3N97B

Rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase sigma factor
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Thermus aquaticus
molecule tags Gene regulation/dna
total genus 21
structure length 75
sequence length 75
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3n97B00
5DQIA 3UQ0A 4M04A 1HUZA 2PXIA 3JPPA 1ZQBA 4I2IA 1U49A 1BPBA 4EBDA 2R8JA 3EZ5A 1UT5A 4ECWA 4KMUA 1NK9A 1RYSA 2FLPA 8ICLA 3RBEA 3Q8QB 4B9SA 7ICRA 1ZQXA 2DFLA 4ELUA 4M9GA 2R8KA 4J9LA 2W9CB 2VA2A 5J2JA 4ZH4A 5J0TA 5BOMA 3TFSA 4I29A 4UB1A 4Q43A 4JV1A 3Q8MA 3GV5B 2V4RA 4UB2A 3NTUA 5KG6A 2W9CA 4DOCA 4XRHA 2BCSA 2KZ3A 4ED7A 5KFKA 4TUSA 2XCPA 1BPXA 3UXPA 1S0OA 4YXMA 4ECZA 2C22A 1L5UA 3GFKB 5J2CA 5CJ7A 5J0YA 4QZ9A 5DKWA 5KFVA 3HX0A 5DLGA 5KT3A 4NM2A 3T3FA 9ICAA 4EZ9A 1AROP 4Q44A 4DO9A 2UVVA 4YMMA 3V7JA 2BQ3A 4O3PA 4F2RA 4I2EA 3RJKA 3QZ7A 4O5CA 9ICXA 4BXOB 1LV5A 4B9TA 4JWNA 5IIIA 4J9MA 1X9WA 3HW8A 4YFKA 3ISDA 4ED3A 5IINA 4PGQA 3THVA 5EWEA 4QZAA 3V7KA 4TUPA 1K1QA 8ICUA 4IQTA 1Z3EB 4KLIA 4RQ6A 5KG2A 7ICIA 2HHWA 1KFTA 3C2MA 4F4WA 1ZQVA 1ZETA 1X9SA 4DL6A 2KFZA 5DDYA 9ICIA 8ICNA 1MQ3A 1JX4A 4P4MA 4ELTA 1ZQCA 4IQVA 1C7YA 3JPQA 2C2EA 3OGUA 2FMSA 4EBCA 3T5HA 3ZDDA 3KHRA 3GIJA 3PMNA 3MABA 5KFUA 4G3IA 4F93B 9ICLA 2KZZA 4YG2A 5KT5A 2W8KA 2Y1JA 1IM4A 9ICKA 1A77A 2RDIA 4Q45A 4RQ0A 5CB1A 1DOQA 1ZQLA 3C5GA 4F50A 4ECVA 4DQRA 1SZPA 3UXNA 4O9MA 2BPFA 3C1ZA 5BOLA 1MSWD 8ICOA 4ECYA 3PW4A 1BPZA 3C1YA 3HWTA 9ICGA 3AUOA 1NKBA 2J6TA 3B0YA 4P2HA 4YD2A 2PFPA 1NJYA 9ICTA 1BGXT 2V4QA 2ASDA 3ORYA 3KHGA 4TQSA 4EBEA 4DFPA 4C8OA 1L3VA 3MR6A 1JXEA 3K4GA 8ICSA 3ZDEA 1KEJA 5DLFA 4RQ1A 1MC8A 3MDAA 5DBCA 5KFZA 4I28A 2F1HA 2F1IA 5DGBA 4KLFA 4ED0A 3M9NB 3OJUA 5L1KA 4ECRA 2FPMA 4DFKA 4YCXA 4ECTA 1ZQYA 4RUAA 4ECSA 4RNMA 3OHAA 1CEZA 1XU4A 3QEBZ 1SL2A 4I2AA 1S97A 4QW8A 5F9NA 5DG7A 2PFOA 5L9XA 5CP2A 5HMMA 1QSSA 4IR1A 3MBYA 1NJWA 3RJJA 3E2EA 3PNCA 4KLDA 3TANA 4NM1A 3RH4A 1SKWA 5DBAA 5L1LA 2R8GA 4NXZA 4QZHA 4QZFA 1ZQOA 3RH6A 3FYHA 7ICMA 4X5VA 9ICBA 4QW9A 9ICVA 5KG5A 5KG1A 8ICTA 4I2FA 3H8JA 1RZTA 4F5OA 2NRVA 2BPGA 2ALZA 4RQ3A 1TKDA 3ZDAA 1DGSA 5KFSA 3RAXA 4YXJA 3GV8B 3RJEA 3PO4A 2HHXA 2ATLA 4RQ4A 2AU0A 4XA5A 1XO1A 4F91B 3OJSA 1B43A 4F2SA 4DSIA 3OHBA 2HHVA 2BPCA 5IIJA 3PMLA 1SKSA 1QSLA 7ICGA 4IQWA 2ASLA 9ICHA 1ZQZA 5D46A 3EWAA 4GXIA 4DL7A 1Z00B 1ZQTA 4UB3A 3KHLA 4FS1A 3AU2A 5KFPA 2HHQA 1NKEA 4I2BA 4O0IA 1XSLA 1Z00A 3TI0A 3Q8PB 3C23A 4DF4A 3JPNA 2BCQA 4DSKA 4M9LA 2OWOA 8ICFA 8ICBA 1NJZA 4R64A 1HUOA 5EOZA 2PFQA 5F9LA 5IIOA 5CWRA 4KLOA 4YN4A 1JN3A 4PGYA 5J2GA 3ZD9A 3MFHA 1A76A 8ICZA 5IIKA 1U47A 1LB2B 4QWDA 2UVWA 4NLKA 5CR0A 3PX6A 3V6HA 4EEYA 4E0DA 9ICNA 4B9UA 5DB8A 4F5PA 3TARA 3PX4A 2ZJ8A 3MGIA 1ZJMA 4PHDA 4UBBA 3JPOA 1SL1A 4DS5A 3V7LA 2P6RA 3KTQA 3JPSA 4QZDA 2C2RA 5L1JA 4JUZA 4YP3A 5KG7A 3SZ2A 5J29A 1ZQKA 2ZTDA 4PGXA 1ZQHA 4Z6CA 2JEFA 5BPCA 3GIKA 3RAQA 9ICOA 7ICQA 4P4PA 3Q8KA 4DL2A 4ECXA 2C2DA 3M9MB 1JMSA 3RJHA 2BR0A 4C8KA 1D9FA 3RTVA 4ED1A 2BCRA 4O5EA 3H8SA 4C8LA 4KLMA 2Q0ZX 1S0NA 4BGDA 4J9KA 3SV4A 4GXKA 4BXOA 4KLHA 1ZQGA 3N97B 4IRDA 3GV7B 1BPYA 5TZVA 5J0XA 2GWSA 5KFAA 3RR7A 4MEXA 4C8NA 1H38A 4I2CA 1NK6A 4FS2A 1TK0A 4R65A 1SKRA 4I2HA 1V9PA 4MFAA 4KTQA 4PPXA 2JZBB 4F8RA 4F4ZA 2DPJA 4F5QA 2P66A 4ED2A 1U4BA 1XC9A 4I2JA 3M8SA 8ICWA 3ISBA 2DPIA 2IHMA 4M9HA 4J9RA 4F5RA 4M0AA 1S0VA 3TAQA 1B22A 1BVSA 2M9NA 3ZDBA 4BWMA 5KFGA 4KLJA 3PY8A 4DQPA 4C8MA 3PR5B 2IHNA 1TV9A 5J0QA 1ZQIA 4YD1A 5J2FA 4TQRA 3RJIA 7ICPA 1T8EA 1D9DA 2UVUA 4KLUA 4DF8A 3ETLA 4RPZA 4HYKA 1ZYQA 1TAQA 1ZQDA 2BCVA 3C5FA 1K1SA 5KFQA 4DSJA 1D8LA 4Q8FA 1ZQWA 2HHTA 2W9BB 5L1IA 1ZQNA 3H8WA 4UB4A 7ICJA 4Q8EA 3TQ1A 2J6UA 9ICRA 8ICCA 4B9MA 3JPTA 3RB3A 3RB4A 4QWCA 3ISCA 4O3SA 3IM1A 4DQQA 1QSYA 2V9WA 1ZQJA 4XUSA 4YQWA 3C2LA 2NRWA 4ED6A 2JEIA 2XGQA 8ICIA 2AGQA 7ICEA 1ZQRA 4F4KA 3UQ2A 2BQRA 1U48A 5KT7A 5DQHA 2PI4A 3NGDA 5KFTA 4J9PA 4YR3A 4DL3A 1WCLA 1NK5A 1RYRA 4QZCA 5KFRA 3PW0A 1TVAA 4Z6FA 3MR2A 1L3SA 8ICJA 2F1JA 4NLZA 2BKEA 3QEAZ 4R66A 1T4GA 1ZQSA 5DB9A 4PH5A 5J0PA 3PR4A 2AQ4A 9ICUA 2A1JB 4JK1A 9ICPA 4PHPA 2XY7A 3B0XA 2HVIA 5DB6A 9ICEA 4J9OA 1TK8A 3TFRA 8ICPA 3LDAA 5KFIA 3T5JA 2ZTCA 5KFDA 3RJGA 1PZNA 4Z6EA 4RUCA 4DWIA 1X9MA 3V72A 4O3OA 2LYHA 1KSPA 3RJFA 7ICSA 3EW9A 5KFXA 4QZEA 4UAZA 4I2DA 5IILA 1BPEA 1JXLA 4K4HA 2ISOA 4ECUA 2H5XA 1TFRA 4M47A 4RPXA 5KFCA 3BQ2A 4GC6A 3C21A 2XGPA 2XY5A 2ZTEA 3PW7A 1NJXA 3BQTA 4UAWA 2P6UA 4RQ2A 4YR2A 1NK4A 4RQ8A 4YMOA 2VANA 4UB5A 1CUKA 4DLEA 2VA8A 5DDMA 1HJPA 4KN4A 1NKCA 4M9JA 4ECQA 2PI5A 4R8UB 4M6WB 3BQ0A 5HHIA 3HT3A 5KT4A 2WTFA 3UPQA 8ICRA 2B21A 8ICAA 4UAYA 1SL0A 4YVZA 5DQGA 4KLQA 1S0MA 1KFDA 2ZUDA 5JUMA 3H4DA 2FPLA 3GILA 5C5JA 4DLGA 4KN7A 4J9NA 1KDHA 4RPYA 4Z6DA 1T3NA 2NRTA 4KLGA 4DSEA 4DL4A 4RQ5A 3BJYA 4IQUA 5D49A 3GIIA 2ASJA 1XSPA 2J6SA 3G6YA 3SYZA 3GQCA 2JEGA 2KN7A 3BQ1A 1N48A 4KLSA 1XWLA 5J2DA 2R8IA 2PFNA 4JWMA 7ICFA 7ICKA 2XO7A 3Q8SB 3G6VA 2BHNA 1TAUA 4TURA 7ICVA 5EWFA 3H40A 1NOMA 2W9MA 4FO6A 1ZJNA 2IBKA 4RT3A 4F3OA 2C28A 2BDPA 4O3NA 4MF2A 2NRZA 4BWJA 8ICXA 2FLLA 3EYZA 3RB0A 5KG3A 2FMPA 2XY6A 3C2KA 4GXJA 4LVSA 5HMLA 4ED8A 3T5LA 4FBTA 3Q8RB 3N4MB 1ZQQA 4DOBA 2UVRA 4QWBA 5J2AA 4RNOA 2VA3A 3PVXA 4DEZA 9ICCA 5DG9A 7ICHA 4EYIB 3BDPA 2MUTB 3ZD8A 5J0OA 5DB7A 4FBUA 4JV2A 1COOA 3MR3A 2ZUCA 4DFJA 5J2KA 1ZQFA 4B9LA 1UA1A 5J0UA 4K4IA 3H7IA 8ICMA 5HP4A 3KHHA 2HHUA 2JZBA 5CA7A 4MFCA 2MUTA 5KG4A 1ZQMA 4LZGA 4RU9A 3PX0A 2BGWA 1ZQPA 1L3UA 3LWMA 1NK8A 1RPLA 3FDSA 1IXRA 1TK5A 4DQIA 2I1QA 5IIMA 1XSNA 4TUQA 2AGOA 9ICSA 3T5KA 5KFMA 3UXOA 1UA0A 2JEJA 2IA6A 4ELVA 5KFOA 4F4YA 3QE9Y 3EPGA 4DQSA 4DSLA 5KTQA 4GC7A 2XCAA 1BPDA 1EXNA 1NK7A 3ZDCA 7ICUA 7ICTA 2NRXA 3K75D 5HHHA 4EYHB 4RQ7A 4F4XA 3V6JA 2R8HA 4O3RA 2HHSA 5J2IA 4K4GA 2BQUA 4KLEA 4YMNA 5KFHA 4DS4A 5KFFA 9ICJA 2W9BA 5KT2A 4IRKA 4PHEA 3RH5A 2AJQA 8ICEA 2KTQA 1RXVA 3SV3A 4NLGA 1KLNA 9ICQA 4CCHA 5KFYA 4BDPA 1X2IA 1XS9D 4QZIA 3JPRA 3EPIA 1NK0A 1QTMA 4R63A 1ZQAA 4O5KA 4QZ8A 8ICYA 4QWEA 4NLNA 5J2EA 3M9OB 3GIMA 5J0RA 5KFNA 4UBCA 5CHGA 4QWAA 3LWLA 1Y88A 4MFFA 4QZGA 1QLNA 4RNNA 3RRHA 4DFMA 4LZDA 2AGPA 3H4BA 3PW2A 3G6XA 4PHAA 2Y1IA 1U45A 4MEYA 1S10A 5KFBA 4YR0A 3MGHA 3RB6A 3OSPA 4KITB 3HPOA 8ICKA 5J0WA 3MR5A 1N56A 3RRGA 3M8RA 2A1JA 3TAPA 2AQ0A 4EZ6A 5DGAA 3MDCA 2IMWP 2FMQA 4IR9A 5KFWA 4XQ8A 5J0SA 1WCNA 4O3QA 4F92B 4B9VA 8ICHA 4I2GA 4UQGA 3PV8A 1S76D 3HP6A 3SI8A 3V6KA 5KFJA 3OSNA 1MQ2A 8ICVA 1ZQEA 2ZJ5A 9ICFA 4P4OA 4GLXA 1UT8A 5KG0A 4DOAA 4RT2A 9ICMA 4QZBA 4B9NA 3PO5A 3MFIA 2BCUA 2KZMA 5KT6A 5J2HA 5EWGA 1JIHA 4I27A 3PW5A 2W9AA 3RBDA 2FLNA 2I9GA 2ISPA 3GDXA 1S77D 2HVHA 5HNKA 3IHQB 4RZRA 2KFNA 8ICGA 1RXWA 1U9LA 4NY8A 8ICQA 3Q8LA 4M2YA 2W8LA 2FPKA 2ZJAA 4MF8A 4J9QA 1L3TA 2RDJA 5KFEA 4DL5A 3QZ8A 2HW3A 4JV0A 5DBBA 1T7PA 1KTQA 1D8YA 2MAXA 2XC9A 4DSFA 5D4BA 4KLLA 4R8UA 5DG8A 4M6WA 5KFLA 3AU6A 7ICNA 1KFSA 4KLTA 7ICOA 9ICWA 1ZQUA 1S9FA 4IRCA 4M9NA 1KRPA 3LK9A 4J9SA 2ZUBA 4F5NA 7ICLA 3RR8A 5J2BA
chains in the Genus database with same CATH superfamily
4M04A 3CRXA 4I2IA 4F72A 2ZIWA 1RYSA 4BX9C 4B9SA 3AN1A 4EX6A 1WWUA 4J9LA 2W9CB 2VA2A 3TFSA 4UB1A 3NTUA 2I5HA 5J0YA 4QZ9A 5DKWA 1TE2A 5KT3A 4EZ9A 4Q44A 4DO9A 4YMMA 4F2RA 5AKJA 1IIPA 4O5CA 4B9TA 3PSFA 4QIWC 1X9WA 3THVA 5EWEA 3V7KA 5JTIA 4IQTA 2W3RA 5AM3A 5KG2A 1KFTA 2W11A 3IN5A 9ICIA 3F2DA 4IQVA 2H3IA 3OGUA 4EBCA 3IP4B 1PK3A 2JMGA 3LYSA 3I1YA 2BZFA 4RQ0A 3WKBA 4BJQA 4F50A 5BOLA 8ICOA 3PW4A 1BPZA 3C1YA 3AUOA 2J6TA 1XO0A 4P2HA 2PFPA 1KKXA 3PZPA 5ALLA 4EBEA 1VDVA 1L3VA 1JXEA 8ICSA 1RYUA 2LYAA 4RQ1A 5DBCA 2K4EA 2F1HA 2F1IA 4ED0A 2KV2A 3M9NB 3KOOA 4ECRA 4YCXA 4ECTA 4RNMA 3OHAA 1XU4A 1J2MA 1SV4A 3OTQA 3N7PD 1S97A 4QW8A 2B0CA 4PJ0U 5HMMA 3ICXA 4IR1A 1NJWA 3PNCA 3TANA 4NM1A 3RH4A 3AQFA 2DKZA 1CRXA 4QZFA 7ICMA 3RH6A 3SR6A 4KX3A 5A0LA 2E1EA 4F5OA 1ZRNA 2ALZA 3ZDAA 2KIVA 1DGSA 3RAXA 4YXJA 2EAPA 2NO5A 2AU0A 4XA5A 4F2SA 4CE6A 2HHVA 1Q46A 2EQYA 2BPCA 3PMLA 1QSLA 2QARB 4GXIA 2KKPA 5ALHA 3AQEA 1NNLA 3KHLA 4FS1A 3AU2A 5AI6A 1NKEA 2K8CB 5J8YA 2E8MA 3C23A 4DF4A 3F2BA 5IIOA 4YN4A 1A76A 5ALTA 1U47A 4UB6U 1VJ5A 3PX6A 4EEYA 3KBBA 5DB8A 3TARA 1ECWA 2GH1A 2ZJ8A 4UBBA 2P6RA 4YP3A 1ZQHA 4Z6CA 3BS5B 2WF7A 4NL9A 3WK5A 5JU5A 2OYYA 1UHUA 4USAA 4DL2A 2BR0A 4C8KA 4Y2UA 2D6FC 4KLHA 3CW2C 2W03A 2NO4A 4C8NA 1TK0A 4KTQA 4MFAA 2JZBB 2GO7A 3M8SA 4P0QA 1B0XA 3IG5A 1S0VA 4BWMA 5KFGA 1SIJA 3TKAA 4DQPA 2IHNA 5J2FA 7ICPA 2UVUA 2ZIUA 1N63A 3ETLA 2BCVA 3C5FA 4IS7A 1K1SA 5KFQA 4EELA 5L1IA 1N60A 1QQ7A 7ICJA 2J6UA 2HOQA 4B9MA 1LKYB 1RG6A 4DQQA 3C2LA 4ED6A 2XGQA 7ICEA 1ZQRA 5KT7A 3H0RB 5KFTA 2YN4A 2W04A 4Z6FA 4KMOB 1ZQSA 5J0PA 1T3QA 2AQ4A 4JK1A 5KAIU 3EUB2 3HKZC 1Z4OA 2HVIA 8ICPA 3LDAA 2Y9UA 5KFDA 3RJGA 4DWIA 2LYHA 7ICSA 4I2DA 3WK6A 5ALWA 2KSOA 4RPXA 4UAWA 4RQ2A 1NK4A 2PMZC 1N61A 1L8LA 1NI3A 4M9JA 4ECQA 4C80A 4R8UB 5KT4A 2B21A 5DQGA 1S0MA 3H4DA 4DLGA 1KDHA 4Z6DA 2F3NA 3KFUF 2NRTA 3DDHA 3GIIA 3S6JA 1XSPA 2ZXHA 1AQ6A 3BQ1A 2YB1A 3Q8SB 3G6VA 1TAUA 4TURA 7ICVA 4PZOA 5EWFA 4FO6A 2HBJA 5ALIA 2IBKA 4RT3A 8ICXA 3EYZA 2FMPA 2XY6A 5HMLA 4ED8A 4CF5A 4QWBA 5J2AA 3C28A 2I6XA 3WU2U 9ICCA 4P0PB 4EYIB 5J0OA 5DB7A 2DKXA 2L5YA 2ZUCA 1ZQFA 2W43A 3H7IA 3KHHA 4FZMA 4MFCA 2DUYA 3RF9A 1X40A 3PX0A 3FDSA 4DQIA 1XSNA 2AGOA 3T5KA 3UXOA 3WKAA 2IA6A 3HRDD 4DSLA 1UQVA 5FP0A 4GC7A 2CN1A 7ICUA 7ICTA 2NRXA 4EYHB 4KLEA 3QU9A 5AIAA 4DS4A 1N62A 2Q4TA 2YY6A 1RXVA 1KLNA 4QZIA 2XVTA 4R63A 4OJOA 3GIMA 5J0RA 5KFNA 4MFFA 1QLNA 2AGPA 5EE9A 3H4BA 1X66A 3A0HU 4NJ8A 4PHAA 2Y1IA 1U45A 2F44A 4YR0A 3MGHA 3HPOA 2E8PA 2A1JA 4C7YA 3C29A 4MHVA 3MDCA 2IMWP 2FMQA 3WK9A 2EAOA 4XQ8A 4F92B 4UQGA 8ICVA 1MQ2A 4P4OA 1SB3C 4B9NA 5J2HA 1JIHA 2EZYA 4RZRA 1RXWA 4NY8A 4U6PA 4EENA 2W8LA 3NRWA 1L3TA 2CRXA 1N5WA 2Y0SF 5C0YA 5KFEA 1KN5A 2F8LA 2HW3A 3TACB 4JV0A 1T7PA 1KTQA 1X6JA 2MAXA 4KLLA 2DBYA 5DG8A 4JMUA 3ETRA 2KK0A 7ICLA 3WK8A 1HUZA 4F71A 1ZQBA 3EZ5A 4ECWA 4KMUA 8ICLA 2DFLA 4ELUA 2R8KA 3L3FX 4Q43A 4JV1A 3Q8MA 3E0FA 5AK4A 2LYBA 4DOCA 2KZ3A 4ED7A 5KFKA 1BPXA 3UXPA 1SGGA 3GFKB 2XI9A 5CJ7A 5HR6A 5KFVA 5DLGA 4NM2A 2OHFA 5AK6A 9ICAA 3V7JA 4O3PA 3QZ7A 9ICXA 5IIIA 3HW8A 3ISDA 4ED3A 1JUDA 3SQIA 5K4LA 4IL6U 4TUPA 8ICUA 1QQ6A 3C2MA 5ALRA 4F4WA 4P0QB 1ZD3A 1X9SA 2KFZA 8ICNA 1JX4A 3JPQA 2JHDA 3ZDDA 3KHRA 3PMNA 4G3IA 2G5HB 9ICLA 5KT5A 2RDIA 4Q45A 2K4HA 4UW9A 3C5GA 2WFAA 1RQNA 2IOHA 4DQRA 1SZPA 2LBOA 3CP8A 2WF9A 3C1ZA 3N7RC 1MSWD 4ECYA 9ICGA 3B0YA 3NVZA 1BGXT 2V4QA 1SV0C 1V38A 2G5IB 3K4GA 1KEJA 1MC8A 3PSPA 5DGBA 2WAQC 4CF4A 5L1KA 2FPMA 1JI7A 5EE1A 1ZQYA 4ECSA 2NV3A 5H2FU 2ZIXA 3QX7A 1WG8A 1BNPA 3RJJA 4KLDA 3QXGA 4EX7A 2R8GA 4NXZA 2RLTA 1ZQOA 4DCCA 4X5VA 9ICVA 5KG5A 8ICTA 4I2FA 3H8JA 1RZTA 3F53A 4ICAA 1XNSA 3RJEA 3O0FA 3GV8B 3PSTA 1XO1A 2KSOB 1B43A 4DSIA 4UARA 2G07A 7ICGA 1DK2A 1Z19A 3EWAA 1Z00B 1X9XA 1ZQTA 4UB3A 4UAVA 4US9A 3UMBA 4O0IA 2B6GA 1XSLA 1UCVA 2BCQA 4J03A 4DSKA 2OWOA 4M9LA 3D2SA 8ICFA 4R64A 5EOZA 5JRTA 3I76A 4JB3A 4NLKA 2FDRA 2K8AA 9ICNA 4B9UA 4F5PA 3PX4A 4PHDA 4C7ZA 3WK7A 2HI0A 5B66U 2OEHA 4QZDA 4PGXA 2JEFA 3GIKA 3RAQA 2HOFA 1F5SA 3NS1A 2C2DA 4AP9A 3FAHA 4O5EA 4ED1A 2BCRA 4GIBA 4KLMA 1SWVA 2Q0ZX 4Y2RA 1S0NA 1IG6A 4BXOA 1ZQGA 3N97B 2QB1A 5KFAA 4MEXA 5AK3A 4I2HA 1V9PA 5ALGA 4PPXA 4F4ZA 2DPJA 4F5QA 2P66A 1XC9A 3ISBA 1L7MA 2K8BB 2DPIA 1A0PA 4FZNA 1WUDA 1B22A 4KX5A 3ZDBA 4KLJA 4C8MA 3PR5B 2WHEA 1ZQIA 4EEKA 1ZYQA 1L7OA 2XIDA 1QQ5A 1ZQWA 2HHTA 2ZIVA 1ZQNA 1L7PA 3H8WA 4ZOHC 4Q8EA 3TQ1A 9ICRA 8ICCA 3JPTA 3RB4A 2KNJA 2JEIA 2NRWA 2R18A 2ES6A 1DRGA 1U48A 4J9PA 3ONNA 1NK5A 3PW0A 2QB0A 2KVSA 4OJ5A 1L3SA 5AK5A 4NLZA 4R66A 2A1JB 5L1MA 9ICPA 2XY7A 3H8MA 2AH5A 5ALUA 2MU2A 4Y2JA 1TK8A 5ALFA 3TFRA 5KFIA 3T5JA 4Z6EA 3IDWA 5ALZA 3V72A 4O3OA 1BPEA 1JXLA 1VLBA 5ALKA 3R9KA 2RQ5A 4Y2QA 4M47A 1KL9A 3RFAA 3BQ2A 4GC6A 3C21A 2E1FA 2XGPA 2ZTEA 2XY5A 1NJXA 3BQTA 4YR2A 4RQ8A 4DLEA 2VA8A 1HJPA 1PK1A 4KN4A 1N2XA 4YVZA 3H0LB 4CDGA 5JUMA 4US8A 3L4PA 2MRLA 5AM0A 2DF4B 2LI6A 4J9NA 3N7SC 1TAMA 2JXJA 4RQ5A 3BJYA 4IQUA 3GQCA 2KEYA 1N48A 1XWLA 4JWMA 7ICFA 2XO7A 2KVCA 2W55A 2BHNA 5ALSA 3MGVA 4CF3A 1ZJNA 1NOMA 2W9MA 2BDPA 4MF2A 2NRZA 3GU3A 1FO4A 2FLLA 2WB1C 3RB0A 3CNHA 4DFDA 3C2KA 4FBTA 3T5LA 5AI4A 3Q8RB 3N4MB 4DOBA 3AMZA 2VA3A 4DEZA 2MUTB 5ALPA 2ZG6A 4DFJA 5AM5A 5J2KA 5J0UA 4K4IA 5HP4A 1Q3UA 5CA7A 1ZQMA 4LZGA 4RU9A 2BGWA 1ZQPA 1L3UA 1IXRA 2I1QA 2HMXA 1UA0A 3K1RB 4CGZA 1NK7A 3ZDCA 3SEIA 2KG5A 4AYBF 5AHXA 2BQUA 2AJQA 3SV3A 4CCHA 4BDPA 4OD0A 1X2IA 1S5LU 5J8YC 4O5KA 1M6YA 4QWEA 1L7NA 1IV8A 4QWAA 5CHGA 1Y88A 3RRHA 2WF5A 3PW2A 3QNMA 5KFBA 2WAQF 3LVWA 4Y2YA 3MR5A 3BZKA 5KFWA 3B9JA 4I2GA 3PV8A 3HP6A 4NL9C 3M7DA 5AI0A 5KFJA 4GFJA 9ICFA 1UT8A 2H3VA 2BCUA 2KZMA 1O08A 5EWGA 2BDUA 3PW5A 2W9AA 3RBDA 2FLNA 2ISPA 5HNKA 2FPKA 4MF8A 1ED1A 3QUCA 3M6ZA 4FZLA 2XC9A 4DSFA 3BZCA 7ICNA 1KFSA 9ICWA 3M1YA 1ZQUA 2YB4A 1COKA 2AHOB 2ZIWB 2E5SA 3RR8A 5DQIA 2HOIA 1KQQA 2PXIA 1U49A 4EBDA 2FLPA 1QCKA 2FI1A 1L8OA 3BS7A 4OJPA 4M9GA 5J2JA 5J0TA 1RDFA 3GV5B 3D2NA 2W9CA 2BCSA 2KKVA 2XCPA 1S0OA 4YXMA 4ECZA 2C22A 4UATA 1L5UA 3HX0A 4OJ6A 2ZXIA 2KIWA 1ZD2P 3TADA 1HEKA 2UVVA 2BQ3A 5GTHU 4B6JA 3WK4A 4I2EA 2KHVA 4BXOB 1LV5A 4JWNA 4QIWF 4RQNA 5IINA 2W7OA 2Y9TA 1Z3EB 4C4SA 4KLIA 4RQ6A 1V85A 2HHWA 3IG8A 1ZQVA 2RRDA 1ZETA 4DL6A 1MQ3A 4G9BA 4UASA 4P4MA 4ELTA 4OJLA 1C7YA 5AKLA 2C2EA 3MABA 2KZZA 2Y1JA 1IM4A 4Y2VA 9ICKA 4NLBA 1A77A 5EE0A 5CB1A 3NVWA 4NLCA 3WKCA 2ZIVB 2OXOA 1FFUA 4LJXA 2K89A 1NKBA 4YD2A 1NJYA 5B5EU 3VC8A 2ASDA 2G08A 3KHGA 3VCBA 3ZDEA 5DLFA 4WJ3B 2QB0B 3SD7A 2KJ9A 1L6NA 1CEZA 4I2AA 5F9NA 1NZPA 5L9XA 3MBYA 1CI4A 2JGAA 3SENA 3J81j 5HR7A 5L1LA 4QZHA 3FYHA 2H3QA 2KP7A 2BPGA 1TKDA 4RQ3A 3DV9A 2MA1A 5KFSA 3T79A 2O6KA 2HHXA 2ATLA 5G5GA 5CEHA 4RQ4A 4F91B 3F2CA 3SAHA 1ZOLA 5IIJA 1SKSA 4IQWA 1PK1B 2HBKA 4C0ZA 2K4IA 2QARA 2LM4A 3D6JA 3UMGA 4PL1A 3NASA 2G0AA 3JPNA 3K1ZA 8ICBA 4QNLA 1NJZA 5F9LA 2F8KA 4KLOA 3BQ7A 4PGYA 3MFHA 3ZD9A 3ZI4A 3L5KA 5IIKA 1LB2B 4QWDA 1PUZA 5CR0A 1KW4A 1ZJMA 4Y2PA 3JPOA 2YMMA 5ALYA 1SL1A 2GOLA 3V7LA 2N1RA 4DS5A 3KTQA 3JPSA 2YMLA 1D8BA 4JUZA 5KG7A 2EH9A 9ICOA 1JMSA 3RJHA 3BS5A 3H8SA 4Y2XA 4C8LA 2D8CA 1DXSA 4J9KA 3SV4A 4GXKA 4IRDA 3QU2A 3GV7B 1BPYA 2GWSA 3RR7A 2KE7A 4I2CA 1NK6A 3FC4A 1OXJA 2OM6A 1SKRA 1Q8KA 4F8RA 8ICWA 2IHMA 4M9HA 4J9RA 4F5RA 3F5AA 3TAQA 1BVSA 2M9NA 2ZIUB 1ZRMA 3PY8A 1TV9A 5J0QA 4YD1A 3RJIA 1T8EA 1D9DA 4KLUA 1DGJA 4DF8A 4HYKA 1RM6C 2YMPA 2VJ4A 1D8LA 5AI5A 4Q8FA 3QYPA 5ALQA 4O3SA 4QWCA 3ISCA 4XUSA 4YQWA 8ICIA 2KMDA 2AGQA 3LVVA 4F4KA 3UQ2A 2BQRA 1LKYA 1ZXIA 2PI4A 3I28A 3NGDA 4YR3A 1RYRA 3MR2A 8ICJA 2F1JA 2BKEA 5DB9A 4PH5A 2EDUA 5AI9A 3PR4A 4CNQA 9ICUA 4PHPA 5ALOA 3HKZF 2E8NA 9ICEA 5DB6A 5T14A 1PZNA 1X9MA 3KKAC 2EZZA 1QH9A 2HSZA 3EW9A 5KFXA 4QZEA 5IILA 5G5HA 2ISOA 2H5XA 1TFRA 4NV0A 2OH2A 5KFCA 3PW7A 3QUBA 2PMZF 2P6UA 4QJFB 4PZNA 4YMOA 1CUKA 4OCZA 5HHIA 1MN8A 4CRXA 4UAYA 1SL0A 2KJ8A 1KFDA 2ZUDA 2EAMA 5C5JA 2K60A 1SWWA 2EZXA 2EANA 2JH1A 1T3NA 4DSEA 1OW5A 5D49A 2QKQA 2J6SA 1J97A 3G6YA 3SYZA 2JEGA 2R8IA 2PFNA 2W7PA 1PVPA 4O3NA 3QU4A 2AXTU 4GXJA 1ZQQA 2UVRA 3N28A 2Z7JA 5DG9A 3BDPA 3ZD8A 3FM9A 2JR5A 4FBUA 3MR3A 4B9LA 8ICMA 4P0PA 2QLTA 3NVVA 4BUGA 5AM2A 2F77X 2KD1A 1TK5A 5IIMA 4TUQA 5KFMA 2JEJA 5AIBA 5AM4A 5KFOA 2CXYA 4F4YA 3QE9Y 4DQSA 5KTQA 1HIWA 1EXNA 1BPDA 3K75D 5HHHA 3NUQA 1N5XA 4F4XA 2A19A 2HHSA 4K4GA 5KFHA 5KFFA 9ICJA 2W9BA 5KT2A 3RH5A 8ICEA 5KFYA 1O03A 3EPIA 1NK0A 1ZQAA 4QZ8A 4NLNA 5J2EA 4UBCA 4RNNA 4LZDA 3SAFA 3QUQA 3G6XA 1S10A 3RB6A 3OSPA 1A6SA 8ICKA 5J0WA 1N56A 3RRGA 2AQ0A 4EZ6A 2IOFA 4ACOA 4FE3A 3SMVA 1WCNA 4B9VA 3SI8A 3V6KA 3OSNA 1JRPA 1ZQEA 1RQLA 3NRZA 4RQMA 3PSIA 4DOAA 4RT2A 3H0MB 9ICMA 5KT6A 2XICA 4I27A 2I9GA 1S77D 1ZD5A 2HVHA 3WKDA 2W3SA 1UPHA 1PVRA 1U9LA 3DEEA 4M2YA 4J9QA 2RDJA 4DL5A 2Y0SC 5EE3A 5DBBA 3HJEA 2WF6A 4M6WA 5KFLA 1P7DA 2IOFK 1Z4NA 4IRCA 1S9FA 4M9NA 3LK9A 4J9SA 2ZUBA 4F5NA 5CRXA 5J2BA 3UQ0A 3JPPA 1BPBA 2R8JA 1UT5A 1NK9A 5ALDA 3RBEA 3Q8QB 7ICRA 1ZQXA 5AKZA 4ZH4A 5BOMA 4I29A 1WWVA 3KZXA 1X6IA 2V4RA 4UB2A 1V97A 5KG6A 4XRHA 2YTUA 4TUSA 2LHTA 3HILA 5J2CA 5GTIU 3T3FA 1AROP 3RJKA 4Y2TA 4J9MA 3F5EA 2P35A 4YFKA 4PGQA 3NVYA 4IC9A 4QZAA 4UAUA 1K1QA 2YX8A 1C20A 7ICIA 2LKYA 5DDYA 2DL0A 2W54A 1ZQCA 1K5OA 2FMSA 2PKEA 5ALJA 3T5HA 3GIJA 5KFUA 4F93B 1SXDA 4YG2A 2W8KA 1DOQA 1ZQLA 1Z1VA 4ECVA 3UXNA 4O9MA 2BPFA 1FIQA 5ALMA 3HWTA 5AM1A 9ICTA 1YT3A 3ORYA 4TQSA 4C8OA 4DFPA 3MR6A 2LPEA 4FFDA 3MDAA 5KFZA 4I28A 4KLFA 2ZIXB 3OJUA 2HBLA 4DFKA 1J2NA 4RUAA 3QEBZ 3SAGA 1SL2A 2PFOA 5DG7A 4UB8U 5CP2A 1QSSA 3E2EA 1SKWA 5DBAA 1KBUA 5F3XB 9ICBA 4QW9A 5KG1A 2G09A 1JALA 2NRVA 3WKEA 3D2QA 5ALVA 3PO4A 1F0MA 3OJSA 3OHBA 2ASLA 9ICHA 1ZQZA 1BNOA 5D46A 3AL0B 4DL7A 3AM9A 5KFPA 2K4PA 2HHQA 4I2BA 1Z00A 2CPRA 3Q8PB 3TI0A 1URJA 2VIXA 2PFQA 1HUOA 5CWRA 1JN3A 2DQNB 1X42A 5J2GA 2KICA 8ICZA 2UVWA 2LM1A 5ALXA 3V6HA 4E0DA 3MGIA 5KL8B 1ZD4A 2F76X 5E79U 2C2RA 2M0NA 5L1JA 1ZQKA 5ALEA 5J29A 3SZ2A 2ZTDA 5BPCA 2GLEA 7ICQA 4P4PA 3Q8KA 4ECXA 3M9MB 1D9FA 3RTVA 2HBMA 3IRUA 4BGDA 1ZQ1C 5AKIA 5TZVA 2D3DA 2LMRA 5J0XA 3OPXA 1H38A 4FS2A 4R65A 2A1AA 4ED2A 1U4BA 2E3TA 4I2JA 1T94A 2DGZA 1LVHA 4M0AA 3ALRA 2E8OA 1MA7A 2VKQA 1SZHA 4TQRA 4RPZA 1ZQDA 1TAQA 1NZBA 5AKXA 4DSJA 2W9BB 4UB4A 2NYVA 4HAIA 1FEZA 3RB3A 1YZ6A 3IM1A 1QSYA 2V9WA 1ZQJA 5KNIA 3CYMA 2JRZA 5DQHA 4DL3A 1WCLA 4QZCA 5KFRA 1TVAA 2JV3A 3AEVA 2KOBA 5AKYA 2ESEA 2KHQA 3QEAZ 1T4GA 1PVQA 1YZ7A 3B0XA 4J9OA 2JH7A 2ZTCA 4RUCA 5AKGA 3TADC 1KSPA 3RJFA 4UAZA 3QU5A 4K4HA 3A0BU 5KAFU 4ECUA 1F44A 4U7CA 2ODGA 2VANA 4UB5A 2FJ6A 1NKCA 5DDMA 4O3MA 2PI5A 4M6WB 3BQ0A 3HT3A 2WTFA 3UPQA 8ICRA 5TISU 8ICAA 2RP5A 4KLQA 2FPLA 3M6KA 1SV0A 3GILA 4OO1J 4KN7A 5AKHA 4RPYA 4KLGA 1JROA 2F2AB 5AI8A 4DL4A 2HCFA 2ASJA 2KN7A 5AICA 4C4TA 4KLSA 5J2DA 7ICKA 3H40A 3UM9A 4F3OA 2C28A 3ED5A 2VJ5A 2H3FA 4BWJA 1DK3A 2WB1F 3GZFA 5KG3A 4LVSA 4RNOA 3PVXA 2KJ5A 3KKAA 7ICHA 1GO3F 1SXEA 4JV2A 1COOA 2MSNA 1UA1A 2HHUA 2JZBA 2MUTA 5KG4A 3IV6A 1Z1BA 3LWMA 1NK8A 1RPLA 9ICSA 4ELVA 3EPGA 2XCAA 1WYGA 2H3ZA 4RQ7A 4C4RA 3KZIU 4A8EA 3V6JA 4AYBC 3QUTA 2R8HA 4O3RA 3MC1A 5J2IA 3E58A 4YMNA 4IRKA 4Y2SA 4PHEA 2KTQA 2G06A 4NLGA 9ICQA 1XS9D 3JPRA 1FFVA 1QTMA 8ICYA 3M9OB 3LWLA 4QZGA 2OCEA 1S8OA 3QU7A 4DFMA 5AKKA 2DWQA 1OUQA 5KL1B 4MEYA 4KITB 3KD3A 3M8RA 3TAPA 5DGAA 4IR9A 5J0SA 8ICHA 4O3QA 1S76D 2YQEA 2ZJ5A 4GLXA 5ALNA 5KG0A 4QZBA 3PO5A 2YMQA 3MFIA 2A3VA 3U26A 1Q3VA 3GDXA 2FE9A 3IHQB 2KFNA 8ICGA 8ICQA 3Q8LA 4NWIA 2ZJAA 2HDOA 3QZ8A 1D8YA 5D4BA 5AKEA 4R8UA 3AU6A 7ICOA 4KLTA 4PL2A 1KRPA 2RHFA 3UMCA 1B4FA 2WF8A
chains in the Genus database with same CATH topology
5DQIA 3UQ0A 4M04A 1HUZA 2PXIA 3JPPA 1ZQBA 4I2IA 1U49A 1BPBA 4EBDA 2R8JA 3EZ5A 1UT5A 4ECWA 4KMUA 1NK9A 1RYSA 2FLPA 8ICLA 3RBEA 3Q8QB 4B9SA 7ICRA 1ZQXA 2DFLA 4ELUA 4M9GA 2R8KA 4J9LA 2W9CB 2VA2A 5J2JA 4ZH4A 5J0TA 5BOMA 3TFSA 4I29A 4UB1A 4Q43A 4JV1A 3Q8MA 3GV5B 2V4RA 4UB2A 3NTUA 5KG6A 2W9CA 4DOCA 4XRHA 2BCSA 2KZ3A 4ED7A 5KFKA 4TUSA 2XCPA 1BPXA 3UXPA 1S0OA 4YXMA 4ECZA 2C22A 1L5UA 3GFKB 5J2CA 5CJ7A 5J0YA 4QZ9A 5DKWA 5KFVA 3HX0A 5DLGA 5KT3A 4NM2A 3T3FA 9ICAA 4EZ9A 1AROP 4Q44A 4DO9A 2UVVA 4YMMA 3V7JA 2BQ3A 4O3PA 4F2RA 4I2EA 3RJKA 3QZ7A 4O5CA 9ICXA 4BXOB 1LV5A 4B9TA 4JWNA 5IIIA 4J9MA 1X9WA 3HW8A 4YFKA 3ISDA 4ED3A 5IINA 4PGQA 3THVA 5EWEA 4QZAA 3V7KA 4TUPA 1K1QA 8ICUA 4IQTA 1Z3EB 4KLIA 4RQ6A 5KG2A 7ICIA 2HHWA 1KFTA 3C2MA 4F4WA 1ZQVA 1ZETA 1X9SA 4DL6A 2KFZA 5DDYA 9ICIA 8ICNA 1MQ3A 1JX4A 4P4MA 4ELTA 1ZQCA 4IQVA 1C7YA 3JPQA 2C2EA 3OGUA 2FMSA 4EBCA 3T5HA 3ZDDA 3KHRA 3GIJA 3PMNA 3MABA 5KFUA 4G3IA 4F93B 9ICLA 2KZZA 4YG2A 5KT5A 2W8KA 2Y1JA 1IM4A 9ICKA 1A77A 2RDIA 4Q45A 4RQ0A 5CB1A 1DOQA 1ZQLA 3C5GA 4F50A 4ECVA 4DQRA 1SZPA 3UXNA 4O9MA 2BPFA 3C1ZA 5BOLA 1MSWD 8ICOA 4ECYA 3PW4A 1BPZA 3C1YA 3HWTA 9ICGA 3AUOA 1NKBA 2J6TA 3B0YA 4P2HA 4YD2A 2PFPA 1NJYA 9ICTA 1BGXT 2V4QA 2ASDA 3ORYA 3KHGA 4TQSA 4EBEA 4DFPA 4C8OA 1L3VA 3MR6A 1JXEA 3K4GA 8ICSA 3ZDEA 1KEJA 5DLFA 4RQ1A 1MC8A 3MDAA 5DBCA 5KFZA 4I28A 2F1HA 2F1IA 5DGBA 4KLFA 4ED0A 3M9NB 3OJUA 5L1KA 4ECRA 2FPMA 4DFKA 4YCXA 4ECTA 1ZQYA 4RUAA 4ECSA 4RNMA 3OHAA 1CEZA 1XU4A 3QEBZ 1SL2A 4I2AA 1S97A 4QW8A 5F9NA 5DG7A 2PFOA 5L9XA 5CP2A 5HMMA 1QSSA 4IR1A 3MBYA 1NJWA 3RJJA 3E2EA 3PNCA 4KLDA 3TANA 4NM1A 3RH4A 1SKWA 5DBAA 5L1LA 2R8GA 4NXZA 4QZHA 4QZFA 1ZQOA 3RH6A 3FYHA 7ICMA 4X5VA 9ICBA 4QW9A 9ICVA 5KG5A 5KG1A 8ICTA 4I2FA 3H8JA 1RZTA 4F5OA 2NRVA 2BPGA 2ALZA 4RQ3A 1TKDA 3ZDAA 1DGSA 5KFSA 3RAXA 4YXJA 3GV8B 3RJEA 3PO4A 2HHXA 2ATLA 4RQ4A 2AU0A 4XA5A 1XO1A 4F91B 3OJSA 1B43A 4F2SA 4DSIA 3OHBA 2HHVA 2BPCA 5IIJA 3PMLA 1SKSA 1QSLA 7ICGA 4IQWA 2ASLA 9ICHA 1ZQZA 5D46A 3EWAA 4GXIA 4DL7A 1Z00B 1ZQTA 4UB3A 3KHLA 4FS1A 3AU2A 5KFPA 2HHQA 1NKEA 4I2BA 4O0IA 1XSLA 1Z00A 3TI0A 3Q8PB 3C23A 4DF4A 3JPNA 2BCQA 4DSKA 4M9LA 2OWOA 8ICFA 8ICBA 1NJZA 4R64A 1HUOA 5EOZA 2PFQA 5F9LA 5IIOA 5CWRA 4KLOA 4YN4A 1JN3A 4PGYA 5J2GA 3ZD9A 3MFHA 1A76A 8ICZA 5IIKA 1U47A 1LB2B 4QWDA 2UVWA 4NLKA 5CR0A 3PX6A 3V6HA 4EEYA 4E0DA 9ICNA 4B9UA 5DB8A 4F5PA 3TARA 3PX4A 2ZJ8A 3MGIA 1ZJMA 4PHDA 4UBBA 3JPOA 1SL1A 4DS5A 3V7LA 2P6RA 3KTQA 3JPSA 4QZDA 2C2RA 5L1JA 4JUZA 4YP3A 5KG7A 3SZ2A 5J29A 1ZQKA 2ZTDA 4PGXA 1ZQHA 4Z6CA 2JEFA 5BPCA 3GIKA 3RAQA 9ICOA 7ICQA 4P4PA 3Q8KA 4DL2A 4ECXA 2C2DA 3M9MB 1JMSA 3RJHA 2BR0A 4C8KA 1D9FA 3RTVA 4ED1A 2BCRA 4O5EA 3H8SA 4C8LA 4KLMA 2Q0ZX 1S0NA 4BGDA 4J9KA 3SV4A 4GXKA 4BXOA 4KLHA 1ZQGA 3N97B 4IRDA 3GV7B 1BPYA 5TZVA 5J0XA 2GWSA 5KFAA 3RR7A 4MEXA 4C8NA 1H38A 4I2CA 1NK6A 4FS2A 1TK0A 4R65A 1SKRA 4I2HA 1V9PA 4MFAA 4KTQA 4PPXA 2JZBB 4F8RA 4F4ZA 2DPJA 4F5QA 2P66A 4ED2A 1U4BA 1XC9A 4I2JA 3M8SA 8ICWA 3ISBA 2DPIA 2IHMA 4M9HA 4J9RA 4F5RA 4M0AA 1S0VA 3TAQA 1B22A 1BVSA 2M9NA 3ZDBA 4BWMA 5KFGA 4KLJA 3PY8A 4DQPA 4C8MA 3PR5B 2IHNA 1TV9A 5J0QA 1ZQIA 4YD1A 5J2FA 4TQRA 3RJIA 7ICPA 1T8EA 1D9DA 2UVUA 4KLUA 4DF8A 3ETLA 4RPZA 4HYKA 1ZYQA 1TAQA 1ZQDA 2BCVA 3C5FA 1K1SA 5KFQA 4DSJA 1D8LA 4Q8FA 1ZQWA 2HHTA 2W9BB 5L1IA 1ZQNA 3H8WA 4UB4A 7ICJA 4Q8EA 3TQ1A 2J6UA 9ICRA 8ICCA 4B9MA 3JPTA 3RB3A 3RB4A 4QWCA 3ISCA 4O3SA 3IM1A 4DQQA 1QSYA 2V9WA 1ZQJA 4XUSA 4YQWA 3C2LA 2NRWA 4ED6A 2JEIA 2XGQA 8ICIA 2AGQA 7ICEA 1ZQRA 4F4KA 3UQ2A 2BQRA 1U48A 5KT7A 5DQHA 2PI4A 3NGDA 5KFTA 4J9PA 4YR3A 4DL3A 1WCLA 1NK5A 1RYRA 4QZCA 5KFRA 3PW0A 1TVAA 4Z6FA 3MR2A 1L3SA 8ICJA 2F1JA 4NLZA 2BKEA 3QEAZ 4R66A 1T4GA 1ZQSA 5DB9A 4PH5A 5J0PA 3PR4A 2AQ4A 9ICUA 2A1JB 4JK1A 9ICPA 4PHPA 2XY7A 3B0XA 2HVIA 5DB6A 9ICEA 4J9OA 1TK8A 3TFRA 8ICPA 3LDAA 5KFIA 3T5JA 2ZTCA 5KFDA 3RJGA 1PZNA 4Z6EA 4RUCA 4DWIA 1X9MA 3V72A 4O3OA 2LYHA 1KSPA 3RJFA 7ICSA 3EW9A 5KFXA 4QZEA 4UAZA 4I2DA 5IILA 1BPEA 1JXLA 4K4HA 2ISOA 4ECUA 2H5XA 1TFRA 4M47A 4RPXA 5KFCA 3BQ2A 4GC6A 3C21A 2XGPA 2XY5A 2ZTEA 3PW7A 1NJXA 3BQTA 4UAWA 2P6UA 4RQ2A 4YR2A 1NK4A 4RQ8A 4YMOA 2VANA 4UB5A 1CUKA 4DLEA 2VA8A 5DDMA 1HJPA 4KN4A 1NKCA 4M9JA 4ECQA 2PI5A 4R8UB 4M6WB 3BQ0A 5HHIA 3HT3A 5KT4A 2WTFA 3UPQA 8ICRA 2B21A 8ICAA 4UAYA 1SL0A 4YVZA 5DQGA 4KLQA 1S0MA 1KFDA 2ZUDA 5JUMA 3H4DA 2FPLA 3GILA 5C5JA 4DLGA 4KN7A 4J9NA 1KDHA 4RPYA 4Z6DA 1T3NA 2NRTA 4KLGA 4DSEA 4DL4A 4RQ5A 3BJYA 4IQUA 5D49A 3GIIA 2ASJA 1XSPA 2J6SA 3G6YA 3SYZA 3GQCA 2JEGA 2KN7A 3BQ1A 1N48A 4KLSA 1XWLA 5J2DA 2R8IA 2PFNA 4JWMA 7ICFA 7ICKA 2XO7A 3Q8SB 3G6VA 2BHNA 1TAUA 4TURA 7ICVA 5EWFA 3H40A 1NOMA 2W9MA 4FO6A 1ZJNA 2IBKA 4RT3A 4F3OA 2C28A 2BDPA 4O3NA 4MF2A 2NRZA 4BWJA 8ICXA 2FLLA 3EYZA 3RB0A 5KG3A 2FMPA 2XY6A 3C2KA 4GXJA 4LVSA 5HMLA 4ED8A 3T5LA 4FBTA 3Q8RB 3N4MB 1ZQQA 4DOBA 2UVRA 4QWBA 5J2AA 4RNOA 2VA3A 3PVXA 4DEZA 9ICCA 5DG9A 7ICHA 4EYIB 3BDPA 2MUTB 3ZD8A 5J0OA 5DB7A 4FBUA 4JV2A 1COOA 3MR3A 2ZUCA 4DFJA 5J2KA 1ZQFA 4B9LA 1UA1A 5J0UA 4K4IA 3H7IA 8ICMA 5HP4A 3KHHA 2HHUA 2JZBA 5CA7A 4MFCA 2MUTA 5KG4A 1ZQMA 4LZGA 4RU9A 3PX0A 2BGWA 1ZQPA 1L3UA 3LWMA 1NK8A 1RPLA 3FDSA 1IXRA 1TK5A 4DQIA 2I1QA 5IIMA 1XSNA 4TUQA 2AGOA 9ICSA 3T5KA 5KFMA 3UXOA 1UA0A 2JEJA 2IA6A 4ELVA 5KFOA 4F4YA 3QE9Y 3EPGA 4DQSA 4DSLA 5KTQA 4GC7A 2XCAA 1BPDA 1EXNA 1NK7A 3ZDCA 7ICUA 7ICTA 2NRXA 3K75D 5HHHA 4EYHB 4RQ7A 4F4XA 3V6JA 2R8HA 4O3RA 2HHSA 5J2IA 4K4GA 2BQUA 4KLEA 4YMNA 5KFHA 4DS4A 5KFFA 9ICJA 2W9BA 5KT2A 4IRKA 4PHEA 3RH5A 2AJQA 8ICEA 2KTQA 1RXVA 3SV3A 4NLGA 1KLNA 9ICQA 4CCHA 5KFYA 4BDPA 1X2IA 1XS9D 4QZIA 3JPRA 3EPIA 1NK0A 1QTMA 4R63A 1ZQAA 4O5KA 4QZ8A 8ICYA 4QWEA 4NLNA 5J2EA 3M9OB 3GIMA 5J0RA 5KFNA 4UBCA 5CHGA 4QWAA 3LWLA 1Y88A 4MFFA 4QZGA 1QLNA 4RNNA 3RRHA 4DFMA 4LZDA 2AGPA 3H4BA 3PW2A 3G6XA 4PHAA 2Y1IA 1U45A 4MEYA 1S10A 5KFBA 4YR0A 3MGHA 3RB6A 3OSPA 4KITB 3HPOA 8ICKA 5J0WA 3MR5A 1N56A 3RRGA 3M8RA 2A1JA 3TAPA 2AQ0A 4EZ6A 5DGAA 3MDCA 2IMWP 2FMQA 4IR9A 5KFWA 4XQ8A 5J0SA 1WCNA 4O3QA 4F92B 4B9VA 8ICHA 4I2GA 4UQGA 3PV8A 1S76D 3HP6A 3SI8A 3V6KA 5KFJA 3OSNA 1MQ2A 8ICVA 1ZQEA 2ZJ5A 9ICFA 4P4OA 4GLXA 1UT8A 5KG0A 4DOAA 4RT2A 9ICMA 4QZBA 4B9NA 3PO5A 3MFIA 2BCUA 2KZMA 5KT6A 5J2HA 5EWGA 1JIHA 4I27A 3PW5A 2W9AA 3RBDA 2FLNA 2I9GA 2ISPA 3GDXA 1S77D 2HVHA 5HNKA 3IHQB 4RZRA 2KFNA 8ICGA 1RXWA 1U9LA 4NY8A 8ICQA 3Q8LA 4M2YA 2W8LA 2FPKA 2ZJAA 4MF8A 4J9QA 1L3TA 2RDJA 5KFEA 4DL5A 3QZ8A 2HW3A 4JV0A 5DBBA 1T7PA 1KTQA 1D8YA 2MAXA 2XC9A 4DSFA 5D4BA 4KLLA 4R8UA 5DG8A 4M6WA 5KFLA 3AU6A 7ICNA 1KFSA 4KLTA 7ICOA 9ICWA 1ZQUA 1S9FA 4IRCA 4M9NA 1KRPA 3LK9A 4J9SA 2ZUBA 4F5NA 7ICLA 3RR8A 5J2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DQI A;  3UQ0 A;  4M04 A;  1HUZ A;  2PXI A;  3JPP A;  1ZQB A;  4I2I A;  1U49 A;  1BPB A;  4EBD A;  2R8J A;  3EZ5 A;  1UT5 A;  4ECW A;  4KMU A;  1NK9 A;  1RYS A;  2FLP A;  8ICL A;  3RBE A;  3Q8Q B;  4B9S A;  7ICR A;  1ZQX A;  2DFL A;  4ELU A;  4M9G A;  2R8K A;  4J9L A;  2W9C B;  2VA2 A;  5J2J A;  4ZH4 A;  5J0T A;  5BOM A;  3TFS A;  4I29 A;  4UB1 A;  4Q43 A;  4JV1 A;  3Q8M A;  3GV5 B;  2V4R A;  4UB2 A;  3NTU A;  5KG6 A;  2W9C A;  4DOC A;  4XRH A;  2BCS A;  2KZ3 A;  4ED7 A;  5KFK A;  4TUS A;  2XCP A;  1BPX A;  3UXP A;  1S0O A;  4YXM A;  4ECZ A;  2C22 A;  1L5U A;  3GFK B;  5J2C A;  5CJ7 A;  5J0Y A;  4QZ9 A;  5DKW A;  5KFV A;  3HX0 A;  5DLG A;  5KT3 A;  4NM2 A;  3T3F A;  9ICA A;  4EZ9 A;  1ARO P;  4Q44 A;  4DO9 A;  2UVV A;  4YMM A;  3V7J A;  2BQ3 A;  4O3P A;  4F2R A;  4I2E A;  3RJK A;  3QZ7 A;  4O5C A;  9ICX A;  4BXO B;  1LV5 A;  4B9T A;  4JWN A;  5III A;  4J9M A;  1X9W A;  3HW8 A;  4YFK A;  3ISD A;  4ED3 A;  5IIN A;  4PGQ A;  3THV A;  5EWE A;  4QZA A;  3V7K A;  4TUP A;  1K1Q A;  8ICU A;  4IQT A;  1Z3E B;  4KLI A;  4RQ6 A;  5KG2 A;  7ICI A;  2HHW A;  1KFT A;  3C2M A;  4F4W A;  1ZQV A;  1ZET A;  1X9S A;  4DL6 A;  2KFZ A;  5DDY A;  9ICI A;  8ICN A;  1MQ3 A;  1JX4 A;  4P4M A;  4ELT A;  1ZQC A;  4IQV A;  1C7Y A;  3JPQ A;  2C2E A;  3OGU A;  2FMS A;  4EBC A;  3T5H A;  3ZDD A;  3KHR A;  3GIJ A;  3PMN A;  3MAB A;  5KFU A;  4G3I A;  4F93 B;  9ICL A;  2KZZ A;  4YG2 A;  5KT5 A;  2W8K A;  2Y1J A;  1IM4 A;  9ICK A;  1A77 A;  2RDI A;  4Q45 A;  4RQ0 A;  5CB1 A;  1DOQ A;  1ZQL A;  3C5G A;  4F50 A;  4ECV A;  4DQR A;  1SZP A;  3UXN A;  4O9M A;  2BPF A;  3C1Z A;  5BOL A;  1MSW D;  8ICO A;  4ECY A;  3PW4 A;  1BPZ A;  3C1Y A;  3HWT A;  9ICG A;  3AUO A;  1NKB A;  2J6T A;  3B0Y A;  4P2H A;  4YD2 A;  2PFP A;  1NJY A;  9ICT A;  1BGX T;  2V4Q A;  2ASD A;  3ORY A;  3KHG A;  4TQS A;  4EBE A;  4DFP A;  4C8O A;  1L3V A;  3MR6 A;  1JXE A;  3K4G A;  8ICS A;  3ZDE A;  1KEJ A;  5DLF A;  4RQ1 A;  1MC8 A;  3MDA A;  5DBC A;  5KFZ A;  4I28 A;  2F1H A;  2F1I A;  5DGB A;  4KLF A;  4ED0 A;  3M9N B;  3OJU A;  5L1K A;  4ECR A;  2FPM A;  4DFK A;  4YCX A;  4ECT A;  1ZQY A;  4RUA A;  4ECS A;  4RNM A;  3OHA A;  1CEZ A;  1XU4 A;  3QEB Z;  1SL2 A;  4I2A A;  1S97 A;  4QW8 A;  5F9N A;  5DG7 A;  2PFO A;  5L9X A;  5CP2 A;  5HMM A;  1QSS A;  4IR1 A;  3MBY A;  1NJW A;  3RJJ A;  3E2E A;  3PNC A;  4KLD A;  3TAN A;  4NM1 A;  3RH4 A;  1SKW A;  5DBA A;  5L1L A;  2R8G A;  4NXZ A;  4QZH A;  4QZF A;  1ZQO A;  3RH6 A;  3FYH A;  7ICM A;  4X5V A;  9ICB A;  4QW9 A;  9ICV A;  5KG5 A;  5KG1 A;  8ICT A;  4I2F A;  3H8J A;  1RZT A;  4F5O A;  2NRV A;  2BPG A;  2ALZ A;  4RQ3 A;  1TKD A;  3ZDA A;  1DGS A;  5KFS A;  3RAX A;  4YXJ A;  3GV8 B;  3RJE A;  3PO4 A;  2HHX A;  2ATL A;  4RQ4 A;  2AU0 A;  4XA5 A;  1XO1 A;  4F91 B;  3OJS A;  1B43 A;  4F2S A;  4DSI A;  3OHB A;  2HHV A;  2BPC A;  5IIJ A;  3PML A;  1SKS A;  1QSL A;  7ICG A;  4IQW A;  2ASL A;  9ICH A;  1ZQZ A;  5D46 A;  3EWA A;  4GXI A;  4DL7 A;  1Z00 B;  1ZQT A;  4UB3 A;  3KHL A;  4FS1 A;  3AU2 A;  5KFP A;  2HHQ A;  1NKE A;  4I2B A;  4O0I A;  1XSL A;  1Z00 A;  3TI0 A;  3Q8P B;  3C23 A;  4DF4 A;  3JPN A;  2BCQ A;  4DSK A;  4M9L A;  2OWO A;  8ICF A;  8ICB A;  1NJZ A;  4R64 A;  1HUO A;  5EOZ A;  2PFQ A;  5F9L A;  5IIO A;  5CWR A;  4KLO A;  4YN4 A;  1JN3 A;  4PGY A;  5J2G A;  3ZD9 A;  3MFH A;  1A76 A;  8ICZ A;  5IIK A;  1U47 A;  1LB2 B;  4QWD A;  2UVW A;  4NLK A;  5CR0 A;  3PX6 A;  3V6H A;  4EEY A;  4E0D A;  9ICN A;  4B9U A;  5DB8 A;  4F5P A;  3TAR A;  3PX4 A;  2ZJ8 A;  3MGI A;  1ZJM A;  4PHD A;  4UBB A;  3JPO A;  1SL1 A;  4DS5 A;  3V7L A;  2P6R A;  3KTQ A;  3JPS A;  4QZD A;  2C2R A;  5L1J A;  4JUZ A;  4YP3 A;  5KG7 A;  3SZ2 A;  5J29 A;  1ZQK A;  2ZTD A;  4PGX A;  1ZQH A;  4Z6C A;  2JEF A;  5BPC A;  3GIK A;  3RAQ A;  9ICO A;  7ICQ A;  4P4P A;  3Q8K A;  4DL2 A;  4ECX A;  2C2D A;  3M9M B;  1JMS A;  3RJH A;  2BR0 A;  4C8K A;  1D9F A;  3RTV A;  4ED1 A;  2BCR A;  4O5E A;  3H8S A;  4C8L A;  4KLM A;  2Q0Z X;  1S0N A;  4BGD A;  4J9K A;  3SV4 A;  4GXK A;  4BXO A;  4KLH A;  1ZQG A;  3N97 B;  4IRD A;  3GV7 B;  1BPY A;  5TZV A;  5J0X A;  2GWS A;  5KFA A;  3RR7 A;  4MEX A;  4C8N A;  1H38 A;  4I2C A;  1NK6 A;  4FS2 A;  1TK0 A;  4R65 A;  1SKR A;  4I2H A;  1V9P A;  4MFA A;  4KTQ A;  4PPX A;  2JZB B;  4F8R A;  4F4Z A;  2DPJ A;  4F5Q A;  2P66 A;  4ED2 A;  1U4B A;  1XC9 A;  4I2J A;  3M8S A;  8ICW A;  3ISB A;  2DPI A;  2IHM A;  4M9H A;  4J9R A;  4F5R A;  4M0A A;  1S0V A;  3TAQ A;  1B22 A;  1BVS A;  2M9N A;  3ZDB A;  4BWM A;  5KFG A;  4KLJ A;  3PY8 A;  4DQP A;  4C8M A;  3PR5 B;  2IHN A;  1TV9 A;  5J0Q A;  1ZQI A;  4YD1 A;  5J2F A;  4TQR A;  3RJI A;  7ICP A;  1T8E A;  1D9D A;  2UVU A;  4KLU A;  4DF8 A;  3ETL A;  4RPZ A;  4HYK A;  1ZYQ A;  1TAQ A;  1ZQD A;  2BCV A;  3C5F A;  1K1S A;  5KFQ A;  4DSJ A;  1D8L A;  4Q8F A;  1ZQW A;  2HHT A;  2W9B B;  5L1I A;  1ZQN A;  3H8W A;  4UB4 A;  7ICJ A;  4Q8E A;  3TQ1 A;  2J6U A;  9ICR A;  8ICC A;  4B9M A;  3JPT A;  3RB3 A;  3RB4 A;  4QWC A;  3ISC A;  4O3S A;  3IM1 A;  4DQQ A;  1QSY A;  2V9W A;  1ZQJ A;  4XUS A;  4YQW A;  3C2L A;  2NRW A;  4ED6 A;  2JEI A;  2XGQ A;  8ICI A;  2AGQ A;  7ICE A;  1ZQR A;  4F4K A;  3UQ2 A;  2BQR A;  1U48 A;  5KT7 A;  5DQH A;  2PI4 A;  3NGD A;  5KFT A;  4J9P A;  4YR3 A;  4DL3 A;  1WCL A;  1NK5 A;  1RYR A;  4QZC A;  5KFR A;  3PW0 A;  1TVA A;  4Z6F A;  3MR2 A;  1L3S A;  8ICJ A;  2F1J A;  4NLZ A;  2BKE A;  3QEA Z;  4R66 A;  1T4G A;  1ZQS A;  5DB9 A;  4PH5 A;  5J0P A;  3PR4 A;  2AQ4 A;  9ICU A;  2A1J B;  4JK1 A;  9ICP A;  4PHP A;  2XY7 A;  3B0X A;  2HVI A;  5DB6 A;  9ICE A;  4J9O A;  1TK8 A;  3TFR A;  8ICP A;  3LDA A;  5KFI A;  3T5J A;  2ZTC A;  5KFD A;  3RJG A;  1PZN A;  4Z6E A;  4RUC A;  4DWI A;  1X9M A;  3V72 A;  4O3O A;  2LYH A;  1KSP A;  3RJF A;  7ICS A;  3EW9 A;  5KFX A;  4QZE A;  4UAZ A;  4I2D A;  5IIL A;  1BPE A;  1JXL A;  4K4H A;  2ISO A;  4ECU A;  2H5X A;  1TFR A;  4M47 A;  4RPX A;  5KFC A;  3BQ2 A;  4GC6 A;  3C21 A;  2XGP A;  2XY5 A;  2ZTE A;  3PW7 A;  1NJX A;  3BQT A;  4UAW A;  2P6U A;  4RQ2 A;  4YR2 A;  1NK4 A;  4RQ8 A;  4YMO A;  2VAN A;  4UB5 A;  1CUK A;  4DLE A;  2VA8 A;  5DDM A;  1HJP A;  4KN4 A;  1NKC A;  4M9J A;  4ECQ A;  2PI5 A;  4R8U B;  4M6W B;  3BQ0 A;  5HHI A;  3HT3 A;  5KT4 A;  2WTF A;  3UPQ A;  8ICR A;  2B21 A;  8ICA A;  4UAY A;  1SL0 A;  4YVZ A;  5DQG A;  4KLQ A;  1S0M A;  1KFD A;  2ZUD A;  5JUM A;  3H4D A;  2FPL A;  3GIL A;  5C5J A;  4DLG A;  4KN7 A;  4J9N A;  1KDH A;  4RPY A;  4Z6D A;  1T3N A;  2NRT A;  4KLG A;  4DSE A;  4DL4 A;  4RQ5 A;  3BJY A;  4IQU A;  5D49 A;  3GII A;  2ASJ A;  1XSP A;  2J6S A;  3G6Y A;  3SYZ A;  3GQC A;  2JEG A;  2KN7 A;  3BQ1 A;  1N48 A;  4KLS A;  1XWL A;  5J2D A;  2R8I A;  2PFN A;  4JWM A;  7ICF A;  7ICK A;  2XO7 A;  3Q8S B;  3G6V A;  2BHN A;  1TAU A;  4TUR A;  7ICV A;  5EWF A;  3H40 A;  1NOM A;  2W9M A;  4FO6 A;  1ZJN A;  2IBK A;  4RT3 A;  4F3O A;  2C28 A;  2BDP A;  4O3N A;  4MF2 A;  2NRZ A;  4BWJ A;  8ICX A;  2FLL A;  3EYZ A;  3RB0 A;  5KG3 A;  2FMP A;  2XY6 A;  3C2K A;  4GXJ A;  4LVS A;  5HML A;  4ED8 A;  3T5L A;  4FBT A;  3Q8R B;  3N4M B;  1ZQQ A;  4DOB A;  2UVR A;  4QWB A;  5J2A A;  4RNO A;  2VA3 A;  3PVX A;  4DEZ A;  9ICC A;  5DG9 A;  7ICH A;  4EYI B;  3BDP A;  2MUT B;  3ZD8 A;  5J0O A;  5DB7 A;  4FBU A;  4JV2 A;  1COO A;  3MR3 A;  2ZUC A;  4DFJ A;  5J2K A;  1ZQF A;  4B9L A;  1UA1 A;  5J0U A;  4K4I A;  3H7I A;  8ICM A;  5HP4 A;  3KHH A;  2HHU A;  2JZB A;  5CA7 A;  4MFC A;  2MUT A;  5KG4 A;  1ZQM A;  4LZG A;  4RU9 A;  3PX0 A;  2BGW A;  1ZQP A;  1L3U A;  3LWM A;  1NK8 A;  1RPL A;  3FDS A;  1IXR A;  1TK5 A;  4DQI A;  2I1Q A;  5IIM A;  1XSN A;  4TUQ A;  2AGO A;  9ICS A;  3T5K A;  5KFM A;  3UXO A;  1UA0 A;  2JEJ A;  2IA6 A;  4ELV A;  5KFO A;  4F4Y A;  3QE9 Y;  3EPG A;  4DQS A;  4DSL A;  5KTQ A;  4GC7 A;  2XCA A;  1BPD A;  1EXN A;  1NK7 A;  3ZDC A;  7ICU A;  7ICT A;  2NRX A;  3K75 D;  5HHH A;  4EYH B;  4RQ7 A;  4F4X A;  3V6J A;  2R8H A;  4O3R A;  2HHS A;  5J2I A;  4K4G A;  2BQU A;  4KLE A;  4YMN A;  5KFH A;  4DS4 A;  5KFF A;  9ICJ A;  2W9B A;  5KT2 A;  4IRK A;  4PHE A;  3RH5 A;  2AJQ A;  8ICE A;  2KTQ A;  1RXV A;  3SV3 A;  4NLG A;  1KLN A;  9ICQ A;  4CCH A;  5KFY A;  4BDP A;  1X2I A;  1XS9 D;  4QZI A;  3JPR A;  3EPI A;  1NK0 A;  1QTM A;  4R63 A;  1ZQA A;  4O5K A;  4QZ8 A;  8ICY A;  4QWE A;  4NLN A;  5J2E A;  3M9O B;  3GIM A;  5J0R A;  5KFN A;  4UBC A;  5CHG A;  4QWA A;  3LWL A;  1Y88 A;  4MFF A;  4QZG A;  1QLN A;  4RNN A;  3RRH A;  4DFM A;  4LZD A;  2AGP A;  3H4B A;  3PW2 A;  3G6X A;  4PHA A;  2Y1I A;  1U45 A;  4MEY A;  1S10 A;  5KFB A;  4YR0 A;  3MGH A;  3RB6 A;  3OSP A;  4KIT B;  3HPO A;  8ICK A;  5J0W A;  3MR5 A;  1N56 A;  3RRG A;  3M8R A;  2A1J A;  3TAP A;  2AQ0 A;  4EZ6 A;  5DGA A;  3MDC A;  2IMW P;  2FMQ A;  4IR9 A;  5KFW A;  4XQ8 A;  5J0S A;  1WCN A;  4O3Q A;  4F92 B;  4B9V A;  8ICH A;  4I2G A;  4UQG A;  3PV8 A;  1S76 D;  3HP6 A;  3SI8 A;  3V6K A;  5KFJ A;  3OSN A;  1MQ2 A;  8ICV A;  1ZQE A;  2ZJ5 A;  9ICF A;  4P4O A;  4GLX A;  1UT8 A;  5KG0 A;  4DOA A;  4RT2 A;  9ICM A;  4QZB A;  4B9N A;  3PO5 A;  3MFI A;  2BCU A;  2KZM A;  5KT6 A;  5J2H A;  5EWG A;  1JIH A;  4I27 A;  3PW5 A;  2W9A A;  3RBD A;  2FLN A;  2I9G A;  2ISP A;  3GDX A;  1S77 D;  2HVH A;  5HNK A;  3IHQ B;  4RZR A;  2KFN A;  8ICG A;  1RXW A;  1U9L A;  4NY8 A;  8ICQ A;  3Q8L A;  4M2Y A;  2W8L A;  2FPK A;  2ZJA A;  4MF8 A;  4J9Q A;  1L3T A;  2RDJ A;  5KFE A;  4DL5 A;  3QZ8 A;  2HW3 A;  4JV0 A;  5DBB A;  1T7P A;  1KTQ A;  1D8Y A;  2MAX A;  2XC9 A;  4DSF A;  5D4B A;  4KLL A;  4R8U A;  5DG8 A;  4M6W A;  5KFL A;  3AU6 A;  7ICN A;  1KFS A;  4KLT A;  7ICO A;  9ICW A;  1ZQU A;  1S9F A;  4IRC A;  4M9N A;  1KRP A;  3LK9 A;  4J9S A;  2ZUB A;  4F5N A;  7ICL A;  3RR8 A;  5J2B A; 
#chains in the Genus database with same CATH topology
 4M04 A;  3CRX A;  4I2I A;  4F72 A;  2ZIW A;  1RYS A;  4BX9 C;  4B9S A;  3AN1 A;  4EX6 A;  1WWU A;  4J9L A;  2W9C B;  2VA2 A;  3TFS A;  4UB1 A;  3NTU A;  2I5H A;  5J0Y A;  4QZ9 A;  5DKW A;  1TE2 A;  5KT3 A;  4EZ9 A;  4Q44 A;  4DO9 A;  4YMM A;  4F2R A;  5AKJ A;  1IIP A;  4O5C A;  4B9T A;  3PSF A;  4QIW C;  1X9W A;  3THV A;  5EWE A;  3V7K A;  5JTI A;  4IQT A;  2W3R A;  5AM3 A;  5KG2 A;  1KFT A;  2W11 A;  3IN5 A;  9ICI A;  3F2D A;  4IQV A;  2H3I A;  3OGU A;  4EBC A;  3IP4 B;  1PK3 A;  2JMG A;  3LYS A;  3I1Y A;  2BZF A;  4RQ0 A;  3WKB A;  4BJQ A;  4F50 A;  5BOL A;  8ICO A;  3PW4 A;  1BPZ A;  3C1Y A;  3AUO A;  2J6T A;  1XO0 A;  4P2H A;  2PFP A;  1KKX A;  3PZP A;  5ALL A;  4EBE A;  1VDV A;  1L3V A;  1JXE A;  8ICS A;  1RYU A;  2LYA A;  4RQ1 A;  5DBC A;  2K4E A;  2F1H A;  2F1I A;  4ED0 A;  2KV2 A;  3M9N B;  3KOO A;  4ECR A;  4YCX A;  4ECT A;  4RNM A;  3OHA A;  1XU4 A;  1J2M A;  1SV4 A;  3OTQ A;  3N7P D;  1S97 A;  4QW8 A;  2B0C A;  4PJ0 U;  5HMM A;  3ICX A;  4IR1 A;  1NJW A;  3PNC A;  3TAN A;  4NM1 A;  3RH4 A;  3AQF A;  2DKZ A;  1CRX A;  4QZF A;  7ICM A;  3RH6 A;  3SR6 A;  4KX3 A;  5A0L A;  2E1E A;  4F5O A;  1ZRN A;  2ALZ A;  3ZDA A;  2KIV A;  1DGS A;  3RAX A;  4YXJ A;  2EAP A;  2NO5 A;  2AU0 A;  4XA5 A;  4F2S A;  4CE6 A;  2HHV A;  1Q46 A;  2EQY A;  2BPC A;  3PML A;  1QSL A;  2QAR B;  4GXI A;  2KKP A;  5ALH A;  3AQE A;  1NNL A;  3KHL A;  4FS1 A;  3AU2 A;  5AI6 A;  1NKE A;  2K8C B;  5J8Y A;  2E8M A;  3C23 A;  4DF4 A;  3F2B A;  5IIO A;  4YN4 A;  1A76 A;  5ALT A;  1U47 A;  4UB6 U;  1VJ5 A;  3PX6 A;  4EEY A;  3KBB A;  5DB8 A;  3TAR A;  1ECW A;  2GH1 A;  2ZJ8 A;  4UBB A;  2P6R A;  4YP3 A;  1ZQH A;  4Z6C A;  3BS5 B;  2WF7 A;  4NL9 A;  3WK5 A;  5JU5 A;  2OYY A;  1UHU A;  4USA A;  4DL2 A;  2BR0 A;  4C8K A;  4Y2U A;  2D6F C;  4KLH A;  3CW2 C;  2W03 A;  2NO4 A;  4C8N A;  1TK0 A;  4KTQ A;  4MFA A;  2JZB B;  2GO7 A;  3M8S A;  4P0Q A;  1B0X A;  3IG5 A;  1S0V A;  4BWM A;  5KFG A;  1SIJ A;  3TKA A;  4DQP A;  2IHN A;  5J2F A;  7ICP A;  2UVU A;  2ZIU A;  1N63 A;  3ETL A;  2BCV A;  3C5F A;  4IS7 A;  1K1S A;  5KFQ A;  4EEL A;  5L1I A;  1N60 A;  1QQ7 A;  7ICJ A;  2J6U A;  2HOQ A;  4B9M A;  1LKY B;  1RG6 A;  4DQQ A;  3C2L A;  4ED6 A;  2XGQ A;  7ICE A;  1ZQR A;  5KT7 A;  3H0R B;  5KFT A;  2YN4 A;  2W04 A;  4Z6F A;  4KMO B;  1ZQS A;  5J0P A;  1T3Q A;  2AQ4 A;  4JK1 A;  5KAI U;  3EUB 2;  3HKZ C;  1Z4O A;  2HVI A;  8ICP A;  3LDA A;  2Y9U A;  5KFD A;  3RJG A;  4DWI A;  2LYH A;  7ICS A;  4I2D A;  3WK6 A;  5ALW A;  2KSO A;  4RPX A;  4UAW A;  4RQ2 A;  1NK4 A;  2PMZ C;  1N61 A;  1L8L A;  1NI3 A;  4M9J A;  4ECQ A;  4C80 A;  4R8U B;  5KT4 A;  2B21 A;  5DQG A;  1S0M A;  3H4D A;  4DLG A;  1KDH A;  4Z6D A;  2F3N A;  3KFU F;  2NRT A;  3DDH A;  3GII A;  3S6J A;  1XSP A;  2ZXH A;  1AQ6 A;  3BQ1 A;  2YB1 A;  3Q8S B;  3G6V A;  1TAU A;  4TUR A;  7ICV A;  4PZO A;  5EWF A;  4FO6 A;  2HBJ A;  5ALI A;  2IBK A;  4RT3 A;  8ICX A;  3EYZ A;  2FMP A;  2XY6 A;  5HML A;  4ED8 A;  4CF5 A;  4QWB A;  5J2A A;  3C28 A;  2I6X A;  3WU2 U;  9ICC A;  4P0P B;  4EYI B;  5J0O A;  5DB7 A;  2DKX A;  2L5Y A;  2ZUC A;  1ZQF A;  2W43 A;  3H7I A;  3KHH A;  4FZM A;  4MFC A;  2DUY A;  3RF9 A;  1X40 A;  3PX0 A;  3FDS A;  4DQI A;  1XSN A;  2AGO A;  3T5K A;  3UXO A;  3WKA A;  2IA6 A;  3HRD D;  4DSL A;  1UQV A;  5FP0 A;  4GC7 A;  2CN1 A;  7ICU A;  7ICT A;  2NRX A;  4EYH B;  4KLE A;  3QU9 A;  5AIA A;  4DS4 A;  1N62 A;  2Q4T A;  2YY6 A;  1RXV A;  1KLN A;  4QZI A;  2XVT A;  4R63 A;  4OJO A;  3GIM A;  5J0R A;  5KFN A;  4MFF A;  1QLN A;  2AGP A;  5EE9 A;  3H4B A;  1X66 A;  3A0H U;  4NJ8 A;  4PHA A;  2Y1I A;  1U45 A;  2F44 A;  4YR0 A;  3MGH A;  3HPO A;  2E8P A;  2A1J A;  4C7Y A;  3C29 A;  4MHV A;  3MDC A;  2IMW P;  2FMQ A;  3WK9 A;  2EAO A;  4XQ8 A;  4F92 B;  4UQG A;  8ICV A;  1MQ2 A;  4P4O A;  1SB3 C;  4B9N A;  5J2H A;  1JIH A;  2EZY A;  4RZR A;  1RXW A;  4NY8 A;  4U6P A;  4EEN A;  2W8L A;  3NRW A;  1L3T A;  2CRX A;  1N5W A;  2Y0S F;  5C0Y A;  5KFE A;  1KN5 A;  2F8L A;  2HW3 A;  3TAC B;  4JV0 A;  1T7P A;  1KTQ A;  1X6J A;  2MAX A;  4KLL A;  2DBY A;  5DG8 A;  4JMU A;  3ETR A;  2KK0 A;  7ICL A;  3WK8 A;  1HUZ A;  4F71 A;  1ZQB A;  3EZ5 A;  4ECW A;  4KMU A;  8ICL A;  2DFL A;  4ELU A;  2R8K A;  3L3F X;  4Q43 A;  4JV1 A;  3Q8M A;  3E0F A;  5AK4 A;  2LYB A;  4DOC A;  2KZ3 A;  4ED7 A;  5KFK A;  1BPX A;  3UXP A;  1SGG A;  3GFK B;  2XI9 A;  5CJ7 A;  5HR6 A;  5KFV A;  5DLG A;  4NM2 A;  2OHF A;  5AK6 A;  9ICA A;  3V7J A;  4O3P A;  3QZ7 A;  9ICX A;  5III A;  3HW8 A;  3ISD A;  4ED3 A;  1JUD A;  3SQI A;  5K4L A;  4IL6 U;  4TUP A;  8ICU A;  1QQ6 A;  3C2M A;  5ALR A;  4F4W A;  4P0Q B;  1ZD3 A;  1X9S A;  2KFZ A;  8ICN A;  1JX4 A;  3JPQ A;  2JHD A;  3ZDD A;  3KHR A;  3PMN A;  4G3I A;  2G5H B;  9ICL A;  5KT5 A;  2RDI A;  4Q45 A;  2K4H A;  4UW9 A;  3C5G A;  2WFA A;  1RQN A;  2IOH A;  4DQR A;  1SZP A;  2LBO A;  3CP8 A;  2WF9 A;  3C1Z A;  3N7R C;  1MSW D;  4ECY A;  9ICG A;  3B0Y A;  3NVZ A;  1BGX T;  2V4Q A;  1SV0 C;  1V38 A;  2G5I B;  3K4G A;  1KEJ A;  1MC8 A;  3PSP A;  5DGB A;  2WAQ C;  4CF4 A;  5L1K A;  2FPM A;  1JI7 A;  5EE1 A;  1ZQY A;  4ECS A;  2NV3 A;  5H2F U;  2ZIX A;  3QX7 A;  1WG8 A;  1BNP A;  3RJJ A;  4KLD A;  3QXG A;  4EX7 A;  2R8G A;  4NXZ A;  2RLT A;  1ZQO A;  4DCC A;  4X5V A;  9ICV A;  5KG5 A;  8ICT A;  4I2F A;  3H8J A;  1RZT A;  3F53 A;  4ICA A;  1XNS A;  3RJE A;  3O0F A;  3GV8 B;  3PST A;  1XO1 A;  2KSO B;  1B43 A;  4DSI A;  4UAR A;  2G07 A;  7ICG A;  1DK2 A;  1Z19 A;  3EWA A;  1Z00 B;  1X9X A;  1ZQT A;  4UB3 A;  4UAV A;  4US9 A;  3UMB A;  4O0I A;  2B6G A;  1XSL A;  1UCV A;  2BCQ A;  4J03 A;  4DSK A;  2OWO A;  4M9L A;  3D2S A;  8ICF A;  4R64 A;  5EOZ A;  5JRT A;  3I76 A;  4JB3 A;  4NLK A;  2FDR A;  2K8A A;  9ICN A;  4B9U A;  4F5P A;  3PX4 A;  4PHD A;  4C7Z A;  3WK7 A;  2HI0 A;  5B66 U;  2OEH A;  4QZD A;  4PGX A;  2JEF A;  3GIK A;  3RAQ A;  2HOF A;  1F5S A;  3NS1 A;  2C2D A;  4AP9 A;  3FAH A;  4O5E A;  4ED1 A;  2BCR A;  4GIB A;  4KLM A;  1SWV A;  2Q0Z X;  4Y2R A;  1S0N A;  1IG6 A;  4BXO A;  1ZQG A;  3N97 B;  2QB1 A;  5KFA A;  4MEX A;  5AK3 A;  4I2H A;  1V9P A;  5ALG A;  4PPX A;  4F4Z A;  2DPJ A;  4F5Q A;  2P66 A;  1XC9 A;  3ISB A;  1L7M A;  2K8B B;  2DPI A;  1A0P A;  4FZN A;  1WUD A;  1B22 A;  4KX5 A;  3ZDB A;  4KLJ A;  4C8M A;  3PR5 B;  2WHE A;  1ZQI A;  4EEK A;  1ZYQ A;  1L7O A;  2XID A;  1QQ5 A;  1ZQW A;  2HHT A;  2ZIV A;  1ZQN A;  1L7P A;  3H8W A;  4ZOH C;  4Q8E A;  3TQ1 A;  9ICR A;  8ICC A;  3JPT A;  3RB4 A;  2KNJ A;  2JEI A;  2NRW A;  2R18 A;  2ES6 A;  1DRG A;  1U48 A;  4J9P A;  3ONN A;  1NK5 A;  3PW0 A;  2QB0 A;  2KVS A;  4OJ5 A;  1L3S A;  5AK5 A;  4NLZ A;  4R66 A;  2A1J B;  5L1M A;  9ICP A;  2XY7 A;  3H8M A;  2AH5 A;  5ALU A;  2MU2 A;  4Y2J A;  1TK8 A;  5ALF A;  3TFR A;  5KFI A;  3T5J A;  4Z6E A;  3IDW A;  5ALZ A;  3V72 A;  4O3O A;  1BPE A;  1JXL A;  1VLB A;  5ALK A;  3R9K A;  2RQ5 A;  4Y2Q A;  4M47 A;  1KL9 A;  3RFA A;  3BQ2 A;  4GC6 A;  3C21 A;  2E1F A;  2XGP A;  2ZTE A;  2XY5 A;  1NJX A;  3BQT A;  4YR2 A;  4RQ8 A;  4DLE A;  2VA8 A;  1HJP A;  1PK1 A;  4KN4 A;  1N2X A;  4YVZ A;  3H0L B;  4CDG A;  5JUM A;  4US8 A;  3L4P A;  2MRL A;  5AM0 A;  2DF4 B;  2LI6 A;  4J9N A;  3N7S C;  1TAM A;  2JXJ A;  4RQ5 A;  3BJY A;  4IQU A;  3GQC A;  2KEY A;  1N48 A;  1XWL A;  4JWM A;  7ICF A;  2XO7 A;  2KVC A;  2W55 A;  2BHN A;  5ALS A;  3MGV A;  4CF3 A;  1ZJN A;  1NOM A;  2W9M A;  2BDP A;  4MF2 A;  2NRZ A;  3GU3 A;  1FO4 A;  2FLL A;  2WB1 C;  3RB0 A;  3CNH A;  4DFD A;  3C2K A;  4FBT A;  3T5L A;  5AI4 A;  3Q8R B;  3N4M B;  4DOB A;  3AMZ A;  2VA3 A;  4DEZ A;  2MUT B;  5ALP A;  2ZG6 A;  4DFJ A;  5AM5 A;  5J2K A;  5J0U A;  4K4I A;  5HP4 A;  1Q3U A;  5CA7 A;  1ZQM A;  4LZG A;  4RU9 A;  2BGW A;  1ZQP A;  1L3U A;  1IXR A;  2I1Q A;  2HMX A;  1UA0 A;  3K1R B;  4CGZ A;  1NK7 A;  3ZDC A;  3SEI A;  2KG5 A;  4AYB F;  5AHX A;  2BQU A;  2AJQ A;  3SV3 A;  4CCH A;  4BDP A;  4OD0 A;  1X2I A;  1S5L U;  5J8Y C;  4O5K A;  1M6Y A;  4QWE A;  1L7N A;  1IV8 A;  4QWA A;  5CHG A;  1Y88 A;  3RRH A;  2WF5 A;  3PW2 A;  3QNM A;  5KFB A;  2WAQ F;  3LVW A;  4Y2Y A;  3MR5 A;  3BZK A;  5KFW A;  3B9J A;  4I2G A;  3PV8 A;  3HP6 A;  4NL9 C;  3M7D A;  5AI0 A;  5KFJ A;  4GFJ A;  9ICF A;  1UT8 A;  2H3V A;  2BCU A;  2KZM A;  1O08 A;  5EWG A;  2BDU A;  3PW5 A;  2W9A A;  3RBD A;  2FLN A;  2ISP A;  5HNK A;  2FPK A;  4MF8 A;  1ED1 A;  3QUC A;  3M6Z A;  4FZL A;  2XC9 A;  4DSF A;  3BZC A;  7ICN A;  1KFS A;  9ICW A;  3M1Y A;  1ZQU A;  2YB4 A;  1COK A;  2AHO B;  2ZIW B;  2E5S A;  3RR8 A;  5DQI A;  2HOI A;  1KQQ A;  2PXI A;  1U49 A;  4EBD A;  2FLP A;  1QCK A;  2FI1 A;  1L8O A;  3BS7 A;  4OJP A;  4M9G A;  5J2J A;  5J0T A;  1RDF A;  3GV5 B;  3D2N A;  2W9C A;  2BCS A;  2KKV A;  2XCP A;  1S0O A;  4YXM A;  4ECZ A;  2C22 A;  4UAT A;  1L5U A;  3HX0 A;  4OJ6 A;  2ZXI A;  2KIW A;  1ZD2 P;  3TAD A;  1HEK A;  2UVV A;  2BQ3 A;  5GTH U;  4B6J A;  3WK4 A;  4I2E A;  2KHV A;  4BXO B;  1LV5 A;  4JWN A;  4QIW F;  4RQN A;  5IIN A;  2W7O A;  2Y9T A;  1Z3E B;  4C4S A;  4KLI A;  4RQ6 A;  1V85 A;  2HHW A;  3IG8 A;  1ZQV A;  2RRD A;  1ZET A;  4DL6 A;  1MQ3 A;  4G9B A;  4UAS A;  4P4M A;  4ELT A;  4OJL A;  1C7Y A;  5AKL A;  2C2E A;  3MAB A;  2KZZ A;  2Y1J A;  1IM4 A;  4Y2V A;  9ICK A;  4NLB A;  1A77 A;  5EE0 A;  5CB1 A;  3NVW A;  4NLC A;  3WKC A;  2ZIV B;  2OXO A;  1FFU A;  4LJX A;  2K89 A;  1NKB A;  4YD2 A;  1NJY A;  5B5E U;  3VC8 A;  2ASD A;  2G08 A;  3KHG A;  3VCB A;  3ZDE A;  5DLF A;  4WJ3 B;  2QB0 B;  3SD7 A;  2KJ9 A;  1L6N A;  1CEZ A;  4I2A A;  5F9N A;  1NZP A;  5L9X A;  3MBY A;  1CI4 A;  2JGA A;  3SEN A;  3J81 j;  5HR7 A;  5L1L A;  4QZH A;  3FYH A;  2H3Q A;  2KP7 A;  2BPG A;  1TKD A;  4RQ3 A;  3DV9 A;  2MA1 A;  5KFS A;  3T79 A;  2O6K A;  2HHX A;  2ATL A;  5G5G A;  5CEH A;  4RQ4 A;  4F91 B;  3F2C A;  3SAH A;  1ZOL A;  5IIJ A;  1SKS A;  4IQW A;  1PK1 B;  2HBK A;  4C0Z A;  2K4I A;  2QAR A;  2LM4 A;  3D6J A;  3UMG A;  4PL1 A;  3NAS A;  2G0A A;  3JPN A;  3K1Z A;  8ICB A;  4QNL A;  1NJZ A;  5F9L A;  2F8K A;  4KLO A;  3BQ7 A;  4PGY A;  3MFH A;  3ZD9 A;  3ZI4 A;  3L5K A;  5IIK A;  1LB2 B;  4QWD A;  1PUZ A;  5CR0 A;  1KW4 A;  1ZJM A;  4Y2P A;  3JPO A;  2YMM A;  5ALY A;  1SL1 A;  2GOL A;  3V7L A;  2N1R A;  4DS5 A;  3KTQ A;  3JPS A;  2YML A;  1D8B A;  4JUZ A;  5KG7 A;  2EH9 A;  9ICO A;  1JMS A;  3RJH A;  3BS5 A;  3H8S A;  4Y2X A;  4C8L A;  2D8C A;  1DXS A;  4J9K A;  3SV4 A;  4GXK A;  4IRD A;  3QU2 A;  3GV7 B;  1BPY A;  2GWS A;  3RR7 A;  2KE7 A;  4I2C A;  1NK6 A;  3FC4 A;  1OXJ A;  2OM6 A;  1SKR A;  1Q8K A;  4F8R A;  8ICW A;  2IHM A;  4M9H A;  4J9R A;  4F5R A;  3F5A A;  3TAQ A;  1BVS A;  2M9N A;  2ZIU B;  1ZRM A;  3PY8 A;  1TV9 A;  5J0Q A;  4YD1 A;  3RJI A;  1T8E A;  1D9D A;  4KLU A;  1DGJ A;  4DF8 A;  4HYK A;  1RM6 C;  2YMP A;  2VJ4 A;  1D8L A;  5AI5 A;  4Q8F A;  3QYP A;  5ALQ A;  4O3S A;  4QWC A;  3ISC A;  4XUS A;  4YQW A;  8ICI A;  2KMD A;  2AGQ A;  3LVV A;  4F4K A;  3UQ2 A;  2BQR A;  1LKY A;  1ZXI A;  2PI4 A;  3I28 A;  3NGD A;  4YR3 A;  1RYR A;  3MR2 A;  8ICJ A;  2F1J A;  2BKE A;  5DB9 A;  4PH5 A;  2EDU A;  5AI9 A;  3PR4 A;  4CNQ A;  9ICU A;  4PHP A;  5ALO A;  3HKZ F;  2E8N A;  9ICE A;  5DB6 A;  5T14 A;  1PZN A;  1X9M A;  3KKA C;  2EZZ A;  1QH9 A;  2HSZ A;  3EW9 A;  5KFX A;  4QZE A;  5IIL A;  5G5H A;  2ISO A;  2H5X A;  1TFR A;  4NV0 A;  2OH2 A;  5KFC A;  3PW7 A;  3QUB A;  2PMZ F;  2P6U A;  4QJF B;  4PZN A;  4YMO A;  1CUK A;  4OCZ A;  5HHI A;  1MN8 A;  4CRX A;  4UAY A;  1SL0 A;  2KJ8 A;  1KFD A;  2ZUD A;  2EAM A;  5C5J A;  2K60 A;  1SWW A;  2EZX A;  2EAN A;  2JH1 A;  1T3N A;  4DSE A;  1OW5 A;  5D49 A;  2QKQ A;  2J6S A;  1J97 A;  3G6Y A;  3SYZ A;  2JEG A;  2R8I A;  2PFN A;  2W7P A;  1PVP A;  4O3N A;  3QU4 A;  2AXT U;  4GXJ A;  1ZQQ A;  2UVR A;  3N28 A;  2Z7J A;  5DG9 A;  3BDP A;  3ZD8 A;  3FM9 A;  2JR5 A;  4FBU A;  3MR3 A;  4B9L A;  8ICM A;  4P0P A;  2QLT A;  3NVV A;  4BUG A;  5AM2 A;  2F77 X;  2KD1 A;  1TK5 A;  5IIM A;  4TUQ A;  5KFM A;  2JEJ A;  5AIB A;  5AM4 A;  5KFO A;  2CXY A;  4F4Y A;  3QE9 Y;  4DQS A;  5KTQ A;  1HIW A;  1EXN A;  1BPD A;  3K75 D;  5HHH A;  3NUQ A;  1N5X A;  4F4X A;  2A19 A;  2HHS A;  4K4G A;  5KFH A;  5KFF A;  9ICJ A;  2W9B A;  5KT2 A;  3RH5 A;  8ICE A;  5KFY A;  1O03 A;  3EPI A;  1NK0 A;  1ZQA A;  4QZ8 A;  4NLN A;  5J2E A;  4UBC A;  4RNN A;  4LZD A;  3SAF A;  3QUQ A;  3G6X A;  1S10 A;  3RB6 A;  3OSP A;  1A6S A;  8ICK A;  5J0W A;  1N56 A;  3RRG A;  2AQ0 A;  4EZ6 A;  2IOF A;  4ACO A;  4FE3 A;  3SMV A;  1WCN A;  4B9V A;  3SI8 A;  3V6K A;  3OSN A;  1JRP A;  1ZQE A;  1RQL A;  3NRZ A;  4RQM A;  3PSI A;  4DOA A;  4RT2 A;  3H0M B;  9ICM A;  5KT6 A;  2XIC A;  4I27 A;  2I9G A;  1S77 D;  1ZD5 A;  2HVH A;  3WKD A;  2W3S A;  1UPH A;  1PVR A;  1U9L A;  3DEE A;  4M2Y A;  4J9Q A;  2RDJ A;  4DL5 A;  2Y0S C;  5EE3 A;  5DBB A;  3HJE A;  2WF6 A;  4M6W A;  5KFL A;  1P7D A;  2IOF K;  1Z4N A;  4IRC A;  1S9F A;  4M9N A;  3LK9 A;  4J9S A;  2ZUB A;  4F5N A;  5CRX A;  5J2B A;  3UQ0 A;  3JPP A;  1BPB A;  2R8J A;  1UT5 A;  1NK9 A;  5ALD A;  3RBE A;  3Q8Q B;  7ICR A;  1ZQX A;  5AKZ A;  4ZH4 A;  5BOM A;  4I29 A;  1WWV A;  3KZX A;  1X6I A;  2V4R A;  4UB2 A;  1V97 A;  5KG6 A;  4XRH A;  2YTU A;  4TUS A;  2LHT A;  3HIL A;  5J2C A;  5GTI U;  3T3F A;  1ARO P;  3RJK A;  4Y2T A;  4J9M A;  3F5E A;  2P35 A;  4YFK A;  4PGQ A;  3NVY A;  4IC9 A;  4QZA A;  4UAU A;  1K1Q A;  2YX8 A;  1C20 A;  7ICI A;  2LKY A;  5DDY A;  2DL0 A;  2W54 A;  1ZQC A;  1K5O A;  2FMS A;  2PKE A;  5ALJ A;  3T5H A;  3GIJ A;  5KFU A;  4F93 B;  1SXD A;  4YG2 A;  2W8K A;  1DOQ A;  1ZQL A;  1Z1V A;  4ECV A;  3UXN A;  4O9M A;  2BPF A;  1FIQ A;  5ALM A;  3HWT A;  5AM1 A;  9ICT A;  1YT3 A;  3ORY A;  4TQS A;  4C8O A;  4DFP A;  3MR6 A;  2LPE A;  4FFD A;  3MDA A;  5KFZ A;  4I28 A;  4KLF A;  2ZIX B;  3OJU A;  2HBL A;  4DFK A;  1J2N A;  4RUA A;  3QEB Z;  3SAG A;  1SL2 A;  2PFO A;  5DG7 A;  4UB8 U;  5CP2 A;  1QSS A;  3E2E A;  1SKW A;  5DBA A;  1KBU A;  5F3X B;  9ICB A;  4QW9 A;  5KG1 A;  2G09 A;  1JAL A;  2NRV A;  3WKE A;  3D2Q A;  5ALV A;  3PO4 A;  1F0M A;  3OJS A;  3OHB A;  2ASL A;  9ICH A;  1ZQZ A;  1BNO A;  5D46 A;  3AL0 B;  4DL7 A;  3AM9 A;  5KFP A;  2K4P A;  2HHQ A;  4I2B A;  1Z00 A;  2CPR A;  3Q8P B;  3TI0 A;  1URJ A;  2VIX A;  2PFQ A;  1HUO A;  5CWR A;  1JN3 A;  2DQN B;  1X42 A;  5J2G A;  2KIC A;  8ICZ A;  2UVW A;  2LM1 A;  5ALX A;  3V6H A;  4E0D A;  3MGI A;  5KL8 B;  1ZD4 A;  2F76 X;  5E79 U;  2C2R A;  2M0N A;  5L1J A;  1ZQK A;  5ALE A;  5J29 A;  3SZ2 A;  2ZTD A;  5BPC A;  2GLE A;  7ICQ A;  4P4P A;  3Q8K A;  4ECX A;  3M9M B;  1D9F A;  3RTV A;  2HBM A;  3IRU A;  4BGD A;  1ZQ1 C;  5AKI A;  5TZV A;  2D3D A;  2LMR A;  5J0X A;  3OPX A;  1H38 A;  4FS2 A;  4R65 A;  2A1A A;  4ED2 A;  1U4B A;  2E3T A;  4I2J A;  1T94 A;  2DGZ A;  1LVH A;  4M0A A;  3ALR A;  2E8O A;  1MA7 A;  2VKQ A;  1SZH A;  4TQR A;  4RPZ A;  1ZQD A;  1TAQ A;  1NZB A;  5AKX A;  4DSJ A;  2W9B B;  4UB4 A;  2NYV A;  4HAI A;  1FEZ A;  3RB3 A;  1YZ6 A;  3IM1 A;  1QSY A;  2V9W A;  1ZQJ A;  5KNI A;  3CYM A;  2JRZ A;  5DQH A;  4DL3 A;  1WCL A;  4QZC A;  5KFR A;  1TVA A;  2JV3 A;  3AEV A;  2KOB A;  5AKY A;  2ESE A;  2KHQ A;  3QEA Z;  1T4G A;  1PVQ A;  1YZ7 A;  3B0X A;  4J9O A;  2JH7 A;  2ZTC A;  4RUC A;  5AKG A;  3TAD C;  1KSP A;  3RJF A;  4UAZ A;  3QU5 A;  4K4H A;  3A0B U;  5KAF U;  4ECU A;  1F44 A;  4U7C A;  2ODG A;  2VAN A;  4UB5 A;  2FJ6 A;  1NKC A;  5DDM A;  4O3M A;  2PI5 A;  4M6W B;  3BQ0 A;  3HT3 A;  2WTF A;  3UPQ A;  8ICR A;  5TIS U;  8ICA A;  2RP5 A;  4KLQ A;  2FPL A;  3M6K A;  1SV0 A;  3GIL A;  4OO1 J;  4KN7 A;  5AKH A;  4RPY A;  4KLG A;  1JRO A;  2F2A B;  5AI8 A;  4DL4 A;  2HCF A;  2ASJ A;  2KN7 A;  5AIC A;  4C4T A;  4KLS A;  5J2D A;  7ICK A;  3H40 A;  3UM9 A;  4F3O A;  2C28 A;  3ED5 A;  2VJ5 A;  2H3F A;  4BWJ A;  1DK3 A;  2WB1 F;  3GZF A;  5KG3 A;  4LVS A;  4RNO A;  3PVX A;  2KJ5 A;  3KKA A;  7ICH A;  1GO3 F;  1SXE A;  4JV2 A;  1COO A;  2MSN A;  1UA1 A;  2HHU A;  2JZB A;  2MUT A;  5KG4 A;  3IV6 A;  1Z1B A;  3LWM A;  1NK8 A;  1RPL A;  9ICS A;  4ELV A;  3EPG A;  2XCA A;  1WYG A;  2H3Z A;  4RQ7 A;  4C4R A;  3KZI U;  4A8E A;  3V6J A;  4AYB C;  3QUT A;  2R8H A;  4O3R A;  3MC1 A;  5J2I A;  3E58 A;  4YMN A;  4IRK A;  4Y2S A;  4PHE A;  2KTQ A;  2G06 A;  4NLG A;  9ICQ A;  1XS9 D;  3JPR A;  1FFV A;  1QTM A;  8ICY A;  3M9O B;  3LWL A;  4QZG A;  2OCE A;  1S8O A;  3QU7 A;  4DFM A;  5AKK A;  2DWQ A;  1OUQ A;  5KL1 B;  4MEY A;  4KIT B;  3KD3 A;  3M8R A;  3TAP A;  5DGA A;  4IR9 A;  5J0S A;  8ICH A;  4O3Q A;  1S76 D;  2YQE A;  2ZJ5 A;  4GLX A;  5ALN A;  5KG0 A;  4QZB A;  3PO5 A;  2YMQ A;  3MFI A;  2A3V A;  3U26 A;  1Q3V A;  3GDX A;  2FE9 A;  3IHQ B;  2KFN A;  8ICG A;  8ICQ A;  3Q8L A;  4NWI A;  2ZJA A;  2HDO A;  3QZ8 A;  1D8Y A;  5D4B A;  5AKE A;  4R8U A;  3AU6 A;  7ICO A;  4KLT A;  4PL2 A;  1KRP A;  2RHF A;  3UMC A;  1B4F A;  2WF8 A; 
#chains in the Genus database with same CATH homology
 5DQI A;  3UQ0 A;  4M04 A;  1HUZ A;  2PXI A;  3JPP A;  1ZQB A;  4I2I A;  1U49 A;  1BPB A;  4EBD A;  2R8J A;  3EZ5 A;  1UT5 A;  4ECW A;  4KMU A;  1NK9 A;  1RYS A;  2FLP A;  8ICL A;  3RBE A;  3Q8Q B;  4B9S A;  7ICR A;  1ZQX A;  2DFL A;  4ELU A;  4M9G A;  2R8K A;  4J9L A;  2W9C B;  2VA2 A;  5J2J A;  4ZH4 A;  5J0T A;  5BOM A;  3TFS A;  4I29 A;  4UB1 A;  4Q43 A;  4JV1 A;  3Q8M A;  3GV5 B;  2V4R A;  4UB2 A;  3NTU A;  5KG6 A;  2W9C A;  4DOC A;  4XRH A;  2BCS A;  2KZ3 A;  4ED7 A;  5KFK A;  4TUS A;  2XCP A;  1BPX A;  3UXP A;  1S0O A;  4YXM A;  4ECZ A;  2C22 A;  1L5U A;  3GFK B;  5J2C A;  5CJ7 A;  5J0Y A;  4QZ9 A;  5DKW A;  5KFV A;  3HX0 A;  5DLG A;  5KT3 A;  4NM2 A;  3T3F A;  9ICA A;  4EZ9 A;  1ARO P;  4Q44 A;  4DO9 A;  2UVV A;  4YMM A;  3V7J A;  2BQ3 A;  4O3P A;  4F2R A;  4I2E A;  3RJK A;  3QZ7 A;  4O5C A;  9ICX A;  4BXO B;  1LV5 A;  4B9T A;  4JWN A;  5III A;  4J9M A;  1X9W A;  3HW8 A;  4YFK A;  3ISD A;  4ED3 A;  5IIN A;  4PGQ A;  3THV A;  5EWE A;  4QZA A;  3V7K A;  4TUP A;  1K1Q A;  8ICU A;  4IQT A;  1Z3E B;  4KLI A;  4RQ6 A;  5KG2 A;  7ICI A;  2HHW A;  1KFT A;  3C2M A;  4F4W A;  1ZQV A;  1ZET A;  1X9S A;  4DL6 A;  2KFZ A;  5DDY A;  9ICI A;  8ICN A;  1MQ3 A;  1JX4 A;  4P4M A;  4ELT A;  1ZQC A;  4IQV A;  1C7Y A;  3JPQ A;  2C2E A;  3OGU A;  2FMS A;  4EBC A;  3T5H A;  3ZDD A;  3KHR A;  3GIJ A;  3PMN A;  3MAB A;  5KFU A;  4G3I A;  4F93 B;  9ICL A;  2KZZ A;  4YG2 A;  5KT5 A;  2W8K A;  2Y1J A;  1IM4 A;  9ICK A;  1A77 A;  2RDI A;  4Q45 A;  4RQ0 A;  5CB1 A;  1DOQ A;  1ZQL A;  3C5G A;  4F50 A;  4ECV A;  4DQR A;  1SZP A;  3UXN A;  4O9M A;  2BPF A;  3C1Z A;  5BOL A;  1MSW D;  8ICO A;  4ECY A;  3PW4 A;  1BPZ A;  3C1Y A;  3HWT A;  9ICG A;  3AUO A;  1NKB A;  2J6T A;  3B0Y A;  4P2H A;  4YD2 A;  2PFP A;  1NJY A;  9ICT A;  1BGX T;  2V4Q A;  2ASD A;  3ORY A;  3KHG A;  4TQS A;  4EBE A;  4DFP A;  4C8O A;  1L3V A;  3MR6 A;  1JXE A;  3K4G A;  8ICS A;  3ZDE A;  1KEJ A;  5DLF A;  4RQ1 A;  1MC8 A;  3MDA A;  5DBC A;  5KFZ A;  4I28 A;  2F1H A;  2F1I A;  5DGB A;  4KLF A;  4ED0 A;  3M9N B;  3OJU A;  5L1K A;  4ECR A;  2FPM A;  4DFK A;  4YCX A;  4ECT A;  1ZQY A;  4RUA A;  4ECS A;  4RNM A;  3OHA A;  1CEZ A;  1XU4 A;  3QEB Z;  1SL2 A;  4I2A A;  1S97 A;  4QW8 A;  5F9N A;  5DG7 A;  2PFO A;  5L9X A;  5CP2 A;  5HMM A;  1QSS A;  4IR1 A;  3MBY A;  1NJW A;  3RJJ A;  3E2E A;  3PNC A;  4KLD A;  3TAN A;  4NM1 A;  3RH4 A;  1SKW A;  5DBA A;  5L1L A;  2R8G A;  4NXZ A;  4QZH A;  4QZF A;  1ZQO A;  3RH6 A;  3FYH A;  7ICM A;  4X5V A;  9ICB A;  4QW9 A;  9ICV A;  5KG5 A;  5KG1 A;  8ICT A;  4I2F A;  3H8J A;  1RZT A;  4F5O A;  2NRV A;  2BPG A;  2ALZ A;  4RQ3 A;  1TKD A;  3ZDA A;  1DGS A;  5KFS A;  3RAX A;  4YXJ A;  3GV8 B;  3RJE A;  3PO4 A;  2HHX A;  2ATL A;  4RQ4 A;  2AU0 A;  4XA5 A;  1XO1 A;  4F91 B;  3OJS A;  1B43 A;  4F2S A;  4DSI A;  3OHB A;  2HHV A;  2BPC A;  5IIJ A;  3PML A;  1SKS A;  1QSL A;  7ICG A;  4IQW A;  2ASL A;  9ICH A;  1ZQZ A;  5D46 A;  3EWA A;  4GXI A;  4DL7 A;  1Z00 B;  1ZQT A;  4UB3 A;  3KHL A;  4FS1 A;  3AU2 A;  5KFP A;  2HHQ A;  1NKE A;  4I2B A;  4O0I A;  1XSL A;  1Z00 A;  3TI0 A;  3Q8P B;  3C23 A;  4DF4 A;  3JPN A;  2BCQ A;  4DSK A;  4M9L A;  2OWO A;  8ICF A;  8ICB A;  1NJZ A;  4R64 A;  1HUO A;  5EOZ A;  2PFQ A;  5F9L A;  5IIO A;  5CWR A;  4KLO A;  4YN4 A;  1JN3 A;  4PGY A;  5J2G A;  3ZD9 A;  3MFH A;  1A76 A;  8ICZ A;  5IIK A;  1U47 A;  1LB2 B;  4QWD A;  2UVW A;  4NLK A;  5CR0 A;  3PX6 A;  3V6H A;  4EEY A;  4E0D A;  9ICN A;  4B9U A;  5DB8 A;  4F5P A;  3TAR A;  3PX4 A;  2ZJ8 A;  3MGI A;  1ZJM A;  4PHD A;  4UBB A;  3JPO A;  1SL1 A;  4DS5 A;  3V7L A;  2P6R A;  3KTQ A;  3JPS A;  4QZD A;  2C2R A;  5L1J A;  4JUZ A;  4YP3 A;  5KG7 A;  3SZ2 A;  5J29 A;  1ZQK A;  2ZTD A;  4PGX A;  1ZQH A;  4Z6C A;  2JEF A;  5BPC A;  3GIK A;  3RAQ A;  9ICO A;  7ICQ A;  4P4P A;  3Q8K A;  4DL2 A;  4ECX A;  2C2D A;  3M9M B;  1JMS A;  3RJH A;  2BR0 A;  4C8K A;  1D9F A;  3RTV A;  4ED1 A;  2BCR A;  4O5E A;  3H8S A;  4C8L A;  4KLM A;  2Q0Z X;  1S0N A;  4BGD A;  4J9K A;  3SV4 A;  4GXK A;  4BXO A;  4KLH A;  1ZQG A;  3N97 B;  4IRD A;  3GV7 B;  1BPY A;  5TZV A;  5J0X A;  2GWS A;  5KFA A;  3RR7 A;  4MEX A;  4C8N A;  1H38 A;  4I2C A;  1NK6 A;  4FS2 A;  1TK0 A;  4R65 A;  1SKR A;  4I2H A;  1V9P A;  4MFA A;  4KTQ A;  4PPX A;  2JZB B;  4F8R A;  4F4Z A;  2DPJ A;  4F5Q A;  2P66 A;  4ED2 A;  1U4B A;  1XC9 A;  4I2J A;  3M8S A;  8ICW A;  3ISB A;  2DPI A;  2IHM A;  4M9H A;  4J9R A;  4F5R A;  4M0A A;  1S0V A;  3TAQ A;  1B22 A;  1BVS A;  2M9N A;  3ZDB A;  4BWM A;  5KFG A;  4KLJ A;  3PY8 A;  4DQP A;  4C8M A;  3PR5 B;  2IHN A;  1TV9 A;  5J0Q A;  1ZQI A;  4YD1 A;  5J2F A;  4TQR A;  3RJI A;  7ICP A;  1T8E A;  1D9D A;  2UVU A;  4KLU A;  4DF8 A;  3ETL A;  4RPZ A;  4HYK A;  1ZYQ A;  1TAQ A;  1ZQD A;  2BCV A;  3C5F A;  1K1S A;  5KFQ A;  4DSJ A;  1D8L A;  4Q8F A;  1ZQW A;  2HHT A;  2W9B B;  5L1I A;  1ZQN A;  3H8W A;  4UB4 A;  7ICJ A;  4Q8E A;  3TQ1 A;  2J6U A;  9ICR A;  8ICC A;  4B9M A;  3JPT A;  3RB3 A;  3RB4 A;  4QWC A;  3ISC A;  4O3S A;  3IM1 A;  4DQQ A;  1QSY A;  2V9W A;  1ZQJ A;  4XUS A;  4YQW A;  3C2L A;  2NRW A;  4ED6 A;  2JEI A;  2XGQ A;  8ICI A;  2AGQ A;  7ICE A;  1ZQR A;  4F4K A;  3UQ2 A;  2BQR A;  1U48 A;  5KT7 A;  5DQH A;  2PI4 A;  3NGD A;  5KFT A;  4J9P A;  4YR3 A;  4DL3 A;  1WCL A;  1NK5 A;  1RYR A;  4QZC A;  5KFR A;  3PW0 A;  1TVA A;  4Z6F A;  3MR2 A;  1L3S A;  8ICJ A;  2F1J A;  4NLZ A;  2BKE A;  3QEA Z;  4R66 A;  1T4G A;  1ZQS A;  5DB9 A;  4PH5 A;  5J0P A;  3PR4 A;  2AQ4 A;  9ICU A;  2A1J B;  4JK1 A;  9ICP A;  4PHP A;  2XY7 A;  3B0X A;  2HVI A;  5DB6 A;  9ICE A;  4J9O A;  1TK8 A;  3TFR A;  8ICP A;  3LDA A;  5KFI A;  3T5J A;  2ZTC A;  5KFD A;  3RJG A;  1PZN A;  4Z6E A;  4RUC A;  4DWI A;  1X9M A;  3V72 A;  4O3O A;  2LYH A;  1KSP A;  3RJF A;  7ICS A;  3EW9 A;  5KFX A;  4QZE A;  4UAZ A;  4I2D A;  5IIL A;  1BPE A;  1JXL A;  4K4H A;  2ISO A;  4ECU A;  2H5X A;  1TFR A;  4M47 A;  4RPX A;  5KFC A;  3BQ2 A;  4GC6 A;  3C21 A;  2XGP A;  2XY5 A;  2ZTE A;  3PW7 A;  1NJX A;  3BQT A;  4UAW A;  2P6U A;  4RQ2 A;  4YR2 A;  1NK4 A;  4RQ8 A;  4YMO A;  2VAN A;  4UB5 A;  1CUK A;  4DLE A;  2VA8 A;  5DDM A;  1HJP A;  4KN4 A;  1NKC A;  4M9J A;  4ECQ A;  2PI5 A;  4R8U B;  4M6W B;  3BQ0 A;  5HHI A;  3HT3 A;  5KT4 A;  2WTF A;  3UPQ A;  8ICR A;  2B21 A;  8ICA A;  4UAY A;  1SL0 A;  4YVZ A;  5DQG A;  4KLQ A;  1S0M A;  1KFD A;  2ZUD A;  5JUM A;  3H4D A;  2FPL A;  3GIL A;  5C5J A;  4DLG A;  4KN7 A;  4J9N A;  1KDH A;  4RPY A;  4Z6D A;  1T3N A;  2NRT A;  4KLG A;  4DSE A;  4DL4 A;  4RQ5 A;  3BJY A;  4IQU A;  5D49 A;  3GII A;  2ASJ A;  1XSP A;  2J6S A;  3G6Y A;  3SYZ A;  3GQC A;  2JEG A;  2KN7 A;  3BQ1 A;  1N48 A;  4KLS A;  1XWL A;  5J2D A;  2R8I A;  2PFN A;  4JWM A;  7ICF A;  7ICK A;  2XO7 A;  3Q8S B;  3G6V A;  2BHN A;  1TAU A;  4TUR A;  7ICV A;  5EWF A;  3H40 A;  1NOM A;  2W9M A;  4FO6 A;  1ZJN A;  2IBK A;  4RT3 A;  4F3O A;  2C28 A;  2BDP A;  4O3N A;  4MF2 A;  2NRZ A;  4BWJ A;  8ICX A;  2FLL A;  3EYZ A;  3RB0 A;  5KG3 A;  2FMP A;  2XY6 A;  3C2K A;  4GXJ A;  4LVS A;  5HML A;  4ED8 A;  3T5L A;  4FBT A;  3Q8R B;  3N4M B;  1ZQQ A;  4DOB A;  2UVR A;  4QWB A;  5J2A A;  4RNO A;  2VA3 A;  3PVX A;  4DEZ A;  9ICC A;  5DG9 A;  7ICH A;  4EYI B;  3BDP A;  2MUT B;  3ZD8 A;  5J0O A;  5DB7 A;  4FBU A;  4JV2 A;  1COO A;  3MR3 A;  2ZUC A;  4DFJ A;  5J2K A;  1ZQF A;  4B9L A;  1UA1 A;  5J0U A;  4K4I A;  3H7I A;  8ICM A;  5HP4 A;  3KHH A;  2HHU A;  2JZB A;  5CA7 A;  4MFC A;  2MUT A;  5KG4 A;  1ZQM A;  4LZG A;  4RU9 A;  3PX0 A;  2BGW A;  1ZQP A;  1L3U A;  3LWM A;  1NK8 A;  1RPL A;  3FDS A;  1IXR A;  1TK5 A;  4DQI A;  2I1Q A;  5IIM A;  1XSN A;  4TUQ A;  2AGO A;  9ICS A;  3T5K A;  5KFM A;  3UXO A;  1UA0 A;  2JEJ A;  2IA6 A;  4ELV A;  5KFO A;  4F4Y A;  3QE9 Y;  3EPG A;  4DQS A;  4DSL A;  5KTQ A;  4GC7 A;  2XCA A;  1BPD A;  1EXN A;  1NK7 A;  3ZDC A;  7ICU A;  7ICT A;  2NRX A;  3K75 D;  5HHH A;  4EYH B;  4RQ7 A;  4F4X A;  3V6J A;  2R8H A;  4O3R A;  2HHS A;  5J2I A;  4K4G A;  2BQU A;  4KLE A;  4YMN A;  5KFH A;  4DS4 A;  5KFF A;  9ICJ A;  2W9B A;  5KT2 A;  4IRK A;  4PHE A;  3RH5 A;  2AJQ A;  8ICE A;  2KTQ A;  1RXV A;  3SV3 A;  4NLG A;  1KLN A;  9ICQ A;  4CCH A;  5KFY A;  4BDP A;  1X2I A;  1XS9 D;  4QZI A;  3JPR A;  3EPI A;  1NK0 A;  1QTM A;  4R63 A;  1ZQA A;  4O5K A;  4QZ8 A;  8ICY A;  4QWE A;  4NLN A;  5J2E A;  3M9O B;  3GIM A;  5J0R A;  5KFN A;  4UBC A;  5CHG A;  4QWA A;  3LWL A;  1Y88 A;  4MFF A;  4QZG A;  1QLN A;  4RNN A;  3RRH A;  4DFM A;  4LZD A;  2AGP A;  3H4B A;  3PW2 A;  3G6X A;  4PHA A;  2Y1I A;  1U45 A;  4MEY A;  1S10 A;  5KFB A;  4YR0 A;  3MGH A;  3RB6 A;  3OSP A;  4KIT B;  3HPO A;  8ICK A;  5J0W A;  3MR5 A;  1N56 A;  3RRG A;  3M8R A;  2A1J A;  3TAP A;  2AQ0 A;  4EZ6 A;  5DGA A;  3MDC A;  2IMW P;  2FMQ A;  4IR9 A;  5KFW A;  4XQ8 A;  5J0S A;  1WCN A;  4O3Q A;  4F92 B;  4B9V A;  8ICH A;  4I2G A;  4UQG A;  3PV8 A;  1S76 D;  3HP6 A;  3SI8 A;  3V6K A;  5KFJ A;  3OSN A;  1MQ2 A;  8ICV A;  1ZQE A;  2ZJ5 A;  9ICF A;  4P4O A;  4GLX A;  1UT8 A;  5KG0 A;  4DOA A;  4RT2 A;  9ICM A;  4QZB A;  4B9N A;  3PO5 A;  3MFI A;  2BCU A;  2KZM A;  5KT6 A;  5J2H A;  5EWG A;  1JIH A;  4I27 A;  3PW5 A;  2W9A A;  3RBD A;  2FLN A;  2I9G A;  2ISP A;  3GDX A;  1S77 D;  2HVH A;  5HNK A;  3IHQ B;  4RZR A;  2KFN A;  8ICG A;  1RXW A;  1U9L A;  4NY8 A;  8ICQ A;  3Q8L A;  4M2Y A;  2W8L A;  2FPK A;  2ZJA A;  4MF8 A;  4J9Q A;  1L3T A;  2RDJ A;  5KFE A;  4DL5 A;  3QZ8 A;  2HW3 A;  4JV0 A;  5DBB A;  1T7P A;  1KTQ A;  1D8Y A;  2MAX A;  2XC9 A;  4DSF A;  5D4B A;  4KLL A;  4R8U A;  5DG8 A;  4M6W A;  5KFL A;  3AU6 A;  7ICN A;  1KFS A;  4KLT A;  7ICO A;  9ICW A;  1ZQU A;  1S9F A;  4IRC A;  4M9N A;  1KRP A;  3LK9 A;  4J9S A;  2ZUB A;  4F5N A;  7ICL A;  3RR8 A;  5J2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...