3N97B

Rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation/dna
molecule keywords RNA polymerase sigma factor
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Thermus aquaticus
total genus 21
structure length 75
sequence length 75
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3n97B00
4DSLA 2HVIA 2BR0A 2FLPA 2ZJ8A 4DS4A 9ICRA 5KG4A 1KSPA 1COOA 2W8KA 7ICSA 1NK5A 4I2GA 3QEBZ 1QSLA 1BGXT 4FO6A 8ICHA 3H8WA 2JEFA 4RQ2A 1N48A 3SYZA 3V72A 4Z6CA 4I2IA 4J9OA 1S0NA 3H4DA 4C8LA 4EZ9A 2I9GA 4J9QA 7ICMA 4NM1A 8ICZA 1Z00A 3RH5A 1T3NA 4KLEA 7ICFA 3QZ7A 1ZQWA 3UXNA 3RAXA 2HW3A 9ICGA 1JXEA 2A1JB 1MC8A 3UXPA 3RH4A 2W8LA 3C2KA 2P6UA 4RUCA 4KLGA 8ICAA 1H38A 2KTQA 4NY8A 4YD1A 2V9WA 3K4GA 5TZVA 2JEJA 8ICQA 5J0UA 1TK5A 4F4ZA 2BKEA 5IIIA 3OHBA 5KFOA 4JWMA 1S10A 4O0IA 4M6WB 1KEJA 3GV8B 4FS2A 1BPXA 4I29A 5L1LA 3ZD9A 1UT8A 4UB1A 4DO9A 2C22A 4KLOA 9ICAA 4YQWA 2VA2A 3GIKA 4MEXA 5KFRA 9ICLA 4F5QA 4RQ8A 1SZPA 4YMMA 4ECQA 1UA1A 3BQ1A 8ICFA 9ICBA 5F9LA 5J0WA 2XCPA 5DBBA 3B0YA 1BPYA 1QSYA 1TFRA 1NJXA 7ICGA 3HX0A 3V6JA 4QZ8A 4I2FA 4IQWA 8ICJA 1UT5A 2IHMA 3IHQB 5J2GA 4YG2A 1ZQOA 5KFWA 4ED7A 4DQSA 4P2HA 2BCUA 4M9JA 3H4BA 2R8KA 2ZTCA 3MDCA 4IQTA 1HJPA 4DSKA 4M9LA 3MR2A 2H5XA 9ICQA 4GXIA 5HHHA 4J9LA 4KLFA 1RPLA 2PFQA 5L1IA 2ZJ5A 1ZQSA 3SZ2A 1D9FA 3T5HA 3RR8A 4TQSA 5KFTA 2R8JA 2VA8A 4JK1A 1X9SA 4RNOA 4RNMA 3SI8A 2ISPA 5HP4A 5DQIA 7ICUA 5KFPA 3GIMA 1KDHA 4DFMA 1NJYA 2ASJA 4DSJA 4IRKA 9ICUA 5J2BA 2W9BB 1ZJMA 8ICLA 2JZBB 4ZH4A 5DQGA 4J9MA 2NRZA 8ICVA 4EBCA 2Q0ZX 1ZQYA 2ZUDA 5IIOA 4GC7A 4IQVA 5IIKA 3RBEA 1NK8A 4NLKA 3GIIA 4Z6FA 1S0OA 7ICLA 1ZQVA 3MR5A 3OSPA 4GC6A 2UVVA 3C23A 4XRHA 2DPIA 1D9DA 4R8UA 1ZQIA 4ECVA 5F9NA 3PVXA 1XSPA 5KT3A 3JPTA 2PFOA 3RB3A 4ECUA 7ICOA 4B9TA 9ICEA 2FMSA 2Y1JA 4M9HA 5CJ7A 4BGDA 1ZQNA 4DFKA 4YD2A 5KG3A 2DPJA 4LVSA 1C7YA 4DQPA 4YR3A 2KN7A 4J9SA 1ZQKA 5J0OA 3GV7B 2ZTEA 4UB3A 5IINA 1TVAA 4YXJA 1NK0A 4MF2A 2BPFA 3RRGA 1V9PA 5CR0A 4O5EA 3JPPA 1XSNA 1T4GA 2B21A 5DDYA 5BOMA 8ICMA 3ZDAA 4F4WA 2BQ3A 1QLNA 9ICVA 4ED2A 1ZQJA 5J2JA 4QZCA 5HMLA 4KN7A 3MR6A 4B9SA 5KT6A 1D8LA 4NLNA 4UB2A 8ICGA 3ZDBA 1XS9D 4JWNA 2AQ0A 2NRXA 4ECSA 4EYHB 1NK4A 4DSEA 2BGWA 4NLZA 4KTQA 5J2IA 3OHAA 4ED8A 3LK9A 4QWBA 3V6KA 5EWGA 4O5CA 1N56A 1AROP 5J0SA 3TFSA 4KITB 3RR7A 2A1JA 3TFRA 3JPNA 4DL5A 1D8YA 1KRPA 1T7PA 3BDPA 2R8IA 2XY5A 4R64A 1B22A 4RQ5A 1SL1A 2ATLA 5KT4A 3V7JA 5IILA 3HT3A 1S0VA 4QZGA 1RYSA 2F1IA 4PGYA 4P4PA 2PFPA 5J2DA 1ZQHA 3T5JA 4B9UA 2BDPA 4BDPA 1A77A 2ISOA 4PGQA 5C5JA 3RTVA 5J0RA 2J6UA 4DQRA 5CB1A 2M9NA 4I2DA 3T3FA 1L3UA 2RDJA 1XSLA 1U45A 8ICBA 1NJZA 5DGAA 1BVSA 5KFVA 4J9RA 4ECRA 3PX4A 3PV8A 1B43A 5EWFA 3Q8SB 3LWMA 2FLNA 4QWEA 3BQTA 5J0PA 1ZQXA 1ZQAA 3RJHA 2PXIA 3JPRA 4C8MA 3PMLA 4DLEA 1U48A 2VA3A 1BPDA 2VANA 4G3IA 4NXZA 2IA6A 1IXRA 4UQGA 3KTQA 4C8KA 5KT2A 4TQRA 3AU6A 1RZTA 3PMNA 2MUTB 3NTUA 3OJSA 3QZ8A 3GILA 4GXJA 2BPGA 4MF8A 3MBYA 1KFDA 3PO4A 5IIJA 4KLLA 3RJJA 9ICWA 5KFKA 5KG1A 3NGDA 1NKCA 1LV5A 9ICKA 3UXOA 2IBKA 1L5UA 4B9MA 4KLSA 3JPSA 4O3NA 4EYIB 5HHIA 4KMUA 3M8RA 1NKEA 4DF8A 2I1QA 3RJGA 4MEYA 4Q43A 4F5NA 1KFSA 2P6RA 3MFHA 4Q8FA 3BQ2A 4KLQA 7ICEA 1RYRA 4DQQA 1BPZA 9ICPA 5CP2A 4C8NA 4P4MA 2FPLA 1T8EA 1MQ2A 3SV4A 4TUSA 3PY8A 5KFBA 3PW4A 4I27A 9ICJA 3B0XA 3C1YA 4R63A 5EOZA 5J2KA 1WCLA 3RJIA 8ICRA 1ZQUA 2W9MA 4DF4A 4F4XA 3M9MB 4F50A 2PFNA 4RPYA 4QWAA 5KFEA 5D46A 1TAUA 3RBDA 4Z6EA 2BCSA 4QWDA 4YVZA 3C2LA 5KFDA 2W9AA 4F93B 4RZRA 3UQ0A 5KT7A 8ICUA 2P66A 1Z00B 2XCAA 4QZAA 3ZDDA 4DL7A 2HVHA 3TAQA 4UAZA 3Q8KA 4F8RA 4ED1A 4RQ1A 3MFIA 3TARA 1QSSA 4R65A 5DBCA 4KLTA 4DOBA 5BPCA 3IM1A 3GIJA 3C5FA 5CWRA 4PHDA 3PW2A 3ISCA 2F1JA 3C21A 4YMNA 2BHNA 4DS5A 1NJWA 4BXOA 4QZHA 1ZQRA 7ICJA 3M8SA 2KFZA 5J29A 9ICCA 1JX4A 2J6SA 1S9FA 2R8GA 1XC9A 4ECXA 3TQ1A 2AJQA 2WTFA 2W9CB 4ELUA 4TURA 2Y1IA 2XY7A 2C2EA 1NK6A 5KG5A 1KLNA 2FLLA 3C1ZA 5J2AA 1L3TA 1ZQMA 5KFCA 3OGUA 1ZQZA 4F3OA 5DBAA 4XA5A 1U4BA 1NKBA 4GXKA 4P4OA 4RQ7A 3T5LA 3PO5A 3GV5B 5D4BA 5KFNA 4UBBA 1HUOA 2ZJAA 4RPZA 4DWIA 4E0DA 8ICKA 2KFNA 5KFYA 3M9NB 4F4YA 4RPXA 5CA7A 4HYKA 4M2YA 4KN4A 4TUPA 3ETLA 3FDSA 3JPOA 5DB6A 5KFHA 7ICQA 5DDMA 3Q8QB 1LB2B 3TI0A 1TK0A 4I2AA 5KFGA 5J0QA 2OWOA 5DB7A 4EZ6A 2XC9A 4FS1A 1U49A 3GDXA 4DQIA 4O3SA 4ELTA 5KFMA 5KG6A 3PR4A 3RH6A 4KLUA 4J9KA 4QZIA 4KLIA 8ICYA 3MR3A 5KFSA 4KLHA 2XGQA 3UPQA 1TK8A 4TUQA 5KG7A 2FMQA 4IRDA 2BQUA 4DSIA 7ICPA 3G6YA 4KLMA 1EXNA 1XO1A 3RJEA 1K1SA 2XY6A 5D49A 2F1HA 4M6WA 4F91B 5IIMA 4RQ3A 4K4IA 4F5RA 4DEZA 2C2DA 5DB8A 4JV1A 3RRHA 8ICWA 2KZ3A 2ZUBA 1SKWA 2BPCA 5JUMA 3THVA 1K1QA 4RT2A 2PI5A 5DKWA 1MQ3A 4M47A 4QW9A 1S97A 1PZNA 3PX6A 2BCRA 4MFCA 5DQHA 3Q8MA 3AUOA 8ICNA 4RQ6A 1ZETA 2ZUCA 3RB0A 2HHXA 3ISDA 4UAYA 7ICKA 5DGBA 1L3SA 2IHNA 2BCQA 4UBCA 2UVWA 5DB9A 3HPOA 1KFTA 1JN3A 2HHVA 2C28A 2GWSA 4IR1A 4EBEA 5BOLA 4ED0A 3H40A 2UVRA 1S77D 8ICTA 4IRCA 5DG8A 4Z6DA 9ICNA 4F5OA 3Q8RB 4M04A 4ED3A 3RJFA 4QZBA 3MGHA 4O3RA 9ICTA 4O3QA 5KG2A 4R66A 5DLGA 3OJUA 2V4QA 1SL0A 3EPIA 1S76D 3BJYA 5L1JA 4CCHA 2KZZA 4UB5A 4J9PA 1SL2A 2BCVA 5KFLA 4RQ0A 4ECZA 4RNNA 2AGQA 1DOQA 1KTQA 4O3OA 1XU4A 2AGPA 4PHEA 1ZQEA 3QE9Y 4I2JA 4YCXA 3H8JA 2W9BA 5KFJA 3E2EA 4KLJA 2JZBA 4RT3A 1A76A 3EWAA 4YFKA 1ZYQA 4I2HA 3PR5B 9ICOA 3BQ0A 4I2CA 4K4GA 4QW8A 2HHTA 4DL4A 5KFXA 4PHPA 9ICXA 2NRWA 4ECWA 4ECTA 5KFQA 3KHLA 8ICIA 8ICCA 3N97B 4M0AA 3OSNA 2PI4A 3ZD8A 3QEAZ 2XO7A 1NOMA 1X9WA 1DGSA 5L1KA 1SKSA 2W9CA 3HWTA 5J0XA 5DG7A 4M9GA 4NM2A 4YR0A 3EZ5A 4DOAA 4EEYA 1RXWA 3KHHA 3RAQA 2FMPA 1ZQTA 4DLGA 1CEZA 3JPQA 4PH5A 1CUKA 3SV3A 3Q8PB 2ASDA 1ZQPA 4F2RA 3C5GA 4XUSA 4MFAA 4C8OA 2RDIA 3GFKB 4JV0A 1JMSA 3UQ2A 2JEGA 4RQ4A 8ICOA 5KTQA 4X5VA 2HHUA 4J9NA 1X2IA 2MAXA 7ICVA 4IQUA 4FBTA 8ICSA 4EBDA 1ZQQA 4YR2A 1BPBA 2XGPA 4ELVA 2JEIA 9ICHA 5KFAA 4BWMA 5L9XA 5KFFA 3TANA 1JIHA 4MFFA 4B9VA 3G6XA 4DSFA 4QZFA 4DFPA 7ICHA 3FYHA 4ECYA 4DFJA 2ZTDA 5J0TA 1X9MA 5EWEA 3Q8LA 2AQ4A 4F4KA 2HHQA 1ZQGA 7ICTA 4ED6A 1ZQBA 4M9NA 2AU0A 4Q8EA 4O9MA 4JUZA 2FPMA 5J2FA 4QZDA 4QWCA 2FPKA 1NK7A 5KFZA 8ICXA 1ZQCA 3HP6A 2IMWP 2KZMA 4GLXA 5J0YA 3TAPA 4QZ9A 3PNCA 3C2MA 5HMMA 4YMOA 3H7IA 4PHAA 3PW5A 1TKDA 4RU9A 4KLDA 3LDAA 1U47A 2HHSA 4Q45A 2R8HA 1L3VA 4F2SA 1HUZA 5J2HA 2ASLA 9ICIA 1TAQA 2LYHA 4O5KA 4I2BA 8ICEA 4JV2A 4QZEA 3PX0A 4LZDA 3V7LA 2DFLA 1IM4A 3LWLA 1NK9A 1MSWD 3K75D 1WCNA 4DOCA 8ICPA 3ZDEA 4YXMA 4K4HA 1BPEA 5J2EA 1Z3EB 3V7KA 1ZJNA 1Y88A 7ICRA 3V6HA 2C2RA 4DL6A 5KFIA 5HNKA 5KT5A 3PW0A 2NRTA 1UA0A 4B9NA 4UAWA 3ORYA 3EPGA 2MUTA 3KHRA 4F5PA 1SKRA 3MGIA 1QTMA 4NLGA 7ICIA 3AU2A 5DLFA 3KHGA 4PPXA 4DL2A 3EYZA 3H8SA 7ICNA 3T5KA 5DG9A 4BXOB 4R8UB 5J2CA 2NRVA 5KFUA 1ZQLA 4DL3A 4UB4A 2ALZA 5KG0A 3ZDCA 4O3PA 4LZGA 3RB6A 1ZQDA 9ICSA 9ICMA 4RUAA 3RJKA 9ICFA 3GQCA 3MABA 1TV9A 3MDAA 4F92B 2BQRA 2UVUA 3PW7A 3EW9A 1S0MA 4BWJA 3G6VA 4Q44A 3HW8A 2AGOA 4YN4A 4PGXA 1U9LA 4I28A 3N4MB 5CHGA 2HHWA 3M9OB 1JXLA 3RB4A 4I2EA 4XQ8A 4B9LA 2V4RA 3ISBA 1ZQFA 4FBUA 2J6TA 1XWLA 4IR9A 1RXVA 4YP3A
chains in the Genus database with same CATH superfamily
2W8KA 1NK5A 3QEBZ 1QSLA 8ICHA 1N48A 3SYZA 3PSPA 2I9GA 1JUDA 2Z7JA 1NI3A 7ICFA 1ZQWA 2HW3A 5AKGA 1JXEA 1XNSA 3MC1A 3UXPA 8ICAA 4RUCA 4KLGA 1H38A 4NY8A 3K4GA 2ZG6A 3A0BU 1ZD2P 1IV8A 5ALJA 4JWMA 2NV3A 1N61A 5C0YA 3FC4A 4DO9A 5ALSA 4YQWA 4US9A 2VA2A 4MEXA 9ICLA 4F5QA 1SZPA 4YMMA 4ECQA 9ICBA 2RP5A 3AQEA 3TADC 1TFRA 1NJXA 3HX0A 3V6JA 4QZ8A 8ICJA 1UT5A 4ED7A 2R8KA 2QARB 1HJPA 4M9LA 2H5XA 1ZRMA 4PJ0U 4J9LA 1ZQSA 1D9FA 3T5HA 4MHVA 4JK1A 1X9SA 4RNMA 7ICUA 5KFPA 2PKEA 3SD7A 3PZPA 9ICUA 8ICLA 2NRZA 8ICVA 3WK8A 7ICLA 1ZQVA 4QNLA 4XRHA 2PFOA 5KT3A 3RB3A 1OXJA 3UMBA 4U6PA 3WU2U 2DPJA 1PVPA 4YR3A 3HRDD 4UB3A 4MF2A 8ICMA 1T4GA 4UASA 2RQ5A 1ZQJA 4KN7A 3MR6A 4B9SA 2ZIWA 4NLNA 2G06A 5AKXA 3ZDBA 3B9JA 1XS9D 2F77X 2BGWA 3V6KA 5J0SA 3TFSA 4P0PB 4DL5A 3JPNA 4RQMA 2XY5A 4RQ5A 1SL1A 5IILA 2F1IA 2YTUA 5J2DA 2KKPA 1ZQHA 1A77A 5C5JA 4DQRA 4KX3A 8ICBA 3PX4A 2B0CA 5KFVA 4J9RA 4ECRA 3PV8A 1B43A 3HILA 3FAHA 2VJ5A 4C8MA 4DLEA 1BPDA 1IXRA 2E8PA 2DF4B 3KTQA 3PMNA 3EUB2 3GILA 4AP9A 2BPGA 1C20A 9ICWA 3BS7A 3QUBA 4C7YA 4Y2TA 3M6KA 5HHIA 4KMUA 3M8RA 4F5NA 1KFSA 2OYYA 4Q8FA 3L4PA 1RYRA 2O6KA 2W11A 5B66U 9ICPA 1T8EA 4FZLA 3PW4A 4P0QA 4PL2A 4R63A 5EOZA 5J2KA 3RJIA 3M9MB 5KFEA 1F0MA 1TAUA 4Z6EA 4QWDA 2PMZC 4YVZA 3DEEA 5KFDA 3UQ0A 5ALNA 5ALFA 2P66A 2XCAA 2LKYA 3ZDDA 2HVHA 4UAZA 3H0RB 3Q8KA 5JTIA 4F8RA 4RQ1A 5ALKA 3MFIA 5TISU 4DOBA 3IM1A 3F53A 2K4HA 2WF9A 3RF9A 3PW2A 2IOFK 4OJ6A 4YMNA 4QZHA 5AKKA 1WG8A 4ECXA 2AJQA 2YMLA 2W9CB 4ELUA 2FLLA 5J2AA 5HR7A 3OGUA 4P4OA 1ZXIA 5T14A 5ALDA 4UBBA 4CF5A 2QB0B 2KIWA 1K5OA 1QH9A 8ICKA 4F4YA 4RPXA 5AI6A 3K1RB 7ICQA 3JPOA 3Q8QB 1LVHA 2Y0SF 5J0QA 1U49A 4DQIA 4O3SA 4ELTA 3PR4A 3RH6A 4J9KA 4QZIA 3I1YA 3WK4A 2EAOA 4KLIA 8ICYA 3NRWA 3E58A 3WKAA 5KFSA 1VLBA 4IRDA 2BQUA 1XO1A 3RJEA 2A1AA 2EDUA 4RQ3A 1QQ6A 1SKWA 2BPCA 1V85A 3THVA 5ALGA 5A0LA 5DKWA 1MQ3A 3PX6A 3Q8MA 4RQ6A 2HHXA 2ZUCA 7ICKA 2YMQA 2GO7A 1PVRA 2LM4A 1KFTA 2C28A 2GWSA 4EBEA 4ED0A 3H40A 8ICTA 2QARA 1SIJA 4CDGA 4M04A 3RJFA 3N7PD 4Y2JA 1S76D 3EPIA 5L1JA 4RQ0A 4O3OA 1KTQA 1ZQEA 2EAPA 2F44A 1SV4A 1A76A 2HOQA 3PR5B 3BQ0A 4UARA 4ECWA 1ZRNA 4JMUA 3QEAZ 1NOMA 1DGSA 3EZ5A 4FFDA 5AIAA 3RAQA 4NL9A 4DLGA 3JPQA 1CRXA 3C5GA 1MN8A 4UB6U 4JV0A 8ICOA 3DDHA 3H8MA 4EBDA 2JEIA 9ICHA 2W3SA 4BWMA 5KFFA 4MFFA 4B9VA 4P0PA 4OCZA 3Q8LA 4ED6A 1ZQBA 4Q8EA 2AU0A 3PSFA 2FPMA 4QZDA 8ICXA 2FPKA 4AYBC 5KFZA 4QZ9A 5HMMA 3H7IA 3WK7A 4RU9A 1FFVA 3LDAA 2HHSA 5EE1A 4F2SA 5AM1A 2E1EA 2ES6A 4O5KA 1YZ6A 3V7LA 1MSWD 2MA1A 1OW5A 3IP4B 5J2EA 1Z3EB 3V7KA 2G07A 3D2SA 5KFIA 1UA0A 3EPGA 3KHRA 4F5PA 1QTMA 4QJFB 3MGIA 2KHVA 2E8MA 4CF4A 4PPXA 5J2CA 1UHUA 2E8NA 1RM6C 2KVCA 3RB6A 1ZQDA 9ICMA 3GQCA 2FDRA 1TV9A 3MDAA 2UVUA 5AI9A 2LYBA 3EW9A 5ALTA 1S0MA 4BWJA 3G6VA 4Q44A 2AGOA 4PGXA 4I28A 3N4MB 4EENA 2VJ4A 1JXLA 4B9LA 2J6TA 1XWLA 2N1RA 5KAFU 1NNLA 2K60A 4DSLA 2HVIA 4DS4A 1KSPA 2ZIWB 7ICSA 4ICAA 2JV3A 4OD0A 2JEFA 4Z6CA 4J9OA 4NM1A 2W43A 1T3NA 9ICGA 3KKAA 2W3RA 2W8LA 4YD1A 2V9WA 3VC8A 2JEJA 1JROA 2HBLA 2OCEA 3J81j 5IIIA 5AM3A 3OHBA 2AXTU 1WYGA 3GV8B 4I29A 3ZD9A 1UT8A 2C22A 4KLOA 1O03A 1X40A 4UB8U 1N5XA 1UA1A 1JRPA 3TKAA 2LPEA 5F9LA 2XCPA 7ICGA 3KKAC 4IQWA 2GOLA 2I5HA 4I2FA 3OTQA 2IHMA 3IHQB 1ZQOA 2BCUA 4IS7A 2YB4A 3CNHA 2ZTCA 3MDCA 4GXIA 2KOBA 5L1IA 2ZJ5A 3HKZC 5J8YA 1UPHA 3SI8A 2ISPA 5HP4A 5DQIA 4OO1J 4DCCA 3GIMA 1KDHA 3QU7A 1Q3UA 2W9BB 2JR5A 4J9MA 4GC7A 3RBEA 5IIOA 4IQVA 5IIKA 2Q4TA 3GIIA 3MR5A 4GC6A 2WAQC 3ETRA 4R8UA 4ECVA 3JPTA 3NVYA 4OJOA 4ECUA 4Y2XA 5J8YC 2FMSA 4CE6A 4BGDA 1ZQNA 2OHFA 4DFKA 4UW9A 1C7YA 4J9SA 2HCFA 1TVAA 5IINA 4YXJA 2A19A 2P35A 5CR0A 3JPPA 1DXSA 5DDYA 3WK9A 5BOMA 1QCKA 2BQ3A 3ZDAA 3KZXA 4QZCA 1VJ5A 5HMLA 3MGVA 4UB2A 8ICGA 5ALMA 5L1MA 4KTQA 4ED8A 1SGGA 4QWBA 4KITB 3RR7A 2A1JA 1T7PA 3RFAA 2R18A 2WF7A 2ZXIA 4R64A 3WKCA 2ATLA 3H0LB 3HT3A 4QZGA 1F5SA 5ALIA 1RYSA 4P4PA 3T5JA 4BDPA 2BDPA 2XI9A 3RTVA 5J0RA 2J6UA 5CB1A 3T3FA 3KFUF 1XSLA 1U45A 1NJZA 2H3VA 4Y2RA 2KSOB 2W7OA 3NVZA 3KD3A 2OM6A 2XICA 3S6JA 2PXIA 3JPRA 2VANA 4G3IA 1YT3A 1BNOA 4UQGA 4O3MA 4C8KA 4TQRA 3QZ8A 3NVVA 3MBYA 1IG6A 1SXDA 3PO4A 2DUYA 5ALYA 4EYIB 5AK5A 3RJGA 2LYAA 2I1QA 4DF8A 3MFHA 4KLQA 2NO4A 4C8NA 1MQ2A 5AI4A 3SV4A 2XIDA 2F3NA 4F50A 3ED5A 2DGZA 3RBDA 1WWVA 2E1FA 1Z00B 3TAQA 3SQIA 2HBJA 4ED1A 3F5AA 1QSSA 4R65A 1ECWA 5CWRA 4PHDA 3ISCA 3C21A 3M8SA 9ICCA 2J6SA 4NLCA 2WTFA 2Y1IA 2XY7A 1KLNA 3C1ZA 3IRUA 1ZQMA 2AH5A 2D8CA 5DBAA 4XA5A 3GV5B 5D4BA 1HUOA 4DWIA 5KFYA 5CA7A 2NYVA 4M2YA 3FDSA 4CNQA 5DB6A 1VDVA 2KMDA 1TK0A 5KFGA 2CPRA 2OWOA 4EZ6A 5DB7A 2XC9A 5G5HA 1X66A 1CI4A 2ESEA 5AKYA 5EE0A 1ED1A 2FMQA 3UMGA 4EEKA 3G6YA 2XVTA 3KBBA 4KLMA 1K1SA 5D49A 2F1HA 4F91B 3QXGA 1SB3C 4F5RA 5DB8A 1O08A 2Y9TA 5AM2A 2ZUBA 5JUMA 3F2BA 2G5IB 4OJLA 1S97A 1PZNA 5DQHA 4Y2VA 3ISDA 3KZIU 2IHNA 2BCQA 4UBCA 1JI7A 2UVWA 3HPOA 1JN3A 4BX9C 2ZIUA 1S77D 5DG8A 4Z6DA 1P7DA 3Q8RB 3MGHA 9ICTA 5KG2A 3OJUA 5ALLA 1SL0A 2RLTA 2JHDA 4J9PA 1SL2A 3C28A 1Z4NA 2K4IA 3T79A 2D6FC 4PHEA 3QE9Y 2K8BB 3H8JA 2W9BA 4KLJA 4RT3A 3EWAA 4YFKA 2WB1F 2F2AB 2HBKA 2HHTA 5KFXA 4PHPA 9ICXA 2EQYA 8ICCA 3D2NA 4M0AA 3OSNA 1KL9A 3PSTA 2PI4A 3ZD8A 4QIWF 2XO7A 5L1KA 3HWTA 5DG7A 4F71A 4YR0A 4EEYA 2HOFA 3A0HU 3KHHA 1FFUA 3C29A 2ASDA 4PH5A 2WF8A 4F2RA 4NJ8A 4XUSA 2RDIA 2CXYA 2JEGA 5AK6A 4X5VA 1SWVA 4PZNA 1ZQQA 2XGPA 1RQNA 4QZFA 7ICHA 3FYHA 4ECYA 4DFJA 4F4KA 1X9MA 2HHQA 1ZQGA 2YMPA 2D3DA 3QUQA 2KZMA 5J0YA 3TAPA 3PW5A 1TKDA 1L7PA 4Q45A 3AL0B 5AK4A 2LHTA 5J2HA 2KSOA 2LYHA 4Y2QA 4I2BA 8ICEA 2DKZA 4KMOB 4JV2A 3PX0A 2DFLA 3QUCA 1L7NA 1WCNA 8ICPA 1BPEA 3V6HA 1T3QA 5HNKA 3BQ7A 4KX5A 2NRTA 3ORYA 4WJ3B 1SKRA 5ALXA 3R9KA 1D8BA 2H3QA 1PK1B 3H8SA 7ICNA 5H2FU 4R8UB 2NRVA 5ALQA 1ZQLA 2HSZA 3ZDCA 3D2QA 1DK2A 4F92B 4FE3A 1QQ5A 4YN4A 2HHWA 4XQ8A 2WHEA 3ISBA 4FBUA 5EE9A 3L5KA 2BR0A 2FLPA 1L7MA 2ZJ8A 4I2GA 1COKA 1BGXT 3H8WA 4RQ2A 3V72A 4C8LA 3H4DA 7ICMA 8ICZA 1Z00A 3RH5A 4KLEA 3QZ7A 3CP8A 3UXNA 3RAXA 2KD1A 2A1JB 3OPXA 1MC8A 2P6UA 2KTQA 1AQ6A 5TZVA 2KK0A 5J0UA 4F4ZA 3SAFA 1Q3VA 2QB1A 5AM4A 1YZ7A 1S10A 2YY6A 1KEJA 5F3XB 1BPXA 5L1LA 9ICAA 5ALZA 3M1YA 3GIKA 3GU3A 2KIVA 1MA7A 4RQ8A 5J0WA 3B0YA 5ALRA 1BPYA 3NRZA 5ALUA 4GIBA 4YG2A 4J03A 4DQSA 1V97A 3WK5A 2EANA 3MR2A 3IG8A 5HHHA 2PFQA 3RR8A 4TQSA 5KFTA 3I76A 4RNOA 5ALHA 4DFMA 4DSJA 1ZJMA 4NL9C 5DQGA 3D6JA 4NLKA 4Z6FA 2EAMA 5JRTA 3OSPA 2UVVA 1D9DA 5F9NA 1XSPA 4B9TA 9ICEA 5G5GA 2Y1JA 4M9HA 2EZXA 5KG3A 2HOIA 2KN7A 5J0OA 2ZIVB 4C4TA 2Y0SC 2BPFA 4Y2PA 1KKXA 2B21A 5HR6A 4F4WA 9ICVA 4ED2A 5J2JA 1M6YA 1D8LA 5AK3A 4JWNA 2AQ0A 2NRXA 4EYHB 1NK4A 5J2IA 3OHAA 3LK9A 5EWGA 1S5LU 4O5CA 1N56A 3TFRA 1KRPA 2E3TA 4NLBA 1B22A 2H3FA 4USAA 5KL1B 3V7JA 1S0VA 2MU2A 2ISOA 2M9NA 4I2DA 3UM9A 2RDJA 2DKXA 5DGAA 1BVSA 4A8EA 5EWFA 3CW2C 4JB3A 3Q8SB 2FLNA 2CN1A 2RHFA 3O0FA 3RJHA 5ALOA 3LVVA 2VA3A 2EZYA 4C4SA 5KT2A 3AU6A 1RZTA 3NTUA 3OJSA 2JMGA 2JGAA 2K8CB 2QKQA 4GXJA 4MF8A 1FIQA 3QU5A 4UAUA 5IIJA 4GFJA 4KLLA 5KFKA 5AKIA 1J97A 3NGDA 2IBKA 1L5UA 4B9MA 2VIXA 3JPSA 4O3NA 2IOHA 3IN5A 5ALVA 2P6RA 1BPZA 5CP2A 2HDOA 2FPLA 3ZI4A 4ACOA 2E8OA 2ZIUB 5EE3A 4Y2YA 1ZQUA 2FE9A 2PFNA 1B0XA 4QWAA 5AHXA 3C2LA 2K4EA 5KT7A 1NZBA 4QZAA 2HMXA 1X42A 3TARA 4KLTA 5BPCA 3GIJA 5KNIA 1PK1A 1J2NA 4DS5A 4HAIA 3ICXA 1SV0A 1ZQRA 4RQNA 5J29A 1XC9A 4UAVA 5AM5A 2C2EA 1NK6A 3WKBA 1IIPA 1L3TA 4F3OA 5AKEA 1X9XA 1NKBA 4GXKA 3N7SC 4RQ7A 3T5LA 2G08A 2DL0A 4E0DA 2KFNA 2KV2A 3M9NB 1SV0C 4HYKA 1KW4A 1ZOLA 4KN4A 4TUPA 2LBOA 5KFHA 5DDMA 4I2AA 1Z1BA 5KFMA 5KG6A 4KLUA 2W04A 2I6XA 1OUQA 4OJ5A 1SXEA 2XGQA 1TK8A 2YB1A 3QUTA 4DSIA 7ICPA 2KJ9A 1EXNA 2XY6A 3L3FX 3QU2A 4JV1A 8ICWA 2KZ3A 1RDFA 1K1QA 4RT2A 2PI5A 4M47A 2BCRA 3RB0A 4UAYA 5DB9A 3F2DA 3AM9A 5BOLA 2HI0A 4LJXA 9ICNA 3IG5A 4ED3A 4O3RA 2V4QA 4R66A 2HBMA 3BJYA 4UB5A 2BCVA 3TADA 2AGQA 1DOQA 2K8AA 4I2JA 4YCXA 5KFJA 3AQFA 4IC9A 4QW8A 4DL4A 3DV9A 2NRWA 2IOFA 3KHLA 8ICIA 3N97B 3FM9A 3BS5B 4M9GA 4NM2A 4DOAA 1RXWA 2ZIVA 1ZQTA 1N2XA 2FMPA 3SV3A 1CUKA 3Q8PB 2KEYA 4C8OA 2B6GA 3LVWA 3GFKB 1LKYA 2HHUA 2PMZF 2MAXA 3QU4A 1ZQ1C 4IQUA 4FBTA 4YR2A 4ELVA 5KFAA 5L9XA 3NASA 3TANA 1JIHA 3G6XA 4DSFA 1S8OA 2BDUA 2ZTDA 5J0TA 5EWEA 4M9NA 1A6SA 5ALEA 4PZOA 3HP6A 2IMWP 3PNCA 4YMOA 2A3VA 4PHAA 1JALA 3F2CA 2M0NA 3I28A 3NVWA 2ASLA 9ICIA 1TAQA 2YX8A 4QZEA 3QU9A 1IM4A 1NK9A 1FO4A 3K75D 3ZDEA 4YXMA 4K4HA 1DGJA 2K89A 1Y88A 2C2RA 4DL6A 3PW0A 2KJ5A 4UAWA 4NLGA 1X6JA 7ICIA 3AU2A 3KHGA 4DL2A 3EYZA 2ODGA 4BXOB 5FP0A 5KFUA 3AEVA 3IV6A 3TACB 3UMCA 5KG0A 3IDWA 9ICSA 3RJKA 2EZZA 3MABA 2BQRA 3PW7A 2W03A 3HW8A 1U9LA 5CHGA 3M9OB 5KAIU 2V4RA 4IR9A 1RXVA 5E79U 9ICRA 2W55A 5KG4A 1COOA 5AIBA 2LMRA 4FO6A 1N60A 1S0NA 4I2IA 8ICUA 4CF3A 4EZ9A 4J9QA 2GH1A 5AKZA 3RH4A 3C2KA 2DWQA 3BZKA 8ICQA 1TK5A 2E5SA 4EX7A 2BKEA 5KFOA 4O0IA 4M6WB 4FS2A 4UB1A 4BJQA 2KG5A 5KFRA 3BQ1A 8ICFA 1URJA 4U7CA 5DBBA 1QSYA 2G0AA 5J2GA 1Z1VA 1TE2A 2WF6A 5KFWA 3HJEA 4P2HA 4PL1A 4M9JA 3H4BA 2JRZA 1PK3A 4DSKA 4IQTA 4FZNA 9ICQA 4ZOHC 4KLFA 1RPLA 3N28A 3SAHA 3SZ2A 2R8JA 2VA8A 3M6ZA 3QYPA 2F8LA 3M7DA 2ASJA 1NJYA 4IRKA 5J2BA 2JZBB 4ZH4A 4CGZA 4EBCA 2Q0ZX 1ZQYA 2ZUDA 1NK8A 1S0OA 4DFDA 1UCVA 3C23A 2DPIA 3AMZA 1ZQIA 3PVXA 5AM0A 2KICA 7ICOA 4OJPA 2JXJA 1L6NA 4AYBF 5CJ7A 4YD2A 4LVSA 4DQPA 1ZQKA 3GV7B 2ZTEA 1NK0A 3RRGA 1V9PA 5GTIU 4O5EA 1XSNA 1QLNA 4CRXA 1KN5A 1T94A 4NWIA 5KT6A 3ONNA 4ECSA 3KOOA 4DSEA 4NLZA 3SR6A 5KL8B 1AROP 1WWUA 5AICA 1ZD4A 3BDPA 1D8YA 1J2MA 2R8IA 3GZFA 5ALWA 2KKVA 5KT4A 5GTHU 5B5EU 4PGYA 2PFPA 4B9UA 4C80A 4PGQA 2ZIXB 3WK6A 1L3UA 2KHQA 3E0FA 1B4FA 5AI8A 3BS5A 3LWMA 1N63A 4QWEA 1DK3A 3BQTA 5J0PA 1ZQXA 1ZQAA 4G9BA 2MSNA 2YQEA 5AI5A 3PMLA 1U48A 4NXZA 2IA6A 1KBUA 2MUTB 2OH2A 4Y2SA 2F76X 1KFDA 2WB1C 4NV0A 3RJJA 2WF5A 5KG1A 1NKCA 1LV5A 9ICKA 4FZMA 3QNMA 3UXOA 2ZXHA 5K4LA 4KLSA 1HEKA 3SMVA 1NKEA 4MEYA 4Q43A 1L8LA 3AN1A 4QIWC 3BQ2A 7ICEA 4DQQA 1PVQA 4P4MA 4TUSA 2KVSA 3PY8A 5KFBA 4I27A 9ICJA 3B0XA 3C1YA 8ICRA 1N62A 1WCLA 3QX7A 2W9MA 2EH9A 4Y2UA 4F4XA 4DF4A 4RPYA 5D46A 2G09A 2H3ZA 2BCSA 3BZCA 2W9AA 4RZRA 3SENA 1Q46A 4F93B 4DL7A 3F5EA 2Y9UA 5DBCA 3C5FA 2K4PA 2LM1A 3U26A 3HKZF 2QLTA 2F1JA 2BHNA 1NJWA 4BXOA 7ICJA 1WUDA 2KFZA 1JX4A 1S9FA 4EX6A 2R8GA 3TQ1A 4TURA 3WKDA 5KG5A 5KFCA 1ZQZA 1U4BA 2WAQF 2LI6A 3PO5A 3WKEA 5KFNA 1Z4OA 2ZJAA 1LKYB 4RPZA 5ALPA 3SEIA 3ETLA 1LB2B 3TI0A 1RYUA 4FS1A 1GO3F 3GDXA 3CYMA 3MR3A 4C0ZA 4KLHA 3UPQA 4TUQA 5KG7A 3LYSA 3H0MB 1DRGA 5AI0A 3NUQA 4M6WA 4C7ZA 5IIMA 2OEHA 4K4IA 4DEZA 2C2DA 3RRHA 2AHOB 1BNPA 2G5HB 5JU5A 4QW9A 2DQNB 2CRXA 4MFCA 8ICNA 3AUOA 1ZETA 2BZFA 1FEZA 5DGBA 1L3SA 4US8A 2F8KA 1RG6A 1QQ7A 1Z19A 2HHVA 4IR1A 3SAGA 2UVRA 4F72A 4IRCA 2JH7A 4F5OA 4QZBA 4O3QA 1NZPA 5DLGA 2KP7A 4CCHA 2KZZA 4B6JA 3K1ZA 5KFLA 2NO5A 4ECZA 2WFAA 4RNNA 2AGPA 1XU4A 2FJ6A 1KQQA 3E2EA 3PSIA 2JZBA 1X6IA 1HIWA 5CRXA 4C4RA 1ZYQA 4I2HA 2W7PA 9ICOA 3ALRA 2H3IA 4K4GA 4I2CA 1PUZA 4UATA 2VKQA 3N7RC 5KFQA 4ECTA 2RRDA 1X9WA 1SKSA 2W9CA 2YMMA 5J0XA 1N5WA 2W54A 5AKJA 2MRLA 2KNJA 1CEZA 4EELA 1ZQPA 4MFAA 2QB0A 3UQ2A 1JMSA 1A0PA 4RQ4A 2JH1A 5KTQA 4J9NA 1X2IA 7ICVA 2GLEA 8ICSA 4IL6U 1BPBA 1V38A 1ZD5A 1SZHA 5AKLA 2L5YA 2FI1A 4DFPA 3VCBA 2AQ4A 7ICTA 1RQLA 4O9MA 4JUZA 4BUGA 1NK7A 5J2FA 4QWCA 1UQVA 1ZQCA 4GLXA 3C2MA 2YN4A 2ZIXA 4KLDA 1U47A 4P0QB 2KE7A 2R8HA 1L3VA 1HUZA 1SWWA 1TAMA 1L8OA 4LZDA 3LWLA 4DOCA 3CRXA 1ZJNA 7ICRA 5CEHA 2DBYA 2OXOA 5KT5A 4B9NA 2MUTA 3NS1A 5AKHA 5DLFA 3T5KA 1Q8KA 5DG9A 1F44A 1L7OA 1ZD3A 4DL3A 4UB4A 2ALZA 4O3PA 4LZGA 2KJ8A 4RUAA 9ICFA 3RB4A 4I2EA 1ZQFA 1XO0A 4YP3A
chains in the Genus database with same CATH topology
4DSLA 2HVIA 2BR0A 2FLPA 2ZJ8A 4DS4A 9ICRA 5KG4A 1KSPA 1COOA 2W8KA 7ICSA 1NK5A 4I2GA 3QEBZ 1QSLA 1BGXT 4FO6A 8ICHA 3H8WA 2JEFA 4RQ2A 1N48A 3SYZA 3V72A 4Z6CA 4I2IA 4J9OA 1S0NA 3H4DA 4C8LA 4EZ9A 2I9GA 4J9QA 7ICMA 4NM1A 8ICZA 1Z00A 3RH5A 1T3NA 4KLEA 7ICFA 3QZ7A 1ZQWA 3UXNA 3RAXA 2HW3A 9ICGA 1JXEA 2A1JB 1MC8A 3UXPA 3RH4A 2W8LA 3C2KA 2P6UA 4RUCA 4KLGA 8ICAA 1H38A 2KTQA 4NY8A 4YD1A 2V9WA 3K4GA 5TZVA 2JEJA 8ICQA 5J0UA 1TK5A 4F4ZA 2BKEA 5IIIA 3OHBA 5KFOA 4JWMA 1S10A 4O0IA 4M6WB 1KEJA 3GV8B 4FS2A 1BPXA 4I29A 5L1LA 3ZD9A 1UT8A 4UB1A 4DO9A 2C22A 4KLOA 9ICAA 4YQWA 2VA2A 3GIKA 4MEXA 5KFRA 9ICLA 4F5QA 4RQ8A 1SZPA 4YMMA 4ECQA 1UA1A 3BQ1A 8ICFA 9ICBA 5F9LA 5J0WA 2XCPA 5DBBA 3B0YA 1BPYA 1QSYA 1TFRA 1NJXA 7ICGA 3HX0A 3V6JA 4QZ8A 4I2FA 4IQWA 8ICJA 1UT5A 2IHMA 3IHQB 5J2GA 4YG2A 1ZQOA 5KFWA 4ED7A 4DQSA 4P2HA 2BCUA 4M9JA 3H4BA 2R8KA 2ZTCA 3MDCA 4IQTA 1HJPA 4DSKA 4M9LA 3MR2A 2H5XA 9ICQA 4GXIA 5HHHA 4J9LA 4KLFA 1RPLA 2PFQA 5L1IA 2ZJ5A 1ZQSA 3SZ2A 1D9FA 3T5HA 3RR8A 4TQSA 5KFTA 2R8JA 2VA8A 4JK1A 1X9SA 4RNOA 4RNMA 3SI8A 2ISPA 5HP4A 5DQIA 7ICUA 5KFPA 3GIMA 1KDHA 4DFMA 1NJYA 2ASJA 4DSJA 4IRKA 9ICUA 5J2BA 2W9BB 1ZJMA 8ICLA 2JZBB 4ZH4A 5DQGA 4J9MA 2NRZA 8ICVA 4EBCA 2Q0ZX 1ZQYA 2ZUDA 5IIOA 4GC7A 4IQVA 5IIKA 3RBEA 1NK8A 4NLKA 3GIIA 4Z6FA 1S0OA 7ICLA 1ZQVA 3MR5A 3OSPA 4GC6A 2UVVA 3C23A 4XRHA 2DPIA 1D9DA 4R8UA 1ZQIA 4ECVA 5F9NA 3PVXA 1XSPA 5KT3A 3JPTA 2PFOA 3RB3A 4ECUA 7ICOA 4B9TA 9ICEA 2FMSA 2Y1JA 4M9HA 5CJ7A 4BGDA 1ZQNA 4DFKA 4YD2A 5KG3A 2DPJA 4LVSA 1C7YA 4DQPA 4YR3A 2KN7A 4J9SA 1ZQKA 5J0OA 3GV7B 2ZTEA 4UB3A 5IINA 1TVAA 4YXJA 1NK0A 4MF2A 2BPFA 3RRGA 1V9PA 5CR0A 4O5EA 3JPPA 1XSNA 1T4GA 2B21A 5DDYA 5BOMA 8ICMA 3ZDAA 4F4WA 2BQ3A 1QLNA 9ICVA 4ED2A 1ZQJA 5J2JA 4QZCA 5HMLA 4KN7A 3MR6A 4B9SA 5KT6A 1D8LA 4NLNA 4UB2A 8ICGA 3ZDBA 1XS9D 4JWNA 2AQ0A 2NRXA 4ECSA 4EYHB 1NK4A 4DSEA 2BGWA 4NLZA 4KTQA 5J2IA 3OHAA 4ED8A 3LK9A 4QWBA 3V6KA 5EWGA 4O5CA 1N56A 1AROP 5J0SA 3TFSA 4KITB 3RR7A 2A1JA 3TFRA 3JPNA 4DL5A 1D8YA 1KRPA 1T7PA 3BDPA 2R8IA 2XY5A 4R64A 1B22A 4RQ5A 1SL1A 2ATLA 5KT4A 3V7JA 5IILA 3HT3A 1S0VA 4QZGA 1RYSA 2F1IA 4PGYA 4P4PA 2PFPA 5J2DA 1ZQHA 3T5JA 4B9UA 2BDPA 4BDPA 1A77A 2ISOA 4PGQA 5C5JA 3RTVA 5J0RA 2J6UA 4DQRA 5CB1A 2M9NA 4I2DA 3T3FA 1L3UA 2RDJA 1XSLA 1U45A 8ICBA 1NJZA 5DGAA 1BVSA 5KFVA 4J9RA 4ECRA 3PX4A 3PV8A 1B43A 5EWFA 3Q8SB 3LWMA 2FLNA 4QWEA 3BQTA 5J0PA 1ZQXA 1ZQAA 3RJHA 2PXIA 3JPRA 4C8MA 3PMLA 4DLEA 1U48A 2VA3A 1BPDA 2VANA 4G3IA 4NXZA 2IA6A 1IXRA 4UQGA 3KTQA 4C8KA 5KT2A 4TQRA 3AU6A 1RZTA 3PMNA 2MUTB 3NTUA 3OJSA 3QZ8A 3GILA 4GXJA 2BPGA 4MF8A 3MBYA 1KFDA 3PO4A 5IIJA 4KLLA 3RJJA 9ICWA 5KFKA 5KG1A 3NGDA 1NKCA 1LV5A 9ICKA 3UXOA 2IBKA 1L5UA 4B9MA 4KLSA 3JPSA 4O3NA 4EYIB 5HHIA 4KMUA 3M8RA 1NKEA 4DF8A 2I1QA 3RJGA 4MEYA 4Q43A 4F5NA 1KFSA 2P6RA 3MFHA 4Q8FA 3BQ2A 4KLQA 7ICEA 1RYRA 4DQQA 1BPZA 9ICPA 5CP2A 4C8NA 4P4MA 2FPLA 1T8EA 1MQ2A 3SV4A 4TUSA 3PY8A 5KFBA 3PW4A 4I27A 9ICJA 3B0XA 3C1YA 4R63A 5EOZA 5J2KA 1WCLA 3RJIA 8ICRA 1ZQUA 2W9MA 4DF4A 4F4XA 3M9MB 4F50A 2PFNA 4RPYA 4QWAA 5KFEA 5D46A 1TAUA 3RBDA 4Z6EA 2BCSA 4QWDA 4YVZA 3C2LA 5KFDA 2W9AA 4F93B 4RZRA 3UQ0A 5KT7A 8ICUA 2P66A 1Z00B 2XCAA 4QZAA 3ZDDA 4DL7A 2HVHA 3TAQA 4UAZA 3Q8KA 4F8RA 4ED1A 4RQ1A 3MFIA 3TARA 1QSSA 4R65A 5DBCA 4KLTA 4DOBA 5BPCA 3IM1A 3GIJA 3C5FA 5CWRA 4PHDA 3PW2A 3ISCA 2F1JA 3C21A 4YMNA 2BHNA 4DS5A 1NJWA 4BXOA 4QZHA 1ZQRA 7ICJA 3M8SA 2KFZA 5J29A 9ICCA 1JX4A 2J6SA 1S9FA 2R8GA 1XC9A 4ECXA 3TQ1A 2AJQA 2WTFA 2W9CB 4ELUA 4TURA 2Y1IA 2XY7A 2C2EA 1NK6A 5KG5A 1KLNA 2FLLA 3C1ZA 5J2AA 1L3TA 1ZQMA 5KFCA 3OGUA 1ZQZA 4F3OA 5DBAA 4XA5A 1U4BA 1NKBA 4GXKA 4P4OA 4RQ7A 3T5LA 3PO5A 3GV5B 5D4BA 5KFNA 4UBBA 1HUOA 2ZJAA 4RPZA 4DWIA 4E0DA 8ICKA 2KFNA 5KFYA 3M9NB 4F4YA 4RPXA 5CA7A 4HYKA 4M2YA 4KN4A 4TUPA 3ETLA 3FDSA 3JPOA 5DB6A 5KFHA 7ICQA 5DDMA 3Q8QB 1LB2B 3TI0A 1TK0A 4I2AA 5KFGA 5J0QA 2OWOA 5DB7A 4EZ6A 2XC9A 4FS1A 1U49A 3GDXA 4DQIA 4O3SA 4ELTA 5KFMA 5KG6A 3PR4A 3RH6A 4KLUA 4J9KA 4QZIA 4KLIA 8ICYA 3MR3A 5KFSA 4KLHA 2XGQA 3UPQA 1TK8A 4TUQA 5KG7A 2FMQA 4IRDA 2BQUA 4DSIA 7ICPA 3G6YA 4KLMA 1EXNA 1XO1A 3RJEA 1K1SA 2XY6A 5D49A 2F1HA 4M6WA 4F91B 5IIMA 4RQ3A 4K4IA 4F5RA 4DEZA 2C2DA 5DB8A 4JV1A 3RRHA 8ICWA 2KZ3A 2ZUBA 1SKWA 2BPCA 5JUMA 3THVA 1K1QA 4RT2A 2PI5A 5DKWA 1MQ3A 4M47A 4QW9A 1S97A 1PZNA 3PX6A 2BCRA 4MFCA 5DQHA 3Q8MA 3AUOA 8ICNA 4RQ6A 1ZETA 2ZUCA 3RB0A 2HHXA 3ISDA 4UAYA 7ICKA 5DGBA 1L3SA 2IHNA 2BCQA 4UBCA 2UVWA 5DB9A 3HPOA 1KFTA 1JN3A 2HHVA 2C28A 2GWSA 4IR1A 4EBEA 5BOLA 4ED0A 3H40A 2UVRA 1S77D 8ICTA 4IRCA 5DG8A 4Z6DA 9ICNA 4F5OA 3Q8RB 4M04A 4ED3A 3RJFA 4QZBA 3MGHA 4O3RA 9ICTA 4O3QA 5KG2A 4R66A 5DLGA 3OJUA 2V4QA 1SL0A 3EPIA 1S76D 3BJYA 5L1JA 4CCHA 2KZZA 4UB5A 4J9PA 1SL2A 2BCVA 5KFLA 4RQ0A 4ECZA 4RNNA 2AGQA 1DOQA 1KTQA 4O3OA 1XU4A 2AGPA 4PHEA 1ZQEA 3QE9Y 4I2JA 4YCXA 3H8JA 2W9BA 5KFJA 3E2EA 4KLJA 2JZBA 4RT3A 1A76A 3EWAA 4YFKA 1ZYQA 4I2HA 3PR5B 9ICOA 3BQ0A 4I2CA 4K4GA 4QW8A 2HHTA 4DL4A 5KFXA 4PHPA 9ICXA 2NRWA 4ECWA 4ECTA 5KFQA 3KHLA 8ICIA 8ICCA 3N97B 4M0AA 3OSNA 2PI4A 3ZD8A 3QEAZ 2XO7A 1NOMA 1X9WA 1DGSA 5L1KA 1SKSA 2W9CA 3HWTA 5J0XA 5DG7A 4M9GA 4NM2A 4YR0A 3EZ5A 4DOAA 4EEYA 1RXWA 3KHHA 3RAQA 2FMPA 1ZQTA 4DLGA 1CEZA 3JPQA 4PH5A 1CUKA 3SV3A 3Q8PB 2ASDA 1ZQPA 4F2RA 3C5GA 4XUSA 4MFAA 4C8OA 2RDIA 3GFKB 4JV0A 1JMSA 3UQ2A 2JEGA 4RQ4A 8ICOA 5KTQA 4X5VA 2HHUA 4J9NA 1X2IA 2MAXA 7ICVA 4IQUA 4FBTA 8ICSA 4EBDA 1ZQQA 4YR2A 1BPBA 2XGPA 4ELVA 2JEIA 9ICHA 5KFAA 4BWMA 5L9XA 5KFFA 3TANA 1JIHA 4MFFA 4B9VA 3G6XA 4DSFA 4QZFA 4DFPA 7ICHA 3FYHA 4ECYA 4DFJA 2ZTDA 5J0TA 1X9MA 5EWEA 3Q8LA 2AQ4A 4F4KA 2HHQA 1ZQGA 7ICTA 4ED6A 1ZQBA 4M9NA 2AU0A 4Q8EA 4O9MA 4JUZA 2FPMA 5J2FA 4QZDA 4QWCA 2FPKA 1NK7A 5KFZA 8ICXA 1ZQCA 3HP6A 2IMWP 2KZMA 4GLXA 5J0YA 3TAPA 4QZ9A 3PNCA 3C2MA 5HMMA 4YMOA 3H7IA 4PHAA 3PW5A 1TKDA 4RU9A 4KLDA 3LDAA 1U47A 2HHSA 4Q45A 2R8HA 1L3VA 4F2SA 1HUZA 5J2HA 2ASLA 9ICIA 1TAQA 2LYHA 4O5KA 4I2BA 8ICEA 4JV2A 4QZEA 3PX0A 4LZDA 3V7LA 2DFLA 1IM4A 3LWLA 1NK9A 1MSWD 3K75D 1WCNA 4DOCA 8ICPA 3ZDEA 4YXMA 4K4HA 1BPEA 5J2EA 1Z3EB 3V7KA 1ZJNA 1Y88A 7ICRA 3V6HA 2C2RA 4DL6A 5KFIA 5HNKA 5KT5A 3PW0A 2NRTA 1UA0A 4B9NA 4UAWA 3ORYA 3EPGA 2MUTA 3KHRA 4F5PA 1SKRA 3MGIA 1QTMA 4NLGA 7ICIA 3AU2A 5DLFA 3KHGA 4PPXA 4DL2A 3EYZA 3H8SA 7ICNA 3T5KA 5DG9A 4BXOB 4R8UB 5J2CA 2NRVA 5KFUA 1ZQLA 4DL3A 4UB4A 2ALZA 5KG0A 3ZDCA 4O3PA 4LZGA 3RB6A 1ZQDA 9ICSA 9ICMA 4RUAA 3RJKA 9ICFA 3GQCA 3MABA 1TV9A 3MDAA 4F92B 2BQRA 2UVUA 3PW7A 3EW9A 1S0MA 4BWJA 3G6VA 4Q44A 3HW8A 2AGOA 4YN4A 4PGXA 1U9LA 4I28A 3N4MB 5CHGA 2HHWA 3M9OB 1JXLA 3RB4A 4I2EA 4XQ8A 4B9LA 2V4RA 3ISBA 1ZQFA 4FBUA 2J6TA 1XWLA 4IR9A 1RXVA 4YP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSL A;  2HVI A;  2BR0 A;  2FLP A;  2ZJ8 A;  4DS4 A;  9ICR A;  5KG4 A;  1KSP A;  1COO A;  2W8K A;  7ICS A;  1NK5 A;  4I2G A;  3QEB Z;  1QSL A;  1BGX T;  4FO6 A;  8ICH A;  3H8W A;  2JEF A;  4RQ2 A;  1N48 A;  3SYZ A;  3V72 A;  4Z6C A;  4I2I A;  4J9O A;  1S0N A;  3H4D A;  4C8L A;  4EZ9 A;  2I9G A;  4J9Q A;  7ICM A;  4NM1 A;  8ICZ A;  1Z00 A;  3RH5 A;  1T3N A;  4KLE A;  7ICF A;  3QZ7 A;  1ZQW A;  3UXN A;  3RAX A;  2HW3 A;  9ICG A;  1JXE A;  2A1J B;  1MC8 A;  3UXP A;  3RH4 A;  2W8L A;  3C2K A;  2P6U A;  4RUC A;  4KLG A;  8ICA A;  1H38 A;  2KTQ A;  4NY8 A;  4YD1 A;  2V9W A;  3K4G A;  5TZV A;  2JEJ A;  8ICQ A;  5J0U A;  1TK5 A;  4F4Z A;  2BKE A;  5III A;  3OHB A;  5KFO A;  4JWM A;  1S10 A;  4O0I A;  4M6W B;  1KEJ A;  3GV8 B;  4FS2 A;  1BPX A;  4I29 A;  5L1L A;  3ZD9 A;  1UT8 A;  4UB1 A;  4DO9 A;  2C22 A;  4KLO A;  9ICA A;  4YQW A;  2VA2 A;  3GIK A;  4MEX A;  5KFR A;  9ICL A;  4F5Q A;  4RQ8 A;  1SZP A;  4YMM A;  4ECQ A;  1UA1 A;  3BQ1 A;  8ICF A;  9ICB A;  5F9L A;  5J0W A;  2XCP A;  5DBB A;  3B0Y A;  1BPY A;  1QSY A;  1TFR A;  1NJX A;  7ICG A;  3HX0 A;  3V6J A;  4QZ8 A;  4I2F A;  4IQW A;  8ICJ A;  1UT5 A;  2IHM A;  3IHQ B;  5J2G A;  4YG2 A;  1ZQO A;  5KFW A;  4ED7 A;  4DQS A;  4P2H A;  2BCU A;  4M9J A;  3H4B A;  2R8K A;  2ZTC A;  3MDC A;  4IQT A;  1HJP A;  4DSK A;  4M9L A;  3MR2 A;  2H5X A;  9ICQ A;  4GXI A;  5HHH A;  4J9L A;  4KLF A;  1RPL A;  2PFQ A;  5L1I A;  2ZJ5 A;  1ZQS A;  3SZ2 A;  1D9F A;  3T5H A;  3RR8 A;  4TQS A;  5KFT A;  2R8J A;  2VA8 A;  4JK1 A;  1X9S A;  4RNO A;  4RNM A;  3SI8 A;  2ISP A;  5HP4 A;  5DQI A;  7ICU A;  5KFP A;  3GIM A;  1KDH A;  4DFM A;  1NJY A;  2ASJ A;  4DSJ A;  4IRK A;  9ICU A;  5J2B A;  2W9B B;  1ZJM A;  8ICL A;  2JZB B;  4ZH4 A;  5DQG A;  4J9M A;  2NRZ A;  8ICV A;  4EBC A;  2Q0Z X;  1ZQY A;  2ZUD A;  5IIO A;  4GC7 A;  4IQV A;  5IIK A;  3RBE A;  1NK8 A;  4NLK A;  3GII A;  4Z6F A;  1S0O A;  7ICL A;  1ZQV A;  3MR5 A;  3OSP A;  4GC6 A;  2UVV A;  3C23 A;  4XRH A;  2DPI A;  1D9D A;  4R8U A;  1ZQI A;  4ECV A;  5F9N A;  3PVX A;  1XSP A;  5KT3 A;  3JPT A;  2PFO A;  3RB3 A;  4ECU A;  7ICO A;  4B9T A;  9ICE A;  2FMS A;  2Y1J A;  4M9H A;  5CJ7 A;  4BGD A;  1ZQN A;  4DFK A;  4YD2 A;  5KG3 A;  2DPJ A;  4LVS A;  1C7Y A;  4DQP A;  4YR3 A;  2KN7 A;  4J9S A;  1ZQK A;  5J0O A;  3GV7 B;  2ZTE A;  4UB3 A;  5IIN A;  1TVA A;  4YXJ A;  1NK0 A;  4MF2 A;  2BPF A;  3RRG A;  1V9P A;  5CR0 A;  4O5E A;  3JPP A;  1XSN A;  1T4G A;  2B21 A;  5DDY A;  5BOM A;  8ICM A;  3ZDA A;  4F4W A;  2BQ3 A;  1QLN A;  9ICV A;  4ED2 A;  1ZQJ A;  5J2J A;  4QZC A;  5HML A;  4KN7 A;  3MR6 A;  4B9S A;  5KT6 A;  1D8L A;  4NLN A;  4UB2 A;  8ICG A;  3ZDB A;  1XS9 D;  4JWN A;  2AQ0 A;  2NRX A;  4ECS A;  4EYH B;  1NK4 A;  4DSE A;  2BGW A;  4NLZ A;  4KTQ A;  5J2I A;  3OHA A;  4ED8 A;  3LK9 A;  4QWB A;  3V6K A;  5EWG A;  4O5C A;  1N56 A;  1ARO P;  5J0S A;  3TFS A;  4KIT B;  3RR7 A;  2A1J A;  3TFR A;  3JPN A;  4DL5 A;  1D8Y A;  1KRP A;  1T7P A;  3BDP A;  2R8I A;  2XY5 A;  4R64 A;  1B22 A;  4RQ5 A;  1SL1 A;  2ATL A;  5KT4 A;  3V7J A;  5IIL A;  3HT3 A;  1S0V A;  4QZG A;  1RYS A;  2F1I A;  4PGY A;  4P4P A;  2PFP A;  5J2D A;  1ZQH A;  3T5J A;  4B9U A;  2BDP A;  4BDP A;  1A77 A;  2ISO A;  4PGQ A;  5C5J A;  3RTV A;  5J0R A;  2J6U A;  4DQR A;  5CB1 A;  2M9N A;  4I2D A;  3T3F A;  1L3U A;  2RDJ A;  1XSL A;  1U45 A;  8ICB A;  1NJZ A;  5DGA A;  1BVS A;  5KFV A;  4J9R A;  4ECR A;  3PX4 A;  3PV8 A;  1B43 A;  5EWF A;  3Q8S B;  3LWM A;  2FLN A;  4QWE A;  3BQT A;  5J0P A;  1ZQX A;  1ZQA A;  3RJH A;  2PXI A;  3JPR A;  4C8M A;  3PML A;  4DLE A;  1U48 A;  2VA3 A;  1BPD A;  2VAN A;  4G3I A;  4NXZ A;  2IA6 A;  1IXR A;  4UQG A;  3KTQ A;  4C8K A;  5KT2 A;  4TQR A;  3AU6 A;  1RZT A;  3PMN A;  2MUT B;  3NTU A;  3OJS A;  3QZ8 A;  3GIL A;  4GXJ A;  2BPG A;  4MF8 A;  3MBY A;  1KFD A;  3PO4 A;  5IIJ A;  4KLL A;  3RJJ A;  9ICW A;  5KFK A;  5KG1 A;  3NGD A;  1NKC A;  1LV5 A;  9ICK A;  3UXO A;  2IBK A;  1L5U A;  4B9M A;  4KLS A;  3JPS A;  4O3N A;  4EYI B;  5HHI A;  4KMU A;  3M8R A;  1NKE A;  4DF8 A;  2I1Q A;  3RJG A;  4MEY A;  4Q43 A;  4F5N A;  1KFS A;  2P6R A;  3MFH A;  4Q8F A;  3BQ2 A;  4KLQ A;  7ICE A;  1RYR A;  4DQQ A;  1BPZ A;  9ICP A;  5CP2 A;  4C8N A;  4P4M A;  2FPL A;  1T8E A;  1MQ2 A;  3SV4 A;  4TUS A;  3PY8 A;  5KFB A;  3PW4 A;  4I27 A;  9ICJ A;  3B0X A;  3C1Y A;  4R63 A;  5EOZ A;  5J2K A;  1WCL A;  3RJI A;  8ICR A;  1ZQU A;  2W9M A;  4DF4 A;  4F4X A;  3M9M B;  4F50 A;  2PFN A;  4RPY A;  4QWA A;  5KFE A;  5D46 A;  1TAU A;  3RBD A;  4Z6E A;  2BCS A;  4QWD A;  4YVZ A;  3C2L A;  5KFD A;  2W9A A;  4F93 B;  4RZR A;  3UQ0 A;  5KT7 A;  8ICU A;  2P66 A;  1Z00 B;  2XCA A;  4QZA A;  3ZDD A;  4DL7 A;  2HVH A;  3TAQ A;  4UAZ A;  3Q8K A;  4F8R A;  4ED1 A;  4RQ1 A;  3MFI A;  3TAR A;  1QSS A;  4R65 A;  5DBC A;  4KLT A;  4DOB A;  5BPC A;  3IM1 A;  3GIJ A;  3C5F A;  5CWR A;  4PHD A;  3PW2 A;  3ISC A;  2F1J A;  3C21 A;  4YMN A;  2BHN A;  4DS5 A;  1NJW A;  4BXO A;  4QZH A;  1ZQR A;  7ICJ A;  3M8S A;  2KFZ A;  5J29 A;  9ICC A;  1JX4 A;  2J6S A;  1S9F A;  2R8G A;  1XC9 A;  4ECX A;  3TQ1 A;  2AJQ A;  2WTF A;  2W9C B;  4ELU A;  4TUR A;  2Y1I A;  2XY7 A;  2C2E A;  1NK6 A;  5KG5 A;  1KLN A;  2FLL A;  3C1Z A;  5J2A A;  1L3T A;  1ZQM A;  5KFC A;  3OGU A;  1ZQZ A;  4F3O A;  5DBA A;  4XA5 A;  1U4B A;  1NKB A;  4GXK A;  4P4O A;  4RQ7 A;  3T5L A;  3PO5 A;  3GV5 B;  5D4B A;  5KFN A;  4UBB A;  1HUO A;  2ZJA A;  4RPZ A;  4DWI A;  4E0D A;  8ICK A;  2KFN A;  5KFY A;  3M9N B;  4F4Y A;  4RPX A;  5CA7 A;  4HYK A;  4M2Y A;  4KN4 A;  4TUP A;  3ETL A;  3FDS A;  3JPO A;  5DB6 A;  5KFH A;  7ICQ A;  5DDM A;  3Q8Q B;  1LB2 B;  3TI0 A;  1TK0 A;  4I2A A;  5KFG A;  5J0Q A;  2OWO A;  5DB7 A;  4EZ6 A;  2XC9 A;  4FS1 A;  1U49 A;  3GDX A;  4DQI A;  4O3S A;  4ELT A;  5KFM A;  5KG6 A;  3PR4 A;  3RH6 A;  4KLU A;  4J9K A;  4QZI A;  4KLI A;  8ICY A;  3MR3 A;  5KFS A;  4KLH A;  2XGQ A;  3UPQ A;  1TK8 A;  4TUQ A;  5KG7 A;  2FMQ A;  4IRD A;  2BQU A;  4DSI A;  7ICP A;  3G6Y A;  4KLM A;  1EXN A;  1XO1 A;  3RJE A;  1K1S A;  2XY6 A;  5D49 A;  2F1H A;  4M6W A;  4F91 B;  5IIM A;  4RQ3 A;  4K4I A;  4F5R A;  4DEZ A;  2C2D A;  5DB8 A;  4JV1 A;  3RRH A;  8ICW A;  2KZ3 A;  2ZUB A;  1SKW A;  2BPC A;  5JUM A;  3THV A;  1K1Q A;  4RT2 A;  2PI5 A;  5DKW A;  1MQ3 A;  4M47 A;  4QW9 A;  1S97 A;  1PZN A;  3PX6 A;  2BCR A;  4MFC A;  5DQH A;  3Q8M A;  3AUO A;  8ICN A;  4RQ6 A;  1ZET A;  2ZUC A;  3RB0 A;  2HHX A;  3ISD A;  4UAY A;  7ICK A;  5DGB A;  1L3S A;  2IHN A;  2BCQ A;  4UBC A;  2UVW A;  5DB9 A;  3HPO A;  1KFT A;  1JN3 A;  2HHV A;  2C28 A;  2GWS A;  4IR1 A;  4EBE A;  5BOL A;  4ED0 A;  3H40 A;  2UVR A;  1S77 D;  8ICT A;  4IRC A;  5DG8 A;  4Z6D A;  9ICN A;  4F5O A;  3Q8R B;  4M04 A;  4ED3 A;  3RJF A;  4QZB A;  3MGH A;  4O3R A;  9ICT A;  4O3Q A;  5KG2 A;  4R66 A;  5DLG A;  3OJU A;  2V4Q A;  1SL0 A;  3EPI A;  1S76 D;  3BJY A;  5L1J A;  4CCH A;  2KZZ A;  4UB5 A;  4J9P A;  1SL2 A;  2BCV A;  5KFL A;  4RQ0 A;  4ECZ A;  4RNN A;  2AGQ A;  1DOQ A;  1KTQ A;  4O3O A;  1XU4 A;  2AGP A;  4PHE A;  1ZQE A;  3QE9 Y;  4I2J A;  4YCX A;  3H8J A;  2W9B A;  5KFJ A;  3E2E A;  4KLJ A;  2JZB A;  4RT3 A;  1A76 A;  3EWA A;  4YFK A;  1ZYQ A;  4I2H A;  3PR5 B;  9ICO A;  3BQ0 A;  4I2C A;  4K4G A;  4QW8 A;  2HHT A;  4DL4 A;  5KFX A;  4PHP A;  9ICX A;  2NRW A;  4ECW A;  4ECT A;  5KFQ A;  3KHL A;  8ICI A;  8ICC A;  3N97 B;  4M0A A;  3OSN A;  2PI4 A;  3ZD8 A;  3QEA Z;  2XO7 A;  1NOM A;  1X9W A;  1DGS A;  5L1K A;  1SKS A;  2W9C A;  3HWT A;  5J0X A;  5DG7 A;  4M9G A;  4NM2 A;  4YR0 A;  3EZ5 A;  4DOA A;  4EEY A;  1RXW A;  3KHH A;  3RAQ A;  2FMP A;  1ZQT A;  4DLG A;  1CEZ A;  3JPQ A;  4PH5 A;  1CUK A;  3SV3 A;  3Q8P B;  2ASD A;  1ZQP A;  4F2R A;  3C5G A;  4XUS A;  4MFA A;  4C8O A;  2RDI A;  3GFK B;  4JV0 A;  1JMS A;  3UQ2 A;  2JEG A;  4RQ4 A;  8ICO A;  5KTQ A;  4X5V A;  2HHU A;  4J9N A;  1X2I A;  2MAX A;  7ICV A;  4IQU A;  4FBT A;  8ICS A;  4EBD A;  1ZQQ A;  4YR2 A;  1BPB A;  2XGP A;  4ELV A;  2JEI A;  9ICH A;  5KFA A;  4BWM A;  5L9X A;  5KFF A;  3TAN A;  1JIH A;  4MFF A;  4B9V A;  3G6X A;  4DSF A;  4QZF A;  4DFP A;  7ICH A;  3FYH A;  4ECY A;  4DFJ A;  2ZTD A;  5J0T A;  1X9M A;  5EWE A;  3Q8L A;  2AQ4 A;  4F4K A;  2HHQ A;  1ZQG A;  7ICT A;  4ED6 A;  1ZQB A;  4M9N A;  2AU0 A;  4Q8E A;  4O9M A;  4JUZ A;  2FPM A;  5J2F A;  4QZD A;  4QWC A;  2FPK A;  1NK7 A;  5KFZ A;  8ICX A;  1ZQC A;  3HP6 A;  2IMW P;  2KZM A;  4GLX A;  5J0Y A;  3TAP A;  4QZ9 A;  3PNC A;  3C2M A;  5HMM A;  4YMO A;  3H7I A;  4PHA A;  3PW5 A;  1TKD A;  4RU9 A;  4KLD A;  3LDA A;  1U47 A;  2HHS A;  4Q45 A;  2R8H A;  1L3V A;  4F2S A;  1HUZ A;  5J2H A;  2ASL A;  9ICI A;  1TAQ A;  2LYH A;  4O5K A;  4I2B A;  8ICE A;  4JV2 A;  4QZE A;  3PX0 A;  4LZD A;  3V7L A;  2DFL A;  1IM4 A;  3LWL A;  1NK9 A;  1MSW D;  3K75 D;  1WCN A;  4DOC A;  8ICP A;  3ZDE A;  4YXM A;  4K4H A;  1BPE A;  5J2E A;  1Z3E B;  3V7K A;  1ZJN A;  1Y88 A;  7ICR A;  3V6H A;  2C2R A;  4DL6 A;  5KFI A;  5HNK A;  5KT5 A;  3PW0 A;  2NRT A;  1UA0 A;  4B9N A;  4UAW A;  3ORY A;  3EPG A;  2MUT A;  3KHR A;  4F5P A;  1SKR A;  3MGI A;  1QTM A;  4NLG A;  7ICI A;  3AU2 A;  5DLF A;  3KHG A;  4PPX A;  4DL2 A;  3EYZ A;  3H8S A;  7ICN A;  3T5K A;  5DG9 A;  4BXO B;  4R8U B;  5J2C A;  2NRV A;  5KFU A;  1ZQL A;  4DL3 A;  4UB4 A;  2ALZ A;  5KG0 A;  3ZDC A;  4O3P A;  4LZG A;  3RB6 A;  1ZQD A;  9ICS A;  9ICM A;  4RUA A;  3RJK A;  9ICF A;  3GQC A;  3MAB A;  1TV9 A;  3MDA A;  4F92 B;  2BQR A;  2UVU A;  3PW7 A;  3EW9 A;  1S0M A;  4BWJ A;  3G6V A;  4Q44 A;  3HW8 A;  2AGO A;  4YN4 A;  4PGX A;  1U9L A;  4I28 A;  3N4M B;  5CHG A;  2HHW A;  3M9O B;  1JXL A;  3RB4 A;  4I2E A;  4XQ8 A;  4B9L A;  2V4R A;  3ISB A;  1ZQF A;  4FBU A;  2J6T A;  1XWL A;  4IR9 A;  1RXV A;  4YP3 A; 
#chains in the Genus database with same CATH topology
 2W8K A;  1NK5 A;  3QEB Z;  1QSL A;  8ICH A;  1N48 A;  3SYZ A;  3PSP A;  2I9G A;  1JUD A;  2Z7J A;  1NI3 A;  7ICF A;  1ZQW A;  2HW3 A;  5AKG A;  1JXE A;  1XNS A;  3MC1 A;  3UXP A;  8ICA A;  4RUC A;  4KLG A;  1H38 A;  4NY8 A;  3K4G A;  2ZG6 A;  3A0B U;  1ZD2 P;  1IV8 A;  5ALJ A;  4JWM A;  2NV3 A;  1N61 A;  5C0Y A;  3FC4 A;  4DO9 A;  5ALS A;  4YQW A;  4US9 A;  2VA2 A;  4MEX A;  9ICL A;  4F5Q A;  1SZP A;  4YMM A;  4ECQ A;  9ICB A;  2RP5 A;  3AQE A;  3TAD C;  1TFR A;  1NJX A;  3HX0 A;  3V6J A;  4QZ8 A;  8ICJ A;  1UT5 A;  4ED7 A;  2R8K A;  2QAR B;  1HJP A;  4M9L A;  2H5X A;  1ZRM A;  4PJ0 U;  4J9L A;  1ZQS A;  1D9F A;  3T5H A;  4MHV A;  4JK1 A;  1X9S A;  4RNM A;  7ICU A;  5KFP A;  2PKE A;  3SD7 A;  3PZP A;  9ICU A;  8ICL A;  2NRZ A;  8ICV A;  3WK8 A;  7ICL A;  1ZQV A;  4QNL A;  4XRH A;  2PFO A;  5KT3 A;  3RB3 A;  1OXJ A;  3UMB A;  4U6P A;  3WU2 U;  2DPJ A;  1PVP A;  4YR3 A;  3HRD D;  4UB3 A;  4MF2 A;  8ICM A;  1T4G A;  4UAS A;  2RQ5 A;  1ZQJ A;  4KN7 A;  3MR6 A;  4B9S A;  2ZIW A;  4NLN A;  2G06 A;  5AKX A;  3ZDB A;  3B9J A;  1XS9 D;  2F77 X;  2BGW A;  3V6K A;  5J0S A;  3TFS A;  4P0P B;  4DL5 A;  3JPN A;  4RQM A;  2XY5 A;  4RQ5 A;  1SL1 A;  5IIL A;  2F1I A;  2YTU A;  5J2D A;  2KKP A;  1ZQH A;  1A77 A;  5C5J A;  4DQR A;  4KX3 A;  8ICB A;  3PX4 A;  2B0C A;  5KFV A;  4J9R A;  4ECR A;  3PV8 A;  1B43 A;  3HIL A;  3FAH A;  2VJ5 A;  4C8M A;  4DLE A;  1BPD A;  1IXR A;  2E8P A;  2DF4 B;  3KTQ A;  3PMN A;  3EUB 2;  3GIL A;  4AP9 A;  2BPG A;  1C20 A;  9ICW A;  3BS7 A;  3QUB A;  4C7Y A;  4Y2T A;  3M6K A;  5HHI A;  4KMU A;  3M8R A;  4F5N A;  1KFS A;  2OYY A;  4Q8F A;  3L4P A;  1RYR A;  2O6K A;  2W11 A;  5B66 U;  9ICP A;  1T8E A;  4FZL A;  3PW4 A;  4P0Q A;  4PL2 A;  4R63 A;  5EOZ A;  5J2K A;  3RJI A;  3M9M B;  5KFE A;  1F0M A;  1TAU A;  4Z6E A;  4QWD A;  2PMZ C;  4YVZ A;  3DEE A;  5KFD A;  3UQ0 A;  5ALN A;  5ALF A;  2P66 A;  2XCA A;  2LKY A;  3ZDD A;  2HVH A;  4UAZ A;  3H0R B;  3Q8K A;  5JTI A;  4F8R A;  4RQ1 A;  5ALK A;  3MFI A;  5TIS U;  4DOB A;  3IM1 A;  3F53 A;  2K4H A;  2WF9 A;  3RF9 A;  3PW2 A;  2IOF K;  4OJ6 A;  4YMN A;  4QZH A;  5AKK A;  1WG8 A;  4ECX A;  2AJQ A;  2YML A;  2W9C B;  4ELU A;  2FLL A;  5J2A A;  5HR7 A;  3OGU A;  4P4O A;  1ZXI A;  5T14 A;  5ALD A;  4UBB A;  4CF5 A;  2QB0 B;  2KIW A;  1K5O A;  1QH9 A;  8ICK A;  4F4Y A;  4RPX A;  5AI6 A;  3K1R B;  7ICQ A;  3JPO A;  3Q8Q B;  1LVH A;  2Y0S F;  5J0Q A;  1U49 A;  4DQI A;  4O3S A;  4ELT A;  3PR4 A;  3RH6 A;  4J9K A;  4QZI A;  3I1Y A;  3WK4 A;  2EAO A;  4KLI A;  8ICY A;  3NRW A;  3E58 A;  3WKA A;  5KFS A;  1VLB A;  4IRD A;  2BQU A;  1XO1 A;  3RJE A;  2A1A A;  2EDU A;  4RQ3 A;  1QQ6 A;  1SKW A;  2BPC A;  1V85 A;  3THV A;  5ALG A;  5A0L A;  5DKW A;  1MQ3 A;  3PX6 A;  3Q8M A;  4RQ6 A;  2HHX A;  2ZUC A;  7ICK A;  2YMQ A;  2GO7 A;  1PVR A;  2LM4 A;  1KFT A;  2C28 A;  2GWS A;  4EBE A;  4ED0 A;  3H40 A;  8ICT A;  2QAR A;  1SIJ A;  4CDG A;  4M04 A;  3RJF A;  3N7P D;  4Y2J A;  1S76 D;  3EPI A;  5L1J A;  4RQ0 A;  4O3O A;  1KTQ A;  1ZQE A;  2EAP A;  2F44 A;  1SV4 A;  1A76 A;  2HOQ A;  3PR5 B;  3BQ0 A;  4UAR A;  4ECW A;  1ZRN A;  4JMU A;  3QEA Z;  1NOM A;  1DGS A;  3EZ5 A;  4FFD A;  5AIA A;  3RAQ A;  4NL9 A;  4DLG A;  3JPQ A;  1CRX A;  3C5G A;  1MN8 A;  4UB6 U;  4JV0 A;  8ICO A;  3DDH A;  3H8M A;  4EBD A;  2JEI A;  9ICH A;  2W3S A;  4BWM A;  5KFF A;  4MFF A;  4B9V A;  4P0P A;  4OCZ A;  3Q8L A;  4ED6 A;  1ZQB A;  4Q8E A;  2AU0 A;  3PSF A;  2FPM A;  4QZD A;  8ICX A;  2FPK A;  4AYB C;  5KFZ A;  4QZ9 A;  5HMM A;  3H7I A;  3WK7 A;  4RU9 A;  1FFV A;  3LDA A;  2HHS A;  5EE1 A;  4F2S A;  5AM1 A;  2E1E A;  2ES6 A;  4O5K A;  1YZ6 A;  3V7L A;  1MSW D;  2MA1 A;  1OW5 A;  3IP4 B;  5J2E A;  1Z3E B;  3V7K A;  2G07 A;  3D2S A;  5KFI A;  1UA0 A;  3EPG A;  3KHR A;  4F5P A;  1QTM A;  4QJF B;  3MGI A;  2KHV A;  2E8M A;  4CF4 A;  4PPX A;  5J2C A;  1UHU A;  2E8N A;  1RM6 C;  2KVC A;  3RB6 A;  1ZQD A;  9ICM A;  3GQC A;  2FDR A;  1TV9 A;  3MDA A;  2UVU A;  5AI9 A;  2LYB A;  3EW9 A;  5ALT A;  1S0M A;  4BWJ A;  3G6V A;  4Q44 A;  2AGO A;  4PGX A;  4I28 A;  3N4M B;  4EEN A;  2VJ4 A;  1JXL A;  4B9L A;  2J6T A;  1XWL A;  2N1R A;  5KAF U;  1NNL A;  2K60 A;  4DSL A;  2HVI A;  4DS4 A;  1KSP A;  2ZIW B;  7ICS A;  4ICA A;  2JV3 A;  4OD0 A;  2JEF A;  4Z6C A;  4J9O A;  4NM1 A;  2W43 A;  1T3N A;  9ICG A;  3KKA A;  2W3R A;  2W8L A;  4YD1 A;  2V9W A;  3VC8 A;  2JEJ A;  1JRO A;  2HBL A;  2OCE A;  3J81 j;  5III A;  5AM3 A;  3OHB A;  2AXT U;  1WYG A;  3GV8 B;  4I29 A;  3ZD9 A;  1UT8 A;  2C22 A;  4KLO A;  1O03 A;  1X40 A;  4UB8 U;  1N5X A;  1UA1 A;  1JRP A;  3TKA A;  2LPE A;  5F9L A;  2XCP A;  7ICG A;  3KKA C;  4IQW A;  2GOL A;  2I5H A;  4I2F A;  3OTQ A;  2IHM A;  3IHQ B;  1ZQO A;  2BCU A;  4IS7 A;  2YB4 A;  3CNH A;  2ZTC A;  3MDC A;  4GXI A;  2KOB A;  5L1I A;  2ZJ5 A;  3HKZ C;  5J8Y A;  1UPH A;  3SI8 A;  2ISP A;  5HP4 A;  5DQI A;  4OO1 J;  4DCC A;  3GIM A;  1KDH A;  3QU7 A;  1Q3U A;  2W9B B;  2JR5 A;  4J9M A;  4GC7 A;  3RBE A;  5IIO A;  4IQV A;  5IIK A;  2Q4T A;  3GII A;  3MR5 A;  4GC6 A;  2WAQ C;  3ETR A;  4R8U A;  4ECV A;  3JPT A;  3NVY A;  4OJO A;  4ECU A;  4Y2X A;  5J8Y C;  2FMS A;  4CE6 A;  4BGD A;  1ZQN A;  2OHF A;  4DFK A;  4UW9 A;  1C7Y A;  4J9S A;  2HCF A;  1TVA A;  5IIN A;  4YXJ A;  2A19 A;  2P35 A;  5CR0 A;  3JPP A;  1DXS A;  5DDY A;  3WK9 A;  5BOM A;  1QCK A;  2BQ3 A;  3ZDA A;  3KZX A;  4QZC A;  1VJ5 A;  5HML A;  3MGV A;  4UB2 A;  8ICG A;  5ALM A;  5L1M A;  4KTQ A;  4ED8 A;  1SGG A;  4QWB A;  4KIT B;  3RR7 A;  2A1J A;  1T7P A;  3RFA A;  2R18 A;  2WF7 A;  2ZXI A;  4R64 A;  3WKC A;  2ATL A;  3H0L B;  3HT3 A;  4QZG A;  1F5S A;  5ALI A;  1RYS A;  4P4P A;  3T5J A;  4BDP A;  2BDP A;  2XI9 A;  3RTV A;  5J0R A;  2J6U A;  5CB1 A;  3T3F A;  3KFU F;  1XSL A;  1U45 A;  1NJZ A;  2H3V A;  4Y2R A;  2KSO B;  2W7O A;  3NVZ A;  3KD3 A;  2OM6 A;  2XIC A;  3S6J A;  2PXI A;  3JPR A;  2VAN A;  4G3I A;  1YT3 A;  1BNO A;  4UQG A;  4O3M A;  4C8K A;  4TQR A;  3QZ8 A;  3NVV A;  3MBY A;  1IG6 A;  1SXD A;  3PO4 A;  2DUY A;  5ALY A;  4EYI B;  5AK5 A;  3RJG A;  2LYA A;  2I1Q A;  4DF8 A;  3MFH A;  4KLQ A;  2NO4 A;  4C8N A;  1MQ2 A;  5AI4 A;  3SV4 A;  2XID A;  2F3N A;  4F50 A;  3ED5 A;  2DGZ A;  3RBD A;  1WWV A;  2E1F A;  1Z00 B;  3TAQ A;  3SQI A;  2HBJ A;  4ED1 A;  3F5A A;  1QSS A;  4R65 A;  1ECW A;  5CWR A;  4PHD A;  3ISC A;  3C21 A;  3M8S A;  9ICC A;  2J6S A;  4NLC A;  2WTF A;  2Y1I A;  2XY7 A;  1KLN A;  3C1Z A;  3IRU A;  1ZQM A;  2AH5 A;  2D8C A;  5DBA A;  4XA5 A;  3GV5 B;  5D4B A;  1HUO A;  4DWI A;  5KFY A;  5CA7 A;  2NYV A;  4M2Y A;  3FDS A;  4CNQ A;  5DB6 A;  1VDV A;  2KMD A;  1TK0 A;  5KFG A;  2CPR A;  2OWO A;  4EZ6 A;  5DB7 A;  2XC9 A;  5G5H A;  1X66 A;  1CI4 A;  2ESE A;  5AKY A;  5EE0 A;  1ED1 A;  2FMQ A;  3UMG A;  4EEK A;  3G6Y A;  2XVT A;  3KBB A;  4KLM A;  1K1S A;  5D49 A;  2F1H A;  4F91 B;  3QXG A;  1SB3 C;  4F5R A;  5DB8 A;  1O08 A;  2Y9T A;  5AM2 A;  2ZUB A;  5JUM A;  3F2B A;  2G5I B;  4OJL A;  1S97 A;  1PZN A;  5DQH A;  4Y2V A;  3ISD A;  3KZI U;  2IHN A;  2BCQ A;  4UBC A;  1JI7 A;  2UVW A;  3HPO A;  1JN3 A;  4BX9 C;  2ZIU A;  1S77 D;  5DG8 A;  4Z6D A;  1P7D A;  3Q8R B;  3MGH A;  9ICT A;  5KG2 A;  3OJU A;  5ALL A;  1SL0 A;  2RLT A;  2JHD A;  4J9P A;  1SL2 A;  3C28 A;  1Z4N A;  2K4I A;  3T79 A;  2D6F C;  4PHE A;  3QE9 Y;  2K8B B;  3H8J A;  2W9B A;  4KLJ A;  4RT3 A;  3EWA A;  4YFK A;  2WB1 F;  2F2A B;  2HBK A;  2HHT A;  5KFX A;  4PHP A;  9ICX A;  2EQY A;  8ICC A;  3D2N A;  4M0A A;  3OSN A;  1KL9 A;  3PST A;  2PI4 A;  3ZD8 A;  4QIW F;  2XO7 A;  5L1K A;  3HWT A;  5DG7 A;  4F71 A;  4YR0 A;  4EEY A;  2HOF A;  3A0H U;  3KHH A;  1FFU A;  3C29 A;  2ASD A;  4PH5 A;  2WF8 A;  4F2R A;  4NJ8 A;  4XUS A;  2RDI A;  2CXY A;  2JEG A;  5AK6 A;  4X5V A;  1SWV A;  4PZN A;  1ZQQ A;  2XGP A;  1RQN A;  4QZF A;  7ICH A;  3FYH A;  4ECY A;  4DFJ A;  4F4K A;  1X9M A;  2HHQ A;  1ZQG A;  2YMP A;  2D3D A;  3QUQ A;  2KZM A;  5J0Y A;  3TAP A;  3PW5 A;  1TKD A;  1L7P A;  4Q45 A;  3AL0 B;  5AK4 A;  2LHT A;  5J2H A;  2KSO A;  2LYH A;  4Y2Q A;  4I2B A;  8ICE A;  2DKZ A;  4KMO B;  4JV2 A;  3PX0 A;  2DFL A;  3QUC A;  1L7N A;  1WCN A;  8ICP A;  1BPE A;  3V6H A;  1T3Q A;  5HNK A;  3BQ7 A;  4KX5 A;  2NRT A;  3ORY A;  4WJ3 B;  1SKR A;  5ALX A;  3R9K A;  1D8B A;  2H3Q A;  1PK1 B;  3H8S A;  7ICN A;  5H2F U;  4R8U B;  2NRV A;  5ALQ A;  1ZQL A;  2HSZ A;  3ZDC A;  3D2Q A;  1DK2 A;  4F92 B;  4FE3 A;  1QQ5 A;  4YN4 A;  2HHW A;  4XQ8 A;  2WHE A;  3ISB A;  4FBU A;  5EE9 A;  3L5K A;  2BR0 A;  2FLP A;  1L7M A;  2ZJ8 A;  4I2G A;  1COK A;  1BGX T;  3H8W A;  4RQ2 A;  3V72 A;  4C8L A;  3H4D A;  7ICM A;  8ICZ A;  1Z00 A;  3RH5 A;  4KLE A;  3QZ7 A;  3CP8 A;  3UXN A;  3RAX A;  2KD1 A;  2A1J B;  3OPX A;  1MC8 A;  2P6U A;  2KTQ A;  1AQ6 A;  5TZV A;  2KK0 A;  5J0U A;  4F4Z A;  3SAF A;  1Q3V A;  2QB1 A;  5AM4 A;  1YZ7 A;  1S10 A;  2YY6 A;  1KEJ A;  5F3X B;  1BPX A;  5L1L A;  9ICA A;  5ALZ A;  3M1Y A;  3GIK A;  3GU3 A;  2KIV A;  1MA7 A;  4RQ8 A;  5J0W A;  3B0Y A;  5ALR A;  1BPY A;  3NRZ A;  5ALU A;  4GIB A;  4YG2 A;  4J03 A;  4DQS A;  1V97 A;  3WK5 A;  2EAN A;  3MR2 A;  3IG8 A;  5HHH A;  2PFQ A;  3RR8 A;  4TQS A;  5KFT A;  3I76 A;  4RNO A;  5ALH A;  4DFM A;  4DSJ A;  1ZJM A;  4NL9 C;  5DQG A;  3D6J A;  4NLK A;  4Z6F A;  2EAM A;  5JRT A;  3OSP A;  2UVV A;  1D9D A;  5F9N A;  1XSP A;  4B9T A;  9ICE A;  5G5G A;  2Y1J A;  4M9H A;  2EZX A;  5KG3 A;  2HOI A;  2KN7 A;  5J0O A;  2ZIV B;  4C4T A;  2Y0S C;  2BPF A;  4Y2P A;  1KKX A;  2B21 A;  5HR6 A;  4F4W A;  9ICV A;  4ED2 A;  5J2J A;  1M6Y A;  1D8L A;  5AK3 A;  4JWN A;  2AQ0 A;  2NRX A;  4EYH B;  1NK4 A;  5J2I A;  3OHA A;  3LK9 A;  5EWG A;  1S5L U;  4O5C A;  1N56 A;  3TFR A;  1KRP A;  2E3T A;  4NLB A;  1B22 A;  2H3F A;  4USA A;  5KL1 B;  3V7J A;  1S0V A;  2MU2 A;  2ISO A;  2M9N A;  4I2D A;  3UM9 A;  2RDJ A;  2DKX A;  5DGA A;  1BVS A;  4A8E A;  5EWF A;  3CW2 C;  4JB3 A;  3Q8S B;  2FLN A;  2CN1 A;  2RHF A;  3O0F A;  3RJH A;  5ALO A;  3LVV A;  2VA3 A;  2EZY A;  4C4S A;  5KT2 A;  3AU6 A;  1RZT A;  3NTU A;  3OJS A;  2JMG A;  2JGA A;  2K8C B;  2QKQ A;  4GXJ A;  4MF8 A;  1FIQ A;  3QU5 A;  4UAU A;  5IIJ A;  4GFJ A;  4KLL A;  5KFK A;  5AKI A;  1J97 A;  3NGD A;  2IBK A;  1L5U A;  4B9M A;  2VIX A;  3JPS A;  4O3N A;  2IOH A;  3IN5 A;  5ALV A;  2P6R A;  1BPZ A;  5CP2 A;  2HDO A;  2FPL A;  3ZI4 A;  4ACO A;  2E8O A;  2ZIU B;  5EE3 A;  4Y2Y A;  1ZQU A;  2FE9 A;  2PFN A;  1B0X A;  4QWA A;  5AHX A;  3C2L A;  2K4E A;  5KT7 A;  1NZB A;  4QZA A;  2HMX A;  1X42 A;  3TAR A;  4KLT A;  5BPC A;  3GIJ A;  5KNI A;  1PK1 A;  1J2N A;  4DS5 A;  4HAI A;  3ICX A;  1SV0 A;  1ZQR A;  4RQN A;  5J29 A;  1XC9 A;  4UAV A;  5AM5 A;  2C2E A;  1NK6 A;  3WKB A;  1IIP A;  1L3T A;  4F3O A;  5AKE A;  1X9X A;  1NKB A;  4GXK A;  3N7S C;  4RQ7 A;  3T5L A;  2G08 A;  2DL0 A;  4E0D A;  2KFN A;  2KV2 A;  3M9N B;  1SV0 C;  4HYK A;  1KW4 A;  1ZOL A;  4KN4 A;  4TUP A;  2LBO A;  5KFH A;  5DDM A;  4I2A A;  1Z1B A;  5KFM A;  5KG6 A;  4KLU A;  2W04 A;  2I6X A;  1OUQ A;  4OJ5 A;  1SXE A;  2XGQ A;  1TK8 A;  2YB1 A;  3QUT A;  4DSI A;  7ICP A;  2KJ9 A;  1EXN A;  2XY6 A;  3L3F X;  3QU2 A;  4JV1 A;  8ICW A;  2KZ3 A;  1RDF A;  1K1Q A;  4RT2 A;  2PI5 A;  4M47 A;  2BCR A;  3RB0 A;  4UAY A;  5DB9 A;  3F2D A;  3AM9 A;  5BOL A;  2HI0 A;  4LJX A;  9ICN A;  3IG5 A;  4ED3 A;  4O3R A;  2V4Q A;  4R66 A;  2HBM A;  3BJY A;  4UB5 A;  2BCV A;  3TAD A;  2AGQ A;  1DOQ A;  2K8A A;  4I2J A;  4YCX A;  5KFJ A;  3AQF A;  4IC9 A;  4QW8 A;  4DL4 A;  3DV9 A;  2NRW A;  2IOF A;  3KHL A;  8ICI A;  3N97 B;  3FM9 A;  3BS5 B;  4M9G A;  4NM2 A;  4DOA A;  1RXW A;  2ZIV A;  1ZQT A;  1N2X A;  2FMP A;  3SV3 A;  1CUK A;  3Q8P B;  2KEY A;  4C8O A;  2B6G A;  3LVW A;  3GFK B;  1LKY A;  2HHU A;  2PMZ F;  2MAX A;  3QU4 A;  1ZQ1 C;  4IQU A;  4FBT A;  4YR2 A;  4ELV A;  5KFA A;  5L9X A;  3NAS A;  3TAN A;  1JIH A;  3G6X A;  4DSF A;  1S8O A;  2BDU A;  2ZTD A;  5J0T A;  5EWE A;  4M9N A;  1A6S A;  5ALE A;  4PZO A;  3HP6 A;  2IMW P;  3PNC A;  4YMO A;  2A3V A;  4PHA A;  1JAL A;  3F2C A;  2M0N A;  3I28 A;  3NVW A;  2ASL A;  9ICI A;  1TAQ A;  2YX8 A;  4QZE A;  3QU9 A;  1IM4 A;  1NK9 A;  1FO4 A;  3K75 D;  3ZDE A;  4YXM A;  4K4H A;  1DGJ A;  2K89 A;  1Y88 A;  2C2R A;  4DL6 A;  3PW0 A;  2KJ5 A;  4UAW A;  4NLG A;  1X6J A;  7ICI A;  3AU2 A;  3KHG A;  4DL2 A;  3EYZ A;  2ODG A;  4BXO B;  5FP0 A;  5KFU A;  3AEV A;  3IV6 A;  3TAC B;  3UMC A;  5KG0 A;  3IDW A;  9ICS A;  3RJK A;  2EZZ A;  3MAB A;  2BQR A;  3PW7 A;  2W03 A;  3HW8 A;  1U9L A;  5CHG A;  3M9O B;  5KAI U;  2V4R A;  4IR9 A;  1RXV A;  5E79 U;  9ICR A;  2W55 A;  5KG4 A;  1COO A;  5AIB A;  2LMR A;  4FO6 A;  1N60 A;  1S0N A;  4I2I A;  8ICU A;  4CF3 A;  4EZ9 A;  4J9Q A;  2GH1 A;  5AKZ A;  3RH4 A;  3C2K A;  2DWQ A;  3BZK A;  8ICQ A;  1TK5 A;  2E5S A;  4EX7 A;  2BKE A;  5KFO A;  4O0I A;  4M6W B;  4FS2 A;  4UB1 A;  4BJQ A;  2KG5 A;  5KFR A;  3BQ1 A;  8ICF A;  1URJ A;  4U7C A;  5DBB A;  1QSY A;  2G0A A;  5J2G A;  1Z1V A;  1TE2 A;  2WF6 A;  5KFW A;  3HJE A;  4P2H A;  4PL1 A;  4M9J A;  3H4B A;  2JRZ A;  1PK3 A;  4DSK A;  4IQT A;  4FZN A;  9ICQ A;  4ZOH C;  4KLF A;  1RPL A;  3N28 A;  3SAH A;  3SZ2 A;  2R8J A;  2VA8 A;  3M6Z A;  3QYP A;  2F8L A;  3M7D A;  2ASJ A;  1NJY A;  4IRK A;  5J2B A;  2JZB B;  4ZH4 A;  4CGZ A;  4EBC A;  2Q0Z X;  1ZQY A;  2ZUD A;  1NK8 A;  1S0O A;  4DFD A;  1UCV A;  3C23 A;  2DPI A;  3AMZ A;  1ZQI A;  3PVX A;  5AM0 A;  2KIC A;  7ICO A;  4OJP A;  2JXJ A;  1L6N A;  4AYB F;  5CJ7 A;  4YD2 A;  4LVS A;  4DQP A;  1ZQK A;  3GV7 B;  2ZTE A;  1NK0 A;  3RRG A;  1V9P A;  5GTI U;  4O5E A;  1XSN A;  1QLN A;  4CRX A;  1KN5 A;  1T94 A;  4NWI A;  5KT6 A;  3ONN A;  4ECS A;  3KOO A;  4DSE A;  4NLZ A;  3SR6 A;  5KL8 B;  1ARO P;  1WWU A;  5AIC A;  1ZD4 A;  3BDP A;  1D8Y A;  1J2M A;  2R8I A;  3GZF A;  5ALW A;  2KKV A;  5KT4 A;  5GTH U;  5B5E U;  4PGY A;  2PFP A;  4B9U A;  4C80 A;  4PGQ A;  2ZIX B;  3WK6 A;  1L3U A;  2KHQ A;  3E0F A;  1B4F A;  5AI8 A;  3BS5 A;  3LWM A;  1N63 A;  4QWE A;  1DK3 A;  3BQT A;  5J0P A;  1ZQX A;  1ZQA A;  4G9B A;  2MSN A;  2YQE A;  5AI5 A;  3PML A;  1U48 A;  4NXZ A;  2IA6 A;  1KBU A;  2MUT B;  2OH2 A;  4Y2S A;  2F76 X;  1KFD A;  2WB1 C;  4NV0 A;  3RJJ A;  2WF5 A;  5KG1 A;  1NKC A;  1LV5 A;  9ICK A;  4FZM A;  3QNM A;  3UXO A;  2ZXH A;  5K4L A;  4KLS A;  1HEK A;  3SMV A;  1NKE A;  4MEY A;  4Q43 A;  1L8L A;  3AN1 A;  4QIW C;  3BQ2 A;  7ICE A;  4DQQ A;  1PVQ A;  4P4M A;  4TUS A;  2KVS A;  3PY8 A;  5KFB A;  4I27 A;  9ICJ A;  3B0X A;  3C1Y A;  8ICR A;  1N62 A;  1WCL A;  3QX7 A;  2W9M A;  2EH9 A;  4Y2U A;  4F4X A;  4DF4 A;  4RPY A;  5D46 A;  2G09 A;  2H3Z A;  2BCS A;  3BZC A;  2W9A A;  4RZR A;  3SEN A;  1Q46 A;  4F93 B;  4DL7 A;  3F5E A;  2Y9U A;  5DBC A;  3C5F A;  2K4P A;  2LM1 A;  3U26 A;  3HKZ F;  2QLT A;  2F1J A;  2BHN A;  1NJW A;  4BXO A;  7ICJ A;  1WUD A;  2KFZ A;  1JX4 A;  1S9F A;  4EX6 A;  2R8G A;  3TQ1 A;  4TUR A;  3WKD A;  5KG5 A;  5KFC A;  1ZQZ A;  1U4B A;  2WAQ F;  2LI6 A;  3PO5 A;  3WKE A;  5KFN A;  1Z4O A;  2ZJA A;  1LKY B;  4RPZ A;  5ALP A;  3SEI A;  3ETL A;  1LB2 B;  3TI0 A;  1RYU A;  4FS1 A;  1GO3 F;  3GDX A;  3CYM A;  3MR3 A;  4C0Z A;  4KLH A;  3UPQ A;  4TUQ A;  5KG7 A;  3LYS A;  3H0M B;  1DRG A;  5AI0 A;  3NUQ A;  4M6W A;  4C7Z A;  5IIM A;  2OEH A;  4K4I A;  4DEZ A;  2C2D A;  3RRH A;  2AHO B;  1BNP A;  2G5H B;  5JU5 A;  4QW9 A;  2DQN B;  2CRX A;  4MFC A;  8ICN A;  3AUO A;  1ZET A;  2BZF A;  1FEZ A;  5DGB A;  1L3S A;  4US8 A;  2F8K A;  1RG6 A;  1QQ7 A;  1Z19 A;  2HHV A;  4IR1 A;  3SAG A;  2UVR A;  4F72 A;  4IRC A;  2JH7 A;  4F5O A;  4QZB A;  4O3Q A;  1NZP A;  5DLG A;  2KP7 A;  4CCH A;  2KZZ A;  4B6J A;  3K1Z A;  5KFL A;  2NO5 A;  4ECZ A;  2WFA A;  4RNN A;  2AGP A;  1XU4 A;  2FJ6 A;  1KQQ A;  3E2E A;  3PSI A;  2JZB A;  1X6I A;  1HIW A;  5CRX A;  4C4R A;  1ZYQ A;  4I2H A;  2W7P A;  9ICO A;  3ALR A;  2H3I A;  4K4G A;  4I2C A;  1PUZ A;  4UAT A;  2VKQ A;  3N7R C;  5KFQ A;  4ECT A;  2RRD A;  1X9W A;  1SKS A;  2W9C A;  2YMM A;  5J0X A;  1N5W A;  2W54 A;  5AKJ A;  2MRL A;  2KNJ A;  1CEZ A;  4EEL A;  1ZQP A;  4MFA A;  2QB0 A;  3UQ2 A;  1JMS A;  1A0P A;  4RQ4 A;  2JH1 A;  5KTQ A;  4J9N A;  1X2I A;  7ICV A;  2GLE A;  8ICS A;  4IL6 U;  1BPB A;  1V38 A;  1ZD5 A;  1SZH A;  5AKL A;  2L5Y A;  2FI1 A;  4DFP A;  3VCB A;  2AQ4 A;  7ICT A;  1RQL A;  4O9M A;  4JUZ A;  4BUG A;  1NK7 A;  5J2F A;  4QWC A;  1UQV A;  1ZQC A;  4GLX A;  3C2M A;  2YN4 A;  2ZIX A;  4KLD A;  1U47 A;  4P0Q B;  2KE7 A;  2R8H A;  1L3V A;  1HUZ A;  1SWW A;  1TAM A;  1L8O A;  4LZD A;  3LWL A;  4DOC A;  3CRX A;  1ZJN A;  7ICR A;  5CEH A;  2DBY A;  2OXO A;  5KT5 A;  4B9N A;  2MUT A;  3NS1 A;  5AKH A;  5DLF A;  3T5K A;  1Q8K A;  5DG9 A;  1F44 A;  1L7O A;  1ZD3 A;  4DL3 A;  4UB4 A;  2ALZ A;  4O3P A;  4LZG A;  2KJ8 A;  4RUA A;  9ICF A;  3RB4 A;  4I2E A;  1ZQF A;  1XO0 A;  4YP3 A; 
#chains in the Genus database with same CATH homology
 4DSL A;  2HVI A;  2BR0 A;  2FLP A;  2ZJ8 A;  4DS4 A;  9ICR A;  5KG4 A;  1KSP A;  1COO A;  2W8K A;  7ICS A;  1NK5 A;  4I2G A;  3QEB Z;  1QSL A;  1BGX T;  4FO6 A;  8ICH A;  3H8W A;  2JEF A;  4RQ2 A;  1N48 A;  3SYZ A;  3V72 A;  4Z6C A;  4I2I A;  4J9O A;  1S0N A;  3H4D A;  4C8L A;  4EZ9 A;  2I9G A;  4J9Q A;  7ICM A;  4NM1 A;  8ICZ A;  1Z00 A;  3RH5 A;  1T3N A;  4KLE A;  7ICF A;  3QZ7 A;  1ZQW A;  3UXN A;  3RAX A;  2HW3 A;  9ICG A;  1JXE A;  2A1J B;  1MC8 A;  3UXP A;  3RH4 A;  2W8L A;  3C2K A;  2P6U A;  4RUC A;  4KLG A;  8ICA A;  1H38 A;  2KTQ A;  4NY8 A;  4YD1 A;  2V9W A;  3K4G A;  5TZV A;  2JEJ A;  8ICQ A;  5J0U A;  1TK5 A;  4F4Z A;  2BKE A;  5III A;  3OHB A;  5KFO A;  4JWM A;  1S10 A;  4O0I A;  4M6W B;  1KEJ A;  3GV8 B;  4FS2 A;  1BPX A;  4I29 A;  5L1L A;  3ZD9 A;  1UT8 A;  4UB1 A;  4DO9 A;  2C22 A;  4KLO A;  9ICA A;  4YQW A;  2VA2 A;  3GIK A;  4MEX A;  5KFR A;  9ICL A;  4F5Q A;  4RQ8 A;  1SZP A;  4YMM A;  4ECQ A;  1UA1 A;  3BQ1 A;  8ICF A;  9ICB A;  5F9L A;  5J0W A;  2XCP A;  5DBB A;  3B0Y A;  1BPY A;  1QSY A;  1TFR A;  1NJX A;  7ICG A;  3HX0 A;  3V6J A;  4QZ8 A;  4I2F A;  4IQW A;  8ICJ A;  1UT5 A;  2IHM A;  3IHQ B;  5J2G A;  4YG2 A;  1ZQO A;  5KFW A;  4ED7 A;  4DQS A;  4P2H A;  2BCU A;  4M9J A;  3H4B A;  2R8K A;  2ZTC A;  3MDC A;  4IQT A;  1HJP A;  4DSK A;  4M9L A;  3MR2 A;  2H5X A;  9ICQ A;  4GXI A;  5HHH A;  4J9L A;  4KLF A;  1RPL A;  2PFQ A;  5L1I A;  2ZJ5 A;  1ZQS A;  3SZ2 A;  1D9F A;  3T5H A;  3RR8 A;  4TQS A;  5KFT A;  2R8J A;  2VA8 A;  4JK1 A;  1X9S A;  4RNO A;  4RNM A;  3SI8 A;  2ISP A;  5HP4 A;  5DQI A;  7ICU A;  5KFP A;  3GIM A;  1KDH A;  4DFM A;  1NJY A;  2ASJ A;  4DSJ A;  4IRK A;  9ICU A;  5J2B A;  2W9B B;  1ZJM A;  8ICL A;  2JZB B;  4ZH4 A;  5DQG A;  4J9M A;  2NRZ A;  8ICV A;  4EBC A;  2Q0Z X;  1ZQY A;  2ZUD A;  5IIO A;  4GC7 A;  4IQV A;  5IIK A;  3RBE A;  1NK8 A;  4NLK A;  3GII A;  4Z6F A;  1S0O A;  7ICL A;  1ZQV A;  3MR5 A;  3OSP A;  4GC6 A;  2UVV A;  3C23 A;  4XRH A;  2DPI A;  1D9D A;  4R8U A;  1ZQI A;  4ECV A;  5F9N A;  3PVX A;  1XSP A;  5KT3 A;  3JPT A;  2PFO A;  3RB3 A;  4ECU A;  7ICO A;  4B9T A;  9ICE A;  2FMS A;  2Y1J A;  4M9H A;  5CJ7 A;  4BGD A;  1ZQN A;  4DFK A;  4YD2 A;  5KG3 A;  2DPJ A;  4LVS A;  1C7Y A;  4DQP A;  4YR3 A;  2KN7 A;  4J9S A;  1ZQK A;  5J0O A;  3GV7 B;  2ZTE A;  4UB3 A;  5IIN A;  1TVA A;  4YXJ A;  1NK0 A;  4MF2 A;  2BPF A;  3RRG A;  1V9P A;  5CR0 A;  4O5E A;  3JPP A;  1XSN A;  1T4G A;  2B21 A;  5DDY A;  5BOM A;  8ICM A;  3ZDA A;  4F4W A;  2BQ3 A;  1QLN A;  9ICV A;  4ED2 A;  1ZQJ A;  5J2J A;  4QZC A;  5HML A;  4KN7 A;  3MR6 A;  4B9S A;  5KT6 A;  1D8L A;  4NLN A;  4UB2 A;  8ICG A;  3ZDB A;  1XS9 D;  4JWN A;  2AQ0 A;  2NRX A;  4ECS A;  4EYH B;  1NK4 A;  4DSE A;  2BGW A;  4NLZ A;  4KTQ A;  5J2I A;  3OHA A;  4ED8 A;  3LK9 A;  4QWB A;  3V6K A;  5EWG A;  4O5C A;  1N56 A;  1ARO P;  5J0S A;  3TFS A;  4KIT B;  3RR7 A;  2A1J A;  3TFR A;  3JPN A;  4DL5 A;  1D8Y A;  1KRP A;  1T7P A;  3BDP A;  2R8I A;  2XY5 A;  4R64 A;  1B22 A;  4RQ5 A;  1SL1 A;  2ATL A;  5KT4 A;  3V7J A;  5IIL A;  3HT3 A;  1S0V A;  4QZG A;  1RYS A;  2F1I A;  4PGY A;  4P4P A;  2PFP A;  5J2D A;  1ZQH A;  3T5J A;  4B9U A;  2BDP A;  4BDP A;  1A77 A;  2ISO A;  4PGQ A;  5C5J A;  3RTV A;  5J0R A;  2J6U A;  4DQR A;  5CB1 A;  2M9N A;  4I2D A;  3T3F A;  1L3U A;  2RDJ A;  1XSL A;  1U45 A;  8ICB A;  1NJZ A;  5DGA A;  1BVS A;  5KFV A;  4J9R A;  4ECR A;  3PX4 A;  3PV8 A;  1B43 A;  5EWF A;  3Q8S B;  3LWM A;  2FLN A;  4QWE A;  3BQT A;  5J0P A;  1ZQX A;  1ZQA A;  3RJH A;  2PXI A;  3JPR A;  4C8M A;  3PML A;  4DLE A;  1U48 A;  2VA3 A;  1BPD A;  2VAN A;  4G3I A;  4NXZ A;  2IA6 A;  1IXR A;  4UQG A;  3KTQ A;  4C8K A;  5KT2 A;  4TQR A;  3AU6 A;  1RZT A;  3PMN A;  2MUT B;  3NTU A;  3OJS A;  3QZ8 A;  3GIL A;  4GXJ A;  2BPG A;  4MF8 A;  3MBY A;  1KFD A;  3PO4 A;  5IIJ A;  4KLL A;  3RJJ A;  9ICW A;  5KFK A;  5KG1 A;  3NGD A;  1NKC A;  1LV5 A;  9ICK A;  3UXO A;  2IBK A;  1L5U A;  4B9M A;  4KLS A;  3JPS A;  4O3N A;  4EYI B;  5HHI A;  4KMU A;  3M8R A;  1NKE A;  4DF8 A;  2I1Q A;  3RJG A;  4MEY A;  4Q43 A;  4F5N A;  1KFS A;  2P6R A;  3MFH A;  4Q8F A;  3BQ2 A;  4KLQ A;  7ICE A;  1RYR A;  4DQQ A;  1BPZ A;  9ICP A;  5CP2 A;  4C8N A;  4P4M A;  2FPL A;  1T8E A;  1MQ2 A;  3SV4 A;  4TUS A;  3PY8 A;  5KFB A;  3PW4 A;  4I27 A;  9ICJ A;  3B0X A;  3C1Y A;  4R63 A;  5EOZ A;  5J2K A;  1WCL A;  3RJI A;  8ICR A;  1ZQU A;  2W9M A;  4DF4 A;  4F4X A;  3M9M B;  4F50 A;  2PFN A;  4RPY A;  4QWA A;  5KFE A;  5D46 A;  1TAU A;  3RBD A;  4Z6E A;  2BCS A;  4QWD A;  4YVZ A;  3C2L A;  5KFD A;  2W9A A;  4F93 B;  4RZR A;  3UQ0 A;  5KT7 A;  8ICU A;  2P66 A;  1Z00 B;  2XCA A;  4QZA A;  3ZDD A;  4DL7 A;  2HVH A;  3TAQ A;  4UAZ A;  3Q8K A;  4F8R A;  4ED1 A;  4RQ1 A;  3MFI A;  3TAR A;  1QSS A;  4R65 A;  5DBC A;  4KLT A;  4DOB A;  5BPC A;  3IM1 A;  3GIJ A;  3C5F A;  5CWR A;  4PHD A;  3PW2 A;  3ISC A;  2F1J A;  3C21 A;  4YMN A;  2BHN A;  4DS5 A;  1NJW A;  4BXO A;  4QZH A;  1ZQR A;  7ICJ A;  3M8S A;  2KFZ A;  5J29 A;  9ICC A;  1JX4 A;  2J6S A;  1S9F A;  2R8G A;  1XC9 A;  4ECX A;  3TQ1 A;  2AJQ A;  2WTF A;  2W9C B;  4ELU A;  4TUR A;  2Y1I A;  2XY7 A;  2C2E A;  1NK6 A;  5KG5 A;  1KLN A;  2FLL A;  3C1Z A;  5J2A A;  1L3T A;  1ZQM A;  5KFC A;  3OGU A;  1ZQZ A;  4F3O A;  5DBA A;  4XA5 A;  1U4B A;  1NKB A;  4GXK A;  4P4O A;  4RQ7 A;  3T5L A;  3PO5 A;  3GV5 B;  5D4B A;  5KFN A;  4UBB A;  1HUO A;  2ZJA A;  4RPZ A;  4DWI A;  4E0D A;  8ICK A;  2KFN A;  5KFY A;  3M9N B;  4F4Y A;  4RPX A;  5CA7 A;  4HYK A;  4M2Y A;  4KN4 A;  4TUP A;  3ETL A;  3FDS A;  3JPO A;  5DB6 A;  5KFH A;  7ICQ A;  5DDM A;  3Q8Q B;  1LB2 B;  3TI0 A;  1TK0 A;  4I2A A;  5KFG A;  5J0Q A;  2OWO A;  5DB7 A;  4EZ6 A;  2XC9 A;  4FS1 A;  1U49 A;  3GDX A;  4DQI A;  4O3S A;  4ELT A;  5KFM A;  5KG6 A;  3PR4 A;  3RH6 A;  4KLU A;  4J9K A;  4QZI A;  4KLI A;  8ICY A;  3MR3 A;  5KFS A;  4KLH A;  2XGQ A;  3UPQ A;  1TK8 A;  4TUQ A;  5KG7 A;  2FMQ A;  4IRD A;  2BQU A;  4DSI A;  7ICP A;  3G6Y A;  4KLM A;  1EXN A;  1XO1 A;  3RJE A;  1K1S A;  2XY6 A;  5D49 A;  2F1H A;  4M6W A;  4F91 B;  5IIM A;  4RQ3 A;  4K4I A;  4F5R A;  4DEZ A;  2C2D A;  5DB8 A;  4JV1 A;  3RRH A;  8ICW A;  2KZ3 A;  2ZUB A;  1SKW A;  2BPC A;  5JUM A;  3THV A;  1K1Q A;  4RT2 A;  2PI5 A;  5DKW A;  1MQ3 A;  4M47 A;  4QW9 A;  1S97 A;  1PZN A;  3PX6 A;  2BCR A;  4MFC A;  5DQH A;  3Q8M A;  3AUO A;  8ICN A;  4RQ6 A;  1ZET A;  2ZUC A;  3RB0 A;  2HHX A;  3ISD A;  4UAY A;  7ICK A;  5DGB A;  1L3S A;  2IHN A;  2BCQ A;  4UBC A;  2UVW A;  5DB9 A;  3HPO A;  1KFT A;  1JN3 A;  2HHV A;  2C28 A;  2GWS A;  4IR1 A;  4EBE A;  5BOL A;  4ED0 A;  3H40 A;  2UVR A;  1S77 D;  8ICT A;  4IRC A;  5DG8 A;  4Z6D A;  9ICN A;  4F5O A;  3Q8R B;  4M04 A;  4ED3 A;  3RJF A;  4QZB A;  3MGH A;  4O3R A;  9ICT A;  4O3Q A;  5KG2 A;  4R66 A;  5DLG A;  3OJU A;  2V4Q A;  1SL0 A;  3EPI A;  1S76 D;  3BJY A;  5L1J A;  4CCH A;  2KZZ A;  4UB5 A;  4J9P A;  1SL2 A;  2BCV A;  5KFL A;  4RQ0 A;  4ECZ A;  4RNN A;  2AGQ A;  1DOQ A;  1KTQ A;  4O3O A;  1XU4 A;  2AGP A;  4PHE A;  1ZQE A;  3QE9 Y;  4I2J A;  4YCX A;  3H8J A;  2W9B A;  5KFJ A;  3E2E A;  4KLJ A;  2JZB A;  4RT3 A;  1A76 A;  3EWA A;  4YFK A;  1ZYQ A;  4I2H A;  3PR5 B;  9ICO A;  3BQ0 A;  4I2C A;  4K4G A;  4QW8 A;  2HHT A;  4DL4 A;  5KFX A;  4PHP A;  9ICX A;  2NRW A;  4ECW A;  4ECT A;  5KFQ A;  3KHL A;  8ICI A;  8ICC A;  3N97 B;  4M0A A;  3OSN A;  2PI4 A;  3ZD8 A;  3QEA Z;  2XO7 A;  1NOM A;  1X9W A;  1DGS A;  5L1K A;  1SKS A;  2W9C A;  3HWT A;  5J0X A;  5DG7 A;  4M9G A;  4NM2 A;  4YR0 A;  3EZ5 A;  4DOA A;  4EEY A;  1RXW A;  3KHH A;  3RAQ A;  2FMP A;  1ZQT A;  4DLG A;  1CEZ A;  3JPQ A;  4PH5 A;  1CUK A;  3SV3 A;  3Q8P B;  2ASD A;  1ZQP A;  4F2R A;  3C5G A;  4XUS A;  4MFA A;  4C8O A;  2RDI A;  3GFK B;  4JV0 A;  1JMS A;  3UQ2 A;  2JEG A;  4RQ4 A;  8ICO A;  5KTQ A;  4X5V A;  2HHU A;  4J9N A;  1X2I A;  2MAX A;  7ICV A;  4IQU A;  4FBT A;  8ICS A;  4EBD A;  1ZQQ A;  4YR2 A;  1BPB A;  2XGP A;  4ELV A;  2JEI A;  9ICH A;  5KFA A;  4BWM A;  5L9X A;  5KFF A;  3TAN A;  1JIH A;  4MFF A;  4B9V A;  3G6X A;  4DSF A;  4QZF A;  4DFP A;  7ICH A;  3FYH A;  4ECY A;  4DFJ A;  2ZTD A;  5J0T A;  1X9M A;  5EWE A;  3Q8L A;  2AQ4 A;  4F4K A;  2HHQ A;  1ZQG A;  7ICT A;  4ED6 A;  1ZQB A;  4M9N A;  2AU0 A;  4Q8E A;  4O9M A;  4JUZ A;  2FPM A;  5J2F A;  4QZD A;  4QWC A;  2FPK A;  1NK7 A;  5KFZ A;  8ICX A;  1ZQC A;  3HP6 A;  2IMW P;  2KZM A;  4GLX A;  5J0Y A;  3TAP A;  4QZ9 A;  3PNC A;  3C2M A;  5HMM A;  4YMO A;  3H7I A;  4PHA A;  3PW5 A;  1TKD A;  4RU9 A;  4KLD A;  3LDA A;  1U47 A;  2HHS A;  4Q45 A;  2R8H A;  1L3V A;  4F2S A;  1HUZ A;  5J2H A;  2ASL A;  9ICI A;  1TAQ A;  2LYH A;  4O5K A;  4I2B A;  8ICE A;  4JV2 A;  4QZE A;  3PX0 A;  4LZD A;  3V7L A;  2DFL A;  1IM4 A;  3LWL A;  1NK9 A;  1MSW D;  3K75 D;  1WCN A;  4DOC A;  8ICP A;  3ZDE A;  4YXM A;  4K4H A;  1BPE A;  5J2E A;  1Z3E B;  3V7K A;  1ZJN A;  1Y88 A;  7ICR A;  3V6H A;  2C2R A;  4DL6 A;  5KFI A;  5HNK A;  5KT5 A;  3PW0 A;  2NRT A;  1UA0 A;  4B9N A;  4UAW A;  3ORY A;  3EPG A;  2MUT A;  3KHR A;  4F5P A;  1SKR A;  3MGI A;  1QTM A;  4NLG A;  7ICI A;  3AU2 A;  5DLF A;  3KHG A;  4PPX A;  4DL2 A;  3EYZ A;  3H8S A;  7ICN A;  3T5K A;  5DG9 A;  4BXO B;  4R8U B;  5J2C A;  2NRV A;  5KFU A;  1ZQL A;  4DL3 A;  4UB4 A;  2ALZ A;  5KG0 A;  3ZDC A;  4O3P A;  4LZG A;  3RB6 A;  1ZQD A;  9ICS A;  9ICM A;  4RUA A;  3RJK A;  9ICF A;  3GQC A;  3MAB A;  1TV9 A;  3MDA A;  4F92 B;  2BQR A;  2UVU A;  3PW7 A;  3EW9 A;  1S0M A;  4BWJ A;  3G6V A;  4Q44 A;  3HW8 A;  2AGO A;  4YN4 A;  4PGX A;  1U9L A;  4I28 A;  3N4M B;  5CHG A;  2HHW A;  3M9O B;  1JXL A;  3RB4 A;  4I2E A;  4XQ8 A;  4B9L A;  2V4R A;  3ISB A;  1ZQF A;  4FBU A;  2J6T A;  1XWL A;  4IR9 A;  1RXV A;  4YP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...