN4A 4PPXA 3QE9Y 1K1SA 4F5OA 3MFHA 1X9SA 5KG0A 1KL9A 2ZIVB 4GC7A 3KKAC 5J0XA 1JXLA 3MGVA 1A77A 1BVSA 2VIXA 2IHNA 4GLXA 2E1FA 5ALIA 1U9LA 5AI9A 3JPNA 4YQWA 2CN1A 9ICUA 4JWMA 3BS7A 4DS5A 3JPOA 1PUZA 2HHTA 1F5SA 5ALNA 3K75D 1ZQIA 4RQNA 1BPXA 5D4BA 9ICLA 8ICZA 2BPCA 3N28A 2F3NA 5AHXA 5CR0A 4IQTA 2A1JA 2Y1JA 4GXKA 3AM9A 4I2IA 4TUSA 1RYUA 2BCVA 4FS2A 4Y2VA 2ASLA 3LVVA 5CP2A 4Y2JA 3WK4A 3BS5A 4C8NA 1SV0A 1DK2A 2V4RA 3RH6A 3CW2C 5KFBA 5GTHU 4Y2UA 2Y9UA 4IR9A 1NZPA 8ICUA 1ZQTA 2JRZA 7ICEA 2IMWP 2Q4TA 4EZ6A 1B43A 3F5AA 1AQ6A 1MA7A 3ZD9A 1NK8A 3C23A 1S0OA 4EZ9A 2ZIUA 4LJXA 2V4QA 4ECRA 2ES6A 3C5GA 1IG6A 1HIWA 3KHGA 3PV8A 1COKA 2W7PA 3RBEA 7ICHA 5A0LA 4DL6A 2BPFA 1PK3A 3MR2A 4RQ7A 4PH5A 3L5KA 3M9MB 5ALQA 4NLNA 2IHMA 3AU2A 9ICSA 2MU2A 9ICQA 3QUCA 3GFKB 1SV0C 5DQIA 1ED1A 2DPJA 1SL0A 1F0MA 5KFCA 3AL0B 4C8OA 5BOLA 4O3RA 1FEZA 3M9OB 4AYBF 2BDUA 3QNMA 2C28A 2K8AA 9ICMA 2AGQA 2YTUA 1ZQDA 8ICCA 4F4KA 5F9NA 3MR3A 5DG9A 4MHVA 5KFMA 4RU9A 1MN8A 3MR5A 4BUGA 3SI8A 5CJ7A 2XIDA 4M9NA 1ZQMA 4J9MA 1ZQWA 4FZNA 2G06A 4F72A 3MFIA 4O9MA 1EXNA 5KAIU 5J0TA 3PSFA 3O0FA 2DUYA 4Y2SA 5BOMA 4PHDA 4B9NA 1L3TA 2QB1A 5AK5A 2YY6A 5J29A 4B9LA 4ECUA 4BGDA 2KZZA 2LM4A 3KFUF 7ICVA 1QLNA 1NK7A 1Z4NA 5AIAA 2VA8A 2W8LA 2KZ3A 3M6ZA 3RH4A 2H3FA 2ATLA 4C8KA 4BWMA 3ALRA 4YVZA 2QARB 2FLPA 4KLMA 2ISOA 2WTFA 1N56A 4DL3A 4B9MA 5DQGA 5IINA 2L5YA 3T79A 2I1QA 4K4HA 3C1YA 3RAXA 2AGOA 5KFDA 3Q8RB 1Z00A 4ZH4A 4RUAA 2Y9TA 4I2BA 2FPLA 4Z6FA 1SB3C 1ZJNA 2E5SA 1MQ3A 4KLIA 1S9FA 4RPXA 3PX4A 1ZQKA 2K60A 2A19A 4QWBA 5J0RA 1IM4A 2EZXA 1JRPA 5AKXA 3OSPA 4J9RA 3QU2A 2F8KA 1UT5A 3WU2U 1WG8A 5ALOA 4I2CA 2LBOA 1L7PA 4J9PA 2M0NA 3F5EA 1VDVA 4IRDA 5AKEA 2MSNA 8ICKA 3SAHA 4MFAA 4RZRA 9ICFA 4QW8A 4J9OA 9ICXA 5J2EA 3V7LA 2PFNA 1ZQ1C 1N61A 3SAFA 7ICSA 1XO0A 2LYBA 3JPTA 8ICYA 2CPRA 4YR3A 3D2SA 4IRCA 4OO1J 3H8JA 2G08A 1V97A 3PSIA 3RB6A 5KT2A 4B9TA 4FBUA 5KG2A 2F44A 9ICVA 2KIVA 5ALWA 2ZIWA 4EBEA 1X40A 4LZGA 5ALRA 2HBJA 4G3IA 8ICHA 4F4WA 2QLTA 3WKBA 3PX6A 2XCAA 8ICVA 2RDJA 1BPZA 2F8LA 1VJ5A 5KFAA 5KG3A 2XY6A 4J9SA 1DK3A 2ZIUB 4YG2A 4UB5A 3WK5A 2BQ3A 8ICWA 3OHAA 1TVAA 4B9SA 4K4IA 4M9GA 2ZXHA 3ISBA 2W43A 1U45A 1JIHA 4C4SA 4DL7A 3UQ2A 1PVRA 4I28A 2UVRA 2G09A 1S0MA 4O5CA 3SENA 2PFPA 1D8LA 4DFPA 3SD7A 3UQ0A 4PGXA 5AM2A 4TURA 4YMOA 3SV3A 1DRGA 3RB4A 5G5HA 5JU5A 2K4HA 1UA0A 4NV0A 3EPIA 4RQ4A 5GTIU 5KFIA 9ICKA 3D2NA 4R8UA 3CRXA 1NZBA 3KD3A 3M8SA 4UB3A 4RQ8A 4M0AA 2ZJ8A 4QWDA 3IP4B 2HHUA 3CYMA 1NK5A 3QX7A 4RNMA 1ZETA 4OJ5A 4FZLA 1RPLA 1N2XA 1ZXIA 3PW0A 2G07A 1JXEA 1BGXT 5ALEA 4TQRA 4UW9A 2WF5A 2H3QA 4EEKA 5J2CA 2BCUA 2DPIA 1CEZA 1RG6A 3E58A 2W3SA 4QZIA 3QU9A 4DSLA 4ECSA 5AM3A 5TZVA 5JUMA 4O0IA 2ZIXB 4Q43A 1WCLA 4Y2RA 2EAMA 1MQ2A 2W11A 1S77D 1QCKA 2PI4A 1J97A 8ICPA 4RQ2A 2LMRA 4PGQA 2WF7A 4DO9A 2M9NA 2VA2A 9ICNA 5D49A 1OXJA 4KLUA 1TAQA 4QZCA 1ZQYA 2BZFA 5ALMA 8ICNA 5F3XB 5KFNA 2Q0ZX 1Z00B 1N5XA 3IG8A 1OUQA 3QUQA 4F5NA 4CF5A 4YR0A 4F5QA 1DXSA 3Q8MA 4DFMA 1K1QA 1YZ7A 4QIWF 3OSNA 4KLEA 3AQEA 1V9PA 2H3ZA 2WAQF 5KFPA 3SMVA 1SIJA 1BNPA 3GU3A 2EAOA 1XO1A 2JEIA 2K4PA 3NTUA 7ICJA 2GLEA 3QXGA 3GIIA 2G0AA 2B0CA 4O5EA 3M8RA 5AKLA 1SXEA 4FFDA 4AYBC 2W54A 4FO6A 3RJJA 1ZQFA 1V85A 2K8CB 4ICAA 4ECZA 3V7JA 2PKEA 5J8YA 5J2AA 1J2MA 3TARA 4P4PA 2AGPA 3UMBA 4Q8EA 4KLHA 2HSZA 8ICOA 3WKDA 2KE7A 4QZGA 5DG7A 1NK4A 2KVCA 2W9AA 4AP9A 5J2GA 2EDUA 3PO4A 4EELA 2W9MA 2ZIWB 4R63A 1KQQA 5DDYA 5J0SA 5HMMA 1KFSA 4I2HA 4M47A 2WHEA 3MABA 5AIBA 3G6XA 2OH2A 4YXMA 5ALZA 3ICXA 4KMOB 1BPBA 5DLFA 4UAVA 4M04A 2LYAA 1KEJA 5J0YA 4RPZA 3S6JA 4NY8A 1UA1A 1ZQNA 2W3RA 4P2HA 3DDHA 5J8YC 3N4MB 3N7RC 3WKCA 2ZUDA 2GOLA 4LVSA 3BQ0A 3ISCA 4C4TA 4R64A 2QARA 3QZ7A 1QSYA 4I29A 3IV6A 2NV3A 3GIJA 2MUTB 4Y2YA 1ZD5A 5ALSA 3TFRA 1NJYA 4FE3A 4KMUA 2ODGA 3I1YA 3RRHA 2C22A 4CGZA 4R8UB 2RRDA 1PVQA 1RZTA 8ICTA 4PHAA 4US8A 3NASA 4XRHA 4RNOA 2NYVA 2DKZA 4NLKA 3WK7A 2W03A 2JEFA 3B0XA 2WB1F 5AK6A 4RQ5A 3NRWA 3UMGA 2KJ9A 4OJLA 5AM1A 1U47A 2YMLA 1J2NA 4DL4A 2A3VA 5KAFU 1KFTA 4OJPA 2H3IA 3NVYA 3MDCA 4DQIA 4C7YA 5DBAA 4RNNA 2B6GA 1MSWD 3TKAA 2YMPA 3J81j 2FMQA 1ZQZA 4P0PB 1T3QA 1SWVA 4ELTA 1L8OA 3RH5A 2IOHA 1RQLA 3OJSA 1S97A 5CEHA 1ZQVA 3HJEA 3M1YA 4QWEA 3HRDD 1NJWA 2B21A 1TK5A 2YMMA 7ICQA 1S10A 4F5PA 2PFOA 1L7NA 5J0QA 5J2IA 5J0OA 4JV2A 8ICXA 1FO4A 2J6SA 2DF4B 3WK9A 2I5HA 5L1IA 5L1MA 4I27A 4C80A 5IIIA 1RYSA 3EWAA 5JTIA 2C2EA 2RQ5A 1ZQRA 2ESEA 1Q8KA 9ICWA 1ZD4A 1XS9D 3L4PA 5KG5A 1ZQOA 4KITB 3NS1A 1FIQA 3N7SC 4DOBA 3EW9A 5J0WA 3TACB 4DF4A 4YP3A 2LYHA 2OCEA 5EWEA 4HYKA 3SAGA 7ICOA 2AQ0A 4GFJA 5DBCA 4J9NA 1Z1VA 3MC1A 4Y2TA 3TAPA 3BQ7A 1JROA 2R8KA 3GILA 1ECWA 3PMLA 3RR8A 8ICAA 2ASDA 3C5FA 3GQCA 4C0ZA 3H4DA 4NLBA 5KFEA 3TFSA 3QUTA 5KT7A 1XU4A 4BJQA 4EX7A 1NI3A 5F9LA 5HHHA 5ALUA 7ICTA 4UB8U 1ZQGA 1ZQPA 8ICIA 2AHOB 3ISDA 1DGJA 1NNLA 1NK0A 3F2CA 3F53A 2XVTA 4JB3A 3BQ2A 2RDIA 3BZCA 3JPPA 4ECVA 1KTQA 3KHHA 2F1IA 5AI0A 1X42A 5J0UA 4ZOHC 4RUCA 5CA7A 4PZOA 3HP6A 2R8GA 4RQ1A 1O08A 4ECQA 3ZDBA 1T94A 5KFXA 1D9FA 2ZJAA 1WYGA 3QU4A 2UVVA 2JH7A 3BQTA 3F2DA 3ORYA 4IL6U 4P4OA 4ED7A 4J9KA 1LVHA 2ZIXA 1URJA 5KFWA 1B22A 3H8WA 2OM6A 4PL2A 9ICPA 2F1JA 4IRKA 1P7DA 3QUBA 2W9BB 4QIWC 2HHVA 3C2MA 4YFKA 3SZ2A 3WKEA 5HR6A 1RM6C 2KIWA 2QB0A 4NL9A 2BQRA 3H7IA 2G5IB 3OJUA 5KFUA 1Z4OA 4PJ0U 5CRXA 4P0QB 1YZ6A 2LPEA 1ZQHA 4KLOA 8ICLA 2JGAA 3V6KA 4R65A 5ALKA 3GDXA 4I2JA 4QZAA 2D6FC 8ICMA 5KFHA 2P6RA 4QNLA 1KDHA 2DGZA 3ONNA 2GO7A 3NVWA 4UQGA 2E3TA 3HILA 2MAXA 3MDAA 4ED3A 3CNHA 3T5JA 1N60A 3E2EA 3UPQA 2NRZA 2JHDA 1UHUA 5C5JA 5JRTA 4U6PA 1AROP 1KRPA 7ICUA 2G5HB 3M6KA 5AKYA 5AM4A 4NM2A 2JH1A 2ISPA 3RJKA 2HBMA 9ICTA 2XY7A 3KHRA 4M9LA 2ZTDA 2PMZC 4NL9C 4NM1A 1ZQQA 2E1EA 3V6JA 5AI5A 2VJ5A 3JPRA 1D9DA 4DOAA 1NK9A 4YMNA 1L3VA 3PW7A 1TKDA 1O03A 3JPSA 1TFRA 4O3PA 4F50A 2CXYA 4Q45A 4DSIA 5AM5A 4EBCA 4DWIA 2EH9A 3TAQA 4K4GA 5HMLA 4DEZA 3BQ1A 4NWIA 5DDMA 2ALZA 3RJFA 8ICGA 4U7CA 4F8RA 3H0MB 1ZQJA 3PMNA 2JEGA 3NVVA 4M6WB 1NKBA 1JUDA 1VLBA 4BXOA 3H0RB 3PW5A 4YD1A 4RPYA 4QZFA 2YB1A 4DL5A 2J6TA 3RF9A 2UVWA 2Y0SF 3C28A 1Z19A 2MUTA 3TADA 1RXWA 5KG4A 1TK8A 1K5OA 4Y2XA 1BPEA 3AN1A 3JPQA 2PXIA 7ICLA 2HW3A 1HUOA 2DWQA 3RB0A 2YB4A 2WB1C 4DCCA 5ALVA 5KFZA 5AK3A 5IILA 4O3NA 5KFYA 3D6JA 3E0FA 5AKIA 4IQUA 1T3NA 2FLLA 4UBBA 4ED8A 2C2DA 1SWWA 3HKZF 2BPGA 1LV5A 4UB4A 3WKAA 3RRGA 4ED6A 2LKYA 4CCHA 5DLGA 4EBDA 2KZMA 3NGDA 3ETLA 3Q8QB 2N1RA 2O6KA 4OJ6A 3KBBA 4YCXA 5KT3A 5DB8A 1JX4A 2BDPA 2V9WA 4PHPA 2DL0A 5B5EU 2R8HA 1NOMA 3TADC 5DKWA 1UQVA 4I2FA 5KFJA 3C2LA 5IIJA 4P0PA 4F3OA 4BX9C 4I2EA 1RDFA 1L7MA 2KFZA 4KLQA 2KN7A 1ZRMA 4PL1A 3U26A 5J2FA 1ZQSA 4RQ6A 3G6VA 3HT3A 4NXZA 3C2KA 5AM0A 3WK6A 1HUZA 2JMGA 4G9BA 5CWRA 2EZYA 2AXTU 3PX0A 3SV4A 1BNOA 1YT3A 3M7DA 1LB2B 3UXOA 2KV2A 2KICA 2KK0A 2KMDA 2BCSA 2HMXA 2QB0B 4C8LA 1GO3F 7ICRA 5DGBA 1N48A 9ICGA 3NVZA 3LVWA 4BDPA 4GC6A 4ED1A 5EOZA 1SL2A 7ICKA 2WF8A 2D3DA 2ASJA 3EUB2 3IM1A 4KLTA 5EE9A 2NO5A 5KFVA 1C20A 3QEBZ 5J2DA 1T7PA 3N7PD 1IIPA 2W9CB 2JXJA 5KFKA 2ZG6A 4R66A 2BKEA 2E8NA 3KZIU 2AH5A 2H3VA 3SQIA 1ZRNA 4FS1A 4QZ9A 1PVPA 4M2YA 4UBCA 2WFAA 2KTQA 2BQUA 1XSPA 4QWAA 5HP4A 3ZD8A 5KT5A 3PO5A 3H8SA 2A1AA 1KW4A 4OD0A 3AMZA 1X6JA 5HHIA 1SV4A 5FP0A 4QZEA 1SKWA 5AKGA 4JV1A 4ACOA 3B9JA 2R8IA 5KTQA 3AQFA 3G6YA 1NJZA 5KL8B 1QH9A 1FFUA 1MC8A 2VA3A 2K4IA 1S0NA 5DB6A 3H40A 3T5HA 4USAA 3R9KA 5DQHA 5H2FU 4RQ3A 4DOCA 4EEYA 3K1RB 3IN5A 5IIMA 1BPDA 4BXOB 4JUZA 2HHWA 1NJXA 4UAZA 2W8KA 2YMQA 1COOA 2FE9A 1LKYB 5KT6A 5J2HA 3UMCA 5CB1A 4CE6A 1ZQLA 3Q8SB 4J9QA 1UT8A 4CF4A 4NLGA 2W9BA 3V6HA 1L3SA 1SKSA 4DFDA 3QYPA 1QTMA 1QSLA 1IXRA 2KSOA 4UATA 3PVXA 3RJGA 5KG7A 3FDSA 1IV8A 2HHXA 5ALLA 1U49A 4QZ8A 4DSJA 4KN7A 1Z3EB 3ZI4A 3EZ5A 2HDOA 2YX8A 5L9XA 2KHQA 4O3MA 5AICA 4P0QA 4IC9A 1KN5A 5CHGA 3GV5B 1TAUA 4UAYA 5ALHA 1WWVA 4XA5A 2FMSA 3LWMA 7ICPA 2K89A 3KZXA 3PNCA 2CRXA 3GIKA 8ICEA 3RB3A 5DBBA 4EYHB 1X66A 1OW5A 5J2KA 2BGWA 2OEHA 3NUQA 2DBYA 9ICOA 2K4EA 4JMUA 4IQWA 2KD1A 4DSEA 1TAMA 5EE0A 3V72A 3D2QA 4EX6A 8ICBA 4YR2A 3QU5A 2ZTCA 3WK8A 1CI4A 4O3SA 3CP8A 3PW2A 4GIBA 3K1ZA 1KKXA 4FZMA 4O3QA 4B9VA 3ED5A 2NO4A 3FYHA 2KJ5A 2W7OA 4OJOA 3EPGA 4Y2PA 1QSSA 1X9WA 3LDAA 8ICJA 2FPKA 1S5LU 5ALPA 4DLEA 2FPMA 4ECWA 3VC8A 2HOQA 3HW8A 2XI9A 4GXIA 2XO7A 4F93B 4B9UA 2EZZA 3C29A 1SZHA 2Y0SC 2RHFA 4Q44A 4M6WA 4ED2A 2KJ8A 7ICNA 8ICRA 2D8CA 2ZUCA 4KN4A 1SZPA 1D8BA 3PW4A 3QU7A 3HPOA 1U4BA 1ZOLA 2DKXA 4FBTA 4KLLA 4KLSA 2EQYA 5DGAA 5AKKA 5KL1B 2KEYA 5ALJA 2FI1A 3EYZA 3HX0A 4F91B 1L6NA 4DQSA 3TQ1A 3FM9A 2FLNA 1JMSA 2HBLA 1KLNA 4KTQA 3HKZC 4ED0A 2XCPA 5KNIA 3GIMA 3ZDDA 4RT3A 5KFRA 2W04A 1RXVA 3Q8LA 4TQSA 1QQ7A 2NRWA 1HEKA 2GH1A 4TUQA 3LWLA 2LI6A 5E79U 1UCVA 3M9NB 2Y1IA 3LYSA 3PR5B 4QZDA 2MRLA 5HNKA 2KKPA 4YMMA 3RBDA 2IOFK 2W55A 2VANA 3GV7B 3I76A 2HOFA 1XSLA 3KTQA 4CDGA 2XGPA 1KBUA 3DV9A 2ZXIA 3PZPA 1XC9A 1ZJMA 9ICEA 4UB6U 1L5UA 5AI8A 4DLGA 2WF6A 3KOOA 4UAUA 2VKQA 2EANA 5L1KA 2HVHA 5ALGA 2H5XA 4M9JA 2FMPA 5L1JA 1ZQAA 5KFSA 5AKJA 5G5GA 5EWGA 4IQVA 1CRXA 1NKCA 2KSOB 1JN3A 2WAQC 3ETRA 1BPYA 4QWCA 2EAPA 3C1ZA 2XC9A 4HAIA 2MA1A 1PK1A 5KFLA 3B0YA 2HHQA 4PZNA 2C2RA 2E8OA 1NKEA 4C4RA 8ICQA 3Q8KA 1B0XA 1A76A 2VJ4A 2E8MA 2W9CA 3RR7A 4E0DA 3VCBA 1X6IA 2OHFA 1ZQBA 2XGQA 3GV8B 3N97B 5IIOA 2HHSA 3OTQA 5J0PA 2HI0A 4F5RA 2IBKA 3BZKA 1DGSA 1Y88A 3SYZA 3QZ8A 3HWTA 4A8EA 1ZQEA 3H8MA 4ECXA 3A0BU 2RP5A 1H38A 7ICFA 4UASA 2A1JB 2PI5A 2ZTEA 3AEVA 1RQNA 1M6YA 2BCQA 4Y2QA 5ALDA 4I2GA 2ZUBA 2FJ6A 2BHNA 2K8BB 3PY8A 2WF9A 4TUPA 2GWSA 4BWJA 3QEAZ 1Z1BA 4DQQA 4CF3A 5T14A 4F92B 3T5KA 3BS5B 5EE3A 2F2AB 2F76X 4XUSA 4KLGA 2I6XA 9ICJA 1ZD3A 1SXDA 3FAHA 4I2AA 4F4ZA 5J2JA 5AKZA 4DF8A 4YD2A 1WWUA 3F2BA 3SEIA 2OXOA 3ZDAA 4KX3A 5KG1A 1WCNA 5TISU 4F4YA 4JWNA 4Q8FA 1L7OA 1C7YA 3KHLA 5HR7A 2P6UA 4US9A 1A6SA 5C0YA 1B4FA 1LKYA 4QZBA 4DSFA 9ICAA 2KOBA 3BDPA 1KFDA 3PR4A 1PZNA 3FC4A 8ICSA 2AJQA 3H0LB 2UVUA 3V7KA 2KFNA 1N63A 2BR0A 5DB9A 7ICIA 4QJFB 2KHVA 1XNSA 5AI6A 4OCZA 5KFTA 2PFQA 1A0PA 3DEEA 3C21A 9ICIA 2JZBA 4F4XA 3T5LA 2AU0A 4YXJA 1UPHA 1S76D 4M9HA 4UB1A 1JALA 4ECYA 4F2SA 4NLCA 2P66A 2ZIVA 1ZD2P 4ELUA 4I2DA 2BCRA 2P35A 4J03A 4CRXA 4C7ZA 2F1HA 1SL1A 2HCFA 5KFQA 4KX5A 2HBKA 5AKHA 5K4LA 2AQ4A 2JEJA 2IA6A 1CUKA 2HVIA 4MF8A 4RQMA 4XQ8A 3SR6A 3TI0A 3RJEA 3MGHA 5D46A 4RT2A 1TK0A 1D8YA 3MGIA 1L8LA 1F44A 9ICRA 3BJYA 3UM9A 1SGGA 4QZHA 1ZQCA 1ZQXA 4DSKA 3MR6A 2DQNB 2QKQA 3TANA 1ZQUA 4O3OA 2JV3A 4C8MA 4B6JA 5DB7A 1SKRA 5EWFA 9ICHA 1X2IA 1XWLA 5KFFA 1N62A 5EE1A 4KLDA 4Z6DA 4QW9A 4MFFA 2YN4A 4O5KA 5DG8A 4P4MA 4DS4A 1PK1B 3OGUA 2NRXA 1X9XA 3RFAA 7ICGA 5KFOA 4DL2A 5KG6A 2OYYA 3OHBA 1T4GA 1V38A 1WUDA 4EENA 1Q3UA 2YQEA 3Q8PB 4JK1A 1TV9A 2KVSA 3PSTA 4F2RA 4RQ0A 3L3FX 5L1LA 2JR5A 4Z6EA 2XY5A 1T8EA 2ZJ5A 2R8JA 2XICA 5ALYA 1X9MA 4DQPA 4CNQA 3IDWA 4DQRA 2NRVA 4UAWA 1ZYQA 1L3UA 1DOQA 4NJ8A 2KP7A 1RYRA 4UARA 2LM1A 3THVA 4WJ3B 3LK9A 4F71A 8ICFA 4PHEA 3RJHA 2KKVA 3OPXA 1Q46A 1XSNA 4EYIB 3RJIA 3IG5A 3NRZA 4IS7A 5BPCA 4ELVA 1U48A 4MFCA 1QQ5A 9ICBA 2R18A 4GXJA 1QQ6A 4ECTA 4J9LA 1Q3VA
chains in the Genus database with same CATH topology
1ZETA 7ICMA 1RPLA 4KLJA 4Q44A 1ZQHA 4KLOA 8ICLA 4KLFA 4M6WA 3AUOA 3PW0A 4NLZA 3V6KA 3RAQA 3ZDEA 4LZDA 4R65A 3H4BA 4X5VA 4DFKA 4ED2A 7ICNA 3GDXA 1JXEA 4I2JA 4QZAA 8ICRA 1BGXT 5KFHA 4PGYA 2P6RA 1KDHA 8ICMA 1HJPA 2ZUCA 4KN4A 4TQRA 1SZPA 1NK6A 2J6UA 3IHQB 4UQGA 3PW4A 2MAXA 3MDAA 4ED3A 2OWOA 5KFGA 3K4GA 3T5JA 1S0VA 3T3FA 3E2EA 3HPOA 5J2CA 3UPQA 4MEXA 2BCUA 2NRZA 3RTVA 1U4BA 5C5JA 2DPIA 1CEZA 4Z6CA 1AROP 1KRPA 7ICUA 5IIKA 4UB2A 4QZIA 4FBTA 4KLLA 4KLSA 5DGAA 4NM2A 4ECSA 4DSLA 4JV0A 5TZVA 5JUMA 4O0IA 2ISPA 3RJKA 3EYZA 9ICTA 3HX0A 4MEYA 1KSPA 4F91B 4Q43A 2XY7A 3KHRA 9ICCA 1WCLA 4M9LA 2ZTDA 3UXPA 1MQ2A 4DQSA 3TQ1A 1S77D 3ZDCA 2FLNA 2PI4A 1JMSA 8ICPA 4RQ2A 4DFJA 4NM1A 4PGQA 4DO9A 4MF2A 1ZQQA 1KLNA 4IR1A 2M9NA 4KTQA 3V6JA 4ED0A 2XCPA 2VA2A 3GIMA 3ZDDA 9ICNA 3JPRA 5D49A 1D9DA 4RT3A 5J2BA 4DOAA 2NRTA 4KLUA 3AU6A 5KFRA 1NK9A 2I9GA 5KT4A 4QZCA 1TAQA 4YMNA 1ZQYA 3PW7A 1RXVA 2JZBB 2DFLA 4TQSA 3MBYA 3Q8LA 3UXNA 4YN4A 3JPSA 1TKDA 2NRWA 1TFRA 4O3PA 4PPXA 5KFNA 2Q0ZX 4F50A 3QE9Y 1K1SA 1Z00B 4Q45A 4F5OA 3MFHA 1X9SA 4DSIA 4EBCA 5KG0A 4DWIA 4TUQA 3LWLA 4F5NA 4GC7A 5J0XA 3M9NB 2Y1IA 3TAQA 1JXLA 1A77A 4K4GA 5HMLA 3PR5B 4YR0A 4F5QA 4QZDA 5HNKA 1BVSA 4YMMA 4DEZA 3RBDA 3Q8MA 2IHNA 4GLXA 3BQ1A 2VANA 4DFMA 1K1QA 5DDMA 1U9LA 3OSNA 3JPNA 4YQWA 4KLEA 3GV7B 1XSLA 2ALZA 1V9PA 3KTQA 3RJFA 9ICUA 4JWMA 8ICGA 5KFPA 2XGPA 4DS5A 3JPOA 4F8RA 1ZQJA 1XC9A 3PMNA 2JEGA 2HHTA 3K75D 4M6WB 1NKBA 1ZJMA 4BXOA 1XO1A 1ZQIA 3NTUA 2JEIA 1L5UA 1BPXA 9ICEA 7ICJA 5D4BA 3PW5A 4YD1A 4DLGA 3GIIA 4RPYA 9ICLA 8ICZA 4O5EA 4QZFA 3M8RA 4DL5A 2BPCA 2J6TA 5L1KA 2HVHA 2H5XA 2UVWA 5CR0A 4M9JA 4IQTA 2A1JA 2Y1JA 2MUTA 4FO6A 4GXKA 3RJJA 1ZQFA 2FMPA 4I2IA 5L1JA 1ZQAA 4TUSA 4ECZA 5KFSA 3V7JA 2BCVA 5J2AA 4FS2A 1RXWA 2ASLA 3TARA 4P4PA 5EWGA 5KG4A 1TK8A 5CP2A 4IQVA 1BPEA 2AGPA 1NKCA 4Q8EA 1JN3A 4KLHA 3JPQA 2PXIA 1BPYA 2HW3A 4QWCA 7ICLA 8ICOA 1HUOA 4C8NA 3RB0A 3C1ZA 2V4RA 3RH6A 2XC9A 5KFBA 4QZGA 5DG7A 1NK4A 5KFZA 5KFLA 2W9AA 3B0YA 4IR9A 8ICUA 5J2GA 3PO4A 1ZQTA 2W9MA 5IILA 4O3NA 5KFYA 2HHQA 4R63A 7ICEA 2IMWP 5DDYA 4IQUA 2C2RA 1T3NA 2FLLA 5J0SA 4UBBA 1NKEA 4ED8A 8ICQA 3Q8KA 5HMMA 1KFSA 4EZ6A 4I2HA 4M47A 1A76A 1B43A 2C2DA 3MABA 3G6XA 2BPGA 1LV5A 4UB4A 4YXMA 3ZD9A 2W9CA 1BPBA 1NK8A 3RR7A 4E0DA 3C23A 3RRGA 5DLFA 4ED6A 1S0OA 4EZ9A 2V4QA 4M04A 1KEJA 4ECRA 4CCHA 5DLGA 5J0YA 4RPZA 3NGDA 3ETLA 3Q8QB 3C5GA 4EBDA 2XGQA 3KHGA 3GV8B 3N97B 1UA1A 4YCXA 3PV8A 5KT3A 3RBEA 5IIOA 5DB8A 1JX4A 1ZQNA 2BDPA 2HHSA 2V9WA 7ICHA 4P2HA 4PHPA 4DL6A 2R8HA 5J0PA 1NOMA 3N4MB 5DKWA 2BPFA 4I2FA 2ZUDA 3MR2A 4RQ7A 5KFJA 3C2LA 5IIJA 4PH5A 4LVSA 4F5RA 3BQ0A 2IBKA 4F3OA 3ISCA 1DGSA 1Y88A 3M9MB 4I2EA 4R64A 3SYZA 3QZ8A 4NLNA 3HWTA 2IHMA 3AU2A 2KFZA 4KLQA 3QZ7A 1ZQEA 9ICSA 2KN7A 1QSYA 4I29A 9ICQA 4ECXA 7ICFA 3GFKB 1H38A 5DQIA 2A1JB 5J2FA 3GIJA 2MUTB 1ZQSA 4RQ6A 3G6VA 2DPJA 2ZTEA 3HT3A 2PI5A 1SL0A 4NXZA 3C2KA 5KFCA 1HUZA 2BCQA 4I2GA 3TFRA 1NJYA 2ZUBA 5CWRA 2BHNA 4KMUA 5BOLA 4C8OA 4O3RA 3PX0A 3SV4A 1LB2B 3PY8A 3M9OB 3UXOA 4TUPA 2GWSA 4BWJA 3QEAZ 2C28A 3RRHA 4DQQA 2C22A 4F92B 9ICMA 2AGQA 3T5KA 2BCSA 4R8UB 1ZQDA 8ICCA 1RZTA 4XUSA 5F9NA 4F4KA 4KLGA 4C8LA 8ICTA 3MR3A 5DG9A 9ICJA 4PHAA 7ICRA 5KFMA 5DGBA 4RU9A 3MR5A 4XRHA 4RNOA 1N48A 3SI8A 4I2AA 5CJ7A 4M9NA 1ZQMA 9ICGA 4NLKA 4F4ZA 4J9MA 4BDPA 1ZQWA 5J2JA 4GC6A 4ED1A 4DF8A 5EOZA 3MFIA 2JEFA 4YD2A 1SL2A 3B0XA 7ICKA 4O9MA 1EXNA 5J0TA 2ASJA 4RQ5A 3IM1A 3ZDAA 5KG1A 4KLTA 1WCNA 4F4YA 4Q8FA 4JWNA 5KFVA 5BOMA 4PHDA 3QEBZ 4B9NA 5J2DA 1C7YA 3KHLA 1L3TA 1U47A 1T7PA 2P6UA 2W9CB 5KFKA 4DL4A 2KZMA 1KFTA 5J29A 4R66A 4B9LA 4ECUA 2BKEA 4QZBA 4DSFA 9ICAA 3BDPA 1KFDA 3MDCA 4BGDA 2KZZA 3PR4A 1PZNA 4DQIA 1MSWD 5DBAA 4RNNA 7ICVA 1QLNA 1NK7A 8ICSA 2AJQA 2VA8A 2W8LA 2FMQA 2UVUA 4FS1A 2KZ3A 3V7KA 1ZQZA 4QZ9A 3RH4A 4M2YA 4UBCA 2ATLA 2KFNA 4C8KA 1ZQBA 2BR0A 4BWMA 4ELTA 2KTQA 5DB9A 7ICIA 3RH5A 4YVZA 2BQUA 1XSPA 2FLPA 4QWAA 5HP4A 4KLMA 3OJSA 2ISOA 2WTFA 1S97A 3ZD8A 1ZQVA 5KT5A 5KFTA 1N56A 4QWEA 4DL3A 1NJWA 2B21A 1TK5A 5DQGA 2PFQA 3PO5A 4B9MA 7ICQA 5IINA 3H8SA 1S10A 2I1QA 4F5PA 4K4HA 2PFOA 3C21A 5HHIA 9ICIA 2JZBA 3C1YA 4F4XA 5J0QA 5J2IA 5J0OA 3T5LA 3RAXA 2AU0A 4YXJA 4QZEA 2AGOA 2J6SA 4JV2A 8ICXA 5KFDA 5L1IA 1S76D 4M9HA 4UB1A 1Z00A 3Q8RB 4ZH4A 4RUAA 4ECYA 1SKWA 4I2BA 2FPLA 4Z6FA 4F2SA 4I27A 4JV1A 2R8IA 2P66A 5IIIA 1RYSA 3EWAA 4ELUA 5KTQA 4I2DA 2C2EA 2BCRA 1ZQRA 1ZJNA 1MQ3A 4KLIA 3G6YA 1NJZA 9ICWA 2F1HA 1S9FA 4RPXA 3PX4A 1SL1A 1XS9D 5KG5A 1ZQKA 1ZQOA 5KFQA 4KITB 4QWBA 1IM4A 5J0RA 1MC8A 2AQ4A 2JEJA 4DOBA 3EW9A 2VA3A 2IA6A 1S0NA 5DB6A 5J0WA 3OSPA 3H40A 1CUKA 4J9RA 2HVIA 4MF8A 3T5HA 4DF4A 4XQ8A 4YP3A 3TI0A 2LYHA 5DQHA 4RQ3A 5EWEA 5D46A 4RT2A 3MGHA 4DOCA 4EEYA 4HYKA 1TK0A 1D8YA 4GXIA 1UT5A 7ICOA 5IIMA 2AQ0A 1BPDA 4BXOB 3MGIA 5DBCA 4JUZA 4I2CA 2HHWA 4J9NA 9ICRA 1NJXA 3BJYA 3TAPA 4UAZA 4QZHA 2W8KA 1ZQXA 1ZQCA 4DSKA 4J9PA 1COOA 2R8KA 3GILA 3PMLA 3RR8A 8ICAA 4IRDA 3MR6A 2ASDA 3C5FA 3TANA 5KT6A 1ZQUA 3GQCA 4MFAA 4O3OA 5J2HA 8ICKA 5CB1A 3H4DA 4RZRA 5KFEA 4C8MA 1ZQLA 9ICFA 3Q8SB 4J9QA 3TFSA 1UT8A 5KT7A 4NLGA 4QW8A 1XU4A 5DB7A 1SKRA 5EWFA 4J9OA 2W9BA 9ICXA 5J2EA 3V6HA 3V7LA 1L3SA 2PFNA 5F9LA 1SKSA 9ICHA 1X2IA 1XWLA 1QTMA 1QSLA 5HHHA 1IXRA 5KFFA 4KLDA 7ICTA 1ZQGA 3PVXA 3RJGA 7ICSA 5KG7A 4Z6DA 3JPTA 3FDSA 1ZQPA 4QW9A 8ICYA 4YR3A 2HHXA 4MFFA 8ICIA 4O5KA 1U49A 4QZ8A 3ISDA 4DSJA 4KN7A 5DG8A 1Z3EB 1NK0A 4IRCA 4P4MA 3H8JA 3EZ5A 4DS4A 3RB6A 5L9XA 5KT2A 3BQ2A 4B9TA 4FBUA 3OGUA 5KG2A 2RDIA 2NRXA 9ICVA 3JPPA 4EBEA 4ECVA 1KTQA 4LZGA 3KHHA 7ICGA 5CHGA 3GV5B 1TAUA 5KFOA 4UAYA 4DL2A 8ICNA 2F1IA 5KG6A 4G3IA 8ICHA 4F4WA 1T4GA 3OHBA 4XA5A 5J0UA 3PX6A 2XCAA 2FMSA 3LWMA 8ICVA 2RDJA 7ICPA 4RUCA 1BPZA 5CA7A 4J9LA 5KFAA 5KG3A 2XY6A 3Q8PB 3PNCA 4J9SA 4JK1A 1TV9A 3HP6A 4F2RA 4YG2A 4UB5A 2BQ3A 3GIKA 1L3VA 8ICEA 2R8GA 4RQ0A 4RQ1A 3ZDBA 4ECQA 3RB3A 5DBBA 5L1LA 4EYHB 8ICWA 4Z6EA 3OHAA 2XY5A 1T8EA 5KFXA 5J2KA 1TVAA 4B9SA 4K4IA 4M9GA 2BGWA 2ZJAA 1D9FA 2ZJ5A 3ISBA 2UVVA 3BQTA 2R8JA 3ORYA 4P4OA 4ED7A 4NY8A 4J9KA 9ICOA 1U45A 1JIHA 4IQWA 4DSEA 1X9MA 3V72A 4DL7A 3UQ2A 4DQPA 4I28A 8ICBA 2UVRA 5KFWA 4YR2A 4DQRA 2NRVA 4UAWA 2ZTCA 1ZYQA 1S0MA 1DOQA 1L3UA 2PFPA 4O5CA 1RYRA 1B22A 3H8WA 1D8LA 4DFPA 3UQ0A 4O3SA 3PW2A 4PGXA 3THVA 4TURA 3LK9A 4YMOA 9ICPA 8ICFA 3SV3A 2F1JA 3RB4A 4IRKA 4PHEA 3RJHA 1UA0A 4O3QA 3EPIA 4RQ4A 4B9VA 2W9BB 2HHVA 3C2MA 3FYHA 4YFKA 1XSNA 4EYIB 5KFIA 3SZ2A 3RJIA 9ICKA 4R8UA 3EPGA 1QSSA 1X9WA 3LDAA 5BPCA 8ICJA 2FPKA 4ELVA 2BQRA 4DLEA 3H7IA 3M8SA 1U48A 4UB3A 2FPMA 4RQ8A 4ECWA 4M0AA 2ZJ8A 4QWDA 3RJEA 4MFCA 9ICBA 2HHUA 4GXJA 3HW8A 3OJUA 1NK5A 4ECTA 5KFUA 2XO7A 4RNMA 4F93B 4B9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZET A;  7ICM A;  1RPL A;  4KLJ A;  4Q44 A;  1ZQH A;  4KLO A;  8ICL A;  4KLF A;  4M6W A;  3AUO A;  3PW0 A;  4NLZ A;  3V6K A;  3RAQ A;  3ZDE A;  4LZD A;  4R65 A;  3H4B A;  4X5V A;  4DFK A;  4ED2 A;  7ICN A;  3GDX A;  1JXE A;  4I2J A;  4QZA A;  8ICR A;  1BGX T;  5KFH A;  4PGY A;  2P6R A;  1KDH A;  8ICM A;  1HJP A;  2ZUC A;  4KN4 A;  4TQR A;  1SZP A;  1NK6 A;  2J6U A;  3IHQ B;  4UQG A;  3PW4 A;  2MAX A;  3MDA A;  4ED3 A;  2OWO A;  5KFG A;  3K4G A;  3T5J A;  1S0V A;  3T3F A;  3E2E A;  3HPO A;  5J2C A;  3UPQ A;  4MEX A;  2BCU A;  2NRZ A;  3RTV A;  1U4B A;  5C5J A;  2DPI A;  1CEZ A;  4Z6C A;  1ARO P;  1KRP A;  7ICU A;  5IIK A;  4UB2 A;  4QZI A;  4FBT A;  4KLL A;  4KLS A;  5DGA A;  4NM2 A;  4ECS A;  4DSL A;  4JV0 A;  5TZV A;  5JUM A;  4O0I A;  2ISP A;  3RJK A;  3EYZ A;  9ICT A;  3HX0 A;  4MEY A;  1KSP A;  4F91 B;  4Q43 A;  2XY7 A;  3KHR A;  9ICC A;  1WCL A;  4M9L A;  2ZTD A;  3UXP A;  1MQ2 A;  4DQS A;  3TQ1 A;  1S77 D;  3ZDC A;  2FLN A;  2PI4 A;  1JMS A;  8ICP A;  4RQ2 A;  4DFJ A;  4NM1 A;  4PGQ A;  4DO9 A;  4MF2 A;  1ZQQ A;  1KLN A;  4IR1 A;  2M9N A;  4KTQ A;  3V6J A;  4ED0 A;  2XCP A;  2VA2 A;  3GIM A;  3ZDD A;  9ICN A;  3JPR A;  5D49 A;  1D9D A;  4RT3 A;  5J2B A;  4DOA A;  2NRT A;  4KLU A;  3AU6 A;  5KFR A;  1NK9 A;  2I9G A;  5KT4 A;  4QZC A;  1TAQ A;  4YMN A;  1ZQY A;  3PW7 A;  1RXV A;  2JZB B;  2DFL A;  4TQS A;  3MBY A;  3Q8L A;  3UXN A;  4YN4 A;  3JPS A;  1TKD A;  2NRW A;  1TFR A;  4O3P A;  4PPX A;  5KFN A;  2Q0Z X;  4F50 A;  3QE9 Y;  1K1S A;  1Z00 B;  4Q45 A;  4F5O A;  3MFH A;  1X9S A;  4DSI A;  4EBC A;  5KG0 A;  4DWI A;  4TUQ A;  3LWL A;  4F5N A;  4GC7 A;  5J0X A;  3M9N B;  2Y1I A;  3TAQ A;  1JXL A;  1A77 A;  4K4G A;  5HML A;  3PR5 B;  4YR0 A;  4F5Q A;  4QZD A;  5HNK A;  1BVS A;  4YMM A;  4DEZ A;  3RBD A;  3Q8M A;  2IHN A;  4GLX A;  3BQ1 A;  2VAN A;  4DFM A;  1K1Q A;  5DDM A;  1U9L A;  3OSN A;  3JPN A;  4YQW A;  4KLE A;  3GV7 B;  1XSL A;  2ALZ A;  1V9P A;  3KTQ A;  3RJF A;  9ICU A;  4JWM A;  8ICG A;  5KFP A;  2XGP A;  4DS5 A;  3JPO A;  4F8R A;  1ZQJ A;  1XC9 A;  3PMN A;  2JEG A;  2HHT A;  3K75 D;  4M6W B;  1NKB A;  1ZJM A;  4BXO A;  1XO1 A;  1ZQI A;  3NTU A;  2JEI A;  1L5U A;  1BPX A;  9ICE A;  7ICJ A;  5D4B A;  3PW5 A;  4YD1 A;  4DLG A;  3GII A;  4RPY A;  9ICL A;  8ICZ A;  4O5E A;  4QZF A;  3M8R A;  4DL5 A;  2BPC A;  2J6T A;  5L1K A;  2HVH A;  2H5X A;  2UVW A;  5CR0 A;  4M9J A;  4IQT A;  2A1J A;  2Y1J A;  2MUT A;  4FO6 A;  4GXK A;  3RJJ A;  1ZQF A;  2FMP A;  4I2I A;  5L1J A;  1ZQA A;  4TUS A;  4ECZ A;  5KFS A;  3V7J A;  2BCV A;  5J2A A;  4FS2 A;  1RXW A;  2ASL A;  3TAR A;  4P4P A;  5EWG A;  5KG4 A;  1TK8 A;  5CP2 A;  4IQV A;  1BPE A;  2AGP A;  1NKC A;  4Q8E A;  1JN3 A;  4KLH A;  3JPQ A;  2PXI A;  1BPY A;  2HW3 A;  4QWC A;  7ICL A;  8ICO A;  1HUO A;  4C8N A;  3RB0 A;  3C1Z A;  2V4R A;  3RH6 A;  2XC9 A;  5KFB A;  4QZG A;  5DG7 A;  1NK4 A;  5KFZ A;  5KFL A;  2W9A A;  3B0Y A;  4IR9 A;  8ICU A;  5J2G A;  3PO4 A;  1ZQT A;  2W9M A;  5IIL A;  4O3N A;  5KFY A;  2HHQ A;  4R63 A;  7ICE A;  2IMW P;  5DDY A;  4IQU A;  2C2R A;  1T3N A;  2FLL A;  5J0S A;  4UBB A;  1NKE A;  4ED8 A;  8ICQ A;  3Q8K A;  5HMM A;  1KFS A;  4EZ6 A;  4I2H A;  4M47 A;  1A76 A;  1B43 A;  2C2D A;  3MAB A;  3G6X A;  2BPG A;  1LV5 A;  4UB4 A;  4YXM A;  3ZD9 A;  2W9C A;  1BPB A;  1NK8 A;  3RR7 A;  4E0D A;  3C23 A;  3RRG A;  5DLF A;  4ED6 A;  1S0O A;  4EZ9 A;  2V4Q A;  4M04 A;  1KEJ A;  4ECR A;  4CCH A;  5DLG A;  5J0Y A;  4RPZ A;  3NGD A;  3ETL A;  3Q8Q B;  3C5G A;  4EBD A;  2XGQ A;  3KHG A;  3GV8 B;  3N97 B;  1UA1 A;  4YCX A;  3PV8 A;  5KT3 A;  3RBE A;  5IIO A;  5DB8 A;  1JX4 A;  1ZQN A;  2BDP A;  2HHS A;  2V9W A;  7ICH A;  4P2H A;  4PHP A;  4DL6 A;  2R8H A;  5J0P A;  1NOM A;  3N4M B;  5DKW A;  2BPF A;  4I2F A;  2ZUD A;  3MR2 A;  4RQ7 A;  5KFJ A;  3C2L A;  5IIJ A;  4PH5 A;  4LVS A;  4F5R A;  3BQ0 A;  2IBK A;  4F3O A;  3ISC A;  1DGS A;  1Y88 A;  3M9M B;  4I2E A;  4R64 A;  3SYZ A;  3QZ8 A;  4NLN A;  3HWT A;  2IHM A;  3AU2 A;  2KFZ A;  4KLQ A;  3QZ7 A;  1ZQE A;  9ICS A;  2KN7 A;  1QSY A;  4I29 A;  9ICQ A;  4ECX A;  7ICF A;  3GFK B;  1H38 A;  5DQI A;  2A1J B;  5J2F A;  3GIJ A;  2MUT B;  1ZQS A;  4RQ6 A;  3G6V A;  2DPJ A;  2ZTE A;  3HT3 A;  2PI5 A;  1SL0 A;  4NXZ A;  3C2K A;  5KFC A;  1HUZ A;  2BCQ A;  4I2G A;  3TFR A;  1NJY A;  2ZUB A;  5CWR A;  2BHN A;  4KMU A;  5BOL A;  4C8O A;  4O3R A;  3PX0 A;  3SV4 A;  1LB2 B;  3PY8 A;  3M9O B;  3UXO A;  4TUP A;  2GWS A;  4BWJ A;  3QEA Z;  2C28 A;  3RRH A;  4DQQ A;  2C22 A;  4F92 B;  9ICM A;  2AGQ A;  3T5K A;  2BCS A;  4R8U B;  1ZQD A;  8ICC A;  1RZT A;  4XUS A;  5F9N A;  4F4K A;  4KLG A;  4C8L A;  8ICT A;  3MR3 A;  5DG9 A;  9ICJ A;  4PHA A;  7ICR A;  5KFM A;  5DGB A;  4RU9 A;  3MR5 A;  4XRH A;  4RNO A;  1N48 A;  3SI8 A;  4I2A A;  5CJ7 A;  4M9N A;  1ZQM A;  9ICG A;  4NLK A;  4F4Z A;  4J9M A;  4BDP A;  1ZQW A;  5J2J A;  4GC6 A;  4ED1 A;  4DF8 A;  5EOZ A;  3MFI A;  2JEF A;  4YD2 A;  1SL2 A;  3B0X A;  7ICK A;  4O9M A;  1EXN A;  5J0T A;  2ASJ A;  4RQ5 A;  3IM1 A;  3ZDA A;  5KG1 A;  4KLT A;  1WCN A;  4F4Y A;  4Q8F A;  4JWN A;  5KFV A;  5BOM A;  4PHD A;  3QEB Z;  4B9N A;  5J2D A;  1C7Y A;  3KHL A;  1L3T A;  1U47 A;  1T7P A;  2P6U A;  2W9C B;  5KFK A;  4DL4 A;  2KZM A;  1KFT A;  5J29 A;  4R66 A;  4B9L A;  4ECU A;  2BKE A;  4QZB A;  4DSF A;  9ICA A;  3BDP A;  1KFD A;  3MDC A;  4BGD A;  2KZZ A;  3PR4 A;  1PZN A;  4DQI A;  1MSW D;  5DBA A;  4RNN A;  7ICV A;  1QLN A;  1NK7 A;  8ICS A;  2AJQ A;  2VA8 A;  2W8L A;  2FMQ A;  2UVU A;  4FS1 A;  2KZ3 A;  3V7K A;  1ZQZ A;  4QZ9 A;  3RH4 A;  4M2Y A;  4UBC A;  2ATL A;  2KFN A;  4C8K A;  1ZQB A;  2BR0 A;  4BWM A;  4ELT A;  2KTQ A;  5DB9 A;  7ICI A;  3RH5 A;  4YVZ A;  2BQU A;  1XSP A;  2FLP A;  4QWA A;  5HP4 A;  4KLM A;  3OJS A;  2ISO A;  2WTF A;  1S97 A;  3ZD8 A;  1ZQV A;  5KT5 A;  5KFT A;  1N56 A;  4QWE A;  4DL3 A;  1NJW A;  2B21 A;  1TK5 A;  5DQG A;  2PFQ A;  3PO5 A;  4B9M A;  7ICQ A;  5IIN A;  3H8S A;  1S10 A;  2I1Q A;  4F5P A;  4K4H A;  2PFO A;  3C21 A;  5HHI A;  9ICI A;  2JZB A;  3C1Y A;  4F4X A;  5J0Q A;  5J2I A;  5J0O A;  3T5L A;  3RAX A;  2AU0 A;  4YXJ A;  4QZE A;  2AGO A;  2J6S A;  4JV2 A;  8ICX A;  5KFD A;  5L1I A;  1S76 D;  4M9H A;  4UB1 A;  1Z00 A;  3Q8R B;  4ZH4 A;  4RUA A;  4ECY A;  1SKW A;  4I2B A;  2FPL A;  4Z6F A;  4F2S A;  4I27 A;  4JV1 A;  2R8I A;  2P66 A;  5III A;  1RYS A;  3EWA A;  4ELU A;  5KTQ A;  4I2D A;  2C2E A;  2BCR A;  1ZQR A;  1ZJN A;  1MQ3 A;  4KLI A;  3G6Y A;  1NJZ A;  9ICW A;  2F1H A;  1S9F A;  4RPX A;  3PX4 A;  1SL1 A;  1XS9 D;  5KG5 A;  1ZQK A;  1ZQO A;  5KFQ A;  4KIT B;  4QWB A;  1IM4 A;  5J0R A;  1MC8 A;  2AQ4 A;  2JEJ A;  4DOB A;  3EW9 A;  2VA3 A;  2IA6 A;  1S0N A;  5DB6 A;  5J0W A;  3OSP A;  3H40 A;  1CUK A;  4J9R A;  2HVI A;  4MF8 A;  3T5H A;  4DF4 A;  4XQ8 A;  4YP3 A;  3TI0 A;  2LYH A;  5DQH A;  4RQ3 A;  5EWE A;  5D46 A;  4RT2 A;  3MGH A;  4DOC A;  4EEY A;  4HYK A;  1TK0 A;  1D8Y A;  4GXI A;  1UT5 A;  7ICO A;  5IIM A;  2AQ0 A;  1BPD A;  4BXO B;  3MGI A;  5DBC A;  4JUZ A;  4I2C A;  2HHW A;  4J9N A;  9ICR A;  1NJX A;  3BJY A;  3TAP A;  4UAZ A;  4QZH A;  2W8K A;  1ZQX A;  1ZQC A;  4DSK A;  4J9P A;  1COO A;  2R8K A;  3GIL A;  3PML A;  3RR8 A;  8ICA A;  4IRD A;  3MR6 A;  2ASD A;  3C5F A;  3TAN A;  5KT6 A;  1ZQU A;  3GQC A;  4MFA A;  4O3O A;  5J2H A;  8ICK A;  5CB1 A;  3H4D A;  4RZR A;  5KFE A;  4C8M A;  1ZQL A;  9ICF A;  3Q8S B;  4J9Q A;  3TFS A;  1UT8 A;  5KT7 A;  4NLG A;  4QW8 A;  1XU4 A;  5DB7 A;  1SKR A;  5EWF A;  4J9O A;  2W9B A;  9ICX A;  5J2E A;  3V6H A;  3V7L A;  1L3S A;  2PFN A;  5F9L A;  1SKS A;  9ICH A;  1X2I A;  1XWL A;  1QTM A;  1QSL A;  5HHH A;  1IXR A;  5KFF A;  4KLD A;  7ICT A;  1ZQG A;  3PVX A;  3RJG A;  7ICS A;  5KG7 A;  4Z6D A;  3JPT A;  3FDS A;  1ZQP A;  4QW9 A;  8ICY A;  4YR3 A;  2HHX A;  4MFF A;  8ICI A;  4O5K A;  1U49 A;  4QZ8 A;  3ISD A;  4DSJ A;  4KN7 A;  5DG8 A;  1Z3E B;  1NK0 A;  4IRC A;  4P4M A;  3H8J A;  3EZ5 A;  4DS4 A;  3RB6 A;  5L9X A;  5KT2 A;  3BQ2 A;  4B9T A;  4FBU A;  3OGU A;  5KG2 A;  2RDI A;  2NRX A;  9ICV A;  3JPP A;  4EBE A;  4ECV A;  1KTQ A;  4LZG A;  3KHH A;  7ICG A;  5CHG A;  3GV5 B;  1TAU A;  5KFO A;  4UAY A;  4DL2 A;  8ICN A;  2F1I A;  5KG6 A;  4G3I A;  8ICH A;  4F4W A;  1T4G A;  3OHB A;  4XA5 A;  5J0U A;  3PX6 A;  2XCA A;  2FMS A;  3LWM A;  8ICV A;  2RDJ A;  7ICP A;  4RUC A;  1BPZ A;  5CA7 A;  4J9L A;  5KFA A;  5KG3 A;  2XY6 A;  3Q8P B;  3PNC A;  4J9S A;  4JK1 A;  1TV9 A;  3HP6 A;  4F2R A;  4YG2 A;  4UB5 A;  2BQ3 A;  3GIK A;  1L3V A;  8ICE A;  2R8G A;  4RQ0 A;  4RQ1 A;  3ZDB A;  4ECQ A;  3RB3 A;  5DBB A;  5L1L A;  4EYH B;  8ICW A;  4Z6E A;  3OHA A;  2XY5 A;  1T8E A;  5KFX A;  5J2K A;  1TVA A;  4B9S A;  4K4I A;  4M9G A;  2BGW A;  2ZJA A;  1D9F A;  2ZJ5 A;  3ISB A;  2UVV A;  3BQT A;  2R8J A;  3ORY A;  4P4O A;  4ED7 A;  4NY8 A;  4J9K A;  9ICO A;  1U45 A;  1JIH A;  4IQW A;  4DSE A;  1X9M A;  3V72 A;  4DL7 A;  3UQ2 A;  4DQP A;  4I28 A;  8ICB A;  2UVR A;  5KFW A;  4YR2 A;  4DQR A;  2NRV A;  4UAW A;  2ZTC A;  1ZYQ A;  1S0M A;  1DOQ A;  1L3U A;  2PFP A;  4O5C A;  1RYR A;  1B22 A;  3H8W A;  1D8L A;  4DFP A;  3UQ0 A;  4O3S A;  3PW2 A;  4PGX A;  3THV A;  4TUR A;  3LK9 A;  4YMO A;  9ICP A;  8ICF A;  3SV3 A;  2F1J A;  3RB4 A;  4IRK A;  4PHE A;  3RJH A;  1UA0 A;  4O3Q A;  3EPI A;  4RQ4 A;  4B9V A;  2W9B B;  2HHV A;  3C2M A;  3FYH A;  4YFK A;  1XSN A;  4EYI B;  5KFI A;  3SZ2 A;  3RJI A;  9ICK A;  4R8U A;  3EPG A;  1QSS A;  1X9W A;  3LDA A;  5BPC A;  8ICJ A;  2FPK A;  4ELV A;  2BQR A;  4DLE A;  3H7I A;  3M8S A;  1U48 A;  4UB3 A;  2FPM A;  4RQ8 A;  4ECW A;  4M0A A;  2ZJ8 A;  4QWD A;  3RJE A;  4MFC A;  9ICB A;  2HHU A;  4GXJ A;  3HW8 A;  3OJU A;  1NK5 A;  4ECT A;  5KFU A;  2XO7 A;  4RNM A;  4F93 B;  4B9U A; 
#chains in the Genus database with same CATH topology
 5AK4 A;  7ICM A;  4KLJ A;  2PMZ F;  4KLF A;  3AUO A;  5ALT A;  4NLZ A;  1FFV A;  3ZDE A;  3RAQ A;  4LZD A;  3H4B A;  4X5V A;  3KKA A;  4DFK A;  2LHT A;  1TE2 A;  4PGY A;  2FDR A;  3PSP A;  2KNJ A;  1HJP A;  1S8O A;  3GZF A;  5B66 U;  1NK6 A;  2J6U A;  3IHQ B;  2RLT A;  2F77 X;  5ALX A;  2HOI A;  1N5W A;  5KFG A;  2KG5 A;  3K4G A;  1S0V A;  3T3F A;  2IOF A;  4MEX A;  3RTV A;  4Z6C A;  2Z7J A;  5IIK A;  4UB2 A;  5AI4 A;  3I28 A;  4JV0 A;  2E8P A;  4MEY A;  1KSP A;  9ICC A;  3UXP A;  1JI7 A;  3ZDC A;  3A0H U;  4DFJ A;  4MF2 A;  5ALF A;  4IR1 A;  5J2B A;  2NRT A;  3AU6 A;  2I9G A;  5KT4 A;  2OWO A;  2JZB B;  2DFL A;  3IRU A;  3MBY A;  3UXN A;  4YN4 A;  4PPX A;  3QE9 Y;  1K1S A;  4F5O A;  3MFH A;  1X9S A;  5KG0 A;  1KL9 A;  2ZIV B;  4GC7 A;  3KKA C;  5J0X A;  1JXL A;  3MGV A;  1A77 A;  1BVS A;  2VIX A;  2IHN A;  4GLX A;  2E1F A;  5ALI A;  1U9L A;  5AI9 A;  3JPN A;  4YQW A;  2CN1 A;  9ICU A;  4JWM A;  3BS7 A;  4DS5 A;  3JPO A;  1PUZ A;  2HHT A;  1F5S A;  5ALN A;  3K75 D;  1ZQI A;  4RQN A;  1BPX A;  5D4B A;  9ICL A;  8ICZ A;  2BPC A;  3N28 A;  2F3N A;  5AHX A;  5CR0 A;  4IQT A;  2A1J A;  2Y1J A;  4GXK A;  3AM9 A;  4I2I A;  4TUS A;  1RYU A;  2BCV A;  4FS2 A;  4Y2V A;  2ASL A;  3LVV A;  5CP2 A;  4Y2J A;  3WK4 A;  3BS5 A;  4C8N A;  1SV0 A;  1DK2 A;  2V4R A;  3RH6 A;  3CW2 C;  5KFB A;  5GTH U;  4Y2U A;  2Y9U A;  4IR9 A;  1NZP A;  8ICU A;  1ZQT A;  2JRZ A;  7ICE A;  2IMW P;  2Q4T A;  4EZ6 A;  1B43 A;  3F5A A;  1AQ6 A;  1MA7 A;  3ZD9 A;  1NK8 A;  3C23 A;  1S0O A;  4EZ9 A;  2ZIU A;  4LJX A;  2V4Q A;  4ECR A;  2ES6 A;  3C5G A;  1IG6 A;  1HIW A;  3KHG A;  3PV8 A;  1COK A;  2W7P A;  3RBE A;  7ICH A;  5A0L A;  4DL6 A;  2BPF A;  1PK3 A;  3MR2 A;  4RQ7 A;  4PH5 A;  3L5K A;  3M9M B;  5ALQ A;  4NLN A;  2IHM A;  3AU2 A;  9ICS A;  2MU2 A;  9ICQ A;  3QUC A;  3GFK B;  1SV0 C;  5DQI A;  1ED1 A;  2DPJ A;  1SL0 A;  1F0M A;  5KFC A;  3AL0 B;  4C8O A;  5BOL A;  4O3R A;  1FEZ A;  3M9O B;  4AYB F;  2BDU A;  3QNM A;  2C28 A;  2K8A A;  9ICM A;  2AGQ A;  2YTU A;  1ZQD A;  8ICC A;  4F4K A;  5F9N A;  3MR3 A;  5DG9 A;  4MHV A;  5KFM A;  4RU9 A;  1MN8 A;  3MR5 A;  4BUG A;  3SI8 A;  5CJ7 A;  2XID A;  4M9N A;  1ZQM A;  4J9M A;  1ZQW A;  4FZN A;  2G06 A;  4F72 A;  3MFI A;  4O9M A;  1EXN A;  5KAI U;  5J0T A;  3PSF A;  3O0F A;  2DUY A;  4Y2S A;  5BOM A;  4PHD A;  4B9N A;  1L3T A;  2QB1 A;  5AK5 A;  2YY6 A;  5J29 A;  4B9L A;  4ECU A;  4BGD A;  2KZZ A;  2LM4 A;  3KFU F;  7ICV A;  1QLN A;  1NK7 A;  1Z4N A;  5AIA A;  2VA8 A;  2W8L A;  2KZ3 A;  3M6Z A;  3RH4 A;  2H3F A;  2ATL A;  4C8K A;  4BWM A;  3ALR A;  4YVZ A;  2QAR B;  2FLP A;  4KLM A;  2ISO A;  2WTF A;  1N56 A;  4DL3 A;  4B9M A;  5DQG A;  5IIN A;  2L5Y A;  3T79 A;  2I1Q A;  4K4H A;  3C1Y A;  3RAX A;  2AGO A;  5KFD A;  3Q8R B;  1Z00 A;  4ZH4 A;  4RUA A;  2Y9T A;  4I2B A;  2FPL A;  4Z6F A;  1SB3 C;  1ZJN A;  2E5S A;  1MQ3 A;  4KLI A;  1S9F A;  4RPX A;  3PX4 A;  1ZQK A;  2K60 A;  2A19 A;  4QWB A;  5J0R A;  1IM4 A;  2EZX A;  1JRP A;  5AKX A;  3OSP A;  4J9R A;  3QU2 A;  2F8K A;  1UT5 A;  3WU2 U;  1WG8 A;  5ALO A;  4I2C A;  2LBO A;  1L7P A;  4J9P A;  2M0N A;  3F5E A;  1VDV A;  4IRD A;  5AKE A;  2MSN A;  8ICK A;  3SAH A;  4MFA A;  4RZR A;  9ICF A;  4QW8 A;  4J9O A;  9ICX A;  5J2E A;  3V7L A;  2PFN A;  1ZQ1 C;  1N61 A;  3SAF A;  7ICS A;  1XO0 A;  2LYB A;  3JPT A;  8ICY A;  2CPR A;  4YR3 A;  3D2S A;  4IRC A;  4OO1 J;  3H8J A;  2G08 A;  1V97 A;  3PSI A;  3RB6 A;  5KT2 A;  4B9T A;  4FBU A;  5KG2 A;  2F44 A;  9ICV A;  2KIV A;  5ALW A;  2ZIW A;  4EBE A;  1X40 A;  4LZG A;  5ALR A;  2HBJ A;  4G3I A;  8ICH A;  4F4W A;  2QLT A;  3WKB A;  3PX6 A;  2XCA A;  8ICV A;  2RDJ A;  1BPZ A;  2F8L A;  1VJ5 A;  5KFA A;  5KG3 A;  2XY6 A;  4J9S A;  1DK3 A;  2ZIU B;  4YG2 A;  4UB5 A;  3WK5 A;  2BQ3 A;  8ICW A;  3OHA A;  1TVA A;  4B9S A;  4K4I A;  4M9G A;  2ZXH A;  3ISB A;  2W43 A;  1U45 A;  1JIH A;  4C4S A;  4DL7 A;  3UQ2 A;  1PVR A;  4I28 A;  2UVR A;  2G09 A;  1S0M A;  4O5C A;  3SEN A;  2PFP A;  1D8L A;  4DFP A;  3SD7 A;  3UQ0 A;  4PGX A;  5AM2 A;  4TUR A;  4YMO A;  3SV3 A;  1DRG A;  3RB4 A;  5G5H A;  5JU5 A;  2K4H A;  1UA0 A;  4NV0 A;  3EPI A;  4RQ4 A;  5GTI U;  5KFI A;  9ICK A;  3D2N A;  4R8U A;  3CRX A;  1NZB A;  3KD3 A;  3M8S A;  4UB3 A;  4RQ8 A;  4M0A A;  2ZJ8 A;  4QWD A;  3IP4 B;  2HHU A;  3CYM A;  1NK5 A;  3QX7 A;  4RNM A;  1ZET A;  4OJ5 A;  4FZL A;  1RPL A;  1N2X A;  1ZXI A;  3PW0 A;  2G07 A;  1JXE A;  1BGX T;  5ALE A;  4TQR A;  4UW9 A;  2WF5 A;  2H3Q A;  4EEK A;  5J2C A;  2BCU A;  2DPI A;  1CEZ A;  1RG6 A;  3E58 A;  2W3S A;  4QZI A;  3QU9 A;  4DSL A;  4ECS A;  5AM3 A;  5TZV A;  5JUM A;  4O0I A;  2ZIX B;  4Q43 A;  1WCL A;  4Y2R A;  2EAM A;  1MQ2 A;  2W11 A;  1S77 D;  1QCK A;  2PI4 A;  1J97 A;  8ICP A;  4RQ2 A;  2LMR A;  4PGQ A;  2WF7 A;  4DO9 A;  2M9N A;  2VA2 A;  9ICN A;  5D49 A;  1OXJ A;  4KLU A;  1TAQ A;  4QZC A;  1ZQY A;  2BZF A;  5ALM A;  8ICN A;  5F3X B;  5KFN A;  2Q0Z X;  1Z00 B;  1N5X A;  3IG8 A;  1OUQ A;  3QUQ A;  4F5N A;  4CF5 A;  4YR0 A;  4F5Q A;  1DXS A;  3Q8M A;  4DFM A;  1K1Q A;  1YZ7 A;  4QIW F;  3OSN A;  4KLE A;  3AQE A;  1V9P A;  2H3Z A;  2WAQ F;  5KFP A;  3SMV A;  1SIJ A;  1BNP A;  3GU3 A;  2EAO A;  1XO1 A;  2JEI A;  2K4P A;  3NTU A;  7ICJ A;  2GLE A;  3QXG A;  3GII A;  2G0A A;  2B0C A;  4O5E A;  3M8R A;  5AKL A;  1SXE A;  4FFD A;  4AYB C;  2W54 A;  4FO6 A;  3RJJ A;  1ZQF A;  1V85 A;  2K8C B;  4ICA A;  4ECZ A;  3V7J A;  2PKE A;  5J8Y A;  5J2A A;  1J2M A;  3TAR A;  4P4P A;  2AGP A;  3UMB A;  4Q8E A;  4KLH A;  2HSZ A;  8ICO A;  3WKD A;  2KE7 A;  4QZG A;  5DG7 A;  1NK4 A;  2KVC A;  2W9A A;  4AP9 A;  5J2G A;  2EDU A;  3PO4 A;  4EEL A;  2W9M A;  2ZIW B;  4R63 A;  1KQQ A;  5DDY A;  5J0S A;  5HMM A;  1KFS A;  4I2H A;  4M47 A;  2WHE A;  3MAB A;  5AIB A;  3G6X A;  2OH2 A;  4YXM A;  5ALZ A;  3ICX A;  4KMO B;  1BPB A;  5DLF A;  4UAV A;  4M04 A;  2LYA A;  1KEJ A;  5J0Y A;  4RPZ A;  3S6J A;  4NY8 A;  1UA1 A;  1ZQN A;  2W3R A;  4P2H A;  3DDH A;  5J8Y C;  3N4M B;  3N7R C;  3WKC A;  2ZUD A;  2GOL A;  4LVS A;  3BQ0 A;  3ISC A;  4C4T A;  4R64 A;  2QAR A;  3QZ7 A;  1QSY A;  4I29 A;  3IV6 A;  2NV3 A;  3GIJ A;  2MUT B;  4Y2Y A;  1ZD5 A;  5ALS A;  3TFR A;  1NJY A;  4FE3 A;  4KMU A;  2ODG A;  3I1Y A;  3RRH A;  2C22 A;  4CGZ A;  4R8U B;  2RRD A;  1PVQ A;  1RZT A;  8ICT A;  4PHA A;  4US8 A;  3NAS A;  4XRH A;  4RNO A;  2NYV A;  2DKZ A;  4NLK A;  3WK7 A;  2W03 A;  2JEF A;  3B0X A;  2WB1 F;  5AK6 A;  4RQ5 A;  3NRW A;  3UMG A;  2KJ9 A;  4OJL A;  5AM1 A;  1U47 A;  2YML A;  1J2N A;  4DL4 A;  2A3V A;  5KAF U;  1KFT A;  4OJP A;  2H3I A;  3NVY A;  3MDC A;  4DQI A;  4C7Y A;  5DBA A;  4RNN A;  2B6G A;  1MSW D;  3TKA A;  2YMP A;  3J81 j;  2FMQ A;  1ZQZ A;  4P0P B;  1T3Q A;  1SWV A;  4ELT A;  1L8O A;  3RH5 A;  2IOH A;  1RQL A;  3OJS A;  1S97 A;  5CEH A;  1ZQV A;  3HJE A;  3M1Y A;  4QWE A;  3HRD D;  1NJW A;  2B21 A;  1TK5 A;  2YMM A;  7ICQ A;  1S10 A;  4F5P A;  2PFO A;  1L7N A;  5J0Q A;  5J2I A;  5J0O A;  4JV2 A;  8ICX A;  1FO4 A;  2J6S A;  2DF4 B;  3WK9 A;  2I5H A;  5L1I A;  5L1M A;  4I27 A;  4C80 A;  5III A;  1RYS A;  3EWA A;  5JTI A;  2C2E A;  2RQ5 A;  1ZQR A;  2ESE A;  1Q8K A;  9ICW A;  1ZD4 A;  1XS9 D;  3L4P A;  5KG5 A;  1ZQO A;  4KIT B;  3NS1 A;  1FIQ A;  3N7S C;  4DOB A;  3EW9 A;  5J0W A;  3TAC B;  4DF4 A;  4YP3 A;  2LYH A;  2OCE A;  5EWE A;  4HYK A;  3SAG A;  7ICO A;  2AQ0 A;  4GFJ A;  5DBC A;  4J9N A;  1Z1V A;  3MC1 A;  4Y2T A;  3TAP A;  3BQ7 A;  1JRO A;  2R8K A;  3GIL A;  1ECW A;  3PML A;  3RR8 A;  8ICA A;  2ASD A;  3C5F A;  3GQC A;  4C0Z A;  3H4D A;  4NLB A;  5KFE A;  3TFS A;  3QUT A;  5KT7 A;  1XU4 A;  4BJQ A;  4EX7 A;  1NI3 A;  5F9L A;  5HHH A;  5ALU A;  7ICT A;  4UB8 U;  1ZQG A;  1ZQP A;  8ICI A;  2AHO B;  3ISD A;  1DGJ A;  1NNL A;  1NK0 A;  3F2C A;  3F53 A;  2XVT A;  4JB3 A;  3BQ2 A;  2RDI A;  3BZC A;  3JPP A;  4ECV A;  1KTQ A;  3KHH A;  2F1I A;  5AI0 A;  1X42 A;  5J0U A;  4ZOH C;  4RUC A;  5CA7 A;  4PZO A;  3HP6 A;  2R8G A;  4RQ1 A;  1O08 A;  4ECQ A;  3ZDB A;  1T94 A;  5KFX A;  1D9F A;  2ZJA A;  1WYG A;  3QU4 A;  2UVV A;  2JH7 A;  3BQT A;  3F2D A;  3ORY A;  4IL6 U;  4P4O A;  4ED7 A;  4J9K A;  1LVH A;  2ZIX A;  1URJ A;  5KFW A;  1B22 A;  3H8W A;  2OM6 A;  4PL2 A;  9ICP A;  2F1J A;  4IRK A;  1P7D A;  3QUB A;  2W9B B;  4QIW C;  2HHV A;  3C2M A;  4YFK A;  3SZ2 A;  3WKE A;  5HR6 A;  1RM6 C;  2KIW A;  2QB0 A;  4NL9 A;  2BQR A;  3H7I A;  2G5I B;  3OJU A;  5KFU A;  1Z4O A;  4PJ0 U;  5CRX A;  4P0Q B;  1YZ6 A;  2LPE A;  1ZQH A;  4KLO A;  8ICL A;  2JGA A;  3V6K A;  4R65 A;  5ALK A;  3GDX A;  4I2J A;  4QZA A;  2D6F C;  8ICM A;  5KFH A;  2P6R A;  4QNL A;  1KDH A;  2DGZ A;  3ONN A;  2GO7 A;  3NVW A;  4UQG A;  2E3T A;  3HIL A;  2MAX A;  3MDA A;  4ED3 A;  3CNH A;  3T5J A;  1N60 A;  3E2E A;  3UPQ A;  2NRZ A;  2JHD A;  1UHU A;  5C5J A;  5JRT A;  4U6P A;  1ARO P;  1KRP A;  7ICU A;  2G5H B;  3M6K A;  5AKY A;  5AM4 A;  4NM2 A;  2JH1 A;  2ISP A;  3RJK A;  2HBM A;  9ICT A;  2XY7 A;  3KHR A;  4M9L A;  2ZTD A;  2PMZ C;  4NL9 C;  4NM1 A;  1ZQQ A;  2E1E A;  3V6J A;  5AI5 A;  2VJ5 A;  3JPR A;  1D9D A;  4DOA A;  1NK9 A;  4YMN A;  1L3V A;  3PW7 A;  1TKD A;  1O03 A;  3JPS A;  1TFR A;  4O3P A;  4F50 A;  2CXY A;  4Q45 A;  4DSI A;  5AM5 A;  4EBC A;  4DWI A;  2EH9 A;  3TAQ A;  4K4G A;  5HML A;  4DEZ A;  3BQ1 A;  4NWI A;  5DDM A;  2ALZ A;  3RJF A;  8ICG A;  4U7C A;  4F8R A;  3H0M B;  1ZQJ A;  3PMN A;  2JEG A;  3NVV A;  4M6W B;  1NKB A;  1JUD A;  1VLB A;  4BXO A;  3H0R B;  3PW5 A;  4YD1 A;  4RPY A;  4QZF A;  2YB1 A;  4DL5 A;  2J6T A;  3RF9 A;  2UVW A;  2Y0S F;  3C28 A;  1Z19 A;  2MUT A;  3TAD A;  1RXW A;  5KG4 A;  1TK8 A;  1K5O A;  4Y2X A;  1BPE A;  3AN1 A;  3JPQ A;  2PXI A;  7ICL A;  2HW3 A;  1HUO A;  2DWQ A;  3RB0 A;  2YB4 A;  2WB1 C;  4DCC A;  5ALV A;  5KFZ A;  5AK3 A;  5IIL A;  4O3N A;  5KFY A;  3D6J A;  3E0F A;  5AKI A;  4IQU A;  1T3N A;  2FLL A;  4UBB A;  4ED8 A;  2C2D A;  1SWW A;  3HKZ F;  2BPG A;  1LV5 A;  4UB4 A;  3WKA A;  3RRG A;  4ED6 A;  2LKY A;  4CCH A;  5DLG A;  4EBD A;  2KZM A;  3NGD A;  3ETL A;  3Q8Q B;  2N1R A;  2O6K A;  4OJ6 A;  3KBB A;  4YCX A;  5KT3 A;  5DB8 A;  1JX4 A;  2BDP A;  2V9W A;  4PHP A;  2DL0 A;  5B5E U;  2R8H A;  1NOM A;  3TAD C;  5DKW A;  1UQV A;  4I2F A;  5KFJ A;  3C2L A;  5IIJ A;  4P0P A;  4F3O A;  4BX9 C;  4I2E A;  1RDF A;  1L7M A;  2KFZ A;  4KLQ A;  2KN7 A;  1ZRM A;  4PL1 A;  3U26 A;  5J2F A;  1ZQS A;  4RQ6 A;  3G6V A;  3HT3 A;  4NXZ A;  3C2K A;  5AM0 A;  3WK6 A;  1HUZ A;  2JMG A;  4G9B A;  5CWR A;  2EZY A;  2AXT U;  3PX0 A;  3SV4 A;  1BNO A;  1YT3 A;  3M7D A;  1LB2 B;  3UXO A;  2KV2 A;  2KIC A;  2KK0 A;  2KMD A;  2BCS A;  2HMX A;  2QB0 B;  4C8L A;  1GO3 F;  7ICR A;  5DGB A;  1N48 A;  9ICG A;  3NVZ A;  3LVW A;  4BDP A;  4GC6 A;  4ED1 A;  5EOZ A;  1SL2 A;  7ICK A;  2WF8 A;  2D3D A;  2ASJ A;  3EUB 2;  3IM1 A;  4KLT A;  5EE9 A;  2NO5 A;  5KFV A;  1C20 A;  3QEB Z;  5J2D A;  1T7P A;  3N7P D;  1IIP A;  2W9C B;  2JXJ A;  5KFK A;  2ZG6 A;  4R66 A;  2BKE A;  2E8N A;  3KZI U;  2AH5 A;  2H3V A;  3SQI A;  1ZRN A;  4FS1 A;  4QZ9 A;  1PVP A;  4M2Y A;  4UBC A;  2WFA A;  2KTQ A;  2BQU A;  1XSP A;  4QWA A;  5HP4 A;  3ZD8 A;  5KT5 A;  3PO5 A;  3H8S A;  2A1A A;  1KW4 A;  4OD0 A;  3AMZ A;  1X6J A;  5HHI A;  1SV4 A;  5FP0 A;  4QZE A;  1SKW A;  5AKG A;  4JV1 A;  4ACO A;  3B9J A;  2R8I A;  5KTQ A;  3AQF A;  3G6Y A;  1NJZ A;  5KL8 B;  1QH9 A;  1FFU A;  1MC8 A;  2VA3 A;  2K4I A;  1S0N A;  5DB6 A;  3H40 A;  3T5H A;  4USA A;  3R9K A;  5DQH A;  5H2F U;  4RQ3 A;  4DOC A;  4EEY A;  3K1R B;  3IN5 A;  5IIM A;  1BPD A;  4BXO B;  4JUZ A;  2HHW A;  1NJX A;  4UAZ A;  2W8K A;  2YMQ A;  1COO A;  2FE9 A;  1LKY B;  5KT6 A;  5J2H A;  3UMC A;  5CB1 A;  4CE6 A;  1ZQL A;  3Q8S B;  4J9Q A;  1UT8 A;  4CF4 A;  4NLG A;  2W9B A;  3V6H A;  1L3S A;  1SKS A;  4DFD A;  3QYP A;  1QTM A;  1QSL A;  1IXR A;  2KSO A;  4UAT A;  3PVX A;  3RJG A;  5KG7 A;  3FDS A;  1IV8 A;  2HHX A;  5ALL A;  1U49 A;  4QZ8 A;  4DSJ A;  4KN7 A;  1Z3E B;  3ZI4 A;  3EZ5 A;  2HDO A;  2YX8 A;  5L9X A;  2KHQ A;  4O3M A;  5AIC A;  4P0Q A;  4IC9 A;  1KN5 A;  5CHG A;  3GV5 B;  1TAU A;  4UAY A;  5ALH A;  1WWV A;  4XA5 A;  2FMS A;  3LWM A;  7ICP A;  2K89 A;  3KZX A;  3PNC A;  2CRX A;  3GIK A;  8ICE A;  3RB3 A;  5DBB A;  4EYH B;  1X66 A;  1OW5 A;  5J2K A;  2BGW A;  2OEH A;  3NUQ A;  2DBY A;  9ICO A;  2K4E A;  4JMU A;  4IQW A;  2KD1 A;  4DSE A;  1TAM A;  5EE0 A;  3V72 A;  3D2Q A;  4EX6 A;  8ICB A;  4YR2 A;  3QU5 A;  2ZTC A;  3WK8 A;  1CI4 A;  4O3S A;  3CP8 A;  3PW2 A;  4GIB A;  3K1Z A;  1KKX A;  4FZM A;  4O3Q A;  4B9V A;  3ED5 A;  2NO4 A;  3FYH A;  2KJ5 A;  2W7O A;  4OJO A;  3EPG A;  4Y2P A;  1QSS A;  1X9W A;  3LDA A;  8ICJ A;  2FPK A;  1S5L U;  5ALP A;  4DLE A;  2FPM A;  4ECW A;  3VC8 A;  2HOQ A;  3HW8 A;  2XI9 A;  4GXI A;  2XO7 A;  4F93 B;  4B9U A;  2EZZ A;  3C29 A;  1SZH A;  2Y0S C;  2RHF A;  4Q44 A;  4M6W A;  4ED2 A;  2KJ8 A;  7ICN A;  8ICR A;  2D8C A;  2ZUC A;  4KN4 A;  1SZP A;  1D8B A;  3PW4 A;  3QU7 A;  3HPO A;  1U4B A;  1ZOL A;  2DKX A;  4FBT A;  4KLL A;  4KLS A;  2EQY A;  5DGA A;  5AKK A;  5KL1 B;  2KEY A;  5ALJ A;  2FI1 A;  3EYZ A;  3HX0 A;  4F91 B;  1L6N A;  4DQS A;  3TQ1 A;  3FM9 A;  2FLN A;  1JMS A;  2HBL A;  1KLN A;  4KTQ A;  3HKZ C;  4ED0 A;  2XCP A;  5KNI A;  3GIM A;  3ZDD A;  4RT3 A;  5KFR A;  2W04 A;  1RXV A;  3Q8L A;  4TQS A;  1QQ7 A;  2NRW A;  1HEK A;  2GH1 A;  4TUQ A;  3LWL A;  2LI6 A;  5E79 U;  1UCV A;  3M9N B;  2Y1I A;  3LYS A;  3PR5 B;  4QZD A;  2MRL A;  5HNK A;  2KKP A;  4YMM A;  3RBD A;  2IOF K;  2W55 A;  2VAN A;  3GV7 B;  3I76 A;  2HOF A;  1XSL A;  3KTQ A;  4CDG A;  2XGP A;  1KBU A;  3DV9 A;  2ZXI A;  3PZP A;  1XC9 A;  1ZJM A;  9ICE A;  4UB6 U;  1L5U A;  5AI8 A;  4DLG A;  2WF6 A;  3KOO A;  4UAU A;  2VKQ A;  2EAN A;  5L1K A;  2HVH A;  5ALG A;  2H5X A;  4M9J A;  2FMP A;  5L1J A;  1ZQA A;  5KFS A;  5AKJ A;  5G5G A;  5EWG A;  4IQV A;  1CRX A;  1NKC A;  2KSO B;  1JN3 A;  2WAQ C;  3ETR A;  1BPY A;  4QWC A;  2EAP A;  3C1Z A;  2XC9 A;  4HAI A;  2MA1 A;  1PK1 A;  5KFL A;  3B0Y A;  2HHQ A;  4PZN A;  2C2R A;  2E8O A;  1NKE A;  4C4R A;  8ICQ A;  3Q8K A;  1B0X A;  1A76 A;  2VJ4 A;  2E8M A;  2W9C A;  3RR7 A;  4E0D A;  3VCB A;  1X6I A;  2OHF A;  1ZQB A;  2XGQ A;  3GV8 B;  3N97 B;  5IIO A;  2HHS A;  3OTQ A;  5J0P A;  2HI0 A;  4F5R A;  2IBK A;  3BZK A;  1DGS A;  1Y88 A;  3SYZ A;  3QZ8 A;  3HWT A;  4A8E A;  1ZQE A;  3H8M A;  4ECX A;  3A0B U;  2RP5 A;  1H38 A;  7ICF A;  4UAS A;  2A1J B;  2PI5 A;  2ZTE A;  3AEV A;  1RQN A;  1M6Y A;  2BCQ A;  4Y2Q A;  5ALD A;  4I2G A;  2ZUB A;  2FJ6 A;  2BHN A;  2K8B B;  3PY8 A;  2WF9 A;  4TUP A;  2GWS A;  4BWJ A;  3QEA Z;  1Z1B A;  4DQQ A;  4CF3 A;  5T14 A;  4F92 B;  3T5K A;  3BS5 B;  5EE3 A;  2F2A B;  2F76 X;  4XUS A;  4KLG A;  2I6X A;  9ICJ A;  1ZD3 A;  1SXD A;  3FAH A;  4I2A A;  4F4Z A;  5J2J A;  5AKZ A;  4DF8 A;  4YD2 A;  1WWU A;  3F2B A;  3SEI A;  2OXO A;  3ZDA A;  4KX3 A;  5KG1 A;  1WCN A;  5TIS U;  4F4Y A;  4JWN A;  4Q8F A;  1L7O A;  1C7Y A;  3KHL A;  5HR7 A;  2P6U A;  4US9 A;  1A6S A;  5C0Y A;  1B4F A;  1LKY A;  4QZB A;  4DSF A;  9ICA A;  2KOB A;  3BDP A;  1KFD A;  3PR4 A;  1PZN A;  3FC4 A;  8ICS A;  2AJQ A;  3H0L B;  2UVU A;  3V7K A;  2KFN A;  1N63 A;  2BR0 A;  5DB9 A;  7ICI A;  4QJF B;  2KHV A;  1XNS A;  5AI6 A;  4OCZ A;  5KFT A;  2PFQ A;  1A0P A;  3DEE A;  3C21 A;  9ICI A;  2JZB A;  4F4X A;  3T5L A;  2AU0 A;  4YXJ A;  1UPH A;  1S76 D;  4M9H A;  4UB1 A;  1JAL A;  4ECY A;  4F2S A;  4NLC A;  2P66 A;  2ZIV A;  1ZD2 P;  4ELU A;  4I2D A;  2BCR A;  2P35 A;  4J03 A;  4CRX A;  4C7Z A;  2F1H A;  1SL1 A;  2HCF A;  5KFQ A;  4KX5 A;  2HBK A;  5AKH A;  5K4L A;  2AQ4 A;  2JEJ A;  2IA6 A;  1CUK A;  2HVI A;  4MF8 A;  4RQM A;  4XQ8 A;  3SR6 A;  3TI0 A;  3RJE A;  3MGH A;  5D46 A;  4RT2 A;  1TK0 A;  1D8Y A;  3MGI A;  1L8L A;  1F44 A;  9ICR A;  3BJY A;  3UM9 A;  1SGG A;  4QZH A;  1ZQC A;  1ZQX A;  4DSK A;  3MR6 A;  2DQN B;  2QKQ A;  3TAN A;  1ZQU A;  4O3O A;  2JV3 A;  4C8M A;  4B6J A;  5DB7 A;  1SKR A;  5EWF A;  9ICH A;  1X2I A;  1XWL A;  5KFF A;  1N62 A;  5EE1 A;  4KLD A;  4Z6D A;  4QW9 A;  4MFF A;  2YN4 A;  4O5K A;  5DG8 A;  4P4M A;  4DS4 A;  1PK1 B;  3OGU A;  2NRX A;  1X9X A;  3RFA A;  7ICG A;  5KFO A;  4DL2 A;  5KG6 A;  2OYY A;  3OHB A;  1T4G A;  1V38 A;  1WUD A;  4EEN A;  1Q3U A;  2YQE A;  3Q8P B;  4JK1 A;  1TV9 A;  2KVS A;  3PST A;  4F2R A;  4RQ0 A;  3L3F X;  5L1L A;  2JR5 A;  4Z6E A;  2XY5 A;  1T8E A;  2ZJ5 A;  2R8J A;  2XIC A;  5ALY A;  1X9M A;  4DQP A;  4CNQ A;  3IDW A;  4DQR A;  2NRV A;  4UAW A;  1ZYQ A;  1L3U A;  1DOQ A;  4NJ8 A;  2KP7 A;  1RYR A;  4UAR A;  2LM1 A;  3THV A;  4WJ3 B;  3LK9 A;  4F71 A;  8ICF A;  4PHE A;  3RJH A;  2KKV A;  3OPX A;  1Q46 A;  1XSN A;  4EYI B;  3RJI A;  3IG5 A;  3NRZ A;  4IS7 A;  5BPC A;  4ELV A;  1U48 A;  4MFC A;  1QQ5 A;  9ICB A;  2R18 A;  4GXJ A;  1QQ6 A;  4ECT A;  4J9L A;  1Q3V A; 
#chains in the Genus database with same CATH homology
 1ZET A;  7ICM A;  1RPL A;  4KLJ A;  4Q44 A;  1ZQH A;  4KLO A;  8ICL A;  4KLF A;  4M6W A;  3AUO A;  3PW0 A;  4NLZ A;  3V6K A;  3RAQ A;  3ZDE A;  4LZD A;  4R65 A;  3H4B A;  4X5V A;  4DFK A;  4ED2 A;  7ICN A;  3GDX A;  1JXE A;  4I2J A;  4QZA A;  8ICR A;  1BGX T;  5KFH A;  4PGY A;  2P6R A;  1KDH A;  8ICM A;  1HJP A;  2ZUC A;  4KN4 A;  4TQR A;  1SZP A;  1NK6 A;  2J6U A;  3IHQ B;  4UQG A;  3PW4 A;  2MAX A;  3MDA A;  4ED3 A;  2OWO A;  5KFG A;  3K4G A;  3T5J A;  1S0V A;  3T3F A;  3E2E A;  3HPO A;  5J2C A;  3UPQ A;  4MEX A;  2BCU A;  2NRZ A;  3RTV A;  1U4B A;  5C5J A;  2DPI A;  1CEZ A;  4Z6C A;  1ARO P;  1KRP A;  7ICU A;  5IIK A;  4UB2 A;  4QZI A;  4FBT A;  4KLL A;  4KLS A;  5DGA A;  4NM2 A;  4ECS A;  4DSL A;  4JV0 A;  5TZV A;  5JUM A;  4O0I A;  2ISP A;  3RJK A;  3EYZ A;  9ICT A;  3HX0 A;  4MEY A;  1KSP A;  4F91 B;  4Q43 A;  2XY7 A;  3KHR A;  9ICC A;  1WCL A;  4M9L A;  2ZTD A;  3UXP A;  1MQ2 A;  4DQS A;  3TQ1 A;  1S77 D;  3ZDC A;  2FLN A;  2PI4 A;  1JMS A;  8ICP A;  4RQ2 A;  4DFJ A;  4NM1 A;  4PGQ A;  4DO9 A;  4MF2 A;  1ZQQ A;  1KLN A;  4IR1 A;  2M9N A;  4KTQ A;  3V6J A;  4ED0 A;  2XCP A;  2VA2 A;  3GIM A;  3ZDD A;  9ICN A;  3JPR A;  5D49 A;  1D9D A;  4RT3 A;  5J2B A;  4DOA A;  2NRT A;  4KLU A;  3AU6 A;  5KFR A;  1NK9 A;  2I9G A;  5KT4 A;  4QZC A;  1TAQ A;  4YMN A;  1ZQY A;  3PW7 A;  1RXV A;  2JZB B;  2DFL A;  4TQS A;  3MBY A;  3Q8L A;  3UXN A;  4YN4 A;  3JPS A;  1TKD A;  2NRW A;  1TFR A;  4O3P A;  4PPX A;  5KFN A;  2Q0Z X;  4F50 A;  3QE9 Y;  1K1S A;  1Z00 B;  4Q45 A;  4F5O A;  3MFH A;  1X9S A;  4DSI A;  4EBC A;  5KG0 A;  4DWI A;  4TUQ A;  3LWL A;  4F5N A;  4GC7 A;  5J0X A;  3M9N B;  2Y1I A;  3TAQ A;  1JXL A;  1A77 A;  4K4G A;  5HML A;  3PR5 B;  4YR0 A;  4F5Q A;  4QZD A;  5HNK A;  1BVS A;  4YMM A;  4DEZ A;  3RBD A;  3Q8M A;  2IHN A;  4GLX A;  3BQ1 A;  2VAN A;  4DFM A;  1K1Q A;  5DDM A;  1U9L A;  3OSN A;  3JPN A;  4YQW A;  4KLE A;  3GV7 B;  1XSL A;  2ALZ A;  1V9P A;  3KTQ A;  3RJF A;  9ICU A;  4JWM A;  8ICG A;  5KFP A;  2XGP A;  4DS5 A;  3JPO A;  4F8R A;  1ZQJ A;  1XC9 A;  3PMN A;  2JEG A;  2HHT A;  3K75 D;  4M6W B;  1NKB A;  1ZJM A;  4BXO A;  1XO1 A;  1ZQI A;  3NTU A;  2JEI A;  1L5U A;  1BPX A;  9ICE A;  7ICJ A;  5D4B A;  3PW5 A;  4YD1 A;  4DLG A;  3GII A;  4RPY A;  9ICL A;  8ICZ A;  4O5E A;  4QZF A;  3M8R A;  4DL5 A;  2BPC A;  2J6T A;  5L1K A;  2HVH A;  2H5X A;  2UVW A;  5CR0 A;  4M9J A;  4IQT A;  2A1J A;  2Y1J A;  2MUT A;  4FO6 A;  4GXK A;  3RJJ A;  1ZQF A;  2FMP A;  4I2I A;  5L1J A;  1ZQA A;  4TUS A;  4ECZ A;  5KFS A;  3V7J A;  2BCV A;  5J2A A;  4FS2 A;  1RXW A;  2ASL A;  3TAR A;  4P4P A;  5EWG A;  5KG4 A;  1TK8 A;  5CP2 A;  4IQV A;  1BPE A;  2AGP A;  1NKC A;  4Q8E A;  1JN3 A;  4KLH A;  3JPQ A;  2PXI A;  1BPY A;  2HW3 A;  4QWC A;  7ICL A;  8ICO A;  1HUO A;  4C8N A;  3RB0 A;  3C1Z A;  2V4R A;  3RH6 A;  2XC9 A;  5KFB A;  4QZG A;  5DG7 A;  1NK4 A;  5KFZ A;  5KFL A;  2W9A A;  3B0Y A;  4IR9 A;  8ICU A;  5J2G A;  3PO4 A;  1ZQT A;  2W9M A;  5IIL A;  4O3N A;  5KFY A;  2HHQ A;  4R63 A;  7ICE A;  2IMW P;  5DDY A;  4IQU A;  2C2R A;  1T3N A;  2FLL A;  5J0S A;  4UBB A;  1NKE A;  4ED8 A;  8ICQ A;  3Q8K A;  5HMM A;  1KFS A;  4EZ6 A;  4I2H A;  4M47 A;  1A76 A;  1B43 A;  2C2D A;  3MAB A;  3G6X A;  2BPG A;  1LV5 A;  4UB4 A;  4YXM A;  3ZD9 A;  2W9C A;  1BPB A;  1NK8 A;  3RR7 A;  4E0D A;  3C23 A;  3RRG A;  5DLF A;  4ED6 A;  1S0O A;  4EZ9 A;  2V4Q A;  4M04 A;  1KEJ A;  4ECR A;  4CCH A;  5DLG A;  5J0Y A;  4RPZ A;  3NGD A;  3ETL A;  3Q8Q B;  3C5G A;  4EBD A;  2XGQ A;  3KHG A;  3GV8 B;  3N97 B;  1UA1 A;  4YCX A;  3PV8 A;  5KT3 A;  3RBE A;  5IIO A;  5DB8 A;  1JX4 A;  1ZQN A;  2BDP A;  2HHS A;  2V9W A;  7ICH A;  4P2H A;  4PHP A;  4DL6 A;  2R8H A;  5J0P A;  1NOM A;  3N4M B;  5DKW A;  2BPF A;  4I2F A;  2ZUD A;  3MR2 A;  4RQ7 A;  5KFJ A;  3C2L A;  5IIJ A;  4PH5 A;  4LVS A;  4F5R A;  3BQ0 A;  2IBK A;  4F3O A;  3ISC A;  1DGS A;  1Y88 A;  3M9M B;  4I2E A;  4R64 A;  3SYZ A;  3QZ8 A;  4NLN A;  3HWT A;  2IHM A;  3AU2 A;  2KFZ A;  4KLQ A;  3QZ7 A;  1ZQE A;  9ICS A;  2KN7 A;  1QSY A;  4I29 A;  9ICQ A;  4ECX A;  7ICF A;  3GFK B;  1H38 A;  5DQI A;  2A1J B;  5J2F A;  3GIJ A;  2MUT B;  1ZQS A;  4RQ6 A;  3G6V A;  2DPJ A;  2ZTE A;  3HT3 A;  2PI5 A;  1SL0 A;  4NXZ A;  3C2K A;  5KFC A;  1HUZ A;  2BCQ A;  4I2G A;  3TFR A;  1NJY A;  2ZUB A;  5CWR A;  2BHN A;  4KMU A;  5BOL A;  4C8O A;  4O3R A;  3PX0 A;  3SV4 A;  1LB2 B;  3PY8 A;  3M9O B;  3UXO A;  4TUP A;  2GWS A;  4BWJ A;  3QEA Z;  2C28 A;  3RRH A;  4DQQ A;  2C22 A;  4F92 B;  9ICM A;  2AGQ A;  3T5K A;  2BCS A;  4R8U B;  1ZQD A;  8ICC A;  1RZT A;  4XUS A;  5F9N A;  4F4K A;  4KLG A;  4C8L A;  8ICT A;  3MR3 A;  5DG9 A;  9ICJ A;  4PHA A;  7ICR A;  5KFM A;  5DGB A;  4RU9 A;  3MR5 A;  4XRH A;  4RNO A;  1N48 A;  3SI8 A;  4I2A A;  5CJ7 A;  4M9N A;  1ZQM A;  9ICG A;  4NLK A;  4F4Z A;  4J9M A;  4BDP A;  1ZQW A;  5J2J A;  4GC6 A;  4ED1 A;  4DF8 A;  5EOZ A;  3MFI A;  2JEF A;  4YD2 A;  1SL2 A;  3B0X A;  7ICK A;  4O9M A;  1EXN A;  5J0T A;  2ASJ A;  4RQ5 A;  3IM1 A;  3ZDA A;  5KG1 A;  4KLT A;  1WCN A;  4F4Y A;  4Q8F A;  4JWN A;  5KFV A;  5BOM A;  4PHD A;  3QEB Z;  4B9N A;  5J2D A;  1C7Y A;  3KHL A;  1L3T A;  1U47 A;  1T7P A;  2P6U A;  2W9C B;  5KFK A;  4DL4 A;  2KZM A;  1KFT A;  5J29 A;  4R66 A;  4B9L A;  4ECU A;  2BKE A;  4QZB A;  4DSF A;  9ICA A;  3BDP A;  1KFD A;  3MDC A;  4BGD A;  2KZZ A;  3PR4 A;  1PZN A;  4DQI A;  1MSW D;  5DBA A;  4RNN A;  7ICV A;  1QLN A;  1NK7 A;  8ICS A;  2AJQ A;  2VA8 A;  2W8L A;  2FMQ A;  2UVU A;  4FS1 A;  2KZ3 A;  3V7K A;  1ZQZ A;  4QZ9 A;  3RH4 A;  4M2Y A;  4UBC A;  2ATL A;  2KFN A;  4C8K A;  1ZQB A;  2BR0 A;  4BWM A;  4ELT A;  2KTQ A;  5DB9 A;  7ICI A;  3RH5 A;  4YVZ A;  2BQU A;  1XSP A;  2FLP A;  4QWA A;  5HP4 A;  4KLM A;  3OJS A;  2ISO A;  2WTF A;  1S97 A;  3ZD8 A;  1ZQV A;  5KT5 A;  5KFT A;  1N56 A;  4QWE A;  4DL3 A;  1NJW A;  2B21 A;  1TK5 A;  5DQG A;  2PFQ A;  3PO5 A;  4B9M A;  7ICQ A;  5IIN A;  3H8S A;  1S10 A;  2I1Q A;  4F5P A;  4K4H A;  2PFO A;  3C21 A;  5HHI A;  9ICI A;  2JZB A;  3C1Y A;  4F4X A;  5J0Q A;  5J2I A;  5J0O A;  3T5L A;  3RAX A;  2AU0 A;  4YXJ A;  4QZE A;  2AGO A;  2J6S A;  4JV2 A;  8ICX A;  5KFD A;  5L1I A;  1S76 D;  4M9H A;  4UB1 A;  1Z00 A;  3Q8R B;  4ZH4 A;  4RUA A;  4ECY A;  1SKW A;  4I2B A;  2FPL A;  4Z6F A;  4F2S A;  4I27 A;  4JV1 A;  2R8I A;  2P66 A;  5III A;  1RYS A;  3EWA A;  4ELU A;  5KTQ A;  4I2D A;  2C2E A;  2BCR A;  1ZQR A;  1ZJN A;  1MQ3 A;  4KLI A;  3G6Y A;  1NJZ A;  9ICW A;  2F1H A;  1S9F A;  4RPX A;  3PX4 A;  1SL1 A;  1XS9 D;  5KG5 A;  1ZQK A;  1ZQO A;  5KFQ A;  4KIT B;  4QWB A;  1IM4 A;  5J0R A;  1MC8 A;  2AQ4 A;  2JEJ A;  4DOB A;  3EW9 A;  2VA3 A;  2IA6 A;  1S0N A;  5DB6 A;  5J0W A;  3OSP A;  3H40 A;  1CUK A;  4J9R A;  2HVI A;  4MF8 A;  3T5H A;  4DF4 A;  4XQ8 A;  4YP3 A;  3TI0 A;  2LYH A;  5DQH A;  4RQ3 A;  5EWE A;  5D46 A;  4RT2 A;  3MGH A;  4DOC A;  4EEY A;  4HYK A;  1TK0 A;  1D8Y A;  4GXI A;  1UT5 A;  7ICO A;  5IIM A;  2AQ0 A;  1BPD A;  4BXO B;  3MGI A;  5DBC A;  4JUZ A;  4I2C A;  2HHW A;  4J9N A;  9ICR A;  1NJX A;  3BJY A;  3TAP A;  4UAZ A;  4QZH A;  2W8K A;  1ZQX A;  1ZQC A;  4DSK A;  4J9P A;  1COO A;  2R8K A;  3GIL A;  3PML A;  3RR8 A;  8ICA A;  4IRD A;  3MR6 A;  2ASD A;  3C5F A;  3TAN A;  5KT6 A;  1ZQU A;  3GQC A;  4MFA A;  4O3O A;  5J2H A;  8ICK A;  5CB1 A;  3H4D A;  4RZR A;  5KFE A;  4C8M A;  1ZQL A;  9ICF A;  3Q8S B;  4J9Q A;  3TFS A;  1UT8 A;  5KT7 A;  4NLG A;  4QW8 A;  1XU4 A;  5DB7 A;  1SKR A;  5EWF A;  4J9O A;  2W9B A;  9ICX A;  5J2E A;  3V6H A;  3V7L A;  1L3S A;  2PFN A;  5F9L A;  1SKS A;  9ICH A;  1X2I A;  1XWL A;  1QTM A;  1QSL A;  5HHH A;  1IXR A;  5KFF A;  4KLD A;  7ICT A;  1ZQG A;  3PVX A;  3RJG A;  7ICS A;  5KG7 A;  4Z6D A;  3JPT A;  3FDS A;  1ZQP A;  4QW9 A;  8ICY A;  4YR3 A;  2HHX A;  4MFF A;  8ICI A;  4O5K A;  1U49 A;  4QZ8 A;  3ISD A;  4DSJ A;  4KN7 A;  5DG8 A;  1Z3E B;  1NK0 A;  4IRC A;  4P4M A;  3H8J A;  3EZ5 A;  4DS4 A;  3RB6 A;  5L9X A;  5KT2 A;  3BQ2 A;  4B9T A;  4FBU A;  3OGU A;  5KG2 A;  2RDI A;  2NRX A;  9ICV A;  3JPP A;  4EBE A;  4ECV A;  1KTQ A;  4LZG A;  3KHH A;  7ICG A;  5CHG A;  3GV5 B;  1TAU A;  5KFO A;  4UAY A;  4DL2 A;  8ICN A;  2F1I A;  5KG6 A;  4G3I A;  8ICH A;  4F4W A;  1T4G A;  3OHB A;  4XA5 A;  5J0U A;  3PX6 A;  2XCA A;  2FMS A;  3LWM A;  8ICV A;  2RDJ A;  7ICP A;  4RUC A;  1BPZ A;  5CA7 A;  4J9L A;  5KFA A;  5KG3 A;  2XY6 A;  3Q8P B;  3PNC A;  4J9S A;  4JK1 A;  1TV9 A;  3HP6 A;  4F2R A;  4YG2 A;  4UB5 A;  2BQ3 A;  3GIK A;  1L3V A;  8ICE A;  2R8G A;  4RQ0 A;  4RQ1 A;  3ZDB A;  4ECQ A;  3RB3 A;  5DBB A;  5L1L A;  4EYH B;  8ICW A;  4Z6E A;  3OHA A;  2XY5 A;  1T8E A;  5KFX A;  5J2K A;  1TVA A;  4B9S A;  4K4I A;  4M9G A;  2BGW A;  2ZJA A;  1D9F A;  2ZJ5 A;  3ISB A;  2UVV A;  3BQT A;  2R8J A;  3ORY A;  4P4O A;  4ED7 A;  4NY8 A;  4J9K A;  9ICO A;  1U45 A;  1JIH A;  4IQW A;  4DSE A;  1X9M A;  3V72 A;  4DL7 A;  3UQ2 A;  4DQP A;  4I28 A;  8ICB A;  2UVR A;  5KFW A;  4YR2 A;  4DQR A;  2NRV A;  4UAW A;  2ZTC A;  1ZYQ A;  1S0M A;  1DOQ A;  1L3U A;  2PFP A;  4O5C A;  1RYR A;  1B22 A;  3H8W A;  1D8L A;  4DFP A;  3UQ0 A;  4O3S A;  3PW2 A;  4PGX A;  3THV A;  4TUR A;  3LK9 A;  4YMO A;  9ICP A;  8ICF A;  3SV3 A;  2F1J A;  3RB4 A;  4IRK A;  4PHE A;  3RJH A;  1UA0 A;  4O3Q A;  3EPI A;  4RQ4 A;  4B9V A;  2W9B B;  2HHV A;  3C2M A;  3FYH A;  4YFK A;  1XSN A;  4EYI B;  5KFI A;  3SZ2 A;  3RJI A;  9ICK A;  4R8U A;  3EPG A;  1QSS A;  1X9W A;  3LDA A;  5BPC A;  8ICJ A;  2FPK A;  4ELV A;  2BQR A;  4DLE A;  3H7I A;  3M8S A;  1U48 A;  4UB3 A;  2FPM A;  4RQ8 A;  4ECW A;  4M0A A;  2ZJ8 A;  4QWD A;  3RJE A;  4MFC A;  9ICB A;  2HHU A;  4GXJ A;  3HW8 A;  3OJU A;  1NK5 A;  4ECT A;  5KFU A;  2XO7 A;  4RNM A;  4F93 B;  4B9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...