3N97B

Rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase sigma factor
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Thermus aquaticus
molecule tags Gene regulation/dna
total genus 21
structure length 75
sequence length 75
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3n97B00
1XC9A 3EWAA 1ZQKA 4KITB 3ZDDA 3PX4A 2C2EA 3RR8A 3MABA 3V6JA 3ISCA 5J2AA 1NJXA 2Y1JA 4RUCA 3M9NB 2BDPA 3FDSA 4RU9A 3N4MB 5EOZA 3QZ8A 2BHNA 1ZQMA 2J6SA 5CR0A 4NLGA 2H5XA 5CA7A 1S0OA 5KFGA 3K4GA 5KT2A 5DDMA 5L1JA 4K4IA 2KTQA 1BVSA 2UVUA 4FS2A 4C8LA 2KZMA 5J0SA 4LZDA 4RQ6A 3ISDA 1ZQQA 3T3FA 5IILA 1MQ3A 9ICQA 4MFFA 4Z6DA 3ZD8A 5J0TA 4RPYA 1DGSA 5BOLA 2A1JB 3M8SA 4EEYA 2BQUA 2W8LA 9ICJA 2HVHA 2FPLA 5EWGA 3RTVA 4F4KA 1KFDA 2BQRA 4GC7A 4YMNA 3GQCA 4QZIA 1L5UA 4KLOA 3OSPA 4DL6A 1K1QA 1MC8A 4YD2A 3E2EA 4RQ5A 2Y1IA 3LK9A 3AUOA 3N97B 4Z6FA 2PFNA 3T5KA 2BCQA 4M9GA 4ECSA 1SKWA 8ICXA 1BGXT 4NY8A 3H40A 4I29A 3EPIA 4PPXA 4DL3A 1COOA 5L1LA 4YR0A 3IHQB 2IA6A 1TK8A 1PZNA 4YCXA 5DB9A 4RZRA 1SKRA 4PGXA 4EBDA 4KLEA 2IHNA 4QZHA 3V6KA 5IIKA 3PW7A 3PX6A 4MF2A 1T7PA 4JWMA 7ICGA 4DOCA 2V9WA 2HHTA 1Z00A 1KRPA 1U45A 4IRDA 7ICLA 1C7YA 3C2MA 2ASDA 2BCSA 2KFNA 5JUMA 3PVXA 8ICBA 4UB4A 1KFSA 3T5JA 2W8KA 3JPTA 2P6RA 2HHQA 4MEYA 3JPPA 3HW8A 4GXIA 1UA0A 4NLKA 3OSNA 2BQ3A 4KLSA 1MQ2A 4QWDA 2ZJ5A 2HHSA 4DS5A 4G3IA 5KFKA 2GWSA 1U4BA 4DQIA 4EBCA 9ICPA 2FMQA 2W9MA 4QZ8A 2DPIA 4ECWA 8ICTA 2NRWA 5KFYA 5J2CA 3AU6A 5DG8A 3FYHA 2JEJA 2DPJA 3RH5A 4K4GA 1HUOA 1NK9A 3ORYA 4KLFA 2IBKA 5J2KA 3M9MB 4UQGA 3M9OB 3MGHA 3JPOA 3SV3A 4Q43A 5BOMA 1S0MA 5KFMA 5DQIA 2BPGA 4YD1A 4F93B 5DG9A 1SZPA 5CB1A 4R65A 4YMOA 5KFEA 4DOBA 2P66A 4CCHA 3HX0A 3UXPA 4UBCA 3RB6A 3MDAA 2IMWP 3RJEA 4B9VA 2HW3A 1XO1A 8ICZA 5KT4A 3MR2A 3V6HA 8ICKA 8ICEA 3JPRA 9ICTA 2AJQA 3Q8LA 2BCVA 9ICOA 4DEZA 4J9NA 5KG5A 4KN4A 1ZQTA 2F1JA 4UAWA 9ICWA 5D4BA 3PW5A 1RZTA 5CHGA 4TUQA 9ICFA 4P2HA 2KZZA 3RRHA 1XU4A 2A1JA 4NLZA 2R8HA 2ZTEA 4DWIA 2XY5A 4I2FA 1L3TA 3QZ7A 4NM2A 3T5LA 8ICGA 2XC9A 8ICVA 3NGDA 2R8JA 4F5PA 4ED7A 4BGDA 4O3RA 4MFCA 5CWRA 3OHAA 3PW4A 2AQ0A 4P4MA 5J2IA 2BCUA 9ICAA 2MUTA 1TFRA 1MSWD 8ICJA 1KFTA 1NOMA 1ZQFA 1QTMA 3V72A 1KEJA 2BGWA 7ICMA 3HP6A 5KFAA 1N56A 1BPBA 4R66A 4I2CA 1RXVA 1SL1A 5DLFA 3RAQA 3H4DA 1CEZA 4YFKA 4X5VA 5DB6A 2Q0ZX 3PY8A 7ICTA 1D8YA 2JEFA 3V7KA 4ELTA 5HMMA 1ZQXA 5KFJA 4RT3A 4B9TA 4F4ZA 4EBEA 2HHWA 5DQGA 4F50A 4UB5A 2R8IA 5IIOA 9ICEA 2PFOA 3AU2A 5IIMA 4QZEA 9ICHA 4UB2A 1U47A 4KLQA 5KTQA 4DSEA 4YR3A 5J0UA 3Q8PB 4XQ8A 2P6UA 1ZQIA 3RR7A 3KTQA 1BPDA 3TFSA 2FMSA 3V7LA 4ECQA 8ICOA 3THVA 3C21A 2ISPA 4PGQA 1NK5A 8ICAA 4UBBA 4I27A 4RPXA 4RNNA 3PMNA 1QSSA 1BPYA 1B22A 4YQWA 4R8UA 3QEAZ 1T4GA 5KFOA 2ZUCA 3PW0A 5J0RA 4EYHB 2XGQA 3M8RA 1XSPA 1NK0A 2FPMA 4O3PA 3KHRA 3Q8RB 4KLJA 1NK8A 5KT3A 2ASJA 4QW9A 1JXEA 1ZQWA 3ZDEA 4GC6A 2RDIA 5DDYA 2MAXA 5C5JA 3JPQA 4ED2A 1ZQPA 2VA2A 3RB4A 4I2EA 8ICMA 3GV7B 9ICCA 5KFWA 4M6WB 3EYZA 3K75D 1TVAA 9ICLA 5KFFA 4ED3A 4ECZA 4DFKA 3TFRA 1UA1A 5EWFA 4FO6A 1HUZA 3MGIA 1RYSA 4F4XA 3UXNA 2C2DA 1LB2B 4PGYA 3PNCA 2M9NA 1ZQVA 5J0XA 4QWEA 4ECVA 2JZBB 1ZQCA 4RT2A 1U49A 4DFMA 1ZQOA 5DB7A 3RH4A 1ZQEA 4F4YA 5J2EA 2ZTCA 4LZGA 4F3OA 4IQWA 4JWNA 2HHVA 4B9NA 4B9UA 5KG7A 9ICGA 3SYZA 2PXIA 1HJPA 3ZDBA 5L9XA 4GXKA 3GIKA 4O3OA 8ICYA 2XY7A 4KLIA 1TK5A 1ZQRA 2LYHA 5EWEA 4DSKA 1SKSA 3C23A 8ICQA 4PHDA 3JPNA 5J2HA 4BDPA 1XWLA 4F91B 3RJIA 3Q8MA 1JX4A 1ZQAA 5KFDA 5BPCA 3ZDCA 4F5NA 4DL7A 4DOAA 2FLNA 3GIJA 2RDJA 4KLHA 3H7IA 1EXNA 2DFLA 2KN7A 9ICRA 5KG3A 2AQ4A 3LWLA 4DL4A 3C2LA 4M9LA 4IRKA 3RBDA 5J0OA 1BPEA 4QWAA 2AGQA 4PH5A 1BPXA 1D8LA 2I9GA 4M9JA 7ICSA 3OJSA 4F8RA 3H8SA 3PX0A 4GXJA 1ZQNA 4J9PA 4M2YA 1K1SA 3PO4A 5J2GA 3Q8SB 5IINA 2BPCA 4F92B 1ZQBA 1QSLA 7ICRA 5J29A 5KG6A 4J9RA 1WCLA 4PHPA 4DLGA 5KG2A 3PV8A 1A76A 2PI5A 2B21A 1B43A 9ICSA 1JIHA 5J0QA 3KHGA 1H38A 3SV4A 4ECYA 4J9KA 1N48A 8ICIA 1TV9A 4YP3A 3RBEA 5DBCA 4YXJA 4XRHA 4B9SA 4ZH4A 4XA5A 5IIJA 5DLGA 3RJHA 1NJZA 3MFIA 3SI8A 4Q44A 1TKDA 4C8KA 4M04A 8ICRA 4DSIA 2WTFA 9ICKA 1RPLA 5KFHA 3C5FA 3JPSA 3GDXA 4HYKA 3RB0A 2R8GA 4QZFA 4YVZA 1SL0A 3RJFA 4K4HA 2NRVA 7ICQA 4ED1A 1ZQZA 3G6VA 1A77A 3TAQA 2I1QA 5KFCA 5KT7A 3BJYA 5KFPA 2ZJ8A 4PHAA 1NK6A 1TAUA 7ICVA 4M6WA 1L3SA 4DQQA 4IQVA 3MR5A 2FLLA 7ICJA 4C8MA 1QSYA 4I2BA 4TQRA 3EW9A 1NKBA 3HT3A 5KFUA 2W9CB 4NM1A 2JZBA 4YN4A 1TAQA 3MR6A 1ZQDA 1U48A 4C8OA 5L1KA 3ZD9A 1RYRA 2ISOA 5DGAA 3B0YA 1Z00B 1JN3A 4IR9A 3ETLA 4IQTA 2V4RA 3G6YA 5DBBA 4F2RA 7ICFA 9ICVA 1Y88A 5DGBA 4M0AA 5KG0A 4FS1A 5D46A 3HPOA 2W9BB 4RQ4A 1S10A 4Q8FA 2FMPA 4P4PA 2KFZA 1WCNA 4QZCA 4I2IA 1X9SA 4Q45A 1BPZA 1IM4A 1JMSA 3B0XA 4IR1A 4FBTA 4DL5A 3RH6A 1ZQSA 4MFAA 2ASLA 4I2JA 3IM1A 4E0DA 4DQRA 3PR4A 3H4BA 1ZJMA 4JV2A 2VANA 1ZQGA 1S9FA 4O5EA 5KFXA 2OWOA 2JEIA 3KHHA 2J6UA 5KFNA 2J6TA 3RJJA 1L3VA 4RUAA 1TK0A 3G6XA 4B9LA 3RAXA 4M9HA 9ICNA 4ELVA 4KLGA 5HMLA 5DB8A 4GLXA 5D49A 5KFSA 2ALZA 7ICPA 5CP2A 3PO5A 3EPGA 3MBYA 4DSFA 3BQ1A 4F5QA 3BQTA 9ICUA 4IRCA 4F2SA 4QWCA 5KFBA 5KFRA 4QZAA 3GIMA 3RRGA 5DBAA 4DSLA 9ICBA 4ECRA 4YXMA 3H8WA 1ZQJA 2F1IA 3TQ1A 2PI4A 3RJGA 8ICCA 8ICPA 4ED6A 4TUPA 4UAYA 3C2KA 3UQ2A 1KSPA 4JUZA 4I2HA 3GFKB 3H8JA 3MR3A 3RB3A 2FLPA 8ICSA 4DFPA 2AU0A 1ZQUA 4Q8EA 4DSJA 4PHEA 3UQ0A 4O3SA 7ICHA 4EZ9A 1ZETA 4ELUA 9ICIA 5KT6A 4M9NA 2NRXA 4RQ1A 1QLNA 4KLLA 2AGPA 4KN7A 8ICFA 4JK1A 3GIIA 1KLNA 3BQ0A 3GILA 4BWJA 2R8KA 2MUTB 4O3QA 4R63A 4I2AA 1SL2A 4ED0A 5J2BA 5J2DA 5L1IA 2VA8A 3SZ2A 1NK4A 1KTQA 5HHIA 2W9AA 2JEGA 2KZ3A 2W9CA 1NKEA 3BDPA 4BXOB 4NLNA 5TZVA 3PMLA 7ICEA 4O5KA 4DF4A 5J0PA 3T5HA 2HHXA 3OGUA 4EYIB 1DOQA 1NJYA 5F9NA 4J9OA 3EZ5A 3C5GA 7ICIA 2ZTDA 3LDAA 4KLMA 2ZUBA 4DL2A 1JXLA 5J2FA 5KFQA 4J9MA 3C1YA 4RQ0A 4ED8A 2W9BA 4KMUA 9ICMA 3ISBA 2UVWA 2IHMA 5KG1A 1V9PA 7ICUA 1ZQYA 5KFLA 1XS9D 4EZ6A 4O5CA 3BQ2A 5KFTA 1S76D 1UT8A 1T8EA 4I2DA 4BWMA 4DFJA 3TARA 4QZBA 5DQHA 4ECXA 1LV5A 4DQPA 4DLEA 1NK7A 4QZDA 8ICNA 2BR0A 4I2GA 4B9MA 4RQ7A 4UB3A 3ZDAA 1KDHA 4YMMA 3UXOA 4I28A 1CUKA 4P4OA 5IIIA 5KG4A 4O0IA 4R8UB 4RNOA 5HP4A 4KLUA 2XCAA 1S77D 1IXRA 3TI0A 1NKCA 4DS4A 5HHHA 2XCPA 1X9MA 5F9LA 4RPZA 3OJUA 2C2RA 2C28A 3PW2A 2HHUA 4TUSA 5DKWA 5KFZA 4MF8A 4YG2A 4KLDA 1S0NA 2V4QA 1D9FA 4YR2A 3UPQA 4QZGA 3C1ZA 3Q8QB 4RNMA 7ICKA 2UVRA 4ECUA 1Z3EB 4TURA 2BKEA 4J9LA 2PFQA 4O9MA 1L3UA 1T3NA 5J2JA 3KHLA 2XO7A 3MDCA 3Q8KA 4O3NA 2VA3A 8ICLA 3OHBA 1X9WA 5DG7A 1ZQHA 4JV1A 7ICOA 8ICUA 1X2IA 4R64A 2UVVA 1UT5A 2ZUDA 1XSLA 2FPKA 5HNKA 4F5OA 8ICHA 4XUSA 1AROP 2ZJAA 9ICXA 4TQSA 4Z6EA 2BCRA 2F1HA 2AGOA 4C8NA 3QE9Y 1S0VA 3GV8B 2NRTA 5KFVA 2XGPA 4J9SA 4DF8A 1NJWA 4QZ9A 3NTUA 4MEXA 4UB1A 2ATLA 4Z6CA 3V7JA 2HVIA 5KT5A 4ECTA 4JV0A 1RXWA 4KTQA 4M47A 3TAPA 4IQUA 4RQ3A 3PR5B 3GV5B 2C22A 3TANA 4J9QA 1ZQLA 5J0WA 1D9DA 1U9LA 5J0YA 4F4WA 4DQSA 4NXZA 3LWMA 4LVSA 7ICNA 5CJ7A 1S97A 4UAZA 1XSNA 3RJKA 3QEBZ 4BXOA 3MFHA 4DO9A 2BPFA 1ZJNA 4KLTA 4QW8A 4QWBA 1ZYQA 4FBUA 4RQ2A 4F5RA 2XY6A 5KFIA 2PFPA 8ICWA 4RQ8A 3HWTA 2NRZA
chains in the Genus database with same CATH superfamily
4BX9C 2ZG6A 2ZXIA 3MABA 2D3DA 1JALA 3M9NB 2BDPA 4RU9A 2J6SA 1JRPA 3KBBA 3QZ8A 4NLGA 2H5XA 5CA7A 1S0OA 5L1JA 5TISU 5IILA 3IV6A 4UATA 5J0TA 3ZD8A 2WB1F 3QUCA 5BOLA 3M8SA 4EEYA 2FPLA 3F2CA 1KFDA 2BQRA 5AI0A 3OSPA 2KVSA 2LYAA 4RQ5A 3J81j 1RDFA 4Z6FA 2G08A 2BCQA 3B9JA 4M9GA 1GO3F 1SKWA 1BGXT 4PPXA 4FZLA 1COOA 3TADC 3IHQB 1PZNA 5DB9A 1SKRA 4PGXA 3SQIA 2JMGA 1VLBA 1T7PA 2V9WA 4IRDA 1URJA 1J97A 3C2MA 3PVXA 3T5JA 2W8KA 4P0PA 2P6RA 1UA0A 4QWDA 3WKCA 4G3IA 9ICPA 1SWVA 2W9MA 8ICTA 3IP4B 4UB6U 5KFYA 3AU6A 2DPJA 4K4GA 3ORYA 2L5YA 2WF7A 4Q43A 5BOMA 1PK1A 2LBOA 5DG9A 1UCVA 1DK3A 5ALZA 2P66A 3RB6A 2HW3A 3MDAA 2IMWP 8ICKA 1O03A 1CI4A 2BCVA 3SENA 3BZCA 3PW5A 2KZZA 3LVVA 3TACB 2ZTEA 2NYVA 4I2FA 3T5LA 3WK6A 2WFAA 2R8JA 4F5PA 4BGDA 5CWRA 3PW4A 9ICAA 2MUTA 1Q8KA 1NOMA 1PVQA 1N56A 4I2CA 1OUQA 4CF3A 1D8YA 3V7KA 2A19A 3NVZA 4B9TA 4EBEA 4UB5A 5IIOA 2PFOA 2WF5A 3VCBA 5KTQA 4DSEA 1Z4NA 5J0UA 4EX6A 3KTQA 5AM5A 5KAIU 4ECQA 3THVA 1OW5A 2G0AA 4PGQA 1NK5A 4I27A 2BDUA 1B22A 1NI3A 5J0RA 4EYHB 2KICA 1NK0A 4O3PA 2XIDA 3I1YA 5KT3A 1DRGA 2A3VA 3ZDEA 3CYMA 5DDYA 2MAXA 5C5JA 9ICCA 2KJ8A 3SEIA 5KFFA 2ODGA 3MC1A 4DFKA 2KG5A 5EWFA 1HUZA 2LI6A 1YZ7A 4F4XA 3UXNA 1RYSA 1LB2B 5K4LA 3PNCA 3DDHA 4RT2A 1ZQEA 2ZTCA 2G5HB 5B66U 2B6GA 1AQ6A 5KG7A 1HJPA 3WK4A 2H3FA 5L9XA 3LYSA 2YY6A 1ZQRA 2LYHA 4BDPA 1A6SA 5ALYA 1JX4A 5KFDA 3ZDCA 4DL7A 4DOAA 3GIJA 2RDJA 3T79A 4KLHA 1EXNA 1ZD4A 5KG3A 2H3IA 5J0OA 3KKAA 3OJSA 4F8RA 3PX0A 1ZQNA 3SR6A 2IOFA 2K4PA 4US8A 7ICRA 2YN4A 5KG6A 4J9RA 3NVYA 5KG2A 1A76A 2GLEA 4UASA 2QARB 1JIHA 5J0QA 2XICA 3SV4A 4ECYA 1TV9A 4CF5A 3RBEA 1SZHA 5DBCA 4YXJA 4B9SA 4ZH4A 9ICKA 3AM9A 3IG5A 2W7PA 1RPLA 2R8GA 4YVZA 1SL0A 1QQ7A 4OJPA 3WK8A 5KFCA 1NK6A 4PHAA 4M6WA 5ALDA 4C8MA 4I2BA 2DBYA 5ALNA 4EEKA 1NKBA 1KW4A 2W9CB 2R18A 1ZQDA 4C8OA 2ISOA 1Z4OA 1X66A 3G6YA 4F2RA 5AICA 3QU4A 5DGBA 1JUDA 5D46A 4Q8FA 2OEHA 2FMPA 4OJOA 2I5HA 1WCNA 2JH1A 4Q45A 1IM4A 1JMSA 5ALJA 1S9FA 3KHHA 2YQEA 2FI1A 5AKKA 3RJJA 4MHVA 4RUAA 3G6XA 1MN8A 1NZBA 2OXOA 3QUBA 4KLGA 4GLXA 5AI4A 2ALZA 5ALFA 3PO5A 2LKYA 3BQ1A 4F5QA 3U26A 2RP5A 5KFRA 2RQ5A 2OCEA 1SB3C 4ECRA 1RQNA 3H8WA 2PI4A 3N7SC 3UQ2A 2W11A 1KSPA 4JUZA 4I2HA 3H8JA 3MR3A 2FLPA 4DSJA 4O3SA 2KHVA 1BNOA 2KK0A 5KT6A 1ECWA 3UMCA 4CRXA 4JK1A 2G5IB 3SAFA 1SL2A 3SZ2A 2I6XA 2W3RA 5HHIA 2W9AA 3BDPA 1LVHA 3AQFA 4DF4A 3T5HA 2OHFA 2JXJA 1NJYA 3F5AA 2LM1A 2ZUBA 3C1YA 4RQ0A 4Y2QA 2E8NA 5AI9A 2UVWA 5AHXA 1S76D 4DFJA 4QZBA 4ECXA 4DLEA 1NK7A 8ICNA 4B9MA 1B0XA 4UB3A 4EELA 1KDHA 4YMMA 3KFUF 1Q3VA 5AM0A 1IXRA 2ZXHA 4NLCA 4DS4A 3OJUA 2HHUA 2AH5A 1S0NA 4P0QA 2V4QA 3Q8QB 2UVRA 4ECUA 2VIXA 2XO7A 3GZFA 3Q8KA 2BZFA 2FPKA 4XUSA 4Z6EA 2F1HA 5KFVA 1NJWA 2HVIA 4Y2TA 1RXWA 4M47A 4IQUA 3PR5B 4J9QA 2DUYA 1ZQLA 1D9DA 5J0YA 4F4WA 4LVSA 4DQSA 1N61A 4BXOA 2LYBA 2KKVA 4DO9A 4C4TA 4FBUA 1ZD3A 2YMMA 3EWAA 3I76A 1ZQKA 5E79U 2C2EA 1DXSA 3RR8A 2H3QA 3ISCA 3FDSA 1ZQMA 2BHNA 3HJEA 5DDMA 4FS2A 4C7ZA 3LVWA 2KZMA 5J0SA 3ISDA 1ZQQA 5C0YA 3T3FA 1MQ3A 9ICQA 4FFDA 4MFFA 2WAQC 5CEHA 3IRUA 2BQUA 2W8LA 2HVHA 3RTVA 2H3VA 3GQCA 1DGJA 1RYUA 2K8AA 4YD2A 2Y1IA 1N5WA 5ALUA 2F76X 1UQVA 3EPIA 3WK5A 5L1LA 1J2NA 2IA6A 1TK8A 2E8MA 4YCXA 4EBDA 4KLEA 2IHNA 3V6KA 3PX6A 5IIKA 4MF2A 3KD3A 7ICGA 4DOCA 3HILA 2KHQA 4OD0A 1KFSA 3JPTA 3JPPA 3QNMA 1KQQA 1CRXA 3OSNA 1MQ2A 3A0BU 2QLTA 1N60A 4DQIA 2K4HA 4ECWA 5J2CA 5DG8A 3FYHA 1HIWA 1NK9A 4KLFA 2B0CA 3WKDA 4YD1A 1F5SA 4F93B 4OCZA 5AKHA 3PSPA 4R65A 4CCHA 8ICZA 3AN1A 4Y2SA 3RJEA 4B9VA 1XO1A 8ICEA 2Z7JA 9ICTA 4KN4A 2N1RA 1C20A 4EX7A 4TUQA 2WAQF 3RRHA 3PSFA 4NL9C 2MA1A 5ALSA 1KKXA 5AM3A 3NVVA 2DF4B 4IC9A 8ICGA 3DV9A 4ED7A 4O3RA 5AKZA 1K5OA 3M7DA 4P4MA 5J2IA 2BCUA 1TFRA 1MSWD 8ICJA 1RG6A 2DKZA 2HOIA 1N5XA 3V72A 3N7PD 1UHUA 5KFAA 3AEVA 5DLFA 5DB6A 5KFJA 4JMUA 1JI7A 3AU2A 5IIMA 2K60A 2ZIWB 4XQ8A 1BPDA 1IV8A 2EAPA 8ICOA 2ISPA 2NV3A 3AL0B 8ICAA 3H0MB 4RNNA 3PMNA 5JTIA 1T4GA 5KFOA 2XGQA 3M8RA 2FPMA 4KLJA 1XNSA 1NK8A 2ASJA 5ALVA 2VJ4A 5AM4A 3JPQA 4I2EA 8ICMA 3GV7B 3K75D 3KZIU 4ECZA 4ED3A 5ALIA 2G06A 1UA1A 4C7YA 2NO4A 4DFDA 4FO6A 1UPHA 4PGYA 1N62A 2M9NA 5J0XA 2JZBB 1ZQOA 4DFMA 4F3OA 2ZIUB 4FE3A 2PXIA 5AI5A 3GIKA 8ICYA 4OJ6A 1TK5A 5ALRA 4DSKA 1SKSA 3PZPA 4BJQA 4PHDA 2HBKA 4OJ5A 1ZQAA 5BPCA 3H0RB 1L7MA 2AQ4A 2H3ZA 4U7CA 4DL4A 4C80A 1VJ5A 2AGQA 4M9JA 3K1ZA 7ICSA 2DL0A 1SXDA 3H8SA 2WHEA 4GXJA 4J9PA 2F77X 5IINA 2E8OA 1ZQBA 2KD1A 4PHPA 1JROA 4J03A 8ICIA 3M1YA 1N48A 2HSZA 2EANA 3MFIA 4HYKA 3C5FA 3RB0A 4K4HA 1KBUA 3G6VA 1A77A 2FJ6A 2W3SA 3BJYA 2ZJ8A 1FFUA 4UAUA 4IL6U 5GTHU 4TQRA 3NRZA 4NM1A 2RHFA 1TAQA 1U48A 5L1KA 3ZD9A 1RYRA 5ALWA 4IR9A 4IQTA 1BNPA 9ICVA 2EDUA 4FS1A 2W9BB 4RQ4A 4P0PB 2E1FA 2CXYA 4P4PA 2KFZA 4QZCA 1SIJA 1Z19A 3B0XA 4IR1A 4FBTA 3RH6A 1ZQSA 3IM1A 2OH2A 1ZQGA 5KFXA 2OWOA 2Y0SC 2JEIA 5KFNA 1L3VA 2YMQA 1TK0A 1SV0C 3RAXA 9ICNA 4ELVA 5ALOA 5DB8A 4PJ0U 5D49A 5KFSA 5CP2A 3QX7A 1PK1B 4ZOHC 4DSFA 2NO5A 9ICUA 5G5GA 5KFBA 3RRGA 5DBAA 9ICBA 2KP7A 5AKYA 8ICPA 3C2KA 2KJ5A 2IOHA 5AI6A 2HDOA 3L5KA 3GFKB 1ZQUA 4ELUA 9ICIA 4M9NA 2W54A 2EAOA 2AGPA 4BWJA 2MUTB 4R63A 3QU2A 5JRTA 2VA8A 5AIBA 3GU3A 5L1IA 4FZNA 2PKEA 1KTQA 1NKEA 2W9CA 2K89A 4NLNA 5TZVA 3PMLA 7ICEA 4O5KA 5J0PA 1DOQA 5F9NA 4J9OA 4J9MA 5KFQA 2K8CB 4KMUA 9ICMA 3ISBA 4KMOB 2O6KA 5KG1A 7ICUA 1XS9D 4EZ6A 1T8EA 2D8CA 4DQPA 4QZDA 5HR6A 4RQ7A 2Y0SF 3ALRA 5F3XB 1CUKA 5G5HA 3NVWA 1ZD5A 2XCAA 1S77D 3F5EA 1NKCA 1X9MA 2C28A 1ZRMA 3PW2A 4MF8A 3BS5A 4RNMA 5AKXA 1Z3EB 2ESEA 2BKEA 4O9MA 1L3UA 2MU2A 3OTQA 5DG7A 2UVVA 1UT5A 4QJFB 4QNLA 2HBJA 3N28A 4DCCA 2ZJAA 3ONNA 2JR5A 5ALLA 2YMPA 3H8MA 3NTUA 4C4SA 4Z6CA 4KTQA 3TANA 2CPRA 4NXZA 4UARA 2LMRA 2KJ9A 1S97A 1XSNA 3QXGA 2F8LA 1ZJNA 3UMGA 1ZYQA 1KL9A 4F5RA 2EZXA 2PFPA 8ICWA 3HWTA 2NRZA 1XC9A 4KITB 3V6JA 5J2AA 1DK2A 1NJXA 2Y1JA 5ALXA 4KX3A 3K4GA 1BVSA 2UVUA 4OJLA 4C8LA 4RQ6A 4Z6DA 2HOFA 2A1JB 9ICJA 5EWGA 4F4KA 1L6NA 4QZIA 1L5UA 4KLOA 2WF6A 3F2DA 4PZNA 3LK9A 3AUOA 5AKJA 2PFNA 3T5KA 4ECSA 5CRXA 3NRWA 4NY8A 2Q4TA 5GTIU 4YR0A 5ALQA 1TAMA 4JWMA 1Z00A 1KRPA 7ICLA 1C7YA 2ASDA 2KFNA 5JUMA 4UB4A 2ZIVA 2HHQA 3HW8A 4KLSA 2ZJ5A 4DS5A 2GWSA 1U4BA 2FMQA 4C0ZA 1QCKA 3M9OB 3SV3A 1PK3A 5KFMA 1SZPA 2G07A 4YMOA 5KFEA 2W55A 3HX0A 3UXPA 5KL8B 4UBCA 2KVCA 3R9KA 5ALEA 3V6HA 3QU9A 2AJQA 3Q8LA 9ICOA 4DEZA 4UAWA 3C29A 9ICWA 2W7OA 5D4BA 1RZTA 5CHGA 9ICFA 4P2HA 1X6IA 3BQ7A 1XU4A 4NLZA 1FEZA 1LKYA 2KEYA 1B4FA 4NLBA 2W43A 3NGDA 4MFCA 3OHAA 2E8PA 3KKAC 4UAVA 2AQ0A 5KNIA 3D6JA 3FM9A 1ZQFA 1QTMA 7ICMA 3HP6A 1BPBA 4R66A 2IOFK 1RXVA 1Q46A 1CEZA 4X5VA 3PY8A 7ICTA 4EENA 2JEFA 5HMMA 1ZQXA 2DKXA 3WK9A 2HI0A 4F50A 5ALMA 2GH1A 3TADA 9ICHA 2JGAA 5J8YA 3Q8PB 2A1AA 1L8OA 4UBBA 4RPXA 2WF9A 1SWWA 1BPYA 4YQWA 4R8UA 3QEAZ 2ZUCA 3PW0A 3SAHA 2Y9UA 3Q8RB 3KHRA 4G9BA 4QW9A 4GC6A 2RDIA 4AYBC 2GO7A 3CRXA 4JB3A 4ED2A 1ZQPA 9ICLA 3TFRA 2C2DA 1ZQVA 4ECVA 5DB7A 3RH4A 4F4YA 4Y2PA 3QUTA 4IQWA 4B9NA 9ICGA 3ZDBA 4GXKA 3OPXA 2XY7A 4KLIA 1V38A 2ZIXB 8ICQA 3JPNA 1L7NA 5J2HA 1XWLA 1S5LU 4F5NA 2F3NA 3H7IA 9ICRA 3M6KA 3NUQA 4U6PA 3LWLA 3C2LA 4IRKA 2I9GA 4QWAA 1BPEA 1BPXA 4PH5A 1D8LA 2F2AB 1Z1VA 5J2GA 3Q8SB 4F92B 1QSLA 5J29A 1WCLA 3M6ZA 3WK7A 2KSOB 3D2QA 9ICSA 4J9KA 1M6YA 4XRHA 5IIJA 1N2XA 3UMBA 4M04A 3SI8A 3F2BA 1TKDA 2AXTU 2WTFA 3RJFA 2K8BB 4ED1A 1ZQZA 2KIVA 4HAIA 4PL2A 4AYBF 3TKAA 3TAQA 1P7DA 2I1QA 5AK5A 5KT7A 1TAUA 7ICVA 1L3SA 4DQQA 1V97A 3MR5A 7ICJA 1QSYA 3EW9A 2FDRA 2JZBA 2JV3A 4YN4A 4BUGA 3MR6A 2ZIUA 3QYPA 3B0YA 1JN3A 5DBBA 1Y88A 1PVPA 5KG0A 3HRDD 3HPOA 1S10A 2K4IA 2OYYA 1BPZA 2QB0B 4DL5A 3SD7A 3PR4A 4JV2A 4O5EA 1WWVA 2J6TA 4RQMA 5HMLA 3EPGA 3MBYA 1XO0A 3VC8A 3BQTA 4IRCA 4Y2RA 4F2SA 4QWCA 4QZAA 3GIMA 2HMXA 4DSLA 2F1IA 3TQ1A 4B6JA 4TUPA 3ED5A 4QIWC 1HEKA 1YT3A 2DWQA 2KOBA 2HBMA 8ICSA 4DFPA 4Q8EA 4PHEA 7ICHA 2NRXA 4RQ1A 1QLNA 4KLLA 4KN7A 1ED1A 4NJ8A 2R8KA 4O3QA 4I2AA 4ED0A 5J2BA 1PUZA 5J2DA 1L7OA 1MA7A 2JEGA 2KZ3A 2KV2A 5AK6A 3WKBA 5J8YC 2FE9A 2HHXA 3OGUA 3EZ5A 3C5GA 7ICIA 2KKPA 2MRLA 5EE1A 3L3FX 4DL2A 1JXLA 1IIPA 2W9BA 1WWUA 2XI9A 2IHMA 5KFLA 4O5CA 4UB8U 3TARA 5AM1A 5DQHA 1LV5A 3ICXA 4I2GA 4C4RA 5AKEA 4P4OA 5IIIA 4RNOA 5T14A 4KLUA 4USAA 3QU7A 5HHHA 2XCPA 1SGGA 1RQLA 5DKWA 5KFZA 4YG2A 4KLDA 1D9FA 4YR2A 3UPQA 4QZGA 7ICKA 1ZXIA 4Y2VA 5ALGA 1QQ6A 4TURA 4J9LA 1T3NA 4UW9A 3MDCA 2ES6A 4O3NA 3E58A 5JU5A 2VA3A 4QIWF 4O3MA 4JV1A 1ZRNA 1N63A 1X2IA 7ICOA 1XSLA 2GOLA 4F5OA 1AROP 9ICXA 2YB1A 2BCRA 1YZ6A 3I28A 4C8NA 3QE9Y 1S0VA 3GV8B 4J9SA 3QU5A 4A8EA 4QZ9A 4MEXA 4UB1A 4ECTA 3TAPA 4RQ3A 2C22A 1U9LA 2KMDA 7ICNA 5AK4A 4UAZA 3KZXA 2F44A 3MFHA 2BPFA 4PZOA 4QW8A 3UM9A 3ZDDA 3PX4A 4RUCA 2EZYA 1Q3UA 3O0FA 3N4MB 5EOZA 5CR0A 1QQ5A 1TE2A 5KFGA 5L1MA 5KT2A 4K4IA 2KTQA 2QARA 4NV0A 4LZDA 2G09A 3BS7A 2YMLA 4RPYA 1DGSA 2QKQA 3WU2U 2EH9A 2YB4A 1PVRA 4GC7A 4YMNA 4DL6A 1K1QA 1MC8A 3E2EA 3N97B 4OO1J 8ICXA 3H40A 4I29A 4DL3A 4RZRA 4F72A 4QZHA 3PW7A 2LM4A 2HHTA 1WYGA 1U45A 2BCSA 8ICBA 1SXEA 4MEYA 4GXIA 4NLKA 4PL1A 3RFAA 2BQ3A 4ICAA 2HHSA 2KNJA 5KFKA 4EBCA 4QZ8A 2DPIA 2NRWA 2JEJA 3RH5A 3A0HU 1HUOA 2IBKA 5J2KA 3M9MB 4UQGA 3MGHA 3JPOA 1S0MA 1F44A 3WKAA 5DQIA 1S8OA 2BPGA 1V85A 5CB1A 2D6FC 4DOBA 4CNQA 5ALHA 2JHDA 5KT4A 3MR2A 3JPRA 2F8KA 4J9NA 5KG5A 1ZQTA 2F1JA 3ZI4A 2A1JA 2R8HA 4DWIA 2XY5A 1L3TA 4Y2JA 3QZ7A 4NM2A 3MGVA 2XC9A 8ICVA 4Y2XA 3CP8A 2LPEA 1T3QA 1SV4A 1KFTA 1KEJA 2BGWA 2W04A 1RM6C 1SL1A 3RAQA 3H4DA 4YFKA 4WJ3B 2Q0ZX 4ELTA 4RT3A 4F4ZA 2HHWA 5DQGA 2R8IA 9ICEA 2YTUA 4QZEA 4UB2A 1U47A 4KLQA 4YR3A 1WG8A 2LHTA 2P6UA 1ZQIA 3RR7A 3TFSA 2FMSA 2KE7A 3V7LA 3C21A 2JRZA 5H2FU 1QSSA 4Y2YA 3L4PA 1O08A 1XSPA 1D8BA 4KX5A 3BS5B 2CN1A 1JXEA 1ZQWA 1NNLA 3BZKA 3AMZA 2VA2A 3RB4A 5HR7A 5KFWA 4GFJA 4M6WB 3EYZA 1TVAA 4NWIA 1FIQA 3E0FA 5EE0A 3MGIA 4QWEA 4LJXA 1ZQCA 2PMZC 5AIAA 3KOOA 1U49A 5J2EA 4LZGA 4JWNA 3PSTA 5B5EU 2HHVA 2XVTA 4B9UA 5A0LA 1NZPA 3SYZA 5ALTA 3FC4A 2VJ5A 5AKIA 4O3OA 1COKA 5EWEA 3C23A 4NL9A 3RJIA 4F91B 3Q8MA 4CE6A 2FLNA 2Y9TA 2KN7A 2DFLA 2K4EA 2EZZA 4M9LA 1F0MA 5EE3A 3RBDA 3CW2C 2YX8A 4M2YA 1K1SA 3PO4A 1ZOLA 2BPCA 5ALPA 2EQYA 4DLGA 3EUB2 2RLTA 3C28A 3PV8A 1FFVA 5KAFU 2PI5A 1L7PA 1T94A 2B21A 1B43A 5AK3A 3KHGA 1H38A 3IN5A 4AP9A 4YP3A 1X9XA 5AKLA 1X40A 5AKGA 4XA5A 3HKZC 3SAGA 5DLGA 1Z1BA 1NJZA 3RJHA 4Q44A 4C8KA 8ICRA 5ALKA 4DSIA 5KFHA 3JPSA 3GDXA 2HOQA 4QZFA 2NRVA 7ICQA 3H0LB 2VKQA 5KFPA 4IS7A 4US9A 4IQVA 2FLLA 3HT3A 5KFUA 1ZD2P 3S6JA 2E5SA 2PMZF 2WF8A 2M0NA 5DGAA 3QUQA 1Z00B 3ETLA 2V4RA 2JH7A 7ICFA 4M0AA 5KL1B 3WKEA 2ZIVB 3IG8A 4Y2UA 1A0PA 4F71A 3N7RC 4I2IA 1X9SA 2ZIXA 4MFAA 2ASLA 4I2JA 4E0DA 4DQRA 1ZJMA 3H4BA 2VANA 2J6UA 3IDWA 4B9LA 4M9HA 3DEEA 2HCFA 1X6JA 7ICPA 1VDVA 3ETRA 2P35A 5AM2A 4P0QB 3NASA 2KSOA 4YXMA 1ZQJA 8ICCA 2E1EA 3RJGA 4ED6A 1L8LA 4UAYA 1ZQ1C 3RB3A 4CF4A 2AU0A 3UQ0A 3HKZF 4EZ9A 1LKYB 1ZETA 3PSIA 2KIWA 3K1RB 8ICFA 1X42A 3GIIA 1KLNA 2AHOB 3BQ0A 3GILA 2OM6A 2MSNA 5AI8A 1OXJA 5FP0A 1NK4A 3AQEA 4BXOB 4EYIB 4ACOA 5EE9A 2ZTDA 3LDAA 4KLMA 5J2FA 4CDGA 1WUDA 4ED8A 3D2NA 1V9PA 2ZIWA 1ZQYA 1KN5A 3NS1A 3BQ2A 5KFTA 1UT8A 4I2DA 4BWMA 2QB0A 2W03A 2DGZA 2BR0A 3D2SA 3ZDAA 4I28A 3UXOA 2QB1A 5KG4A 4O0IA 5HP4A 4R8UB 2WB1C 3TI0A 5F9LA 4RPZA 2C2RA 2HBLA 4TUSA 4RQNA 3F53A 4CGZA 3C1ZA 1SV0A 3FAHA 2PFQA 5J2JA 3KHLA 1FO4A 2RRDA 2CRXA 8ICLA 3OHBA 1J2MA 1X9WA 1ZQHA 8ICUA 4R64A 2ZUDA 5HNKA 8ICHA 3SMVA 4TQSA 2AGOA 2NRTA 2XGPA 4DF8A 2DQNB 2E3TA 3CNHA 2ATLA 3V7JA 5KT5A 4JV0A 3RF9A 3GV5B 2EAMA 1QH9A 5J0WA 3LWMA 5CJ7A 3RJKA 4GIBA 3QEBZ 4KLTA 4FZMA 4QWBA 1IG6A 4RQ2A 2XY6A 5KFIA 4RQ8A
chains in the Genus database with same CATH topology
1XC9A 3EWAA 1ZQKA 4KITB 3ZDDA 3PX4A 2C2EA 3RR8A 3MABA 3V6JA 3ISCA 5J2AA 1NJXA 2Y1JA 4RUCA 3M9NB 2BDPA 3FDSA 4RU9A 3N4MB 5EOZA 3QZ8A 2BHNA 1ZQMA 2J6SA 5CR0A 4NLGA 2H5XA 5CA7A 1S0OA 5KFGA 3K4GA 5KT2A 5DDMA 5L1JA 4K4IA 2KTQA 1BVSA 2UVUA 4FS2A 4C8LA 2KZMA 5J0SA 4LZDA 4RQ6A 3ISDA 1ZQQA 3T3FA 5IILA 1MQ3A 9ICQA 4MFFA 4Z6DA 3ZD8A 5J0TA 4RPYA 1DGSA 5BOLA 2A1JB 3M8SA 4EEYA 2BQUA 2W8LA 9ICJA 2HVHA 2FPLA 5EWGA 3RTVA 4F4KA 1KFDA 2BQRA 4GC7A 4YMNA 3GQCA 4QZIA 1L5UA 4KLOA 3OSPA 4DL6A 1K1QA 1MC8A 4YD2A 3E2EA 4RQ5A 2Y1IA 3LK9A 3AUOA 3N97B 4Z6FA 2PFNA 3T5KA 2BCQA 4M9GA 4ECSA 1SKWA 8ICXA 1BGXT 4NY8A 3H40A 4I29A 3EPIA 4PPXA 4DL3A 1COOA 5L1LA 4YR0A 3IHQB 2IA6A 1TK8A 1PZNA 4YCXA 5DB9A 4RZRA 1SKRA 4PGXA 4EBDA 4KLEA 2IHNA 4QZHA 3V6KA 5IIKA 3PW7A 3PX6A 4MF2A 1T7PA 4JWMA 7ICGA 4DOCA 2V9WA 2HHTA 1Z00A 1KRPA 1U45A 4IRDA 7ICLA 1C7YA 3C2MA 2ASDA 2BCSA 2KFNA 5JUMA 3PVXA 8ICBA 4UB4A 1KFSA 3T5JA 2W8KA 3JPTA 2P6RA 2HHQA 4MEYA 3JPPA 3HW8A 4GXIA 1UA0A 4NLKA 3OSNA 2BQ3A 4KLSA 1MQ2A 4QWDA 2ZJ5A 2HHSA 4DS5A 4G3IA 5KFKA 2GWSA 1U4BA 4DQIA 4EBCA 9ICPA 2FMQA 2W9MA 4QZ8A 2DPIA 4ECWA 8ICTA 2NRWA 5KFYA 5J2CA 3AU6A 5DG8A 3FYHA 2JEJA 2DPJA 3RH5A 4K4GA 1HUOA 1NK9A 3ORYA 4KLFA 2IBKA 5J2KA 3M9MB 4UQGA 3M9OB 3MGHA 3JPOA 3SV3A 4Q43A 5BOMA 1S0MA 5KFMA 5DQIA 2BPGA 4YD1A 4F93B 5DG9A 1SZPA 5CB1A 4R65A 4YMOA 5KFEA 4DOBA 2P66A 4CCHA 3HX0A 3UXPA 4UBCA 3RB6A 3MDAA 2IMWP 3RJEA 4B9VA 2HW3A 1XO1A 8ICZA 5KT4A 3MR2A 3V6HA 8ICKA 8ICEA 3JPRA 9ICTA 2AJQA 3Q8LA 2BCVA 9ICOA 4DEZA 4J9NA 5KG5A 4KN4A 1ZQTA 2F1JA 4UAWA 9ICWA 5D4BA 3PW5A 1RZTA 5CHGA 4TUQA 9ICFA 4P2HA 2KZZA 3RRHA 1XU4A 2A1JA 4NLZA 2R8HA 2ZTEA 4DWIA 2XY5A 4I2FA 1L3TA 3QZ7A 4NM2A 3T5LA 8ICGA 2XC9A 8ICVA 3NGDA 2R8JA 4F5PA 4ED7A 4BGDA 4O3RA 4MFCA 5CWRA 3OHAA 3PW4A 2AQ0A 4P4MA 5J2IA 2BCUA 9ICAA 2MUTA 1TFRA 1MSWD 8ICJA 1KFTA 1NOMA 1ZQFA 1QTMA 3V72A 1KEJA 2BGWA 7ICMA 3HP6A 5KFAA 1N56A 1BPBA 4R66A 4I2CA 1RXVA 1SL1A 5DLFA 3RAQA 3H4DA 1CEZA 4YFKA 4X5VA 5DB6A 2Q0ZX 3PY8A 7ICTA 1D8YA 2JEFA 3V7KA 4ELTA 5HMMA 1ZQXA 5KFJA 4RT3A 4B9TA 4F4ZA 4EBEA 2HHWA 5DQGA 4F50A 4UB5A 2R8IA 5IIOA 9ICEA 2PFOA 3AU2A 5IIMA 4QZEA 9ICHA 4UB2A 1U47A 4KLQA 5KTQA 4DSEA 4YR3A 5J0UA 3Q8PB 4XQ8A 2P6UA 1ZQIA 3RR7A 3KTQA 1BPDA 3TFSA 2FMSA 3V7LA 4ECQA 8ICOA 3THVA 3C21A 2ISPA 4PGQA 1NK5A 8ICAA 4UBBA 4I27A 4RPXA 4RNNA 3PMNA 1QSSA 1BPYA 1B22A 4YQWA 4R8UA 3QEAZ 1T4GA 5KFOA 2ZUCA 3PW0A 5J0RA 4EYHB 2XGQA 3M8RA 1XSPA 1NK0A 2FPMA 4O3PA 3KHRA 3Q8RB 4KLJA 1NK8A 5KT3A 2ASJA 4QW9A 1JXEA 1ZQWA 3ZDEA 4GC6A 2RDIA 5DDYA 2MAXA 5C5JA 3JPQA 4ED2A 1ZQPA 2VA2A 3RB4A 4I2EA 8ICMA 3GV7B 9ICCA 5KFWA 4M6WB 3EYZA 3K75D 1TVAA 9ICLA 5KFFA 4ED3A 4ECZA 4DFKA 3TFRA 1UA1A 5EWFA 4FO6A 1HUZA 3MGIA 1RYSA 4F4XA 3UXNA 2C2DA 1LB2B 4PGYA 3PNCA 2M9NA 1ZQVA 5J0XA 4QWEA 4ECVA 2JZBB 1ZQCA 4RT2A 1U49A 4DFMA 1ZQOA 5DB7A 3RH4A 1ZQEA 4F4YA 5J2EA 2ZTCA 4LZGA 4F3OA 4IQWA 4JWNA 2HHVA 4B9NA 4B9UA 5KG7A 9ICGA 3SYZA 2PXIA 1HJPA 3ZDBA 5L9XA 4GXKA 3GIKA 4O3OA 8ICYA 2XY7A 4KLIA 1TK5A 1ZQRA 2LYHA 5EWEA 4DSKA 1SKSA 3C23A 8ICQA 4PHDA 3JPNA 5J2HA 4BDPA 1XWLA 4F91B 3RJIA 3Q8MA 1JX4A 1ZQAA 5KFDA 5BPCA 3ZDCA 4F5NA 4DL7A 4DOAA 2FLNA 3GIJA 2RDJA 4KLHA 3H7IA 1EXNA 2DFLA 2KN7A 9ICRA 5KG3A 2AQ4A 3LWLA 4DL4A 3C2LA 4M9LA 4IRKA 3RBDA 5J0OA 1BPEA 4QWAA 2AGQA 4PH5A 1BPXA 1D8LA 2I9GA 4M9JA 7ICSA 3OJSA 4F8RA 3H8SA 3PX0A 4GXJA 1ZQNA 4J9PA 4M2YA 1K1SA 3PO4A 5J2GA 3Q8SB 5IINA 2BPCA 4F92B 1ZQBA 1QSLA 7ICRA 5J29A 5KG6A 4J9RA 1WCLA 4PHPA 4DLGA 5KG2A 3PV8A 1A76A 2PI5A 2B21A 1B43A 9ICSA 1JIHA 5J0QA 3KHGA 1H38A 3SV4A 4ECYA 4J9KA 1N48A 8ICIA 1TV9A 4YP3A 3RBEA 5DBCA 4YXJA 4XRHA 4B9SA 4ZH4A 4XA5A 5IIJA 5DLGA 3RJHA 1NJZA 3MFIA 3SI8A 4Q44A 1TKDA 4C8KA 4M04A 8ICRA 4DSIA 2WTFA 9ICKA 1RPLA 5KFHA 3C5FA 3JPSA 3GDXA 4HYKA 3RB0A 2R8GA 4QZFA 4YVZA 1SL0A 3RJFA 4K4HA 2NRVA 7ICQA 4ED1A 1ZQZA 3G6VA 1A77A 3TAQA 2I1QA 5KFCA 5KT7A 3BJYA 5KFPA 2ZJ8A 4PHAA 1NK6A 1TAUA 7ICVA 4M6WA 1L3SA 4DQQA 4IQVA 3MR5A 2FLLA 7ICJA 4C8MA 1QSYA 4I2BA 4TQRA 3EW9A 1NKBA 3HT3A 5KFUA 2W9CB 4NM1A 2JZBA 4YN4A 1TAQA 3MR6A 1ZQDA 1U48A 4C8OA 5L1KA 3ZD9A 1RYRA 2ISOA 5DGAA 3B0YA 1Z00B 1JN3A 4IR9A 3ETLA 4IQTA 2V4RA 3G6YA 5DBBA 4F2RA 7ICFA 9ICVA 1Y88A 5DGBA 4M0AA 5KG0A 4FS1A 5D46A 3HPOA 2W9BB 4RQ4A 1S10A 4Q8FA 2FMPA 4P4PA 2KFZA 1WCNA 4QZCA 4I2IA 1X9SA 4Q45A 1BPZA 1IM4A 1JMSA 3B0XA 4IR1A 4FBTA 4DL5A 3RH6A 1ZQSA 4MFAA 2ASLA 4I2JA 3IM1A 4E0DA 4DQRA 3PR4A 3H4BA 1ZJMA 4JV2A 2VANA 1ZQGA 1S9FA 4O5EA 5KFXA 2OWOA 2JEIA 3KHHA 2J6UA 5KFNA 2J6TA 3RJJA 1L3VA 4RUAA 1TK0A 3G6XA 4B9LA 3RAXA 4M9HA 9ICNA 4ELVA 4KLGA 5HMLA 5DB8A 4GLXA 5D49A 5KFSA 2ALZA 7ICPA 5CP2A 3PO5A 3EPGA 3MBYA 4DSFA 3BQ1A 4F5QA 3BQTA 9ICUA 4IRCA 4F2SA 4QWCA 5KFBA 5KFRA 4QZAA 3GIMA 3RRGA 5DBAA 4DSLA 9ICBA 4ECRA 4YXMA 3H8WA 1ZQJA 2F1IA 3TQ1A 2PI4A 3RJGA 8ICCA 8ICPA 4ED6A 4TUPA 4UAYA 3C2KA 3UQ2A 1KSPA 4JUZA 4I2HA 3GFKB 3H8JA 3MR3A 3RB3A 2FLPA 8ICSA 4DFPA 2AU0A 1ZQUA 4Q8EA 4DSJA 4PHEA 3UQ0A 4O3SA 7ICHA 4EZ9A 1ZETA 4ELUA 9ICIA 5KT6A 4M9NA 2NRXA 4RQ1A 1QLNA 4KLLA 2AGPA 4KN7A 8ICFA 4JK1A 3GIIA 1KLNA 3BQ0A 3GILA 4BWJA 2R8KA 2MUTB 4O3QA 4R63A 4I2AA 1SL2A 4ED0A 5J2BA 5J2DA 5L1IA 2VA8A 3SZ2A 1NK4A 1KTQA 5HHIA 2W9AA 2JEGA 2KZ3A 2W9CA 1NKEA 3BDPA 4BXOB 4NLNA 5TZVA 3PMLA 7ICEA 4O5KA 4DF4A 5J0PA 3T5HA 2HHXA 3OGUA 4EYIB 1DOQA 1NJYA 5F9NA 4J9OA 3EZ5A 3C5GA 7ICIA 2ZTDA 3LDAA 4KLMA 2ZUBA 4DL2A 1JXLA 5J2FA 5KFQA 4J9MA 3C1YA 4RQ0A 4ED8A 2W9BA 4KMUA 9ICMA 3ISBA 2UVWA 2IHMA 5KG1A 1V9PA 7ICUA 1ZQYA 5KFLA 1XS9D 4EZ6A 4O5CA 3BQ2A 5KFTA 1S76D 1UT8A 1T8EA 4I2DA 4BWMA 4DFJA 3TARA 4QZBA 5DQHA 4ECXA 1LV5A 4DQPA 4DLEA 1NK7A 4QZDA 8ICNA 2BR0A 4I2GA 4B9MA 4RQ7A 4UB3A 3ZDAA 1KDHA 4YMMA 3UXOA 4I28A 1CUKA 4P4OA 5IIIA 5KG4A 4O0IA 4R8UB 4RNOA 5HP4A 4KLUA 2XCAA 1S77D 1IXRA 3TI0A 1NKCA 4DS4A 5HHHA 2XCPA 1X9MA 5F9LA 4RPZA 3OJUA 2C2RA 2C28A 3PW2A 2HHUA 4TUSA 5DKWA 5KFZA 4MF8A 4YG2A 4KLDA 1S0NA 2V4QA 1D9FA 4YR2A 3UPQA 4QZGA 3C1ZA 3Q8QB 4RNMA 7ICKA 2UVRA 4ECUA 1Z3EB 4TURA 2BKEA 4J9LA 2PFQA 4O9MA 1L3UA 1T3NA 5J2JA 3KHLA 2XO7A 3MDCA 3Q8KA 4O3NA 2VA3A 8ICLA 3OHBA 1X9WA 5DG7A 1ZQHA 4JV1A 7ICOA 8ICUA 1X2IA 4R64A 2UVVA 1UT5A 2ZUDA 1XSLA 2FPKA 5HNKA 4F5OA 8ICHA 4XUSA 1AROP 2ZJAA 9ICXA 4TQSA 4Z6EA 2BCRA 2F1HA 2AGOA 4C8NA 3QE9Y 1S0VA 3GV8B 2NRTA 5KFVA 2XGPA 4J9SA 4DF8A 1NJWA 4QZ9A 3NTUA 4MEXA 4UB1A 2ATLA 4Z6CA 3V7JA 2HVIA 5KT5A 4ECTA 4JV0A 1RXWA 4KTQA 4M47A 3TAPA 4IQUA 4RQ3A 3PR5B 3GV5B 2C22A 3TANA 4J9QA 1ZQLA 5J0WA 1D9DA 1U9LA 5J0YA 4F4WA 4DQSA 4NXZA 3LWMA 4LVSA 7ICNA 5CJ7A 1S97A 4UAZA 1XSNA 3RJKA 3QEBZ 4BXOA 3MFHA 4DO9A 2BPFA 1ZJNA 4KLTA 4QW8A 4QWBA 1ZYQA 4FBUA 4RQ2A 4F5RA 2XY6A 5KFIA 2PFPA 8ICWA 4RQ8A 3HWTA 2NRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC9 A;  3EWA A;  1ZQK A;  4KIT B;  3ZDD A;  3PX4 A;  2C2E A;  3RR8 A;  3MAB A;  3V6J A;  3ISC A;  5J2A A;  1NJX A;  2Y1J A;  4RUC A;  3M9N B;  2BDP A;  3FDS A;  4RU9 A;  3N4M B;  5EOZ A;  3QZ8 A;  2BHN A;  1ZQM A;  2J6S A;  5CR0 A;  4NLG A;  2H5X A;  5CA7 A;  1S0O A;  5KFG A;  3K4G A;  5KT2 A;  5DDM A;  5L1J A;  4K4I A;  2KTQ A;  1BVS A;  2UVU A;  4FS2 A;  4C8L A;  2KZM A;  5J0S A;  4LZD A;  4RQ6 A;  3ISD A;  1ZQQ A;  3T3F A;  5IIL A;  1MQ3 A;  9ICQ A;  4MFF A;  4Z6D A;  3ZD8 A;  5J0T A;  4RPY A;  1DGS A;  5BOL A;  2A1J B;  3M8S A;  4EEY A;  2BQU A;  2W8L A;  9ICJ A;  2HVH A;  2FPL A;  5EWG A;  3RTV A;  4F4K A;  1KFD A;  2BQR A;  4GC7 A;  4YMN A;  3GQC A;  4QZI A;  1L5U A;  4KLO A;  3OSP A;  4DL6 A;  1K1Q A;  1MC8 A;  4YD2 A;  3E2E A;  4RQ5 A;  2Y1I A;  3LK9 A;  3AUO A;  3N97 B;  4Z6F A;  2PFN A;  3T5K A;  2BCQ A;  4M9G A;  4ECS A;  1SKW A;  8ICX A;  1BGX T;  4NY8 A;  3H40 A;  4I29 A;  3EPI A;  4PPX A;  4DL3 A;  1COO A;  5L1L A;  4YR0 A;  3IHQ B;  2IA6 A;  1TK8 A;  1PZN A;  4YCX A;  5DB9 A;  4RZR A;  1SKR A;  4PGX A;  4EBD A;  4KLE A;  2IHN A;  4QZH A;  3V6K A;  5IIK A;  3PW7 A;  3PX6 A;  4MF2 A;  1T7P A;  4JWM A;  7ICG A;  4DOC A;  2V9W A;  2HHT A;  1Z00 A;  1KRP A;  1U45 A;  4IRD A;  7ICL A;  1C7Y A;  3C2M A;  2ASD A;  2BCS A;  2KFN A;  5JUM A;  3PVX A;  8ICB A;  4UB4 A;  1KFS A;  3T5J A;  2W8K A;  3JPT A;  2P6R A;  2HHQ A;  4MEY A;  3JPP A;  3HW8 A;  4GXI A;  1UA0 A;  4NLK A;  3OSN A;  2BQ3 A;  4KLS A;  1MQ2 A;  4QWD A;  2ZJ5 A;  2HHS A;  4DS5 A;  4G3I A;  5KFK A;  2GWS A;  1U4B A;  4DQI A;  4EBC A;  9ICP A;  2FMQ A;  2W9M A;  4QZ8 A;  2DPI A;  4ECW A;  8ICT A;  2NRW A;  5KFY A;  5J2C A;  3AU6 A;  5DG8 A;  3FYH A;  2JEJ A;  2DPJ A;  3RH5 A;  4K4G A;  1HUO A;  1NK9 A;  3ORY A;  4KLF A;  2IBK A;  5J2K A;  3M9M B;  4UQG A;  3M9O B;  3MGH A;  3JPO A;  3SV3 A;  4Q43 A;  5BOM A;  1S0M A;  5KFM A;  5DQI A;  2BPG A;  4YD1 A;  4F93 B;  5DG9 A;  1SZP A;  5CB1 A;  4R65 A;  4YMO A;  5KFE A;  4DOB A;  2P66 A;  4CCH A;  3HX0 A;  3UXP A;  4UBC A;  3RB6 A;  3MDA A;  2IMW P;  3RJE A;  4B9V A;  2HW3 A;  1XO1 A;  8ICZ A;  5KT4 A;  3MR2 A;  3V6H A;  8ICK A;  8ICE A;  3JPR A;  9ICT A;  2AJQ A;  3Q8L A;  2BCV A;  9ICO A;  4DEZ A;  4J9N A;  5KG5 A;  4KN4 A;  1ZQT A;  2F1J A;  4UAW A;  9ICW A;  5D4B A;  3PW5 A;  1RZT A;  5CHG A;  4TUQ A;  9ICF A;  4P2H A;  2KZZ A;  3RRH A;  1XU4 A;  2A1J A;  4NLZ A;  2R8H A;  2ZTE A;  4DWI A;  2XY5 A;  4I2F A;  1L3T A;  3QZ7 A;  4NM2 A;  3T5L A;  8ICG A;  2XC9 A;  8ICV A;  3NGD A;  2R8J A;  4F5P A;  4ED7 A;  4BGD A;  4O3R A;  4MFC A;  5CWR A;  3OHA A;  3PW4 A;  2AQ0 A;  4P4M A;  5J2I A;  2BCU A;  9ICA A;  2MUT A;  1TFR A;  1MSW D;  8ICJ A;  1KFT A;  1NOM A;  1ZQF A;  1QTM A;  3V72 A;  1KEJ A;  2BGW A;  7ICM A;  3HP6 A;  5KFA A;  1N56 A;  1BPB A;  4R66 A;  4I2C A;  1RXV A;  1SL1 A;  5DLF A;  3RAQ A;  3H4D A;  1CEZ A;  4YFK A;  4X5V A;  5DB6 A;  2Q0Z X;  3PY8 A;  7ICT A;  1D8Y A;  2JEF A;  3V7K A;  4ELT A;  5HMM A;  1ZQX A;  5KFJ A;  4RT3 A;  4B9T A;  4F4Z A;  4EBE A;  2HHW A;  5DQG A;  4F50 A;  4UB5 A;  2R8I A;  5IIO A;  9ICE A;  2PFO A;  3AU2 A;  5IIM A;  4QZE A;  9ICH A;  4UB2 A;  1U47 A;  4KLQ A;  5KTQ A;  4DSE A;  4YR3 A;  5J0U A;  3Q8P B;  4XQ8 A;  2P6U A;  1ZQI A;  3RR7 A;  3KTQ A;  1BPD A;  3TFS A;  2FMS A;  3V7L A;  4ECQ A;  8ICO A;  3THV A;  3C21 A;  2ISP A;  4PGQ A;  1NK5 A;  8ICA A;  4UBB A;  4I27 A;  4RPX A;  4RNN A;  3PMN A;  1QSS A;  1BPY A;  1B22 A;  4YQW A;  4R8U A;  3QEA Z;  1T4G A;  5KFO A;  2ZUC A;  3PW0 A;  5J0R A;  4EYH B;  2XGQ A;  3M8R A;  1XSP A;  1NK0 A;  2FPM A;  4O3P A;  3KHR A;  3Q8R B;  4KLJ A;  1NK8 A;  5KT3 A;  2ASJ A;  4QW9 A;  1JXE A;  1ZQW A;  3ZDE A;  4GC6 A;  2RDI A;  5DDY A;  2MAX A;  5C5J A;  3JPQ A;  4ED2 A;  1ZQP A;  2VA2 A;  3RB4 A;  4I2E A;  8ICM A;  3GV7 B;  9ICC A;  5KFW A;  4M6W B;  3EYZ A;  3K75 D;  1TVA A;  9ICL A;  5KFF A;  4ED3 A;  4ECZ A;  4DFK A;  3TFR A;  1UA1 A;  5EWF A;  4FO6 A;  1HUZ A;  3MGI A;  1RYS A;  4F4X A;  3UXN A;  2C2D A;  1LB2 B;  4PGY A;  3PNC A;  2M9N A;  1ZQV A;  5J0X A;  4QWE A;  4ECV A;  2JZB B;  1ZQC A;  4RT2 A;  1U49 A;  4DFM A;  1ZQO A;  5DB7 A;  3RH4 A;  1ZQE A;  4F4Y A;  5J2E A;  2ZTC A;  4LZG A;  4F3O A;  4IQW A;  4JWN A;  2HHV A;  4B9N A;  4B9U A;  5KG7 A;  9ICG A;  3SYZ A;  2PXI A;  1HJP A;  3ZDB A;  5L9X A;  4GXK A;  3GIK A;  4O3O A;  8ICY A;  2XY7 A;  4KLI A;  1TK5 A;  1ZQR A;  2LYH A;  5EWE A;  4DSK A;  1SKS A;  3C23 A;  8ICQ A;  4PHD A;  3JPN A;  5J2H A;  4BDP A;  1XWL A;  4F91 B;  3RJI A;  3Q8M A;  1JX4 A;  1ZQA A;  5KFD A;  5BPC A;  3ZDC A;  4F5N A;  4DL7 A;  4DOA A;  2FLN A;  3GIJ A;  2RDJ A;  4KLH A;  3H7I A;  1EXN A;  2DFL A;  2KN7 A;  9ICR A;  5KG3 A;  2AQ4 A;  3LWL A;  4DL4 A;  3C2L A;  4M9L A;  4IRK A;  3RBD A;  5J0O A;  1BPE A;  4QWA A;  2AGQ A;  4PH5 A;  1BPX A;  1D8L A;  2I9G A;  4M9J A;  7ICS A;  3OJS A;  4F8R A;  3H8S A;  3PX0 A;  4GXJ A;  1ZQN A;  4J9P A;  4M2Y A;  1K1S A;  3PO4 A;  5J2G A;  3Q8S B;  5IIN A;  2BPC A;  4F92 B;  1ZQB A;  1QSL A;  7ICR A;  5J29 A;  5KG6 A;  4J9R A;  1WCL A;  4PHP A;  4DLG A;  5KG2 A;  3PV8 A;  1A76 A;  2PI5 A;  2B21 A;  1B43 A;  9ICS A;  1JIH A;  5J0Q A;  3KHG A;  1H38 A;  3SV4 A;  4ECY A;  4J9K A;  1N48 A;  8ICI A;  1TV9 A;  4YP3 A;  3RBE A;  5DBC A;  4YXJ A;  4XRH A;  4B9S A;  4ZH4 A;  4XA5 A;  5IIJ A;  5DLG A;  3RJH A;  1NJZ A;  3MFI A;  3SI8 A;  4Q44 A;  1TKD A;  4C8K A;  4M04 A;  8ICR A;  4DSI A;  2WTF A;  9ICK A;  1RPL A;  5KFH A;  3C5F A;  3JPS A;  3GDX A;  4HYK A;  3RB0 A;  2R8G A;  4QZF A;  4YVZ A;  1SL0 A;  3RJF A;  4K4H A;  2NRV A;  7ICQ A;  4ED1 A;  1ZQZ A;  3G6V A;  1A77 A;  3TAQ A;  2I1Q A;  5KFC A;  5KT7 A;  3BJY A;  5KFP A;  2ZJ8 A;  4PHA A;  1NK6 A;  1TAU A;  7ICV A;  4M6W A;  1L3S A;  4DQQ A;  4IQV A;  3MR5 A;  2FLL A;  7ICJ A;  4C8M A;  1QSY A;  4I2B A;  4TQR A;  3EW9 A;  1NKB A;  3HT3 A;  5KFU A;  2W9C B;  4NM1 A;  2JZB A;  4YN4 A;  1TAQ A;  3MR6 A;  1ZQD A;  1U48 A;  4C8O A;  5L1K A;  3ZD9 A;  1RYR A;  2ISO A;  5DGA A;  3B0Y A;  1Z00 B;  1JN3 A;  4IR9 A;  3ETL A;  4IQT A;  2V4R A;  3G6Y A;  5DBB A;  4F2R A;  7ICF A;  9ICV A;  1Y88 A;  5DGB A;  4M0A A;  5KG0 A;  4FS1 A;  5D46 A;  3HPO A;  2W9B B;  4RQ4 A;  1S10 A;  4Q8F A;  2FMP A;  4P4P A;  2KFZ A;  1WCN A;  4QZC A;  4I2I A;  1X9S A;  4Q45 A;  1BPZ A;  1IM4 A;  1JMS A;  3B0X A;  4IR1 A;  4FBT A;  4DL5 A;  3RH6 A;  1ZQS A;  4MFA A;  2ASL A;  4I2J A;  3IM1 A;  4E0D A;  4DQR A;  3PR4 A;  3H4B A;  1ZJM A;  4JV2 A;  2VAN A;  1ZQG A;  1S9F A;  4O5E A;  5KFX A;  2OWO A;  2JEI A;  3KHH A;  2J6U A;  5KFN A;  2J6T A;  3RJJ A;  1L3V A;  4RUA A;  1TK0 A;  3G6X A;  4B9L A;  3RAX A;  4M9H A;  9ICN A;  4ELV A;  4KLG A;  5HML A;  5DB8 A;  4GLX A;  5D49 A;  5KFS A;  2ALZ A;  7ICP A;  5CP2 A;  3PO5 A;  3EPG A;  3MBY A;  4DSF A;  3BQ1 A;  4F5Q A;  3BQT A;  9ICU A;  4IRC A;  4F2S A;  4QWC A;  5KFB A;  5KFR A;  4QZA A;  3GIM A;  3RRG A;  5DBA A;  4DSL A;  9ICB A;  4ECR A;  4YXM A;  3H8W A;  1ZQJ A;  2F1I A;  3TQ1 A;  2PI4 A;  3RJG A;  8ICC A;  8ICP A;  4ED6 A;  4TUP A;  4UAY A;  3C2K A;  3UQ2 A;  1KSP A;  4JUZ A;  4I2H A;  3GFK B;  3H8J A;  3MR3 A;  3RB3 A;  2FLP A;  8ICS A;  4DFP A;  2AU0 A;  1ZQU A;  4Q8E A;  4DSJ A;  4PHE A;  3UQ0 A;  4O3S A;  7ICH A;  4EZ9 A;  1ZET A;  4ELU A;  9ICI A;  5KT6 A;  4M9N A;  2NRX A;  4RQ1 A;  1QLN A;  4KLL A;  2AGP A;  4KN7 A;  8ICF A;  4JK1 A;  3GII A;  1KLN A;  3BQ0 A;  3GIL A;  4BWJ A;  2R8K A;  2MUT B;  4O3Q A;  4R63 A;  4I2A A;  1SL2 A;  4ED0 A;  5J2B A;  5J2D A;  5L1I A;  2VA8 A;  3SZ2 A;  1NK4 A;  1KTQ A;  5HHI A;  2W9A A;  2JEG A;  2KZ3 A;  2W9C A;  1NKE A;  3BDP A;  4BXO B;  4NLN A;  5TZV A;  3PML A;  7ICE A;  4O5K A;  4DF4 A;  5J0P A;  3T5H A;  2HHX A;  3OGU A;  4EYI B;  1DOQ A;  1NJY A;  5F9N A;  4J9O A;  3EZ5 A;  3C5G A;  7ICI A;  2ZTD A;  3LDA A;  4KLM A;  2ZUB A;  4DL2 A;  1JXL A;  5J2F A;  5KFQ A;  4J9M A;  3C1Y A;  4RQ0 A;  4ED8 A;  2W9B A;  4KMU A;  9ICM A;  3ISB A;  2UVW A;  2IHM A;  5KG1 A;  1V9P A;  7ICU A;  1ZQY A;  5KFL A;  1XS9 D;  4EZ6 A;  4O5C A;  3BQ2 A;  5KFT A;  1S76 D;  1UT8 A;  1T8E A;  4I2D A;  4BWM A;  4DFJ A;  3TAR A;  4QZB A;  5DQH A;  4ECX A;  1LV5 A;  4DQP A;  4DLE A;  1NK7 A;  4QZD A;  8ICN A;  2BR0 A;  4I2G A;  4B9M A;  4RQ7 A;  4UB3 A;  3ZDA A;  1KDH A;  4YMM A;  3UXO A;  4I28 A;  1CUK A;  4P4O A;  5III A;  5KG4 A;  4O0I A;  4R8U B;  4RNO A;  5HP4 A;  4KLU A;  2XCA A;  1S77 D;  1IXR A;  3TI0 A;  1NKC A;  4DS4 A;  5HHH A;  2XCP A;  1X9M A;  5F9L A;  4RPZ A;  3OJU A;  2C2R A;  2C28 A;  3PW2 A;  2HHU A;  4TUS A;  5DKW A;  5KFZ A;  4MF8 A;  4YG2 A;  4KLD A;  1S0N A;  2V4Q A;  1D9F A;  4YR2 A;  3UPQ A;  4QZG A;  3C1Z A;  3Q8Q B;  4RNM A;  7ICK A;  2UVR A;  4ECU A;  1Z3E B;  4TUR A;  2BKE A;  4J9L A;  2PFQ A;  4O9M A;  1L3U A;  1T3N A;  5J2J A;  3KHL A;  2XO7 A;  3MDC A;  3Q8K A;  4O3N A;  2VA3 A;  8ICL A;  3OHB A;  1X9W A;  5DG7 A;  1ZQH A;  4JV1 A;  7ICO A;  8ICU A;  1X2I A;  4R64 A;  2UVV A;  1UT5 A;  2ZUD A;  1XSL A;  2FPK A;  5HNK A;  4F5O A;  8ICH A;  4XUS A;  1ARO P;  2ZJA A;  9ICX A;  4TQS A;  4Z6E A;  2BCR A;  2F1H A;  2AGO A;  4C8N A;  3QE9 Y;  1S0V A;  3GV8 B;  2NRT A;  5KFV A;  2XGP A;  4J9S A;  4DF8 A;  1NJW A;  4QZ9 A;  3NTU A;  4MEX A;  4UB1 A;  2ATL A;  4Z6C A;  3V7J A;  2HVI A;  5KT5 A;  4ECT A;  4JV0 A;  1RXW A;  4KTQ A;  4M47 A;  3TAP A;  4IQU A;  4RQ3 A;  3PR5 B;  3GV5 B;  2C22 A;  3TAN A;  4J9Q A;  1ZQL A;  5J0W A;  1D9D A;  1U9L A;  5J0Y A;  4F4W A;  4DQS A;  4NXZ A;  3LWM A;  4LVS A;  7ICN A;  5CJ7 A;  1S97 A;  4UAZ A;  1XSN A;  3RJK A;  3QEB Z;  4BXO A;  3MFH A;  4DO9 A;  2BPF A;  1ZJN A;  4KLT A;  4QW8 A;  4QWB A;  1ZYQ A;  4FBU A;  4RQ2 A;  4F5R A;  2XY6 A;  5KFI A;  2PFP A;  8ICW A;  4RQ8 A;  3HWT A;  2NRZ A; 
#chains in the Genus database with same CATH topology
 4BX9 C;  2ZG6 A;  2ZXI A;  3MAB A;  2D3D A;  1JAL A;  3M9N B;  2BDP A;  4RU9 A;  2J6S A;  1JRP A;  3KBB A;  3QZ8 A;  4NLG A;  2H5X A;  5CA7 A;  1S0O A;  5L1J A;  5TIS U;  5IIL A;  3IV6 A;  4UAT A;  5J0T A;  3ZD8 A;  2WB1 F;  3QUC A;  5BOL A;  3M8S A;  4EEY A;  2FPL A;  3F2C A;  1KFD A;  2BQR A;  5AI0 A;  3OSP A;  2KVS A;  2LYA A;  4RQ5 A;  3J81 j;  1RDF A;  4Z6F A;  2G08 A;  2BCQ A;  3B9J A;  4M9G A;  1GO3 F;  1SKW A;  1BGX T;  4PPX A;  4FZL A;  1COO A;  3TAD C;  3IHQ B;  1PZN A;  5DB9 A;  1SKR A;  4PGX A;  3SQI A;  2JMG A;  1VLB A;  1T7P A;  2V9W A;  4IRD A;  1URJ A;  1J97 A;  3C2M A;  3PVX A;  3T5J A;  2W8K A;  4P0P A;  2P6R A;  1UA0 A;  4QWD A;  3WKC A;  4G3I A;  9ICP A;  1SWV A;  2W9M A;  8ICT A;  3IP4 B;  4UB6 U;  5KFY A;  3AU6 A;  2DPJ A;  4K4G A;  3ORY A;  2L5Y A;  2WF7 A;  4Q43 A;  5BOM A;  1PK1 A;  2LBO A;  5DG9 A;  1UCV A;  1DK3 A;  5ALZ A;  2P66 A;  3RB6 A;  2HW3 A;  3MDA A;  2IMW P;  8ICK A;  1O03 A;  1CI4 A;  2BCV A;  3SEN A;  3BZC A;  3PW5 A;  2KZZ A;  3LVV A;  3TAC B;  2ZTE A;  2NYV A;  4I2F A;  3T5L A;  3WK6 A;  2WFA A;  2R8J A;  4F5P A;  4BGD A;  5CWR A;  3PW4 A;  9ICA A;  2MUT A;  1Q8K A;  1NOM A;  1PVQ A;  1N56 A;  4I2C A;  1OUQ A;  4CF3 A;  1D8Y A;  3V7K A;  2A19 A;  3NVZ A;  4B9T A;  4EBE A;  4UB5 A;  5IIO A;  2PFO A;  2WF5 A;  3VCB A;  5KTQ A;  4DSE A;  1Z4N A;  5J0U A;  4EX6 A;  3KTQ A;  5AM5 A;  5KAI U;  4ECQ A;  3THV A;  1OW5 A;  2G0A A;  4PGQ A;  1NK5 A;  4I27 A;  2BDU A;  1B22 A;  1NI3 A;  5J0R A;  4EYH B;  2KIC A;  1NK0 A;  4O3P A;  2XID A;  3I1Y A;  5KT3 A;  1DRG A;  2A3V A;  3ZDE A;  3CYM A;  5DDY A;  2MAX A;  5C5J A;  9ICC A;  2KJ8 A;  3SEI A;  5KFF A;  2ODG A;  3MC1 A;  4DFK A;  2KG5 A;  5EWF A;  1HUZ A;  2LI6 A;  1YZ7 A;  4F4X A;  3UXN A;  1RYS A;  1LB2 B;  5K4L A;  3PNC A;  3DDH A;  4RT2 A;  1ZQE A;  2ZTC A;  2G5H B;  5B66 U;  2B6G A;  1AQ6 A;  5KG7 A;  1HJP A;  3WK4 A;  2H3F A;  5L9X A;  3LYS A;  2YY6 A;  1ZQR A;  2LYH A;  4BDP A;  1A6S A;  5ALY A;  1JX4 A;  5KFD A;  3ZDC A;  4DL7 A;  4DOA A;  3GIJ A;  2RDJ A;  3T79 A;  4KLH A;  1EXN A;  1ZD4 A;  5KG3 A;  2H3I A;  5J0O A;  3KKA A;  3OJS A;  4F8R A;  3PX0 A;  1ZQN A;  3SR6 A;  2IOF A;  2K4P A;  4US8 A;  7ICR A;  2YN4 A;  5KG6 A;  4J9R A;  3NVY A;  5KG2 A;  1A76 A;  2GLE A;  4UAS A;  2QAR B;  1JIH A;  5J0Q A;  2XIC A;  3SV4 A;  4ECY A;  1TV9 A;  4CF5 A;  3RBE A;  1SZH A;  5DBC A;  4YXJ A;  4B9S A;  4ZH4 A;  9ICK A;  3AM9 A;  3IG5 A;  2W7P A;  1RPL A;  2R8G A;  4YVZ A;  1SL0 A;  1QQ7 A;  4OJP A;  3WK8 A;  5KFC A;  1NK6 A;  4PHA A;  4M6W A;  5ALD A;  4C8M A;  4I2B A;  2DBY A;  5ALN A;  4EEK A;  1NKB A;  1KW4 A;  2W9C B;  2R18 A;  1ZQD A;  4C8O A;  2ISO A;  1Z4O A;  1X66 A;  3G6Y A;  4F2R A;  5AIC A;  3QU4 A;  5DGB A;  1JUD A;  5D46 A;  4Q8F A;  2OEH A;  2FMP A;  4OJO A;  2I5H A;  1WCN A;  2JH1 A;  4Q45 A;  1IM4 A;  1JMS A;  5ALJ A;  1S9F A;  3KHH A;  2YQE A;  2FI1 A;  5AKK A;  3RJJ A;  4MHV A;  4RUA A;  3G6X A;  1MN8 A;  1NZB A;  2OXO A;  3QUB A;  4KLG A;  4GLX A;  5AI4 A;  2ALZ A;  5ALF A;  3PO5 A;  2LKY A;  3BQ1 A;  4F5Q A;  3U26 A;  2RP5 A;  5KFR A;  2RQ5 A;  2OCE A;  1SB3 C;  4ECR A;  1RQN A;  3H8W A;  2PI4 A;  3N7S C;  3UQ2 A;  2W11 A;  1KSP A;  4JUZ A;  4I2H A;  3H8J A;  3MR3 A;  2FLP A;  4DSJ A;  4O3S A;  2KHV A;  1BNO A;  2KK0 A;  5KT6 A;  1ECW A;  3UMC A;  4CRX A;  4JK1 A;  2G5I B;  3SAF A;  1SL2 A;  3SZ2 A;  2I6X A;  2W3R A;  5HHI A;  2W9A A;  3BDP A;  1LVH A;  3AQF A;  4DF4 A;  3T5H A;  2OHF A;  2JXJ A;  1NJY A;  3F5A A;  2LM1 A;  2ZUB A;  3C1Y A;  4RQ0 A;  4Y2Q A;  2E8N A;  5AI9 A;  2UVW A;  5AHX A;  1S76 D;  4DFJ A;  4QZB A;  4ECX A;  4DLE A;  1NK7 A;  8ICN A;  4B9M A;  1B0X A;  4UB3 A;  4EEL A;  1KDH A;  4YMM A;  3KFU F;  1Q3V A;  5AM0 A;  1IXR A;  2ZXH A;  4NLC A;  4DS4 A;  3OJU A;  2HHU A;  2AH5 A;  1S0N A;  4P0Q A;  2V4Q A;  3Q8Q B;  2UVR A;  4ECU A;  2VIX A;  2XO7 A;  3GZF A;  3Q8K A;  2BZF A;  2FPK A;  4XUS A;  4Z6E A;  2F1H A;  5KFV A;  1NJW A;  2HVI A;  4Y2T A;  1RXW A;  4M47 A;  4IQU A;  3PR5 B;  4J9Q A;  2DUY A;  1ZQL A;  1D9D A;  5J0Y A;  4F4W A;  4LVS A;  4DQS A;  1N61 A;  4BXO A;  2LYB A;  2KKV A;  4DO9 A;  4C4T A;  4FBU A;  1ZD3 A;  2YMM A;  3EWA A;  3I76 A;  1ZQK A;  5E79 U;  2C2E A;  1DXS A;  3RR8 A;  2H3Q A;  3ISC A;  3FDS A;  1ZQM A;  2BHN A;  3HJE A;  5DDM A;  4FS2 A;  4C7Z A;  3LVW A;  2KZM A;  5J0S A;  3ISD A;  1ZQQ A;  5C0Y A;  3T3F A;  1MQ3 A;  9ICQ A;  4FFD A;  4MFF A;  2WAQ C;  5CEH A;  3IRU A;  2BQU A;  2W8L A;  2HVH A;  3RTV A;  2H3V A;  3GQC A;  1DGJ A;  1RYU A;  2K8A A;  4YD2 A;  2Y1I A;  1N5W A;  5ALU A;  2F76 X;  1UQV A;  3EPI A;  3WK5 A;  5L1L A;  1J2N A;  2IA6 A;  1TK8 A;  2E8M A;  4YCX A;  4EBD A;  4KLE A;  2IHN A;  3V6K A;  3PX6 A;  5IIK A;  4MF2 A;  3KD3 A;  7ICG A;  4DOC A;  3HIL A;  2KHQ A;  4OD0 A;  1KFS A;  3JPT A;  3JPP A;  3QNM A;  1KQQ A;  1CRX A;  3OSN A;  1MQ2 A;  3A0B U;  2QLT A;  1N60 A;  4DQI A;  2K4H A;  4ECW A;  5J2C A;  5DG8 A;  3FYH A;  1HIW A;  1NK9 A;  4KLF A;  2B0C A;  3WKD A;  4YD1 A;  1F5S A;  4F93 B;  4OCZ A;  5AKH A;  3PSP A;  4R65 A;  4CCH A;  8ICZ A;  3AN1 A;  4Y2S A;  3RJE A;  4B9V A;  1XO1 A;  8ICE A;  2Z7J A;  9ICT A;  4KN4 A;  2N1R A;  1C20 A;  4EX7 A;  4TUQ A;  2WAQ F;  3RRH A;  3PSF A;  4NL9 C;  2MA1 A;  5ALS A;  1KKX A;  5AM3 A;  3NVV A;  2DF4 B;  4IC9 A;  8ICG A;  3DV9 A;  4ED7 A;  4O3R A;  5AKZ A;  1K5O A;  3M7D A;  4P4M A;  5J2I A;  2BCU A;  1TFR A;  1MSW D;  8ICJ A;  1RG6 A;  2DKZ A;  2HOI A;  1N5X A;  3V72 A;  3N7P D;  1UHU A;  5KFA A;  3AEV A;  5DLF A;  5DB6 A;  5KFJ A;  4JMU A;  1JI7 A;  3AU2 A;  5IIM A;  2K60 A;  2ZIW B;  4XQ8 A;  1BPD A;  1IV8 A;  2EAP A;  8ICO A;  2ISP A;  2NV3 A;  3AL0 B;  8ICA A;  3H0M B;  4RNN A;  3PMN A;  5JTI A;  1T4G A;  5KFO A;  2XGQ A;  3M8R A;  2FPM A;  4KLJ A;  1XNS A;  1NK8 A;  2ASJ A;  5ALV A;  2VJ4 A;  5AM4 A;  3JPQ A;  4I2E A;  8ICM A;  3GV7 B;  3K75 D;  3KZI U;  4ECZ A;  4ED3 A;  5ALI A;  2G06 A;  1UA1 A;  4C7Y A;  2NO4 A;  4DFD A;  4FO6 A;  1UPH A;  4PGY A;  1N62 A;  2M9N A;  5J0X A;  2JZB B;  1ZQO A;  4DFM A;  4F3O A;  2ZIU B;  4FE3 A;  2PXI A;  5AI5 A;  3GIK A;  8ICY A;  4OJ6 A;  1TK5 A;  5ALR A;  4DSK A;  1SKS A;  3PZP A;  4BJQ A;  4PHD A;  2HBK A;  4OJ5 A;  1ZQA A;  5BPC A;  3H0R B;  1L7M A;  2AQ4 A;  2H3Z A;  4U7C A;  4DL4 A;  4C80 A;  1VJ5 A;  2AGQ A;  4M9J A;  3K1Z A;  7ICS A;  2DL0 A;  1SXD A;  3H8S A;  2WHE A;  4GXJ A;  4J9P A;  2F77 X;  5IIN A;  2E8O A;  1ZQB A;  2KD1 A;  4PHP A;  1JRO A;  4J03 A;  8ICI A;  3M1Y A;  1N48 A;  2HSZ A;  2EAN A;  3MFI A;  4HYK A;  3C5F A;  3RB0 A;  4K4H A;  1KBU A;  3G6V A;  1A77 A;  2FJ6 A;  2W3S A;  3BJY A;  2ZJ8 A;  1FFU A;  4UAU A;  4IL6 U;  5GTH U;  4TQR A;  3NRZ A;  4NM1 A;  2RHF A;  1TAQ A;  1U48 A;  5L1K A;  3ZD9 A;  1RYR A;  5ALW A;  4IR9 A;  4IQT A;  1BNP A;  9ICV A;  2EDU A;  4FS1 A;  2W9B B;  4RQ4 A;  4P0P B;  2E1F A;  2CXY A;  4P4P A;  2KFZ A;  4QZC A;  1SIJ A;  1Z19 A;  3B0X A;  4IR1 A;  4FBT A;  3RH6 A;  1ZQS A;  3IM1 A;  2OH2 A;  1ZQG A;  5KFX A;  2OWO A;  2Y0S C;  2JEI A;  5KFN A;  1L3V A;  2YMQ A;  1TK0 A;  1SV0 C;  3RAX A;  9ICN A;  4ELV A;  5ALO A;  5DB8 A;  4PJ0 U;  5D49 A;  5KFS A;  5CP2 A;  3QX7 A;  1PK1 B;  4ZOH C;  4DSF A;  2NO5 A;  9ICU A;  5G5G A;  5KFB A;  3RRG A;  5DBA A;  9ICB A;  2KP7 A;  5AKY A;  8ICP A;  3C2K A;  2KJ5 A;  2IOH A;  5AI6 A;  2HDO A;  3L5K A;  3GFK B;  1ZQU A;  4ELU A;  9ICI A;  4M9N A;  2W54 A;  2EAO A;  2AGP A;  4BWJ A;  2MUT B;  4R63 A;  3QU2 A;  5JRT A;  2VA8 A;  5AIB A;  3GU3 A;  5L1I A;  4FZN A;  2PKE A;  1KTQ A;  1NKE A;  2W9C A;  2K89 A;  4NLN A;  5TZV A;  3PML A;  7ICE A;  4O5K A;  5J0P A;  1DOQ A;  5F9N A;  4J9O A;  4J9M A;  5KFQ A;  2K8C B;  4KMU A;  9ICM A;  3ISB A;  4KMO B;  2O6K A;  5KG1 A;  7ICU A;  1XS9 D;  4EZ6 A;  1T8E A;  2D8C A;  4DQP A;  4QZD A;  5HR6 A;  4RQ7 A;  2Y0S F;  3ALR A;  5F3X B;  1CUK A;  5G5H A;  3NVW A;  1ZD5 A;  2XCA A;  1S77 D;  3F5E A;  1NKC A;  1X9M A;  2C28 A;  1ZRM A;  3PW2 A;  4MF8 A;  3BS5 A;  4RNM A;  5AKX A;  1Z3E B;  2ESE A;  2BKE A;  4O9M A;  1L3U A;  2MU2 A;  3OTQ A;  5DG7 A;  2UVV A;  1UT5 A;  4QJF B;  4QNL A;  2HBJ A;  3N28 A;  4DCC A;  2ZJA A;  3ONN A;  2JR5 A;  5ALL A;  2YMP A;  3H8M A;  3NTU A;  4C4S A;  4Z6C A;  4KTQ A;  3TAN A;  2CPR A;  4NXZ A;  4UAR A;  2LMR A;  2KJ9 A;  1S97 A;  1XSN A;  3QXG A;  2F8L A;  1ZJN A;  3UMG A;  1ZYQ A;  1KL9 A;  4F5R A;  2EZX A;  2PFP A;  8ICW A;  3HWT A;  2NRZ A;  1XC9 A;  4KIT B;  3V6J A;  5J2A A;  1DK2 A;  1NJX A;  2Y1J A;  5ALX A;  4KX3 A;  3K4G A;  1BVS A;  2UVU A;  4OJL A;  4C8L A;  4RQ6 A;  4Z6D A;  2HOF A;  2A1J B;  9ICJ A;  5EWG A;  4F4K A;  1L6N A;  4QZI A;  1L5U A;  4KLO A;  2WF6 A;  3F2D A;  4PZN A;  3LK9 A;  3AUO A;  5AKJ A;  2PFN A;  3T5K A;  4ECS A;  5CRX A;  3NRW A;  4NY8 A;  2Q4T A;  5GTI U;  4YR0 A;  5ALQ A;  1TAM A;  4JWM A;  1Z00 A;  1KRP A;  7ICL A;  1C7Y A;  2ASD A;  2KFN A;  5JUM A;  4UB4 A;  2ZIV A;  2HHQ A;  3HW8 A;  4KLS A;  2ZJ5 A;  4DS5 A;  2GWS A;  1U4B A;  2FMQ A;  4C0Z A;  1QCK A;  3M9O B;  3SV3 A;  1PK3 A;  5KFM A;  1SZP A;  2G07 A;  4YMO A;  5KFE A;  2W55 A;  3HX0 A;  3UXP A;  5KL8 B;  4UBC A;  2KVC A;  3R9K A;  5ALE A;  3V6H A;  3QU9 A;  2AJQ A;  3Q8L A;  9ICO A;  4DEZ A;  4UAW A;  3C29 A;  9ICW A;  2W7O A;  5D4B A;  1RZT A;  5CHG A;  9ICF A;  4P2H A;  1X6I A;  3BQ7 A;  1XU4 A;  4NLZ A;  1FEZ A;  1LKY A;  2KEY A;  1B4F A;  4NLB A;  2W43 A;  3NGD A;  4MFC A;  3OHA A;  2E8P A;  3KKA C;  4UAV A;  2AQ0 A;  5KNI A;  3D6J A;  3FM9 A;  1ZQF A;  1QTM A;  7ICM A;  3HP6 A;  1BPB A;  4R66 A;  2IOF K;  1RXV A;  1Q46 A;  1CEZ A;  4X5V A;  3PY8 A;  7ICT A;  4EEN A;  2JEF A;  5HMM A;  1ZQX A;  2DKX A;  3WK9 A;  2HI0 A;  4F50 A;  5ALM A;  2GH1 A;  3TAD A;  9ICH A;  2JGA A;  5J8Y A;  3Q8P B;  2A1A A;  1L8O A;  4UBB A;  4RPX A;  2WF9 A;  1SWW A;  1BPY A;  4YQW A;  4R8U A;  3QEA Z;  2ZUC A;  3PW0 A;  3SAH A;  2Y9U A;  3Q8R B;  3KHR A;  4G9B A;  4QW9 A;  4GC6 A;  2RDI A;  4AYB C;  2GO7 A;  3CRX A;  4JB3 A;  4ED2 A;  1ZQP A;  9ICL A;  3TFR A;  2C2D A;  1ZQV A;  4ECV A;  5DB7 A;  3RH4 A;  4F4Y A;  4Y2P A;  3QUT A;  4IQW A;  4B9N A;  9ICG A;  3ZDB A;  4GXK A;  3OPX A;  2XY7 A;  4KLI A;  1V38 A;  2ZIX B;  8ICQ A;  3JPN A;  1L7N A;  5J2H A;  1XWL A;  1S5L U;  4F5N A;  2F3N A;  3H7I A;  9ICR A;  3M6K A;  3NUQ A;  4U6P A;  3LWL A;  3C2L A;  4IRK A;  2I9G A;  4QWA A;  1BPE A;  1BPX A;  4PH5 A;  1D8L A;  2F2A B;  1Z1V A;  5J2G A;  3Q8S B;  4F92 B;  1QSL A;  5J29 A;  1WCL A;  3M6Z A;  3WK7 A;  2KSO B;  3D2Q A;  9ICS A;  4J9K A;  1M6Y A;  4XRH A;  5IIJ A;  1N2X A;  3UMB A;  4M04 A;  3SI8 A;  3F2B A;  1TKD A;  2AXT U;  2WTF A;  3RJF A;  2K8B B;  4ED1 A;  1ZQZ A;  2KIV A;  4HAI A;  4PL2 A;  4AYB F;  3TKA A;  3TAQ A;  1P7D A;  2I1Q A;  5AK5 A;  5KT7 A;  1TAU A;  7ICV A;  1L3S A;  4DQQ A;  1V97 A;  3MR5 A;  7ICJ A;  1QSY A;  3EW9 A;  2FDR A;  2JZB A;  2JV3 A;  4YN4 A;  4BUG A;  3MR6 A;  2ZIU A;  3QYP A;  3B0Y A;  1JN3 A;  5DBB A;  1Y88 A;  1PVP A;  5KG0 A;  3HRD D;  3HPO A;  1S10 A;  2K4I A;  2OYY A;  1BPZ A;  2QB0 B;  4DL5 A;  3SD7 A;  3PR4 A;  4JV2 A;  4O5E A;  1WWV A;  2J6T A;  4RQM A;  5HML A;  3EPG A;  3MBY A;  1XO0 A;  3VC8 A;  3BQT A;  4IRC A;  4Y2R A;  4F2S A;  4QWC A;  4QZA A;  3GIM A;  2HMX A;  4DSL A;  2F1I A;  3TQ1 A;  4B6J A;  4TUP A;  3ED5 A;  4QIW C;  1HEK A;  1YT3 A;  2DWQ A;  2KOB A;  2HBM A;  8ICS A;  4DFP A;  4Q8E A;  4PHE A;  7ICH A;  2NRX A;  4RQ1 A;  1QLN A;  4KLL A;  4KN7 A;  1ED1 A;  4NJ8 A;  2R8K A;  4O3Q A;  4I2A A;  4ED0 A;  5J2B A;  1PUZ A;  5J2D A;  1L7O A;  1MA7 A;  2JEG A;  2KZ3 A;  2KV2 A;  5AK6 A;  3WKB A;  5J8Y C;  2FE9 A;  2HHX A;  3OGU A;  3EZ5 A;  3C5G A;  7ICI A;  2KKP A;  2MRL A;  5EE1 A;  3L3F X;  4DL2 A;  1JXL A;  1IIP A;  2W9B A;  1WWU A;  2XI9 A;  2IHM A;  5KFL A;  4O5C A;  4UB8 U;  3TAR A;  5AM1 A;  5DQH A;  1LV5 A;  3ICX A;  4I2G A;  4C4R A;  5AKE A;  4P4O A;  5III A;  4RNO A;  5T14 A;  4KLU A;  4USA A;  3QU7 A;  5HHH A;  2XCP A;  1SGG A;  1RQL A;  5DKW A;  5KFZ A;  4YG2 A;  4KLD A;  1D9F A;  4YR2 A;  3UPQ A;  4QZG A;  7ICK A;  1ZXI A;  4Y2V A;  5ALG A;  1QQ6 A;  4TUR A;  4J9L A;  1T3N A;  4UW9 A;  3MDC A;  2ES6 A;  4O3N A;  3E58 A;  5JU5 A;  2VA3 A;  4QIW F;  4O3M A;  4JV1 A;  1ZRN A;  1N63 A;  1X2I A;  7ICO A;  1XSL A;  2GOL A;  4F5O A;  1ARO P;  9ICX A;  2YB1 A;  2BCR A;  1YZ6 A;  3I28 A;  4C8N A;  3QE9 Y;  1S0V A;  3GV8 B;  4J9S A;  3QU5 A;  4A8E A;  4QZ9 A;  4MEX A;  4UB1 A;  4ECT A;  3TAP A;  4RQ3 A;  2C22 A;  1U9L A;  2KMD A;  7ICN A;  5AK4 A;  4UAZ A;  3KZX A;  2F44 A;  3MFH A;  2BPF A;  4PZO A;  4QW8 A;  3UM9 A;  3ZDD A;  3PX4 A;  4RUC A;  2EZY A;  1Q3U A;  3O0F A;  3N4M B;  5EOZ A;  5CR0 A;  1QQ5 A;  1TE2 A;  5KFG A;  5L1M A;  5KT2 A;  4K4I A;  2KTQ A;  2QAR A;  4NV0 A;  4LZD A;  2G09 A;  3BS7 A;  2YML A;  4RPY A;  1DGS A;  2QKQ A;  3WU2 U;  2EH9 A;  2YB4 A;  1PVR A;  4GC7 A;  4YMN A;  4DL6 A;  1K1Q A;  1MC8 A;  3E2E A;  3N97 B;  4OO1 J;  8ICX A;  3H40 A;  4I29 A;  4DL3 A;  4RZR A;  4F72 A;  4QZH A;  3PW7 A;  2LM4 A;  2HHT A;  1WYG A;  1U45 A;  2BCS A;  8ICB A;  1SXE A;  4MEY A;  4GXI A;  4NLK A;  4PL1 A;  3RFA A;  2BQ3 A;  4ICA A;  2HHS A;  2KNJ A;  5KFK A;  4EBC A;  4QZ8 A;  2DPI A;  2NRW A;  2JEJ A;  3RH5 A;  3A0H U;  1HUO A;  2IBK A;  5J2K A;  3M9M B;  4UQG A;  3MGH A;  3JPO A;  1S0M A;  1F44 A;  3WKA A;  5DQI A;  1S8O A;  2BPG A;  1V85 A;  5CB1 A;  2D6F C;  4DOB A;  4CNQ A;  5ALH A;  2JHD A;  5KT4 A;  3MR2 A;  3JPR A;  2F8K A;  4J9N A;  5KG5 A;  1ZQT A;  2F1J A;  3ZI4 A;  2A1J A;  2R8H A;  4DWI A;  2XY5 A;  1L3T A;  4Y2J A;  3QZ7 A;  4NM2 A;  3MGV A;  2XC9 A;  8ICV A;  4Y2X A;  3CP8 A;  2LPE A;  1T3Q A;  1SV4 A;  1KFT A;  1KEJ A;  2BGW A;  2W04 A;  1RM6 C;  1SL1 A;  3RAQ A;  3H4D A;  4YFK A;  4WJ3 B;  2Q0Z X;  4ELT A;  4RT3 A;  4F4Z A;  2HHW A;  5DQG A;  2R8I A;  9ICE A;  2YTU A;  4QZE A;  4UB2 A;  1U47 A;  4KLQ A;  4YR3 A;  1WG8 A;  2LHT A;  2P6U A;  1ZQI A;  3RR7 A;  3TFS A;  2FMS A;  2KE7 A;  3V7L A;  3C21 A;  2JRZ A;  5H2F U;  1QSS A;  4Y2Y A;  3L4P A;  1O08 A;  1XSP A;  1D8B A;  4KX5 A;  3BS5 B;  2CN1 A;  1JXE A;  1ZQW A;  1NNL A;  3BZK A;  3AMZ A;  2VA2 A;  3RB4 A;  5HR7 A;  5KFW A;  4GFJ A;  4M6W B;  3EYZ A;  1TVA A;  4NWI A;  1FIQ A;  3E0F A;  5EE0 A;  3MGI A;  4QWE A;  4LJX A;  1ZQC A;  2PMZ C;  5AIA A;  3KOO A;  1U49 A;  5J2E A;  4LZG A;  4JWN A;  3PST A;  5B5E U;  2HHV A;  2XVT A;  4B9U A;  5A0L A;  1NZP A;  3SYZ A;  5ALT A;  3FC4 A;  2VJ5 A;  5AKI A;  4O3O A;  1COK A;  5EWE A;  3C23 A;  4NL9 A;  3RJI A;  4F91 B;  3Q8M A;  4CE6 A;  2FLN A;  2Y9T A;  2KN7 A;  2DFL A;  2K4E A;  2EZZ A;  4M9L A;  1F0M A;  5EE3 A;  3RBD A;  3CW2 C;  2YX8 A;  4M2Y A;  1K1S A;  3PO4 A;  1ZOL A;  2BPC A;  5ALP A;  2EQY A;  4DLG A;  3EUB 2;  2RLT A;  3C28 A;  3PV8 A;  1FFV A;  5KAF U;  2PI5 A;  1L7P A;  1T94 A;  2B21 A;  1B43 A;  5AK3 A;  3KHG A;  1H38 A;  3IN5 A;  4AP9 A;  4YP3 A;  1X9X A;  5AKL A;  1X40 A;  5AKG A;  4XA5 A;  3HKZ C;  3SAG A;  5DLG A;  1Z1B A;  1NJZ A;  3RJH A;  4Q44 A;  4C8K A;  8ICR A;  5ALK A;  4DSI A;  5KFH A;  3JPS A;  3GDX A;  2HOQ A;  4QZF A;  2NRV A;  7ICQ A;  3H0L B;  2VKQ A;  5KFP A;  4IS7 A;  4US9 A;  4IQV A;  2FLL A;  3HT3 A;  5KFU A;  1ZD2 P;  3S6J A;  2E5S A;  2PMZ F;  2WF8 A;  2M0N A;  5DGA A;  3QUQ A;  1Z00 B;  3ETL A;  2V4R A;  2JH7 A;  7ICF A;  4M0A A;  5KL1 B;  3WKE A;  2ZIV B;  3IG8 A;  4Y2U A;  1A0P A;  4F71 A;  3N7R C;  4I2I A;  1X9S A;  2ZIX A;  4MFA A;  2ASL A;  4I2J A;  4E0D A;  4DQR A;  1ZJM A;  3H4B A;  2VAN A;  2J6U A;  3IDW A;  4B9L A;  4M9H A;  3DEE A;  2HCF A;  1X6J A;  7ICP A;  1VDV A;  3ETR A;  2P35 A;  5AM2 A;  4P0Q B;  3NAS A;  2KSO A;  4YXM A;  1ZQJ A;  8ICC A;  2E1E A;  3RJG A;  4ED6 A;  1L8L A;  4UAY A;  1ZQ1 C;  3RB3 A;  4CF4 A;  2AU0 A;  3UQ0 A;  3HKZ F;  4EZ9 A;  1LKY B;  1ZET A;  3PSI A;  2KIW A;  3K1R B;  8ICF A;  1X42 A;  3GII A;  1KLN A;  2AHO B;  3BQ0 A;  3GIL A;  2OM6 A;  2MSN A;  5AI8 A;  1OXJ A;  5FP0 A;  1NK4 A;  3AQE A;  4BXO B;  4EYI B;  4ACO A;  5EE9 A;  2ZTD A;  3LDA A;  4KLM A;  5J2F A;  4CDG A;  1WUD A;  4ED8 A;  3D2N A;  1V9P A;  2ZIW A;  1ZQY A;  1KN5 A;  3NS1 A;  3BQ2 A;  5KFT A;  1UT8 A;  4I2D A;  4BWM A;  2QB0 A;  2W03 A;  2DGZ A;  2BR0 A;  3D2S A;  3ZDA A;  4I28 A;  3UXO A;  2QB1 A;  5KG4 A;  4O0I A;  5HP4 A;  4R8U B;  2WB1 C;  3TI0 A;  5F9L A;  4RPZ A;  2C2R A;  2HBL A;  4TUS A;  4RQN A;  3F53 A;  4CGZ A;  3C1Z A;  1SV0 A;  3FAH A;  2PFQ A;  5J2J A;  3KHL A;  1FO4 A;  2RRD A;  2CRX A;  8ICL A;  3OHB A;  1J2M A;  1X9W A;  1ZQH A;  8ICU A;  4R64 A;  2ZUD A;  5HNK A;  8ICH A;  3SMV A;  4TQS A;  2AGO A;  2NRT A;  2XGP A;  4DF8 A;  2DQN B;  2E3T A;  3CNH A;  2ATL A;  3V7J A;  5KT5 A;  4JV0 A;  3RF9 A;  3GV5 B;  2EAM A;  1QH9 A;  5J0W A;  3LWM A;  5CJ7 A;  3RJK A;  4GIB A;  3QEB Z;  4KLT A;  4FZM A;  4QWB A;  1IG6 A;  4RQ2 A;  2XY6 A;  5KFI A;  4RQ8 A; 
#chains in the Genus database with same CATH homology
 1XC9 A;  3EWA A;  1ZQK A;  4KIT B;  3ZDD A;  3PX4 A;  2C2E A;  3RR8 A;  3MAB A;  3V6J A;  3ISC A;  5J2A A;  1NJX A;  2Y1J A;  4RUC A;  3M9N B;  2BDP A;  3FDS A;  4RU9 A;  3N4M B;  5EOZ A;  3QZ8 A;  2BHN A;  1ZQM A;  2J6S A;  5CR0 A;  4NLG A;  2H5X A;  5CA7 A;  1S0O A;  5KFG A;  3K4G A;  5KT2 A;  5DDM A;  5L1J A;  4K4I A;  2KTQ A;  1BVS A;  2UVU A;  4FS2 A;  4C8L A;  2KZM A;  5J0S A;  4LZD A;  4RQ6 A;  3ISD A;  1ZQQ A;  3T3F A;  5IIL A;  1MQ3 A;  9ICQ A;  4MFF A;  4Z6D A;  3ZD8 A;  5J0T A;  4RPY A;  1DGS A;  5BOL A;  2A1J B;  3M8S A;  4EEY A;  2BQU A;  2W8L A;  9ICJ A;  2HVH A;  2FPL A;  5EWG A;  3RTV A;  4F4K A;  1KFD A;  2BQR A;  4GC7 A;  4YMN A;  3GQC A;  4QZI A;  1L5U A;  4KLO A;  3OSP A;  4DL6 A;  1K1Q A;  1MC8 A;  4YD2 A;  3E2E A;  4RQ5 A;  2Y1I A;  3LK9 A;  3AUO A;  3N97 B;  4Z6F A;  2PFN A;  3T5K A;  2BCQ A;  4M9G A;  4ECS A;  1SKW A;  8ICX A;  1BGX T;  4NY8 A;  3H40 A;  4I29 A;  3EPI A;  4PPX A;  4DL3 A;  1COO A;  5L1L A;  4YR0 A;  3IHQ B;  2IA6 A;  1TK8 A;  1PZN A;  4YCX A;  5DB9 A;  4RZR A;  1SKR A;  4PGX A;  4EBD A;  4KLE A;  2IHN A;  4QZH A;  3V6K A;  5IIK A;  3PW7 A;  3PX6 A;  4MF2 A;  1T7P A;  4JWM A;  7ICG A;  4DOC A;  2V9W A;  2HHT A;  1Z00 A;  1KRP A;  1U45 A;  4IRD A;  7ICL A;  1C7Y A;  3C2M A;  2ASD A;  2BCS A;  2KFN A;  5JUM A;  3PVX A;  8ICB A;  4UB4 A;  1KFS A;  3T5J A;  2W8K A;  3JPT A;  2P6R A;  2HHQ A;  4MEY A;  3JPP A;  3HW8 A;  4GXI A;  1UA0 A;  4NLK A;  3OSN A;  2BQ3 A;  4KLS A;  1MQ2 A;  4QWD A;  2ZJ5 A;  2HHS A;  4DS5 A;  4G3I A;  5KFK A;  2GWS A;  1U4B A;  4DQI A;  4EBC A;  9ICP A;  2FMQ A;  2W9M A;  4QZ8 A;  2DPI A;  4ECW A;  8ICT A;  2NRW A;  5KFY A;  5J2C A;  3AU6 A;  5DG8 A;  3FYH A;  2JEJ A;  2DPJ A;  3RH5 A;  4K4G A;  1HUO A;  1NK9 A;  3ORY A;  4KLF A;  2IBK A;  5J2K A;  3M9M B;  4UQG A;  3M9O B;  3MGH A;  3JPO A;  3SV3 A;  4Q43 A;  5BOM A;  1S0M A;  5KFM A;  5DQI A;  2BPG A;  4YD1 A;  4F93 B;  5DG9 A;  1SZP A;  5CB1 A;  4R65 A;  4YMO A;  5KFE A;  4DOB A;  2P66 A;  4CCH A;  3HX0 A;  3UXP A;  4UBC A;  3RB6 A;  3MDA A;  2IMW P;  3RJE A;  4B9V A;  2HW3 A;  1XO1 A;  8ICZ A;  5KT4 A;  3MR2 A;  3V6H A;  8ICK A;  8ICE A;  3JPR A;  9ICT A;  2AJQ A;  3Q8L A;  2BCV A;  9ICO A;  4DEZ A;  4J9N A;  5KG5 A;  4KN4 A;  1ZQT A;  2F1J A;  4UAW A;  9ICW A;  5D4B A;  3PW5 A;  1RZT A;  5CHG A;  4TUQ A;  9ICF A;  4P2H A;  2KZZ A;  3RRH A;  1XU4 A;  2A1J A;  4NLZ A;  2R8H A;  2ZTE A;  4DWI A;  2XY5 A;  4I2F A;  1L3T A;  3QZ7 A;  4NM2 A;  3T5L A;  8ICG A;  2XC9 A;  8ICV A;  3NGD A;  2R8J A;  4F5P A;  4ED7 A;  4BGD A;  4O3R A;  4MFC A;  5CWR A;  3OHA A;  3PW4 A;  2AQ0 A;  4P4M A;  5J2I A;  2BCU A;  9ICA A;  2MUT A;  1TFR A;  1MSW D;  8ICJ A;  1KFT A;  1NOM A;  1ZQF A;  1QTM A;  3V72 A;  1KEJ A;  2BGW A;  7ICM A;  3HP6 A;  5KFA A;  1N56 A;  1BPB A;  4R66 A;  4I2C A;  1RXV A;  1SL1 A;  5DLF A;  3RAQ A;  3H4D A;  1CEZ A;  4YFK A;  4X5V A;  5DB6 A;  2Q0Z X;  3PY8 A;  7ICT A;  1D8Y A;  2JEF A;  3V7K A;  4ELT A;  5HMM A;  1ZQX A;  5KFJ A;  4RT3 A;  4B9T A;  4F4Z A;  4EBE A;  2HHW A;  5DQG A;  4F50 A;  4UB5 A;  2R8I A;  5IIO A;  9ICE A;  2PFO A;  3AU2 A;  5IIM A;  4QZE A;  9ICH A;  4UB2 A;  1U47 A;  4KLQ A;  5KTQ A;  4DSE A;  4YR3 A;  5J0U A;  3Q8P B;  4XQ8 A;  2P6U A;  1ZQI A;  3RR7 A;  3KTQ A;  1BPD A;  3TFS A;  2FMS A;  3V7L A;  4ECQ A;  8ICO A;  3THV A;  3C21 A;  2ISP A;  4PGQ A;  1NK5 A;  8ICA A;  4UBB A;  4I27 A;  4RPX A;  4RNN A;  3PMN A;  1QSS A;  1BPY A;  1B22 A;  4YQW A;  4R8U A;  3QEA Z;  1T4G A;  5KFO A;  2ZUC A;  3PW0 A;  5J0R A;  4EYH B;  2XGQ A;  3M8R A;  1XSP A;  1NK0 A;  2FPM A;  4O3P A;  3KHR A;  3Q8R B;  4KLJ A;  1NK8 A;  5KT3 A;  2ASJ A;  4QW9 A;  1JXE A;  1ZQW A;  3ZDE A;  4GC6 A;  2RDI A;  5DDY A;  2MAX A;  5C5J A;  3JPQ A;  4ED2 A;  1ZQP A;  2VA2 A;  3RB4 A;  4I2E A;  8ICM A;  3GV7 B;  9ICC A;  5KFW A;  4M6W B;  3EYZ A;  3K75 D;  1TVA A;  9ICL A;  5KFF A;  4ED3 A;  4ECZ A;  4DFK A;  3TFR A;  1UA1 A;  5EWF A;  4FO6 A;  1HUZ A;  3MGI A;  1RYS A;  4F4X A;  3UXN A;  2C2D A;  1LB2 B;  4PGY A;  3PNC A;  2M9N A;  1ZQV A;  5J0X A;  4QWE A;  4ECV A;  2JZB B;  1ZQC A;  4RT2 A;  1U49 A;  4DFM A;  1ZQO A;  5DB7 A;  3RH4 A;  1ZQE A;  4F4Y A;  5J2E A;  2ZTC A;  4LZG A;  4F3O A;  4IQW A;  4JWN A;  2HHV A;  4B9N A;  4B9U A;  5KG7 A;  9ICG A;  3SYZ A;  2PXI A;  1HJP A;  3ZDB A;  5L9X A;  4GXK A;  3GIK A;  4O3O A;  8ICY A;  2XY7 A;  4KLI A;  1TK5 A;  1ZQR A;  2LYH A;  5EWE A;  4DSK A;  1SKS A;  3C23 A;  8ICQ A;  4PHD A;  3JPN A;  5J2H A;  4BDP A;  1XWL A;  4F91 B;  3RJI A;  3Q8M A;  1JX4 A;  1ZQA A;  5KFD A;  5BPC A;  3ZDC A;  4F5N A;  4DL7 A;  4DOA A;  2FLN A;  3GIJ A;  2RDJ A;  4KLH A;  3H7I A;  1EXN A;  2DFL A;  2KN7 A;  9ICR A;  5KG3 A;  2AQ4 A;  3LWL A;  4DL4 A;  3C2L A;  4M9L A;  4IRK A;  3RBD A;  5J0O A;  1BPE A;  4QWA A;  2AGQ A;  4PH5 A;  1BPX A;  1D8L A;  2I9G A;  4M9J A;  7ICS A;  3OJS A;  4F8R A;  3H8S A;  3PX0 A;  4GXJ A;  1ZQN A;  4J9P A;  4M2Y A;  1K1S A;  3PO4 A;  5J2G A;  3Q8S B;  5IIN A;  2BPC A;  4F92 B;  1ZQB A;  1QSL A;  7ICR A;  5J29 A;  5KG6 A;  4J9R A;  1WCL A;  4PHP A;  4DLG A;  5KG2 A;  3PV8 A;  1A76 A;  2PI5 A;  2B21 A;  1B43 A;  9ICS A;  1JIH A;  5J0Q A;  3KHG A;  1H38 A;  3SV4 A;  4ECY A;  4J9K A;  1N48 A;  8ICI A;  1TV9 A;  4YP3 A;  3RBE A;  5DBC A;  4YXJ A;  4XRH A;  4B9S A;  4ZH4 A;  4XA5 A;  5IIJ A;  5DLG A;  3RJH A;  1NJZ A;  3MFI A;  3SI8 A;  4Q44 A;  1TKD A;  4C8K A;  4M04 A;  8ICR A;  4DSI A;  2WTF A;  9ICK A;  1RPL A;  5KFH A;  3C5F A;  3JPS A;  3GDX A;  4HYK A;  3RB0 A;  2R8G A;  4QZF A;  4YVZ A;  1SL0 A;  3RJF A;  4K4H A;  2NRV A;  7ICQ A;  4ED1 A;  1ZQZ A;  3G6V A;  1A77 A;  3TAQ A;  2I1Q A;  5KFC A;  5KT7 A;  3BJY A;  5KFP A;  2ZJ8 A;  4PHA A;  1NK6 A;  1TAU A;  7ICV A;  4M6W A;  1L3S A;  4DQQ A;  4IQV A;  3MR5 A;  2FLL A;  7ICJ A;  4C8M A;  1QSY A;  4I2B A;  4TQR A;  3EW9 A;  1NKB A;  3HT3 A;  5KFU A;  2W9C B;  4NM1 A;  2JZB A;  4YN4 A;  1TAQ A;  3MR6 A;  1ZQD A;  1U48 A;  4C8O A;  5L1K A;  3ZD9 A;  1RYR A;  2ISO A;  5DGA A;  3B0Y A;  1Z00 B;  1JN3 A;  4IR9 A;  3ETL A;  4IQT A;  2V4R A;  3G6Y A;  5DBB A;  4F2R A;  7ICF A;  9ICV A;  1Y88 A;  5DGB A;  4M0A A;  5KG0 A;  4FS1 A;  5D46 A;  3HPO A;  2W9B B;  4RQ4 A;  1S10 A;  4Q8F A;  2FMP A;  4P4P A;  2KFZ A;  1WCN A;  4QZC A;  4I2I A;  1X9S A;  4Q45 A;  1BPZ A;  1IM4 A;  1JMS A;  3B0X A;  4IR1 A;  4FBT A;  4DL5 A;  3RH6 A;  1ZQS A;  4MFA A;  2ASL A;  4I2J A;  3IM1 A;  4E0D A;  4DQR A;  3PR4 A;  3H4B A;  1ZJM A;  4JV2 A;  2VAN A;  1ZQG A;  1S9F A;  4O5E A;  5KFX A;  2OWO A;  2JEI A;  3KHH A;  2J6U A;  5KFN A;  2J6T A;  3RJJ A;  1L3V A;  4RUA A;  1TK0 A;  3G6X A;  4B9L A;  3RAX A;  4M9H A;  9ICN A;  4ELV A;  4KLG A;  5HML A;  5DB8 A;  4GLX A;  5D49 A;  5KFS A;  2ALZ A;  7ICP A;  5CP2 A;  3PO5 A;  3EPG A;  3MBY A;  4DSF A;  3BQ1 A;  4F5Q A;  3BQT A;  9ICU A;  4IRC A;  4F2S A;  4QWC A;  5KFB A;  5KFR A;  4QZA A;  3GIM A;  3RRG A;  5DBA A;  4DSL A;  9ICB A;  4ECR A;  4YXM A;  3H8W A;  1ZQJ A;  2F1I A;  3TQ1 A;  2PI4 A;  3RJG A;  8ICC A;  8ICP A;  4ED6 A;  4TUP A;  4UAY A;  3C2K A;  3UQ2 A;  1KSP A;  4JUZ A;  4I2H A;  3GFK B;  3H8J A;  3MR3 A;  3RB3 A;  2FLP A;  8ICS A;  4DFP A;  2AU0 A;  1ZQU A;  4Q8E A;  4DSJ A;  4PHE A;  3UQ0 A;  4O3S A;  7ICH A;  4EZ9 A;  1ZET A;  4ELU A;  9ICI A;  5KT6 A;  4M9N A;  2NRX A;  4RQ1 A;  1QLN A;  4KLL A;  2AGP A;  4KN7 A;  8ICF A;  4JK1 A;  3GII A;  1KLN A;  3BQ0 A;  3GIL A;  4BWJ A;  2R8K A;  2MUT B;  4O3Q A;  4R63 A;  4I2A A;  1SL2 A;  4ED0 A;  5J2B A;  5J2D A;  5L1I A;  2VA8 A;  3SZ2 A;  1NK4 A;  1KTQ A;  5HHI A;  2W9A A;  2JEG A;  2KZ3 A;  2W9C A;  1NKE A;  3BDP A;  4BXO B;  4NLN A;  5TZV A;  3PML A;  7ICE A;  4O5K A;  4DF4 A;  5J0P A;  3T5H A;  2HHX A;  3OGU A;  4EYI B;  1DOQ A;  1NJY A;  5F9N A;  4J9O A;  3EZ5 A;  3C5G A;  7ICI A;  2ZTD A;  3LDA A;  4KLM A;  2ZUB A;  4DL2 A;  1JXL A;  5J2F A;  5KFQ A;  4J9M A;  3C1Y A;  4RQ0 A;  4ED8 A;  2W9B A;  4KMU A;  9ICM A;  3ISB A;  2UVW A;  2IHM A;  5KG1 A;  1V9P A;  7ICU A;  1ZQY A;  5KFL A;  1XS9 D;  4EZ6 A;  4O5C A;  3BQ2 A;  5KFT A;  1S76 D;  1UT8 A;  1T8E A;  4I2D A;  4BWM A;  4DFJ A;  3TAR A;  4QZB A;  5DQH A;  4ECX A;  1LV5 A;  4DQP A;  4DLE A;  1NK7 A;  4QZD A;  8ICN A;  2BR0 A;  4I2G A;  4B9M A;  4RQ7 A;  4UB3 A;  3ZDA A;  1KDH A;  4YMM A;  3UXO A;  4I28 A;  1CUK A;  4P4O A;  5III A;  5KG4 A;  4O0I A;  4R8U B;  4RNO A;  5HP4 A;  4KLU A;  2XCA A;  1S77 D;  1IXR A;  3TI0 A;  1NKC A;  4DS4 A;  5HHH A;  2XCP A;  1X9M A;  5F9L A;  4RPZ A;  3OJU A;  2C2R A;  2C28 A;  3PW2 A;  2HHU A;  4TUS A;  5DKW A;  5KFZ A;  4MF8 A;  4YG2 A;  4KLD A;  1S0N A;  2V4Q A;  1D9F A;  4YR2 A;  3UPQ A;  4QZG A;  3C1Z A;  3Q8Q B;  4RNM A;  7ICK A;  2UVR A;  4ECU A;  1Z3E B;  4TUR A;  2BKE A;  4J9L A;  2PFQ A;  4O9M A;  1L3U A;  1T3N A;  5J2J A;  3KHL A;  2XO7 A;  3MDC A;  3Q8K A;  4O3N A;  2VA3 A;  8ICL A;  3OHB A;  1X9W A;  5DG7 A;  1ZQH A;  4JV1 A;  7ICO A;  8ICU A;  1X2I A;  4R64 A;  2UVV A;  1UT5 A;  2ZUD A;  1XSL A;  2FPK A;  5HNK A;  4F5O A;  8ICH A;  4XUS A;  1ARO P;  2ZJA A;  9ICX A;  4TQS A;  4Z6E A;  2BCR A;  2F1H A;  2AGO A;  4C8N A;  3QE9 Y;  1S0V A;  3GV8 B;  2NRT A;  5KFV A;  2XGP A;  4J9S A;  4DF8 A;  1NJW A;  4QZ9 A;  3NTU A;  4MEX A;  4UB1 A;  2ATL A;  4Z6C A;  3V7J A;  2HVI A;  5KT5 A;  4ECT A;  4JV0 A;  1RXW A;  4KTQ A;  4M47 A;  3TAP A;  4IQU A;  4RQ3 A;  3PR5 B;  3GV5 B;  2C22 A;  3TAN A;  4J9Q A;  1ZQL A;  5J0W A;  1D9D A;  1U9L A;  5J0Y A;  4F4W A;  4DQS A;  4NXZ A;  3LWM A;  4LVS A;  7ICN A;  5CJ7 A;  1S97 A;  4UAZ A;  1XSN A;  3RJK A;  3QEB Z;  4BXO A;  3MFH A;  4DO9 A;  2BPF A;  1ZJN A;  4KLT A;  4QW8 A;  4QWB A;  1ZYQ A;  4FBU A;  4RQ2 A;  4F5R A;  2XY6 A;  5KFI A;  2PFP A;  8ICW A;  4RQ8 A;  3HWT A;  2NRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...