3N97B

Rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Combined structural model for a transcription activation assembly
rcsb
source organism Thermus aquaticus
molecule tags Gene regulation/dna
molecule keywords RNA polymerase sigma factor
total genus 21
structure length 75
sequence length 75
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3n97B00
1S0MA 3NGDA 5J0RA 5J0OA 2R8HA 7ICQA 3RBDA 5KT6A 2IHNA 2Y1JA 4UAWA 1XU4A 4KLLA 2C28A 4UB4A 4C8LA 4YXJA 3UQ2A 2BQUA 4EBCA 5J2DA 2ASLA 3SZ2A 3QE9Y 3RB4A 4DSIA 8ICBA 3C2KA 4KLIA 2BCVA 1D9FA 2KZZA 2XC9A 5KG0A 3V72A 3PNCA 3GILA 1MQ2A 3V6HA 1QSLA 7ICMA 5J0UA 9ICNA 5KG5A 9ICLA 4F4KA 1COOA 2HHVA 4I2JA 1ZQXA 3SYZA 4K4GA 5KFRA 5KTQA 1NJZA 4QZEA 2P6RA 9ICKA 4B9MA 8ICAA 3ZDAA 2NRZA 4Q8EA 4IRDA 8ICIA 1XS9D 2ZTEA 1AROP 1BGXT 2VA8A 4GC6A 9ICHA 4BGDA 5HHIA 2WTFA 5EWEA 1L5UA 2AGOA 3OGUA 2BQRA 7ICTA 5EWGA 4EBEA 1S76D 1A77A 1ZQIA 5L1KA 3PV8A 2BCSA 4B9VA 4PGXA 4M9GA 9ICFA 3T5KA 4UAYA 2AQ0A 5KFHA 4I2HA 4F2RA 3HT3A 4TQRA 3RJKA 9ICWA 3ISCA 1TK8A 4YQWA 4F4YA 4Q44A 1RPLA 1KRPA 4RQ7A 2ZTDA 3MR3A 4RT3A 2C2DA 2PI5A 1ZQJA 7ICPA 1ZJMA 5J2AA 2ISOA 4MF2A 1BPYA 1T4GA 4IQUA 4IR9A 4UBBA 5KFYA 3C2LA 8ICFA 1TVAA 2HHWA 3JPNA 2FLLA 2H5XA 9ICTA 3LDAA 4ELVA 1LV5A 3GIIA 5IINA 1NKCA 1QTMA 3MFIA 5DG8A 4RQ5A 3RH5A 2HVIA 1ZQZA 5KFKA 5F9NA 5J29A 5JUMA 3PMLA 8ICJA 4P4MA 2HHUA 3THVA 8ICWA 3JPOA 3OSPA 4EEYA 8ICTA 1KDHA 1KTQA 4QW8A 4QZDA 1TK5A 4I2CA 4M6WB 3RB3A 4KLEA 5HHHA 9ICEA 4GLXA 4IQWA 2LYHA 3JPRA 4O3PA 4KLFA 4O5KA 1X9WA 4YFKA 4F4ZA 3ZDCA 7ICKA 3ZDBA 4YP3A 2MUTB 5KFLA 4F92B 4DL3A 4KMUA 3GFKB 5CA7A 4QWCA 4F5NA 8ICQA 4Z6CA 4YG2A 1NJXA 1D9DA 1PZNA 5D49A 4ELUA 4M9JA 3GQCA 3Q8KA 3RJIA 4CCHA 3PW7A 3V6KA 1RYSA 4JV0A 1ZQVA 2IHMA 2HHXA 7ICFA 4FS2A 2PFNA 4RPZA 4RQ8A 3C1ZA 2ASDA 3M9NB 1S0OA 3UXPA 4LZGA 2BPFA 4QWAA 3C2MA 1N56A 5J2GA 5KFFA 1SL0A 3OJUA 1JXEA 1XO1A 4DS4A 4B9NA 9ICPA 4F5PA 4ED2A 2C2RA 2V4RA 4RQ6A 8ICLA 4YMMA 1MC8A 4Q43A 5EWFA 1RXWA 5DGAA 5IIMA 4MF8A 1JIHA 1ZQGA 4JWNA 7ICOA 1X9MA 2A1JA 2JZBA 3Q8RB 5DGBA 2UVWA 4DSEA 3GIKA 3ZDEA 4EYHB 4RZRA 1KFDA 4ECYA 1L3SA 4JV1A 3PW5A 5KG1A 4PGYA 4I2IA 3GV5B 4DL6A 5KT4A 4M04A 4Q8FA 3PW4A 4ED1A 3RRGA 1CEZA 3JPQA 4NM2A 4RQ2A 1NK8A 1X2IA 2UVVA 4I29A 4NLGA 1EXNA 4I2GA 4I2FA 5D4BA 2ZUDA 1T7PA 2NRVA 3M8SA 1BPXA 1UT8A 2W9AA 4O3SA 1XSNA 2BR0A 1ZQEA 1NK0A 5KFVA 4F50A 4ED3A 4DL7A 4GC7A 3EPIA 2UVRA 4QZIA 4ECTA 4B9SA 1IM4A 2F1IA 4DQPA 4J9SA 1A76A 4BWJA 3JPPA 2DPJA 4G3IA 4QWDA 2FMSA 5DBBA 4HYKA 3JPSA 5KG3A 3BJYA 2KZMA 4IQTA 2BPGA 4I28A 1NK6A 1H38A 3BQ1A 2I9GA 9ICSA 4DSJA 2BKEA 2ALZA 3PW0A 5KFAA 4ED6A 2RDIA 2JEGA 9ICOA 1BPDA 5BOLA 4C8NA 3G6XA 5J0XA 1UA1A 4GXJA 4DQIA 1NK9A 5DQHA 2V4QA 4XQ8A 9ICJA 2W9BB 4M0AA 3AU6A 2AU0A 3MGIA 5KFGA 1S10A 2MUTA 7ICEA 3C23A 4PH5A 3OHAA 4BDPA 4KTQA 3FDSA 1IXRA 5CWRA 5DLGA 4B9LA 1U45A 1U9LA 5DDMA 2V9WA 4F91B 4IQVA 4RQ0A 1U47A 1RYRA 4UB5A 4O0IA 3RTVA 1ZQUA 4J9NA 3Q8SB 5HMLA 5EOZA 3TANA 3KHHA 9ICGA 3EWAA 8ICUA 4ECUA 4I2AA 2XO7A 4NLZA 3PO4A 1D8YA 8ICCA 4YCXA 3EZ5A 2MAXA 1TAUA 4I2BA 1BPEA 1ZYQA 1CUKA 5HNKA 3Q8MA 1NJYA 2R8GA 5L1IA 1ZQQA 1U49A 4DSKA 7ICNA 2KZ3A 4R63A 3PR4A 4UB1A 4ELTA 5KFTA 3ETLA 5J2HA 2FPMA 1WCNA 5J0PA 4IRCA 5CHGA 5KFSA 3HX0A 2ZTCA 3HP6A 9ICVA 5DB9A 4Z6FA 5KFCA 2RDJA 3RBEA 2ASJA 4M47A 1Y88A 9ICAA 4XUSA 2FPKA 3SI8A 5KFBA 9ICUA 7ICIA 5TZVA 3T5LA 2PI4A 4RQ3A 3RAQA 4I27A 2BDPA 3K4GA 4FBTA 3TI0A 3PX0A 1T8EA 1BPBA 1L3VA 4JWMA 5KFMA 1ZQRA 1WCLA 2ATLA 5KFWA 1NK5A 2XGQA 5D46A 4KLQA 3V6JA 1ZQYA 2PXIA 1D8LA 4JV2A 5DQGA 1U48A 1HUOA 4P4OA 3BQ2A 1DGSA 1UA0A 4JUZA 2J6TA 3C5GA 2ZJAA 5KG4A 4J9KA 5KG6A 4YVZA 5HP4A 2KFZA 4NLKA 5J0YA 1TKDA 8ICNA 5CJ7A 3B0XA 4QZHA 5KFUA 3PMNA 3QZ8A 4KLDA 3K75D 2R8KA 3MABA 4XRHA 4O3QA 2XCPA 4GXKA 4YR0A 4F5OA 2XY5A 3PW2A 3QEAZ 2W9MA 1ZQDA 1ZQNA 1KFTA 5HMMA 2NRWA 5J2KA 4MFAA 3TAPA 3HW8A 3B0YA 3TAQA 4K4IA 4Z6EA 4DL2A 9ICRA 3KTQA 3H8WA 3EW9A 3UXNA 3ZDDA 4NXZA 1MSWD 2HHQA 1QSSA 4R8UB 1JX4A 4K4HA 3BQTA 3H40A 4KN4A 2VA2A 4DOAA 1NOMA 4C8OA 4ED7A 4DLEA 7ICVA 2PFQA 2W9BA 5KFDA 5KT3A 3OSNA 2PFPA 4RUAA 4DSFA 1S77D 4DEZA 2BCRA 2FLNA 2XGPA 5KFEA 4RPYA 2J6SA 4DLGA 3RJEA 4IRKA 2IA6A 4QWEA 3UPQA 4DO9A 4DFMA 4DS5A 4DQSA 1NKBA 4F8RA 4J9LA 4KLGA 2FLPA 4KITB 1ZQLA 2IBKA 4DQQA 4TURA 4QZ8A 4DOBA 1JXLA 4TUQA 5DKWA 4Q45A 1V9PA 5F9LA 5J2IA 5J0QA 3Q8PB 3MDAA 4RU9A 4RNNA 1X9SA 4YN4A 9ICQA 3PO5A 4J9RA 3OHBA 2UVUA 2FMQA 9ICMA 5L9XA 4UAZA 4MEYA 2DFLA 1XSPA 4RNOA 3RRHA 5J0WA 2W9CB 4BXOA 2HVHA 4JK1A 3FYHA 2B21A 4ECSA 1S9FA 4UB3A 1SZPA 2AGPA 1ZQMA 1S97A 4C8MA 5DDYA 3ISBA 3GIMA 2P66A 1S0VA 2XY6A 3TFSA 5KFIA 2I1QA 4YMNA 1B43A 3MR2A 3N97B 3BDPA 8ICKA 4BWMA 3G6VA 8ICRA 7ICHA 3MGHA 3PX4A 3Q8LA 4KLTA 5KT2A 1JN3A 5CR0A 2F1JA 9ICIA 4I2DA 3RAXA 4RNMA 5KFZA 1K1SA 3HPOA 3MR5A 3HWTA 4DF8A 3T5HA 1LB2B 2NRTA 3KHGA 5KG2A 1KSPA 2XY7A 3V7KA 4O3OA 4UQGA 7ICJA 5J0TA 4DOCA 2W9CA 3IM1A 4X5VA 2KFNA 3ZD8A 9ICCA 3C1YA 8ICXA 5J2FA 2W8KA 1RZTA 4LVSA 4KLMA 4DQRA 5C5JA 2NRXA 1JMSA 1HUZA 2A1JB 2JZBB 5KFQA 3PR5B 3M9OB 3BQ0A 3M8RA 1NK7A 4B9TA 4DSLA 4F4WA 2JEFA 4PHEA 4MFFA 3NTUA 4PHPA 4TQSA 3E2EA 3TFRA 3MDCA 3H4DA 3H8JA 1U4BA 3GIJA 4NLNA 2KTQA 4QZFA 2W8LA 1B22A 3RJFA 3UXOA 3PY8A 2KN7A 3RJGA 3LWMA 1XWLA 2FMPA 4P2HA 8ICZA 8ICOA 1SKWA 3SV4A 7ICSA 4FS1A 2FPLA 4M6WA 4P4PA 4E0DA 4PPXA 5IIOA 4R65A 4QWBA 3T5JA 5DQIA 5IILA 1ZETA 1TV9A 8ICPA 3QZ7A 3RB0A 4F5QA 1S0NA 9ICXA 4PHDA 8ICMA 4F93B 2BCUA 2BQ3A 5CB1A 5KFNA 1N48A 1ZQHA 4J9OA 4ZH4A 3H8SA 4F3OA 2HW3A 5J2CA 4F5RA 2GWSA 2PFOA 4KLOA 7ICGA 4XA5A 7ICUA 1BPZA 2C22A 1XSLA 3RR8A 3T3FA 1TK0A 1Z00A 4ECQA 3V7JA 5IIKA 4ECVA 3MFHA 3PVXA 2BGWA 3RJHA 3V7LA 3RH6A 5KFXA 3LWLA 1HJPA 5J2JA 5DG9A 4O3NA 3SV3A 8ICEA 8ICVA 5J2EA 5KT5A 1ZQPA 4I2EA 4BXOB 4M9HA 2VA3A 2J6UA 4UB2A 1SL2A 1TAQA 4YXMA 4DFKA 2ZUBA 5KFJA 2Y1IA 3N4MB 2JEJA 2HHTA 1TFRA 2OWOA 2AJQA 5J0SA 4KLJA 3AU2A 4R66A 3RR7A 4KLHA 1SL1A 2XCAA 4DF4A 4ED8A 4F4XA 4R64A 1ZQAA 4EZ9A 2F1HA 9ICBA 7ICLA 4YR3A 1KFSA 4ED0A 1DOQA 3TARA 1ZQKA 4TUPA 4M9LA 3C21A 4RQ1A 1C7YA 2BHNA 3IHQB 5BOMA 1QSYA 4M9NA 8ICHA 3C5FA 4LZDA 4YMOA 1Z3EB 3PX6A 4MFCA 5IIIA 2AQ4A 1SKSA 3OJSA 1ZQTA 5DG7A 4QZGA 3KHLA 5L1JA 3GV7B 4PGQA 1ZQOA 4DWIA 3ORYA 3RH4A 1L3TA 4ECRA 4NM1A 2R8JA 4KN7A 5DBCA 3EYZA 1ZJNA 4O5CA 1L3UA 5KG7A 2M9NA 4QZAA 4RUCA 1XC9A 3QEBZ 4O9MA 8ICSA 4DL5A 5L1LA 1UT5A 1ZQWA 2ZJ8A 2ISPA 1RXVA 4FO6A 5DB6A 2BPCA 4UBCA 3H7IA 5KT7A 2R8IA 5DB7A 4J9QA 4J9PA 4YD1A 4YR2A 4B9UA 4O3RA 4EBDA 3RB6A 8ICGA 2ZUCA 4J9MA 1NK4A 4O5EA 3MBYA 4QZBA 4QZCA 1KEJA 4EZ6A 3H4BA 4EYIB 4KLUA 5KFPA 2BCQA 5DBAA 3JPTA 3G6YA 5DB8A 1NJWA 4F2SA 2Q0ZX 4RQ4A 4NY8A 4GXIA 4KLSA 3RJJA 4C8KA 2C2EA 1ZQFA 2JEIA 1KLNA 5CP2A 4PHAA 4DFPA 4DFJA 1ZQBA 3ISDA 2IMWP 1K1QA 2DPIA 4M2YA 5DLFA 4QZ9A 1QLNA 5BPCA 3EPGA 8ICYA 4QW9A 1SKRA 3UQ0A 3GDXA 4IR1A 3TQ1A 3Q8QB 2P6UA 4TUSA 3MR6A 3AUOA 4RPXA 5KFOA 4FBUA 4RT2A 4ECXA 1Z00B 3LK9A 3KHRA 5IIJA 7ICRA 2VANA 1ZQSA 2ZJ5A 4R8UA 4YD2A 3GV8B 1T3NA 4ECWA 1ZQCA 3ZD9A 1MQ3A 2AGQA 3M9MB 1NKEA 1BVSA 2HHSA 4Z6DA 4DL4A 4ECZA 4MEXA 5J2BA
chains in the Genus database with same CATH superfamily
2I5HA 2NO4A 1XU4A 4KLLA 4YXJA 3U26A 2F8LA 5JRTA 3V72A 1MQ2A 3V6HA 4P0PA 9ICLA 1YZ6A 4F4KA 2HHVA 3TACB 1ZQXA 2RLTA 3SYZA 5KFRA 5KTQA 4GFJA 3QU9A 8ICAA 3ZDAA 3IV6A 2OH2A 4Q8EA 4Y2SA 1AROP 5ALQA 4GC6A 4ZOHC 2WTFA 2EZXA 3NVZA 1N5XA 2HOFA 2BCSA 9ICFA 4M9GA 2KIWA 4I2HA 3H0LB 3HRDD 4DFDA 1F0MA 9ICWA 2G0AA 4NJ8A 1KRPA 4RQ7A 2ZIXB 1ZXIA 3MR3A 2C2DA 4B6JA 3QUCA 4IR9A 5EE9A 3PSPA 3C2LA 4ELVA 1LV5A 1DRGA 5IINA 3IRUA 2E5SA 2HVIA 1ZQZA 5KFKA 4ACOA 5AKHA 2G5HB 1L6NA 2KOBA 1KTQA 4QW8A 4I2CA 4M6WB 2JXJA 2WF8A 4EEKA 4KLEA 2LYHA 2W7OA 4BUGA 3QNMA 4KLFA 1N60A 2H3ZA 2MUTB 4F92B 4Y2PA 5CA7A 5AHXA 4YG2A 4ELUA 5D49A 4CCHA 1S8OA 2NO5A 1RYSA 2VIXA 2WF5A 2ASDA 3M9NB 2BPFA 3D6JA 1DK3A 1JXEA 4DS4A 2C2RA 4BJQA 1ZQGA 5IIMA 4MF8A 1JIHA 4JWNA 1FFUA 2BZFA 2LPEA 3K1RB 4DSEA 2KKVA 4RZRA 4JV1A 2RQ5A 1ZD4A 4I2IA 4DL6A 5KT4A 4M04A 3PW4A 4ED1A 4RQ2A 1HEKA 4I2GA 3O0FA 5J8YC 4I2FA 2ZUDA 1T7PA 3WKDA 1BPXA 4O3SA 2BR0A 2G09A 2UVRA 4QZIA 4DQPA 2ZIXA 4J9SA 3JPPA 2DPJA 1C20A 4QWDA 1O03A 4OCZA 1ZRNA 3JPSA 5KG3A 2KZMA 1NK6A 4DSJA 2JEGA 2RDIA 5J0XA 4DQIA 5ALUA 2LKYA 2W43A 4M0AA 2CN1A 5E79U 2MUTA 1ZD5A 3C23A 4PH5A 1F5SA 2QB0B 1CRXA 4JB3A 4P0QA 1U45A 5AI5A 1U47A 3RTVA 1ZQUA 1JRPA 3Q8SB 5EOZA 3KHHA 4ECUA 5AM4A 3PO4A 1CUKA 3Q8MA 5AICA 1U49A 7ICNA 1DXSA 3PR4A 4ELTA 3SQIA 5J0PA 1GO3F 5KFSA 2ZTCA 3HP6A 3HX0A 2RDJA 5F3XB 1BNOA 4RQ3A 3K4GA 4FBTA 2WF6A 1BPBA 1OXJA 1QCKA 5KFMA 2ATLA 2M0NA 1ZQYA 1UA0A 2KVCA 3AN1A 5KG6A 1JALA 5HP4A 2KFZA 3QZ8A 2QARA 2R8KA 3MABA 1S5LU 2VKQA 4YR0A 4F5OA 2XY5A 3KKAC 1UPHA 1ZQNA 4NLBA 3TAPA 1M6YA 3B0YA 4K4IA 4Z6EA 9ICRA 3EW9A 3UXNA 2KSOB 2Z7JA 1N62A 3UMBA 4NL9A 4DOAA 5AM0A 4ED7A 5KFDA 2PFPA 3KD3A 4QIWC 2E8PA 4RPYA 4IRKA 2IA6A 4QWEA 3C29A 1SZHA 2QB0A 4DQSA 4J9LA 4KLGA 2FLPA 3SR6A 4TURA 1JXLA 4MHVA 5AI4A 4TUQA 5ALRA 4J9RA 9ICMA 5L1MA 4CDGA 2JMGA 4MEYA 5J0WA 4JK1A 2B21A 2LI6A 4UB3A 5DDYA 3WU2U 4YMNA 3BDPA 3N7SC 2Y9UA 1JN3A 5HR7A 2EZZA 4RNMA 3MR5A 3HWTA 3KHGA 5KL8B 7ICJA 2W3RA 3QU2A 4CNQA 2ZIWB 3ZD8A 8ICXA 5J2FA 1RZTA 4KLMA 2A1JB 5ALSA 4PHPA 3TFRA 3PY8A 3RJGA 1Q46A 1X42A 4M6WA 4P4PA 4E0DA 4PPXA 4R65A 1ZETA 4F5QA 3NUQA 9ICXA 4PHDA 8ICMA 2BCUA 2BQ3A 1N48A 2E1FA 5J2CA 2PFOA 2IOHA 3RR8A 4ECQA 3V7JA 3LWLA 5DG9A 3ED5A 3SV3A 8ICEA 5J2EA 4J03A 1UQVA 2W3SA 2Y1IA 3IG8A 2JEJA 3TKAA 4KLJA 2R18A 3ONNA 1SL1A 4DF4A 2OYYA 3PSIA 4ED8A 5AI0A 1ZQAA 7ICLA 5CRXA 4ED0A 4RQ1A 3AL0B 2BHNA 1QSYA 4M9NA 4LZDA 3BZKA 5IIIA 1SKSA 1ZQTA 5DG7A 2YMLA 4FZMA 4QZGA 5L1JA 3GV7B 2XICA 1ZJNA 1RQLA 2G08A 5KG7A 2M9NA 3N28A 4QZAA 2YQEA 2YMQA 4O9MA 5L1LA 5AI6A 5KL1B 2OHFA 3L5KA 4FZNA 3WK5A 4YR2A 8ICGA 4QZCA 4KLUA 5KFPA 3OPXA 3G6YA 2KD1A 5ALTA 4GXIA 3AEVA 3RJJA 1ZQFA 3WKCA 4DFPA 2HMXA 4CF4A 2IMWP 1K1QA 2DPIA 1QLNA 4IR1A 2YB1A 4TUSA 5AI8A 2EZYA 3KHRA 5IIJA 2VANA 4YD2A 1T3NA 4U6PA 3M9MB 1BVSA 1V38A 1J2MA 4C4RA 4MEXA 4YD1A 5J0OA 7ICQA 2Y1JA 3WKEA 2C28A 3BS5B 2BQUA 3C2KA 2XC9A 5KG0A 3PNCA 2D8CA 2WAQC 5J0UA 5T14A 4C4SA 1J97A 2YX8A 2BDUA 4I2JA 4K4GA 2P6RA 9ICKA 4B9MA 2O6KA 1SXEA 2A19A 4Y2JA 4IRDA 5GTIU 2ZTEA 9ICHA 2GOLA 3SD7A 3RFAA 3OGUA 3M7DA 2BQRA 1KN5A 4EBEA 1ZQIA 3PV8A 4PGXA 5AKKA 2WHEA 1X6IA 3QU7A 3ISCA 4F4YA 1KKXA 4PZOA 4RT3A 2PI5A 5J2AA 2ZXHA 4OJPA 1BPYA 2NYVA 2ISOA 3UMGA 4UBBA 8ICFA 9ICTA 3GIIA 1QTMA 5DG8A 3RH5A 2LBOA 5J29A 5JUMA 3TADC 8ICJA 8ICWA 3OSPA 2EH9A 4QZDA 4IQWA 3H8MA 4O5KA 3E58A 2K8BB 2XIDA 3I76A 5KFLA 3GFKB 3HKZF 5ALHA 3BS5A 4Z6CA 1NJXA 1PZNA 3RJIA 1ZQVA 1ZOLA 2HHXA 2KE7A 4FS2A 4RQ8A 3C1ZA 5J2GA 4NV0A 1K5OA 3AMZA 3HJEA 4B9NA 1ZRMA 4F5PA 4RQ6A 2DF4B 8ICLA 2ZIWA 4Q43A 5DGAA 5ALMA 2A1JA 4Y2UA 3ICXA 2YTUA 4ECYA 3NVWA 3PW5A 5KG1A 3KZXA 3RRGA 1PK1B 2HOQA 2ES6A 3M8SA 1XSNA 1ZQEA 4C80A 1NK0A 4DL7A 3EPIA 4B9SA 1IM4A 4Y2XA 2JH7A 3IG5A 2ESEA 3M6ZA 3BJYA 2BPGA 9ICSA 4BX9C 4F71A 5AK6A 1WWVA 2HBMA 1BPDA 5BOLA 4C8NA 1NK9A 4EX7A 2V4QA 1Q3VA 3CRXA 3AU6A 3MGIA 1S10A 3OHAA 3FDSA 1IXRA 3I28A 5DDMA 4F91B 4IQVA 2F44A 4UB5A 4O0IA 5HMLA 9ICGA 3EWAA 4I2AA 2XO7A 4YCXA 3EZ5A 4I2BA 5HNKA 2E8MA 3LVVA 2HDOA 2KZ3A 4R63A 5KFTA 3ETLA 5J2HA 3GZFA 5AKGA 1L7PA 5DB9A 9ICAA 1Y88A 2FPKA 5KFBA 1N5WA 2AHOB 2PI4A 3MC1A 3QUBA 2ZXIA 1T8EA 2JHDA 1NK5A 4KLQA 3V6JA 2KJ5A 2K4HA 1D8LA 5DQGA 2DL0A 4UAUA 1DGSA 4YVZA 3TADA 5AK5A 5KFUA 3K75D 4XRHA 4GXKA 1ZQDA 4OO1J 1X40A 5AK4A 2YN4A 3KTQA 3H8WA 1LKYB 2HHQA 4EELA 3WK4A 3BQTA 4KN4A 2VA2A 2KP7A 4RUAA 4DSFA 4DEZA 5KFEA 1F44A 3KOOA 4DFMA 5ALFA 4F8RA 5DKWA 4RU9A 2UVUA 2FMQA 2VJ4A 4WJ3B 2W7PA 1TAMA 3NRWA 4RNOA 3RRHA 9ICPA 4BXOA 3VCBA 1SZPA 2LYBA 1ZQMA 4C8MA 2GLEA 1ZQ1C 3GIMA 3HILA 3M1YA 3H0RB 4G9BA 1Z1BA 3TFSA 2K8CB 1MN8A 2VJ5A 2I1QA 3G6VA 3NASA 3Q8LA 5CR0A 2DQNB 5KFZA 4PZNA 3HPOA 1LB2B 1KSPA 3SAFA 1KL9A 3V7KA 5AK3A 4UQGA 4DOCA 3AQEA 2KFNA 1QH9A 9ICCA 2HOIA 1KW4A 4LVSA 2NRXA 5C5JA 2JZBB 5AKEA 4A8EA 5KFQA 3M9OB 3M8RA 4CRXA 2JEFA 5AIBA 4NLNA 2KTQA 2W8LA 5AKJA 5EE1A 4UASA 3RJFA 3UXOA 2KN7A 3CP8A 3FM9A 8ICZA 7ICSA 1DGJA 1PK3A 2KJ9A 3QZ7A 3AQFA 2JH1A 4F93B 2EAMA 4J9OA 1J2NA 3H8SA 4OJ6A 4KLOA 5B66U 4XA5A 2CRXA 4OJ5A 7ICUA 1TK0A 3PVXA 5J2JA 4O3NA 4I2EA 4BXOB 3CW2C 2VA3A 2F77X 2J6UA 1L7OA 1TAQA 2ZUBA 3N4MB 3SMVA 2LM1A 3RR7A 2XVTA 1PK1A 4YR3A 1KFSA 3WKBA 3TARA 1ZQKA 4M9LA 4NLCA 5ALDA 3C5FA 3L3FX 3N7PD 3OJSA 1Q8KA 1ZQOA 4UW9A 3RH4A 4ECRA 5JU5A 4NM1A 3EYZA 5ALJA 2FDRA 1L3UA 3DDHA 8ICSA 1Q3UA 4DL5A 2W11A 1ZQWA 2ISPA 4FO6A 2R8IA 4B9UA 4O3RA 4J9QA 1NK4A 4O5EA 3MBYA 4QZBA 2DWQA 1KEJA 3FAHA 4EYIB 2HBLA 3KFUF 2BCQA 2KHQA 1VLBA 3IP4B 3WK9A 4OJLA 2KV2A 5AKZA 3LYSA 1SKRA 1RDFA 1A6SA 2RRDA 1X9XA 3KBBA 1L8OA 7ICRA 1ZQSA 2DBYA 4ECWA 1MQ3A 2DKZA 2H3IA 4DL4A 2KK0A 5J2BA 1S0MA 5J0RA 3RBDA 2IHNA 3D2QA 3IDWA 4UB4A 3UQ2A 2ASLA 3SZ2A 3QE9Y 8ICBA 4KLIA 2WAQF 1D9FA 3GILA 9ICNA 5KG5A 1COOA 3F5AA 1FO4A 1NJZA 8ICIA 4QIWF 4BGDA 5HHIA 5EWEA 7ICTA 1Z4NA 1A77A 2OCEA 3T5KA 2AQ0A 5KNIA 2ZIUB 1LKYA 5KFHA 1TK8A 2GO7A 4CGZA 1FEZA 4Q44A 2ZTDA 2GH1A 7ICPA 1ZQJA 4MF2A 4IQUA 5KFYA 1TVAA 2H5XA 3NVVA 3MFIA 3GU3A 1ZD3A 3PMLA 2YB4A 8ICTA 3RB3A 5HHHA 1SWVA 4CF3A 4YFKA 4F4ZA 7ICKA 1VJ5A 4YP3A 4DL3A 1L8LA 1N63A 4QWCA 4F5NA 1SV4A 1X6JA 4M9JA 3Q8KA 3V6KA 4JV0A 1ECWA 2IHMA 7ICFA 2PFNA 5ALVA 3F5EA 1S0OA 4RQMA 1N56A 5KFFA 3WK7A 3OJUA 5K4LA 1XO1A 1UCVA 4ED2A 2V4RA 4KMOB 1MC8A 2QB1A 4C7YA 2JZBA 2WFAA 5DGBA 1Z4OA 1OW5A 4UB8U 3D2SA 1VDVA 4PGYA 3GV5B 1CEZA 1NK8A 4I29A 2JR5A 1NNLA 4NLGA 5D4BA 2NRVA 2W9AA 1IV8A 4RQNA 4F50A 4ED3A 4GC7A 4ECTA 2F1IA 3F53A 2CPRA 4USAA 2LHTA 1IG6A 4EENA 4HYKA 4IQTA 1PVRA 2ODGA 2BKEA 2ALZA 4ED6A 3FC4A 1O08A 4XQ8A 9ICJA 3I1YA 2W9BB 3QUTA 2MRLA 2AU0A 5KFGA 7ICEA 2W54A 1SB3C 4B9LA 1HIWA 5J8YA 2ZIVB 2V9WA 4RQ0A 3QUQA 5G5GA 1T3QA 8ICUA 4NLZA 1D8YA 3WK8A 1TAUA 1JUDA 1BPEA 1JI7A 1NJYA 1ZQQA 2WB1C 3F2CA 4DSKA 4UB1A 5JTIA 1COKA 4Z6FA 3IN5A 3CYMA 2ASJA 4XUSA 4CE6A 3SI8A 1KQQA 4Y2YA 9ICUA 4I27A 2BDPA 2FJ6A 2PMZC 1URJA 1L3VA 4JWMA 1XNSA 1WCLA 3WK6A 2KKPA 3SENA 3RF9A 2PXIA 4US8A 2W03A 4JV2A 1HUOA 4P4OA 3BQ2A 4J9KA 2ZJAA 8ICNA 5CJ7A 3PMNA 4KLDA 1D8BA 3NRZA 1KFTA 3QEAZ 2W9MA 1T94A 4NL9C 4MFAA 2K89A 3HW8A 3TAQA 2K4IA 3ZDDA 3WKAA 2K4EA 1JX4A 4K4HA 3N7RC 1NOMA 1WUDA 2PFQA 2W9BA 1S77D 2BCRA 2XGPA 3A0BU 3RJEA 5B5EU 2H3FA 4DO9A 4DS5A 4KITB 2IBKA 2D3DA 5ALPA 4QZ8A 1AQ6A 4DOBA 2KMDA 2EQYA 4QNLA 2MSNA 4Q45A 5F9LA 5J2IA 5J0QA 9ICQA 4YN4A 3PO5A 3OHBA 1WG8A 4UAZA 2DFLA 2FE9A 1XSPA 5GTHU 2HVHA 3ISBA 2P66A 1S0VA 2XY6A 2EDUA 3N97B 1Z1VA 8ICRA 3DV9A 7ICHA 3MGHA 3SEIA 3PX4A 4KLTA 5KT2A 2F1JA 9ICIA 3RAXA 2D6FC 3D2NA 4Y2RA 2KIVA 1N61A 1UHUA 2W9CA 1DK2A 4X5VA 3C1YA 3PR5B 3BQ0A 1NK7A 4DSLA 3NTUA 3HKZC 3MDCA 3H4DA 2G06A 1U4BA 2AXTU 4QZFA 1B22A 2IOFA 4P2HA 1XWLA 2FMPA 5G5HA 3BZCA 8ICOA 3SV4A 4FS1A 2FPLA 2DUYA 5IIOA 3T5JA 5DQIA 5IILA 1TV9A 2LM4A 4PJ0U 1S0NA 5CB1A 3R9KA 1ZQHA 1X66A 3H0MB 3VC8A 2C22A 1BPZA 5ALLA 3KKAA 4ECVA 5IIKA 1SWWA 3MFHA 3V7LA 3RH6A 3QYPA 5KFXA 1HJPA 2EANA 5ALOA 1BNPA 5AM3A 1ZD2P 1SL2A 5ALGA 4YXMA 2HHTA 1TFRA 2OWOA 5J0SA 3AU2A 3QX7A 2YMPA 2F1HA 2P35A 3ETRA 4TUPA 2OM6A 5BOMA 1PVPA 2QLTA 1Z3EB 2B6GA 3PX6A 4MFCA 3KHLA 4PGQA 4UAVA 3ORYA 4QJFB 4KN7A 2E8NA 3LVWA 1XC9A 4PL1A 1RXVA 4J9PA 2BPCA 5KT7A 4NWIA 4EBDA 3RB6A 1IIPA 2ZUCA 1NI3A 1SV0A 4C0ZA 5KAFU 4J9MA 1QQ6A 4EZ6A 3H4BA 1V97A 3JPTA 1NJWA 4F2SA 2Q0ZX 4NY8A 4KLSA 1RM6C 3F2DA 2C2EA 1FFVA 1KLNA 5CP2A 4DFJA 5AKYA 1ZQBA 3ISDA 3QXGA 5DLFA 4QZ9A 3EPGA 4QW9A 3UQ0A 3GDXA 3TQ1A 3Q8QB 2CXYA 4FBUA 4RT2A 4UB6U 4U7CA 3BS7A 4R8UA 2EAPA 3J81j 4LJXA 3E0FA 4Y2TA 2KICA 2G5IB 2ZG6A 2HBJA 4AP9A 2KHVA 3NGDA 2R8HA 2F3NA 5KT6A 4UAWA 4C8LA 4EBCA 5J2DA 4DSIA 3RB4A 2PMZF 4F72A 4FZLA 2BCVA 1RQNA 2PKEA 2KZZA 1QSLA 7ICMA 3MGVA 2JGAA 4QZEA 3SAHA 5ALNA 2NRZA 1XS9D 1BGXT 2VA8A 1JROA 1L5UA 2AGOA 5EWGA 1S76D 5L1KA 4B9VA 4UAYA 4F2RA 3HT3A 4DCCA 4TQRA 3RJKA 4KX5A 4YQWA 1RPLA 4ICAA 1ZJMA 3NS1A 1T4GA 1N2XA 1SIJA 5TISU 2HHWA 3JPNA 2FLLA 3LDAA 1NKCA 4RQ5A 5F9NA 1NZBA 4P4MA 2HHUA 3THVA 3JPOA 4EEYA 1KDHA 2A3VA 1TK5A 3B9JA 9ICEA 2N1RA 4GLXA 3JPRA 4O3PA 3EUB2 5ALYA 1X9WA 3ZDCA 2Q4TA 3ZDBA 4KMUA 3DEEA 3PSFA 8ICQA 1D9DA 2KG5A 3GQCA 2OXOA 3BQ7A 3PW7A 2K4PA 2WF9A 1RG6A 1V85A 4RPZA 2RHFA 3UXPA 4LZGA 4QWAA 3C2MA 2JV3A 1SL0A 1NZPA 3T79A 3PZPA 4YMMA 5EWFA 1RXWA 1B0XA 7ICOA 1X9MA 2EAOA 4JMUA 2XI9A 3Q8RB 2UVWA 2FI1A 3GIKA 1TE2A 3ZDEA 4EYHB 1KFDA 1L3SA 4OD0A 4Q8FA 1MA7A 3JPQA 4NM2A 2UVVA 1X2IA 4UARA 5ALZA 1EXNA 5FP0A 1UT8A 5KFVA 2YY6A 1A76A 4BWJA 4G3IA 1SGGA 3UMCA 2FMSA 2F8KA 5HR6A 5DBBA 2Y0SC 4I28A 4AYBC 1H38A 3BQ1A 2I9GA 2ZIVA 3PW0A 5KFAA 2H3QA 9ICOA 2KJ8A 4KX3A 5AKIA 3G6XA 5EE3A 1UA1A 4GXJA 1SV0C 5DQHA 2NV3A 2DKXA 3CNHA 2QKQA 4US9A 4BDPA 4KTQA 2E3TA 3ALRA 5CWRA 5DLGA 1U9LA 1RYRA 4J9NA 1WYGA 3TANA 2ZIUA 8ICCA 2MAXA 1ZYQA 2R8GA 5L1IA 2KVSA 2B0CA 3ZI4A 1PUZA 2FPMA 1WCNA 4IRCA 5CHGA 9ICVA 3RBEA 5KFCA 3S6JA 4M47A 4P0QB 4IS7A 7ICIA 5TZVA 3T5LA 3RAQA 3L4PA 3TI0A 2HBKA 1L7MA 3PX0A 1ZQRA 2A1AA 2IOFK 5KFWA 2XGQA 3QU4A 5D46A 4GIBA 4FE3A 1U48A 4JUZA 2J6TA 3C5GA 5KG4A 2K60A 4NLKA 5J0YA 1TKDA 3B0XA 4QZHA 2L5YA 2Y0SF 4AYBF 2JRZA 1YT3A 4O3QA 2XCPA 2HI0A 3PW2A 5HMMA 2NRWA 5J2KA 2HCFA 4DL2A 4NXZA 1MSWD 1QSSA 4R8UB 4FFDA 3H40A 4HAIA 5ALIA 5AM5A 4C8OA 4DLEA 7ICVA 3OSNA 5KT3A 2FLNA 2J6SA 4DLGA 2WB1F 2QARB 3UPQA 1NKBA 5AKLA 1ZQLA 4DQQA 4Y2QA 1V9PA 5AKXA 3Q8PB 3MDAA 4RNNA 1X9SA 5C0YA 2F76X 5L9XA 3AM9A 4EX6A 2RP5A 2W9CB 3M6KA 3FYHA 4ECSA 1S9FA 2AGPA 1A0PA 1S97A 5A0LA 3A0HU 1QQ7A 2K8AA 3PSTA 5KFIA 3MR2A 1B43A 8ICKA 4BWMA 3KZIU 2MU2A 1L7NA 4I2DA 1OUQA 1K1SA 4DF8A 3T5HA 2NRTA 5KG2A 2XY7A 4PL2A 1YZ7A 4O3OA 5J0TA 3IM1A 2F2AB 5AM1A 2W8KA 3OTQA 4DQRA 1HUZA 1JMSA 5ALEA 2AH5A 4B9TA 4F4WA 4PHEA 4MFFA 2LYAA 4TQSA 3E2EA 3H8JA 3GIJA 5ALXA 3LWMA 2W04A 1SKWA 4QWBA 1CI4A 8ICPA 3RB0A 4UATA 5H2FU 5KAIU 5KFNA 4C7ZA 1Z19A 4C4TA 1RYUA 4ZH4A 4F3OA 2HW3A 4F5RA 2GWSA 5AIAA 7ICGA 1KBUA 5CEHA 1XSLA 3T3FA 1Z00A 5ALKA 3RJHA 2BGWA 1WWUA 2KNJA 2I6XA 2LMRA 8ICVA 5KT5A 1ZQPA 4M9HA 4UB2A 4DFKA 5KFJA 1ED1A 2AJQA 4R66A 4KLHA 2W55A 2XCAA 4F4XA 2WF7A 4R64A 4EZ9A 9ICBA 2YMMA 1DOQA 3SAGA 1QQ5A 3C21A 1C7YA 8ICHA 3IHQB 4P0PB 4YMOA 2AQ4A 4OJOA 4DWIA 1L3TA 2R8JA 5DBCA 4O5CA 4RUCA 3UM9A 2G07A 1SXDA 3QEBZ 1XO0A 1UT5A 2ZJ8A 4IL6U 5DB6A 2E8OA 4UBCA 1PVQA 3H7IA 5DB7A 2DGZA 3K1ZA 5AM2A 3C28A 5DBAA 1P7DA 5DB8A 4RQ4A 2Y9TA 4C8KA 2JEIA 2KEYA 1LVHA 4PHAA 5ALWA 4CF5A 2E1EA 1B4FA 4M2YA 5BPCA 8ICYA 5EE0A 2P6UA 4O3MA 3MR6A 3AUOA 4RPXA 5KFOA 2OEHA 4ECXA 1Z00B 3LK9A 2HSZA 2KSOA 4IC9A 4Y2VA 2ZJ5A 3NVYA 3GV8B 2H3VA 2MA1A 3ZD9A 2AGQA 1NKEA 2HHSA 1FIQA 3QU5A 4Z6DA 5AI9A 1ZQCA 4ECZA 3F2BA
chains in the Genus database with same CATH topology
1S0MA 3NGDA 5J0RA 5J0OA 2R8HA 7ICQA 3RBDA 5KT6A 2IHNA 2Y1JA 4UAWA 1XU4A 4KLLA 2C28A 4UB4A 4C8LA 4YXJA 3UQ2A 2BQUA 4EBCA 5J2DA 2ASLA 3SZ2A 3QE9Y 3RB4A 4DSIA 8ICBA 3C2KA 4KLIA 2BCVA 1D9FA 2KZZA 2XC9A 5KG0A 3V72A 3PNCA 3GILA 1MQ2A 3V6HA 1QSLA 7ICMA 5J0UA 9ICNA 5KG5A 9ICLA 4F4KA 1COOA 2HHVA 4I2JA 1ZQXA 3SYZA 4K4GA 5KFRA 5KTQA 1NJZA 4QZEA 2P6RA 9ICKA 4B9MA 8ICAA 3ZDAA 2NRZA 4Q8EA 4IRDA 8ICIA 1XS9D 2ZTEA 1AROP 1BGXT 2VA8A 4GC6A 9ICHA 4BGDA 5HHIA 2WTFA 5EWEA 1L5UA 2AGOA 3OGUA 2BQRA 7ICTA 5EWGA 4EBEA 1S76D 1A77A 1ZQIA 5L1KA 3PV8A 2BCSA 4B9VA 4PGXA 4M9GA 9ICFA 3T5KA 4UAYA 2AQ0A 5KFHA 4I2HA 4F2RA 3HT3A 4TQRA 3RJKA 9ICWA 3ISCA 1TK8A 4YQWA 4F4YA 4Q44A 1RPLA 1KRPA 4RQ7A 2ZTDA 3MR3A 4RT3A 2C2DA 2PI5A 1ZQJA 7ICPA 1ZJMA 5J2AA 2ISOA 4MF2A 1BPYA 1T4GA 4IQUA 4IR9A 4UBBA 5KFYA 3C2LA 8ICFA 1TVAA 2HHWA 3JPNA 2FLLA 2H5XA 9ICTA 3LDAA 4ELVA 1LV5A 3GIIA 5IINA 1NKCA 1QTMA 3MFIA 5DG8A 4RQ5A 3RH5A 2HVIA 1ZQZA 5KFKA 5F9NA 5J29A 5JUMA 3PMLA 8ICJA 4P4MA 2HHUA 3THVA 8ICWA 3JPOA 3OSPA 4EEYA 8ICTA 1KDHA 1KTQA 4QW8A 4QZDA 1TK5A 4I2CA 4M6WB 3RB3A 4KLEA 5HHHA 9ICEA 4GLXA 4IQWA 2LYHA 3JPRA 4O3PA 4KLFA 4O5KA 1X9WA 4YFKA 4F4ZA 3ZDCA 7ICKA 3ZDBA 4YP3A 2MUTB 5KFLA 4F92B 4DL3A 4KMUA 3GFKB 5CA7A 4QWCA 4F5NA 8ICQA 4Z6CA 4YG2A 1NJXA 1D9DA 1PZNA 5D49A 4ELUA 4M9JA 3GQCA 3Q8KA 3RJIA 4CCHA 3PW7A 3V6KA 1RYSA 4JV0A 1ZQVA 2IHMA 2HHXA 7ICFA 4FS2A 2PFNA 4RPZA 4RQ8A 3C1ZA 2ASDA 3M9NB 1S0OA 3UXPA 4LZGA 2BPFA 4QWAA 3C2MA 1N56A 5J2GA 5KFFA 1SL0A 3OJUA 1JXEA 1XO1A 4DS4A 4B9NA 9ICPA 4F5PA 4ED2A 2C2RA 2V4RA 4RQ6A 8ICLA 4YMMA 1MC8A 4Q43A 5EWFA 1RXWA 5DGAA 5IIMA 4MF8A 1JIHA 1ZQGA 4JWNA 7ICOA 1X9MA 2A1JA 2JZBA 3Q8RB 5DGBA 2UVWA 4DSEA 3GIKA 3ZDEA 4EYHB 4RZRA 1KFDA 4ECYA 1L3SA 4JV1A 3PW5A 5KG1A 4PGYA 4I2IA 3GV5B 4DL6A 5KT4A 4M04A 4Q8FA 3PW4A 4ED1A 3RRGA 1CEZA 3JPQA 4NM2A 4RQ2A 1NK8A 1X2IA 2UVVA 4I29A 4NLGA 1EXNA 4I2GA 4I2FA 5D4BA 2ZUDA 1T7PA 2NRVA 3M8SA 1BPXA 1UT8A 2W9AA 4O3SA 1XSNA 2BR0A 1ZQEA 1NK0A 5KFVA 4F50A 4ED3A 4DL7A 4GC7A 3EPIA 2UVRA 4QZIA 4ECTA 4B9SA 1IM4A 2F1IA 4DQPA 4J9SA 1A76A 4BWJA 3JPPA 2DPJA 4G3IA 4QWDA 2FMSA 5DBBA 4HYKA 3JPSA 5KG3A 3BJYA 2KZMA 4IQTA 2BPGA 4I28A 1NK6A 1H38A 3BQ1A 2I9GA 9ICSA 4DSJA 2BKEA 2ALZA 3PW0A 5KFAA 4ED6A 2RDIA 2JEGA 9ICOA 1BPDA 5BOLA 4C8NA 3G6XA 5J0XA 1UA1A 4GXJA 4DQIA 1NK9A 5DQHA 2V4QA 4XQ8A 9ICJA 2W9BB 4M0AA 3AU6A 2AU0A 3MGIA 5KFGA 1S10A 2MUTA 7ICEA 3C23A 4PH5A 3OHAA 4BDPA 4KTQA 3FDSA 1IXRA 5CWRA 5DLGA 4B9LA 1U45A 1U9LA 5DDMA 2V9WA 4F91B 4IQVA 4RQ0A 1U47A 1RYRA 4UB5A 4O0IA 3RTVA 1ZQUA 4J9NA 3Q8SB 5HMLA 5EOZA 3TANA 3KHHA 9ICGA 3EWAA 8ICUA 4ECUA 4I2AA 2XO7A 4NLZA 3PO4A 1D8YA 8ICCA 4YCXA 3EZ5A 2MAXA 1TAUA 4I2BA 1BPEA 1ZYQA 1CUKA 5HNKA 3Q8MA 1NJYA 2R8GA 5L1IA 1ZQQA 1U49A 4DSKA 7ICNA 2KZ3A 4R63A 3PR4A 4UB1A 4ELTA 5KFTA 3ETLA 5J2HA 2FPMA 1WCNA 5J0PA 4IRCA 5CHGA 5KFSA 3HX0A 2ZTCA 3HP6A 9ICVA 5DB9A 4Z6FA 5KFCA 2RDJA 3RBEA 2ASJA 4M47A 1Y88A 9ICAA 4XUSA 2FPKA 3SI8A 5KFBA 9ICUA 7ICIA 5TZVA 3T5LA 2PI4A 4RQ3A 3RAQA 4I27A 2BDPA 3K4GA 4FBTA 3TI0A 3PX0A 1T8EA 1BPBA 1L3VA 4JWMA 5KFMA 1ZQRA 1WCLA 2ATLA 5KFWA 1NK5A 2XGQA 5D46A 4KLQA 3V6JA 1ZQYA 2PXIA 1D8LA 4JV2A 5DQGA 1U48A 1HUOA 4P4OA 3BQ2A 1DGSA 1UA0A 4JUZA 2J6TA 3C5GA 2ZJAA 5KG4A 4J9KA 5KG6A 4YVZA 5HP4A 2KFZA 4NLKA 5J0YA 1TKDA 8ICNA 5CJ7A 3B0XA 4QZHA 5KFUA 3PMNA 3QZ8A 4KLDA 3K75D 2R8KA 3MABA 4XRHA 4O3QA 2XCPA 4GXKA 4YR0A 4F5OA 2XY5A 3PW2A 3QEAZ 2W9MA 1ZQDA 1ZQNA 1KFTA 5HMMA 2NRWA 5J2KA 4MFAA 3TAPA 3HW8A 3B0YA 3TAQA 4K4IA 4Z6EA 4DL2A 9ICRA 3KTQA 3H8WA 3EW9A 3UXNA 3ZDDA 4NXZA 1MSWD 2HHQA 1QSSA 4R8UB 1JX4A 4K4HA 3BQTA 3H40A 4KN4A 2VA2A 4DOAA 1NOMA 4C8OA 4ED7A 4DLEA 7ICVA 2PFQA 2W9BA 5KFDA 5KT3A 3OSNA 2PFPA 4RUAA 4DSFA 1S77D 4DEZA 2BCRA 2FLNA 2XGPA 5KFEA 4RPYA 2J6SA 4DLGA 3RJEA 4IRKA 2IA6A 4QWEA 3UPQA 4DO9A 4DFMA 4DS5A 4DQSA 1NKBA 4F8RA 4J9LA 4KLGA 2FLPA 4KITB 1ZQLA 2IBKA 4DQQA 4TURA 4QZ8A 4DOBA 1JXLA 4TUQA 5DKWA 4Q45A 1V9PA 5F9LA 5J2IA 5J0QA 3Q8PB 3MDAA 4RU9A 4RNNA 1X9SA 4YN4A 9ICQA 3PO5A 4J9RA 3OHBA 2UVUA 2FMQA 9ICMA 5L9XA 4UAZA 4MEYA 2DFLA 1XSPA 4RNOA 3RRHA 5J0WA 2W9CB 4BXOA 2HVHA 4JK1A 3FYHA 2B21A 4ECSA 1S9FA 4UB3A 1SZPA 2AGPA 1ZQMA 1S97A 4C8MA 5DDYA 3ISBA 3GIMA 2P66A 1S0VA 2XY6A 3TFSA 5KFIA 2I1QA 4YMNA 1B43A 3MR2A 3N97B 3BDPA 8ICKA 4BWMA 3G6VA 8ICRA 7ICHA 3MGHA 3PX4A 3Q8LA 4KLTA 5KT2A 1JN3A 5CR0A 2F1JA 9ICIA 4I2DA 3RAXA 4RNMA 5KFZA 1K1SA 3HPOA 3MR5A 3HWTA 4DF8A 3T5HA 1LB2B 2NRTA 3KHGA 5KG2A 1KSPA 2XY7A 3V7KA 4O3OA 4UQGA 7ICJA 5J0TA 4DOCA 2W9CA 3IM1A 4X5VA 2KFNA 3ZD8A 9ICCA 3C1YA 8ICXA 5J2FA 2W8KA 1RZTA 4LVSA 4KLMA 4DQRA 5C5JA 2NRXA 1JMSA 1HUZA 2A1JB 2JZBB 5KFQA 3PR5B 3M9OB 3BQ0A 3M8RA 1NK7A 4B9TA 4DSLA 4F4WA 2JEFA 4PHEA 4MFFA 3NTUA 4PHPA 4TQSA 3E2EA 3TFRA 3MDCA 3H4DA 3H8JA 1U4BA 3GIJA 4NLNA 2KTQA 4QZFA 2W8LA 1B22A 3RJFA 3UXOA 3PY8A 2KN7A 3RJGA 3LWMA 1XWLA 2FMPA 4P2HA 8ICZA 8ICOA 1SKWA 3SV4A 7ICSA 4FS1A 2FPLA 4M6WA 4P4PA 4E0DA 4PPXA 5IIOA 4R65A 4QWBA 3T5JA 5DQIA 5IILA 1ZETA 1TV9A 8ICPA 3QZ7A 3RB0A 4F5QA 1S0NA 9ICXA 4PHDA 8ICMA 4F93B 2BCUA 2BQ3A 5CB1A 5KFNA 1N48A 1ZQHA 4J9OA 4ZH4A 3H8SA 4F3OA 2HW3A 5J2CA 4F5RA 2GWSA 2PFOA 4KLOA 7ICGA 4XA5A 7ICUA 1BPZA 2C22A 1XSLA 3RR8A 3T3FA 1TK0A 1Z00A 4ECQA 3V7JA 5IIKA 4ECVA 3MFHA 3PVXA 2BGWA 3RJHA 3V7LA 3RH6A 5KFXA 3LWLA 1HJPA 5J2JA 5DG9A 4O3NA 3SV3A 8ICEA 8ICVA 5J2EA 5KT5A 1ZQPA 4I2EA 4BXOB 4M9HA 2VA3A 2J6UA 4UB2A 1SL2A 1TAQA 4YXMA 4DFKA 2ZUBA 5KFJA 2Y1IA 3N4MB 2JEJA 2HHTA 1TFRA 2OWOA 2AJQA 5J0SA 4KLJA 3AU2A 4R66A 3RR7A 4KLHA 1SL1A 2XCAA 4DF4A 4ED8A 4F4XA 4R64A 1ZQAA 4EZ9A 2F1HA 9ICBA 7ICLA 4YR3A 1KFSA 4ED0A 1DOQA 3TARA 1ZQKA 4TUPA 4M9LA 3C21A 4RQ1A 1C7YA 2BHNA 3IHQB 5BOMA 1QSYA 4M9NA 8ICHA 3C5FA 4LZDA 4YMOA 1Z3EB 3PX6A 4MFCA 5IIIA 2AQ4A 1SKSA 3OJSA 1ZQTA 5DG7A 4QZGA 3KHLA 5L1JA 3GV7B 4PGQA 1ZQOA 4DWIA 3ORYA 3RH4A 1L3TA 4ECRA 4NM1A 2R8JA 4KN7A 5DBCA 3EYZA 1ZJNA 4O5CA 1L3UA 5KG7A 2M9NA 4QZAA 4RUCA 1XC9A 3QEBZ 4O9MA 8ICSA 4DL5A 5L1LA 1UT5A 1ZQWA 2ZJ8A 2ISPA 1RXVA 4FO6A 5DB6A 2BPCA 4UBCA 3H7IA 5KT7A 2R8IA 5DB7A 4J9QA 4J9PA 4YD1A 4YR2A 4B9UA 4O3RA 4EBDA 3RB6A 8ICGA 2ZUCA 4J9MA 1NK4A 4O5EA 3MBYA 4QZBA 4QZCA 1KEJA 4EZ6A 3H4BA 4EYIB 4KLUA 5KFPA 2BCQA 5DBAA 3JPTA 3G6YA 5DB8A 1NJWA 4F2SA 2Q0ZX 4RQ4A 4NY8A 4GXIA 4KLSA 3RJJA 4C8KA 2C2EA 1ZQFA 2JEIA 1KLNA 5CP2A 4PHAA 4DFPA 4DFJA 1ZQBA 3ISDA 2IMWP 1K1QA 2DPIA 4M2YA 5DLFA 4QZ9A 1QLNA 5BPCA 3EPGA 8ICYA 4QW9A 1SKRA 3UQ0A 3GDXA 4IR1A 3TQ1A 3Q8QB 2P6UA 4TUSA 3MR6A 3AUOA 4RPXA 5KFOA 4FBUA 4RT2A 4ECXA 1Z00B 3LK9A 3KHRA 5IIJA 7ICRA 2VANA 1ZQSA 2ZJ5A 4R8UA 4YD2A 3GV8B 1T3NA 4ECWA 1ZQCA 3ZD9A 1MQ3A 2AGQA 3M9MB 1NKEA 1BVSA 2HHSA 4Z6DA 4DL4A 4ECZA 4MEXA 5J2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0M A;  3NGD A;  5J0R A;  5J0O A;  2R8H A;  7ICQ A;  3RBD A;  5KT6 A;  2IHN A;  2Y1J A;  4UAW A;  1XU4 A;  4KLL A;  2C28 A;  4UB4 A;  4C8L A;  4YXJ A;  3UQ2 A;  2BQU A;  4EBC A;  5J2D A;  2ASL A;  3SZ2 A;  3QE9 Y;  3RB4 A;  4DSI A;  8ICB A;  3C2K A;  4KLI A;  2BCV A;  1D9F A;  2KZZ A;  2XC9 A;  5KG0 A;  3V72 A;  3PNC A;  3GIL A;  1MQ2 A;  3V6H A;  1QSL A;  7ICM A;  5J0U A;  9ICN A;  5KG5 A;  9ICL A;  4F4K A;  1COO A;  2HHV A;  4I2J A;  1ZQX A;  3SYZ A;  4K4G A;  5KFR A;  5KTQ A;  1NJZ A;  4QZE A;  2P6R A;  9ICK A;  4B9M A;  8ICA A;  3ZDA A;  2NRZ A;  4Q8E A;  4IRD A;  8ICI A;  1XS9 D;  2ZTE A;  1ARO P;  1BGX T;  2VA8 A;  4GC6 A;  9ICH A;  4BGD A;  5HHI A;  2WTF A;  5EWE A;  1L5U A;  2AGO A;  3OGU A;  2BQR A;  7ICT A;  5EWG A;  4EBE A;  1S76 D;  1A77 A;  1ZQI A;  5L1K A;  3PV8 A;  2BCS A;  4B9V A;  4PGX A;  4M9G A;  9ICF A;  3T5K A;  4UAY A;  2AQ0 A;  5KFH A;  4I2H A;  4F2R A;  3HT3 A;  4TQR A;  3RJK A;  9ICW A;  3ISC A;  1TK8 A;  4YQW A;  4F4Y A;  4Q44 A;  1RPL A;  1KRP A;  4RQ7 A;  2ZTD A;  3MR3 A;  4RT3 A;  2C2D A;  2PI5 A;  1ZQJ A;  7ICP A;  1ZJM A;  5J2A A;  2ISO A;  4MF2 A;  1BPY A;  1T4G A;  4IQU A;  4IR9 A;  4UBB A;  5KFY A;  3C2L A;  8ICF A;  1TVA A;  2HHW A;  3JPN A;  2FLL A;  2H5X A;  9ICT A;  3LDA A;  4ELV A;  1LV5 A;  3GII A;  5IIN A;  1NKC A;  1QTM A;  3MFI A;  5DG8 A;  4RQ5 A;  3RH5 A;  2HVI A;  1ZQZ A;  5KFK A;  5F9N A;  5J29 A;  5JUM A;  3PML A;  8ICJ A;  4P4M A;  2HHU A;  3THV A;  8ICW A;  3JPO A;  3OSP A;  4EEY A;  8ICT A;  1KDH A;  1KTQ A;  4QW8 A;  4QZD A;  1TK5 A;  4I2C A;  4M6W B;  3RB3 A;  4KLE A;  5HHH A;  9ICE A;  4GLX A;  4IQW A;  2LYH A;  3JPR A;  4O3P A;  4KLF A;  4O5K A;  1X9W A;  4YFK A;  4F4Z A;  3ZDC A;  7ICK A;  3ZDB A;  4YP3 A;  2MUT B;  5KFL A;  4F92 B;  4DL3 A;  4KMU A;  3GFK B;  5CA7 A;  4QWC A;  4F5N A;  8ICQ A;  4Z6C A;  4YG2 A;  1NJX A;  1D9D A;  1PZN A;  5D49 A;  4ELU A;  4M9J A;  3GQC A;  3Q8K A;  3RJI A;  4CCH A;  3PW7 A;  3V6K A;  1RYS A;  4JV0 A;  1ZQV A;  2IHM A;  2HHX A;  7ICF A;  4FS2 A;  2PFN A;  4RPZ A;  4RQ8 A;  3C1Z A;  2ASD A;  3M9N B;  1S0O A;  3UXP A;  4LZG A;  2BPF A;  4QWA A;  3C2M A;  1N56 A;  5J2G A;  5KFF A;  1SL0 A;  3OJU A;  1JXE A;  1XO1 A;  4DS4 A;  4B9N A;  9ICP A;  4F5P A;  4ED2 A;  2C2R A;  2V4R A;  4RQ6 A;  8ICL A;  4YMM A;  1MC8 A;  4Q43 A;  5EWF A;  1RXW A;  5DGA A;  5IIM A;  4MF8 A;  1JIH A;  1ZQG A;  4JWN A;  7ICO A;  1X9M A;  2A1J A;  2JZB A;  3Q8R B;  5DGB A;  2UVW A;  4DSE A;  3GIK A;  3ZDE A;  4EYH B;  4RZR A;  1KFD A;  4ECY A;  1L3S A;  4JV1 A;  3PW5 A;  5KG1 A;  4PGY A;  4I2I A;  3GV5 B;  4DL6 A;  5KT4 A;  4M04 A;  4Q8F A;  3PW4 A;  4ED1 A;  3RRG A;  1CEZ A;  3JPQ A;  4NM2 A;  4RQ2 A;  1NK8 A;  1X2I A;  2UVV A;  4I29 A;  4NLG A;  1EXN A;  4I2G A;  4I2F A;  5D4B A;  2ZUD A;  1T7P A;  2NRV A;  3M8S A;  1BPX A;  1UT8 A;  2W9A A;  4O3S A;  1XSN A;  2BR0 A;  1ZQE A;  1NK0 A;  5KFV A;  4F50 A;  4ED3 A;  4DL7 A;  4GC7 A;  3EPI A;  2UVR A;  4QZI A;  4ECT A;  4B9S A;  1IM4 A;  2F1I A;  4DQP A;  4J9S A;  1A76 A;  4BWJ A;  3JPP A;  2DPJ A;  4G3I A;  4QWD A;  2FMS A;  5DBB A;  4HYK A;  3JPS A;  5KG3 A;  3BJY A;  2KZM A;  4IQT A;  2BPG A;  4I28 A;  1NK6 A;  1H38 A;  3BQ1 A;  2I9G A;  9ICS A;  4DSJ A;  2BKE A;  2ALZ A;  3PW0 A;  5KFA A;  4ED6 A;  2RDI A;  2JEG A;  9ICO A;  1BPD A;  5BOL A;  4C8N A;  3G6X A;  5J0X A;  1UA1 A;  4GXJ A;  4DQI A;  1NK9 A;  5DQH A;  2V4Q A;  4XQ8 A;  9ICJ A;  2W9B B;  4M0A A;  3AU6 A;  2AU0 A;  3MGI A;  5KFG A;  1S10 A;  2MUT A;  7ICE A;  3C23 A;  4PH5 A;  3OHA A;  4BDP A;  4KTQ A;  3FDS A;  1IXR A;  5CWR A;  5DLG A;  4B9L A;  1U45 A;  1U9L A;  5DDM A;  2V9W A;  4F91 B;  4IQV A;  4RQ0 A;  1U47 A;  1RYR A;  4UB5 A;  4O0I A;  3RTV A;  1ZQU A;  4J9N A;  3Q8S B;  5HML A;  5EOZ A;  3TAN A;  3KHH A;  9ICG A;  3EWA A;  8ICU A;  4ECU A;  4I2A A;  2XO7 A;  4NLZ A;  3PO4 A;  1D8Y A;  8ICC A;  4YCX A;  3EZ5 A;  2MAX A;  1TAU A;  4I2B A;  1BPE A;  1ZYQ A;  1CUK A;  5HNK A;  3Q8M A;  1NJY A;  2R8G A;  5L1I A;  1ZQQ A;  1U49 A;  4DSK A;  7ICN A;  2KZ3 A;  4R63 A;  3PR4 A;  4UB1 A;  4ELT A;  5KFT A;  3ETL A;  5J2H A;  2FPM A;  1WCN A;  5J0P A;  4IRC A;  5CHG A;  5KFS A;  3HX0 A;  2ZTC A;  3HP6 A;  9ICV A;  5DB9 A;  4Z6F A;  5KFC A;  2RDJ A;  3RBE A;  2ASJ A;  4M47 A;  1Y88 A;  9ICA A;  4XUS A;  2FPK A;  3SI8 A;  5KFB A;  9ICU A;  7ICI A;  5TZV A;  3T5L A;  2PI4 A;  4RQ3 A;  3RAQ A;  4I27 A;  2BDP A;  3K4G A;  4FBT A;  3TI0 A;  3PX0 A;  1T8E A;  1BPB A;  1L3V A;  4JWM A;  5KFM A;  1ZQR A;  1WCL A;  2ATL A;  5KFW A;  1NK5 A;  2XGQ A;  5D46 A;  4KLQ A;  3V6J A;  1ZQY A;  2PXI A;  1D8L A;  4JV2 A;  5DQG A;  1U48 A;  1HUO A;  4P4O A;  3BQ2 A;  1DGS A;  1UA0 A;  4JUZ A;  2J6T A;  3C5G A;  2ZJA A;  5KG4 A;  4J9K A;  5KG6 A;  4YVZ A;  5HP4 A;  2KFZ A;  4NLK A;  5J0Y A;  1TKD A;  8ICN A;  5CJ7 A;  3B0X A;  4QZH A;  5KFU A;  3PMN A;  3QZ8 A;  4KLD A;  3K75 D;  2R8K A;  3MAB A;  4XRH A;  4O3Q A;  2XCP A;  4GXK A;  4YR0 A;  4F5O A;  2XY5 A;  3PW2 A;  3QEA Z;  2W9M A;  1ZQD A;  1ZQN A;  1KFT A;  5HMM A;  2NRW A;  5J2K A;  4MFA A;  3TAP A;  3HW8 A;  3B0Y A;  3TAQ A;  4K4I A;  4Z6E A;  4DL2 A;  9ICR A;  3KTQ A;  3H8W A;  3EW9 A;  3UXN A;  3ZDD A;  4NXZ A;  1MSW D;  2HHQ A;  1QSS A;  4R8U B;  1JX4 A;  4K4H A;  3BQT A;  3H40 A;  4KN4 A;  2VA2 A;  4DOA A;  1NOM A;  4C8O A;  4ED7 A;  4DLE A;  7ICV A;  2PFQ A;  2W9B A;  5KFD A;  5KT3 A;  3OSN A;  2PFP A;  4RUA A;  4DSF A;  1S77 D;  4DEZ A;  2BCR A;  2FLN A;  2XGP A;  5KFE A;  4RPY A;  2J6S A;  4DLG A;  3RJE A;  4IRK A;  2IA6 A;  4QWE A;  3UPQ A;  4DO9 A;  4DFM A;  4DS5 A;  4DQS A;  1NKB A;  4F8R A;  4J9L A;  4KLG A;  2FLP A;  4KIT B;  1ZQL A;  2IBK A;  4DQQ A;  4TUR A;  4QZ8 A;  4DOB A;  1JXL A;  4TUQ A;  5DKW A;  4Q45 A;  1V9P A;  5F9L A;  5J2I A;  5J0Q A;  3Q8P B;  3MDA A;  4RU9 A;  4RNN A;  1X9S A;  4YN4 A;  9ICQ A;  3PO5 A;  4J9R A;  3OHB A;  2UVU A;  2FMQ A;  9ICM A;  5L9X A;  4UAZ A;  4MEY A;  2DFL A;  1XSP A;  4RNO A;  3RRH A;  5J0W A;  2W9C B;  4BXO A;  2HVH A;  4JK1 A;  3FYH A;  2B21 A;  4ECS A;  1S9F A;  4UB3 A;  1SZP A;  2AGP A;  1ZQM A;  1S97 A;  4C8M A;  5DDY A;  3ISB A;  3GIM A;  2P66 A;  1S0V A;  2XY6 A;  3TFS A;  5KFI A;  2I1Q A;  4YMN A;  1B43 A;  3MR2 A;  3N97 B;  3BDP A;  8ICK A;  4BWM A;  3G6V A;  8ICR A;  7ICH A;  3MGH A;  3PX4 A;  3Q8L A;  4KLT A;  5KT2 A;  1JN3 A;  5CR0 A;  2F1J A;  9ICI A;  4I2D A;  3RAX A;  4RNM A;  5KFZ A;  1K1S A;  3HPO A;  3MR5 A;  3HWT A;  4DF8 A;  3T5H A;  1LB2 B;  2NRT A;  3KHG A;  5KG2 A;  1KSP A;  2XY7 A;  3V7K A;  4O3O A;  4UQG A;  7ICJ A;  5J0T A;  4DOC A;  2W9C A;  3IM1 A;  4X5V A;  2KFN A;  3ZD8 A;  9ICC A;  3C1Y A;  8ICX A;  5J2F A;  2W8K A;  1RZT A;  4LVS A;  4KLM A;  4DQR A;  5C5J A;  2NRX A;  1JMS A;  1HUZ A;  2A1J B;  2JZB B;  5KFQ A;  3PR5 B;  3M9O B;  3BQ0 A;  3M8R A;  1NK7 A;  4B9T A;  4DSL A;  4F4W A;  2JEF A;  4PHE A;  4MFF A;  3NTU A;  4PHP A;  4TQS A;  3E2E A;  3TFR A;  3MDC A;  3H4D A;  3H8J A;  1U4B A;  3GIJ A;  4NLN A;  2KTQ A;  4QZF A;  2W8L A;  1B22 A;  3RJF A;  3UXO A;  3PY8 A;  2KN7 A;  3RJG A;  3LWM A;  1XWL A;  2FMP A;  4P2H A;  8ICZ A;  8ICO A;  1SKW A;  3SV4 A;  7ICS A;  4FS1 A;  2FPL A;  4M6W A;  4P4P A;  4E0D A;  4PPX A;  5IIO A;  4R65 A;  4QWB A;  3T5J A;  5DQI A;  5IIL A;  1ZET A;  1TV9 A;  8ICP A;  3QZ7 A;  3RB0 A;  4F5Q A;  1S0N A;  9ICX A;  4PHD A;  8ICM A;  4F93 B;  2BCU A;  2BQ3 A;  5CB1 A;  5KFN A;  1N48 A;  1ZQH A;  4J9O A;  4ZH4 A;  3H8S A;  4F3O A;  2HW3 A;  5J2C A;  4F5R A;  2GWS A;  2PFO A;  4KLO A;  7ICG A;  4XA5 A;  7ICU A;  1BPZ A;  2C22 A;  1XSL A;  3RR8 A;  3T3F A;  1TK0 A;  1Z00 A;  4ECQ A;  3V7J A;  5IIK A;  4ECV A;  3MFH A;  3PVX A;  2BGW A;  3RJH A;  3V7L A;  3RH6 A;  5KFX A;  3LWL A;  1HJP A;  5J2J A;  5DG9 A;  4O3N A;  3SV3 A;  8ICE A;  8ICV A;  5J2E A;  5KT5 A;  1ZQP A;  4I2E A;  4BXO B;  4M9H A;  2VA3 A;  2J6U A;  4UB2 A;  1SL2 A;  1TAQ A;  4YXM A;  4DFK A;  2ZUB A;  5KFJ A;  2Y1I A;  3N4M B;  2JEJ A;  2HHT A;  1TFR A;  2OWO A;  2AJQ A;  5J0S A;  4KLJ A;  3AU2 A;  4R66 A;  3RR7 A;  4KLH A;  1SL1 A;  2XCA A;  4DF4 A;  4ED8 A;  4F4X A;  4R64 A;  1ZQA A;  4EZ9 A;  2F1H A;  9ICB A;  7ICL A;  4YR3 A;  1KFS A;  4ED0 A;  1DOQ A;  3TAR A;  1ZQK A;  4TUP A;  4M9L A;  3C21 A;  4RQ1 A;  1C7Y A;  2BHN A;  3IHQ B;  5BOM A;  1QSY A;  4M9N A;  8ICH A;  3C5F A;  4LZD A;  4YMO A;  1Z3E B;  3PX6 A;  4MFC A;  5III A;  2AQ4 A;  1SKS A;  3OJS A;  1ZQT A;  5DG7 A;  4QZG A;  3KHL A;  5L1J A;  3GV7 B;  4PGQ A;  1ZQO A;  4DWI A;  3ORY A;  3RH4 A;  1L3T A;  4ECR A;  4NM1 A;  2R8J A;  4KN7 A;  5DBC A;  3EYZ A;  1ZJN A;  4O5C A;  1L3U A;  5KG7 A;  2M9N A;  4QZA A;  4RUC A;  1XC9 A;  3QEB Z;  4O9M A;  8ICS A;  4DL5 A;  5L1L A;  1UT5 A;  1ZQW A;  2ZJ8 A;  2ISP A;  1RXV A;  4FO6 A;  5DB6 A;  2BPC A;  4UBC A;  3H7I A;  5KT7 A;  2R8I A;  5DB7 A;  4J9Q A;  4J9P A;  4YD1 A;  4YR2 A;  4B9U A;  4O3R A;  4EBD A;  3RB6 A;  8ICG A;  2ZUC A;  4J9M A;  1NK4 A;  4O5E A;  3MBY A;  4QZB A;  4QZC A;  1KEJ A;  4EZ6 A;  3H4B A;  4EYI B;  4KLU A;  5KFP A;  2BCQ A;  5DBA A;  3JPT A;  3G6Y A;  5DB8 A;  1NJW A;  4F2S A;  2Q0Z X;  4RQ4 A;  4NY8 A;  4GXI A;  4KLS A;  3RJJ A;  4C8K A;  2C2E A;  1ZQF A;  2JEI A;  1KLN A;  5CP2 A;  4PHA A;  4DFP A;  4DFJ A;  1ZQB A;  3ISD A;  2IMW P;  1K1Q A;  2DPI A;  4M2Y A;  5DLF A;  4QZ9 A;  1QLN A;  5BPC A;  3EPG A;  8ICY A;  4QW9 A;  1SKR A;  3UQ0 A;  3GDX A;  4IR1 A;  3TQ1 A;  3Q8Q B;  2P6U A;  4TUS A;  3MR6 A;  3AUO A;  4RPX A;  5KFO A;  4FBU A;  4RT2 A;  4ECX A;  1Z00 B;  3LK9 A;  3KHR A;  5IIJ A;  7ICR A;  2VAN A;  1ZQS A;  2ZJ5 A;  4R8U A;  4YD2 A;  3GV8 B;  1T3N A;  4ECW A;  1ZQC A;  3ZD9 A;  1MQ3 A;  2AGQ A;  3M9M B;  1NKE A;  1BVS A;  2HHS A;  4Z6D A;  4DL4 A;  4ECZ A;  4MEX A;  5J2B A; 
#chains in the Genus database with same CATH topology
 2I5H A;  2NO4 A;  1XU4 A;  4KLL A;  4YXJ A;  3U26 A;  2F8L A;  5JRT A;  3V72 A;  1MQ2 A;  3V6H A;  4P0P A;  9ICL A;  1YZ6 A;  4F4K A;  2HHV A;  3TAC B;  1ZQX A;  2RLT A;  3SYZ A;  5KFR A;  5KTQ A;  4GFJ A;  3QU9 A;  8ICA A;  3ZDA A;  3IV6 A;  2OH2 A;  4Q8E A;  4Y2S A;  1ARO P;  5ALQ A;  4GC6 A;  4ZOH C;  2WTF A;  2EZX A;  3NVZ A;  1N5X A;  2HOF A;  2BCS A;  9ICF A;  4M9G A;  2KIW A;  4I2H A;  3H0L B;  3HRD D;  4DFD A;  1F0M A;  9ICW A;  2G0A A;  4NJ8 A;  1KRP A;  4RQ7 A;  2ZIX B;  1ZXI A;  3MR3 A;  2C2D A;  4B6J A;  3QUC A;  4IR9 A;  5EE9 A;  3PSP A;  3C2L A;  4ELV A;  1LV5 A;  1DRG A;  5IIN A;  3IRU A;  2E5S A;  2HVI A;  1ZQZ A;  5KFK A;  4ACO A;  5AKH A;  2G5H B;  1L6N A;  2KOB A;  1KTQ A;  4QW8 A;  4I2C A;  4M6W B;  2JXJ A;  2WF8 A;  4EEK A;  4KLE A;  2LYH A;  2W7O A;  4BUG A;  3QNM A;  4KLF A;  1N60 A;  2H3Z A;  2MUT B;  4F92 B;  4Y2P A;  5CA7 A;  5AHX A;  4YG2 A;  4ELU A;  5D49 A;  4CCH A;  1S8O A;  2NO5 A;  1RYS A;  2VIX A;  2WF5 A;  2ASD A;  3M9N B;  2BPF A;  3D6J A;  1DK3 A;  1JXE A;  4DS4 A;  2C2R A;  4BJQ A;  1ZQG A;  5IIM A;  4MF8 A;  1JIH A;  4JWN A;  1FFU A;  2BZF A;  2LPE A;  3K1R B;  4DSE A;  2KKV A;  4RZR A;  4JV1 A;  2RQ5 A;  1ZD4 A;  4I2I A;  4DL6 A;  5KT4 A;  4M04 A;  3PW4 A;  4ED1 A;  4RQ2 A;  1HEK A;  4I2G A;  3O0F A;  5J8Y C;  4I2F A;  2ZUD A;  1T7P A;  3WKD A;  1BPX A;  4O3S A;  2BR0 A;  2G09 A;  2UVR A;  4QZI A;  4DQP A;  2ZIX A;  4J9S A;  3JPP A;  2DPJ A;  1C20 A;  4QWD A;  1O03 A;  4OCZ A;  1ZRN A;  3JPS A;  5KG3 A;  2KZM A;  1NK6 A;  4DSJ A;  2JEG A;  2RDI A;  5J0X A;  4DQI A;  5ALU A;  2LKY A;  2W43 A;  4M0A A;  2CN1 A;  5E79 U;  2MUT A;  1ZD5 A;  3C23 A;  4PH5 A;  1F5S A;  2QB0 B;  1CRX A;  4JB3 A;  4P0Q A;  1U45 A;  5AI5 A;  1U47 A;  3RTV A;  1ZQU A;  1JRP A;  3Q8S B;  5EOZ A;  3KHH A;  4ECU A;  5AM4 A;  3PO4 A;  1CUK A;  3Q8M A;  5AIC A;  1U49 A;  7ICN A;  1DXS A;  3PR4 A;  4ELT A;  3SQI A;  5J0P A;  1GO3 F;  5KFS A;  2ZTC A;  3HP6 A;  3HX0 A;  2RDJ A;  5F3X B;  1BNO A;  4RQ3 A;  3K4G A;  4FBT A;  2WF6 A;  1BPB A;  1OXJ A;  1QCK A;  5KFM A;  2ATL A;  2M0N A;  1ZQY A;  1UA0 A;  2KVC A;  3AN1 A;  5KG6 A;  1JAL A;  5HP4 A;  2KFZ A;  3QZ8 A;  2QAR A;  2R8K A;  3MAB A;  1S5L U;  2VKQ A;  4YR0 A;  4F5O A;  2XY5 A;  3KKA C;  1UPH A;  1ZQN A;  4NLB A;  3TAP A;  1M6Y A;  3B0Y A;  4K4I A;  4Z6E A;  9ICR A;  3EW9 A;  3UXN A;  2KSO B;  2Z7J A;  1N62 A;  3UMB A;  4NL9 A;  4DOA A;  5AM0 A;  4ED7 A;  5KFD A;  2PFP A;  3KD3 A;  4QIW C;  2E8P A;  4RPY A;  4IRK A;  2IA6 A;  4QWE A;  3C29 A;  1SZH A;  2QB0 A;  4DQS A;  4J9L A;  4KLG A;  2FLP A;  3SR6 A;  4TUR A;  1JXL A;  4MHV A;  5AI4 A;  4TUQ A;  5ALR A;  4J9R A;  9ICM A;  5L1M A;  4CDG A;  2JMG A;  4MEY A;  5J0W A;  4JK1 A;  2B21 A;  2LI6 A;  4UB3 A;  5DDY A;  3WU2 U;  4YMN A;  3BDP A;  3N7S C;  2Y9U A;  1JN3 A;  5HR7 A;  2EZZ A;  4RNM A;  3MR5 A;  3HWT A;  3KHG A;  5KL8 B;  7ICJ A;  2W3R A;  3QU2 A;  4CNQ A;  2ZIW B;  3ZD8 A;  8ICX A;  5J2F A;  1RZT A;  4KLM A;  2A1J B;  5ALS A;  4PHP A;  3TFR A;  3PY8 A;  3RJG A;  1Q46 A;  1X42 A;  4M6W A;  4P4P A;  4E0D A;  4PPX A;  4R65 A;  1ZET A;  4F5Q A;  3NUQ A;  9ICX A;  4PHD A;  8ICM A;  2BCU A;  2BQ3 A;  1N48 A;  2E1F A;  5J2C A;  2PFO A;  2IOH A;  3RR8 A;  4ECQ A;  3V7J A;  3LWL A;  5DG9 A;  3ED5 A;  3SV3 A;  8ICE A;  5J2E A;  4J03 A;  1UQV A;  2W3S A;  2Y1I A;  3IG8 A;  2JEJ A;  3TKA A;  4KLJ A;  2R18 A;  3ONN A;  1SL1 A;  4DF4 A;  2OYY A;  3PSI A;  4ED8 A;  5AI0 A;  1ZQA A;  7ICL A;  5CRX A;  4ED0 A;  4RQ1 A;  3AL0 B;  2BHN A;  1QSY A;  4M9N A;  4LZD A;  3BZK A;  5III A;  1SKS A;  1ZQT A;  5DG7 A;  2YML A;  4FZM A;  4QZG A;  5L1J A;  3GV7 B;  2XIC A;  1ZJN A;  1RQL A;  2G08 A;  5KG7 A;  2M9N A;  3N28 A;  4QZA A;  2YQE A;  2YMQ A;  4O9M A;  5L1L A;  5AI6 A;  5KL1 B;  2OHF A;  3L5K A;  4FZN A;  3WK5 A;  4YR2 A;  8ICG A;  4QZC A;  4KLU A;  5KFP A;  3OPX A;  3G6Y A;  2KD1 A;  5ALT A;  4GXI A;  3AEV A;  3RJJ A;  1ZQF A;  3WKC A;  4DFP A;  2HMX A;  4CF4 A;  2IMW P;  1K1Q A;  2DPI A;  1QLN A;  4IR1 A;  2YB1 A;  4TUS A;  5AI8 A;  2EZY A;  3KHR A;  5IIJ A;  2VAN A;  4YD2 A;  1T3N A;  4U6P A;  3M9M B;  1BVS A;  1V38 A;  1J2M A;  4C4R A;  4MEX A;  4YD1 A;  5J0O A;  7ICQ A;  2Y1J A;  3WKE A;  2C28 A;  3BS5 B;  2BQU A;  3C2K A;  2XC9 A;  5KG0 A;  3PNC A;  2D8C A;  2WAQ C;  5J0U A;  5T14 A;  4C4S A;  1J97 A;  2YX8 A;  2BDU A;  4I2J A;  4K4G A;  2P6R A;  9ICK A;  4B9M A;  2O6K A;  1SXE A;  2A19 A;  4Y2J A;  4IRD A;  5GTI U;  2ZTE A;  9ICH A;  2GOL A;  3SD7 A;  3RFA A;  3OGU A;  3M7D A;  2BQR A;  1KN5 A;  4EBE A;  1ZQI A;  3PV8 A;  4PGX A;  5AKK A;  2WHE A;  1X6I A;  3QU7 A;  3ISC A;  4F4Y A;  1KKX A;  4PZO A;  4RT3 A;  2PI5 A;  5J2A A;  2ZXH A;  4OJP A;  1BPY A;  2NYV A;  2ISO A;  3UMG A;  4UBB A;  8ICF A;  9ICT A;  3GII A;  1QTM A;  5DG8 A;  3RH5 A;  2LBO A;  5J29 A;  5JUM A;  3TAD C;  8ICJ A;  8ICW A;  3OSP A;  2EH9 A;  4QZD A;  4IQW A;  3H8M A;  4O5K A;  3E58 A;  2K8B B;  2XID A;  3I76 A;  5KFL A;  3GFK B;  3HKZ F;  5ALH A;  3BS5 A;  4Z6C A;  1NJX A;  1PZN A;  3RJI A;  1ZQV A;  1ZOL A;  2HHX A;  2KE7 A;  4FS2 A;  4RQ8 A;  3C1Z A;  5J2G A;  4NV0 A;  1K5O A;  3AMZ A;  3HJE A;  4B9N A;  1ZRM A;  4F5P A;  4RQ6 A;  2DF4 B;  8ICL A;  2ZIW A;  4Q43 A;  5DGA A;  5ALM A;  2A1J A;  4Y2U A;  3ICX A;  2YTU A;  4ECY A;  3NVW A;  3PW5 A;  5KG1 A;  3KZX A;  3RRG A;  1PK1 B;  2HOQ A;  2ES6 A;  3M8S A;  1XSN A;  1ZQE A;  4C80 A;  1NK0 A;  4DL7 A;  3EPI A;  4B9S A;  1IM4 A;  4Y2X A;  2JH7 A;  3IG5 A;  2ESE A;  3M6Z A;  3BJY A;  2BPG A;  9ICS A;  4BX9 C;  4F71 A;  5AK6 A;  1WWV A;  2HBM A;  1BPD A;  5BOL A;  4C8N A;  1NK9 A;  4EX7 A;  2V4Q A;  1Q3V A;  3CRX A;  3AU6 A;  3MGI A;  1S10 A;  3OHA A;  3FDS A;  1IXR A;  3I28 A;  5DDM A;  4F91 B;  4IQV A;  2F44 A;  4UB5 A;  4O0I A;  5HML A;  9ICG A;  3EWA A;  4I2A A;  2XO7 A;  4YCX A;  3EZ5 A;  4I2B A;  5HNK A;  2E8M A;  3LVV A;  2HDO A;  2KZ3 A;  4R63 A;  5KFT A;  3ETL A;  5J2H A;  3GZF A;  5AKG A;  1L7P A;  5DB9 A;  9ICA A;  1Y88 A;  2FPK A;  5KFB A;  1N5W A;  2AHO B;  2PI4 A;  3MC1 A;  3QUB A;  2ZXI A;  1T8E A;  2JHD A;  1NK5 A;  4KLQ A;  3V6J A;  2KJ5 A;  2K4H A;  1D8L A;  5DQG A;  2DL0 A;  4UAU A;  1DGS A;  4YVZ A;  3TAD A;  5AK5 A;  5KFU A;  3K75 D;  4XRH A;  4GXK A;  1ZQD A;  4OO1 J;  1X40 A;  5AK4 A;  2YN4 A;  3KTQ A;  3H8W A;  1LKY B;  2HHQ A;  4EEL A;  3WK4 A;  3BQT A;  4KN4 A;  2VA2 A;  2KP7 A;  4RUA A;  4DSF A;  4DEZ A;  5KFE A;  1F44 A;  3KOO A;  4DFM A;  5ALF A;  4F8R A;  5DKW A;  4RU9 A;  2UVU A;  2FMQ A;  2VJ4 A;  4WJ3 B;  2W7P A;  1TAM A;  3NRW A;  4RNO A;  3RRH A;  9ICP A;  4BXO A;  3VCB A;  1SZP A;  2LYB A;  1ZQM A;  4C8M A;  2GLE A;  1ZQ1 C;  3GIM A;  3HIL A;  3M1Y A;  3H0R B;  4G9B A;  1Z1B A;  3TFS A;  2K8C B;  1MN8 A;  2VJ5 A;  2I1Q A;  3G6V A;  3NAS A;  3Q8L A;  5CR0 A;  2DQN B;  5KFZ A;  4PZN A;  3HPO A;  1LB2 B;  1KSP A;  3SAF A;  1KL9 A;  3V7K A;  5AK3 A;  4UQG A;  4DOC A;  3AQE A;  2KFN A;  1QH9 A;  9ICC A;  2HOI A;  1KW4 A;  4LVS A;  2NRX A;  5C5J A;  2JZB B;  5AKE A;  4A8E A;  5KFQ A;  3M9O B;  3M8R A;  4CRX A;  2JEF A;  5AIB A;  4NLN A;  2KTQ A;  2W8L A;  5AKJ A;  5EE1 A;  4UAS A;  3RJF A;  3UXO A;  2KN7 A;  3CP8 A;  3FM9 A;  8ICZ A;  7ICS A;  1DGJ A;  1PK3 A;  2KJ9 A;  3QZ7 A;  3AQF A;  2JH1 A;  4F93 B;  2EAM A;  4J9O A;  1J2N A;  3H8S A;  4OJ6 A;  4KLO A;  5B66 U;  4XA5 A;  2CRX A;  4OJ5 A;  7ICU A;  1TK0 A;  3PVX A;  5J2J A;  4O3N A;  4I2E A;  4BXO B;  3CW2 C;  2VA3 A;  2F77 X;  2J6U A;  1L7O A;  1TAQ A;  2ZUB A;  3N4M B;  3SMV A;  2LM1 A;  3RR7 A;  2XVT A;  1PK1 A;  4YR3 A;  1KFS A;  3WKB A;  3TAR A;  1ZQK A;  4M9L A;  4NLC A;  5ALD A;  3C5F A;  3L3F X;  3N7P D;  3OJS A;  1Q8K A;  1ZQO A;  4UW9 A;  3RH4 A;  4ECR A;  5JU5 A;  4NM1 A;  3EYZ A;  5ALJ A;  2FDR A;  1L3U A;  3DDH A;  8ICS A;  1Q3U A;  4DL5 A;  2W11 A;  1ZQW A;  2ISP A;  4FO6 A;  2R8I A;  4B9U A;  4O3R A;  4J9Q A;  1NK4 A;  4O5E A;  3MBY A;  4QZB A;  2DWQ A;  1KEJ A;  3FAH A;  4EYI B;  2HBL A;  3KFU F;  2BCQ A;  2KHQ A;  1VLB A;  3IP4 B;  3WK9 A;  4OJL A;  2KV2 A;  5AKZ A;  3LYS A;  1SKR A;  1RDF A;  1A6S A;  2RRD A;  1X9X A;  3KBB A;  1L8O A;  7ICR A;  1ZQS A;  2DBY A;  4ECW A;  1MQ3 A;  2DKZ A;  2H3I A;  4DL4 A;  2KK0 A;  5J2B A;  1S0M A;  5J0R A;  3RBD A;  2IHN A;  3D2Q A;  3IDW A;  4UB4 A;  3UQ2 A;  2ASL A;  3SZ2 A;  3QE9 Y;  8ICB A;  4KLI A;  2WAQ F;  1D9F A;  3GIL A;  9ICN A;  5KG5 A;  1COO A;  3F5A A;  1FO4 A;  1NJZ A;  8ICI A;  4QIW F;  4BGD A;  5HHI A;  5EWE A;  7ICT A;  1Z4N A;  1A77 A;  2OCE A;  3T5K A;  2AQ0 A;  5KNI A;  2ZIU B;  1LKY A;  5KFH A;  1TK8 A;  2GO7 A;  4CGZ A;  1FEZ A;  4Q44 A;  2ZTD A;  2GH1 A;  7ICP A;  1ZQJ A;  4MF2 A;  4IQU A;  5KFY A;  1TVA A;  2H5X A;  3NVV A;  3MFI A;  3GU3 A;  1ZD3 A;  3PML A;  2YB4 A;  8ICT A;  3RB3 A;  5HHH A;  1SWV A;  4CF3 A;  4YFK A;  4F4Z A;  7ICK A;  1VJ5 A;  4YP3 A;  4DL3 A;  1L8L A;  1N63 A;  4QWC A;  4F5N A;  1SV4 A;  1X6J A;  4M9J A;  3Q8K A;  3V6K A;  4JV0 A;  1ECW A;  2IHM A;  7ICF A;  2PFN A;  5ALV A;  3F5E A;  1S0O A;  4RQM A;  1N56 A;  5KFF A;  3WK7 A;  3OJU A;  5K4L A;  1XO1 A;  1UCV A;  4ED2 A;  2V4R A;  4KMO B;  1MC8 A;  2QB1 A;  4C7Y A;  2JZB A;  2WFA A;  5DGB A;  1Z4O A;  1OW5 A;  4UB8 U;  3D2S A;  1VDV A;  4PGY A;  3GV5 B;  1CEZ A;  1NK8 A;  4I29 A;  2JR5 A;  1NNL A;  4NLG A;  5D4B A;  2NRV A;  2W9A A;  1IV8 A;  4RQN A;  4F50 A;  4ED3 A;  4GC7 A;  4ECT A;  2F1I A;  3F53 A;  2CPR A;  4USA A;  2LHT A;  1IG6 A;  4EEN A;  4HYK A;  4IQT A;  1PVR A;  2ODG A;  2BKE A;  2ALZ A;  4ED6 A;  3FC4 A;  1O08 A;  4XQ8 A;  9ICJ A;  3I1Y A;  2W9B B;  3QUT A;  2MRL A;  2AU0 A;  5KFG A;  7ICE A;  2W54 A;  1SB3 C;  4B9L A;  1HIW A;  5J8Y A;  2ZIV B;  2V9W A;  4RQ0 A;  3QUQ A;  5G5G A;  1T3Q A;  8ICU A;  4NLZ A;  1D8Y A;  3WK8 A;  1TAU A;  1JUD A;  1BPE A;  1JI7 A;  1NJY A;  1ZQQ A;  2WB1 C;  3F2C A;  4DSK A;  4UB1 A;  5JTI A;  1COK A;  4Z6F A;  3IN5 A;  3CYM A;  2ASJ A;  4XUS A;  4CE6 A;  3SI8 A;  1KQQ A;  4Y2Y A;  9ICU A;  4I27 A;  2BDP A;  2FJ6 A;  2PMZ C;  1URJ A;  1L3V A;  4JWM A;  1XNS A;  1WCL A;  3WK6 A;  2KKP A;  3SEN A;  3RF9 A;  2PXI A;  4US8 A;  2W03 A;  4JV2 A;  1HUO A;  4P4O A;  3BQ2 A;  4J9K A;  2ZJA A;  8ICN A;  5CJ7 A;  3PMN A;  4KLD A;  1D8B A;  3NRZ A;  1KFT A;  3QEA Z;  2W9M A;  1T94 A;  4NL9 C;  4MFA A;  2K89 A;  3HW8 A;  3TAQ A;  2K4I A;  3ZDD A;  3WKA A;  2K4E A;  1JX4 A;  4K4H A;  3N7R C;  1NOM A;  1WUD A;  2PFQ A;  2W9B A;  1S77 D;  2BCR A;  2XGP A;  3A0B U;  3RJE A;  5B5E U;  2H3F A;  4DO9 A;  4DS5 A;  4KIT B;  2IBK A;  2D3D A;  5ALP A;  4QZ8 A;  1AQ6 A;  4DOB A;  2KMD A;  2EQY A;  4QNL A;  2MSN A;  4Q45 A;  5F9L A;  5J2I A;  5J0Q A;  9ICQ A;  4YN4 A;  3PO5 A;  3OHB A;  1WG8 A;  4UAZ A;  2DFL A;  2FE9 A;  1XSP A;  5GTH U;  2HVH A;  3ISB A;  2P66 A;  1S0V A;  2XY6 A;  2EDU A;  3N97 B;  1Z1V A;  8ICR A;  3DV9 A;  7ICH A;  3MGH A;  3SEI A;  3PX4 A;  4KLT A;  5KT2 A;  2F1J A;  9ICI A;  3RAX A;  2D6F C;  3D2N A;  4Y2R A;  2KIV A;  1N61 A;  1UHU A;  2W9C A;  1DK2 A;  4X5V A;  3C1Y A;  3PR5 B;  3BQ0 A;  1NK7 A;  4DSL A;  3NTU A;  3HKZ C;  3MDC A;  3H4D A;  2G06 A;  1U4B A;  2AXT U;  4QZF A;  1B22 A;  2IOF A;  4P2H A;  1XWL A;  2FMP A;  5G5H A;  3BZC A;  8ICO A;  3SV4 A;  4FS1 A;  2FPL A;  2DUY A;  5IIO A;  3T5J A;  5DQI A;  5IIL A;  1TV9 A;  2LM4 A;  4PJ0 U;  1S0N A;  5CB1 A;  3R9K A;  1ZQH A;  1X66 A;  3H0M B;  3VC8 A;  2C22 A;  1BPZ A;  5ALL A;  3KKA A;  4ECV A;  5IIK A;  1SWW A;  3MFH A;  3V7L A;  3RH6 A;  3QYP A;  5KFX A;  1HJP A;  2EAN A;  5ALO A;  1BNP A;  5AM3 A;  1ZD2 P;  1SL2 A;  5ALG A;  4YXM A;  2HHT A;  1TFR A;  2OWO A;  5J0S A;  3AU2 A;  3QX7 A;  2YMP A;  2F1H A;  2P35 A;  3ETR A;  4TUP A;  2OM6 A;  5BOM A;  1PVP A;  2QLT A;  1Z3E B;  2B6G A;  3PX6 A;  4MFC A;  3KHL A;  4PGQ A;  4UAV A;  3ORY A;  4QJF B;  4KN7 A;  2E8N A;  3LVW A;  1XC9 A;  4PL1 A;  1RXV A;  4J9P A;  2BPC A;  5KT7 A;  4NWI A;  4EBD A;  3RB6 A;  1IIP A;  2ZUC A;  1NI3 A;  1SV0 A;  4C0Z A;  5KAF U;  4J9M A;  1QQ6 A;  4EZ6 A;  3H4B A;  1V97 A;  3JPT A;  1NJW A;  4F2S A;  2Q0Z X;  4NY8 A;  4KLS A;  1RM6 C;  3F2D A;  2C2E A;  1FFV A;  1KLN A;  5CP2 A;  4DFJ A;  5AKY A;  1ZQB A;  3ISD A;  3QXG A;  5DLF A;  4QZ9 A;  3EPG A;  4QW9 A;  3UQ0 A;  3GDX A;  3TQ1 A;  3Q8Q B;  2CXY A;  4FBU A;  4RT2 A;  4UB6 U;  4U7C A;  3BS7 A;  4R8U A;  2EAP A;  3J81 j;  4LJX A;  3E0F A;  4Y2T A;  2KIC A;  2G5I B;  2ZG6 A;  2HBJ A;  4AP9 A;  2KHV A;  3NGD A;  2R8H A;  2F3N A;  5KT6 A;  4UAW A;  4C8L A;  4EBC A;  5J2D A;  4DSI A;  3RB4 A;  2PMZ F;  4F72 A;  4FZL A;  2BCV A;  1RQN A;  2PKE A;  2KZZ A;  1QSL A;  7ICM A;  3MGV A;  2JGA A;  4QZE A;  3SAH A;  5ALN A;  2NRZ A;  1XS9 D;  1BGX T;  2VA8 A;  1JRO A;  1L5U A;  2AGO A;  5EWG A;  1S76 D;  5L1K A;  4B9V A;  4UAY A;  4F2R A;  3HT3 A;  4DCC A;  4TQR A;  3RJK A;  4KX5 A;  4YQW A;  1RPL A;  4ICA A;  1ZJM A;  3NS1 A;  1T4G A;  1N2X A;  1SIJ A;  5TIS U;  2HHW A;  3JPN A;  2FLL A;  3LDA A;  1NKC A;  4RQ5 A;  5F9N A;  1NZB A;  4P4M A;  2HHU A;  3THV A;  3JPO A;  4EEY A;  1KDH A;  2A3V A;  1TK5 A;  3B9J A;  9ICE A;  2N1R A;  4GLX A;  3JPR A;  4O3P A;  3EUB 2;  5ALY A;  1X9W A;  3ZDC A;  2Q4T A;  3ZDB A;  4KMU A;  3DEE A;  3PSF A;  8ICQ A;  1D9D A;  2KG5 A;  3GQC A;  2OXO A;  3BQ7 A;  3PW7 A;  2K4P A;  2WF9 A;  1RG6 A;  1V85 A;  4RPZ A;  2RHF A;  3UXP A;  4LZG A;  4QWA A;  3C2M A;  2JV3 A;  1SL0 A;  1NZP A;  3T79 A;  3PZP A;  4YMM A;  5EWF A;  1RXW A;  1B0X A;  7ICO A;  1X9M A;  2EAO A;  4JMU A;  2XI9 A;  3Q8R B;  2UVW A;  2FI1 A;  3GIK A;  1TE2 A;  3ZDE A;  4EYH B;  1KFD A;  1L3S A;  4OD0 A;  4Q8F A;  1MA7 A;  3JPQ A;  4NM2 A;  2UVV A;  1X2I A;  4UAR A;  5ALZ A;  1EXN A;  5FP0 A;  1UT8 A;  5KFV A;  2YY6 A;  1A76 A;  4BWJ A;  4G3I A;  1SGG A;  3UMC A;  2FMS A;  2F8K A;  5HR6 A;  5DBB A;  2Y0S C;  4I28 A;  4AYB C;  1H38 A;  3BQ1 A;  2I9G A;  2ZIV A;  3PW0 A;  5KFA A;  2H3Q A;  9ICO A;  2KJ8 A;  4KX3 A;  5AKI A;  3G6X A;  5EE3 A;  1UA1 A;  4GXJ A;  1SV0 C;  5DQH A;  2NV3 A;  2DKX A;  3CNH A;  2QKQ A;  4US9 A;  4BDP A;  4KTQ A;  2E3T A;  3ALR A;  5CWR A;  5DLG A;  1U9L A;  1RYR A;  4J9N A;  1WYG A;  3TAN A;  2ZIU A;  8ICC A;  2MAX A;  1ZYQ A;  2R8G A;  5L1I A;  2KVS A;  2B0C A;  3ZI4 A;  1PUZ A;  2FPM A;  1WCN A;  4IRC A;  5CHG A;  9ICV A;  3RBE A;  5KFC A;  3S6J A;  4M47 A;  4P0Q B;  4IS7 A;  7ICI A;  5TZV A;  3T5L A;  3RAQ A;  3L4P A;  3TI0 A;  2HBK A;  1L7M A;  3PX0 A;  1ZQR A;  2A1A A;  2IOF K;  5KFW A;  2XGQ A;  3QU4 A;  5D46 A;  4GIB A;  4FE3 A;  1U48 A;  4JUZ A;  2J6T A;  3C5G A;  5KG4 A;  2K60 A;  4NLK A;  5J0Y A;  1TKD A;  3B0X A;  4QZH A;  2L5Y A;  2Y0S F;  4AYB F;  2JRZ A;  1YT3 A;  4O3Q A;  2XCP A;  2HI0 A;  3PW2 A;  5HMM A;  2NRW A;  5J2K A;  2HCF A;  4DL2 A;  4NXZ A;  1MSW D;  1QSS A;  4R8U B;  4FFD A;  3H40 A;  4HAI A;  5ALI A;  5AM5 A;  4C8O A;  4DLE A;  7ICV A;  3OSN A;  5KT3 A;  2FLN A;  2J6S A;  4DLG A;  2WB1 F;  2QAR B;  3UPQ A;  1NKB A;  5AKL A;  1ZQL A;  4DQQ A;  4Y2Q A;  1V9P A;  5AKX A;  3Q8P B;  3MDA A;  4RNN A;  1X9S A;  5C0Y A;  2F76 X;  5L9X A;  3AM9 A;  4EX6 A;  2RP5 A;  2W9C B;  3M6K A;  3FYH A;  4ECS A;  1S9F A;  2AGP A;  1A0P A;  1S97 A;  5A0L A;  3A0H U;  1QQ7 A;  2K8A A;  3PST A;  5KFI A;  3MR2 A;  1B43 A;  8ICK A;  4BWM A;  3KZI U;  2MU2 A;  1L7N A;  4I2D A;  1OUQ A;  1K1S A;  4DF8 A;  3T5H A;  2NRT A;  5KG2 A;  2XY7 A;  4PL2 A;  1YZ7 A;  4O3O A;  5J0T A;  3IM1 A;  2F2A B;  5AM1 A;  2W8K A;  3OTQ A;  4DQR A;  1HUZ A;  1JMS A;  5ALE A;  2AH5 A;  4B9T A;  4F4W A;  4PHE A;  4MFF A;  2LYA A;  4TQS A;  3E2E A;  3H8J A;  3GIJ A;  5ALX A;  3LWM A;  2W04 A;  1SKW A;  4QWB A;  1CI4 A;  8ICP A;  3RB0 A;  4UAT A;  5H2F U;  5KAI U;  5KFN A;  4C7Z A;  1Z19 A;  4C4T A;  1RYU A;  4ZH4 A;  4F3O A;  2HW3 A;  4F5R A;  2GWS A;  5AIA A;  7ICG A;  1KBU A;  5CEH A;  1XSL A;  3T3F A;  1Z00 A;  5ALK A;  3RJH A;  2BGW A;  1WWU A;  2KNJ A;  2I6X A;  2LMR A;  8ICV A;  5KT5 A;  1ZQP A;  4M9H A;  4UB2 A;  4DFK A;  5KFJ A;  1ED1 A;  2AJQ A;  4R66 A;  4KLH A;  2W55 A;  2XCA A;  4F4X A;  2WF7 A;  4R64 A;  4EZ9 A;  9ICB A;  2YMM A;  1DOQ A;  3SAG A;  1QQ5 A;  3C21 A;  1C7Y A;  8ICH A;  3IHQ B;  4P0P B;  4YMO A;  2AQ4 A;  4OJO A;  4DWI A;  1L3T A;  2R8J A;  5DBC A;  4O5C A;  4RUC A;  3UM9 A;  2G07 A;  1SXD A;  3QEB Z;  1XO0 A;  1UT5 A;  2ZJ8 A;  4IL6 U;  5DB6 A;  2E8O A;  4UBC A;  1PVQ A;  3H7I A;  5DB7 A;  2DGZ A;  3K1Z A;  5AM2 A;  3C28 A;  5DBA A;  1P7D A;  5DB8 A;  4RQ4 A;  2Y9T A;  4C8K A;  2JEI A;  2KEY A;  1LVH A;  4PHA A;  5ALW A;  4CF5 A;  2E1E A;  1B4F A;  4M2Y A;  5BPC A;  8ICY A;  5EE0 A;  2P6U A;  4O3M A;  3MR6 A;  3AUO A;  4RPX A;  5KFO A;  2OEH A;  4ECX A;  1Z00 B;  3LK9 A;  2HSZ A;  2KSO A;  4IC9 A;  4Y2V A;  2ZJ5 A;  3NVY A;  3GV8 B;  2H3V A;  2MA1 A;  3ZD9 A;  2AGQ A;  1NKE A;  2HHS A;  1FIQ A;  3QU5 A;  4Z6D A;  5AI9 A;  1ZQC A;  4ECZ A;  3F2B A; 
#chains in the Genus database with same CATH homology
 1S0M A;  3NGD A;  5J0R A;  5J0O A;  2R8H A;  7ICQ A;  3RBD A;  5KT6 A;  2IHN A;  2Y1J A;  4UAW A;  1XU4 A;  4KLL A;  2C28 A;  4UB4 A;  4C8L A;  4YXJ A;  3UQ2 A;  2BQU A;  4EBC A;  5J2D A;  2ASL A;  3SZ2 A;  3QE9 Y;  3RB4 A;  4DSI A;  8ICB A;  3C2K A;  4KLI A;  2BCV A;  1D9F A;  2KZZ A;  2XC9 A;  5KG0 A;  3V72 A;  3PNC A;  3GIL A;  1MQ2 A;  3V6H A;  1QSL A;  7ICM A;  5J0U A;  9ICN A;  5KG5 A;  9ICL A;  4F4K A;  1COO A;  2HHV A;  4I2J A;  1ZQX A;  3SYZ A;  4K4G A;  5KFR A;  5KTQ A;  1NJZ A;  4QZE A;  2P6R A;  9ICK A;  4B9M A;  8ICA A;  3ZDA A;  2NRZ A;  4Q8E A;  4IRD A;  8ICI A;  1XS9 D;  2ZTE A;  1ARO P;  1BGX T;  2VA8 A;  4GC6 A;  9ICH A;  4BGD A;  5HHI A;  2WTF A;  5EWE A;  1L5U A;  2AGO A;  3OGU A;  2BQR A;  7ICT A;  5EWG A;  4EBE A;  1S76 D;  1A77 A;  1ZQI A;  5L1K A;  3PV8 A;  2BCS A;  4B9V A;  4PGX A;  4M9G A;  9ICF A;  3T5K A;  4UAY A;  2AQ0 A;  5KFH A;  4I2H A;  4F2R A;  3HT3 A;  4TQR A;  3RJK A;  9ICW A;  3ISC A;  1TK8 A;  4YQW A;  4F4Y A;  4Q44 A;  1RPL A;  1KRP A;  4RQ7 A;  2ZTD A;  3MR3 A;  4RT3 A;  2C2D A;  2PI5 A;  1ZQJ A;  7ICP A;  1ZJM A;  5J2A A;  2ISO A;  4MF2 A;  1BPY A;  1T4G A;  4IQU A;  4IR9 A;  4UBB A;  5KFY A;  3C2L A;  8ICF A;  1TVA A;  2HHW A;  3JPN A;  2FLL A;  2H5X A;  9ICT A;  3LDA A;  4ELV A;  1LV5 A;  3GII A;  5IIN A;  1NKC A;  1QTM A;  3MFI A;  5DG8 A;  4RQ5 A;  3RH5 A;  2HVI A;  1ZQZ A;  5KFK A;  5F9N A;  5J29 A;  5JUM A;  3PML A;  8ICJ A;  4P4M A;  2HHU A;  3THV A;  8ICW A;  3JPO A;  3OSP A;  4EEY A;  8ICT A;  1KDH A;  1KTQ A;  4QW8 A;  4QZD A;  1TK5 A;  4I2C A;  4M6W B;  3RB3 A;  4KLE A;  5HHH A;  9ICE A;  4GLX A;  4IQW A;  2LYH A;  3JPR A;  4O3P A;  4KLF A;  4O5K A;  1X9W A;  4YFK A;  4F4Z A;  3ZDC A;  7ICK A;  3ZDB A;  4YP3 A;  2MUT B;  5KFL A;  4F92 B;  4DL3 A;  4KMU A;  3GFK B;  5CA7 A;  4QWC A;  4F5N A;  8ICQ A;  4Z6C A;  4YG2 A;  1NJX A;  1D9D A;  1PZN A;  5D49 A;  4ELU A;  4M9J A;  3GQC A;  3Q8K A;  3RJI A;  4CCH A;  3PW7 A;  3V6K A;  1RYS A;  4JV0 A;  1ZQV A;  2IHM A;  2HHX A;  7ICF A;  4FS2 A;  2PFN A;  4RPZ A;  4RQ8 A;  3C1Z A;  2ASD A;  3M9N B;  1S0O A;  3UXP A;  4LZG A;  2BPF A;  4QWA A;  3C2M A;  1N56 A;  5J2G A;  5KFF A;  1SL0 A;  3OJU A;  1JXE A;  1XO1 A;  4DS4 A;  4B9N A;  9ICP A;  4F5P A;  4ED2 A;  2C2R A;  2V4R A;  4RQ6 A;  8ICL A;  4YMM A;  1MC8 A;  4Q43 A;  5EWF A;  1RXW A;  5DGA A;  5IIM A;  4MF8 A;  1JIH A;  1ZQG A;  4JWN A;  7ICO A;  1X9M A;  2A1J A;  2JZB A;  3Q8R B;  5DGB A;  2UVW A;  4DSE A;  3GIK A;  3ZDE A;  4EYH B;  4RZR A;  1KFD A;  4ECY A;  1L3S A;  4JV1 A;  3PW5 A;  5KG1 A;  4PGY A;  4I2I A;  3GV5 B;  4DL6 A;  5KT4 A;  4M04 A;  4Q8F A;  3PW4 A;  4ED1 A;  3RRG A;  1CEZ A;  3JPQ A;  4NM2 A;  4RQ2 A;  1NK8 A;  1X2I A;  2UVV A;  4I29 A;  4NLG A;  1EXN A;  4I2G A;  4I2F A;  5D4B A;  2ZUD A;  1T7P A;  2NRV A;  3M8S A;  1BPX A;  1UT8 A;  2W9A A;  4O3S A;  1XSN A;  2BR0 A;  1ZQE A;  1NK0 A;  5KFV A;  4F50 A;  4ED3 A;  4DL7 A;  4GC7 A;  3EPI A;  2UVR A;  4QZI A;  4ECT A;  4B9S A;  1IM4 A;  2F1I A;  4DQP A;  4J9S A;  1A76 A;  4BWJ A;  3JPP A;  2DPJ A;  4G3I A;  4QWD A;  2FMS A;  5DBB A;  4HYK A;  3JPS A;  5KG3 A;  3BJY A;  2KZM A;  4IQT A;  2BPG A;  4I28 A;  1NK6 A;  1H38 A;  3BQ1 A;  2I9G A;  9ICS A;  4DSJ A;  2BKE A;  2ALZ A;  3PW0 A;  5KFA A;  4ED6 A;  2RDI A;  2JEG A;  9ICO A;  1BPD A;  5BOL A;  4C8N A;  3G6X A;  5J0X A;  1UA1 A;  4GXJ A;  4DQI A;  1NK9 A;  5DQH A;  2V4Q A;  4XQ8 A;  9ICJ A;  2W9B B;  4M0A A;  3AU6 A;  2AU0 A;  3MGI A;  5KFG A;  1S10 A;  2MUT A;  7ICE A;  3C23 A;  4PH5 A;  3OHA A;  4BDP A;  4KTQ A;  3FDS A;  1IXR A;  5CWR A;  5DLG A;  4B9L A;  1U45 A;  1U9L A;  5DDM A;  2V9W A;  4F91 B;  4IQV A;  4RQ0 A;  1U47 A;  1RYR A;  4UB5 A;  4O0I A;  3RTV A;  1ZQU A;  4J9N A;  3Q8S B;  5HML A;  5EOZ A;  3TAN A;  3KHH A;  9ICG A;  3EWA A;  8ICU A;  4ECU A;  4I2A A;  2XO7 A;  4NLZ A;  3PO4 A;  1D8Y A;  8ICC A;  4YCX A;  3EZ5 A;  2MAX A;  1TAU A;  4I2B A;  1BPE A;  1ZYQ A;  1CUK A;  5HNK A;  3Q8M A;  1NJY A;  2R8G A;  5L1I A;  1ZQQ A;  1U49 A;  4DSK A;  7ICN A;  2KZ3 A;  4R63 A;  3PR4 A;  4UB1 A;  4ELT A;  5KFT A;  3ETL A;  5J2H A;  2FPM A;  1WCN A;  5J0P A;  4IRC A;  5CHG A;  5KFS A;  3HX0 A;  2ZTC A;  3HP6 A;  9ICV A;  5DB9 A;  4Z6F A;  5KFC A;  2RDJ A;  3RBE A;  2ASJ A;  4M47 A;  1Y88 A;  9ICA A;  4XUS A;  2FPK A;  3SI8 A;  5KFB A;  9ICU A;  7ICI A;  5TZV A;  3T5L A;  2PI4 A;  4RQ3 A;  3RAQ A;  4I27 A;  2BDP A;  3K4G A;  4FBT A;  3TI0 A;  3PX0 A;  1T8E A;  1BPB A;  1L3V A;  4JWM A;  5KFM A;  1ZQR A;  1WCL A;  2ATL A;  5KFW A;  1NK5 A;  2XGQ A;  5D46 A;  4KLQ A;  3V6J A;  1ZQY A;  2PXI A;  1D8L A;  4JV2 A;  5DQG A;  1U48 A;  1HUO A;  4P4O A;  3BQ2 A;  1DGS A;  1UA0 A;  4JUZ A;  2J6T A;  3C5G A;  2ZJA A;  5KG4 A;  4J9K A;  5KG6 A;  4YVZ A;  5HP4 A;  2KFZ A;  4NLK A;  5J0Y A;  1TKD A;  8ICN A;  5CJ7 A;  3B0X A;  4QZH A;  5KFU A;  3PMN A;  3QZ8 A;  4KLD A;  3K75 D;  2R8K A;  3MAB A;  4XRH A;  4O3Q A;  2XCP A;  4GXK A;  4YR0 A;  4F5O A;  2XY5 A;  3PW2 A;  3QEA Z;  2W9M A;  1ZQD A;  1ZQN A;  1KFT A;  5HMM A;  2NRW A;  5J2K A;  4MFA A;  3TAP A;  3HW8 A;  3B0Y A;  3TAQ A;  4K4I A;  4Z6E A;  4DL2 A;  9ICR A;  3KTQ A;  3H8W A;  3EW9 A;  3UXN A;  3ZDD A;  4NXZ A;  1MSW D;  2HHQ A;  1QSS A;  4R8U B;  1JX4 A;  4K4H A;  3BQT A;  3H40 A;  4KN4 A;  2VA2 A;  4DOA A;  1NOM A;  4C8O A;  4ED7 A;  4DLE A;  7ICV A;  2PFQ A;  2W9B A;  5KFD A;  5KT3 A;  3OSN A;  2PFP A;  4RUA A;  4DSF A;  1S77 D;  4DEZ A;  2BCR A;  2FLN A;  2XGP A;  5KFE A;  4RPY A;  2J6S A;  4DLG A;  3RJE A;  4IRK A;  2IA6 A;  4QWE A;  3UPQ A;  4DO9 A;  4DFM A;  4DS5 A;  4DQS A;  1NKB A;  4F8R A;  4J9L A;  4KLG A;  2FLP A;  4KIT B;  1ZQL A;  2IBK A;  4DQQ A;  4TUR A;  4QZ8 A;  4DOB A;  1JXL A;  4TUQ A;  5DKW A;  4Q45 A;  1V9P A;  5F9L A;  5J2I A;  5J0Q A;  3Q8P B;  3MDA A;  4RU9 A;  4RNN A;  1X9S A;  4YN4 A;  9ICQ A;  3PO5 A;  4J9R A;  3OHB A;  2UVU A;  2FMQ A;  9ICM A;  5L9X A;  4UAZ A;  4MEY A;  2DFL A;  1XSP A;  4RNO A;  3RRH A;  5J0W A;  2W9C B;  4BXO A;  2HVH A;  4JK1 A;  3FYH A;  2B21 A;  4ECS A;  1S9F A;  4UB3 A;  1SZP A;  2AGP A;  1ZQM A;  1S97 A;  4C8M A;  5DDY A;  3ISB A;  3GIM A;  2P66 A;  1S0V A;  2XY6 A;  3TFS A;  5KFI A;  2I1Q A;  4YMN A;  1B43 A;  3MR2 A;  3N97 B;  3BDP A;  8ICK A;  4BWM A;  3G6V A;  8ICR A;  7ICH A;  3MGH A;  3PX4 A;  3Q8L A;  4KLT A;  5KT2 A;  1JN3 A;  5CR0 A;  2F1J A;  9ICI A;  4I2D A;  3RAX A;  4RNM A;  5KFZ A;  1K1S A;  3HPO A;  3MR5 A;  3HWT A;  4DF8 A;  3T5H A;  1LB2 B;  2NRT A;  3KHG A;  5KG2 A;  1KSP A;  2XY7 A;  3V7K A;  4O3O A;  4UQG A;  7ICJ A;  5J0T A;  4DOC A;  2W9C A;  3IM1 A;  4X5V A;  2KFN A;  3ZD8 A;  9ICC A;  3C1Y A;  8ICX A;  5J2F A;  2W8K A;  1RZT A;  4LVS A;  4KLM A;  4DQR A;  5C5J A;  2NRX A;  1JMS A;  1HUZ A;  2A1J B;  2JZB B;  5KFQ A;  3PR5 B;  3M9O B;  3BQ0 A;  3M8R A;  1NK7 A;  4B9T A;  4DSL A;  4F4W A;  2JEF A;  4PHE A;  4MFF A;  3NTU A;  4PHP A;  4TQS A;  3E2E A;  3TFR A;  3MDC A;  3H4D A;  3H8J A;  1U4B A;  3GIJ A;  4NLN A;  2KTQ A;  4QZF A;  2W8L A;  1B22 A;  3RJF A;  3UXO A;  3PY8 A;  2KN7 A;  3RJG A;  3LWM A;  1XWL A;  2FMP A;  4P2H A;  8ICZ A;  8ICO A;  1SKW A;  3SV4 A;  7ICS A;  4FS1 A;  2FPL A;  4M6W A;  4P4P A;  4E0D A;  4PPX A;  5IIO A;  4R65 A;  4QWB A;  3T5J A;  5DQI A;  5IIL A;  1ZET A;  1TV9 A;  8ICP A;  3QZ7 A;  3RB0 A;  4F5Q A;  1S0N A;  9ICX A;  4PHD A;  8ICM A;  4F93 B;  2BCU A;  2BQ3 A;  5CB1 A;  5KFN A;  1N48 A;  1ZQH A;  4J9O A;  4ZH4 A;  3H8S A;  4F3O A;  2HW3 A;  5J2C A;  4F5R A;  2GWS A;  2PFO A;  4KLO A;  7ICG A;  4XA5 A;  7ICU A;  1BPZ A;  2C22 A;  1XSL A;  3RR8 A;  3T3F A;  1TK0 A;  1Z00 A;  4ECQ A;  3V7J A;  5IIK A;  4ECV A;  3MFH A;  3PVX A;  2BGW A;  3RJH A;  3V7L A;  3RH6 A;  5KFX A;  3LWL A;  1HJP A;  5J2J A;  5DG9 A;  4O3N A;  3SV3 A;  8ICE A;  8ICV A;  5J2E A;  5KT5 A;  1ZQP A;  4I2E A;  4BXO B;  4M9H A;  2VA3 A;  2J6U A;  4UB2 A;  1SL2 A;  1TAQ A;  4YXM A;  4DFK A;  2ZUB A;  5KFJ A;  2Y1I A;  3N4M B;  2JEJ A;  2HHT A;  1TFR A;  2OWO A;  2AJQ A;  5J0S A;  4KLJ A;  3AU2 A;  4R66 A;  3RR7 A;  4KLH A;  1SL1 A;  2XCA A;  4DF4 A;  4ED8 A;  4F4X A;  4R64 A;  1ZQA A;  4EZ9 A;  2F1H A;  9ICB A;  7ICL A;  4YR3 A;  1KFS A;  4ED0 A;  1DOQ A;  3TAR A;  1ZQK A;  4TUP A;  4M9L A;  3C21 A;  4RQ1 A;  1C7Y A;  2BHN A;  3IHQ B;  5BOM A;  1QSY A;  4M9N A;  8ICH A;  3C5F A;  4LZD A;  4YMO A;  1Z3E B;  3PX6 A;  4MFC A;  5III A;  2AQ4 A;  1SKS A;  3OJS A;  1ZQT A;  5DG7 A;  4QZG A;  3KHL A;  5L1J A;  3GV7 B;  4PGQ A;  1ZQO A;  4DWI A;  3ORY A;  3RH4 A;  1L3T A;  4ECR A;  4NM1 A;  2R8J A;  4KN7 A;  5DBC A;  3EYZ A;  1ZJN A;  4O5C A;  1L3U A;  5KG7 A;  2M9N A;  4QZA A;  4RUC A;  1XC9 A;  3QEB Z;  4O9M A;  8ICS A;  4DL5 A;  5L1L A;  1UT5 A;  1ZQW A;  2ZJ8 A;  2ISP A;  1RXV A;  4FO6 A;  5DB6 A;  2BPC A;  4UBC A;  3H7I A;  5KT7 A;  2R8I A;  5DB7 A;  4J9Q A;  4J9P A;  4YD1 A;  4YR2 A;  4B9U A;  4O3R A;  4EBD A;  3RB6 A;  8ICG A;  2ZUC A;  4J9M A;  1NK4 A;  4O5E A;  3MBY A;  4QZB A;  4QZC A;  1KEJ A;  4EZ6 A;  3H4B A;  4EYI B;  4KLU A;  5KFP A;  2BCQ A;  5DBA A;  3JPT A;  3G6Y A;  5DB8 A;  1NJW A;  4F2S A;  2Q0Z X;  4RQ4 A;  4NY8 A;  4GXI A;  4KLS A;  3RJJ A;  4C8K A;  2C2E A;  1ZQF A;  2JEI A;  1KLN A;  5CP2 A;  4PHA A;  4DFP A;  4DFJ A;  1ZQB A;  3ISD A;  2IMW P;  1K1Q A;  2DPI A;  4M2Y A;  5DLF A;  4QZ9 A;  1QLN A;  5BPC A;  3EPG A;  8ICY A;  4QW9 A;  1SKR A;  3UQ0 A;  3GDX A;  4IR1 A;  3TQ1 A;  3Q8Q B;  2P6U A;  4TUS A;  3MR6 A;  3AUO A;  4RPX A;  5KFO A;  4FBU A;  4RT2 A;  4ECX A;  1Z00 B;  3LK9 A;  3KHR A;  5IIJ A;  7ICR A;  2VAN A;  1ZQS A;  2ZJ5 A;  4R8U A;  4YD2 A;  3GV8 B;  1T3N A;  4ECW A;  1ZQC A;  3ZD9 A;  1MQ3 A;  2AGQ A;  3M9M B;  1NKE A;  1BVS A;  2HHS A;  4Z6D A;  4DL4 A;  4ECZ A;  4MEX A;  5J2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...